2KYZA

Nmr structure of heavy metal binding protein tm0320 from thermotoga maritima
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MRYVLYVPDISCNHCKMRISKALEELGVKNYEVSVEEKKVVVETENLDSVLKKLEEIDYPVESYQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy metal binding protein
publication title NMR structure of heavy metal binding protein TM0320 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Metal binding protein
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kyzA00
2ACYA 4Q2MA 2AP6A 2JDJA 5F0UA 2ROGA 2OD4A 1S6UA 4EFAC 2QYCA 3WDOA 3KNGA 1Q8LA 2ASYA 4A46A 2CRLA 1V3ZA 2OFGX 2QLWA 2LDIA 2OKQA 1X0PA 2N4DA 4HI2A 1AFJA 2XMJA 1FESA 2XMWA 3CJKA 1CPZA 3GZ7A 2K7KA 1FVQA 1AW0A 4ZA1A 1RJJA 2BJDA 1XBWA 1N5VA 3IWXA 1X8DA 3DCAA 2KYZA 2Q3PA 1KVIA 1CC7A 1OSDA 3LGMA 2IFXA 4DPOA 1GXUA 4NL5A 3FRYA 2FIUA 3BGUA 2RU9A 3KG0A 4FNIA 1Y3KA 1VQYA 3HDSA 4HL9A 2IYGA 2IYIA 2XMVA 4OJ3A 5T7LA 5B0EA 2GGPB 2ROEA 3QMQA 4HH1A 2G9OA 3HHLA 2HQIA 3VTIA 2PD1A 2HLTA 1TZ0A 2GO8A 2KKHA 2QLXA 3DXSX 3FGVA 4OJ1A 5T7LB 2K2PA 5K9FA 2FHMA 2GV1A 2RILA 2W4PA 2XMKA 1FE4A 2HLUA 2QIFA 2K7JA 2L3MA 3F44A 5B0DA 5B09A 1K0VA 2RSQA 2HFOA 3TRGA 5B0GA 2LQBA 1X7VA 1CC8A 3HHLC 4YDXA 5B0FA 1VQSA 3LO3A 4QOTA 2VH7A 2ZDOA 3IWLA 3CJKB 2VV5A 2AW0A 2OP5A 1OPZA 1IUJA 1AFIA 1Q53A 2W4DA 3TNVA 1MWZA 4NPOA 3TOQA 4Y2MA 2XMMA 1Q8BA 1JK9B 2HIQA 1OQ6A 2BYCA 3HF5A 4HH0A 3T9NA 2LQ9A 3BM7A 1MWYA 1TUVA 1YJRA 1YRXA 2KT3A 5B0AA 5IXUA 2BBEA 2GFFA 3BR8A 1P8GA 1TL4A 1SI9A 2RMLA 2BJEA 3HHLB 1Y0HA 2HFNA 3KG1A 4OJHA 5F0WA 1YG0A 1P6TA 2LXFA 2OMOA 2N4CA 3LGNA 2FB0A 4Y2KA 1APSA 1KVJA 2PGCA 5A6PA 5B0CA 1FEEA 2BUNA 2K1RA 4F67A 5KAKA 3HX9A 1LQ9A 3FMBA 3K7RA 2GGPA 3QGPA 4A48A 1S6OA 4A47A 1SQEA 3MZIA 1ULRA 5B08A 1Y3JA 2GCFA 5A6WA 4A4JA 3I9ZA 1TR0A 2EW9A 4Q2LA 2KT2A 1GXTA 3MCSA 4OIXA 4DN9A 1Y9OA 2XMUA 4ZOSA 1FD8A 4YEAA 1R6YA 1URRA 1N5QA 2W4CA 2ZDPA 4FNHA 3BB5A 4Y2IA 5B0BA 4HI1A 1YJTA 2AJ1A 2OAUA 1FE0A 4U9RA 1JWWA 1W2IA 4DL0C 3KKFA 1Q4RA 1YJVA 2GA7A 1N5TA 2OD6A 1OQ3A 2N7YA 2XMTA 3HFKA 3E8OA 1YJUA 3BN7A 1KQKA 1QUPA 3BF4A 2ROPA 1N5SA 4OJGA 3HHLD 2AJ0A 1TL5A 3UDCA 1FVSA 2K1RB 1WD6A 1U7LA 2FTRA 1SB6A 3BDEA 2OFHX
chains in the Genus database with same CATH superfamily
4XDCA 1KLMA 2ZH7A 3D6TB 1H98A 3BH6B 3GCWP 3KJVA 4BHQA 1R7IA 3D7SB 1CJVB 2K7KA 3Q8VA 4ILRA 2IVMA 1FK9B 3U27A 3SSSA 1A0OB 3R1HA 4C3MA 2HLUA 3EYZA 4QR2A 3ZZPA 1D9AA 1FJGJ 2J7WA 3CDUA 4DQQA 3VV2B 1UWBB 2IC3A 2ZOMA 3ZO7A 4AYBD 1PAUB 3Q83A 1E6VA 2BBEA 3H7HB 1ZA1B 3C3LA 2HFNA 2CQ3A 3PX6A 4LFBJ 4RW7A 2KHDA 3A3PB 1FEEA 1WHYA 5DDRC 1ZPVA 3SDEB 2OPRA 2IDEA 4KGVB 4CO2A 4A4JA 1PO6A 2ALZA 4FYYB 4A8QA 4TLRA 3WBZA 4F25A 3G6ES 4C8NA 3OLBA 2YNHA 4KPCA 4ZLJA 4LF9F 2Z58B 1KQFB 4CLYA 1SL2A 4HHUA 1M1HA 4Q5VA 1FESA 2JLGA 2MXYA 4DS5A 1Q82T 4NXMJ 4IYQA 1RT1A 1S76D 2OPSB 2NREA 4U8VA 1EHWA 1TUGB 2CVIA 2ZWPA 3FEXB 3GP9A 4AXIA 3W64A 2BV3A 1UEKA 3GV8B 3SEOA 1HW8A 1JLBB 2HNDA 3EGZA 4JI5J 4Q44A 2DXDA 2EKNA 1N32F 4F2RA 3OBIA 3I0SA 3ULHA 5DGAA 1IJEB 3GIKA 3DYAA 2E5LJ 2AMCB 4DHVA 1QM9A 3THVA 1D0EA 1UVNA 2FLPA 2IM0A 3GU0A 1S0VA 5FJ4A 4USTA 2IM3A 5DS7A 1BQNB 2IVYA 3S1TA 1R6VA 2KH9A 4LQ9A 4FXDA 3TZZA 1E6YA 3LAKA 5KG0A 4ICLA 1WACA 1NK4A 2N82B 4LF8J 4WIQA 1FFWB 5LT5A 2BOPA 2DNQA 4OZJA 4DWIA 2GIFA 4HDGA 2R7XA 1UEUA 4DFKA 2RRNA 2CPXA 5IFMA 4OZ3A 2YQ3A 3O6QA 3T5JA 4OLOA 2JVOA 3T1HF 3BGUA 4ZVFA 1HBNA 2MEWA 5D77A 2GHWA 3VZHA 4DSIA 2DTJA 2CZVC 2QMUB 2W2MP 1RHMB 3KFWX 2XZDB 3PW0A 2ZZNA 3O3LA 2PSZA 2F8MA 3M6UA 4K50A 2KXFA 3FCVA 2FB0A 4DSFA 3N28A 2YX4A 2BM0A 2G0JA 3CXCR 4AFFA 4Z37A 1TR0A 1AROP 3FDSA 4YUDA 4WU2A 3PV8A 3QSYB 3CMQA 3BQ1A 1H0HB 1NB7A 3MFIA 3M6WA 4DMZA 2I8EA 3NXZA 3AHPA 1UL3A 2AD9A 4FYXB 1RKIA 2FVPA 4ZITA 2VG6B 3I31A 4QR0A 4RO0A 2HAIA 3E01B 3H5UA 1YWXA 2VOPA 3HULA 3OVSA 4UOGA 1JXLA 4MFBA 1WEYA 3Q8QB 3DOKA 4O44A 4CO5A 5IWAJ 4Y2AA 4PABA 2MMYA 2H48B 3MMJA 3I5CA 1C2PA 3M1VB 1HWIA 1U2FA 2BA9A 1K0VA 4IG3B 1SC6A 3HHLC 3PRDA 1A9NB 4ZVGA 2DNHA 5DLFA 5C2GA 3IR5B 1VQ9S 2C2DA 3CE8A 1EKSA 4Q45A 3KG1A 3POTA 2UUTA 3PYFA 3M6XA 3KYLA 3A3NB 3PG9A 3L95X 1YVFA 3W7BA 5DLGA 4TVAB 3S6EA 1N5QA 4DR4J 4Y2IA 2HVZA 4J9KA 4P2SA 1RBOB 1PYTA 4WFXA 4NLXA 3RBDA 4ZS6A 4QPXA 2VFTA 3R5BA 2J9CA 1P1TA 4FF3A 5KFWA 3VGSA 2ROGA 3QQCD 5HLFB 4WBFA 1XNQF 2IJNA 1UJ4A 2NUHA 1YKWA 4LF4F 2A3JA 4DCPB 1RTHA 1DLOA 1M1KT 3W2VB 1S1XB 3HFZB 3MCNA 2JLEA 1P1LA 5LOQA 2R2UA 1Q5VA 1UJ6A 3K8WA 4F2SA 2KKHA 3W63A 4DR7F 2DEIA 4A8SA 4ILMA 4PXEA 4W92B 2B9WA 4DV4J 1QSLA 1WNEA 3MPYA 2EC2A 4YR0A 3R5DA 1ZZNA 4PAAA 5JVHQ 2LQ9A 1FD2A 1DTQB 3T5KA 1F60B 3NLCA 4CM2A 4CNZA 1SUQB 5KG7A 1TELA 2XY7A 1D3WA 2XO6A 4M5GA 3JSRA 1QE1A 2MHEA 3IRXB 5DQIA 5A0YA 1WC3A 2ZVIA 4LSZB 2V2KA 5H9EJ 1RWNB 5CZVA 3M30B 4O3SA 4YB5A 1RHKB 3A4TA 4NLOA 1WHWA 5E33A 5A2QU 3AOAA 3M2RA 5E41A 4X4SA 3WIVA 3KJQB 3D0IE 3OT9A 4TY8A 2H5IB 1T9YA 5LSOA 2O67A 2F1FA 3HVRA 2GGPB 4DQSA 4BWMA 3CCJS 1IQTA 2G2OA 4ANCA 5HSPA 3DM2B 3Q8SB 2D41A 2OEKA 1WI6A 4BC7A 1G4CA 3T1AA 3UVJA 1YITS 4NPOA 3OJSA 3JB9k 1DAXA 1RSCA 4YP3A 4CLFA 1U4BA 1KVKA 2HRTA 2DNMA 5KFMA 3M9MB 4ITSA 2KRBA 1R8AA 4JB8B 2GMJA 2YTCA 3K58A 5B08A 1QDUB 1T9VA 1EKRA 2FJWA 1REVA 3AXMA 3NG8A 2WVFA 1FT8A 4ANEA 1RB0A 3IS9A 4FYDA 4EU0A 3MOZA 1EETA 2KI2A 2VG7B 2W2OP 1NKBA 2BW2A 1M5SA 5M2RA 3HHNB 4DG1B 4RNMA 1KOOA 2JLFA 1VHIA 1XMQJ 2ZM6J 4J9NA 1QVGR 3C19A 4LUBA 3OR1B 1KHVA 3BSOA 2LA4A 4XO0A 4ED0A 2VPWB 4M1KA 2EFQA 2FY8A 2ADBA 3MAQA 2VC0A 1BXNA 4X64J 2GVZB 2RIJA 4OFZA 3KK3A 3CMAS 1AFIA 1ROFA 1WOPA 4Q0BB 1X4EA 2RHSB 5GAGI 1P8GA 3FUYA 4DX6A 5IOLA 2KN4A 5ETOA 3CCVS 3MR2A 2CIMA 5J2MA 2KG0A 2GMHA 4DV7J 4NLDA 2C3MA 3HKZD 3WQPA 2H9ZA 3T5HA 5K20B 2AX1A 2WTFA 1NUEA 5A8KB 1FNXH 2XS5A 4DR2J 3PYDA 3GFZA 4ECYA 2E7XA 5SZTA 2EFNA 1U1LA 2CVEA 3MM5A 4ZVPB 2RRBA 1RTZA 2V2VA 1I94F 4WXWA 1GX6A 2KRRA 2VBYA 1JKHB 3BGLA 1DARA 1IBLJ 1JLFB 2MZRA 1HL6A 5J2NB 2ZNZA 3W9IA 1AUDA 2V9WA 4EYHB 3JXOA 5KFZA 1VQSA 4DJBA 1KQSR 1URNA 5T41A 5EN1A 2UXDF 3TOQA 1U1RA 2K8GA 3MMCB 3DLLQ 2LDYA 3G9CA 3HVTA 3DNCA 4QIFA 3T5LA 5U47A 1UVKA 2P9CA 4EBDA 2P8IA 4I2QB 5JJBA 4F36A 1TKTB 3MUVP 1M5OC 4KV8B 5MLCV 3FCWA 3PFEA 3QAEA 3FBCA 4DV0F 4KHMA 4PQUA 3A3OB 2X51A 3FEZA 4W90B 3DRRB 1N8RT 2KXNB 3GJSB 3IAS9 2FPHX 3ZTOA 3O44A 3ILJA 1FKPB 5BXIA 1QY7A 2IHR1 4JI0J 2B0GA 2Z0GA 3VAMA 4AL5A 3QAUA 4P75A 2IFXA 3SFUA 3H4DA 2FVQA 2E66A 1ZTWA 4ZJQA 3LALA 2DH8A 3G96A 3M8PB 3RAQA 4PUOB 3PIOQ 2Y1JA 2NXNA 3MF5A 2M7SA 2VV5A 1LNQA 2QA1A 3DOLB 2CQGA 3DRSA 3K8VA 2MZJA 4CTAA 1U8WA 1JLCB 3F0NA 2Q43A 3A8JA 4JV0A 3CD0A 1RCXB 2VFUA 2HVIA 3I5BA 4KE5A 3KUEA 5CA5A 4XK8C 4IR9A 3W2WB 4F02A 1FF2A 3OHAA 4RBTA 3LH2S 1F2GA 3CDAA 2ZH3A 3EPGA 3FFIB 4CQ1A 1RAFB 4NLPA 5T7LA 2HQ3A 3DU5A 1VBXA 2VPZB 4DUYF 4YHHJ 5HQLA 2CJAA 1N34F 1J2VA 3K5LA 2BE2A 5FD1A 1S72S 5DG9A 4B3MJ 3J7YU 3IC1A 3AJ1A 2YKNA 1XR6A 2KYZA 3BKUA 2AWZA 2E5HA 2WAQD 3P4UB 4J7CA 3TX8A 3KNAA 3KLEB 2SXLA 5HQ8A 1X4AA 4M5KA 1RAHB 2XSJA 3DXSX 3F41A 4TU7A 3GE9A 5F3TA 1FXRA 2MQQA 4C8ZA 1CULA 3TANA 3CJKB 4KGXB 1H2UX 5KFCA 2HIQA 3NBPB 2K3IA 1WEZA 1VQKS 2HZAA 4X4OA 5ETRA 1KVJA 1PGZA 1NRKA 4C4WA 3EGWB 3EGVA 1RHRB 4KFBB 1S6QB 2YXLA 2MY7A 4ED4A 2EG1A 3MPUB 1WKLA 1NHVA 4KGMA 3EX7B 2WCXA 1WD6A 1Q1KA 3K5MA 2MQOA 4OZ5A 2OD4A 2HHSA 4LSNA 3VZIA 3W3SA 3QO9B 1S9EB 2V67A 2B9XA 1HWUA 2LXIA 3KG0A 4C9DA 2FDNA 4GKKF 3OXGA 4EMDA 1U49A 2V8GA 4UOHA 4OV1A 4OZ2A 3ISND 2DNKA 1OPIA 1OY6A 3V4IA 3AA9A 1KR4A 1QAXA 5CQGA 4KR0B 2K06A 1Q53A 1TK8A 3PO5A 2H4YB 5AXNA 4N41A 1PYSB 4DSEA 4ETZA 1PILA 1M0SA 1NM2A 2A1BA 1FKAF 5KT4A 1SI9A 3LANA 2E1MC 2DGWA 4P9SA 3RZAA 2NLWA 1ZH5A 3AD8C 4AQYF 4N47A 4ED8A 4DV6J 4A48A 4RW6A 4DPXA 2XS7A 5E3QA 2J6SA 5KFFA 4Q7AA 2V8PA 2RRAA 1WSRA 3DDKA 1UETA 1Q86T 5ETTA 1V5VA 3CTRA 3KKFA 3FK4A 3UWTA 3QFWA 2ACYA 5C5JA 1TL1B 4WP3A 2QSFA 2I6WA 1IBMF 2FY1A 1U6BA 2KTQA 1JXEA 1UPPA 3RRKA 3MR5A 4J90A 3PHTA 3AAWB 1JJ2R 1X60A 3I0RA 3BREA 1VBYA 3D1HA 1LW0B 4K7QA 4RUBA 3HHLA 2LFVA 4OJ1A 3BV8A 3BPSP 2GS8A 5ADZA 1U0HA 3MM7A 1S1TA 1HD0A 1VLYA 4DPWA 3LO3A 3LUYA 1EQMA 4UOCA 4U7UD 3IRWP 2YNFB 1UJ5A 3G87A 3HF5A 1U6ZA 4ZCKA 5L46A 1MN9A 1EIYB 5C42A 3W5ZA 5K8NA 6FD1A 2R7UA 1U48A 1S9GA 3GLJA 1QAIA 3R5GA 2WBRA 3WZ0A 4L75A 5F8LA 1T3OA 2RJZA 2KDOA 2W4CA 1S79A 1VLOA 1Q0NA 1ZOTA 4DV1J 5DGBA 1YJVA 1YK9A 3BO2A 2WSCC 2DEJA 4PPZA 2X7IA 1OWXA 2ZVSA 1HHTP 3JTOA 4F0KA 3RAXA 2W9BA 3OL7A 3KLIB 5KT5A 5K8OA 4UF4A 4Y65A 5J2QA 1Z2ZA 2PEBA 3GJRB 4H54A 3C15A 2MZ1A 1BMQB 5GMKa 2FJBB 2DHSA 1X5TA 2FGCA 1B0VA 2DNLA 1Q81T 1K0TA 4LRFA 4RW4B 1U26A 4WIIA 2DT9A 1HR0F 3TARA 4ZJLA 1LWEB 5KFNA 1F6TA 2MTLA 2X3GA 1FCAA 2CPDA 1RP5A 3QGIA 3ADAC 1YRXA 1YIJS 4ELTA 1Y0HA 1I1GA 2HBYB 2W9CA 4B3SJ 2LEAA 4LF5J 3PVXA 3ZZTA 3KLGA 5GADU 4F04B 2OELA 3CD7A 4JUZA 4J9UE 2VPYB 4FP9A 5DDQC 4M63A 1X4GA 3N6LA 5KTQA 2CQ0A 3V5RA 4DR5J 4HT5A 2CQDA 4Y00A 1MROB 3WC2A 4KSEB 2JDJA 1JXVA 2QYCA 2CJQA 3BBCA 1DURA 4ZN3A 5L8RC 2HIYA 5DM6Q 3CCTA 3CCWA 4RW7B 3AQPA 2DGSA 3OXLA 4MT1A 4XDDA 2PIIA 3PACA 1S10A 1T05A 3M8QA 2W4DA 3K0JA 1IBKF 2BZ2A 3GFHA 4IDKB 5CYQA 2CPYA 4B9NA 4JI8F 2F4VJ 4CYUB 3D9BA 4PG6A 3CIMA 5ITHA 3KK2A 1D8ZA 3OVBA 1EARA 5A6WA 4DN9A 4LBPA 1RT1B 1R31A 3ZZRA 2M2BA 1RHUB 2PMHA 2HWTA 1U7LA 3EJMA 4CM0A 3EVWA 2I5JA 3W66A 4NMLA 1I51B 3KLFA 2QA4G 1UPMB 4I6AA 3RR8A 2ZBIA 4ECTA 4KKOB 2DY1A 3TI0A 3N9UC 2RF2A 4OX9F 3J81Y 3MTKA 3HVAA 2DR9A 3LP1B 1E6YB 1RT7A 2GHPA 4P7TA 3UPFA 3PHEA 1TMMA 2CQBA 3J7ZT 4K2JA 2IA0A 3C16A 4LFCF 1UKUA 4KPYA 2BYCA 4OYOA 3PW4A 1VQ5S 2G4BA 2K1RA 5CCMA 1RTJA 3PY8A 5KFRA 2YKOA 3DC2A 1JNZB 3TR5A 3M4XA 3EUNA 3NGUA 2FLLA 4IO9Q 3LP0B 5DQHA 2ZH4A 4MKYA 4R0JA 3OR2B 2PI4A 2IPOB 2HMIB 1ITPA 2WOMA 3M8SA 2V50A 2PFFB 3RJMB 3MD3A 3M8WA 4ZIVA 3QWUA 1JJ4A 2J0SD 4FPRA 4QIVA 2NQPA 3ZZZA 5A8RA 3CDEA 1CJTB 2D3ZA 3DI6B 2HLTA 3MDFA 4C8KA 2WK4A 1F5AA 5J1NA 1DQAA 2HFOA 5G0RA 4QIWD 1HNIB 1OPZA 3H2LA 4OHXA 5KFIA 4K0KJ 2HBZB 4OYPA 2OSQA 5H9FK 4ZP6A 4IFVB 3OFFA 1ELOA 1NPPA 2GQCA 1VQNS 2RDDA 1FNOA 1APSA 5KFEA 3HX9A 3DLKA 3US5A 3KMQA 4MKVA 4K59A 1GNKA 5JVGQ 4C0BA 2KZMA 3DOKB 4U9RA 1NH8A 4W98A 5LM7E 2WVEA 2BQ3A 1R8HA 2V4JA 1NEEA 1X31C 4IR1A 1NCLA 2CNKB 4DPYA 2HURA 1FRJA 1SC4B 1GXUA 5H1SV 4CIOA 3G71S 5AJ3J 4ZJOA 2HAFA 3KHGA 3DDNA 2G0CA 2UUAF 5HL7Q 2EK1A 2ATCB 1S7IA 4RNFA 3OLAA 2UXCF 1LW2A 1GMWA 2YX7A 3G6VA 2QLBB 4KTQA 3I82A 2Y8WA 4HTJA 1RTIA 5F9NA 3OFGA 3BQ0A 3OW2R 5KT2A 1FNMA 3K89A 4K4ZA 1WF1A 1CJKA 1YG0A 2VFSA 1T03A 5I3UA 2ASJA 3NP5A 3SIPB 4YR3A 4MK8A 2LEPA 1FTCA 3LWMA 1KN6A 2R7TA 5JUMA 4PWWA 1R6YA 1Y7PA 1FRKA 5AXKA 1YSJA 3SYZA 4DL0C 2N7CA 3OL9A 2I1RA 4FZVA 1UZHA 2AT1B 2D74B 3GJTB 4B3OB 1SV5A 1T0TV 2OLWA 1TV6A 1FRMA 5IM0A 2AJ0A 2KU7A 1J5OB 1HNXJ 1N88A 2E1PA 4GVBA 3Q89A 2UVRA 2V8HA 4WFBQ 3SV4A 3NGDA 1UVMA 1I5OB 3H40A 1C0TA 1HNVA 2ZNYA 1Y00A 5EWEA 4PCQA 1FJGF 2BDPA 3Q23A 4JV5J 2HW3A 1HHQA 1UVIA 5IC4B 2J5AA 3TRGA 1VGYA 1X7VA 1XERA 1V6HA 4LFBF 4XPCA 4OLPA 3H0PA 3AFGA 2BJ7A 2YX1A 5A76A 4R5PA 1BQMA 4DU8A 4ID5A 4AT1B 2GAGC 2HPUA 2PFDA 2YH0A 2BQUA 2FVCA 1KQGB 4EO6A 1N54B 1NJWA 2AHOB 4UUWA 3SXLA 3TA2A 2DXFA 3AT1B 2FLNA 2OPQA 1JIHA 4NXMF 4F8RA 2CDRB 5EUHA 4M5MA 3PFOA 4IG0A 2YPYA 4X4PA 1VQMS 1IKXA 1NK0A 1FRIA 2VBXA 5I42A 1FRLA 1SQGA 2RHQB 2EG2A 2YKQA 5EGYA 4DR6J 3FQLA 2OEMA 4JI5F 4C2MA 3P96A 5B0EA 2RT3A 5E3AA 1RLCL 3QBCA 4DCJB 1HI0P 1YGYA 3R6GB 4KT0C 2BW7A 1REVB 4I67A 3JQJA 2E5LF 4X66J 3TEHB 5K14B 1JLEB 2ZH5A 1WC0A 1TMJA 2VG5A 3BO4A 3B78A 1D8YA 3ZC4A 4M5LA 4ED3A 1TKZB 1FFGB 1C0UB 4X2BA 3QZ8A 3KHHA 1Q78A 4IOCQ 3UE2A 1RKJA 1NJZA 2DCLA 1WKKA 2GC8A 2X3DA 1RWPB 4LF8F 5HBMA 4O4GA 3BJYA 1VIOA 4LSLA 4CO4A 2R8HA 3MXHP 3CEDA 2BJ9A 2LKZA 4BS2A 2J7UA 2YPZA 2H5JB 4K8RA 4P71A 2OFHX 2J76E 3LA0A 9RUBA 1N36J 4H4MA 2R3VA 4PYDA 2AJ4A 4GO7X 4ZCMA 4J9PA 3HSDA 4WZMA 3W5YA 1WC1A 1RU2A 2P9EA 5BYSA 4HYKA 2MKCA 4FVMA 4JP8A 1S6PA 4EO8A 4UY8T 1RWXB 3V6DA 4DS4A 4UUXA 3F44A 2RSQA 1GAOA 3M6VA 3GV5B 4U95A 5C7PA 2CWXA 2V9KA 2VKZG 4BWJA 2QL9B 1NPKA 3IBCB 4WP8A 2XMAA 1S97A 2JEJA 4A8WA 2IM2A 3L3CA 3AOCA 3NS6A 3KJFB 5K8PA 1GEHA 1Y10A 2WONA 1F9HA 3C8YA 4RWWA 3M9OB 3NGSA 2QL5B 2GJ2A 2QMXA 3B4DA 4RR5A 2Z57B 1NK8A 1VMBA 1RBAA 2NXJA 1N56A 1N5YB 2KFYA 1N5TA 3ZZ0A 1S4EA 5IV3A 3PKMA 1KQKA 3ISZA 2MLXA 1Q8KA 3WIUA 4J5OA 4MYUA 5IWAF 3MMAA 1X9SA 4QR1A 3K2YA 5HVGA 2L08A 2AV5A 3G6YA 3DDIA 3KDOA 2DCUB 3UNYA 1XNRJ 1S5ZA 5HQMA 3GIJA 4A8OA 5KOWA 3ZFVA 5D0EA 4DZ6A 4EZ9A 5D6GA 1FXLA 2ZZTA 4RBVA 2F40A 2BRKA 3DMJA 4CLWA 3QT6A 2LCWA 1UA0A 3DOMA 1SKSA 2OMOA 4DR4F 5KAKA 2PA8D 4OQJA 3N5FA 3CIZA 3GPAA 2GCFA 4NOHA 3NL0A 4CT9A 5CD4H 4LRAA 2EBEA 8ATCB 1JQGA 1HWJA 4DU7A 2ZDPA 3M2VA 5M2PA 1R0AA 2LQJA 1S59A 3H90A 3E8OA 4ZP9A 3MECB 1EQ0A 3CC7S 4F3OA 4DX8H 4F3QA 3VQSA 4DLEA 2CJKA 2V6AA 2UUCJ 4PPDA 1VRTB 4H4KC 4LF7J 4PXDA 5KFKA 2CNOB 3SBMA 2F8HA 1S4FA 2BJDA 2QE5A 3IM9A 3BO3A 2CQHA 3NAIA 4DV4F 4ZMMA 5THWA 1C1BB 3W9HA 1UFKA 4LMZA 1F5CA 2FQQB 2ZH9A 4ZDNA 3G82B 1IM4A 2CJYB 2ERRA 4O3PA 5A8WA 3VVUA 5J1EB 4QOTA 4DL5A 3SCIE 3A8KA 1XC9A 3KOAA 3IN5A 3BM7A 5HJYA 3CD6S 3A8IA 4LREA 3KLVA 2UV8A 2MJUA 1WG4A 1L3SA 5FDLB 4LF1A 2MGZA 2PGCA 4TKTA 3R97A 4K4WA 1EJ7L 4B3RJ 2BE2B 1ZAXA 4XTTA 3HD2A 2YKNB 5JXSA 2OIHA 3LAMA 4ES3A 4FVCA 3P3DA 3BR9A 4F4YA 4FS1A 1NSQA 4L74A 2LU1A 3SQGA 2XSJB 1K8AT 1W2IA 3O1LA 1G3OA 2MLYA 2HS3A 3KMSA 1HNZJ 2IAJB 1LWCA 2IDLA 3GFXA 2KFZA 1WOOA 4C0HA 4LQ3A 7AT1B 1SKWA 2KB2A 3FMWA 2QG9B 3ITHA 4UZBA 4DBQA 1FDBA 4NYOA 2ZH1A 2A2CA 3GR1A 3R5JB 3M9NB 2DPIA 3GYGA 3FGVA 4YOEA 4OYIA 3EZ5A 2AIRB 2ZDOA 5HAOA 2Q79A 3MD1A 4WFNQ 1TL3B 1ZYQA 4M5DA 2H1YA 2VA2A 1HBUA 1JLGB 3MM9B 2KJWA 2WB4A 4Y2KA 4JI2J 4UQTA 3NEKA 2Z2LA 4KYZA 1S9FA 3K7RA 2VFRA 3HZEA 4P2XA 3CCSS 4GVLA 2CG4A 3UCZP 3TA0A 3T6BA 2KT2A 3PJXA 2QT7A 3PRVA 5HP1B 3I87A 1RT3A 2ZHOA 1M5HA 4YFUA 1HBMB 2FVSA 1OQ3A 2ZD1A 4Y0FA 4S0MA 4X4NA 1FXDA 4NYZA 4UW2A 5C2CA 3V4IB 1XMQF 5BYQA 2ZM6F 3QZ7A 2AP6A 3N6NA 1Y11A 3PZPA 2ZJQQ 3AA8A 3FEYB 4G1PA 3KJNB 4P2FA 2JC0A 1VK3A 3LPEA 3PIPQ 4YY3J 1KVIA 4X64F 2GJFA 1RAAB 4O23A 3R8YA 2WVDA 2ROEA 4RW6B 4WFAQ 4LIWA 2KO1A 4QBUA 1HBOA 4ZKAA 1LXJA 2RD5C 5L39A 1XIQA 3HO1A 4BBYA 3PW7A 3TYTA 3MEGB 3OTBA 4GC7A 4HDHA 2Z2ZA 2BQRA 4MKAA 3GJQB 1HQUA 2AJQA 4DV7F 2M70A 4HR2A 2FYXA 2DJWA 1Q7YT 1B70B 3P8BB 4G3IA 4DR1J 1QVFR 2KVQE 1WHVA 3DGPB 3MZIA 4QWAA 4DR2F 4JI4J 5HI7A 4K4XA 4YB7A 1U24A 1GXTA 4E0DA 3RR7A 3UDVA 3HP6A 3L09A 4OI2A 4F4AA 4DSLA 1JWWA 1MU2B 2L41A 1M5PC 1FX4A 4N76A 1U0HB 4NRTA 2G2ZA 1SJFA 3WC0A 4OI6A 4JI7J 2HZCA 3NOGA 4RPFA 4ZCLA 2AGPA 4E98A 3T41A 1IBLF 2CAJA 1MN7A 1EP4A 2IRYA 3OPKA 1CG2A 2V8VA 2DGQA 2WW4A 4NYPA 3SSQA 3TVZA 5C42B 2YKMB 4USKA 2VD3A 1WDDA 4UQGA 4USWA 3QT8A 2QJ3A 4NCBA 4ANDA 2EVZA 1N33J 5F8HA 3PDNA 1QSYA 2YWGA 1F9EB 4WK1A 2N3LA 1UA1A 1BGXT 1SVDA 2VASA 3MM8B 3RB6A 1RT6A 1WG1A 4ED1A 1HPZA 1SJ4P 4X62J 2KHCA 4TYBA 5J2QB 3FQKA 2F65A 3ZTQA 1EAYC 3HFVA 5ETPA 3IMQJ 4DFPA 1RQ0A 3ET6A 3DLHA 4JI0F 1MSWD 4NZ7A 1FK9A 2MKIA 5HROB 2CQ1A 2HHVA 1RACB 1XQIA 2OO4A 3OSNA 1P9YA 3FBFA 2BJ1A 1GMUA 4JBCA 4F4ZA 1H73A 1PJ7A 3WDOA 1IKVB 3RB3A 2GMLA 3D66A 1UWBA 2ZFHA 4C8LA 2R7OA 2W9CB 2JVRA 3LPYA 3IFEA 2EBGA 2QGFB 2V68A 2VB6A 3PJWA 2HFVA 4J9QA 2VQFJ 3UN5A 4NA2A 2FLOA 2HWHA 2Z2YB 3IWNC 3DLEB 2B51A 1IN0A 3W9JA 4KQZA 1V3RA 2RS8A 2EC0A 1N6QB 3L9ZA 1SKUB 1JX4A 3SV3A 1YZ7A 1GQEA 1OYDA 4F67A 2B3TB 3CWJA 2MHNA 3CC2S 5J1PA 3AQOA 2IVFB 1VJWA 2MKYA 4O3RA 2PT0A 3HZGA 2RUGA 4A8XA 4ZVTB 2MQNA 4YHHF 4EBCA 3LP2B 2OPSA 2KL8A 2HGNA 1YJUA 3MFHA 1SKRA 5ETNA 4ZLNA 5F8GA 4B3MF 4NLRA 1WC5A 2GVDB 3G8SA 2KM8C 2J7KA 2BANB 1D9FA 1ZM2A 4CO3A 4ECWA 3UR0A 3QIPA 1SPBP 4PKDB 3X1LB 3C14B 3Q22A 4Y28C 4OJ3A 1DJ0A 5DO2A 2HBRB 4WF9Q 3N5BA 3MWBA 2HG4A 3T1YJ 2ZUGA 2BRLA 1CQNA 1RXOB 2FHOB 4DV3J 5FLXY 3QT7A 4A8YA 1HNWJ 4K4UA 1BQNA 3D6MB 1U1PA 1B99A 1B0PA 2RUSA 4C6AA 4PZVA 4WZQA 3IAM9 2RB7A 1XWLA 1W7WA 2RNEA 4M5JA 2V5HG 4C7QA 4L72B 4YQWA 2VJUA 1RWKB 2B4OA 3SZ2A 3QRPA 1T11A 4C8OA 1VBKA 3G86A 3SCKE 2QRRA 2CPIA 3GMGA 3BQ2A 2DPJA 3MEDA 1Q8IA 1NK5A 1RA7A 1DTTA 2CADA 1KC8T 3QPIA 3G8TA 5M2UA 3MR6A 2C3OA 2G0IA 1FJCA 1Z2LA 1WSVA 3Q86A 1RTJB 1WC4A 5GMDA 2Y0BB 4JYAJ 2W2NP 3K5NA 1VRUB 5K9FA 2GV1A 3KDNA 2ZH6A 2Z2MA 2XM3A 3W60A 2F8EX 4DV6F 4IOAQ 4MIBA 2C3YA 1S1UB 3FSXA 4PWDB 4I4BA 3CJ8A 3MM6A 3H98A 4N7TA 5DZ6A 2VG6A 4ZHRB 4ZOSA 1UW9A 2XZTB 2JWNA 5CYMB 5A8RB 2EXUA 3I96A 3E01A 4J91A 4RUHA 1TL7B 3HT3A 1LWXA 1QUPA 3QGHA 2QLJB 5ETMA 5KG4A 2KT5A 3RRHA 3EGNA 2LA6A 1Z1ZA 3M1VA 4IG3A 4KRWA 2UXBJ 3GYNA 2XYGB 4CLSA 5KFHA 4FDFA 4DXLA 3F73A 3PEJA 5C24B 3NGKA 4OZ0A 2Y9HA 4WYLA 2VICA 4RJVA 1BLUA 4WP9A 4B3TJ 4IQMA 1MWYA 4OI4A 2HHWA 3A12A 1ZETA 3UCUP 3O8WA 3GSIA 4P2MA 4DV1F 2LXUA 1KD1T 5F41A 3BGOP 1RWWB 5HLFA 2HS4A 2HFZA 3W5XA 3D2WA 1IKYA 1N48A 1URRA 2BMBA 3GONA 1OO0B 1EB0A 3W2VA 3ZNJ1 4F0MA 1S1XA 3KHRA 3ETMA 1HKAA 3FNNA 4WTYA 4Q8FA 2QO3A 2ATLA 3D6FB 1KOHA 1U1NA 1U2CA 5D4NA 1WORA 5E7OB 1LFPA 4H4KA 3KXDA 1S48A 2MQ8A 4OYWA 1WTBA 2Y1IA 5DG7A 4NLTA 1WDTA 1B0TA 2N4DA 1ZPWX 4P7VA 4JOUA 3VALA 1DHMA 4EWTA 1OSDA 3PKYA 3RRGA 2RQMA 5I3UB 2VC1A 2K2PA 4B9MA 1R89A 5L9XA 3P5TL 2B43A 1HFEL 4UTGA 4NMXA 4DSJA 4B3SF 3D4JA 4LF5F 2FHJA 5IM0B 4DL4A 1VC5A 2D9PA 4FYWB 1VYAA 4I64A 4GVBB 4B02A 2AGQA 3UN3A 4OHWA 4ERDA 1YRUA 4DR5F 1SC3B 3DLBA 4DL2A 1SBRA 4NA1A 1RWOB 3D3BJ 1FEHA 3KK1A 3QYYA 2U2FA 1OJ4A 3NY0A 3C6TA 3MCOA 3HHEA 5D4PA 3J80U 5ETQA 2F9JA 2YWKA 2HZVA 4Q2MA 3U1LA 3KLHB 3ENWA 3HK2A 1O5JA 5J2PB 4C8YA 1VK8A 2CJXB 4ZA1A 4DR3J 1D09B 2YWFA 1VQYA 5L9NA 3M05A 1SCJB 2D3O1 3DN9A 5KFYA 4CNYA 3BGRB 4WKRA 3OTCA 1LFWA 5EWGA 2FD2A 2V69A 2F4VF 1RHJB 1RYSA 4TXSA 3FZBA 4I6WA 2BR0A 3TO8A 2E44A 3NGRA 2Z30B 2ZJRQ 1S6OA 1IKXB 1ULRA 5I42B 4L73A 2I2YA 1NU4A 2J6UA 4B9SA 3JS9A 4DG1A 4DPTA 1NKEA 2C22A 3SI8A 3JQMA 1NBEB 2P6SA 4NLSA 2CPEA 5D0GA 4J9MA 2G1HA 3MPWA 1HHSA 3BPDA 2HSEB 4URSA 1AT1B 3IM8A 2W9AA 1DFDA 3LGMA 1QAYA 5KT6A 4Q0BA 5E2QA 4EK2A 1XEZA 4EYIB 3CT9A 1SL1A 3D68A 4KHPJ 4ZPTR 3MCMA 5HBMB 1NJIT 1KFSA 4O4GB 2HKEA 4JI3J 2UUWA 4PEOA 3ZZUA 4LSLB 3OD2A 3DRPB 5GMEA 1WWHA 1CJUA 3QFHA 1YBTA 2OTLS 3PTWA 3W62A 3TAPA 3OTOJ 4M5NA 3UDEA 1VQ8S 1KEKA 5A8KA 2J0QD 4RNOA 1NPRA 4NE9C 4H4MB 3HT0A 5D8HB 3SMZA 3TZYA 3EWGA 1FD8A 3K5OA 3NWGA 3QIDA 4RU2A 4AL7A 2W25A 3L7UA 1CQMA 2R7VA 2GJIA 1HYSB 4FS2A 1C4CA 1JKHA 3DHWC 3CULA 1T9XA 1JLFA 5J2NA 2DR8A 3RG6A 3GILA 1Y5IB 1Z4UA 4KBIA 3CNQP 2QLWA 1B4SA 5IS2A 1FI4A 9ATCB 2BJ3A 4I2PB 5DG8A 3MMCA 4D3HA 2VONA 3FRZA 1HMVA 4K0KF 2BACA 5B7WA 2E7WA 1HD1A 2I9SA 4K4TA 3I56S 3RBXA 4I2QA 3VAHA 1BHNA 3L4BC 1ICEB 3H5SA 3RBZA 4DL3A 2DY9A 1VOMA 2ZKTA 3V4MA 3BH7B 2DH7A 1W2BR 2E9TA 4FKXA 4GMKA 3DRRA 3ZZYA 2B5JB 2OH2A 1FKPA 3A13A 3RAMA 1UAWA 3MMAB 2XCAA 2XY5A 5LJ3Y 1VQ7S 1U02A 4Z7CA 1Q95G 1JJCB 4YR2A 3W1YC 1Y5NB 1U1OA 2N3OA 5L1LA 4ZIWA 1CS4B 2IIHA 2R2SA 4AXJA 4QWBA 3AOBA 1R27B 3I5AA 4X65J 2H4WB 3M8PA 2KJVA 2J0XA 1RYRA 1ZAWA 2HNZA 1ZA2B 2CDQA 5ETVA 1RTDB 2AEFA 5AJ3F 4C11B 1RT4B 3DMJB 1VQLS 1IJFB 1X0PA 2WW8A 4NA3A 1DQ8A 2BKOA 2LLZA 3DOLA 4ZVOB 5CAAA 3LTOA 1CC7A 4FKYA 2ASDA 1F3FA 2EFVA 3D0HE 4OI0A 4IKAA 1HQEA 3I9V9 4HEA9 3KUHA 5D4LA 1JLCA 2OEJA 4CDIA 3F56A 1N0UA 1FE4A 1XMBA 5L1IA 5EWFA 3AD7C 2OSRA 2DIVA 3QSIA 1NZAA 1IUJA 3T19A 3B6BA 2F7VA 2F63A 4ENOA 2C3UA 3W2WA 2NPFA 4KGKA 4DFMA 3R2CJ 3FFIA 1WELA 1C1CB 2WRMA 2BUNA 4XPEA 3NNAA 3AH6A 1XMOJ 3FZ2A 5KFPA 3A1YG 1LEOA 2A6OA 1HNXF 4IRCA 4U96A 4ER8A 3GIRA 2MSTA 4P52A 2RS2A 3KLEA 1R8PA 4EI2A 2WB1D 3FSIA 5IZHA 1FDNA 3DHXA 2GNKA 4JV5F 2D7SA 1OMSA 1J27A 3TVKA 2Z4PA 4NI2A 3CJKA 3IR7B 2DBBA 2DNZA 1WOSA 2MGZB 3NBPA 2X1AA 3MR7A 3D5MA 3MEEB 1V3SA 3DKDA 3OHBA 4O0IA 5KFQA 2FJVA 3TUZC 2V63A 2OPPB 1H2VZ 2ZH8A 2AW0A 4KFBA 4RKUC 3D1QA 1S6QA 1HWKA 2GQ2A 4MKBA 4OYAA 1LWCB 5ETSA 2XULA 3HKWA 3LGNA 2CQ4A 1LQ9A 2R7QA 1N4LA 5HK4A 1SIWB 1VFJA 3ITHB 3GIIA 3QO9A 2CQIA 3BB5A 5IQQA 2YBVA 5D3GB 3TP2A 1Q4RA 1S49A 2PA3A 2YNIA 2XZWA 2IM1A 1X9WA 4DR6F 3V6JA 4HHHA 2UVWA 3D28A 3AY0A 3P6YC 3JYTB 1N5VA 3IR6B 2VU5A 3I4PA 3CJ0A 3AJ2A 4X66F 2G13A 2B56A 2XMVA 4CI0B 3PJ9A 5KG2A 2HQCA 2W8KA 4J9VA 2PD1A 2XYHB 2AEJA 3T3FA 2QIFA 1ZM4A 1H74A 5ETKA 2HHHJ 3O5TB 1U1KA 1KTVA 1NHKL 3JSMB 1ZM3A 5C25B 1RLDA 4RWXA 1WUUA 4TYAA 2JC1A 3HLUA 4N8NA 2V4QA 5FLXU 5BJRA 1PYOB 3K59A 3CO0P 1TL1A 2A6MA 2DITA 3HPOA 3MMBB 4I0WA 3UNGC 1P27B 1AB8A 2DNRA 2IMOA 4LR9A 5EX0A 4RUAA 3BDPA 1N36F 3MTJA 3MI7X 1LW0A 4ZPWR 3CJ3A 4ZVQB 3CJTA 5I4MA 1NNDA 2FTRA 2Y1RI 2HRYA 5F8MA 3R7SB 4NCAA 5KFJA 1S0OA 2I38A 5KFDA 4WK3A 1Q8LA 1HQUB 2LP4A 1AZSA 4OZNA 1AW0A 2YNFA 3DCAA 4DPOA 2Z56B 4NL5A 1Y3KA 4G1QB 2CPFA 3Q8PB 2DHAA 2YNGA 2D3UA 2HQIA 1BE4A 2HQGA 4I7FB 5B09A 2V4RA 3PCOB 3P49B 4N56A 1XN9A 5LMNJ 3OFHA 4J37A 4ED7A 2EKYA 1IXKA 1K44A 1TKXB 4ID8A 3BSNA 3OUYB 1F3VA 4ILLA 1O0PA 1S12A 2BM1A 3KLIA 4ZK7M 4HACA 5IT9U 2XNQA 3NRBA 1UCNA 3QLHA 4O3NA 2DR5A 2DGXA 1GTEA 2E7VA 4RW4A 1S6UA 3D0GE 3ETOA 2NXCA 3U02A 2OFGX 2LDIA 1XNRF 1LWEA 1L3VA 1EX8A 3GSDA 2P9GA 4UZCA 4K4VA 1GK8A 4JI6J 4K2XA 4NCGB 2KXHA 5L38A 4C0OC 3EZUA 1QSSA 2EPIA 5B0DA 4R8UB 2HFSA 4C97A 5DQGA 2XB2D 2W24A 2QA2A 3ET6B 1KLNA 1PG5B 1JJHA 4QJVA 2BKPA 3TAMB 4GKJJ 3UD4P 1NSAA 2FC8A 2FGOA 1NJYA 2RE1A 4R0EA 1PKUA 4LBIA 1MROA 3EZOA 4O3QA 1T9UA 2ZKUA 1XR5A 4Y3CA 2IRUA 1UVLA 2UUCF 4R25A 2GA7A 4UT4A 2R8IA 4RNNA 2PN6A 3RU0A 4LF7F 3HHLD 4KO0B 1JLQB 2FZCB 3BDEA 5CABA 2EK6A 3CDBA 4IFYB 2ASYA 3R6LB 3H8YA 1IKWB 5KFGA 4WE1B 2M52A 1GFWB 3PW2A 2R9LA 2JFDA 1WC6A 4FPIA 2LQ8A 4RUCA 2B9EA 4IDKA 2NS1B 4CYUA 2G1DA 1RGVA 5HN0A 1RT5B 3Q8RB 4V19J 2ZE2B 4B3RF 4YMEA 3VQTA 1HW9A 1YJ9S 3QT5A 4OJHA 2BXJA 3DFEA 3HSGA 2CPHA 5A6PA 2BE7D 3MAAB 4OYBA 3THPA 2UVVA 3QIPB 3N01A 5AXLA 1HNZF 3I9ZA 5F8IA 3DLGB 2OI2A 2MKSA 4L76A 4AUKA 4KKOA 3V2UC 4J9SA 3OJUA 2R8KA 2B8PA 1TVRB 4RW9A 5EHHA 1NB2A 3LP1A 1RU1A 4LR7A 3FC9A 3C2PA 4C3KA 5HMZA 1LV5A 4CP5A 5H9FJ 1F9FA 1OY8A 1JNRB 3V81B 2UU9J 4KIAA 2HK3A 1KLMB 5CZXA 4NLVA 2Q1LA 2H65B 3HHKA 3KJVB 4K4SA 2X1FA 1FWLA 1MWQA 3GR0A 5KT3A 1EZZB 4JI2F 3MEDB 1MWZA 4Y2MA 3LP0A 4MAKA 5KFOA 7FD1A 3T9NA 1DTTB 2YWWA 3TUJC 4U7UK 3OR2A 4I68A 3D1OA 2HMIA 3C6UA 1U1MA 1T95A 2E5JA 1B7FA 2ZWOA 3IGNA 1NXIA 3QATA 3EM1A 4DL7A 3UO0A 3M2UA 4J9LA 4DUTA 1G6BA 4DV2J 1RWMB 2IC3B 3ISNC 1BWEA 5AE3A 1E6VB 4F7VA 3AXKA 1G7CB 3V6KA 2ROPA 1CJTA 1IM6A 3DI6A 1FO1A 4YY3F 2OPRB 2ADCA 1RA6A 3ICLA 1AYEA 1RCOB 4ALZA 2EFOA 1HNIA 2LVWA 5KG5A 1PCAA 4IFVA 3MM6B 3ZTPA 4ZPBA 1B3TA 3JAMY 1K9MT 2YNHB 4U6PA 2FHMA 1KS2A 2RILA 2HGMA 1SIZA 1R0BG 2OMLA 2HK2A 4DR1F 3IO1A 5KFUA 4PYAA 2C2RA 3TZWA 1FRHA 2UUBJ 1YJRA 1TUVA 4JI4F 3DRYA 3LOUA 1TL4A 2E1CA 2XQCA 4ZVUB 2IJRA 4CO0A 3R5CA 2OJ3A 4A47A 2HNDB 2XI2A 3PNIA 1RBLA 1Y5LB 2HBQB 5L1KA 4GO5X 4H4OA 3I0SB 1QTMA 1TKDA 2D69A 4JI7F 3DYAB 1U2RA 2ZBQA 4ZPVR 4MH8A 4OYZA 1HI1A 3N4WA 2DR6A 1X4HA 1RADB 3ONQA 4FN5A 2OTJS 3H59A 4QIEA 4ECXA 2DR7A 1JLAA 1SQFA 4NLYA 2VUGA 2HQFA 1N33F 2DNOA 1NK6A 2C2EA 5KFBA 4ICLB 2IY5B 3L7PA 2J8SA 1KKHA 5CHCB 4X4RA 3QNWB 3AB2B 3ELHA 2B6AA 2PMWA 2CKWA 2EWHA 1IKYB 2WSFC 1V9OA 1ZBTA 1VQ6S 4X4UA 4O0NA 5E3RA 2C3PA 3NMAA 4X62F 5BR8J 4ED5A 5LMUJ 1HI8A 4N8OA 3EPIA 4EUVA 3H2VE 1HBNB 4LBHA 1NK9A 1J5EJ 1KP6A 2JSXA 4NEYA 4B3OA 2J9EA 3TW0A 3H25A 1J5OA 1U1QA 4RW8A 2HHTA 1KNZA 1KDNA 3UCGA 4CLKA 1FX2A 2GW8A 1TFYA 1RAEB 2VBWA 2XGQA 1PJ5A 1DZ5A 2KVIA 3CGIA 4X4TA 2OD6A 2WVCA 2YWHA 3BF4A 2XBPA 4PXCA 2W7OA 4OI1A 1M1GA 3M7VA 3Q2SC 2VF3A 4CH1A 1X4FA 5DM7Q 2DYAA 2QEXS 1YTYA 1H72C 1IBCB 3OQ2A 5E3CA 2RDJA 1FERA 2CNNB 4LFAJ 2PEHA 2VQFF 2HEKA 2QFJA 4P74A 2XLIA 1OYEA 4ZVSB 3CF5Q 4DQRA 3VTIA 2MZSA 2W4PA 4LT6A 4M5IA 3NGTA 3KK1B 1H7XA 1BUXA 4WJBA 3FVYA 4MYTA 2FJEB 2CPZA 3C6TB 4JV2A 3T9ZA 1S57A 4MFBB 1VC6A 4O44B 3CJSA 1K1QA 2POKA 3K57A 4U8YA 2AYGA 4E8UA 2XHWA 3PRBA 2NXEA 1RWUA 4KJIA 5DETA 2HHQA 3OTEA 1VIXA 5GAEI 1VRQC 3S7RA 4P10A 3D3CJ 3HFKA 3POTB 3BBBA 3TQ1A 4L3NA 1N5SA 2XGPA 1DY3A 1XK8A 1YDLA 3IG1A 1BC6A 4QPTA 1GH8A 2R42A 1VQOS 2MZTA 5HATA 2E29A 1GMWD 3OL6A 1PC5A 4PRFA 2AYEA 3BZQA 1WI8A 1V3ZA 1H7WA 4XAKA 1FKOA 4HI2A 5K14A 3T1YF 1JLEA 2XMWA 4DUZJ 5MAOA 1RJJA 5BYRA 4DV3F 2D3OR 3GCXP 1LXNA 1HARA 4N5SA 1HNWF 4HHJA 1TKZA 2AZ1A 1C0UA 2VQEJ 2B7BB 1RAJA 2B7CB 3P5BP 3HMJG 3HJFA 2VJVA 1PJ6A 2C2ZB 4WWSA 2LYVA 2M3DA 3X3UA 5LJ5Y 3IP0A 4QU7A 2V2ZA 1F5BA 1RTHB 1DLOB 4QYRA 4TNOA 4DPUA 1LK7A 3M8ZA 4MK7A 3J7A1 4RU9A 4DV5J 3TQEA 1Q79A 3RB0A 5KFAA 1SH3A 2HFUA 1LKZA 2JEIA 1KSPA 3NOCA 1HIYA 1HLWA 2P2CB 2AU0A 3I6PA 4M8LA 2H3EB 2O5DA 1FWKA 1RT2A 2QV6A 1FVSA 3NNHA 2DNGA 3GWCA 2A0FB 1LWFA 1CJUB 4JYAF 1RDRA 2DXEA 3VVTA 1QE1B 4NEZA 4CZCA 5A0YB 1QD1A 1SJ3P 3CUNA 1MMLA 4IRDA 3EDQB 4B17A 1B7YB 2BX6A 2GQQA 4J9OA 1FTRA 3HCXA 2NPIA 5E5NA 4Y34A 3M2RB 3FBEA 4ED6A 3NCRA 1YZ6A 1Q16B 4TY8B 4I6YA 1UZDA 4IH6A 2JL9A 3SFGA 3CCZA 1N5YA 1TQLA 1KONA 2KT3A 3I32A 2DNPA 1L5UA 3HM9A 1RK8A 3KHLA 1SQEA 4AE5A 1IQZA 4X4QA 2AJ2A 2FJXA 4QZVB 1IR1A 4P6QA 1QJHA 3UVJB 2IMWP 3HXMA 3IA0A 1L3UA 3VAGA 1HMVB 1YX2A 4CLUA 1FE0A 3GV7B 4PQAA 2CXEA 4LIRA 2XLJA 2R2TA 2UXBF 1NDLA 4WKYA 5D0HA 4OYMA 4LF6J 5L1JA 1WKJA 2CYYA 1X4DA 3AJDA 3TAQA 2QYGA 4CH0S 4OMFG 5H9EK 4JI1J 3FRYA 2FIUA 3BKTA 1RABB 3IS9B 3R5AA 4Y6IA 1YQHA 1EETB 4B3TF 1G2EA 4DQPA 4Q8EA 5CYJA 4GRSA 4FBTA 3M32A 2DGVA 4MK9A 2BOAA 2QSWA 1UW4A 2YY3A 4ZP8A 3BYRA 2HNZB 3MECA 4WU3A 4KY3A 3K17A 1VDHA 2MB0B 2GIRA 1O51A 2HNYA 3KK3B 5CD4A 3R2DJ 4OIXA 3VWSA 1VRTA 2DHXA 4B9LA 2NZCA 4NXNJ 2YH1A 5B0BA 4C48A 1HQEB 4KC5A 2W2PP 1SJQA 2NR0A 1MNEA 4BCAA 1C1BA 4RL1A 1W26A 3G82A 5J2MB 4XIUA 5D78A 3CJ2A 1RISA 5J1EA 3UQSA 2LU2A 3UD5A 2M9KA 1PBUA 3BGFA 4Y2CA 3C46A 3MEKA 3R7NB 2M88A 1DQ9A 2CJBA 5FDLA 4USHA 3LW5C 3MM5B 3SCLE 1NSPA 2B9YA 3BKFA 1REGX 1U6FA 2VH7A 2QN6B 2ZBCA 3ENQA 2KM8B 5HMYA 8AT1B 4YB6A 3IXQA 2ZHBA 3VAIA 5DRKA 4DI6A 3AD9C 2RMLA 3ILLA 4KHRA 2IAJA 2B4UA 5B0CA 1AXQA 1VI7A 3QJPA 3BEGB 4NI2B 3TUIC 5EDWA 3R7BB 2CJ9A 2DRDA 1R3NA 2RDIA 2NYIA 2D1CA 4IUFA 1VBZA 2GHVC 3HVTB 5KFXA 4QCLA 2HHXA 1TUWA 4F4KA 4DR3F 3BBFA 2ILZA 2CZ4A 1UP1A 3GG1A 5D0RA 4PQUB 1TTHB 4ZVEA 2AF6A 2HRUA 1NO8A 1TL3A 2J6TA 1JLGA 3MM9A 1HQ2A 3GB0A 2R7WA 1O8BA 5D4OA 1X0FA 3CW2C 3J80Y 4KGZB 5HP1A 2YNIB 4ECRA 1HBMA 5I3QA 4IOBA 1N52B 3G8QA 3TVYA 4MTPA 1UTAA 1C4AA 3CO9A 4TU8A 3CJRA 4USIA 2UP1A 4F4XA 3UFCX 3DRSB 2AJ1A 1RWVB 3CMES 2XMTA 4CTAB 4M5HA 1X5PA 1PC4A 5LXRA 3GYXB 3CB4A 2VA3A 2IBKA 3R9LA 2FUG9 2XY6A 4EFAC 1UFWA 3MEGA 2RQKA 3GZ7A 1TFWA 4KHPF 1KFDA 3FSYA 4JI3F 4F4WA 4ZVHA 3HDSA 2XS2A 4LF9J 2G9OA 4LR8A 5T7LB 2RKIA 1DBDA 5G4DA 4PG8A 3OTOF 3DGPA 3QWPA 4M94A 2WBMA 3TJ8A 3E3XA 2W7AA 3G6XA 3EE3A 5IT4A 1OQ6A 5IXUA 1MU2A 3BR8A 5AXMA 3H42A 5I3PA 5CH7B 2QLFB 1KTQA 2Y3YA 2DVIA 1A7GE 1N32J 1AZSB 4CT8A 1CULB 3ILIA 4Q2LA 4ZLLA 2NZ4A 3UW1A 1VISA 1VHFA 2YNGB 1KRPA 2OAUA 2OUGA 2DO4A 1X4CA 4B9VA 2YKMA 1U45A 2DNYA 3MPVA 3R3TA 1RI7A 3IBFB 4DZDA 5HVFA 2BE9B 4CLLA 4WCEQ 2JFKA 4I56A 5CCLA 1TK5A 4ECZA 3UI3A 3EXCX 2DGOA 3MM8A 2XNRA 4ECQA 3CC4S 4HACB 2BKNA 2Y1LB 2MJNA 4LSNB 3T1HJ 3JSYA 3QLHB 4USJC 2DRBA 2RQ4A 4Q43A 4URGA 4HLBA 3U7JA 4LVNP 4A8KA 3JAMU 5HROA 3T6JA 4M95A 2YQ1A 1BQXA 3EVMA 1H6KX 2JEFA 2E5IA 4QWEA 8RUCA 4X65F 2B4PA 2ZUAA 1CSJA 1IKVA 1I6JA 3RGIA 3RB4A 3RBEA 2NUUG 3BS9A 2CQCA 4ELVA 2EFGA 2UZAA 3CCRS 1NDCA 1S1WA 3MUTP 1NJXA 2ZH2A 4A46A 3DLEA 4CLTA 1L3TA 1R43A 3ZNUA 1FVQA 2V0NA 5AE2A 1N6QA 2M0GB 1T9TA 2AYMA 2IYIA 3OV7A 2QMWA 4P72A 3S8SA 2DGTA 3RUBL 2L3MA 2WZ1A 3HSJA 3BYPA 2HS0A 2HQDA 3NCQA 5B0FA 5HMXA 4OHVA 1UFLA 3I0RB 1OY9A 1NAQA 1XMOF 2MSSA 2RH3A 5DDPC 4B08A 2PI5A 3HHLB 2BJEA 3LP2A 5HJXA 3MM7B 2Y8YA 2R7RA 1S1TB 2HYIB 5F8JA 2GVDA 3OFEA 3ZXWA 2BANA 3NMRA 2XMUA 2ZJPQ 3PYEA 1QAJA 3TZXA 1OSCA 5KG3A 1GMVA 1S1VA 4NLQA 3J7Z5 3C14A 4FXWA 2QL7B 2HHUA 3VGVA 3HJVA 4CCHA 3H5XA 1JB0C 4MMOA 1S9GB 1BD6A 4ZP7A 3CJ4A 1YJWS 2WVBA 4DCOB 1NKCA 4U7CA 2CRLA 1FDAA 2RU3A 5KFSA 3GG0A 1XBWA 4ECUA 2HWIA 3NNCA 4G6VB 3ZTSA 4RNHA 2IYGA 2DISA 4OX6A 1XNQJ 3CCQS 4LF4J 2D9OA 2JOQA 2DKOB 2W9BB 3JQKA 1VC0A 3VCDA 2ZOFA 4RLEA 3C15B 4TQSA 4QU6A 4DR7J 3OTDA 4IH7A 1MLAA 1CJVA 2C42A 4V19X 1CEZA 2A18A 4C3LA 2MQPA 2O1PA 2DHGA 4RW9B 2AEMA 2JX2A 1IWAA 4J9RA 2JEGA 3VHQA 1KBRA 5AE1A 1O6XA 1F2HA 4PWUA 2XWXA 3NKYA 4FXVA 1NZ8A 2APOA 2CPJA 1CBKA 3I4HX 3ENVA 2MZQA 1BY9A 4AD6A 2F5GA 2MLZA 2NCKL 5JMNA 2XO7A 3KLGB 1PBAA 1VRUA 3NCPA 1FJ7A 2FJAB 4DQIA 4YS2A 3SDEA 4RBUA 1NLKL 2CQPA 2WSEC 1FHTA 2HHHF 2VL1A 3CVKA 3C6UB 4E2FB 3PO4A 1S1UA 4A8MP 3QMQA 4PWDA 2MY8A 5KG1A 2GO8A 3QRQA 4BDPA 3AB4B 4B9TA 3QJLA 2QFIA 3M2UB 4LVOP 4YDXA 5GVQA 4ZHRA 2L48A 2G2YA 5CYMA 2A10A 3S01A 3PR5B 1S0NA 1TL7A 2QA4S 5F0WA 3M8RA 2DIUA 4ZVRB 3N79A 4P73A 4TU9A 4FBUA 1X4BA 3OSPA 2FZGB 1T05B 3BSCA 4DFJA 5D15A 2EW9A 3W8PA 3M8QB 2VDIA 2VIHA 1F0XA 1JLBA 2O66A 2VBZA 1RAIB 4CLPA 1WEXA 4G65A 1NDPA 4LRBA 1NDKA 1XR7A 5CYQB 1IVZA 3RW7A 3P45B 4NASA 4OJGA 5F3ZA 5GAHU 4TQRA 1SH0A 4ZPDA 4TN2A 2Q6CA 2XG8A 3KK2B 4KB7A 4DLGA 5C24A 4MJKA 3BSAA 2JZ5A 1CVJA 4A8FA 2BJ8A 5IT0A 2ZC4A 2K3KA 3IWXA 2CWKA 5KT7A 3DU6A 4HH1A 5LMNF 3TA1A 2J9DA 2I5JB 4H4OB 3GIMA 3KLFB 3THTA 2MQMA 3HD1A 2L9WA 2KZZA 1FFSB 3H2UB 2R2RA 1TP7A 2ZEJA 3C66A 3HI9A 4B9UA 3VR1A 3N0VA 2DRAA 5HANA 1JLAB 1QUVA 2RF2B 3B4MA 1IR2A 2JNJA 2ZZMA 1RT7B 1T94A 3HVWA 3C16B 4YEAA 3GFYA 2B6AB 3KG4A 3CPWR 3TJ9A 2FHKA 2K1RB 1P9QC 2C2KB 3SCJE 3ZTRA 3UDLA 2R7SA 4JI6F 2W7PA 2KFNA 1U09A 1IR0A 5IT9Y 3FCHA 2RU9A 4RW8B 2C2NA 2WOMB 1I94J 4ZPAA 1OS5A 4NX9A 3SSRA 1NK7A 5EX3A 1HA1A 2X1GA 2W01A 4GKJF 3MPDA 4DOZA 2OP5A 3H5YA 1RAOA 4DX7A 3TWZA 6AT1B 4FF1A 2M8DB 2AYBA 4CRJA 1GXLA 2UXDJ 2AKWB 2JHEA 2IA6A 4YDDB 2NSBA 5G0RB 3KLHA 1S0MA 3EVOA 2I0XA 2QC3A 3CDWA 5J2PA 1D9DA 1Y4ZB 1T7PA 1K1SA 1FRXA 3MURP 1SC1B 1R8BA 5KFTA 3BGRA 4DV0J 5IQ6A 4LJMA 3E51A 2OGUA 3DLKB 1FA0A 2XSFA 1VCTA 4O4RA 4YN3B 3KNGA 4I69A 1YJNS 4K5RA 2CUYA 2MQLA 4F3MA 3L7OA 2DNNA 4OX7A 3AODA 4USUA 5E3PA 2V4JB 3J7YI 3K5PA 4OHZA 3HSZA 1QLNA 2LECA 4QYZJ 4KH0B 4GC6A 3LGHA 1RHQB 2J8AA 4N77A 4NZ0A 2RAQA 5IC6B 3IG1B 3W61A 2MKHA 2IJFA 2L9NA 1HWLA 3PEHA 3EMTA 1LW2B 1B64A 1FKOB 3KWMA 3NS5A 3PW5A 2H51B 4UY85 3PXGa 3M8YA 1Y9OA 2E9RX 3QJJA 2L9DA 1KHWA 1RTIB 3JTNA 4WYWA 1YJTA 4FYVB 2X1BA 1CJKB 5AT1B 3MHYA 1SL0A 3LF0A 1T03B 4NLWA 4QWCA 1RAGB 2CFXA 1DTQA 4URQU 1SUQA 4OZLA 2UU9F 2OKQA 1AFJA 3Q24A 2VHGA 3DRPA 2VODA 1YHQS 7FDRA 1X8DA 2FHJD 5HVHA 3IRXA 4DUYJ 1SV5B 2AZ3A 1TV6B 1S7HA 4MIWA 1N34J 1RZMA 1ZM9A 1K47A 3M30A 4DF8A 4ES1A 2CNLB 2Y0SD 1W25A 2PO4A 3WX4A 4L3KA 1RT2B 2E1AA 3TNVA 1C0TB 1HNVB 1U47A 2Z8QA 4BC9A 4PXBA 1HYSA 2BABA 1LWFB 2N4CA 4DV2F 4WXOA 2KYXA 1U25A 3FMBA 2GGPA 3I55S 3OVAA 1A6LA 3DM2A 4WFZA 1MW7A 2CQ2A 4ZPCA 1Q7LB 2XCPA 3CSKA 3WHIA 4I2PA 4DF4A 2J0WA 4R5PB 4DX5A 2UVUA 1BQMB 4L6V3 3DRXA 4ID5B 1X9MA 2HHPA 2V94A 2RQCA 1SJRA 3MR3A 2C28A 2CG8A 4NZ6A 1YLXA 4DN0A 4ECVA 3VAKA 1MMDA 5LL6d 1XTZA 2XEXA 2OPQB 3V6HA 1KWMA 2B5JA 4C8MA 4RX6A 3GQCA 3FKBA 2ZC3A 2M4MA 2UUBF 2K7JA 3TJAA 3W65A 1F1BB 4IG0B 4FF4A 4C98A 2QZ8A 1IWGA 4GKKJ 2VG7A 2ILYA 1CS4A 1ZAVA 4PG5A 3CCES 2YKAA 5B0AA 3H4BA 2GFFA 3VAJA 2LXFA 2DO0A 3OR1A 3QGPA 5E0OA 2FJDB 3QRRA 2AGOA 3H20A 2PDAA 3A8EA 2EEYA 1M5VC 2B8QA 4OZ1A 1RTDA 3B8HA 2VG5B 4C11A 1S77D 1RT4A 2GVZA 2H5EA 4AQYJ 4I1TA 4IQXA 2HVEA 3TEGA 2DD8S 5IV4A 3MUMP 4QIGA 1NH7A 2ZHAA 3NS7B 4USMA 2P5VA 2HVHA 5K8MA 1VQPS 2VPXB 2M5YA 3M32B 4ZCIA 4X4VA 3NWRA 4LRDA 2DH9A 2B4VA 3R27A 4NLUA 4HL9A 2UV8G 1IBMJ 2FC9A 2ASLA 5BR8F 2VOOA 4NRUA 1R0CB 5LMUF 2BEFA 1C1CA 2HNYB 4ELUA 1UMJA 4PG7A 4MIAA 1U0SA 1J5EF 5LSLA 4QYZK 2QX0A 4G1IA 2LQBA 4W4MA 3IGVA 1M5KC 1H2TZ 2XMMA 1S99A 3TX0A 1JK9B 3MOJB 2GAHC 3U1NA 1FWPA 1S6PB 3RYLA 3V6DB 4WTOB 2O3DA 2MDAA 1G1XA 4DSKA 3CCMS 1Q5YA 5GADI 1MMNA 1SJ1A 1TU0B 3J7AN 4JV1A 4LFAF 2PC6A 2F9DA 3BN7A 1YRTA 2QTWA 2XI3A 1GT8A 3MEEA 2WONB 5F0UA 2EI5A 2OPPA 1QTNB 2PMZD 1K73T 1TKTA 2XYPB 4OV6A 4KV8A 2ZBRA 2C1EB 1PIEA 2GO9A 3MAHA 3J81j 3QGGA 1T3NA 3LWLA 1LOUA 1VR6A 4ZLPA 4CLZA 2YKPA 4CH7A 2Q6BA 1YI2S 4IRKA 1HR0J 4DEZA 5D3GA 2XTJP 3CCUS 1WTFA 1TAUA 4F0HA 4USVA 3Q8YA 2YQ0A 1D1UA 1Y3JA 3GTYX 3MCSA 5A2QY 1ZTTA 3EDRB 3UD3P 4PUOA 4CO1A 4FNHA 2VDHA 3JYTA 1GX5A 2WHOA 3DOMB 4KH1B 2O01C 4DUZF 2RVJA 3D54A 4TY9A 2IRXA 4TLQA 5T14A 2ACMA 2VQEF 4OX8A 3LQVA 5F8NA 4BLGA 4ETXA 3M2VB 1R0AB 1X5SA 1WF0A 3JSMA 4NLGA 3RW6A 3EXYA 2LMIA 5C25A 1ZZFA 2ZITA 3WX8A 1TZ0A 6FDRA 2XWYA 3Q0AA 4Z7YA 2GIQA 3RTVA 5LSRA 2AQ4A 1WJ9A 2CZ9A 1T8EA 3MMBA 4DV5F 1DRZA 2E9ZA 1BWVA 3DGVA 2DGUA 2IBOA 1WF2A 5KG6A 1SXLA 1Q8BA 1TK0A 4FF2A 2E1RA 2V34A 3G2XA 4U67Q 3CJ5A 1OIAA 4O3OA 1P6TA 4Z2XA 2R8JA 2H54B 2ALYB 4IO1A 5GAEU 1U8SA 2DB1A 1YBAA 1IBKJ 5A8WB 5ETLA 4D3GA 4OI3A 4JI8J 1M90T 5F9LA 3OL8A 2COLA 3CJQA 1XJWB 4WFYA 1UEVA 2NXUA 2NYHA 2RKIB 4G1QA 1H38A 4EGLA 4HTIA 3J81U 2R4FA 3PX0A 2JJ4D 3CD5A 4K4YA 5DZ7A 2PE8A 1TAQA 4I7FA 4QWDA 3W8GA 2MPUA 2XMJA 1ZS6A 1V5IB 3SQGB 2LEBA 1I3OB 2R8GA 4V1Ak 2ABYA 3ENAA 2QLXA 3VAFA 1TKXA 5HO4A 2YVSA 3VGUA 4RZRA 5SUHA 3OUYA 3UN2A 4ZN1A 3PM9A 2W1BA 2V8DA 5B0GA 3SQOP 3IWLA 4KAIA 1FDDA 1UWAA 2V2QA 1NSKL 2XHCA 4PR6A 3KUGA 3G4SS 4K5SA 1S9EA 2DK2A 4AL6A 4OX9J 4OYXA 4HT7A 1GTHA 3HHDA 4QQBA 2XLKA 3DLJA 4HKQA 4LFCJ 5GAGU 3EICA 4WPAA 1FJEB 1CLFA 1H3DA 2VZ9A 4M5DB 1VQ4S 5GAHI 5KOXA 4LF6F 1HBUB 1SH2A 3PX4A 2FVRA 4ES2A 3UR3C 4X84A 2FZKB 4NCGA 4JI1F 4PG4A 3FJ2A 1RUSA 3PR4A 1WG5A 4R8UA 3VGTA 1VJQA 2GX8A 1VS3A 1X5OA 1RT3B 1CPZA 2XC9A 1PAEX 4ECSA 4EZ6A 2U1AA 4FNIA 4IH5A 1ACMB 2ZD1B 5KFLA 2EFPA 2W8LA 3JSBA 3TAMA 5HMWA 2HVDA 1T9WA 3E2EA 3N6MA 1R8CA 2AJFE 2JH3A 2C2MB 2VFVA 4F26A 3R1LA 3KTQA 3Q2TC 2M8HA 4F50A 2NSCA 3O2IA 1N0VC 2E5GA 3IBWA 4HH0A 3U1MA 2AX0A 1AUSL 5K5MA 3FBBA 1S1WB 1YJ7A 1RE1B 4NXNF 1HBOB 5KFVA 4KO0A 1JLQA 4LRCA 3Q8UA 3ZZOA 3D67A 4ED2A 4OHYA 3CCLS 4IFYA 2P6TA 3B82A 3NAHA 1IKWA 4DL6A 4HI1A 3DXBA 5DJBA 5DDOC 4EEYA 4WE1A 5CXTA 2C2OB 2N7YA 1JMTA 2KG1A 1WHXA 2MKJA 3UDCA 1L3KA 2BVZA 4YB1P 1SB6A 2YWEA 1YBUA 4ATNA 3MGJA 1RT5A 2VKRA 3BN4A 2LQ5A 2ZOGA 4QW8A 2F4FA 4OL8A 2Q3PA 4DDFA 1NMEB 2ZE2A 5LXYA 3OXFA 3PYGA 2J9DE 4CWBA 2A2DA 1T02A 4QW9A 2HGLA 4LF2A 3MAAA 2XMKA 1NHUA 1CC8A 1EP4B 1S1VB 4EBEA 2UUAJ 5RUBA 4HVZA 2CA9A 2MKKA 2OHDA 1UVJA 3DLGA 2UXCJ 2DHHA 3VF0B 2ZBPA 3B54A 2GZOA 1PSDA 1TVRA 2Q66A 2F3JA 3TUPA 5FIIA 3JTPA 4UOFA 2W2QP 1LK5A 3D6HB 1AA1B 1RT6B 1HPZB 1MG7A 2MYFA 1TL5A 3V81A 4NWBA 2JRSA 3ILOA
chains in the Genus database with same CATH topology
4XDCA 1NEEA 2FUG9 5J2NA 2XY6A 2DR8A 1KLMA 3GILA 2ZH7A 4IR1A 4EFAC 1H98A 1Y5IB 1UFWA 1Z4UA 4KBIA 3KJVA 2QLWA 3MEGA 4BHQA 1R7IA 5IS2A 2RQKA 3GZ7A 2K7KA 1TFWA 4KHPF 1KFDA 4I2PB 3FSYA 4ILRA 5DG8A 1FRJA 1GXUA 4JI3F 4F4WA 2IVMA 3MMCA 4ZVHA 5H1SV 4D3HA 3HDSA 2XS2A 2VONA 4CIOA 1FK9B 3G71S 3U27A 3SSSA 2G9OA 3FRZA 3R1HA 3KHGA 1HMVA 3DDNA 2G0CA 2UUAF 2BACA 5HL7Q 4K0KF 2EK1A 5T7LB 5B7WA 2RKIA 4RNFA 1DBDA 2E7WA 4C3MA 1HD1A 5G4DA 2I9SA 2HLUA 4PG8A 3OLAA 3I56S 1LW2A 3EYZA 4K4TA 2UXCF 2YX7A 4QR2A 3OTOF 3ZZPA 3G6VA 1D9AA 3DGPA 4KTQA 3I82A 4I2QA 3VAHA 3QWPA 3H5SA 4M94A 4DL3A 2J7WA 2WBMA 4HTJA 3CDUA 1VOMA 2ZKTA 3V4MA 3E3XA 1RTIA 4DQQA 2W7AA 3G6XA 2DH7A 1UWBB 5F9NA 2IC3A 2ZOMA 3OFGA 3BQ0A 1W2BR 5IT4A 2E9TA 1OQ6A 4AYBD 3OW2R 5KT2A 4GMKA 1E6VA 5IXUA 1FNMA 1MU2A 2BBEA 3BR8A 3DRRA 5AXMA 3ZZYA 3C3LA 1WF1A 4K4ZA 2B5JB 2HFNA 2CQ3A 1YG0A 3PX6A 5I3PA 2OH2A 2VFSA 4RW7A 5CH7B 1T03A 2KHDA 1FEEA 1KTQA 1WHYA 1FKPA 2DVIA 5DDRC 5I3UA 1A7GE 3RAMA 1ZPVA 1UAWA 3SDEB 2OPRA 2ASJA 3MMAB 3NP5A 2XCAA 4YR3A 4CO2A 4CT8A 2XY5A 4MK8A 5LJ3Y 2LEPA 1FTCA 3LWMA 1VQ7S 4A4JA 1PO6A 4Q2LA 1KN6A 4YR2A 2R7TA 2ALZA 5JUMA 1Y5NB 1U1OA 2N3OA 2NZ4A 1R6YA 3UW1A 1Y7PA 5L1LA 1FRKA 5AXKA 4A8QA 1VHFA 2YNGB 4TLRA 3WBZA 4F25A 1KRPA 1YSJA 2OAUA 3G6ES 3SYZA 4DL0C 2DO4A 1X4CA 4QWBA 4AXJA 2I1RA 4FZVA 2N7CA 2R2SA 3OL9A 2D74B 4C8NA 4B9VA 4B3OB 1SV5A 1R27B 2YKMA 1U45A 2OLWA 1TV6A 1FRMA 3I5AA 2AJ0A 2KU7A 5IM0A 2DNYA 1J5OB 3OLBA 3M8PA 2KJVA 2J0XA 3MPVA 3R3TA 2YNHA 1N88A 1RYRA 1ZAWA 2HNZA 4LF9F 1KQFB 2CDQA 1RI7A 1RTDB 1SL2A 5AJ3F 4C11B 4Q5VA 2V8HA 2UVRA 1RT4B 3DMJB 4WFBQ 3SV4A 1VQLS 1IJFB 1X0PA 2WW8A 4NA3A 1FESA 1DQ8A 3NGDA 2JLGA 4WCEQ 2MXYA 4DS5A 1UVMA 2LLZA 1Q82T 2JFKA 3DOLA 4I56A 5CCLA 3H40A 1TK5A 4IYQA 1C0TA 1HNVA 1CC7A 2ZNYA 4ECZA 1RT1A 1Y00A 1S76D 3UI3A 5EWEA 4PCQA 2OPSB 1FJGF 2ASDA 2BDPA 2NREA 3Q23A 2EFVA 3D0HE 3EXCX 4OI0A 2DGOA 4IKAA 2HW3A 1HQEA 3MM8A 2XNRA 4ECQA 2CVIA 3I9V9 4HEA9 5D4LA 1JLCA 3FEXB 3CC4S 4AXIA 2BV3A 3F56A 1UVIA 1N0UA 3GV8B 3SEOA 1FE4A 1HW8A 1JLBB 1XMBA 2J5AA 2MJNA 4LSNB 5L1IA 3TRGA 1VGYA 2HNDA 1X7VA 3JSYA 3QLHB 4USJC 1XERA 5EWFA 1V6HA 2OSRA 4LFBF 3EGZA 2DIVA 2DRBA 4XPCA 1NZAA 1IUJA 2RQ4A 4Q43A 4URGA 3T19A 4OLPA 4Q44A 4HLBA 2F7VA 1N32F 4F2RA 3OBIA 3I0SA 3U7JA 4LVNP 3ULHA 5DGAA 1IJEB 2YX1A 2C3UA 4R5PA 3W2WA 2NPFA 1BQMA 4A8KA 4KGKA 4DFMA 3GIKA 3DYAA 4DHVA 1QM9A 4ID5A 3THVA 1D0EA 1UVNA 3FFIA 1WELA 1C1CB 2WRMA 3T6JA 5HROA 2FLPA 4M95A 2IM0A 2BUNA 4XPEA 3NNAA 1S0VA 1BQXA 3AH6A 3FZ2A 2HPUA 5FJ4A 2YH0A 2IM3A 5DS7A 2BQUA 2FVCA 5KFPA 1BQNB 1H6KX 1KQGB 3A1YG 2JEFA 2E5IA 4QWEA 4X65F 4EO6A 2B4PA 2IVYA 3S1TA 1CSJA 1N54B 1NJWA 1IKVA 1I6JA 1HNXF 4IRCA 2KH9A 4UUWA 3SXLA 4LQ9A 4FXDA 3RB4A 3RBEA 3TA2A 2MSTA 1E6YA 2NUUG 3BS9A 2CQCA 3LAKA 5KG0A 4ICLA 1WACA 1NK4A 4ELVA 2FLNA 2OPQA 2N82B 2RS2A 1JIHA 1R8PA 3KLEA 2WB1D 2EFGA 3FSIA 5IZHA 5LT5A 2UZAA 4NXMF 1FDNA 4F8RA 2BOPA 3CCRS 2DNQA 1S1WA 4OZJA 4DWIA 5EUHA 3DHXA 2GNKA 3MUTP 4HDGA 1NJXA 4JV5F 2R7XA 2D7SA 3PFOA 1UEUA 4DFKA 2RRNA 2ZH2A 2CPXA 4IG0A 4X4PA 3TVKA 4A46A 3DLEA 2Z4PA 1VQMS 1L3TA 1IKXA 5IFMA 1NK0A 1FRIA 2VBXA 2YQ3A 3CJKA 5I42A 1R43A 1FVQA 3IR7B 3O6QA 1FRLA 3T5JA 2V0NA 2DBBA 5AE2A 2DNZA 4OLOA 1N6QA 2EG2A 2JVOA 2YKQA 3T1HF 2M0GB 5EGYA 2MGZB 3BGUA 3FQLA 3NBPA 4ZVFA 1HBNA 2AYMA 2IYIA 4C2MA 3OV7A 4JI5F 3P96A 5B0EA 5D77A 2RT3A 2QMWA 5E3AA 2GHWA 3VZHA 4DSIA 2X1AA 3S8SA 3D5MA 3MEEB 1HI0P 1YGYA 2DTJA 4KT0C 1V3SA 3OHBA 4O0IA 2DGTA 5KFQA 2FJVA 2CZVC 2L3MA 3TUZC 1REVB 4I67A 2OPPB 3KFWX 1H2VZ 2E5LF 2HS0A 3NCQA 5B0FA 5HMXA 2ZH8A 5K14B 4OHVA 1JLEB 2ZH5A 3PW0A 2ZZNA 1UFLA 2AW0A 2VG5A 4KFBA 3O3LA 4RKUC 3D1QA 3BO4A 1S6QA 3I0RB 1HWKA 2GQ2A 2PSZA 1XMOF 1NAQA 3B78A 1D8YA 2F8MA 4MKBA 3ZC4A 2MSSA 1LWCB 2RH3A 4ED3A 5DDPC 4B08A 2PI5A 3M6UA 1TKZB 4K50A 1C0UB 3HHLB 4FF2A 2BJEA 3LP2A 2KXFA 4X2BA 3QZ8A 2XULA 3KHHA 3HKWA 3LGNA 2CQ4A 2FB0A 1Q78A 4IOCQ 4DSFA 3UE2A 3N28A 1NJZA 1RKJA 3MM7B 2YX4A 2BM0A 1LQ9A 2R7QA 2DCLA 2R7RA 1S1TB 1N4LA 2HYIB 5F8JA 3CXCR 3OFEA 1SIWB 1VFJA 4AFFA 2GC8A 3ITHB 4Z37A 2BANA 1TR0A 3NMRA 1AROP 3FDSA 4YUDA 4WU2A 4LF8F 2XMUA 2ZJPQ 3PV8A 5HBMA 3GIIA 4O4GA 1QAJA 1OSCA 3QO9A 3BJYA 2CQIA 1VIOA 3BB5A 5IQQA 5KG3A 4LSLA 4CO4A 2R8HA 3BQ1A 1S1VA 4NLQA 1H0HB 3MXHP 5D3GB 3J7Z5 3TP2A 3CEDA 1NB7A 1Q4RA 4FXWA 1S49A 2LKZA 2PA3A 2HHUA 3MFIA 4CCHA 3H5XA 1JB0C 2YNIA 3M6WA 4DMZA 4BS2A 2J7UA 4MMOA 2I8EA 1S9GB 2XZWA 3AHPA 1UL3A 2OFHX 2AD9A 2IM1A 1X9WA 4DR6F 2J76E 3V6JA 1BD6A 2UVWA 4ZP7A 3CJ4A 1YJWS 1RKIA 2FVPA 2VG6B 1NKCA 3D28A 3I31A 4H4MA 4U7CA 2CRLA 4QR0A 1FDAA 2RU3A 3AY0A 3P6YC 2AJ4A 4GO7X 4ZCMA 2HAIA 5KFSA 3E01B 3H5UA 3JYTB 4J9PA 3GG0A 1XBWA 1N5VA 3IR6B 4ECUA 1N33F 2HWIA 1YWXA 4WZMA 3NNCA 4G6VB 2VOPA 3I4PA 3CJ0A 3OVSA 4RNHA 3AJ2A 2P9EA 4X66F 4MFBA 2G13A 2IYGA 2B56A 2XMVA 1JXLA 2DISA 5BYSA 1WEYA 4OX6A 4CI0B 3DOKA 4O44A 2MKCA 4FVMA 2D9OA 3Q8QB 4CO5A 3CCQS 4HYKA 4Y2AA 5KG2A 2W8KA 2PD1A 1S6PA 2JOQA 4EO8A 2MMYA 4UY8T 3MMJA 3T3FA 3V6DA 3I5CA 4DS4A 2W9BB 2QIFA 1C2PA 3M1VB 1HWIA 1ZM4A 4UUXA 1U2FA 2BA9A 3F44A 1K0VA 4IG3B 2RSQA 1SC6A 3HHLC 3PRDA 1A9NB 4ZVGA 1VC0A 1GAOA 2DNHA 3VCDA 3O5TB 3M6VA 5DLFA 2ZOFA 1U1KA 3GV5B 3IR5B 1KTVA 4RLEA 1VQ9S 4TQSA 4QU6A 2V9KA 3JSMB 3OTDA 2VKZG 4IH7A 4BWJA 1ZM3A 5C25B 2C2DA 3CE8A 2C42A 4V19X 1CEZA 2A18A 4Q45A 3KG1A 4C3LA 4RWXA 2MQPA 2O1PA 3POTA 2DHGA 1S97A 4RW9B 2JEJA 2UUTA 2IM2A 2JX2A 4A8WA 3M6XA 3L3CA 3KYLA 4TYAA 2JC1A 3NS6A 3HLUA 4N8NA 2V4QA 5BJRA 5K8PA 4J9RA 2JEGA 2WONA 3K59A 3L95X 1TL1A 5AE1A 2DITA 1YVFA 3C8YA 4RWWA 4PWUA 3MMBB 4I0WA 2XWXA 3UNGC 3W7BA 3HPOA 3M9OB 5DLGA 3B4DA 1P27B 2GJ2A 2QMXA 3NKYA 4FXVA 3S6EA 1N5QA 4Y2IA 1NK8A 1VMBA 2APOA 2DNRA 2HVZA 1N56A 4J9KA 1N5YB 2CPJA 2IMOA 5EX0A 4RUAA 2KFYA 3BDPA 3I4HX 1N5TA 4P2SA 1N36F 3MTJA 3ZZ0A 3ENVA 2MZQA 3MI7X 4WFXA 1KQKA 1BY9A 1LW0A 4ZPWR 3ISZA 3PKMA 3CJ3A 4NLXA 3RBDA 4ZS6A 4QPXA 5I4MA 1NNDA 2FTRA 2Y1RI 2VFTA 2XO7A 3R5BA 2HRYA 2J9CA 5F8MA 3KLGB 1P1TA 4FF3A 4NCAA 1VRUA 5KFJA 5KFWA 1S0OA 3NCPA 2ROGA 5HLFB 4J5OA 2I38A 1FJ7A 4MYUA 5KFDA 2FJAB 1XNQF 2IJNA 1UJ4A 4WK3A 2NUHA 4LF4F 1Q8LA 5IWAF 1HQUB 4DQIA 2A3JA 3SDEA 1RTHA 3MMAA 1DLOA 4RBUA 4OZNA 3W2VB 1X9SA 1M1KT 1S1XB 4QR1A 1AW0A 2CQPA 2YNFA 3K2YA 2WSEC 3DCAA 2L08A 1FHTA 2AV5A 4DPOA 3G6YA 2VL1A 2JLEA 3CVKA 4NL5A 2HHHF 3C6UB 2DCUB 1Y3KA 4G1QB 3PO4A 2CPFA 1S1UA 3Q8PB 4A8MP 1P1LA 2DHAA 3QMQA 2YNGA 2D3UA 2R2UA 4PWDA 2HQIA 2MY8A 1UJ6A 3K8WA 4F2SA 5KG1A 2GO8A 2KKHA 4DR7F 4BDPA 3AB4B 4B9TA 3QJLA 3GIJA 4A8SA 4ILMA 4A8OA 5KOWA 4I7FB 4PXEA 3M2UB 3ZFVA 5B09A 4EZ9A 4W92B 2B9WA 5D6GA 4LVOP 2V4RA 4YDXA 1FXLA 5GVQA 3P49B 4N56A 1QSLA 1XN9A 4ZHRA 2L48A 1WNEA 3OFHA 3MPYA 5CYMA 4YR0A 2A10A 3S01A 4J37A 4RBVA 2F40A 3R5DA 2BRKA 3DMJA 3PR5B 1ZZNA 5JVHQ 2LQ9A 1FD2A 1S0NA 4ED7A 2EKYA 2LCWA 2QA4S 1UA0A 1DTQB 1IXKA 3DOMA 5F0WA 1F60B 3NLCA 3M8RA 3T5KA 1SKSA 2DIUA 1TKXB 2OMOA 3N79A 4ID8A 4CNZA 4DR4F 3BSNA 1SUQB 3OUYB 5KG7A 4TU9A 5KAKA 2PA8D 4FBUA 4OQJA 2XY7A 1X4BA 3N5FA 4ILLA 1D3WA 1O0PA 2BM1A 3OSPA 3CIZA 4NOHA 2GCFA 3JSRA 1T05B 3BSCA 3KLIA 3NL0A 4CT9A 4ZK7M 4DFJA 5CD4H 2EW9A 2EBEA 3M8QB 1F0XA 1JLBA 1QE1A 2O66A 2MHEA 2XNQA 2VBZA 3NRBA