3ILLA

Crystal structure of e. coli hppk(d97a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLAIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3illA00
1KBRA 1RTZA 3HSJA 4M5HA 4CYUB 2F65A 3HCXA 5ETVA 1DY3A 1EX8A 3ILOA 5ETTA 3UD5A 3HSGA 4M5LA 4M5JA 4M5GA 3HSZA 5ETKA 1EQ0A 4CWBA 1HQ2A 1RU2A 3HT0A 3HSDA 3KUEA 4PZVA 2QX0A 3QBCA 4CRJA 1EQMA 3HD1A 1HKAA 1RAOA 1IM6A 3ILIA 5ETNA 1Q0NA 3KUGA 5ETSA 4AD6A 2BMBA 4M5IA 5ETMA 1CBKA 3ILJA 3HD2A 3UDEA 2CG8A 1RB0A 3ILLA 4M5MA 5ETQA 5ETRA 2F63A 3MCOA 5ETLA 4M5KA 5ETPA 4M5NA 1TMMA 1F9HA 3KUHA 5ETOA 3UDVA 4CYUA 3MCNA 3MCMA 4F7VA 3IP0A 1RU1A 1G4CA 1TMJA
chains in the Genus database with same CATH superfamily
2KHCA 3LP2A 2FD2A 3L7OA 4M8LA 1SQGA 5KFRA 3JS9A 3OVSA 4DV5J 4JI7F 2VBWA 2AYEA 2G0IA 2IRYA 4LF8J 2Q3PA 4RL1A 5JXSA 4TLRA 2GQCA 3R5AA 5F8HA 1ZS6A 1NM2A 2HBQB 1FE0A 3KLIA 3NLCA 4OX7A 3BSNA 4B9UA 4USIA 5HAOA 3ZTSA 4C48A 4MKVA 3M8SA 4N7TA 1HL6A 2YKOA 1CSJA 2JFDA 3TP2A 3OTOF 3I55S 1CQMA 3OUYB 4DV1J 3QO9B 3E51A 2ASDA 4WPAA 4NLPA 1DLOB 2MMYA 3DC2A 1JQGA 4Y2CA 4GKJJ 1H6KX 1RT1A 4ANEA 4ZLLA 3AD8C 2E5IA 4OYOA 2J7KA 4ATNA 3JAMU 1OY9A 2IA0A 4WTYA 1TKZA 1U45A 3THTA 2FY8A 1YG0A 4PXCA 4OV6A 3KYLA 4DUYJ 2H65B 1JNZB 1JLAB 1NK9A 4NASA 4IKAA 3CMES 4GKKJ 3CO9A 3PYGA 5LSLA 4EEYA 1SC6A 1ZAXA 1O51A 5IT9Y 2LYVA 3DKDA 2P6TA 2RU9A 1APSA 1HKAA 2V34A 1WKKA 3ITHB 1FJEB 1VQ5S 2HK2A 4G1QA 1VR6A 2QJ3A 4B08A 4ELTA 1VIOA 3BPSP 2Y9HA 2B56A 1KC8T 1BY9A 2DNOA 2E5JA 3MOJB 8ATCB 1H2VZ 1S7IA 1MU2B 4ZN3A 4OYPA 2FVRA 3MAAA 1FHTA 2AD9A 1JX4A 3MURP 2ZHAA 2N7YA 2WVCA 5KFBA 2XY6A 4YR2A 4BDPA 1NSAA 4TY8B 2BW2A 2LCWA 3GWCA 4DCPB 1R0BG 4DU8A 2VKRA 2VBXA 2BKNA 4ID5B 1R0CB 2MLZA 1DRZA 1YK9A 3T41A 3FJ2A 2O67A 3CDBA 5KAKA 5KG5A 4AL7A 4ECWA 3J7AN 3CW2C 1DTTB 2WK4A 3T5LA 2ALZA 4K0KF 3PJXA 1FEEA 3VGTA 3M6XA 5HQ8A 4M63A 1EARA 1PKUA 2QFIA 4OYXA 2HHHJ 3AA8A 3FMBA 3M2VA 2BBEA 2ATCB 4RR5A 1MN7A 1BXNA 3QLHA 5M2UA 4J9QA 3NCRA 1GT8A 2V2VA 3IS9B 1WOPA 5HSPA 5KT7A 1D3WA 3IXQA 4NYZA 2GAGC 4JV5F 3PHTA 4JYAF 3NG8A 2EKYA 4DXLA 4OJ1A 3NKYA 2PMZD 5BYQA 5KFJA 4USTA 4TQSA 4KPYA 1RJJA 1YI2S 2HHPA 4M95A 3MM7A 1T05A 4DR5F 2F7VA 2MDAA 2JSXA 3MPDA 4DQQA 1N4LA 4LMZA 2WB1D 2B9XA 2XB2D 4CZCA 4UZCA 2MGZA 4A8MP 2HFUA 1U26A 5HANA 1S0NA 4B9SA 2FJBB 3R1LA 1S6PA 3DRSB 4QU6A 4ECZA 2LQBA 3D1OA 4NX9A 4PXEA 4QZVB 2YKMB 1FWLA 5A0YB 3QZ8A 1XJWB 4I6WA 1JJ4A 2CPHA 1UEUA 1Q7YT 4DR7J 2DTJA 5G0RA 1UPPA 2KJVA 2AJ2A 2NXEA 4NI2A 2ZOFA 1OPZA 2NS1B 4DLEA 1WI6A 3OXFA 3FZ2A 2OD4A 2NLWA 4AD6A 3CCES 2F5GA 3RRGA 1T94A 2QRRA 2R8GA 1HIYA 3IA0A 5B0FA 3HHDA 1IQZA 1TL5A 3JTNA 1SC4B 4YMEA 4JV1A 1UMJA 3D2WA 2BOAA 2QC3A 3PW7A 3GIKA 4NRTA 1A9NB 2P8IA 1IXKA 1HHSA 5HBMA 5L1JA 2YTCA 2F65A 3I82A 4LR9A 4DWIA 2GHPA 4QWCA 1R0AB 4DV4F 5GAHI 3Q8PB 1WD6A 1VBYA 5HATA 2R8IA 1JLAA 5LJ5Y 4EYHB 3GP9A 2AGQA 3UWTA 4G1QB 1QTNB 2DRDA 2CQ0A 1QDUB 2C2DA 2CNKB 2JVOA 1S6OA 4K59A 1FNOA 1ULRA 2W9CA 4N76A 1NRKA 1IR2A 3FSXA 4MAKA 3UDEA 4ED5A 3CD6S 2RT3A 2DHXA 5C7PA 1XEZA 2LEBA 5J1NA 2HFNA 3BDPA 1GXTA 1RTHA 2VQEJ 2MY8A 3BS9A 3M8YA 3O3LA 3RTVA 1P8GA 1HBNA 2GA7A 4MJKA 1QAXA 5KFFA 4ELUA 3OFEA 4F26A 3EDQB 1NPPA 2CXEA 2FHJA 1JLBA 9RUBA 3N4WA 3US5A 3MEEA 1S6QA 4K4UA 7FD1A 3NGDA 1Y0HA 3HT3A 2YNFA 1SJFA 2W4CA 4OI4A 4CLLA 1NPRA 1V3ZA 4ZCLA 1YJUA 3W7BA 2M2BA 4IG0A 2ALYB 2HQ3A 2G0JA 3OT9A 3F0NA 5E7OB 2VBZA 4J7CA 4Q0BB 4TU7A 4AT1B 1D9FA 4F0HA 1VQKS 3SEOA 3G71S 5LMUJ 5F8IA 4ZP8A 4DQSA 3THPA 3LAMA 1R8BA 1HQEA 1F3FA 2AW0A 3MECB 3NOGA 2CPIA 4P73A 4ZPDA 2VDIA 2A3JA 4O0NA 4OMFG 2DH7A 3NBPB 4NLQA 4ZJLA 4DV7F 2HLTA 5IM0A 4LFBJ 1WELA 2BV3A 2DK2A 3OXGA 1TMJA 4L75A 3FKBA 1RTZA 2FC8A 4Y6IA 2KM8B 2KXNB 5KFZA 4IOBA 2XG8A 4WK3A 3SSRA 4RU9A 1IBMJ 2BM1A 5HLFB 3EGZA 2Y0BB 3CIMA 4GVBA 4P2XA 3CC7S 1CQNA 3IR7B 2LU2A 2KRRA 3VQTA 1LWEB 3LTOA 2W2NP 3DRSA 5GAEU 1N33F 2DR6A 4L72B 4LFCJ 1PAUB 5JUMA 2XNRA 1KS2A 5EN1A 3TUIC 3T1YJ 3HULA 3OXLA 2MB0B 4DR4F 3IMQJ 4ICLA 3D0HE 4MK8A 4PYDA 1Y5NB 4X64F 2UVVA 4U95A 1FA0A 1U0SA 1TMMA 3GU0A 5L46A 5DGAA 1OWXA 1RTIB 2WBRA 2UXDJ 1SH3A 3CCVS 4DG1A 5HVHA 4HL9A 4NA2A 4WU3A 2VG5B 4WK1A 3EX7B 1Q82T 2IM0A 1TAQA 4CLZA 1HHTP 2GO8A 3TO8A 3QRPA 5IQQA 3H5XA 1PBUA 4P2FA 2SXLA 4M5GA 4TLQA 1Q86T 2QTWA 2VC0A 4KHMA 5KFKA 1N56A 2HHTA 1GMUA 2MJUA 2K1RA 3GJSB 3KUEA 1H98A 2ACMA 3QBCA 3UD4P 2XS2A 4ZVGA 1Q5VA 2PMWA 4E98A 3EVOA 4NEYA 3I5AA 3KHHA 2W9CB 1IM6A 3ZZPA 2W01A 2IRUA 4IQMA 2CVIA 4ALZA 2R3VA 3PXGa 5JVHQ 3W64A 2Q6CA 4IFVA 3FMWA 2BM0A 2VFSA 2HBYB 2DH9A 3JXOA 2ZWOA 1ELOA 2LP4A 3QT8A 2ZH6A 2O01C 3HI9A 1ZZNA 5DG7A 2CQPA 2VFUA 1MMNA 5KG6A 4KV8B 2ZFHA 1FFGB 3N79A 1RQ0A 4NZ6A 3UO0A 4F4AA 2YKQA 3D1QA 3CXCR 2ZDPA 1I94J 3W60A 3WX8A 3SXLA 4JBCA 1VRUB 4A8FA 2DIVA 2W2PP 1XNRF 1N36F 1NPKA 2CQIA 4ZHRA 5F8MA 3KHRA 3VR1A 1KHVA 4GVLA 3MM9A 2YH0A 1SL0A 3KOAA 2PIIA 1T0TV 4UUWA 1N0UA 4N5SA 1T9UA 2XY5A 1NK0A 3QFHA 4C9DA 4MYUA 2VONA 4PWDA 1HW8A 4Y2MA 3KUGA 4I2PA 3CF5Q 2V8PA 1NJIT 1VIXA 3NBPA 4V19J 1X4BA 1NDLA 2BJEA 1R6YA 4LIRA 2X3GA 4RBUA 4ID8A 1KD1T 2YNHA 4H4OB 3LH2S 5DDPC 1F1BB 2H54B 4HTJA 2X1GA 4N8OA 1AW0A 2GJ2A 2LQ9A 2PFDA 4LT6A 4IQXA 4LF9F 1S0VA 2KZZA 1RWMB 2V50A 1KBRA 4O23A 2ASJA 1T95A 2QGFB 3ETMA 3ZZ0A 2HYIB 1SBRA 1VFJA 4ITSA 2IM2A 3B4MA 5CYQA 1UETA 2P6SA 2ZOGA 3FEZA 2GMLA 2V0NA 3OTBA 5HMWA 4Y2KA 1N34J 5A6WA 2OIHA 1U6FA 2KXHA 2VG7A 4FN5A 1FKPB 2MQQA 3NNHA 4DV0F 3OLBA 1Q7LB 3QYYA 4IH6A 4Y00A 1FKAF 1U1PA 3KLIB 3QRRA 3T5KA 3J7YU 4NLUA 2UU9J 5IT9U 2BQRA 5J1EB 4V19X 5H9FK 2DISA 4X65F 2RF2A 3KFWX 1D0EA 1TU0B 2EVZA 3A3PB 5K14A 4ZCMA 3TZXA 3V6KA 1X60A 4QR1A 5DDOC 3TZYA 3K5MA 3K59A 2A0FB 5ETOA 2CQCA 3OFFA 3RB0A 1V3SA 2GVDB 5ADZA 4L3NA 3QATA 5DZ6A 2R2RA 4WZQA 1QUVA 3IO1A 2GVZB 4MTPA 3UNYA 3V6DA 4ZPTR 2OPQB 1CG2A 3A8IA 4WIQA 4C97A 3QGIA 1LEOA 4YHHF 2DGWA 4X84A 1H73A 4OX8A 2EBGA 1VQ7S 2DR5A 2ZE2B 4JI3J 1N5VA 1KHWA 1H2TZ 1RTJB 2PC6A 2QA1A 2BJ9A 4R5PA 1SQEA 1F60B 1R3NA 2RKIA 3NMAA 1WEZA 3G9CA 1KP6A 3E01B 3NGUA 5HK4A 4LF1A 3M30B 4FS1A 3T9ZA 1RWKB 3CD0A 3ITHA 3DI6B 2V4RA 5F0UA 2HWHA 3CUNA 5L38A 5AT1B 1S6UA 3O8WA 4W98A 4ZK7M 3KHGA 1VRTA 3OR1B 3DDKA 4RUAA 4LFCF 4XDCA 1HI1A 1N5TA 5DRKA 5EWGA 2KTQA 4X4TA 5T7LB 4DQPA 5D0EA 1FVSA 1WC6A 4KO0A 4A4JA 4BCAA 5B0CA 2X1FA 1HWUA 1RA7A 3FK4A 2FJAB 4IG3B 4CLYA 1NNDA 1NK7A 4DPYA 4QW9A 4K5RA 1CULA 2FLPA 4HLBA 3A8KA 4RW9A 1HQ2A 1JKHB 2PT0A 3BGLA 2BE9B 3K2YA 4A48A 1WG5A 4DFJA 4LREA 1GXUA 1S99A 1RGVA 4DF8A 1YX2A 1HR0F 5L8RC 4L73A 1K0TA 2A18A 3KK3B 2LLZA 3QAUA 4K4WA 3P45B 4ZJOA 1VJQA 2WOMB 5EX3A 3GLJA 2KU7A 2AP6A 4I2PB 3D5MA 1YVFA 4LSLB 2WBMA 1UA0A 1C0TB 4NLGA 2DGOA 2ZJQQ 3FEXB 1KOHA 1AXQA 3HT0A 3WDOA 4ZVUB 1WKLA 1GMVA 3FBCA 2HWTA 2YKAA 4RUCA 1JJHA 1VQPS 1P1LA 2KL8A 3RR7A 4DSJA 2QSFA 1DBDA 3RG6A 5HROA 1RCXB 3NS7B 5G0RB 4C8ZA 2GIQA 3MFIA 3HHLC 1EQMA 1M5SA 1ZM2A 5CYMA 4KGKA 2FTRA 1FKPA 1Y9OA 2DHSA 4NI2B 3RUBL 5ETMA 4F0MA 5T14A 3K57A 4AQYJ 4DV2J 3TOQA 3VAMA 1UFLA 2CWXA 1RBAA 2GVDA 5E5NA 3MCOA 5KG3A 3QSIA 1U49A 2WRMA 5FLXY 2YY3A 2OSRA 1HBOB 1TV6B 3EGVA 3Q8VA 4NA1A 4XDDA 1Q16B 2KFZA 1ZZFA 3M8PB 4OIXA 4LIWA 3GV5B 2VQFJ 4ED0A 3EE3A 4RW7A 1HNZJ 1FDAA 1KONA 2DHAA 3PRVA 2RHSB 3MM9B 5IV3A 4F2SA 3PFOA 4PQAA 2K06A 1JLGA 4NL5A 1JLCB 1I3OB 2CPZA 5C42B 1NH8A 3W9IA 1M1KT 4F8RA 4JV5J 1J2VA 1RT7A 3OVAA 1Q1KA 2D1CA 4FYYB 4NXMF 3GSIA 4FYDA 1BWEA 2M8HA 1XC9A 4FKXA 4WXWA 1RI7A 2IM3A 4YR0A 2ZZTA 4USJC 1REVB 2NYHA 2I0XA 3V6HA 4DF4A 2R7TA 1RZMA 3EVWA 1WC3A 2J7UA 2ZNZA 4OL8A 4OHWA 2Z2ZA 4LF5F 4KFBA 2M70A 1FRKA 3KJFB 3MMCA 3DNCA 4Y65A 2NUHA 4ZKAA 1MROB 2DKOB 3DRPB 3I9ZA 3IM8A 3NS6A 1R8AA 3S6EA 4YP3A 2MLXA 5GADI 5GVQA 1FRIA 2FVCA 5F41A 3M6WA 1G4CA 4XPCA 2L3MA 2MXYA 3L09A 3Q2TC 4RNHA 2ZD1A 3HCXA 2QFJA 2ZBCA 3GJQB 3D28A 1RHRB 3HP6A 2Y8YA 4A8YA 3KLHA 1WUUA 3JSMA 2KFNA 3P6YC 4IOAQ 1CC7A 1RT5A 2JL9A 3QWUA 4ECSA 3VAJA 2AGPA 3LUYA 4U7UD 3WIVA 2HPUA 3G96A 3Q0AA 1XIQA 4CTAA 1VDHA 2BE7D 4LRCA 4NOHA 1N48A 4RW9B 1WOOA 2WOMA 4HT5A 2D74B 4X4NA 2ROGA 5IV4A 1CLFA 1S9EA 3N5BA 5BYSA 1RSCA 3MMAB 1S10A 2BANB 5EDWA 3VTIA 2QLXA 5KT6A 2FUG9 4Q0BA 2OPRB 4BLGA 1JJ2R 1FCAA 1JXEA 5CH7B 4ZPBA 2D3ZA 2B6AA 4RX6A 2ERRA 4FYXB 4WF9Q 1DFDA 3DDNA 4Y2AA 5K8MA 4ED7A 3EYZA 1TK0A 3ONQA 2CNNB 1NHKL 3MEGB 3P8BB 3JB9k 2KT3A 1Q8LA 4IR9A 2HHUA 3ADAC 2YKNA 4X66J 5SZTA 3DMJB 4YDXA 1I5OB 1TKTB 2F1FA 5D15A 5A2QY 1UJ5A 3BKFA 2F8HA 3OUYA 1X5OA 3TW0A 3EVMA 3DI6A 2FZCB 1I94F 4Z7CA 1WC0A 3O44A 2LEPA 1RHMB 1S77D 4U7CA 3KLGA 3CVKA 1D8ZA 1QY7A 3UR3C 1CJUA 2VQFF 5B08A 3T5JA 3C6UB 3QJLA 3KWMA 3CCLS 4RWWA 3JQKA 4DQIA 4KHPJ 2QZ8A 1T03B 4I2QA 4UOHA 2KT5A 3I5CA 3MGJA 2R8HA 2HGNA 3LPYA 1YHQS 1RHKB 1FNMA 4R8UA 5ETTA 2VU5A 2MSSA 1X9MA 2EC2A 2RQ4A 4M5LA 2JEJA 2ZM6F 2IVFB 4Z37A 1JB0C 4PQUB 1NSKL 4DPOA 1RYRA 4IRCA 1O6XA 2GV1A 1JLFA 4ZP7A 3FEYB 3HF5A 3SDEA 3W8GA 3K89A 3KJQB 2XLIA 2B7BB 3GCXP 3I56S 3LANA 3DOLB 4RLEA 4AUKA 1FESA 1UJ6A 1NZ8A 4FPRA 3EGNA 4ERDA 1VC0A 3UN2A 4E0DA 1MMLA 1IWGA 3I32A 1MWZA 3F44A 4M5MA 4DL2A 4KBIA 5KFVA 1X9WA 3BH7B 1E6VA 1JLQB 4KFBB 1HBUA 4JV2A 4NXNJ 4H4KA 1IKVA 2EW9A 3MMCB 3IN5A 2DPIA 1KRPA 4LQ3A 1RAAB 2FB0A 3SSQA 4CM2A 5F0WA 3QQCD 3OW2R 1WEYA 2JLGA 3MTJA 1SV5A 2N3OA 2ZH2A 1FRLA 2W1BA 2OLWA 2OPPA 2RMLA 3D7SB 5B0EA 3MUTP 3EUNA 3D3CJ 1UWBA 1V9OA 1S79A 3A8JA 3D66A 3OHAA 1NK6A 3HJFA 4OI6A 1RT2A 2XI3A 1W2IA 4KY3A 4CT8A 2UP1A 3C2PA 2R7QA 3Q83A 3W3SA 4PWDB 5DM7Q 2IYGA 1JNRB 3FCHA 2P9CA 4ZP6A 4ZOSA 2L41A 3CJ5A 5J2MA 3R1HA 2HS0A 4X2BA 4M94A 4RW4B 3VAHA 4I56A 1R8PA 2LFVA 1YBAA 3W63A 4DX6A 1ZA2B 2LXUA 5KT2A 2LDYA 2VD3A 1YRXA 4NXMJ 3K0JA 1KQGB 1H7WA 2XYGB 4Q43A 3FQKA 2R8JA 3P49B 1RAGB 1ZAVA 4NWBA 3E3XA 4NXNF 3JTPA 4M5JA 5GAEI 4JI6F 3CWJA 3GTYX 5LXRA 2AEMA 1WACA 4I69A 2XHWA 4DJBA 1XR6A 1MW7A 4DS5A 1OMSA 4KRWA 1C4AA 1X31C 3M2RA 3PW2A 3HKZD 3S7RA 3BSCA 1FEHA 1YBUA 3VGSA 5KFQA 1B0VA 4QYRA 4RUBA 2DCUB 5CXTA 2I2YA 3G82A 3TUPA 4PG4A 4DPTA 1QVFR 2CPFA 2FHJD 4DR4J 2QE5A 3QMQA 4KYZA 1URRA 3GSDA 2KN4A 3D9BA 4TYBA 5J1EA 2YKMA 1QLNA 4F02A 5D8HB 5B0BA 3MAAB 4DSLA 2Y0SD 1BQMB 1TL1A 4ZVOB 1YBTA 2CJQA 2XMWA 4NLOA 5KOWA 1CPZA 4WFXA 2CQGA 1YJ9S 2KM8C 1WG1A 2CYYA 4NLVA 2MLYA 2QA4G 4KGMA 2VASA 1G1XA 5E0OA 1RAFB 2E66A 4TYAA 3CJ3A 2CAJA 3M8WA 3O1LA 4Q7AA 1MWYA 3BKUA 1Y7PA 2CIMA 3DRYA 1SIZA 3I9V9 4CYUB 1S76D 4DSIA 2ZBIA 2C2EA 3C46A 2QL5B 2IAJB 4O4RA 2FYXA 2QO3A 5KFSA 4EO6A 2JEIA 4X4UA 1X4FA 2P2CB 2AYBA 3MHYA 2F8EX 1IBKJ 3QLHB 5K8OA 2IJRA 1Q78A 3PIPQ 3X1LB 1T9VA 2QL9B 1HNVA 3PNIA 1WORA 2BW7A 3C19A 2OO4A 4OZNA 1RAIB 3DXBA 1HNIA 1E6VB 1JLQA 3E01A 5IS2A 2YWFA 1KLNA 2E5GA 5KFLA 1W7WA 4IO9Q 1W2BR 1N8RT 2CQHA 4M5KA 3DLBA 3TI0A 4PKDB 4F7VA 2R7VA 2R7WA 2CJBA 2PMHA 2HGMA 1OPIA 3AJ2A 1TZ0A 3OFHA 5DG9A 3CJQA 5DLFA 4DFPA 4NLYA 1RTDA 1D9AA 1FWKA 4IDKA 2RHQB 3Q89A 3RZAA 2Z2MA 3H5UA 1IM4A 5B0AA 2VPYB 5HQLA 3NAHA 2B9YA 5LT5A 1VQNS 4NRUA 2VDHA 3KKFA 3SCJE 4RW4A 3EPIA 2QA4S 1VC6A 2DXDA 2LEAA 4K2JA 4KIAA 4I0WA 1BMQB 4ZVHA 2YNFB 3RW7A 3R5BA 4RW6A 2MQPA 3S8SA 2ADCA 2DR8A 2OD6A 3PM9A 1FXLA 4B9TA 3BQ2A 3C6UA 3CMAS 2RVJA 1A0OB 5HJXA 2HURA 1WHXA 1NHUA 2L9DA 4EK2A 4ZIWA 3TRGA 2WHOA 3MECA 1WKJA 2FGOA 5K8NA 1XMOF 2HHHF 4WJBA 4ZLJA 5IT0A 4NZ0A 4KPCA 4XK8C 2AEFA 3W9JA 3KJVB 4K0KJ 1KVKA 3BEGB 4ES3A 1UVKA 2XNQA 1FX2A 1ROFA 3CCWA 2XLKA 2B9WA 2RQKA 1U1LA 2JVRA 4X65J 1Z4UA 1FRMA 3T6BA 3V81A 3OVBA 2V4JA 3UN5A 1KEKA 1NAQA 2I38A 2CA9A 3IRXB 3OR2B 1RHQB 2H5IB 2C3OA 1V6HA 3C66A 3NCPA 4PPZA 4A8OA 3BO2A 3LGNA 2WCXA 2YNGA 2EK1A 3H2VE 4TXSA 4CDIA 4ECXA 4QBUA 4OYAA 3MMBB 3AXMA 3T9NA 1IJEB 2CG4A 2UZAA 3K7RA 4HYKA 3V4IA 3N6NA 3IR5B 1BQMA 4CQ1A 3HMJG 2FY1A 1B0TA 1DARA 3SCLE 3VAFA 4B3RJ 4HR2A 3M6UA 1PAEX 4NYPA 2B3TB 3JAMY 2UV8G 3DU6A 2QLFB 3QPIA 3KHLA 5E3PA 2XM3A 2BOPA 1QVGR 3FGVA 3HHKA 3UD5A 2G2ZA 3HSGA 5HMZA 1WDDA 5C25A 5JMNA 2BQ3A 2CUYA 1WC5A 2RSQA 4GKKF 3PW5A 1SC3B 3N6MA 3UCUP 1EETA 2P9GA 4DZDA 5HJYA 2YX1A 4DFMA 3MR7A 3HHLA 3HD1A 4IFVB 1R7IA 4PABA 1EIYB 4XO0A 1M0SA 4FVMA 1LWXA 2LDIA 2NCKL 3G6VA 2RRAA 1Q0NA 3C6TB 3K5PA 2BX6A 4ES1A 4OQJA 1YITS 2IM1A 3R6GB 3TJ9A 4X62F 3M9OB 4CRJA 3W2WB 1L5UA 1S59A 5ETLA 3J81U 2RDDA 2AJ4A 3KG4A 4MIBA 3TR5A 1YGYA 3DHXA 3CEDA 4FZVA 1U1OA 5GMEA 1NJYA 4PRFA 1P6TA 3MXHP 2HAFA 2IC3B 4BWJA 1IN0A 7FDRA 3MEDB 3Q22A 3H4BA 4ELVA 1TFWA 5IXUA 2H4YB 3EDRB 3ISNC 2IBKA 3TAMA 1AROP 3C16A 2VC1A 3S1TA 3GJTB 1E6YA 1FJCA 4PG6A 5F8GA 3U1NA 2DITA 4FXWA 3R9LA 2CPEA 2V8HA 2CQBA 3PX0A 3BDEA 3NWRA 4ZVTB 2M3DA 3ENVA 3SSSA 3MR3A 4AL6A 4I4BA 2ASLA 3POTB 1R8CA 4TY9A 4DL7A 2VH7A 2L08A 3AH6A 3GFYA 4OLPA 1S57A 4FBUA 4H4OA 1LXNA 2N3LA 2ZWPA 4QIEA 5D4PA 3N6LA 5D78A 1CBKA 5C24A 2K2PA 3NS5A 3HFKA 3SYZA 1X5TA 2B0GA 2Y1LB 3B78A 3SIPB 4CH0S 4YUDA 1UW9A 2HZAA 2VQEF 4ILLA 1NK8A 1BLUA 1YJVA 1NHVA 1NJXA 2HHWA 2V68A 4NA3A 4TQRA 2CPDA 2OPRA 1P27B 3G6ES 2UVUA 3CIZA 1RBOB 2ZH4A 3JSYA 4NLDA 3IR6B 2BJ7A 2EG1A 2IHR1 5J2PB 1HA1A 3L7PA 3MR5A 3RU0A 4YOEA 2NSBA 1X8DA 2WONA 2QEXS 3MEGA 2VPWB 3DOMB 3LP0A 5KFAA 2HVHA 1BUXA 4KGZB 4LF6J 1ACMB 2B8PA 4G1PA 4IO1A 1S9GB 5KG4A 4ED8A 3AOAA 2WVDA 1N5YB 4HEA9 4OHYA 4DDFA 4FDFA 3TQ1A 4IH7A 3SQOP 3QFWA 1NSQA 1U1NA 4C3LA 4ZJQA 2MPUA 4NCAA 1LK5A 3G8TA 4USUA 1T03A 1Y10A 3VZIA 3V4IB 1RACB 4PG8A 3ZO7A 3CB4A 3MPYA 1CJUB 1Y4ZB 1X4AA 3ZZYA 3BPDA 4K8RA 3TQEA 4ZVPB 3M8QB 4BC9A 2J0XA 3DLJA 2MZTA 4F04B 2UUCJ 2UXCJ 2XI2A 3GIRA 3RW6A 5D4OA 3PKYA 2FVQA 1D09B 1GX6A 4KE5A 1T9TA 1YWXA 2HNYA 3VQSA 2RAQA 2HFVA 3X3UA 3U1LA 5KFNA 3PZPA 2D3OR 1VBZA 4HHHA 4MKBA 3DLEA 4N47A 2MTLA 2NPFA 3W62A 5CQGA 4U67Q 4RNMA 2Y1IA 3VZHA 2F9DA 1A7GE 4LJMA 4YY3F 5KFEA 3ENAA 4RKUC 2HNDB 2V2QA 2OI2A 2I9SA 3BR8A 4XPEA 2O66A 1ZAWA 1V5IB 2DHGA 9ATCB 1NCLA 2DD8S 2W9AA 3MCMA 3HHEA 1JXLA 4H54A 4QPXA 3PJ9A 3GFHA 5I4MA 2LQJA 3BR9A 2UVWA 3MUMP 5DLGA 4CNYA 1OY8A 1FO1A 2WB4A 3VF0B 4B3SF 1FDDA 1WHYA 3HLUA 1N5QA 1FK9A 1RT6B 3R7NB 1M5VC 2JHEA 3I96A 1SPBP 1HWKA 5FDLA 2QSWA 2BE2B 3QIPB 3GFZA 1VOMA 4LUBA 2POKA 1FE4A 2DY9A 3CDWA 4EO8A 2J6TA 2A6OA 2M8DB 1X7VA 3OFGA 2VICA 4TNOA 1Q79A 5K14B 3PKMA 3J80U 2XYHB 2DGQA 4USVA 1X0PA 2Y3YA 4CO3A 3R5CA 4RWXA 4P10A 5GAGI 2JEFA 4I2QB 1FERA 2XCPA 2U2FA 2A2DA 2CNLB 4LBPA 4JYAJ 4H4KC 1HWLA 5F9LA 5LOQA 2KJWA 2GGPB 4WE1B 4OI1A 3ISND 5J2QB 4WP8A 3M9MB 2ZUGA 1JWWA 1YKWA 2EFVA 4ZCIA 3RJMB 1KDNA 4PWWA 3KMSA 4PUOB 3DM2B 3BBCA 2UV8A 3KJNB 3NEKA 1MN9A 2W2QP 3FBFA 1EQ0A 1ZM3A 2IFXA 2AIRB 4OFZA 4ZCKA 1L3SA 3W2VB 4ZP9A 2HBZB 3GONA 5CD4H 2YWKA 2E1RA 5I3UA 4WKYA 1FD8A 2OFHX 1JLEB 3I5BA 3NGKA 1HWJA 2D9PA 1TP7A 4ER8A 4H4MA 2ZBRA 5B09A 4GO7X 4WIIA 4USMA 4WTOB 4YB7A 1DAXA 1C1BA 5HI7A 2ZUAA 4F4XA 3DCAA 4M5NA 2XMJA 4KH1B 3D6MB 1F9HA 4EZ9A 2CZ9A 2ZVIA 3IAM9 2YX7A 3M8QA 4OJ3A 4NLRA 5J2NB 4N41A 4UOCA 3N01A 3EZUA 1SKSA 1YLXA 1KQKA 1NB2A 4LFAJ 4HHJA 2ATLA 3PHEA 4ZDNA 4DV1F 2CNOB 3EXCX 4KO0B 2EG2A 4C3KA 3JYTB 1XMBA 1IKWA 3DLEB 3NGTA 4MFBB 2EFNA 2PEHA 3UVJA 3ZNUA 2V4QA 2ZH1A 2VIHA 1XERA 1SCJB 2HSEB 2MQMA 2OELA 3CT9A 3EM1A 4GC6A 1DQ9A 4TU9A 3DLGA 2C3UA 3GCWP 1KSPA 2PDAA 1F5CA 4LFAF 3HDSA 2VKZG 3EMTA 3NCQA 4IG0B 3VALA 5I42A 4OI2A 4Z7YA 1SJ1A 4C11B 4O3SA 1HNWF 5HMYA 2XS5A 1REVA 1M5HA 2HFZA 4QWEA 4ZS6A 5K5MA 2FVSA 4C8LA 3I31A 2CVEA 2VFTA 2VJUA 1RTDB 2EBEA 3GG0A 2N7CA 5J2PA 1RU1A 3EGWB 2ZBQA 1MROA 3DRPA 4C8NA 3JSMB 3EICA 1P9YA 2V9KA 4OZ1A 2EK6A 3JTOA 4KH0B 4PCQA 1VHFA 3OTEA 2CJAA 1NXIA 2W9BB 1FD2A 1SKUB 4QIWD 1Z1ZA 3H2UB 3DYAA 1HMVA 3CJ8A 5KFDA 1WSVA 1WTFA 3DLKB 2LA4A 2JFKA 1EAYC 3HSDA 3MUVP 2HHXA 2WAQD 4J90A 1VHIA 2W7AA 4DCJB 5A8KA 2EFOA 1HI0P 4DV5F 2XULA 4DV6F 4P2SA 3Q86A 3VVUA 1F0XA 2CPXA 2ILZA 5F8NA 1TUWA 3RAQA 3PY8A 3GQCA 2E9RX 3M2VB 2KI2A 2JOQA 3B6BA 3HKWA 4WFZA 2HIQA 3CSKA 1C2PA 2OMOA 4RW7B 3CCJS 3CJSA 5K8PA 3RRHA 1DLOA 1TL7B 2G2YA 1M5OC 1DJ0A 2KO1A 4Q8FA 4NZ7A 4LRAA 1JLGB 2DGSA 4GO5X 1Q5YA 3ET6B 1N52B 2GMJA 4O3OA 2PI5A 4K5SA 5J2QA 3RBEA 1U4BA 2GQ2A 2YKPA 3P5TL 2AWZA 3TA1A 2VODA 4BS2A 4X64J 1KOOA 1LKZA 4RO0A 4Y2IA 1ZTTA 3HM9A 3MPVA 4GRSA 4WXOA 1SL2A 1IKYA 3Q23A 1RADB 2XWYA 2QN6B 3VWSA 4C6AA 3HVRA 4CH7A 4F4WA 4JI3F 1TAUA 4W90B 1SJ4P 2HWIA 4HH1A 1CJTB 2UXCF 4TKTA 5AXMA 2HQFA 2NSCA 2DBBA 4IFYA 3RBXA 1S97A 1RWOB 3PO4A 2DIUA 1H74A 2BUNA 1K0VA 3RYLA 3TA2A 2OHDA 1NDPA 4LVOP 3GIIA 3RBDA 1B7FA 2HQGA 2CDQA 2V6AA 1NZAA 1T7PA 3NGSA 4PXDA 3AHPA 1WC4A 2ASYA 1DY3A 2W2OP 3MFHA 4OLOA 3B8HA 1SJQA 2AYMA 4QQBA 5KT4A 2E7XA 3A4TA 2N82B 2E1MC 4FS2A 3FSIA 1XNQF 4R8UB 2VG6A 4CLPA 4J9PA 1R6VA 3U27A 4HDHA 4IYQA 1N34F 3FRYA 1XNQJ 1X4HA 1K1SA 1VBKA 4I7FB 1VCTA 1R43A 2VPXB 3JSRA 4ECUA 3H40A 3IFEA 1N5SA 5F3TA 3K5LA 1S48A 1HBUB 3BGUA 4N77A 2BKOA 1PYTA 5AE2A 3PW4A 2J6SA 1F6TA 2LXIA 1GMWD 3RB4A 1VQ4S 2CFXA 3IS9A 3R8YA 3RBZA 2OPPB 1VQSA 2YNHB 3M8RA 3UN3A 1WTBA 4O3QA 3D6TB 1QSSA 4RBTA 3HVTB 2GS8A 4LVNP 1IKVB 1W26A 3I6PA 4QPTA 3GFXA 2ZM6J 4Y3CA 2DHHA 5BR8F 3R3TA 5T7LA 2QL7B 4O3RA 1URNA 1AUSL 2WVEA 3K5OA 3HSZA 1PJ7A 3OR2A 2YKNB 2LQ8A 2MKSA 3H8YA 2C3YA 3ETOA 2FGCA 5J1PA 4F3OA 2WSCC 4NLXA 4UY85 4ZIVA 1SXLA 1B0PA 2QYCA 2VG7B 3SV4A 3NNAA 2GFFA 1F5BA 2ZBPA 1XR7A 3PJWA 4MK9A 1M5KC 2XMTA 3L4BC 4DCOB 3EJMA 3HO1A 3OL9A 4C98A 3JSBA 1EP4B 1OYEA 3IGNA 5E33A 5KFPA 2ZHBA 3HXMA 5J2NA 2DY1A 2MQ8A 5C24B 3RB6A 2RH3A 2F4VJ 2J0QD 2WVFA 1HQUB 1HI8A 1JXVA 4LBIA 3C3LA 1HW9A 1N32F 2ABYA 2Z58B 3DOMA 5AXLA 3UD3P 3GJRB 2J8SA 5MAOA 5EHHA 5KFUA 4DV6J 3Q8QB 1X4GA 3EPGA 3BJYA 1FTRA 1F3VA 3IM9A 3OTCA 1N5YA 2XZTB 1TQLA 4HACA 4DPWA 3TUJC 1WF1A 2RE1A 4PG7A 3PVXA 4LF9J 2IPOB 4YEAA 4F4YA 3OSNA 1RT3B 3P96A 2I5JA 4EFAC 4JI0F 5A8WA 4NCGB 1OQ3A 2OGUA 4YB5A 2M88A 2F8MA 2MY7A 1UA1A 1FDNA 4DR2F 4NYOA 2IIHA 5T41A 5KFTA 3B82A 2GCFA 2MZSA 3UQSA 1G3OA 3A12A 3T3FA 3Q24A 3ZZTA 1TL1B 3ZZRA 3MOZA 3LGMA 3VGUA 4CYUA 2M5YA 5D6GA 5KFHA 2J0WA 2JNJA 2NXNA 3Q2SC 4DX8H 2WSEC 2Z8QA 1DURA 4HT7A 5DETA 2GC8A 3CO0P 3H59A 2AJFE 2VF3A 4OV1A 4JI8J 2AJ1A 2FVPA 1XNRJ 2HNYB 1F9FA 2HRTA 1DQAA 3LPEA 4PYAA 2EI5A 3WHIA 5K9FA 1QD1A 4HTIA 3KTQA 4JI4J 1HNVB 4LSNA 1MLAA 1VRQC 2WZ1A 2XYPB 4L3KA 3RRKA 4EI2A 4J9UE 4LBHA 2DYAA 2XEXA 5KG2A 1AZSB 1UW4A 1JJCB 4IDKB 3KK1B 4DUZJ 1NJZA 1HFEL 5CD4A 2W4PA 1TFYA 2B5JB 3SCIE 2VA2A 3DXSX 3R2CJ 3W5YA 2CPYA 1YJRA 1DHMA 4X4SA 1TKDA 4KHPF 4M5DA 3SFUA 4HDGA 2NUUG 1LNQA 2QMWA 3AODA 3MPWA 4DL0C 3O6QA 3N28A 3GILA 3FRZA 3M2RB 5HL7Q 5L1LA 4DL4A 1VQMS 1XMQF 3PX4A 1RWNB 1GK8A 4A46A 4P7TA 3CJ2A 4DOZA 3GE9A 1IBCB 2ILYA 1XWLA 2AYGA 3CCRS 2E5HA 2X51A 3M8ZA 2IYIA 4J91A 1QTMA 2JLEA 4NMXA 2CADA 2HS4A 4OZ0A 3H5YA 2E29A 1VQYA 2ZH5A 5DZ7A 4CP5A 2Y1RI 3LGHA 1CS4B 3HHLD 4X66F 4FF2A 1IJFB 5FDLB 3OHBA 2QT7A 3JQJA 3TA0A 1IBLF 2FJWA 1HBOA 4CH1A 4W4MA 4YR3A 1U2FA 3I0SA 2GGPA 4WE1A 3FDSA 3ZZOA 5BR8J 3QGHA 4L74A 4OHZA 3TZZA 2BANA 1VQLS 3J80Y 4FNHA 3BB5A 4CIOA 2Z57B 1W25A 4ECQA 1SKRA 3PO5A 4LF6F 1UTAA 2IVYA 4GC7A 2Z30B 2UXDF 4RUHA 5CCLA 4BBYA 4ED6A 1NDCA 1FJ7A 4U9RA 3IRXA 3NRBA 3KDOA 1RT3A 4AL5A 2BKPA 3FUYA 3MAHA 4NCGA 4U8VA 2R2TA 1HBMA 2HMIB 4GKJF 1RA6A 4WP9A 1R8HA 3TARA 5BYRA 3OBIA 1IBKF 5CHCB 3EZOA 3MM5A 5H9EK 4QIGA 2COLA 2PD1A 3DRXA 2X3DA 1DZ5A 3I0RB 4NEZA 2MKHA 3ILJA 1PJ5A 2FC9A 2H3EB 1IVZA 1Y11A 2PO4A 2W4DA 1PBAA 1CJKB 5DM6Q 1HNIB 2D3UA 1VK8A 3VAIA 4G65A 1G7CB 5DO2A 4DZ6A 2NQPA 1RISA 2W2MP 4JV0A 3OLAA 2R9LA 2EFQA 4OYWA 2R2SA 1IBMF 2RDJA 1IKXA 1RABB 1DTTA 4HH0A 5C2CA 2PA3A 4B3TJ 1L3VA 2V69A 4OI0A 1FXRA 2G4BA 1B3TA 1EZZB 3TAPA 3D6HB 1WSRA 3CDAA 2E7WA 5C25B 3BQ1A 3PX6A 1NKEA 5FD1A 2J0SD 4K4XA 3HZGA 4LSNB 3KDNA 3KMQA 1S1TA 4G3IA 4CO2A 5M2PA 4HI1A 3AB4B 1TL3B 3ZFVA 4K4YA 2BMBA 2B6AB 5DQHA 4X62J 1LFPA 3VHQA 1WF2A 1FRJA 1R27B 1TKZB 4F4ZA 4LR8A 3MZIA 5FJ4A 1S1VA 2D7SA 3KG1A 1WNEA 2D41A 2OPSA 4EWTA 3MCNA 1AA1B 3J7A1 3W2WA 2X7IA 2HK3A 2HW3A 4AXJA 3MAQA 1K9MT 3A1YG 1BQNB 1H7XA 1ZOTA 4ETXA 4AQYF 2DR7A 2DO0A 1PIEA 2KHDA 2DNGA 2EFGA 3J7YI 3OJUA 2DR9A 3IGVA 4I68A 1NSPA 3V81B 2J76E 2HQDA 2JC0A 1P9QC 1IR1A 2V4JB 1GXLA 1P1TA 5FIIA 1WWHA 3G8SA 4B9VA 5KFGA 1FDBA 5L1IA 2Y1JA 1NK5A 4B3MJ 2V67A 4ECVA 3T1HJ 1RKJA 2UXBF 1MG7A 1PC4A 2PN6A 3ZZZA 3CCZA 1SL1A 1TK5A 2KVQE 2VB6A 4CLSA 1SJ3P 2KZMA 2QMUB 4F3QA 4IUFA 2XMAA 1LWCB 1S1UA 1NMEB 2MQOA 4YQWA 1RB0A 4J9SA 1BWVA 2RD5C 4HKQA 3KLFA 3AOBA 3H42A 1KQSR 1CJVB 3F41A 1JMTA 4WBFA 4DR1J 5D4NA 1RHUB 3J7Z5 5EWFA 5JVGQ 4J9NA 1OQ6A 2Z0GA 4DR7F 3LA0A 1R31A 1S72S 1U2RA 4CT9A 1RLCL 3FNNA 4MH8A 4U96A 3QJJA 4PQUA 1Y3JA 5DJBA 1NH7A 2RQMA 2QA2A 2KDOA 1HR0J 5HN0A 1FXDA 3MCSA 1U6BA 3SMZA 4BC7A 4Q5VA 1IKYB 2AX1A 4C4WA 1D1UA 4KT0C 4UUXA 2WONB 3C6TA 3U7JA 3PR4A 3VV2B 2O3DA 1HYSB 1RWPB 1BQXA 1U09A 3BYPA 1B99A 1RAHB 1O8BA 2LECA 1J5EJ 3LQVA 4MT1A 5GAHU 3KK2A 2W8KA 2C2NA 3M2UA 1Q8IA 1S5ZA 3PYFA 4QR0A 4X4QA 4OZLA 3LO3A 4WFBQ 2CJKA 1JIHA 2JJ4D 2NXUA 2CJXB 4DI6A 2C28A 5FLXU 2CQ1A 5DG8A 3G6XA 3DLLQ 2KKHA 1Y00A 5HVGA 1SJRA 1TV6A 3A3OB 3DYAB 1XK8A 4UY8T 1RTHB 1PGZA 1VQ8S 2VG6B 2DEJA 3LW5C 1RUSA 2BEFA 5A0YA 3W66A 5BXIA 1IKXB 3TJ8A 5F8LA 1SV5B 2ZJPQ 4DR3J 2FZKB 2UU9F 5L9XA 3ICLA 4HVZA 2H4WB 2GNKA 3ISZA 1E6YB 2GJFA 5JJBA 2NR0A 4FXVA 4OYMA 3BREA 1L3UA 2W7PA 2R7UA 2DH8A 4K4SA 1M1GA 2J6UA 1X4DA 5KFXA 5GMDA 2E5LF 3M32A 3Q8RB 1V3RA 1C0UA 4NLTA 3IG1A 2ZH8A 1GAOA 4OX9J 2AJ0A 3CCQS 4LSZB 2DNRA 3ILLA 2UUAJ 1Q8KA 2KYZA 1AYEA 3MI7X 3KK3A 2XCAA 3ET6A 4J9MA 1HQEB 6FDRA 1XN9A 2C2RA 5ETKA 2D69A 3BYRA 2E9TA 4PXBA 4DN0A 1T9WA 3MTKA 3QGPA 1NBEB 3KG0A 1SUQA 1LQ9A 1O0PA 3AQPA 1M90T 3FBBA 3GR0A 5IZHA 4DSFA 2HBRB 4DSEA 2UUTA 3HVTA 4S0MA 1NUEA 3RAXA 2R7OA 2FJVA 1FF2A 2OH2A 2RRBA 1J5OB 4O4GA 2O5DA 4C0BA 4K50A 1VLYA 3NNCA 4DUYF 4KB7A 3OL6A 1QAJA 1U1KA 4D3HA 2ZZNA 4DBQA 2XZDB 1NO8A 3W5XA 5AE3A 5EGYA 1LW0B 2HZCA 2JWNA 2HRUA 4G1IA 4CI0B 1N36J 5K20B 4C0HA 1RXOB 1U2CA 1UVMA 1UVNA 2OEMA 3CC2S 3RAMA 4DR2J 2X1BA 5KFYA 1HHQA 3G6YA 4ES2A 3DGPB 5IWAJ 1AB8A 3AXKA 3C14A 2KG1A 1RT1B 4J5OA 4JI0J 4FBTA 2E1CA 3PV8A 2W8LA 4J9KA 1ICEB 1HPZB 3DOKB 4CLTA 1PG5B 3IBCB 4ZVFA 2H1YA 3PR5B 4DSKA 3BBBA 3ILOA 3OD2A 3UCZP 1D9DA 2C2OB 2YQ3A 4QW8A 1QAIA 1Q8BA 1KN6A 2ZKUA 5KFMA 1U7LA 3HFZB 5E3AA 3HVWA 1TL3A 4J9VA 2IAJA 3KJVA 3MF5A 2XY7A 2GHVC 3R2DJ 2H51B 2HNDA 1MU2A 2Q1LA 4PG5A 2XQCA 3D1HA 3AAWB 1U47A 3BBFA 2W7OA 4TY8A 4TVAB 1TL7A 2B4OA 4KHRA 3UI3A 2DGXA 5E2QA 2YBVA 4YB1P 1WOSA 4EUVA 4V1Ak 5EX0A 1RT6A 4KV8A 3CDEA 3JYTA 4QIVA 4RJVA 4NPOA 3GB0A 2HHVA 3AT1B 4X4VA 2AQ4A 3TAQA 4ZPCA 4ILMA 2EPIA 4Q45A 4B3SJ 1NB7A 4HHUA 4DL3A 2GW8A 3AA9A 2XMUA 5GADU 1RKIA 1VISA 2GQQA 1LV5A 3NP5A 3W65A 2MZ1A 1FTCA 1IKWB 1UFWA 3UVJB 2C2MB 1UEKA 2ZOMA 2P9EA 4FXDA 2DNYA 2EXUA 2LQ5A 1HNZF 2J9EA 3THVA 4IRDA 2MQLA 1KQFB 3MM7B 3WZ0A 2DNZA 5IQ6A 5CABA 3HPOA 2RIJA 1KFSA 4A47A 1YRUA 4L6V3 4ZVEA 2BZ2A 3DMJA 3R6LB 1VQOS 4ANCA 1V5VA 3C15A 4K2XA 1J5OA 5U47A 1IR0A 2MKYA 3SQGB 3WC0A 5HQMA 5GAGU 2VPZB 4P9SA 4FP9A 4DLGA 4PUOA 2NZ4A 3GIMA 1XR5A 1MNEA 3TJAA 4RZRA 1LXJA 3MMJA 3GZ7A 3CCSS 3A8EA 3DLKA 4EYIB 4C8MA 2EEYA 2YWGA 1REGX 4ZVRB 3CJKB 1GTEA 1U8WA 3ZTQA 4C8YA 1HARA 4DMZA 2C42A 4DS4A 3G86A 3FBEA 4EBDA 4USKA 1GMWA 2PSZA 3AY0A 4UTGA 1LFWA 3KLEA 2DEIA 3NXZA 4F25A 4WFNQ 4NLWA 1RE1B 3GYNA 3V6DB 2AX0A 4LRDA 4PWUA 5A6PA 4DL5A 4UT4A 6FD1A 1HD1A 3H90A 1C0UB 3ZTOA 4F3MA 2VV5A 1ZTWA 4R0EA 4DUZF 1TELA 5H1SV 3HX9A 5LM7E 3PIOQ 4IFYB 1WC1A 3CNQP 3CMQA 3DRRA 3WX4A 1U1QA 2V5HG 2HMIA 1GQEA 3SDEB 2RRNA 2YQ1A 2XO7A 4M5DB 4ZA1A 1PSDA 1FI4A 5RUBA 3K8VA 4ZPVR 4ANDA 2F40A 3TANA 3CE8A 5GMKa 4OZ3A 1M1HA 3M30A 1KFDA 3DU5A 4XTTA 2AV5A 5IOLA 1VS3A 2G1DA 2HVDA 3E8OA 2QLWA 3PRDA 4Y28C 4DU7A 1B64A 3U1MA 2MGZB 4QWAA 3QSYB 4CCHA 4B3RF 3L9ZA 1U1MA 4B02A 1F2HA 2R8KA 4JI1J 2FJXA 2IC3A 1G2EA 4IR1A 2L48A 4O4GB 4WWSA 1DTQA 2G0CA 3C16B 5HVFA 3VGVA 1ZETA 2DCLA 2HGLA 4FPIA 1QSYA 3BSOA 3MM8B 4K7QA 2C2ZB 4Z2XA 3MPUB 1HMVB 4Q44A 4P72A 5KT5A 3BO4A 4U6PA 6AT1B 5ETNA 3GYXB 2RILA 1TVRB 2AEJA 4M5IA 1FNXH 4YN3B 2KG0A 3LP1A 4LF5J 3VVTA 1RDRA 5C5JA 1GX5A 2MHEA 3BGRB 1DQ8A 1KLMB 2VUGA 2JZ5A 4EU0A 3T6JA 4KC5A 4KKOB 4IH5A 1U0HB 2C3PA 4MIAA 2VHGA 1YJNS 1HNXF 2IY5B 1X5PA 2OEJA 3LWLA 4GVBB 4EBCA 5KTQA 1NKCA 5IM0B 2Q6BA 1LK7A 1MWQA 5DGBA 3MR6A 3CTRA 4F0KA 2PGCA 2AKWB 3MM6B 5ITHA 5A2QU 3PTWA 2RKIB 3KNAA 4K4TA 3WBZA 1RWUA 4DHVA 2I1RA 4PPDA 2QX0A 4G6VB 5DDQC 3QRQA 2YX4A 5CA5A 2FIUA 4MKYA 3GIJA 1S7HA 3PFEA 4QYZK 4DN9A 1UZHA 2QLBB 2XO6A 5C2GA 4I67A 5BJRA 3A3NB 2BYCA 4RNOA 1K8AT 3D67A 3M8PA 2I8EA 5ETRA 1U6ZA 1LWFB 1TK8A 5LXYA 2HKEA 3PEJA 2B43A 4MKAA 5D0HA 1N33J 3MEKA 2J9DA 2DNNA 1OSDA 1SI9A 4OZ2A 2IDLA 2AGOA 1J5EF 2FHKA 4Y34A 3W9HA 4M5HA 3MEEB 3W5ZA 3HK2A 4JB8B 1VGYA 3QGGA 4FF1A 4PAAA 2K7KA 2A1BA 5DQGA 3GMGA 4WCEQ 1UL3A 2Z2LA 4ETZA 2A6MA 1S1TB 4UQTA 3T1HF 1OJ4A 3JQMA 3KXDA 4UOFA 3BSAA 4I6AA 2HVZA 2HG4A 5C42A 1NK4A 2G13A 2R7SA 3BM7A 1FT8A 1M5PC 1JK9B 3G2XA 2CWKA 2VBYA 4Q2LA 1ZPVA 1L3TA 4I7FA 3SFGA 3Q8UA 2V63A 4LQ9A 1YJ7A 1VJWA 2L9WA 2CG8A 3V6JA 4UOGA 1EJ7L 2RU3A 5ETPA 4I64A 4DR1F 2F4VF 3EWGA 2XMVA 4I1TA 2FZGB 1UAWA 3UDVA 3D0GE 3NWGA 2M52A 1J27A 2B8QA 5A76A 3IP0A 2BQUA 4R25A 5KFCA 1EHWA 2IRXA 4GMKA 3TYTA 4YS2A 4ZHRB 5E41A 2V8DA 2CQ4A 4P75A 2YWWA 2PFFB 2BE2A 4P71A 4DPUA 2HHQA 3T5HA 2C3MA 3TEGA 1KWMA 3V4MA 1RCOB 3A13A 3BGOP 1QJHA 4OYBA 4RW6B 4DL6A 1BD6A 1S9EB 4OJGA 1DTQB 4KGVB 3M4XA 3UDLA 4C0OC 2FDNA 2XMKA 3OSPA 3CCUS 2XLJA 1RHJB 3H5SA 4KTQA 5A8RA 3J81Y 4CTAB 2VJVA 3BGRA 4F67A 4F50A 2ZH3A 3M32B 3AOCA 2PE8A 3N5FA 1UEVA 2DNLA 2GZOA 2RS8A 2YXLA 2HRYA 2E1PA 2WSFC 1TVRA 1C1CB 4CM0A 4QYZJ 1MSWD 2RQCA 4JI6J 2FQQB 4QR2A 2GX8A 2RJZA 3CJTA 4OHVA 1FFSB 1N6QB 2FPHX 3DM2A 4ECRA 1FFWB 2ZC4A 1S6PB 2N4CA 5D4LA 3GV7B 3QT5A 4XIUA 1O5JA 1OSCA 4DV4J 4WYLA 3HZEA 4ZVQB 3TAMB 3BV8A 4OI3A 5I3UB 1ZM4A 4I6YA 5L39A 1RAJA 3ZTPA 4EBEA 2OTJS 1CS4A 1Y5IB 3AFGA 3ZC4A 3O2IA 2BDPA 4H4MB 2UVRA 1YRTA 4RU2A 2EFPA 4XAKA 4MK7A 2OMLA 4J9RA 1KVIA 2MEWA 2ACYA 4QJVA 3DHWC 1VYAA 1RT4A 1TUGB 1SB6A 2XWXA 5A8KB 3J81j 4JI7J 1YJTA 4B9NA 4YHHJ 3ZNJ1 4CO0A 4D3GA 2FLNA 2E44A 4B3MF 2J9DE 4JI2J 2AHOB 4DR6J 2ZHOA 3UDCA 1Q53A 4ID5A 2BXJA 4B9LA 2GJIA 2AT1B 1KR4A 2RF2B 5D3GB 3I0SB 3M7VA 5AXKA 2BRKA 3TX8A 2X1AA 3KLHB 2IVMA 4NE9C 2H48B 3CJRA 3PYDA 1B4SA 2V9WA 1QM9A 1RAEB 2DRAA 4O3NA 3VCDA 4ZLPA 1KKHA 5LJ3Y 1JLFB 1TTHB 5DQIA 1YDLA 4E8UA 1PC5A 1UZDA 5HBMB 2BJ8A 3DLHA 3AD9C 3H0PA 2Z4PA 4USHA 3I4PA 4CNZA 1HNWJ 4PZVA 5THWA 1YIJS 1S1WA 1X0FA 1N88A 2MJNA 2ZE2A 1HWIA 2KB2A 3LP0B 1L3KA 2F3JA 3B4DA 2QG9B 3DDIA 4KSEB 4UW2A 1H3DA 2DT9A 3QZ7A 1KTQA 4BWMA 3CULA 2KH9A 3TEHB 2CJYB 3R27A 1KLMA 4LF4J 5KG1A 5IFMA 2FJEB 1PO6A 3L7UA 4USWA 5I42B 1CJTA 4W92B 4MYTA 2ZH7A 1PYSB 2I6WA 4WP3A 1CJKA 2XBPA 2MSTA 1X5SA 2RS2A 3AJ1A 3TVKA 4J9OA 3NL0A 3GV8B 3D3BJ 3ELHA 4B3OB 5I3QA 1H72C 2BJ1A 4QIFA 1GNKA 5J2MB 2Q66A 1D8YA 2QV6A 2Z2YB 5A8RB 1FJGF 1S6QB 3J7ZT 4JP8A 1RT2B 1FX4A 2H5EA 3OTDA 4NLSA 4UF4A 3OQ2A 4CO5A 1Q81T 2DNHA 2A2CA 2C2KB 4LRFA 1F9EB 2OUGA 5D77A 2NXJA 3DGPA 3LAKA 4U8YA 3L3CA 1SH2A 3IC1A 2AJQA 3C14B 2KXFA 1XQIA 2ROPA 2U1AA 2XTJP 3FFIA 5G4DA 1WDTA 4C8KA 1N6QA 4R0JA 4P6QA 2HVEA 2K7JA 3C15B 3M1VB 4OX9F 4C11A 2XS7A 1LW2B 3UR0A 1HD0A 1T9XA 2DGTA 2K3KA 2ROEA 2OSQA 3PW0A 1BC6A 5ETVA 3G82B 2IMOA 3PYEA 1C0TA 3TX0A 3OL7A 5HP1A 4K4ZA 4KJIA 2DXEA 3FZBA 2F9JA 2DXFA 4FKYA 5E3RA 2ZJRQ 2M7SA 1H38A 3CC4S 2UUWA 2YWEA 3LOUA 4LRBA 2YH1A 2PEBA 1YZ6A 1FK9B 1GEHA 1RAOA 3I4HX 3WC2A 4M1KA 1LWCA 3SI8A 2DGUA 1HBMB 2KVIA 4ZITA 3QIPA 1S9GA 3K58A 5CCMA 1S1XA 3KNGA 2IA6A 2K3IA 1AUDA 4K4VA 2D3O1 1H0HB 1UWAA 2FHMA 2MQNA 4OZ5A 5KOXA 1RT4B 4LR7A 2E9ZA 2DNKA 3CD5A 3V5RA 1FKOA 4ED4A 1SQFA 5F9NA 1SC1B 2BRLA 1SH0A 2AU0A 3IRWP 1PCAA 2GMHA 3D4JA 4ICLB 4O3PA 1FRHA 2MZRA 2WW4A 2YPYA 4ZPWR 3OJSA 4OYZA 4DQRA 4O44A 3D68A 1WI8A 3IAS9 3W8PA 1YQHA 1QUPA 2ZH9A 2EC0A 1UVJA 1S9FA 4A8WA 4DG1B 2HFSA 1KTVA 3D0IE 1QSLA 3BN7A 2UXBJ 3R5GA 4P74A 5B7WA 3OV7A 1AFJA 2Y8WA 4RNFA 4C8OA 1JLBB 1NDKA 2M4MA 3NAIA 3KK2B 3FC9A 4KGXB 2LXFA 3GPAA 3GG1A 4RPFA 4OZJA 1S1WB 2E5LJ 2BVZA 5CZXA 1OY6A 1C1CA 5F3ZA 2WW8A 2AF6A 4BHQA 4U7UK 3T1AA 3LWMA 3CCMS 1U1RA 2LKZA 3QT6A 4WFYA 2O1PA 1SIWB 2XGPA 3QJPA 2M0GB 4DR3F 1N0VC 4N8NA 3TUZC 3M2UB 2FJDB 1YSJA 3H20A 2CRLA 4FYVB 2OKQA 1C4CA 5KT3A 2PI4A 5I3PA 3UNGC 4O0IA 4J9LA 3ZTRA 3VAKA 4P7VA 3BF4A 3D6FB 4DFKA 4URGA 2B7CB 1VK3A 2MYFA 5L9NA 4FNIA 4ECTA 3UFCX 3LP2B 3QAEA 1LWEA 1OS5A 2GIFA 4KAIA 2JLFA 4CLUA 4DV2F 1ZH5A 1PYOB 2DJWA 3M05A 1VRUA 3OPKA 1UJ4A 2YQ0A 2BJDA 2HAIA 1LOUA 5LL6d 4ED2A 1S4EA 5KFIA 1S1UB 4DEZA 3QNWB 2QLJB 2ZITA 2PA8D 3MM8A 1K1QA 1FWPA 7AT1B 3NGRA 1EKSA 1WHWA 4B3TF 3L95X 1ZM9A 2HS3A 3K17A 2BABA 1T3NA 1LW2A 1U0HA 1RTIA 1U24A 2M9KA 2BACA 2DO4A 2QIFA 3HVAA 3PCOB 3QO9A 5KG7A 4N56A 4EZ6A 2B4UA 1X4CA 1SUQB 3R97A 4LFBF 3FFIB 2MZQA 4DX5A 1EB0A 2V8VA 3O5TB 4YFUA 3P5BP 1Q4RA 3MM6A 2RB7A 3T1YF 1TKTA 4DPXA 1RYSA 2R4FA 4MIWA 1U8SA 1U48A 4OX6A 3P3DA 3N0VA 5LMUF 3ZZUA 4DR6F 2ADBA 2HNZA 2XHCA 5A8WB 4Q8EA 1RU2A 4C7QA 2Q43A 3H7HB 2N4DA 4JOUA 1RLDA 4RBVA 1S1XB 4HACB 3KLGB 3RB3A 3AQOA 3EZ5A 2NREA 4WZMA 4TN2A 5ETSA 1IWAA 2FHOB 3Q8YA 5CAAA 1HYSA 3CJ4A 3R5DA 3FQLA 1ZA1B 3LF0A 2E1AA 2F63A 2ZDOA 2VL1A 1VBXA 3MMBA 2XMMA 1N54B 2J9CA 2IJNA 2Q79A 2ZD1B 1T02A 1UPMB 5HO4A 1UVIA 3VAGA 4B3OA 1LWFA 4YB6A 1TKXA 4OJHA 3HSJA 5SUHA 2YWHA 2YNIA 3U02A 2OJ3A 4IOCQ 1RT5B 1IBLJ 4HI2A 3F73A 4MFBA 4A8SA 2C1EB 3SCKE 2G1HA 1S4FA 1UFKA 2FLOA 4Y0FA 3CPWR 3HFVA 2R7RA 3G87A 2DNMA 2VOPA 1AZSA 2LVWA 4A8XA 2FLLA 3MD3A 1GFWB 3RR8A 4QWDA 4F36A 3MR2A 1S49A 1BE4A 2AMCB 3ZXWA 3IG1B 4MMOA 3R7BB 1FRXA 2XSJB 2JEGA 3WQPA 3SBMA 4X4PA 3M6VA 4OHXA 3PRBA 4JI5F 3MM5B 4WFAQ 3GYGA 2V2KA 3IWLA 3NOCA 3KK1A 5IWAF 5LMNF 2OTLS 1K44A 3F56A 4WU2A 1ZPWX 2JX2A 1XMQJ 2MZJA 2DPJA 1WEXA 1ZBTA 2LMIA 2BR0A 2DRBA 1U02A 3MD1A 1NEEA 4L76A 2AZ1A 3TNVA 3FVYA 4EMDA 1CULB 2XSFA 2J5AA 1QE1A 5KG0A 2RDIA 4ZLNA 2VA3A 1ITPA 1GH8A 1RWWB 1IUJA 1PILA 3B54A 1NJWA 1T05B 1CEZA 4RW8B 2MHNA 4FF4A 1VLOA 1XTZA 4X4RA 3CD7A 2W9BA 1G6BA 5CYQB 4NCBA 2W24A 2D9OA 2NZCA 3CDUA 3IWXA 5EWEA 1YTYA 2G2OA 3IBFB 1EKRA 1Z2ZA 4LF2A 2JC1A 4CLWA 1FKOB 2MKCA 4CO4A 2C22A 2CQ3A 2KRBA 2R2UA 4QWBA 4Q2MA 5LSRA 1LW0A 2VFRA 2VZ9A 2ZEJA 3CCTA 3N9UC 1UVLA 4WKRA 2A10A 1HPZA 1RK8A 3DOKA 3I87A 3KUHA 4DR5J 3PEHA 4PEOA 3TWZA 4F2RA 1ZYQA 1OIAA 1XMOJ 3SQGA 2OAUA 3FSYA 3BN4A 2OPSB 1QAYA 4LSLA 4AFFA 2RNEA 1BHNA 1RTJA 2HNZB 3R5JB 5CZVA 2ZVSA 3GR1A 2ZKTA 4JUZA 5MLCV 1GTHA 2OEKA 4A8KA 1SKWA 5AJ3J 4AE5A 4ZPAA 5IC4B 2DNQA 3DOLA 4F4KA 1NKBA 5CYMB 2OPQA 4YDDB 4LF7J 8AT1B 2EWHA 2MKJA 2GHWA 3I0RA 5H9FJ 1I51B 3EXYA 3ENWA 3HHNB 2J8AA 2HHSA 3DFEA 5KFWA 4FF3A 3NY0A 2E7VA 4EGLA 3IBWA 2QMXA 3OL8A 5ETQA 3H2LA 2BA9A 3UW1A 2DVIA 3CJKA 3PACA 4ECYA 1CC8A 4ZVSB 2F4FA 8RUCA 4C2MA 4KR0B 1K73T 4DV0J 2IMWP 2CQDA 4UQGA 1KNZA 1VRTB 3C8YA 3OR1A 2ZC3A 1HQUA 4CO1A 4AYBD 1HNXJ 2HEKA 1JKHA 1EX8A 4FVCA 3POTA 3SZ2A 1HBNB 5CYJA 5D0GA 1R89A 4P52A 3UE2A 2P5VA 1VC5A 1IQTA 4IG3A 2XSJA 5H9EJ 4CWBA 4TU8A 2XGQA 2VFVA 3G8QA 5L1KA 2UUAF 2R7XA 2DB1A 3AJDA 4X4OA 4ED1A 2APOA 3S01A 5E3QA 1F2GA 1RT7B 3W61A 5M2RA 1S0MA 1I6JA 2MKIA 4URQU 5AJ3F 4ZMMA 5LMNJ 1RBLA 1S1VB 1N32J 2I5JB 2XC9A 3DRRB 4LF4F 4QU7A 1HLWA 1Y5LB 2DGVA 1RWXB 3V2UC 2W25A 4JI4F 1BQNA 1H2UX 1PJ6A 1WJ9A 1OYDA 1YZ7A 5EUHA 2KT2A 5HMXA 5DDRC 1KVJA 2KYXA 2HQCA 2LU1A 1TL4A 2OFGX 4JI8F 3UPFA 4JI1F 5D3GA 1Y3KA 2B4PA 2NXCA 2B51A 5HROB 3M9NB 1F5AA 2EKNA 4PR6A 2JRSA 2LA6A 3QWPA 2V2ZA 5B0DA 2WVBA 1QE1B 5IC6B 5AXNA 4LF7F 2GIRA 1CVJA 5HLFA 3G4SS 1NU4A 4A8QA 1VI7A 4CLKA 1FJGJ 2HQIA 4J37A 2H5JB 2OP5A 3MMAA 4FYWB 1Q95G 2IDEA 1UCNA 2CKWA 1K47A 1I1GA 3KLFB 5IT4A 4ED3A 1CJVA 4LF8F 1BGXT 5E3CA 5LSOA 4IRKA 3BH6B 4KKOA 1Z2LA 2GO9A 2R42A 4OYIA 3UCGA 2QYGA 3KLEB 3CGIA 1TKXB 4KQZA 3T19A 4QCLA 2B5JA 4AXIA 2YNIB 3TVYA 1EP4A 2VG5A 5B0GA 1T8EA 3P4UB 4DUTA 1WF0A 3MWBA 3BKTA 4DX7A 4YY3J 4DV7J 1VQ6S 2CZ4A 2HZVA 3M1VA 1VQ9S 3FCWA 2BJ3A 2IBOA 1X9SA 1XBWA 3TVZA 1B70B 2KFYA 2JDJA 3K5NA 2JH3A 1AT1B 1UP1A 5HP1B 4P2MA 1JLEA 3SV3A 4B17A 2CPJA 2UUCF 2V94A 1B7YB 1TR0A 2H9ZA 1JLCA 1TUVA 4E2FB 1SVDA 2G9OA 3ILIA 1C1BB 2K1RB 5KFOA 4RNNA 3K8WA 1FVQA 3H98A 5D0RA 3W2VA 3TZWA 2IJFA 3W1YC 4C3MA 4ZN1A 2HLUA 1WG4A 2ZNYA 2NPIA 4DV3F 2K8GA 3RGIA 3CJ0A 2GAHC 2Z56B 4UZBA 2YNGB 2CQ2A 1UKUA 3AD7C 4WYWA 2UUBF 3BZQA 2V8GA 2YPZA 3D54A 3BQ0A 2HVIA 4ILRA 2ZZMA 2UUBJ 3DN9A 3E2EA 1VMBA 2XZWA 3QIDA 4QOTA 4RW8A 1AFIA 3FCVA 4JI5J 4JI2F 3NMRA 4DV3J 2CJ9A 2YVSA 3HJVA 3ENQA 3PG9A 2MKKA 2CDRB 2GVZA 2B4VA 1U25A 4O44B 3WIUA 4NMLA 3H25A 1S12A 1R0AA 1RWVB 3Q8SB 1S0OA 2NYIA 1A6LA 2L9NA 2WTFA 3H4DA 1RP5A 3MDFA 3BGFA 3PDNA 3QT7A 4URSA 5DS7A 1EETB 2HFOA 1T3OA 5AE1A 2DNPA 1WHVA 4R5PB 3DGVA 3HHLB 3LALA 1YJWS 3IWNC 1T11A 2AZ3A 4ENOA 4B9MA 2B9EA 3DLGB 3HD2A 3KLVA 2VOOA 3R7SB 5F8JA 1X4EA 2RUGA 3MEDA 1MMDA 1OO0B 1NLKL 2RUSA 2J7WA 3ULHA 4CLFA 3AB2B 3LP1B 3BO3A 1T9YA 2CZVC 3OTOJ 2HIYA 1UWBB
chains in the Genus database with same CATH topology
1KBRA 1RTZA 3HSJA 4M5HA 4CYUB 2F65A 3HCXA 5ETVA 1DY3A 1EX8A 3ILOA 5ETTA 3UD5A 3HSGA 4M5LA 4M5JA 4M5GA 3HSZA 5ETKA 1EQ0A 4CWBA 1HQ2A 1RU2A 3HT0A 3HSDA 3KUEA 4PZVA 2QX0A 3QBCA 4CRJA 1EQMA 3HD1A 1HKAA 1RAOA 1IM6A 3ILIA 5ETNA 1Q0NA 3KUGA 5ETSA 4AD6A 2BMBA 4M5IA 5ETMA 1CBKA 3ILJA 3HD2A 3UDEA 2CG8A 1RB0A 3ILLA 4M5MA 5ETQA 5ETRA 2F63A 3MCOA 5ETLA 4M5KA 5ETPA 4M5NA 1TMMA 1F9HA 3KUHA 5ETOA 3UDVA 4CYUA 3MCNA 3MCMA 4F7VA 3IP0A 1RU1A 1G4CA 1TMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBR A;  1RTZ A;  3HSJ A;  4M5H A;  4CYU B;  2F65 A;  3HCX A;  5ETV A;  1DY3 A;  1EX8 A;  3ILO A;  5ETT A;  3UD5 A;  3HSG A;  4M5L A;  4M5J A;  4M5G A;  3HSZ A;  5ETK A;  1EQ0 A;  4CWB A;  1HQ2 A;  1RU2 A;  3HT0 A;  3HSD A;  3KUE A;  4PZV A;  2QX0 A;  3QBC A;  4CRJ A;  1EQM A;  3HD1 A;  1HKA A;  1RAO A;  1IM6 A;  3ILI A;  5ETN A;  1Q0N A;  3KUG A;  5ETS A;  4AD6 A;  2BMB A;  4M5I A;  5ETM A;  1CBK A;  3ILJ A;  3HD2 A;  3UDE A;  2CG8 A;  1RB0 A;  3ILL A;  4M5M A;  5ETQ A;  5ETR A;  2F63 A;  3MCO A;  5ETL A;  4M5K A;  5ETP A;  4M5N A;  1TMM A;  1F9H A;  3KUH A;  5ETO A;  3UDV A;  4CYU A;  3MCN A;  3MCM A;  4F7V A;  3IP0 A;  1RU1 A;  1G4C A;  1TMJ A; 
#chains in the Genus database with same CATH topology
 2KHC A;  3LP2 A;  2FD2 A;  3L7O A;  4M8L A;  1SQG A;  5KFR A;  3JS9 A;  3OVS A;  4DV5 J;  4JI7 F;  2VBW A;  2AYE A;  2G0I A;  2IRY A;  4LF8 J;  2Q3P A;  4RL1 A;  5JXS A;  4TLR A;  2GQC A;  3R5A A;  5F8H A;  1ZS6 A;  1NM2 A;  2HBQ B;  1FE0 A;  3KLI A;  3NLC A;  4OX7 A;  3BSN A;  4B9U A;  4USI A;  5HAO A;  3ZTS A;  4C48 A;  4MKV A;  3M8S A;  4N7T A;  1HL6 A;  2YKO A;  1CSJ A;  2JFD A;  3TP2 A;  3OTO F;  3I55 S;  1CQM A;  3OUY B;  4DV1 J;  3QO9 B;  3E51 A;  2ASD A;  4WPA A;  4NLP A;  1DLO B;  2MMY A;  3DC2 A;  1JQG A;  4Y2C A;  4GKJ J;  1H6K X;  1RT1 A;  4ANE A;  4ZLL A;  3AD8 C;  2E5I A;  4OYO A;  2J7K A;  4ATN A;  3JAM U;  1OY9 A;  2IA0 A;  4WTY A;  1TKZ A;  1U45 A;  3THT A;  2FY8 A;  1YG0 A;  4PXC A;  4OV6 A;  3KYL A;  4DUY J;  2H65 B;  1JNZ B;  1JLA B;  1NK9 A;  4NAS A;  4IKA A;  3CME S;  4GKK J;  3CO9 A;  3PYG A;  5LSL A;  4EEY A;  1SC6 A;  1ZAX A;  1O51 A;  5IT9 Y;  2LYV A;  3DKD A;  2P6T A;  2RU9 A;  1APS A;  1HKA A;  2V34 A;  1WKK A;  3ITH B;  1FJE B;  1VQ5 S;  2HK2 A;  4G1Q A;  1VR6 A;  2QJ3 A;  4B08 A;  4ELT A;  1VIO A;  3BPS P;  2Y9H A;  2B56 A;  1KC8 T;  1BY9 A;  2DNO A;  2E5J A;  3MOJ B;  8ATC B;  1H2V Z;  1S7I A;  1MU2 B;  4ZN3 A;  4OYP A;  2FVR A;  3MAA A;  1FHT A;  2AD9 A;  1JX4 A;  3MUR P;  2ZHA A;  2N7Y A;  2WVC A;  5KFB A;  2XY6 A;  4YR2 A;  4BDP A;  1NSA A;  4TY8 B;  2BW2 A;  2LCW A;  3GWC A;  4DCP B;  1R0B G;  4DU8 A;  2VKR A;  2VBX A;  2BKN A;  4ID5 B;  1R0C B;  2MLZ A;  1DRZ A;  1YK9 A;  3T41 A;  3FJ2 A;  2O67 A;  3CDB A;  5KAK A;  5KG5 A;  4AL7 A;  4ECW A;  3J7A N;  3CW2 C;  1DTT B;  2WK4 A;  3T5L A;  2ALZ A;  4K0K F;  3PJX A;  1FEE A;  3VGT A;  3M6X A;  5HQ8 A;  4M63 A;  1EAR A;  1PKU A;  2QFI A;  4OYX A;  2HHH J;  3AA8 A;  3FMB A;  3M2V A;  2BBE A;  2ATC B;  4RR5 A;  1MN7 A;  1BXN A;  3QLH A;  5M2U A;  4J9Q A;  3NCR A;  1GT8 A;  2V2V A;  3IS9 B;  1WOP A;  5HSP A;  5KT7 A;  1D3W A;  3IXQ A;  4NYZ A;  2GAG C;  4JV5 F;  3PHT A;  4JYA F;  3NG8 A;  2EKY A;  4DXL A;  4OJ1 A;  3NKY A;  2PMZ D;  5BYQ A;  5KFJ A;  4UST A;  4TQS A;  4KPY A;  1RJJ A;  1YI2 S;  2HHP A;  4M95 A;  3MM7 A;  1T05 A;  4DR5 F;  2F7V A;  2MDA A;  2JSX A;  3MPD A;  4DQQ A;  1N4L A;  4LMZ A;  2WB1 D;  2B9X A;  2XB2 D;  4CZC A;  4UZC A;  2MGZ A;  4A8M P;  2HFU A;  1U26 A;  5HAN A;  1S0N A;  4B9S A;  2FJB B;  3R1L A;  1S6P A;  3DRS B;  4QU6 A;  4ECZ A;  2LQB A;  3D1O A;  4NX9 A;  4PXE A;  4QZV B;  2YKM B;  1FWL A;  5A0Y B;  3QZ8 A;  1XJW B;  4I6W A;  1JJ4 A;  2CPH A;  1UEU A;  1Q7Y T;  4DR7 J;  2DTJ A;  5G0R A;  1UPP A;  2KJV A;  2AJ2 A;  2NXE A;  4NI2 A;  2ZOF A;  1OPZ A;  2NS1 B;  4DLE A;  1WI6 A;  3OXF A;  3FZ2 A;  2OD4 A;  2NLW A;  4AD6 A;  3CCE S;  2F5G A;  3RRG A;  1T94 A;  2QRR A;  2R8G A;  1HIY A;  3IA0 A;  5B0F A;  3HHD A;  1IQZ A;  1TL5 A;  3JTN A;  1SC4 B;  4YME A;  4JV1 A;  1UMJ A;  3D2W A;  2BOA A;  2QC3 A;  3PW7 A;  3GIK A;  4NRT A;  1A9N B;  2P8I A;  1IXK A;  1HHS A;  5HBM A;  5L1J A;  2YTC A;  2F65 A;  3I82 A;  4LR9 A;  4DWI A;  2GHP A;  4QWC A;  1R0A B;  4DV4 F;  5GAH I;  3Q8P B;  1WD6 A;  1VBY A;  5HAT A;  2R8I A;  1JLA A;  5LJ5 Y;  4EYH B;  3GP9 A;  2AGQ A;  3UWT A;  4G1Q B;  1QTN B;  2DRD A;  2CQ0 A;  1QDU B;  2C2D A;  2CNK B;  2JVO A;  1S6O A;  4K59 A;  1FNO A;  1ULR A;  2W9C A;  4N76 A;  1NRK A;  1IR2 A;  3FSX A;  4MAK A;  3UDE A;  4ED5 A;  3CD6 S;  2RT3 A;  2DHX A;  5C7P A;  1XEZ A;  2LEB A;  5J1N A;  2HFN A;  3BDP A;  1GXT A;  1RTH A;  2VQE J;  2MY8 A;  3BS9 A;  3M8Y A;  3O3L A;  3RTV A;  1P8G A;  1HBN A;  2GA7 A;  4MJK A;  1QAX A;  5KFF A;  4ELU A;  3OFE A;  4F26 A;  3EDQ B;  1NPP A;  2CXE A;  2FHJ A;  1JLB A;  9RUB A;  3N4W A;  3US5 A;  3MEE A;  1S6Q A;  4K4U A;  7FD1 A;  3NGD A;  1Y0H A;  3HT3 A;  2YNF A;  1SJF A;  2W4C A;  4OI4 A;  4CLL A;  1NPR A;  1V3Z A;  4ZCL A;  1YJU A;  3W7B A;  2M2B A;  4IG0 A;  2ALY B;  2HQ3 A;  2G0J A;  3OT9 A;  3F0N A;  5E7O B;  2VBZ A;  4J7C A;  4Q0B B;  4TU7 A;  4AT1 B;  1D9F A;  4F0H A;  1VQK S;  3SEO A;  3G71 S;  5LMU J;  5F8I A;  4ZP8 A;  4DQS A;  3THP A;  3LAM A;  1R8B A;  1HQE A;  1F3F A;  2AW0 A;  3MEC B;  3NOG A;  2CPI A;  4P73 A;  4ZPD A;  2VDI A;  2A3J A;  4O0N A;  4OMF G;  2DH7 A;  3NBP B;  4NLQ A;  4ZJL A;  4DV7 F;  2HLT A;  5IM0 A;  4LFB J;  1WEL A;  2BV3 A;  2DK2 A;  3OXG A;  1TMJ A;  4L75 A;  3FKB A;  1RTZ A;  2FC8 A;  4Y6I A;  2KM8 B;  2KXN B;  5KFZ A;  4IOB A;  2XG8 A;  4WK3 A;  3SSR A;  4RU9 A;  1IBM J;  2BM1 A;  5HLF B;  3EGZ A;  2Y0B B;  3CIM A;  4GVB A;  4P2X A;  3CC7 S;  1CQN A;  3IR7 B;  2LU2 A;  2KRR A;  3VQT A;  1LWE B;  3LTO A;  2W2N P;  3DRS A;  5GAE U;  1N33 F;  2DR6 A;  4L72 B;  4LFC J;  1PAU B;  5JUM A;  2XNR A;  1KS2 A;  5EN1 A;  3TUI C;  3T1Y J;  3HUL A;  3OXL A;  2MB0 B;  4DR4 F;  3IMQ J;  4ICL A;  3D0H E;  4MK8 A;  4PYD A;  1Y5N B;  4X64 F;  2UVV A;  4U95 A;  1FA0 A;  1U0S A;  1TMM A;  3GU0 A;  5L46 A;  5DGA A;  1OWX A;  1RTI B;  2WBR A;  2UXD J;  1SH3 A;  3CCV S;  4DG1 A;  5HVH A;  4HL9 A;  4NA2 A;  4WU3 A;  2VG5 B;  4WK1 A;  3EX7 B;  1Q82 T;  2IM0 A;  1TAQ A;  4CLZ A;  1HHT P;  2GO8 A;  3TO8 A;  3QRP A;  5IQQ A;  3H5X A;  1PBU A;  4P2F A;  2SXL A;  4M5G A;  4TLQ A;  1Q86 T;  2QTW A;  2VC0 A;  4KHM A;  5KFK A;  1N56 A;  2HHT A;  1GMU A;  2MJU A;  2K1R A;  3GJS B;  3KUE A;  1H98 A;  2ACM A;  3QBC A;  3UD4 P;  2XS2 A;  4ZVG A;  1Q5V A;  2PMW A;  4E98 A;  3EVO A;  4NEY A;  3I5A A;  3KHH A;  2W9C B;  1IM6 A;  3ZZP A;  2W01 A;  2IRU A;  4IQM A;  2CVI A;  4ALZ A;  2R3V A;  3PXG a;  5JVH Q;  3W64 A;  2Q6C A;  4IFV A;  3FMW A;  2BM0 A;  2VFS A;  2HBY B;  2DH9 A;  3JXO A;  2ZWO A;  1ELO A;  2LP4 A;  3QT8 A;  2ZH6 A;  2O01 C;  3HI9 A;  1ZZN A;  5DG7 A;  2CQP A;  2VFU A;  1MMN A;  5KG6 A;  4KV8 B;  2ZFH A;  1FFG B;  3N79 A;  1RQ0 A;  4NZ6 A;  3UO0 A;  4F4A A;  2YKQ A;  3D1Q A;  3CXC R;  2ZDP A;  1I94 J;  3W60 A;  3WX8 A;  3SXL A;  4JBC A;  1VRU B;  4A8F A;  2DIV A;  2W2P P;  1XNR F;  1N36 F;  1NPK A;  2CQI A;  4ZHR A;  5F8M A;  3KHR A;  3VR1 A;  1KHV A;  4GVL A;  3MM9 A;  2YH0 A;  1SL0 A;  3KOA A;  2PII A;  1T0T V;  4UUW A;  1N0U A;  4N5S A;  1T9U A;  2XY5 A;  1NK0 A;  3QFH A;  4C9D A;  4MYU A;  2VON A;  4PWD A;  1HW8 A;  4Y2M A;  3KUG A;  4I2P A;  3CF5 Q;  2V8P A;  1NJI T;  1VIX A;  3NBP A;  4V19 J;  1X4B A;  1NDL A;  2BJE A;  1R6Y A;  4LIR A;  2X3G A;  4RBU A;  4ID8 A;  1KD1 T;  2YNH A;  4H4O B;  3LH2 S;  5DDP C;  1F1B B;  2H54 B;  4HTJ A;  2X1G A;  4N8O A;  1AW0 A;  2GJ2 A;  2LQ9 A;  2PFD A;  4LT6 A;  4IQX A;  4LF9 F;  1S0V A;  2KZZ A;  1RWM B;  2V50 A;  1KBR A;  4O23 A;  2ASJ A;  1T95 A;  2QGF B;  3ETM A;  3ZZ0 A;  2HYI B;  1SBR A;  1VFJ A;  4ITS A;  2IM2 A;  3B4M A;  5CYQ A;  1UET A;  2P6S A;  2ZOG A;  3FEZ A;  2GML A;  2V0N A;  3OTB A;  5HMW A;  4Y2K A;  1N34 J;  5A6W A;  2OIH A;  1U6F A;  2KXH A;  2VG7 A;  4FN5 A;  1FKP B;  2MQQ A;  3NNH A;  4DV0 F;  3OLB A;  1Q7L B;  3QYY A;  4IH6 A;  4Y00 A;  1FKA F;  1U1P A;  3KLI B;  3QRR A;  3T5K A;  3J7Y U;  4NLU A;  2UU9 J;  5IT9 U;  2BQR A;  5J1E B;  4V19 X;  5H9F K;  2DIS A;  4X65 F;  2RF2 A;  3KFW X;  1D0E A;  1TU0 B;  2EVZ A;  3A3P B;  5K14 A;  4ZCM A;  3TZX A;  3V6K A;  1X60 A;  4QR1 A;  5DDO C;  3TZY A;  3K5M A;  3K59 A;  2A0F B;  5ETO A;  2CQC A;  3OFF A;  3RB0 A;  1V3S A;  2GVD B;  5ADZ A;  4L3N A;  3QAT A;  5DZ6 A;  2R2R A;  4WZQ A;  1QUV A;  3IO1 A;  2GVZ B;  4MTP A;  3UNY A;  3V6D A;  4ZPT R;  2OPQ B;  1CG2 A;  3A8I A;  4WIQ A;  4C97 A;  3QGI A;  1LEO A;  4YHH F;  2DGW A;  4X84 A;  1H73 A;  4OX8 A;  2EBG A;  1VQ7 S;  2DR5 A;  2ZE2 B;  4JI3 J;  1N5V A;  1KHW A;  1H2T Z;  1RTJ B;  2PC6 A;  2QA1 A;  2BJ9 A;  4R5P A;  1SQE A;  1F60 B;  1R3N A;  2RKI A;  3NMA A;  1WEZ A;  3G9C A;  1KP6 A;  3E01 B;  3NGU A;  5HK4 A;  4LF1 A;  3M30 B;  4FS1 A;  3T9Z A;  1RWK B;  3CD0 A;  3ITH A;  3DI6 B;  2V4R A;  5F0U A;  2HWH A;  3CUN A;  5L38 A;  5AT1 B;  1S6U A;  3O8W A;  4W98 A;  4ZK7 M;  3KHG A;  1VRT A;  3OR1 B;  3DDK A;  4RUA A;  4LFC F;  4XDC A;  1HI1 A;  1N5T A;  5DRK A;  5EWG A;  2KTQ A;  4X4T A;  5T7L B;  4DQP A;  5D0E A;  1FVS A;  1WC6 A;  4KO0 A;  4A4J A;  4BCA A;  5B0C A;  2X1F A;  1HWU A;  1RA7 A;  3FK4 A;  2FJA B;  4IG3 B;  4CLY A;  1NND A;  1NK7 A;  4DPY A;  4QW9 A;  4K5R A;  1CUL A;  2FLP A;  4HLB A;  3A8K A;  4RW9 A;  1HQ2 A;  1JKH B;  2PT0 A;  3BGL A;  2BE9 B;  3K2Y A;  4A48 A;  1WG5 A;  4DFJ A;  4LRE A;  1GXU A;  1S99 A;  1RGV A;  4DF8 A;  1YX2 A;  1HR0 F;  5L8R C;  4L73 A;  1K0T A;  2A18 A;  3KK3 B;  2LLZ A;  3QAU A;  4K4W A;  3P45 B;  4ZJO A;  1VJQ A;  2WOM B;  5EX3 A;  3GLJ A;  2KU7 A;  2AP6 A;  4I2P B;  3D5M A;  1YVF A;  4LSL B;  2WBM A;  1UA0 A;  1C0T B;  4NLG A;  2DGO A;  2ZJQ Q;  3FEX B;  1KOH A;  1AXQ A;  3HT0 A;  3WDO A;  4ZVU B;  1WKL A;  1GMV A;  3FBC A;  2HWT A;  2YKA A;  4RUC A;  1JJH A;  1VQP S;  1P1L A;  2KL8 A;  3RR7 A;  4DSJ A;  2QSF A;  1DBD A;  3RG6 A;  5HRO A;  1RCX B;  3NS7 B;  5G0R B;  4C8Z A;  2GIQ A;  3MFI A;  3HHL C;  1EQM A;  1M5S A;  1ZM2 A;  5CYM A;  4KGK A;  2FTR A;  1FKP A;  1Y9O A;  2DHS A;  4NI2 B;  3RUB L;  5ETM A;  4F0M A;  5T14 A;  3K57 A;  4AQY J;  4DV2 J;  3TOQ A;  3VAM A;  1UFL A;  2CWX A;  1RBA A;  2GVD A;  5E5N A;  3MCO A;  5KG3 A;  3QSI A;  1U49 A;  2WRM A;  5FLX Y;  2YY3 A;  2OSR A;  1HBO B;  1TV6 B;  3EGV A;  3Q8V A;  4NA1 A;  4XDD A;  1Q16 B;  2KFZ A;  1ZZF A;  3M8P B;  4OIX A;  4LIW A;  3GV5 B;  2VQF J;  4ED0 A;  3EE3 A;  4RW7 A;  1HNZ J;  1FDA A;  1KON A;  2DHA A;  3PRV A;  2RHS B;  3MM9 B;  5IV3 A;  4F2S A;  3PFO A;  4PQA A;  2K06 A;  1JLG A;  4NL5 A;  1JLC B;  1I3O B;  2CPZ A;  5C42 B;  1NH8 A;  3W9I A;  1M1K T;  4F8R A;  4JV5 J;  1J2V A;  1RT7 A;  3OVA A;  1Q1K A;  2D1C A;  4FYY B;  4NXM F;  3GSI A;  4FYD A;  1BWE A;  2M8H A;  1XC9 A;  4FKX A;  4WXW A;  1RI7 A;  2IM3 A;  4YR0 A;  2ZZT A;  4USJ C;  1REV B;  2NYH A;  2I0X A;  3V6H A;  4DF4 A;  2R7T A;  1RZM A;  3EVW A;  1WC3 A;  2J7U A;  2ZNZ A;  4OL8 A;  4OHW A;  2Z2Z A;  4LF5 F;  4KFB A;  2M70 A;  1FRK A;  3KJF B;  3MMC A;  3DNC A;  4Y65 A;  2NUH A;  4ZKA A;  1MRO B;  2DKO B;  3DRP B;  3I9Z A;  3IM8 A;  3NS6 A;  1R8A A;  3S6E A;  4YP3 A;  2MLX A;  5GAD I;  5GVQ A;  1FRI A;  2FVC A;  5F41 A;  3M6W A;  1G4C A;  4XPC A;  2L3M A;  2MXY A;  3L09 A;  3Q2T C;  4RNH A;  2ZD1 A;  3HCX A;  2QFJ A;  2ZBC A;  3GJQ B;  3D28 A;  1RHR B;  3HP6 A;  2Y8Y A;  4A8Y A;  3KLH A;  1WUU A;  3JSM A;  2KFN A;  3P6Y C;  4IOA Q;  1CC7 A;  1RT5 A;  2JL9 A;  3QWU A;  4ECS A;  3VAJ A;  2AGP A;  3LUY A;  4U7U D;  3WIV A;  2HPU A;  3G96 A;  3Q0A A;  1XIQ A;  4CTA A;  1VDH A;  2BE7 D;  4LRC A;  4NOH A;  1N48 A;  4RW9 B;  1WOO A;  2WOM A;  4HT5 A;  2D74 B;  4X4N A;  2ROG A;  5IV4 A;  1CLF A;  1S9E A;  3N5B A;  5BYS A;  1RSC A;  3MMA B;  1S10 A;  2BAN B;  5EDW A;  3VTI A;  2QLX A;  5KT6 A;  2FUG 9;  4Q0B A;  2OPR B;  4BLG A;  1JJ2 R;  1FCA A;  1JXE A;  5CH7 B;  4ZPB A;  2D3Z A;  2B6A A;  4RX6 A;  2ERR A;  4FYX B;  4WF9 Q;  1DFD A;  3DDN A;  4Y2A A;  5K8M A;  4ED7 A;  3EYZ A;  1TK0 A;  3ONQ A;  2CNN B;  1NHK L;  3MEG B;  3P8B B;  3JB9 k;  2KT3 A;  1Q8L A;  4IR9 A;  2HHU A;  3ADA C;  2YKN A;  4X66 J;  5SZT A;  3DMJ B;  4YDX A;  1I5O B;  1TKT B;  2F1F A;  5D15 A;  5A2Q Y;  1UJ5 A;  3BKF A;  2F8H A;  3OUY A;  1X5O A;  3TW0 A;  3EVM A;  3DI6 A;  2FZC B;  1I94 F;  4Z7C A;  1WC0 A;  3O44 A;  2LEP A;  1RHM B;  1S77 D;  4U7C A;  3KLG A;  3CVK A;  1D8Z A;  1QY7 A;  3UR3 C;  1CJU A;  2VQF F;  5B08 A;  3T5J A;  3C6U B;  3QJL A;  3KWM A;  3CCL S;  4RWW A;  3JQK A;  4DQI A;  4KHP J;  2QZ8 A;  1T03 B;  4I2Q A;  4UOH A;  2KT5 A;  3I5C A;  3MGJ A;  2R8H A;  2HGN A;  3LPY A;  1YHQ S;  1RHK B;  1FNM A;  4R8U A;  5ETT A;  2VU5 A;  2MSS A;  1X9M A;  2EC2 A;  2RQ4 A;  4M5L A;  2JEJ A;  2ZM6 F;  2IVF B;  4Z37 A;  1JB0 C;  4PQU B;  1NSK L;  4DPO A;  1RYR A;  4IRC A;  1O6X A;  2GV1 A;  1JLF A;  4ZP7 A;  3FEY B;  3HF5 A;  3SDE A;  3W8G A;  3K89 A;  3KJQ B;  2XLI A;  2B7B B;  3GCX P;  3I56 S;  3LAN A;  3DOL B;  4RLE A;  4AUK A;  1FES A;  1UJ6 A;  1NZ8 A;  4FPR A;  3EGN A;  4ERD A;  1VC0 A;  3UN2 A;  4E0D A;  1MML A;  1IWG A;  3I32 A;  1MWZ A;  3F44 A;  4M5M A;  4DL2 A;  4KBI A;  5KFV A;  1X9W A;  3BH7 B;  1E6V A;  1JLQ B;  4KFB B;  1HBU A;  4JV2 A;  4NXN J;  4H4K A;  1IKV A;  2EW9 A;  3MMC B;  3IN5 A;  2DPI A;  1KRP A;  4LQ3 A;  1RAA B;  2FB0 A;  3SSQ A;  4CM2 A;  5F0W A;  3QQC D;  3OW2 R;  1WEY A;  2JLG A;  3MTJ A;  1SV5 A;  2N3O A;  2ZH2 A;  1FRL A;  2W1B A;  2OLW A;  2OPP A;  2RML A;  3D7S B;  5B0E A;  3MUT P;  3EUN A;  3D3C J;  1UWB A;  1V9O A;  1S79 A;  3A8J A;  3D66 A;  3OHA A;  1NK6 A;  3HJF A;  4OI6 A;  1RT2 A;  2XI3 A;  1W2I A;  4KY3 A;  4CT8 A;  2UP1 A;  3C2P A;  2R7Q A;  3Q83 A;  3W3S A;  4PWD B;  5DM7 Q;  2IYG A;  1JNR B;  3FCH A;  2P9C A;  4ZP6 A;  4ZOS A;  2L41 A;  3CJ5 A;  5J2M A;  3R1H A;  2HS0 A;  4X2B A;  4M94 A;  4RW4 B;  3VAH A;  4I56 A;  1R8P A;  2LFV A;  1YBA A;  3W63 A;  4DX6 A;  1ZA2 B;  2LXU A;  5KT2 A;  2LDY A;  2VD3 A;  1YRX A;  4NXM J;  3K0J A;  1KQG B;  1H7W A;  2XYG B;  4Q43 A;  3FQK A;  2R8J A;  3P49 B;  1RAG B;  1ZAV A;  4NWB A;  3E3X A;  4NXN F;  3JTP A;  4M5J A;  5GAE I;  4JI6 F;  3CWJ A;  3GTY X;  5LXR A;  2AEM A;  1WAC A;  4I69 A;  2XHW A;  4DJB A;  1XR6 A;  1MW7 A;  4DS5 A;  1OMS A;  4KRW A;  1C4A A;  1X31 C;  3M2R A;  3PW2 A;  3HKZ D;  3S7R A;  3BSC A;  1FEH A;  1YBU A;  3VGS A;  5KFQ A;  1B0V A;  4QYR A;  4RUB A;  2DCU B;  5CXT A;  2I2Y A;  3G82 A;  3TUP A;  4PG4 A;  4DPT A;  1QVF R;  2CPF A;  2FHJ D;  4DR4 J;  2QE5 A;  3QMQ A;  4KYZ A;  1URR A;  3GSD A;  2KN4 A;  3D9B A;  4TYB A;  5J1E A;  2YKM A;  1QLN A;  4F02 A;  5D8H B;  5B0B A;  3MAA B;  4DSL A;  2Y0S D;  1BQM B;  1TL1 A;  4ZVO B;  1YBT A;  2CJQ A;  2XMW A;  4NLO A;  5KOW A;  1CPZ A;  4WFX A;  2CQG A;  1YJ9 S;  2KM8 C;  1WG1 A;  2CYY A;  4NLV A;  2MLY A;  2QA4 G;  4KGM A;  2VAS A;  1G1X A;  5E0O A;  1RAF B;  2E66 A;  4TYA A;  3CJ3 A;  2CAJ A;  3M8W A;  3O1L A;  4Q7A A;  1MWY A;  3BKU A;  1Y7P A;  2CIM A;  3DRY A;  1SIZ A;  3I9V 9;  4CYU B;  1S76 D;  4DSI A;  2ZBI A;  2C2E A;  3C46 A;  2QL5 B;  2IAJ B;  4O4R A;  2FYX A;  2QO3 A;  5KFS A;  4EO6 A;  2JEI A;  4X4U A;  1X4F A;  2P2C B;  2AYB A;  3MHY A;  2F8E X;  1IBK J;  3QLH B;  5K8O A;  2IJR A;  1Q78 A;  3PIP Q;  3X1L B;  1T9V A;  2QL9 B;  1HNV A;  3PNI A;  1WOR A;  2BW7 A;  3C19 A;  2OO4 A;  4OZN A;  1RAI B;  3DXB A;  1HNI A;  1E6V B;  1JLQ A;  3E01 A;  5IS2 A;  2YWF A;  1KLN A;  2E5G A;  5KFL A;  1W7W A;  4IO9 Q;  1W2B R;  1N8R T;  2CQH A;  4M5K A;  3DLB A;  3TI0 A;  4PKD B;  4F7V A;  2R7V A;  2R7W A;  2CJB A;  2PMH A;  2HGM A;  1OPI A;  3AJ2 A;  1TZ0 A;  3OFH A;  5DG9 A;  3CJQ A;  5DLF A;  4DFP A;  4NLY A;  1RTD A;  1D9A A;  1FWK A;  4IDK A;  2RHQ B;  3Q89 A;  3RZA A;  2Z2M A;  3H5U A;  1IM4 A;  5B0A A;  2VPY B;  5HQL A;  3NAH A;  2B9Y A;  5LT5 A;  1VQN S;  4NRU A;  2VDH A;  3KKF A;  3SCJ E;  4RW4 A;  3EPI A;  2QA4 S;  1VC6 A;  2DXD A;  2LEA A;  4K2J A;  4KIA A;  4I0W A;  1BMQ B;  4ZVH A;  2YNF B;  3RW7 A;  3R5B A;  4RW6 A;  2MQP A;  3S8S A;  2ADC A;  2DR8 A;  2OD6 A;  3PM9 A;  1FXL A;  4B9T A;  3BQ2 A;  3C6U A;  3CMA S;  2RVJ A;  1A0O B;  5HJX A;  2HUR A;  1WHX A;  1NHU A;  2L9D A;  4EK2 A;  4ZIW A;  3TRG A;  2WHO A;  3MEC A;  1WKJ A;  2FGO A;  5K8N A;  1XMO F;  2HHH F;  4WJB A;  4ZLJ A;  5IT0 A;  4NZ0 A;  4KPC A;  4XK8 C;  2AEF A;  3W9J A;  3KJV B;  4K0K J;  1KVK A;  3BEG B;  4ES3 A;  1UVK A;  2XNQ A;  1FX2 A;  1ROF A;  3CCW A;  2XLK A;  2B9W A;  2RQK A;  1U1L A;  2JVR A;  4X65 J;  1Z4U A;  1FRM A;  3T6B A;  3V81 A;  3OVB A;  2V4J A;  3UN5 A;  1KEK A;  1NAQ A;  2I38 A;  2CA9 A;  3IRX B;  3OR2 B;  1RHQ B;  2H5I B;  2C3O A;  1V6H A;  3C66 A;  3NCP A;  4PPZ A;  4A8O A;  3BO2 A;  3LGN A;  2WCX A;  2YNG A;  2EK1 A;  3H2V E;  4TXS A;  4CDI A;  4ECX A;  4QBU A;  4OYA A;  3MMB B;  3AXM A;  3T9N A;  1IJE B;  2CG4 A;  2UZA A;  3K7R A;  4HYK A;  3V4I A;  3N6N A;  3IR5 B;  1BQM A;  4CQ1 A;  3HMJ G;  2FY1 A;  1B0T A;  1DAR A;  3SCL E;  3VAF A;  4B3R J;  4HR2 A;  3M6U A;  1PAE X;  4NYP A;  2B3T B;  3JAM Y;  2UV8 G;  3DU6 A;  2QLF B;  3QPI A;  3KHL A;  5E3P A;  2XM3 A;  2BOP A;  1QVG R;  3FGV A;  3HHK A;  3UD5 A;  2G2Z A;  3HSG A;  5HMZ A;  1WDD A;  5C25 A;  5JMN A;  2BQ3 A;  2CUY A;  1WC5 A;  2RSQ A;  4GKK F;  3PW5 A;  1SC3 B;  3N6M A;  3UCU P;  1EET A;  2P9G A;  4DZD A;  5HJY A;  2YX1 A;  4DFM A;  3MR7 A;  3HHL A;  3HD1 A;  4IFV B;  1R7I A;  4PAB A;  1EIY B;  4XO0 A;  1M0S A;  4FVM A;  1LWX A;  2LDI A;  2NCK L;  3G6V A;  2RRA A;  1Q0N A;  3C6T B;  3K5P A;  2BX6 A;  4ES1 A;  4OQJ A;  1YIT S;  2IM1 A;  3R6G B;  3TJ9 A;  4X62 F;  3M9O B;  4CRJ A;  3W2W B;  1L5U A;  1S59 A;  5ETL A;  3J81 U;  2RDD A;  2AJ4 A;  3KG4 A;  4MIB A;  3TR5 A;  1YGY A;  3DHX A;  3CED A;  4FZV A;  1U1O A;  5GME A;  1NJY A;  4PRF A;  1P6T A;  3MXH P;  2HAF A;  2IC3 B;  4BWJ A;  1IN0 A;  7FDR A;  3MED B;  3Q22 A;  3H4B A;  4ELV A;  1TFW A;  5IXU A;  2H4Y B;  3EDR B;  3ISN C;  2IBK A;  3TAM A;  1ARO P;  3C16 A;  2VC1 A;  3S1T A;  3GJT B;  1E6Y A;  1FJC A;  4PG6 A;  5F8G A;  3U1N A;  2DIT A;  4FXW A;  3R9L A;  2CPE A;  2V8H A;  2CQB A;  3PX0 A;  3BDE A;  3NWR A;  4ZVT B;  2M3D A;  3ENV A;  3SSS A;  3MR3 A;  4AL6 A;  4I4B A;  2ASL A;  3POT B;  1R8C A;  4TY9 A;  4DL7 A;  2VH7 A;  2L08 A;  3AH6 A;  3GFY A;  4OLP A;  1S57 A;  4FBU A;  4H4O A;  1LXN A;  2N3L A;  2ZWP A;  4QIE A;  5D4P A;  3N6L A;  5D78 A;  1CBK A;  5C24 A;  2K2P A;  3NS5 A;  3HFK A;  3SYZ A;  1X5T A;  2B0G A;  2Y1L B;  3B78 A;  3SIP B;  4CH0 S;  4YUD A;  1UW9 A;  2HZA A;  2VQE F;  4ILL A;  1NK8 A;  1BLU A;  1YJV A;  1NHV A;  1NJX A;  2HHW A;  2V68 A;  4NA3 A;  4TQR A;  2CPD A;  2OPR A;  1P27 B;  3G6E S;  2UVU A;  3CIZ A;  1RBO B;  2ZH4 A;  3JSY A;  4NLD A;  3IR6 B;  2BJ7 A;  2EG1 A;  2IHR 1;  5J2P B;  1HA1 A;  3L7P A;  3MR5 A;  3RU0 A;  4YOE A;  2NSB A;  1X8D A;  2WON A;  2QEX S;  3MEG A;  2VPW B;  3DOM B;  3LP0 A;  5KFA A;  2HVH A;  1BUX A;  4KGZ B;  4LF6 J;  1ACM B;  2B8P A;  4G1P A;  4IO1 A;  1S9G B;  5KG4 A;  4ED8 A;  3AOA A;  2WVD A;  1N5Y B;  4HEA 9;  4OHY A;  4DDF A;  4FDF A;  3TQ1 A;  4IH7 A;  3SQO P;  3QFW A;  1NSQ A;  1U1N A;  4C3L A;  4ZJQ A;  2MPU A;  4NCA A;  1LK5 A;  3G8T A;  4USU A;  1T03 A;  1Y10 A;  3VZI A;  3V4I B;  1RAC B;  4PG8 A;  3ZO7 A;  3CB4 A;  3MPY A;  1CJU B;  1Y4Z B;  1X4A A;  3ZZY A;  3BPD A;  4K8R A;  3TQE A;  4ZVP B;  3M8Q B;  4BC9 A;  2J0X A;  3DLJ A;  2MZT A;  4F04 B;  2UUC J;  2UXC J;  2XI2 A;  3GIR A;  3RW6 A;  5D4O A;  3PKY A;  2FVQ A;  1D09 B;  1GX6 A;  4KE5 A;  1T9T A;  1YWX A;  2HNY A;  3VQS A;  2RAQ A;  2HFV A;  3X3U A;  3U1L A;  5KFN A;  3PZP A;  2D3O R;  1VBZ A;  4HHH A;  4MKB A;  3DLE A;  4N47 A;  2MTL A;  2NPF A;  3W62 A;  5CQG A;  4U67 Q;  4RNM A;  2Y1I A;  3VZH A;  2F9D A;  1A7G E;  4LJM A;  4YY3 F;  5KFE A;  3ENA A;  4RKU C;  2HND B;  2V2Q A;  2OI2 A;  2I9S A;  3BR8 A;  4XPE A;  2O66 A;  1ZAW A;  1V5I B;  2DHG A;  9ATC B;  1NCL A;  2DD8 S;  2W9A A;  3MCM A;  3HHE A;  1JXL A;  4H54 A;  4QPX A;  3PJ9 A;  3GFH A;  5I4M A;  2LQJ A;  3BR9 A;  2UVW A;  3MUM P;  5DLG A;  4CNY A;  1OY8 A;  1FO1 A;  2WB4 A;  3VF0 B;  4B3S F;  1FDD A;  1WHY A;  3HLU A;  1N5Q A;  1FK9 A;  1RT6 B;  3R7N B;  1M5V C;  2JHE A;  3I96 A;  1SPB P;  1HWK A;  5FDL A;  2QSW A;  2BE2 B;  3QIP B;  3GFZ A;  1VOM A;  4LUB A;  2POK A;  1FE4 A;  2DY9 A;  3CDW A;  4EO8 A;  2J6T A;  2A6O A;  2M8D B;  1X7V A;  3OFG A;  2VIC A;  4TNO A;  1Q79 A;  5K14 B;  3PKM A;  3J80 U;  2XYH B;  2DGQ A;  4USV A;  1X0P A;  2Y3Y A;  4CO3 A;  3R5C A;  4RWX A;  4P10 A;  5GAG I;  2JEF A;  4I2Q B;  1FER A;  2XCP A;  2U2F A;  2A2D A;  2CNL B;  4LBP A;  4JYA J;  4H4K C;  1HWL A;  5F9L A;  5LOQ A;  2KJW A;  2GGP B;  4WE1 B;  4OI1 A;  3ISN D;  5J2Q B;  4WP8 A;  3M9M B;  2ZUG A;  1JWW A;  1YKW A;  2EFV A;  4ZCI A;  3RJM B;  1KDN A;  4PWW A;  3KMS A;  4PUO B;  3DM2 B;  3BBC A;  2UV8 A;  3KJN B;  3NEK A;  1MN9 A;  2W2Q P;  3FBF A;  1EQ0 A;  1ZM3 A;  2IFX A;  2AIR B;  4OFZ A;  4ZCK A;  1L3S A;  3W2V B;  4ZP9 A;  2HBZ B;  3GON A;  5CD4 H;  2YWK A;  2E1R A;  5I3U A;  4WKY A;  1FD8 A;  2OFH X;  1JLE B;  3I5B A;  3NGK A;  1HWJ A;  2D9P A;  1TP7 A;  4ER8 A;  4H4M A;  2ZBR A;  5B09 A;  4GO7 X;  4WII A;  4USM A;  4WTO B;  4YB7 A;  1DAX A;  1C1B A;  5HI7 A;  2ZUA A;  4F4X A;  3DCA A;  4M5N A;  2XMJ A;  4KH1 B;  3D6M B;  1F9H A;  4EZ9 A;  2CZ9 A;  2ZVI A;  3IAM 9;  2YX7 A;  3M8Q A;  4OJ3 A;  4NLR A;  5J2N B;  4N41 A;  4UOC A;  3N01 A;  3EZU A;  1SKS A;  1YLX A;  1KQK A;  1NB2 A;  4LFA J;  4HHJ A;  2ATL A;  3PHE A;  4ZDN A;  4DV1 F;  2CNO B;  3EXC X;  4KO0 B;  2EG2 A;  4C3K A;  3JYT B;  1XMB A;  1IKW A;  3DLE B;  3NGT A;  4MFB B;  2EFN A;  2PEH A;  3UVJ A;  3ZNU A;  2V4Q A;  2ZH1 A;  2VIH A;  1XER A;  1SCJ B;  2HSE B;  2MQM A;  2OEL A;  3CT9 A;  3EM1 A;  4GC6 A;  1DQ9 A;  4TU9 A;  3DLG A;  2C3U A;  3GCW P;  1KSP A;  2PDA A;  1F5C A;  4LFA F;  3HDS A;  2VKZ G;  3EMT A;  3NCQ A;  4IG0 B;  3VAL A;  5I42 A;  4OI2 A;  4Z7Y A;  1SJ1 A;  4C11 B;  4O3S A;  1HNW F;  5HMY A;  2XS5 A;  1REV A;  1M5H A;  2HFZ A;  4QWE A;  4ZS6 A;  5K5M A;  2FVS A;  4C8L A;  3I31 A;  2CVE A;  2VFT A;  2VJU A;  1RTD B;  2EBE A;  3GG0 A;  2N7C A;  5J2P A;  1RU1 A;  3EGW B;  2ZBQ A;  1MRO A;  3DRP A;  4C8N A;  3JSM B;  3EIC A;  1P9Y A;  2V9K A;  4OZ1 A;  2EK6 A;  3JTO A;  4KH0 B;  4PCQ A;  1VHF A;  3OTE A;  2CJA A;  1NXI A;  2W9B B;  1FD2 A;  1SKU B;  4QIW D;  1Z1Z A;  3H2U B;  3DYA A;  1HMV A;  3CJ8 A;  5KFD A;  1WSV A;  1WTF A;  3DLK B;  2LA4 A;  2JFK A;  1EAY C;  3HSD A;  3MUV P;  2HHX A;  2WAQ D;  4J90 A;  1VHI A;  2W7A A;  4DCJ B;  5A8K A;  2EFO A;  1HI0 P;  4DV5 F;  2XUL A;  4DV6 F;  4P2S A;  3Q86 A;  3VVU A;  1F0X A;  2CPX A;  2ILZ A;  5F8N A;  1TUW A;  3RAQ A;  3PY8 A;  3GQC A;  2E9R X;  3M2V B;  2KI2 A;  2JOQ A;  3B6B A;  3HKW A;  4WFZ A;  2HIQ A;  3CSK A;  1C2P A;  2OMO A;  4RW7 B;  3CCJ S;  3CJS A;  5K8P A;  3RRH A;  1DLO A;  1TL7 B;  2G2Y A;  1M5O C;  1DJ0 A;  2KO1 A;  4Q8F A;  4NZ7 A;  4LRA A;  1JLG B;  2DGS A;  4GO5 X;  1Q5Y A;  3ET6 B;  1N52 B;  2GMJ A;  4O3O A;  2PI5 A;  4K5S A;  5J2Q A;  3RBE A;  1U4B A;  2GQ2 A;  2YKP A;  3P5T L;  2AWZ A;  3TA1 A;  2VOD A;  4BS2 A;  4X64 J;  1KOO A;  1LKZ A;  4RO0 A;  4Y2I A;  1ZTT A;  3HM9 A;  3MPV A;  4GRS A;  4WXO A;  1SL2 A;  1IKY A;  3Q23 A;  1RAD B;  2XWY A;  2QN6 B;  3VWS A;  4C6A A;  3HVR A;  4CH7 A;  4F4W A;  4JI3 F;  1TAU A;  4W90 B;  1SJ4 P;  2HWI A;  4HH1 A;  1CJT B;  2UXC F;  4TKT A;  5AXM A;  2HQF A;  2NSC A;  2DBB A;  4IFY A;  3RBX A;  1S97 A;  1RWO B;  3PO4 A;  2DIU A;  1H74 A;  2BUN A;  1K0V A;  3RYL A;  3TA2 A;  2OHD A;  1NDP A;  4LVO P;  3GII A;  3RBD A;  1B7F A;  2HQG A;  2CDQ A;  2V6A A;  1NZA A;  1T7P A;  3NGS A;  4PXD A;  3AHP A;  1WC4 A;  2ASY A;  1DY3 A;  2W2O P;  3MFH A;  4OLO A;  3B8H A;  1SJQ A;  2AYM A;  4QQB A;  5KT4 A;  2E7X A;  3A4T A;  2N82 B;  2E1M C;  4FS2 A;  3FSI A;  1XNQ F;  4R8U B;  2VG6 A;  4CLP A;  4J9P A;  1R6V A;  3U27 A;  4HDH A;  4IYQ A;  1N34 F;  3FRY A;  1XNQ J;  1X4H A;  1K1S A;  1VBK A;  4I7F B;  1VCT A;  1R43 A;  2VPX B;  3JSR A;  4ECU A;  3H40 A;  3IFE A;  1N5S A;  5F3T A;  3K5L A;  1S48 A;  1HBU B;  3BGU A;  4N77 A;  2BKO A;  1PYT A;  5AE2 A;  3PW4 A;  2J6S A;  1F6T A;  2LXI A;  1GMW D;  3RB4 A;  1VQ4 S;  2CFX A;  3IS9 A;  3R8Y A;  3RBZ A;  2OPP B;  1VQS A;  2YNH B;  3M8R A;  3UN3 A;  1WTB A;  4O3Q A;  3D6T B;  1QSS A;  4RBT A;  3HVT B;  2GS8 A;  4LVN P;  1IKV B;  1W26 A;  3I6P A;  4QPT A;  3GFX A;  2ZM6 J;  4Y3C A;  2DHH A;  5BR8 F;  3R3T A;  5T7L A;  2QL7 B;  4O3R A;  1URN A;  1AUS L;  2WVE A;  3K5O A;  3HSZ A;  1PJ7 A;  3OR2 A;  2YKN B;  2LQ8 A;  2MKS A;  3H8Y A;  2C3Y A;  3ETO A;  2FGC A;  5J1P A;  4F3O A;  2WSC C;  4NLX A;  4UY8 5;  4ZIV A;  1SXL A;  1B0P A;  2QYC A;  2VG7 B;  3SV4 A;  3NNA A;  2GFF A;  1F5B A;  2ZBP A;  1XR7 A;  3PJW A;  4MK9 A;  1M5K C;  2XMT A;  3L4B C;  4DCO B;  3EJM A;  3HO1 A;  3OL9 A;  4C98 A;  3JSB A;  1EP4 B;  1OYE A;  3IGN A;  5E33 A;  5KFP A;  2ZHB A;  3HXM A;  5J2N A;  2DY1 A;  2MQ8 A;  5C24 B;  3RB6 A;  2RH3 A;  2F4V J;  2J0Q D;  2WVF A;  1HQU B;  1HI8 A;  1JXV A;  4LBI A;  3C3L A;  1HW9 A;  1N32 F;  2ABY A;  2Z58 B;  3DOM A;  5AXL A;  3UD3 P;  3GJR B;  2J8S A;  5MAO A;  5EHH A;  5KFU A;  4DV6 J;  3Q8Q B;  1X4G A;  3EPG A;  3BJY A;  1FTR A;  1F3V A;  3IM9 A;  3OTC A;  1N5Y A;  2XZT B;  1TQL A;  4HAC A;  4DPW A;  3TUJ C;  1WF1 A;  2RE1 A;  4PG7 A;  3PVX A;  4LF9 J;  2IPO B;  4YEA A;  4F4Y A;  3OSN A;  1RT3 B;  3P96 A;  2I5J A;  4EFA C;  4JI0 F;  5A8W A;  4NCG B;  1OQ3 A;  2OGU A;  4YB5 A;  2M88 A;  2F8M A;  2MY7 A;  1UA1 A;  1FDN A;  4DR2 F;  4NYO A;  2IIH A;  5T41 A;  5KFT A;  3B82 A;  2GCF A;  2MZS A;  3UQS A;  1G3O A;  3A12 A;  3T3F A;  3Q24 A;  3ZZT A;  1TL1 B;  3ZZR A;  3MOZ A;  3LGM A;  3VGU A;  4CYU A;  2M5Y A;  5D6G A;  5KFH A;  2J0W A;  2JNJ A;  2NXN A;  3Q2S C;  4DX8 H;  2WSE C;  2Z8Q A;  1DUR A;  4HT7 A;  5DET A;  2GC8 A;  3CO0 P;  3H59 A;  2AJF E;  2VF3 A;  4OV1 A;  4JI8 J;  2AJ1 A;  2FVP A;  1XNR J;  2HNY B;  1F9F A;  2HRT A;  1DQA A;  3LPE A;  4PYA A;  2EI5 A;  3WHI A;  5K9F A;  1QD1 A;  4HTI A;  3KTQ A;  4JI4 J;  1HNV B;  4LSN A;  1MLA A;  1VRQ C;  2WZ1 A;  2XYP B;  4L3K A;  3RRK A;  4EI2 A;  4J9U E;  4LBH A;  2DYA A;  2XEX A;  5KG2 A;  1AZS B;  1UW4 A;  1JJC B;  4IDK B;  3KK1 B;  4DUZ J;  1NJZ A;  1HFE L;  5CD4 A;  2W4P A;  1TFY A;  2B5J B;  3SCI E;  2VA2 A;  3DXS X;  3R2C J;  3W5Y A;  2CPY A;  1YJR A;  1DHM A;  4X4S A;  1TKD A;  4KHP F;  4M5D A;  3SFU A;  4HDG A;  2NUU G;  1LNQ A;  2QMW A;  3AOD A;  3MPW A;  4DL0 C;  3O6Q A;  3N28 A;  3GIL A;  3FRZ A;  3M2R B;  5HL7 Q;  5L1L A;  4DL4 A;  1VQM S;  1XMQ F;  3PX4 A;  1RWN B;  1GK8 A;  4A46 A;  4P7T A;  3CJ2 A;  4DOZ A;  3GE9 A;  1IBC B;  2ILY A;  1XWL A;  2AYG A;  3CCR S;  2E5H A;  2X51 A;  3M8Z A;  2IYI A;  4J91 A;  1QTM A;  2JLE A;  4NMX A;  2CAD A;  2HS4 A;  4OZ0 A;  3H5Y A;  2E29 A;  1VQY A;  2ZH5 A;  5DZ7 A;  4CP5 A;  2Y1R I;  3LGH A;  1CS4 B;  3HHL D;  4X66 F;  4FF2 A;  1IJF B;  5FDL B;  3OHB A;  2QT7 A;  3JQJ A;  3TA0 A;  1IBL F;  2FJW A;  1HBO A;  4CH1 A;  4W4M A;  4YR3 A;  1U2F A;  3I0S A;  2GGP A;  4WE1 A;  3FDS A;  3ZZO A;  5BR8 J;  3QGH A;  4L74 A;  4OHZ A;  3TZZ A;  2BAN A;  1VQL S;  3J80 Y;  4FNH A;  3BB5 A;  4CIO A;  2Z57 B;  1W25 A;  4ECQ A;  1SKR A;  3PO5 A;  4LF6 F;  1UTA A;  2IVY A;  4GC7 A;  2Z30 B;  2UXD F;  4RUH A;  5CCL A;  4BBY A;  4ED6 A;  1NDC A;  1FJ7 A;  4U9R A;  3IRX A;  3NRB A;  3KDO A;  1RT3 A;  4AL5 A;  2BKP A;  3FUY A;  3MAH A;  4NCG A;  4U8V A;  2R2T A;  1HBM A;  2HMI B;  4GKJ F;  1RA6 A;  4WP9 A;  1R8H A;  3TAR A;  5BYR A;  3OBI A;  1IBK F;  5CHC B;  3EZO A;  3MM5 A;  5H9E K;  4QIG A;  2COL A;  2PD1 A;  3DRX A;  2X3D A;  1DZ5 A;  3I0R B;  4NEZ A;  2MKH A;  3ILJ A;  1PJ5 A;  2FC9 A;  2H3E B;  1IVZ A;  1Y11 A;  2PO4 A;  2W4D A;  1PBA A;  1CJK B;  5DM6 Q;  1HNI B;  2D3U A;  1VK8 A;  3VAI A;  4G65 A;  1G7C B;  5DO2 A;  4DZ6 A;  2NQP A;  1RIS A;  2W2M P;  4JV0 A;  3OLA A;  2R9L A;  2EFQ A;  4OYW A;  2R2S A;  1IBM F;  2RDJ A;  1IKX A;  1RAB B;  1DTT A;  4HH0 A;  5C2C A;  2PA3 A;  4B3T J;  1L3V A;  2V69 A;  4OI0 A;  1FXR A;  2G4B A;  1B3T A;  1EZZ B;  3TAP A;  3D6H B;  1WSR A;  3CDA A;  2E7W A;  5C25 B;  3BQ1 A;  3PX6 A;  1NKE A;  5FD1 A;  2J0S D;  4K4X A;  3HZG A;  4LSN B;  3KDN A;  3KMQ A;  1S1T A;  4G3I A;  4CO2 A;  5M2P A;  4HI1 A;  3AB4 B;  1TL3 B;  3ZFV A;  4K4Y A;  2BMB A;  2B6A B;  5DQH A;  4X62 J;  1LFP A;  3VHQ A;  1WF2 A;  1FRJ A;  1R27 B;  1TKZ B;  4F4Z A;  4LR8 A;  3MZI A;  5FJ4 A;  1S1V A;  2D7S A;  3KG1 A;  1WNE A;  2D41 A;  2OPS A;  4EWT A;  3MCN A;  1AA1 B;  3J7A 1;  3W2W A;  2X7I A;  2HK3 A;  2HW3 A;  4AXJ A;  3MAQ A;  1K9M T;  3A1Y G;  1BQN B;  1H7X A;  1ZOT A;  4ETX A;  4AQY F;  2DR7 A;  2DO0 A;  1PIE A;  2KHD A;  2DNG A;  2EFG A;  3J7Y I;  3OJU A;  2DR9 A;  3IGV A;  4I68 A;  1NSP A;  3V81 B;  2J76 E;  2HQD A;  2JC0 A;  1P9Q C;  1IR1 A;  2V4J B;  1GXL A;  1P1T A;  5FII A;  1WWH A;  3G8S A;  4B9V A;  5KFG A;  1FDB A;  5L1I A;  2Y1J A;  1NK5 A;  4B3M J;  2V67 A;  4ECV A;  3T1H J;  1RKJ A;  2UXB F;  1MG7 A;  1PC4 A;  2PN6 A;  3ZZZ A;  3CCZ A;  1SL1 A;  1TK5 A;  2KVQ E;  2VB6 A;  4CLS A;  1SJ3 P;  2KZM A;  2QMU B;  4F3Q A;  4IUF A;  2XMA A;  1LWC B;  1S1U A;  1NME B;  2MQO A;  4YQW A;  1RB0 A;  4J9S A;  1BWV A;  2RD5 C;  4HKQ A;  3KLF A;  3AOB A;  3H42 A;  1KQS R;  1CJV B;  3F41 A;  1JMT A;  4WBF A;  4DR1 J;  5D4N A;  1RHU B;  3J7Z 5;  5EWF A;  5JVG Q;  4J9N A;  1OQ6 A;  2Z0G A;  4DR7 F;  3LA0 A;  1R31 A;  1S72 S;  1U2R A;  4CT9 A;  1RLC L;  3FNN A;  4MH8 A;  4U96 A;  3QJJ A;  4PQU A;  1Y3J A;  5DJB A;  1NH7 A;  2RQM A;  2QA2 A;  2KDO A;  1HR0 J;  5HN0 A;  1FXD A;  3MCS A;  1U6B A;  3SMZ A;  4BC7 A;  4Q5V A;  1IKY B;  2AX1 A;  4C4W A;  1D1U A;  4KT0 C;  4UUX A;  2WON B;  3C6T A;  3U7J A;  3PR4 A;  3VV2 B;  2O3D A;  1HYS B;  1RWP B;  1BQX A;  1U09 A;  3BYP A;  1B99 A;  1RAH B;  1O8B A;  2LEC A;  1J5E J;  3LQV A;  4MT1 A;  5GAH U;  3KK2 A;  2W8K A;  2C2N A;  3M2U A;  1Q8I A;  1S5Z A;  3PYF A;  4QR0 A;  4X4Q A;  4OZL A;  3LO3 A;  4WFB Q;  2CJK A;  1JIH A;  2JJ4 D;  2NXU A;  2CJX B;  4DI6 A;  2C28 A;  5FLX U;  2CQ1 A;  5DG8 A;  3G6X A;  3DLL Q;  2KKH A;  1Y00 A;  5HVG A;  1SJR A;  1TV6 A;  3A3O B;  3DYA B;  1XK8 A;  4UY8 T;  1RTH B;  1PGZ A;  1VQ8 S;  2VG6 B;  2DEJ A;  3LW5 C;  1RUS A;  2BEF A;  5A0Y A;  3W66 A;  5BXI A;  1IKX B;  3TJ8 A;  5F8L A;  1SV5 B;  2ZJP Q;  4DR3 J;  2FZK B;  2UU9 F;  5L9X A;  3ICL A;  4HVZ A;  2H4W B;  2GNK A;  3ISZ A;  1E6Y B;  2GJF A;  5JJB A;  2NR0 A;  4FXV A;  4OYM A;  3BRE A;  1L3U A;  2W7P A;  2R7U A;  2DH8 A;  4K4S A;  1M1G A;  2J6U A;  1X4D A;  5KFX A;  5GMD A;  2E5L F;  3M32 A;  3Q8R B;  1V3R A;  1C0U A;  4NLT A;  3IG1 A;  2ZH8 A;  1GAO A;  4OX9 J;  2AJ0 A;  3CCQ S;  4LSZ B;  2DNR A;  3ILL A;  2UUA J;  1Q8K A;  2KYZ A;  1AYE A;  3MI7 X;  3KK3 A;  2XCA A;  3ET6 A;  4J9M A;  1HQE B;  6FDR A;  1XN9 A;  2C2R A;  5ETK A;  2D69 A;  3BYR A;  2E9T A;  4PXB A;  4DN0 A;  1T9W A;  3MTK A;  3QGP A;  1NBE B;  3KG0 A;  1SUQ A;  1LQ9 A;  1O0P A;  3AQP A;  1M90 T;  3FBB A;  3GR0 A;  5IZH A;  4DSF A;  2HBR B;  4DSE A;  2UUT A;  3HVT A;  4S0M A;  1NUE A;  3RAX A;  2R7O A;  2FJV A;  1FF2 A;  2OH2 A;  2RRB A;  1J5O B;  4O4G A;  2O5D A;  4C0B A;  4K50 A;  1VLY A;  3NNC A;  4DUY F;  4KB7 A;  3OL6 A;  1QAJ A;  1U1K A;  4D3H A;  2ZZN A;  4DBQ A;  2XZD B;  1NO8 A;  3W5X A;  5AE3 A;  5EGY A;  1LW0 B;  2HZC A;  2JWN A;  2HRU A;  4G1I A;  4CI0 B;  1N36 J;  5K20 B;  4C0H A;  1RXO B;  1U2C A;  1UVM A;  1UVN A;  2OEM A;  3CC2 S;  3RAM A;  4DR2 J;  2X1B A;  5KFY A;  1HHQ A;  3G6Y A;  4ES2 A;  3DGP B;  5IWA J;  1AB8 A;  3AXK A;  3C14 A;  2KG1 A;  1RT1 B;  4J5O A;  4JI0 J;  4FBT A;  2E1C A;  3PV8 A;  2W8L A;  4J9K A;  1ICE B;  1HPZ B;  3DOK B;  4CLT A;  1PG5 B;  3IBC B;  4ZVF A;  2H1Y A;  3PR5 B;  4DSK A;  3BBB A;  3ILO A;  3OD2 A;  3UCZ P;  1D9D A;  2C2O B;  2YQ3 A;  4QW8 A;  1QAI A;  1Q8B A;  1KN6 A;  2ZKU A;  5KFM A;  1U7L A;  3HFZ B;  5E3A A;  3HVW A;  1TL3 A;  4J9V A;  2IAJ A;  3KJV A;  3MF5 A;  2XY7 A;  2GHV C;  3R2D J;  2H51 B;  2HND A;  1MU2 A;  2Q1L A;  4PG5 A;  2XQC A;  3D1H A;  3AAW B;  1U47 A;  3BBF A;  2W7O A;  4TY8 A;  4TVA B;  1TL7 A;  2B4O A;  4KHR A;  3UI3 A;  2DGX A;  5E2Q A;  2YBV A;  4YB1 P;  1WOS A;  4EUV A;  4V1A k;  5EX0 A;  1RT6 A;  4KV8 A;  3CDE A;  3JYT A;  4QIV A;  4RJV A;  4NPO A;  3GB0 A;  2HHV A;  3AT1 B;  4X4V A;  2AQ4 A;  3TAQ A;  4ZPC A;  4ILM A;  2EPI A;  4Q45 A;  4B3S J;  1NB7 A;  4HHU A;  4DL3 A;  2GW8 A;  3AA9 A;  2XMU A;  5GAD U;  1RKI A;  1VIS A;  2GQQ A;  1LV5 A;  3NP5 A;  3W65 A;  2MZ1 A;  1FTC A;  1IKW B;  1UFW A;  3UVJ B;  2C2M B;  1UEK A;  2ZOM A;  2P9E A;  4FXD A;  2DNY A;  2EXU A;  2LQ5 A;  1HNZ F;  2J9E A;  3THV A;  4IRD A;  2MQL A;  1KQF B;  3MM7 B;  3WZ0 A;  2DNZ A;  5IQ6 A;  5CAB A;  3HPO A;  2RIJ A;  1KFS A;  4A47 A;  1YRU A;  4L6V 3;  4ZVE A;  2BZ2 A;  3DMJ A;  3R6L B;  1VQO S;  4ANC A;  1V5V A;  3C15 A;  4K2X A;  1J5O A;  5U47 A;  1IR0 A;  2MKY A;  3SQG B;  3WC0 A;  5HQM A;  5GAG U;  2VPZ B;  4P9S A;  4FP9 A;  4DLG A;  4PUO A;  2NZ4 A;  3GIM A;  1XR5 A;  1MNE A;  3TJA A;  4RZR A;  1LXJ A;  3MMJ A;  3GZ7 A;  3CCS S;  3A8E A;  3DLK A;  4EYI B;  4C8M A;  2EEY A;  2YWG A;  1REG X;  4ZVR B;  3CJK B;  1GTE A;  1U8W A;  3ZTQ A;  4C8Y A;  1HAR A;  4DMZ A;  2C42 A;  4DS4 A;  3G86 A;  3FBE A;  4EBD A;  4USK A;  1GMW A;  2PSZ A;  3AY0 A;  4UTG A;  1LFW A;  3KLE A;  2DEI A;  3NXZ A;  4F25 A;  4WFN Q;  4NLW A;  1RE1 B;  3GYN A;  3V6D B;  2AX0 A;  4LRD A;  4PWU A;  5A6P A;  4DL5 A;  4UT4 A;  6FD1 A;  1HD1 A;  3H90 A;  1C0U B;  3ZTO A;  4F3M A;  2VV5 A;  1ZTW A;  4R0E A;  4DUZ F;  1TEL A;  5H1S V;  3HX9 A;  5LM7 E;  3PIO Q;  4IFY B;  1WC1 A;  3CNQ P;  3CMQ A;  3DRR A;  3WX4 A;  1U1Q A;  2V5H G;  2HMI A;  1GQE A;  3SDE B;  2RRN A;  2YQ1 A;  2XO7 A;  4M5D B;  4ZA1 A;  1PSD A;  1FI4 A;  5RUB A;  3K8V A;  4ZPV R;  4AND A;  2F40 A;  3TAN A;  3CE8 A;  5GMK a;  4OZ3 A;  1M1H A;  3M30 A;  1KFD A;  3DU5 A;  4XTT A;  2AV5 A;  5IOL A;  1VS3 A;  2G1D A;  2HVD A;  3E8O A;  2QLW A;  3PRD A;  4Y28 C;  4DU7 A;  1B64 A;  3U1M A;  2MGZ B;  4QWA A;  3QSY B;  4CCH A;  4B3R F;  3L9Z A;  1U1M A;  4B02 A;  1F2H A;  2R8K A;  4JI1 J;  2FJX A;  2IC3 A;  1G2E A;  4IR1 A;  2L48 A;  4O4G B;  4WWS A;  1DTQ A;  2G0C A;  3C16 B;  5HVF A;  3VGV A;  1ZET A;  2DCL A;  2HGL A;  4FPI A;  1QSY A;  3BSO A;  3MM8 B;  4K7Q A;  2C2Z B;  4Z2X A;  3MPU B;  1HMV B;  4Q44 A;  4P72 A;  5KT5 A;  3BO4 A;  4U6P A;  6AT1 B;  5ETN A;  3GYX B;  2RIL A;  1TVR B;  2AEJ A;  4M5I A;  1FNX H;  4YN3 B;  2KG0 A;  3LP1 A;  4LF5 J;  3VVT A;  1RDR A;  5C5J A;  1GX5 A;  2MHE A;  3BGR B;  1DQ8 A;  1KLM B;  2VUG A;  2JZ5 A;  4EU0 A;  3T6J A;  4KC5 A;  4KKO B;  4IH5 A;  1U0H B;  2C3P A;  4MIA A;  2VHG A;  1YJN S;  1HNX F;  2IY5 B;  1X5P A;  2OEJ A;  3LWL A;  4GVB B;  4EBC A;  5KTQ A;  1NKC A;  5IM0 B;  2Q6B A;  1LK7 A;  1MWQ A;  5DGB A;  3MR6 A;  3CTR A;  4F0K A;  2PGC A;  2AKW B;  3MM6 B;  5ITH A;  5A2Q U;  3PTW A;  2RKI B;  3KNA A;  4K4T A;  3WBZ A;  1RWU A;  4DHV A;  2I1R A;  4PPD A;  2QX0 A;  4G6V B;  5DDQ C;  3QRQ A;  2YX4 A;  5CA5 A;  2FIU A;  4MKY A;  3GIJ A;  1S7H A;  3PFE A;  4QYZ K;  4DN9 A;  1UZH A;  2QLB B;  2XO6 A;  5C2G A;  4I67 A;  5BJR A;  3A3N B;  2BYC A;  4RNO A;  1K8A T;  3D67 A;  3M8P A;  2I8E A;  5ETR A;  1U6Z A;  1LWF B;  1TK8 A;  5LXY A;  2HKE A;  3PEJ A;  2B43 A;  4MKA A;  5D0H A;  1N33 J;  3MEK A;  2J9D A;  2DNN A;  1OSD A;  1SI9 A;  4OZ2 A;  2IDL A;  2AGO A;  1J5E F;  2FHK A;  4Y34 A;  3W9H A;  4M5H A;  3MEE B;  3W5Z A;  3HK2 A;  4JB8 B;  1VGY A;  3QGG A;  4FF1 A;  4PAA A;  2K7K A;  2A1B A;  5DQG A;  3GMG A;  4WCE Q;  1UL3 A;  2Z2L A;  4ETZ A;  2A6M A;  1S1T B;  4UQT A;  3T1H F;  1OJ4 A;  3JQM A;  3KXD A;  4UOF A;  3BSA A;  4I6A A;  2HVZ A;  2HG4 A;  5C42 A;  1NK4 A;  2G13 A;  2R7S A;  3BM7 A;  1FT8 A;  1M5P C;  1JK9 B;  3G2X A;  2CWK A;  2VBY A;  4Q2L A;  1ZPV A;  1L3T A;  4I7F A;  3SFG A;  3Q8U A;  2V63 A;  4LQ9 A;  1YJ7 A;  1VJW A;  2L9W A;  2CG8 A;  3V6J A;  4UOG A;  1EJ7 L;  2RU3 A;  5ETP A;  4I64 A;  4DR1 F;  2F4V F;  3EWG A;  2XMV A;  4I1T A;  2FZG B;  1UAW A;  3UDV A;  3D0G E;  3NWG A;  2M52 A;  1J27 A;  2B8Q A;  5A76 A;  3IP0 A;  2BQU A;  4R25 A;  5KFC A;  1EHW A;  2IRX A;  4GMK A;  3TYT A;  4YS2 A;  4ZHR B;  5E41 A;  2V8D A;  2CQ4 A;  4P75 A;  2YWW A;  2PFF B;  2BE2 A;  4P71 A;  4DPU A;  2HHQ A;  3T5H A;  2C3M A;  3TEG A;  1KWM A;  3V4M A;  1RCO B;  3A13 A;  3BGO P;  1QJH A;  4OYB A;  4RW6 B;  4DL6 A;  1BD6 A;  1S9E B;  4OJG A;  1DTQ B;  4KGV B;  3M4X A;  3UDL A;  4C0O C;  2FDN A;  2XMK A;  3OSP A;  3CCU S;  2XLJ A;  1RHJ B;  3H5S A;  4KTQ A;  5A8R A;  3J81 Y;  4CTA B;  2VJV A;  3BGR A;  4F67 A;  4F50 A;  2ZH3 A;  3M32 B;  3AOC A;  2PE8 A;  3N5F A;  1UEV A;  2DNL A;  2GZO A;  2RS8 A;  2YXL A;  2HRY A;  2E1P A;  2WSF C;  1TVR A;  1C1C B;  4CM0 A;  4QYZ J;  1MSW D;  2RQC A;  4JI6 J;  2FQQ B;  4QR2 A;  2GX8 A;  2RJZ A;  3CJT A;  4OHV A;  1FFS B;  1N6Q B;  2FPH X;  3DM2 A;  4ECR A;  1FFW B;  2ZC4 A;  1S6P B;  2N4C A;  5D4L A;  3GV7 B;  3QT5 A;  4XIU A;  1O5J A;  1OSC A;  4DV4 J;  4WYL A;  3HZE A;  4ZVQ B;  3TAM B;  3BV8 A;  4OI3 A;  5I3U B;  1ZM4 A;  4I6Y A;  5L39 A;  1RAJ A;  3ZTP A;  4EBE A;  2OTJ S;  1CS4 A;  1Y5I B;  3AFG A;  3ZC4 A;  3O2I A;  2BDP A;  4H4M B;  2UVR A;  1YRT A;  4RU2 A;  2EFP A;  4XAK A;  4MK7 A;  2OML A;  4J9R A;  1KVI A;  2MEW A;  2ACY A;  4QJV A;  3DHW C;  1VYA A;  1RT4 A;  1TUG B;  1SB6 A;  2XWX A;  5A8K B;  3J81 j;  4JI7 J;  1YJT A;  4B9N A;  4YHH J;  3ZNJ 1;  4CO0 A;  4D3G A;  2FLN A;  2E44 A;  4B3M F;  2J9D E;  4JI2 J;  2AHO B;  4DR6 J;  2ZHO A;  3UDC A;  1Q53 A;  4ID5 A;  2BXJ A;  4B9L A;  2GJI A;  2AT1 B;  1KR4 A;  2RF2 B;  5D3G B;  3I0S B;  3M7V A;  5AXK A;  2BRK A;  3TX8 A;  2X1A A;  3KLH B;  2IVM A;  4NE9 C;  2H48 B;  3CJR A;  3PYD A;  1B4S A;  2V9W A;  1QM9 A;  1RAE B;  2DRA A;  4O3N A;  3VCD A;  4ZLP A;  1KKH A;  5LJ3 Y;  1JLF B;  1TTH B;  5DQI A;  1YDL A;  4E8U A;  1PC5 A;  1UZD A;  5HBM B;  2BJ8 A;  3DLH A;  3AD9 C;  3H0P A;  2Z4P A;  4USH A;  3I4P A;  4CNZ A;  1HNW J;  4PZV A;  5THW A;  1YIJ S;  1S1W A;  1X0F A;  1N88 A;  2MJN A;  2ZE2 A;  1HWI A;  2KB2 A;  3LP0 B;  1L3K A;  2F3J A;  3B4D A;  2QG9 B;  3DDI A;  4KSE B;  4UW2 A;  1H3D A;  2DT9 A;  3QZ7 A;  1KTQ A;  4BWM A;  3CUL A;  2KH9 A;  3TEH B;  2CJY B;  3R27 A;  1KLM A;  4LF4 J;  5KG1 A;  5IFM A;  2FJE B;  1PO6 A;  3L7U A;  4USW A;  5I42 B;  1CJT A;  4W92 B;  4MYT A;  2ZH7 A;  1PYS B;  2I6W A;  4WP3 A;  1CJK A;  2XBP A;  2MST A;  1X5S A;  2RS2 A;  3AJ1 A;  3TVK A;  4J9O A;  3NL0 A;  3GV8 B;  3D3B J;  3ELH A;  4B3O B;  5I3Q A;  1H72 C;  2BJ1 A;  4QIF A;  1GNK A;  5J2M B;  2Q66 A;  1D8Y A;  2QV6 A;  2Z2Y B;  5A8R B;  1FJG F;  1S6Q B;  3J7Z T;  4JP8 A;  1RT2 B;  1FX4 A;  2H5E A;  3OTD A;  4NLS A;  4UF4 A;  3OQ2 A;  4CO5 A;  1Q81 T;  2DNH A;  2A2C A;  2C2K B;  4LRF A;  1F9E B;  2OUG A;  5D77 A;  2NXJ A;  3DGP A;  3LAK A;  4U8Y A;  3L3C A;  1SH2 A;  3IC1 A;  2AJQ A;  3C14 B;  2KXF A;  1XQI A;  2ROP A;  2U1A A;  2XTJ P;  3FFI A;  5G4D A;  1WDT A;  4C8K A;  1N6Q A;  4R0J A;  4P6Q A;  2HVE A;  2K7J A;  3C15 B;  3M1V B;  4OX9 F;  4C11 A;  2XS7 A;  1LW2 B;  3UR0 A;  1HD0 A;  1T9X A;  2DGT A;  2K3K A;  2ROE A;  2OSQ A;  3PW0 A;  1BC6 A;  5ETV A;  3G82 B;  2IMO A;  3PYE A;  1C0T A;  3TX0 A;  3OL7 A;  5HP1 A;  4K4Z A;  4KJI A;  2DXE A;  3FZB A;  2F9J A;  2DXF A;  4FKY A;  5E3R A;  2ZJR Q;  2M7S A;  1H38 A;  3CC4 S;  2UUW A;  2YWE A;  3LOU A;  4LRB A;  2YH1 A;  2PEB A;  1YZ6 A;  1FK9 B;  1GEH A;  1RAO A;  3I4H X;  3WC2 A;  4M1K A;  1LWC A;  3SI8 A;  2DGU A;  1HBM B;  2KVI A;  4ZIT A;  3QIP A;  1S9G A;  3K58 A;  5CCM A;  1S1X A;  3KNG A;  2IA6 A;  2K3I A;  1AUD A;  4K4V A;  2D3O 1;  1H0H B;  1UWA A;  2FHM A;  2MQN A;  4OZ5 A;  5KOX A;  1RT4 B;  4LR7 A;  2E9Z A;  2DNK A;  3CD5 A;  3V5R A;  1FKO A;  4ED4 A;  1SQF A;  5F9N A;  1SC1 B;  2BRL A;  1SH0 A;  2AU0 A;  3IRW P;  1PCA A;  2GMH A;  3D4J A;  4ICL B;  4O3P A;  1FRH A;  2MZR A;  2WW4 A;  2YPY A;  4ZPW R;  3OJS A;  4OYZ A;  4DQR A;  4O44 A;  3D68 A;  1WI8 A;  3IAS 9;  3W8P A;  1YQH A;  1QUP A;  2ZH9 A;  2EC0 A;  1UVJ A;  1S9F A;  4A8W A;  4DG1 B;  2HFS A;  1KTV A;  3D0I E;  1QSL A;  3BN7 A;  2UXB J;  3R5G A;  4P74 A;  5B7W A;  3OV7 A;  1AFJ A;  2Y8W A;  4RNF A;  4C8O A;  1JLB B;  1NDK A;  2M4M A;  3NAI A;  3KK2 B;  3FC9 A;  4KGX B;  2LXF A;  3GPA A;  3GG1 A;  4RPF A;  4OZJ A;  1S1W B;  2E5L J;  2BVZ A;  5CZX A;  1OY6 A;  1C1C A;  5F3Z A;  2WW8 A;  2AF6 A;  4BHQ A;  4U7U K;  3T1A A;  3LWM A;  3CCM S;  1U1R A;  2LKZ A;  3QT6 A;  4WFY A;  2O1P A;  1SIW B;  2XGP A;  3QJP A;  2M0G B;  4DR3 F;  1N0V C;  4N8N A;  3TUZ C;  3M2U B;  2FJD B;  1YSJ A;  3H20 A;  2CRL A;  4FYV B;  2OKQ A;  1C4C A;  5KT3 A;  2PI4 A;  5I3P A;  3UNG C;  4O0I A;  4J9L A;  3ZTR A;  3VAK A;  4P7V A;  3BF4 A;  3D6F B;  4DFK A;  4URG A;  2B7C B;  1VK3 A;  2MYF A;  5L9N A;  4FNI A;  4ECT A;  3UFC X;  3LP2 B;  3QAE A;  1LWE A;  1OS5 A;  2GIF A;  4KAI A;  2JLF A;  4CLU A;  4DV2 F;  1ZH5 A;  1PYO B;  2DJW A;  3M05 A;  1VRU A;  3OPK A;  1UJ4 A;  2YQ0 A;  2BJD A;  2HAI A;  1LOU A;  5LL6 d;  4ED2 A;  1S4E A;  5KFI A;  1S1U B;  4DEZ A;  3QNW B;  2QLJ B;  2ZIT A;  2PA8 D;  3MM8 A;  1K1Q A;  1FWP A;  7AT1 B;  3NGR A;  1EKS A;  1WHW A;  4B3T F;  3L95 X;  1ZM9 A;  2HS3 A;  3K17 A;  2BAB A;  1T3N A;  1LW2 A;  1U0H A;  1RTI A;  1U24 A;  2M9K A;  2BAC A;  2DO4 A;  2QIF A;  3HVA A;  3PCO B;  3QO9 A;  5KG7 A;  4N56 A;  4EZ6 A;  2B4U A;  1X4C A;  1SUQ B;  3R97 A;  4LFB F;  3FFI B;  2MZQ A;  4DX5 A;  1EB0 A;  2V8V A;  3O5T B;  4YFU A;  3P5B P;  1Q4R A;  3MM6 A;  2RB7 A;  3T1Y F;  1TKT A;  4DPX A;  1RYS A;  2R4F A;  4MIW A;  1U8S A;  1U48 A;  4OX6 A;  3P3D A;  3N0V A;  5LMU F;  3ZZU A;  4DR6 F;  2ADB A;  2HNZ A;  2XHC A;  5A8W B;  4Q8E A;  1RU2 A;  4C7Q A;  2Q43 A;  3H7H B;  2N4D A;  4JOU A;  1RLD A;  4RBV A;  1S1X B;  4HAC B;  3KLG B;  3RB3 A;  3AQO A;  3EZ5 A;  2NRE A;  4WZM A;  4TN2 A;  5ETS A;  1IWA A;  2FHO B;  3Q8Y A;  5CAA A;  1HYS A;  3CJ4 A;  3R5D A;  3FQL A;  1ZA1 B;  3LF0 A;  2E1A A;  2F63 A;  2ZDO A;  2VL1 A;  1VBX A;  3MMB A;  2XMM A;  1N54 B;  2J9C A;  2IJN A;  2Q79 A;  2ZD1 B;  1T02 A;  1UPM B;  5HO4 A;  1UVI A;  3VAG A;  4B3O A;  1LWF A;  4YB6 A;  1TKX A;  4OJH A;  3HSJ A;  5SUH A;  2YWH A;  2YNI A;  3U02 A;  2OJ3 A;  4IOC Q;  1RT5 B;  1IBL J;  4HI2 A;  3F73 A;  4MFB A;  4A8S A;  2C1E B;  3SCK E;  2G1H A;  1S4F A;  1UFK A;  2FLO A;  4Y0F A;  3CPW R;  3HFV A;  2R7R A;  3G87 A;  2DNM A;  2VOP A;  1AZS A;  2LVW A;  4A8X A;  2FLL A;  3MD3 A;  1GFW B;  3RR8 A;  4QWD A;  4F36 A;  3MR2 A;  1S49 A;  1BE4 A;  2AMC B;  3ZXW A;  3IG1 B;  4MMO A;  3R7B B;  1FRX A;  2XSJ B;  2JEG A;  3WQP A;  3SBM A;  4X4P A;  3M6V A;  4OHX A;  3PRB A;  4JI5 F;  3MM5 B;  4WFA Q;  3GYG A;  2V2K A;  3IWL A;  3NOC A;  3KK1 A;  5IWA F;  5LMN F;  2OTL S;  1K44 A;  3F56 A;  4WU2 A;  1ZPW X;  2JX2 A;  1XMQ J;  2MZJ A;  2DPJ A;  1WEX A;  1ZBT A;  2LMI A;  2BR0 A;  2DRB A;  1U02 A;  3MD1 A;  1NEE A;  4L76 A;  2AZ1 A;  3TNV A;  3FVY A;  4EMD A;  1CUL B;  2XSF A;  2J5A A;  1QE1 A;  5KG0 A;  2RDI A;  4ZLN A;  2VA3 A;  1ITP A;  1GH8 A;  1RWW B;  1IUJ A;  1PIL A;  3B54 A;  1NJW A;  1T05 B;  1CEZ A;  4RW8 B;  2MHN A;  4FF4 A;  1VLO A;  1XTZ A;  4X4R A;  3CD7 A;  2W9B A;  1G6B A;  5CYQ B;  4NCB A;  2W24 A;  2D9O A;  2NZC A;  3CDU A;  3IWX A;  5EWE A;  1YTY A;  2G2O A;  3IBF B;  1EKR A;  1Z2Z A;  4LF2 A;  2JC1 A;  4CLW A;  1FKO B;  2MKC A;  4CO4 A;  2C22 A;  2CQ3 A;  2KRB A;  2R2U A;  4QWB A;  4Q2M A;  5LSR A;  1LW0 A;  2VFR A;  2VZ9 A;  2ZEJ A;  3CCT A;  3N9U C;  1UVL A;  4WKR A;  2A10 A;  1HPZ A;  1RK8 A;  3DOK A;  3I87 A;  3KUH A;  4DR5 J;  3PEH A;  4PEO A;  3TWZ A;  4F2R A;  1ZYQ A;  1OIA A;  1XMO J;  3SQG A;  2OAU A;  3FSY A;  3BN4 A;  2OPS B;  1QAY A;  4LSL A;  4AFF A;  2RNE A;  1BHN A;  1RTJ A;  2HNZ B;  3R5J B;  5CZV A;  2ZVS A;  3GR1 A;  2ZKT A;  4JUZ A;  5MLC V;  1GTH A;  2OEK A;  4A8K A;  1SKW A;  5AJ3 J;  4AE5 A;  4ZPA A;  5IC4 B;  2DNQ A;  3DOL A;  4F4K A;  1NKB A;  5CYM B;  2OPQ A;  4YDD B;  4LF7 J;  8AT1 B;  2EWH A;  2MKJ A;  2GHW A;  3I0R A;  5H9F J;  1I51 B;  3EXY A;  3ENW A;  3HHN B;  2J8A A;  2HHS A;  3DFE A;  5KFW A;  4FF3 A;  3NY0 A;  2E7V A;  4EGL A;  3IBW A;  2QMX A;  3OL8 A;  5ETQ A;  3H2L A;  2BA9 A;  3UW1 A;  2DVI A;  3CJK A;  3PAC A;  4ECY A;  1CC8 A;  4ZVS B;  2F4F A;  8RUC A;  4C2M A;  4KR0 B;  1K73 T;  4DV0 J;  2IMW P;  2CQD A;  4UQG A;  1KNZ A;  1VRT B;  3C8Y A;  3OR1 A;  2ZC3 A;  1HQU A;  4CO1 A;  4AYB D;  1HNX J;  2HEK A;  1JKH A;  1EX8 A;  4FVC A;  3POT A;  3SZ2 A;  1HBN B;  5CYJ A;  5D0G A;  1R89 A;  4P52 A;  3UE2 A;  2P5V A;  1VC5 A;  1IQT A;  4IG3 A;  2XSJ A;  5H9E J;  4CWB A;  4TU8 A;  2XGQ A;  2VFV A;  3G8Q A;  5L1K A;  2UUA F;  2R7X A;  2DB1 A;  3AJD A;  4X4O A;  4ED1 A;  2APO A;  3S01 A;  5E3Q A;  1F2G A;  1RT7 B;  3W61 A;  5M2R A;  1S0M A;  1I6J A;  2MKI A;  4URQ U;  5AJ3 F;  4ZMM A;  5LMN J;  1RBL A;  1S1V B;  1N32 J;  2I5J B;  2XC9 A;  3DRR B;  4LF4 F;  4QU7 A;  1HLW A;  1Y5L B;  2DGV A;  1RWX B;  3V2U C;  2W25 A;  4JI4 F;  1BQN A;  1H2U X;  1PJ6 A;  1WJ9 A;  1OYD A;  1YZ7 A;  5EUH A;  2KT2 A;  5HMX A;  5DDR C;  1KVJ A;  2KYX A;  2HQC A;  2LU1 A;  1TL4 A;  2OFG X;  4JI8 F;  3UPF A;  4JI1 F;  5D3G A;  1Y3K A;  2B4P A;  2NXC A;  2B51 A;  5HRO B;  3M9N B;  1F5A A;  2EKN A;  4PR6 A;  2JRS A;  2LA6 A;  3QWP A;  2V2Z A;  5B0D A;  2WVB A;  1QE1 B;  5IC6 B;  5AXN A;  4LF7 F;  2GIR A;  1CVJ A;  5HLF A;  3G4S S;  1NU4 A;  4A8Q A;  1VI7 A;  4CLK A;  1FJG J;  2HQI A;  4J37 A;  2H5J B;  2OP5 A;  3MMA A;  4FYW B;  1Q95 G;  2IDE A;  1UCN A;  2CKW A;  1K47 A;  1I1G A;  3KLF B;  5IT4 A;  4ED3 A;  1CJV A;  4LF8 F;  1BGX T;  5E3C A;  5LSO A;  4IRK A;  3BH6 B;  4KKO A;  1Z2L A;  2GO9 A;  2R42 A;  4OYI A;  3UCG A;  2QYG A;  3KLE B;  3CGI A;  1TKX B;  4KQZ A;  3T19 A;  4QCL A;  2B5J A;  4AXI A;  2YNI B;  3TVY A;  1EP4 A;  2VG5 A;  5B0G A;  1T8E A;  3P4U B;  4DUT A;  1WF0 A;  3MWB A;  3BKT A;  4DX7 A;  4YY3 J;  4DV7 J;  1VQ6 S;  2CZ4 A;  2HZV A;  3M1V A;  1VQ9 S;  3FCW A;  2BJ3 A;  2IBO A;  1X9S A;  1XBW A;  3TVZ A;  1B70 B;  2KFY A;  2JDJ A;  3K5N A;  2JH3 A;  1AT1 B;  1UP1 A;  5HP1 B;  4P2M A;  1JLE A;  3SV3 A;  4B17 A;  2CPJ A;  2UUC F;  2V94 A;  1B7Y B;  1TR0 A;  2H9Z A;  1JLC A;  1TUV A;  4E2F B;  1SVD A;  2G9O A;  3ILI A;  1C1B B;  2K1R B;  5KFO A;  4RNN A;  3K8W A;  1FVQ A;  3H98 A;  5D0R A;  3W2V A;  3TZW A;  2IJF A;  3W1Y C;  4C3M A;  4ZN1 A;  2HLU A;  1WG4 A;  2ZNY A;  2NPI A;  4DV3 F;  2K8G A;  3RGI A;  3CJ0 A;  2GAH C;  2Z56 B;  4UZB A;  2YNG B;  2CQ2 A;  1UKU A;  3AD7 C;  4WYW A;  2UUB F;  3BZQ A;  2V8G A;  2YPZ A;  3D54 A;  3BQ0 A;  2HVI A;  4ILR A;  2ZZM A;  2UUB J;  3DN9 A;  3E2E A;  1VMB A;  2XZW A;  3QID A;  4QOT A;  4RW8 A;  1AFI A;  3FCV A;  4JI5 J;  4JI2 F;  3NMR A;  4DV3 J;  2CJ9 A;  2YVS A;  3HJV A;  3ENQ A;  3PG9 A;  2MKK A;  2CDR B;  2GVZ A;  2B4V A;  1U25 A;  4O44 B;  3WIU A;  4NML A;  3H25 A;  1S12 A;  1R0A A;  1RWV B;  3Q8S B;  1S0O A;  2NYI A;  1A6L A;  2L9N A;  2WTF A;  3H4D A;  1RP5 A;  3MDF A;  3BGF A;  3PDN A;  3QT7 A;  4URS A;  5DS7 A;  1EET B;  2HFO A;  1T3O A;  5AE1 A;  2DNP A;  1WHV A;  4R5P B;  3DGV A;  3HHL B;  3LAL A;  1YJW S;  3IWN C;  1T11 A;  2AZ3 A;  4ENO A;  4B9M A;  2B9E A;  3DLG B;  3HD2 A;  3KLV A;  2VOO A;  3R7S B;  5F8J A;  1X4E A;  2RUG A;  3MED A;  1MMD A;  1OO0 B;  1NLK L;  2RUS A;  2J7W A;  3ULH A;  4CLF A;  3AB2 B;  3LP1 B;  3BO3 A;  1T9Y A;  2CZV C;  3OTO J;  2HIY A;  1UWB B; 
#chains in the Genus database with same CATH homology
 1KBR A;  1RTZ A;  3HSJ A;  4M5H A;  4CYU B;  2F65 A;  3HCX A;  5ETV A;  1DY3 A;  1EX8 A;  3ILO A;  5ETT A;  3UD5 A;  3HSG A;  4M5L A;  4M5J A;  4M5G A;  3HSZ A;  5ETK A;  1EQ0 A;  4CWB A;  1HQ2 A;  1RU2 A;  3HT0 A;  3HSD A;  3KUE A;  4PZV A;  2QX0 A;  3QBC A;  4CRJ A;  1EQM A;  3HD1 A;  1HKA A;  1RAO A;  1IM6 A;  3ILI A;  5ETN A;  1Q0N A;  3KUG A;  5ETS A;  4AD6 A;  2BMB A;  4M5I A;  5ETM A;  1CBK A;  3ILJ A;  3HD2 A;  3UDE A;  2CG8 A;  1RB0 A;  3ILL A;  4M5M A;  5ETQ A;  5ETR A;  2F63 A;  3MCO A;  5ETL A;  4M5K A;  5ETP A;  4M5N A;  1TMM A;  1F9H A;  3KUH A;  5ETO A;  3UDV A;  4CYU A;  3MCN A;  3MCM A;  4F7V A;  3IP0 A;  1RU1 A;  1G4C A;  1TMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...