4JI6F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji6F00
3T1YF 1XNRF 1CQMA 1J5EF 4DV2F 4B3MF 1VMBA 4DR4F 5BR8F 4DV7F 4GKJF 1GH8A 1IBLF 4LF6F 1G7CB 4JI2F 4DV1F 2E5LF 4LF8F 4X62F 4B3TF 4LFAF 4LF7F 4AQYF 4YHHF 2UUAF 4X64F 1F60B 4DV5F 2HHHF 2VQFF 4LF9F 2UXBF 1IBKF 2UU9F 4DR5F 1HNZF 1IJEB 1IBMF 3OTOF 4KHPF 2BVZA 3T1HF 1LOUA 1RISA 4JI6F 1FJGF 1N33F 2RJZA 1N34F 4JI1F 2B7CB 4LF5F 4GKKF 1HR0F 4DUYF 1IJFB 4OX9F 2J5AA 4DR6F 2F4VF 5AJ3F 4JI3F 3R3TA 4DR2F 4JI4F 1HNXF 2ZM6F 1XMQF 4LFBF 4K0KF 1G1XA 4X66F 2YY3A 3ZZPA 1B64A 4JV5F 4B3SF 2KJVA 2VQEF 5LMUF 4JI0F 1QJHA 4DR3F 4NXMF 4DV0F 4DUZF 4X65F 4LFCF 2KJWA 4JI5F 1XNQF 4NXNF 2UUCF 4LF4F 2UXDF 1XMOF 1I94F 1N32F 4DR7F 1CQNA 1FKAF 4DV6F 4JI7F 5IWAF 4DR1F 1N36F 4JYAF 4DV4F 2UXCF 4B3RF 4JI8F 4YY3F 2B7BB 4DV3F 1HNWF 2UUBF 2BXJA 5LMNF
chains in the Genus database with same CATH superfamily
4ILLA 3BN4A 3M2RA 4CDIA 1BLUA 2GHWA 4CLTA 4ERDA 2CAJA 2KRBA 3W9JA 3M8PB 4OJ1A 2MLYA 4ZP9A 2BANA 2N7YA 4C11B 3M2UB 1WSVA 3T41A 3OXGA 2KXFA 4IDKA 4OYOA 2G0JA 2HGLA 2KM8C 4DR5F 1FRLA 3VVUA 1K1QA 3QIPA 3QGGA 2YH1A 1X4GA 1X4BA 1UFLA 2X3GA 1YK9A 4ZIVA 3V6HA 2IM1A 1R0CB 3ZXWA 3EVOA 1S1UA 4EFAC 4DR6F 2HZVA 4DG1B 4UOGA 2DNOA 3GV7B 2A2DA 2RVJA 2JSXA 4PYDA 3G96A 1R8HA 4F25A 4X65F 4C8NA 5C24B 4USWA 1ZPWX 4I6YA 4OQJA 3QRQA 2WHOA 5CHCB 4WFBQ 2HVIA 3TA2A 2M3DA 1OYDA 2J7UA 3VGTA 5A8RB 4I69A 3GIKA 5K8MA 3QZ8A 4HACB 4PXBA 1CJKB 3QWPA 4G1IA 5FDLA 3R1HA 2H54B 3V6KA 2ZC4A 3TARA 2PE8A 4OYBA 4CH0S 5F3TA 1NBEB 2JZ5A 4USUA 4CQ1A 5LOQA 2YNFB 2GIRA 5DJBA 3PEJA 4ECZA 1R6VA 3G87A 1KRPA 4M5HA 5GAGI 2B7CB 2PA8D 1S1TA 3W7BA 3NGSA 2E44A 3NCRA 1JLFA 3HZGA 5D4NA 2CUYA 2XY6A 1RWUA 3ZO7A 4PR6A 2I6WA 1VI7A 3TI0A 4NLRA 1S9EA 2HFOA 1LEOA 4LF9J 4ZCLA 1Y9OA 4XDDA 5E2QA 1PC5A 3T1HJ 2FLNA 4XDCA 3Q2SC 3LP0A 3PDNA 3TAQA 1HYSA 5ETVA 3TX8A 2XYPB 3BO3A 1JLBB 1AYEA 2LDYA 4ZMMA 4ZVQB 2DGOA 2CVEA 3W2VA 2CDQA 3TJ8A 1LW0A 4BBYA 4IQXA 1NNDA 3QZ7A 4PYAA 3CIMA 1KR4A 4C8OA 5F0UA 2PI5A 1K44A 4W98A 4LRAA 2D74B 2K2PA 3EMTA 1WF2A 5D8HB 2GMLA 5EX0A 1R0AA 4EBCA 2ZITA 4JBCA 3MAQA 1LOUA 1EJ7L 2DR7A 1M5OC 2J9DE 1RQ0A 3BH6B 4MKAA 3RR8A 5CD4H 2Z2YB 1A0OB 3RAXA 2NXCA 3US5A 2NXEA 2MZTA 1HBMA 2K1RB 2BJ3A 3U1MA 3GSIA 4JI5F 3H20A 4J7CA 2FZCB 1HLWA 4LF1A 1M5PC 1D09B 4O3PA 1N4LA 2MKYA 1RE1B 2DGTA 2PMHA 3U27A 2KB2A 3SFGA 4OIXA 3DN9A 2KL8A 1HBOB 4DL2A 1Y4ZB 3MPWA 3G6YA 3MM5A 1WUUA 2MQMA 4PEOA 3V4IB 3HHNB 2JFKA 1U6FA 4NE9C 3KHLA 1RWNB 2WOMA 4ZVGA 3E2EA 3D1QA 1PYTA 3GJSB 1S1VA 1B70B 4C3LA 3IFEA 3G82A 4KC5A 5DO2A 2CJQA 1RHUB 1KQKA 1M90T 5GMDA 1RHQB 1T05B 5CCLA 4ZVPB 3DOMB 1QSYA 3EDQB 4Q2LA 1PSDA 1R8AA 4ZPBA 2CQIA 3TA0A 1Q1KA 1P9QC 1C0TA 1PG5B 3K5NA 2R7TA 1SJQA 3BKFA 1NK0A 3OVAA 4XPEA 5I3PA 3LALA 6FDRA 4NXNF 1U4BA 1XMOF 2VONA 3SSSA 4JYAF 1X4EA 1YJUA 2VKZG 2VPXB 4Q45A 4NLSA 2HBYB 3C46A 3J81j 2DO4A 1IKYB 2KM8B 2J0QD 2DEIA 3V6JA 4C11A 3M2UA 3ETMA 4LUBA 1YJ7A 5EX3A 1N8RT 1IWAA 1LWFB 3W9HA 1ZBTA 5H9FJ 1HKAA 4QYZJ 3O5TB 2XM3A 1NK6A 2GJIA 2H51B 4IH6A 4DG1A 5JXSA 4F4YA 4X84A 3W65A 3SQGB 4OMFG 2HIQA 4WFNQ 1R8PA 3TWZA 3BDEA 1REGX 3ET6B 4X4VA 4RNNA 4CLYA 5C24A 2FHMA 3BH7B 1GMUA 3M6XA 4ED8A 4ZPAA 4AUKA 2KXHA 4IO1A 2I9SA 2DD8S 5T7LA 4ECTA 1FWKA 1FT8A 1WOOA 4A4JA 3GIMA 3GP9A 1W7WA 1NU4A 1LV5A 3M6UA 5A8RA 2E1PA 4TQSA 2ACYA 3VZIA 1O0PA 4HACA 3IRXB 4QW8A 3SMZA 2ZZTA 1RTHB 1CJKA 2CQDA 1SKRA 3CJTA 1CLFA 1P1TA 2OELA 4C0BA 1PYSB 4FF4A 1NKCA 1JKHB 2OHDA 2HHPA 3DI6B 3EZOA 2IVFB 1C1BB 4NPOA 3JSRA 3I9V9 2XS7A 2DR5A 3ITHA 2ZUAA 2ZBIA 4X64F 2BE7D 1KVKA 3OJSA 3G71S 4OZLA 2LLZA 4M5IA 4KHPF 3D3CJ 1RTZA 4LF5F 2W2PP 1RAJA 3VQTA 1U24A 1V5VA 4DUTA 1K73T 5HJYA 3EGNA 4X66F 1URRA 1J27A 4I0WA 3Q2TC 4M5JA 4F4ZA 2P6SA 2JVOA 2FD2A 2KJWA 1Q0NA 2X51A 4ZOSA 1GXTA 2EI5A 1UA0A 1JLBA 3PJ9A 2QL9B 5EWFA 2D1CA 4C8LA 2QT7A 3H98A 4B3RF 1NO8A 1H2TZ 3TEHB 2FHKA 2PIIA 3R27A 1C4AA 2CFXA 1WWHA 2COLA 4I6WA 2W7PA 2FVSA 1Q4RA 4DV7F 2CQGA 3ELHA 4DXLA 4IKAA 2AMCB 2CPXA 2DR9A 4NXNJ 4X62F 1XMOJ 1VQKS 2KU7A 5J2QB 2KI2A 3K5PA 4JYAJ 3HFVA 5BJRA 2WZ1A 2QIFA 1NRKA 2V8VA 3W8GA 1OYEA 4DV0J 4OYZA 3CMES 2K06A 3TZWA 4U7UK 4DF8A 1BY9A 1UEUA 2K1RA 2QO3A 5AXMA 1PAEX 4HYKA 5HMZA 5KFZA 3RUBL 3AD7C 2VQEF 3H2UB 2F8MA 4MIWA 4DZDA 4F3MA 4DPXA 2OJ3A 2ZWPA 2NR0A 3DGVA 1VQ5S 1TAUA 4U7UD 3C6TB 4TNOA 1BC6A 1HBOA 3GTYX 4NL5A 2WAQD 1LWCB 1RWOB 2DTJA 3MEEB 4KHRA 2ZH5A 3V4IA 2JLGA 5G4DA 1V3ZA 4TLQA 5K5MA 1NPPA 4P2FA 2NSCA 2QGFB 4YS2A 4DS5A 2F7VA 2YQ0A 1CBKA 2V8GA 1RXOB 1YZ6A 3EM1A 1T0TV 4HH1A 3QIDA 5CYQB 3QATA 3GWCA 1T05A 3Q8SB 2K7KA 3Q83A 4BDPA 3C15B 2F40A 3DOMA 2BM1A 2WSEC 1P1LA 3ZFVA 4MTPA 3H5YA 2SXLA 3KG0A 2OKQA 3B82A 1NUEA 3FUYA 2DRAA 3PXGa 4HT7A 4EU0A 1GT8A 3PX0A 2HURA 2IY5B 1AW0A 4ILRA 3DM2B 5JVHQ 4EK2A 2LCWA 3EX7B 2NCKL 5T41A 3GJTB 1LKZA 1FKAF 1T9XA 4LF5J 5IWAF 1IKYA 3BSNA 1YRTA 3KLVA 1RHMB 4RNFA 4V19J 2KHCA 3K8WA 1SJ1A 2PEHA 1U7LA 3IMQJ 4TU8A 4L3KA 1CJUA 1S1WB 4X66J 4Q8FA 1LWFA 1FJGJ 4B9SA 1VQ7S 3CNQP 3GMGA 4ECRA 2FLLA 4NLTA 3TW0A 4QWCA 2GX8A 2RNEA 1D9DA 5K9FA 3SQGA 4B3RJ 4CLZA 2B4PA 3MTJA 5A8WB 4FBUA 3ET6A 4Y0FA 3SCKE 1MU2B 1FKOB 2VF3A 4MFBA 4AXIA 1NH8A 2DIUA 1SV5B 4TY9A 3HKZD 2J5AA 2ZE2A 4DV7J 4MYTA 5GMEA 4RUAA 2MPUA 4TQRA 3PHEA 3R3TA 2GFFA 2ZBCA 1FNOA 4X62J 2ZH9A 5THWA 4LSLB 4FYWB 3R6GB 1YJ9S 3WIVA 5IC4B 3IRXA 2E1MC 2P8IA 1RTHA 4N77A 4MK9A 1FE0A 3W63A 4FF2A 3CMAS 1Y10A 2MMYA 1T9YA 5D4PA 4YN3B 2G13A 3KUHA 1JKHA 3VR1A 5HN0A 3DI6A 2A0FB 2M8DB 3G6ES 1C1BA 2AX0A 1OJ4A 2A6OA 5GADU 2CRLA 2BEFA 1RT2B 1YDLA 2VQEJ 4WIIA 3EPGA 1RADB 3NG8A 2P9EA 3UFCX 2DNMA 1GH8A 3OTCA 2R2SA 5KFHA 4JI2F 1FO1A 3BREA 3WDOA 1SKSA 1KSPA 1H38A 4C8YA 2HHHF 4C3MA 3GONA 3K57A 1IBMF 3LWLA 4WK3A 4MK7A 1KFSA 4ZP6A 5FJ4A 4OX9F 2OMOA 1IR2A 1KN6A 1YQHA 1TUWA 3MM7B 3BF4A 2IVYA 5DG7A 2BQRA 1S9FA 2YKQA 4U9RA 3GCWP 5IV3A 2B3TB 5LJ5Y 1NSPA 1Y5NB 3FRYA 3GIJA 4F4KA 3HVAA 1QLNA 7FDRA 1N32F 4QBUA 3EYZA 1RTIB 4FS2A 2NXNA 4URSA 4Y00A 2HAIA 2WVCA 2ZC3A 2F9JA 3IXQA 5LL6d 3GFHA 1IR0A 3I5AA 4X4RA 1SC3B 2XYHB 1YBAA 2AJ1A 1KS2A 2GZOA 1VQNS 4Z2XA 1LW2B 1HNXJ 4WXOA 2ILZA 4G1QB 5IWAJ 3SI8A 4FNHA 2HRUA 1HNZF 2RQCA 5ETNA 4KH1B 3DGPB 2V4RA 3RAQA 2F63A 3PFEA 3QQCD 2FC9A 1RTJB 5E7OB 4FKXA 3Q0AA 3M4XA 3UD5A 5C25B 4YDDB 4JI7J 4C98A 2VFUA 5IM0A 4GMKA 2PT0A 1FRKA 1YJWS 2FC8A 2BKPA 3G8QA 4DR3F 5T14A 1F9FA 3C6TA 3THTA 3HSZA 2C2DA 4C0HA 1VK8A 3FEYB 1LWCA 3MEEA 2IRUA 3CJ8A 5KT6A 2HZAA 4YDXA 2GJFA 2JJ4D 2BRLA 4KO0B 2C3OA 3AY0A 2AT1B 3AOBA 3TJAA 3QMQA 1Z1ZA 4H4OB 3KJNB 3QRRA 2P6TA 2MHEA 2KO1A 4YB1P 5CYQA 1IKWB 4M63A 2V67A 3UI3A 4X2BA 1UWAA 3RGIA 2HHVA 3C15A 1XTZA 3CJSA 4URGA 1KFDA 2DRBA 2CZ9A 2G2ZA 2HBRB 3VVTA 1M1KT 2VQFF 3W61A 1U48A 5GAEU 1WD6A 2A6MA 2XMWA 1DHMA 4I1TA 1DAXA 2B4OA 2AYBA 3HULA 1N88A 1Y00A 1HI0P 4G1PA 4FXWA 4AL7A 3DM2A 5DQGA 4JI2J 3X3UA 3DLGB 2X1BA 2AHOB 3DC2A 3DLHA 2E1RA 3LAKA 1UEKA 3KDNA 4QR2A 5DQHA 4ATNA 4PQUB 2BOAA 1IBMJ 3VF0B 1ZZFA 1N6QB 1WG4A 1S9GB 4DN0A 2E5HA 3CDAA 4USTA 3I56S 1SH3A 5IQ6A 3V2UC 1S1WA 4ELUA 2IA6A 3Q8PB 2BE9B 4OX9J 4X4OA 4LF7J 2GC8A 3AOCA 1RTDB 3I0SB 2IRXA 5LMNF 3T1YF 2FLOA 2QLJB 1IUJA 3CDWA 3ZNUA 1YJVA 3SCLE 3N28A 3SXLA 2I5JB 4DL4A 5A8WA 3GIRA 3N6MA 1TV6B 1NSKL 3VGSA 3V5RA 2D69A 4FNIA 1FKOA 1GFWB 2NZ4A 3SCIE 4PPZA 1SV5A 2MYFA 3LQVA 3MEKA 1L3SA 1OMSA 4W92B 4N41A 1VRTB 4KR0B 2Z8QA 4MK8A 1XERA 2Q1LA 1UW9A 3M6WA 2XEXA 3M2VA 1TL4A 3OLBA 3T5JA 3ZZPA 1T02A 1N0UA 4MT1A 5IT4A 1VBKA 1CJTB 2YKAA 5KFMA 1HNZJ 3EPIA 1FCAA 4F7VA 3NMRA 1QUVA 1MNEA 2X1GA 3C16B 2Q43A 1IQZA 1REVA 5IT9Y 4NLQA 1RT2A 1YKWA 4A8OA 1FJ7A 3MEDB 4YY3F 3H59A 2RU9A 1VFJA 3RBZA 4AD6A 2FJWA 4NYOA 2DCUB 1SC6A 4UQTA 2R3VA 1ZAXA 2R7XA 4DR3J 1JJ2R 3ZTOA 1HMVA 5F8MA 4XTTA 1FNXH 2M8HA 1CULB 4NCGB 5ETOA 3CXCR 3I96A 4HHJA 2HQ3A 4XIUA 3GCXP 3CCWA 4CP5A 4OZ0A 3HT0A 3FFIB 4WF9Q 3UCUP 1S10A 1VQ4S 3Q8RB 1DBDA 1N33F 5B0DA 2VL1A 4F0MA 3MM7A 1EKRA 4DUYF 1HD1A 2MLXA 5HQ8A 2NREA 1UJ6A 1SVDA 1U8SA 2B5JB 3NWRA 4JV5F 2HWTA 2CNOB 3TUPA 3PO5A 2RRAA 1S97A 1RTIA 2MKIA 3LUYA 2Z0GA 3A3PB 3MAHA 2XLIA 1H7XA 2QLWA 2Q79A 4ES1A 3TVYA 1ZM9A 4DCOB 4NI2B 5KG5A 1KKHA 2XSFA 3HD2A 3FRZA 4ZVUB 3PACA 1LW2A 1I3OB 3M8ZA 4G1QA 1AB8A 1TL3B 4LF6F 1S6QB 1DTTA 2VFVA 3R5CA 2LDIA 4NMLA 1RTJA 2HLUA 1U1RA 1OS5A 2E9ZA 1V5IB 3I0RA 2LECA 1FERA 4IQMA 1S0MA 2ZH2A 4YR2A 3H90A 2DCLA 4S0MA 1KQGB 3ZTSA 2HAFA 2GAGC 2CA9A 4CLPA 5AE2A 3QT5A 2FQQB 5B0BA 1K9MT 2YKOA 4FS1A 2W4CA 1T94A 3DLEB 4N8NA 1Q82T 3LTOA 3FCVA 1HQ2A 3NY0A 4K50A 4KO0A 2AD9A 3OFGA 4PPDA 3ZTRA 4H4OA 4NZ0A 3ETOA 2OAUA 3DU6A 4NRUA 2YPYA 4N56A 4K7QA 2ZVSA 1IKWA 2AYMA 2IVMA 2ILYA 1G3OA 4KPYA 3DRYA 4LBHA 5KFQA 1R31A 2BA9A 1U1PA 1TFYA 3PTWA 2XZDB 3B54A 2V4JB 3BQ2A 1FFGB 3TP2A 4OX8A 1SJFA 1DQAA 2UU9F 4YY3J 4RNMA 4J9PA 3A1YG 2WVFA 2V9WA 2LA6A 4WYWA 1RYRA 3DLGA 4B08A 1RBLA 3N5FA 4CLSA 2HYIB 4TVAB 5BXIA 4PQUA 4QR1A 1WHYA 3CCVS 3KNGA 1S9GA 3ZZZA 2L48A 4JI0F 1ZA2B 2UVVA 3TUZC 3KK3B 2P9CA 2EFVA 1RTDA 3NS5A 2Z2LA 3TRGA 1NJWA 4HKQA 2YWFA 2HIYA 1VJWA 4Q5VA 4DUYJ 2W8LA 2YPZA 3H2VE 2XY5A 2P5VA 3WC2A 4JV5J 2V4QA 2CNLB 3J7YI 1J5EF 2I5JA 3J80Y 4DQPA 1D1UA 2YVSA 1TV6A 3I82A 2QLFB 1Z2LA 4E8UA 2GMJA 1PIEA 5KTQA 2C2KB 3CDEA 3U7JA 4IOAQ 1FJEB 2QFIA 5L39A 2J7KA 2IM2A 4L76A 2C22A 4TU7A 3O1LA 1TKTB 3UN2A 1WDDA 4WXWA 3ENWA 2WVEA 4ICLB 1UPPA 2OEJA 3HJFA 2POKA 3CIZA 1RU1A 3FCWA 1CJTA 5B7WA 1RAOA 2DXEA 5B08A 2KH9A 5CQGA 5DGAA 4L75A 2MQNA 4RR5A 3C16A 4IR9A 3R97A 5D77A 3MEDA 1RAHB 3RB0A 5F41A 2JVRA 2WK4A 2M70A 4FYVB 2M88A 2RUGA 5E3CA 4ZCIA 3MMAB 2HNZB 2C2RA 1CULA 4NCGA 3NL0A 1Q8KA 3NP5A 1EAYC 2GGPB 1PKUA 4CM2A 3D9BA 4IRKA 3FFIA 1OQ3A 1YIJS 1F9HA 3KK2B 4ID5B 3FZ2A 4QCLA 2VPWB 2YQ3A 2HFZA 1WC4A 4DV5F 2PA3A 4ED5A 2QC3A 5D0RA 2AGOA 2QA2A 5GVQA 4CH1A 4OI3A 4RUCA 1HR0F 2B5JA 1BWEA 1N5VA 1KDNA 2IAJB 1X5TA 1TELA 1N56A 5A6WA 1JLCB 3QBCA 3GPAA 3CD0A 4IFYB 2H9ZA 2VFSA 2VFRA 4ECQA 3M30B 4USIA 3A8KA 3BPSP 1R6YA 1KC8T 2WB1D 2Y3YA 2UU9J 2DT9A 3GFXA 2XHWA 3HPOA 5HVHA 1F1BB 3KLIB 2R2TA 4NI2A 4N47A 3MFIA 1B3TA 4USMA 1HW8A 1FXDA 1TL3A 2BQ3A 1CS4A 1Z4UA 4X4TA 4ES3A 1S6QA 3HHLD 4DQIA 1Q53A 3MURP 1J2VA 3SFUA 1KHWA 4LR7A 3AJDA 1K0TA 1I51B 4AE5A 4NCBA 4AQYF 5KFWA 4GO5X 1AFIA 4DFPA 5G0RB 1M5SA 4R0EA 3M6VA 3G6XA 2BUNA 2LEPA 4P75A 1J5EJ 4M8LA 4M5DB 4MKBA 2ADCA 3DLEA 4N76A 2VA3A 4I56A 1YTYA 1Y3JA 1NK7A 1WEZA 3TNVA 3G4SS 1RLCL 1SJ4P 2M5YA 3MM8B 5B0AA 1IN0A 1U45A 2F9DA 2XCAA 4KRWA 2HHUA 3BR8A 3TX0A 2DHGA 3LOUA 3R8YA 4ECXA 1TK8A 3ZNJ1 4ZJOA 2RQMA 3HJVA 1VOMA 2UVWA 1XR6A 4KV8B 1XQIA 2R9LA 2XTJP 3UWTA 2V4JA 2MKSA 3M7VA 2EC2A 3D66A 3B6BA 1IKXB 1LNQA 2V2QA 4EYHB 5RUBA 2MZQA 2XMJA 4J9LA 1YSJA 3OL6A 3HCXA 2NPIA 1H2UX 3UR3C 2U1AA 3VQSA 5F0WA 2BACA 5L1LA 2W2OP 2KN4A 5ETPA 2UUWA 4ALZA 3RU0A 2DK2A 1H2VZ 3DDKA 2LQBA 3MCMA 4P10A 4M5NA 2GIFA 4DPYA 2I1RA 1XN9A 2MQOA 4DR2F 4DV4J 3KLGB 4Y34A 3KK3A 4MIBA 1FI4A 4K4XA 3RB4A 3BDPA 4QWBA 1GMWA 1NCLA 3JYTB 4DV5J 4ZPCA 3UE2A 2WBRA 1MWYA 3CCLS 2DVIA 4DR1F 1HR0J 4IRCA 1XR5A 1WTBA 2F3JA 1S6PB 1J5OB 4ED6A 5HI7A 1VDHA 4DPOA 1RA6A 3BSAA 2OPPB 3MR7A 2VG5B 4ZCMA 4Y6IA 2XNRA 4HI2A 3J7A1 5B0FA 2RB7A 4O23A 2E9RX 1LFWA 1MW7A 2BKOA 2L9WA 1TKTA 1WJ9A 1W25A 3ILOA 5KFXA 2I2YA 1S72S 3K5OA 4FYXB 4ICLA 3NGDA 4C8MA 3OR1B 1JLAB 3KJQB 2HMIB 1YJTA 3ENAA 3TAMA 4DLGA 4OZJA 3ZZ0A 1FRIA 2NYHA 3IC1A 2ZM6F 4KKOB 1QJHA 2DR8A 4GVBB 4KY3A 4UUXA 4G6VB 4WZQA 2W01A 3DDNA 2IA0A 4JP8A 3U02A 3VAIA 1NAQA 3CW2C 2HNZA 3GYXB 2M9KA 3VV2B 2WB4A 2YNIB 5C42B 1WOSA 4IR1A 2GGPA 4NCAA 1DLOA 5LSRA 1T8EA 1VLYA 2ZOFA 4C8ZA 3FMBA 5K8PA 1XNRF 1YJRA 5BYSA 2XMAA 3QT6A 2XGPA 3NNHA 3MPUB 1S0VA 3KK2A 4KIAA 4MKVA 2HVHA 5E0OA 1HI1A 3BBFA 2C3UA 4GVLA 5JJBA 3DNCA 2ERRA 3MUTP 4UOCA 3BBCA 4YHHF 3N01A 5F8NA 3CEDA 2C2NA 3ADAC 5ETMA 4J91A 2IAJA 4OYWA 1CG2A 2B0GA 1JLCA 2MB0B 4GC6A 1YBUA 2RUSA 1GXLA 1WI8A 3LP2B 4ELTA 4IFYA 2KRRA 1P8GA 4WU3A 3M30A 1N36J 3IRWP 3N9UC 5KFKA 3KYLA 1HA1A 2HSEB 1G1XA 4PG7A 4TYBA 3VHQA 2Z56B 3KLIA 4USHA 3RJMB 2MZSA 2ZH8A 5CYMB 3CSKA 1F3VA 4CYUB 3Q22A 1U49A 2FVPA 4LF4F 4EUVA 1R43A 1QVFR 1VQYA 1NXIA 4F26A 3OXLA 4WJBA 4IO9Q 4DR2J 2IJFA 2CQ4A 1NPKA 3C3LA 4EZ9A 4CO5A 1RCOB 3LP1B 2DGUA 4JV2A 5J1NA 5U47A 3ULHA 3F41A 5HVFA 2BMBA 4WTOB 3MI7X 4EWTA 1NM2A 2YWKA 2XMKA 4CLUA 3KLEB 2BJDA 4DR1J 3G86A 4M5DA 2FGOA 1K0VA 3JQKA 4NXMJ 2JDJA 3X1LB 3IAM9 2EFNA 3FSYA 1NB2A 1VCTA 2HRTA 3VWSA 4QWDA 4WCEQ 2QRRA 3MM8A 3E8OA 3QAUA 5HLFB 3P45B 3LA0A 3H2LA 4PRFA 3EXCX 4A48A 4RO0A 2AW0A 1JK9B 4IG3B 1QVGR 5DG9A 3RRGA 2MZ1A 5CYJA 2GS8A 4B9UA 1WC6A 2FJVA 2OPSB 5LJ3Y 3PG9A 4KV8A 2XMMA 1FVSA 2MQPA 4KFBA 5IXUA 1FEEA 1IKXA 2FUG9 5D78A 2ZM6J 1CQMA 3HX9A 4B9LA 2BV3A 2AJQA 5DG8A 4Q0BB 1N5YB 2QA4G 2IC3B 1VR6A 1RBAA 2EFPA 3LGNA 2MZJA 1C0UB 1RAAB 2KFNA 4DJBA 1U2CA 4NZ6A 1VC0A 4IFVB 5FLXY 2QTWA 1WTFA 4F50A 1XNRJ 4JI1F 5KFJA 3KLGA 5HBMB 4CT8A 4TYAA 4IG0B 3JTOA 5AJ3F 4WFAQ 4WP8A 1TKDA 3ZTQA 4DI6A 4R5PB 2FVRA 4YHHJ 2LP4A 4F0HA 3ICLA 3NNCA 2ZOGA 4DDFA 1Q7YT 8RUCA 4Q2MA 3UW1A 2XHCA 2A1BA 4NA2A 2OPPA 2VG5A 3IS9B 4C0OC 1ZPVA 5KFRA 1HHTP 5DETA 3R5JB 1L3UA 3O3LA 2ZNYA 3CD6S 2KFYA 1EARA 4RWWA 4WIQA 1XBWA 2GO9A 3POTB 4FXDA 4LF4J 2ZH6A 1JLAA 3KOAA 2EEYA 4CWBA 4HDGA 2EVZA 5M2RA 3PYGA 5I3QA 2ASJA 3TZYA 1GTHA 4ZP8A 4KKOA 1JNRB 4GVBA 2VOOA 4JI4F 5GMKa 2H48B 1E6VA 3MR5A 1B64A 2ATLA 2HQGA 5HQLA 1ZAVA 5IFMA 1HW9A 4CLLA 2V63A 4DV2J 3HVTB 2JX2A 1EIYB 5C42A 1HWLA 1OPIA 2J0WA 2W24A 5KFEA 1S57A 2IPOB 4J9VA 1RT1B 1QAIA 3D28A 3AAWB 1Q8BA 3GV5B 2BYCA 4O3RA 1NK5A 1V3RA 2V5HG 4DX7A 1NKEA 3W2WB 5LSOA 1RWVB 3ENQA 3UPFA 1TUGB 1KWMA 3LH2S 3T19A 4H54A 3CT9A 2DHSA 1H98A 3LP2A 1VC5A 1T9WA 4U67Q 4LRCA 1B7FA 1HBNB 4EO8A 4ECSA 2DNZA 2H1YA 2LYVA 1D9AA 5CYMA 4LFBF 3ZZTA 3BV8A 3MF5A 4CYUA 3K0JA 1T3OA 4PXDA 3TQEA 2RDJA 2BQUA 1X60A 3CJQA 2MJUA 4O0IA 3W1YC 3AHPA 2CPJA 1KQFB 2QL7B 1Q78A 2DNNA 2DRDA 3UNYA 2IBKA 5J2MA 3I4HX 2IJRA 2ZZNA 4JI1J 3FEZA 3LP1A 2PMWA 2F65A 3ILIA 3PJXA 2XB2D 2PDAA 3AOAA 1JJHA 1P27B 1ICEB 2J6UA 1WOPA 4I4BA 2Y8WA 2MDAA 1MWZA 2B8QA 3CD5A 2XYGB 3KLEA 2EBEA 1SKUB 4LT6A 4ZP7A 2CDRB 1MSWD 4B3TF 3JTPA 3NKYA 1UVLA 2HFSA 3W62A 4KH0B 2F8EX 3I5CA 4OJ3A 4FBTA 4WFZA 4K4ZA 5HLFA 2BVZA 4ZLLA 1UVKA 4J9UE 1RSCA 2FDNA 2RSQA 4OI4A 4IG3A 3HVWA 5HAOA 3ENVA 4ZLPA 1Y0HA 4DU8A 3BSCA 3J7ZT 2G1HA 2AZ1A 1T9TA 3HFZB 3D0GE 4ECUA 1GAOA 2OPSA 4LR8A 2BJ1A 3T6BA 3CDUA 4NYZA 2YBVA 4DR4J 4UOFA 5DDQC 4RNHA 3W60A 4ECWA 4MKYA 2UXDF 2WSCC 2V8HA 3ZZOA 2AF6A 4LQ3A 3T3FA 5E3QA 3C19A 2Y8YA 1Y3KA 4ZVRB 4PG6A 1RABB 4Q0BA 1N5YA 2IC3A 4JI4J 2VV5A 2OPQB 5HSPA 1JLGB 3CPWR 5AXNA 1C0UA 4ANCA 5J2NB 2VODA 5HJXA 2R7WA 2R8JA 1S0OA 4IFVA 3AXKA 5H9FK 2W9BA 4QYZK 1AUDA 3CTRA 5HBMA 1F60B 1QAYA 3PZPA 4FPIA 4IG0A 4IUFA 5AXKA 3IO1A 7FD1A 3W66A 3DCAA 5B0CA 1KVIA 1SQGA 1GK8A 2J7WA 1DTQB 3VALA 4QJVA 1BXNA 3EGVA 2VPYB 4C4WA 2EKYA 4R5PA 2XC9A 4RX6A 2CYYA 3VAGA 1I5OB 2ZHOA 4K4VA 4NMXA 3VGVA 1XR7A 1VBYA 3H42A 2AJFE 3PRBA 3RYLA 1RU2A 2HS3A 3FSXA 4V1Ak 4HL9A 2CG8A 3BR9A 2R8IA 2HGMA 4UUWA 3MMCB 1WHWA 5GAGU 3T5KA 4PCQA 1X9SA 3RR7A 4NASA 2FTRA 3P3DA 3P49B 5I42B 4A8YA 4E2FB 5J1PA 3VAMA 3S1TA 5F8HA 1TMJA 1MN9A 3G8TA 1VQPS 1U6ZA 4P2MA 4LFBJ 5KFDA 3POTA 3OTOJ 2J6TA 2MQLA 3KMQA 3LW5C 4V19X 2V68A 3HI9A 5KFUA 2V50A 4KSEB 2L41A 2ADBA 1GX6A 1TL7A 1S5ZA 1B4SA 4KGVB 2FVCA 5DM6Q 4QIEA 2RD5C 3OFEA 5ETLA 1X4FA 2DH9A 3PR5B 3GILA 2DNLA 3GFZA 4FN5A 1EZZB 1W2BR 3MMJA 4KGMA 2DIVA 3OQ2A 1RDRA 2CQHA 2K3IA 1NJYA 2ZKUA 1VGYA 3HVTA 1OSDA 2XZWA 2F5GA 9ATCB 4B3TJ 2OFGX 3UO0A 3HD1A 2KYZA 3AD8C 1U0SA 2OEKA 4WP3A 1MMDA 4TXSA 1KTVA 3EDRB 2VH7A 4I7FB 2AJ0A 4QQBA 4DPWA 4ED3A 4CH7A 1O5JA 3GR1A 1VJQA 3W2WA 3TEGA 3UD3P 4NZ7A 4P6QA 2R8KA 2R7OA 2A3JA 2DXDA 5AE3A 2BJ8A 3OFHA 4XK8C 4QWAA 2UXDJ 3JSMB 2E5JA 3V6DB 4ID8A 2XSJB 1NEEA 2L9DA 1HBNA 4WE1B 1SL0A 1KLNA 3KJFB 3M8WA 2PSZA 3N0VA 1FD2A 1FHTA 4FXVA 3JSYA 2CWXA 2XI3A 2MY7A 2AEJA 3MWBA 1RAFB 1QM9A 3I31A 2LMIA 4YOEA 2MSTA 3QSIA 2KG0A 2MXYA 1TR0A 1UZHA 3BKTA 4K2XA 2GHVC 3D6TB 3RBDA 4DFMA 2DGWA 5H1SV 2HS0A 3HMJG 3AJ2A 3V4MA 1UPMB 2ZDPA 4CO4A 2HBQB 2CIMA 1LXJA 4PWWA 3CJ2A 2X3DA 2VBWA 3CC2S 1M5HA 5JMNA 3OTEA 3KG4A 1SIWB 1V3SA 2MTLA 2QMXA 2XO7A 4JI6J 1APSA 1X31C 1FDBA 3L09A 3EZ5A 1RP5A 5KT4A 2WONB 3R5DA 5L1IA 1YRUA 2CJ9A 2FJDB 2YNGB 4QU6A 3GG0A 1WC3A 3FK4A 3IG1B 5KG1A 4ETZA 2JFDA 4B9NA 3K89A 3RBEA 4B3OB 3CJ0A 2V0NA 3MZIA 2HFNA 1XK8A 2MLZA 3BGUA 5HROB 2CXEA 3GYNA 2GIQA 3PRDA 3J7AN 4NLDA 2QV6A 2Y0SD 4ZK7M 7AT1B 3T9ZA 4DV0F 3M8PA 1WI6A 1CSJA 4L74A 1OQ6A 3SSRA 1ZS6A 1AZSB 3GR0A 1VQLS 5L8RC 4P2SA 4AXJA 2W2NP 2OPQA 4Y2AA 1JLGA 1R7IA 2DITA 1UA1A 2C3MA 3OXFA 5A76A 5J2NA 3ZZYA 2QEXS 3DHWC 1OY6A 1IXKA 5F8IA 4C6AA 1SH2A 4C97A 5L1JA 3FEXB 1U2RA 4L3NA 4YQWA 4OX6A 5FIIA 4C48A 3WC0A 2CNNB 2K7JA 2LQJA 1FFSB 1D0EA 1U47A 5KOXA 1DTQA 4ED4A 2R7SA 3RAMA 2HK3A 1VC6A 2GQCA 2DO0A 2QSWA 1O51A 2XY7A 5BYRA 5JUMA 4ELVA 2W7AA 4WKYA 2N4CA 3MCNA 3RBXA 2VG7B 2CPZA 4OHVA 2C1EB 1V6HA 5HP1B 3FC9A 1UJ4A 2O67A 4B3SF 1X4AA 1MMLA 1HQEB 5I42A 3SSQA 2R8GA 4LFCF 3O6QA 3N79A 1O8BA 2ATCB 3NOGA 2RU3A 2E5LJ 2YNFA 5M2PA 3D7SB 5E41A 1PBUA 4EGLA 3QT7A 5E3PA 1IWGA 2HFVA 2KTQA 2UXBJ 4TY8B 3FZBA 4AYBD 4DSKA 3BJYA 5D0GA 1NK9A 1UEVA 1YZ7A 2EBGA 5KFSA 3R2CJ 2R7RA 2YKNB 5H9EK 2V2VA 3T5HA 4PXCA 2B9EA 1TK0A 1B0PA 1F2HA 4U7CA 2LA4A 3OSNA 1NHUA 3Q23A 4ZJQA 3DRRB 4OJGA 1VBZA 4BC7A 2VIHA 2OSQA 2IIHA 4USVA 1FJGF 1HPZB 1FDDA 4M5MA 2HNDB 2VD3A 1FTRA 2NS1B 2KDOA 4P74A 2B51A 3QLHB 4BCAA 3IGVA 2QYCA 1HWIA 2XBPA 1PJ5A 2VFTA 3A13A 3FQKA 4I7FA 2FHJA 4DBQA 3PKYA 1FA0A 1VLOA 1R8BA 1FDNA 3MECB 3LAMA 2YX4A 2QL5B 3BEGB 4A8SA 3RB3A 1Y7PA 4ANEA 3HZEA 2NSBA 4J9RA 3NAIA 4Y2KA 4K4YA 3PO4A 2XWXA 3KHRA 4ZVTB 3AODA 4Y28C 3JSMA 1R89A 2NXUA 1PJ7A 3V6DA 2XSJA 1RI7A 4WE1A 4LF8F 1IQTA 1L3TA 1HWKA 2E29A 3CCES 4RW4B 2BR0A 3MOZA 2V94A 3I5BA 1V9OA 5K8OA 2KFZA 1RT7B 4OHWA 2MY8A 2ALYB 3M2RB 4EEYA 3KDOA 3DXSX 2RS2A 3OPKA 2AX1A 4KAIA 1U1OA 2UP1A 2XS2A 1RBOB 3FMWA 1TL1B 2B6AB 4F3QA 2BANB 1S79A 4OV1A 2CPIA 1YGYA 3HO1A 1W2IA 3NXZA 1RA7A 3EZUA 2PMZD 1F5BA 3N5BA 2VASA 2XCPA 1Q86T 3MFHA 1DQ9A 1K8AT 1NSQA 2PN6A 2W4DA 1S1UB 2HQFA 1P6TA 2ZH3A 2J6SA 2WONA 4NLYA 3OUYB 4B3SJ 2RQKA 8AT1B 1RZMA 1KBRA 3V81B 2R8HA 1FNMA 1KONA 3TOQA 4LFCJ 2DGXA 4PABA 2G9OA 4OYIA 2MJNA 2RQ4A 4U6PA 2AYEA 3DOKB 4NLUA 2ZH1A 1DY3A 2V8DA 1IKVB 4QPTA 2DY1A 1QY7A 3O44A 2NLWA 4OV6A 5HROA 2JC0A 3SCJE 2XNQA 4BWJA 5SZTA 1IJFB 1MN7A 1ZA1B 4HEA9 2ZZMA 1NJIT 1YRXA 5M2UA 1HNXF 3IR6B 1NH7A 2IM0A 3MM6B 3KG1A 1BUXA 5F8JA 3D3BJ 2I38A 1FEHA 3QGPA 3MPDA 4ZITA 4ZVOB 2AZ3A 5K14B 4KJIA 3OHAA 4R25A 2IFXA 4JI7F 4O3SA 3HDSA 1Y5LB 5HO4A 1QTMA 3QNWB 3T5LA 1S48A 2YKMB 4PXEA 1A6LA 2BABA 2LQ8A 3MAAB 1TKXB 4WWSA 1X0FA 5L46A 3M8YA 2CPYA 2MGZB 3CMQA 1NLKL 3SV4A 3QT8A 1FF2A 1KP6A 4DN9A 2W8KA 3W8PA 3JTNA 4R0JA 4DX6A 1ZETA 1AA1B 2VG7A 5HP1A 4ZPWR 2H4YB 1QD1A 1LW0B 2XQCA 4OZ3A 2ROGA 4J9NA 1HQEA 1I1GA 4ED0A 1AFJA 2MZRA 2J8AA 3J7Z5 2HVDA 4K0KF 4LF8J 2AIRB 2HHTA 3BO2A 3THPA 2CQ2A 3PNIA 3NS7B 1PJ6A 2IYGA 3B4DA 4GRSA 5KT2A 2HKEA 1RHRB 5L9XA 3I4PA 4DCPB 1E6YB 2VJUA 4TY8A 3D6MB 4OI0A 1S1XB 5EWEA 5H9EJ 4F3OA 2U2FA 3D67A 4NA3A 3AA9A 2GO8A 5KG2A 3KMSA 1PO6A 1F0XA 2YKNA 4ECYA 1U0HB 3UNGC 2EPIA 3D0IE 1F9EB 2DNKA 3DRRA 2OGUA 2MSSA 1RAEB 4LF7F 2JOQA 3K17A 1HPZA 4K59A 4UT4A 3RW7A 2D3OR 1ACMB 2HNDA 4J9QA 4DSLA 4U96A 1H7WA 2RF2B 2PFDA 4NEZA 4JB8B 1SQFA 5IC6B 2VJVA 4ECVA 3KLFB 1PGZA 3QLHA 2N82B 2HW3A 2KZMA 1KOOA 4UTGA 4U8YA 3FSIA 3GE9A 3MECA 3AQOA 4UY8T 1XNQF 2ASYA 2BW2A 3BN7A 3D68A 3RRHA 3M32B 2VHGA 5J2QA 3TVZA 2NUUG 1A9NB 3NCQA 2ZHAA 3RTVA 2WW8A 1C0TB 2XMVA 1RT4B 3L7UA 2R7VA 5KT7A 4RW4A 1QE1B 1HHSA 2G2YA 3L9ZA 3PW7A 3QFHA 4IH7A 1RT7A 1T03B 2G1DA 2E7VA 2BKNA 1Y5IB 4DEZA 1AXQA 4P52A 2C2OB 1TL1A 2B6AA 3UDLA 3QAEA 5CCMA 4PG4A 1WG1A 2H4WB 3CJ3A 3DOLB 4EZ6A 1UFWA 3OSPA 4F4XA 3MCSA 3CCZA 3C66A 1KEKA 3MD1A 3K5LA 3ZZUA 1SC1B 2VPZB 2QN6B 4DHVA 2LQ9A 4A8MP 2GVZB 1WC0A 3GFYA 2APOA 3GG1A 1S49A 3OUYA 1S99A 3W9IA 4NX9A 4WFXA 3V81A 4DV3F 3A12A 4ZVHA 3DHXA 4BWMA 2D3UA 3QFWA 4K0KJ 1G2EA 1RAIB 4DL3A 3F73A 3DOKA 4KGXB 5EGYA 1S4FA 4QWEA 1JNZB 4CI0B 1IKVA 2VBXA 1A7GE 5T7LB 3GYGA 5SUHA 2YH0A 6AT1B 2J0SD 4I2QB 2Q6BA 4FVMA 3CGIA 1TFWA 2F8HA 5LMUJ 2K8GA 1DRZA 1OWXA 3MCOA 4J9SA 2GAHC 3TZXA 1BHNA 2CJXB 3MM6A 2HHQA 1HWUA 3MR6A 3C8YA 5L38A 1RHJB 4QU7A 3ITHB 4C3KA 2KJVA 5K14A 5J1EB 3H5SA 1GMVA 5LT5A 2DGVA 2JNJA 3PW2A 2VBZA 5KFNA 2YKMA 1Z2ZA 3VGUA 3PIOQ 3MAAA 3IP0A 1YLXA 1TKXA 1U6BA 2BW7A 2LFVA 4K5RA 1UW4A 2MGZA 2KT3A 3RRKA 4O44B 2AEFA 2V34A 1QSSA 4OFZA 1MU2A 4RJVA 3W64A 3TVKA 3CJRA 1WHXA 4ZIWA 3BB5A 4ZJLA 2VB6A 1XNQJ 3CC7S 3W5YA 3AB2B 2UZAA 2BJ7A 4IH5A 3GJRB 5L9NA 4LSLA 1VQ9S 3ILLA 4RBVA 2IJNA 4J9KA 3IM9A 2HS4A 3EWGA 4H4KC 2LXIA 2ZBQA 1EHWA 1N52B 2QMWA 5K8NA 2HHXA 3TO8A 2JHEA 1M5VC 4NLWA 4ILMA 2UXCJ 1C4CA 2UUBJ 2LXFA 3WIUA 2R2UA 4F67A 1Q5YA 2CNKB 4LREA 1E6YA 4DUZF 1Q8IA 3BGLA 3LPEA 3GZ7A 1S1XA 2CQ3A 2FZGB 4RUBA 2ZFHA 1UKUA 4OLPA 3BQ0A 2XI2A 3E3XA 2CQ1A 3TZZA 5CH7B 1U0HA 3KUGA 4DF4A 4DR5J 1JQGA 3OR2B 3AA8A 2D3ZA 3VAFA 4A47A 2DXFA 2DNGA 4AT1B 3F56A 1AROP 3IA0A 3PW5A 4DR6J 5F8LA 1LFPA 1SL2A 1F6TA 2RF2A 3D54A 3LGHA 2AGQA 2VBYA 5CA5A 3UQSA 1U26A 2DNYA 2IBOA 3KLFA 4M95A 3P4UB 4DV3J 1IM6A 3PYFA 5F9NA 4X65J 4HTJA 2Z30B 1JJCB 2B9XA 4GKKF 3PRVA 1NDCA 2B8PA 4O4RA 3F44A 2RRBA 4YUDA 1PILA 4PWUA 4EBEA 5DQIA 4IOCQ 3I55S 3ZC4A 3M32A 4X4NA 3QRPA 3NGKA 2PO4A 4ED1A 3TUJC 2NQPA 1OY9A 2BM0A 4BC9A 2CG4A 2E1CA 2XWYA 2V9KA 3H4DA 1RACB 1CC8A 5DDPC 2V6AA 4DR7F 5HVGA 3MMBB 1RT4A 2GQ2A 3DGPA 3KJVB 2KT5A 2E66A 4Q7AA 1EETB 1QE1A 2V8PA 5DDRC 2V2KA 3BKUA 4RL1A 3NWGA 1KVJA 1HARA 1T03A 3HHKA 2BDPA 4YMEA 2ZVIA 1WF0A 5C25A 2FHOB 3NS6A 2HLTA 4IOBA 4CNYA 4LQ9A 5F8GA 3HM9A 1KD1T 3Q86A 2KT2A 4HI1A 3GU0A 4RZRA 4ZPDA 1VIXA 2C3PA 1FWPA 4Y2CA 3HHDA 4QPXA 1PAUB 4W90B 2C2EA 4Y2MA 3DOLA 2GA7A 1CJUB 4Y2IA 3PVXA 4PG5A 1W26A 4RBUA 2N3LA 3C6UB 3R7NB 2WBMA 3TQ1A 2LQ5A 1PC4A 4LRFA 1WKKA 1JJ4A 3K7RA 3RZAA 4TLRA 2GVZA 2EFGA 5B0EA 4PQAA 2DNRA 4KQZA 3R5AA 4NEYA 4PZVA 5HATA 1UAWA 4RKUC 1U09A 1D3WA 3R5GA 4MFBB 2IDEA 4WYLA 2EFQA 5A0YB 2ZE2B 3P5BP 2I8EA 4HTIA 2B7BB 1OIAA 1P9YA 4ZA1A 2O66A 2OTLS 4I2QA 4LVNP 3MD3A 4DUZJ 2OD4A 4ZDNA 1MROB 5ETQA 3JB9k 3NAHA 4L73A 1G4CA 3GLJA 5I3UB 2M4MA 2BRKA 3KFWX 3WX8A 2NUHA 3EGZA 3FBBA 1N6QA 2VKRA 3J7YU 2DR6A 2F1FA 2E5IA 4JI5J 4PWDB 1PBAA 1X9MA 2AYGA 5J1EA 2QG9B 3GV8B 4NLOA 3I0SA 2IMWP 1WEXA 1CVJA 1NDKA 2YY3A 1WG5A 4YP3A 3MDFA 2FIUA 1EX8A 3CCUS 2CADA 2EG1A 2KYXA 1N54B 2HWIA 1UTAA 2AKWB 3IGNA 5A6PA 3UCGA 4O44A 1WORA 1JLQB 4UW2A 3BO4A 1URNA 1SUQB 4GKKJ 4XPCA 1FE4A 3HSDA 4K2JA 3CCQS 1RAGB 4YR3A 3FKBA 2NZCA 1VRTA 4I2PB 4PG8A 3KLHB 2ZJPQ 1YVFA 3HXMA 2QE5A 2PGCA 1NJZA 1IBLF 1L3VA 2Y1IA 3SEOA 4LIWA 4ETXA 2C2ZB 3CB4A 1U1MA 1OY8A 4DR7J 2CJBA 3OHBA 3HP6A 4DQQA 2R42A 4P2XA 3PIPQ 4ZLNA 1DARA 2N3OA 3CE8A 3Q8YA 9RUBA 3Q8QB 4TU9A 5KFLA 3G9CA 4A8KA 1K1SA 2YWHA 4NLPA 3VTIA 1F2GA 2HQDA 4WK1A 1H74A 1YX2A 2HPUA 2QMUB 2CQBA 1BGXT 4DX8H 3CJ5A 3OL8A 4FKYA 1HBUB 1I94F 4OZ1A 1IBCB 4A46A 3OR2A 4DV4F 2PC6A 2Z4PA 4FVCA 4DPUA 1ZTWA 3R1LA 1VHFA 3MTKA 5IM0B 4ED2A 2CPEA 1MLAA 3LF0A 3AQPA 3G6VA 3FQLA 2HK2A 1GMWD 3M8SA 1SQEA 4P7VA 1TQLA 2CWKA 3CCMS 3CCTA 8ATCB 4KT0C 4E98A 2PEBA 4URQU 4GC7A 5BYQA 1UP1A 3CVKA 2FZKB 2Y1RI 2OD6A 3DLJA 3N4WA 3WZ0A 2WW4A 3HF5A 3S6EA 2WTFA 4DZ6A 1TAQA 4RU2A 2A18A 2X7IA 5AXLA 2C2MB 2OSRA 4F2RA 2VG6B 3IN5A 1HHQA 2KVIA 3MMBA 1VISA 1IR1A 1UZDA 4J9MA 4B02A 3KJVA 1VHIA 1RK8A 2MEWA 1EETA 4DQRA 1KLMB 5IT0A 5E3AA 2V69A 3SZ2A 4X64J 5CAAA 1N48A 3DDIA 3M8RA 4KHPJ 4PAAA 1WELA 2VU5A 2BX6A 1HL6A 2LU2A 4ZPVR 2H3EB 4FYDA 4WP9A 1BQMB 2MHNA 1KQSR 2NYIA 2GQQA 3W3SA 3S8SA 3IBFB 3T1AA 2N7CA 2KHDA 4F04B 3H25A 2DKOB 3C6UA 5KFOA 3FGVA 3H7HB 2C42A 3AD9C 1S59A 4FF1A 3PYDA 2GNKA 3VAKA 1IBLJ 1X9WA 5E3RA 2CVIA 3HSGA 2XGQA 3IWXA 5IZHA 2YWGA 2W9CB 4OJHA 2RHSB 4J37A 4LF2A 3QYYA 1ZM3A 1CJVB 1M1GA 4UY85 2OIHA 5A0YA 4C9DA 1MMNA 1NKBA 1N36F 4OHZA 4X4PA 2BXJA 1YWXA 1N5TA 1ZH5A 1X8DA 4ER8A 5D3GB 1MROA 3M2VB 1ZM4A 2JEFA 2W2MP 5C5JA 1NK4A 4HHHA 1FK9B 2O01C 5I3UA 3Q89A 3SQOP 2WVBA 1DZ5A 4ED7A 1CPZA 3M8QB 1Q5VA 4LFAF 4K4WA 5GAHU 4FF3A 3MOJB 1I94J 2KG1A 1WDTA 2M0GB 1REVB 5KFYA 4PWDA 2DNHA 1NSAA 2J9DA 4Z7CA 3DU5A 2UVRA 3KTQA 4LVOP 3BM7A 1XWLA 2WSFC 3NCPA 1NHKL 1HMVB 2D41A 2JL9A 4P9SA 1FDAA 3K2YA 4O4GB 3G2XA 3KXDA 5GADI 4B9TA 4HR2A 1JLQA 4NXMF 1U2FA 1SUQA 4DFJA 3BGOP 4NLXA 2DISA 2G4BA 3IBWA 3H5XA 3CCRS 1G6BA 4IRDA 4L6V3 4I2PA 3KLHA 4H4KA 3IBCB 1QUPA 3DFEA 4ZVFA 1OO0B 4ZN1A 1UJ5A 3OTBA 4G65A 4QIVA 4ZHRB 4F02A 1FJCA 3I9ZA 2GHPA 5E33A 4DCJB 3CD7A 2OLWA 3AXMA 4P71A 1SKWA 1R0BG 4QIFA 2R7UA 4B17A 3NBPB 4M1KA 2YX7A 5LXYA 1JLEB 1WEYA 2CQ0A 1N34F 4WPAA 4QW9A 2WRMA 2ACMA 4DSFA 1NK8A 3PR4A 2O5DA 3EUNA 2ZKTA 3MMAA 2BOPA 1OSCA 4R8UB 1DTTB 2EFOA 5IOLA 3H4BA 4RW8B 4NYPA 1HBUA 5CD4A 3R5BA 2CZ4A 2YX1A 1RHKB 1X7VA 3I0RB 1KTQA 5DDOC 4KGKA 2C3YA 4BHQA 2M52A 4ID5A 1N5QA 2KZZA 2R2RA 4USKA 2HEKA 1FRHA 2DHXA 2OO4A 4JI8F 1HNWF 1NZ8A 5HMYA 2H5EA 2EXUA 4LSNB 2W4PA 3D1OA 3HT3A 4B3MF 1WACA 3D4JA 4HH0A 3BZQA 4GKJF 5DZ6A 2XLJA 4K8RA 3CCJS 2MKJA 2Y1JA 3VAJA 1UWBB 2OTJS 1HI8A 4G3IA 4C8KA 2BJEA 4N8OA 4YR0A 1N5SA 2CQPA 3CULA 5KFIA 3NOCA 2F4FA 3PEHA 4Q43A 3S7RA 4JV1A 2VG6A 5IV4A 4DL5A 1R8CA 1FKPB 4LIRA 4LFAJ 1BQNB 4DU7A 3MEGB 1VQ6S 2JWNA 4OYMA 1NB7A 1KLMA 4LBIA 3GQCA 2FJBB 1LK5A 3U1LA 1S7IA 5G0RA 1VQ8S 3A8JA 3THVA 3J81Y 4I68A 4RU9A 4HHUA 4O3NA 1X5OA 1BQMA 2HHHJ 1D8YA 5B0GA 2LEAA 4DV2F 5GAEI 1EB0A 1Q95G 2P9GA 2KXNB 1QAJA 2D9PA 2CKWA 3NLCA 4CO2A 4KGZB 1VRUB 3ZTPA 1RKJA 4AL5A 4O3QA 4X4SA 5D0HA 2ASDA 3OD2A 3T6JA 4RNOA 1VIOA 3J81U 1YITS 1NZAA 3L3CA 2DHAA 3VCDA 4CT9A 1SIZA 3LPYA 1LWXA 3K5MA 3I6PA 1U1QA 4Q8EA 2W9CA 4YB6A 1N32J 3PCOB 2JEIA 2LU1A 3PFOA 3HLUA 1CJVA 2W2QP 2DPJA 3GSDA 4K5SA 3QJLA 4FP9A 5CXTA 4W4MA 4DSJA 2J0XA 3QGIA 1N34J 5D3GA 4DV6F 3IWLA 1SH0A 1IVZA 2Y9HA 2WCXA 1FK9A 4LBPA 3FBCA 1UVMA 4QYRA 1UFKA 1X5SA 1AUSL 3M8QA 2GW8A 4BS2A 1DURA 4WTYA 3FVYA 3HHLC 3IAS9 3WBZA 4UZCA 3EICA 2Z2MA 4I64A 5HMXA 3JQJA 3P96A 3TYTA 1VK3A 2AU0A 3DLLQ 3JYTA 2CZVC 4JI8J 1HNWJ 3WX4A 3KHGA 5CZXA 2ZH4A 3A3OB 4B3MJ 3BBBA 4O4GA 1KOHA 4CLWA 3D5MA 4EYIB 4GKJJ 1FXRA 5IT9U 2F4VF 2IHR1 3PX6A 2BE2B 1S6PA 3QPIA 1Y11A 1J5OA 3SDEB 5D0EA 3CJKB 1BE4A 2DEJA 3BPDA 3CO9A 5F9LA 1T3NA 1XMBA 4DL7A 3ILJA 4K4SA 2DHHA 4ZHRA 4L72B 3OR1A 1YHQS 1BD6A 2VQFJ 4HVZA 2HMIA 3HFKA 1R3NA 4OYPA 3GB0A 1EP4B 4DR4F 4K4UA 3DXBA 3Q8UA 5CZVA 4WZMA 1FXLA 1SPBP 5KFGA 2RE1A 4OHYA 3NBPA 2FJEB 2EKNA 2EW9A 4NLGA 2VUGA 1JLEA 4ZCKA 3OL7A 2DGSA 2L08A 3BQ1A 4B9VA 2QA1A 4FZVA 2CQCA 1CS4B 3A3NB 1TP7A 3D1HA 4R8UA 1WC1A 3PM9A 1EQMA 4PUOB 3NRBA 4RW8A 3GIIA 2YNIA 2AQ4A 2ZNZA 3MR3A 1ZOTA 4JI3F 1SXLA 1X4HA 5JVGQ 5LXRA 2XMUA 4M5LA 3D2WA 1FRJA 4J5OA 2W7OA 2B9YA 5LMNJ 1RLDA 1T9UA 3T1YJ 2DJWA 2DNPA 4P72A 5DZ7A 1HNIB 4UF4A 1RWXB 1RUSA 2OUGA 5FD1A 2QSFA 2Y1LB 4LSNA 3H8YA 3D6HB 1M1HA 4CO1A 3DMJB 4A8QA 1FWLA 1F3FA 3EJMA 2RDIA 1UWBA 4RLEA 3NNAA 1WKLA 5KT5A 4OZNA 2QLBB 4H4MB 2R4FA 4MJKA 2EC0A 4DV6J 3EVWA 2VOPA 2AJ4A 1NDLA 5LM7E 3OTOF 4Q44A 2OEMA 4ZVEA 4WU2A 3SV3A 1KHVA 4WBFA 3JAMY 1HWJA 1FKPA 3MPYA 3MR2A 2UV8A 3JQMA 4DSIA 2HFUA 1BQNA 4OI2A 3OT9A 3W5ZA 3MEGA 3RG6A 3L4BC 3BYPA 3E01B 2BJ9A 3HSJA 4M5KA 6FD1A 1HFEL 3IWNC 4OI6A 2ZD1B 3L7OA 1EQ0A 1FTCA 1HNVB 2H65B 2MKKA 5DRKA 2IDLA 3JAMU 3DRPB 4ZS6A 1H0HB 1CQNA 3FCHA 5A8KB 3I32A 1ULRA 2F4VJ 1LK7A 4LRBA 1FFWB 1VRUA 2JRSA 2DGQA 1H3DA 3R7SB 5J2PB 1N33J 5BR8F 2FY8A 2YXLA 2OPRB 1JXLA 4YB5A 2IRYA 5KFVA 3AT1B 4XO0A 2HZCA 5KG7A 5AE1A 4Y65A 3TJ9A 4NA1A 3M9OB 3C14B 4MIAA 4WFYA 2ZUGA 3QJPA 1TVRB 1SL1A 3W5XA 3HK2A 2G0IA 5I4MA 1NPRA 1RJJA 1RT3B 4LSZB 1UVNA 2OMLA 3RB6A 2HHSA 4GO7X 3TUIC 2VDIA 3J80U 3EVMA 3CC4S 3HHLB 4KBIA 5A2QY 4LF6J 4U95A 1LWEB 4F4AA 2WVDA 1AT1B 3TAMB 3AFGA 3JXOA 4JI3J 5DS7A 4DMZA 2M7SA 3H0PA 1T9VA 2Q66A 4BLGA 2JH3A 1C1CB 1FD8A 2LKZA 4B9MA 1C2PA 3P5TL 3EXYA 4CRJA 2OFHX 1YBTA 3OLAA 3HKWA 2MKHA 5KG4A 5A2QU 3MPVA 2J9EA 2FB0A 4Y3CA 1RYSA 2HNYB 1U1LA 1IBKF 2IYIA 3ISND 1O6XA 1DLOB 2MKCA 4JI6F 2BE2A 4PKDB 5MAOA 2VA2A 1TU0B 4RW7B 3SDEA 1SJRA 3CJKA 2YQ1A 1XIQA 5HMWA 1NHVA 1GEHA 2D7SA 3FDSA 3IS9A 4NWBA 3MHYA 2XMTA 4OLOA 2RMLA 2I0XA 4NRTA 3SBMA 2EK1A 1NMEB 2JLFA 2ZJQQ 1RT5B 1VQMS 5KOWA 2FJXA 4X4QA 2UUCF 2Q3PA 3D0HE 1WSRA 1B0VA 2CPFA 3IR5B 4LMZA 1EP4A 3OTDA 2X1AA 2ALZA 4UQGA 3NEKA 2ABYA 3K8VA 2L9NA 2VDHA 3UR0A 2DPIA 2PI4A 4OI1A 4M94A 1RWMB 1S6UA 2ROEA 1VBXA 2GV1A 3KK1B 2W9AA 2RS8A 5LSLA 2FJAB 2G0CA 1ELOA 3NGUA 4X4UA 5HL7Q 4PUOA 4JI0J 2PFFB 1U1NA 3UD4P 3MXHP 5D4OA 4OYAA 2EWHA 4JV0A 4ZVSB 3BGFA 1T95A 5BR8J 4AL6A 1RT1A 5KFAA 5D4LA 1JXEA 1GXUA 1UETA 1RWPB 4ITSA 4J90A 3BGRB 1I6JA 4OYXA 4LR9A 4MMOA 5D6GA 1HNIA 4ES2A 2YWEA 2W25A 3NMAA 2Y0BB 4TN2A 3ISZA 4CIOA 1EKSA 3CWJA 5ADZA 3JSBA 5EHHA 2H5JB 3RW6A 2O3DA 3DMJA 3M9NB 3DLKB 3UDEA 2G2OA 2L3MA 1FX4A 2RILA 3UDVA 2E1AA 3EE3A 2YNHB 3DRSB 5AT1B 3DYAB 2R7QA 3KWMA 2JC1A 1L5UA 5F3ZA 4CCHA 1QSLA 1D8ZA 2CJAA 4H4MA 2GVDB 5ETRA 1XJWB 2HG4A 2E5GA 1BQXA 4RUHA 1LQ9A 1RWWB 5L1KA 2D9OA 4DV1F 2ZBRA 2E5LF 4QIGA 4DOZA 1GTEA 5DGBA 1L3KA 3B4MA 4DPTA 1M0SA 4I6AA 1U02A 3HVRA 3QJJA 4OX7A 4KYZA 4KFBB 2UXBF 3Q24A 3G8SA 3OVSA 3NGRA 2RT3A 4ZLJA 4YEAA 4YB7A 3PKMA 4KHMA 3E01A 1FX2A 2ZD1A 4JUZA 2LEBA 5KFCA 2RRNA 1HNVA 5D15A 1S6OA 4KTQA 2RAQA 1TZ0A 3DRPA 5A8KA 4QIWD 3M9MB 1IBKJ 1X5PA 1WC5A 3Q8VA 3EGWB 1QAXA 1TUVA 3KUEA 1RT6B 4FDFA 2EK6A 4DL6A 4K4TA 3R2DJ 5J2PA 3E51A 2OPRA 3QGHA 3KKFA 1JWWA 2K3KA 5EN1A 3A8EA 4USJC 1U8WA 1QTNB 4RW6B 2FHJD 1FVQA 2RKIB 3DLBA 5GAHI 4DLEA 1B99A 2UUCJ 3C14A 4RW9B 3S01A 1JXVA 1BMQB 5DLGA 5KG0A 1TVRA 2HQCA 3MM9B 3BS9A 1RT3A 2RJZA 3F0NA 5C2GA 2OI2A 1PYOB 1T11A 3M1VB 5KFBA 1WNEA 2A10A 3MUMP 1KNZA 4P7TA 1Q7LB 1XMQF 2PD1A 1F5CA 3B8HA 1CC7A 3HHLA 3AH6A 4FPRA 1LWEA 1ROFA 2AP6A 4DQSA 1ZAWA 2QLXA 4RWXA 2HBZB 1X4DA 1DQ8A 3PY8A 4O0NA 5IS2A 1H6KX 2DB1A 3PW0A 4AQYJ 1C1CA 2X1FA 3OV7A 3PHTA 1JX4A 3CF5Q 4RPFA 1E6VB 4MYUA 5EUHA 4Z37A 1VQSA 3KHHA 5ITHA 4LJMA 3PYEA 2HNYA 3T9NA 5K20B 5C7PA 5KG6A 2UUAF 4RBTA 1CEZA 4RW7A 4CLKA 3IM8A 3MMCA 5KG3A 5EDWA 4KE5A 3BSOA 5DLFA 5DM7Q 1Q8LA 4F0KA 1HQUB 2B9WA 4AFFA 2CJKA 2E7WA 2B56A 1MG7A 2C28A 4DV1J 5HK4A 4EI2A 1VS3A 3A4TA 2YWWA 1RT5A 2ZOMA 1RWKB 2YKPA 4KPCA 2UVUA 2E9TA 1GNKA 4MAKA 2FGCA 2DH7A 2M2BA 3SIPB 4LRDA 3IR7B 1HD0A 2GMHA 1TKZB 2O1PA 1SJ3P 1TMMA 3CJ4A 2NXJA 4MH8A 4CTAB 2W1BA 4N5SA 1VRQC 3KK1A 2B4VA 1HIYA 2RHQB 5J2MB 2HVEA 3L7PA 3MUVP 2AEMA 5ETKA 3QO9B 4C2MA 2DBBA 2AV5A 2XLKA 3BYRA 3BGRA 3ZZRA 4ENOA 3UVJB 2Z2ZA 4UOHA 1MWQA 3DRXA 5KFPA 2BZ2A 1N0VC 4M5GA 2D3O1 5KAKA 3OBIA 1DJ0A 3OFFA 4A8WA 4A8XA 3ISNC 4HT5A 3DLKA 4OZ2A 3ONQA 4O3OA 3U1NA 1S77D 4WKRA 2YNHA 3DRSA 2VC0A 2OP5A 3DYAA 2XZTB 1ZTTA 5ETSA 1YG0A 3R9LA 1S0NA 4DFKA 3TAPA 2GVDA 2XG8A 3DKDA 2RIJA 4FYYB 4HDHA 1SI9A 2ASLA 2ZBPA 1XMQJ 4XAKA 5E5NA 4CNZA 2XO6A 4ZKAA 1UMJA 2FVQA 4A8FA 1G7CB 3K58A 3UN5A 2HQIA 3JS9A 2GCFA 4C7QA 5MLCV 5ETTA 1B0TA 2J76E 1U1KA 3PJWA 1UL3A 4NOHA 1TK5A 4IDKB 2ZEJA 1IM4A 5EWGA 3R6LB 2HHWA 1S12A 1NJXA 4OL8A 2IM3A 2EG2A 5HANA 3QIPB 4NLVA 3H40A 1RGVA 1TTHB 2KVQE 2W9BB 2FLPA 2DYAA 4ZN3A 3CCSS 3L95X 2UUAJ 1RT6A 2YTCA 3P8BB 4HLBA 2FPHX 5B09A 3AB4B 2YNGA 4F4WA 3IG1A 3CO0P 3K59A 2QA4S 4F2SA 3FNNA 4CO0A 4B3OA 2UV8G 4RW6A 2RKIA 1WF1A 4DL0C 3PX4A 5FLXU 3I87A 1DFDA 1VMBA 2QJ3A 4RW9A 2H5IB 3FBEA 1Q79A 1BWVA 1XEZA 5FDLB 3MM9A 4DX5A 3QWUA 1U25A 4TKTA 1UVIA 1Q81T 2B43A 1NDPA 1S4EA 3M1VA 1AZSA 1FESA 4CZCA 1RISA 3A8IA 2QX0A 2HWHA 4EBDA 3N6LA 2IMOA 4F36A 2CJYB 1YI2S 3OVBA 1TL7B 1S1TB 3C2PA 3KNAA 2GJ2A 2MQ8A 2CPHA 3D6FB 2AWZA 1JLFB 1TL5A 2J9CA 1R27B 2J8SA 4F8RA 3LWMA 3LANA 3B78A 4OHXA 1H73A 1S9EB 4IYQA 2B4UA 5KFFA 3LP0B 4EMDA 1HYSB 3VAHA 1RB0A 3UN3A 3FBFA 2FYXA 4P73A 3H5UA 4UZBA 2VC1A 3CDBA 1VQOS 3W2VB 4CLFA 2LXUA 4ANDA 3N6NA 1JMTA 1K47A 3OW2R 2QFJA 3GJQB 2ZHBA 1HQUA 4OZ5A 1M5KC 4I67A 4DS4A 3LO3A 1IJEB 2HGNA 1ZYQA 1T7PA 4D3HA 1JIHA 1R0AB 2VICA 2JLEA 3OL9A 2E7XA 4QOTA 3AJ1A 3M05A 3CUNA 2AJ2A 2DY9A 2P2CB 4QZVB 1FRMA 2ZDOA 5LMUF 2CPDA 1PCAA 1TKZA 1SB6A 1X4CA 2HRYA 2DH8A 3R7BB 2UUTA 1HBMB 5HQMA 3PV8A 3NGTA 3QSYB 3P6YC 3OJUA 1RKIA 1WHVA 4CTAA 3WQPA 2NPFA 3VZHA 2LVWA 5CABA 2RDDA 4QR0A 2ZJRQ 2QZ8A 1SCJB 1X0PA 2MQQA 1D9FA 1ZM2A 4CM0A 3TANA 4EO6A 1GX5A 5IQQA 1SC4B 4D3GA 1ITPA 3QO9A 3SYZA 2FY1A 1SBRA 5AJ3J 1GQEA 1B7YB 1QDUB 3MM5B 2ZWOA 2V2ZA 2Z57B 3LGMA 3TA1A 3FJ2A 1F5AA 4KB7A 3UVJA 4LF9F 4JOUA 4ZPTR 1JB0C 2WOMB 2ROPA 2DNQA 4J9OA 3T1HF 2AGPA 2XS5A 2QYGA 2N4DA 1S1VB 4E0DA 1FRXA 3PW4A 1LXNA 3G82B 2BBEA 1S76D 3WHIA 1UVJA 2HVZA 1WKJA 3UDCA 1YJNS 4DWIA 2JEGA 1RCXB 4YFUA 2RH3A 1XC9A 2Z58B 4N7TA 2ZH7A 4DSEA 2A2CA 2VZ9A 4U8VA 2OH2A 2XULA 4Z7YA 1ZZNA 2KKHA 1OPZA 2JEJA 1S7HA 3O8WA 5C2CA 5KT3A 3O2IA 5KFTA 1UCNA 1VYAA 4CO3A 3UCZP 3MGJA 3HHEA 1Q16B 2UXCF 1H72C 2UUBF 3TR5A 2Q6CA
chains in the Genus database with same CATH topology
2H5EA 3WC2A 4LSNB 4ILLA 2KTQA 3BN4A 3M2RA 4TY8B 3FZBA 2W4PA 3D1OA 4AYBD 3HT3A 1BLUA 2V4QA 4DSKA 3BJYA 1J5EF 3J7YI 1NK9A 2I5JA 1UEVA 1WACA 2GHWA 4B3MF 2EBGA 4ERDA 3J80Y 4HH0A 4DQPA 1D1UA 2YVSA 1TV6A 3BZQA 3I82A 4GKJF 2KRBA 2XLJA 3CCJS 1Z2LA 2MKJA 5KFSA 4E8UA 3M8PB 2Y1JA 4OJ1A 2GMJA 2R7RA 5KTQA 4ZP9A 3VAJA 2BANA 2N7YA 1UWBB 2OTJS 1HI8A 3CDEA 2YKNB 4C11B 3M2UB 3U7JA 3T5HA 4IOAQ 3OXGA 1FJEB 4PXCA 2KXFA 5L39A 1TK0A 4IDKA 1B0PA 4U7CA 4G3IA 2J7KA 2LA4A 2HGLA 2IM2A 4C8KA 2BJEA 1NHUA 4N8OA 1N5SA 4YR0A 3OSNA 2KM8C 2CQPA 3Q23A 4DR5F 3DRRB 4OJGA 2C22A 4TU7A 1VBZA 3O1LA 4BC7A 2OSQA 1FRLA 1TKTB 1K1QA 3QIPA 5KFIA 4WXWA 1FJGF 3QGGA 2YH1A 1X4GA 1HPZB 3ENWA 1X4BA 1UFLA 1FDDA 2X3GA 4ICLB 3PEHA 2HNDB 2VD3A 3V6HA 2IM1A 4Q43A 3S7RA 4EFAC 1FTRA 1S1UA 4DR6F 3HJFA 2POKA 3CIZA 4DG1B 4JV1A 2NS1B 2DNOA 2VG6A 3GV7B 5B7WA 2A2DA 1R8CA 5B08A 4DL5A 2KDOA 2KH9A 1FKPB 4LIRA 5CQGA 5DGAA 2B51A 3QLHB 2MQNA 4BCAA 1BQNB 3IGVA 2QYCA 1HWIA 4IR9A 2XBPA 2RVJA 2VFTA 3MEGB 2JSXA 3FQKA 1VQ6S 3G96A 1R8HA 2JWNA 4F25A 4I7FA 4X65F 2FHJA 4DBQA 4C8NA 5D77A 1NB7A 3PKYA 1KLMA 5C24B 3GQCA 2FJBB 3MEDA 1ZPWX 1FA0A 3RB0A 5F41A 2JVRA 2WK4A 4I6YA 1R8BA 1FDNA 3MECB 2WHOA 4OQJA 2M70A 1LK5A 3U1LA 3LAMA 2YX4A 5CHCB 2M88A 5G0RA 4WFBQ 3BEGB 2RUGA 5E3CA 4A8SA 3RB3A 2HVIA 1VQ8S 3THVA 4ZCIA 4I68A 3J81Y 3TA2A 1Y7PA 4RU9A 3HZEA 2M3DA 4O3NA 1X5OA 2J7UA 3MMAB 1BQMA 2NSBA 5A8RB 4I69A 4J9RA 3NAIA 4Y2KA 4K4YA 3GIKA 2HNZB 3PO4A 1D8YA 5K8MA 2XWXA 3KHRA 3QZ8A 5B0GA 2C2RA 4PXBA 2LEAA 4NCGA 4Y28C 4DV2F 3NL0A 5GAEI 3JSMA 2P9GA 3QWPA 2KXNB 4G1IA 1QAJA 3NP5A 1R89A 5FDLA 2D9PA 2GGPB 3R1HA 2CKWA 3V6KA 2ZC4A 3NLCA 4CO2A 3TARA 2NXUA 1VRUB 2PE8A 4IRKA 4CH0S 3V6DA 5F3TA 2XSJA 3FFIA 2JZ5A 1RI7A 1OQ3A 4CQ1A 4WE1A 1RKJA 4LF8F 1IQTA 1L3TA 1YIJS 1HWKA 4AL5A 4O3QA 4X4SA 3KK2B 2E29A 4ID5B 3CCES 3FZ2A 4RW4B 2VPWB 2ASDA 2BR0A 4QCLA 3MOZA 2V94A 2YNFB 3T6JA 4RNOA 1VIOA 2GIRA 2YQ3A 5DJBA 3PEJA 1YITS 2HFZA 1NZAA 4DV5F 4ECZA 2PA3A 4ED5A 3L3CA 3I5BA 2DHAA 2AGOA 3VCDA 1V9OA 5K8OA 2KFZA 1RT7B 1SIZA 3LPYA 4CT9A 2QA2A 1KRPA 4OHWA 5GVQA 4CH1A 5GAGI 3K5MA 2MY8A 3I6PA 3M2RB 1U1QA 4OI3A 4EEYA 2B7CB 2PA8D 4RUCA 1S1TA 1HR0F 2B5JA 1BWEA 4Q8EA 1N5VA 3DXSX 3W7BA 2RS2A 2IAJB 2W9CA 1X5TA 3OPKA 2AX1A 2E44A 4KAIA 3NCRA 1JLFA 3HZGA 4YB6A 5D4NA 1U1OA 1N56A 2UP1A 2XS2A 3FMWA 1TL1B 5A6WA 2JEIA 1JLCB 2B6AB 2XY6A 2LU1A 1RWUA 3HLUA 3PFOA 4F3QA 2BANB 2DPJA 1S79A 3CD0A 4OV1A 3GSDA 4K5SA 3QJLA 4IFYB 2CPIA 1YGYA 2H9ZA 2VFSA 4PR6A 2VFRA 3HO1A 1W2IA 4ECQA 1RA7A 3EZUA 3M30B 4USIA 1VI7A 3TI0A 4NLRA 4FP9A 5CXTA 1S9EA 2HFOA 1KC8T 1R6YA 2PMZD 1F5BA 2WB1D 4ZCLA 4DSJA 2DT9A 3N5BA 1Y9OA 4XDDA 2J0XA 5E2QA 3GFXA 2XHWA 1PC5A 2VASA 3HPOA 2XCPA 3QGIA 1Q86T 2FLNA 4XDCA 3Q2SC 3LP0A 3KLIB 3MFHA 3PDNA 2R2TA 5D3GA 1DQ9A 3TAQA 1HYSA 4DV6F 3IWLA 1K8AT 1SH0A 2PN6A 4N47A 2W4DA 3MFIA 3TX8A 3BO3A 1HW8A 1S1UB 2WCXA 1JLBB 1FK9A 1P6TA 2LDYA 4ZMMA 1FXDA 2DGOA 1UVMA 2ZH3A 4QYRA 2CVEA 1TL3A 1X5SA 3W2VA 2WONA 2BQ3A 1Z4UA 2J6SA 2CDQA 4NLYA 3OUYB 3M8QA 4X4TA 4ES3A 2RQKA 1S6QA 2GW8A 3HHLD 4BS2A 1DURA 4DQIA 4WTYA 3V81B 1LW0A 2R8HA 4BBYA 1Q53A 1FNMA 3FVYA 3HHLC 3IAS9 1NNDA 4IQXA 3WBZA 3MURP 1KONA 1J2VA 3TOQA 3QZ7A 3SFUA 1KHWA 2DGXA 3CIMA 2Z2MA 2G9OA 4I64A 1K0TA 5HMXA 1KR4A 4C8OA 2MJNA 5F0UA 4AE5A 2RQ4A 4U6PA 3P96A 2AYEA 3DOKB 4NLUA 2ZH1A 4NCBA 4AQYF 2PI5A 3TYTA 5KFWA 2V8DA 2D74B 4GO5X 1IKVB 1VK3A 2K2PA 1WF2A 4QPTA 4DFPA 2AU0A 5D8HB 1AFIA 5G0RB 3DLLQ 2GMLA 5EX0A 3JYTA 1R0AA 1QY7A 3O44A 1M5SA 2CZVC 4R0EA 2NLWA 5HROA 3WX4A 3KHGA 4EBCA 2ZITA 2JC0A 3SCJE 4JBCA 3M6VA 3G6XA 3MAQA 2BUNA 1LOUA 2LEPA 2XNQA 4BWJA 5CZXA 2ZH4A 5SZTA 2DR7A 1M5OC 2J9DE 1RQ0A 4M8LA 4O4GA 4M5DB 1KOHA 1IJFB 4HEA9 4MKBA 2ADCA 3D5MA 4MKAA 4EYIB 3DLEA 4N76A 1FXRA 2F4VF 2ZZMA 2IHR1 3RR8A 3PX6A 1NJIT 1YRXA 2VA3A 2BE2B 4I56A 1S6PA 5M2UA 1Y3JA 3QPIA 5CD4H 1YTYA 1NK7A 1HNXF 1J5OA 3RAXA 1WEZA 3US5A 3SDEB 2MZTA 3IR6B 1HBMA 1NH7A 2IM0A 3MM6B 3CJKB 3TNVA 2K1RB 3G4SS 1SJ4P 2M5YA 3KG1A 3MM8B 5B0AA 1IN0A 3U1MA 5F8JA 3CO9A 1U45A 5F9LA 2I38A 1FEHA 1T3NA 3QGPA 2F9DA 1XMBA 4JI5F 2XCAA 4KRWA 3H20A 2HHUA 3BR8A 5K14B 4KJIA 3OHAA 4DL7A 4R25A 2DHGA 4K4SA 3LOUA 1M5PC 2IFXA 4JI7F 4O3SA 3HDSA 4ECXA 4O3PA 1TK8A 1Y5LB 5HO4A 1N4LA 1QTMA 3T5LA 4ZHRA 1S48A 2YKMB 4L72B 2RQMA 2DGTA 4PXEA 3OR1A 2PMHA 1A6LA 2BABA 3U27A 1VOMA 1YHQS 2KB2A 1BD6A 1TKXB 1XR6A 2UVWA 4HVZA 2HMIA 4KV8B 3SFGA 1X0FA 3HFKA 4OIXA 1R3NA 3DN9A 1HBOB 2CPYA 2MGZB 3GB0A 4DL2A 1EP4B 2R9LA 4DR4F 4K4UA 3DXBA 1Y4ZB 3MPWA 3G6YA 3UWTA 5CZVA 3MM5A 2V4JA 2MKSA 2MQMA 4WZMA 3SV4A 1IKXB 3V4IB 1FXLA 4EYHB 1FF2A 5KFGA 2RE1A 4OHYA 3HHNB 4DN9A 2W8KA 2MZQA 3NBPA 2FJEB 2JFKA 2XMJA 2EW9A 4J9LA 1U6FA 1YSJA 3KHLA 3OL6A 2WOMA 4ZVGA 2VUGA 4NLGA 1JLEA 2NPIA 1H2UX 3D1QA 3UR3C 2U1AA 3E2EA 3VQSA 4ZCKA 1S1VA 3JTNA 5F0WA 3OL7A 2DGSA 2BACA 4R0JA 5L1LA 4C3LA 3IFEA 2L08A 3BQ1A 4B9VA 4KC5A 2KN4A 1ZETA 2QA1A 4FZVA 2UUWA 4ALZA 2VG7A 5DO2A 3RU0A 2DK2A 2CJQA 2CQCA 1KQKA 5HP1A 1H2VZ 1M90T 1TP7A 3D1HA 3DDKA 4ZPWR 2LQBA 1T05B 4R8UA 3PM9A 5CCLA 1LW0B 4PUOB 3NRBA 4RW8A 3GIIA 2YNIA 2AQ4A 2ZNZA 3MR3A 2ROGA 1ZOTA 4J9NA 2I1RA 4JI3F 1XN9A 2MQOA 1QSYA 4Q2LA 1HQEA 1PSDA 1I1GA 4DR2F 1R8AA 4ZPBA 1SXLA 4ED0A 2MZRA 1AFJA 2J8AA 2CQIA 3TA0A 1X4HA 1Q1KA 4Y34A 3J7Z5 1P9QC 3KLGB 1C0TA 3KK3A 4K0KF 4MIBA 3K5NA 5JVGQ 2R7TA 5LXRA 1SJQA 2XMUA 3D2WA 4K4XA 1FRJA 4J5OA 2W7OA 3RB4A 2B9YA 3BDPA 4QWBA 2HHTA 3BO2A 2DJWA 3THPA 2CQ2A 2DNPA 1NK0A 3PNIA 2IYGA 3OVAA 3JYTB 3B4DA 4ZPCA 4XPEA 5KT2A 1HNIB 3UE2A 5I3PA 2WBRA 3LALA 1MWYA 6FDRA 4NXNF 1U4BA 5L9XA 3CCLS 1XMOF 2DVIA 3I4PA 5FD1A 2QSFA 2VONA 3SSSA 4LSNA 1E6YB 4DR1F 4TY8A 3H8YA 4JYAF 4OI0A 1X4EA 4CO1A 1YJUA 4IRCA 2VKZG 1XR5A 1S1XB 2VPXB 4Q45A 4NLSA 1WTBA 3C46A 3DMJB 2F3JA 5EWEA 4A8QA 5H9EJ 4F3OA 1S6PB 2U2FA 4NA3A 2DO4A 3AA9A 2RDIA 1J5OB 4ED6A 2GO8A 5HI7A 5KG2A 1IKYB 4DPOA 2KM8B 3KMSA 1UWBA 2J0QD 1PO6A 1F0XA 3V6JA 4RLEA 2YKNA 4C11A 1RA6A 3BSAA 3M2UA 4ECYA 2OPPB 3NNAA 4LUBA 2VG5B 4ZCMA 3UNGC 4Y6IA 2XNRA 4HI2A 2EPIA 3D0IE 5B0FA 3J7A1 2RB7A 4O23A 5KT5A 2DNKA 5EX3A 1N8RT 2E9RX 1LFWA 1MW7A 3DRRA 4OZNA 1LWFB 4H4MB 1ZBTA 2L9WA 5H9FJ 2MSSA 1TKTA 4LF7F 1W25A 2R4FA 4MJKA 4QYZJ 5KFXA 2JOQA 2I2YA 3O5TB 1S72S 3K5OA 2EC0A 1HPZA 1NK6A 4K59A 4ICLA 2GJIA 3RW7A 2VOPA 3NGDA 4C8MA 2D3OR 2AJ4A 2HNDA 3OR1B 1JLAB 4IH6A 3OTOF 4J9QA 4DSLA 4Q44A 4DG1A 1H7WA 5JXSA 2RF2B 4F4YA 4X84A 4ZVEA 4WU2A 3SV3A 2HMIB 1YJTA 1KHVA 3JAMY 1HWJA 1FKPA 4ECVA 3SQGB 3MPYA 4OMFG 3KLFB 3MR2A 2UV8A 1PGZA 4DSIA 2HIQA 3QLHA 4WFNQ 1R8PA 3TAMA 1BQNA 3BDEA 4DLGA 4OI2A 2N82B 2HW3A 4OZJA 3ZZ0A 4X4VA 3MEGA 4RNNA 2KZMA 1FRIA 3IC1A 1KOOA 2ZM6F 5C24A 3E01B 3FSIA 2FHMA 3GE9A 3M6XA 6FD1A 1HFEL 4KKOB 3IWNC 1QJHA 2ZD1B 3MECA 4OI6A 4ED8A 2DR8A 3AQOA 4ZPAA 4AUKA 2KXHA 4IO1A 3L7OA 2I9SA 1FTCA 2DD8S 4UUXA 5T7LA 4G6VB 4UY8T 4ECTA 4WZQA 1XNQF 1FT8A 1HNVB 2ASYA 2BW2A 3DDNA 4A4JA 3GIMA 3BN7A 2IA0A 1NU4A 1LV5A 2MKKA 3RRHA 5DRKA 3M6UA 3U02A 1NAQA 5A8RA 3M32B 3VAIA 3DRPB 4ZS6A 1H0HB 1CQNA 5J2QA 3TVZA 2ACYA 3FCHA 2HNZA 2NUUG 3VZIA 3GYXB 4TQSA 5A8KB 1A9NB 2M9KA 3I32A 1ULRA 2WB4A 1O0PA 3NCQA 3IRXB 4QW8A 2YNIB 3SMZA 1RTHB 5C42B 2ZHAA 3RTVA 2CQDA 4IR1A 1SKRA 1LK7A 2GGPA 4NCAA 1DLOA 5LSRA 1T8EA 1VLYA 1CLFA 1P1TA 2WW8A 2ZOFA 4C8ZA 4C0BA 1VRUA 3FMBA 5K8PA 1C0TB 4FF4A 1XNRF 2JRSA 2XMVA 1YJRA 1NKCA 1JKHB 5BYSA 2HHPA 2DGQA 3DI6B 1H3DA 3NNHA 2XGPA 1RT4B 2R7VA 2IVFB 5J2PB 1C1BB 5KT7A 5BR8F 4NPOA 1S0VA 3KK2A 3JSRA 4KIAA 2HVHA 4RW4A 5E0OA 1HI1A 2OPRB 1JXLA 3I9V9 2XS7A 1QE1B 2C3UA 1HHSA 4YB5A 3PW7A 2DR5A 5JJBA 3DNCA 2ERRA 2IRYA 5KFVA 3ITHA 4IH7A 3MUTP 4XO0A 4UOCA 1RT7A 1T03B 4YHHF 2HZCA 3N01A 2G1DA 5F8NA 3CEDA 2ZBIA 4X64F 5KG7A 3OJSA 3G71S 1Y5IB 4OZLA 5AE1A 4DEZA 4Y65A 1AXQA 2LLZA 2IAJA 4NA1A 3M9OB 4MIAA 4KHPF 1CG2A 4WFYA 2B0GA 2ZUGA 3QJPA 1TL1A 1TVRB 1JLCA 2B6AA 2MB0B 1SL1A 3UDLA 4GC6A 3HK2A 5I4MA 4LF5F 3LP2B 1GXLA 1WI8A 4ELTA 3QAEA 1RAJA 3VQTA 1U24A 5CCMA 4IFYA 4PG4A 2KRRA 1RJJA 1WG1A 1P8GA 4WU3A 3M30A 3CJ3A 3DOLB 1RT3B 4EZ6A 3IRWP 3N9UC 1UFWA 3OSPA 1K73T 5KFKA 3KYLA 3EGNA 1HA1A 1G1XA 4X66F 1UVNA