2FHOB

Nmr solution structure of the human spliceosomal protein complex p14-sf3b155
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
GRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the human spliceosomal protein complex p14-SF3b155
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords spliceosomal protein SF3b155
total genus 14
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhoB01
1VQNS 1U6BA 2CPZA 1QVGR 4PRFA 3SMZA 1L3KA 2KI2A 3VAMA 1X5SA 2G4BA 2FY1A 3S7RA 1AUDA 2DH9A 2VONA 1DHMA 1O0PA 2DGVA 1H2UX 2RNEA 1FNXH 2FPHX 2AYEA 2DNYA 3FEXB 1VC6A 4IOAQ 3CC7S 1SXLA 1YJWS 1U1PA 5DDPC 2D9OA 3BO2A 2JWNA 2J0SD 4C7QA 1OPIA 3CF5Q 3CULA 2YH0A 2M88A 3CCSS 3I56S 2CPEA 3BS9A 2RS2A 2XB2D 1FJCA 2U2FA 1N54B 1VQ9S 3R1HA 1VQMS 2MZTA 4UY8T 4OZ1A 1KD1T 2B0GA 2MYFA 3P6YC 2SXLA 1VQ6S 2CPXA 3P3DA 2M9KA 2DNOA 2DGUA 2MQNA 3PIPQ 1UP1A 3RW7A 2RRBA 2D3OR 5DM6Q 2DO0A 4ED5A 2OSRA 2CQBA 4WKRA 1N88A 2KRRA 4F26A 1U1KA 2DHSA 2CQIA 2XS5A 2MJNA 3UD4P 4WCEQ 2X1BA 1FJEB 1U1OA 5IM0B 5CYJA 5GAEU 3TP2A 3P5TL 2NLWA 1X4AA 2YH1A 2A3JA 1VC0A 3CCES 2CQ4A 3LQVA 2LKZA 1X4DA 5DDQC 2AYBA 4W90B 3J7YU 3CTRA 4YOEA 5LJ5Y 2MKHA 1H2TZ 1PGZA 1WHXA 1JJHA 4F02A 2RS8A 2DIUA 2E5JA 2ADBA 3UWTA 3CD6S 2VOOA 2CQ1A 3IRWP 2KM8C 3BO3A 1U1QA 2DITA 1R8PA 2OTLS 3VAHA 1OIAA 4LIRA 5BJRA 2JVRA 3MI7X 3K0JA 1DBDA 4EGLA 5D78A 1DZ5A 2DGXA 1X4GA 2DGWA 4FXWA 1S79A 2MXYA 1D8ZA 4M5DB 2MKIA 1G2EA 2KHCA 1U1LA 2AD9A 3S6EA 2MSSA 3J7ZT 3CCLS 2BZ2A 2LECA 3MOJB 2QFJA 2RQ4A 3N9UC 3NS5A 4C4WA 2MSTA 3NS6A 1WI8A 1VQLS 3VALA 2MJUA 2KH9A 2F3JA 4CH1A 3HI9A 4LMZA 2YTCA 3G9CA 2LA6A 2KN4A 4CH0S 5IM0A 3PIOQ 1UW4A 2XS7A 2M4MA 1B7FA 2DNHA 1RK8A 1WF0A 1WF1A 2JX2A 5IFMA 1HD0A 1KC8T 2HVZA 1FXLA 1SJRA 2DB1A 2K3KA 1YIJS 2KFYA 2RQCA 2M7SA 2VODA 2GO9A 3L3CA 3CPWR 4PKDB 4CQ1A 1UFWA 3CCJS 1CVJA 3US5A 1YHQS 4BS2A 2ERRA 1KQSR 3TO8A 1X4HA 2N7CA 2YWKA 1Q82T 1YJNS 1IQTA 2HGMA 1X4EA 2M2BA 3H2VE 3VF0B 1VQ8S 1YTYA 2DNNA 4U67Q 5D77A 3SDEB 2NZ4A 3NNCA 1FJ7A 2KXHA 4WF9Q 1PO6A 1HA1A 1JMTA 2MQLA 1VQOS 2CQGA 4QPTA 3NMRA 3EGNA 1M5VC 2DNQA 2FC8A 2N3OA 1WHYA 1SJFA 1YITS 2KU7A 1FO1A 3CCRS 2CQHA 1R8HA 1WG1A 2N82B 4Y00A 2UP1A 1U1RA 2KVIA 1Q81T 2PE8A 2U1AA 2DGSA 2AYMA 3U1LA 2OIHA 3MD1A 5JVGQ 1Q86T 2MQPA 5CXTA 2HYIB 1WHVA 2M8DB 2E5GA 1NU4A 3CCUS 2MZJA 1SJ4P 3VAFA 5IQQA 1WG5A 5GAGU 1JJ4A 2RUGA 2I38A 3G71S 2YKAA 1WHWA 1WI6A 2E44A 5GADU 2XNQA 4IO9Q 2QA4S 1ZH5A 2DK2A 1A7GE 4A8XA 5LXRA 1U6FA 3H2UB 2MGZB 3MUVP 5LSOA 1HL6A 4W92B 2M70A 1QVFR 2LXIA 3CCVS 1M5PC 4ERDA 2JRSA 2ZJRQ 2DHXA 3G8TA 5LXYA 3CC4S 1WEXA 2CQ2A 2L41A 1NO8A 1M5OC 3CCMS 2DH7A 4P6QA 1X4CA 2LYVA 3G8SA 5ITHA 1UAWA 3MURP 1WEYA 4J5OA 5LJ3Y 2CPYA 3EX7B 3VAGA 4QU6A 3Q2TC 2LA4A 2K8GA 2CQCA 3B4MA 4UQTA 3OW2R 1VQKS 3CCQS 3VAJA 2CQPA 5DDRC 2F9JA 4Z2XA 1U1MA 3DLLQ 2DNRA 1H2VZ 1WEZA 2XSFA 1X0FA 4YB1P 2HGNA 4PR6A 1K9MT 2KT5A 2LMIA 2JVOA 2KYXA 3R27A 2MZRA 3EGZA 2DNPA 3MUTP 2HZCA 2CPDA 2MQMA 2M8HA 2DNKA 1P1TA 2G1DA 4YUDA 5CA5A 1VQ5S 2MZQA 4F25A 3R1LA 1WWHA 2FC9A 3G4SS 3BO4A 1K8AT 4OZ0A 2F9DA 3UD3P 3JB9k 1WTBA 3UCGA 2EVZA 3MUMP 2RRAA 2CPHA 3UE2A 3I55S 1P27B 4TLQA 2BOPA 2MKCA 2CQDA 2EK1A 2CPJA 3CMAS 2M0GB 2LEAA 1VBZA 2DNLA 1VQ7S 3ZZZA 2WBRA 2L9WA 1HD1A 1S72S 3NNHA 3RW6A 2KM8B 3LPYA 2MHNA 1RKJA 1Q7YT 1OO0B 5DDOC 3VAIA 2E5IA 2DISA 1X5PA 2MKKA 1M90T 1N52B 5GVQA 1DRZA 5GMKa 2OJ3A 5MLCV 2MQQA 1X4FA 2DGQA 2MY7A 4C0OC 5HO4A 2LQ5A 2LXUA 1SJ3P 2EK6A 2CQ3A 1YJ9S 2RVJA 3CC2S 2Q79A 2CPIA 3MD3A 2XS2A 2DHAA 4IOCQ 5HL7Q 2J0QD 2MZ1A 2KXFA 1M1KT 4IUFA 1X5OA 5JVHQ 2HGLA 1X4BA 5LSLA 1U1NA 1ZZNA 2KXNB 2I2YA 1WG4A 3Q2SC 3HHNB 1FHTA 1X5TA 1JJ2R 2M52A 4WIIA 1F9FA 2LCWA 2OTJS 2N3LA 3SXLA 2J76E 3UCUP 2PEHA 2XNRA 2DHGA 3FEYB 2MMYA 2L08A 1H6KX 2DGTA 2X1GA 1VBYA 2ADCA 1KOHA 3ZZYA 2MKSA 4Y0FA 2MPUA 3BEGB 1U2FA 2E5HA 1W2BR 1BY9A 3UCZP 2ZJQQ 1D9AA 3G96A 1OWXA 2CJKA 2MY8A 5FJ4A 4FXVA 4QQBA 3THPA 3IWNC 2X1AA 1URNA 3NNAA 2DGOA 5EN1A 1VBXA 3MXHP 2J8AA 1YWXA 5H1SV 2OSQA 4WFAQ 1NJIT 2DIVA 2KRBA 1VC5A 1SJQA 3G6ES 1ZZFA 3SDEA 3V4MA 2X1FA 2DH8A 3MDFA 3CUNA 2VOPA 3ULHA 1A9NB 1N8RT 4QU7A 4CIOA 2MZSA 3S8SA 3D2WA 2D9PA 2ZJPQ 1KOOA 5GAHU 3CMES 1XN9A 3P49B 3DXBA 3S01A 2DNGA 2DNMA 2KG0A 2RU3A 4TU7A 2FHOB 2DNZA 4TU8A 2MQOA 2AYGA 4TU9A 2KG1A 1WF2A 1YI2S 2MKJA 1WELA 4RU2A 2V94A 1FT8A 2RT3A 3THTA 1M5KC 2DO4A 2MB0B 4ZKAA 2LEBA 2GHPA 3B4DA 1VQ4S 2CQ0A 2O3DA 4WFBQ 3CXCR 2MGZA 1K73T 1QM9A 2QEXS 3TYTA 4WFNQ 2G0CA 5DM7Q 2CPFA 4LJMA 1VQPS 4V19X 3VAKA 3U1MA 5DETA
chains in the Genus database with same CATH superfamily
1VQNS 1B99A 3LAMA 3OL7A 4JV5J 1SC1B 3THVA 4PRFA 1EZZB 4TN2A 1L3KA 1D3WA 2QL7B 4RW9B 2P9CA 3A8JA 1DQ9A 2ROPA 3W60A 3QPIA 5KFNA 4LSZB 4MIAA 2O1PA 1HWIA 4JI7F 1XNQJ 3V2UC 3V4IA 1NXIA 4KHRA 1RAAB 2HLTA 2QO3A 4RLEA 1FJGF 1AXQA 4ZLNA 2YQ0A 4O3OA 4OYBA 1T3OA 2MKYA 3GSIA 4ES1A 2FPHX 2ZKTA 2XQCA 1RYSA 2DNYA 3MM9A 4LFAF 4Q8EA 4RW7A 5KFYA 3RR8A 4IOAQ 4Y2KA 2PMHA 3VQTA 2PI5A 1U1PA 2IJNA 4USTA 4USWA 4ZJLA 5GADI 2DVIA 3DOMB 4DV1J 1SL2A 4LR9A 2VG5B 1Q7LB 3L7PA 1YSJA 3C16B 3KLFA 4K50A 3CF5Q 2BRLA 2YH0A 2M88A 4DV2F 2D1CA 4FF2A 1X60A 1U4BA 4DR1F 3CULA 2C28A 4D3HA 1R8CA 1GX5A 1FJCA 2WHOA 2XB2D 1NPKA 2OD6A 1ZA1B 4M1KA 2HPUA 4DU7A 3WBZA 1Y5IB 1VOMA 3BGOP 3MAHA 4IH6A 1R27B 2MZTA 1VQMS 2DKOB 4WP9A 3LP0B 1DTQA 1S1WB 1TMMA 4PZVA 2I6WA 3VGTA 4UY8T 3NXZA 3D1QA 2CZVC 1FRHA 1MG7A 4ZPBA 5B09A 2Y1LB 1KD1T 1HIYA 2B6AB 4LBHA 4L74A 1FXRA 3LPEA 4DR5J 1RTDA 4FYWB 4DN0A 3VGVA 3QAUA 1V5IB 1LFWA 1SQGA 4EK2A 4ER8A 3VQSA 4H54A 1ZAWA 2FLLA 2B3TB 1TFWA 2RRBA 3NWGA 1KVIA 1U45A 2CQBA 4OJ3A 1PC5A 4NXNF 4F26A 4OMFG 3MEEA 5HVFA 3JQJA 3W7BA 3OL8A 1U1KA 4L76A 4NWBA 2NYIA 1ZBTA 1NCLA 4WCEQ 2LDIA 2X1BA 3J81U 4LFBF 5KFSA 1C2PA 3R2DJ 3CD7A 1RAJA 2H9ZA 3KG0A 1RHUB 2NLWA 2FD2A 1UL3A 3GE9A 1FX2A 4JI8F 1YKWA 2VASA 2IMWP 4FP9A 1HQUA 3LQVA 1FDAA 2EBGA 1I6JA 4USIA 4OI0A 3OR2A 4DV6J 4W90B 3LGHA 1SL0A 1RT2A 1RT1B 4NLQA 1HPZA 3KNAA 4EWTA 4WTOB 1PGZA 3LH2S 2QMUB 4DR6J 2V4JB 1X9MA 2HKEA 4I2QB 3KUGA 1PC4A 2DIUA 1RI7A 2E5JA 3KG1A 4N8OA 4OX6A 4CO5A 3CD6S 3K2YA 4KC5A 4C0HA 3OQ2A 2VOOA 4MFBB 3BO3A 2C42A 2KYZA 2W4PA 5E2QA 4FNHA 3M1VB 5LOQA 4URGA 3V81A 2BJ1A 3H40A 2HFZA 2OTLS 3VAHA 1NJWA 1AROP 1OIAA 3W3SA 2RSQA 4LIRA 4RW4B 1T03B 1LWXA 1JLBA 1IM4A 1WTFA 1YJRA 3D5MA 2LQBA 3MMCA 4EU0A 4R5PB 3D66A 4NCBA 2P6SA 3OPKA 4NRUA 4RWWA 5KG5A 3OBIA 2DGWA 4LUBA 1RT4A 2VBWA 4U95A 2MKIA 3HFVA 3N6LA 4M5DB 3TUIC 2G2YA 2I5JB 2V2QA 3AJDA 1Q8LA 4JOUA 1VFJA 3PYEA 1IBLF 3SQGA 2DPIA 4FKYA 4HT5A 4ZVTB 1S0NA 1QE1A 2HNYB 4LFCJ 2Q43A 4NYOA 4KYZA 2QFJA 4QYZJ 4NI2B 2HBYB 3MMAB 3T9NA 2R2UA 4TYAA 3I87A 1CULA 4K4WA 5F9NA 3NGKA 2V8DA 5G4DA 4C11A 4ILRA 3H4DA 3EGWB 3BPSP 3CJ0A 2WB1D 4RNNA 3KLEB 4RWXA 2OFHX 4JI7J 5CD4A 3Q8YA 1UJ4A 2EPIA 3BYRA 1G1XA 2VKZG 4C8ZA 2BOAA 3O44A 3HKWA 4N47A 4ZOSA 2UU9F 2JH3A 2NSBA 2M4MA 1B7FA 5DJBA 3ISNC 3U7JA 2D74B 2DNHA 2A1BA 4C0BA 2BE9B 1WF1A 1SIZA 4GVLA 1HD0A 4CNYA 1KC8T 2VA2A 4QR2A 2J9EA 2O01C 2RF2B 5KTQA 1SJRA 2DB1A 1MN7A 1KP6A 3DLBA 5B0EA 4RO0A 3HLUA 2GO9A 2EG2A 3L3CA 3CPWR 3SCKE 2FGCA 2R42A 4BS2A 2HK2A 3B8HA 4OIXA 4YR2A 3AD8C 1X4HA 4OJHA 2A6OA 1JLQA 1MLAA 1EETA 2H48B 2YWKA 3R5AA 4XDCA 1UTAA 3M9MB 2HGMA 3VF0B 1TK0A 1S6OA 3O5TB 3AT1B 1YTYA 3HXMA 1FKAF 4DQSA 1S7IA 3FZ2A 3HULA 1TAUA 1BLUA 2Y0BB 2NZ4A 2OEMA 2KXHA 4IDKB 3KDOA 4LVOP 4WF9Q 1JMTA 3PEJA 2CQGA 1VISA 4KHMA 1Q5YA 1N32J 5KT6A 3MECB 1VIXA 4DG1B 4WK1A 4OHYA 3PACA 4M5JA 1HW8A 1Z4UA 3GJTB 4P71A 2PD1A 2OEJA 3CIZA 3PNIA 3OT9A 4Y00A 2XYGB 2WAQD 4OYAA 1Y9OA 2AWZA 4DR7J 1IN0A 1Q81T 2PE8A 1SQFA 1NKCA 4OI1A 2AYMA 4DFMA 4PUOB 3MD1A 3NRBA 4LT6A 1NAQA 1A6LA 2FJAB 4IG0B 4TY9A 3TNVA 3KLHB 4DV6F 2ASLA 1RHMB 2O67A 2BJ3A 3HKZD 3MCNA 4OYOA 4ZP7A 3PVXA 1NK8A 5HQ8A 5CXTA 2HYIB 3DLHA 2E5GA 1JKHA 1HQEA 3K8WA 2VJUA 3BPDA 5LMNJ 1T05A 3A4TA 3X3UA 1R8AA 5BR8F 1SJ4P 2FVRA 3R3TA 4I4BA 1S1UA 1RTDB 3CMQA 3M2RB 4YMEA 4LF7F 4I2PA 2QLJB 2LQ8A 1TZ0A 3GJRB 5I42A 1P9YA 2XZDB 3QJLA 3W63A 2IA6A 4CLZA 5CCLA 1WHWA 3GIKA 2AJ1A 4OX9J 1WSRA 1E6YB 4H4MB 2ZWOA 4URSA 3KK3A 2W24A 5HMYA 3KK1B 1ZYQA 1T11A 3IR7B 1S0MA 2KDOA 5ETQA 1DY3A 4A8XA 3PY8A 2F4VJ 1ZM3A 2HG4A 2Z2YB 2HAIA 5LXRA 2ZM6F 2JJ4D 1HL6A 5L38A 1HNZJ 3BGRB 3DDKA 3LP2A 4ED0A 3BSOA 3OSPA 2C2NA 2HS4A 1TKZA 4ERDA 3W2WA 2R7UA 4JBCA 2DHXA 4U6PA 4NLYA 5LXYA 3ZZOA 4NLRA 3CC4S 2OEKA 1Q53A 3UO0A 2FVQA 5KFUA 5BYSA 3HM9A 1NO8A 3I0SB 4PG6A 1M5OC 3G6XA 2EFVA 3CE8A 2VFUA 1U48A 1DTTA 1JKHB 2EKNA 2KJWA 5SUHA 3PFEA 5ITHA 1I94J 2WOMA 1RSCA 2CAJA 2E7WA 3T5JA 2E1CA 1DAXA 4DS5A 3FUYA 1QTMA 4K4UA 5LJ3Y 1TP7A 4NZ6A 3CJ3A 3H4BA 2JNJA 2HWTA 3VAGA 5A8KA 1HBMA 4XAKA 3WQPA 5CCMA 1IBLJ 2UVRA 5K8MA 3SQGB 3FJ2A 3M6UA 4NCGA 1RBOB 2DY1A 4DUZF 3AJ2A 3ZZ0A 3MM9B 4UQTA 4ZLPA 3OJUA 1T94A 2ZZTA 3HP6A 1VQKS 3M2UB 2C2KB 2VZ9A 2CWXA 1RXOB 1HNZF 1HNWF 5DS7A 4DCJB 3VAJA 1V3RA 2UUCJ 1RT4B 3EVOA 5A8WB 2VIHA 5KFFA 3KHGA 4DSIA 1BQXA 1JLGA 2M3DA 3KJFB 3DC2A 3C2PA 4RR5A 1TKTA 4WJBA 2R2RA 2BA9A 1X9SA 1XTZA 1WEZA 4PXEA 4MH8A 3RRHA 5EX3A 2HHHF 1FRXA 3ELHA 5J2QA 4A8QA 1K9MT 2CFXA 4F4WA 2ZC3A 2AZ3A 2DEIA 2HHQA 3R27A 1RTJB 3GU0A 3N5FA 4DS4A 5AE2A 2VPWB 2COLA 2W9BA 4UZBA 1LW2B 3BN4A 2Z2ZA 2MQMA 2BE2B 2H3EB 2J7UA 3IS9A 2QFIA 2HNDA 1T02A 2G1DA 2HBZB 1BQMB 3N01A 2AGOA 1J27A 1VQ5S 2HHUA 2FJEB 2MZQA 5C42A 2WOMB 4NOHA 4ED7A 1OYDA 3OJSA 3K8VA 1R6VA 3P5BP 1YLXA 4Q2MA 4J9UE 8RUCA 1SBRA 1TU0B 2BUNA 2F9DA 4MK8A 3PR4A 3BO4A 2IHR1 4AL5A 2BVZA 2RF2A 5CHCB 3UDEA 3TZWA 1WTBA 4C8MA 3KHRA 2RRAA 1SI9A 2CPHA 3UE2A 4WU2A 1P27B 4PG5A 4PAAA 2XBPA 3RAMA 3W9IA 1UKUA 1GTHA 2ZH1A 2HFNA 4F4ZA 2BOPA 1S12A 1YGYA 3M8QA 3OTCA 4J9NA 1XR5A 1S97A 4DSJA 1TV6B 2M0GB 3CMAS 1U8WA 4ECTA 2LEAA 2YKMB 1IXKA 3EE3A 1VBZA 3OXGA 1VQ7S 6AT1B 4Q45A 1RJJA 2EFGA 2WBRA 4WU3A 3UN2A 5LT5A 4DF8A 4LRDA 5JMNA 1OY8A 2PEBA 4M5KA 4M5GA 4WTYA 3GR1A 4Q0BB 2CXEA 5HQMA 1Q7YT 3W5YA 2UUBJ 1NSPA 1IBKF 4KSEB 5JXSA 1RHRB 4F3MA 2E7XA 4DL4A 4Y2CA 4WXOA 2DISA 3V81B 2XCPA 1WD6A 2W7OA 1YJTA 3MTKA 3D0IE 1JXLA 4H4KA 1S57A 1K1QA 4I2QA 4B3MF 5GMKa 2YNHA 3IM9A 2P2CB 4F3OA 5MLCV 3QWPA 5BXIA 2MQQA 2I5JA 1HQEB 5GMEA 1RCXB 4YHHF 1JB0C 2WK4A 4I6WA 2BV3A 3K5NA 1B64A 4EMDA 5KFPA 1RTIB 2LQ5A 5D3GA 3V4IB 2HVHA 4WYLA 1QSYA 3D6MB 2HHTA 2CQ3A 1DQAA 2ZD1B 4BWMA 3QSIA 2Y3YA 1BMQB 1NK7A 2FVCA 3ZZTA 2Q79A 3HJVA 4ECUA 3R2CJ 1NK4A 5I42B 2HQ3A 2UXBF 5U47A 4DV0F 1SV5B 1XBWA 2K2PA 4WIQA 5IC6B 3BQ0A 2J0QD 3FC9A 3E01A 3SFUA 2UXDF 2D69A 1RAIB 1UJ5A 1KQKA 2WSCC 4JV2A 3HVTA 2MQ8A 3K0JA 2HGLA 1KR4A 5ETVA 5K14B 3PKMA 4NL5A 5EWEA 3R7SB 3W2VA 2LLZA 3W65A 3IWXA 1U1NA 4NRTA 4CLPA 3PX0A 3OFEA 4A8SA 1DURA 2F4VF 4NLVA 1N5TA 1C0UA 3RBXA 2M52A 4WIIA 4O3QA 4FF3A 2LCWA 2N3LA 2ZE2B 3IG1A 3MEGB 4DUZJ 3FVYA 1MWYA 2J76E 1WOSA 2YNIB 4FDFA 1BE4A 3FEYB 4GKJJ 3MM5A 2UUWA 2C2ZB 3UI3A 5K8NA 3M05A 2GJIA 2DGTA 3KXDA 4HT7A 2BDPA 3ZZYA 2XLKA 5E3CA 2OD4A 5D0EA 2POKA 3JS9A 3OV7A 4J9SA 4F2SA 1JLEB 2E5HA 3M32B 1GXUA 5D3GB 4OL8A 3IP0A 1Q8BA 3H59A 3BZQA 3NBPB 4Q0BA 2CNLB 4FXVA 3THPA 2UXDJ 2E5LF 1LWFB 2X1AA 2XSJB 2RDJA 3FK4A 3MOZA 2VG7B 4OX8A 2YNGB 5EN1A 2HBRB 4YP3A 3PX4A 1T9VA 3MXHP 1S9FA 1HNIA 2J8AA 2HQDA 2ZBRA 5THWA 2A2DA 3DRSB 4DV5J 2B43A 3O1LA 2NREA 5H1SV 1UVJA 3I9ZA 4M5MA 4WFAQ 1YVFA 3GILA 1CJKA 1D9DA 5KT3A 2YNFA 4R25A 4F2RA 2P9GA 2N7YA 3HHLD 2O66A 1CJUB 1FDDA 3OFGA 2DIVA 4KH1B 4EZ6A 3G82B 1VC5A 1PYOB 4BHQA 4DPXA 2GQCA 4KH0B 1ZZFA 4F36A 3CJTA 2G13A 2OPSB 2Z30B 2AX0A 2OMOA 1WNEA 1FNMA 3CUNA 4QCLA 3J7AN 4YFUA 2CJ9A 1RA6A 4AL7A 3PRVA 3D1HA 1RP5A 2QG9B 3CCZA 5K9FA 4A46A 4CIOA 3EPIA 5F41A 1NK0A 3BF4A 3D2WA 2DRDA 3TR5A 4EYIB 3PG9A 3DRPA 2RD5C 2ZJPQ 1T05B 3NEKA 3CMES 1XN9A 1F9HA 1NHUA 3DXBA 3P49B 3O8WA 4PUOA 2ZBCA 3QT5A 1B3TA 4KGZB 1KWMA 3DLEB 3W8PA 3JSBA 2BE2A 1GMWD 4J9QA 5H9EJ 2E9ZA 1L3SA 5IZHA 2FHOB 2HNDB 4LQ9A 2XO6A 3KK2A 2FQQB 2OO4A 2W7AA 2YPYA 3BSAA 4OQJA 2Y1RI 1IR2A 3UDCA 4M95A 2CKWA 4X4SA 4IQMA 2Y8WA 2IYIA 1FE4A 3PW0A 2FHKA 5KFIA 1ZTTA 4QBUA 2K7JA 3DOLA 3ET6B 1F2GA 4NA2A 1FT8A 2NS1B 2ZBIA 4LFAJ 4TQSA 5J1PA 4EFAC 3UR0A 4JI5J 1RWXB 2Z0GA 3M9OB 5FDLB 2R7TA 1M5KC 4X4OA 3R9LA 1KVJA 4N7TA 3A3PB 3FCHA 4ZKAA 2GHPA 3WIVA 3B4DA 1TR0A 2ZOMA 1VRTB 4XPEA 1PJ6A 3JYTB 1KQFB 4JI6J 3SSSA 2JOQA 2B7BB 4X64F 4V19J 3ITHB 1TL3A 3FRZA 3VGUA 2HEKA 1CJTB 1VK3A 2ACMA 2JFDA 4WE1B 5EWFA 3Q23A 3I32A 3QT6A 3C15B 1GEHA 3H90A 2YQ3A 4QIEA 4ANCA 4ZIWA 2UUBF 2E9RX 2XMKA 3SMZA 3R97A 3T6JA 2NZCA 3IR5B 3LW5C 1LW0A 1RUSA 2NXJA 1YJVA 1HBMB 1X5SA 2H4WB 3FBBA 3K17A 3GG1A 4I69A 2MHEA 3BYPA 3L4BC 4PG4A 3Q24A 3AH6A 2FY1A 1RU2A 2R7OA 2J9DE 4K4YA 5D8HB 4XO0A 1H2UX 2FY8A 4Y6IA 4AFFA 3ZC4A 1QUPA 4JV1A 1UFLA 3ILIA 2V4RA 5FLXU 3LALA 4IR1A 1HQ2A 1NB2A 2FIUA 3A12A 3KHLA 2ZZMA 2AYEA 4DEZA 4KKOA 3AJ1A 5KG7A 5DGAA 1GFWB 3CJSA 1S1XA 1EB0A 1F6TA 1M1GA 1WOPA 4QZVB 4B3RF 3KUEA 1IUJA 3EM1A 5DDPC 1VK8A 2GIRA 4DX8H 3BO2A 5CYQB 3IAS9 3LWMA 1T3NA 1WJ9A 5LSRA 5A76A 1T8EA 1U7LA 4P74A 1GT8A 1OPIA 3BSCA 1T7PA 1TK8A 1VRUA 5B0DA 4NLOA 2EG1A 3I4PA 2V8VA 5F8MA 4N8NA 3G86A 4RNHA 3OTEA 2QSWA 2ZHBA 2HWHA 2VQFF 4DR2F 1TKDA 2F63A 2QLWA 2U2FA 1WUUA 3OVSA 1JLFB 2NPIA 4OV1A 4YDXA 3M8PB 3ENWA 4J9RA 1N54B 2LVWA 3M30B 2IRUA 4PWWA 3IRXB 2ZH9A 3CJ5A 3M4XA 3ZTQA 5EGYA 1VR6A 2V4QA 1A0OB 3IS9B 2CNKB 5HSPA 1H3DA 2WTFA 4DR6F 1S1VB 3DRXA 3EWGA 3WZ0A 4JI0F 1EQ0A 4KBIA 2IAJB 3J81Y 3OTOJ 3M8ZA 3P6YC 4WPAA 2R7VA 3C19A 1AFJA 2DTJA 2BXJA 1KRPA 4C8OA 2MQNA 2DGUA 3C14B 4P10A 2ZHAA 4BBYA 4DQPA 4Z7CA 1JLEA 2B5JB 3PIPQ 1T9XA 1UPMB 1FE0A 1GNKA 2R3VA 1XEZA 3QIPA 3AQOA 4TLRA 3QBCA 5B08A 2DO0A 1RT3B 3KLHA 2OSRA 3MM6B 8ATCB 2X3DA 2UVVA 1B0VA 1FKOA 3LGNA 5B0BA 4B3OA 1Q1KA 3NOGA 4B9UA 4C3LA 2C1EB 3CDWA 1GH8A 2HZAA 1T9TA 4Z7YA 1U1OA 2ZDOA 2BM0A 5C25B 1FJEB 3FRYA 1HBOA 2J9DA 4OYXA 4EZ9A 1X4AA 3LP1A 3IWLA 2YH1A 5HMWA 3TUZC 2A3JA 2AP6A 2ZDPA 3N6NA 4ELVA 2Y8YA 4F4YA 2CQ4A 3MM8A 2QC3A 1X4DA 1K0TA 3J7YU 1HHTP 4JYAF 4YOEA 1BC6A 2WONA 2ZITA 1ZM4A 2EW9A 3HHEA 4DPOA 1WHXA 3SI8A 1REVA 1GMUA 2ATCB 4I7FB 4JV0A 4QWAA 2PFDA 2UVUA 2RS8A 3J80U 2ADBA 3UWTA 4OI3A 4QIVA 1S1VA 1VQSA 1TVRA 3CDBA 2UU9J 1EETB 2DITA 3JQKA 4EBEA 3CJKB 2XZTB 1ITPA 2IC3B 2LU2A 2VQEJ 4R0JA 5E5NA 4A47A 5KFXA 1EX8A 4HEA9 2AJ2A 4ZVRB 1JX4A 2DPJA 1FD8A 1OQ6A 3O6QA 1FTRA 2V69A 4QPXA 3JSYA 5ETPA 2JVRA 5F3ZA 4QIWD 4EGLA 4LSNA 3AOBA 2DGXA 1X4GA 3KJQB 2MXYA 3OVBA 1G2EA 1D8ZA 2DXEA 4AXJA 4DV3J 1IKWA 3F0NA 2IAJA 4YB6A 2JZ5A 5G0RA 1S9EA 1RHKB 4A8KA 3CCLS 2LECA 2F5GA 4OV6A 4USKA 3N9UC 3NS5A 2HLUA 4HDGA 4DSKA 3GFZA 4KO0A 4ZCIA 4ZITA 2EKYA 4ZN3A 3NS6A 4DR4J 1EQMA 1U0HB 1WI8A 2FTRA 3VALA 4M5LA 5L1IA 4PWDB 1C0TA 2KH9A 1L3TA 5ETMA 5AXKA 4CH1A 3PV8A 3HI9A 3A8IA 1U1QA 2CJAA 2ASDA 4JI5F 4LMZA 4E8UA 5DRKA 2LA6A 2KN4A 3MR6A 4DV1F 4J9VA 2D41A 3KNGA 3N0VA 5BYRA 2ZH3A 2XS7A 2GW8A 2FJWA 2IDLA 4PXBA 3GCXP 1ZA2B 3HDSA 3JAMU 3C15A 1Y3KA 3GIMA 4ZJOA 4G65A 3F73A 1QAXA 1RK8A 5IV3A 4OZLA 1IBKJ 4JV5F 5IFMA 4R8UB 1K44A 2L9DA 3W66A 2G1HA 4AD6A 1JLBB 3MMCB 2B4PA 3K57A 1ZM2A 4ECZA 3QNWB 4IR9A 4CNZA 4DOZA 1T03A 2IRXA 3I6PA 4AQYF 1NJYA 5T41A 3R6LB 1UFWA 4PKDB 1KLMB 1YHQS 2YBVA 3MCOA 1LW0B 2ERRA 3TAQA 4OYMA 4RW9A 3ZZPA 4DPTA 1ZPVA 3ISND 1EP4A 2YX7A 5KFAA 2QE5A 3PJ9A 3RB4A 4ZPVR 1LWEA 2M2BA 2ZNYA 3MTJA 2GVZA 4DLGA 2LP4A 4O3RA 2HFOA 2WB4A 3C6TA 2IYGA 1NSQA 4UF4A 1IR1A 1HWUA 3S1TA 4WKYA 4UOGA 4DX6A 3K5LA 4L3NA 1PO6A 4LF7J 3E2EA 4QPTA 4PWDA 4WZMA 3EGNA 2FC8A 1ZS6A 4UOCA 3QJJA 2F40A 2ZKUA 1GAOA 1WKKA 1KBRA 2RU9A 2YNHB 2Z56B 2R8HA 2JHEA 4Q2LA 3C66A 3NG8A 1PYSB 2HRYA 4M8LA 3N79A 1R8HA 3M6VA 1WG1A 2X51A 1NDCA 1XJWB 1RAEB 3W62A 3TZXA 4U7CA 2FZCB 2F8EX 2KVIA 3Q8UA 2BJ7A 4L72B 4OHVA 4X65F 3OUYB 2H51B 3M8PA 4GKKJ 2W2PP 2GVDB 3NGDA 3OVAA 1KDNA 3QT8A 3IRXA 1P8GA 1TL4A 4X66J 4RUHA 3GV5B 3GIJA 1TMJA 1Q86T 2BYCA 4IH5A 3ZXWA 4PQAA 1FXDA 1I1GA 4UOFA 1WHVA 1X9WA 1NDKA 4JI4J 1N6QA 1FNOA 2DD8S 2XTJP 2OP5A 3D1OA 1T95A 1AUSL 2B6AA 3G87A 2XHWA 4OI6A 3RB3A 2AKWB 2J5AA 2XHCA 1WG5A 4DV0J 2IA0A 1H7WA 2VFRA 1JJ4A 4KY3A 3NOCA 4DX5A 2V2VA 3EYZA 5CQGA 3HHLA 4J37A 1LEOA 1FEHA 2XNQA 3RB0A 2HNZA 4GMKA 4ETXA 2QJ3A 1PBUA 4ED6A 1KFDA 4QYZK 2XLJA 1ZH5A 3PO4A 3GZ7A 3NKYA 3H42A 1M0SA 2B8PA 3DU6A 4HDHA 2IM1A 3JQMA 3LTOA 4CM2A 4IFVB 1R43A 1HARA 1SC4B 4NZ0A 4ZVFA 4O44B 5BYQA 3NL0A 4CLWA 1P6TA 4TYBA 5DLGA 1M5PC 2B9WA 2CJYB 2JRSA 3VHQA 2ZJRQ 4UOHA 3OUYA 2ACYA 4MT1A 3G8TA 3EJMA 4W98A 3QZ8A 1RWVB 2HQIA 3TOQA 1XQIA 2ZVIA 4MFBA 4X4RA 2RB7A 4DV7J 4L3KA 2L41A 1VGYA 4MJKA 1AFIA 1AT1B 1G3OA 1LWFA 1S5ZA 4F04B 2FHJD 5EDWA 3BSNA 2DH7A 3GYGA 4P6QA 1PIEA 1KQGB 3RGIA 1N5VA 5IC4B 1XERA 2LYVA 3T41A 4CWBA 3NAHA 4ECVA 2WVBA 3M32A 1UAWA 1OPZA 4MKVA 1U6ZA 2EFPA 1WEYA 2ZC4A 4HLBA 2FB0A 3I96A 3FSYA 4ZCMA 3EX7B 2NSCA 4FF1A 4K0KF 4QU6A 2LA4A 1RTZA 1B0TA 4DU8A 3BQ2A 3WHIA 2DR9A 5F8NA 2CQCA 3FBCA 2WZ1A 3CNQP 1HI8A 1FKPA 1E6VB 2QYCA 3PW7A 4RW6B 4U7UD 3K59A 3POTA 4DDFA 1CC7A 4U7UK 9RUBA 1RT6B 1WC5A 2CQPA 2E1MC 3BKTA 2RJZA 1C0TB 3TAPA 5J1EB 1U1MA 2DRAA 1S48A 1FF2A 1JLFA 5ADZA 1APSA 3N6MA 1F5AA 2FZKB 1HHSA 1Y00A 1HBUA 1PJ7A 3TX0A 3MM7B 4YB1P 2RUSA 1U2RA 1N0UA 4UY85 1NPRA 3KUHA 3DRPB 2LMIA 4YN3B 3RR7A 5ETTA 2IFXA 5C7PA 3D6FB 2DR7A 1GXTA 1RWUA 5IS2A 4IKAA 3MUTP 4QR1A 1N34J 1T0TV 2LEPA 2CPDA 3W9HA 5EWGA 4X64J 3BDEA 3ILOA 1W25A 1PBAA 1S10A 2Z57B 3M2VA 1IBCB 1S4EA 3MR2A 2ILYA 1UA1A 4F0HA 4YUDA 5CA5A 5K8OA 4DX7A 1PAUB 2KFZA 1Y7PA 2C2DA 3B54A 4DQQA 3DOKA 1WKJA 4O4RA 4A8WA 1SH2A 3EGVA 4IG3A 4A48A 1EJ7L 1X0PA 4DR7F 1RT5A 3J7Z5 2GS8A 4OZ0A 4UW2A 2YWGA 2VFSA 2XO7A 1S4FA 5J1NA 3WIUA 3OTOF 4USHA 2GMLA 3UDLA 3CJRA 3QFWA 1UEKA 2FDNA 1RT6A 3K5MA 2ALYB 4C9DA 2V8GA 1SB6A 4LSLB 2VF3A 4PQUB 4TLQA 5HANA 4Q43A 4B17A 5KT5A 1NM2A 1VHIA 2CQDA 2YNIA 1FESA 2ZNZA 4FYXB 4YB5A 2XCAA 2CG4A 2WONB 4KGVB 3R7BB 4URQU 5CAAA 5BR8J 4QWEA 4RUAA 4JI4F 1KEKA 1RWNB 2DNLA 2JC1A 3W8GA 3ZZZA 4QR0A 4XPCA 1NK9A 1UCNA 5ETSA 2DEJA 3KMQA 1TFYA 2BX6A 1N32F 4K2JA 2KM8B 3AHPA 1RKJA 1AZSA 2NUHA 2ZH2A 4RW6A 4LFBJ 4QOTA 5H9EK 1M1HA 2F7VA 3TEHB 5KFHA 4WE1A 2EFOA 2K3IA 3MEDA 4Q7AA 1SKUB 2L48A 2ZE2A 3IG1B 3MEGA 4KTQA 4KGXB 4LREA 1DRZA 4DG1A 4ZLLA 1HYSA 1TTHB 3OHAA 3NMRA 3BREA 4F3QA 2IM2A 5CYMB 1LQ9A 1X4FA 2V9WA 3RTVA 4IG0A 4H4OA 1B70B 4C0OC 4QW9A 1SL1A 2VFVA 1C1BA 1HWJA 1S1TA 2DHHA 1SJ3P 4PYDA 3R5JB 3VGSA 2HZVA 5E3QA 2WVCA 1RHJB 3M1VA 3BDPA 4CT9A 3HSJA 2RVJA 1J5OB 3T9ZA 4J9OA 3SBMA 4P7VA 1YRXA 4OYIA 4P2MA 2CPIA 3MD3A 3DYAB 4MIWA 3TJAA 2BE7D 4V1Ak 3KLIB 4Y3CA 4DV7F 4J90A 2ALZA 1N36J 4KHPF 4ITSA 1FK9B 3C6UB 2FJBB 3BBBA 4DN9A 1HMVA 4PWUA 3HSGA 4TY8B 5KFMA 2R8JA 5ETNA 4IUFA 1X5OA 4NYZA 3M6WA 1YK9A 4ANEA 3BGRA 3LP2B 1NKBA 3P4UB 3VZIA 1V3ZA 3DDIA 4O44A 5E7OB 1BWEA 4OZJA 1CJUA 1NSKL 2PC6A 3FBFA 2ZM6J 1RAFB 4K0KJ 3D0HE 2DJWA 4KO0B 1NB7A 1QAYA 3FQKA 2VDIA 1JJ2R 3HHNB 4FYDA 1KTVA 3HD2A 1G7CB 1F9FA 4C11B 2OTJS 4J7CA 4J9LA 2KZMA 5KFQA 2HQFA 4Y28C 1I3OB 2QA4G 2B56A 2GQQA 2HHXA 1N0VC 2AU0A 1S9GA 2GJFA 3K89A 2HSEB 2L08A 4TXSA 3M8RA 4IRKA 5J2MB 3MR3A 1S6UA 1OSCA 1TKZB 2GAGC 3HZGA 4B02A 4Y0FA 1RWOB 3DHXA 4ZVGA 5KG4A 3BBFA 1UZHA 2CUYA 2V2ZA 3CIMA 1U2FA 2XY5A 5B0CA 1TKXA 1D1UA 3K5PA 3UCZP 5KFOA 1XMQF 3G96A 3V6JA 1H73A 1OWXA 2HWIA 4TVAB 2CJKA 5HAOA 3KTQA 1RTHA 4K8RA 1QAJA 3NCQA 4RU9A 4BC7A 3EZOA 3FMWA 1URNA 3QGPA 4OLPA 1PAEX 2AJ0A 3DLGA 4PYAA 3M9NB 4ECSA 2NR0A 1VBXA 4DPUA 5KFWA 1RB0A 1FKPB 1S49A 4Y2IA 3EMTA 2RHSB 3HFKA 3QO9A 1I51B 4CM0A 4RUCA 1BGXT 4DV3F 4NASA 3KOAA 5HLFA 2P8IA 4AQYJ 3TI0A 4X4VA 4O0NA 2J0WA 1NJIT 4ZDNA 4O0IA 3HSZA 3HMJG 3PO5A 1S0VA 4IRDA 2R8KA 2KRBA 2I1RA 4IDKA 3CJQA 1SJQA 2NXCA 4RNOA 3K7RA 3OXFA 2BEFA 1DLOB 1I5OB 2RKIB 5A8WA 2W2QP 3LGMA 3E01B 4LF8J 2A6MA 3KWMA 2VOPA 3ADAC 3ULHA 4MAKA 2W9BB 2QMXA 3EXCX 3RUBL 4OHZA 2LXFA 3OFFA 4QU7A 1NNDA 4B9SA 3BQ1A 1HLWA 2W9CA 2EFQA 3GWCA 3R8YA 2B4OA 4LVNP 3RBDA 2VA3A 1ELOA 5GAHU 2ROEA 4GC7A 1R31A 4ZVSB 3Q8SB 5CABA 2EBEA 2OPPA 3S01A 2DNGA 3IXQA 3VZHA 1WC3A 2DNMA 2F8HA 5HATA 1NBEB 4MKAA 2JSXA 2OAUA 2XI3A 2ZHOA 3LANA 4F0MA 4B3SJ 4O4GB 4B08A 4CT8A 2HNZB 4ED1A 3QGIA 4USJC 3KJVB 2AYGA 3OSNA 2KG1A 1WF2A 1WKLA 2MLZA 1VJWA 2QRRA 3PHEA 3QO9B 1IWGA 2QLFB 4NLPA 2XLIA 2MKJA 3NCRA 1OY6A 2PMZD 3VVTA 4A8YA 1YI2S 4ANDA 2QTWA 2J6UA 2V94A 3TZYA 2RT3A 3DN9A 3ICLA 1FWLA 2E1AA 2R2TA 3HFZB 2PA8D 3RG6A 2MB0B 5D0GA 1N33J 4DFPA 1VQ4S 2HHPA 1CLFA 1H7XA 2CIMA 2CQ0A 2HK3A 2O3DA 3OR1B 2V6AA 4WFBQ 1K73T 3TYTA 1LFPA 4Y2MA 4WFNQ 4DL6A 4EO8A 1FRJA 2OPSA 4LJMA 5A2QY 2KJVA 1U09A 3I0SA 5KT7A 1VQPS 4NLGA 3CO0P 3D28A 5AXMA 5DETA 1Y5NB 1SJ1A 2QSFA 3BBCA 3W61A 3PW4A 1QVGR 1U6BA 4C8YA 3VAMA 3TUPA 2G4BA 3GCWP 2R7SA 2C2EA 3Q22A 1Q78A 3S7RA 1LXNA 4X4PA 4MKBA 2VONA 4NCAA 1TAQA 5CH7B 2DGVA 4RBTA 3HO1A 1H98A 3Q8QB 2RNEA 4F50A 4GKKF 1Y5LB 5EX0A 1FNXH 3GFYA 4ZP9A 3C6TB 4ED8A 4ICLA 2PA3A 1ZPWX 2B51A 4E2FB 2CWKA 2GMJA 3SFGA 5B7WA 2OPRB 4NLSA 1SXLA 3CC7S 2WW4A 3KLIA 1O8BA 1LKZA 1YJWS 3HVAA 3PYGA 3F41A 4K4ZA 2G2OA 2JWNA 1JIHA 1TUWA 5E33A 5C25A 1Y4ZB 5KFJA 4XIUA 2D3O1 2OUGA 3I5BA 2W25A 2P9EA 3DCAA 2IVMA 5KFEA 2Y1IA 3GV8B 1S59A 1XMBA 3GFHA 1YBAA 3CCSS 4DJBA 4TKTA 3UR3C 4P2XA 1JWWA 3A13A 1O6XA 3FSXA 1PJ5A 4NE9C 1NDPA 3UN5A 1CPZA 3NGSA 2DR8A 4DSFA 2IRYA 1O5JA 1VQ9S 1OY9A 3R1HA 1LW2A 3I5AA 4FN5A 5HBMB 3UPFA 2R7RA 2IM3A 1L3VA 3HD1A 2X7IA 1N48A 3HHDA 5A6WA 4YEAA 3X1LB 2GNKA 1VLYA 1ZM9A 3A3NB 1REVB 4I7FA 5DG8A 1VJQA 4Z37A 3PEHA 4IQXA 3VV2B 4FNIA 2W4CA 2Q3PA 2SXLA 5EUHA 4EBDA 2CPXA 3P3DA 4IFYA 2M9KA 3BH7B 3JYTA 1CS4A 5L9NA 5E41A 3ETOA 2VJVA 4MK9A 3PW5A 4J91A 4ZVUB 2QZ8A 2G2ZA 3ZTOA 3T5LA 3LO3A 1KONA 1RU1A 3RW7A 3L7UA 3ZNJ1 1U0HA 4LBIA 3IMQJ 3R5BA 4CO4A 1N88A 2BW7A 2KRRA 5LL6d 2LFVA 4YY3F 5HROB 4LF8F 2W01A 2CQIA 5B0GA 3CO9A 5A0YA 5K8PA 2H5IB 3UD4P 4ZP8A 1WC6A 1S6QB 4M94A 3DHWC 3TVKA 4IH7A 1ZAVA 4U8YA 5I4MA 1IKVA 2JDJA 1GXLA 3CT9A 4CLSA 5CYJA 4GC6A 2R4FA 2ATLA 4X4UA 5GAEU 3TP2A 1S76D 3P5TL 1JQGA 1RT5B 1LK7A 1AZSB 1KHWA 2CA9A 2Q1LA 4WFXA 4ZJQA 1TK5A 1TELA 1WC4A 1FI4A 4AYBD 5DDQC 4NXMJ 4UZCA 5ETOA 3EVWA 3W9JA 2AYBA 2E9TA 1ICEB 2AQ4A 4LR7A 1UVIA 3RYLA 5LJ5Y 2FHMA 4XDDA 2MKHA 4ES2A 4WK3A 1F2HA 4YHHJ 2BJEA 1JJHA 2OH2A 1NZAA 4F02A 5HP1B 4ALZA 3TANA 4QIGA 4DR5F 1NEEA 2YQ1A 3VWSA 4EO6A 1ACMB 4OLOA 1ZTWA 3RU0A 4B9MA 2XMWA 3CDAA 1F1BB 2CQ1A 2KM8C 2XGPA 1C4CA 3IRWP 5J2NA 3G6VA 5IOLA 1N5QA 5D0RA 1VI7A 1MROA 4ZCKA 2XULA 1Q5VA 2OKQA 3V6KA 5L39A 1HNVB 5F0UA 4CYUB 2DBBA 1WDDA 4G1IA 5AXNA 4X4TA 3MFIA 3T5HA 3AFGA 3D7SB 3CJ2A 3DMJB 4U8VA 3CGIA 1DZ5A 2VPXB 4X4NA 4FXWA 3UN3A 5J1EA 2HRTA 3CVKA 5HMZA 3G6YA 3DGPB 4CLFA 3T5KA 5JUMA 2AD9A 3S6EA 2MSSA 1E6VA 4G6VB 3ISZA 5HI7A 2BZ2A 4YDDB 2CZ9A 1EAYC 2RQ4A 3DM2B 3DYAA 3SSQA 4C3MA 4EI2A 2HHVA 2HHWA 1HNXJ 4YQWA 4F4KA 4KPYA 4F4AA 2MSTA 4WWSA 4ZVOB 3M6XA 3W64A 1VQLS 1K47A 1TUVA 4I67A 2B4VA 3GIRA 4ZPCA 2MJUA 2KKHA 3U02A 2FVPA 1N33F 4N77A 1Q16B 1RT1A 1FVSA 1RWPB 1UVLA 2B9YA 1UJ6A 2ZBPA 4TY8A 3DOLB 3ET6A 2FUG9 2AJFE 3AA8A 1T9YA 2UXBJ 4PEOA 3NMAA 1IKVB 3DXSX 2PGCA 3MM5B 5C24A 1MMNA 1UETA 1CJTA 1UW4A 4CH0S 1VDHA 3GIIA 4DV4J 4DQRA 1IKYA 3MAAB 4WFZA 4RJVA 2KFNA 1Q4RA 4FZVA 2FLNA 2FYXA 3QLHB 2JX2A 1N56A 1C0UB 2KVQE 3GP9A 1V9OA 2UUAJ 2F65A 3PZPA 2HVZA 1OYEA 4F0KA 2R8GA 1FXLA 3GB0A 1YIJS 3DFEA 3HT0A 3NGRA 2G0JA 2E29A 1JJCB 1U02A 2M7SA 2RQCA 4DLEA 1XC9A 3MHYA 3CCJS 4AL6A 4K4XA 2VICA 2PI4A 2CJQA 2BJ8A 3M8QB 3RBEA 2G0IA 2NCKL 2WBMA 2NXUA 4HH1A 4EUVA 5DG9A 4LFCF 2ZH5A 2W2NP 3RRGA 1ZAXA 1FDBA 2OPRA 3SEOA 2N7CA 3T1AA 4OI2A 5J2NB 1XR6A 1SCJB 2H1YA 2VV5A 5DGBA 1MWQA 3QRRA 1YQHA 4KFBB 3W2WB 1VQ8S 2R2SA 5A8RA 4NA3A 1WORA 4P72A 4KIAA 3H5SA 5D77A 2K1RB 4U67Q 3SDEB 1NK6A 1FFSB 3AXMA 3HVRA 3G82A 2B4UA 5DQHA 2R7WA 3OL9A 4ECYA 1HA1A 4F8RA 4OZ5A 1VQOS 3PJXA 4QWDA 1QJHA 3FEZA 4ZA1A 2DXDA 2W9AA 3BV8A 1M5VC 2YX4A 1WHYA 1SJFA 2OFGX 3D6TB 1T9UA 1Q0NA 1FO1A 1PSDA 4HACB 3CCRS 4ZN1A 5IWAJ 4OYPA 3F44A 2OPQA 3LP0A 4ZS6A 1U47A 3HHKA 3TZZA 2D3ZA 3D6HB 2J0XA 1U1RA 1S7HA 2V8PA 3D54A 3EUNA 3NWRA 4OZNA 5DO2A 4ZHRA 2CNOB 1R7IA 2DGSA 2U1AA 3IGNA 2RQKA 3U1LA 3KLGB 4WZQA 1QY7A 1Y0HA 5JVGQ 2HS3A 3I0RB 4RL1A 3IBFB 2MQPA 2HVEA 2QLXA 3DLJA 4ZVHA 2M8DB 1Y10A 1JLGB 1WSVA 4KV8A 1NU4A 1VS3A 3PJWA 3CCUS 3TARA 3ENVA 1EARA 3VAFA 2IJFA 5KFKA 4JI2J 4KFBA 1N36F 4KHPJ 2VBYA 1CEZA 3A8KA 5GAGU 2IBKA 3I31A 1IJEB 3PYFA 3ZZRA 1ZOTA 2KL8A 2VUGA 4I0WA 4O3NA 5E0OA 2XYHB 3MZIA 3PXGa 4P73A 4JI6F 3EPGA 4IO9Q 3D67A 1MSWD 3H20A 1RYRA 1KFSA 3FCVA 1RGVA 3FDSA 3MCSA 3MWBA 3TA0A 1FEEA 5CZXA 2BM1A 4RUBA 2DK2A 1A7GE 1GMVA 3MM8B 1TKTB 4RPFA 3SV4A 5LSOA 2WCXA 2JFKA 4BLGA 1BQMA 3PFOA 3QMQA 3OTDA 1QVFR 2M70A 4A8OA 4B9NA 4P7TA 1J5EJ 5F8JA 3UNYA 3ENAA 3CCVS 2LQJA 4LF2A 3W5ZA 1OMSA 1Q8KA 1WEXA 1OQ3A 3MAQA 3GPAA 3BB5A 3HSDA 2XEXA 3QQCD 4ECRA 4LF5F 3C3LA 1QTNB 3UVJA 1KNZA 4ZCLA 3QZ7A 4P2FA 3IN5A 4C2MA 3AXKA 3IAM9 3CCMS 1VCTA 4ENOA 2Y1JA 2QN6B 2ZWPA 3PX6A 3G8SA 3NLCA 4WXWA 4D3GA 2JEGA 4IRCA 4DR1J 3PRDA 4KV8B 4ETZA 2ZOGA 4I68A 5GAHI 1AB8A 4RBVA 1XMOJ 3R6GB 3BR8A 1M5HA 3Q2TC 1MROB 2K8GA 3TUJC 2C3OA 2VB6A 4HHHA 1Z1ZA 7FD1A 3DM2A 1KLNA 3DGPA 4FKXA 3B4MA 3CCWA 5G0RB 4CO2A 4DHVA 1GQEA 4ICLB 1W26A 4LIWA 2C22A 4HI1A 1UVKA 2AEMA 4QWBA 4CLLA 2GQ2A 1SC3B 5AJ3J 4F7VA 4PXDA 5DDRC 5KFGA 3Q86A 2F9JA 3B78A 2R8IA 1QSSA 2LDYA 3DLLQ 2XMVA 3AD7C 2XG8A 4C8NA 3BGFA 3UW1A 2DNRA 3DNCA 1FVQA 2YWHA 5LMUF 2XSFA 1VRUB 2E7VA 1X0FA 3D0GE 1JLCB 3FFIB 3R5CA 4PR6A 5SZTA 3C16A 1MMLA 2XMMA 3HHLB 4J9MA 4CLKA 3FCWA 2KYXA 3TA2A 3EICA 4RZRA 4KPCA 5E3PA 1VHFA 5FLXY 2V5HG 1LNQA 1UWBB 4ED4A 2BR0A 2M8HA 3DLKB 1SKSA 3M8WA 4O4GA 2IBOA 1P1TA 2P6TA 5IXUA 1FX4A 2XMJA 4F25A 4CH7A 2XMAA 4FPRA 3R1LA 1WWHA 1JLAB 1S77D 3AODA 5F8LA 2FC9A 3VCDA 5C2GA 4KAIA 5I3UB 3UD3P 1K8AT 4LF9F 1BHNA 2OLWA 3CSKA 2GVZB 1RDRA 3POTB 3JB9k 3UCGA 3MR7A 4JI0J 3KJVA 3GG0A 1CG2A 2GA7A 3QGGA 5I3QA 5M2PA 3MUMP 1J5OA 1JXVA 4GO5X 4Y34A 5ETRA 2PIIA 1BUXA 3RBZA 4E0DA 5IT0A 2KTQA 1IR0A 2H4YB 4BWJA 1U8SA 5KFZA 1RT2B 2CPJA 1FKOB 2ZOFA 4WFYA 1ULRA 3I4HX 4K7QA 4B3OB 1HPZB 2C2RA 2OMLA 2JEIA 4YY3J 4NMLA 1D09B 2BKNA 2L9WA 2H65B 1S72S 3TX8A 5KG0A 2V67A 3SV3A 3RW6A 6FD1A 4LF4J 2WRMA 1EKRA 2MHNA 3LP1B 1SH3A 1MW7A 1OO0B 5F8GA 3AY0A 2V34A 5DDOC 4TQRA 3VAIA 4LF6J 1FFWB 4P9SA 4QW8A 1RACB 5J2PB 2F8MA 1RTJA 3LF0A 3MPYA 3D4JA 1X5PA 1OSDA 2XY7A 3DI6A 1S0OA 3M8YA 4CI0B 2MKKA 2FVSA 4ELUA 2B9EA 1TL5A 3DLGB 1NHVA 1C1CA 3A8EA 5L46A 5IWAF 5HP1A 2OJ3A 3MPVA 4DUYJ 2J7WA 1WDTA 1DJ0A 2W7PA 4E98A 1QLNA 3IA0A 2VHGA 1W2IA 2MY7A 4CTAA 2VG6B 2ASJA 2FJVA 4O3PA 1UPPA 2HQGA 1UA0A 1VIOA 1UVNA 4NX9A 2OI2A 2EK6A 2HAFA 3CEDA 4UUWA 1YBUA 4C3KA 3H7HB 3WC2A 3B82A 1YJ9S 4PPDA 3P8BB 2AEJA 3CC2S 3BJYA 2CZ4A 2FJDB 2DHAA 3T1YJ 2XS2A 5T14A 1S1XB 2BJ9A 1XNRF 1PG5B 5HL7Q 3N4WA 2MZ1A 2MLYA 3GJQB 2CVEA 2WVFA 5GAGI 2K7KA 2L9NA 2G9OA 3CDEA 3M30A 3EDRB 3HVWA 2F4FA 3DOKB 1FTCA 1ROFA 3KFWX 2A0FB 3LWLA 5JVHQ 4DFKA 2I9SA 3J80Y 2F1FA 2AJQA 1CJKB 1TQLA 2GJ2A 3DKDA 2HVDA 8AT1B 4J9KA 4RKUC 2EWHA 4MMOA 4OHXA 3PKYA 3EZUA 1ZZNA 2KXNB 3KG4A 2CRLA 2QYGA 4HHUA 2I2YA 3TRGA 3GV7B 1X5TA 1FHTA 4DL7A 3KK3B 2C2OB 2YWEA 2YWFA 3KK1A 1LOUA 4QIFA 5AE3A 1HNXF 3DI6B 1DTQB 1J5EF 2IY5B 3TVZA 4RBUA 4ZPAA 4NLWA 1HKAA 1B4SA 3FKBA 3PTWA 5D4NA 5AT1B 5HROA 2X1GA 1S6PB 2APOA 1KOHA 2ZEJA 2ADCA 1B0PA 1VBYA 1S1TB 3LAKA 2MKSA 2IM0A 1KLMA 1MMDA 2MPUA 3BEGB 2KO1A 2VG6A 4GVBB 1W2BR 4DZ6A 2WSFC 4I64A 1C1BB 2ZJQQ 4CZCA 3V5RA 4HYKA 5FDLA 1U0SA 4QQBA 3UVJB 2K1RA 1F0XA 3IWNC 3PRBA 1N34F 1EIYB 1FK9A 3TA1A 5A8RB 2D7SA 2KZZA 2VFTA 3I5CA 4FVCA 5AXLA 1V5VA 4YS2A 3MPWA 1YBTA 3QWUA 4P2SA 5FD1A 2RDDA 4OZ3A 2ROGA 1DFDA 3ITHA 1FFGB 1EP4B 3DGVA 2FLPA 2NYHA 4ILLA 4NXMF 5A8KB 2RQMA 1V3SA 2GHWA 1C4AA 1LWCB 2OSQA 5HK4A 4CLTA 3QSYB 1Y11A 2EFNA 1TL7A 3CD0A 1LV5A 3CJ8A 4RNMA 4HHJA 1QUVA 3PW2A 2Y9HA 5E3RA 4C8KA 4ZVPB 3GYNA 3L09A 4ZHRB 1FRKA 3V4MA 4GKJF 3L95X 4UTGA 4G1QA 2GGPA 4OI4A 2DH8A 1TUGB 3TW0A 4B3RJ 5MAOA 3HJFA 3MMBA 5I3PA 1HHQA 4X4QA 2VU5A 4R0EA 1NDLA 2UV8A 4BC9A 2BQ3A 2KHDA 2Q6BA 1TL1B 4KQZA 3H5XA 4CP5A 2OELA 2QL9B 3S8SA 3D9BA 3EZ5A 3FFIA 2VBZA 2ZVSA 3QGHA 4LBPA 3TQ1A 2E5LJ 5KFLA 1RTHB 1KOOA 4OZ2A 3JXOA 4A8MP 3K5OA 2B7CB 2RU3A 4A4JA 4TU7A 2PFFB 2DNZA 4LSLA 4TU8A 4PQUA 5C5JA 1HNIB 2LQ9A 2W1BA 3OXLA 3QAEA 4H4MA 4LR8A 4DQIA 3SSRA 1FD2A 1S9EB 3MF5A 3R5GA 5A2QU 3KDNA 2VBXA 2WVDA 1Z2LA 1R6YA 3GONA 2GC8A 3FZBA 4PPZA 1SH0A 3CWJA 5K20B 5KFRA 1S1UB 4IFVA 4MK7A 4PG7A 3Q8PB 3KLEA 2E1RA 2DO4A 3UFCX 2UXCJ 3HCXA 2W8KA 4NLDA 2RAQA 3IR6B 2LEBA 1VQYA 2RIJA 3Q8VA 4X62F 4UUXA 4K4VA 2MGZA 1QM9A 2QEXS 1RABB 5D6GA 5HJXA 4ILMA 3TEGA 3WX4A 3JSMA 1C1CB 4JI3F 2CPFA 4K2XA 3VAKA 3U1MA 1K0VA 1S1WA 1RT7A 3SCIE 2CPZA 2AF6A 3E8OA 3EVMA 5A0YB 3OTBA 3NGTA 2GX8A 1BQNA 2CADA 3BN7A 2HS0A 2KI2A 2BJDA 3HX9A 4KGKA 5IQ6A 3T1HJ 2MEWA 2Z2MA 2CJBA 2NUUG 1AUDA 2DH9A 1L3UA 4I6AA 2FJXA 1DHMA 1O0PA 1YZ6A 1NPPA 2RH3A 2XGQA 3TJ9A 2L3MA 4KB7A 1T9WA 2OPPB 2DY9A 4K5RA 4DR3J 4ECQA 2H54B 3N5BA 2QX0A 3FEXB 3MPDA 3C6UA 1VC6A 1LK5A 5GAEI 1Q8IA 1S6QA 2V68A 4DSLA 1W7WA 4QYRA 9ATCB 2D9OA 3RZAA 2V4JA 3ZFVA 2A2CA 3GTYX 3PHTA 5B0AA 1JNRB 1VBKA 1JLQB 3EXYA 1WOOA 4C7QA 4DL3A 1QAIA 2J0SD 1BD6A 2ZD1A 3H2LA 2AEFA 4OX7A 3HK2A 3HHLC 1VYAA 2BKPA 3FMBA 1MU2A 1RWMB 1UZDA 1VRTA 2GO8A 2HMIB 1IKXB 3I56S 2CPEA 3BS9A 4NLTA 4OYZA 2RS2A 1R0AA 1NRKA 5T7LB 3GYXB 4W4MA 2W2MP 1KKHA 3M2UA 1HNVA 1X7VA 4CYUA 3HT3A 1B7YB 2AJ4A 3HVTB 3T1HF 3M8SA 1KS2A 1RADB 4DXLA 2GV1A 1SIWB 3UDVA 5DG7A 2UUCF 1CBKA 4N56A 3NP5A 1RBAA 2H5EA 5KFDA 3P96A 4F4XA 1RT7B 4OZ1A 2GMHA 3PM9A 3QRQA 3N28A 4B3TJ 2GZOA 2B0GA 2MYFA 2PSZA 1VLOA 4O23A 1RE1B 2VC1A 3AAWB 1NK5A 1SC6A 2ZH7A 4B9VA 3OD2A 1WACA 5LMUJ 1VQ6S 1JLAA 2RILA 3EDQB 2DNOA 2MTLA 5KFCA 1N5YA 4X2BA 3MR5A 1R89A 1NUEA 3ONQA 4GVBA 3MMJA 1TKXB 2JLGA 1UP1A 1NLKL 4WP8A 5LMNF 4DSEA 1XK8A 3L7OA 5DM6Q 2FGOA 2VQEF 5KG6A 3T3FA 1OJ4A 2D3OR 4ED5A 4WKRA 1KN6A 4FS1A 1GX6A 4OJ1A 4UQGA 1RISA 4B9TA 4IYQA 2DHSA 2XS5A 5CYQA 2MJNA 3DRSA 1RLDA 4LF1A 5KG3A 3NS7B 1FCAA 3E3XA 4CLUA 5IM0B 4L6V3 2UV8G 2N4CA 2MDAA 4DCPB 1YJUA 3KKFA 3JTNA 3QFHA 2J6SA 2C3YA 1VC0A 3CCES 5D4OA 1XNQF 3QRPA 2YNFB 2BABA 2LKZA 4MYUA 2YVSA 3CTRA 4ZVQB 3GLJA 1S99A 3H8YA 4B3TF 1HW9A 1UFKA 3FNNA 1PYTA 3LA0A 4HVZA 4ID5B 4ZPDA 1H2TZ 2Y0SD 2XM3A 2YKQA 1F3VA 4DL2A 5RUBA 4K5SA 4HH0A 1TL1A 2XYPB 3DOMA 2Q6CA 4FBTA 1IKYB 2IVYA 3A1YG 5ETLA 2YX1A 4DCOB 1GMWA 4DPWA 5C24B 4DV4F 4BDPA 4C98A 3G2XA 1MNEA 5FIIA 1R8PA 2DRBA 1YZ7A 3NY0A 1H74A 1YRUA 3TQEA 1OS5A 5D0HA 4ECWA 2YKOA 2WW8A 4HR2A 3DLEA 3RAXA 3BM7A 5KOXA 4A8FA 2JEJA 2YKPA 5BJRA 2V2KA 3GJSB 3MI7X 1H38A 2AGPA 1DBDA 2ILZA 1DTTB 1JK9B 1P9QC 2BQRA 5D78A 3H5UA 4KR0B 2VQFJ 2KT2A 3QIDA 4JUZA 1S79A 3AOAA 4OJGA 2UVWA 2HW3A 2KHCA 2J9CA 4KE5A 4EBCA 3UQSA 4DFJA 1IQZA 3I82A 3SCLE 1R0CB 1U1LA 2XY6A 5AJ3F 3J7ZT 3MEKA 2YWWA 4USUA 1UW9A 1HNWJ 4NLXA 2XZWA 3MOJB 3E51A 4N76A 3TAMA 2J7KA 4C4WA 3D3CJ 3FGVA 5J2QB 2UUTA 4C48A 5E3AA 2GHVC 4FF4A 2ZUAA 4PXCA 5F0WA 2QMWA 3UNGC 2UXCF 5K14A 2F3JA 4RNFA 3W5XA 2KB2A 3BH6B 3AD9C 5M2RA 2DXFA 3RJMB 4PABA 5H9FK 4L73A 2YTCA 3M2VB 3G9CA 1CSJA 1GK8A 3GR0A 3H98A 5IM0A 3PIOQ 1NKEA 4LRCA 3TWZA 3AB2B 5L1JA 4I2PB 1XIQA 2YXLA 1WF0A 2PN6A 2HFSA 3OR1A 5KFTA 4M63A 4ED3A 2WVEA 3V6HA 1SKWA 3DMJA 5CD4H 1CC8A 1DQ8A 5L8RC 3MPUB 1PILA 2XMUA 3IFEA 3NBPA 3HZEA 2K3KA 4LSNB 3I9V9 5B0FA 5M2UA 2NQPA 2KFYA 1S6PA 2CDQA 4DUYF 2VODA 1CVJA 4USVA 4CQ1A 4JYAJ 5IT9Y 1QD1A 3US5A 3G8QA 4X66F 2YY3A 5HLFB 5J2MA 3NGUA 2DCUB 1TV6A 1UEUA 3WX8A 3TO8A 1KQSR 1TVRB 3B6BA 4M5NA 2JLEA 4OHWA 5H9FJ 2Q66A 1G6BA 1Q82T 5KFBA 4HKQA 4Q5VA 1YJNS 2N4DA 4I1TA 3H2VE 1GTEA 1X4EA 1AW0A 3M2RA 4LRFA 1IQTA 1HBNB 2OHDA 2DNNA 2AZ1A 2Z2LA 1RAHB 2QIFA 4ES3A 3VTIA 2HHSA 2BW2A 1FJ7A 3NNCA 1U26A 3CD5A 1SKRA 4R5PA 2AHOB 2YKMA 1X31C 2MQLA 2UZAA 1YJ7A 1NMEB 2EXUA 4EYHB 3RB6A 1HWLA 3KJNB 7FDRA 3QATA 1SUQB 2I8EA 2DNQA 4XK8C 1LWCA 5T7LA 2N3OA 1RZMA 4G1PA 1RAGB 1YITS 4B9LA 2KU7A 4DV5F 2CQHA 3ZO7A 2HNYA 1F3FA 2V63A 4BCAA 2N82B 5DZ6A 2HIQA 2CVIA 3MAAA 2UP1A 2YKNB 3V6DA 3NAIA 4FBUA 1MN9A 2RMLA 1KSPA 1DLOA 1WC0A 2DYAA 2RKIA 1MWZA 4U9RA 4UT4A 4ZMMA 5J2PA 4B3SF 3JAMY 1FJGJ 2OIHA 3J7YI 3QIPB 2H5JB 2VD3A 1YRTA 3FQLA 4QWCA 2IDEA 1XWLA 2NXEA 3VR1A 3BR9A 1KVKA 1RWWB 2MZJA 3SZ2A 4S0MA 5IQQA 1PCAA 3CB4A 1LWEB 2Z8QA 2WSEC 1KHVA 2CYYA 1RCOB 2ZH4A 1CJVB 4I56A 1XNRJ 2RUGA 2I38A 4NCGB 3G71S 2YKAA 2QGFB 1WI6A 2E44A 4LRAA 2GAHC 5GADU 1YG0A 3KK2B 3ZTPA 1UWAA 1RT3A 2QA4S 1XMOF 3OLAA 3JSRA 2LU1A 2XC9A 3JSMB 2C3UA 1HQUB 4FYYB 1HWKA 2V0NA 2VKRA 4ID8A 1U6FA 3H2UB 3OR2B 2MGZB 3MUVP 3FSIA 1UEVA 2AGQA 2B8QA 3AQPA 3CDUA 1FWKA 2YPZA 2HURA 2NXNA 4RW8B 4W92B 1BQNB 2LXIA 2GIQA 2YKNA 1FWPA 4XTTA 2W8LA 3V6DB 2J6TA 1HBNA 1VRQC 4AT1B 3H5YA 3F56A 2BANB 2CQ2A 1KTQA 4FPIA 1BWVA 1RA7A 4IOBA 3SQOP 1R3NA 4KGMA 1G4CA 3QJPA 3R7NB 3DDNA 2QA1A 3O2IA 4X62J 1N4LA 1X4CA 2CJXB 4NXNJ 5KG1A 4RW4A 2PMWA 4ATNA 4DZDA 3GQCA 2HFVA 3H0PA 5F8HA 3MURP 1EHWA 1SQEA 4GO7X 4CO0A 2M5YA 4JB8B 4J5OA 4DV2J 2CPYA 1N6QB 3BGLA 4DL0C 1NJZA 1QSLA 3J81j 2XWYA 1RKIA 2IC3A 1FRLA 4OX9F 3NCPA 4DF4A 4FYVB 2HFUA 3Q0AA 1LXJA 3OW2R 2IPOB 3CCQS 2YNGA 1BXNA 5DQIA 4YR3A 4YB7A 3ZNUA 1CQNA 3K58A 2BKOA 3GMGA 3LOUA 2DR6A 1SPBP 3ILJA 4Z2XA 4DR3F 3DU5A 1FA0A 1H72C 3DRRA 2BACA 1TL7B 1H2VZ 3KLFB 2QV6A 2I0XA 2IMOA 2ZFHA 4IO1A 4J9PA 4CTAB 4N41A 1MU2B 3MFHA 2HIYA 1SVDA 2HGNA 2VG5A 5EHHA 2W9CB 3A3OB 2GIFA 5HN0A 2KT5A 2MLXA 2HRUA 2AT1B 4IFYB 2JVOA 3SYZA 1U49A 3TJ8A 3BKUA 3KMSA 5D4LA 3OLBA 2ZH8A 2VL1A 2HQCA 2MZRA 3T1YF 2DNPA 2VDHA 3EGZA 4G1QB 2W4DA 4HL9A 5HBMA 1NH8A 2HZCA 2AIRB 2ABYA 1CQMA 1D8YA 4Q44A 2DNKA 2FZGB 1N5SA 2PDAA 1VMBA 3MM6A 4H4OB 4LF6F 5JJBA 2OGUA 3KLVA 4DWIA 3AB4B 5CYMA 5A6PA 2ZBQA 2HBQB 1DARA 4P75A 1HR0J 1Q79A 3G4SS 1IBMF 4R8UA 1Q95G 2XMTA 5KG2A 3T19A 4CCHA 4TNOA 1HBOB 1AA1B 3Q8RB 2EVZA 2VH7A 1HFEL 3M7VA 4N5SA 3O3LA 3I55S 1M5SA 4NA1A 4U96A 1F5BA 2MKCA 1H0HB 2EK1A 3PYDA 5K5MA 4DPYA 4K59A 2A10A 2VPYB 3U27A 1SUQA 1UVMA 1I94F 2E1PA 4ID5A 2V9KA 3MECA 5DZ7A 4LQ3A 1IVZA 1RLCL 3DRRB 3W2VB 5AE1A 2HHHJ 4JI1F 2ZH6A 3R5DA 4AE5A 1FRIA 3IBWA 1HD1A 4CO1A 4M5HA 4ELTA 3NNHA 5IT4A 2PT0A 3QYYA 3LPYA 2NPFA 2DT9A 2AX1A 2EI5A 4WYWA 3RAQA 2AW0A 2AMCB 2E5IA 2OPQB 4WBFA 2HVIA 4OYWA 3CCTA 4CO3A 4YR0A 1M90T 2RRNA 5D4PA 3KYLA 2VG7A 1N52B 2CNNB 4FS2A 2DR5A 5GVQA 4P52A 1IM6A 3JTPA 1EKSA 1NSAA 1IBMJ 3RRKA 4KKOB 4DMZA 1IKWB 1HBUB 2DGQA 2BQUA 1NHKL 3I0RA 5L1LA 4IG3B 3MM7A 3WC0A 4EEYA 5HO4A 2LXUA 2IJRA 3PDNA 2VC0A 1IJFB 3PCOB 5KT4A 3D3BJ 3OFHA 3CJKA 1REGX 1QE1B 4HI2A 3W1YC 2CDRB 1UWBA 2IIHA 2K06A 4KT0C 3MMAA 3ZTSA 3L9ZA 2Z4PA 3LUYA 3T6BA 5HVGA 4ZVEA 4ZP6A 1NZ8A 3IGVA 2XSJA 4IOCQ 1ZETA 1FDNA 2R7QA 3GSDA 4M5IA 3D68A 2W2OP 2KXFA 3ILLA 3OHBA 1M1KT 3DRYA 3JTOA 2V50A 2E66A 4K4SA 4M5DA 1XR7A 4Y65A 2V8HA 1JNZB 1X4BA 4GRSA 4MYTA 4MIBA 3Q89A 5KAKA 5LSLA 4DR2J 2HMIA 1R0AB 2VPZB 4FXDA 1RAOA 2QT7A 1WG4A 3Q2SC 2JC0A 3FBEA 3AOCA 2ZZNA 4KJIA 3QLHA 4NI2A 3SCJE 2UUAF 3TAMB 5HQLA 4WP3A 4ZPWR 4C97A 6FDRA 5ETKA 2BANA 4ZIVA 4L75A 5F8IA 3SXLA 1RBLA 5L1KA 2JLFA 4DR4F 4RX6A 5KT2A 3UCUP 4B3MJ 2PEHA 2XNRA 2DHGA 4LRBA 2R9LA 2GGPB 1NJXA 4K4TA 2MMYA 2PO4A 5DQGA 1NH7A 2RDIA 3QT7A 4HTJA 4RW8A 4LF5J 1H6KX 1FERA 3BKFA 3PR5B 2C2MB 3CW2C 5D15A 1U2CA 4ECXA 1BY9A 2DCLA 1D9AA 2B9XA 1IWAA 2CG8A 3C14A 3ZZUA 2MY8A 5FJ4A 2B5JA 2BMBA 1JXEA 1X8DA 1F60B 3CJ4A 1SV5A 3IBCB 2DGOA 4JP8A 5F3TA 3UD5A 4C8LA 1HMVB 3NNAA 2EC2A 2C3MA 4JI3J 4HTIA 2ASYA 2FHJA 2QLBB 3C46A 3J7A1 4NYPA 4DUTA 3MEEB 4QJVA 2XWXA 4I6YA 4ZK7M 1YWXA 3C8YA 1HI0P 4AXIA 2EC0A 2QA2A 2BRKA 1U24A 1UMJA 2O5DA 5DLFA 1RTIA 4LF9J 4JI8J 2KT3A 4NZ7A 5LM7E 2GCFA 1HR0F 3GFXA 1FRMA 4KRWA 4MTPA 5C2CA 4ZLJA 5IV4A 4CRJA 1HI1A 3BGUA 3G6ES 1RQ0A 3IC1A 3SDEA 4DI6A 2X1FA 3KLGA 4F67A 2A18A 2J8SA 3IO1A 2ZUGA 3MDFA 3SIPB 5HVHA 1F9EB 1RHQB 3DLKA 2BBEA 5HJYA 4FVMA 3AA9A 4O3SA 1A9NB 3Q83A 3TVYA 1AYEA 1S9GB 1PKUA 4USMA 1N8RT 1TL3B 3IM8A 2MZSA 4AUKA 1O51A 4NMXA 4JI2F 5GMDA 1JLCA 5L9XA 3ETMA 1P1LA 1WC1A 4HACA 4CLYA 4LF4F 2D9PA 4NEYA 2QL5B 4JI1J 2D3UA 1U25A 5C42B 3ENQA 1URRA 3VVUA 3MGJA 3HF5A 4NPOA 4PCQA 2Z58B 1RWKB 5F9LA 5KFVA 3U1NA 2X3GA 2JEFA 4G3IA 2KG0A 1CULB 5CZVA 1R0BG 4X65J 2GVDA 3HPOA 4NLUA 4DBQA 1E6YA 2P5VA 2C3PA 3MCMA 2IVFB 2MQOA 4OFZA 4TU9A 3H25A 1L5UA 4C6AA 2RE1A 2AV5A 3P45B 1QDUB 1Z2ZA 4RW7B 1R8BA 3OL6A 2GFFA 3WDOA 4MKYA 1CJVA 4Y2AA 2R7XA 1Y3JA 2XI2A 1WELA 4X84A 4RU2A 3THTA 4H4KC 3ZTRA 1YX2A 1IKXA 2FLOA 1K1SA 4CDIA 1D9FA 3KHHA 5KOWA 1N5YB 5HMXA 1CS4B 4ED2A 2EEYA 1J2VA 1F5CA 1XMQJ 3CXCR 7AT1B 4Q8FA 1V6HA 4PG8A 5I3UA 1YDLA 2G0CA 5DM7Q 5IT9U 2RHQB 1D0EA 4V19X 1HYSB 3MEDB 3MMBB 2JL9A 4DL5A 4NEZA 4ZPTR
chains in the Genus database with same CATH topology
1VQNS 3LAMA 3OL7A 4PRFA 3THVA 4TN2A 1L3KA 1D3WA 4RW9B 2P9CA 1DQ9A 2ROPA 5KFNA 3QPIA 4MIAA 2O1PA 1HWIA 3V2UC 3V4IA 4KHRA 2HLTA 2QO3A 4RLEA 1FJGF 1AXQA 4O3OA 1T3OA 4ES1A 2FPHX 2ZKTA 1RYSA 4LFAF 2DNYA 3MM9A 4Q8EA 4RW7A 5KFYA 3RR8A 4IOAQ 4Y2KA 2PMHA 3VQTA 1U1PA 2IJNA 2DVIA 5GADI 1SL2A 2VG5B 1Q7LB 3L7PA 1YSJA 3KLFA 4K50A 3CF5Q 2BRLA 2YH0A 2M88A 4DV2F 2D1CA 4FF2A 1U4BA 3CULA 4DR1F 2C28A 4D3HA 1R8CA 1GX5A 1FJCA 2WHOA 2XB2D 2OD6A 4M1KA 2HPUA 3WBZA 1Y5IB 1VOMA 3MAHA 4IH6A 1R27B 2MZTA 1VQMS 4UY8T 3LP0B 1DTQA 1S1WB 3D1QA 2CZVC 1FRHA 5B09A 4ZPBA 1KD1T 2B6AB 1FXRA 1RTDA 4DN0A 3QAUA 1LFWA 3VQSA 4H54A 1ZAWA 2FLLA 2B3TB 1TFWA 2RRBA 3NWGA 1KVIA 1U45A 2CQBA 4OJ3A 1PC5A 4NXNF 4F26A 4OMFG 3MEEA 3W7BA 1U1KA 3OL8A 4NWBA 2NYIA 1ZBTA 4WCEQ 2LDIA 2X1BA 4LFBF 5KFSA 1C2PA 3CD7A 1RAJA 2H9ZA 3KG0A 2NLWA 2FD2A 1UL3A 3GE9A 4JI8F 2VASA 2IMWP 4FP9A 1HQUA 3LQVA 1FDAA 2EBGA 1I6JA 4USIA 4OI0A 3OR2A 4W90B 1SL0A 1RT2A 1RT1B 4NLQA 1HPZA 3KNAA 4EWTA 1PGZA 3LH2S 2V4JB 1X9MA 4I2QB 1PC4A 2DIUA 1RI7A 2E5JA 3KG1A 4N8OA 4OX6A 4CO5A 3CD6S 3K2YA 4KC5A 4C0HA 3OQ2A 2VOOA 4MFBB 3BO3A 2C42A 2KYZA 2W4PA 5E2QA 4FNHA 3M1VB 3V81A 4URGA 1U1QA 3H40A 2HFZA 2OTLS 3VAHA 1NJWA 1AROP 1OIAA 3W3SA 2RSQA 4LIRA 4RW4B 1T03B 1JLBA 1WTFA 1IM4A 1YJRA 3D5MA 3MMCA 2LQBA 4EU0A 3K0JA 4R5PB 4NCBA 2P6SA 3OPKA 4NRUA 4RWWA 5KG5A 3OBIA 2DGWA 4LUBA 1RT4A 2VBWA 2MKIA 4M5DB 3N6LA 3TUIC 2I5JB 1Q8LA 4JOUA 1VFJA 1IBLF 2DPIA 3SQGA 4HT5A 1S0NA 1QE1A 2HNYB 4QYZJ 2Q43A 4NYOA 2QFJA 3MMAB 3T9NA 2R2UA 4TYAA 3I87A 4K4WA 5F9NA 3NGKA 2V8DA 5G4DA 4C11A 4ILRA 3H4DA 3EGWB 3CJ0A 2WB1D 4RNNA 3KLEB 4RWXA 2OFHX 1UJ4A 2EPIA 1G1XA 2VKZG 4C8ZA 3O44A 3HKWA 4N47A 4ZOSA 2UU9F 2JH3A 2NSBA 2M4MA 1B7FA 5DJBA 3ISNC 3U7JA 2D74B 2DNHA 2A1BA 4C0BA 1WF1A 1SIZA 1HD0A 4CNYA 1KC8T 2VA2A 4QR2A 2J9EA 2O01C 2RF2B 5KTQA 1SJRA 2DB1A 3DLBA 5B0EA 3HLUA 2GO9A 2EG2A 3L3CA 3CPWR 3SCKE 2FGCA 4BS2A 3B8HA 4OIXA 4YR2A 1X4HA 4OJHA 1JLQA 4XDCA 1EETA 2YWKA 3R5AA 3M9MB 2HGMA 3VF0B 1TK0A 1S6OA 3O5TB 1YTYA 3HXMA 1FKAF 4DQSA 3FZ2A 1TAUA 1BLUA 2NZ4A 2KXHA 4IDKB 4LVOP 4WF9Q 1JMTA 3PEJA 2CQGA 4KHMA 5KT6A 3MECB 1VIXA 4DG1B 4WK1A 3PACA 1HW8A 1Z4UA 2PD1A 3CIZA 3PNIA 4Y00A 2WAQD 1Y9OA 2AWZA 1IN0A 1Q81T 2PE8A 1NKCA 4OI1A 2AYMA 4DFMA 4PUOB 3MD1A 3NRBA 4LT6A 1NAQA 1A6LA 2FJAB 4IG0B 4TY9A 3TNVA 3KLHB 4DV6F 2ASLA 2O67A 3HKZD 3PVXA 4ZP7A 5CXTA 2HYIB 1NK8A 3DLHA 5HQ8A 4I67A 2E5GA 1JKHA 1HQEA 3K8WA 1T05A 5BR8F 3X3UA 1R8AA 1SJ4P 2FVRA 3R3TA 4I4BA 1S1UA 1RTDB 4LF7F 3M2RB 4YMEA 4I2PA 1TZ0A 5I42A 3QJLA 2IA6A 3GIKA 5CCLA 1WHWA 2AJ1A 1E6YB 4H4MB 4URSA 3KK3A 2W24A 5HMYA 3KK1B 1ZYQA 1S0MA 3IR7B 2KDOA 3PY8A 4A8XA 1ZM3A 2HG4A 5LXRA 2HAIA 2ZM6F 2JJ4D 1HL6A 5L38A 3BGRB 3DDKA 3LP2A 4ED0A 3BSOA 3OSPA 2HS4A 1TKZA 4ERDA 3W2WA 2R7UA 4JBCA 2DHXA 4U6PA 4NLYA 5LXYA 3ZZOA 3CC4S 1Q53A 2FVQA 5KFUA 5BYSA 3HM9A 1NO8A 3I0SB 4PG6A 1M5OC 3G6XA 2EFVA 3CE8A 2VFUA 1U48A 1DTTA 1JKHB 2KJWA 5SUHA 3PFEA 5ITHA 2WOMA 2E7WA 3T5JA 2E1CA 1DAXA 4DS5A 1QTMA 4K4UA 5LJ3Y 1TP7A 4NZ6A 3CJ3A 3H4BA 2HWTA 3VAGA 5A8KA 1HBMA 4XAKA 5CCMA 2UVRA 5K8MA 3SQGB 3FJ2A 3M6UA 4NCGA 4DUZF 3AJ2A 3ZZ0A 3MM9B 4UQTA 4ZLPA 3OJUA 1T94A 3HP6A 1VQKS 3M2UB 1HNZF 2VZ9A 1HNWF 1K0TA 5DS7A 3VAJA 1V3RA 1RT4B 5A8WB 4DSIA 5KFFA 3KHGA 1BQXA 1JLGA 2M3DA 3C2PA 3DC2A 1TKTA 4WJBA 2R2RA 2BA9A 1X9SA 1XTZA 1WEZA 4PXEA 4MH8A 3RRHA 5EX3A 2HHHF 1FRXA 5J2QA 4A8QA 1K9MT 2CFXA 4F4WA 2ZC3A 2HHQA 3R27A 1RTJB 3N5FA 4DS4A 5AE2A 2VPWB 2COLA 2W9BA 1LW2B 3BN4A 2MQMA 2BE2B 2J7UA 3IS9A 2HNDA 1T02A 2G1DA 2AGOA 1BQMB 3N01A 1VQ5S 2HHUA 2FJEB 2MZQA 5C42A 2WOMB 4NOHA 4ED7A 3OJSA 3K8VA 3PW7A 4Q2MA 1SBRA 2BUNA 4MK8A 2F9DA 3PR4A 3BO4A 4AL5A 2IHR1 2BVZA 2RF2A 5CHCB 1WTBA 4C8MA 3KHRA 2RRAA 1SI9A 2CPHA 3UE2A 4WU2A 1P27B 4PG5A 3RAMA 2XBPA 2ZH1A 1UKUA 1GTHA 4F4ZA 2HFNA 2BOPA 3OTCA 1YGYA 3M8QA 4J9NA 1S97A 1XR5A 4DSJA 1TV6B 2M0GB 3CMAS 4ECTA 2LEAA 2YKMB 1IXKA 1VBZA 3OXGA 1VQ7S 4Q45A 1RJJA 2EFGA 2WBRA 4WU3A 5LT5A 4DF8A 4WTYA 3GR1A 4Q0BB 1Q7YT 1IBKF 4KSEB 5JXSA 4F3MA 3V81B 2E7XA 4DL4A 4Y2CA 4WXOA 2DISA 2XCPA 1WD6A 2W7OA 1YJTA 3MTKA 3D0IE 1JXLA 4H4KA 1K1QA 4I2QA 4B3MF 5GMKa 2YNHA 4F3OA 5MLCV 3QWPA 2MQQA 2I5JA 1HQEB 4YHHF 1JB0C 2WK4A 4I6WA 2BV3A 3K5NA 5KFPA 1RTIB 2LQ5A 5D3GA 3V4IB 2HVHA 4WYLA 1QSYA 2HHTA 2CQ3A 1DQAA 2ZD1B 4BWMA 1NK7A 2FVCA 3ZZTA 2Q79A 4ECUA 1NK4A 5I42B 2HQ3A 2UXBF 5U47A 4DV0F 1SV5B 1XBWA 2K2PA 2J0QD 3BQ0A 3E01A 3SFUA 2UXDF 1KQKA 1UJ5A 2WSCC 4JV2A 3HVTA 2HGLA 1KR4A 5K14B 3PKMA 4NL5A 5EWEA 1U1NA 3W2VA 2LLZA 3IWXA 4NRTA 3PX0A 3OFEA 4A8SA 1DURA 2F4VF 4NLVA 1N5TA 1C0UA 4FF3A 2M52A 4WIIA 4O3QA 2LCWA 2N3LA 2ZE2B 3IG1A 3MEGB 3FVYA 1MWYA 2J76E 2YNIB 3FEYB 3MM5A 2UUWA 3UI3A 5K8NA 3M05A 2GJIA 2DGTA 2BDPA 4HT7A 3ZZYA 2XLKA 5E3CA 2OD4A 2POKA 3OV7A 4J9SA