2FHOB

Nmr solution structure of the human spliceosomal protein complex p14-sf3b155
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
GRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords spliceosomal protein SF3b155
publication title NMR solution structure of the human spliceosomal protein complex p14-SF3b155
rcsb
source organism Homo sapiens
total genus 14
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhoB01
2DGWA 4CH0S 1RKJA 2U1AA 1YHQS 1SJ3P 2JVOA 2QFJA 1ZH5A 2I38A 2YTCA 1VQ4S 2MKCA 3G96A 2OIHA 2MMYA 2M88A 1M5VC 4BS2A 2HYIB 1VBYA 1X4CA 1SJFA 2KI2A 2OJ3A 2RU3A 3RW6A 2F9JA 1SJQA 3MXHP 5BJRA 2CPDA 1Q86T 3P3DA 1K9MT 3DXBA 1D9AA 2KRBA 3CC2S 2DIUA 2HGLA 1WWHA 5DM7Q 3SMZA 3MUMP 1M1KT 1K73T 2MB0B 4F25A 3MI7X 5IQQA 1X4DA 2CQIA 1VQ8S 2DNRA 2M7SA 2MPUA 1N54B 3B4DA 2EK6A 1WG5A 1P1TA 2CPEA 1R8HA 1X4BA 5DDPC 3EX7B 1P27B 1FJ7A 1PO6A 1X5PA 1JJ4A 2RS2A 1U1PA 1UP1A 2LQ5A 4FXVA 1QVFR 3CC4S 1G2EA 2LKZA 5LJ5Y 2ADCA 2CQ3A 1OPIA 2CQ2A 2XSFA 3DLLQ 1YWXA 4TLQA 2OSQA 2RQ4A 2CPJA 3ZZZA 2KVIA 3CCMS 3BO3A 2HVZA 5GADU 4WF9Q 4IO9Q 2DNMA 2PE8A 2LEBA 3VAIA 4C4WA 4YOEA 3HI9A 2MHNA 1UAWA 1FXLA 3I55S 5GAGU 2YH1A 3MOJB 1VBXA 1YJNS 4Y00A 5ITHA 3H2VE 1KOHA 3K0JA 2FPHX 2NLWA 5CA5A 2KXFA 2N3LA 2OTLS 1WEZA 1X4EA 1O0PA 3VAHA 4TU7A 4PKDB 2FC9A 2DNQA 2AYMA 1U1MA 1U1RA 4V19X 4YUDA 2CQ0A 3P49B 3D2WA 3CULA 1DBDA 2CPZA 4U67Q 2MSSA 2X1AA 2CPYA 1VQOS 1QM9A 5IM0B 5D77A 2CQGA 2DGOA 2MSTA 5HL7Q 1M5KC 2DGSA 3UCGA 3ZZYA 2HZCA 2KU7A 4WFNQ 2LYVA 4QPTA 4W90B 1OO0B 3US5A 1FJCA 4IOCQ 4M5DB 2J0QD 1VQNS 4QU7A 2J76E 1IQTA 2DO0A 1HL6A 2RS8A 3V4MA 1D8ZA 1KOOA 3B4MA 1XN9A 3CCES 1X4AA 1S79A 2M2BA 2N3OA 4WIIA 3S7RA 1YTYA 5IFMA 2DHGA 2U2FA 3CCQS 4IUFA 2AYBA 1U1KA 2KRRA 1VQ5S 1DZ5A 3RW7A 3PIPQ 2XS2A 1N52B 4A8XA 3NNCA 1NJIT 1WTBA 1NU4A 2M70A 1X5OA 2MKHA 3VALA 1AUDA 2CPXA 5DDOC 1JMTA 3THPA 2UP1A 5DM6Q 2DH9A 3CCSS 3UWTA 2MJUA 2LEAA 2A3JA 1ZZNA 2D9OA 1HA1A 3JB9k 3THTA 2MKJA 2OTJS 1NO8A 2MGZB 2JX2A 4Z2XA 3CXCR 1DHMA 2K8GA 2MKSA 1WHWA 5JVHQ 5FJ4A 1H6KX 2K3KA 2KM8B 2CPFA 1VQKS 4LMZA 3MD1A 3UE2A 2YWKA 1F9FA 4FXWA 2OSRA 1KC8T 3CCUS 2RVJA 2CQ4A 3ULHA 2M52A 3U1LA 3R27A 2DHXA 2G0CA 2DB1A 1U6BA 4J5OA 2DNZA 2E44A 2MYFA 1X4FA 2RQCA 3CCJS 2M9KA 3SDEB 2DH8A 1HD1A 2MY7A 1WEXA 1X5TA 2XS7A 1BY9A 2X1BA 3MURP 1K8AT 2ZJRQ 2D9PA 3J7YU 2LCWA 3MUTP 2WBRA 2LA4A 5CYJA 4WKRA 1WG1A 3LQVA 1X0FA 1L3KA 3SXLA 1X5SA 4WFAQ 1FHTA 1JJHA 2CQDA 5DDRC 1U6FA 2DNNA 5LXRA 2B0GA 3BEGB 2EK1A 2SXLA 1UFWA 1WHXA 2LMIA 2QEXS 2F9DA 3CMES 2M0GB 1YJ9S 3S01A 2FY1A 2LXIA 2MZTA 2XNQA 2LA6A 4C7QA 2MKKA 2PEHA 4CIOA 5DETA 5D78A 4RU2A 1WHYA 3MUVP 2ADBA 3UD4P 5HO4A 4P6QA 5LSLA 2VOOA 2L08A 2MY8A 2AYEA 2RNEA 4F02A 3TP2A 1URNA 2DGTA 2DITA 3J7ZT 1WF0A 2MZ1A 2KG0A 1RK8A 2E5IA 3G4SS 1SXLA 2MQQA 5CXTA 4QU6A 2YH0A 1R8PA 1WI6A 3G8SA 1KD1T 2CJKA 1U1NA 1OWXA 2MQOA 2VODA 2E5GA 3EGZA 2BZ2A 2J0SD 2HGNA 4UQTA 2MQLA 3NS5A 2KG1A 5H1SV 3CF5Q 1HD0A 3NNAA 1SJ4P 2DISA 1YITS 4QQBA 5JVGQ 2RRAA 2ERRA 1M5PC 3Q2TC 1X4HA 1VC0A 2CQPA 1A9NB 2M4MA 2MQPA 3CCVS 1SJRA 2YKAA 3FEXB 2MKIA 1FT8A 5GVQA 2J8AA 2DIVA 3HHNB 3LPYA 2V94A 3CCLS 2AD9A 1VQ9S 2MXYA 1WG4A 5DDQC 5LJ3Y 5MLCV 4YB1P 1U1QA 4UY8T 2DK2A 4CQ1A 2MJNA 3G6ES 1VQMS 2N82B 3CUNA 3UD3P 2CPIA 2DHSA 2O3DA 4ED5A 3BO2A 4WFBQ 3BS9A 1YJWS 1Q82T 1WELA 2L9WA 1QVGR 4OZ1A 3MD3A 5EN1A 3UCUP 3VF0B 1OIAA 3OW2R 2CQBA 4ERDA 2XS5A 1W2BR 2QA4S 2CPHA 1H2UX 3MDFA 1M5OC 1M90T 1FO1A 3VAJA 3VAFA 2FHOB 3CTRA 2E5HA 3TO8A 3U1MA 1VQ6S 3EGNA 2DH7A 2L41A 1PGZA 3VAGA 2AYGA 2X1FA 3IRWP 1U1LA 1YIJS 2DNKA 3I56S 3CPWR 2RT3A 1VQPS 1VBZA 2KH9A 4C0OC 1ZZFA 1VQ7S 1VC5A 1FNXH 4LIRA 3VAMA 2DNGA 2DHAA 5GMKa 2XB2D 1Q7YT 2NZ4A 2D3OR 2RUGA 3CC7S 5IM0A 3VAKA 2G1DA 5GAHU 4TU8A 2E5JA 3NS6A 3FEYB 3S8SA 2CQ1A 3P5TL 2FC8A 2JVRA 3G8TA 4PR6A 2I2YA 2MZQA 1U2FA 3TYTA 1DRZA 2CQHA 1Q81T 4ZKAA 3N9UC 2N7CA 1CVJA 2DNLA 4F26A 2DGQA 1WEYA 3H2UB 2GHPA 4EGLA 2DNOA 1FJEB 1JJ2R 2Q79A 2CQCA 2MQNA 2LECA 2DO4A 2LXUA 3NMRA 4PRFA 2M8DB 2HGMA 3G71S 3UCZP 1VC6A 2G4BA 1S72S 1YI2S 5GAEU 1VQLS 2DGVA 2KN4A 3CCRS 3R1LA 2KXNB 2BOPA 2MZSA 1N8RT 1A7GE 2KXHA 4LJMA 4WCEQ 2M8HA 5LSOA 3G9CA 1H2VZ 1H2TZ 1KQSR 2F3JA 2KT5A 3CMAS 3R1HA 2DGUA 2KYXA 2MGZA 2MZJA 2ZJPQ 1X4GA 4Y0FA 2KFYA 2MZRA 2DNPA 5LXYA 2KHCA 2VONA 2MQMA 3Q2SC 4CH1A 2GO9A 3P6YC 3L3CA 2VOPA 1U1OA 2JRSA 4W92B 2EVZA 2XNRA 3CD6S 1B7FA 1UW4A 2DNHA 4TU9A 2ZJQQ 4OZ0A 1WI8A 3S6EA 4IOAQ 2X1GA 1WHVA 2JWNA 3BO4A 2RRBA 3PIOQ 1N88A 2DGXA 3SDEA 2KM8C 1WF1A 3NNHA 3IWNC 2DNYA 1WF2A
chains in the Genus database with same CATH superfamily
1IKXA 3RUBL 2R7RA 3O2IA 2J7UA 3AJDA 1LV5A 2HHTA 1VQ4S 2VC0A 4ID5B 1S0OA 4RLEA 4HHUA 1BE4A 4PWUA 3NGKA 5D3GA 1WC5A 4FP9A 4WE1A 2BJ7A 4B9SA 3MGJA 4FN5A 4YEAA 2CPEA 4J7CA 2HS4A 4RW7B 3PW4A 2QA4G 2LKZA 5K9FA 2Z0GA 3T1AA 1KRPA 4DR5F 2LEBA 2WSEC 4C4WA 1UWBA 2JDJA 3MFHA 2ABYA 3QGGA 4WP3A 4FXDA 4NCGA 4CWBA 1DTQB 4B3RF 5MAOA 3R7SB 4HH1A 4IYQA 3ITHB 4YUDA 4ED6A 5KFUA 2DR5A 3K7RA 3SCIE 1S9EA 1N6QA 4AL5A 2ZUAA 5DGBA 1RHKB 1HBNA 1S1VB 3L95X 2OGUA 3R5JB 1HNXJ 4WP9A 4M5DB 2LU1A 3H90A 2P6SA 1RLCL 3ENWA 1FWPA 4QU7A 4DL4A 1UEUA 1G7CB 1RAIB 3CWJA 1R8CA 3CDUA 2AJ0A 1YTYA 3QLHB 3CDAA 2XMMA 1FRIA 1SKRA 1WKLA 4V19J 2GVDA 2LU2A 1S48A 2CPXA 3ETOA 1R6VA 3D0HE 1Y10A 2D9OA 1ULRA 4QIVA 3Q8VA 3V6HA 3PKYA 2M3DA 1NEEA 5KFKA 4FXWA 4AXJA 2CQ4A 1NSKL 4EUVA 3R27A 2F8HA 4P75A 1X9SA 4LBIA 4ZCMA 1IVZA 1W2IA 1S97A 3LAMA 3A3NB 4M5NA 1R6YA 3V6JA 3WQPA 1OYEA 4ELVA 1BY9A 3G8QA 1WC4A 3C8YA 2Q43A 3MUTP 5CYJA 2NSCA 1RT5A 3HKZD 2FVSA 4B3SF 4QBUA 2B0GA 3I31A 3R5CA 3CDWA 4EMDA 4CNZA 5T41A 3VZIA 5IOLA 1CJUA 2FY1A 2B9YA 4K4VA 2KZZA 4C7QA 1OSCA 4K4XA 4AL6A 2DEIA 1FX4A 5HO4A 2RJZA 2VIHA 4OZ3A 1NDKA 2V4RA 5KT2A 2QC3A 2BJEA 2D3ZA 1NDLA 2HSEB 3EGZA 4OI3A 2XWXA 3HKWA 3QAEA 3DLEB 2RRAA 1U47A 2ZITA 4CLUA 2CQPA 4QWDA 2QGFB 4QWBA 4E0DA 1KN6A 3G2XA 3DGVA 2C3MA 3GP9A 3EWGA 2HRTA 3V6KA 1VQ9S 3M9NB 4KGVB 2MJNA 2EBGA 1RWOB 3MR3A 1S0NA 2O67A 3JQKA 4CZCA 3M2RB 1XMOF 1RJJA 2YKNA 3BH6B 4TQSA 1UWAA 1PYOB 5J2QB 4LF1A 2HKEA 3HM9A 2LQJA 3GWCA 4Q8FA 2XMJA 2FLLA 4DV4J 4OYWA 3RB4A 3IGVA 1HNIB 3M30B 4OHWA 1HYSA 1CG2A 2AYGA 3IRWP 4FF2A 1U1LA 3CPWR 4J9LA 1VQPS 1VBZA 4ZCKA 1FNXH 1IKYB 1FEEA 5GMKa 2XB2D 1FRMA 3L7UA 1XR7A 2NREA 1P6TA 1E6VA 2FC8A 4B9UA 2MZQA 2IIHA 3K8VA 2MTLA 4K0KJ 5KFZA 4WZMA 4R8UA 1M5HA 2E7WA 1RAEB 2DNOA 3L7PA 4DSJA 3FZBA 2HGMA 3RBEA 4JV2A 2BQUA 1TKZA 1VQLS 2KN4A 1G1XA 2OPSA 4TY8B 4LFBJ 3TAPA 4M5MA 2BOPA 4QOTA 4WCEQ 2KXHA 4KFBA 4DPTA 1REVB 5LSOA 3QZ7A 2FLPA 1CJVB 1PIEA 2W01A 2RU9A 5IC6B 3LOUA 4LSLA 2KYXA 2GHVC 4NYPA 2DNPA 3OL6A 5IWAJ 2RAQA 1FKOB 2PIIA 3HVRA 3ZTPA 1REGX 4CLWA 4P2FA 3PJ9A 4B9LA 3ENVA 3EUNA 3MM8B 4M8LA 4CLLA 4F7VA 3D66A 4L3NA 3ENAA 5B0AA 1M0SA 2JJ4D 2J6UA 1NSQA 3W1YC 4O3SA 4X4RA 1M5VC 1VBYA 2W7OA 1UVNA 3TVYA 2RU3A 1Q8LA 2OLWA 4KKOA 4DR1J 5BJRA 1KDNA 1Q86T 4LFAF 3AY0A 3TA1A 5D8HB 2NXJA 1MWYA 3IAS9 2K3IA 1N54B 4D3GA 1PILA 3NXZA 2DPJA 5GMEA 4HDGA 3NGSA 1IM4A 1S12A 2XY6A 1S59A 1S7HA 2FVQA 2ZBPA 3ZZZA 3WDOA 4DXLA 1BWEA 2BBEA 4YB7A 1SI9A 2MHNA 1UAWA 1VS3A 1QE1B 4ER8A 1X60A 5KFTA 1RACB 1RT1A 2AW0A 3BYPA 2ZH1A 3KHGA 5CA5A 4V19X 3RZAA 1WORA 4GO5X 5A8KB 1V9OA 3CE8A 4F4XA 4CM2A 3R6LB 2V8HA 1HWUA 3WHIA 1H3DA 1QSSA 1R0BG 4DFMA 2Y0BB 2HFSA 4IFYB 4IR1A 3IS9A 2NUUG 1D8ZA 4CT8A 1KOOA 2HNDA 3B4MA 2W2PP 4RW8B 2OPPA 2VPZB 4WIIA 4F0HA 3GIIA 5DJBA 5A6PA 3OV7A 4U7UK 1DZ5A 5F8GA 3D1OA 3L09A 3CEDA 1LW0B 3K5NA 1X5OA 1AUDA 4NLRA 3THPA 2EG1A 2DH9A 3KHLA 3GPAA 3OJUA 1NKEA 1HNXF 3FJ2A 4USUA 4ZLJA 1WHWA 1YJUA 3VQTA 2ZZMA 2V6AA 4MKVA 3H59A 2BKOA 2M52A 3AD7C 3PKMA 1CLFA 4N8OA 2XMTA 1ELOA 1VFJA 2DJWA 2X1BA 4DQPA 1U7LA 4BWJA 2IRYA 4CLTA 4L72B 2LCWA 3DM2B 4IH6A 4OJ1A 1HFEL 2Y0SD 1SIZA 5H9FJ 3PEJA 3THVA 3A3PB 3BQ0A 1OJ4A 2WBMA 3NAHA 1U26A 3D6MB 4DQQA 3HVWA 2MY8A 2YQ0A 2HVHA 3K17A 1R3NA 4QU6A 5D6GA 1RYRA 1T3NA 4LSNB 2PFDA 3LP0A 2FZCB 2BRKA 2D1CA 3UN2A 1CJKA 1P9QC 1N5SA 3NNAA 2UUCJ 2WCXA 2M4MA 3SZ2A 4LRAA 1T9XA 3HHNB 4FF3A 1HBUB 4IFVB 1RTJB 5CZXA 2W25A 4Y6IA 3IP0A 3SQGA 3W63A 3AJ1A 2V8GA 2QJ3A 1XR5A 3OFHA 3M8QB 2W8LA 1U09A 3MDFA 2F5GA 1HNWF 1MN9A 3UVJB 2RT3A 4M94A 3CIMA 1YRTA 1G3OA 3DRSB 1DFDA 3OFFA 2XG8A 1FFSB 1YJ7A 1RWVB 5I42A 4PR6A 1RAJA 1F1BB 5F8IA 1VBKA 2VB6A 4CTAA 4LFCJ 3LO3A 4ZVFA 3DOMA 2GX8A 3H5XA 3MEGA 4C3LA 2MQNA 2LXUA 3JYTA 2G4BA 2V68A 4X66J 4DSFA 2DGVA 5KG0A 5HK4A 4ZPCA 4ATNA 2IVYA 3BGRA 3UDEA 2KXNB 3CO9A 4NLQA 2D74B 4CH7A 3IN5A 3ADAC 4WXOA 1IWGA 1IKVA 2XZDB 1DLOA 3IR7B 3AOCA 1LK5A 4QJVA 3KLEA 2ZH4A 3U02A 3V5RA 2JWNA 1HQ2A 2RRBA 2VFVA 2DGXA 1XK8A 4DCOB 1MN7A 3IWNC 1S6UA 1D8YA 4LFBF 2ZBQA 2UXBJ 3GQCA 3HO1A 2QFJA 1SL0A 4NLPA 4ED2A 4DPYA 3WC0A 1T9WA 4L3KA 3TI0A 4BS2A 3TAQA 3NGUA 1CS4A 2PMHA 1S1UA 1SJFA 2FDNA 1UFKA 2F9JA 3GG0A 5HP1B 4ITSA 4K2JA 1D9AA 3DLKB 4TLRA 3RRGA 3GYGA 1GH8A 1LWFB 1T03A 3IWLA 3CJKA 3H5YA 1XIQA 1A0OB 4NYOA 1FD2A 2CJQA 2FZKB 3T1HF 4ZVRB 2A2DA 2CQ2A 4CM0A 4DQIA 4N77A 1GMWD 2HLTA 2E7XA 4USIA 2H3EB 1J5OB 2WHOA 3Q89A 3GV7B 1H98A 3C16A 1H7XA 5DQGA 2HK2A 5CD4H 2QYCA 2VG7B 3RJMB 4M5GA 1QTMA 2FPHX 1TAUA 3VAHA 4PKDB 1X9WA 1U1MA 1RI7A 4RNNA 3D2WA 5F8LA 2PD1A 2ZC3A 4I6WA 1RA7A 3PW5A 3D0GE 2MQ8A 1TUVA 1FJCA 1S5ZA 4RNMA 3GFZA 4ICLA 3ZNUA 3VZHA 2QMXA 4ETZA 4ZJQA 2AYBA 3D4JA 3RW7A 2B5JB 1QSLA 3P5BP 5HBMA 4KTQA 3MEKA 2JEGA 2ZDOA 4OV6A 1U2RA 4WP8A 3UDVA 3J7Z5 4Y2AA 4YQWA 1DHMA 1UZDA 1C1BB 1FNOA 2RVJA 3LP2A 3M8SA 1PJ5A 1U0HA 2EFOA 4HKQA 3AD8C 2GA7A 1VQYA 2PMWA 1HD1A 1LOUA 3ZC4A 1FRLA 4JI4J 2YNIA 2HS0A 2C28A 4KQZA 1S0MA 3VGUA 3LQVA 3GJTB 2PSZA 4ZLPA 1T05A 2H1YA 2BKPA 2SXLA 4LUBA 3JQMA 4YP3A 2M0GB 1S7IA 4DV0J 2GJFA 2XNQA 3BSOA 3CJ8A 4U7UD 2FHMA 4HACB 2VOOA 3IR6B 1AA1B 4L75A 4F02A 3JAMY 2MZ1A 5B0GA 5C2CA 2P5VA 4ID5A 1CULB 3IM8A 3TA0A 5HJXA 2F4FA 3HF5A 3HLUA 3F41A 5IV3A 1HQEB 1VC0A 1GFWB 2HAFA 2OO4A 3N6LA 2AD9A 2UV8A 2V8PA 4DS4A 2DK2A 2A18A 4NX9A 4RW7A 3HX9A 1FTCA 2XYPB 3N5FA 1AROP 5AJ3F 4MJKA 1ZAXA 4BLGA 4TYAA 2XY7A 4OZ1A 2IM1A 2CQBA 1VQSA 4NZ0A 2NYHA 3NOGA 4F4KA 2W4DA 2GIRA 1DTQA 4FYXB 2HWHA 4LRBA 3RYLA 3ITHA 4CLFA 3PZPA 1Y5NB 1RZMA 2JLGA 3CD0A 5C24B 4QR1A 2D3OR 1IQZA 2RUGA 4X2BA 4DR2F 4ES1A 2QG9B 1S1VA 3I6PA 3ENQA 2VH7A 4DMZA 1V3SA 4DEZA 4M5DA 3N9UC 2N7CA 4ECQA 1WEYA 5KFDA 2GHPA 3T5KA 4DI6A 1JJ2R 2Z57B 2ZZNA 3QLHA 1FFGB 3N28A 3J81U 1RAHB 4PYDA 2DT9A 1BHNA 4PG5A 2OEKA 4C0BA 2R7XA 4I56A 3MAAB 1HHSA 1JB0C 4F3QA 1TMMA 4MT1A 2YNGB 4LFCF 2H5EA 5CZVA 2ILZA 4ZPAA 3P6YC 2EVZA 2VA2A 1YJVA 2ILYA 3GLJA 3UD5A 4X66F 3NNHA 1MWQA 2ZHOA 4PQAA 2NYIA 4CO1A 1NKBA 2JVOA 5E3AA 1EIYB 2I38A 2V2VA 1PC5A 3G96A 3G86A 3QPIA 4I6YA 2OEJA 5F9LA 3RW6A 4WXWA 2J9DE 5L1LA 1RDRA 4DU8A 4JB8B 2C2DA 5KTQA 2M7SA 2EFGA 3M9MB 4EYIB 1X0PA 3EX7B 4QR2A 1GMWA 1Y00A 3QRRA 2IJNA 2D3O1 2UXBF 2ADCA 2OFHX 3TX8A 2ZC4A 1SPBP 4KRWA 1YWXA 1WJ9A 2KVIA 4DR7J 3O44A 1VJQA 2L9DA 4HEA9 3HI9A 3DLEA 4UQGA 1ZOTA 3MMCB 3W60A 3H5SA 3UI3A 3DCAA 1W7WA 4QW9A 4DZ6A 4ANDA 4G3IA 4U9RA 2OPRB 2CPZA 3T5HA 2C22A 5K5MA 3M2RA 1RHJB 3RBZA 5I3QA 5HANA 2KKHA 2KU7A 2B8QA 4I68A 3SSRA 4XIUA 4PYAA 4P7TA 5BR8F 5J2QA 2Y3YA 3T1YF 5E33A 3CJ4A 2IVFB 4NXNF 4ZP9A 2UUBJ 2UXDJ 1HNIA 3M30A 3NRBA 1XN9A 2N4CA 3GMGA 2OD4A 2CJ9A 4PPZA 4NWBA 2NPIA 1IKYA 1Y7PA 4ZOSA 2ZVSA 2XO7A 2HVEA 1UL3A 3M8RA 2HBZB 4M95A 3CCSS 3PW2A 4GO7X 1R27B 5ETSA 4HTJA 3KHHA 3CXCR 4USWA 3TARA 2GNKA 1VQKS 3ELHA 5A2QU 3HHLD 4ED8A 1U8WA 2G0CA 3EGVA 4C8OA 2E44A 4TY8A 7AT1B 1REVA 2QL9B 1CJVA 2YY3A 1U6FA 3DHXA 2EK1A 1JLGB 5J2NB 1FKOA 1EQMA 2HHVA 2LXIA 3P8BB 2MKKA 3GYXB 3MPVA 3D28A 3FSIA 1WHYA 3H20A 3MUVP 1N33J 3MCMA 2XGQA 3OTCA 3MM8A 4OX7A 2L08A 1HLWA 2LLZA 3M6WA 4JI4F 2KG0A 4PXCA 2HIYA 1KD1T 4N5SA 1SL2A 5GAHI 2XMKA 3EXCX 2GC8A 1G6BA 3DOKB 5KT7A 3F0NA 3NG8A 4DX8H 2MQPA 2YKAA 1R0CB 1HR0J 4X64J 2R7UA 2DCUB 3EXYA 4CRJA 4JYAJ 5DDQC 1TELA 1U1QA 4IO1A 4DV5F 4Z37A 4IDKB 5IT9U 3MR6A 4C8ZA 2B4PA 5KOWA 1Q53A 2YX7A 2CWXA 1OQ3A 1S1TB 3JSBA 3NGRA 1QE1A 4NA2A 1S57A 2CJBA 3GCXP 2E5HA 3TO8A 3LH2S 3OVAA 2DH7A 1FCAA 2X1FA 1N5YB 2EWHA 3DLHA 1FXDA 2Z2MA 5A8KA 2DNGA 3EZUA 4JI0J 3UN5A 2E5JA 5F3TA 3P5TL 2JVRA 1U2FA 2ZM6J 3KNAA 1VYAA 4KPYA 1PC4A 2DNLA 4IFYA 1XBWA 4P73A 1EQ0A 4RW8A 5E3PA 1HWJA 1VGYA 2XYHB 2J5AA 2FJBB 3ISZA 3Q0AA 1LW0A 2MZSA 3VHQA 2GMHA 2ZH6A 2X3GA 2GCFA 2VF3A 4USHA 2KHCA 5HI7A 4J9OA 1UW4A 2BABA 2ZJQQ 4FYDA 3KTQA 3EVMA 4Z7YA 1KR4A 2F4VJ 1RP5A 3NWRA 1F6TA 1N88A 2ALYB 4JI2J 4ZN3A 3ZZTA 2G2ZA 3I9ZA 4PG7A 2BX6A 4OLPA 3MEEB 3DM2A 2G9OA 2AT1B 5M2RA 1XMBA 3G6YA 4PZVA 2G0IA 2W9BB 3O3LA 3NCPA 1JLBB 5CCMA 1T0TV 4DV6J 3ILOA 2AMCB 3QO9B 1VQ8S 2KO1A 2V50A 1X4BA 1ZPVA 3GTYX 1PBUA 4WU3A 4P52A 4E8UA 4I0WA 3E51A 2XHWA 4LSNA 2WTFA 4DUZJ 2AX0A 4ZLNA 2JEIA 2CJAA 3A3OB 2E1AA 4NA3A 4IO9Q 4UTGA 2EFNA 2DVIA 5KFXA 2CZVC 1ZPWX 3E01B 4DCJB 4LF9J 1HHTP 3R6GB 1RU2A 2Y1LB 1HBUA 3JSRA 2GAGC 4IFVA 1V3RA 1U1RA 1YDLA 1RTJA 1RA6A 1NK4A 4ZMMA 5CAAA 4ZVPB 4ILLA 1S0VA 1NJXA 4DV7J 1UEKA 1SC3B 2W9AA 3M8QA 2FB0A 1WUUA 3FC9A 3HZEA 3C6TB 2CNLB 1OQ6A 1SC4B 3K59A 3PW7A 1RWWB 3UVJA 2ALZA 1FA0A 4U7CA 4DFPA 1UPPA 3NKYA 3IBCB 3C2PA 3PW0A 3DRSA 1F2GA 1XTZA 4LR7A 3ZZUA 1RTIB 3CD7A 2ROPA 2C2OB 2EG2A 2IMOA 2MKJA 3KNGA 4DV3J 5CYQB 2UXDF 1ZM2A 5M2PA 4I4BA 2H4WB 2PMZD 2RQCA 2GJ2A 2ZOFA 1A6LA 5LMNJ 6AT1B 4PG4A 3BJYA 2LP4A 3FBBA 4PWWA 4M5LA 1WG1A 2XMWA 4CYUB 1FFWB 2UV8G 1BXNA 3ZO7A 1D3WA 1TK0A 3R7NB 2CKWA 4ZP6A 4ZN1A 1JKHB 2DY9A 2R8IA 3T6JA 3R5BA 1Z2LA 3BZQA 4P6QA 3JQJA 1HNZF 3SEOA 5DG9A 3LWLA 3QZ8A 1TQLA 2E5IA 1HPZB 1N32J 4DFJA 3I0RB 2PI5A 5KFRA 3CF5Q 1HD0A 1H0HB 5HP1A 4LF7J 3RBXA 3EYZA 3DLKA 3OXLA 2EC0A 1NJWA 2CZ9A 4PXEA 3M6VA 1LWFA 5ADZA 3DRXA 1TZ0A 4FNIA 1UEVA 4ZPVR 2XC9A 1N33F 1VQMS 1N34F 2CG8A 1F2HA 4DL7A 3BBFA 4RU9A 3OTBA 3QIDA 4OZJA 1J5OA 3MD3A 3DDKA 4F67A 5A6WA 3HFZB 2B56A 2ZNYA 2CPHA 1FO1A 2FHOB 2VG7A 3U1MA 3PR5B 4RR5A 2VJUA 4X64F 3VAGA 4JYAF 3W62A 3PDNA 4U95A 1CBKA 3AXKA 1RCOB 3CC7S 4EBEA 3PHTA 4DPWA 5DLGA 4MIAA 5HJYA 1F5CA 3VV2B 5KT5A 3GR1A 3PG9A 1GTEA 2GAHC 4EGLA 1C2PA 4A8SA 2LDYA 2FGCA 5KFPA 3BGFA 5FIIA 2KT2A 3P45B 2B5JA 1V3ZA 3AT1B 4ECWA 4U8VA 2ZH8A 4XPEA 4JI0F 1R43A 3T3FA 2BM1A 3SYZA 1H2TZ 1HARA 2D69A 1TL3B 2MZJA 1C1BA 2MQMA 2A0FB 3QFHA 3OR2B 3AHPA 2ZWPA 3NCQA 4DLEA 5GAGI 1JK9B 4C48A 1RT6B 5D4PA 1WF1A 3CW2C 3UNGC 3W9JA 3OTOJ 4OV1A 1SJ3P 2P9GA 3R97A 2YTCA 3QJLA 2BACA 1SJQA 2ZHAA 1NK6A 1WDTA 2K2PA 2F4VF 5KFGA 2WVFA 2UUTA 1O8BA 2NXEA 4PUOB 2HW3A 4RWXA 3NP5A 2VBZA 3B78A 4HACA 3IBWA 2OH2A 3W61A 1CULA 2BDPA 2DBBA 4PAAA 3A4TA 3ZTRA 3CCMS 3BO3A 3R8YA 1HQEA 4NE9C 1GX5A 3MOJB 4AL7A 3PO4A 4DV6F 5H9EK 3M6XA 1JLQB 4TU7A 1Q0NA 2E1PA 4WK3A 4X62J 2X1AA 1VQOS 4B9NA 4HT7A 3UCGA 3ZZYA 4EO8A 1T11A 2FY8A 2V9WA 2HZAA 5E3CA 4EZ9A 3HMJG 2LEPA 3DU5A 1N5VA 1JQGA 5CHCB 1NAQA 4X4PA 2HQGA 2PGCA 5KG7A 3BGLA 4J9UE 5C24A 4TQRA 4DX5A 1N52B 3D6FB 3SCKE 1NU4A 4ZVOB 4UZCA 3CCZA 4OI2A 2HG4A 2EFVA 1FXRA 2CVEA 3M32B 2VICA 3UWTA 2R7OA 1H6KX 2HPUA 3GSIA 4IKAA 1UVKA 2WZ1A 4LF8F 1XNQF 3R7BB 1DJ0A 3DDNA 1PCAA 1ZM9A 3OVBA 3KFWX 3DRPB 3HFVA 4LVOP 2D7SA 2AJ2A 1WEXA 1F9HA 1WSRA 1YX2A 1IBKJ 3MAAA 4QIFA 2YNGA 4KHRA 5E3RA 4YFUA 5ETRA 2UU9J 4DV3F 4OZ5A 3LW5C 8ATCB 3HT3A 2E1CA 1RT4B 5GMDA 3D9BA 2YNFB 3D3CJ 5DETA 2V2KA 2IMWP 4K4ZA 3DRRB 4DR6J 4B3OB 4UOHA 4GC6A 4DL2A 1E6YB 5LMNF 3KJNB 4J90A 4E2FB 2CAJA 3M8WA 1XNRF 3GU0A 2AJ1A 3AA9A 2EW9A 3N79A 5KT4A 3QAUA 1NK8A 3MPYA 5DGAA 3WBZA 4KAIA 2VC1A 5JVGQ 4HYKA 3Q2TC 4CNYA 4MK9A 3CCVS 3DHWC 3PVXA 4XK8C 3KHRA 5GVQA 4ZPTR 1NZAA 2YKQA 3BR8A 4X4SA 5J1EB 4J9NA 2LQ8A 2B7BB 5L8RC 3PRDA 5KAKA 1FESA 2OELA 1B0TA 3LGNA 2J6SA 3VF0B 2WONB 3OD2A 1NMEB 3MMCA 4O23A 4HH0A 1M90T 3HK2A 4Q45A 2CNNB 3JSYA 1HKAA 4IR9A 3A8JA 3KWMA 4DJBA 1HW9A 2H5IB 2BJDA 2OPRA 5KFCA 2W2NP 4LF4J 5KFIA 3WX4A 4TXSA 3PYEA 4OLOA 1RAFB 5CCLA 3TYTA 5IC4B 3TAMB 3DKDA 2C3PA 3CJQA 1FVSA 4IRCA 1Y3KA 2LECA 2CQCA 3H2LA 3G71S 3OFGA 3MM7B 1YK9A 2R42A 4B3TF 4ES2A 2XMUA 4LF5J 3RBDA 2PI4A 1WC6A 1ROFA 2APOA 2C42A 1NBEB 4QYZJ 4RUHA 1QAXA 2F63A 3OHAA 2PN6A 4CH1A 1DTTB 1ZTWA 4G1IA 3UR0A 1BQXA 4GKJF 1NNDA 1YG0A 1IBMF 3U1NA 1XERA 3IXQA 1XWLA 4YR0A 1V6HA 1AZSB 1QSYA 2KM8C 5C2GA 1BLUA 4C0HA 4M1KA 1X7VA 3MEDB 4NCAA 1RKJA 3BBCA 2U1AA 3MFIA 1CC7A 4YN3B 1X4CA 4ELTA 1JLGA 4M5IA 5J2NA 2EXUA 4ECRA 3FBCA 1BQMB 3P3DA 3CC2S 1WWHA 3IG1B 3SMZA 3H40A 8AT1B 4JI1J 1WG5A 4NASA 2KDOA 1FTRA 3OTOF 4FXVA 2QIFA 4F3OA 4KIAA 4OZNA 4LT6A 5F0WA 2CVIA 2L48A 3QWUA 3DOKA 3QGIA 1TVRB 4KE5A 2R2UA 1NLKL 5E5NA 4RW4B 1YJNS 2F7VA 2AWZA 2IJRA 4GC7A 1U8SA 4CDIA 1KOHA 2KXFA 1TL4A 2OTLS 2R2RA 2G13A 1OY9A 3P49B 4RBVA 4URSA 2IDEA 4IDKA 2V0NA 2HLUA 2P9EA 4DPUA 4ZS6A 4RBTA 3H8YA 2IA6A 4BC7A 1OO0B 1S1TA 3RTVA 5KT3A 4KHMA 2WSFC 3TWZA 3VGTA 2V8VA 4WK1A 2CIMA 1I1GA 2PEBA 2M2BA 2OD6A 5D15A 1N5YA 3W2WB 2QLXA 1Q8BA 1N36F 3V81B 4ECTA 2XS2A 1NJIT 1WTBA 4OJHA 3W2VB 3VALA 1NK7A 1UZHA 2QSFA 4URGA 2BJ8A 3GE9A 2W7PA 1C1CB 2OTJS 1SBRA 1NO8A 4TYBA 4AYBD 4R5PB 1PAUB 5JVHQ 1YZ7A 4DS5A 1KC8T 1KHVA 3W8GA 2RF2B 2BW2A 3EM1A 2AU0A 1NJZA 2GMJA 1KHWA 2JOQA 3B8HA 3BN4A 1BUXA 1TR0A 3T5LA 4A48A 1TL1B 1PJ7A 1L3KA 1VHFA 3SXLA 2F40A 2GV1A 3MCOA 3DOLB 4CP5A 2GMLA 2BVZA 2QEXS 4ZJLA 2A1BA 2EKYA 4QWAA 4L6V3 2PEHA 4KO0B 4OZ2A 1VDHA 2XYGB 2FIUA 5KFHA 4EI2A 4EZ6A 2AYEA 1URNA 1U49A 1RUSA 2VDHA 3MEEA 2VD3A 5FDLB 1NM2A 4B3MJ 4X4OA 2JNJA 2BM0A 3F56A 3HSDA 2G2YA 1K47A 3DC2A 2W9BA 2MLYA 4QQBA 2JFDA 1JLBA 3IAM9 1APSA 3N01A 1JXEA 2IJFA 4C6AA 2CA9A 4A8MP 3DGPB 1RHQB 2W9CB 3QO9A 4RKUC 4W4MA 4KGXB 2QO3A 3FGVA 4J9RA 1XQIA 4CQ1A 3UD3P 2K7JA 4DR6F 2IYGA 3M4XA 4WFBQ 3BS9A 2ZH2A 3L9ZA 3AB4B 3OUYB 1GEHA 2XLJA 3MM6B 2WVEA 1RTDB 3M9OB 3E01A 1OS5A 2E29A 4DDFA 2HHWA 1TUWA 2RE1A 1YIJS 2HQCA 1FD8A 1M1GA 4BDPA 2XSJB 1VQ7S 1ZZFA 2G2OA 3HVAA 3SCLE 2DHAA 3VWSA 1OY8A 1GTHA 1RXOB 1PAEX 2HQ3A 1RCXB 3HFKA 3PM9A 2DKOB 3KG0A 1DRZA 3UN3A 4Q44A 3C6TA 1H38A 2DGQA 2C2NA 4JI5J 4ID8A 5DZ6A 4ELUA 2IBKA 2ZH7A 4A8OA 2AEMA 5KFBA 4I67A 1I5OB 1WOPA 4GKKJ 4KH0B 3TZXA 3C6UB 4K59A 3TZWA 1N8RT 3TJ9A 3Q22A 1RTIA 1EETB 1LKZA 4KGMA 2E5LF 2C2EA 4OYBA 1XMQF 2B9EA 5CYQA 2V8DA 3IM9A 5GADI 2DXEA 3UR3C 1FKPB 1U1OA 1KVJA 4NPOA 1NDCA 4M5KA 4NLYA 2ZBRA 2DHHA 1WKJA 1CPZA 1MW7A 3EZOA 1NXIA 5JMNA 3RU0A 2OHDA 3GIJA 2ASDA 2HHHJ 4CO0A 1FX2A 4CYUA 1AYEA 3JXOA 3B54A 4DPOA 2BKNA 2OJ3A 2VQEF 4DUTA 1VLYA 2ZH9A 1JKHA 3M8PB 3MUMP 2WW8A 3GFXA 4NXMF 2MPUA 1NPKA 2H4YB 4IRKA 3JS9A 5KFOA 1HPZA 4OI1A 1G2EA 2DR7A 3C19A 3OVSA 2ZWOA 3FRZA 4P74A 2HRYA 3I0RA 1HHQA 1EJ7L 3G87A 4UZBA 1RWNB 4ZITA 2XZTB 3MPDA 4Y00A 9ATCB 4H54A 3PX0A 4C8NA 3A12A 2FZGB 2B7CB 3O1LA 3TA2A 1O0PA 2YVSA 2DNQA 2G1HA 2WK4A 2K1RB 3KG1A 4YS2A 3CULA 2J8SA 5IM0B 3IGNA 4Y2IA 3KJFB 1JJCB 2JHEA 4W90B 3ZZPA 1VK8A 1KONA 2M5YA 1ZA1B 3QATA 4A8KA 2LDIA 1KP6A 1T9YA 1X4AA 2N3OA 3A8EA 1FDNA 4DV1J 3N4WA 2HHPA 4WZQA 1I94J 3MR7A 2UP1A 2C3OA 1WC3A 5KFAA 3R5AA 3AOBA 2RKIB 2LEAA 1HA1A 3JB9k 3HXMA 3AFGA 3BV8A 2UUAJ 2KM8B 2EPIA 4IH7A 2YWKA 4JI3J 1F9FA 2KL8A 1QJHA 4NEZA 4RUAA 4EFAC 5IT9Y 4ECZA 1QAIA 3DDIA 4DUYF 1TP7A 2M9KA 4JV5J 4AQYJ 3DYAB 2I1RA 1SQGA 2CZ4A 3J7YU 1ZTTA 3MMBB 2PA3A 2GO8A 1T8EA 1TL3A 2LA4A 4WKRA 1JNZB 2QLJB 5HQLA 3I82A 1FRJA 1FHTA 3M7VA 1WNEA 3EGWB 3OR2A 1WDDA 5E0OA 3M8ZA 1N4LA 5ETNA 2UVRA 4DF4A 4NLGA 1RT6A 5EGYA 1X31C 4A8YA 1RE1B 2CDQA 3CDBA 2H48B 3MCNA 2EI5A 3HJVA 4A8WA 1RT3B 2BE7D 1R31A 1WD6A 2QL7B 2VDIA 3FRYA 1NDPA 2ERRA 2DCLA 4PUOA 2C3UA 1TL7B 2AZ1A 1S1WB 4DHVA 3CCWA 1KFDA 3QNWB 3G6XA 3OTEA 2VQFJ 2HNYB 3CJ3A 4QYZK 4RW6B 1Q82T 2PA8D 2FTRA 2HS3A 1CC8A 1GXLA 4ERDA 2VPXB 4CO2A 1M5OC 4KV8B 2E7VA 1VQ6S 3EGNA 4C2MA 2PC6A 2QRRA 2VPYB 3MM9B 1JLQA 4Q5VA 4C0OC 1Y3JA 1VC5A 4NLDA 4IG3B 1YBTA 2JLEA 3VAKA 2COLA 3FEYB 3DNCA 1JNRB 2POKA 4FF4A 3OT9A 3FCVA 2Z2YB 4X65J 3RAMA 3B6BA 1WOSA 2FJVA 4I2QB 3IWXA 4OL8A 5EWGA 3MR5A 2B3TB 3KLVA 3PTWA 5GAEU 4NRUA 3KK2B 3J80Y 1JLCB 2IC3B 3E2EA 1A7GE 3M32A 3G9CA 4ZIVA 1YRXA 2KT5A 3OXGA 4ZVUB 1KWMA 3TR5A 2KFYA 5LXYA 3EMTA 5LT5A 2VONA 3PNIA 5IXUA 2VOPA 4JI5F 2JRSA 2YNHB 4U96A 1SQFA 3EE3A 2X1GA 1WHVA 3DFEA 1F3VA 2E1MC 1N56A 3DRPA 1KTVA 1TUGB 4NCBA 4K4UA 4ED4A 1EKSA 3BF4A 2GQQA 3CJ0A 4RWWA 1KFSA 2RIJA 1KQKA 2MKCA 1Y5LB 4F8RA 3I5AA 3POTB 3I32A 2KHDA 2BW7A 2ZD1B 2HFOA 4H4KC 1I51B 4MYTA 1RT4A 4JOUA 4LF2A 1RHRB 3AODA 1ZYQA 1FWKA 5EX3A 2YNFA 1W25A 4C97A 5HQMA 3DRRA 2A10A 3V4IB 4B3OA 4I1TA 1E6YA 2Z56B 2QT7A 1U1PA 2LQ5A 1RWPB 1PYTA 1K0VA 1MU2B 1VRUB 2RDDA 4QIEA 3HHEA 1T9VA 2HHHF 1B64A 1GX6A 3TUJC 2CPJA 3LGHA 5J2MB 3JAMU 3V6DB 1B0VA 2DNMA 4DLGA 4OYXA 3VAIA 3K58A 2MLZA 3FQKA 4H4OB 2YH1A 4R25A 2I9SA 3NAIA 4NRTA 3CDEA 3X3UA 3CNQP 1X8DA 4K4TA 1SVDA 1FJGJ 4Z7CA 1FK9B 1WEZA 1X4EA 3ZFVA 3QIPB 3W9IA 2YWWA 4C98A 5J1EA 3N6MA 3JTPA 5DG8A 5L9NA 2CPYA 1NB2A 5D77A 1VRQC 2MSTA 3CCTA 3QT6A 4NZ6A 2NPFA 2WONA 3Q24A 8RUCA 1G4CA 4DCPB 1SQEA 4OI4A 3M1VB 3PHEA 3CCES 2DHGA 2B4UA 5HQ8A 4B17A 4A8XA 4ED7A 3HD2A 2V67A 4BC9A 2DPIA 4LF6J 4A47A 3TAMA 2MJUA 3BREA 3W64A 2WSCC 2FVRA 2JX2A 5ETVA 2XM3A 1O6XA 2K8GA 4DG1B 5FJ4A 3OJSA 1RBOB 3TW0A 2OP5A 4HHHA 3UE2A 5AE2A 3MHYA 4NMXA 4CO3A 3MM7A 4DV1F 1F9EB 1X4FA 4QWEA 1I94F 1U25A 3SDEB 2MY7A 3MURP 4UUWA 2Z4PA 4ZHRB 2ZJRQ 1RQ0A 5KFEA 2Y1JA 1VIOA 5C7PA 3NGTA 1DTTA 4OZLA 1L3VA 2HWTA 4DX7A 1AZSA 4EU0A 2MZTA 2BR0A 1RAOA 4DV4F 1S99A 4J37A 3BR9A 4JV5F 3MEDA 3I0SB 4AQYF 5LSLA 3IRXB 3TP2A 3J7ZT 2VFSA 3OTDA 3J7YI 3QT5A 4IH5A 4ZVTB 2XQCA 1S6QB 5HVGA 4WFYA 4K0KF 2IBOA 3AQOA 3RR7A 1BQMA 4OYAA 4R0JA 2C2MB 3IG1A 2IHR1 1U0SA 3FKBA 1LW2B 5ETMA 1OYDA 2XBPA 2DHSA 4ED5A 4DR4J 3RR8A 1YJWS 4ECXA 2J9CA 1GQEA 4F04B 4B3SJ 2J7KA 3GR0A 1TVRA 1IJFB 5RUBA 2XULA 1W26A 2VBXA 2XS5A 4RW4A 4QCLA 1H2UX 4I6AA 2HQIA 1TKTB 5IWAF 3GJSB 5A76A 2GW8A 5AXMA 3L7OA 2VQFF 3LP1B 3FFIB 3LWMA 1S9GB 1JX4A 2KB2A 3G8TA 3R3TA 2I2YA 4HR2A 1GXUA 2IM2A 4NLXA 5KFJA 2BQ3A 4WBFA 2AV5A 3H2UB 1KVKA 3ZTQA 1FJEB 2Z30B 2Q79A 4DR1F 2W2QP 3W2WA 1B0PA 3TQ1A 3V81A 1IR2A 3W2VA 1XMOJ 4RPFA 2QN6B 2M8HA 1H2VZ 2CWKA 3CMAS 2J0XA 3HSJA 1C1CA 3QQCD 4I7FB 5HROB 2ZJPQ 3LANA 2P6TA 4Y0FA 4R5PA 3EDRB 4EWTA 1K44A 5KT6A 4W92B 2RF2A 3GV5B 2DNHA 4OYZA 2NXUA 4EBDA 2RD5C 1ICEB 2RDJA 3CGIA 1T9UA 2BJ1A 4URQU 1YHQS 1TL1A 2GIQA 2OIHA 3K5MA 4E98A 1NSAA 2BE9B 3DOLA 2BUNA 5L46A 2KI2A 4O4GB 3R2CJ 2F65A 1RAGB 1FI4A 3C3LA 4DSKA 2CPDA 3ZZ0A 2KRBA 1BWVA 4J9KA 2HGLA 1FDAA 5EDWA 1M1KT 1K73T 4KO0A 3PYDA 2MB0B 3QSIA 2FHKA 5IQQA 3ZZOA 2QFIA 1UKUA 3I87A 2F1FA 1N0VC 2WVCA 4CLPA 4Q2LA 5IT4A 1BD6A 2ZDPA 2P9CA 5FDLA 1BQNB 4Q8EA 1EX8A 1VHIA 4EYHB 3CJ2A 3SFUA 1LWEB 4FZVA 2MLXA 2HVZA 4WF9Q 4NYZA 1J5EJ 2ZBIA 3JTOA 4YHHJ 3DGPA 2W9CA 5T7LB 2PDAA 4MTPA 3JSMB 5J1NA 2IVMA 4NL5A 4NLVA 3QRPA 4TNOA 1MROB 5F9NA 3A1YG 4ZVEA 2ZBCA 1PSDA 2BRLA 3OUYA 3DXSX 3K5OA 3US5A 3MM6A 1RTDA 1H7WA 4LFAJ 1Q16B 3CSKA 4USMA 3BSAA 5FLXY 3M6UA 3Q8UA 2NQPA 1FJGF 2XI3A 4DN9A 3CCQS 2XSJA 2QX0A 3BDEA 3GFYA 4F36A 1LFWA 3SSSA 3KMSA 2UVVA 4JI7J 4NLWA 5HMWA 1FERA 3G6VA 3THTA 3KUGA 4HDHA 1YGYA 2X3DA 5T14A 2AZ3A 3KK3B 2YKMB 3MD1A 3CCUS 3ULHA 4LVNP 4HI2A 4J9PA 3U1LA 2UUCF 3TVKA 1UVMA 1FEHA 4DZDA 2HQDA 4HI1A 1GMUA 3C6UA 4ZPBA 2QLWA 2N7YA 2R8KA 4F2RA 1EETA 2RQMA 1Q1KA 2EFPA 4LF6F 2WBRA 4OIXA 4WTOB 5HVFA 2I8EA 1FKPA 3GCWP 4GRSA 3KOAA 1B99A 1WHXA 3RB3A 3CMES 1YJ9S 4TY9A 3D3BJ 2ZH3A 1SB6A 2RHQB 4KGZB 2ZNZA 3NEKA 1BC6A 3VGSA 3UD4P 2OAUA 3M8YA 1NK0A 3AB2B 5B0BA 1YBAA 2DGTA 4U8YA 2YPYA 5CXTA 2IFXA 1FNMA 3BSCA 3QSYB 3NGDA 4DWIA 3R5DA 4F4AA 4DL6A 5B0DA 2KG1A 1M5PC 1X4HA 3M8PA 5JUMA 1SV5B 1FE4A 7FD1A 2NR0A 5MLCV 4N7TA 5DZ7A 4OX8A 3OSPA 5EWFA 1L5UA 4LQ9A 2J9EA 1JXLA 1WELA 2ZHBA 3U27A 3UCUP 3OW2R 4OYMA 6FDRA 2QA4S 4LR8A 1XJWB 2ASLA 3HHLC 4K5SA 3SFGA 1L3UA 3SQOP 5KG1A 2K1RA 3VAMA 2JLFA 1Q7YT 2LQ9A 1DAXA 1SKSA 5IM0A 2G1DA 4DR4F 1HMVB 3MR2A 2CQ1A 3WIUA 3R2DJ 1HIYA 1CVJA 3QJJA 1TU0B 1NHKL 1IXKA 3NMRA 2M8DB 2FJDB 1VC6A 4QWCA 1HI1A 3FSXA 4F3MA 4OHYA 3C15B 2ACMA 3KUEA 1HI8A 2Q6BA 5KG6A 1J27A 2RKIA 3EVOA 3TANA 3R1HA 1UMJA 4MAKA 1HNWJ 3L3CA 3MMAB 1T7PA 3NMAA 5K14B 3S6EA 1PG5B 2ROGA 4FPIA 1SH2A 3BO4A 2HHQA 1F5BA 3DYAA 1YJRA 4J9MA 2AP6A 4ZJOA 1QTNB 3RB6A 3DN9A 2BQRA 3P4UB 1BGXT 2HVDA 4TVAB 3MMBA 1SC6A 1FRHA 1Y0HA 1ZH5A 2WOMB 2I5JB 3UDLA 2XTJP 4O3QA 3GV8B 4DN0A 2EEYA 3BSNA 3EJMA 1K9MT 3NL0A 3CJRA 1NHVA 5DM7Q 2B8PA 3SSQA 1WC1A 2HMIB 2XHCA 2FHJD 2DNRA 1IM6A 1ZA2B 2RH3A 4GVBB 2VKZG 2RS2A 1RT3A 3TEHB 1TFWA 2HEKA 5H9EJ 1QVFR 3CMQA 3CC4S 3NCRA 2QE5A 1OY6A 3IO1A 2ASYA 5DQIA 1K0TA 3PXGa 1KEKA 4K4SA 5DLFA 3OXFA 4PCQA 5ETLA 1RABB 1EZZB 3M05A 4OX9J 3H4DA 1XEZA 3GJRB 4PEOA 5ITHA 1MLAA 4XDDA 5KFLA 2WVBA 1TL7A 1S1WA 5AXNA 4AFFA 4CLZA 2CQ0A 1V5VA 2Y1IA 3Q8PB 2HNYA 1NH8A 3M2UB 4RW6A 2UXCJ 1QM9A 2AGPA 2CQGA 2IM0A 5HL7Q 2CJXB 4O3RA 2YX1A 2HFVA 2OI2A 1J5EF 3PJWA 4KV8A 2J0WA 2W8KA 2J76E 4YHHF 3MM9A 3FEZA 2U2FA 2EC2A 3OFEA 1U1KA 4IG3A 4DV0F 3T1HJ 1F0XA 1VRTB 4PWDB 1RB0A 2XEXA 3MCSA 1YQHA 3VR1A 1RTZA 1R8AA 2F8EX 3HT0A 2MKSA 4KSEB 2HVIA 4I2QA 3LF0A 2BMBA 3X1LB 3KK2A 2BYCA 4PPDA 1S10A 4IG0B 1JLCA 3I96A 2IC3A 5HN0A 1C0TB 1ZBTA 5C5JA 4RNOA 2C3YA 1WSVA 5B09A 4JI7F 2HAIA 2R7QA 1YSJA 2B43A 1MG7A 5D4NA 1JJHA 3VCDA 2YNHA 3BEGB 4OHVA 4TKTA 2OKQA 3KJQB 2HQFA 2YWEA 4Y65A 1KLNA 3LAKA 3W5YA 1HQUB 2ADBA 1TV6B 4UT4A 3QGHA 4OQJA 1L3SA 1RTHB 3HSZA 3POTA 1SCJB 3QRQA 2HGNA 2ZD1A 1S6PB 1IUJA 1SJ4P 2DR8A 5E2QA 2L9NA 4KH1B 1T02A 3KLIB 3LALA 2KYZA 1WOOA 4FKXA 5LJ3Y 2MXYA 3V4IA 2VUGA 1N5TA 2N82B 4KPCA 5KFSA 1MU2A 1VRUA 3NBPB 2XLIA 3KDNA 4LBPA 3WC2A 5J2MA 2L9WA 3V6DA 5DO2A 5EN1A 1FDBA 1MMLA 1PYSB 3LUYA 1Q8KA 2VBYA 3H7HB 2KT3A 3HULA 4H4OA 4FS1A 1RADB 2FVCA 1D9DA 4KT0C 1FK9A 4CI0B 3QIPA 4ZA1A 2BJ9A 2NZ4A 4C11B 3FUYA 2WRMA 2R2SA 1HI0P 5L9XA 4JP8A 2HK3A 3W8PA 2IDLA 4F26A 1AW0A 5CH7B 3M1VA 4C8MA 3IMQJ 4ETXA 2R7SA 5F3ZA 2XO6A 4USTA 5AJ3J 5D4LA 4K8RA 3MTJA 4DSIA 3D7SB 1GXTA 2YWFA 2OUGA 2H65B 2E9RX 3ZNJ1 4DG1A 3JTNA 2CFXA 4DR7F 4N41A 2ATCB 2Z8QA 3HZGA 4XO0A 2XI2A 1KLMB 4CLKA 3BPSP 2RRNA 3SDEA 4ZVQB 5KG2A 3MPWA 4DR2J 3KLGB 3W66A 4ZHRA 3K57A 3RAQA 1MMDA 4B08A 1SUQB 4W98A 2QYGA 3MOZA 5KG4A 2IAJB 2W2OP 1JXVA 3FSYA 5K8OA 3QWPA 4RL1A 2HBYB 4Y2MA 4C9DA 2ZH5A 2FHJA 4F4ZA 4DL0C 2VJVA 1LEOA 2UUBF 5HMYA 3T19A 2RB7A 5K20B 4F25A 4QIGA 2CQIA 3I0SA 5BYQA 1P1TA 5DDPC 4KR0B 1FJ7A 3IRXA 1B4SA 4QIWD 3U7JA 4ZCIA 1NK5A 4JV0A 4UOCA 1OPIA 2AJFE 1S6QA 4P2SA 3HHLB 3T5JA 2E1RA 2B51A 5KFFA 1CEZA 1FXLA 1VBXA 1TTHB 3OSNA 4P10A 4ECVA 1LW2A 4LIWA 2HWIA 2FC9A 2AYMA 1SKUB 4AT1B 3TJAA 5HSPA 4U67Q 3SV3A 1B3TA 1XR6A 2W1BA 1VIXA 5ETTA 4IOCQ 2CXEA 3QT7A 3O6QA 4OX9F 1HBOB 2BE2B 4FVCA 1TKTA 5BXIA 2DRDA 4O44B 1S79A 4C3KA 5B7WA 3CVKA 4G1QB 2P8IA 3PO5A 1Q95G 3KLFB 2R2TA 2XCAA 3DI6B 2BANB 1VMBA 9RUBA 5C42B 3MECB 3LP1A 3NNCA 3FFIA 1S9GA 4GVLA 5EWEA 2K06A 2UXCF 4X84A 2W7AA 4USKA 1HW8A 4OI0A 3D1QA 1AFJA 1FDDA 1JLEB 4Z2XA 1LWXA 3VTIA 1IBLJ 4MFBB 2DB1A 4M63A 4OYPA 4XPCA 3CCJS 3ETMA 1HR0F 4YR2A 2DH8A 1WKKA 5D0HA 1FWLA 3EDQB 3D68A 3KG4A 5BR8J 3T1YJ 4I7FA 5HROA 4Y34A 3Q8YA 2FUG9 1X0FA 4NXNJ 1UETA 1X5SA 2CQDA 4OHZA 2CDRB 2LXFA 4JI6J 3TX0A 2F9DA 4AD6A 4OFZA 3DLGB 4RW9B 1LXNA 1VK3A 5D78A 2KFZA 4P2MA 2IM3A 4YDDB 1N48A 3K5LA 3G4SS 2DITA 2XWYA 4AUKA 2C1EB 2MQQA 1U1NA 1OWXA 2GZOA 5D0RA 2MQOA 1YVFA 4UQTA 2NXNA 4O4GA 4FYYB 2ZM6F 1RT7B 1HWIA 2UVUA 4XAKA 1ZS6A 1BMQB 5I3UB 5IS2A 4DBQA 3TQEA 3CCLS 4G1PA 1N0UA 3OR1B 3FK4A 2VFRA 3CUNA 2XLKA 3FDSA 3D0IE 1BQNA 3D5MA 4FS2A 3W65A 1LWEA 5SZTA 3KUHA 1HNVB 4WU2A 2GGPB 3GIMA 2JL9A 2GVZB 3CB4A 2ATLA 1RBLA 4MKYA 2W24A 4N8NA 3FMWA 2L41A 5T7LA 4PG6A 3M2VB 4YB6A 4C8YA 3T6BA 2RUSA 1KBRA 1M1HA 3JSMA 3BH7B 4I69A 3NS7B 3HSGA 2VASA 5KFWA 1AB8A 5ETPA 5I3PA 1RISA 4JI2F 4ED1A 1MROA 5GAHU 4TU8A 2BJ3A 3BKTA 2KTQA 2CG4A 1GK8A 5E3QA 1NPPA 2DRAA 3H0PA 3TZYA 2CQHA 1NCLA 4MYUA 5IZHA 1UJ4A 4A8FA 4X4VA 1RT2B 2ZEJA 1TK5A 5G0RB 2DO4A 1NSPA 4YMEA 2LFVA 1N5QA 1TL5A 1YI2S 4RNFA 3MPUB 4DV5J 4WKYA 3R1LA 4NEYA 1ITPA 4LRCA 4A8QA 3D54A 1KQSR 2EFQA 4DUZF 2DGUA 5LSRA 4HL9A 1B7YB 2KJVA 2MZRA 3KK3A 1ZAWA 2YKMA 3Q2SC 2XNRA 1C4AA 4V1Ak 5E41A 3BKFA 4JBCA 4OZ0A 1UW9A 3UO0A 4IOAQ 1CQNA 4ZPWR 4FBUA 2V4QA 2R7VA 4X4UA 4LF9F 1O51A 3MZIA 5HATA 2ASJA 1WF2A 2DGWA 4H4KA 3HD1A 3TVZA 4A4JA 3HJFA 5LL6d 1H72C 4GMKA 2MMYA 2M88A 4DV7F 1Z2ZA 2JFKA 1JLFB 1O5JA 3T41A 1SJ1A 4WFXA 5B0FA 1QUVA 4A46A 2R9LA 4I2PB 5A8RB 4K4WA 1TKXB 2HBQB 1R8HA 3RG6A 2HIQA 5K8PA 1PO6A 1UP1A 3NWGA 4NLSA 2VFUA 2YBVA 1PJ6A 4ALZA 2CQ3A 2XSFA 3R9LA 1LFPA 2JEJA 3DLLQ 1JLAB 2NSBA 3ZTOA 2OSQA 1DQAA 3PFOA 3W3SA 3AA8A 2ZKTA 4UF4A 3MWBA 4UOGA 2K7KA 2E66A 1SV5A 5AT1B 2HHUA 2AGQA 2NLWA 2WAQD 5SUHA 4WJBA 1VLOA 3HHDA 5AE3A 1SC1B 3NOCA 2IPOB 4FYVB 3SI8A 1EP4B 2ZVIA 4PQUB 2LYVA 5B0CA 2FLOA 2VZ9A 5IQ6A 4Y2KA 4OYOA 4MH8A 2VG6B 4LQ3A 2DRBA 3EZ5A 5K8NA 1SL1A 2DO0A 1HL6A 2RS8A 4B02A 4MIBA 2QSWA 5BYRA 2PO4A 3O8WA 1VOMA 4IUFA 2HNZB 5A8WB 1KSPA 1YKWA 2KRRA 1OPZA 4DSEA 1SKWA 4P7VA 1D0EA 1HMVA 2A6MA 5EHHA 4M5HA 3Q8QB 1GAOA 4DU7A 4B9TA 4RNHA 4EK2A 2WW4A 1N32F 1Y5IB 1U45A 4KHPJ 3PJXA 1DARA 1U4BA 4LF7F 4LR9A 1SH3A 1RGVA 2Y8WA 3AAWB 3C15A 2XS7A 3BM7A 3C14B 1H74A 1TAQA 2D9PA 4RX6A 1LNQA 2YX4A 1IR0A 4WFAQ 2C2RA 2XCPA 3MMAA 5K14A 1UFWA 5LMUJ 1IBLF 3BN7A 3HP6A 4ILMA 1FVQA 4RU2A 3TRGA 1EARA 5H9FK 3VVUA 4OYIA 3TEGA 1R8PA 1UA1A 1RLDA 2WOMA 2I5JA 2Z2ZA 1GNKA 1X9MA 2KFNA 3GSDA 4CLSA 2BOAA 4JI6F 2YQ3A 3BGOP 2W2MP 4X4NA 2HMIA 1UTAA 2J8AA 2DIVA 2UUWA 1M5SA 1Q7LB 1DURA 2J6TA 2FVPA 2JZ5A 1MNEA 4GVBA 3H42A 5K8MA 3G6ES 2GHWA 3ZTSA 3F73A 3DLBA 2H54B 2BXJA 2F8MA 1R8BA 3C66A 2Q1LA 2FJXA 3KXDA 3AOAA 4WIQA 1OIAA 2MKYA 2B9XA 3PYGA 1D9FA 3AH6A 4H4MB 4JI8J 3CJSA 4ZP8A 3CTRA 2CJYB 4QW8A 3FCWA 4F0KA 4P2XA 2BA9A 3FBFA 2XY5A 3QFWA 2B6AB 3I56S 1HNZJ 1T94A 3TNVA 4ZCLA 3BB5A 2OPQB 1UJ5A 3MM5B 5J2PB 3ONQA 3AD9C 3M2UA 4EEYA 3HVTB 5F8MA 5U47A 4CO4A 3NS6A 4L76A 2R8GA 2DR9A 4O0IA 3Q8SB 2HFNA 3Q8RB 4ZKAA 1R89A 4QYRA 3ISNC 1R0AB 5A0YB 3DU6A 3HCXA 1QUPA 4PRFA 2VA3A 5I4MA 3LA0A 1JWWA 1IJEB 1N34J 3I4HX 2HFUA 4FDFA 3OL9A 1VRTA 4PWDA 2ZE2B 4Q0BB 3AXMA 1KQFB 2R7WA 3GZ7A 1T95A 2ROEA 1U6ZA 5L38A 1IKWB 3Q23A 1TKDA 4NI2B 4J9QA 1I3OB 3MF5A 1UPMB 1HWKA 2AEFA 1B7FA 3T9ZA 1RSCA 3GJQB 2MDAA 2AGOA 3MAQA 3KLHB 3PX4A 4K5RA 4WYLA 4IG0A 1TFYA 5ETQA 4QZVB 1C0TA 2O66A 2IA0A 4CH0S 3DMJB 4BCAA 3RRKA 2N4DA 1P9YA 3RGIA 1Y9OA 5CYMB 4X62F 4CO5A 4ECYA 4P71A 5C25B 2I6WA 3QGPA 1KTQA 3KK1B 2DIUA 1S49A 3FQLA 3D6TB 5KG3A 5CD4A 1X4DA 4UUXA 1HQUA 1C0UB 4WTYA 2V2QA 2V34A 1TV6A 1X5PA 2LVWA 5B08A 2GS8A 1RTHA 4FF1A 2FJAB 2GQ2A 2B4OA 2L3MA 1D1UA 1S9FA 2GFFA 1S6PA 2XZWA 4ZK7M 4Q43A 1S1XB 4MK8A 3I55S 1KNZA 5GAGU 4QR0A 3H2VE 2VG5B 3KLIA 5F8NA 1C4CA 3G82B 3PV8A 1XC9A 3B82A 3K0JA 1MMNA 2AHOB 2ZOGA 4YY3J 3ET6B 1U48A 2ZKUA 1FF2A 1VISA 1DBDA 3NBPA 2ZFHA 2X51A 4OHXA 2Y1RI 4K50A 1IBKF 4WFNQ 1IR1A 3KYLA 2CRLA 4QPTA 2NUHA 2VV5A 3KJVB 2G0JA 1QDUB 3GILA 2J0QD 2A6OA 1CJTB 3J81Y 5E7OB 2UU9F 3V4MA 4NZ7A 3A8IA 1CSJA 1LWCB 3Q83A 4DL3A 2W4PA 4RUBA 2VBWA 3ILIA 1VQ5S 5G4DA 1SH0A 4I64A 3PIPQ 4C11A 2QLFB 3TUIC 5DDOC 3PYFA 3D67A 1ACMB 4Y2CA 4L73A 1EB0A 2A3JA 1U2CA 2AX1A 2MGZB 2ACYA 2CPFA 4LMZA 5HLFB 1HBMB 1U6BA 4ECUA 4J5OA 1VJWA 4ENOA 4QPXA 1MWZA 1NB7A 2V4JB 4O3OA 2MEWA 2Q6CA 3FBEA 1IKXB 2YWGA 3PY8A 4DQSA 1TMJA 2FJEB 3D6HB 4P72A 3J80U 1YBUA 3EPIA 1NKCA 3ZZRA 4XTTA 5LXRA 5AXLA 1KVIA 4IOBA 4KHPF 3W9HA 5D3GB 2LMIA 2H5JB 1KLMA 2YPZA 1EAYC 4WE1B 1JIHA 4ZP7A 3KLGA 4DQRA 1WC0A 3OL8A 3OBIA 3GYNA 4B9MA 3BQ1A 1WF0A 3KMQA 1UFLA 1SUQA 2CJKA 4LF4F 5KFYA 2IAJA 2QLBB 1FRXA 1S4EA 3NS5A 5KOXA 5H1SV 4ES3A 3BYRA 5L39A 4LF8J 1XNQJ 1Q4RA 1RWXB 1UWBB 2DISA 1YITS 5LMUF 1KS2A 4NCGB 1Y4ZB 2V94A 2YWHA 2V5HG 5JXSA 4YB1P 3BDPA 4J9SA 2YQ1A 4N56A 2JSXA 3ZXWA 1IN0A 4ANEA 2J9DA 3VVTA 3O5TB 4LF5F 1S9EB 3BO2A 1N6QB 3W5XA 4C8KA 3UFCX 1Q5YA 3HHLA 1HBNB 1VI7A 1QVGR 4PXDA 1Q78A 1QD1A 2AKWB 4HT5A 1UVLA 5EUHA 2I0XA 3DRYA 5IT0A 1IWAA 3VAFA 4F4YA 4PABA 4F4WA 2W4CA 2O01C 2DXDA 2YKOA 1PGZA 3VGVA 2JC0A 4IQXA 1I6JA 1Z4UA 1XNRJ 4KY3A 1WACA 2GVDB 3PRVA 2Q3PA 1U02A 3S8SA 1UVIA 3WX8A 5A2QY 3WIVA 1HBOA 2BE2A 2H9ZA 1H73A 4JI8F 3IC1A 2QTWA 4O44A 4G1QA 5KFQA 1LXJA 3KLFA 3DI6A 2BANA 3UDCA 3H5UA 4O3NA 5C42A 3MECA 4N47A 1FKAF 4JI1F 2RDIA 2AIRB 4ANCA 3PR4A 1RBAA 4KBIA 4RO0A 3C46A 1LK7A 1JLEA 1X4GA 4PG8A 3HPOA 2QA1A 1RT5B 2CADA 2Q66A 2GO9A 2JH3A 3QMQA 2J7WA 4MFBA 4TU9A 1T3OA 1CJUB 4KYZA 3OPKA 3PIOQ 3NY0A 2DNYA 3HHKA 4MKAA 2WB4A 4C8LA 1CQMA 4R0EA 1Y11A 3PEHA 5AXKA 4CT9A 3MXHP 2UVWA 2B4VA 3DLGA 4RW9A 3DXBA 3N5BA 2JEFA 2IRXA 3AQPA 4ED3A 5KG5A 4B3TJ 3MI7X 3B4DA 4DV2J 1U24A 4NLTA 2YKPA 2CUYA 3DLJA 1S4FA 2NCKL 1Z1ZA 3V2UC 2OMOA 5KFVA 4TLQA 3PRBA 2RQ4A 2YKNB 4ZVHA 2PE8A 4GKJJ 4K2XA 1RAAB 1RT7A 4YOEA 1IBMJ 2EBEA 4Q7AA 5I3UA 2ZUGA 4KC5A 4DFKA 3ICLA 2CNOB 3GIRA 3OR1A 1HYSB 2BV3A 3QBCA 3SBMA 1GT8A 1HWLA 2MSSA 3E3XA 4NOHA 4UOFA 2DGOA 1M5KC 1E6VB 4CLYA 1HNVA 2FYXA 2GGPA 2GVZA 2AQ4A 4ECSA 3MMJA 1VQNS 4R8UB 2AJ4A 1IQTA 3M2VA 3H98A 2VL1A 4WYWA 5LOQA 3VQSA 3RRHA 4YY3F 4NLUA 1TKZB 3A8KA 4USVA 2OPSB 3J81j 3BKUA 5FD1A 1NUEA 4P9SA 5DM6Q 1ZM3A 4EBCA 1TK8A 4KFBB 4DR3J 1S76D 1ZZNA 1ZAVA 1UVJA 1J2VA 4DPXA 2O5DA 4B3MF 4LSLB 2K3KA 2ZZTA 1RT2A 4Q2MA 5BYSA 5G0RA 1ZM4A 1VR6A 4EO6A 2DHXA 1AFIA 5F8JA 2DNZA 4ZVSB 3FCHA 5DG7A 5D0GA 3W7BA 5L1JA 3E8OA 4G65A 3EVWA 3BQ2A 1EKRA 5D0EA 3OLAA 1ZETA 1NH7A 4ZVGA 2D41A 1F3FA 1KQGB 4F50A 4WPAA 4F0MA 4ZLLA 1S77D 3NLCA 4KKOB 2DYAA 1NRKA 1PKUA 2RSQA 2FGOA 2HRUA 3S01A 4FBTA 1N36J 2LA6A 3GB0A 1YJTA 4CIOA 1FE0A 2Z58B 2V9KA 3W5ZA 2KVQE 4C3MA 1SXLA 1Q79A 2DD8S 1WI6A 2VODA 2E5GA 3RAXA 4XDCA 2J0SD 2FQQB 4BHQA 2VFTA 1JLFA 2GQCA 3UNYA 4O3PA 1A9NB 3IR5B 3QT8A 4X4QA 4I2PA 1FT8A 1RT1B 1RYSA 5A8RA 1TKXA 4NMLA 5F41A 1WG4A 4F2SA 4UY8T 1EHWA 4MKBA 1P1LA 3OQ2A 3UPFA 4KJIA 4GKKF 2HHSA 2O3DA 3CIZA 3J7A1 1YLXA 1JLAA 3AJ2A 4J9VA 4B9VA 4OJGA 2C2ZB 3OLBA 1W2BR 3WZ0A 5HAOA 2QA2A 4Y3CA 2NXCA 2XMAA 5DS7A 3F44A 3IS9B 1RKIA 2HNDB 2OPPB 4CCHA 2Z2LA 1OSDA 2KH9A 1DY3A 4RZRA 4LIRA 5J1PA 2HBRB 4OX6A 2IY5B 1EP4A 4U6PA 4HTIA 4PQUA 2VHGA 1RHMB 2QMUB 3EICA 3OL7A 3LPEA 1Q81T 2Y8YA 2QMWA 2VG6A 3BPDA 2HURA 4BBYA 4OI6A 3CD5A 2DEJA 1KKHA 3BBBA 4AXIA 3UCZP 2OEMA 4HHJA 1S72S 2HNZA 5A8WA 3TOQA 2IRUA 5F0UA 7FDRA 5FLXU 3CCRS 2V69A 1IBCB 4NA1A 3PX6A 2V63A 4OMFG 3CO0P 4LJMA 4FKYA 1YRUA 4RJVA 2HZVA 4KB7A 1AXQA 4RBUA 2C2KB 3K2YA 4Y28C 1LQ9A 2DR6A 3P96A 1QAJA 5B0EA 2R3VA 1K1SA 4MIWA 1WI8A 2DTJA 4FPRA 1B70B 1QAYA 3SV4A 4ZDNA 2O1PA 4DSLA 1GMVA 1UA0A 3GG1A 3KKFA 4DF8A 1T9TA 3C14A 3MAHA 1DQ9A 1SIWB 2DXFA 3LP0B 3Q86A 4DR5J 1Q8IA 2D3UA 3FZ2A 4MK7A 4ZPDA 2HYIB 2GJIA 2HHXA 3CT9A 1CJKB 2PFFB 1RWUA 3ILJA 5AE1A 4K7QA 1WTFA 1MSWD 2ZOMA 4B3RJ 4WWSA 3I4PA 2P2CB 2MHEA 2EK6A 2XGPA 1P27B 4N76A 4L74A 1JJ4A 2AF6A 2E5LJ 1PBAA 1F60B 1NK9A 2PT0A 3HDSA 4O4RA 2FLNA 4FVMA 5LJ5Y 2R8JA 1XMQJ 3SQGB 3CJTA 4UY85 5GADU 1QLNA 3PFEA 1NJYA 2KZMA 3TJ8A 4RUCA 2UUAF 4LRDA 4KGKA 4JI3F 5M2UA 1FRKA 2N3LA 5IV4A 2V2ZA 3OHBA 4WFZA 4DV2F 5CQGA 1UJ6A 3N6NA 4O0NA 2DGSA 2HZCA 5I42B 5CABA 2VQEJ 3LTOA 4CTAB 3H25A 4H4MA 1RWMB 3DOMB 4DL5A 2NZCA 2Y9HA 4NXMJ 4DX6A 1V5IB 3MEGB 4JUZA 3JYTB 2B6AA 3S7RA 1NPRA 5IFMA 3TUZC 2OPQA 3MM5A 5J2PA 1OMSA 4YB5A 3HVTA 3BGRB 2M70A 2AEJA 2OMLA 4HVZA 2MKHA 1JMTA 2VPWB 5L1KA 2CYYA 2R7TA 3MTKA 2GIFA 2YXLA 3KDOA 1IKVB 5A0YA 1R0AA 3QJPA 1DLOB 5ETOA 4IQMA 1AT1B 2OSRA 3KLEB 3T9NA 3IA0A 4LBHA 2VU5A 5F8HA 5LM7E 2R4FA 2MYFA 4HLBA 3ILLA 3PCOB 5KFMA 1VCTA 2ZE2A 3I9V9 1X5TA 5KFNA 4X4TA 1K8AT 4Q0BA 2QV6A 3K5PA 4DR3F 2BEFA 1L3TA 4M5JA 1IKWA 5L1IA 4NI2A 2FJWA 5DDRC 2DNNA 1CS4B 2QL5B 1S1UB 3UQSA 3FNNA 3EPGA 3GONA 2FD2A 4MMOA 5HMXA 4G6VB 4JV1A 4S0MA 3KLHA 3H4BA 1QY7A 3IFEA 2A2CA 2B9WA 4TN2A 1T03B 1RU1A 2NS1B 3A13A 3CJKB 2XMVA 3DMJA 1S6OA 4DOZA 2RNEA 2R8HA 3PACA 1RK8A 3SCJE 2RMLA 2YH0A 5CYMA 3G8SA 2QZ8A 3QYYA 3RB0A 2BZ2A 3GFHA 2RQKA 5C25A 2MQLA 2IYIA 4X65F 2OFGX 3C16B 3KK1A 1AUSL 3CJ5A 2RILA 4PXBA 3GIKA 1NHUA 1SJRA 2DY1A 2WVDA 3IBFB 3FEXB 4DUYJ 4YR3A 2MKIA 3I5CA 3LPYA 1C0UA 3UW1A 6FD1A 3I5BA 1Q5VA 1NZ8A 5GAEI 4BWMA 2CPIA 4K4YA 4ILRA 2VKRA 3D1HA 5HVHA 1RWKB 5THWA 1DQ8A 4D3HA 4J91A 1S1XA 4ZIWA 3VAJA 4ICLB 3TZZA 5ETKA 5DQHA 2VG5A 2KJWA 4YDXA 3G82A 3ET6A 2DNKA 2H51B 1YZ6A 4AE5A 3BGUA 3L4BC 2RHSB 4IRDA 1UCNA 3K8WA 5D4OA 5HBMB 2WB1D 2AJQA 3ISND 3KJVA 3FMBA 4USJC 4NLOA 4LREA 1R7IA 1CJTA 2LQBA 2E9TA 4LRFA 1D09B 1K1QA 1LWCA 4ED0A 3TUPA 1RHUB 3LP2B 1U0HB 3LGMA 2UZAA 5HMZA 1P8GA 2HFZA 4OJ3A 4UW2A 3K89A 2YNIB 2F3JA 4FYWB 5EX0A 2EKNA 2CNKB 2E9ZA 2MGZA 5DRKA 3N0VA 2X7IA 3SIPB 5HLFA 1T05B 3CD6S 3R5GA 1URRA 4LSZB 1HBMA 5JJBA 3FVYA 2V4JA 3S1TA 2JC1A 1F5AA 4FNHA 3J7AN
chains in the Genus database with same CATH topology
1IKXA 2DGWA 2GQQA 4H4KA 3CJ0A 3I9ZA 3TVZA 4RWWA 3O2IA 2R7RA 2J7UA 1KFSA 4PG7A 4A4JA 1LV5A 2RIJA 1KQKA 3HJFA 4OLPA 3MEEB 2HHTA 3DM2A 1VQ4S 2VC0A 5LL6d 2MKCA 2G9OA 4GMKA 1Y5LB 2MMYA 4ID5B 1S0OA 5M2RA 4F8RA 1XMBA 4RLEA 2M88A 3G6YA 3I5AA 3POTB 3I32A 4DV7F 1Z2ZA 2KHDA 4H4KC 2ZD1B 2HFOA 2JFKA 4PWUA 1JLFB 3NGKA 4MYTA 5D3GA 2W9BB 1RT4A 3O3LA 4JOUA 1O5JA 3NCPA 1JLBB 1SJ1A 4FP9A 4WFXA 5CCMA 4WE1A 5B0FA 1QUVA 4A46A 2R9LA 1ZYQA 5EX3A 2YNFA 4B9SA 4I2PB 3MGJA 3QO9B 1VQ8S 1W25A 4C97A 2KO1A 5A8RB 4FN5A 4K4WA 1TKXB 4YEAA 2CPEA 1R8HA 1X4BA 1ZPVA 2A10A 3DRRA 3V4IB 4WU3A 2HIQA 4I1TA 2HS4A 1E6YA 5K8PA 1PO6A 4RW7B 4B3OA 4E8UA 2QT7A 3PW4A 1U1PA 1UP1A 2QA4G 4I0WA 2LQ5A 3E51A 2XHWA 3NWGA 4LSNA 2VFUA 1MU2B 1VRUB 4NLSA 2WTFA 4QIEA 2AX0A 3HHEA 2LKZA 5K9FA 4ALZA 2CQ3A 2HHHF 1B64A 2JEIA 2XSFA 2Z0GA 1GX6A 2CJAA 1LFPA 3T1AA 1KRPA 2E1AA 3TUJC 2JEJA 3DLLQ 1JLAB 2NSBA 4DR5F 2OSQA 1DQAA 2CPJA 5J2MB 3V6DB 1B0VA 3PFOA 4NA3A 4IO9Q 3W3SA 2DNMA 3AA8A 4DLGA 2LEBA 2ZKTA 3VAIA 3K58A 2WSEC 3MWBA 4C4WA 2EFNA 1UWBA 2JDJA 3FQKA 5KFXA 2DVIA 3MFHA 2ABYA 4H4OB 2YH1A 2CZVC 4R25A 3QGGA 1ZPWX 2I9SA 4FXDA 3E01B 2K7KA 4NCGA 3NAIA 4NRTA 2E66A 1SV5A 3CDEA 2HHUA 3X3UA 1HHTP 1DTQB 1X8DA 4B3RF 2AGQA 4K4TA 5MAOA 2NLWA 2WAQD 4HH1A 1FK9B 4IYQA 1HBUA 3JSRA 5SUHA 1WEZA 1X4EA 3ZFVA 3ITHB 4WJBA 4IFVA 3QIPB 1V3RA 1U1RA 4YUDA 4ED6A 1RTJA 5KFUA 1RA6A 3HHDA 4C98A 5J1EA 5AE3A 1NK4A 3N6MA 4ZMMA 3K7RA 3SCIE 2DR5A 1S9EA 3JTPA 5DG8A 1N6QA 4AL5A 5L9NA 3SI8A 2CPYA 4ILLA 1S0VA 5DGBA 3BF4A 5D77A 1EP4B 2MSTA 1NJXA 3CCTA 4PQUB 1HBNA 2W9AA 4NZ6A 2LYVA 3M8QA 1S1VB 5B0CA 2FLOA 2NPFA 2VZ9A 5IQ6A 4Y2KA 2WONA 3L95X 2FB0A 3Q24A 3HZEA 4M5DB 4MH8A 2VG6B 2LU1A 3C6TB 1SQEA 2P6SA 3ENWA 4OI4A 4LQ3A 1OQ6A 2DRBA 4QU7A 3EZ5A 3K59A 1UEUA 5K8NA 4DL4A 1G7CB 3M1VB 1SL1A 3CWJA 2DO0A 1HL6A 2RS8A 3PHEA 3PW7A 4B02A 4MIBA 3CCES 1R8CA 3CDUA 2AJ0A 2QSWA 2ALZA 1FA0A 5BYRA 4U7CA 1YTYA 2PO4A 4DFPA 3QLHB 3O8WA 2DHGA 1VOMA 3CDAA 2XMMA 4IUFA 2HNZB 3NKYA 5A8WB 2B4UA 1KSPA 1FRIA 2KRRA 1OPZA 3C2PA 1SKRA 5HQ8A 4DSEA 4B17A 3DRSA 3PW0A 1SKWA 4V19J 4A8XA 4P7VA 1D0EA 4ED7A 2LU2A 1F2GA 4BC9A 1HMVA 1S48A 2CPXA 1XTZA 5EHHA 3ETOA 3D0HE 3ZZUA 2DPIA 1RTIB 3Q8QB 1GAOA 3CD7A 4B9TA 2ROPA 4A47A 3TAMA 2MJUA 3BREA 4RNHA 2D9OA 2EG2A 2WSCC 2FVRA 2IMOA 1ULRA 2MKJA 2JX2A 3KNGA 4QIVA 1N32F 2K8GA 5CYQB 1Y5IB 4DG1B 1U45A 3OJSA 3V6HA 3PKYA 3TW0A 5FJ4A 2M3DA 3PJXA 1NEEA 5KFKA 2OP5A 3UE2A 2UXDF 4FXWA 1DARA 1ZM2A 5AE2A 4AXJA 2CQ4A 1U4BA 3MHYA 5M2PA 4CO3A 4EUVA 4LF7F 3R27A 2F8HA 4I4BA 1X9SA 3MM7A 4ZCMA 1SH3A 1W2IA 1S97A 4DV1F 1RGVA 2PMZD 1X4FA 3LAMA 2RQCA 3AAWB 4QWEA 1I94F 1U25A 3SDEB 1R6YA 2GJ2A 3V6JA 2ZOFA 2MY7A 1A6LA 2XS7A 4ELVA 1BY9A 3G8QA 3C8YA 4PG4A 3BJYA 3MURP 4UUWA 2Q43A 2Z4PA 3BM7A 4ZHRB 2ZJRQ 1TAQA 2D9PA 1RQ0A 4RX6A 5KFEA 2Y1JA 3MUTP 5CYJA 2YX4A 1WG1A 2NSCA 1VIOA 1RT5A 2XMWA 1IR0A 3HKZD 2FVSA 4WFAQ 2UV8G 4B3SF 1DTTA 4QBUA 2XCPA 2C2RA 2B0GA 3I31A 3MMAA 3R5CA 3CDWA 1D3WA 5K14A 1UFWA 1TK0A 1IBLF 2CKWA 4OZLA 1L3VA 4ZP6A 4CNZA 3BN7A 5T41A 3HP6A 4ILMA 3VZIA 2HWTA 1FVQA 1JKHB 2FY1A 2B9YA 4EU0A 2MZTA 2BR0A 4DV4F 4K4VA 2KZZA 1S99A 4C7QA 1OSCA 4K4XA 2R8IA 4J37A 4AL6A 4RU2A 3T6JA 3R5BA 3BR9A 1Z2LA 3TRGA 4JV5F 3MEDA 3I0SB 3BZQA 5HO4A 4AQYF 2RJZA 4P6QA 5LSLA 1HNZF 3SEOA 5DG9A 3LWLA 3QZ8A 2V4RA 3IRXB 3TP2A 1TQLA 5KT2A 3J7ZT 2VFSA 2E5IA 3OTDA 2BJEA 1HPZB 1R8PA 1UA1A 3J7YI 2D3ZA 2WOMA 3EGZA 4IH5A 4OI3A 2I5JA 1S6QB 4DFJA 1GNKA 2XWXA 1X9MA 2KFNA 3I0RB 3GSDA 2PI5A 4WFYA 5KFRA 3HKWA 3CF5Q 4K0KF 1HD0A 3QAEA 2IBOA 1H0HB 3AQOA 5HP1A 3DLEB 2RRAA 3RR7A 1U47A 1BQMA 4JI6F 2ZITA 3EYZA 2YQ3A 3DLKA 2CQPA 4R0JA 4QWDA 3OXLA 4QWBA 1NJWA 4E0DA 2EC0A 3IG1A 4PXEA 4X4NA 1KN6A 2HMIA 3M6VA 2J8AA 1LWFA 2DIVA 2C3MA 2UUWA 5ADZA 1M5SA 1Q7LB 3DRXA 2IHR1 1DURA 2J6TA 1TZ0A 2FVPA 3V6KA 2JZ5A 1MNEA 4FNIA 1UEVA 3M9NB 1VQ9S 4ZPVR 2XC9A 1LW2B 5K8MA 1N33F 2MJNA 3G6ES 1VQMS 2GHWA 2XBPA 1N34F 2EBGA 3F73A 2DHSA 3DLBA 4DL7A 3MR3A 1S0NA 4ED5A 3RR8A 2O67A 2BXJA 2F8MA 4CZCA 1R8BA 3M2RB 4ECXA 1YJWS 1XMOF 1RJJA 3C66A 2J9CA 1GQEA 4RU9A 2YKNA 2Q1LA 3OTBA 2J7KA 3GR0A 3QIDA 1TVRA 4TQSA 4OZJA 1J5OA 1IJFB 3MD3A 2FJXA 3DDKA 4F67A 1OIAA 2XULA 5A6WA 2B9XA 2VBXA 2XS5A 5J2QB 2B56A 4RW4A 1D9FA 2ZNYA 3AH6A 2CPHA 1H2UX 4H4MB 3HM9A 2LQJA 4ZP8A 3GWCA 1FO1A 4Q8FA 2XMJA 2FHOB 2VG7A 2FLLA 3CTRA 4I6AA 3U1MA 3RB4A 3IGVA 2HQIA 4QW8A 1HNIB 3PR5B 3M30B 1TKTB 5IWAF 2BA9A 4X64F 2XY5A 4OHWA 1HYSA 1CG2A 3VAGA 2AYGA 3IRWP 4FF2A 1U1LA 2B6AB 3I56S 3CPWR 1T94A 4J9LA 1VQPS 1VBZA 4JYAF 3TNVA 2GW8A 4ZCKA 4ZCLA 1FNXH 3BB5A 2OPQB 1UJ5A 1IKYB 3MM5B 5AXMA 1FEEA 3PDNA 5J2PB 3L7OA 3ONQA 2VQFF 3M2UA 3LP1B 5GMKa 2XB2D 1FRMA 3FFIB 3LWMA 1S9GB 4EEYA 3HVTB 1XR7A 5U47A 4CO4A 5F8MA 2NREA 3CC7S 1P6TA 1JX4A 3NS6A 2R8GA 1E6VA 2KB2A