1ZPWX

Crystal structure of a hypothetical protein tt1823 from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
b'GKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TT1823
publication title Crystal structure of a hypothetical protein TT1823 from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1zpwX00
2I8EA 2L9NA 1ZPWX 4ZCKA 4ZCLA 2BM0A 4QR2A 1ZM4A 3B78A 1N0UA 1FNMA 4ES1A 2BV3A 2ZITA 3LH2S 1ELOA 3E3XA 4FN5A 2NPFA 4QR0A 3ZZTA 2WBMA 4MYUA 1N0VC 1ZM2A 4ZCMA 2BM1A 4MAKA 1T95A 4M1KA 1P9QC 4QR1A 3B8HA 3OQ2A 5G4DA 1VI7A 4ES3A 1ZM9A 3UI3A 2IVYA 2KDOA 2EFGA 2I0XA 3ZZUA 4ES2A 2E1RA 2CVEA 3EXCX 1ZM3A 2J7KA 4TNOA 3ZZ0A 1U2RA 1KTVA 4ZCIA 4MYTA 3B82A 2XEXA 1DARA
chains in the Genus database with same CATH superfamily
3BBCA 2BM0A 4DFJA 3FK4A 3L3CA 2GO8A 1M5HA 1U1LA 1VQPS 2R8JA 1IBKF 2IJNA 3BB5A 4CNYA 5K14A 2FJDB 1BQNA 4A8MP 4Y2AA 5AXMA 1U6ZA 4LFCJ 2KU7A 1RWXB 4WK3A 3PIOQ 4S0MA 4DV5F 3CJ3A 1LXJA 1TVRA 1WEZA 1UVIA 1UVNA 3VGVA 4G1PA 2DNKA 3C19A 4YFUA 2OAUA 3DLLQ 4ED8A 3A3NB 2JLEA 1WC4A 1TKDA 5KTQA 2X3DA 3MM8A 4TY8A 1NM2A 3T19A 2F9JA 2HZVA 4WIIA 3CJQA 3LGHA 2ZH2A 2OFGX 4HYKA 4ETZA 2E5JA 3D68A 2CQCA 3TEHB 3IGNA 2RRAA 1WC6A 4P7TA 2Y8YA 3VWSA 2R2UA 1VRUA 4CZCA 1LWEB 3NGUA 4WYWA 3SEOA 5KFBA 1U1MA 3MEDB 3KG4A 4B9SA 3BH6B 1FDAA 4DV3J 3PJWA 4HEA9 4FN5A 3ICLA 1ZM2A 1FNOA 3J81Y 5DQIA 2QSFA 2CPFA 2IY5B 2HK3A 3EDQB 3EVMA 2OPPB 1T0TV 3DXBA 3L9ZA 1P1TA 5GAHI 1RTIA 1U0HA 4HH1A 3SCKE 2QJ3A 3JAMY 3MECB 4Y2KA 2UVWA 1AB8A 5D4PA 3NCPA 3KUHA 4ICLB 4ECVA 3KLFA 2LEBA 3CXCR 5B0CA 4K4TA 4N77A 3OR1B 2VFSA 2CUYA 4DBQA 3J81j 4DJBA 1HNZF 4IYQA 1DLOA 2YNFA 3LPYA 3GFZA 1WI8A 4J7CA 3M8PB 2HZCA 1T95A 3SFUA 3MM6A 4WTOB 1TV6B 1GQEA 2PO4A 3KHLA 2O66A 1VS3A 1Q79A 2WVDA 3Q86A 4DSIA 2QA1A 1SI9A 4OFZA 2J0QD 3BREA 2YQ1A 1XIQA 4PWDB 2N3LA 2F40A 3BPSP 2BOPA 2E9ZA 1EKSA 3W5ZA 3M8WA 3Q23A 1H2UX 4IH6A 1U24A 1BC6A 2YNGA 2K7JA 3DLKB 4PPZA 3PO5A 5CYMA 2XI2A 1X9MA 1YLXA 2GCFA 3PG9A 1Z2ZA 3ZO7A 2ALZA 2XMMA 2OGUA 2UXCF 4M5JA 4YB6A 1SC6A 3FQLA 1DURA 3RAXA 4J9PA 2A2CA 2DCLA 4B3OB 2ACMA 2DR6A 1CQMA 5H9EJ 3C16B 2MGZB 3OXGA 5D8HB 1FCAA 2R4FA 3BEGB 2B43A 2M4MA 3NMRA 1S9FA 2KI2A 1AYEA 2PMWA 3BGOP 4DSFA 1F5AA 1S9GB 3FSXA 3UVJA 1W7WA 3DLHA 4F4XA 1N5QA 3DOKB 5F8IA 4ZVOB 4Q0BB 4OMFG 3OL9A 1JLAA 4RW4A 2W24A 2WW8A 4OLOA 3OL8A 1YVFA 1FWPA 1X9WA 2HG4A 5D3GB 2C2ZB 5L39A 4DFPA 3LGNA 4W98A 4URQU 1OSCA 2VH7A 2BJEA 2LQBA 1KD1T 4RW9B 4DR2F 2YNHA 1UVKA 1H3DA 2OPRB 3TX0A 1UEVA 2F8HA 3EJMA 3R2DJ 4USJC 1FJCA 3G6XA 4KFBA 3A4TA 2VOOA 3PDNA 4WBFA 1B3TA 2FIUA 1U1PA 3D0GE 2AP6A 4ZCLA 2GVZB 1B99A 1OQ3A 1CG2A 3NBPB 2HHPA 4C0OC 3OUYA 3R1LA 2UXDJ 4QIFA 1IQZA 3MPUB 4NLSA 4G1QA 5KG1A 2V4QA 1RK8A 2YKMB 1WJ9A 1M5SA 2XLIA 4OHZA 5ETNA 3V2UC 4ELUA 5KOWA 3NGKA 2XMVA 2BACA 2HIQA 4K2JA 1K1SA 2HNDB 3SIPB 1WKKA 4RNHA 1J2VA 1FRLA 4RPFA 1UCNA 1WDDA 1TUWA 5H1SV 5HO4A 3MCOA 1ITPA 3DNCA 1CULB 1UZDA 1RTJB 5KG7A 2H4YB 2NPFA 5HLFB 5B0GA 2E7WA 5KT6A 4B3SF 5L46A 1JNZB 1ZOTA 4OJHA 1TK0A 3QMQA 1DZ5A 2W9BA 2R2TA 2MYFA 5D0HA 4E2FB 5F8LA 4QW9A 5EX3A 1HWJA 4HI1A 2U2FA 4W90B 4QPTA 3GG1A 2BX6A 3KLVA 1RJJA 5DJBA 2E9RX 2YNIA 1E6YA 5DG7A 1IN0A 3TVZA 3WZ0A 1HIYA 3TP2A 4EBCA 4UW2A 1MU2A 3EICA 4PYDA 4E0DA 2QFJA 5C42B 5F3TA 1SKWA 3P4UB 3PW0A 4BDPA 1GMWD 3H42A 2DPIA 4PCQA 3B78A 2G1HA 4C97A 2UUTA 2ZITA 4FVMA 2GVDA 3IGVA 3PHTA 1ZZNA 1J5OB 2HVHA 4NASA 4FYYB 3GMGA 5EWEA 1OMSA 3THPA 4LRCA 3LP1B 4MYTA 3HVTA 2WSCC 4KGXB 4OZ0A 1JLGA 3QSYB 2L41A 2IM3A 1M5KC 4B9LA 4ZVQB 2E7XA 4Y6IA 3M8YA 1NPRA 2DYAA 4PG5A 4QIEA 1RT1B 4FDFA 1BD6A 4DR4J 1GK8A 2ZC4A 3CMES 3NXZA 3QT6A 2WHOA 3A8KA 1K1QA 4USTA 1X60A 2J0SD 4QYZJ 1S6QB 1TAQA 3M8RA 2C3MA 3MMBB 4FF4A 4M5HA 2VG5A 2MLXA 3V6JA 4QJVA 1FRKA 3AB4B 3KFWX 3MCMA 3CIMA 4FXDA 2WBRA 1KSPA 4DPOA 4B9VA 3EMTA 1YBAA 3BO3A 2BE7D 2H48B 3RG6A 1NDLA 2CRLA 4KB7A 1HNVB 1RBAA 3OVBA 1K0TA 4CWBA 1SKUB 4I0WA 2OHDA 4K5SA 5U47A 5CQGA 1NO8A 1Y11A 2AX1A 5HMYA 1LWEA 1VHIA 3MEDA 1MWYA 3QAEA 3HSZA 5GAHU 4H4MB 2ZH5A 2VC0A 3MUVP 2DKOB 4XDDA 2GHPA 1XR7A 4TYBA 2WSFC 4FBUA 4JI8J 2BABA 4UOHA 4DR7F 2OPPA 4WTYA 3CJKB 4PWUA 3IAS9 3CUNA 2FUG9 5J2QB 1AW0A 1MG7A 2VBXA 1WNEA 2RRNA 3CCVS 3MECA 5IV3A 2JEIA 4ICLA 2M3DA 3MMCB 2I0XA 5B7WA 1GMVA 3OR1A 3T1YF 3ULHA 3GSIA 2I9SA 4WJBA 2O1PA 4PXBA 4CLYA 1PG5B 4A8YA 3OHBA 1V3RA 2ALYB 2EWHA 3PXGa 2QLJB 2HIYA 3QFWA 1FT8A 3W9JA 2EEYA 5DZ7A 3M8PA 1L3VA 1OY6A 1TV6A 1G6BA 2DNQA 1VQ7S 1HWUA 3H5YA 4P9SA 1TELA 3G8TA 4LF7F 3OFFA 4KSEB 4HHUA 3PZPA 2VPWB 5LJ3Y 3ILOA 4FNIA 5HMZA 4OZ1A 1HBOB 4PWDA 3IXQA 3W5XA 3J7ZT 2B6AB 1GX5A 2DK2A 2ZD1B 1N36J 1XMQF 2FHKA 2FGOA 2GJIA 2QZ8A 4IO1A 1S1VB 4I2QB 3KUEA 1FXDA 3FRZA 5KOXA 4C98A 4CLWA 2FJEB 5F9LA 2WB1D 4WKYA 3DLKA 5K9FA 1UTAA 2P9CA 3E8OA 3MPWA 4Q44A 3J7YI 1UWBB 4K0KF 3GR1A 2CNKB 5LL6d 3R9LA 2HLTA 3ILLA 4PG4A 1JQGA 1NB2A 4F4KA 2LKZA 1HMVB 4F8RA 3LOUA 1PYOB 4U8YA 1FFSB 3IFEA 4B3OA 3B54A 3U1NA 3C16A 2HNZB 2OTLS 2MGZA 2LEAA 1VBZA 3K17A 1KQFB 2AEFA 5I3QA 1DJ0A 3C3LA 2VKRA 1S77D 1S9GA 4K59A 1WWHA 2CQHA 3HSDA 4NYPA 3DOKA 4Q0BA 1QSYA 5MLCV 2E5IA 4LFBJ 3ZTRA 1W26A 3AAWB 3BQ1A 2KHCA 3IBFB 2F4VF 3AD8C 1UAWA 4OZ5A 2B3TB 2PN6A 5D3GA 1UL3A 3G6YA 2J6SA 4Q2MA 1RAIB 2GX8A 3OJUA 5DGAA 4WU2A 3MXHP 5DZ6A 2IAJB 4P75A 4RW9A 4JV1A 3DLJA 4CM2A 4FPIA 1S99A 2ROPA 4YHHJ 1GTHA 3IR7B 2OPRA 2ATLA 4ECQA 4RW6A 4TQRA 5CZVA 1X5TA 2P9GA 4EUVA 5ADZA 2NXJA 4J9KA 5KFLA 2G0IA 2IA6A 3KNGA 3M9OB 1DHMA 2W4DA 1R8AA 4HKQA 2GVZA 4J5OA 4NLTA 2V9WA 3NBPA 2G0CA 2ZBCA 5RUBA 2CAJA 1BGXT 2E5GA 3PR5B 1WI6A 2KTQA 4DUYF 4L72B 4P2MA 1U1RA 4OX9J 3D6HB 2YKMA 4HR2A 1BMQB 3TARA 4HTJA 3QO9B 3G82B 4N41A 3J7AN 4LFCF 3OXLA 2XMJA 3R5CA 2D9OA 2HNDA 3BGFA 3IWXA 2CKWA 3R8YA 4UT4A 2MQOA 3LP2A 3DOLB 4KJIA 3M05A 1N54B 1FEHA 3EX7B 1VQLS 2D74B 2IIHA 2L08A 3G86A 1FVQA 2M70A 5HLFA 2FDNA 1N48A 3CCES 1Y3KA 1T8EA 3K59A 5CXTA 3HJFA 5DDRC 4F3QA 5KFMA 1NAQA 1FF2A 2E1AA 5CH7B 2V5HG 2PIIA 2Z4PA 3VAMA 1L5UA 1WTFA 4ZP8A 1I51B 4NA3A 4DL0C 4L76A 2CNLB 2E66A 3BQ2A 4A46A 1B0TA 4J9NA 4DV3F 2DXFA 2CZ4A 3E01B 1TKTB 2A10A 2V68A 3D0IE 4RNOA 2FPHX 4CT8A 2PEBA 4ECYA 1LWCB 5L1JA 2NZCA 5KFWA 2V2QA 5JMNA 2J9EA 1KVKA 4B3TJ 2PFDA 3JQJA 1J5OA 1U02A 3OPKA 3PR4A 2XMUA 3BQ0A 3G71S 1WELA 3LP1A 2ZOFA 2RRBA 1RABB 4OI1A 2QA4G 3RRKA 4LBIA 4Q8EA 1VRTB 2PSZA 1V9OA 3DU5A 3RRGA 3IC1A 1VC0A 4CM0A 2MZRA 4CCHA 3Q0AA 5KG4A 2EK1A 2M0GB 1TUVA 4Y65A 5IWAF 1S6QA 4KY3A 5DLGA 4X66J 1SJQA 3MMBA 2A3JA 5KG3A 1Q5VA 3PY8A 2GZOA 2NXEA 4KHPJ 3NWRA 4ANEA 3K5NA 3N6NA 3IG1B 4DR5J 2DITA 2JEFA 2Y1RI 4DDFA 4ZLPA 4Z7CA 3H5UA 2VASA 1UPPA 5DDOC 3KLGB 5L8RC 4OX7A 2DY9A 5GMKa 5ETOA 1FNXH 1HHQA 1PYTA 5LMUF 4LREA 4AE5A 5ITHA 2E1CA 2HAIA 2XWXA 3D1OA 4WWSA 2JH3A 5HBMB 4JV5J 9RUBA 5K8PA 2DRBA 1ZTTA 3MUMP 1C0TB 4H4MA 2V2KA 3FEYB 2CPXA 5LT5A 5I42B 1QTMA 4CI0B 3H8YA 1JLEB 4DN9A 1QD1A 5KFTA 5HN0A 1NDCA 2HGLA 3L7UA 4DLGA 4LSLB 3PYGA 4DCJB 4ECRA 4O44B 3CJKA 3L7OA 2D3OR 5J2QA 1SC4B 2HWHA 5KFOA 1FRHA 3UW1A 3TA2A 3IP0A 3MMCA 4M5NA 1VJWA 4USWA 2XNQA 4JV2A 2UZAA 3BGUA 3NCRA 3TQEA 3G4SS 3W65A 1G7CB 5HANA 3LALA 3MR2A 4HHHA 1IBLJ 3R5DA 1S1WB 2DBBA 3OTOJ 3ZZTA 2VC1A 4RUCA 1FD8A 2YTCA 4K4YA 1F5CA 2RQ4A 2PE8A 2ZC3A 3HHLD 1N34J 2XHCA 3PM9A 1SKRA 1R8BA 1HBOA 4HI2A 4ED6A 1NSPA 2B6AA 3KHHA 4DUZF 2H5IB 3J7YU 3VQSA 4RBTA 4NLWA 1S1VA 2VQFJ 4F4WA 2UXDF 2H4WB 4I2QA 2ZHOA 3BSCA 1ACMB 2AIRB 2XS2A 2BRLA 1TL7B 1X0PA 3TW0A 5KFAA 2LQ5A 1PKUA 4B9UA 2FYXA 2JFDA 1UWBA 1IUJA 2WZ1A 4OI2A 5C24B 1SJRA 2K06A 4ILRA 1HARA 1ZTWA 4XAKA 3W3SA 4NLXA 1TL5A 4WXOA 2NSCA 1UFKA 4PG8A 5IOLA 3AT1B 3V6DB 4OYZA 2GMHA 1R7IA 1JJ2R 3PX4A 2HNZA 4U7UK 2AQ4A 2HAFA 2LQJA 2HFSA 4O0NA 3IR5B 3HVWA 1RYSA 2MB0B 1NK6A 4KQZA 3CWJA 4LF5J 4IQXA 3HD2A 4IUFA 1PYSB 2GAGC 3HLUA 1AA1B 5HAOA 1ULRA 1ZPVA 2ZJPQ 4IH7A 2ZKUA 3QGHA 1WORA 3PW7A 2G0JA 1IM6A 2B9EA 3LAMA 4X62F 3SCLE 4PWWA 1NK7A 4RNMA 1B0VA 1LFPA 4KKOB 2XZWA 1PILA 3PTWA 3ZZZA 2WVCA 4AFFA 3A3PB 3FNNA 2IAJA 1HNWJ 3FCWA 4DV4J 2QL7B 2HS3A 4U6PA 2IRUA 2SXLA 1M5PC 3V5RA 3WBZA 3AODA 1M5OC 4AXIA 5JJBA 4MH8A 3RGIA 1S6PB 1TKZB 4QU6A 2GC8A 3KG0A 1PJ5A 1KEKA 2KZZA 1HI0P 1LWFB 2GNKA 5KG2A 3US5A 3HMJG 3ADAC 2UUAJ 1RACB 4XK8C 2N82B 4USIA 2YVSA 2FZKB 3HKZD 3RU0A 3ZXWA 4DR4F 1Q53A 3QO9A 3G82A 2Q6BA 1S97A 2OEKA 2AU0A 1Q16B 3BSOA 3P6YC 2Y1JA 4EGLA 1H6KX 3CD5A 2Y0BB 2QMWA 5HP1B 2XYPB 3Q8PB 4TKTA 3LQVA 3MM5B 6AT1B 3PJXA 1RT7B 3IR6B 1VI7A 3UDLA 4N5SA 3OT9A 5FDLB 2MQLA 1VQMS 3G6ES 1ZYQA 2R7VA 2KRBA 3IO1A 4RW8B 3GTYX 4M1KA 3R7BB 2CJQA 3K58A 3W7BA 3OL7A 2PI4A 2YX4A 4YR3A 1HPZB 4DUTA 1QAXA 4RWXA 1Y9OA 2XO7A 2RS8A 1Y5LB 3E01A 1TKTA 2FVCA 5DQHA 4MK9A 2NXUA 1HQUB 5E3PA 2KT2A 3EE3A 1LWCA 2PMZD 4JI8F 3QPIA 4FVCA 3HHNB 2MDAA 4KR0B 1C4CA 1RTHB 4ED4A 3CE8A 4FNHA 2MKHA 1QAYA 1ZA2B 5J1PA 1YZ6A 3HZEA 5KFCA 1VRTA 3VAIA 4GMKA 5IM0B 4KGMA 4LF6F 3DDIA 4IO9Q 2QA4S 4L3KA 3TRGA 4ES2A 5E33A 1U48A 2BOAA 2RUGA 3NGSA 3PEJA 1YHQS 2HRYA 4DQQA 1LQ9A 5KFDA 5FLXU 1HWLA 3CCZA 2V8VA 3ETOA 3PRVA 5H9FJ 3MF5A 3GFXA 2CQ2A 1R0BG 1NK0A 3K8WA 3TA1A 2BKNA 4BHQA 2CJYB 2Z2MA 3EGZA 2V4RA 4M5GA 4J90A 1RHQB 3RRHA 1YJUA 5IXUA 2XC9A 2XMWA 2R7TA 3VAGA 3HPOA 5HROB 3IG1A 2VFUA 2AEMA 1N36F 4O3NA 2OJ3A 3WDOA 4NEYA 3QWPA 2EPIA 3KLGA 1L3TA 3CJ5A 3P96A 2XSJB 2FHJD 2XCPA 3HVAA 3C2PA 1UMJA 1KOHA 2GHWA 2M2BA 2MKYA 2BVZA 1T94A 1XMBA 4CH1A 1C0UB 5HBMA 1Q8KA 1RDRA 3T3FA 4DFMA 2P6SA 1C0TA 1KLNA 2MLZA 3MI7X 5I42A 3OFHA 4A8XA 1JLEA 3GP9A 1K9MT 4IOCQ 4ES1A 4Y00A 2BV3A 5F8NA 1LFWA 3FRYA 5HQLA 1CS4B 4LSLA 1HD1A 1I3OB 2LFVA 4TNOA 1WHXA 1BUXA 3F73A 1RHMB 4FP9A 3OSNA 1K73T 2XBPA 2W8LA 3NWGA 2AYEA 3HO1A 5CZXA 5BXIA 4LFBF 3ET6A 3HFKA 1RISA 3D4JA 2YH1A 3C14B 4XO0A 1RCOB 2V8DA 4UQTA 1HWKA 4ECXA 3DI6B 1S1WA 1JIHA 2J76E 5ETMA 1DBDA 3CDWA 1LW2B 1VK8A 3TJ8A 1RHJB 4RBUA 1REGX 2QX0A 3I5AA 2VUGA 3CPWR 4RL1A 2XYGB 4KPYA 1U4BA 1VQYA 1R3NA 5ETPA 4CO5A 3TZYA 3CNQP 1S5ZA 1FXRA 3M30B 2DT9A 3A3OB 2ASLA 1R8PA 5KFKA 3TANA 1KLMA 3QRRA 1UPMB 4NZ0A 4X2BA 4Y3CA 1RT3A 4OX9F 1RU2A 4DQPA 2QO3A 3H5XA 1X0FA 2FHMA 5ETKA 1TL7A 2NR0A 3GCWP 4OI0A 2RNEA 4DL6A 3O6QA 4ECWA 1TP7A 2CJXB 3EPIA 1QE1B 2YWEA 2HNYB 4JI0J 4OJ1A 5C24A 1O5JA 3EZUA 1N6QB 3S7RA 3ITHB 3MHYA 3IWLA 3BV8A 3V6DA 3HXMA 2GIFA 2EFQA 7FDRA 2PFFB 4U9RA 1SJ3P 4I68A 4PUOB 3AXMA 3QQCD 2UUBJ 1WDTA 1NHKL 4ZLNA 2HHHF 4X64J 3ZC4A 2QGFB 1VFJA 4DV0F 3MWBA 4X4SA 1T9WA 3NS7B 1S4EA 2AJQA 1B7YB 4MTPA 4EZ6A 2PA3A 2ZE2B 3CCRS 2ZOGA 4Y2IA 2AGOA 5GADI 2QL5B 1ELOA 2OSQA 3OXFA 2GO9A 1GMWA 3T1AA 4PXCA 2R42A 2CQ0A 2DO4A 3UO0A 1U6FA 4WP9A 2D9PA 3N28A 1Q4RA 3TQ1A 3T41A 1UETA 4NWBA 1UFWA 1X4CA 4B3TF 3BO4A 3EXYA 2KB2A 3TZZA 1HFEL 1WD6A 3VGTA 2NPIA 1S6PA 1TKZA 2W2QP 1KP6A 2BKPA 1FE4A 2ZBRA 1S10A 2VB6A 3TVKA 1LWFA 2UXBJ 1N32J 2RB7A 3JQKA 1NNDA 4X4QA 1S1TB 4DS4A 4FF1A 2M8HA 5L9XA 3VV2B 1F2HA 3T6JA 3D6MB 4F4ZA 4UF4A 2VPYB 3OTEA 3M1VB 4O4RA 4ZIVA 2VD3A 4NOHA 4UY8T 3CULA 4J91A 4X66F 1CSJA 1NDKA 2F3JA 4ECUA 3HT0A 1S9EB 2J8SA 3CCLS 4OJ3A 2XLKA 2HQ3A 2BE2A 1NH7A 4KAIA 2D69A 4F2SA 2WSEC 4WFAQ 4KHPF 2MZTA 3MM5A 1M90T 4DR5F 1RT7A 4ZP6A 2Y9HA 5FDLA 3IM9A 4ZVPB 3OW2R 2LXIA 2RJZA 4RW8A 3DKDA 4KBIA 2L9DA 1KHWA 3SV4A 2ZH4A 3FJ2A 2HHXA 1SXLA 3GV8B 3FSYA 2VDIA 3N6LA 2VFVA 2A1BA 1HPZA 1CJTB 4FPRA 2QG9B 4JV5F 3P8BB 3H4BA 5DM6Q 4C8OA 1S1XB 3H2VE 3RJMB 4J9OA 3C15B 2N3OA 4WFXA 1PC5A 2R2SA 4X4RA 1HR0J 1LOUA 5T14A 3FGVA 1VRQC 2PGCA 2HW3A 3AH6A 4ER8A 1RTHA 3I87A 4PQAA 2E44A 2OP5A 1HD0A 1VC5A 1YJNS 4C9DA 2NSBA 3GG0A 3CDEA 3T5HA 3MEEB 1JK9B 2RHSB 4CT9A 1J27A 5IM0A 3EYZA 3HT3A 4ZCKA 1H73A 3N0VA 3CIZA 1U2FA 5HSPA 1JMTA 2RVJA 4DSKA 3D3CJ 4ZLJA 3DLBA 2V8GA 4DQIA 4QW8A 3RR7A 4DR3F 1NKBA 3KLHB 3VHQA 2MZQA 3DXSX 2ZEJA 3AJ1A 3HJVA 2DHSA 1JJCB 3W9HA 4LF8F 3GIJA 2CZVC 3HHLB 1RWMB 1YJRA 4FKYA 3PEHA 3BBBA 2FC9A 2J8AA 2B7CB 4FF3A 1P27B 2AYGA 1N34F 5ETRA 1N5SA 5HROA 2V2VA 3W63A 1FFGB 5E3QA 3JTPA 1PBAA 3KXDA 2VQFF 1FDNA 2L48A 4AL6A 1UEUA 1T7PA 5BR8J 2YWFA 3NKYA 1M0SA 2FZGB 3TJAA 2XSJA 1NK4A 1Q0NA 3I0RB 1H38A 4LR9A 1JWWA 1S48A 3KHGA 1I6JA 4OHXA 4G65A 2C2OB 3F56A 3EDRB 3JXOA 2L3MA 3V6HA 5KFGA 5LOQA 3I6PA 1JB0C 1C0UA 4QBUA 3IN5A 3CCUS 4F67A 3HI9A 4A47A 4RJVA 1NDPA 5IT9Y 1LEOA 5EUHA 1RHRB 2CPHA 2G13A 2QEXS 3LP0A 1WOPA 2K1RB 4LVOP 2C3OA 1PJ6A 2CZ9A 5KFIA 4PXDA 1CS4A 3NCQA 5ETSA 4NYZA 4LF5F 1VIOA 1NHUA 1HBMA 4CH7A 1KQSR 1R43A 5JXSA 4NLOA 2A2DA 1D9AA 2MZJA 1MWZA 3CW2C 1E6VB 4BWJA 1LWXA 2J9DE 3R5GA 3C14A 1SUQA 3F41A 1F1BB 2ROEA 4I56A 2AMCB 3DI6A 4YN3B 2AJ0A 4N7TA 4MT1A 3O2IA 5K8NA 3OHAA 1HNWF 3BBFA 2BRKA 4DV4F 5MAOA 3CD6S 4C3LA 4WP3A 3H90A 4B9TA 5F8HA 2B8PA 3ZZPA 1MLAA 4I67A 3CO9A 1BLUA 5IS2A 2NYHA 4GO7X 3M6XA 4PG7A 2JDJA 4DG1B 4JBCA 1F9EB 3M30A 4ETXA 2UUAF 3E2EA 1VBYA 2HFNA 2XCAA 3TAQA 4DL2A 2H9ZA 5B0AA 3TNVA 2ABYA 4BS2A 2CWXA 4OJGA 4JI6F 3ZZOA 2N4DA 3KK2B 2DO0A 5DDQC 2ZUGA 1GT8A 1QE1A 4NLQA 2HNYA 1RWPB 2WOMB 3MCNA 3RZAA 3BSNA 8RUCA 3GQCA 5EN1A 1DY3A 1N6QA 4ECTA 4HH0A 4Q7AA 2PDAA 3ITHA 2VKZG 2CJBA 4EMDA 1F2GA 2HMIA 1ICEB 4BLGA 4PUOA 2WVEA 2XS5A 5GADU 5HQMA 4Y34A 4DX6A 3PIPQ 3HHLC 4FBTA 3EUNA 1FJGJ 2LCWA 4M5KA 3BGRB 2ZE2A 4UZCA 4ED3A 3VVTA 2KO1A 5DG8A 3BKTA 1JKHA 1T9YA 4CP5A 2PD1A 1NEEA 3FBFA 3KJQB 1U2RA 1EIYB 2W1BA 1VQ6S 1JLFB 3HHDA 3W2WB 1AUDA 1FI4A 4Z2XA 4QOTA 3HHKA 4KV8A 1GXLA 1YX2A 1NSKL 4ZPDA 3UR0A 2KXFA 5IC6B 1WSVA 2HEKA 4C4WA 5FIIA 2GQCA 2VZ9A 2WW4A 3CDAA 4UOGA 1QUVA 4FXVA 3KMSA 2BQUA 3BYPA 2GFFA 4P73A 4DL3A 2M88A 1N5VA 1X8DA 2KM8B 4ANDA 4MIBA 2B5JB 2YKAA 1AXQA 3ZFVA 1S59A 5JVHQ 1X4FA 2IDLA 2WB4A 3CCSS 3BH7B 4R0EA 1FERA 1M1HA 2K3KA 3D5MA 1WSRA 3M2RA 2RU9A 4YUDA 1S6UA 5KT7A 4CLUA 1WC3A 1YRXA 1NKEA 2GAHC 4ES3A 5A0YB 3QATA 4RLEA 2ASYA 4DL4A 4NI2B 4YMEA 1S9EA 1F5BA 4LSNA 1S76D 5F8JA 5DQGA 4KIAA 1VGYA 4F0HA 1YTYA 1U47A 4YB7A 2D1CA 1QAJA 5E0OA 3W9IA 1MROB 2YH0A 1OSDA 3R2CJ 3DDKA 1FESA 2HURA 3FCHA 3MR6A 2HBRB 3V4IB 3QT7A 2KT5A 1FNMA 3Q2TC 5KFHA 1RTDB 2A18A 3G96A 2KFNA 1R0AB 1FRJA 1SL2A 2O5DA 1X7VA 4DPWA 1CJTA 2UVUA 5HVGA 3PFEA 3NRBA 2YWHA 5FLXY 1S1XA 2JVOA 3C15A 1VMBA 4DSEA 4DV2J 2CQBA 4EYIB 4DR6J 4F0KA 3CDBA 2VIHA 3BR9A 3VR1A 4B02A 3HSJA 2XMTA 2R2RA 4YEAA 2HBQB 2ZM6J 3HZGA 3QFHA 2MHNA 4Z37A 4MKVA 2W4CA 2ZNYA 4DS5A 2MQNA 2DHGA 1RB0A 2CFXA 3MEEA 3AJ2A 3U7JA 3SCJE 4KH1B 1KQKA 2GA7A 1GXTA 2XG8A 1FRIA 1S49A 1A0OB 2W7PA 1QM9A 5A6WA 4NXNJ 5D15A 2DNPA 2EKNA 4XPEA 2DGTA 4JUZA 2QT7A 3C6UB 3LWMA 1AZSB 2VBZA 4ZN1A 3KLHA 4C8ZA 5SUHA 2DR7A 1KFSA 3HHLA 2ZBIA 3TVYA 1G3OA 1RI7A 1SH3A 4W92B 5LXYA 2VA3A 2HS4A 5AE1A 4NYOA 3KK1B 3J7Z5 2DY1A 3GLJA 4ID5B 3J80U 4C8KA 3DRRB 2Q6CA 2H3EB 1VQOS 3MURP 5D6GA 2ZHAA 3F0NA 3EGNA 1GMUA 4TYAA 1Y3JA 3P45B 2W7OA 2F4FA 2AEJA 2XY5A 1S72S 1KN6A 2B4OA 2AKWB 3M2VB 5E2QA 5KFQA 3E51A 2DNRA 1VQ5S 5D4NA 4EBDA 5C7PA 3I4HX 3I56S 3PW5A 3ETMA 1U26A 2KM8C 4KO0B 3VTIA 4EO6A 4QR2A 4I7FB 2J0WA 1MN7A 2B7BB 3V4MA 3K5LA 4KC5A 3CCMS 1HBUB 2CYYA 4E8UA 3KMQA 3GZ7A 2UUBF 3MAAA 1R27B 5EWFA 1FJ7A 1DQAA 4X64F 3PX6A 4WF9Q 2VJUA 2DEJA 2MXYA 5CCMA 3HDSA 2Z0GA 5GAGI 1ROFA 2OIHA 1OIAA 1KFDA 4K8RA 3WIVA 2UUCJ 5LSOA 4X65J 4DV5J 1E6VA 4AT1B 2KFZA 1WG5A 3HX9A 2BJ3A 5L9NA 1NRKA 1MMNA 2XHWA 3I9V9 4WFZA 3HF5A 5A8RB 1UP1A 2XWYA 1CLFA 3LW5C 3GCXP 2HQCA 4O4GB 4CLPA 4RU9A 5HVHA 1X5PA 4EYHB 4ELTA 1VQ9S 3DMJB 3SYZA 1APSA 4H54A 1W2IA 3BN4A 2DNMA 1Q7YT 2J0XA 2OKQA 4UOCA 4DG1A 4LT6A 5IQQA 2UXBF 2YX1A 1FKPA 3UQSA 2C2MB 2I2YA 3FFIB 3KJVB 4OYXA 4C8MA 3QIPB 2ILYA 2E7VA 4PR6A 1JLCB 3SV3A 1CC7A 1IJEB 1HBNB 1URRA 1U09A 3ILIA 1QSSA 1ZZFA 2C3PA 3QGIA 1IBCB 3DRPB 4OYWA 2WOMA 2Y1IA 5FD1A 5AE2A 3CCTA 1B7FA 5CD4H 2DGOA 1KVIA 3AD7C 4ZVUB 2LP4A 2B4PA 3U27A 5KFZA 2OD4A 3UN5A 3R7NB 4JI1J 4AUKA 2CWKA 3MM9A 4LF4J 5GMEA 1YSJA 4JI5J 1Q82T 1U7LA 2AGQA 1GX6A 4IH5A 4ZJOA 4FYDA 1DTQA 2CG8A 3AHPA 1XMOJ 3BGRA 1FTRA 3RAQA 2FHOB 3DYAB 3WHIA 3RB4A 2YKPA 2W2NP 2DNOA 2NUHA 2E1MC 3BDPA 1Y10A 1JLFA 4M63A 4ZVFA 4UUWA 4GKKF 1UKUA 4OYPA 3FCVA 5LSLA 2KXHA 2LECA 1UVLA 3KHRA 1HR0F 1N0UA 3FSIA 3BYRA 3JSMB 2AZ3A 4B3MF 2B9WA 1Y5NB 3DCAA 3DM2A 5KAKA 2OI2A 4KHRA 2RT3A 3D3BJ 1RT4B 3ZTSA 5SZTA 4WKRA 2JNJA 2DGVA 3GE9A 3LUYA 5K8OA 3THTA 4C11B 2R7UA 3MEKA 2B5JA 2BW7A 2ROGA 5KT2A 2ZHBA 3CCQS 2K8GA 1RHUB 1U6BA 4DV7F 3MFHA 4ZKAA 3MPVA 2HPUA 3LA0A 1KRPA 4C2MA 1RHKB 1Y0HA 4IQMA 1Z2LA 3CC4S 5K8MA 5A0YA 2JLFA 4X4UA 1S7HA 2NYIA 4DPXA 2P2CB 3OSPA 2HKEA 2J5AA 1TKXB 2R8IA 2BBEA 2KRRA 3M32B 2W8KA 3ZZUA 1MROA 2Z57B 2QMXA 1FDBA 3NOGA 3I4PA 4ZHRB 2BXJA 2FHJA 1SQFA 4AQYJ 2HVEA 1RAOA 4MAKA 4QR1A 3V4IA 5BR8F 4G3IA 2W2MP 2ZBQA 1RTDA 3TWZA 4IKAA 4YY3J 1WG4A 3KTQA 3C8YA 3BF4A 4USHA 5F3ZA 3MPDA 3UDVA 1I94J 3GJQB 1K0VA 2ZBPA 4QPXA 2EG1A 5J2NA 2GJ2A 2HVDA 1WC0A 4CLLA 2COLA 2KG0A 3CB4A 5T7LB 1N0VC 1PC4A 4ZCMA 2LQ9A 4PXEA 2CPEA 4K4ZA 2ATCB 4OYAA 3L09A 2BQ3A 3WX4A 1ZM4A 5K14B 5J2MA 2HHTA 1OY9A 4DF4A 4B9NA 4G6VB 1RQ0A 3DN9A 1NB7A 2JEGA 2ZVSA 4DL7A 1TVRB 5AXLA 4IDKB 1Q95G 1RE1B 1WF2A 2V94A 3DLEB 2OSRA 4XTTA 3JSRA 1BWVA 6FD1A 2GMJA 1UJ5A 2JWNA 3C6UA 1EX8A 1AZSA 3U1MA 4F26A 1A7GE 4RW7B 2DGUA 2MHEA 2ZNZA 2IM1A 5L1IA 4ED7A 4CYUB 1YJWS 3D66A 2X1BA 3WC2A 4P2SA 1MMDA 2MTLA 4Q5VA 3KK1A 3QZ7A 1MWQA 4ID5A 2HK2A 4BC7A 3TUJC 2V67A 1BWEA 1WC1A 2IMOA 2LDIA 1AFJA 4HVZA 1VOMA 3TR5A 2AX0A 5LMNJ 1V3ZA 2XS7A 1UWAA 3JYTB 5BJRA 1N5YB 2CPIA 2H1YA 3DRSB 1RZMA 1IWGA 4K4XA 1PSDA 4K4SA 2FY1A 3M2VA 2VU5A 3ENQA 2OFHX 3T5JA 1X31C 3SZ2A 4BWMA 1T3NA 2EFGA 2MY8A 5DG9A 4I64A 4CLKA 1PBUA 3Q2SC 2LVWA 1NMEB 4KO0A 5JVGQ 4FYVB 1UVMA 2RDJA 1UW9A 2XI3A 4I7FA 5KFNA 5GAGU 3H5SA 1HBUA 2OO4A 4NXMF 4WZMA 3NAHA 4Y2CA 5DM7Q 2EFOA 2YWKA 2NREA 2ILZA 5K5MA 1G2EA 2MQPA 1IXKA 2J9CA 1EJ7L 3QRPA 3KWMA 1RLDA 5KFEA 3TUIC 1FJGF 3ZTQA 1NJWA 3PNIA 2MKKA 4RO0A 1HI1A 5LSRA 5D4OA 2J6UA 2YY3A 2ADBA 2RD5C 1VCTA 1S12A 2BMBA 1D3WA 1WHWA 1VHFA 5A8KB 2MJUA 5A8RA 2XMAA 2XULA 4F50A 1H72C 4N47A 3GJTB 4DI6A 4C8NA 4O4GA 1V3SA 2D3UA 4DZ6A 2XGQA 4WFNQ 5IC4B 3DMJA 4CDIA 4LUBA 3T5LA 1PO6A 2CVIA 5D0EA 3BO2A 1YBTA 5H9FK 3MR3A 3EVOA 2ZDPA 3OFEA 3UN3A 4GC6A 3UNYA 3ZNJ1 2V69A 2W9AA 2V6AA 1RA7A 1C4AA 4ZVTB 4DX5A 1RP5A 2CDQA 3FFIA 2EC2A 4OX8A 3KJVA 1T3OA 3CDUA 4HT5A 3OD2A 4JI4J 5GMDA 1JLCA 5G0RB 4LRAA 1HBNA 3NEKA 3RYLA 1QSLA 1UW4A 5DETA 1Q81T 1D1UA 4QZVB 4DR7J 3AOBA 4NCBA 1RYRA 2EBGA 3DRPA 4G1IA 4ZPVR 4JI7J 3BPDA 5KFYA 4OZJA 4WK1A 2QSWA 1CBKA 3FKBA 1ZBTA 4YB5A 2FVRA 1U0SA 3AOCA 2P5VA 1X9SA 1Y4ZB 4MYUA 2M5YA 2JFKA 3CTRA 1Y7PA 1NK9A 1LK5A 5KFJA 2LA6A 2WBMA 1WEYA 3T9NA 4ED1A 2CJKA 4O3RA 3UE2A 2WCXA 1O6XA 2G9OA 2FC8A 4Q2LA 5E3CA 1TU0B 2V0NA 2PMHA 3R5AA 4KFBB 4Z7YA 4ZCIA 3CJSA 4LF9F 1NUEA 5CYJA 3LPEA 4DV2F 1YIJS 4DR6F 1CVJA 1RKJA 2BZ2A 4EEYA 4GKJF 3OUYB 2W2PP 2C3YA 3JSMA 1LW0B 3OBIA 3KYLA 4RUHA 2G1DA 2ZM6F 3WIUA 1RT4A 4ZP7A 4YS2A 1TMJA 4C11A 3NNCA 2IHR1 4JOUA 2FJBB 4DHVA 1P8GA 1TQLA 4NXNF 2DNHA 2MKIA 5FJ4A 3W61A 4N8NA 3W66A 2IJFA 2RHQB 2OH2A 2HWTA 4YB1P 1JJHA 2JVRA 4EK2A 1H74A 1VJQA 1CULA 1EQMA 1RTJA 2V8PA 2FQQB 1TKXA 3GR0A 5K20B 3FC9A 3M32A 5J2PB 2ZKTA 5IFMA 3GONA 4XIUA 3Q89A 4NRUA 3TO8A 2F4VJ 2VG6B 1RXOB 1QLNA 4RU2A 2ZH3A 2MQQA 5I3PA 2VICA 4QWDA 4DMZA 3N79A 4O3SA 3D6FB 1HHSA 4HACB 4P6QA 4L3NA 4RBVA 1Q8BA 3CT9A 1A9NB 1RSCA 4OI3A 1C2PA 5C42A 1LNQA 2D7SA 2OTJS 2AD9A 2HBYB 4DN0A 4CO2A 1K8AT 2JRSA 2BJ1A 5KT4A 1GEHA 3I0SB 2FJAB 3VALA 2LXFA 4OV1A 1F3VA 1YJVA 3ELHA 3IRXB 4DPYA 5T7LA 1W2BR 5HI7A 2F1FA 2I8EA 2FJXA 3G87A 2WVBA 1ZH5A 4CO3A 1TR0A 2PEHA 4J9VA 3LH2S 4K4UA 3J80Y 4DUYJ 5KG6A 3CSKA 5EX0A 4NRTA 1M1KT 1YK9A 3I96A 1TAUA 1SC3B 1HI8A 2CJAA 4NA1A 2UUCF 2IYIA 5A8WB 1RT1A 3SQGB 3OFGA 4X65F 2JJ4D 5E41A 4IDKA 2VG5B 1XC9A 3CJ0A 1BY9A 3DLEA 4HT7A 1S7IA 3VAHA 3ZNUA 1DFDA 1X4HA 3MMAB 2DHHA 4RKUC 4X84A 4O23A 1N88A 4RW7A 1GTEA 3D0HE 1RT5B 1DRZA 2ASJA 3OLBA 4WZQA 1NSAA 2J7KA 4CYUA 5LXRA 1TFYA 3HULA 5AT1B 1EP4B 2NLWA 3ZTOA 3HM9A 2VOPA 2FTRA 2DGSA 3NNAA 1PAUB 1VBXA 1HNVA 1LKZA 4L74A 4NCAA 4NPOA 1HW9A 3W8GA 4OX6A 4F02A 3JYTA 1SVDA 1TFWA 1N5YA 1I1GA 3ENVA 2MMYA 2F65A 1UFLA 3DRSA 1IJFB 3QNWB 2AYMA 2VA2A 4DSJA 3TJ9A 4OYOA 2G2YA 1VLOA 4LR7A 5I3UB 1YJTA 2R8KA 5C5JA 1DQ9A 3ONQA 2CPZA 4GRSA 2DTJA 3X3UA 2KYXA 4DV1J 4N56A 4LRFA 1H0HB 3M4XA 2A6OA 3QZ8A 2Z8QA 1IM4A 3X1LB 1NJIT 2MSSA 4PRFA 3D1QA 4JI1F 2OD6A 5F0WA 2H51B 4LF4F 2OEMA 4JI5F 1QUPA 3M6UA 1S79A 5A6PA 1EARA 3NLCA 1RCXB 5F8GA 3TX8A 4DXLA 2LQ8A 3O3LA 4MK8A 4F3MA 5IWAJ 1XMOF 2HYIB 2IVYA 4WFYA 2HFUA 4LRBA 3OV7A 2W01A 2VJVA 3K5OA 3EVWA 4P7VA 2WVFA 2AW0A 4QIVA 2IA0A 4Q43A 3IWNC 3K7RA 5A8KA 5IT9U 5D77A 2LXUA 4P72A 4KE5A 4LQ9A 3W2VB 3NGTA 1O51A 3K0JA 3T1HJ 1CJKB 4UUXA 4USUA 3WC0A 1P9YA 4ZPAA 4ALZA 2ZD1A 3O1LA 3R1HA 2XB2D 3MTJA 1XNQJ 5HJXA 3A8EA 5LMUJ 4JV0A 1RKIA 4TY9A 1U8SA 2KG1A 4OQJA 1VYAA 1DAXA 1FKOB 2Q43A 4F4YA 1U1NA 2DNNA 3SSQA 3V81B 3QYYA 3BDEA 2DISA 4CTAB 2KDOA 2LU2A 3NOCA 3MUTP 2NQPA 1H7WA 3GYXB 5G0RA 1B64A 2X1FA 1IKWB 4UY85 2YX7A 1J5EJ 1KBRA 1HMVA 2XLJA 1X4GA 1BQMB 3D54A 3B4DA 1SC1B 2QLFB 1SPBP 2KYZA 3VGSA 1WF0A 1FTCA 1D8ZA 5CD4A 3N5BA 2MEWA 3GFHA 3MOZA 2GHVC 4LF2A 3MPYA 2MKCA 2RQKA 2YBVA 2R7XA 2E9TA 1RWVB 4ZPWR 1IR2A 2HFZA 4AQYF 2M8DB 1SL1A 2D3O1 1IKYB 3W1YC 1O0PA 3W64A 4IG3B 3R6GB 5KT5A 2KVIA 4R0JA 4C0BA 4JB8B 4PAAA 4IG0B 1S57A 2WONB 4YY3F 3MR5A 1VISA 2HSEB 2YQ3A 2RU3A 3QGPA 4QQBA 1UEKA 4RW6B 1I94F 1W25A 2RDDA 4DCOB 2XZTB 2U1AA 2DH7A 2FVQA 3OVSA 3R6LB 5HVFA 2AF6A 4DUZJ 3NL0A 2K2PA 3Q8UA 5D78A 3AD9C 1XJWB 1PJ7A 1RBOB 1U45A 4RNFA 1LW0A 2H5EA 4KGKA 3UWTA 3RAMA 3OLAA 3I5BA 3AQOA 4DFKA 2FVPA 2BANB 3LAKA 3LP2B 3QJPA 3TOQA 5EWGA 4ATNA 1FEEA 3JQMA 2VPXB 2ZVIA 1NZAA 3PX0A 1R6VA 3DOLA 4ZVSB 2V4JB 2QA2A 2E5LJ 4X4VA 2O3DA 4LJMA 8ATCB 4ANCA 2X1GA 1RU1A 3MCSA 2H54B 3GPAA 1JLQB 1RAGB 3PRDA 1NJYA 4KPCA 2RUSA 3ZZYA 2R7RA 3OR2B 4XDCA 1HKAA 2VBYA 5J2PA 1VQNS 4AL5A 2MQMA 1FE0A 4M5IA 3BM7A 2XGPA 4X62J 3QGGA 4MIWA 5LMNF 2VG6A 1MMLA 4DPUA 1NHVA 5IV4A 3P5BP 2F8EX 3KLIB 1VIXA 3FMBA 4AD6A 3ZZ0A 4F3OA 4EZ9A 4HACA 1T9UA 5B08A 3FZ2A 2GIRA 3HKWA 1HQEB 3TI0A 4RZRA 4JYAJ 3Q83A 3E3XA 2NZ4A 1EHWA 4ED2A 5EHHA 2DEIA 4JI3J 2A6MA 3ISND 3PCOB 3VCDA 3PO4A 4QYRA 3I0SA 5C2CA 1FDDA 4RX6A 3H0PA 1IQTA 3CJ8A 3IRXA 4QR0A 2J7UA 1GNKA 5KFFA 2ZJRQ 2RS2A 5DGBA 5KFRA 2Z30B 3M6WA 3A8IA 4QIGA 1VK3A 4ZJQA 2DR9A 2C28A 2I1RA 2GJFA 1B4SA 1NK8A 3MDFA 3IM8A 1RUSA 5KFXA 1OPZA 4E98A 1TUGB 4PQUB 4QCLA 2XMKA 3IS9B 1XWLA 3QSIA 3K8VA 2JL9A 5A8WA 4A48A 3SQGA 4C7QA 1T03B 4KGZB 2XTJP 1Q7LB 3KKFA 3NS5A 3T5KA 4DZDA 2LMIA 1EZZB 2EG2A 3V6KA 2LYVA 2Q66A 5IT0A 4DEZA 3MMAA 3P5TL 4FZVA 2L9WA 1JLBB 2RMLA 5T41A 3FQKA 1RT5A 4D3HA 3AA9A 3FZBA 2IDEA 3K57A 1EP4A 4YP3A 1NPPA 2RKIB 4NLGA 1VLYA 4U95A 4TXSA 5KFUA 2RE1A 1NH8A 3HCXA 4EU0A 1K44A 5HMWA 4ILMA 2X7IA 2H65B 5A2QU 5HL7Q 1X4BA 2CQIA 2ZH9A 4IRDA 4JI4F 3Q24A 1RWOB 2CQGA 2ACYA 2HHQA 3M6VA 4J9UE 4B08A 1FA0A 4X4TA 5I3UA 4A8OA 2BJ8A 4JI7F 5AE3A 2ZH7A 1DQ8A 4X4NA 2DXDA 1KQGB 3BJYA 2BJ7A 3FUYA 1L3SA 2QYGA 3JB9k 2EC0A 4LF6J 4WYLA 3LO3A 4O44A 1KTVA 2JC1A 3LGMA 3ISZA 3LANA 3PHEA 1VC6A 1FX2A 3RW7A 1JJ4A 3VGUA 3SFGA 4I1TA 4TN2A 2HQIA 2NCKL 4D3GA 4JP8A 5GVQA 4EO8A 1ZAVA 2WTFA 4R25A 5EDWA 3MAQA 4ENOA 2DCUB 2NUUG 2MJNA 3KUGA 2Y0SD 3K5PA 3P49B 5E7OB 4RUAA 4YHHF 1PGZA 3A8JA 4CLTA 4I6YA 3FVYA 3MAHA 1NK5A 2DR8A 1NU4A 3W2VA 1TL1B 8AT1B 3SSSA 2J7WA 1FKAF 3TZWA 1CJKA 1SCJB 1OYDA 3OJSA 2IBOA 2FD2A 3GV5B 5LJ5Y 2ZUAA 4A4JA 3CMQA 1FKOA 5F41A 4LBHA 4H4OB 2UV8G 2RAQA 3V81A 2RF2B 2FLPA 2HHSA 4CTAA 1LXNA 4YR0A 2FLOA 1IKWA 1WUUA 3HD1A 5E3RA 5CABA 1BQMA 3NG8A 2W7AA 2C2RA 1XR6A 3UD4P 2VQEJ 3TAMB 2G4BA 2I38A 1T11A 4RWWA 2LU1A 1ZM3A 4J9LA 4Q45A 5KT3A 3C46A 3N6MA 3DHWC 1ZA1B 3MOJB 1NXIA 1N5TA 1QVGR 1IKYA 2AT1B 2B4UA 4MKAA 3MTKA 4IG3A 2MLYA 3R5JB 3M8ZA 4IG0A 4LF1A 1TK8A 2WONA 3A1YG 4K4WA 4KKOA 1NSQA 2GGPB 1FWKA 4PKDB 2UUWA 3PYFA 1SIZA 3PKYA 2BKOA 2PA8D 2EI5A 5CYQB 7FD1A 3ZZRA 2DIUA 3DDNA 5KG5A 4ZMMA 2ZZNA 4CLZA 3FBEA 2HFOA 5DS7A 4M5DB 5KFVA 1XK8A 4NEZA 3RBXA 1CC8A 2N4CA 4OZNA 2UP1A 4ZDNA 2IVFB 1OJ4A 2W2OP 4MMOA 3AA8A 1REVB 5HQ8A 2HHVA 2DHAA 3GILA 2BANA 2OMOA 5ETQA 1T9VA 4CQ1A 2G2OA 1MSWD 3CF5Q 2ADCA 3VZHA 1PCAA 2KL8A 1BQXA 2GQ2A 1XNRJ 3SBMA 2B9YA 2QC3A 3ILJA 1AUSL 4IFYB 4WPAA 3WX8A 4EI2A 5L38A 3FEZA 2V4JA 5ETVA 1YKWA 1WEXA 3SI8A 2G2ZA 3BKUA 3PW4A 2IMWP 1OYEA 1M5VC 2YKNB 3AQPA 1N56A 1JLQA 3MM7B 5HP1A 2HHHJ 4TLQA 4DV0J 5ETLA 3OR2A 4WU3A 2W9CB 5H9EK 2HVZA 4CO1A 4DX8H 1YWXA 1SBRA 5DO2A 4NL5A 1XBWA 2XEXA 3KLIA 2Y3YA 4LIWA 2CPJA 1MW7A 3KG1A 2DJWA 1HQEA 4WCEQ 2MZSA 2EFPA 1YG0A 3CD0A 2J6TA 2HLUA 1U1QA 2APOA 4P71A 1HQUA 1NKCA 1TZ0A 1D8YA 5ETTA 3PJ9A 2QLXA 3M7VA 1FK9B 4DV1F 4M94A 4C3MA 4EFAC 4NLRA 3U1LA 1NJXA 3EXCX 2MSTA 2JHEA 2HQGA 3PW2A 3UNGC 1QTNB 2R3VA 4DV6J 2BJ9A 2F8MA 1R31A 1KOOA 2OPSB 2NXCA 4HLBA 1H2VZ 1Q78A 4M8LA 2CNOB 1YJ9S 1FRMA 4A8KA 2D3ZA 4DL5A 4PQUA 1F60B 2AYBA 2ZOMA 3IS9A 1EETB 3R27A 1FO1A 5D0GA 2QFIA 4U67Q 1T03A 2VV5A 2IM2A 1IBLF 1RGVA 2C1EB 3VAJA 4DWIA 4LFAJ 2YKQA 3OTOF 3DLGB 2RDIA 2YWWA 1YRUA 3UCGA 5L1LA 3AOAA 4IRKA 3FBCA 1JLBA 4A8QA 3PFOA 2K3IA 4R5PB 3T1HF 1NJZA 3ENWA 4HL9A 5AJ3J 3K89A 1SH2A 3M9NB 2X1AA 2YWGA 4WE1B 4DQSA 2W25A 3KNAA 2RKIA 3LF0A 1XNQF 3NNHA 2VONA 3DGVA 5B0BA 3Q8VA 3TZXA 3GJRB 3KJNB 3VQTA 4LBPA 4ZVEA 1UA1A 4HHJA 2Z56B 1YDLA 1T9XA 3CC7S 1S0NA 2DGWA 1KS2A 2E1RA 4ILLA 1RAHB 5DDPC 1RAFB 2QTWA 4ZVGA 1J5EF 1ZPWX 1HNXJ 4DF8A 1D9FA 2B8QA 2P8IA 2JC0A 1VQ4S 2CQ4A 4IFVB 4LMZA 2YKOA 2E29A 1JXEA 1T05B 3F44A 2KN4A 3H7HB 3SDEB 3BSAA 4RUBA 4CH0S 3W62A 3I55S 1ZAXA 3QT5A 2HVIA 4QWAA 4L6V3 1YRTA 5L1KA 4IR1A 2GQQA 2QMUB 3ET6B 1N52B 1RT2B 3R97A 2F7VA 1P9QC 1IKXB 3MD1A 2DNGA 2UV8A 1KR4A 1R6YA 4DSLA 1X5OA 1U1KA 2WAQD 2Z2LA 4DR3J 1PAEX 1S4FA 3QJJA 2KZMA 4LF8J 4Y28C 4KTQA 2XQCA 1MNEA 1H98A 1SB6A 2R8HA 3H98A 2R8GA 2VODA 4J9QA 5THWA 3N9UC 5E5NA 3PVXA 1RAAB 2IRXA 1HA1A 1LW2A 1SQGA 3MR7A 2JLGA 3DFEA 5KFSA 5M2PA 2CIMA 3PRBA 2P6TA 2AV5A 3CJ4A 2ZZTA 1TL1A 4F04B 4QYZK 3IBWA 2ZH8A 1KLMB 4NLUA 4GO5X 4YR2A 1IR1A 3T6BA 1RT3B 2EK6A 4B3RJ 2DH9A 2QN6B 4OYMA 1CEZA 3M8SA 3R5BA 1SV5B 2IJRA 3IAM9 1Q5YA 3DHXA 1CJUB 2YPYA 2DGQA 4H4OA 4UOFA 1WKLA 2RF2A 3S6EA 3RBDA 4OIXA 1S0MA 2E5HA 2F9DA 2RQCA 1FRXA 4UTGA 3G2XA 1YZ7A 2C2EA 3RB6A 4NA2A 2E5LF 3N01A 5AXKA 5B0DA 4I69A 1U2CA 1ZAWA 1VQKS 3TAMA 1FVSA 1B0PA 2A0FB 4ELVA 5C25B 4K4VA 2DHXA 4ZLLA 3VVUA 2Z2YB 4QU7A 2FY8A 2AJ2A 4V19X 2L9NA 4Y2MA 4ZPBA 3TUZC 1JXVA 2HS0A 3MFIA 4HTIA 4OI6A 3TYTA 1UZHA 4L73A 1XTZA 4C6AA 2B4VA 4JYAF 3FDSA 2VFTA 5IT4A 3GJSB 2QIFA 2GGPA 5HK4A 1Q86T 2JSXA 4JI3F 4USMA 1FD2A 2KHDA 4DR1J 3OQ2A 5CYQA 3KJFB 3NGDA 4OYBA 1EQ0A 2AJ4A 3M8QB 4ZA1A 4MFBB 3R7SB 3O5TB 1U25A 2HHWA 4M5DA 1EAYC 5BYSA 2OPQB 3VAKA 1C1BB 4ZP9A 1ZETA 4K50A 4BCAA 4TU7A 1WKJA 1OPIA 4C8YA 2CVEA 3SSRA 1REVA 4JI6J 4FYWB 4F2RA 1VQSA 2V34A 3H20A 3B6BA 1H7XA 1S1TA 5F0UA 5D0RA 3AJDA 4OZ3A 3MEGB 3QT8A 4A8FA 1XERA 2OLWA 2V9KA 2MZ1A 5D4LA 2CDRB 4FS1A 2KKHA 1UJ6A 3M1VA 4XPCA 1G1XA 2XY6A 2FB0A 1B70B 4MK7A 3KDNA 3IBCB 2BE2B 3Q8QB 2XNRA 4IFYA 1HLWA 1RAEB 2MKSA 2NXNA 3KK3B 3FBBA 4P10A 4QWCA 3DRYA 2J9DA 3RR8A 2LA4A 1DARA 3G9CA 5B0EA 2YKNA 4NCGB 1S6OA 3OVAA 3MM7A 1VR6A 4NLPA 2Y8WA 3K2YA 1A6LA 1OO0B 2ASDA 2C2NA 3SCIE 3OTCA 4YDDB 2W9CA 3QIDA 4CRJA 2Q79A 4I6AA 2JX2A 3RB0A 3GYNA 2RILA 2YXLA 4J9MA 4F0MA 1F9FA 1P6TA 3G8QA 1NLKL 2RQMA 2WK4A 1NPKA 1S1UB 2R7OA 1CJVB 3RBZA 4IRCA 3PKMA 1FXLA 4PG6A 2B56A 2Y1LB 4NZ7A 4OHWA 3HVRA 3NP5A 3A13A 1FK9A 5IZHA 1UVJA 2CG4A 1FJEB 4ECSA 2V2ZA 4NX9A 3GV7B 2DRDA 1UA0A 2OPSA 4NMXA 2Z2ZA 2CQPA 3Q22A 2VL1A 1SH0A 1FX4A 2C2KB 3AY0A 1GXUA 5IQ6A 5A2QY 2I5JB 3VF0B 1EETA 1XQIA 3M2UB 2V50A 2AJFE 3J7A1 4URGA 6FDRA 4J9SA 2KH9A 3LWLA 1IVZA 2FLNA 1SIWB 5HJYA 2F63A 2BDPA 3DLGA 4KT0C 1YITS 1GH8A 2IYGA 1R89A 5DLFA 2AJ1A 4M5LA 4JI2J 3JTOA 3JTNA 2EFVA 1T02A 1XEZA 4R5PA 1RWKB 1IR0A 3R3TA 4WE1A 3ISNC 1LK7A 1T9TA 2RSQA 1D0EA 2BE9B 5CA5A 2QYCA 5KFPA 4F7VA 2DRAA 1KKHA 1TL3B 1IBMJ 2OMLA 4IOAQ 2CJ9A 1OS5A 1HQ2A 2HGNA 2I6WA 3I0RA 4RNNA 2BA9A 3EZ5A 2KJWA 1N33J 1GAOA 1IWAA 4WFBQ 4MIAA 3LP0B 3I5CA 4ED5A 4JI0F 3C66A 1D09B 2P9EA 2M9KA 4H4KC 1AROP 3WQPA 4ED0A 2BUNA 3D6TB 1RT6B 2BQRA 1JX4A 5B09A 4IFVA 2ZH1A 2VQEF 1HNIB 3UD5A 1HBMB 4BC9A 1T05A 2UU9J 2K1RA 4OYIA 2HRTA 1TL4A 4LIRA 3SDEA 4OHYA 3PACA 4CO0A 1SKSA 4ZN3A 3H2UB 5BYRA 3RB3A 1RLCL 2R7QA 3S8SA 1IBKJ 1F0XA 1RT2A 1WHYA 1IKXA 1CPZA 1SUQB 5GAEI 2XSFA 4PYAA 3UDEA 4GVLA 3M9MB 2RH3A 3MD3A 1C1CB 4N8OA 4MJKA 3J81U 2BEFA 2QRRA 2QLWA 4MKBA 2H5JB 4ECZA 4B9MA 4OI4A 4DPTA 4FKXA 3HSGA 3H2LA 3NGRA 4O3PA 1SL0A 4N76A 4OLPA 4UZBA 3SQOP 3JAMU 3HFVA 3O44A 1URNA 2KVQE 1YBUA 2DIVA 2DR5A 1HYSB 2AZ1A 2HHUA 5M2RA 3CCJS 3QWUA 3GSDA 3UR3C 2R7WA 4I2PB 1M1GA 3GYGA 3EGWB 1F9HA 2LLZA 3TAPA 4OV6A 4HDGA 1RWUA 2Q1LA 3DOMB 1N32F 4KH0B 3IRWP 1SV5A 5EGYA 1HHTP 1RADB 4O3OA 1KVJA 4CNZA 3G6VA 5J1EB 1CJUA 2HQFA 4P74A 3EM1A 5CHCB 3CCWA 4F36A 1XNRF 3KK2A 3AXKA 3BGLA 2X3GA 1NCLA 2LDYA 3CO0P 5CAAA 2MQ8A 4FXWA 4FYXB 4DU7A 3SXLA 2HMIB 4PEOA 3KDOA 4YDXA 3QBCA 1WTBA 4NLDA 4Q8FA 4ERDA 4V19J 4C8LA 2EBEA 3MZIA 1VBKA 3L7PA 3HK2A 2YPZA 1FWLA 3HP6A 3H40A 3TEGA 5C25A 1R0CB 4GVBB 2XO6A 3RTVA 3IMQJ 2V63A 3L4BC 4NMLA 2F5GA 1JKHB 2VG7B 1HNZJ 1D9DA 3CVKA 4P2XA 4V1Ak 2EVZA 4QWBA 2M52A 2B0GA 2HFVA 5I4MA 3FEXB 1EB0A 3JS9A 4KV8B 1QJHA 4DU8A 1K47A 3Q8RB 4U8VA 3PYDA 3JSBA 3GIIA 2BM1A 3N4WA 3W2WA 4TQSA 2GMLA 1YGYA 5KG0A 3C6TB 2KFYA 2JEJA 4IR9A 1RA6A 2HWIA 2DH8A 4URSA 1AFIA 1DTTB 2PT0A 4U7CA 2DB1A 3M8QA 4MFBA 3D1HA 2B51A 3KLEB 4DV6F 2EXUA 2VPZB 2OPQA 3THVA 4O3QA 3DGPB 1C1BA 4MKYA 4H4KA 2EKYA 4F4AA 2JZ5A 4LSZB 3QJLA 3CD7A 1F3FA 3M2RB 1S0OA 3B8HA 3NAIA 3BKFA 2UXCJ 2XZDB 4USKA 1JXLA 3MEGA 4EWTA 3GIMA 1Y5IB 1P1LA 1RAJA 4LSNB 2VHGA 2M7SA 3B4MA 4LFAF 3O8WA 1TMMA 4U7UD 1UJ4A 4OHVA 2HZAA 2BW2A 2QLBB 3KK3A 4NI2A 2LEPA 4C3KA 2FVSA 3EWGA 3VAFA 1YI2S 3GU0A 5AJ3F 1IKVB 4NCGA 2RIJA 1HWIA 2IC3B 4KRWA 3POTB 4GC7A 4CO4A 1N8RT 4QWEA 2VFRA 2Z58B 5E3AA 4X4PA 2CPYA 3CGIA 2HBZB 1NBEB 2KT3A 4DR2J 1R0AA 4K2XA 3UPFA 4GKKJ 5C2GA 4NE9C 3L95X 1BXNA 4W4MA 2Q3PA 1SJFA 4OL8A 3QLHB 4B17A 7AT1B 2ZDOA 1S1UA 2IRYA 4PZVA 1CJVA 1HNXF 3NS6A 3UCUP 4DLEA 1KTQA 1RTZA 5LM7E 2QE5A 2AGPA 4B3MJ 2CQ3A 4U96A 4R8UB 4TU9A 3K5MA 3G8SA 1X4EA 2KXNB 2CPDA 3QRQA 3EZOA 1NZ8A 2V8HA 4FS2A 2UVRA 2CA9A 1BQNB 1G4CA 3D2WA 3I82A 2QL9B 1X5SA 2C2DA 4DV7J 2GS8A 1KHVA 1FFWB 1Z4UA 3CEDA 1X4DA 1OWXA 5M2UA 2PI5A 1RWWB 2CQDA 3I9ZA 2I5JA 4BBYA 3D9BA 1ZS6A 4ID8A 3M2UA 4LVNP 3H25A 1HL6A 1YQHA 4I6WA 1LV5A 3W8PA 3MM8B 4TY8B 4B3SJ 1QY7A 1WF1A 5F8MA 1F6TA 4IOBA 3PYEA 3MMJA 3LTOA 4UQGA 3EPGA 4B3RF 2NS1B 2UVVA 3DRRA 3I31A 1VRUB 4K7QA 4NLYA 4ZS6A 3H59A 4EBEA 1Y00A 2N7YA 1TL3A 3PV8A 3SMZA 3UCZP 1L3KA 3B82A 3KOAA 3OTBA 4DCPB 4DQRA 4L75A 3NMAA 2DXEA 3HHEA 3TA0A 5HATA 1R8HA 3RBEA 3H4DA 4YOEA 1TTHB 4K5RA 4J9RA 2AHOB 1RTIB 1U0HB 1QDUB 4ZVRB 5B0FA 1RBLA 3MAAB 3D28A 4FF2A 1RT6A 2B9XA 1TK5A 2K7KA 1HNIA 3KLFB 4ZPTR 2MY7A 5GAEU 3CC2S 1I5OB 2AWZA 1QVFR 2OUGA 4AL7A 2VF3A 4ZOSA 5AXNA 2BYCA 4NZ6A 1DLOB 2YNFB 4OZLA 4NLVA 3MGJA 1Q8IA 1MN9A 4CLFA 3W60A 2BR0A 2HQDA 3MM6B 2DVIA 3UDCA 1C1CA 2C42A 2KJVA 3RW6A 3D67A 1XR5A 1Z1ZA 2E1PA 4C0HA 2CQ1A 3QAUA 2JOQA 3S01A 4PABA 2VBWA 4M5MA 1WOOA 4DR1F 2D41A 3D7SB 2CADA 4KGVB 1YJ7A 1WG1A 4USVA 4QIWD 5CCLA 5BYQA 4TLRA 1HYSA 3ENAA 1FKPB 2W4PA 4P2FA 2YNGB 2ZH6A 4I2PA 1PIEA 4Y0FA 1U8WA 2OEJA 3JSYA 5CYMB 1L3UA 3CMAS 4J37A 3DRXA 4ZPCA 3HFZB 2FJWA 3DOMA 3FMWA 3CJRA 2DNLA 4ZIWA 2CNNB 5J1NA 4A8SA 1R8CA 3BN7A 3W5YA 5J1EA 2YQ0A 1AT1B 3QIPA 2WRMA 2DNYA 4LQ3A 1OQ6A 2FGCA 1HW8A 3GFYA 2CXEA 4ZK7M 1WACA 2HRUA 2ZWOA 2O01C 2O67A 3UN2A 4X4OA 1KWMA 2ZFHA 4KHMA 4DOZA 3MM9B 3N5FA 3UVJB 4NXMJ 1V6HA 3ZTPA 1V5VA 3Q8SB 1V5IB 1JLAB 4RW4B 1FHTA 4AYBD 3GIRA 1DTQB 2XM3A 2EW9A 1QAIA 3GWCA 2DPJA 4GVBA 3T1YJ 1BHNA 1N4LA 3CJTA 2DGXA 4ZVHA 5G4DA 2VG7A 4PPDA 1WOSA 1SQEA 2OELA 3AB2B 2IFXA 2YNHB 4O0IA 3Q8YA 3OTDA 2ZJQQ 2IVMA 3DYAA 2FJVA 1ZM9A 1GFWB 2MPUA 2ZZMA 2GV1A 4LF7J 2FZCB 3UD3P 2QV6A 1OY8A 3C6TA 3DM2B 4WXWA 5JUMA 4C48A 4TVAB 2GIQA 1VDHA 1U1OA 2C3UA 1S0VA 4DX7A 1XMQJ 1Q1KA 1DTTA 4ZJLA 4ITSA 1WC5A 1EKRA 2R9LA 1XN9A 4G1QB 2PC6A 4AXJA 3KLEA 2IM0A 3DGPA 4LRDA 4HDHA 3EGVA 1H2TZ 4K0KJ 2BJDA 4P52A 2IPOB 5A76A 3DC2A 3BS9A 1U49A 4M95A 2ERRA 1KONA 3OL6A 3A12A 9ATCB 4RR5A 1O8BA 2XY7A 4F25A 2IBKA 2XYHB 2GW8A 3IA0A 3CJ2A 2W9BB 1CQNA 1X4AA 2ZWPA 3I32A 4TU8A 4JI2F 3DU6A 3AFGA 2VDHA 3UFCX 1VQ8S 1Q8LA 1IKVA 4KYZA 3NY0A 1KDNA 2DD8S 2POKA 2X51A 4ZITA 2MKJA 2DNZA 2YNIB 1E6YB 2IC3A 1KC8T 1RWNB 2EFNA 3POTA 2HGMA 4ZHRA 3UI3A 1SJ4P 3BZQA 3S1TA 4WIQA 1IBMF 1KNZA 1MU2B 2N7CA 4CLSA 4LR8A 3VZIA 4A8WA 1BE4A 1SJ1A 5J2NB 4WP8A 2FLLA 2C22A 4LF9J 3TUPA 1N33F 4CIOA 4I4BA 3QLHA 5HMXA 2GVDB 4YQWA 4GKJJ 3RUBL 3GIKA 3HVTB 2R7SA 4OZ2A 3T9ZA 1JNRB 3GB0A 3P3DA 3U02A 5DRKA 1JLGB 1WHVA 5F9NA 2UU9F 5J2MB 4R8UA 3BR8A
chains in the Genus database with same CATH topology
2JHEA 2BQ3A 1QAYA 3PW2A 3UNGC 5J1PA 2BM0A 3WX4A 1ZM4A 4DFJA 2F8MA 3HZEA 1R31A 5K14B 3L3CA 5J2MA 2HHTA 1KOOA 2GO8A 5KFCA 1VRTA 3VAIA 2OPSB 4GMKA 5IM0B 4KGMA 4LF6F 1M5HA 1U1LA 1VQPS 4HLBA 4DF4A 2R8JA 1H2VZ 1Q78A 4M8LA 2IJNA 1IBKF 4IO9Q 3BB5A 4B9NA 4CNYA 4G6VB 5K14A 2QA4S 1YJ9S 2FJDB 1BQNA 3TRGA 1RQ0A 4ES2A 4A8MP 3DN9A 4Y2AA 5E33A 1NB7A 5AXMA 1U6ZA 1U48A 2JEGA 1FRMA 4A8KA 2RUGA 2ZVSA 4DL7A 2KU7A 1TVRB 5AXLA 2D3ZA 4DL5A 4PQUA 4IDKB 1F60B 4WK3A 3PEJA 2AYBA 2ZOMA 3PIOQ 3IS9A 1EETB 3R27A 1YHQS 1WF2A 2V94A 3DLEB 2HRYA 2OSRA 4DQQA 1FO1A 1LQ9A 4DV5F 3CJ3A 1LXJA 1TVRA 1HWLA 5KFDA 4U67Q 1T03A 3JSRA 2VV5A 1WEZA 6FD1A 2GMJA 2IM2A 1IBLF 1UVIA 1UVNA 3CCZA 1RGVA 2V8VA 1UJ5A 2JWNA 4G1PA 3VAJA 3ETOA 4DWIA 3C6UA 2DNKA 5H9FJ 3MF5A 4YFUA 3U1MA 2OAUA 3DLLQ 3GFXA 2CQ2A 2YKQA 3OTOF 4F26A 1NK0A 3K8WA 1A7GE 4ED8A 3TA1A 3DLGB 2JLEA 4RW7B 2DGUA 2RDIA 4BHQA 2MHEA 1TKDA 1YRUA 2Z2MA 3UCGA 5KTQA 5L1LA 2ZNZA 2IM1A 3EGZA 5L1IA 4ED7A 2V4RA 3MM8A 4IRKA 4TY8A 1JLBA 3T19A 1YJWS 4A8QA 3PFOA 3RRHA 2X1BA 2F9JA 3WC2A 2K3IA 1YJUA 4P2SA 4WIIA 5IXUA 2XC9A 2ZH2A 2OFGX 2XMWA 2R7TA 4R5PB 1MMDA 3VAGA 3T1HF 4HYKA 3ENWA 3HPOA 1NJZA 5HROB 4HL9A 4Q5VA 3IG1A 3KK1A 3QZ7A 2VFUA 1SH2A 3M9NB 4ID5A 1N36F 4O3NA 4ETZA 2X1AA 2E5JA 2YWGA 4BC7A 2OJ3A 4WE1B 4DQSA 3WDOA 3TUJC 2W25A 3KNAA 1BWEA 3QWPA 2RKIA 2CQCA 3LF0A 3IGNA 2RRAA 1XNQF 2IMOA 2EPIA 2LDIA 3KLGA 1AFJA 4HVZA 4P7TA 1VOMA 3TR5A 3NNHA 2AX0A 1L3TA 3VWSA 1V3ZA 2R2UA 3CJ5A 3P96A 2VONA 2XS7A 1VRUA 2XSJB 5B0BA 1LWEB 4WYWA 5BJRA 4CZCA 3JYTB 3SEOA 5KFBA 2FHJD 2XCPA 3VQTA 1U1MA 2CPIA 3MEDB 1N5YB 4ZVEA 3HVAA 3C2PA 3KG4A 1UMJA 1KOHA 4B9SA 2GHWA 3DRSB 1UA1A 4HHJA 2M2BA 1FDAA 4K4XA 3PJWA 1PSDA 4K4SA 4HEA9 4FN5A 2BVZA 1T94A 2FY1A 3ICLA 3M2VA 1XMBA 3CC7S 4CH1A 1ZM2A 1C0UB 1S0NA 3ENQA 2OFHX 1FNOA 5HBMA 3T5JA 1RDRA 3T3FA 2DGWA 4DFMA 2P6SA 3SZ2A 3J81Y 5DQIA 1KS2A 4BWMA 2EFGA 1T3NA 2E1RA 1C0TA 2QSFA 2CPFA 4ILLA 2MY8A 1KLNA 5DG9A 3MI7X 5DDPC 4ZVGA 1J5EF 5I42A 3OFHA 4A8XA 1ZPWX 3BQ0A 4DF8A 1D9FA 1JLEA 1K9MT 2OPPB 4I64A 4IOCQ 3Q2SC 2LVWA 4ES1A 4Y00A 2BV3A 2JC0A 3DXBA 4KO0A 5JVGQ 1VQ4S 5F8NA 1LFWA 1P1TA 5GAHI 2CQ4A 1RTIA 4IFVB 3FRYA 2RDJA 1UVMA 4LMZA 4HH1A 2YKOA 2E29A 3SCKE 1JXEA 1T05B 2XI3A 4LSLA 1HD1A 4I7FA 5KFNA 3F44A 3JAMY 2KN4A 5GAGU 3SDEB 3MECB 3BSAA 4TNOA 4CH0S 1WHXA 4Y2KA 3H5SA 2UVWA 3F73A 1HBUA 5D4PA 3I55S 3NCPA 4ICLB 4ECVA 3KLFA 1ZAXA 2OO4A 2HVIA 4FP9A 4QWAA 3OSNA 4L6V3 1YRTA 5L1KA 1K73T 4IR1A 4NXMF 4WZMA 2GQQA 3NAHA 4Y2CA 2LEBA 2XBPA 3CXCR 1N52B 2W8LA 5DM7Q 1RT2B 2AYEA 2EFOA 3NWGA 3HO1A 2YWKA 5CZXA 2NREA 2F7VA 5B0CA 2ILZA 1P9QC 4N77A 1IKXB 3OR1B 2VFSA 3MD1A 5K5MA 1IXKA 2MQPA 4K4TA 1G2EA 4DBQA 2J9CA 4LFBF 3KWMA 2DNGA 2UV8A 5KFEA 3TUIC 3HFKA 1RISA 4DJBA 1FJGF 2YH1A 1HNZF 1KR4A 4IYQA 1NJWA 1R6YA 1DLOA 2YNFA 3PNIA 3LPYA 2MKKA 4DSLA 1X5OA 1U1KA 3GFZA 1WI8A 3CCJS 4XO0A 2WAQD 1HI1A 2Z2LA 5LSRA 5D4OA 2V8DA 3M8PB 1HWKA 1S4FA 4UQTA 2J6UA 3QJJA 4Y28C 2KZMA 4ECXA 2HZCA 2YY3A 2ADBA 1T95A 3DI6B 2RD5C 3MM6A 1S1WA 3SFUA 1TV6B 4KTQA 1JIHA 2J76E 1GQEA 2PO4A 1MNEA 1H98A 1SB6A 2O66A 3KHLA 1VS3A 1DBDA 2R8HA 1Q79A 3H98A 1D3WA 1WHWA 3CDWA 2R8GA 1VHFA 5A8KB 1LW2B 2VODA 4J9QA 5THWA 1VK8A 3N9UC 4DSIA 5E5NA 3PVXA 2QA1A 1SI9A 4RBUA 2MJUA 4OFZA 2J0QD 3BREA 2IRXA 1HA1A 1LW2A 5A8RA 3I5AA 2XULA 4PWDB 2JLGA 4F50A 2VUGA 4N47A 3DFEA 2N3LA 2F40A 4C8NA 4O4GA 5KFSA 3CPWR 1V3SA 5M2PA 2D3UA 2CIMA 3PRBA 2P6TA 2XGQA 2BOPA 2AV5A 4WFNQ 3CJ4A 4KPYA 2E9ZA 1U4BA 1VQYA 3DMJA 1TL1A 1R3NA 4LUBA 3IBWA 3T5LA 4CO5A 1PO6A 2CVIA 3BO2A 3Q23A 2ZH8A 1KLMB 4NLUA 4GO5X 4YR2A 1H2UX 4IH6A 3T6BA 3MR3A 1U24A 1FXRA 3M30B 1BC6A 2ZDPA 1RT3B 2EK6A 2YNGA 2DT9A 3OFEA 2K7JA 2ASLA 1R8PA 3DLKB 5KFKA 4GC6A 3TANA 2DH9A 1CEZA 1KLMA 2W9AA 3M8SA 4PPZA 1RA7A 3PO5A 4NZ0A 4X2BA 3R5BA 1SV5B 1C4AA 4Y3CA 5CYMA 1RT3A 4OX9F 2XI2A 1X9MA 4DQPA 3IAM9 2QO3A 3H5XA 1X0FA 2GCFA 1RP5A 1Z2ZA 2FHMA 3DHXA 2ALZA 2CDQA 3FFIA 4OX8A 2NR0A 3KJVA 1T3OA 2XMMA 2DGQA 3CDUA 4HT5A 4OI0A 2RNEA 4DL6A 4H4OA 3O6QA 4ECWA 1TP7A 2UXCF 3EPIA 2RF2A 1JLCA 5G0RB 3S6EA 1QE1B 3RBDA 2YWEA 1HBNA 4OIXA 2HNYB 1S0MA 3RYLA 4YB6A 1QSLA 1SC6A 2E5HA 2F9DA 4OJ1A 5C24A 1UW4A 2RQCA 1FRXA 1O5JA 5DETA 3FQLA 1DURA 3RAXA 4J9PA 1Q81T 3EZUA 1D1UA 2A2CA 2DCLA 4QZVB 4B3OB 4NCBA 1RYRA 2EBGA 3DRPA 1CQMA 4G1IA 4ZPVR 5H9EJ 2C2EA 3RB6A 4NA2A 5KFYA 2MGZB 1N6QB 4OZJA 3OXGA 4WK1A 3S7RA 2QSWA 2E5LF 5D8HB 3ITHB 3MHYA 1FCAA 3N01A 2R4FA 3BEGB 1ZBTA 2B43A 2M4MA 3IWLA 4I69A 5AXKA 5B0DA 3V6DA 3HXMA 4YB5A 2FVRA 1ZAWA 2EFQA 1S9FA 3NMRA 2KI2A 7FDRA 1VQKS 2PFFB 4U9RA 1SJ3P 4I68A 4PUOB 3TAMA 4DSFA 1F5AA 1S9GB 3FSXA 1FVSA 2P5VA 1B0PA 3DLHA 4F4XA 1N5QA 4ELVA 3DOKB 2HHHF 5C25B 5F8IA 4K4VA 4Q0BB 1X9SA 1Y4ZB 4MYUA 3ZC4A 2DHXA 2M5YA 1VFJA 4DV0F 2JFKA 4OMFG 3OL9A 1JLAA 3CTRA 4RW4A 3MWBA 4X4SA 2W24A 1Y7PA 2WW8A 4OLOA 4QU7A 2AJQA 3OL8A 4MTPA 1NK9A 1LK5A 4EZ6A 2PA3A 5KFJA 2LA6A 2ZE2B 1YVFA 2WBMA 1WEYA 4V19X 2L9NA 1X9WA 2HG4A 3CCRS 2ZOGA 4Y2IA 5D3GB 3T9NA 4Y2MA 5L39A 4ED1A 4ZPBA 3TUZC 2AGOA 4DFPA 3LGNA 5GADI 2CJKA 4O3RA 1ELOA 2OSQA 3UE2A 4URQU 1OSCA 2VH7A 2HS0A 2WCXA 3OXFA 2BJEA 3MFIA 2GO9A 4HTIA 4OI6A 3TYTA 2LQBA 3T1AA 1KD1T 2G9OA 4RW9B 2FC8A 4Q2LA 1XTZA 4PXCA 4DR2F 5E3CA 2CQ0A 2V0NA 2YNHA 2PMHA 1UVKA 2B4VA 4JYAF 3R5AA 4KFBB 3FDSA 2DO4A 1H3DA 2VFTA 2OPRB 4ZCIA 1UEVA 1U6FA 2F8HA 5IT4A 2D9PA 3N28A 4LF9F 1Q4RA 2QIFA 2GGPA 3TQ1A 1Q86T 4USJC 2JSXA 4JI3F 1FJCA 3G6XA 4KFBA 1UETA 5CYJA 4NWBA 1UFWA 1FD2A 2VOOA 1X4CA 2KHDA 3PDNA 4B3TF 3BO4A 3OQ2A 3EXYA 2KB2A 4DV2F 5CYQA 1HFEL 1YIJS 4DR6F 1CVJA 2FIUA 1U1PA 2BZ2A 1RKJA 3D0GE 4EEYA 1WD6A 4GKJF 3OUYB 3NGDA 2NPIA 1S6PA 2C3YA 2AJ4A 2AP6A 3M8QB 1TKZA 3JSMA 1LW0B 3OBIA 4ZA1A 4MFBB 4ZCLA 3O5TB 1U25A 1FE4A 3KYLA 2HHWA 4M5DA 4RUHA 1OQ3A 2G1DA 1CG2A 3NBPB 2HHPA 2ZM6F 4C0OC 1S10A 3OUYA 2VB6A 5BYSA 2OPQB 3TVKA 3R1LA 1LWFA 3VAKA 1RT4A 4ZP7A 1C1BB 1IQZA 2RB7A 4QIFA 4ZP9A 1ZETA 4NLSA 4K50A 4BCAA 4TU7A 4G1QA 5KG1A 2V4QA 1NNDA 1RK8A 2YKMB 4X4QA 1OPIA 1S1TB 4C8YA 2CVEA 3SSRA 1M5SA 2XLIA 4DS4A 4OHZA 4C11A 4FF1A 3NNCA 2IHR1 1REVA 2M8HA 3V2UC 4ELUA 4JOUA 5KOWA 2FJBB 4F2RA 5L9XA 1VQSA 3NGKA 3H20A 4DHVA 1P8GA 2XMVA 2BACA 1H7XA 1TQLA 2HIQA 1K1SA 1S1TA 5F0UA 2HNDB 3T6JA 4F4ZA 2VPYB 1J2VA 3OTEA 4RNHA 4NXNF 2DNHA 3MEGB 2MKIA 4A8FA 1XERA 3M1VB 4O4RA 1FRLA 2OLWA 5FJ4A 5H1SV 2V9KA 5HO4A 2MZ1A 2VD3A 4N8NA 5D4LA 2IJFA 4NOHA 4FS1A 2KKHA 1UJ6A 3M1VA 4UY8T 4XPCA 3CULA 1G1XA 2XY6A 2OH2A 2FB0A 2HWTA 4X66F 4YB1P 1JJHA 1CSJA 4MK7A 2F3JA 2XNRA 2BE2B 3Q8QB 3DNCA 4ECUA 1RTJB 4IFYA 1S9EB 2JVRA 5KG7A 2NPFA 3CCLS 4OJ3A 2MKSA 2XLKA 5HLFB 2HQ3A 5B0GA 2BE2A 2E7WA 5KT6A 3KK3B 4B3SF 1JNZB 1ZOTA 4OJHA 1NH7A 1RTJA 4KAIA 1TK0A 4F2SA 4QWCA 2WSEC 3DRYA 3QMQA 2J9DA 4WFAQ 4KHPF 1DZ5A 2W9BA 2MZTA 3RR8A 3MM5A 2LA4A 1M90T 2R2TA 2MYFA 1DARA 4DR5F 5B0EA 1TKXA 1RT7A 4ZP6A 3G9CA 2YKNA 3GR0A 1S6OA 4NCGB 5F8LA 5EX3A 4QW9A 3OVAA 3MM7A 1HWJA 4HI1A 5FDLA 3M32A 2U2FA 4W90B 5J2PB 2ZKTA 4QPTA 3GG1A 4NLPA 5IFMA 3KLVA 4XIUA 3K2YA 3OW2R 1A6LA 1OO0B 1RJJA 2LXIA 5DJBA 2ASDA 2RJZA 3SCIE 4NRUA 4RW8A 3OTCA 3TO8A 4YDDB 2E9RX 2VG6B 1QLNA 4KBIA 2L9DA 1KHWA 2W9CA 2ZH3A 4RU2A 2YNIA 2MQQA 1E6YA 5DG7A 3SV4A 5I3PA 2ZH4A 3QIDA 3FJ2A 4QWDA 1IN0A 2Q79A 2HHXA 4I6AA 1SXLA 4DMZA 3GV8B 3N79A 3TVZA 4O3SA 2JX2A 3FSYA 3WZ0A 3RB0A 1HHSA 3TP2A 4P6QA 3GYNA 4L3NA 4EBCA 2RILA 4UW2A 1MU2A 3N6LA 2VFVA 2A1BA 1HPZA 4J9MA 2QFJA 4E0DA 4RBVA 5C42B 4FPRA 5F3TA 1SKWA 3PW0A 1F9FA 4JV5F 1P6TA 3G8QA 1Q8BA 3H4BA 3CT9A 2RQMA 2WK4A 1A9NB 4BDPA 5DM6Q 4C8OA 1S1XB 1S1UB 3H2VE 2DPIA 4PCQA 4OI3A 4J9OA 1C2PA 5C42A 2R7OA 2D7SA 3B78A 2N3OA 2OTJS 4WFXA 4C97A 2UUTA 2AD9A 2ZITA 4DN0A 1PC5A 4CO2A 1K8AT 2R2SA 4FVMA 2JRSA 3IGVA 1ZZNA 4IRCA 5KT4A 3I0SB 4X4RA 3PKMA 1J5OB 1FXLA 4PG6A 2FJAB 2HVHA 2B56A 1LOUA 5T14A 3FGVA 3VALA 3GMGA 2LXFA 4OV1A 5EWEA 2PGCA 4NZ7A 1YJVA 3AH6A 4OHWA 3IRXB 3HVRA 2HW3A 3NP5A 3THPA 5T7LA 1RTHA 3I87A 3LP1B 4MYTA 3HVTA 4PQAA 1W2BR 5HI7A 2WSCC 2F1FA 2E44A 2I8EA 2FJXA 1FK9A 1ZH5A 4OZ0A 4CO3A 1TR0A 1JLGA 2PEHA 2L41A 2OP5A 2IM3A 3LH2S 1HD0A 5IZHA 1VC5A 1UVJA 2CG4A 1YJNS 1FJEB 4C9DA 3J80Y 4K4UA 4ECSA 1M5KC 2NSBA 4B9LA 3GG0A 2E7XA 5KG6A 3CDEA 4Y6IA 3CSKA 4NX9A 3GV7B 5EX0A 3T5HA 3MEEB 1JK9B 4NRTA 4CT9A 1M1KT 1UA0A 2OPSA 3I96A 4PG5A 4QIEA 5IM0A 1RT1B 3EYZA 2CQPA 3Q22A 3HT3A 1TAUA 1HI8A 4ZCKA 1BD6A 2VL1A 3N0VA 2ZC4A 3CMES 2CJAA 1SH0A 3CIZA 1U2FA 4NA1A 1JMTA 3AY0A 2UUCF 2IYIA 2RVJA 5A8WB 1RT1A 2WHOA 3SQGB 3OFGA 4DSKA 1K1QA 4X65F 3DLBA