3J7YI

Structure of the large ribosomal subunit from human mitochondria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
158
Chain Sequence
SKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQGFINYSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 33
structure length 158
sequence length 168
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j7yI00
2QA4G 1ZAWA 5GADI 3A1YG 3J7YI 5D6GA 5GAEI 3J7Z5 5GAHI 4V19J 5D8HB 3JSYA 5GAGI 4NWBA 4UY85 1ZAXA 1ZAVA
chains in the Genus database with same CATH superfamily
2IVYA 3G8QA 3BKUA 3RAXA 1ZA2B 5AT1B 1HNVA 3NP5A 2BRLA 1VR6A 4KGXB 1FD2A 1JLBB 1PYSB 3G9CA 1HBOA 5GAHI 2VA3A 2B4VA 3DYAB 1FHTA 1RT5B 5HJYA 1WC1A 2ZNZA 4XDDA 3HHLC 1P9QC 2HK3A 5J2MB 4NZ6A 2VG5A 4JV5J 3A8EA 2KG1A 5L1LA 4ZN3A 1SI9A 1B3TA 5I3UA 2COLA 1UVMA 1SQEA 5BR8J 5K8PA 4NMXA 5DDPC 1KSPA 4PG6A 4DSEA 2I1RA 2C3YA 3FRZA 2LXIA 3AD8C 3HKZD 3CC2S 4ZVEA 3R5AA 1WACA 4L72B 2MXYA 1C0TA 3CF5Q 1YZ7A 4USVA 3IXQA 3UQSA 2XWYA 2BJ7A 3R2CJ 2NXEA 3TO8A 3H5UA 1VOMA 1RI7A 4IOBA 4M1KA 2F8EX 1J5OB 2DNRA 3W61A 1T9VA 2V50A 5CZXA 1VQ7S 1TAQA 4RW4A 4DQQA 2WVCA 4I1TA 4OI3A 5FLXY 1DRZA 2HPUA 2L3MA 3LP0B 3WDOA 1NK6A 4ILMA 1MU2A 3CE8A 3CCRS 1NZAA 1Y9OA 3TW0A 4EFAC 3GR1A 2UVWA 3SSRA 1UFLA 3K8WA 4WP8A 3B82A 3CXCR 2MY7A 4TU8A 3NXZA 3EPIA 2CNNB 4FNIA 4ICLA 5J2QB 5C25A 3GSDA 2PN6A 2ZWOA 2G0CA 1HARA 3PEHA 2H5IB 3ULHA 3TWZA 4DLGA 4DR4F 3L09A 4ILRA 2QFJA 3JSYA 2P5VA 1KBRA 3DOKB 4DQPA 3MPYA 1TK8A 1PYTA 1KNZA 3QLHB 2B5JB 2FY8A 2GVZB 4AE5A 3C14A 2V4RA 3KJFB 4DL7A 2QA4G 3UWTA 5HSPA 1SH0A 1U2CA 1BXNA 4A48A 3ENQA 2LXUA 2I2YA 3C6UB 2MZTA 4QZVB 1WC6A 5HLFA 4QU6A 3SQOP 4N76A 5D0HA 3Q8RB 2LQJA 3HPOA 1X4CA 2B43A 2C22A 1CULB 2DRBA 2WRMA 2WONB 3IN5A 5IC6B 4C98A 2AJ2A 4DR1F 1S76D 2BM1A 5E3RA 4PRFA 2MQMA 2Z4PA 3L7PA 2B9WA 2OFHX 2BQUA 3DOMA 3ZTSA 4N77A 2JRSA 1KP6A 3W65A 3FDSA 4BC9A 4ZCKA 1GT8A 1H2UX 3CJ0A 4C8NA 1RADB 2PO4A 4RNMA 4PG4A 5B0DA 2Z2MA 3JAMY 4PUOB 3QMQA 4UOHA 2C3UA 2QMWA 2P6SA 5F8JA 3TEGA 2V8PA 4C48A 3T1YF 1TUGB 4RUCA 4OV6A 4I4BA 4HDGA 1E6VA 1FNOA 2E5HA 1EB0A 2W2NP 4DF8A 3M8PB 1TU0B 1R89A 1SJ1A 1H98A 3LH2S 2YY3A 1S49A 4ZK7M 4BLGA 2GFFA 2OSRA 1N5YB 2IAJB 3GV8B 2JEGA 1WKLA 3BN7A 4WE1A 3DU5A 4OI0A 1HQEA 1LWXA 4TNOA 5CYMA 3P49B 3LANA 4XK8C 2AEFA 3NGDA 2PA8D 3G82A 3M2VB 1PAUB 4W98A 4F7VA 3R7BB 1VRUB 3OR1A 3HM9A 3M32B 5FIIA 2GMHA 4BC7A 4CRJA 3DU6A 1LWFA 3GJTB 5KG6A 3PX6A 2N7CA 1OSDA 4PXDA 2H5EA 1JJ4A 4DL2A 4WTOB 2ZBIA 4DXLA 2BACA 2NSBA 2DXDA 4OFZA 2JC0A 1YITS 5K8MA 1WSRA 2R8HA 3RGIA 3IC1A 1FK9A 2CPIA 3RRGA 2V4QA 1PILA 3MM9B 1C0UB 4DFJA 2HFVA 3FSXA 4ZVUB 5DLFA 3MCOA 4M5JA 1AW0A 2XMJA 2OPQB 3OL6A 4X62J 2H3EB 2ZBCA 1VLOA 3NY0A 2OELA 3EJMA 1DTQB 1NDLA 4B3OA 4NRTA 1WHVA 1U6BA 2VC0A 3G96A 2BR0A 4ED4A 2CVIA 2R2UA 1UP1A 4S0MA 4LBHA 3R2DJ 3P6YC 1QVGR 3UI3A 2BJ9A 2HQ3A 1DLOA 4V19J 4PZVA 4A8OA 3CCLS 1URNA 2DGQA 2G1HA 5HP1B 2CFXA 5LMNF 2XZTB 3CCTA 2E7VA 4ELTA 5D3GB 2J8AA 4L3NA 1JLEA 2IIHA 1UVLA 3NEKA 1FFGB 2UUWA 1PJ6A 9RUBA 3RBZA 2C2OB 3NBPA 2HNYA 2HAFA 1G7CB 5IM0B 1FVQA 2CG4A 1NH8A 3HI9A 1GK8A 4IDKB 1RU2A 2W24A 1L3VA 4LF1A 4Y2CA 3TA2A 1N33J 1U1OA 2CWXA 1HNXF 2YKPA 1RTIA 3CCWA 3J7YI 1KLMA 2AJ1A 4ELVA 1K1SA 3VAJA 2BKOA 3CT9A 3OTBA 2L9DA 1VQ8S 1WTBA 4JI6J 4DJBA 4LRAA 2HNDA 4KKOA 4CM0A 1F9EB 4TYAA 1Q4RA 5EX0A 3K2YA 1QD1A 3D4JA 3LWLA 3HHLA 3TX8A 1MW7A 2MKKA 1KOOA 4A8QA 1IBLF 1VRTA 2DNNA 1KDNA 3D3CJ 3RAMA 4ED1A 1FDBA 4QBUA 3OUYA 2I0XA 1K0TA 3I0SB 1XIQA 2XCPA 1CJUA 2MB0B 3N01A 4RNFA 3NNCA 3B78A 5CHCB 3MM8B 3S01A 4I0WA 2W7PA 6FD1A 3ZXWA 4DU8A 1Y4ZB 1Q86T 1UW9A 2A3JA 1EAYC 3MEGB 1C1BA 1T7PA 4Y00A 4ERDA 3AA8A 2ZH4A 4DFMA 1YGYA 1KKHA 3VAFA 2J0SD 2RS2A 2VOPA 3FQKA 2VA2A 3TQEA 5K14B 5A76A 4M5NA 5KG2A 1X0FA 1FEEA 1I5OB 4OHWA 1S1TA 3EVWA 3ZTPA 2QE5A 4YOEA 1VQSA 1DQ8A 2M52A 3T5KA 3KLGA 5F8MA 2XMKA 4OHZA 2OPSA 2RE1A 2XYGB 4RW9B 1X8DA 8AT1B 4NI2B 4YDDB 3PEJA 1D8YA 1BGXT 4KTQA 2YVSA 2K7KA 1T95A 2VQEF 1HL6A 2EVZA 2YX4A 3G2XA 4OYBA 2PDAA 1T9YA 2DNQA 1M5PC 3HT0A 3THTA 2R2SA 1O0PA 2WOMB 1UCNA 3RW6A 3MAAB 5FJ4A 5C7PA 3WBZA 1QAYA 4Y6IA 3NMRA 3QT5A 2I5JB 2W2QP 1CQNA 3ZTOA 2X3GA 2M9KA 4OX7A 3PW2A 4PQUA 2GW8A 2VB6A 1KONA 1S7HA 1WI8A 3VTIA 3MMBA 1LKZA 3FBEA 1HNIB 4IR9A 1XK8A 4NLQA 2BJDA 2AYBA 2EK6A 3PR5B 2HVIA 4WU3A 3PRVA 1VQ6S 3OLBA 4LF9F 4F02A 3UPFA 3GIIA 2XS7A 4PWWA 1NLKL 1HWIA 1Q8LA 4KHPF 2KZMA 1VISA 2ZH5A 3W3SA 3GJQB 1U1MA 3TVYA 4ANDA 3Q24A 5J1PA 2AJ4A 4TY8B 3I5BA 4KGKA 3IM9A 4ZPVR 4K59A 1KEKA 3HHEA 4FYWB 3BKTA 2WW8A 5JMNA 1R0AA 1PKUA 1ZOTA 4RJVA 4TLQA 4RW6B 4KQZA 4OJ3A 2CG8A 4LRFA 3TNVA 2GS8A 4IH7A 4WZQA 4MYTA 1RSCA 1S0VA 2VUGA 5HJXA 4RR5A 1K44A 4QR2A 2JLGA 1Q0NA 2X51A 2R3VA 3PDNA 1HLWA 2HLUA 4WYWA 4OV1A 3ENAA 4JV5F 2ZD1A 2QMXA 1PIEA 2K3IA 3JTNA 2EFPA 5ETVA 1FRXA 4ZP8A 2HZVA 3LP1B 1VBXA 4N7TA 2CXEA 4C3KA 5DM6Q 2ZZTA 4OYPA 1ZZFA 5GAHU 2YBVA 1OY9A 7AT1B 2AX0A 3QYYA 5J1NA 4CZCA 2DNYA 3NCQA 4KO0B 2JNJA 1SIWB 3CO9A 4GC6A 1U4BA 4ZVQB 3I32A 1DZ5A 1UVIA 2KZZA 4DQRA 5HQMA 1VHIA 4DBQA 1V3ZA 3KLHA 4C9DA 3W5XA 1KVIA 5E2QA 4EO6A 1L3TA 3UDLA 2NXCA 3EM1A 5ETRA 1HD0A 2IBKA 2N7YA 3BGUA 1UVKA 1Y3JA 2DKOB 3U7JA 1W2BR 1NNDA 1FTRA 2D9PA 2DPJA 4KY3A 3ZZYA 3BQ2A 4CI0B 2FVSA 5LXYA 2DD8S 1IKXA 2QEXS 2HS3A 2D3ZA 2QMUB 1VMBA 1H73A 4JBCA 1QTNB 1AA1B 4X4OA 3ONQA 2BW2A 4CNZA 2LQ9A 3ZZOA 2GCFA 5GAGI 3VGUA 2ILYA 1JNRB 4NCGA 4WXOA 2C28A 2DNPA 2Q6BA 5GMKa 2EFGA 3MR5A 4K4WA 1T9XA 5HK4A 2HNZB 1RB0A 3A3PB 4HDHA 3OFFA 2I8EA 3DDKA 3DHWC 2QSFA 4O3SA 2MEWA 4B9NA 4E98A 4RUHA 3HO1A 4DR3F 2VASA 5A8RB 2VKZG 1HMVB 2JEFA 2XMTA 4OYZA 5EN1A 4MJKA 2PSZA 1WF0A 5B7WA 3R5CA 4JI3J 1GMVA 2AEMA 2LEAA 2J76E 4ECZA 3A3OB 1D9AA 4HACA 3MM7A 1RHJB 1U25A 1VHFA 1RYRA 4JI1J 3M6WA 4HVZA 1S0MA 2IJRA 3E8OA 4H4MA 3Q89A 3I87A 4RLEA 2MPUA 2MGZA 5D4PA 5F9NA 1TKZA 2Z56B 3C6TA 4FN5A 4F4YA 2HLTA 4JV0A 4DLEA 2HEKA 1SL2A 1WHWA 2HBQB 3AOAA 2LLZA 3AB4B 3KXDA 1HW8A 2HW3A 3KJVB 1XR6A 3UDVA 2VFUA 4X4NA 1XQIA 1NCLA 3JSMB 3P96A 4LFAF 4WU2A 3BN4A 1SJ3P 2KU7A 2OI2A 5KFMA 1T02A 4RW7A 3AB2B 4K4UA 2E5GA 4LF5J 1V5IB 1SJ4P 1K0VA 1FA0A 5J2PA 3JQMA 1ZAXA 4KV8A 1RA6A 3KJQB 3UVJB 2B4PA 4HHJA 2RT3A 2N4DA 3ISND 3TYTA 4CQ1A 1IBKF 2JLEA 2JFDA 3TRGA 1D9FA 3MUTP 2VH7A 2IC3B 3RAQA 2JL9A 2RUSA 3N6MA 1QAIA 2XQCA 2F40A 3A4TA 4CLSA 1Y11A 3FZ2A 2OEJA 1R8PA 1IKWB 1DHMA 3V4IB 4HTJA 1REVB 4LRDA 2O5DA 2W9BA 3HD2A 2FLLA 2QTWA 1JXLA 2WB1D 4DV6J 1R6VA 4EWTA 5HO4A 4U8VA 4DUZJ 4TY9A 1FDNA 2E1AA 3CNQP 5F9LA 1HBMB 3NAHA 1S6PB 2FHJD 1GMUA 2ZVIA 1RAAB 1KQFB 3TANA 4DUYJ 1MWYA 2EXUA 2VG7B 4NLUA 4DPWA 1T03A 4ED8A 2OO4A 3C16A 3QIPB 3H2LA 1T11A 4IG3A 2CJQA 3IAM9 4B9TA 1HKAA 2IMWP 2MJUA 3UR0A 4CO3A 4KFBB 2FVPA 3D6FB 4YB6A 4ETXA 4RU2A 1S9EA 3W2VA 2EG2A 5DQHA 1CSJA 1QVFR 4R25A 5LOQA 2OPRA 3S8SA 1SJFA 4OX8A 1RTDA 1HA1A 1TUWA 4EI2A 4ECQA 3KMSA 3MAQA 1FJEB 2LECA 3K0JA 2FQQB 3PIPQ 3MM6A 3J7ZT 1Q16B 2MQQA 2C2ZB 3EVMA 2VG6B 1HYSA 3SI8A 2XS2A 3DC2A 3RZAA 4GRSA 2HVDA 4YEAA 4JI4J 5IWAF 1AFJA 4ZCLA 3OTOJ 4R5PB 1SL1A 1ZAWA 3M1VA 1SC3B 4OHXA 4TN2A 3RBEA 2UXBJ 4PKDB 3W9IA 1U09A 3DLBA 1TKTA 3CCQS 1RT3B 3TZWA 1F9FA 2HIQA 1RUSA 4ZPBA 3FZBA 4IFVB 1HWJA 2PMWA 2UXCJ 4DSFA 1UZDA 1KQGB 3A8JA 4K0KF 1OIAA 2G2OA 2ZE2B 3QGPA 2POKA 1JQGA 4O44A 1NHUA 5KFKA 5FLXU 3G6VA 4OYOA 5F8NA 2M7SA 1FJGF 4J91A 3J7YU 3CGIA 2XSJA 5L39A 4LF6J 4K4VA 3R5GA 3W5YA 1JLFB 3R7SB 2V69A 3W64A 4F0MA 1NK0A 1CS4B 4J9VA 3KK3B 1YBAA 3RU0A 4ZMMA 1Q7LB 3T1AA 1NK8A 5KFOA 5DG8A 2KB2A 2VFTA 1AUSL 1DAXA 1RJJA 1V9OA 4J5OA 4RPFA 3VQSA 5I3PA 4DHVA 4B3TJ 4L76A 2RVJA 1LW0A 1RT1A 4GMKA 3A8IA 3K7RA 4LFBF 4DDFA 4J9SA 4H54A 5KG3A 4H4KC 1PYOB 4QOTA 1RACB 1V6HA 3K89A 2NXUA 3W1YC 1T3OA 1ZPVA 3PACA 4OHVA 2ROEA 3WX4A 2RU9A 1APSA 3M2UA 1S1XA 3RG6A 3UNYA 3W7BA 3OL7A 2V8GA 1UJ6A 4OZ2A 2UP1A 2HVHA 4CLLA 1X5SA 1WOPA 4OHYA 1MG7A 3UN2A 4DWIA 4ECXA 4ED0A 2OEKA 2RKIB 3NL0A 1OQ6A 3U1NA 1TL3A 3BH6B 1QLNA 5D0GA 3AXKA 3DOLA 4ENOA 3P5BP 3ZTQA 3JAMU 4WP3A 3MPWA 3R5JB 4O0NA 3MMJA 2N3LA 2EEYA 1FE0A 3UCZP 1IKYB 4ZDNA 4IQMA 1YDLA 3CMQA 4NXMJ 2AW0A 2E9ZA 3W66A 4H4OA 4ED6A 1JJ2R 3BM7A 1WEXA 5BYQA 4QPTA 3SXLA 4Y2KA 4KT0C 4YB7A 3KLIB 3X3UA 1NPKA 2BVZA 4R8UA 2UZAA 2HBYB 4LVOP 3ICLA 2MSTA 2ZHAA 5KFUA 3C8YA 3GSIA 4TXSA 4C3MA 1CC7A 2C42A 1Z1ZA 3I5AA 3M8QB 3PJ9A 4QYRA 4ZVSB 3ZNUA 4YP3A 4MT1A 1ULRA 3RB3A 3OL8A 4HH0A 2IA0A 1ITPA 3NGUA 1RAHB 4OYWA 4LFCJ 3VAIA 2KXFA 2ASJA 2JEJA 2V2KA 4B3SJ 2G2YA 1BE4A 1N5QA 1TFYA 1KR4A 3KLFA 4NXNF 1KTVA 1BY9A 2HWTA 1NJXA 4ILLA 1AFIA 1TL1B 1FESA 5KFQA 4J9NA 3MEDA 2CJYB 2WHOA 3HKWA 4G6VB 4OI4A 5K8OA 3A1YG 4MKBA 2GO9A 5E3QA 3LP2A 2DB1A 1FCAA 3HHNB 5KFTA 1U8WA 1C0TB 3GIMA 3M8YA 1GTHA 1YKWA 4UY85 1NKBA 2IYIA 1VK8A 1Y5IB 3LQVA 4I56A 4P71A 1IM6A 3DRSB 4DV0F 2UUBJ 3KNGA 3S7RA 3OR2A 4HHHA 1SH3A 3LTOA 5L1JA 3ZNJ1 1RKIA 5F8HA 1VQLS 3UO0A 4IO1A 3VQTA 3JSRA 2UU9F 1NAQA 2CQ0A 1M5OC 4DN0A 5HVFA 5D77A 1X60A 3TVZA 2MZ1A 4WK3A 1Q1KA 2CQ2A 4HKQA 3B6BA 1NH7A 3X1LB 3CCJS 4L73A 1RCXB 1QSSA 4IRKA 2JEIA 1UVNA 2HFSA 2AGQA 2GQQA 3WHIA 2FGOA 3MMCA 2UXDJ 5C25B 5J1EA 4C11A 3SQGA 5SZTA 2QL5B 2W4DA 3OPKA 1HPZB 2D9OA 3TI0A 4E2FB 5GAGU 4YR0A 2ASDA 1NXIA 4P9SA 4JI7J 4KC5A 1YJNS 5A2QY 1GXUA 2GVDB 4DV4F 4CWBA 3KDNA 2AZ1A 5T14A 3LGMA 4LF2A 2EC0A 2QLFB 5DQGA 3SFGA 3V6JA 1GAOA 4K4TA 2MHEA 1IXKA 3CDEA 2AWZA 3BGFA 5I42B 1R0BG 1HD1A 3LO3A 3HZEA 5M2RA 4NA1A 3MM5B 3KKFA 4Q44A 1FDDA 4JI1F 4Y2AA 2BJ8A 5HROB 3N0VA 1IJFB 4RKUC 4U8YA 3FFIA 2CPZA 2R7VA 2LYVA 2HQCA 2KVQE 3PG9A 1UL3A 3D7SB 3DOMB 5KTQA 2KJWA 4QIVA 3SV4A 2QLWA 2M88A 1FERA 3SCJE 1U49A 5LM7E 4ZS6A 1WNEA 2W9CA 3HMJG 4X65J 3FKBA 3KG1A 2MTLA 4XO0A 1RTJB 1E6VB 1M5VC 5F0WA 4DPYA 3IRXA 4J9KA 3JB9k 1VJWA 4ZPWR 1A6LA 4ZCIA 1RWKB 1E6YA 1S1UA 4C4WA 2PI5A 1KLNA 3DGPA 2H54B 1N48A 2VKRA 2IVFB 4ECWA 4WE1B 3O2IA 2GGPA 5CYMB 3J7AN 2PMZD 5L1IA 3MECB 2KT2A 1WSVA 4LSLA 4OZ3A 3HHLD 3HVTB 3ADAC 4DV6F 3VAMA 3OR1B 1IWAA 2YNFA 2BM0A 2DNKA 1FRIA 4GKKJ 2G0IA 4DUZF 1TAUA 4U7UD 4GC7A 1HW9A 2VFSA 1TVRA 5BJRA 3KK1A 1XMBA 4F0KA 1DY3A 3GLJA 1H2VZ 4WJBA 3G86A 5DGBA 1S6QA 4BWJA 4H4KA 4X2BA 1NB2A 3K5PA 1RBAA 2ZM6J 1MWZA 4ELUA 8RUCA 4ZLLA 4JI2F 3POTA 2CVEA 2V4JB 3MHYA 4F26A 4WXWA 2MKYA 3OFGA 3H5YA 1O8BA 3NS5A 2GIRA 1FK9B 2BQ3A 4LMZA 3EICA 2Y8YA 4CLWA 1SKWA 3RBXA 1KTQA 5C24B 2HVZA 3KHHA 1SUQA 2W1BA 2ZZNA 4OZJA 4LSZB 1Y10A 1VQKS 1KHVA 1N8RT 1G4CA 2WVFA 4ATNA 1ZM4A 1NHVA 4J90A 2FYXA 4EGLA 2QLXA 4N8OA 4K2XA 4IG0A 1CBKA 3M9OB 4WKRA 3ZC4A 1JB0C 1IJEB 2CPFA 2CJXB 4OZLA 5H9FK 2OTJS 1LK5A 4L3KA 4IR1A 2VQFF 5L9NA 3MUMP 2OSQA 2OUGA 4DL4A 2UXBF 5HQ8A 2XS5A 3RYLA 2MKJA 3PO4A 5A6WA 2XM3A 2KTQA 1QUPA 5K5MA 3B8HA 4U7UK 3FBBA 3PFOA 4GKJJ 2LU2A 3UD5A 3KHLA 2XBPA 1FWLA 1WC3A 3QO9B 2B51A 1KVKA 3F41A 2VBZA 1UW4A 3JTOA 2DPIA 4Z37A 4MK7A 5C5JA 1EJ7L 1ZM3A 1J27A 4NWBA 2Z8QA 1B4SA 2IRXA 1JLQA 3VWSA 4G1PA 5KFRA 3TAMB 2FJWA 2LU1A 2BANA 2RHQB 2R7OA 4ER8A 3DLEA 4A8XA 4LF6F 1VQ4S 1ZPWX 2L41A 3RUBL 1YBTA 4KKOB 4YR2A 1FWPA 1N6QB 4DV1J 1F3VA 3MMAA 4G3IA 3I4PA 2AMCB 4CYUA 1VRTB 2J7WA 3UN5A 3P45B 5GADI 4EK2A 2CKWA 2GV1A 1XTZA 1U1NA 4X66J 3DHXA 2DNMA 3MCNA 4L6V3 1EQMA 4B3TF 3VGVA 1JLAA 5EUHA 5DLGA 2YNGB 3QJLA 2K1RA 1HI0P 3HSJA 3UDCA 1IVZA 3MD3A 4U6PA 3JQJA 1MN7A 4EEYA 3AH6A 3GFHA 3MURP 1N54B 5MLCV 2YKOA 2DGTA 2HVEA 3BR9A 4U96A 5HATA 2HHWA 1UWBB 2EI5A 3FJ2A 2XULA 3CJ4A 1LEOA 3ET6B 1ACMB 4ZA1A 3EX7B 2Y0SD 2EK1A 1J5EJ 2O66A 3U1LA 1JLBA 2DVIA 1R27B 1HIYA 1G3OA 3DYAA 3D9BA 2CPYA 1S12A 2LQ5A 4OYMA 3M6XA 3CIMA 4FPRA 4TU7A 1X9WA 4AL7A 3GIRA 5KT4A 5J2MA 1H72C 2V34A 4OZ0A 1HBNA 1SH2A 4FP9A 1DURA 1D0EA 2DRAA 2DIUA 1NJYA 1PO6A 4UF4A 4P72A 1N36J 3V6KA 2ADCA 4JI0J 4WKYA 3OSNA 1RT4B 5DZ6A 4QWEA 4O0IA 3OVSA 2RDJA 4JYAJ 1B0PA 4UUXA 1JXEA 4NXMF 2IRUA 3OTEA 4OX9F 3SZ2A 2W4CA 3W60A 1X4HA 2XY5A 3M7VA 1FFSB 3IG1B 1N34F 5E5NA 4O3RA 3ZZTA 1J5OA 2LMIA 1OWXA 2MKSA 2BJEA 1BQNA 2ZKTA 3KFWX 3DGVA 3OL9A 2DR5A 1SC6A 5SUHA 2KFZA 4M5LA 2HQFA 3VAKA 3LP0A 3GIKA 2VBWA 2KFYA 1CPZA 4TLRA 3G4SS 3GG1A 3QNWB 2CQ3A 5KFIA 1RLCL 3IM8A 4M8LA 3M6UA 4JI5J 4TKTA 3A3NB 1WKJA 4EYHB 1WF1A 2ZKUA 4XDCA 4USJC 4QIWD 4LFCF 5B0GA 4DS4A 3WZ0A 4QIEA 2AJQA 4U9RA 4RWWA 2HQDA 1KN6A 3O3LA 3KTQA 4LRBA 4OZ5A 1EETA 3OJSA 5KFDA 2RRAA 5KFXA 3DLKB 1HR0J 4XTTA 1D1UA 1PC5A 3UCGA 3HFZB 5L1KA 3QLHA 4I2QA 3MOJB 2GIFA 4NLVA 2ASYA 4I6YA 1NK9A 4OJ1A 5D0RA 1NDPA 2ZBPA 4DV7J 2BYCA 4UOCA 3DLHA 1GXLA 2QC3A 2ZH6A 2LDIA 1MLAA 1SKRA 1RWMB 1FNMA 5A8WB 4P2SA 4DFKA 2Y3YA 5B08A 1SKSA 3QGIA 1CULA 3KLHB 2DCLA 2E5IA 2WONA 4CLYA 2UUBF 1D3WA 4C8MA 3PV8A 5L9XA 1A0OB 5HMXA 2AD9A 5THWA 5DRKA 2BKPA 2DR7A 2WSCC 1U1RA 1B64A 2ZH3A 1D8ZA 2UVVA 4OJGA 4UQGA 4B3RJ 2VPWB 4KSEB 4M5KA 4J37A 3QZ7A 1S0NA 2VDIA 4PUOA 1F1BB 3SFUA 3KHRA 4UUWA 2KXHA 3K5MA 2WBMA 3PO5A 4QPXA 1SCJB 3R3TA 2LEPA 1SJQA 2ZJQQ 5LMUF 4AQYF 2GZOA 4WF9Q 3LPEA 2VBYA 3VAHA 4NZ0A 4PXBA 2CPDA 3N4WA 3SSQA 4NCAA 5I3QA 2IDLA 3H4BA 4ID8A 3A13A 4YUDA 3E01B 4JI7F 4B9SA 2E5LJ 4DV5J 2XGPA 2ZDPA 1BUXA 2F8MA 3NCRA 2R7XA 3IS9B 2DY9A 3QRRA 1B0TA 1YTYA 4Y0FA 1SXLA 3M2VA 2LFVA 4EZ6A 3CJ8A 1HNZJ 1KFDA 1VRUA 4ZVPB 4ZVTB 3M32A 3QT8A 4USTA 2XC9A 3FRYA 3AJDA 4DV2J 1P27B 3V81A 1Q7YT 1S48A 3NS7B 2RIJA 3RTVA 2J0WA 3MM7B 1WOOA 1ZTTA 7FD1A 2BW7A 3NRBA 2RHSB 2XHCA 2R2TA 2XNQA 3W2WB 2V0NA 4B02A 2Z57B 1D9DA 3AD9C 2MGZB 2CA9A 3HLUA 2D3OR 3UFCX 2ZC4A 5IC4B 3IGVA 2G4BA 3CCZA 1TKZB 3C6TB 4PXCA 4ZCMA 5DGAA 1IM4A 2B4UA 3CMES 4FXWA 4LR8A 4XPEA 4EU0A 3HP6A 1U1PA 1NB7A 4X65F 4RBUA 3BSOA 2ZH8A 1I94J 1EZZB 1N52B 4W90B 2WZ1A 1XMQJ 2KKHA 3DXSX 2ZITA 4HYKA 3ENVA 3IFEA 1RAJA 2RB7A 4A47A 2KM8C 3Q2SC 2R2RA 2YH1A 2G1DA 4RW7B 3SBMA 2OGUA 3BSNA 4FF3A 3R27A 4Y65A 2YTCA 1PBUA 4ZPTR 3D6HB 5CQGA 5J2PB 3B54A 3CCUS 2KHDA 4WFNQ 2XLIA 3PW5A 1X4BA 2JX2A 2DNZA 2ZOFA 2G0JA 2C2RA 1JKHA 3OXFA 1K47A 2XYHB 5BYSA 1FRKA 1FE4A 1WUUA 2XB2D 3DM2B 4KGVB 1XWLA 3VGSA 5D3GA 2P9CA 2F63A 2XLKA 4OJHA 4QJVA 2C2DA 1SPBP 3SSSA 1N32F 2B4OA 5IM0A 1ZTWA 1ZS6A 3D0HE 3EDRB 3GJRB 4RWXA 1JLCB 3KYLA 4AYBD 4IDKA 4OX6A 2Q43A 1H6KX 5H9EK 2ZM6F 4U95A 3Q8QB 4K8RA 2BDPA 5D6GA 3DN9A 1F5BA 1L3SA 1LXJA 2HKEA 2QL7B 1QAXA 3LAKA 3OW2R 3O5TB 1S9GA 2HURA 4O4RA 4J7CA 1FXDA 3LAMA 4NYOA 4AXJA 1T05B 1AYEA 4F67A 3VF0B 3QPIA 1XR5A 5HVHA 1HQ2A 4B17A 1P1TA 4XAKA 1JXVA 1N5SA 1FTCA 1S59A 3M2RA 3NS6A 4NX9A 1S4EA 3R1LA 2B6AA 1UEKA 2OPRB 5HQLA 4ID5B 1JMTA 3BV8A 3I0SA 3R8YA 1S77D 2XO6A 2CZVC 3AAWB 2XLJA 4DQIA 4KGMA 4EYIB 1U6FA 4CLPA 2OMOA 3KWMA 1FRJA 3D1HA 3MM6B 1YJUA 4AXIA 2PE8A 2LKZA 3GCWP 4W92B 4DSKA 2A18A 1HYSB 2C3PA 2GHWA 3QFWA 3W8PA 1PSDA 3ETOA 1Q8IA 1K73T 4A8SA 4ECYA 1UA1A 1XNRJ 4X64F 4DR2F 2OKQA 3T5LA 4GKJF 2MQNA 5K14A 3H25A 2B9YA 2V2VA 3BS9A 3K5NA 4K5SA 2GAGC 4RW9A 4RL1A 4NI2A 4LQ9A 3GJSB 2BA9A 3UCUP 1GEHA 5F8IA 2V8DA 2VICA 3S1TA 4LF4J 2Z2LA 2MY8A 3CDBA 1RTZA 3MFIA 3AXMA 1L5UA 4LVNP 3ZO7A 1P1LA 2WOMA 5G0RB 1DBDA 1P8GA 1IBMJ 3MAAA 1W7WA 4DL6A 1RCOB 2XSJB 3K8VA 3D66A 5L8RC 3BPDA 2I5JA 4QCLA 3DRRB 3ILLA 4USHA 1Q79A 2EC2A 2Z2ZA 3TA1A 4Z7YA 2YQ3A 4X66F 2R7WA 3BGRA 1GTEA 5KFCA 2LQBA 5F3ZA 2C1EB 1RHRB 4MTPA 2ACMA 3F44A 1X5PA 1RE1B 2Q1LA 3T5HA 1H3DA 1EKSA 1HNIA 2Q3PA 3TVKA 3BREA 3L9ZA 4RBTA 4P2MA 5GADU 1F6TA 5GAEU 3IGNA 5A2QU 4TY8A 4QW9A 4ED7A 2EKYA 1RT7B 3HFVA 1XR7A 2XMUA 3N9UC 5IOLA 2GMJA 1S0OA 3V6DB 1UZHA 5F3TA 2AYGA 1VQYA 4NLDA 3AOBA 4ZP7A 3W9JA 4USMA 4Q8EA 5DZ7A 2FD2A 3BO3A 1HQUB 3H5SA 2AYMA 4O3NA 1RZMA 4R0JA 5DETA 1YVFA 3QJJA 3F73A 1MROB 3GFYA 1BD6A 3VAGA 2W8LA 5ETNA 4Q0BB 1T0TV 3MGJA 2BABA 2DH8A 3I9V9 1RT2A 3W5ZA 2DH9A 2V8HA 5HMYA 3DOLB 3CDUA 4JYAF 1WDTA 4KO0A 3EMTA 3IA0A 1S9FA 4FF1A 4CH0S 4RNOA 5L38A 2FPHX 2QA4S 4PWDA 3GWCA 1W25A 5C42B 1KWMA 1EARA 4K2JA 2UVUA 1F5AA 1W26A 1R3NA 2XMMA 3NOCA 4J9PA 5ETLA 2JSXA 4C8KA 3FC9A 1YG0A 4ED2A 4ECTA 2OIHA 3FNNA 2Y0BB 4PEOA 1IKVB 2R7TA 2O3DA 2KN4A 2B9XA 1TUVA 1RHKB 4CP5A 4NRUA 2J6SA 5D0EA 1FX2A 4KRWA 2DHGA 3D3BJ 4G1QB 2R7RA 1ZM9A 2EBGA 1WTFA 2HAIA 3J7A1 3B4MA 3MUVP 1S1VA 4NPOA 2QG9B 2AYEA 2V2QA 1X4DA 1MN9A 4WFZA 3UD4P 3J80Y 3VHQA 1L3UA 1WG1A 5LSLA 1YWXA 1FKOA 3Q0AA 2HNZA 2SXLA 4NASA 2R8JA 2RS8A 1LOUA 4ECRA 5C2CA 2QN6B 2CNLB 2AJFE 4KBIA 1YHQS 1BHNA 4OI1A 2VF3A 4L75A 1S1WB 2QL9B 3EGZA 4QU7A 4DR4J 1MNEA 2ROGA 3J81j 1WG4A 1NU4A 4GVBB 1D09B 2BBEA 1Q78A 2DGUA 2HRUA 4OZ1A 5DJBA 1UMJA 4DV7F 3CIZA 1HMVA 3M8WA 3BBBA 2CQPA 2ROPA 1QM9A 3PRBA 1VQMS 2RRBA 5KFAA 5DQIA 2B0GA 1U1QA 2UUAJ 1Z4UA 4ZVHA 5IZHA 5AE1A 5EWFA 2KXNB 2CJAA 1BLUA 4DPXA 1QE1B 1URRA 4DR7F 2GNKA 2VC1A 2ZBRA 4B3MF 2DR8A 3MAHA 3LPYA 3THVA 1RYSA 1H74A 3D67A 4B3RF 2IHR1 2VHGA 4LSNB 3PX4A 5LXRA 3TUJC 5T41A 4BBYA 4CTAB 4M5HA 2DGWA 1QAJA 5FDLA 2E1PA 2RQCA 4HEA9 1YRTA 4N8NA 2Y1RI 3W63A 2Y8WA 4OMFG 3NKYA 4WP9A 3OVBA 2QA2A 3DFEA 3MR6A 3B4DA 3CPWR 3KJVA 4Q7AA 2FJEB 1NJIT 3JSMA 4Y2MA 1TL5A 5C2GA 3T1YJ 2YWFA 4DQSA 4F0HA 2QYGA 2M5YA 3U1MA 2E5LF 4KGZB 2MLYA 4DV5F 2AF6A 3T19A 1NK5A 1UJ4A 3KHGA 1P6TA 5B0BA 4ZLJA 3VALA 2JFKA 2IM1A 2DHSA 2H51B 2XZDB 1HNZF 1RWWB 2K3KA 1VRQC 1UEUA 1IKWA 3V4IA 3KOAA 1HFEL 1REVA 2YNIA 4HT5A 4EBEA 3OJUA 1OJ4A 3HX9A 3QBCA 2P9GA 4I2PB 3CEDA 4PXEA 2J7UA 1U1LA 3GZ7A 4ANEA 4DV2F 2CWKA 3O1LA 1C1CB 2CQHA 3TJ8A 2ZEJA 3QSIA 2GX8A 1UETA 1HBMA 2DNLA 1VC6A 5DDRC 1AROP 2W01A 2YKAA 4X4TA 1S6PA 1RISA 1DQ9A 5AXNA 2RQ4A 2VG7A 2DGOA 2KJVA 5IXUA 1LNQA 3QIPA 1DTTA 2DNHA 3MEEB 1RWVB 2DXEA 3PW7A 1S5ZA 4I7FB 4MKAA 1TKDA 4KFBA 3BYRA 3KG0A 1PC4A 2HHUA 2QX0A 4DG1B 3RB6A 3L3CA 5F8LA 2FUG9 1XMQF 3CDAA 3KK2B 2APOA 2FY1A 5HVGA 2VDHA 4B9VA 1YZ6A 2W9CB 2CQ4A 1VC5A 2RMLA 3MTKA 2IMOA 1U2RA 2DIVA 3PCOB 5IQQA 1V5VA 4X4QA 2OP5A 5D78A 1IWGA 2G9OA 1U7LA 3DGPB 3M4XA 2GQ2A 3NGSA 3IBFB 4JI8F 2ZHOA 2RRNA 2YKNA 3L7UA 4C3LA 5M2PA 3BSAA 3H59A 1T9TA 5KFSA 5ETTA 2FLPA 3OTDA 4R5PA 4RU9A 5LMNJ 3QGHA 1CJTA 1BQXA 3OFHA 2L08A 4NLRA 3ZFVA 4C8ZA 1R8BA 4LSLB 2EFQA 2QGFB 4C97A 4X84A 2X1FA 1RT3A 3KNAA 2YNFB 3QSYB 4F3MA 1WORA 4IFVA 4NCBA 1WEZA 4F4WA 3G71S 5K20B 1RWXB 4A46A 5RUBA 4TQRA 2EBEA 1S6QB 1RBLA 4KR0B 4ES3A 4WWSA 2GMLA 2ZE2A 1KRPA 4ED5A 2Y1LB 4NEYA 3POTB 4CLTA 2GC8A 1HNXJ 5AJ3J 2BE2A 2KL8A 2PEBA 4HLBA 5BR8F 3HSZA 3I9ZA 2E1MC 2F65A 3N5BA 4KHRA 2VPXB 2FC8A 1X5OA 5AE2A 2YWHA 4CO5A 4Y3CA 1JLFA 5CCLA 3EZUA 4FYYB 4QQBA 2EKNA 2FHKA 4P74A 1CS4A 1S79A 1HHTP 5DG9A 3KK3A 1IBLJ 1LWEA 1VGYA 2NS1B 1HWLA 2NXJA 2V67A 4DPUA 3RR8A 3BDPA 3D5MA 1U47A 1JK9B 1H0HB 1RAFB 3SDEA 2NPIA 5CXTA 4KB7A 3HVRA 1QY7A 1G2EA 3AD7C 2OFGX 1NMEB 5KFLA 2OD4A 1XEZA 3WC0A 3LA0A 3QT7A 2ALZA 1B70B 3UN3A 1WD6A 3MF5A 2HG4A 3OT9A 1VS3A 3EGVA 1UFKA 5D4NA 1RTHB 4YB1P 1VFJA 1TTHB 5KAKA 3DRPA 1RAOA 4RZRA 4WZMA 4IKAA 4MYUA 2VFRA 1M5SA 3BBCA 2PC6A 2EG1A 4DFPA 4M5MA 2OTLS 2K06A 2KO1A 1Q95G 2E7WA 1HBUB 3AOCA 5CABA 4FYDA 3IWXA 1SIZA 1LFPA 3OLAA 2OD6A 5KOXA 2LVWA 3QWUA 2RKIA 4P6QA 2W7OA 2VQEJ 1JLQB 2PMHA 2JJ4D 4OYAA 5ETSA 1RDRA 2YX1A 2BANB 4I68A 3DLGB 4DX6A 3PKYA 3BF4A 4MFBB 2JLFA 3DLEB 1K9MT 4USIA 1H7XA 3HCXA 2ILZA 4HL9A 4ZJLA 2D3O1 4ZKAA 4ZJOA 2RDIA 3CJKB 2AZ3A 4EBCA 1IKYA 1OS5A 2B9EA 4IH6A 2HHSA 5KG0A 3M30A 5U47A 1TL7B 2WB4A 1YJ7A 2F8HA 3LGNA 4IFYB 2W2PP 3Q2TC 1SV5A 2YWKA 4OLPA 2J9DA 1RKJA 1N5VA 4YHHJ 1VK3A 1C4CA 2A6MA 3CTRA 4URGA 3DI6B 2HS4A 1ZBTA 4P10A 2J5AA 4YB5A 1S10A 4J9MA 3TOQA 3PW4A 1AUDA 5GMDA 4JUZA 5JVHQ 2DGVA 2QFIA 2KT3A 1WWHA 4LF9J 2QRRA 3EWGA 1C2PA 4KHPJ 2HGMA 1H38A 3CO0P 5A0YB 3M8QA 3PKMA 4Q43A 1LFWA 5KG4A 1HI8A 3TQ1A 4GO5X 5HBMB 1KS2A 2DITA 3CJTA 2VV5A 3HHDA 2WCXA 3D6TB 2R42A 3G6YA 3NLCA 5JVGQ 1P9YA 3DCAA 2OH2A 3DRXA 4R0EA 1DARA 2ZBQA 3LOUA 2QT7A 1ZZNA 5CYQA 4C0BA 2ATCB 1EP4B 5KFHA 1HBNB 3J81Y 1IR1A 2YKMB 3SCIE 1A9NB 1TL1A 3C46A 2Z2YB 4HR2A 1TQLA 1EX8A 1MSWD 4QYZK 3GU0A 3T9ZA 3ILJA 5I4MA 4ZN1A 3HJVA 3I0RB 5DO2A 3I4HX 1RK8A 4USWA 1FWKA 5A8KB 1R43A 2HGNA 2KRBA 4RO0A 4FYXB 2NUHA 2FVQA 4CCHA 3D0IE 4USKA 1BWVA 4PWUA 1FD8A 3MPUB 3DRSA 4WFXA 3C66A 2AKWB 1TV6B 3BJYA 1BQNB 2VPZB 3M6VA 4OL8A 4DZ6A 3CJQA 5ETQA 2YWEA 1HWKA 1M0SA 2R8IA 5H9FJ 4DR5J 4M5DB 3SYZA 1I3OB 5ETPA 2ZJPQ 4X62F 2ZOMA 1N88A 2B3TB 1FF2A 4NLPA 3H0PA 3FCHA 1I1GA 4FBTA 4D3GA 2RH3A 4PG7A 2CJBA 4FPIA 3LW5C 2CQGA 4O3QA 3FEYB 1FKPB 4C0HA 2OPPB 2NR0A 4BCAA 2NPFA 4AT1B 3JS9A 3CD6S 1JLGA 1VQPS 1HPZA 1EETB 2AU0A 4M5GA 2AT1B 4OYIA 2ATLA 3LF0A 2GVDA 2BE9B 3R97A 2OLWA 4RW8A 1X9MA 3CJ5A 3SCLE 4CDIA 3U27A 4I2QB 1RQ0A 2KYXA 3PJWA 3MCSA 4DR3J 4ZVOB 2MYFA 3MPVA 3NCPA 2UUAF 1OY8A 5IT4A 2HMIB 1S4FA 3TAQA 2WVEA 3DLJA 4LR7A 2GO8A 4WIQA 4UY8T 3Q22A 2FZKB 2XSFA 5I42A 5T7LB 5KT2A 4OIXA 2DJWA 2CPJA 3BB5A 6AT1B 3MM5A 4A8WA 1N33F 1U0SA 4KHMA 2L9WA 4LF8J 5HROA 3OBIA 3SV3A 2VL1A 1LWCA 3WC2A 4M94A 3OFEA 2FJXA 4P2FA 1X5TA 1FEHA 4JI6F 4TQSA 4WFAQ 1RAIB 3T41A 4CT8A 2R7QA 2N4CA 4CH7A 4RBVA 2DO4A 4DSIA 1ROFA 3I56S 4JP8A 4LUBA 2IBOA 3V6HA 1AZSB 2P9EA 2C3MA 2YNHB 3QWPA 2FHMA 1T8EA 1RTJA 4F4AA 2XZWA 4MMOA 1UWAA 4LFAJ 5CA5A 1RABB 2V6AA 1LW2B 1QUVA 3QRQA 3PX0A 4TVAB 3PHEA 1NDKA 1I6JA 8ATCB 2JVOA 3DKDA 1VCTA 2H4YB 1IBKJ 3BQ0A 2GHPA 1YIJS 3Q86A 2AX1A 3EGNA 1WHYA 2D1CA 2NXNA 1T9UA 3MECA 3GQCA 1RA7A 1NJZA 1TKXB 3HVTA 4FVCA 4ZPDA 3BKFA 3D2WA 4AD6A 1LV5A 1EIYB 3WIUA 3C3LA 2IY5B 1S99A 1RWOB 2BRKA 3PM9A 3V81B 2FGCA 4BWMA 4IUFA 2B56A 1F9HA 2ZVSA 1PBAA 2VZ9A 2V4JA 1RGVA 4YN3B 4FDFA 2FLNA 1VC0A 3HK2A 3KMQA 3KLEB 2Q79A 1H2TZ 3FUYA 4X4RA 2ADBA 1TL4A 1VYAA 1VBYA 3C15B 2YX7A 1U0HB 5HMZA 3CSKA 3GV7B 1ZYQA 5C24A 4LIWA 2CYYA 1TMMA 3ZZPA 4A8MP 2DBBA 4XIUA 4X4SA 4Q2MA 2ZHBA 1S7IA 3IO1A 1QJHA 2HHTA 1OO0B 1IUJA 5LT5A 1K8AT 2U2FA 5LSOA 1JKHB 2MMYA 4QIGA 2V63A 1BQMB 3AT1B 2FJBB 3PRDA 3AODA 5IWAJ 3FQLA 2WTFA 3E51A 2W2MP 1PCAA 2G13A 3RB0A 1Y7PA 4X4PA 4ED3A 3PVXA 2DK2A 4P52A 3QO9A 2GHVC 2E7XA 3GYGA 4DU7A 1HNVB 2E9TA 1NPPA 2BX6A 3UNGC 2XY6A 1LXNA 3BO2A 2XGQA 1HBOB 3N79A 3P5TL 5KFNA 2I38A 3GMGA 5AJ3F 3UW1A 4K0KJ 3HULA 2MZSA 1BC6A 1NK7A 4MIAA 3KUGA 4QWCA 1FO1A 4TYBA 3CJRA 1CJKA 2VG5B 1S9GB 3TAMA 4B9LA 3BGOP 4DMZA 3R9LA 1JX4A 5I3UB 3MPDA 2R8GA 3GTYX 1YLXA 4PG5A 2I9SA 2R9LA 3M2RB 5IS2A 1N6QA 1DQAA 4C8YA 4KPCA 1FJGJ 3HDSA 4YMEA 1VI7A 3NAIA 2B6AB 4RUAA 5F41A 1GH8A 1LK7A 3IR6B 4LT6A 2GJIA 4LQ3A 4NLOA 1R8AA 3AHPA 1RXOB 3J80U 1OY6A 2LA4A 4QIFA 2DRDA 2ZDOA 3Q8UA 3FSIA 4RNNA 2YNGA 2VFVA 2VJUA 3R6LB 2NZCA 2L9NA 4RW4B 2QYCA 1ZH5A 2JVRA 2HS0A 2R4FA 1FI4A 3H98A 3SIPB 3PXGa 2CAJA 4LFBJ 2PFDA 1WF2A 2CJ9A 3ISZA 2IFXA 1MU2B 1UWBA 2GIQA 2RDDA 1IQZA 3ET6A 5F8GA 2J9DE 1CVJA 1M5KC 5D8HB 2MKCA 4N41A 3BGLA 2Y1IA 1SB6A 1B7YB 4LRCA 1GMWA 4N56A 3PYGA 3CCES 2LA6A 3L4BC 3LGHA 3BQ1A 3I6PA 1KQSR 4ICLB 2MKIA 2IPOB 1VQNS 3WIVA 4P7TA 3CCVS 2BUNA 3G6ES 3T1HJ 1KD1T 4DPOA 1Y5NB 4I67A 3MWBA 2RQKA 3GV5B 1GX5A 4F3OA 1PAEX 3ZZZA 1MMLA 3TUZC 4BDPA 1FJCA 4MIBA 2PFFB 1AB8A 1QSYA 1YRUA 4DL3A 1NRKA 3DMJA 1RT4A 1NZ8A 3C14B 2J0QD 3MD1A 4JI3F 2ACYA 3VVUA 4NLGA 3V5RA 5HLFB 1VIOA 3H2UB 3BGRB 2EFOA 3IG1A 5CAAA 2HFUA 5K8NA 3D28A 2VD3A 4YHHF 1Q53A 4BS2A 1WKKA 3KLVA 3O6QA 2HHXA 1ZA1B 1N5TA 2IYGA 2ABYA 4FS1A 4C8OA 3H4DA 1F0XA 2V68A 2BZ2A 5EGYA 4LIRA 4Y28C 5HL7Q 4KJIA 3JSBA 4NE9C 1YJWS 6FDRA 2A2CA 2NYIA 4DV3J 2FIUA 2B7CB 2E1RA 2CQ1A 1N56A 2JC1A 1YJ9S 1U1KA 4LF5F 1V3RA 4V1Ak 4XPCA 3HF5A 3I5CA 3W62A 1RT6A 1V3SA 5H9EJ 2NCKL 2ZH7A 1YSJA 4NA3A 2DXFA 4IQXA 1CJVA 2RAQA 2VPYB 4GO7X 2F4VJ 3DLKA 2JDJA 4NXNJ 4P75A 3K17A 2FJDB 1S6UA 3VVTA 4QR0A 2MJNA 1HQEB 2LCWA 4K4XA 2K8GA 3VZHA 5IT9Y 1RT2B 3G82B 1AT1B 4HI1A 4DEZA 2AGPA 3T6BA 4Y2IA 5HANA 3PZPA 2VODA 3U02A 2JZ5A 5A8WA 1U26A 4Q45A 4PWDB 2KFNA 3NWRA 1LWFB 3RB4A 2R8KA 4C2MA 2XY7A 1UPMB 4DUYF 1Y5LB 2UV8G 1SQGA 1HI1A 3KJNB 1X0PA 2ZUGA 2NLWA 2E66A 1JWWA 3EDQB 2F5GA 3IWNC 1YJRA 3H42A 4DV0J 3CB4A 4DR5F 4LREA 2XEXA 3R1HA 2KG0A 1FNXH 4CLUA 1G6BA 5KT7A 4UOFA 1UJ5A 4QWAA 2LEBA 4OLOA 5KFWA 2QJ3A 4OI2A 2YPYA 5J2NA 3D54A 2UU9J 1X4GA 3JYTA 1S1VB 3K5OA 2ERRA 1OYEA 2MDAA 5E3PA 2YKQA 3FCWA 3H8YA 4B3OB 5JUMA 3EE3A 2HQIA 1FJ7A 2HZCA 5HMWA 5AE3A 3G87A 3T6JA 4O4GA 1FKOB 3OVAA 1TK5A 3HT3A 3E01A 1YBUA 4NYZA 3TUIC 1RU1A 2RF2A 1DLOB 1C4AA 4A4JA 4JI4F 2RSQA 4AFFA 5GVQA 3IS9A 3OTOF 2KM8B 2J6UA 4F4ZA 3GONA 4DV4J 2HFNA 1JLEB 5ETMA 2M8DB 1HNWJ 3NBPB 1YJTA 2OMLA 4FXVA 2HNYB 2NSCA 4ZHRA 3IAS9 2V8VA 2FVRA 3HHKA 4ZVFA 2WSEC 2A1BA 3K5LA 2X1GA 2UXCF 3FBCA 1UA0A 3LUYA 5BYRA 4LF8F 1SC1B 2V9KA 2F9DA 1NKCA 1TK0A 5M2UA 2K2PA 3MEKA 3WQPA 3AA9A 5B0CA 3W2WA 1YJVA 3W8GA 1RTIB 1KLMB 2H4WB 3ITHA 3D6MB 3TEHB 2XMAA 4WFYA 4EZ9A 1M90T 3H40A 3MDFA 5FDLB 4IRCA 4RUBA 1LQ9A 4UOGA 3H2VE 4FF2A 4LBPA 2B8PA 3OQ2A 2HNDB 2Z58B 2FLOA 1X9SA 2DO0A 3HHLB 3A8KA 1XC9A 1VJQA 4ES1A 1NSKL 3TX0A 2N3OA 3Q23A 2KRRA 3NGRA 2AV5A 2C3OA 3IP0A 2FJVA 3OUYB 1CJUB 3IMQJ 2H5JB 1Y00A 2BXJA 3Q8VA 1OPIA 1F2GA 1F2HA 5E0OA 3M9NB 2HRYA 2H1YA 2CNOB 2E44A 4K4SA 2IM2A 3DM2A 2XCAA 2YWWA 4F25A 2HK2A 1C1BB 4DL5A 4EUVA 4CM2A 4IRDA 2EFVA 1ELOA 2YNIB 2CPXA 3HFKA 1J2VA 4YR3A 3IBCB 1JLCA 1S1TB 5LL6d 3GFXA 3N6LA 4PPZA 3KLGB 2RU3A 1SC4B 2OPSB 1NM2A 5KFVA 1RHQB 3O8WA 1RT5A 3R6GB 3D1QA 5HN0A 4O3PA 2CDRB 2JOQA 1RWNB 2EW9A 1UVJA 4MH8A 2J6TA 4B9MA 7FDRA 4JI2J 3PYDA 1DTTB 1IR2A 4D3HA 1T05A 4QR1A 3DNCA 3CD5A 1JIHA 1CLFA 4U67Q 1SKUB 3JQKA 4OYXA 1CQMA 2L48A 5B0EA 1U6ZA 4O23A 2BEFA 3VGTA 2FTRA 4K7QA 4Q2LA 3NGKA 3HZGA 4IYQA 4ANCA 1MMNA 3Q8SB 3D68A 4ID5A 2HWHA 2XI2A 4U7CA 1S6OA 1NSPA 4C0OC 2FVCA 5JJBA 2WAQD 3M8ZA 1VQ5S 4PQUB 3N6NA 5GMEA 2K7JA 2ZNYA 3N5FA 2J9CA 5KG5A 4F8RA 1HHSA 5B0AA 3MMBB 1NEEA 1U48A 1TMJA 3AY0A 2GAHC 1QDUB 4L74A 2OEMA 1NBEB 5IT0A 2MHNA 3J81U 1RAEB 4B9UA 2YKNB 2BMBA 4F04B 2D74B 4Q5VA 2J7KA 1CJTB 4NEZA 3MR7A 2VQFJ 4X4UA 3FGVA 1RBOB 4F4KA 4V19X 4IOCQ 1O5JA 1R0AB 3BZQA 3T9NA 4I6WA 3CUNA 4O3OA 4P73A 3EUNA 2XWXA 1NPRA 1I51B 4KPYA 3L95X 3R5BA 3DDNA 3D1OA 4LR9A 4B3SF 1OMSA 3CWJA 1QTMA 1WC4A 5J2QA 3UDEA 3PIOQ 2ZD1B 5KFEA 4QWBA 1KQKA 2BE2B 2NUUG 1KFSA 2C2NA 3DOKA 5G0RA 2IVMA 3M9MB 2B5JA 1WOSA 2GVZA 1R7IA 2HSEB 3ETMA 1A7GE 4ZVGA 4ZLPA 3JTPA 4DSJA 4DR6J 3CC7S 3DRRA 3C2PA 2WVDA 3C6UA 1LWEB 3NMAA 1UKUA 1UPPA 1WDDA 4M95A 4HT7A 2M70A 1Q81T 2XNRA 4FXDA 2YQ0A 4B08A 2PI4A 2DY1A 1YQHA 5CD4A 5ITHA 2Z30B 3DLLQ 2W25A 3SDEB 3C19A 2X1BA 2WVBA 2NYHA 3CJ2A 2AQ4A 2MZRA 3AQOA 3ILIA 1BMQB 4C8LA 4I64A 4ALZA 2CPHA 1S72S 4FNHA 1RT7A 2Z0GA 2KHCA 2BKNA 4ZPAA 4YQWA 1IKXB 3GE9A 4UQTA 1SQFA 3CCSS 2HHHJ 3V6DA 3DRPB 3ILOA 1IQTA 2XHWA 4FVMA 3CVKA 4MK9A 2M2BA 1HQUA 3EPGA 4NCGB 1VDHA 2UXDF 3M8PA 2FB0A 3T1HF 4KE5A 2HGLA 5K9FA 1EHWA 1MROA 3BPSP 1XMOJ 3HSDA 2DGXA 3P3DA 1N5YA 1PJ7A 2IAJA 2DT9A 1FRLA 2UVRA 4Q0BA 3RW7A 3FVYA 1Y3KA 1U45A 3RBDA 2DHXA 2AEJA 3QQCD 5E3AA 4KH1B 1VQOS 2WW4A 4NLXA 3IR7B 2IM3A 5AXKA 5C42A 1XN9A 2HIYA 2KH9A 2P2CB 3QZ8A 3M30B 3EXYA 4OX9J 1OYDA 1IBCB 3CD0A 3OXLA 1SV5B 4W4MA 4A8FA 1N34J 4HACB 4CO0A 1F60B 1O51A 2BE7D 2GJFA 1IKVA 4H4MB 3DRYA 1JJCB 4F4XA 4J9UE 1XERA 3AQPA 3PFEA 2AP6A 4ZIVA 5LJ3Y 1X4FA 4JV1A 3MM9A 1C0UA 3SCKE 2EPIA 2D3UA 4G1QA 2HBRB 2OPQA 3MR2A 9ATCB 4DV3F 2OJ3A 2YWGA 1W2IA 3RRKA 1NSAA 4DS5A 1DTQA 4ZITA 3MXHP 4DX5A 5KFJA 2FHOB 3BBFA 3QATA 3PR4A 4EMDA 1YRXA 1NKEA 2Q6CA 4RX6A 2RNEA 4F36A 2F4VF 2CQBA 4KV8B 5CYQB 2C2MB 3QFHA 2CQDA 1NK4A 3J7Z5 1WELA 5HP1A 1S1WA 1SVDA 2CUYA 4EO8A 5DDOC 4GVBA 1Q5VA 5EWEA 2BV3A 4DX8H 3VCDA 1CEZA 1X31C 4GKKF 3KG4A 1X4AA 1FDAA 1B7FA 1KHWA 3LALA 4NLSA 3I55S 4KYZA 5B0FA 2HYIB 2W9BB 5LSRA 2ZC3A 1IN0A 3GP9A 2MLXA 3V4MA 4CO2A 2HBZB 4E0DA 1VBKA 1QE1A 4CT9A 1FX4A 5CZVA 2KYZA 2VJVA 4P2XA 2H48B 2BQRA 2XG8A 2XTJP 2DR9A 3PYEA 2VONA 2E9RX 1FFWB 5KOWA 2UUCJ 4LSNA 1Q5YA 1IR0A 3M05A 4TU9A 3MTJA 1T03B 1KVJA 4CTAA 3TJ9A 3C16B 4HHUA 2OHDA 2CJKA 2QIFA 5AXMA 4IG3B 3HVAA 1B99A 5CYJA 1U2FA 1N0VC 1GQEA 3AJ2A 1VQ9S 3QAEA 1M1HA 2LDYA 4HI2A 5E3CA 5LJ5Y 1S9EB 4DZDA 3W2VB 2AJ0A 3DXBA 2DEIA 1R0CB 1RHMB 3D0GE 3NNHA 1RTDB 1T9WA 4N5SA 5LMUJ 4AQYJ 3PYFA 3ELHA 2CQIA 3ZZRA 3MM8A 2HHVA 1WG5A 3RR7A 2QZ8A 2A10A 1X7VA 5IV3A 3IBWA 5JXSA 1NO8A 2CQCA 4F2RA 1JLGB 3MEGA 2PA3A 2IJNA 1CG2A 5KT5A 2F4FA 4Y34A 4UW2A 4RW8B 4ECSA 4CO1A 1HNWF 5D4OA 2MLZA 4DX7A 3CULA 1NSQA 4PYAA 3M1VB 3QJPA 2D7SA 4I69A 4I2PA 1GX6A 5D15A 3OV7A 1ZAVA 1TKTB 4NL5A 3OTCA 1C1CA 3FSYA 4M63A 1WI6A 1WC0A 2CIMA 3TZZA 5E41A 3NG8A 4C7QA 3UE2A 2A6OA 1F3FA 2H9ZA 2W4PA 1CC8A 5ETKA 5EX3A 3HD1A 3QGGA 4DUTA 4YY3J 4LF7J 3K59A 1LWCB 1Q8KA 3Q83A 2E1CA 4GVLA 4WFBQ 1NUEA 3MEEA 2R7SA 4QW8A 1XNQJ 4BHQA 2JHEA 5E7OB 4I7FA 4O44B 2RILA 3DDIA 4DG1A 4ZVRB 2V9WA 2OAUA 2CPEA 2FDNA 2RD5C 4G1IA 4DV1F 4KIAA 4CLZA 3O44A 2DISA 1O6XA 3KK2A 2HFZA 2BJ1A 5IV4A 3I82A 3FBFA 4FS2A 1VBZA 4IH5A 3G8TA 1SL0A 4HH1A 3GPAA 1VIXA 1WJ9A 2P6TA 3PY8A 2M3DA 3QIDA 5A6PA 1WHXA 1KC8T 1FVSA 1B0VA 3FK4A 3MI7X 4JV2A 1NJWA 1MWQA 3CC4S 4JOUA 1LW0B 1RT1B 3RJMB 4YDXA 2M8HA 3VZIA 4MK8A 2C2KB 3BEGB 2W9AA 5HI7A 2HZAA 4PABA 2HWIA 4QYZJ 3HVWA 1G1XA 1HHQA 3OXGA 2WSFC 3H20A 4RW6A 2DEJA 3LWMA 2LXFA 3E2EA 2DH7A 2VBXA 1J5EF 3ISNC 1N32J 1R31A 1TP7A 4NLTA 2GQCA 3OHAA 1JNZB 3M2UB 1M1KT 1S1XB 2YQ1A 2HQGA 5KFPA 2GJ2A 4C6AA 3A12A 2JWNA 2HHPA 3PNIA 2R7UA 3P4UB 3LP1A 1L3KA 1N36F 4DCOB 3Q8YA 4OZNA 4JI0F 4LJMA 1UEVA 4WTYA 3SEOA 3CDWA 1TL3B 4FZVA 2N82B 2MQ8A 3TR5A 4YS2A 2KDOA 3CD7A 4K4ZA 2VIHA 2XMVA 3MZIA 2HRTA 3GB0A 2RQMA 1RWUA 4Z2XA 1PG5B 1DFDA 1R8CA 2J0XA 2HHQA 2CDQA 4ZOSA 1GMWD 3K57A 4UZBA 2ZH1A 4USUA 3VR1A 3K58A 4H4OB 1SBRA 3KUHA 3OHBA 1YX2A 4CIOA 4NYPA 3PTWA 2XO7A 5CCMA 3ZZUA 3RRHA 5B09A 4NOHA 1RAGB 5IQ6A 3FCVA 1K1QA 4R8UB 2MZQA 4KAIA 3UR3C 4JI5F 1RP5A 3ZTRA 4K5RA 3W9HA 5L46A 5IT9U 4CO4A 4X64J 2YXLA 5E33A 4DR2J 1RTHA 3EGWB 2DGSA 5IFMA 4LBIA 3G8SA 1X4EA 2HFOA 2B7BB 1GXTA 1RWPB 4PPDA 2E29A 1HBUA 4PG8A 3BO4A 3R5DA 4YFUA 3BSCA 1EQ0A 3KLFB 1HR0F 2Y1JA 2DTJA 2F1FA 3EVOA 3TP2A 1CJKB 4NMLA 3DLGA 3US5A 1Q8BA 4MFBA 4DL0C 4NLYA 4A8KA 1YK9A 5A8RA 3MEDB 4MAKA 4DR6F 2DCUB 3PW0A 3ENWA 1Y0HA 4X4VA 4I6AA 1HWUA 4ZPCA 3LP2B 3CJKA 4J9RA 5FD1A 4DCJB 3Q8PB 1U24A 2D69A 4MIWA 5H1SV 3THPA 1TL7A 5GAEI 2MQPA 3MFHA 4N47A 4IFYA 2ZUAA 3S6EA 1ZETA 3HSGA 3TZXA 3DI6A 5EDWA 2MQOA 1UFWA 4DR1J 1YI2S 4ECVA 3QRPA 3OR2B 4UT4A 1F5CA 4JB8B 2DNOA 1U02A 1XJWB 3MCMA 3TAPA 1RHUB 2PGCA 1N0UA 4DSLA 2W7AA 2EFNA 3TARA 5A0YA 2XI3A 1H7WA 1GFWB 2HHHF 2QA1A 5HBMA 2Y9HA 2AHOB 3BYPA 2LQ8A 2RUGA 3GYNA 4FBUA 3TJAA 2D41A 2QSWA 2P8IA 3PJXA 2XMWA 3KUEA 1UAWA 1Z2ZA 1R6YA 3P8BB 2X3DA 2NQPA 3FEXB 3HXMA 4FKXA 4OI6A 1FRHA 1XMOF 3UVJA 4CH1A 1EP4A 2KVIA 2PEHA 2BOPA 1OQ3A 3MMCB 2YKMA 5J1EB 4C11B 3SQGB 2W2OP 2QLBB 1M1GA 3UD3P 3FEZA 2YH0A 2IC3A 3MR3A 3F56A 4K50A 3WX8A 3I0RA 1UTAA 1M5HA 3E3XA 5A8KA 3DMJB 4NLWA 3I31A 4ZJQA 4ZP6A 2DNGA 1EKRA 5CD4H 5D4LA 2A2DA 5ADZA 2PT0A 1MMDA 2FZGB 2CADA 2V5HG 3GILA 5DS7A 3AFGA 4ECUA 3TZYA 5DG7A 3OD2A 2CZ4A 1TV6A 2X7IA 5HAOA 2BJ3A 1FXRA 3FFIB 5KFFA 1ICEB 2XYPB 4PR6A 3CMAS 2KT5A 3NNAA 3GYXB 2YPZA 5F0UA 4M5DA 3G6XA 1I94F 2CZ9A 4WBFA 1PJ5A 3V2UC 1T3NA 1S97A 2X1AA 2LP4A 2QV6A 1TELA 2IJFA 1DJ0A 2O1PA 3GCXP 4UZCA 2DYAA 2PD1A 1FKPA 2G2ZA 2OPPA 5KFGA 2IRYA 2GA7A 3H5XA 2CNKB 3H7HB 4Z7CA 3MOZA 1RT6B 2V94A 4UTGA 3IRXB 4J9QA 4ES2A 2Q66A 2MZJA 1CJVB 5MAOA 2VG6A 4DI6A 1E6YB 1S1UB 4AL6A 2AIRB 4ZLNA 1QSLA 1FKAF 3N28A 5KFBA 2NREA 2GGPB 1Z2LA 2VU5A 2ZOGA 2QLJB 3SMZA 2VOOA 5ETOA 3BH7B 2HMIA 1TR0A 4MKYA 2F7VA 5T7LA 1FT8A 3BR8A 1N4LA 2CRLA 1TVRB 5KT6A 3KK1B 2M4MA 4OQJA 2FC9A 1T94A 3H90A 2DHHA 4FF4A 2UUCF 4DR7J 2MQLA 3FMBA 1GNKA 4CLKA 2A0FB 3T3FA 2W8KA 4B3MJ 3BDEA 4NZ7A 4PYDA 3TA0A 4AUKA 1BWEA 1S57A 1U8SA 2DR6A 4WIIA 4F50A 5DM7Q 3R7NB 2FZCB 2I6WA 1FXLA 4PAAA 3ZZ0A 1TFWA 2IA6A 3PHTA 2ZZMA 3L7OA 1VLYA 5J2NB 4J9OA 1AZSA 2H65B 4M5IA 4PCQA 3JYTB 1SUQB 3M8RA 2YNHA 3GIJA 2WBRA 4Q8FA 3NOGA 4URSA 1TZ0A 4ITSA 2IM0A 2FHJA 3VV2B 1LW2A 2ZH2A 3QAUA 4IG0B 2UV8A 5EHHA 1NHKL 4O4GB 3KDOA 4E8UA 3EZOA 1WC5A 5G4DA 2RF2B 4G65A 1SJRA 1NDCA 3FMWA 3IRWP 2ZH9A 1XNRF 4F2SA 4RNHA 2O01C 2AGOA 4WPAA 2E5JA 3JXOA 5BXIA 2F3JA 2U1AA 4WK1A 4IO9Q 1TKXA 3GR0A 4PQAA 1R8HA 2ZFHA 1OSCA 4ETZA 2ZWPA 3CCMS 4HTIA 4URQU 1RLDA 4ZHRB 5KG7A 4AL5A 4CNYA 3QT6A 1XBWA 1ZM2A 4ZIWA 4FKYA 1OPZA 3EZ5A 4YY3F 4LF7F 4ZP9A 1JJHA 2MSSA 2RJZA 3TUPA 4LF4F 3HJFA 4QWDA 2NZ4A 3NGTA 4NA2A 1XNQF 3EYZA 2C2EA 4DPTA 1PGZA 2WK4A 3ITHB 2M0GB 5KFZA 3IWLA 5AXLA 5EWGA 2ZJRQ 2DHAA 3M8SA 4IOAQ 1IBMF 3IR5B 3KLEA 1REGX 2J9EA 4FYVB 3C15A 4P7VA 3T5JA 4DN9A 1U0HA 1AXQA 4EBDA 4WYLA 3CW2C 4A8YA 4J9LA 3CJ3A 5KFYA 3OSPA 5DDQC 2UUTA 1FRMA 3GG0A 3MMAB 4KH0B 1KOHA 4WCEQ 3EXCX 4F3QA 4CLFA 4CYUB 2V2ZA 1Q82T 4DF4A 2JH3A 2PIIA 5CH7B 2EWHA 2MKHA 2FJAB 2O67A 4DOZA 1WEYA 5KG1A 2IDEA 3F0NA 2QO3A 2KI2A 3I96A 2ALYB 2J8SA 2ASLA 4K4YA 1JLAB 3KLIA 1BQMA 2K1RB 3CJSA 5KT3A 3NWGA 2BOAA 3AJ1A 4MKVA 4JI8J 2F9JA 3GFZA 4DCPB 2B8QA
chains in the Genus database with same CATH topology
2IVYA 3G8QA 2DR8A 4B3MF 3MAHA 3LPYA 4ILLA 2AV5A 2C3OA 3THVA 1RYSA 3RAXA 1AFIA 2FJVA 1TL1B 1FESA 3OUYB 5KFQA 4B3RF 4J9NA 2IHR1 4LSNB 3PX4A 3MEDA 5LXRA 3TUJC 2WHOA 3HKWA 4G6VB 4OI4A 5T41A 4BBYA 5K8OA 1Y00A 4CTAB 1HNVA 2DGWA 3A1YG 1QAJA 2BXJA 3NP5A 5FDLA 2BRLA 2RQCA 4HEA9 1OPIA 1YRTA 4MKBA 1F2GA 2GO9A 5E0OA 5E3QA 3M9NB 2HRYA 1FD2A 4N8NA 2Y1RI 3LP2A 2DB1A 1JLBB 4OMFG 3NKYA 3G9CA 1HBOA 5GAHI 2E44A 2VA3A 1FCAA 2B4VA 3DYAB 5KFTA 3HHNB 1RT5B 4K4SA 1FHTA 3OVBA 2QA2A 3DFEA 2IM2A 2ZNZA 1C0TB 3DM2A 2XCAA 3MR6A 3GIMA 1GTHA 3B4DA 4XDDA 3HHLC 4F25A 1NKBA 1C1BB 4DL5A 3CPWR 4UY85 1P9QC 4EUVA 3KJVA 1JWWA 2IYIA 5J2MB 1VK8A 1Y5IB 4IRDA 4Q7AA 4NZ6A 2FJEB 3LQVA 4I56A 2VG5A 1NJIT 3JSMA 4Y2MA 3A8EA 2KG1A 1TL5A 5L1LA 2EFVA 1ELOA 2YNIB 2CPXA 1SI9A 3DRSB 3HFKA 5I3UA 2COLA 1UVMA 1SQEA 1J2VA 4YR3A 2YWFA 4DQSA 4DV0F 5K8PA 5DDPC 1KSPA 4PG6A 3KNGA 3S7RA 1JLCA 1S1TB 3OR2A 2I1RA 4DSEA 2C3YA 1SH3A 5LL6d 3FRZA 2M5YA 3GFXA 3N6LA 3U1MA 4PPZA 5L1JA 2E5LF 4DV5F 3KLGB 1RKIA 5F8HA 2RU3A 1VQLS 2AF6A 2OPSB 3T19A 4IO1A 2LXIA 1NK5A 5KFVA 1UJ4A 3HKZD 3KHGA 3VQTA 3CC2S 3O8WA 1P6TA 5B0BA 1RT5A 3VALA 3JSRA 4ZVEA 3R5AA 1WACA 4L72B 2MXYA 1C0TA 2UU9F 3D1QA 5HN0A 3CF5Q 2JFKA 4O3PA 2IM1A 3IXQA 2DHSA 2JOQA 1NAQA 3UQSA 2CQ0A 2XWYA 1HNZF 2K3KA 2EW9A 1UVJA 4MH8A 2J6TA 4B9MA 1M5OC 7FDRA 1UEUA 4DN0A 3TO8A 1DTTB 5D77A 1IKWA 3H5UA 4D3HA 3V4IA 4QR1A 1HFEL 1REVA 1VOMA 1RI7A 2YNIA 1JIHA 3CD5A 3DNCA 4HT5A 4IOBA 3TVZA 4M1KA 3OJUA 4EBEA 4U67Q 1CLFA 2F8EX 3HX9A 2MZ1A 1J5OB 2P9GA 2DNRA 4I2PB 4WK3A 1Q1KA 2CQ2A 3CEDA 4HKQA 4PXEA 1NH7A 3X1LB 2J7UA 1CQMA 5CZXA 3CCJS 1U1LA 2L48A 1QSSA 4IRKA 3GZ7A 1U6ZA 5B0EA 4DV2F 4O23A 1TAQA 4RW4A 1VQ7S 3O1LA 1C1CB 2CQHA 4DQQA 2JEIA 1UVNA 4I1TA 2GX8A 4OI3A 5FLXY 1DRZA 2AGQA 2GQQA 2FTRA 1UETA 1HBMA 2DNLA 2HPUA 2FGOA 2L3MA 3NGKA 3LP0B 3MMCA 3HZGA 1AROP 2YKAA 4IYQA 5C25B 5DDRC 1MMNA 5J1EA 4C11A 3SQGA 5SZTA 4X4TA 1S6PA 3Q8SB 2W4DA 4ID5A 1RISA 3WDOA 3OPKA 2HWHA 1NK6A 1HPZB 2XI2A 4U7CA 4ILMA 1MU2A 1S6OA 2D9OA 3TI0A 5GAGU 4YR0A 1DQ9A 2ASDA 3CE8A 4C0OC 2FVCA 3CCRS 5AXNA 2RQ4A 4KC5A 1YJNS 5A2QY 2VG7A 5JJBA 1GXUA 4DV4F 2WAQD 5T14A 3LGMA 1VQ5S 2DGOA 4PQUB 3N6NA 2EC0A 2K7JA 2KJVA 1NZAA 5IXUA 1Y9OA 3TW0A 3QIPA 4EFAC 5DQGA 1DTTA 2ZNYA 2J9CA 3GR1A 3N5FA 5KG5A 1HHSA 2DNHA 3MEEB 4F8RA 5B0AA 3PW7A 2UVWA 3MMBB 4I7FB 4MKAA 3SFGA 3SSRA 3V6JA 1UFLA 1TKDA 1GAOA 3K8WA 1NEEA 1U48A 4KFBA 3AY0A 4K4TA 3B82A 3KG0A 1PC4A 2HHUA 3CXCR 2MY7A 4DG1B 2MHEA 1IXKA 5IT0A 2MHNA 3CDEA 2AWZA 3BGFA 4TU8A 5I42B 3EPIA 3RB6A 4FNIA 3L3CA 4ICLA 4B9UA 5F8LA 2YKNB 2FUG9 1HD1A 1XMQF 3LO3A 3CDAA 3KK2B 3HZEA 5J2QB 2APOA 5M2RA 5C25A 3GSDA 2PN6A 4NA1A 2FY1A 2G0CA 3MM5B 4B9VA 2W9CB 2CQ4A 2D74B 4Q5VA 1VC5A 1HARA 2J7KA 3KKFA 3PEHA 4Q44A 1FDDA 3ULHA 4JI1F 4Y2AA 4X4UA 3FGVA 4DLGA 2RMLA 4F4KA 4V19X 5HROB 4DR4F 4IOCQ 3N0VA 3L09A 4ILRA 2QFJA 3JSYA 3MTKA 1IJFB 2P5VA 4RKUC 3FFIA 1O5JA 2CPZA 1R0AB 3BZQA 2R7VA 2LYVA 3DOKB 3T9NA 4DQPA 3MPYA 1TK8A 2IMOA 1U2RA 4I6WA 2DIVA 5IQQA 3CUNA 1UL3A 4O3OA 1KNZA 3QLHB 4X4QA 2OP5A 2B5JB 4AE5A 3EUNA 5D78A 2V4RA 2XWXA 4DL7A 5KTQA 2QA4G 2G9OA 3UWTA 1SH0A 2KJWA 1U7LA 4A48A 4KPYA 3L95X 3R5BA 3DDNA 3ENQA 2LXUA 2I2YA 3D1OA 3C6UB 2MZTA 4QZVB 5HLFA 4QIVA 3SV4A 4B3SF 2QLWA 3M4XA 2M88A 2GQ2A 4QU6A 4JI8F 2ZHOA 2RRNA 2YKNA 3CWJA 4N76A 4C3LA 3Q8RB 1FERA 5M2PA 2LQJA 3HPOA 3BSAA 1QTMA 5J2QA 3SCJE 1U49A 3H59A 5KFSA 2FLPA 3OTDA 4R5PA 4ZS6A 1X4CA 1WNEA 2W9CA 4RU9A 3HMJG 3PIOQ 3QGHA 2B43A 1BQXA 3OFHA 2ZD1B 2C22A 2L08A 5KFEA 4QWBA 3KG1A 1KQKA 2DRBA 4NLRA 3ZFVA 2BE2B 2WRMA 2WONB 3IN5A 4C8ZA 2NUUG 1R8BA 1KFSA 4LSLB 2EFQA 4XO0A 3DOKA 5G0RA 4C98A 1RTJB 4C97A 4DR1F 1E6VB 2IVMA 1S76D 4X84A 2BM1A 3M9MB 5E3RA 2X1FA 4PRFA 1M5VC 1RT3A 2MQMA 5F0WA 2Z4PA 3L7PA 3KNAA 2B9WA 2B5JA 2YNFB 2OFHX 3IRXA 4J9KA 2BQUA 4F3MA 3DOMA 3JB9k 4IFVA 4N77A 1R7IA 1VJWA 2JRSA 4ZPWR 4ZVGA 1A7GE 3FDSA 1WEZA 4NCBA 1A6LA 4ZLPA 4BC9A 4F4WA 3G71S 4ZCIA 3JTPA 4ZCKA 1GT8A 4DSJA 1H2UX 4A46A 1E6YA 1S1UA 3CC7S 3CJ0A 3DRRA 4TQRA 2PI5A 4C4WA 4C8NA 3C2PA 2EBEA 2PO4A 1S6QB 4RNMA 1KLNA 3C6UA 4PG4A 5B0DA 2Z2MA 3DGPA 4KR0B 4ES3A 3JAMY 1N48A 4PUOB 1LWEB 3QMQA 2GMLA 3NMAA 2ZE2A 2C3UA 1UKUA 2VKRA 1KRPA 2QMWA 2P6SA 2IVFB 4ECWA 4WE1B 4ED5A 4M95A 5F8JA 3O2IA 2GGPA 2M70A 4HT7A 1Q81T 2XNRA 3POTB 4FXDA 5CYMB 2GC8A 4B08A 2PI4A 2PMZD 5L1IA 1YQHA 2BE2A 3MECB 4HLBA 5BR8F 2KT2A 3T1YF 4LSLA 4RUCA 3I9ZA 5ITHA 3HHLD 4I4BA 3HVTB 2E1MC 4HDGA 1E6VA 1FNOA 4DV6F 3N5BA 3DLLQ 2E5HA 2W25A 3SDEB 4KHRA 3VAMA 3OR1B 2X1BA 2AQ4A 3CJ2A 2YNFA 2BM0A 2VPXB 2DNKA 1FRIA 2FC8A 1X5OA 4DUZF 2MZRA 3AQOA 1TAUA 5AE2A 4GC7A 4DF8A 1HW9A 2VFSA 2YWHA 4CO5A 1TVRA 3M8PB 4Y3CA 4C8LA 5BJRA 1R89A 1SJ1A 3KK1A 1H98A 1JLFA 1XMBA 3LH2S 5CCLA 3EZUA 1H2VZ 4WJBA 3G86A 4QQBA 4I64A 5DGBA 1S6QA 2YY3A 1S49A 4ALZA 4BWJA 4ZK7M 2CPHA 2FHKA 1S79A 4H4KA 1HHTP 1S72S 4X2BA 3K5PA 2GFFA 5DG9A 3KK3A 4FNHA 1MWZA 2OSRA 1LWEA 1N5YB 4ELUA 2IAJB 3GV8B 2JEGA 1RT7A 1VGYA 2Z0GA 3BN7A 4WE1A 3DU5A 2KHCA 2NS1B 4OI0A 1HQEA 1HWLA 4ZPAA 4YQWA 4JI2F 3POTA 4TNOA 2CVEA 2V4JB 5CYMA 1IKXB 3MHYA 4F26A 3P49B 3GE9A 4UQTA 4WXWA 3OFGA 3H5YA 3LANA 4XK8C 3CCSS 3NGDA 2PA8D 3RR8A 3M2VB 3V6DA 3BDPA 1O8BA 3DRPB 3D5MA 1U47A 1JK9B 1H0HB 3NS5A 1IQTA 3SDEA 1VRUB 2NPIA 2GIRA 2XHWA 3OR1A 5CXTA 1FK9B 4KB7A 3HM9A 4FVMA 3HVRA 1QY7A 3CVKA 4MK9A 2M2BA 2BQ3A 1VC6A 1G2EA 1HQUA 3M32B 4LMZA 2OFGX 5FIIA 3EPGA 2GMHA 5KFLA 4BC7A 4NCGB 2OD4A 1XEZA 3WC0A 2UXDF 3M8PA 2FB0A 1SKWA 3T1HF 3DU6A 4KE5A 1LWFA 1KTQA 5C24B 2HGLA 5K9FA 2HVZA 5KG6A 3KHHA 2ALZA 3PX6A 1MROA 1SUQA 2ZZNA 4OZJA 2N7CA 1OSDA 1WD6A 3MF5A 4PXDA 2DGXA 3P3DA 1N5YA 2H5EA 2IAJA 2HG4A 1KHVA 1N8RT 1VQKS 1JJ4A 2DT9A 1FRLA 4DL2A 4ATNA 2UVRA 1VS3A 4Q0BA 3RW7A 1ZM4A 2ZBIA 2BACA 1NHVA 2NSBA 5D4NA 4EGLA 3FVYA 1RTHB 2QLXA 4OFZA 2JC0A 1Y3KA 4YB1P 4N8OA 1VFJA 3RBDA 4K2XA 4IG0A 2DHXA 1U45A 5KAKA 3M9OB 4WKRA 3ZC4A 3DRPA 5E3AA 1YITS 4RZRA 5K8MA 2R8HA 4WZMA 4IKAA 1JB0C 1VQOS 4MYUA 2VFRA 1IJEB 2CPFA 3IC1A 1M5SA 4NLXA 1FK9A 2CPIA 3RRGA 2PC6A 2EG1A 2V4QA 4DFPA 1PILA 3IR7B 3MM9B 4OZLA 2OTLS 1C0UB 2IM3A 5AXKA 4DFJA 3FSXA 2KO1A 5DLFA 2OTJS 1AW0A 2E7WA 5C42A 1HBUB 1LK5A 1XN9A 2XMJA 4FYDA 2KH9A 3IWXA 1SIZA 2OPQB 1LFPA 3OL6A 4IR1A 2VQFF 3OLAA 2OD6A 5L9NA 5KOXA 3MUMP 2LVWA 3QZ8A 3M30B 3QWUA 2OSQA 4DL4A 2UXBF 2RKIA 2ZBCA 3EXYA 4P6QA 2W7OA 1JLQB 1DTQB 5HQ8A 2XS5A 2PMHA 2MKJA 3CD0A 4NRTA 3RYLA 4B3OA 2JJ4D 3OXLA 1SV5B 1WHVA 4A8FA 3PO4A 4CO0A 5A6WA 1RDRA 2YX1A 2KTQA 1F60B 1O51A 1QUPA 5K5MA 3B8HA 2BANB 1U6BA 4I68A 4U7UK 3DLGB 2VC0A 3PFOA 2LU2A 3PKYA 3BF4A 4MFBB 3G96A 2JLFA 3KHLA 1IKVA 3DLEB 2BR0A 2XBPA 3DRYA 4H4MB 4F4XA 2CVIA 4USIA 1K9MT 1H7XA 1XERA 3AQPA 3QO9B 3PFEA 2R2UA 2B51A 3F41A 2AP6A 2VBZA 1UP1A 2ILZA 1UW4A 1X4FA 4HL9A 5LJ3Y 3P6YC 4JV1A 3MM9A 3UI3A 1QVGR 1C0UA 3JTOA 2HQ3A 4Z37A 4ZKAA 2DPIA 4MK7A 1DLOA 4V19J 3SCKE 4A8OA 3CCLS 5C5JA 2EPIA 1URNA 2DGQA 2D3UA 2RDIA 1ZM3A 4G1QA 3CJKB 5HP1B 2CFXA 5LMNF 4EBCA 2OPQA 4NWBA 1IKYA 3MR2A 4DV3F 1OS5A 2Z8QA 2OJ3A 4IH6A 2HHSA 5KG0A 3CCTA 2YWGA 1W2IA 3M30A 2IRXA 5U47A 2WB4A 3RRKA 2F8HA 3LGNA 4DS5A 4ELTA 5D3GB 2J8AA 4IFYB 4L3NA 1JLQA 1DTQA 3VWSA 1JLEA 3Q2TC 1UVLA 1SV5A 2YWKA 4OLPA 1T05A 3MXHP 4G1PA 2J9DA 5KFRA 1RKJA 1N5VA 2UUWA 5KFJA 3TAMB 2FJWA 2FHOB 3NBPA 2LU1A 2BANA 1VK3A 1C4CA 2HNYA 3PR4A 3CTRA 2R7OA 4URGA 3DI6B 1G7CB 2HS4A 3DLEA 1ZBTA 4A8XA 4LF6F 5IM0B 1ZPWX 2L41A 1VQ4S 1FVQA 2J5AA 1YRXA 4YB5A 1S10A 2Q6CA 4KKOB 1NKEA 4RX6A 2CG4A 1NH8A 4J9MA 4YR2A 3HI9A 3TOQA 3PW4A 4IDKB 2RNEA 2W24A 1AUDA 4JUZA 5JVHQ 2F4VF 1N6QB 2DGVA 2CQBA 2KT3A 4KV8B 1L3VA 5CYQB 1WWHA 2QRRA 3MMAA 4Y2CA 2CQDA 1NK4A 1C2PA 4G3IA 3I4PA 1VRTB 3TA2A 3J7Z5 2J7WA 1WELA 5HP1A 1S1WA 1U1OA 2HGMA 5GADI 4EO8A 2CKWA 1H38A 1HNXF 5DDOC 5A0YB 2YKPA 1RTIA 3CCWA 3M8QA 1KLMA 4Q43A 1LFWA 2GV1A 5EWEA 3J7YI 5KG4A 3PKMA 1XTZA 1HI8A 3TQ1A 2BV3A 4GO5X 2AJ1A 5HBMB 1U1NA 4ELVA 1K1SA 1KS2A 3VAJA 4DX8H 3CT9A 3DHXA 2DNMA 2DITA 4L6V3 3OTBA 2VV5A 3HHDA 2L9DA 1VQ8S 3VCDA 1WTBA 2WCXA 1CEZA 4GKKF 3KG4A 4B3TF 1X4AA 1FDAA 4DJBA 1JLAA 1KHWA 3LALA 4NLSA 5EUHA 3I55S 1B7FA 5B0FA 2HYIB 2HNDA 5DLGA 2W9BB 3G6YA 2YNGB 3NLCA 4KKOA 5LSRA 3QJLA 5JVGQ 2ZC3A 4TYAA 2K1RA 1Q4RA 3DCAA 5EX0A 3K2YA 2OH2A 3LWLA 3HHLA 1HI0P 3DRXA 1IN0A 4R0EA 3TX8A 3V4MA 1DARA 3UDCA 3LOUA 2QT7A 4CO2A 1MW7A 2MKKA 5CYQA 1ZZNA 4E0DA 1KOOA 1QE1A 4A8QA 3MD3A 4U6PA 1IBLF 4CT9A 4EEYA 5CZVA 4C0BA 1EP4B 2KYZA 3AH6A 3GFHA 5KFHA 3MURP 1VRTA 1HBNB 1N54B 2DNNA 5MLCV 3J81Y 2YKMB 2YKOA 2DGTA 3SCIE 3RAMA 2BQRA 4ED1A 1A9NB 1TL1A 2XG8A 1FDBA 2DR9A 4QBUA 3OUYA 3BR9A 3C46A 2I0XA 1K0TA 3I0SB 2VONA 1TQLA 2E9RX 2HHWA 1MSWD 1UWBB 2EI5A 5KOWA 3FJ2A 2XCPA 2XULA 2MB0B 3N01A 4LSNA 3T9ZA 1IR0A 3CJ4A 5I4MA 4RNFA 4ZA1A 3B78A 3M05A 4TU9A 3MTJA