3J7YI

Structure of the large ribosomal subunit from human mitochondria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
158
Chain Sequence
b'SKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQGFINYSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 158
sequence length 168
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j7yI00
4NWBA 3JSYA 1ZAVA 5GADI 5GAHI 4UY85 5GAGI 5D8HB 1ZAWA 4V19J 5GAEI 2QA4G 3J7YI 5D6GA 3A1YG 1ZAXA 3J7Z5
chains in the Genus database with same CATH superfamily
4P7VA 3T5KA 1RK8A 3BO3A 1MROA 4DFPA 4EMDA 4LREA 3MM8B 4C8YA 3FQLA 4O3SA 2Q3PA 5DS7A 1NCLA 1IN0A 1UPPA 2A6OA 4NZ7A 1ROFA 2J9DE 3AH6A 1SPBP 4ZIWA 1KFDA 1L3SA 1YRUA 5KFBA 2CQCA 4ER8A 1LK7A 2IMWP 4O3RA 3GIIA 1JJHA 2FVCA 1OQ3A 5BYQA 4YOEA 2LQ5A 1S9FA 4FVMA 1MWQA 4WU2A 2EK1A 5T14A 1M90T 1S1WA 1S1XB 1AUSL 1RHUB 5C25A 4DL5A 4DL6A 3PTWA 2JHEA 1M5HA 5D77A 5E33A 3NGRA 1XTZA 1N56A 1WI8A 2KRBA 4U8YA 3EZUA 1N8RT 4ZKAA 2MZJA 3QJLA 3LUYA 4KGKA 1HD1A 4FVCA 2BJDA 5DG8A 1WC0A 2G2ZA 2DHXA 3PFOA 4F36A 3R1LA 2LDIA 2VA2A 3D54A 1N88A 1GEHA 5KOWA 3BBCA 2N7YA 1RWVB 3OFHA 2K3IA 1UCNA 3HPOA 1N32F 2B56A 2GC8A 2XHCA 3I9V9 2IBOA 3K0JA 4QU7A 2LKZA 1EB0A 3NNAA 4OI1A 5E5NA 2QMUB 2QJ3A 4NMXA 3HP6A 5F8JA 5DM7Q 5F8HA 4JV0A 5K9FA 4YP3A 2G0JA 1TMMA 4PWDB 3PR4A 3DYAA 3EGNA 4ECXA 1RHRB 3UDCA 4DQPA 1FRHA 5D4LA 4W90B 3AQOA 3HK2A 2ZKTA 3FMWA 2BRLA 4F4XA 1XQIA 3VGSA 3BGRA 2GIFA 3GSDA 3HD1A 2IMOA 4QW8A 1T02A 2UXCF 2NXNA 1VCTA 1HA1A 1TQLA 4OI0A 3ILJA 1Y3KA 3T19A 5HJYA 3TAPA 3JTOA 3TANA 4NA1A 1M1GA 3IP0A 2WW8A 4URSA 3POTB 3S01A 3BQ1A 1VDHA 3OR1B 2DGUA 5L8RC 1HBMA 2DJWA 3CTRA 1MU2B 2B6AB 2DTJA 5KFKA 5RUBA 1SUQA 2CRLA 1GH8A 1UEKA 1XNRJ 3BN4A 3VAKA 1WSVA 3NS5A 1FKAF 3R1HA 3GJTB 2BABA 2JC0A 4X84A 5GAHI 2MPUA 2WB1D 5CYMA 2ZBRA 2HMIA 3CCQS 1UWBA 3DYAB 5I3UA 1FX2A 4DF4A 2B4OA 4C9DA 1JXVA 1RT7B 2GO9A 4I67A 1TL3A 5DO2A 2OKQA 1IKWA 1DTTA 3L4BC 4UT4A 4NOHA 1YJWS 2B8QA 4DR7F 4JV5F 3I6PA 4AUKA 1J5OB 1IKYA 4LT6A 4O44A 4JI2F 2MB0B 4MK7A 2K1RA 1B70B 2ACYA 4CLZA 3PX0A 2KFYA 4GKJF 1VQ7S 2PI4A 1SVDA 2RAQA 1FDAA 1FJGJ 2DEIA 1TP7A 2DPIA 3K5LA 2HS3A 1NK4A 1IBLJ 2D3O1 3SEOA 4BLGA 2KYXA 4J9LA 1M5VC 3KLIA 3EDQB 3M05A 2DRDA 3CO0P 2YWKA 4NL5A 3H5SA 1V3ZA 3ONQA 4RBUA 5KTQA 2QN6B 2XG8A 2W2MP 2VDHA 1EP4A 4G1QB 5ETRA 5C2CA 4Q2MA 1UW4A 3G6XA 3CDWA 3QZ8A 2KT3A 4MKVA 4A46A 2L41A 3HSZA 3MEGA 4KH0B 3RG6A 1E6VB 1VHFA 2EFGA 4JV2A 2P6SA 1R0AB 5GMDA 2DIVA 3A8JA 3WBZA 1NKCA 4ETXA 5DZ7A 1FT8A 3ZZOA 3UWTA 4BBYA 3M6UA 1L3KA 3AOCA 4I2QB 4KGZB 1KLMA 3G2XA 1U6ZA 2CDRB 1VQNS 3M30A 4HYKA 3TUZC 2X3DA 4HVZA 2KKHA 1UVNA 2HNZA 3NMAA 2J8SA 5AE1A 3JAMY 1TV6A 4OV1A 2ZITA 2DHSA 3T5LA 1HMVA 4OYZA 5E41A 1RISA 1X31C 1WSRA 3CT9A 4C8KA 3UPFA 1N4LA 1WORA 1OSDA 1TR0A 4WFZA 4PXBA 5JVGQ 4IOBA 4KB7A 3W2VB 2HBZB 2RIJA 4D3GA 5H9FJ 1DAXA 4USUA 4J9QA 2HAIA 4DZDA 2QIFA 3FRZA 3M1VA 5GAGI 2CXEA 3SYZA 2HNDA 1S9EA 5H9EJ 2OHDA 3LH2S 2R9LA 4FBTA 2PT0A 3NLCA 4L73A 5J2NB 2W8LA 4OZJA 5L1JA 1B64A 1PKUA 3LP2A 4NPOA 2V4JA 2HFSA 2N4CA 4J91A 4IKAA 4ZVRB 2XM3A 3FJ2A 4ECSA 3T6BA 4OYBA 1WHVA 1VK8A 1W26A 1NAQA 3A13A 1RBLA 3GU0A 4R8UA 3HHNB 3K8WA 2V8PA 3QT8A 2LMIA 2Z8QA 2VDIA 3Q2SC 1UETA 1MWZA 1S9GA 1SB6A 2WONA 1N6QA 3CULA 3I5AA 4LF7J 2RDJA 1BQMB 4C3KA 3P96A 1T03B 3OVBA 3HZEA 2XY6A 3QSIA 3N9UC 4DV5J 1D8ZA 1HNWJ 4K5SA 4B3TJ 3KLEB 1V3RA 3IG1B 1FKOA 5ETTA 4I2PB 2FZGB 4MYTA 3NL0A 2HNDB 5SZTA 3U1MA 2FTRA 3BQ2A 1F3VA 2VQEJ 2M2BA 3F73A 3OFFA 4KC5A 1T9YA 2B4UA 2HFVA 1XNRF 4BWJA 1S6UA 4FF1A 2ROGA 4DJBA 3I5CA 1EIYB 2J0WA 4IYQA 1S76D 1F2HA 3DOKB 2MZQA 3L7PA 4OX9J 1NDPA 3H20A 2B9WA 2YBVA 4JUZA 9RUBA 5LJ5Y 2XYPB 4TYAA 1Q79A 5ADZA 5BR8J 4DSLA 1FNOA 1YJRA 2DNQA 4C2MA 5T41A 4MMOA 3GWCA 2FVQA 2QG9B 4ZP8A 4YFUA 3AFGA 2L9DA 2QA1A 4TQRA 3LPYA 4U7UD 4OI3A 4OYWA 2R7VA 2CVIA 2H5EA 4E2FB 2MLXA 1LFPA 3BZQA 3GP9A 3BR9A 2ZFHA 4WFAQ 3DOLA 1RTJB 2HFOA 3I9ZA 1TKZA 4D3HA 5E3AA 3UVJB 1UA1A 4GKKJ 2W7OA 3E01A 4U95A 1FJGF 1DJ0A 2AGOA 3SQGB 2F5GA 2CWKA 3VAMA 1IBLF 1XMBA 4RX6A 2K7KA 1NDCA 1IM6A 3E51A 3EXYA 2NS1B 4NYOA 3HFVA 4IRKA 4NCGA 3Q83A 3QT6A 2AHOB 3T41A 2FJWA 4CLKA 1TU0B 2H3EB 4J37A 3KG0A 4F3MA 2RF2A 1TZ0A 2CPYA 1WOOA 2NYHA 4NLRA 2ABYA 4LJMA 3JXOA 1S4FA 1VOMA 4I6AA 4C0BA 2F8HA 3PG9A 2BZ2A 2ERRA 1G6BA 2YXLA 2DR9A 3C46A 4P2XA 2PI5A 3EPGA 1SJ4P 2FJEB 3T1AA 1Q0NA 1HQUB 2ZDOA 4J9RA 2HK2A 2Z57B 1R31A 1L3TA 4LMZA 1WD6A 3FRYA 2AYBA 3NMRA 4ILMA 1ZETA 4KE5A 1H2TZ 3CJ8A 1NK6A 3OTBA 2G13A 3ZNJ1 4OI6A 4UY85 3MEEB 2CG8A 2C3OA 2IRXA 2ZOGA 1HIYA 3DLGA 2BACA 3MM6B 3DGPA 5GVQA 3MMCB 2X1GA 2F3JA 4HT5A 2CZ4A 3PO5A 4S0MA 4EZ6A 1QSYA 2QL5B 1DQ8A 4KY3A 1YBAA 2X1AA 4JI8J 1N0VC 1HI1A 3NEKA 5HVFA 3GCWP 2IJFA 5HATA 3N6NA 4RKUC 4IG3A 1HWIA 3PYDA 3MCNA 2F9DA 4CO3A 3G96A 4LF8J 4RUBA 2MZSA 3NOGA 2F7VA 3U27A 4YY3J 2HKEA 1WG1A 2WTFA 2WSCC 3IAM9 2KB2A 2MTLA 3F44A 5EGYA 1DBDA 1WHWA 4OJGA 4CLUA 5KFDA 4DR5J 3LANA 2IJRA 1VQKS 4DFJA 5F3TA 3I4PA 2ZH5A 3MMBB 4PCQA 1FKPB 4OZ1A 3QLHB 1UWAA 3UDVA 4LBPA 4BDPA 4Y2AA 3ZFVA 4PZVA 5C2GA 3DLKB 1HFEL 3MM9A 4F2RA 4LF7F 3TX0A 4M5KA 2BJEA 1REVB 2QYGA 3C8YA 1Q8BA 5HMWA 2BV3A 3A8EA 2XO6A 3D6MB 4N8NA 2XC9A 3CDEA 2H4YB 4DV5F 5H9FK 2HGMA 1HNWF 3NBPB 3J81j 4B3TF 3W9JA 5ITHA 4WFBQ 4USHA 2JWNA 4ZLLA 3N01A 3UR3C 4F25A 2GQ2A 4M95A 5H9EK 2XB2D 3R2CJ 2YKMB 2GJFA 4LSLB 3VWSA 2VQEF 3ET6A 2WAQD 3N6LA 4LF1A 1T7PA 2VD3A 2O1PA 2HVIA 1YJUA 3UCZP 4NEYA 5EX0A 2R2RA 2ASYA 2MKYA 1VIXA 4ZVHA 2I9SA 4BHQA 1AFJA 3MFHA 4ZN3A 2Y9HA 3M2VA 4OX9F 4NLOA 1R0CB 3OR2A 3TA2A 3H4DA 4M5NA 4X4RA 1U6FA 4YB5A 1RT5B 1S7IA 2Y1LB 1S0NA 2EBGA 5BR8F 2AKWB 2HIQA 1Q78A 3H40A 1ZPVA 1WTBA 3C19A 4CTAA 2KT5A 2QV6A 1VIOA 1R6VA 3CC4S 1RA6A 4PWWA 3TVYA 2JEIA 5D0RA 2R7TA 1GMWA 4WXOA 2FLLA 5I3PA 1VQ8S 2F4VJ 3QWPA 4OJ3A 4QCLA 2Z0GA 1G7CB 4JI0J 1AZSA 1JNZB 4CO5A 3IWXA 3OUYB 4X2BA 5B08A 4GKKF 3MECB 1GMUA 3DHWC 1YI2S 4UOCA 3PJ9A 1XR5A 1EQ0A 4DPOA 5K5MA 3QGIA 5DETA 2DR7A 3TUJC 4DR3F 3KLHA 3GCXP 1VGYA 1X0PA 4P2MA 5K14B 1HW9A 4EK2A 2I8EA 3GYGA 3LF0A 2KHDA 1WOSA 3KOAA 1RWOB 4TNOA 4BC9A 1S79A 3I55S 2XZDB 2VJUA 2PDAA 5KFVA 3P5TL 2DNOA 3VALA 2DCLA 2CQ0A 3HLUA 2GHVC 2VBYA 4OI2A 4OLPA 1B99A 2ZBPA 1U26A 3C16B 1RSCA 2B4PA 2KL8A 1VJQA 3L3CA 1BXNA 4K4XA 4TY9A 4RW6A 1X4AA 4CIOA 2Q66A 1X4HA 4ZCKA 4YEAA 4LBHA 1FRXA 2APOA 4M5DB 4CLYA 1HYSA 2G1HA 1SCJB 1O5JA 2WVBA 1NPPA 3RZAA 1KBRA 1HD0A 2D69A 3HFKA 3SCJE 3QRPA 2R7SA 3FMBA 3M8WA 5D4NA 4DG1A 5DQIA 2MYFA 2KO1A 5DDPC 4DEZA 1RT1B 4YHHJ 3IWNC 4DDFA 2BKNA 1M5PC 1E6YB 2ZDPA 3C6UA 4P2SA 4N47A 2HQDA 3KUGA 2NXJA 2IHR1 2FLOA 4DFMA 3S8SA 3SZ2A 3A3PB 4JI8F 1RT6A 5DQGA 4X4QA 4RNFA 3MHYA 2ZM6J 1BWEA 4AT1B 4QR0A 2WSFC 4LF8F 4I4BA 4WE1A 4M94A 4PPDA 4C8ZA 3OHAA 4DV7J 3CPWR 3HT3A 1RWNB 4ZVPB 3KK3A 4YY3F 2LQ8A 4FXVA 8AT1B 4DPXA 3KHHA 1D0EA 3FBCA 1K9MT 5KFPA 3FCWA 4M63A 2XSJB 4PEOA 3W66A 5I42A 3PKYA 2GW8A 4MKYA 1XJWB 4DR5F 1G3OA 4EYIB 2FJBB 3R7BB 4DCPB 2ZE2A 2DIUA 1S0VA 3TUPA 2I5JB 2V63A 3DKDA 3BGFA 4CO0A 4AL7A 5KFRA 1NH8A 3MXHP 2ADBA 4FS2A 4USTA 2DB1A 4J9SA 1VRTA 1W25A 4IFVB 3NRBA 3B8HA 3MR6A 1VQ6S 2IDEA 1RTHA 2GIRA 1IJEB 4ZJQA 2GHPA 5IT0A 1SKRA 3PACA 3RRKA 1NJZA 1LQ9A 3MD1A 3R5CA 3GYXB 2IRUA 1DQAA 3W62A 5HL7Q 4K7QA 3C6TB 4IO1A 2VBWA 3D68A 5IM0A 2B5JA 4AL5A 1JWWA 1MNEA 2JLGA 1IQZA 2YNIB 5A8KA 1EARA 4PUOA 4F0MA 1B3TA 2D3OR 4AFFA 3NP5A 1F5CA 2GQQA 3DRRA 5IQ6A 2P2CB 4NASA 4IOCQ 1DY3A 1S4EA 4EGLA 4O4GB 1FEEA 1X9WA 5A6PA 2G2OA 2V34A 4ECYA 1I3OB 3GFHA 4P52A 1QAYA 2HGNA 3LP0B 1NPKA 1EX8A 3MR5A 2BR0A 2DR6A 3UCGA 4RR5A 4JI1J 3T1HJ 1KRPA 2B7BB 1X5SA 2HRUA 3QNWB 2F4VF 1PYOB 3PHEA 4J7CA 4NLXA 3TEHB 2CIMA 5ETLA 4EUVA 3KLGB 4W4MA 1FTRA 3IGVA 3G8SA 5IZHA 3RR7A 2E66A 2XS2A 3CD6S 1QUPA 4JI0F 3CJKA 5GADI 1FRJA 2L9NA 4NMLA 1XMQJ 1NSQA 2W9AA 2YPZA 2RKIB 2G0CA 1VRUB 2WB4A 1NKBA 3TA1A 4PG5A 3M2UB 3GTYX 4UOFA 2CWXA 3RRGA 1WEYA 3QIDA 3H98A 3MMAB 1D9AA 1VQPS 2PC6A 2HRTA 3M8SA 1U45A 5DDQC 1HBOA 4OYAA 1K73T 1TL7B 4A8QA 1TVRB 5D0GA 3V4IB 2AGQA 2JFKA 3CCTA 4F8RA 3M8PA 1UKUA 1CJUA 1VI7A 2G9OA 3PKMA 2F9JA 3B4MA 2DO0A 4O3QA 1SJRA 2FVRA 3VQSA 2QLJB 4O3PA 2MSTA 1K0TA 5KFIA 2I0XA 1SL1A 4V19X 2UP1A 2YNFB 3VGVA 2W2QP 1U1KA 1FCAA 1WWHA 1RE1B 4FF4A 2BA9A 2MY7A 3KNAA 3KLFA 1CS4B 1H7WA 1VLOA 4IFYA 1ELOA 4A47A 1NHKL 2YNGA 1YJ9S 1V5IB 4J90A 2DRAA 4X4PA 4UZCA 4TVAB 4LQ3A 4CLFA 1U6BA 2KXFA 3ICLA 1URRA 3AJDA 3UW1A 4YHHF 1OIAA 1FJ7A 4OZ3A 2BRKA 3E8OA 2DYAA 5HANA 3R5JB 4F4ZA 3VQTA 1M1KT 2CVEA 3KJQB 2VG6A 2UZAA 3DRPB 3H0PA 3ULHA 1NJWA 3WC0A 4J9OA 3KXDA 1JLBA 1V9OA 4DV6J 3D0IE 4Z7CA 4P73A 1SV5A 2C2OB 4CP5A 1IXKA 4P72A 2CQIA 2ZM6F 3C3LA 1RBOB 3NGTA 2C2ZB 1SC3B 3M2RA 1Q16B 4C3MA 2XNRA 1YWXA 2BBEA 4DV7F 1PJ5A 3QZ7A 1R43A 2VL1A 3O5TB 1I6JA 5JUMA 4FBUA 2BE2B 1JLQA 1OPIA 2R7UA 4DLEA 2Y0SD 5F8MA 1JLFA 5HVGA 2P9GA 2EKYA 2KM8C 5KG2A 3M32B 5KFWA 2PEHA 1VYAA 1LV5A 4R5PA 2C3UA 1SC4B 4I6YA 1HNZJ 2J9CA 1IWGA 3DLJA 2DNMA 1HQEB 3M6VA 5CAAA 4KBIA 4WIIA 1BWVA 5KT5A 3R6GB 1RAAB 1NZ8A 3O6QA 5IC4B 1EETB 4KFBB 4A8KA 3EYZA 3N4WA 5DQHA 5DGBA 5J2PB 1N36J 4DPTA 2D1CA 2DNZA 2ZVSA 2ACMA 3GFXA 3I4HX 1RT4A 2Z2LA 4Q2LA 2IVYA 1RU2A 3V6DA 3R5BA 2VH7A 4DR2J 1FNXH 1U24A 2NQPA 4WP3A 4QR1A 3ILLA 1CVJA 1SBRA 4IDKB 4LF4J 3BB5A 4W98A 1M5OC 4WFYA 1JLEB 3ILIA 1X4CA 2ATLA 1QTNB 1RHKB 2ZH7A 3GG1A 4USVA 3BEGB 1Q1KA 2ZC4A 3V2UC 2HVHA 2R8JA 2YKNA 4LUBA 4TYBA 4MH8A 4JI1F 5IC6B 2WSEC 4TN2A 2BYCA 3T1HF 4WP9A 4C8MA 4DV3J 2YWGA 2GVZB 5KG1A 3KWMA 3FZBA 1HPZA 2HEKA 2UV8G 3J7Z5 3DMJA 2AX1A 4LSZB 2JEFA 3SV3A 2CAJA 3M8QB 1FK9A 1C0UB 4ID5A 3TOQA 1XMQF 3CO9A 2KDOA 1UJ5A 4DQSA 2VFSA 5A8WB 1BMQB 3J7A1 2JDJA 2OH2A 1F9EB 2DGTA 4LBIA 3BREA 2VBXA 2HHHJ 4W92B 2C42A 1PAUB 2V50A 5FJ4A 4U9RA 3IS9A 3QQCD 2C1EB 3GR1A 3D66A 1Q8KA 2YNHB 4OZ0A 3BM7A 3JB9k 3I87A 1WC6A 5J2MA 3W7BA 2DGVA 1X4EA 1C1CA 4WFNQ 1LEOA 4HL9A 3PX4A 2DO4A 2H1YA 3GIJA 2ADCA 4RUAA 5G4DA 1J5EJ 2QA2A 2HS4A 3AJ1A 4K4YA 4HKQA 2DNLA 1HI0P 2BM1A 5HBMA 3ZTOA 5KFMA 3UNGC 1ZH5A 3KK1A 5E2QA 3DRXA 3DRSA 4FKYA 1L5UA 2GGPB 5JVHQ 2XCAA 3AA8A 3HSGA 2BOPA 1N34J 3VAHA 2IJNA 3SMZA 2E5HA 2R2TA 4PRFA 2HHUA 4B9VA 2KYZA 1RTIB 2GX8A 1M1HA 4ECWA 4QIVA 3BKUA 3MPYA 5C7PA 4CO1A 5SUHA 2PFFB 4P2FA 4P6QA 1GFWB 3H4BA 2HFNA 3GFYA 2B9YA 4RBVA 1I94J 4CYUB 1NH7A 1OMSA 1Y10A 3O2IA 1FI4A 2FQQB 3ZZPA 4K4ZA 2JEGA 2OD6A 1OJ4A 4B9NA 2MQOA 4YB7A 2AZ1A 2NPIA 5G0RB 2A0FB 4ED3A 4G65A 1LW0B 4EWTA 3LGNA 1AFIA 5J2MB 1T05B 3DI6A 1FVQA 1C1CB 3MPVA 4OHWA 3I32A 8ATCB 4DV6F 5HP1B 1VQLS 2ZD1A 2QZ8A 4U7UK 4YB1P 3KJVA 2FLPA 2A6MA 3V81A 3SBMA 4N56A 3R8YA 3UD3P 5LSRA 2H65B 1PGZA 5D8HB 3MUVP 3U1LA 2IBKA 1IBCB 2DEJA 2H48B 3O3LA 2J6UA 4X4NA 2ZJPQ 2V0NA 2OFHX 3KDOA 1S6PA 4PXCA 2J0SD 1D8YA 2N3OA 3VV2B 2V5HG 1YLXA 2KH9A 5KG5A 5KFJA 4K4WA 4F3OA 3QFWA 3TAMB 1P9QC 2VC1A 4H54A 2VG7A 1WDDA 2JC1A 4A4JA 3MAHA 4TQSA 1P27B 4DXLA 3MM7B 3IRXB 4Q45A 4PR6A 3PVXA 1HNZF 5DG9A 3CJRA 2M5YA 2CPHA 4U7CA 5CA5A 2Y1JA 2CQPA 1LOUA 2ZC3A 2XYGB 3DOMB 2Q43A 3PY8A 2XY5A 2JSXA 4M5HA 3Q8PB 3SI8A 1H6KX 3IAS9 2IA6A 1IVZA 2QL9B 3VR1A 1X5OA 4WIQA 2IVMA 1FJEB 3I0SA 1N36F 2EFOA 2HQGA 1ICEB 4NLVA 1FRIA 4KPCA 2RHSB 1UJ6A 2VKZG 4PQUA 1B0TA 1OYDA 4OYOA 3TP2A 3R27A 2CQHA 1UW9A 4KO0A 3M9MB 2VASA 2QT7A 1CQMA 2NSBA 1D9DA 4DR2F 2GVDA 2WCXA 4DUZJ 2FHMA 1QE1A 3EGWB 1KNZA 3KYLA 3TEGA 4LF4F 2V9WA 3PM9A 3L09A 1T9WA 4NYZA 2BJ7A 4DUYJ 4ZJLA 3GONA 4A48A 4ZVOB 3W9HA 4R0EA 3DU5A 5J2QB 3OT9A 4CLSA 4DQQA 1R89A 2MQLA 1HNIB 2AV5A 3UD4P 4H4MA 5BYRA 2BDPA 3B82A 4C97A 1I1GA 5CXTA 4KKOA 4DV3F 5I4MA 2YH1A 4MJKA 2E9RX 3QGGA 1Z4UA 2K8GA 1C1BB 3DLHA 3DLEB 4PG8A 3GQCA 2BJ9A 3BN7A 1A7GE 4HLBA 1JLGA 4PQUB 4FXDA 2N4DA 5CZVA 2GJIA 2D9PA 4KQZA 1S59A 1WF2A 1GXUA 3NGKA 2QE5A 1S10A 3OTCA 2HHHF 3JQMA 3OL8A 2C2RA 5L9XA 1WEZA 3DU6A 1RYSA 5KFYA 3BR8A 1ZS6A 5DDRC 3C14B 4OX7A 2EC2A 2GZOA 2QA4S 1RADB 3WIVA 2Q79A 5KFLA 4XIUA 1JLCA 5J1EB 1WTFA 4RZRA 2MKKA 2I1RA 1DTQA 5ETPA 4IUFA 1HBUB 1JIHA 2AF6A 1J5EF 4C98A 3MGJA 1HWJA 4YQWA 4ED8A 4Z7YA 3JAMU 3SCLE 3R5DA 1S7HA 3DM2A 2VPZB 4DQRA 5L39A 5ETQA 4I68A 2G1DA 3MCSA 1TAQA 2D7SA 2UVRA 2BE9B 3S6EA 4DSEA 4ZHRB 5KFOA 1N34F 3JSMB 1KFSA 2ROEA 3KKFA 1LWFB 4F4AA 3QT5A 1ZM4A 1TL1A 4Q8EA 4KHRA 3R5AA 2QX0A 2M88A 3BH7B 4P10A 3GIRA 3KG4A 3G82A 1NB2A 2PD1A 2FHJD 4JI5J 1I94F 5B0EA 4ZLPA 3THVA 4CH7A 2QFIA 2VFUA 4ELVA 4BS2A 4NI2B 2BJ8A 1XIQA 1RYRA 2H5JB 1FX4A 3OV7A 3FBBA 2DR8A 3M8ZA 4HH0A 2DNRA 2KZMA 1OO0B 5JJBA 3VAGA 3AHPA 3OLBA 1VFJA 2HZAA 4OHYA 4JOUA 4IR9A 1EQMA 2K7JA 3ILOA 3AD9C 4LF5J 1T9UA 2N7CA 3QJJA 1V3SA 5GAEU 1HNXF 2AEMA 2KTQA 2FIUA 3PV8A 2VOOA 1KOHA 2XI3A 2VODA 1ZA2B 3HF5A 1U0HA 2XMKA 3P49B 4OZLA 4CZCA 4WPAA 1JLAB 3JTPA 2W2PP 2L48A 3C66A 3LO3A 2RILA 4UUXA 4LF2A 2PA3A 3I0RA 5B7WA 3TARA 1AROP 3CJ2A 4ENOA 1JJ2R 3MZIA 2ALYB 3NS6A 5B0FA 4A8XA 2VU5A 5CQGA 4Z2XA 3QFHA 4IG0B 1CULB 1U7LA 8RUCA 2AP6A 3C2PA 4B3OA 1H38A 3I96A 3IC1A 3UCUP 4ECUA 1TKTA 2MLZA 2ZOMA 2DVIA 4TLRA 1LNQA 2GMLA 4MIWA 3CWJA 1ZZNA 4B9MA 5I3QA 3BF4A 2DY1A 1DQ9A 5D3GB 4LIRA 2OEKA 2OFGX 5ETSA 1IM4A 3NOCA 5DM6Q 2BE7D 2QLXA 4DUZF 1YHQS 2ZBIA 3LP1B 5CCLA 2YVSA 2MDAA 1S49A 4EBEA 1B7YB 1ZBTA 5MAOA 3HHLA 1S1VB 4DUYF 2OIHA 4QZVB 1ZTWA 3M9NB 1OY6A 2QLWA 3CB4A 1YX2A 3KK2A 1U02A 4ZP7A 3OLAA 1VQSA 2QL7B 2XULA 4H4OA 1FE0A 2VONA 5E3QA 5BYSA 4RW9B 3IM9A 2HNYB 1NK7A 1S1TB 3W64A 4QPTA 4KHMA 3M8YA 2V6AA 1Y00A 1JKHA 4MTPA 4ZVUB 3U1NA 7AT1B 3W9IA 3CJ4A 4FPRA 5MLCV 3D3BJ 5KT3A 4TU7A 1LFWA 4PKDB 1J2VA 4FZVA 3CIZA 2CPFA 5GAGU 4ZP6A 1GNKA 3QAUA 2CJQA 3MM8A 1KWMA 2ZBCA 1IR1A 2MGZB 4IOAQ 1RI7A 4DSKA 1MMNA 4OV6A 3TZYA 3WQPA 1FXDA 4DV4J 1ZYQA 2XLIA 5THWA 3MTJA 1F9HA 5HJXA 2AU0A 1RACB 1F5BA 3IR7B 4ZDNA 1K8AT 2F63A 1S0MA 1F3FA 2NSCA 4MKAA 2JH3A 4F2SA 4AXJA 3DDNA 3FKBA 2XMUA 2U2FA 1MN7A 1L3UA 5KAKA 2E7WA 3P5BP 1S1XA 2KXHA 2JNJA 3CCWA 1QSSA 1GQEA 2ZOFA 3G8TA 4QJVA 3B54A 1KVJA 4QIWD 3UI3A 5AXNA 1I5OB 7FD1A 2DHHA 5E3PA 3M4XA 3PW2A 1Q4RA 1RHJB 1KLNA 4JI5F 1F2GA 5CYQB 3Q0AA 3HHKA 4G3IA 1RKIA 2OSQA 4RW8B 1BE4A 1RP5A 1BQNB 3R6LB 2BQRA 1S6OA 2MZRA 5KG0A 1MMLA 4C48A 2Z2YB 4OFZA 2J6TA 5E0OA 2R7OA 4PPZA 4UQTA 1LW2B 4Y65A 4LFBJ 3JS9A 1VISA 4MIBA 1XNQJ 2XS5A 1T95A 3K57A 4LF5F 3VCDA 2ZUAA 1NEEA 1QM9A 1Y9OA 5F41A 2BANB 3OL9A 2D3ZA 4RWXA 1TUVA 4B9LA 2DHAA 2OPRB 4ZPDA 3TR5A 5KFFA 2Q6CA 4PWDA 1RAJA 5M2RA 3E3XA 4OIXA 2MKHA 2AX0A 4WKRA 1U1QA 3UN2A 1FA0A 4Y2MA 4ZP9A 4UOHA 2XLJA 3MOJB 2ZJQQ 3D28A 3ZZRA 3CJ0A 2HYIB 1PJ6A 1UFWA 1T9VA 2ZH1A 3B4DA 2FJXA 3TZZA 2YWWA 2C3PA 3G87A 1SC1B 2HHSA 3HJVA 3AT1B 3QT7A 2KXNB 1ZM2A 5KG7A 2NZCA 4IQXA 2EG2A 5C24B 3POTA 2MQNA 3OR1A 1UVIA 1MU2A 2B6AA 3K5NA 5EDWA 2B51A 3CCVS 4QWCA 1KC8T 4DOZA 2R8HA 2PGCA 2BW2A 1WDTA 3NXZA 3OXLA 2OPPB 3ISND 1PSDA 2JZ5A 2CYYA 2XWXA 4F7VA 3ITHB 3FCVA 4G1IA 1XBWA 4USMA 1MLAA 4NA3A 4I6WA 3QRQA 2YPYA 2RHQB 2PIIA 3MWBA 3V4MA 1RT7A 3HFZB 4C4WA 2VPWB 1IKVB 1RDRA 1U1OA 1ULRA 1GXTA 3MUMP 1J5OA 4KHPJ 1O0PA 2W8KA 2UUTA 1Y5LB 2HBYB 1JJCB 2W2OP 4UQGA 2AJ2A 4ZN1A 5F8IA 2G0IA 1SIZA 4EFAC 5HLFB 4ATNA 2X1BA 2FHOB 4P74A 4IR1A 1WC3A 1LWCB 1S6QB 4IRCA 4DU8A 4F26A 2HQIA 4Y6IA 3O1LA 1U49A 3M8RA 2IC3A 4OHXA 3Q8SB 3PZPA 4DHVA 5B0AA 1RWUA 3CF5Q 3T9ZA 1BD6A 2BW7A 3WIUA 2F65A 4G1QA 4TXSA 3W2WB 2KFZA 3PR5B 2QA4G 1DRZA 1YQHA 3HHDA 2E1MC 1K1QA 5DLFA 1E6VA 3QYYA 3W60A 1VQ4S 4J9UE 4LQ9A 4RWWA 2OMLA 1R0AA 3FGVA 4ILRA 2MY8A 2SXLA 3LALA 4K4SA 3T1YJ 2Y8WA 2C3MA 4DV4F 3HT0A 2HGLA 3PO4A 2IAJB 2LXFA 4H4KA 3RBEA 4I2QA 4ZJOA 1KSPA 2J7UA 3D0GE 3OTOJ 3D1OA 1MN9A 2MKJA 1JK9B 2CDQA 5KFAA 2OTLS 2HAFA 5KOXA 4GMKA 5U47A 4QPXA 2IC3B 4F0HA 1EAYC 3A1YG 4F4WA 3DHXA 4PG4A 1NBEB 4Q8FA 2KVQE 3HX9A 5E3CA 3W2VA 3CD0A 3VAFA 2XY7A 1YKWA 3KNGA 3T5JA 2EFQA 1XEZA 3V5RA 2HHXA 4DN9A 2RDDA 4Y3CA 3A3NB 3EDRB 4QOTA 5A2QY 4HHUA 2J8AA 4ECQA 3KJFB 3BKTA 3O8WA 3K7RA 4WZMA 1FD8A 3OFGA 2K2PA 3HI9A 4NCAA 5J2NA 3FFIB 1TFYA 5AT1B 1UZHA 2RRNA 3CCRS 4YR2A 5ETVA 4LFBF 1XNQF 3ENAA 2E9ZA 1VBXA 4KSEB 1R8AA 1BHNA 1MMDA 3DFEA 3HVTB 3BQ0A 2W01A 3NWRA 5C42B 4C8LA 4KGVB 5KT6A 2GJ2A 4TY8B 2MEWA 4V19J 1M0SA 3RUBL 2E5LJ 5L1IA 3MUTP 5T7LB 4WF9Q 3JYTB 1S97A 1JQGA 5EUHA 4RNNA 2AJ4A 2V8VA 4ZVGA 1RA7A 1BQMA 1IKXB 4QQBA 4MKBA 1NDLA 1T03A 1FESA 4ZOSA 3MAAB 1KS2A 4O0NA 4F4KA 2XI2A 1TAUA 2V67A 4Y0FA 1TKXB 2YKQA 3QBCA 1HHSA 3N79A 4OX8A 3KLEA 2DISA 3IG1A 4I2PA 1UPMB 5IT9Y 3UN3A 3DNCA 1YJ7A 5HROB 3CEDA 1HBNB 4PABA 3GFZA 2V94A 3BDEA 2IM2A 1WC5A 1SQFA 1TKDA 4CDIA 4NYPA 3HMJG 2ROPA 4KT0C 1GT8A 2PA8D 1F9FA 4WK3A 5CYJA 5D15A 2LDYA 1LWEB 2MLYA 4ICLB 4O0IA 3DOKA 3CMAS 2WHOA 1GTHA 2FC9A 4WU3A 4DMZA 1QLNA 1FXRA 2ZH9A 1N54B 1S1UB 2GAGC 3I56S 2E44A 4HACB 1RQ0A 2IPOB 3GIKA 1RAHB 5EX3A 2FD2A 5FLXY 2QC3A 3IFEA 2LFVA 5DLGA 1S57A 3MM5B 3QSYB 1HLWA 3T3FA 1S72S 2VG5B 4KHPF 2W7AA 3ADAC 4J9VA 3SSSA 2DGQA 3ETMA 4QYRA 1B7FA 4QWAA 3W1YC 1KDNA 1RTJA 1KD1T 2V4RA 5JXSA 5KFZA 1NXIA 3UVJA 3R3TA 1UVMA 1APSA 3OHBA 4AXIA 3SQGA 4DL4A 1C0TB 2CJYB 2Y3YA 5F8NA 3PEJA 5IS2A 4PXDA 2PEBA 2R3VA 4PQAA 3MAQA 2BXJA 2IVFB 2VV5A 3PFEA 4HR2A 2RVJA 2EK6A 1YDLA 1O51A 2B9EA 4HHHA 3CC7S 2VBZA 4I1TA 3MEDB 3MFIA 2FJAB 4OI4A 4X66J 4AE5A 3OSPA 4PG7A 3FC9A 2AEFA 5IV4A 1CJKB 4YR3A 4ELUA 4LR8A 1Y7PA 2LLZA 3Q2TC 1HQUA 2ZH3A 4ZA1A 4UZBA 1IR0A 3M9OB 3T1YF 4DWIA 5EHHA 4ZITA 1X8DA 3OTOF 3QIPB 2QSFA 2Y1RI 3GE9A 5A8RB 3D0HE 3H2VE 3KMQA 1ITPA 3MEEA 4L6V3 4RW7B 2XLKA 2MHEA 4ZK7M 4Y34A 2E1AA 1HWKA 2K3KA 2DXEA 3MM6A 2VOPA 4NLDA 2V8HA 3MMCA 3OVAA 5CABA 2FJDB 1QD1A 4LSNB 1GXLA 2Z30B 1RHQB 2M70A 4J9MA 2W9CB 2OJ3A 2OGUA 4UY8T 2RE1A 4OZ2A 3RTVA 3EUNA 4DPUA 5HSPA 2COLA 1UVKA 2POKA 4KV8B 1M5KC 3ZZUA 3V6JA 2HHVA 1IWAA 3CD7A 1TK0A 1NRKA 3G8QA 2C2DA 1Z1ZA 2VB6A 3MCMA 3SFUA 2J6SA 3H59A 1TELA 4A8WA 2E7XA 5A0YB 1RT3B 4USKA 1ZA1B 2FVPA 2M9KA 2LU1A 2Z2ZA 2EFPA 1EHWA 1LWXA 3ELHA 1OPZA 3VZIA 4EZ9A 2CPIA 1N5YB 3MMBA 1U1RA 2NXUA 2E5LF 2XGPA 1FKPA 4CLLA 5B09A 4KIAA 4ANEA 3QLHA 1W2IA 1QDUB 4KYZA 2KG1A 2MKIA 3DLKA 1WNEA 2Y0BB 3L95X 4WP8A 2R7QA 2XMJA 1I51B 1REVA 2GO8A 3PRVA 3MTKA 2D9OA 4I7FB 4GO5X 1H2UX 1NHVA 3NGSA 4ED0A 3D1HA 3NBPA 2V2ZA 3N6MA 4NX9A 1KVIA 3W5XA 3D2WA 1Y11A 6FD1A 3N5BA 2CJKA 3J81Y 2YKMA 3THTA 4GVBB 2KU7A 4LSLA 4K4UA 1NSAA 3GB0A 5EWGA 1FHTA 2XS7A 2IIHA 3HDSA 2KG0A 1X4BA 3RW7A 1G1XA 3H5UA 3CJSA 1CG2A 4B17A 2KJVA 2ZHBA 2UUCJ 1DLOB 2LP4A 2ZVIA 1KTQA 3P8BB 1EJ7L 1WC1A 3EGZA 3CGIA 1QJHA 1GX5A 4RJVA 1YG0A 4UW2A 1LXJA 3TUIC 2LU2A 2BUNA 1W7WA 1SJ3P 5L1LA 4DL2A 3ZZYA 2PMWA 1RT5A 2CQ1A 5F0WA 1EKSA 3NNCA 2ZNYA 4K0KJ 5DRKA 2VHGA 1U2FA 4V1Ak 3MR3A 3PDNA 2IM3A 2PFDA 4ZS6A 4NA2A 1NHUA 1T9TA 2AD9A 4CH1A 4M5LA 3EVOA 1R8PA 3SDEB 2YX1A 1KP6A 3GLJA 4NE9C 4OYPA 3UN5A 1VMBA 1R0BG 3FEXB 2W4CA 2XCPA 1FRLA 4FYDA 3OUYA 2DKOB 2OMOA 4WYLA 3MECA 3TVZA 1K1SA 4NLTA 3VZHA 2WZ1A 3TO8A 4NLPA 2CJ9A 1QY7A 1NZAA 4U96A 1PO6A 4I64A 4B9TA 4DX6A 2L08A 1U4BA 1RT2B 4PYDA 4OMFG 1WHYA 5FDLB 5K14A 4KAIA 1Y3JA 3QRRA 2CPEA 3ZTQA 5IT4A 4X66F 3ZC4A 5B0GA 3P6YC 2UUBJ 2VFVA 4LIWA 2DGWA 3C15B 1CJVB 3H8YA 1QSLA 4AQYJ 3C16A 4ZLNA 2RB7A 3AOAA 1QUVA 2QMWA 3BSCA 3NS7B 2OPQB 4CM0A 2E1PA 4M5DA 4YDXA 3KMSA 1YRTA 1T8EA 2W24A 4C11B 3SXLA 2B43A 3AA9A 4GC6A 1R6YA 3SSQA 2VA3A 4JV1A 2HFUA 2LYVA 1RT1A 1FFGB 5EWFA 1YZ7A 5ETMA 4NXMJ 2HG4A 1Y4ZB 4CNYA 1PAEX 2OPSB 4RBTA 1E6YA 4ELTA 4JI4J 3TA0A 4FNHA 4F02A 1GAOA 2LEAA 2P9CA 4RW4B 2IYIA 2LA6A 3AODA 4GC7A 4P75A 4LRBA 1QAJA 1NK5A 1BC6A 4X62J 3SFGA 3GPAA 2DNGA 2IM0A 1HNVB 1IR2A 4CM2A 5CHCB 3QO9B 3SCIE 4Y28C 5GMEA 2EC0A 1YITS 2HBQB 3UDEA 5IXUA 1RTDB 3GJRB 3BGOP 2ASJA 1CJTB 3D7SB 2RUSA 3FZ2A 4IRDA 2CQDA 1XERA 2XSJA 2WOMB 1MWYA 1ZPWX 4NXNJ 1IBKJ 1MROB 1GMVA 2VZ9A 1DZ5A 2GFFA 2I5JA 2KVIA 4X64J 3H42A 2DXFA 3HKWA 1KVKA 2LCWA 1B0PA 3F56A 1FTCA 1T0TV 4YR0A 4IFVA 3Q22A 1TL5A 4C7QA 4Y2KA 3Q23A 1N33J 4L74A 4DFKA 3HHLC 1S1WB 2DGOA 1F5AA 1Q95G 3M6XA 5C25B 2AQ4A 1X4GA 2MZ1A 1QVGR 2HVZA 3C6TA 1YZ6A 4XDDA 2Y1IA 3D6HB 4MT1A 4RL1A 2FJVA 4ZPBA 3EVWA 2V9KA 2YNIA 2R2UA 2VICA 2AJQA 4L75A 4NZ6A 1X7VA 2BVZA 4HI2A 5D78A 2UUCF 2RQCA 2YY3A 2MQMA 3IBWA 4ED2A 1SL2A 3RB4A 4O4GA 3BPSP 3EXCX 2PO4A 5DZ6A 4U6PA 1N52B 2BKPA 4FP9A 4A8MP 3TI0A 3CJTA 4OQJA 2DNHA 4K0KF 3LP0A 1FO1A 3ISZA 5GAEI 4O3OA 1UVJA 4R0JA 2W1BA 4DL3A 4DV1J 3IBFB 5ETOA 2QLBB 1FRMA 3WC2A 3KLGA 3NAHA 3AQPA 3QWUA 1SH0A 4RU9A 3H2LA 1SI9A 3NY0A 1JMTA 3BGRB 3KHGA 3ENQA 1N5VA 4X65J 2RKIA 3H7HB 1VRUA 4KH1B 1OSCA 2BM0A 3DGVA 3R7NB 4OZ5A 4N77A 2MZTA 2F4FA 3M2UA 1Y0HA 3IGNA 2IDLA 2XNQA 1H73A 4QWEA 1V5VA 1HBMB 2BKOA 3MMAA 2CNKB 4WK1A 3PW0A 3NCRA 3W65A 3BGUA 4Q44A 1SUQB 3CD5A 1TFWA 3M6WA 1NO8A 1F0XA 3JSYA 1XC9A 1TL7A 3CMES 1TVRA 3DDKA 4RLEA 4DL0C 3V4IA 1TMJA 1KHWA 2XHWA 3G6ES 4YUDA 4C0HA 5HK4A 2UUBF 5CYMB 2HMIB 5D0EA 4OJ1A 3FBFA 1UWBB 2KM8B 3JQJA 3A4TA 2GA7A 2EVZA 4AQYF 5I3UB 3CDUA 2JX2A 3OW2R 2M8DB 2HBRB 1XMOJ 1G2EA 3QJPA 3NCPA 3BPDA 1TL3B 2YNFA 1IKWB 3QPIA 3RJMB 2GS8A 1DTTB 1CS4A 2R8KA 3T5HA 3K5PA 3CCUS 1PC5A 1ZM9A 1SKUB 3OQ2A 2A2DA 1VK3A 1IKYB 4O44B 3OJUA 2E7VA 4ES2A 3VVUA 2K1RB 1C4AA 3ISNC 4Q7AA 4NXMF 3Q8UA 3NNHA 2W9BA 1YK9A 3KUEA 2QRRA 1L3VA 3W63A 4ANCA 3DRPA 4JI4F 2CQBA 3UQSA 3EZOA 1NJIT 2FZKB 1SH2A 2JJ4D 3KLIB 3MI7X 1PJ7A 3LWLA 4ED1A 4ZVEA 2FDNA 4X62F 5KT4A 3FBEA 3HVRA 2KI2A 4GRSA 4NRUA 4CI0B 2UUWA 1PC4A 1EP4B 2LEBA 2XMAA 3Q89A 1EKRA 9ATCB 2J9DA 1CQNA 2FVSA 2X7IA 3SQOP 3ZZZA 3Q8RB 3Q86A 5KT2A 2YTCA 3U7JA 3MEGB 1HI8A 2BE2A 2EEYA 4NXNF 3EPIA 2FYXA 1IBKF 5HN0A 3BSOA 4YN3B 3OBIA 4CT9A 2G2YA 3GZ7A 5GMKa 2FB0A 2V2VA 2B4VA 3M32A 1AYEA 1YGYA 4X64F 4ZPCA 4EBDA 3BYRA 2E5GA 2W9BB 4DU7A 1KLMB 3X1LB 1HQEA 1NU4A 3MD3A 3AY0A 3M30B 2H9ZA 3BO2A 1TUWA 3H5XA 4QWBA 2YKOA 2RDIA 5FIIA 4NLSA 1N33F 1KOOA 1EETA 2HNZB 3MURP 4KFBA 1KEKA 3KG1A 5LMNJ 1FDNA 1TV6B 3SV4A 1HMVB 4I69A 1SKSA 2BX6A 6FDRA 4PWUA 5J2PA 4O3NA 3M7VA 4DPYA 2YWHA 1FDBA 1UA0A 4CNZA 3LOUA 5AJ3J 4J9NA 1LK5A 3KJNB 2FGCA 2GIQA 5KFGA 2E1CA 3M1VB 2J5AA 2RT3A 5AE3A 3CMQA 4A8YA 2DPJA 5JMNA 2Y8YA 3MPWA 2RRAA 4UF4A 1S9EB 3CUNA 1U8WA 4IDKA 2L9WA 2P9EA 3J80Y 2VUGA 1FDDA 4MK8A 1JLEA 1KQGB 3LP2B 2X3GA 2V4JB 1OQ6A 3CNQP 2R2SA 3AD8C 1WKKA 3FEZA 3RB3A 2HK3A 1WHXA 2CNLB 4RUHA 2UVUA 3FVYA 4LR7A 4R8UB 4DV1F 2WBRA 2LQJA 2GVZA 2CPZA 3OFEA 2R8GA 1WF1A 5F0UA 1S9GB 1HQ2A 2EXUA 3D1QA 2WONB 2H51B 1N6QB 2CPDA 3RBZA 1SQGA 3A8IA 4H4KC 5F9LA 1NSKL 1SL0A 2W2NP 4XK8C 1FWPA 3M8QA 1C0UA 1NK9A 2FC8A 3ZTSA 4X65F 1J27A 4X4SA 2M3DA 1RBAA 1BLUA 5A8WA 2XZWA 5LXYA 3VF0B 2VC0A 1R8BA 1FKOB 2Z56B 3IXQA 3J7ZT 1PCAA 4OYIA 3EWGA 2YNHA 2RSQA 4RNMA 2BMBA 1LKZA 3R7SB 2C2MB 3T9NA 5CH7B 2EFVA 2LQBA 3HSDA 5CZXA 1ZOTA 2PN6A 3UDLA 2CG4A 3FSYA 2CKWA 2JEJA 3R9LA 2M0GB 3BH6B 3JSBA 4WTOB 2DXDA 3OTDA 4DR3J 2E9TA 5A76A 1SC6A 3J7YU 4KTQA 3JSRA 1SJ1A 1JB0C 2GGPA 3ETOA 1WEXA 1T9XA 1JX4A 3D4JA 1XMOF 2LVWA 4WZQA 1SJQA 2BOAA 2B3TB 3QGPA 2RH3A 1DHMA 1RTIA 2WK4A 1D09B 1DARA 4E0DA 3V6HA 3R5GA 4YMEA 3BBBA 4RU2A 1DFDA 1IUJA 1X9SA 1WOPA 3DDIA 4CYUA 2MHNA 5K8OA 2D41A 3IRWP 2V2KA 2LXUA 4J9PA 3TZWA 3IN5A 3DOLB 4FN5A 1ZAWA 1TL4A 4G6VB 2DITA 4A8OA 1BUXA 1TKZB 4NLWA 3CDAA 5G0RA 4DL7A 2O5DA 1LW0A 1UFLA 1GX6A 3E01B 2YQ1A 1T05A 2YX4A 3GYNA 1NUEA 5DG7A 4L3NA 2LECA 4DBQA 3UNYA 5HP1A 2NR0A 2N82B 3PW7A 4NCGB 5KFEA 4EYHB 4UUWA 3FSXA 3OL6A 2RF2B 4LF9J 4KR0B 2UUAJ 1RWWB 4ZVFA 4N41A 4GO7X 1KQKA 1P1TA 2DRBA 4J5OA 2ZEJA 3CVKA 3RBXA 1LXNA 4YS2A 2MJUA 4EO8A 2ZH4A 1KR4A 1N5QA 2R8IA 2ZHOA 1U1MA 2V8GA 1RWXB 4YB6A 3QATA 2J0QD 1MSWD 4WCEQ 2RNEA 3WX4A 2AT1B 1IBMJ 3TAMA 4KPYA 3GSIA 3PYFA 5IV3A 3ZTRA 2YKAA 3TNVA 4Z37A 4ZPAA 2A2CA 2PE8A 1WF0A 3IA0A 3MM7A 3IRXA 4DPWA 4O23A 2GAHC 2IRYA 4NLGA 1FEHA 2H4WB 2NCKL 4MYUA 2HRYA 1N0UA 3B6BA 2ZZMA 2HHPA 3HM9A 4LRDA 3TRGA 2CQGA 4JI3J 2RS2A 1K0VA 2ZH6A 3DOMA 4NLQA 3KLVA 5LMNF 4B3SJ 2DBBA 5L9NA 3DLGB 4FYYB 1VQYA 3DGPB 2PMHA 3CW2C 2C28A 3J7AN 1P9YA 4FXWA 1QVFR 4F50A 1FD2A 1A6LA 3V6KA 2PMZD 1NSPA 2KFNA 2HLUA 4DR4J 2VFTA 2GCFA 5AJ3F 2O3DA 4ID8A 2KZZA 4AD6A 4DR1J 2P6TA 4CH0S 1VBKA 3K8VA 4IG3B 3W61A 5ETKA 2V2QA 3CXCR 2KT2A 2ZBQA 4ED7A 1CLFA 2C3YA 2FUG9 4ERDA 5J1PA 3JQKA 1PILA 1RAOA 1WKLA 3VAIA 2NPFA 2XQCA 2NREA 1Q8IA 1U47A 5J2QA 1QAXA 1HARA 1K44A 2CPJA 1F6TA 4EI2A 1HNIA 1UZDA 1VS3A 2XZTB 1RCOB 3B78A 3TJ8A 5KG3A 3MM9B 4BWMA 3TQEA 1C1BA 2R7WA 3Q8QB 3DLEA 4ZPVR 4MAKA 4HDHA 5AE2A 2AWZA 4LRAA 2WVEA 3PYGA 3G4SS 1X0FA 3G6VA 1ACMB 4PXEA 2K06A 3K5MA 3F0NA 4HH1A 3HSJA 2FLNA 5DJBA 2BQUA 1Z2ZA 2RU3A 1R3NA 3C14A 2JL9A 3ET6B 2HW3A 3FCHA 2VFRA 4ZPTR 5J1EA 2R7XA 4ES3A 2AZ3A 4ECRA 1HBUA 3TQ1A 4HT7A 4ZCMA 5M2UA 4NWBA 4Q0BA 2WVCA 5HMZA 3TJ9A 2R42A 2DNNA 3M2VB 3WDOA 3OR2B 3W8GA 1S5ZA 3OXGA 3F41A 2NYIA 3OTEA 3PW5A 3BKFA 3LQVA 3UFCX 2QEXS 4ZHRA 2DT9A 3JSMA 3RAXA 4K4VA 1GMWD 4DSJA 4CTAB 2GQCA 1LWFA 4DSFA 3A12A 2IYGA 3VTIA 2BJ3A 5A2QU 4QBUA 1OYEA 4K50A 2E5JA 4BC7A 1FE4A 2KN4A 2AW0A 3FNNA 4RNOA 4FF2A 4TLQA 4M5IA 4NI2A 1AZSB 2FHJA 4XPEA 2NXEA 2CPXA 3KFWX 3N0VA 5FD1A 4CWBA 2MJNA 2RD5C 5DGAA 4U8VA 1KKHA 3D6FB 2GMHA 4WJBA 4N5SA 3VVTA 4Q0BB 1T94A 3KLHB 4LF9F 2UUAF 1H2VZ 4NEZA 3TJAA 3DCAA 5C5JA 2YWEA 5BJRA 1YTYA 1N48A 1PG5B 3PRBA 1HW8A 3WHIA 1CC7A 3AJ2A 3G86A 3P3DA 4CLPA 1U48A 2C22A 1Q53A 1RB0A 2UXDJ 1JLAA 3MOZA 1IBMF 1UEVA 1YJVA 4FF3A 3BS9A 1Q5VA 4RW6B 4FNIA 2QLFB 3LGMA 5IT9U 2EFNA 2AGPA 1RAFB 5CCMA 4WTYA 2Q1LA 3PX6A 1HYSB 5KFXA 3NGUA 4USWA 2J76E 4IG0A 2AIRB 3HD2A 3I5BA 4QR2A 1T3OA 1VLYA 1CULA 1FWLA 5IQQA 3IR6B 3PYEA 4LFAJ 4JI3F 2A3JA 4DG1B 2XYHB 3BYPA 3NCQA 4LVOP 1V6HA 3ZO7A 4B3SF 3MR7A 5EWEA 5GAHU 4L3KA 3C6UB 4B3RJ 2HPUA 2XMVA 5FLXU 1X4DA 4DR4F 2B9XA 4CLWA 5D3GA 1RUSA 2ZH2A 4DR1F 2OAUA 1YIJS 1RT6B 5E7OB 1SIWB 1Q7LB 3IO1A 4F3QA 3LPEA 2H54B 3S7RA 4YDDB 2CZ9A 4O4RA 4ANDA 5B0DA 3EJMA 4NCBA 5KFNA 4DV0J 3LP1A 4WE1B 3NKYA 2EW9A 4RPFA 2R7RA 3KK3B 2Z58B 2X1FA 2ALZA 3HCXA 4C8NA 3MPDA 2QYCA 4XDCA 1S1VA 1Q7YT 4ECTA 5I42B 4X4TA 3RYLA 1YBUA 4FS1A 4R25A 3X3UA 6AT1B 4NLUA 4DV2J 4G1PA 4QU6A 2ZE2B 2I6WA 2IFXA 4M5JA 2MSSA 5HQMA 4URQU 1FF2A 2RUGA 4RW9A 4FPIA 3TW0A 3CE8A 2HNYA 1HKAA 4F0KA 1VRTB 4CQ1A 2ASDA 1H98A 4DR6J 4TKTA 1S1TA 3G9CA 4WFXA 3Q8YA 1RTHB 4OHZA 5KFUA 3G71S 4MIAA 2RRBA 3MPUB 2HHTA 1KQFB 2Z2MA 1XN9A 3JTNA 3QMQA 3CCSS 2VPYB 5F3ZA 2KJWA 4N8OA 2FY8A 2JLFA 1S77D 4PYAA 5IM0B 1R8CA 2B5JB 1OWXA 4ZVTB 2DY9A 3CJ5A 1PYTA 2DCUB 4C0OC 5KFQA 2UVVA 4DCOB 5H1SV 5A8KB 2MGZA 4PUOB 1RZMA 5B0BA 4JI7J 2C2EA 2QO3A 1ZM3A 4HTJA 1VR6A 5HI7A 3DRRB 2DH9A 1YVFA 1Z2LA 4KGXB 4ETZA 3FK4A 3K59A 7FDRA 4FDFA 3FUYA 3RR8A 3H25A 2F8MA 3EMTA 4EBCA 4HHJA 1ZAVA 1YJNS 1PBUA 1WELA 2BJ1A 2HVEA 1CPZA 3VHQA 2HURA 2W4DA 3TYTA 2CA9A 3VGUA 4DSIA 5F8LA 4DQIA 4USJC 1VQMS 5CYQA 1C2PA 1A0OB 4AYBD 2G4BA 1UEUA 4DX5A 4RW8A 5IWAJ 1BQNA 3CJKB 4C6AA 5HAOA 1AT1B 4WXWA 3OPKA 1U1NA 2CFXA 3EZ5A 1WG5A 1U8SA 2W4PA 4ED5A 1LW2A 3BGLA 3AB4B 2ZHAA 1N5SA 4ZMMA 2CNOB 2QMXA 2HWTA 5D4PA 2QSWA 2ZKUA 1SH3A 3IM8A 4MFBA 1REGX 2BANA 2IM1A 5KG4A 1HHTP 4GVLA 3ZNUA 3TZXA 4JB8B 4RO0A 2O66A 2OPRA 1HBOB 5L1KA 3LWMA 3DN9A 4KRWA 2GHWA 1WG4A 3BBFA 2JFDA 3SIPB 4X4OA 3M8PB 1CJUB 4X4VA 4PAAA 5IFMA 3PJWA 3OJSA 2HLTA 5LL6d 1D1UA 2A10A 1Q5YA 5HO4A 2OLWA 2W25A 2UXDF 3PIOQ 3AXKA 4Y2IA 3THPA 3MDFA 2CQ2A 1FJCA 4DI6A 3J81U 2XGQA 3FQKA 1VHIA 4URGA 1NJXA 5HQLA 4M1KA 3RBDA 1MG7A 2M52A 2H5IB 3KLFB 5LMUJ 5C24A 4CO4A 4IFYB 2YNGB 2ZH8A 4QYZJ 2YQ3A 1M5SA 4DCJB 4EU0A 2V8DA 3EM1A 4LFAF 1JNRB 1U09A 3R2DJ 2XMTA 1RABB 4ED6A 1C4CA 1HWUA 1SXLA 2MMYA 2DNKA 3CCLS 3R97A 1T3NA 4MFBB 3TAQA 1NNDA 2OPPA 2VG6B 4LRCA 1UP1A 1JLBB 2YQ0A 2YWFA 4WKYA 3BSAA 3ITHA 4NRTA 4B3RF 5K8NA 3QAEA 3GV7B 3HVWA 1SV5B 2DH8A 2YH0A 5M2PA 2MQ8A 2DHGA 1IKVA 2EWHA 1DURA 5KFHA 3M2RB 3EVMA 1JJ4A 4DV0F 1RCXB 2HQ3A 5AXMA 1GTEA 3VGTA 4XO0A 5KFCA 2OO4A 4K2XA 3KDNA 3AD7C 1F1BB 4B9SA 2OEMA 4L72B 2XMWA 4BCAA 5CD4H 1JLQB 2LQ9A 3DRYA 4LF6J 1JLFB 1PIEA 5F9NA 1AXQA 4DV2F 5HLFA 1ZAXA 2VKRA 1LWCA 1RAIB 2RQ4A 1URNA 1S6QA 4R5PB 1RAEB 4LR9A 2DNYA 3DC2A 1RHMB 1SJFA 3CIMA 3HJFA 1U2RA 2MKSA 3W3SA 3PNIA 2V69A 4DR6F 2HSEB 2OUGA 1O8BA 5LSLA 2ZZNA 1WJ9A 3CJ3A 3GJSB 2AMCB 2UXBJ 3CCZA 1KN6A 1CEZA 3W2WA 5KFSA 3O44A 5KT7A 4JYAJ 4L76A 5K20B 4ALZA 2ILZA 3PRDA 3G6YA 4DX8H 4U67Q 2J9EA 4OL8A 3ZZ0A 2JLEA 1KTVA 1RU1A 1AB8A 1H72C 1ZZFA 2XBPA 3KUHA 2Z4PA 4ZVSB 1RT4B 3IMQJ 3LAMA 4OHVA 2AJFE 4M5GA 3OXFA 3V6DB 4JI7F 4I56A 2DR5A 2X51A 5L46A 4TU8A 2IAJA 2RQKA 1YRXA 2P8IA 3L9ZA 1S99A 1YJTA 4KGMA 3A8KA 1JXEA 1Q81T 1HHQA 2AYGA 3BO4A 4P71A 1XWLA 4FYVB 2RMLA 2YKPA 2B0GA 2NZ4A 2AEJA 2WW4A 4DF8A 3H2UB 3GJQB 5D4OA 2XEXA 4K8RA 2YKNB 1RKJA 5CD4A 2LXIA 2F8EX 4QIGA 2OI2A 3GG0A 4A8FA 4CLTA 3TVKA 3HULA 1HR0J 3K58A 2VPXB 1WI6A 1HPZB 5B0CA 3NG8A 3RW6A 1R8HA 5IWAF 4N76A 2EG1A 3DMJB 3MF5A 1VQOS 4ILLA 1B4SA 3KHLA 4K2JA 2MQPA 1FK9B 3DXBA 2FY1A 4ID5B 4JP8A 1G4CA 2OELA 1Y5IB 3FFIA 1RLDA 1P1LA 3IS9B 1U25A 1D9FA 4B9UA 3HVTA 5C42A 4E98A 1NJYA 2E5IA 1P8GA 5HMXA 2VF3A 4FKXA 4TY8A 2A18A 5E3RA 3UR0A 2ASLA 4JI6J 3RGIA 3HVAA 2HHWA 3N28A 2AJ0A 5T7LA 3SCKE 2CUYA 1UJ4A 2EBEA 4Y2CA 2F40A 3JYTA 2LA4A 2XO7A 1VC0A 5LT5A 5HBMB 1IKXA 1RWPB 1HNXJ 1T11A 5HMYA 3KK1B 4DLGA 2RU9A 1YBTA 3DRSB 3MAAA 3P4UB 1F60B 4FYXB 1KQSR 4J9KA 3E2EA 1P6TA 1S12A 5A6WA 2BQ3A 4ZPWR 1TKXA 2I38A 5ETNA 3RAQA 1D3WA 4X4UA 1X9MA 3OD2A 5LMUF 4RUCA 4DS5A 4KJIA 2HWIA 2ILYA 3PW4A 5HROA 1UVLA 2J7WA 1HBNA 3LA0A 1N5TA 1HL6A 4EO6A 2FPHX 2NUHA 4B08A 5K8MA 3BSNA 4UOGA 3RB6A 4QIFA 4AL6A 4F4YA 1GK8A 1AW0A 1IJFB 1TK5A 4NLYA 4HTIA 1LWEA 4ICLA 2HHQA 3RU0A 3DI6B 2PSZA 3A3OB 3CJQA 3OVSA 3HZGA 1S1UA 2ZD1B 2XSFA 2FHKA 3KJVB 5J1NA 3V81B 4HACA 1Q82T 4LFCJ 1Q8LA 2DGXA 2GV1A 1S48A 1VC6A 3T6JA 3AOBA 2DGSA 2QFJA 2CNNB 3DLLQ 3IR5B 4P7TA 1NDKA 2HFZA 4IO9Q 2JVOA 2KRRA 2HVDA 3MM5A 2RJZA 3AAWB 3K89A 5D6GA 2VG5A 1S6PB 3D3CJ 1VQ5S 3DLBA 1S0OA 2E29A 1OS5A 3N5FA 1UL3A 5KG6A 4DX7A 1U2CA 3PEHA 4LF6F 2OEJA 4QYZK 3D5MA 3U02A 2VG7B 1FWKA 1CSJA 2N3LA 1AA1B 4IH5A 2WBMA 1VC5A 1C0TA 4NZ0A 2ATCB 4OZNA 3IWLA 1WKJA 1RWMB 1NK8A 4F04B 2UU9J 2UVWA 1YSJA 1R27B 1X5TA 4JBCA 4Y00A 4HEA9 2ZZTA 2UXBF 4P9SA 2P5VA 3L7OA 3FSIA 3MEDA 4JYAF 1QAIA 1UFKA 4E8UA 1WC4A 2D3UA 1NK0A 4M5MA 3LGHA 3I0SB 3CCES 2MQQA 4N7TA 2ZWPA 3H5YA 4HDGA 4K59A 2VQFJ 1CJKA 3WZ0A 4ITSA 1NLKL 3DXSX 3ZTPA 5LM7E 4I0WA 1TUGB 1X4FA 2J7KA 3CDBA 3US5A 3TWZA 4KO0B 4M8LA 5F8GA 2A1BA 3RAMA 1NPRA 4ZLJA 4XAKA 1TK8A 1UAWA 2GVDB 3K17A 3GR0A 1FFWB 2AJ1A 3OL7A 5LSOA 1AUDA 3QIPA 1TTHB 1QE1B 1CBKA 3PJXA 5D0HA 3HHEA 2FGOA 4PG6A 3LW5C 5A8RA 1O6XA 2QGFB 1OY8A 2M7SA 4DS4A 1BY9A 1NKEA 2I2YA 4RW7A 1NMEB 1HWLA 1RWKB 2D74B 3EX7B 2MKCA 2CJAA 3NGDA 2NUUG 4XTTA 2L3MA 2V4QA 4LSNA 4QIEA 4H4MB 2DNPA 5IOLA 4QWDA 4KKOB 2W9CA 2B7CB 1HR0F 2HZCA 4CO2A 1FNMA 4B3MJ 3ZXWA 2ZNZA 2HQFA 4KV8A 3PIPQ 4C8OA 3FDSA 2AYEA 1JLGB 1OY9A 1FFSB 1VBZA 1BGXT 3W5YA 2KHCA 3OSNA 5AXLA 5A0YA 1W2BR 1RT3A 5DDOC 1VRQC 2CJBA 2U1AA 2CQ4A 3Q24A 3QGHA 1U0SA 1ZTTA 4XPCA 3Q8VA 2ZWOA 3K2YA 1N5YA 3WX8A 2ZUGA 4CRJA 4JI6F 1FXLA 5K8PA 5LJ3Y 2CQ3A 3LAKA 3PXGa 2LEPA 2CZVC 1JLCB 2W7PA 1DTQB 1RXOB 2HQCA 1PYSB 3D6TB 2M8HA 3HXMA 1EZZB 2HWHA 2CJXB 2J0XA 3J7YI 4OYXA 1WUUA 3DM2B 1RLCL 1X60A 4K4TA 4I7FA 4Q5VA 3MCOA 5BXIA 2VJVA 1H74A 1FRKA 3FEYB 4TU9A 2NXCA 1JXLA 1WACA 3NAIA 4DUTA 2VIHA 3BV8A 1XR6A 3P45B 3CSKA 2JVRA 3D9BA 1TL1B 1BQXA 1FERA 4K5RA 4GVBA 2OP5A 4C3LA 1KONA 3RB0A 3EE3A 3S1TA 3G82B 3H90A 2FZCB 5HVHA 1RAGB 4OX6A 2Q6BA 3KTQA 3EGVA 2OTJS 3AXMA 4OLOA 2WRMA 3W5ZA 1DLOA 3J80U 2XWYA 3GIMA 4WBFA 2V68A 1RTZA 1N32J 3GV5B 4WYWA 3HO1A 3K5OA 3TX8A 1Q86T 1VQ9S 5HQ8A 3SSRA 4LFCF 2EKNA 2R4FA 4ZCLA 2RQMA 2BEFA 3GV8B 2YX7A 3CCMS 3MMJA 3HKZD 3EICA 4DN0A 2HZVA 1R7IA 2GNKA 3UO0A 4LRFA 4CCHA 3SDEA 3PCOB 2JOQA 4WWSA 1KHVA 1U1PA 5EN1A 2OSRA 2IY5B 1U0HB 2UV8A 4B02A 3ZZTA 2C2NA 5GADU 2DK2A 2JRSA 2UXCJ 2QTWA 3W8PA 4UTGA 4HI1A 3I0RB 4CT8A 1SQEA 5LOQA 3MR2A 2WVDA 2UU9F 3PHTA 2CADA 2C2KB 4ES1A 1RT2A 3GILA 4QW9A 4ECVA 1K47A 3I82A 4LVNP 3BDPA 4F67A 4B3OB 2DH7A 2M4MA 5FDLA 4ZCIA 3UE2A 1XK8A 2HS0A 1CC8A 1TKTB 2XMMA 4IQMA 1Y5NB 4ZVQB 3D67A 3ENVA 4IH7A 1IQTA 2HIYA 2VQFF 1RJJA 2RS8A 3C15A 1CJVA 1UTAA 2OD4A 4OYMA 2XTJP 3I31A 1H3DA 2AYMA 3IBCB 3CCJS 3MEKA 2OPQA 2F1FA 1RGVA 1MW7A 1XR7A 3HHLD 4C11A 4DR7J 3AB2B 4JV5J 1A9NB 3NWGA 4USIA 3CC2S 5KFTA 3L7UA 2IA0A 1H7XA 3VAJA 4JI2J 1B0VA 1QTMA 3UD5A 2EPIA 3HHLB 4ZIVA 1NB7A 4RNHA 4MK9A 4A8SA 1NM2A 4OJHA 4GKJJ 2MXYA 2O01C 2OPSA 3KK2B 2E1RA 3BJYA 1FVSA 4EEYA 2WVFA 4RW4A 1SKWA 4H4OB 2ZJRQ 1VBYA 3GMGA 1VJWA 2O67A 2DD8S 1PBAA 1H0HB 4B3MF 1HNVA 4IH6A 1U1LA 3KHRA 4FYWB 5LXRA 1UMJA 3QO9A 1X5PA 2NLWA 4ED4A 2GMJA 1JKHB 2EI5A 4Q43A 1RTDA 4DZ6A 1CJTA 2B8PA 4ECZA 3ENWA 5AXKA 5L38A 3LTOA 2WOMA 3RRHA
chains in the Genus database with same CATH topology
4P7VA 3T5KA 3TQ1A 4HT7A 4ZCMA 1RK8A 5M2UA 3BO3A 1MROA 4DV7F 3I56S 4DFPA 2E44A 1RQ0A 3MM8B 4C8YA 4NWBA 4Q0BA 3FQLA 3GIKA 5HMZA 3QZ7A 4O3SA 1R43A 2Q3PA 2DNNA 3M2VB 3WDOA 5EX3A 2VL1A 5DS7A 2FD2A 3OR2B 5FLXY 3O5TB 1IN0A 1I6JA 4NZ7A 5JUMA 4FBUA 3IFEA 1ROFA 3OXGA 3F41A 2J9DE 3AH6A 2BE2B 1JLQA 1OPIA 2NYIA 3OTEA 5DLGA 2R7UA 4DLEA 2Y0SD 3PW5A 1KFDA 1L3SA 3MM5B 5F8MA 3LQVA 1YRUA 3UFCX 5KFBA 2CQCA 1JLFA 2QEXS 4ZHRA 1LK7A 2P9GA 2IMWP 2DT9A 3JSMA 3T3FA 2EKYA 3RAXA 1S72S 2VG5B 4KHPF 4O3RA 2KM8C 4K4VA 2W7AA 4DSJA 5KG2A 4CTAB 3SSSA 2GQCA 2DGQA 3GIIA 1LWFA 3M32B 5KFWA 4QYRA 1B7FA 1JJHA 2PEHA 2FVCA 1OQ3A 5BYQA 1LV5A 4YOEA 2LQ5A 4R5PA 4QWAA 4DSFA 2C3UA 1S9FA 1RTJA 1KD1T 2V4RA 4I6YA 2IYGA 5JXSA 5KFZA 3VTIA 4FVMA 2J9CA 3R3TA 4QBUA 3DLJA 1UVMA 4K50A 2E5JA 4WU2A 2EK1A 2DNMA 5T14A 1M90T 1APSA 3OHBA 4AXIA 1S1WA 1S1XB 4BC7A 3SQGA 5C25A 4DL5A 1HQEB 4DL6A 1FE4A 2JHEA 2KN4A 3M6VA 1M5HA 5D77A 4DL4A 4KBIA 4WIIA 5E33A 1XTZA 2AW0A 1C0TB 1N56A 1WI8A 3FNNA 5F8NA 5KT5A 2KRBA 4RNOA 3PEJA 4TLQA 4FF2A 3EZUA 1N8RT 3O6QA 2FHJA 4ZKAA 5IS2A 2MZJA 1EETB 4PXDA 4XPEA 3QJLA 4KFBB 4PQAA 3MAQA 2CPXA 3LUYA 4KGKA 3KFWX 4A8KA 3EYZA 1HD1A 3N4WA 5DQHA 2BXJA 2BJDA 4FVCA 2IVFB 5DG8A 2VV5A 2DHXA 3N0VA 5FD1A 3PFOA 3PFEA 5DGBA 3R1LA 2LDIA 5J2PB 2RVJA 2VA2A 2EK6A 2MJNA 3D54A 1N88A 2RD5C 1O51A 5KOWA 5DGAA 2D1CA 3CC7S 2N7YA 2DNZA 2VBZA 4I1TA 3MEDB 2ZVSA 3GFXA 3I4HX 1RT4A 2GMHA 3OFHA 2K3IA 4WJBA 3HPOA 4N5SA 1N32F 3MFIA 2Z2LA 4Q0BB 1T94A 2B56A 2FJAB 4OI4A 4Q2LA 4AE5A 3OSPA 2GC8A 3KLHB 2IVYA 4PG7A 3V6DA 4LF9F 3R5BA 2UUAF 1H2VZ 3I9V9 2IBOA 3K0JA 4QU7A 2LKZA 3DCAA 2VH7A 2YWEA 5C5JA 5BJRA 1FNXH 1YTYA 4YR3A 1N48A 1U24A 4ELUA 3NNAA 3PRBA 2NQPA 4OI1A 5E5NA 1Y7PA 4QR1A 1CVJA 1HW8A 3HP6A 1SBRA 1CC7A 5F8JA 2LLZA 3AJ2A 3G86A 5DM7Q 4IDKB 3P3DA 5F8HA 1U48A 3BB5A 1HQUA 5K9FA 4JV0A 2ZH3A 3Q2TC 4ZA1A 4YP3A 1M5OC 4WFYA 1JLEB 1IR0A 3M9OB 3T1YF 2C22A 1X4CA 2ATLA 1Q53A 2ZH7A 3GG1A 4PWDB 4DWIA 1JLAA 5EHHA 3PR4A 3DYAA 3EGNA 4ECXA 3MOZA 1IBMF 1X8DA 3BEGB 1Q1KA 3OTOF 1UEVA 1YJVA 3UDCA 2ZC4A 2QSFA 3QIPB 3V2UC 4FF3A 4DQPA 1FRHA 3BS9A 5D4LA 2Y1RI 4RW6B 4FNIA 4W90B 3LGMA 2HVHA 2R8JA 3GE9A 3AQOA 2EFNA 2AGPA 5A8RB 5CCMA 4WTYA 3HK2A 2YKNA 3D0HE 4LUBA 2ZKTA 3FMWA 2BRLA 2Q1LA 3H2VE 4TYBA 3PX6A 3KMQA 4MH8A 4JI1F 2WSEC 4TN2A 3MEEA 1HYSB 2BYCA 4L6V3 4RW7B 5KFXA 4F4XA 2XLKA 3T1HF 3BGRA 2MHEA 3GSDA 2J76E 4IG0A 2IMOA 4QW8A 4ZK7M 4C8MA 1T02A 4Y34A 2E1AA 1HWKA 2K3KA 2YWGA 2UXCF 5KG1A 3I5BA 3FZBA 3KWMA 1T3OA 4QR2A 1VLYA 3MM6A 5IQQA 1HA1A 1TQLA 3IR6B 4NLDA 4OI0A 2VOPA 1HPZA 2V8HA 3MMCA 2UV8G 1Y3KA 3T19A 3OVAA 3J7Z5 3DMJA 2AX1A 2A3JA 3JTOA 3TAPA 4JI3F 4DG1B 2FJDB 3TANA 4LSNB 4NA1A 1GXLA 3NCQA 2JEFA 2WW8A 4LVOP 4URSA 3SV3A 3M8QB 1V6HA 1FK9A 3POTB 3S01A 2M70A 3BQ1A 4B3SF 4J9MA 1C0UB 2W9CB 3OR1B 2DGUA 4ID5A 3TOQA 1XMQF 2OJ3A 3CO9A 5L8RC 4UY8T 1HBMA 2RE1A 2KDOA 1UJ5A 5EWEA 4DQSA 2VFSA 5A8WB 3RTVA 2DJWA 2JDJA 3J7A1 3CTRA 5GAHU 1MU2B 2B6AB 3EUNA 2DTJA 2OH2A 5KFKA 2DGTA 3BREA 2VBXA 4W92B 2C42A 2COLA 2POKA 1UVKA 1SUQA 2CRLA 5FJ4A 4KV8B 3C6UB 3ZZUA 1M5KC 1GH8A 3V6JA 3BN4A 3VAKA 2HHVA 4U9RA 3IS9A 3NS5A 1FKAF 3CD7A 2HPUA 3R1HA 2XMVA 1TK0A 1NRKA 3GR1A 2BABA 1X4DA 3G8QA 2C2DA 4DR4F 2B9XA 1Z1ZA 2VB6A 3SFUA 2J6SA 3H59A 5D3GA 2YNHB 4OZ0A 2ZH2A 4A8WA 2JC0A 3BM7A 4X84A 4DR1F 2OAUA 1YIJS 2E7XA 1RT6B 5GAHI 5A0YB 1RT3B 5E7OB 3JB9k 2MPUA 1SIWB 3I87A 2WB1D 2FVPA 1Q7LB 5J2MA 2M9KA 2DGVA 2LU1A 3IO1A 5CYMA 3W7BA 2HMIA 1X4EA 2EFPA 4F3QA 1C1CA 4WFNQ 3CCQS 1UWBA 4HL9A 3S7RA 4YDDB 1OPZA 3PX4A 4O4RA 3VZIA 5B0DA 2DO4A 4EZ9A 4NCBA 3DYAB 5KFNA 3LP1A 5I3UA 3GIJA 4WE1B 2ADCA 4RUAA 5G4DA 3NKYA 2EW9A 2QA2A 2CPIA 2HS4A 3AJ1A 2R7RA 3KK3B 4DF4A 2B4OA 1N5YB 4K4YA 4C9DA 4HKQA 2GO9A 1RT7B 4I67A 2DNLA 1HI0P 1TL3A 5DO2A 2OKQA 3MMBA 2BM1A 1U1RA 1IKWA 2NXUA 5HBMA 2X1FA 2ALZA 2E5LF 5KFMA 3UNGC 4C8NA 1ZH5A 3KK1A 1DTTA 2XGPA 2QYCA 5E2QA 1FKPA 3DRXA 4XDCA 5B09A 4KIAA 1S1VA 3DRSA 4NOHA 3QLHA 1Q7YT 1L5UA 2GGPB 5JVHQ 2XCAA 4ECTA 1YJWS 5I42B 4X4TA 1W2IA 4DR7F 3AA8A 3RYLA 4JV5F 4FS1A 4R25A 2KG1A 3I6PA 4AUKA 2MKIA 3DLKA 2BOPA 1WNEA 3X3UA 1J5OB 3L95X 1IKYA 4LT6A 2IJNA 4NLUA 4O44A 3VAHA 2R7QA 4JI2F 3SMZA 2XMJA 4G1PA 2E5HA 4QU6A 2R2TA 2ZE2B 4PRFA 1REVA 2MB0B 2GO8A 2HHUA 3MTKA 4MK7A 4B9VA 2KYZA 1RTIB 2D9OA 2K1RA 2GX8A 2IFXA 2ACYA 4I7FB 4ECWA 2MSSA 3PX0A 4QIVA 4GO5X 1NHVA 1H2UX 3MPYA 4URQU 4CO1A 1FF2A 2RUGA 5SUHA 4ED0A 2PFFB 4RW9A 2KFYA 4GKJF 4P6QA 1VQ7S 2PI4A 3D1HA 3H4BA 1FDAA 2HFNA 3GFYA 3NBPA 3N6MA 3TW0A 3CE8A 2B9YA 2HNYA 4RBVA 1VRTB 1TP7A 2DPIA 1NH7A 4CQ1A 2ASDA 4NX9A 1H98A 3K5LA 1KVIA 3O2IA 2HS3A 4TKTA 1NK4A 1S1TA 3G9CA 4WFXA 3SEOA 3D2WA 6FD1A 3N5BA 3ZZPA 2KYXA 4K4ZA 2CJKA 2JEGA 2OD6A 3J81Y 4J9LA 1RTHB 4B9NA 2YKMA 4OHZA 3THTA 1M5VC 2MQOA 4YB7A 5KFUA 2KU7A 3KLIA 4LSLA 2NPIA 4K4UA 5G0RB 3GB0A 3G71S 4ED3A 5EWGA 1FHTA 3M05A 4MIAA 2XS7A 1LW0B 4EWTA 2RRBA 3LGNA 1AFIA 2HHTA 3HDSA 1KQFB 2YWKA 4NL5A 5J2MB 3H5SA 2KG0A 1T05B 3DI6A 1V3ZA 1FVQA 1X4BA 2Z2MA 1XN9A 1C1CB 3MPVA 3JTNA 4OHWA 3QMQA 3ONQA 4RBUA 3CCSS 5KTQA 2VPYB 3RW7A 1G1XA 2XG8A 5F3ZA 2KJWA 3H5UA 3I32A 1CG2A 4B17A 4N8OA 4DV6F 2KJVA 2ZHBA 1DLOB 2JLFA 1EP4A 5HP1B 4G1QB 1VQLS 1S77D 2ZD1A 2QZ8A 1KTQA 4U7UK 5IM0B 1R8CA 4YB1P 3KJVA 2B5JB 2FLPA 1OWXA 3EGZA 3V81A 3CGIA 1QJHA 1GX5A 3CJ5A 1UW4A 4Q2MA 4N56A 3UD3P 1YG0A 3G6XA 5LSRA 2DCUB 3CDWA 4UW2A 1PGZA 1LXJA 5D8HB 3QZ8A 4C0OC 3TUIC 3MUVP 2KT3A 2LU2A 4A46A 5KFQA 3U1LA 2UVVA 5H1SV 5A8KB 2BUNA 2MGZA 2L41A 2IBKA 4PUOB 1SJ3P 3MEGA 5B0BA 5L1LA 4DL2A 3ZZYA 2C2EA 2QO3A 1RT5A 1ZM3A 1E6VB 4HTJA 2CQ1A 5F0WA 1VHFA 3O3LA 2EFGA 2J6UA 5HI7A 4X4NA 3DRRB 2ZNYA 2V0NA 2ZJPQ 3NNCA 2OFHX 4JV2A 2P6SA 2DH9A 5DRKA 1YVFA 1R0AB 1Z2LA 2DIVA 3WBZA 1S6PA 4ETZA 1NKCA 4PXCA 2J0SD 4ETXA 3K59A 1D8YA 2N3OA 1U2FA 3MR3A 3PDNA 7FDRA 2IM3A 1FT8A 3ZZOA 2V5HG 3UWTA 4ZS6A 4BBYA 4NA2A 1NHUA 3RR8A 2AD9A 3H25A 4CH1A 2F8MA 3M6UA 1L3KA 2KH9A 5KG5A 4EBCA 4HHJA 1ZAVA 1R8PA 3SDEB 4I2QB 5KFJA 4K4WA 4F3OA 3TAMB 1P9QC 2VC1A 2YX1A 1KLMA 1YJNS 1WELA 4H54A 2VG7A 2JC1A 1U6ZA 4A4JA 1VQNS 3M30A 1CPZA 3MAHA 4HYKA 4TQSA 1VMBA 3TUZC 2W4DA 3FEXB 2W4CA 4HVZA 2XCPA 1P27B 2KKHA 3TYTA 1FRLA 3MM7B 3IRXB 4Q45A 4PR6A 4FYDA 1UVNA 2HNZA 3PVXA 3NMAA 3OUYA 1HNZF 4DSIA 5DG9A 5F8LA 5AE1A 2OMOA 3JAMY 2M5YA 4DQIA 4USJC 1TV6A 4OV1A 2ZITA 2DHSA 4WYLA 1C2PA 3MECA 5CYQA 1VQMS 3T5LA 2CPHA 1HMVA 3TVZA 4U7CA 4AYBD 5E41A 1K1SA 5CA5A 2G4BA 1UEUA 4NLTA 2Y1JA 1RISA 2CQPA 4RW8A 3VZHA 3TO8A 3CT9A 4NLPA 2CJ9A 4C8KA 1LOUA 3UPFA 1N4LA 1BQNA 3CJKB 2ZC3A 1QY7A 1NZAA 1OSDA 2Q43A 1TR0A 3PY8A 1PO6A 2XY5A 2JSXA 4WFZA 3Q8PB 3SI8A 1H6KX 4PXBA 4WXWA 3IAS9 5JVGQ 4IOBA 4KB7A 3W2VB 3OPKA 4I64A 2IA6A 1U1NA 4B9TA 2RIJA 2CFXA 3EZ5A 2L08A 4D3GA 1U4BA 3VR1A 5H9FJ 1X5OA 1RT2B 1DAXA 2IVMA 1FJEB 4J9QA 1WG5A 2HAIA 3I0SA 1U8SA 2W4PA 2EFOA 2QIFA 4OMFG 1N36F 3FRZA 4ED5A 1WHYA 3M1VA 1LW2A 3BGLA 3AB4B 2ZHAA 4NLVA 1FRIA 5FDLB 5K14A 4KAIA 1UJ6A 1Y3JA 1N5SA 4ZMMA 2VKZG 5GAGI 2QMXA 3SYZA 4PQUA 1B0TA 2HWTA 5D4PA 2QSWA 2HNDA 1S9EA 2CPEA 5H9EJ 2ZKUA 3TP2A 3LH2S 3R27A 2CQHA 5IT4A 2R9LA 4FBTA 1SH3A 2PT0A 4KO0A 4X66F 3M9MB 2VASA 3NLCA 5J2NB 4MFBA 3ZC4A 2W8LA 2BANA 2QT7A 2IM1A 1CQMA 5B0GA 5KG4A 4OZJA 5L1JA 1HHTP 3P6YC 1B64A 2VFVA 2NSBA 3LP2A 1D9DA 4NPOA 2V4JA 2N4CA 2O66A 2OPRA 1HBOB 4LIWA 2DGWA 4IKAA 5L1KA 4DR2F 1QSLA 3LWMA 3H8YA 3DN9A 3FJ2A 2WCXA 4KRWA 4ECSA 2FHMA 2GHWA 1WG4A 2RB7A 3T6BA 2JFDA 1QE1A 3EGWB 4X4OA 3M8PB 1KNZA 3KYLA 4X4VA 1QUVA 5IFMA 3PJWA 1WHVA 3OJSA 2HLTA 2V9WA 4LF4F 5LL6d 1VK8A 2QMWA 1D1UA 1NAQA 2A10A 3BSCA 2OPQB 5HO4A 3PM9A 4M5DA 3L09A 2OLWA 4R8UA 2W25A 4YDXA 3HHNB 2UXDF 4NYZA 3K8WA 3PIOQ 3KMSA 1YRTA 1T8EA 2LMIA 2W24A 4A48A 4Y2IA 3THPA 4C11B 3MDFA 4R0EA 3DU5A 2Z8QA 3SXLA 5J2QB 2CQ2A 2B43A 1FJCA 4DQQA 3AA9A 1R89A 3Q2SC 1UETA 1MWZA 1S9GA 1SB6A 2WONA 2MQLA 1R6YA 2XGQA 4GC6A 3SSQA 1N6QA 3FQKA 2VA3A 4URGA 3CULA 1NJXA 3I5AA 1HNIB 2AV5A 2RDJA 4JV1A 4M1KA 3UD4P 3RBDA 1BQMB 4C3KA 3P96A 4H4MA 2LYVA 5BYRA 2M52A 1T03B 2BDPA 3B82A 3KLFB 4C97A 1RT1A 1I1GA 5EWFA 3OVBA 5C24A 3HZEA 4IFYB 4CO4A 5CXTA 4KKOA 2XY6A 4DV3F 3N9UC 2YNGB 2ZH8A 5I4MA 2YH1A 4QYZJ 2HG4A 1Y4ZB 2YQ3A 1M5SA 1D8ZA 4MJKA 2E9RX 3QGGA 1Z4UA 4CNYA 2K8GA 4EU0A 1C1BB 4K5SA 2V8DA 2OPSB 4RBTA 4LFAF 1E6YA 3KLEB 3DLHA 3DLEB 4PG8A 1JNRB 4ELTA 1U09A 1V3RA 3TA0A 3IG1B 4FNHA 3GQCA 1FKOA 4F02A 1GAOA 3BN7A 1A7GE 2XMTA 4ED6A 1C4CA 2LEAA 4I2PB 1HWUA 4MYTA 4HLBA 2P9CA 1JLGA 4PQUB 4RW4B 3NL0A 1SXLA 4FXDA 2HNDB 2MMYA 2DNKA 5SZTA 3U1MA 2IYIA 3CCLS 2N4DA 5CZVA 2LA6A 2GJIA 2D9PA 4GC7A 2FTRA 3BQ2A 4KQZA 1T3NA 2M2BA 1WF2A 3F73A 3OFFA 4MFBB 4KC5A 1GXUA 3NGKA 2QE5A 3TAQA 1S10A 1QAJA 1NK5A 1BC6A 1NNDA 2OPPA 2VG6B 3OTCA 3SFGA 2HHHF 2B4UA 2DNGA 1UP1A 3OL8A 2IM0A 1JLBB 2C2RA 2YWFA