1ZPWX

Crystal structure of a hypothetical protein tt1823 from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
GKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TT1823
publication title Crystal structure of a hypothetical protein TT1823 from Thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zpwX00
1ZPWX 2EFGA 4MYTA 5G4DA 1VI7A 3B78A 1U2RA 4ES3A 3B82A 3EXCX 4FN5A 4ZCKA 3B8HA 3LH2S 2CVEA 4M1KA 2BV3A 2I0XA 2BM1A 2KDOA 4ZCLA 4ES2A 1N0VC 1T95A 2XEXA 1KTVA 2E1RA 4QR0A 4QR2A 3OQ2A 3ZZ0A 1ELOA 2ZITA 1N0UA 1ZM3A 2I8EA 4ES1A 4ZCIA 2BM0A 1FNMA 1P9QC 2IVYA 1ZM4A 3UI3A 3ZZUA 4TNOA 2J7KA 1ZM2A 1ZM9A 2WBMA 4MAKA 3ZZTA 2L9NA 1DARA 4QR1A 2NPFA 4ZCMA 3E3XA 4MYUA
chains in the Genus database with same CATH superfamily
3W63A 3TR5A 4KJIA 1NK0A 1XMOJ 3TNVA 1TL7B 3UD5A 4USWA 2ZH1A 4DSIA 2LXUA 2B0GA 2R7RA 4DFPA 3BM7A 2HKEA 3NL0A 2O1PA 3H5UA 5HLFB 5FD1A 3J7ZT 4DR4J 4RU9A 2NXEA 1RT3B 1LNQA 4JBCA 3I31A 1YIJS 4FXWA 5MLCV 3KJFB 4PG4A 1D3WA 2LKZA 1XERA 3TA2A 1C0UB 3OXGA 5HROB 3UDEA 4ED5A 5A0YB 1FKPB 2CQPA 3KK3A 1IM6A 5GVQA 2EW9A 5CZXA 1Q1KA 3CVKA 3GLJA 1S9EB 4P9SA 3GILA 2DEIA 3OTOF 2DGQA 3I0SA 3SQGA 4UUXA 4RZRA 4DV3F 3AODA 1RT6A 1C4CA 5AE1A 5HMXA 4CLYA 2YNGA 4ECWA 2YWEA 4YOEA 1IUJA 2QX0A 3BSOA 2H4YB 1OY9A 3THTA 2ZE2B 4U8VA 3KJVB 5CYQA 1L3KA 2QE5A 4LFCJ 2OPSA 4OYWA 2A0FB 3AD8C 3IFEA 1ZA1B 4MK8A 2K8GA 2KJWA 1F9HA 4Q2LA 4NLPA 2V2VA 5F3TA 1NKEA 4AUKA 2DEJA 2OEMA 3M8QA 4H4MB 1MMDA 5HJXA 4DZDA 4PUOA 4WXWA 5LSOA 3MEGA 3I6PA 4DPWA 2ZKUA 3DM2A 3CCUS 2F4VJ 2N3LA 2OD6A 4ID5B 4NLVA 1Q4RA 1JJ2R 1KS2A 4I56A 4CTAB 3NS6A 4KGVB 2F40A 1U6ZA 2E44A 4OZNA 3CXCR 4YY3J 1T9XA 3V4IB 2RSQA 1TL7A 4NLYA 3ZTPA 2WK4A 4JI5F 3G82B 3H4BA 4WCEQ 2FJEB 5HLFA 2VIHA 4BHQA 1VLOA 2QV6A 2XMVA 3A12A 4JI3F 5K8NA 3TYTA 3KDNA 3OW2R 1RT3A 3GJSB 2YWFA 2G2OA 5A6WA 2VU5A 3F56A 2XYHB 4Q43A 2VPZB 4F36A 4TU7A 3W5ZA 4HEA9 5HVHA 1C0UA 1NJIT 5HROA 2WOMB 2QMWA 5A0YA 1FKPA 1WDDA 1QTMA 3QZ7A 1IJFB 4WPAA 2RRNA 3NBPB 1AUSL 1S9GB 1OO0B 2ZH7A 2P9CA 3UN2A 1S9EA 2EG1A 4NEYA 4D3HA 1F9EB 1MWQA 5KFBA 3VALA 2N3OA 4X4OA 2ASDA 4DU7A 2ZBRA 5I42B 4BDPA 1S4FA 4X4UA 2ZE2A 3N01A 3KLHB 1R7IA 3KJVA 1H6KX 4KYZA 4LRFA 2OKQA 2Y3YA 5M2UA 1NXIA 2WTFA 3M32B 4NZ0A 4MKBA 2UVVA 4DN9A 5LXYA 2M52A 4LR8A 3A3OB 3PKYA 2YQ3A 5HMZA 2GAHC 4H4MA 3CSKA 4RUAA 1UVIA 1GH8A 4URSA 2YVSA 1JLCB 4B9NA 1VC0A 2JWNA 1FJEB 3UPFA 2KRRA 3KNGA 5HK4A 1H38A 3HK2A 1NO8A 2MQ8A 4ID5A 3H8YA 2BE9B 4DEZA 1M1KT 4EFAC 4RLEA 4MH8A 4CTAA 1X4BA 4OIXA 1VQ7S 4DV2J 1Y7PA 3A3NB 1IBKF 4DL5A 3V4IA 2Z2LA 4DX5A 2F8EX 3G82A 4DR1J 3TA0A 3J7Z5 4X62F 2D1CA 1CBKA 5SZTA 2DNMA 3M2UB 4WBFA 4L74A 1OQ6A 4YR2A 4DR7J 3FNNA 3VV2B 1HR0J 1RZMA 3IR7B 1U2RA 3R5GA 4JV5J 2KXHA 3BF4A 5IC6B 2EVZA 1X9MA 2UU9F 4DR3J 2VQEJ 2WOMA 3EM1A 2QL7B 3I9ZA 4M63A 2MQMA 2EFOA 5L39A 4B3TF 2KYXA 3NBPA 3MMAB 2V4JB 1S9GA 3GV8B 2K7JA 2YKQA 4CZCA 3ADAC 2IM3A 3DYAB 4HHUA 4RO0A 2DR9A 2W7PA 3M8SA 1EJ7L 5AJ3J 1KVKA 2W1BA 2KT3A 4FYDA 5KOWA 2V2KA 1RT2B 5ETKA 1QSYA 4EWTA 5I42A 1FX2A 3BKTA 2HHSA 3KLHA 2DRBA 2FLLA 1FVQA 2DXEA 2YX1A 4AL5A 5CYJA 1S1WB 2N4CA 5DZ7A 2AGPA 3FC9A 1YJNS 5KFKA 3M32A 2UUBF 4MMOA 1NDKA 1X9WA 1AFJA 3FMBA 2BM0A 4QWBA 4Q44A 2ZH2A 3WIUA 3R1LA 3DDIA 4WKRA 4Z7YA 4O3NA 3R3TA 2X1BA 1MROB 3J7YI 3BR9A 2BABA 1SJ4P 1BUXA 2PC6A 4I6AA 1JLCA 1K0TA 4DR2F 2LU2A 1EKSA 2WSEC 2Q43A 4NLSA 1V3ZA 3KHLA 2VFTA 4ZCLA 2FHMA 2CQBA 4DR6J 4F4WA 4Y2CA 1U1RA 2KKHA 3PHEA 2RF2B 3SCKE 3H5XA 3QPIA 3L09A 1NJXA 4GKKF 2ZUGA 5K8PA 1NSQA 1LWEB 3D1OA 4WZQA 1YJWS 1FDDA 2NS1B 3IN5A 3MCMA 1S6OA 1GK8A 2QGFB 1VQ9S 1FX4A 1CVJA 4WYWA 3QYYA 3M2UA 2H5JB 2QG9B 2GJIA 2P2CB 4KV8B 2IYGA 1WC3A 3HHLC 3KLIB 4FP9A 5IV3A 4LR9A 3HHLD 1K0VA 2XZDB 3SMZA 5L9XA 2FHOB 3VGUA 1VCTA 1Q78A 4DV5F 5AXMA 1X60A 4KHMA 4HDGA 4LF2A 3R5JB 1Y9OA 3NAIA 4K8RA 3CJQA 2GJFA 3LAKA 4KHPJ 1TFWA 4FNHA 5KFJA 1RWPB 5DQHA 3MMAA 2V4JA 4OZJA 2AYGA 3P8BB 3D54A 1EB0A 2GVZB 1HD1A 1RADB 3OTOJ 4B9VA 2UXBJ 3HFZB 2MQNA 3TARA 3CCWA 3MM5B 2E66A 2UVUA 1CPZA 1N36F 1RT2A 1SCJB 5L8RC 3T9NA 3L4BC 4DUZJ 3W2WB 2HBRB 1U45A 2J9CA 1SVDA 2H65B 4C8LA 2KFZA 1OYDA 1S1WA 1RJJA 2K06A 2YPZA 5KT3A 4X4TA 4XAKA 5KFRA 2J7WA 1WTBA 3CMES 3OR2B 3M4XA 4AXJA 2MZSA 4PQAA 3F44A 1K44A 1PBUA 5HSPA 3GFXA 3Q22A 4QW9A 3IRXB 2NREA 2P5VA 5THWA 3N6NA 3AB2B 3UE2A 1KVIA 2IRXA 3J7YU 2A3JA 1ZZFA 2FVSA 1NB2A 5KFAA 4LRBA 5DQGA 1HWUA 3TAPA 3OPKA 4DL4A 2NXJA 3ZZUA 1ZM2A 2HQIA 3BB5A 2LQ8A 2W4PA 4W90B 2RF2A 2VFSA 3Q23A 2H5IB 4RNMA 2GO9A 2ZKTA 3GPAA 3M1VB 2PGCA 1LWEA 1HBMB 1ELOA 3DHXA 1ZA2B 1L3SA 3ETOA 4OJ1A 4FS2A 2BRLA 1SH0A 4F3OA 4KV8A 3NRBA 4KQZA 1HL6A 3KLIA 2BM1A 1WOOA 2DNZA 4WFZA 4ZVTB 1SJ3P 3AFGA 9ATCB 5DQIA 3F73A 2CJBA 2XNRA 4EBEA 3OLBA 1XWLA 4ZVPB 2RILA 3J81U 4OYMA 1IXKA 2V8DA 2LMIA 2U2FA 1RHRB 1B0PA 3KG1A 3CC7S 1TMJA 4J9RA 1KFSA 3GJQB 5HANA 1KC8T 1Y00A 3RG6A 4NLXA 2HVIA 2XS7A 2XZWA 2ABYA 2GVZA 1NK4A 3IS9A 3NMRA 5EDWA 1RE1B 4O3RA 2DGUA 3MM5A 4Y28C 4CLKA 2MQLA 3CDWA 1R8CA 4NI2B 5I3QA 3HULA 4ZKAA 3W2WA 4OYBA 4DSKA 5LT5A 1HNXF 2OP5A 4A8KA 1Q8BA 3NCQA 2DIVA 5HP1B 2GQ2A 4X4NA 3AT1B 2X3DA 5KFNA 3KHHA 4K5RA 3POTB 3GU0A 5EUHA 5HAOA 2HNDB 2L48A 2BDPA 2BW2A 3I4PA 4NX9A 2IA0A 1YX2A 3T1YJ 3D5MA 2B9XA 4P2MA 4Y6IA 1HWKA 3IRXA 4NOHA 3BDEA 3WQPA 2KRBA 3CD5A 3EVWA 2HFNA 1NMEB 3I56S 1C1CB 4DQQA 1IQTA 1RBOB 2DJWA 3GIKA 2DRAA 2BJEA 5DG8A 2DCUB 5DDRC 3M1VA 2HZAA 2C1EB 1T9UA 2RD5C 2QA4S 1HBMA 2OI2A 3R6GB 1T03B 2BR0A 1FRLA 4X62J 1RT1B 3VAMA 2DYAA 3HHDA 5K14B 4KO0B 3CGIA 2FHKA 1NM2A 4ERDA 2GA7A 2WBRA 1MNEA 2F4FA 1MLAA 2JC0A 2UVRA 3KMSA 4A48A 2CDRB 2IDLA 3LUYA 4P6QA 2BE7D 1PJ5A 5AE2A 2MLZA 4R25A 1DARA 4MK7A 4Y00A 3QATA 5DDQC 1V5VA 4OZ3A 4WP8A 2CZ4A 1S77D 3SXLA 4ZK7M 4UZBA 4USVA 3EPGA 1LK7A 4NI2A 5ETQA 2ZJRQ 2XGQA 3BGFA 5I3UB 2XY5A 4KE5A 4ANCA 1TL3A 2ROPA 2AX1A 3I4HX 1TP7A 2MDAA 2OLWA 1U2CA 5HP1A 3HSDA 4WP9A 5JVHQ 4KSEB 2UV8A 3MOJB 1M90T 2VKZG 2JLGA 1IQZA 4NLDA 5KFVA 3OSPA 3IR6B 2HNDA 4ED6A 3K17A 5SUHA 3IGNA 4IOBA 1P1LA 2OSRA 5IXUA 3PKMA 5HVFA 1WC5A 4L72B 2Q6BA 4RNHA 1S57A 3D6FB 1RAEB 4LF6J 5ETRA 4RW4B 1NHVA 4WKYA 5KG3A 1K8AT 1C1CA 4K2JA 3TO8A 1YWXA 2FUG9 2VG5B 4NEZA 5DETA 4RNNA 3RB4A 3ZZ0A 4G3IA 2R42A 4KGKA 4WFBQ 1UL3A 2YKPA 2B3TB 3IGVA 1HWJA 1UVLA 2GX8A 3T6JA 2BBEA 1T03A 1WC6A 2PMZD 3Q89A 1KTVA 1RT1A 1WF0A 4PXCA 5K14A 4KO0A 5KFDA 3P4UB 1L5UA 4G6VB 3A3PB 3AY0A 4DUYF 3L7UA 1WHYA 1PSDA 1Q82T 1G6BA 2OH2A 4M5LA 1WD6A 4MKVA 2ZC3A 1I94J 1RT5B 2D74B 1SJ1A 3A8JA 4S0MA 4X4PA 5GAHI 3HKWA 3OFHA 4ZIWA 1YJ7A 3D3BJ 2Z58B 3RYLA 2V50A 1TK0A 2CDQA 3FQLA 2HRTA 2BKOA 4XTTA 4UOFA 1S97A 2NPIA 3R5DA 1XR5A 1EP4B 1JLBA 2MJUA 1N36J 3IA0A 1RWOB 5I3UA 1RTJB 3D68A 1V3RA 2NYIA 1Y3JA 4PYDA 2HS3A 1K1SA 1XNQF 4ZP6A 5C25B 4B9MA 2B8QA 3BYPA 1D09B 2LCWA 1VIXA 4ECZA 2P9GA 4IO1A 3JTPA 3RB6A 1H74A 2CQ2A 3FZ2A 8RUCA 2PN6A 3MTKA 3J81j 1VQNS 1NKBA 4PPZA 2V9WA 3OHAA 2XNQA 2LECA 2NSBA 4U96A 3AA9A 2BJ7A 5DM7Q 1JNZB 1D9AA 1TVRB 1LWCB 3WC2A 3TJ8A 2FJWA 4N77A 2IPOB 4C0HA 2LA6A 3FFIB 2W4CA 3BPDA 4RW4A 2VDIA 2UXDJ 3L9ZA 2BE2B 4WFYA 3LQVA 1GAOA 4KAIA 4LF8F 4NASA 3HMJG 3BR8A 2OEKA 3R97A 3VQSA 4DV1F 1JWWA 4OL8A 3HDSA 3BO2A 1S1XB 1FJGF 4ED1A 4CO3A 5KT4A 1H0HB 1H73A 3EICA 3HSZA 4PQUB 4N47A 3GONA 4PAAA 1C0TB 4CLFA 2W2QP 4OFZA 3RW6A 2DGVA 1YK9A 2WCXA 3MMBB 1IKXB 3ZZPA 4O23A 2GIRA 3D66A 1X4GA 5B0AA 4ETXA 5H9EK 4DZ6A 1X31C 3J80U 4K0KJ 3DRYA 3H42A 2HGLA 2EFPA 4WFNQ 1RT5A 1Y0HA 1RKJA 3C14B 4AYBD 2OAUA 2IRYA 1U02A 2XULA 3UN5A 1MSWD 2F5GA 3KK2B 2MQOA 2IAJB 1IWAA 3CJ4A 2WVEA 3OD2A 2RQKA 3M8PB 2VD3A 1XNRF 4F4KA 3MM6B 3M2VA 2DXDA 1HBNB 3DU5A 1Q95G 2PFFB 4QYRA 3DMJA 1EP4A 2HWIA 2AEFA 4CIOA 4QWDA 1NBEB 1K47A 5B09A 1KQFB 1RTJA 2YPYA 2I1RA 3NGUA 3GMGA 3OXLA 1HLWA 4NCGA 1C1BB 3M8ZA 5C25A 4J9NA 1R0AB 4B3RF 2C2KB 3OLAA 5C5JA 2DNNA 5LMNJ 2RE1A 3BGLA 4ECVA 4B3SF 3CCQS 3FUYA 1PCAA 2R2UA 2XMMA 3T5LA 2FLOA 3MAQA 3JSMB 5F0UA 3G6ES 2V68A 2R2TA 1TVRA 1LWCA 5IM0B 4CLSA 4I64A 3FFIA 4TYAA 1XC9A 4CO0A 3M2RB 2BE2A 2KG0A 4GKJF 3CCZA 2A6MA 4ZLPA 2DNHA 2F7VA 1P9QC 3TZYA 4F2SA 5GAGU 1S1XA 2KFYA 3WX8A 3I55S 3EDRB 3C16B 1I51B 2OPPA 3E01A 4C3MA 3DGPB 1C0TA 1L3TA 4NXMJ 3MMBA 1F2HA 3K7RA 2BANB 2GAGC 1IKXA 4EO6A 4F02A 4N8OA 2ROEA 1XBWA 5F8NA 3G87A 2R7TA 2DNYA 1X5SA 3NOGA 4AXIA 1GXLA 4PEOA 3AH6A 2YWKA 2DHSA 1BLUA 3PTWA 4I2QB 3VAGA 2D3O1 2I0XA 5CCLA 3C14A 3SYZA 1KEKA 4H54A 4QBUA 3QT6A 3KK2A 4G1IA 2IAJA 4ZP9A 4JI4J 2OPRB 3NGKA 1YRUA 3MM6A 3UFCX 1HQ2A 1N5VA 1TL1B 4X66J 5HATA 3MTJA 3G4SS 1G1XA 4CH7A 1UZDA 1IKYB 2HQ3A 3D0IE 4AQYJ 4CCHA 1JKHB 2LQ5A 2F65A 1O5JA 1T7PA 3AJ2A 4ZDNA 3GCWP 1FWKA 4M5NA 4ZCIA 3GB0A 1C1BA 3MAHA 3QZ8A 2L3MA 4HLBA 1KN6A 1R0AA 1AFIA 1RA6A 4OI1A 3LF0A 3W9JA 5DGBA 4IH6A 2J6UA 3DLHA 4QYZK 2Y1RI 4FKXA 1EQMA 4LRAA 1IKVA 3V6DB 4KIAA 4FNIA 5C24B 3KLFB 2K1RB 3JSMA 2RDJA 3PJ9A 3CE8A 5CCMA 3MDFA 3D67A 2WVDA 4RBVA 2LU1A 5IM0A 5F8HA 2MZ1A 3P5BP 1T02A 3M2RA 4LF1A 2F9DA 3M30B 1U1KA 2EFVA 1KP6A 1TQLA 1IM4A 2OMOA 4EU0A 3LOUA 1SPBP 3PEHA 1UA0A 4G65A 3C16A 2RHQB 2BJ9A 2Q66A 3U7JA 4PR6A 1SC4B 3BQ2A 3DGPA 5KFCA 2FPHX 1KQGB 2BANA 3CD7A 2CQ0A 2V67A 1F2GA 5HJYA 2EXUA 1FESA 4X65F 1ULRA 1J5EF 1WEYA 2GJ2A 2KVQE 3IP0A 2DGSA 3U1LA 2XC9A 1NPRA 1N5SA 1X0PA 4I2QA 5IWAJ 2HK3A 1VJQA 5CD4H 3KUHA 3QFWA 1TKZB 2MLXA 3DRPB 4CRJA 2KO1A 2LLZA 2YKAA 4FPIA 1QUPA 4WJBA 3QJJA 1LW2B 2XG8A 2C3YA 2OPRA 2J0QD 1VRQC 1RGVA 2UP1A 1Q81T 4JI6F 4I7FB 3MPUB 3R27A 1SH2A 1TL1A 1UWAA 1FWPA 1RDRA 5E41A 1RAOA 1IKYA 4FZVA 3CB4A 4OV1A 5HI7A 2QMXA 2UUTA 4IO9Q 1FNMA 3IWNC 1X4CA 2J8SA 3X1LB 5DRKA 4ZPDA 3BN4A 2V4RA 2F1FA 3VR1A 5D0EA 4LF4J 3DLJA 2RS2A 3HHNB 3UR3C 3Q8UA 2RHSB 2HK2A 2C2RA 1U4BA 2M70A 4A8QA 4IG3B 4QOTA 3AAWB 3JYTB 3V6DA 4ZVQB 3S6EA 3HVWA 5C24A 3KLFA 2K1RA 2MKCA 4FXDA 5KFPA 2VICA 3WZ0A 2E5IA 1N8RT 3LP2B 2WONA 4JI1J 2CPXA 4TKTA 4DV6F 2AZ1A 3M30A 5GMKa 2A1BA 2CPJA 4ZPVR 1WG4A 3HHLB 1PILA 3C46A 2HHPA 3OBIA 3PR5B 4YS2A 2JZ5A 1QAJA 4DI6A 2DHGA 1RXOB 2KN4A 2JVOA 3T1HF 2HPUA 2BQRA 2AYEA 3OTDA 4ZN1A 1I1GA 5ETOA 7FDRA 1RTIB 2M88A 3MPYA 4DSJA 2UUCJ 5D78A 1SQFA 3NCPA 2Z4PA 1D9FA 4LF5F 1HARA 1FERA 3UR0A 3K5OA 1VQ4S 4OLOA 1TR0A 3VHQA 1TKZA 3DRPA 2VH7A 1FE4A 2LP4A 1QY7A 2IFXA 3B8HA 1LW2A 1RHKB 2D41A 4C0BA 4M5IA 3K5LA 4O3QA 3RBZA 1HI1A 3ILJA 4I7FA 2Y1IA 3OXFA 2GO8A 2IJRA 3OVAA 3CEDA 4XO0A 3BS9A 5C42B 1SC1B 3CCSS 2HZCA 4F50A 1SXLA 1EQ0A 1MN9A 3H4DA 3MM9B 2G2ZA 2PT0A 4J7CA 5F8IA 4NCBA 3M8WA 1OIAA 4UOHA 1WELA 1NZ8A 2AW0A 3LGMA 2YNIB 4LIWA 2AIRB 5KFIA 3CJ0A 4TXSA 2W25A 4UY8T 2CPYA 3ZTOA 4HKQA 3QT5A 4IG3A 3HKZD 3JYTA 3LANA 1VJWA 1U1QA 3MECB 2E7WA 4RBTA 3O44A 4B9LA 5BR8F 3UI3A 2XLKA 2O01C 2ZDOA 3ZZTA 3LP2A 4FVMA 2EFGA 4DX6A 4GKJJ 3HHLA 4P75A 2VBYA 5KFSA 2Z30B 2RU9A 4ETZA 2RS8A 3CCMS 1HA1A 1WOSA 1KSPA 4OHZA 4CO2A 3BN7A 2HHVA 2IJFA 1LWXA 4C2MA 1RTIA 2XY6A 2XMKA 3VVUA 1ZH5A 2NUUG 2IM0A 3GYXB 1M1HA 3TI0A 4O0NA 2DR8A 4O0IA 5A6PA 4OZLA 2DD8S 2VB6A 5A2QY 1CG2A 4A8OA 2B51A 4J9OA 2HWTA 1RQ0A 2L41A 4USUA 4LR7A 4ES3A 1AROP 3KDOA 1TKDA 2KDOA 4A47A 5GMDA 2XM3A 3S1TA 1P6TA 4IOAQ 5K20B 3SCLE 3GIRA 2X1FA 4K59A 2HFUA 4K50A 1RP5A 2CJYB 4LFBF 4L6V3 1IR1A 2DCLA 5C42A 2HAIA 3PM9A 4QR0A 1UWBB 5CH7B 1BQXA 4OHVA 3MM9A 4NLRA 4OZ1A 2HLUA 3JS9A 5KT7A 2YX7A 2AMCB 3CT9A 4Y65A 1K9MT 3CJ2A 3LALA 2WSCC 2JNJA 2ZM6J 1RTDB 2QO3A 2YNIA 4FXVA 2XHWA 1A7GE 3BKUA 3OHBA 1UFLA 2ZBPA 4N7TA 1R8HA 1FHTA 5E5NA 4GO5X 2VF3A 1O51A 1S0VA 4QPTA 3BSNA 4M5DA 3EXYA 4DX7A 4DSEA 4J9KA 1Q16B 3MECA 4WU2A 2RUGA 3C3LA 2DGXA 4IRKA 5B0CA 4IFVB 4NCAA 4LT6A 3BGRB 2MZTA 1VBKA 3FGVA 1FKAF 1OJ4A 3WX4A 2ZH3A 4DDFA 2PO4A 3M6WA 2X7IA 3RJMB 1NK6A 1XQIA 3IM9A 3MFHA 3RAMA 3MUTP 4X64J 3AD9C 1FVSA 3H40A 1DLOB 1KHWA 2MZRA 4XPCA 3G8TA 2RRBA 4DFMA 5A8WB 4ZPAA 4L76A 4DU8A 2YKMB 2WW8A 2ZHBA 3NS7B 4ECQA 4OMFG 2HSEB 3IR5B 4NXNF 2M9KA 1WKJA 4U9RA 2XEXA 1PJ6A 2XSJB 3MR5A 3FSIA 4HACB 3GP9A 1VYAA 1IVZA 3QSIA 2N82B 2OD4A 3ZFVA 5JJBA 1YG0A 3PR4A 2MTLA 2KL8A 4CLTA 2OFGX 1SL1A 1NH8A 4A8WA 1CS4B 1PC4A 4OZ0A 1DY3A 5IV4A 3H98A 2BX6A 2G0IA 1T3OA 3ZZRA 3UCUP 2UXCF 5DLGA 3BJYA 2YWGA 5LMUJ 4OI3A 1IBMF 3O8WA 1GT8A 2QA4G 1PC5A 1MN7A 2DH9A 4ER8A 4RW7B 1UWBA 3TX0A 4Y3CA 4KGMA 1ZETA 4HDHA 3MPVA 2E1PA 2BKNA 3HJVA 5DO2A 1H7XA 5AXLA 4UY85 3KG0A 1RTDA 4G1QB 1KQKA 4M95A 3C8YA 2HS4A 1OSDA 2NUHA 4ZCKA 3PVXA 1WNEA 5ETNA 3NMAA 2QA2A 3R7NB 4O4GB 1Z1ZA 3T1AA 4IFVA 3BGRA 1HHSA 1G3OA 2DPIA 3H5SA 2XWYA 1U8SA 5L9NA 1DQ8A 4PG8A 2MY8A 1WACA 1WOPA 1URNA 1ZYQA 4X4RA 5LXRA 4X2BA 2AJ0A 4LF9F 1N5YB 4U8YA 5KG6A 1DLOA 2B7CB 1B0TA 1NSAA 3U27A 2D3ZA 1SQGA 5AXNA 2KYZA 1FXRA 1SUQB 4WP3A 1FFWB 2YKMA 3H0PA 2VA2A 4DQPA 4OYOA 3IAS9 5GAEI 3OQ2A 2XHCA 2XSJA 2FHJD 4FPRA 3TUZC 1R27B 3KUEA 1S4EA 4ZLJA 3H5YA 2AGQA 3V4MA 4OYXA 1X4DA 3H20A 1H98A 3LW5C 5KFXA 4HVZA 3HD2A 3UDLA 3ET6B 4EI2A 2FVQA 4B3OB 4FF3A 5LM7E 4W4MA 5T14A 1CS4A 2KG1A 4HHJA 3GZ7A 4KH1B 5HMYA 4HT7A 2W2OP 2XBPA 3CCVS 2ZBQA 3UD3P 1WHWA 5D6GA 1SKSA 1X4FA 4RW7A 2RDDA 5L46A 5BYSA 2R2SA 4GVBB 3PXGa 2E1AA 1JLGB 1UCNA 4R5PB 3KLEB 5E7OB 4M5HA 1U0SA 2B5JB 3FEXB 4IG0B 2XCPA 4F3QA 4A8MP 1PBAA 2J6SA 2QMUB 7AT1B 1E6VB 4UTGA 1RBAA 2RUSA 1Y11A 4N5SA 4G1QA 1CEZA 3D0GE 4K4TA 4RW8B 1RAJA 4J9QA 2WAQD 2QEXS 3LGNA 1VISA 1VBXA 2EFQA 1BY9A 5H1SV 1Q8KA 4RUCA 4NA2A 3JQMA 1FKOB 4JI0J 3GR0A 4TU8A 2QN6B 4O4GA 3W9IA 2SXLA 2AGOA 3W61A 2AP6A 3HFVA 3NS5A 3I87A 2NZ4A 4P7VA 4WTOB 1X5OA 3AJ1A 1EETA 5LSLA 4P2FA 3E51A 3P5TL 4GC7A 1NB7A 2Z57B 1N5YA 4PG7A 2ZWPA 1EKRA 2A18A 1SUQA 4ATNA 5D4LA 3VGSA 3KHRA 3HT0A 1WC1A 2RMLA 4UW2A 3RUBL 3TJ9A 3GG1A 3GSIA 4B17A 4B3MF 2R7QA 3W2VB 2YNGB 3TUIC 5B0EA 1RLCL 1WWHA 2CJ9A 3AXMA 5CZVA 1XMQJ 4UQTA 1L3VA 2J7UA 2B9EA 3DDNA 3EYZA 5FJ4A 2XY7A 3ET6A 2QSFA 4B3OA 5E3PA 2ZBCA 3UO0A 2HBZB 1QVFR 2ZITA 2FYXA 4ZP7A 3M8RA 4BLGA 2G0CA 3M05A 4YHHJ 2GNKA 1NSPA 4GVBA 2ZNZA 1JLGA 3UNGC 4R5PA 3KLEA 1GFWB 3CJTA 4PUOB 2B5JA 4IG0A 1VK3A 3UDCA 2L9WA 3PIPQ 1RHJB 1E6VA 3DLEA 1WKKA 3BKFA 4DR5J 4EZ9A 1D1UA 4RW8A 1I3OB 2ZBIA 3EE3A 1WF2A 3DGVA 2YWWA 4W98A 4FYWB 3EWGA 4QIEA 4P7TA 4MT1A 2C3OA 4E98A 1FKOA 2C42A 3RRGA 5IT9U 2OSQA 2HFOA 3D6TB 3NCRA 1N32F 5D4NA 4I69A 4ZCMA 3GIMA 1Q5YA 2MZQA 4ELUA 5T41A 1Q53A 3SBMA 3TJAA 5H9FJ 1LKZA 2E7VA 1XK8A 3BGUA 1YGYA 1WJ9A 2IIHA 2RNEA 1DAXA 3MEDB 3TEHB 5KG1A 1IBCB 3ZZZA 1U2FA 3N6MA 1SV5B 2RRAA 3V2UC 3AA8A 3EDQB 4F0HA 5RUBA 5DZ6A 1ZM9A 2PMWA 4K2XA 1NAQA 1P9YA 3PYFA 4NXNJ 4A8YA 1DQAA 4FVCA 1KD1T 1Y4ZB 2QRRA 2R7WA 3W2VA 3DXSX 3KHGA 3U02A 3MCNA 1U6FA 2XSFA 5L38A 4DXLA 3CUNA 1F3VA 3DN9A 4JP8A 5KFEA 4GRSA 1HWIA 4P10A 1SJQA 3K0JA 4M94A 3G6XA 2BVZA 2DBBA 1U47A 4JB8B 2CXEA 1SKUB 3ETMA 3HZGA 1UJ5A 2UXCJ 3GIJA 4RBUA 4J9PA 4ZMMA 2PE8A 5DGAA 2CQGA 2HVHA 3PY8A 3PDNA 2C3UA 3L95X 2MEWA 3OV7A 2IBOA 2PFDA 3EZOA 3EVMA 4PRFA 2XCAA 2YQ1A 1ZAVA 4LSLB 3SCIE 1S1UB 1N56A 1LXJA 4C11B 2KJVA 3CDUA 3D7SB 5T7LB 2DKOB 2R8JA 4DPUA 1CJUB 1ZM4A 3VZIA 3W62A 1FRMA 2QLFB 1EAYC 2C3PA 3K5MA 4KH0B 2IRUA 3HP6A 2HYIB 4OX9J 4JI2F 4Q2MA 1HNIB 2CPIA 3LGHA 1VFJA 3M9MB 1HNZJ 1MMNA 2MKYA 4PG5A 4ELVA 1UP1A 4MTPA 4Y34A 3FBBA 1FXDA 5D0RA 2CPDA 2AU0A 4DV7F 3R5BA 4MKAA 1YSJA 1KLNA 4R8UA 2Y0SD 3MR3A 2KT2A 2HHHF 3US5A 5HBMB 4TLQA 5K8OA 2VQFF 5KG7A 4JYAF 3TVZA 3OT9A 2R9LA 5LL6d 1H7WA 2EFNA 2LVWA 3ICLA 2V8GA 3ZZYA 3MEDA 4LF9J 3W8GA 2XZTB 1QTNB 5HQ8A 5IFMA 4WFAQ 1SV5A 5EHHA 2AQ4A 4DV4J 4ECUA 2GGPB 1RHQB 5D0HA 2FTRA 3NGDA 2NYHA 3DRXA 4QWCA 5KFLA 3ZZOA 5KT5A 3JXOA 1R8AA 1FDAA 4RNFA 5EGYA 3ELHA 3UCGA 4PWDB 3LH2S 1SC6A 3OL6A 2DB1A 4ED2A 2Z56B 4JOUA 3BZQA 3O5TB 1B64A 1FK9B 3HCXA 4BS2A 3K57A 1H2TZ 4LF7F 2YKOA 1KNZA 1U6BA 1FNXH 2OEJA 2VC0A 2MKSA 4WFXA 2VV5A 2XS5A 2W4DA 1LK5A 2KM8B 2ADCA 4URQU 1FEEA 3CDAA 5MAOA 1B4SA 1KRPA 1UJ6A 4LSLA 4RPFA 1S1UA 5B0BA 1J5OA 4LFAJ 3IAM9 4C11A 2Y0BB 3VAFA 2ZH4A 5T7LA 4DLEA 1NCLA 2WW4A 1CJUA 3NNHA 4DL2A 2GQCA 3HT3A 4QU7A 2VC1A 3MR6A 1FRJA 1HNIA 2CQ3A 1ZM3A 2B4VA 2FGCA 4ED0A 2E7XA 4DPXA 1VIOA 5F41A 1R31A 4OX6A 2HFVA 1YJ9S 4NYOA 2DNKA 4OQJA 5GADU 2R8KA 4B9TA 3BDPA 4USKA 5HBMA 1VRUA 5HMWA 1QM9A 1JJHA 2C2MB 1CQMA 2V69A 4J37A 2OUGA 3M6VA 1QDUB 3JTOA 1XN9A 4PWWA 4L73A 5B0DA 1TV6B 1A0OB 4KT0C 4NYPA 3UVJB 2VKRA 2YXLA 4Y2MA 2E5LJ 5EWFA 1WKLA 3CD6S 4QZVB 2BOAA 4D3GA 5EX3A 2G1DA 2GGPA 3UDVA 2WSFC 4J91A 4AL7A 3G8SA 1S7HA 2M2BA 1FRKA 2ZFHA 1LWFB 1UVMA 2LDYA 2E1CA 2DK2A 2EI5A 2FQQB 3WC0A 2AZ3A 2Q1LA 2AT1B 4LVOP 4C8OA 1QSSA 1N34F 2C2ZB 4PWDA 3RR7A 2FZKB 3VVTA 2HRYA 1MWYA 3GV7B 1SL0A 1TKTB 4WIIA 1RHUB 3OJSA 1M5KC 1FK9A 1F1BB 3GFYA 3R7SB 3QT7A 2DO4A 4ED8A 2FZCB 2BYCA 3Q8VA 2F9JA 4J9SA 2HIQA 1U24A 5ADZA 1TK5A 3H7HB 2CZVC 4NPOA 4CT9A 2DGOA 2VUGA 3PX6A 2HHTA 3HPOA 2OPQB 3PACA 1AZSB 4KC5A 2W2PP 1JLAB 1RAHB 1FF2A 2NSCA 3UN3A 1SC3B 2CPFA 3Q8PB 2R8HA 3MCOA 5KFWA 2V0NA 1QE1A 4ZJQA 4LSZB 5D4PA 4CP5A 1MG7A 2IYIA 4C9DA 3SSQA 2XO7A 2PSZA 3I32A 2NR0A 1Q86T 4PPDA 4YDXA 1KDNA 2HGMA 2V9KA 5ITHA 2DISA 4QWEA 1PJ7A 4C97A 1WDTA 2HS0A 2CWKA 3TOQA 2MZJA 4UUWA 2R8GA 2N4DA 5J1EB 1U8WA 2QJ3A 4G1PA 3Q8RB 2R7OA 3CJ8A 1TV6A 1AUDA 1U09A 3UVJA 2E9ZA 2AWZA 2OJ3A 3GG0A 2R4FA 2J0SD 4LFCF 3NNCA 2IDEA 3CCTA 4WK3A 4DL0C 3IS9B 4OHWA 1YJVA 4CYUB 4NWBA 1GXUA 1OSCA 2CQHA 3ITHA 4DV3J 5KT2A 1LWFA 1Y5NB 2V2ZA 1AB8A 3KLVA 3KG4A 1B0VA 5LSRA 4MIBA 4IRCA 3EVOA 3HHEA 4P73A 1KONA 3PZPA 2HGNA 5J2NB 4DJBA 3QLHB 1SB6A 1TKTA 3LTOA 1YRTA 3H2UB 2M8DB 1WG5A 3IRWP 5U47A 3FSXA 1H3DA 4E0DA 4TN2A 1JXEA 1TKXB 2ZH9A 2F4VF 3BO4A 3FCWA 2KTQA 3RBDA 4KHRA 3PEJA 4CH1A 1EHWA 4YY3F 2RQCA 2OPQA 1RKIA 5D15A 3WDOA 1AZSA 5DLFA 1JLAA 4ECYA 1FDNA 4DMZA 1ZPWX 2YNHB 3QQCD 1OY6A 1RSCA 4HTIA 1FWLA 1ZPVA 3I96A 3PCOB 1DTTB 3U1MA 1G7CB 3KK1B 4JI2J 4F4ZA 1D0EA 2D9PA 4X4QA 2MLYA 3BREA 1N6QB 1UVKA 1XR6A 1VR6A 3N5BA 4JI5J 1T0TV 2RAQA 2FLPA 2FC9A 1YJRA 3N9UC 2HW3A 5KTQA 2KXFA 4UQGA 3UCZP 4JI3J 3J7A1 1HFEL 3NOCA 2MB0B 2R7VA 3CDEA 5J1EA 2DHXA 3FCVA 1REVB 3A4TA 2XI2A 1XJWB 4MFBB 3CF5Q 4KKOA 1VQLS 2VBXA 3QO9A 1Z2ZA 3W64A 3OL9A 3NY0A 3Q2SC 1VRTB 2ZC4A 4NMXA 4K4XA 3IBWA 3R9LA 3Q86A 4KB7A 3E2EA 3EGNA 4LRCA 3TWZA 1IR0A 3RW7A 4DS5A 4CYUA 4EBDA 1T95A 1S0OA 3ZC4A 3G9CA 2KZMA 4HYKA 1Q0NA 2E1MC 2V8VA 4U6PA 3HZEA 4QCLA 5A8RA 3ZTSA 2C2DA 5G4DA 1TL3B 2DY1A 5J2NA 3QLHA 3QIDA 1PAUB 1T05A 2M5YA 4IH5A 4YUDA 2EKYA 3QAEA 4PXEA 3TAQA 2EEYA 3ZTQA 4CLPA 4LF7J 3IO1A 1TKXA 1RYSA 3D3CJ 3CJKB 1I6JA 1S79A 4M5KA 5CABA 3FVYA 3C2PA 1NK8A 2H3EB 4C4WA 3HI9A 2M7SA 3B4MA 4J9UE 4ZPCA 2XQCA 3JQJA 4P71A 1UKUA 2HNZB 1F5AA 4DV2F 4CQ1A 3HO1A 3CC4S 4ZVUB 3HSGA 2AJ4A 1BHNA 3TAMB 1U1MA 4B08A 4NZ7A 3LA0A 4DR1F 4NLWA 2WVBA 3NAHA 1O0PA 4R0JA 2YNHA 2VFUA 1VK8A 1O6XA 1UVNA 1JNRB 3TZWA 3F41A 4KGXB 4YQWA 1DTTA 1H2UX 4LUBA 4Y2IA 3ONQA 4DR7F 3KK1A 1HR0F 2HMIB 4CO1A 5JMNA 3I82A 1IBKJ 5IT4A 3CCRS 2FC8A 2CA9A 3FZBA 1N6QA 2VQEF 1MMLA 3DI6B 1T3NA 1PYSB 4DQRA 4IR9A 4BC7A 2RH3A 4NMLA 1JK9B 2K7KA 3I5BA 5DJBA 1OPZA 5E3QA 4QPXA 3FRZA 1REVA 3H90A 5AJ3F 2ZD1B 4MFBA 2H5EA 2CJQA 3SV4A 2UU9J 1RHMB 1VRTA 3SI8A 2J9DE 1B99A 2CPHA 2QYCA 1I5OB 4ZVOB 1FO1A 2JFKA 2U1AA 4B3TJ 3F0NA 3TVYA 1LXNA 2A10A 3AOBA 4ES2A 2IBKA 4F67A 2X51A 1W7WA 3VGVA 1R8BA 2QYGA 4EO8A 1T94A 1BXNA 1JLBB 2CQDA 2G4BA 2LQBA 4QIGA 2J8AA 2E29A 2CRLA 5BYQA 1R3NA 4CDIA 3MURP 3D0HE 1ROFA 3BQ0A 2UUBJ 5C2CA 3CJKA 1RISA 4YB6A 5E3CA 4DR6F 3OL8A 3PYDA 1RT4B 1N33F 1QAXA 2EWHA 2HNZA 2ADBA 2IVFB 3OFGA 2DH7A 3TAMA 2BJ3A 2QT7A 2W7OA 4RW9B 1NK5A 1BQNB 2FB0A 3IWXA 1NJZA 2DR5A 2EC0A 4DR2J 2OELA 4FYYB 1R0BG 2Z2ZA 5ETTA 1ZTTA 5B0GA 2HMIA 1SKWA 2PEBA 2AYMA 2XLJA 4C8NA 2VODA 1VC5A 3CJRA 1PYOB 4GKKJ 4TY9A 2OTLS 3N5FA 3CMAS 4GVLA 3GV5B 4DFJA 1N88A 3DI6A 3K5NA 4KHPF 1JLEA 2XWXA 3QAUA 3DOLA 3BGOP 1KOHA 3W9HA 8ATCB 3A1YG 3SCJE 1YBUA 3AQPA 2FHJA 3EXCX 1HKAA 2HFSA 2HZVA 5L1IA 2UXBF 1LW0B 1RABB 2ZD1A 4DV5J 6FD1A 3CMQA 1S72S 2JEJA 2KZZA 3DRSB 1N54B 4ZITA 2B7BB 2ROGA 4DUZF 2FJAB 2QC3A 3K89A 3ILIA 2V34A 1QUVA 1TUWA 3U1NA 2GS8A 3PX4A 3M2VB 3W60A 3KTQA 4TNOA 4O44B 3AD7C 1UETA 1RCOB 3DMJB 2BXJA 3KNAA 2CVEA 1M5SA 1NDLA 5CHCB 4JUZA 1XIQA 2EK1A 3PRBA 1FI4A 4NCGB 3IBFB 3PV8A 1NEEA 2XYPB 4C0OC 1F5CA 3I5CA 4KPYA 2CNNB 3W3SA 3FBEA 2O5DA 1AYEA 2I8EA 2RIJA 3UWTA 5F8GA 4NLOA 1NPKA 2GMJA 4BBYA 1RT4A 3ZNJ1 4FBTA 2E5JA 2BV3A 1N0VC 5IQ6A 3CPWR 2MYFA 4RW9A 2HBQB 1BQNA 4JI8F 2Y9HA 4N8NA 4Q8FA 1W2IA 5GAGI 2B6AB 4QIVA 2C2NA 2ZUAA 2CG8A 4ECXA 1KTQA 2MGZB 1VHFA 1VQOS 1VMBA 3BBCA 1RA7A 2OMLA 4C6AA 2OPPB 3E01B 2LFVA 5KFHA 1ZOTA 4X84A 3I5AA 1GX5A 4FBUA 3VCDA 4F04B 4DPTA 4C8YA 4O3OA 1U25A 4ZP8A 3QJPA 2ZHOA 5KFMA 3T5JA 1NJYA 3FMWA 2HQDA 4EYIB 1T9VA 1LW0A 5KFOA 4HH0A 2F8MA 2XI3A 3DRSA 3OFEA 1Y5LB 4ZPTR 1DFDA 1YKWA 3QFHA 2QLJB 3J80Y 4YDDB 2J76E 2MQPA 1S6QB 3MD3A 3RB3A 4DQIA 4O44A 3B78A 5FLXY 3HJFA 1KLMB 1QJHA 2CJAA 1RK8A 3KXDA 4NLQA 3KJNB 4UT4A 2KT5A 1IKWB 2FVCA 1P8GA 5AT1B 4Z7CA 3KJQB 3KYLA 2C3MA 3GJTB 4LVNP 3T1YF 1CSJA 3CJ5A 1HNXJ 4V19X 3DC2A 2CJKA 1D8ZA 1ZAWA 2Q3PA 1WSRA 2AKWB 2GMHA 4DL3A 2KB2A 3PO4A 3T5HA 1VGYA 4AL6A 4F3MA 4KGZB 1R89A 3MF5A 1NJWA 3PFOA 1FRHA 4U7UD 1IKVB 1JB0C 9RUBA 4RL1A 3HHKA 4NZ6A 2IM2A 2ATCB 2CYYA 3DRRB 4U7CA 4DOZA 2LA4A 4DFKA 1VQ8S 2Z2MA 1M5PC 4MYTA 1GX6A 2FY8A 4AD6A 4OYIA 1U0HB 2HQGA 1UFKA 2B6AA 2FVPA 5D77A 2W9CB 2A6OA 4ZJOA 2HHWA 1H72C 1HI0P 2RVJA 4B02A 2MGZA 1GMVA 1NHKL 2ILZA 3IM8A 2CFXA 2R7XA 3UD4P 4C8KA 4FKYA 1FDBA 1N5QA 5H9EJ 5AE3A 1U48A 2IMWP 2KFNA 2QZ8A 2IC3B 2B43A 5EWEA 2VG6B 1GMWD 2P8IA 3MAAB 3PIOQ 2WVCA 4Z2XA 1DBDA 1V5IB 2L08A 1ZAXA 2G13A 3D6MB 4GO7X 3FEYB 5I3PA 3VTIA 3FKBA 2KI2A 1FE0A 2B4PA 3OL7A 3JSRA 4ALZA 2E9TA 2LXFA 1XTZA 2IJNA 5K8MA 4IDKB 4FF1A 3D2WA 1B7FA 3PRDA 3DOKB 2O3DA 2DHHA 2DR6A 2BEFA 1S6QA 4ZLNA 3NKYA 2DITA 2JOQA 3S8SA 3PW7A 1KLMA 4NLTA 4PYAA 1J2VA 1IKWA 4WWSA 2ALZA 2BACA 3DNCA 1RWWB 3D1QA 3N0VA 3FDSA 5CA5A 4Q8EA 2UUAF 3DU6A 5M2RA 2H48B 3ILOA 2I9SA 4LF6F 2CQ4A 4LRDA 1UPMB 3VAJA 5A8KB 4EZ6A 2CNOB 1T11A 1TUGB 2PA3A 4IYQA 1FJ7A 2IY5B 2AEMA 1HHQA 1X4HA 1PGZA 4OZ2A 2COLA 1U1OA 1U1NA 4LJMA 2CQIA 3M9OB 3KOAA 3D9BA 2I5JB 3K5PA 4UZCA 1N33J 2WHOA 3DRRA 2J0XA 3N6LA 2ZJPQ 4ZVSB 1GQEA 1Q79A 4F7VA 3K58A 2MSTA 2DY9A 1KVJA 2E5GA 1CC7A 4ED3A 5GMEA 2WONB 3HVTB 1RB0A 4IH7A 1U0HA 5KAKA 3MD1A 3GFZA 3V81B 2B8PA 4YR3A 2C2EA 2QA1A 2WB4A 2W9CA 5F9NA 1RWUA 3RU0A 2PD1A 2MXYA 1PIEA 2R7UA 1S12A 3K2YA 2OTJS 2HEKA 2IC3A 4UF4A 1I94F 1LFWA 5A76A 3PJWA 3NGTA 3SSRA 2VG6A 3MWBA 3PRVA 3RTVA 3MAAA 2DO0A 2UV8G 4OYAA 5DM6Q 4X4SA 2JJ4D 2GIQA 2CQCA 3VGTA 1QSLA 2JLFA 3MFIA 3K59A 4NA1A 3D1HA 1NK9A 1UPPA 2AX0A 4DUYJ 5B0FA 3A8IA 3DYAA 1NZAA 1M0SA 2C2OB 2DNGA 1R8PA 2ZEJA 4XDDA 3RRKA 3DLBA 1XMBA 2XMAA 3QBCA 4IDKA 3VZHA 4YEAA 3DOKA 2MKIA 3GTYX 4LBHA 4FDFA 4YN3B 4U7UK 3FRYA 4J9MA 2NQPA 3R2DJ 4JI7F 3X3UA 4C3KA 1AT1B 1F0XA 3ILLA 1S1TB 2VBWA 4KTQA 2AYBA 4WE1B 3B82A 1G2EA 2WZ1A 3B6BA 4QYZJ 4U95A 4F25A 1CULB 3CIMA 4C8ZA 3LWMA 2GVDB 1MROA 2WBMA 3G6VA 1XNQJ 3PW0A 5A8KA 2W9AA 2UXDF 2EPIA 2D7SA 2RKIB 3NXZA 1CJKB 4DCPB 2I5JA 3BO3A 3JQKA 4EK2A 2XB2D 1UMJA 2Z8QA 5L1LA 2VA3A 1LQ9A 3HVTA 3WIVA 4JI8J 3HX9A 1CC8A 3V81A 2BJ8A 4HR2A 4F4AA 1ZTWA 3A8EA 4LF8J 3KMQA 4DV1J 4N76A 2W8KA 2MY7A 4K0KF 2ZOGA 3H59A 2JH3A 1FJGJ 3R2CJ 3S7RA 3GIIA 4ZJLA 3GYGA 4LBPA 4Q45A 5EX0A 3ISNC 3EGVA 4ITSA 4LREA 1VQPS 4Y0FA 4XIUA 4QJVA 4TYBA 1AW0A 6FDRA 4DQSA 4OYZA 5HN0A 3ISND 2Y1JA 2XGPA 2CUYA 2E9RX 1FXLA 1N4LA 1APSA 4ED7A 2YX4A 1BC6A 1DJ0A 1UJ4A 2ZNYA 4TQRA 3GQCA 3TANA 4DCOB 3TEGA 2D3OR 4PWUA 2DTJA 1EX8A 2APOA 4QW8A 3RBXA 2NXUA 3T5KA 4WTYA 2PEHA 3W7BA 2L9NA 3NNAA 4DSLA 3DLGB 2W8LA 2EC2A 1UVJA 4XK8C 3O2IA 2M3DA 4U67Q 1XNRJ 2OIHA 2D69A 1RAIB 2NXCA 3SFGA 5LMNF 2BUNA 2VG7B 4RX6A 1S1TA 3DHWC 4CLZA 2QSWA 3OR2A 4WE1A 4YB5A 4CM2A 1CULA 3V6JA 3IWLA 3R6LB 3RAXA 4ILLA 2NZCA 1X9SA 2GVDA 3H2VE 1U26A 4NE9C 5E2QA 2YH1A 4OJGA 5ETVA 2IMOA 4B3RJ 1Q8LA 2GW8A 1X5PA 2ATLA 5KFTA 1VQ6S 4B3SJ 2W9BB 4M5DB 2MHNA 4K4WA 3CW2C 2RKIA 1CJKA 3N4WA 1VBZA 4DV0F 4K4YA 1WEZA 4ICLB 2Y1LB 4H4OB 3P3DA 4CLUA 3C15B 1JLQB 4NXMF 5EWGA 1VI7A 3TQEA 5KFZA 4BCAA 3C19A 3THPA 1IR2A 1FTRA 4RR5A 3KWMA 3O1LA 1DHMA 2G0JA 3CULA 2DVIA 4ZHRB 2AF6A 2IM1A 1UEUA 2CG4A 2LEPA 1SBRA 1NRKA 2BRKA 1TZ0A 4JI4F 3ENWA 1A9NB 2PI5A 3PHTA 3NG8A 4X66F 1VBYA 3T9ZA 4PXBA 4TU9A 2WVFA 4AQYF 3E8OA 4MIWA 3DLGA 4YB7A 4LQ3A 3HM9A 2KXNB 1Z4UA 3M6XA 3QRPA 4H4KC 2DNQA 4GMKA 5ETPA 4QR1A 1FCAA 2WB1D 2VG7A 3TRGA 4N56A 5FDLB 2G1HA 2GQQA 3POTA 1PO6A 4OI2A 2W01A 3MHYA 4ID8A 3DLLQ 1MU2B 4C98A 2XYGB 3WBZA 1KWMA 3MCSA 5KFUA 1S0MA 2QL9B 2UUAJ 3JAMY 4TY8B 2KU7A 3CO0P 4E2FB 2RT3A 4QIFA 4ECRA 3BSCA 3G8QA 4LMZA 3LPEA 1YZ6A 2MHEA 3L3CA 4DBQA 3SEOA 4F0MA 5BXIA 3LO3A 5C7PA 3MR2A 2BZ2A 4K4UA 4DF4A 2W9BA 1U49A 1S0NA 2UZAA 4OI4A 2ZH5A 2A2DA 2CVIA 1YHQS 2FJVA 2RB7A 1EZZB 1SI9A 3SIPB 1RYRA 4ICLA 1NUEA 5KG0A 4H4OA 1QD1A 3M8YA 1FNOA 3VAHA 4KY3A 3C15A 4TVAB 1JLQA 4ELTA 3LP1B 2CIMA 2VHGA 2W2MP 2L9DA 2VDHA 2CJXB 2VOPA 4USHA 1LOUA 1VOMA 4L3NA 5F8MA 3IMQJ 1QAIA 5IWAF 3ULHA 4A4JA 1TFYA 3MM8B 4DLGA 4ZHRA 3MMCB 2MMYA 1TL5A 1KR4A 1FRXA 2GHPA 5KG2A 2W2NP 2AJFE 2AD9A 3W65A 3CTRA 3GJRB 3CCES 4USJC 4X65J 1YDLA 1J5EJ 2OHDA 1TU0B 5E3AA 3MUVP 2GZOA 2CADA 3OTCA 1ITPA 4ZVFA 3KUGA 2VFVA 5KFFA 5L1JA 1MWZA 1UAWA 2K3IA 1FRIA 4F4XA 4NLGA 1OS5A 2VBZA 4OZ5A 3R5CA 2GHWA 2LEAA 1C4AA 4JI7J 4JI6J 3QGGA 4LF4F 4ECSA 3HXMA 5FDLA 2VPYB 1RAGB 3GFHA 3TUJC 3SV3A 3OVSA 3TVKA 1MU2A 4C8MA 2AV5A 4J5OA 1K73T 2AEJA 2C28A 4TY8A 3NLCA 1ICEB 3RGIA 4ED4A 4KR0B 2JEGA 4HH1A 4JI1F 5HO4A 4N41A 1WEXA 2GC8A 1LFPA 2M4MA 4MJKA 1IJEB 2VG5A 3H2LA 4M5JA 3QT8A 3ENQA 2HIYA 1WTFA 2B4OA 2EG2A 3FQKA 5KG4A 4BC9A 3AXKA 3M6UA 4BWJA 4OYPA 1KFDA 5L1KA 4OLPA 3W66A 1YITS 1EETB 4RUHA 4ZVEA 2J7KA 3LP1A 1HQUB 4DV6J 3ZO7A 1Q8IA 1VC6A 3ZTRA 2UUCF 1RWKB 1NKCA 2CZ9A 2XMTA 3HVAA 3QWUA 5KFQA 4K4SA 2QL5B 4JV2A 4WXOA 4IRDA 3EZ5A 4NRTA 5DDOC 3QNWB 1M1GA 3MM8A 1HNWF 5J2PB 3QSYB 5FLXU 1WI6A 3MMCA 3T1HJ 2H1YA 4NL5A 1VQMS 1YTYA 3PFEA 2JL9A 2PI4A 3AB4B 5F3ZA 2FGOA 4ZOSA 4IKAA 1QVGR 5IOLA 5GAHU 3FSYA 3MPWA 2DNPA 4LF5J 1X7VA 3OUYB 2HLTA 3LPYA 3N28A 1Q7LB 2MSSA 5IQQA 3G6YA 2VOOA 1HW8A 2I38A 3UW1A 1WSVA 2J6TA 5BYRA 2HVZA 2P6TA 4K4VA 2D3UA 2EBGA 5DG7A 5IZHA 3J7AN 2CNKB 3TUPA 4P2SA 4I6WA 4I1TA 1S48A 1R0CB 3GSDA 2E5HA 1N0UA 3H25A 1NPPA 2H9ZA 3K8WA 3TP2A 4DG1B 3Q83A 2V2QA 2I2YA 1RWNB 4CNYA 2HG4A 1RT7B 4K4ZA 1A6LA 2DHAA 1YRXA 2F63A 1S6PB 1IN0A 5F8LA 2VL1A 1TL4A 2N7CA 2Q6CA 2HHQA 3DLEB 2YH0A 2FDNA 3PJXA 5EN1A 2B56A 2MJNA 2OGUA 1DTQB 1HPZB 4HI2A 3L7PA 1T8EA 2ZH8A 4RJVA 3TA1A 4A46A 2MKJA 3G96A 1BD6A 2VFRA 1F5BA 3IG1B 4DV0J 3QIPB 3RBEA 2H51B 2XLIA 2FZGB 4E8UA 3AHPA 1SKRA 5BR8J 3C6UB 4I67A 4PQUA 2J0WA 1R6YA 2O66A 1JMTA 5KG5A 1X5TA 3CWJA 3KLGB 4IQXA 1JXLA 3VWSA 1HQUA 4ZLLA 8AT1B 3P45B 2JC1A 4CNZA 3BH7B 1PG5B 1JJCB 1CJTB 2J5AA 3T19A 5BJRA 3AQOA 2LDIA 2HBYB 3VQTA 3JB9k 3DCAA 1OYEA 1WF1A 5K5MA 1Y10A 1RCXB 3A8KA 5J2PA 2LEBA 2QFIA 2ZOFA 2V6AA 3NWGA 4YMEA 5J2QB 1YJUA 5LOQA 4DN0A 1R43A 4IQMA 2B9YA 1YI2S 1M5OC 4WF9Q 1EARA 3M8PA 5B7WA 4LBIA 4Y2KA 1NLKL 3OUYA 1D8YA 4AT1B 4ZVGA 2C22A 1HBNA 4ZPWR 5D4OA 2CAJA 1ACMB 5K9FA 2VJUA 2H4WB 4J9LA 5F9LA 1BWVA 1YBTA 2NPFA 1OPIA 4IFYB 2FD2A 4KRWA 1PAEX 2Z0GA 3O3LA 1M5HA 2V8HA 5IS2A 3EPIA 3TZZA 2HVEA 1P1TA 2ZM6F 3MZIA 3THVA 4KFBB 2ACMA 2YWHA 1AXQA 1DURA 4LFBJ 2W24A 2ZZTA 4WYLA 4DG1A 2PIIA 1X0FA 4K5SA 1Q5VA 3HD1A 1RT7A 4I68A 3OFFA 4IR1A 3R1HA 2RQ4A 1F9FA 1S6PA 4ILRA 1YZ7A 3DOMB 3W5XA 4ANEA 4HHHA 2DRDA 1GTEA 2V8PA 2R2RA 1WG1A 1B3TA 5ETLA 1DTQA 3RRHA 5F8JA 1HPZA 3WHIA 2GIFA 2Y8WA 2IVMA 3BPSP 5D8HB 2QTWA 3VAKA 5CQGA 4X64F 4RW6B 4FF4A 3IG1A 3QIPA 2V63A 1FTCA 3KKFA 3C6UA 2FLNA 1R6VA 5F0WA 2Z2YB 4FS1A 2ZDPA 1VQSA 4R8UB 2GV1A 3KLGA 1BWEA 1T9YA 4OX7A 2FIUA 3D28A 4J9VA 4RNOA 5IT9Y 2FY1A 1CJTA 2W7AA 3Q0AA 5CXTA 4YFUA 4BWMA 1V6HA 2BJDA 3B4DA 1OMSA 4IUFA 2DH8A 1S49A 3G86A 2B9WA 2VASA 3V6HA 2V5HG 5DS7A 3Q8YA 2BQ3A 1JIHA 2NCKL 1OWXA 4PCQA 3RR8A 5J2QA 3HLUA 3CDBA 1FD8A 3PYGA 3LWLA 3UQSA 1C2PA 4O3SA 4QIWD 3CD0A 1VLYA 1X4EA 5LMUF 3CCJS 4XDCA 1GMUA 3T3FA 5CYMB 5DDPC 1S1VB 2ZOMA 2M0GB 4FF2A 4HI1A 1T9WA 4CWBA 4IFYA 1E6YB 3DKDA 1UEKA 4ENOA 1HYSB 1JKHA 6AT1B 1W2BR 4IOCQ 1FFSB 2BKPA 4ZN3A 4V19J 2ALYB 2KHCA 5IT0A 1RTHB 4KFBA 1M5VC 3EGZA 3BBFA 2HHXA 4EMDA 2XMJA 3EMTA 2HRUA 3VF0B 3N79A 1IBMJ 3NGSA 2YTCA 2WRMA 2POKA 4Q0BB 2KM8C 4DF8A 1UEVA 5HVGA 1YJTA 4GC6A 3HFKA 2DR7A 4OX8A 4M5GA 1J5OB 3DOMA 2QLBB 2FVRA 2MKHA 3A13A 4QR2A 1BE4A 2DGWA 3PW2A 2ILYA 5LJ5Y 4DSFA 1N5TA 4ZS6A 4RWXA 1F6TA 2N7YA 3SDEB 1S9FA 3E3XA 4DPYA 5FIIA 5JXSA 2Y8YA 2DXFA 4B9SA 1YBAA 5GADI 4B9UA 2J9DA 2ZWOA 3R5AA 4RW6A 3GYNA 4PXDA 4OJ3A 4DX8H 3MEEB 1GMWA 2CKWA 2EK6A 5G0RB 4TLRA 4QQBA 1OY8A 2YQ0A 4DPOA 1J27A 1VRUB 1GTHA 3FK4A 3OSNA 3QWPA 4L75A 2ZHAA 3CC2S 4M1KA 3Q24A 1KHVA 1K1QA 2XS2A 1HNWJ 2GHVC 4MKYA 3C6TB 3FCHA 2LYVA 3GR1A 4ECTA 1S76D 2YKNB 2FJXA 1WUUA 3MUMP 5AXKA 4TQSA 3MMJA 1RWMB 3G2XA 4I2PB 1REGX 3EGWB 5CYMA 5E3RA 1S1VA 2XTJP 1WC0A 3IBCB 2GFFA 1T9TA 4J90A 2YY3A 1E6YA 4WK1A 1HYSA 1SIZA 1RACB 2RDIA 3D6HB 3TZXA 2DGTA 2CWXA 1SIWB 1TMMA 4CI0B 4CM0A 4P52A 4F4YA 1HNVB 1RTHA 5D3GB 3S01A 3NGRA 2RU3A 3HF5A 5J2MB 4USTA 1NNDA 2BW7A 4LQ9A 3RZAA 2ZZMA 4Q0BA 1PYTA 2HHUA 2A2CA 1Z2LA 4JI0F 4Y2AA 3HVRA 1SQEA 3QGIA 1JXVA 1JX4A 4P72A 4ES1A 3CCLS 3BSAA 1WORA 1IBLF 1DRZA 1JJ4A 2GCFA 5E33A 4EUVA 1YQHA 2G9OA 3IC1A 4WZMA 3FBFA 5ETMA 1QE1B 3SDEA 2JFDA 5DG9A 4EYHB 2K2PA 2LQ9A 2HVDA 4CLWA 2CPEA 1KQSR 2X1GA 1F3FA 3PW5A 3BQ1A 2MPUA 3K8VA 3LP0B 3PYEA 1NDCA 2YBVA 3MPDA 3L7OA 2QFJA 2BJ1A 3MOZA 2F3JA 3QRRA 2JEIA 1UA1A 2OFHX 3MEKA 3MEEA 1VS3A 5A2QU 3W1YC 3EZUA 5G0RA 1CLFA 1VDHA 3O6QA 4OJHA 3VAIA 2ZVSA 2DNOA 3P49B 4PZVA 3QRQA 3OTEA 3GE9A 3JTNA 2DT9A 2H54B 2JHEA 1NSKL 2MQQA 3QMQA 2ERRA 3ZNUA 4M5MA 1XMQF 5JVGQ 3BH6B 2BA9A 2LQJA 3C6TA 4JV1A 3DFEA 4P74A 1WHXA 1HBOB 3TX8A 4I4BA 3ENVA 4DS4A 4DUTA 4ZVHA 2YKNA 3ITHB 4PG6A 1VQYA 1X4AA 3JAMU 2FJDB 2HNYB 4B3MJ 4MYUA 4I2PA 4C3LA 5HQLA 4K7QA 5D0GA 4W92B 3Q2TC 2ZZNA 4FYXB 4YHHF 2DIUA 1AA1B 2IVYA 5HL7Q 2VONA 3W8PA 2P6SA 4RU2A 1SJFA 3ENAA 4OV6A 2MKKA 2VJVA 4QU6A 1URRA 4RKUC 2BOPA 1HNVA 4DR5F 2PA8D 5D3GA 5JUMA 5J2MA 2UUWA 4C7QA 2AJQA 2HAFA 3CNQP 2NXNA 1UZHA 5J1PA 1HIYA 1XMOF 3NWRA 3FJ2A 1RU2A 3PNIA 4L3KA 3MM7B 1YLXA 3KFWX 3R8YA 2JDJA 2VPWB 2P9EA 3SQOP 3BBBA 1RU1A 3AOCA 4DR4F 2HQCA 4CLLA 1NK7A 3GCXP 2CNLB 2FJBB 1S10A 1CJVB 1NU4A 2IA6A 3V6KA 4DL7A 1X8DA 4LSNB 3LP0A 3B54A 1TELA 1U7LA 3MGJA 2QLXA 1N32J 1B70B 2PDAA 4Q7AA 1FT8A 1QAYA 1D9DA 3R7BB 5C2GA 2BMBA 4CT8A 2X1AA 3OTBA 1DQ9A 2JRSA 4ILMA 3EUNA 1NHUA 3OR1B 4HTJA 4KKOB 3QO9B 1S99A 3CJSA 4MIAA 4MAKA 2ASJA 1Y5IB 1S6UA 1YVFA 1KOOA 1GNKA 2VZ9A 4URGA 1XR7A 1VQKS 3RB0A 3SZ2A 3TW0A 3EJMA 1HBOA 1VHIA 4MK9A 1JQGA 2CPZA 2BQUA 4KBIA 2HNYA 4CO5A 4DWIA 4EBCA 2R3VA 1S59A 1RLDA 3SFUA 5A8RB 2HQFA 3C66A 4F8RA 5I4MA 1T05B 4OHXA 1OQ3A 3FBCA 4O3PA 4F26A 1WHVA 1SH3A 1RWXB 3W5YA 4USMA 2QLWA 3NEKA 3MI7X 1KBRA 3I9V9 1JLFB 4OX9F 5M2PA 4F2RA 1NDPA 1CQNA 3CJ3A 1V9OA 1G4CA 1HNZF 2AJ2A 4I0WA 3DLKB 1W25A 1IWGA 3MM7A 1HMVB 2DPJA 3PG9A 1QLNA 3FEZA 2JSXA 2KVIA 2E1RA 3M9NB 1TTHB 2RJZA 1GEHA 1SL2A 3QGHA 4NA3A 4YR0A 1CJVA 5CAAA 4OHYA 4CH0S 4WU3A 2V4QA 4LSNA 3ISZA 2R7SA 4ZIVA 3Q8SB 3I0RB 4JV0A 2AHOB 4DV4F 4QWAA 5A8WA 4DV7J 4HL9A 3BYRA 1WC4A 2XO6A 4USIA 2Q79A 2JX2A 5HQMA 1FJCA 5E0OA 1ZZNA 4A8XA 2HHHJ 1KKHA 2VQFJ 5KOXA 3QJLA 4JYAJ 3IXQA 2B4UA 3JSYA 4XPEA 3OR1A 4HACA 2I6WA 1RBLA 1FA0A 2V94A 1B7YB 1HD0A 5J1NA 2JVRA 4EGLA 1Y3KA 4V1Ak 2YNFB 2M8HA 3JSBA 3PO5A 3PX0A 1HQEB 2J9EA 3EX7B 1BQMB 2CQ1A 1Q7YT 1MW7A 4H4KA 4M8LA 2JLEA 1RWVB 1TUVA 1RI7A 3J81Y 2F8HA 1EIYB 5CD4A 4PABA 1S7IA 4ANDA 4OI6A 4DCJB 1RUSA 1HBUB 2ASYA 3QGPA 3OVBA 5LJ3Y 4A8SA 1GXTA 1FFGB 3LAMA 4LIRA 3SSSA 3P96A 1DZ5A 4LFAF 1VQ5S 4HT5A 3OJUA 2EBEA 4UOCA 5IC4B 4I6YA 5ETSA 1FD2A 4WIQA 2DNRA 1NH7A 1JLFA 1V3SA 4ZPBA 1BMQB 3CIZA 3BEGB 1HI8A 1SJRA 2LXIA 2AJ1A 1F60B 3MXHP 4X4VA 2K3KA 3DLKA 3AJDA 1S5ZA 2OO4A 1HHTP 1HMVA 1RTZA 3V5RA 3TQ1A 2QIFA 2UVWA 3BV8A 3D4JA 1IBLJ 5KFYA 4ZA1A 3AOAA 1N48A 1ZS6A 1UW4A 4FN5A 4JV5F 1TK8A 2DNLA 2ZVIA 4RWWA 2JEFA 3GWCA 1H2VZ 4DR3F 3ZXWA 4AFFA 4NLUA 4EEYA 3KK3B 3I0RA 5H9FK 4PKDB 1JLEB 4P2XA 2E5LF 4YP3A 3NP5A 3DOLB 2HWHA 1XEZA 2R8IA 3CO9A 1UFWA 5KT6A 2GMLA 1PKUA 3I0SB 4NYZA 3SQGB 1FEHA 1RT6B 4FYVB 5GAEU 4R0EA 2O67A 4YB1P 1LV5A 2XMWA 2IHR1 1HWLA 3PW4A 1U1PA 2XMUA 5CYQB 2YNFA 1LEOA 1UTAA 2OPSB 1HQEA 5KFGA 1BQMA 5B08A 1HW9A 2D9OA 4CO4A 4O4RA 3G71S 2ZJQQ 1O8BA 2HURA 2ZH6A 1U1LA 1RAAB 4DL6A 2G2YA 3MR7A 3DDKA 1HBUA 1N34J 3M8QB 1P27B 4AE5A 2KHDA 4RUBA 4F0KA 2HFZA 2NLWA 3HSJA 4NRUA 4Z37A 3T6BA 1N52B 7FD1A 2PMHA 1L3UA 4DHVA 2ASLA 3MEGB 1WI8A 3M7VA 4OI0A 1RAFB 3P6YC 3DXBA 1TAUA 1UW9A 2KH9A 2EKNA 2X3GA 3DM2B 2ACYA 4C48A 2VPXB 3T41A 1TAQA 4KPCA 1ZBTA 4UOGA 4A8FA 2RQMA 3RAQA 4Q5VA 3UNYA 1W26A 1BGXT 4ZVRB 3Q8QB
chains in the Genus database with same CATH topology
3MR2A 2BZ2A 4RBVA 4K4UA 3Q8PB 3TR5A 4KJIA 1NK0A 4DF4A 2R8HA 2W9BA 1U49A 3TNVA 1S0NA 2LU1A 5IM0A 5F8HA 2UZAA 4OI4A 5KFWA 2ZH1A 2V0NA 4DSIA 1QE1A 2MZ1A 2ZH5A 1T02A 2LXUA 2A2DA 2CVIA 5D4PA 2B0GA 2IYIA 4C9DA 3M2RA 1YHQS 2FJVA 2RB7A 2R7RA 4DFPA 3SSQA 3BM7A 1SI9A 2XO7A 3NL0A 2F9DA 2O1PA 3M30B 1RYRA 3H5UA 2PSZA 3I32A 4ICLA 2NR0A 5HLFB 1Q86T 5FD1A 5KG0A 4PPDA 4H4OA 4YDXA 2HGMA 1U1KA 1FNOA 2V9KA 5ITHA 3VAHA 2DISA 4QWEA 3J7ZT 2EFVA 1TQLA 4C97A 1JLQA 1IM4A 4RU9A 2OMOA 4ELTA 4EU0A 1RT3B 3LOUA 1UA0A 3PEHA 3LP1B 2HS0A 2CIMA 4JBCA 3I31A 2Q66A 3U7JA 4PR6A 1YIJS 4FXWA 5MLCV 4PG4A 3BQ2A 2L9DA 2VOPA 3DGPA 4USHA 1LOUA 5KFCA 1D3WA 1VOMA 2LKZA 2FPHX 4L3NA 3TOQA 2MZJA 1KQGB 1XERA 3TA2A 5F8MA 1C0UB 4UUWA 2R8GA 3OXGA 5HROB 4ED5A 5A0YB 1FKPB 2BANA 2CQPA 3KK3A 1QAIA 2N4DA 5J1EB 3CD7A 2CQ0A 5GVQA 5IWAF 3ULHA 4G1PA 4A4JA 3Q8RB 1TFYA 2R7OA 3MM8B 1F2GA 4DLGA 1FESA 2EW9A 4ZHRA 3MMCB 4X65F 1ULRA 1J5EF 5CZXA 2MMYA 1WEYA 1TV6A 1TL5A 1KR4A 2GJ2A 1AUDA 1Q1KA 1FRXA 1U09A 2GHPA 3CVKA 5KG2A 1S9EB 3GILA 2AJFE 3OTOF 2E9ZA 2XC9A 2DGSA 3U1LA 2AD9A 2DGQA 1N5SA 1X0PA 4I2QA 2AWZA 3CTRA 3I0SA 3CCES 2OJ3A 3GG0A 3SQGA 5CD4H 4UUXA 4USJC 2R4FA 4RZRA 4DV3F 2J0SD 1RT6A 1C4CA 4LFCF 5AE1A 1TKZB 5HMXA 2YNGA 3DRPB 3NNCA 2KO1A 3CCTA 2LLZA 2YKAA 4ECWA 2YWEA 4YOEA 4WK3A 1IUJA 4DL0C 3IS9B 4OHWA 1YJVA 1QUPA 3BSOA 4WJBA 3QJJA 4NWBA 1GXUA 1OSCA 1LW2B 5E3AA 2ZE2B 3THTA 2CQHA 3MUVP 3KJVB 2XG8A 3ITHA 3OTCA 5CYQA 2C3YA 2OPRA 2J0QD 5KT2A 1LWFA 1L3KA 4ZVFA 2QE5A 1Y5NB 1RGVA 2OPSA 2VFVA 2UP1A 5KFFA 1Q81T 4JI6F 3KLVA 4I7FB 5L1JA 3KG4A 1MWZA 3R27A 1B0VA 1UAWA 4MIBA 5LSRA 2K3IA 1FRIA 1SH2A 3IFEA 4F4XA 1TL1A 4NLGA 4IRCA 1OS5A 4MK8A 2VBZA 1RDRA 2K8GA 2KJWA 3HHEA 4OZ5A 1KONA 5E41A 3R5CA 3PZPA 2HGNA 1IKYA 5J2NB 4DJBA 3QLHB 1SB6A 1TKTA 2GHWA 2LEAA 4Q2LA 1C4AA 4FZVA 1YRTA 3CB4A 3H2UB 4NLPA 4OV1A 2M8DB 1WG5A 5F3TA 3IRWP 1NKEA 3QGGA 5U47A 5HI7A 4AUKA 4LF4F 3FSXA 2QMXA 2UUTA 4IO9Q 4ECSA 1H3DA 3HXMA 4E0DA 3M8QA 4H4MB 1FNMA 1MMDA 4TN2A 5FDLA 2VPYB 1JXEA 1TKXB 3GFHA 1X4CA 2ZH9A 3IWNC 2F4VF 3X1LB 3TUJC 5DRKA 4ZPDA 3BN4A 3SV3A 3BO4A 2V4RA 2KTQA 2F1FA 3RBDA 4PUOA 4WXWA 5LSOA 3OVSA 3TVKA 1MU2A 4C8MA 3MEGA 3VR1A 3I6PA 3DLJA 2AV5A 4KHRA 4J5OA 2RS2A 3HHNB 3UR3C 3PEJA 1K73T 4CH1A 2C28A 2C2RA 1U4BA 2ZKUA 3DM2A 4TY8A 4YY3F 2RQCA 3CCUS 2OPQA 1RKIA 3NLCA 2M70A 4A8QA 3WDOA 5DLFA 4KR0B 4IG3B 2N3LA 4QOTA 2JEGA 1JLAA 2OD6A 3AAWB 1Q4RA 4HH1A 4ID5B 4NLVA 3S6EA 3JYTB 4ECYA 1FDNA 3V6DA 4JI1F 5HO4A 4DMZA 1JJ2R 3HVWA 4N41A 1KS2A 5C24A 1ZPWX 4I56A 4CTAB 3KLFA 3NS6A 2K1RA 2MKCA 4FXDA 2YNHB 1WEXA 2F40A 1U6ZA 5KFPA 2GC8A 2E44A 1LFPA 4OZNA 3CXCR 3WZ0A 2E5IA 2M4MA 4MJKA 1IJEB 4HTIA 3V4IB 2RSQA 1N8RT 2VG5A 1ZPVA 4NLYA 3I96A 3LP2B 2WONA 3H2LA 1DTTB 2CPXA 2WK4A 1G7CB 3U1MA 3KK1B 4JI5F 3ENQA 4TKTA 1WTFA 2B4OA 2EG2A 3FQKA 4DV6F 3H4BA 4F4ZA 4WCEQ 3M30A 2FJEB 2A1BA 2CPJA 5GMKa 4ZPVR 1D0EA 5KG4A 4BC9A 5HLFA 1WG4A 3HHLB 1PILA 2D9PA 3C46A 3M6UA 2HHPA 3OBIA 4BWJA 4X4QA 4BHQA 2XMVA 2QV6A 3BREA 4JI3F 1N6QB 1KFDA 5K8NA 3PR5B 1UVKA 1XR6A 3TYTA 3N5BA 5L1KA 4OLPA 1YITS 3OW2R 1RT3A 1EETB 4RUHA 2JZ5A 4ZVEA 1QAJA 2FLPA 2J7KA 2FC9A 3LP1A 1HQUB 2YWFA 1YJRA 3N9UC 5A6WA 1Q8IA 3F56A 1VC6A 2HW3A 4Q43A 2VPZB 2UUCF 2DHGA 5KTQA 1NKCA 2KXFA 2XMTA 4TU7A 2KN4A 3HVAA 3QWUA 2JVOA 4HEA9 4UQGA 3UCZP 5KFQA 4K4SA 3T1HF 2HPUA 2BQRA 1C0UA 1NJIT 3J7A1 1HFEL 2AYEA 2WOMB 4WXOA 5HROA 4JV2A 3OTDA 2MB0B 2QMWA 2R7VA 5A0YA 1FKPA 3CDEA 4IRDA 5J1EA 1I1GA 2DHXA 3EZ5A 4NRTA 1REVB 5DDOC 1QTMA 7FDRA 1RTIB 3QZ7A 2M88A 3MM8A 3MPYA 4DSJA 1IJFB 1HNWF 5J2PB 5D78A 2RRNA 2XI2A 3NBPB 3NCPA 1WI6A 4MFBB 3MMCA 2Z4PA 4KKOA 3CF5Q 1D9FA 1VQLS 2VBXA 1S9GB 3QO9A 4LF5F 1OO0B 1HARA 1Z2ZA 1FERA 3UR0A 2ZH7A 3K5OA 1VQ4S 2P9CA 4OLOA 1TR0A 3OL9A 1S9EA 3Q2SC 4NL5A 1VRTB 1VQMS 1YTYA 3PFEA 2ZC4A 2JL9A 2PI4A 2EG1A 3AB4B 5F3ZA 4D3HA 4K4XA 3IBWA 2FGOA 4ZOSA 5KFBA 4IKAA 1QVGR 3VALA 2N3OA 5GAHU 1TKZA 3FSYA 4KB7A 3DRPA 3MPWA 2VH7A 4X4OA 2DNPA 1FE4A 3EGNA 2ASDA 3E2EA 1X7VA 3OUYB 2HLTA 3LPYA 1QY7A 3N28A 1Q7LB 1IR0A 3RW7A 4DS5A 2IFXA 2MSSA 5I42B 4EBDA 4BDPA 3B8HA 1S4FA 4X4UA 5IQQA 1LW2A 2ZE2A 3N01A 1T95A 3KLHB 1S0OA 1R7IA 2D41A 4C0BA 3KJVA 3ZC4A 3G6YA 3G9CA 2KZMA 2VOOA 1HW8A 1H6KX 2I38A 4HYKA 3K5LA 2E1MC 4O3QA 3UW1A 1HI1A 2V8VA 4U6PA 2OKQA 4I7FA 2Y1IA 3HZEA 3OXFA 5M2UA 2GO8A 2WTFA 2J6TA 3OVAA 5BYRA 2HVZA 4QCLA 5A8RA 2P6TA 4K4VA 2D3UA 3CEDA 3M32B 4XO0A 3BS9A 5C42B 2C2DA 4NZ0A 4MKBA 5G4DA 3CCSS 1TL3B 2HZCA 2EBGA 5DG7A 4DN9A 4F50A 1SXLA 5IZHA 2UVVA 5J2NA 3QLHA 3QIDA 4P2SA 2M52A 4I6WA 5LXYA 4I1TA 1S48A 3H4DA 3GSDA 3MM9B 1T05A 2M5YA 4IH5A 3PKYA 4YUDA 2E5HA 1N0UA 3H25A 2EKYA 2PT0A 3QAEA 4PXEA 2H9ZA 5F8IA 3TAQA 2YQ3A 4NCBA 5HMZA 3K8WA 4H4MA 3TP2A 4DG1B 3CSKA 3IO1A 1OIAA 1TKXA 1WELA 1RYSA 4RUAA 2I2YA 1UVIA 3CJKB 1I6JA 1S79A 2AW0A 4CNYA 2HG4A 1RT7B 3FVYA 3LGMA 3C2PA 2YNIB 4K4ZA 1GH8A 4LIWA 1NK8A 1A6LA 2DHAA 4URSA 5KFIA 1YRXA 3HI9A 2M7SA 2YVSA 3B4MA 3CJ0A 4C4WA 1JLCB 1S6PB 4ZPCA 4TXSA 1IN0A 5F8LA 2VL1A 1UKUA 2W25A 1TL4A 2HNZB 1F5AA 2N7CA 1VC0A 4B9NA 2CPYA 4UY8T 2Q6CA 2JWNA 4DV2F 4CQ1A 3HO1A 3CC4S 1FJEB 2HHQA 3DLEB 3UPFA 2KRRA 3KNGA 1H38A 2AJ4A 2YH0A 3HK2A 4HKQA 3TAMB 1U1MA 1NO8A 2FDNA 4IG3A 3HKZD 4B08A 4ID5A 3PJXA 4NZ7A 3H8YA 3LANA 3JYTA 5EN1A 1VJWA 1U1QA 2B56A 3MECB 4DEZA 2MJNA 4DR1F 1M1KT 4NLWA 4EFAC 4RLEA 4MH8A 1DTQB 4CTAA 1X4BA 4OIXA 3NAHA 2E7WA 1O0PA 4RBTA 4R0JA 1HPZB 2YNHA 2VFUA 1VQ7S 1VK8A 4HI2A 1Y7PA 3O44A 1IBKF 4B9LA 1UVNA 4DL5A 5BR8F 3L7PA 3UI3A 2XLKA 3V4IA 1JNRB 2O01C 3F41A 1T8EA 2ZH8A 2ZDOA 4YQWA 3ZZTA 3LP2A 2Z2LA 3TA1A 1DTTA 1H2UX 4LUBA 2F8EX 3ONQA 4Y2IA 4FVMA 4A46A 4DR7F 3KK1A 2EFGA 1HR0F 3TA0A 3J7Z5 2HMIB 2MKJA 4X62F 3G96A 1BD6A 4CO1A 2VFRA 1F5BA 2D1CA 3IG1B 3QIPB 5SZTA 3RBEA 3I82A 2XLIA 2DNMA 4E8UA 3HHLA 3AHPA 5IT4A 3M2UB 1SKRA 3CCRS 3C6UB 4I67A 4PQUA 2J0WA 1OQ6A 2VBYA 2FC8A 3FZBA 5KFSA 1N6QA 2VQEF 2RU9A 1R6YA 2O66A 4YR2A 1JMTA 5KG5A 1X5TA 4ETZA 2RS8A 3FNNA 1MMLA 3CWJA 3KLGB 4IQXA 3CCMS 3DI6B 1JXLA 1HA1A 3VWSA 1T3NA 1HQUA 4DQRA 4IR9A 3IR7B 1U2RA 1KSPA 2KXHA 4OHZA 3BF4A 2RH3A 4BC7A 2EVZA 2JC1A 4NMLA 4CNZA 1X9MA 2UU9F 4CO2A 2J5AA 3T19A 3BN7A 1JK9B 5BJRA 2K7KA 3I5BA 2HHVA 2IJFA 3AQOA 2WOMA 5DJBA 1OPZA 2LDIA 5E3QA 4QPXA 3VQTA 3FRZA 4C2MA 3I9ZA 4M63A 3JB9k 1REVA 3DCAA 1WF1A 5K5MA 2MQMA 1RTIA 2EFOA 5L39A 5J2PA 2XY6A 2XMKA 4B3TF 5AJ3F 2LEBA 2KYXA 3NBPA 2ZD1B 3MMAB 4MFBA 2H5EA 2V4JB 1ZH5A 2NUUG 2IM0A 1S9GA 2ZOFA 3GYXB 3GV8B 2CJQA 2K7JA 3SV4A 3TI0A 3NWGA 4YMEA 2YKQA 5J2QB 1YJUA 2DR8A 4CZCA 1VRTA 4O0IA 3SI8A 2J9DE 5A6PA 2CPHA 2QYCA 4OZLA 2DD8S 2IM3A 3DYAB 4DN0A 1R43A 2VB6A 5A2QY 2DR9A 1FO1A 4IQMA 2B9YA 2JFKA 2U1AA 2W7PA 1CG2A 1YI2S 1M5OC 4A8OA 3M8SA 4WF9Q 2B51A 3M8PA 4J9OA 5B7WA 2HWTA 1RQ0A 2L41A 2KT3A 4Y2KA 4ES3A 4FYDA 5KOWA 1AROP 3TVYA 2V2KA 3OUYA 1RT2B 1D8YA 1LXNA 2A10A 4ES2A 1TKDA 2KDOA 2IBKA 1QSYA 4ZVGA 2C22A 4A47A 1HBNA 4F67A 4EWTA 5I42A 4ZPWR 3S1TA 1P6TA 5D4OA 4IOAQ 5K9FA 2HHSA 3KLHA 3SCLE 2X51A 2DRBA 2FLLA 1R8BA 4EO8A 1FVQA 2X1FA 4J9LA 4K59A 5F9LA 1T94A 2NPFA 4K50A 1OPIA 1RP5A 4IFYB 2YX1A 4AL5A 5CYJA 1JLBB 1S1WB 2FD2A 4KRWA 2N4CA 2Z0GA 3O3LA 1M5HA 2AGPA 4LFBF 2V8HA 2CQDA 5IS2A 4L6V3 3EPIA 2DCLA 2G4BA 1YJNS 2LQBA 5KFKA 3M32A 5C42A 2UUBF 1P1TA 2HAIA 3PM9A 4MMOA 1X9WA 1AFJA 4QIGA 4QR0A 2J8AA 1UWBB 2E29A 3FMBA 2ZM6F 5CH7B 2BM0A 4QWBA 2CRLA 1BQXA 5BYQA 4OHVA 1R3NA 3MM9A 4NLRA 4OZ1A 3MZIA 4Q44A 3THVA 4KFBB 2HLUA 2ZH2A 3MURP 3D0HE 2YWHA 1AXQA 1DURA 2W24A 5KT7A 2YX7A 3CT9A 4Y65A 4WYLA 3R1LA 1ROFA 3CJ2A 1K9MT 3BQ0A 3LALA 4DG1A 4WKRA 4O3NA 2PIIA 3R3TA 2WSCC 1X0FA 4K5SA 2X1BA 3CJKA 1RTDB 1RISA 4YB6A 2QO3A 1MROB 1RT7A 4I68A 3J7YI 2YNIA 3OFFA 4FXVA 5E3CA 4IR1A 4DR6F 2XHWA 3BR9A 2BABA 1SJ4P 3OL8A 1A7GE 2PC6A 2RQ4A 4I6AA 1F9FA 3OHBA 1JLCA 1S6PA 1UFLA 4ILRA 1R8HA 1FHTA 1RT4B 5E5NA 1N33F 1QAXA 1K0TA 2EWHA 2HNZA 4GO5X 2ADBA 4DR2F 2LU2A 1O51A 2WSEC 2Q43A 4NLSA 1S0VA 1V3ZA 2IVFB 4QPTA 1GTEA 3OFGA 2DH7A 3KHLA 2VFTA 3BSNA 4M5DA 3TAMA 4ZCLA 2FHMA 3EXYA 2CQBA 2QT7A 2R2RA 2W7OA 4RW9B 4F4WA 4DSEA 4J9KA 1Q16B 1WG1A 3MECA 1NK5A 4Y2CA 1U1RA 4WU2A 1BQNB 1DTQA 2RUGA 3RRHA 2DGXA 3C3LA 2KKHA 3PHEA 4IRKA 5F8JA 2FB0A 1HPZA 2RF2B 3IWXA 1NJZA 2DR5A 2EC0A 3SCKE 5B0CA 4IFVB 4NCAA 4LT6A 3BGRB 2MZTA 3H5XA 3FGVA 2IVMA 1FKAF 3QPIA 3L09A 1NJXA 4GKKF 2ZUGA 5K8PA 1LWEB 5D8HB 3D1OA 3VAKA 4WZQA 1YJWS 1FDDA 2NS1B 5CQGA 3WX4A 4RW6B 4X64F 3IN5A 4DDFA 2ZH3A 1ZTTA 4FF4A 5B0GA 2HMIA 1SKWA 2PO4A 3M6WA 1S6OA 3IG1A 2AYMA