2FHOB

Nmr solution structure of the human spliceosomal protein complex p14-sf3b155
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
b'GRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords spliceosomal protein SF3b155
publication title NMR solution structure of the human spliceosomal protein complex p14-SF3b155
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhoB01
3CC7S 2DNGA 2DNNA 3NNCA 2AYGA 3U1LA 3CULA 2D3OR 1M5OC 3UD4P 2HGNA 4OZ0A 3CCLS 2FC8A 2JVOA 3VAJA 1WWHA 2CQ2A 2MQNA 3MD1A 4W92B 2HGMA 3UE2A 3G8TA 2BOPA 3CCMS 2RRBA 2YWKA 1N8RT 2MYFA 5JVHQ 2JWNA 2DGXA 2DGSA 1VC5A 2AYBA 2LXIA 4YB1P 1KC8T 2HYIB 1W2BR 1H2VZ 2ADBA 2U1AA 1KQSR 1M5VC 3TYTA 1DRZA 2MZQA 4YUDA 3CCSS 2RUGA 4Y00A 1VQ5S 3P3DA 1U1OA 2YTCA 4PKDB 1A7GE 1XN9A 2I2YA 2DO4A 5DETA 2A3JA 2KVIA 1U6BA 5DDRC 1S79A 3NS5A 1M5KC 2MMYA 2LQ5A 3NNAA 1VQ9S 2CQ1A 2LEAA 3MURP 3CCUS 1SJQA 3THTA 2U2FA 2X1FA 3I55S 2DHXA 5HO4A 1U1NA 1FJEB 2GHPA 3CF5Q 1O0PA 4C4WA 2DGQA 4F26A 5GMKa 1WEZA 2DGTA 2DNYA 5H1SV 2RRAA 1N52B 2AYMA 1X5OA 2MKSA 4FXWA 1X4FA 4CQ1A 5CXTA 1ZZFA 1FT8A 1X0FA 2CPHA 1D9AA 5IM0B 3EGZA 2M9KA 2OTJS 4WFNQ 2DGVA 2KI2A 3PIPQ 3BO2A 3G4SS 2V94A 2Q79A 2OIHA 2XNRA 1RK8A 2DITA 3SMZA 4M5DB 4IOAQ 2FPHX 3CUNA 2FC9A 2MZTA 4U67Q 1OWXA 2CQHA 2DO0A 1X5TA 5IM0A 3NMRA 4UY8T 2G0CA 2DNZA 1HD0A 4LJMA 2LYVA 2MQOA 1WI8A 1ZH5A 2NZ4A 2PE8A 1YITS 2RNEA 2CQDA 2DB1A 1AUDA 2VONA 4C0OC 2DNOA 2DGOA 2KRBA 2MZJA 4LIRA 1DBDA 2DGWA 2N3OA 1OO0B 2M52A 1VQ4S 2VOPA 3BO3A 5GADU 2DNLA 3NNHA 3EGNA 3R27A 1F9FA 2HGLA 1NO8A 1WG4A 2DNPA 4QQBA 2DNMA 4UQTA 1Q82T 3ZZYA 3CCES 1P1TA 1WELA 2MGZA 2MQMA 1VQOS 3S7RA 3J7ZT 2E44A 1WHXA 1PGZA 3CPWR 1QVGR 2KXHA 3US5A 5D77A 2ZJQQ 3CCRS 4W90B 2KFYA 2M0GB 5DDQC 1WEXA 4WIIA 2ZJRQ 1WG5A 3D2WA 4YOEA 5IFMA 3THPA 2PEHA 2DGUA 3RW7A 1WF2A 2RS2A 4A8XA 1KOHA 2GO9A 3S01A 2O3DA 2MKIA 4QU6A 2MQPA 1YI2S 2KN4A 1WF1A 2KM8B 3L3CA 3Q2SC 3CCJS 2CPDA 2LCWA 2DHSA 3VAKA 5CYJA 3V4MA 2ZJPQ 1WHVA 3H2VE 3MI7X 2QEXS 5DM6Q 4ZKAA 2CQ3A 5LSLA 3CMES 2LKZA 2X1AA 1YTYA 2M70A 2YH0A 3HI9A 3S6EA 4IOCQ 2DHGA 2OSRA 4C7QA 2L41A 1K9MT 2J0SD 2RT3A 3CCVS 2L08A 3P49B 2LA4A 1DHMA 3IWNC 3UCGA 4QPTA 1VQKS 2XB2D 2JVRA 2N7CA 1KOOA 3G71S 2N3LA 2E5HA 1ZZNA 2XS7A 3VALA 2EK1A 3VAIA 2LEBA 2DH7A 1YWXA 5LJ3Y 4IUFA 1BY9A 4TU8A 3CXCR 1M1KT 2M88A 2OJ3A 1X4BA 2MY8A 1K73T 1Q7YT 2CPJA 2CQ4A 1CVJA 5LJ5Y 4J5OA 1WF0A 3IRWP 4Z2XA 2MZSA 2CQGA 2YH1A 1U1PA 2DHAA 1L3KA 2QA4S 2KM8C 1X4CA 2G1DA 2AYEA 2J8AA 2MY7A 1S72S 1JJ4A 2JX2A 1X4GA 2CQIA 2K3KA 2G4BA 2DH8A 2UP1A 1OPIA 1YHQS 4Y0FA 4FXVA 2KG0A 1SJRA 2CQBA 2MQLA 1R8HA 2WBRA 1WHYA 3B4DA 1OIAA 2QFJA 1U1MA 3MD3A 2KH9A 3BEGB 3U1MA 2M4MA 1VC6A 4TU7A 3MUTP 3Q2TC 4WFBQ 4V19X 3CTRA 2KRRA 1K8AT 2M8DB 1VQPS 1FNXH 2K8GA 4CH1A 1H2UX 2MZRA 4WFAQ 1WHWA 2MZ1A 2AD9A 1H2TZ 5DM7Q 5GAHU 2CQPA 2VODA 3FEXB 2J0QD 2KXFA 2DIUA 4PR6A 2MB0B 1NU4A 3LQVA 3MUMP 2KG1A 1JJHA 1VQ7S 1VQ8S 2CPXA 1YJWS 3P5TL 1VQ6S 2DH9A 3MOJB 2DNHA 2F3JA 1SJ3P 2RS8A 2DNRA 1URNA 2MXYA 1HA1A 1X4AA 2MKHA 3BS9A 1YIJS 2HVZA 3VAMA 2BZ2A 2D9OA 2CPZA 4BS2A 2YKAA 2FY1A 3FEYB 5JVGQ 3OW2R 2J76E 5DDPC 2M8HA 2EVZA 1KD1T 1M90T 2EK6A 5LXYA 4F02A 2E5GA 1N54B 1IQTA 3MXHP 2MQQA 3I56S 3G8SA 3CMAS 4IO9Q 3G6ES 1VQNS 3HHNB 2VOOA 1R8PA 2OSQA 3DXBA 4CIOA 2OTLS 2B0GA 3CCQS 2CQCA 3TP2A 3DLLQ 3TO8A 2RQCA 2CPEA 1VBXA 2HZCA 1QM9A 5GVQA 1Q86T 4ED5A 1U1QA 3CC2S 3H2UB 1B7FA 1SXLA 1JMTA 3PIOQ 3SDEB 4P6QA 5FJ4A 3G96A 2M7SA 2JRSA 1X4HA 2DIVA 2KT5A 2RQ4A 2MKKA 3K0JA 3J7YU 1FXLA 2LA6A 2FHOB 2D9PA 5LSOA 3SXLA 4LMZA 1HD1A 1M5PC 1SJ4P 2F9DA 3R1LA 1UFWA 2MKJA 2F9JA 1UW4A 3VAFA 5LXRA 5DDOC 2M2BA 3SDEA 4ERDA 2XSFA 1P27B 3R1HA 5IQQA 1YJ9S 3VAGA 1A9NB 1FJCA 2MKCA 2X1BA 2MJNA 3UCZP 2XS2A 1WG1A 4WKRA 2RU3A 1VQMS 5GAEU 2DISA 1U6FA 3ULHA 5MLCV 2CPYA 1D8ZA 2MJUA 4TU9A 1NJIT 1VBZA 3B4MA 4F25A 1X4EA 2DNQA 2CJKA 4TLQA 3VAHA 1U2FA 5D78A 2ERRA 2DNKA 1X4DA 2SXLA 3MDFA 5HL7Q 3CD6S 2L9WA 2I38A 1WTBA 3S8SA 3CC4S 3UCUP 3NS6A 1U1LA 5CA5A 2MHNA 1Q81T 2KXNB 1UP1A 3P6YC 2XNQA 1U1KA 2KU7A 2RVJA 1WI6A 2NLWA 2CPIA 2LXUA 4CH0S 1PO6A 2MSTA 2MSSA 2X1GA 1FJ7A 4RU2A 1G2EA 1X5PA 5BJRA 3JB9k 4WF9Q 2MGZB 2E5JA 1VQLS 1N88A 4WCEQ 1FO1A 1H6KX 3LPYA 1YJNS 1UAWA 3BO4A 1FHTA 3MUVP 3RW6A 1DZ5A 5EN1A 2LMIA 5ITHA 1U1RA 2E5IA 3EX7B 2CPFA 1VBYA 2MPUA 3UWTA 2XS5A 2KYXA 2ADCA 3N9UC 3VF0B 3ZZZA 1WEYA 4EGLA 2CQ0A 1RKJA 1QVFR 3G9CA 2KHCA 5GAGU 4OZ1A 1HL6A 1X5SA 3UD3P 2DK2A 2N82B 4QU7A 1SJFA 2LECA 1VC0A 1JJ2R 4PRFA
chains in the Genus database with same CATH superfamily
3NNCA 1BHNA 4DQSA 4N5SA 1NJXA 4OZ0A 1V5VA 4C98A 3V2UC 2G9OA 1UWBA 2AP6A 3G8TA 1IKXA 1FRHA 3EDQB 1JXEA 2DGXA 4P10A 1RABB 2LXIA 3I0RA 3MEDB 2E1PA 1VCTA 2CJ9A 2B9XA 1RTDB 3T9ZA 2O67A 5I3PA 3KG1A 4USUA 2YVSA 3WBZA 1AB8A 3BREA 4JV1A 1FFGB 1EKRA 3FCWA 3M4XA 2UUBF 4YR0A 3THTA 4MKAA 4YS2A 1HR0F 2IRYA 4NLVA 4ES2A 2H54B 4YB5A 3J7A1 5EX3A 2PT0A 4P2MA 1FKAF 4W4MA 3BH7B 4MIBA 4JUZA 4AXJA 1N52B 5AE1A 2VQFJ 1X5OA 4JB8B 2KKHA 3WZ0A 1D9AA 4OJ1A 3H40A 4A47A 4DV2F 1D1UA 2M9KA 3R2CJ 3KK3A 3GIMA 2MZTA 5C25A 2VHGA 1S99A 2GNKA 3N01A 4ZN1A 4X62F 3JQJA 2A2CA 2FD2A 2YX7A 2CQDA 2DB1A 1RTIA 5A8WB 1AUDA 4KTQA 5H9FJ 4K0KJ 2DNLA 2H4WB 5LMNJ 1F9FA 1TU0B 4K4XA 4OHWA 3TR5A 4CO5A 2BX6A 1RT5B 3CSKA 1E6YB 1ZAVA 4MYTA 3I5CA 3CJKA 5HLFA 1FD2A 2FGCA 3Q0AA 3IGNA 1WG5A 5AE2A 2HBZB 5D6GA 4Y3CA 4IFVA 3IC1A 4D3GA 3GCXP 2PEHA 1BQNB 3T5LA 1GMWA 2QLXA 2FHMA 4UY85 1YJRA 2F4FA 1UFLA 4DQIA 1Z4UA 2BE2B 3PFEA 2HURA 3ZZPA 2AJ1A 4L74A 2IRUA 4IOCQ 3K2YA 2Z30B 2L41A 3TA1A 1TFWA 1RHRB 3IAS9 4NLUA 4L75A 1N33F 3OUYB 3PACA 4CLKA 1U8SA 1URRA 3FEZA 3OHAA 3O3LA 3F56A 2YX4A 1NRKA 4LF4F 4JV5F 2Q3PA 1RYSA 1Q7YT 1TAUA 2DBBA 3JSMB 1GT8A 4DFJA 6FDRA 3PW4A 1SKUB 2IC3A 2J8AA 1RWOB 2H5JB 2N4DA 4PUOA 2V8VA 2H9ZA 1YHQS 1FNOA 2BKPA 4X2BA 1OPZA 3NAIA 2UUCF 1KLMB 1O6XA 3QFHA 4DL0C 3MAQA 3R5CA 3ELHA 4UW2A 1HI8A 3TA0A 3SQGB 3KDOA 3B82A 3EZOA 1NU4A 4K4UA 1VQ6S 2LQBA 2YKMB 2DNHA 2H65B 3ZZRA 1V6HA 2FHJA 1HA1A 4F4ZA 3IM9A 1YIJS 1LW2B 1CS4B 3FFIB 4LF8F 2GMLA 2M8HA 2NCKL 1M90T 3KK1A 5LXYA 1UFKA 2B4UA 5KFIA 1HHSA 2ZKUA 4BBYA 2NXEA 2NXUA 2MTLA 1B0PA 5DS7A 4WTOB 4M5IA 3FDSA 4LF9J 3QGGA 2IM1A 1U1QA 3CC2S 3AH6A 3CWJA 4E2FB 4NZ6A 5FJ4A 3U27A 4LSNA 3I9ZA 5KFTA 1JLBB 2F9JA 3HM9A 4OI6A 4DX8H 1XERA 1RE1B 1VHFA 4OX9J 4I2PA 3D68A 4DU7A 1TV6A 1LWFA 1C0TA 2ATCB 2XQCA 1TELA 3QO9A 1JLAA 2IJNA 1TK0A 5E3QA 2J9CA 3CE8A 1U0HA 3H2LA 4LBPA 3KUEA 2DJWA 2SXLA 3KUHA 1HW9A 3HX9A 2I38A 1NAQA 3DRRA 2I8EA 3M8QB 4P9SA 1I6JA 1U1KA 3W60A 1IM4A 3OR2B 2R2TA 2RD5C 1H98A 4ILMA 1FNMA 3LTOA 1NK5A 2X51A 5KG5A 2GVDA 1IJEB 2ZUAA 3CCWA 3BO4A 1TKDA 3T1HJ 4FBTA 3W9JA 2E5IA 3C2PA 1VIOA 3FKBA 1UWBB 3N9UC 3GG0A 1N48A 1IKXB 1FTRA 2PO4A 1NH8A 2XG8A 4PWDA 1I94F 3F73A 2AYGA 1Q8KA 4B3SJ 2ZH4A 2AX0A 2FIUA 3GV5B 3MCNA 1RHMB 3I0RB 2JVOA 3QMQA 2G0IA 4ZVFA 2B4VA 1OQ6A 3CJ2A 3AOCA 2U1AA 5C2GA 1C0UA 2W7PA 1SQGA 2XWYA 1U1OA 2CFXA 4YHHF 4IRKA 3NS5A 1EARA 3SCLE 3CJSA 1Q95G 1NDPA 2W24A 3EVOA 5IV3A 3KK3B 3ZNJ1 5C25B 4KFBA 3BO2A 2V94A 3PKYA 4FF2A 2AGOA 2FPHX 3ICLA 1RTIB 1QY7A 1NPKA 1Z2ZA 3H0PA 3O5TB 2HNDA 1OWXA 1LW0A 3PFOA 2CNKB 2LQ9A 4DLEA 3BN4A 3BDPA 4DFKA 2E1CA 3VWSA 4C0OC 2UUBJ 1DBDA 2BUNA 1RWNB 3CJKB 2PFDA 5HLFB 4UQTA 3V6DA 3ZZYA 3LALA 2PEBA 4C97A 3P8BB 3HFKA 3MM7A 2E44A 4PZVA 1QVGR 3US5A 3W7BA 4CRJA 3LA0A 4DV2J 3I4PA 1D9FA 3KHRA 3M2UA 1CEZA 3QFWA 4A8XA 4DSKA 3EUNA 3GYXB 1B4SA 2CDQA 4X62J 3GYNA 1RHJB 2KN4A 1WF1A 3H5XA 4DR2F 4U8YA 1SIZA 2QEXS 3RJMB 1EP4B 1IKVB 9RUBA 4DQQA 5GMEA 5F3TA 4XO0A 5B7WA 2MLZA 5HMWA 1J2VA 1FE0A 4USIA 4G6VB 4ZPBA 2IC3B 1NCLA 2FJVA 4PUOB 3WHIA 1LXJA 1R8BA 4WFYA 2HIQA 4J9OA 3MPDA 2V0NA 4NLXA 1F2HA 2QT7A 3AB2B 1OY6A 3BSAA 2FJDB 3KJVA 3B4DA 1LWEA 3RAQA 4GC7A 5F8HA 1VQPS 4QWBA 3CD5A 1HNVA 4PCQA 3PO4A 3HO1A 2PGCA 2RF2A 4PQUB 3LQVA 3MUMP 1JJHA 2VFVA 5F8IA 2F3JA 1URNA 5DG7A 3IA0A 2RJZA 3KK1B 2V34A 3WDOA 1SIWB 4N77A 3TANA 5A0YA 3CDUA 1EKSA 1T03A 3BJYA 2J6SA 2V4QA 1N54B 2HHXA 1PYSB 3DXBA 3M6XA 4KR0B 2YNGA 4LSNB 2OTLS 1P9YA 3I87A 3IBCB 3H8YA 1Q86T 4UF4A 3MEKA 3HKZD 2JRSA 3D67A 2RQ4A 1WC0A 3G6XA 3J7YU 2FHOB 2HIYA 3EE3A 3L7UA 4DLGA 2C3PA 2MQ8A 3GU0A 4I2PB 1ZS6A 1TV6B 1C0TB 3HVAA 3QO9B 3MM9A 1JLAB 3VVUA 1AA1B 4A46A 1FJCA 3PNIA 4F0HA 1U0HB 3LANA 4JI0F 3IM8A 4YN3B 2N4CA 5E0OA 5G4DA 2CPYA 3DRRB 2HHSA 4IQXA 4EK2A 2P6TA 2YPZA 2DNKA 3ONQA 4CM2A 1IBMJ 3LGHA 1R8AA 3MDFA 4LF7F 2HWIA 3MPYA 5D8HB 1PO6A 2MSTA 3BGRA 1D3WA 2FYXA 2KB2A 3A8JA 2NREA 2JEIA 1H6KX 1UVMA 1OY8A 3G6VA 3R6GB 4PWDB 3LW5C 4X4UA 4NYPA 5KFHA 3PM9A 3JYTA 1B70B 4WIQA 2ADCA 3G9CA 4H4OA 3KLFA 4R0EA 3JTOA 3CO9A 1AT1B 1IR2A 5KG0A 4F4AA 1C2PA 3I0SA 2WZ1A 4KQZA 2FLPA 4KYZA 2FC8A 1RLDA 2JH3A 2XHCA 1MU2A 2UUAF 1C0UB 2VC1A 3KFWX 1TL7A 2XMAA 1N8RT 2DGSA 3DOKA 5HJYA 4YB1P 4JI4J 2HYIB 3L09A 1KQSR 2HHVA 1CPZA 5B0EA 3BKFA 1VQ5S 5BR8F 3NNAA 3HDSA 3CT9A 2LEPA 3G86A 2Z57B 4WU3A 2U2FA 3I55S 2CJBA 4J9VA 1WC5A 1YKWA 1I94J 4F26A 1IN0A 4KFBB 2ABYA 4X4RA 1RAOA 2X3GA 2DGTA 2E1AA 2C1EB 5H1SV 1X4FA 2HNDB 2BXJA 4U96A 4CQ1A 1FT8A 1X0FA 2CPHA 1VDHA 1L5UA 1LKZA 3EGZA 2X3DA 2KI2A 4CLSA 5IC6B 5ETRA 2AEJA 3ZZTA 3J81j 4WPAA 2XMMA 4QIWD 2YQ0A 3T5HA 4YHHJ 4USKA 2B9WA 5HQMA 2Q1LA 3OXLA 3D4JA 3V6DB 3A3PB 3HSJA 4K4SA 1FRLA 2VONA 1RTHA 3IBFB 1IVZA 3MM7B 1OO0B 4ZDNA 3ZTQA 3BO3A 2C2RA 4OYXA 3AXMA 4DX5A 2M5YA 4ZLPA 2FTRA 3M2UB 5HSPA 3KLGA 1WOSA 3GIRA 2AEFA 3BQ0A 3F41A 3C6UA 4KGMA 4E98A 3D2WA 3I96A 4FF1A 2WK4A 4YOEA 2IM3A 4ZPAA 3LPEA 4WFZA 3K8WA 2GO9A 2HVHA 4CNZA 3PW5A 5CCLA 2HEKA 5K9FA 2RQKA 3BSOA 3VAKA 3C6TA 3H2VE 2V2KA 5J2QA 4CI0B 4ZKAA 4M5KA 2NYIA 4PPZA 4IRDA 2VBXA 3EPIA 4I56A 2VBZA 3NS7B 3IWLA 5KG6A 2DRDA 3DU5A 5L1KA 4IUFA 3OHBA 3RR8A 3KJVB 2BRLA 4ECVA 1LWEB 2QSWA 4XTTA 2B7CB 1LV5A 4KJIA 4KV8A 2G4BA 2UP1A 1OPIA 1Y10A 4FXVA 1UJ4A 4A4JA 1HNVB 1R8HA 4DR2J 1DLOA 2RF2B 1NLKL 5FDLA 2M8DB 5T14A 2XZTB 1IKWA 4B9SA 1H2TZ 5CYMA 5GAHU 2CQPA 2UVUA 2VODA 3VZHA 2Y8WA 2V9KA 1TZ0A 2MB0B 2R8IA 4B3MF 4DN9A 5A0YB 2XSJA 1T9YA 2R8JA 4IQMA 2DNRA 3TX0A 4EO8A 1T03B 1RSCA 4EEYA 3NXZA 4ILRA 2FY1A 4QR0A 2KJVA 2YNGB 2W2NP 2EVZA 2W2QP 2EK6A 4LRFA 4EBEA 4X4PA 2FLLA 3KTQA 2GMJA 4CIOA 3CJ8A 3SYZA 1RHQB 4B3OA 3W5YA 1VK3A 3H2UB 4XPEA 4R25A 2E9TA 4DCJB 3VQTA 2MKKA 1QUVA 3MM9B 5AXNA 2D41A 1VGYA 4DOZA 1KNZA 3BKTA 4WK3A 3TUPA 4RUHA 1S6PA 5D4OA 1F1BB 4MIWA 4UT4A 4A8QA 1A9NB 2UZAA 3BGFA 5HMYA 5GAEU 2D3O1 2KZMA 2FJXA 3CJQA 3HFZB 3MCOA 3O8WA 3ZTOA 5DGAA 2MJUA 5KFAA 1FKPA 4NYZA 4CLFA 3KXDA 5CYQA 3JS9A 2CJKA 4DSIA 3DKDA 4I69A 3BGRB 2JL9A 2GFFA 3S8SA 2CZ4A 4OI2A 4HDHA 1Q81T 2IY5B 2OAUA 3L7PA 2AV5A 2B5JA 4CO2A 3JYTB 2MKYA 3KLFB 2ZH5A 1FDDA 1NDCA 3EPGA 1S4FA 4K4ZA 3I0SB 4WP9A 2ZH3A 3W2WA 1L3TA 4JI0J 3KJNB 2V5HG 2XMVA 4ZP7A 1QVFR 1MU2B 1UVLA 1TL7B 3VGUA 4PRFA 2XMJA 4CLYA 2EG2A 2AMCB 4C48A 5F8MA 3DOKB 3BGUA 4RNOA 1R6YA 3HZGA 3BPDA 4B3TF 2A18A 5DZ6A 2EFVA 4LF7J 1TKXA 1JNZB 2IVMA 3RRKA 3TJAA 2HRYA 4WZMA 4OZ2A 1FX4A 2HS0A 4JI7J 4NMLA 3VQSA 1M5VC 3G6YA 4YUDA 2HFUA 1U26A 3BQ1A 2WBMA 2VL1A 4DV4F 3UFCX 2LEAA 1BGXT 3MM8A 5E3CA 5M2PA 3TVKA 1ZOTA 3C46A 5K14A 2UUAJ 4J9KA 5CXTA 1MNEA 4DZ6A 4QWAA 2QIFA 1W26A 2DGVA 2C2KB 4KY3A 2OD6A 3K5OA 1FDBA 2AJQA 2FC9A 4AYBD 1RTHB 3FSIA 4ANEA 3EGWB 1HD0A 2RILA 2VPWB 3IXQA 4KH1B 2GAGC 3DHWC 2DGOA 4JI5F 1JB0C 2VOPA 4RLEA 3KLGB 2CJYB 2J5AA 1P1TA 4F3OA 2HQCA 3C6UB 2VJUA 5KFQA 2CWKA 4ECYA 2CVIA 2HHWA 4DSFA 2KXHA 4ELVA 2WSFC 1L3VA 2CZ9A 5ETVA 3LAMA 2EW9A 1MN9A 3B6BA 1O5JA 2HW3A 5J2QB 3D5MA 4NYOA 1WF2A 1C4AA 1XWLA 1G4CA 2GO8A 2DPJA 1TMJA 4N47A 1WORA 2ZHOA 2MQPA 1LFPA 2K1RA 3V4MA 3Q8VA 3MR7A 1Q5VA 4ZIVA 1EETA 3JTNA 2ZH1A 5AT1B 2VBWA 3QZ7A 3CCVS 3DDIA 2G1HA 2EFNA 2LQJA 3BDEA 1U2CA 2ZZTA 4ILLA 3ZC4A 4FNIA 3C14A 3W65A 4C8MA 3DLKA 3W66A 1X8DA 4CLLA 5LJ3Y 4KV8B 4CTAA 3JQKA 3LP1A 2C2EA 5HK4A 1F3FA 4J9SA 1AXQA 4Z2XA 1DLOB 2MZSA 1L3KA 5FDLB 1LWCA 4B9TA 2COLA 4UUXA 5C42A 5CYMB 3ILIA 1TKZA 1UW9A 3MD3A 5KFZA 1PC4A 3MTJA 4AT1B 6AT1B 1LXNA 3O44A 1EQMA 2DVIA 5IQ6A 1H2UX 3GQCA 4DS4A 1SC1B 4ANCA 4JI3F 4USVA 5FIIA 4FVCA 4FYYB 3QATA 3DDKA 1TL4A 3HD2A 2ACMA 1HBUA 3MM6A 3EVWA 3K5NA 4B3OB 4C0HA 3OW2R 3ISND 1NK9A 2XYPB 1P9QC 2A10A 3LWLA 3JQMA 1IBCB 4I4BA 1JXLA 3JSRA 3TO8A 3A13A 5HVGA 3MTKA 4QR1A 4U7UD 4DR1F 4RWXA 2DR6A 4B9MA 3MCMA 1S6PB 3U7JA 4B3MJ 1NKCA 4BC7A 2GJIA 5E3RA 5DLFA 3AAWB 4LMZA 3RZAA 1UW4A 5HATA 2HFSA 1FI4A 4CLWA 3K5LA 3NGUA 3V5RA 1JKHA 4DL2A 1SPBP 5CYQB 3PTWA 2JEFA 2YKQA 4LBHA 4QPXA 2BJDA 4MKYA 4Y2KA 1D8ZA 2AF6A 2XEXA 3NWGA 2B5JB 2DNQA 2EFGA 3AHPA 4GMKA 2L9WA 1U1LA 3HJVA 4TNOA 2QYCA 1FEHA 5I3UA 2FJEB 2HQIA 3B54A 3NWRA 4KBIA 3PR4A 3QSYB 3UD5A 4CO1A 3HT0A 3W2WB 1VQLS 1TL1A 3X3UA 5C5JA 5EN1A 4M5MA 2NUUG 3UR3C 2LDIA 1K0VA 3C16B 1K1SA 1TKXB 1T3OA 1ZM9A 5F0UA 2UU9J 1Q5YA 3CC7S 4N8NA 2IYGA 4YB6A 2B51A 2CQ2A 4EMDA 3MD1A 1QAXA 1F9HA 3W8PA 1YZ7A 1VHIA 4DS5A 3IN5A 3J80Y 1C1BA 2FUG9 5GAGI 3KMSA 2RUGA 3P3DA 4WP3A 1WC6A 4FN5A 3MM8B 1S79A 5LMUF 3PYGA 2HNYA 1NNDA 2BM1A 3QNWB 3CCZA 3HHKA 1C4CA 1X9MA 4QIVA 1MG7A 2G2OA 4C0BA 4F4KA 4KH0B 3TX8A 3M32B 4HEA9 4B3TJ 4FXWA 1ZZFA 4OYAA 1GX6A 2XO6A 1FKOA 1RK8A 1RWWB 1AFIA 4Y65A 1HMVA 3GB0A 4UY8T 2GGPA 4ZVPB 4ZVOB 4CO4A 4LJMA 5ETNA 4TXSA 2E9ZA 3OVSA 1FFWB 4JP8A 4DV4J 3N6MA 2N3OA 3HJFA 4CT8A 4AXIA 1QSLA 1RT6A 4A8MP 1N5YA 1WELA 2MGZA 4ZVEA 3QBCA 2ZUGA 1FRIA 1WHXA 3FVYA 1PYOB 2ZJQQ 2FZGB 2FLOA 1ZM4A 2OPRA 2K1RB 1HWLA 3I32A 2KFNA 1B64A 5IT9U 1O51A 2VA2A 1EETB 2R3VA 1HW8A 4JI1J 2CPDA 2Z4PA 4AUKA 1WC4A 2WCXA 4A48A 2LKZA 1YTYA 4JI5J 2DHGA 3AD7C 4RW7A 3C14B 3ILLA 3DLKB 2RT3A 2LA4A 3TA2A 1S77D 3LP1B 4FZVA 5IT0A 2I9SA 2JVRA 4Y28C 2N3LA 2EK1A 1S9FA 3IRXA 3FMBA 4QZVB 3CXCR 1HIYA 1BUXA 5C42B 4KHPJ 1TKZB 2DR5A 3G87A 2HLUA 2F5GA 2KG0A 3J7YI 1FFSB 1SJRA 1FDNA 5F8GA 3ITHA 4WYWA 4Y2AA 4B9UA 1Y0HA 2K8GA 3QQCD 2ZBIA 1WHWA 3SQOP 3B78A 1KTQA 2HVIA 4LFBJ 1S6OA 1FE4A 5KFYA 4I68A 1HBUB 2XLJA 1S6UA 2CZVC 3MM6B 1IR0A 4FS2A 2EEYA 2MKHA 2XWXA 2ZE2A 4ZPWR 4KIAA 4PXEA 4E0DA 4AQYJ 2J9DE 3BF4A 2C28A 2KZZA 4OYWA 2J76E 5DDPC 4QWCA 2HQDA 4N76A 4J7CA 3AODA 1Q8LA 3HF5A 2PA3A 1MMDA 3CCQS 1EJ7L 3TP2A 2RH3A 1VBXA 2CADA 4NWBA 1YBTA 2VC0A 1UVKA 4WE1A 1JMTA 3BQ2A 5IWAF 2FJAB 2CUYA 2KT5A 2VG6A 1PBUA 1JKHB 5FLXY 4WKYA 4DV7F 4DV0F 2KHDA 4BWJA 2FJWA 1RBAA 1VIXA 4L72B 5IV4A 4UOGA 1YX2A 2NXNA 3M1VA 2VDHA 3EJMA 3NY0A 5KFNA 3MPWA 1VFJA 3E2EA 4NE9C 3PRVA 3HHLD 2IPOB 1GMVA 4UOCA 1DQ8A 5I3UB 2PMWA 4LF1A 4DR1J 1CG2A 2HFZA 4IYQA 5ETLA 3AOBA 5C24A 5BYSA 2IA6A 1TL1B 4LSZB 4TYBA 2OELA 4LF5F 4J37A 2VKRA 1X5PA 2C3YA 1Y4ZB 1DZ5A 2ZH7A 4Q0BA 2CPFA 4FYVB 2I1RA 2XMWA 1MSWD 1RDRA 1C1BB 2R7TA 2A1BA 1VQYA 3W61A 2RKIB 4UOHA 2E5LF 5D0GA 2Y3YA 4XIUA 1CBKA 1GFWB 1IBLF 2Z2LA 4X65F 1NZAA 2HVEA 1QSYA 2POKA 5JVHQ 4USWA 1HBMA 3THVA 2HNYB 1KC8T 1HYSA 1H2VZ 4J9MA 4DL7A 4ZVRB 3GFZA 3GJRB 4PKDB 1UEVA 4OYIA 5KFEA 3OXFA 1FK9B 1U6BA 1KBRA 2OFHX 1NSQA 3CCUS 3RAXA 4I6YA 5IS2A 4Y2IA 3W3SA 2IMWP 3E51A 2GHPA 4C2MA 3CF5Q 1GQEA 1O0PA 1FKOB 3PX6A 1NSAA 1RJJA 4CYUA 3RBDA 1Q79A 5B0GA 1HMVB 3JSYA 3RR7A 4QIFA 1UL3A 3N4WA 2BJ1A 2W25A 4QW8A 2ALYB 4DV5F 1NHKL 2K3IA 4U67Q 1XNQJ 5F8NA 1RT6B 3GIKA 2VFSA 5EX0A 1N5YB 4M8LA 5LMUJ 4M5DA 2L9DA 4OI0A 3T41A 4FPIA 4L3KA 1G3OA 5DO2A 1ROFA 3CJRA 2HZAA 2OPRB 4P72A 1HBOA 4DF4A 2WOMA 1PILA 1F6TA 5KFGA 2XGQA 1FWKA 2AZ3A 2HAIA 4HACA 4F4XA 1S9GA 3BGOP 2XCAA 2H3EB 4FYWB 1RKIA 4E8UA 2BA9A 1Y3JA 3POTA 5GAHI 4UOFA 3CD7A 4A8FA 4F0KA 1ZPWX 3SCIE 3PEHA 1KONA 4PWWA 3M6WA 4O3OA 1SL1A 1YJUA 2DHSA 2DCUB 1N56A 2XY5A 5DM6Q 3BPSP 3MHYA 2OSRA 2NXJA 5EWFA 3W5XA 3IRXB 1SCJB 1RAHB 1DHMA 3CB4A 5L9XA 5L1IA 1NEEA 3BYPA 2MLYA 3MM5A 3TEGA 3ITHB 5EWEA 4DV1J 1FRKA 2D74B 2ZBCA 1LEOA 2CQBA 2FZKB 1YLXA 2ZVSA 1TUVA 3VTIA 4U8VA 4EZ9A 4RR5A 2XI3A 4WFBQ 3CTRA 4TY8A 3TW0A 2HHHF 5HP1B 5HMXA 3OJUA 4LVNP 1HNXF 4YR2A 4P52A 1Q78A 2J0QD 2Q43A 2ZE2B 1H73A 3R7SB 1H7XA 2PFFB 3WX4A 2CPXA 4KPYA 2DH9A 2MXYA 4NOHA 3OJSA 2AZ1A 2YQ1A 2GW8A 2YNHA 4NI2A 4R0JA 7FDRA 4PG6A 2LDYA 4JV2A 5LL6d 4WE1B 1QJHA 5HVFA 2VG6B 1V3RA 3M8RA 4UQGA 3DLLQ 1IQZA 1YBAA 3TWZA 3CIZA 2QV6A 1S59A 3D54A 1A0OB 1X4HA 2UV8G 3NGKA 4ETXA 3M1VB 1T9UA 2YXLA 1SJ4P 5A76A 1ICEB 2XM3A 4F2RA 3W9IA 1P27B 3L7OA 3UW1A 3TAPA 4Z37A 4RW9A 4RBUA 5LMNF 1XMBA 2DEIA 2ZVIA 1B7YB 2AT1B 1WUUA 4F0MA 2IBKA 5C24B 4P2XA 1N36F 5EHHA 5IZHA 2QG9B 3FZBA 4ZCIA 2ZEJA 3UCUP 5K8OA 5IWAJ 4ES3A 4B9NA 1TK8A 3JAMU 4ZMMA 4Q0BB 4DV0J 4NXNF 4PYDA 4OLOA 2QLFB 2CNNB 1WOPA 3D6TB 3H42A 1T0TV 1TMMA 3GP9A 2RSQA 3GE9A 4NLSA 2WW4A 4M63A 2WB1D 1HWKA 4ZVQB 1OY9A 3MCSA 1HL6A 1S7HA 3SSRA 3D0HE 2XO7A 3OR1A 4ZPVR 5T7LA 3AA8A 1HBMB 1NJWA 1HNWF 1QDUB 3CCLS 2WRMA 1HYSB 2ROEA 1MWYA 3CCMS 2Q66A 4F7VA 2P2CB 5J2MA 1G1XA 2MYFA 4NLRA 4CM0A 1FEEA 2FVRA 3NOGA 3CVKA 3EGVA 3CJ5A 1JLCA 4LF5J 2VASA 1UA0A 1GTEA 4ZJLA 1UJ5A 4USHA 4WJBA 5DETA 2A3JA 3T6JA 1ELOA 1KQFB 2V2ZA 4BC9A 2VG5A 1F0XA 3E3XA 4CYUB 2X1FA 2AIRB 4ED4A 2BEFA 3HVTA 1FJEB 2MEWA 3SCJE 4OYPA 3ENQA 1X9SA 2ASDA 2W1BA 3ZTPA 2W4CA 1HQUB 4CNYA 2AYMA 1YK9A 2HZVA 2Y9HA 4J9UE 1IBLJ 2FDNA 4X65J 1Q8IA 3M8PA 4ICLA 3PIPQ 2OIHA 4X4NA 4M5DB 3CUNA 1EB0A 2CQHA 2IAJB 3NMRA 5IM0A 3M8YA 1YRXA 2GHVC 4JYAF 1YITS 2RNEA 1NKEA 3TAQA 2WOMB 3K5MA 3LWMA 4F04B 3BBBA 2DY1A 3HHLC 2ZWOA 4HACB 1S9GB 2K2PA 1ZPVA 4X64F 1YQHA 3SEOA 3S1TA 1GMWD 1KVKA 4DV6F 4NL5A 2V6AA 4OX9F 5ETSA 2DGUA 3F44A 4DU8A 4DBQA 2O3DA 4FS1A 2APOA 5F41A 3D1HA 3Q2SC 5D4PA 4OHZA 4B02A 4DV3J 3MI7X 3CW2C 2M70A 1N0UA 1BE4A 4CLPA 2IYIA 3CGIA 4QPTA 1CJUA 3DRYA 2DTJA 3CDWA 1NB2A 1W7WA 4K8RA 2HSEB 1GH8A 2J9EA 2M88A 4EWTA 1HFEL 3T1HF 2YH1A 3FCVA 1X4CA 1YJ7A 1S72S 4CO3A 5L1LA 2P5VA 2A6OA 4TY8B 1UEUA 2WBRA 4ZVUB 1OYEA 1VC6A 3MUTP 1VLYA 2KRRA 1RI7A 3A8KA 1U2RA 1TL5A 4CO0A 4AFFA 3R6LB 3GR1A 4ZP6A 4KHMA 4Q8EA 2FHJD 2JLFA 4O3QA 1J5OA 3PCOB 4AL5A 4NA3A 2KG1A 3LO3A 2YNHB 1VQ8S 1VK8A 2QJ3A 2N7YA 1J27A 3GWCA 4I0WA 2R9LA 2PN6A 2J8SA 1DARA 5IC4B 2PD1A 3AQOA 1FWPA 4EBDA 5B0FA 4LQ3A 4QYZK 2EKYA 3TVYA 5A8RA 4LUBA 2EG1A 4WFXA 2BKOA 2MQQA 3CMAS 3L4BC 1R8PA 2HHHJ 3UNGC 1VRQC 1HNXJ 2BJ3A 1QM9A 2J0XA 4HH1A 4P2FA 4KPCA 4RW9B 2D9PA 2W7AA 3MMBA 5L1JA 4ELUA 2RDIA 2YBVA 3E8OA 4L3NA 9ATCB 1RT2A 2XSFA 1OQ3A 3R7NB 4USMA 3C19A 4ED2A 2MJNA 1L3SA 3Q89A 3RU0A 2BQ3A 1S12A 1UVIA 2ROGA 3GCWP 1SKRA 3HP6A 1MLAA 3SSSA 1VLOA 4LVOP 4FBUA 4WWSA 3OT9A 2R7XA 2BOAA 2HQGA 3VAHA 5HL7Q 2DKOB 1IJFB 1RT7A 1RWXB 1SH2A 2GQCA 3ILJA 3NCQA 3P6YC 5B0BA 3EMTA 4X4TA 3TEHB 1U25A 4JI6F 2E29A 2MSSA 3HKWA 2DY9A 4YB7A 2RHSB 1R3NA 2YWHA 4LRCA 4R8UA 2ZZNA 1Z1ZA 3OR1B 1U1RA 4F3MA 4LSLA 4ED0A 1LWXA 1RTZA 4L76A 1WEYA 1REVA 3UD3P 1X5SA 3MZIA 3BYRA 1N36J 1CJKA 4NLTA 3GMGA 1CLFA 1M5OC 1JLCB 5EGYA 4X4QA 4A8OA 2RRBA 3FNNA 3ISZA 2UXBF 4RUAA 1XBWA 2JWNA 7AT1B 4DR3F 3ENAA 2VG5B 3Q83A 2I0XA 2FVCA 4LFCF 4NXNJ 2YTCA 3R97A 4J9LA 1F5CA 4XPCA 1S6QA 2BQRA 5SZTA 1MN7A 2IFXA 4ICLB 1HNWJ 1GX5A 1KDNA 4ID8A 1ITPA 2JC0A 2UXDF 4ZS6A 2OH2A 5IM0B 1AW0A 5KFCA 3TVZA 3SMZA 3MGJA 1EQ0A 2ZFHA 1GXTA 2EFOA 4ECTA 4DCPB 2H5IB 3DRXA 4LFAF 1RXOB 2YKPA 1FA0A 3NG8A 2DNZA 3R5BA 3TI0A 1WI8A 5D15A 1U49A 4K4TA 2Z2ZA 2OEJA 4LIRA 3NNHA 3ILOA 3SFUA 5KG3A 4DXLA 4PXCA 2DNMA 3GV7B 1VQOS 1S9EA 4RW8A 3H7HB 4DL5A 3CCTA 1JNRB 3OLAA 2VDIA 2VQEF 1RA7A 5HAOA 4F4WA 2ZJRQ 2B4PA 3KMQA 5GADI 3U02A 4J90A 1KOHA 5DGBA 5CZVA 4N7TA 4CLUA 4JYAJ 3PW2A 2HHUA 1F3VA 4NA1A 1CJUB 3QT7A 4PABA 3HI9A 3S6EA 1IBMF 2XI2A 3GZ7A 1JLFA 1CULA 1NJZA 2J0SD 3P49B 4KGXB 4X64J 3IBWA 1JLGB 2XB2D 2FY8A 1FCAA 1KOOA 1ZZNA 4ZP8A 2LEBA 4K59A 3PHTA 1N32F 1Q8BA 2MY8A 4DV6J 4OJGA 1KVIA 2KM8C 2MY7A 3BGLA 2IM0A 3NBPA 5DJBA 4Y0FA 4BHQA 5K8NA 2DRBA 2QFJA 1OIAA 2VIHA 4I7FA 1J5OB 2J7KA 5KFBA 1S5ZA 5AXKA 4S0MA 4JI4F 4DEZA 1K1QA 1AZSA 1YJWS 2KJWA 3SBMA 4C8KA 2E7VA 4CLTA 3W1YC 3N79A 2ZZMA 1LOUA 2OMLA 3CMQA 2IVYA 4K2XA 1H74A 3PJXA 2VKZG 3H20A 1MW7A 3VAMA 4IH6A 2CPZA 2ZH9A 4C6AA 2YKAA 3G8QA 4I2QA 1VQSA 4QWEA 1B99A 2B8PA 5LOQA 1OYDA 3V81A 4M95A 2HK2A 3I6PA 1VQNS 2BKNA 3AD9C 2CPEA 2IM2A 3MMBB 4HLBA 2HZCA 1U8WA 1VJQA 1EZZB 1XIQA 4IFYA 2O66A 3BKUA 2JSXA 4DFPA 3ZTSA 4ES1A 4ECWA 3HPOA 3DFEA 4HT7A 3Q8PB 2Y1IA 2V50A 5HQ8A 2Y1LB 2QA2A 5KFRA 4RBTA 1S1WA 3UCZP 2XS2A 4WKRA 2O1PA 4Q44A 1RT7B 2WTFA 1APSA 4P71A 2HQ3A 1RT4A 4LRDA 2V8HA 2ALZA 2HG4A 2FHKA 1KLNA 2CRLA 4NLOA 1IXKA 4X4SA 2F4VJ 4M5LA 4R8UB 8RUCA 2YWGA 2LXUA 1EHWA 2X1GA 2ZBRA 3KJQB 4LSLB 5BJRA 2W4PA 4IO1A 4H4KC 3T1AA 2ZOFA 1ZTTA 3LPYA 3NCPA 4C11A 1CJKB 4V19J 4YP3A 4I1TA 2MPUA 2KYXA 2XLKA 5GAGU 1S1VA 4IFVB 3QAEA 2LECA 3MAAA 3RBXA 3NGRA 1P1LA 3CULA 3H4BA 2V8PA 1WWHA 3R8YA 3TJ8A 2H5EA 1WTFA 1U02A 1CJVA 2FZCB 4JI6J 1K47A 1W2BR 2NYHA 1RT1A 2F7VA 3C66A 1S6QB 5E2QA 3QRRA 3I82A 3LP2A 1S48A 4RNNA 5E7OB 5L8RC 2V67A 2BABA 4WXWA 1SJQA 2EWHA 4RO0A 4Q43A 1UETA 4QYRA 2NXCA 3ZZ0A 1KQGB 3MEEA 2HK3A 2CWXA 1TFYA 2HFNA 4C4WA 1SBRA 2DGQA 4NXMF 5KG7A 2ZNZA 1KFSA 3AA9A 5DLGA 4ECSA 4YQWA 4ZOSA 2R8HA 2UXBJ 2Z8QA 2HWHA 3G4SS 3MOZA 2HFOA 4DR3J 4LFCJ 2V63A 1V9OA 5MAOA 1REGX 5E5NA 3K5PA 1ZH5A 2PE8A 3GJTB 1KWMA 1S9EB 4QR2A 2DGWA 3PX0A 2K06A 1GAOA 3DI6A 4MH8A 3EYZA 4P75A 2BJEA 2DNPA 1Q82T 3LOUA 3FGVA 5A6PA 3M05A 3QSIA 3R7BB 1RADB 4P7TA 2ZH2A 2UXDJ 2M0GB 3OFFA 4TKTA 2RQMA 1PCAA 2IJRA 4KGKA 4OYZA 5I3QA 1T9XA 4OZ5A 2QLJB 2HBYB 4LFAJ 1CULB 1ZA1B 2C2MB 4ZVGA 3CCJS 4OI1A 1QSSA 2AQ4A 1K44A 1UZHA 1KTVA 3AJ2A 1N4LA 1RTDA 2DR8A 3CD0A 2IDEA 1HWIA 3I9V9 2V2QA 3CDBA 4KO0A 3RRHA 1BQMA 1R0AA 3VAIA 1LWFB 3ZNUA 5A8KA 2VQEJ 3NBPB 4PEOA 1F5AA 3SI8A 1NZ8A 1NMEB 4LT6A 2Z58B 4I7FB 1RAIB 1KHWA 2H48B 1M1HA 1N5QA 3GTYX 1AUSL 1XQIA 3I4HX 3PKMA 1AZSB 3AOAA 4DQPA 2ZOMA 2L48A 2GVDB 1JX4A 4BLGA 3QIPA 4DJBA 5KG1A 4JI7F 3MECA 3UDEA 2BW2A 3GIJA 3GIIA 2Z56B 2BE7D 2RS8A 1N32J 4I2QB 4OYOA 2JNJA 2W2MP 5BYQA 1SQFA 4DF8A 2GC8A 3BS9A 3V81B 4OLPA 3OL7A 1XR6A 1NXIA 2VF3A 1RT5A 2AU0A 2D9OA 4RX6A 5KFUA 4K2JA 4PG4A 2C2NA 3PW7A 3FEYB 2YWEA 1U09A 1XEZA 2ZC3A 1SVDA 1FVQA 2E5GA 5KFPA 2FVQA 2CNLB 2B3TB 3G8SA 1M5SA 4IR9A 2AX1A 2FQQB 1P8GA 2CQCA 4EFAC 1RTJA 2BBEA 4EO6A 2OHDA 4P6QA 2J6UA 4ZLJA 3D6FB 3J7AN 4OYMA 2D1CA 3FRZA 3DGVA 1KQKA 2HQFA 1D8YA 1MWQA 3NP5A 3IMQJ 1M5PC 5B0AA 1S1WB 1TP7A 1VYAA 2WVBA 1XMOF 1RT4B 1ZBTA 4AL7A 3QT8A 2CNOB 3MR3A 1HKAA 1KN6A 4WBFA 5MLCV 5CH7B 3PX4A 3GSDA 4OX7A 4WK1A 5B08A 2KT2A 2ERRA 1LW0B 2HBRB 1WKLA 5KFDA 4HHJA 2CA9A 2LU1A 2ZOGA 1NBEB 2HS4A 4KGZB 3KG0A 2VJVA 1SL0A 4O3PA 4F50A 4WCEQ 1S1VB 1FO1A 2OI2A 4ID5A 2KO1A 3MAAB 2KTQA 1Y5NB 3UN5A 3R2DJ 4NLYA 2F8EX 1VBYA 2XS5A 4DHVA 3VF0B 4EGLA 2P8IA 2YNFA 3DOLA 4OZ1A 5HJXA 4LRBA 1UZDA 3O2IA 5DG9A 3OBIA 5F3ZA 4RUCA 4ZCLA 1R7IA 4OMFG 1CJVB 3U1LA 3UD4P 2WB4A 1JLEA 1SKSA 1RT1B 3W8GA 4OHXA 2Z0GA 3D6HB 4EU0A 1RHKB 2UXCJ 2DHHA 4J9RA 1QLNA 4HYKA 4HT5A 3CCSS 4QIEA 1S0OA 3PRDA 5KFMA 3MEEB 1NPPA 3H5YA 3NKYA 1VQ9S 1SI9A 3IWXA 3MMJA 2ZWPA 5IT4A 4GKJF 3MURP 2XC9A 3OFEA 1HNIA 1RQ0A 2GCFA 3ZZOA 3A3NB 3PEJA 2DCLA 5L39A 5C7PA 1YGYA 1CC7A 4ZA1A 4UZBA 3LAKA 2RRAA 3HMJG 4NMXA 2DD8S 3R5GA 4OIXA 3K8VA 1Y9OA 2GJ2A 1YG0A 3KHHA 3ZFVA 3ZTRA 2H1YA 2DO0A 1N6QA 1RB0A 3ADAC 2G0CA 3DI6B 1V3SA 2HFVA 2RDDA 1T9VA 4OQJA 4DI6A 1FDAA 1VR6A 4BWMA 2XMKA 4GO7X 2V2VA 1WD6A 3CCES 1T95A 3BBFA 1SUQA 1TAQA 3T1YF 4NXMJ 3P5BP 3J81Y 2AHOB 4KT0C 3EWGA 4LR9A 4O4RA 1WEXA 3M2VA 4WIIA 4NA2A 4AL6A 1UKUA 3V4IA 5DQGA 4U7CA 1PG5B 5RUBA 1YI2S 4DR5F 4HL9A 1T9WA 1FX2A 1WHVA 2JFDA 4RNHA 4KO0B 2MDAA 4CT9A 1BQMB 3Q22A 1R0AB 1N34F 2DXEA 5A8KB 1SQEA 1WJ9A 2LU2A 5D4NA 3QGPA 4GRSA 1VQKS 2N7CA 2VUGA 4ECRA 4DWIA 2GQ2A 3CO0P 3DLJA 2ZH6A 3EDRB 2DEJA 2AJ2A 5K8MA 4ED1A 4J5OA 2RHQB 3IRWP 2HAFA 1N0VC 3GJQB 2AJ0A 2QA4S 1FRMA 4ZVSB 4YDXA 1X0PA 2UU9F 1Y11A 4ALZA 3Q2TC 3QIPB 4V19X 2OKQA 1RYRA 3RUBL 2GAHC 2R8GA 3MECB 2I6WA 4WFAQ 3QJJA 2QZ8A 1EX8A 4KSEB 3D66A 4YY3F 5DQIA 2ZH8A 1Q4RA 4K5RA 2JEGA 1ZM3A 2D69A 1XTZA 1FF2A 1H72C 3G82A 4H4OB 3R5DA 3CNQP 3BH6B 4WTYA 4DUZF 3TAMA 2BZ2A 1BMQB 2O5DA 2R2SA 1H0HB 3J81U 2CG8A 1RU1A 5JVGQ 3M9NB 2QA1A 1ZM2A 1RTJB 2IJFA 3HFVA 3RYLA 3MXHP 3G6ES 4RPFA 3A4TA 5I42A 5LT5A 5KFWA 5HVHA 3K59A 4HVZA 4NCBA 4ZCKA 4FKYA 4C8ZA 2P6SA 3VGTA 4GO5X 1FXLA 4OI4A 1HD1A 1EP4A 1KP6A 3R1LA 1IKVA 2OMOA 3VAFA 2J7UA 4J91A 4EYHB 1UCNA 1N5TA 1TK5A 4RU9A 1U47A 3HSDA 2W4DA 3W64A 3RB0A 3GONA 2GA7A 1VBKA 1VBZA 1RISA 1PBAA 1R43A 4H4KA 1U2FA 2AWZA 3QRQA 2HRTA 1RAAB 4MTPA 3FBCA 3CDAA 5CA5A 5H9EJ 2VB6A 3TJ9A 4ID5B 4CH0S 2RUSA 1YSJA 4JI1F 4DCOB 4GKKJ 3OD2A 2YNFB 3DOLB 3PO5A 3VHQA 5THWA 2QSFA 1XMOJ 3SCKE 2QMWA 4PQUA 2GS8A 1S7IA 2R8KA 3MUVP 3RW6A 2BE9B 4IG0A 3OFHA 4ZJOA 3UWTA 2WVFA 1JLEB 2QGFB 2MHEA 1V3ZA 5KT6A 4C9DA 3D3BJ 3GG1A 3FK4A 2WVEA 4FNHA 5AJ3F 3L9ZA 2G2ZA 2XMTA 3FBBA 4ITSA 3C6TB 1RWMB 5FD1A 4KHPF 3ZXWA 1RU2A 1SH3A 2VFUA 4MT1A 1VC5A 2AYBA 5JMNA 2J0WA 4NASA 1VS3A 1NKBA 4O0NA 2J6TA 2MZQA 1HNIB 3V6KA 1A7GE 2I2YA 1RBOB 2W01A 4WU2A 1HWJA 3DCAA 4OHYA 4LFBF 2CQ1A 3RBZA 2VPYB 4CP5A 4MAKA 3AXKA 5GMKa 4DQRA 2GIQA 3DLHA 2C2ZB 1XC9A 3GYGA 4IG3A 4DX6A 3MF5A 1N6QB 4AQYF 1UVNA 1IKWB 5CZXA 3O6QA 2CJXB 3CJTA 4QYZJ 1SB6A 1SC6A 1TL3A 5M2RA 4NX9A 3SSQA 2KL8A 2LYVA 5K20B 3UQSA 1SUQB 3HHEA 4GKJJ 2XSJB 2DNOA 4OZNA 4NRUA 2HLTA 3OXGA 2XY7A 3IGVA 1KRPA 1IR1A 3OFGA 3M2VB 2MQMA 2D3UA 2BYCA 3RGIA 4C8NA 4DSEA 4X66F 3V4IB 4N56A 5CHCB 5D77A 2KFYA 2Y0BB 3RTVA 2MLXA 4Z7CA 1UEKA 2CKWA 5F9LA 2JZ5A 2LVWA 1PYTA 5IFMA 3N5FA 1B3TA 3RW7A 3X1LB 5ADZA 2PC6A 3UN2A 4JOUA 4KGVB 1T02A 3A8EA 2KM8B 4Y2CA 2LCWA 3M7VA 3T5KA 4MIAA 3SV4A 2CDRB 3NLCA 2CQ3A 5LSLA 3KLIA 4OFZA 4MK7A 3UI3A 2EI5A 2IMOA 3J7Z5 3T1YJ 3FCHA 1GTHA 3G71S 1Q1KA 3ETMA 3I5BA 2ROPA 5KG4A 5K5MA 1DQAA 2GZOA 1GXLA 3CJ3A 2QA4G 1I5OB 1FKPB 2QLWA 2XZDB 5EUHA 1FVSA 3GFXA 4B9VA 1NHVA 5D4LA 5CD4A 2MQLA 4DR5J 4H4MA 1WHYA 2VPXB 2ZM6F 4URGA 4TU7A 4YR3A 4FVMA 1NK0A 1DTQA 3VCDA 2MZ1A 1N34J 2DXFA 2FJBB 4C8LA 2BACA 2Y1RI 3NCRA 3G82B 3KYLA 1RAJA 3Q8YA 4OHVA 4TQSA 1HR0J 4YDDB 3DNCA 1QE1A 2GX8A 5CQGA 2Z2MA 3TAMB 3K17A 2QMXA 2QE5A 4IRCA 2R7QA 2HNZA 2R2RA 4OV6A 1PJ6A 4ZLNA 2OPPA 4QJVA 5I42B 4NZ0A 3QT6A 1KD1T 3BB5A 3MFHA 3M2RA 1TQLA 1IQTA 1FRJA 3HHNB 2WSCC 3DM2A 5J2PA 1W2IA 2B0GA 2JC1A 4NLPA 1NK7A 4YY3J 4LF2A 3UVJA 2AEMA 2B7BB 4PG5A 1R89A 2WAQD 1H3DA 3G96A 1OSDA 5KFFA 3K0JA 1TUWA 1BXNA 1XNQF 3GSIA 3SV3A 5DDOC 3JTPA 1S49A 4DUZJ 1KVJA 2XGPA 1YBUA 3IR6B 5K14B 2B4OA 3EXCX 3KG4A 3DOMA 1I51B 2QL5B 4NEYA 3ULHA 3PW0A 3B4MA 4CCHA 4QIGA 1F60B 3OV7A 3BSCA 4ZN3A 4LBIA 4UUWA 1RGVA 1HQ2A 3NS6A 1N33J 5ETMA 5KOWA 2BQUA 1QAJA 1HQEA 1U0SA 2R2UA 4MJKA 2YQ3A 2YX1A 4IG0B 4X84A 2JLEA 1CSJA 3HVRA 1M0SA 4LF4J 4JV5J 3IS9A 2E5JA 4XDCA 5JXSA 3QAUA 2LMIA 1LNQA 1UPMB 2OEKA 3EX7B 3UDCA 1XK8A 2QX0A 3KK2A 1EAYC 1VRUA 3U1NA 1SJFA 3QJLA 3IP0A 1VJWA 2UUCJ 4IH5A 5K8PA 2PSZA 3C8YA 3QWUA 4NLDA 1GMUA 4KB7A 1Y00A 3R5JB 3JSBA 3M6VA 3ENVA 4DV1F 3VR1A 3G2XA 4ZVTB 3GLJA 1T8EA 1KR4A 4B08A 3J80U 2DO4A 2FB0A 5DDRC 5ETTA 4RKUC 2OPSA 4B17A 2ILZA 4LF8J 1IWGA 4URSA 4CTAB 1NPRA 3WIVA 2R7UA 2DHXA 1S97A 4IG3B 1UPPA 1LWCB 2CYYA 2ASLA 1ACMB 5AJ3J 3H5SA 2DXDA 3HSGA 4C3LA 3HZEA 1TL3B 2OTJS 4WFNQ 2KYZA 4IOAQ 4JI8F 4WYLA 1H7WA 3R3TA 1T7PA 4MYUA 1HLWA 2MQOA 2NUHA 4OJ3A 3OL9A 2XLIA 2KRBA 1R31A 5KT4A 5GADU 2CIMA 3LF0A 3CDEA 1TUGB 1PJ5A 2BR0A 1BWEA 3S7RA 2RB7A 1ZTWA 3Q8RB 3BBCA 4G3IA 2BVZA 3H5UA 3PDNA 4JBCA 3DRPA 4JI2F 3RB4A 3DLEA 4OJHA 5I4MA 3KLIB 2IA0A 5D3GA 2MKIA 1PAUB 3TOQA 4TQRA 2ZJPQ 4ATNA 1Y7PA 4HR2A 4BCAA 2YWFA 1LQ9A 2E66A 3UCGA 2R7SA 4PG8A 2WONA 4X66J 1NK4A 2P9CA 1NH7A 1YWXA 3QGIA 4TU8A 1KFDA 1CVJA 4H4MB 3BR8A 1WF0A 3M9OB 1U1PA 4AE5A 1JJ4A 4JV0A 1MMNA 1DTQB 2DH8A 2HHQA 1FTCA 1U1MA 2QRRA 2KH9A 1QE1B 1HBNA 4M1KA 1WOOA 3KNGA 2VA3A 2HNZB 2KXFA 3T19A 1R6VA 2OPPB 3P5TL 2B9YA 3MOJB 5F9NA 4RNMA 3UO0A 1T05A 3E01A 3IAM9 1Q16B 2UV8A 3M2RB 2IDLA 3K89A 2YKNA 3DM2B 3QT5A 3MWBA 2KT3A 5J2PB 4OL8A 2EFPA 5U47A 2W9BA 1UA1A 3PY8A 2ZKTA 3FUYA 4DR6F 1XR5A 1RUSA 3UVJB 2ZM6J 2E7WA 2VOOA 1S10A 3NRBA 2EC0A 3JXOA 4EI2A 2IIHA 4KHRA 2W9AA 4ZLLA 1SV5A 1U45A 4QOTA 2UUTA 2M7SA 4V1Ak 5M2UA 2QC3A 3DOMB 2Y1JA 4NLWA 3ISNC 1U6ZA 3SDEA 3MMAA 4CWBA 1KS2A 4HI1A 1I3OB 5IQQA 5B09A 5FLXU 2ZD1A 3R5AA 4F67A 3ETOA 1QTNB 1D0EA 1A6LA 3GJSB 2LFVA 2BW7A 4CDIA 3OTOF 4FXDA 4LREA 4TU9A 1NJIT 4HTJA 3T9NA 1SC4B 4F25A 1HQEB 4I67A 2GGPB 1QAYA 3CD6S 4USJC 2JEJA 3IS9B 3HXMA 1YRUA 1UP1A 1ZAWA 4K5SA 4DV3F 3F0NA 2OFGX 1QTMA 3JB9k 2MGZB 1RP5A 3KK2B 1RCOB 1VRUB 5DZ7A 1U48A 1B0VA 1JLQA 2KHCA 2LP4A 3D1QA 2DK2A 4FF4A 1VC0A 2NPIA 4PPDA 1S1UA 2DNNA 2B56A 3DDNA 3NEKA 3W62A 1Y3KA 2MQNA 4W92B 2BOPA 5G0RA 1RBLA 4RW7B 2OPSB 4A8WA 3TYTA 4CLZA 5KFVA 1FESA 2KVIA 2VH7A 2BDPA 2V68A 1M5KC 2RIJA 3PRBA 3CEDA 1Q7LB 1PC5A 3FSXA 3Q8QB 4RBVA 2IVFB 2C3OA 5KOXA 3ENWA 5KT5A 5D0EA 2FVSA 3LH2S 1XNRF 2VU5A 2Y8YA 5CAAA 1RA6A 3FQLA 3N28A 1S76D 3PVXA 5HMZA 2P9GA 3EM1A 3HULA 4MMOA 2W2OP 2JDJA 4YEAA 5KTQA 1BLUA 4KC5A 3QGHA 4ZITA 4DUTA 3IFEA 2OO4A 3MR5A 2EBGA 3A3OB 4O3SA 1X5TA 3TZWA 4O3NA 3M9MB 2NZ4A 4EUVA 5LSRA 1ULRA 3H59A 3LGMA 2AGQA 1AROP 1VQ4S 2AW0A 3EGNA 2R7RA 1YRTA 1NO8A 2ZDOA 4QQBA 1PKUA 3PYFA 1GEHA 4N41A 4C3MA 1IBKF 2YPYA 3DRPB 3CPWR 3DLEB 2XMUA 2B8QA 4ZJQA 5D3GB 5DDQC 1BD6A 4DPTA 3C16A 4UTGA 4QW9A 3KDNA 1WC3A 2RDJA 1DY3A 1KEKA 4JI8J 3DLBA 3AB4B 3DXSX 1X9WA 3KHLA 4QWDA 4FYXB 5CYJA 3T5JA 3MFIA 2K7KA 2WONB 2X1AA 2OD4A 5HROA 1WDTA 1K9MT 1VOMA 4PG7A 3I5AA 3QJPA 3OTBA 4DSJA 2VBYA 2WVCA 3O1LA 2DH7A 3AJ1A 3OTDA 4OYBA 3D3CJ 2CQ4A 2DHAA 2F8HA 3PG9A 5AXMA 4JI2J 5DG8A 2H51B 3AT1B 1HBNB 3OVAA 2CQIA 4DG1A 5JUMA 1S1XA 3M32A 2E7XA 5J1EA 3Q23A 2EXUA 4ZP9A 5DQHA 3BEGB 3U1MA 5BR8J 5E41A 1S0VA 2O01C 4R5PA 2RMLA 1T05B 2UVWA 4O3RA 3E01B 2IHR1 3M8WA 2G13A 3QZ8A 2DIUA 5F0WA 2CAJA 2W7OA 2YKNB 3MR2A 2KFZA 5LM7E 4GC6A 4NCAA 2W9BB 1HARA 2VG7A 1C1CA 3IG1A 1QD1A 4U6PA 3WQPA 1JXVA 1S1TA 4BS2A 3M8SA 2PMHA 5KFJA 2R4FA 2EPIA 2CXEA 4XK8C 4KAIA 1SV5B 4I6AA 3QWPA 2G2YA 2OSQA 3SIPB 3W2VA 5H9FK 3PR5B 5GVQA 2IBOA 1XJWB 1ZYQA 1F5BA 4P73A 3SDEB 3WC2A 2VD3A 3MMAB 4ECUA 4MFBA 2ZD1B 3SXLA 1TTHB 2F9DA 3IR5B 3OL8A 1RZMA 3QYYA 3N6LA 1DQ9A 4O44A 2B43A 3H98A 1E6VA 1WDDA 2OPQA 1HHQA 1B0TA 1WG1A 5KFKA 1T9TA 2BMBA 3IO1A 1Q0NA 4PQAA 4DR6J 2XTJP 4QBUA 4G1PA 3K7RA 3TNVA 2W9CA 2AJFE 3A8IA 3HLUA 3FMWA 3NGSA 1X4DA 5IXUA 4A8YA 3DRSA 5HBMA 3I31A 3CC4S 2W2PP 3NL0A 4IKAA 4DR7F 1WI6A 5KT2A 3BM7A 2UUWA 5JJBA 4EYIB 1BQXA 4U95A 4RU2A 2B6AA 1G2EA 1JLQB 1NDKA 3QRPA 1HBOB 3M6UA 3KLEA 4Q8FA 4WF9Q 1T3NA 1F2GA 1YVFA 1S1UB 4P7VA 2YNIA 3T6BA 1NM2A 1U4BA 2QO3A 4NLQA 3ZZZA 3GV8B 3POTB 3UDVA 1J5EF 3OTOJ 1JJ2R 2JLGA 4G65A 5G0RB 2VFRA 1SC3B 2PMZD 3GFHA 8ATCB 2GHWA 1S0MA 2OEMA 5H9EK 2QLBB 1MROA 2YWKA 4AD6A 4TN2A 3BV8A 4Z7YA 4Q45A 3RB3A 1FERA 5D0RA 3A12A 3N0VA 2GV1A 1U7LA 4MKBA 2XZWA 2NSBA 2OGUA 4DPXA 3LP0A 4ZHRA 1SKWA 4TYAA 5HQLA 3MM5B 4URQU 2ACYA 3CIMA 3WC0A 1RWUA 5ETOA 1WEZA 4DL6A 1FJGF 3AD8C 2C2OB 2F63A 2P9EA 5D0HA 4RL1A 3K58A 1DAXA 2UVVA 3AFGA 2F1FA 4K50A 1Q53A 2Q79A 2GMHA 2DITA 1TVRA 3FRYA 4OI3A 4NPOA 4A8SA 4X4VA 3DGPA 1S0NA 4MK8A 3DLGA 3M8ZA 2MZJA 3EZUA 2XBPA 2M52A 4WXOA 2V4RA 4LR7A 4MK9A 2HGLA 2ILYA 1WG4A 4RWWA 3D0IE 1XNRJ 4NI2B 4DL4A 4RW4A 2A0FB 3NMAA 4FP9A 1CJTA 4PXDA 4ECZA 3NGDA 5IT9Y 3CCRS 2BM0A 4ZCMA 4W90B 4ECQA 1RAGB 2BV3A 3OTEA 4F8RA 2QN6B 2DR9A 3KLHA 3TARA 4X4OA 2RS2A 1YDLA 2R7OA 4ZPDA 5HROB 2RKIA 5KT3A 3BR9A 4NZ7A 1HI1A 1FWLA 2F65A 3EVMA 4ZPCA 2F4VF 4HI2A 1JIHA 2E1MC 3FBFA 2DRAA 2XCPA 4IR1A 2GIFA 4B3RF 2GVZA 3D1OA 1IBKJ 1FK9A 3MR6A 3VALA 3KUGA 4RW6A 3HSZA 4DG1B 2NZCA 1S1XB 1BY9A 1M1KT 1CC8A 5J1EB 2HPUA 2CPJA 4DUYF 1DURA 2BJ7A 2CQGA 1BWVA 2JX2A 2PIIA 1X4GA 2VICA 4LR8A 3VV2B 1PAEX 1HHTP 3RBEA 4ZIWA 1NK8A 4R5PB 2NSCA 1WNEA 2M4MA 4C8YA 4CH1A 2H4YB 3Q24A 4UZCA 2OUGA 2HKEA 2NR0A 2HWTA 2HMIA 2VG7B 2DPIA 4YFUA 1C1CB 1NK6A 4LF6F 1JQGA 3R9LA 4PR6A 1P6TA 3IG1B 1ZETA 2XY6A 1L3UA 1X60A 1VQ7S 1S1TB 4MKVA 4O0IA 1RCXB 3GILA 3MEGA 5A2QY 4C3KA 4HTIA 3V6HA 1RAEB 4XAKA 2RU9A 5T7LB 4M5JA 5A6WA 3TZXA 2D7SA 5J1NA 3W2VB 3D6MB 2QYGA 1JWWA 3PHEA 5J2MB 4ELTA 3A1YG 3NOCA 3TRGA 2WW8A 5CD4H 5KG2A 4MFBB 3RAMA 2J9DA 1B7FA 1NDLA 4HHHA 1YJVA 5IOLA 2QMUB 4O44B 4FPRA 1VI7A 2KVQE 5E33A 5LSOA 3MMCA 3OPKA 4EBCA 1E6VB 2OPQB 3HVTB 5F8LA 4LRAA 3IR7B 3OSNA 4KE5A 1WKJA 3TQEA 3LUYA 3LGNA 4DN0A 2ZDPA 2MKCA 2W9CB 2HRUA 3M8PB 2DISA 4RJVA 3DRSB 5HBMB 1U6FA 4GVLA 3H25A 4GVBA 4PAAA 4M5HA 1HNZF 2V4JA 5D78A 1IM6A 1UTAA 4USTA 4RUBA 2QTWA 2V8DA 2B6AB 4F4YA 4M5GA 1WTBA 2D3ZA 3KLEB 4DPOA 4DR4F 4ED3A 2KU7A 3PXGa 4ED7A 1NSPA 2YNIB 5HP1A 3H4DA 4BDPA 1SH0A 1R27B 2CJAA 3D9BA 3KNAA 1SL2A 1VMBA 5HN0A 1VRTA 2LXFA 5A2QU 1RKJA 2CQ0A 3HVWA 2C3UA 3C15A 2JJ4D 1MROB 2N82B 4QU7A 1XR7A 4J9QA 4K4WA 3HT3A 2ASYA 4G1QA 3PYDA 1AYEA 3VGSA 1ZA2B 1F9EB 2ZBPA 2NPFA 2C3MA 1WC1A 4JI3J 4DR7J 1DJ0A 2AKWB 3HK2A 4ZVHA 3LP0B 2CJQA 4ZHRB 1DRZA 3SFGA 5HANA 1D09B 4LIWA 3BZQA 1XN9A 3OVBA 1OMSA 2LQ8A 5J2NA 2LQ5A 4P2SA 1H38A 4WP8A 1TR0A 3V6JA 1XMQF 1R8CA 2FGOA 2C42A 5KAKA 3RG6A 1J5EJ 5HO4A 2EC2A 2G0JA 1IUJA 3DYAA 1W25A 4ETZA 4OZLA 1TVRB 4LQ9A 2MKSA 4Y34A 3OLBA 2HHPA 4PWUA 3ET6A 1NSKL 3TZZA 3FSYA 3DGPB 2PDAA 3KKFA 1LK5A 3DLGB 3HHDA 3DMJA 3PZPA 1GXUA 5CABA 4RW4B 1CJTB 3GPAA 3VZIA 2E1RA 2BANA 2PI4A 4IOBA 3R27A 1HPZA 2CG4A 1MMLA 1X7VA 4KKOA 3J7ZT 2JFKA 1FJGJ 3KLHB 1PGZA 2DYAA 5A8RB 4A8KA 1IKYA 1ZAXA 2R42A 4DDFA 1JK9B 4ED6A 4U9RA 4O4GA 1WSVA 4QU6A 3SZ2A 1NJYA 2UVRA 1OJ4A 1AFJA 3L3CA 3KJFB 1NUEA 3N5BA 3CJ0A 2C22A 2KDOA 2FLNA 4ANDA 2GVZB 4H54A 4PXBA 3MAHA 4C7QA 4RW6B 2L08A 1RT2B 1DTTA 5DRKA 3IWNC 5T41A 2ATLA 4RZRA 2XULA 2Q6BA 2E5HA 3D28A 1FXRA 1UWAA 3PJ9A 3QIDA 1K73T 5KFLA 1FRXA 5LJ5Y 4DFMA 1YJTA 2YWWA 2G1DA 3T3FA 5KFOA 3P45B 1S57A 1HQUA 2GIRA 4L73A 2HMIB 2HBQB 2Z2YB 1YZ6A 3W63A 4IH7A 2MZRA 2AD9A 4D3HA 3MEGB 3FEXB 2IAJA 4B3RJ 3EZ5A 1WACA 2UXCF 2RAQA 3Q86A 2A6MA 2YY3A 2EBEA 1REVB 5BYRA 3K57A 4DUYJ 3OTCA 4OX6A 4DX7A 1T11A 1UVJA 5E3AA 1Y5IB 4F2SA 1PJ7A 4M94A 4F02A 5C2CA 3KHGA 3EXYA 4J9PA 4ZK7M 3MMCB 4F3QA 4ED5A 1VISA 4LF6J 3PIOQ 2WVDA 2L3MA 2DIVA 4TVAB 3KWMA 4K4YA 1Y5LB 2NS1B 2M3DA 4C8OA 5E3PA 4DPYA 2M2BA 4O23A 4ERDA 1JJCB 1KHVA 3R1HA 1U24A 4GVBB 1YJ9S 5B0DA 4ZPTR 1N5SA 2X1BA 4ENOA 3UR0A 2ZHBA 2V4JB 2VFTA 1VQMS 3MPVA 2GJFA 5ETQA 1UJ6A 4IDKA 1FXDA 2B9EA 3D0GE 1LFWA 2W8KA 3GR0A 1X4EA 4TLQA 4Y6IA 4NLGA 1RACB 3W5ZA 3HHLA 3JAMY 3FBEA 2MHNA 2I5JA 1TKTA 3QLHA 2RVJA 4FDFA 4OV1A 5GAEI 5KFXA 2NLWA 2CPIA 4L6V3 2L9NA 2ASJA 4QCLA 3TQ1A 3BN7A 3M30A 1VRTB 3C15B 2NQPA 2BJ9A 4OZJA 1IWAA 5L38A 3AY0A 1G7CB 4RW8B 1GK8A 1UAWA 5ITHA 4G1QB 4DMZA 2VV5A 2PA8D 2DNGA 4FYDA 3N6NA 2D3OR 2HGNA 1HNZJ 3OL6A 3VAJA 2WSEC 4NCGA 4I64A 2VQFF 3W9HA 2HGMA 3UE2A 2K7JA 1RT3A 4DR4J 2ZC4A 5J2NB 3WIUA 1JLFB 1RWKB 5BXIA 3DU6A 2ADBA 5AXLA 3B8HA 2E9RX 4Q7AA 4Y00A 3RB6A 1Z2LA 1D9DA 3FJ2A 1WKKA 2MMYA 3MEDA 3P4UB 1PSDA 2W8LA 3DYAB 4K0KF 2RRNA 2R7VA 4HH0A 4OZ3A 2Q6CA 4CH7A 4K7QA 1U1NA 4I6WA 3OSPA 3ET6B 3UPFA 4HKQA 2VPZB 2HHTA 2DNYA 1RWPB 4OX8A 1BC6A 1CQMA 2BRKA 3DMJB 2QL7B 2AJ4A 5HI7A 2ZNYA 3HCXA 2EFQA 2XNRA 2ZBQA 2BANB 4FKXA 1RLCL 1HPZB 3TZYA 4DV7J 1K0TA 2XYHB 3DC2A 3DHXA 4KKOB 1RHUB 1XMQJ 4W98A 3UN3A 1IKYB 3PYEA 5A8WA 3MPUB 3BSNA 3Q8SB 3UNYA 4B9LA 4O4GB 3PV8A 4HHUA 5SUHA 1E6YA 4TLRA 3THPA 3FC9A 4EZ6A 6FD1A 4N8OA 3S01A 4CZCA 1EIYB 1KSPA 1R0BG 1NB7A 3TUJC 1DTTB 4IFYB 2V69A 2QL9B 5CCMA 1N5VA 1BQNA 5ETKA 3CMES 2YH0A 4Q2LA 3TUZC 1OSCA 3KLVA 2XYGB 3C3LA 2JOQA 2YKOA 2R7WA 4HDGA 1RAFB 4DZDA 2HVDA 2BE2A 2F8MA 2PI5A 4DL3A 2XS7A 2DR7A 3FQKA 5KFSA 2VZ9A 4GKKF 3OUYA 3QPIA 2OJ3A 1X4BA 5ETPA 2E5LJ 4M5NA 4ECXA 3DN9A 1OS5A 2AYEA 3PJWA 2K3KA 3KOAA 1X31C 1O8BA 1PIEA 4KRWA 3JSMA 5EWGA 1I1GA 2GQQA 1K8AT 1FNXH 3H90A 3WX8A 4NRTA 2JHEA 5DM7Q 4LF9F 2ZHAA 5B0CA 1KLMA 3CJ4A 4C11B 2C2DA 4PYAA 2A2DA 2CVEA 1SJ3P 2V8GA 2BJ8A 3NGTA 3SQGA 1X4AA 4DPUA 2HVZA 3FZ2A 5KT7A 2YKMA 3UDLA 3D7SB 4DV5J 2HS3A 1FD8A 1LW2A 1CS4A 3FFIA 2AGPA 3I56S 4IO9Q 1HWUA 8AT1B 1V5IB 2LLZA 2EKNA 2X7IA 1S4EA 2DT9A 2OLWA 4Y2MA 5L9NA 2RQCA 3LP2B 1NHUA 3ZO7A 1T94A 2Y0SD 1SXLA 2QFIA 1R0CB 1M1GA 2IRXA 1HI0P 5L46A 4DPWA 3L95X 2LA6A 1DFDA 1CQNA 7FD1A 1QAIA 1UFWA 2MKJA 1RWVB 5LXRA 3P96A 2V9WA 3AQPA 3VVTA 1QUPA 4NEZA 2FVPA 2ZITA 1SJ1A 1JLGA 4G1IA 3VAGA 1JLBA 4IDKB 4FF3A 2RU3A 4XDDA 4J9NA 4ER8A 3HHLB 1LK7A 2I5JB 1TKTB 3QLHB 4B3SF 2XHWA 5GMDA 2WHOA 1MWZA 3ZZUA 5AE3A 3NAHA 4RNFA 3OQ2A 3M30B 2J7WA 5F8JA 3Q8UA 4F36A 5EDWA 3GFYA 2KXNB 1M5HA 3HD1A 4TY9A 2XNQA 1G6BA 3RRGA 4Q5VA 4P74A 3AJDA 1FJ7A 3TUIC 4K4VA 3VGVA 1KKHA 5J1PA 3M8QA 1N88A 1WSRA 4YMEA 1YJNS 3OR2A 1FHTA 2F40A 1GNKA 4U7UK 4Q2MA 4ED8A 2RE1A 4NCGB 4DSLA 2OP5A 3EICA 1UMJA 1RT3B 4WZQA
chains in the Genus database with same CATH topology
4PPDA 1S1UA 3CC7S 3NNCA 2DNNA 4N8NA 1P1LA 2B56A 2IYGA 3H4BA 4DQSA 3CULA 3DDNA 4N5SA 1NJXA 4OZ0A 4YB6A 1Y3KA 1WWHA 4C98A 2B51A 2CQ2A 2MQNA 3V2UC 2G9OA 3MD1A 1UWBA 1QAXA 1QSLA 4W92B 2AP6A 3G8TA 1IKXA 2BOPA 2H5EA 1WTFA 1FRHA 4DS5A 3IN5A 1JXEA 5G0RA 3J80Y 2DGXA 1C1BA 2LXIA 4RW7B 3I0RA 3MEDB 2FUG9 2OPSB 5GAGI 3KMSA 1W2BR 4A8WA 2CJ9A 1RT1A 2B9XA 2F7VA 3C66A 1S6QB 5E2QA 3T9ZA 3TYTA 1RTDB 2O67A 5I3PA 3KG1A 3I82A 2RUGA 5KFVA 3P3DA 3LP2A 1FESA 1S48A 2KVIA 2VH7A 2BDPA 2YVSA 4FN5A 4RNNA 3MM8B 3WBZA 1S79A 1M5KC 5LMUF 5E7OB 2HNYA 3BREA 5L8RC 1NNDA 4JV1A 2RIJA 2BM1A 2BABA 3PRBA 3M4XA 3CEDA 4WXWA 2UUBF 4YR0A 1Q7LB 1PC5A 3FSXA 1SJQA 2EWHA 3CCZA 3HHKA 3THTA 3Q8QB 1C4CA 4MKAA 4RBVA 4Q43A 1X9MA 1UETA 1HR0F 4QIVA 2IVFB 2IRYA 2C3OA 5KOXA 3ENWA 4QYRA 5KT5A 4NLVA 1KQGB 3ZZ0A 3MEEA 4ES2A 2FVSA 3LH2S 4YB5A 4C0BA 4F4KA 1XNRF 3J7A1 5EX3A 1TFYA 2HFNA 2PT0A 4C4WA 1SBRA 2DGQA 1FKAF 4MIBA 3TX8A 4NXMF 5KG7A 4JUZA 3M32B 1RA6A 3FQLA 4HEA9 2ZNZA 4AXJA 1KFSA 3N28A 3AA9A 1N52B 5AE1A 5DLGA 4ECSA 1X5OA 4FXWA 1S76D 3PVXA 5HMZA 1ZZFA 4YQWA 2KKHA 3WZ0A 1GX6A 2P9GA 4ZOSA 1D9AA 2R8HA 4OJ1A 4MMOA 3H40A 4A47A 4DV2F 2Z8QA 1FKOA 2M9KA 1D1UA 2JDJA 2HWHA 4YEAA 5KTQA 3G4SS 1BLUA 3MOZA 1RK8A 2HFOA 3QGHA 4KC5A 1AFIA 3IFEA 2OO4A 3MR5A 3KK3A 2EBGA 2MZTA 3GIMA 5C25A 4Y65A 1S99A 2GNKA 3N01A 1HMVA 3GB0A 4X62F 4O3SA 1X5TA 4UY8T 1V9OA 2A2CA 2GGPA 4O3NA 5MAOA 2FD2A 4LJMA 4CO4A 5E5NA 3K5PA 4TXSA 3M9MB 2E9ZA 1ZH5A 3OVSA 2NZ4A 2PE8A 2YX7A 2CQDA 2DB1A 1S9EB 4EUVA 1RTIA 5LSRA 5A8WB 1AUDA 1ULRA 3H59A 3N6MA 5H9FJ 4KTQA 4QR2A 3LGMA 2N3OA 2DGWA 3HJFA 2AGQA 4CT8A 1AROP 4AXIA 1VQ4S 3PX0A 2DNLA 2AW0A 3EGNA 1GAOA 3DI6A 4MH8A 2R7RA 1F9FA 1YRTA 3EYZA 4K4XA 1NO8A 4OHWA 1RT6A 3TR5A 2BJEA 2ZDOA 2DNPA 4QQBA 4CO5A 1Q82T 4A8MP 3LOUA 1RT5B 1N5YA 3CSKA 1WELA 2MGZA 3FGVA 5A6PA 1E6YB 4ZVEA 4N41A 4C3MA 1IBKF 3M05A 2ZUGA 1FRIA 1WHXA 4P7TA 3FVYA 2ZH2A 3DRPB 1ZAVA 3CPWR 3DLEB 4MYTA 2XMUA 3I5CA 2ZJQQ 3CJKA 5HLFA 2FLOA 1FD2A 1ZM4A 5D3GB 2M0GB 2FGCA 3OFFA 4TKTA 5DDQC 2OPRA 3Q0AA 2RQMA 3IGNA 1BD6A 1WG5A 1HWLA 2K1RB 3I32A 4KGKA 5AE2A 5D6GA 4Y3CA 2KFNA 1B64A 4QW9A 4IFVA 3IC1A 4D3GA 2RDJA 5I3QA 2PEHA 1KEKA 4OZ5A 1BQNB 1O51A 3T5LA 2VA2A 3DLBA 3AB4B 2QLXA 3DXSX 2FHMA 1X9WA 1EETB 4UY85 1YJRA 3KHLA 4QWDA 1HW8A 4ZVGA 3CCJS 1UFLA 2CPDA 4DQIA 5CYJA 2Z4PA 4OI1A 1QSSA 2AQ4A 3T5JA 4AUKA 3MFIA 1Z4UA 2WCXA 4A48A 2BE2B 3PFEA 2K7KA 2WONB 2LKZA 3ZZPA 2X1AA 1YTYA 2AJ1A 2IRUA 2OD4A 4IOCQ 2DHGA 5HROA 4RW7A 3K2YA 1KTVA 3DLKB 2L41A 3TA1A 1K9MT 1TFWA 1VOMA 2RT3A 3IAS9 3AJ2A 1N4LA 1RTDA 2DR8A 3CD0A 4NLUA 1N33F 4PG7A 2LA4A 3OUYB 1HWIA 3TA2A 1S77D 3I5AA 3QJPA 3LP1B 3OTBA 4FZVA 2VBYA 4DSJA 3I9V9 3PACA 5IT0A 2I9SA 2JVRA 3O1LA 1U8SA 3CDBA 4Y28C 4KO0A 1URRA 2N3LA 3RRHA 3FEZA 3OHAA 1BQMA 3F56A 3O3LA 2EK1A 3VAIA 1R0AA 2YX4A 2DH7A 1LWFB 1NRKA 3AJ1A 3IRXA 5A8KA 1S9FA 4LF4F 4JV5F 3FMBA 2Q3PA 3OTDA 4QZVB 3NBPB 1F5AA 1RYSA 3CXCR 3SI8A 1Q7YT 1TAUA 2CQ4A 2DBBA 3JSMB 5C42B 4LT6A 1GT8A 1TKZB 4DFJA 2DHAA 2F8HA 6FDRA 3PW4A 2DR5A 4I7FB 2IC3A 2J8AA 5AXMA 1KHWA 2N4DA 5DG8A 1HBNB 3OVAA 2CQIA 4DG1A 5JUMA 4PUOA 1S1XA 2HLUA 2V8VA 2H9ZA 1YHQS 3M32A 2KG0A 3J7YI 2E7XA 1FNOA 1N5QA 1SJRA 1FDNA 5J1EA 3Q23A 4X2BA 1OPZA 4ZP9A 5DQHA 5F8GA 3NAIA 3BEGB 3ITHA 3U1MA 4WYWA 2UUCF 1KLMB 3I4HX 4Y2AA 4B9UA 1Y0HA 5E41A 2K8GA 4DL0C 3PKMA 1S0VA 2ZBIA 1WHWA 3B78A 1KTQA 2HVIA 2O01C 3MAQA 3R5CA 4UW2A 4DQPA 2ZOMA 4R5PA 2L48A 2RMLA 1S6OA 1T05B 2UVWA 1HI8A 1FE4A 3E01B 2IHR1 4O3RA 3TA0A 3SQGB 5KFYA 1JX4A 3B82A 2G13A 3QIPA 3QZ8A 4I68A 2DIUA 1HBUB 4DJBA 2XLJA 5KG1A 4JI7F 1S6UA 5F0WA 1NU4A 3MECA 2CZVC 2W7OA 3MM6B 4K4UA 2YKNB 3MR2A 1IR0A 2BW2A 2LQBA 2YKMB 1VQ6S 2KFZA 3GIJA 2DNHA 3GIIA 3ZZRA 2RS8A 1V6HA 4GC6A 4I2QB 2FHJA 4FS2A 4NCAA 1HA1A 2W9BB 1HARA 2MKHA 2VG7A 5BYQA 4F4ZA 4DF8A 2GC8A 1C1CA 2XWXA 2ZE2A 3BS9A 4ZPWR 3V81B 1YIJS 1LW2B 4OLPA 3OL7A 4KIAA 1XR6A 3IG1A 4PXEA 2AU0A 1RT5A 3FFIB 4U6PA 2D9OA 4E0DA 4RX6A 1S1TA 4LF8F 2GMLA 4BS2A 2J9DE 3BF4A 5KFUA 3M8SA 2PMHA 4PG4A 2C28A 5KFJA 2KZZA 3PW7A 2R4FA 3FEYB 2J76E 5DDPC 2M8HA 2YWEA 4QWCA 1U09A 1XEZA 2EPIA 2ZC3A 4XK8C 1M90T 4KAIA 3KK1A 1FVQA 5LXYA 2B4UA 1SV5B 5KFIA 1HHSA 2E5GA 5KFPA 2FVQA 4N76A 2ZKUA 4BBYA 1Q8LA 2B3TB 2NXUA 3HF5A 3G8SA 1M5SA 4IR9A 2PA3A 1B0PA 2AX1A 5DS7A 4I6AA 3QWPA 2OSQA 1MMDA 1P8GA 3CCQS 3W2VA 3PR5B 2CQCA 3TP2A 4EFAC 2RH3A 1RTJA 2BBEA 3FDSA 1VBXA 3QGGA 4NWBA 5GVQA 2IBOA 4EO6A 2IM1A 1ZYQA 1U1QA 3CC2S 2VC0A 1UVKA 4WE1A 3AH6A 1JMTA 1F5BA 3CWJA 3BQ2A 3SDEB 4NZ6A 4P6QA 2J6UA 5IWAF 2VD3A 3WC2A 2FJAB 3MMAB 5FJ4A 2KT5A 3U27A 2VG6A 4LSNA 4ECUA 2D1CA 4MFBA 3FRZA 3I9ZA 5KFTA 1JKHB 2ZD1B 1JLBB 1KQKA 3SXLA 1D8YA 3NP5A 5FLXY 1M5PC 5B0AA 2F9DA 3IR5B 1S1WB 1TP7A 4WKYA 3OL8A 4DV7F 2F9JA 4DV0F 2KHDA 3QYYA 3N6LA 4BWJA