4AD6A

Synthesis and sar of guanine based analogues for hppk inhibitors
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
SHMIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Exploring the Chemical Space Around 8-Mercaptoguanine as a Route to New Inhibitors of the Folate Biosynthesis Enzyme Hppk.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4ad6A00
1Q0NA 4M5KA 1F9HA 2F63A 3MCMA 4PZVA 5ETVA 1CBKA 3HSZA 3KUEA 1KBRA 1HQ2A 3HCXA 1EQMA 4M5MA 2CG8A 5ETPA 1RTZA 3KUGA 4M5HA 5ETQA 5ETLA 4CWBA 3HT0A 5ETSA 2QX0A 4M5GA 1G4CA 3HD2A 3QBCA 3MCNA 1TMJA 3UDVA 3UD5A 3MCOA 1EQ0A 4F7VA 3ILJA 3IP0A 5ETOA 4M5LA 4CYUB 4M5IA 4CYUA 4M5NA 4AD6A 1HKAA 3ILIA 3HD1A 1RU1A 1RAOA 1TMMA 1IM6A 3KUHA 2F65A 3ILLA 3ILOA 4M5JA 5ETRA 3HSDA 5ETNA 1EX8A 3HSGA 1RU2A 4CRJA 5ETTA 3UDEA 5ETMA 3HSJA 1RB0A 2BMBA 1DY3A 5ETKA
chains in the Genus database with same CATH superfamily
5IM0A 3CULA 4C3LA 2VKZG 4BS2A 4IR1A 2RHSB 4BBYA 3S1TA 2ZNYA 1YTYA 5AXKA 4DR3J 1WDDA 4NCGB 5FD1A 4TYAA 1XMQF 2H5JB 1X4FA 3DLLQ 3KK2B 3HX9A 2QLXA 2YWFA 2KXFA 1E6YA 1CPZA 3FZ2A 1FWPA 4Y34A 3SSRA 1K8AT 4CO1A 3PKYA 1RBAA 5HJXA 2RJZA 3WC2A 1Z4UA 2V8GA 2BKOA 5ETQA 1S9FA 1ZAWA 2CQCA 4KGZB 4LQ3A 1W7WA 4NE9C 4QR0A 5IXUA 2AD9A 3CC4S 1XQIA 3EZ5A 1H2VZ 5A8RA 4IFVB 1UWBB 3ZFVA 4F4WA 1D09B 1RA7A 2A3JA 3V81B 4AYBD 3GJSB 4DV3F 5KFZA 4NLQA 2H3EB 2VPWB 5CCMA 3TOQA 3C14A 3CJRA 2DGOA 5C2CA 3GJRB 1F6TA 2YPYA 2AHOB 4IG3B 3Q22A 2KN4A 5BJRA 2DH9A 3EGWB 2OP5A 1U6ZA 1ZS6A 2WB4A 3ZZPA 1RQ0A 5SZTA 2KDOA 2QE5A 5K8PA 2NR0A 2E5GA 3QLHA 2BQRA 2ZD1A 4QPXA 5C42B 2Y1IA 3FBCA 4PQUB 4OJ3A 3DOKA 3DLKB 3K58A 2RF2A 1FNOA 5I42A 4DSIA 1Q81T 3UN5A 4OHXA 4C6AA 3HD2A 2W2OP 1WWHA 1XNRJ 1X4GA 2YWKA 3BGUA 1FJEB 4K4TA 2HFZA 1S6OA 2C1EB 1BC6A 4ZDNA 4EU0A 2V9WA 2VG6A 2JOQA 1UVKA 4WK1A 2K1RA 2AF6A 4LSNA 2BQ3A 4LQ9A 3ZZTA 4DSKA 2UP1A 1E6VA 4WCEQ 2NSBA 4PKDB 5HMZA 1CJVB 2HPUA 1NHKL 1NSQA 4FDFA 2HBYB 3ZZYA 4QYZK 3SDEA 1RK8A 4WF9Q 2AJ2A 5C25A 2Z56B 4WWSA 2W9BB 1RWNB 1DY3A 1IKWA 1J2VA 2KRRA 4KGKA 2E44A 3UD4P 3KLFB 2IA6A 1AXQA 3A4TA 4O4GA 2DY9A 3CJ4A 5EX0A 1KR4A 2R2UA 4KFBB 4R0EA 4YEAA 1IJFB 2J0QD 3F56A 5G0RB 1S1XA 5KFBA 4ETXA 3K8VA 2JDJA 1HW9A 4JI3F 2RILA 3CCWA 5A0YA 3S01A 1Y4ZB 1KONA 1HD1A 2GQQA 4ZCLA 1U45A 2HHPA 1R0AA 3R5AA 5B0AA 3K5MA 2C3UA 3G6YA 1Y10A 1TL1B 2DNRA 1IVZA 3HI9A 1D9FA 4X4QA 4LF4F 3UDCA 1JLGB 3C6UB 2OD6A 5C24B 5L1JA 4CLZA 1NPRA 3MM7B 3LALA 1FCAA 4RUBA 4M5HA 1H2TZ 2MGZA 4OMFG 1F60B 1LW0A 2J6UA 1I94F 1U8SA 1WC5A 3NCRA 3CJ0A 3T1AA 4DLGA 5EX3A 5CA5A 2MQPA 3AAWB 4DFJA 3CC2S 2XSJB 4XPCA 4C8YA 1X9WA 1HBOA 3CWJA 2YH0A 1VLOA 2P6SA 3MM5B 3CIZA 2A18A 4WBFA 5JJBA 4QYZJ 5KG6A 3DGPB 5KT6A 2DXFA 2IBKA 5EDWA 1UVIA 4HT7A 1FEHA 3A13A 2ZH3A 3MDFA 5K14A 1RT4A 1HI8A 4EK2A 3CCMS 2HVZA 3CO0P 3VQSA 3T6JA 2CJAA 1SCJB 1RWVB 1ITPA 4OJ1A 5JUMA 4WP8A 4UW2A 4O3PA 3CDAA 5T7LA 1F3VA 2K7KA 3MHYA 1R27B 1MNEA 2QLWA 3H4DA 1KFSA 1EKSA 4DX6A 2IC3B 3H20A 4NI2A 4AL6A 1OQ3A 1Q8KA 3GIMA 2BRKA 1D9DA 3NGUA 4J9KA 3E01B 1NKBA 4QQBA 2MMYA 3U1MA 2KH9A 4LIRA 4J9UE 2MQQA 2MDAA 2UXBF 3D28A 1NH8A 1LQ9A 2YKQA 3RRHA 2E5LJ 2BJ1A 1RU1A 2HLTA 2ZJPQ 2IYIA 3JSBA 2HK3A 5HBMA 1U49A 3NS7B 1RTZA 5FLXY 3OQ2A 5DJBA 1R31A 2LYVA 5BYSA 1XR6A 2G0JA 3AA8A 5MAOA 4JI7F 3W62A 3TAMA 4KY3A 1KQFB 1AZSB 2J0XA 2MSTA 3PRVA 5GAHU 1Q7LB 4AXJA 2VFUA 4ES3A 1IKYB 2DO0A 3B8HA 3EM1A 3EVMA 2UXDF 3OFEA 4DSEA 5DS7A 1KVIA 2HGLA 3MEEA 3BGFA 4DR4J 3RG6A 4B3MJ 4JI4J 3VWSA 3PO4A 1ZYQA 4DBQA 3BKUA 2I5JA 3OFGA 1TKDA 3KLHB 4Y2AA 2Q3PA 3EXCX 4KGXB 1VBXA 1S0VA 2B5JB 2JZ5A 1NSAA 1UL3A 2MKKA 4TKTA 2UU9F 3OBIA 5ETKA 5E3CA 2VFTA 1WC6A 2Q79A 3AA9A 3DM2A 3MAAA 4K2XA 2W9CB 1BWEA 1S7HA 3CD6S 3QJPA 2CJKA 4X4OA 2HHXA 4B3OA 3BN7A 4CH0S 2FVQA 3T1YJ 3HHNB 2J0SD 4RW7A 3QT5A 1S79A 3N6LA 4ED4A 3QRQA 1OIAA 3MOZA 5DETA 2E7XA 1FXDA 4NOHA 2AWZA 5CYJA 1X5OA 4M94A 1FE0A 4RU9A 2H54B 4TYBA 1PYOB 5HQMA 3M1VA 4DPWA 3N28A 4UOFA 1TUVA 5K8NA 3NNCA 2CZVC 4OHVA 2NXJA 4QU6A 3EICA 1OPIA 4PWUA 1LFWA 4CT8A 4LSZB 1Q82T 3DDIA 5LOQA 4DF4A 1CULA 5KT5A 3WX4A 4P74A 1Y00A 4ES2A 3T1HF 1T9VA 2MKYA 2JLGA 2G2ZA 4DWIA 1KLMB 3DHWC 3QJJA 2OELA 1C2PA 4CT9A 3QIPB 4F4ZA 3FBEA 4ZHRA 5KFAA 1WHWA 1FE4A 3DU6A 1N5TA 1WG1A 3RAQA 1ELOA 2AGQA 3AQPA 2VH7A 4YMEA 1F1BB 3N5BA 5IV3A 1NK4A 2IJFA 2W7PA 5IC4B 4ZJLA 2HBQB 3DDNA 3IG1B 3UN2A 3NCPA 4N7TA 4OV6A 2J9EA 2OLWA 4QZVB 2RDIA 4J9RA 2LQ9A 2BXJA 1FDBA 2MB0B 4GO5X 1EJ7L 1U0HA 3PYEA 2G1DA 1IKXA 4RNNA 4K5RA 5LMNJ 3V6HA 3DCAA 4NA2A 4U67Q 5B0FA 4J9MA 1ZH5A 2GFFA 4XAKA 3HK2A 5F9LA 3HHKA 3W2VB 1QSLA 1RLDA 1MU2A 3OLAA 3S7RA 4OYWA 3UDEA 3SFUA 5CD4A 3PW2A 1ROFA 2MJNA 2DHSA 4RPFA 1FRLA 4F4AA 2CQ2A 4USUA 1TV6A 1YJVA 2FHJD 1BD6A 2PC6A 1IUJA 4RWXA 4PAAA 3BKTA 2FTRA 2WVDA 4P2MA 1R6YA 4ELTA 4DFMA 2BYCA 3BO3A 4HHUA 3J7ZT 1HWJA 2N4CA 5K8MA 2V8DA 2HHUA 2E9RX 2XMMA 5BXIA 3MUMP 1GX6A 3K5LA 3I32A 4YHHF 4M1KA 3HSZA 4W92B 3HKWA 1B99A 3SV3A 5F0UA 4CYUB 3BYRA 2CJXB 2Z58B 5GAHI 2IHR1 4OYMA 1N5VA 2RHQB 3TEHB 3QQCD 1U02A 5HP1B 2J7WA 1MLAA 5KG4A 2CA9A 5D8HB 1HNXF 3HXMA 4M5IA 3PW0A 2FB0A 2FLOA 3KK3A 4J9NA 5IT9Y 1WORA 4KV8B 4B9NA 4YP3A 3PACA 2XZDB 4DCOB 1VBZA 3VZIA 1OPZA 1JNRB 2MQMA 4XDDA 4ZLPA 1TKZA 2VONA 3DRRB 4KO0A 2ZZTA 4KAIA 2HFVA 1SH2A 2X3GA 1VHIA 2L08A 1SC4B 4QIFA 3MTKA 4WXOA 2XTJP 4ED5A 1XMQJ 1FEEA 3QPIA 3GYXB 3LP2B 1NK6A 4OI3A 2RE1A 3IS9B 4LSLB 5L46A 4C8KA 3J7YU 2ZC3A 1SIZA 2L48A 1FFGB 1YJWS 2YWEA 5KT7A 5E3AA 2H5EA 2W2MP 3M8WA 1GH8A 1QAJA 2B4PA 3V81A 1PJ7A 2IVYA 1TL7B 2B43A 4HDGA 2WK4A 3Q8SB 2YKMB 1GXLA 1A0OB 2DIUA 4ZN1A 3QT6A 2ZFHA 1N52B 1UJ5A 4QJVA 2GIRA 5D3GB 3TA2A 5LMUF 1WC1A 3D0GE 1PGZA 4RW4B 2BQUA 1PC4A 3M8ZA 1U1MA 1C4CA 3MEGB 1UPPA 2Q6CA 2HFUA 2XMKA 3LGMA 2G0IA 1ACMB 3GFXA 2RB7A 5C42A 4G1PA 1HQEB 2ZOGA 2CVIA 2VJVA 4WFBQ 3QGGA 1TKTB 4PQUA 3MXHP 2GIQA 3DLKA 1CJKA 1FT8A 2YKOA 3U7JA 4QIGA 4P10A 1FWKA 4OHWA 1SIWB 3RBXA 2CZ9A 2GA7A 1NDKA 3NS6A 2BV3A 2EBGA 2OPPA 1YK9A 2BJDA 3M2VA 3J7AN 1SJQA 1QLNA 2VPXB 2ZH1A 1VR6A 3DRYA 2MQNA 3R5DA 2VA2A 3KHLA 2JFKA 1DJ0A 4LF5F 4EFAC 1WF1A 3Q2TC 3D54A 2OPSB 1C1CB 1UMJA 2W4CA 2CG4A 1CJVA 5IT0A 4IO9Q 4CZCA 2HQIA 2CJYB 4DR2F 4FF2A 1FDDA 2DPIA 2W8KA 1JMTA 3VGVA 2W9BA 1OJ4A 5KFXA 1VCTA 5F8JA 1YVFA 3MM9B 1D0EA 3M4XA 3TA1A 2D74B 1VRTB 1TVRA 3J80U 3M8QB 4NYPA 5G0RA 4NX9A 4FKXA 3TA0A 2JJ4D 5AJ3J 4WZMA 3HJVA 2AGOA 4E98A 3FRYA 4N5SA 4NMXA 2VG7B 5KG1A 1B70B 4KHMA 5HO4A 3G4SS 4DPOA 1SUQB 2JEFA 4FYYB 1HNVB 2WBRA 4X4TA 1LNQA 1W2IA 1NUEA 4TY9A 1WKLA 3ETMA 4CWBA 4RNHA 1FNXH 4A8KA 4ZVFA 3KK1B 4JI3J 1HNWF 3C6UA 5C24A 2RIJA 1UCNA 3FBBA 4YB7A 2ERRA 2N3LA 2Y3YA 1RWOB 1NRKA 2E7WA 1RKIA 3D9BA 1VC5A 1YJTA 1J5EJ 3ZZZA 3N6MA 2R8IA 2KO1A 2HZVA 4ED6A 4LF4J 4WP3A 3HVTA 4DV4F 1YRTA 3TVKA 3UDVA 5JVGQ 1V3RA 1IBKF 1TFWA 2KJVA 3BSAA 2UVRA 3GV7B 1KKHA 1ZOTA 3NBPB 3IM8A 8ATCB 3JS9A 2ZH7A 3J7YI 5DG7A 4TLQA 3V6KA 1XNQF 5IZHA 1FD2A 3ILIA 3TZXA 2QZ8A 2VD3A 1ZPVA 3KDNA 4YFUA 2RQMA 3AXMA 4ZIVA 4ZVUB 1J5OB 2DHXA 3VGTA 3I4HX 3RAXA 3B4MA 5ETPA 1BQNB 2F4FA 1G4CA 5MLCV 3A8EA 3RRGA 2QA1A 2HHTA 1SKSA 1FRXA 4I6YA 1S4EA 2HLUA 5IT9U 5LT5A 2HNDA 2ASJA 3MOJB 2Z2YB 4F36A 4YB1P 3KJFB 4WK3A 1OS5A 3AOAA 3CB4A 3M8YA 1VQYA 4ZN3A 4EBCA 2HVEA 2BM1A 3T9NA 4JV5F 4EI2A 5ETNA 3QRPA 3SCJE 1IWAA 4FVCA 2RAQA 4A8WA 2BOAA 1X5TA 5G4DA 4PQAA 1MW7A 3Q8QB 1G2EA 1ZBTA 4R5PB 1NSPA 4OX8A 5F8IA 1H74A 4Y28C 1FJGF 5J2PB 3LUYA 1MG7A 4OX9F 2EFPA 4R8UB 3BYPA 3MM6B 2ZH8A 2XS5A 1IR1A 3R7SB 2V69A 2YNFB 3CCSS 2DNQA 3K59A 3EDQB 4LR9A 1I51B 2HQGA 5F0WA 3PNIA 1WF0A 3QNWB 4KH1B 2QX0A 4A46A 1ZZFA 3BPSP 2YX4A 2LP4A 1FWLA 2R7SA 4RW8B 1IJEB 1N36F 3TRGA 2HFNA 3Q0AA 2BE9B 3KLHA 2LEAA 3H98A 4BC9A 4L73A 1S1WB 3K0JA 2YWWA 4DR7J 3US5A 2GQ2A 4FKYA 1RWXB 4TY8A 1YHQS 2OTLS 3PW5A 4LF1A 4RWWA 1B0VA 4B02A 2BDPA 1H6KX 4C3KA 3ICLA 2HEKA 3LP0B 4O0NA 2UXDJ 3OV7A 3ELHA 1CC7A 4R25A 1N5YB 4RUAA 2E1MC 1HWKA 5A8KB 1DRZA 3QSIA 4ER8A 3CCZA 4LMZA 3UVJB 3WHIA 1HWLA 2ABYA 5HQ8A 3MD1A 2RKIB 1IQZA 1CQMA 2J76E 4PXDA 2KJWA 2RQ4A 3N01A 4B17A 3OVSA 3FFIB 3CMQA 3IRXA 4HI2A 3H5UA 4HH1A 2BW7A 2NXEA 2WOMB 2MXYA 2NS1B 1VMBA 2ZDPA 1PBUA 5GAEU 3JSRA 1HBMB 4B9TA 2H65B 4HEA9 3W63A 3QAUA 3B4DA 3I55S 4H4OB 2L3MA 1SC1B 3SXLA 2JC1A 1RHMB 2OPRA 3IN5A 4J9QA 3VCDA 2P9CA 1NDLA 2MZJA 3TUZC 2EKNA 1RYRA 2JSXA 2ZJQQ 1WSRA 4J9SA 1RHKB 2HQCA 5HQLA 4ECWA 1RT7A 1T9WA 2DRDA 2OEMA 1JX4A 3M6XA 3JSMB 2QC3A 2XWYA 5SUHA 1Y5NB 2X1FA 2XHCA 1R43A 2FJXA 5LJ5Y 2NYHA 3PVXA 2AJFE 4NASA 2FHJA 4TNOA 3GCXP 3GV8B 3PJ9A 2M3DA 2H48B 1KC8T 2FJAB 5KFUA 4JI8J 3AJDA 4RO0A 4HI1A 5L9XA 1LW2B 2AU0A 3K17A 2O5DA 3MPUB 4JI5J 4P72A 1HQ2A 3DOLB 4K4UA 3FMBA 3VGSA 1ZM9A 2V4JA 3QFHA 1YGYA 4EUVA 4NYZA 5AE3A 2OSRA 1CC8A 2OD4A 4O0IA 4G1IA 2EI5A 2XY6A 4DS5A 4N41A 3Q8RB 1EARA 4B9VA 2YNHA 4FXDA 3SI8A 1PBAA 1WSVA 1T9UA 5DQHA 2FGOA 3SQOP 3C19A 4FS1A 2V34A 4DJBA 1PAEX 2QLJB 3M30A 1YJRA 1S48A 3DRXA 3BQ2A 3UN3A 1TAUA 4A8OA 1M1HA 3GIIA 2HG4A 1WF2A 1FD8A 3V2UC 3C16B 4NLYA 2R8GA 2PGCA 1HI0P 2XY7A 1RAJA 1NPKA 5B09A 1NDCA 1FKOB 2PA8D 2JVRA 2AJ1A 3PFOA 1O8BA 3ILOA 5DZ7A 3BGRA 5KTQA 4WFNQ 2LXIA 3PIOQ 1T9XA 3EWGA 3IM9A 4YHHJ 2UUBJ 1HBUA 3OT9A 2E1CA 2HFOA 1X8DA 2F9DA 4OJGA 2PMZD 1D8ZA 4JB8B 3I9V9 1SJFA 4MYTA 1XMOJ 4IH6A 4KV8A 3RW6A 1U8WA 4QCLA 1WTBA 5M2RA 2R2SA 1H7WA 2QMUB 2YKNA 1IQTA 1HNXJ 1TK8A 3CJ5A 1Z1ZA 5J2MB 1TK5A 3WQPA 2CPDA 4X4PA 1IWGA 2N3OA 1X0FA 3MM8A 2RQKA 5D0GA 2UUTA 2CRLA 4NL5A 4QR2A 4MT1A 4AQYJ 4F50A 4AL7A 1WELA 3HJFA 3PM9A 2D41A 2WVEA 1PC5A 4YY3F 5KG5A 3ETOA 5GVQA 4ZITA 2MZSA 3IS9A 1VQ8S 3H0PA 4PG6A 3CDUA 5GAEI 4TQSA 2OUGA 3V4IA 4KRWA 3MI7X 3LQVA 1TL7A 2KHDA 2DXDA 2H5IB 3KWMA 4QWCA 1MWYA 3KLVA 2JEIA 2AP6A 3NXZA 1SXLA 1VISA 2RRBA 3SSQA 1Q8LA 1S6QB 1S99A 3SQGB 4KYZA 5B7WA 3FBFA 3P3DA 2F9JA 3DYAA 1HBNB 1S1TB 2CQ4A 2W25A 4RW4A 4P75A 1V9OA 2BABA 5B0EA 4IFYA 2R7OA 4K4XA 1RADB 2DHHA 4CLYA 3UE2A 2YQ3A 4RNOA 3OTOF 3HD1A 2NXCA 2BUNA 1TKTA 4CTAB 3HFKA 1RAIB 4USKA 3FEYB 1UJ4A 3KMSA 4DEZA 2B51A 3LPYA 2ZVIA 1U1OA 4HTJA 1V5VA 3FJ2A 4I7FA 5DLFA 5E3QA 2CJ9A 4C11B 4MKVA 3BQ1A 2Y8WA 1NHUA 4F2SA 3PW7A 3D67A 2WVBA 5HATA 3CSKA 1M90T 5GMEA 2XMTA 2M5YA 3N6NA 4O23A 2RSQA 4X64F 2M88A 5KFNA 2O3DA 2VJUA 2QA2A 5AXLA 2DO4A 2ROPA 4Y6IA 4G3IA 2DGXA 3RW7A 1FHTA 1C1CA 1RHRB 5KG2A 1REGX 2DHAA 1GTHA 4U6PA 3VTIA 5D4LA 2R3VA 2ATCB 2CPYA 2ZBQA 1Z2ZA 4IH5A 2MHEA 3OJUA 2XB2D 4Q7AA 3MM9A 4LF2A 1U4BA 4FPIA 3GPAA 3O3LA 2RDJA 1U48A 2GVZB 3HZEA 4DZ6A 1R7IA 5FDLA 4UOCA 4P2FA 1JLBB 4QWBA 3IRWP 3PX0A 5J2QB 2V94A 5F9NA 2VG7A 1OQ6A 4FN5A 1JNZB 2J7UA 2IY5B 2NPIA 2RUSA 2CVEA 2KT3A 1SUQA 2XHWA 4Y3CA 2W8LA 3OTDA 1GMVA 1OY9A 2CQHA 4V19J 2J0WA 2V5HG 2DNHA 2IIHA 3IR7B 2V68A 1YBAA 5I3UB 4ZPCA 3JQMA 1F5BA 1U09A 2ZBPA 2CUYA 1XJWB 3Q8VA 2ASLA 2ASYA 4HHJA 3PDNA 4OI2A 2MLZA 2EC0A 1FRMA 2GV1A 1NXIA 1HNWJ 2AYMA 4WJBA 4OYPA 3TWZA 4DG1B 4ENOA 4K4ZA 1MN9A 1RT6B 3L09A 3D4JA 3I0SB 4FZVA 2KFNA 3V5RA 4DV4J 1X4BA 1VRUB 1RTJB 2CPIA 5M2UA 5DDPC 4PG5A 4OZ5A 3DLJA 2GCFA 3J81Y 2ZH2A 3SIPB 2V2VA 1F9EB 3W5XA 4USVA 2C2EA 4HL9A 4O44A 4DV0J 2AYEA 4ZKAA 3OSNA 3DLHA 3HM9A 1VQNS 2G1HA 3QBCA 2VA3A 1WEYA 4QWDA 2NXNA 1WACA 4DV6J 3RBZA 1S10A 4F25A 3WIUA 3MMAB 5F8HA 4XO0A 3OL7A 2HMIB 3HHLB 4DUYJ 1SKUB 2EPIA 2R9LA 2CQIA 3KNGA 1U47A 2QN6B 4R5PA 5KFMA 3PTWA 4HHHA 4DF8A 5IT4A 2FUG9 3SCLE 1L3VA 4ZVOB 1NBEB 2X3DA 1ZA1B 3QIDA 2FVCA 3CD5A 4R8UA 1AB8A 4DDFA 1XBWA 2HHQA 2UUCJ 2CWKA 3DMJB 2MSSA 2YNFA 4WTOB 4L6V3 3QGHA 4A8MP 4DCPB 3DGVA 4GC6A 2QSWA 5D15A 4ES1A 1WJ9A 2FYXA 2Z57B 4I2QB 2YQ1A 3J7Z5 1FJGJ 5EHHA 4OX9J 1B3TA 4J5OA 1NK8A 5CYMA 2B9XA 4LR7A 1L3UA 2M52A 4WP9A 4J7CA 1PSDA 2W4DA 1ZAXA 5KT4A 2YX1A 2OGUA 2KYXA 2NXUA 3B82A 3GFYA 3JSYA 4I6AA 1H2UX 4ECZA 4K7QA 3BO4A 3LP0A 1CVJA 5KFKA 4I0WA 3IAS9 1LXJA 1N36J 1NB7A 5A8KA 2RQCA 3P45B 1P1TA 4LFCF 2R42A 1B64A 3UVJA 4CO4A 1S6UA 4I2PB 1KDNA 1UFKA 3AD7C 2LDIA 2RKIA 1L5UA 2UUWA 3CCES 3T5LA 1YLXA 2RRAA 1KN6A 3ZTOA 4OZLA 3TQ1A 2XM3A 3S6EA 3AJ2A 4DUTA 3DLEA 1H72C 4ELUA 3CNQP 4ED3A 1Y7PA 1UW9A 1RJJA 1HBMA 4H4OA 2QFIA 1UVNA 3QRRA 2M70A 2R2TA 3M7VA 4ZCKA 1P1LA 2A2CA 3UNYA 2IDLA 1IXKA 2F4VF 2ZNZA 1T3OA 4OLOA 3KLGA 3VAMA 2LEBA 5DDQC 3HULA 2DCUB 4GMKA 2KXNB 2X51A 2HRYA 1XC9A 3OR1B 3G82B 3HLUA 1BLUA 1JLAB 3LANA 1BUXA 1DBDA 3PJXA 3ILLA 3HMJG 1HYSB 1RCXB 3PZPA 1U0SA 1SL1A 2DJWA 1S9EB 4UOGA 4I1TA 3R2CJ 2O01C 2QEXS 1VQ4S 2CFXA 4WE1A 1RT2A 2ZHBA 2DGWA 3BJYA 1ULRA 4URSA 2GZOA 3W64A 2BANA 2HS0A 1G7CB 3W5ZA 2XLKA 3TZYA 3WZ0A 1HIYA 5CYQB 1DLOB 3ITHA 5FJ4A 4MMOA 4CO3A 3DOLA 3SSSA 2GS8A 4RU2A 3W9HA 1Q5VA 1QD1A 2HNYB 4CLKA 1LWCA 4I67A 3CJKA 2IM0A 2CNNB 1Q95G 1RTHB 4JOUA 3VAJA 7FD1A 2BACA 2FY1A 3H2VE 4XK8C 1VQ5S 4WIQA 3TR5A 2PI5A 3W3SA 2EG1A 1NJYA 1CQNA 1VGYA 3GG1A 2YKPA 1NK5A 2IAJB 1S72S 3L4BC 2CQBA 3RJMB 4RZRA 3G87A 3SYZA 2CPXA 4DR1F 4E8UA 1DQ8A 3GILA 3O6QA 1S6PB 5A6WA 3VALA 4B3MF 4FP9A 4UZCA 3DRPA 3C16A 3U02A 1HPZB 2EK6A 1JJ2R 4RX6A 3G8SA 4OV1A 2RH3A 5F8MA 2QLFB 4ELVA 2ADCA 1VDHA 3W2WB 3OW2R 3DXBA 1Y9OA 4CLPA 3R97A 3AOBA 3EJMA 2VOOA 4LREA 2GVDB 1UEUA 2OIHA 3KLEB 4WKRA 2CWXA 3DI6B 1NK0A 2V9KA 2WRMA 3J81U 2JVOA 2VBXA 2DR8A 1M5SA 1NJZA 4UT4A 4ECYA 5HROA 4AD6A 4ZP7A 2JLFA 4KB7A 2EBEA 1SH3A 3RR8A 1NU4A 2YBVA 3LPEA 2VKRA 1WKKA 4BC7A 1RACB 1MROB 3K2YA 2YNGA 5EN1A 3OLBA 1GFWB 4QIWD 1DHMA 4PG8A 4ILMA 1AW0A 3BN4A 1ZPWX 3D2WA 5EGYA 3ENAA 3L7OA 2MJUA 4J90A 2ZBCA 4ZVQB 3HT3A 4MK9A 4RW6A 4DV2J 1UEVA 1TK0A 3MCOA 2ADBA 3TX0A 2DPJA 1YJNS 3FK4A 2OKQA 3DRSB 4B3TF 2P2CB 4PXEA 4EZ6A 4DMZA 4ERDA 4F4XA 2MYFA 3NEKA 2LQJA 1X5SA 2XNQA 1NMEB 1RAOA 1QAYA 3ZXWA 4LFAF 3M2UB 2ZKTA 2QFJA 2OAUA 3OTCA 1C0TB 4JI1J 4ZPTR 1K1QA 3CT9A 4HKQA 4OJHA 2BW2A 5KFGA 2IPOB 3POTB 1EX8A 4YY3J 4DFKA 4LVNP 3KYLA 4OLPA 3BSOA 3MPVA 2VOPA 4NLTA 3GSDA 4PABA 5E33A 3K8WA 1RHJB 4DV5F 2DRAA 2GW8A 1SQGA 3SQGA 2RRNA 1HBNA 3OR2A 1S1TA 3CO9A 1T05A 4U7CA 3R6LB 5LL6d 3QZ8A 3AJ1A 3FDSA 2KM8B 4H54A 4IRCA 3SEOA 3VVTA 3ZC4A 4F0KA 3GR1A 1A7GE 2EKYA 2R7RA 4S0MA 2DTJA 3FZBA 1YRUA 1O6XA 1JB0C 3HVAA 1Y5LB 4FYWB 4M5MA 4WFYA 4A8FA 4RLEA 5ADZA 3ET6B 4M5JA 1N4LA 3Q8YA 3DFEA 4IYQA 1VK3A 3OTOJ 2DRBA 3WX8A 4X4UA 4DL7A 1FRKA 1UJ6A 5K5MA 1BWVA 3R2DJ 2QV6A 2MQOA 3DN9A 2ASDA 1RT5A 3Q86A 2J8SA 3DOMA 2OI2A 4EMDA 1G1XA 3OXFA 2MTLA 2J5AA 3MMCB 2IMOA 3MMJA 4OYBA 4CLUA 1N88A 2HIQA 2AQ4A 2AEMA 2I0XA 3ENWA 3H8YA 4X64J 3TZZA 1BQXA 3NS5A 4WFAQ 1H38A 1NK9A 1FX2A 5F8GA 2HNZB 3NAIA 1P8GA 4U9RA 5HK4A 4AUKA 4F0MA 2XO7A 3FMWA 2KKHA 1X4CA 3BBCA 3JQKA 3NLCA 4Y65A 2Y1RI 4USIA 4QU7A 2PT0A 2U1AA 5KG0A 5KFYA 4TLRA 4IOAQ 2GAGC 3EUNA 3ZTRA 1YG0A 4MFBA 2GHVC 2XWXA 4KGMA 3C6TB 6FD1A 3A3OB 4XTTA 4UY8T 2VODA 3CUNA 2X1GA 4RW9B 1N33F 1Q0NA 4C0HA 5DGBA 5L8RC 2PFFB 1LWXA 1S0MA 1NKCA 2O67A 3LAKA 1OSCA 2V8HA 3KDOA 2FJDB 4NZ0A 1JLEB 2R2RA 3CJQA 4Q5VA 1HLWA 4TVAB 4DSLA 3THPA 2UXCF 1YDLA 1IKVA 5HN0A 4CQ1A 3CCUS 4OX6A 4GKKF 2AMCB 4W90B 4AL5A 2CNOB 2ILYA 1KQSR 1T9TA 1JLQA 3EZOA 3MFHA 4DU7A 1TR0A 1QE1A 4CM0A 3PEJA 3C2PA 3KG1A 5LXYA 3QWUA 3KG4A 1RT6A 5I3QA 3GCWP 2WCXA 3E51A 3KMQA 1WOSA 1UVLA 4PWDB 1RYSA 2R7WA 2CQ0A 3VR1A 1JKHB 2FLNA 4ANCA 4KT0C 4H4KC 3V6JA 1WEZA 2DISA 2K2PA 2VFSA 3RBDA 3JQJA 1UW4A 2DH7A 3QFWA 3DXSX 1CJTB 2XBPA 3PV8A 4Q0BA 1RB0A 1S76D 4OI0A 1RTIB 4G6VB 3HT0A 2LLZA 4UQTA 1FRJA 1U6BA 1HNIB 1FA0A 2G2YA 4ZMMA 1FVQA 2WW4A 5IWAJ 2QSFA 3MMAA 4TU9A 3D0IE 2Y0BB 4NXMF 4G1QA 1RGVA 3I31A 1EQ0A 4ED0A 4F2RA 2WAQD 4ZVGA 4F3QA 2FHKA 2HHWA 1RTDA 3M32B 4ZOSA 1CS4A 3HCXA 4N77A 4Y2MA 3V6DB 3A8IA 3MFIA 4P7TA 1SPBP 1JLCA 5HMYA 4IO1A 5IQQA 3ISND 2W01A 2BMBA 2FD2A 2CKWA 3W65A 3WC0A 4I2QA 1V5IB 5AJ3F 4NCBA 2IVMA 4NLDA 4IG0B 4PRFA 4OYZA 4OX7A 3ILJA 2AW0A 2CQDA 2CJBA 1VS3A 3TZWA 2D9PA 3KTQA 3TVYA 1RHQB 2CJQA 4P71A 1PIEA 3R5GA 3KJVB 1P27B 1N34F 4K5SA 4ZPWR 3FSYA 3PX6A 4ED7A 3O8WA 2XZTB 1TUWA 4BHQA 1TKXA 4YN3B 4JI2J 4H4MB 3RB4A 1M5HA 1S1VA 4FPRA 2CAJA 1D1UA 1J5EF 2WONA 3OD2A 2ZDOA 2VQFF 2ZKUA 3CVKA 5HLFA 5D4PA 1EETA 8AT1B 4ECVA 4PUOB 1S97A 1F3FA 4M5KA 4LFCJ 4CNYA 3H2UB 1J27A 5LJ3Y 1WOPA 3D0HE 1T02A 5ETOA 1F9FA 2MLXA 3QT7A 5LSOA 4JV0A 3UCGA 2FJVA 3GMGA 3Q8UA 5M2PA 5ETVA 1N6QA 2HK2A 4BDPA 4LRFA 1EQMA 4Y00A 2ACMA 2Q6BA 4LT6A 2E5IA 1RZMA 1M5PC 2YNIA 3OTEA 3VAKA 4E2FB 3TUIC 4DN9A 4JI6F 2ZUAA 1VBYA 3C14B 3NOCA 3AD8C 1YJ7A 2B8QA 2I38A 2XI3A 1FI4A 1YSJA 1U1RA 3OHAA 4N8NA 4J91A 3NL0A 4F4YA 2R7VA 3CJTA 1K1SA 4YB6A 2HS3A 4WXWA 2A6OA 3MAQA 2F4VJ 3P5BP 3DHXA 3W8PA 3DU5A 4EGLA 1O0PA 3BEGB 4N56A 1X7VA 5E7OB 2ZD1B 1WG5A 4IDKA 2Z2ZA 1PAUB 4QWAA 2BEFA 2RU9A 2FC9A 1GAOA 3CJ8A 1U25A 1LWFB 2RF2B 5B0CA 4QW9A 2ZOMA 1GEHA 1KVKA 3AY0A 3VGUA 3MMBA 5L39A 3P96A 1NSKL 3KXDA 1WUUA 3MEDA 4WPAA 3C8YA 1FKPB 3F0NA 3C46A 1P9YA 1RTHA 1VRQC 2V50A 1BQMA 4WIIA 1H0HB 4YR3A 2VG6B 2QGFB 3IBFB 4DR6F 1HMVA 1UKUA 4Z37A 4O3SA 2X7IA 2XYHB 1VQ7S 2QYCA 4LSNB 3T5JA 2VQEF 1X31C 5ETTA 1HR0F 1Q8BA 4OZJA 3TUJC 3SDEB 2CZ4A 3MAHA 4OZ2A 3PY8A 4C7QA 4RNFA 4DR7F 3IFEA 1CBKA 3LO3A 4O4GB 3LP1A 1NLKL 2QJ3A 4ED1A 3HPOA 2MZTA 1DQ9A 1T94A 1VQLS 3BQ0A 4DR1J 4NXNJ 1S1XB 1XERA 5L1IA 1X0PA 3L3CA 4ECQA 3M8PB 4MH8A 3OHBA 2YQ0A 2GVDA 1LWEB 4KKOB 3KLEA 1RT1A 2HVDA 2AIRB 4OZ3A 3QGPA 1SJRA 2VZ9A 2KU7A 1R0AB 1ICEB 2VPYB 4LIWA 5KAKA 3MUVP 4JP8A 3FCVA 2NREA 4DV7J 3H40A 1MROA 5F8LA 4DFPA 3PR5B 1Q7YT 5C7PA 3ZTQA 2NLWA 4KPYA 1VC6A 1HHQA 5FIIA 1RWPB 4ZJQA 2OJ3A 4HACA 4GVBB 4P9SA 2MGZB 2LFVA 2JC0A 2CPJA 1NEEA 1WI8A 1QTNB 4FXVA 2PIIA 2KG0A 3I0RA 4FBUA 2LXUA 1YWXA 1XN9A 2EFGA 1NDPA 4UZBA 3OFFA 4CO5A 2XULA 1TFYA 1LK5A 2EEYA 1MSWD 3TJ8A 2ZC4A 3GP9A 1REVB 4P2XA 1VQ6S 3M2UA 1NZAA 4A8QA 4ID5B 2BJ9A 2XC9A 4FF3A 4B3TJ 3FCWA 1TL3A 1NB2A 1MWZA 1RT4B 3MR2A 4IOCQ 4FYVB 6FDRA 3M8SA 4LFAJ 4L3KA 4JI8F 5J2NA 3BPDA 4ZK7M 3FSIA 2OTJS 2Q66A 1RKJA 1RSCA 3IWXA 4JI5F 2VBYA 3N9UC 2ZE2A 2FLPA 2PEHA 2W24A 5T7LB 2BBEA 3UD3P 5DO2A 1WDTA 3MR6A 3RR7A 4CDIA 5JMNA 3UPFA 3PKMA 4NI2B 3N5FA 3C3LA 3HVRA 2IRYA 4DV5J 2J6TA 3V4MA 1RUSA 2XGPA 2YPZA 4QW8A 5HAOA 5J1NA 2BRLA 3TVZA 1RWUA 3CE8A 2KT2A 1I3OB 3SZ2A 2DY1A 4C48A 1FO1A 1U2CA 2D9OA 3BV8A 4EBDA 4DUZF 1TAQA 2IFXA 1FRHA 5HBMB 1KFDA 4CH1A 3A3NB 5LXRA 2G9OA 2LQBA 2HWHA 1YITS 3TAMB 3A3PB 4ZPBA 4ZLNA 4ZCMA 1TQLA 4OI6A 5BYQA 4ANDA 4C4WA 3N4WA 2HHSA 4F8RA 2I5JB 3JTOA 2UUBF 2V67A 1QAIA 1U6FA 1W25A 1VQKS 2UUAF 3IP0A 4NPOA 4P7VA 1RAEB 1GXTA 4ZLLA 1AUSL 2KG1A 1XMOF 1VYAA 3QO9A 4OHZA 2XQCA 1FK9B 3NOGA 5CZVA 4QR1A 1U2RA 2W9AA 4U8YA 2WVCA 3ISNC 4OQJA 3MAAB 5HANA 4ZP9A 2RDDA 1DFDA 1S1UB 3KHGA 4B3OB 4DQIA 4RW9A 2LU2A 4RW7B 4ECSA 2DGTA 1UTAA 3IR6B 4ATNA 4AQYF 4U96A 2X1AA 2QL5B 1NO8A 3RU0A 4LF7F 3GB0A 3D68A 1YQHA 1OWXA 1AFIA 4IKAA 4NCGA 5JXSA 7FDRA 3M1VB 2FZKB 4DR5J 3KK2A 1EB0A 1N33J 3U27A 1IBLF 2OHDA 2Z0GA 2HBZB 4DL5A 3Q23A 3K89A 1BGXT 3D3CJ 2IM3A 2V63A 1CULB 1HA1A 4E0DA 5FLXU 2OPQB 1R6VA 1AROP 1PCAA 2RT3A 1XWLA 3CCVS 2LDYA 2GMHA 2UXCJ 3CW2C 4IFVA 1UWBA 1HFEL 3TEGA 3QZ7A 4GKKJ 1N0UA 3BZQA 2OEJA 1VQOS 1RE1B 4ZHRB 3CTRA 5DM7Q 2BJEA 4ZCIA 4OZ0A 3UFCX 4PWDA 2FZCB 2WHOA 3BSCA 3IR5B 4X4SA 2QL7B 3I5BA 1UA0A 3BSNA 4CNZA 4C8ZA 2XCAA 2C42A 4IG3A 2K7JA 5A2QY 3OL6A 2ZM6J 3R27A 1JJCB 1U1KA 1FXRA 1U0HB 1IKXB 1JIHA 4MJKA 1UAWA 4ZVTB 2EK1A 2CNLB 3H7HB 2WB1D 3PFEA 4F02A 1NNDA 3EZUA 1RCOB 4ZJOA 1HNIA 3CCTA 4P73A 5THWA 3BR8A 5KFQA 2DK2A 2E7VA 3HSGA 2CDQA 1KLNA 3Q83A 2A0FB 3MWBA 4KGVB 2FVSA 5L9NA 1B0TA 2HQ3A 1TV6B 1H98A 4JV2A 5E2QA 3TARA 3SV4A 1RBOB 5A6PA 2NUHA 2AX0A 1D8YA 1HQUB 3TP2A 2CQPA 2O1PA 4AT1B 2CIMA 4KR0B 4ICLB 5K8OA 2ZH5A 3TANA 3P4UB 3UR3C 1HNZJ 4NXMJ 3ZZ0A 1S49A 3L7UA 2BZ2A 1QDUB 4DPTA 1RXOB 1U1PA 3X1LB 3KFWX 4DI6A 4V1Ak 2B9WA 4F4KA 4LR8A 1OY6A 5GAGU 3MPDA 4JI0J 3NCQA 1Y0HA 1QSYA 3EVWA 2BJ7A 2C2MB 2GO8A 5E3PA 4EO6A 5HVHA 3GIJA 1N0VC 3KLFA 4HDHA 4USJC 4KFBA 3EPIA 4I69A 3MEKA 2P5VA 3OFHA 3PRBA 2XG8A 2ZEJA 4CLFA 1UZHA 2YTCA 3KK3B 5DG8A 3HFZB 1O51A 4Q44A 2B4UA 1OYDA 4H4MA 5HMXA 3AH6A 1TKZB 4DL0C 1N34J 4KO0B 4JV1A 4DX5A 1TL1A 1APSA 4OFZA 2KRBA 4M95A 1B0PA 3VF0B 1JLGA 1Q78A 1SJ3P 2Z8QA 4BWMA 4PUOA 2XNRA 3MM7A 4CLSA 4FNHA 4UTGA 2Q1LA 2C2OB 5CAAA 2I9SA 4ZA1A 4V19X 1FX4A 3KUHA 2WVFA 3CMES 3UR0A 2VQFJ 4Z7CA 4ALZA 5KG7A 3HO1A 3D3BJ 1UVJA 2XSJA 5IS2A 4BWJA 5F3ZA 2LCWA 3F41A 1RAFB 3U1NA 2UV8G 3MM5A 2GX8A 3QT8A 1P6TA 3H59A 3DGPA 4UUWA 5D78A 2C2ZB 1TELA 4M5GA 1EZZB 1YJUA 1IBMF 2GNKA 4DV0F 3PYFA 4ZIWA 2AZ1A 1S7IA 3MR3A 1KS2A 1PJ6A 3VAGA 1FJCA 1TU0B 5E41A 3D7SB 4DV6F 2PEBA 5IQ6A 4JI6J 3AODA 3OVAA 4TN2A 1HL6A 1S0OA 5HMWA 4K2JA 1KTVA 1LFPA 4DUYF 2QL9B 2Y1JA 3P6YC 1LWFA 2FGCA 3F44A 1CJKB 3I96A 4OL8A 3BH7B 2PE8A 3R5JB 2YVSA 3H5XA 4DX7A 2W2QP 2FDNA 1K44A 2IC3A 2F65A 4I64A 4ITSA 3H90A 1FKPA 2OPPB 2MZ1A 3E01A 3GYNA 3M2VB 2UUCF 1F9HA 2B56A 3MPYA 3IAM9 4NRTA 4PCQA 1DTTB 4X4VA 5EWEA 3H2LA 4RBTA 1CG2A 3BREA 2R7TA 3M6VA 1L3TA 1YZ7A 1GT8A 2YX7A 2E1PA 4OYIA 2PMWA 2EFQA 3RB0A 1SJ4P 3LF0A 4DR6J 5GMDA 4OZ1A 1AZSA 4JUZA 4Y2IA 2KB2A 2IBOA 2VQEJ 3EPGA 4ZS6A 4CM2A 2Y0SD 1IKYA 2EFVA 4AFFA 4C2MA 1HR0J 3FNNA 3MUTP 2JLEA 2JEJA 2VFVA 2E5HA 2QYGA 1JXLA 3AQOA 1TVRB 4A8YA 2ROEA 1VQPS 5GAGI 1VLYA 4DL2A 2B4VA 2W4PA 2PSZA 3M8PA 2POKA 1LWEA 2DR9A 4KKOA 3UNGC 5A2QU 2V4QA 1FKAF 3UD5A 1GMUA 2B5JA 3L9ZA 4TXSA 2KVIA 5EWFA 3CDEA 5E0OA 1N32F 3TAPA 3PHTA 4DPYA 4NLGA 1PJ5A 5RUBA 2QA4G 2W9CA 4DS4A 3R1LA 5KT2A 4UY85 2AYGA 3CJSA 2F8EX 4F26A 3AXKA 3BBFA 4O3QA 2M7SA 3EYZA 2F63A 2V8PA 4X4RA 1AUDA 1B4SA 4GVBA 2F5GA 2HYIB 3PYDA 4YB5A 3R6GB 1FFWB 1HHSA 1TL5A 1IM4A 3ZTPA 4X66J 1DQAA 4K4WA 3HVTB 2H4YB 3FGVA 3QSYB 5LSRA 3EMTA 3HHEA 1UZDA 4USWA 2N7CA 4NLXA 5KOXA 4C8NA 3R7NB 5L1KA 1REVA 4IQMA 4ANEA 1X4DA 2AGPA 4MYUA 4ID5A 1RAAB 3KUGA 3FSXA 2KXHA 1GQEA 2ZH9A 3Q89A 1HWUA 3VAFA 4QWEA 5BR8F 4B3SJ 2UZAA 2MQLA 1JJ4A 3G6VA 1KLMA 2DBBA 2UVVA 5KFVA 2L9NA 1MMNA 4CLTA 4DSFA 4OHYA 3QIPA 3MD3A 3PJWA 1KBRA 3SCKE 2VF3A 2FQQB 2XMWA 3CXCR 1WC3A 2OO4A 4Q45A 1AA1B 3ENQA 4G65A 2ZHOA 2XY5A 2MZQA 4GKJJ 5D4NA 2QMXA 3I4PA 2HZCA 1GNKA 2CNKB 1SVDA 2V6AA 4RR5A 2HNDB 3IG1A 4NWBA 3O5TB 4LRAA 4NRUA 2F3JA 5B0DA 4JYAF 5KFSA 5CABA 2A1BA 4ILLA 2FLLA 2YXLA 4DQSA 2M4MA 2WBMA 4PPZA 2XEXA 3BBBA 5JVHQ 3W2VA 3I5CA 1LEOA 3SBMA 2DNOA 2U2FA 1SL0A 2HQFA 3RB3A 3NKYA 4PG4A 2B9EA 3HHDA 4HVZA 2ZVSA 1FJ7A 1TZ0A 4M5NA 1HD0A 2EW9A 3HDSA 2PI4A 2B7CB 2L9WA 3B54A 1HI1A 4L74A 1UA1A 2Z30B 3T5HA 3UQSA 5KFTA 3IO1A 4DUZJ 1S9GB 1M5KC 3OSPA 5A8WB 4B3RJ 2IDEA 3HZGA 3I82A 2G0CA 3J7A1 4PPDA 4XIUA 2MQ8A 1WTFA 4FF1A 2DHGA 5KFCA 4PEOA 2KZMA 4Z2XA 4ECRA 4TY8B 4CYUA 3IWLA 4LRBA 4HT5A 2VBWA 5AXMA 2DNKA 1FK9A 5U47A 5HP1A 1RAGB 5AXNA 2DD8S 1VJWA 3M2RB 2E5JA 2HS4A 2UUAJ 4DV2F 1S1UA 3NP5A 2OEKA 2QLBB 1QTMA 4KPCA 3LGHA 2QA4S 3E8OA 1FTCA 4B9UA 1W2BR 3X3UA 2NUUG 3BR9A 3FQLA 3H4BA 1C4AA 3IRXB 2V2QA 4ECXA 2DITA 5I3PA 1SC3B 5A76A 1XMBA 2IRUA 3Q8PB 3DRRA 4QOTA 1Q8IA 4A48A 4B9LA 3GQCA 7AT1B 1RISA 1Y3JA 5L1LA 1KTQA 4JI1F 2CXEA 4WZQA 2OPRB 4K4SA 3CDWA 4LF7J 2FJEB 5IFMA 2J7KA 2RMLA 2OPQA 3M05A 2COLA 3JAMY 4DQQA 4C8LA 4ED8A 2HW3A 3PW4A 3LP2A 1RT7B 4LSLA 1IBLJ 3OTBA 3O1LA 2D3ZA 2DEIA 3QATA 4I68A 2DXEA 3EGZA 1ZA2B 1I6JA 4LF6F 2M0GB 4NYOA 3M8RA 5T14A 1T8EA 5B0BA 2YKMA 1URRA 3O44A 1SV5B 3J80Y 2R8HA 1KOOA 1C1BB 5D4OA 3CCRS 5D3GA 1HKAA 3VQTA 2P8IA 2C3PA 4KC5A 4ZVRB 1Y3KA 3FKBA 1XEZA 3MEGA 4EYHB 1YZ6A 2KYZA 2R7QA 5ETSA 3ISZA 4I56A 4X65J 4IOBA 2V4JB 4M5DB 1HQEA 2JRSA 4ZPDA 3QJLA 3CJ2A 1RI7A 4K0KF 5KFEA 3GG0A 4I6WA 2PMHA 4O3NA 2CPZA 2LKZA 3NNHA 2GJ2A 1KOHA 1PKUA 2AEJA 3MECB 6AT1B 2YNHB 3GLJA 3VHQA 1GK8A 4USHA 1VC0A 1PYTA 5DRKA 4WFZA 5HJYA 4KE5A 1JK9B 1NZ8A 3M30B 1HQUA 4KHPF 4DPUA 4ICLA 4NMLA 2ZBIA 2EC2A 2HGNA 3NGSA 1PG5B 2OPSA 3KOAA 1AFJA 2BE2B 3MCSA 4LF9F 3W8GA 1ZAVA 3VAIA 1RP5A 4WKYA 2EFNA 4PR6A 1R0CB 3GTYX 2AJ0A 3BGRB 2HBRB 4Z7YA 4LRCA 1FERA 1RHUB 5IV4A 3NGRA 1VJQA 2KHCA 4L76A 2M2BA 1HBUB 1VRTA 3M8QA 4EWTA 1X9MA 1HARA 8RUCA 3EVOA 2YY3A 1YX2A 2H9ZA 1FESA 1FDNA 2MLYA 1F2GA 2BX6A 4ZP8A 1X4EA 3MTJA 1JXVA 5KG3A 4PG7A 2H1YA 2YKNB 3ENVA 1HNVA 1FF2A 4OI4A 2BR0A 3MM8B 3TI0A 2DNGA 3I6PA 4J9PA 1LKZA 4USMA 2M8DB 1SQFA 3KK1A 2HAFA 4HYKA 1NHVA 2NSCA 3H5YA 4GC7A 2DCLA 3AB2B 4DSJA 2AT1B 3BO2A 3G2XA 2WSEC 4JBCA 2CG8A 2KZZA 2HWIA 1NK7A 3M9MB 1JQGA 1NH7A 2I8EA 5KFWA 4I4BA 1KQKA 4U7UK 1MMLA 2B8PA 3D5MA 1SKWA 2Z4PA 4DQRA 3GIKA 3PG9A 3V4IB 3HP6A 2NYIA 1VI7A 4YS2A 2AEFA 2QT7A 1NAQA 3LH2S 1CJUB 1RA6A 2FVPA 3NBPA 1R8HA 1NKEA 1N5QA 4QBUA 1JWWA 2OFGX 3KNAA 3DKDA 4OYOA 3DYAB 3FCHA 4Q8EA 3N0VA 4MIBA 3OPKA 3EXYA 4DV3J 1J5OA 2C2NA 2BA9A 4IFYB 3IBWA 2UVUA 1BQNA 2LVWA 5IWAF 2BKPA 1KVJA 1IBMJ 4Q2MA 1MMDA 2I6WA 4MTPA 4EBEA 2MY8A 3NG8A 2GHPA 2VDIA 3EGVA 4I7FB 4DN0A 4MKBA 4GO7X 1NCLA 1HWIA 3IGVA 3DNCA 3RB6A 4U7UD 3KUEA 4CO2A 2VG5B 4YR0A 2ZHAA 2B6AB 3T41A 3FVYA 2M9KA 4U8VA 1DTTA 4LVOP 4DQPA 5J2PA 3A12A 3GONA 1YI2S 3NGTA 2MKHA 3JAMU 3MM6A 5KFOA 1EIYB 1VIXA 2HFSA 4F7VA 2KT5A 5H9EK 2P9EA 1ZTTA 2Z2MA 3ONQA 4ZVEA 3CIMA 3P5TL 5ETMA 1SQEA 1KP6A 1V3SA 3UO0A 5KFLA 2XO6A 4X62F 2IYGA 4FVMA 3M6UA 2E9TA 3G6XA 1G3OA 3GIRA 1Q53A 4KTQA 4IR9A 3HHLD 3H25A 3AD9C 4RW8A 1UFLA 5FDLB 3K57A 3R9LA 4JI2F 2R4FA 1KHWA 1S1WA 1SKRA 2FZGB 1VK8A 4LBHA 2G4BA 3GWCA 1JLFB 2VV5A 3EDRB 4GVLA 2LMIA 4ED2A 1F5CA 1N5YA 2F40A 5IOLA 4Y2CA 4C97A 1BXNA 4CO0A 2E66A 2NCKL 4LFBF 4J9LA 3B6BA 2VU5A 1F2HA 1EAYC 2F8HA 1AYEA 2C2DA 2K3KA 3U1LA 3ZO7A 1N32J 2BVZA 1VHFA 3A8KA 2OMOA 1S4FA 3FFIA 4DZDA 5KFDA 1TP7A 1WD6A 1T95A 4Y2KA 3W7BA 1IN0A 2W7AA 1R8BA 2N4DA 2JL9A 2WOMA 1Q16B 3MF5A 3O2IA 3M9NB 4RUHA 2ZUGA 2DH8A 3DLGB 1I94J 5H9EJ 3GU0A 1U1LA 5KFPA 4J37A 2KFYA 3H42A 3K5PA 2R7UA 2OH2A 1KNZA 2Y9HA 2JX2A 3W5YA 3CEDA 4LJMA 3JSMA 3PCOB 1NJXA 4YQWA 1R3NA 1PYSB 3K5OA 3JYTB 1IM6A 1ZM4A 4DXLA 5DM6Q 4O44B 2VL1A 5BR8J 3AOCA 1WOOA 4WTYA 2CADA 2ZZNA 3BKFA 1RWMB 4UOHA 4M8LA 3AT1B 3BF4A 3PR4A 3IC1A 1ZM3A 2F1FA 1LW2A 4CIOA 4RJVA 4PZVA 4LF8F 4C0BA 4MIAA 4NA1A 2JNJA 3RUBL 2O66A 1Q1KA 4NLSA 5E5NA 4FXWA 1AT1B 4ECUA 4D3HA 4K4VA 2HVIA 2FJWA 4PYDA 3IGNA 3T9ZA 3OL9A 4DPXA 3PXGa 2C2KB 4FNIA 2L41A 5LM7E 4JYAJ 3GJTB 1S57A 2MKJA 3R3TA 2ILZA 1RABB 1QSSA 5EUHA 2XS2A 2UXBJ 2GAHC 3NY0A 4W98A 4Q8FA 2VDHA 2XZWA 2KVQE 3ZNUA 2NZCA 1SB6A 1K73T 4NXNF 2B0GA 1LXNA 2L9DA 2N82B 3P8BB 1S9GA 1DAXA 5KFIA 5A8WA 2HQDA 5CYMB 4DOZA 1QUPA 2AX1A 2ACYA 2XYGB 3NGKA 1KHVA 2DB1A 2I2YA 1C0UB 4JI7J 5AE1A 3TX8A 1UPMB 5BYRA 1YJ9S 1FKOA 3A8JA 1FTRA 3SCIE 2HHHF 1GMWD 2RNEA 4DV7F 4FS2A 1RWWB 4J9VA 2IRXA 2KTQA 2RS8A 5DZ6A 3FQKA 4LBIA 2B4OA 4DX8H 3M2RA 2VICA 2VB6A 4L75A 3R7BB 4B9SA 4C9DA 4QYRA 2B9YA 4F3OA 1GTEA 3PYGA 2PDAA 2UU9J 1U2FA 4YOEA 4ETZA 1UFWA 4DL6A 1K9MT 3R5BA 4CRJA 4F04B 5J2MA 2PO4A 4UF4A 2YH1A 3UWTA 1VOMA 3C15B 5F8NA 3DLEB 1CSJA 2DGSA 2IA0A 1UEKA 4M5LA 5D0EA 4A47A 1TL4A 4M63A 1M1KT 5H9FK 4CH7A 5DQIA 3D1OA 2E1RA 3C66A 3F73A 2RVJA 2C2RA 5DLGA 2XSFA 3FRZA 4EEYA 1IR0A 2XMUA 2XI2A 5ITHA 2AV5A 2ROGA 3KLGB 4C0OC 2CDRB 1RDRA 2ALYB 1URNA 4UUXA 2V8VA 4RBUA 3BS9A 2GC8A 4DV1F 3RRKA 4PXBA 2C28A 4F3MA 4KQZA 5CH7B 2FHOB 4IRKA 3T1HJ 4QIVA 4WYLA 5F41A 3D1HA 4C8MA 3QMQA 1SV5A 3CF5Q 2WZ1A 1C1BA 1S6QA 1WG4A 5KFJA 1I1GA 2HIYA 4WE1B 1RT2B 1K47A 4PXCA 3PO5A 2WW8A 5DG9A 2BANB 2RD5C 4W4MA 4LF6J 1TUGB 4RKUC 2MEWA 1I5OB 3LAMA 1U1QA 3ITHB 3LA0A 3GE9A 3KLIB 1B7YB 2DVIA 3FC9A 4M5DA 3UCUP 1LWCB 3OUYB 3CJKB 4HR2A 4CTAA 1VFJA 5HSPA 2JFDA 4NLVA 4A4JA 2BOPA 2DIVA 3D66A 3MECA 4C11A 2DNYA 1UP1A 2Z2LA 1SI9A 2XYPB 1TTHB 1X4AA 5H9FJ 1YBUA 4K0KJ 3T5KA 2PD1A 3VAHA 4K59A 4L3NA 3DRPB 2ZH6A 3QAEA 1N8RT 4URGA 4KHRA 4WU2A 1DARA 3NAHA 2BE2A 4LUBA 1OMSA 4DU8A 4GRSA 1DTQB 4KHPJ 1LOUA 1BHNA 1VQ9S 3AFGA 1N48A 2DEJA 2FJBB 3NMRA 2QIFA 4WYWA 4A8SA 1W26A 3SFGA 1EKRA 1HW8A 3GFHA 3HF5A 2SXLA 5KFRA 5HROB 4QPTA 3W9IA 4LF9J 2GVZA 5C2GA 4K4YA 4NLPA 3RAMA 3FEZA 2C3YA 1EP4B 2YNGB 1JLBA 4BCAA 3DLBA 2VC1A 3MZIA 3JTNA 1HHTP 4ID8A 3KG0A 4YR2A 1TMJA 5J2QA 2CPHA 2Y8YA 4P2SA 3R5CA 3TAQA 4X4NA 4DR5F 2BKNA 3JTPA 4YDXA 1H7XA 3GR0A 4NLOA 4RW6B 3OJSA 1XIQA 4OI1A 2LU1A 1RT3B 3HHLC 3RZAA 4MK7A 4QIEA 2H4WB 4ZPVR 5L38A 9ATCB 3QYYA 4CLLA 3S8SA 1H3DA 3CPWR 3WBZA 5I3UA 1FNMA 1B7FA 2MPUA 2D7SA 3K5NA 1UETA 1NM2A 1T7PA 5H1SV 1WC4A 4BLGA 5KFHA 3IWNC 2DR6A 2DNNA 3ZZUA 3MURP 1K0VA 3KHHA 3NWGA 4HH0A 1IBCB 2I1RA 4DG1A 1CJUA 2V0NA 3OVBA 2AJQA 4OIXA 2ZM6F 1T03B 3I0SA 4A8XA 3CMAS 3LOUA 4O3OA 5B0GA 2D3UA 3OXLA 3OR2B 4U95A 1RLCL 1T05B 3PHEA 3IA0A 3HSDA 3IXQA 1VRUA 1RTJA 4DHVA 2HRTA 3A1YG 4ZVHA 3BH6B 3J81j 4EO8A 1BY9A 4F0HA 1S77D 1Z2LA 1BE4A 1FVSA 2XMJA 3I9ZA 2E29A 5AT1B 2J9CA 5LMUJ 3R8YA 4AXIA 2AKWB 4K50A 1QUVA 5HL7Q 2W2NP 1HNZF 3TUPA 2HVHA 5HI7A 2HMIA 3HHLA 5J1EB 1CLFA 1L3KA 2VG5A 1Q4RA 2B6AA 2HRUA 2GGPB 1Q5YA 4B9MA 3UCZP 3OXGA 4ZPAA 4JI0F 1RT5B 1XK8A 4EYIB 2WTFA 3DOMB 1U7LA 1T0TV 3FEXB 5CHCB 3RBEA 3PIPQ 2IVFB 3DMJA 4OYAA 2LQ5A 2KFZA 4O3RA 1MN7A 1WHYA 3NRBA 3UW1A 2OSQA 4LF5J 5KOWA 2QMWA 4P6QA 4YUDA 2VBZA 2E9ZA 1SJ1A 3GFZA 1V6HA 1G6BA 2XS7A 2JH3A 2J6SA 3FUYA 3TYTA 1F0XA 4DR2J 2ATLA 3D6TB 4HTIA 2WSCC 4DR3F 2FPHX 2DGQA 2W2PP 4MFBB 4XPEA 2J8AA 2V2KA 3QGIA 2VIHA 4X62J 2ZZMA 3CGIA 1A6LA 4H4KA 1JLFA 1YBTA 5IM0B 3NGDA 3TQEA 4N47A 4F67A 1R0BG 4IUFA 1QAXA 4NZ6A 4Q43A 3LTOA 2IJRA 2GQCA 3BB5A 4I2PA 4TU7A 4C3MA 5C5JA 4IRDA 1U1NA 2VUGA 4DL3A 1E6YB 1IKVB 3MGJA 3T19A 1Q79A 4TU8A 2PFDA 4LFBJ 1QVGR 1RWKB 2LA4A 4C8OA 1WHVA 3NWRA 2DYAA 1JLQB 3CD0A 2D3OR 2DKOB 3LWMA 2EVZA 3EGNA 3ZZRA 2ZH4A 3LGNA 3AB4B 5A8RB 1QE1B 2BJ3A 2LXFA 4KSEB 3DLGA 3G6ES 1X60A 4MAKA 4X2BA 3KHRA 1VQSA 2D3O1 3W66A 3W1YC 3E2EA 3BDPA 4J9OA 1IBKJ 2V2ZA 2DNMA 3OR1A 2FY8A 3G82A 4K8RA 1JLAA 3D6HB 3TO8A 3Q2SC 3JYTA 2CQGA 1QY7A 3LWLA 4RNMA 4FYXB 2DT9A 4KJIA 4Q0BB 2C3OA 4PYAA 1XNQJ 1HYSA 5KFFA 1XNRF 4WFXA 1S9EA 2GMJA 3QLHB 3UI3A 3RTVA 3HKZD 4LBPA 3DOKB 4ILRA 5I42B 1Q86T 5DDOC 5CYQA 1DLOA 3I56S 4G1QB 4FF4A 5D0RA 3E3XA 1L3SA 1NJWA 2GMLA 1S0NA 2HNYA 3SMZA 1S59A 1MWQA 1TMMA 1RTDB 3CDBA 2J9DE 2RU3A 1GMWA 2HURA 2DR5A 4P52A 2CYYA 1CS4B 4JV5J 4NLRA 5CQGA 3UDLA 4MIWA 1F5AA 4LF8J 1X4HA 5D77A 1P9QC 1JLCB 2IAJA 2K1RB 2VPZB 4RBVA 5CCLA 1ZTWA 5D6GA 4FYDA 2ZITA 1R8CA 3D6MB 2WSFC 1E6VB 1K0TA 2DGVA 2R8KA 2E1AA 1N5SA 2HSEB 1S6PA 1OO0B 5C25B 1T3NA 2IMWP 1KRPA 1HPZA 1RU2A 3MR5A 1IKWB 2J9DA 2QTWA 1M5OC 1SC6A 2ZWOA 5EWGA 2V4RA 1C0UA 3W2WA 1WHXA 3N79A 3ZZOA 2APOA 4NA3A 4FBTA 4MKAA 2EXUA 2BE7D 2RS2A 4DL4A 2EFOA 2DNPA 5A0YB 1M1GA 1VBKA 1ZM2A 3ADAC 3DI6A 2KM8C 1TKXB 2XLIA 2KL8A 5J1PA 4R0JA 5ETRA 2W7OA 1YRXA 2HHHJ 1S1VB 2DR7A 1N56A 1D9AA 1SBRA 3G86A 1JXEA 1ZZNA 2WONB 4X66F 4NLUA 3HVWA 2JHEA 1SH0A 5HLFB 1EETB 2B7BB 1N54B 2BM0A 2XMVA 3NNAA 3KJNB 2GJIA 4L72B 2N7YA 3W9JA 1LW0B 3C15A 3NMAA 2PN6A 3G71S 3JXOA 1GX5A 2VASA 3BM7A 3DC2A 1NJIT 3DRSA 1LK7A 3GV5B 1N6QB 9RUBA 1M5VC 1HBOB 3EE3A 4B3SF 5E3RA 2LQ8A 1LV5A 2ZOFA 3I87A 5IC6B 5DGAA 2YNIB 4RL1A 2HHVA 4Y0FA 3W60A 1R8PA 2DNLA 3CC7S 1OSDA 2M8HA 1UWAA 2FIUA 4KBIA 4NLWA 1C0TA 4B08A 4AE5A 1YKWA 4MK8A 3EX7B 2MKCA 4MKYA 1U24A 4KH0B 1RAHB 4GKJF 3GJQB 1EHWA 2C22A 3L7PA 5K14B 1UVMA 3POTA 4IH7A 2ZWPA 2UV8A 3PX4A 3D6FB 3RGIA 1Y5IB 5I4MA 4IDKB 1KSPA 2HAIA 1WI6A 2UVWA 2YWHA 4DV1J 2OMLA 1XR5A 2E5LF 3WDOA 1XTZA 2Q43A 3MMBB 4D3GA 1KEKA 3MCNA 3Q24A 3KLIA 2F7VA 1JJHA 3TNVA 1FRIA 3MEDB 2XGQA 3OUYA 2BJ8A 1FFSB 2NQPA 2VHGA 2G2OA 1BQMB 1DURA 2JEGA 1X5PA 4ZLJA 2LA6A 1HMVB 3GZ7A 4XDCA 2DGUA 1T11A 3BGLA 5B08A 3ET6A 2MHNA 2A10A 1V3ZA 4B3RF 5CD4H 3TW0A 4DCJB 5GMKa 1BMQB 3KKFA 3PEHA 1SL2A 5GADU 4DR4F 2GJFA 4JI4F 3RYLA 2YWGA 3H5SA 1PO6A 3QWPA 3IMQJ 3BDEA 2XCPA 2EG2A 1WC0A 3LP1B 4HLBA 3MMCA 1ZETA 4ZVPB 3VZHA 1DTQA 2VC0A 2YKAA 4N76A 2NPFA 3MEEB 1S12A 3I5AA 1GXUA 3K7RA 2VFRA 2R8JA 1OYEA 5HVGA 1XR7A 2HNZA 3THTA 1RT1B 2G13A 3WIVA 3G9CA 1NPPA 2OFHX 2QG9B 5K20B 2D69A 3PRDA 2K3IA 3LW5C 3G96A 4UQGA 3T1YF 3JB9k 4EZ9A 4CCHA 1EP4A 3CD7A 3MPWA 2K06A 2DNZA 1X9SA 1A9NB 3DM2B 2W1BA 3L95X 1S5ZA 3BGOP 2P6TA 4LRDA 3C6TA 3ZTSA 2K8GA 3W61A 1DZ5A 4OZNA 4HACB 1D3WA 3TJAA 4ZP6A 5LSLA 2IM1A 1O5JA 2H51B 2JWNA 2P9GA 1RT3A 1VQMS 1VIOA 1T9YA 4IQXA 1QVFR 5K9FA 1IR2A 2FHMA 3IBCB 3I0RB 1JLEA 2X1BA 2CPFA 4RUCA 2ALZA 1H73A 3GSIA 2MKIA 1Y11A 5T41A 1KD1T 2AYBA 3CCJS 3HSJA 2FC8A 2LEPA 3VVUA 2ZJRQ 4WU3A 1TL3B 3CCQS 2AZ3A 4NEYA 5CZXA 1QJHA 3ZNJ1 2PA3A 2GO9A 4OYXA 4URQU 3M9OB 5DQGA 3CCLS 1KWMA 5J2NB 1T03A 2Y1LB 3DDKA 3M6WA 2ZE2B 5LMNF 1FXLA 2R7XA 1WNEA 1JKHA 4N8OA 4YDDB 2B3TB 4X65F 2NZ4A 1U26A 2CPEA 2QO3A 1R8AA 2MY7A 3VV2B 2ZBRA 2XMAA 2QRRA 1CJTA 5DDRC 2FVRA 4Q2LA 5F3TA 2RUGA 2GHWA 1RTIA 4KIAA 4PWWA 4DLEA 4TQRA 1M0SA 3R1HA 1MU2B 2AJ4A 3CJ3A 1QM9A 4NCAA 5HVFA 2C3MA 3KJQB 2EWHA 4ZVSB 3P49B 2LECA 5J1EA 2KI2A 4NEZA 2CQ3A 3OL8A 2A2DA 4CLWA 3GYGA 1FDAA 3D1QA 2GGPA 2MKSA 3M32A 4CP5A 2MZRA 2A6MA 1WKJA 4ECTA 1RBLA 1KQGB 4CI0B 3HFVA 3ULHA 3V6DA 4NZ7A 4C98A 3G8QA 1R89A 2D1CA 3THVA 2IM2A 3T6BA 3MCMA 4X84A 3G8TA 5GADI 1WEXA 2F8MA 5KT3A 2CQ1A 1OY8A 4USTA 3QO9B 2HWTA 3MR7A 4IG0A 2HZAA 1PILA 5AE2A 2HKEA 5ETLA 5D0HA 4O4RA 2GIFA 2HGMA 5CXTA 3TJ9A 3KJVA 3T3FA 3AHPA 1YIJS 1CEZA 2XLJA 2IJNA 3B78A
chains in the Genus database with same CATH topology
1Q0NA 4M5KA 1F9HA 2F63A 3MCMA 4PZVA 5ETVA 1CBKA 3HSZA 3KUEA 1KBRA 1HQ2A 3HCXA 1EQMA 4M5MA 2CG8A 5ETPA 1RTZA 3KUGA 4M5HA 5ETQA 5ETLA 4CWBA 3HT0A 5ETSA 2QX0A 4M5GA 1G4CA 3HD2A 3QBCA 3MCNA 1TMJA 3UDVA 3UD5A 3MCOA 1EQ0A 4F7VA 3ILJA 3IP0A 5ETOA 4M5LA 4CYUB 4M5IA 4CYUA 4M5NA 4AD6A 1HKAA 3ILIA 3HD1A 1RU1A 1RAOA 1TMMA 1IM6A 3KUHA 2F65A 3ILLA 3ILOA 4M5JA 5ETRA 3HSDA 5ETNA 1EX8A 3HSGA 1RU2A 4CRJA 5ETTA 3UDEA 5ETMA 3HSJA 1RB0A 2BMBA 1DY3A 5ETKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0N A;  4M5K A;  1F9H A;  2F63 A;  3MCM A;  4PZV A;  5ETV A;  1CBK A;  3HSZ A;  3KUE A;  1KBR A;  1HQ2 A;  3HCX A;  1EQM A;  4M5M A;  2CG8 A;  5ETP A;  1RTZ A;  3KUG A;  4M5H A;  5ETQ A;  5ETL A;  4CWB A;  3HT0 A;  5ETS A;  2QX0 A;  4M5G A;  1G4C A;  3HD2 A;  3QBC A;  3MCN A;  1TMJ A;  3UDV A;  3UD5 A;  3MCO A;  1EQ0 A;  4F7V A;  3ILJ A;  3IP0 A;  5ETO A;  4M5L A;  4CYU B;  4M5I A;  4CYU A;  4M5N A;  4AD6 A;  1HKA A;  3ILI A;  3HD1 A;  1RU1 A;  1RAO A;  1TMM A;  1IM6 A;  3KUH A;  2F65 A;  3ILL A;  3ILO A;  4M5J A;  5ETR A;  3HSD A;  5ETN A;  1EX8 A;  3HSG A;  1RU2 A;  4CRJ A;  5ETT A;  3UDE A;  5ETM A;  3HSJ A;  1RB0 A;  2BMB A;  1DY3 A;  5ETK A; 
#chains in the Genus database with same CATH topology
 5IM0 A;  3CUL A;  4C3L A;  2VKZ G;  4BS2 A;  4IR1 A;  2RHS B;  4BBY A;  3S1T A;  2ZNY A;  1YTY A;  5AXK A;  4DR3 J;  1WDD A;  4NCG B;  5FD1 A;  4TYA A;  1XMQ F;  2H5J B;  1X4F A;  3DLL Q;  3KK2 B;  3HX9 A;  2QLX A;  2YWF A;  2KXF A;  1E6Y A;  1CPZ A;  3FZ2 A;  1FWP A;  4Y34 A;  3SSR A;  1K8A T;  4CO1 A;  3PKY A;  1RBA A;  5HJX A;  2RJZ A;  3WC2 A;  1Z4U A;  2V8G A;  2BKO A;  5ETQ A;  1S9F A;  1ZAW A;  2CQC A;  4KGZ B;  4LQ3 A;  1W7W A;  4NE9 C;  4QR0 A;  5IXU A;  2AD9 A;  3CC4 S;  1XQI A;  3EZ5 A;  1H2V Z;  5A8R A;  4IFV B;  1UWB B;  3ZFV A;  4F4W A;  1D09 B;  1RA7 A;  2A3J A;  3V81 B;  4AYB D;  3GJS B;  4DV3 F;  5KFZ A;  4NLQ A;  2H3E B;  2VPW B;  5CCM A;  3TOQ A;  3C14 A;  3CJR A;  2DGO A;  5C2C A;  3GJR B;  1F6T A;  2YPY A;  2AHO B;  4IG3 B;  3Q22 A;  2KN4 A;  5BJR A;  2DH9 A;  3EGW B;  2OP5 A;  1U6Z A;  1ZS6 A;  2WB4 A;  3ZZP A;  1RQ0 A;  5SZT A;  2KDO A;  2QE5 A;  5K8P A;  2NR0 A;  2E5G A;  3QLH A;  2BQR A;  2ZD1 A;  4QPX A;  5C42 B;  2Y1I A;  3FBC A;  4PQU B;  4OJ3 A;  3DOK A;  3DLK B;  3K58 A;  2RF2 A;  1FNO A;  5I42 A;  4DSI A;  1Q81 T;  3UN5 A;  4OHX A;  4C6A A;  3HD2 A;  2W2O P;  1WWH A;  1XNR J;  1X4G A;  2YWK A;  3BGU A;  1FJE B;  4K4T A;  2HFZ A;  1S6O A;  2C1E B;  1BC6 A;  4ZDN A;  4EU0 A;  2V9W A;  2VG6 A;  2JOQ A;  1UVK A;  4WK1 A;  2K1R A;  2AF6 A;  4LSN A;  2BQ3 A;  4LQ9 A;  3ZZT A;  4DSK A;  2UP1 A;  1E6V A;  4WCE Q;  2NSB A;  4PKD B;  5HMZ A;  1CJV B;  2HPU A;  1NHK L;  1NSQ A;  4FDF A;  2HBY B;  3ZZY A;  4QYZ K;  3SDE A;  1RK8 A;  4WF9 Q;  2AJ2 A;  5C25 A;  2Z56 B;  4WWS A;  2W9B B;  1RWN B;  1DY3 A;  1IKW A;  1J2V A;  2KRR A;  4KGK A;  2E44 A;  3UD4 P;  3KLF B;  2IA6 A;  1AXQ A;  3A4T A;  4O4G A;  2DY9 A;  3CJ4 A;  5EX0 A;  1KR4 A;  2R2U A;  4KFB B;  4R0E A;  4YEA A;  1IJF B;  2J0Q D;  3F56 A;  5G0R B;  1S1X A;  5KFB A;  4ETX A;  3K8V A;  2JDJ A;  1HW9 A;  4JI3 F;  2RIL A;  3CCW A;  5A0Y A;  3S01 A;  1Y4Z B;  1KON A;  1HD1 A;  2GQQ A;  4ZCL A;  1U45 A;  2HHP A;  1R0A A;  3R5A A;  5B0A A;  3K5M A;  2C3U A;  3G6Y A;  1Y10 A;  1TL1 B;  2DNR A;  1IVZ A;  3HI9 A;  1D9F A;  4X4Q A;  4LF4 F;  3UDC A;  1JLG B;  3C6U B;  2OD6 A;  5C24 B;  5L1J A;  4CLZ A;  1NPR A;  3MM7 B;  3LAL A;  1FCA A;  4RUB A;  4M5H A;  1H2T Z;  2MGZ A;  4OMF G;  1F60 B;  1LW0 A;  2J6U A;  1I94 F;  1U8S A;  1WC5 A;  3NCR A;  3CJ0 A;  3T1A A;  4DLG A;  5EX3 A;  5CA5 A;  2MQP A;  3AAW B;  4DFJ A;  3CC2 S;  2XSJ B;  4XPC A;  4C8Y A;  1X9W A;  1HBO A;  3CWJ A;  2YH0 A;  1VLO A;  2P6S A;  3MM5 B;  3CIZ A;  2A18 A;  4WBF A;  5JJB A;  4QYZ J;  5KG6 A;  3DGP B;  5KT6 A;  2DXF A;  2IBK A;  5EDW A;  1UVI A;  4HT7 A;  1FEH A;  3A13 A;  2ZH3 A;  3MDF A;  5K14 A;  1RT4 A;  1HI8 A;  4EK2 A;  3CCM S;  2HVZ A;  3CO0 P;  3VQS A;  3T6J A;  2CJA A;  1SCJ B;  1RWV B;  1ITP A;  4OJ1 A;  5JUM A;  4WP8 A;  4UW2 A;  4O3P A;  3CDA A;  5T7L A;  1F3V A;  2K7K A;  3MHY A;  1R27 B;  1MNE A;  2QLW A;  3H4D A;  1KFS A;  1EKS A;  4DX6 A;  2IC3 B;  3H20 A;  4NI2 A;  4AL6 A;  1OQ3 A;  1Q8K A;  3GIM A;  2BRK A;  1D9D A;  3NGU A;  4J9K A;  3E01 B;  1NKB A;  4QQB A;  2MMY A;  3U1M A;  2KH9 A;  4LIR A;  4J9U E;  2MQQ A;  2MDA A;  2UXB F;  3D28 A;  1NH8 A;  1LQ9 A;  2YKQ A;  3RRH A;  2E5L J;  2BJ1 A;  1RU1 A;  2HLT A;  2ZJP Q;  2IYI A;  3JSB A;  2HK3 A;  5HBM A;  1U49 A;  3NS7 B;  1RTZ A;  5FLX Y;  3OQ2 A;  5DJB A;  1R31 A;  2LYV A;  5BYS A;  1XR6 A;  2G0J A;  3AA8 A;  5MAO A;  4JI7 F;  3W62 A;  3TAM A;  4KY3 A;  1KQF B;  1AZS B;  2J0X A;  2MST A;  3PRV A;  5GAH U;  1Q7L B;  4AXJ A;  2VFU A;  4ES3 A;  1IKY B;  2DO0 A;  3B8H A;  3EM1 A;  3EVM A;  2UXD F;  3OFE A;  4DSE A;  5DS7 A;  1KVI A;  2HGL A;  3MEE A;  3BGF A;  4DR4 J;  3RG6 A;  4B3M J;  4JI4 J;  3VWS A;  3PO4 A;  1ZYQ A;  4DBQ A;  3BKU A;  2I5J A;  3OFG A;  1TKD A;  3KLH B;  4Y2A A;  2Q3P A;  3EXC X;  4KGX B;  1VBX A;  1S0V A;  2B5J B;  2JZ5 A;  1NSA A;  1UL3 A;  2MKK A;  4TKT A;  2UU9 F;  3OBI A;  5ETK A;  5E3C A;  2VFT A;  1WC6 A;  2Q79 A;  3AA9 A;  3DM2 A;  3MAA A;  4K2X A;  2W9C B;  1BWE A;  1S7H A;  3CD6 S;  3QJP A;  2CJK A;  4X4O A;  2HHX A;  4B3O A;  3BN7 A;  4CH0 S;  2FVQ A;  3T1Y J;  3HHN B;  2J0S D;  4RW7 A;  3QT5 A;  1S79 A;  3N6L A;  4ED4 A;  3QRQ A;  1OIA A;  3MOZ A;  5DET A;  2E7X A;  1FXD A;  4NOH A;  2AWZ A;  5CYJ A;  1X5O A;  4M94 A;  1FE0 A;  4RU9 A;  2H54 B;  4TYB A;  1PYO B;  5HQM A;  3M1V A;  4DPW A;  3N28 A;  4UOF A;  1TUV A;  5K8N A;  3NNC A;  2CZV C;  4OHV A;  2NXJ A;  4QU6 A;  3EIC A;  1OPI A;  4PWU A;  1LFW A;  4CT8 A;  4LSZ B;  1Q82 T;  3DDI A;  5LOQ A;  4DF4 A;  1CUL A;  5KT5 A;  3WX4 A;  4P74 A;  1Y00 A;  4ES2 A;  3T1H F;  1T9V A;  2MKY A;  2JLG A;  2G2Z A;  4DWI A;  1KLM B;  3DHW C;  3QJJ A;  2OEL A;  1C2P A;  4CT9 A;  3QIP B;  4F4Z A;  3FBE A;  4ZHR A;  5KFA A;  1WHW A;  1FE4 A;  3DU6 A;  1N5T A;  1WG1 A;  3RAQ A;  1ELO A;  2AGQ A;  3AQP A;  2VH7 A;  4YME A;  1F1B B;  3N5B A;  5IV3 A;  1NK4 A;  2IJF A;  2W7P A;  5IC4 B;  4ZJL A;  2HBQ B;  3DDN A;  3IG1 B;  3UN2 A;  3NCP A;  4N7T A;  4OV6 A;  2J9E A;  2OLW A;  4QZV B;  2RDI A;  4J9R A;  2LQ9 A;  2BXJ A;  1FDB A;  2MB0 B;  4GO5 X;  1EJ7 L;  1U0H A;  3PYE A;  2G1D A;  1IKX A;  4RNN A;  4K5R A;  5LMN J;  3V6H A;  3DCA A;  4NA2 A;  4U67 Q;  5B0F A;  4J9M A;  1ZH5 A;  2GFF A;  4XAK A;  3HK2 A;  5F9L A;  3HHK A;  3W2V B;  1QSL A;  1RLD A;  1MU2 A;  3OLA A;  3S7R A;  4OYW A;  3UDE A;  3SFU A;  5CD4 A;  3PW2 A;  1ROF A;  2MJN A;  2DHS A;  4RPF A;  1FRL A;  4F4A A;  2CQ2 A;  4USU A;  1TV6 A;  1YJV A;  2FHJ D;  1BD6 A;  2PC6 A;  1IUJ A;  4RWX A;  4PAA A;  3BKT A;  2FTR A;  2WVD A;  4P2M A;  1R6Y A;  4ELT A;  4DFM A;  2BYC A;  3BO3 A;  4HHU A;  3J7Z T;  1HWJ A;  2N4C A;  5K8M A;  2V8D A;  2HHU A;  2E9R X;  2XMM A;  5BXI A;  3MUM P;  1GX6 A;  3K5L A;  3I32 A;  4YHH F;  4M1K A;  3HSZ A;  4W92 B;  3HKW A;  1B99 A;  3SV3 A;  5F0U A;  4CYU B;  3BYR A;  2CJX B;  2Z58 B;  5GAH I;  2IHR 1;  4OYM A;  1N5V A;  2RHQ B;  3TEH B;  3QQC D;  1U02 A;  5HP1 B;  2J7W A;  1MLA A;  5KG4 A;  2CA9 A;  5D8H B;  1HNX F;  3HXM A;  4M5I A;  3PW0 A;  2FB0 A;  2FLO A;  3KK3 A;  4J9N A;  5IT9 Y;  1WOR A;  4KV8 B;  4B9N A;  4YP3 A;  3PAC A;  2XZD B;  4DCO B;  1VBZ A;  3VZI A;  1OPZ A;  1JNR B;  2MQM A;  4XDD A;  4ZLP A;  1TKZ A;  2VON A;  3DRR B;  4KO0 A;  2ZZT A;  4KAI A;  2HFV A;  1SH2 A;  2X3G A;  1VHI A;  2L08 A;  1SC4 B;  4QIF A;  3MTK A;  4WXO A;  2XTJ P;  4ED5 A;  1XMQ J;  1FEE A;  3QPI A;  3GYX B;  3LP2 B;  1NK6 A;  4OI3 A;  2RE1 A;  3IS9 B;  4LSL B;  5L46 A;  4C8K A;  3J7Y U;  2ZC3 A;  1SIZ A;  2L48 A;  1FFG B;  1YJW S;  2YWE A;  5KT7 A;  5E3A A;  2H5E A;  2W2M P;  3M8W A;  1GH8 A;  1QAJ A;  2B4P A;  3V81 A;  1PJ7 A;  2IVY A;  1TL7 B;  2B43 A;  4HDG A;  2WK4 A;  3Q8S B;  2YKM B;  1GXL A;  1A0O B;  2DIU A;  4ZN1 A;  3QT6 A;  2ZFH A;  1N52 B;  1UJ5 A;  4QJV A;  2GIR A;  5D3G B;  3TA2 A;  5LMU F;  1WC1 A;  3D0G E;  1PGZ A;  4RW4 B;  2BQU A;  1PC4 A;  3M8Z A;  1U1M A;  1C4C A;  3MEG B;  1UPP A;  2Q6C A;  2HFU A;  2XMK A;  3LGM A;  2G0I A;  1ACM B;  3GFX A;  2RB7 A;  5C42 A;  4G1P A;  1HQE B;  2ZOG A;  2CVI A;  2VJV A;  4WFB Q;  3QGG A;  1TKT B;  4PQU A;  3MXH P;  2GIQ A;  3DLK A;  1CJK A;  1FT8 A;  2YKO A;  3U7J A;  4QIG A;  4P10 A;  1FWK A;  4OHW A;  1SIW B;  3RBX A;  2CZ9 A;  2GA7 A;  1NDK A;  3NS6 A;  2BV3 A;  2EBG A;  2OPP A;  1YK9 A;  2BJD A;  3M2V A;  3J7A N;  1SJQ A;  1QLN A;  2VPX B;  2ZH1 A;  1VR6 A;  3DRY A;  2MQN A;  3R5D A;  2VA2 A;  3KHL A;  2JFK A;  1DJ0 A;  4LF5 F;  4EFA C;  1WF1 A;  3Q2T C;  3D54 A;  2OPS B;  1C1C B;  1UMJ A;  2W4C A;  2CG4 A;  1CJV A;  5IT0 A;  4IO9 Q;  4CZC A;  2HQI A;  2CJY B;  4DR2 F;  4FF2 A;  1FDD A;  2DPI A;  2W8K A;  1JMT A;  3VGV A;  2W9B A;  1OJ4 A;  5KFX A;  1VCT A;  5F8J A;  1YVF A;  3MM9 B;  1D0E A;  3M4X A;  3TA1 A;  2D74 B;  1VRT B;  1TVR A;  3J80 U;  3M8Q B;  4NYP A;  5G0R A;  4NX9 A;  4FKX A;  3TA0 A;  2JJ4 D;  5AJ3 J;  4WZM A;  3HJV A;  2AGO A;  4E98 A;  3FRY A;  4N5S A;  4NMX A;  2VG7 B;  5KG1 A;  1B70 B;  4KHM A;  5HO4 A;  3G4S S;  4DPO A;  1SUQ B;  2JEF A;  4FYY B;  1HNV B;  2WBR A;  4X4T A;  1LNQ A;  1W2I A;  1NUE A;  4TY9 A;  1WKL A;  3ETM A;  4CWB A;  4RNH A;  1FNX H;  4A8K A;  4ZVF A;  3KK1 B;  4JI3 J;  1HNW F;  3C6U A;  5C24 A;  2RIJ A;  1UCN A;  3FBB A;  4YB7 A;  2ERR A;  2N3L A;  2Y3Y A;  1RWO B;  1NRK A;  2E7W A;  1RKI A;  3D9B A;  1VC5 A;  1YJT A;  1J5E J;  3ZZZ A;  3N6M A;  2R8I A;  2KO1 A;  2HZV A;  4ED6 A;  4LF4 J;  4WP3 A;  3HVT A;  4DV4 F;  1YRT A;  3TVK A;  3UDV A;  5JVG Q;  1V3R A;  1IBK F;  1TFW A;  2KJV A;  3BSA A;  2UVR A;  3GV7 B;  1KKH A;  1ZOT A;  3NBP B;  3IM8 A;  8ATC B;  3JS9 A;  2ZH7 A;  3J7Y I;  5DG7 A;  4TLQ A;  3V6K A;  1XNQ F;  5IZH A;  1FD2 A;  3ILI A;  3TZX A;  2QZ8 A;  2VD3 A;  1ZPV A;  3KDN A;  4YFU A;  2RQM A;  3AXM A;  4ZIV A;  4ZVU B;  1J5O B;  2DHX A;  3VGT A;  3I4H X;  3RAX A;  3B4M A;  5ETP A;  1BQN B;  2F4F A;  1G4C A;  5MLC V;  3A8E A;  3RRG A;  2QA1 A;  2HHT A;  1SKS A;  1FRX A;  4I6Y A;  1S4E A;  2HLU A;  5IT9 U;  5LT5 A;  2HND A;  2ASJ A;  3MOJ B;  2Z2Y B;  4F36 A;  4YB1 P;  3KJF B;  4WK3 A;  1OS5 A;  3AOA A;  3CB4 A;  3M8Y A;  1VQY A;  4ZN3 A;  4EBC A;  2HVE A;  2BM1 A;  3T9N A;  4JV5 F;  4EI2 A;  5ETN A;  3QRP A;  3SCJ E;  1IWA A;  4FVC A;  2RAQ A;  4A8W A;  2BOA A;  1X5T A;  5G4D A;  4PQA A;  1MW7 A;  3Q8Q B;  1G2E A;  1ZBT A;  4R5P B;  1NSP A;  4OX8 A;  5F8I A;  1H74 A;  4Y28 C;  1FJG F;  5J2P B;  3LUY A;  1MG7 A;  4OX9 F;  2EFP A;  4R8U B;  3BYP A;  3MM6 B;  2ZH8 A;  2XS5 A;  1IR1 A;  3R7S B;  2V69 A;  2YNF B;  3CCS S;  2DNQ A;  3K59 A;  3EDQ B;  4LR9 A;  1I51 B;  2HQG A;  5F0W A;  3PNI A;  1WF0 A;  3QNW B;  4KH1 B;  2QX0 A;  4A46 A;  1ZZF A;  3BPS P;  2YX4 A;  2LP4 A;  1FWL A;  2R7S A;  4RW8 B;  1IJE B;  1N36 F;  3TRG A;  2HFN A;  3Q0A A;  2BE9 B;  3KLH A;  2LEA A;  3H98 A;  4BC9 A;  4L73 A;  1S1W B;  3K0J A;  2YWW A;  4DR7 J;  3US5 A;  2GQ2 A;  4FKY A;  1RWX B;  4TY8 A;  1YHQ S;  2OTL S;  3PW5 A;  4LF1 A;  4RWW A;  1B0V A;  4B02 A;  2BDP A;  1H6K X;  4C3K A;  3ICL A;  2HEK A;  3LP0 B;  4O0N A;  2UXD J;  3OV7 A;  3ELH A;  1CC7 A;  4R25 A;  1N5Y B;  4RUA A;  2E1M C;  1HWK A;  5A8K B;  1DRZ A;  3QSI A;  4ER8 A;  3CCZ A;  4LMZ A;  3UVJ B;  3WHI A;  1HWL A;  2ABY A;  5HQ8 A;  3MD1 A;  2RKI B;  1IQZ A;  1CQM A;  2J76 E;  4PXD A;  2KJW A;  2RQ4 A;  3N01 A;  4B17 A;  3OVS A;  3FFI B;  3CMQ A;  3IRX A;  4HI2 A;  3H5U A;  4HH1 A;  2BW7 A;  2NXE A;  2WOM B;  2MXY A;  2NS1 B;  1VMB A;  2ZDP A;  1PBU A;  5GAE U;  3JSR A;  1HBM B;  4B9T A;  2H65 B;  4HEA 9;  3W63 A;  3QAU A;  3B4D A;  3I55 S;  4H4O B;  2L3M A;  1SC1 B;  3SXL A;  2JC1 A;  1RHM B;  2OPR A;  3IN5 A;  4J9Q A;  3VCD A;  2P9C A;  1NDL A;  2MZJ A;  3TUZ C;  2EKN A;  1RYR A;  2JSX A;  2ZJQ Q;  1WSR A;  4J9S A;  1RHK B;  2HQC A;  5HQL A;  4ECW A;  1RT7 A;  1T9W A;  2DRD A;  2OEM A;  1JX4 A;  3M6X A;  3JSM B;  2QC3 A;  2XWY A;  5SUH A;  1Y5N B;  2X1F A;  2XHC A;  1R43 A;  2FJX A;  5LJ5 Y;  2NYH A;  3PVX A;  2AJF E;  4NAS A;  2FHJ A;  4TNO A;  3GCX P;  3GV8 B;  3PJ9 A;  2M3D A;  2H48 B;  1KC8 T;  2FJA B;  5KFU A;  4JI8 J;  3AJD A;  4RO0 A;  4HI1 A;  5L9X A;  1LW2 B;  2AU0 A;  3K17 A;  2O5D A;  3MPU B;  4JI5 J;  4P72 A;  1HQ2 A;  3DOL B;  4K4U A;  3FMB A;  3VGS A;  1ZM9 A;  2V4J A;  3QFH A;  1YGY A;  4EUV A;  4NYZ A;  5AE3 A;  2OSR A;  1CC8 A;  2OD4 A;  4O0I A;  4G1I A;  2EI5 A;  2XY6 A;  4DS5 A;  4N41 A;  3Q8R B;  1EAR A;  4B9V A;  2YNH A;  4FXD A;  3SI8 A;  1PBA A;  1WSV A;  1T9U A;  5DQH A;  2FGO A;  3SQO P;  3C19 A;  4FS1 A;  2V34 A;  4DJB A;  1PAE X;  2QLJ B;  3M30 A;  1YJR A;  1S48 A;  3DRX A;  3BQ2 A;  3UN3 A;  1TAU A;  4A8O A;  1M1H A;  3GII A;  2HG4 A;  1WF2 A;  1FD8 A;  3V2U C;  3C16 B;  4NLY A;  2R8G A;  2PGC A;  1HI0 P;  2XY7 A;  1RAJ A;  1NPK A;  5B09 A;  1NDC A;  1FKO B;  2PA8 D;  2JVR A;  2AJ1 A;  3PFO A;  1O8B A;  3ILO A;  5DZ7 A;  3BGR A;  5KTQ A;  4WFN Q;  2LXI A;  3PIO Q;  1T9X A;  3EWG A;  3IM9 A;  4YHH J;  2UUB J;  1HBU A;  3OT9 A;  2E1C A;  2HFO A;  1X8D A;  2F9D A;  4OJG A;  2PMZ D;  1D8Z A;  4JB8 B;  3I9V 9;  1SJF A;  4MYT A;  1XMO J;  4IH6 A;  4KV8 A;  3RW6 A;  1U8W A;  4QCL A;  1WTB A;  5M2R A;  2R2S A;  1H7W A;  2QMU B;  2YKN A;  1IQT A;  1HNX J;  1TK8 A;  3CJ5 A;  1Z1Z A;  5J2M B;  1TK5 A;  3WQP A;  2CPD A;  4X4P A;  1IWG A;  2N3O A;  1X0F A;  3MM8 A;  2RQK A;  5D0G A;  2UUT A;  2CRL A;  4NL5 A;  4QR2 A;  4MT1 A;  4AQY J;  4F50 A;  4AL7 A;  1WEL A;  3HJF A;  3PM9 A;  2D41 A;  2WVE A;  1PC5 A;  4YY3 F;  5KG5 A;  3ETO A;  5GVQ A;  4ZIT A;  2MZS A;  3IS9 A;  1VQ8 S;  3H0P A;  4PG6 A;  3CDU A;  5GAE I;  4TQS A;  2OUG A;  3V4I A;  4KRW A;  3MI7 X;  3LQV A;  1TL7 A;  2KHD A;  2DXD A;  2H5I B;  3KWM A;  4QWC A;  1MWY A;  3KLV A;  2JEI A;  2AP6 A;  3NXZ A;  1SXL A;  1VIS A;  2RRB A;  3SSQ A;  1Q8L A;  1S6Q B;  1S99 A;  3SQG B;  4KYZ A;  5B7W A;  3FBF A;  3P3D A;  2F9J A;  3DYA A;  1HBN B;  1S1T B;  2CQ4 A;  2W25 A;  4RW4 A;  4P75 A;  1V9O A;  2BAB A;  5B0E A;  4IFY A;  2R7O A;  4K4X A;  1RAD B;  2DHH A;  4CLY A;  3UE2 A;  2YQ3 A;  4RNO A;  3OTO F;  3HD1 A;  2NXC A;  2BUN A;  1TKT A;  4CTA B;  3HFK A;  1RAI B;  4USK A;  3FEY B;  1UJ4 A;  3KMS A;  4DEZ A;  2B51 A;  3LPY A;  2ZVI A;  1U1O A;  4HTJ A;  1V5V A;  3FJ2 A;  4I7F A;  5DLF A;  5E3Q A;  2CJ9 A;  4C11 B;  4MKV A;  3BQ1 A;  2Y8W A;  1NHU A;  4F2S A;  3PW7 A;  3D67 A;  2WVB A;  5HAT A;  3CSK A;  1M90 T;  5GME A;  2XMT A;  2M5Y A;  3N6N A;  4O23 A;  2RSQ A;  4X64 F;  2M88 A;  5KFN A;  2O3D A;  2VJU A;  2QA2 A;  5AXL A;  2DO4 A;  2ROP A;  4Y6I A;  4G3I A;  2DGX A;  3RW7 A;  1FHT A;  1C1C A;  1RHR B;  5KG2 A;  1REG X;  2DHA A;  1GTH A;  4U6P A;  3VTI A;  5D4L A;  2R3V A;  2ATC B;  2CPY A;  2ZBQ A;  1Z2Z A;  4IH5 A;  2MHE A;  3OJU A;  2XB2 D;  4Q7A A;  3MM9 A;  4LF2 A;  1U4B A;  4FPI A;  3GPA A;  3O3L A;  2RDJ A;  1U48 A;  2GVZ B;  3HZE A;  4DZ6 A;  1R7I A;  5FDL A;  4UOC A;  4P2F A;  1JLB B;  4QWB A;  3IRW P;  3PX0 A;  5J2Q B;  2V94 A;  5F9N A;  2VG7 A;  1OQ6 A;  4FN5 A;  1JNZ B;  2J7U A;  2IY5 B;  2NPI A;  2RUS A;  2CVE A;  2KT3 A;  1SUQ A;  2XHW A;  4Y3C A;  2W8L A;  3OTD A;  1GMV A;  1OY9 A;  2CQH A;  4V19 J;  2J0W A;  2V5H G;  2DNH A;  2IIH A;  3IR7 B;  2V68 A;  1YBA A;  5I3U B;  4ZPC A;  3JQM A;  1F5B A;  1U09 A;  2ZBP A;  2CUY A;  1XJW B;  3Q8V A;  2ASL A;  2ASY A;  4HHJ A;  3PDN A;  4OI2 A;  2MLZ A;  2EC0 A;  1FRM A;  2GV1 A;  1NXI A;  1HNW J;  2AYM A;  4WJB A;  4OYP A;  3TWZ A;  4DG1 B;  4ENO A;  4K4Z A;  1MN9 A;  1RT6 B;  3L09 A;  3D4J A;  3I0S B;  4FZV A;  2KFN A;  3V5R A;  4DV4 J;  1X4B A;  1VRU B;  1RTJ B;  2CPI A;  5M2U A;  5DDP C;  4PG5 A;  4OZ5 A;  3DLJ A;  2GCF A;  3J81 Y;  2ZH2 A;  3SIP B;  2V2V A;  1F9E B;  3W5X A;  4USV A;  2C2E A;  4HL9 A;  4O44 A;  4DV0 J;  2AYE A;  4ZKA A;  3OSN A;  3DLH A;  3HM9 A;  1VQN S;  2G1H A;  3QBC A;  2VA3 A;  1WEY A;  4QWD A;  2NXN A;  1WAC A;  4DV6 J;  3RBZ A;  1S10 A;  4F25 A;  3WIU A;  3MMA B;  5F8H A;  4XO0 A;  3OL7 A;  2HMI B;  3HHL B;  4DUY J;  1SKU B;  2EPI A;  2R9L A;  2CQI A;  3KNG A;  1U47 A;  2QN6 B;  4R5P A;  5KFM A;  3PTW A;  4HHH A;  4DF8 A;  5IT4 A;  2FUG 9;  3SCL E;  1L3V A;  4ZVO B;  1NBE B;  2X3D A;  1ZA1 B;  3QID A;  2FVC A;  3CD5 A;  4R8U A;  1AB8 A;  4DDF A;  1XBW A;  2HHQ A;  2UUC J;  2CWK A;  3DMJ B;  2MSS A;  2YNF A;  4WTO B;  4L6V 3;  3QGH A;  4A8M P;  4DCP B;  3DGV A;  4GC6 A;  2QSW A;  5D15 A;  4ES1 A;  1WJ9 A;  2FYX A;  2Z57 B;  4I2Q B;  2YQ1 A;  3J7Z 5;  1FJG J;  5EHH A;  4OX9 J;  1B3T A;  4J5O A;  1NK8 A;  5CYM A;  2B9X A;  4LR7 A;  1L3U A;  2M52 A;  4WP9 A;  4J7C A;  1PSD A;  2W4D A;  1ZAX A;  5KT4 A;  2YX1 A;  2OGU A;  2KYX A;  2NXU A;  3B82 A;  3GFY A;  3JSY A;  4I6A A;  1H2U X;  4ECZ A;  4K7Q A;  3BO4 A;  3LP0 A;  1CVJ A;  5KFK A;  4I0W A;  3IAS 9;  1LXJ A;  1N36 J;  1NB7 A;  5A8K A;  2RQC A;  3P45 B;  1P1T A;  4LFC F;  2R42 A;  1B64 A;  3UVJ A;  4CO4 A;  1S6U A;  4I2P B;  1KDN A;  1UFK A;  3AD7 C;  2LDI A;  2RKI A;  1L5U A;  2UUW A;  3CCE S;  3T5L A;  1YLX A;  2RRA A;  1KN6 A;  3ZTO A;  4OZL A;  3TQ1 A;  2XM3 A;  3S6E A;  3AJ2 A;  4DUT A;  3DLE A;  1H72 C;  4ELU A;  3CNQ P;  4ED3 A;  1Y7P A;  1UW9 A;  1RJJ A;  1HBM A;  4H4O A;  2QFI A;  1UVN A;  3QRR A;  2M70 A;  2R2T A;  3M7V A;  4ZCK A;  1P1L A;  2A2C A;  3UNY A;  2IDL A;  1IXK A;  2F4V F;  2ZNZ A;  1T3O A;  4OLO A;  3KLG A;  3VAM A;  2LEB A;  5DDQ C;  3HUL A;  2DCU B;  4GMK A;  2KXN B;  2X51 A;  2HRY A;  1XC9 A;  3OR1 B;  3G82 B;  3HLU A;  1BLU A;  1JLA B;  3LAN A;  1BUX A;  1DBD A;  3PJX A;  3ILL A;  3HMJ G;  1HYS B;  1RCX B;  3PZP A;  1U0S A;  1SL1 A;  2DJW A;  1S9E B;  4UOG A;  4I1T A;  3R2C J;  2O01 C;  2QEX S;  1VQ4 S;  2CFX A;  4WE1 A;  1RT2 A;  2ZHB A;  2DGW A;  3BJY A;  1ULR A;  4URS A;  2GZO A;  3W64 A;  2BAN A;  2HS0 A;  1G7C B;  3W5Z A;  2XLK A;  3TZY A;  3WZ0 A;  1HIY A;  5CYQ B;  1DLO B;  3ITH A;  5FJ4 A;  4MMO A;  4CO3 A;  3DOL A;  3SSS A;  2GS8 A;  4RU2 A;  3W9H A;  1Q5V A;  1QD1 A;  2HNY B;  4CLK A;  1LWC A;  4I67 A;  3CJK A;  2IM0 A;  2CNN B;  1Q95 G;  1RTH B;  4JOU A;  3VAJ A;  7FD1 A;  2BAC A;  2FY1 A;  3H2V E;  4XK8 C;  1VQ5 S;  4WIQ A;  3TR5 A;  2PI5 A;  3W3S A;  2EG1 A;  1NJY A;  1CQN A;  1VGY A;  3GG1 A;  2YKP A;  1NK5 A;  2IAJ B;  1S72 S;  3L4B C;  2CQB A;  3RJM B;  4RZR A;  3G87 A;  3SYZ A;  2CPX A;  4DR1 F;  4E8U A;  1DQ8 A;  3GIL A;  3O6Q A;  1S6P B;  5A6W A;  3VAL A;  4B3M F;  4FP9 A;  4UZC A;  3DRP A;  3C16 A;  3U02 A;  1HPZ B;  2EK6 A;  1JJ2 R;  4RX6 A;  3G8S A;  4OV1 A;  2RH3 A;  5F8M A;  2QLF B;  4ELV A;  2ADC A;  1VDH A;  3W2W B;  3OW2 R;  3DXB A;  1Y9O A;  4CLP A;  3R97 A;  3AOB A;  3EJM A;  2VOO A;  4LRE A;  2GVD B;  1UEU A;  2OIH A;  3KLE B;  4WKR A;  2CWX A;  3DI6 B;  1NK0 A;  2V9K A;  2WRM A;  3J81 U;  2JVO A;  2VBX A;  2DR8 A;  1M5S A;  1NJZ A;  4UT4 A;  4ECY A;  5HRO A;  4AD6 A;  4ZP7 A;  2JLF A;  4KB7 A;  2EBE A;  1SH3 A;  3RR8 A;  1NU4 A;  2YBV A;  3LPE A;  2VKR A;  1WKK A;  4BC7 A;  1RAC B;  1MRO B;  3K2Y A;  2YNG A;  5EN1 A;  3OLB A;  1GFW B;  4QIW D;  1DHM A;  4PG8 A;  4ILM A;  1AW0 A;  3BN4 A;  1ZPW X;  3D2W A;  5EGY A;  3ENA A;  3L7O A;  2MJU A;  4J90 A;  2ZBC A;  4ZVQ B;  3HT3 A;  4MK9 A;  4RW6 A;  4DV2 J;  1UEV A;  1TK0 A;  3MCO A;  2ADB A;  3TX0 A;  2DPJ A;  1YJN S;  3FK4 A;  2OKQ A;  3DRS B;  4B3T F;  2P2C B;  4PXE A;  4EZ6 A;  4DMZ A;  4ERD A;  4F4X A;  2MYF A;  3NEK A;  2LQJ A;  1X5S A;  2XNQ A;  1NME B;  1RAO A;  1QAY A;  3ZXW A;  4LFA F;  3M2U B;  2ZKT A;  2QFJ A;  2OAU A;  3OTC A;  1C0T B;  4JI1 J;  4ZPT R;  1K1Q A;  3CT9 A;  4HKQ A;  4OJH A;  2BW2 A;  5KFG A;  2IPO B;  3POT B;  1EX8 A;  4YY3 J;  4DFK A;  4LVN P;  3KYL A;  4OLP A;  3BSO A;  3MPV A;  2VOP A;  4NLT A;  3GSD A;  4PAB A;  5E33 A;  3K8W A;  1RHJ B;  4DV5 F;  2DRA A;  2GW8 A;  1SQG A;  3SQG A;  2RRN A;  1HBN A;  3OR2 A;  1S1T A;  3CO9 A;  1T05 A;  4U7C A;  3R6L B;  5LL6 d;  3QZ8 A;  3AJ1 A;  3FDS A;  2KM8 B;  4H54 A;  4IRC A;  3SEO A;  3VVT A;  3ZC4 A;  4F0K A;  3GR1 A;  1A7G E;  2EKY A;  2R7R A;  4S0M A;  2DTJ A;  3FZB A;  1YRU A;  1O6X A;  1JB0 C;  3HVA A;  1Y5L B;  4FYW B;  4M5M A;  4WFY A;  4A8F A;  4RLE A;  5ADZ A;  3ET6 B;  4M5J A;  1N4L A;  3Q8Y A;  3DFE A;  4IYQ A;  1VK3 A;  3OTO J;  2DRB A;  3WX8 A;  4X4U A;  4DL7 A;  1FRK A;  1UJ6 A;  5K5M A;  1BWV A;  3R2D J;  2QV6 A;  2MQO A;  3DN9 A;  2ASD A;  1RT5 A;  3Q86 A;  2J8S A;  3DOM A;  2OI2 A;  4EMD A;  1G1X A;  3OXF A;  2MTL A;  2J5A A;  3MMC B;  2IMO A;  3MMJ A;  4OYB A;  4CLU A;  1N88 A;  2HIQ A;  2AQ4 A;  2AEM A;  2I0X A;  3ENW A;  3H8Y A;  4X64 J;  3TZZ A;  1BQX A;  3NS5 A;  4WFA Q;  1H38 A;  1NK9 A;  1FX2 A;  5F8G A;  2HNZ B;  3NAI A;  1P8G A;  4U9R A;  5HK4 A;  4AUK A;  4F0M A;  2XO7 A;  3FMW A;  2KKH A;  1X4C A;  3BBC A;  3JQK A;  3NLC A;  4Y65 A;  2Y1R I;  4USI A;  4QU7 A;  2PT0 A;  2U1A A;  5KG0 A;  5KFY A;  4TLR A;  4IOA Q;  2GAG C;  3EUN A;  3ZTR A;  1YG0 A;  4MFB A;  2GHV C;  2XWX A;  4KGM A;  3C6T B;  6FD1 A;  3A3O B;  4XTT A;  4UY8 T;  2VOD A;  3CUN A;  2X1G A;  4RW9 B;  1N33 F;  1Q0N A;  4C0H A;  5DGB A;  5L8R C;  2PFF B;  1LWX A;  1S0M A;  1NKC A;  2O67 A;  3LAK A;  1OSC A;  2V8H A;  3KDO A;  2FJD B;  4NZ0 A;  1JLE B;  2R2R A;  3CJQ A;  4Q5V A;  1HLW A;  4TVA B;  4DSL A;  3THP A;  2UXC F;  1YDL A;  1IKV A;  5HN0 A;  4CQ1 A;  3CCU S;  4OX6 A;  4GKK F;  2AMC B;  4W90 B;  4AL5 A;  2CNO B;  2ILY A;  1KQS R;  1T9T A;  1JLQ A;  3EZO A;  3MFH A;  4DU7 A;  1TR0 A;  1QE1 A;  4CM0 A;  3PEJ A;  3C2P A;  3KG1 A;  5LXY A;  3QWU A;  3KG4 A;  1RT6 A;  5I3Q A;  3GCW P;  2WCX A;  3E51 A;  3KMQ A;  1WOS A;  1UVL A;  4PWD B;  1RYS A;  2R7W A;  2CQ0 A;  3VR1 A;  1JKH B;  2FLN A;  4ANC A;  4KT0 C;  4H4K C;  3V6J A;  1WEZ A;  2DIS A;  2K2P A;  2VFS A;  3RBD A;  3JQJ A;  1UW4 A;  2DH7 A;  3QFW A;  3DXS X;  1CJT B;  2XBP A;  3PV8 A;  4Q0B A;  1RB0 A;  1S76 D;  4OI0 A;  1RTI B;  4G6V B;  3HT0 A;  2LLZ A;  4UQT A;  1FRJ A;  1U6B A;  1HNI B;  1FA0 A;  2G2Y A;  4ZMM A;  1FVQ A;  2WW4 A;  5IWA J;  2QSF A;  3MMA A;  4TU9 A;  3D0I E;  2Y0B B;  4NXM F;  4G1Q A;  1RGV A;  3I31 A;  1EQ0 A;  4ED0 A;  4F2R A;  2WAQ D;  4ZVG A;  4F3Q A;  2FHK A;  2HHW A;  1RTD A;  3M32 B;  4ZOS A;  1CS4 A;  3HCX A;  4N77 A;  4Y2M A;  3V6D B;  3A8I A;  3MFI A;  4P7T A;  1SPB P;  1JLC A;  5HMY A;  4IO1 A;  5IQQ A;  3ISN D;  2W01 A;  2BMB A;  2FD2 A;  2CKW A;  3W65 A;  3WC0 A;  4I2Q A;  1V5I B;  5AJ3 F;  4NCB A;  2IVM A;  4NLD A;  4IG0 B;  4PRF A;  4OYZ A;  4OX7 A;  3ILJ A;  2AW0 A;  2CQD A;  2CJB A;  1VS3 A;  3TZW A;  2D9P A;  3KTQ A;  3TVY A;  1RHQ B;  2CJQ A;  4P71 A;  1PIE A;  3R5G A;  3KJV B;  1P27 B;  1N34 F;  4K5S A;  4ZPW R;  3FSY A;  3PX6 A;  4ED7 A;  3O8W A;  2XZT B;  1TUW A;  4BHQ A;  1TKX A;  4YN3 B;  4JI2 J;  4H4M B;  3RB4 A;  1M5H A;  1S1V A;  4FPR A;  2CAJ A;  1D1U A;  1J5E F;  2WON A;  3OD2 A;  2ZDO A;  2VQF F;  2ZKU A;  3CVK A;  5HLF A;  5D4P A;  1EET A;  8AT1 B;  4ECV A;  4PUO B;  1S97 A;  1F3F A;  4M5K A;  4LFC J;  4CNY A;  3H2U B;  1J27 A;  5LJ3 Y;  1WOP A;  3D0H E;  1T02 A;  5ETO A;  1F9F A;  2MLX A;  3QT7 A;  5LSO A;  4JV0 A;  3UCG A;  2FJV A;  3GMG A;  3Q8U A;  5M2P A;  5ETV A;  1N6Q A;  2HK2 A;  4BDP A;  4LRF A;  1EQM A;  4Y00 A;  2ACM A;  2Q6B A;  4LT6 A;  2E5I A;  1RZM A;  1M5P C;  2YNI A;  3OTE A;  3VAK A;  4E2F B;  3TUI C;  4DN9 A;  4JI6 F;  2ZUA A;  1VBY A;  3C14 B;  3NOC A;  3AD8 C;  1YJ7 A;  2B8Q A;  2I38 A;  2XI3 A;  1FI4 A;  1YSJ A;  1U1R A;  3OHA A;  4N8N A;  4J91 A;  3NL0 A;  4F4Y A;  2R7V A;  3CJT A;  1K1S A;  4YB6 A;  2HS3 A;  4WXW A;  2A6O A;  3MAQ A;  2F4V J;  3P5B P;  3DHX A;  3W8P A;  3DU5 A;  4EGL A;  1O0P A;  3BEG B;  4N56 A;  1X7V A;  5E7O B;  2ZD1 B;  1WG5 A;  4IDK A;  2Z2Z A;  1PAU B;  4QWA A;  2BEF A;  2RU9 A;  2FC9 A;  1GAO A;  3CJ8 A;  1U25 A;  1LWF B;  2RF2 B;  5B0C A;  4QW9 A;  2ZOM A;  1GEH A;  1KVK A;  3AY0 A;  3VGU A;  3MMB A;  5L39 A;  3P96 A;  1NSK L;  3KXD A;  1WUU A;  3MED A;  4WPA A;  3C8Y A;  1FKP B;  3F0N A;  3C46 A;  1P9Y A;  1RTH A;  1VRQ C;  2V50 A;  1BQM A;  4WII A;  1H0H B;  4YR3 A;  2VG6 B;  2QGF B;  3IBF B;  4DR6 F;  1HMV A;  1UKU A;  4Z37 A;  4O3S A;  2X7I A;  2XYH B;  1VQ7 S;  2QYC A;  4LSN B;  3T5J A;  2VQE F;  1X31 C;  5ETT A;  1HR0 F;  1Q8B A;  4OZJ A;  3TUJ C;  3SDE B;  2CZ4 A;  3MAH A;  4OZ2 A;  3PY8 A;  4C7Q A;  4RNF A;  4DR7 F;  3IFE A;  1CBK A;  3LO3 A;  4O4G B;  3LP1 A;  1NLK L;  2QJ3 A;  4ED1 A;  3HPO A;  2MZT A;  1DQ9 A;  1T94 A;  1VQL S;  3BQ0 A;  4DR1 J;  4NXN J;  1S1X B;  1XER A;  5L1I A;  1X0P A;  3L3C A;  4ECQ A;  3M8P B;  4MH8 A;  3OHB A;  2YQ0 A;  2GVD A;  1LWE B;  4KKO B;  3KLE A;  1RT1 A;  2HVD A;  2AIR B;  4OZ3 A;  3QGP A;  1SJR A;  2VZ9 A;  2KU7 A;  1R0A B;  1ICE B;  2VPY B;  4LIW A;  5KAK A;  3MUV P;  4JP8 A;  3FCV A;  2NRE A;  4DV7 J;  3H40 A;  1MRO A;  5F8L A;  4DFP A;  3PR5 B;  1Q7Y T;  5C7P A;  3ZTQ A;  2NLW A;  4KPY A;  1VC6 A;  1HHQ A;  5FII A;  1RWP B;  4ZJQ A;  2OJ3 A;  4HAC A;  4GVB B;  4P9S A;  2MGZ B;  2LFV A;  2JC0 A;  2CPJ A;  1NEE A;  1WI8 A;  1QTN B;  4FXV A;  2PII A;  2KG0 A;  3I0R A;  4FBU A;  2LXU A;  1YWX A;  1XN9 A;  2EFG A;  1NDP A;  4UZB A;  3OFF A;  4CO5 A;  2XUL A;  1TFY A;  1LK5 A;  2EEY A;  1MSW D;  3TJ8 A;  2ZC4 A;  3GP9 A;  1REV B;  4P2X A;  1VQ6 S;  3M2U A;  1NZA A;  4A8Q A;  4ID5 B;  2BJ9 A;  2XC9 A;  4FF3 A;  4B3T J;  3FCW A;  1TL3 A;  1NB2 A;  1MWZ A;  1RT4 B;  3MR2 A;  4IOC Q;  4FYV B;  6FDR A;  3M8S A;  4LFA J;  4L3K A;  4JI8 F;  5J2N A;  3BPD A;  4ZK7 M;  3FSI A;  2OTJ S;  2Q66 A;  1RKJ A;  1RSC A;  3IWX A;  4JI5 F;  2VBY A;  3N9U C;  2ZE2 A;  2FLP A;  2PEH A;  2W24 A;  5T7L B;  2BBE A;  3UD3 P;  5DO2 A;  1WDT A;  3MR6 A;  3RR7 A;  4CDI A;  5JMN A;  3UPF A;  3PKM A;  4NI2 B;  3N5F A;  3C3L A;  3HVR A;  2IRY A;  4DV5 J;  2J6T A;  3V4M A;  1RUS A;  2XGP A;  2YPZ A;  4QW8 A;  5HAO A;  5J1N A;  2BRL A;  3TVZ A;  1RWU A;  3CE8 A;  2KT2 A;  1I3O B;  3SZ2 A;  2DY1 A;  4C48 A;  1FO1 A;  1U2C A;  2D9O A;  3BV8 A;  4EBD A;  4DUZ F;  1TAQ A;  2IFX A;  1FRH A;  5HBM B;  1KFD A;  4CH1 A;  3A3N B;  5LXR A;  2G9O A;  2LQB A;  2HWH A;  1YIT S;  3TAM B;  3A3P B;  4ZPB A;  4ZLN A;  4ZCM A;  1TQL A;  4OI6 A;  5BYQ A;  4AND A;  4C4W A;  3N4W A;  2HHS A;  4F8R A;  2I5J B;  3JTO A;  2UUB F;  2V67 A;  1QAI A;  1U6F A;  1W25 A;  1VQK S;  2UUA F;  3IP0 A;  4NPO A;  4P7V A;  1RAE B;  1GXT A;  4ZLL A;  1AUS L;  2KG1 A;  1XMO F;  1VYA A;  3QO9 A;  4OHZ A;  2XQC A;  1FK9 B;  3NOG A;  5CZV A;  4QR1 A;  1U2R A;  2W9A A;  4U8Y A;  2WVC A;  3ISN C;  4OQJ A;  3MAA B;  5HAN A;  4ZP9 A;  2RDD A;  1DFD A;  1S1U B;  3KHG A;  4B3O B;  4DQI A;  4RW9 A;  2LU2 A;  4RW7 B;  4ECS A;  2DGT A;  1UTA A;  3IR6 B;  4ATN A;  4AQY F;  4U96 A;  2X1A A;  2QL5 B;  1NO8 A;  3RU0 A;  4LF7 F;  3GB0 A;  3D68 A;  1YQH A;  1OWX A;  1AFI A;  4IKA A;  4NCG A;  5JXS A;  7FDR A;  3M1V B;  2FZK B;  4DR5 J;  3KK2 A;  1EB0 A;  1N33 J;  3U27 A;  1IBL F;  2OHD A;  2Z0G A;  2HBZ B;  4DL5 A;  3Q23 A;  3K89 A;  1BGX T;  3D3C J;  2IM3 A;  2V63 A;  1CUL B;  1HA1 A;  4E0D A;  5FLX U;  2OPQ B;  1R6V A;  1ARO P;  1PCA A;  2RT3 A;  1XWL A;  3CCV S;  2LDY A;  2GMH A;  2UXC J;  3CW2 C;  4IFV A;  1UWB A;  1HFE L;  3TEG A;  3QZ7 A;  4GKK J;  1N0U A;  3BZQ A;  2OEJ A;  1VQO S;  1RE1 B;  4ZHR B;  3CTR A;  5DM7 Q;  2BJE A;  4ZCI A;  4OZ0 A;  3UFC X;  4PWD A;  2FZC B;  2WHO A;  3BSC A;  3IR5 B;  4X4S A;  2QL7 B;  3I5B A;  1UA0 A;  3BSN A;  4CNZ A;  4C8Z A;  2XCA A;  2C42 A;  4IG3 A;  2K7J A;  5A2Q Y;  3OL6 A;  2ZM6 J;  3R27 A;  1JJC B;  1U1K A;  1FXR A;  1U0H B;  1IKX B;  1JIH A;  4MJK A;  1UAW A;  4ZVT B;  2EK1 A;  2CNL B;  3H7H B;  2WB1 D;  3PFE A;  4F02 A;  1NND A;  3EZU A;  1RCO B;  4ZJO A;  1HNI A;  3CCT A;  4P73 A;  5THW A;  3BR8 A;  5KFQ A;  2DK2 A;  2E7V A;  3HSG A;  2CDQ A;  1KLN A;  3Q83 A;  2A0F B;  3MWB A;  4KGV B;  2FVS A;  5L9N A;  1B0T A;  2HQ3 A;  1TV6 B;  1H98 A;  4JV2 A;  5E2Q A;  3TAR A;  3SV4 A;  1RBO B;  5A6P A;  2NUH A;  2AX0 A;  1D8Y A;  1HQU B;  3TP2 A;  2CQP A;  2O1P A;  4AT1 B;  2CIM A;  4KR0 B;  4ICL B;  5K8O A;  2ZH5 A;  3TAN A;  3P4U B;  3UR3 C;  1HNZ J;  4NXM J;  3ZZ0 A;  1S49 A;  3L7U A;  2BZ2 A;  1QDU B;  4DPT A;  1RXO B;  1U1P A;  3X1L B;  3KFW X;  4DI6 A;  4V1A k;  2B9W A;  4F4K A;  4LR8 A;  1OY6 A;  5GAG U;  3MPD A;  4JI0 J;  3NCQ A;  1Y0H A;  1QSY A;  3EVW A;  2BJ7 A;  2C2M B;  2GO8 A;  5E3P A;  4EO6 A;  5HVH A;  3GIJ A;  1N0V C;  3KLF A;  4HDH A;  4USJ C;  4KFB A;  3EPI A;  4I69 A;  3MEK A;  2P5V A;  3OFH A;  3PRB A;  2XG8 A;  2ZEJ A;  4CLF A;  1UZH A;  2YTC A;  3KK3 B;  5DG8 A;  3HFZ B;  1O51 A;  4Q44 A;  2B4U A;  1OYD A;  4H4M A;  5HMX A;  3AH6 A;  1TKZ B;  4DL0 C;  1N34 J;  4KO0 B;  4JV1 A;  4DX5 A;  1TL1 A;  1APS A;  4OFZ A;  2KRB A;  4M95 A;  1B0P A;  3VF0 B;  1JLG A;  1Q78 A;  1SJ3 P;  2Z8Q A;  4BWM A;  4PUO A;  2XNR A;  3MM7 A;  4CLS A;  4FNH A;  4UTG A;  2Q1L A;  2C2O B;  5CAA A;  2I9S A;  4ZA1 A;  4V19 X;  1FX4 A;  3KUH A;  2WVF A;  3CME S;  3UR0 A;  2VQF J;  4Z7C A;  4ALZ A;  5KG7 A;  3HO1 A;  3D3B J;  1UVJ A;  2XSJ A;  5IS2 A;  4BWJ A;  5F3Z A;  2LCW A;  3F41 A;  1RAF B;  3U1N A;  2UV8 G;  3MM5 A;  2GX8 A;  3QT8 A;  1P6T A;  3H59 A;  3DGP A;  4UUW A;  5D78 A;  2C2Z B;  1TEL A;  4M5G A;  1EZZ B;  1YJU A;  1IBM F;  2GNK A;  4DV0 F;  3PYF A;  4ZIW A;  2AZ1 A;  1S7I A;  3MR3 A;  1KS2 A;  1PJ6 A;  3VAG A;  1FJC A;  1TU0 B;  5E41 A;  3D7S B;  4DV6 F;  2PEB A;  5IQ6 A;  4JI6 J;  3AOD A;  3OVA A;  4TN2 A;  1HL6 A;  1S0O A;  5HMW A;  4K2J A;  1KTV A;  1LFP A;  4DUY F;  2QL9 B;  2Y1J A;  3P6Y C;  1LWF A;  2FGC A;  3F44 A;  1CJK B;  3I96 A;  4OL8 A;  3BH7 B;  2PE8 A;  3R5J B;  2YVS A;  3H5X A;  4DX7 A;  2W2Q P;  2FDN A;  1K44 A;  2IC3 A;  2F65 A;  4I64 A;  4ITS A;  3H90 A;  1FKP A;  2OPP B;  2MZ1 A;  3E01 A;  3GYN A;  3M2V B;  2UUC F;  1F9H A;  2B56 A;  3MPY A;  3IAM 9;  4NRT A;  4PCQ A;  1DTT B;  4X4V A;  5EWE A;  3H2L A;  4RBT A;  1CG2 A;  3BRE A;  2R7T A;  3M6V A;  1L3T A;  1YZ7 A;  1GT8 A;  2YX7 A;  2E1P A;  4OYI A;  2PMW A;  2EFQ A;  3RB0 A;  1SJ4 P;  3LF0 A;  4DR6 J;  5GMD A;  4OZ1 A;  1AZS A;  4JUZ A;  4Y2I A;  2KB2 A;  2IBO A;  2VQE J;  3EPG A;  4ZS6 A;  4CM2 A;  2Y0S D;  1IKY A;  2EFV A;  4AFF A;  4C2M A;  1HR0 J;  3FNN A;  3MUT P;  2JLE A;  2JEJ A;  2VFV A;  2E5H A;  2QYG A;  1JXL A;  3AQO A;  1TVR B;  4A8Y A;  2ROE A;  1VQP S;  5GAG I;  1VLY A;  4DL2 A;  2B4V A;  2W4P A;  2PSZ A;  3M8P A;  2POK A;  1LWE A;  2DR9 A;  4KKO A;  3UNG C;  5A2Q U;  2V4Q A;  1FKA F;  3UD5 A;  1GMU A;  2B5J A;  3L9Z A;  4TXS A;  2KVI A;  5EWF A;  3CDE A;  5E0O A;  1N32 F;  3TAP A;  3PHT A;  4DPY A;  4NLG A;  1PJ5 A;  5RUB A;  2QA4 G;  2W9C A;  4DS4 A;  3R1L A;  5KT2 A;  4UY8 5;  2AYG A;  3CJS A;  2F8E X;  4F26 A;  3AXK A;  3BBF A;  4O3Q A;  2M7S A;  3EYZ A;  2F63 A;  2V8P A;  4X4R A;  1AUD A;  1B4S A;  4GVB A;  2F5G A;  2HYI B;  3PYD A;  4YB5 A;  3R6G B;  1FFW B;  1HHS A;  1TL5 A;  1IM4 A;  3ZTP A;  4X66 J;  1DQA A;  4K4W A;  3HVT B;  2H4Y B;  3FGV A;  3QSY B;  5LSR A;  3EMT A;  3HHE A;  1UZD A;  4USW A;  2N7C A;  4NLX A;  5KOX A;  4C8N A;  3R7N B;  5L1K A;  1REV A;  4IQM A;  4ANE A;  1X4D A;  2AGP A;  4MYU A;  4ID5 A;  1RAA B;  3KUG A;  3FSX A;  2KXH A;  1GQE A;  2ZH9 A;  3Q89 A;  1HWU A;  3VAF A;  4QWE A;  5BR8 F;  4B3S J;  2UZA A;  2MQL A;  1JJ4 A;  3G6V A;  1KLM A;  2DBB A;  2UVV A;  5KFV A;  2L9N A;  1MMN A;  4CLT A;  4DSF A;  4OHY A;  3QIP A;  3MD3 A;  3PJW A;  1KBR A;  3SCK E;  2VF3 A;  2FQQ B;  2XMW A;  3CXC R;  1WC3 A;  2OO4 A;  4Q45 A;  1AA1 B;  3ENQ A;  4G65 A;  2ZHO A;  2XY5 A;  2MZQ A;  4GKJ J;  5D4N A;  2QMX A;  3I4P A;  2HZC A;  1GNK A;  2CNK B;  1SVD A;  2V6A A;  4RR5 A;  2HND B;  3IG1 A;  4NWB A;  3O5T B;  4LRA A;  4NRU A;  2F3J A;  5B0D A;  4JYA F;  5KFS A;  5CAB A;  2A1B A;  4ILL A;  2FLL A;  2YXL A;  4DQS A;  2M4M A;  2WBM A;  4PPZ A;  2XEX A;  3BBB A;  5JVH Q;  3W2V A;  3I5C A;  1LEO A;  3SBM A;  2DNO A;  2U2F A;  1SL0 A;  2HQF A;  3RB3 A;  3NKY A;  4PG4 A;  2B9E A;  3HHD A;  4HVZ A;  2ZVS A;  1FJ7 A;  1TZ0 A;  4M5N A;  1HD0 A;  2EW9 A;  3HDS A;  2PI4 A;  2B7C B;  2L9W A;  3B54 A;  1HI1 A;  4L74 A;  1UA1 A;  2Z30 B;  3T5H A;  3UQS A;  5KFT A;  3IO1 A;  4DUZ J;  1S9G B;  1M5K C;  3OSP A;  5A8W B;  4B3R J;  2IDE A;  3HZG A;  3I82 A;  2G0C A;  3J7A 1;  4PPD A;  4XIU A;  2MQ8 A;  1WTF A;  4FF1 A;  2DHG A;  5KFC A;  4PEO A;  2KZM A;  4Z2X A;  4ECR A;  4TY8 B;  4CYU A;  3IWL A;  4LRB A;  4HT5 A;  2VBW A;  5AXM A;  2DNK A;  1FK9 A;  5U47 A;  5HP1 A;  1RAG B;  5AXN A;  2DD8 S;  1VJW A;  3M2R B;  2E5J A;  2HS4 A;  2UUA J;  4DV2 F;  1S1U A;  3NP5 A;  2OEK A;  2QLB B;  1QTM A;  4KPC A;  3LGH A;  2QA4 S;  3E8O A;  1FTC A;  4B9U A;  1W2B R;  3X3U A;  2NUU G;  3BR9 A;  3FQL A;  3H4B A;  1C4A A;  3IRX B;  2V2Q A;  4ECX A;  2DIT A;  5I3P A;  1SC3 B;  5A76 A;  1XMB A;  2IRU A;  3Q8P B;  3DRR A;  4QOT A;  1Q8I A;  4A48 A;  4B9L A;  3GQC A;  7AT1 B;  1RIS A;  1Y3J A;  5L1L A;  1KTQ A;  4JI1 F;  2CXE A;  4WZQ A;  2OPR B;  4K4S A;  3CDW A;  4LF7 J;  2FJE B;  5IFM A;  2J7K A;  2RML A;  2OPQ A;  3M05 A;  2COL A;  3JAM Y;  4DQQ A;  4C8L A;  4ED8 A;  2HW3 A;  3PW4 A;  3LP2 A;  1RT7 B;  4LSL A;  1IBL J;  3OTB A;  3O1L A;  2D3Z A;  2DEI A;  3QAT A;  4I68 A;  2DXE A;  3EGZ A;  1ZA2 B;  1I6J A;  4LF6 F;  2M0G B;  4NYO A;  3M8R A;  5T14 A;  1T8E A;  5B0B A;  2YKM A;  1URR A;  3O44 A;  1SV5 B;  3J80 Y;  2R8H A;  1KOO A;  1C1B B;  5D4O A;  3CCR S;  5D3G A;  1HKA A;  3VQT A;  2P8I A;  2C3P A;  4KC5 A;  4ZVR B;  1Y3K A;  3FKB A;  1XEZ A;  3MEG A;  4EYH B;  1YZ6 A;  2KYZ A;  2R7Q A;  5ETS A;  3ISZ A;  4I56 A;  4X65 J;  4IOB A;  2V4J B;  4M5D B;  1HQE A;  2JRS A;  4ZPD A;  3QJL A;  3CJ2 A;  1RI7 A;  4K0K F;  5KFE A;  3GG0 A;  4I6W A;  2PMH A;  4O3N A;  2CPZ A;  2LKZ A;  3NNH A;  2GJ2 A;  1KOH A;  1PKU A;  2AEJ A;  3MEC B;  6AT1 B;  2YNH B;  3GLJ A;  3VHQ A;  1GK8 A;  4USH A;  1VC0 A;  1PYT A;  5DRK A;  4WFZ A;  5HJY A;  4KE5 A;  1JK9 B;  1NZ8 A;  3M30 B;  1HQU A;  4KHP F;  4DPU A;  4ICL A;  4NML A;  2ZBI A;  2EC2 A;  2HGN A;  3NGS A;  1PG5 B;  2OPS A;  3KOA A;  1AFJ A;  2BE2 B;  3MCS A;  4LF9 F;  3W8G A;  1ZAV A;  3VAI A;  1RP5 A;  4WKY A;  2EFN A;  4PR6 A;  1R0C B;  3GTY X;  2AJ0 A;  3BGR B;  2HBR B;  4Z7Y A;  4LRC A;  1FER A;  1RHU B;  5IV4 A;  3NGR A;  1VJQ A;  2KHC A;  4L76 A;  2M2B A;  1HBU B;  1VRT A;  3M8Q A;  4EWT A;  1X9M A;  1HAR A;  8RUC A;  3EVO A;  2YY3 A;  1YX2 A;  2H9Z A;  1FES A;  1FDN A;  2MLY A;  1F2G A;  2BX6 A;  4ZP8 A;  1X4E A;  3MTJ A;  1JXV A;  5KG3 A;  4PG7 A;  2H1Y A;  2YKN B;  3ENV A;  1HNV A;  1FF2 A;  4OI4 A;  2BR0 A;  3MM8 B;  3TI0 A;  2DNG A;  3I6P A;  4J9P A;  1LKZ A;  4USM A;  2M8D B;  1SQF A;  3KK1 A;  2HAF A;  4HYK A;  1NHV A;  2NSC A;  3H5Y A;  4GC7 A;  2DCL A;  3AB2 B;  4DSJ A;  2AT1 B;  3BO2 A;  3G2X A;  2WSE C;  4JBC A;  2CG8 A;  2KZZ A;  2HWI A;  1NK7 A;  3M9M B;  1JQG A;  1NH7 A;  2I8E A;  5KFW A;  4I4B A;  1KQK A;  4U7U K;  1MML A;  2B8P A;  3D5M A;  1SKW A;  2Z4P A;  4DQR A;  3GIK A;  3PG9 A;  3V4I B;  3HP6 A;  2NYI A;  1VI7 A;  4YS2 A;  2AEF A;  2QT7 A;  1NAQ A;  3LH2 S;  1CJU B;  1RA6 A;  2FVP A;  3NBP A;  1R8H A;  1NKE A;  1N5Q A;  4QBU A;  1JWW A;  2OFG X;  3KNA A;  3DKD A;  4OYO A;  3DYA B;  3FCH A;  4Q8E A;  3N0V A;  4MIB A;  3OPK A;  3EXY A;  4DV3 J;  1J5O A;  2C2N A;  2BA9 A;  4IFY B;  3IBW A;  2UVU A;  1BQN A;  2LVW A;  5IWA F;  2BKP A;  1KVJ A;  1IBM J;  4Q2M A;  1MMD A;  2I6W A;  4MTP A;  4EBE A;  2MY8 A;  3NG8 A;  2GHP A;  2VDI A;  3EGV A;  4I7F B;  4DN0 A;  4MKB A;  4GO7 X;  1NCL A;  1HWI A;  3IGV A;  3DNC A;  3RB6 A;  4U7U D;  3KUE A;  4CO2 A;  2VG5 B;  4YR0 A;  2ZHA A;  2B6A B;  3T41 A;  3FVY A;  2M9K A;  4U8V A;  1DTT A;  4LVO P;  4DQP A;  5J2P A;  3A12 A;  3GON A;  1YI2 S;  3NGT A;  2MKH A;  3JAM U;  3MM6 A;  5KFO A;  1EIY B;  1VIX A;  2HFS A;  4F7V A;  2KT5 A;  5H9E K;  2P9E A;  1ZTT A;  2Z2M A;  3ONQ A;  4ZVE A;  3CIM A;  3P5T L;  5ETM A;  1SQE A;  1KP6 A;  1V3S A;  3UO0 A;  5KFL A;  2XO6 A;  4X62 F;  2IYG A;  4FVM A;  3M6U A;  2E9T A;  3G6X A;  1G3O A;  3GIR A;  1Q53 A;  4KTQ A;  4IR9 A;  3HHL D;  3H25 A;  3AD9 C;  4RW8 A;  1UFL A;  5FDL B;  3K57 A;  3R9L A;  4JI2 F;  2R4F A;  1KHW A;  1S1W A;  1SKR A;  2FZG B;  1VK8 A;  4LBH A;  2G4B A;  3GWC A;  1JLF B;  2VV5 A;  3EDR B;  4GVL A;  2LMI A;  4ED2 A;  1F5C A;  1N5Y A;  2F40 A;  5IOL A;  4Y2C A;  4C97 A;  1BXN A;  4CO0 A;  2E66 A;  2NCK L;  4LFB F;  4J9L A;  3B6B A;  2VU5 A;  1F2H A;  1EAY C;  2F8H A;  1AYE A;  2C2D A;  2K3K A;  3U1L A;  3ZO7 A;  1N32 J;  2BVZ A;  1VHF A;  3A8K A;  2OMO A;  1S4F A;  3FFI A;  4DZD A;  5KFD A;  1TP7 A;  1WD6 A;  1T95 A;  4Y2K A;  3W7B A;  1IN0 A;  2W7A A;  1R8B A;  2N4D A;  2JL9 A;  2WOM A;  1Q16 B;  3MF5 A;  3O2I A;  3M9N B;  4RUH A;  2ZUG A;  2DH8 A;  3DLG B;  1I94 J;  5H9E J;  3GU0 A;  1U1L A;  5KFP A;  4J37 A;  2KFY A;  3H42 A;  3K5P A;  2R7U A;  2OH2 A;  1KNZ A;  2Y9H A;  2JX2 A;  3W5Y A;  3CED A;  4LJM A;  3JSM A;  3PCO B;  1NJX A;  4YQW A;  1R3N A;  1PYS B;  3K5O A;  3JYT B;  1IM6 A;  1ZM4 A;  4DXL A;  5DM6 Q;  4O44 B;  2VL1 A;  5BR8 J;  3AOC A;  1WOO A;  4WTY A;  2CAD A;  2ZZN A;  3BKF A;  1RWM B;  4UOH A;  4M8L A;  3AT1 B;  3BF4 A;  3PR4 A;  3IC1 A;  1ZM3 A;  2F1F A;  1LW2 A;  4CIO A;  4RJV A;  4PZV A;  4LF8 F;  4C0B A;  4MIA A;  4NA1 A;  2JNJ A;  3RUB L;  2O66 A;  1Q1K A;  4NLS A;  5E5N A;  4FXW A;  1AT1 B;  4ECU A;  4D3H A;  4K4V A;  2HVI A;  2FJW A;  4PYD A;  3IGN A;  3T9Z A;  3OL9 A;  4DPX A;  3PXG a;  2C2K B;  4FNI A;  2L41 A;  5LM7 E;  4JYA J;  3GJT B;  1S57 A;  2MKJ A;  3R3T A;  2ILZ A;  1RAB B;  1QSS A;  5EUH A;  2XS2 A;  2UXB J;  2GAH C;  3NY0 A;  4W98 A;  4Q8F A;  2VDH A;  2XZW A;  2KVQ E;  3ZNU A;  2NZC A;  1SB6 A;  1K73 T;  4NXN F;  2B0G A;  1LXN A;  2L9D A;  2N82 B;  3P8B B;  1S9G A;  1DAX A;  5KFI A;  5A8W A;  2HQD A;  5CYM B;  4DOZ A;  1QUP A;  2AX1 A;  2ACY A;  2XYG B;  3NGK A;  1KHV A;  2DB1 A;  2I2Y A;  1C0U B;  4JI7 J;  5AE1 A;  3TX8 A;  1UPM B;  5BYR A;  1YJ9 S;  1FKO A;  3A8J A;  1FTR A;  3SCI E;  2HHH F;  1GMW D;  2RNE A;  4DV7 F;  4FS2 A;  1RWW B;  4J9V A;  2IRX A;  2KTQ A;  2RS8 A;  5DZ6 A;  3FQK A;  4LBI A;  2B4O A;  4DX8 H;  3M2R A;  2VIC A;  2VB6 A;  4L75 A;  3R7B B;  4B9S A;  4C9D A;  4QYR A;  2B9Y A;  4F3O A;  1GTE A;  3PYG A;  2PDA A;  2UU9 J;  1U2F A;  4YOE A;  4ETZ A;  1UFW A;  4DL6 A;  1K9M T;  3R5B A;  4CRJ A;  4F04 B;  5J2M A;  2PO4 A;  4UF4 A;  2YH1 A;  3UWT A;  1VOM A;  3C15 B;  5F8N A;  3DLE B;  1CSJ A;  2DGS A;  2IA0 A;  1UEK A;  4M5L A;  5D0E A;  4A47 A;  1TL4 A;  4M63 A;  1M1K T;  5H9F K;  4CH7 A;  5DQI A;  3D1O A;  2E1R A;  3C66 A;  3F73 A;  2RVJ A;  2C2R A;  5DLG A;  2XSF A;  3FRZ A;  4EEY A;  1IR0 A;  2XMU A;  2XI2 A;  5ITH A;  2AV5 A;  2ROG A;  3KLG B;  4C0O C;  2CDR B;  1RDR A;  2ALY B;  1URN A;  4UUX A;  2V8V A;  4RBU A;  3BS9 A;  2GC8 A;  4DV1 F;  3RRK A;  4PXB A;  2C28 A;  4F3M A;  4KQZ A;  5CH7 B;  2FHO B;  4IRK A;  3T1H J;  4QIV A;  4WYL A;  5F41 A;  3D1H A;  4C8M A;  3QMQ A;  1SV5 A;  3CF5 Q;  2WZ1 A;  1C1B A;  1S6Q A;  1WG4 A;  5KFJ A;  1I1G A;  2HIY A;  4WE1 B;  1RT2 B;  1K47 A;  4PXC A;  3PO5 A;  2WW8 A;  5DG9 A;  2BAN B;  2RD5 C;  4W4M A;  4LF6 J;  1TUG B;  4RKU C;  2MEW A;  1I5O B;  3LAM A;  1U1Q A;  3ITH B;  3LA0 A;  3GE9 A;  3KLI B;  1B7Y B;  2DVI A;  3FC9 A;  4M5D A;  3UCU P;  1LWC B;  3OUY B;  3CJK B;  4HR2 A;  4CTA A;  1VFJ A;  5HSP A;  2JFD A;  4NLV A;  4A4J A;  2BOP A;  2DIV A;  3D66 A;  3MEC A;  4C11 A;  2DNY A;  1UP1 A;  2Z2L A;  1SI9 A;  2XYP B;  1TTH B;  1X4A A;  5H9F J;  1YBU A;  4K0K J;  3T5K A;  2PD1 A;  3VAH A;  4K59 A;  4L3N A;  3DRP B;  2ZH6 A;  3QAE A;  1N8R T;  4URG A;  4KHR A;  4WU2 A;  1DAR A;  3NAH A;  2BE2 A;  4LUB A;  1OMS A;  4DU8 A;  4GRS A;  1DTQ B;  4KHP J;  1LOU A;  1BHN A;  1VQ9 S;  3AFG A;  1N48 A;  2DEJ A;  2FJB B;  3NMR A;  2QIF A;  4WYW A;  4A8S A;  1W26 A;  3SFG A;  1EKR A;  1HW8 A;  3GFH A;  3HF5 A;  2SXL A;  5KFR A;  5HRO B;  4QPT A;  3W9I A;  4LF9 J;  2GVZ A;  5C2G A;  4K4Y A;  4NLP A;  3RAM A;  3FEZ A;  2C3Y A;  1EP4 B;  2YNG B;  1JLB A;  4BCA A;  3DLB A;  2VC1 A;  3MZI A;  3JTN A;  1HHT P;  4ID8 A;  3KG0 A;  4YR2 A;  1TMJ A;  5J2Q A;  2CPH A;  2Y8Y A;  4P2S A;  3R5C A;  3TAQ A;  4X4N A;  4DR5 F;  2BKN A;  3JTP A;  4YDX A;  1H7X A;  3GR0 A;  4NLO A;  4RW6 B;  3OJS A;  1XIQ A;  4OI1 A;  2LU1 A;  1RT3 B;  3HHL C;  3RZA A;  4MK7 A;  4QIE A;  2H4W B;  4ZPV R;  5L38 A;  9ATC B;  3QYY A;  4CLL A;  3S8S A;  1H3D A;  3CPW R;  3WBZ A;  5I3U A;  1FNM A;  1B7F A;  2MPU A;  2D7S A;  3K5N A;  1UET A;  1NM2 A;  1T7P A;  5H1S V;  1WC4 A;  4BLG A;  5KFH A;  3IWN C;  2DR6 A;  2DNN A;  3ZZU A;  3MUR P;  1K0V A;  3KHH A;  3NWG A;  4HH0 A;  1IBC B;  2I1R A;  4DG1 A;  1CJU A;  2V0N A;  3OVB A;  2AJQ A;  4OIX A;  2ZM6 F;  1T03 B;  3I0S A;  4A8X A;  3CMA S;  3LOU A;  4O3O A;  5B0G A;  2D3U A;  3OXL A;  3OR2 B;  4U95 A;  1RLC L;  1T05 B;  3PHE A;  3IA0 A;  3HSD A;  3IXQ A;  1VRU A;  1RTJ A;  4DHV A;  2HRT A;  3A1Y G;  4ZVH A;  3BH6 B;  3J81 j;  4EO8 A;  1BY9 A;  4F0H A;  1S77 D;  1Z2L A;  1BE4 A;  1FVS A;  2XMJ A;  3I9Z A;  2E29 A;  5AT1 B;  2J9C A;  5LMU J;  3R8Y A;  4AXI A;  2AKW B;  4K50 A;  1QUV A;  5HL7 Q;  2W2N P;  1HNZ F;  3TUP A;  2HVH A;  5HI7 A;  2HMI A;  3HHL A;  5J1E B;  1CLF A;  1L3K A;  2VG5 A;  1Q4R A;  2B6A A;  2HRU A;  2GGP B;  1Q5Y A;  4B9M A;  3UCZ P;  3OXG A;  4ZPA A;  4JI0 F;  1RT5 B;  1XK8 A;  4EYI B;  2WTF A;  3DOM B;  1U7L A;  1T0T V;  3FEX B;  5CHC B;  3RBE A;  3PIP Q;  2IVF B;  3DMJ A;  4OYA A;  2LQ5 A;  2KFZ A;  4O3R A;  1MN7 A;  1WHY A;  3NRB A;  3UW1 A;  2OSQ A;  4LF5 J;  5KOW A;  2QMW A;  4P6Q A;  4YUD A;  2VBZ A;  2E9Z A;  1SJ1 A;  3GFZ A;  1V6H A;  1G6B A;  2XS7 A;  2JH3 A;  2J6S A;  3FUY A;  3TYT A;  1F0X A;  4DR2 J;  2ATL A;  3D6T B;  4HTI A;  2WSC C;  4DR3 F;  2FPH X;  2DGQ A;  2W2P P;  4MFB B;  4XPE A;  2J8A A;  2V2K A;  3QGI A;  2VIH A;  4X62 J;  2ZZM A;  3CGI A;  1A6L A;  4H4K A;  1JLF A;  1YBT A;  5IM0 B;  3NGD A;  3TQE A;  4N47 A;  4F67 A;  1R0B G;  4IUF A;  1QAX A;  4NZ6 A;  4Q43 A;  3LTO A;  2IJR A;  2GQC A;  3BB5 A;  4I2P A;  4TU7 A;  4C3M A;  5C5J A;  4IRD A;  1U1N A;  2VUG A;  4DL3 A;  1E6Y B;  1IKV B;  3MGJ A;  3T19 A;  1Q79 A;  4TU8 A;  2PFD A;  4LFB J;  1QVG R;  1RWK B;  2LA4 A;  4C8O A;  1WHV A;  3NWR A;  2DYA A;  1JLQ B;  3CD0 A;  2D3O R;  2DKO B;  3LWM A;  2EVZ A;  3EGN A;  3ZZR A;  2ZH4 A;  3LGN A;  3AB4 B;  5A8R B;  1QE1 B;  2BJ3 A;  2LXF A;  4KSE B;  3DLG A;  3G6E S;  1X60 A;  4MAK A;  4X2B A;  3KHR A;  1VQS A;  2D3O 1;  3W66 A;  3W1Y C;  3E2E A;  3BDP A;  4J9O A;  1IBK J;  2V2Z A;  2DNM A;  3OR1 A;  2FY8 A;  3G82 A;  4K8R A;  1JLA A;  3D6H B;  3TO8 A;  3Q2S C;  3JYT A;  2CQG A;  1QY7 A;  3LWL A;  4RNM A;  4FYX B;  2DT9 A;  4KJI A;  4Q0B B;  2C3O A;  4PYA A;  1XNQ J;  1HYS A;  5KFF A;  1XNR F;  4WFX A;  1S9E A;  2GMJ A;  3QLH B;  3UI3 A;  3RTV A;  3HKZ D;  4LBP A;  3DOK B;  4ILR A;  5I42 B;  1Q86 T;  5DDO C;  5CYQ A;  1DLO A;  3I56 S;  4G1Q B;  4FF4 A;  5D0R A;  3E3X A;  1L3S A;  1NJW A;  2GML A;  1S0N A;  2HNY A;  3SMZ A;  1S59 A;  1MWQ A;  1TMM A;  1RTD B;  3CDB A;  2J9D E;  2RU3 A;  1GMW A;  2HUR A;  2DR5 A;  4P52 A;  2CYY A;  1CS4 B;  4JV5 J;  4NLR A;  5CQG A;  3UDL A;  4MIW A;  1F5A A;  4LF8 J;  1X4H A;  5D77 A;  1P9Q C;  1JLC B;  2IAJ A;  2K1R B;  2VPZ B;  4RBV A;  5CCL A;  1ZTW A;  5D6G A;  4FYD A;  2ZIT A;  1R8C A;  3D6M B;  2WSF C;  1E6V B;  1K0T A;  2DGV A;  2R8K A;  2E1A A;  1N5S A;  2HSE B;  1S6P A;  1OO0 B;  5C25 B;  1T3N A;  2IMW P;  1KRP A;  1HPZ A;  1RU2 A;  3MR5 A;  1IKW B;  2J9D A;  2QTW A;  1M5O C;  1SC6 A;  2ZWO A;  5EWG A;  2V4R A;  1C0U A;  3W2W A;  1WHX A;  3N79 A;  3ZZO A;  2APO A;  4NA3 A;  4FBT A;  4MKA A;  2EXU A;  2BE7 D;  2RS2 A;  4DL4 A;  2EFO A;  2DNP A;  5A0Y B;  1M1G A;  1VBK A;  1ZM2 A;  3ADA C;  3DI6 A;  2KM8 C;  1TKX B;  2XLI A;  2KL8 A;  5J1P A;  4R0J A;  5ETR A;  2W7O A;  1YRX A;  2HHH J;  1S1V B;  2DR7 A;  1N56 A;  1D9A A;  1SBR A;  3G86 A;  1JXE A;  1ZZN A;  2WON B;  4X66 F;  4NLU A;  3HVW A;  2JHE A;  1SH0 A;  5HLF B;  1EET B;  2B7B B;  1N54 B;  2BM0 A;  2XMV A;  3NNA A;  3KJN B;  2GJI A;  4L72 B;  2N7Y A;  3W9J A;  1LW0 B;  3C15 A;  3NMA A;  2PN6 A;  3G71 S;  3JXO A;  1GX5 A;  2VAS A;  3BM7 A;  3DC2 A;  1NJI T;  3DRS A;  1LK7 A;  3GV5 B;  1N6Q B;  9RUB A;  1M5V C;  1HBO B;  3EE3 A;  4B3S F;  5E3R A;  2LQ8 A;  1LV5 A;  2ZOF A;  3I87 A;  5IC6 B;  5DGA A;  2YNI B;  4RL1 A;  2HHV A;  4Y0F A;  3W60 A;  1R8P A;  2DNL A;  3CC7 S;  1OSD A;  2M8H A;  1UWA A;  2FIU A;  4KBI A;  4NLW A;  1C0T A;  4B08 A;  4AE5 A;  1YKW A;  4MK8 A;  3EX7 B;  2MKC A;  4MKY A;  1U24 A;  4KH0 B;  1RAH B;  4GKJ F;  3GJQ B;  1EHW A;  2C22 A;  3L7P A;  5K14 B;  1UVM A;  3POT A;  4IH7 A;  2ZWP A;  2UV8 A;  3PX4 A;  3D6F B;  3RGI A;  1Y5I B;  5I4M A;  4IDK B;  1KSP A;  2HAI A;  1WI6 A;  2UVW A;  2YWH A;  4DV1 J;  2OML A;  1XR5 A;  2E5L F;  3WDO A;  1XTZ A;  2Q43 A;  3MMB B;  4D3G A;  1KEK A;  3MCN A;  3Q24 A;  3KLI A;  2F7V A;  1JJH A;  3TNV A;  1FRI A;  3MED B;  2XGQ A;  3OUY A;  2BJ8 A;  1FFS B;  2NQP A;  2VHG A;  2G2O A;  1BQM B;  1DUR A;  2JEG A;  1X5P A;  4ZLJ A;  2LA6 A;  1HMV B;  3GZ7 A;  4XDC A;  2DGU A;  1T11 A;  3BGL A;  5B08 A;  3ET6 A;  2MHN A;  2A10 A;  1V3Z A;  4B3R F;  5CD4 H;  3TW0 A;  4DCJ B;  5GMK a;  1BMQ B;  3KKF A;  3PEH A;  1SL2 A;  5GAD U;  4DR4 F;  2GJF A;  4JI4 F;  3RYL A;  2YWG A;  3H5S A;  1PO6 A;  3QWP A;  3IMQ J;  3BDE A;  2XCP A;  2EG2 A;  1WC0 A;  3LP1 B;  4HLB A;  3MMC A;  1ZET A;  4ZVP B;  3VZH A;  1DTQ A;  2VC0 A;  2YKA A;  4N76 A;  2NPF A;  3MEE B;  1S12 A;  3I5A A;  1GXU A;  3K7R A;  2VFR A;  2R8J A;  1OYE A;  5HVG A;  1XR7 A;  2HNZ A;  3THT A;  1RT1 B;  2G13 A;  3WIV A;  3G9C A;  1NPP A;  2OFH X;  2QG9 B;  5K20 B;  2D69 A;  3PRD A;  2K3I A;  3LW5 C;  3G96 A;  4UQG A;  3T1Y F;  3JB9 k;  4EZ9 A;  4CCH A;  1EP4 A;  3CD7 A;  3MPW A;  2K06 A;  2DNZ A;  1X9S A;  1A9N B;  3DM2 B;  2W1B A;  3L95 X;  1S5Z A;  3BGO P;  2P6T A;  4LRD A;  3C6T A;  3ZTS A;  2K8G A;  3W61 A;  1DZ5 A;  4OZN A;  4HAC B;  1D3W A;  3TJA A;  4ZP6 A;  5LSL A;  2IM1 A;  1O5J A;  2H51 B;  2JWN A;  2P9G A;  1RT3 A;  1VQM S;  1VIO A;  1T9Y A;  4IQX A;  1QVF R;  5K9F A;  1IR2 A;  2FHM A;  3IBC B;  3I0R B;  1JLE A;  2X1B A;  2CPF A;  4RUC A;  2ALZ A;  1H73 A;  3GSI A;  2MKI A;  1Y11 A;  5T41 A;  1KD1 T;  2AYB A;  3CCJ S;  3HSJ A;  2FC8 A;  2LEP A;  3VVU A;  2ZJR Q;  4WU3 A;  1TL3 B;  3CCQ S;  2AZ3 A;  4NEY A;  5CZX A;  1QJH A;  3ZNJ 1;  2PA3 A;  2GO9 A;  4OYX A;  4URQ U;  3M9O B;  5DQG A;  3CCL S;  1KWM A;  5J2N B;  1T03 A;  2Y1L B;  3DDK A;  3M6W A;  2ZE2 B;  5LMN F;  1FXL A;  2R7X A;  1WNE A;  1JKH A;  4N8O A;  4YDD B;  2B3T B;  4X65 F;  2NZ4 A;  1U26 A;  2CPE A;  2QO3 A;  1R8A A;  2MY7 A;  3VV2 B;  2ZBR A;  2XMA A;  2QRR A;  1CJT A;  5DDR C;  2FVR A;  4Q2L A;  5F3T A;  2RUG A;  2GHW A;  1RTI A;  4KIA A;  4PWW A;  4DLE A;  4TQR A;  1M0S A;  3R1H A;  1MU2 B;  2AJ4 A;  3CJ3 A;  1QM9 A;  4NCA A;  5HVF A;  2C3M A;  3KJQ B;  2EWH A;  4ZVS B;  3P49 B;  2LEC A;  5J1E A;  2KI2 A;  4NEZ A;  2CQ3 A;  3OL8 A;  2A2D A;  4CLW A;  3GYG A;  1FDA A;  3D1Q A;  2GGP A;  2MKS A;  3M32 A;  4CP5 A;  2MZR A;  2A6M A;  1WKJ A;  4ECT A;  1RBL A;  1KQG B;  4CI0 B;  3HFV A;  3ULH A;  3V6D A;  4NZ7 A;  4C98 A;  3G8Q A;  1R89 A;  2D1C A;  3THV A;  2IM2 A;  3T6B A;  3MCM A;  4X84 A;  3G8T A;  5GAD I;  1WEX A;  2F8M A;  5KT3 A;  2CQ1 A;  1OY8 A;  4UST A;  3QO9 B;  2HWT A;  3MR7 A;  4IG0 A;  2HZA A;  1PIL A;  5AE2 A;  2HKE A;  5ETL A;  5D0H A;  4O4R A;  2GIF A;  2HGM A;  5CXT A;  3TJ9 A;  3KJV A;  3T3F A;  3AHP A;  1YIJ S;  1CEZ A;  2XLJ A;  2IJN A;  3B78 A; 
#chains in the Genus database with same CATH homology
 1Q0N A;  4M5K A;  1F9H A;  2F63 A;  3MCM A;  4PZV A;  5ETV A;  1CBK A;  3HSZ A;  3KUE A;  1KBR A;  1HQ2 A;  3HCX A;  1EQM A;  4M5M A;  2CG8 A;  5ETP A;  1RTZ A;  3KUG A;  4M5H A;  5ETQ A;  5ETL A;  4CWB A;  3HT0 A;  5ETS A;  2QX0 A;  4M5G A;  1G4C A;  3HD2 A;  3QBC A;  3MCN A;  1TMJ A;  3UDV A;  3UD5 A;  3MCO A;  1EQ0 A;  4F7V A;  3ILJ A;  3IP0 A;  5ETO A;  4M5L A;  4CYU B;  4M5I A;  4CYU A;  4M5N A;  4AD6 A;  1HKA A;  3ILI A;  3HD1 A;  1RU1 A;  1RAO A;  1TMM A;  1IM6 A;  3KUH A;  2F65 A;  3ILL A;  3ILO A;  4M5J A;  5ETR A;  3HSD A;  5ETN A;  1EX8 A;  3HSG A;  1RU2 A;  4CRJ A;  5ETT A;  3UDE A;  5ETM A;  3HSJ A;  1RB0 A;  2BMB A;  1DY3 A;  5ETK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...