2FHOB

Nmr solution structure of the human spliceosomal protein complex p14-sf3b155
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
GRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords spliceosomal protein SF3b155
publication title NMR solution structure of the human spliceosomal protein complex p14-SF3b155
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fhoB01
1X4GA 2E44A 2X1GA 2FPHX 1SJFA 3LPYA 4CIOA 2DNZA 4ZKAA 4C7QA 3CCJS 2CPXA 1YWXA 2LEBA 3CMES 5JVGQ 2HVZA 2N3OA 2X1BA 4FXWA 1FO1A 1FHTA 4RU2A 5HL7Q 3ZZZA 3UWTA 4F02A 1QM9A 1H2VZ 1DHMA 4FXVA 3P49B 2DGUA 2MJUA 1M1KT 2MZRA 1VBZA 2DH9A 2MZ1A 1HD0A 3IRWP 2MSSA 4TU9A 2MKKA 1SJ3P 2EK6A 2MMYA 3CMAS 2DGQA 1UP1A 2DNLA 1M5PC 2CJKA 2I2YA 2VODA 2CQGA 5FJ4A 4OZ1A 4QPTA 2M4MA 1SJRA 3EGNA 3G6ES 2MZTA 2AYMA 2VOOA 2KN4A 2DNPA 5DDQC 3BO4A 3VAFA 1FT8A 2PE8A 3S01A 3BO3A 5JVHQ 1U1RA 3CCES 2X1FA 2MKJA 2MY7A 2GO9A 2L41A 2DK2A 2OTLS 1YI2S 2MQLA 4W92B 2LQ5A 1Q82T 5DM7Q 1QVGR 1K8AT 1VC6A 2EK1A 1YJWS 1VC5A 1VBYA 2J0QD 1M5KC 2ZJPQ 4TLQA 4QU6A 3LQVA 3S7RA 3NNHA 1WF0A 1U1PA 2G1DA 2D9PA 3ZZYA 1DRZA 3MI7X 3FEYB 3N9UC 3SMZA 3TO8A 1G2EA 2LEAA 2KRBA 1YJNS 1QVFR 1YITS 2MQMA 2RT3A 2MKSA 3CCRS 1FJCA 1WEYA 1O0PA 3VAMA 1VQ5S 3THTA 1X4FA 2DGTA 1VQ9S 3RW7A 1X5OA 1U1QA 1R8PA 2KG1A 3U1LA 2QA4S 1FNXH 1ZZFA 3CXCR 2MZSA 1ZH5A 1WWHA 2EVZA 2KRRA 4Z2XA 1X4CA 2JWNA 1FXLA 1FJ7A 1OPIA 2M2BA 3CF5Q 3D2WA 2DNHA 2LMIA 1VBXA 2E5HA 1K73T 5CXTA 2KVIA 5LXYA 1UFWA 1UAWA 2O3DA 1A7GE 2HGMA 2MY8A 2CPYA 2CPFA 2MQQA 3NNCA 4PRFA 2M7SA 3CCSS 3H2VE 2DNMA 3Q2SC 2KXHA 2AYEA 4QQBA 4CH1A 3I56S 3BO2A 4UY8T 2DGWA 2PEHA 2CQPA 3MUTP 2OIHA 1X4HA 2XS2A 2L9WA 4IUFA 3S6EA 1VQLS 2RVJA 2VONA 3JB9k 2MZJA 2RNEA 2AD9A 3V4MA 2G4BA 1NU4A 3UCGA 4LIRA 4WIIA 2YH1A 1X4BA 1XN9A 1U6FA 2BZ2A 1Q7YT 1D9AA 3CC2S 2KFYA 3CCLS 3CPWR 3BS9A 1WEZA 3TYTA 2MSTA 2KG0A 1Q86T 1M90T 3CCMS 3H2UB 2ADBA 2MYFA 2DNNA 2JVOA 4PR6A 2M9KA 1HD1A 2KU7A 3CC7S 1URNA 2OSRA 2RS2A 5ITHA 3G9CA 2CQHA 2G0CA 2D3OR 3PIOQ 5GAGU 2A3JA 3MOJB 3MD1A 2DITA 5CA5A 1L3KA 2K3KA 5DDPC 3VALA 2DNRA 2DO0A 3RW6A 3MXHP 2ZJQQ 4ERDA 1M5OC 3R1LA 3U1MA 3CC4S 1OWXA 3P5TL 4LMZA 1WG1A 1Q81T 2MHNA 3R27A 4TU8A 1U1KA 2SXLA 5IM0A 3G8TA 1VQNS 1OO0B 1JMTA 2MGZA 2JRSA 4TU7A 2F9DA 1VQKS 2L08A 1X4AA 2LXIA 1W2BR 3VAJA 3HI9A 3IWNC 2LYVA 2RRAA 2N82B 2ERRA 1SXLA 1WI6A 1N52B 2DIUA 2XSFA 5IM0B 2MGZB 2HZCA 5LXRA 1HA1A 5CYJA 2CPJA 3EGZA 2DH7A 1WHVA 2DNOA 3CUNA 3B4MA 1P1TA 2DGOA 3UE2A 2KT5A 2LXUA 2CPEA 2J8AA 2MKCA 2DGSA 1AUDA 2D9OA 2MXYA 5HO4A 2OJ3A 2DGVA 3UCZP 3J7YU 1DBDA 2XS5A 5GAEU 1VQMS 4F26A 3NS5A 2KXFA 4YOEA 3SXLA 5LJ3Y 3NNAA 2M0GB 2LA4A 1CVJA 1VQ8S 1UW4A 4M5DB 4P6QA 2KM8C 2CPHA 2KH9A 2QFJA 2JVRA 1JJ4A 1X5PA 2LKZA 2RUGA 1FJEB 3L3CA 1VQ6S 3ULHA 3UCUP 1VQOS 3CCVS 2DHGA 1KC8T 1SJQA 3OW2R 5LJ5Y 2J76E 3NMRA 1S72S 2J0SD 4WFAQ 2DIVA 1WELA 2MQPA 1RKJA 2DNKA 2DHSA 2E5JA 1RK8A 1WHXA 1H2UX 2HGLA 1X0FA 2FHOB 1X4DA 4F25A 1VC0A 1X4EA 2MZQA 3VAGA 1WEXA 3UD3P 2U2FA 1DZ5A 2KHCA 4WKRA 2XNQA 2DGXA 2AYBA 2YKAA 2M8HA 2XB2D 1BY9A 3P3DA 1ZZNA 2DH8A 2CQ2A 5D78A 3PIPQ 2YTCA 3J7ZT 2CQ0A 1HL6A 5IQQA 1P27B 1YHQS 1U1NA 4UQTA 4PKDB 2LECA 2B0GA 4W90B 1WI8A 2RS8A 1X5SA 1OIAA 4YUDA 4V19X 1WHYA 1M5VC 2QEXS 2DHXA 2HGNA 4C4WA 2ZJRQ 1NO8A 4OZ0A 5MLCV 3NS6A 4Y0FA 4CH0S 3K0JA 2F9JA 3UD4P 5DM6Q 5GADU 1WG5A 4Y00A 1H2TZ 2CQIA 2OTJS 2X1AA 2KXNB 5H1SV 4WFBQ 2F3JA 4WFNQ 5D77A 1A9NB 1NJIT 2NZ4A 2DNYA 2E5IA 3MUVP 1N88A 3VAHA 2MPUA 2WBRA 5EN1A 3MDFA 3CULA 4LJMA 1R8HA 4WCEQ 2M8DB 2DISA 1WF1A 1U1LA 3G96A 2OSQA 4C0OC 2XNRA 3VAKA 2RQCA 1YTYA 2V94A 4IOCQ 3MUMP 3SDEA 1YJ9S 2RU3A 1N8RT 2LCWA 4EGLA 2MQNA 3Q2TC 1VQ4S 3G8SA 1WF2A 1U6BA 2M88A 4U67Q 3MD3A 3G4SS 4IO9Q 4QU7A 1IQTA 1KOHA 2YWKA 3BEGB 2N3LA 1SJ4P 3SDEB 3DLLQ 5DETA 3TP2A 3FEXB 1VQ7S 4A8XA 2GHPA 1H6KX 2CQ3A 5DDOC 1K9MT 1KQSR 2CQCA 2Q79A 1YIJS 3R1HA 1N54B 1X5TA 2FC9A 2DHAA 1WTBA 2CQ1A 1WG4A 3VF0B 2NLWA 3CTRA 2RQ4A 2MB0B 2FC8A 1F9FA 5IFMA 5LSOA 2U1AA 5LSLA 2AYGA 4BS2A 3CCUS 2MQOA 1KOOA 5GMKa 3I55S 2KI2A 5BJRA 3MURP 4CQ1A 1KD1T 1JJ2R 4ED5A 3THPA 4YB1P 3HHNB 2M70A 2VOPA 2MKIA 2I38A 3CD6S 1PGZA 2UP1A 3P6YC 2M52A 1PO6A 1S79A 2CQ4A 2CPIA 2CQDA 2DNQA 3CCQS 3B4DA 4IOAQ 2FY1A 2DB1A 3EX7B 3US5A 5DDRC 2KYXA 2HYIB 1D8ZA 5GVQA 2JX2A 2BOPA 2LA6A 2E5GA 3G71S 1WHWA 2KM8B 1B7FA 2MKHA 2ADCA 2XS7A 2K8GA 1JJHA 2DNGA 2CQBA 1U1MA 3DXBA 2CPZA 2MJNA 2RRBA 2YH0A 2DO4A 3S8SA 4WF9Q 2CPDA 1U2FA 2N7CA 3VAIA 1U1OA 5GAHU 1VQPS 4J5OA
chains in the Genus database with same CATH superfamily
3IWXA 2R7SA 3IG1A 4ZKAA 2DHHA 4QR0A 3IMQJ 5KG1A 2N3OA 1VK3A 2E9ZA 4USUA 3SV3A 4DV6F 4LREA 2DGUA 4IKAA 3BPDA 4F3MA 1RLDA 2D3ZA 3LWLA 2YKPA 1C2PA 4H4MA 2LQ9A 3SCJE 1HQUA 3A3NB 3DMJB 3J7Z5 3IP0A 1U09A 1C0UA 1UJ6A 5KT7A 2HNDB 4YFUA 5FDLB 3VVUA 3VR1A 4OHXA 2H65B 3AJ2A 3M8WA 3PR5B 3IGNA 4LSLB 3H40A 2RQMA 4DF4A 4DQIA 4RW6B 2RT3A 1XQIA 1DQ8A 4ZN1A 5I3UA 5KT6A 1WSVA 3FRZA 3U1LA 2FYXA 3FQKA 3I0RB 4C9DA 4GO5X 1FJ7A 3H5XA 2QLWA 3KLIA 5KFGA 3L4BC 2LMIA 3N0VA 2F8EX 1GT8A 3FDSA 4OX7A 1T9WA 2E5HA 4DV1F 1CG2A 4O3OA 4GC6A 1N0VC 3NNCA 1CBKA 2VPWB 2XYHB 5M2UA 2YWEA 2R2UA 3R5CA 2DGWA 2A0FB 2VONA 1V6HA 4WIIA 3Q8UA 3MMCA 8AT1B 4C8NA 1WORA 2GGPA 4M5MA 4NLUA 2QX0A 2KG0A 4RW8B 4R8UB 3DOKB 1TV6B 1O6XA 3G9CA 2CQHA 3TZZA 1NSKL 3SCIE 3VALA 1TKTA 3MXHP 2P9GA 1JLQA 1PBUA 2GCFA 1RWWB 3CC4S 1NK4A 1OWXA 2JL9A 2MHNA 3HLUA 1RAEB 1FI4A 2ZUGA 4PXCA 4XAKA 3ENVA 4CM0A 1BQNB 3QBCA 5F8IA 3PTWA 3QAUA 1TK0A 3UR0A 2OEJA 1N52B 4F2RA 2DPJA 3OTCA 3IRXB 1N48A 3D5MA 5C2CA 1QSLA 4ETXA 2FLPA 3MPUB 3W3SA 3UE2A 2DY1A 2VC1A 3M8QB 2HIQA 3W1YC 4RW7A 2XS5A 3AOBA 4F26A 2RRNA 3PKMA 2C42A 2KT2A 3RBDA 5AE3A 4R5PA 4M63A 2B9WA 3HT3A 1FVQA 2AIRB 1BLUA 2DIVA 3DOLB 3HHLA 4IH6A 3KHHA 4ED4A 1KVIA 1FKPB 2QSFA 5B0CA 2HQFA 4IYQA 4J91A 2VA3A 3HZEA 2YKAA 2WK4A 2F4VF 2ZH4A 4RO0A 4PQUA 1HBNB 4HACA 3MCMA 3SYZA 2QIFA 5CABA 3FNNA 4DL7A 4Z7YA 4RZRA 2ASLA 1OJ4A 1HR0F 2E7WA 2FJAB 5MLCV 3NS6A 4C11A 3V4IB 5GADU 1Z1ZA 1WUUA 3W2WB 4WZQA 1CJUA 3DRRB 3NGDA 3BQ2A 2B6AA 4TY8A 4ES1A 4FP9A 5KFYA 2PA3A 3MM8B 2WTFA 4NRTA 1HNXJ 4JI7F 3DLGA 5AJ3F 2AT1B 3KOAA 3H7HB 2UXDJ 4USMA 1N8RT 3PV8A 3K17A 2HPUA 4OX8A 3DI6B 1E6VB 1IQTA 1SVDA 2DXDA 4AL5A 5HMXA 1T0TV 3KG1A 3CJQA 2FC9A 3OFFA 2JFDA 1WG4A 4KY3A 3ADAC 1RWOB 2EI5A 2R2SA 2J6TA 2HFSA 3TEHB 1RTIA 3PFOA 5B0AA 2LDIA 3OL8A 3D9BA 2YKNB 2C2RA 3EUNA 4DV4F 3OJUA 3RGIA 1DARA 5E3RA 3LP1A 5F0UA 2X7IA 1FX4A 2QT7A 2CADA 1Q53A 1S99A 3LP0A 4YDDB 3C6UA 4I68A 1OSDA 2CPDA 4DR7J 2FTRA 4K5RA 4ZLPA 2L48A 3JTOA 1NDPA 4QW8A 3HKZD 2YWHA 4EBEA 3N6LA 4ED3A 4DF8A 4YN3B 5LL6d 4F36A 1NJYA 4KAIA 1S4FA 4J9RA 2Y1JA 3IS9B 1G4CA 4TQSA 4X4NA 3IRWP 2HZVA 2R7RA 1C1CB 4USKA 3KLFA 2OI2A 3RB3A 3C14A 3VTIA 4ECQA 3JTPA 2KN4A 2E5LJ 1U1RA 4UUXA 2GO9A 1PCAA 1Q82T 4U9RA 1XR7A 4OMFG 2X3DA 5DGAA 4LBHA 2LEAA 1VRQC 1IKXB 1S9GB 3A8KA 1FJCA 4CLUA 2C2ZB 2KKHA 4KJIA 3PW4A 1X9SA 5KG7A 4DR5J 3K5PA 5AE1A 1TKZA 4EO8A 5HLFB 4ZCLA 2CDRB 3BGRA 1H74A 3PJXA 2OPPB 3KNAA 2EVZA 3D6MB 3ET6B 3TAPA 3RBEA 4EU0A 1OPIA 1UETA 3MF5A 2LQJA 2OPQB 5A0YA 4M1KA 4ECYA 2PI5A 1WC4A 1K1QA 1YRXA 4RPFA 1VHIA 3KJQB 3BH6B 3G6YA 4ICLA 1YGYA 5J2QA 1HWKA 2VIHA 3MOZA 1X4HA 2VFRA 1N33F 2YNFA 2AD9A 2EWHA 4DCJB 5BXIA 1REGX 2YPZA 4B3TF 1XN9A 1EX8A 5H9FJ 4P7TA 1L3UA 1ZTWA 1S6QA 2DNNA 1EIYB 2B5JB 2ALYB 2YX7A 3JAMU 3C46A 3SSRA 3UN2A 2BE9B 1ZAWA 5HBMB 3M8RA 3GFYA 4ZP6A 4ZJOA 1UWBA 3AD9C 3N6NA 1A0OB 1U1KA 3RR7A 1HNVB 2R8IA 1TZ0A 2QTWA 4WTYA 2VC0A 3VCDA 1UVKA 2BJ3A 1RT6B 2EKYA 3BKTA 3HKWA 4X65J 2BW2A 3HDSA 2CPJA 1U02A 2VG6A 2LQ8A 4G1QB 5HP1A 2MKCA 1Q8BA 1UA1A 1WKKA 3TVYA 1JK9B 2EC2A 2M5YA 2VPZB 1VQMS 4DR2J 5LMUJ 5FLXU 1FRIA 1HLWA 1T03A 4IQXA 5C25B 1TL1B 2I1RA 2RUGA 2ZNYA 1XNRJ 2HNZA 3OL6A 2JEIA 2E1PA 3CD7A 2EEYA 4PXEA 1WELA 3AXKA 3R3TA 1YJ7A 4LF9J 4U7CA 4MT1A 3U02A 1N32F 1Q16B 3R2CJ 4ZLNA 4ECXA 2AJ2A 2V4RA 2XCAA 2KJVA 4IFYB 4AXJA 4K4UA 4HYKA 2VJUA 1RWXB 1FJGF 2EXUA 4OJGA 1N34J 2NSBA 1FWLA 4B9NA 3N5BA 2OTJS 1K47A 3F73A 3SEOA 3EXYA 3JQMA 3MWBA 4ZLLA 3I9ZA 1IKVB 2BQ3A 4LBIA 5CHCB 1KTQA 1LQ9A 3EVOA 2H5IB 3OFHA 2E1AA 3KNGA 2QFIA 5EWFA 5L8RC 2GZOA 1J5OB 1NK5A 4B3SJ 2QJ3A 3TP2A 1VQ7S 1C0UB 2F7VA 3KK2A 4O4GA 2R8JA 2JLEA 2GO8A 3DLEB 1RT3A 4M5IA 4PUOA 2WW4A 3I55S 1RA6A 3MURP 4DX7A 3C6TB 5BYQA 1ZM2A 4ED5A 3DLKA 1NKCA 1QSYA 2GIQA 4NZ6A 2ABYA 2YQ1A 4JI0J 3CD6S 3OTOF 2FDNA 1NDLA 2W9AA 1HW8A 3RBZA 1JLCB 4F3QA 3M2VB 3EDQB 4JI6F 1CEZA 2DR6A 5D0HA 1DY3A 4OI1A 2BANB 2HRUA 4AYBD 3DXBA 2CNOB 5IT0A 2DR7A 5A6PA 2GAGC 1RTDA 5G0RA 4ZDNA 5M2PA 3CJ5A 2UXBF 4CIOA 1QTNB 1FEEA 1KQGB 4FXWA 4NYOA 2B4PA 1S1VA 3PYEA 1H2VZ 2YNHA 4KHRA 4QBUA 2WB4A 3BBFA 3MMCB 3HXMA 1TTHB 2MZ1A 2GGPB 2LQBA 2GJFA 1CQMA 2DNLA 3MMBA 3MR7A 3G6ES 4KV8B 2DNPA 1SI9A 5DDQC 1D9DA 3S01A 1TL7B 3R6GB 2MY7A 4CTAA 4CO2A 3MAAB 4NLWA 2MQLA 3ISNC 2HW3A 4WE1B 3KDNA 4DU8A 3B82A 5KFPA 2H54B 2ZH9A 1ITPA 2FJBB 3JTNA 2D9PA 2EFVA 3KLGB 3ZZYA 1SQGA 2NXNA 4ECSA 2VFUA 3QT6A 3RBXA 1C4AA 3TQEA 4B9SA 4ETZA 3C8YA 1NK8A 3AY0A 4UW2A 4MYTA 2ROEA 4B3RJ 2DT9A 1XIQA 2MZSA 2ZNZA 4O23A 2Z4PA 3EWGA 1T9YA 4KO0A 1MWQA 2L9NA 1VBXA 3QQCD 4HTJA 5B0DA 2BE2A 3EZUA 3MECB 2ROPA 4OHZA 1WOPA 3T5JA 3LW5C 2KXHA 1YLXA 3QMQA 4DSKA 2Q3PA 3CJKA 4B9VA 4K4ZA 1NU4A 1D3WA 4H4OA 3KK3B 4HHHA 5DZ7A 3BS9A 4JI1F 1WEZA 4WP3A 5J2MB 3TZYA 4PQUB 2ZDPA 4PR6A 2P9CA 4DPTA 1FFGB 2BM1A 4JI2F 2LXFA 5GAGU 1LWCB 1XR5A 3MD1A 5EHHA 4KGXB 3UO0A 4A47A 2CKWA 2FIUA 4QR1A 2HHXA 4C11B 2ZZMA 1FFSB 3PVXA 1IXKA 5F8MA 2JRSA 3KK1B 2F9DA 1NK7A 5CYQB 1W2BR 1V3ZA 1UTAA 2CG4A 2RRAA 2PIIA 3CVKA 2N82B 1U2RA 5IT9U 2WSFC 4JI4F 3EGZA 4NLVA 3HHDA 4LRBA 3HSGA 1TKXA 3DLGB 2BBEA 2HK2A 4KGZB 3OLBA 3QT8A 5IZHA 2MXYA 2XYPB 2OJ3A 2HURA 5KFSA 3T9ZA 3I5CA 2GS8A 4DV0F 3BV8A 2H5JB 3NNAA 3W63A 3OTBA 2KH9A 2LKZA 3QSIA 1IBCB 1VQ6S 2V2QA 4D3GA 3OUYB 3PNIA 3KLVA 1KLMA 5K14B 4X84A 1U8WA 3R5DA 2V8GA 2V63A 1WOOA 2ILZA 1FDAA 1RK8A 3H20A 2HQDA 4U95A 4CLYA 1VC0A 3VAGA 4K4WA 4DR1J 3U1NA 4JP8A 2XB2D 1JKHA 2DBBA 4CH7A 1JQGA 5GAHI 4DV7J 4W4MA 2IPOB 3PW5A 2RS8A 1HNZJ 1AA1B 1WHYA 2QEXS 3WHIA 2HGNA 2CG8A 1VDHA 4RBVA 3RB4A 5H9FK 1WG5A 4Y00A 5KFHA 2O1PA 2CQIA 4X62F 3SCLE 1J2VA 5LOQA 2KZZA 3K5OA 1T7PA 4GVLA 1EJ7L 1R8AA 4Y2IA 1U45A 2I6WA 5KG3A 4OQJA 4LF4F 4Q2LA 2JHEA 3MUMP 3QO9A 4NEZA 3RRGA 1YSJA 1L3SA 1SUQB 1WSRA 2V8VA 1VQ4S 3G8SA 2ZOMA 2ZDOA 1PYOB 2OHDA 1JXVA 4DDFA 3PKYA 2HNYB 2RUSA 1N6QB 3O3LA 2AW0A 5H9EJ 4FF1A 4CNYA 4DG1B 3MM7B 3TAMB 3ENAA 5GAEI 2ZFHA 2OKQA 3CEDA 4DWIA 3D68A 3CCUS 4PWDA 2ZBRA 3T9NA 6FD1A 3SSQA 4O3SA 5BYSA 1REVB 4JI8F 2G13A 3C16B 2C2EA 1JLFA 2OPSA 4IOAQ 2XMAA 3US5A 4NLSA 2KYXA 4ILMA 1QDUB 2XG8A 1Y3KA 1HPZA 4KR0B 1MROA 4YR3A 3LTOA 1NSQA 2VJVA 2UXCJ 5CYMB 5B0EA 1FTCA 1X4GA 5DJBA 2FHJD 4C7QA 3GP9A 4GVBB 1N56A 1AXQA 1BHNA 1RWUA 3KLHB 2Z2LA 5D8HB 3P49B 1AROP 1YJTA 3QLHA 4PXBA 5RUBA 1HD0A 1EETB 2ZH6A 3VQTA 3OR1A 2MMYA 1NHVA 4N5SA 1YBAA 5KFLA 3LH2S 2EFQA 3PDNA 1DQ9A 3PYFA 3GMGA 2XWXA 2E66A 2MKJA 4UUWA 2OTLS 1SB6A 1YJRA 4MIAA 2L9DA 2IMOA 3RAXA 1FX2A 2YWGA 1UFKA 1WD6A 3NNHA 4OL8A 9ATCB 3FEYB 1KBRA 2KRBA 2XMTA 1FWPA 3CCRS 1O0PA 3DDIA 3MEEA 1VQ5S 2BUNA 2ZBQA 5IXUA 2HVDA 4ENOA 5ETRA 2CXEA 3M32B 4Z2XA 2VPYB 3QRRA 2GQ2A 4J9UE 2DNHA 2POKA 2IM1A 2XC9A 1PAEX 2KVIA 3AQPA 2HGMA 2E29A 4EYIB 3Q83A 2J6SA 4MK8A 3HF5A 1S49A 4K2XA 1F1BB 1OPZA 2PEHA 3TR5A 2XS2A 4HT7A 1KHWA 4ZVUB 2ZEJA 3T5KA 4MIWA 1IKWB 3GPAA 1D9AA 2XGQA 2C3UA 2J8SA 3QNWB 4C97A 3CCMS 2GW8A 3M8SA 4PCQA 4USJC 2FGOA 3T41A 1IKYA 3ETOA 5HQMA 4KB7A 1GTEA 3I6PA 1JMTA 4DV6J 4Y3CA 5KAKA 1QUPA 5GMEA 3D54A 5LMNF 4KYZA 4ZMMA 4NI2A 4I6WA 2C2OB 2YPYA 5KFFA 3GYGA 4ZLJA 2DGOA 1YG0A 4ZOSA 4OZJA 2W7PA 3B8HA 2HS0A 3CCTA 2OLWA 3NS5A 3G86A 1IR2A 4WP9A 2FLLA 1CS4B 4IG0A 2ASJA 1ZM4A 1U4BA 1RKIA 2G1HA 2CJAA 1SIWB 1KHVA 3OW2R 4PG6A 1RKJA 1NJZA 1S57A 4QR2A 5A8RB 1Q8LA 4PYAA 2W2OP 1S0OA 3VHQA 1OYDA 2XNQA 1RT2B 2CA9A 4K4XA 2IBOA 1X0PA 2CQ0A 2D3O1 1MMDA 2XSJB 3EVWA 3JSMB 2VF3A 2BJ9A 2RKIA 4F4WA 4LR7A 4Z7CA 1SC1B 3N28A 5HAOA 1EP4B 3IGVA 2X1AA 2XMWA 5H1SV 4WFBQ 2IM3A 3KLEA 1U49A 2XY6A 2HQCA 4PEOA 1FRLA 2WAQD 3VGUA 2M8DB 3CD5A 5D6GA 3KHGA 8ATCB 2JLFA 4FF4A 3NY0A 3HK2A 2CIMA 4CT8A 2BV3A 3UDVA 3HHEA 3G4SS 1VLOA 1YKWA 5CH7B 1HARA 1C4CA 2H9ZA 4CP5A 2YQ0A 5DETA 2CQCA 2Q79A 3V5RA 2I9SA 4KTQA 1GTHA 1E6YB 4HH1A 1VRUA 2VFSA 1RWMB 2B7CB 1GX6A 5IOLA 2U1AA 2ZHOA 5K8MA 2B4UA 2ALZA 4U7UK 3MM5A 4OYXA 1IQZA 5E2QA 1RJJA 1UVMA 3SSSA 3HHLC 4GC7A 1M1HA 2J9DE 1B3TA 3TVZA 3PM9A 1S79A 4WFXA 3PZPA 1OSCA 1L3TA 3POTA 3ZXWA 3DGVA 2HAIA 4ED8A 4ZIVA 2QL5B 2W4DA 1TAUA 1JJHA 3OVAA 4ILRA 2MJNA 2BKPA 3S8SA 2MHEA 5ETPA 3VAIA 1S76D 1U1OA 4J5OA 2VDIA 2NPFA 4P52A 4C8LA 2DNZA 5IWAJ 1SKUB 2FHMA 1HNWJ 3WZ0A 3BN7A 1UWAA 2YX4A 2F4VJ 1ZM3A 1BD6A 3CJKB 3BJYA 3UWTA 3M6XA 3L09A 3ZFVA 2MZRA 1HNXF 1CJKA 5HJYA 2MKKA 2DGQA 5L9NA 4FNIA 1M5PC 1VRTA 2UXDF 3D3CJ 1MU2B 1R8BA 3M05A 1YBTA 9RUBA 1NEEA 2DEIA 4Q44A 1RTJB 2CFXA 4F0MA 1VLYA 3M6VA 3LQVA 1U1PA 5MAOA 4JI7J 1FKAF 5AJ3J 4RW4A 1RT5B 2MKSA 4AL6A 2JDJA 2XLKA 1CULA 4JV0A 5H9EK 2AJFE 1DQAA 3VGVA 4FVMA 3CXCR 2P8IA 1RT1A 4L73A 3NGRA 4KGKA 1PSDA 2ZOGA 1QJHA 2MQQA 4DR7F 4OI2A 4BC9A 4ZHRB 3R8YA 3B78A 2OIHA 4DV4J 3UVJB 4G6VB 1XEZA 3GB0A 3JB9k 5F8NA 2W9CA 5AXNA 4X64J 1Q7YT 2H51B 3CPWR 3R7BB 1RISA 2Z2YB 1JKHB 5KFCA 3DXSX 2V2KA 3CC7S 3QIDA 2G0CA 2E5LF 1N5YB 5DDPC 1FFWB 4ERDA 4PG8A 4MJKA 5CCLA 4Q8EA 2JH3A 2YNIA 2LP4A 2VBZA 1MN9A 2HEKA 4EEYA 2MGZA 1HIYA 4ZPCA 3HVTB 1B64A 3HCXA 3CJ8A 1F3FA 1BWEA 1R89A 2CJBA 4AUKA 1R0CB 4DR5F 1LWEA 2DGSA 1PJ7A 2IHR1 3TA0A 2HRYA 1CSJA 3M30A 4ECVA 2R7TA 5ETKA 3D4JA 1H73A 1TQLA 3OR2A 4USTA 4M5DB 4NLOA 5I42A 1HHSA 3KWMA 3ULHA 3UCUP 1RTZA 2UUWA 4K50A 4C98A 4NPOA 3FBCA 3A8JA 4C8YA 2GHWA 2VZ9A 1IM6A 5DG7A 3AQOA 4MKYA 3DGPA 5HJXA 3ILLA 3EM1A 4ANDA 2DGXA 1RHUB 3BSAA 2VHGA 5D4NA 2M8HA 1V5IB 4ZVFA 1RTHA 5D78A 3J7ZT 2OPSB 4CLSA 2FHJA 1S9EA 5IQQA 5A8WB 1Z4UA 3N79A 3AJDA 2Z2ZA 1NXIA 1FDNA 2LDYA 4OIXA 4N56A 2RIJA 3D3BJ 2GMLA 2ZUAA 4LF8F 3AB4B 3NCRA 4Q43A 2GAHC 4O3QA 1ZAXA 1HYSA 3EZOA 3OTEA 5ETTA 4LJMA 3ZZTA 4X65F 3VWSA 3QLHB 4PG5A 1SH2A 4UTGA 4FKXA 1HI1A 2IJRA 4CLFA 1D9FA 3VQSA 3MAHA 4DR2F 4MK9A 4NZ7A 3FEXB 4EUVA 5LMUF 3V6KA 4AL7A 1PJ6A 3ZTQA 3RR8A 3DHWC 1RCXB 1XNRF 1P9QC 4OYOA 1QY7A 1IM4A 4ZVPB 3DC2A 2XLJA 4HI1A 3KMSA 3SV4A 4LF9F 2YKMB 2KI2A 4WZMA 3HPOA 4HDHA 3TX8A 1JIHA 4IH5A 1PJ5A 3CJ4A 4ZPTR 1PBAA 3CDEA 2BOPA 2E5GA 3DRYA 5F9NA 3A8IA 3A3PB 1HBOB 2ADCA 2K8GA 1N34F 2RRBA 3I87A 2FVSA 2NYHA 2N7CA 1RYSA 1TUVA 2ZITA 4ID5A 1X8DA 2QC3A 2HQIA 3N5FA 3M1VA 4RU2A 5GMDA 4WWSA 1OS5A 3OVBA 5A6WA 4RNNA 1VK8A 3I5BA 3FCWA 3GYXB 3DMJA 3DLJA 1D1UA 1FTRA 4LRAA 4L72B 2VOOA 4Q2MA 2HNDA 4RW9B 3BO4A 3RB6A 4QWEA 2PE8A 2J0XA 4ZPBA 2J7UA 2HVIA 2L41A 4OZNA 3TJ8A 1S9FA 2IRUA 4MYUA 4LSLA 1M5KC 4I1TA 1XMOF 1M1GA 3GU0A 4ZPAA 1XK8A 5F41A 2VQEJ 5J1EB 1Y00A 3I0RA 3MPWA 2B51A 4ID8A 2AJQA 2C3PA 3BKFA 4LF2A 4JI0F 3KG0A 4RKUC 2P2CB 2PSZA 3GFXA 1ZZFA 1P6TA 3W5ZA 1RAGB 4CI0B 1ZH5A 1F6TA 1N36J 1TL5A 1TK5A 2OFGX 3K2YA 3I82A 3D2WA 4ES2A 4NWBA 4UT4A 1KS2A 2K7JA 1NK9A 4QIGA 3A4TA 4X66J 2ZBIA 5HQ8A 1X7VA 3CDUA 4M5GA 5LM7E 1WC5A 4I4BA 2ZM6J 3E3XA 2RVJA 3VGSA 1YX2A 2OUGA 4RW8A 3U7JA 4R8UA 3W9HA 1HQEA 3DOKA 1TV6A 2D41A 3NCPA 1FK9B 5L1IA 1BMQB 4EFAC 4CO3A 1UPPA 2OD4A 2VA2A 1SL1A 3LAMA 2DXFA 3OVSA 1URNA 2R7QA 4M5KA 2D3OR 3I96A 1U0SA 2UVWA 2CRLA 3U1MA 5CD4A 3HVWA 4A8KA 4DN0A 1BQNA 5EUHA 1XJWB 1R31A 1NPKA 3M7VA 1HWUA 4RUCA 4QWDA 2L08A 2VU5A 2LXIA 1VS3A 4DX5A 4OX9J 4CT9A 2F4FA 2LYVA 2VG5B 3GE9A 1Q8KA 4DX8H 4F4XA 3M8QA 1RACB 2DH7A 1ZOTA 3B4MA 4B3RF 2ZBPA 5KT5A 4IRCA 1FE0A 3CO0P 3RJMB 4J9MA 3OFEA 2XLIA 1UW4A 2UV8G 5F3ZA 1X5PA 1SC4B 2ASDA 1Q1KA 3OXLA 4YMEA 3DOLA 5T7LB 3G6XA 3DM2A 4FZVA 4JB8B 4KKOB 3BGOP 1FKPA 3D1OA 2XMJA 2QLBB 4NCAA 1WDDA 4X4UA 5E3CA 1KVKA 3Q89A 1WHXA 1HBNA 3KXDA 3UD3P 2U2FA 3AOCA 2KL8A 3KUEA 1BY9A 5B0FA 3MR2A 3UNGC 4XK8C 3BDPA 3FZBA 3BYRA 2VV5A 3V4IA 4EBDA 1O51A 2AZ3A 5ETQA 4C6AA 4KH0B 3W2WA 2XULA 3BREA 4G3IA 3DRRA 4OZ0A 2YVSA 3CO9A 3PXGa 3ZTRA 1YDLA 4BDPA 3GV5B 4Y65A 4UZBA 2PN6A 4J9OA 3MM8A 2NZ4A 1VFJA 1K0VA 4JI1J 3VAHA 2WBRA 4P71A 2AWZA 4LF5J 5I3QA 4LF1A 3DI6A 3IR6B 1E6VA 1Q7LB 4CLWA 4C8OA 5BYRA 3HP6A 3GCWP 5KFZA 3H59A 4IH7A 4IO9Q 1B7YB 1HWIA 2VBXA 5K20B 4FN5A 4HH0A 1TR0A 4CO5A 3R1HA 2KZMA 1G6BA 4YP3A 3OSNA 3TZWA 3EZ5A 2CYYA 3SCKE 2RQ4A 2YKNA 4IRKA 3JQJA 3NOCA 2R8KA 5LSOA 3AA9A 3F41A 4JI4J 3CNQP 4BS2A 5LSRA 5F8LA 1VGYA 4DUYJ 2FQQB 5HQLA 3HO1A 4USVA 3DRXA 2B43A 3P6YC 2CQ4A 2CQDA 4H4KC 1KFDA 5KFQA 4DHVA 1H3DA 1RWNB 1TK8A 4DV7F 5K8NA 3UN3A 2HYIB 2ZE2B 2JX2A 3T1YJ 1LXJA 4ES3A 3PW2A 1LWFB 5ETSA 4U8YA 4XO0A 2NS1B 4F4ZA 2NSCA 4P72A 1ZA2B 4DPYA 1YJUA 4EZ6A 3IS9A 2JFKA 3CMES 4NEYA 4WXOA 1C1CA 2QA4G 4RNOA 5GAGI 4ELVA 1DLOB 2WSEC 3ILOA 2IA0A 2ZH7A 4A46A 1RBAA 4C0HA 4J9KA 1GQEA 1UEKA 3DYAA 1NBEB 3CMAS 2Q6BA 3ILIA 2DJWA 1OQ6A 2R2RA 1LK7A 3AFGA 4DR4F 4F2SA 1NLKL 4X62J 2EFNA 4CLKA 1YI2S 3D0HE 1N5QA 3HMJG 5KFBA 4KPCA 4K0KF 2ZJPQ 1IKXA 1S9GA 3V6HA 2RILA 1LW0A 4DZDA 1DRZA 3SMZA 2V4QA 3PFEA 1Y10A 5HLFA 2NREA 4WJBA 4DPUA 5HVHA 3BN4A 3THTA 5EDWA 2OPPA 2BE7D 2DGTA 3ET6A 1ZPVA 2BM0A 1KFSA 2OPQA 3W5XA 3GONA 1NH7A 2VBWA 3EGVA 3M30B 4I64A 2HBZB 5IQ6A 3G87A 2QLXA 3C3LA 1YZ7A 3CCSS 1QUVA 2UXCF 2HHPA 2HSEB 1RAHB 2UUTA 3UDEA 4UY8T 3TARA 3H98A 4NASA 3OL7A 3NRBA 2KFYA 2PFDA 1SKWA 1NMEB 3MCSA 3WIUA 5HBMA 3LGNA 5ITHA 4HDGA 3MOJB 2ZVSA 1H72C 1RWPB 3LP2A 2FZCB 3G82B 5KFOA 1AYEA 2N7YA 3NKYA 2W4CA 1RHMB 1Q81T 2XWYA 3CWJA 2QMUB 1R0AB 1SQEA 1RT6A 5DQGA 3GYNA 3EJMA 2NXEA 5ETNA 4BC7A 4F04B 3IXQA 2BJ7A 3C66A 3W9IA 4CWBA 1NH8A 2ERRA 4LF7F 2BVZA 4G1QA 3TWZA 2ZWPA 1LEOA 4FF2A 1FXDA 4GKJJ 2J8AA 1S0MA 3M8PB 3PR4A 1NCLA 3J7YU 4I7FB 3WX4A 4I2PB 4X4VA 1TELA 2R7VA 5KFDA 4P73A 4P6QA 1VOMA 4ZVGA 2CDQA 3G6VA 3MCNA 2A1BA 1SJQA 2GHVC 2J0SD 5J2PB 1LKZA 4OHWA 4BLGA 3CDWA 3QJPA 3J80Y 1W7WA 1SQFA 3MMAB 4IFYA 2AX1A 1MLAA 4OYIA 2IVFB 2FUG9 4DUTA 2F65A 4Y2AA 1XMQJ 3Q8VA 1OYEA 1S6UA 1UVIA 5DO2A 5E7OB 2YBVA 5JJBA 1YHQS 1U1NA 4PKDB 5IV3A 2B0GA 5L38A 3OHBA 4X2BA 1R43A 4C4WA 5KFIA 2IA6A 1IKVA 4NL5A 1H2TZ 2KHDA 4ZVRB 4V19J 4A8MP 3W8GA 4ID5B 2Y1LB 3AD7C 5KFAA 1SKRA 3V2UC 4NA3A 1R8HA 3M1VB 4QCLA 1NM2A 2F8MA 4C0OC 2BEFA 2A6OA 1J5OA 1HBMB 1RA7A 1L5UA 2DCLA 4OZ5A 1TU0B 3RRHA 4AD6A 2M88A 5DGBA 3IR7B 3BEGB 2GVZB 5KOXA 4N77A 5A8KB 3DLEA 4MKAA 3M9OB 1K9MT 2PT0A 2AZ1A 3MHYA 1N54B 4ZK7M 3GSIA 3D0GE 2NLWA 5L1JA 3NGUA 5LMNJ 4TYBA 4X4OA 3C6TA 3E2EA 2NZCA 5HSPA 5GMKa 3J7AN 2F5GA 4KBIA 3NOGA 3THPA 5CD4H 2M70A 1JLCA 3M2VA 2FJEB 1NDKA 1NZAA 4AQYF 5ETMA 1KTVA 2RD5C 2GQQA 1RGVA 2BANA 4OI6A 5G4DA 3M9NB 1D09B 2V34A 1XERA 4W98A 2IY5B 2HFNA 1Y4ZB 3GG0A 1WC3A 3DFEA 4P9SA 2HHWA 3FBBA 1KONA 4FS2A 4V1Ak 3OPKA 2C2MB 1FO1A 1UCNA 3FJ2A 1R3NA 5HL7Q 1PC5A 2V4JB 3LGHA 4TNOA 3SIPB 1HQEB 1PILA 3R9LA 4KV8A 1FCAA 4K4TA 3P45B 2XMVA 2V8DA 3FUYA 2NR0A 1TL7A 4M5HA 3MMJA 1N0UA 1Q5YA 1Y3JA 2XEXA 3BH7B 3MAAA 4WE1A 2IM2A 5KFKA 3PHEA 2OO4A 2HQ3A 3CCES 3PW7A 1WC0A 3IM9A 3AB2B 3KLGA 2CJYB 1RBOB 2O01C 1KNZA 2J0QD 3A1YG 3I9V9 3FRYA 3PACA 1RB0A 5AT1B 2G1DA 4BHQA 3TO8A 3FEZA 4B9LA 2VICA 1H7WA 2AEJA 3L7OA 3R5JB 4U6PA 3ISZA 2AP6A 1RI7A 2G0IA 3NLCA 1QE1B 2KRRA 2MQ8A 4CYUB 5ADZA 1NJXA 4RUAA 3MECA 3KFWX 3GIIA 1UFWA 1MMLA 5D15A 3NGSA 3RU0A 3F0NA 3DM2B 3D66A 2WVEA 5B08A 3KK3A 4F4YA 5L39A 3PO4A 3TOQA 5F3TA 4RLEA 2L9WA 4IUFA 2DCUB 5IWAF 3GTYX 2FY8A 4OX6A 2Y0BB 1VQLS 1HNWF 3CJTA 5J2MA 2DVIA 5F9LA 2NXUA 4LIRA 3OTDA 2XTJP 1ROFA 2QG9B 4IG3B 3CCLS 1JLAA 4FYVB 1FRMA 3Q8YA 3ZZUA 1LWCA 4FBUA 4FYYB 1HD1A 3O2IA 2V0NA 3UI3A 3D6FB 3TJ9A 3HULA 3AH6A 3RW6A 4HHJA 3KK1A 4TN2A 5CYQA 3JSYA 2R4FA 5T14A 2XZWA 2QZ8A 2ZH1A 1VQNS 4TU7A 2E1MC 1VQKS 1TL4A 1B99A 2RMLA 5KFUA 2XHWA 4PABA 2DPIA 2IC3B 5IM0B 2NUUG 3QSYB 1LOUA 5SUHA 4FYXB 5B0BA 4ECTA 3KKFA 5ETLA 5EGYA 4A8WA 3OUYA 4ZA1A 3UPFA 5K14A 3BGLA 4G1IA 3ZTPA 5C7PA 2RDJA 1WNEA 5LJ5Y 3NMRA 1U24A 1TAQA 1QLNA 2KYZA 3P96A 3HJFA 4IO1A 4O3PA 2MQPA 1LW2A 1YBUA 4HL9A 4QYZJ 4PZVA 2Z56B 1HKAA 4X64F 2HVHA 4A8QA 3V6DB 3PX0A 5D3GB 3M2RB 1EKSA 2O5DA 2QV6A 1R6VA 2LECA 3WX8A 4W90B 3T6JA 3PRDA 3BQ1A 3SQGB 2FVPA 1WJ9A 5D77A 5J1PA 3QIPB 3WIVA 3J81Y 2C2DA 4OJ1A 4WKYA 4ED2A 1U6ZA 4IRDA 2FJXA 5EN1A 4DPOA 1ZTTA 1SUQA 4LR8A 3G96A 3OT9A 5DG8A 1U26A 1HBUB 4LVNP 2ZC4A 3DYAB 2LCWA 4NLDA 4YR2A 2HNYA 1N6QA 2HAFA 3H0PA 2PDAA 3QJJA 3E8OA 1EQ0A 4IR1A 2N3LA 4DOZA 3E51A 1FDBA 1F9HA 2IRYA 4DG1A 2XHCA 3MM7A 3TAMA 2Q43A 4A8XA 2GHPA 2CQ3A 1J27A 1NPPA 3QFWA 3DRSB 5DRKA 4DCPB 3NL0A 3CTRA 4LF6J 3LPEA 1F60B 4P10A 2DD8S 3H4DA 1SV5B 3SQOP 1CQNA 1LW0B 1REVA 4B9TA 2R7XA 3C16A 1HNIB 1HFEL 4OLOA 4PG4A 3IBCB 3TA2A 4O0IA 1I94F 3D6HB 1V3SA 1TL3B 2ZBCA 2VOPA 2I38A 3D67A 1Q4RA 2R7OA 3O44A 3M9MB 3HD1A 2DTJA 1H0HB 3MCOA 2DB1A 5L9XA 3W7BA 4MH8A 3Q8QB 5CYMA 3CJ2A 1RU2A 4G1PA 5B0GA 4GVBA 1FKOB 1VQPS 3KLHA 4PAAA 2FPHX 1SJFA 2LEBA 2R8GA 3W62A 5JVGQ 1EETA 1PC4A 5L1KA 2F8HA 1T9VA 4IR9A 3U27A 3GILA 4DFKA 2R7WA 2OPRB 2CJKA 2RAQA 3H4BA 2VODA 4YB7A 2J7WA 1R7IA 3T1HJ 3B54A 3W65A 3F56A 2ASYA 4LF8J 3LP2B 1Y0HA 2DK2A 3ZNJ1 1JXEA 1FD8A 2I5JB 1QVGR 2DKOB 4O0NA 3D6TB 3M2UB 2B4VA 1OMSA 2AMCB 4DR3J 1LK5A 3DHXA 3GV7B 2R3VA 4B08A 1WEYA 5CQGA 3TRGA 2IDLA 1X4FA 4P2FA 3M32A 4N76A 2J9DA 2RF2B 1VHFA 2OFHX 2V6AA 2JWNA 2K2PA 2LU1A 2B9XA 2DRAA 3GJSB 1MWYA 5F8HA 5E3QA 2W2PP 4PRFA 3GR1A 4B3OB 4OFZA 4MKVA 3H2VE 2AEFA 2DNMA 2OELA 3UR3C 2JNJA 4QQBA 1IKWA 3LO3A 1KRPA 3I56S 4NCGB 1S77D 1UMJA 4M5JA 3G8QA 4C3MA 3NBPB 2G4BA 4OI3A 1U7LA 4GMKA 3WC2A 2HFUA 1UW9A 2R9LA 5K5MA 1Z2LA 1SJ1A 4UZCA 4KPYA 4NYPA 3GJQB 2ILYA 5K8PA 2OD6A 1HMVB 5L46A 2K3KA 4DFJA 2CZVC 2Y1RI 1M5OC 2LU2A 3WBZA 1RQ0A 5ETVA 4TU8A 1S1UB 1YZ6A 1S1XB 3IO1A 1UFLA 4RL1A 3VAJA 4P75A 1GNKA 2QL9B 2AQ4A 2VQEF 1FNOA 2XM3A 1BQXA 3EPGA 2CUYA 3I4PA 5A2QU 2AX0A 3VV2B 3CUNA 4OJHA 1CS4A 4DUZJ 2A6MA 4J7CA 2EC0A 2ZH3A 1N36F 1RP5A 5GAEU 4K4SA 3CCWA 4OI0A 1N5TA 5LJ3Y 1VQ8S 1XMOJ 4DV2J 2QFJA 1JJ4A 2Z8QA 2HMIB 4X66F 1K1SA 1T94A 5A8RA 4WXWA 4C8KA 4C8MA 1T11A 5KG6A 1ZPWX 4DLGA 4QW9A 4DL6A 3BR8A 4DX6A 3MR6A 2ZM6F 3BYPA 1RT2A 5IC4B 2K1RB 4HLBA 5KFRA 4Q0BB 2AYBA 2BJ8A 1IBLJ 2XSJA 3JSMA 2V67A 2AJ1A 3BKUA 3DCAA 3GV8B 2E1CA 3M6WA 1XBWA 2K06A 4I2QA 1EP4A 1CJTA 1M5VC 4JV5J 1BUXA 2ZJRQ 1OY8A 2WONB 4F50A 1HHTP 4DSIA 4Q7AA 5K9FA 3ZO7A 1KLNA 4OV6A 4OX9F 3FSIA 2HVEA 5AXLA 3LWMA 2HLUA 4E98A 1IR1A 3GJRB 4WCEQ 4P7VA 4HR2A 3I0SB 4DPWA 4OLPA 2RQCA 4IOCQ 2V8HA 4YQWA 2ZHAA 4OYZA 2QYCA 3MD3A 4IDKA 2Y9HA 4O4RA 1E6YA 2J7KA 1U0HA 3QJLA 2QE5A 2HHVA 3DRPB 1KQSR 4GO7X 4IFVB 2JEJA 4YEAA 1S6PB 5DS7A 5LSLA 2DY9A 1S48A 3PRBA 4BBYA 4DZ6A 2IAJB 3ZC4A 1TKDA 1QSSA 5EX0A 2OMLA 1T3NA 3LA0A 3JXOA 4QZVB 2LA6A 3IM8A 2KM8B 5AE2A 2FVRA 4RWWA 2DNGA 2M3DA 4QYZK 2CPZA 3GIJA 3NCQA 3BB5A 1X9MA 4YS2A 2XMUA 1U2FA 3P8BB 4ELTA 3BSNA 2EG2A 1SL2A 3ZTOA 2PA8D 2GC8A 1NDCA 1FHTA 4LF5F 2OH2A 5FD1A 2P6SA 1MU2A 1JLAB 2MJUA 4Y28C 3HT0A 2IVYA 3NWRA 2BRLA 1SJ3P 2HBQB 4F0KA 1Q8IA 4O3RA 5FJ4A 1FXRA 1JNZB 3EGNA 2H48B 3H5UA 2V8PA 1RTJA 6AT1B 3PJWA 4JI5J 1UPMB 3QZ8A 1K8AT 1Y9OA 3MPVA 4R0EA 2NCKL 2VKRA 4QU6A 1RT5A 3DU6A 5IV4A 4ZPVR 4F4AA 4J9SA 3KYLA 3FKBA 3K5MA 2MQMA 4DUYF 5D0EA 2NQPA 1YK9A 3C15B 1IR0A 4K5SA 1TVRA 3BR9A 2KG1A 2W01A 5DZ6A 2XMKA 5F8GA 4NE9C 3OLAA 3T1YF 4XPEA 4K4YA 5JMNA 1UVJA 4HVZA 4ZHRA 3JSBA 4TY9A 3UVJA 3GIRA 4ZIWA 1C1BB 4AFFA 3JYTB 1H7XA 3JAMY 1LW2B 4H4KA 1EZZB 2CZ9A 4C3KA 2BZ2A 5D4LA 1GXUA 2UUBJ 2E7XA 1LWXA 1N5YA 1M90T 3MPDA 1FA0A 1AB8A 1EB0A 2JVOA 1UJ4A 2M9KA 2QA2A 4OYPA 4LQ3A 5HATA 3FBFA 3HVTA 3R1LA 3MM6B 2O67A 4FKYA 4TVAB 1X4AA 3K8WA 3IWNC 1ICEB 2QMXA 2N4CA 4C3LA 2R42A 5FLXY 2AF6A 2HZCA 4E0DA 1HA1A 5CYJA 1I6JA 4DR4J 2DNOA 1FRXA 3M8ZA 3EGWB 1P1LA 4M5DA 2D74B 2Z57B 3AOAA 1S97A 4K0KJ 3MEDB 2M0GB 2UUCF 3C19A 1CVJA 1AUSL 1RT4B 2JVRA 3CCVS 1S0NA 3ILJA 2HHTA 2A2DA 1S72S 1TUWA 4WFAQ 2DNKA 2E9TA 4NA2A 5E3PA 1TFYA 3AT1B 2FHOB 2KJWA 3MR5A 4RNMA 4EYHB 2RSQA 3GFZA 1IJEB 5A8WA 2FVQA 1ZZNA 1RWVB 3MM9B 1BE4A 4A8OA 3TEGA 1AZSB 1IVZA 1BXNA 4KSEB 1MW7A 2DHXA 5DQHA 1U25A 3W2VB 4RBTA 1R0BG 5DLFA 1V5VA 2Y1IA 2HWIA 3A3OB 5C24A 3L9ZA 4EMDA 2F3JA 2W2MP 2XZDB 1NJIT 2JC0A 3NG8A 5A2QY 3QYYA 3R7NB 5HROA 4KT0C 3H25A 3AJ1A 8RUCA 4L3KA 2VD3A 4GKJF 1YJ9S 1DTTB 5M2RA 5CZVA 1RSCA 4QU7A 4U67Q 2YNGA 4ZP7A 1TMMA 3I5AA 2FHKA 3MEKA 3CIZA 3VF0B 3Q23A 2DXEA 4E2FB 1FWKA 1J5EJ 1JLEA 2YKMA 4LF7J 1I3OB 2W2NP 4CLZA 2WVDA 5J2NA 1S1WB 2H3EB 2MQOA 3KG4A 2BR0A 1KD1T 2AEMA 4MFBB 1JJ2R 3ZZRA 1X9WA 4WYLA 1XMQF 2P5VA 1PGZA 2BRKA 1B0VA 2VG7B 3Q8PB 3ENWA 5KT3A 1HBOA 1WKLA 2A2CA 4O44B 3DLHA 4Y2MA 2WOMB 2HS4A 3Q8SB 1D8ZA 1CC8A 1WACA 3WC0A 4P2MA 1BQMA 4QIWD 1WC1A 1B70B 2WVCA 2CQBA 4K2JA 3R6LB 2VDHA 2RJZA 3PYDA 4DPXA 3IN5A 3EE3A 4Y2CA 4N47A 1IBKJ 2EG1A 4F02A 1QM9A 1DHMA 3RAQA 2PI4A 1ZYQA 1VQYA 4RW9A 2CJXB 4TU9A 1W26A 2LVWA 4DR6J 3FZ2A 2FJWA 2KFZA 2M4MA 1RU1A 5HVGA 1T05B 1VIXA 4PG7A 3TVKA 3H5SA 2B8PA 1N4LA 4HHUA 5F8JA 4C0BA 4LR9A 1FD2A 2HHHF 4UOCA 1YJWS 1VC5A 4TLQA 5J1EA 4HEA9 4FF3A 3QT5A 5KFEA 1W25A 3J7YI 3K5LA 2AHOB 4A4JA 3V81B 1YITS 2YY3A 3N4WA 3A8EA 2G2ZA 2XI2A 5EX3A 5BR8J 1TUGB 4NOHA 4JV1A 2BACA 5T41A 4ZN3A 3OV7A 2OGUA 4WFZA 3K8VA 4UQGA 2Y3YA 1HI8A 3H5YA 1FESA 4CO1A 4NCBA 2LEPA 2QYGA 1UL3A 4ANEA 4I56A 4FVCA 3AXMA 3S6EA 1FK9A 3T6BA 5KFVA 2MZJA 4AQYJ 3V4MA 3KJVB 3UCGA 1DAXA 4CCHA 5C42A 3PX4A 3W61A 2ACMA 2MYFA 3E01A 2RS2A 3BZQA 2A3JA 2DITA 5CA5A 2HLTA 4I2QB 4K59A 1CJTB 1S6OA 5IT9Y 4FYDA 4JYAJ 1VISA 1QD1A 4AXIA 4PPDA 2ATLA 4OHYA 2V2ZA 2DR5A 1TFWA 2VG5A 2SXLA 4TLRA 3RAMA 3DOMA 2WHOA 2YKQA 3PO5A 1GMVA 1WHVA 2MLYA 2DEJA 4U96A 2KT5A 2CPEA 1AUDA 2DGVA 5I4MA 4KFBB 2LFVA 4IDKB 1DBDA 5CAAA 4NLTA 1Z2ZA 5T7LA 2UUAJ 4NLYA 3VZHA 4YOEA 2GVDB 1R8CA 1U0HB 3HX9A 4LVOP 4KKOA 5KTQA 2KM8C 1Q78A 2CPHA 1RCOB 3MFHA 4KC5A 1LXNA 1DTQB 3GLJA 1WKJA 5D0RA 3VZIA 4LUBA 1QTMA 2PC6A 3EPIA 4FNHA 2HGLA 1X4EA 4LFAF 1WEXA 1DZ5A 4I69A 2B8QA 1B0PA 1D0EA 4LRDA 2HG4A 3P3DA 2NXJA 4ZVSB 2EFOA 1OY9A 1RHKB 5HI7A 4BWJA 3TW0A 4UQTA 1Y5NB 3O5TB 1RAAB 1AW0A 1A6LA 2YQ3A 2ZH2A 2NYIA 3K0JA 2MLZA 1S1TA 1S4EA 1YVFA 1DJ0A 1SIZA 1HHQA 4WFNQ 4ECRA 3W60A 2XGPA 1NHKL 3PY8A 4OV1A 2DISA 1T9TA 1OQ3A 1JJCB 2OSQA 2AV5A 3TNVA 3VAKA 2OMOA 3M8YA 3T19A 3T5LA 4YR0A 2MQNA 3D1QA 1U6BA 1Y11A 2YWKA 5HMYA 2V9WA 1SJ4P 3SDEB 4QIVA 2ZD1B 3QPIA 2BQUA 3QWPA 5HMZA 3SFGA 4RJVA 4QIFA 2C2NA 4NLRA 1RAFB 2MB0B 2FC8A 4WTOB 3GR0A 1F9FA 1R27B 3AHPA 4J9NA 3NEKA 1T9XA 5JXSA 3IAS9 3RZAA 2BJDA 2KTQA 3HHNB 1M5SA 2BX6A 1PG5B 2ZE2A 1KKHA 5D0GA 3FVYA 2M52A 1TVRB 1PO6A 1NRKA 2CPIA 3CCQS 1LWFA 3BSCA 4UOHA 4KHPJ 5KG2A 4GKKJ 3TA1A 1LFWA 2MKHA 2XS7A 2Z58B 1NAQA 1C0TB 3Q22A 3NWGA 2IBKA 4WF9Q 4X4PA 1S59A 4PXDA 2V5HG 3W5YA 1DLOA 4LSNB 2GJ2A 3W64A 1JLGB 1RWKB 4DS4A 3DLBA 3ZZOA 5GADI 1JLBA 4FXVA 3IG1B 4P2SA 3VGTA 2B7BB 4NXNJ 4L75A 1FVSA 4RR5A 4UY85 1QAJA 2HZAA 3CT9A 2H4WB 4OYAA 7FDRA 4FPRA 5EWGA 1I51B 4FBTA 2X1FA 4H4MB 2EK1A 4ZVEA 1VBYA 2AJ0A 4ED1A 1HQUB 4LF6F 3BDEA 4B9UA 1G2EA 1F2HA 4USWA 4ILLA 1TP7A 5EWEA 1IWAA 2XQCA 1VQ9S 1FEHA 4DV3J 2FGCA 1FNXH 4MAKA 5DQIA 3H2LA 5I3UB 4DL3A 2PFFB 1K44A 5CXTA 1AT1B 3BGFA 1UZHA 2O3DA 1XR6A 2CPYA 4X4SA 4PYDA 2KFNA 1NJWA 3KLIB 2KO1A 3OL9A 2YWFA 3BM7A 1I94J 1AFJA 2GMJA 1I5OB 1S12A 4DV5J 5KG5A 2FB0A 4USIA 1W2IA 2HFZA 1X4BA 2WBMA 2MSTA 4CLPA 3F44A 2Y0SD 4ZPDA 3G82A 2KU7A 3G2XA 3T1HF 2XY7A 1KVJA 4M5LA 3ZZ0A 3PIOQ 3LUYA 3R5AA 3W9JA 2JC1A 1L3KA 4HT5A 2ROGA 1R0AA 1PIEA 4OHVA 1WDTA 2CNKB 1B0TA 4DR3F 1TKTB 3CDBA 2G2OA 1QAIA 5C24B 1JLQB 1OO0B 2GNKA 2HHUA 1ELOA 1GAOA 3CB4A 3OBIA 3HI9A 3LF0A 3R97A 2EBGA 2AGQA 2CVEA 3M8PA 5HROB 4I7FA 4I2PA 1APSA 2LXUA 1L3VA 2VL1A 4ZPWR 2P6TA 5K8OA 3UCZP 2YNGB 1UVNA 4NMLA 4XDCA 2KXFA 2BKOA 4B3MF 1P8GA 2XCPA 5J2PA 4RW7B 1U47A 4WFYA 4YHHJ 3R2DJ 3MMAA 2IRXA 4USHA 1ZAVA 1JLEB 2VH7A 3X3UA 3HJVA 1G1XA 2FZKB 2VPXB 5J2NB 4DL0C 3UQSA 3KHLA 4R5PB 2VKZG 2MKYA 1NHUA 1YJVA 4L6V3 3HHLB 1UJ5A 4ANCA 3FFIA 3DNCA 1JB0C 4NZ0A 4RUHA 4ECZA 4F0HA 1X5SA 4HACB 4Y34A 4MMOA 4YUDA 4V19X 1BQMB 4Y0FA 1SC6A 4CH0S 2BKNA 3QATA 5HK4A 2JEGA 2BDPA 2COLA 1SH0A 4Q45A 2DNYA 2RU9A 1N88A 1YRUA 1HBMA 2QGFB 3SBMA 3CULA 1RT7A 1CJUB 4BCAA 1RAOA 3PYGA 2B6AB 4TY8B 1Q5VA 2AU0A 2V94A 2GVZA 4OYMA 3KJNB 3FC9A 3HFVA 3D28A 5A8KA 4EGLA 4DUZF 2N4DA 4J9LA 3TI0A 4WBFA 3NMAA 2CNNB 2W2QP 4Q5VA 1T9UA 3QGHA 4TYAA 3SZ2A 1G7CB 5DDOC 2PD1A 1YIJS 4DV2F 2DHAA 4CZCA 3OD2A 2BJEA 4NXMF 1Y5LB 3PEJA 5IFMA 3K59A 2VFTA 1TMJA 3GG1A 3QGIA 4MIBA 1KOOA 3CJ0A 4X4TA 1LFPA 4JOUA 5BJRA 2CWKA 1RTIB 3W8PA 4URGA 1IBLF 2UP1A 4U8VA 3M6UA 3B4DA 3N6MA 4A8YA 2HIYA 5GVQA 1VBKA 3LP1B 1MMNA 4JV5F 2RB7A 4LSZB 1IBMF 2JJ4D 2Z2MA 2DO4A 1MWZA 1SBRA 4DBQA 2JEFA 1KP6A 3LP0B 4I0WA 2X1GA 4YY3J 4ZP8A 2C3YA 2V4JA 3LPYA 3C6UB 2ZZTA 5U47A 3ETMA 4LFCF 2FJVA 1G3OA 1K0TA 3KTQA 3FGVA 4CM2A 5E0OA 4D3HA 5C42B 4ZITA 4DI6A 3P5BP 5E3AA 1UP1A 2RE1A 4FPIA 3QGGA 4IOBA 2PO4A 5IC6B 4C8ZA 3QWUA 3E01B 2NPIA 3OFGA 2WVBA 3KLFB 1NSAA 3C14B 3ENQA 3BO3A 3SI8A 1Y7PA 3T1AA 4WYWA 3HSZA 3BQ0A 3R5BA 4LIWA 2VASA 1Y5IB 3DOMB 3Q86A 4JV2A 4ED6A 3QGPA 2J0WA 2D69A 4K7QA 3CJ3A 3VAMA 1RABB 1QE1A 4L76A 4CYUA 1X5OA 1GMWD 3WQPA 1U1QA 3FCHA 3N01A 4X4RA 5THWA 4NRUA 3MR3A 1FXLA 2ZOFA 1BC6A 2ATCB 3CF5Q 1TKZB 3BGRB 1K73T 4QWAA 2GA7A 2CVIA 4Q8FA 1UAWA 1IJFB 1VIOA 4J9VA 2MY8A 4LFBF 2M7SA 4HTIA 2AGPA 5A0YB 3BO2A 4IG3A 3W66A 4ZVOB 2CQPA 3JSRA 4CRJA 4J37A 3PX6A 2RNEA 4ICLB 5J2QB 3CC2S 2WSCC 4AE5A 2YNFB 4CLTA 3PJ9A 1BGXT 4CNZA 1NB7A 1S0VA 1UZDA 2IVMA 2R7UA 5KG0A 1XNQF 2C1EB 1ZA1B 1NPRA 1UKUA 4FYWB 1S6QB 4JI5F 2DO0A 2W8LA 4WPAA 1WG1A 3ITHA 1S1TB 1FERA 3GQCA 1RBLA 3QZ7A 3FCVA 1ULRA 1LV5A 2IC3A 5IM0A 3KMQA 1UWBB 4MTPA 3T5HA 5IS2A 1SXLA 2W9BA 1NNDA 5D4PA 2V9KA 2VQFJ 2PGCA 2HK3A 1HW9A 2VG6B 4CDIA 3EICA 1RDRA 1F9EB 2ZH5A 5HP1B 1RZMA 5HVFA 3KUGA 2CWXA 4LT6A 4DJBA 3FSYA 2A18A 2F1FA 3HHKA 1T03B 2MDAA 4P2XA 5DG9A 3D7SB 1KQKA 3GSDA 1DFDA 4Z37A 1KN6A 3VVTA 2DHSA 2HNZB 2XBPA 3V6DA 1VCTA 5D3GA 3IBFB 3ZTSA 4F25A 3M2RA 4NA1A 3DDNA 1T8EA 3MAQA 2UUBF 1KWMA 3QRQA 2IIHA 1LNQA 2X3GA 5KFJA 1QAYA 1RYRA 2UU9J 2GFFA 3SQGA 4JI3J 3ELHA 4XTTA 3IR5B 1VJQA 2APOA 5B7WA 3RUBL 2J9CA 4B9MA 3GZ7A 2R8HA 2HHSA 1I1GA 3QRPA 3RB0A 3QIPA 4ZVTB 2KVQE 2C22A 2E5IA 3OXFA 3MUVP 2YWWA 3LANA 2QLFB 1HBUA 2B4OA 2RHQB 4RNFA 2ZZNA 1JLBB 1YQHA 1QAXA 3I4HX 4RUBA 3NAIA 2PEBA 3A13A 2DRBA 5KFNA 3NXZA 3K5NA 3UDLA 3H8YA 2ZWOA 3DRSA 2HBRB 4HI2A 3DLLQ 2AJ4A 2OAUA 4Y6IA 3PEHA 1SV5A 2BQRA 2CQ1A 3BPSP 3Q24A 1HNIA 2QRRA 3KK2B 4OZ2A 4O4GB 4TXSA 1T95A 4URQU 1TL3A 3AODA 3DDKA 2Z0GA 4CQ1A 1RT3B 3NS7B 4NMXA 3ZZPA 5J1NA 4PUOB 5F0WA 3PHTA 2UUCJ 5L1LA 3JS9A 3DLKB 3GWCA 2FY1A 5AXKA 1GK8A 1P9YA 1FRHA 1FKOA 3G71S 1MSWD 4DV1J 3Q0AA 1B7FA 3HSJA 4PWUA 1GEHA 1U1MA 1EQMA 2DR9A 4ZJQA 1NK6A 1MN7A 3CDAA 3TJAA 1RTDB 2HVZA 2X1BA 4DQRA 4KIAA 3B6BA 4DN9A 2OPRA 1M5HA 3ZZZA 5G0RB 3NGTA 4YB6A 3P4UB 5HANA 3MEGA 1VR6A 1S1VB 2YNHB 4OZ1A 2ZH8A 1SJRA 2AYMA 2I5JA 1FE4A 3GIKA 4ATNA 3M2UA 4RX6A 5JVHQ 1RHJB 3MMBB 1B4SA 2E1RA 3FMWA 5KFMA 2FZGB 4ED0A 1VC6A 3H42A 3AD8C 4NYZA 1J5EF 4CTAB 4NLGA 3S7RA 2W7OA 3MI7X 5KFWA 3ISND 2CNLB 3FQLA 2RF2A 2F40A 2JLGA 3RW7A 1U8SA 2QA4S 3FSXA 1XWLA 3TZXA 2ZVIA 1JWWA 1X4CA 3FBEA 3PG9A 2RDIA 4B3OA 4FXDA 1FF2A 5LXYA 4NCGA 2C28A 3AA8A 2L3MA 2F63A 4KO0B 1ZETA 3NBPA 3TUZC 2BE2B 3MUTP 3IWLA 1XTZA 1VI7A 5D4OA 2RQKA 4ECWA 1SKSA 3WDOA 3THVA 4OJ3A 1IBKF 2Y8WA 3EVMA 2FLNA 1U6FA 2UV8A 3QAEA 4ITSA 1O5JA 1DURA 3DKDA 1RXOB 4NLPA 3TYTA 3UFCX 2EFPA 1HMVA 2HFOA 4MK7A 3H2UB 4DR6F 4H4OB 2ZKTA 3FFIB 5E33A 3CJSA 2IYGA 2W25A 4ZJLA 1H98A 1F2GA 4LBPA 4J9PA 2Q6CA 1HR0J 5A76A 1S1UA 1S1XA 2ZJQQ 3CJRA 1FNMA 4KHMA 4DMZA 1PYTA 3NGKA 4LMZA 3TAQA 3A12A 3QT7A 4ZCKA 2HS3A 3T3FA 4WIQA 4P74A 3IBWA 1WI6A 1RT7B 2QLJB 3GFHA 1VJWA 4F7VA 1PKUA 3GJTB 1EAYC 4EO6A 3LOUA 4RNHA 5BR8F 4NLQA 2HHHJ 2HMIA 1TKXB 4CO4A 4DL4A 2WB1D 1GFWB 3SXLA 2GMHA 3R7SB 2D3UA 7FD1A 2EKNA 4RWXA 3RRKA 2E9RX 1H38A 2BOAA 4K4VA 4WK3A 1NUEA 1F5CA 3RYLA 1V9OA 1CJVA 3KDOA 2K1RA 4MKBA 2J6UA 4DSEA 3BBBA 1KR4A 1Q79A 4Q0BA 4KQZA 1IUJA 1BWVA 1KLMB 2HFVA 4AT1B 5C5JA 2HKEA 2KHCA 1R6YA 4DS5A 2CQ2A 2BW7A 3ONQA 2EW9A 5CZXA 2W7AA 1S7IA 4UOGA 2WONA 2CAJA 1OIAA 3BSOA 4B02A 4WU2A 4DEZA 1NO8A 4JYAF 3LAKA 3PW0A 3V6JA 2F9JA 3UD4P 2GX8A 2WVFA 2ZC3A 3LALA 3CMQA 3I0SA 2MLXA 1WC6A 1GH8A 3GIMA 4DLEA 4F8RA 2XNRA 1YTYA 3L7UA 3MPYA 3I31A 3Q2TC 3DRPA 3ZNUA 1FDDA 3LGMA 1KOHA 4F67A 3UNYA 4O3NA 2UUAF 4IFVA 5DLGA 3QO9B 2B9YA 1U48A 1RAJA 2WCXA 1S6PA 4DL5A 1WTBA 3CSKA 3J7A1 2KDOA 1GMWA 5C2GA 2IAJA 1YRTA 5IT4A 2XO7A 3TX0A 2UZAA 4XIUA 1SC3B 3UN5A 3K7RA 4PWDB 2GIFA 4DQQA 2AGOA 2DNQA 4JUZA 2EFGA 1HWLA 2GQCA 4M8LA 1F3VA 1WHWA 3UW1A 1RLCL 1JLFB 3MGJA 1HWJA 1GXLA 4URSA 3HFKA 1M0SA 5CCMA 1T02A 1F0XA 3C2PA 4KH1B 2E44A 1HPZB 4LFAJ 3JQKA 1MROB 1N33J 2HRTA 4YB5A 3CCJS 4IQMA 4B3TJ 1RHQB 1M1KT 3IFEA 3OSPA 2EPIA 4ZCIA 2GIRA 2EK6A 1U2CA 2FD2A 3OJSA 2CQGA 4QPTA 1NSPA 1ACMB 2MZTA 4EI2A 3PCOB 3OR1B 2I0XA 4OYBA 2JZ5A 2LQ5A 1ZM9A 2BXJA 2C2KB 4Y2KA 5DM7Q 2W4PA 2VBYA 2IM0A 1CLFA 3ITHB 2BMBA 2EBEA 3C15A 3N9UC 2UVUA 2B56A 2Z30B 1X31C 1JXLA 2B9EA 2ZKUA 2W9BB 3BGUA 3OQ2A 4R0JA 2K7KA 1R8PA 2QA1A 4S0MA 3MEEB 3AAWB 1O8BA 7AT1B 4KHPF 4GKKF 2IDEA 1A7GE 1C1BA 3JYTA 2CPFA 1MNEA 4ECUA 2PMHA 2QSWA 2PMZD 1SH3A 4A48A 3Q2SC 2AYEA 4TQRA 4DL2A 4C2MA 4N8OA 4RBUA 4ER8A 4ZVHA 2XZTB 1N32J 6FDRA 2YH1A 3MFIA 4DCOB 4NXNF 4JBCA 1FRKA 3OHAA 4QWCA 5I3PA 5KFXA 2ADBA 4QOTA 4E8UA 4QWBA 3KUHA 4PQAA 1MG7A 4B17A 4EK2A 1PYSB 3MM6A 1HQ2A 2BJ1A 2OEKA 1FJGJ 5KOWA 1UEUA 1EHWA 2IMWP 5B09A 5HN0A 2FLOA 1GX5A 5FDLA 5KT4A 3S1TA 4B3SF 3R27A 1IKYB 5LT5A 1NB2A 4L74A 4N7TA 4ZP9A 4RW6A 1GXTA 2DIUA 2XSFA 3DU5A 2Q1LA 4LQ9A 4J90A 4DSFA 2QO3A 4DV3F 3MEDA 3OXGA 4NI2B 1RT4A 4DQSA 2J9EA 2XMMA 4KGMA 1SL0A 1Q0NA 2HWHA 1FJEB 5FIIA 1PAUB 3L3CA 1JNRB 1RHRB 2I8EA 4QIEA 1VQOS 2HWTA 4UF4A 2DHGA 3TUIC 4IG0B 2J76E 3K58A 2ZHBA 3EXCX 4DV5F 4DSLA 1X0FA 1X4DA 3MM9A 2MZQA 4EWTA 4WKRA 4KGVB 1NKBA 4LRFA 3HVAA 3OTOJ 1AZSA 5AXMA 2HHQA 1S7HA 1RAIB 3PIPQ 2B3TB 3SFUA 4H54A 1S10A 3W2VA 4KRWA 3UD5A 4CO0A 4JI6J 3M4XA 3J80U 4X4QA 1UA0A 4DQPA 2JSXA 1N5VA 4NLXA 2XYGB 3D0IE 2NXCA 2RKIB 2HBYB 4DFPA 4QJVA 3I32A 2UXBJ 2OEMA 1RE1B 1Q95G 3RG6A 2MPUA 3MDFA 3HM9A 3KLEB 2KB2A 3IRXA 2LLZA 1DTTA 4G65A 1IN0A 4OI4A 2HQGA 3MEGB 3D1HA 4C48A 2RU3A 3CIMA 3ICLA 2W24A 2MEWA 3O6QA 1FRJA 2G9OA 3IAM9 3R5GA 1H6KX 1X5TA 1KDNA 1S1WA 4I67A 4YHHF 3UDCA 4MFBA 1KEKA 4A8FA 4QYRA 3X1LB 2WW8A 1VRUB 2VG7A 2G0JA 4O44A 2WOMA 4DXLA 4XDDA 2MKIA 1KQFB 3MM5B 4FDFA 1RUSA 4WU3A 3NAHA 1N5SA 1X60A 4B3MJ 5DDRC 3HHLD 1GMUA 5KT2A 4QPXA 3CD0A 3POTB 2Y8YA 3FK4A 5GAHU 2RH3A 1RADB 3RTVA 2YX1A 3HVRA 2GJIA 2CPXA 1YWXA 2A10A 4N8NA 4I6AA 1CC7A 2DRDA 2CJ9A 5KFTA 4M5NA 1VBZA 2DH9A 2XI3A 1T05A 2MSSA 1ZBTA 1VYAA 2I2YA 4OZ3A 2OP5A 1EKRA 4HKQA 4JI2J 2C3OA 1ZS6A 1CJKB 3VAFA 1FT8A 1S5ZA 3MTKA 1AFIA 1VRTB 2YKOA 4W92B 1SCJB 3V81A 1WF0A 2X51A 5SZTA 3H90A 1WOSA 2IJNA 2V50A 1YJNS 1QVFR 1F5BA 3Q8RB 2MTLA 2FVCA 1NZ8A 4I6YA 3L7PA 2DYAA 4RW4B 3TUJC 3K57A 3FMBA 1WWHA 3O8WA 3QFHA 1CULB 4DR1F 4WP8A 2M2BA 4DV0J 2VB6A 4ED7A 2CZ4A 1XMBA 4NXMJ 1RT1B 2IFXA 4XPCA 1CJVB 1HNZF 4OYWA 3KJVA 4CH1A 4YY3F 4ELUA 4CLLA 2QMWA 2V68A 4TKTA 3TANA 2J5AA 3KHRA 3KJFB 2O66A 1Q86T 2W9CB 3L95X 2KT3A 1IBMJ 2OSRA 2QL7B 2DNRA 1URRA 2CJQA 4M94A 2K3IA 4PWWA 3TUPA 4YDXA 4GRSA 1HI0P 3P5TL 4U7UD 4LFCJ 5ETOA 3HD2A 4K8RA 3G8TA 1V3RA 1NKEA 2YNIB 2XO6A 3J81j 2JOQA 2UVVA 4R25A 4ALZA 3K89A 2MGZB 2VFVA 3HSDA 1EARA 5LXRA 2GV1A 4KFBA 3BF4A 3NP5A 4UOFA 4LF4J 3HZGA 1P1TA 4A8SA 2GVDA 2BYCA 2D9OA 4EZ9A 5HO4A 2IYIA 1LWEB 1DTQA 3CGIA 4ZS6A 2LA4A 1D8YA 2H4YB 4J9QA 3EMTA 2VUGA 2QN6B 5KG4A 1VMBA 1CPZA 2D7SA 1KC8T 3OR2B 4M95A 3PRVA 5I42B 2Q66A 2RHSB 2AKWB 1IWGA 2E5JA 2ACYA 1XC9A 1H2UX 5HMWA 3GCXP 4F4KA 5E5NA 4JI8J 3EYZA 2DH8A 2B5JA 2YTCA 2R2TA 2D1CA 1HL6A 3DGPB 4LFBJ 1P27B 1WTFA 4DFMA 2W8KA 4FS1A 1WI8A 3MZIA 1RTHB 4DU7A 2E7VA 1S9EB 4NX9A 4ZVQB 5DM6Q 2C3MA 2KXNB 1HNVA 2H1YA 1A9NB 2V69A 2BABA 4DSJA 4L3NA 2UVRA 1XNQJ 1WF1A 3O1LA 1U1LA 2H5EA 1HYSB 1T3OA 2W1BA 4WK1A 4ZCMA 2BA9A 3SDEA 2VQFF 1NK0A 2WRMA 2ZD1A 3J81U 1WF2A 2FJDB 2P9EA 1SPBP 1UEVA 4KE5A 2V2VA 5C25A 1TL1A 2RDDA 5E41A 2DR8A 3TQ1A 4OZLA 3CW2C 1VQSA 4PPZA 2PMWA 1UVLA 4EBCA 2AYGA 4YB1P 3CE8A 1F5AA 3IC1A 1OY6A 2IJFA 3BBCA 3EDRB 4F3OA 3MTJA 2UU9F 2WZ1A 1C0TA 3EX7B 4JI3F 1KSPA 3DN9A 4RU9A 4LRCA 1JX4A 4N41A 4BWMA 3HFZB 4LSNA 2XY5A 2YH0A 3IA0A 1JLGA 3CCZA 2YXLA 2G2YA 5JUMA 2NUHA
chains in the Genus database with same CATH topology
2X1GA 2FPHX 4ZP8A 2C3YA 2V4JA 3LPYA 2NPFA 1SJFA 3IWXA 3C6UB 3IG1A 4C8LA 2R7SA 2DNZA 4ZKAA 2FHMA 2LEBA 4QR0A 5U47A 3WZ0A 2R8GA 3BN7A 5JVGQ 1EETA 5KG1A 2YX4A 2N3OA 1ZM3A 1VK3A 2E9ZA 1PC4A 1BD6A 3CJKB 4LFCF 3SV3A 2FJVA 5L1KA 1G3OA 3BJYA 1K0TA 3KTQA 3UWTA 3FGVA 2F8HA 4DV6F 3M6XA 3L09A 2DGUA 5E0OA 3ZFVA 4D3HA 5C42B 2MZRA 4IKAA 4IR9A 1HNXF 3U27A 3GILA 4DFKA 2MKKA 2R7WA 4F3MA 2DGQA 5E3AA 2OPRB 4FNIA 2D3ZA 1UP1A 5L9NA 1M5PC 2CJKA 1VRTA 2RE1A 4IOBA 3QGGA 4YB7A 2PO4A 3H4BA 2UXDF 2VODA 2J7WA 1R7IA 4C8ZA 1MU2B 3QWUA 3LWLA 3E01B 2NPIA 2YKPA 3OFGA 1C2PA 3F56A 1R8BA 3M05A 4H4MA 2LQ9A 3KLFB 2ASYA 3SCJE 1HQUA 3DMJB 3ENQA 3J7Z5 3BO3A 1U09A 3LP2B 1Y7PA 3SI8A 3T1AA 1C0UA 1UJ6A 1Y0HA 2DK2A 1JXEA 1FD8A 4WYWA 1NEEA 5KT7A 2I5JB 2HNDB 4Q44A 1QVGR 4YFUA 1RTJB 3M2UB 2CFXA 2B4VA 5FDLB 3VR1A 4OHXA 3AJ2A 3BQ0A 3PR5B 1VLYA 3M6VA 3LQVA 3R5BA 1LK5A 4LIWA 1U1PA 5MAOA 3DHXA 2VASA 1Y5IB 3IGNA 4LSLB 4JV2A 3H40A 1FKAF 2RQMA 3GV7B 4DF4A 4ED6A 4DQIA 3QGPA 4RW6B 4RW4A 2J0WA 1RT5B 4B08A 2RT3A 2MKSA 4AL6A 2JDJA 1WEYA 3CJ3A 5CQGA 1DQ8A 3TRGA 3VAMA 5I3UA 2XLKA 5KT6A 1X4FA 3M32A 1QE1A 4N76A 4JV0A 1X5OA 3FRZA 1U1QA 2J9DA 3FCHA 2AJFE 2RF2B 1DQAA 3U1LA 3N01A 4FVMA 3FQKA 3CXCR 3I0RB 4X4RA 1RT1A 5THWA 1VHFA 2OFHX 4NRUA 4C9DA 2JWNA 4GO5X 3MR3A 1FXLA 1FJ7A 2K2PA 2ZOFA 1BC6A 3H5XA 3CF5Q 1TKZB 2QLWA 2LU1A 3KLIA 2B9XA 5KFGA 2LMIA 3N0VA 2DRAA 2F8EX 1GT8A 3BGRB 3FDSA 2E5HA 4KGKA 4OX7A 4DV1F 1K73T 4QWAA 2GA7A 1CG2A 2CVIA 1MWYA 4O3OA 4GC6A 1PSDA 4Q8FA 1UAWA 1IJFB 1VIOA 5F8HA 2ZOGA 2MY8A 1QJHA 4LFBF 1N0VC 5E3QA 2MQQA 3NNCA 4PRFA 2M7SA 4HTIA 3GR1A 2VPWB 4B3OB 4OFZA 3H2VE 4DR7F 2AGPA 4OI2A 5A0YB 2DNMA 3UR3C 4BC9A 4QQBA 4ZHRB 5M2UA 2YWEA 2R2UA 1IKWA 3LO3A 1KRPA 3R5CA 3I56S 3BO2A 2DGWA 3B78A 4IG3A 4NCGB 2CQPA 1UMJA 2OIHA 1S77D 3G8QA 3JSRA 4J37A 4C3MA 3PX6A 4G6VB 2VONA 1V6HA 1XEZA 3GB0A 3NBPB 2RNEA 3JB9k 5F8NA 2W9CA 2G4BA 4ICLB 4OI3A 4WIIA 5J2QB 5AXNA 1U7LA 4GMKA 1Q7YT 3MMCA 3WC2A 3CC2S 2WSCC 3CPWR 4C8NA 4AE5A 2YNFB 2GGPA 1BGXT 1RISA 4CNZA 4NLUA 1NB7A 2KG0A 2R9LA 5K5MA 1S0VA 1Z2LA 1JKHB 2IVMA 4RW8B 1SJ1A 5KFCA 3DXSX 2R7UA 5KG0A 4R8UB 1XNQF 3DOKB 4KPYA 2V2KA 3CC7S 1TV6B 4NYPA 3G9CA 2CQHA 3QIDA 2G0CA 2ILYA 2E5LF 5K8PA 2OD6A 1N5YB 1HMVB 1UKUA 1S6QB 2K3KA 3SCIE 5DDPC 3VALA 4DFJA 2CZVC 4JI5F 2DO0A 2Y1RI 1TKTA 2W8LA 3MXHP 2P9GA 1JLQA 4ERDA 2GCFA 4PG8A 1M5OC 4MJKA 5CCLA 3CC4S 4Q8EA 2JH3A 1OWXA 2LU2A 3WBZA 2YNIA 1NK4A 1RQ0A 2VBZA 1WG1A 3ITHA 2JL9A 1S1TB 1FERA 3GQCA 2MHNA 4TU8A 1S1UB 3QZ7A 1ULRA 1S1XB 2IC3A 3HLUA 3IO1A 5IM0A 2MGZA 4EEYA 1LV5A 4ZPCA 3KMQA 3HVTB 1UFLA 2ZUGA 1B64A 4PXCA 1UWBB 3ENVA 4MTPA 4XAKA 3VAJA 3T5HA 1GNKA 1BQNB 5F8IA 3QAUA 5IS2A 1TK0A 2AQ4A 2VQEF 1FNOA 3UR0A 1BQXA 1SXLA 1N52B 4F2RA 2DPJA 3OTCA 3EPGA 2W9BA 3IRXB 1N48A 3D5MA 1QSLA 3I4PA 1BWEA 2AX0A 1R89A 1NNDA 2CJBA 4ETXA 2FLPA 5D4PA 4AUKA 2V9KA 3CUNA 1LWEA 4DR5F 3W3SA 4OJHA 3UE2A 2DGSA 2IHR1 2VC1A 2EC0A 3M8QB 2PGCA 2ZH3A 2HIQA 3TA0A 1N36F 4RW7A 1HW9A 2HRYA 1CSJA 2VG6B 3M30A 2XS5A 1RP5A 5GAEU 4ECVA 4K4SA 1RDRA 3CCWA 4F26A 4OI0A 2RRNA 3PKMA 2R7TA 2C42A 2ZH5A 1N5TA 1TQLA 5LJ3Y 2KT2A 5HP1B 3RBDA 3OR2A 1VQ8S 4M5DB 5AE3A 2QFJA 4NLOA 1JJ4A 5I42A 1HHSA 2Z8QA 2HMIB 4LT6A 1K1SA 3KWMA 4X66F 3ULHA 1T94A 3UCUP 5A8RA 4DJBA 4R5PA 3FSYA 2A18A 4WXWA 4M63A 4C8KA 4C8MA 5KG6A 2F1FA 2B9WA 1ZPWX 3HHKA 4DLGA 3HT3A 4QW9A 1T03B 2MDAA 3BR8A 4DL6A 3MR6A 1FVQA 2ZM6F 1BLUA 5DG9A 2DIVA 2UUWA 3GSDA 1KQKA 4K50A 1DFDA 3DOLB 4C98A 3HHLA 4NPOA 4IH6A 4Z37A 1KN6A 2DHSA 2HNZB 4C8YA 1RT2A 2XBPA 3KHHA 2GHWA 3V6DA 1KVIA 2VZ9A 5D3GA 2K1RB 1FKPB 2QSFA 4F25A 3M2RA 4HLBA 5B0CA 5DG7A 3AQOA 4IYQA 4NA1A 3DDNA 4MKYA 3DGPA 5KFRA 1T8EA 2VA3A 4Q0BB 3HZEA 2DGXA 2AYBA 2YKAA 3MAQA 2UUBF 2WK4A 2XSJA 3JSMA 3BSAA 2F4VF 5D4NA 2M8HA 2ZH4A 4PQUA 1HBNB 2AJ1A 2X3GA 4ZVFA 1RTHA 5D78A 3SYZA 5KFJA 3J7ZT 1QAYA 2QIFA 3DCAA 1RYRA 2OPSB 2GFFA 2FHJA 3SQGA 3FNNA 1S9EA 5IQQA 3GV8B 2E1CA 4DL7A 3IR5B 3M6WA 4RZRA 1XBWA 2APOA 2ASLA 5B7WA 4I2QA 5A8WB 2J9CA 1EP4A 1Z4UA 4B9MA 3GZ7A 2R8HA 2HHSA 3N79A 1M5VC 1HR0F 1I1GA 2E7WA 3RB0A 2FJAB 1FDNA 2LDYA 2ZJRQ 4OIXA 3QIPA 5MLCV 4N56A 2RIJA 3NS6A 2GMLA 4C11A 3V4IB 2WONB 4F50A 5GADU 1Z1ZA 1HHTP 4LF8F 3AB4B 3W2WB 4WZQA 3NCRA 4Q43A 3DRRB 3NGDA 4Q7AA 4DSIA 4O3QA 2C22A 5K9FA 3BQ2A 2E5IA 3OXFA 3MUVP 1KLNA 1ZAXA 3LANA 1HYSA 2B6AA 4TY8A 4OX9F 3FSIA 5AXLA 3LWMA 2HLUA 3OTEA 4ES1A 4E98A 4LJMA 1HBUA 2B4OA 4FP9A 3KLHA 4WCEQ 4P7VA 5KFYA 2PA3A 3MM8B 3ZZTA 4RNFA 2WTFA 1JLBB 2ZZNA 1YQHA 4NRTA 1QAXA 3I4HX 3I0SB 3VWSA 4X65F 4JI7F 3QLHB 4OLPA 2RQCA 3NAIA 3DLGA 4PG5A 5AJ3F 2DRBA 4IOCQ 1SH2A 2V8HA 5KFNA 4YQWA 3KOAA 1HI1A 3K5NA 2ZHAA 3UDLA 1N8RT 3H8YA 3PV8A 2QYCA 2HPUA 4OX8A 3DI6B 3MD3A 4IDKA 1E6VB 1IQTA 1D9FA 3DRSA 4O4RA 3VQSA 4HI2A 3MAHA 4AL5A 1E6YA