2KYZA

Nmr structure of heavy metal binding protein tm0320 from thermotoga maritima
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MRYVLYVPDISCNHCKMRISKALEELGVKNYEVSVEEKKVVVETENLDSVLKKLEEIDYPVESYQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Heavy metal binding protein
publication title NMR structure of heavy metal binding protein TM0320 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kyzA00
1TL5A 1Q4RA 1CC8A 1Q8LA 1GXTA 2IYIA 3TNVA 1TZ0A 1MWZA 2OFGX 2BBEA 2BUNA 4HL9A 5K9FA 4ZOSA 1KQKA 2AJ0A 3IWXA 3LO3A 1N5VA 4NPOA 1QUPA 2K2PA 2JDJA 3BR8A 1CPZA 3I9ZA 4F67A 2K7JA 3VTIA 2N4DA 3FRYA 4Q2LA 1X0PA 5B0AA 2KYZA 3BGUA 1AW0A 2W4CA 2LXFA 2XMKA 2IFXA 1APSA 1U7LA 4FNHA 1S6UA 1R6YA 2FHMA 1N5QA 2AJ1A 2HFNA 2HFOA 5F0UA 2OFHX 1RJJA 2ROEA 4DPOA 2KT3A 1SB6A 2QLWA 4ZA1A 3QGPA 1V3ZA 4DL0C 1YJUA 1FESA 1AFJA 2ROPA 1OPZA 2LQBA 1N5SA 2GO8A 1X8DA 4Y2KA 1KVIA 3E8OA 2AP6A 4OJHA 4A47A 2W4PA 2XMTA 2VH7A 4FNIA 2LQ9A 1OQ3A 2L3MA 2ACYA 2PGCA 3HF5A 4OJ3A 1YJRA 3HHLA 1K0VA 2CRLA 3HHLB 3T9NA 2K1RA 2K1RB 1FEEA 2BYCA 3HX9A 4OJ1A 3FGVA 2FB0A 1Y3JA 2HLUA 2OKQA 3MZIA 3HHLD 2XMMA 1TUVA 3HHLC 2G9OA 3HFKA 3KNGA 3TRGA 2OMOA 2XMUA 2XMWA 4HH0A 3FMBA 1SI9A 2FIUA 2OD6A 2PD1A 1FVSA 1FD8A 2ZDOA 3UDCA 5A6PA 3GZ7A 3F44A 2ASYA 1LQ9A 2BJEA 2N4CA 2VV5A 1Y0HA 3IWLA 1CC7A 1OQ6A 4HH1A 5B0BA 3LGNA 2ZDPA 1X7VA 1S6OA 1VQSA 3LGMA 4HI1A 4DN9A 5B08A 2HIQA 2OP5A 2OAUA 1Y3KA 4U9RA 2GFFA 1ULRA 1YJVA 2W4DA 2EW9A 1P8GA 4Y2MA 2RILA 3KG0A 4HI2A 4YEAA 1XBWA 5T7LA 1W2IA 2LDIA 2HLTA 1SQEA 5T7LB 3MCSA 4Q2MA 2QYCA 3CJKA 1Q53A 5B0EA 3CJKB 2ROGA 3HDSA 5B0GA 2BJDA 3KG1A 4Y2IA 1URRA 2KKHA 5B0FA 3BN7A 4A48A 5B0DA 1OSDA 3BF4A 3K7RA 4QOTA 5IXUA 5KAKA 1IUJA 4OJGA 1VQYA 2IYGA 1JWWA 3TOQA 1KVJA 1FE4A 5A6WA 1YRXA 4A46A 4OIXA 4A4JA 2KT2A 1GXUA 2OD4A 2GGPA 4NL5A 2GGPB 2GV1A 2AW0A 2RU9A 2QIFA 4EFAC 1WD6A 1YJTA 3BB5A 1Q8BA 1TL4A 2N7YA 5B09A 2GCFA 5F0WA 3DXSX 2RMLA 1Y9OA 2HQIA 1AFIA 1FE0A 1MWYA 2FTRA 2Q3PA 1N5TA 4YDXA 1JK9B 1P6TA 1TR0A 2K7KA 3DCAA 2GA7A 2XMVA 3BDEA 3WDOA 1YG0A 1FVQA 3QMQA 3KKFA 2QLXA 3BM7A 5B0CA 2RSQA 2XMJA
chains in the Genus database with same CATH superfamily
1HQ2A 3G8SA 2VOPA 2DXDA 4LF6F 1B0PA 4RZRA 1UMJA 4DSIA 5C2GA 2UP1A 1WDDA 1LFWA 2N3LA 4EYIB 3P3DA 4RBUA 3HPOA 4NEZA 2QGFB 3Q0AA 3TI0A 4CQ1A 2HVZA 3QIPB 2VH7A 1B7FA 4J9NA 1UVIA 1U6FA 2V8HA 3LUYA 3HM9A 2PI5A 3KLGB 1SI9A 3T1HF 3DOKA 3NS6A 2ZOFA 1JXEA 5THWA 2CNKB 2QE5A 1NSPA 4JV5F 2O3DA 1QAYA 2NZ4A 5HLFA 3OXFA 5AE3A 2CQ0A 4H4KA 5LMUF 2EBEA 5F3ZA 4EFAC 5JXSA 2QA4G 1R6VA 1RKIA 3R2DJ 4EO6A 4ZMMA 2YX1A 1FK9B 4DR7F 1R43A 3BPDA 3IAM9 2DHAA 4NA3A 1J2VA 4WTYA 3KHLA 1QAJA 2YVSA 2HS4A 3PJXA 2DNHA 2FGOA 1FFWB 2CJQA 1I51B 3IBCB 3MGJA 4PAAA 3KJQB 2R3VA 5KFPA 2AD9A 4JI5J 1R0AB 3FRZA 4DR4F 3EVMA 1RLCL 4K7QA 3BO3A 1NPKA 4DQQA 3MEEA 3H7HB 3BYRA 1SV5A 2HHPA 3O2IA 4E8UA 1JLGA 1U47A 4M5GA 3V81B 2F63A 2VG6B 2DGTA 4JI7F 3W2VB 1NKCA 1JLEB 1WKJA 4HVZA 1ULRA 2W4DA 2RILA 1N52B 1V5IB 2PMZD 4FYYB 2U1AA 4PG7A 2B9YA 5EHHA 4LQ9A 3NCRA 1HQEA 2YNHA 2LA4A 3HHKA 2Y1IA 3KLIA 4V19X 5D4LA 5L1JA 4DV4F 1TK5A 2IA6A 3R1HA 1QSSA 3QGHA 2RF2A 3D28A 3MEEB 2YKOA 1RYSA 4YQWA 1SV5B 1RAFB 3RG6A 2DXEA 2RDIA 3VAHA 2HFNA 1LWEB 2JFDA 1BUXA 5CYMA 1VOMA 5A2QU 1RE1B 5L39A 1PYTA 4CLUA 3OR1B 1G1XA 1XERA 3W63A 2IM0A 5KFQA 4A8FA 2CJXB 3QO9B 3ZXWA 2R42A 4F3OA 1RCXB 1R7IA 4A8KA 4F36A 2YY3A 2DNLA 4DSLA 2Q43A 1IKXA 4X84A 4KE5A 5ETOA 2VF3A 1NDLA 3DRYA 2V69A 2LQ8A 2ZHBA 1U1KA 2EWHA 2DVIA 1KSPA 2XY6A 3BDPA 4LF7F 2KT5A 3HO1A 1YWXA 3UCGA 1S1TB 2YKNB 3EMTA 1TKXB 2E66A 3AY0A 1FE4A 1JLFB 4N76A 4AT1B 1GXUA 4NLWA 2C42A 4KGKA 3D1HA 3CO9A 3PJ9A 3ZC4A 1YITS 3UVJA 4FXVA 3PYFA 2CZVC 5ETSA 3MR7A 2AU0A 2J8SA 2KM8B 3JQKA 4DUZF 5KT3A 1LKZA 1IKWA 3TP2A 1N5QA 2ZH2A 2BM1A 5GAEI 2QLWA 5FDLB 3KMSA 2KG0A 3HHLB 4WCEQ 3M9MB 4UUWA 2AX0A 1PAEX 5EDWA 1YBUA 1FO1A 4B3RF 1N32F 1P27B 1NKEA 2D7SA 2YTCA 5KG1A 2OAUA 2I38A 1O6XA 4CLSA 4F7VA 2UUBF 2L9DA 3QT6A 2OEJA 3WBZA 3UVJB 3I0SB 1D0EA 2WRMA 2IYGA 2X1FA 3Q8SB 3KJFB 3TA0A 2M8HA 4JI8J 1C1BB 2ZWOA 2DNPA 3F41A 2R4FA 5ETPA 2Y1LB 4ED6A 5J2PA 3DRSB 2Y1RI 1E6YA 1RKJA 1YZ6A 4O3PA 3TUZC 5EGYA 1VYAA 2W1BA 2R2RA 4K4YA 3MM9A 2QLJB 4L6V3 4U7UD 3U1LA 2GVZA 2VUGA 5AXMA 9RUBA 1FRMA 3S1TA 1FJCA 1E6VA 4B9NA 1JJ4A 3CJ2A 2XI3A 2AEFA 3RB0A 1U8WA 3JSYA 4OJ3A 2CQ2A 4M1KA 3RAMA 3LA0A 1WC6A 4Z7YA 4HTIA 3K17A 3HFKA 2X7IA 3G96A 1RT4A 4KKOB 1ZAXA 4OZ5A 2GMJA 3HZEA 2NYIA 1WELA 3SI8A 3D6FB 1RA7A 1IM6A 1KHWA 3EVWA 3PVXA 4F4KA 4ECXA 1EQ0A 2HRUA 3VQTA 3RUBL 5KFJA 2MQQA 4USVA 2MQNA 1OWXA 3ZZOA 5HVHA 1U6ZA 4JB8B 3MM9B 3T6JA 4S0MA 3VAIA 3CT9A 3KLHB 4IQXA 2AYMA 3DXSX 1NH7A 1S79A 1O0PA 1CJVA 4IUFA 3FQLA 1REVB 2BJ9A 2HW3A 4QIGA 3MHYA 1FNXH 3GJTB 2KFNA 1VRUA 4J5OA 4Y34A 2CQCA 3CJSA 3P4UB 2LXFA 3MEDB 2JVOA 5CA5A 5D3GB 1KQFB 3A8EA 2LEAA 2PT0A 1R0BG 4JUZA 2VKZG 2JVRA 1KDNA 1U49A 4YOEA 3GU0A 2CJKA 3THPA 2JC1A 1UJ5A 4TU9A 1VQ4S 3MECB 3MPYA 2AHOB 3AA9A 3LWLA 3T41A 1JX4A 4AD6A 3W1YC 2ASJA 4IH7A 4IYQA 3JSRA 1KC8T 4GC7A 4JV2A 3TVKA 2HWTA 1J5EJ 4Y6IA 5LSLA 5A76A 1F0XA 4DLEA 1B3TA 3IBFB 3VCDA 1UWBA 2MQ8A 2R7RA 1NJZA 4ENOA 3QATA 3RYLA 2Z56B 3KDNA 5B0CA 3PW4A 4DV2F 4DEZA 2XS2A 4F26A 3WX4A 3FZ2A 4ZITA 4J9QA 5L1KA 2VIHA 2LKZA 1NJXA 2PO4A 2FHOB 3R8YA 5HMYA 4NYPA 3ZZUA 4HEA9 4ZK7M 5ETTA 4G6VB 1C0UA 2UV8A 1XMQJ 3QT8A 2OTLS 3DYAA 1L3SA 1YX2A 3CIZA 5GADU 1V3SA 4LBPA 1HYSB 4DN9A 1N0VC 2DD8S 1UWBB 2ZBIA 3CJTA 3LANA 1BQMA 2R7WA 2HNDA 2QL5B 4WP8A 1VQOS 4ED8A 3FBFA 3A3NB 1U0SA 1RLDA 2R7XA 1RAOA 1N34J 3I96A 3ELHA 3TUJC 9ATCB 3G82B 2Q3PA 3T3FA 2M8DB 1ROFA 2M52A 3MTJA 3EGVA 1FVQA 2DHXA 4Q44A 2VOOA 5L46A 1ZZFA 1ZPWX 4ZP6A 4WBFA 5K9FA 1RHJB 3I9ZA 4K4TA 3NXZA 1NPRA 3ILJA 2F40A 4WFAQ 2CKWA 1KRPA 2WSCC 3D7SB 3LP0A 4OYWA 3A3PB 3N5FA 4LSZB 4YY3J 1FEHA 2M70A 1BWEA 2HHWA 2XM3A 3QRRA 2C3UA 2JWNA 5A0YB 1TQLA 3IXQA 1BQMB 2H48B 2YNGA 3HT3A 2PMHA 1REGX 4QR0A 2A18A 4OV6A 1S7HA 3PEHA 2CNOB 2FLLA 2L41A 4GMKA 2V8DA 2HSEB 4OYZA 5CHCB 3FEXB 3CJ4A 2JZ5A 4OYOA 4RW8A 1L5UA 4C0OC 4OJGA 3H42A 3A8KA 4LF8F 2RD5C 1HHSA 3NAHA 3L09A 3FCVA 1VR6A 5DO2A 5B09A 3MMBB 2MY8A 2QFIA 3QRPA 2JJ4D 2KH9A 3LP0B 2ZBPA 2KXNB 3FEYB 3CCZA 2XY7A 2OGUA 2VFUA 4I2QA 4Q2LA 1RTIB 3GG1A 1H98A 3U1NA 3GV8B 3HP6A 3IWNC 4WYWA 4ZP8A 3GIJA 3O6QA 3QGPA 1H6KX 3DLBA 1PG5B 3C2PA 4ZLLA 1I94F 2XMTA 3VWSA 4MIAA 2FPHX 5GAHU 1PIEA 4WU3A 4C8OA 4RW8B 4URGA 4CP5A 4LREA 1RDRA 3D67A 2V8GA 4BS2A 3NG8A 5CYQA 1N5YA 2OPPA 3WIUA 5MAOA 2C2EA 4A8OA 2BOAA 1M0SA 1MMDA 3UDEA 2YKQA 1TUWA 4DR3J 3TQEA 1VISA 3N01A 2OO4A 1M5KC 3BS9A 2RRNA 4LF4F 4FF3A 3OFFA 2YQ3A 3KLVA 2DIUA 1U48A 3S7RA 5EX0A 3FZBA 4ICLA 3W8PA 1S4EA 2JLEA 1RWKB 1S1XA 4ZA1A 4J90A 2I0XA 2V6AA 4CDIA 4DR1J 1GX6A 4YP3A 1RTHB 3J7Z5 3OFHA 2QN6B 2Z4PA 1NHVA 4H4MB 2QFJA 3SQGB 1RADB 3K59A 4YB6A 3HSZA 3NP5A 2E7XA 2A2DA 1HPZB 1Y5LB 2QA4S 2D3UA 3AOCA 1TFYA 1N5YB 2OPPB 5IV3A 1PYSB 1NK6A 3PYDA 3OW2R 3R5AA 4R25A 4ECSA 3BO4A 3KDOA 1SIZA 1LQ9A 4CRJA 2R8IA 4DL3A 4I2PB 1AZSB 5HK4A 1UTAA 4W92B 4NCBA 3AD7C 2HYIB 1SH2A 4XPCA 1T9WA 4R8UB 1NU4A 1S1XB 2FVPA 1GMWA 4MK8A 2E7WA 4HT7A 4NI2A 2LA6A 4TYBA 1LEOA 3K2YA 2C3MA 2H3EB 5IT9Y 2J6TA 2HBRB 5IT4A 2DNGA 3NNCA 1S9GA 4ZJOA 4TXSA 3F73A 1UVLA 1PSDA 4DV7J 3OFEA 3ETMA 3KJVB 3O3LA 1ICEB 2BR0A 1S7IA 4OHXA 3QAUA 1CULB 4I6YA 2HWIA 4F04B 1VJQA 4BBYA 2NQPA 1KQSR 2Q6BA 4CM2A 3G6VA 3UE2A 1UFKA 4ZLPA 1R31A 1VK8A 4C3LA 4G1PA 1FDBA 1ZH5A 5KFUA 4ZVSB 2NLWA 1FRHA 4ZKAA 1SKSA 4KO0A 5F8MA 4WU2A 4NEYA 1F5BA 4NI2B 1HD1A 5B0BA 1HFEL 3JSMA 5DLFA 3ZZTA 1H2UX 2NPFA 3MM8A 2MEWA 1SQEA 4CT9A 2QA1A 4AL7A 1FKPB 4LR9A 2MSTA 4K2JA 1VIXA 2XQCA 5KFYA 3EGNA 3DHWC 1X9SA 2HZVA 3MI7X 2GGPA 2D3O1 3CD0A 1S77D 2N3OA 4WFNQ 5DQHA 4NLQA 4HR2A 4DV1J 1RU1A 3JB9k 3BH7B 5CAAA 1YJ9S 1ZM2A 2EBGA 3J80U 1PO6A 4J7CA 2HHSA 3CJRA 3NOGA 4V1Ak 1Q7LB 1PJ6A 3ZZYA 3SSQA 3A4TA 4Z37A 4ZJQA 4UQTA 3W9IA 1N88A 1S0VA 3GSIA 3P96A 1W2BR 2P8IA 2KT3A 2NREA 5DZ6A 4OYMA 3ITHB 2ZNZA 1PKUA 3AOAA 4A47A 4ILMA 4GO7X 4L75A 2APOA 2BX6A 3ZTQA 3MD1A 3QFHA 1D8YA 4IG0B 4I7FB 4DV6J 2AGPA 1XWLA 1U1NA 4KAIA 4ES3A 2HGMA 1JIHA 4Z2XA 1VQLS 2E9ZA 3DDNA 1M1HA 3KXDA 3EUNA 3SFUA 2DPJA 2H51B 4PUOB 1OSDA 4OZLA 3M9OB 3GYGA 2FUG9 2E1RA 4X64J 2E5JA 4NZ6A 1FWPA 1SL0A 1B99A 2GIFA 1GT8A 4NLTA 4PYAA 4ZVTB 2MZJA 2JNJA 5DG8A 2GIQA 2A3JA 3W2WB 2AJ0A 5AT1B 3L7UA 4F67A 1RK8A 4QYZK 1APSA 4OYIA 2R7UA 2PEHA 1WEZA 4ZCIA 1F60B 3WIVA 3VQSA 4FZVA 5M2RA 2BMBA 1I6JA 3DOLB 5D0RA 3AXKA 2M9KA 1UFWA 4DFMA 1WEYA 2DR7A 3MAQA 2LYVA 5IV4A 1TTHB 3IP0A 5DQIA 4QIEA 4OI0A 2IJRA 5HN0A 4J9KA 2EK6A 4EZ6A 4Y2MA 4JP8A 3BPSP 4JI2J 1S59A 5MLCV 2W01A 2D3ZA 5I3QA 4IKAA 1RB0A 4FP9A 1F9FA 3NGSA 4USWA 2NSCA 1M5SA 2DHGA 4FYVB 1WTFA 1HKAA 2BVZA 2JEIA 1Q8BA 1AFIA 4ZN3A 3R3TA 2ACMA 5LM7E 4CH0S 1WOPA 1DRZA 1W7WA 4A8XA 4ED5A 4IFVA 1Q4RA 2ZD1A 3AJDA 1TZ0A 4XDDA 1ELOA 2OPQB 2U2FA 3FDSA 3CVKA 3CMES 4DFPA 3ZO7A 5K8NA 1RISA 3LALA 2KTQA 1ZETA 4UUXA 2VA3A 1WG1A 1X4EA 4O44B 1HW9A 1MN7A 2XHWA 5I42B 1LWCA 1SJQA 4PG5A 4DV5J 3UFCX 2CG4A 5CZVA 4P73A 1CQMA 1T0TV 2OSRA 1FVSA 2VL1A 2LXUA 4N8NA 4K2XA 3M2RB 4JI8F 3TAMA 3U02A 3R1LA 2WB4A 1KR4A 5J2MA 4ZVGA 1BQXA 2GHWA 2WVCA 3ET6A 4FKYA 2QMUB 3AT1B 2BKNA 2ZHOA 4IFVB 3DRRB 4CLTA 1RHRB 1RT1B 3SCLE 1Q86T 1XNQF 4NMLA 1TL7A 1F6TA 3TEGA 3HSGA 4ZIVA 4FS2A 2C2RA 1JLQB 4N77A 3B4MA 3BV8A 1YK9A 5B7WA 1JKHA 3OVAA 1KQKA 3IWXA 1LWCB 3JSBA 2LECA 5KFHA 1U7LA 1YGYA 1SC1B 4FNHA 1HQUB 3TUIC 4I6WA 2ZUAA 1U25A 4EEYA 1SJ3P 3THTA 4CO3A 5D8HB 4ZCMA 1GQEA 2OEKA 4BHQA 1VC6A 3R6LB 4OI1A 1RT7B 2AEMA 1N33J 4CIOA 1HI8A 1TU0B 1HBMB 3MURP 1UPPA 1EJ7L 2KFYA 4C3KA 2RAQA 4F2RA 4MIWA 4RKUC 2VQEF 4PG6A 3Q23A 3C16A 2E5GA 1M1KT 3ILIA 2QX0A 3NGKA 4QWDA 4ZHRB 1S6PB 2UV8G 4AXJA 1JWWA 1M90T 2Z8QA 2B43A 4A4JA 4ZVRB 2FQQB 4OI3A 2VQFJ 1HWIA 4PG4A 2HK2A 4DR5J 4YN3B 4I69A 1G7CB 3P8BB 1S9EA 3CGIA 1JNZB 1XJWB 1UWAA 3QGIA 5KFDA 2ZOGA 1MWZA 1MROB 4LJMA 3DI6A 1CJUA 4ETXA 5B0AA 4FBUA 3E01A 3GWCA 2KRRA 4ECTA 5CH7B 1MU2B 4O0IA 5JUMA 1SC3B 2OMLA 1RT3A 1YJUA 3OR2A 1NK8A 5K14A 3PIOQ 5GAGU 1IBMF 4BC7A 4OMFG 1FKAF 4LSLB 2R2TA 3RRGA 2YKMA 4DOZA 4B3SJ 2GQ2A 1J5EF 1KWMA 3IBWA 2XMUA 2AT1B 4LRFA 3QYYA 4ZIWA 4MYUA 3LGNA 4KH1B 2XB2D 2MGZA 1YJWS 1DHMA 4ECUA 3R5JB 1X9WA 3OL9A 4RUHA 2UVVA 4CI0B 2YPYA 3RW6A 2XWYA 2HQIA 2ABYA 3FBBA 4L76A 2ZH4A 2XYPB 2H5IB 3GYXB 1UFLA 1IVZA 2CZ4A 3HHNB 4K4UA 1NSAA 4OX9J 3RTVA 5K14B 1XMQF 2AZ3A 2JX2A 1U26A 4JI6J 3RR8A 2GC8A 3WHIA 2KFZA 2RUSA 1EETA 2AMCB 4NA1A 2RDJA 2Y8WA 3PO5A 1YZ7A 3C46A 1V3ZA 3FCWA 3OTBA 4Y2KA 8AT1B 4K0KJ 1FX2A 1Q7YT 4Y2AA 5C2CA 3CJQA 2KRBA 3FKBA 1RWXB 2MLYA 1D9AA 1N34F 4JI0F 3IWLA 2HQ3A 3DLKA 2OPSA 3D54A 1SJRA 5K8MA 4U8YA 4X65J 1Q79A 4OHYA 3ADAC 1KQGB 3W9JA 4ANCA 2BE2A 3M8PA 3H0PA 5F8JA 3BN7A 4MT1A 1N36J 4ZP7A 3TOQA 3T1YJ 3PDNA 4K4SA 5A6WA 1YKWA 2GMHA 5GMEA 3E2EA 4PPDA 3NCQA 4G3IA 1EETB 2PC6A 3C6UA 1GTHA 4YY3F 1VBXA 4ZVFA 1N0UA 3I32A 2IIHA 2WW8A 3F44A 5J2NB 1HL6A 4ED3A 4RW4A 1IBLJ 2M88A 3DM2B 4I64A 5F3TA 4KJIA 5DDOC 5I4MA 4KTQA 2DNNA 2IFXA 3R7NB 2F4FA 1Y4ZB 4UQGA 3I0RA 3ENVA 1S1WA 2WOMA 2DNQA 2OPSB 2FJAB 2L3MA 1FKOA 4L74A 3BSNA 2HS3A 1D09B 2FVSA 2A6MA 3OSNA 2K3KA 2BE2B 2FHJA 4F4AA 2HGNA 3DMJA 4N41A 3PACA 3TJ8A 3FFIB 5KFTA 2P9GA 1F9EB 2R8HA 1R8CA 2DGVA 2QC3A 3MWBA 4AYBD 2ZKUA 1DY3A 4YDXA 1N5TA 4DSJA 4C0HA 2DRDA 3R97A 3VAFA 2XZDB 2CWKA 1S6QB 3D68A 2JC0A 3EYZA 2W9BA 1HLWA 2RSQA 5KT4A 2WOMB 4K50A 1HNXJ 4LFAF 3B82A 2RNEA 1FKOB 3MUTP 1SC4B 1VQKS 1DARA 4F02A 1SC6A 2XYHB 1JLAB 4FS1A 3ZTPA 1N5SA 3DMJB 4ECZA 2HEKA 3HJFA 4CH1A 3EGZA 2ZH6A 2XCPA 4EMDA 2FJXA 3OTCA 3IRXA 4DR3F 2BABA 2OTJS 4GVLA 2QSFA 3UD3P 4WIQA 3VGVA 2MKSA 3H2LA 4EYHB 4QU6A 3R7BB 2C2NA 4W4MA 1T9UA 3CJKB 2BA9A 4ELVA 4XK8C 3FQKA 2W9BB 2DHSA 4QOTA 5GAHI 3AD9C 3TYTA 2RQKA 3I5CA 2HWHA 3FSXA 4DR1F 1VQNS 3LP1A 3VGSA 3UDVA 2BJ7A 3IM9A 1GMVA 2PA8D 2YQ1A 2E5IA 4IFYA 3M4XA 4EU0A 5KFWA 4D3GA 3M8ZA 2RRBA 3GIIA 3DLHA 4M5HA 5C42A 2WK4A 2G0CA 1VS3A 4U8VA 2FY8A 1FRXA 3FBEA 1HNZJ 1K1QA 3IO1A 3S6EA 4MMOA 1VRTA 4I4BA 3EDQB 4AL5A 3MAAA 3QJPA 2CNNB 4P2MA 3GFZA 3BN4A 3DU6A 3CE8A 1H3DA 2J7WA 3J7A1 1SVDA 5AE2A 4X4UA 1KOHA 1UW4A 4LSNA 2C3PA 1VGYA 1F2HA 1SH3A 4EBCA 5E3PA 1HBOB 4QIVA 3QSYB 1NK5A 2ALZA 2YWEA 3QLHA 4DG1B 2OP5A 5KT6A 3MUMP 2NXUA 4NLRA 4F3MA 4XPEA 4DV7F 3K7RA 1C1CA 2HAIA 4OYAA 3VZIA 3JTNA 3EE3A 3VALA 3BZQA 5HVFA 1TL3A 2CZ9A 3PYEA 4HACA 2FTRA 2K7KA 1KLMB 2DH9A 3H4BA 3BSCA 4DR2J 1FJGJ 2LMIA 1Q16B 1IBCB 2C2OB 2PE8A 4F4YA 1YI2S 2DIVA 3G6YA 1F2GA 4B9SA 4X2BA 4LSNB 3TJAA 2MY7A 3K5LA 1MG7A 3GFHA 2F8EX 4DUYJ 3EZ5A 3HULA 1T03A 2ACYA 3MUVP 3I56S 2K1RB 4Y3CA 1NK9A 3RAXA 2OPRA 1UPMB 3HD1A 1K8AT 1C1CB 2OD6A 2CDRB 4DX7A 2VG5A 5HANA 1ZM4A 3T5JA 2V4QA 4DV1F 1B64A 3FCHA 2HVIA 1EARA 3LPEA 2YNFB 4CM0A 4Q8EA 1AUSL 3I4PA 5FJ4A 2RQMA 3VAMA 3PG9A 2QIFA 2PIIA 1IBKJ 4WFZA 4HDHA 2C1EB 2ZH7A 3D6TB 3JTOA 4RNFA 4G1IA 1SJFA 4LF5F 1PGZA 4GKJJ 1NM2A 1HNWJ 1T03B 4OV1A 2XCAA 4DV6F 5IWAJ 1IR0A 2E9RX 1H2VZ 2DNYA 2W7PA 3GR0A 1FWLA 5CD4H 2Z0GA 3D0HE 4IG3B 3TVZA 4ED2A 3RB6A 3BBBA 4P71A 5JMNA 1ZPVA 1XMOJ 2ZEJA 2UUAJ 2WONA 2AKWB 4B3MJ 1DQ9A 2EFGA 1XNRF 3V6DB 2B6AB 3FMBA 3RRKA 3FVYA 4X64F 1TKTB 2N4CA 4ZJLA 1B7YB 4TYAA 4M5DA 4C11A 2IAJA 2HAFA 3NLCA 1CJTB 1MMNA 1YDLA 4IOBA 2NUHA 3AB2B 2G2OA 4X62F 5T7LB 1S1VA 4A8MP 4UY85 5D4NA 2VC0A 4RU9A 3W66A 1SKWA 3LW5C 3OV7A 5KFAA 1S1UB 4UZCA 2MQLA 1I1GA 2UXDJ 3WQPA 1HBNB 4DQSA 3RBEA 2H5JB 2YKAA 4NLUA 4ZN1A 1BD6A 3QQCD 2OIHA 2CA9A 3W5YA 1RT2A 5KFIA 3KK2B 1U1OA 4KFBA 2MXYA 3ZTSA 1ITPA 2LFVA 1EKSA 5L9XA 2YX4A 4RW7A 1XR5A 4QQBA 1VQ5S 1GFWB 2QYGA 3CCUS 1UP1A 3SYZA 4JYAJ 1S1VB 4P75A 2WBRA 2UUCJ 2W8LA 3LTOA 3OL6A 3HKWA 1VBYA 2QMWA 1BGXT 3IG1A 2EW9A 3FK4A 3C14B 4YEAA 1FXLA 3BREA 3SCJE 1Q95G 5E3AA 3B8HA 5CQGA 2F3JA 1G4CA 4WTOB 4QIWD 3MEGA 4RNNA 4G1QB 2HVHA 1TVRA 2J7UA 4CTAA 4NCGB 3JS9A 1RI7A 2RJZA 1WI8A 4DV5F 2OELA 1X31C 2BZ2A 1HBUB 3SV4A 1Z2LA 1KFDA 1OPIA 4RJVA 3DRPB 2R8KA 2COLA 3N9UC 2UUWA 1SJ4P 3CULA 1FJEB 5DG9A 2AP6A 5A8WA 4UOCA 4UZBA 1JJ2R 4DL4A 2W2QP 3PRBA 5D0EA 3HVTA 1TKZA 4DF8A 3V5RA 2PMWA 2Q6CA 1Y7PA 5KFFA 1R3NA 2FIUA 2V4JB 3BQ2A 3O5TB 2DGQA 5HP1B 5F8GA 2GVDA 1ZBTA 3R9LA 2QTWA 1XR6A 2ZE2A 2Y9HA 2MMYA 1QTMA 3FSIA 4CTAB 1VI7A 3MM5A 5ETMA 1RWOB 4F4XA 1KVJA 3D6HB 2BANB 2VBWA 5HO4A 3AODA 4Q0BA 4OX8A 2RKIB 1YTYA 1MWYA 3GLJA 4Q45A 1B4SA 4L72B 2CPZA 1QDUB 4P2SA 3UR3C 4I6AA 4RNMA 2BUNA 4CLZA 5A8WB 4ZOSA 1V6HA 4AE5A 3BBFA 2CJYB 3ISZA 3DOMB 1N33F 3MMCA 2EFQA 5LMNJ 1MW7A 2M2BA 4ZPVR 5AE1A 3M8SA 3D66A 2POKA 3PRDA 4PEOA 3H40A 2XMAA 3GQCA 2X3GA 2R8JA 2GVDB 2HVEA 5J2QA 2UU9J 3FGVA 5D4PA 4ILLA 2WBMA 3KNGA 3TRGA 2VBZA 5ETKA 3MCNA 4DSKA 1FD8A 2HMIB 4BWMA 3PW5A 1CC7A 3J81Y 2UVRA 3A8JA 5DETA 1HD0A 4W98A 2HFSA 3MTKA 2L08A 5HAOA 3F0NA 2BE9B 3CC2S 4UOHA 2E1MC 4WP3A 1RU2A 3CJ3A 4QR1A 3VGUA 1UETA 4HT5A 2R7VA 3KYLA 3MEKA 4QW9A 4RUCA 2GS8A 4OYXA 2XMVA 1QE1A 2GQQA 3LAMA 2B9EA 3VZHA 4NYZA 5KG5A 3Q2TC 4OLOA 2XHCA 3NKYA 5IZHA 4B3SF 4NLOA 1TV6A 1N8RT 4U6PA 4DV3J 4OZJA 3PX0A 1F1BB 1AA1B 2WVFA 1RWWB 2MPUA 2XWXA 1WF2A 3BO2A 2W4PA 1K1SA 3FNNA 3A12A 1NBEB 2DXFA 3BBCA 4OHZA 1TK0A 3BSAA 4ZCLA 3OTDA 2EKNA 4R5PA 1SKRA 1RTDA 2CPDA 3LF0A 4YR3A 1F3FA 3NY0A 3GZ7A 1M5PC 2IVMA 4C4WA 2EVZA 1JMTA 5C25B 3KUHA 4OYPA 4KV8B 4FBTA 5IC4B 2JLFA 1QE1B 1Q53A 1ZTTA 5GAGI 2KKHA 2PN6A 2YH1A 1U6BA 2QSWA 3NMAA 3HLUA 3PX4A 5I3UA 4MFBB 1ZYQA 3DLGA 2NXEA 4WJBA 2GAGC 2CYYA 1HA1A 3W64A 2AGOA 2F4VJ 4H4OB 3UNYA 1NB7A 4LR8A 3KHHA 3NNAA 3QWPA 3KKFA 3BYPA 5F8NA 2ATLA 1NHKL 1RTDB 2J9DE 4LF9J 4F50A 2CJ9A 4W90B 4X65F 3R5GA 3TA1A 3PR4A 3IR7B 2W2PP 3QIPA 2HBZB 1EHWA 2NR0A 4YHHF 2KB2A 3LPYA 1YBTA 2WVBA 1N36F 1Z4UA 1Y11A 2NUUG 3T1YF 3DLJA 4B9VA 3N6NA 2W2OP 2ZDOA 1NH8A 4FDFA 1YRUA 3DLGB 2ASLA 3CEDA 2X1AA 3C15A 1KD1T 3ENAA 4PR6A 5KG4A 1IBLF 1VFJA 1VC5A 1KN6A 1HWUA 3ZZPA 3HVWA 2GJFA 5JVHQ 1NLKL 2Z2MA 2VFRA 3SMZA 3ETOA 3T5HA 3BGLA 3D4JA 3IAS9 3CW2C 1FK9A 2G2YA 3M9NB 4MKVA 3SBMA 4YUDA 4C48A 3C6TB 1R0AA 1NDKA 2OFHX 5KFOA 3KJNB 2O67A 3PRVA 1PJ5A 2W9CB 3AAWB 4MKBA 2G2ZA 1T11A 3C15B 4DQIA 3K5MA 2DITA 3VV2B 1YHQS 3V81A 4DCOB 2HHTA 2VG6A 1GTEA 2Y1JA 3W2VA 5ETVA 5KFZA 2ASYA 4C7QA 5JJBA 1JLEA 3R5DA 2F5GA 3DGPB 2E7VA 1WHXA 5AXKA 3DFEA 2I5JB 1FD2A 1U8SA 2QZ8A 4QWAA 1HNXF 4OQJA 5LXRA 3POTA 2MZQA 3OSPA 3ISND 3CWJA 2ZJRQ 2Y0SD 1DZ5A 3PCOB 3FJ2A 3TEHB 3N79A 4ID5B 2EFNA 2DH8A 4D3HA 2PDAA 4NRTA 1WSVA 1WSRA 5C7PA 3GIKA 4DUTA 5A8KB 1SUQB 2LU2A 1LFPA 3Q22A 1AW0A 1ZAWA 4F8RA 2KVQE 2IPOB 2A1BA 3PKMA 1LWEA 3TX0A 1U1LA 1L3UA 3HSDA 2YNIB 2ZVSA 1OPZA 2EEYA 1HNVB 2YBVA 3OR1A 1CLFA 5HMZA 1YJRA 4KGVB 2AJ2A 3QO9A 2AJQA 2H4WB 1DLOB 4N47A 3POTB 4O4GB 1XQIA 4P52A 2FVCA 3M32B 3OVBA 4USMA 2PFDA 1RHUB 2UZAA 3MMJA 1U2CA 3CJ8A 4WFYA 2ZVIA 1XBWA 1S1TA 2HLTA 2YKNA 4LRBA 1TKXA 1S0NA 3VAGA 4USHA 2KXHA 1JLFA 1HNZF 4DL2A 2GV1A 1JJHA 3NCPA 5ETLA 1VMBA 1FJ7A 4B3TJ 4H4KC 5H9EK 2V68A 3N28A 4NOHA 4BC9A 2Z2LA 4DL5A 2LLZA 1X5TA 4AFFA 4DZDA 2RU3A 2DEJA 2ZH9A 2ZZNA 2EFVA 4OZ0A 2DGUA 4XTTA 1U09A 2R7SA 3RW7A 5F9NA 1J5OB 4NCAA 4QCLA 4KYZA 1QSYA 5FDLA 2ROPA 4QU7A 3CDAA 3CC7S 4PPZA 3NS5A 3CC4S 4V19J 2GHPA 1OQ3A 1ZA2B 4O23A 3HHLA 1K73T 2BYCA 1DTQB 4TN2A 4M5JA 4P2FA 2PD1A 4DS4A 1FTRA 1RXOB 3AJ1A 3CB4A 4ZP9A 1YBAA 1P1LA 3TUPA 3T5KA 4RUAA 2FJWA 4KHRA 2XSJB 4MK9A 3I0SA 5B0EA 1WG4A 5E3RA 2ILZA 2Z30B 2D69A 3G8TA 4DPYA 1BMQB 1C1BA 2EC2A 3D3CJ 4DF4A 3DLLQ 2QL7B 4M5IA 1FRKA 3DRSA 4DUYF 2B4PA 4IDKA 1FFGB 1DTTB 2V2KA 3TR5A 1OYEA 2IYIA 3IA0A 3M6UA 4A8QA 4OX7A 1KEKA 2KJWA 3G6ES 3NL0A 2K7JA 2CUYA 3JAMY 3M1VB 2DO0A 4LBHA 2F8MA 4PWDB 1N6QB 4MIBA 1CSJA 3BGOP 4DCJB 2W25A 5T14A 3M7VA 3M30A 2EK1A 4FPIA 1DQAA 4KKOA 2HHVA 1EAYC 1VQ8S 2IM3A 1HI1A 2VPXB 1RYRA 2KL8A 1IBKF 3HXMA 1HNIB 3TWZA 4U67Q 4RPFA 3KLFA 4TY8B 4LT6A 1SQGA 5IQ6A 5LXYA 2NZCA 4GKJF 4ETZA 4PQUB 4IDKB 3CDWA 5IXUA 2KI2A 5G0RB 1YRXA 2CPEA 5IWAF 4DZ6A 4CH7A 2UXCJ 3KLHA 2D3OR 1GEHA 3A1YG 2P6SA 4K4XA 4RWWA 2ZBRA 1MMLA 1EX8A 3ZZRA 1REVA 4RU2A 3H59A 1H73A 3CDBA 4B3RJ 1X4CA 4NLDA 4NPOA 2LCWA 1XMOF 4B3MF 4J9RA 2HNYA 3M30B 3MEDA 1FTCA 1S6UA 3NRBA 5DLGA 5D3GA 1CS4B 4DCPB 3MXHP 2UUBJ 2MKCA 1KFSA 4PYDA 2BOPA 4CZCA 2ZM6J 2B7BB 3KLFB 4FNIA 3B54A 4N8OA 1WOSA 2ZH1A 4LRAA 2HG4A 3TO8A 1A9NB 1ZOTA 5E41A 2C3YA 3MECA 1K9MT 3KHRA 2GJ2A 3ZNJ1 1LW2B 2IHR1 1IKVA 4RWXA 4M5NA 1VLOA 1WC5A 2VBYA 2L9NA 2BRKA 3H20A 4Q2MA 1DJ0A 5ADZA 3DGVA 2XI2A 2R7QA 1EZZB 1QTNB 4CWBA 4C97A 2BM0A 3RGIA 4QW8A 1ZAVA 1GMUA 3KHGA 2HNYB 2G1DA 4HKQA 1CJKB 2KHDA 2BXJA 3ZZZA 4RLEA 4NXNJ 3ZTOA 4JYAF 4ZPTR 3QBCA 4DN0A 2UUCF 2CG8A 2WW4A 4KHMA 2RVJA 1H7XA 1VRQC 3NOCA 4B02A 1L3TA 3VVTA 3CCES 2BJ1A 1R8AA 1VCTA 2HNZA 2VG7B 2YWFA 3CSKA 1IKVB 5HL7Q 4X4NA 2I8EA 4DS5A 1MNEA 4KR0B 8ATCB 2GAHC 3AA8A 2EFPA 1LXNA 1F9HA 1JQGA 1VQ9S 1HYSA 3V6KA 2DCLA 1URNA 3M8RA 1JLCB 3K8WA 3O1LA 4ZLNA 2ROGA 4A48A 1AXQA 2AQ4A 4PZVA 1NJWA 3PNIA 3NS7B 2CQ1A 2JEJA 2UVWA 3PO4A 1WDTA 3G82A 5LSRA 4ALZA 3CTRA 1KNZA 2MTLA 1RHMB 2HNZB 4KB7A 2IJFA 1WHYA 4E0DA 1A0OB 4NE9C 2J0XA 2CWXA 3P6YC 5J1NA 1QSLA 3NGRA 4B9LA 1KONA 3MCOA 4FXDA 1OO0B 5A0YA 2XYGB 1NZAA 2OKQA 3MZIA 5GVQA 2G9OA 2H9ZA 4ZVOB 1WACA 3CMAS 3PR5B 2OHDA 3CDEA 4X4SA 1Y0HA 4DU8A 1JNRB 4F2SA 4O0NA 2J8AA 4AXIA 3SEOA 3MCSA 1OJ4A 3H90A 1SL1A 2HHXA 3S01A 4WXWA 4QYRA 4Y65A 2FLPA 2VA2A 5LMNF 4F3QA 2VPWB 2W2MP 1LK7A 1WD6A 3CD5A 3MMBA 2NXNA 4HHHA 3CCVS 2E5HA 3I87A 3W9HA 4OHVA 3GJRB 4P2XA 1FT8A 1NPPA 2RB7A 4EK2A 3GB0A 3TNVA 2JH3A 2UU9F 4PXCA 3W5ZA 4BLGA 2XNRA 2RIJA 1RTIA 5SUHA 3CCSS 1JJCB 2JRSA 5FD1A 3R5CA 4B3OB 3M8QA 4DBQA 3M8YA 1RJJA 1FRLA 4MTPA 2IBOA 1SH0A 4C8KA 1U24A 1NUEA 4OJHA 2A2CA 3AHPA 2HBQB 3Q24A 2CJBA 2XLIA 4IRCA 1TUVA 3MMAB 3HSJA 2DKOB 5DGAA 3QPIA 2AYGA 5GMKa 3M2VB 3CCJS 2AYEA 3PX6A 1LXJA 4K59A 3MF5A 3OUYB 2F1FA 2Q66A 4ILRA 4J9LA 2Q79A 1IN0A 1H72C 3ZZ0A 1JLBA 4KSEB 4DV3F 4IRKA 2EPIA 5T41A 3M8QB 2J5AA 1SJ1A 4NLXA 3BQ0A 3C3LA 4DPUA 1MN9A 1IQZA 4C8NA 1RTHA 2YWWA 1RTJB 2Q1LA 4H4MA 1SCJB 1SB6A 3SQGA 3UDLA 1VJWA 4O3OA 2CQHA 4WXOA 4TQRA 2W8KA 1HPZA 1F5AA 4M63A 4N56A 3MR3A 2EXUA 3TZWA 1RAHB 3MFHA 4NLVA 2NXJA 4YDDB 3GIRA 2YXLA 3IS9A 2BRLA 5KFMA 1Q5VA 2GNKA 4YB5A 5IM0B 1JLBB 1S6OA 2UXBJ 2MJNA 3OPKA 2F4VF 2C3OA 4I2PA 1AZSA 5K8OA 1NK4A 1QAIA 2AZ1A 2V8VA 4RX6A 2XO7A 3KG1A 4R8UA 2V8PA 1WWHA 3P5TL 5CD4A 2HHQA 3QT7A 4ITSA 2XSFA 4NL5A 3PFEA 4DL7A 2HVDA 2NXCA 2Y8YA 1P6TA 5D6GA 2K8GA 3JTPA 1WC3A 4CO1A 3TJ9A 2DH7A 3KJVA 4RNHA 2PEBA 1FERA 2KYZA 4Y00A 2YH0A 1CULA 3I4HX 1R6YA 5F0UA 4KHPF 1R8PA 3IS9B 3N4WA 4EI2A 1FA0A 5E2QA 5F8IA 3BQ1A 1C2PA 2PSZA 2PGCA 5E3CA 1K0VA 2DHHA 4F4WA 1YJ7A 2R9LA 1WG5A 4LF4J 4ZS6A 1X4HA 2W2NP 3Q8YA 3IRWP 2D9PA 1T02A 2DGXA 2V2VA 2E44A 4HH1A 1NNDA 4AUKA 3EZUA 5ETQA 1X9MA 2V9WA 1FKPA 4HLBA 1S4FA 1V5VA 3SDEA 4OIXA 5A2QY 3ONQA 2VB6A 3UW1A 2MZ1A 3KMQA 2RU9A 4JI1J 5LOQA 2QRRA 1N48A 1TR0A 2QJ3A 1XEZA 3BSOA 1TMJA 3GIMA 3G4SS 3M6WA 4GRSA 4EGLA 5BYSA 3IMQJ 3LO3A 3J7YU 4I67A 1SPBP 1D3WA 4OL8A 2W9AA 5LT5A 2OSQA 2B9XA 3O8WA 3N6MA 1QM9A 5LL6d 2DT9A 3ITHA 4DX5A 3SCIE 3G2XA 2CRLA 4IG0A 2OEMA 3HHDA 4I7FA 3IC1A 5H9EJ 5DQGA 3C66A 3SDEB 3MM7B 2CVEA 4JI5F 3LGMA 3JYTB 1RAAB 4C8YA 4WK3A 1HMVB 2O1PA 2M5YA 1A6LA 4XIUA 4PUOA 2LQJA 4ZVHA 4RR5A 2O01C 4WE1B 5IFMA 4J9MA 1UVJA 1RAJA 2WSEC 1T95A 2YWHA 1Q0NA 2EG1A 2N82B 1N54B 2B4OA 1OY6A 2HQFA 2LXIA 4P6QA 4FXWA 3TZYA 3W2WA 1CPZA 1R8BA 1RBLA 6FDRA 2FHMA 1WC4A 3GYNA 1RAEB 4BDPA 4USKA 3DOLA 4ID8A 4O3NA 5DGBA 2AF6A 1RQ0A 1X5PA 2DTJA 1S49A 4X4RA 3UCZP 4ZVQB 4B3TF 3DOKB 2L48A 4PKDB 1H2TZ 3NEKA 4YFUA 3EZOA 1B70B 4GKKJ 4WF9Q 5HLFB 4TU8A 1VQYA 3K58A 2KJVA 4DLGA 3Q8QB 1RWUA 1RWVB 3VAKA 4DXLA 1SL2A 3I5AA 3OTEA 4LRDA 5JVGQ 3AQPA 2X51A 4ED7A 2J0SD 2HHHJ 4DPXA 2OPQA 3SFGA 3IR5B 4DX8H 2BDPA 3W61A 1KBRA 3PFOA 4P72A 3MOJB 3W5XA 1X0PA 2QLFB 1H74A 4RW6A 4J37A 2LEPA 1PBAA 2FZCB 3TQ1A 1R89A 4O44A 2V2ZA 2XY5A 2PI4A 5I42A 2FC9A 3KNAA 3GPAA 5IT9U 4O3RA 1NRKA 2ZH8A 1FWKA 1JLGB 4MKYA 3R5BA 2A6OA 3IN5A 7AT1B 2FVQA 4C0BA 3NNHA 1O5JA 3B78A 3CCQS 3M2RA 4N5SA 1S9FA 5L1IA 1UZHA 2HQCA 2GFFA 1KP6A 2WZ1A 4GVBA 3BH6B 2ZBCA 3BR9A 4KH0B 3T6BA 1RBAA 2LDIA 4OZ3A 5H1SV 1ACMB 1D8ZA 2J6SA 2I9SA 1HQEB 1WEXA 2YNHB 3DRRA 5E0OA 4RL1A 2JEFA 1RT1A 3HVAA 1LWXA 3KLIB 3KWMA 3HK2A 4RW6B 5DRKA 1JLQA 1HWJA 3WDOA 2DO4A 1HR0J 2AIRB 1NAQA 3HJVA 4PXBA 5D0HA 2CQDA 1MLAA 3N5BA 2RF2B 1YSJA 2IA0A 4IH6A 1NJYA 1NHUA 2K2PA 4O3SA 4QBUA 5BJRA 2MYFA 2XO6A 1HQUA 3K57A 5CYMB 5KFGA 3I55S 1KHVA 1EKRA 1UEKA 4F4ZA 5EWFA 4B9UA 2ZKTA 4EWTA 3QRQA 3FUYA 1XTZA 4HHUA 1X4DA 2OI2A 4USIA 4GVBB 2KYXA 1RT7A 1D9DA 1IKXB 3RB4A 1HBMA 4DPTA 2XLKA 3HD2A 2C2ZB 4HDGA 2UXCF 3CPWR 1VQSA 3DLEA 1IJFB 2EG2A 3SIPB 3R6GB 2VD3A 4A8WA 4QWCA 7FDRA 4ZHRA 2OUGA 1URRA 1RBOB 1HHQA 1S6PA 4ELTA 5GMDA 1IKYA 3K89A 5HQ8A 5KFCA 3Q2SC 1U2RA 2ZM6F 2Z2ZA 4G65A 4RNOA 3QZ7A 1CC8A 3MR2A 1MROA 4BWJA 3G6XA 1M1GA 1MU2A 1IKWB 2QT7A 2DISA 2FC8A 3L7PA 3VGTA 4LFBJ 2B7CB 4ECQA 2CPHA 1NKBA 3DLEB 2KG1A 4LSLA 4K4ZA 3HX9A 6FD1A 2FB0A 4MAKA 3W8GA 1XNQJ 2VFSA 3JQMA 1ZA1B 2DEIA 2IMWP 2EFOA 3CCMS 1AB8A 1IKYB 4WFXA 1KTQA 1NXIA 4A8SA 2FHKA 4CO4A 3CIMA 3H2VE 4OI2A 4NXNF 2GZOA 1FRJA 1BXNA 1GMWD 3H98A 4DV0J 4MH8A 5CXTA 1VIOA 4LVOP 2K3IA 2CADA 5J2PB 1Y10A 1X4AA 3G9CA 1Z2ZA 4DSEA 1E6YB 1VBKA 5LJ3Y 1R8HA 4U7CA 3BGUA 2QG9B 4NRUA 2VQEJ 2GVZB 2ROEA 4M5LA 2FDNA 1RP5A 2XS5A 1E6VB 2LQBA 5KT5A 2H1YA 1PAUB 4X66J 5CCLA 2GJIA 1XN9A 4FF1A 2V67A 2XMMA 4ES1A 1X4GA 4YB1P 1GXLA 1RT4B 3GV5B 4ZCKA 2P9EA 3FSYA 3THVA 4CO2A 1RABB 1IXKA 3I31A 5K5MA 1VQ6S 2ILYA 4L73A 4Y2IA 4DR6J 4CO0A 2MKIA 1BY9A 1HIYA 3I6PA 3H5YA 2VC1A 2C22A 1UJ6A 1IBMJ 4NLSA 5D0GA 5KFNA 3HHEA 3CUNA 3GP9A 1CJVB 1PCAA 3BM7A 5J2NA 3NGTA 3LGHA 3V6JA 2CAJA 3TW0A 4NASA 3OT9A 2W7AA 2DJWA 3DM2A 1VRUB 1B0TA 3H4DA 4ANEA 5F8LA 2B56A 1F5CA 4BCAA 3SXLA 3FBCA 1Q81T 2DBBA 2GQCA 4ZDNA 1EQMA 1UVMA 3GJQB 1RZMA 3E8OA 4OI4A 3A13A 4EBEA 4AQYJ 3GMGA 2BQUA 4C98A 4LRCA 5EWEA 2B51A 4CLKA 4TU7A 3ICLA 4PCQA 2RHQB 1FI4A 3TARA 4Z7CA 3UCUP 3FFIA 1X7VA 1RSCA 1EIYB 4CLWA 3QZ8A 3OL8A 4I56A 4DQRA 3QGGA 1S76D 2MKHA 4WZQA 1WOOA 2M3DA 1VK3A 2KT2A 7FD1A 2CVIA 3L95X 3CCRS 4C6AA 4LR7A 4FYXB 3MR6A 4JBCA 1NMEB 4ZPBA 2DNRA 1S6QA 2HRTA 3LAKA 3UQSA 2QLXA 4LMZA 3VF0B 1M5OC 3BEGB 4NYOA 2NSBA 2WSFC 2YWGA 4UT4A 1NK0A 1TAQA 4YS2A 4K4WA 4JI0J 3MPDA 2MKKA 3IR6B 5KFBA 4J9OA 1JLAA 2RQCA 3H25A 2VFTA 2MHNA 1YJNS 2DR6A 4USJC 1AROP 3L9ZA 3D1OA 4ZPWR 1TK8A 4KT0C 3DXBA 3CF5Q 1C0UB 2HRYA 4OJ1A 2E1AA 3DYAB 2B4UA 4WYLA 2I1RA 1PBUA 1UJ4A 3UDCA 2C28A 2BJEA 2KU7A 3GTYX 3BJYA 1RAGB 1OIAA 4WFBQ 2RRAA 3GFYA 3U27A 3UD5A 2HURA 4I1TA 3KUGA 2HNDB 5H9FK 2F7VA 3CJKA 1RHKB 4WKRA 1UEUA 4GC6A 2D1CA 1UKUA 1WC0A 5HJYA 3T1AA 1IWAA 2R8GA 3W62A 2CPXA 2CJAA 2B8QA 2XULA 3Q8VA 2J0WA 4FYDA 5EN1A 4LF2A 3OLBA 4WK1A 3WC2A 4AL6A 2DR5A 2N4DA 2FY1A 3IGNA 2E5LJ 1X0FA 2B8PA 2UXBF 2RDDA 3CMQA 4UW2A 4ED1A 2IDLA 5G4DA 2RS8A 1NEEA 4PQAA 4YMEA 5BR8J 1Y3JA 2JL9A 2ASDA 2WHOA 2YNGB 4ERDA 1HWLA 3A3OB 5FIIA 1C0TA 1HBOA 2GO9A 4TY9A 4QPTA 4DG1A 3J80Y 4LFAJ 3DHXA 1S12A 1B0VA 5B0GA 1KVKA 2ALYB 1VC0A 4OZ1A 2FVRA 2XGPA 2RQ4A 4KPYA 4CCHA 4LIWA 2AWZA 1KLMA 4E2FB 5CCMA 5KT2A 2JOQA 1S0MA 4U96A 3GR1A 4ECVA 1U02A 2V34A 4I2QB 1XR7A 2XMKA 5KFEA 4PXDA 4DX6A 2J6UA 3QIDA 4TLQA 1C0TB 5KFXA 5CABA 3R2CJ 1RWNB 2J7KA 2K1RA 1UW9A 5HQLA 1X5OA 3QJJA 2V9KA 1NCLA 1G3OA 4LVNP 5A6PA 1T05A 4JI1F 1QVFR 3MCMA 1ZS6A 2WVDA 2V0NA 4OZNA 1TP7A 4MK7A 4U9RA 2Z2YB 3J7AN 3K8VA 5CYQB 3TA2A 2KN4A 2YNFA 4FPRA 3MD3A 2ZFHA 1IUJA 2V4RA 3AFGA 1GK8A 2B4VA 1JXVA 1FNOA 2N7YA 2BKOA 3B4DA 1FE0A 1JK9B 1CEZA 2XG8A 2ERRA 1CQNA 3CCWA 4ICLB 3QMQA 3F56A 1NZ8A 2H54B 2IM1A 2MZSA 3H5SA 3RBDA 2K06A 4YR0A 2PA3A 4CNYA 3LH2S 2HQGA 2F9DA 1T05B 2GO8A 1M5VC 4IG3A 2WVEA 4XO0A 4C8ZA 4OX6A 4OHWA 3HT0A 1WTBA 1TMMA 2O66A 5K8PA 3OLAA 4FYWB 2IBKA 3J7YI 3V6DA 2B6AA 4URSA 4QYZJ 1TKTA 2VV5A 4LFCJ 1PC4A 3DC2A 1CJTA 4J9PA 3KG0A 5T7LA 3Q89A 2IRUA 3WZ0A 5HSPA 5KAKA 3NGDA 4ZPDA 2MHEA 3GCWP 1S1UA 2J9EA 1G6BA 1HW8A 3HVRA 2P5VA 3GV7B 1HBNA 3RAQA 1HI0P 3DNCA 2CPFA 3KK2A 3EM1A 3OL7A 1S9GB 5KFRA 1Q82T 2XMJA 3R7SB 2NYHA 5DM7Q 1WKLA 3KFWX 2V94A 1LNQA 3RR7A 4L3KA 2JEGA 2KDOA 4QWBA 2LU1A 1FDNA 3N0VA 2AJ1A 1JB0C 5L1LA 1WF0A 2F65A 2QMXA 3ZTRA 4CLFA 4J9VA 4B17A 5L38A 2J76E 5A8RA 3PW2A 4GKKF 1G2EA 1RWMB 2VHGA 1QLNA 4RO0A 2ZH3A 2VASA 2CQGA 4KO0B 5KFSA 3US5A 4LF5J 1Q1KA 3MPUB 3JSMB 4NXMJ 3MM8B 1O8BA 4HI2A 3LP2A 3GJSB 3C14A 1XK8A 1W2IA 2HHHF 3OTOJ 2SXLA 3M6VA 3J81j 2H5EA 4KBIA 5SZTA 1QJHA 4C8LA 2GGPB 4G1QA 4DFKA 1WC1A 1OYDA 1Q78A 3D0IE 1U2FA 2WTFA 3PM9A 2ZZMA 4NCGA 1T94A 1ZZNA 1L3VA 2MZTA 2VU5A 2YKPA 2QA2A 4QJVA 1T9TA 1XNRJ 1FDDA 1O51A 5A8RB 3RRHA 4JI2F 2HIYA 1HBUA 4KGXB 3DRPA 1BE4A 2V50A 3EXYA 3EVOA 3QT5A 4CT8A 2QEXS 4X62J 5IOLA 1KTVA 2VJVA 1WF1A 4LBIA 3FMWA 2D41A 3LP2B 3AOBA 1UA0A 3G87A 4HH0A 5C24A 2V4JA 1RCOB 3UR0A 3DN9A 2J0QD 5HP1A 4EBDA 3I82A 4K5RA 1LWFA 2FHJD 3OXLA 1U0HA 4Q7AA 5C5JA 1HR0F 2FD2A 4DL6A 3V2UC 3W3SA 2LVWA 1SIWB 3LWMA 5D4OA 5ETNA 5D15A 2XEXA 2BANA 2VPZB 1GAOA 1RA6A 4ECRA 3D6MB 3M6XA 1K44A 2GCFA 2RKIA 3J7ZT 3CJ0A 3HKZD 4OZ2A 1KLNA 3UN3A 2GA7A 3D3BJ 5FLXU 2DPIA 1AYEA 2WAQD 1CG2A 3MR5A 4NX9A 2BBEA 3DKDA 2YPZA 5DDPC 2JDJA 3DOMA 2XS7A 1IQTA 3SZ2A 1RACB 1VLYA 4EO8A 3W7BA 3MPWA 2GHVC 5C24B 2FYXA 5KG0A 4MJKA 1FESA 1T3NA 1LWFB 1NDCA 5KG2A 1U0HB 4KPCA 4MYTA 3T9NA 3HFVA 2HPUA 2KZMA 3B6BA 4IRDA 1BQNA 1UCNA 4CO5A 5LSOA 1U1QA 4KY3A 1NSKL 5ITHA 2HMIA 1SXLA 1X60A 2YWKA 3SSSA 2DNZA 1XIQA 1YJVA 3Q8UA 4CYUA 4J9UE 1MSWD 1DBDA 5EX3A 1A7GE 4URQU 1YQHA 4J91A 4QIFA 4CNZA 3UN2A 4NLGA 4ECWA 1LV5A 4LFBF 3DCAA 5E3QA 4NLYA 3AH6A 1OS5A 2JLGA 3EJMA 4QR2A 2C2KB 1Q8LA 1XC9A 2ZD1B 3EWGA 2AX1A 1IR2A 2DY1A 3N6LA 5HMWA 1OY9A 1BQNB 2YX7A 4DDFA 4DPOA 3G8QA 4HHJA 2VQFF 3OXGA 4JI3J 4DR5F 3V4IA 4ZPAA 1S72S 4XAKA 4DQPA 4FVCA 3CCTA 2KVIA 3TVYA 4B08A 2MDAA 4OYBA 1DURA 4CYUB 1WUUA 3NWRA 3T5LA 3CXCR 2ZUGA 1NJIT 2AYBA 1NDPA 2ZJPQ 1TUGB 3TAMB 4DV0F 2L9WA 2XNQA 5C25A 1BWVA 5J2MB 5E5NA 2VODA 1H7WA 2MLXA 2IVFB 4ES2A 3EGWB 4ELUA 2E1PA 4KV8A 2FLOA 3PZPA 3AD8C 3ET6B 4P9SA 1YLXA 3AQOA 2A0FB 1W25A 3KK1A 3D1QA 3CD7A 4MFBA 2HQDA 1S10A 3P49B 1TL4A 3ZNUA 3Q83A 1TL7B 4H4OA 3UN5A 2JSXA 4TLRA 4UTGA 3EPGA 4FKXA 1JKHB 2VONA 3I5BA 4X66F 3V4IB 2R7TA 1PJ7A 2UVUA 4JI4J 3H5UA 5IQQA 2G13A 2D74B 1RAIB 4DI6A 3RB3A 2F9JA 5M2PA 2HHUA 1RUSA 3T19A 2BW7A 4O4RA 3D2WA 4KGMA 2EKYA 3L7OA 3M2UA 1FEEA 1UL3A 2FGCA 4DR6F 2R2SA 4OX9F 3PW0A 5KG6A 3KG4A 3TAQA 1P9QC 3KK1B 4P74A 4JI6F 1ZM9A 2ZDPA 3C16B 2MKJA 1P8GA 4K0KF 2EI5A 5B0FA 1S0OA 2WCXA 3AJ2A 2OJ3A 2MQMA 1FRIA 2WB1D 2O5DA 4EUVA 1RWPB 1K0TA 2D9OA 1OY8A 5AJ3J 2HKEA 2Z57B 1S9EB 4P7VA 4F0MA 3K5NA 5HJXA 5ETRA 4AQYF 2OFGX 3DI6B 1CJUB 3M2UB 1CVJA 3E01B 3C6TA 4FF4A 2CPJA 3FC9A 4IOCQ 1BHNA 2IM2A 1RT3B 1AT1B 3OR2B 2DNKA 2QLBB 3OQ2A 4Y28C 5H9FJ 1ZTWA 4X4QA 2DGWA 2W9CA 1NB2A 2HZCA 4M8LA 2YKMB 4TNOA 1PYOB 2DYAA 2VJUA 1QAXA 3DGPA 3D5MA 2I5JA 4USUA 4DU7A 2MGZB 4HYKA 4OFZA 2QYCA 3PIPQ 4K4VA 1OMSA 4TQSA 2AJ4A 2FZGB 2OD4A 2AGQA 5LJ5Y 1H38A 2AW0A 4EZ9A 4ID5A 5HBMA 1RHQB 4DHVA 3UO0A 4UOGA 4YHHJ 3PYGA 4PG8A 1OSCA 1QUVA 1KKHA 3GFXA 3RU0A 4QWEA 5KG7A 1J27A 3J81U 4DWIA 5A8KA 1N5VA 1SUQA 3W60A 2J9CA 2ZNYA 3Q86A 4Y2CA 5GADI 2E29A 4N7TA 2DR8A 2KO1A 3P45B 1S97A 1RT6A 2MQPA 2YNIA 3C8YA 1HNVA 2CQ3A 2P6TA 1FXRA 2V63A 3HF5A 3O44A 4LQ3A 5F8HA 3H5XA 4LF6J 3MAHA 2GMLA 2X1BA 2FJEB 4PABA 3EDRB 3BKUA 1DLOA 1SKUB 3FEZA 1IR1A 4O4GA 3GE9A 3M32A 5IS2A 5KTQA 3RBZA 3DLKB 3M05A 5HBMB 2HFZA 3X1LB 3M8PB 3SQOP 2VPYB 3JXOA 1IM4A 2MQOA 2QO3A 3ENWA 3T1HJ 3DDIA 2UUTA 5L8RC 2ADCA 1YJTA 1KS2A 2E5LF 5F0WA 3PHEA 1C4AA 4RBVA 3MPVA 2HFVA 1EP4A 1WJ9A 1BLUA 1RT6B 3C6UB 4P10A 5HATA 3CJ5A 1WKKA 4NMXA 2MZRA 1X4FA 2XC9A 5BR8F 4JV5J 4RW4B 3BR8A 2ZC3A 5LMUJ 1J5OA 2C2DA 1N56A 2BW2A 1VHFA 3PTWA 3I0RB 1S1WB 3HZGA 3H8YA 3OBIA 4DR7J 2IVYA 1QVGR 3CCLS 2R2UA 1AUDA 1DTQA 3PKYA 2JHEA 3AB4B 4TVAB 4NZ7A 4DR4J 4NWBA 1WHWA 4WZMA 3IGVA 1PC5A 4ZLJA 2IDEA 1S5ZA 1VQMS 2ADBA 1EP4B 2M0GB 2XSJA 3V6HA 4WKYA 3T9ZA 3HDSA 2FZKB 2CPIA 3CDUA 5CYJA 1VQPS 1Y5IB 1VBZA 1SQFA 4ZVEA 3G86A 4FN5A 3OHAA 2E1CA 3OHBA 1S48A 4JI7J 2ZJQQ 4B9MA 5HROA 4U95A 2KXFA 4RBTA 5BXIA 1R0CB 1T9XA 4NZ0A 1DTTA 2XBPA 4K5SA 4Y0FA 4X4OA 3M1VA 3V4MA 2Z58B 4DV4J 3RBXA 1U1MA 2R7OA 4PWDA 1PILA 3MOZA 1N6QA 2N7CA 1Y00A 1RGVA 5AXNA 4DR2F 3PJWA 1Q8KA 2GW8A 3UI3A 1FJGF 3JQJA 3IRXB 3UD4P 3VHQA 2VFVA 3GSDA 2CQIA 4ANDA 1D1UA 1HNIA 5J1PA 2KHCA 4P7TA 3GG0A 1D9FA 3A8IA 4TY8A 4C3MA 5HROB 4I68A 5DM6Q 4JOUA 4PQUA 2CQ4A 3ZFVA 1FX4A 2MLZA 2QV6A 5G0RA 2CXEA 3E51A 2FLNA 2AJFE 3LP1B 3ULHA 5GAEU 4PWUA 3HFZB 3BGRA 3IFEA 4LF7J 4IFYB 2FJBB 1R27B 2I6WA 5C42B 4HL9A 4DMZA 1GH8A 4YB7A 1VRTB 5DZ7A 2KM8C 1U4BA 3QSIA 3MAAB 1CS4A 4NLPA 4LFCF 3K5OA 2VICA 2IJNA 2RHSB 2MSSA 2JFKA 1TAUA 1T3OA 3OJSA 3PXGa 3HHLC 4M95A 4DUZJ 1HNWF 2HFUA 1DFDA 2YQ0A 1LW2A 1GX5A 3QLHB 2CFXA 2HIQA 4U7UK 3EXCX 3BGRB 2RUGA 5BYQA 4UOFA 3BF4A 1F3VA 1IJEB 5FLXY 3ILLA 4HTJA 3DDKA 2UUAF 2IC3A 1TL3B 1N32J 4WIIA 1T8EA 4X4VA 5DS7A 4IR1A 4HACB 5KFVA 1NSQA 1CJKA 1TELA 3BGFA 3KK3A 3SCKE 4ATNA 1BC6A 4J9SA 3TAPA 4DL0C 3S8SA 2UXDF 1RT5A 2VG7A 1GNKA 8RUCA 2VKRA 2HGLA 4RUBA 4NXMF 3MM6A 2IY5B 4H54A 4KGZB 2LQ9A 1Q8IA 4Q5VA 1W26A 3OTOF 2OPRB 4WPAA 1M5HA 1UVKA 1Y5NB 3D9BA 2VG5B 3W65A 3NMRA 4DJBA 2P2CB 4IO1A 2IC3B 4HI1A 3D0GE 5B08A 4IH5A 4CLYA 1JLCA 5D78A 3Q8PB 2IMOA 5KFLA 2ZH5A 3KK3B 2J9DA 2CDQA 1HWKA 3VAJA 1SBRA 4KQZA 3UWTA 4I0WA 5U47A 3E3XA 3NAIA 2G0IA 5HVGA 1RT5B 4IO9Q 1TL5A 1UEVA 3MM6B 3LOUA 3TZXA 1FHTA 4RW9A 3K5PA 3WC0A 3X3UA 4UF4A 2IRYA 1UAWA 1V3RA 4OLPA 3NWGA 1Q5YA 5EWGA 3NBPA 4Q8FA 2HK3A 2V5HG 4K8RA 2ATCB 3KTQA 2WONB 4F0HA 2VDHA 2BACA 3ILOA 5KOXA 3BKFA 5DDRC 1QY7A 1EB0A 2DY9A 3VVUA 2HBYB 4M5DB 4C11B 2IAJB 3MDFA 3JAMU 5KG3A 4DFJA 2XZWA 1UVNA 3G71S 5HQMA 3BKTA 1TKDA 3QFWA 3KLEA 3H2UB 2HS0A 2ZC4A 2B5JA 5F9LA 1VQ7S 3VR1A 2DGSA 2NS1B 4RW9B 3BB5A 2Y3YA 2MJUA 1NO8A 1YG0A 1YVFA 2CPYA 1RT2B 5L9NA 1GXTA 2OH2A 4KFBB 3NBPB 3AXMA 3SV3A 4ER8A 2LDYA 5EUHA 2DNMA 3L4BC 2H65B 4B3OA 5CZXA 4X4TA 4YR2A 5DDQC 4RW7B 1LK5A 5BYRA 2CIMA 4DV2J 4MKAA 3RJMB 3EPIA 3EX7B 4M5KA 2W24A 5KFKA 3MMAA 4X4PA 4ZVPB 3KLEB 2B5JB 1N4LA 2DCUB 2V2QA 4FVMA 1OQ6A 2P9CA 3PHTA 3MFIA 3GONA 3M2VA 1Y3KA 1JXLA 3IG1B 2ZBQA 3OUYA 5E33A 1YIJS 2W7OA 3TANA 2CNLB 1NK7A 1LW0A 3QJLA 2ZZTA 3MEGB 2BEFA 3PY8A 4KRWA 2X1GA 3OFGA 1TVRB 4ZVUB 3HMJG 1FDAA 1U45A 2E9TA 4QPXA 4JI3F 1RTZA 3CO0P 2DK2A 4IR9A 2ZWPA 2NCKL 3WX8A 2BJ3A 3ISNC 2XTJP 3UPFA 1QUPA 4LUBA 2BJ8A 2M4MA 2C2MB 4KC5A 2XLJA 3P5BP 1KOOA 2LP4A 1FCAA 2EC0A 1RTJA 2XZTB 3K0JA 1AFJA 1FFSB 3PW7A 1X8DA 4R0EA 4PWWA 2AEJA 2XGQA 4F0KA 2NPIA 2RH3A 5KOWA 2BKPA 3U1MA 2H4YB 1CBKA 4IOAQ 4L3NA 3HVTB 1TKZB 3HHLD 2OMOA 4A8YA 6AT1B 3SSRA 3OVSA 2KZZA 2G1HA 1LW0B 2LEBA 1YRTA 5J1EA 5AXLA 5F41A 1VDHA 4CLLA 5IM0A 1DAXA 2BQ3A 1X5SA 1WORA 2BV3A 2RE1A 1UZDA 2ZE2B 3L3CA 3DRXA 4IQMA 5B0DA 3KUEA 2HZAA 3UNGC 3MM5B 4JI4F 3ENQA 1FNMA 5I3PA 1VHIA 3HCXA 1C4CA 4C8MA 1V9OA 2QL9B 2GX8A 4Q0BB 1WNEA 3R27A 4USTA 5DG7A 2DRAA 3BDEA 3GILA 2B0GA 2B9WA 4OI6A 4Q43A 4GO5X 2ZOMA 4NA2A 4FF2A 1U1PA 1I5OB 4LF8J 3FRYA 2CQPA 3MMCB 5KT7A 4QZVB 4TKTA 2HFOA 3CNQP 4C2MA 1T9VA 1TL1A 4F25A 1KVIA 5J1EB 3HI9A 5J2QB 4LF1A 2FJVA 4UY8T 1WHVA 1L3KA 3U7JA 3PEJA 4E98A 3C19A 3I9V9 1HHTP 3LQVA 2AV5A 1Z1ZA 5AJ3F 3PV8A 4WP9A 4M5MA 3NGUA 4XDCA 2X3DA 1X4BA 2ZITA 5D77A 4DPWA 2I2YA 2PFFB 4C9DA 1I3OB 1MWQA 3KOAA 4LF9F 1I94J 2VBXA 3DU5A 1P1TA 1HARA 5K20B 5HI7A 1S57A 4A46A 1ZM3A 4B9TA 4DSFA 5RUBA 3EICA 2RMLA 2VZ9A 5E7OB 2A10A 5IC6B 1FXDA 4CLPA 4PRFA 3GCXP 2GIRA 3M8WA 2ZHAA 1TL1B 1DQ8A 4M94A 1XMBA 4WWSA 2B3TB 3QNWB 1K47A 2DGOA 5HMXA 3IM8A 5M2UA 3VTIA 2M7SA 2W4CA 1TV6B 4PXEA 2F8HA 3RZAA 2RT3A 4JV0A 2MB0B 1UA1A 3TZZA 1FF2A 4ED4A 2BE7D 2FJDB 5IT0A 5DJBA 1WI6A 1T9YA 2G0JA 3CD6S 3OD2A 2HLUA 2CQBA 4R5PB 2XMWA 2MKYA 3MM7A 4ZPCA 2BQRA 1QD1A 2DB1A 3JYTA 2OLWA 4ECYA 4KIAA 2VDIA 3TX8A 3OJUA 4JV1A 2LQ5A 2RS2A 1U1RA 1HMVA 2IRXA 2Y0BB 2BJDA 3KLGA 1H0HB 1S99A 4ED0A 4WE1A 4LIRA 5I3UB 4KHPJ 1IWGA 1P9YA 3Q8RB 4O3QA 1LOUA 1Y9OA 2DNOA 2DRBA 1TFWA 3QWUA 1T7PA 3QAEA 4R0JA 2G4BA 2DR9A
chains in the Genus database with same CATH topology
2CZ4A 3ZZZA 3G8SA 5DM7Q 3HHNB 2VOPA 4K4UA 3KFWX 4RLEA 3RTVA 2V94A 5K14B 1XMQF 4LF6F 3RR7A 2JX2A 1U26A 1B0PA 4JYAF 4RZRA 1UMJA 3RR8A 4ZPTR 4DN0A 4DSIA 2GC8A 2UUCF 2UP1A 2KFZA 4KHMA 2RVJA 1H7XA 2JEGA 2KDOA 1EETA 1LFWA 2N3LA 4QWBA 2LU1A 1FDNA 4EYIB 3N0VA 2AJ1A 1JB0C 3P3DA 4RBUA 4NA1A 3HPOA 2RDJA 4B02A 5L1LA 1L3TA 3PO5A 3C46A 3CCES 1V3ZA 1WF0A 2QMXA 3Q0AA 1R8AA 3OTBA 2HNZA 2VG7B 2YWFA 3CSKA 3TI0A 4Y2KA 4CQ1A 1IKVB 2HVZA 3QIPB 5HL7Q 2VH7A 4B17A 1B7FA 5L38A 4J9NA 4X4NA 2J76E 2I8EA 5A8RA 4DS5A 3PW2A 1Q7YT 1MNEA 1UVIA 4GKKF 1G2EA 1U6FA 4Y2AA 4KR0B 2V8HA 3LUYA 1QLNA 3HM9A 3AA8A 2EFPA 1LXNA 2ZH3A 2KRBA 2PI5A 2VASA 3KLGB 1SI9A 2CQGA 4KO0B 3T1HF 1D9AA 1N34F 4JI0F 5KFSA 1VQ9S 3IWLA 3DOKA 1HYSA 2HQ3A 3NS6A 3DLKA 2OPSA 2ZOFA 1SJRA 1Q1KA 3D54A 3US5A 5K8MA 1JXEA 5THWA 3JSMB 3V6KA 2DCLA 1URNA 1Q79A 4OHYA 3M8RA 1JLCB 3MM8B 1KQGB 1O8BA 3LP2A 4HI2A 3K8WA 2QE5A 1XK8A 3O1LA 1W2IA 2BE2A 3M8PA 2ROGA 4JV5F 2O3DA 2HHHF 4A48A 1QAYA 1AXQA 2SXLA 3BN7A 2AQ4A 5F8JA 2NZ4A 5HLFA 3M6VA 1NJWA 3OXFA 3PNIA 4ZP7A 4WFNQ 3TOQA 4K4SA 3PDNA 5AE3A 2CQ0A 4H4KA 5A6WA 2H5EA 5LMUF 4KBIA 2EBEA 2CQ1A 5F3ZA 2JEJA 5SZTA 2UVWA 1QJHA 4C8LA 3PO4A 2GGPB 2GMHA 4G1QA 4DFKA 3E2EA 4EFAC 4PPDA 5JXSA 1Q78A 3D0IE 2QA4G 3NCQA 5LSRA 4G3IA 1U2FA 1EETB 2WTFA 2PC6A 3C6UA 4ALZA 1GTHA 4YY3F 1VBXA 3CTRA 1KNZA 1RKIA 4ZVFA 4EO6A 1N0UA 3PM9A 4ZMMA 2ZZMA 2YX1A 3I32A 4NCGA 1FK9B 1T94A 4DR7F 1R43A 3IAM9 2WW8A 2DHAA 1ZZNA 4NA3A 1L3VA 3F44A 2MZTA 5J2NB 1J2VA 2HNZB 2YKPA 4KB7A 4WTYA 2IJFA 2QA2A 4QJVA 1WHYA 3KHLA 1QAJA 1HL6A 4ED3A 4RW4A 4E0DA 2M88A 1FDDA 2YVSA 1O51A 5A8RB 2HS4A 3PJXA 3RRHA 2DNHA 2FGOA 4JI2F 1HBUA 3DM2B 4I64A 2CJQA 5F3TA 4KJIA 2J0XA 3MGJA 5DDOC 5I4MA 4KTQA 2DNNA 2IFXA 5KFPA 2AD9A 3P6YC 1R0AB 3FRZA 4DR4F 3DRPA 5J1NA 1QSLA 1Y4ZB 3EXYA 4UQGA 3I0RA 4B9LA 3ENVA 4CT8A 1S1WA 2QEXS 3BO3A 2WOMA 4DQQA 1KONA 2DNQA 4FXDA 3MEEA 1OO0B 1KTVA 2OPSB 5A0YA 1WF1A 2FJAB 2L3MA 3FMWA 2D41A 1FKOA 1SV5A 1NZAA 3BSNA 2HHPA 2HS3A 3O2IA 3LP2B 4E8UA 2OKQA 3MZIA 2FVSA 5GVQA 1JLGA 1U47A 3OSNA 1UA0A 2K3KA 2BE2B 3V81B 2G9OA 2H9ZA 2VG6B 4HH0A 1WACA 2FHJA 2V4JA 2DGTA 5C24A 3CMAS 4JI7F 3PR5B 3UR0A 3DN9A 2HGNA 3W2VB 3CDEA 2J0QD 4X4SA 5HP1A 3DMJA 1NKCA 4EBDA 3I82A 1Y0HA 4K5RA 1LWFA 1JLEB 2FHJD 4N41A 1JNRB 3PACA 3OXLA 3FFIB 4HVZA 5KFTA 4Q7AA 2P9GA 4F2SA 5C5JA 1ULRA 2W4DA 1HR0F 2FD2A 2J8AA 2RILA 4DL6A 1N52B 4AXIA 2PMZD 3SEOA 3V2UC 2U1AA 3MCSA 3W3SA 4PG7A 2LVWA 2B9YA 5EHHA 1SL1A 2HHXA 4LQ9A 3S01A 4WXWA 1SIWB 3NCRA 1HQEA 4QYRA 3LWMA 5D4OA 2YNHA 2R8HA 1R8CA 2LA4A 4Y65A 2DGVA 2XEXA 2FLPA 2VA2A 3HHKA 5LMNF 2Y1IA 4F3QA 2BANA 3KLIA 4V19X 2VPZB 1GAOA 1RA6A 4ECRA 2VPWB 3MWBA 5D4LA 3M6XA 4AYBD 1LK7A 1WD6A 3CD5A 5L1JA 2ZKUA 4DV4F 2GCFA 2RKIA 3MMBA 3J7ZT 3CJ0A 3HKZD 4YDXA 1N5TA 4DSJA 4C0HA 1TK5A 2IA6A 3CCVS 2E5HA 3I87A 1KLNA 3VAFA 2GA7A 1S6QB 3R1HA 4OHVA 2DPIA 1QSSA 2WAQD 3QGHA 1FT8A 2JC0A 3EYZA 2W9BA 2RB7A 2RF2A 1CG2A 2RSQA 5KT4A 2WOMB 3GB0A 3MR5A 4K50A 4NX9A 3D28A 4LFAF 3TNVA 3MEEB 3B82A 2JH3A 2BBEA 2YKOA 2UU9F 4PXCA 2RNEA 1RYSA 5DDPC 2JDJA 1FKOB 3MUTP 4YQWA 2XNRA 2RIJA 3DOMA 1VQKS 2XS7A 1SV5B 1RTIA 5SUHA 3CCSS 3SZ2A 1IQTA 1DARA 4F02A 1VLYA 1SC6A 2JRSA 2RDIA 3VAHA 5FD1A 4EO8A 3R5CA 4B3OB 2HFNA 3M8QA 3W7BA 4DBQA 1LWEB 1JLAB 1FRLA 1RJJA 2JFDA 3MPWA 2GHVC 5C24B 5CYMA 1VOMA 4MTPA 5KG0A 4MJKA 2IBOA 4FS1A 1FESA 1SH0A 4C8KA 1N5SA 3DMJB 1T3NA 5L39A 4ECZA 1U24A 1LWFB 5KG2A 4OJHA 3OR1B 1G1XA 3HJFA 4CH1A 1XERA 2IM0A 5KFQA 3EGZA 4A8FA 2ZH6A 4MYTA 2XCPA 2A2CA 3AHPA 3T9NA 3QO9B 2FJXA 3Q24A 2HPUA 2CJBA 2XLIA 3OTCA 3IRXA 4F3OA 4DR3F 1R7IA 4A8KA 4IRCA 2KZMA 2BABA 1TUVA 2DNLA 2YY3A 1BQNA 2Q43A 1IKXA 3MMAB 4CO5A 5LSOA 4DSLA 2OTJS 4X84A 4KE5A 1U1QA 5ITHA 3DRYA 5DGAA 3QPIA 2HMIA 1SXLA 2QSFA 3UD3P 2YWKA 3SSSA 2AYGA 5GMKa 2ZHBA 1U1KA 2EWHA 2DNZA 2MKSA 3H2LA 3M2VB 2DVIA 1KSPA 2XY6A 3BDPA 3CCJS 4LF7F 2KT5A 2AYEA 4EYHB 1YJVA 4QU6A 3PX6A 1LXJA 4K59A 3HO1A 1YWXA 3MF5A 3UCGA 1S1TB 3CJKB 2YKNB 2BA9A 1MSWD 3OUYB 2F1FA 1DBDA 4ELVA 1TKXB 4XK8C 2E66A 3FQKA 2W9BB 2DHSA 4QOTA 5EX3A 5GAHI 1A7GE 2Q66A 3AY0A 1FE4A 3TYTA 4URQU 2RQKA 1JLFB 1YQHA 2HWHA 3I5CA 3FSXA 4DR1F 4N76A 4ILRA 1VQNS 4QIFA 1GXUA 4J9LA 2Q79A 3LP1A 1IN0A 4NLWA 1JLBA 2C42A 3ZZ0A 4CNZA 4KGKA 3D1HA 4NLGA 4KSEB 4DV3F 4ECWA 4IRKA 2EPIA 3CO9A 1LV5A 3ZC4A 1YITS 4LFBF 2PA8D 3DCAA 5E3QA 2E5IA 3AH6A 3M4XA 3M8QB 4IFYA 4NLYA 5T41A 1OS5A 4EU0A 5KFWA 4FXVA 2JLGA 2CZVC 4D3GA 2J5AA 1SJ1A 4QR2A 4NLXA 2RRBA 3GIIA 3DLHA 3BQ0A 1Q8LA 1XC9A 3C3LA 2ZD1B 5C42A 2WK4A 1IQZA 2G0CA 2AU0A 2AX1A 1VS3A 2KM8B 1FRXA 1K1QA 4C8NA 3IO1A 4DUZF 3N6LA 3S6EA 5KT3A 4MMOA 1VRTA 5HMWA 1LKZA 1IKWA 1RTHA 3TP2A 1BQNB 1N5QA 1RTJB 4I4BA 2Q1LA 2YX7A 4AL5A 2ZH2A 4DDFA 3QJPA 4DPOA 3G8QA 2BM1A 4H4MA 5GAEI 4HHJA 3SQGA 1SB6A 2QLWA 2VQFF 3UDLA 3OXGA 1VJWA 5FDLB 4DR5F 3V4IA 3KMSA 4ZPAA 1S72S 4XAKA 4DQPA 3GFZA 4O3OA 4FVCA 2CQHA 4WXOA 3CCTA 3BN4A 4TQRA 2W8KA 3DU6A 2KG0A 1HPZA 1F5AA 2KVIA 4M63A 3HHLB 4N56A 3MR3A 3CE8A 3TVYA 1H3DA 2J7WA 4B08A 3J7A1 2MDAA 4WCEQ 5AE2A 3M9MB 4UUWA 1DURA 3MFHA 4X4UA 1KOHA 4NLVA 1UW4A 2AX0A 4YDDB 4LSNA 5EDWA 2C3PA 3T5LA 3CXCR 2ZUGA 4B3RF 1FO1A 1NJIT 1VGYA 2AYBA 1SH3A 4EBCA 2ZJPQ 3IS9A 2BRLA 5KFMA 5E3PA 1HBOB 4QIVA 1N32F 2GNKA 3TAMB 2ALZA 1P27B 2YWEA 3QLHA 2L9WA 4DV0F 2D7SA 2XNQA 1NK5A 1NKEA 4YB5A 5IM0B 2YTCA 1JLBB 1S6OA 5KG1A 4DG1B 5C25A 2MJNA 2OP5A 3OPKA 2OAUA 5J2MB 5E5NA 2F4VF 2VODA 1H7WA 2I38A 2C3OA 4I2PA 2IVFB 4ES2A 3EGWB 5KT6A 3MUMP 4ELUA 5K8OA 2UUBF 4KV8A 1NK4A 2FLOA 2NXUA 4NLRA 2L9DA 1QAIA 4F3MA 3PZPA 2V8VA 4RX6A 3WBZA 4XPEA 2XO7A 3I0SB 4DV7F 3KG1A 4R8UA 3AQOA 2WRMA 1D0EA 3K7RA 1C1CA 1WWHA 2HAIA 2IYGA 1W25A 3VZIA 2X1FA 3P5TL 3Q8SB 3KK1A 3D1QA 3JTNA 3CD7A 3TA0A 2HHQA 4MFBA 2M8HA 3VALA 3BZQA 4ITSA 2XSFA 4NL5A 1TL3A 1S10A 3PFEA 3P49B 1C1BB 4DL7A 1TL4A 2DNPA 3F41A 2FTRA 2R4FA 1P6TA 2K7KA 1KLMB 2DH9A 4H4OA 4ED6A 5D6GA 2K8GA 3DRSB 3H4BA 5J2PA 3BSCA 2Y1RI 2JSXA 4TLRA 3JTPA 3EPGA 1E6YA 2LMIA 1JKHB 2VONA 1Q16B 3I5BA 4X66F 3V4IB 1RKJA 4O3PA 2PE8A 2R7TA 4CO1A 3TUZC 4F4YA 1YI2S 5EGYA 2DH7A 2UVUA 2R2RA 4K4YA 3H5UA 3KJVA 5IQQA 3MM9A 4RNHA 2DIVA 1FERA 3G6YA 4L6V3 1F2GA 4B9SA 4X2BA 3U1LA 2KYZA 2G13A 2D74B 4Y00A 2YH0A 2VUGA 3I4HX 5AXMA 1R6YA 4LSNB 3RB3A 2MY7A 5F0UA 2F9JA 4KHPF 1FRMA 5M2PA 3K5LA 2HHUA 3S1TA 1FJCA 1E6VA 4B9NA 1R8PA 3IS9B 3T19A 3N4WA 1JJ4A 3GFHA 3CJ2A 2F8EX 1FA0A 2XI3A 5E2QA 3EZ5A 4O4RA 5F8IA 3RB0A 3D2WA 3BQ1A 1T03A 4KGMA 1C2PA 2PSZA 2EKYA 2PGCA 2ACYA 3JSYA 4OJ3A 2CQ2A 3L7OA 5E3CA 1K0VA 3M2UA 4M1KA 3MUVP 3I56S 2K1RB 1FEEA 1UL3A 4Y3CA 3RAMA 4F4WA 2FGCA 1NK9A 2R9LA 1WG5A 3RAXA 4DR6F 2OPRA 4ZS6A 4HTIA 2R2SA 1X4HA 3HFKA 4OX9F 3G96A 3PW0A 1RT4A 4KKOB 3IRWP 1K8AT 1C1CB 2D9PA 5KG6A 1ZAXA 2OD6A 1T02A 3KG4A 2GMJA 4OZ5A 3TAQA 2DGXA 2VG5A 1P9QC 3KK1B 4JI6F 3HZEA 2E44A 2NYIA 1ZM9A 1WELA 3SI8A 1ZM4A 1RA7A 4HH1A 2ZDPA 3T5JA 1NNDA 1KHWA 2MKJA 3PVXA 4F4KA 4AUKA 2V4QA 4DV1F 4ECXA 1P8GA 3EZUA 2HRUA 3VQTA 1B64A 3FCHA 1X9MA 2HVIA 5KFJA 2V9WA 2MQQA 2YNFB 4K0KF 1FKPA 2EI5A 5B0FA 4HLBA 1S0OA 2MQNA 2WCXA 3AJ2A 1OWXA 1S4FA 3ZZOA 2MQMA 2OJ3A 1FRIA 3SDEA 4Q8EA 4OIXA 5A2QY 3ONQA 1U6ZA 2WB1D 3I4PA 5FJ4A 2O5DA 2VB6A