2KYZA

Nmr structure of heavy metal binding protein tm0320 from thermotoga maritima
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
b'MRYVLYVPDISCNHCKMRISKALEELGVKNYEVSVEEKKVVVETENLDSVLKKLEEIDYPVESYQEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy metal binding protein
publication title NMR structure of heavy metal binding protein TM0320 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Metal binding protein
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kyzA00
2LQBA 2K7KA 3WDOA 3I9ZA 4OJ1A 1MWYA 1TL4A 2HIQA 2HQIA 3BGUA 2GFFA 1FE4A 1RJJA 2BJDA 5B08A 1WD6A 1CC7A 4A48A 1YG0A 2QLXA 1YJTA 2RU9A 3IWXA 1KVJA 4YDXA 2ZDOA 1APSA 2BUNA 2FTRA 5IXUA 1N5QA 2FIUA 1OQ3A 2XMJA 1SI9A 2EW9A 4NPOA 1V3ZA 2HFNA 3MZIA 3IWLA 3LGMA 1FE0A 3FGVA 3TOQA 3UDCA 5B0BA 2ASYA 3HX9A 2KYZA 2HLTA 1XBWA 1FVQA 2W4PA 1Q8LA 3GZ7A 5B0FA 5B0DA 1FVSA 3HHLD 5F0UA 1YJVA 3KG1A 2JDJA 3HDSA 1TZ0A 2AP6A 1GXUA 3HHLB 4Y2KA 4HH1A 3KG0A 2IFXA 3BF4A 2RMLA 4OJHA 4EFAC 1R6YA 4A46A 3T9NA 1Q8BA 1Y3KA 5A6PA 1N5VA 3HFKA 2GCFA 1P6TA 3HF5A 1N5SA 4HL9A 2QIFA 1P8GA 2K1RA 2ROGA 1Q53A 4DN9A 1OSDA 3BN7A 2BJEA 2VV5A 3E8OA 3K7RA 3KKFA 1K0VA 2GGPB 1KVIA 2HLUA 1GXTA 3BB5A 2GO8A 2RILA 2BBEA 2FHMA 3F44A 1X8DA 2OFHX 2FB0A 2PGCA 2XMVA 3QGPA 1MWZA 2LQ9A 2OD4A 5A6WA 1JK9B 1Q4RA 2GA7A 2OD6A 4HI1A 1X0PA 1Y3JA 3VTIA 2QYCA 2QLWA 4U9RA 2XMUA 2OAUA 3MCSA 1CC8A 1IUJA 3CJKB 2GGPA 3HHLC 2OFGX 2LDIA 4FNHA 1FD8A 2XMWA 4Y2IA 2XMTA 2GV1A 5K9FA 5T7LB 4DL0C 2OP5A 4OIXA 4ZOSA 3DXSX 4DPOA 3LO3A 2XMMA 1YJUA 2KKHA 5B0GA 2N7YA 1TL5A 1CPZA 1N5TA 2AW0A 2W4DA 5B0AA 4F67A 2ROPA 2KT3A 3CJKA 3HHLA 2K2PA 5B0EA 1Y9OA 4A47A 2AJ1A 3LGNA 2AJ0A 1KQKA 5T7LA 2ACYA 4OJ3A 4YEAA 1Y0HA 5B09A 1ULRA 1AFJA 2G9OA 1AFIA 1YRXA 3QMQA 3BM7A 1TR0A 3FRYA 4Q2LA 1QUPA 4FNIA 2K7JA 4HI2A 2ZDPA 4NL5A 2CRLA 2IYIA 2IYGA 3FMBA 5F0WA 2PD1A 2OMOA 1SQEA 1W2IA 2Q3PA 2VH7A 1YJRA 2RSQA 4Y2MA 2N4CA 1LQ9A 2ROEA 4HH0A 4Q2MA 1FEEA 2N4DA 2XMKA 4OJGA 1AW0A 3TRGA 1TUVA 2HFOA 1URRA 1FESA 3DCAA 1X7VA 1VQSA 3BR8A 4QOTA 1U7LA 2LXFA 1S6OA 1OQ6A 1VQYA 4ZA1A 5KAKA 3TNVA 2L3MA 2K1RB 2KT2A 1SB6A 2W4CA 4A4JA 3KNGA 2BYCA 1S6UA 2OKQA 1OPZA 5B0CA 1JWWA 3BDEA
chains in the Genus database with same CATH superfamily
1XC9A 3BQ2A 3W64A 3BH7B 3ZZUA 2HVDA 4PAAA 4N8NA 3CO9A 5J2QA 2IA6A 1UFWA 3DHXA 1N5YB 1XJWB 1AZSA 3BR9A 4DDFA 2CQ0A 3B54A 4KFBB 3KK2B 2ZH2A 3SIPB 4C8YA 1S6QA 3TUPA 4WFBQ 4DSIA 1JLQB 3RB6A 1WG1A 3M2UA 5AE2A 3P45B 1PO6A 1K44A 1YJNS 1E6VA 3R5AA 1HNZF 1RAAB 1FJGF 3I56S 5A8RB 5KFJA 2GGPA 2YWEA 2XBPA 1XQIA 2IM0A 3HD2A 3CCSS 2B9WA 1OWXA 2DH8A 1TR0A 3ZZOA 2W2OP 2VA2A 3MMBB 3MR7A 1OPIA 3CJ3A 2HHWA 3DCAA 2HVEA 2MB0B 1Q82T 2W2PP 2LYVA 1U7LA 1NDLA 2ZJRQ 4ZLPA 4IUFA 4J9NA 2CWXA 1OJ4A 1YBAA 2V9KA 5ETSA 1WHYA 1NO8A 5KG5A 3OPKA 2W2MP 3ZC4A 5J1NA 5A8WA 1LFPA 1WF0A 5L8RC 3TANA 3CC4S 2Y1LB 2BANA 3D2WA 1C1CB 4I68A 1JLBA 2RQCA 4J7CA 1ITPA 2AHOB 5K8MA 4NXNF 3DRPA 2QFIA 2YKAA 2CQ3A 3CCWA 3QAEA 5A8KA 1N32F 2V5HG 1FX4A 1QVFR 4JI4J 3FCWA 3IN5A 4OZNA 3T41A 1S76D 2WSFC 2IAJB 3I5AA 2HFUA 5LL6d 3D67A 4L76A 4PQAA 1LWFA 1SIWB 5J2PA 3NAIA 4ED4A 2FVCA 2MQMA 3PHEA 3I4HX 1QAIA 4ED3A 2RAQA 2OEJA 1FRKA 4DV6J 4I0WA 5CCLA 3BN4A 5L1IA 2E66A 2CQ4A 2VF3A 5KFOA 3PW2A 3KLHB 1S48A 2YNFB 1Z2ZA 2QA4S 2PDAA 2GFFA 2X1GA 1K1QA 1SV5A 3MD3A 3ICLA 3PJ9A 3W8PA 3FGVA 1ROFA 3AOBA 3H4BA 4TQSA 1AYEA 2WVFA 3MEDA 4TY8A 1ZAXA 4RNFA 4M8LA 3EGZA 3WC2A 2ZZMA 2RQMA 2ZZNA 1UA1A 1JKHA 4WCEQ 3MCSA 1FD8A 3M8WA 4IFVB 5BYRA 4CYUA 1UW9A 1RTHA 1WORA 1UA0A 2CG8A 4IH7A 2BQ3A 3F56A 2F4FA 1RT1A 3J80Y 3LP2A 5ETMA 2D9OA 2PFFB 2NYHA 3V4IA 1UWAA 3NS6A 3C15A 4PPDA 2N4DA 1KEKA 1IBKJ 4ZITA 5AXMA 2UUBF 2HS4A 3P96A 1S1WA 4DUZF 2H48B 4LR8A 1XNRF 2YKMB 4JB8B 4DV4J 1WC3A 3AD8C 2BUNA 3AT1B 1RU1A 2G4BA 4GKJJ 3K5PA 5B0BA 3V6HA 4DPUA 4YOEA 1UVMA 1FX2A 4DV7J 1BC6A 4EBCA 2CPZA 2PO4A 3SXLA 4N56A 1HBMB 3PCOB 4ZPDA 1GH8A 3SSQA 5KFUA 3OJUA 1NK7A 4Q0BB 1C0UA 3FSXA 1DQ9A 4I6WA 2NS1B 5B0EA 1RT4A 1Y0HA 1VK3A 3QMQA 2ZH4A 4F4AA 3BKUA 4ZCMA 2RDJA 3CMAS 5ETTA 1BY9A 1KKHA 1NH8A 2Y1RI 4ZA1A 2B6AA 1HNVB 3CDBA 1C1BB 4Q5VA 1WUUA 4DS4A 4HR2A 4A48A 2IJRA 1SKSA 5K14A 2VDHA 4O3SA 4ZVQB 2NXEA 1DLOA 5DRKA 5H9FJ 4EMDA 4B9MA 2CJ9A 2EFPA 2BRKA 2R8GA 1TTHB 2J0WA 1Q8BA 1V6HA 1EKRA 5GMDA 4HDHA 2VUGA 5HLFB 1R7IA 4Q44A 4B3SJ 3CJTA 1K9MT 3GFYA 1XN9A 3ITHB 3DNCA 4DF8A 3PX0A 2QFJA 3GSIA 3UD5A 3QGIA 3VCDA 3HFVA 2ZC4A 2GZOA 2F7VA 4FF1A 1KLNA 1JMTA 1IJEB 2UUCJ 4WKYA 2WB1D 4ELUA 1C0TA 2LXFA 1UWBA 4MAKA 2HPUA 2R7OA 1BQNA 5HVHA 2ZC3A 2OMLA 3T1HJ 4KO0A 5D3GA 5L9NA 1T9UA 1R31A 2DGSA 3G6XA 2CJYB 4NLOA 1FT8A 2BE2B 4N5SA 2W9BA 4MKYA 3POTB 4Y6IA 2FJAB 3QATA 1HNZJ 4NI2B 3MMJA 4PG4A 1YDLA 1S59A 5A0YB 2CAJA 1XNQF 5F8IA 4WJBA 5GMKa 2XO7A 2VQEF 1YITS 2AGOA 1KLMB 1PKUA 3MCMA 3CMQA 1YJUA 2OEKA 2DXFA 2W9CB 2VKZG 4BWMA 1H2VZ 4I6YA 1D1UA 1X5PA 2CRLA 1W2IA 3RR7A 2J8AA 3I6PA 1K0TA 2GHVC 1NJWA 1VLOA 2Y1IA 1IBLF 2MY8A 2CG4A 4LVNP 2RRBA 4KR0B 1TL4A 4PYDA 2HWHA 3CCLS 3L7PA 3CD6S 1SC1B 3QGHA 2FTRA 2D3ZA 1JJHA 4DPTA 1MW7A 4KV8B 4OI4A 3BKTA 3RGIA 4NXNJ 4DFJA 1UEUA 1LV5A 4LQ9A 1LWXA 4ZP7A 2MQOA 1N32J 2HQDA 4Y2KA 2XY6A 1E6YA 2GS8A 4DV1J 3Q8YA 3DMJA 3QRQA 2F4VF 5AXLA 4ED5A 5HO4A 2MKKA 3NCRA 3UCUP 3KK3A 3FEYB 1ELOA 2FZGB 4MH8A 2BJ3A 5AE3A 2FHOB 2ZHBA 2Y3YA 1F2GA 2DNZA 4ZLLA 2PIIA 2XI2A 4F67A 5F9NA 1RAFB 3JSMA 2VHGA 2U1AA 1M5PC 5E0OA 4B9TA 3DOMA 4OZ5A 5KFPA 1D0EA 2ROEA 5IQQA 2EPIA 2V2QA 3PJWA 1TKTA 3BBBA 2ATLA 4WFAQ 2L3MA 4L72B 2V2ZA 5CA5A 2BV3A 3I9ZA 4P74A 1GK8A 4ICLB 3P5TL 2RKIA 3H20A 2DR9A 4O3NA 2PMZD 2Z2MA 4M5DA 4QIGA 1WOPA 3KNAA 2MZJA 2BKNA 2D3OR 4EUVA 2H1YA 4ECSA 4EZ6A 4MIAA 4J9UE 2OPQA 3T6BA 2K1RA 4NYOA 3CCJS 2FLNA 1WKLA 1S0VA 3R8YA 4WE1A 1GXTA 1LXNA 1VYAA 2EC2A 2MLXA 2MHNA 3THPA 2YH0A 4U9RA 1JLGA 3MM7B 3FCHA 5C24B 4BC9A 1B7FA 2VG6B 2H65B 1AROP 1YQHA 1TKZB 3G82A 5LXRA 1TMMA 4NCGB 1NSPA 1TK8A 3A8KA 1H3DA 2UUBJ 3KLGA 3HVTA 1WKKA 4C8ZA 1HHTP 5IOLA 4DUZJ 2V50A 1CBKA 4ECYA 1XNRJ 2JJ4D 2GHWA 3JQKA 3R1LA 1M1GA 4FKYA 2YKNA 2FVSA 2BOAA 3GJSB 5M2UA 2DO0A 2V8VA 4RW9A 3IRXB 1YJTA 1OMSA 4C11A 3L7OA 5E5NA 3TA1A 1EZZB 4G1QB 3GIJA 1N34F 5AXKA 2BR0A 2RMLA 2VG5A 3MDFA 4IYQA 1YBTA 1SKUB 3D4JA 3I31A 4RNNA 5HMXA 1H74A 1S1VB 3LP0A 4TU7A 1W26A 1YIJS 2BW2A 2RIJA 4KB7A 4OX6A 2QX0A 2DR7A 3M8ZA 4J9VA 1CQMA 5C25A 3KTQA 3D54A 3LGHA 3MWBA 3OVAA 4H4OA 1S9GB 2KRBA 5KFKA 1GMWD 4S0MA 3TJ8A 3W3SA 3P49B 3LANA 3B4MA 4H4MA 4DR6F 2M70A 3KJFB 3CIZA 1HHQA 2H3EB 4KGXB 1SIZA 1KWMA 1FF2A 2BJ7A 4NLSA 3QPIA 1GNKA 2VPWB 3RB0A 4XDCA 2DRAA 3LUYA 3VVTA 2HFNA 2NLWA 2ZD1A 1U1OA 1U0SA 4C9DA 4NLTA 3KHHA 2DKOB 2EFOA 2O3DA 3KFWX 1OSDA 5J2NA 1NHUA 1ZAVA 3PEHA 4F3QA 2VDIA 2CWKA 3W1YC 2HNDB 3H8YA 4HEA9 1UTAA 2GVZB 5FDLB 1U0HA 4I2QA 1HBNB 1B64A 4UZCA 2OTJS 2C1EB 4PYAA 2M52A 4Q8EA 1GEHA 1PJ7A 2BM0A 5D78A 3D0IE 1FNMA 1WKJA 1WOSA 4A47A 4LMZA 2YBVA 3IGNA 4QYZK 4Q2LA 4AL6A 2OSRA 2C42A 2ZDPA 3FMBA 3MEEA 2PD1A 2AYGA 3I5BA 4Y2MA 2XMKA 1HQUB 4M94A 2QLFB 4LF9F 3V81A 2OHDA 4ZIVA 4F25A 4O3RA 1CJTB 1FFSB 4ANDA 4ED6A 5ETQA 2MQPA 2F65A 1EAYC 3M9OB 3MXHP 2XLKA 4RW4B 1FK9B 2OUGA 5F9LA 2OTLS 4DQRA 2UXBF 1KQSR 4ITSA 4IR9A 3FK4A 2JEGA 2UVVA 3G9CA 3TR5A 5BR8J 1REVB 1VISA 1XNQJ 2GMJA 2BW7A 4CLKA 4O44B 3N0VA 2V67A 4C8LA 3ZZTA 2VQEJ 2MQQA 4ZVFA 2QYGA 4R0JA 5LSRA 3LP1A 1GQEA 4QJVA 3UVJB 5IT9Y 2V4RA 4YMEA 2DHXA 1NAQA 4B3RF 1UVLA 2GQ2A 2G1HA 3NWRA 4LBIA 3W9IA 2PMHA 3OV7A 1H6KX 4RBVA 5DLGA 3UD4P 4FP9A 1I1GA 2FGOA 3IS9A 1RHKB 5AJ3F 2DEJA 4Q7AA 2XGQA 4L73A 1QLNA 4ZHRA 3Q8PB 2XM3A 1TAUA 5J2QB 4DR2J 4LBPA 3R5BA 1TKXA 5EHHA 1YJ9S 1AZSB 5E33A 3PYGA 5CXTA 1SJ4P 2QEXS 3VR1A 4DCPB 2MGZA 2E7XA 2ZOMA 1YSJA 1U1LA 2PI4A 2F4VJ 3TAMB 1JJ4A 3JQMA 3HDSA 4HHJA 3U27A 3GR0A 2VICA 3HM9A 1U6FA 4K0KF 4KC5A 1E6VB 1JNRB 1HI8A 5KFEA 2GGPB 5MLCV 5JXSA 5LOQA 2QMUB 2UVWA 1NPRA 5HBMA 1Y3JA 5FJ4A 4OQJA 2XMWA 4H4KC 4ER8A 2MSSA 5KT4A 4LSLB 1RCOB 2F40A 2RDIA 3BM7A 4OI3A 4A8YA 3LW5C 3ZTQA 3D1OA 2IM3A 4UY8T 3ISNC 4B9NA 2NZ4A 2IBOA 4ETZA 4YB1P 2ZH9A 2KO1A 9RUBA 3QJPA 1N52B 4FYWB 1JLBB 1YI2S 3GV5B 1Q7YT 4USJC 4HKQA 3PHTA 2N7CA 4AT1B 2DJWA 2JL9A 3DRPB 1FVQA 2N3OA 2HSEB 2WRMA 5HP1B 5A8KB 2JDJA 3HJFA 3PYFA 4O3PA 1Q78A 4MIWA 4K4TA 1B3TA 1VFJA 1FKOA 5CYMA 4KTQA 3EGWB 3SBMA 3VZHA 2J76E 2B7CB 1N0VC 2AX0A 1S4EA 1AXQA 1FRXA 1FTCA 1DZ5A 3MPDA 1TAQA 2P9CA 2R2UA 5GADU 2HK2A 1T03A 3R97A 1A7GE 2HFOA 2CDQA 1VQNS 8AT1B 3G8QA 1UKUA 4ZPVR 4CLTA 2VODA 4ES2A 4ANCA 1MMDA 4DSLA 2JHEA 1UPMB 1NU4A 4ES1A 1N34J 1SI9A 1V3ZA 2QG9B 1YZ6A 4PCQA 3MEDB 4NEZA 1Y5NB 1SBRA 2JFDA 2CPDA 4C48A 5HQLA 5T14A 1RAHB 1JLCB 1JKHB 1WF2A 1EETB 3N5FA 5KT6A 4JI7F 4CYUB 1VRUB 1RTHB 2ZH6A 1Q4RA 2DGVA 3CCRS 4ZMMA 3D6HB 1RT1B 2UUAF 1HARA 1SJRA 3C15B 3SMZA 2V4JA 3U7JA 3VQSA 4ILMA 3BSOA 2RSQA 2CPYA 4DS5A 2HGNA 5D4NA 1S1WB 3IXQA 1VLYA 3LTOA 3ENQA 3HT3A 4LFAJ 1MU2B 4BDPA 1FKAF 4CLSA 3P6YC 1U48A 1Z4UA 4ZPTR 3UPFA 4K4WA 2A2CA 1SL0A 1JLEA 5DETA 5CZXA 3MUTP 3PX6A 1NK8A 4L6V3 1UZHA 1TFWA 1J5OA 2XYPB 4C6AA 4NLGA 3CMES 4DV5F 3HHEA 4FDFA 5D15A 4NE9C 4LF6F 4CT8A 5CYJA 2DHSA 1C0UB 3J7YI 3NKYA 1RTZA 4NLRA 3K57A 3UW1A 1CQNA 2L08A 1RT4B 4ALZA 3VV2B 2AGPA 1H2TZ 2FQQB 4HHHA 1NDPA 4TQRA 1SJ3P 4CNYA 2EK1A 2DIUA 3W2WA 1VI7A 4G1PA 4HI2A 1C2PA 2B6AB 3OHAA 1UVKA 1YJRA 2LLZA 4BCAA 4C0HA 3OTBA 4NOHA 1HR0F 4NLQA 1GMWA 5K14B 4NWBA 2BYCA 3V5RA 2CUYA 1XR6A 2K7KA 1CULB 4DX6A 1RJJA 1XMOF 2GNKA 3QIPB 2HZCA 3TP2A 3MCOA 3M05A 4OZ0A 4QYZJ 2OEMA 1BUXA 2XMAA 1DHMA 1FXRA 1H7WA 3CJQA 3RG6A 3HP6A 1WHXA 2L48A 1HNWF 3HHKA 3AQPA 5C2GA 4MYTA 4C8OA 3QIDA 4F4YA 4NRUA 3RW6A 4PKDB 1FRIA 2CQHA 1X9WA 4Z7YA 4DFKA 1NMEB 2M9KA 1UPPA 1BHNA 3I9V9 5GAHU 3AA9A 1VJWA 4PXDA 1EX8A 4DQPA 2YKPA 2G0JA 1R8PA 2Q6CA 2BVZA 2XMTA 4LVOP 2COLA 4TYAA 3I32A 5M2PA 5BYSA 3ILLA 1QAYA 1S6PB 4DV3F 1KQKA 5T7LA 4IG0B 4J37A 4EBDA 3MURP 2FJBB 1HD0A 1M5HA 3F73A 1RTJA 3PJXA 4Y3CA 1NK6A 2NSBA 3JTOA 2FDNA 4FZVA 4IR1A 2PI5A 2E9ZA 2IRYA 1NJZA 2ADBA 3M8PA 1X9MA 3FBEA 1YG0A 5L39A 5DZ7A 2AGQA 3HFZB 1D9FA 3QFHA 3QNWB 1QTMA 1NHVA 5ETKA 3VALA 4K0KJ 5GAGI 4RUHA 3HHLD 4ZJLA 3A12A 2XZWA 1X4AA 1EKSA 2AMCB 4IDKA 5HJXA 3PFEA 3BN7A 1ZTTA 4LR9A 3G96A 1RQ0A 2DEIA 3F44A 4OFZA 3AOCA 2XEXA 4ZVOB 2E9RX 2HBZB 5G0RA 2GIFA 2OP5A 1X0FA 2PA8D 3M7VA 1NPKA 1IM4A 3VGVA 3IC1A 2K2PA 3PEJA 3AY0A 2K7JA 3DFEA 1NK4A 3AD7C 1VIOA 1SXLA 2DH9A 2CQDA 2CQCA 4XDDA 1FRLA 4I2PA 2XYHB 5BYQA 4DG1A 3NCPA 3BREA 3BV8A 2BEFA 3KLIA 1FDDA 1L3TA 1RWMB 3ET6A 1PYSB 4R8UA 3FSYA 4ENOA 4PEOA 1E6YB 1BD6A 1JXLA 3DMJB 1FVSA 5EWFA 5KFBA 4M5MA 3KK3B 2KXNB 2IRXA 1MROB 5GAEI 4URQU 3KLEB 3CDEA 4OI0A 2HRUA 4D3HA 3WHIA 4FN5A 2AEMA 1B0TA 3W65A 3DYAA 2F5GA 1HA1A 2XB2D 2CQBA 2QLWA 1CC8A 4HTIA 3BDPA 5IT0A 1QSLA 1T3NA 2BQUA 3TUJC 3PW5A 2DGWA 2JEJA 3FVYA 4ZPAA 3NBPB 2ZH8A 1S0NA 2J6SA 1I5OB 1TUGB 1TKTB 4LF5F 4RL1A 4OYAA 3ILOA 4X66F 4DU8A 3MM8A 3W5ZA 4YN3B 3CWJA 4OI1A 5EUHA 1RT2A 1HPZA 3DLHA 4M5DB 5LSLA 2I2YA 1RCXB 1XTZA 5EN1A 2EG1A 4F0HA 1Q86T 2A10A 3BQ1A 3KHLA 2FHJD 3AJDA 4K5RA 3DLBA 4HVZA 2B4VA 1CS4B 2OPQB 1CLFA 3MPYA 4WZQA 4WTOB 2HNYA 4JI7J 2QJ3A 2PEBA 4OV1A 2M3DA 3MAAB 3NG8A 2NREA 1VQMS 3FEZA 2UVUA 1G2EA 2HLUA 2KL8A 1MWZA 4GVBB 2UUAJ 3G82B 5D6GA 4PPZA 1CJVB 2DNYA 3KK1A 2VZ9A 3WC0A 2MZ1A 1M5OC 4DR4F 1TL7A 3HVTB 2LA4A 2B9XA 4B02A 2LQ8A 5LMUF 1RE1B 1U1QA 2J0QD 2EFQA 1GT8A 4Z7CA 5HROB 4KHRA 2YY3A 2JZ5A 1HNXF 3DHWC 4RW9B 2BKOA 2B7BB 1FNXH 3D6MB 1I51B 3G6VA 1SH0A 4C11B 3GFZA 1SH2A 2YX7A 3H40A 4PWDB 3O3LA 4AXIA 3W62A 2C2NA 4ZLNA 4C0BA 3CXCR 3T1AA 2YNIA 1UL3A 4QR0A 2XLJA 4OHXA 5IT4A 2XG8A 1HMVA 2R8HA 4B9LA 4HACB 4JV2A 2HHPA 1IBMF 2POKA 4USHA 3BYRA 1W25A 2Z56B 3LWMA 1KHWA 4P72A 1N36F 3QWUA 3EGNA 1U1PA 1R0CB 1PBUA 4JI2F 5C25B 3LAMA 4HTJA 4JI3F 3PW0A 2A0FB 4USIA 1RLDA 1S79A 2CNOB 2KJVA 2AW0A 4MFBB 4H4MB 4F4KA 4X4NA 2ACYA 2HBYB 1O51A 1Y00A 1F5CA 1ZOTA 3GJTB 2BMBA 3UCGA 1HR0J 5F3TA 1X4GA 3EICA 4DZ6A 3L3CA 1FRMA 2VBXA 3HT0A 2YPZA 4KRWA 1XMOJ 1VQYA 4ATNA 3TW0A 3MMCA 4ID5A 2MJUA 4C97A 1DTTA 1NZ8A 3MM9B 4EBEA 3H7HB 1HNWJ 2GHPA 8RUCA 2ZVIA 3UDCA 2EFVA 1IM6A 1JXEA 1R0AB 2E5IA 3Q23A 3M1VB 3MI7X 2GX8A 5J2NB 4LF7F 4DBQA 3MHYA 2W1BA 2AEFA 1NK5A 4RU9A 1YJ7A 2NUHA 2YTCA 4I2QB 3C16A 1URNA 2VD3A 2V63A 2CPIA 2CKWA 1U2CA 4DWIA 1T05A 2LEBA 4DV3J 1K1SA 2XWYA 1UJ6A 1S0MA 4GKKF 3SYZA 3FC9A 2DY9A 2Q6BA 2V34A 3PZPA 2OPSB 1QUPA 3V81B 5I42A 4DLGA 4LF2A 2MTLA 1IQTA 3I4PA 2Z4PA 1DRZA 4CO1A 3DRRA 4KHMA 5JUMA 6FD1A 1XMQJ 2CFXA 4JI1F 3DU5A 2OPPA 1S5ZA 5C42A 1ZPWX 3M6UA 4DL4A 2LA6A 2UU9F 2W8KA 4W90B 1U2RA 4W92B 3FEXB 2IDLA 2RF2A 3I0RB 4IH6A 5IM0A 4B3TJ 2XS2A 4CM0A 2WAQD 2JEIA 1PILA 2MLZA 3HXMA 2M8HA 3R7NB 4DN9A 2DGTA 4XO0A 1HBOB 4I1TA 1I6JA 6AT1B 5EWGA 4ZP9A 2CJAA 2MPUA 4UW2A 1O0PA 2XMUA 2J9DA 1BWVA 4YR3A 4Y34A 1D9AA 4LQ3A 3JS9A 5C5JA 2XMMA 4ZVUB 2BRLA 2K3IA 4B17A 4Y2CA 1RT6B 1QY7A 1O5JA 2V8DA 1H38A 2J6UA 3UWTA 4ZHRB 1FXDA 3K5NA 3KWMA 1FEEA 1FCAA 2RHSB 3ZTPA 1S1UA 2CYYA 4M5LA 1RYRA 2E1PA 2I9SA 2N82B 2MGZB 3F41A 4FYVB 2HQIA 1IKVA 2VC1A 2M0GB 4R5PA 4PG7A 1RT7A 2E1CA 3NNHA 3JXOA 4K7QA 3MM6A 3SZ2A 2NPFA 5FLXU 3PKYA 5HI7A 2DISA 3QBCA 3R6GB 1XEZA 3N9UC 2R7TA 1TL1A 3I0SA 4FXDA 3AOAA 1O8BA 1UFKA 2M2BA 1NCLA 1RWPB 4Q8FA 3KDNA 2RE1A 4LF5J 3SV4A 5HVGA 4F04B 2AJ1A 4X66J 2WK4A 4PWUA 3KHGA 4F3OA 2H4WB 4I6AA 1R8HA 3DM2A 1V3SA 4F02A 3PM9A 1X4HA 5D4PA 5LJ5Y 1LW2A 1XR7A 1WWHA 2OKQA 3ZZPA 2E5JA 1U8SA 1X4FA 1MWYA 3WX8A 2IVMA 2CZ9A 4NLUA 1HNIA 3SFGA 1J5EF 4CLWA 2O5DA 1MSWD 2HHUA 4X4OA 4N77A 2XTJP 3KLFB 4PABA 4RUBA 4K4SA 3BBFA 3PO5A 1YLXA 3AJ2A 2VQFF 1NKEA 4ZKAA 4JI8J 3ELHA 4WP3A 3DU6A 1X5OA 1RUSA 2QMXA 1FKOB 5CYMB 1SJ1A 3PY8A 4ZK7M 1F6TA 2RNEA 4RW8B 3AB4B 2R8IA 2CPEA 1ZBTA 4K5SA 3SQOP 4V19J 2XZDB 2IHR1 2Q43A 3MM5B 4DR4J 4CDIA 4WZMA 4AQYF 4OIXA 2YXLA 3TVZA 1UAWA 5LMUJ 2IVFB 2MEWA 1L3KA 3HHNB 2RQKA 4LSNA 2W4DA 3OUYA 4QU6A 1Y9OA 3NGRA 3DI6A 2DY1A 5IS2A 5KT5A 1Z2LA 3PVXA 1M90T 1KFSA 1HNXJ 2JC1A 4YY3F 1L3SA 3O8WA 3PDNA 3BH6B 3HSZA 1AW0A 3C6TB 3H0PA 2FLLA 5K8PA 1NRKA 3HJVA 2GJ2A 1EQ0A 4CH0S 3A3NB 4OHYA 1CSJA 5KG4A 4FPRA 2V9WA 2CVIA 5J1EA 1U26A 3BPSP 2OPRB 1RT5A 1FTRA 2WONB 4QYRA 2JWNA 1IBMJ 3I87A 4IRCA 4DL6A 2I0XA 1N36J 1HI0P 2ZHAA 2IFXA 2YQ0A 1KD1T 1RK8A 2C2RA 1B4SA 3SQGB 3QSYB 4P2SA 2WOMA 1W7WA 2PGCA 4QBUA 2B8PA 1QE1A 1RA7A 5DS7A 2HMIA 4E8UA 3RBDA 5K9FA 2HGLA 4IFYA 1VS3A 1N5TA 4UY85 3RU0A 5AT1B 3M2RA 1JLAB 3A8JA 4ES3A 5JJBA 4WF9Q 3W9HA 4TKTA 2H51B 2C3UA 4DSJA 2HHSA 2KZZA 4FNIA 5KG6A 1FJ7A 2HS3A 1IVZA 4I7FB 4I67A 4UUXA 5E3CA 4M63A 2KI2A 3JSYA 4IG3A 4CTAA 4XAKA 4PUOA 2AIRB 5DGAA 3M30B 4OI6A 1JLEB 1FD2A 3KMSA 3H98A 4QR1A 3OHBA 3JSBA 3M32A 4LF7J 3OVBA 2J7KA 2C2KB 5BXIA 3LAKA 1RWNB 3GIIA 2KVQE 3CCVS 5F8HA 1RHJB 2J0SD 3SV3A 2W2NP 1MMNA 1LWCA 2ALYB 4RW6B 4JBCA 2R8KA 3CTRA 2DPJA 2W25A 3AHPA 5IQ6A 4GKKJ 1VQ8S 2AZ1A 2B8QA 2H5IB 4USWA 3H2UB 4ECVA 1RTDB 2NSCA 1JLFA 3C66A 3NLCA 3D68A 2N7YA 3KMQA 5CZVA 3H25A 3V6KA 4O4GB 4DLEA 2HYIB 4C8KA 4CLUA 3CJ2A 2Z0GA 1N6QA 1WSRA 3GJQB 2HKEA 2IYIA 3IR5B 1HIYA 3OLAA 1NXIA 4QWBA 4JI1J 1ZZFA 4I56A 4OJGA 2J7UA 5DJBA 1DTQA 2U2FA 2R7QA 1TV6B 2LEAA 2UU9J 2P5VA 1HYSA 4MK7A 2WBRA 2QLXA 5THWA 3W60A 3T5HA 3EMTA 2ZOGA 4XIUA 3BJYA 4KHPJ 3DLEB 5DG7A 2AYEA 4B3OA 3HVRA 3U02A 4OYZA 1R6YA 2HHTA 2XHCA 2R7SA 2HEKA 1M5KC 2AJFE 4B9SA 4B3SF 1WNEA 1WDTA 2XY5A 2P9GA 3OT9A 4BHQA 3ETMA 2LQ9A 4USUA 4GC7A 3HKWA 2C3PA 2XY7A 4EWTA 3LPEA 5RUBA 5T7LB 2I38A 2KYXA 4CWBA 1UP1A 2B5JA 1RWOB 3UR3C 4KFBA 2B4OA 5B0AA 3KK2A 3DKDA 2BXJA 1JLQA 1RT3A 4F4XA 3VGUA 1U1KA 5KT7A 5DDPC 2HHQA 2IM2A 2ZM6J 3Q8QB 4MMOA 2BJ1A 5IV3A 2JSXA 4ED7A 4JI6F 3JYTA 1JQGA 3W9JA 5A8RA 2H5EA 2BZ2A 2QT7A 1F3VA 3T1HF 2LQBA 4RJVA 3TEHB 1LW0B 3UN3A 4M5IA 3TYTA 3W8GA 3CDAA 4WIIA 3HSDA 4IDKB 5CYQA 2E5HA 3CJ0A 2CZ4A 1G1XA 3GV7B 1LK7A 1MNEA 1ACMB 2Z2LA 4YB6A 1RBLA 5G0RB 4MKAA 4TU9A 3OFFA 3VAHA 2HURA 2IJFA 3ENVA 1DFDA 4TN2A 5A76A 1VJQA 3UDEA 1M0SA 3QZ8A 3QRPA 1G6BA 2JH3A 2KU7A 4FF2A 1GTEA 1RWUA 5ETRA 4CRJA 3J80U 2IYGA 3MGJA 4RU2A 5ETLA 3O1LA 4NLWA 1RP5A 1UJ5A 2ZBPA 3FNNA 3KLIB 3I96A 2O01C 4F36A 3PKMA 3ET6B 1WF1A 5KAKA 3M6VA 4R8UB 3FFIA 2I5JA 1J5EJ 1P9YA 3RUBL 1IKXB 1Q5VA 2DHHA 3CO0P 1CC7A 3UD3P 2VQFJ 3OR1A 2FJWA 2HHHJ 4DV1F 4LR7A 3EPGA 3JQJA 3HD1A 2EC0A 1S9FA 2VFVA 5LJ3Y 2YNFA 1B0PA 4AQYJ 2M8DB 4CLLA 2Z2YB 1RSCA 4DSEA 1RHUB 4F50A 2ZKTA 1KSPA 4YY3J 2ASDA 1PIEA 2AJ0A 3FCVA 2CQ1A 4EK2A 3DC2A 2ZWOA 3D6FB 3Q8RB 3V6JA 3N01A 3E51A 3CGIA 1NZAA 4PQUA 5KFWA 2V8HA 2XQCA 2JEFA 2HW3A 4NMLA 1U1NA 4ECRA 3ZO7A 1VRTB 3HSJA 2R2TA 3J7YU 3NOGA 2DTJA 3NGDA 2KB2A 4EO6A 4ERDA 3R5GA 4X4VA 2HK3A 4L75A 4DV0F 3FMWA 3JTPA 3OTCA 2M7SA 2C2ZB 2H54B 4AL7A 3LALA 1AA1B 4CH7A 2HWTA 2Z8QA 4FVCA 4RBTA 1YTYA 4C4WA 1Z1ZA 3DLGA 3KK1B 1AUSL 1DJ0A 5DM7Q 2YKMA 1YWXA 4RZRA 2OELA 3CCES 5LXYA 4TU8A 3LO3A 5KOXA 4OL8A 2CJQA 1CPZA 1EP4B 2OIHA 1YZ7A 4BBYA 4ID8A 4DL3A 2A6MA 2MKJA 3SCJE 1HBMA 1PGZA 4LSZB 3MR2A 4OHWA 3CCZA 2XYGB 3KHRA 2M5YA 3MAHA 3DDKA 2HQCA 2YNIB 3DXBA 1HMVB 4AYBD 2A3JA 4KQZA 1FKPA 2EWHA 2AKWB 4P7TA 2L9WA 2ADCA 4MK8A 1X4CA 3MMAA 2IIHA 4J9KA 1HNVA 2KHCA 4OHZA 5HN0A 3N6NA 3AQOA 2B56A 2MDAA 5B7WA 3WQPA 2NXNA 3J7AN 2LU1A 4F26A 2E44A 2HQGA 3JB9k 4U7UK 1S57A 1IXKA 4QWAA 1BQMB 1VBKA 2MQNA 2AD9A 2NCKL 2X3DA 1SH3A 2IRUA 2V0NA 3L9ZA 2BE9B 1F9FA 2CQPA 1X60A 3CJ4A 2N4CA 2Z58B 3NGTA 1FXLA 1X7VA 4X4UA 1QTNB 2PN6A 2LEPA 1Q8KA 3IR6B 3HSGA 3MUVP 2E29A 2AF6A 1W2BR 5KFRA 3C6UA 1DURA 3TI0A 3V6DB 3PRVA 4X4RA 2ALZA 4A8OA 1FDNA 2KYZA 3B82A 4N76A 2QSFA 1YJVA 2CPJA 1ZAWA 1UVIA 3FZ2A 2ZOFA 2CADA 1T05B 5KG3A 2WTFA 5F8LA 5KTQA 2VA3A 3PR4A 1NNDA 2LP4A 3Q83A 2VV5A 2RVJA 2JLGA 4ZP8A 1VHFA 5KFTA 2DR8A 1R0BG 3NMAA 3H5XA 5EDWA 2RT3A 3EPIA 4ZOSA 3HULA 4U67Q 2MQ8A 3DDIA 2DGUA 5HMYA 3ISZA 4FPIA 4OZ1A 4JV0A 2BE2A 3THVA 5SUHA 3POTA 1BMQB 4LF4F 2AJ4A 4YR0A 4NI2A 2E7VA 4JI6J 2OMOA 1RHRB 1FJCA 5A0YA 1NKBA 2FVRA 1X5TA 2VONA 2ASLA 5C42B 4CLZA 1N4LA 1D8ZA 1X9SA 4HYKA 5KFFA 2CZVC 2OLWA 1Q8IA 1U24A 3BSNA 1YVFA 1IBCB 1DARA 4BLGA 4YDXA 2PE8A 5BR8F 5F8NA 3FBBA 3UE2A 4NRTA 5CQGA 2LXUA 4K8RA 3BSCA 2ZUAA 5A6PA 3HF5A 2D41A 3DLLQ 4J5OA 1FJEB 2DPIA 4KE5A 3TQ1A 1VQ7S 1N33F 2F9JA 3LQVA 2KN4A 3M2VA 2BBEA 3ZTOA 3P3DA 2L9DA 2ZH3A 1YX2A 3VAIA 2E5LF 4KV8A 4M5HA 3CCTA 2HBRB 2VPZB 3IBFB 3CJKA 4DCOB 5HANA 4N7TA 1H2UX 4QIVA 1HHSA 1O6XA 1TUWA 1TK5A 3T6JA 4DV2F 4DR2F 2ZZTA 2E9TA 3CC2S 5T41A 1VQOS 1IKVB 4R5PB 4P2MA 3WIVA 1OPZA 3GCXP 1RT7B 4KH0B 1RHQB 3C19A 3J81Y 1NB7A 2FLPA 1YRUA 2IPOB 2RU9A 3ZFVA 4DR1J 2BABA 4WFXA 3BS9A 1U49A 3QO9A 1CJKB 4K2XA 2QLBB 4F2RA 1DQ8A 2BQRA 4USKA 3R1HA 3KG1A 3HHLB 2D3UA 1VGYA 3I0SB 2OSQA 2DVIA 4HT5A 3D66A 2VG7A 5GVQA 3GIKA 4J9LA 2JLFA 4M5GA 3GIMA 4ICLA 1LWEB 3EGVA 2LQJA 3J81j 2PA3A 4DUYF 1XIQA 2QV6A 4FNHA 4KSEB 2G2ZA 2CXEA 2G1DA 1IJFB 5DQIA 3OSNA 3NNAA 3DM2B 2GMHA 1VBZA 2HAIA 3GB0A 4OX8A 1LW2B 3E01B 3WIUA 2WW8A 4CIOA 4A8WA 1HNIB 3MM7A 1QM9A 5C24A 1I3OB 2BACA 2VG6A 1FE4A 3CDUA 2RS2A 1WEZA 1TKZA 4DV0J 1FWKA 3NY0A 2B0GA 1CEZA 1ZA2B 4AUKA 2R2RA 4J91A 4WIQA 1GTHA 3HHDA 3U1LA 4ZCKA 2IDEA 4EFAC 1NLKL 4DSKA 2CIMA 4BC7A 2VBYA 4NLPA 1S72S 1HBUB 1KTVA 2DBBA 3VVUA 3IRXA 3R5JB 1X0PA 4LSNB 3OUYB 4NEYA 4B9UA 3G6YA 3PIPQ 3R7SB 3H4DA 2LDIA 1SJQA 4F3MA 3PNIA 2VPXB 2KKHA 4G1QA 2G13A 3LWLA 3EYZA 4YDDB 3W2VB 2DNPA 1U1RA 3DGPB 2R7RA 3I82A 3WBZA 2PSZA 1JJCB 2APOA 1S1VA 4Q2MA 3UDVA 4KGKA 1TUVA 2Z30B 3EWGA 1R43A 2Y9HA 2HG4A 5J1EB 1Y4ZB 2BJ8A 4OZ2A 2KG1A 1RT5B 4MK9A 3BO4A 4DCJB 3C14B 3V2UC 3TX8A 1IKYB 2CPXA 2QN6B 3VF0B 1GX6A 2C3OA 2R2SA 1U47A 1OQ3A 1S9GA 1HWJA 2B9EA 4IOCQ 2R3VA 2EBEA 3RAMA 3BGRB 3FQKA 2WOMB 3CNQP 5GADI 4U7CA 1N5VA 3KYLA 4EYIB 2ZH5A 3N28A 4W98A 1U2FA 3HKZD 3RRKA 4LFCF 3G2XA 3BEGB 5E7OB 3BGLA 2FUG9 3NCQA 3M2RB 3UNYA 5IT9U 4ECWA 2J8SA 3QLHA 5IWAF 2E1RA 4A8FA 2JC0A 3ISND 3G4SS 4J90A 1OS5A 1MMLA 3H5YA 3RAXA 2XZTB 5KG1A 4NLXA 7FD1A 1VC0A 4NX9A 4LFAF 4CTAB 4PUOB 2HNDA 1KS2A 5DDOC 3CDWA 1FESA 4JP8A 4YUDA 2QZ8A 5FDLA 3TO8A 4IQXA 4I4BA 2CPHA 3M32B 3KJVA 4CM2A 2ZBCA 3BGUA 2XGPA 5HJYA 3QJLA 4X65J 2XS5A 2QL9B 2UV8G 4UZBA 3F0NA 3KUEA 4O0NA 3UDLA 3MZIA 5A2QY 4DZDA 2V8PA 1LWCB 5ETOA 3HFKA 3NS5A 2EFNA 2GC8A 5AXNA 1BQXA 2DNMA 3MFHA 2C22A 2ZFHA 1P1LA 2H4YB 1UEVA 3DGVA 3OTOF 3VAJA 1VC6A 1FK9A 3TQEA 5CCMA 4USTA 3EZOA 4LF4J 1WC1A 4MJKA 1RADB 2H5JB 2QC3A 4GO5X 1WDDA 2G0IA 2C28A 3N79A 5I3QA 3FUYA 3W66A 2EFGA 1SUQA 1HYSB 2HRYA 1VHIA 3UVJA 4E2FB 4Q43A 2UZAA 4F4WA 2AT1B 1RB0A 4P2XA 4JI0F 6FDRA 3VAMA 1YK9A 2ZE2B 5KG7A 3TZXA 3M8QA 3Q0AA 1GAOA 1RTIB 4OZLA 2YPYA 1S7IA 5L1KA 2DYAA 1SL2A 2E7WA 5KFCA 4F8RA 3OLBA 3RTVA 4R0EA 1N33J 1OYEA 2DXEA 2YNGB 2H9ZA 1VQ6S 2CJXB 4XPCA 1KQGB 4NZ7A 2RD5C 3ILIA 1LNQA 3D3BJ 1RISA 2E5LJ 4ZVSB 5DGBA 2B5JB 2NXUA 3DOKA 3QJJA 1JXVA 4OMFG 1RT3B 1KRPA 3EVMA 4P52A 3CD0A 4MKBA 3TAMA 4ZPBA 1YBUA 4DV2J 4AL5A 2RB7A 5KT2A 2X1AA 4M5JA 2IMWP 2HFSA 2R7XA 1HQEA 3JYTB 2XHWA 1GMUA 4NLVA 3JAMY 1S6QB 4IOAQ 4M5KA 1OQ6A 5CD4A 5F8GA 2W7AA 4JOUA 3M2UB 2PEHA 4LF8J 1M1KT 1PJ6A 5L1LA 1JJ2R 5GAHI 4RW7A 1IKWA 5CYQB 4C3MA 3HO1A 4LSLA 4WKRA 3HCXA 3MEGA 1NSAA 4J9SA 2FY1A 2HRTA 4ECXA 4ZCIA 4QWCA 3PTWA 4NLDA 3HX9A 3U1MA 3PG9A 4UQTA 1JIHA 1UCNA 2HWIA 1TKDA 4OJHA 1L5UA 4KH1B 4LRFA 3MR3A 3AAWB 4DUYJ 3D9BA 1ZM2A 3Q89A 4XPEA 1BXNA 4WTYA 3ONQA 3HLUA 4FBTA 3J7Z5 2C2MB 2GVDA 4LFBF 3GJRB 1PCAA 4O4RA 5HP1A 1RAIB 1WEXA 4ELTA 1T9YA 4OJ3A 3TWZA 4YEAA 1A9NB 4FYYB 5A8WB 2WVDA 3EM1A 2A18A 2C2EA 2ILYA 1DQAA 4M95A 2BANB 3FFIB 2I5JB 4OX7A 4NA2A 3TJ9A 2DNLA 5D0HA 1M1HA 3G8TA 4V19X 3EX7B 2YWWA 3GFXA 3EDRB 2KG0A 1FFWB 3OR1B 4DPXA 2GW8A 2FZCB 1XWLA 4WFNQ 4R25A 2L41A 4LREA 1NH7A 1UETA 4L3NA 4ZIWA 1VMBA 3SCKE 5HSPA 3LGMA 2CPFA 1IR1A 4DN0A 2HLTA 1F5AA 3E3XA 1AUDA 4DSFA 1LWFB 3PW7A 2M4MA 2MKCA 5J2PB 4Y00A 1KBRA 2WZ1A 4DX7A 4KKOA 1K8AT 4ZJOA 1Q53A 2DXDA 1H0HB 1R8AA 1HKAA 5MAOA 2J0XA 4PXCA 1OIAA 2IBKA 4BWJA 5ITHA 1RI7A 1T9XA 1OY6A 1N8RT 2DR6A 1SV5B 3PYDA 3T5KA 4EI2A 1SVDA 3OTEA 1JLCA 3OXFA 4PQUB 2KVIA 5HQ8A 1EETA 2DH7A 5IFMA 1VRUA 3SSSA 1D9DA 3EZ5A 2VASA 4TY8B 2HGMA 1ZA1B 3MPVA 5DQHA 1F2HA 4KJIA 3EUNA 3OR2A 2JLEA 3D0GE 1VQ5S 3GG0A 4QQBA 5LSOA 2HVZA 4KPYA 2KZMA 1RDRA 5DO2A 2JVRA 3DLGB 4LFCJ 1KTQA 3W5YA 4F0KA 2LMIA 4OX9J 1MU2A 3DLJA 3LP2B 3V4IB 4Y28C 4LRDA 4CLFA 5KFMA 3KG4A 5IWAJ 1NUEA 5L38A 2K06A 4U8VA 5KFHA 3IR7B 2ZEJA 3HVAA 4CP5A 2Z57B 2CDRB 3TZYA 5C2CA 4F7VA 3QYYA 1S1XA 2DHAA 2E1MC 3A13A 2QL5B 1S97A 3RW7A 4A8KA 2WSCC 2ZWPA 3FJ2A 5CABA 2EXUA 1RAEB 4OZ3A 1FKPB 2B51A 3GPAA 2FZKB 3RYLA 5G4DA 3MMAB 4O0IA 5H9EK 3DRSA 2ATCB 4OYMA 3THTA 2RRNA 4ECUA 4TVAB 2IC3A 4QU7A 1LXJA 1SKWA 1WOOA 3IBWA 1KONA 2AZ3A 1VK8A 1N0UA 3OTOJ 3KUHA 4G3IA 4H54A 1CULA 3FSIA 2ACMA 2UXDF 2FHMA 1HLWA 4Y2AA 3QIPA 2UV8A 4XK8C 5E41A 4ELVA 2FPHX 2OFGX 4OLOA 4AXJA 4ZP6A 1ZTWA 4X4TA 2WVBA 4OYBA 3ULHA 4N41A 4OYIA 1H98A 2FC9A 4EEYA 4DQIA 2E1AA 1DLOB 3P4UB 2AYBA 4NYZA 1HW9A 2GAHC 5ETPA 1Y10A 4JI0J 3RB4A 1FWPA 1VQ4S 3C6UB 5KG2A 4UT4A 2FHKA 3MFIA 4X64F 2YWFA 4MT1A 2QA1A 1IWGA 1OO0B 1VR6A 1S6PA 1U25A 1Q81T 1KR4A 4CLPA 4IG0A 1DY3A 5E3PA 2W8LA 3UO0A 3CUNA 3D1HA 4KIAA 2I6WA 4LJMA 1NJYA 2EKNA 1SC6A 1V5IB 4GMKA 1FNOA 4A46A 4K4ZA 1TL3A 1SC3B 1NSKL 1WG5A 1PYTA 1C0TB 1UWBB 2OAUA 2HAFA 2MXYA 2F3JA 5GMEA 4ETXA 1BQNB 1FHTA 3HK2A 3UFCX 1RAJA 3MOJB 1MLAA 1FJGJ 2JNJA 2VOPA 4OV6A 1RKJA 5KFNA 4KO0B 5D3GB 4FYDA 1XMQF 1JNZB 5D0EA 2KTQA 1B99A 2W9BB 2KFYA 2N3LA 1T9WA 3CD7A 2KT2A 4N8OA 3BDEA 2BA9A 2D1CA 2ZNYA 2ZBRA 1BWEA 3L09A 4U7UD 5B08A 4YS2A 1APSA 1V5VA 4DR5F 1J2VA 1N5QA 2FIUA 4AE5A 3FDSA 4NPOA 3G8SA 5EWEA 4B3TF 3IWLA 4DFPA 3BPDA 4FS1A 2VKRA 4QW8A 1GXUA 3M2VB 3GMGA 3T19A 4FXWA 4URSA 2HQFA 2YWKA 2GQCA 1NEEA 4IRDA 1PC4A 4LFBJ 3QT8A 3T1YF 2MJNA 3KUGA 4UOHA 3AB2B 3CJKB 2B43A 4DL0C 4QCLA 3R5CA 4DL7A 1VQPS 3B4DA 4C2MA 4ZN3A 3OQ2A 3CD5A 3CJ5A 5DG8A 1MROA 3RZAA 2AWZA 3KLEA 3OL7A 2HBQB 3RB3A 2VOOA 3FBFA 4F4ZA 1U1MA 1FI4A 4YQWA 2YVSA 4WYLA 4CH1A 2RHQB 3JTNA 4LBHA 1SB6A 3G71S 1KVKA 3QO9B 1HWKA 3RJMB 1SJFA 3LH2S 4NXMF 2A6OA 4DL5A 3K8WA 4E0DA 3MTJA 2LVWA 1ZYQA 3NBPA 2QGFB 1R3NA 1HWLA 1S12A 3GYNA 2VG7B 1R8CA 3IA0A 3U1NA 5J2MA 2NXJA 3JSMB 3PXGa 1Y3KA 1ICEB 1OSCA 1N5SA 2VPYB 4HT7A 2WB4A 1JX4A 3DOMB 3S7RA 2MHEA 4W4MA 4PG8A 2OD4A 2GA7A 2OD6A 2A1BA 4B9VA 2WVEA 3MR5A 2KFZA 1SQGA 5L1JA 3K89A 1CS4A 4JV1A 3DRXA 2RRAA 2MZRA 1R6VA 2RKIB 3LGNA 1RABB 3MAAA 4CI0B 1P9QC 1C4AA 2NUUG 1UW4A 4ILLA 4KAIA 1YKWA 4GVBA 1V3RA 3GIRA 3OFEA 4IKAA 4WFYA 2K1RB 1CJVA 5DQGA 4J9OA 2XNRA 3SCLE 4WE1B 5HQMA 1CG2A 1XERA 4ZJQA 2KM8C 3X1LB 2HIYA 1QAJA 1JLGB 4JI8F 2PT0A 1MWQA 4V1Ak 4ZVGA 2ASJA 1T95A 5HROA 3N5BA 4QWEA 3AXMA 1X4DA 3T9ZA 3OD2A 4KPCA 5KFZA 3C2PA 1VOMA 5DZ6A 4PWDA 4C3KA 4TLQA 3KLGB 3Q2SC 4RWXA 4NLYA 3WZ0A 1NJIT 3D28A 4OHVA 3CCUS 1G4CA 2YKNB 4DU7A 4K4YA 4WP8A 4HACA 1RHMB 4WPAA 1HQ2A 4PG5A 1XMBA 5KOWA 4UTGA 2RUSA 1ZPVA 3HVWA 1V9OA 5IC6B 2GJIA 4DQQA 4P2FA 2VG5B 1KQFB 3IWNC 4F2SA 3R27A 2V69A 3LP0B 4MFBA 3TAQA 2QO3A 1QUVA 3ZNUA 4G1IA 4B08A 4MKVA 1XK8A 4YHHF 4ZCLA 2I8EA 4ZVHA 1R27B 4HH1A 2P9EA 4H4OB 2UXDJ 4OYXA 3D7SB 3S01A 2ROGA 4J9RA 4WU3A 5LT5A 1KVIA 2V2VA 4ZPWR 2FLOA 2GO8A 3W63A 2O1PA 3QLHB 1IQZA 3MM9A 5H1SV 3VAKA 3TA2A 5DDRC 2F8MA 2QA2A 1PYOB 3K59A 4D3GA 3Q2TC 1WTBA 5H9EJ 3KJQB 1R0AA 1LK5A 3M1VA 3UCZP 2ILZA 2CJBA 3WX4A 4WU2A 1M5VC 3C3LA 3FQLA 3MF5A 3HI9A 1U4BA 3M9NB 2PFDA 5KFQA 2WSEC 1SQEA 3S1TA 2ZD1B 3ZTRA 4DJBA 4X64J 3KJVB 2XNQA 3MPWA 1NHKL 3ILJA 2HHVA 4JV5F 4IRKA 4LIWA 1KOHA 4YB7A 2X1FA 2XSJA 5I3UA 3QWPA 2MZTA 2XS7A 1ZM9A 2VFSA 1U0HB 2PMWA 3OXLA 1PAUB 2YKOA 1U8WA 2OPSA 2J7WA 1GMVA 4GO7X 3W61A 4DHVA 4ZVPB 3HZGA 5F0UA 4A8SA 1Q79A 4KGZB 2KHDA 3CPWR 1WHWA 3ETOA 3E8OA 3MOZA 1T9TA 3MEEB 3CJ8A 4WBFA 1RZMA 2GMLA 4K50A 3K8VA 3LF0A 1VQKS 4K4VA 3G87A 2P6SA 3QZ7A 5M2RA 3EVWA 3DN9A 5D8HB 3DLKA 5BJRA 3NXZA 2GAGC 2VBWA 5DM6Q 3I0RA 2RDDA 4C98A 5B09A 1ULRA 5CHCB 4QR2A 1AFIA 1SUQB 2R42A 1HBOA 2QE5A 1NB2A 1URRA 4UQGA 5DDQC 1EIYB 1T11A 1RAOA 4QOTA 2K3KA 2ZBQA 3M8QB 3IAM9 4DR5J 2EKYA 3WDOA 4OYOA 4DFMA 2ABYA 2HS0A 1KVJA 4KHPF 1IBLJ 2ZDOA 3LP1B 4I64A 3CW2C 1RT6A 1YHQS 1I94F 2A2DA 1IR0A 3SDEA 1FE0A 2ASYA 4AFFA 4RKUC 3DOLA 2DNNA 4FF4A 3QFWA 3UQSA 3BGOP 4P73A 2QLJB 4CO4A 5D0RA 3T1YJ 3VQTA 4L74A 3NS7B 1C4CA 1K0VA 2DT9A 4K59A 3DOKB 5E3RA 3RR8A 3IS9B 2XMVA 5A6WA 1REGX 4ECZA 2IA0A 3IAS9 3OVSA 1TKXB 2DGXA 3DDNA 2YQ1A 3PW4A 1HQEB 4EU0A 4NZ0A 1YJWS 1U45A 1Y5IB 2ZM6F 4QWDA 4LUBA 3T5JA 2ZJPQ 1KHVA 1S10A 2ZJQQ 2ZBIA 3EZUA 1R8BA 1K73T 1G3OA 4RW7B 1IKWB 4NXMJ 3MEGB 3R5DA 4A4JA 4DX5A 4HLBA 4C8NA 2ERRA 3K5OA 4FS2A 2BJDA 2JRSA 4M1KA 5HBMB 3PR5B 1X4BA 2IY5B 4NCBA 3NWGA 2HVIA 1IWAA 1FRHA 2Q1LA 4K4XA 2FVQA 1EQMA 4BS2A 2XC9A 3NMRA 3OFGA 3CULA 3B78A 2EVZA 2FY8A 2J9DE 3QSIA 3BYPA 4HL9A 3GTYX 1SL1A 2KFNA 3IG1A 2Y8WA 2HQ3A 4YR2A 2GVDB 3P5BP 3QGPA 4X2BA 1Q7LB 3KLFA 4IO1A 1GXLA 2YQ3A 1VBYA 2VC0A 3AA8A 2YKQA 3UI3A 3TVKA 5KFYA 1PAEX 1Q0NA 3LPYA 1YRXA 4DEZA 2VU5A 4X84A 3Q86A 3K58A 4JYAF 4RW8A 1Q16B 2FD2A 3CCQS 3GQCA 1FERA 1ZM4A 5LMNF 2WW4A 3NOCA 3GLJA 1WI8A 3MM5A 4OI2A 1RWKB 1L3VA 3NEKA 1FFGB 3MEKA 1WC0A 5CD4H 2HHHF 3H42A 3MECA 1N88A 2V8GA 2AJQA 4DPWA 3K17A 5K8OA 2VJUA 3GYXB 3GONA 4YFUA 2XMJA 1F1BB 2OI2A 3A8IA 3OFHA 2FGCA 1FEHA 4KKOB 3CCMS 3N6LA 2W7PA 3C6TA 1R89A 1Q95G 3RAQA 4K2JA 2NQPA 2Y0BB 2XSFA 1NK9A 3SI8A 2YWHA 1T03B 4PR6A 4RO0A 2HNZA 1MN7A 2Q66A 1SCJB 2OPRA 2WONA 2W9AA 3QRRA 3T5LA 2KH9A 5D77A 1EHWA 2KT3A 2CNNB 2BDPA 2AU0A 1NJXA 1N54B 3FRYA 3SQGA 1F5BA 3TEGA 3KDOA 4LF1A 1NDKA 3OR2B 2FJVA 1CVJA 3ZZRA 5JMNA 3TNVA 3CE8A 4NA3A 1RBAA 1F3FA 4CO2A 4DR6J 1U6BA 4XTTA 2BE7D 1HI1A 3FKBA 1YGYA 3H2VE 2P8IA 3BBCA 3EE3A 3VWSA 3NAHA 4YHHJ 1FA0A 4LRAA 2X7IA 1JLAA 1RLCL 5D4LA 2RUGA 4FVMA 3P8BB 2NPIA 5JVGQ 2Z2ZA 1A6LA 2VJVA 4C3LA 4I7FA 3I55S 4ZLJA 1T94A 3KG0A 4IH5A 4WK1A 2V4JB 1PSDA 2R8JA 1D3WA 4TLRA 3Q8SB 3M30A 3PX4A 2VB6A 2OFHX 3IRWP 4Z2XA 4HI1A 4DI6A 2V68A 4K4UA 1QD1A 5AE1A 1BE4A 1RGVA 4Q45A 1S1XB 5KFLA 3IMQJ 2RJZA 2LQ5A 2XLIA 1BGXT 3N4WA 1NSQA 3J7A1 4MTPA 1S9EA 2ZH7A 1RAGB 2HHXA 2F63A 1J5OB 4RW6A 4JV5J 4P10A 4CO3A 2WHOA 2Q79A 4JUZA 1FDAA 1NM2A 3QT7A 3BR8A 1NDCA 1VC5A 1T9VA 3EVOA 4H4KA 2VL1A 2G2OA 1S1TA 3OL6A 1RTDA 4MIBA 3DRSB 3GWCA 4QW9A 3W5XA 4LIRA 4RLEA 2MKHA 3RBZA 4LF9J 1VBXA 3R6LB 4O4GA 2MZQA 1OYDA 2IC3B 2C2OB 3M8RA 1XR5A 3DRYA 4OYWA 2MKSA 3SEOA 1U6ZA 2DD8S 3W2WB 4TY9A 2UXBJ 4URGA 2ZNZA 1TV6A 5EX3A 5I4MA 3OJSA 3TUZC 4KGVB 2DGQA 2BOPA 2D3O1 3NGSA 2EBGA 2BKPA 1IUJA 3NL0A 4RUCA 5KT3A 3OBIA 5KFIA 4J9QA 3DLEA 4G65A 2DITA 2MMYA 4P6QA 4B3RJ 4ED1A 1TVRA 3KXDA 4KYZA 4NL5A 3QAUA 4EGLA 5JVHQ 1YRTA 2LCWA 1LQ9A 2YNHA 2XCPA 1TU0B 1WSVA 2E5GA 2MQLA 2UVRA 1QJHA 4U8YA 3HZEA 1I94J 5AJ3J 1WJ9A 2HZAA 1Q1KA 1CJUA 3BKFA 2J9EA 2MY7A 1F0XA 3TOQA 4HDGA 2DCLA 1DBDA 1TL3B 3Q8VA 1N5YA 3BF4A 4FXVA 1GFWB 1PC5A 3QQCD 2CNKB 4FYXB 3OSPA 3A1YG 2BJEA 3PYEA 1RTJB 3D5MA 3BB5A 3FBCA 1LW0A 4O3OA 4KGMA 4RBUA 1VQ9S 4ZPCA 3M6WA 5IZHA 3K5LA 3ENAA 4CCHA 1S4FA 4ED8A 2GIRA 3A8EA 4KT0C 2NR0A 1TP7A 3M8PB 4CLYA 1AT1B 4USMA 2QRRA 2KDOA 2UUWA 5KFSA 4WXOA 3D3CJ 2J9CA 1WACA 3PFOA 5HMZA 4RNOA 1PBAA 1TFYA 3A3PB 4DR3F 3MMBA 4JI5F 3VGSA 1S7HA 3H90A 2C3YA 5E2QA 1M5SA 5DLFA 4ECQA 2NYIA 4A8QA 4FF3A 3GZ7A 4KY3A 5HL7Q 3S6EA 4ZVRB 1N48A 2HFZA 3SSRA 2ZUGA 3ZTSA 1VDHA 1C1CA 1P8GA 1IKXA 4HHUA 5E3QA 1F60B 1QSSA 3TA0A 4RPFA 4M5NA 4I2PB 2GO9A 3LOUA 3N6MA 2CA9A 4DG1B 5K8NA 2KRRA 4JYAJ 1SC4B 2DR5A 2HFVA 2QMWA 2ROPA 4PZVA 1RBOB 2YX1A 2X3GA 1TMJA 1WEYA 2IAJA 5HVFA 2V94A 5ADZA 5LMNJ 1S0OA 3IO1A 3UN2A 1UZDA 3ZXWA 2YX4A 4B3MF 3M9MB 2CVEA 1UEKA 1T8EA 2BJ9A 1NKCA 2GJFA 4DR1F 3V4MA 5KFGA 1N56A 2Y1JA 3CT9A 2WBMA 2W01A 4ZN1A 5K5MA 4IO9Q 1FRJA 1HD1A 1G7CB 3IWXA 1UVNA 4LRCA 3DYAB 3MD1A 3KLHA 3MCNA 5L9XA 5J2MB 2V6AA 3E2EA 3TZWA 4WWSA 3GG1A 5IV4A 2B4PA 2AP6A 2DNKA 3H59A 2B4UA 4CZCA 2W2QP 4YP3A 3EDQB 3PRDA 2LDYA 2IJNA 1K47A 2X1BA 5HK4A 3MM8B 1VRTA 1TQLA 3RRHA 4G6VB 1ZETA 2VBZA 5FD1A 1RT2B 2GV1A 1HPZB 4OZJA 3IBCB 3LA0A 4C8MA 5B0GA 2ZH1A 1QAXA 3Q8UA 4IFVA 2G9OA 2JX2A 1S49A 1Q5YA 2AV5A 3OW2R 3M6XA 5F0WA 4KBIA 4P9SA 2HNYB 4HH0A 3MR6A 1B7YB 3O44A 3ADAC 3JSRA 1VQSA 2JVOA 1T7PA 2OO4A 4WXWA 1MN9A 2VIHA 2ZVSA 4RX6A 2GQQA 2QSWA 4UOGA 1NK0A 3PV8A 1EP4A 1KP6A 2KT5A 5K20B 2HVHA 5IC4B 4LRBA 3OTDA 5L46A 4J9PA 1WG4A 2F8HA 2AEJA 2B9YA 3IFEA 2GIQA 4ED2A 1MG7A 1TL7B 3CF5Q 5KFXA 2IVYA 1P6TA 2KXHA 3BO2A 5CH7B 2HZVA 3L95X 4DV5J 3T3FA 1UJ4A 1RYSA 3NRBA 4LF6J 2R7WA 1JK9B 3EXYA 4RR5A 1KFDA 1D09B 4DXLA 3HHLC 2DHGA 2MKYA 2QL7B 4ANEA 4Q0BA 1WHVA 3AXKA 4NMXA 4A8MP 1LKZA 2RU3A 4RNMA 3R9LA 3M4XA 1T0TV 2D9PA 2Q3PA 2VH7A 5U47A 2NXCA 1Y5LB 2ZHOA 4WFZA 4WP9A 1BQMA 4OJ1A 2G0CA 5E3AA 1WD6A 3EJMA 1C1BA 2AX1A 3MUMP 4DR7F 2EW9A 1S99A 3TUIC 2I1RA 4U96A 2EEYA 3VZIA 3AFGA 1PG5B 3AH6A 2BM1A 3AODA 3O6QA 1U09A 3IP0A 2J6TA 2XWXA 2GCFA 4P71A 1QDUB 2XO6A 4Z37A 3FZBA 4PXEA 2NZCA 3H5SA 4QIEA 2F9DA 1X4EA 3A3OB 1EB0A 3CIMA 4UUWA 4NCAA 1ZH5A 2C3MA 3V6DA 3MMCB 3L7UA 4ID5B 5HLFA 4ZS6A 3DXSX 4DPOA 1HWUA 4L3KA 1DTTB 4CQ1A 4QPTA 2D74B 1RACB 2D7SA 2CNLB 2DB1A 5GAGU 3I5CA 3RRGA 5D4OA 1H72C 4ILRA 3ZNJ1 3ITHA 4U95A 7AT1B 4J9MA 4GVLA 2CJKA 2J5AA 5HAOA 2Y8YA 2XSJB 5I3UB 2CQ2A 3IGVA 4X65F 2Y0SD 1WELA 3CVKA 3KNGA 3C16B 1JWWA 3GU0A 2KXFA 2X51A 2LECA 5EX0A 3J81U 1HW8A 1ZZNA 3VAFA 3SFUA 1RWWB 2RQ4A 1ZM3A 2F8EX 1Y7PA 4MYUA 3NNCA 4DOZA 4GRSA 3K2YA 1IR2A 1KOOA 4EZ9A 4QPXA 3GE9A 3TVYA 5D0GA 5I42B 2LU2A 1JB0C 8ATCB 2RILA 2DNGA 1X8DA 1BLUA 4X62F 3CJSA 3DLKB 1VQLS 3RBEA 3VTIA 3DRRB 3R2CJ 4QIWD 3TARA 3NGKA 4Y65A 4YB5A 2OPPB 2FJXA 3BGFA 1F9EB 2AYMA 3PACA 3BO3A 3L4BC 2UP1A 1GX5A 1FWLA 3KLVA 1S77D 1KLMA 2IM1A 3VAGA 4TNOA 3TX0A 3TAPA 2W9CA 1NPPA 5GAEU 4WK3A 2DO4A 4DR3J 4JI5J 2RF2B 3M8SA 5IM0B 5F8MA 1T3OA 4AD6A 1RA6A 1B0VA 4X4SA 3QGGA 4A8XA 2DIVA 3EXCX 3SDEB 2IMOA 4UF4A 5SZTA 1IN0A 4NA1A 3DOLB 3GFHA 2KM8B 2UXCF 9ATCB 4RNHA 4PG6A 1J27A 3NP5A 2KJWA 3K5MA 5KG0A 4UOFA 5HMWA 1TZ0A 1WC5A 4FBUA 1TK0A 4PWWA 2UUTA 1S1UB 2QYCA 1RXOB 4CNZA 2DCUB 3ZZYA 1CJKA 2DNOA 2LXIA 3UNGC 1WI6A 1TL5A 2QTWA 3HHLA 3CEDA 1AFJA 2BX6A 4ZDNA 2R7VA 3GILA 4O3QA 4B3MJ 3MM6B 5J1PA 1AB8A 2PC6A 4NYPA 5F3ZA 4PRFA 3TJAA 4LF8F 1LWEA 1U02A 5HATA 1TL1B 1F9HA 3QT5A 2CQGA 2OGUA 3OXGA 1KN6A 2ZKUA 4N47A 2V4QA 1WC6A 4RWWA 1VCTA 2B3TB 3R3TA 2VFUA 3ENWA 4TYBA 5B0DA 4F0MA 3IG1B 3PO4A 3E01A 5LM7E 2W24A 4C0OC 4ED0A 3GSDA 1P27B 2EI5A 3A4TA 2D69A 3FRZA 1P1TA 3KOAA 3CSKA 5F41A 4QZVB 4X4PA 2L9NA 4IQMA 3K0JA 3G86A 4Y2IA 3S8SA 1X31C 4JI4F 5DG9A 1SPBP 2XULA 5I3PA 4X4QA 3AJ1A 3MTKA 4NASA 1D8YA 5KFVA 2R4FA 2MSTA 3H2LA 3GV8B 2EK6A 1FO1A 1HBUA 2MLYA 4NCGA 1UMJA 3MECB 1TELA 4FKXA 3C46A 1LOUA 4DV6F 2FJEB 1RWVB 4QIFA 2FVPA 3W2VA 3X3UA 3MPUB 3BZQA 3DGPA 5FLXY 2O66A 3AD9C 2DK2A 3IM8A 4EO8A 5A2QU 2DNQA 1NBEB 2W4PA 5B0FA 2VFRA 4DF4A 3R7BB 4O23A 3DI6B 4U6PA 2WVCA 3T9NA 3O5TB 2HNZB 3PIOQ 2OJ3A 2M88A 4ZVEA 3K7RA 4DQSA 3C14A 2YH1A 1H73A 4OYPA 1H7XA 3US5A 1IKYA 2LKZA 3Q24A 3HMJG 1FDBA 1HFEL 2AJ2A 2DNRA 3VGTA 2FHJA 5F8JA 3O2IA 4JI2J 4ZVTB 1L3UA 5EGYA 3BGRA 4JI3J 4C7QA 2EG2A 4UOCA 2AQ4A 4DPYA 3QT6A 7FDRA 2MYFA 2DGOA 2RH3A 3VHQA 3RBXA 2LFVA 3TRGA 1WC4A 1KNZA 4OLPA 2W4CA 1S6UA 3OL9A 4DR7J 2HIQA 1IBKF 3UR0A 3KJNB 4P75A 1QE1B 1RWXB 3HPOA 1UVJA 3CB4A 2R7UA 2HMIB 3Q22A 1T02A 2ZITA 1RKIA 4OX9F 4IFYB 1LEOA 4DV4F 1XBWA 5ETNA 1WTFA 1QSYA 4DL2A 2MZSA 3D1QA 4GKJF 5KFAA 1EARA 2K8GA 5KFDA 1RU2A 3SCIE 2JFKA 2FYXA 3CJRA 5ETVA 4DV7F 3KKFA 3GYGA 3R2DJ 2R9LA 3PRBA 4DMZA 1A0OB 4IG3B 2FJDB 1VIXA 2DNHA 3GR1A 1S9EB 2GVZA 4CO0A 1LFWA 1HBNA 1HWIA 4EYHB 1X5SA 4USVA 1OY9A 3BQ0A 4P7VA 5H9FK 4ECTA 3NGUA 1S1TB 3D6TB 3JAMU 4CT9A 3TZZA 1HL6A 4DUTA 1S6OA 1OY8A 2JOQA 3G6ES 4TXSA 3OL8A 1HQUA 3ZZ0A 4Y0FA 2V2KA 3J7ZT 2OH2A 4PXBA 4E98A 5IXUA 2XCAA 1CJTA 2QA4G 2MKIA 1UFLA 3H5UA 4DX8H 1JLFB 1Q8LA 3B6BA 3D0HE 3MAQA 1QVGR 2SXLA 1KC8T 4RW4A 2P2CB 1SKRA 3C8YA 2G2YA 1N6QB 2DRDA 1VRQC 1ZS6A 2QIFA 4X62J 1DAXA 2P6TA 4IOBA 3M8YA 4CO5A 1REVA 2ZE2A 3BSAA 2YWGA 3W7BA 2FB0A 1KDNA 5FIIA 2C2DA 2FC8A 4WYWA 3ZZZA 4O44A 5C7PA 1DTQB 3GCWP 1RTIA 1TVRB 3B8HA 1SQFA 2O67A 3CC7S 2DRBA 2YNGA 2YNHB 4RUAA 4LT6A 1PJ5A 5CAAA 2WCXA 4I69A 2CQIA 3GP9A 3IM9A 2XI3A 4NZ6A 2W7OA 4B3OB 3UN5A 1B70B 1Y11A 4GC6A 2F1FA 1CJUB 1EJ7L 2RS8A 2VFTA 2UXCJ 5B0CA 2UUCF
chains in the Genus database with same CATH topology
2CZVC 2EKYA 3WDOA 2ADBA 4DFMA 1XC9A 3M8PA 1X9MA 3BQ2A 2ABYA 2HS0A 2OLWA 3ZZUA 4N8NA 1YG0A 5L39A 1Q8IA 1U24A 3BSNA 4KHPF 1YVFA 1KVJA 1DARA 3CO9A 5J2QA 4YDXA 2IA6A 1UFWA 2ZDOA 3LP1B 2PE8A 2AGQA 4I64A 5BR8F 3DHXA 1N5YB 1RT6A 1D9FA 1YHQS 5F8NA 1I94F 2A2DA 1IR0A 1QTMA 3UE2A 3SDEA 4NRTA 5CQGA 2LXUA 1FE0A 1NHVA 3BR9A 3VALA 2ASYA 4AFFA 4DDFA 4RKUC 2CQ0A 5GAGI 3DOLA 4RUHA 2DNNA 4FF4A 3HHLD 4KFBB 3BSCA 3KK2B 2ZH2A 4C8YA 1S6QA 4WFBQ 2XZWA 3UQSA 4DSIA 1X4AA 4IDKA 1JLQB 5A6PA 3RB6A 3HF5A 4CO4A 2D41A 3DLLQ 3VQTA 3PFEA 1WG1A 4J5OA 1FJEB 2DPIA 4KE5A 3BN7A 1ZTTA 3M2UA 1C4CA 1K0VA 3TQ1A 2DT9A 4K59A 3DOKB 5E3RA 1VQ7S 2F9JA 1N33F 3LQVA 5AE2A 2KN4A 3M2VA 2BBEA 3G96A 1RQ0A 3P3DA 3RR8A 3IS9B 3F44A 4OFZA 1PO6A 2L9DA 2XMVA 1YJNS 1E6VA 5A6WA 3R5AA 1HNZF 2XEXA 1FJGF 3I56S 4ECZA 2IA0A 5A8RB 3IAS9 2ZH3A 5KFJA 3OVSA 2GGPA 2E9RX 3VAIA 2YWEA 2E5LF 4KV8A 3CCTA 5G0RA 2OP5A 1X0FA 1TKXB 2DGXA 2XBPA 3DDNA 3PW4A 2PA8D 1HQEB 1IM4A 4EU0A 4NZ0A 1YJWS 2VPZB 1U45A 3IC1A 3CJKA 2K2PA 2IM0A 3PEJA 1Y5IB 2ZM6F 4QWDA 3CCSS 4LUBA 2B9WA 1OWXA 3T5JA 2DH8A 3AY0A 1H2UX 4QIVA 2ZJPQ 1TR0A 1HHSA 3ZZOA 1KHVA 1S10A 2K7JA 1TK5A 3T6JA 2ZJQQ 2ZBIA 3EZUA 3DFEA 4DV2F 4DR2F 1NK4A 1R8BA 2VA2A 2E9TA 1K73T 3CC2S 3MMBB 1G3OA 1VIOA 1SXLA 1OPIA 5T41A 3CJ3A 2DH9A 2CQDA 2CQCA 1IKVB 3DCAA 1VQOS 2HHWA 4RW7B 1FRLA 4XDDA 1IKWB 1Q82T 4I2PA 2MB0B 2LYVA 5BYQA 4R5PB 1U7LA 3MEGB 2ZJRQ 3R5DA 4A4JA 4DG1A 3NCPA 4ZLPA 4IUFA 1OPZA 3BREA 4J9NA 1RT7B 4HLBA 3KLIA 1FDDA 4C8NA 1YBAA 2V9KA 3J81Y 2ERRA 1WHYA 3K5OA 1NO8A 4FS2A 1L3TA 1NB7A 2FLPA 5KG5A 2BJDA 2JRSA 4M1KA 1YRUA 2RU9A 4R8UA 3FSYA 3ZFVA 3OPKA 2BABA 5HBMB 3PR5B 3ZC4A 1X4BA 4WFXA 3BS9A 5J1NA 4NCBA 5A8WA 1LFPA 3QO9A 1U49A 1E6YB 1WF0A 3NWGA 4K2XA 2HVIA 5L8RC 3TANA 1BD6A 1FRHA 3CC4S 4F2RA 1JXLA 2BANA 3D2WA 3DMJB 1C1CB 1DQ8A 2BQRA 4I68A 2Q1LA 1JLBA 3R1HA 4K4XA 1FVSA 2FVQA 5EWFA 4BS2A 2XC9A 3KG1A 2RQCA 3NMRA 3OFGA 3CULA 3HHLB 3B78A 2D3UA 1VGYA 2EVZA 5KFBA 3I0SB 2J9DE 3KK3B 5K8MA 4NXNF 2OSQA 2DVIA 2KXNB 4HT5A 2IRXA 3DRPA 1MROB 2YKAA 4HL9A 2VG7A 5GAEI 1SL1A 4URQU 3KLEB 2KFNA 2CQ3A 3IG1A 3CCWA 3QAEA 5GVQA 5A8KA 2HQ3A 3GIKA 4J9LA 1N32F 3CDEA 2V5HG 4YR2A 1QVFR 4OI0A 2JLFA 3GIMA 2HRUA 4ICLA 4D3HA 1LWEB 3QGPA 4FN5A 1B0TA 3DYAA 2LQJA 1HA1A 2XB2D 4X2BA 2CQBA 1Q7LB 2QLWA 2PA3A 3IN5A 4DUYF 1CC8A 3KLFA 4HTIA 2QV6A 4FNHA 3BDPA 4OZNA 1S76D 5IT0A 4IO1A 2WSFC 1GXLA 2YQ3A 2IAJB 3I5AA 4KSEB 1VBYA 2VC0A 5LL6d 1QSLA 1T3NA 2G1DA 4PQAA 2BQUA 1IJFB 3AA8A 3TUJC 1LWFA 1SIWB 5DQIA 3OSNA 3PW5A 2YKQA 5J2PA 2DGWA 3NAIA 2JEJA 3UI3A 3TVKA 3FVYA 2FVCA 5KFYA 4ZPAA 3NBPB 3NNAA 3DM2B 2MQMA 2ZH8A 1S0NA 2J6SA 3LPYA 1YRXA 3I4HX 3PHEA 4DEZA 1QAIA 4X84A 2GMHA 1VBZA 3K58A 4JYAF 1TKTB 4ED3A 4LF5F 4RW8A 1Q16B 2FD2A 3CCQS 2HAIA 3GQCA 3GB0A 4OX8A 1LW2B 1FRKA 4X66F 1FERA 1ZM4A 4I0WA 3E01B 5CCLA 3MM8A 3BN4A 5LMNF 5L1IA 2E66A 3CWJA 2WW8A 1WI8A 4CIOA 4A8WA 4OI1A 1HNIB 3MM5A 2CQ4A 4OI2A 3MM7A 5KFOA 5EUHA 1RT2A 3PW2A 3KLHB 1QM9A 1HPZA 1L3VA 1S48A 5C24A 3DLHA 2YNFB 1Z2ZA 3MEKA 2QA4S 2VG6A 2BACA 2PDAA 4M5DB 2GFFA 2X1GA 5LSLA 1FE4A 5CD4H 3CDUA 2HHHF 1K1QA 3MECA 2RS2A 2I2YA 1WEZA 1N88A 1SV5A 1TKZA 2V8GA 2AJQA 3MD3A 1XTZA 5K8OA 5EN1A 2EG1A 1Q86T 3GYXB 2A10A 2B0GA 3BQ1A 4YFUA 2XMJA 3KHLA 1CEZA 2FHJD 3DLBA 3ICLA 3OFHA 4K5RA 3FGVA 4AUKA 4HVZA 2B4VA 2FGCA 1ROFA 3H4BA 2OPQB 2R2RA 1CLFA 1FEHA 3MPYA 4KKOB 4WZQA 4TQSA 1GTHA 3CCMS 3HHDA 2HNYA 3N6LA 2W7PA 3U1LA 3C6TA 4ZCKA 1R89A 4EFAC 3MEDA 4OV1A 4TY8A 3RAQA 2M3DA 2NQPA 2XSFA 4DSKA 3NG8A 1ZAXA 4RNFA 2NREA 2CIMA 1VQMS 4BC7A 1NK9A 3FEZA 3SI8A 4M8LA 2UVUA 3EGZA 1G2EA 2HLUA 2VBYA 3WC2A 4NLPA 2YWHA 1S72S 2ZZMA 1HBUB 1KTVA 2DBBA 1T03B 4PR6A 2RQMA 2ZZNA 3IRXA 1MWZA 2HNZA 1UA1A 1X0PA 2Q66A 2OPRA 4LSNB 3OUYB 1JKHA 2WONA 4WCEQ 4B9UA 3MCSA 3G6YA 3PIPQ 2W9AA 3H4DA 5D6GA 2LDIA 1SJQA 1FD8A 4PPZA 3PNIA 4F3MA 4IFVB 2DNYA 3KK1A 5BYRA 2VPXB 3T5LA 2KH9A 1RTHA 5D77A 2VZ9A 3WC0A 2KKHA 2MZ1A 4G1QA 1M5OC 2G13A 3LWLA 3EYZA 1UA0A 4IH7A 2KT3A 4YDDB 4DR4F 2BQ3A 3F56A 3W2VB 2DNPA 3HVTB 2LA4A 1U1RA 2B9XA 2AU0A 2BDPA 1NJXA 4B02A 1N54B 5LMUF 1RT1A 2R7RA 3J80Y 3FRYA 3SQGA 3LP2A 3I82A 1F5BA 3WBZA 2D9OA 1U1QA 2PFFB 2PSZA 3V4IA 2J0QD 2EFQA 3NS6A 4PPDA 1GT8A 5HROB 2APOA 1S1VA 4Q2MA 2N4DA 4KGKA 4KHRA 1TUVA 2YY3A 2JZ5A 1HNXF 1R43A 1KEKA 3OR2B 2FJVA 1CVJA 3ZZRA 3DHWC 4RW9B 2B7BB 2HG4A 5J1EB 1FNXH 5AXMA 3TNVA 1Y4ZB 3CE8A 4NA3A 3G6VA 2HS4A 2KG1A 2UUBF 1SH0A 4CO2A 4C11B 3GFZA 1RT5B 4MK9A 3P96A 3BO4A 1U6BA 1SH2A 2YX7A 3H40A 4PWDB 3O3LA 1S1WA 1HI1A 4AXIA 4DUZF 3V2UC 3TX8A 1YGYA 3H2VE 1XNRF 2YKMB 3VWSA 3NAHA 1IKYB 2CPXA 1FA0A 3VF0B 1JLAA 1GX6A 4C0BA 2BUNA 2G4BA 2C3OA 5D4LA 2RUGA 2R2SA 3CXCR 3T1AA 1OQ3A 1S9GA 4FVMA 1U47A 2YNIA 1UL3A 4QR0A 2XLJA 1HWJA 4OHXA 5IT4A 3K5PA 2XG8A 2NPIA 5B0BA 3V6HA 5JVGQ 4IOCQ 1HMVA 1A6LA 2R8HA 4YOEA 2EBEA 4B9LA 4C3LA 4JV2A 1UVMA 4I7FA 3I55S 3RAMA 3BGRB 2HHPA 3FQKA 1IBMF 1BC6A 1T94A 2WOMB 3KG0A 4IH5A 4EBCA 2CPZA 2POKA 5GADI 4WK1A 2PO4A 4USHA 2V4JB 4U7CA 1W25A 1PSDA 1N5VA 3SXLA 2R8JA 4N56A 3LWMA 1KHWA 3KYLA 4EYIB 2ZH5A 3N28A 1D3WA 4TLRA 3Q8SB 3M30A 1N36F 1U2FA 1HBMB 3HKZD 3QWUA 3PX4A 3EGNA 3RRKA 1U1PA 4LFCF 4ZPDA 1GH8A 2VB6A 3SSQA 5KFUA 3OJUA 3BEGB 2OFHX 5E7OB 1NK7A 3IRWP 4JI2F 4Z2XA 3BGLA 4HI1A 5C25B 2FUG9 4Q0BB 1C0UA 3FSXA 3NCQA 4K4UA 3LAMA 4HTJA 4JI3F 1DQ9A 3M2RB 5AE1A 4I6WA 1RGVA 3PW0A 4ECWA 4Q45A 4USIA 1S1XB 3QLHA 5IWAF 2E1RA 4A8FA 2JC0A 3ISND 5KFLA 1S79A 3G4SS 2KJVA 2AW0A 4MFBB 2RJZA 2LQ5A 2NS1B 2XLIA 4H4MB 5B0EA 1BGXT 1RT4A 3N4WA 4F4KA 1OS5A 4X4NA 2ACYA 1Y0HA 1MMLA 1VK3A 1O51A 3H5YA 3RAXA 3J7A1 1Y00A 5KG1A 3QMQA 1F5CA 1ZOTA 4MTPA 4NLXA 7FD1A 2ZH4A 1VC0A 4NX9A 1S9EA 2ZH7A 3UCGA 5F3TA 4LFAF 4CTAB 4PUOB 1X4GA 4ZCMA 2HHXA 1J5OB 4RW6A 2HNDA 3L3CA 1KS2A 5DDOC 3CDWA 4CO3A 1FRMA 2WHOA 2VBXA 3CMAS 2RDJA 2Q79A 1FESA 4YUDA 1BY9A 1FDAA 2QZ8A 5FDLA 4JUZA 4KRWA 3BR8A 3TO8A 1NH8A 2Y1RI 4ZA1A 1VQYA 4ATNA 1VC5A 2B6AA 1HNVB 4IQXA 3CDBA 3TW0A 4I4BA 4H4KA 1C1BB 2VL1A 2CPHA 3MMCA 1S1TA 3M32B 4ID5A 4Q5VA 3OL6A 1RTDA 2MJUA 4C97A 3KJVA 2ZBCA 4DS4A 3BGUA 1DTTA 4MIBA 3DRSB 3GWCA 4QW9A 4LIRA 2XGPA 4RLEA 2MKHA 4A48A 3QJLA 1VBXA 1SKSA 4O4GA 3MM9B 5K14A 4EBEA 2XS5A 2GHPA 2MZQA 2UV8G 2IC3B 4O3SA 3UDLA 3MZIA 5A2QY 3M8RA 3UDCA 2EFVA 1XR5A 3DRYA 1DLOA 5DRKA 1JXEA 5H9FJ 1R0AB 2E5IA 3Q23A 3M1VB 3MI7X 2GX8A 5J2NB 4B9MA 2MKSA 3SEOA 1U6ZA 4LF7F 4DBQA 2DD8S 2CJ9A 2EFPA 3MHYA 1LWCB 2BRKA 3W2WB 4TY9A 1NK5A 2R8GA 2J0WA 1Q8BA 3HFKA 4RU9A 1V6HA 2NUHA 4URGA 2YTCA 3NS5A 2EFNA 2ZNZA 4I2QB 1TV6A 1URNA 2GC8A 2VD3A 5EX3A 5I4MA 3OJSA 5AXNA 1BQXA 2DNMA 3MFHA 3TUZC 2C22A 2DGQA 2CPIA 2ZFHA 4HDHA 2BOPA 2CKWA 2VUGA 5HLFB 1R7IA 4DWIA 1T05A 1P1LA 4Q44A 2EBGA 1UEVA 3OTOF 3VAJA 1IUJA 3NL0A 1VC6A 1FK9A 2LEBA 4RUCA 5CCMA 5KT3A 1K1SA 3OBIA 1K9MT 5KFIA 2XWYA 4J9QA 3DLEA 3GFYA 4MJKA 1UJ6A 1XN9A 1S0MA 3ITHB 3DNCA 4DF8A 4GKKF 3SYZA 3PX0A 2DITA 2MMYA 4P6QA 2QFJA 4ED1A 3QGIA 4GO5X 1TVRA 2Q6BA 3VCDA 3PZPA 2OPSB 2ZC4A 1QUPA 2F7VA 3QAUA 4NL5A 4EGLA 3V81B 4DLGA 5I42A 2C28A 4FF1A 5JVHQ 1KLNA 1YRTA 1JMTA 1IJEB 3N79A 5I3QA 2LCWA 1IQTA 2EFGA 3I4PA 1LQ9A 2YNHA 4WKYA 2XCPA 1SUQA 2Z4PA 1HYSB 2WB1D 1DRZA 4ELUA 4CO1A 2HRYA