4JI6F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 19
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji6F00
1HNWF 1VMBA 5IWAF 1RISA 1CQMA 1IJFB 2UXCF 2YY3A 4JI6F 2UUAF 4DV3F 4DUZF 4JI7F 2VQEF 1QJHA 4DR4F 4X66F 4DR7F 2UU9F 3T1YF 4B3MF 4AQYF 1CQNA 4DV4F 2B7CB 2KJWA 1IBMF 3R3TA 2ZM6F 4LF8F 4X64F 1IJEB 4DR2F 2UUCF 4DV5F 4GKKF 2UXBF 4YHHF 4JI4F 1B64A 4DV7F 4DR1F 1HNXF 4JI0F 1N34F 1G1XA 1IBLF 1IBKF 1XMOF 4JYAF 4DV2F 4LF5F 4DR3F 1N33F 4DR6F 4LF4F 1HNZF 2HHHF 2UUBF 4LF6F 4X62F 4K0KF 1HR0F 4GKJF 2VQFF 4DV6F 1FJGF 2BVZA 5AJ3F 3ZZPA 1GH8A 5LMNF 1I94F 4JI5F 2UXDF 2B7BB 3T1HF 4X65F 2KJVA 2E5LF 1FKAF 1G7CB 1N32F 1J5EF 4JI1F 4KHPF 4B3SF 4LFBF 4B3RF 4DV1F 4YY3F 3OTOF 4LFAF 4NXMF 4NXNF 4DUYF 4LF7F 4LFCF 4JI2F 2RJZA 4LF9F 1F60B 1XMQF 4DV0F 4JV5F 4JI3F 5LMUF 4OX9F 4B3TF 2F4VF 4DR5F 1XNRF 5BR8F 1N36F 2J5AA 1XNQF 2BXJA 1LOUA 4JI8F
chains in the Genus database with same CATH superfamily
2XWYA 3M8SA 4DL3A 2R4FA 5MLCV 1TKXA 3C66A 4I2QB 2D3OR 1CSJA 1XMBA 4GKJJ 2J0QD 3CF5Q 3LP1B 3NMAA 3D3CJ 4JUZA 2HZCA 2X1GA 3VAIA 3QAUA 2J7WA 2KVIA 3E3XA 5KT4A 2IAJB 3PNIA 5ETMA 1S9EA 1VRUB 2CWKA 3PRBA 3L09A 4QIGA 2ZBIA 1DARA 5L1LA 3T1YF 1UJ6A 1KD1T 1C1CA 2CNLB 1RT4B 1NLKL 2AJ4A 4QPTA 1HNIB 1WTBA 3ISNC 2H65B 1Y3JA 2LQJA 2KU7A 1R8BA 2CQ4A 5H1SV 3KHRA 4ZOSA 1T03B 2DNYA 1S6OA 1OMSA 2MB0B 3ILLA 5KFOA 3W63A 3KK3B 5AE3A 4JYAJ 1C1BB 1HBMA 1HWJA 3RR7A 4CH1A 4M1KA 2DGXA 2CAJA 4DPOA 4EU0A 2DIUA 2Y8WA 1VQ9S 1P27B 4DSIA 1R27B 3GFZA 5H9EK 2B6AB 4R8UA 4ZCKA 2HFOA 5L1IA 1F3FA 3KHHA 1WHWA 1KTVA 1T94A 1RT7A 5GADI 4EZ9A 3LP0B 5IC4B 5KFSA 5I3UA 4NYPA 3QRRA 1YITS 2O1PA 4G1IA 2GVDA 4KR0B 4XPCA 2VOOA 4I6AA 2H48B 4LR7A 4DN0A 2HAIA 1IBLF 2OMOA 4P73A 2W9AA 1TVRA 1FA0A 1L3KA 1UEVA 4F4WA 4DCJB 4F4YA 2VG7B 4IRKA 4MMOA 4C98A 2YWEA 2EBEA 3PKMA 2E9RX 3QGHA 2EEYA 1JLCA 1WKLA 2PT0A 1QUVA 2ZH4A 3NXZA 3IA0A 3IWLA 2E1AA 3MPVA 3OR1A 3ILOA 2BM1A 2DVIA 2R3VA 1NAQA 1Y5LB 2BYCA 1FNMA 4WFXA 2CQ0A 4HHJA 1U4BA 3MM5B 3QZ8A 1SUQA 2V69A 2DKOB 3O6QA 2AWZA 4LSNB 3BBBA 2I8EA 3LW5C 5KT3A 1R6YA 2BJEA 2I5JB 4IQXA 3AY0A 1OPIA 2GVZA 1NU4A 3IGVA 4MT1A 2AJ0A 1XTZA 3BH6B 4IRCA 1K8AT 4ED4A 1PSDA 3AXKA 3OL7A 5F8JA 2W2OP 1FWPA 1LWEA 3HM9A 2VDIA 4HVZA 4OI0A 5EX0A 3U1MA 4ZLPA 3CCUS 4WE1A 3QIPA 3M8PA 5KT7A 3D1QA 5KFIA 2QLWA 1FDNA 2ZH8A 3MEDB 4L76A 4MFBB 1S7IA 4H4KC 4QW8A 3GFYA 5B0GA 4B9VA 3C14B 1FKPA 3HZGA 3I0RA 2DEJA 3U27A 4DL6A 1IBKJ 1Q7YT 1F2GA 5HROA 4C7QA 4LFAF 1S1WA 3BJYA 2ZZNA 1GTHA 1RT2A 2VC0A 1S0MA 4FYYB 4DSEA 1GMVA 4IG3B 4TKTA 2M2BA 2ZHBA 4YHHJ 1XMQF 1F9FA 3SSQA 5AE1A 5J1EA 3GJRB 5IV4A 3I4PA 4RW6B 4WXWA 5KFZA 5A8KB 3CE8A 3PTWA 3M9NB 3Q0AA 1TKTB 4USHA 2KFZA 2XMWA 2ZD1B 4DR4J 2GS8A 3D6TB 4ZVHA 4CO1A 2DNOA 1VQ7S 4D3GA 1S6QB 2VDHA 3T5HA 1P8GA 4HH0A 1S0VA 4PXEA 3O2IA 1R8AA 1VI7A 3DLGA 4KQZA 4PG4A 2Q3PA 5IWAF 2VL1A 4CP5A 4XTTA 5AXNA 3G6VA 2DPIA 3BBFA 2VFTA 4QYZK 1RTJA 4GRSA 2YKOA 2V4RA 1GMWA 2K3KA 2PGCA 2NR0A 4WTYA 4DXLA 2E1RA 4CYUB 4BBYA 1UPPA 1VK3A 1RAIB 2D1CA 4QWBA 5AJ3J 4C8ZA 4DR7J 2YNFA 3B82A 2JWNA 2AJQA 1L5UA 3DGVA 3M2UA 1VLYA 4A8KA 2OELA 1NK4A 1HWKA 1FE0A 4DV4F 3SFUA 4IR9A 1MWQA 1PKUA 2P2CB 1KDNA 5DG7A 1U49A 4WU2A 4E0DA 2F8HA 4PXBA 1CJKA 2ZH1A 1GFWB 1XIQA 2KHCA 3HPOA 1HA1A 3V5RA 4U7CA 1FESA 1RQ0A 1WI6A 1MWYA 1ZPWX 3AODA 3BO3A 2K06A 2CNOB 5KFXA 4ZIWA 1R8HA 3R27A 3GLJA 4E2FB 2DO4A 2F1FA 6AT1B 4KE5A 4KO0B 2FJEB 4AUKA 5L8RC 4ED7A 1VQLS 5I42B 1WOSA 2Z57B 1FJEB 1Q16B 2CJQA 4DR3F 1K0TA 1EKSA 1LWXA 2WONA 4ELVA 1KHWA 4R25A 4RBVA 2QYGA 1X4EA 4ZLLA 2UUBF 7AT1B 3I82A 4FYDA 2DIVA 3TZXA 4PWDB 3G6YA 2KN4A 1TMMA 3M8QB 4QIFA 1TL4A 4ZVSB 3RZAA 1FJGF 1MWZA 4U95A 4M5LA 4B3MJ 1XQIA 1RGVA 2ZZTA 3BGRB 3PJ9A 1Q1KA 1YJUA 1AZSA 3N5BA 1S99A 1UW9A 1WEZA 5K8MA 5HMXA 3NGDA 1H2VZ 3GIKA 2XSJB 2NPIA 1VBXA 2CQDA 3TEHB 2DNMA 2CFXA 1NZAA 3V4MA 3CC2S 3G2XA 4RU2A 1SPBP 1UTAA 1YJTA 2AV5A 3KYLA 3PIPQ 4DQSA 1DQ8A 5CABA 4Q45A 2W8KA 3DRRA 3KLIB 3JTOA 4CLYA 1PC4A 3ZTPA 1TL7B 2RQKA 1J5EF 4B3OB 1WKJA 3BS9A 1X0FA 2JVRA 2XQCA 2UUBJ 2F8EX 4ILLA 4DOZA 2N82B 4B3SF 3DOKA 2EFNA 3MZIA 3ZTRA 1N5YB 2J9DA 1IKWA 2ATCB 4DF4A 3NCQA 3MFIA 1APSA 1ELOA 2V8VA 1UJ5A 3OTCA 4OJ3A 3H90A 3OHBA 3NKYA 2V4JB 2WB4A 4ZPWR 3MM8A 1X9SA 3NEKA 4JI4J 3A3OB 3M2RA 3HVTB 2R7UA 4LRBA 4YUDA 3OSNA 4GMKA 3OJUA 1KSPA 4O3SA 4LSLB 1FXDA 3R1HA 2GCFA 1BY9A 1R43A 4O4GA 4F4AA 5IXUA 5KAKA 3PEHA 5GAGU 3GIRA 4ETZA 1HI8A 1QM9A 1TP7A 2IBOA 2QZ8A 3TVYA 2BXJA 3M8ZA 4IKAA 1RLDA 2VG6A 4IH5A 1LOUA 4J91A 2J0SD 3UFCX 3TQ1A 3OD2A 4DX8H 2L48A 3DRSB 1ZBTA 1T05B 3DM2A 4PZVA 2E5LJ 2M5YA 4DR2J 1AB8A 1ZAWA 1NJIT 2D9OA 1HQEB 1NXIA 1IR1A 2M3DA 3GTYX 5B0FA 2RIJA 4AFFA 4J9MA 3OR2A 3EGWB 4IOBA 1BGXT 4HTIA 2QLXA 4RW9B 4FP9A 4Y34A 4DL0C 1WORA 3QFWA 2DNGA 3J81j 1DTTA 2HMIB 4UZCA 1GXTA 1R8CA 2R2RA 1S9GA 3A3NB 2G1HA 2AJ1A 1H7WA 2HNYB 3BR9A 1S1XA 1VR6A 1RTDA 3MXHP 3HD1A 1RT6A 1WHXA 2HZAA 4G1QB 4KV8A 4Z7CA 1LQ9A 3RTVA 3TOQA 1TKDA 4JI8J 1KR4A 1YZ7A 3I31A 2EFPA 5HANA 5C42B 1VDHA 1YBAA 2J7UA 1HHQA 3FMWA 3HHLC 5D4PA 3SCKE 5CAAA 2YKQA 4P74A 1R8PA 4ELUA 3DLEA 2LQ9A 3CD5A 1FERA 3C15B 1SV5B 2HIYA 3CVKA 2L9WA 4IFYA 4OI6A 2CADA 4YHHF 2MXYA 4UT4A 1EETB 1YLXA 4DR1F 3S1TA 1UWBA 3RB0A 2CJKA 3SIPB 4OI1A 4NA1A 5GMKa 3ZTOA 3CULA 3R2DJ 2V4QA 3FBCA 3OXLA 3FSXA 1C0TB 2LU1A 1FFGB 1OSCA 4V19J 5C2GA 3JSMA 3IC1A 1RHJB 3TRGA 4F7VA 3DKDA 1HPZA 1JJHA 3DCAA 2IRUA 1FDAA 3HZEA 4P7TA 4P71A 4DX5A 3LOUA 3V4IA 2HQCA 2FY8A 3DC2A 4J9OA 1YBUA 3RRHA 2VA3A 2OPPA 2W2PP 2CJAA 2D3UA 1TKZB 2GX8A 1P1TA 2V2QA 3C16B 4UOHA 3PX6A 3FK4A 3MUMP 2OTLS 2VQFF 1T9VA 1U8SA 4OYPA 2P6SA 4J9QA 2GHPA 4NI2B 1S12A 4DSJA 1CS4B 3I5CA 3IMQJ 5DRKA 1MW7A 4IYQA 3JS9A 4MK8A 3FCVA 4PQAA 2VIHA 4YOEA 2DGUA 2E5JA 3QATA 1FI4A 2IM3A 4WP9A 5DQIA 5LT5A 3W60A 3QGGA 2ZHAA 1C0UB 4M5MA 5ETPA 1O8BA 3BV8A 4K5RA 1RI7A 1PAEX 3AD9C 1Q8KA 4ZLJA 1RT1A 3CJ3A 4RLEA 4O3RA 4WWSA 5KG0A 4ZVGA 2V94A 3M2VA 1ZA2B 1KFDA 1WOPA 1RTHB 3A8IA 2CPYA 2IRXA 4Y0FA 3Q8SB 1OSDA 2MZQA 4HHHA 1K73T 1SIWB 4BC7A 1IQTA 1O0PA 1LW2B 4G1PA 3TX8A 2M8HA 3W5YA 4J9PA 1M1GA 3US5A 1NK8A 4D3HA 1BUXA 3PDNA 4NCGB 4DPWA 2KB2A 3W2WB 5JVHQ 2DRAA 2V8DA 1FHTA 3CJKB 5L1KA 2EK1A 2L3MA 2JZ5A 4W90B 1N88A 3GILA 2HHTA 3AAWB 1PG5B 1SQFA 2AU0A 1U1KA 2DNNA 4X4NA 1O6XA 1NKBA 2FZGB 1R89A 2DNKA 4TN2A 2R7XA 4Q8EA 8AT1B 3B8HA 3KJFB 5IQ6A 1EQMA 1GT8A 2H1YA 3SDEA 4NXNF 1UVIA 4LFCF 3M32B 4KV8B 1Z1ZA 4FVCA 4OZJA 2ZZMA 3QZ7A 3C6UA 2XZWA 2DNLA 2CPEA 1JJ2R 3P3DA 3FNNA 4R5PB 1ICEB 4JV5F 1BE4A 1JLAB 2DBBA 2FHOB 2HFSA 1JLGB 2MSSA 3VGSA 3U1LA 5M2UA 5FLXY 2MQNA 1Q78A 4LF2A 3KUGA 3PW0A 1VQ6S 2NXCA 1UEKA 2GHVC 2QX0A 4KHRA 4BLGA 1JK9B 4IH6A 2J5AA 4ANCA 1HNXJ 4C3LA 4DI6A 2VQEJ 1NK6A 1T0TV 3VWSA 3KK2B 1XBWA 3FBEA 3DGPB 1RYRA 3Q8YA 1LEOA 4P2MA 5A2QY 4OZ0A 3KDNA 2CPZA 3MD3A 2M9KA 4QWEA 2BX6A 4QR1A 2UXCF 3V81A 1YWXA 4XDCA 4U8YA 2CDRB 2HS0A 2R7TA 2MHEA 2Y1IA 3G82A 2JJ4D 2WRMA 4LSLA 4N41A 3MEEA 1KVKA 2CG4A 1HFEL 2NLWA 3W8GA 2AJ2A 2GFFA 3M2RB 4KY3A 4NEYA 3M8WA 2PDAA 2FY1A 3UO0A 1IKYB 4KSEB 1HW8A 2GAHC 2XTJP 4I69A 5J2MA 4OYMA 3R7NB 1OS5A 2YWWA 3MDFA 1YJWS 4AXIA 1NSPA 3I9ZA 1M5KC 1IJEB 4K4ZA 3AXMA 2QL9B 3OTEA 2LEAA 1JLQA 3CPWR 2DK2A 2WCXA 3OBIA 3BBCA 4FKXA 4DV5F 2H4WB 1N5YA 2FVQA 3NNCA 1JLQB 2PI5A 1LXJA 3THPA 4LF9J 3DMJA 1U1NA 4ILRA 3JSBA 4FS1A 1GEHA 1HBUA 1WDTA 2CJXB 4EZ6A 4B3OA 3UN5A 1BQNB 1V5VA 4KKOA 2QLFB 2EPIA 5T7LB 2ZOFA 3F41A 4H4MA 2E9TA 3KHGA 1YJVA 3NMRA 3N5FA 2BM0A 3I87A 3VGTA 1IR2A 1N54B 2KRBA 5L9XA 5HLFB 1U45A 4Y3CA 2UUCJ 1NDPA 3N0VA 1UEUA 2Z2ZA 2V6AA 5DS7A 1JWWA 4NXMJ 3WC2A 2P5VA 2RDIA 5AXLA 1QE1A 1T95A 1VQPS 1HWLA 1NK5A 2DGQA 1B70B 5EWFA 2J6UA 9ATCB 4L3KA 4JI5J 1E6VA 2HIQA 3D6MB 2FPHX 3JQMA 2ASDA 2CJYB 1NSQA 2CQGA 4RUCA 1LXNA 5DDPC 1D8YA 3SQGB 2IA0A 3ENQA 1N5SA 2KFNA 1KN6A 4A8FA 4BC9A 2F40A 2H5EA 4K0KJ 2Z30B 1XNQJ 2HHSA 1Z2ZA 3ENWA 3S01A 4X65F 1CC8A 3D0GE 4OX8A 4R5PA 1L3VA 2NZCA 4LUBA 3K8VA 3HT0A 4ECUA 5DZ6A 5IWAJ 4PRFA 3I0SA 4DR5J 1FKAF 2V2KA 2VD3A 2UZAA 1X9MA 1YDLA 4Y28C 4LR8A 4TLRA 3LP2A 3HSZA 5F0UA 3M9OB 3Q2TC 3H8YA 5IT4A 5KFUA 4NLRA 2OPRB 4Q2MA 3RBZA 5F8IA 1FRJA 1ZH5A 1Q8BA 2DNPA 2KXFA 3BKTA 5KT2A 3CJKA 1NJZA 2GQQA 1QSLA 1Q95G 1WDDA 2LU2A 2DH8A 1V3SA 3OFEA 4GO5X 2R7SA 1S10A 1RHRB 4YY3F 4ED1A 4GKKJ 2XMTA 2IY5B 3IFEA 1S1UB 3GYXB 2XEXA 2V2ZA 2YPYA 2RDDA 2CPXA 4LR9A 2QMWA 3M8YA 3R5CA 3BQ2A 4LF9F 4ZPAA 4LIWA 2VU5A 2A2DA 4KGVB 1U2FA 1BQMB 2FHMA 3ZZOA 2M8DB 4OX9J 1FVQA 1VRQC 2AX1A 5ETQA 4NLOA 4ED0A 2HNZA 3RB3A 4DWIA 3JQJA 5KT6A 1CEZA 4UOFA 1HQUB 5E3PA 3AHPA 3B54A 2H3EB 4ZHRB 3MUTP 4DFJA 4X4PA 3UD4P 1VC6A 1NKEA 1YJNS 1OYEA 2XC9A 1QAJA 4C9DA 3PVXA 3QQCD 3D6FB 4KBIA 2JLFA 3TUPA 3M9MB 4A8WA 4ILMA 4N77A 1S72S 2ROEA 2DXFA 2DR7A 2QFIA 3MM6A 4OV1A 1HQ2A 3CNQP 2BJ7A 3FFIB 5GAGI 2B43A 1REVB 2UUAF 4USMA 1RUSA 4AYBD 2X1BA 1X4AA 1WWHA 2MKYA 4F3MA 1JLFB 5CHCB 3JTPA 3MPYA 4NZ7A 4ZA1A 5A8KA 5KG6A 3U7JA 5C5JA 1UCNA 2HFNA 4X66F 4NYOA 4AQYF 4H4OA 2FJBB 2XS7A 2RKIB 1B3TA 2KVQE 3MFHA 4HI1A 4FPIA 2R2TA 1JJ4A 2VJUA 1FE4A 1FEEA 3DHXA 3DYAA 3KWMA 2VFRA 2GA7A 2VPWB 2OO4A 4JB8B 4K4UA 4Y2MA 4USVA 1FKPB 1FTCA 1OPZA 2XO6A 2R7WA 1VOMA 2V50A 3OQ2A 3VALA 2GMJA 3DLBA 3MEDA 4MFBA 3GONA 2OEKA 3IBCB 3JYTB 2ZWPA 3FZ2A 1LWCA 4G3IA 4F2SA 2RQMA 3LAMA 1IWAA 1TTHB 2JHEA 3D1HA 3W2VA 2P9CA 4ES2A 4DF8A 4TYAA 2HZVA 4M94A 3MR2A 3KNAA 2JLGA 3CJ5A 2APOA 3TJ9A 2FVCA 2ATLA 5B0BA 1N36J 2JC1A 3HHLA 1J5OB 1RBAA 3TJAA 3TVKA 2RVJA 1S9GB 1UAWA 2GVZB 2W2NP 2R7RA 4K5SA 1YK9A 4DS5A 2R8JA 2JX2A 4O44A 3QJPA 1UZDA 4JYAF 5HBMB 2HLTA 3CT9A 2DNQA 2MQOA 2LMIA 4RW9A 3DU6A 2DH9A 3KUHA 3JSYA 2E9ZA 4DBQA 1R31A 2Z8QA 4CNZA 2GV1A 1PILA 1NM2A 5LL6d 2BABA 4LMZA 4K0KF 2RUSA 3W3SA 3MUVP 3NOGA 1HR0F 3LF0A 1YKWA 3RRGA 3AFGA 3S7RA 3DRSA 1JKHA 3Q89A 3SSRA 1Q8IA 4X66J 4CQ1A 4CM2A 3CJSA 1T05A 1FJ7A 3ZTSA 1HBOB 2WBMA 4OHYA 4B9UA 5CYQB 1SJRA 2JNJA 1YBTA 4PPZA 5M2RA 3CW2C 6FDRA 4UUWA 1REVA 2X1FA 1VIOA 4ICLB 4MKYA 3OSPA 3MM6B 3UN2A 3GSDA 1WD6A 2MJUA 4RBTA 1M5PC 2JL9A 2C3YA 2DJWA 2VKRA 1M1KT 2HNDA 2OHDA 3TWZA 4TLQA 3NG8A 1JLBB 3QMQA 5I3UB 3UNYA 2LCWA 4ZHRA 2DGTA 3K5NA 1RT7B 2DYAA 4L72B 1WELA 2UV8G 2JEFA 2KM8C 2LVWA 4ED5A 3H0PA 4OHWA 1I94J 2B6AA 2AT1B 3T6BA 4CO5A 3M30A 2ZHOA 5K14B 4IOAQ 1S1TB 2BACA 4HEA9 2HW3A 3GJQB 3D6HB 1WC0A 2CIMA 2FHJD 3VTIA 2QL7B 2C2MB 2MTLA 3Q86A 3PW2A 1WF1A 1T9XA 3BGUA 5A8WA 4PUOB 4C0HA 2QA4S 2PMWA 5EDWA 2H5JB 4URGA 4K7QA 2F9DA 2ASYA 1OY9A 2FD2A 2HBZB 2H9ZA 1HNIA 4C8YA 4RU9A 3KLIA 4EK2A 2IBKA 1XNRJ 2YPZA 2MJNA 3A12A 3O44A 3OTOJ 2BA9A 2C3PA 2HBRB 1WG5A 1R7IA 1IUJA 3FC9A 1VYAA 4R0JA 2MLZA 2HKEA 3E2EA 4A8OA 1Y11A 4HHUA 4USIA 3C2PA 2NXEA 3KFWX 2XCAA 2DGSA 2DTJA 1VQMS 3EICA 2FVRA 4IFVB 1PJ6A 1ZZNA 3LQVA 4M95A 2OMLA 2AMCB 3UR0A 2P9EA 1EKRA 5K20B 1Y0HA 3IG1B 1RTDB 2GO9A 5ETKA 5GADU 4X65J 3GG0A 4HTJA 1Q8LA 2YY3A 4PYDA 2LXFA 1DBDA 4RWXA 2YX7A 1M5OC 3HVAA 4KGZB 4QU6A 3SQGA 2RT3A 3TANA 2SXLA 4DUZF 3HT3A 1NK7A 1AW0A 1OQ3A 3QBCA 2FGOA 1TAQA 3TA2A 2YKNB 2VQEF 1NJXA 2OJ3A 3HX9A 4HI2A 4KJIA 1S97A 4YEAA 3MMAB 2E1PA 4A8XA 4F0KA 2XI3A 4KO0A 2G4BA 2NQPA 5GAEI 2W7OA 3KLFB 5D4NA 1CQNA 1MG7A 2B5JA 3BPSP 4JV5J 4U67Q 4ED3A 3HF5A 1FKOA 3HP6A 3A8EA 3PKYA 1RYSA 3LO3A 4UZBA 1TL3A 1HI0P 4TVAB 2VA2A 1JJCB 1UFWA 1DHMA 3TVZA 1WTFA 3W9HA 4JBCA 6FD1A 4EEYA 5L9NA 3LGMA 4GVBA 3Q8RB 2J76E 2RE1A 3FSIA 4OYIA 3NBPB 1V5IB 5I3PA 1FFSB 1X7VA 2FGCA 3ZO7A 4QBUA 1HBUB 3AD8C 3W8PA 1FX2A 2K8GA 3GV8B 4ECQA 2VH7A 3KK1B 2XMUA 2RS2A 2PA8D 3LH2S 4TU9A 2FHKA 4AT1B 1Q86T 3OVBA 1MNEA 3M2UB 1YGYA 2GAGC 1KLMA 4ZCIA 2QA4G 5KFAA 1IBMJ 4Y2CA 1G2EA 3AT1B 3ISZA 1PCAA 3MGJA 1BD6A 4N5SA 3VAJA 2AF6A 2J9EA 2ZE2A 2EBGA 4PAAA 2NXUA 2HGLA 1B0PA 1SJ1A 4CDIA 1U6ZA 1Y00A 4X64J 2WVEA 2A18A 4GC7A 4DQPA 5J2MB 1HNZF 1YRXA 4UUXA 4HT5A 5DLFA 2LECA 4ZVFA 3W64A 3POTA 2O3DA 2VC1A 3DFEA 3WC0A 3VQSA 5HMZA 2V0NA 3P8BB 5KFNA 2YX4A 4PKDB 2E7WA 1NJWA 1NKCA 2OIHA 4RX6A 1RABB 3PV8A 1KC8T 3BKUA 5ETOA 4P2FA 1FVSA 4YR3A 5HP1A 2IVMA 4DQIA 4DX6A 1AYEA 4OYOA 3WDOA 3EPIA 2HHWA 2OUGA 2HK2A 3G87A 3DOLB 4I67A 1G4CA 4YN3B 2NXJA 1CPZA 2KI2A 1RCOB 2GJIA 3DOLA 2Y0SD 4RW6A 3M6UA 2IDLA 3SFGA 3J80Y 1VHIA 4MKVA 2H4YB 4KFBA 3FBFA 4DHVA 5GMEA 2YXLA 4LREA 2QLJB 1N32F 1BMQB 1RT2B 3G71S 4WYLA 1NSKL 1S1WB 2HHHJ 5F3TA 4ECYA 4NLPA 1RB0A 1X60A 3G86A 4RW7B 1HI1A 2VFVA 4ID5A 3H2UB 4L6V3 2LEPA 3P6YC 3TNVA 1KS2A 2ZBCA 3EYZA 1VRTB 2HAFA 1FCAA 4E8UA 2Z2MA 4FXVA 3HHLB 1RBOB 2DGWA 2ZDPA 4ER8A 4OYAA 4NYZA 3ZZYA 4YR2A 4NXMF 1O5JA 2IM2A 1X5TA 2AEJA 4JI2F 2EFQA 3W7BA 1T9YA 1VLOA 4RW4A 1HD1A 1XMOJ 2RQ4A 1I51B 3MEGB 1X4FA 4I68A 3D66A 4K4VA 2LXUA 2HVDA 4RJVA 5BR8F 3D7SB 2LDYA 2LQ5A 4KH0B 4QR0A 2BV3A 3M6WA 1R0BG 2E44A 2G9OA 1LW2A 4A4JA 3A4TA 1XNQF 3IAS9 3HHNB 4OIXA 4OQJA 4OI3A 5DG8A 4H4OB 4NCAA 2WW4A 3MECB 3GE9A 3M2VB 3ZFVA 4F3QA 3KMQA 4RO0A 4WTOB 1NCLA 2B5JB 4X2BA 1B99A 2PFDA 1RT1B 3MMBB 5E0OA 3SBMA 1IJFB 3R8YA 5D6GA 3PW4A 1U0SA 3IBFB 5B09A 3AB4B 4DZ6A 1AXQA 1JLCB 1C0UA 5KG7A 4DPYA 5EX3A 4MIAA 4QWCA 3GU0A 3OT9A 4DV6J 3BDEA 4DV3F 2VG7A 3IM9A 4HR2A 3FFIA 3SI8A 2C2DA 3IGNA 3TAQA 1CS4A 3CWJA 1JB0C 2UVVA 1AT1B 1KHVA 1KONA 1EX8A 1HWUA 1T7PA 3NLCA 5BR8J 1ZETA 4UTGA 2WVDA 2ZFHA 1YIJS 3W9JA 2NYHA 3T5KA 3V4IB 4DQRA 1WC1A 1H73A 1VISA 1HQUA 2Q6CA 2VB6A 2ZOMA 3VVUA 4DMZA 1VBKA 2PSZA 3PYGA 2ZM6F 4F4XA 3HMJG 4A8YA 2MY7A 3PJXA 4C0BA 4JI2J 4IFVA 2V2VA 1M1HA 2YQ0A 4JOUA 4ECZA 4ENOA 2AKWB 2RU3A 4LJMA 3EGZA 1EB0A 3M05A 5D0EA 2B4OA 4CO3A 3AH6A 1MN7A 1YJ7A 2CPDA 4ZITA 2XO7A 4ALZA 3QSYB 2C3UA 4Q44A 4OZ3A 4F36A 1S1UA 1PBAA 2XHCA 4BHQA 5F9NA 1UL3A 1S7HA 3K0JA 4B3SJ 1NPKA 4LRAA 4GO7X 4IFYB 1HNXF 2QEXS 1FWLA 2HFZA 1FFWB 3IM8A 3BB5A 4ZMMA 2RRBA 3J81Y 1N34F 4DV1J 2OPRA 2PI4A 5HATA 2IAJA 3ILIA 2KG0A 3IRXA 4OJHA 3BZQA 3CCVS 2C2RA 1Y5NB 1TK0A 3FQLA 3N4WA 1GXLA 3KDOA 3LP1A 3QT6A 3LP2B 2EKNA 2CVIA 3HHDA 4CWBA 4F0HA 5LOQA 4NX9A 1AFIA 2HGNA 2Y9HA 3M30B 1Q4RA 1PIEA 2COLA 2CQCA 3B6BA 5D4LA 3BO4A 2XB2D 5GAHI 1CULA 2OEMA 4DJBA 2OGUA 2DNRA 1LW0A 3V6DA 1QTNB 4PG5A 1QAYA 1SKUB 1VCTA 1W25A 4G6VB 2UU9J 5FDLA 1UFKA 2DITA 2VASA 3QPIA 5HQ8A 1SL0A 4LF1A 1N56A 2HSEB 3OR2B 3O8WA 4DV4J 3MOJB 1F2HA 2QA1A 4DFMA 2F63A 2G2OA 2UXDF 1KWMA 1Y7PA 5KG4A 3P45B 3LWLA 3L7UA 4G65A 5G4DA 4RNNA 3OTDA 4OHXA 2AGPA 2GMHA 3MMCB 4DG1B 2KJVA 3H4DA 3GCWP 1HBOA 5A0YB 1TUGB 2IMWP 3KG4A 4WBFA 3NRBA 5HVGA 1A7GE 1Z4UA 2YH0A 3MMBA 2MGZB 2W1BA 4NLSA 4IG0B 3OVSA 4EYIB 4E98A 1L3SA 2FZKB 4CLLA 3BR8A 2XI2A 3TZZA 4QWAA 1QVGR 1CLFA 1NMEB 4X84A 4LVNP 3W62A 1HMVA 3ELHA 3D2WA 1RTZA 1H2UX 2KT2A 4KKOB 5HBMA 3K89A 2RQCA 4DL5A 1PYOB 3LTOA 1VQ4S 2KZZA 4ED8A 1RTIB 4J7CA 3MEGA 3R1LA 2RNEA 3NGTA 4ZP7A 3ZZUA 1H3DA 1WC4A 1H7XA 1Y9OA 2HRUA 2ZWOA 3DOMB 4RW4B 1J5OA 4OZ5A 2WW8A 1FF2A 1CBKA 1ZA1B 1A6LA 3MAHA 3OFFA 1IKWB 3A8KA 4JI3F 4ZPBA 2GO8A 1SJFA 2LYVA 1S4FA 1DFDA 4OX6A 1XJWB 4B17A 1XNRF 2UVRA 3HK2A 4PG7A 4WFAQ 4MKBA 2R7QA 1K9MT 3TR5A 3FKBA 4TY8B 4CNYA 2CPHA 3MOZA 2HFUA 3KJNB 2J0WA 3LUYA 3NY0A 5HMWA 3HFVA 4KYZA 1GMUA 4J9UE 3T3FA 2IC3B 3QJJA 1W2IA 2MYFA 3ZZZA 3GFHA 3HI9A 4WU3A 3VVTA 4I6YA 3G6XA 1TQLA 2EK6A 1TR0A 4TU8A 1MMNA 3MR5A 1JX4A 4ZKAA 2OP5A 2R8HA 4JI0J 4WP3A 3HDSA 3J7A1 2QO3A 4Y00A 4DSKA 3UE2A 3GYNA 4RNOA 1HHSA 2F65A 4J9RA 2ZOGA 2FC8A 2ZKTA 3Q2SC 5J1NA 2QJ3A 5IC6B 1URNA 1ZM2A 2AX0A 1MLAA 2JFDA 3M8QA 4ZVOB 2I9SA 3MM9A 2D3ZA 1RWKB 2XNQA 4ERDA 4ES3A 2E66A 3R3TA 3KJQB 2C2ZB 1VGYA 2VFUA 3A8JA 4WIIA 3O3LA 1HYSA 4I0WA 3PJWA 4DR2F 2BQUA 2QG9B 1YTYA 1BXNA 1JLGA 1RSCA 3MCSA 3NGSA 3MPUB 2JSXA 2M52A 4L75A 5ETLA 5U47A 3H2LA 3PRDA 4IDKB 4DFPA 3KLGB 4C4WA 2W25A 5IFMA 4FBUA 4NLVA 1ZPVA 4I1TA 1XERA 1H2TZ 1DQ9A 3N01A 4NLTA 3SV3A 2E1CA 3M32A 3H5UA 2MQQA 5E3QA 3SDEB 1YRUA 4EBCA 1KLMB 3ENAA 4DN9A 5LXRA 5DQHA 1D9DA 4J9VA 2FVSA 4QYRA 3DU5A 1N5QA 4J90A 3KLHA 1HIYA 2FDNA 2HWTA 3JTNA 1IBLJ 5CA5A 4OLOA 2OEJA 3DRPA 1JNZB 2AZ3A 3NBPA 1XMOF 4LQ3A 2KXNB 2F7VA 1N33F 4L3NA 1F5CA 1ZOTA 2L08A 1RT5A 4UQGA 2PA3A 2R8IA 4DR6F 2J0XA 5ETRA 3EVWA 4OYBA 4EO6A 4O0IA 1H38A 4URSA 2GQCA 3CD0A 3MCOA 4MH8A 2ILZA 1Y10A 1PYTA 4ETXA 1FKOB 4ZLNA 4DV3J 4DV6F 2L9DA 4ZPCA 4K4TA 2OPSB 5AJ3F 2VODA 3GPAA 4ATNA 5EN1A 1IM6A 2K3IA 1UJ4A 3MMAA 3DI6A 2VZ9A 4C6AA 1S6UA 1HKAA 1RTJB 2Z4PA 3MM7B 2EWHA 4M5KA 3W66A 4EYHB 2AYEA 4ZVUB 1C4AA 2YQ1A 3BGOP 3GJSB 5K9FA 5GMDA 4J9SA 5L39A 3MMJA 2FUG9 3TJ8A 3SSSA 3UCGA 4KC5A 2GJFA 4ECTA 3BSAA 1JXVA 3VZIA 2BKPA 2OPPB 3MM9B 3QT8A 3CMAS 3BREA 1SQEA 3SV4A 1QAIA 3T1AA 1G7CB 2IM1A 1PGZA 2ZH3A 3FCWA 3PYDA 1W2BR 3HJVA 5E3RA 1OIAA 1RT3A 2KXHA 4C3KA 3CJ0A 2ZBQA 3TUZC 4ED2A 4LF6J 5DLGA 2WK4A 1P9QC 1QE1B 2NSBA 4P2XA 1EZZB 1M0SA 4DUTA 4LFBF 3K59A 2DRBA 1B0TA 2AHOB 5C25A 4WK3A 2XZTB 3JSRA 4EI2A 3PX4A 4DX7A 1YJRA 2XZDB 2EI5A 3HULA 4DV1F 1FRLA 1SKWA 3OTOF 3HHEA 1RAGB 3D28A 5LSRA 5T7LA 5HROB 4CTAA 4TY8A 5L46A 3V6HA 2CYYA 4KRWA 2ZH6A 1BC6A 1IN0A 5AXMA 3EZOA 4NCBA 4YB1P 4OX9F 2ZJRQ 3CXCR 3E51A 3I56S 4MK7A 5A8WB 2KHDA 2HHXA 3G96A 3P96A 3Q83A 3QIPB 3JAMU 1EJ7L 4OL8A 3MI7X 1VBZA 1FRIA 1S1TA 1KP6A 1LWEB 1JLEA 3CDBA 5KFQA 2E5HA 4WPAA 2ZM6J 5D4OA 3RAXA 2QYCA 4OHVA 5K8PA 2V63A 3WQPA 1ZTWA 4UQTA 2UUAJ 1U2CA 2YVSA 2HVIA 1FXRA 2BJ3A 1IKYA 3NWGA 2XSFA 5HJYA 4KPCA 2NYIA 3SYZA 1FJGJ 4LSNA 4Y2AA 4ZN1A 3MTKA 4LRDA 2HWHA 1SUQB 5DO2A 5F8GA 3H40A 1IQZA 4ICLA 2DR9A 2XLIA 4M63A 3DM2B 5D0GA 3IO1A 4OZNA 4OFZA 4J9KA 3L3CA 5IV3A 2V8PA 5ETVA 3TUIC 2GIQA 5A0YA 3BGFA 1JKHB 1VJWA 2BW7A 2MZTA 5HVHA 1IBMF 4LRCA 2ZJQQ 4DPXA 4M8LA 1RWNB 1IBCB 1B4SA 3CCTA 1OJ4A 2W24A 2WZ1A 3DGPA 2KYZA 3EWGA 2D74B 2OSQA 1LNQA 4HL9A 4YB6A 3TUJC 5HQMA 3KK2A 4CLZA 2DHSA 2EKYA 3R97A 1SC4B 4GKKF 2IRYA 3SCLE 1UPMB 1U7LA 1Q7LB 4O44B 4Q8FA 3BQ0A 2Q66A 3LP0A 1LW0B 1HLWA 3CJ4A 4OYWA 4DV7F 2QLBB 2CZ9A 2CWXA 3A3PB 3LWMA 4U8VA 1NPRA 2F4FA 1EARA 3NAIA 1YI2S 1JLEB 5HVFA 2R42A 2XLKA 4GC6A 1HBMB 1YX2A 3KLEA 3DOKB 4F4KA 3JXOA 2ZH9A 2EC0A 1NDCA 1U6FA 2OAUA 2DGOA 4MJKA 5IZHA 2BR0A 2IA6A 4ECRA 3U02A 4CO4A 2A6MA 3B78A 4F4ZA 2HVEA 2MLYA 3RAMA 3IWNC 3AOBA 1H0HB 3CJTA 1WG4A 1S9EB 1VRUA 2BE7D 2MQ8A 2QV6A 2RHSB 4HLBA 4IO9Q 1T8EA 5AT1B 2E5GA 2C42A 2RSQA 2RKIA 4H54A 1XR7A 2XHWA 4KHMA 1RTHA 3RJMB 3FEZA 5JMNA 2JH3A 1I94F 2XSJA 3DRYA 3PY8A 3PW5A 4JI5F 4GVLA 4WF9Q 2QGFB 1YJ9S 4CIOA 3T1HJ 4I2QA 2KO1A 3R5JB 1NB7A 1JLFA 2E1MC 4ZP9A 3H5YA 2ROPA 1GQEA 3W9IA 3PW7A 2MZ1A 2KTQA 3MPDA 1K1QA 4P75A 3HFZB 1U02A 3I5BA 2AD9A 5DQGA 4B9LA 3EZ5A 4ID8A 2VONA 4F3OA 2HVHA 2CQHA 1YSJA 4NLWA 3ZXWA 2WONB 2K7KA 3CIMA 3MPWA 3NGUA 1SKRA 4KB7A 1KQFB 1F1BB 1D09B 3AA9A 3L7OA 4KHPF 4K4SA 3KG0A 2CQPA 3CCLS 2WSCC 3Q24A 5KFPA 4TYBA 4DZDA 2EC2A 1C4CA 4U9RA 1KRPA 2DXDA 2F4VJ 3P4UB 3RG6A 1HPZB 3PIOQ 2BE2B 4IOCQ 2MPUA 2OPSA 2B51A 5EUHA 2CQ2A 5A76A 1ZYQA 3CMES 3L95X 1WF0A 2Y1LB 2L41A 4ECXA 4IUFA 1UW4A 4Z37A 3BKFA 4USWA 1N0UA 2LEBA 2MQLA 3Q23A 5EHHA 1B7YB 1UWBB 3HSGA 3MF5A 5K8OA 3P49B 1EETA 3N6LA 3P5BP 4PWWA 2C22A 4R0EA 2AYBA 4B3TF 4FF4A 3HLUA 3CDWA 4OMFG 3BYRA 4YB5A 1S57A 1M5SA 3Q8UA 3GQCA 3DRPB 1N36F 1SH0A 2DY9A 3Q8VA 5CYMB 4DU7A 2WTFA 3FCHA 2HQIA 4OI2A 3CCZA 3G4SS 2KKHA 1TK5A 2YWGA 2FB0A 3ETMA 4USUA 2POKA 2XMAA 3G6ES 3RBXA 2ZH7A 2UV8A 1SH2A 1VMBA 2CNKB 4NASA 1CQMA 8ATCB 1Q5YA 4CO0A 4C48A 2UXCJ 3I0SB 1FRXA 4ZP6A 3PG9A 1D1UA 1S1XB 1HARA 2IMOA 1SJQA 2F8MA 3OW2R 2OTJS 2YTCA 3D9BA 4IDKA 3DHWC 2C2NA 1T9WA 1WEXA 4DUZJ 3HVRA 2N4DA 3GSIA 2MZJA 1S5ZA 4DDFA 2ASJA 1KEKA 3NS6A 4RW7A 4C11A 3UWTA 1HL6A 3T1YJ 1I1GA 2ALZA 2BKNA 2BJ1A 3NL0A 2IJRA 4KFBB 3J80U 3BM7A 4X4UA 2AEMA 3T5LA 4OX7A 4KGXB 4CH7A 2FYXA 3PR4A 2RILA 2VG6B 2K1RB 2Q43A 1RU2A 4OV6A 2AQ4A 3V6KA 2LXIA 2UUCF 1TUWA 4ZDNA 3EVMA 3MD1A 4I64A 2UXBF 2NSCA 5HP1B 4F2RA 1QLNA 4RBUA 1RWUA 4KT0C 4O4GB 5C2CA 1GXUA 3NGKA 4MIBA 4BWMA 3OJSA 2N3LA 5RUBA 1RWOB 4ITSA 2ZITA 3R7SB 4JV2A 4H4MB 3TW0A 4QOTA 3CCES 2DPJA 1DLOA 3POTB 2NCKL 3I0RB 1ACMB 3MM8B 4CM0A 3K5OA 1R0AB 2V4JA 3GMGA 3AB2B 4NEZA 4B3RJ 2ABYA 4Q5VA 2YWFA 4LBIA 4RPFA 4LQ9A 2F5GA 3D3BJ 4V1Ak 2EFOA 4EFAC 2Y0BB 1YG0A 4WIQA 4DR1J 2CPFA 4CT9A 3FJ2A 4K2JA 2OLWA 2BJ8A 3QAEA 2BOPA 2DCLA 3DOMA 1X9WA 1U1OA 2D69A 4GKJF 4URQU 3KK1A 2AZ1A 2G0IA 5HI7A 5F8NA 2MEWA 3PACA 3OV7A 4QWDA 2RMLA 2UUWA 4RL1A 2KYXA 3OXGA 4GVBB 3QLHB 2JDJA 4BS2A 1EHWA 2IJNA 1HMVB 2W9CB 5CXTA 1VC5A 1TL3B 1W26A 2NXNA 3MEEB 3R6LB 4HKQA 1JMTA 2B7BB 3NCPA 3G82B 3T1HF 1VQOS 3VAHA 1NH7A 2VG5B 3AQPA 3HO1A 2XBPA 3OFGA 4TU7A 2M70A 3BO2A 2YWHA 4DPTA 1RKJA 2N7CA 3BGRA 2LP4A 2PMZD 4B9TA 2AIRB 1SIZA 2JLEA 3QSIA 3FBBA 2JC0A 2RH3A 3SQOP 2YKMA 1SH3A 1HR0J 2XY5A 3DXBA 1RACB 2ZUGA 2YKNA 2VPZB 2W2MP 3HSJA 3HVWA 2WHOA 5IS2A 3AQOA 1X4DA 1N0VC 4X4OA 3RBEA 3MHYA 4U96A 4B02A 2QL5B 2VICA 2NUUG 4CZCA 3LPYA 3KLVA 4QIEA 2ACYA 2LQ8A 4B3RF 5ITHA 2V67A 3FMBA 1PJ5A 1RAAB 2FIUA 2RAQA 2YBVA 4OYXA 1RAHB 1CULB 4XIUA 2PMHA 3C6UB 3V6JA 1OY8A 3D4JA 4LFCJ 5GVQA 3H42A 1B0VA 2QT7A 5KFJA 2BUNA 3K2YA 5IT9Y 4RZRA 3IS9A 4QYZJ 3DNCA 4LIRA 3I5AA 4DR5F 2FJXA 3KHLA 4EGLA 4Q7AA 3FEXB 1NNDA 5ETSA 4MK9A 1UVKA 2DHHA 3SCIE 5F9LA 4X4RA 2FTRA 4AL7A 4DUYJ 2VF3A 5GAHU 1WKKA 1YHQS 2KZMA 2HQ3A 1C1CB 2F4VF 2HQGA 4NCGA 5KG3A 2ZNZA 5B0DA 2FZCB 3M8RA 3UCUP 1ZZFA 2RRAA 3RU0A 2R8GA 3HKWA 1PBUA 3UDEA 1REGX 2CRLA 1U24A 2RDJA 4AQYJ 3K5PA 1DAXA 2D7SA 2BJ9A 2A3JA 1H98A 4NLYA 4C8LA 1OWXA 3D0HE 3M4XA 4O3NA 3TAMA 3NS5A 1F5AA 2Z0GA 3EGNA 4HH1A 4MKAA 5K14A 4WYWA 5KFBA 4CYUA 1TKXB 2AGOA 1Y5IB 3K5LA 3HSDA 3IR7B 2VV5A 5ETNA 4JI7F 1QJHA 2P9GA 3F0NA 1Q0NA 4ES1A 4WCEQ 3H4BA 1EIYB 1TAUA 2FJVA 3DLJA 2BEFA 2WAQD 5E5NA 5D3GA 5HL7Q 2B8PA 2X3GA 4CO2A 3PCOB 2LFVA 2E7VA 2MY8A 1HNVB 1J27A 2LDIA 3MCNA 1TKZA 1ZM9A 3C16A 5BYSA 1S6QA 3D67A 3OTBA 1DTQA 3WX4A 2D41A 5H9FK 3R2CJ 1WHYA 1FD8A 1RLCL 4B3TJ 5CYQA 5LMUJ 2V9KA 4LRFA 5KFKA 5B0CA 3JSMB 1QDUB 3V2UC 4FF1A 4N56A 2QC3A 1FO1A 4PABA 4DV5J 1RCXB 2A6OA 1B64A 1SC3B 5F41A 4ZVPB 1TK8A 5FJ4A 4C8NA 3PFOA 4IG3A 4O3PA 1FT8A 4YY3J 1ZAVA 3CJQA 1TL5A 4XPEA 2PD1A 4UW2A 1TFWA 2V9WA 2M7SA 2HS3A 4N8NA 2CXEA 3B4DA 3LAKA 2V8GA 4IH7A 3UD5A 4WFNQ 1XC9A 4LFBJ 2XMMA 1LFPA 4IO1A 2BQ3A 2G2YA 2R7VA 3ZNJ1 2QSWA 4LF6F 1QTMA 2LKZA 4LVOP 2PC6A 4W98A 1WEYA 3BDPA 2PE8A 3C3LA 2X7IA 2BVZA 5C24B 1UP1A 1G6BA 2A0FB 2B4UA 5JXSA 3ULHA 3SZ2A 3HXMA 2V8HA 4FF3A 4V19X 1S76D 5A2QU 3JYTA 2YNGB 2HNYA 3EZUA 5LMNF 3QJLA 4WXOA 3OFHA 1VQYA 3UDLA 3KG1A 3CCRS 5D15A 5IT0A 3D1OA 2UVWA 3DLHA 4ECWA 4PXCA 5KFDA 1DTTB 2CZ4A 4ID5B 3CCSS 3DYAB 2Q79A 2QA2A 5HJXA 3RGIA 2G13A 4M5HA 4X4TA 4ECSA 1FXLA 3TEGA 2LLZA 1U1PA 2VBXA 3GR0A 4NZ6A 3TAPA 1WF2A 4ANDA 3GIIA 5LSLA 4CLFA 4FYVB 2RB7A 3M6VA 4NLXA 3EVOA 4PXDA 1NDLA 5KT5A 4QW9A 3JB9k 1IXKA 2MLXA 3GJTB 2R7OA 5HAOA 2YWKA 3KXDA 5B7WA 2NS1B 3IR5B 4X4QA 2GHWA 2L9NA 3D0IE 1ROFA 4I56A 2V34A 5KFCA 2ADBA 4QZVB 4PWUA 3H59A 1RHKB 3C19A 3GG1A 5GAEU 3HVTA 1CJUA 2AW0A 4DEZA 2R9LA 4YMEA 1NUEA 5HK4A 2V68A 4M5IA 4Q0BB 1NHKL 4JI1J 2Z2YB 4DV0F 2R2SA 4A8MP 2VUGA 4ZN3A 3IRWP 1X31C 4FDFA 3GV7B 1QD1A 2JEGA 2QE5A 3CDUA 3W61A 2I0XA 3OL8A 2Y1JA 2WSFC 1BQMA 1UKUA 2F9JA 2YH1A 3E01B 1MROB 2PO4A 4KTQA 2GNKA 2RUGA 4MTPA 3TAMB 4W92B 5E2QA 4UY8T 3JAMY 3KK3A 4Y65A 1RK8A 1A0OB 1S49A 3VQTA 4RNFA 4JI6J 1LK7A 2HQFA 1VFJA 4LBHA 1GNKA 1IKVB 4O0NA 2ZBRA 3HKZD 2DT9A 2VQFJ 2GIFA 3X1LB 1SB6A 5KTQA 5HSPA 2B9YA 1EAYC 2P6TA 2RD5C 5A6WA 2GJ2A 1U1LA 2BDPA 4ZJQA 1UVLA 4QU7A 1RZMA 2DD8S 4ZCMA 5HO4A 3Q22A 4DS4A 1WSRA 3OUYB 1HD0A 1NRKA 2VKZG 2Q6BA 4FVMA 4DR4F 4NWBA 1AZSB 1UA0A 4B3MF 1WACA 2HWIA 2PIIA 2IJFA 4J9LA 2HHVA 4KPYA 4UY85 3HHKA 3OVAA 3IR6B 2DRDA 2YNIA 1NSAA 4M5JA 1HHTP 4F8RA 4M5DB 1FDBA 5KFFA 2QIFA 3MAAA 1NJYA 4K4WA 4U7UD 3A13A 2ZBPA 3DDIA 3ZTQA 1DRZA 4DCPB 3C8YA 3CCMS 1NBEB 1WHVA 4WZQA 3H98A 1SQGA 5E41A 1K47A 2EFGA 2IHR1 5I3QA 1XK8A 3UI3A 2IM0A 4X4VA 1AUDA 4JI3J 1H74A 1E6VB 1GMWD 3NWRA 5FD1A 4A47A 5DDQC 3ZNUA 2YNIB 4CI0B 5MAOA 2W9BB 3TARA 3RBDA 1U25A 4B9SA 2R2UA 3H20A 2FLOA 2JOQA 1AA1B 1PJ7A 3ONQA 3PO4A 4NXNJ 3OLAA 3R5GA 1I6JA 2CKWA 4RNHA 2BJDA 2OFHX 5F8MA 5KG5A 3NOCA 3VCDA 3BSCA 3FDSA 4EWTA 3C6TA 2JRSA 4ZP8A 1UA1A 3FQKA 1N6QB 4F02A 4HACA 4NLDA 2G1DA 4NLGA 4PEOA 1QAXA 2FHJA 4RUHA 2ZJPQ 3UD3P 2KT3A 2B4VA 2CDQA 1ULRA 3L4BC 4X62F 3KMSA 1IKVA 4XAKA 1RA7A 2FJWA 1WC3A 2BRLA 1RWMB 2FLPA 2W01A 3HJFA 2PFFB 2WVCA 4A8SA 1ZS6A 1X4BA 2WOMA 3DMJB 1JNRB 2J9CA 3L9ZA 4DL7A 2VBZA 1U1MA 4PUOA 3VAKA 4J9NA 4C8KA 1X5SA 4USJC 4YDXA 3AJ1A 3UVJA 5J1PA 1ZM3A 2U1AA 4K59A 1RADB 3PXGa 3S6EA 1U26A 4DLEA 2ASLA 4HDGA 5J2NB 1SJ4P 4C97A 2HYIB 4IR1A 4FF2A 7FD1A 3VAGA 1D3WA 3CJ8A 5D8HB 2A1BA 1JLBA 4Q0BA 2MKSA 4W4MA 2ZVSA 3LALA 2HNDB 1MSWD 1U48A 1DZ5A 3IWXA 3QWUA 5CYJA 4B08A 4ED6A 3BF4A 2NPFA 3QYYA 1RU1A 3IAM9 2NREA 5K5MA 1VQNS 2EXUA 3V81B 2BQRA 1XEZA 3SEOA 4L73A 1GX6A 2MKKA 2AGQA 3MEKA 3OXFA 3W1YC 2O66A 2MQPA 1X8DA 3SMZA 2BANB 1KKHA 1S4EA 2QMXA 2W7AA 5J1EB 4P7VA 4CLUA 4DV2J 1NO8A 1M5VC 1NB2A 4OHZA 1H72C 3QGPA 1J5EJ 4MAKA 3GIJA 1U0HB 3W65A 2DY1A 2W8LA 2W2QP 1X4CA 2MZSA 1GTEA 1JLAA 4OJGA 1KNZA 3CD6S 1FNOA 5KFYA 2IIHA 4AL6A 2YNGA 4WKRA 2EW9A 4O4RA 2DR6A 4J5OA 3EDQB 3NCRA 4WE1B 3X3UA 1H6KX 1YRTA 2DGVA 4WP8A 1ITPA 5LM7E 3W2VB 3DLLQ 4LBPA 1CJVA 1LWCB 3TZYA 1QUPA 2OSRA 3UQSA 1SL1A 4P2SA 5CYMA 3WX8A 2I5JA 3DDNA 1VS3A 3VGVA 2J9DE 2B4PA 4BWJA 4XO0A 3BGLA 3BPDA 2FVPA 4DR7F 3EJMA 1UETA 3MM5A 2KH9A 5AXKA 3QO9A 4ZJOA 1VHFA 7FDRA 3PO5A 1A9NB 1KOHA 1RHMB 1FTRA 1VC0A 1KOOA 2VPYB 4FKYA 5CZVA 1HBNA 5D78A 5J2QA 5CZXA 1CC7A 3PZPA 2IYGA 2GQ2A 2QFJA 1VQKS 1TV6B 2VOPA 2A2CA 2KFYA 5DETA 1EQ0A 1NEEA 5BYQA 3UPFA 4DV0J 1BHNA 2J8AA 2WVBA 1EP4B 5E7OB 2AJFE 4NLUA 3G9CA 3PR5B 4DV7J 2CVEA 5HQLA 4OZ2A 1PAUB 1F0XA 2XS2A 2XYPB 4F25A 1X5OA 3KKFA 1FRMA 3ISND 1T9UA 2CG8A 3UNGC 4ECVA 3NAHA 1CJTB 2E5IA 2HLUA 4R8UB 2HNZB 4EO8A 5J2QB 3LA0A 3J7AN 1MU2B 1C0TA 4K50A 4FN5A 4YQWA 4RWWA 1NZ8A 3L7PA 1R0CB 1C1BA 1ZM4A 4LF7J 4PQUB 1RDRA 1TL1B 2OPQB 3GIMA 4QPXA 2ALYB 1RKIA 2KL8A 1T03A 2DNZA 2ZNYA 2KRRA 3EUNA 4P72A 3THVA 1UVMA 2VFSA 4F26A 1UVJA 3AJDA 2XCPA 3K8WA 4N7TA 1QY7A 3ZZPA 4YS2A 1RT4A 2XYHB 1SV5A 5KFRA 3J81U 5L1JA 3R5DA 5B0AA 1SKSA 2Y8YA 2HRYA 3H5SA 4NRTA 4RKUC 5AE2A 1T02A 3O5TB 2ZDOA 3RW6A 3PFEA 2ROGA 2Z56B 1WOOA 2UXDJ 4NL5A 1NH8A 3I9V9 2XMVA 4NMXA 4ZK7M 4QIWD 4X62J 1M5HA 1CJVB 1WSVA 1NDKA 4OI4A 2GGPA 2HBQB 3TA0A 4QIVA 4F67A 5C42A 5KG2A 5DDRC 1P1LA 4TQRA 2XS5A 4Z7YA 1Q81T 2HQDA 3CMQA 1XWLA 2DR8A 2XMJA 4N8OA 1CG2A 4NZ0A 2OD4A 2BKOA 2CQBA 3NS7B 2Q1LA 4P10A 4ZIVA 2MQMA 5DM6Q 2DR5A 1S6PA 1SVDA 3DDKA 1JXEA 1RWVB 3CB4A 3VGUA 5BXIA 1AUSL 3HCXA 1KVIA 1X5PA 1Y4ZB 4HT7A 2B8QA 2CPJA 4KAIA 3QRQA 3IN5A 3T9NA 1YZ6A 4LFAJ 3CJRA 2BE9B 3WIUA 1HQEA 4B9NA 4KIAA 3T19A 4BDPA 1N34J 5JUMA 5J2PB 3WIVA 1YVFA 1V3RA 5KFVA 3J7ZT 2BANA 2HRTA 2RF2A 4C0OC 2C2OB 2Y1RI 4LF7F 3NNHA 5DZ7A 3TO8A 2XGQA 1U6BA 3CSKA 3ETOA 4RW8B 1L3TA 2UUTA 2O5DA 2HG4A 1TELA 5LMUF 5A8RA 3OHAA 1WUUA 5HLFA 4I2PA 3CDEA 3M7VA 3R5BA 4QR2A 2QRRA 3K7RA 2FLLA 3BEGB 2W9CA 3CJ2A 4A48A 5JVGQ 2IFXA 3QLHA 3F44A 1TZ0A 5L38A 2CJ9A 3EX7B 1BQNA 4JV0A 1RAOA 3WZ0A 2XULA 3KJVB 3TQEA 4ANEA 2IVYA 2XY6A 1IKXB 3CCQS 4PG8A 2OH2A 1X0PA 5T41A 4CLTA 1R3NA 5J2NA 9RUBA 4FPRA 1DY3A 4ZJLA 4JI7J 2HHPA 1P9YA 4JI6F 2VJVA 4H4KA 1FJCA 1JQGA 2EFVA 2B9XA 2BRKA 5THWA 4KGKA 3M1VA 4PYAA 4K2XA 1LK5A 2H51B 2E7XA 2ZUAA 4OZ1A 4WJBA 5SZTA 1PO6A 4CT8A 1B7FA 1S1VA 2MKCA 4I7FB 4RUAA 2ADCA 1IKXA 1R0AA 4JV1A 1DJ0A 1Q82T 5DDOC 3DRRB 2W7PA 3BSOA 1E6YA 2WBRA 3T6JA 5LJ5Y 4CLWA 2W4CA 3J7YU 1SBRA 4DSLA 2ACMA 2YKPA 3HD2A 1VQ8S 4MIWA 4ZCLA 2JVOA 2EVZA 4DR6J 1FRHA 1N6QA 1K1SA 3CGIA 5C25B 4EMDA 1RA6A 4Z2XA 3QT5A 4Y2KA 2HURA 2MMYA 4RW8A 5DG9A 1X4GA 4CRJA 2ZEJA 1HWIA 5BYRA 5ADZA 4K4XA 4K4YA 2C2EA 3EMTA 5HN0A 2W9BA 3ADAC 2N3OA 2RRNA 2RF2B 1XMQJ 2ZVIA 2I6WA 3MR3A 3QFHA 1URRA 2K2PA 3K5MA 1VBYA 3ET6B 3C46A 1OY6A 3PYFA 4M5NA 4HYKA 5CD4A 2H5IB 3FRZA 4C11B 4YFUA 3EDRB 2DHAA 5D0HA 2BMBA 1IBKF 4C8MA 4DV2F 4M5DA 1N52B 3TP2A 5I42A 2BZ2A 3MM7A 3OPKA 1HW9A 2DH7A 1X4HA 3A1YG 3DI6B 4EBEA 3H25A 2HHHF 4N76A 2E29A 3GB0A 3LPEA 1F9HA 1TUVA 4P6QA 2VBWA 4BCAA 2BBEA 4YP3A 1N32J 1FDDA 1GAOA 4U6PA 5LXYA 2D3O1 1RAFB 5D77A 4NPOA 3OUYA 5ETTA 1IVZA 2D9PA 5LJ3Y 2X3DA 1UWAA 1O51A 5DJBA 3BH7B 3VZHA 4FS2A 3IBWA 1RT5B 1T9TA 3T5JA 3W2WA 4KH1B 1WI8A 5DM7Q 1WNEA 1I3OB 2OFGX 3KUEA 5F8HA 1D0EA 4DQQA 1D9AA 2FJDB 2HFVA 3GR1A 1F6TA 3H7HB 2YNHB 2X51A 3KLHB 2ZH5A 1Y3KA 3BSNA 1UVNA 4ZVRB 4NA3A 1TL1A 2OPQA 4FYXB 4TXSA 2FC9A 1LV5A 2M0GB 3E01A 4PQUA 3UDCA 3G8QA 1HNZJ 1MU2A 2DB1A 3CEDA 1KQSR 3K17A 2RS8A 1N5VA 2BE2A 1CJTA 1SXLA 3RUBL 3KLGA 3ITHB 5KFGA 3PHEA 5B08A 2VPXB 3QIDA 1U8WA 3MCMA 4U7UK 1Q53A 1S77D 1RWXB 2OKQA 1HYSB 1WJ9A 4J37A 1RAJA 2DHGA 4NI2A 2IDEA 3N28A 1CJUB 3DLGB 3PYEA 3AOAA 1EP4A 2IYIA 4DUYF 5KFLA 1TMJA 2UVUA 2RJZA 5G0RB 1C2PA 2QN6B 2DXEA 5KOWA 3ET6A 3KOAA 4A46A 2IVFB 3MR6A 1IM4A 4LF5J 2XG8A 3CIZA 2DCUB 3I55S 1U47A 1SL2A 1R6VA 1U1QA 3H2VE 2ZD1A 2UXBJ 3QNWB 2C2KB 5F8LA 4CCHA 1FK9B 1IR0A 3GV5B 2N7YA 1SC1B 2BOAA 5KFWA 2N4CA 5EWEA 1HBNB 3RYLA 1JIHA 2X1AA 3OL6A 2EG2A 1P6TA 3CO9A 2MKJA 3QO9B 1OYDA 3EE3A 3ZZRA 1RXOB 2JEJA 1UMJA 2R8KA 2HBYB 1HNWF 4ZVTB 4LT6A 1VK8A 1WC5A 2Z2LA 1E6YB 4QJVA 3C15A 3VHQA 1F5BA 2QTWA 2GZOA 1DQAA 2DHXA 1KBRA 3WBZA 1S79A 5FIIA 3DLEB 1FNXH 1RHUB 1S0NA 1Z2LA 4FXWA 4NRUA 2W4DA 1FD2A 4K8RA 2M88A 4F04B 2B9EA 2KT5A 5C24A 3KLEB 4TNOA 5CQGA 1K44A 1RBLA 3LGNA 2UU9F 2LA6A 2XGPA 1MMDA 1RT6B 1V3ZA 2PN6A 4G1QA 1VQSA 3U1NA 4AD6A 3BN7A 4DU8A 5I4MA 5LSOA 3R6GB 4DL2A 2W4PA 1QVFR 3GCXP 3TZWA 5KFMA 4NE9C 4TY9A 4AXJA 5F0WA 1D8ZA 2AYMA 3KJVA 3RB4A 4Q43A 2HMIA 4LF4J 4XDDA 2XMKA 3ICLA 3UR3C 1U0HA 3RR8A 1MMLA 2AP6A 1XR6A 4EBDA 4WFZA 5CH7B 2KDOA 2WVFA 3IP0A 4S0MA 1RJJA 5A8RB 2PEHA 3OL9A 4WK1A 5HMYA 5M2PA 3CO0P 4IG0A 2Z58B 3DXSX 2MGZA 1TFYA 3PM9A 1T3OA 2FQQB 3K58A 2HEKA 4PR6A 3VAMA 1AROP 2UP1A 3F73A 4XK8C 4UOGA 1T11A 4RUBA 2FJAB 3D5MA 2KM8B 2DEIA 2LQBA 3UW1A 4PG6A 2MZRA 3HHLD 1UFLA 1RP5A 4USKA 3K57A 2VBYA 2DO0A 1HNVA 3PHTA 4PCQA 5D0RA 2G0CA 3IXQA 3ZZ0A 4LF4F 4AL5A 3TX0A 1FX4A 5C7PA 2GVDB 2HVZA 4X4SA 4ZS6A 1KLNA 2CQ3A 5KFHA 2BW2A 1S6PB 2C3OA 1BQXA 2ZC3A 3V6DB 2GW8A 1F3VA 1KQGB 1OO0B 3G8TA 4FNIA 4JP8A 1MN9A 1DURA 2B56A 3I6PA 3LANA 1RHQB 2CQIA 2DISA 3NGRA 4CLPA 2RU9A 5T14A 4N47A 1QSSA 1CVJA 1GH8A 3AA8A 5EGYA 5F3ZA 2GGPB 4Y2IA 4DLGA 3D54A 2QMUB 4UOCA 5K8NA 3MURP 3FGVA 3W5XA 3IRXB 3I96A 4KGMA 1ZTTA 3EXCX 4FZVA 2WOMB 3GP9A 3NP5A 3Q8QB 2QSFA 1HNWJ 3AOCA 1TL7A 1S59A 5IOLA 4F0MA 2E5LF 4CTAB 3EPGA 4C2MA 3GZ7A 2CQ1A 2HS4A 3M6XA 1RE1B 2IPOB 3EGVA 4JI1F 4I4BA 5H9EJ 1GK8A 2HPUA 5KFEA 1N5TA 4M5GA 4RR5A 3J7Z5 2ZH2A 5LMNJ 2I2YA 2B0GA 3C6TB 1LFWA 3I4HX 2KG1A 3IS9B 1NK9A 3CCWA 4OJ1A 3T9ZA 3RB6A 4CLSA 3EXYA 1I5OB 2I38A 3CDAA 5KFTA 2C28A 1N8RT 3CC4S 1KVJA 1TU0B 1FK9A 4IRDA 4L74A 1PC5A 1RT3B 2DNHA 2P8IA 5KOXA 1RWWB 4FNHA 1UZHA 5EWGA 3GYGA 4FBTA 1WC6A 2ZC4A 3I32A 4PWDA 4DL4A 1V9OA 3WHIA 4YR0A 4NOHA 5G0RA 1BLUA 1Q79A 3Q8PB 2G0JA 3CCJS 1GX5A 2YQ3A 3DRXA 2NUHA 3SXLA 2LA4A 1S0OA 3BN4A 3BYPA 5IQQA 5IM0A 2NZ4A 3ZZTA 4B9MA 1FEHA 2YKMB 4Y6IA 1BWVA 4YDDB 1NPPA 3ITHA 4OZLA 1TV6A 1VJQA 4LF8J 1KTQA 2J6SA 1SJ3P 1RWPB 2PEBA 3F56A 1S48A 3OLBA 1FRKA 2YX1A 2CPIA 4CLKA 3CUNA 1RISA 1SCJB 3P5TL 2VG5A 4O23A 3MECA 4HDHA 3AD7C 4OYZA 4P9SA 2YNHA 4ZVQB 1CJKB 3DN9A 3QT7A 1N4LA 2CJBA 2M4MA 1V6HA 3TA1A 5CCMA 5FLXU 4WFBQ 5A6PA 5DGBA 3BQ1A 5DGAA 3MWBA 3PEJA 2HHUA 1U1RA 4QCLA 3MTJA 4WZMA 2B9WA 1U09A 2MSTA 1JXLA 1L3UA 1NHVA 4JI4F 1AFJA 2GC8A 3RAQA 1ZAXA 4ZPDA 2YNFB 1T3NA 3AJ2A 2B7CB 1MROA 2XWXA 2KJWA 2ZKUA 2MDAA 3VF0B 3R5AA 4IQMA 3W5ZA 4LF8F 1U2RA 4FYWB 4X64F 3RRKA 1M90T 3VAFA 2MKIA 5CCLA 1VRTA 4DR3J 2WSEC 1XN9A 3CTRA 3N79A 3FEYB 2C1EB 3DLKA 1N48A 4ELTA 1PYSB 1OQ6A 4USTA 1DLOB 3KNGA 4QQBA 3B4MA 1WG1A 1VQ5S 4O3QA 1LWFA 3N6MA 1XR5A 4C8OA 3HFKA 1IWGA 4JI0F 4O3OA 3VR1A 4UF4A 2U2FA 4MYTA 1G1XA 3FRYA 2J7KA 3KTQA 2O67A 1KFSA 1TKTA 5IT9U 2CA9A 2K1RA 3MR7A 4LSZB 4NLQA 3UN3A 3GWCA 4LF5F 3JQKA 3T41A 5H9FJ 3VV2B 2J6TA 4F50A 4ZPTR 2ERRA 3N6NA 2Y3YA 4DCOB 4DFKA 3S8SA 1LWFB 3E8OA 2IC3A 2AYGA 4DPUA 1D9FA 2CUYA 1QSYA 3UDVA 2MHNA 2C3MA 3ZC4A 3PRVA 1FWKA 3DLKB 3GFXA 5B0EA 5JJBA 3C14A 2CZVC 4ZVEA 4DSFA 3LGHA 1SI9A 1S1VB 4I7FA 4I6WA 1F9EB 2K7JA 1W7WA 3M8PB 2ZE2B 4AE5A 3M1VB 4A8QA 3PX0A 3UVJB 5E3AA 1YQHA 3ENVA 3O1LA 5CD4H 3D68A 1VIXA 4RNMA 3FVYA 3N9UC 2G2ZA 4FXDA 3UCZP 1KQKA 2HGMA 4WFYA 1Q5VA 1RTIA 3QWPA 4NA2A 5SUHA 4TQSA 4Q2LA 2JEIA 2OI2A 2AEFA 4YB7A 1SC6A 3J7YI 2XLJA 2HHQA 3R9LA 1N33J 5E3CA 3FUYA 2F3JA 3EM1A 3MAQA 2VHGA 1K0VA 4ZPVR 2YKAA 3R7BB 1NK0A 4HACB 2XYGB 4I2PB 3H5XA 2EG1A 2JFKA 3CD7A 1J2VA 2HK3A 2MKHA 1RAEB 2O01C 3OR1B 1LKZA 2I1RA 3KLFA 3TI0A 1BWEA 5KG1A 1NHUA 3FZBA 1F60B 3ILJA 2J8SA 4C3MA 4EUVA 2OD6A 5BJRA 2V5HG 2XY7A 2XNRA 2ILYA 3MMCA 2WB1D 4DG1A 3QGIA 8RUCA 4P52A 1DTQB 2B3TB 2RHQB 5IM0B 4NMLA 5J2PA 4OLPA 3CC7S 1G3OA 1TVRB 2GIRA 1S9FA 2FLNA 2A10A 4CH0S 3FSYA 3RW7A 3G8SA 4PPDA 2XM3A 4KHPJ 3THTA 3QRPA 3TYTA 2H54B 3NNAA 5D3GB 4MYUA 5FDLB 3MAAB 2GMLA 3SCJE 5E33A 4JI8F 4WKYA 2CNNB 3IG1A
chains in the Genus database with same CATH topology
2XWYA 3M8SA 4DL3A 2R4FA 5MLCV 1TKXA 3C66A 4I2QB 2D3OR 1CSJA 1XMBA 2J0QD 3CF5Q 3LP1B 3NMAA 4JUZA 2HZCA 2X1GA 3VAIA 3QAUA 2J7WA 2KVIA 3E3XA 5KT4A 2IAJB 3PNIA 1S9EA 1VRUB 3PRBA 4QIGA 3L09A 5L1LA 2ZBIA 1DARA 3T1YF 1KD1T 1UJ6A 1C1CA 1RT4B 2AJ4A 4QPTA 1HNIB 1WTBA 3ISNC 1Y3JA 2LQJA 2KU7A 1R8BA 2CQ4A 5H1SV 3KHRA 4ZOSA 1T03B 2DNYA 1S6OA 2MB0B 5KFOA 3KK3B 5AE3A 1C1BB 1HBMA 1HWJA 3RR7A 4CH1A 4M1KA 2DGXA 4DPOA 4EU0A 2DIUA 1VQ9S 1P27B 4DSIA 1R27B 3GFZA 2B6AB 4R8UA 4ZCKA 2HFOA 5L1IA 3KHHA 1WHWA 1KTVA 1T94A 1RT7A 5GADI 4EZ9A 3LP0B 5KFSA 5I3UA 4NYPA 1YITS 2O1PA 4G1IA 4KR0B 4XPCA 2VOOA 4I6AA 4DN0A 1IBLF 2HAIA 2OMOA 2W9AA 1TVRA 1FA0A 1L3KA 1UEVA 4F4WA 4F4YA 2VG7B 4IRKA 4MMOA 4C98A 2YWEA 2EBEA 3PKMA 2E9RX 3QGHA 1JLCA 2PT0A 1QUVA 2ZH4A 3IA0A 3IWLA 2E1AA 3MPVA 3OR1A 2BM1A 2DVIA 1NAQA 1Y5LB 2BYCA 1FNMA 4WFXA 2CQ0A 4HHJA 1U4BA 3MM5B 3QZ8A 1SUQA 3O6QA 2AWZA 4LSNB 2I8EA 3LW5C 5KT3A 1R6YA 2BJEA 2I5JB 4IQXA 3AY0A 1OPIA 1NU4A 3IGVA 2AJ0A 1XTZA 4IRCA 1PSDA 5F8JA 3OL7A 1LWEA 3HM9A 4HVZA 4OI0A 5EX0A 3U1MA 4ZLPA 3CCUS 4WE1A 3QIPA 3M8PA 5KT7A 3D1QA 5KFIA 2QLWA 1FDNA 2ZH8A 3MEDB 4MFBB 4H4KC 4QW8A 4B9VA 3GFYA 5B0GA 1FKPA 3HZGA 3I0RA 3U27A 4DL6A 1F2GA 1Q7YT 5HROA 4C7QA 4LFAF 1S1WA 3BJYA 2ZZNA 1GTHA 1RT2A 2VC0A 1S0MA 4DSEA 4TKTA 4IG3B 2M2BA 2ZHBA 1XMQF 1F9FA 3SSQA 5AE1A 5J1EA 3I4PA 4RW6B 4WXWA 5KFZA 5A8KB 3CE8A 3M9NB 3Q0AA 1TKTB 4USHA 2KFZA 2XMWA 2ZD1B 4ZVHA 4CO1A 2DNOA 1VQ7S 4D3GA 1S6QB 3T5HA 1P8GA 4HH0A 1S0VA 4PXEA 3O2IA 1R8AA 1VI7A 3DLGA 4KQZA 4PG4A 2Q3PA 5IWAF 2VL1A 1SJ4P 5AXNA 3G6VA 2DPIA 2VFTA 1RTJA 2V4RA 2YKOA 2NR0A 2PGCA 2K3KA 4WTYA 2E1RA 4BBYA 1VK3A 2D1CA 4QWBA 4C8ZA 2YNFA 3B82A 2JWNA 2AJQA 1L5UA 3M2UA 1VLYA 4A8KA 1NK4A 1HWKA 1FE0A 4DV4F 3SFUA 4IR9A 5DG7A 1U49A 4WU2A 2F8HA 4PXBA 2ZH1A 2KHCA 3HPOA 1HA1A 3V5RA 4U7CA 1FESA 1RQ0A 1WI6A 1MWYA 1ZPWX 3BO3A 5KFXA 1R8HA 3R27A 2DO4A 2F1FA 4KE5A 4KO0B 2FJEB 4AUKA 5L8RC 4ED7A 1VQLS 5I42B 1FJEB 1Q16B 2CJQA 4DR3F 1K0TA 2WONA 4ELVA 1KHWA 4R25A 4RBVA 1X4EA 2UUBF 3I82A 4FYDA 2DIVA 4PWDB 3G6YA 2KN4A 3M8QB 4QIFA 1TL4A 3RZAA 1FJGF 1MWZA 1RGVA 3BGRB 1Q1KA 1YJUA 3N5BA 5K8MA 1S99A 1WEZA 5HMXA 3NGDA 1H2VZ 3GIKA 2XSJB 2NPIA 1VBXA 2CQDA 2DNMA 2CFXA 1NZAA 3V4MA 3CC2S 4RU2A 1YJTA 2AV5A 3KYLA 3PIPQ 4DQSA 1DQ8A 4Q45A 2W8KA 3DRRA 3KLIB 3JTOA 1PC4A 2RQKA 1J5EF 4B3OB 3BS9A 1X0FA 2JVRA 2F8EX 4ILLA 4DOZA 2N82B 4B3SF 3DOKA 2EFNA 3MZIA 1N5YB 2J9DA 1IKWA 4DF4A 3NCQA 3MFIA 1APSA 1ELOA 2V8VA 1UJ5A 3OTCA 4OJ3A 3OHBA 3NKYA 2V4JB 2WB4A 4ZPWR 3MM8A 1X9SA 3M2RA 3HVTB 2R7UA 3OSNA 4YUDA 1KSPA 4GMKA 3OJUA 4O3SA 4LSLB 1FXDA 3R1HA 2GCFA 1BY9A 1R43A 4O4GA 5KAKA 5IXUA 3PEHA 5GAGU 4ETZA 1HI8A 1QM9A 1TP7A 2IBOA 2QZ8A 3TVYA 2BXJA 4IKAA 4IH5A 2VG6A 2J0SD 1LOUA 3IWNC 3UFCX 3TQ1A 4DX8H 2L48A 3DRSB 1ZBTA 1T05B 3DM2A 2M5YA 4G3IA 1ZAWA 1NJIT 2D9OA 1HQEB 5B0FA 2M3DA 4AFFA 2RIJA 4J9MA 2R8JA 3OR2A 3EGWB 4IOBA 1BGXT 4HTIA 2QLXA 4RW9B 4FP9A 4Y34A 4DL0C 2DNGA 1DTTA 2HMIB 1GXTA 1R8CA 2R2RA 1S9GA 3BR9A 2AJ1A 1H7WA 2HNYB 1S1XA 3MXHP 1RT6A 1WHXA 4G1QB 4KV8A 1TKDA 3RTVA 1LQ9A 3TOQA 1KR4A 3I31A 5C42B 2EFPA 4DFMA 1YBAA 2J7UA 3FMWA 5D4PA 3HHLC 3SCKE 2YKQA 1R8PA 4ELUA 3DLEA 2LQ9A 3CD5A 1FERA 1SV5B 3CVKA 2L9WA 4IFYA 4OI6A 4YHHF 2MXYA 1EETB 4DR1F 3S1TA 1UWBA 3RB0A 2CJKA 4OI1A 4NA1A 5GMKa 3CULA 2V4QA 3OXLA 3FSXA 1C0TB 2LU1A 1OSCA 4V19J 3JSMA 3IC1A 3TRGA 1HPZA 1JJHA 3DCAA 2IRUA 1FDAA 3HZEA 4P7TA 3LOUA 3V4IA 4J9OA 3DC2A 3RRHA 2VA3A 2OPPA 3PX6A 2CJAA 2D3UA 1TKZB 2GX8A 1P1TA 2OTLS 3MUMP 2VQFF 1U8SA 4J9QA 2P6SA 2GHPA 3I5CA 5DRKA 1MW7A 4IYQA 4PQAA 4MK8A 4YOEA 2DGUA 2E5JA 2ZHAA 2IM3A 5DQIA 5LT5A 3QGGA 1C0UB 1O8BA 4K5RA 1RI7A 1RT1A 3CJ3A 4RLEA 4O3RA 5KG0A 4ZVGA 2V94A 3M2VA 3Q8SB 1KFDA 1RTHB 1K73T 2CPYA 2IRXA 4Y0FA 1IQTA 1OSDA 2MZQA 1SIWB 4BC7A 1O0PA 1LW2B 4G1PA 3TX8A 2M8HA 4J9PA 3US5A 1NK8A 4D3HA 3PDNA 4NCGB 2KB2A 3W2WB 5JVHQ 2DRAA 2V8DA 1FHTA 3CJKB 5L1KA 2EK1A 2L3MA 2JZ5A 4W90B 1N88A 3GILA 2HHTA 3AAWB 4X4NA 2AU0A 1U1KA 2DNNA 1NKBA 1R89A 2DNKA 4TN2A 2R7XA 4Q8EA 3B8HA 5IQ6A 1GT8A 3SDEA 4NXNF 1UVIA 4LFCF 3M32B 4KV8B 1Z1ZA 4FVCA 4OZJA 2ZZMA 3QZ7A 3C6UA 2XZWA 2DNLA 2CPEA 1JJ2R 3P3DA 3FNNA 4R5PB 4JV5F 2FHOB 1JLAB 2DBBA 2MSSA 1JLGB 3H40A 3PW0A 3U1LA 5M2UA 5FLXY 2MQNA 1Q78A 1VQ6S 2GHVC 4KHRA 1JK9B 4IH6A 2J5AA 4C3LA 1NK6A 3VWSA 3KK2B 1XBWA 1RYRA 5A2QY 4OZ0A 3MD3A 2CPZA 2M9KA 4QWEA 4QR1A 2UXCF 3V81A 1YWXA 4XDCA 2HS0A 2R7TA 2MHEA 2Y1IA 2JJ4D 2WRMA 4LSLA 4N41A 3MEEA 2CG4A 1HFEL 2NLWA 2GFFA 3M2RB 2FY1A 2PDAA 1IKYB 4KSEB 1HW8A 5J2MA 4I69A 1YJWS 1OS5A 3MDFA 4AXIA 3I9ZA 1M5KC 4K4ZA 1IJEB 3OTEA 2LEAA 1JLQA 3CPWR 2DK2A 2WCXA 3OBIA 4DV5F 2FVQA 1N5YA 3NNCA 1JLQB 2PI5A 1LXJA 3THPA 3DMJA 1U1NA 4ILRA 3JSBA 4FS1A 1HBUA 4EZ6A 4B3OA 1BQNB 4KKOA 2EPIA 5T7LB 2ZOFA 3F41A 4H4MA 2E9TA 3KHGA 1YJVA 3NMRA 3N5FA 2BM0A 3I87A 2KRBA 1N54B 5L9XA 5HLFB 1U45A 4Y3CA 3N0VA 1UEUA 5DS7A 1JWWA 3WC2A 2P5VA 2RDIA 5AXLA 1QE1A 1T95A 1VQPS 1HWLA 1NK5A 2DGQA 5EWFA 2J6UA 1E6VA 2HIQA 2FPHX 2ASDA 2CQGA 4RUCA 1LXNA 5DDPC 1D8YA 3SQGB 2IA0A 3ENQA 1N5SA 2KFNA 1KN6A 4A8FA 4BC9A 2F40A 2H5EA 2HHSA 1Z2ZA 3ENWA 3S01A 4X65F 1CC8A 3D0GE 4OX8A 4R5PA 1L3VA 4LUBA 3K8VA 4ECUA 4PRFA 3I0SA 1FKAF 2V2KA 2VD3A 2UZAA 1X9MA 4Y28C 4TLRA 3LP2A 5F0UA 3M9OB 3Q2TC 3H8YA 5IT4A 5KFUA 4NLRA 2OPRB 4Q2MA 5F8IA 1FRJA 1ZH5A 1Q8BA 2DNPA 2KXFA 5KT2A 1NJZA 3CJKA 2GQQA 1QSLA 2R7SA 2LU2A 2DH8A 1V3SA 3OFEA 4GO5X 1S10A 4YY3F 4ED1A 2XMTA 3IFEA 1S1UB 3GYXB 2XEXA 2CPXA 2QMWA 3R5CA 3BQ2A 4LF9F 4ZPAA 4LIWA 2A2DA 1U2FA 1BQMB 2FHMA 3ZZOA 2M8DB 1FVQA 2AX1A 4NLOA 4ED0A 2HNZA 3RB3A 4DWIA 5KT6A 1CEZA 1HQUB 5E3PA 3AHPA 4DFJA 4ZHRB 3MUTP 3UD4P 4X4PA 1VC6A 1NKEA 1YJNS 4C9DA 2XC9A 1QAJA 3PVXA 4KBIA 2JLFA 3M9MB 4A8WA 4ILMA 4N77A 1S72S 2ROEA 2DR7A 3MM6A 4OV1A 3FFIB 5GAGI 2B43A 1REVB 2UUAF 4AYBD 2X1BA 1X4AA 1WWHA 4F3MA 1JLFB 5CHCB 3JTPA 3MPYA 4NZ7A 4ZA1A 5A8KA 5KG6A 3U7JA 5C5JA 2HFNA 4X66F 4NYOA 4AQYF 4H4OA 2FJBB 2XS7A 2RKIB 3MFHA 4HI1A 2R2TA 1JJ4A 1FE4A 1FEEA 3DHXA 3DYAA 3KWMA 2VFRA 2GA7A 2VPWB 2OO4A 4K4UA 4Y2MA 1FKPB 1FTCA 1OPZA 2R7WA 1VOMA 3OQ2A 3VALA 2GMJA 3DLBA 3MEDA 4MFBA 3JYTB 3FZ2A 1LWCA 4F2SA 2RQMA 3LAMA 3W2VA 2HHVA 2JHEA 3D1HA 4ES2A 2P9CA 4M94A 4DF8A 4TYAA 3MR2A 3KNAA 2JLGA 3CJ5A 2APOA 2FVCA 2ATLA 5B0BA 2JC1A 3HHLA 1J5OB 3TVKA 2RVJA 1S9GB 1UAWA 2R7RA 4K5SA 4DS5A 2JX2A 4O44A 4JYAF 5HBMB 2HLTA 3CT9A 2DNQA 2MQOA 2LMIA 4RW9A 3DU6A 2DH9A 2E9ZA 3JSYA 4DBQA 1R31A 2Z8QA 4CNZA 2GV1A 1PILA 5LL6d 4K0KF 2BABA 4LMZA 3W3SA 3MUVP 1HR0F 3LF0A 3RRGA 4CQ1A 3S7RA 3DRSA 1JKHA 3SSRA 1T05A 1Q8IA 4E0DA 1FJ7A 4OHYA 1HBOB 2WBMA 4B9UA 5CYQB 1SJRA 4PPZA 5M2RA 6FDRA 4UUWA 1REVA 2X1FA 1VIOA 4ICLB 4MKYA 3OSPA 3MM6B 3GSDA 1WD6A 2MJUA 4RBTA 1M5PC 2JL9A 2C3YA 2DJWA 2VKRA 1M1KT 2HNDA 4TLQA 3NG8A 1JLBB 3QMQA 5I3UB 3K5NA 2LCWA 4ZHRA 2DGTA 2JEFA 1RT7B 4L72B 4DSJA 1WELA 2UV8G 2KM8C 2LVWA 4ED5A 4OHWA 2B6AA 3T6BA 4CO5A 3M30A 2ZHOA 5K14B 4IOAQ 1S1TB 2BACA 4HEA9 2CIMA 3VTIA 2FHJD 3PW2A 1WF1A 5A8WA 3BGUA 4PUOB 4C0HA 2QA4S 5EDWA 4URGA 2F9DA 2ASYA 2FD2A 2H9ZA 1HNIA 4C8YA 4RU9A 3KLIA 2IBKA 2MJNA 3O44A 2BA9A 2C3PA 1WG5A 1R7IA 1IUJA 4R0JA 3E2EA 4A8OA 4USIA 3C2PA 2XCAA 3KFWX 1VQMS 2DGSA 2DTJA 2FVRA 4IFVB 1ZZNA 3LQVA 4M95A 2OMLA 3UR0A 1RTDB 2P9EA 1Y0HA 3IG1B 2GO9A 5GADU 3GG0A 4HTJA 1Q8LA 2YY3A 2LXFA 1DBDA 4RWXA 2YX7A 1M5OC 3HVAA 4QU6A 3SQGA 2RT3A 3TANA 2SXLA 4DUZF 3HT3A 1NK7A 1AW0A 1OQ3A 2FGOA 1TAQA 3TA2A 2YKNB 2VQEF 1NJXA 2OJ3A 3HX9A 4HI2A 4KJIA 1S97A 4YEAA 3MMAB 4A8XA 2NQPA 2XI3A 4KO0A 2G4BA 5GAEI 3KLFB 5D4NA 1CQNA 2B5JA 4U67Q 4ED3A 3HF5A 1FKOA 3HP6A 3A8EA 3PKYA 1RYSA 3LO3A 1TL3A 1HI0P 2VA2A 1UFWA 1DHMA 3TVZA 1WTFA 4EEYA 4JBCA 6FD1A 5L9NA 3LGMA 3Q8RB 2RE1A 2J76E 3FSIA 3NBPB 5I3PA 4QBUA 1X7VA 4JI4F 2FGCA 3GV8B 1HBUB 1SKRA 2K8GA 4ECQA 2VH7A 3KK1B 2XMUA 2RS2A 2PA8D 3LH2S 4TU9A 2FHKA 1Q86T 3OVBA 1MNEA 3M2UB 1YGYA 1KLMA 4ZCIA 2QA4G 5KFAA 4Y2CA 1G2EA 3ISZA 3MGJA 1BD6A 4N5SA 3VAJA 2AF6A 2J9EA 2ZE2A 2EBGA 2NXUA 2HGLA 1B0PA 1SJ1A 1U6ZA 1Y00A 4DQPA 4GC7A 2A18A 5J2MB 1HNZF 1YRXA 4UUXA 4HT5A 5DLFA 2LECA 4ZVFA 3WC0A 3POTA 2O3DA 2VC1A 3DFEA