4JI6F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji6F00
1IJEB 2UXBF 2UUAF 3OTOF 1CQMA 1HNZF 4DV5F 1XNQF 1IBKF 4JYAF 4JI7F 4LF6F 4OX9F 3R3TA 2F4VF 4B3RF 4DR4F 4JI3F 2KJVA 1VMBA 5LMNF 1QJHA 4DV3F 1N36F 4NXNF 2B7BB 4JI1F 5BR8F 1LOUA 3ZZPA 1N34F 4LF4F 1CQNA 2UXDF 4X64F 4AQYF 2VQEF 4DR5F 4LF7F 2BVZA 1HR0F 4JV5F 3T1YF 4LF9F 1IBMF 2UUCF 4NXMF 4JI8F 4B3MF 4DR2F 4JI6F 5IWAF 1G1XA 4DV7F 1IJFB 2YY3A 4JI0F 4LFBF 4DV0F 4LFAF 4X65F 2ZM6F 4JI4F 4B3SF 4DV4F 1F60B 2E5LF 4K0KF 4GKJF 4YY3F 2B7CB 4X66F 4JI2F 4DUYF 4DUZF 1I94F 1N32F 1FJGF 1N33F 3T1HF 2RJZA 4B3TF 4JI5F 1G7CB 2UXCF 4DR6F 1GH8A 1XMOF 4LF5F 1HNWF 5LMUF 4YHHF 4DV6F 2UUBF 1J5EF 2UU9F 4DV1F 5AJ3F 4GKKF 1HNXF 4LF8F 1XNRF 1RISA 4DV2F 1B64A 4KHPF 2HHHF 4LFCF 1XMQF 4DR7F 2BXJA 2VQFF 4X62F 1FKAF 1IBLF 2J5AA 4DR3F 2KJWA 4DR1F
chains in the Genus database with same CATH superfamily
1UFWA 3ZFVA 4UOFA 3C14A 1VHFA 3T1HJ 4IG3A 2IIHA 3Q8QB 1RHKB 4O44B 1QAJA 3RJMB 3JTOA 4ATNA 4X2BA 2QGFB 3CVKA 2DEJA 1YGYA 2GVZB 4ZP6A 4CWBA 3SYZA 3IGVA 1IJFB 3A3PB 1BGXT 1XMBA 4YB6A 4EBCA 1NK7A 4MYUA 1OPIA 1TQLA 1HNWF 2XMUA 3RB3A 3W9HA 2A18A 4FVCA 1RT3B 4IG3B 1L3SA 3HZEA 3AH6A 1R8HA 4NXMJ 4DWIA 4NA3A 1ZM4A 1FNMA 3H2UB 3SI8A 1SPBP 3NGRA 4DX5A 4NZ7A 3C46A 2V8GA 2MQQA 4YP3A 3AJ2A 4B9VA 3J80Y 1S9EB 4KH0B 3K2YA 1DURA 5KTQA 4RPFA 1FDDA 4P75A 1RT5A 2RD5C 1WKJA 5FLXU 3OL9A 4ZN1A 1S48A 2VFUA 4PPDA 2AGOA 3EGZA 3SSQA 3BGLA 1B7YB 3U1MA 1B70B 5CZVA 1TV6A 4IH7A 2K2PA 5KT3A 1Q5VA 6AT1B 4K59A 1BMQB 1UWBB 4R8UA 4P2XA 3NLCA 3BGOP 3FFIA 4JBCA 2EPIA 3M30B 3O2IA 3MMAA 4FPIA 2QLWA 1VQKS 3UVJA 3PG9A 1Y3JA 1VJQA 2E1RA 5EGYA 5IT4A 5KOWA 1SIWB 2JFDA 2AYBA 2EKYA 2OEJA 2CJQA 1WD6A 4RW8A 2EBGA 2WVCA 3D67A 4F50A 3MR3A 1TV6B 1CC8A 2HNZB 4A48A 3CCSS 1UAWA 4Q2MA 2ZITA 2PIIA 1RE1B 3IP0A 3R3TA 1IBMJ 5E2QA 1X9WA 1ICEB 1HHTP 4FYDA 3DKDA 4IYQA 2FPHX 4NEYA 2DPJA 4ZK7M 4NA1A 3MEKA 4LT6A 2OPRA 4O3RA 3IGNA 2HFVA 4WBFA 4HACA 1U6ZA 4RW8B 3Q86A 4IRKA 2ZOGA 2KYXA 4MKVA 3DLEA 3NAHA 4LFAF 5D6GA 4CZCA 1OO0B 1X5OA 4LR7A 4AFFA 4C11A 2XI2A 5J2QB 4Y28C 1Q8IA 2MLXA 5D4PA 4J9RA 1J5EF 3C2PA 3GU0A 2MQOA 1XNRF 2IVYA 2AQ4A 3H98A 3Q83A 4C8YA 4H4MB 2NXEA 1F9HA 3JAMU 2HURA 1YKWA 4DZDA 4F3QA 3DDKA 3KNAA 2VASA 3JQMA 4I6AA 2BMBA 4ICLA 4E0DA 3M7VA 5LSOA 4FVMA 4Q8FA 1JMTA 2RU3A 2MZQA 1KLNA 5BR8F 1C0UA 2P6TA 2DO4A 4TY8A 2IRYA 4NRUA 3LP0A 1HPZA 3QBCA 3MR7A 2DNPA 4J9SA 2UVUA 4BLGA 3BYPA 2ALYB 3T9NA 1RWXB 4UT4A 5JVGQ 4DEZA 3C66A 1HQUA 5B0BA 3HSDA 3GSDA 3BDPA 1RBLA 5LJ5Y 1J27A 2DYAA 4QWBA 2LYVA 3MHYA 2PFFB 2OIHA 3OQ2A 5LT5A 3AD7C 2F63A 1M5KC 2M88A 3QLHA 5CYQA 1YG0A 1RTHB 3HKZD 4ICLB 4JI5F 1UPMB 3BGUA 3LF0A 4DLEA 2HQFA 2CQ3A 2WHOA 1C2PA 4LF8F 1C0UB 4JV0A 3UCGA 1S6UA 4JI8J 3HT3A 3LP0B 2H5EA 1HPZB 2HS0A 5IWAJ 1YX2A 4M5JA 2YBVA 1FKAF 3OVBA 1FKOB 4OFZA 3UN5A 2B9WA 3TI0A 5E41A 1VQ8S 5DQIA 1T9VA 4E98A 1T11A 3A12A 4P7VA 3H40A 3F73A 2KZZA 1LV5A 2KO1A 1HNXJ 3OXLA 4DCOB 4KBIA 3K5LA 3HMJG 2VL1A 4NLYA 1OIAA 1G1XA 1U2CA 3RB6A 2PEBA 3HCXA 2IPOB 5AJ3J 1WSRA 4ZKAA 2M7SA 1T3NA 4QPTA 4X66F 1H73A 2C3YA 3R5GA 4Z7CA 2C1EB 2XHWA 1O6XA 5IOLA 4J37A 4PAAA 2FD2A 4RU2A 3JQJA 3H0PA 1CJTA 1HWUA 4PUOA 4PG6A 1R8BA 4LRBA 4AL5A 2UU9F 1SKSA 4JI7J 2DTJA 3MF5A 4K2JA 1E6YA 3QJPA 1R7IA 1RUSA 3QWPA 2IDEA 1P9QC 3QFWA 5HQMA 3DLHA 3SFGA 1S99A 2H5JB 4OX9F 1BUXA 2VB6A 2RMLA 1Q4RA 2ASYA 3BF4A 3NS5A 2ZZTA 4C48A 3ELHA 1AZSB 2F8HA 1F6TA 2COLA 1BE4A 4KO0A 2BA9A 2UVRA 4LF2A 5CYMA 4AXJA 1Q8LA 4URGA 1CJTB 3TQ1A 4F4ZA 2NUUG 2KDOA 1WF2A 3VGSA 2YWGA 1E6YB 2W9CB 2NR0A 1JXVA 5L9NA 4PYDA 1DQ9A 3Q89A 1IQZA 2D1CA 1CULB 4DN0A 5IV3A 4TU8A 3HHDA 4JUZA 2JLFA 4LF5F 4CNYA 4KY3A 2J6SA 2IJFA 3ET6B 1RAIB 2VPYB 1HBUA 1P27B 4ZJOA 3PRBA 4YDXA 3HJFA 2XS5A 2IJRA 2A6MA 5CCLA 2HAIA 3R9LA 1DZ5A 3GIIA 2J8SA 3W8GA 3DNCA 3TZZA 3FDSA 2CQPA 3JSMB 4RBUA 4OYPA 1B0VA 2BE7D 4QR1A 1TKXB 3HSGA 2AJ4A 1FXLA 1YITS 1VMBA 5GMDA 1X31C 3OTEA 5DLFA 4TKTA 1JNZB 3P5BP 4AQYF 4AXIA 3N6NA 1SJRA 3TAMA 1RACB 2CQ4A 2RNEA 4OV1A 1TKZA 3ZXWA 3PIOQ 2V8VA 3GB0A 2FVPA 1JWWA 3V81A 4ZA1A 5K20B 4DV7F 3M8YA 5E3PA 5GADI 1KTVA 5FDLB 3D1QA 4Y3CA 4GKJF 2EFGA 2AD9A 3CJKB 4QWCA 2J0XA 3VV2B 4C98A 1YWXA 4OYZA 4ILRA 3HVAA 4NRTA 3HT0A 3CC7S 2H4YB 4TLRA 2MXYA 1YI2S 2ZH1A 1U7LA 2WSCC 1I5OB 5THWA 4G1IA 2GCFA 3FK4A 2CZ4A 2XGQA 2GA7A 4NPOA 3DYAA 3RRGA 2AJFE 1FO1A 5ETTA 5IT9U 3V81B 2O67A 3BN4A 2CNNB 3NS6A 4LF6F 4ZVHA 2NXCA 5LMNF 4C8KA 3DRRA 3GE9A 1IKXB 1HR0F 3GP9A 1RA6A 3IS9B 2WONA 3ZTRA 1N33J 1X5TA 5DETA 4IFVA 4OI6A 4BWMA 2X3DA 4AE5A 3R5BA 4K4SA 3JYTA 2BW2A 4IDKB 5CYJA 1RWMB 1WKKA 1RHJB 1VIOA 1GH8A 1IR1A 1S1TA 3NNHA 2QG9B 5CH7B 2IAJA 4DV6F 2HZVA 2D9OA 5DDOC 2UUBF 1KKHA 3IG1B 2B8QA 1JLFA 5KT2A 3JB9k 1UVNA 1RTIB 2W4CA 4IO1A 2KG1A 3PTWA 1TL7A 1FK9B 2OI2A 3BV8A 5KFUA 2Q79A 1MU2A 2K3KA 2VG7A 3G6XA 3CJRA 2GJ2A 2DT9A 3MPDA 2DXFA 2KFZA 4AUKA 5F9LA 2XQCA 1RT1A 1WG1A 1FI4A 4QR2A 4RO0A 1VFJA 4DV3F 4OX8A 1HARA 1N5TA 2YXLA 1R43A 3SCIE 2RRNA 3KK3A 2LU1A 1HBMB 2IAJB 3RAQA 1Y3KA 2NYHA 4YB5A 2G0IA 2HHPA 1APSA 2HBZB 3T1AA 1RWVB 3W9JA 3MD1A 1F5BA 4OZ5A 2HNDA 3Q22A 5KFJA 3CIZA 4DUZF 1VRQC 2VICA 4B3OA 1JB0C 3L7UA 1VQNS 3PDNA 3T9ZA 3LALA 3P49B 4OZ3A 4HVZA 2XB2D 3TZXA 4MKYA 4F0KA 2ZH2A 3LH2S 3GG0A 5EDWA 3KK3B 3I55S 4C2MA 4JI0J 2ILZA 4WFAQ 1YTYA 1C1BA 4B9MA 1FEHA 2VF3A 2OKQA 1RAFB 1HNVA 5D15A 4F26A 2V2VA 3IBWA 3PCOB 3D6HB 1U8WA 2KB2A 1HA1A 1UETA 1U48A 2AZ1A 5EN1A 4J9PA 3AJ1A 4DV2J 5C42A 2DGOA 1N8RT 4ZVUB 2ZJQQ 1FJGJ 2V9WA 4FXWA 2LEPA 1S72S 3IR5B 4CM2A 2KL8A 3T5HA 4FPRA 1HFEL 2W2NP 5HP1A 2YX7A 1TMMA 2AWZA 2ZHOA 3IFEA 2HWIA 4EYHB 4K5RA 3V6DB 1C1BB 2R8GA 1UA1A 3M4XA 3R5AA 4KB7A 4YDDB 2DBBA 2KRRA 2GJFA 4YN3B 3B4DA 1HNVB 1RLCL 2E7XA 2BANA 1VQ5S 2C2ZB 3T1YJ 4M5IA 2HHUA 3TUIC 2BRKA 2JRSA 2VFSA 1SCJB 2W24A 4ZP9A 2XTJP 2NCKL 3SIPB 2J5AA 3OFEA 3H4BA 3K7RA 3IM8A 5D8HB 3GJSB 2VZ9A 1Z2LA 2E9RX 3C6UA 2C22A 1LW0A 2Z2ZA 2H48B 1FDNA 3ZTSA 3M2RB 2EVZA 3ENAA 4GVLA 1SH0A 1ACMB 3DU6A 4DV0J 2HQGA 2GX8A 2B9XA 1M1KT 2AMCB 2CDQA 2Y3YA 3NS7B 2OO4A 4M5DB 3QT8A 3FQKA 2UXCJ 2B9EA 1UW9A 3DOMB 3CCLS 3Q2TC 1RDRA 3D1OA 1S1UB 5F0UA 3BS9A 2IMWP 4B3RJ 1NMEB 1S77D 4LRDA 3FBBA 4U7CA 2CVEA 3D4JA 4M8LA 2VONA 4DHVA 4P7TA 3V5RA 2YKOA 1LW0B 1KVKA 3L4BC 3R7NB 2CA9A 2G1DA 3T6BA 3M9NB 1IBKJ 4GKKF 2PMWA 2CG8A 2R8HA 1YK9A 1RLDA 3QT5A 2B56A 1M1GA 4MKBA 3RUBL 1FKPA 2ROPA 4ZOSA 3UD5A 2W9AA 4WIQA 3KTQA 1SH3A 3SXLA 1TUVA 3ZNUA 1FDBA 4NXNF 2VBZA 4X4OA 4BWJA 4NLTA 4DR5F 2F9JA 2E1MC 3D2WA 4P71A 3LP1B 2NSBA 4A8OA 3QFHA 3PEJA 4QU7A 2KXNB 3W8PA 4B9NA 1MG7A 3MM8B 2V8HA 4RW4A 2FHMA 2QTWA 5A0YB 3M1VA 2DHHA 3VAFA 3M8RA 2EW9A 2HHSA 2ZNZA 2HGNA 2POKA 3RBEA 4NZ6A 1FKPB 4DR7J 3JTNA 3QGGA 1YJ9S 4OQJA 3FBEA 3GFYA 3EGWB 4C4WA 3W62A 2EG2A 3VAIA 3PM9A 4FF3A 3OTOJ 3M8WA 2HRTA 2BKNA 4ER8A 4N47A 3PJXA 4OZ0A 1JX4A 2ZHBA 2CQ0A 3A1YG 2MSTA 3KG1A 2FJEB 2X1BA 1WC3A 3FUYA 3CCQS 2CNKB 2YKMB 4LIWA 1NM2A 4O23A 4GRSA 1A0OB 1D1UA 3G8QA 4RW4B 2EBEA 4X4VA 3TZWA 1EARA 2J9CA 3HFKA 2GO8A 4EI2A 1RI7A 1WOOA 3KHGA 2FIUA 5J2NA 1Q8BA 2DRDA 4NI2A 2DR6A 3R5CA 2C3MA 2LEAA 2N7CA 1OY6A 2PEHA 1QAXA 3Q8YA 4UUXA 2DNKA 5AE1A 4R0JA 3M8QA 6FD1A 1HQ2A 1K47A 3UPFA 4W4MA 1WEYA 3OR2B 2JWNA 4YR3A 2DNGA 1U26A 4H4KA 1JLEB 3KK2A 2JJ4D 2C2NA 4IG0A 4ZCIA 3FKBA 5HMYA 2A2DA 3PRDA 1FEEA 3PYEA 3FSXA 3V4IA 2ZWOA 1SC6A 1MN9A 2M5YA 3H8YA 4GC7A 2Y1JA 5J2NB 3IRWP 1X4HA 3N79A 4JI1J 1VRTA 3BGRA 1N48A 1Q95G 1VQSA 1T95A 1G3OA 4PG5A 1UFKA 4ZPDA 5HROA 2I38A 5KT4A 5LM7E 4GMKA 4YEAA 4K4VA 3M8QB 3BSNA 1UWAA 5J2PB 1IKYA 3HD1A 1KOOA 3NRBA 1YRTA 2MY8A 2OP5A 3A8KA 2F7VA 1RAJA 2CIMA 3GIRA 2G2YA 2DNLA 1ITPA 4C97A 2V94A 2OUGA 4A8MP 2CNOB 4WFZA 2GGPA 5JUMA 1S0NA 3MECA 2QFJA 1NSQA 4DS5A 2MSSA 4X62J 2KG0A 2BJ7A 3D6FB 1H6KX 2W2OP 3LP2A 1UL3A 1DRZA 1EETB 2F4VJ 2N7YA 4K0KF 1HWKA 3I0RA 2NPIA 3NGKA 1I94F 4BHQA 1S1VA 2HEKA 4I67A 1Y9OA 4NA2A 4X4TA 1Q79A 1IKVA 2FUG9 3UFCX 3HD2A 5C25A 2R7XA 4ZVGA 1KD1T 2YKNA 2WW8A 1TU0B 2XY7A 3R2DJ 4CLSA 3DOKB 1AUDA 1W2IA 4F2SA 3TUJC 1PIEA 4OZNA 2MKHA 1X4DA 2GGPB 3KG4A 5L1KA 1VQMS 1JLQB 5J2MA 1RTZA 3PKYA 3CO0P 4UZCA 1ZETA 2QN6B 4WTYA 2QZ8A 2BDPA 3ILOA 2GO9A 3CC2S 3I0RB 4V19X 4AT1B 1S1VB 3K5MA 1FE4A 3QRRA 3D3CJ 5DG9A 1IKVB 3KJFB 1NJZA 1U1KA 1REGX 4B9TA 2R8IA 4Q7AA 2V0NA 3RYLA 4EEYA 2VC0A 2D74B 3G6VA 5DDRC 5F8NA 4C8NA 1WTBA 1KFSA 2HPUA 1N54B 1UCNA 5M2UA 3S01A 2R7QA 1N32F 3MDFA 4YB1P 1U8SA 5J2MB 1EHWA 3MCSA 1HWLA 4PQUA 4JV5J 5C2GA 1W25A 2WBMA 4F8RA 2VG6B 3HJVA 2XMWA 4DL0C 2VDHA 3I56S 1WI6A 3OTBA 1LXNA 2BRLA 2YNFB 4HI1A 3BH6B 4OHWA 3L7OA 5HLFA 1GXLA 2AYGA 3DLKA 2KU7A 1V9OA 3GLJA 5C24A 2M8DB 1KHVA 2V9KA 2XZWA 2OFGX 1NRKA 4ZPCA 4DX8H 1SKWA 4FBTA 1TK5A 1TKTA 4M5HA 4WPAA 3RU0A 2Y0SD 2E1AA 4C3LA 4RW7A 1S5ZA 3PO5A 5HVFA 1AFIA 5F3TA 4P73A 1T3OA 1GX6A 4QBUA 4RWXA 4QIGA 2FTRA 2V69A 2W7AA 1JLAB 1S0VA 4K50A 1NK8A 3K5NA 2IJNA 2DO0A 2E5LF 2BQUA 3QZ7A 3E51A 3D28A 5C2CA 5A8KA 2JEFA 2ATLA 3DLKB 4J9QA 2OPPB 1JLBB 1YVFA 4TY9A 1FTRA 1Y5NB 1HQEA 5C24B 4A8WA 2LLZA 3H42A 1H2TZ 1T8EA 4KPYA 3QMQA 1WC4A 2OJ3A 3ZZZA 3A8JA 2DIUA 1VOMA 3UO0A 4DOZA 4KHPF 3AAWB 2EXUA 2BXJA 2AEFA 1LXJA 3UR0A 5KFCA 4IFYB 1FERA 4AYBD 2IM0A 3NMRA 1QD1A 4RW7B 2WVBA 4F2RA 2ACYA 3CCMS 4H4OB 2NS1B 1XNQF 4DG1B 3DXSX 1RHRB 4WP3A 4CH7A 2CXEA 4MK8A 1VS3A 1HI0P 1SC4B 4LRAA 5F41A 4ZN3A 4I2QA 4FBUA 3I31A 3KLGA 1GMVA 1L3TA 4U8YA 2YQ3A 4LFAJ 3SDEB 1AA1B 4QW9A 2Z2MA 2RS2A 2WVEA 5C7PA 3PNIA 1C0TB 3AODA 3HSZA 2ZUAA 2KHCA 5KG5A 1L3VA 2MB0B 2HIQA 1SL1A 1CBKA 2R8KA 4LRCA 3QIPA 1M5HA 2HQIA 4Q0BA 2C42A 2RJZA 4KQZA 1LWFB 1FVQA 3F44A 2LDYA 3MM7A 1H38A 2B0GA 5D4NA 1ZM9A 2E5JA 2QX0A 4QYRA 3K57A 5CD4A 1HKAA 2GMLA 2GMHA 3KFWX 1JXLA 3D1HA 1P8GA 3N9UC 1S6QA 5KT6A 3R1HA 1LWXA 3A8IA 2DY9A 4Q2LA 1T02A 2L9WA 4MIAA 4OL8A 1R31A 2CPIA 3RRHA 2VKRA 2UXDF 3M8ZA 1IN0A 2WBRA 1OJ4A 2C3PA 5HAOA 4I7FA 4AD6A 5JXSA 4TN2A 4JI5J 4JI6F 3TVZA 3HM9A 4WXOA 5FJ4A 2ZZNA 2DJWA 2R7RA 1RCXB 1RA7A 4WJBA 4ZVQB 1PC4A 3OJSA 2QRRA 1S6QB 2NZCA 2N4DA 1FFGB 5KFQA 2CKWA 4ID5B 2MKJA 3TEGA 1RBAA 4LVNP 4L73A 2H1YA 2PA3A 2UV8G 2FY1A 4O3QA 3PHTA 4ZIVA 4OHZA 1PSDA 3P3DA 3G86A 3FSIA 3MUMP 2EFOA 1F0XA 4DR4F 3HHLA 2DHXA 3MAQA 2RRAA 2XLIA 4ENOA 1N36F 1RWPB 3QRPA 4DSKA 4F4AA 4YHHJ 4G6VB 5EWGA 2HBRB 1T05A 1CJKA 5DZ7A 2CPZA 1VCTA 1BQMA 1XTZA 4NLOA 4R0EA 3AQOA 1V3RA 4MJKA 5A8WA 4DCPB 2KM8B 2VHGA 2HG4A 4HHJA 1BC6A 2VA2A 1CEZA 3UD4P 3DGPB 1HBOB 3D6TB 3HPOA 7FDRA 3PW5A 3EXYA 2UU9J 3H20A 4ECRA 3KLHA 3L09A 1KLMA 4K8RA 2OPSA 1U1QA 1N6QA 3GJTB 1XBWA 3QYYA 3GIJA 3DFEA 1U4BA 1MSWD 3MI7X 3NP5A 1WEXA 1RU1A 5D0HA 2BW7A 1G6BA 4OX7A 3MAAB 3G6YA 4TYBA 1S4EA 4OX9J 1PJ7A 2B5JA 2I8EA 3THPA 2ATCB 4TLQA 2QT7A 1T05B 7AT1B 1HWJA 3MUVP 1CG2A 1N5VA 3FEYB 5KG0A 5A8WB 2AIRB 1VQ7S 2XMKA 5HVGA 5IM0B 3CJ2A 3I5CA 1R0AA 4OI4A 2V2QA 4WFNQ 4B3TJ 4YFUA 1JQGA 2NYIA 1FFSB 2J9DA 3IR7B 3T19A 1N34F 1N6QB 3CCRS 4TNOA 1S0MA 2AZ3A 3I9ZA 3UN2A 2RU9A 1RTDA 2DHAA 4DZ6A 1PBAA 2MQPA 2MPUA 3AY0A 1Q7YT 3BO3A 2RDIA 5HANA 2MHNA 3KLVA 3I5AA 2UVWA 3RBXA 2DB1A 2CWXA 4CNZA 1QY7A 5I3QA 2BE2A 2MLYA 4LSNA 2LDIA 1TVRA 2FLPA 3MTJA 4M5LA 5CXTA 1SUQB 2WRMA 4PXEA 3FGVA 1U02A 1J5OA 4QJVA 2I2YA 4BC7A 5IXUA 1O51A 4URQU 3MM6B 3RTVA 2YPZA 2LA4A 4NLXA 4ZVTB 3MM9B 2OH2A 1AB8A 4RNNA 1Z1ZA 1QSSA 4DLGA 5GADU 2FVCA 3GYGA 4R5PB 1IWAA 1PO6A 2Y8WA 3CJ8A 2I6WA 2A1BA 3T6JA 4AQYJ 5K5MA 2J7UA 1YZ6A 3CCUS 1RHMB 1NPPA 2RHQB 3IRXB 4K2XA 2WVFA 2MZSA 5I3PA 2ZH7A 3MD3A 1TVRB 3BSCA 4MIBA 5MLCV 2W7PA 3FNNA 3A3NB 5ETRA 4UZBA 1NKBA 4IO9Q 2PT0A 1J5OB 4GKJJ 1R8AA 3N0VA 2IM3A 2ZBIA 1XMQJ 1H72C 1TL1A 4YOEA 3Q2SC 4DPXA 5HBMA 3VAGA 3SCLE 3VQTA 1T7PA 4CLUA 4B3SF 4FN5A 2E29A 2CADA 3QO9B 5AXNA 5B09A 1TFWA 2V4JB 4ED2A 5IQQA 3G6ES 4ZDNA 2MKIA 4PWDB 3KHLA 4X64J 4S0MA 4Z37A 5D3GB 4N8NA 2M3DA 4DPUA 4LF6J 2JSXA 2UUCJ 4KV8A 1DJ0A 2WB1D 2IVMA 3PZPA 3NBPA 3DGVA 2FJVA 3SQOP 2I5JB 1RAGB 2GQCA 1RT6B 2XZDB 5B0FA 2Z30B 4OMFG 3BSOA 3HDSA 4C6AA 2QA4S 3BZQA 5HBMB 2MEWA 2VU5A 3Q24A 1NCLA 4ITSA 3ADAC 2H3EB 4WCEQ 4RW6A 2QA1A 1ZTWA 4J9LA 5LL6d 2H65B 2YY3A 1SJ1A 2GMJA 3SMZA 4KV8B 3GONA 4PRFA 3HVRA 2UUBJ 4X65F 2DNMA 1REVA 1FD2A 1WG4A 2VOOA 1U0HA 4ETXA 5B0GA 2YKQA 3S6EA 2E7WA 3MUTP 3R6GB 2C2RA 2Q6CA 2ASLA 1A6LA 2AV5A 4A4JA 1JKHA 4DV3J 3RAXA 2YH0A 4ZCKA 2HQCA 2BEFA 2DCUB 3ITHB 1RWUA 3CCES 3D68A 4OI2A 1FNOA 3IBCB 3MCOA 2RQCA 2XSFA 3W61A 2OSRA 4D3GA 4EO6A 3CCVS 3ZNJ1 4OYMA 4RBVA 1U0HB 5DM6Q 5HK4A 1K73T 5GMKa 2VD3A 3CC4S 4RUBA 4UOHA 3BEGB 2ZD1B 2JNJA 1QTMA 1ZH5A 3CSKA 2JLEA 4DUZJ 2BJDA 1OYDA 3JAMY 5KFBA 3HP6A 1T9YA 2R7OA 1FRLA 1JKHB 4N76A 1NJXA 1N5YB 2L3MA 2B6AA 3S7RA 4JI3J 1QUPA 1GAOA 1VQYA 4RUHA 2ZH8A 1RK8A 1XJWB 2PGCA 4U6PA 2XMAA 5F8GA 3VAJA 5KFMA 2K1RA 3TOQA 2DGVA 4GC6A 1F3VA 3QRQA 4ZITA 2WOMA 2AYMA 3MCNA 2ADBA 3PJ9A 2OAUA 2MKYA 3GCWP 3TQEA 2X1FA 3PX6A 4PYAA 3W2WB 1FX4A 2I0XA 1R8PA 2G13A 1PKUA 3FMWA 3TUPA 1BQNA 4C8OA 4RR5A 1ZA2B 4LBPA 2AEMA 3DMJA 1IXKA 3HI9A 2HVDA 4OZJA 5EUHA 3OSPA 4Y34A 2ACMA 1NPRA 1FJ7A 1TL3B 2ZDPA 1S1XA 3UI3A 4ECUA 2PMZD 4WK3A 2HK3A 3CJ5A 5E5NA 2L48A 2WOMB 1N5QA 1FJCA 2E1PA 3DLJA 1R0CB 4CLFA 3M8PB 3DM2A 4DUYF 3J7A1 1ZYQA 3T1HF 4LBHA 3NCRA 2BM0A 2SXLA 2AX0A 4P2SA 2R42A 3I4PA 4G3IA 2H4WB 4ES3A 3FZ2A 3MPYA 5K8PA 4KFBA 3DRSA 2JVOA 3TX8A 3CCZA 4ZLNA 3SSRA 4WP8A 3T41A 3I32A 4PG7A 3KLEB 5L1LA 5L1IA 3N5BA 2CG4A 2ZVIA 3DRXA 3O8WA 3FCWA 4NXMF 4M5NA 2RB7A 5CHCB 4DSEA 4WE1A 2DY1A 1UJ5A 2FHJA 1WC6A 2XEXA 1WSVA 1U1MA 2HVZA 2ZOMA 3NWGA 4CDIA 5KG7A 1LWCB 2HZAA 3DRSB 1VHIA 3BO4A 2ZHAA 1SV5A 3UDLA 4DQSA 2ZE2B 4EFAC 3CWJA 4OYBA 1EKSA 4RNFA 3CCTA 1NBEB 2Z57B 1HMVB 3ZTOA 3B4MA 1IKWA 1WHYA 3HO1A 2YX4A 4MYTA 4FF2A 1S9FA 2HW3A 1RYSA 3A13A 1TMJA 3OL7A 1DARA 3DOLA 4DR1F 3J7YI 4CLKA 2JDJA 2VFRA 4RW9B 2KXFA 3CNQP 1CSJA 2XY5A 3BBBA 5L38A 2KFNA 3K5PA 4MKAA 3MMCA 2VJVA 2G0CA 3GJQB 1S7HA 1T9XA 3BPDA 3ZO7A 2RILA 1Q53A 1FXDA 5BJRA 4LFCJ 1IKWB 2IC3B 3WBZA 4DX6A 1UMJA 3L95X 2WAQD 3TAPA 1Q16B 2N82B 5GAGI 5E3CA 2KT2A 4ZCMA 3RBZA 3S8SA 2CYYA 4KKOA 3EE3A 2BR0A 2KT3A 3RW6A 4ZS6A 3QT7A 4G1QA 3OW2R 2DNRA 1NO8A 2CJKA 1Q7LB 2M9KA 1BQXA 2ZOFA 1RT2B 3RB4A 2J0QD 2O1PA 1Q0NA 3GQCA 2KVIA 4USIA 2BUNA 1MROB 3IAS9 4DFJA 4L76A 1YBUA 4ETZA 1X60A 3JXOA 4NEZA 4NMLA 3AA9A 2GW8A 1SH2A 2BM1A 4MK9A 2XLKA 4O44A 5B0EA 1H2VZ 3W2VB 3C6TB 4G1QB 1GXTA 3IXQA 3BKTA 2ZNYA 5IT9Y 3DDNA 1SKRA 3PX0A 2X51A 3DLLQ 5DO2A 1C4CA 4IRDA 3I96A 1HI1A 1VI7A 4PQAA 4IQXA 4USKA 2W2MP 3CD0A 2HIYA 2FZCB 3QAEA 1TP7A 4O4RA 2NREA 1BY9A 3JSYA 2CZVC 3I0SB 3NL0A 1QTNB 2QMXA 1TKDA 4IUFA 3W60A 4B3MJ 1RT3A 2MYFA 1Q81T 1ZOTA 1HD1A 4XPCA 1VBKA 3LPEA 3NG8A 1EB0A 3W5ZA 5DQGA 3AD9C 5CZXA 3D0IE 3SFUA 1S9EA 4USJC 4DU7A 4U7UK 3D0GE 2HBYB 2VKZG 1TR0A 4K4YA 3EYZA 4ZVRB 4OLOA 3SCJE 1GEHA 4K0KJ 3P96A 2H54B 3CF5Q 5AXKA 5M2PA 4ECYA 4JI8F 4TU9A 1I94J 1HBNB 5IWAF 5KFTA 1UWBA 2ZZMA 4DMZA 4WP9A 1Y4ZB 4RJVA 1RP5A 4JI4F 2DH7A 3M30A 2DGSA 3MPWA 5HMWA 2AF6A 1DQAA 4JV2A 3TA1A 2R2UA 2XSJB 3BR8A 3K59A 1S6OA 2XY6A 5K14B 4BCAA 2ZUGA 3AD8C 1AROP 4XAKA 2BQRA 1XC9A 1CLFA 1HNXF 1PYTA 2J0WA 4A8QA 2E66A 2R4FA 2C3OA 4C8LA 2Y1RI 1WHWA 3PJWA 4QQBA 3ZZYA 2A2CA 4V19J 5DS7A 2R7UA 2HNZA 4N56A 1Y00A 2YNGA 4PEOA 3CW2C 4GVBB 5KFYA 2XC9A 3TP2A 2BYCA 1HIYA 3HK2A 3X3UA 2HFNA 4HTIA 1Z2ZA 3UR3C 4MMOA 3KYLA 2JVRA 3G82B 3PXGa 4MT1A 3TVKA 1U1LA 1ZZFA 2R2RA 1T9UA 1QSLA 2DNOA 2AJ2A 1B3TA 1D8ZA 2VFVA 1RAHB 3EZ5A 3F41A 2QFIA 3NKYA 1HNIB 5HMXA 1KC8T 4XPEA 1K1QA 2J7KA 2JEJA 5D0EA 5JMNA 4LQ9A 4EYIB 2C2KB 5J2QA 2YNGB 1VDHA 2ASDA 1SL2A 2R3VA 3PFOA 5AT1B 2MDAA 4JOUA 2ZH5A 1Y5IB 4I64A 5H1SV 4DR2J 2JHEA 3AOAA 4USWA 5KFXA 4J7CA 4H4MA 2DGUA 4OI0A 2GIQA 2AP6A 4DL6A 2MQNA 1U47A 4ZLLA 1JJHA 2W2QP 3FC9A 1UEUA 1WUUA 2BACA 3GIMA 3AT1B 5DJBA 2PO4A 1VGYA 2ZWPA 2GZOA 5B7WA 4WU3A 5F0WA 4PXCA 2VIHA 1SL0A 5HMZA 2VBYA 3GV8B 3NY0A 3SZ2A 2QA2A 1X4BA 4CLYA 4LQ3A 2HVEA 4DV5J 4PWUA 4PXBA 5U47A 4N5SA 3BN7A 4FKXA 5LOQA 2HKEA 3LWMA 2LQ5A 1W26A 4L6V3 1RTHA 2YPYA 4OIXA 5KFSA 1ZZNA 2DR8A 2XHCA 1RT7A 3KOAA 1B7FA 3OFHA 2DNQA 1AXQA 1M90T 3KDNA 3GFHA 1FKOA 3K8WA 1CJVB 3NOCA 4UW2A 1KQSR 4HTJA 3P45B 4NLDA 2KJVA 2IA6A 5LMUJ 4L75A 5J1EB 4U67Q 3EGNA 3VGTA 4ES2A 3T5JA 2LP4A 2G9OA 3OVSA 3OHAA 4A8FA 4J9KA 2V2KA 2DITA 2RQ4A 5ETVA 3NGUA 4DSFA 1RT7B 4Y00A 2QL9B 3OFGA 1NXIA 3ISZA 4BBYA 4U95A 2HFSA 2KFYA 4PR6A 5HATA 1WHVA 3H90A 1VQLS 2OD6A 5G0RB 4ES1A 4EK2A 2UP1A 3CJQA 2GIFA 2Q43A 6FDRA 1ZAXA 1Y5LB 3JTPA 2VG5B 1B64A 5ITHA 3BGFA 5CD4H 1UJ6A 4I6WA 4CH0S 2PSZA 5K8NA 1RT4B 4I2PB 1ZM2A 4DBQA 3OR1B 2XWYA 4ZLJA 3EZOA 2CQ2A 3AOCA 2LMIA 2NXNA 2AGPA 4EBDA 3AJDA 1U6BA 2J7WA 3G2XA 2LA6A 2QE5A 1NDCA 4JI6J 1F3FA 4DL3A 1M5VC 3W3SA 3VWSA 5IFMA 4M95A 1X5PA 2G1HA 4XO0A 1PAUB 4FF4A 3EDRB 1D9DA 3D7SB 5H9EJ 1AZSA 4EWTA 1B99A 2HLUA 3LANA 2Z8QA 4A8XA 2MQ8A 2VV5A 2OTLS 1IM6A 2IVFB 3MZIA 2XULA 3V6JA 2FVQA 1F5CA 3C3LA 1IR0A 2BKOA 2W9CA 2CPFA 1DQ8A 1N0VC 3DLGB 1CULA 3EPIA 1PYOB 4Y2IA 2EC0A 4NOHA 4ZVSB 2O66A 3CMES 1UVKA 3CGIA 4XDCA 5KT7A 3C8YA 3ET6A 1N36J 5T7LB 2AJ0A 2A10A 2LU2A 4N7TA 3MMJA 4ID8A 4CLPA 2DPIA 3W5XA 2CDRB 2ZBRA 3W1YC 3CB4A 4PG4A 2BJ9A 4O0IA 2IBOA 2Z4PA 1SC3B 3JSMA 2ZH4A 1TK0A 1TKXA 1V6HA 2XZTB 3ONQA 5L46A 3BDEA 1WELA 2IDLA 4OYAA 2D41A 4HT5A 3SQGA 1H3DA 1GNKA 4CRJA 2HGLA 1LW2B 2B51A 1C1CB 4JI0F 1G2EA 3GTYX 4UQTA 3R2CJ 1Y10A 4M5GA 1IUJA 2MY7A 1O0PA 1VQ9S 3MEEA 1NU4A 5FDLA 3KK1B 3CJKA 3PW2A 2LQ8A 3K89A 1KN6A 4HT7A 4DV2F 5KFEA 4F67A 4UOCA 4Q43A 1S7IA 2FDNA 3MOJB 1N34J 1DTQB 2DK2A 1U49A 4F04B 3SQGB 1X9MA 4DV4J 4O0NA 2JH3A 3KXDA 2LCWA 2ERRA 2QLXA 3TRGA 1UVMA 4NZ0A 2QSWA 1LQ9A 4IOAQ 1VRUA 4ECSA 1DTTB 3U1LA 1YJTA 2Y9HA 3I9V9 3MEEB 3HHLD 4O4GA 1IKXA 3T1YF 1D9FA 1TTHB 5LSLA 4UY8T 3KUEA 2N3OA 3HKWA 4QW8A 4FYWB 1D8YA 3E01B 3IS9A 3THTA 1HNZJ 3VAMA 4RL1A 3HSJA 3UQSA 2K7JA 3LA0A 3MCMA 3BB5A 1N4LA 2HVHA 3PFEA 4IDKA 1HW9A 4DPOA 1S6PB 1VQPS 1KVIA 3BKUA 1K1SA 4C0HA 2DH8A 2BJ1A 1VRUB 3VTIA 1OMSA 4ANEA 3IG1A 2AKWB 2HHHF 7FD1A 4O4GB 1RTIA 1LWEA 1FK9A 4HH1A 3C16B 3NMAA 2DXEA 4P2MA 4XDDA 4UF4A 4C8MA 4B3RF 4AL7A 3QJJA 1HYSB 2Y1LB 4FYVB 2PFDA 4MFBA 3KHHA 2DKOB 5L39A 2DR9A 3ULHA 2YX1A 4WXWA 2VQEF 1FFWB 1GX5A 4B3SJ 3TJ9A 3MEGA 4K4ZA 2QLJB 2DGTA 3PR5B 2KTQA 2YVSA 4NLRA 3LPYA 1IBLJ 1HBMA 4DV1J 3WX8A 3VVUA 1IVZA 4ZVOB 4LMZA 1MMDA 8AT1B 3JSRA 1LWEB 2JC0A 2H5IB 4KGZB 4RUAA 2LXIA 4Q44A 1VBZA 4QWDA 1RCOB 4R25A 3WDOA 3NEKA 4MFBB 4JB8B 3CO9A 4A8YA 4KE5A 2HFOA 5I42B 3LTOA 5F8HA 1VBYA 1EKRA 3MEGB 2M8HA 2XS7A 4F4YA 1CQMA 3VZHA 4JV1A 2WZ1A 2L08A 2ILYA 1KQFB 4Q8EA 4TU7A 1K0TA 4MH8A 1Q1KA 4OZ1A 3GMGA 4DPYA 5EX3A 2P9CA 4P74A 4X65J 1YLXA 3T5LA 5KOXA 3ILIA 3CUNA 2FHOB 1D0EA 1SBRA 5KAKA 2VUGA 1M5PC 1GTEA 4ANCA 2VQFJ 3A8EA 4F3OA 2FY8A 4OJ3A 4DSIA 3CDWA 5A8RA 4K4XA 2D3UA 1B4SA 1RWWB 3IWXA 5EWEA 1KEKA 4RWWA 1SXLA 3OT9A 2OEMA 2CZ9A 3FBCA 4RNMA 4NWBA 4ZCLA 3V6DA 3CULA 2CNLB 2YWHA 4ED4A 2W9BB 4P72A 4KPCA 2NZ4A 1WHXA 3OTCA 4C0BA 3IBFB 4LFBJ 3KJNB 2GVDB 2HYIB 3M2UA 3PW7A 3FCHA 5A8RB 2I1RA 4DU8A 2YQ1A 4DSLA 2V68A 1NLKL 1XMOJ 4QIFA 2XM3A 3EMTA 1VQ4S 1OQ3A 2OHDA 2WVDA 2L41A 4L3NA 3WIUA 4LSLA 3MFIA 3GG1A 3J81Y 3BR9A 2BJ8A 2FZKB 3M2RA 2IBKA 5IV4A 1WF1A 5FIIA 1X7VA 1MW7A 1RSCA 2CPHA 4FNIA 1V3ZA 4M5DA 3UE2A 4I0WA 4I6YA 1C4AA 4K4WA 4JYAJ 1YJVA 3DOMA 3MXHP 1S1UA 2O3DA 1D3WA 5ETOA 4RZRA 3M2UB 4USUA 8RUCA 4UY85 2AGQA 3IMQJ 1UEKA 1GQEA 2KT5A 3MR5A 3AA8A 1NSKL 1IQTA 2F1FA 4ZP7A 1R6YA 3UDEA 5CABA 4LSLB 2E7VA 1YBTA 2ZKUA 1FJEB 5EWFA 2EK6A 2X7IA 1T94A 4X62F 1K9MT 1KP6A 2UXBF 3MR6A 5CQGA 2X1AA 1NKCA 1KNZA 2F4VF 2EK1A 2EFNA 1CS4B 2J0SD 3M32A 2DIVA 2MKKA 1QE1B 1YRXA 2BVZA 1IM4A 1TUWA 1EAYC 4DUYJ 5F8IA 1D09B 3LP1A 4LR9A 4OV6A 1M0SA 3BJYA 1GXUA 3CXCR 2OGUA 2AT1B 4DFMA 3MM8A 2GV1A 3LQVA 3MTKA 1NJWA 2E5GA 5A0YA 2XMVA 2X3GA 3DC2A 3F56A 3GWCA 4DL7A 3ZZ0A 5DDQC 1S9GB 3E3XA 3PW4A 5KFZA 3K58A 2EFQA 1SQGA 3M32B 4RNHA 1UW4A 2MKSA 1TK8A 2YWFA 2EEYA 4PABA 4M5MA 1WOSA 3IO1A 3GZ7A 2MGZA 2YKAA 3D54A 2LQJA 3C14B 2UUAF 4ILMA 2WSEC 2CQIA 4HL9A 2YKMA 2CQGA 4DR6J 2R2SA 4ZVFA 1MWZA 3OL6A 1FNXH 2XMJA 5H9EK 3VQSA 4U7UD 3ISND 4ZHRA 1FHTA 3J7YU 4JV5F 1NK9A 2AW0A 1R27B 1LNQA 4HDHA 1NB2A 3G96A 2HK2A 4KGKA 2JFKA 3DLBA 4URSA 2FC8A 4QR0A 2B4PA 1JJ4A 1PILA 2MGZB 3OR2A 1JLEA 2FZGB 2C2OB 1U2RA 4LR8A 2M4MA 4DR1J 1UVIA 3GSIA 3CMAS 3V6HA 1T9WA 2P2CB 3JQKA 4HI2A 4TVAB 4M63A 4DL4A 3QSIA 1S49A 1F9FA 5GAGU 4ZHRB 2GHPA 1RT5B 2FJAB 1ELOA 3M05A 4WF9Q 1IJEB 1KFDA 1IR2A 3RGIA 5J1PA 4USHA 3POTA 1Q8KA 4CLWA 3Q0AA 3FVYA 5EX0A 2YQ0A 4RNOA 2P9EA 4ED6A 1K0VA 1X0PA 5KFFA 3GV7B 4CLTA 4DQPA 1XK8A 5ETPA 5J2PA 2K3IA 1ULRA 4R8UB 4DQRA 3FFIB 3QAUA 3K8VA 2CPYA 3MMAB 3H2VE 4CCHA 4ELUA 4QOTA 3KMSA 4DR3J 3UVJB 2EFPA 5DLGA 3KJQB 2C2DA 3IAM9 3PYFA 2FHJD 1V5IB 1EETA 2BKPA 3DHXA 3TVYA 3OL8A 3POTB 3NCPA 1YDLA 3EZUA 4YB7A 3UN3A 4PWWA 1I1GA 3ZZTA 1P1LA 2PD1A 2D3ZA 4YQWA 4CO1A 3O44A 3UNYA 3GYNA 2MLZA 1KBRA 3DOKA 5E3RA 2GJIA 1NK0A 5KFKA 1VJWA 2LXUA 5ETKA 1JLQA 3PHEA 3Q23A 1XR6A 2OPRB 5HI7A 2R7WA 1RXOB 1TFYA 4C3MA 2XO7A 3Q8SB 2Z58B 4HACB 1TZ0A 2A6OA 4NL5A 3GFXA 1VLOA 1T9TA 1FXRA 2MQLA 3G9CA 3DLEB 5BYQA 3O3LA 1B0PA 3H25A 2F8EX 1DAXA 4ED1A 4C11B 4DXLA 2R2TA 2QC3A 1VC0A 1BD6A 4YY3F 4C3KA 1KTQA 4A8SA 2WCXA 5EHHA 1RABB 5ADZA 4ANDA 1N52B 1WWHA 3EVMA 2FJDB 3VGUA 1U1OA 3ETOA 3M2VA 4OI1A 1K8AT 2IRUA 3EVWA 3ENWA 4O3OA 3MFHA 3EDQB 2VG6A 5IQ6A 3U1NA 3P4UB 2YNFA 1BXNA 5D78A 2U2FA 5F8LA 1J2VA 4TY8B 1U0SA 3HHKA 4F4XA 3H2LA 5J1NA 2B7BB 1HNWJ 1DY3A 1WDTA 2OD4A 1HHSA 3TO8A 3EX7B 4JI4J 1X4FA 2DRAA 1DBDA 3MOZA 2L9NA 4MAKA 4LF9F 3OV7A 1HQUB 4FZVA 5F3ZA 1UKUA 3MEDA 3Q8PB 3M2VB 1NJYA 1MWYA 2IY5B 4I1TA 3MWBA 4BS2A 3O6QA 3QLHB 5CYQB 4U96A 3CCJS 1JLAA 1ZPVA 1CC7A 1E6VA 2ROEA 3O1LA 1FRIA 5DGBA 4C7QA 4QIVA 2AJ1A 1N88A 5I4MA 4YHHF 2L9DA 5E3QA 2DR5A 3SSSA 2OPPA 3RZAA 1JLBA 4Y6IA 3OSNA 1FRMA 3CJ4A 1RQ0A 2LEBA 3EXCX 4ZPTR 2ZVSA 3OXFA 3O5TB 1R3NA 3MEDB 2KI2A 4IFYA 2XBPA 3TAQA 5F9NA 1I3OB 4IKAA 4H4OA 2VA3A 3UW1A 4DG1A 3PVXA 2NXJA 1Q86T 3CTRA 2CPDA 2HGMA 1PGZA 4P10A 1WACA 4EUVA 5KT5A 1E6VB 4QIEA 1M5SA 1FESA 4X4SA 1YJUA 4FXDA 4B9SA 1CJUA 4FF1A 3SDEA 3BM7A 1N0UA 3CMQA 3DU5A 2WK4A 4OX6A 3GPAA 2RUGA 2DRBA 5CA5A 4QWAA 1OY8A 1U45A 3D5MA 1C0TA 3I4HX 3KWMA 4DFPA 2Z56B 1AT1B 1YRUA 2ZH3A 2V67A 2D3OR 2CRLA 1TUGB 1NHUA 4PUOB 3LOUA 2KRBA 4B3TF 4CO0A 2GAGC 3NXZA 2MHEA 3LGHA 2P9GA 1LWFA 2YWWA 2BQ3A 3UD3P 1VK8A 4PPZA 3GR1A 2QA4G 5BXIA 4TQSA 1FVSA 1I6JA 3RB0A 1VBXA 1CJUB 5CAAA 5HSPA 4NLWA 5LSRA 2DCLA 4YUDA 1CVJA 4YS2A 3R7SB 5KFLA 2KN4A 2FC9A 2BX6A 5KFVA 2NXUA 1GMWD 5BYRA 5AXMA 4H4KC 2DHGA 4KO0B 1Q78A 2HHWA 2XMMA 5CYMB 1J5EJ 4ZLPA 1XNRJ 2UUTA 1S76D 1KS2A 5L1JA 1W2BR 1NK5A 4LBIA 4OYOA 4IQMA 4LVOP 5HL7Q 3IWLA 2MTLA 4X4RA 3J81U 4IH5A 2XCPA 3PY8A 3AXKA 2C2MB 1NK4A 4IOBA 3RR8A 5BR8J 2K06A 5HN0A 1HBUB 1Z4UA 2DGQA 3FQLA 1S4FA 3NGDA 4P6QA 1U1RA 2IA0A 5KFGA 5A2QU 3GV5B 4ID5A 1RISA 2HHXA 5GAHI 3UCUP 1XMQF 2DGXA 3DRPA 3CD6S 1KQKA 4L3KA 4DUTA 3V2UC 1RJJA 1GTHA 3D3BJ 3LO3A 1UEVA 3DI6A 1NEEA 1KONA 1QJHA 3EPGA 2ADCA 3DN9A 3TAMB 3N6LA 2D69A 2VPZB 4Q5VA 4ED8A 8ATCB 1QAIA 1TL5A 2QLBB 1TKZB 4X64F 2RE1A 3U7JA 3MURP 3E8OA 2GFFA 4LF8J 2RQMA 3VGVA 1QAYA 3MR2A 1NH7A 2UUCF 2DISA 2Z2YB 3T3FA 4KGVB 1HI8A 4I69A 4HYKA 2RS8A 1R6VA 2Y1IA 3VAKA 5SZTA 3DGPA 3DRPB 1F2GA 1HBOA 3OPKA 3LAMA 4I68A 2OPQA 2HBQB 2NPFA 3OBIA 3DI6B 4WIIA 3ILLA 1WC0A 5DDPC 1UJ4A 5GAEI 3DYAB 1NB7A 3MM5A 1U1NA 3MAAA 1RKIA 5IS2A 5T14A 3QPIA 4P2FA 1WOPA 1OWXA 2D7SA 4ZVPB 4CO5A 2A3JA 4W92B 2YKPA 3DRRB 4ZPBA 2ZC3A 1LFWA 4X66J 2LVWA 3G71S 1UVJA 5D4LA 3CD5A 3BQ2A 5IM0A 3OUYA 3QGPA 2OMLA 4WFBQ 2WONB 1UVLA 2QO3A 2U1AA 2OPQB 2K8GA 3EUNA 4IFVB 4I4BA 2QMUB 1AW0A 1HLWA 2FGCA 3KKFA 4OYWA 3JYTB 1QM9A 3HVWA 3J80U 3MM5B 2HFZA 3PX4A 1TELA 4ED5A 5DGAA 4LREA 4JI2F 1S1TB 3RRKA 2EG1A 2FGOA 4HHUA 1U24A 4OYXA 1SUQA 1JLFB 2QIFA 5DM7Q 1L5UA 1TL7B 2PA8D 5E7OB 3MM6A 3OUYB 4OLPA 1MU2B 5KFAA 3SV4A 4WK1A 5D0RA 3MM9A 2VG7B 3NWRA 3BBCA 3CT9A 3DRYA 2GHVC 1RT1B 4R5PA 4J9NA 2V8PA 1L3UA 4J9UE 4QU6A 3X1LB 4KYZA 1FRXA 4JI3F 1SJQA 1O5JA 2W7OA 1RHQB 2NSCA 1HD0A 4CO4A 4LF5J 3IRXA 4KIAA 3SV3A 1NNDA 3RG6A 4KT0C 3KUGA 5DRKA 4Z7YA 2VOPA 3DXBA 2FVSA 5IC6B 3LGMA 4W98A 3TW0A 4ED3A 2HNDB 2DD8S 4DPTA 3CCWA 4ED0A 2V34A 1RB0A 4B3OB 2MMYA 2QMWA 2GS8A 3HF5A 2R8JA 3ZZUA 2FHKA 3QO9A 2FQQB 2V4JA 3OJUA 5ETSA 4B17A 2M0GB 4PWDA 3M9OB 4NCAA 3M9MB 2J8AA 5D3GA 1B0TA 4DV7J 2BJEA 4NYPA 4DF8A 4OJ1A 4ECQA 4LUBA 2CUYA 4NLPA 4HLBA 2I5JA 1SQFA 4C8ZA 1RT6A 4F0HA 3THVA 3LUYA 3ZZPA 1FWLA 1QDUB 4BDPA 5C42B 1PYSB 1RU2A 5ETMA 3ETMA 1R8CA 5HP1B 2NQPA 4ZJQA 2DXDA 3D66A 4A8KA 1X4GA 2N3LA 1BHNA 2YNIA 1YIJS 2F9DA 1NH8A 3IN5A 1F1BB 3R5DA 5BYSA 4HHHA 2D3O1 5LMNJ 2HHHJ 4EU0A 3TYTA 2BANB 3SEOA 1LKZA 4K7QA 2EKNA 3Q8RB 4ECTA 1HR0J 2PE8A 3CDBA 2QL5B 3CD7A 3L9ZA 4RX6A 3BQ0A 4PKDB 5B0AA 2VC1A 2RF2A 2BOAA 2XNRA 3BO2A 2BE9B 2VQEJ 4YMEA 3C6UB 4DFKA 3M6WA 3KNGA 4HDGA 4K4TA 4TXSA 3ITHA 2YNIB 3KMQA 5KFOA 3LAKA 3KLFA 4ELTA 2DVIA 2V63A 3A3OB 1UPPA 3ZC4A 3H5SA 2F40A 4DV6J 1NK6A 3GFZA 3OD2A 2A0FB 2CWKA 1XR7A 1LFPA 3FSYA 5M2RA 4F02A 2MZTA 1NDPA 2KM8C 4ZPWR 2ZD1A 2CAJA 2PN6A 2FLLA 4JP8A 3OVAA 3ENQA 2RF2B 4U9RA 2ZDOA 4ZMMA 2ZJPQ 2N4CA 1V3SA 2WB4A 4L72B 3V4MA 1N5YA 3CE8A 1S79A 4K5SA 4DF4A 1NDKA 1SVDA 2ABYA 2ZH9A 2Z2LA 2MZJA 3HHLC 4GO7X 2JC1A 3K5OA 1ZPWX 1X5SA 4DSJA 3KLFB 3HHEA 4NMXA 2AX1A 3P8BB 2V8DA 1URNA 1S1WA 4LFCF 3NNCA 1EIYB 1FRKA 2MZ1A 3JS9A 2Y8YA 4QCLA 1RHUB 3B54A 3HFZB 3R5JB 4FYYB 4KHMA 3W2WA 1WJ9A 4CIOA 2CQCA 2OELA 2UVVA 4CT9A 3FMBA 1XWLA 1NAQA 4LF7F 1AYEA 4K4UA 4UQGA 1X0FA 4QZVB 4IR9A 2V6AA 3M1VB 1OY9A 1TL3A 3BPSP 1QVFR 3KDOA 5KFPA 1QVGR 2ZM6F 1S1WB 4W90B 1H74A 1LK5A 1X4CA 2DHSA 3VAHA 1KR4A 3VALA 3M8PA 2HLTA 1EZZB 5C5JA 2HFUA 3WZ0A 3ZTQA 2P5VA 1XQIA 5RUBA 2WTFA 1U1PA 1JJ2R 4PZVA 1A9NB 4C0OC 3J7ZT 2P8IA 1RYRA 2DR7A 4QYZJ 1OYEA 3QWUA 2M2BA 5A76A 5HJXA 3TA0A 4IR1A 3PRVA 3QNWB 3KHRA 3DCAA 4NI2B 4M94A 4LF4F 2B3TB 1CQNA 4NYZA 1RGVA 2B4UA 2QEXS 1RAOA 4O3SA 2GHWA 4ZJLA 1UZDA 2MKCA 1NZAA 2EC2A 1FX2A 3M6VA 3CDEA 4WTOB 3BSAA 5A6PA 4B02A 3EVOA 4ZPVR 3FCVA 4B3MF 3KLEA 4OHYA 2YH1A 2DNNA 1TAQA 2CPEA 3KK2B 2RQKA 4IG0B 1Y7PA 4A47A 3H4DA 4KJIA 2XS2A 1OS5A 1VYAA 3I87A 3OXGA 1LWCA 3V4IB 3RW7A 1X9SA 3WC2A 4NLSA 2R9LA 2UXBJ 2ZE2A 3QJLA 4Y2AA 2MJUA 1ZAVA 1VRTB 3BGRB 1HMVA 3R6LB 4NCGA 3F0NA 4EZ6A 1WDDA 1SJ3P 4D3HA 5HROB 1SC1B 2DNZA 1MLAA 2XCAA 5GVQA 4OJHA 1ROFA 2EWHA 4B08A 1IKYB 2E9TA 2R7VA 4DN9A 2BBEA 3UDVA 4BC9A 2RT3A 5E0OA 4F25A 3M6XA 5ETQA 4RW9A 1YBAA 5DQHA 1YHQS 1AFJA 3UCZP 2HNYA 2GQQA 1L3KA 2W4DA 4GKKJ 2IFXA 3MECB 2ASJA 3ENVA 4LJMA 1WC1A 5KFDA 3RR7A 3LP2B 3DDIA 2M70A 5KFRA 1IBCB 1RADB 2UZAA 4NCGB 2IC3A 2FVRA 4CM0A 5SUHA 1H7XA 4F7VA 3FJ2A 3L7PA 5L8RC 2VDIA 2W25A 4KHRA 4LRFA 2M52A 4WWSA 5DG8A 4NXNJ 5C25B 4CLZA 2YKNB 4X4NA 4DR5J 2UUAJ 2HRUA 3QGIA 4M1KA 1OPZA 5HJYA 2HNYB 4HR2A 3NCQA 1RKJA 2HS3A 2MJNA 1ZBTA 3NAIA 4KH1B 4LF1A 3GILA 4FYXB 1RT2A 3GIKA 2PI5A 3QT6A 1MROA 1IWGA 3OTDA 5KG4A 2VODA 4PCQA 1ZAWA 3PKMA 3P6YC 3NGTA 2OTJS 4ZVEA 1WI8A 5IZHA 4OI3A 3BBFA 3CDUA 2W01A 1IBMF 2RDDA 1K44A 4DDFA 1BWVA 3KG0A 4DR2F 4EO8A 4NLGA 5D0GA 1S12A 3W2VA 2IRXA 3C6TA 5HVHA 1PCAA 3HZGA 3VCDA 2UUWA 5KG2A 4KTQA 4RU9A 2JL9A 1V5VA 4PQUB 2Q66A 1NJIT 2BOPA 1VISA 1WNEA 1SJ4P 2YTCA 3W63A 3RBDA 1KRPA 3CDAA 2FJWA 4FXVA 5HLFB 4CYUA 1ZM3A 3I0SA 3CPWR 1O8BA 2RSQA 2IM2A 3GR0A 2APOA 4X84A 3EJMA 4ECVA 3US5A 2PDAA 2PC6A 3T5KA 5JVHQ 5D77A 1PBUA 1RZMA 1HHQA 2XYHB 2FLNA 4DV5F 1H98A 2ZFHA 2ZEJA 1TKTB 3HX9A 4ECWA 3W65A 2K7KA 3SBMA 1G4CA 2HVIA 1JXEA 4KAIA 3J7Z5 2O5DA 2RAQA 3VR1A 2HMIA 2F65A 3H59A 1TAUA 3AXMA 2V2ZA 4LSZB 1PJ6A 3PO4A 4OHXA 2RRBA 2HWTA 1HBNA 4CYUB 2XYPB 2IM1A 1HWIA 5A8KB 1SIZA 1JNRB 2G0JA 2B7CB 1S57A 4ILLA 1RBOB 1HQEB 3G8SA 3U02A 3TUZC 5HQLA 2VPWB 3KJVA 3R8YA 2CPJA 5F8MA 5LMUF 1BLUA 2XSJA 3ISNC 5K14A 1RTJA 2VH7A 4X4QA 4CO2A 2IYGA 3PACA 2J6TA 1P9YA 5H9FJ 4NLUA 2HMIB 2B8PA 3W7BA 2FYXA 3D6MB 4H54A 4I2QB 2W4PA 3KLGB 2J9DE 2NUHA 2AU0A 4EMDA 3ICLA 2MZRA 2LKZA 4F0MA 3UDCA 4GVBA 3S1TA 1DLOA 2RUSA 3WC0A 1VR6A 4YY3J 4MTPA 3KJVB 3H5UA 2KKHA 1JLCA 3G82A 1RTJB 3VF0B 4MIWA 2GNKA 3QIPB 1F9EB 2YNHA 1F5AA 4Q0BB 1URRA 3BH7B 3MM7B 1WKLA 1FWKA 3PW0A 1WORA 3B82A 5B0CA 4ED7A 2W1BA 3W64A 1FDAA 3W5YA 1HNIA 1GMWA 2VBXA 4WZQA 3H5XA 4CP5A 5AJ3F 4USVA 5LJ3Y 2LECA 2RDJA 4UOGA 3V6KA 1DLOB 5CCMA 2ZKTA 2XMTA 1TL4A 2HZCA 1R0BG 1UP1A 2W8KA 3BREA 5D4OA 3TWZA 1JLCB 3UWTA 4DL5A 4JI7F 2OSQA 2QYGA 4LF9J 1GT8A 4RBTA 3H5YA 2DH9A 3QIDA 1N32J 1OQ6A 2J76E 1NSAA 1JK9B 4QWEA 2FB0A 2YNHB 4WYLA 3IWNC 2Z0GA 4Y2MA 2KHDA 3BQ1A 2F5GA 3NOGA 4DCJB 1XERA 4CH1A 4I7FB 1PC5A 3VVTA 1Y11A 4ALZA 4ZPAA 4CQ1A 3A4TA 4J9MA 4UUWA 1VK3A 3I6PA 2RVJA 3L3CA 2P6SA 2DNHA 3QQCD 4X4PA 3GYXB 3J81j 1ZTTA 2CQ1A 1NKEA 2J6UA 3NGSA 2CJXB 1FF2A 4GO5X 2IYIA 2XO6A 5T41A 1U2FA 4NYOA 4C9DA 1PAEX 1F2HA 1ZA1B 2CJAA 3Q8UA 1YJRA 3PEHA 3HHLB 3MAHA 3DHWC 2CFXA 3K0JA 2XLJA 4UTGA 2E5LJ 4DL2A 3QZ8A 2E1CA 4RKUC 2ROGA 1KWMA 1OSCA 2BABA 2RIJA 3G4SS 4DI6A 4CI0B 1XIQA 4OHVA 1CJKB 1BQMB 1CJVA 2JEIA 3WHIA 3B6BA 4IOCQ 1NSPA 1RAEB 5LXYA 4KHPJ 1EQ0A 5J1EA 3TA2A 4OJGA 3ZZRA 2OEKA 4O3NA 3MPUB 3WQPA 3KLHB 1H2UX 1X8DA 1KLMB 3CJTA 2OPSB 4J5OA 4G65A 1XNQJ 4DV4F 5E3AA 2QLFB 5KFNA 1FTCA 2R7TA 1R89A 3TJ8A 1FE0A 3HXMA 5LXRA 1BWEA 2HAFA 1M5OC 2B5JB 5G0RA 1H0HB 4OYIA 1WC5A 2B9YA 1U6FA 4QYZK 3Q8VA 2Y0BB 4Y2CA 2VG5A 1R0AB 4FP9A 4XIUA 1HNZF 2JEGA 1MN7A 1MWQA 2RH3A 2KXHA 1RT4A 4I2PA 3J7AN 4HH0A 3TJAA 3OR1A 2GQ2A 2J9EA 4P52A 3KLIA 2B43A 3GJRB 1Q82T 5AXLA 3IM9A 1RTDB 1ZS6A 5GAHU 3TARA 3GCXP 4FKYA 2F8MA 2E44A 4NX9A 1SB6A 1DHMA 4Q45A 4A46A 3W66A 1PG5B 2ZJRQ 3HLUA 1Q5YA 1SQEA 3C19A 2ZBCA 4F36A 2JX2A 2BE2B 4LSNB 5GMEA 3QSYB 2AHOB 4V1Ak 9ATCB 1YJNS 2MQMA 3LWLA 4YR2A 2Q3PA 1VIXA 4X4UA 3HFVA 4AL6A 2H9ZA 5MAOA 3IA0A 2H51B 2JLGA 1SJFA 1N33F 2AEJA 1P1TA 1G7CB 2IHR1 2RHSB 2UXDJ 4HKQA 4P9SA 2GC8A 3TZYA 4CO3A 3D9BA 3KLIB 3DLGA 1FRJA 1UTAA 2JZ5A 4EBEA 1W7WA 3CIMA 5FLXY 4J9OA 4ECZA 4USMA 4USTA 2G2ZA 2ZBPA 2CPXA 1GMUA 4HEA9 1IBLF 2DGWA 4DV1F 2X1GA 1M1HA 5T7LA 4OZLA 4WKYA 4J91A 4KGMA 5GAEU 4DX7A 4QPXA 1LOUA 5K8MA 1U09A 3HHNB 3M6UA 3LW5C 1WF0A 3TANA 5ETLA 3OFFA 1TL1B 5F8JA 1PJ5A 1T03A 2HS4A 1WG5A 4WZMA 1QUVA 3QGHA 3R7BB 4L74A 2RKIA 1HL6A 1NHVA 1F60B 1LW2A 5G4DA 4Z2XA 4DR4J 1C1CA 3ILJA 3JSBA 1KHWA 3BYRA 4ERDA 2KZMA 4IRCA 3KK1A 3EICA 2FJXA 5KFHA 4N41A 2VFTA 3NBPB 2CVIA 4RLEA 1LEOA 3ZZOA 2KYZA 2XNQA 2VQFF 3B8HA 2VBWA 1T03B 2HHTA 2CJYB 2XG8A 4B9UA 2OFHX 3PYGA 1DTQA 1JJCB 3CJSA 2ZBQA 4F3MA 3TX0A 4FS1A 4NLQA 2R7SA 2BJ3A 2EFVA 2G4BA 2RKIB 4F4WA 2PMHA 1X4EA 4RW6B 2C2EA 3I5BA 2HWHA 4Y2KA 4EGLA 1DTTA 4KGXB 3UNGC 5KG3A 2UV8A 4JI2J 2GIRA 3N6MA 5DZ6A 1FT8A 3AHPA 1YZ7A 1REVB 3HULA 2CQDA 1QLNA 2HQDA 4WKRA 4LFBF 4M5KA 2D9PA 3E01A 3NNAA 3VZIA 1RWKB 1KOHA 3I82A 1FJGF 2GAHC 1SKUB 1UFLA 1SI9A 1XMOF 2G2OA 4TQRA 3B78A 2YWKA 4LIRA 5L9XA 1QSYA 1GK8A 1S6PA 3FEZA 1EJ7L 5KG1A 4WFXA 5KFWA 2HHQA 2E5HA 3VHQA 4TYAA 2JOQA 4NCBA 2KJWA 3K17A 2XYGB 4PG8A 3FRYA 4FDFA 4JYAF 3C16A 3HVTA 3EM1A 2LFVA 5KG6A 2KH9A 4ELVA 1LK7A 3WIVA 2V5HG 2HQ3A 2KVQE 3PV8A 2PI4A 1HYSA 4U8VA 4MK7A 1JIHA 1RAAB 2HRYA 5DG7A 1XR5A 2E5IA 3AOBA 4Y65A 4KSEB 2YWEA 2B6AB 4DV0F 9RUBA 2DNYA 4XK8C 5HQ8A 3G8TA 4O3PA 1VC5A 1VLYA 3SCKE 1KSPA 2XGPA 3W9IA 2B4VA 2UXCF 2FLOA 3HVTB 2K1RB 1YJ7A 3ZTPA 3AFGA 3CJ0A 2ZC4A 4E2FB 2CJBA 3AQPA 3MGJA 4KC5A 4DQIA 4FS2A 5H9FK 1YSJA 4ZP8A 1NUEA 1UA0A 2F4FA 3FRZA 3MPVA 5I42A 2AYEA 1IBKF 2HHVA 3R1LA 2XWXA 1BQNB 5K8OA 1EX8A 3LGNA 3DMJB 3TR5A 3TEHB 1S97A 1VC6A 1GFWB 1UZHA 2NLWA 2W2PP 2WW4A 1S1XB 4KRWA 5HO4A 3RAMA 5I3UA 1OSDA 2E9ZA 2AJQA 3WX4A 3N4WA 3IR6B 4ECXA 2V4QA 3DM2B 3R97A 5AE3A 4B9LA 1A7GE 1X4AA 2QL7B 1EP4A 4DQQA 5AE2A 2O01C 2LXFA 4I56A 4NE9C 3PYDA 1FRHA 2V4RA 4DR6F 2OLWA 2CJ9A 5ETNA 4F4KA 1HW8A 4KFBB 3G87A 4FNHA 3P5TL 3EGVA 4DR7F 2W9BA 1I51B 4XTTA 2B4OA 1D9AA 5I3UB 3IC1A 1S0OA 3OTOF 4CTAA 1WEZA 1KDNA 2LQ9A 1VQOS 4J90A 2GVDA 1Y0HA 1JLGA 1FCAA 3FZBA 1EP4B 3PIPQ 2VJUA 4N8OA 5K9FA 1U25A 4EZ9A 3E2EA 4WE1B 4E8UA 4CLLA 1S59A 3N5FA 1AUSL 1EQMA 3D0HE 1KQGB 3FBFA 3PR4A 3OLAA 1T0TV 2LQBA 2FJBB 5A6WA 2QV6A 1SV5B 3N28A 3QATA 3CEDA 1KVJA 3EWGA 3C15A 2C3UA 2OMOA 4N77A 3U27A 4YR0A 4CTAB 1MNEA 1DFDA 3FEXB 4NLVA 4DPWA 4WFYA 3KUHA 3H7HB 4ZIWA 3AB4B 4Y0FA 5FD1A 1CPZA 1S10A 3MMBA 3TNVA 1JLGB 5B08A 2ZH6A 4KR0B 4WU2A 2XI3A 1P6TA 5JJBA 2Q1LA 3M8SA 1N5SA 5E33A 3DOLB 2CQBA 3N01A 2DEIA 3CJ3A 2VPXB 4DS4A 4DR3F 2BV3A 4LF7J 1YJWS 2QYCA 3R27A 4OZ2A 4NASA 3OHBA 4WYWA 4RUCA 3MMCB 4PXDA 4J9VA 5B0DA 1VQ6S 4JI1F 1N56A 1CS4A 2EI5A 2C28A 1XN9A 3C15B 1YQHA 5IC4B 2ZM6J 4IH6A 1QE1A 1WTFA 1RWNB 5A2QY 1MMNA 1FA0A 3BKFA 3OLBA 2QJ3A 3MMBB 2W8LA 3AB2B 5KFIA 2QSFA 1XEZA 4KKOB 2Q6BA 4G1PA 1MMLA 2HSEB 5IT0A 2BZ2A 2V50A 1FWPA 1NPKA 1NDLA 2GVZA 4DJBA 4QIWD 1NHKL 1H7WA 1NZ8A 1FD8A 1S9GA 2WSFC 2ALZA 2CQHA 2I9SA 1RWOB 4CT8A 4LF4J 2IMOA 2F3JA
chains in the Genus database with same CATH topology
2LU2A 4RW7B 3MMJA 4ID8A 2ACYA 4YMEA 4F2RA 3C6UB 3CCMS 2DPIA 1UFWA 4H4OB 3ZFVA 2NS1B 1XNQF 4DFKA 3M6WA 4DG1B 3KNGA 3DXSX 4HDGA 4K4TA 3CB4A 4PG4A 4TXSA 4O0IA 3ITHA 2IBOA 2Z4PA 4CH7A 2YNIB 1VHFA 3JSMA 3KMQA 2ZH4A 1TK0A 5KFOA 3LAKA 4MK8A 3KLFA 1VS3A 4ELTA 1TKXA 1HI0P 4IG3A 1V6HA 3Q8QB 5F41A 2DVIA 3ONQA 3ZC4A 3H5SA 2F40A 4I2QA 1NK6A 4FBUA 3BDEA 3GFZA 3I31A 4O44B 3KLGA 1WELA 1QAJA 1L3TA 2YQ3A 1XR7A 1LFPA 3FSYA 3SDEB 3JTOA 4ATNA 5M2RA 4QW9A 4X2BA 2D41A 2Z2MA 2RS2A 3CVKA 4F02A 4HT5A 2MZTA 3SQGA 1H3DA 1YGYA 1GNKA 3PNIA 1C0TB 4ZP6A 2KM8C 4ZPWR 2ZD1A 2KHCA 5KG5A 3SYZA 3IGVA 2HGLA 1L3VA 1IJFB 2PN6A 2MB0B 1LW2B 2B51A 1BGXT 1C1CB 2FLLA 4JI0F 2HIQA 1SL1A 1G2EA 3OVAA 2R8KA 1XMBA 4YB6A 3ENQA 4UQTA 2RF2B 4EBCA 1IUJA 4U9RA 2ZDOA 2MY7A 4ZMMA 1NK7A 2ZJPQ 1O0PA 2N4CA 1VQ9S 3MEEA 4MYUA 3QIPA 1M5HA 1NU4A 2HQIA 1V3SA 2WB4A 5FDLA 3KK1B 2C42A 4L72B 4Q0BA 3V4MA 1N5YA 2RJZA 1OPIA 4KQZA 1LWFB 3CE8A 1FVQA 1S79A 1TQLA 2LDYA 3F44A 3MM7A 4K5SA 3CJKA 4DF4A 2B0GA 1H38A 2ABYA 3PW2A 2ZH9A 1HNWF 2Z2LA 2XMUA 2MZJA 5D4NA 3HHLC 4GO7X 3RB3A 1ZM9A 2JC1A 3K5OA 1ZPWX 2A18A 1X5SA 1KN6A 4DSJA 2E5JA 3KLFB 3HHEA 4FVCA 1RT3B 4IG3B 1L3SA 4HT7A 2AX1A 3HZEA 3AH6A 4QYRA 1R8HA 3K57A 4DV2F 5KFEA 4DWIA 4F67A 4UOCA 4Q43A 4NA3A 2V8DA 1ZM4A 2FDNA 1FNMA 1URNA 3H2UB 3SI8A 1S1WA 4LFCF 3NNCA 3MOJB 4NZ7A 3C46A 2GMLA 2V8GA 1FRKA 2MQQA 2MZ1A 1DTQB 4YP3A 2DK2A 2GMHA 3KFWX 1U49A 3AJ2A 4QCLA 4B9VA 3J80Y 3SQGB 1S9EB 1X9MA 1JXLA 3K2YA 1DURA 3D1HA 1P8GA 5KTQA 1FDDA 1RT5A 2RD5C 2JH3A 3N9UC 2LCWA 1S6QA 2ERRA 5KT6A 2QLXA 4KHMA 3R1HA 3W2WA 3TRGA 3OL9A 1UVMA 4NZ0A 1S48A 2QSWA 4Q2LA 1LQ9A 2CQCA 4CIOA 1T02A 2L9WA 2VFUA 1VRUA 4MIAA 4PPDA 2AGOA 3EGZA 3SSQA 4ECSA 2UVVA 4IOAQ 4OL8A 1DTTB 1R31A 3BGLA 3U1LA 4CT9A 3U1MA 3FMBA 1YJTA 1XWLA 2CPIA 3RRHA 2VKRA 2UXDF 5CZVA 1IN0A 1NAQA 3I9V9 3MEEB 2WBRA 3HHLD 1TV6A 4IH7A 4LF7F 4O4GA 4K4UA 2K2PA 5KT3A 4UQGA 2C3PA 1IKXA 3T1YF 1X0FA 4K59A 4QZVB 1D9FA 1UWBB 4I7FA 5LSLA 4UY8T 4R8UA 5JXSA 4IR9A 2N3OA 3NLCA 3HKWA 3M1VB 4TN2A 4QW8A 3FFIA 4JI6F 1D8YA 4JBCA 1TL3A 3TVZA 1QVFR 3E01B 3HM9A 2EPIA 3M30B 3O2IA 3IS9A 3THTA 3MMAA 4WXOA 5KFPA 5FJ4A 2ZZNA 2DJWA 2R7RA 3VAMA 1QVGR 2ZM6F 2QLWA 3UQSA 1S1WB 2K7JA 3BB5A 1RA7A 1N4LA 2HVHA 1VQKS 4WJBA 4W90B 1LK5A 1X4CA 2DHSA 3VAHA 1Y3JA 1KR4A 3PFEA 1PC4A 3VALA 4IDKA 3OJSA 1HW9A 4DPOA 1S6PB 1VQPS 2E1RA 2QRRA 3M8PA 1KVIA 2HLTA 1S6QB 5EGYA 2N4DA 5IT4A 5KOWA 5C5JA 1SIWB 5KFQA 1K1SA 2CKWA 2DH8A 2JFDA 4ID5B 4C0HA 2MKJA 3WZ0A 2AYBA 2EKYA 2P5VA 2CJQA 1WD6A 1VRUB 4RW8A 3VTIA 2EBGA 4LVNP 4F50A 2WTFA 1U1PA 1JJ2R 3MR3A 3IG1A 2HHHF 1TV6B 1A9NB 4C0OC 2PA3A 7FD1A 1CC8A 4O4GB 2UV8G 1RTIA 3J7ZT 1RYRA 2DR7A 1LWEA 2HNZB 1FK9A 4HH1A 4O3QA 4A48A 2FY1A 4QYZJ 3CCSS 1UAWA 3NMAA 4Q2MA 4OHZA 1PSDA 3P3DA 2M2BA 3QWUA 2ZITA 2PIIA 4XDDA 3G86A 4C8MA 3FSIA 3MUMP 2EFOA 3R3TA 1F0XA 4B3RF 4DR4F 3HHLA 2DHXA 3MAQA 5E2QA 3TA0A 2RRAA 1X9WA 4IR1A 4AL7A 3QJJA 2XLIA 3KHRA 1HYSB 3DCAA 1HHTP 1N36F 4FYDA 4IYQA 4MFBA 3KHHA 4LF4F 2B3TB 5L39A 4M94A 4DSKA 2DR9A 3ULHA 2YX1A 1CQNA 4NYZA 2FPHX 4WXWA 1RGVA 4G6VB 5EWGA 2B4UA 2QEXS 2VQEF 1T05A 4ZK7M 2DPJA 4O3SA 4NA1A 2GHWA 1GX5A 3MEKA 2MKCA 2CPZA 1NZAA 1BQMA 3MEGA 4LT6A 1XTZA 4K4ZA 4NLOA 2OPRA 4R0EA 3AQOA 1V3RA 3M6VA 3CDEA 4MJKA 5A8WA 4O3RA 3BSAA 3IGNA 2DGTA 3PR5B 2KTQA 5A6PA 4B02A 2KM8B 4ZPVR 2HG4A 2YVSA 4HHJA 4NLRA 4B3MF 3KLEA 4OHYA 1BC6A 2VA2A 3LPYA 1U6ZA 1CEZA 3UD4P 2YH1A 4RW8B 1HBMA 2DNNA 4IRKA 1TAQA 1HBOB 2CPEA 3KK2B 3HPOA 7FDRA 2RQKA 2ZOGA 2KYXA 3PW5A 3EXYA 3DLEA 3NAHA 4LFAF 4IG0B 1Y7PA 3H20A 5D6GA 4CZCA 4ECRA 3KLHA 4A47A 3H4DA 1OO0B 3L09A 4KJIA 4LMZA 2XS2A 1X5OA 1OS5A 1KLMA 1MMDA 2OPSA 3JSRA 1LWEB 1U1QA 1N6QA 2JC0A 4AFFA 4C11A 3I87A 3OXGA 4RUAA 1XBWA 3QYYA 3GIJA 2XI2A 3DFEA 5J2QB 1U4BA 1LWCA 2LXIA 1Q8IA 4Y28C 3V4IB 1MSWD 3MI7X 3RW7A 3NP5A 5D4PA 1X9SA 4Q44A 1VBZA 3WC2A 1WEXA 4NLSA 2R9LA 4QWDA 4R25A 1G6BA 2ZE2A 4J9RA 3QJLA 1J5EF 4OX7A 4Y2AA 3WDOA 2MJUA 3G6YA 4TYBA 3C2PA 2MQOA 1ZAVA 1VRTB 3BGRB 2IVYA 1HMVA 2B5JA 2I8EA 3H98A 4MFBB 2AQ4A 4C8YA 3CO9A 4H4MB 4A8YA 4NCGA 4KE5A 3THPA 2HFOA 4EZ6A 4TLQA 2QT7A 5F8HA 5I42B 1VBYA 1T05B 1SJ3P 1HWJA 3MUVP 4D3HA 1CG2A 3MEGB 2M8HA 4F3QA 1N5VA 3FEYB 5HROB 2DNZA 5KG0A 5A8WB 3DDKA 2XCAA 2XS7A 2VASA 5GVQA 4F4YA 3KNAA 4OJHA 1ROFA 4I6AA 1CQMA 1VQ7S 4ICLA 4E0DA 2EWHA 4B08A 1IKYB 3VZHA 2E9TA 2XMKA 4JV1A 2R7VA 4DN9A 2BBEA 5IM0B 2L08A 2ILYA 3CJ2A 3I5CA 1KQFB 2RT3A 4OI4A 4BC9A 1R0AA 4Q8EA 5E0OA 5LSOA 4FVMA 4F25A 4TU7A 4Q8FA 4WFNQ 1JMTA 4YFUA 3M6XA 2RU3A 2MZQA 1KLNA 1K0TA 5BR8F 4MH8A 1Q1KA 2NYIA 4RW9A 1C0UA 3IR7B 1YBAA 2J9DA 4OZ1A 3T19A 5DQHA 1YHQS 1N34F 3GMGA 2P6TA 2DO4A 4TY8A 2IRYA 4NRUA 1AFJA 1N6QB 3CCRS 4TNOA 3UCZP 2HNYA 3LP0A 1S0MA 2GQQA 5EX3A 2P9CA 3I9ZA 1HPZA 2RU9A 1RTDA 3T5LA 1L3KA 2DHAA 2W4DA 5KOXA 3CUNA 2FHOB 2IFXA 3MECB 2DNPA 1D0EA 2MQPA 1SBRA 4J9SA 2MPUA 2ASJA 3ENVA 5KAKA 2UVUA 4LJMA 2VUGA 3AY0A 1Q7YT 3BO3A 5KFDA 1M5PC 2RDIA 1GTEA 2MHNA 3T9NA 3A8EA 3KLVA 3RR7A 4F3OA 3LP2B 4OJ3A 5JVGQ 4DSIA 4DEZA 3C66A 1HQUA 5B0BA 3CDWA 5A8RA 3GSDA 2M70A 5KFRA 4K4XA 3I5AA 2UVWA 3BDPA 2UZAA 2DB1A 4NCGB 4CNZA 5LJ5Y 2D3UA 2IC3A 2FVRA 1QY7A 5I3QA 2BE2A 4QWBA 4LSNA 5SUHA 1H7XA 2LDIA 2LYVA 1TVRA 3MHYA 2FLPA 3MTJA 2PFFB 3IWXA 5EWEA 3FJ2A 5CXTA 2OIHA 1SUQB 3L7PA 5L8RC 3OQ2A 5LT5A 2W25A 4KHRA 2WRMA 1KEKA 1M5KC 2M88A 2M52A 3QLHA 4PXEA 4RWWA 1SXLA 3FGVA 5CYQA 5DG8A 1YG0A 5C25B 1J5OA 1RTHB 3HKZD 4ICLB 4JI5F 4QJVA 3BGUA 2I2YA 2YKNB 4BC7A 5IXUA 1O51A 4URQU 3MM6B 4X4NA 4RNMA 4NWBA 3RTVA 3LF0A 4ZCLA 3V6DA 2LA4A 4NLXA 3CULA 3MM9B 4DLEA 2OH2A 2CQ3A 4RNNA 1Z1ZA 1QSSA 2YWHA 4DLGA 2W9BB 5GADU 2WHOA 1C2PA 4LF8F 1C0UB 2HRUA 4JV0A 3QGIA 3UCGA 1S6UA 2FVCA 3HT3A 4M1KA 4R5PB 1OPZA 2HNYB 3LP0B 1PO6A 2NZ4A 2H5EA 1HPZB 1WHXA 3OTCA 2HS0A 4C0BA 3NCQA 1RKJA 1FKAF 2HS3A 2MJNA 2A1BA 3OVBA 3T6JA 1ZBTA 1FKOB 3NAIA 5K5MA 3GILA 1RT2A 4OFZA 3GIKA 2B9WA 2HYIB 2J7UA 3TI0A 3M2UA 2PI5A 3PW7A 5E41A 1VQ8S 3CCUS 3FCHA 1MROA 5A8RB 2I1RA 3IRXB 4K2XA 3OTDA 5KG4A 4DSLA 2MZSA 5I3PA 5DQIA 2ZH7A 3MD3A 4E98A 4QIFA 1TVRB 3BSCA 4MIBA 5MLCV 2VODA 1VQ4S 4PCQA 1ZAWA 2W7PA 1OQ3A 3FNNA 4P7VA 3H40A 2L41A 4IO9Q 4L3NA 3F73A 1NKBA 4LSLA 3MFIA 1LV5A 2KZZA 3PKMA 3P6YC 3GG1A 3J81Y 3BR9A 2PT0A 4ZVEA 2OTJS 3M2RA 1J5OB 2KO1A 2IBKA 1WI8A 5IZHA 3OXLA 4OI3A 3K5LA 4KBIA 1WF1A 5FIIA 1R8AA 1X7VA 3HMJG 3CDUA 1IBMF 3N0VA 2IM3A 2ZBIA 4DDFA 2VL1A 1TL1A 3KG0A 4DR2F 4NLYA 1OIAA 4YOEA 1G1XA 3Q2SC 1MW7A 4EO8A 4NLGA 3RB6A 2CPHA 3W2VA 5HBMA 2IRXA 4FNIA 3VAGA 1V3ZA 4M5DA 3C6TA 3SCLE 3UE2A 3VQTA 4I0WA 4I6YA 1T7PA 1C4AA 3HZGA 3VCDA 4B3SF 4ZKAA 4K4WA 1YJVA 4FN5A 3DOMA 2M7SA 2UUWA 2E29A 3QO9B 3MXHP 1S1UA 5KG2A 5AXNA 5B09A 1TFWA 1T3NA 4QPTA 4X66F 2V4JB 2O3DA 4KTQA 2C3YA 4ED2A 5IQQA 1D3WA 3G6ES 4RU9A 2XHWA 2JL9A 4RZRA 4ZDNA 2MKIA 4PQUB 3M2UB 4J37A 2Q66A 3KHLA 1NJIT 2FD2A 4RU2A 2BOPA 1WNEA 4PWDB 1SJ4P 1HWUA 2YTCA 4Z37A 4PUOA 4PG6A 4UY85 5D3GB 1R8BA 2AGQA 4N8NA 2M3DA 4AL5A 3RBDA 2UU9F 1GQEA 2KT5A 3MR5A 1SKSA 3AA8A 3CDAA 2FJWA 1KRPA 4FXVA 2DTJA 2JSXA 3MF5A 5HLFB 1IQTA 4KV8A 1ZM3A 2F1FA 3I0SA 3CPWR 1O8BA 2RSQA 1DJ0A 2IM2A 4ZP7A 1E6YA 1R6YA 3GR0A 2APOA 2WB1D 3QJPA 4X84A 4LSLB 4ECVA 2IVMA 2ZKUA 1FJEB 5EWFA 1R7IA 2EK6A 2PDAA 2PC6A 3QWPA 3US5A 3T5KA 3PZPA 5JVHQ 1T94A 5D77A 4X62F 3NBPA 1K9MT 1P9QC 2FJVA 2I5JB 2UXBF 2GQCA 3DLHA 1RT6B 3SFGA 3MR6A 2FLNA 5B0FA 4DV5F 5CQGA 1H98A 2X1AA 1S99A 3BSOA 4OMFG 1NKCA 1KNZA 2ZFHA 4OX9F 2EK1A 3HDSA 2F4VF 2EFNA 2VB6A 2QA4S 3BZQA 2J0SD 2RMLA 5HBMB 1TKTB 1Q4RA 3HX9A 4ECWA 3M32A 2ASYA 3BF4A 2DIVA 2MKKA 2K7KA 3NS5A 1QE1B 3Q24A 2F8HA 4ITSA 2HVIA 1YRXA 2BVZA 1JXEA 4KAIA 4WCEQ 2COLA 3J7Z5 2O5DA 4KO0A 4RW6A 2BA9A 2UVRA 2QA1A 1IM4A 5CYMA 4AXJA 1Q8LA 4URGA 3VR1A 2HMIA 5F8IA 1ZTWA 3H59A 3LP1A 4J9LA 1TAUA 1M0SA 3BJYA 5LL6d 1GXUA 3TQ1A 3CXCR 4F4ZA 2NUUG 2KDOA 3PO4A 4OHXA 2RRBA 2YY3A 1WF2A 1SJ1A 2GMJA 2HWTA 4KV8B 1HBNA 3SMZA 4DFMA 2IM1A 2YWGA 3HVRA 4PRFA 1HWIA 5A8KB 1E6YB 4X65F 2W9CB 2NR0A 5L9NA 2DNMA 3MM8A 1REVA 2GV1A 3LQVA 1DQ9A 1IQZA 1SIZA 3MTKA 1NJWA 2D1CA 1FD2A 1WG4A 2VOOA 1JNRB 2E5GA 2B7CB 4ETXA