3ILLA

Crystal structure of e. coli hppk(d97a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLAIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3illA00
3HSJA 3HT0A 3MCMA 5ETRA 1TMMA 1Q0NA 4M5NA 1RAOA 1RTZA 5ETPA 5ETMA 3ILLA 2F65A 4CYUB 5ETKA 1TMJA 2QX0A 3HD2A 3QBCA 3ILOA 1EQMA 5ETSA 3UD5A 4CRJA 1F9HA 4M5HA 3KUGA 1EQ0A 3IP0A 3KUHA 4M5IA 4F7VA 4AD6A 1EX8A 3UDVA 3HSZA 3HSGA 2CG8A 5ETQA 1DY3A 1RB0A 2F63A 2BMBA 1G4CA 4M5JA 4M5GA 5ETVA 4M5KA 4CYUA 3ILJA 5ETOA 3UDEA 3MCOA 4M5MA 4PZVA 3ILIA 3KUEA 1RU2A 1CBKA 3MCNA 1KBRA 5ETLA 5ETNA 1RU1A 1HQ2A 5ETTA 3HSDA 3HCXA 4CWBA 4M5LA 3HD1A 1HKAA 1IM6A
chains in the Genus database with same CATH superfamily
2MZJA 5F0WA 1QVFR 3BDEA 1KKHA 1FCAA 2AHOB 1I3OB 3CVKA 4OZ3A 3ZZPA 2HHTA 3QRPA 2KRBA 3I5BA 3NG8A 1SC3B 2HHHJ 2GAHC 2KTQA 3MM5B 4NCGA 4J9NA 4R0EA 2AV5A 5IZHA 5AE2A 3OUYB 1PO6A 5HI7A 2MY7A 2DIUA 1KHWA 4LRAA 3NXZA 3QZ8A 5DZ6A 3K2YA 2LA6A 4DV2F 1UJ4A 2JFDA 4CO4A 4DF4A 4DV3J 4DN0A 1HNZJ 4C8LA 1QDUB 4LIWA 3LF0A 2WCXA 2DHXA 2ZJQQ 3PYFA 3HVTA 1N56A 2B7CB 1RAJA 2WBMA 4HL9A 1Q7YT 2OPSA 2P8IA 2W2NP 3DGPB 2YWEA 2CPDA 2ADBA 3R7SB 2WW8A 2UUTA 3IAM9 4PWUA 2CNNB 3UPFA 4KHMA 2XLJA 2IM1A 2B5JA 4JI0F 2JZ5A 2Q3PA 2R8IA 1ULRA 1YHQS 1N6QB 2LU2A 4CCHA 5EN1A 4RW6B 2CZ9A 3DLGA 1GXLA 4LFBJ 1KQKA 2MY8A 5EWGA 4RUCA 2K7KA 2ZWPA 2QN6B 1R8PA 2N7CA 1C0TB 5HAOA 1IM6A 4LF7F 3ENVA 1U26A 3HHKA 3EGWB 1UA0A 4DV6J 3DLKA 5L1KA 1KWMA 1S79A 1IJEB 5GAEU 1HARA 3IC1A 1VC6A 4ZA1A 3PZPA 1KLMA 1WHVA 1AXQA 5BR8F 1QE1B 4I2PA 5C25A 1D9FA 2JEJA 2XQCA 3QLHB 2WZ1A 1C4CA 4X66F 1X0FA 3GE9A 3O2IA 1KTVA 3CJKB 3F56A 4KFBB 3P96A 3P5TL 4DFKA 2ZE2A 2EKYA 5H9EJ 1MWZA 1EARA 4ZVUB 2Z8QA 2XS7A 5CYQB 1SXLA 2JX2A 4KSEB 5KFGA 1KBRA 4U96A 4QWDA 3F41A 1LKZA 2JC1A 4OZ1A 1QJHA 2UVRA 1HMVB 1U1RA 2J9DE 5A8RA 2MB0B 4Y2AA 5LXRA 1U45A 1SQFA 4IYQA 4KH1B 1W25A 2WVDA 4OQJA 1SC4B 4PG5A 5B0FA 1K47A 2VIHA 5G4DA 1HQEA 3W60A 4NXNJ 1N36J 3NCPA 2O66A 4C11A 2UXBJ 3UFCX 1ZAWA 3WIVA 4ZITA 3HFZB 4XPEA 1RISA 4GVLA 4QIVA 4RBTA 2LEBA 2AYBA 2Y8WA 4WXWA 1F3FA 3MR2A 3AH6A 3TVZA 2BJ9A 4J9SA 3CMES 2O67A 3LP0B 4XDDA 4K7QA 3CB4A 2DNGA 3SXLA 1X5TA 2LEAA 5I3QA 2ASDA 4NL5A 4CLKA 1Q81T 1IKWA 3R6GB 5DDPC 2Q66A 3ULHA 2BVZA 3CCJS 3M8SA 3HHNB 2HFNA 3AA9A 2HGLA 2WONA 5HVGA 5CD4A 2FTRA 3BDPA 3OSPA 4OJ3A 2C1EB 4K4UA 2CDQA 2KI2A 1BE4A 4LIRA 4YDDB 1YRUA 4PABA 2DBBA 2NQPA 5HMWA 3HD1A 4R8UB 1UL3A 3M6WA 3CC2S 1SKSA 1C0UA 2BE2B 4WJBA 2FHJD 1NXIA 2KKHA 4C97A 4BLGA 2BM0A 5DO2A 5KFBA 2VQEF 1SJ1A 3C2PA 1X5PA 3CCVS 2CPJA 3UVJB 3E51A 3KTQA 4BWMA 4ED2A 4C48A 2R2UA 5HQ8A 3OTCA 2L41A 2E5LF 3PFEA 4ED6A 5CAAA 2OH2A 1YK9A 5G0RB 1W2BR 3PKMA 3R5DA 2LECA 3T6JA 5CZVA 3THTA 4LF1A 3OJUA 4DV5F 4DV1J 4M5GA 2I5JB 4WK3A 1R0CB 1RHUB 1S6UA 2B9YA 2J5AA 3MMBA 2W24A 5ETTA 3CMQA 4OYOA 2FJAB 1TV6A 3RBEA 3M2RB 1CJKA 2OAUA 1FO1A 1NM2A 1Y00A 3DDIA 1BXNA 2B6AA 4JV5F 3SBMA 1SCJB 2DH9A 1FDNA 1OYEA 2Q1LA 2CNOB 3MMAA 1DQ9A 1J5OB 5HO4A 2HGNA 3H2LA 4QQBA 4CLFA 1DTTB 4F8RA 2NXUA 4IQMA 2XO7A 2F8MA 2BKNA 4WIIA 2ZOMA 1NK9A 2FYXA 1XNQJ 1LNQA 4Y2KA 2PA8D 1NHVA 5U47A 3DLHA 1ZZNA 2CNLB 4A46A 1KP6A 4X65F 4J9VA 3JYTB 3M9OB 2Z0GA 1M0SA 4ER8A 4F7VA 1NZ8A 5ETPA 1TU0B 1FWKA 4OYXA 5LM7E 3ZZYA 2JC0A 1VK3A 1P1LA 2UUBJ 3QWUA 3C15A 2HQ3A 1KQSR 1ZETA 3CO0P 4LT6A 1MMNA 1WC5A 2AX0A 2CZ4A 3HVAA 3QGIA 2ASLA 3IFEA 2KN4A 5L46A 4YOEA 4XDCA 1WF0A 4HEA9 2ROEA 4UZBA 1XR7A 2BOAA 2V6AA 2JLFA 4D3HA 4UQGA 3AA8A 3R5GA 1HQUA 4KB7A 4USMA 2W2QP 4B3SF 3BSAA 1FKPB 2J7KA 3MFHA 3PO5A 4K5SA 4ZVEA 3NNAA 2QLBB 1T3OA 2UVVA 4B3TJ 1R0AB 2ZH3A 4TLQA 1M5PC 2MQMA 3DRSA 5L1IA 3TNVA 4F3QA 3H7HB 3UD4P 4RR5A 2XB2D 4CT9A 1U1QA 1KSPA 4I56A 3FMWA 1MNEA 2PT0A 2Z57B 4TY8B 2DEIA 1VQOS 1SJRA 1NJZA 3AJ2A 4DL0C 3CIMA 5KFMA 4RBUA 1C4AA 4C0OC 5JJBA 2PGCA 2F4FA 4NYOA 3A3NB 3OUYA 2GGPB 3FZ2A 3NEKA 1F1BB 5HSPA 5HLFB 1NK7A 1YRXA 1Q79A 2HHQA 5SUHA 1S97A 3AAWB 2BDPA 4WFAQ 3ENAA 3CC7S 3DYAA 4CO1A 3A8IA 2PI5A 4FPRA 2AD9A 4A8SA 4HDHA 2ZFHA 2R7SA 4EO8A 1XWLA 8AT1B 4C0HA 3W63A 2M9KA 2VG6B 1ZA2B 5FLXU 1S4FA 1K0TA 2C3OA 1N6QA 2WB4A 2ZUGA 3IRXA 5ITHA 1WKJA 3N6MA 3DXSX 3BYPA 3KUGA 1FFWB 4LREA 3AD7C 4RW6A 1IBLF 4QR0A 4NOHA 1HW8A 1RCXB 1VRUA 5KG5A 1S0MA 4I67A 3BKUA 2IJRA 1C0TA 3I9V9 2RUGA 3W1YC 2M88A 1EETA 1AFJA 2OPQB 4F4WA 3FZBA 5ETVA 1S6QB 1LWXA 2RSQA 2VF3A 3MPDA 3M8ZA 1LFWA 1LOUA 3MEGB 4G1IA 1Q8BA 3BB5A 4P74A 1VDHA 1Y3KA 3BSOA 4ZPTR 1QE1A 1UP1A 1TZ0A 1KD1T 3GJRB 4J7CA 3A12A 3MECA 3SQGB 3LALA 4Q45A 3W9HA 2RJZA 3D6FB 4O3SA 3DC2A 5EWEA 2AX1A 1JX4A 2CPHA 2KB2A 3BZQA 5CYQA 2ATLA 4B9TA 1Q0NA 1AW0A 1S77D 4FNHA 2IM3A 4OX9F 1YZ6A 3UNYA 2KJWA 4A8KA 5K5MA 2MSSA 5HBMA 4MT1A 3QSIA 2L48A 1KVJA 3MTJA 5DGBA 4ILLA 4KGXB 3OL9A 4NLDA 2GVDB 3WIUA 1FJGJ 1ZBTA 4EI2A 2MKJA 5IM0A 4WIQA 4OI0A 3LPEA 3I87A 1KONA 4MK8A 4UTGA 3OW2R 1F9EB 3ILIA 5B0DA 1HYSB 2RRAA 4ETXA 2BKOA 4EYIB 1YJ7A 4K0KF 2CJ9A 1VBZA 5AJ3F 1D3WA 1FESA 1T8EA 2KM8B 3WDOA 2M2BA 1FK9A 4ZLLA 2I0XA 4QBUA 2UXDJ 2ZD1B 2XZWA 2QE5A 3T1HJ 1JJ4A 3L3CA 2UUAF 3MCNA 4N8OA 1UZHA 2HWIA 4RUBA 1UJ5A 3I82A 2CPIA 1S9EB 1T9WA 3IWLA 2E5IA 2MKHA 1JNZB 3TUPA 1HD0A 3OLAA 3G6ES 1Z4UA 1CBKA 4AXJA 3PRDA 3GFHA 4IRDA 2AIRB 5D6GA 2DGVA 4L74A 1UVJA 4OHYA 4DPWA 3DFEA 1Y0HA 2RMLA 2X1BA 5HROA 4X84A 2FJVA 2LDIA 2KH9A 4EEYA 4J37A 1RWPB 1DTQB 3I4PA 3CMAS 3RBZA 2RU9A 2EWHA 2WRMA 3VALA 2CJKA 4HI1A 4A8QA 2ERRA 1S4EA 3J80U 2LLZA 2IYIA 2Q6CA 2HBZB 2BE7D 4ZP8A 4ZVOB 3UVJA 1JXEA 3BS9A 1UMJA 3KG4A 4YDXA 2EFQA 2DGTA 5GAEI 2A0FB 3DOLB 3I4HX 3SCIE 1S9FA 1TELA 4CO5A 2VICA 2FHKA 3AY0A 2DKOB 4DQQA 5G0RA 1VBKA 3VGVA 2MHNA 3MGJA 1S6PB 1N33F 1U4BA 5CZXA 1PJ6A 3T9ZA 2HHSA 3MEEB 4JI2J 2YX1A 2G0JA 1VCTA 4J9MA 2D69A 1GXUA 3C6UB 3OXFA 4IKAA 2F40A 4Z7CA 4X4UA 3M2RA 1SV5B 4KC5A 2JHEA 1R3NA 4B3RF 1FRXA 1RE1B 1XMBA 3ZZTA 1HR0F 1DLOB 4FS2A 1OY8A 2R2TA 4DF8A 3IR6B 4HTIA 2B7BB 2DD8S 5GAHU 1H0HB 2B51A 4QWBA 4NXMJ 2HQFA 1S1UB 4X4TA 2G9OA 4JI7J 4XTTA 5DG9A 4B08A 4JI1F 4O3RA 4DCOB 3I9ZA 2YKNB 1IJFB 3PEJA 1PIEA 5KFSA 4DQSA 1L3SA 1HQ2A 1AUDA 3DMJB 2H5EA 2AGOA 3JYTA 2HAFA 3D3CJ 3H98A 2YWKA 2FC8A 1CQMA 2CZVC 1TFWA 3TARA 4DX8H 3MDFA 4A8YA 3FSYA 2ZM6F 3QIDA 4KKOA 1YLXA 3O3LA 1GNKA 1RWWB 1Q16B 2XLKA 2CJXB 2WW4A 1XMOJ 3R8YA 4OYBA 4WKRA 4WTOB 1EKSA 5E0OA 2PEBA 3M05A 3M30B 3SI8A 4JUZA 2MZQA 1IKVB 3ENQA 5E7OB 4GRSA 1L3KA 1U47A 3BM7A 2RDJA 1RT1B 5CQGA 3SDEB 1LK5A 2QLWA 1Q53A 4ATNA 4IFVB 4RLEA 3KJVB 3MCSA 2BJDA 4C8NA 2OI2A 2GNKA 3DRYA 2YNGB 1YBTA 4NLGA 4LRDA 3QT6A 3H90A 2VZ9A 3EZUA 4LF9J 5DQGA 3X1LB 5CYJA 3CJ5A 4ZVTB 3OVBA 1MU2A 5BYQA 2AW0A 4DV7J 1R0AA 5H9EK 2BQ3A 3BGOP 4JV0A 3R1HA 3ILLA 4ZJOA 4DSIA 5HP1B 1N34F 2MJUA 4P2SA 4TY8A 1T9TA 4OIXA 2ZHAA 3NOCA 5IWAF 4LF2A 2DNLA 2RF2B 1NK5A 2GGPA 4AFFA 2YWFA 3HSGA 4JI5F 2AZ1A 2LQJA 1GAOA 1QAJA 4ZDNA 5LMNJ 3SCJE 3M2UB 2DNYA 2KZZA 3H42A 1M90T 3F44A 1XMQJ 3PDNA 2YPZA 3W9JA 1T11A 3QGGA 2ZC3A 1LEOA 3PFOA 1APSA 2F9DA 2MMYA 2XEXA 3V6JA 1U1LA 4ZPVR 4FKXA 1DRZA 2GX8A 4WKYA 1VOMA 1HW9A 4IO9Q 2NPFA 5KFTA 4WYLA 4OHWA 4IOCQ 3N01A 2GHVC 1X4CA 4YB6A 2DY9A 2VA2A 4LSNA 4TY9A 3KWMA 1X9SA 3GR1A 2MQ8A 1WHWA 4KR0B 3KHRA 4PG8A 1U25A 3M6XA 2VBYA 4NA2A 5KG7A 4QWEA 5KG3A 2OPQA 3CD0A 1S6QA 4NYPA 3RB3A 4OX6A 4DDFA 5DG8A 4JI3J 1Q7LB 3MEGA 3BBCA 3GSIA 2F3JA 2Z2YB 1ZM9A 2V0NA 2ZKTA 4MMOA 2XY5A 2QSFA 3MPWA 2FPHX 2GHPA 3PJ9A 1SBRA 4DQRA 3AD9C 4CO2A 3W5ZA 3SQGA 3ILJA 4PG4A 4WF9Q 4ICLA 3MCMA 2YH0A 4ED0A 1N5QA 4CO3A 5K8PA 4URQU 3P3DA 4RL1A 3BH6B 1D9AA 2Z2MA 3RW7A 2M52A 3R5BA 2PD1A 3KDOA 1H73A 1IXKA 3FQKA 3HHLB 1XJWB 4NLRA 1H74A 5LJ5Y 1QD1A 3B4MA 3C16B 2D3ZA 5KG6A 3QJPA 4GKJJ 4I69A 1RP5A 1KEKA 2IBKA 3QIPB 2GVDA 4QZVB 4M5LA 3AD8C 2JWNA 2CPZA 5JVHQ 1UWAA 1CJTB 2ALYB 3HD2A 2FZCB 4IH6A 5KFHA 5A2QY 3OVAA 1HHSA 2HFOA 3QFHA 3W64A 3I0RB 1OPZA 2ZD1A 1R27B 5B7WA 5KFLA 3M6VA 4NMLA 2NZCA 2W7PA 4ZKAA 3QYYA 4J5OA 2DVIA 4MKVA 1TUGB 1RHJB 3PIOQ 1FDAA 3W3SA 4AE5A 1UJ6A 1PCAA 1U2FA 3MMCA 4Q8EA 3SV3A 2NUHA 4M5HA 4JOUA 3MEKA 2VL1A 3QATA 1YDLA 1XQIA 3ZO7A 2AEJA 3RAXA 2CXEA 2CVIA 1QLNA 1OWXA 5DGAA 2B3TB 4NLVA 1DTQA 2CQGA 5KFDA 2YKQA 4DUYJ 3VCDA 4USWA 2C2EA 2BEFA 3EGNA 4RO0A 1Z1ZA 1YI2S 3VQTA 1VRTA 4C9DA 2OPPA 1S1VB 2J0QD 5F9NA 2XMWA 3LP2B 1OMSA 3L7UA 4L75A 3PR5B 2AQ4A 2D9OA 1SKUB 1YJ9S 1WELA 4PEOA 4M95A 1WF1A 5CH7B 1FJEB 1UCNA 4RW8B 3G6YA 1KHVA 4H4MB 1TFYA 4RNMA 4C3KA 4X62J 2WVEA 3HMJG 2EKNA 5EGYA 3OSNA 3DOLA 2QFIA 4B02A 3CJRA 3KLIB 1U2CA 2VFSA 3EICA 4DPXA 4CT8A 4FYWB 1YVFA 1VC0A 4AQYJ 1SJ3P 4I4BA 1X5SA 3MR3A 2XSFA 1S6PA 3MR5A 4WU2A 1RA7A 1TKXA 2DXFA 1VQLS 1MW7A 2CQCA 5CA5A 3H59A 3C6UA 1X4FA 4N8NA 1SV5A 3LAKA 4DR6J 4AL6A 3DDKA 4RKUC 1FRMA 2HVHA 2FLLA 1SQGA 5D4PA 3T5HA 4CI0B 4DLGA 3NBPB 4ED1A 3C14A 3VAFA 4FXWA 4AT1B 2XYHB 2HVIA 3M8PA 3HULA 1S1UA 3W65A 2G4BA 4RUHA 1WC4A 2P9CA 2MLXA 2IYGA 4J90A 2N3LA 5BYSA 2HHXA 4JI4F 5C7PA 4IQXA 4DSLA 1AZSB 2DRAA 2MLZA 1FDDA 4B9NA 2MZTA 2GFFA 2IVMA 2LQBA 2E44A 3GYNA 5SZTA 4N76A 1UVNA 1T02A 1YQHA 3UI3A 2P6SA 2QTWA 3TAMB 1Z2LA 1CJVB 1GMVA 2RILA 1BC6A 1F5AA 3M30A 5CABA 1PJ5A 3K89A 1IKVA 4DV2J 3FSXA 1RT1A 1JIHA 5A8WB 3Q8QB 2XMVA 3CWJA 2KT5A 3GP9A 4OHVA 4IFVA 4ZIVA 2IMWP 1QAXA 4RW9B 2YNGA 2EPIA 3DGVA 1TK0A 2G1HA 3PVXA 2D9PA 4ANEA 3M32B 1RWMB 1WI6A 3W9IA 3G82B 1Q82T 3M2VB 2CRLA 4ES2A 3OXGA 3HCXA 4JI0J 2DISA 1Y11A 2BACA 4OHXA 2ZOFA 4DL3A 1JLAA 3HHLC 5A0YB 4LR8A 1NCLA 1K1SA 4YFUA 2Y3YA 4WZMA 1RT4B 5HP1A 5KT5A 3G8QA 3B8HA 2CQDA 2AJQA 4CTAB 1Q4RA 1BMQB 5LJ3Y 2FUG9 2BBEA 4ILRA 2CPXA 4LF7J 3KK3A 5KFYA 1RABB 4UOGA 2NXNA 6AT1B 2ZKUA 1J5EF 1L3TA 2DNHA 4UQTA 2ZBPA 1NPRA 2BQUA 1MMDA 3H2VE 1NMEB 2NXCA 3HJVA 2OEJA 5DLFA 2DITA 2LU1A 5BR8J 1BGXT 2MGZB 5GAGU 3D1QA 3Q8RB 3KG0A 3PW7A 4Z37A 4Y2MA 4MKBA 4WFYA 3GCXP 4X66J 2KG1A 3G6VA 2Z30B 2B4PA 1IN0A 1ZPVA 4LF5F 2NPIA 1RBOB 2HIQA 3UNGC 5GAHI 1HPZB 2K1RB 3PXGa 3V81B 2IY5B 3N79A 3ELHA 1NDPA 3BQ0A 2PC6A 2OEKA 4PZVA 4JB8B 1EIYB 5A6WA 5DS7A 2Z2ZA 4U95A 2YX7A 1IR0A 1WG1A 1F0XA 4XO0A 1Q5VA 4AYBD 4KPYA 2DTJA 3OV7A 4USTA 1N0UA 2QT7A 4ZIWA 2YNHB 1KNZA 3OBIA 4C8YA 3NCQA 1N32F 3FJ2A 4G65A 3MM9B 4OV6A 4DR2F 1EB0A 3NKYA 3L4BC 2LP4A 2F7VA 5F8JA 2XY6A 2DO0A 4DX5A 4ZP9A 1BLUA 1VMBA 4EWTA 2C3MA 2QEXS 3CJ8A 3M8YA 3PRBA 2RB7A 3CO9A 4HLBA 3NGRA 3WC2A 1NJYA 4U7UK 3RB6A 4RU2A 4YY3F 3PJWA 1B0TA 1M1HA 1U48A 4DPYA 3AT1B 3EXCX 1U0HA 2Y1JA 4OI2A 3E01B 2QL5B 3OFFA 4K8RA 2HLTA 3CDBA 1CC7A 3TVYA 2XY7A 2I1RA 1NPKA 2ZH7A 2VUGA 3ITHB 3TX8A 4Q0BA 2MTLA 3QIPA 3OQ2A 3DI6A 1PJ7A 2V69A 1CJTA 1RT7B 2AP6A 4ZN3A 1KVIA 2QMUB 3UDCA 3I0RA 2KHCA 1FKOB 1VS3A 2VQEJ 3G6XA 2X51A 2Y0SD 3KXDA 1HWUA 1LXJA 2E5LJ 5EHHA 2HWHA 4CP5A 4KT0C 3Q83A 3AOAA 3FCVA 2BX6A 5D78A 2Q43A 2XCPA 2MJNA 1KC8T 1VQ8S 2GJIA 1SB6A 5B0CA 4DV5J 5F41A 3DDNA 2XWYA 1RTIB 3FSIA 2KYXA 4TYBA 2MYFA 4ZLNA 2W9CB 2XMTA 1VLYA 2V8GA 1HKAA 2ZZNA 2C3UA 3ZZZA 5L1LA 3FQLA 1KR4A 1UPPA 4BHQA 1S1VA 5J2PB 1PC4A 4JV5J 4KGVB 3LP2A 1K0VA 5B08A 1XBWA 5K8OA 1SUQB 3GG1A 3P6YC 4F50A 4RW8A 4LFAF 1ZA1B 4FP9A 4H4MA 3ICLA 4ZJQA 3M4XA 3G4SS 2RQMA 3M8QB 4UT4A 4RU9A 4OJ1A 3IG1B 4J9RA 7FDRA 2KDOA 4X65J 1NDCA 3I55S 2DH7A 3NY0A 2IA6A 2FQQB 2QC3A 4N7TA 3O6QA 4K2XA 3KFWX 2WOMB 1F6TA 2BJ3A 3R5CA 3KLFB 2W4CA 1HNIB 5E33A 1RU1A 3DRXA 1H6KX 5CYMB 4F4XA 2DCLA 3PACA 3W2VB 1GK8A 5H1SV 3HJFA 2DR6A 4IDKB 4RW7B 1VK8A 1VJQA 2HNZB 2WB1D 4CNYA 2BW7A 2R8HA 4FYXB 2VH7A 3L7OA 1B7FA 3J7AN 1JLBB 2BR0A 4A8OA 5K8MA 1S48A 4ZOSA 2M7SA 1IKXB 2AU0A 2O01C 4LVOP 3ZNUA 2JEFA 1UW4A 2QA4S 4PRFA 3NBPA 4O3QA 3OFGA 3PNIA 1G1XA 2CYYA 5J2MB 3WZ0A 1XK8A 2XZDB 4IOBA 3JSYA 3O8WA 1S9GB 2CQHA 4OMFG 3KYLA 2LXFA 4PXEA 5DLGA 2OTJS 3GFYA 1TUVA 1AZSA 4E0DA 1Q8KA 3VAKA 2F5GA 4E2FB 4LQ9A 3IA0A 2CPYA 4H4KC 4ZPWR 4DL7A 4F4ZA 4LR7A 2ACYA 3TAMA 3KLGB 3TAQA 1FX4A 1SVDA 4K2JA 4X64F 1CJVA 2OPSB 2XZTB 1RWNB 2UV8G 2HQCA 3V6HA 1CLFA 3B82A 3T6BA 5J2QB 4TVAB 4N77A 1KDNA 1P9YA 3SSQA 3TX0A 4L3KA 4CM0A 4Q43A 3J7YI 4OZLA 1WUUA 5DRKA 2A10A 4RW9A 3HFKA 2Z4PA 5F9LA 1Y9OA 1NDKA 4ECTA 2GJFA 3M32A 3Q8UA 4LRFA 2OO4A 1M5HA 5KG2A 1T9UA 3QSYB 1IR2A 4A4JA 2UU9F 3PTWA 3V2UC 3AQPA 2QFJA 5A0YA 2ZOGA 1IBLJ 4CWBA 1YZ7A 1RT4A 2A3JA 3HKZD 4W4MA 2BRKA 3DLKB 2IM0A 2PE8A 2YKPA 3EWGA 4DR7F 3GIKA 4CTAA 1OY9A 3CCSS 1WHXA 4TQRA 3ZC4A 5LT5A 3FFIB 1UEUA 2I8EA 4PQUA 1EP4B 3I0SB 1NHKL 2XM3A 2BJEA 5D77A 3IS9B 2VG5A 2FD2A 3LGHA 4JV2A 5ETRA 1X31C 1O6XA 1NJXA 2DRBA 2V2QA 2CA9A 3OL6A 4HH1A 2IC3B 3CW2C 4F0KA 1RAIB 2KU7A 4DPOA 1FEEA 3CCUS 1ACMB 4ED4A 4Q8FA 1NK0A 2WAQD 2GVZA 1HPZA 1BUXA 2K1RA 2LYVA 1BWVA 3V81A 3L7PA 2VODA 1HI1A 4FYYB 2C2ZB 4OX9J 3GIMA 2XI3A 2QJ3A 4DQPA 1IBKF 4IG3B 1U7LA 3JB9k 3OL7A 4BC7A 1U0SA 3MM6B 4C98A 4NRTA 3HHLD 5D4NA 5C2GA 4X4NA 3TR5A 2GC8A 2VPWB 5JXSA 4P9SA 3QJJA 1U1KA 2DR9A 3D1HA 1RWVB 3RBXA 2M8DB 1TP7A 3J7Z5 5CCMA 2HFUA 3RGIA 2NCKL 5KG4A 4K0KJ 2V5HG 5AJ3J 2AGQA 4B3MF 4CH1A 3GZ7A 3NAHA 1FRHA 5D4OA 2UUAJ 3DCAA 2BM1A 5A2QU 3BPSP 4L3NA 2F1FA 2IAJB 1HNXF 4ZCLA 2ZZMA 3DLEB 1BWEA 3UCUP 4E98A 1X4HA 2C3YA 1Q1KA 2COLA 3BO4A 4IFYA 4DLEA 3PX4A 1VI7A 3NGUA 1LW0B 2HRTA 1JK9B 4M5MA 3G9CA 1WG4A 3E01A 3EVMA 1EKRA 5D4LA 2RQKA 3PV8A 3W8GA 2JFKA 4ZPBA 3L9ZA 3J81U 3ITHA 1WD6A 1D1UA 3BH7B 1S7HA 4QU7A 3DLJA 5DZ7A 4DR1F 1HLWA 2OFHX 4RNHA 4ZS6A 3WQPA 1NNDA 4DR4F 1RT7A 2U2FA 4B9LA 3TA1A 3MEDB 1XNRF 4DCPB 1RT6A 5T7LA 1R8BA 1D9DA 3CEDA 4W98A 4KE5A 4DPTA 1FA0A 5DETA 1FKOA 2ALZA 2B8QA 3MOJB 1TL3B 3R7NB 4I6YA 4ILMA 1IQZA 4YB5A 1H72C 4QW9A 4V19X 4OX8A 2MQPA 1VLOA 4GO7X 4F3MA 3MMBB 2VQFF 4Y0FA 2UXCF 5HN0A 1TV6B 4ZVFA 4DG1A 1GMWA 1I5OB 3EVWA 1MROB 1R8HA 1N33J 2HAIA 4UF4A 1QVGR 3HFVA 4TXSA 3NP5A 2LVWA 3LWLA 3PR4A 4X4RA 5D0GA 4KY3A 3MR7A 2HBRB 1FNXH 4X4QA 4PQAA 3I56S 4URGA 5IFMA 4ED5A 2V63A 1X0PA 2FY1A 4B3RJ 1N8RT 4WZQA 2I6WA 3CT9A 4YN3B 1HR0J 4USKA 1RTHB 5J2PA 4QYZJ 3BO2A 4OYMA 5L9XA 2OIHA 5AXNA 2J0WA 2DGSA 1JJCB 2VFRA 1OYDA 3BJYA 1NHUA 2DHSA 4GKKF 1SUQA 7AT1B 2Y9HA 2MHEA 4QIFA 5GMEA 4JI1J 4Y6IA 2IRUA 2R2RA 2WVFA 3VAJA 3M8QA 4Y65A 1ZM4A 4OYWA 2QLXA 2R42A 4QU6A 2DR5A 3HX9A 2WOMA 3RU0A 1JJ2R 5F8NA 3KLFA 1AUSL 2IDEA 1HNIA 4PPZA 2ZM6J 3BGLA 5CYMA 4F67A 4C3LA 2MQQA 1RBAA 3W2VA 5GMKa 4URSA 1UA1A 2HW3A 1BQMA 4Z7YA 1JLCB 3BSCA 4QW8A 3NGSA 4O0NA 3UW1A 3PG9A 4FVCA 1JLBA 3T19A 3RAMA 2E66A 3FEZA 1SL2A 3JSRA 1UZDA 1U2RA 2QLFB 1B64A 2DJWA 4J9UE 2H5IB 2ZH1A 4IUFA 2NYHA 4LFCF 3ONQA 2UUCF 4XPCA 1R6VA 1RT2A 2RRNA 3C6TB 3DRSB 1P27B 2WVBA 3N0VA 2VD3A 3OL8A 4WU3A 3OJSA 1OQ3A 1WEYA 5J2MA 4ZCMA 2IFXA 2RVJA 1S9GA 1WOOA 1H7WA 2FVPA 2U1AA 3GJSB 2MLYA 2HIYA 1VBYA 3JS9A 2CQPA 1N34J 4XIUA 3PX6A 4FF3A 3AHPA 3W7BA 2HHUA 3HF5A 2GW8A 3NOGA 3IWXA 3CJ3A 4CH0S 1JMTA 4KGKA 2QO3A 3DYAB 2RQ4A 2CWKA 2J9EA 3QWPA 4P73A 5IWAJ 1CPZA 3KLGA 4UUWA 2XHWA 3D6HB 4GO5X 2Y1LB 1V5IB 2QV6A 4FXVA 3MAAB 4JI5J 5J2QA 3PEHA 2O1PA 5LSRA 2DNKA 1X4BA 2VDHA 4PR6A 2AEFA 1IWGA 2EK1A 4G1QB 3GYXB 2BMBA 1YIJS 2XMUA 1TL1B 3IRXB 1R8AA 1W7WA 3HVWA 1WKLA 4B9UA 2V4QA 1QSYA 4P2MA 5M2RA 1WWHA 1VRUB 2PI4A 2V50A 5LL6d 3K58A 3A3OB 2MSTA 4OV1A 1EETB 3M9MB 3GTYX 1H2TZ 2EC0A 2V8VA 3NMRA 2UV8A 5D0HA 3TQ1A 4H4OB 1DHMA 1DARA 3A1YG 4OJHA 1ZOTA 2KXFA 2C2RA 2GQ2A 4OZ0A 2QZ8A 5HATA 3FFIA 4ECQA 3MECB 4ZVPB 3MPVA 3PYEA 2MKKA 3CJQA 1EP4A 3I0SA 1SH0A 1I1GA 1UFLA 4PXCA 3IS9A 1DAXA 1S0NA 5HANA 2EFGA 5AXKA 1WI8A 4O0IA 4M8LA 1C1BB 2YWHA 8ATCB 3LGMA 3KHGA 2CQBA 2IC3A 1LV5A 3FEXB 5HBMB 3EPGA 4DUZJ 3E2EA 3SEOA 5CD4H 4CQ1A 4DR5F 1IM4A 4ZPAA 2D3O1 5IM0B 2R7VA 2K3KA 4O4GB 3HZEA 2VU5A 3BREA 3Q24A 2D3OR 1RWUA 1CULA 3ZXWA 1MLAA 3OFHA 2XS2A 4IG3A 3D6MB 3OTOF 4TN2A 2F4VF 1FK9B 2MKSA 2DB1A 3ZTQA 3MM6A 3SMZA 2BABA 3GILA 3KJQB 2JEIA 1RSCA 2LKZA 4A8WA 3IXQA 4AL7A 3HZGA 2R8JA 4DS5A 1NKBA 3K5NA 4GMKA 4BS2A 3BV8A 2QL9B 4USVA 3CPWR 3Q2SC 3RB0A 2WSEC 3IWNC 3MOZA 1R7IA 4CLZA 3CE8A 2XMAA 1QM9A 1SKWA 3BF4A 1NB7A 4KGMA 5F3TA 5HROB 4U67Q 1U6FA 1H2UX 2V68A 1W26A 2IAJA 3DLEA 4LBHA 5HJYA 4MIBA 1X4DA 1TK5A 1LW0A 4R5PB 1RTJA 1Y10A 2W4DA 4NWBA 3J81j 4ZHRB 4DL5A 2XG8A 4FXDA 4B9VA 5KFEA 2LCWA 2ZBCA 1WTBA 1GT8A 2RH3A 1IUJA 3C19A 3CDAA 2DGOA 3TI0A 2A18A 2NS1B 1ICEB 4FS1A 1KQGB 5DG7A 3MEDA 3QPIA 3MZIA 4M5DB 2YQ1A 3WBZA 2Q79A 4JP8A 3T41A 2QMWA 2MQLA 3CJ0A 2QX0A 5EWFA 3UCZP 4K4YA 3H4BA 1TL3A 2EBEA 5KFRA 2W8LA 1WG5A 8RUCA 5F8IA 5L1JA 1CG2A 4HHJA 2RDDA 5HVFA 2QGFB 2W2MP 5ETSA 1MROA 2J0XA 3ZZ0A 2GJ2A 2IVFB 1NSPA 1X4GA 3BGFA 2HHPA 2KJVA 4KIAA 1V3SA 4J9KA 1FD2A 5THWA 1BQNB 4PKDB 4NA1A 4Q2LA 2VPXB 3KUHA 3K5MA 4OYIA 5E3AA 2JEGA 4F3OA 4ZCIA 2W2OP 4PG7A 2BE9B 5KOXA 5HK4A 3CULA 3T5KA 2R4FA 5DJBA 2CFXA 4YP3A 5LXYA 1RTHA 3M1VA 4FPIA 3IP0A 1HIYA 1RHQB 4BDPA 4QIGA 2VJUA 3KMSA 3PM9A 2E9TA 1B3TA 3KK2A 1QAIA 1Y5NB 3OFEA 3KK1B 3GJQB 3FBBA 2I38A 2AJFE 4DL4A 2P9EA 4KKOB 1B99A 2K8GA 2VBWA 3V4MA 3JSMB 5FJ4A 4JI4J 1KVKA 3K8VA 1UEKA 3PRVA 4Q2MA 1S1TA 2VC0A 2K3IA 3JXOA 1PAUB 5DQHA 1FXDA 1J2VA 4KHPF 4TLRA 4NZ0A 4I1TA 1AYEA 3Q2TC 2FVSA 2LQ9A 4ZVHA 1XEZA 4Q44A 1S1XA 3MM8B 2HSEB 1JLCA 4USHA 1AROP 1FFSB 1IBMF 2P5VA 2W7AA 4B17A 1H98A 3IRWP 2O5DA 1UPMB 1NKCA 4OYZA 1UFWA 4ID8A 2DNQA 3U27A 3BBFA 1MU2B 4RPFA 3MURP 5C24B 3C6TA 3HDSA 4KJIA 4EK2A 3EYZA 4B9SA 2HHVA 1N52B 1EAYC 4OYPA 3EZOA 3OTEA 4M5NA 1F3VA 4RWWA 2ROGA 2DH8A 2W9BB 4I64A 3DKDA 3D6TB 3I5CA 1JLEB 3DOMB 1HHQA 2YXLA 3D67A 4PUOA 3FK4A 3SIPB 3UE2A 4ZLJA 3ETOA 2BQRA 3RG6A 4A8XA 3SV4A 2XYGB 1TKZB 1D8YA 3VAMA 1AB8A 1IBCB 2E1RA 2FB0A 3GQCA 4R25A 3HT0A 3KG1A 1RTZA 4JI8F 1FEHA 1J5EJ 2VBZA 2AT1B 2K06A 3D7SB 1YITS 2V4JA 3MAAA 7FD1A 4N56A 2APOA 2BKPA 5DM6Q 1M5KC 3DRPB 4MKYA 4DWIA 3CDUA 4ANCA 4G1QA 1TL1A 5KFZA 4MFBB 3D2WA 5KTQA 3K8WA 5HVHA 2RUSA 4GC6A 1G2EA 3O44A 3HK2A 3HXMA 4IG0B 3PW4A 5CXTA 1T05A 4X4SA 2MDAA 2PA3A 4LSNB 4LF8F 3IAS9 2DHAA 3TJ9A 4RNNA 1NK4A 3GFXA 4LF5J 2E5JA 4OZ5A 5E3CA 1E6VB 2VC1A 2OD6A 4Q5VA 2ASYA 1H38A 2NSBA 5L38A 2ZH5A 5D0EA 3S7RA 1WACA 4G6VB 2MEWA 4H4OA 1RTDA 2LFVA 2AGPA 2BJ8A 1RAHB 1X60A 4Y34A 2H54B 4ALZA 4LSLB 4ICLB 2DNPA 1N54B 1N32J 4Y2CA 2HK3A 2GIRA 2HQIA 1X7VA 2H3EB 2XWXA 4DN9A 4DR2J 3HVRA 2HVDA 3NAIA 2V8PA 2AJ4A 4YMEA 2EW9A 1C1BA 2WTFA 5IT9U 3M9NB 4ELUA 4IRCA 2V9KA 2R7QA 5EX0A 4JI6F 4TU8A 4TKTA 4HACA 1RI7A 3B4DA 1V6HA 1FNMA 1S49A 4ZK7M 2ILZA 1V3RA 4YY3J 1Y4ZB 1KQFB 1BHNA 3EVOA 3PHEA 4O4GA 1RQ0A 1RAGB 2WHOA 4IR9A 3WX4A 2CDRB 4DV4F 1VQMS 4F0HA 5IQ6A 5J1EA 1RLDA 1FWPA 1VQ4S 2OUGA 1IVZA 3N28A 2C2OB 4DFPA 3ZTPA 5J1PA 3IGVA 5FIIA 2QYCA 4UY85 4DMZA 1PYOB 2DNZA 5E41A 2J8SA 3FCWA 4B3OB 4BWJA 4QYZK 1CEZA 3QNWB 2OEMA 2OMLA 2X1GA 3MMCB 3M8WA 3LA0A 3OHAA 4QPXA 4FDFA 3HSJA 3K57A 4HR2A 2HVZA 4NLPA 3GU0A 4G1PA 4WP9A 3BGRB 4B9MA 4C8KA 3FNNA 4ZN1A 2DY1A 5B0GA 2KZMA 3SCLE 4J9OA 1VRTB 4WFNQ 3BSNA 2OPPB 4ES3A 3MUTP 4R5PA 5F3ZA 4LF4F 3S01A 3TJAA 3W5XA 4NLTA 2YNIB 2DO4A 1B0PA 2L3MA 4ZHRA 5E2QA 3PYGA 2FHJA 3TYTA 4HHHA 4X4OA 5K8NA 3D28A 4EBEA 2ZH9A 3T5LA 2CQIA 1UFKA 1FVSA 2KYZA 1WNEA 3L95X 2ZNZA 1NEEA 3GYGA 2OGUA 4DSFA 3MAHA 2F65A 1RWKB 4DR3F 4PWWA 3R2DJ 4M5DA 1NPPA 4LFAJ 4NX9A 2J76E 2FLPA 4ZVGA 1S72S 2H1YA 4S0MA 3CCQS 1TKXB 1Q8IA 2EG1A 1RT5B 2FJEB 4O44B 4NI2A 3Q8PB 5KAKA 1S0VA 2LEPA 1MSWD 3J7A1 4K4WA 2HBYB 1RWXB 9RUBA 1VHIA 4IH7A 4HKQA 1FKAF 2Z58B 1JJHA 1JLGB 1OSDA 1XC9A 2RD5C 2ADCA 4AUKA 2G2ZA 5KFQA 1LK7A 3HKWA 2E1CA 4M5IA 5K14A 2OP5A 2ZEJA 3TAPA 1BQNA 3CD6S 3C14B 3M8PB 5IXUA 2BZ2A 4ECSA 1HBUA 3EM1A 1YGYA 4YQWA 3UN5A 4CDIA 5KFOA 4V19J 2CJQA 4P75A 3BQ1A 2PMHA 3US5A 2MPUA 2HS3A 1YJWS 1HHTP 1EJ7L 2DRDA 3LANA 5ETNA 1PAEX 2MZ1A 1B0VA 3Q8SB 2E1MC 3E3XA 3KK1A 2Y1IA 3I6PA 4LJMA 1HNVB 4ELTA 1ITPA 1IKYA 4D3GA 1SQEA 3JSMA 1XR6A 3GJTB 2QSWA 4RNOA 3WC0A 4CZCA 1B4SA 1DQAA 3TEHB 1ZAXA 2J9DA 1CJUB 2E29A 1O8BA 5L39A 4P71A 1VQ6S 2ZHBA 1KN6A 2V2ZA 2EFVA 4X64J 2JSXA 3MM8A 2XI2A 3MF5A 4Y3CA 1RT3B 2XLIA 1X4AA 1N48A 5EUHA 2MZSA 3D4JA 4DSJA 3RRGA 1PYSB 5AXLA 3TA0A 1MG7A 3NNHA 1JLAB 2F9JA 3CUNA 4UZCA 5E3PA 5C24A 2IM2A 1SC1B 2R3VA 2H48B 1ZS6A 1RAOA 2IVYA 4OJGA 2HWTA 3ETMA 1C2PA 3VGUA 4LF6F 1H3DA 1NB2A 2W9BA 4F2SA 1MMLA 3CCES 3THPA 4DX6A 3TEGA 3IO1A 3KK3B 2UU9J 3DRRA 4USJC 1LXNA 1JLEA 1HBMB 3GV8B 3DOMA 2OTLS 2DGWA 3PW2A 1L5UA 1YWXA 3CJSA 2KM8C 1VIOA 5M2PA 4HT7A 4K4ZA 4MTPA 1Q8LA 2R2SA 1TKZA 4DR7J 2PDAA 2D3UA 4P2FA 2B0GA 2AYEA 2N82B 1YJNS 1VHFA 3SFUA 2N7YA 3TW0A 2XYPB 3DRPA 3VQSA 2GIFA 2OPRB 5IT4A 3S8SA 1B70B 4LSZB 2NYIA 3KOAA 5KFPA 4MFBA 2XO6A 1B7YB 1TAQA 4WK1A 4IG0A 3M7VA 2QA1A 4EO6A 3D9BA 3HPOA 3EXYA 3V6DB 1U1PA 4YHHJ 3FCHA 1CQNA 4JBCA 3AODA 2CQ4A 3AXKA 2ABYA 2IA0A 1E6VA 1VQSA 3GWCA 1JLFA 1MWYA 2VPZB 4JYAF 2V2VA 3QBCA 2QG9B 1IBKJ 3QGHA 3OLBA 2FGCA 1Q86T 1N5YA 3A4TA 3FBEA 2Y1RI 1CS4B 3QO9A 3VGSA 3QAEA 2O3DA 3F0NA 3GR0A 3H2UB 3CJ4A 2XNRA 4P52A 4YB7A 4LQ3A 1PYTA 1RHRB 1NSAA 3EGVA 3QAUA 4HDGA 5EDWA 4LSLA 4DUZF 2CIMA 1P8GA 3LP1B 4LBIA 4A8MP 3PW0A 1I6JA 4B3MJ 2WSCC 5F8LA 3BKTA 3OPKA 1I94F 2OELA 1U0HB 1LWEB 3JAMY 2GO9A 2RQCA 2VBXA 3GLJA 2K2PA 3LUYA 1HNXJ 4NLUA 1TKTB 2XMKA 4DL2A 2BA9A 3GMGA 5E5NA 3UO0A 3G96A 4Q0BB 1CC8A 2IMOA 2JVRA 3GCWP 3JQJA 3DI6B 2XBPA 2G1DA 3CC4S 1S12A 4WE1B 2HVEA 2EG2A 2DK2A 2HRUA 4GC7A 3BO3A 4UW2A 2C22A 1FWLA 3T1YF 3GG0A 1RYRA 2ZJRQ 4CLTA 3RW6A 1FVQA 4DR1J 2WSFC 5KFKA 1U24A 4DR4J 2JLGA 1RJJA 1XNRJ 4XAKA 4B3OA 4XK8C 4UOHA 1ZTWA 3J81Y 3Q8YA 4KGZB 3UR3C 2DGQA 2AMCB 4DQIA 1VQ7S 3I96A 3OXLA 2R8KA 3L09A 4NEZA 1Y5LB 4KBIA 5KFXA 4BC9A 3BGRA 2VQFJ 5BXIA 1OJ4A 2UXCJ 3ISZA 4FYVB 1X4EA 4OI6A 3J7YU 2ZC4A 2JJ4D 2GZOA 2SXLA 4NRUA 2YNIA 3D0HE 1D0EA 3SCKE 3GFZA 2ATCB 4M5KA 3T3FA 1JKHB 5A76A 2HMIB 1DZ5A 3UCGA 1XIQA 3DHWC 1LWCB 3MTKA 4HT5A 3CSKA 5IS2A 4WXOA 4G3IA 4YUDA 2MQNA 1VQ5S 1WC0A 2A1BA 2R7TA 1RU2A 1U6ZA 3H5SA 4GKKJ 3RAQA 1NDLA 2RIJA 2J7WA 3P5BP 5IQQA 2NR0A 4PG6A 4FNIA 4ZP6A 4J9LA 1RT5A 1WOSA 4O44A 1G6BA 4OI4A 4TU9A 3QFWA 4I68A 2VONA 2JNJA 3HHEA 4AL5A 3A3PB 1SIZA 4WP3A 1JLGA 2HRYA 3AOBA 3OT9A 2DHHA 1RAEB 1VFJA 3PO4A 4ED3A 1PBUA 2FVRA 1Q5YA 2V9WA 4MIAA 3LGNA 4KO0A 3DN9A 1T95A 3THVA 5HMZA 2HFVA 2OFGX 3UN3A 5DDRC 2BJ7A 5HMXA 1A9NB 2R9LA 4KPCA 2MQOA 4DCJB 2DHGA 4LFCJ 1YSJA 2UUCJ 1VQPS 1R89A 3MPYA 1UVKA 2E7VA 3A8JA 3P8BB 4O3NA 2W4PA 2CAJA 1HWIA 3U02A 3P49B 3H20A 2CQ3A 4QR2A 3ZZOA 2YTCA 2R7OA 2W1BA 2AWZA 1HNVA 1KOOA 1M5SA 2YQ3A 2ZDPA 5MAOA 2B8PA 1LWFB 2H9ZA 4IRKA 5DM7Q 1N5VA 3WX8A 2KVIA 1ZM2A 5I42B 2HZVA 3UD5A 2J8AA 1TL5A 2KT3A 1CJUA 3MUMP 3MM5A 4KHRA 1NJWA 1WOPA 1HI8A 2QLJB 2XSJB 2BANB 2RS2A 2AJ1A 2DNRA 2V8HA 4KYZA 2YH1A 2AYGA 2H65B 5C5JA 1T3NA 2H51B 1F2HA 1GTEA 3D5MA 1N0VC 1RT3A 1KTQA 2OLWA 1RLCL 3R5AA 2HQGA 1M1GA 4WPAA 2EBGA 3BR9A 1TUWA 2N4CA 4Y00A 1RA6A 3DGPA 5A8KB 4DL6A 1VQYA 5IT0A 2G2OA 3H5UA 4DV0J 2D7SA 2AF6A 1TTHB 3KUEA 2G0IA 1FJCA 2EEYA 5C2CA 3C46A 2L9DA 2ZBQA 1PILA 1VBXA 2J7UA 4DZDA 2KVQE 2VV5A 1U49A 3AOCA 4C7QA 4FF4A 1NSKL 3FDSA 3QJLA 5KFAA 3QRQA 3BKFA 4NE9C 2C42A 5B0EA 1HBMA 4PQUB 1YG0A 2CPFA 3G71S 3O1LA 3DLLQ 2QMXA 2PMWA 3SFGA 1REVB 3OR2B 2VG5B 4WFXA 3MD3A 1PC5A 3G2XA 5HJXA 5ETQA 2G13A 1N88A 3CCWA 3DOKB 1UEVA 1ZYQA 4K5RA 3OR1B 2JLEA 2QL7B 1RKJA 4EZ6A 5KG0A 1RAFB 2HNYB 1XTZA 2MZRA 4O23A 5D3GB 2GVZB 2OPRA 4DBQA 2CWXA 4IH5A 4WWSA 4CLYA 3MXHP 3QLHA 2M70A 1RADB 3N5FA 2EXUA 5F0UA 4OZ2A 3ADAC 4DFJA 4M63A 5D15A 4LMZA 2B9WA 2XC9A 3CJKA 4KFBA 1WDTA 4DI6A 1NAQA 1M5OC 2PSZA 3V6DA 1ZM3A 1MN7A 1JXLA 3N5BA 3TVKA 2YWWA 5KT2A 2RT3A 3TO8A 1A6LA 4DR5J 1P9QC 2HS0A 1KLNA 3NS6A 4Q7AA 1HMVA 3OTOJ 2F4VJ 3RZAA 3O5TB 1HNWF 1CS4A 2R7RA 1ZPWX 4UOFA 4NLXA 2NXJA 4ECZA 2ZVSA 1VR6A 2ZDOA 1EHWA 3ET6B 2XS5A 5H9FJ 1UVIA 2FJBB 1KFSA 3HHDA 2BXJA 2H4WB 4K50A 3LP1A 1T9XA 4QWAA 4ZMMA 1HWJA 2BJ1A 1FRIA 1LQ9A 4IFYB 5HQLA 1QSSA 3LP0A 4NLYA 1LWEA 4ZVSB 4YR0A 3H40A 2B4UA 1E6YB 3A8KA 1TKTA 2CJBA 1FERA 1GEHA 3EPIA 4MYTA 5M2UA 2R7XA 4ZPCA 1NZAA 2JDJA 1JWWA 3W66A 2H4YB 1UWBB 3DM2B 4USUA 2FHOB 1VQ9S 4UOCA 4AXIA 4WE1A 2RHQB 4NZ7A 3ZFVA 2OSRA 1Y7PA 1RT6B 4GVBB 5T7LB 3HP6A 1TMMA 2OHDA 2GMHA 3RUBL 1FJ7A 2CUYA 3EJMA 5KFUA 2KFYA 4R8UA 4OHZA 4P2XA 5GADU 2W01A 2F8HA 4A47A 2BE2A 2FHMA 2WK4A 3PY8A 1JB0C 4NEYA 2D74B 4A48A 3JSBA 3TJ8A 1NK6A 3KDNA 4DU8A 2UVWA 4DG1B 3FVYA 1PSDA 2AJ2A 1A7GE 5F8MA 2C28A 2GO8A 2ROPA 2GMJA 5IC6B 2LMIA 2DR7A 1RK8A 4I6WA 1WEXA 2KFNA 3OD2A 2J0SD 3NGKA 2I5JA 3UD3P 3R5JB 1MN9A 2VFTA 3R97A 3LTOA 2WVCA 1U1MA 3GIIA 1RB0A 3FRYA 2X1AA 3CDWA 3R3TA 1L3VA 3GIRA 5BYRA 5IV3A 1Q95G 4QCLA 4RBVA 1JKHA 4U7CA 4CRJA 4NCBA 2HMIA 5T41A 3VVTA 1LWCA 2V8DA 4NMXA 5KG1A 1M1KT 4O4RA 3LW5C 1J5OA 1RDRA 3Q8VA 3BBBA 3J7ZT 4FBTA 1XERA 4ZPDA 1DTTA 3E8OA 5EX3A 3MWBA 1UVLA 4DHVA 1S59A 1FRKA 2C2KB 6FD1A 3IBFB 4F25A 3HLUA 4CNZA 4EBDA 2CNKB 2ZH8A 4KAIA 5LMUF 2R8GA 2B4OA 4NPOA 4FKYA 1BQMB 1WSVA 2BYCA 2ZNYA 2LA4A 4CM2A 3JTOA 3I5AA 3JTPA 2IIHA 9ATCB 2KRRA 5AT1B 5T14A 1CSJA 1C1CB 4KHPJ 4U7UD 4ZLPA 1QY7A 3HSZA 1RT2B 2YNFB 3PW5A 1FHTA 4WFBQ 4PPDA 2E1PA 2CG4A 1IBMJ 4F26A 3BQ2A 2KHDA 2GV1A 4P7TA 4RNFA 2V2KA 3K17A 1RGVA 2NUUG 3LAMA 1IQTA 2PIIA 4OFZA 1WTFA 2V94A 4NLOA 4DS4A 3HM9A 2EC2A 1FKPA 4ZVRB 4ED7A 2W8KA 1SPBP 2HHWA 2HHHF 1JXVA 4YEAA 2E7WA 2OJ3A 1QAYA 3VTIA 3TRGA 3W61A 1LWFA 5LSLA 1T94A 3VF0B 2E5GA 1NO8A 1WJ9A 4QJVA 4P10A 3PIPQ 3AXMA 4DV3F 3T5JA 2RE1A 5I42A 1HNZF 2YKMB 1T9VA 4TQSA 3KJFB 4NLWA 2UUWA 3LH2S 3RJMB 2CQ1A 3EDRB 2XSJA 2BANA 5I4MA 4J9QA 3RTVA 3K59A 4JI8J 2ZHOA 2E9ZA 1Y5IB 4BBYA 5HLFA 1RYSA 2ZITA 4CO0A 4X4PA 3C3LA 3AQOA 1S5ZA 1GTHA 4PYAA 3EUNA 3IM8A 1FX2A 2HURA 5F8HA 2XGQA 5J1NA 4LFBF 1F2GA 1GMUA 2KXNB 2EFPA 5A8KA 1TVRB 4LF8J 3BGUA 4RUAA 1H2VZ 1RHKB 2VG6A 3QMQA 4PXDA 5DDOC 1HBOB 3FBCA 5D8HB 2XHCA 3TUJC 3K5OA 3EMTA 3TZZA 1WSRA 2JOQA 4DV6F 2NREA 5J2NB 2G2YA 3R7BB 4KRWA 2RKIB 1DJ0A 2DR8A 2ZWOA 2XTJP 1REVA 3OR2A 2HQDA 3VWSA 2XGPA 5HQMA 2EFNA 2IBOA 4F36A 3ZTOA 4E8UA 4OX7A 3V4IB 5GMDA 3VGTA 3DOKA 3OR1A 4F04B 3QT8A 1TAUA 2VDIA 2YVSA 2HNYA 4YHHF 4FYDA 5JMNA 2GS8A 5D3GA 2A6OA 4I2QB 3CF5Q 3CJ2A 5IOLA 3U1LA 2VFUA 3ISNC 3SSSA 2OD4A 4RW4B 3QQCD 2HBQB 2FJXA 4K4VA 3N6NA 3HI9A 1CULB 5B0BA 4CLWA 5ETMA 4JI6J 4QPTA 2RDIA 4FBUA 4TU7A 4HI2A 1T03B 1OPIA 4CLSA 1ZH5A 3PCOB 2FLNA 4F2RA 4NXNF 2GA7A 1N36F 5IT9Y 3JAMU 2UXBF 5LSOA 2GQQA 2ZZTA 5L9NA 4DV4J 3ILOA 4ETZA 3R2CJ 3R1LA 1K8AT 1EX8A 4A8FA 4WTYA 4OZJA 5K9FA 3ZTRA 2AYMA 3WHIA 1SI9A 3ET6A 2JRSA 1HYSA 1UETA 5KFVA 1F9HA 2VOOA 1WORA 5B0AA 5A6PA 2W7OA 3EGZA 2Q6BA 4WYWA 2P6TA 2ZUAA 1BQXA 3NGDA 4AD6A 1O0PA 1K1QA 1SJ4P 1S9EA 1RTJB 4IO1A 2CJYB 2VKZG 3LPYA 2V34A 3QRRA 1E6YA 5KOWA 2AZ3A 1S1WB 4FVMA 1Y3JA 1YJVA 4FZVA 3UN2A 1FXRA 1TL7B 4CLUA 1UWBA 3DM2A 4M94A 4LF4J 2FJDB 4K4SA 5D0RA 2DGXA 3N6LA 4ECWA 4W92B 4GVBA 3S6EA 3UDVA 3D54A 1WEZA 1P1TA 4LRBA 2ZH4A 1R0BG 1TL4A 3POTB 1FRLA 1HL6A 1TK8A 3TWZA 3D0GE 1SL0A 2MKCA 4DR3J 3G87A 1R31A 4RWXA 2CJAA 4HTJA 5KFNA 2AEMA 2HNDB 2EK6A 4DV1F 3Q86A 1HFEL 4N41A 3TOQA 4WBFA 2RHSB 2J6UA 2DNNA 2KL8A 4P6QA 5ETOA 4ZCKA 3OTBA 2XMJA 5C42B 4M1KA 1NSQA 2C2DA 2ILYA 3KLHB 4FF1A 5ETKA 2Y0BB 2NZ4A 3H25A 2V67A 2CVEA 3MEEA 4RJVA 3EZ5A 1T0TV 4QWCA 3NWRA 1HD1A 3H5XA 2HGMA 3M1VB 1NBEB 2X3DA 3B6BA 3QT7A 2KT2A 1GFWB 3NRBA 1PGZA 2B56A 3KK2B 4NCAA 1HBNB 1S6OA 4C4WA 3KLVA 1XNQF 1DLOA 3Q0AA 4L6V3 4MKAA 2L9NA 3NS7B 2M4MA 2LDYA 1UTAA 1S1TB 4CLLA 1FI4A 2VKRA 2DYAA 3P4UB 4DUTA 3D66A 2YKNA 4O3OA 3Q89A 3NWGA 3K5PA 2UUBF 3GONA 2YKOA 3DMJA 3MMJA 4ED8A 3W8PA 2P9GA 1S1XB 4MK7A 1RCOB 6FDRA 4ECYA 4PWDB 1K73T 1EZZB 2DEJA 4ANDA 1SH3A 3CTRA 4DXLA 2CG8A 1REGX 2N4DA 3QZ7A 1C1CA 2YNFA 4QIEA 4U9RA 2NXEA 2YQ0A 1S57A 3MHYA 3SDEA 3FGVA 1RHMB 4Y28C 2PFDA 3DXBA 4NZ6A 4B3TF 1QTNB 1G7CB 3KJVA 1F5BA 1DURA 3BN4A 3LQVA 2RS8A 4J9PA 2FVQA 3PHTA 3FBFA 5GADI 4PUOB 1YX2A 1F5CA 2DCUB 4X4VA 3TZWA 4LF6J 4EFAC 1GXTA 2GAGC 1LW2B 4RX6A 4I7FB 5I3PA 4V1Ak 4CYUB 3TANA 3MPUB 1V5VA 3UDLA 3IGNA 1FF2A 2AJ0A 3FRZA 1D8ZA 1ELOA 3G86A 4N47A 2V4JB 2I2YA 3FKBA 4L73A 3RYLA 3A13A 2E9RX 2YKMA 4MAKA 3VZIA 1N5TA 4EGLA 1VIXA 2E7XA 3KHHA 1DFDA 4EZ9A 2RF2A 5JUMA 1S10A 4YB1P 1KRPA 1T05B 2E1AA 4DV0F 4MIWA 2P2CB 1VQKS 3T1AA 3V5RA 3RR7A 3M2UA 4BCAA 4EMDA 1LFPA 5H9FK 2B43A 3P45B 3HSDA 4OZNA 2I9SA 1RBLA 2L08A 3ZTSA 3X3UA 3K5LA 3NL0A 4L76A 1OO0B 1TVRA 1JQGA 2QRRA 2MKIA 4OYAA 1FT8A 2Z2LA 1RTDB 5GVQA 1V9OA 1HBOA 4PYDA 3EE3A 1P6TA 3SQOP 5J2NA 4JYAJ 3GIJA 4U6PA 4ECXA 2A2DA 2RKIA 1SJFA 1RUSA 1HI0P 4EBCA 2D41A 2ZJPQ 4CIOA 4ECVA 1VRQC 2IRXA 3TP2A 2YY3A 2UVUA 5KFJA 3OHBA 3V4IA 3JQMA 3MFIA 4QOTA 4ECRA 4TYAA 3H8YA 2KO1A 1A0OB 3CCMS 1WDDA 1GX6A 2Z56B 3W2WB 3MAQA 4HACB 3CCRS 1U1OA 3KLEB 3UWTA 3FEYB 3PX0A 1YJRA 4I2QA 1DBDA 2HZCA 1N5SA 4C0BA 5KFWA 4LRCA 1NH7A 1I94J 3U1NA 4RW4A 1UW9A 3RBDA 3B78A 1BD6A 5RUBA 5J1EB 3IR5B 4DJBA 1U6BA 2PEHA 5L8RC 2HS4A 1WC6A 2KG0A 3EX7B 4FN5A 1FJGF 1T03A 2H5JB 3RB4A 4OLOA 5IC4B 3DU6A 4KH0B 3HHLA 1JLQB 3D0IE 2A6MA 1NJIT 1OIAA 4KV8B 2QA4G 4ZVQB 4KQZA 4USIA 1RKIA 3D68A 3C16A 2W25A 4EYHB 2HG4A 2UXDF 3LOUA 2BRLA 3MI7X 1OQ6A 2R7WA 3T1HF 1O5JA 4I6AA 3T1YJ 1R8CA 3K7RA 1U1NA 3IMQJ 3TZYA 1RAAB 3RRHA 1V3ZA 2BV3A 1YJUA 5ETLA 2NLWA 4NLSA 5CHCB 3CXCR 5HL7Q 1R43A 4K59A 3EDQB 3GSDA 2CQ0A 2MKYA 2JVOA 3VAGA 4I0WA 3TA2A 1R6YA 3QGPA 1PKUA 2VHGA 1GMWD 5E3QA 4DSEA 3DHXA 2RRBA 3W5YA 1QUVA 1X9MA 1UAWA 4P72A 4C8ZA 3KJNB 3ISND 2G0CA 4OI3A 3CGIA 1S76D 4L72B 1H7XA 5AXMA 3VAHA 2VG7B 3AJ1A 1S1WA 3UDEA 1YRTA 2N3OA 1MWQA 1YBAA 2B9EA 2C2MB 4NA3A 5FD1A 1TL7A 1URNA 4K4XA 1EQMA 3U7JA 1QTMA 4ES1A 5AE3A 2AKWB 2FGOA 4DSKA 3A8EA 2FIUA 3FMBA 4F0MA 4U8YA 5I3UB 1I51B 3TUIC 2WBRA 1K44A 3POTA 4CLPA 1O51A 2OSQA 4ZJLA 5DQIA 3ZZRA 2FJWA 4NI2B 2A2CA 2NSCA 4ID5B 5K20B 1TMJA 2ZBRA 3U1MA 3CDEA 3AB4B 1X8DA 2HNDA 5FDLB 1AA1B 4JI2F 1KOHA 4YR2A 1AT1B 4O3PA 1U02A 3KLIA 5K14B 2UP1A 1G3OA 4ELVA 3ZNJ1 5C42A 3DNCA 4HVZA 2HFSA 1WC3A 4QIWD 2YPYA 3VHQA 3KLHA 1NKEA 3F73A 1HBUB 1JNRB 2L9WA 2RNEA 3MM7B 2VA3A 1F9FA 2XCAA 1U8WA 2HEKA 3IBWA 3N9UC 1X9WA 2VFVA 4OI1A 4H54A 2DT9A 3IR7B 3CD5A 2IRYA 4NXMF 3RRKA 4JI7F 5HMYA 2LQ8A 2CKWA 2HYIB 1HBNA 3BN7A 2UZAA 1RXOB 5ADZA 1WHYA 4UY8T 1VYAA 1IKYB 2XMMA 2VB6A 4WFZA 1G4CA 2W2PP 3MCOA 3I32A 3IM9A 2CADA 4B3SJ 3MD1A 4Y2IA 1GH8A 2YBVA 4ITSA 1UVMA 2DXDA 4F02A 3S1TA 2M0GB 3KNGA 4C8MA 2FDNA 3NMAA 4NCGB 1HWKA 1XMOF 4LVNP 4CH7A 2ASJA 4MK9A 3BPDA 4PCQA 4EU0A 3UQSA 4MH8A 3R9LA 1RACB 3RR8A 3NGTA 3NNCA 4PWDA 2CQ2A 1F60B 3C66A 5KFIA 4K4TA 4R0JA 5KT6A 3HVTB 4MJKA 3BYRA 2DPJA 5KFFA 2IPOB 3DLBA 1W2IA 1SC6A 3M8RA 1L3UA 4LF9F 1YTYA 3KKFA 2YKAA 2B5JB 1T7PA 2KXHA 1GQEA 2FZGB 1NRKA 5A8WA 2VOPA 4NASA 1OS5A 1SL1A 4DV7F 2D1CA 1NU4A 2ZH2A 4HH0A 3KHLA 1KFDA 4EUVA 3K0JA 3DLGB 2POKA 3DRRB 2FY8A 1M5VC 2PN6A 2M5YA 3G82A 3M2VA 1LW2A 3CNQP 1DQ8A 3KMQA 2EI5A 4DZ6A 4I7FA 1YBUA 4CYUA 4NYZA 3MUVP 4YS2A 2IDLA 4LR9A 2JL9A 5LMNF 4Z2XA 3JQKA 1K9MT 4JV1A 2HZAA 5FLXY 1KLMB 4U8VA 1XMQF 4I2PB 5E3RA 5C25B 1NK8A 3ENWA 3NLCA 1FD8A 3D1OA 2OKQA 2R7UA 3C8YA 3IN5A 1ZZFA 1XN9A 4DX7A 2ZE2B 1FE0A 2IJNA 4HHUA 2HFZA 3CCTA 2IHR1 3NCRA 4QR1A 4C3MA 3CCZA 1RZMA 5KT4A 2MGZA 1EQ0A 1JLFB 1N4LA 3HT3A 4F4KA 2F63A 1PBAA 1URRA 2DIVA 5B09A 1TQLA 3OVSA 2F8EX 5A8RB 1N5YB 3GV7B 3QO9B 1SIWB 4F4AA 1YJTA 2HK2A 5MLCV 3GPAA 1HQEB 1FNOA 2FVCA 2LXUA 4JI3F 2QYGA 4C11B 2Y8YA 2PFFB 5KFCA 1ZAVA 2ZBIA 2BOPA 1ZTTA 4C6AA 4H4KA 3I31A 1HNWJ 3LWMA 3SSRA 3VZHA 3PJXA 1FTRA 5IV4A 2B9XA 2C3PA 2DNOA 1VQNS 2YNHA 1FTCA 3DU5A 1D09B 4DOZA 3MM9A 3TQEA 3W2WA 1IKWB 3GB0A 3H0PA 3CJTA 2GMLA 2FC9A 2CPEA 2JH3A 3KLEA 1QUPA 1BY9A 2QIFA 2XNQA 5BJRA 1VC5A 4YR3A 3M6UA 4F4YA 3H4DA 2V4RA 1WF2A 2WONB 3QT5A 2FZKB 2LQ5A 4NLQA 4C8OA 2DNMA 4W90B 5CCLA 4HYKA 4DEZA 4ERDA 2HPUA 5JVGQ 2DXEA 1KS2A 1S7IA 4GKJF 2DGUA 2GHWA 1FRJA 2ZVIA 4LBPA 3Q23A 3TUZC 3R27A 1C0UB 1AFIA 2K7JA 1JLQA 4FF2A 1CVJA 1FDBA 5KT7A 4KV8A 2VPYB 3T9NA 2LXIA 3PYDA 3BR8A 1WKKA 2GIQA 3IBCB 1RWOB 3D3BJ 1QSLA 1DY3A 1IWAA 1S0OA 2HKEA 2IJFA 5DDQC 3V6KA 3B54A 1HWLA 5KT3A 1Z2ZA 4TNOA 2J6SA 2E5HA 5AE1A 1FFGB 3R6LB 2C2NA 4PXBA 2J9CA 3VAIA 1FXLA 1U09A 3TZXA 4DU7A 2B4VA 2GQCA 3CIZA 3SYZA 1SH2A 1IR1A 3LO3A 3J80Y 4M5JA 3OTDA 5GAGI 4OL8A 1TKDA 4C2MA 4WCEQ 3G8TA 4DUYF 1CJKB 2PO4A 2VG7A 3PKYA 2EVZA 2B6AB 2BUNA 2X3GA 4X2BA 2GCFA 3MMAB 1WC1A 3FC9A 1J27A 1RTIA 1VISA 2OMOA 2W9CA 1S99A 4J91A 3AJDA 3N4WA 1X5OA 4X62F 1T9YA 2RU3A 3HO1A 3AB2B 2M8HA 1GX5A 3SZ2A 5I3UA 4WP8A 1TR0A 2XULA 1FE4A 1UKUA 3CCLS 1Q78A 3G8SA 1SKRA 4AQYF 3VV2B 2FLOA 4ID5A 2J6TA 4DPUA 3H5YA 4N5SA 4RZRA 5F8GA 1VJWA 2X7IA 2EFOA 5FDLA 2VJVA 4IR1A 4KTQA 1U8SA 4ENOA 3C15B 2W9AA 4IOAQ 5LMUJ 3IG1A 1PG5B 1OY6A 1XR5A 1NUEA 3JTNA 4ZP7A 4KO0B 2DPIA 2X1FA 4DR6F 4MYUA 2RAQA 2ZH6A 4PAAA 2QA2A 4OLPA 1YKWA 4UUXA 3KNAA 3MM7A 2BW2A 3UR0A 3NS5A 2MXYA 2M3DA 1HA1A 2VASA 2HLUA 1HQUB 3BEGB 3CD7A 4DFMA 3W62A 3Q22A 4IDKA 4RW7A 2HNZA 1NLKL 4ECUA 1NH8A 4P7VA 1VGYA 3GV5B 2YX4A 1ROFA 3MR6A 3ZZUA 2PMZD 3FUYA 4LUBA 1IKXA 1SJQA 1OSCA 3AFGA 3VR1A 2ACMA 5LOQA 2YWGA 4QYRA 2KFZA 3VVUA
chains in the Genus database with same CATH topology
3HSJA 3HT0A 3MCMA 5ETRA 1TMMA 1Q0NA 4M5NA 1RAOA 1RTZA 5ETPA 5ETMA 3ILLA 2F65A 4CYUB 5ETKA 1TMJA 2QX0A 3HD2A 3QBCA 3ILOA 1EQMA 5ETSA 3UD5A 4CRJA 1F9HA 4M5HA 3KUGA 1EQ0A 3IP0A 3KUHA 4M5IA 4F7VA 4AD6A 1EX8A 3UDVA 3HSZA 3HSGA 2CG8A 5ETQA 1DY3A 1RB0A 2F63A 2BMBA 1G4CA 4M5JA 4M5GA 5ETVA 4M5KA 4CYUA 3ILJA 5ETOA 3UDEA 3MCOA 4M5MA 4PZVA 3ILIA 3KUEA 1RU2A 1CBKA 3MCNA 1KBRA 5ETLA 5ETNA 1RU1A 1HQ2A 5ETTA 3HSDA 3HCXA 4CWBA 4M5LA 3HD1A 1HKAA 1IM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSJ A;  3HT0 A;  3MCM A;  5ETR A;  1TMM A;  1Q0N A;  4M5N A;  1RAO A;  1RTZ A;  5ETP A;  5ETM A;  3ILL A;  2F65 A;  4CYU B;  5ETK A;  1TMJ A;  2QX0 A;  3HD2 A;  3QBC A;  3ILO A;  1EQM A;  5ETS A;  3UD5 A;  4CRJ A;  1F9H A;  4M5H A;  3KUG A;  1EQ0 A;  3IP0 A;  3KUH A;  4M5I A;  4F7V A;  4AD6 A;  1EX8 A;  3UDV A;  3HSZ A;  3HSG A;  2CG8 A;  5ETQ A;  1DY3 A;  1RB0 A;  2F63 A;  2BMB A;  1G4C A;  4M5J A;  4M5G A;  5ETV A;  4M5K A;  4CYU A;  3ILJ A;  5ETO A;  3UDE A;  3MCO A;  4M5M A;  4PZV A;  3ILI A;  3KUE A;  1RU2 A;  1CBK A;  3MCN A;  1KBR A;  5ETL A;  5ETN A;  1RU1 A;  1HQ2 A;  5ETT A;  3HSD A;  3HCX A;  4CWB A;  4M5L A;  3HD1 A;  1HKA A;  1IM6 A; 
#chains in the Genus database with same CATH topology
 2MZJ A;  5F0W A;  1QVF R;  3BDE A;  1KKH A;  1FCA A;  2AHO B;  1I3O B;  3CVK A;  4OZ3 A;  3ZZP A;  2HHT A;  3QRP A;  2KRB A;  3I5B A;  3NG8 A;  1SC3 B;  2HHH J;  2GAH C;  2KTQ A;  3MM5 B;  4NCG A;  4J9N A;  4R0E A;  2AV5 A;  5IZH A;  5AE2 A;  3OUY B;  1PO6 A;  5HI7 A;  2MY7 A;  2DIU A;  1KHW A;  4LRA A;  3NXZ A;  3QZ8 A;  5DZ6 A;  3K2Y A;  2LA6 A;  4DV2 F;  1UJ4 A;  2JFD A;  4CO4 A;  4DF4 A;  4DV3 J;  4DN0 A;  1HNZ J;  4C8L A;  1QDU B;  4LIW A;  3LF0 A;  2WCX A;  2DHX A;  2ZJQ Q;  3PYF A;  3HVT A;  1N56 A;  2B7C B;  1RAJ A;  2WBM A;  4HL9 A;  1Q7Y T;  2OPS A;  2P8I A;  2W2N P;  3DGP B;  2YWE A;  2CPD A;  2ADB A;  3R7S B;  2WW8 A;  2UUT A;  3IAM 9;  4PWU A;  2CNN B;  3UPF A;  4KHM A;  2XLJ A;  2IM1 A;  2B5J A;  4JI0 F;  2JZ5 A;  2Q3P A;  2R8I A;  1ULR A;  1YHQ S;  1N6Q B;  2LU2 A;  4CCH A;  5EN1 A;  4RW6 B;  2CZ9 A;  3DLG A;  1GXL A;  4LFB J;  1KQK A;  2MY8 A;  5EWG A;  4RUC A;  2K7K A;  2ZWP A;  2QN6 B;  1R8P A;  2N7C A;  1C0T B;  5HAO A;  1IM6 A;  4LF7 F;  3ENV A;  1U26 A;  3HHK A;  3EGW B;  1UA0 A;  4DV6 J;  3DLK A;  5L1K A;  1KWM A;  1S79 A;  1IJE B;  5GAE U;  1HAR A;  3IC1 A;  1VC6 A;  4ZA1 A;  3PZP A;  1KLM A;  1WHV A;  1AXQ A;  5BR8 F;  1QE1 B;  4I2P A;  5C25 A;  1D9F A;  2JEJ A;  2XQC A;  3QLH B;  2WZ1 A;  1C4C A;  4X66 F;  1X0F A;  3GE9 A;  3O2I A;  1KTV A;  3CJK B;  3F56 A;  4KFB B;  3P96 A;  3P5T L;  4DFK A;  2ZE2 A;  2EKY A;  5H9E J;  1MWZ A;  1EAR A;  4ZVU B;  2Z8Q A;  2XS7 A;  5CYQ B;  1SXL A;  2JX2 A;  4KSE B;  5KFG A;  1KBR A;  4U96 A;  4QWD A;  3F41 A;  1LKZ A;  2JC1 A;  4OZ1 A;  1QJH A;  2UVR A;  1HMV B;  1U1R A;  2J9D E;  5A8R A;  2MB0 B;  4Y2A A;  5LXR A;  1U45 A;  1SQF A;  4IYQ A;  4KH1 B;  1W25 A;  2WVD A;  4OQJ A;  1SC4 B;  4PG5 A;  5B0F A;  1K47 A;  2VIH A;  5G4D A;  1HQE A;  3W60 A;  4NXN J;  1N36 J;  3NCP A;  2O66 A;  4C11 A;  2UXB J;  3UFC X;  1ZAW A;  3WIV A;  4ZIT A;  3HFZ B;  4XPE A;  1RIS A;  4GVL A;  4QIV A;  4RBT A;  2LEB A;  2AYB A;  2Y8W A;  4WXW A;  1F3F A;  3MR2 A;  3AH6 A;  3TVZ A;  2BJ9 A;  4J9S A;  3CME S;  2O67 A;  3LP0 B;  4XDD A;  4K7Q A;  3CB4 A;  2DNG A;  3SXL A;  1X5T A;  2LEA A;  5I3Q A;  2ASD A;  4NL5 A;  4CLK A;  1Q81 T;  1IKW A;  3R6G B;  5DDP C;  2Q66 A;  3ULH A;  2BVZ A;  3CCJ S;  3M8S A;  3HHN B;  2HFN A;  3AA9 A;  2HGL A;  2WON A;  5HVG A;  5CD4 A;  2FTR A;  3BDP A;  3OSP A;  4OJ3 A;  2C1E B;  4K4U A;  2CDQ A;  2KI2 A;  1BE4 A;  4LIR A;  4YDD B;  1YRU A;  4PAB A;  2DBB A;  2NQP A;  5HMW A;  3HD1 A;  4R8U B;  1UL3 A;  3M6W A;  3CC2 S;  1SKS A;  1C0U A;  2BE2 B;  4WJB A;  2FHJ D;  1NXI A;  2KKH A;  4C97 A;  4BLG A;  2BM0 A;  5DO2 A;  5KFB A;  2VQE F;  1SJ1 A;  3C2P A;  1X5P A;  3CCV S;  2CPJ A;  3UVJ B;  3E51 A;  3KTQ A;  4BWM A;  4ED2 A;  4C48 A;  2R2U A;  5HQ8 A;  3OTC A;  2L41 A;  2E5L F;  3PFE A;  4ED6 A;  5CAA A;  2OH2 A;  1YK9 A;  5G0R B;  1W2B R;  3PKM A;  3R5D A;  2LEC A;  3T6J A;  5CZV A;  3THT A;  4LF1 A;  3OJU A;  4DV5 F;  4DV1 J;  4M5G A;  2I5J B;  4WK3 A;  1R0C B;  1RHU B;  1S6U A;  2B9Y A;  2J5A A;  3MMB A;  2W24 A;  5ETT A;  3CMQ A;  4OYO A;  2FJA B;  1TV6 A;  3RBE A;  3M2R B;  1CJK A;  2OAU A;  1FO1 A;  1NM2 A;  1Y00 A;  3DDI A;  1BXN A;  2B6A A;  4JV5 F;  3SBM A;  1SCJ B;  2DH9 A;  1FDN A;  1OYE A;  2Q1L A;  2CNO B;  3MMA A;  1DQ9 A;  1J5O B;  5HO4 A;  2HGN A;  3H2L A;  4QQB A;  4CLF A;  1DTT B;  4F8R A;  2NXU A;  4IQM A;  2XO7 A;  2F8M A;  2BKN A;  4WII A;  2ZOM A;  1NK9 A;  2FYX A;  1XNQ J;  1LNQ A;  4Y2K A;  2PA8 D;  1NHV A;  5U47 A;  3DLH A;  1ZZN A;  2CNL B;  4A46 A;  1KP6 A;  4X65 F;  4J9V A;  3JYT B;  3M9O B;  2Z0G A;  1M0S A;  4ER8 A;  4F7V A;  1NZ8 A;  5ETP A;  1TU0 B;  1FWK A;  4OYX A;  5LM7 E;  3ZZY A;  2JC0 A;  1VK3 A;  1P1L A;  2UUB J;  3QWU A;  3C15 A;  2HQ3 A;  1KQS R;  1ZET A;  3CO0 P;  4LT6 A;  1MMN A;  1WC5 A;  2AX0 A;  2CZ4 A;  3HVA A;  3QGI A;  2ASL A;  3IFE A;  2KN4 A;  5L46 A;  4YOE A;  4XDC A;  1WF0 A;  4HEA 9;  2ROE A;  4UZB A;  1XR7 A;  2BOA A;  2V6A A;  2JLF A;  4D3H A;  4UQG A;  3AA8 A;  3R5G A;  1HQU A;  4KB7 A;  4USM A;  2W2Q P;  4B3S F;  3BSA A;  1FKP B;  2J7K A;  3MFH A;  3PO5 A;  4K5S A;  4ZVE A;  3NNA A;  2QLB B;  1T3O A;  2UVV A;  4B3T J;  1R0A B;  2ZH3 A;  4TLQ A;  1M5P C;  2MQM A;  3DRS A;  5L1I A;  3TNV A;  4F3Q A;  3H7H B;  3UD4 P;  4RR5 A;  2XB2 D;  4CT9 A;  1U1Q A;  1KSP A;  4I56 A;  3FMW A;  1MNE A;  2PT0 A;  2Z57 B;  4TY8 B;  2DEI A;  1VQO S;  1SJR A;  1NJZ A;  3AJ2 A;  4DL0 C;  3CIM A;  5KFM A;  4RBU A;  1C4A A;  4C0O C;  5JJB A;  2PGC A;  2F4F A;  4NYO A;  3A3N B;  3OUY A;  2GGP B;  3FZ2 A;  3NEK A;  1F1B B;  5HSP A;  5HLF B;  1NK7 A;  1YRX A;  1Q79 A;  2HHQ A;  5SUH A;  1S97 A;  3AAW B;  2BDP A;  4WFA Q;  3ENA A;  3CC7 S;  3DYA A;  4CO1 A;  3A8I A;  2PI5 A;  4FPR A;  2AD9 A;  4A8S A;  4HDH A;  2ZFH A;  2R7S A;  4EO8 A;  1XWL A;  8AT1 B;  4C0H A;  3W63 A;  2M9K A;  2VG6 B;  1ZA2 B;  5FLX U;  1S4F A;  1K0T A;  2C3O A;  1N6Q A;  2WB4 A;  2ZUG A;  3IRX A;  5ITH A;  1WKJ A;  3N6M A;  3DXS X;  3BYP A;  3KUG A;  1FFW B;  4LRE A;  3AD7 C;  4RW6 A;  1IBL F;  4QR0 A;  4NOH A;  1HW8 A;  1RCX B;  1VRU A;  5KG5 A;  1S0M A;  4I67 A;  3BKU A;  2IJR A;  1C0T A;  3I9V 9;  2RUG A;  3W1Y C;  2M88 A;  1EET A;  1AFJ A;  2OPQ B;  4F4W A;  3FZB A;  5ETV A;  1S6Q B;  1LWX A;  2RSQ A;  2VF3 A;  3MPD A;  3M8Z A;  1LFW A;  1LOU A;  3MEG B;  4G1I A;  1Q8B A;  3BB5 A;  4P74 A;  1VDH A;  1Y3K A;  3BSO A;  4ZPT R;  1QE1 A;  1UP1 A;  1TZ0 A;  1KD1 T;  3GJR B;  4J7C A;  3A12 A;  3MEC A;  3SQG B;  3LAL A;  4Q45 A;  3W9H A;  2RJZ A;  3D6F B;  4O3S A;  3DC2 A;  5EWE A;  2AX1 A;  1JX4 A;  2CPH A;  2KB2 A;  3BZQ A;  5CYQ A;  2ATL A;  4B9T A;  1Q0N A;  1AW0 A;  1S77 D;  4FNH A;  2IM3 A;  4OX9 F;  1YZ6 A;  3UNY A;  2KJW A;  4A8K A;  5K5M A;  2MSS A;  5HBM A;  4MT1 A;  3QSI A;  2L48 A;  1KVJ A;  3MTJ A;  5DGB A;  4ILL A;  4KGX B;  3OL9 A;  4NLD A;  2GVD B;  3WIU A;  1FJG J;  1ZBT A;  4EI2 A;  2MKJ A;  5IM0 A;  4WIQ A;  4OI0 A;  3LPE A;  3I87 A;  1KON A;  4MK8 A;  4UTG A;  3OW2 R;  1F9E B;  3ILI A;  5B0D A;  1HYS B;  2RRA A;  4ETX A;  2BKO A;  4EYI B;  1YJ7 A;  4K0K F;  2CJ9 A;  1VBZ A;  5AJ3 F;  1D3W A;  1FES A;  1T8E A;  2KM8 B;  3WDO A;  2M2B A;  1FK9 A;  4ZLL A;  2I0X A;  4QBU A;  2UXD J;  2ZD1 B;  2XZW A;  2QE5 A;  3T1H J;  1JJ4 A;  3L3C A;  2UUA F;  3MCN A;  4N8O A;  1UZH A;  2HWI A;  4RUB A;  1UJ5 A;  3I82 A;  2CPI A;  1S9E B;  1T9W A;  3IWL A;  2E5I A;  2MKH A;  1JNZ B;  3TUP A;  1HD0 A;  3OLA A;  3G6E S;  1Z4U A;  1CBK A;  4AXJ A;  3PRD A;  3GFH A;  4IRD A;  2AIR B;  5D6G A;  2DGV A;  4L74 A;  1UVJ A;  4OHY A;  4DPW A;  3DFE A;  1Y0H A;  2RML A;  2X1B A;  5HRO A;  4X84 A;  2FJV A;  2LDI A;  2KH9 A;  4EEY A;  4J37 A;  1RWP B;  1DTQ B;  3I4P A;  3CMA S;  3RBZ A;  2RU9 A;  2EWH A;  2WRM A;  3VAL A;  2CJK A;  4HI1 A;  4A8Q A;  2ERR A;  1S4E A;  3J80 U;  2LLZ A;  2IYI A;  2Q6C A;  2HBZ B;  2BE7 D;  4ZP8 A;  4ZVO B;  3UVJ A;  1JXE A;  3BS9 A;  1UMJ A;  3KG4 A;  4YDX A;  2EFQ A;  2DGT A;  5GAE I;  2A0F B;  3DOL B;  3I4H X;  3SCI E;  1S9F A;  1TEL A;  4CO5 A;  2VIC A;  2FHK A;  3AY0 A;  2DKO B;  4DQQ A;  5G0R A;  1VBK A;  3VGV A;  2MHN A;  3MGJ A;  1S6P B;  1N33 F;  1U4B A;  5CZX A;  1PJ6 A;  3T9Z A;  2HHS A;  3MEE B;  4JI2 J;  2YX1 A;  2G0J A;  1VCT A;  4J9M A;  2D69 A;  1GXU A;  3C6U B;  3OXF A;  4IKA A;  2F40 A;  4Z7C A;  4X4U A;  3M2R A;  1SV5 B;  4KC5 A;  2JHE A;  1R3N A;  4B3R F;  1FRX A;  1RE1 B;  1XMB A;  3ZZT A;  1HR0 F;  1DLO B;  4FS2 A;  1OY8 A;  2R2T A;  4DF8 A;  3IR6 B;  4HTI A;  2B7B B;  2DD8 S;  5GAH U;  1H0H B;  2B51 A;  4QWB A;  4NXM J;  2HQF A;  1S1U B;  4X4T A;  2G9O A;  4JI7 J;  4XTT A;  5DG9 A;  4B08 A;  4JI1 F;  4O3R A;  4DCO B;  3I9Z A;  2YKN B;  1IJF B;  3PEJ A;  1PIE A;  5KFS A;  4DQS A;  1L3S A;  1HQ2 A;  1AUD A;  3DMJ B;  2H5E A;  2AGO A;  3JYT A;  2HAF A;  3D3C J;  3H98 A;  2YWK A;  2FC8 A;  1CQM A;  2CZV C;  1TFW A;  3TAR A;  4DX8 H;  3MDF A;  4A8Y A;  3FSY A;  2ZM6 F;  3QID A;  4KKO A;  1YLX A;  3O3L A;  1GNK A;  1RWW B;  1Q16 B;  2XLK A;  2CJX B;  2WW4 A;  1XMO J;  3R8Y A;  4OYB A;  4WKR A;  4WTO B;  1EKS A;  5E0O A;  2PEB A;  3M05 A;  3M30 B;  3SI8 A;  4JUZ A;  2MZQ A;  1IKV B;  3ENQ A;  5E7O B;  4GRS A;  1L3K A;  1U47 A;  3BM7 A;  2RDJ A;  1RT1 B;  5CQG A;  3SDE B;  1LK5 A;  2QLW A;  1Q53 A;  4ATN A;  4IFV B;  4RLE A;  3KJV B;  3MCS A;  2BJD A;  4C8N A;  2OI2 A;  2GNK A;  3DRY A;  2YNG B;  1YBT A;  4NLG A;  4LRD A;  3QT6 A;  3H90 A;  2VZ9 A;  3EZU A;  4LF9 J;  5DQG A;  3X1L B;  5CYJ A;  3CJ5 A;  4ZVT B;  3OVB A;  1MU2 A;  5BYQ A;  2AW0 A;  4DV7 J;  1R0A A;  5H9E K;  2BQ3 A;  3BGO P;  4JV0 A;  3R1H A;  3ILL A;  4ZJO A;  4DSI A;  5HP1 B;  1N34 F;  2MJU A;  4P2S A;  4TY8 A;  1T9T A;  4OIX A;  2ZHA A;  3NOC A;  5IWA F;  4LF2 A;  2DNL A;  2RF2 B;  1NK5 A;  2GGP A;  4AFF A;  2YWF A;  3HSG A;  4JI5 F;  2AZ1 A;  2LQJ A;  1GAO A;  1QAJ A;  4ZDN A;  5LMN J;  3SCJ E;  3M2U B;  2DNY A;  2KZZ A;  3H42 A;  1M90 T;  3F44 A;  1XMQ J;  3PDN A;  2YPZ A;  3W9J A;  1T11 A;  3QGG A;  2ZC3 A;  1LEO A;  3PFO A;  1APS A;  2F9D A;  2MMY A;  2XEX A;  3V6J A;  1U1L A;  4ZPV R;  4FKX A;  1DRZ A;  2GX8 A;  4WKY A;  1VOM A;  1HW9 A;  4IO9 Q;  2NPF A;  5KFT A;  4WYL A;  4OHW A;  4IOC Q;  3N01 A;  2GHV C;  1X4C A;  4YB6 A;  2DY9 A;  2VA2 A;  4LSN A;  4TY9 A;  3KWM A;  1X9S A;  3GR1 A;  2MQ8 A;  1WHW A;  4KR0 B;  3KHR A;  4PG8 A;  1U25 A;  3M6X A;  2VBY A;  4NA2 A;  5KG7 A;  4QWE A;  5KG3 A;  2OPQ A;  3CD0 A;  1S6Q A;  4NYP A;  3RB3 A;  4OX6 A;  4DDF A;  5DG8 A;  4JI3 J;  1Q7L B;  3MEG A;  3BBC A;  3GSI A;  2F3J A;  2Z2Y B;  1ZM9 A;  2V0N A;  2ZKT A;  4MMO A;  2XY5 A;  2QSF A;  3MPW A;  2FPH X;  2GHP A;  3PJ9 A;  1SBR A;  4DQR A;  3AD9 C;  4CO2 A;  3W5Z A;  3SQG A;  3ILJ A;  4PG4 A;  4WF9 Q;  4ICL A;  3MCM A;  2YH0 A;  4ED0 A;  1N5Q A;  4CO3 A;  5K8P A;  4URQ U;  3P3D A;  4RL1 A;  3BH6 B;  1D9A A;  2Z2M A;  3RW7 A;  2M52 A;  3R5B A;  2PD1 A;  3KDO A;  1H73 A;  1IXK A;  3FQK A;  3HHL B;  1XJW B;  4NLR A;  1H74 A;  5LJ5 Y;  1QD1 A;  3B4M A;  3C16 B;  2D3Z A;  5KG6 A;  3QJP A;  4GKJ J;  4I69 A;  1RP5 A;  1KEK A;  2IBK A;  3QIP B;  2GVD A;  4QZV B;  4M5L A;  3AD8 C;  2JWN A;  2CPZ A;  5JVH Q;  1UWA A;  1CJT B;  2ALY B;  3HD2 A;  2FZC B;  4IH6 A;  5KFH A;  5A2Q Y;  3OVA A;  1HHS A;  2HFO A;  3QFH A;  3W64 A;  3I0R B;  1OPZ A;  2ZD1 A;  1R27 B;  5B7W A;  5KFL A;  3M6V A;  4NML A;  2NZC A;  2W7P A;  4ZKA A;  3QYY A;  4J5O A;  2DVI A;  4MKV A;  1TUG B;  1RHJ B;  3PIO Q;  1FDA A;  3W3S A;  4AE5 A;  1UJ6 A;  1PCA A;  1U2F A;  3MMC A;  4Q8E A;  3SV3 A;  2NUH A;  4M5H A;  4JOU A;  3MEK A;  2VL1 A;  3QAT A;  1YDL A;  1XQI A;  3ZO7 A;  2AEJ A;  3RAX A;  2CXE A;  2CVI A;  1QLN A;  1OWX A;  5DGA A;  2B3T B;  4NLV A;  1DTQ A;  2CQG A;  5KFD A;  2YKQ A;  4DUY J;  3VCD A;  4USW A;  2C2E A;  2BEF A;  3EGN A;  4RO0 A;  1Z1Z A;  1YI2 S;  3VQT A;  1VRT A;  4C9D A;  2OPP A;  1S1V B;  2J0Q D;  5F9N A;  2XMW A;  3LP2 B;  1OMS A;  3L7U A;  4L75 A;  3PR5 B;  2AQ4 A;  2D9O A;  1SKU B;  1YJ9 S;  1WEL A;  4PEO A;  4M95 A;  1WF1 A;  5CH7 B;  1FJE B;  1UCN A;  4RW8 B;  3G6Y A;  1KHV A;  4H4M B;  1TFY A;  4RNM A;  4C3K A;  4X62 J;  2WVE A;  3HMJ G;  2EKN A;  5EGY A;  3OSN A;  3DOL A;  2QFI A;  4B02 A;  3CJR A;  3KLI B;  1U2C A;  2VFS A;  3EIC A;  4DPX A;  4CT8 A;  4FYW B;  1YVF A;  1VC0 A;  4AQY J;  1SJ3 P;  4I4B A;  1X5S A;  3MR3 A;  2XSF A;  1S6P A;  3MR5 A;  4WU2 A;  1RA7 A;  1TKX A;  2DXF A;  1VQL S;  1MW7 A;  2CQC A;  5CA5 A;  3H59 A;  3C6U A;  1X4F A;  4N8N A;  1SV5 A;  3LAK A;  4DR6 J;  4AL6 A;  3DDK A;  4RKU C;  1FRM A;  2HVH A;  2FLL A;  1SQG A;  5D4P A;  3T5H A;  4CI0 B;  4DLG A;  3NBP B;  4ED1 A;  3C14 A;  3VAF A;  4FXW A;  4AT1 B;  2XYH B;  2HVI A;  3M8P A;  3HUL A;  1S1U A;  3W65 A;  2G4B A;  4RUH A;  1WC4 A;  2P9C A;  2MLX A;  2IYG A;  4J90 A;  2N3L A;  5BYS A;  2HHX A;  4JI4 F;  5C7P A;  4IQX A;  4DSL A;  1AZS B;  2DRA A;  2MLZ A;  1FDD A;  4B9N A;  2MZT A;  2GFF A;  2IVM A;  2LQB A;  2E44 A;  3GYN A;  5SZT A;  4N76 A;  1UVN A;  1T02 A;  1YQH A;  3UI3 A;  2P6S A;  2QTW A;  3TAM B;  1Z2L A;  1CJV B;  1GMV A;  2RIL A;  1BC6 A;  1F5A A;  3M30 A;  5CAB A;  1PJ5 A;  3K89 A;  1IKV A;  4DV2 J;  3FSX A;  1RT1 A;  1JIH A;  5A8W B;  3Q8Q B;  2XMV A;  3CWJ A;  2KT5 A;  3GP9 A;  4OHV A;  4IFV A;  4ZIV A;  2IMW P;  1QAX A;  4RW9 B;  2YNG A;  2EPI A;  3DGV A;  1TK0 A;  2G1H A;  3PVX A;  2D9P A;  4ANE A;  3M32 B;  1RWM B;  1WI6 A;  3W9I A;  3G82 B;  1Q82 T;  3M2V B;  2CRL A;  4ES2 A;  3OXG A;  3HCX A;  4JI0 J;  2DIS A;  1Y11 A;  2BAC A;  4OHX A;  2ZOF A;  4DL3 A;  1JLA A;  3HHL C;  5A0Y B;  4LR8 A;  1NCL A;  1K1S A;  4YFU A;  2Y3Y A;  4WZM A;  1RT4 B;  5HP1 A;  5KT5 A;  3G8Q A;  3B8H A;  2CQD A;  2AJQ A;  4CTA B;  1Q4R A;  1BMQ B;  5LJ3 Y;  2FUG 9;  2BBE A;  4ILR A;  2CPX A;  4LF7 J;  3KK3 A;  5KFY A;  1RAB B;  4UOG A;  2NXN A;  6AT1 B;  2ZKU A;  1J5E F;  1L3T A;  2DNH A;  4UQT A;  2ZBP A;  1NPR A;  2BQU A;  1MMD A;  3H2V E;  1NME B;  2NXC A;  3HJV A;  2OEJ A;  5DLF A;  2DIT A;  2LU1 A;  5BR8 J;  1BGX T;  2MGZ B;  5GAG U;  3D1Q A;  3Q8R B;  3KG0 A;  3PW7 A;  4Z37 A;  4Y2M A;  4MKB A;  4WFY A;  3GCX P;  4X66 J;  2KG1 A;  3G6V A;  2Z30 B;  2B4P A;  1IN0 A;  1ZPV A;  4LF5 F;  2NPI A;  1RBO B;  2HIQ A;  3UNG C;  5GAH I;  1HPZ B;  2K1R B;  3PXG a;  3V81 B;  2IY5 B;  3N79 A;  3ELH A;  1NDP A;  3BQ0 A;  2PC6 A;  2OEK A;  4PZV A;  4JB8 B;  1EIY B;  5A6W A;  5DS7 A;  2Z2Z A;  4U95 A;  2YX7 A;  1IR0 A;  1WG1 A;  1F0X A;  4XO0 A;  1Q5V A;  4AYB D;  4KPY A;  2DTJ A;  3OV7 A;  4UST A;  1N0U A;  2QT7 A;  4ZIW A;  2YNH B;  1KNZ A;  3OBI A;  4C8Y A;  3NCQ A;  1N32 F;  3FJ2 A;  4G65 A;  3MM9 B;  4OV6 A;  4DR2 F;  1EB0 A;  3NKY A;  3L4B C;  2LP4 A;  2F7V A;  5F8J A;  2XY6 A;  2DO0 A;  4DX5 A;  4ZP9 A;  1BLU A;  1VMB A;  4EWT A;  2C3M A;  2QEX S;  3CJ8 A;  3M8Y A;  3PRB A;  2RB7 A;  3CO9 A;  4HLB A;  3NGR A;  3WC2 A;  1NJY A;  4U7U K;  3RB6 A;  4RU2 A;  4YY3 F;  3PJW A;  1B0T A;  1M1H A;  1U48 A;  4DPY A;  3AT1 B;  3EXC X;  1U0H A;  2Y1J A;  4OI2 A;  3E01 B;  2QL5 B;  3OFF A;  4K8R A;  2HLT A;  3CDB A;  1CC7 A;  3TVY A;  2XY7 A;  2I1R A;  1NPK A;  2ZH7 A;  2VUG A;  3ITH B;  3TX8 A;  4Q0B A;  2MTL A;  3QIP A;  3OQ2 A;  3DI6 A;  1PJ7 A;  2V69 A;  1CJT A;  1RT7 B;  2AP6 A;  4ZN3 A;  1KVI A;  2QMU B;  3UDC A;  3I0R A;  2KHC A;  1FKO B;  1VS3 A;  2VQE J;  3G6X A;  2X51 A;  2Y0S D;  3KXD A;  1HWU A;  1LXJ A;  2E5L J;  5EHH A;  2HWH A;  4CP5 A;  4KT0 C;  3Q83 A;  3AOA A;  3FCV A;  2BX6 A;  5D78 A;  2Q43 A;  2XCP A;  2MJN A;  1KC8 T;  1VQ8 S;  2GJI A;  1SB6 A;  5B0C A;  4DV5 J;  5F41 A;  3DDN A;  2XWY A;  1RTI B;  3FSI A;  2KYX A;  4TYB A;  2MYF A;  4ZLN A;  2W9C B;  2XMT A;  1VLY A;  2V8G A;  1HKA A;  2ZZN A;  2C3U A;  3ZZZ A;  5L1L A;  3FQL A;  1KR4 A;  1UPP A;  4BHQ A;  1S1V A;  5J2P B;  1PC4 A;  4JV5 J;  4KGV B;  3LP2 A;  1K0V A;  5B08 A;  1XBW A;  5K8O A;  1SUQ B;  3GG1 A;  3P6Y C;  4F50 A;  4RW8 A;  4LFA F;  1ZA1 B;  4FP9 A;  4H4M A;  3ICL A;  4ZJQ A;  3M4X A;  3G4S S;  2RQM A;  3M8Q B;  4UT4 A;  4RU9 A;  4OJ1 A;  3IG1 B;  4J9R A;  7FDR A;  2KDO A;  4X65 J;  1NDC A;  3I55 S;  2DH7 A;  3NY0 A;  2IA6 A;  2FQQ B;  2QC3 A;  4N7T A;  3O6Q A;  4K2X A;  3KFW X;  2WOM B;  1F6T A;  2BJ3 A;  3R5C A;  3KLF B;  2W4C A;  1HNI B;  5E33 A;  1RU1 A;  3DRX A;  1H6K X;  5CYM B;  4F4X A;  2DCL A;  3PAC A;  3W2V B;  1GK8 A;  5H1S V;  3HJF A;  2DR6 A;  4IDK B;  4RW7 B;  1VK8 A;  1VJQ A;  2HNZ B;  2WB1 D;  4CNY A;  2BW7 A;  2R8H A;  4FYX B;  2VH7 A;  3L7O A;  1B7F A;  3J7A N;  1JLB B;  2BR0 A;  4A8O A;  5K8M A;  1S48 A;  4ZOS A;  2M7S A;  1IKX B;  2AU0 A;  2O01 C;  4LVO P;  3ZNU A;  2JEF A;  1UW4 A;  2QA4 S;  4PRF A;  3NBP A;  4O3Q A;  3OFG A;  3PNI A;  1G1X A;  2CYY A;  5J2M B;  3WZ0 A;  1XK8 A;  2XZD B;  4IOB A;  3JSY A;  3O8W A;  1S9G B;  2CQH A;  4OMF G;  3KYL A;  2LXF A;  4PXE A;  5DLG A;  2OTJ S;  3GFY A;  1TUV A;  1AZS A;  4E0D A;  1Q8K A;  3VAK A;  2F5G A;  4E2F B;  4LQ9 A;  3IA0 A;  2CPY A;  4H4K C;  4ZPW R;  4DL7 A;  4F4Z A;  4LR7 A;  2ACY A;  3TAM A;  3KLG B;  3TAQ A;  1FX4 A;  1SVD A;  4K2J A;  4X64 F;  1CJV A;  2OPS B;  2XZT B;  1RWN B;  2UV8 G;  2HQC A;  3V6H A;  1CLF A;  3B82 A;  3T6B A;  5J2Q B;  4TVA B;  4N77 A;  1KDN A;  1P9Y A;  3SSQ A;  3TX0 A;  4L3K A;  4CM0 A;  4Q43 A;  3J7Y I;  4OZL A;  1WUU A;  5DRK A;  2A10 A;  4RW9 A;  3HFK A;  2Z4P A;  5F9L A;  1Y9O A;  1NDK A;  4ECT A;  2GJF A;  3M32 A;  3Q8U A;  4LRF A;  2OO4 A;  1M5H A;  5KG2 A;  1T9U A;  3QSY B;  1IR2 A;  4A4J A;  2UU9 F;  3PTW A;  3V2U C;  3AQP A;  2QFJ A;  5A0Y A;  2ZOG A;  1IBL J;  4CWB A;  1YZ7 A;  1RT4 A;  2A3J A;  3HKZ D;  4W4M A;  2BRK A;  3DLK B;  2IM0 A;  2PE8 A;  2YKP A;  3EWG A;  4DR7 F;  3GIK A;  4CTA A;  1OY9 A;  3CCS S;  1WHX A;  4TQR A;  3ZC4 A;  5LT5 A;  3FFI B;  1UEU A;  2I8E A;  4PQU A;  1EP4 B;  3I0S B;  1NHK L;  2XM3 A;  2BJE A;  5D77 A;  3IS9 B;  2VG5 A;  2FD2 A;  3LGH A;  4JV2 A;  5ETR A;  1X31 C;  1O6X A;  1NJX A;  2DRB A;  2V2Q A;  2CA9 A;  3OL6 A;  4HH1 A;  2IC3 B;  3CW2 C;  4F0K A;  1RAI B;  2KU7 A;  4DPO A;  1FEE A;  3CCU S;  1ACM B;  4ED4 A;  4Q8F A;  1NK0 A;  2WAQ D;  2GVZ A;  1HPZ A;  1BUX A;  2K1R A;  2LYV A;  1BWV A;  3V81 A;  3L7P A;  2VOD A;  1HI1 A;  4FYY B;  2C2Z B;  4OX9 J;  3GIM A;  2XI3 A;  2QJ3 A;  4DQP A;  1IBK F;  4IG3 B;  1U7L A;  3JB9 k;  3OL7 A;  4BC7 A;  1U0S A;  3MM6 B;  4C98 A;  4NRT A;  3HHL D;  5D4N A;  5C2G A;  4X4N A;  3TR5 A;  2GC8 A;  2VPW B;  5JXS A;  4P9S A;  3QJJ A;  1U1K A;  2DR9 A;  3D1H A;  1RWV B;  3RBX A;  2M8D B;  1TP7 A;  3J7Z 5;  5CCM A;  2HFU A;  3RGI A;  2NCK L;  5KG4 A;  4K0K J;  2V5H G;  5AJ3 J;  2AGQ A;  4B3M F;  4CH1 A;  3GZ7 A;  3NAH A;  1FRH A;  5D4O A;  2UUA J;  3DCA A;  2BM1 A;  5A2Q U;  3BPS P;  4L3N A;  2F1F A;  2IAJ B;  1HNX F;  4ZCL A;  2ZZM A;  3DLE B;  1BWE A;  3UCU P;  4E98 A;  1X4H A;  2C3Y A;  1Q1K A;  2COL A;  3BO4 A;  4IFY A;  4DLE A;  3PX4 A;  1VI7 A;  3NGU A;  1LW0 B;  2HRT A;  1JK9 B;  4M5M A;  3G9C A;  1WG4 A;  3E01 A;  3EVM A;  1EKR A;  5D4L A;  2RQK A;  3PV8 A;  3W8G A;  2JFK A;  4ZPB A;  3L9Z A;  3J81 U;  3ITH A;  1WD6 A;  1D1U A;  3BH7 B;  1S7H A;  4QU7 A;  3DLJ A;  5DZ7 A;  4DR1 F;  1HLW A;  2OFH X;  4RNH A;  4ZS6 A;  3WQP A;  1NND A;  4DR4 F;  1RT7 A;  2U2F A;  4B9L A;  3TA1 A;  3MED B;  1XNR F;  4DCP B;  1RT6 A;  5T7L A;  1R8B A;  1D9D A;  3CED A;  4W98 A;  4KE5 A;  4DPT A;  1FA0 A;  5DET A;  1FKO A;  2ALZ A;  2B8Q A;  3MOJ B;  1TL3 B;  3R7N B;  4I6Y A;  4ILM A;  1IQZ A;  4YB5 A;  1H72 C;  4QW9 A;  4V19 X;  4OX8 A;  2MQP A;  1VLO A;  4GO7 X;  4F3M A;  3MMB B;  2VQF F;  4Y0F A;  2UXC F;  5HN0 A;  1TV6 B;  4ZVF A;  4DG1 A;  1GMW A;  1I5O B;  3EVW A;  1MRO B;  1R8H A;  1N33 J;  2HAI A;  4UF4 A;  1QVG R;  3HFV A;  4TXS A;  3NP5 A;  2LVW A;  3LWL A;  3PR4 A;  4X4R A;  5D0G A;  4KY3 A;  3MR7 A;  2HBR B;  1FNX H;  4X4Q A;  4PQA A;  3I56 S;  4URG A;  5IFM A;  4ED5 A;  2V63 A;  1X0P A;  2FY1 A;  4B3R J;  1N8R T;  4WZQ A;  2I6W A;  3CT9 A;  4YN3 B;  1HR0 J;  4USK A;  1RTH B;  5J2P A;  4QYZ J;  3BO2 A;  4OYM A;  5L9X A;  2OIH A;  5AXN A;  2J0W A;  2DGS A;  1JJC B;  2VFR A;  1OYD A;  3BJY A;  1NHU A;  2DHS A;  4GKK F;  1SUQ A;  7AT1 B;  2Y9H A;  2MHE A;  4QIF A;  5GME A;  4JI1 J;  4Y6I A;  2IRU A;  2R2R A;  2WVF A;  3VAJ A;  3M8Q A;  4Y65 A;  1ZM4 A;  4OYW A;  2QLX A;  2R42 A;  4QU6 A;  2DR5 A;  3HX9 A;  2WOM A;  3RU0 A;  1JJ2 R;  5F8N A;  3KLF A;  1AUS L;  2IDE A;  1HNI A;  4PPZ A;  2ZM6 J;  3BGL A;  5CYM A;  4F67 A;  4C3L A;  2MQQ A;  1RBA A;  3W2V A;  5GMK a;  4URS A;  1UA1 A;  2HW3 A;  1BQM A;  4Z7Y A;  1JLC B;  3BSC A;  4QW8 A;  3NGS A;  4O0N A;  3UW1 A;  3PG9 A;  4FVC A;  1JLB A;  3T19 A;  3RAM A;  2E66 A;  3FEZ A;  1SL2 A;  3JSR A;  1UZD A;  1U2R A;  2QLF B;  1B64 A;  2DJW A;  4J9U E;  2H5I B;  2ZH1 A;  4IUF A;  2NYH A;  4LFC F;  3ONQ A;  2UUC F;  4XPC A;  1R6V A;  1RT2 A;  2RRN A;  3C6T B;  3DRS B;  1P27 B;  2WVB A;  3N0V A;  2VD3 A;  3OL8 A;  4WU3 A;  3OJS A;  1OQ3 A;  1WEY A;  5J2M A;  4ZCM A;  2IFX A;  2RVJ A;  1S9G A;  1WOO A;  1H7W A;  2FVP A;  2U1A A;  3GJS B;  2MLY A;  2HIY A;  1VBY A;  3JS9 A;  2CQP A;  1N34 J;  4XIU A;  3PX6 A;  4FF3 A;  3AHP A;  3W7B A;  2HHU A;  3HF5 A;  2GW8 A;  3NOG A;  3IWX A;  3CJ3 A;  4CH0 S;  1JMT A;  4KGK A;  2QO3 A;  3DYA B;  2RQ4 A;  2CWK A;  2J9E A;  3QWP A;  4P73 A;  5IWA J;  1CPZ A;  3KLG A;  4UUW A;  2XHW A;  3D6H B;  4GO5 X;  2Y1L B;  1V5I B;  2QV6 A;  4FXV A;  3MAA B;  4JI5 J;  5J2Q A;  3PEH A;  2O1P A;  5LSR A;  2DNK A;  1X4B A;  2VDH A;  4PR6 A;  2AEF A;  1IWG A;  2EK1 A;  4G1Q B;  3GYX B;  2BMB A;  1YIJ S;  2XMU A;  1TL1 B;  3IRX B;  1R8A A;  1W7W A;  3HVW A;  1WKL A;  4B9U A;  2V4Q A;  1QSY A;  4P2M A;  5M2R A;  1WWH A;  1VRU B;  2PI4 A;  2V50 A;  5LL6 d;  3K58 A;  3A3O B;  2MST A;  4OV1 A;  1EET B;  3M9M B;  3GTY X;  1H2T Z;  2EC0 A;  2V8V A;  3NMR A;  2UV8 A;  5D0H A;  3TQ1 A;  4H4O B;  1DHM A;  1DAR A;  3A1Y G;  4OJH A;  1ZOT A;  2KXF A;  2C2R A;  2GQ2 A;  4OZ0 A;  2QZ8 A;  5HAT A;  3FFI A;  4ECQ A;  3MEC B;  4ZVP B;  3MPV A;  3PYE A;  2MKK A;  3CJQ A;  1EP4 A;  3I0S A;  1SH0 A;  1I1G A;  1UFL A;  4PXC A;  3IS9 A;  1DAX A;  1S0N A;  5HAN A;  2EFG A;  5AXK A;  1WI8 A;  4O0I A;  4M8L A;  1C1B B;  2YWH A;  8ATC B;  3LGM A;  3KHG A;  2CQB A;  2IC3 A;  1LV5 A;  3FEX B;  5HBM B;  3EPG A;  4DUZ J;  3E2E A;  3SEO A;  5CD4 H;  4CQ1 A;  4DR5 F;  1IM4 A;  4ZPA A;  2D3O 1;  5IM0 B;  2R7V A;  2K3K A;  4O4G B;  3HZE A;  2VU5 A;  3BRE A;  3Q24 A;  2D3O R;  1RWU A;  1CUL A;  3ZXW A;  1MLA A;  3OFH A;  2XS2 A;  4IG3 A;  3D6M B;  3OTO F;  4TN2 A;  2F4V F;  1FK9 B;  2MKS A;  2DB1 A;  3ZTQ A;  3MM6 A;  3SMZ A;  2BAB A;  3GIL A;  3KJQ B;  2JEI A;  1RSC A;  2LKZ A;  4A8W A;  3IXQ A;  4AL7 A;  3HZG A;  2R8J A;  4DS5 A;  1NKB A;  3K5N A;  4GMK A;  4BS2 A;  3BV8 A;  2QL9 B;  4USV A;  3CPW R;  3Q2S C;  3RB0 A;  2WSE C;  3IWN C;  3MOZ A;  1R7I A;  4CLZ A;  3CE8 A;  2XMA A;  1QM9 A;  1SKW A;  3BF4 A;  1NB7 A;  4KGM A;  5F3T A;  5HRO B;  4U67 Q;  1U6F A;  1H2U X;  2V68 A;  1W26 A;  2IAJ A;  3DLE A;  4LBH A;  5HJY A;  4MIB A;  1X4D A;  1TK5 A;  1LW0 A;  4R5P B;  1RTJ A;  1Y10 A;  2W4D A;  4NWB A;  3J81 j;  4ZHR B;  4DL5 A;  2XG8 A;  4FXD A;  4B9V A;  5KFE A;  2LCW A;  2ZBC A;  1WTB A;  1GT8 A;  2RH3 A;  1IUJ A;  3C19 A;  3CDA A;  2DGO A;  3TI0 A;  2A18 A;  2NS1 B;  1ICE B;  4FS1 A;  1KQG B;  5DG7 A;  3MED A;  3QPI A;  3MZI A;  4M5D B;  2YQ1 A;  3WBZ A;  2Q79 A;  4JP8 A;  3T41 A;  2QMW A;  2MQL A;  3CJ0 A;  2QX0 A;  5EWF A;  3UCZ P;  4K4Y A;  3H4B A;  1TL3 A;  2EBE A;  5KFR A;  2W8L A;  1WG5 A;  8RUC A;  5F8I A;  5L1J A;  1CG2 A;  4HHJ A;  2RDD A;  5HVF A;  2QGF B;  2W2M P;  5ETS A;  1MRO A;  2J0X A;  3ZZ0 A;  2GJ2 A;  2IVF B;  1NSP A;  1X4G A;  3BGF A;  2HHP A;  2KJV A;  4KIA A;  1V3S A;  4J9K A;  1FD2 A;  5THW A;  1BQN B;  4PKD B;  4NA1 A;  4Q2L A;  2VPX B;  3KUH A;  3K5M A;  4OYI A;  5E3A A;  2JEG A;  4F3O A;  4ZCI A;  2W2O P;  4PG7 A;  2BE9 B;  5KOX A;  5HK4 A;  3CUL A;  3T5K A;  2R4F A;  5DJB A;  2CFX A;  4YP3 A;  5LXY A;  1RTH A;  3M1V A;  4FPI A;  3IP0 A;  1HIY A;  1RHQ B;  4BDP A;  4QIG A;  2VJU A;  3KMS A;  3PM9 A;  2E9T A;  1B3T A;  3KK2 A;  1QAI A;  1Y5N B;  3OFE A;  3KK1 B;  3GJQ B;  3FBB A;  2I38 A;  2AJF E;  4DL4 A;  2P9E A;  4KKO B;  1B99 A;  2K8G A;  2VBW A;  3V4M A;  3JSM B;  5FJ4 A;  4JI4 J;  1KVK A;  3K8V A;  1UEK A;  3PRV A;  4Q2M A;  1S1T A;  2VC0 A;  2K3I A;  3JXO A;  1PAU B;  5DQH A;  1FXD A;  1J2V A;  4KHP F;  4TLR A;  4NZ0 A;  4I1T A;  1AYE A;  3Q2T C;  2FVS A;  2LQ9 A;  4ZVH A;  1XEZ A;  4Q44 A;  1S1X A;  3MM8 B;  2HSE B;  1JLC A;  4USH A;  1ARO P;  1FFS B;  1IBM F;  2P5V A;  2W7A A;  4B17 A;  1H98 A;  3IRW P;  2O5D A;  1UPM B;  1NKC A;  4OYZ A;  1UFW A;  4ID8 A;  2DNQ A;  3U27 A;  3BBF A;  1MU2 B;  4RPF A;  3MUR P;  5C24 B;  3C6T A;  3HDS A;  4KJI A;  4EK2 A;  3EYZ A;  4B9S A;  2HHV A;  1N52 B;  1EAY C;  4OYP A;  3EZO A;  3OTE A;  4M5N A;  1F3V A;  4RWW A;  2ROG A;  2DH8 A;  2W9B B;  4I64 A;  3DKD A;  3D6T B;  3I5C A;  1JLE B;  3DOM B;  1HHQ A;  2YXL A;  3D67 A;  4PUO A;  3FK4 A;  3SIP B;  3UE2 A;  4ZLJ A;  3ETO A;  2BQR A;  3RG6 A;  4A8X A;  3SV4 A;  2XYG B;  1TKZ B;  1D8Y A;  3VAM A;  1AB8 A;  1IBC B;  2E1R A;  2FB0 A;  3GQC A;  4R25 A;  3HT0 A;  3KG1 A;  1RTZ A;  4JI8 F;  1FEH A;  1J5E J;  2VBZ A;  2AT1 B;  2K06 A;  3D7S B;  1YIT S;  2V4J A;  3MAA A;  7FD1 A;  4N56 A;  2APO A;  2BKP A;  5DM6 Q;  1M5K C;  3DRP B;  4MKY A;  4DWI A;  3CDU A;  4ANC A;  4G1Q A;  1TL1 A;  5KFZ A;  4MFB B;  3D2W A;  5KTQ A;  3K8W A;  5HVH A;  2RUS A;  4GC6 A;  1G2E A;  3O44 A;  3HK2 A;  3HXM A;  4IG0 B;  3PW4 A;  5CXT A;  1T05 A;  4X4S A;  2MDA A;  2PA3 A;  4LSN B;  4LF8 F;  3IAS 9;  2DHA A;  3TJ9 A;  4RNN A;  1NK4 A;  3GFX A;  4LF5 J;  2E5J A;  4OZ5 A;  5E3C A;  1E6V B;  2VC1 A;  2OD6 A;  4Q5V A;  2ASY A;  1H38 A;  2NSB A;  5L38 A;  2ZH5 A;  5D0E A;  3S7R A;  1WAC A;  4G6V B;  2MEW A;  4H4O A;  1RTD A;  2LFV A;  2AGP A;  2BJ8 A;  1RAH B;  1X60 A;  4Y34 A;  2H54 B;  4ALZ A;  4LSL B;  4ICL B;  2DNP A;  1N54 B;  1N32 J;  4Y2C A;  2HK3 A;  2GIR A;  2HQI A;  1X7V A;  2H3E B;  2XWX A;  4DN9 A;  4DR2 J;  3HVR A;  2HVD A;  3NAI A;  2V8P A;  2AJ4 A;  4YME A;  2EW9 A;  1C1B A;  2WTF A;  5IT9 U;  3M9N B;  4ELU A;  4IRC A;  2V9K A;  2R7Q A;  5EX0 A;  4JI6 F;  4TU8 A;  4TKT A;  4HAC A;  1RI7 A;  3B4D A;  1V6H A;  1FNM A;  1S49 A;  4ZK7 M;  2ILZ A;  1V3R A;  4YY3 J;  1Y4Z B;  1KQF B;  1BHN A;  3EVO A;  3PHE A;  4O4G A;  1RQ0 A;  1RAG B;  2WHO A;  4IR9 A;  3WX4 A;  2CDR B;  4DV4 F;  1VQM S;  4F0H A;  5IQ6 A;  5J1E A;  1RLD A;  1FWP A;  1VQ4 S;  2OUG A;  1IVZ A;  3N28 A;  2C2O B;  4DFP A;  3ZTP A;  5J1P A;  3IGV A;  5FII A;  2QYC A;  4UY8 5;  4DMZ A;  1PYO B;  2DNZ A;  5E41 A;  2J8S A;  3FCW A;  4B3O B;  4BWJ A;  4QYZ K;  1CEZ A;  3QNW B;  2OEM A;  2OML A;  2X1G A;  3MMC B;  3M8W A;  3LA0 A;  3OHA A;  4QPX A;  4FDF A;  3HSJ A;  3K57 A;  4HR2 A;  2HVZ A;  4NLP A;  3GU0 A;  4G1P A;  4WP9 A;  3BGR B;  4B9M A;  4C8K A;  3FNN A;  4ZN1 A;  2DY1 A;  5B0G A;  2KZM A;  3SCL E;  4J9O A;  1VRT B;  4WFN Q;  3BSN A;  2OPP B;  4ES3 A;  3MUT P;  4R5P A;  5F3Z A;  4LF4 F;  3S01 A;  3TJA A;  3W5X A;  4NLT A;  2YNI B;  2DO4 A;  1B0P A;  2L3M A;  4ZHR A;  5E2Q A;  3PYG A;  2FHJ A;  3TYT A;  4HHH A;  4X4O A;  5K8N A;  3D28 A;  4EBE A;  2ZH9 A;  3T5L A;  2CQI A;  1UFK A;  1FVS A;  2KYZ A;  1WNE A;  3L95 X;  2ZNZ A;  1NEE A;  3GYG A;  2OGU A;  4DSF A;  3MAH A;  2F65 A;  1RWK B;  4DR3 F;  4PWW A;  3R2D J;  4M5D A;  1NPP A;  4LFA J;  4NX9 A;  2J76 E;  2FLP A;  4ZVG A;  1S72 S;  2H1Y A;  4S0M A;  3CCQ S;  1TKX B;  1Q8I A;  2EG1 A;  1RT5 B;  2FJE B;  4O44 B;  4NI2 A;  3Q8P B;  5KAK A;  1S0V A;  2LEP A;  1MSW D;  3J7A 1;  4K4W A;  2HBY B;  1RWX B;  9RUB A;  1VHI A;  4IH7 A;  4HKQ A;  1FKA F;  2Z58 B;  1JJH A;  1JLG B;  1OSD A;  1XC9 A;  2RD5 C;  2ADC A;  4AUK A;  2G2Z A;  5KFQ A;  1LK7 A;  3HKW A;  2E1C A;  4M5I A;  5K14 A;  2OP5 A;  2ZEJ A;  3TAP A;  1BQN A;  3CD6 S;  3C14 B;  3M8P B;  5IXU A;  2BZ2 A;  4ECS A;  1HBU A;  3EM1 A;  1YGY A;  4YQW A;  3UN5 A;  4CDI A;  5KFO A;  4V19 J;  2CJQ A;  4P75 A;  3BQ1 A;  2PMH A;  3US5 A;  2MPU A;  2HS3 A;  1YJW S;  1HHT P;  1EJ7 L;  2DRD A;  3LAN A;  5ETN A;  1PAE X;  2MZ1 A;  1B0V A;  3Q8S B;  2E1M C;  3E3X A;  3KK1 A;  2Y1I A;  3I6P A;  4LJM A;  1HNV B;  4ELT A;  1ITP A;  1IKY A;  4D3G A;  1SQE A;  3JSM A;  1XR6 A;  3GJT B;  2QSW A;  4RNO A;  3WC0 A;  4CZC A;  1B4S A;  1DQA A;  3TEH B;  1ZAX A;  2J9D A;  1CJU B;  2E29 A;  1O8B A;  5L39 A;  4P71 A;  1VQ6 S;  2ZHB A;  1KN6 A;  2V2Z A;  2EFV A;  4X64 J;  2JSX A;  3MM8 A;  2XI2 A;  3MF5 A;  4Y3C A;  1RT3 B;  2XLI A;  1X4A A;  1N48 A;  5EUH A;  2MZS A;  3D4J A;  4DSJ A;  3RRG A;  1PYS B;  5AXL A;  3TA0 A;  1MG7 A;  3NNH A;  1JLA B;  2F9J A;  3CUN A;  4UZC A;  5E3P A;  5C24 A;  2IM2 A;  1SC1 B;  2R3V A;  2H48 B;  1ZS6 A;  1RAO A;  2IVY A;  4OJG A;  2HWT A;  3ETM A;  1C2P A;  3VGU A;  4LF6 F;  1H3D A;  1NB2 A;  2W9B A;  4F2S A;  1MML A;  3CCE S;  3THP A;  4DX6 A;  3TEG A;  3IO1 A;  3KK3 B;  2UU9 J;  3DRR A;  4USJ C;  1LXN A;  1JLE A;  1HBM B;  3GV8 B;  3DOM A;  2OTL S;  2DGW A;  3PW2 A;  1L5U A;  1YWX A;  3CJS A;  2KM8 C;  1VIO A;  5M2P A;  4HT7 A;  4K4Z A;  4MTP A;  1Q8L A;  2R2S A;  1TKZ A;  4DR7 J;  2PDA A;  2D3U A;  4P2F A;  2B0G A;  2AYE A;  2N82 B;  1YJN S;  1VHF A;  3SFU A;  2N7Y A;  3TW0 A;  2XYP B;  3DRP A;  3VQS A;  2GIF A;  2OPR B;  5IT4 A;  3S8S A;  1B70 B;  4LSZ B;  2NYI A;  3KOA A;  5KFP A;  4MFB A;  2XO6 A;  1B7Y B;  1TAQ A;  4WK1 A;  4IG0 A;  3M7V A;  2QA1 A;  4EO6 A;  3D9B A;  3HPO A;  3EXY A;  3V6D B;  1U1P A;  4YHH J;  3FCH A;  1CQN A;  4JBC A;  3AOD A;  2CQ4 A;  3AXK A;  2ABY A;  2IA0 A;  1E6V A;  1VQS A;  3GWC A;  1JLF A;  1MWY A;  2VPZ B;  4JYA F;  2V2V A;  3QBC A;  2QG9 B;  1IBK J;  3QGH A;  3OLB A;  2FGC A;  1Q86 T;  1N5Y A;  3A4T A;  3FBE A;  2Y1R I;  1CS4 B;  3QO9 A;  3VGS A;  3QAE A;  2O3D A;  3F0N A;  3GR0 A;  3H2U B;  3CJ4 A;  2XNR A;  4P52 A;  4YB7 A;  4LQ3 A;  1PYT A;  1RHR B;  1NSA A;  3EGV A;  3QAU A;  4HDG A;  5EDW A;  4LSL A;  4DUZ F;  2CIM A;  1P8G A;  3LP1 B;  4LBI A;  4A8M P;  3PW0 A;  1I6J A;  4B3M J;  2WSC C;  5F8L A;  3BKT A;  3OPK A;  1I94 F;  2OEL A;  1U0H B;  1LWE B;  3JAM Y;  2GO9 A;  2RQC A;  2VBX A;  3GLJ A;  2K2P A;  3LUY A;  1HNX J;  4NLU A;  1TKT B;  2XMK A;  4DL2 A;  2BA9 A;  3GMG A;  5E5N A;  3UO0 A;  3G96 A;  4Q0B B;  1CC8 A;  2IMO A;  2JVR A;  3GCW P;  3JQJ A;  3DI6 B;  2XBP A;  2G1D A;  3CC4 S;  1S12 A;  4WE1 B;  2HVE A;  2EG2 A;  2DK2 A;  2HRU A;  4GC7 A;  3BO3 A;  4UW2 A;  2C22 A;  1FWL A;  3T1Y F;  3GG0 A;  1RYR A;  2ZJR Q;  4CLT A;  3RW6 A;  1FVQ A;  4DR1 J;  2WSF C;  5KFK A;  1U24 A;  4DR4 J;  2JLG A;  1RJJ A;  1XNR J;  4XAK A;  4B3O A;  4XK8 C;  4UOH A;  1ZTW A;  3J81 Y;  3Q8Y A;  4KGZ B;  3UR3 C;  2DGQ A;  2AMC B;  4DQI A;  1VQ7 S;  3I96 A;  3OXL A;  2R8K A;  3L09 A;  4NEZ A;  1Y5L B;  4KBI A;  5KFX A;  4BC9 A;  3BGR A;  2VQF J;  5BXI A;  1OJ4 A;  2UXC J;  3ISZ A;  4FYV B;  1X4E A;  4OI6 A;  3J7Y U;  2ZC4 A;  2JJ4 D;  2GZO A;  2SXL A;  4NRU A;  2YNI A;  3D0H E;  1D0E A;  3SCK E;  3GFZ A;  2ATC B;  4M5K A;  3T3F A;  1JKH B;  5A76 A;  2HMI B;  1DZ5 A;  3UCG A;  1XIQ A;  3DHW C;  1LWC B;  3MTK A;  4HT5 A;  3CSK A;  5IS2 A;  4WXO A;  4G3I A;  4YUD A;  2MQN A;  1VQ5 S;  1WC0 A;  2A1B A;  2R7T A;  1RU2 A;  1U6Z A;  3H5S A;  4GKK J;  3RAQ A;  1NDL A;  2RIJ A;  2J7W A;  3P5B P;  5IQQ A;  2NR0 A;  4PG6 A;  4FNI A;  4ZP6 A;  4J9L A;  1RT5 A;  1WOS A;  4O44 A;  1G6B A;  4OI4 A;  4TU9 A;  3QFW A;  4I68 A;  2VON A;  2JNJ A;  3HHE A;  4AL5 A;  3A3P B;  1SIZ A;  4WP3 A;  1JLG A;  2HRY A;  3AOB A;  3OT9 A;  2DHH A;  1RAE B;  1VFJ A;  3PO4 A;  4ED3 A;  1PBU A;  2FVR A;  1Q5Y A;  2V9W A;  4MIA A;  3LGN A;  4KO0 A;  3DN9 A;  1T95 A;  3THV A;  5HMZ A;  2HFV A;  2OFG X;  3UN3 A;  5DDR C;  2BJ7 A;  5HMX A;  1A9N B;  2R9L A;  4KPC A;  2MQO A;  4DCJ B;  2DHG A;  4LFC J;  1YSJ A;  2UUC J;  1VQP S;  1R89 A;  3MPY A;  1UVK A;  2E7V A;  3A8J A;  3P8B B;  4O3N A;  2W4P A;  2CAJ A;  1HWI A;  3U02 A;  3P49 B;  3H20 A;  2CQ3 A;  4QR2 A;  3ZZO A;  2YTC A;  2R7O A;  2W1B A;  2AWZ A;  1HNV A;  1KOO A;  1M5S A;  2YQ3 A;  2ZDP A;  5MAO A;  2B8P A;  1LWF B;  2H9Z A;  4IRK A;  5DM7 Q;  1N5V A;  3WX8 A;  2KVI A;  1ZM2 A;  5I42 B;  2HZV A;  3UD5 A;  2J8A A;  1TL5 A;  2KT3 A;  1CJU A;  3MUM P;  3MM5 A;  4KHR A;  1NJW A;  1WOP A;  1HI8 A;  2QLJ B;  2XSJ B;  2BAN B;  2RS2 A;  2AJ1 A;  2DNR A;  2V8H A;  4KYZ A;  2YH1 A;  2AYG A;  2H65 B;  5C5J A;  1T3N A;  2H51 B;  1F2H A;  1GTE A;  3D5M A;  1N0V C;  1RT3 A;  1KTQ A;  2OLW A;  1RLC L;  3R5A A;  2HQG A;  1M1G A;  4WPA A;  2EBG A;  3BR9 A;  1TUW A;  2N4C A;  4Y00 A;  1RA6 A;  3DGP A;  5A8K B;  4DL6 A;  1VQY A;  5IT0 A;  2G2O A;  3H5U A;  4DV0 J;  2D7S A;  2AF6 A;  1TTH B;  3KUE A;  2G0I A;  1FJC A;  2EEY A;  5C2C A;  3C46 A;  2L9D A;  2ZBQ A;  1PIL A;  1VBX A;  2J7U A;  4DZD A;  2KVQ E;  2VV5 A;  1U49 A;  3AOC A;  4C7Q A;  4FF4 A;  1NSK L;  3FDS A;  3QJL A;  5KFA A;  3QRQ A;  3BKF A;  4NE9 C;  2C42 A;  5B0E A;  1HBM A;  4PQU B;  1YG0 A;  2CPF A;  3G71 S;  3O1L A;  3DLL Q;  2QMX A;  2PMW A;  3SFG A;  1REV B;  3OR2 B;  2VG5 B;  4WFX A;  3MD3 A;  1PC5 A;  3G2X A;  5HJX A;  5ETQ A;  2G13 A;  1N88 A;  3CCW A;  3DOK B;  1UEV A;  1ZYQ A;  4K5R A;  3OR1 B;  2JLE A;  2QL7 B;  1RKJ A;  4EZ6 A;  5KG0 A;  1RAF B;  2HNY B;  1XTZ A;  2MZR A;  4O23 A;  5D3G B;  2GVZ B;  2OPR A;  4DBQ A;  2CWX A;  4IH5 A;  4WWS A;  4CLY A;  3MXH P;  3QLH A;  2M70 A;  1RAD B;  3N5F A;  2EXU A;  5F0U A;  4OZ2 A;  3ADA C;  4DFJ A;  4M63 A;  5D15 A;  4LMZ A;  2B9W A;  2XC9 A;  3CJK A;  4KFB A;  1WDT A;  4DI6 A;  1NAQ A;  1M5O C;  2PSZ A;  3V6D A;  1ZM3 A;  1MN7 A;  1JXL A;  3N5B A;  3TVK A;  2YWW A;  5KT2 A;  2RT3 A;  3TO8 A;  1A6L A;  4DR5 J;  1P9Q C;  2HS0 A;  1KLN A;  3NS6 A;  4Q7A A;  1HMV A;  3OTO J;  2F4V J;  3RZA A;  3O5T B;  1HNW F;  1CS4 A;  2R7R A;  1ZPW X;  4UOF A;  4NLX A;  2NXJ A;  4ECZ A;  2ZVS A;  1VR6 A;  2ZDO A;  1EHW A;  3ET6 B;  2XS5 A;  5H9F J;  1UVI A;  2FJB B;  1KFS A;  3HHD A;  2BXJ A;  2H4W B;  4K50 A;  3LP1 A;  1T9X A;  4QWA A;  4ZMM A;  1HWJ A;  2BJ1 A;  1FRI A;  1LQ9 A;  4IFY B;  5HQL A;  1QSS A;  3LP0 A;  4NLY A;  1LWE A;  4ZVS B;  4YR0 A;  3H40 A;  2B4U A;  1E6Y B;  3A8K A;  1TKT A;  2CJB A;  1FER A;  1GEH A;  3EPI A;  4MYT A;  5M2U A;  2R7X A;  4ZPC A;  1NZA A;  2JDJ A;  1JWW A;  3W66 A;  2H4Y B;  1UWB B;  3DM2 B;  4USU A;  2FHO B;  1VQ9 S;  4UOC A;  4AXI A;  4WE1 A;  2RHQ B;  4NZ7 A;  3ZFV A;  2OSR A;  1Y7P A;  1RT6 B;  4GVB B;  5T7L B;  3HP6 A;  1TMM A;  2OHD A;  2GMH A;  3RUB L;  1FJ7 A;  2CUY A;  3EJM A;  5KFU A;  2KFY A;  4R8U A;  4OHZ A;  4P2X A;  5GAD U;  2W01 A;  2F8H A;  4A47 A;  2BE2 A;  2FHM A;  2WK4 A;  3PY8 A;  1JB0 C;  4NEY A;  2D74 B;  4A48 A;  3JSB A;  3TJ8 A;  1NK6 A;  3KDN A;  4DU8 A;  2UVW A;  4DG1 B;  3FVY A;  1PSD A;  2AJ2 A;  1A7G E;  5F8M A;  2C28 A;  2GO8 A;  2ROP A;  2GMJ A;  5IC6 B;  2LMI A;  2DR7 A;  1RK8 A;  4I6W A;  1WEX A;  2KFN A;  3OD2 A;  2J0S D;  3NGK A;  2I5J A;  3UD3 P;  3R5J B;  1MN9 A;  2VFT A;  3R97 A;  3LTO A;  2WVC A;  1U1M A;  3GII A;  1RB0 A;  3FRY A;  2X1A A;  3CDW A;  3R3T A;  1L3V A;  3GIR A;  5BYR A;  5IV3 A;  1Q95 G;  4QCL A;  4RBV A;  1JKH A;  4U7C A;  4CRJ A;  4NCB A;  2HMI A;  5T41 A;  3VVT A;  1LWC A;  2V8D A;  4NMX A;  5KG1 A;  1M1K T;  4O4R A;  3LW5 C;  1J5O A;  1RDR A;  3Q8V A;  3BBB A;  3J7Z T;  4FBT A;  1XER A;  4ZPD A;  1DTT A;  3E8O A;  5EX3 A;  3MWB A;  1UVL A;  4DHV A;  1S59 A;  1FRK A;  2C2K B;  6FD1 A;  3IBF B;  4F25 A;  3HLU A;  4CNZ A;  4EBD A;  2CNK B;  2ZH8 A;  4KAI A;  5LMU F;  2R8G A;  2B4O A;  4NPO A;  4FKY A;  1BQM B;  1WSV A;  2BYC A;  2ZNY A;  2LA4 A;  4CM2 A;  3JTO A;  3I5A A;  3JTP A;  2IIH A;  9ATC B;  2KRR A;  5AT1 B;  5T14 A;  1CSJ A;  1C1C B;  4KHP J;  4U7U D;  4ZLP A;  1QY7 A;  3HSZ A;  1RT2 B;  2YNF B;  3PW5 A;  1FHT A;  4WFB Q;  4PPD A;  2E1P A;  2CG4 A;  1IBM J;  4F26 A;  3BQ2 A;  2KHD A;  2GV1 A;  4P7T A;  4RNF A;  2V2K A;  3K17 A;  1RGV A;  2NUU G;  3LAM A;  1IQT A;  2PII A;  4OFZ A;  1WTF A;  2V94 A;  4NLO A;  4DS4 A;  3HM9 A;  2EC2 A;  1FKP A;  4ZVR B;  4ED7 A;  2W8K A;  1SPB P;  2HHW A;  2HHH F;  1JXV A;  4YEA A;  2E7W A;  2OJ3 A;  1QAY A;  3VTI A;  3TRG A;  3W61 A;  1LWF A;  5LSL A;  1T94 A;  3VF0 B;  2E5G A;  1NO8 A;  1WJ9 A;  4QJV A;  4P10 A;  3PIP Q;  3AXM A;  4DV3 F;  3T5J A;  2RE1 A;  5I42 A;  1HNZ F;  2YKM B;  1T9V A;  4TQS A;  3KJF B;  4NLW A;  2UUW A;  3LH2 S;  3RJM B;  2CQ1 A;  3EDR B;  2XSJ A;  2BAN A;  5I4M A;  4J9Q A;  3RTV A;  3K59 A;  4JI8 J;  2ZHO A;  2E9Z A;  1Y5I B;  4BBY A;  5HLF A;  1RYS A;  2ZIT A;  4CO0 A;  4X4P A;  3C3L A;  3AQO A;  1S5Z A;  1GTH A;  4PYA A;  3EUN A;  3IM8 A;  1FX2 A;  2HUR A;  5F8H A;  2XGQ A;  5J1N A;  4LFB F;  1F2G A;  1GMU A;  2KXN B;  2EFP A;  5A8K A;  1TVR B;  4LF8 J;  3BGU A;  4RUA A;  1H2V Z;  1RHK B;  2VG6 A;  3QMQ A;  4PXD A;  5DDO C;  1HBO B;  3FBC A;  5D8H B;  2XHC A;  3TUJ C;  3K5O A;  3EMT A;  3TZZ A;  1WSR A;  2JOQ A;  4DV6 F;  2NRE A;  5J2N B;  2G2Y A;  3R7B B;  4KRW A;  2RKI B;  1DJ0 A;  2DR8 A;  2ZWO A;  2XTJ P;  1REV A;  3OR2 A;  2HQD A;  3VWS A;  2XGP A;  5HQM A;  2EFN A;  2IBO A;  4F36 A;  3ZTO A;  4E8U A;  4OX7 A;  3V4I B;  5GMD A;  3VGT A;  3DOK A;  3OR1 A;  4F04 B;  3QT8 A;  1TAU A;  2VDI A;  2YVS A;  2HNY A;  4YHH F;  4FYD A;  5JMN A;  2GS8 A;  5D3G A;  2A6O A;  4I2Q B;  3CF5 Q;  3CJ2 A;  5IOL A;  3U1L A;  2VFU A;  3ISN C;  3SSS A;  2OD4 A;  4RW4 B;  3QQC D;  2HBQ B;  2FJX A;  4K4V A;  3N6N A;  3HI9 A;  1CUL B;  5B0B A;  4CLW A;  5ETM A;  4JI6 J;  4QPT A;  2RDI A;  4FBU A;  4TU7 A;  4HI2 A;  1T03 B;  1OPI A;  4CLS A;  1ZH5 A;  3PCO B;  2FLN A;  4F2R A;  4NXN F;  2GA7 A;  1N36 F;  5IT9 Y;  3JAM U;  2UXB F;  5LSO A;  2GQQ A;  2ZZT A;  5L9N A;  4DV4 J;  3ILO A;  4ETZ A;  3R2C J;  3R1L A;  1K8A T;  1EX8 A;  4A8F A;  4WTY A;  4OZJ A;  5K9F A;  3ZTR A;  2AYM A;  3WHI A;  1SI9 A;  3ET6 A;  2JRS A;  1HYS A;  1UET A;  5KFV A;  1F9H A;  2VOO A;  1WOR A;  5B0A A;  5A6P A;  2W7O A;  3EGZ A;  2Q6B A;  4WYW A;  2P6T A;  2ZUA A;  1BQX A;  3NGD A;  4AD6 A;  1O0P A;  1K1Q A;  1SJ4 P;  1S9E A;  1RTJ B;  4IO1 A;  2CJY B;  2VKZ G;  3LPY A;  2V34 A;  3QRR A;  1E6Y A;  5KOW A;  2AZ3 A;  1S1W B;  4FVM A;  1Y3J A;  1YJV A;  4FZV A;  3UN2 A;  1FXR A;  1TL7 B;  4CLU A;  1UWB A;  3DM2 A;  4M94 A;  4LF4 J;  2FJD B;  4K4S A;  5D0R A;  2DGX A;  3N6L A;  4ECW A;  4W92 B;  4GVB A;  3S6E A;  3UDV A;  3D54 A;  1WEZ A;  1P1T A;  4LRB A;  2ZH4 A;  1R0B G;  1TL4 A;  3POT B;  1FRL A;  1HL6 A;  1TK8 A;  3TWZ A;  3D0G E;  1SL0 A;  2MKC A;  4DR3 J;  3G87 A;  1R31 A;  4RWX A;  2CJA A;  4HTJ A;  5KFN A;  2AEM A;  2HND B;  2EK6 A;  4DV1 F;  3Q86 A;  1HFE L;  4N41 A;  3TOQ A;  4WBF A;  2RHS B;  2J6U A;  2DNN A;  2KL8 A;  4P6Q A;  5ETO A;  4ZCK A;  3OTB A;  2XMJ A;  5C42 B;  4M1K A;  1NSQ A;  2C2D A;  2ILY A;  3KLH B;  4FF1 A;  5ETK A;  2Y0B B;  2NZ4 A;  3H25 A;  2V67 A;  2CVE A;  3MEE A;  4RJV A;  3EZ5 A;  1T0T V;  4QWC A;  3NWR A;  1HD1 A;  3H5X A;  2HGM A;  3M1V B;  1NBE B;  2X3D A;  3B6B A;  3QT7 A;  2KT2 A;  1GFW B;  3NRB A;  1PGZ A;  2B56 A;  3KK2 B;  4NCA A;  1HBN B;  1S6O A;  4C4W A;  3KLV A;  1XNQ F;  1DLO A;  3Q0A A;  4L6V 3;  4MKA A;  2L9N A;  3NS7 B;  2M4M A;  2LDY A;  1UTA A;  1S1T B;  4CLL A;  1FI4 A;  2VKR A;  2DYA A;  3P4U B;  4DUT A;  3D66 A;  2YKN A;  4O3O A;  3Q89 A;  3NWG A;  3K5P A;  2UUB F;  3GON A;  2YKO A;  3DMJ A;  3MMJ A;  4ED8 A;  3W8P A;  2P9G A;  1S1X B;  4MK7 A;  1RCO B;  6FDR A;  4ECY A;  4PWD B;  1K73 T;  1EZZ B;  2DEJ A;  4AND A;  1SH3 A;  3CTR A;  4DXL A;  2CG8 A;  1REG X;  2N4D A;  3QZ7 A;  1C1C A;  2YNF A;  4QIE A;  4U9R A;  2NXE A;  2YQ0 A;  1S57 A;  3MHY A;  3SDE A;  3FGV A;  1RHM B;  4Y28 C;  2PFD A;  3DXB A;  4NZ6 A;  4B3T F;  1QTN B;  1G7C B;  3KJV A;  1F5B A;  1DUR A;  3BN4 A;  3LQV A;  2RS8 A;  4J9P A;  2FVQ A;  3PHT A;  3FBF A;  5GAD I;  4PUO B;  1YX2 A;  1F5C A;  2DCU B;  4X4V A;  3TZW A;  4LF6 J;  4EFA C;  1GXT A;  2GAG C;  1LW2 B;  4RX6 A;  4I7F B;  5I3P A;  4V1A k;  4CYU B;  3TAN A;  3MPU B;  1V5V A;  3UDL A;  3IGN A;  1FF2 A;  2AJ0 A;  3FRZ A;  1D8Z A;  1ELO A;  3G86 A;  4N47 A;  2V4J B;  2I2Y A;  3FKB A;  4L73 A;  3RYL A;  3A13 A;  2E9R X;  2YKM A;  4MAK A;  3VZI A;  1N5T A;  4EGL A;  1VIX A;  2E7X A;  3KHH A;  1DFD A;  4EZ9 A;  2RF2 A;  5JUM A;  1S10 A;  4YB1 P;  1KRP A;  1T05 B;  2E1A A;  4DV0 F;  4MIW A;  2P2C B;  1VQK S;  3T1A A;  3V5R A;  3RR7 A;  3M2U A;  4BCA A;  4EMD A;  1LFP A;  5H9F K;  2B43 A;  3P45 B;  3HSD A;  4OZN A;  2I9S A;  1RBL A;  2L08 A;  3ZTS A;  3X3U A;  3K5L A;  3NL0 A;  4L76 A;  1OO0 B;  1TVR A;  1JQG A;  2QRR A;  2MKI A;  4OYA A;  1FT8 A;  2Z2L A;  1RTD B;  5GVQ A;  1V9O A;  1HBO A;  4PYD A;  3EE3 A;  1P6T A;  3SQO P;  5J2N A;  4JYA J;  3GIJ A;  4U6P A;  4ECX A;  2A2D A;  2RKI A;  1SJF A;  1RUS A;  1HI0 P;  4EBC A;  2D41 A;  2ZJP Q;  4CIO A;  4ECV A;  1VRQ C;  2IRX A;  3TP2 A;  2YY3 A;  2UVU A;  5KFJ A;  3OHB A;  3V4I A;  3JQM A;  3MFI A;  4QOT A;  4ECR A;  4TYA A;  3H8Y A;  2KO1 A;  1A0O B;  3CCM S;  1WDD A;  1GX6 A;  2Z56 B;  3W2W B;  3MAQ A;  4HAC B;  3CCR S;  1U1O A;  3KLE B;  3UWT A;  3FEY B;  3PX0 A;  1YJR A;  4I2Q A;  1DBD A;  2HZC A;  1N5S A;  4C0B A;  5KFW A;  4LRC A;  1NH7 A;  1I94 J;  3U1N A;  4RW4 A;  1UW9 A;  3RBD A;  3B78 A;  1BD6 A;  5RUB A;  5J1E B;  3IR5 B;  4DJB A;  1U6B A;  2PEH A;  5L8R C;  2HS4 A;  1WC6 A;  2KG0 A;  3EX7 B;  4FN5 A;  1FJG F;  1T03 A;  2H5J B;  3RB4 A;  4OLO A;  5IC4 B;  3DU6 A;  4KH0 B;  3HHL A;  1JLQ B;  3D0I E;  2A6M A;  1NJI T;  1OIA A;  4KV8 B;  2QA4 G;  4ZVQ B;  4KQZ A;  4USI A;  1RKI A;  3D68 A;  3C16 A;  2W25 A;  4EYH B;  2HG4 A;  2UXD F;  3LOU A;  2BRL A;  3MI7 X;  1OQ6 A;  2R7W A;  3T1H F;  1O5J A;  4I6A A;  3T1Y J;  1R8C A;  3K7R A;  1U1N A;  3IMQ J;  3TZY A;  1RAA B;  3RRH A;  1V3Z A;  2BV3 A;  1YJU A;  5ETL A;  2NLW A;  4NLS A;  5CHC B;  3CXC R;  5HL7 Q;  1R43 A;  4K59 A;  3EDQ B;  3GSD A;  2CQ0 A;  2MKY A;  2JVO A;  3VAG A;  4I0W A;  3TA2 A;  1R6Y A;  3QGP A;  1PKU A;  2VHG A;  1GMW D;  5E3Q A;  4DSE A;  3DHX A;  2RRB A;  3W5Y A;  1QUV A;  1X9M A;  1UAW A;  4P72 A;  4C8Z A;  3KJN B;  3ISN D;  2G0C A;  4OI3 A;  3CGI A;  1S76 D;  4L72 B;  1H7X A;  5AXM A;  3VAH A;  2VG7 B;  3AJ1 A;  1S1W A;  3UDE A;  1YRT A;  2N3O A;  1MWQ A;  1YBA A;  2B9E A;  2C2M B;  4NA3 A;  5FD1 A;  1TL7 A;  1URN A;  4K4X A;  1EQM A;  3U7J A;  1QTM A;  4ES1 A;  5AE3 A;  2AKW B;  2FGO A;  4DSK A;  3A8E A;  2FIU A;  3FMB A;  4F0M A;  4U8Y A;  5I3U B;  1I51 B;  3TUI C;  2WBR A;  1K44 A;  3POT A;  4CLP A;  1O51 A;  2OSQ A;  4ZJL A;  5DQI A;  3ZZR A;  2FJW A;  4NI2 B;  2A2C A;  2NSC A;  4ID5 B;  5K20 B;  1TMJ A;  2ZBR A;  3U1M A;  3CDE A;  3AB4 B;  1X8D A;  2HND A;  5FDL B;  1AA1 B;  4JI2 F;  1KOH A;  4YR2 A;  1AT1 B;  4O3P A;  1U02 A;  3KLI A;  5K14 B;  2UP1 A;  1G3O A;  4ELV A;  3ZNJ 1;  5C42 A;  3DNC A;  4HVZ A;  2HFS A;  1WC3 A;  4QIW D;  2YPY A;  3VHQ A;  3KLH A;  1NKE A;  3F73 A;  1HBU B;  1JNR B;  2L9W A;  2RNE A;  3MM7 B;  2VA3 A;  1F9F A;  2XCA A;  1U8W A;  2HEK A;  3IBW A;  3N9U C;  1X9W A;  2VFV A;  4OI1 A;  4H54 A;  2DT9 A;  3IR7 B;  3CD5 A;  2IRY A;  4NXM F;  3RRK A;  4JI7 F;  5HMY A;  2LQ8 A;  2CKW A;  2HYI B;  1HBN A;  3BN7 A;  2UZA A;  1RXO B;  5ADZ A;  1WHY A;  4UY8 T;  1VYA A;  1IKY B;  2XMM A;  2VB6 A;  4WFZ A;  1G4C A;  2W2P P;  3MCO A;  3I32 A;  3IM9 A;  2CAD A;  4B3S J;  3MD1 A;  4Y2I A;  1GH8 A;  2YBV A;  4ITS A;  1UVM A;  2DXD A;  4F02 A;  3S1T A;  2M0G B;  3KNG A;  4C8M A;  2FDN A;  3NMA A;  4NCG B;  1HWK A;  1XMO F;  4LVN P;  4CH7 A;  2ASJ A;  4MK9 A;  3BPD A;  4PCQ A;  4EU0 A;  3UQS A;  4MH8 A;  3R9L A;  1RAC B;  3RR8 A;  3NGT A;  3NNC A;  4PWD A;  2CQ2 A;  1F60 B;  3C66 A;  5KFI A;  4K4T A;  4R0J A;  5KT6 A;  3HVT B;  4MJK A;  3BYR A;  2DPJ A;  5KFF A;  2IPO B;  3DLB A;  1W2I A;  1SC6 A;  3M8R A;  1L3U A;  4LF9 F;  1YTY A;  3KKF A;  2YKA A;  2B5J B;  1T7P A;  2KXH A;  1GQE A;  2FZG B;  1NRK A;  5A8W A;  2VOP A;  4NAS A;  1OS5 A;  1SL1 A;  4DV7 F;  2D1C A;  1NU4 A;  2ZH2 A;  4HH0 A;  3KHL A;  1KFD A;  4EUV A;  3K0J A;  3DLG B;  2POK A;  3DRR B;  2FY8 A;  1M5V C;  2PN6 A;  2M5Y A;  3G82 A;  3M2V A;  1LW2 A;  3CNQ P;  1DQ8 A;  3KMQ A;  2EI5 A;  4DZ6 A;  4I7F A;  1YBU A;  4CYU A;  4NYZ A;  3MUV P;  4YS2 A;  2IDL A;  4LR9 A;  2JL9 A;  5LMN F;  4Z2X A;  3JQK A;  1K9M T;  4JV1 A;  2HZA A;  5FLX Y;  1KLM B;  4U8V A;  1XMQ F;  4I2P B;  5E3R A;  5C25 B;  1NK8 A;  3ENW A;  3NLC A;  1FD8 A;  3D1O A;  2OKQ A;  2R7U A;  3C8Y A;  3IN5 A;  1ZZF A;  1XN9 A;  4DX7 A;  2ZE2 B;  1FE0 A;  2IJN A;  4HHU A;  2HFZ A;  3CCT A;  2IHR 1;  3NCR A;  4QR1 A;  4C3M A;  3CCZ A;  1RZM A;  5KT4 A;  2MGZ A;  1EQ0 A;  1JLF B;  1N4L A;  3HT3 A;  4F4K A;  2F63 A;  1PBA A;  1URR A;  2DIV A;  5B09 A;  1TQL A;  3OVS A;  2F8E X;  5A8R B;  1N5Y B;  3GV7 B;  3QO9 B;  1SIW B;  4F4A A;  1YJT A;  2HK2 A;  5MLC V;  3GPA A;  1HQE B;  1FNO A;  2FVC A;  2LXU A;  4JI3 F;  2QYG A;  4C11 B;  2Y8Y A;  2PFF B;  5KFC A;  1ZAV A;  2ZBI A;  2BOP A;  1ZTT A;  4C6A A;  4H4K A;  3I31 A;  1HNW J;  3LWM A;  3SSR A;  3VZH A;  3PJX A;  1FTR A;  5IV4 A;  2B9X A;  2C3P A;  2DNO A;  1VQN S;  2YNH A;  1FTC A;  3DU5 A;  1D09 B;  4DOZ A;  3MM9 A;  3TQE A;  3W2W A;  1IKW B;  3GB0 A;  3H0P A;  3CJT A;  2GML A;  2FC9 A;  2CPE A;  2JH3 A;  3KLE A;  1QUP A;  1BY9 A;  2QIF A;  2XNQ A;  5BJR A;  1VC5 A;  4YR3 A;  3M6U A;  4F4Y A;  3H4D A;  2V4R A;  1WF2 A;  2WON B;  3QT5 A;  2FZK B;  2LQ5 A;  4NLQ A;  4C8O A;  2DNM A;  4W90 B;  5CCL A;  4HYK A;  4DEZ A;  4ERD A;  2HPU A;  5JVG Q;  2DXE A;  1KS2 A;  1S7I A;  4GKJ F;  2DGU A;  2GHW A;  1FRJ A;  2ZVI A;  4LBP A;  3Q23 A;  3TUZ C;  3R27 A;  1C0U B;  1AFI A;  2K7J A;  1JLQ A;  4FF2 A;  1CVJ A;  1FDB A;  5KT7 A;  4KV8 A;  2VPY B;  3T9N A;  2LXI A;  3PYD A;  3BR8 A;  1WKK A;  2GIQ A;  3IBC B;  1RWO B;  3D3B J;  1QSL A;  1DY3 A;  1IWA A;  1S0O A;  2HKE A;  2IJF A;  5DDQ C;  3V6K A;  3B54 A;  1HWL A;  5KT3 A;  1Z2Z A;  4TNO A;  2J6S A;  2E5H A;  5AE1 A;  1FFG B;  3R6L B;  2C2N A;  4PXB A;  2J9C A;  3VAI A;  1FXL A;  1U09 A;  3TZX A;  4DU7 A;  2B4V A;  2GQC A;  3CIZ A;  3SYZ A;  1SH2 A;  1IR1 A;  3LO3 A;  3J80 Y;  4M5J A;  3OTD A;  5GAG I;  4OL8 A;  1TKD A;  4C2M A;  4WCE Q;  3G8T A;  4DUY F;  1CJK B;  2PO4 A;  2VG7 A;  3PKY A;  2EVZ A;  2B6A B;  2BUN A;  2X3G A;  4X2B A;  2GCF A;  3MMA B;  1WC1 A;  3FC9 A;  1J27 A;  1RTI A;  1VIS A;  2OMO A;  2W9C A;  1S99 A;  4J91 A;  3AJD A;  3N4W A;  1X5O A;  4X62 F;  1T9Y A;  2RU3 A;  3HO1 A;  3AB2 B;  2M8H A;  1GX5 A;  3SZ2 A;  5I3U A;  4WP8 A;  1TR0 A;  2XUL A;  1FE4 A;  1UKU A;  3CCL S;  1Q78 A;  3G8S A;  1SKR A;  4AQY F;  3VV2 B;  2FLO A;  4ID5 A;  2J6T A;  4DPU A;  3H5Y A;  4N5S A;  4RZR A;  5F8G A;  1VJW A;  2X7I A;  2EFO A;  5FDL A;  2VJV A;  4IR1 A;  4KTQ A;  1U8S A;  4ENO A;  3C15 B;  2W9A A;  4IOA Q;  5LMU J;  3IG1 A;  1PG5 B;  1OY6 A;  1XR5 A;  1NUE A;  3JTN A;  4ZP7 A;  4KO0 B;  2DPI A;  2X1F A;  4DR6 F;  4MYU A;  2RAQ A;  2ZH6 A;  4PAA A;  2QA2 A;  4OLP A;  1YKW A;  4UUX A;  3KNA A;  3MM7 A;  2BW2 A;  3UR0 A;  3NS5 A;  2MXY A;  2M3D A;  1HA1 A;  2VAS A;  2HLU A;  1HQU B;  3BEG B;  3CD7 A;  4DFM A;  3W62 A;  3Q22 A;  4IDK A;  4RW7 A;  2HNZ A;  1NLK L;  4ECU A;  1NH8 A;  4P7V A;  1VGY A;  3GV5 B;  2YX4 A;  1ROF A;  3MR6 A;  3ZZU A;  2PMZ D;  3FUY A;  4LUB A;  1IKX A;  1SJQ A;  1OSC A;  3AFG A;  3VR1 A;  2ACM A;  5LOQ A;  2YWG A;  4QYR A;  2KFZ A;  3VVU A; 
#chains in the Genus database with same CATH homology
 3HSJ A;  3HT0 A;  3MCM A;  5ETR A;  1TMM A;  1Q0N A;  4M5N A;  1RAO A;  1RTZ A;  5ETP A;  5ETM A;  3ILL A;  2F65 A;  4CYU B;  5ETK A;  1TMJ A;  2QX0 A;  3HD2 A;  3QBC A;  3ILO A;  1EQM A;  5ETS A;  3UD5 A;  4CRJ A;  1F9H A;  4M5H A;  3KUG A;  1EQ0 A;  3IP0 A;  3KUH A;  4M5I A;  4F7V A;  4AD6 A;  1EX8 A;  3UDV A;  3HSZ A;  3HSG A;  2CG8 A;  5ETQ A;  1DY3 A;  1RB0 A;  2F63 A;  2BMB A;  1G4C A;  4M5J A;  4M5G A;  5ETV A;  4M5K A;  4CYU A;  3ILJ A;  5ETO A;  3UDE A;  3MCO A;  4M5M A;  4PZV A;  3ILI A;  3KUE A;  1RU2 A;  1CBK A;  3MCN A;  1KBR A;  5ETL A;  5ETN A;  1RU1 A;  1HQ2 A;  5ETT A;  3HSD A;  3HCX A;  4CWB A;  4M5L A;  3HD1 A;  1HKA A;  1IM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...