3J7YI

Structure of the large ribosomal subunit from human mitochondria
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
158
Chain Sequence
SKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQGFINYSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 158
sequence length 168
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j7yI00
3A1YG 4NWBA 5GAEI 1ZAVA 3J7Z5 4UY85 3JSYA 3J7YI 2QA4G 5D8HB 5GADI 5GAGI 5GAHI 5D6GA 1ZAXA 1ZAWA 4V19J
chains in the Genus database with same CATH superfamily
4M5DB 1D9FA 2IIHA 4X2BA 4U7CA 2UXCF 1ZH5A 1N52B 2HWIA 1HQEA 5A8RB 4EK2A 2GZOA 4RUHA 2I9SA 5DS7A 3NWGA 2KTQA 1U1RA 3DGPA 2ZOGA 4EI2A 3KMSA 1K1SA 4HT7A 3CJ2A 4F04B 4Y65A 3GR0A 2VBYA 1NMEB 4PWDB 4UQGA 1RAOA 3GFXA 1SQEA 3DRPB 3H4BA 1S0NA 2EVZA 1EETB 3LAKA 1ZA1B 5DLFA 2V4JB 2PO4A 5C42B 1RACB 5KFLA 2BW2A 1HYSA 1FA0A 3GLJA 3I87A 3MMAA 3ENAA 1RWVB 3SCIE 3UDVA 4R5PB 5ETTA 3KLGB 4X84A 4LFCF 2BRLA 3W9IA 3HXMA 3UNGC 3L9ZA 1N0VC 1M0SA 3HPOA 2MQOA 2BDPA 1X5PA 4NCBA 1S49A 4YOEA 3E8OA 1F5BA 4QWCA 5JMNA 1CC8A 1I3OB 4KQZA 4NLGA 5HJXA 1OPIA 1NK8A 2OAUA 3H40A 1L3UA 5LSRA 1TKXA 2QLBB 3Q8RB 1WUUA 2R2UA 1KFDA 1YRXA 2Z58B 5I3QA 5J2NB 1BLUA 1AFJA 4ZVFA 1K0VA 1YGYA 1KC8T 4OX8A 3J7YI 2AYGA 4ZVUB 1R27B 1VJQA 1KS2A 3N28A 4DV4F 5K20B 4CLYA 2V9WA 4PKDB 5A6WA 1VK3A 2GX8A 4TU9A 1NZ8A 4CWBA 2XGPA 4C3MA 5U47A 2R7XA 2VZ9A 3HHNB 2HHSA 2DITA 1Q95G 4CTAA 4MYUA 3W2VA 5I3UB 3RRKA 5J2PB 3A4TA 2A18A 1CC7A 1OY9A 2YY3A 2JDJA 1QAIA 1UCNA 4LF9J 2HFZA 4PG4A 4GC7A 4DEZA 1PJ5A 3DLKB 3W7BA 5LSOA 2B9EA 2HPUA 2XMVA 4FXVA 4WE1B 2MQ8A 3VAJA 4C8KA 3I82A 4CNZA 2VBXA 4X4QA 1VQ9S 4C0HA 3QWPA 3AQOA 4X62J 5CD4H 5LMNF 2MQMA 4F8RA 3BREA 1AW0A 4OMFG 3BEGB 2VC0A 3TUZC 2Y8WA 3ISZA 2E1RA 2CXEA 4ZLLA 1SH2A 3DHXA 2GJFA 4P72A 5CD4A 1QDUB 3MPWA 1PAUB 2MZSA 5DDPC 1QSLA 4I64A 4KY3A 2PFDA 3W5YA 2NYHA 4C11A 2FJVA 1SJ1A 3VGSA 1D8ZA 5THWA 2E9ZA 1LWFA 4RW6A 2GAHC 3N6LA 4DPYA 2IM2A 5KFAA 2B6AA 2HGLA 5KFHA 4Q8EA 3AH6A 3D5MA 1QAYA 2GGPA 1CS4A 4PXDA 3AD7C 3MAHA 4YB6A 1MN7A 3IP0A 3EGZA 3BKTA 5F3TA 2OPSB 1VCTA 2B8QA 2B43A 1AXQA 4CCHA 1LW2B 1HNXJ 4W4MA 3WX8A 2IJNA 3NGSA 1E6YB 1YRTA 4FKXA 3O44A 4MKYA 3HO1A 5IM0B 4DSJA 2YKPA 1VYAA 1U45A 4J9QA 5F9NA 5KFWA 3PO5A 2JFDA 4MIAA 2W4DA 4JOUA 2RU9A 4OZ1A 3R7BB 4KHRA 2C2OB 2AWZA 1H38A 1XIQA 1TKZA 4ALZA 2FLNA 2EBEA 3OR2B 2B4PA 4DFMA 4ZP8A 2HEKA 5KFRA 3I5AA 2RRAA 4FP9A 1KQKA 2FYXA 2QC3A 2JEIA 4X4PA 5HATA 4RW9B 3V81A 3FQKA 3DOLA 3JQJA 3CCRS 1T9TA 2DRBA 2F63A 3Q2SC 3MZIA 2ALZA 1R8BA 2VASA 2YNGB 3MM7B 2EG2A 6FD1A 4NEZA 3CJ8A 1S1XB 5KAKA 1T94A 3LALA 2VL1A 1ZETA 3IXQA 5IQQA 1BD6A 3KK2A 2W24A 1VK8A 2YWHA 2OSQA 4JB8B 3WDOA 4WZMA 4N47A 2YWGA 4ID5B 1PSDA 3FKBA 4ZITA 4IH6A 4B9MA 4JYAF 1XWLA 4ED3A 2HNDA 3EPIA 3AJDA 4KO0A 1B0VA 3NY0A 3DNCA 2QO3A 3RZAA 4QW9A 4RUCA 3RBEA 5F8JA 2DKOB 4B3RJ 1RADB 5EGYA 2OPRB 2QFIA 3DYAB 2ZWPA 3RW6A 2ZNYA 4ICLA 5M2RA 2WB4A 2CKWA 5KFVA 2RUSA 1R0CB 2YNIB 2GO9A 3R6LB 1NUEA 3ILOA 4R25A 4OZNA 4U7UK 5I3PA 1RU1A 4GKJJ 4P71A 1P9QC 1XN9A 5D4PA 3ZZRA 5KOWA 1WSVA 3C2PA 2E1AA 1QAJA 5MAOA 4JI3J 4EU0A 2ZUAA 5B0CA 2ZKUA 1DURA 3KYLA 1BQMA 3W5XA 1DFDA 2UUAF 2LP4A 2AHOB 2GIRA 5KFJA 2R7SA 3MCOA 3CO9A 4OZ3A 5LM7E 4DG1A 2L3MA 1CQMA 3CTRA 2DCUB 5D77A 4TLQA 4BC7A 1S9EA 1NSKL 2QX0A 2UXDF 3VVTA 2ATLA 2ROGA 3UFCX 2D9OA 4HACA 5T7LA 5B0AA 3DOMA 2WVCA 5EWEA 1HNZF 5E2QA 2AX0A 2V9KA 3CCUS 2PMWA 1GH8A 1NK0A 1FWKA 4LIRA 1S6QA 2HQDA 5KFOA 1IBLJ 4A8WA 2HMIA 3GIMA 4WBFA 4FS2A 4RW4A 4DFPA 4GVBB 1UA1A 4DXLA 4ED1A 1H3DA 4K59A 1T9UA 3JSMA 5D3GA 3DDIA 4LVOP 3GYGA 3ITHB 3CW2C 4DPWA 3NNCA 1N5SA 3FCVA 4EWTA 2B3TB 5FD1A 5GAEU 5G0RA 3I0SB 3CCQS 1REGX 3AD9C 4C98A 1P9YA 5BR8J 1GMUA 5D78A 1O6XA 2RSQA 5I42A 2KH9A 2O1PA 3D7SB 2XI2A 1KTVA 5D0EA 4ZPCA 1PG5B 4OQJA 3MM9B 4DUZJ 4PQAA 1LW0A 3AXKA 1JNRB 2HHHJ 2Z30B 2IRXA 1BXNA 2BW7A 1A7GE 2BE2A 3FVYA 2NZCA 1NK4A 2YXLA 3MM6A 2Z56B 2YQ0A 1S12A 2QLXA 2BKPA 2WSEC 3OLAA 2QN6B 1OPZA 2FGCA 3EUNA 3X1LB 4DX7A 4F25A 3W64A 2B0GA 4O3RA 2F8EX 2XHCA 4MYTA 3H2UB 1HI0P 5CZVA 1TL3B 1VJWA 2BJ8A 3TA0A 3SXLA 2HWTA 1NCLA 4PG6A 2R7TA 1U26A 3SEOA 1T02A 1D09B 4HHUA 3NMAA 5L8RC 3LWMA 1NPKA 3CMAS 1KNZA 1TMJA 2CZ9A 3Q89A 4TKTA 5K8NA 2OIHA 4ED8A 5IC4B 3W2WB 2MKIA 2NSCA 1S48A 4FDFA 3UPFA 2ZNZA 5T41A 4RPFA 3QRQA 4V1Ak 5C24B 1F3VA 2ASDA 3GU0A 4WP8A 2J5AA 4QIEA 2OEJA 1G4CA 5LSLA 2XMMA 1UVIA 1SKRA 1NM2A 5B0BA 3SZ2A 4LBPA 2VBZA 2ABYA 1ELOA 1KKHA 3HFVA 5A8WB 2GHPA 2OO4A 3NS5A 1EARA 4MFBB 3CC7S 3EZ5A 2YX4A 1N34J 1LXJA 1FK9A 1VHFA 2CJ9A 3MEGA 2DNPA 1MROB 2DNMA 3VZIA 3DXBA 1VQ5S 3PHEA 3PKYA 4NLDA 3RGIA 2CUYA 1DHMA 1RWOB 5KFNA 2VBWA 3CUNA 4YHHJ 3VHQA 1T95A 3PW2A 2I5JA 4CQ1A 1WC3A 2J0QD 3O5TB 4XPEA 3BPSP 3I31A 4JV5F 3TEHB 2FGOA 2M52A 5J1EB 5SZTA 4DDFA 3UD5A 1A0OB 5HL7Q 5H9EK 5GAHI 3AAWB 4RL1A 3A8EA 4RBTA 3MEKA 2QJ3A 5KT2A 2F5GA 1HBNA 2Z2MA 5LOQA 1LK5A 2RHSB 3HSDA 4PPZA 4DZDA 3WQPA 3GJQB 5CZXA 2QTWA 2RRNA 1XMOJ 2KFZA 3K5PA 4ZLPA 1HMVA 3BBBA 1N6QB 1URNA 2XEXA 4M5LA 4C3LA 1WG5A 1JJ4A 2KT2A 4WPAA 3OVSA 1AUDA 1T7PA 1NK7A 3EICA 5CXTA 4U8VA 1FFSB 1DTTB 4A8SA 2BOPA 2EFPA 4BWJA 1EJ7L 2LQJA 1FKPB 2GAGC 3BGLA 1RT1B 4B9TA 4ZVPB 2AEMA 2SXLA 2JLFA 1U8SA 3LF0A 2W2OP 3HULA 4F4XA 1VQNS 2R7QA 3GFHA 3G96A 2E1CA 3CCTA 4BHQA 1PAEX 1P6TA 1F9HA 2AJ1A 3NGDA 3GTYX 1LV5A 1KRPA 1UEUA 2IY5B 3QO9A 3ZZ0A 1TVRA 3C16A 6AT1B 2UXBJ 5ETVA 2GQQA 3BDEA 5DLGA 2DNLA 2FHJD 2GVDA 1N54B 3ILIA 4DUYJ 1TK0A 5HO4A 5DM7Q 2BE7D 3QZ7A 3OL6A 3V4IA 1PYOB 4L74A 1R3NA 4ILMA 3FCWA 3T6BA 2ZOMA 1MLAA 5DETA 1UVMA 1UW9A 1YRUA 4QWAA 3PW5A 3HHLD 2XYHB 1OS5A 3AD8C 1X0FA 2AIRB 2DNOA 5E3AA 1JQGA 1JMTA 4DHVA 2AEFA 4PWUA 2EC0A 4YP3A 1EP4B 4DL3A 2AJFE 4NXMJ 3D4JA 2A6OA 3EGWB 1S1WA 4KH1B 2DHHA 1U0HB 3KLVA 3TARA 1HWLA 5E41A 2VV5A 1S1VB 5F8IA 2ZWOA 1S0OA 4DR4F 2DPIA 2AX1A 3MPYA 2XLIA 3QSIA 3PIPQ 1W2BR 3C46A 4K4YA 2HZAA 3MOZA 3MUMP 2XZTB 3TO8A 4YB1P 5E7OB 4LF5F 3PM9A 3TAMA 2RQMA 3I56S 1PYSB 3IRXB 4PYAA 1VBXA 2E9RX 4LBIA 4JV2A 2BX6A 1Q8LA 3IG1A 4P7TA 3R7NB 1YTYA 4X64J 4U96A 2MJUA 2V8VA 4ZVQB 2MZQA 2UP1A 4PEOA 4JI0J 1JLEA 2FJAB 2V8DA 4A8FA 1NH8A 1O0PA 4B9VA 4P2XA 4ZN3A 3RBZA 1F60B 3CD0A 4L3KA 2DR7A 1PGZA 1W2IA 2J7KA 3QT5A 1BHNA 5M2UA 1N36F 2D3OR 3MECB 3ZTQA 4B9SA 4TNOA 4EGLA 1UTAA 2M2BA 1SIWB 2ZHAA 1U7LA 1OO0B 2IPOB 1S76D 4ES3A 4LSLB 4CNYA 4WIQA 5JUMA 2BQRA 3HHKA 1XJWB 3ZZZA 2V68A 3KOAA 1TU0B 4ZDNA 3LA0A 3KHHA 3FBEA 3PRDA 4ED0A 4X4VA 1KLNA 3MFHA 1R89A 1FF2A 2VF3A 3HF5A 1KONA 1X4EA 3DN9A 1S1TA 2G4BA 3M2UB 5AXMA 4KFBA 2PMZD 4DR7J 1XEZA 4B9LA 4K0KJ 1IR2A 2XSJB 1LOUA 2F1FA 3LANA 1RA6A 3WZ0A 2WSFC 3R1HA 2VHGA 3FBBA 2XY5A 5IT4A 1WC6A 2C2RA 3FDSA 4QBUA 2HBZB 1QUVA 3K8WA 1HHQA 3FJ2A 4N77A 3M8SA 3ENQA 4CYUB 3GR1A 3M8ZA 4RO0A 4FF3A 2W1BA 2CJXB 2FHJA 4JI5J 3EJMA 5D4OA 2VU5A 4LRDA 1GTEA 2GS8A 1HBUA 2GW8A 2P2CB 4LFAJ 4IOAQ 1SXLA 2ZH8A 1RQ0A 2AJ0A 4ZVOB 4XPCA 5A0YA 1IR0A 3FFIA 2QMWA 2RE1A 4DR5F 4H4MB 1R7IA 4HVZA 2P5VA 4NCGB 4YY3J 3HHLA 4KV8B 3ZO7A 4E8UA 4USHA 1TK8A 2UV8G 5LMUF 3DRRA 2CPEA 4P9SA 3SFUA 2I2YA 1L3TA 5CYJA 3Q8SB 4DR6F 2FB0A 1X7VA 1VHIA 2KDOA 2Z4PA 1S0MA 1MG7A 1S4FA 3MAQA 5GMKa 4NA1A 1F2HA 3HP6A 2PEHA 4LF8F 5C5JA 1J5OB 1FRMA 1U1KA 4F3QA 3SBMA 3OPKA 2HNYA 1YK9A 1C0UB 5ETQA 2CA9A 3VF0B 1RTIA 4NE9C 2JC1A 2J0XA 3C15B 1N5TA 1X5TA 2AD9A 3VQSA 4EYIB 2EK6A 2YPZA 4M5NA 3RB4A 1SKUB 3MM8A 4DV5J 1C1CB 2QG9B 3OTBA 4OX6A 3LP1A 2CQCA 3NBPA 3TQEA 2RD5C 2X1FA 3ISNC 4X4UA 3WHIA 3C8YA 3KK3A 4ED4A 4YB7A 3OSPA 1CJTB 2H4WB 3IM8A 1NDKA 2EXUA 2QLWA 2WONB 3B54A 3Q0AA 2F7VA 2DGUA 1EKSA 3CJ3A 1A9NB 2VA3A 4A8QA 1BWVA 4RW8A 3V6KA 3QGIA 2QA1A 4DV6J 3BR8A 2ZITA 2B5JA 3K0JA 3HKZD 1YJTA 4C3KA 5CYQA 1IBKJ 2RNEA 3F73A 2J8SA 2Z2LA 1WELA 4IDKA 1N33J 2VQEF 2HGNA 1IKVB 4I2PB 4K4VA 1IUJA 2QMXA 5BYQA 2V63A 2RQ4A 2DB1A 2WBRA 1S10A 2DGSA 1Q82T 2P8IA 3RR8A 2J9DE 2K8GA 3ONQA 3BYRA 4JUZA 3NGTA 1T3NA 5L1IA 2QRRA 4HHHA 1UJ6A 2VJVA 1C0TA 1RT3A 3HVTA 3M6VA 3UN2A 3BYPA 2E5LJ 4WFZA 3CJ5A 4ZHRB 4LF4F 5KFKA 1SKSA 2XMKA 3MTJA 5B09A 3LH2S 2CJYB 3M8PB 2CWKA 2UU9F 3JTOA 4N56A 2B9XA 2YNHA 1P1LA 1NNDA 2E1MC 1Q1KA 3OLBA 2VG7A 1WWHA 2K1RA 2H5JB 2Y9HA 4KHPJ 2OEMA 4CLZA 3OTEA 1RWXB 4QU7A 2FZKB 3R5AA 3J81Y 2POKA 5KT7A 4ETZA 2A2DA 3DGPB 1K73T 3IN5A 3UO0A 3TNVA 2C3YA 1KEKA 3M30A 5F3ZA 4LJMA 5A6PA 2MKJA 3JB9k 4DR2F 3CPWR 3SYZA 5KFSA 3A3OB 4OLOA 2Z2ZA 4QOTA 3O3LA 3PO4A 1H7WA 1Q0NA 3KXDA 2L08A 2QE5A 1HYSB 3TZWA 1TK5A 3O6QA 4E98A 3MMAB 3QPIA 2FJEB 3I9V9 1HI1A 3BO4A 4NLTA 2DNGA 4H4KA 4OI4A 4ZCKA 3PYGA 3S01A 3LAMA 2GFFA 4CLLA 3FSXA 2O67A 4C8MA 2AJ4A 3AB4B 1SJRA 2DYAA 5H9FK 4FVMA 1MMNA 2MKCA 3Q24A 1B4SA 1S77D 3R27A 2OTLS 1KQSR 3UDEA 1R0AA 4KGXB 1VRTA 4GVLA 2R7RA 5DM6Q 2HBQB 4CO1A 2FJDB 2LXUA 1X5SA 1IKXB 3SV3A 4LFCJ 3CJ4A 1M5OC 2UZAA 1RE1B 3GIKA 4K4ZA 7FD1A 1AT1B 4NASA 1EZZB 4V19X 1Y5NB 3E01A 3P6YC 4KAIA 4RBVA 3DXSX 1VIOA 5HVFA 4LFBF 4Q5VA 2VG5A 1F5CA 1N88A 5J2MA 1HQUB 3TZYA 2X7IA 4PZVA 5H1SV 5HK4A 1A6LA 1RAJA 3CMQA 4CTAB 3OUYA 2MKYA 4ZJLA 2VDIA 2W4PA 3GIRA 3ZZYA 4DV4J 5A2QU 2GO8A 3R2DJ 4K8RA 4LF1A 5EUHA 2ROPA 3RB6A 1YZ6A 3S7RA 2JZ5A 4ZKAA 2WZ1A 2LEBA 1PYTA 4C0BA 1M90T 1VRUA 2DT9A 4OI6A 3T19A 2JOQA 1UWAA 4ED6A 2E5HA 3EWGA 1HFEL 5GMEA 2LU1A 4BCAA 2OSRA 2JEJA 3KHLA 4K2JA 4QPXA 2XY7A 2CPXA 4O3OA 4LF7F 3ZNUA 4R8UA 2L9DA 3D3CJ 1V9OA 2VPWB 2VB6A 1AUSL 5EWGA 4BS2A 4GKKJ 1UJ5A 4F02A 3L3CA 5DG9A 1HNWF 3J80U 1TL5A 3G6VA 4C11B 2BOAA 1EQMA 3BV8A 2XS2A 2ROEA 5LMNJ 5F41A 5KG0A 3SMZA 1SL1A 4M8LA 1HR0F 1LWFB 2VG6B 4RW6B 3W63A 2DISA 3OL7A 2XI3A 2O01C 5HMXA 5LXRA 5F8NA 3G8TA 4YDDB 2XWXA 4LF6F 4NOHA 1QVFR 1CS4B 1URRA 4CH0S 2EWHA 4CLKA 1FFWB 1GMVA 2M70A 1DLOA 2CQIA 2WCXA 2WTFA 2LMIA 4C97A 3KKFA 4P10A 3NOCA 1W26A 3BGOP 2DHGA 3NL0A 1FE4A 1WHYA 2YX1A 4DV7F 3G87A 5HBMA 4J91A 3DLGA 3DM2A 2XMUA 3CWJA 5K8OA 3MWBA 3SCKE 4CM2A 4ITSA 3TQ1A 1JXVA 1YJNS 1J5EF 1IN0A 1X4AA 2BM1A 4QYZJ 2BQUA 4HTIA 4ZK7M 3ZNJ1 3L7OA 4K4SA 1RT5A 2I6WA 2DY9A 2I0XA 3K17A 5JJBA 1JJCB 3QRPA 5T14A 3V81B 4DL4A 3KLFB 3DOLB 4EEYA 4XO0A 2PA3A 2LDYA 2A2CA 5DDQC 2ASLA 1RT4A 5GVQA 3OQ2A 4GC6A 2MKSA 3MCSA 2H5EA 3N9UC 3TA1A 2DNZA 2ZOFA 1C1BA 3KK2B 3K57A 4Y0FA 2MY8A 2E44A 4J9SA 4HH1A 2H54B 1NPRA 3VR1A 4WZQA 1T8EA 3B4MA 3TJ9A 4GRSA 1DQ9A 1APSA 2ZH4A 4DX6A 1NKEA 2FUG9 1JXLA 3NCQA 1UPMB 2FJXA 3PEJA 5B0DA 3T1YF 4J9OA 2OGUA 3C6UA 4KO0B 4DR1F 2IAJA 3M7VA 2ILZA 3IC1A 4H4OB 4P2MA 2YBVA 3HFKA 1BMQB 3FEYB 4IFVB 1N48A 2AYMA 1SV5B 4K5SA 5ETOA 1JX4A 2GIFA 3HM9A 2VKZG 1B70B 2HVHA 3D1OA 5HMWA 3M9MB 1KVJA 4CLPA 4ICLB 3H5YA 3H2VE 1YHQS 4F2SA 4A8YA 3DRSB 1H0HB 4JYAJ 3SQGA 1HA1A 3HX9A 1U1QA 3S1TA 3LUYA 1S57A 3AA8A 5FJ4A 2GMLA 3L09A 3GV8B 3NRBA 2MLXA 1Y11A 3B6BA 2XO6A 3VCDA 1YJRA 4ZS6A 3BO3A 4ZPTR 3QZ8A 2Y3YA 3WIUA 1TAUA 1JLBB 1UL3A 3OHAA 2XQCA 1T9WA 1FD8A 4TY8B 2C42A 2HQFA 2IM0A 2DCLA 1HPZA 2ZBQA 3MR5A 2G0CA 2Q1LA 4DG1B 2PT0A 2U2FA 4IG3A 3ZZOA 1LK7A 1ZYQA 4NA2A 1P1TA 5IT0A 1RTDA 2YWWA 1GNKA 4WU3A 1NDCA 3PIOQ 1Y10A 1RWMB 1HD0A 4CLSA 4WIIA 4USMA 4HACB 4MK7A 2B4UA 1CLFA 1L3VA 5KFYA 2X51A 1J2VA 3I55S 2FVCA 4KPYA 4UOGA 2QLJB 2VOOA 3VTIA 1O8BA 3KJVB 5IT9Y 3ZZPA 2UUAJ 1S6QB 3Q8PB 3DI6A 2HMIB 3LTOA 3P3DA 1UAWA 3D1QA 1PBAA 3TOQA 2MQPA 2QIFA 1RT2A 2C3PA 3JSMB 5D3GB 1Z2LA 1UVKA 3RAMA 3T5KA 1CJVA 1FJCA 5G4DA 5G0RB 3UDCA 3KLHA 2OUGA 3A8KA 3W61A 4JI6F 2JC0A 2ZE2A 1OSCA 3NCPA 2J0SD 1WNEA 5I42B 1YJ9S 3PW0A 1M5SA 2Y1IA 3VQTA 4Q2MA 2HZCA 2YNFA 2F4VJ 1S72S 2W7PA 1C2PA 4FBTA 3TAPA 4URGA 3KDOA 1UFKA 4DF4A 1EAYC 3EZUA 4R5PA 4JI2F 4HI1A 1IWAA 2YWEA 3JQMA 3D68A 3MM6B 4NX9A 1VC6A 2J6SA 1DARA 3HT0A 3Q83A 2NCKL 1PO6A 2H48B 2AEJA 1KOOA 1S99A 2RF2A 2RUGA 1L5UA 3EMTA 4RBUA 1M5HA 2P9GA 3AOBA 4RNNA 4KPCA 3JTPA 4LQ9A 3K5MA 5ETMA 1M1GA 2RDIA 3A8IA 1M5PC 4C4WA 3GMGA 1TR0A 2HNZB 1RHQB 2PFFB 2DGWA 3N79A 3CNQP 1XR7A 3I5CA 2G1HA 1GX5A 3I9ZA 2J7UA 2J9CA 3DOKA 1V5VA 4LREA 4I2QA 1Q16B 1U8WA 3OL8A 5I3UA 1AROP 5J2PA 2B8PA 3N0VA 3MTKA 4N8OA 2F8MA 3EGNA 5BYSA 3DLKA 3FZ2A 3RAXA 2Z8QA 1K1QA 4X4OA 1GQEA 4M5KA 4QIVA 2DRDA 3FQLA 4J9VA 4WK1A 2HHWA 3DHWC 5DG7A 3US5A 1HNIA 3KUEA 1FK9B 2IBOA 4P7VA 3V5RA 3MEDA 2YKMA 4A46A 2MB0B 2NXEA 4PYDA 3G8QA 1ZM3A 1YBAA 1PILA 2DVIA 2XZDB 2VFVA 1X0PA 2OKQA 1ULRA 3HZGA 1JKHA 1GXTA 1EX8A 1T9VA 3AHPA 1HLWA 2EEYA 1KFSA 1HW9A 5CHCB 1SC3B 3HCXA 2WBMA 2H4YB 2RS8A 2DR5A 4FKYA 2C3MA 1RWKB 4BDPA 4NLYA 2KXHA 1GXLA 2P6SA 3ZTSA 4IO9Q 1VIXA 2W25A 1NJYA 3AT1B 4FF1A 1WC0A 2AGOA 2C3OA 1REVA 4DSKA 2KXNB 1EQ0A 1HMVB 1JXEA 1S97A 3QYYA 2E66A 5HAOA 1LWCA 3KLIA 1XNRF 2ZVSA 4DU8A 2IDLA 2GNKA 2L9WA 2XNQA 3R97A 4K5RA 1AYEA 3CC4S 1Z1ZA 5IM0A 1AFIA 4G1IA 4IRCA 5KFQA 1CJUA 4B3SJ 1XNQF 2P9CA 3EVMA 1RTHA 2IC3B 4QWBA 1IKWA 3PYDA 5L38A 3D6FB 4KTQA 2CNNB 4NYZA 1DQ8A 2GC8A 3I4HX 1RYSA 4ES2A 4O0IA 1VQ4S 5C2GA 1HL6A 2V8GA 2JX2A 2CQ1A 1ITPA 1GT8A 4DU7A 3GIJA 4R0JA 5KG2A 1ZTWA 3QO9B 4ECXA 1TVRB 1VQLS 4DV3J 3C16B 2WVDA 1BQNA 2ZD1B 4X65F 4K4WA 2A6MA 3BGRB 2Y1RI 3GV7B 1YJWS 4KGMA 1RWUA 5B0FA 2NZ4A 1G6BA 4EFAC 3SSRA 4O3SA 3W8GA 2OH2A 1VBKA 4YS2A 3MMCA 3V4IB 1IBCB 2YKAA 2C28A 2FJWA 1LWEA 3O2IA 1RCXB 3UR3C 4USJC 5DJBA 1U02A 3UCZP 2NUUG 3G82B 2Y0BB 4EBEA 4ZIWA 1SIZA 2LQBA 1MWYA 1RTZA 2DNQA 2QMUB 1CG2A 1YJUA 2VFTA 4J7CA 4B9UA 2J76E 1TFWA 2UUCJ 4IG0B 2J6TA 3CJTA 4QW8A 2EFGA 1OWXA 2KG0A 3GQCA 2LFVA 4K4UA 1NH7A 1S1WB 2HRYA 2M0GB 2ADBA 1B0PA 4JP8A 2WOMA 3UCUP 3NOGA 2OPRA 1FX4A 3OJUA 2HLUA 4Q44A 3ADAC 4UZBA 1WTFA 2NQPA 2V8PA 4RX6A 4NYOA 1FRHA 1RP5A 4XTTA 3PEHA 4IR9A 3QIPB 4FVCA 2J9DA 1RAAB 5LJ5Y 4YUDA 1NDPA 1WEYA 1TL7A 4LRCA 3MPUB 3W65A 3E3XA 1JWWA 1Q53A 2Q79A 4NEYA 4KKOA 4Y2IA 1N32J 3IG1B 5AE1A 1T05A 1U2FA 3N4WA 4UUWA 1ZM9A 1ROFA 2RRBA 2PC6A 3H0PA 3BSNA 2QL7B 3DRYA 3TI0A 5HP1A 4DR4J 1I6JA 1JLEB 2QV6A 1S9FA 1YDLA 3G86A 3GG1A 4LVNP 1U1NA 4Z7YA 3QT8A 1UZDA 1HBMB 1IBLF 4YR2A 1FJEB 4HLBA 4LF5J 2MHNA 1WDDA 5IFMA 4WU2A 1K8AT 3D54A 2DPJA 1SPBP 1CQNA 3FMWA 3N6NA 2FVPA 2GQCA 3UW1A 5IWAJ 2HQIA 4UZCA 3PXGa 2G2YA 1GXUA 3LP0A 4DN0A 5BXIA 2UVRA 1FRJA 3RRHA 2XO7A 5IT9U 5HI7A 3CGIA 1VQPS 5H9FJ 2ERRA 1P8GA 3RTVA 4F7VA 1R8CA 1MMDA 1S9GB 3MM5A 2KFNA 1N36J 1FDDA 4C8NA 1ZBTA 5DO2A 4LIWA 2ACMA 3I0RB 4GVBA 4L73A 4NLSA 4DUZF 1S1TB 4RNFA 3DU6A 4NPOA 3G6ES 5CH7B 3ETOA 2HHHF 2HAIA 3ITHA 4OZJA 4OYWA 1U2RA 2V67A 3BBFA 4DI6A 5DQIA 5AE3A 4DCOB 3UWTA 1FRIA 3CEDA 4HI2A 1FE0A 1I1GA 2JFKA 2VDHA 1VFJA 3CDWA 3NWRA 4HT5A 3QGGA 4FZVA 5HROA 4FYWB 1HBUB 1WOPA 4DV2F 2VOPA 2CIMA 4IUFA 3SCLE 2XTJP 4ERDA 5A0YB 2CPJA 2GQ2A 4OYOA 1QJHA 3NGKA 3G71S 5K14A 5HQMA 1WD6A 3LPEA 1JK9B 3DRRB 2BA9A 3A13A 1PCAA 3JAMU 3Q86A 1AA1B 4ZJQA 1KSPA 4EZ9A 3ICLA 1MU2A 1L3SA 4NXNF 1ZA2B 1VBYA 5AXLA 4Y2MA 1FNXH 1TL4A 2ASYA 4RUAA 3HVWA 2O3DA 1TL3A 1ZTTA 1Y9OA 3FC9A 2NUHA 5DZ7A 2B9WA 3U27A 3MPDA 2O66A 3IGNA 3ULHA 1H73A 2Y8YA 1M1KT 2VFRA 2KRBA 4DR6J 3DDNA 4B3OA 1XMBA 1E6VB 4U6PA 3DFEA 2LQ8A 1FWPA 3T6JA 1T03B 3MM8B 1CEZA 2IYIA 4W92B 3SI8A 4LF8J 4WXOA 3NBPB 1BE4A 4USVA 3LO3A 3KK3B 4PCQA 2MTLA 2VH7A 4E0DA 4MMOA 4ANDA 2NXCA 3D6TB 5ETKA 2K2PA 4BC9A 2EC2A 3W9JA 5KFBA 1Q7YT 4WKRA 1TV6B 3QSYB 3UDLA 5A8WA 2KYXA 2DHSA 4I6AA 4LSNA 2XLKA 4RW8B 4NA3A 4WYLA 1FNOA 3CDAA 1B64A 5IC6B 3EXCX 1CULA 1UPPA 3QJJA 2RDDA 4NLWA 4ZCMA 2W2PP 2B5JB 5J1PA 3W9HA 4ECSA 1HWUA 5CYQB 4PXBA 3AY0A 4UF4A 4DS5A 2GJIA 3TWZA 3PACA 3WBZA 4IDKB 3BH6B 1NHKL 1T9XA 4I68A 4C48A 3IM9A 4G1QB 2HS3A 2G2OA 4RNMA 2YQ1A 4UUXA 3IGVA 4QR0A 1FVQA 2N4CA 1RT3B 1N4LA 1YBTA 4PG8A 2DNRA 1D8YA 2PI5A 1KWMA 2PI4A 5IV4A 3QQCD 1YLXA 4FN5A 1F6TA 3W66A 5EDWA 3GWCA 3IBWA 4DV0F 2HKEA 3RG6A 2HIYA 1DZ5A 2ZHBA 2DHXA 2YNHB 3W60A 4NL5A 4PG7A 5KFXA 4ECQA 2K1RB 2G9OA 4USUA 2E7XA 4ETXA 1CPZA 3MF5A 1DTTA 2YTCA 1FKPA 1X4CA 2FLOA 2UXBF 2E7VA 2UUTA 4ANEA 4JI7J 4IRKA 1WC5A 3H5XA 1XC9A 2NS1B 2HVEA 2X1GA 3QAUA 4FF2A 1NK9A 4PXCA 1X9MA 2UU9J 1YZ7A 4A8KA 3KFWX 3M30B 3K58A 3W62A 1KBRA 4Y6IA 4JI1F 2VC1A 3FRZA 4F4WA 2CPFA 3TUIC 4ED2A 2QA4G 5C25A 4U9RA 3V6DA 4ZMMA 2VD3A 3POTA 2GCFA 1UP1A 4HDHA 4WFNQ 2CG4A 1WKKA 2V69A 3GSDA 3GPAA 3W5ZA 3OTOJ 1VQ8S 1QAXA 2FIUA 2D3ZA 3MXHP 2ZZMA 4I1TA 1ZZFA 1PJ6A 4RNOA 1MSWD 2IRUA 4KSEB 4NI2A 2MPUA 1UWBB 4EMDA 5HN0A 5HMZA 3AJ2A 3BPDA 4FYVB 4KB7A 3KK1A 2YWKA 4X4TA 3VAMA 4CH1A 2FHKA 4OZ2A 1X31C 2ZC4A 1Y4ZB 1FJGF 1YJVA 1R0AB 3C6TA 1VRTB 4OX9F 3HMJG 2KRRA 2BMBA 3OXGA 4IR1A 3FEXB 2OMOA 3BQ2A 4CO3A 3T41A 3KG0A 1NSPA 4F2RA 4ZN1A 1NKCA 4ED7A 2D7SA 4P75A 1XMQJ 5J2MB 3C14B 3U7JA 2MZTA 3ZXWA 2DR9A 3FUYA 1DTQA 3CDBA 3CIZA 2VFUA 4X4NA 1G1XA 2GIQA 3OUYB 3BN7A 1SJ4P 1IJEB 3FCHA 3K5LA 2QZ8A 1T9YA 3IR6B 3FNNA 1MWZA 1K47A 2QT7A 1NJWA 1NHUA 2KKHA 4F4KA 3HI9A 4B3TJ 2HS4A 1D0EA 2W7OA 3EYZA 2VPYB 2MSTA 4LFBJ 3LP2A 2N7YA 2DR8A 2LQ9A 1VRUB 2AYEA 1V3ZA 5KFZA 1TKTA 2BVZA 4GO5X 1FWLA 1J27A 2HAFA 3UD3P 3CCZA 2HK3A 2OHDA 2DNKA 2ATCB 2L9NA 3MECA 4TYBA 2M8HA 2XBPA 3DLBA 5DDOC 2BV3A 1VRQC 2KT5A 3UNYA 4LSLA 4K0KF 1B7YB 3P45B 2W9BA 3Q8VA 4IRDA 3H2LA 5A8KB 3KMQA 2MDAA 3U02A 2JLGA 1KHVA 3IBCB 2CJQA 2R9LA 2KN4A 2DGTA 4TQSA 5KT4A 5K8MA 2JEGA 1R8HA 3KHGA 2RQCA 2DNNA 2BZ2A 2LA6A 5EHHA 3M1VA 4OZLA 1JJHA 4LF7J 1SUQA 3KWMA 4LFAF 2RKIB 1H98A 2OPQA 5L39A 2CQ4A 3GILA 1FCAA 2XSJA 1HNWJ 1QD1A 4JBCA 4F4ZA 2BJ3A 4C2MA 1DLOB 4I0WA 3R5JB 2FDNA 2X1AA 1CBKA 1S79A 1U4BA 3HVAA 5C2CA 3C19A 4M94A 1HR0J 1HWKA 4IFYB 2B4OA 1RA7A 4LRBA 4Z37A 1FXLA 4IYQA 1SB6A 5HBMB 3CD6S 1YKWA 4OZ5A 3G6YA 2EFNA 4J9NA 3H98A 2CG8A 3DLGB 3DM2B 3VAKA 2NXNA 1AZSB 4LF6J 1OQ3A 4IO1A 2OPPA 4H4MA 3OR1A 1OYDA 5CABA 3B4DA 4LUBA 4NCGA 1FJ7A 2YVSA 3GJSB 5KFTA 2F8HA 5D4LA 1FXRA 3GYXB 2GJ2A 1RJJA 1ZPVA 1WKJA 3BSAA 4TLRA 3MCMA 3FSYA 1RTJA 3QBCA 4DV7J 4J5OA 2AQ4A 1S5ZA 1YWXA 2X1BA 3BJYA 1VQ6S 3ELHA 3I5BA 2R7VA 5JVGQ 1TL1A 2ZBCA 2ILYA 2MLZA 4NMXA 2OLWA 4DL2A 4ZVSB 3W8PA 1J5OA 1RT4B 1JLAA 2Y0SD 4WXWA 1KVIA 4WWSA 2CQBA 1J5EJ 2R4FA 3MEEA 1RAGB 4HKQA 5K8PA 5DQHA 3NMRA 2MQLA 4OFZA 4M95A 1IVZA 4G65A 1H72C 3BF4A 2MGZB 1Y5LB 2Q3PA 1CJKA 4JV1A 2AMCB 2HHTA 1SJQA 4ATNA 4M1KA 3EPGA 4N76A 3QATA 4LSZB 1TUWA 4DV6F 1C1CA 3KDNA 2AW0A 4P73A 2CJAA 3EVWA 1JIHA 4RR5A 3KG4A 3C6UB 2Q43A 2IAJB 4N7TA 1NBEB 3JQKA 2C2NA 1VQOS 2XY6A 2VPXB 3M8RA 2NYIA 4AL7A 2NLWA 1N33F 3L7UA 4XK8C 5D0RA 4JI4F 5CQGA 5SUHA 5KFMA 3WX4A 2XYGB 2WONA 1QLNA 2FJBB 4ER8A 1RZMA 2Y1LB 4MK9A 3J7Z5 2PEBA 5A76A 2CQ2A 1EHWA 2CDRB 3SCJE 3RYLA 1S6PB 3CCWA 3T1YJ 3IBFB 1SL0A 3VGVA 3FGVA 4DZ6A 3NGUA 3GV5B 2WRMA 1NO8A 4DCPB 1WG4A 5FIIA 3H42A 5L9NA 4TU8A 1SQFA 2CVIA 2D1CA 2HFNA 3M32A 3OVBA 3T5JA 1FKOA 4GMKA 3KLEB 1B3TA 3PNIA 4ZVTB 1HPZB 3RB0A 3B78A 2MHEA 2LCWA 1IQTA 1X4DA 7FDRA 4IG3B 4I67A 2DBBA 4DR3F 2OTJS 1QUPA 2IMWP 1VQ7S 2K3IA 4ZHRA 2XB2D 3H7HB 5CYMB 3TRGA 3A8JA 2BQ3A 1RT7A 1IBMF 3ZTRA 3N5BA 1U2CA 2ZFHA 4OYPA 4MH8A 3CCSS 4DV1J 3ET6A 3PHTA 1D9DA 3F41A 1RCOB 2CQ3A 3ISND 1RUSA 2V34A 3NCRA 3PW7A 4FXWA 1RHKB 4UW2A 1RT2B 3ZC4A 1F9FA 2RAQA 2OJ3A 3CD7A 3THVA 2DJWA 2MQNA 4OHYA 1UZHA 5FLXU 1SQGA 4HL9A 2Z0GA 1OIAA 1CJVB 4ZJOA 2ZH6A 2DEJA 4O44A 5KOXA 1I94F 5DZ6A 3KLHB 4MT1A 1FFGB 4NLUA 2ZE2B 3IFEA 2H51B 3G2XA 4RU9A 2XMWA 2V50A 3UN3A 3NKYA 2ZBPA 1UFWA 2HQ3A 3M9OB 4Z2XA 4YDXA 4NRUA 4DQSA 3MAAB 5JVHQ 2YNFB 2HS0A 4HYKA 1WEZA 5MLCV 3RRGA 2BXJA 4F3OA 3OW2R 3QWUA 3QGPA 1K9MT 4J9LA 3H25A 1ZAWA 2UVWA 1EKRA 1WJ9A 2HGMA 4JI6J 2FC8A 3D6HB 3M2RA 5A2QY 2G13A 3BKUA 1RAIB 4DLGA 3NEKA 4CH7A 4K4TA 1Q86T 4NZ7A 2IVFB 3DKDA 5GADI 3P49B 3H5UA 3IR5B 4Q43A 2KZMA 4X4RA 3DDKA 2RF2B 3MGJA 4XIUA 2ZBRA 3PX0A 5DGBA 2FY1A 1U6ZA 2I1RA 5GAGU 3JTNA 4JI2J 2HVDA 1R0BG 4NWBA 1IKXA 1DQAA 4Y2KA 2C3UA 2B51A 2ZBIA 3V6HA 4F4YA 3QLHA 3DC2A 4KE5A 3AOCA 1F1BB 3PW4A 2WVEA 2MY7A 3J80Y 2XMTA 2KZZA 4FNHA 2HZVA 1HQUA 1FESA 1V3SA 2BJDA 5ETRA 5D15A 4WF9Q 1WOOA 3A3NB 4ECZA 1IKYB 4QQBA 4Q2LA 3DOKB 1X4HA 3HSGA 4I2QB 2QFJA 2QSFA 2Y1JA 2W8KA 2PMHA 4O4GA 4O3PA 1ACMB 3DRXA 2MZRA 4C0OC 5F8LA 2XGQA 5CCMA 3HVRA 4M63A 3U1NA 1RT6A 3DLJA 4GKKF 1TUGB 4OJ1A 1FI4A 2E1PA 4NLRA 3TJAA 2V2ZA 4DUTA 1IWGA 3OL9A 5EN1A 2MXYA 3J7AN 4ILLA 3C3LA 4ZA1A 2GA7A 4DOZA 2JL9A 1HNIB 3H90A 1DY3A 1KQGB 4MAKA 3I6PA 4RUBA 1RHRB 3MEDB 2YKMB 3UQSA 2D74B 3TX0A 4WP3A 2UUBF 4B17A 4IKAA 3N6MA 2M4MA 5IV3A 1RXOB 1X5OA 5HLFA 1HIYA 1JKHB 1Y00A 1K0TA 4Q0BB 2VUGA 2K7JA 2LXIA 2CWXA 1ZS6A 2YKNB 3R5DA 1X4FA 1MNEA 4EO6A 2VG6A 1BWEA 3TP2A 3FMBA 3PCOB 2VQFF 5L1JA 1GAOA 4DSFA 3PYEA 3W1YC 1FEHA 3THTA 4PG5A 4DBQA 3L7PA 3Q23A 2M3DA 1UVNA 3K8VA 1UEVA 4DX5A 1LWXA 4ZIVA 3QFHA 1MN9A 3RB3A 3EX7B 1KHWA 4WCEQ 1WSRA 3ZTOA 2PSZA 1S4EA 1REVB 3AFGA 3GFYA 5KT5A 1YQHA 4YR0A 5KG6A 4DF8A 4DQRA 3BS9A 1JLFA 3PR5B 2RDJA 2JHEA 3OT9A 1LWCB 4K7QA 3KLIB 3GZ7A 1WHVA 4LR9A 4C8OA 4QU6A 1Q78A 2COLA 2C2MB 1CJUB 4KC5A 2RU3A 2ZUGA 1WACA 1RTHB 1IKWB 3G6XA 2KT3A 5IQ6A 2IHR1 3PV8A 3J7YU 4NCAA 1VQKS 5ETLA 3D1HA 4CZCA 3NNHA 4IQMA 4Q45A 4DPTA 2OD4A 2KM8C 4CO2A 1YSJA 4G1PA 2BUNA 2AKWB 3PVXA 3BSOA 1XNRJ 4K50A 3JYTA 3IS9A 2HK2A 3CCMS 4ZPVR 5D8HB 3AB2B 2BANB 4X4SA 2HW3A 2R8HA 4QIWD 1XNQJ 3S6EA 3KLFA 4C9DA 1BQNB 4P74A 4X66J 3M2VA 3PJ9A 3D28A 4QPTA 1NAQA 1AB8A 2E5IA 2H65B 1VLYA 1FTCA 1RU2A 4DFKA 3BH7B 3MMCB 4ELUA 2OEKA 1TUVA 1SBRA 1LWEB 1W25A 3TJ8A 1RSCA 1LQ9A 3R1LA 1XQIA 4KGVB 2ALYB 3VV2B 4FYYB 1LNQA 3K5NA 1IM6A 3UI3A 3KUGA 2IM3A 3LWLA 4X65J 3TZZA 2AGPA 4EO8A 3M4XA 4CLFA 5DRKA 4OI3A 1YVFA 1RHUB 3PRVA 1Q8KA 4ECUA 5EWFA 3V6JA 4H4OA 2XWYA 2LEAA 4IFVA 1RAEB 4HH0A 1QY7A 3GG0A 1SV5A 4ID8A 1XBWA 4ZLNA 1FERA 2AZ1A 4CLUA 2WOMB 2ZH9A 3CE8A 2L41A 1VQMS 3T1HF 1KLMB 1JLCA 3HD2A 2RVJA 2E5JA 4C8ZA 2EFVA 2ZJRQ 1S6UA 1SKWA 2DO4A 5HVHA 1R8PA 1DAXA 2ZZNA 4BBYA 3TUJC 5E3PA 4ELTA 3DRSA 4ZLJA 5KFDA 3WIVA 1QM9A 4C8LA 2BABA 1TAQA 5KT6A 3EGVA 2OI2A 2IRYA 5BJRA 2I38A 1GK8A 1HQEB 1TL7B 1ZAVA 3QFWA 3NS6A 2KG1A 1NHVA 4KKOB 2V2VA 4C8YA 3OTDA 2DY1A 3RJMB 1T05B 3P8BB 2FVQA 4O23A 1NZAA 3UN5A 2LQ5A 4EUVA 4KHMA 2QGFB 4CIOA 5HP1B 5HSPA 3QGHA 4ZP9A 1JLBA 2IA6A 4FS1A 2VICA 3PY8A 4TY8A 4USKA 5LT5A 1NKBA 2AGQA 5KT3A 1WOSA 1U47A 2HVIA 3D0HE 4PAAA 2UXCJ 4P2FA 2CPYA 1FKAF 1QVGR 5AXKA 2ZJPQ 2X3GA 4RWWA 4F26A 3BN4A 1NU4A 2HG4A 2ZM6F 2RS2A 1HW8A 2VKRA 3LP0B 4PWWA 2BM0A 4M5IA 3D66A 2V6AA 1F2GA 1HNVA 2HFUA 1BUXA 2QSWA 2KVQE 3KJVA 1GMWD 1WTBA 3PYFA 4OX7A 5AT1B 2XHWA 1U6BA 3MM5B 1KTQA 4PUOA 5D4NA 3I96A 3VGTA 1U49A 4I6YA 4QWEA 2F4VF 2MZJA 3R5CA 1TKXB 1C4CA 4FXDA 4JV0A 2C2ZB 4AT1B 3CO0P 2XMAA 2RQKA 2R7WA 4QIFA 1HI8A 4HTJA 4IOCQ 3IAM9 2GVZA 3C66A 4RJVA 4FPRA 3GE9A 3LQVA 2KU7A 1Y0HA 3NAHA 3OSNA 3CJKA 1O5JA 4OYIA 5HROB 3KUHA 3RR7A 1NB2A 3P5BP 3BBCA 3EXYA 3W2VB 4LQ3A 5I4MA 1QE1A 4OYBA 4P2SA 4C6AA 3RU0A 4Q7AA 4DCJB 2YKQA 4TN2A 5K14B 1UW4A 3Q22A 1IM4A 2HWHA 4HDGA 2ASJA 3MR3A 4DPUA 3T9NA 1LKZA 4DQPA 2BRKA 4N8NA 2DR6A 1UMJA 4CLTA 2N82B 1S1UA 4AXIA 2PGCA 1N5QA 2HFSA 1JLGA 5KG5A 1MU2B 4DV2J 5ETSA 1RB0A 4I7FA 3BQ0A 4PQUA 1H6KX 3H4DA 2UUWA 4K2XA 4DPOA 2FHMA 4YN3B 1I5OB 3OJSA 2HHUA 3SV4A 3VGUA 1B99A 3P96A 1X8DA 1H2TZ 4RW7A 1ZM4A 5F8MA 1N5YA 4AQYF 4N41A 1XK8A 1RKIA 2M8DB 3TZXA 3R8YA 2QA4S 4DX8H 5EX3A 3NNAA 2RH3A 2HNZA 3WC0A 3KJNB 3N01A 3M8QA 1HBOA 3UVJA 2XM3A 3SIPB 3CSKA 4B3OB 3LW5C 4G6VB 4TXSA 3W3SA 2KM8B 3SDEA 4NXNJ 5HANA 4KRWA 1LXNA 4O0NA 1WEXA 2WVFA 1FO1A 2XYPB 1NEEA 3LGMA 2B6AB 1VQYA 2BJEA 4IOBA 3MD3A 2GGPB 2HIQA 3DMJA 2B9YA 2RMLA 2W01A 4J9KA 2W9CA 2PE8A 3PRBA 4A4JA 2XMJA 1D1UA 3ENVA 5JXSA 2BACA 5K5MA 5CCLA 2RHQB 4LSNB 4U8YA 4QYZK 5D6GA 4WFAQ 2VA2A 4BWMA 3T9ZA 8ATCB 1NLKL 1CULB 1VBZA 2EPIA 2WK4A 4YFUA 5KFCA 3AQPA 2JSXA 4I69A 5AJ3F 3IR7B 1R31A 3R5BA 1UJ4A 4NLOA 2OFHX 3L95X 3HDSA 4LRAA 3R5GA 3OTCA 4UOHA 2MLYA 4HEA9 2F40A 5EX0A 1GMWA 1TKZB 2DNYA 3GIIA 1EB0A 1WHWA 3E51A 2EKNA 1WF2A 1RHJB 1OJ4A 2HSEB 2CJBA 4CO5A 1FDBA 2CNOB 3EE3A 3TUPA 3F56A 1P27B 1V6HA 3TW0A 1UETA 1YJ7A 4ILRA 4B3SF 3QT6A 4L75A 5FDLA 3QIDA 3MPVA 1FD2A 5J2QA 3B82A 2A0FB 1S0VA 2FZGB 5F9LA 4AXJA 1FDAA 2W2QP 2U1AA 4OIXA 1FRXA 3G9CA 1QTMA 3MMBA 4TVAB 2LKZA 1UA0A 3R3TA 4DSLA 1OY6A 3FBFA 2C1EB 1Z4UA 2V2QA 2M5YA 5H9EJ 1RYRA 2PD1A 4DL6A 4OV1A 1H2UX 2XS7A 2CPZA 3DGVA 2R2SA 3PX4A 1PBUA 2E9TA 4DV3F 4IQXA 5K9FA 2IC3A 3FRYA 2HNDB 5KG4A 1YG0A 3LOUA 3K2YA 5F0WA 1Y3JA 2WB1D 1RKJA 4Y3CA 3QRRA 4B3MF 3TX8A 5F8HA 2KHDA 3DLEA 4DV0J 1MWQA 1M5VC 3CCVS 3BGFA 4URQU 2AJ2A 3H8YA 3MR6A 1F0XA 1N0UA 4OJHA 4RLEA 2ZH2A 4U95A 1Z2ZA 2VONA 3VWSA 1LEOA 5B08A 5C25B 1JLQA 2C2EA 2DNHA 3V6DB 3QT7A 2JEFA 4FYXB 1NB7A 2ZD1A 4G3IA 3POTB 3BGRA 4DWIA 2CRLA 2Z57B 2UUCF 1GX6A 2R2RA 1SH0A 5BYRA 2FQQB 3FZBA 5KFPA 1DJ0A 3PJXA 4JI8F 4JI1J 4HR2A 3CCLS 3OFFA 4CP5A 4USWA 4NI2B 5KG1A 4A8XA 1NK6A 2V2KA 2BJ7A 3G82A 4KR0B 2DIVA 2M7SA 1BQMB 3KNAA 2IJFA 4QIGA 5KG7A 3KK1B 4ZVGA 2E7WA 3GFZA 4MIWA 4IG0A 1RI7A 2Q66A 3C6TB 1S9EB 2DD8S 1YI2S 1N32F 1PIEA 2XSFA 2IDEA 3OXFA 1DBDA 2XLJA 2MEWA 1JJ2R 4ZPDA 5T7LB 3K5OA 1RAFB 2ZZTA 3DOMB 3NP5A 2EBGA 1VMBA 2H3EB 1WI6A 3HZEA 1HARA 2FPHX 1H2VZ 4LR7A 5KFFA 1DTQB 2GV1A 2WVBA 2HHXA 5GAHU 3QIPA 3BSCA 4QJVA 4M5DA 5L1KA 2AF6A 5ETNA 4RW4B 1FJGJ 3CMES 3T5HA 5A8RA 4OX9J 2H5IB 9RUBA 1U24A 2UXDJ 2WHOA 3OFGA 5L46A 4MJKA 3SFGA 4TY9A 4Y00A 3OD2A 5HQ8A 5IWAF 4AD6A 4ZPAA 1VS3A 4PWDA 1RLCL 3BGUA 1HNZJ 3LP2B 3DRPA 2UVVA 1EETA 2V4JA 1TKTB 4XDDA 5C42A 4OYXA 4PABA 1HBMA 5LJ3Y 1IXKA 2A3JA 2QYGA 1LW0B 3IWNC 2A1BA 2ZKTA 3CT9A 4EYHB 3JSYA 2H9ZA 4CDIA 2ZHOA 3FEZA 2W9BB 2CPIA 1HHSA 3QJPA 2BE2B 1U0SA 3KLGA 1CSJA 1XR5A 3ILLA 4XDCA 3U1LA 2HBRB 1GFWB 2HHVA 2V8HA 4A48A 4OV6A 2BJ1A 3CULA 2CADA 3HSJA 2FC9A 4QZVB 1S9GA 2DXEA 3M1VB 1F9EB 1HWJA 3JAMY 3EDRB 1SUQB 3I0RA 2HVZA 2NXUA 2N4DA 4NMLA 3I4PA 4Y34A 2V0NA 2GMJA 2OPQB 3EZOA 4ZP6A 3KJQB 1WORA 3ZZTA 5J2NA 3Q8UA 1UVJA 3F0NA 2H1YA 4LF9F 3TAQA 3H20A 1KVKA 1N8RT 3O8WA 4NLPA 4NLVA 5E5NA 4KJIA 4O3QA 5C7PA 4KT0C 4QR2A 4OHZA 1HWIA 3QMQA 4X62F 2D3O1 1HKAA 3OXLA 1PKUA 3ZTPA 2Q6BA 3PX6A 2C22A 5F0UA 5B7WA 2OPPB 2LEPA 4URSA 1U25A 2CNKB 3IAS9 2CDQA 2XULA 3OR1B 4OZ0A 2K3KA 2HFVA 2EKYA 4F4AA 3DLLQ 2V4RA 3PR4A 2W2NP 4WE1A 2IM1A 1ZOTA 2CZ4A 1CVJA 3KG1A 2HBYB 3CXCR 4K4XA 1GEHA 2DK2A 1RTJB 2G0JA 4Y28C 4MKBA 4L6V3 3M8YA 4AFFA 2LYVA 2QEXS 1U09A 1Q8IA 3NS7B 3GCXP 1TL1B 3UD4P 3CCJS 3MEGB 2IBKA 2BYCA 2MKHA 1F3FA 3HK2A 4DQIA 2EFOA 2DO0A 3U1MA 2FY8A 1OYEA 4WP9A 1JLAB 3R6GB 1SC1B 1B7FA 1RLDA 3MFIA 4PRFA 1SCJB 2F65A 2CNLB 3MEEB 5GADU 3VALA 3CCES 5RUBA 4DL7A 1RABB 2LVWA 2I5JB 3RW7A 2YKOA 4DL5A 2R42A 1KOHA 1CJKB 3VVUA 2J0WA 4NZ0A 4J9PA 1HNXF 1E6VA 2EI5A 4NLQA 2YQ3A 4DJBA 5L9XA 4OHWA 1T03A 2RJZA 4OL8A 4L3NA 4NZ6A 3HHLC 3IRWP 4CT9A 2WAQD 3RBXA 3PFOA 3IMQJ 1HBNB 3VAHA 5E0OA 2JRSA 1ZM2A 1IJFB 4J9RA 1X9SA 5DDRC 1YIJS 4DL0C 3HJFA 2OPSA 4DSIA 3CIMA 4ZPBA 1LW2A 3OFEA 4JV5J 1TV6A 4AL6A 3MMJA 2VIHA 5KFEA 5KG3A 3HD1A 1E6YA 2B4VA 4UY8T 4H54A 3CJRA 1FTRA 3M05A 2FVSA 2O5DA 1Q81T 4OHVA 2DGVA 4KYZA 4RKUC 3QJLA 4MTPA 2HQCA 1D9AA 2HQGA 4JI4J 2YH1A 5AXNA 3M32B 2YH0A 3OR2A 3HFZB 1LFPA 3P4UB 4G1QA 3J81j 1FKOB 1S59A 4GO7X 3H59A 2EK1A 4M5MA 1YX2A 3VAIA 3TEGA 2FLLA 4RW9A 4USIA 4ECRA 2MKKA 4USTA 3KHRA 1RBAA 3N5FA 2NXJA 2OMLA 3IWXA 4JI7F 2GVDB 2YNGA 3K7RA 1XTZA 2CPHA 3MM7A 4RNHA 1X60A 5E33A 1RT7B 1UVLA 2NPIA 1S1XA 4EBDA 4DQQA 4C7QA 1G7CB 2RB7A 2A10A 5F8GA 4B3RF 3ET6B 2CFXA 3CJSA 1N56A 5DG8A 3T5LA 1TP7A 4M5GA 4ID5A 5IXUA 4DR3J 1SI9A 5LXYA 2ZVIA 1RBLA 4ZPWR 2HRTA 3L4BC 5CAAA 5IOLA 4ECYA 1YBUA 4OJGA 2CQ0A 3OTOF 4F3MA 4A8MP 3IA0A 1IBMJ 4IH5A 1IR1A 3RBDA 4GKJF 2ZEJA 2DH7A 1SVDA 2B7CB 3EDQB 4CI0B 1BY9A 2ZH3A 4O44B 5HJYA 4D3GA 3TYTA 4PPDA 4PXEA 3DYAA 1SC6A 4JI3F 2XCPA 2JLEA 3JSBA 1TTHB 4BLGA 4N5SA 3S8SA 4IH7A 4DS4A 2YNIA 3X3UA 2VJUA 4D3HA 2KJVA 2V5HG 3TAMB 4FPIA 2CQDA 1FDNA 3HHEA 3P5TL 3WC2A 3GP9A 4F50A 2F9JA 2M9KA 1RWWB 4CO0A 3MCNA 4MK8A 1QSSA 3MD1A 1I94J 3RAQA 1T3OA 4OI0A 1S6OA 2R3VA 3M2RB 1UWBA 1V3RA 4I6WA 2LXFA 5E3RA 1XMQF 3UE2A 3CVKA 4WK3A 1WF1A 3TVZA 3GONA 1DRZA 3GJTB 2OP5A 2KB2A 2CZVC 4DFJA 2IA0A 3J7A1 4QR1A 3CDUA 2K7KA 4B3TF 1UKUA 4OHXA 3QLHB 2HHQA 1ZAXA 1RBOB 3NXZA 4ZOSA 3A3PB 2GHVC 1M1HA 3C14A 1NSAA 5BR8F 4I56A 3QAEA 2J7WA 2V94A 1NK5A 2N3OA 4H4KC 2EG1A 2KHCA 4HHJA 2KJWA 4O4GB 2NSBA 2MYFA 3M6WA 4KFBB 1RAHB 2I8EA 5DGAA 4U7UD 2PN6A 1RT6B 2LA4A 1FNMA 1IQZA 2UVUA 3G4SS 1TKDA 4F67A 3JXOA 1ZZNA 3UR0A 3I0SA 4YMEA 2HHPA 5D0HA 2RT3A 4FBUA 2E5GA 3BB5A 3MOJB 4DSEA 3BDPA 3MM9A 4QCLA 2G1DA 4DLEA 3QNWB 1RWNB 1WC4A 3HKWA 3PG9A 1PC4A 2EFQA 1WI8A 4CRJA 1BQXA 3FFIB 2R7OA 4QWDA 2X3DA 5A8KA 4AUKA 5HLFB 2MJNA 2M88A 3HHLB 1U1OA 1X4BA 1Q8BA 4Z7CA 3R9LA 2MQQA 1G2EA 2FZCB 1U6FA 4CM0A 2D41A 1Q4RA 1MMLA 3Q2TC 1Y3KA 2HYIB 1VQSA 4RU2A 2KI2A 2FVRA 3CDEA 3OVAA 2R2TA 2RKIA 1FT8A 2UUBJ 3UCGA 3SSQA 1RGVA 1QSYA 4WFYA 4DR5J 8RUCA 1R6VA 2OELA 3AA9A 2NPFA 3VAGA 4ANCA 3D0IE 2HNYB 3NGRA 1JLFB 5LMUJ 2BKOA 1RTIB 1XERA 2AP6A 4IFYA 3W2WA 1VC5A 2D69A 1NDLA 4WJBA 2VQFJ 3PKMA 2CJKA 4WFBQ 4MIBA 2AYBA 4KIAA 4KH0B 2IJRA 2B56A 5L1LA 1N34F 1WKLA 4DN9A 3KJFB 1O51A 5ETPA 1AZSA 3LP1B 2IFXA 5C24A 3K89A 2XZWA 3FK4A 3ZFVA 4YQWA 2BR0A 1Q5YA 4MKVA 3CJ0A 4ZCIA 2FTRA 4L76A 4YHHF 3NAIA 3JYTB 4Y2CA 4LRFA 5LL6d 3IS9B 4CT8A 2JH3A 2MSSA 4OYAA 2R8KA 2PA8D 3TR5A 4MFBA 2YPYA 3R2CJ 1MROA 3M2VB 3GYNA 3Q8YA 4ZCLA 2DXDA 4ECVA 2HLTA 2DXFA 3D2WA 2W4CA 1VI7A 1HHTP 2LDIA 2PDAA 2QA2A 2DHAA 3FSIA 4WTOB 4AE5A 1B0TA 1XMOF 3TA2A 4J9UE 4J37A 2J9EA 2MGZA 4XAKA 2B7BB 1U1MA 3F44A 4Q8FA 3ETMA 4UOFA 5J1EA 4P52A 2QL5B 1KDNA 8AT1B 3H5SA 1C0TB 3HVTB 2XC9A 2HURA 4CLWA 1T0TV 1Q79A 2F9DA 1T11A 4FF4A 3D9BA 3MR7A 2F3JA 3CB4A 4U67Q 4PR6A 2P6TA 2DGOA 4OYZA 1YITS 1LFWA 3PFEA 4FYDA 2JWNA 2VQEJ 3D6MB 2BEFA 1WC1A 1N6QA 1JLCB 2XCAA 2UV8A 2KFYA 3DCAA 3PJWA 3G8SA 4LBHA 3OV7A 3D67A 2EW9A 5GAEI 4OLPA 2KXFA 1TQLA 2VG7B 2JVRA 4UQTA 1S6PA 3M9NB 2MMYA 2JVOA 2AT1B 2AV5A 2JJ4D 1OY8A 1RISA 1RHMB 4LF4J 1RT1A 4F0HA 1Y5IB 2WW4A 1NXIA 4DUYF 2LU2A 3T1HJ 3T3FA 5HVGA 2R8GA 4V19J 2YX7A 3OBIA 2DH9A 1FX2A 1OMSA 1FHTA 2CQGA 4B02A 3DLHA 1W7WA 5FLXY 4DV1F 3KLEA 4LT6A 4O4RA 3M6UA 3TANA 1OQ6A 1KD1T 3AODA 2P9EA 3IWLA 4ZVRB 3NLCA 2N3LA 3GB0A 1VR6A 2GHWA 2VFSA 2FHOB 3BQ1A 4LMZA 2W7AA 3PDNA 5CYMA 1NJZA 3MURP 1NSQA 4YR3A 3MR2A 4NXMF 1Q5VA 3AJ1A 4DR2J 1VC0A 1HNVB 5B0GA 7AT1B 2WSCC 1S7HA 3MHYA 4QYRA 4PUOB 4J90A 3J81U 4OI1A 4DPXA 4ECWA 3T1AA 4O3NA 4ZVEA 4TYAA 3K59A 1QTNB 4M5JA 1EP4A 4KGKA 2ZM6J 4RWXA 3PTWA 3SQOP 4NLXA 2QYCA 2HRUA 5HQLA 1U0HA 4YEAA 3THPA 2L48A 4ED5A 4X64F 1NRKA 3TVYA 3E01B 3MUVP 1S1VA 2GVZB 1EIYB 2CVEA 2VG5B 1HQ2A 4ZP7A 4JI0F 3HHDA 1FRKA 3HJVA 1R8AA 1F5AA 4UTGA 6FDRA 2ZJQQ 1KN6A 3BZQA 2J6UA 4OI2A 3CJKB 1SL2A 2E29A 3SSSA 1UFLA 2LLZA 3MAAA 4W98A 2R8JA 2BBEA 1UEKA 3O1LA 4FNIA 4TQRA 4EBCA 3IRXA 5CA5A 3ILJA 1VOMA 2C2DA 2YWFA 2Q6CA 3E2EA 1QE1B 2VPZB 5KFIA 2K06A 1D3WA 4F0MA 5GMDA 3BO2A 1XR6A 3B8HA 4ECTA 4R0EA 3M8WA 3MI7X 4NRTA 2DGQA 3JS9A 2FD2A 1S1UB 2IMOA 1FXDA 4DMZA 4WTYA 1JLGB 1WG1A 4B9NA 4I7FB 4PQUB 4M5HA 4UOCA 4R8UB 1KP6A 3CD5A 3KNGA 1I51B 1PC5A 4L72B 2AJQA 1OSDA 4ES1A 4DR7F 4RW7B 3D3BJ 1SJFA 1N5YB 4RZRA 2OD6A 5M2PA 3LGNA 4CO4A 3OFHA 3M8QB 1HBOB 4J9MA 3UVJB 3DU5A 2ADCA 3OHBA 3SDEB 2C2KB 1IKYA 1GTHA 2QL9B 4JI5F 4NYPA 2XNRA 2W8LA 4I4BA 1RDRA 1V5IB 3M2UA 1JNZB 1C4AA 4LR8A 2DTJA 1X9WA 4B08A 4F0KA 5AE2A 1X4GA 3BM7A 4LF2A 3EVOA 2LECA 4WYWA 4AQYJ 3CC2S 3AXMA 9ATCB 2FLPA 4AL5A 3Q8QB 5DQGA 2ZH5A 3DMJB 1R6YA 4A47A 1NJXA 3HLUA 4YY3F 3ZZUA 3IO1A 2XS5A 2G0IA 2W9CB 2N7CA 1SC4B 2QLFB 3TVKA 4CYUA 2APOA 3GCWP 2W2MP 4P6QA 3BKFA 2DIUA 2XG8A 1VGYA 2DGXA 1RWPB 5KFUA 4MKAA 1FRLA 5ITHA 2HFOA 1MW7A 5KTQA 2Z2YB 2CYYA 3R7SB 3V4MA 4A8OA 3CJQA 2AZ3A 2PIIA 4KV8A 1VDHA 4Q0BA 5HMYA 3AOAA 2ZDOA 3GJRB 3HT3A 2KO1A 2YKNA 3D0GE 1FVSA 1S7IA 2D3UA 2BE9B 1M5KC 1RT5B 5IS2A 2IYGA 3M6XA 2CPDA 2KYZA 5AJ3J 2DRAA 4ZVHA 3HSZA 4DV5F 5FDLB 4UY85 3BR9A 5J2QB 3NG8A 5KFGA 2JNJA 2RILA 3EM1A 3LGHA 1KQFB 2ZC3A 3LPYA 1C0UA 2ZH1A 2IVYA 1PJ7A 4YB5A 2GMHA 3MMBB 1C1BB 1U1LA 3C15A 1WF0A 1NJIT 3CF5Q 4WKYA 3MDFA 4UT4A 4F36A 3MUTP 1TMMA 4WFXA 1KR4A 3ENWA 2V4QA 5D0GA 4X66F 1VLOA 1WDTA 1HD1A 2KVIA 1ICEB 1BC6A 2CAJA 3V2UC 2RIJA 2G2ZA 4E2FB 1JB0C 1IBKF 1H7XA 1Q7LB 1FEEA 3VAFA 2W9AA 1RK8A 3DLEB 1N5VA 1Y7PA 1CJTA 1SJ3P 2CQHA 1TZ0A 1U48A 2J8AA 2BANA 1K44A 2ZH7A 2DH8A 3A12A 1JLQB 5ADZA 1TELA 5B0EA 2D9PA 2ZDPA 3PZPA 1VISA 3SQGB 1H74A 4DR1J 1L3KA 1SH3A 2ACYA 2E5LF 3FBCA 5E3QA 4B3MJ 2VODA 3JSRA 5GAGI 2BKNA 4W90B 4ENOA 2OFGX 2NR0A 4Y2AA 3J7ZT 1IKVA 4I2PA 2CQPA 1G3OA 5J1NA 2IVMA 4ELVA 1TFYA 4S0MA 1NPPA 5E3CA 1BGXT 1R43A 2KL8A 4KHPF 3RUBL 2WW8A 3GSIA 5IZHA 2F4FA 4EZ6A 4AYBD 1RTDB 3A1YG 4OYMA 4KGZB 4JI8J 3M8PA 1ZPWX 2BJ9A 4OJ3A 2R8IA 1KLMA 2DEIA 3KTQA 2AU0A 2NREA 1WHXA 4KBIA 4TU7A 2MZ1A 2R7UA 3VZHA 3I32A 1U1PA 3DI6B
chains in the Genus database with same CATH topology
3SYZA 4RNOA 2Q66A 4M5DB 5KFSA 1MSWD 1D9FA 4X2BA 3C6TB 1S9EB 4OLOA 4U7CA 2UXCF 2IRUA 2DD8S 1N52B 4KSEB 2HWIA 1ZH5A 1HQEA 1YI2S 1N32F 4QOTA 3O3LA 5A8RB 3PO4A 2XSFA 1H7WA 2MPUA 3OXFA 2L08A 1DBDA 1UWBB 4RUHA 2XLJA 2I9SA 2QE5A 5DS7A 3NWGA 5HN0A 2KTQA 1JJ2R 4ZPDA 5T7LB 1U1RA 3DGPA 3K5OA 2ZOGA 1HYSB 1TK5A 3KMSA 3O6QA 5HMZA 3AJ2A 4E98A 1K1SA 3MMAB 3NP5A 4HT7A 2EBGA 1VMBA 4KB7A 1WI6A 3CJ2A 3HZEA 4Y65A 3QPIA 3KK1A 2FJEB 1HARA 2YWKA 3I9V9 4X4TA 3VAMA 3GR0A 2VBYA 2FPHX 4PWDB 4UQGA 1H2VZ 1HI1A 4CH1A 3GFXA 3BO4A 4NLTA 2FHKA 1SQEA 5KFFA 2DNGA 4H4KA 2ZC4A 1DTQB 2GV1A 3DRPB 2HHXA 5GAHU 1Y4ZB 3QIPA 4OI4A 3BSCA 3H4BA 1FJGF 1S0NA 1YJVA 4ZCKA 4QJVA 4M5DA 2EVZA 1EETB 5L1KA 2AF6A 1R0AB 3C6TA 1VRTB 3LAKA 4OX9F 3HMJG 5DLFA 2KRRA 3OXGA 2V4JB 4IR1A 2PO4A 2OMOA 3FEXB 3S01A 3LAMA 4RW4B 5C42B 3BQ2A 2GFFA 4CO3A 3CMES 3T5HA 5KFLA 5A8RA 3KG0A 1U24A 2WHOA 3OFGA 2BW2A 3FSXA 4MJKA 2O67A 4F2RA 4C8MA 2AJ4A 3AB4B 1HYSA 3SFGA 4TY9A 1FA0A 4Y00A 3I87A 5HQ8A 3MMAA 1SJRA 5IWAF 1NKCA 4ED7A 2D7SA 4ZPAA 4FVMA 1MMNA 3SCIE 2MKCA 1VS3A 4R5PB 5J2MB 3Q24A 4PWDA 3BGUA 3U7JA 2MZTA 2DR9A 1S77D 3R27A 3LP2B 3DRPA 1DTQA 3CDBA 3CIZA 2OTLS 2VFUA 4X4NA 2UVVA 1KQSR 3KLGB 1G1XA 4X84A 1EETA 2GIQA 1R0AA 1VRTA 2R7RA 5DM6Q 4LFCF 2BRLA 3OUYB 3BN7A 3HXMA 2V4JA 4CO1A 1SJ4P 1TKTB 3UNGC 1IJEB 2FJDB 2LXUA 4XDDA 5C42A 1X5SA 1N0VC 3FCHA 1IKXB 3K5LA 1M0SA 3SV3A 2QZ8A 3HPOA 1HBMA 3CJ4A 1M5OC 5LJ3Y 2UZAA 3IR6B 3GIKA 2MQOA 4K4ZA 3FNNA 2BDPA 7FD1A 1IXKA 1X5PA 1MWZA 2QT7A 4NCBA 4V19X 1NJWA 1NHUA 1Y5NB 2A3JA 2KKHA 3E01A 4F4KA 1S49A 3HI9A 4KAIA 3P6YC 4YOEA 4RBVA 3E8OA 1F5BA 3DXSX 4QWCA 1CC8A 1LW0B 1VIOA 3IWNC 2A1BA 2ZKTA 2HS4A 3CT9A 4KQZA 4EYHB 4LFBF 4Q5VA 4NLGA 1OPIA 1NK8A 2VG5A 3JSYA 1D0EA 2H9ZA 2OAUA 2W7OA 3EYZA 1F5CA 1N88A 5J2MA 1HQUB 2VPYB 2ZHOA 2MSTA 3H40A 3LP2A 3FEZA 5H1SV 2W9BB 2CPIA 2N7YA 1HHSA 1L3UA 3QJPA 2BE2B 5LSRA 1A6LA 1TKXA 3KLGA 2DR8A 2LQ9A 1VRUB 3Q8RB 1RAJA 2AYEA 1CSJA 1V3ZA 4CTAB 3OUYA 1KFDA 5KFZA 1XR5A 2R2UA 1YRXA 1TKTA 2BVZA 4XDCA 4GO5X 3U1LA 5J2NB 5I3QA 1BLUA 1AFJA 4ZVFA 1K0VA 2HHVA 2V8HA 1YGYA 4A48A 3UD3P 3CCZA 1KC8T 4OX8A 3J7YI 2DNKA 2L9NA 2AYGA 1R27B 3CULA 2FC9A 3MECA 1KS2A 3N28A 4DV4F 2W4PA 4TYBA 4QZVB 1S9GA 3M1VB 2V9WA 3ZZYA 2M8HA 4PKDB 2XBPA 3DLBA 1HWJA 2GO8A 3JAMY 1SUQB 3I0RA 5DDOC 2BV3A 2KT5A 5A6WA 5EUHA 2ROPA 3RB6A 1VK3A 2HVZA 3S7RA 2JZ5A 2GX8A 2NXUA 4ZKAA 4TU9A 2N4DA 4LSLA 2XGPA 2LEBA 4K0KF 4C3MA 4NMLA 5U47A 3I4PA 2R7XA 2W9BA 4Y34A 4IRDA 4C0BA 3H2LA 2VZ9A 2V0NA 2GMJA 1M90T 2OPQB 5A8KB 1VRUA 3HHNB 2HHSA 3KMQA 2DT9A 2DITA 2MDAA 4ZP6A 3U02A 4OI6A 3T19A 4CTAA 1KHVA 2JOQA 2JLGA 3ZZTA 2CJQA 4MYUA 2KN4A 2R9LA 4ED6A 5J2NA 2E5HA 3W2VA 2DGTA 1HFEL 3RRKA 5I3UB 1UVJA 5J2PB 4BCAA 2LU1A 2A18A 2OSRA 5KT4A 4TQSA 2JEJA 1CC7A 4LF9F 3TAQA 5K8MA 3KHLA 4QPXA 2XY7A 2JEGA 2YY3A 3H20A 1R8HA 2CPXA 2JDJA 4O3OA 3KHGA 2RQCA 4LF7F 2DNNA 2BZ2A 2LA6A 5EHHA 1N8RT 1QAIA 4R8UA 3M1VA 2L9DA 4OZLA 1JJHA 3O8WA 1V9OA 2VPWB 4NLPA 2VB6A 2HFZA 4PG4A 4GC7A 1SUQA 4NLVA 5E5NA 4DEZA 4KJIA 3DLKB 3KWMA 3W7BA 5LSOA 5EWGA 4BS2A 2HPUA 4O3QA 2XMVA 4FXVA 4WE1B 4KT0C 4QR2A 4OHZA 3VAJA 1HWIA 3QMQA 4LFAF 4C8KA 4X62F 3I82A 1UJ5A 2RKIB 4CNZA 2VBXA 4F02A 4X4QA 3L3CA 1VQ9S 5DG9A 1HNWF 4C0HA 1H98A 2OPQA 5L39A 1TL5A 2CQ4A 3G6VA 3QWPA 3GILA 3AQOA 3OXLA 5CD4H 4C11B 1FCAA 2XSJA 5LMNF 2Q6BA 3PX6A 2C22A 2MQMA 4F8RA 3BREA 5F0UA 2XS2A 4JBCA 1AW0A 5B7WA 4F4ZA 4OMFG 2ROEA 2OPPB 3BEGB 4C2MA 1DLOB 2VC0A 3TUZC 2LEPA 4I0WA 4URSA 3ISZA 2E1RA 1U25A 5F41A 5KG0A 2FDNA 3IAS9 2CDQA 3SMZA 1SL1A 4M8LA 2X1AA 1S79A 1U4BA 1HR0F 2XULA 3OR1B 3HVAA 1SH2A 4OZ0A 3DHXA 1LWFB 2K3KA 2VG6B 4RW6B 3DLLQ 2EKYA 2DISA 3OL7A 4M94A 2XI3A 2O01C 1HWKA 2V4RA 5HMXA 3MPWA 3PR4A 2MZSA 4IFYB 4WE1A 2B4OA 1RA7A 4Z37A 5LXRA 5DDPC 1FXLA 2IM1A 1ZOTA 5F8NA 3G8TA 2CZ4A 1CVJA 3KG1A 4IYQA 3CXCR 1QSLA 1SB6A 5HBMB 4K4XA 3CD6S 4YDDB 2DK2A 4I64A 1RTJB 2XWXA 4OZ5A 3G6YA 2EFNA 4J9NA 3H98A 4LF6F 4NOHA 1QVFR 4C11A 4Y28C 3DLGB 3DM2B 3VAKA 1URRA 4MKBA 2EWHA 4CH0S 4L6V3 4AFFA 2LYVA 1OQ3A 2QEXS 2M70A 1U09A 2OPPA 1SJ1A 4IO1A 2FJVA 1DLOA 2CQIA 1Q8IA 2WCXA 1D8ZA 2WTFA 1TL1B 5THWA 3UD4P 4H4MA 3CCJS 2LMIA 3MEGB 2IBKA 4C97A 3OR1A 2BYCA 2E9ZA 2MKHA 3B4DA 4LUBA 1LWFA 4RW6A 4NCGA 3HK2A 1FJ7A 3KKFA 2YVSA 2EFOA 5KFTA 4DQIA 2DO0A 2F8HA 5D4LA 3U1MA 1FXRA 2DHGA 3NL0A 1FE4A 1JLAB 1WHYA 3GYXB 2YX1A 2GJ2A 1B7FA 4DV7F 3N6LA 1RJJA 2IM2A 5KFAA 1ZPVA 2B6AA 2HGLA 5HBMA 5KFHA 3BSAA 4TLRA 3MFIA 4Q8EA 4PRFA 3FSYA 1RTJA 3AH6A 3D5MA 3MEEB 1QAYA 2GGPA 4J5OA 4PXDA 3DLGA 3DM2A 5GADU 2XMUA 2AQ4A 3CWJA 3MAHA 3VALA 1YWXA 2X1BA 4YB6A 5K8OA 3CCES 4DL7A 3BJYA 1VQ6S 3I5BA 2LVWA 3MWBA 2I5JB 3SCKE 3RW7A 2R7VA 3EGZA 2YKOA 4DL5A 5JVGQ 1KOHA 5F3TA 2OPSB 4ITSA 1TL1A 3TQ1A 2J0WA 4NZ0A 4J9PA 1HNXF 1E6VA 2B43A 2EI5A 1AXQA 4NLQA 2ZBCA 4CCHA 1LW2B 2ILYA 2YQ3A 2OLWA 4DL2A 4DJBA 5L9XA 4OHWA 1T03A 2RJZA 1YJNS 1J5OA 1RT4B 1JLAA 4OL8A 1J5EF 1IN0A 2Y0SD 1X4AA 4L3NA 4WXWA 4NZ6A 1KVIA 2IJNA 3HHLC 2BM1A 3IRWP 2CQBA 4CT9A 1E6YB 4QYZJ 2BQUA 1YRTA 4HTIA 2R4FA 2WAQD 3O44A 4ZK7M 4MKYA 3HO1A 3L7OA 5IM0B 4DSJA 4K4SA 2YKPA 3MEEA 4HKQA 5K8PA 1RT5A 3PFOA 5DQHA 1U45A 1HBNB 3VAHA 4J9QA 3NMRA 5E0OA 2JRSA 1ZM2A 2I0XA 1IJFB 2MQLA 5JJBA 5F9NA 5KFWA 4J9RA 1X9SA 3PO5A 4OFZA 5DDRC 4M95A 5T14A 3V81B 2JFDA 4DL0C 1YIJS 4DL4A 3HJFA 3BF4A 2MGZB 3KLFB 1Y5LB 3DOLB 2Q3PA 4MIAA 2W4DA 2OPSA 4JOUA 2RU9A 4EEYA 4XO0A 4JV1A 4OZ1A 2PA3A 2LDYA 4DSIA 4KHRA 3CIMA 4ZPBA 2AWZA 2HHTA 1SJQA 1LW2A 2A2CA 4ATNA 1H38A 3OFEA 5DDQC 4M1KA 2ASLA 3EPGA 1TV6A 1TKZA 4N76A 4AL6A 4ALZA 1RT4A 3MMJA 4DV6F 1C1CA 2FLNA 2AW0A 2EBEA 5GVQA 3OR2B 5KFEA 2CJAA 3OQ2A 5KG3A 2B4PA 1JIHA 4GC6A 3KG4A 2MKSA 3C6UB 1E6YA 3MCSA 2Q43A 2B4VA 4DFMA 4ZP8A 2IAJB 4UY8T 4H54A 2H5EA 5KFRA 3I5AA 3N9UC 2RRAA 3TA1A 2DNZA 4FP9A 1FTRA 2ZOFA 1KQKA 1C1BA 3M05A 3KK2B 1VQOS 2JEIA 2XY6A 2VPXB 4X4PA 3K57A 2FVSA 3M8RA 2O5DA 2NYIA 4RW9B 4Y0FA 2MY8A 3V81A 2E44A 4AL7A 2NLWA 4J9SA 3FQKA 1N33F 3DOLA 4HH1A 1Q81T 4XK8C 4JI4F 4OHVA 5CQGA 5SUHA 3VR1A 2DGVA 3WX4A 5KFMA 4WZQA 1T8EA 3CCRS 4RKUC 2WONA 3QJLA 2DRBA 1QLNA 3B4MA 4MTPA 1D9AA 3Q2SC 3MZIA 2YH1A 2FJBB 5AXNA 1DQ9A 1APSA 2ALZA 1R8BA 2VASA 3M32B 2ZH4A 1NKEA 2FUG9 2YNGB 1JXLA 3NCQA 2FJXA 3MM7B 3PEJA 2EG2A 5B0DA 2YH0A 3OR2A 4MK9A 3J7Z5 3T1YF 1LFPA 4J9OA 4G1QA 3C6UA 4KO0B 4DR1F 2CQ2A 6FD1A 3SCJE 2IAJA 3RYLA 1S1XB 1S6PB 1FKOB 2ILZA 1T94A 3CCWA 3IC1A 4H4OB 5KAKA 4GO7X 3LALA 2VL1A 1ZETA 1SL0A 3H59A 3HFKA 2EK1A 3IXQA 3FEYB 4IFVB 1N48A 5IQQA 1BD6A 3FGVA 3KK2A 2W24A 3VAIA 2AYMA 2FLLA 4RW9A 1VK8A 3GV5B 4USIA 1SV5B 2YWHA 4ECRA 2OSQA 4K5SA 2WRMA 3WDOA 2MKKA 3KHRA 1JX4A 1NO8A 4WZMA 1WG4A 3HM9A 5FIIA 2VKZG 3N5FA 4N47A 5L9NA 2OMLA 2YWGA 4ID5B 4TU8A 2CVIA 2HVHA 2D1CA 3D1OA 1PSDA 5HMWA 3IWXA 4JI7F 2HFNA 3M9MB 1KVJA 4IH6A 3M32A 4ICLB 3H5YA 2YNGA 4B9MA 4JYAF 3K7RA 1XTZA 1XWLA 2CPHA 3MM7A 3H2VE 4ED3A 1YHQS 4F2SA 2HNDA 4RNHA 4A8YA 5E33A 1RT7B 3EPIA 1UVLA 3DRSB 3OVBA 4KO0A 1B0VA 1H0HB 2NPIA 3DNCA 2QO3A 3T5JA 1S1XA 1HA1A 1FKOA 3HX9A 3SQGA 4C7QA 4GMKA 3RZAA 3KLEB 4EBDA 4DQQA 3S1TA 1U1QA 3LUYA 1G7CB 2RB7A 2A10A 3AA8A 5FJ4A 4QW9A 5F8GA 4B3RF 3PNIA 1HPZB 3RB0A 3B78A 2GMLA 4RUCA 2MHEA 2LCWA 3L09A 3RBEA 1IQTA 1X4DA 2CFXA 3NRBA 3GV8B 5F8JA 7FDRA 4IG3B 1N56A 4I67A 5DG8A 2DBBA 4DR3F 5EGYA 2OTJS 2OPRB 3T5LA 1TP7A 1QUPA 2IMWP 1VQ7S 4ID5A 5IXUA 2K3IA 1SI9A 3DYAB 1YJRA 3VCDA 4ZHRA 5LXYA 4ZS6A 3RW6A 2ZNYA 4ICLA 5M2RA 4ZPWR 2XB2D 2WB4A 3BO3A 5CYMB 4ECYA 2CKWA 4ZPTR 5KFVA 3QZ8A 3TRGA 2BQ3A 1RT7A 4OJGA 1IBMF 2CQ0A 3N5BA 1TAUA 1JLBB 1UL3A 3OTOF 4F3MA 3OHAA 4A8MP 2YNIB 2GO9A 3IA0A 2ZFHA 1FD8A 4TY8B 4IH5A 2C42A 2IM0A 2DCLA 4MH8A 3RBDA 3CCSS 4GKJF 4R25A 1HPZA 2DH7A 3MR5A 2G0CA 4OZNA 2B7CB 4U7UK 1D9DA 2Q1LA 4DG1B 2PT0A 2U2FA 4IG3A 4CI0B 1BY9A 1LK7A 3F41A 5I3PA 3ZZOA 1ZYQA 2ZH3A 4NA2A 1P9QC 4O44B 1P1TA 1XN9A 5D4PA 3ZZRA 5IT0A 4D3GA 1RTDA 3TYTA 1GNKA 4PPDA 5KOWA 3C2PA 4PXEA 2CQ3A 3ISND 2E1AA 1QAJA 3DYAA 4WU3A 1SC6A 3PIOQ 4JI3F 2XCPA 3NCRA 1HD0A 2JLEA 3PW7A 4WIIA 3JSBA 4FXWA 5MAOA 4MK7A 4EU0A 4UW2A 5B0CA 2ZKUA 2B4UA 1DURA 3KYLA 1CLFA 1BQMA 1RT2B 3ZC4A 4N5SA 1F9FA 3S8SA 4IH7A 4DS4A 2YNIA 3X3UA 5KFYA 1L3VA 3CD7A 3THVA 2DJWA 2MQNA 2X51A 1DFDA 4D3HA 2KJVA 1J2VA 2V5HG 3I55S 4OHYA 3TAMB 2CQDA 2FVCA 2UUAF 4KPYA 1FDNA 2GIRA 5KFJA 3HHEA 2R7SA 2VOOA 3CO9A 3P5TL 4HL9A 3WC2A 2Z0GA 3VTIA 1O8BA 4DG1A 1OIAA 2L3MA 2ZH6A 3KJVB 4F50A 1CQMA 5IT9Y 3ZZPA 2F9JA 2M9KA 4CO0A 1S6QB 4O44A 5KOXA 1I94F 3Q8PB 3CTRA 3KLHB 3DI6A 2DCUB 5D77A 2HMIB 4NLUA 4MK8A 4TLQA 4BC7A 1QSSA 1S9EA 3P3DA 2ZE2B 3IFEA 2UXDF 1UAWA 3D1QA 3MD1A 2ATLA 4RU9A 2XMWA 3RAQA 3TOQA 1T3OA 2ROGA 4OI0A 1S6OA 3M2RB 3NKYA 1UWBA 3UFCX 1UFWA 2D9OA 2HQ3A 3M9OB 2MQPA 1V3RA 2QIFA 4I6WA 4YDXA 4Z2XA 4NRUA 2LXFA 5E3RA