4JI6F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji6F00
2HHHF 4LF6F 4DUZF 4LFAF 1HNWF 1N34F 4JI3F 4YHHF 1RISA 1HR0F 1XMQF 4DR2F 4B3SF 2UXCF 5BR8F 1N33F 4DV3F 3OTOF 2J5AA 4JI7F 4X62F 4B3TF 4LFBF 2UUAF 1I94F 1IBMF 5IWAF 4NXNF 1FJGF 2KJWA 5AJ3F 1QJHA 4LF4F 4DR1F 4JI2F 1IJFB 4DR5F 2E5LF 2B7BB 1XMOF 2UU9F 4DR6F 4X65F 4DV5F 4LF5F 2VQFF 3T1YF 4GKKF 4NXMF 4OX9F 2UUCF 4JI4F 2F4VF 1CQNA 4DV0F 1J5EF 4K0KF 1XNRF 4JI6F 1LOUA 4DV4F 4JI8F 2ZM6F 3T1HF 4DR7F 2RJZA 2VQEF 1F60B 4DR3F 1VMBA 4DV6F 5LMNF 4DR4F 1B64A 2BXJA 4GKJF 1N32F 1IBLF 4LF9F 4JI1F 2YY3A 5LMUF 2UXBF 4B3MF 1N36F 4DUYF 1FKAF 4B3RF 4LF8F 1HNZF 1XNQF 4YY3F 1GH8A 2KJVA 1IJEB 4DV7F 4KHPF 3R3TA 2UUBF 4X66F 2BVZA 1HNXF 4JYAF 3ZZPA 4X64F 4JI0F 4JV5F 1G1XA 4DV1F 2UXDF 4LFCF 2B7CB 1IBKF 1G7CB 4AQYF 4JI5F 1CQMA 4DV2F 4LF7F
chains in the Genus database with same CATH superfamily
4LF4J 2BQ3A 1U2FA 2RDJA 2V8VA 4QR1A 1REVB 3N01A 3CJQA 3I55S 3CCRS 1IKXB 1RWUA 4LRBA 3RW7A 1XWLA 1SQGA 2HZAA 3QIPA 3DXBA 2EKYA 2DYAA 2RKIB 3A4TA 3OBIA 4Y3CA 4O4RA 3UWTA 5HL7Q 1KHVA 2O5DA 5ETTA 1REVA 2I2YA 4HVZA 4ZKAA 4ANDA 1TQLA 3PDNA 4F4WA 3ELHA 1TKTB 3UD5A 2HS4A 1IWAA 2OTLS 2RKIA 5EWEA 2BUNA 4P2FA 1HL6A 3O3LA 1EB0A 4BDPA 1KFDA 3R5GA 1HBOB 5THWA 3R97A 4CP5A 1FNXH 4I69A 3CDUA 1N5VA 2MHEA 3MTKA 1S1WB 4Q0BB 2IM0A 2O67A 1U1PA 1T8EA 3ZTPA 2H5IB 3PNIA 3RBXA 1TL5A 1FO1A 2PI5A 3M2RB 4OI3A 1FFSB 2VPYB 5B7WA 3PW7A 3TOQA 2C2MB 2ACMA 3PY8A 4ILMA 1RT6B 1S1WA 4F0HA 4Q0BA 1X60A 2DNPA 1IKWB 5KAKA 3NWRA 3WDOA 4LF9J 3W8PA 4ZPDA 3EPGA 3CCJS 1BLUA 3M2RA 2J7KA 1RQ0A 1WUUA 1BWEA 2R3VA 2XCPA 1RHQB 2MZRA 4Z2XA 1RT6A 3OL8A 4CRJA 1WEYA 4JI1F 4NYZA 3HO1A 2VG6A 4EBDA 4OYPA 4LSNA 1X4CA 5CYMA 1N36F 4DUYF 2VBWA 4ZVTB 3D6FB 2FJEB 3WX8A 4CM0A 3OUYA 5K8PA 4K4UA 5HN0A 2LP4A 4WU2A 3TNVA 3W8GA 3Q8QB 4LJMA 3ZTQA 1K9MT 3NAIA 2C2ZB 2JZ5A 1WC6A 3FRYA 2XWXA 3VF0B 2BANA 4ZPVR 1X5PA 2B3TB 5IT9U 2E9ZA 1QVGR 3VGUA 2WB1D 3GFZA 2EFVA 1Q7LB 3HI9A 3PHTA 3H98A 1DRZA 2XSJB 1FA0A 2BX6A 1FKPB 2FHMA 3KUEA 2HFUA 4CLPA 2MKYA 1UL3A 1NJWA 4J9UE 1I51B 2QV6A 1WI6A 5CA5A 4OZ1A 1X5SA 3VQSA 2DT9A 1NJIT 3CCLS 1CQNA 1S7IA 1HNZJ 4KHMA 4I64A 3BSOA 3F0NA 2GO8A 5ETLA 2XSJA 1XR5A 3JQKA 4JYAJ 2DHGA 1B0PA 1FKPA 5EHHA 4F8RA 4C48A 1RHRB 2J6TA 1NM2A 4WFAQ 2PMHA 4MJKA 5I3PA 2E5JA 3NY0A 5KFYA 2R2TA 5LSRA 3L7PA 3H4DA 2GAGC 1WTBA 4JV5F 3UNGC 4E98A 3B78A 2DNMA 4NRTA 2R7UA 4PXDA 5IQ6A 1YK9A 3G71S 5IM0B 1EKRA 3KLHB 3QPIA 1XBWA 5GAHI 2W2QP 5AE1A 3MEGB 1H2UX 4ELVA 4DR7J 2BJDA 2XMMA 4OI6A 2YQ1A 4YB1P 1WDTA 2ZZMA 2XS7A 4G6VB 1GFWB 3K5MA 2LXIA 3BKTA 1K47A 2HQ3A 1N8RT 5IV3A 1BMQB 5IM0A 3KLHA 3ZTRA 1TUVA 2R8HA 2DJWA 3AFGA 4DR3J 5A8RB 2EBEA 2FHKA 1XEZA 1UTAA 3H4BA 1QM9A 4RUHA 4HACB 3T41A 4NLRA 3L3CA 3DLJA 3TA1A 2UV8G 5E7OB 3EZ5A 3RRGA 3OL6A 4USVA 1NJYA 4OYBA 2M5YA 3P5TL 5KFNA 1D9DA 1PBAA 4NX9A 2P5VA 2DIUA 1EHWA 1S48A 3IO1A 4KFBB 5KFMA 5HSPA 1YRXA 2WSCC 3PVXA 5LOQA 1KLMB 4L76A 3BDPA 3V5RA 5IWAF 4M5LA 1Y9OA 3K0JA 2VQEJ 3QIDA 3C14A 1GX6A 2Y8YA 3BGRB 3EE3A 2H4YB 4NXMF 3LF0A 4KFBA 2VV5A 2WHOA 2EC2A 3BREA 1TFWA 2CPXA 1TKXB 2AX1A 1KLMA 2FC9A 1BHNA 2FVSA 2KM8B 3HD2A 3H2VE 2CADA 3MR7A 1M5OC 3K5OA 2F7VA 4ECRA 2JHEA 1TK0A 2BE7D 3TRGA 4LF6J 1HNWJ 2V50A 4X4NA 2DR8A 4DEZA 4F25A 4X64J 1TKXA 2ZH5A 4MH8A 4OZ3A 4DXLA 3JAMY 3LP0B 4B3TJ 4ZP8A 3B8HA 3KDOA 4A4JA 3G6VA 2VHGA 2RF2B 2CJYB 5KT5A 2FDNA 1S0NA 3VAJA 3UN2A 3CEDA 2ZE2A 1UFLA 2ZD1B 4RBVA 3MEDB 1X4FA 3LP0A 4EGLA 2V8PA 4ZDNA 2IDLA 4DR6F 1Y5IB 2QA1A 3FJ2A 4DQIA 2RF2A 1BXNA 4DX7A 3BYRA 3TAMB 5A8KA 2RJZA 1GMWD 2DNYA 2K7KA 1S9FA 2FTRA 1MSWD 4DV1J 1L3TA 1N56A 2DO0A 4F3MA 1FRHA 3U1LA 3N5BA 1ZAWA 4ZCMA 4ICLB 1D8YA 3UNYA 4OYIA 3MCSA 3SV3A 3I96A 4DSIA 3TAMA 1HARA 3H20A 2NYHA 4F2RA 2U2FA 3ZNJ1 1FRIA 1NPRA 2JNJA 4A8OA 3V4IA 1YBAA 5KFSA 1RLDA 3V81B 3FMBA 3ZZOA 1FX2A 3CJ2A 5CXTA 4ICLA 2A6MA 4EZ6A 1MW7A 5ITHA 3MR5A 1HNIA 2KH9A 3OSNA 4K5RA 2Z56B 3JXOA 3QQCD 4CIOA 1KTQA 3OT9A 2CWKA 1VRQC 1WC1A 2DIVA 3UDCA 1SPBP 2OEJA 4M1KA 5HVGA 4LF4F 4J9QA 4WIIA 4PG5A 2YNGB 3NS6A 4QW9A 3PYFA 3VZHA 3RB4A 3V81A 1KP6A 2VH7A 2XCAA 1FVQA 2X1AA 2W1BA 2IVYA 2YX1A 1OSCA 2R7VA 3DU5A 1RT2B 2OP5A 3AD7C 1X9WA 2FJDB 2YNGA 4PAAA 4ID5B 1HQUB 2XYPB 3HHNB 4F3OA 2QO3A 4KE5A 4FXDA 1XC9A 2H5JB 4AQYJ 1YJNS 1RCOB 2E66A 2DTJA 3FBFA 1RT2A 2CPHA 3MFIA 4M5GA 4NLQA 4OYOA 3P96A 2CNLB 4ID5A 1HQUA 4NZ6A 1LFWA 1RAGB 3W5XA 3H59A 4B9NA 2WONA 3ZZZA 3PO4A 2I5JB 4P7VA 2XEXA 4Y2AA 1BQMB 2GQCA 3M9NB 4W92B 3HHLD 1VBKA 1R6YA 2GJIA 2EI5A 2PMWA 4YMEA 4LF9F 2PO4A 2GVDA 2I5JA 2H3EB 2MZQA 2MQMA 2VJUA 2PN6A 1TKZB 2R7RA 1LW2B 3GCWP 4YP3A 3O8WA 5FDLA 5LJ3Y 4TYBA 2E1CA 3OR1B 4NLUA 4C8LA 2AKWB 2LA6A 3TUPA 3A8KA 4NEZA 3R6GB 2F8MA 1TKZA 1LW2A 3SCJE 3TZWA 3GFYA 1R0AA 2HBZB 2Y9HA 2VQFJ 3QNWB 3A3OB 3JSMB 4JI4J 3MM8B 5D0GA 4ZJLA 1M1KT 2ZUGA 3F44A 4K4TA 1A7GE 4WP8A 3IS9B 3T5HA 3PACA 5DLFA 2P6SA 3HJFA 4MFBB 2AGQA 1FWKA 4IKAA 1KR4A 2ACYA 1RKJA 2AMCB 3JTPA 3HDSA 2QLBB 4RW6A 2XC9A 2NPFA 3QSYB 3NS7B 4WPAA 5K9FA 3JSMA 4WFYA 2YNFB 2K8GA 4HTJA 1UPMB 3MM8A 3PFEA 1HBUA 3W63A 4HH0A 3CE8A 3DGPB 1FKAF 2D3O1 1KQFB 4JUZA 2QEXS 1OMSA 1HNZF 3W60A 2IJFA 4MFBA 4AL5A 3CJ4A 2CJBA 2BVZA 2DEIA 2E5IA 2HHXA 5G0RB 2OPPB 4JYAF 1OQ3A 2HVIA 3S8SA 1R7IA 1Q95G 2N4CA 3CCUS 1Y10A 1IBMJ 3OV7A 3C8YA 3DGPA 2XLKA 4RW8B 2XLIA 1SL2A 1FEEA 2CPZA 5G0RA 2N7YA 2OPPA 3VGVA 4K0KJ 3Q8VA 2MMYA 3PCOB 4O3OA 5LSOA 3VALA 1UVLA 5CABA 5KG7A 3GR0A 2V94A 2DPIA 5DO2A 2C3OA 1IJFB 1GMUA 3VQTA 1ZTTA 2OSQA 2CXEA 1VQ7S 3JQJA 4RW8A 5KG0A 3H25A 3I0RB 2B4VA 1U1RA 1VI7A 4OL8A 4DR7F 4ZP6A 1YZ6A 1VMBA 1FT8A 4M94A 2MJUA 3Q89A 4FZVA 4TQSA 2F9JA 1AUSL 1GXTA 2N3LA 2QRRA 1TU0B 1RT3B 4LR8A 2L9NA 3QRRA 4I4BA 2P9GA 5F8JA 4X4VA 3I0RA 3M32A 5ETRA 5F41A 1CC7A 2ZH8A 2V4JB 2XGPA 3WIUA 3CCSS 1M5PC 4CO1A 4X84A 1RT3A 4UQTA 2IYIA 4XDCA 2H48B 2DH9A 1TELA 2HBQB 1QTNB 3BN4A 3IG1B 2Q3PA 1U1LA 2Y3YA 1SC6A 2DKOB 2V4JA 3H5UA 4NLWA 4KSEB 1KNZA 3KOAA 2ZH3A 3MAHA 1S0MA 3FFIB 3G82B 3MPDA 3PFOA 1AW0A 4PPDA 4A8WA 4CLYA 4DMZA 3GJSB 2XS2A 3M8PA 5E3PA 4F0MA 4UT4A 3C2PA 1WEXA 1UVMA 4HYKA 2VQEF 2XO6A 3H2LA 3O2IA 2HHWA 4CI0B 4DBQA 3IBWA 5F8MA 2BJ7A 4USWA 1HBMB 1SI9A 3FFIA 4LSLB 5CZVA 1RAAB 2DGTA 2ZBPA 1ZS6A 2KKHA 4YQWA 4DF4A 1ZA1B 4PRFA 4E2FB 5IXUA 4CYUB 3L4BC 3UE2A 1LK7A 1CQMA 1PC5A 3RZAA 4CDIA 1HNVB 1KOOA 4LF6F 1HNWF 1JKHB 4KO0B 1UEUA 2NR0A 1FDNA 2R2SA 1HBMA 2HNDB 4LSLA 3LAMA 1HA1A 1LFPA 5DG8A 1B70B 4BC7A 4Y6IA 3HFVA 1RT1B 1Q5YA 2FZCB 1N5TA 4F04B 4FYVB 4B3TF 3I5AA 4ED3A 1ITPA 1RA6A 4ELUA 3KK3B 2HK2A 1KKHA 4HHUA 3QZ7A 2IYGA 3MUTP 2JFKA 2H51B 3FQKA 1HNVA 1FE0A 4DWIA 4NCAA 2ZNYA 3M2VA 1JKHA 4KO0A 4W98A 4TQRA 5AE3A 1PJ5A 1VBYA 2AJ2A 1M0SA 2D3UA 2GFFA 1RT1A 1NKCA 2VPWB 2VKZG 1JXLA 3KK3A 3DLKA 2FLPA 3OFHA 3GIJA 4RWXA 3I4PA 1CULB 2WCXA 4B9LA 3SBMA 4BCAA 1WHWA 4A8YA 2DXDA 5HJYA 2BRKA 4EYHB 5DZ7A 3NCPA 2CQ0A 2ADCA 1OS5A 5M2PA 3WHIA 3MGJA 4DV1F 4KR0B 1MNEA 4U7UK 3KHLA 4BC9A 1SKUB 3R2DJ 2MSTA 2WW8A 1CULA 2C3UA 3KJQB 4C3LA 3PW4A 3BB5A 2HHVA 5EGYA 2R8IA 3DDNA 4OX9J 4MKYA 4Y34A 2O1PA 4X4PA 1NSQA 2AEFA 2HLUA 2CKWA 4A8QA 2BM0A 5C7PA 4PWWA 3RU0A 3CNQP 3DXSX 4P75A 3BSCA 3TW0A 3EZOA 4N8NA 5E33A 5IFMA 2EKNA 3NKYA 1G4CA 1RZMA 2R7SA 2J0SD 3UN3A 1RWPB 4N8OA 4UOHA 2FLOA 1UW4A 3AJ1A 2CQPA 4H54A 4WZQA 5EN1A 4ZVEA 4NE9C 1K1SA 1DTTB 2XI2A 1JLQA 3HCXA 3NAHA 3D5MA 1RTDB 2CQ1A 4IRCA 2XHCA 3NMRA 5KG6A 2XULA 4K4VA 2FYXA 3HSGA 2EW9A 2JWNA 3AQOA 1I94J 3SI8A 1RTHA 1X8DA 1FJEB 3LTOA 2C42A 1RK8A 4USKA 1DTTA 2MKSA 1VYAA 4ILRA 4B17A 2UUCJ 1S4EA 5HROA 4X62F 1M5KC 3CJ5A 3I9ZA 3RGIA 4OZ5A 3BO2A 2IC3A 3RB3A 2QLWA 2E44A 2ZWOA 4ZCKA 3KLGB 3J80Y 3D54A 3CCWA 4I7FA 4X4RA 4MYUA 1OYDA 1WDDA 3LO3A 4N41A 1Q8IA 4I2PB 2ZOGA 4UOGA 4G1PA 1DQAA 2RS2A 1Z2LA 1XMBA 1PYTA 2YKOA 4K4WA 4KHPJ 1X4AA 3AA9A 2OD4A 2DK2A 3KLGA 2VFTA 1Q16B 2BOPA 3PIPQ 2YWGA 2V63A 2ZH6A 4AXJA 2FC8A 1KN6A 4CWBA 3IFEA 3M9MB 2FB0A 2YWHA 1LWEA 3FDSA 2NCKL 3ZC4A 4DL7A 1K0VA 4DR5J 4Q7AA 1RISA 4ECQA 3VGSA 2HVHA 2K3IA 1VC6A 2ILZA 2IPOB 5GAHU 2V4RA 4Z7CA 5LSLA 3GFXA 5F0UA 2LU2A 3PHEA 3NWGA 4OI2A 2DISA 2DHHA 2VQFF 5J1EB 4ZP9A 1HWKA 4Z37A 4JI4F 4YY3J 2OPQA 2HHUA 1N5QA 1JLBA 2OJ3A 1F60B 2M52A 3BGLA 3I87A 4ILLA 2Q66A 3LANA 2E1RA 1ZTWA 1HLWA 2DNQA 1CVJA 2CPJA 5J1EA 2W4CA 2M0GB 5CZXA 2E7VA 2UV8A 2H65B 2HQFA 2YTCA 3CF5Q 2F65A 2HFSA 4CLKA 1RDRA 1D0EA 4U6PA 1PSDA 2AYBA 1HD0A 3JSRA 2FPHX 3QBCA 3W9JA 3OVAA 1AXQA 2R7XA 3ILOA 1JLAB 2ZH2A 1XR7A 2ROPA 3LP1B 3FSXA 3TAQA 2AD9A 3WQPA 3JTNA 1F5CA 1T9WA 1NH7A 1IBMF 3CJSA 3MFHA 3AD8C 3CGIA 5KFIA 3F73A 3Q86A 5JVGQ 1UCNA 2OFGX 3UVJA 1JLAA 2YNHA 4K0KF 4RO0A 1H7XA 1DTQB 2GC8A 2LVWA 3LP1A 5KOWA 4F4YA 2HFZA 1OPZA 2XNRA 1NDCA 4ZVPB 1OWXA 1NK5A 4GO7X 1MWYA 1RKIA 4HT5A 5JMNA 2LQ9A 4LFAJ 2R8JA 4EEYA 3JQMA 4YHHJ 2C2RA 2W24A 4CCHA 4F4ZA 1OY8A 1F0XA 3W2WB 2XS5A 1IVZA 2GJFA 2FVPA 2CZ9A 2IMOA 3KG1A 1S1TB 2QX0A 2B0GA 4Y2KA 1S9GB 2I1RA 3MM5A 1C2PA 1M5VC 4PR6A 3PXGa 4JI2J 2HLTA 2IM2A 4PABA 3DRYA 1HI1A 4B02A 3K17A 4AL6A 2LU1A 1YRTA 3GIKA 3V6JA 1S97A 2RVJA 1TAQA 2KJWA 2NZ4A 4L3NA 1S9GA 4ES3A 3C16A 2IBKA 1K44A 3RB0A 4LF1A 3PW2A 5AXMA 2OI2A 4E0DA 5K8OA 2NQPA 1IUJA 4ZLNA 4K4YA 4LVNP 3ZTOA 4Z7YA 3OXGA 3TO8A 3GPAA 1IBKJ 5HQLA 3P6YC 1H0HB 1IR1A 3CW2C 2HHHJ 4DPWA 1OSDA 2KN4A 1MMLA 1IQZA 2E7XA 4DX8H 2DNRA 1RWWB 4O44B 2E29A 1VK3A 2W9CB 1U1QA 3ISND 3PRBA 4C98A 5IT0A 1SQFA 3NRBA 4P71A 4WZMA 4ZVFA 4MAKA 2BJ9A 1YJUA 1YX2A 1VLYA 2Q43A 3DOKB 3TP2A 3FQLA 4RL1A 4H4KC 4QWBA 3GFHA 2MZTA 1HHSA 4PUOA 1YZ7A 3AY0A 4O44A 2YKMA 4CT9A 3N79A 1M90T 3M6VA 2BE2B 2XYGB 1Y3JA 5GVQA 3NGUA 3DOKA 5J1PA 2M8DB 3UDEA 1R8AA 3W9HA 4RUBA 2JX2A 4I56A 4I0WA 4J9VA 1K8AT 3DI6B 2XYHB 3IRXB 5D8HB 5CYQA 4EFAC 2XY6A 1JLCB 3GE9A 5ETSA 4OV6A 5FD1A 5ETMA 2PA8D 4AE5A 2BE2A 3MR3A 2PEBA 1JLGA 2CPYA 4O3RA 2D3OR 5L9XA 4DR2J 4IYQA 3QATA 3U02A 1HI0P 3LQVA 1TV6A 2KRBA 1V3RA 3CD6S 4P72A 1JLCA 4ZMMA 2HHPA 3ISZA 1JLFB 3NOCA 5D4NA 4YR2A 3TZZA 1FJ7A 2CPEA 2EWHA 3ONQA 4LRCA 4V19X 3UDLA 3PKMA 5DQIA 2WVFA 2J5AA 2BZ2A 2KZZA 2KDOA 2I0XA 2C3YA 1WKJA 3T1HJ 3GB0A 2XG8A 3C19A 4OX9F 3THVA 4C3KA 2BOAA 1UW9A 3CJ0A 2IY5B 3CC7S 1O6XA 2FQQB 3RBZA 2CIMA 4GKJJ 5FLXU 1Y7PA 3TJ8A 2XQCA 3QJJA 5MLCV 2MGZA 2CQBA 3BKFA 4G3IA 1PYSB 4KGMA 1IWGA 3CJKB 1HHQA 1QE1B 2EK6A 1VQKS 2QC3A 1ZM4A 1S77D 1U6FA 4XIUA 4R5PA 3KUHA 3P45B 1RSCA 4JI7J 3KFWX 3ET6B 2XI3A 1UVJA 4HI2A 3CTRA 2B6AB 1GXUA 2BJEA 3J81j 1S1XB 3J7AN 3SEOA 3CJKA 1QE1A 1NO8A 1RBOB 2C2OB 5D15A 2D1CA 1I94F 3KNGA 4KGZB 4JI8J 4YB7A 3SYZA 1SH0A 1HWIA 3SQGB 3C15B 3ET6A 8ATCB 1H72C 2B4OA 4UY85 2GIQA 1FNOA 4A8SA 2B6AA 2ASLA 2UUCF 4OI1A 2A0FB 2FJBB 3AOAA 1S1XA 3R9LA 3TI0A 1C1BA 1XK8A 1EETA 4C6AA 2LECA 3M8WA 3NCRA 3MI7X 1OO0B 2AEJA 4ZVOB 4DSLA 5KTQA 3EUNA 2B5JB 2CG4A 2ERRA 5LMUJ 2Z2ZA 1I3OB 3SQGA 4OYMA 5E3AA 2OAUA 1I1GA 2QYGA 4WYWA 4QCLA 2Z30B 1MU2B 5GMKa 1VQNS 4ECUA 3QZ8A 3R6LB 1UZHA 4OYXA 3BPDA 3EM1A 3UCGA 2YKAA 2CNNB 1DLOB 4FF3A 4C8MA 2B5JA 1KRPA 3EGNA 4NXNJ 4QJVA 1Y4ZB 2FIUA 3UFCX 1NK4A 1P9QC 4M95A 1N52B 1SBRA 4PZVA 2NXCA 2W2MP 4N7TA 1MU2A 2L9DA 3W5YA 4RR5A 2GZOA 2W2PP 4ENOA 1UVNA 1R8CA 4H4MB 1DLOA 5IS2A 3QT5A 4JP8A 2OPRB 4DR5F 3AXMA 4IO9Q 4LF5F 5EWFA 1VISA 4ZIWA 1XNQJ 2BE9B 4YB5A 2EXUA 1P27B 5F3ZA 4RKUC 1WELA 3BGFA 1B64A 2DXEA 2ZVSA 1NCLA 1TTHB 1G6BA 4C0OC 3J81Y 2XMTA 3EYZA 3IXQA 5D4PA 2DR7A 4YY3F 5A0YB 1UA0A 1ROFA 2MDAA 1RBAA 4DL6A 1TL3A 2LQ8A 2J0WA 3FEXB 5FIIA 2VBXA 2X1GA 4UZCA 3UN5A 2BW2A 4UY8T 4ED1A 3W61A 2LXUA 3TA2A 3RBEA 5DZ6A 1YWXA 2HQCA 2Y0BB 2UUAF 3NNAA 2DNKA 3SFUA 4ELTA 2EFGA 4ZLPA 3CDAA 1D9FA 1U1KA 2P2CB 1TMMA 1VQ9S 1VCTA 4QU6A 1IBLJ 4QQBA 1VQOS 5D4OA 2YPZA 3QWPA 4RW9B 2GMLA 1U24A 5KFTA 2QG9B 2GVZB 2HYIB 4ERDA 4OJHA 3UPFA 4ZVHA 1RJJA 1W2IA 2J0XA 3OJSA 2FGOA 2IVMA 2VFRA 3P49B 4CH7A 1E6YB 5KT2A 2DNHA 2JEFA 3MDFA 3HK2A 3CCES 4XDDA 1SC4B 3CO0P 3DRXA 4QPXA 2N82B 2JVOA 3SQOP 3GQCA 5CD4A 2FUG9 3SMZA 4LFAF 2DH8A 2B9EA 1EZZB 4YHHF 2N3OA 1ZPVA 3R1LA 2WTFA 4D3GA 1LK5A 5T7LB 1E6YA 2HNZA 2VFVA 4IRDA 1V9OA 1S49A 5K8NA 3M05A 1REGX 2KM8C 1RI7A 3TEHB 2CZVC 2JEGA 4HLBA 2UVWA 4DLEA 1NEEA 2RRBA 2WSEC 2GV1A 4JI2F 1F9HA 4ED5A 2E7WA 2AIRB 1FF2A 3DRSA 3MOZA 4ES1A 3HM9A 1N5YB 1WHYA 3MAAB 4OHZA 3GSDA 3OW2R 2X51A 4ECWA 4IOCQ 3AOBA 1ICEB 4WBFA 4IO1A 1FTRA 5F9LA 3QJLA 2HS0A 4CO5A 2MXYA 2M3DA 1WOSA 2F4FA 4ZJOA 5K8MA 1IBKF 3KHRA 1HWLA 4ZPBA 5BYQA 3ENWA 2HHHF 4DS5A 4Y2IA 3X3UA 1UMJA 2JFDA 5C25B 2VG5A 4J5OA 4L6V3 2PE8A 1Z1ZA 2NLWA 1HWUA 3BR8A 3R5BA 3DOLB 4C2MA 3R5AA 5D3GB 3ZO7A 2VUGA 4OQJA 1KFSA 2E9RX 2MYFA 4F2SA 4Q44A 5C25A 4CO4A 1AT1B 4C3MA 3OL9A 4KKOB 2E5GA 2YWEA 1VS3A 1FRKA 1NB7A 5D3GA 2PFFB 1OY9A 4MIWA 5KFGA 4M5MA 4F4KA 1QAXA 1Q81T 2H4WB 5AE2A 1D09B 2OPSA 1HW8A 2ZH9A 2Z0GA 4B3OA 3HULA 3PYEA 4WU3A 3FNNA 4IQXA 1U1NA 5B0BA 1K73T 1V6HA 4UUWA 4EU0A 2RRNA 1KQGB 3W7BA 5AXLA 1QSYA 2WVCA 2MLZA 2UVVA 2W8KA 4IR1A 5T41A 2PT0A 3DLEB 5E0OA 1KLNA 4DR2F 1W26A 4RZRA 1EAYC 1WC5A 4CLSA 4HTIA 2FJVA 2YWKA 3ZZTA 1EJ7L 1U1OA 3BSAA 1XTZA 4M5IA 1VIOA 2BKPA 3BKUA 4ETXA 3CDWA 2IBOA 2VKRA 2CJKA 1NKEA 5H9FK 1TAUA 3T1HF 1BC6A 1W7WA 2V9WA 3HHLB 2HVZA 4RX6A 1U25A 3POTB 1AZSA 3IBFB 3VAHA 4ED0A 1X9MA 2ROGA 1UZDA 3D9BA 1M5HA 1UEVA 3MCNA 2XMUA 1GK8A 4ANCA 1UJ5A 2MY7A 3ILJA 4FP9A 5KFUA 1YG0A 2RRAA 1EARA 1VGYA 3MM7B 3POTA 2QSFA 1LWFB 3OR2B 2FVRA 2DY1A 2ZWPA 4CLTA 1U8SA 2WRMA 4S0MA 2HHQA 2CJ9A 3J7YI 5HK4A 3NNHA 4ZOSA 4URQU 4JI7F 3QYYA 2R7TA 5U47A 3O44A 3MM7A 2E5LJ 4G65A 4ZCLA 3D4JA 3Q8PB 1LWFA 4HI1A 3OR2A 5HATA 4ZK7M 1FI4A 5HLFB 1V3ZA 2ZBQA 4NEYA 4BLGA 1WF0A 1T9XA 4QYZK 2KVQE 1PJ7A 4JI8F 1XN9A 3CSKA 3D0HE 3EGVA 2VONA 2BEFA 3CD0A 2NPIA 2H54B 4OYZA 4P9SA 4WXOA 3CC2S 3AJDA 1Q8LA 2XB2D 1AFJA 4ER8A 2CQ4A 3QAEA 1U47A 2BW7A 4NCGB 4P2MA 5M2UA 5HLFA 2CWXA 2KYXA 1YLXA 5J2MB 1T9TA 3I31A 4YUDA 4LQ9A 4GVBB 4ITSA 4PG8A 2D3ZA 4J90A 5CCMA 5SUHA 3TZYA 1F3VA 4XPCA 3CD7A 3KK1B 5J2QB 3M2UB 4NCGA 3TJ9A 5KG2A 1IN0A 5JJBA 1RHUB 2XMWA 1QUPA 1RWKB 2ZDOA 3PX0A 4NXNF 1T9UA 2AJQA 1X4HA 1TUWA 1JLEB 3MUVP 4XO0A 4P10A 2OEKA 2RSQA 1RWNB 3M2UA 2A10A 2HAFA 3OQ2A 3OSPA 3C46A 4P52A 3EVWA 1S57A 2OMLA 3B54A 3DGVA 2XHWA 1JLEA 4XTTA 3GIMA 4NA2A 3RG6A 4DL0C 1OQ6A 1RTIB 4UZBA 1XNQF 3G87A 3PEHA 1RWVB 4DI6A 4WTOB 4HDHA 1T02A 5L46A 2YKQA 2C22A 2JRSA 2PFDA 5HANA 2N4DA 2YH0A 4DV3J 2B8QA 2CQIA 3TZXA 2RMLA 1CJKB 3QAUA 1LXJA 3GR1A 1V3SA 4ZCIA 2YWWA 3GV8B 1S10A 1RT7B 3D66A 1RTIA 4PYAA 1WACA 1RWXB 3MMBA 3M30B 4DF8A 2CQ2A 4A48A 1NH8A 4M8LA 3S01A 3IP0A 2B56A 1U2CA 1CJKA 3R2CJ 2ZUAA 1T11A 2XM3A 1EIYB 4OX8A 1RT7A 1NHVA 4DUTA 1S9EB 3BH6B 1NLKL 1R8BA 1UA1A 3QSIA 2AT1B 3M30A 4DCOB 2HHSA 2OIHA 1GTEA 1IBLF 4D3HA 2NXEA 2DHAA 5GMEA 4P6QA 3R5CA 4F4XA 2OO4A 1FJCA 2KL8A 3O6QA 1QDUB 3I5BA 4QBUA 4FKXA 5EX0A 5KFLA 2QIFA 2QJ3A 3EXYA 3O1LA 1S9EA 2F40A 1B99A 3SXLA 4RW4A 2KVIA 1JJ2R 2RU3A 1TL4A 2VG6B 4LSNB 3LAKA 4EO6A 5CYMB 1IKYA 3FC9A 4Q43A 4CTAA 2MB0B 2GHPA 4P2XA 2BABA 3VVTA 3OUYB 2IM1A 1N33F 3KJVB 2AWZA 2VG7B 3SDEA 4J9MA 1WSRA 5GAGI 1JWWA 1S59A 3TANA 1WOOA 2GW8A 1RTZA 1QD1A 2IFXA 2F3JA 2GX8A 2C2EA 5LXYA 2OLWA 2BANB 3MMCA 2CDQA 3HXMA 1YBUA 4LF8J 3NGKA 2LDYA 5H1SV 4GC7A 1NHUA 3KJVA 3RJMB 2VG7A 2BXJA 2XO7A 3DN9A 4DFMA 4NYPA 2VOOA 4ES2A 4U7CA 1D8ZA 1I5OB 2V2KA 4LF7J 4R8UB 3FSYA 1UETA 1VJQA 1ELOA 4YEAA 1RBLA 3L9ZA 4PCQA 5GADI 3VAIA 2FY8A 4B9VA 3KXDA 5GMDA 4QR2A 1PILA 1U45A 5LT5A 1SKRA 1T9VA 3RYLA 2PD1A 3UR3C 2R7OA 1N88A 3K5PA 4DG1A 1UPPA 1XMOJ 1UFWA 2G2ZA 1FTCA 4R8UA 3CCQS 3C6UB 4R0EA 4DN0A 3HFZB 2ZH7A 2B9WA 3OFGA 4DV4J 4FN5A 2FJXA 2XLJA 5I3UB 3CCTA 4J9KA 1FDBA 1WTFA 4RU2A 4NOHA 4F36A 3UW1A 3BF4A 1CSJA 1J27A 4XAKA 4U7UD 3C6UA 2ZFHA 1WKKA 3MECA 2OTJS 2A18A 1VQLS 4Y65A 4PQAA 4K5SA 4TXSA 1EP4B 5I3UA 4JI5J 4DQRA 4J9NA 4WYLA 2ZH4A 3HKZD 3OL7A 4NLYA 4KTQA 3AT1B 5JUMA 1RE1B 3FZBA 4USTA 4B3SJ 1NZAA 1IBCB 1LWXA 4KH1B 4DOZA 4BS2A 3VWSA 1FVSA 4FNIA 1EP4A 3DMJB 3DLGB 2Z2YB 5J1NA 1YI2S 4C8OA 2UU9J 2ZITA 4WP3A 3FKBA 3NOGA 5D0HA 2DNNA 2IHR1 1J5EJ 2G0JA 2ABYA 3VAFA 3EZUA 3IMQJ 1PO6A 2PMZD 3GIRA 2HWHA 1FWPA 3OPKA 4PQUB 2HS3A 4AXIA 4LRDA 5IV4A 1FKOA 3DMJA 1WG4A 1DQ9A 4IG0B 5ETPA 2QA2A 3CD5A 3DLGA 1UJ6A 2W01A 1YDLA 2XMJA 1VJWA 3A12A 3V6KA 1HQEB 4FF1A 1S79A 4URSA 3BBBA 3M8ZA 4PQUA 2DHXA 3C14B 1OYEA 4OZ0A 2HQGA 4IG0A 3M1VB 3FK4A 4IDKA 2KFNA 4HHJA 3D6TB 4RLEA 4KGKA 1HQEA 2UXDJ 2B7CB 3M8QA 1WD6A 1FD8A 1SC1B 2CZ4A 1YKWA 2KZMA 3GCXP 2YX4A 2KO1A 2WVBA 3BQ1A 2HFNA 2D9OA 2V2ZA 3E2EA 5E5NA 4X65J 3RRHA 1KD1T 3M6UA 5DDQC 3M1VA 2ZZTA 2W7PA 2M70A 1FESA 2Y1LB 2DRBA 3HSZA 2K2PA 2KHDA 2HEKA 4KGXB 1G3OA 2ZZNA 2XSFA 4WTYA 1VQ6S 5C2GA 1FD2A 3OLAA 1LXNA 3FMWA 4BBYA 3FBCA 3R5DA 2PDAA 4LQ3A 3P8BB 5B09A 4TLQA 1QAYA 3LALA 2KXFA 2ZE2B 3MPWA 1U48A 2CQGA 4DX6A 2DITA 3UR0A 3GJTB 1HMVB 4DV2J 2IAJA 4B9MA 3QRPA 1U4BA 2MPUA 1L5UA 2RNEA 1N0VC 1RT4A 3WBZA 1HHTP 1CJUB 3A8EA 3A8JA 3VTIA 3MPYA 4C0BA 1XMQJ 1B4SA 5A8KB 2RE1A 2OKQA 3HJVA 3W64A 4X2BA 3MM9A 3ENQA 3CJ8A 2Y1JA 2OMOA 1MG7A 3BYPA 1HMVA 3ILIA 1VFJA 4P74A 3JYTA 3LGNA 1CJUA 3W66A 3A13A 3THTA 2GMJA 2QGFB 3QGHA 1X4BA 1LW0B 3JSYA 3U7JA 1ZPWX 2Q6CA 3MXHP 2BJ3A 3GTYX 3V4IB 3RR7A 3AQPA 1RHMB 3LGMA 1S1UB 4OV1A 3MCMA 5B0GA 1VIXA 3VHQA 2HRYA 7FD1A 3FSIA 1HNXJ 2IDEA 1HNIB 4CQ1A 4F3QA 3KLFA 2YWFA 1LW0A 1LNQA 3FGVA 3CXCR 2FLLA 1RHJB 1F3FA 2B8PA 1S1UA 2WW4A 1F6TA 2YX7A 3W62A 1F2HA 1KVIA 2J6SA 2EG1A 4K4ZA 4GVLA 2C1EB 1T3NA 4FVCA 2DD8S 3SCLE 2OHDA 2YKNB 1QVFR 2F8HA 4B08A 1NPKA 2ROEA 4DV3F 3M7VA 1KEKA 4EO8A 1NNDA 2XNQA 2RD5C 4Y0FA 3PRVA 1CS4B 1AROP 2HPUA 3G9CA 4MIBA 2QN6B 1VQYA 3H5XA 3KJNB 1MROB 2HFVA 1DHMA 2MTLA 2O01C 3CWJA 1U0SA 5BYSA 2YKNA 2FHJA 2EC0A 2VICA 2DRDA 4EZ9A 4AT1B 2ZJPQ 1KC8T 2BQRA 5D4LA 2WONB 2VA2A 1OPIA 3EGZA 1MWQA 1CS4A 1AB8A 2QA4S 3ITHA 4C11B 2AJFE 2D9PA 4ZLLA 1MROA 4X4SA 3KK2B 1Y5LB 3LWLA 2DNLA 5HQMA 1S5ZA 4ALZA 1SL1A 2B9XA 1E6VA 2VC1A 2ZNZA 2BJ1A 1G7CB 1QAIA 4IH7A 1J5OA 4NLGA 5ETVA 2GVDB 4RU9A 1QAJA 1QSSA 4ECSA 3QMQA 2IA0A 4C11A 1VQ5S 3KK2A 4X4UA 5LXRA 2JLEA 5FDLB 2I38A 5HQ8A 4KIAA 4NMXA 1G2EA 3U1MA 4RNOA 3E3XA 2OUGA 1R3NA 3O5TB 3GLJA 2ASDA 3GWCA 1RXOB 2XTJP 1A9NB 4XPEA 1R0AB 2NS1B 4WK3A 3PW0A 1KHWA 4U96A 2SXLA 1R6VA 2RILA 3HVTB 1NK6A 2VBYA 4USMA 2ASYA 4WXWA 2WVEA 3KLVA 5A2QY 1KQSR 1BE4A 1X5OA 3J7ZT 3G86A 4LF8F 1OY6A 1Y11A 2GCFA 2Q1LA 4C4WA 2J8SA 2A6OA 4RW6B 3ZZPA 3G6ES 1SIWB 5KFAA 5JVHQ 4USIA 2EBGA 3HVTA 2ZHOA 3QT7A 2KXHA 1HBUB 4LF7F 3MUMP 2DH7A 4B9TA 1X9SA 3VCDA 2LFVA 3W9IA 5E3CA 4DV0J 4OIXA 1VQSA 1XIQA 4HDGA 1U7LA 2F9DA 1CJTB 3IRWP 1SCJB 1XMOF 1SKWA 3PO5A 2QL9B 3FBEA 3FEYB 3V2UC 2V0NA 1U6BA 2M7SA 4DV4F 2J9DE 3IR7B 3OFEA 4RNMA 1IKVB 5J2PA 3E8OA 1CJTA 4QZVB 2UZAA 1FERA 4QR0A 1WF2A 2JL9A 5KT6A 1S7HA 2R8KA 2OSRA 3AXKA 1LWCA 4DFKA 1EKSA 3L7UA 5B0AA 4MMOA 2BACA 4QIWD 1VQPS 1YJWS 4EBCA 3LPYA 2Z58B 2GQ2A 4C8YA 3TARA 1T7PA 4JI5F 1IKVA 2H1YA 1WHXA 4DCJB 2LQBA 2BQUA 1DFDA 4MK7A 3UI3A 4B3SF 1ZAVA 2OH2A 2VIHA 1QLNA 3J7YU 4IG3A 3T19A 2HBRB 5EWGA 3M32B 1SH3A 4CM2A 2IRXA 4BWMA 3Q24A 3NBPB 1PGZA 2HNYA 2VC0A 3U1NA 1UWBB 2UU9F 4ED8A 2ZBCA 4MYTA 4JOUA 1UWAA 5M2RA 3H8YA 4NZ0A 5HAOA 1YJTA 1J5EF 3K2YA 1WWHA 2X3GA 2MKKA 1HWJA 4O3QA 1TL1A 2AW0A 3EDRB 1GX5A 1TMJA 4DR3F 1P1LA 1WG1A 3TEGA 3D68A 8RUCA 2L41A 3GJQB 2GIFA 4FXVA 3NBPA 3HPOA 3WIVA 2FJWA 2CFXA 1RACB 1UWBA 1U49A 1FRXA 5CAAA 3GYNA 4V1Ak 4OX7A 2D74B 2XBPA 2ASJA 3M8PB 1C0TA 2OFHX 4IR9A 3BDEA 5K14B 3UQSA 1FWLA 3ZTSA 4W90B 4OYWA 2NXUA 4CH1A 5H9FJ 5L1KA 2L08A 3EWGA 2JSXA 2QFJA 3BR9A 2EEYA 1UP1A 4RW7B 4N5SA 4O3SA 2V2VA 2RDDA 5KOXA 2C3PA 4C9DA 2P8IA 4IH6A 3MWBA 5K14A 3KLEB 1WG5A 2Y8WA 2XY5A 1NJZA 4X65F 2E5HA 3DYAA 1XERA 3A3NB 2IJRA 1YHQS 3HHKA 4RW7A 3AHPA 3I82A 1O0PA 4R25A 5KFRA 1RYRA 3I6PA 3N6LA 2C2DA 1A6LA 3R8YA 3KLEA 1SL0A 4O0IA 4YDDB 3SSQA 4LMZA 5KT4A 4DZDA 1R0BG 3CJTA 2ZVIA 4M5DB 3NP5A 5L1JA 3M2VB 3ZZ0A 3D1QA 1IKXA 4TU7A 2F8EX 2HBYB 2RHQB 4X64F 3BEGB 2OGUA 3NLCA 4K4SA 4DV2F 1KWMA 3DLKB 4L3KA 4USUA 3OTEA 4QYZJ 5KG3A 2IMWP 4OZJA 4M5DA 4IFYB 1YTYA 4CZCA 1XMQF 4ZPAA 3T1YJ 1JNRB 1RAOA 4V19J 2YPYA 4U8VA 1NK9A 1TKTA 4QIGA 3H2UB 1P1TA 5A6WA 4KGVB 4Q8FA 1N32J 4DSJA 4ED6A 2PGCA 1HBOA 3T6JA 3G8TA 4Y2CA 4IFYA 2M8HA 1GQEA 4J9LA 1RAJA 1CLFA 4AYBD 5KG5A 2DPJA 2FVQA 1N4LA 3IN5A 1JK9B 1SIZA 2DNOA 3DRPB 4DUZJ 1HNXF 2W8LA 3AA8A 4P73A 4DX5A 3TR5A 4DJBA 2RB7A 4GRSA 1SC3B 1IKWA 4QWDA 2ZEJA 3QT8A 9ATCB 5F9NA 4WIQA 4DSFA 4U67Q 4DSEA 5HMXA 3AH6A 3DRPA 2Z4PA 4DV5J 1JLQB 3KHHA 3KYLA 3DHXA 2MQLA 4I1TA 4A8FA 3P4UB 3PYGA 5GAGU 4C97A 2YKPA 3F41A 3J81U 2AJ4A 2DB1A 1RTHB 3CCVS 4EYIB 4ZPTR 2QLJB 4NYOA 2NSBA 3EVMA 2UUBJ 4OI0A 3NGDA 5HROB 4J7CA 2BKOA 4EMDA 1LKZA 5T14A 3N6MA 3NL0A 2I8EA 2QSWA 2IC3B 3ZNUA 1HQ2A 4OJGA 4USJC 2Y1IA 4KHRA 4UUXA 2Y0SD 4K2XA 1UVKA 5J2NB 5GADU 2JLGA 4I7FB 5KFQA 3EMTA 4AQYF 3KUGA 3H90A 2WK4A 3L95X 3KJFB 1L3SA 4IRKA 1CC8A 2WB4A 4W4MA 2B43A 4MK8A 4H4OB 3K58A 5J2NA 1XNRJ 1ZM3A 2GA7A 4F67A 1TR0A 4XK8C 1RAHB 3TQEA 2YH1A 1T9YA 2QTWA 4E8UA 2DR6A 4K4XA 1LWEB 2Q79A 2RU9A 1WEZA 3DRRB 1RWOB 3K5NA 4IOBA 4DFPA 1Q4RA 4MT1A 1PKUA 4RBUA 4H4OA 2HGLA 3GP9A 4QYRA 4RNNA 4FYXB 3N9UC 3LWMA 4ECZA 4AL7A 3HZGA 2X3DA 3M8SA 4ZLJA 4UOFA 2BDPA 3D7SB 5A6PA 2V2QA 3US5A 2GIRA 2HZVA 1N34J 1V5IB 3DRRA 5KFEA 4YR0A 2W7OA 2OPQB 3MEGA 3DLLQ 3CCZA 2ZHBA 4DU8A 1JLBB 4FPRA 3OTOJ 4FS1A 2CNKB 2DEJA 4C7QA 1DJ0A 1HIYA 2QFIA 4CLFA 1UKUA 3RUBL 1KOHA 2LA4A 2EPIA 5KFPA 2R2UA 3CT9A 2DNZA 2QL5B 3QFHA 1X7VA 5A8RA 2IRUA 5D6GA 1WJ9A 4WFNQ 4DL5A 4LREA 1LV5A 3VR1A 1NJXA 3OD2A 4MKBA 1RCXB 1SXLA 1MN9A 4HACA 4LIRA 3DNCA 1FRMA 4LBPA 3IAM9 1J2VA 3ENAA 2GS8A 3NGSA 4DV0F 3B6BA 4CO2A 2MSSA 3CC4S 5D78A 1W2BR 4TYAA 1X5TA 1RLCL 4NLSA 1C1CB 5ETQA 3TQ1A 1ZOTA 4AFFA 3VAMA 1JJ4A 1KVJA 4TN2A 1KTVA 3H40A 4FDFA 2XY7A 1WC0A 3FUYA 4JV1A 1TZ0A 1SVDA 3UVJB 3ZFVA 3IA0A 3PR4A 2YNHB 2MKHA 4DSKA 3MPUB 2UXCJ 2PSZA 4QIVA 2VU5A 1SJ1A 4Q2MA 1C1CA 3BGRA 5IC6B 3D28A 2UVRA 3D3CJ 9RUBA 3H0PA 3N0VA 2KI2A 4RJVA 2JJ4D 5HO4A 6AT1B 4ZN1A 4CT8A 3MZIA 1FCAA 3CJRA 3HHLC 1H74A 2DY9A 1C0UB 3ZXWA 4U9RA 1QY7A 3BQ0A 3K8VA 1NU4A 3M8RA 2IRYA 2J0QD 4LIWA 1A0OB 2DO4A 2EFNA 4FF4A 2UXBJ 3MM5B 4I6AA 2M9KA 1WI8A 1MLAA 4WP9A 4J9PA 2GQQA 5B0CA 1H2TZ 2HKEA 4PXEA 2KG0A 1BQNB 4ZVRB 2HIQA 3SFGA 4KB7A 2E1PA 5KFXA 1C0UA 3R27A 4ZHRB 2R8GA 2MEWA 4FVMA 1K1QA 4NA1A 2QE5A 1VQ4S 1NSPA 4OMFG 2WOMB 3C16B 2FHJD 3M9OB 1SJFA 5DLGA 2L9WA 1VBZA 2ZD1A 1DZ5A 1PBUA 4LBHA 3MEDA 1BQNA 1YRUA 1GEHA 2JC1A 5HVHA 4ZHRA 3GIIA 3IR5B 2YQ3A 4NL5A 3VV2B 1K0TA 2WOMA 1S6PB 1WOPA 2CVEA 1S0OA 4KPYA 1FEHA 4KC5A 1RUSA 4WJBA 2MQNA 5KG4A 2PA3A 4ZP7A 2J9CA 3Q8YA 3SV4A 1PJ6A 3JSBA 1R8PA 3N5FA 4ZVQB 3IGNA 2MJNA 3LP2B 1S6PA 1M1HA 4PUOB 4M5NA 1KDNA 2VPXB 4K7QA 4TVAB 4KV8B 1ZBTA 1YJRA 5KFBA 4YFUA 2GHVC 2YKMB 1EQMA 2J9EA 3CMES 1R0CB 3T6BA 1GH8A 4DL3A 2VBZA 1NZ8A 3AODA 1JMTA 2GGPB 5CYJA 2M4MA 2W4DA 1I6JA 1HR0J 3LP2A 1ZH5A 4CNZA 4N77A 3EPIA 3ETMA 1JXEA 3FBBA 1PIEA 4KV8A 3OTDA 5CYQB 2BR0A 5F3TA 4ZVSB 1IR0A 1SH2A 3LUYA 2FHOB 4EBEA 2QMUB 2HQDA 2U1AA 4J9SA 5DRKA 3TUJC 4YN3B 1FHTA 1XQIA 1ZETA 4PXBA 2UVUA 4B9SA 2GGPA 3CIMA 2X7IA 1JLGB 5F8NA 4X62J 2HGNA 3QLHB 2ZM6J 3MHYA 1TV6B 4QU7A 3MTJA 5ETOA 4NWBA 3T1YF 3TUZC 1RYSA 3BH7B 1LEOA 4K50A 1NBEB 2JVRA 2HRTA 1R31A 2K7JA 2J8AA 1N32F 3QLHA 2VD3A 4J9OA 4FYDA 3Q8SB 1RAIB 3HP6A 4DQQA 3QGPA 4NLXA 3BS9A 2LYVA 1F9EB 1KSPA 1Q0NA 2W9BB 3S7RA 2DGOA 3CPWR 1D1UA 4WCEQ 2F5GA 3B4MA 2FY1A 2G9OA 1EQ0A 2HQIA 5CH7B 3DM2B 4LFBJ 3TVZA 2LKZA 4ED4A 4DDFA 4F50A 4DUZF 2MZJA 3C66A 1BQMA 2MGZB 3OFFA 4F02A 2MHNA 4ZVGA 5HI7A 3HFKA 2V67A 2ZKUA 4MTPA 2W9BA 1D3WA 2LDIA 4R5PB 3DM2A 1TK8A 1V5VA 3TA0A 1VOMA 3CDEA 7FDRA 3G6XA 4EK2A 4DV5F 2AJ1A 3OR1A 2RQMA 5HJXA 3PX4A 2BMBA 3MMJA 1NSKL 2AGOA 4OLOA 3ICLA 4QOTA 1QUVA 4DPTA 4QW8A 4RUCA 2IIHA 3SIPB 3TX8A 2UUBF 5KFCA 3BBCA 1HFEL 3I4HX 1VR6A 1C1BB 3I0SB 3KKFA 4X4QA 1EETB 2ZC3A 1T03B 4ED7A 5BR8J 1WF1A 1H73A 3NNCA 4F0KA 4PWDB 3B4DA 4RPFA 3IS9A 1JJCB 4DR1J 5L1LA 1YQHA 4DHVA 2G2OA 2YNFA 4O23A 4LUBA 3GILA 2RT3A 2DNGA 3I0SA 5KG1A 3G2XA 2MLXA 4J9RA 4YR3A 4ETZA 1T03A 1APSA 2HVEA 3DDKA 2G0CA 4DPUA 1QJHA 4PWDA 3M6XA 2ZBRA 2B7BB 5F8LA 2WZ1A 4L74A 2GAHC 1RTJB 5D77A 3D6HB 2EFOA 1B0TA 4QPTA 1XNRF 1U26A 1S99A 4ZVUB 2L3MA 3IWNC 1F1BB 3OVSA 2A1BA 4USHA 1WC3A 5B0EA 2VOPA 2ZH1A 1NXIA 2Z2MA 3TX0A 4KHPF 2CUYA 1JNZB 5H9EK 1RTJA 3CDBA 2P9EA 5DG7A 4JBCA 1T05B 4LT6A 3W65A 1WHVA 1ACMB 4X4OA 2V69A 3ILLA 2LMIA 5FJ4A 2RUSA 2VA3A 4ZPCA 2B9YA 2KXNB 1DARA 1N34F 4OJ3A 2V34A 1X0FA 1NDKA 1UAWA 4CLUA 5L9NA 3DLHA 3DDIA 3K89A 1FXRA 3BGUA 3OTOF 1T05A 2GO9A 2JOQA 3N4WA 1TL3B 3AJ2A 5D0RA 4Y2MA 1PYOB 3T9NA 3HKWA 2V8HA 3MD1A 5MAOA 3A3PB 2JDJA 3VVUA 1O5JA 4B3MJ 5E2QA 1AA1B 1SB6A 4OZNA 5IT9Y 2AV5A 5RUBA 3JB9k 1GT8A 3H42A 4FF2A 3AOCA 4LR7A 4NLDA 1DAXA 1T3OA 2RQCA 2AYMA 1GMVA 2AF6A 2CJXB 2ATLA 3KG0A 1JQGA 3W1YC 5IT4A 4P2SA 1L3KA 4WFZA 3PG9A 1S1VB 2MQ8A 3IG1A 3T9ZA 4C8KA 3ULHA 3P3DA 3RRKA 3BPSP 4IFVB 1C4AA 4DU7A 2MQOA 3G82A 2G13A 2J6UA 3HT0A 4O4GB 4CO3A 1TP7A 2HMIB 3KLIB 4TY8B 1RB0A 2PIIA 2UXCF 3P5BP 1KVKA 2KTQA 2NYIA 1S1VA 3R1HA 3UDVA 2NREA 1U0HB 3TJAA 2JEJA 2QL7B 1S4FA 2EFQA 1RT5B 4ECXA 3CCMS 1R8HA 4IFVA 2FZGB 3MR2A 1MN7A 4O4GA 2AEMA 2HMIA 3KLIA 4TY8A 1VRUB 3OHBA 1XJWB 2HNZB 5AXKA 1LOUA 2AZ3A 1YJ9S 3GU0A 4CYUA 2AGPA 4N47A 4IUFA 4OI4A 1SQEA 1RAFB 1U0HA 2XZWA 1RT5A 2UXBF 3L7OA 5C24B 2VODA 3SCKE 4FBUA 1FRJA 2ZDPA 2HNDA 4RBTA 2RS8A 1M5SA 3CB4A 3QFWA 3HZEA 5KT3A 3DRSB 3BN7A 3RAMA 1VRUA 1KBRA 5F8GA 1R27B 3BO4A 3UCUP 4KRWA 4J37A 2CPIA 1VRTB 2F1FA 3ADAC 5E41A 5C24A 1NK7A 4KPCA 3BO3A 4K59A 2IA6A 2HGMA 4MK9A 4O0NA 4PXCA 4ECVA 2V8GA 3EX7B 1RADB 2Y1RI 3W3SA 1C4CA 3MAQA 1F5AA 1VRTA 3G4SS 2V4QA 2EK1A 4A46A 4ZS6A 1CEZA 5GAEI 1IM4A 3IGVA 3JS9A 2VG5B 3E51A 2KT2A 2V9KA 3D3BJ 1HPZB 1ZZNA 2W2OP 2LQ5A 3F56A 3KDNA 3C6TB 4F7VA 2B4UA 1H2VZ 4JI0J 2YY3A 1AUDA 1YBTA 1DURA 3BSNA 1U2RA 4DCPB 3RW6A 1RABB 2HSEB 1HBNB 1R43A 3EVOA 2EVZA 2D69A 1WKLA 2BKNA 2FJAB 1HPZA 3C6TA 1PCAA 4Y00A 4PEOA 3MOJB 1O51A 2GHWA 2VFUA 1JJHA 1R89A 4K2JA 3D67A 3BQ2A 5HBMB 2OPSB 4DPYA 3TWZA 1HR0F 1X4GA 4EWTA 3QT6A 4CNYA 1HBNA 2M88A 2C2KB 4LRFA 4B3OB 3ENVA 4YS2A 2DVIA 4FXWA 2I6WA 4FBTA 2MY8A 2NSCA 1H3DA 3HMJG 3WZ0A 4JI6J 1Q1KA 2I9SA 4FYYB 1YJ7A 2ADBA 1VQ8S 1UJ4A 3JAMU 1Q5VA 1B7FA 1T95A 3QWUA 2XMKA 1EX8A 1RTDA 1CJVB 5DM6Q 5HBMA 2UP1A 1AFIA 3MEKA 5CHCB 3DC2A 3MEEB 2ZM6F 2DR5A 1HYSB 3KMQA 3NEKA 1Q86T 2VFSA 4TY9A 3GV5B 2FVCA 5IC4B 3UCZP 3I9V9 4LFCJ 3K59A 3CJ3A 3OHAA 5BJRA 4YB6A 1TKDA 2GNKA 1KQKA 2ALZA 1N54B 1N5SA 1CJVA 5DM7Q 3PRDA 1B3TA 1Q79A 3MEEA 1HYSA 5AT1B 3GYXB 2XZTB 1IXKA 3AB4B 1DBDA 3PTWA 2HG4A 2CG8A 3NS5A 1H7WA 1U6ZA 3SSSA 2QYCA 1AZSB 4FS2A 4DPXA 1YSJA 2VDIA 4FYWB 4LFBF 2MKCA 2JEIA 3Q83A 4KY3A 4I2PA 2VDHA 3R7SB 3GYGA 4NLOA 5G4DA 2QZ8A 3PEJA 3EJMA 2ALYB 5LMNJ 5LL6d 4G1IA 4LF5J 2XWYA 3PZPA 3CMQA 4PG6A 5D0EA 2GJ2A 5KFFA 3PIOQ 4OZLA 3BBFA 4DV7J 2DGVA 2XMVA 4FKYA 5F8IA 4BWJA 4GKJF 1YJVA 4ZPWR 2KT5A 1RWMB 2LQJA 3ISNC 4IOAQ 3I32A 3FCHA 2VJVA 4A8XA 4I2QB 4Q45A 4KBIA 4A8KA 2HVDA 3RTVA 4ED2A 1Q78A 3KNAA 2QMWA 4L72B 2ZJQQ 1Z4UA 1FJGJ 3HSDA 3E01B 2ZBIA 4KT0C 2J76E 2BBEA 4I2QA 4X4TA 5B0FA 1NKBA 1U1MA 5BR8F 5JXSA 5KFKA 4EUVA 2UUAJ 3G6YA 2W2NP 4ID8A 4OYAA 3HHDA 1P8GA 4DR1F 3MR6A 3QGGA 3E01A 3RBDA 1RP5A 2LEBA 3NCQA 2CAJA 4NZ7A 1Z2ZA 4X66J 1VBXA 3Q2SC 2VPZB 3QJPA 2G4BA 2QMXA 3TUIC 5DETA 5LMUF 4ZIVA 3QRQA 3NGRA 3KTQA 2CQCA 4DL4A 4ATNA 2WSFC 1IJEB 2Z57B 5CQGA 2DGWA 3HF5A 1GXLA 2COLA 3C3LA 3KWMA 4DFJA 1SJ3P 2Q6BA 4G1QB 4OZ2A 2KG1A 4DL2A 3K7RA 3HSJA 2JC0A 1Q8BA 6FD1A 1DTQA 3N28A 2Z2LA 3IWLA 5DJBA 3WX4A 4K8RA 2VL1A 3D2WA 3TAPA 2UUTA 5LJ5Y 1VC0A 1NHKL 4G1QA 5A2QU 2E1MC 5DQGA 3HLUA 4CH0S 3IWXA 4F4AA 5F8HA 2P6TA 3MM6B 4ECYA 2P9CA 3FCWA 2A3JA 2FZKB 4F26A 4NPOA 1M1GA 3T5LA 4L75A 1NK8A 4JV0A 2YBVA 4PG7A 3PX6A 3PJXA 2R9LA 3W2WA 3MMBB 1BY9A 3LA0A 1UVIA 2QLXA 1S1TA 3MCOA 4B3MF 5F0WA 5CD4H 3MM6A 1FFWB 2O3DA 5HP1B 2RDIA 4JI3J 2CQDA 3UO0A 3LGHA 4I68A 1S76D 1IQTA 4C8NA 3R5JB 1T0TV 2MZSA 1NUEA 1S0VA 2RAQA 4I67A 1FNMA 3JTOA 4M5KA 2GMHA 2HIYA 5HP1A 1URRA 4DQPA 4GKKJ 2J9DA 3W2VB 3DFEA 1F2GA 4RWWA 2G1DA 5KFOA 4RW4B 3HVAA 1ZM9A 4DV6J 5L39A 1FDDA 4QWEA 3CULA 2ZC4A 3PM9A 4WK1A 1KS2A 1IKYB 1VK8A 3KG4A 1IM6A 4CTAB 1WC4A 3T1AA 3W2VA 1NB2A 2NZCA 2W9CA 4NASA 2KT3A 4Q5VA 2KRRA 3SDEB 3SZ2A 1N48A 3GONA 2DR9A 3I5CA 3K5LA 3Q0AA 4AD6A 2LXFA 5KT7A 1NAQA 1HI8A 3GZ7A 1ULRA 1N0UA 1CBKA 3R7NB 2C3MA 2IJNA 3G8QA 1TK5A 4GO5X 3MMCB 3M6WA 3L09A 2V6AA 3SSRA 2HWTA 3HD1A 4LRAA 3IBCB 2RIJA 3HVWA 1ZYQA 1MMDA 1X31C 4GC6A 3BGOP 2D41A 5HMWA 3DI6A 3IRXA 4PWUA 4TU8A 1ZZFA 3DU6A 1FRLA 2ATCB 4CLWA 1LQ9A 2HW3A 3D1HA 1F9FA 3DOMB 3MMAB 3CIZA 4HHHA 1WSVA 1X0PA 2W25A 2EFPA 3OTCA 4B3RJ 1B0VA 4DG1B 3V6DB 1S12A 1Q7YT 2F63A 3GMGA 1UFKA 3PJWA 4OHWA 1JLFA 4KAIA 5IQQA 4A47A 5DDRC 3DOMA 3MMAA 1CG2A 1F5BA 2WAQD 1MWZA 3V6DA 1RA7A 4LBIA 3GV7B 1HKAA 1GNKA 4JI0F 3NGTA 4U95A 1BGXT 3MECB 4U8YA 2K06A 5KFVA 1AYEA 3I56S 2K3KA 5HMYA 2R2RA 4JV2A 2ILYA 2BJ8A 4PKDB 3SCIE 5SZTA 3D1OA 1SJRA 1HW9A 2RHSB 3B82A 3ZZUA 1ZAXA 4J91A 3EGWB 1S6OA 4WFBQ 3UD3P 1L3VA 8AT1B 4OHVA 1TVRB 2NXJA 3LOUA 3WC0A 3OTBA 1XR6A 3KMSA 1WORA 3OVBA 4NMLA 2HZCA 3FZ2A 4DR4J 2KU7A 2HK3A 2HAIA 3EDQB 3CVKA 1BD6A 3PYDA 4LVOP 4PG4A 2VZ9A 3VAGA 1BUXA 1NSAA 2CPFA 2LCWA 3CO9A 2G0IA 4RNHA 4JI6F 1PAUB 1TVRA 5KFDA 4NRUA 3RB6A 2W4PA 2AX0A 5DGAA 4ZA1A 2ZKTA 2DXFA 1VHFA 3M4XA 4NI2B 2IM3A 1FKOB 2JLFA 3PR5B 2BYCA 4TU9A 2K1RB 2RH3A 5EX3A 1G1XA 2CA9A 3R7BB 4UW2A 4LFCF 2CYYA 3C15A 4Q8EA 4WF9Q 2ZOFA 4LF2A 5AJ3J 3HT3A 2UUWA 4NI2A 1VDHA 2X1BA 1URNA 1JIHA 2K1RA 4DQSA 2DGQA 2F4VJ 5C5JA 4IDKB 4P7TA 3VGTA 3A8IA 4R0JA 3QO9B 5B0DA 3M8QB 3Q8UA 4YDXA 3FRZA 1ZA2B 2AHOB 3RR8A 1TUGB 2DGSA 3VAKA 4MKVA 4ZJQA 1X4EA 4TKTA 1H98A 1SJQA 2KB2A 3UD4P 3KHGA 2RQ4A 3FVYA 3PKYA 2CQ3A 1P9YA 5LMNF 1PAEX 3MF5A 3QO9A 1JB0C 3IM9A 3A1YG 2IVFB 2DHSA 1FE4A 1BQXA 1FXDA 4DV7F 3K57A 5ADZA 4H4MA 1SV5B 2CRLA 4KQZA 2OPRA 1ZM2A 5KFZA 1YVFA 2WVDA 3ZZRA 3MD3A 3AB2B 1GTHA 5KFWA 2IAJB 4N56A 4EI2A 4YOEA 4WWSA 1RT4B 3IAS9 5A8WB 3MPVA 4A8MP 3V4MA 3BV8A 5C2CA 1CPZA 1VC5A 1NDLA 1FJGF 1SV5A 2PEHA 4DZ6A 3EXCX 3RAXA 1GAOA 3FEZA 2CPDA 1RHKB 2E5LF 2HFOA 1U02A 3MM9B 4QIEA 5A0YA 1FXLA 4CLZA 3GG0A 1YITS 2MKIA 4OJ1A 2ZOMA 3JYTB 4M5JA 5A8WA 3OJUA 4KJIA 4MKAA 4OX6A 5KFJA 3M8YA 5B08A 2DGXA 2DCLA 1S6UA 2POKA 4NLTA 2A2CA 3IM8A 3IR6B 4X66F 2R42A 3ETOA 2H5EA 2C28A 3CUNA 3ZZYA 3J80U 4UOCA 1U8WA 3U27A 3KLFB 5DS7A 4QWAA 5EUHA 5BXIA 3GSIA 5E3RA 4RW9A 2EG2A 4L73A 3H5YA 2GVZA 3GJRB 3W5ZA 1N33J 3BZQA 2YNIB 2QT7A 3N6NA 1Y3KA 1H38A 1VLOA 5E3QA 1SKSA 6FDRA 5H9EJ 1DQ8A 5L1IA 4JI1J 4IH5A 1P6TA 4BHQA 2W7AA 1N36J 5EDWA 4DUYJ 5ETKA 3LW5C 3T3FA 2J7WA 2L48A 1S72S 2YNIA 2RUGA 4LSZB 1JX4A 3AAWB 2HURA 3J7Z5 5CCLA 5T7LA 2NUHA 3Q23A 2H9ZA 2BRLA 3QGIA 2NUUG 4WKRA 3D0GE 2E9TA 5DG9A 4O3PA 2R4FA 3MURP 4WE1B 2AQ4A 2E1AA 1NDPA 2YXLA 2XZDB 3OXLA 1OJ4A 4JI3F 3BJYA 1HD1A 3ITHB 2AZ1A 2CJQA 4HL9A 3FCVA 4ZN3A 1N5YA 5IZHA 1PG5B 2WBRA 3MAAA 4GMKA 1E6VB 5A76A 1GMWA 2BA9A 2A2DA 1QSLA 2AJ0A 4UTGA 4WE1A 4WKYA 3NMAA 1J5OB 1L3UA 1TFYA 1SJ4P 2QA4G 3K8WA 1X4DA 4GKKF 5AXNA 2HHTA 5GAEU 1U09A 2AU0A 2W9AA 3BM7A 2MQQA 2CJAA 3NXZA 4UF4A 4N76A 4DV6F 4JV5J 2CVIA 4ECTA 5C42B 1DY3A 4PPZA 3TYTA 2BM1A 2CNOB 4RUAA 2DGUA 1S6QB 1VQMS 5DGBA 3DOLA 1QTMA 4HEA9 5I3QA 5L8RC 7AT1B 5HVFA 4JB8B 3OLBA 4B9UA 2JH3A 5C42A 2V68A 2Z8QA 4I6YA 1S6QA 3Q2TC 1Y5NB 1WNEA 4KKOA 1NPPA 1Y00A 4DN9A 3H5SA 1NK0A 4TLRA 4IQMA 4M63A 3LPEA 2WBMA 1RU1A 4NA3A 3PW5A 3DHWC 3PJ9A 1BWVA 1H6KX 3G8SA 3GG1A 5DDOC 4DLGA 2QLFB 3OXFA 5IOLA 2MLYA 2KFYA 2O66A 2OELA 2R7WA 2ZHAA 2CQHA 2XMAA 4NLVA 1SUQB 4I6WA 3DLEA 4B3RF 2DBBA 2DCUB 2RQKA 3Q8RB 1B7YB 1Q8KA 3D0IE 3HHEA 4OLPA 1OIAA 4ZITA 1Y0HA 2OEMA 2YVSA 1UEKA 3DCAA 5J2PB 5IWAJ 3G96A 3HVRA 2LEAA 3PV8A 1SUQA 2N7CA 2NXNA 3VZIA 2FLNA 2KFZA 4WFXA 4HT7A 4UQGA 2V8DA 4NXMJ 3HHLA 1LWCB 3NG8A 3T5JA 2PI4A 4PYDA 5DQHA 4DS4A 1PC4A 3TVKA 2M2BA 2ZJRQ 4TNOA 1KONA 4NLPA 2J7UA 1FDAA 3T5KA 2OD6A 4Y28C 3AD9C 3H7HB 1FK9B 4IG3B 3J7A1 3D6MB 4DR4F 5I4MA 5ETNA 1D9AA 2MQPA 5K20B 5HMZA 2B51A 4HKQA 3TVYA 4MIAA 3LH2S 5I42B 2HNYB 4KH0B 4OHXA 1Q53A 2DRAA 1RGVA 4OHYA 2HRUA 3HX9A 1TL7B 1JXVA 2VB6A 2FGCA 1TL1B 2BV3A 4M5HA 1YGYA 1FK9A 1RAEB 3WC2A 2YQ0A 4QWCA 2CDRB 4AUKA 2V5HG 1N6QB 2AYEA 4QIFA 2C2NA 2FD2A 2G1HA 1Q82T 3EICA 2MKJA 5I42A 4HH1A 3THPA 4Q2LA 4DR6J 2VASA 4CO0A 3Q22A 1W25A 1NRKA 2B4PA 1TL7A 3IC1A 1NMEB 3V6HA 2AP6A 1C0TB 1YIJS 5AJ3F 4URGA 2PC6A 1IR2A 3X1LB 1N6QA 3RAQA 2F4VF 4CLLA 5J2MA 4C8ZA 2R7QA 1T94A 2XGQA 1O8BA 2KYZA 5K5MA 4C0HA 5KFHA 1MMNA 2LEPA 4FPIA 2AYGA 4GVBA 2HWIA 5LM7E 4FNHA 5DDPC 2VF3A 3CMAS 4HR2A 3DLBA 3KK1A 5J2QA 1VHIA 4ANEA 3S1TA 2KJVA 3DYAB 3R3TA 5BYRA 2KHCA 4O3NA 4DPOA 5L38A 4H4KA 4LR9A 2X1FA 1FFGB 3QIPB 4KYZA 1RU2A 2APOA 2G2YA 2D7SA 2UXDF 4OFZA 3DKDA 4RNFA 5FLXY 4NCBA 2LLZA 1FX4A 2MZ1A 3S6EA
chains in the Genus database with same CATH topology
2IMOA 3KG1A 1S1TB 2B0GA 3ENQA 4Y2KA 2MQOA 1S9GB 2G13A 2I1RA 3MM5A 2Y1JA 2J6UA 1C2PA 1M5VC 4O4GB 4PR6A 2BQ3A 2OMOA 3PXGa 4CO3A 1TP7A 1U2FA 1HMVA 2HLTA 2RDJA 2HMIB 3KLIB 2IM2A 4TY8B 2V8VA 4QR1A 1REVB 1VFJA 3N01A 2PIIA 3JYTA 2UXCF 3LGNA 3DRYA 3THTA 2KTQA 1HI1A 2NYIA 2GMJA 3I55S 3CCRS 1IKXB 4B02A 1S1VA 1RWUA 3R1HA 3RW7A 4AL6A 1XWLA 2LU1A 1YRTA 3QIPA 3QGHA 3GIKA 1X4BA 3V6JA 3DXBA 2NREA 1S97A 1LW0B 2EKYA 2JEJA 2RVJA 1TAQA 1S4FA 2EFQA 1RT5B 2KJWA 4ECXA 2RKIB 3CCMS 1R8HA 3JSYA 3OBIA 3U7JA 4IFVA 2NZ4A 4L3NA 1ZPWX 4Y3CA 2Q6CA 3MR2A 3MXHP 1S9GA 3V4IB 3RR7A 3AQPA 3LGMA 4O4GA 4ES3A 1S1UB 4O4RA 4OV1A 3UWTA 5HL7Q 2IBKA 1KHVA 2O5DA 2HMIA 3KLIA 5B0GA 4TY8A 1VRUB 3OHBA 1VIXA 1REVA 2I2YA 3RB0A 4HVZA 2HRYA 4ZKAA 2HNZB 5AXKA 7FD1A 1LOUA 1YJ9S 1TQLA 3PDNA 3FSIA 3PW2A 4F4WA 5AXMA 2AGPA 1HNIB 4CQ1A 4N47A 4IUFA 4E0DA 4F3QA 5K8OA 1TKTB 2NQPA 1IUJA 4OI4A 3KLFA 2YWFA 1SQEA 4K4YA 1LW0A 2HS4A 2XZWA 4LVNP 1RT5A 3FGVA 3CXCR 2OTLS 2UXBF 2RKIA 3L7OA 5C24B 3OXGA 3TO8A 2FLLA 5EWEA 2BUNA 1HL6A 3O3LA 4BDPA 2VODA 3SCKE 4FBUA 1KFDA 1FRJA 2ZDPA 2HNDA 4RBTA 2RS8A 3P6YC 1H0HB 1M5SA 3CB4A 5THWA 1HBOB 3HZEA 5KT3A 1S1UA 1FNXH 1OSDA 2KN4A 3DRSB 1MMLA 3BN7A 4I69A 3CDUA 3RAMA 1N5VA 1VRUA 1IQZA 2E7XA 4DX8H 5F8GA 2DNRA 1R27B 2MHEA 3MTKA 2YX7A 1S1WB 4O44B 3BO4A 3UCUP 2E29A 4Q0BB 1VK3A 4KRWA 2W9CB 2IM0A 2O67A 4J37A 2CPIA 3ISND 1U1QA 1U1PA 1T8EA 3PRBA 4C98A 5IT0A 1VRTB 1KVIA 3PNIA 2F1FA 3NRBA 4WZMA 1TL5A 2EG1A 4ZVFA 2J6SA 4K4ZA 4MAKA 1YJUA 5E41A 5C24A 1NK7A 1T3NA 1VLYA 2Q43A 4FVCA 1FO1A 3BO3A 2DD8S 3DOKB 4K59A 2IA6A 3TP2A 2PI5A 2HGMA 3M2RB 3FQLA 4OI3A 3SCLE 4MK9A 2VPYB 2YKNB 4H4KC 5B7WA 3PW7A 4QWBA 3GFHA 1QVFR 2F8HA 3TOQA 2MZTA 1HHSA 4B08A 4PXCA 2ROEA 4DV3F 4ECVA 4PUOA 2V8GA 1KEKA 3PY8A 3EX7B 2Y1RI 3AY0A 4EO8A 1NNDA 2XNQA 4ILMA 2RD5C 1RT6B 4Y0FA 1S1WA 4O44A 4Q0BA 2DNPA 2YKMA 4CT9A 3W3SA 1AROP 1C4CA 3MAQA 3N79A 2HPUA 3G9CA 1F5AA 1VRTA 3M6VA 1M90T 1IKWB 4MIBA 5KAKA 3G4SS 3WDOA 2V4QA 1VQYA 3H5XA 2BE2B 2EK1A 4A46A 1MROB 4ZPDA 1Y3JA 3EPGA 5GVQA 3CCJS 4ZS6A 1DHMA 5J1PA 3DOKA 2M8DB 2O01C 3CWJA 1IM4A 5GAEI 3IGVA 1CEZA 1BLUA 3M2RA 2VG5B 1R8AA 3E51A 2KT2A 2J7KA 1RQ0A 2JX2A 5BYSA 2V9KA 2YKNA 2FHJA 4I56A 2EC0A 1BWEA 1HPZB 2XCPA 1ZZNA 4EZ9A 2LQ5A 4I0WA 3F56A 2MZRA 1K8AT 3DI6B 4Z2XA 3C6TB 2ZJPQ 1KC8T 3IRXB 2BQRA 2B4UA 5D4LA 5D8HB 5CYQA 1RT6A 4EFAC 3OL8A 1H2VZ 1WEYA 2WONB 2VA2A 2XY6A 1JLCB 1OPIA 4JI1F 2YY3A 3EGZA 4NYZA 3HO1A 1AUDA 2VG6A 3GE9A 1DURA 4EBDA 4LSNA 3BSNA 1U2RA 1X4CA 5FD1A 5CYMA 1N36F 2PA8D 2VBWA 4DUYF 3RW6A 2QA4S 3ITHA 4AE5A 2BE2A 2FJEB 4C11B 2AJFE 3MR3A 2D9PA 1MROA 4X4SA 3OUYA 3KK2B 1Y5LB 3LWLA 5K8PA 2DNLA 4K4UA 1HBNB 5HN0A 1JLGA 1R43A 2EVZA 4WU2A 2CPYA 3TNVA 4ALZA 3Q8QB 1SL1A 4O3RA 4LJMA 2B9XA 2D3OR 1E6VA 5L9XA 2FJAB 1HPZA 2VC1A 4IYQA 1K9MT 3NAIA 2JZ5A 3C6TA 3U02A 2ZNZA 3LQVA 1HI0P 1G7CB 4Y00A 1TV6A 2KRBA 1V3RA 3CD6S 1QAIA 4IH7A 1JLCA 4ZMMA 3FRYA 2XWXA 1J5OA 4NLGA 3MOJB 3VF0B 2HHPA 3ISZA 1O51A 1JLFB 2GHWA 4RU9A 2VFUA 1JJHA 1R89A 5D4NA 1QAJA 2BANA 4ZPVR 1X5PA 4YR2A 2B3TB 1QSSA 4ECSA 1FJ7A 2CPEA 2EWHA 3ONQA 3BQ2A 5HBMB 2E9ZA 2OPSB 3QMQA 2IA0A 4C11A 1VQ5S 1QVGR 4V19X 3UDLA 3KK2A 3PKMA 1HR0F 1X4GA 4EWTA 5DQIA 2WB1D 1HBNA 2M88A 3GFZA 4CNYA 2JLEA 5LXRA 4B3OB 4X4UA 3ENVA 5FDLB 1Q7LB 2I38A 2EFVA 5HQ8A 2DVIA 3HI9A 4FXWA 4FBTA 2MY8A 2NSCA 1H3DA 3H98A 2J5AA 3HMJG 2XSJB 1DRZA 1FA0A 2BZ2A 4KIAA 2KZZA 3WZ0A 1FKPB 2FHMA 2KDOA 2I0XA 1G2EA 1Q1KA 3U1MA 2C3YA 4RNOA 3E3XA 2I9SA 3GB0A 1UL3A 1NJWA 2ADBA 2QV6A 1VQ8S 1UJ4A 1R3NA 2XG8A 3O5TB 2ASDA 1WI6A 1B7FA 5CA5A 1T95A 3QWUA 3GWCA 4OZ1A 2XMKA 1X5SA 3VQSA 2DT9A 1A9NB 4XPEA 1NJIT 1RTDA 4OX9F 5DM6Q 3THVA 4C3KA 5HBMA 3CCLS 2UP1A 1CQNA 1R0AB 2NS1B 3CJ0A 4WK3A 1AFIA 4KHMA 3MEKA 3PW0A 4I64A 3BSOA 5CHCB 2GO8A 1KHWA 3DC2A 3MEEB 2ZM6F 2DR5A 1HYSB 3KMQA 3CC7S 2XSJA 1XR5A 2SXLA 1Q86T 2DHGA 2CIMA 2VFSA 1B0PA 1FKPA 2RILA 3HVTB 4TY9A 5EHHA 2VBYA 3GV5B 2ASYA 4WXWA 1NK6A 4F8RA 1Y7PA 2FVCA 3KLVA 2J6TA 3UCZP 5A2QY 1KQSR 1X5OA 4WFAQ 3I9V9 3QJJA 3K59A 5MLCV 2PMHA 2MGZA 3CJ3A 2CQBA 4MJKA 5BJRA 4YB6A 3OHAA 5I3PA 3J7ZT 2E5JA 4G3IA 3G86A 4LF8F 1TKDA 2GNKA 4KGMA 1KQKA 2ALZA 1N54B 5KFYA 1N5SA 2GCFA 3CJKB 2R2TA 5LSRA 3L7PA 2Q1LA 3H4DA 1WTBA 5DM7Q 4C4WA 3PRDA 1QE1B 2EK6A 1VQKS 4RW6B 1Q79A 3ZZPA 1ZM4A 1S77D 3G6ES 1U6FA 4JV5F 1SIWB 3UNGC 3MEEA 4XIUA 5KFAA 5JVHQ 1HYSA 4USIA 4R5PA 4E98A 3GYXB 1IXKA 3B78A 3AB4B 2EBGA 3HVTA 2DNMA 4NRTA 1DBDA 3KFWX 2ZHOA 2R7UA 4PXDA 2KXHA 1HBUB 2HG4A 4LF7F 3MUMP 2XI3A 1UVJA 3NS5A 1H7WA 1U6ZA 3CTRA 4HI2A 3SSSA 2B6AB 2DH7A 2QYCA 1GXUA 5IQ6A 4B9TA 2BJEA 4FS2A 1X9SA 3VCDA 1S1XB 1YSJA 3SEOA 3G71S 5IM0B 3CJKA 3KLHB 5E3CA 1QE1A 1NO8A 3QPIA 4LFBF 1XBWA 2MKCA 1VQSA 4OIXA 5GAHI 5AE1A 2JEIA 2D1CA 1I94F 4I2PA 3KNGA 3MEGB 5G4DA 1H2UX 4HDGA 1U7LA 4NLOA 4YB7A 3SYZA 4ELVA 1SH0A 2F9DA 2BJDA 2QZ8A 1HWIA 3PEJA 2XMMA 4OI6A 3IRWP 3SQGB 4YB1P 5LL6d 2B4OA 2XS7A 4UY85 2GIQA 1XMOF 2ZZMA 1FNOA 4G6VB 1SKWA 4G1IA 3K5MA 2LXIA 2B6AA 4A8SA 2ASLA 3PO5A 2XWYA 3FEYB 4PG6A 3PZPA 2UUCF 4OI1A 2GJ2A 2FJBB 2HQ3A 5KFFA 1S1XA 3V2UC 3TI0A 1N8RT 2V0NA 3PIOQ 1C1BA 4OZLA 1XK8A 1U6BA 2M7SA 1EETA 5IM0A 2LECA 3NCRA 3MI7X 1OO0B 4DV4F 2DGVA 3KLHA 2J9DE 2XMVA 3IR7B 3OFEA 1TUVA 2R8HA 2DJWA 5F8IA 4RNMA 4DSLA 5A8RB 2EBEA 5KTQA 2FHKA 4BWJA 4GKJF 1XEZA 1YJVA 4ZPWR 3EUNA 2KT5A 2B5JB 1IKVB 5J2PA 2LQJA 2CG4A 2ERRA 3ISNC 3E8OA 4IOAQ 3I32A 3H4BA 1QM9A 3FCHA 4QZVB 4RUHA 2UZAA 3SQGA 1FERA 4QR0A 5E3AA 2OAUA 1I1GA 1WF2A 2JL9A 4WYWA 4A8XA 1S7HA 4I2QB 5KT6A 4Q45A 4KBIA 2R8KA 4QCLA 1MU2B 4A8KA 4NLRA 3L3CA 3DLJA 3TA1A 5GMKa 1VQNS 4ECUA 2UV8G 3QZ8A 2OSRA 3RTVA 4ED2A 1LWCA 4DFKA 5E7OB 5B0AA 1Q78A 4MMOA 3KNAA 3EZ5A 2BACA 4QIWD 3OL6A 3RRGA 1VQPS 3UCGA 1YJWS 2YKAA 3LPYA 4EBCA 1NJYA 2QMWA 1DLOB 2GQ2A 4C8YA 2M5YA 4L72B 3TARA 1T7PA 4JI5F 4FF3A 3P5TL 5KFNA 4C8MA 1D9DA 2B5JA 1IKVA 3EGNA 2ZJQQ 1KRPA 1WHXA 4NX9A 1Z4UA 2P5VA 2DIUA 3E01B 2ZBIA 1Y4ZB 2FIUA 4QJVA 3UFCX 1NK4A 1P9QC 4M95A 4KT0C 2J76E 2BBEA 1S48A 2LQBA 1N52B 1SBRA 3IO1A 4KFBB 2BQUA 4I2QA 1DFDA 4X4TA 5B0FA 5KFMA 4MK7A 3UI3A 1MU2A 2L9DA 1ZAVA 4B3SF 1NKBA 2OH2A 1YRXA 2WSCC 3PVXA 1U1MA 5BR8F 1QLNA 5JXSA 1KLMB 3J7YU 4IG3A 1UVNA 3T19A 3BDPA 5KFKA 4EUVA 1R8CA 5EWGA 3M32B 3V5RA 1SH3A 5IWAF 2IRXA 3G6YA 4H4MB 4ID8A 1DLOA 1Y9OA 4BWMA 3K0JA 5IS2A 3QIDA 3Q24A 3HHDA 1P8GA 4DR1F 2OPRB 3MR6A 1GX6A 4DR5F 3NBPB 1PGZA 3BGRB 2HNYA 2VC0A 3QGGA 3U1NA 1UWBB 4IO9Q 2UU9F 4ED8A 2ZBCA 3E01A 4MYTA 4JOUA 4LF5F 5EWFA 5M2RA 3RBDA 3H8YA 4NZ0A 4NXMF 3LF0A 1RP5A 4KFBA 2VV5A 2LEBA 2WHOA 3BREA 1YJTA 1TFWA 1J5EF 3K2YA 3NCQA 1WWHA 4YB5A 1P27B 2CPXA 2X3GA 4NZ7A 1HWJA 2MKKA 1TKXB 1Z2ZA 2AX1A 4O3QA 1KLMA 1TL1A 2FC9A 5F3ZA 4RKUC 1VBXA 3Q2SC 2VPZB 2AW0A 3QJPA 2FVSA 2KM8B 1GX5A 4DR3F 1P1LA 2G4BA 1WELA 3BGFA 1B64A 3H2VE 1WG1A 2QMXA 3TUIC 1M5OC 3K5OA 2F7VA 5DETA 2ZVSA 2L41A 5LMUF 4ECRA 1G6BA 4C0OC 3J81Y 2XMTA 3KTQA 3EYZA 3IXQA 2CQCA 4FXVA 3NBPA 3HPOA 2FJWA 2JHEA 1TK0A 2CFXA 5D4PA 4DL4A 1UWBA 1U49A 1FRXA 2DR7A 4YY3F 5A0YB 1UA0A 4ATNA 3TRGA 2WSFC 1IJEB 3GYNA 4OX7A 1ROFA 2D74B 5CQGA 2DGWA 3HF5A 4X4NA 1GXLA 2MDAA 2DR8A 2XBPA 2COLA 4DEZA 4DL6A 4F25A 1TL3A 2ASJA 3C3LA 3M8PB 1TKXA 1C0TA 3KWMA 2ZH5A 4MH8A 4DFJA 2OFHX 1SJ3P 4IR9A 3BDEA 5K14B 3UQSA 3JAMY 3LP0B 2Q6BA 2J0WA 4G1QB 2KG1A 4ZP8A 4W90B 4DL2A 3B8HA 3FEXB 3K7RA 5FIIA 2JC0A 2NXUA 1Q8BA 4A4JA 4CH1A 6FD1A 2VBXA 5H9FJ 5L1KA 2X1GA 2L08A 3G6VA 2RF2B 2JSXA 1DTQA 2BW2A 2PI4A 2QFJA 3BR9A 4UY8T 4ED1A 3N28A 2LXUA 3TA2A 2FDNA 5KT5A 1S0NA 3VAJA 1UP1A 3RBEA 4RW7B 4N5SA 4O3SA 2Z2LA 3IWLA 1YWXA 5DJBA 3WX4A 3CEDA 5KOXA 2C3PA 2ZE2A 4C9DA 4IH6A 1UFLA 3MWBA 2VL1A 2ZD1B 4RBVA 2UUAF 3NNAA 2DNKA 3D2WA 3MEDB 3SFUA 2UUTA 5K14A 3TAPA 4ELTA 2EFGA 4ZLPA 1X4FA 3CDAA 3LP0A 5LJ5Y 1VC0A 1D9FA 1U1KA 3KLEB 1WG5A 4G1QA 4EGLA 2E1MC 5DQGA 3HLUA 1VQ9S 4CH0S 3IWXA 5F8HA 4ZDNA 4QU6A 2XY5A 2P6TA 4QQBA 3MM6B 1VQOS 4ECYA 2P9CA 4DR6F 1NJZA 5D4OA 4X65F 2A3JA 2E5HA 3DYAA 4F26A 1Y5IB 2QA1A 1XERA 3QWPA 4NPOA 1NK8A 3T5LA 3FJ2A 4RW9B 4DQIA 4JV0A 2GMLA 1U24A 5KFTA 2RF2A 4PG7A 3PX6A 1YHQS 3PJXA 2R9LA 3W2WA 3HHKA <