3ILLA

Crystal structure of e. coli hppk(d97a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLAIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3illA00
1DY3A 4M5GA 2F65A 4PZVA 2QX0A 4CYUB 5ETKA 3HT0A 3KUGA 1RU2A 4CWBA 1EX8A 2F63A 4M5KA 4CRJA 3KUHA 5ETNA 1RAOA 3HD1A 1RB0A 3UDVA 3HD2A 4AD6A 1HKAA 1Q0NA 5ETVA 1RU1A 1RTZA 1F9HA 1G4CA 3ILOA 3QBCA 4CYUA 3HSDA 4M5LA 5ETPA 1CBKA 1IM6A 1TMMA 5ETQA 3ILLA 4M5MA 2CG8A 2BMBA 1KBRA 3ILJA 3HSGA 5ETRA 5ETSA 3UDEA 1EQMA 3MCNA 5ETMA 4M5HA 3HCXA 1HQ2A 3MCMA 3HSJA 3IP0A 4M5NA 4F7VA 1TMJA 4M5IA 5ETLA 3UD5A 5ETOA 1EQ0A 5ETTA 4M5JA 3ILIA 3HSZA 3MCOA 3KUEA
chains in the Genus database with same CATH superfamily
3M8QA 3EPIA 2W9CB 1RU2A 4PCQA 1MSWD 3DLKA 4UOGA 4MKBA 3S1TA 1OO0B 2QV6A 4P7TA 1WKLA 4D3HA 2C3MA 3R5CA 1REVB 2C2ZB 4DSLA 4FPIA 1VISA 1N5QA 2Y1JA 3RZAA 3CC7S 4Y6IA 1LOUA 4ECUA 5CCLA 2AYEA 2XYHB 1UAWA 3D0GE 2O1PA 2B9EA 2JEGA 2GA7A 3H4DA 4EFAC 4KKOA 4C8YA 3U1NA 3DGVA 1JXEA 1N0VC 4L3NA 2XNRA 1BE4A 3M32B 2FC9A 1GX5A 3A8JA 1F9EB 4RNMA 2IBKA 1VRUA 4C9DA 3CWJA 4C0OC 2C3YA 2VFRA 4IOCQ 4DL2A 4NRTA 4B3TJ 1OS5A 2CJQA 4MKAA 3K59A 4J9KA 4J9MA 1WUUA 4WZMA 4NYZA 5GAHI 1NK7A 3DOKA 2MZ1A 2H4WB 3UI3A 1K0TA 4N47A 1L3KA 3CSKA 1W2IA 3EVOA 2VDHA 5KFXA 2OFGX 3CC4S 3RU0A 4DL6A 2W01A 2AGOA 4CRJA 1H2TZ 2ZC4A 3HHLA 1DLOA 4CZCA 3NS7B 3PTWA 2VG6A 2DR8A 3OL6A 1Y5IB 4GVBA 1F1BB 5HROA 4TLRA 1IWAA 1TV6A 1S7IA 3KUEA 2M5YA 1RT6B 4LRFA 1BQNB 2PO4A 4LVOP 2W9CA 2EBGA 3H7HB 4I2PB 5F0WA 5DS7A 2XMAA 3LP2A 2XS7A 1GXUA 1RABB 2DGQA 2YKPA 3TRGA 1H7XA 4C8ZA 2P9CA 4ZP6A 1REVA 3GP9A 3HK2A 2VPXB 2BXJA 1X4CA 4XO0A 4J9PA 3KOAA 3C8YA 4RNHA 5IM0B 4NEZA 3UCZP 2GHVC 1S1UB 3MUMP 4ZP8A 5DGBA 2Z30B 4CQ1A 5L39A 1VC0A 1QAJA 2HHHF 2CDRB 1DBDA 3R5DA 4EK2A 2FHMA 3Q2TC 5LJ5Y 3NL0A 2MZRA 1R3NA 5B09A 3OJUA 1H2UX 2VA2A 2XGQA 2FLPA 2B4UA 3CIMA 1FEEA 4G1IA 1IBLJ 2G0JA 3V6DB 1W7WA 1YBTA 3TQ1A 1CLFA 1VK3A 1N52B 2QLXA 3KHHA 3CMQA 1YGYA 3EZUA 4NMLA 4WF9Q 2PEHA 4EGLA 2D1CA 1YSJA 4PWDB 2ZH4A 4OI1A 2HVEA 3JTPA 2DNOA 4XDDA 2FIUA 4DOZA 2RS8A 1S6UA 4ER8A 1OY6A 4K7QA 5C5JA 4JI5J 1SH2A 4JI8F 1VIXA 3CTRA 2IDEA 1VHFA 1BQNA 5ETRA 1M5VC 2OPPB 3QGPA 1HNZJ 1XMQF 3F0NA 1WORA 4YS2A 2Z57B 5E7OB 1P1LA 1PKUA 2EG1A 3I31A 1KQFB 1ZZFA 1YJRA 2CFXA 4DR1F 4DL4A 2YBVA 4CT8A 3W1YC 1F5CA 1UPMB 2GGPB 1DTTA 4UW2A 2H5EA 3K57A 2CPDA 1Q8IA 2LVWA 3DOLA 5C7PA 5IM0A 3WC0A 1PCAA 1CPZA 5C2GA 4KGVB 4DLEA 2XBPA 1K44A 3BSOA 4P74A 1U02A 3MEKA 2WVFA 1D0EA 4K4ZA 1P6TA 3W61A 3SIPB 2M9KA 5KFVA 5B0FA 1C4AA 1CS4B 2IA0A 3P8BB 1DHMA 4GRSA 4ED7A 1UEUA 1FRHA 2XO6A 3RR8A 1OPIA 2MGZB 1R8AA 2BE9B 2V0NA 2VFUA 4ZVOB 3L7UA 1HW8A 2HEKA 2IMWP 3FK4A 5ETSA 2F8HA 4FPRA 1JNZB 4ZCMA 4NA1A 2DR6A 4O4GA 3OR2B 4M8LA 4MIAA 4O3SA 3PEHA 1FDAA 4DV6F 3HD1A 1T9WA 3GWCA 4DV5J 3WIUA 4DR7F 1YJ7A 4PYDA 3NNAA 1NNDA 3FQKA 1SKWA 3DMJB 4PXDA 4AE5A 4LF9F 1WWHA 4FVMA 2MKHA 2OPPA 1B0VA 3FC9A 3BPSP 1HBOA 1FNOA 1WELA 4DR4J 2DNRA 2XMTA 2DNZA 5DDPC 2M8DB 1RAJA 3ZZZA 1PJ5A 4HR2A 2NCKL 3Q83A 4K0KJ 5K8NA 2ZBCA 2FDNA 4OHXA 3VWSA 2ZE2A 4ECSA 5LXYA 4P2XA 3MPVA 5CD4A 3MEDB 3DI6B 3VCDA 3ZTRA 5DO2A 2KG0A 1T9VA 4MJKA 5CYMA 1UEKA 4ZCIA 4RL1A 3BKUA 2BKOA 2BJ7A 2GVDB 2HFNA 4CLFA 1EETB 2PSZA 3HD2A 4F4ZA 5BYSA 2RQCA 1DAXA 1MG7A 3EZ5A 4HL9A 4ZN1A 2AZ3A 2DB1A 3UFCX 2Y3YA 5K9FA 1D9DA 1VQMS 4W90B 1W26A 3MPWA 4WFZA 1AW0A 3SMZA 3BSAA 1WC3A 2FLNA 3OTBA 3A4TA 3D3BJ 4ZLPA 3OR2A 4JI7J 3LALA 4TKTA 2XZDB 4KGKA 2BJ3A 3LOUA 4DUYF 1UPPA 4BS2A 2G1DA 1RE1B 4URSA 2W7OA 1VGYA 3D1QA 1FT8A 4ANEA 1MLAA 1RI7A 2E9RX 3TVZA 1RT1B 2M2BA 2AKWB 3F41A 1X0PA 2L9NA 4CO0A 3N79A 2W2PP 3NGTA 4M94A 2RH3A 1SL1A 4ZVFA 2XSJB 5L1LA 3ZNUA 3MHYA 3KTQA 1U1QA 3QO9B 1URNA 3H2VE 3MEEA 4Y2CA 4DUZF 1J5EF 3BDEA 2ZH5A 1I51B 1SUQB 5J2NA 3SXLA 1XR7A 3RJMB 1VQLS 4J91A 1Y10A 4JI4F 2B4PA 5I3QA 4V19J 3MOJB 1Q79A 2GVDA 5KFRA 1EETA 3AJDA 2VDIA 2R8HA 3HX9A 2OD6A 1UJ5A 4ZPAA 1RHMB 4BC7A 3J7Z5 3NS5A 3FMWA 2I5JB 4B3MJ 2NXEA 2ILZA 5GAGI 4K4WA 3K5OA 2QRRA 4IH5A 1S6PA 1RKJA 1OPZA 5EN1A 1HA1A 1RT4B 1VC5A 4O3OA 4N77A 4K50A 4URQU 1F5BA 2HRUA 2IA6A 3A3OB 3ZTSA 5C42A 2H65B 1WDTA 2KI2A 4ZJQA 2OD4A 3VQSA 2MSTA 4Q2LA 3HZGA 2KB2A 3EVWA 2Y1LB 4XDCA 4J9UE 3BGRB 3J81Y 2V8HA 4YOEA 4K5RA 5EX0A 1AUDA 3LTOA 2YX1A 1H6KX 2DNHA 4NA3A 1JWWA 1RT1A 1WOSA 3CD5A 5F8LA 2BM0A 4OJGA 2DH8A 2XSJA 2OP5A 2OO4A 2OI2A 2PA3A 3AFGA 2R2UA 2HQCA 4HVZA 2W25A 1GXLA 2B9XA 2IY5B 2FHKA 1SUQA 2R4FA 2HNYA 1Q53A 2V8PA 4J9OA 3TVYA 4DL3A 1N88A 2G0CA 3UN5A 3KHRA 4EYHB 2L48A 1WTFA 3R2DJ 3HT3A 2DRDA 4U8VA 2KRRA 3PFOA 5IT4A 2VL1A 2WSFC 1LW2B 4WU2A 1R0BG 4B9SA 5H9EJ 3EMTA 4ZVEA 3SCIE 2GVZB 4OX6A 1NPKA 5LOQA 4PG7A 1C0UB 5HO4A 3OL9A 2OSQA 5GAEI 2MKYA 1U1KA 3J7A1 3RAQA 9ATCB 2FLLA 5LT5A 2HBQB 3AQOA 3GJRB 5DJBA 4ECQA 3BGRA 3PXGa 4C8OA 1RHRB 2KVQE 4TXSA 5HQLA 1SC1B 3PHTA 2ATCB 3Q8PB 5KT6A 1G7CB 1T03B 4Q0BA 3GV5B 1RWVB 3IR7B 2UZAA 1BWVA 3I87A 3EYZA 4NLRA 4DR2F 4UUXA 3PZPA 5F8JA 3DLEB 2FUG9 1N56A 4FYWB 1L3SA 3GIKA 1S1TA 5D78A 1CQMA 1HD1A 5J2PB 4C98A 2KZMA 2LQJA 1S9EB 3GJTB 2K06A 3CJ4A 1U6ZA 2Y8YA 4A8SA 2D7SA 2F4FA 1SKSA 3PW0A 1KQKA 1XR5A 3RUBL 1PAEX 3J80U 1SJRA 1LW2A 1R89A 1HQEB 3R8YA 1YHQS 1N34F 2KDOA 3L9ZA 3FCHA 4A8MP 2GV1A 1FDNA 3A8EA 2FC8A 3EGVA 3H40A 3PNIA 2P5VA 4WP9A 1WOPA 1RACB 3K5NA 4QOTA 4JUZA 3V5RA 1FJCA 3ILOA 2DNGA 4QWBA 4I6AA 1N6QB 4UQTA 2J6TA 3K5MA 4CLWA 1EHWA 3W3SA 3C6UB 2IRXA 4L75A 1X4EA 4B9UA 3J7YI 2QL7B 3HMJG 4QQBA 1U25A 1NKEA 4DV4F 1EB0A 4OYPA 3OBIA 1RWOB 4IH7A 2JX2A 5KFEA 1KOHA 2DNQA 1DQ8A 4RNNA 3QWPA 1VQPS 3VALA 4WK3A 1ACMB 1RTHA 3M2UA 2P9EA 3NKYA 3PACA 3LAKA 5LMNF 1H98A 2WZ1A 3GSDA 4B02A 3DGPB 4LF6F 1QTMA 3DLEA 1QSYA 2UUCJ 3MM6B 4RJVA 2JNJA 2QZ8A 4OZJA 2JSXA 4N5SA 3IAM9 1FE4A 2CIMA 4TQRA 3U02A 2DXFA 2HHHJ 5CQGA 2JLFA 2PN6A 2BDPA 1PSDA 2QFIA 2HW3A 2W4PA 3BKFA 2HZVA 4ELTA 3PJXA 3BSCA 4FS2A 5D6GA 3LH2S 3CCTA 2YY3A 2BW7A 3MR3A 2WSEC 1ZM3A 4DF4A 2ASLA 2E1CA 4DX8H 3PR4A 1XR6A 1N54B 1VK8A 2HFOA 4NCAA 1IM6A 4LF5J 2W8KA 3GG1A 3FFIB 3UWTA 4IRCA 4DV3F 1D9AA 3GCXP 3B4MA 3K8WA 3KJVB 7FD1A 1NK6A 3LP0A 3W9JA 4NLPA 1REGX 2RDDA 2C2KB 4E2FB 4LR8A 2WAQD 4K5SA 1NH7A 3LW5C 3DM2B 4GKJF 4U67Q 1RCOB 1Y7PA 1X4AA 4I2QA 3QSYB 2MKJA 3ILIA 4JV1A 1XMQJ 4IO1A 1TKTA 1IJEB 1KFSA 3JYTA 1H0HB 1S1VB 1VMBA 1X9MA 3PEJA 1ROFA 4OV6A 4CH7A 2VC1A 1UW4A 2OEMA 4HHJA 3HVRA 3ICLA 2W7AA 3DGPA 1NK5A 5A2QY 3MM6A 3US5A 3QYYA 1EIYB 3VTIA 1TR0A 3FBFA 3R5JB 1YJVA 1QY7A 3QNWB 2I2YA 1SB6A 3BGUA 2CYYA 1ZM9A 4LRCA 2MQMA 4WFYA 3TVKA 4C11B 5JVGQ 4KB7A 5KG7A 5AJ3F 5J1EB 2LP4A 2V6AA 3M8WA 2MMYA 4DL5A 1WC0A 5HI7A 3H5SA 4M5KA 5HAOA 1HWKA 2Y9HA 3CD7A 3CEDA 1N5TA 3CJRA 1YRTA 3EPGA 3KLEB 1JMTA 3BV8A 4C2MA 4WP3A 1O6XA 2CQHA 2IPOB 3OLAA 3NXZA 2OLWA 1HWUA 3FFIA 1B99A 1ITPA 1DZ5A 4DR7J 2HLTA 1A6LA 3VV2B 2UXDF 4LSNB 3CJQA 3DM2A 5AXMA 5KFMA 2XGPA 4LF9J 3PW4A 3CJ3A 2V34A 2E1RA 3MMBB 1S10A 3GIJA 1BGXT 1RU1A 1RCXB 3JSYA 3S8SA 3GR0A 1RHQB 1HFEL 1S1VA 1QVFR 3ZZTA 3HSJA 1U4BA 3CCJS 3TEHB 3C16B 3WX8A 4N76A 2KYZA 3M9OB 4B9LA 2X51A 1PYSB 1JB0C 3LAMA 2YWKA 1VIOA 1NRKA 2BW2A 2AZ1A 3P4UB 1YJWS 1RB0A 4KHMA 2HURA 4WKYA 4FS1A 1QUVA 3PFEA 1MWYA 1OYEA 2N4DA 1M90T 1UEVA 1EQ0A 3NWRA 4C11A 3ET6B 1HD0A 2IFXA 3HPOA 4DV2F 1D9FA 2V4JB 1Q8LA 3EUNA 1YBUA 2RHQB 1SVDA 4IFVB 1NKCA 4F36A 1JNRB 4OV1A 4F4XA 2LCWA 4TYAA 5L1JA 2Q6BA 1HBMA 5F8HA 3D6HB 4WU3A 3V81B 3PKYA 3G87A 1Y11A 1P9QC 3DHXA 3W66A 2KJWA 5I42A 4DUYJ 5D3GB 4NOHA 5HJYA 3UQSA 3NY0A 2C2OB 2R9LA 3OVBA 4LSNA 4CLTA 3I5AA 2O01C 2BOPA 5CD4H 2EFVA 2EFNA 4DV7J 1Z4UA 3MMBA 1R6YA 1QSLA 2YKOA 2ZH9A 3L09A 3TARA 3SDEA 4ES1A 3C46A 4ANDA 1YRXA 4P72A 3BO4A 2HAIA 3C16A 1FHTA 3DFEA 3AD7C 4PG5A 1GQEA 2F3JA 4XPEA 3LA0A 1Q8BA 1R8HA 2ZH2A 2Y1IA 2AYGA 1IBMF 4NLSA 2KT3A 4KFBB 1P1TA 1X5TA 3PYGA 2E9TA 2LMIA 4NWBA 2BABA 3KNGA 3N4WA 5G4DA 3A3NB 1JX4A 2J7UA 4URGA 3KLHA 4DMZA 3A8IA 3EWGA 1HWJA 5BXIA 1PJ7A 2DEIA 1RJJA 1VQOS 5D4LA 5KFCA 3AQPA 3FJ2A 2QEXS 4ED0A 2EPIA 2LQ5A 3ULHA 4EZ9A 5IFMA 1Y5LB 2HIQA 2O66A 2RKIB 2M70A 4MYTA 2LYVA 4RZRA 1KN6A 2RS2A 3LQVA 3UW1A 1CJVB 4F4WA 2KXNB 3VGTA 4UZBA 1K9MT 4OX8A 1E6YB 5D3GA 2QO3A 3W2VB 4GO7X 5C25A 1AZSB 2GHPA 2BR0A 1DTQB 2VA3A 1FRJA 4PWUA 1IBKF 3JQJA 1HI0P 1K1QA 4UOHA 3MR2A 2EKNA 3PW2A 1FFGB 1TL1A 4ZVSB 2MDAA 3AB2B 2D9PA 4KTQA 3NGSA 5GADI 4Q43A 3H2UB 1N33F 3OTOF 5CZXA 1LXJA 3W60A 4IR9A 4P73A 4RW6B 2WONB 4DL0C 3V6JA 2QLFB 3E3XA 3W7BA 1JJHA 4KFBA 3G6YA 4KHPF 1ZPWX 4JOUA 2WRMA 1FXDA 4FYVB 4DS4A 4B3RF 1V3SA 1NM2A 1SQGA 3KFWX 1Y3JA 3THTA 5IOLA 5T14A 1YX2A 2LLZA 2FPHX 2BQRA 3TUZC 3SCLE 5CHCB 1GMVA 1XMBA 3ELHA 1VJWA 3BBFA 3BBBA 3O3LA 3CE8A 4DPUA 4RUHA 4OYZA 5D0EA 3M6VA 2RKIA 3GONA 4OJ3A 2ROGA 1HNXJ 1EKSA 1FWPA 1WF1A 3CB4A 1RT2B 2NPIA 4NEYA 1E6YA 4CT9A 1UVJA 4AUKA 1NO8A 2ZHOA 2C3UA 1AZSA 1IR1A 3TZYA 4JI2J 1TFWA 1DTQA 3UNGC 5IT9Y 2H5JB 4CH1A 3H5YA 3W9IA 2IJRA 5DLGA 1R8BA 4NLGA 4KHRA 2M4MA 4DR2J 4ZPCA 1ULRA 2OGUA 3GIIA 1D3WA 2C2RA 3R7SB 2E5HA 4ZCLA 1QD1A 4KH1B 4RUCA 3VAFA 4RW6A 2WONA 3BQ1A 1PG5B 2JEFA 1UJ4A 1WG1A 2N7YA 1S6QB 3KLFB 2XZTB 3I0SB 4DQPA 2WSCC 4C3LA 3L7PA 3JAMY 4YHHJ 2FYXA 5B0EA 2MB0B 2X1AA 2HZAA 2M8HA 1E6VA 2QC3A 1TL7A 4FKXA 2Z0GA 5CXTA 3RBDA 4X66J 4RU9A 3SSQA 1HMVA 4JI0J 4E8UA 4A8KA 1U2CA 4USMA 3H5XA 3GFZA 1NK4A 4OI6A 2VF3A 4DQSA 3FBCA 2V8VA 1RWNB 3CCSS 1JLEB 1LFWA 4HACA 3KK1B 1NPRA 2PFFB 2BOAA 5HN0A 1R8PA 2MTLA 3GMGA 4C0HA 3JS9A 5L9NA 3CDBA 5B0GA 2IM3A 1RT2A 3LP1B 3G8TA 1UP1A 2XC9A 1X4GA 2KFYA 4FF1A 1RLDA 2HIYA 2J6SA 2R8IA 3JSBA 2JL9A 4USJC 2OTLS 1YQHA 5F8GA 3G6VA 3MM9B 1EJ7L 1S49A 2NREA 2VIHA 2VG7A 1HNWF 3TNVA 3W2WB 3CDEA 4CYUA 3OLBA 5LMNJ 1VDHA 5K20B 3FSYA 3FCVA 2XMWA 3VVUA 3ETMA 2UVWA 4DHVA 4C3MA 4ED3A 1WG4A 2HHTA 4USTA 4TY8B 3UDVA 1N5SA 1NUEA 1S6QA 3KLFA 4A47A 4CO1A 5A8RB 1TKDA 3DU5A 3TZWA 2DGXA 3M8SA 4M5HA 1S0MA 1QM9A 2HBZB 4V1Ak 1NJIT 3TO8A 2G13A 4DWIA 3FUYA 5KFFA 4IYQA 1CC7A 4RW7A 1IM4A 1ZM4A 1X5OA 4FXWA 1OYDA 1VBXA 2HRTA 3QFWA 2DGWA 1LKZA 4FN5A 1T02A 3UO0A 4RO0A 3SCKE 2FTRA 5A2QU 1M5SA 3IGVA 3N0VA 3VF0B 4CP5A 4DV3J 1JLEA 1KVKA 3KK1A 1Q1KA 1N36J 1X7VA 2RRAA 3TEGA 2VBYA 3ZZOA 1XC9A 3KG4A 3TAPA 1VFJA 3RTVA 2ZBRA 1FRLA 2VICA 4F3MA 4HTJA 5EWFA 3KJFB 4DR6F 2HMIB 1MNEA 1HYSA 2JFKA 4PG8A 2VQFF 4OYIA 4CO2A 4R8UB 1EQMA 5LMUF 1G3OA 2RQMA 4HDGA 4HDHA 2HVZA 4U6PA 1FRIA 1T95A 1LWCB 3ILLA 5E0OA 2XMUA 2ZZMA 1FVQA 1NJYA 4M5JA 2CQIA 3EJMA 4ID5A 5KFAA 1KLNA 5LJ3Y 1S5ZA 4L6V3 3RBXA 3UVJA 3GSIA 4ELUA 4Y28C 4G1QB 5A8RA 5DQGA 3O2IA 4WFNQ 2HNDB 3DRPA 1BWEA 2X1GA 2RRNA 5KFHA 3M1VB 4KT0C 1S0VA 1U24A 2WW4A 3MOZA 2BJEA 2K3IA 1A9NB 2VFTA 3MMAB 2K3KA 3C14B 4B3TF 5GAEU 4IUFA 1RAGB 5EUHA 3GYGA 1V3ZA 2OSRA 4GC7A 2PT0A 1DARA 3RBEA 2VFSA 2XTJP 3Q23A 2CPFA 3K17A 1NZ8A 4ED8A 3M8ZA 4M95A 1X5SA 4J7CA 3TAQA 1FVSA 1XTZA 2RAQA 3PO4A 3I5CA 2K1RA 1TUWA 1SBRA 4LFCJ 1UVIA 4DDFA 3U7JA 2Z2ZA 1EP4B 2HMIA 1T9TA 2DNPA 2O5DA 4N7TA 3CD6S 2OEJA 3HFVA 2DJWA 3PW5A 3ADAC 3BS9A 3EGNA 2RF2A 1TP7A 3AH6A 1BY9A 3HCXA 1LWCA 4C6AA 3M9NB 3KLIB 2BZ2A 4U7UK 4ZIVA 1IXKA 4OLPA 4DSKA 3PRDA 4JP8A 3DU6A 3WHIA 2ASDA 2C2DA 2DH9A 2AJFE 4G1QA 1N4LA 3T6BA 3NGDA 3MR5A 3IC1A 1QDUB 5LSOA 2HNDA 3QGIA 1CJKB 3M1VA 4EO6A 3TZZA 5H9FK 1XJWB 1KEKA 3K58A 4X4RA 3I5BA 5F8IA 3S01A 4ZCKA 4ECZA 3MMAA 1R27B 2AGPA 2QIFA 2UUBJ 4J9RA 2YKMB 5KTQA 3MECA 3I6PA 1FDBA 1U7LA 1WOOA 4ATNA 4N41A 5LL6d 3J7YU 2YNGB 5E3QA 4NXNJ 3TOQA 4IG0B 2QL9B 2OPSA 1WHXA 2AD9A 4MH8A 2B8QA 1T11A 1XWLA 1ZTTA 3LUYA 1BQXA 1JLGA 1FKPB 3OFFA 1S6OA 2Z4PA 1EP4A 2IVFB 2QYGA 1NPPA 3HHNB 3FEYB 3MF5A 5A0YA 3KYLA 3TA0A 3ZO7A 1HNZF 4C0BA 2DXEA 1N48A 2VPWB 2OPQA 5ETVA 4BBYA 4FF3A 3KLIA 5F9NA 4K4XA 2UU9J 2DYAA 2JDJA 2LFVA 3FZ2A 4RLEA 1PILA 2XG8A 4KQZA 1IBMJ 2P2CB 1VHIA 3VZIA 1N32F 4DLGA 4KJIA 1R31A 4K2XA 2YQ3A 4QZVB 2J7KA 1ELOA 4J37A 2RDIA 1S99A 4LFBF 2FVCA 1SL2A 4DI6A 5LSLA 2LKZA 3MD1A 4X4TA 2HNZB 2JH3A 4F4YA 1FTRA 5H9EK 1WC1A 1RXOB 4ID8A 4RUBA 1MROB 2J0XA 2Z2YB 2YKMA 3OXGA 3NBPB 2W9AA 2I38A 2DRAA 1PIEA 2F40A 2P6SA 1V5VA 4P52A 3GTYX 2EFGA 1RWKB 4L73A 1DURA 2YNGA 5HATA 4IG0A 5CYJA 3NCQA 3JQMA 4AXJA 4N56A 4DV5F 3W62A 5ETPA 1SCJB 3OPKA 2B3TB 1U1RA 4F0MA 1U0HB 1FKPA 1IBKJ 2E44A 4F50A 5KFIA 2I1RA 7AT1B 3MEGB 3QPIA 2V8DA 2E66A 4WK1A 4GVLA 3KWMA 4TU8A 1RT7B 4DFKA 4JB8B 4PUOA 1YJTA 3B4DA 3KK3B 3GJSB 1BQMB 3AXKA 3U1MA 4LF8F 2VU5A 3SFUA 4MFBA 1TAQA 1IKVB 4ELVA 4O44B 3VGUA 3IR5B 1SXLA 3UDCA 2R2TA 2R8KA 3DOMB 5E3AA 2C42A 2LQ8A 3M8YA 5K8PA 4CI0B 3ITHB 4ZPTR 2G2YA 1TL3A 1Q7YT 5IT9U 3ETOA 4B3RJ 3T5LA 1VOMA 2IC3B 4MK7A 2ROPA 1IKWA 3NAIA 4A4JA 1VQNS 2BJDA 1T8EA 2GHWA 4OZ3A 1MROA 2FJEB 4LIWA 4H54A 2R7WA 3AD8C 3GFHA 3NBPA 2HBRB 5EHHA 2B0GA 4OYWA 2RT3A 4RU2A 2XB2D 1LWFB 3MM5B 1XNRF 4PAAA 4DPWA 4GC6A 4HLBA 4H4MB 2FZKB 3FZBA 2XNQA 4AL5A 2FVPA 2DNKA 1RT3B 4DS5A 2E29A 1C1BB 3QIPB 3PG9A 3Q8UA 1FTCA 1PBAA 3KKFA 3GFXA 1BD6A 2OELA 5U47A 3Q8VA 4ETZA 2E5GA 3MFIA 1UL3A 1P9YA 2HHXA 1IQTA 3MM7A 2AW0A 1RHKB 2HRYA 3MEGA 5KG2A 2Q3PA 1FJ7A 1MMNA 1M1KT 2Q79A 2F4VF 3AAWB 4DQRA 4NYPA 1JLFB 4K8RA 2VKRA 2MQPA 1KHWA 2V2VA 5KT3A 2RB7A 4O44A 3VAIA 3H8YA 1L5UA 1N5YB 2A2DA 1LXNA 3MR6A 2FZGB 4FNHA 4HT7A 2UVUA 3W5XA 2V8GA 3X1LB 2W1BA 1WHWA 2QGFB 1X9WA 1RT5B 5E41A 1UWAA 3F73A 2CVIA 2B5JB 4DSFA 2BA9A 3HHDA 4K4SA 2IC3A 3P3DA 4AD6A 1O0PA 5L1IA 4B3MF 2QJ3A 1JLAB 2HHSA 4K4YA 5GMEA 4L3KA 2L41A 3S7RA 3RRGA 2L08A 2FJXA 3OFHA 3TJ9A 5F41A 3M6UA 3B78A 4WTYA 4WBFA 4LFAJ 3HKWA 2ZVIA 5DRKA 1LWFA 4TNOA 4H4MA 2E5LJ 2DR7A 4NI2B 1RT3A 2QLJB 2YWEA 3QIPA 4QYRA 2LDIA 1RAFB 3NMAA 3QT5A 4ZPBA 4NX9A 1JLBB 3DNCA 2BM1A 4DJBA 2E7XA 2C2EA 4ZVQB 4LBHA 1KKHA 2BBEA 3R6GB 2FY1A 2BACA 4WYLA 5LM7E 1G2EA 2ZEJA 2HVHA 2R7UA 1S48A 3W64A 4J9LA 4HH1A 3MXHP 2XULA 1JLQA 4I56A 3CPWR 5DG9A 2ZBPA 3IM9A 2NUHA 5IV3A 5B7WA 4ECVA 3CUNA 4ZVPB 3L4BC 4YB1P 3DC2A 4NCGB 3R3TA 3BR9A 4DR5J 1RT5A 2QX0A 2VG5B 2J8AA 4PR6A 3CO9A 4DFJA 1S4EA 2O3DA 4I67A 4HYKA 2FGCA 4B9TA 3N6LA 4O3QA 2J76E 3QJLA 4NL5A 4RX6A 1J2VA 4LF4J 3TW0A 4F4KA 3NCRA 4KYZA 3I56S 3EGWB 2V2KA 2AGQA 1KVIA 2W2QP 2EEYA 2K7KA 1LEOA 2WTFA 1M5KC 2J7WA 1SH3A 2ADCA 3HHLB 1VQKS 2XMVA 2X1FA 5IZHA 4GVBB 4DN9A 2BE2A 2K7JA 4NI2A 5HROB 1TV6B 4DR6J 1FO1A 4NLOA 4FYDA 1G6BA 2VQFJ 3BEGB 3OVSA 5LMUJ 3BKTA 1JLBA 2ZH7A 4A8WA 3WQPA 1H7WA 1SPBP 2C2NA 5GADU 1NHVA 5G0RB 3LP2B 3ENWA 4WPAA 3GV7B 3W5YA 2H9ZA 2EW9A 3OL8A 2CG8A 1Q16B 3MR7A 2ACMA 2MHEA 4OI2A 4LF7J 1OJ4A 3SV4A 5THWA 3BH7B 2KT5A 2N3OA 4DCJB 2R7XA 2IYIA 3VHQA 2G9OA 3M2VA 1UVNA 4CM0A 4ECWA 5C24B 3Q8YA 3IBFB 4TVAB 4NCGA 3HDSA 5KFQA 1GK8A 3U1LA 1RWMB 1YZ6A 4JI3F 4DBQA 2VG5A 3I0RA 4JV2A 2GMJA 2YWWA 2DO0A 2ADBA 5CH7B 3DRYA 2W7PA 5IT0A 5HVGA 1RWPB 2EFPA 2W2OP 4FYYB 3NGUA 2CG4A 2XSFA 3RG6A 1HLWA 3RW6A 4CM2A 1C1CB 3CXCR 4WIQA 3D3CJ 4Q44A 3PDNA 3MPUB 5HK4A 2A2CA 3AHPA 3H59A 2BRLA 1RAAB 4KIAA 1SQEA 2MXYA 1I94J 4XPCA 2FJAB 3PO5A 2ZM6F 1URRA 3EGZA 4Z2XA 2XZWA 3MD3A 4DZ6A 4IDKB 3JTOA 2J5AA 1Y5NB 5G0RA 4Y00A 1RYRA 2DT9A 3AJ2A 1WC4A 5T41A 2FD2A 2B4VA 3E8OA 4RW4B 1C4CA 2MQQA 2IM0A 3VAJA 2YWHA 2F7VA 1FA0A 4Y3CA 1ZETA 1DTTB 3NNCA 2J9DA 1KRPA 4DL7A 3WIVA 3DOLB 1SL0A 2UUCF 1U1OA 2GIQA 4DV1F 4PKDB 5BR8F 3W8GA 5C24A 3HSDA 2NQPA 4NMXA 1VQ6S 1FD8A 2QMXA 2RRBA 4Q45A 4Q7AA 3W9HA 3NMRA 2A18A 1F3FA 3TX8A 1ZPVA 1FNMA 5M2RA 2C3PA 2XS2A 2LXFA 2JEJA 1KQGB 3GPAA 3RBZA 2G1HA 1ZAXA 2ZWOA 1SJ3P 3MURP 1RP5A 1SC4B 4HEA9 4O4GB 4LF5F 1C1CA 4PPZA 4ZITA 3QJPA 2JVOA 1NHKL 3I82A 2A6OA 1D8YA 2QN6B 2W2MP 2X3DA 3BYRA 1I3OB 3D6MB 1JLCA 4YMEA 3ZTPA 2MZTA 4YB6A 4ECXA 4IDKA 1HBOB 4M5GA 3OSNA 1Z2LA 4QPXA 2C2MB 4LQ3A 4RW4A 2XY5A 2ZE2B 2NYHA 1KC8T 2AU0A 3B8HA 3M6XA 5JXSA 4DQQA 5CYMB 5CAAA 1ZM2A 1N32J 4ENOA 3R5GA 2RVJA 2WVDA 3MAAB 3TR5A 1HBUA 4QYZK 2AIRB 1Q7LB 2V94A 3FEXB 4LFBJ 4X84A 3JXOA 2XS5A 1YLXA 3BN7A 2VZ9A 4NCBA 3SQOP 2DKOB 4USHA 5I3PA 3HJVA 4X65J 4EEYA 1IVZA 2DHAA 2A6MA 4DPXA 1FWKA 3WX4A 3IG1A 2H51B 2AJ2A 1OSDA 2JVRA 3CDUA 3BGOP 4V19X 3LGNA 1NZAA 1B7YB 2QTWA 2H1YA 4N8NA 5K14A 2WVEA 3P5TL 4JI6J 4CLPA 4W98A 2MJUA 1NK9A 2EFOA 1CG2A 5FLXY 4UY85 2DTJA 5HMWA 2KH9A 1SIZA 1VS3A 4GO5X 1LWEA 5F8MA 3HFZB 2ERRA 2GQQA 1OSCA 3SEOA 3UR0A 2BX6A 2DHSA 3GU0A 5KFSA 2XEXA 1VQSA 3CMAS 3WZ0A 1OQ3A 3DLLQ 3UR3C 5CABA 2W8LA 5A6WA 5DZ7A 2CWXA 3CGIA 2DNNA 3LANA 1VQ8S 3CCUS 3FNNA 4LF8J 3G8SA 1U47A 1HQUB 3MEEB 3CJTA 1M5PC 3BR8A 5J2NB 2CADA 3DRSA 2UUWA 2XHWA 1T05B 2QA4G 4OX7A 3MAAA 2BE7D 4A46A 3PJWA 1QAIA 2DNYA 2FQQB 3QT7A 5KFTA 4U96A 2HPUA 2IAJA 3I9V9 2HZCA 1Q95G 1Q0NA 1U49A 4A48A 2J9EA 2MEWA 4R0JA 3NRBA 2YPYA 1VBKA 1FD2A 4JI1F 3WBZA 1QLNA 3PM9A 4C3KA 3KUGA 4NZ6A 5KG5A 3ZFVA 1S6PB 2FVRA 3IRXA 2FB0A 3T9NA 3PYFA 4CLSA 5T7LB 4AXIA 1WEXA 1VQ7S 4O3NA 1NMEB 3OFGA 3PIPQ 4FXVA 2UVRA 2V50A 4EBDA 2UVVA 1FESA 2B51A 1XNRJ 1NU4A 5HANA 1T9YA 1NSAA 1T3OA 4ZP9A 5C42B 4OZ1A 4RW9A 1VQYA 1AA1B 2H3EB 3I4PA 4TLQA 2QL5B 4MAKA 4ZLLA 4WIIA 1RGVA 4C48A 1FK9A 1IN0A 3OQ2A 3EX7B 4DV7F 3N6NA 3PV8A 4WCEQ 1KVJA 4FF4A 3ILJA 1V9OA 3I55S 3RR7A 3OR1B 1WNEA 2F4VJ 4QR2A 5D77A 4DSIA 1NSQA 3Q2SC 2MHNA 3MPDA 1F9HA 3CMES 2AQ4A 4WWSA 1HQUA 5HMZA 3OVAA 3NGKA 1OQ6A 4EYIB 2FGOA 5L9XA 4F04B 3A13A 5B08A 2ZC3A 2HNYB 3OXLA 1T05A 2YX7A 2R42A 2MQNA 1IKYB 2DGTA 4U95A 4NA2A 2PEBA 4WTOB 3G8QA 3LWMA 1AT1B 3HT0A 5D8HB 2M3DA 2RJZA 2LXIA 1J27A 3HHEA 1H74A 4EBCA 3CT9A 2HGNA 2AWZA 2RU9A 2J0QD 5BJRA 2JFDA 3CULA 1X5PA 3FRYA 5KFGA 5T7LA 4NXMF 4ZOSA 2B9WA 3EE3A 4LT6A 3MGJA 3DLGB 3LPEA 1M5HA 3THPA 2MYFA 4C8NA 3IR6B 4E98A 1DQAA 3IGNA 2JLGA 2GS8A 4OJ1A 3SBMA 4ALZA 3BZQA 5KFNA 1NH8A 4X4VA 1A0OB 1S1XB 5KG3A 4Q0BB 4ZVTB 3R6LB 3S6EA 5E2QA 2WB1D 3K5PA 4KE5A 4OX9F 3I4HX 3OR1A 4EO8A 2XQCA 4TU7A 4C8LA 1YVFA 3HLUA 4ZVUB 4EI2A 3EVMA 1U1NA 1RZMA 1S1TB 3NLCA 5L8RC 2VBWA 4QIFA 1VQ9S 1LK7A 4X4SA 5DZ6A 4A8OA 2ZZTA 2LDYA 4OHZA 5J2MA 2Q43A 1IKYA 2ZHBA 2IIHA 4FDFA 3PX0A 3AOBA 3QGGA 4P10A 1LK5A 3KDOA 5J2QB 3IAS9 2D3OR 1NSPA 1Q82T 1S12A 3UPFA 4KGXB 2YKNA 2GAHC 2G2ZA 3ENVA 3UCUP 5H1SV 1UWBA 4RUAA 1FFWB 1S4FA 3SCJE 1FDDA 2DGUA 1HI8A 1T0TV 1O5JA 2OTJS 2H5IB 2OJ3A 1UVLA 3PYEA 2GZOA 4WXOA 2ASYA 2R7QA 3DLGA 4W92B 2AEJA 1HNXF 2F9DA 3KLVA 5FD1A 4X64J 4JV5J 3GJQB 2F8EX 2HQDA 2CXEA 3ZNJ1 4C97A 3HVTA 1KONA 2F8MA 2ROEA 5GVQA 4JI2F 2ZJQQ 1S1XA 2LEPA 3D28A 1F60B 3BO2A 4Y2KA 1NLKL 3N28A 1R43A 2NUUG 1DRZA 4MTPA 4G3IA 2CWKA 2ZD1A 3KXDA 5LXRA 3NP5A 1RTHB 3UN3A 2MPUA 3M2UB 1TL5A 3MUVP 3IBCB 2KYXA 2WVBA 5IC4B 4FVCA 1NB7A 5SUHA 4ERDA 4MMOA 1B64A 1KOOA 5HBMB 5J1NA 5LSRA 1ICEB 3Q8RB 4QR0A 5HJXA 4R5PB 2G2OA 2PGCA 4JI3J 4LSZB 2DISA 5EX3A 3LPYA 2DY1A 1CULA 4YHHF 2HQFA 1XERA 4JBCA 5J2QA 2HFUA 4Y2AA 4OZ0A 4C8KA 3ZZUA 4FF2A 4OI3A 4X66F 1S72S 3KHLA 4JI0F 3FSIA 5F9LA 3VGVA 4MIWA 4DSJA 1XQIA 3QRQA 4F3OA 3W63A 2FJWA 1I6JA 4OHWA 3CDAA 4Q2MA 4UY8T 4USIA 1IKXB 1VYAA 4WP8A 2FHOB 3OTCA 1KWMA 2EKYA 3LP0B 5SZTA 1PYOB 5DG8A 2DGVA 1U8WA 1RA7A 3T1YJ 3BN4A 5KFDA 3MCOA 2GAGC 2VV5A 3ISZA 3VQTA 1TVRA 5FJ4A 1KP6A 2ZM6J 4H4KC 1UW9A 1F2GA 4NE9C 4I2QB 4J90A 5CYQA 2C3OA 2RIJA 1TK8A 4USUA 3V4IB 1TKTB 3JQKA 3CJKA 1BMQB 3FDSA 3GIRA 4KPCA 3JYTB 2ZHAA 3HI9A 4LVNP 4NYOA 1HR0J 3PR5B 1GTHA 3THVA 3FCWA 1WSVA 2NS1B 1YRUA 4QPTA 2I0XA 1NCLA 2PD1A 4R25A 3G2XA 1J5OB 1MWZA 4DFPA 3C19A 2BRKA 5HBMA 3CCLS 3R9LA 4DV1J 3AOAA 5BR8J 4A8YA 4X4QA 1GTEA 2J0WA 5HLFB 5GMKa 4R5PA 3OSPA 2BQUA 1GT8A 3ENQA 1KFDA 1RYSA 8RUCA 5A6PA 4YFUA 2VJUA 2CZ9A 4DX7A 4YQWA 1OY8A 2Q6CA 3PIOQ 4ED1A 1B3TA 1SJQA 4I6YA 4OQJA 2UXBF 2Y1RI 3R2CJ 3VVTA 2OMLA 4RWWA 3MTKA 1NAQA 2E1MC 4FP9A 2BV3A 3G82B 1FKAF 3CIZA 1IKXA 5B0AA 4B08A 1HBNB 4H4OA 1G1XA 1N36F 3D1OA 5KT7A 4KH0B 1DY3A 3FGVA 2WB4A 4M63A 5D0RA 4ED4A 3UN2A 4IH6A 3N5BA 2DBBA 3FVYA 2R8JA 5E3PA 3MCMA 3IP0A 4KRWA 3V4IA 1VBZA 1MW7A 2UUAJ 3N6MA 3A8KA 3VAMA 2Z2MA 5KG1A 2NXJA 2P9GA 3KDNA 2CNOB 3M8PA 2XLIA 2DPJA 5FLXU 3R5BA 1FI4A 4NLWA 2XM3A 1J5OA 1HWLA 2VFVA 2KFZA 1KTQA 4NLTA 4F26A 4I6WA 2R7RA 4F67A 2A3JA 3T5KA 5HQMA 4CLYA 1UVKA 5HLFA 1RTJA 2F63A 1ZAWA 4HHUA 1CBKA 3DRRB 4MK9A 2ZITA 1IJFB 4QIVA 4Y2IA 3PW7A 4UQGA 5AXKA 4YR2A 2MQ8A 5B0DA 2NR0A 3MMCB 1U48A 1HBMB 4DPOA 2KM8C 3G82A 1VCTA 1DFDA 2B7CB 2XY6A 1HBNA 1RK8A 5DETA 1HHSA 3NCPA 3R7NB 3BQ2A 5I42B 1FXRA 1QUPA 1S7HA 1S1WA 1PAUB 3KNAA 1AFJA 1L3UA 3IN5A 4RNFA 4U7CA 2FJVA 3J80Y 2I8EA 4LFCF 4I4BA 1X4DA 1K47A 4WJBA 3SSRA 2BJ8A 4QR1A 1Y3KA 3DXBA 1JXLA 4FYXB 4B3OB 1NJZA 3SDEB 2DD8S 4ITSA 2WBMA 2AF6A 4YDXA 2EC2A 2XMMA 1TKXB 4LF1A 1X60A 3OL7A 1LW0B 2XYGB 1YIJS 2EG2A 4X4UA 3M2RB 3SQGB 1GH8A 3M32A 2CQ0A 4B17A 3NGRA 2IM1A 1WEYA 3F56A 1RUSA 2RD5C 4Z37A 2VOPA 3DDKA 1IWGA 4M5DB 3CCQS 4JI1J 3NG8A 3UD5A 3DRRA 4OI4A 1TK5A 3KLHB 4ECTA 4KO0B 1U8SA 1F6TA 2U1AA 4CLLA 3D6TB 2UV8G 2UUBF 3ONQA 3CJ2A 2NSCA 1VR6A 4LRBA 3MMCA 2ILYA 4ZVRB 2ZH8A 3LF0A 2JC1A 4K59A 1FWLA 1RT6A 3KK2B 1O8BA 1NDPA 3CC2S 3IWLA 4NXNF 4ILLA 5C25B 3DLJA 4U8YA 1RBLA 3LWLA 5D4PA 4I2PA 3PCOB 4DV0F 1RAOA 2Q66A 2L3MA 3KG1A 4ZPVR 3IWXA 2IVYA 1CEZA 2RUSA 4EZ6A 2ATLA 4X62J 5F3ZA 5KAKA 5HVHA 1TL1B 4E0DA 2WCXA 1F0XA 3O5TB 1Q78A 1T9UA 3V2UC 4B3OA 2X3GA 1U1LA 2ZWPA 1R7IA 4A8QA 2JZ5A 5ETQA 3UNYA 1S1UA 1TKXA 2V9WA 2UU9F 1LW0A 1JJCB 3B54A 4J5OA 2N82B 4OZ2A 3HSZA 3M2RA 3R1LA 1R8CA 2YWGA 1NXIA 3SQGA 4X4OA 1M1GA 1KTVA 4HI1A 1RAIB 1ZTWA 2OFHX 3VR1A 3J81U 4YY3F 2DXDA 2HVDA 3IXQA 2YNFB 2CNLB 4HHHA 5MAOA 2ZDPA 5DDQC 4WFAQ 3V6DA 3HJFA 4M5DA 1K73T 1RHJB 3CCWA 4DPTA 3D1HA 3PRBA 1MMDA 4KO0A 1JJ2R 1V6HA 2G0IA 2DITA 4PWDA 4WYWA 4MYUA 2PMHA 2HHQA 5D0HA 4DX5A 1XN9A 2E1AA 4NXMJ 4NPOA 2UXCJ 2GQ2A 2CJYB 3TUIC 3A12A 2CNNB 1HIYA 2R2RA 1ZAVA 2MKKA 4QIEA 2ZKTA 3KK2A 4DR3J 4X4NA 2LA4A 1HI1A 1UJ6A 2YWFA 3CCRS 3K7RA 2XMJA 1KSPA 3MZIA 2HQGA 5GMDA 1PJ6A 2AJ0A 4Q8EA 5BYRA 5JMNA 1ZYQA 2KTQA 2A0FB 3TYTA 3PKMA 1CC8A 4OX9J 4RNOA 1S0OA 4YN3B 2GGPA 2HHPA 3GFYA 3C66A 2CNKB 3ISNC 1S0NA 2ZNZA 1JK9B 1HNVB 2E5IA 2DCUB 3IRWP 5D4OA 2MQLA 4I68A 1HNIB 2JWNA 3X3UA 1VRTB 4G65A 4F7VA 3Q8SB 1D1UA 1CS4A 1Q86T 1PBUA 4CWBA 2YNFA 2VKZG 4USWA 4RKUC 1CJUB 4PXEA 4ZPDA 4NLVA 1E6VB 2GJIA 1TL7B 2MGZA 2UV8A 2WHOA 1DQ9A 1KNZA 4PABA 2MSSA 3N01A 1HMVB 2GNKA 1RHUB 1FEHA 2KO1A 4ZP7A 3M30B 5FIIA 2OKQA 3TUJC 2YQ1A 2GCFA 1KS2A 4J9VA 4B9MA 4HACB 4ZS6A 3BPDA 1AB8A 1X4FA 2L9WA 2F65A 2MKCA 1OMSA 4YR3A 2YTCA 3DMJA 2XLKA 4GKKF 1RA6A 2AJ1A 1RWWB 1F5AA 1XNQJ 5IV4A 3GYXB 2DHHA 3ZC4A 3MCNA 1QJHA 5L38A 3SFGA 4KGZB 2RQ4A 5CA5A 4YB7A 2R7SA 2MZSA 1R0AB 4LUBA 1KD1T 2KVIA 3SZ2A 5RUBA 3ZZYA 3MDFA 1H72C 2VPZB 2VG7B 5IQ6A 3MEDA 3DI6A 4CYUB 2N7CA 2VH7A 4ZVHA 4B3SJ 5ETNA 1YJ9S 1HNVA 2V69A 3QAUA 1GEHA 5I4MA 4KR0B 2HS3A 1OY9A 5AE2A 2E9ZA 1RLCL 1ZS6A 1HNIA 2ACYA 5H9FJ 3PHEA 2ASJA 3VGSA 1VRTA 2EBEA 1X4HA 4N8OA 1AXQA 3HHLC 3MMJA 3GZ7A 5DDOC 1YK9A 2LU2A 2P8IA 5D0GA 1UZHA 1CJUA 4DU8A 4P2SA 2LA6A 3R1HA 2H48B 4DZDA 2C1EB 2WVCA 2YH0A 4RW7B 3Q22A 4DCOB 4TQSA 2E7VA 4EBEA 4QU7A 4RBTA 2DO4A 3M30A 5ETMA 2VBXA 2RMLA 5IWAJ 1KDNA 3D66A 4CNZA 2R7TA 3OTEA 5IXUA 1YJNS 3TANA 4PQAA 3HFKA 4UTGA 3MFHA 4LFAF 2ZBQA 2PMZD 3D6FB 1LNQA 3QWUA 4B9NA 3D54A 4GMKA 2R2SA 3NNHA 2F1FA 2HG4A 2Z8QA 2E5LF 1IR2A 1HQ2A 3T19A 3CJ8A 2FVQA 3L95X 4YDDB 2BJ1A 1HYSB 2M52A 1FNXH 5KFJA 2RDJA 4YP3A 3R97A 3GIMA 3AJ1A 1TTHB 3QFHA 1NJXA 2XCPA 1WTBA 1R0AA 2GQCA 1FRKA 1GFWB 3AOCA 2LU1A 4KC5A 3QO9A 3RW7A 4EUVA 2HQIA 4ZHRB 2APOA 3DLHA 4ID5B 2QG9B 2PFDA 4JYAJ 4AQYF 2MLYA 3MM8B 1FJGJ 2VQEJ 4DCPB 3UVJB 1TFYA 4UUWA 4QWDA 4RBVA 2CDQA 1KHVA 3BGLA 2VB6A 2MZJA 3KHGA 1U09A 3I96A 5KFYA 3DRPB 3IMQJ 2I5JA 4DR5F 3UD3P 4Z7YA 3AXMA 5BYQA 2FHJA 1KR4A 3T6JA 1RT4A 1C0TB 4DFMA 2XHCA 3BJYA 2NSBA 2BMBA 3GYNA 1WSRA 2UXBJ 4LBIA 4LF4F 3T1AA 2ZUGA 1YG0A 1BLUA 2CQ4A 4C4WA 4LR9A 1VI7A 2NLWA 2QE5A 1XK8A 2W24A 4CO3A 5ADZA 1MU2B 2HGLA 1AFIA 4CLZA 2HHWA 2K1RB 1GNKA 4ZDNA 3AA9A 4RR5A 4DU7A 2HAFA 5IS2A 1FERA 1FXLA 4LREA 3AD9C 3D0IE 4NASA 1NB2A 3IFEA 1S9GB 2HVIA 3M6WA 2RF2B 2MLXA 1MN7A 5I3UB 4K2JA 4BLGA 4J9NA 3G71S 1H2VZ 2EFQA 2B43A 4ZHRA 2RHSB 4IR1A 2ZBIA 4QBUA 4LF7F 2P6TA 3MM8A 3FEZA 4P2MA 1NDLA 3HSGA 5J1PA 1QVGR 4XTTA 2COLA 3Q86A 4C8MA 1BXNA 3TQEA 3Q0AA 2AX1A 3GCWP 2EXUA 2GVZA 3BB5A 1VLYA 4OL8A 2AT1B 5DQHA 3HP6A 2CQPA 4HI2A 2CZ4A 1C0TA 2ZNYA 1C0UA 3R5AA 4MT1A 1SH0A 2XI3A 1RBOB 1ZH5A 2IM2A 3MECB 4OZLA 3GR1A 1KBRA 2CJKA 2B56A 1XMOF 1TMJA 2KHDA 2VASA 1UFKA 1ZZNA 3GV8B 1MU2A 3EICA 5FDLB 1TMMA 4CNYA 2OPSB 2VONA 4M5MA 2POKA 5EDWA 1T03A 1JLGB 1I94F 3HHKA 3EDRB 2NXCA 4F0KA 3G9CA 3BQ0A 2CQ1A 4UOFA 1CSJA 2X7IA 5A0YB 3D67A 1S9GA 5I3UA 4QIWD 1UKUA 3OT9A 4AL6A 4ECRA 2OPQB 3HVAA 3I9ZA 1F3VA 1Q4RA 4XIUA 5K8OA 2K2PA 3P5BP 5J2PA 4LIRA 2RUGA 8ATCB 2K8GA 1S9EA 5E3RA 4EMDA 2GX8A 4U7UD 2E1PA 2VPYB 2WW8A 3K8VA 3QQCD 2M0GB 2DNMA 3N5FA 2HFZA 1R0CB 1HQEA 2MY8A 3U27A 1Z2ZA 2CPIA 2AV5A 3IM8A 1RISA 2ZDOA 4Q5VA 3P45B 3FQLA 4PG4A 1NK8A 1VRQC 2AYBA 1UFLA 2BYCA 4J9SA 3TZXA 4B9VA 4FXDA 3G86A 2IRUA 4TY9A 2ZKUA 1H3DA 3F44A 2DHXA 3V6KA 2HBYB 1N6QA 2W9BB 1FRXA 4JI8J 3C6UA 5EWGA 4XAKA 1SV5B 3AODA 4P75A 5FDLA 2KKHA 4AFFA 3RYLA 2H4YB 4JV0A 4PZVA 1SQFA 2GC8A 3VZHA 4X4PA 4IG3B 4DV0J 4PXBA 3KMSA 3QLHB 3MTJA 3BREA 2SXLA 1YZ7A 3RAMA 4DR1J 1X31C 2FJBB 3OUYB 2HS4A 1L3TA 1W25A 4PUOB 2CZVC 2YXLA 2W2NP 4ES3A 2RSQA 2QYCA 2XWYA 4CO4A 4MFBB 1RDRA 2W4CA 3TI0A 3QRPA 3J7ZT 3SYZA 3RGIA 1UMJA 4YY3J 2NZ4A 3OHAA 3O1LA 4TN2A 2C22A 3QSIA 5HL7Q 3QAEA 1TL3B 1WC6A 2PDAA 3HULA 3SI8A 1OIAA 2D41A 4X65F 3A1YG 4LRAA 3QGHA 1IKWB 2CUYA 3BO3A 3DXSX 4IRDA 1D09B 3W65A 1VBYA 4A8XA 3HO1A 1WI8A 4DV6J 2CPEA 3KJVA 3EDQB 4QW9A 2JOQA 4JI6F 3FRZA 1U6BA 1ZOTA 4HTIA 2LEBA 3TWZA 2W9BA 4OYOA 1UCNA 3HM9A 1SV5A 4KV8B 5A8WB 2HK2A 2ZOGA 2QMUB 1HHQA 1M1HA 4IG3A 4AL7A 4BWMA 3J81j 2VHGA 5KT2A 3QLHA 1SI9A 3MM7B 2Q1LA 1HHTP 4PQUB 3CCVS 3JSRA 3OUYA 3MAQA 2GO8A 3POTB 4PRFA 1PC5A 1WJ9A 3Q8QB 2CJAA 2PE8A 2V68A 2HK3A 3K2YA 2E5JA 4NLXA 1UETA 1NK0A 3DLBA 2ZJRQ 1UA0A 3OD2A 5HQ8A 1X8DA 2WOMB 2QSFA 2BQ3A 5HSPA 1WKKA 1YTYA 3AA8A 3P96A 4LJMA 4OLOA 4ZN3A 1Q81T 5GAHU 1XEZA 4I1TA 5J1EA 4Y65A 3CCES 1V3RA 4FNIA 3CNQP 5L46A 4R0EA 2D69A 1IR0A 3T3FA 2GIRA 5ETLA 3KLEA 4S0MA 2RILA 3UCGA 4F25A 3B82A 5KFKA 2MLZA 4P71A 2D74B 2KFNA 1TU0B 2FY8A 4DEZA 2CKWA 1YKWA 3HXMA 5IQQA 3OHBA 1HKAA 1U0SA 4KV8A 4GKKJ 2V5HG 5A8WA 2AJQA 2AMCB 1SJ1A 6AT1B 1NJWA 5KFPA 2BKPA 3JAMU 1Y0HA 3PRVA 2NXNA 2QSWA 1NSKL 4PPDA 4PQUA 1MWQA 1N5VA 4DUZJ 3POTA 3G6XA 1J5EJ 2HLUA 4USKA 5KFLA 4JI4J 2BEFA 4ZA1A 5KFOA 4AT1B 1JXVA 2CVEA 2OHDA 2YQ0A 1JLQB 1AROP 4P6QA 4IQXA 2J9DE 4KGMA 2WOMA 4EWTA 4ECYA 3KLGB 1WEZA 2QT7A 4HT5A 2D3O1 4P2FA 3T5JA 2ALYB 9RUBA 3ET6A 2V2ZA 2V4JA 1R6VA 3NS6A 1LQ9A 2ABYA 4ZJOA 1AUSL 3KUHA 4IFVA 1TK0A 4ZVGA 4NLUA 2RQKA 5JVHQ 4KAIA 3V81A 2N4CA 3BM7A 2W4DA 4ZLNA 3M9MB 1UFWA 4O3PA 2HQ3A 3BBCA 1VC6A 3V4MA 2UUTA 3DN9A 2FVSA 4QCLA 2XLJA 3VAGA 2BE2B 3PYDA 5DGAA 1U2RA 3T9ZA 4IFYB 4K4UA 6FDRA 2IYGA 3FBEA 1M0SA 1YITS 2Y0SD 3EXCX 2YNIB 1BUXA 3T1HF 1BHNA 1UTAA 2BUNA 2ZZNA 5HVFA 4CLKA 2EVZA 2HYIB 2QMWA 2CJBA 1T94A 2A10A 3ISND 3H2LA 1F2HA 4AQYJ 4QYZJ 3QZ8A 2HGMA 2DY9A 1GMWD 4OHVA 3NWGA 3M2VB 3T41A 5ITHA 3KLGA 2M88A 3RB4A 1PYTA 2D3UA 4C7QA 1MN9A 1GX6A 4LF2A 4NRUA 4Q8FA 3CJSA 3QT8A 3VAKA 3I0RB 2ZOFA 2E7WA 4KSEB 2IMOA 3GLJA 1Y9OA 3M7VA 4PG6A 2GW8A 3CJ5A 1T7PA 2NXUA 3H20A 1RKIA 1SKUB 2LECA 3C6TB 5CZVA 2B6AB 1CJVA 3LGHA 1WF0A 1SKRA 3M8RA 2I9SA 1YJUA 2AX0A 2CPHA 1YI2S 2KG1A 4AYBD 3SSSA 3W2VA 4M5IA 2NYIA 1U6FA 4UOCA 3HZEA 5IC6B 4MIBA 4BCAA 1U1MA 3N9UC 2Z56B 1FF2A 4IFYA 4JV5F 4X64F 1PC4A 1C2PA 2IBOA 4F02A 1K0VA 1OWXA 4I0WA 2HWIA 4CTAB 4ILMA 2HFVA 3AT1B 1JKHB 2YNIA 1B7FA 4FBTA 3GILA 3K5LA 1X4BA 1FRMA 2PC6A 2ZH3A 3RRKA 4DPYA 4O4RA 3NOCA 3QBCA 1NBEB 4F0HA 4QWCA 1JQGA 2OUGA 4ETXA 1FX4A 1CJTB 3C2PA 3A3PB 3FKBA 1X9SA 2I6WA 3NAHA 5KFWA 1WF2A 4QW8A 3MUTP 1RAEB 4OZ5A 1S77D 1N8RT 1O51A 3AY0A 1W2BR 5DM6Q 8AT1B 5K8MA 2PA8D 4YB5A 3HHLD 1N34J 3VAHA 4RBUA 1RSCA 4ZK7M 2CQCA 1WHYA 1YWXA 3ZZ0A 4U9RA 2ZOMA 4BHQA 4YUDA 2ZH1A 1TAUA 3C15B 5KOXA 3TA2A 2HWHA 3SV3A 3C6TA 2KL8A 4QWEA 2B6AA 5B0CA 3IBWA 1XMOJ 4CO5A 1TZ0A 4L76A 1F9FA 4ES2A 3H4BA 4DV4J 3T1YF 3C3LA 1JLCB 4KY3A 4ZKAA 5ETOA 3OXFA 3PY8A 2QA2A 4CTAA 2FJDB 5AXNA 1JKHA 2JJ4D 1P27B 3RAXA 1KQSR 3LGMA 4LF6J 2V63A 2VBZA 4NZ7A 2V4QA 1HR0F 5KFBA 1EARA 1RWXB 3JB9k 2Y0BB 1CJTA 1N0UA 2YKAA 3Q89A 3RB0A 1ZA2B 4P9SA 4P7VA 1NKBA 3GG0A 1NEEA 4O23A 4OYBA 5F8NA 2J0SD 3I0SA 3PX6A 1QE1B 4ED5A 4QWAA 3QT6A 3TP2A 1B0PA 1TKZB 5GAGU 1HBUB 1WD6A 1LFPA 2BANB 2XWXA 4NLYA 4DSEA 1SJFA 3H98A 3TJAA 3OFEA 2HHUA 2CPZA 2KU7A 3O6QA 2IJNA 5ETTA 3BDPA 1RTDB 3ZXWA 1FX2A 2R8GA 3CW2C 3IG1B 2RNEA 3C15A 3EZOA 2MZQA 1JIHA 4WKRA 2B9YA 5K14B 4WXWA 4IKAA 1BC6A 1EX8A 2YH1A 1Z1ZA 3MCSA 2JEIA 2DEJA 4MKYA 4GKJJ 3BSNA 1LWEB 2R7VA 3LP1A 1L3VA 2IRYA 1U45A 2OMOA 2AYMA 1WACA 7FDRA 1Q8KA 4ZMMA 4CLUA 3MM9A 1K1SA 3BH6B 1LV5A 2IDLA 5D15A 1QSSA 4L72B 5KOWA 2DHGA 3EXYA 2VUGA 3W2WA 5L1KA 3ZZPA 3L3CA 4WFXA 2UUAF 1HL6A 5DM7Q 3HVWA 3BYPA 3IA0A 3MAHA 1K8AT 4WFBQ 4TY8A 3P6YC 3DDIA 1VJQA 3D7SB 2A1BA 1QE1A 3DRSB 5E33A 3GQCA 1Q5YA 2CQGA 3CVKA 3H0PA 1T3NA 1TKZA 2XI2A 2Z58B 1NDKA 2BANA 2IAJB 2EI5A 5AJ3J 4RW8B 6FD1A 3DRXA 4QJVA 4OI0A 3D4JA 3H25A 2HHVA 3DCAA 4ZIWA 1YDLA 3HF5A 3W8PA 3MPYA 4NLDA 2IJFA 1RTDA 2DPIA 3E01B 2CQDA 2R7OA 3ZZRA 2VD3A 3DKDA 3IRXB 1S59A 2DK2A 5ETKA 2QLBB 5KT4A 1X0FA 1TL4A 4Y34A 1APSA 4Z7CA 2UXDJ 2DCLA 4RW9B 4ICLB 4K4TA 4FBUA 4DUTA 3UE2A 3G6ES 4R8UA 4YR0A 2GFFA 5HP1B 5KG0A 3TUPA 1FK9B 2CPJA 4DX6A 1M5OC 1H73A 3UD4P 5KT5A 2YVSA 4FZVA 1RQ0A 4WE1B 5A8KB 1GXTA 4F2SA 4O0NA 1FFSB 3R27A 2H54B 2YNHB 2V67A 2CJXB 4TU9A 1EAYC 3ENAA 1S97A 4LRDA 4H4KA 1TUGB 2DIVA 4OYMA 4UT4A 4LQ9A 4CDIA 5JUMA 2F9JA 2G4BA 1SC3B 3O8WA 1ZA1B 2V4RA 2KRBA 3UDEA 1U2FA 1YBAA 4OYXA 4X2BA 1RAHB 4OZNA 1JJ4A 4RW8A 4DV2J 4PEOA 2KT2A 1IBLF 4BWJA 2JLEA 3QRRA 2XY7A 3C14A 5KG4A 5EGYA 2R3VA 3E01A 3J7AN 2HS0A 2B4OA 3PJ9A 1D8ZA 2QFJA 2O67A 1QAYA 3QZ7A 1GMUA 4I64A 1WC5A 1KLMB 2CJ9A 1FJEB 3OV7A 2HWTA 2XMKA 3GB0A 5KFZA 1WDDA 4CIOA 4OHYA 2JRSA 1EZZB 3NEKA 3FMBA 2V9KA 2RE1A 2CPXA 2CPYA 4JI5F 1VQ5S 2YKQA 4OJHA 3WC2A 3HKZD 1S79A 4ICLA 3DHWC 3R7BB 3TJ8A 3K0JA 2EWHA 3LO3A 2KHCA 4ZJLA 2V2QA 4YEAA 3G96A 4F4AA 3OW2R 5HP1A 3ZTQA 3QIDA 2CAJA 1HWIA 2KM8B 2DGOA 2DRBA 3QMQA 4LSLB 2WK4A 4I69A 3Q24A 4O3RA 5DLFA 3PX4A 2FZCB 4X62F 2KN4A 3OTDA 1T9XA 4PWWA 4RWXA 2PMWA 4WE1A 5A8KA 5M2PA 2Z2LA 3FBBA 2VJVA 5DQIA 2YNHA 5K5MA 1NDCA 3H5UA 3GE9A 3H42A 2VODA 1CJKA 1UZDA 1Y00A 2OEKA 5DG7A 2DR9A 2DH7A 4W4MA 4QU6A 4ED2A 5J2MB 4BDPA 4DN0A 1IBCB 4DG1B 1P8GA 3K89A 4K4VA 2GJ2A 2GIFA 5E3CA 3KMQA 4G6VB 2AEFA 2KXHA 4Y2MA 2FLOA 1CQNA 4LR7A 2YKNB 2ZVSA 1KLMA 1MMLA 4OMFG 5HMYA 2L9DA 1SJ4P 3JSMB 1UWBB 1RADB 4USVA 1GAOA 1NHUA 2UXCF 2EK6A 2U2FA 3P49B 1B4SA 2ZJPQ 3B6BA 1G4CA 4IOBA 2EC0A 1Y4ZB 2BJ9A 3IS9B 4HH0A 2F5GA 4DR3F 1IUJA 4IRKA 2HFSA 1RTIB 2DGSA 2D9OA 2OPRB 3HVTB 4IQMA 4DR4F 2VC0A 5F3TA 3T1HJ 2LQBA 2CA9A 4LSLA 4PXCA 4K0KF 5M2UA 3M05A 3I32A 2J8SA 3DDNA 1WHVA 2LXUA 1UA1A 1N33J 3OTOJ 2ZH6A 1TUVA 2ZD1B 5AE1A 2YPZA 3WDOA 3CDWA 1SIWB 2RU3A 1V5IB 5AE3A 2B7BB 4I7FB 2C28A 1U1PA 2FHJD 1HARA 5F0UA 1HW9A 4OYAA 2QA4S 4KHPJ 2PI4A 3E51A 3D9BA 1ZBTA 3TAMB 1RTZA 4HKQA 4KPYA 5E5NA 1VQ4S 4CCHA 4A8FA 3MI7X 4EU0A 2HNZA 3T5HA 2NPFA 5MLCV 4DG1A 2N3LA 1CULB 4LMZA 4DQIA 3V6HA 4M5LA 1QTNB 1Q5VA 3DYAB 1FCAA 4LBPA 2DR5A 2AHOB 2B8PA 4QIGA 4UF4A 3OJSA 4J9QA 2IVMA 1RBAA 1HPZB 4DF8A 1B0TA 3JTNA 3JSMA 4JI7F 3CD0A 2PIIA 3G4SS 2IHR1 3D0HE 1FKOB 4XK8C 3EM1A 3D2WA 3BF4A 5B0BA 1U0HA 2MKSA 3IS9A 3D5MA 4M1KA 3W5ZA 1XNQF 2ZFHA 3RB6A 1RTIA 2VOOA 1TVRB 2OPRA 1TELA 2ALZA 4WZQA 3E2EA 3FSXA 1SC6A 5CYQB 2JHEA 1RT7A 3KK3A 4F2RA 1H38A 4UZCA 3CJKB 3QJJA 1BQMA 2AJ4A 4IO9Q 2OH2A 1IKVA 3CF5Q 2DIUA 2BKNA 4B3SF 2CQ3A 4RPFA 5D4NA 2DNLA 4I7FA 2XO7A 3UDLA 3DOMA 2GJFA 2QA1A 3CJ0A 2YX4A 3H90A 5EWEA 3TAMA 3ITHA 4TYBA 3KJQB 2PI5A 4ANCA 4OFZA 3O44A 5A76A 1XIQA 5C2CA 1EKRA 1PO6A 4ZPWR 2OIHA 4O0IA 4F8RA 4M5NA 1AYEA 3DYAA 4MK8A 1I1GA 5AXLA 4ILRA 2M7SA 4MKVA 3TA1A 2GO9A 3TX0A 2QLWA 4NLQA 3MM5A 2LEAA 1HPZA 2EK1A 1WG5A 5IWAF 1IQZA 2NZCA 1TQLA 2Y8WA 1C1BA 1S76D 1FKOA 5CCMA 2KJVA 1WKJA 2CQBA 4H4OB 2MY7A 1UVMA 5KG6A 2HKEA 2HSEB 3QATA 2BVZA 3M8QB 1XBWA 1I5OB 2J6UA 3DLKB 3ZTOA 3AB4B 1HNWJ 3PVXA 3KG0A 3IWNC 5AT1B 3L7OA 2CQ2A 2DVIA 4ZLJA 2D3ZA 2WBRA 4OIXA 1JLFA 2J9CA 4D3GA 2LQ9A 4IOAQ 3RRHA 1N5YA 3M8PB 2AEMA 1A7GE 3CCZA 5DDRC 2KXFA 4KKOB 4JYAF 1S57A 1U26A 4NZ0A 3IO1A 2JC0A 2MQOA 1FJGF 2VQEF 4DXLA 1VRUB 5HMXA 2XYPB 4ED6A 2B5JA 1B70B 2KZZA 1S9FA 3CCMS 1DJ0A 2ZUAA 4CH0S 1WI6A 1RTJB 4FKYA 5KFUA 4L74A 2XCAA 1JLAA 4PYAA 1FE0A 2AP6A 2CRLA 1GMWA 3DOKB 2MJNA 2OAUA 4F3QA 2X1BA 2UP1A 2GMHA 1VLOA 1RWUA 1DLOB 3M4XA 5JJBA 2VG6B 3NOGA 4G1PA 1PGZA 1QAXA 2GMLA 1CVJA 4BC9A 3BGFA 3D68A 3CO0P 4Y0FA 3MWBA 4KBIA 1LWXA 3RB3A 1S1WB 3KJNB 2MKIA
chains in the Genus database with same CATH topology
1DY3A 4M5GA 2F65A 4PZVA 2QX0A 4CYUB 5ETKA 3HT0A 3KUGA 1RU2A 4CWBA 1EX8A 2F63A 4M5KA 4CRJA 3KUHA 5ETNA 1RAOA 3HD1A 1RB0A 3UDVA 3HD2A 4AD6A 1HKAA 1Q0NA 5ETVA 1RU1A 1RTZA 1F9HA 1G4CA 3ILOA 3QBCA 4CYUA 3HSDA 4M5LA 5ETPA 1CBKA 1IM6A 1TMMA 5ETQA 3ILLA 4M5MA 2CG8A 2BMBA 1KBRA 3ILJA 3HSGA 5ETRA 5ETSA 3UDEA 1EQMA 3MCNA 5ETMA 4M5HA 3HCXA 1HQ2A 3MCMA 3HSJA 3IP0A 4M5NA 4F7VA 1TMJA 4M5IA 5ETLA 3UD5A 5ETOA 1EQ0A 5ETTA 4M5JA 3ILIA 3HSZA 3MCOA 3KUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DY3 A;  4M5G A;  2F65 A;  4PZV A;  2QX0 A;  4CYU B;  5ETK A;  3HT0 A;  3KUG A;  1RU2 A;  4CWB A;  1EX8 A;  2F63 A;  4M5K A;  4CRJ A;  3KUH A;  5ETN A;  1RAO A;  3HD1 A;  1RB0 A;  3UDV A;  3HD2 A;  4AD6 A;  1HKA A;  1Q0N A;  5ETV A;  1RU1 A;  1RTZ A;  1F9H A;  1G4C A;  3ILO A;  3QBC A;  4CYU A;  3HSD A;  4M5L A;  5ETP A;  1CBK A;  1IM6 A;  1TMM A;  5ETQ A;  3ILL A;  4M5M A;  2CG8 A;  2BMB A;  1KBR A;  3ILJ A;  3HSG A;  5ETR A;  5ETS A;  3UDE A;  1EQM A;  3MCN A;  5ETM A;  4M5H A;  3HCX A;  1HQ2 A;  3MCM A;  3HSJ A;  3IP0 A;  4M5N A;  4F7V A;  1TMJ A;  4M5I A;  5ETL A;  3UD5 A;  5ETO A;  1EQ0 A;  5ETT A;  4M5J A;  3ILI A;  3HSZ A;  3MCO A;  3KUE A; 
#chains in the Genus database with same CATH topology
 3M8Q A;  3EPI A;  2W9C B;  1RU2 A;  4PCQ A;  1MSW D;  3DLK A;  4UOG A;  4MKB A;  3S1T A;  1OO0 B;  2QV6 A;  4P7T A;  1WKL A;  4D3H A;  2C3M A;  3R5C A;  1REV B;  2C2Z B;  4DSL A;  4FPI A;  1VIS A;  1N5Q A;  2Y1J A;  3RZA A;  3CC7 S;  4Y6I A;  1LOU A;  4ECU A;  5CCL A;  2AYE A;  2XYH B;  1UAW A;  3D0G E;  2O1P A;  2B9E A;  2JEG A;  2GA7 A;  3H4D A;  4EFA C;  4KKO A;  4C8Y A;  3U1N A;  3DGV A;  1JXE A;  1N0V C;  4L3N A;  2XNR A;  1BE4 A;  3M32 B;  2FC9 A;  1GX5 A;  3A8J A;  1F9E B;  4RNM A;  2IBK A;  1VRU A;  4C9D A;  3CWJ A;  4C0O C;  2C3Y A;  2VFR A;  4IOC Q;  4DL2 A;  4NRT A;  4B3T J;  1OS5 A;  2CJQ A;  4MKA A;  3K59 A;  4J9K A;  4J9M A;  1WUU A;  4WZM A;  4NYZ A;  5GAH I;  1NK7 A;  3DOK A;  2MZ1 A;  2H4W B;  3UI3 A;  1K0T A;  4N47 A;  1L3K A;  3CSK A;  1W2I A;  3EVO A;  2VDH A;  5KFX A;  2OFG X;  3CC4 S;  3RU0 A;  4DL6 A;  2W01 A;  2AGO A;  4CRJ A;  1H2T Z;  2ZC4 A;  3HHL A;  1DLO A;  4CZC A;  3NS7 B;  3PTW A;  2VG6 A;  2DR8 A;  3OL6 A;  1Y5I B;  4GVB A;  1F1B B;  5HRO A;  4TLR A;  1IWA A;  1TV6 A;  1S7I A;  3KUE A;  2M5Y A;  1RT6 B;  4LRF A;  1BQN B;  2PO4 A;  4LVO P;  2W9C A;  2EBG A;  3H7H B;  4I2P B;  5F0W A;  5DS7 A;  2XMA A;  3LP2 A;  2XS7 A;  1GXU A;  1RAB B;  2DGQ A;  2YKP A;  3TRG A;  1H7X A;  4C8Z A;  2P9C A;  4ZP6 A;  1REV A;  3GP9 A;  3HK2 A;  2VPX B;  2BXJ A;  1X4C A;  4XO0 A;  4J9P A;  3KOA A;  3C8Y A;  4RNH A;  5IM0 B;  4NEZ A;  3UCZ P;  2GHV C;  1S1U B;  3MUM P;  4ZP8 A;  5DGB A;  2Z30 B;  4CQ1 A;  5L39 A;  1VC0 A;  1QAJ A;  2HHH F;  2CDR B;  1DBD A;  3R5D A;  4EK2 A;  2FHM A;  3Q2T C;  5LJ5 Y;  3NL0 A;  2MZR A;  1R3N A;  5B09 A;  3OJU A;  1H2U X;  2VA2 A;  2XGQ A;  2FLP A;  2B4U A;  3CIM A;  1FEE A;  4G1I A;  1IBL J;  2G0J A;  3V6D B;  1W7W A;  1YBT A;  3TQ1 A;  1CLF A;  1VK3 A;  1N52 B;  2QLX A;  3KHH A;  3CMQ A;  1YGY A;  3EZU A;  4NML A;  4WF9 Q;  2PEH A;  4EGL A;  2D1C A;  1YSJ A;  4PWD B;  2ZH4 A;  4OI1 A;  2HVE A;  3JTP A;  2DNO A;  4XDD A;  2FIU A;  4DOZ A;  2RS8 A;  1S6U A;  4ER8 A;  1OY6 A;  4K7Q A;  5C5J A;  4JI5 J;  1SH2 A;  4JI8 F;  1VIX A;  3CTR A;  2IDE A;  1VHF A;  1BQN A;  5ETR A;  1M5V C;  2OPP B;  3QGP A;  1HNZ J;  1XMQ F;  3F0N A;  1WOR A;  4YS2 A;  2Z57 B;  5E7O B;  1P1L A;  1PKU A;  2EG1 A;  3I31 A;  1KQF B;  1ZZF A;  1YJR A;  2CFX A;  4DR1 F;  4DL4 A;  2YBV A;  4CT8 A;  3W1Y C;  1F5C A;  1UPM B;  2GGP B;  1DTT A;  4UW2 A;  2H5E A;  3K57 A;  2CPD A;  1Q8I A;  2LVW A;  3DOL A;  5C7P A;  5IM0 A;  3WC0 A;  1PCA A;  1CPZ A;  5C2G A;  4KGV B;  4DLE A;  2XBP A;  1K44 A;  3BSO A;  4P74 A;  1U02 A;  3MEK A;  2WVF A;  1D0E A;  4K4Z A;  1P6T A;  3W61 A;  3SIP B;  2M9K A;  5KFV A;  5B0F A;  1C4A A;  1CS4 B;  2IA0 A;  3P8B B;  1DHM A;  4GRS A;  4ED7 A;  1UEU A;  1FRH A;  2XO6 A;  3RR8 A;  1OPI A;  2MGZ B;  1R8A A;  2BE9 B;  2V0N A;  2VFU A;  4ZVO B;  3L7U A;  1HW8 A;  2HEK A;  2IMW P;  3FK4 A;  5ETS A;  2F8H A;  4FPR A;  1JNZ B;  4ZCM A;  4NA1 A;  2DR6 A;  4O4G A;  3OR2 B;  4M8L A;  4MIA A;  4O3S A;  3PEH A;  1FDA A;  4DV6 F;  3HD1 A;  1T9W A;  3GWC A;  4DV5 J;  3WIU A;  4DR7 F;  1YJ7 A;  4PYD A;  3NNA A;  1NND A;  3FQK A;  1SKW A;  3DMJ B;  4PXD A;  4AE5 A;  4LF9 F;  1WWH A;  4FVM A;  2MKH A;  2OPP A;  1B0V A;  3FC9 A;  3BPS P;  1HBO A;  1FNO A;  1WEL A;  4DR4 J;  2DNR A;  2XMT A;  2DNZ A;  5DDP C;  2M8D B;  1RAJ A;  3ZZZ A;  1PJ5 A;  4HR2 A;  2NCK L;  3Q83 A;  4K0K J;  5K8N A;  2ZBC A;  2FDN A;  4OHX A;  3VWS A;  2ZE2 A;  4ECS A;  5LXY A;  4P2X A;  3MPV A;  5CD4 A;  3MED B;  3DI6 B;  3VCD A;  3ZTR A;  5DO2 A;  2KG0 A;  1T9V A;  4MJK A;  5CYM A;  1UEK A;  4ZCI A;  4RL1 A;  3BKU A;  2BKO A;  2BJ7 A;  2GVD B;  2HFN A;  4CLF A;  1EET B;  2PSZ A;  3HD2 A;  4F4Z A;  5BYS A;  2RQC A;  1DAX A;  1MG7 A;  3EZ5 A;  4HL9 A;  4ZN1 A;  2AZ3 A;  2DB1 A;  3UFC X;  2Y3Y A;  5K9F A;  1D9D A;  1VQM S;  4W90 B;  1W26 A;  3MPW A;  4WFZ A;  1AW0 A;  3SMZ A;  3BSA A;  1WC3 A;  2FLN A;  3OTB A;  3A4T A;  3D3B J;  4ZLP A;  3OR2 A;  4JI7 J;  3LAL A;  4TKT A;  2XZD B;  4KGK A;  2BJ3 A;  3LOU A;  4DUY F;  1UPP A;  4BS2 A;  2G1D A;  1RE1 B;  4URS A;  2W7O A;  1VGY A;  3D1Q A;  1FT8 A;  4ANE A;  1MLA A;  1RI7 A;  2E9R X;  3TVZ A;  1RT1 B;  2M2B A;  2AKW B;  3F41 A;  1X0P A;  2L9N A;  4CO0 A;  3N79 A;  2W2P P;  3NGT A;  4M94 A;  2RH3 A;  1SL1 A;  4ZVF A;  2XSJ B;  5L1L A;  3ZNU A;  3MHY A;  3KTQ A;  1U1Q A;  3QO9 B;  1URN A;  3H2V E;  3MEE A;  4Y2C A;  4DUZ F;  1J5E F;  3BDE A;  2ZH5 A;  1I51 B;  1SUQ B;  5J2N A;  3SXL A;  1XR7 A;  3RJM B;  1VQL S;  4J91 A;  1Y10 A;  4JI4 F;  2B4P A;  5I3Q A;  4V19 J;  3MOJ B;  1Q79 A;  2GVD A;  5KFR A;  1EET A;  3AJD A;  2VDI A;  2R8H A;  3HX9 A;  2OD6 A;  1UJ5 A;  4ZPA A;  1RHM B;  4BC7 A;  3J7Z 5;  3NS5 A;  3FMW A;  2I5J B;  4B3M J;  2NXE A;  2ILZ A;  5GAG I;  4K4W A;  3K5O A;  2QRR A;  4IH5 A;  1S6P A;  1RKJ A;  1OPZ A;  5EN1 A;  1HA1 A;  1RT4 B;  1VC5 A;  4O3O A;  4N77 A;  4K50 A;  4URQ U;  1F5B A;  2HRU A;  2IA6 A;  3A3O B;  3ZTS A;  5C42 A;  2H65 B;  1WDT A;  2KI2 A;  4ZJQ A;  2OD4 A;  3VQS A;  2MST A;  4Q2L A;  3HZG A;  2KB2 A;  3EVW A;  2Y1L B;  4XDC A;  4J9U E;  3BGR B;  3J81 Y;  2V8H A;  4YOE A;  4K5R A;  5EX0 A;  1AUD A;  3LTO A;  2YX1 A;  1H6K X;  2DNH A;  4NA3 A;  1JWW A;  1RT1 A;  1WOS A;  3CD5 A;  5F8L A;  2BM0 A;  4OJG A;  2DH8 A;  2XSJ A;  2OP5 A;  2OO4 A;  2OI2 A;  2PA3 A;  3AFG A;  2R2U A;  2HQC A;  4HVZ A;  2W25 A;  1GXL A;  2B9X A;  2IY5 B;  2FHK A;  1SUQ A;  2R4F A;  2HNY A;  1Q53 A;  2V8P A;  4J9O A;  3TVY A;  4DL3 A;  1N88 A;  2G0C A;  3UN5 A;  3KHR A;  4EYH B;  2L48 A;  1WTF A;  3R2D J;  3HT3 A;  2DRD A;  4U8V A;  2KRR A;  3PFO A;  5IT4 A;  2VL1 A;  2WSF C;  1LW2 B;  4WU2 A;  1R0B G;  4B9S A;  5H9E J;  3EMT A;  4ZVE A;  3SCI E;  2GVZ B;  4OX6 A;  1NPK A;  5LOQ A;  4PG7 A;  1C0U B;  5HO4 A;  3OL9 A;  2OSQ A;  5GAE I;  2MKY A;  1U1K A;  3J7A 1;  3RAQ A;  9ATC B;  2FLL A;  5LT5 A;  2HBQ B;  3AQO A;  3GJR B;  5DJB A;  4ECQ A;  3BGR A;  3PXG a;  4C8O A;  1RHR B;  2KVQ E;  4TXS A;  5HQL A;  1SC1 B;  3PHT A;  2ATC B;  3Q8P B;  5KT6 A;  1G7C B;  1T03 B;  4Q0B A;  3GV5 B;  1RWV B;  3IR7 B;  2UZA A;  1BWV A;  3I87 A;  3EYZ A;  4NLR A;  4DR2 F;  4UUX A;  3PZP A;  5F8J A;  3DLE B;  2FUG 9;  1N56 A;  4FYW B;  1L3S A;  3GIK A;  1S1T A;  5D78 A;  1CQM A;  1HD1 A;  5J2P B;  4C98 A;  2KZM A;  2LQJ A;  1S9E B;  3GJT B;  2K06 A;  3CJ4 A;  1U6Z A;  2Y8Y A;  4A8S A;  2D7S A;  2F4F A;  1SKS A;  3PW0 A;  1KQK A;  1XR5 A;  3RUB L;  1PAE X;  3J80 U;  1SJR A;  1LW2 A;  1R89 A;  1HQE B;  3R8Y A;  1YHQ S;  1N34 F;  2KDO A;  3L9Z A;  3FCH A;  4A8M P;  2GV1 A;  1FDN A;  3A8E A;  2FC8 A;  3EGV A;  3H40 A;  3PNI A;  2P5V A;  4WP9 A;  1WOP A;  1RAC B;  3K5N A;  4QOT A;  4JUZ A;  3V5R A;  1FJC A;  3ILO A;  2DNG A;  4QWB A;  4I6A A;  1N6Q B;  4UQT A;  2J6T A;  3K5M A;  4CLW A;  1EHW A;  3W3S A;  3C6U B;  2IRX A;  4L75 A;  1X4E A;  4B9U A;  3J7Y I;  2QL7 B;  3HMJ G;  4QQB A;  1U25 A;  1NKE A;  4DV4 F;  1EB0 A;  4OYP A;  3OBI A;  1RWO B;  4IH7 A;  2JX2 A;  5KFE A;  1KOH A;  2DNQ A;  1DQ8 A;  4RNN A;  3QWP A;  1VQP S;  3VAL A;  4WK3 A;  1ACM B;  1RTH A;  3M2U A;  2P9E A;  3NKY A;  3PAC A;  3LAK A;  5LMN F;  1H98 A;  2WZ1 A;  3GSD A;  4B02 A;  3DGP B;  4LF6 F;  1QTM A;  3DLE A;  1QSY A;  2UUC J;  3MM6 B;  4RJV A;  2JNJ A;  2QZ8 A;  4OZJ A;  2JSX A;  4N5S A;  3IAM 9;  1FE4 A;  2CIM A;  4TQR A;  3U02 A;  2DXF A;  2HHH J;  5CQG A;  2JLF A;  2PN6 A;  2BDP A;  1PSD A;  2QFI A;  2HW3 A;  2W4P A;  3BKF A;  2HZV A;  4ELT A;  3PJX A;  3BSC A;  4FS2 A;  5D6G A;  3LH2 S;  3CCT A;  2YY3 A;  2BW7 A;  3MR3 A;  2WSE C;  1ZM3 A;  4DF4 A;  2ASL A;  2E1C A;  4DX8 H;  3PR4 A;  1XR6 A;  1N54 B;  1VK8 A;  2HFO A;  4NCA A;  1IM6 A;  4LF5 J;  2W8K A;  3GG1 A;  3FFI B;  3UWT A;  4IRC A;  4DV3 F;  1D9A A;  3GCX P;  3B4M A;  3K8W A;  3KJV B;  7FD1 A;  1NK6 A;  3LP0 A;  3W9J A;  4NLP A;  1REG X;  2RDD A;  2C2K B;  4E2F B;  4LR8 A;  2WAQ D;  4K5S A;  1NH7 A;  3LW5 C;  3DM2 B;  4GKJ F;  4U67 Q;  1RCO B;  1Y7P A;  1X4A A;  4I2Q A;  3QSY B;  2MKJ A;  3ILI A;  4JV1 A;  1XMQ J;  4IO1 A;  1TKT A;  1IJE B;  1KFS A;  3JYT A;  1H0H B;  1S1V B;  1VMB A;  1X9M A;  3PEJ A;  1ROF A;  4OV6 A;  4CH7 A;  2VC1 A;  1UW4 A;  2OEM A;  4HHJ A;  3HVR A;  3ICL A;  2W7A A;  3DGP A;  1NK5 A;  5A2Q Y;  3MM6 A;  3US5 A;  3QYY A;  1EIY B;  3VTI A;  1TR0 A;  3FBF A;  3R5J B;  1YJV A;  1QY7 A;  3QNW B;  2I2Y A;  1SB6 A;  3BGU A;  2CYY A;  1ZM9 A;  4LRC A;  2MQM A;  4WFY A;  3TVK A;  4C11 B;  5JVG Q;  4KB7 A;  5KG7 A;  5AJ3 F;  5J1E B;  2LP4 A;  2V6A A;  3M8W A;  2MMY A;  4DL5 A;  1WC0 A;  5HI7 A;  3H5S A;  4M5K A;  5HAO A;  1HWK A;  2Y9H A;  3CD7 A;  3CED A;  1N5T A;  3CJR A;  1YRT A;  3EPG A;  3KLE B;  1JMT A;  3BV8 A;  4C2M A;  4WP3 A;  1O6X A;  2CQH A;  2IPO B;  3OLA A;  3NXZ A;  2OLW A;  1HWU A;  3FFI A;  1B99 A;  1ITP A;  1DZ5 A;  4DR7 J;  2HLT A;  1A6L A;  3VV2 B;  2UXD F;  4LSN B;  3CJQ A;  3DM2 A;  5AXM A;  5KFM A;  2XGP A;  4LF9 J;  3PW4 A;  3CJ3 A;  2V34 A;  2E1R A;  3MMB B;  1S10 A;  3GIJ A;  1BGX T;  1RU1 A;  1RCX B;  3JSY A;  3S8S A;  3GR0 A;  1RHQ B;  1HFE L;  1S1V A;  1QVF R;  3ZZT A;  3HSJ A;  1U4B A;  3CCJ S;  3TEH B;  3C16 B;  3WX8 A;  4N76 A;  2KYZ A;  3M9O B;  4B9L A;  2X51 A;  1PYS B;  1JB0 C;  3LAM A;  2YWK A;  1VIO A;  1NRK A;  2BW2 A;  2AZ1 A;  3P4U B;  1YJW S;  1RB0 A;  4KHM A;  2HUR A;  4WKY A;  4FS1 A;  1QUV A;  3PFE A;  1MWY A;  1OYE A;  2N4D A;  1M90 T;  1UEV A;  1EQ0 A;  3NWR A;  4C11 A;  3ET6 B;  1HD0 A;  2IFX A;  3HPO A;  4DV2 F;  1D9F A;  2V4J B;  1Q8L A;  3EUN A;  1YBU A;  2RHQ B;  1SVD A;  4IFV B;  1NKC A;  4F36 A;  1JNR B;  4OV1 A;  4F4X A;  2LCW A;  4TYA A;  5L1J A;  2Q6B A;  1HBM A;  5F8H A;  3D6H B;  4WU3 A;  3V81 B;  3PKY A;  3G87 A;  1Y11 A;  1P9Q C;  3DHX A;  3W66 A;  2KJW A;  5I42 A;  4DUY J;  5D3G B;  4NOH A;  5HJY A;  3UQS A;  3NY0 A;  2C2O B;  2R9L A;  3OVB A;  4LSN A;  4CLT A;  3I5A A;  2O01 C;  2BOP A;  5CD4 H;  2EFV A;  2EFN A;  4DV7 J;  1Z4U A;  3MMB A;  1R6Y A;  1QSL A;  2YKO A;  2ZH9 A;  3L09 A;  3TAR A;  3SDE A;  4ES1 A;  3C46 A;  4AND A;  1YRX A;  4P72 A;  3BO4 A;  2HAI A;  3C16 A;  1FHT A;  3DFE A;  3AD7 C;  4PG5 A;  1GQE A;  2F3J A;  4XPE A;  3LA0 A;  1Q8B A;  1R8H A;  2ZH2 A;  2Y1I A;  2AYG A;  1IBM F;  4NLS A;  2KT3 A;  4KFB B;  1P1T A;  1X5T A;  3PYG A;  2E9T A;  2LMI A;  4NWB A;  2BAB A;  3KNG A;  3N4W A;  5G4D A;  3A3N B;  1JX4 A;  2J7U A;  4URG A;  3KLH A;  4DMZ A;  3A8I A;  3EWG A;  1HWJ A;  5BXI A;  1PJ7 A;  2DEI A;  1RJJ A;  1VQO S;  5D4L A;  5KFC A;  3AQP A;  3FJ2 A;  2QEX S;  4ED0 A;  2EPI A;  2LQ5 A;  3ULH A;  4EZ9 A;  5IFM A;  1Y5L B;  2HIQ A;  2O66 A;  2RKI B;  2M70 A;  4MYT A;  2LYV A;  4RZR A;  1KN6 A;  2RS2 A;  3LQV A;  3UW1 A;  1CJV B;  4F4W A;  2KXN B;  3VGT A;  4UZB A;  1K9M T;  4OX8 A;  1E6Y B;  5D3G A;  2QO3 A;  3W2V B;  4GO7 X;  5C25 A;  1AZS B;  2GHP A;  2BR0 A;  1DTQ B;  2VA3 A;  1FRJ A;  4PWU A;  1IBK F;  3JQJ A;  1HI0 P;  1K1Q A;  4UOH A;  3MR2 A;  2EKN A;  3PW2 A;  1FFG B;  1TL1 A;  4ZVS B;  2MDA A;  3AB2 B;  2D9P A;  4KTQ A;  3NGS A;  5GAD I;  4Q43 A;  3H2U B;  1N33 F;  3OTO F;  5CZX A;  1LXJ A;  3W60 A;  4IR9 A;  4P73 A;  4RW6 B;  2WON B;  4DL0 C;  3V6J A;  2QLF B;  3E3X A;  3W7B A;  1JJH A;  4KFB A;  3G6Y A;  4KHP F;  1ZPW X;  4JOU A;  2WRM A;  1FXD A;  4FYV B;  4DS4 A;  4B3R F;  1V3S A;  1NM2 A;  1SQG A;  3KFW X;  1Y3J A;  3THT A;  5IOL A;  5T14 A;  1YX2 A;  2LLZ A;  2FPH X;  2BQR A;  3TUZ C;  3SCL E;  5CHC B;  1GMV A;  1XMB A;  3ELH A;  1VJW A;  3BBF A;  3BBB A;  3O3L A;  3CE8 A;  4DPU A;  4RUH A;  4OYZ A;  5D0E A;  3M6V A;  2RKI A;  3GON A;  4OJ3 A;  2ROG A;  1HNX J;  1EKS A;  1FWP A;  1WF1 A;  3CB4 A;  1RT2 B;  2NPI A;  4NEY A;  1E6Y A;  4CT9 A;  1UVJ A;  4AUK A;  1NO8 A;  2ZHO A;  2C3U A;  1AZS A;  1IR1 A;  3TZY A;  4JI2 J;  1TFW A;  1DTQ A;  3UNG C;  5IT9 Y;  2H5J B;  4CH1 A;  3H5Y A;  3W9I A;  2IJR A;  5DLG A;  1R8B A;  4NLG A;  4KHR A;  2M4M A;  4DR2 J;  4ZPC A;  1ULR A;  2OGU A;  3GII A;  1D3W A;  2C2R A;  3R7S B;  2E5H A;  4ZCL A;  1QD1 A;  4KH1 B;  4RUC A;  3VAF A;  4RW6 A;  2WON A;  3BQ1 A;  1PG5 B;  2JEF A;  1UJ4 A;  1WG1 A;  2N7Y A;  1S6Q B;  3KLF B;  2XZT B;  3I0S B;  4DQP A;  2WSC C;  4C3L A;  3L7P A;  3JAM Y;  4YHH J;  2FYX A;  5B0E A;  2MB0 B;  2X1A A;  2HZA A;  2M8H A;  1E6V A;  2QC3 A;  1TL7 A;  4FKX A;  2Z0G A;  5CXT A;  3RBD A;  4X66 J;  4RU9 A;  3SSQ A;  1HMV A;  4JI0 J;  4E8U A;  4A8K A;  1U2C A;  4USM A;  3H5X A;  3GFZ A;  1NK4 A;  4OI6 A;  2VF3 A;  4DQS A;  3FBC A;  2V8V A;  1RWN B;  3CCS S;  1JLE B;  1LFW A;  4HAC A;  3KK1 B;  1NPR A;  2PFF B;  2BOA A;  5HN0 A;  1R8P A;  2MTL A;  3GMG A;  4C0H A;  3JS9 A;  5L9N A;  3CDB A;  5B0G A;  2IM3 A;  1RT2 A;  3LP1 B;  3G8T A;  1UP1 A;  2XC9 A;  1X4G A;  2KFY A;  4FF1 A;  1RLD A;  2HIY A;  2J6S A;  2R8I A;  3JSB A;  2JL9 A;  4USJ C;  2OTL S;  1YQH A;  5F8G A;  3G6V A;  3MM9 B;  1EJ7 L;  1S49 A;  2NRE A;  2VIH A;  2VG7 A;  1HNW F;  3TNV A;  3W2W B;  3CDE A;  4CYU A;  3OLB A;  5LMN J;  1VDH A;  5K20 B;  3FSY A;  3FCV A;  2XMW A;  3VVU A;  3ETM A;  2UVW A;  4DHV A;  4C3M A;  4ED3 A;  1WG4 A;  2HHT A;  4UST A;  4TY8 B;  3UDV A;  1N5S A;  1NUE A;  1S6Q A;  3KLF A;  4A47 A;  4CO1 A;  5A8R B;  1TKD A;  3DU5 A;  3TZW A;  2DGX A;  3M8S A;  4M5H A;  1S0M A;  1QM9 A;  2HBZ B;  4V1A k;  1NJI T;  3TO8 A;  2G13 A;  4DWI A;  3FUY A;  5KFF A;  4IYQ A;  1CC7 A;  4RW7 A;  1IM4 A;  1ZM4 A;  1X5O A;  4FXW A;  1OYD A;  1VBX A;  2HRT A;  3QFW A;  2DGW A;  1LKZ A;  4FN5 A;  1T02 A;  3UO0 A;  4RO0 A;  3SCK E;  2FTR A;  5A2Q U;  1M5S A;  3IGV A;  3N0V A;  3VF0 B;  4CP5 A;  4DV3 J;  1JLE A;  1KVK A;  3KK1 A;  1Q1K A;  1N36 J;  1X7V A;  2RRA A;  3TEG A;  2VBY A;  3ZZO A;  1XC9 A;  3KG4 A;  3TAP A;  1VFJ A;  3RTV A;  2ZBR A;  1FRL A;  2VIC A;  4F3M A;  4HTJ A;  5EWF A;  3KJF B;  4DR6 F;  2HMI B;  1MNE A;  1HYS A;  2JFK A;  4PG8 A;  2VQF F;  4OYI A;  4CO2 A;  4R8U B;  1EQM A;  5LMU F;  1G3O A;  2RQM A;  4HDG A;  4HDH A;  2HVZ A;  4U6P A;  1FRI A;  1T95 A;  1LWC B;  3ILL A;  5E0O A;  2XMU A;  2ZZM A;  1FVQ A;  1NJY A;  4M5J A;  2CQI A;  3EJM A;  4ID5 A;  5KFA A;  1KLN A;  5LJ3 Y;  1S5Z A;  4L6V 3;  3RBX A;  3UVJ A;  3GSI A;  4ELU A;  4Y28 C;  4G1Q B;  5A8R A;  5DQG A;  3O2I A;  4WFN Q;  2HND B;  3DRP A;  1BWE A;  2X1G A;  2RRN A;  5KFH A;  3M1V B;  4KT0 C;  1S0V A;  1U24 A;  2WW4 A;  3MOZ A;  2BJE A;  2K3I A;  1A9N B;  2VFT A;  3MMA B;  2K3K A;  3C14 B;  4B3T F;  5GAE U;  4IUF A;  1RAG B;  5EUH A;  3GYG A;  1V3Z A;  2OSR A;  4GC7 A;  2PT0 A;  1DAR A;  3RBE A;  2VFS A;  2XTJ P;  3Q23 A;  2CPF A;  3K17 A;  1NZ8 A;  4ED8 A;  3M8Z A;  4M95 A;  1X5S A;  4J7C A;  3TAQ A;  1FVS A;  1XTZ A;  2RAQ A;  3PO4 A;  3I5C A;  2K1R A;  1TUW A;  1SBR A;  4LFC J;  1UVI A;  4DDF A;  3U7J A;  2Z2Z A;  1EP4 B;  2HMI A;  1T9T A;  2DNP A;  2O5D A;  4N7T A;  3CD6 S;  2OEJ A;  3HFV A;  2DJW A;  3PW5 A;  3ADA C;  3BS9 A;  3EGN A;  2RF2 A;  1TP7 A;  3AH6 A;  1BY9 A;  3HCX A;  1LWC A;  4C6A A;  3M9N B;  3KLI B;  2BZ2 A;  4U7U K;  4ZIV A;  1IXK A;  4OLP A;  4DSK A;  3PRD A;  4JP8 A;  3DU6 A;  3WHI A;  2ASD A;  2C2D A;  2DH9 A;  2AJF E;  4G1Q A;  1N4L A;  3T6B A;  3NGD A;  3MR5 A;  3IC1 A;  1QDU B;  5LSO A;  2HND A;  3QGI A;  1CJK B;  3M1V A;  4EO6 A;  3TZZ A;  5H9F K;  1XJW B;  1KEK A;  3K58 A;  4X4R A;  3I5B A;  5F8I A;  3S01 A;  4ZCK A;  4ECZ A;  3MMA A;  1R27 B;  2AGP A;  2QIF A;  2UUB J;  4J9R A;  2YKM B;  5KTQ A;  3MEC A;  3I6P A;  1FDB A;  1U7L A;  1WOO A;  4ATN A;  4N41 A;  5LL6 d;  3J7Y U;  2YNG B;  5E3Q A;  4NXN J;  3TOQ A;  4IG0 B;  2QL9 B;  2OPS A;  1WHX A;  2AD9 A;  4MH8 A;  2B8Q A;  1T11 A;  1XWL A;  1ZTT A;  3LUY A;  1BQX A;  1JLG A;  1FKP B;  3OFF A;  1S6O A;  2Z4P A;  1EP4 A;  2IVF B;  2QYG A;  1NPP A;  3HHN B;  3FEY B;  3MF5 A;  5A0Y A;  3KYL A;  3TA0 A;  3ZO7 A;  1HNZ F;  4C0B A;  2DXE A;  1N48 A;  2VPW B;  2OPQ A;  5ETV A;  4BBY A;  4FF3 A;  3KLI A;  5F9N A;  4K4X A;  2UU9 J;  2DYA A;  2JDJ A;  2LFV A;  3FZ2 A;  4RLE A;  1PIL A;  2XG8 A;  4KQZ A;  1IBM J;  2P2C B;  1VHI A;  3VZI A;  1N32 F;  4DLG A;  4KJI A;  1R31 A;  4K2X A;  2YQ3 A;  4QZV B;  2J7K A;  1ELO A;  4J37 A;  2RDI A;  1S99 A;  4LFB F;  2FVC A;  1SL2 A;  4DI6 A;  5LSL A;  2LKZ A;  3MD1 A;  4X4T A;  2HNZ B;  2JH3 A;  4F4Y A;  1FTR A;  5H9E K;  1WC1 A;  1RXO B;  4ID8 A;  4RUB A;  1MRO B;  2J0X A;  2Z2Y B;  2YKM A;  3OXG A;  3NBP B;  2W9A A;  2I38 A;  2DRA A;  1PIE A;  2F40 A;  2P6S A;  1V5V A;  4P52 A;  3GTY X;  2EFG A;  1RWK B;  4L73 A;  1DUR A;  2YNG A;  5HAT A;  4IG0 A;  5CYJ A;  3NCQ A;  3JQM A;  4AXJ A;  4N56 A;  4DV5 F;  3W62 A;  5ETP A;  1SCJ B;  3OPK A;  2B3T B;  1U1R A;  4F0M A;  1U0H B;  1FKP A;  1IBK J;  2E44 A;  4F50 A;  5KFI A;  2I1R A;  7AT1 B;  3MEG B;  3QPI A;  2V8D A;  2E66 A;  4WK1 A;  4GVL A;  3KWM A;  4TU8 A;  1RT7 B;  4DFK A;  4JB8 B;  4PUO A;  1YJT A;  3B4D A;  3KK3 B;  3GJS B;  1BQM B;  3AXK A;  3U1M A;  4LF8 F;  2VU5 A;  3SFU A;  4MFB A;  1TAQ A;  1IKV B;  4ELV A;  4O44 B;  3VGU A;  3IR5 B;  1SXL A;  3UDC A;  2R2T A;  2R8K A;  3DOM B;  5E3A A;  2C42 A;  2LQ8 A;  3M8Y A;  5K8P A;  4CI0 B;  3ITH B;  4ZPT R;  2G2Y A;  1TL3 A;  1Q7Y T;  5IT9 U;  3ETO A;  4B3R J;  3T5L A;  1VOM A;  2IC3 B;  4MK7 A;  2ROP A;  1IKW A;  3NAI A;  4A4J A;  1VQN S;  2BJD A;  1T8E A;  2GHW A;  4OZ3 A;  1MRO A;  2FJE B;  4LIW A;  4H54 A;  2R7W A;  3AD8 C;  3GFH A;  3NBP A;  2HBR B;  5EHH A;  2B0G A;  4OYW A;  2RT3 A;  4RU2 A;  2XB2 D;  1LWF B;  3MM5 B;  1XNR F;  4PAA A;  4DPW A;  4GC6 A;  4HLB A;  4H4M B;  2FZK B;  3FZB A;  2XNQ A;  4AL5 A;  2FVP A;  2DNK A;  1RT3 B;  4DS5 A;  2E29 A;  1C1B B;  3QIP B;  3PG9 A;  3Q8U A;  1FTC A;  1PBA A;  3KKF A;  3GFX A;  1BD6 A;  2OEL A;  5U47 A;  3Q8V A;  4ETZ A;  2E5G A;  3MFI A;  1UL3 A;  1P9Y A;  2HHX A;  1IQT A;  3MM7 A;  2AW0 A;  1RHK B;  2HRY A;  3MEG A;  5KG2 A;  2Q3P A;  1FJ7 A;  1MMN A;  1M1K T;  2Q79 A;  2F4V F;  3AAW B;  4DQR A;  4NYP A;  1JLF B;  4K8R A;  2VKR A;  2MQP A;  1KHW A;  2V2V A;  5KT3 A;  2RB7 A;  4O44 A;  3VAI A;  3H8Y A;  1L5U A;  1N5Y B;  2A2D A;  1LXN A;  3MR6 A;  2FZG B;  4FNH A;  4HT7 A;  2UVU A;  3W5X A;  2V8G A;  3X1L B;  2W1B A;  1WHW A;  2QGF B;  1X9W A;  1RT5 B;  5E41 A;  1UWA A;  3F73 A;  2CVI A;  2B5J B;  4DSF A;  2BA9 A;  3HHD A;  4K4S A;  2IC3 A;  3P3D A;  4AD6 A;  1O0P A;  5L1I A;  4B3M F;  2QJ3 A;  1JLA B;  2HHS A;  4K4Y A;  5GME A;  4L3K A;  2L41 A;  3S7R A;  3RRG A;  2L08 A;  2FJX A;  3OFH A;  3TJ9 A;  5F41 A;  3M6U A;  3B78 A;  4WTY A;  4WBF A;  4LFA J;  3HKW A;  2ZVI A;  5DRK A;  1LWF A;  4TNO A;  4H4M A;  2E5L J;  2DR7 A;  4NI2 B;  1RT3 A;  2QLJ B;  2YWE A;  3QIP A;  4QYR A;  2LDI A;  1RAF B;  3NMA A;  3QT5 A;  4ZPB A;  4NX9 A;  1JLB B;  3DNC A;  2BM1 A;  4DJB A;  2E7X A;  2C2E A;  4ZVQ B;  4LBH A;  1KKH A;  2BBE A;  3R6G B;  2FY1 A;  2BAC A;  4WYL A;  5LM7 E;  1G2E A;  2ZEJ A;  2HVH A;  2R7U A;  1S48 A;  3W64 A;  4J9L A;  4HH1 A;  3MXH P;  2XUL A;  1JLQ A;  4I56 A;  3CPW R;  5DG9 A;  2ZBP A;  3IM9 A;  2NUH A;  5IV3 A;  5B7W A;  4ECV A;  3CUN A;  4ZVP B;  3L4B C;  4YB1 P;  3DC2 A;  4NCG B;  3R3T A;  3BR9 A;  4DR5 J;  1RT5 A;  2QX0 A;  2VG5 B;  2J8A A;  4PR6 A;  3CO9 A;  4DFJ A;  1S4E A;  2O3D A;  4I67 A;  4HYK A;  2FGC A;  4B9T A;  3N6L A;  4O3Q A;  2J76 E;  3QJL A;  4NL5 A;  4RX6 A;  1J2V A;  4LF4 J;  3TW0 A;  4F4K A;  3NCR A;  4KYZ A;  3I56 S;  3EGW B;  2V2K A;  2AGQ A;  1KVI A;  2W2Q P;  2EEY A;  2K7K A;  1LEO A;  2WTF A;  1M5K C;  2J7W A;  1SH3 A;  2ADC A;  3HHL B;  1VQK S;  2XMV A;  2X1F A;  5IZH A;  4GVB B;  4DN9 A;  2BE2 A;  2K7J A;  4NI2 A;  5HRO B;  1TV6 B;  4DR6 J;  1FO1 A;  4NLO A;  4FYD A;  1G6B A;  2VQF J;  3BEG B;  3OVS A;  5LMU J;  3BKT A;  1JLB A;  2ZH7 A;  4A8W A;  3WQP A;  1H7W A;  1SPB P;  2C2N A;  5GAD U;  1NHV A;  5G0R B;  3LP2 B;  3ENW A;  4WPA A;  3GV7 B;  3W5Y A;  2H9Z A;  2EW9 A;  3OL8 A;  2CG8 A;  1Q16 B;  3MR7 A;  2ACM A;  2MHE A;  4OI2 A;  4LF7 J;  1OJ4 A;  3SV4 A;  5THW A;  3BH7 B;  2KT5 A;  2N3O A;  4DCJ B;  2R7X A;  2IYI A;  3VHQ A;  2G9O A;  3M2V A;  1UVN A;  4CM0 A;  4ECW A;  5C24 B;  3Q8Y A;  3IBF B;  4TVA B;  4NCG A;  3HDS A;  5KFQ A;  1GK8 A;  3U1L A;  1RWM B;  1YZ6 A;  4JI3 F;  4DBQ A;  2VG5 A;  3I0R A;  4JV2 A;  2GMJ A;  2YWW A;  2DO0 A;  2ADB A;  5CH7 B;  3DRY A;  2W7P A;  5IT0 A;  5HVG A;  1RWP B;  2EFP A;  2W2O P;  4FYY B;  3NGU A;  2CG4 A;  2XSF A;  3RG6 A;  1HLW A;  3RW6 A;  4CM2 A;  1C1C B;  3CXC R;  4WIQ A;  3D3C J;  4Q44 A;  3PDN A;  3MPU B;  5HK4 A;  2A2C A;  3AHP A;  3H59 A;  2BRL A;  1RAA B;  4KIA A;  1SQE A;  2MXY A;  1I94 J;  4XPC A;  2FJA B;  3PO5 A;  2ZM6 F;  1URR A;  3EGZ A;  4Z2X A;  2XZW A;  3MD3 A;  4DZ6 A;  4IDK B;  3JTO A;  2J5A A;  1Y5N B;  5G0R A;  4Y00 A;  1RYR A;  2DT9 A;  3AJ2 A;  1WC4 A;  5T41 A;  2FD2 A;  2B4V A;  3E8O A;  4RW4 B;  1C4C A;  2MQQ A;  2IM0 A;  3VAJ A;  2YWH A;  2F7V A;  1FA0 A;  4Y3C A;  1ZET A;  1DTT B;  3NNC A;  2J9D A;  1KRP A;  4DL7 A;  3WIV A;  3DOL B;  1SL0 A;  2UUC F;  1U1O A;  2GIQ A;  4DV1 F;  4PKD B;  5BR8 F;  3W8G A;  5C24 A;  3HSD A;  2NQP A;  4NMX A;  1VQ6 S;  1FD8 A;  2QMX A;  2RRB A;  4Q45 A;  4Q7A A;  3W9H A;  3NMR A;  2A18 A;  1F3F A;  3TX8 A;  1ZPV A;  1FNM A;  5M2R A;  2C3P A;  2XS2 A;  2LXF A;  2JEJ A;  1KQG B;  3GPA A;  3RBZ A;  2G1H A;  1ZAX A;  2ZWO A;  1SJ3 P;  3MUR P;  1RP5 A;  1SC4 B;  4HEA 9;  4O4G B;  4LF5 F;  1C1C A;  4PPZ A;  4ZIT A;  3QJP A;  2JVO A;  1NHK L;  3I82 A;  2A6O A;  1D8Y A;  2QN6 B;  2W2M P;  2X3D A;  3BYR A;  1I3O B;  3D6M B;  1JLC A;  4YME A;  3ZTP A;  2MZT A;  4YB6 A;  4ECX A;  4IDK A;  1HBO B;  4M5G A;  3OSN A;  1Z2L A;  4QPX A;  2C2M B;  4LQ3 A;  4RW4 A;  2XY5 A;  2ZE2 B;  2NYH A;  1KC8 T;  2AU0 A;  3B8H A;  3M6X A;  5JXS A;  4DQQ A;  5CYM B;  5CAA A;  1ZM2 A;  1N32 J;  4ENO A;  3R5G A;  2RVJ A;  2WVD A;  3MAA B;  3TR5 A;  1HBU A;  4QYZ K;  2AIR B;  1Q7L B;  2V94 A;  3FEX B;  4LFB J;  4X84 A;  3JXO A;  2XS5 A;  1YLX A;  3BN7 A;  2VZ9 A;  4NCB A;  3SQO P;  2DKO B;  4USH A;  5I3P A;  3HJV A;  4X65 J;  4EEY A;  1IVZ A;  2DHA A;  2A6M A;  4DPX A;  1FWK A;  3WX4 A;  3IG1 A;  2H51 B;  2AJ2 A;  1OSD A;  2JVR A;  3CDU A;  3BGO P;  4V19 X;  3LGN A;  1NZA A;  1B7Y B;  2QTW A;  2H1Y A;  4N8N A;  5K14 A;  2WVE A;  3P5T L;  4JI6 J;  4CLP A;  4W98 A;  2MJU A;  1NK9 A;  2EFO A;  1CG2 A;  5FLX Y;  4UY8 5;  2DTJ A;  5HMW A;  2KH9 A;  1SIZ A;  1VS3 A;  4GO5 X;  1LWE A;  5F8M A;  3HFZ B;  2ERR A;  2GQQ A;  1OSC A;  3SEO A;  3UR0 A;  2BX6 A;  2DHS A;  3GU0 A;  5KFS A;  2XEX A;  1VQS A;  3CMA S;  3WZ0 A;  1OQ3 A;  3DLL Q;  3UR3 C;  5CAB A;  2W8L A;  5A6W A;  5DZ7 A;  2CWX A;  3CGI A;  2DNN A;  3LAN A;  1VQ8 S;  3CCU S;  3FNN A;  4LF8 J;  3G8S A;  1U47 A;  1HQU B;  3MEE B;  3CJT A;  1M5P C;  3BR8 A;  5J2N B;  2CAD A;  3DRS A;  2UUW A;  2XHW A;  1T05 B;  2QA4 G;  4OX7 A;  3MAA A;  2BE7 D;  4A46 A;  3PJW A;  1QAI A;  2DNY A;  2FQQ B;  3QT7 A;  5KFT A;  4U96 A;  2HPU A;  2IAJ A;  3I9V 9;  2HZC A;  1Q95 G;  1Q0N A;  1U49 A;  4A48 A;  2J9E A;  2MEW A;  4R0J A;  3NRB A;  2YPY A;  1VBK A;  1FD2 A;  4JI1 F;  3WBZ A;  1QLN A;  3PM9 A;  4C3K A;  3KUG A;  4NZ6 A;  5KG5 A;  3ZFV A;  1S6P B;  2FVR A;  3IRX A;  2FB0 A;  3T9N A;  3PYF A;  4CLS A;  5T7L B;  4AXI A;  1WEX A;  1VQ7 S;  4O3N A;  1NME B;  3OFG A;  3PIP Q;  4FXV A;  2UVR A;  2V50 A;  4EBD A;  2UVV A;  1FES A;  2B51 A;  1XNR J;  1NU4 A;  5HAN A;  1T9Y A;  1NSA A;  1T3O A;  4ZP9 A;  5C42 B;  4OZ1 A;  4RW9 A;  1VQY A;  1AA1 B;  2H3E B;  3I4P A;  4TLQ A;  2QL5 B;  4MAK A;  4ZLL A;  4WII A;  1RGV A;  4C48 A;  1FK9 A;  1IN0 A;  3OQ2 A;  3EX7 B;  4DV7 F;  3N6N A;  3PV8 A;  4WCE Q;  1KVJ A;  4FF4 A;  3ILJ A;  1V9O A;  3I55 S;  3RR7 A;  3OR1 B;  1WNE A;  2F4V J;  4QR2 A;  5D77 A;  4DSI A;  1NSQ A;  3Q2S C;  2MHN A;  3MPD A;  1F9H A;  3CME S;  2AQ4 A;  4WWS A;  1HQU A;  5HMZ A;  3OVA A;  3NGK A;  1OQ6 A;  4EYI B;  2FGO A;  5L9X A;  4F04 B;  3A13 A;  5B08 A;  2ZC3 A;  2HNY B;  3OXL A;  1T05 A;  2YX7 A;  2R42 A;  2MQN A;  1IKY B;  2DGT A;  4U95 A;  4NA2 A;  2PEB A;  4WTO B;  3G8Q A;  3LWM A;  1AT1 B;  3HT0 A;  5D8H B;  2M3D A;  2RJZ A;  2LXI A;  1J27 A;  3HHE A;  1H74 A;  4EBC A;  3CT9 A;  2HGN A;  2AWZ A;  2RU9 A;  2J0Q D;  5BJR A;  2JFD A;  3CUL A;  1X5P A;  3FRY A;  5KFG A;  5T7L A;  4NXM F;  4ZOS A;  2B9W A;  3EE3 A;  4LT6 A;  3MGJ A;  3DLG B;  3LPE A;  1M5H A;  3THP A;  2MYF A;  4C8N A;  3IR6 B;  4E98 A;  1DQA A;  3IGN A;  2JLG A;  2GS8 A;  4OJ1 A;  3SBM A;  4ALZ A;  3BZQ A;  5KFN A;  1NH8 A;  4X4V A;  1A0O B;  1S1X B;  5KG3 A;  4Q0B B;  4ZVT B;  3R6L B;  3S6E A;  5E2Q A;  2WB1 D;  3K5P A;  4KE5 A;  4OX9 F;  3I4H X;  3OR1 A;  4EO8 A;  2XQC A;  4TU7 A;  4C8L A;  1YVF A;  3HLU A;  4ZVU B;  4EI2 A;  3EVM A;  1U1N A;  1RZM A;  1S1T B;  3NLC A;  5L8R C;  2VBW A;  4QIF A;  1VQ9 S;  1LK7 A;  4X4S A;  5DZ6 A;  4A8O A;  2ZZT A;  2LDY A;  4OHZ A;  5J2M A;  2Q43 A;  1IKY A;  2ZHB A;  2IIH A;  4FDF A;  3PX0 A;  3AOB A;  3QGG A;  4P10 A;  1LK5 A;  3KDO A;  5J2Q B;  3IAS 9;  2D3O R;  1NSP A;  1Q82 T;  1S12 A;  3UPF A;  4KGX B;  2YKN A;  2GAH C;  2G2Z A;  3ENV A;  3UCU P;  5H1S V;  1UWB A;  4RUA A;  1FFW B;  1S4F A;  3SCJ E;  1FDD A;  2DGU A;  1HI8 A;  1T0T V;  1O5J A;  2OTJ S;  2H5I B;  2OJ3 A;  1UVL A;  3PYE A;  2GZO A;  4WXO A;  2ASY A;  2R7Q A;  3DLG A;  4W92 B;  2AEJ A;  1HNX F;  2F9D A;  3KLV A;  5FD1 A;  4X64 J;  4JV5 J;  3GJQ B;  2F8E X;  2HQD A;  2CXE A;  3ZNJ 1;  4C97 A;  3HVT A;  1KON A;  2F8M A;  2ROE A;  5GVQ A;  4JI2 F;  2ZJQ Q;  1S1X A;  2LEP A;  3D28 A;  1F60 B;  3BO2 A;  4Y2K A;  1NLK L;  3N28 A;  1R43 A;  2NUU G;  1DRZ A;  4MTP A;  4G3I A;  2CWK A;  2ZD1 A;  3KXD A;  5LXR A;  3NP5 A;  1RTH B;  3UN3 A;  2MPU A;  3M2U B;  1TL5 A;  3MUV P;  3IBC B;  2KYX A;  2WVB A;  5IC4 B;  4FVC A;  1NB7 A;  5SUH A;  4ERD A;  4MMO A;  1B64 A;  1KOO A;  5HBM B;  5J1N A;  5LSR A;  1ICE B;  3Q8R B;  4QR0 A;  5HJX A;  4R5P B;  2G2O A;  2PGC A;  4JI3 J;  4LSZ B;  2DIS A;  5EX3 A;  3LPY A;  2DY1 A;  1CUL A;  4YHH F;  2HQF A;  1XER A;  4JBC A;  5J2Q A;  2HFU A;  4Y2A A;  4OZ0 A;  4C8K A;  3ZZU A;  4FF2 A;  4OI3 A;  4X66 F;  1S72 S;  3KHL A;  4JI0 F;  3FSI A;  5F9L A;  3VGV A;  4MIW A;  4DSJ A;  1XQI A;  3QRQ A;  4F3O A;  3W63 A;  2FJW A;  1I6J A;  4OHW A;  3CDA A;  4Q2M A;  4UY8 T;  4USI A;  1IKX B;  1VYA A;  4WP8 A;  2FHO B;  3OTC A;  1KWM A;  2EKY A;  3LP0 B;  5SZT A;  1PYO B;  5DG8 A;  2DGV A;  1U8W A;  1RA7 A;  3T1Y J;  3BN4 A;  5KFD A;  3MCO A;  2GAG C;  2VV5 A;  3ISZ A;  3VQT A;  1TVR A;  5FJ4 A;  1KP6 A;  2ZM6 J;  4H4K C;  1UW9 A;  1F2G A;  4NE9 C;  4I2Q B;  4J90 A;  5CYQ A;  2C3O A;  2RIJ A;  1TK8 A;  4USU A;  3V4I B;  1TKT B;  3JQK A;  3CJK A;  1BMQ B;  3FDS A;  3GIR A;  4KPC A;  3JYT B;  2ZHA A;  3HI9 A;  4LVN P;  4NYO A;  1HR0 J;  3PR5 B;  1GTH A;  3THV A;  3FCW A;  1WSV A;  2NS1 B;  1YRU A;  4QPT A;  2I0X A;  1NCL A;  2PD1 A;  4R25 A;  3G2X A;  1J5O B;  1MWZ A;  4DFP A;  3C19 A;  2BRK A;  5HBM A;  3CCL S;  3R9L A;  4DV1 J;  3AOA A;  5BR8 J;  4A8Y A;  4X4Q A;  1GTE A;  2J0W A;  5HLF B;  5GMK a;  4R5P A;  3OSP A;  2BQU A;  1GT8 A;  3ENQ A;  1KFD A;  1RYS A;  8RUC A;  5A6P A;  4YFU A;  2VJU A;  2CZ9 A;  4DX7 A;  4YQW A;  1OY8 A;  2Q6C A;  3PIO Q;  4ED1 A;  1B3T A;  1SJQ A;  4I6Y A;  4OQJ A;  2UXB F;  2Y1R I;  3R2C J;  3VVT A;  2OML A;  4RWW A;  3MTK A;  1NAQ A;  2E1M C;  4FP9 A;  2BV3 A;  3G82 B;  1FKA F;  3CIZ A;  1IKX A;  5B0A A;  4B08 A;  1HBN B;  4H4O A;  1G1X A;  1N36 F;  3D1O A;  5KT7 A;  4KH0 B;  1DY3 A;  3FGV A;  2WB4 A;  4M63 A;  5D0R A;  4ED4 A;  3UN2 A;  4IH6 A;  3N5B A;  2DBB A;  3FVY A;  2R8J A;  5E3P A;  3MCM A;  3IP0 A;  4KRW A;  3V4I A;  1VBZ A;  1MW7 A;  2UUA J;  3N6M A;  3A8K A;  3VAM A;  2Z2M A;  5KG1 A;  2NXJ A;  2P9G A;  3KDN A;  2CNO B;  3M8P A;  2XLI A;  2DPJ A;  5FLX U;  3R5B A;  1FI4 A;  4NLW A;  2XM3 A;  1J5O A;  1HWL A;  2VFV A;  2KFZ A;  1KTQ A;  4NLT A;  4F26 A;  4I6W A;  2R7R A;  4F67 A;  2A3J A;  3T5K A;  5HQM A;  4CLY A;  1UVK A;  5HLF A;  1RTJ A;  2F63 A;  1ZAW A;  4HHU A;  1CBK A;  3DRR B;  4MK9 A;  2ZIT A;  1IJF B;  4QIV A;  4Y2I A;  3PW7 A;  4UQG A;  5AXK A;  4YR2 A;  2MQ8 A;  5B0D A;  2NR0 A;  3MMC B;  1U48 A;  1HBM B;  4DPO A;  2KM8 C;  3G82 A;  1VCT A;  1DFD A;  2B7C B;  2XY6 A;  1HBN A;  1RK8 A;  5DET A;  1HHS A;  3NCP A;  3R7N B;  3BQ2 A;  5I42 B;  1FXR A;  1QUP A;  1S7H A;  1S1W A;  1PAU B;  3KNA A;  1AFJ A;  1L3U A;  3IN5 A;  4RNF A;  4U7C A;  2FJV A;  3J80 Y;  2I8E A;  4LFC F;  4I4B A;  1X4D A;  1K47 A;  4WJB A;  3SSR A;  2BJ8 A;  4QR1 A;  1Y3K A;  3DXB A;  1JXL A;  4FYX B;  4B3O B;  1NJZ A;  3SDE B;  2DD8 S;  4ITS A;  2WBM A;  2AF6 A;  4YDX A;  2EC2 A;  2XMM A;  1TKX B;  4LF1 A;  1X60 A;  3OL7 A;  1LW0 B;  2XYG B;  1YIJ S;  2EG2 A;  4X4U A;  3M2R B;  3SQG B;  1GH8 A;  3M32 A;  2CQ0 A;  4B17 A;  3NGR A;  2IM1 A;  1WEY A;  3F56 A;  1RUS A;  2RD5 C;  4Z37 A;  2VOP A;  3DDK A;  1IWG A;  4M5D B;  3CCQ S;  4JI1 J;  3NG8 A;  3UD5 A;  3DRR A;  4OI4 A;  1TK5 A;  3KLH B;  4ECT A;  4KO0 B;  1U8S A;  1F6T A;  2U1A A;  4CLL A;  3D6T B;  2UV8 G;  2UUB F;  3ONQ A;  3CJ2 A;  2NSC A;  1VR6 A;  4LRB A;  3MMC A;  2ILY A;  4ZVR B;  2ZH8 A;  3LF0 A;  2JC1 A;  4K59 A;  1FWL A;  1RT6 A;  3KK2 B;  1O8B A;  1NDP A;  3CC2 S;  3IWL A;  4NXN F;  4ILL A;  5C25 B;  3DLJ A;  4U8Y A;  1RBL A;  3LWL A;  5D4P A;  4I2P A;  3PCO B;  4DV0 F;  1RAO A;  2Q66 A;  2L3M A;  3KG1 A;  4ZPV R;  3IWX A;  2IVY A;  1CEZ A;  2RUS A;  4EZ6 A;  2ATL A;  4X62 J;  5F3Z A;  5KAK A;  5HVH A;  1TL1 B;  4E0D A;  2WCX A;  1F0X A;  3O5T B;  1Q78 A;  1T9U A;  3V2U C;  4B3O A;  2X3G A;  1U1L A;  2ZWP A;  1R7I A;  4A8Q A;  2JZ5 A;  5ETQ A;  3UNY A;  1S1U A;  1TKX A;  2V9W A;  2UU9 F;  1LW0 A;  1JJC B;  3B54 A;  4J5O A;  2N82 B;  4OZ2 A;  3HSZ A;  3M2R A;  3R1L A;  1R8C A;  2YWG A;  1NXI A;  3SQG A;  4X4O A;  1M1G A;  1KTV A;  4HI1 A;  1RAI B;  1ZTW A;  2OFH X;  3VR1 A;  3J81 U;  4YY3 F;  2DXD A;  2HVD A;  3IXQ A;  2YNF B;  2CNL B;  4HHH A;  5MAO A;  2ZDP A;  5DDQ C;  4WFA Q;  3V6D A;  3HJF A;  4M5D A;  1K73 T;  1RHJ B;  3CCW A;  4DPT A;  3D1H A;  3PRB A;  1MMD A;  4KO0 A;  1JJ2 R;  1V6H A;  2G0I A;  2DIT A;  4PWD A;  4WYW A;  4MYU A;  2PMH A;  2HHQ A;  5D0H A;  4DX5 A;  1XN9 A;  2E1A A;  4NXM J;  4NPO A;  2UXC J;  2GQ2 A;  2CJY B;  3TUI C;  3A12 A;  2CNN B;  1HIY A;  2R2R A;  1ZAV A;  2MKK A;  4QIE A;  2ZKT A;  3KK2 A;  4DR3 J;  4X4N A;  2LA4 A;  1HI1 A;  1UJ6 A;  2YWF A;  3CCR S;  3K7R A;  2XMJ A;  1KSP A;  3MZI A;  2HQG A;  5GMD A;  1PJ6 A;  2AJ0 A;  4Q8E A;  5BYR A;  5JMN A;  1ZYQ A;  2KTQ A;  2A0F B;  3TYT A;  3PKM A;  1CC8 A;  4OX9 J;  4RNO A;  1S0O A;  4YN3 B;  2GGP A;  2HHP A;  3GFY A;  3C66 A;  2CNK B;  3ISN C;  1S0N A;  2ZNZ A;  1JK9 B;  1HNV B;  2E5I A;  2DCU B;  3IRW P;  5D4O A;  2MQL A;  4I68 A;  1HNI B;  2JWN A;  3X3U A;  1VRT B;  4G65 A;  4F7V A;  3Q8S B;  1D1U A;  1CS4 A;  1Q86 T;  1PBU A;  4CWB A;  2YNF A;  2VKZ G;  4USW A;  4RKU C;  1CJU B;  4PXE A;  4ZPD A;  4NLV A;  1E6V B;  2GJI A;  1TL7 B;  2MGZ A;  2UV8 A;  2WHO A;  1DQ9 A;  1KNZ A;  4PAB A;  2MSS A;  3N01 A;  1HMV B;  2GNK A;  1RHU B;  1FEH A;  2KO1 A;  4ZP7 A;  3M30 B;  5FII A;  2OKQ A;  3TUJ C;  2YQ1 A;  2GCF A;  1KS2 A;  4J9V A;  4B9M A;  4HAC B;  4ZS6 A;  3BPD A;  1AB8 A;  1X4F A;  2L9W A;  2F65 A;  2MKC A;  1OMS A;  4YR3 A;  2YTC A;  3DMJ A;  2XLK A;  4GKK F;  1RA6 A;  2AJ1 A;  1RWW B;  1F5A A;  1XNQ J;  5IV4 A;  3GYX B;  2DHH A;  3ZC4 A;  3MCN A;  1QJH A;  5L38 A;  3SFG A;  4KGZ B;  2RQ4 A;  5CA5 A;  4YB7 A;  2R7S A;  2MZS A;  1R0A B;  4LUB A;  1KD1 T;  2KVI A;  3SZ2 A;  5RUB A;  3ZZY A;  3MDF A;  1H72 C;  2VPZ B;  2VG7 B;  5IQ6 A;  3MED A;  3DI6 A;  4CYU B;  2N7C A;  2VH7 A;  4ZVH A;  4B3S J;  5ETN A;  1YJ9 S;  1HNV A;  2V69 A;  3QAU A;  1GEH A;  5I4M A;  4KR0 B;  2HS3 A;  1OY9 A;  5AE2 A;  2E9Z A;  1RLC L;  1ZS6 A;  1HNI A;  2ACY A;  5H9F J;  3PHE A;  2ASJ A;  3VGS A;  1VRT A;  2EBE A;  1X4H A;  4N8O A;  1AXQ A;  3HHL C;  3MMJ A;  3GZ7 A;  5DDO C;  1YK9 A;  2LU2 A;  2P8I A;  5D0G A;  1UZH A;  1CJU A;  4DU8 A;  4P2S A;  2LA6 A;  3R1H A;  2H48 B;  4DZD A;  2C1E B;  2WVC A;  2YH0 A;  4RW7 B;  3Q22 A;  4DCO B;  4TQS A;  2E7V A;  4EBE A;  4QU7 A;  4RBT A;  2DO4 A;  3M30 A;  5ETM A;  2VBX A;  2RML A;  5IWA J;  1KDN A;  3D66 A;  4CNZ A;  2R7T A;  3OTE A;  5IXU A;  1YJN S;  3TAN A;  4PQA A;  3HFK A;  4UTG A;  3MFH A;  4LFA F;  2ZBQ A;  2PMZ D;  3D6F B;  1LNQ A;  3QWU A;  4B9N A;  3D54 A;  4GMK A;  2R2S A;  3NNH A;  2F1F A;  2HG4 A;  2Z8Q A;  2E5L F;  1IR2 A;  1HQ2 A;  3T19 A;  3CJ8 A;  2FVQ A;  3L95 X;  4YDD B;  2BJ1 A;  1HYS B;  2M52 A;  1FNX H;  5KFJ A;  2RDJ A;  4YP3 A;  3R97 A;  3GIM A;  3AJ1 A;  1TTH B;  3QFH A;  1NJX A;  2XCP A;  1WTB A;  1R0A A;  2GQC A;  1FRK A;  1GFW B;  3AOC A;  2LU1 A;  4KC5 A;  3QO9 A;  3RW7 A;  4EUV A;  2HQI A;  4ZHR B;  2APO A;  3DLH A;  4ID5 B;  2QG9 B;  2PFD A;  4JYA J;  4AQY F;  2MLY A;  3MM8 B;  1FJG J;  2VQE J;  4DCP B;  3UVJ B;  1TFY A;  4UUW A;  4QWD A;  4RBV A;  2CDQ A;  1KHV A;  3BGL A;  2VB6 A;  2MZJ A;  3KHG A;  1U09 A;  3I96 A;  5KFY A;  3DRP B;  3IMQ J;  2I5J A;  4DR5 F;  3UD3 P;  4Z7Y A;  3AXM A;  5BYQ A;  2FHJ A;  1KR4 A;  3T6J A;  1RT4 A;  1C0T B;  4DFM A;  2XHC A;  3BJY A;  2NSB A;  2BMB A;  3GYN A;  1WSR A;  2UXB J;  4LBI A;  4LF4 F;  3T1A A;  2ZUG A;  1YG0 A;  1BLU A;  2CQ4 A;  4C4W A;  4LR9 A;  1VI7 A;  2NLW A;  2QE5 A;  1XK8 A;  2W24 A;  4CO3 A;  5ADZ A;  1MU2 B;  2HGL A;  1AFI A;  4CLZ A;  2HHW A;  2K1R B;  1GNK A;  4ZDN A;  3AA9 A;  4RR5 A;  4DU7 A;  2HAF A;  5IS2 A;  1FER A;  1FXL A;  4LRE A;  3AD9 C;  3D0I E;  4NAS A;  1NB2 A;  3IFE A;  1S9G B;  2HVI A;  3M6W A;  2RF2 B;  2MLX A;  1MN7 A;  5I3U B;  4K2J A;  4BLG A;  4J9N A;  3G71 S;  1H2V Z;  2EFQ A;  2B43 A;  4ZHR A;  2RHS B;  4IR1 A;  2ZBI A;  4QBU A;  4LF7 F;  2P6T A;  3MM8 A;  3FEZ A;  4P2M A;  1NDL A;  3HSG A;  5J1P A;  1QVG R;  4XTT A;  2COL A;  3Q86 A;  4C8M A;  1BXN A;  3TQE A;  3Q0A A;  2AX1 A;  3GCW P;  2EXU A;  2GVZ A;  3BB5 A;  1VLY A;  4OL8 A;  2AT1 B;  5DQH A;  3HP6 A;  2CQP A;  4HI2 A;  2CZ4 A;  1C0T A;  2ZNY A;  1C0U A;  3R5A A;  4MT1 A;  1SH0 A;  2XI3 A;  1RBO B;  1ZH5 A;  2IM2 A;  3MEC B;  4OZL A;  3GR1 A;  1KBR A;  2CJK A;  2B56 A;  1XMO F;  1TMJ A;  2KHD A;  2VAS A;  1UFK A;  1ZZN A;  3GV8 B;  1MU2 A;  3EIC A;  5FDL B;  1TMM A;  4CNY A;  2OPS B;  2VON A;  4M5M A;  2POK A;  5EDW A;  1T03 A;  1JLG B;  1I94 F;  3HHK A;  3EDR B;  2NXC A;  4F0K A;  3G9C A;  3BQ0 A;  2CQ1 A;  4UOF A;  1CSJ A;  2X7I A;  5A0Y B;  3D67 A;  1S9G A;  5I3U A;  4QIW D;  1UKU A;  3OT9 A;  4AL6 A;  4ECR A;  2OPQ B;  3HVA A;  3I9Z A;  1F3V A;  1Q4R A;  4XIU A;  5K8O A;  2K2P A;  3P5B P;  5J2P A;  4LIR A;  2RUG A;  8ATC B;  2K8G A;  1S9E A;  5E3R A;  4EMD A;  2GX8 A;  4U7U D;  2E1P A;  2VPY B;  2WW8 A;  3K8V A;  3QQC D;  2M0G B;  2DNM A;  3N5F A;  2HFZ A;  1R0C B;  1HQE A;  2MY8 A;  3U27 A;  1Z2Z A;  2CPI A;  2AV5 A;  3IM8 A;  1RIS A;  2ZDO A;  4Q5V A;  3P45 B;  3FQL A;  4PG4 A;  1NK8 A;  1VRQ C;  2AYB A;  1UFL A;  2BYC A;  4J9S A;  3TZX A;  4B9V A;  4FXD A;  3G86 A;  2IRU A;  4TY9 A;  2ZKU A;  1H3D A;  3F44 A;  2DHX A;  3V6K A;  2HBY B;  1N6Q A;  2W9B B;  1FRX A;  4JI8 J;  3C6U A;  5EWG A;  4XAK A;  1SV5 B;  3AOD A;  4P75 A;  5FDL A;  2KKH A;  4AFF A;  3RYL A;  2H4Y B;  4JV0 A;  4PZV A;  1SQF A;  2GC8 A;  3VZH A;  4X4P A;  4IG3 B;  4DV0 J;  4PXB A;  3KMS A;  3QLH B;  3MTJ A;  3BRE A;  2SXL A;  1YZ7 A;  3RAM A;  4DR1 J;  1X31 C;  2FJB B;  3OUY B;  2HS4 A;  1L3T A;  1W25 A;  4PUO B;  2CZV C;  2YXL A;  2W2N P;  4ES3 A;  2RSQ A;  2QYC A;  2XWY A;  4CO4 A;  4MFB B;  1RDR A;  2W4C A;  3TI0 A;  3QRP A;  3J7Z T;  3SYZ A;  3RGI A;  1UMJ A;  4YY3 J;  2NZ4 A;  3OHA A;  3O1L A;  4TN2 A;  2C22 A;  3QSI A;  5HL7 Q;  3QAE A;  1TL3 B;  1WC6 A;  2PDA A;  3HUL A;  3SI8 A;  1OIA A;  2D41 A;  4X65 F;  3A1Y G;  4LRA A;  3QGH A;  1IKW B;  2CUY A;  3BO3 A;  3DXS X;  4IRD A;  1D09 B;  3W65 A;  1VBY A;  4A8X A;  3HO1 A;  1WI8 A;  4DV6 J;  2CPE A;  3KJV A;  3EDQ B;  4QW9 A;  2JOQ A;  4JI6 F;  3FRZ A;  1U6B A;  1ZOT A;  4HTI A;  2LEB A;  3TWZ A;  2W9B A;  4OYO A;  1UCN A;  3HM9 A;  1SV5 A;  4KV8 B;  5A8W B;  2HK2 A;  2ZOG A;  2QMU B;  1HHQ A;  1M1H A;  4IG3 A;  4AL7 A;  4BWM A;  3J81 j;  2VHG A;  5KT2 A;  3QLH A;  1SI9 A;  3MM7 B;  2Q1L A;  1HHT P;  4PQU B;  3CCV S;  3JSR A;  3OUY A;  3MAQ A;  2GO8 A;  3POT B;  4PRF A;  1PC5 A;  1WJ9 A;  3Q8Q B;  2CJA A;  2PE8 A;  2V68 A;  2HK3 A;  3K2Y A;  2E5J A;  4NLX A;  1UET A;  1NK0 A;  3DLB A;  2ZJR Q;  1UA0 A;  3OD2 A;  5HQ8 A;  1X8D A;  2WOM B;  2QSF A;  2BQ3 A;  5HSP A;  1WKK A;  1YTY A;  3AA8 A;  3P96 A;  4LJM A;  4OLO A;  4ZN3 A;  1Q81 T;  5GAH U;  1XEZ A;  4I1T A;  5J1E A;  4Y65 A;  3CCE S;  1V3R A;  4FNI A;  3CNQ P;  5L46 A;  4R0E A;  2D69 A;  1IR0 A;  3T3F A;  2GIR A;  5ETL A;  3KLE A;  4S0M A;  2RIL A;  3UCG A;  4F25 A;  3B82 A;  5KFK A;  2MLZ A;  4P71 A;  2D74 B;  2KFN A;  1TU0 B;  2FY8 A;  4DEZ A;  2CKW A;  1YKW A;  3HXM A;  5IQQ A;  3OHB A;  1HKA A;  1U0S A;  4KV8 A;  4GKK J;  2V5H G;  5A8W A;  2AJQ A;  2AMC B;  1SJ1 A;  6AT1 B;  1NJW A;  5KFP A;  2BKP A;  3JAM U;  1Y0H A;  3PRV A;  2NXN A;  2QSW A;  1NSK L;  4PPD A;  4PQU A;  1MWQ A;  1N5V A;  4DUZ J;  3POT A;  3G6X A;  1J5E J;  2HLU A;  4USK A;  5KFL A;  4JI4 J;  2BEF A;  4ZA1 A;  5KFO A;  4AT1 B;  1JXV A;  2CVE A;  2OHD A;  2YQ0 A;  1JLQ B;  1ARO P;  4P6Q A;  4IQX A;  2J9D E;  4KGM A;  2WOM A;  4EWT A;  4ECY A;  3KLG B;  1WEZ A;  2QT7 A;  4HT5 A;  2D3O 1;  4P2F A;  3T5J A;  2ALY B;  9RUB A;  3ET6 A;  2V2Z A;  2V4J A;  1R6V A;  3NS6 A;  1LQ9 A;  2ABY A;  4ZJO A;  1AUS L;  3KUH A;  4IFV A;  1TK0 A;  4ZVG A;  4NLU A;  2RQK A;  5JVH Q;  4KAI A;  3V81 A;  2N4C A;  3BM7 A;  2W4D A;  4ZLN A;  3M9M B;  1UFW A;  4O3P A;  2HQ3 A;  3BBC A;  1VC6 A;  3V4M A;  2UUT A;  3DN9 A;  2FVS A;  4QCL A;  2XLJ A;  3VAG A;  2BE2 B;  3PYD A;  5DGA A;  1U2R A;  3T9Z A;  4IFY B;  4K4U A;  6FDR A;  2IYG A;  3FBE A;  1M0S A;  1YIT S;  2Y0S D;  3EXC X;  2YNI B;  1BUX A;  3T1H F;  1BHN A;  1UTA A;  2BUN A;  2ZZN A;  5HVF A;  4CLK A;  2EVZ A;  2HYI B;  2QMW A;  2CJB A;  1T94 A;  2A10 A;  3ISN D;  3H2L A;  1F2H A;  4AQY J;  4QYZ J;  3QZ8 A;  2HGM A;  2DY9 A;  1GMW D;  4OHV A;  3NWG A;  3M2V B;  3T41 A;  5ITH A;  3KLG A;  2M88 A;  3RB4 A;  1PYT A;  2D3U A;  4C7Q A;  1MN9 A;  1GX6 A;  4LF2 A;  4NRU A;  4Q8F A;  3CJS A;  3QT8 A;  3VAK A;  3I0R B;  2ZOF A;  2E7W A;  4KSE B;  2IMO A;  3GLJ A;  1Y9O A;  3M7V A;  4PG6 A;  2GW8 A;  3CJ5 A;  1T7P A;  2NXU A;  3H20 A;  1RKI A;  1SKU B;  2LEC A;  3C6T B;  5CZV A;  2B6A B;  1CJV A;  3LGH A;  1WF0 A;  1SKR A;  3M8R A;  2I9S A;  1YJU A;  2AX0 A;  2CPH A;  1YI2 S;  2KG1 A;  4AYB D;  3SSS A;  3W2V A;  4M5I A;  2NYI A;  1U6F A;  4UOC A;  3HZE A;  5IC6 B;  4MIB A;  4BCA A;  1U1M A;  3N9U C;  2Z56 B;  1FF2 A;  4IFY A;  4JV5 F;  4X64 F;  1PC4 A;  1C2P A;  2IBO A;  4F02 A;  1K0V A;  1OWX A;  4I0W A;  2HWI A;  4CTA B;  4ILM A;  2HFV A;  3AT1 B;  1JKH B;  2YNI A;  1B7F A;  4FBT A;  3GIL A;  3K5L A;  1X4B A;  1FRM A;  2PC6 A;  2ZH3 A;  3RRK A;  4DPY A;  4O4R A;  3NOC A;  3QBC A;  1NBE B;  4F0H A;  4QWC A;  1JQG A;  2OUG A;  4ETX A;  1FX4 A;  1CJT B;  3C2P A;  3A3P B;  3FKB A;  1X9S A;  2I6W A;  3NAH A;  5KFW A;  1WF2 A;  4QW8 A;  3MUT P;  1RAE B;  4OZ5 A;  1S77 D;  1N8R T;  1O51 A;  3AY0 A;  1W2B R;  5DM6 Q;  8AT1 B;  5K8M A;  2PA8 D;  4YB5 A;  3HHL D;  1N34 J;  3VAH A;  4RBU A;  1RSC A;  4ZK7 M;  2CQC A;  1WHY A;  1YWX A;  3ZZ0 A;  4U9R A;  2ZOM A;  4BHQ A;  4YUD A;  2ZH1 A;  1TAU A;  3C15 B;  5KOX A;  3TA2 A;  2HWH A;  3SV3 A;  3C6T A;  2KL8 A;  4QWE A;  2B6A A;  5B0C A;  3IBW A;  1XMO J;  4CO5 A;  1TZ0 A;  4L76 A;  1F9F A;  4ES2 A;  3H4B A;  4DV4 J;  3T1Y F;  3C3L A;  1JLC B;  4KY3 A;  4ZKA A;  5ETO A;  3OXF A;  3PY8 A;  2QA2 A;  4CTA A;  2FJD B;  5AXN A;  1JKH A;  2JJ4 D;  1P27 B;  3RAX A;  1KQS R;  3LGM A;  4LF6 J;  2V63 A;  2VBZ A;  4NZ7 A;  2V4Q A;  1HR0 F;  5KFB A;  1EAR A;  1RWX B;  3JB9 k;  2Y0B B;  1CJT A;  1N0U A;  2YKA A;  3Q89 A;  3RB0 A;  1ZA2 B;  4P9S A;  4P7V A;  1NKB A;  3GG0 A;  1NEE A;  4O23 A;  4OYB A;  5F8N A;  2J0S D;  3I0S A;  3PX6 A;  1QE1 B;  4ED5 A;  4QWA A;  3QT6 A;  3TP2 A;  1B0P A;  1TKZ B;  5GAG U;  1HBU B;  1WD6 A;  1LFP A;  2BAN B;  2XWX A;  4NLY A;  4DSE A;  1SJF A;  3H98 A;  3TJA A;  3OFE A;  2HHU A;  2CPZ A;  2KU7 A;  3O6Q A;  2IJN A;  5ETT A;  3BDP A;  1RTD B;  3ZXW A;  1FX2 A;  2R8G A;  3CW2 C;  3IG1 B;  2RNE A;  3C15 A;  3EZO A;  2MZQ A;  1JIH A;  4WKR A;  2B9Y A;  5K14 B;  4WXW A;  4IKA A;  1BC6 A;  1EX8 A;  2YH1 A;  1Z1Z A;  3MCS A;  2JEI A;  2DEJ A;  4MKY A;  4GKJ J;  3BSN A;  1LWE B;  2R7V A;  3LP1 A;  1L3V A;  2IRY A;  1U45 A;  2OMO A;  2AYM A;  1WAC A;  7FDR A;  1Q8K A;  4ZMM A;  4CLU A;  3MM9 A;  1K1S A;  3BH6 B;  1LV5 A;  2IDL A;  5D15 A;  1QSS A;  4L72 B;  5KOW A;  2DHG A;  3EXY A;  2VUG A;  3W2W A;  5L1K A;  3ZZP A;  3L3C A;  4WFX A;  2UUA F;  1HL6 A;  5DM7 Q;  3HVW A;  3BYP A;  3IA0 A;  3MAH A;  1K8A T;  4WFB Q;  4TY8 A;  3P6Y C;  3DDI A;  1VJQ A;  3D7S B;  2A1B A;  1QE1 A;  3DRS B;  5E33 A;  3GQC A;  1Q5Y A;  2CQG A;  3CVK A;  3H0P A;  1T3N A;  1TKZ A;  2XI2 A;  2Z58 B;  1NDK A;  2BAN A;  2IAJ B;  2EI5 A;  5AJ3 J;  4RW8 B;  6FD1 A;  3DRX A;  4QJV A;  4OI0 A;  3D4J A;  3H25 A;  2HHV A;  3DCA A;  4ZIW A;  1YDL A;  3HF5 A;  3W8P A;  3MPY A;  4NLD A;  2IJF A;  1RTD A;  2DPI A;  3E01 B;  2CQD A;  2R7O A;  3ZZR A;  2VD3 A;  3DKD A;  3IRX B;  1S59 A;  2DK2 A;  5ETK A;  2QLB B;  5KT4 A;  1X0F A;  1TL4 A;  4Y34 A;  1APS A;  4Z7C A;  2UXD J;  2DCL A;  4RW9 B;  4ICL B;  4K4T A;  4FBU A;  4DUT A;  3UE2 A;  3G6E S;  4R8U A;  4YR0 A;  2GFF A;  5HP1 B;  5KG0 A;  3TUP A;  1FK9 B;  2CPJ A;  4DX6 A;  1M5O C;  1H73 A;  3UD4 P;  5KT5 A;  2YVS A;  4FZV A;  1RQ0 A;  4WE1 B;  5A8K B;  1GXT A;  4F2S A;  4O0N A;  1FFS B;  3R27 A;  2H54 B;  2YNH B;  2V67 A;  2CJX B;  4TU9 A;  1EAY C;  3ENA A;  1S97 A;  4LRD A;  4H4K A;  1TUG B;  2DIV A;  4OYM A;  4UT4 A;  4LQ9 A;  4CDI A;  5JUM A;  2F9J A;  2G4B A;  1SC3 B;  3O8W A;  1ZA1 B;  2V4R A;  2KRB A;  3UDE A;  1U2F A;  1YBA A;  4OYX A;  4X2B A;  1RAH B;  4OZN A;  1JJ4 A;  4RW8 A;  4DV2 J;  4PEO A;  2KT2 A;  1IBL F;  4BWJ A;  2JLE A;  3QRR A;  2XY7 A;  3C14 A;  5KG4 A;  5EGY A;  2R3V A;  3E01 A;  3J7A N;  2HS0 A;  2B4O A;  3PJ9 A;  1D8Z A;  2QFJ A;  2O67 A;  1QAY A;  3QZ7 A;  1GMU A;  4I64 A;  1WC5 A;  1KLM B;  2CJ9 A;  1FJE B;  3OV7 A;  2HWT A;  2XMK A;  3GB0 A;  5KFZ A;  1WDD A;  4CIO A;  4OHY A;  2JRS A;  1EZZ B;  3NEK A;  3FMB A;  2V9K A;  2RE1 A;  2CPX A;  2CPY A;  4JI5 F;  1VQ5 S;  2YKQ A;  4OJH A;  3WC2 A;  3HKZ D;  1S79 A;  4ICL A;  3DHW C;  3R7B B;  3TJ8 A;  3K0J A;  2EWH A;  3LO3 A;  2KHC A;  4ZJL A;  2V2Q A;  4YEA A;  3G96 A;  4F4A A;  3OW2 R;  5HP1 A;  3ZTQ A;  3QID A;  2CAJ A;  1HWI A;  2KM8 B;  2DGO A;  2DRB A;  3QMQ A;  4LSL B;  2WK4 A;  4I69 A;  3Q24 A;  4O3R A;  5DLF A;  3PX4 A;  2FZC B;  4X62 F;  2KN4 A;  3OTD A;  1T9X A;  4PWW A;  4RWX A;  2PMW A;  4WE1 A;  5A8K A;  5M2P A;  2Z2L A;  3FBB A;  2VJV A;  5DQI A;  2YNH A;  5K5M A;  1NDC A;  3H5U A;  3GE9 A;  3H42 A;  2VOD A;  1CJK A;  1UZD A;  1Y00 A;  2OEK A;  5DG7 A;  2DR9 A;  2DH7 A;  4W4M A;  4QU6 A;  4ED2 A;  5J2M B;  4BDP A;  4DN0 A;  1IBC B;  4DG1 B;  1P8G A;  3K89 A;  4K4V A;  2GJ2 A;  2GIF A;  5E3C A;  3KMQ A;  4G6V B;  2AEF A;  2KXH A;  4Y2M A;  2FLO A;  1CQN A;  4LR7 A;  2YKN B;  2ZVS A;  1KLM A;  1MML A;  4OMF G;  5HMY A;  2L9D A;  1SJ4 P;  3JSM B;  1UWB B;  1RAD B;  4USV A;  1GAO A;  1NHU A;  2UXC F;  2EK6 A;  2U2F A;  3P49 B;  1B4S A;  2ZJP Q;  3B6B A;  1G4C A;  4IOB A;  2EC0 A;  1Y4Z B;  2BJ9 A;  3IS9 B;  4HH0 A;  2F5G A;  4DR3 F;  1IUJ A;  4IRK A;  2HFS A;  1RTI B;  2DGS A;  2D9O A;  2OPR B;  3HVT B;  4IQM A;  4DR4 F;  2VC0 A;  5F3T A;  3T1H J;  2LQB A;  2CA9 A;  4LSL A;  4PXC A;  4K0K F;  5M2U A;  3M05 A;  3I32 A;  2J8S A;  3DDN A;  1WHV A;  2LXU A;  1UA1 A;  1N33 J;  3OTO J;  2ZH6 A;  1TUV A;  2ZD1 B;  5AE1 A;  2YPZ A;  3WDO A;  3CDW A;  1SIW B;  2RU3 A;  1V5I B;  5AE3 A;  2B7B B;  4I7F B;  2C28 A;  1U1P A;  2FHJ D;  1HAR A;  5F0U A;  1HW9 A;  4OYA A;  2QA4 S;  4KHP J;  2PI4 A;  3E51 A;  3D9B A;  1ZBT A;  3TAM B;  1RTZ A;  4HKQ A;  4KPY A;  5E5N A;  1VQ4 S;  4CCH A;  4A8F A;  3MI7 X;  4EU0 A;  2HNZ A;  3T5H A;  2NPF A;  5MLC V;  4DG1 A;  2N3L A;  1CUL B;  4LMZ A;  4DQI A;  3V6H A;  4M5L A;  1QTN B;  1Q5V A;  3DYA B;  1FCA A;  4LBP A;  2DR5 A;  2AHO B;  2B8P A;  4QIG A;  4UF4 A;  3OJS A;  4J9Q A;  2IVM A;  1RBA A;  1HPZ B;  4DF8 A;  1B0T A;  3JTN A;  3JSM A;  4JI7 F;  3CD0 A;  2PII A;  3G4S S;  2IHR 1;  3D0H E;  1FKO B;  4XK8 C;  3EM1 A;  3D2W A;  3BF4 A;  5B0B A;  1U0H A;  2MKS A;  3IS9 A;  3D5M A;  4M1K A;  3W5Z A;  1XNQ F;  2ZFH A;  3RB6 A;  1RTI A;  2VOO A;  1TVR B;  2OPR A;  1TEL A;  2ALZ A;  4WZQ A;  3E2E A;  3FSX A;  1SC6 A;  5CYQ B;  2JHE A;  1RT7 A;  3KK3 A;  4F2R A;  1H38 A;  4UZC A;  3CJK B;  3QJJ A;  1BQM A;  2AJ4 A;  4IO9 Q;  2OH2 A;  1IKV A;  3CF5 Q;  2DIU A;  2BKN A;  4B3S F;  2CQ3 A;  4RPF A;  5D4N A;  2DNL A;  4I7F A;  2XO7 A;  3UDL A;  3DOM A;  2GJF A;  2QA1 A;  3CJ0 A;  2YX4 A;  3H90 A;  5EWE A;  3TAM A;  3ITH A;  4TYB A;  3KJQ B;  2PI5 A;  4ANC A;  4OFZ A;  3O44 A;  5A76 A;  1XIQ A;  5C2C A;  1EKR A;  1PO6 A;  4ZPW R;  2OIH A;  4O0I A;  4F8R A;  4M5N A;  1AYE A;  3DYA A;  4MK8 A;  1I1G A;  5AXL A;  4ILR A;  2M7S A;  4MKV A;  3TA1 A;  2GO9 A;  3TX0 A;  2QLW A;  4NLQ A;  3MM5 A;  2LEA A;  1HPZ A;  2EK1 A;  1WG5 A;  5IWA F;  1IQZ A;  2NZC A;  1TQL A;  2Y8W A;  1C1B A;  1S76 D;  1FKO A;  5CCM A;  2KJV A;  1WKJ A;  2CQB A;  4H4O B;  2MY7 A;  1UVM A;  5KG6 A;  2HKE A;  2HSE B;  3QAT A;  2BVZ A;  3M8Q B;  1XBW A;  1I5O B;  2J6U A;  3DLK B;  3ZTO A;  3AB4 B;  1HNW J;  3PVX A;  3KG0 A;  3IWN C;  5AT1 B;  3L7O A;  2CQ2 A;  2DVI A;  4ZLJ A;  2D3Z A;  2WBR A;  4OIX A;  1JLF A;  2J9C A;  4D3G A;  2LQ9 A;  4IOA Q;  3RRH A;  1N5Y A;  3M8P B;  2AEM A;  1A7G E;  3CCZ A;  5DDR C;  2KXF A;  4KKO B;  4JYA F;  1S57 A;  1U26 A;  4NZ0 A;  3IO1 A;  2JC0 A;  2MQO A;  1FJG F;  2VQE F;  4DXL A;  1VRU B;  5HMX A;  2XYP B;  4ED6 A;  2B5J A;  1B70 B;  2KZZ A;  1S9F A;  3CCM S;  1DJ0 A;  2ZUA A;  4CH0 S;  1WI6 A;  1RTJ B;  4FKY A;  5KFU A;  4L74 A;  2XCA A;  1JLA A;  4PYA A;  1FE0 A;  2AP6 A;  2CRL A;  1GMW A;  3DOK B;  2MJN A;  2OAU A;  4F3Q A;  2X1B A;  2UP1 A;  2GMH A;  1VLO A;  1RWU A;  1DLO B;  3M4X A;  5JJB A;  2VG6 B;  3NOG A;  4G1P A;  1PGZ A;  1QAX A;  2GML A;  1CVJ A;  4BC9 A;  3BGF A;  3D68 A;  3CO0 P;  4Y0F A;  3MWB A;  4KBI A;  1LWX A;  3RB3 A;  1S1W B;  3KJN B;  2MKI A; 
#chains in the Genus database with same CATH homology
 1DY3 A;  4M5G A;  2F65 A;  4PZV A;  2QX0 A;  4CYU B;  5ETK A;  3HT0 A;  3KUG A;  1RU2 A;  4CWB A;  1EX8 A;  2F63 A;  4M5K A;  4CRJ A;  3KUH A;  5ETN A;  1RAO A;  3HD1 A;  1RB0 A;  3UDV A;  3HD2 A;  4AD6 A;  1HKA A;  1Q0N A;  5ETV A;  1RU1 A;  1RTZ A;  1F9H A;  1G4C A;  3ILO A;  3QBC A;  4CYU A;  3HSD A;  4M5L A;  5ETP A;  1CBK A;  1IM6 A;  1TMM A;  5ETQ A;  3ILL A;  4M5M A;  2CG8 A;  2BMB A;  1KBR A;  3ILJ A;  3HSG A;  5ETR A;  5ETS A;  3UDE A;  1EQM A;  3MCN A;  5ETM A;  4M5H A;  3HCX A;  1HQ2 A;  3MCM A;  3HSJ A;  3IP0 A;  4M5N A;  4F7V A;  1TMJ A;  4M5I A;  5ETL A;  3UD5 A;  5ETO A;  1EQ0 A;  5ETT A;  4M5J A;  3ILI A;  3HSZ A;  3MCO A;  3KUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...