2KYZA

Nmr structure of heavy metal binding protein tm0320 from thermotoga maritima
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MRYVLYVPDISCNHCKMRISKALEELGVKNYEVSVEEKKVVVETENLDSVLKKLEEIDYPVESYQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of heavy metal binding protein TM0320 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Metal binding protein
molecule keywords Heavy metal binding protein
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kyzA00
2KYZA 2XMVA 2XMTA 4YDXA 2AP6A 2G9OA 2K1RA 4OJHA 4OIXA 1VQYA 4Q2MA 1YJVA 1SI9A 2GA7A 4Y2MA 2BYCA 2XMJA 3IWLA 2HIQA 1ULRA 5F0UA 1CPZA 1AW0A 2FHMA 1Q8LA 5B0CA 1FVQA 3CJKB 3BN7A 2VV5A 4A46A 2W4PA 3KG0A 1OSDA 3KKFA 3HHLA 2EW9A 2BUNA 3LGNA 2Q3PA 5F0WA 1YRXA 1SB6A 3BF4A 2KKHA 2HFOA 2VH7A 3GZ7A 2N4DA 5B09A 3CJKA 1KVJA 2RILA 1WD6A 1XBWA 1N5SA 2OD6A 1JWWA 2GGPB 1KVIA 4HI2A 2OFHX 4F67A 1TL4A 3HX9A 2AJ0A 3HF5A 4HH1A 4NL5A 3TOQA 4A4JA 1GXTA 2ASYA 1MWYA 2GGPA 5B0GA 2PGCA 4NPOA 5B0EA 1FEEA 2KT2A 5A6WA 1R6YA 2LXFA 4FNIA 4HH0A 2IFXA 1SQEA 1TR0A 4A48A 2GO8A 4DL0C 1IUJA 2W4CA 1QUPA 3BM7A 4OJGA 4QOTA 3E8OA 1N5QA 2OP5A 1YJRA 2HQIA 1FE0A 1S6UA 2K7JA 2OAUA 3F44A 4OJ3A 4ZA1A 2ROGA 1P6TA 1MWZA 1FE4A 2QYCA 1LQ9A 3I9ZA 5IXUA 1X0PA 1Q4RA 2LQ9A 2N7YA 2BJDA 2ZDOA 4Y2KA 1CC8A 4HL9A 4YEAA 3VTIA 1FD8A 5B08A 1OQ6A 2RMLA 1Q8BA 3KG1A 1AFIA 2OD4A 1OQ3A 2FB0A 2HLTA 2PD1A 1KQKA 4DPOA 2GFFA 3UDCA 1RJJA 1VQSA 4OJ1A 2HLUA 3DXSX 2ROEA 2GCFA 1TL5A 5KAKA 1U7LA 1N5VA 1OPZA 1Y3JA 1YJUA 5B0DA 3FRYA 2QIFA 2QLWA 1Y9OA 1GXUA 2HFNA 1W2IA 1FESA 1JK9B 3K7RA 2K1RB 2RU9A 2AW0A 2OFGX 3BDEA 1URRA 3LO3A 1K0VA 4A47A 2N4CA 2QLXA 3TRGA 3BGUA 1P8GA 2XMUA 3HFKA 1V3ZA 3HHLC 5B0AA 4EFAC 1YG0A 1Y3KA 2JDJA 2L3MA 2IYIA 2ROPA 3BB5A 1Y0HA 2ZDPA 4HI1A 1APSA 3HHLB 3DCAA 2XMMA 2XMKA 1CC7A 3QMQA 2LQBA 2LDIA 2K7KA 2FTRA 2BJEA 2ACYA 2BBEA 2RSQA 3WDOA 3LGMA 2W4DA 2GV1A 4Y2IA 3QGPA 3IWXA 5A6PA 5B0BA 1X8DA 1Q53A 1TUVA 3T9NA 4U9RA 5T7LA 2IYGA 3KNGA 4ZOSA 1S6OA 5B0FA 1YJTA 2CRLA 2KT3A 3FMBA 5K9FA 1N5TA 4DN9A 1FVSA 3FGVA 3MCSA 1TZ0A 2FIUA 3MZIA 4Q2LA 3TNVA 4FNHA 3HDSA 1X7VA 1AFJA 2K2PA 3HHLD 3BR8A 5T7LB 2XMWA 2AJ1A 2OKQA 2OMOA
chains in the Genus database with same CATH superfamily
1QJHA 2XMVA 3JYTA 2BMBA 4ZS6A 1D8ZA 1C1BB 2IHR1 2FLLA 4OIXA 3SI8A 3CD7A 3M6UA 4K4SA 4B3RJ 2RHSB 3VQTA 3NGRA 1RTDB 4L3NA 2VZ9A 3GV5B 1S76D 4ED6A 5LT5A 3VAFA 2UU9J 3HVTB 1REVA 1IQZA 5KG1A 1RT2A 5E5NA 2ZWPA 3SCKE 4CNZA 1WG4A 3QZ8A 3V81A 1YJ7A 2BUNA 2RKIB 4ECXA 1RAOA 1X4BA 2MSSA 3OFFA 3CDWA 3SSRA 1KWMA 4LRBA 2A1BA 2DR9A 2Y9HA 3BO3A 3AJ2A 4M5DA 1GNKA 1NHUA 1WD6A 3BKUA 1NM2A 2XSJA 4I6WA 4UOGA 5LMUF 3PJ9A 2XI3A 4HI2A 4L75A 4ZVFA 4I4BA 4ECUA 1J2VA 3QPIA 1PAEX 4ZKAA 4X4QA 1ZETA 1KKHA 1RCXB 1N34J 4LBHA 4HH1A 1BGXT 2AHOB 3BZQA 4N47A 2F4VJ 4WFXA 3W2WA 5THWA 2IC3A 4AL5A 4BBYA 5B0GA 2GVZA 2PGCA 2XNRA 1WHVA 2QMWA 1IKWA 2BM0A 2XEXA 4FNIA 3VZHA 1F3VA 3N28A 3PKMA 4LMZA 2FHKA 4DL0C 3AB4B 3P5TL 3BM7A 1HWKA 3B8HA 2BEFA 3CDEA 3W9JA 3BV8A 2MMYA 1UPMB 1R8AA 2AKWB 3D9BA 3FEYB 1PG5B 4LIWA 4WYWA 5EUHA 1P6TA 4LFAJ 1F9EB 3VAJA 3BGRB 1RT4A 2KZMA 1IM6A 5KFMA 3KMQA 3L7PA 3TO8A 3IRWP 3UCGA 4DOZA 4DQRA 2GIQA 3TA1A 2W9BB 1CLFA 4GKJJ 2CIMA 4NLYA 5ITHA 3GIKA 1JLEA 3PV8A 5HLFB 1ZS6A 1U2CA 4NCAA 5I3UB 4DUTA 4F50A 1ITPA 2ZBPA 3WHIA 1HQUB 1MMDA 1TL7B 2FZCB 3FCVA 2DNQA 2HWHA 4RU9A 1KQSR 1JNZB 5KFVA 3BJYA 2FHOB 2LDYA 3K58A 1NPRA 4OHVA 2WTFA 2UUBJ 1UW9A 2O01C 5IWAJ 2D3OR 4N8NA 3FUYA 1GXUA 3G9CA 4PYAA 2W9CA 2IC3B 1ZTWA 2QA1A 2KFZA 2QSWA 4ZK7M 5DM6Q 1IR2A 3FKBA 2W9AA 4FF3A 4LF5J 1RTJB 3FFIA 1BLUA 4BWJA 3T5KA 1FJCA 2LQJA 2QLXA 3VF0B 3PR5B 1JXEA 3QJPA 2ZD1B 4HACB 4B08A 1RHKB 4C0HA 2ZH7A 2JFDA 3CJ8A 4GO7X 4PKDB 3R6LB 2AMCB 3DHXA 2L3MA 3MM7A 4DR6F 4X4OA 4FF1A 2MLZA 3GWCA 4O3RA 2NUHA 4QIEA 3SCJE 2EFVA 2ZBIA 5IM0A 4JI8F 1XNRJ 3DI6B 3C6UA 4JI5J 2YVSA 2OTJS 4FZVA 1VOMA 2FY8A 2H3EB 1RWVB 4JUZA 3PX0A 4KHMA 3WDOA 5JJBA 1RDRA 2BJ7A 4LF2A 1URNA 1JJCB 4ES1A 1NK0A 8AT1B 1NJXA 1M90T 1FKPB 2RF2B 3PJXA 4EU0A 1XQIA 3POTB 1RHJB 3SYZA 4K59A 3H5UA 2E9RX 2FZKB 2F5GA 4NLTA 1S9GA 4IOAQ 1CS4A 1U2RA 4DFJA 1QSSA 2J9CA 1QLNA 2QG9B 3VAIA 2PFDA 4ECTA 1S1TB 2YWEA 1N33J 2B4PA 3NCRA 3PRVA 4HACA 4M5IA 2BDPA 1KDNA 4DQQA 4LF4F 1RT5A 3MR5A 3LP1B 3QZ7A 1X7VA 1EP4A 3KDOA 3LAKA 4LF6F 4OYAA 1N32J 4XDCA 2UUBF 3CJ5A 3A8KA 2VFSA 2KDOA 5KG0A 1IWGA 1RQ0A 5EX3A 2RNEA 1XNRF 2DHGA 4QU7A 4C4WA 2HZCA 1H7WA 5KFUA 4AD6A 2QL7B 3GILA 4DSFA 2FGCA 5L9NA 2JEGA 2QMUB 2X1GA 3EDQB 4Y34A 2IRUA 3R97A 1UCNA 2VG7A 3NWGA 3HXMA 1KSPA 3J7AN 2DGTA 2FLNA 4FVMA 5DO2A 5F0WA 3IM8A 1YJ9S 4USMA 3LA0A 1RWOB 2FDNA 2N4DA 1FTRA 5ETPA 2CAJA 4E98A 3RBZA 2NSBA 5BXIA 2V8VA 1GMUA 1S9GB 2N3OA 2UUAF 1TAUA 5AXLA 4CQ1A 2CUYA 2O5DA 3QO9B 3HX9A 4I56A 3SSQA 4WE1B 2DR7A 1KLMB 2B8QA 2Y3YA 1WG5A 2NYHA 3D3CJ 5C5JA 3TOQA 4G6VB 2ASYA 4OHZA 2I8EA 3R1HA 1TL3A 1E6VA 3WC0A 2HMIB 2NREA 1VYAA 1ICEB 2BANB 4NPOA 4ZN1A 4B9MA 2KT2A 2BR0A 5KFBA 2GQQA 2ZH5A 4ED5A 4J91A 3M1VA 1IUJA 3A13A 1QUPA 3DLEA 2ALYB 2BKNA 3E8OA 3NBPB 4QOTA 2MKSA 1N56A 1L3TA 2IA6A 4LFBJ 1JLAB 3T1YJ 4B9SA 2NR0A 5D78A 4ENOA 1MWZA 3EE3A 4RW9A 3U02A 3M4XA 1U1OA 2MHEA 3KLVA 5FDLB 3H5YA 1X0PA 3CDAA 5IFMA 1N33F 1JLEB 1NXIA 2DNZA 2IMOA 2OPQA 3VTIA 4KGXB 2XM3A 1FXDA 3G2XA 1LWCA 2HS3A 2MHNA 1Q8BA 2RE1A 1UAWA 4L3KA 2ZOMA 5ETTA 2OD4A 3RB3A 4GO5X 4DCPB 4NXMF 4U67Q 2VC1A 1L3SA 2JFKA 3IR5B 3UDLA 4PUOB 2HAFA 2XGQA 1H74A 1I1GA 2VOPA 3CMES 4ELUA 4DUYF 1N5VA 4EI2A 1WF2A 2Q1LA 2EXUA 3KJVA 5KFXA 3D1HA 1E6VB 3T6BA 4DPWA 4HHHA 4ID8A 4AQYF 1C1BA 4U7UD 3TQEA 3MEGB 1NK7A 4C2MA 1J5EJ 3CCSS 4NXMJ 1NHVA 5D4PA 3CF5Q 1IKYB 4QYZJ 2E1AA 3P6YC 2XG8A 4FBUA 4OX7A 1P8GA 3HFKA 3HVTA 2X1FA 2XYHB 3MMAA 5GMKa 1GTEA 4CO2A 2AJFE 5E41A 3AT1B 2JDJA 4NLUA 1RHUB 3LWMA 4WIQA 4JI3F 3H7HB 2VQEJ 3F56A 2EI5A 4TKTA 1RTIB 2GO9A 4X84A 1R0CB 4RUBA 4WFNQ 3KFWX 4OX9F 3G96A 5LJ5Y 1QE1B 2ZBQA 3DGVA 3LPEA 1FERA 4DR3F 2B43A 2VA3A 3H40A 1LWFA 2QV6A 3IS9A 4X65J 2AF6A 2Q43A 2OELA 1TELA 1ZAXA 5IT0A 1F60B 2XS7A 4J9UE 4A8XA 2IYGA 2IVYA 5HMZA 2QA4G 3I0SB 3HVRA 4B3MJ 3PTWA 1FNXH 2E9TA 2AYMA 5JMNA 4X64F 4DPXA 5C25B 2ATLA 3HHNB 3P45B 2KT3A 1TKXA 7AT1B 3HKWA 1O0PA 4KFBB 4FS2A 5KT6A 5AXKA 1G3OA 1MMNA 1KN6A 1HNVA 3HDSA 1HQ2A 4B9UA 2PEHA 5F41A 3MR3A 2B51A 3MOJB 4B3SF 4K0KJ 1HI1A 3CW2C 2MB0B 1SV5A 2G9OA 2CNNB 2XBPA 4Y2MA 1IKXA 4YB5A 5LSLA 2ZHBA 1CPZA 1U1PA 3BKTA 4NMXA 5BR8J 1N48A 3NKYA 1TL1B 2ZNZA 4NCGA 3T5LA 5IOLA 5L1LA 1NH7A 4USKA 3CPWR 4DS5A 4O4GB 5KG7A 4DF4A 1BUXA 1PBAA 5BYSA 4NYOA 4DPTA 5GAGI 1CVJA 1RB0A 2IDEA 4OZLA 2NXJA 4V19J 3QRRA 1K1SA 4PG5A 2NZCA 3BF4A 3DKDA 1GXLA 3JSYA 4YR3A 5M2PA 1FX2A 2NQPA 1VI7A 4Z37A 2W1BA 3HK2A 2IJFA 1RTDA 2MJNA 2WB4A 3CTRA 4CH0S 4NI2A 2RHQB 2FVSA 1VQOS 4DFMA 3LALA 1UZHA 1WF1A 2DPJA 2AJ0A 3CC4S 1Q16B 2V67A 1NO8A 4JI7J 3WIVA 2D1CA 1RT2B 3S01A 4K7QA 3NAHA 3LF0A 4I64A 4R0EA 4DV5J 4K4UA 3C6TA 4OHYA 4KIAA 3BQ2A 3QT8A 1NKCA 2Y0SD 4OQJA 2G13A 1L3UA 5F8HA 4K4TA 1TK8A 2ASLA 1HMVA 2KG0A 1YSJA 3O5TB 3C6UB 1S5ZA 2P5VA 1VRTB 1SQFA 1PYTA 1VHFA 2CVEA 4ZVTB 1NJIT 2V4JA 4B3OA 2JEIA 4PXBA 3LUYA 2C3YA 1BMQB 2OPPB 1R8PA 2QMXA 3V4MA 2XLJA 2YNHB 2D9PA 2LQ9A 1Q4RA 1RKIA 3CJTA 3KG4A 4TNOA 2FYXA 2AYEA 2P6TA 2GVZB 2R8IA 2A2DA 3DDKA 3IR7B 5ADZA 2FB0A 1W25A 2BW7A 1F1BB 1RP5A 3EVOA 1U49A 1Q5VA 2G0JA 4IR9A 3MI7X 4RU2A 4ZPAA 5BR8F 1MG7A 4F36A 1DFDA 1LKZA 1D09B 4O4RA 3DXSX 2NXNA 2MSTA 1S9FA 2VC0A 3SXLA 1YJUA 3MM6A 2DB1A 1TMJA 3SQGA 1FK9A 1WHYA 3MWBA 4QWEA 4DV1J 5D0GA 1B4SA 4RJVA 1U48A 3QYYA 2W9BA 4NLGA 3D6TB 3Q86A 1VQ7S 1UEKA 1PSDA 3PW7A 4ED4A 1DY3A 1ACMB 1S79A 2BE7D 2CJAA 2EG1A 2XMUA 6FDRA 3IAM9 4ZPVR 2F63A 3KUGA 3CCES 2DITA 2DKOB 2Y1RI 2KO1A 3A8JA 1RYRA 2OLWA 2R7OA 1GTHA 2LMIA 2BJ1A 3MCNA 4ED8A 5F8LA 2AZ1A 1B0PA 1UFLA 2YNIB 1NJWA 3KK1B 1PO6A 1X4GA 4KPYA 4M5MA 3R3TA 2KJVA 2KG1A 2CJ9A 2AX0A 4ZHRB 4YHHF 1K9MT 5IQQA 3HCXA 4NA2A 1J5EF 2CG8A 2HS0A 2O1PA 3QRPA 1S57A 5HP1B 2CPDA 4P2MA 4LF1A 4KT0C 2HNDA 4TU9A 1IQTA 2JNJA 3VR1A 1QSLA 3D6MB 3NMRA 2ZOGA 4AUKA 2GQCA 1XMQF 2UU9F 3EGWB 3PIOQ 3G8SA 4LFCJ 3DGPB 1RA7A 3FMBA 2ZH3A 2M8HA 4M5DB 5I3PA 4RNNA 4YN3B 3Q8SB 3IGNA 2ASDA 1RU2A 4PWWA 2ALZA 2ILZA 3LP2A 1SC6A 3MMJA 4DPUA 2XTJP 2U2FA 2CNKB 3L7UA 4RW9B 4DSEA 3IWNC 3BS9A 1HWUA 2LCWA 1BWEA 4EZ6A 3I9V9 2YWKA 2GNKA 1FHTA 4M5KA 2VIHA 1APSA 5LMNJ 3MOZA 1PCAA 4LSNB 3UI3A 2E5HA 1Z4UA 4LREA 4PWDA 4DV4F 2DNPA 1U6BA 3P8BB 1FVQA 1UEUA 3C14A 4A46A 4C8NA 1LWEB 3KG0A 4GKKF 2HEKA 3TA0A 2C3OA 2XWYA 1TMMA 3HHLA 2YNGA 3DHWC 2GHWA 4DFKA 4DR7J 2A10A 2QZ8A 4GVBB 1IBKF 5CZXA 2OH2A 1JLGA 2P9GA 2AEMA 3AD8C 4DV6J 1KFDA 3CCTA 3CB4A 4LQ9A 4PXDA 2V34A 3I4PA 2H5JB 2WAQD 2PO4A 2R7WA 3HF5A 3MPYA 1Y7PA 2HVZA 2HWIA 1TL7A 2V4JB 2V69A 4HEA9 5KG5A 1TU0B 3MPWA 1Q81T 2G0CA 1GXTA 2NYIA 3N6MA 5AT1B 3DRYA 1MROA 2HBYB 2MGZB 3CXCR 5KFOA 3GIMA 1XNQF 1RWNB 3PW5A 3ZZTA 1OY8A 2C3PA 3QAEA 1YBAA 2VFRA 3D68A 4KH1B 4OJGA 1N5QA 3QQCD 5LSOA 4OJ3A 4WTYA 1KP6A 2VU5A 3G82A 4TY8B 5C2GA 1KHVA 1MN9A 4P72A 3WC2A 1MN7A 5K14A 2RIJA 2YKNA 1SH2A 1FNOA 3BR9A 1XTZA 1UWAA 3LP0A 4P7VA 2X1AA 1FK9B 3CJ3A 2FJDB 4F04B 5I3QA 3M05A 3THVA 4WK3A 4CZCA 4X4UA 2QC3A 3AQOA 3RG6A 3LAMA 1KEKA 2IA0A 1I6JA 4QWBA 3KHHA 1MW7A 2B9XA 1RTHA 2ZVSA 2CQCA 2F8EX 1HWJA 1SH3A 2CQBA 3FVYA 1NZ8A 4XK8C 3CJRA 3GFZA 3UNGC 4C6AA 5DETA 4DV2J 1HBNA 1C4CA 1X4HA 4PWUA 4L73A 3TUIC 5H9EK 1HNIA 4MFBA 3T6JA 1PBUA 1RAEB 3NGTA 3KLHB 1B7FA 1CG2A 1JK9B 1JLCB 1Z1ZA 3NEKA 2IVMA 3TWZA 3VVUA 3K5LA 4DR7F 3MEKA 1ZBTA 2VPWB 4DV7F 4PZVA 3RUBL 1P27B 1G2EA 1AYEA 2CQDA 2HSEB 5IT9Y 1ZM3A 2C2OB 2XSJB 4ES2A 2ZWOA 1NUEA 1UETA 3T1AA 1WC4A 5AXMA 2B7BB 1DLOA 1BD6A 1YG0A 2DK2A 4JI1J 1F2HA 4DCJB 3HPOA 4QQBA 2ABYA 2LXUA 1S1UA 2WBMA 4PG7A 1S1XB 3FJ2A 3BBBA 1KOHA 2EG2A 2HNDB 1R6VA 2YNIA 3DCAA 3I87A 3M8WA 4KPCA 4PAAA 4LF9J 4OX9J 1GX5A 3FCHA 2KYXA 4WP8A 2DGWA 3ENQA 3D2WA 2LDIA 1U09A 5ETSA 1K44A 3L95X 3UFCX 5IZHA 2LFVA 5C42A 1RK8A 2DHAA 1WF0A 3RAXA 3LGMA 2DNYA 4F4WA 3TAMA 2UUCJ 3KMSA 1HBNB 1NMEB 4P9SA 1KLNA 4F3MA 3UD3P 2YH0A 1EJ7L 2LYVA 2V8GA 1RWWB 2V2QA 2YWGA 4PG4A 2LA6A 3ENVA 1OJ4A 3CCZA 3MMBA 2KM8C 2ACMA 3FEZA 1HBOB 5HVFA 1B0VA 4RX6A 3Q89A 2EPIA 1TZ0A 7FD1A 3RB0A 4OZ0A 2OPPA 5C24A 5KFNA 2E29A 1UP1A 4OLPA 4P75A 3QAUA 2YX7A 2W2QP 3BPSP 2P6SA 2RQ4A 3IA0A 2KYZA 4MK7A 4UUWA 1UKUA 1RHRB 2AP6A 3WBZA 2EKNA 2MZRA 4H54A 3PHEA 4NYZA 4I67A 3KNAA 2W25A 1T95A 1AW0A 3FQKA 2FHMA 2MZTA 4IQMA 3FBEA 5KT3A 3Q2TC 3CJKB 5G0RB 1M5VC 3G8TA 4RPFA 2DT9A 2FJAB 3DI6A 2KXNB 2C2MB 2BA9A 1XMQJ 2MQMA 4QZVB 1VC6A 2K3IA 3DRRB 1U1MA 4DR4J 1S12A 4IDKA 4Y65A 1JLBA 2C42A 3GZ7A 2XHWA 4NYPA 1NSQA 4CI0B 4JI4F 2AJQA 3J7YI 2ZC3A 1GK8A 4RBVA 2CPFA 1AB8A 1OY6A 2E7XA 1QD1A 3MMBB 4XO0A 1M5OC 4WFBQ 5DQHA 3BSCA 1F0XA 1SIWB 4I69A 1FFSB 4IFYA 2ZH9A 1EAYC 1FKAF 2VL1A 1LW0B 4KTQA 3D0IE 2E5IA 3JTOA 2MDAA 1DQAA 1GX6A 2CQHA 4HLBA 3VV2B 4QBUA 3PM9A 1OS5A 5CD4A 1QVGR 4WCEQ 4ZP6A 4DX5A 2HHWA 2VQFF 1TV6B 4ANEA 4DU7A 1R6YA 1UA1A 1R43A 4KY3A 4CP5A 2J8AA 3GYGA 1TR0A 3UCZP 3RTVA 3SFGA 2CFXA 4DV0J 1WNEA 1T05A 7FDRA 3QRQA 1JKHB 3D0GE 3F44A 4J9NA 3G82B 1IKYA 2JLEA 1RUSA 2QGFB 3H2VE 2DNMA 3T3FA 1RU1A 2M3DA 2X51A 4AQYJ 2ZHAA 1I51B 1T7PA 1MSWD 3TARA 1EKSA 5HL7Q 1N0UA 3IR6B 3DFEA 5CCLA 1N36F 3M9NB 3DM2A 3UDVA 4NE9C 4NLDA 2WHOA 2VF3A 3M6WA 3UVJA 2HLTA 2OPRB 2OUGA 2CQ2A 2GFFA 1VQSA 2LXIA 2YTCA 1VRTA 2H54B 1HQEA 2HLUA 3W61A 3EX7B 4RW6A 2PSZA 4E8UA 5RUBA 3IBFB 3KUEA 4CH1A 2DNGA 3CC2S 3BQ0A 3OUYA 2AYGA 2JRSA 4M5HA 3DOMA 1N34F 2M5YA 2QL5B 3CNQP 4LVOP 4MJKA 3BSOA 4HT7A 4WF9Q 1S0NA 1K8AT 1VQNS 4JV5J 2AZ3A 4R0JA 3G71S 1WOSA 3W2VA 1Y4ZB 1QTMA 2ZITA 4HVZA 4LSZB 4TU8A 1S99A 1M1HA 3R27A 4CLZA 1I94F 1OPIA 3E01A 3CJQA 2HRTA 5C2CA 4I7FB 4JBCA 4JI3J 2UUWA 2ZBRA 2W01A 3P4UB 1LV5A 3N5FA 2PN6A 3HVWA 3MM6B 2IYIA 3FEXB 1XIQA 4GVBA 4ES3A 4EK2A 3FDSA 4DR6J 2G2OA 1UJ4A 3N4WA 1UFKA 2Z57B 3AH6A 1XN9A 1R8CA 2NCKL 3NS6A 1VQ6S 2HG4A 4EYHB 2G2YA 3CCMS 2SXLA 2FTRA 1EKRA 5DLGA 4CDIA 3IMQJ 4NCGB 4AFFA 4M63A 1KTQA 3HKZD 1D0EA 5HVHA 5GAHU 2MKHA 2V8PA 2YBVA 3VWSA 2OPSA 1RHMB 2V50A 3EPIA 5AJ3F 4EBEA 5BYRA 4CTAA 3AQPA 4FYDA 4M94A 3MAHA 1TKZA 2ATCB 3OJSA 4J5OA 5FIIA 2H4WB 3DLKB 4ZLNA 3J80Y 1WEXA 3SSSA 3PEHA 4TYAA 5GADU 5K8MA 3VAKA 1WC3A 3CEDA 4USJC 4H4OA 5EHHA 3C16B 3IM9A 2GX8A 5IC4B 3IN5A 1FJGF 1Q95G 1HWIA 2AV5A 4PEOA 2L08A 4FNHA 3EGVA 2OGUA 4MYUA 1RZMA 2Q79A 1BXNA 1KONA 3B54A 3R5GA 4DPYA 5A8WA 5IWAF 1X4FA 1T0TV 4B17A 3NWRA 2Y1JA 4Q2MA 1TUGB 3GMGA 3IRXA 3JSBA 4PRFA 1YJVA 4BWMA 2W2NP 1BHNA 4G3IA 2BOAA 4FXDA 8RUCA 5ETMA 1TKTB 2KJWA 1D3WA 2V5HG 5CXTA 3SMZA 1D8YA 4ELVA 1HQUA 2P2CB 3M6VA 4WKYA 2EW9A 5FLXY 3BBFA 1WOPA 2LQ5A 1YRXA 3WX8A 1X9MA 4F3OA 3P96A 5K8OA 3VGUA 2VFUA 3ZZRA 2Z8QA 3ZC4A 2N7CA 2VDHA 2ZFHA 2BW2A 2WZ1A 3QLHB 5CYMB 5B09A 3FSIA 3R9LA 4QWAA 2I38A 2NXUA 2OD6A 2OO4A 4NEYA 4JI5F 4FXVA 4YR0A 4URQU 3EWGA 4BC9A 1CJUB 1U0HB 3NMAA 1SJRA 3OPKA 3R5AA 1DTTB 3DRPA 1RT1B 4A4JA 3W9HA 3ZZPA 1X5TA 3G86A 2HRUA 1D1UA 1AROP 4ZVPB 2B4OA 2C2EA 3HSJA 1I3OB 4NLWA 2ERRA 2BANA 2IFXA 4P2XA 1UVKA 4Y28C 4NXNF 1SV5B 1K1QA 2NSCA 3K89A 4OZ1A 2K7JA 2IRXA 4CM0A 4AL7A 3T1HJ 3V6JA 4CLSA 4KYZA 2J6UA 3BO2A 2JWNA 3AAWB 4I68A 5IXUA 2I5JA 2OJ3A 2N7YA 4Y2KA 1RA6A 3NY0A 3Q8QB 1CC8A 5B08A 4P52A 4WP9A 5MAOA 1FWKA 3MXHP 4WWSA 4LQ3A 1U6ZA 4V19X 2PD1A 1CSJA 3UDCA 2C2NA 3W8PA 2F65A 1VBXA 4K5SA 1BQXA 2CPXA 2W2PP 3AA9A 4ZVOB 5E3CA 5SZTA 4A8MP 3C19A 2WONB 4L72B 2UUAJ 2IM1A 4FKYA 2MKYA 2QLWA 1OIAA 4DS4A 1FXRA 4K8RA 5AE1A 3K7RA 2EFPA 3PX6A 3FCWA 2XS2A 2YX1A 2PI4A 2VICA 1RT3A 3SZ2A 3J81U 4DMZA 5KOWA 3MAQA 3TRGA 1LFWA 2HHVA 2QA4S 2KL8A 1CULA 2HBQB 4W92B 4P7TA 1Q7YT 2HVHA 3MMAB 2I5JB 5J1PA 2VASA 1H2TZ 5EWEA 4USIA 1JLQA 3BKFA 3C6TB 4G65A 1F5AA 5HMYA 1OYDA 2MQOA 4EBCA 5U47A 5B7WA 2A18A 3TX8A 4LFBF 1HYSB 2GJFA 2GQ2A 4AXIA 5L46A 1MWQA 4RKUC 2H5IB 2E5JA 4YB7A 3SCLE 2ZH6A 3NS5A 5LMUJ 2WVBA 2GVDA 3M30A 2DD8S 2RSQA 5KFCA 3TEGA 3M2UA 4F0HA 3BREA 3GP9A 1X4DA 4UOCA 3K8WA 2GIFA 3MPVA 2HHHJ 1KLMA 2MY7A 4HHUA 2YNGB 1FO1A 1H2VZ 5E0OA 1NZAA 1S6QB 2YNFB 3H90A 4FS1A 3CC7S 2M0GB 4O3PA 4O3NA 1T03B 3GG0A 2M88A 3C16A 3TJ8A 3N6LA 3UD5A 4DN9A 4I6AA 4Q43A 1CULB 3MZIA 4Z7YA 5HROA 3C2PA 1WSRA 4QW8A 1BQNB 4ICLB 4P2SA 1RAHB 3BR8A 3QJLA 1AFJA 3IP0A 1P9YA 1OWXA 1ZTTA 3KDNA 4EO6A 4DFPA 3HHEA 1K47A 2K1RA 4IH6A 3ZXWA 2POKA 2HQGA 5L38A 1KC8T 3UVJB 3HT0A 2XMJA 2HIQA 1ULRA 2WSCC 2DY9A 2VPYB 4JP8A 1HNZJ 1YVFA 2OIHA 1NPKA 3FBCA 3OXLA 5GAEU 2XCPA 4ANDA 3ET6B 4Y00A 2CPHA 2HQDA 2K06A 2V2VA 3KLEA 1PAUB 4PUOA 1U0HA 4IFVB 3NOCA 1RT6A 4IRCA 4OX6A 1TK5A 2D9OA 2J7UA 3VAGA 2IMWP 3VZIA 3GV8B 2JEJA 3PFEA 5J1EB 1T9XA 1K0TA 3P5BP 3HULA 4OMFG 1UEVA 1Y5LB 5ETOA 4ED3A 2CXEA 3CGIA 5KFIA 2UXCJ 2FUG9 3IO1A 1RTHB 2QLFB 4CO3A 2D74B 5J2PB 1HNXJ 4FYVB 5ETNA 2V9WA 5HP1A 4NLSA 1WI8A 2GGPA 2VBWA 5D4NA 2V9KA 3ADAC 3PJWA 1FI4A 2RQKA 4RNFA 1T9VA 4DSKA 1FRLA 4F2SA 3CCLS 4DV3J 1C2PA 3UNYA 3MM8A 4DU8A 1VC5A 4B3RF 1S7HA 4FYWB 3DYAB 1FKOA 5EWFA 1R0AB 2BQUA 1I94J 3PR4A 1DARA 3BSAA 1FE4A 1RTJA 2CJQA 1VBZA 3LP2B 4WJBA 3DU6A 5D6GA 4TXSA 4NLPA 5AXNA 1VIOA 4H4KC 2ZDOA 3CJ4A 2CNLB 3R5DA 4FBTA 3MUMP 4B3SJ 2DYAA 1DJ0A 4B02A 3B4MA 2KHDA 3KG1A 5DJBA 3PG9A 1VQMS 3N5BA 4P2FA 4ZPBA 1SJFA 1H38A 3D7SB 3K59A 4LFCF 3G6YA 3JYTB 2OEKA 3NOGA 1RJJA 1UWBB 3UWTA 3VGVA 3OL9A 2QE5A 3EZUA 2RD5C 4DZ6A 5HQ8A 3RR8A 1X0FA 3M1VB 3NRBA 5KAKA 1SL1A 1P1TA 1X4AA 1HNXF 2WSEC 1RAAB 2DH9A 4ZJQA 1FDDA 2VDIA 1V9OA 3G8QA 1Z2ZA 5DQGA 3GU0A 2RU9A 3HFVA 4UQTA 4DV1F 5IC6B 4DR3J 2E1PA 3HMJG 3I31A 3NCPA 3CD0A 1RBLA 2KU7A 2FJBB 2FVCA 1S0VA 2PDAA 3W65A 4DG1B 3OTEA 5BJRA 5K20B 3EDRB 5CD4H 4YR2A 2GHVC 3D66A 4C98A 3M9OB 1SKRA 3OUYB 4X62F 1KR4A 4JI0J 1NK9A 3J81j 4Q0BA 3CDBA 3QT6A 4QR2A 1PILA 1U1KA 4WZQA 3G6ES 2X7IA 1HR0J 4OZ3A 3Q8PB 1EP4B 2ADBA 2J9EA 2LQBA 4U8VA 5KT7A 1SJQA 2XYGB 4FPRA 4OYPA 2L41A 4DX7A 3IG1A 4DF8A 1FDBA 1XJWB 3MTKA 4NZ6A 5JXSA 1IBLJ 4DQIA 2HHTA 1VRUA 1TQLA 3HFZB 1B0TA 4GMKA 1NK5A 5L1JA 4QYRA 1AUDA 3MFIA 1VQ8S 5SUHA 2DY1A 3BGRA 1TUVA 1JIHA 1VK3A 2MZSA 3M2VA 3R7BB 4MH8A 1T3NA 1SBRA 1NRKA 2B5JA 1YWXA 5KOXA 5KT2A 3KLHA 4KO0A 4IO9Q 1S48A 3LPYA 2XY7A 2HHUA 3PYDA 3CE8A 1SH0A 5F3ZA 3Q24A 3BGOP 4MT1A 3OTCA 2K2PA 5A0YA 2AGPA 2AU0A 1JWWA 2XZDB 1IN0A 1FT8A 2OPSB 2XMTA 3R5JB 2AGOA 3D54A 5KFSA 3G87A 4JV5F 5F0UA 5DLFA 2D7SA 1G6BA 4NLRA 1Q8LA 4H4MB 4YB1P 4DLEA 3RRHA 4LSNA 4M5GA 2HHHF 1NU4A 1SIZA 2H51B 4OL8A 1Q78A 1WTFA 5KFGA 2J9DA 4CNYA 3KKFA 3NCQA 1RT6B 4QJVA 2PA3A 4ZPDA 2ZH2A 4F4KA 3BGLA 2CQGA 2V4QA 1SB6A 3GIIA 2KKHA 2O66A 1REVB 4DXLA 1VJQA 4ZJLA 1RAIB 4BLGA 5J1EA 1YRUA 2HGMA 3TQ1A 4M8LA 4OI0A 4K0KF 2LEBA 2B9YA 5FDLA 4DLGA 3KOAA 3T19A 3DOKB 3NXZA 4DV2F 1WSVA 2XB2D 1IKXB 5DDRC 2EFOA 3ISZA 2R2TA 3GSDA 2W7PA 2PMHA 3J7ZT 4AXJA 5DG8A 2LEPA 5D15A 2XY5A 1P1LA 3ILOA 2B6AA 3CT9A 3N01A 1FEEA 3DOMB 2DXDA 3NGUA 3R5CA 1H7XA 4LT6A 4ZP8A 2OPQB 1FX4A 1SJ4P 4HTIA 2RS8A 2F40A 1DAXA 4ZVHA 1NK6A 4W98A 5LSRA 1LK7A 5DRKA 4AYBD 4LF8F 4OV1A 4CLTA 2K3KA 4LF5F 3ILIA 1F3FA 4NA1A 2XC9A 4TYBA 2DO0A 1S1TA 1PIEA 2HK2A 1B7YB 3OTDA 3GYNA 3R6GB 4JYAJ 2YKPA 3B78A 3AA8A 1OQ6A 2DRBA 2BXJA 3MFHA 1UTAA 1L3VA 2E9ZA 4HT5A 2VPXB 1ZPWX 1RT7A 1S6QA 2YNFA 3UN3A 3ZNUA 3EGZA 1TAQA 3M6XA 3MPUB 1JB0C 4YY3J 1VQLS 2XYPB 3MEGA 2FVPA 1R0BG 4BS2A 2HPUA 1HMVB 2IY5B 1S72S 5IQ6A 3RAQA 2UXDJ 2DIUA 2CKWA 4DUZF 1QAYA 2HK3A 4A8QA 1UJ6A 1S10A 2R42A 5KTQA 2FJWA 4PYDA 5E33A 2RRAA 5D3GA 1YGYA 2K1RB 3OTBA 3OQ2A 4IDKB 4YS2A 5KG2A 5LJ3Y 1JNRB 3A8IA 3PW4A 3D28A 3VGSA 1EX8A 4UUXA 3HHKA 1KBRA 2FQQB 3QIPB 2BABA 2ILYA 3H8YA 4N56A 1RCOB 5J2QB 1Q86T 3NGSA 4H4OB 2CADA 1RWUA 3HSDA 3IG1B 1X9SA 2CJKA 1QE1A 4ATNA 3F0NA 4RUHA 1AZSB 1ZM4A 2DR6A 3MM5B 1Y0HA 3M8SA 2ZDPA 4J9MA 3HHLB 4NLQA 2LLZA 4OYZA 3OTOF 1YDLA 5DS7A 4RO0A 5HO4A 1LFPA 2Q6CA 1S1XA 5L9XA 3QT7A 3I56S 2MYFA 3MEDA 3CMAS 3NNCA 2QA2A 1LEOA 5KG3A 2J7WA 2BJEA 3MUTP 4ELTA 1Y11A 3TJAA 4U7CA 2DGVA 3PFOA 2J0QD 2L9DA 1V6HA 1WEYA 1HFEL 1HQEB 3W5YA 5A2QU 5A6PA 1X8DA 1SXLA 3J7A1 1RWKB 2H1YA 3AODA 4NX9A 3KNGA 2BE2B 4F26A 2MKJA 1Q7LB 2CVIA 1NSPA 1XERA 2H5EA 2QL9B 2QTWA 3DM2B 2LA4A 4CLYA 3JSMB 2FPHX 4XPCA 3CD5A 1GMWD 1NJYA 2RUGA 2BZ2A 4X4RA 1NK4A 3DLHA 2R2RA 5EDWA 1UZDA 2GVDB 3TNVA 4LSLA 4ZLLA 4UQGA 2B3TB 1T9TA 4J7CA 2AJ2A 2XMWA 3FK4A 4C3MA 4MIBA 3JB9k 3CIMA 2FC8A 2MXYA 1IKVB 2ZKUA 3KHRA 3S6EA 3QFWA 1PJ5A 1AT1B 4OJHA 1L3KA 2APOA 3VQSA 2OTLS 1RT5B 4DV3F 5GMEA 3M8QA 4DI6A 1X4EA 3C66A 3RAMA 5IV4A 3PO4A 1JXVA 2M8DB 2WW8A 2VV5A 1T9UA 2EK6A 1T03A 1IXKA 1KOOA 3O6QA 1PJ6A 1VQ4S 1XEZA 2BV3A 3KLGA 5L8RC 4ECVA 1ZYQA 3UCUP 2ZUAA 3IBWA 3BYPA 1VJWA 2AEFA 3PRBA 5I3UA 5J2MA 2EFGA 1PJ7A 2RT3A 3V2UC 3GTYX 1VQ5S 5KFFA 2J76E 2X3DA 3ZNJ1 1JLBB 2V2ZA 3DLJA 4KSEB 1IBKJ 4LRFA 4KGVB 1H6KX 2ASJA 4JI6F 4U8YA 4NL5A 2E5LF 1AA1B 1LW0A 4OV6A 1VR6A 4CLFA 3C14B 1K73T 4K4VA 5B0EA 3OVBA 3KHGA 4FDFA 5EGYA 1DLOB 4UW2A 5E3RA 2HQFA 1U25A 3QGIA 2BQ3A 2PFFB 2H65B 2J0WA 2MY8A 3RJMB 4RNOA 3TEHB 3PXGa 1IR1A 1R8HA 1S6UA 1IBMF 4KE5A 3ONQA 4DBQA 4C8OA 3ILJA 1QDUB 3KLIB 5A2QY 2L9NA 3K8VA 2IM0A 1U6FA 1S1WA 1RISA 2G0IA 4JV1A 2JC1A 3SIPB 4YY3F 4C8KA 1B70B 4R5PB 3H2LA 2WSFC 3R1LA 2RMLA 4WIIA 2DPIA 2ZE2B 3MGJA 4CYUB 4DDFA 5IV3A 5I42B 4HTJA 1YI2S 2HZVA 1FRJA 1T9YA 1WJ9A 3H20A 1GMVA 4KRWA 1KQKA 3RRKA 4DPOA 2MGZA 2YH1A 1YIJS 3W66A 2XZWA 3JS9A 1ZM9A 2ROEA 3PEJA 2EC2A 5D77A 4ZVRB 2VG5B 2I6WA 2HNYB 4G1QA 2W2OP 3W64A 1S77D 2AWZA 1F5CA 1V5IB 3DN9A 1WHXA 4OYIA 2G1DA 1FESA 1RT1A 2D41A 2KFYA 2ZC4A 1URRA 4NLOA 1WACA 2EK1A 5AE2A 4K4WA 1NSKL 4UZCA 3MR6A 4RBUA 2R7UA 2C3MA 3W2VB 4RWWA 3CCQS 2CPZA 2WRMA 3BGUA 3N0VA 5CHCB 2RAQA 4UT4A 1N6QB 3MEEB 2FZGB 4DHVA 3BQ1A 2ROPA 1FD2A 2IVFB 4IR1A 5ETVA 2EEYA 2HQ3A 4B9TA 4IOCQ 1FTCA 3M32A 2W7OA 2OI2A 4ZJOA 4X66J 1UVIA 1RLCL 2ZJPQ 3C46A 1N36J 2VFVA 4J9QA 3F73A 4Q8EA 1YHQS 2C2RA 2H9ZA 2CDRB 4GRSA 1QY7A 2W7AA 3AD9C 1VMBA 4QR0A 1G4CA 3HT3A 4LF7F 3QGGA 3DRSA 3UR3C 1RBAA 3OR1A 3DOLA 2R9LA 2F8MA 2VG5A 3PY8A 4B9LA 5FJ4A 4NZ0A 2Q6BA 3H25A 1SL2A 4C48A 4I2PB 3KYLA 1XNQJ 1M0SA 3HZEA 4IFVA 3AFGA 4ZVGA 2P8IA 3SBMA 3QGHA 1CJVB 2E66A 3QO9A 2FLPA 4YB6A 2ZNYA 3F41A 5GMDA 4OYWA 2W9CB 1HNWJ 2CQIA 3MR7A 5K9FA 2IPOB 2EC0A 3D1OA 1JLGB 1V3SA 3FGVA 3MURP 1WORA 2CG4A 4HDHA 2BX6A 4PWDB 2UXBF 4UOFA 2QFJA 4B9NA 5M2UA 2RH3A 5KT5A 4CLKA 1SC3B 2GMLA 1HBUB 2AEJA 4EEYA 4QYZK 3GSIA 4Y0FA 1WKKA 4K5RA 1HNVB 4YQWA 3ZZYA 2J5AA 4FPIA 1QVFR 5F3TA 5CCMA 4OFZA 3MD3A 5ETLA 2Z2YB 3JAMU 1N52B 3OHAA 3OV7A 1KQFB 3KUHA 2FVQA 3ITHB 4IO1A 3FZBA 1S4FA 2DNOA 2HFUA 2R8KA 2KTQA 1U26A 1Z2LA 3OR2B 1WI6A 1GQEA 2Q3PA 2RUSA 1WC5A 2KVQE 1SKUB 2J8SA 3FQLA 1NH8A 1VS3A 2YWFA 4O4GA 4W4MA 4JV0A 3OJUA 3CUNA 5L1IA 3NLCA 2AQ4A 3GG1A 2RILA 3CCWA 4I6YA 3RU0A 3JQJA 3PRDA 4W90B 4P71A 1DQ8A 1TFYA 2KH9A 4JI1F 2WCXA 1YTYA 1ZA1B 2BJ3A 2JZ5A 4DL3A 1U8WA 1R7IA 5F8MA 2B4UA 1CJUA 3CVKA 4QR1A 4KAIA 4DR1F 2UXDF 3R7NB 4OZNA 5HROB 1YITS 5EN1A 3TX0A 2Y8WA 2R7TA 1HW8A 3M7VA 2HVEA 3Q23A 3JTNA 5DG9A 2Z58B 3CDUA 4OI1A 5DDPC 3OBIA 1XR5A 4LBPA 2OP5A 2IM2A 3UN5A 1M5HA 2HHQA 1R3NA 3GJQB 2EKYA 5HI7A 2UUCF 3ENAA 3U27A 4DL7A 2NXEA 3D3BJ 2CZ9A 3OD2A 4NLVA 4PXEA 4RNHA 4DV0F 3TAQA 1LNQA 1RWPB 1H2UX 2G2ZA 2BRLA 4WXWA 4HKQA 4KH0B 3DLBA 3ZZOA 4MKYA 1RACB 1SKSA 4F2RA 2GZOA 3UN2A 3QFHA 2I2YA 1R27B 4ZCMA 4USHA 3I82A 4A8SA 3L9ZA 2YWHA 2F4VF 5D8HB 2CWXA 3ZTOA 1KNZA 4NLXA 4F4ZA 3EPGA 3TANA 3HP6A 1VQKS 2W2MP 4ILRA 1C1CB 5LXRA 1NNDA 1X60A 1S1VA 3TW0A 4KQZA 2CQ1A 1Q82T 2V94A 2QIFA 4OYMA 5LOQA 4U7UK 4ILMA 4C0BA 2EFQA 2HHPA 2ZD1A 4JI2F 5CH7B 4CLUA 2MQQA 2FJVA 1RGVA 1UJ5A 1VFJA 2WVEA 4MTPA 4RW8B 2AD9A 5D4LA 3M8RA 3TI0A 2N4CA 4C8YA 1NHKL 2F1FA 3LW5C 3HD2A 4WBFA 2QLJB 2DH8A 2YKMA 2VHGA 1WTBA 2R7QA 1NJZA 5CZVA 1FRXA 4IKAA 2HS4A 3OR1B 1JJHA 2MKKA 5C42B 2BM1A 4AL6A 4DL6A 3DU5A 2LEAA 1CEZA 5J2MB 2NPIA 4RW6B 1X5SA 2V0NA 3MECB 4CLWA 4DR1J 1O8BA 3OHBA 4RW7A 4R25A 2HGLA 2DNRA 1X31C 2B9WA 2K8GA 1RTZA 2ZVIA 3MD1A 4C7QA 1Q1KA 5JUMA 1TFWA 2R7VA 3MDFA 1PKUA 2MQ8A 3O1LA 4ZN3A 3RBXA 4RZRA 1YBUA 2O3DA 4H4MA 5IT9U 3A8EA 1BY9A 1FDAA 1Y00A 3VHQA 1NSAA 1YZ6A 2B7CB 4Y2IA 2M4MA 5J2QA 3IWXA 2OMLA 3E01B 3D1QA 4OHXA 3GV7B 2BVZA 4OI4A 1J27A 1JMTA 4ZP9A 3ETOA 4U9RA 3SQOP 3T9NA 3KLFA 1N88A 1IM4A 3E3XA 2MQNA 3L09A 3RR7A 3GR0A 2PMZD 1RADB 2D69A 3RW7A 2M52A 4DSIA 4M1KA 3HHLD 4FF4A 2IJNA 5BYQA 3MCOA 1CJTA 2R4FA 2C2KB 2Z0GA 3EXYA 3H0PA 1ZOTA 3H5SA 1WHWA 3MCSA 2FIUA 1R31A 3EM1A 4KC5A 4Q2LA 5CQGA 2V8HA 2LVWA 2UV8G 1NEEA 3R8YA 4PG8A 3LWLA 4LBIA 3T41A 4YMEA 4A8KA 4J9SA 1HBUA 1R89A 1RE1B 2AJ1A 2OKQA 8ATCB 5MLCV 3RBDA 1OMSA 1JJ2R 1C0UA 9RUBA 2RB7A 2DH7A 4OZJA 4DJBA 1A9NB 2DTJA 1C4AA 1TUWA 4OI3A 1WC6A 3TZZA 4ZPWR 2NXCA 2MZQA 3KK3A 2NLWA 4C8ZA 2FLOA 1M1KT 1H3DA 5K8NA 1CJKA 3HVAA 4X4TA 4C8LA 2R7XA 3OR2A 2C1EB 4N8OA 2FD2A 2LQ8A 2X1BA 4HR2A 2GIRA 2XHCA 3M8ZA 2DEIA 3VAMA 4YP3A 3EVWA 4QPTA 1FRKA 2VKRA 4CO0A 3C8YA 1TV6A 4RUCA 4DL4A 1KVIA 3B82A 2B4VA 4F0KA 3I0SA 5D0RA 2RKIA 5F8NA 1RT3B 2A6MA 1JLFA 1VHIA 5IS2A 1JKHA 1SC4B 3W63A 4UOHA 2OPRA 3C15B 3KLGB 1VQPS 4DR2J 1U1LA 1X5OA 2YWWA 3U1LA 4I2QA 2F9JA 5KG6A 5KT4A 3K57A 1RKJA 2LXFA 2UVUA 4X4SA 4A48A 4C8MA 2GO8A 2CPEA 4NWBA 2W4CA 2N82B 3CWJA 1DTQA 1ZH5A 4O23A 2BE9B 1L5UA 1HYSA 4JYAF 2VJVA 2J9DE 2F3JA 1FF2A 1Y10A 3A3OB 4A8FA 4UZBA 1CQMA 2B0GA 2DRDA 3AOCA 2BRKA 2VBYA 4USUA 2CJBA 4F0MA 2RDJA 4F7VA 2DO4A 3AJDA 4HL9A 1HPZA 3EICA 1N54B 1NAQA 3H98A 2EBEA 4PCQA 1FCAA 1DRZA 3UPFA 5E7OB 3TZYA 2P9EA 5AJ3J 1DHMA 1H98A 3W3SA 1ELOA 4RW8A 1HNZF 2F7VA 3AJ1A 4H4KA 3DDNA 1HI8A 2KN4A 4IG3B 3J7Z5 3BPDA 4N41A 1IWAA 3OXGA 1EARA 1J5OB 2L9WA 2MJUA 2RVJA 4GC7A 2OFGX 2Z2LA 5KFLA 4BC7A 4QPXA 3OFGA 3MR2A 3DRRA 2DGSA 4LR9A 1HARA 1LW2A 4RW7B 4GC6A 5DGAA 1N0VC 2VG7B 1XMOJ 1DTQB 4ERDA 2PC6A 3DOKA 4IYQA 4LF4J 2IIHA 5HLFA 5J2NB 1U1QA 4AE5A 4P10A 2ZM6J 1X9WA 1SKWA 3E51A 5HBMA 4DL5A 2C3UA 1X4CA 4M5JA 4Y6IA 4B9VA 1DQ9A 1EQMA 2OEJA 3PIPQ 1SUQB 2ZUGA 2GMJA 5K5MA 4U95A 1SQGA 1NB2A 4Z7CA 2GAHC 1SCJB 3CSKA 4QWCA 4IUFA 2MQLA 5A8WB 4CM2A 4XAKA 3QMQA 3MPDA 4OX8A 2YY3A 1GFWB 1ZA2B 3NG8A 5KFYA 1SL0A 2Z30B 1HA1A 1XR6A 3RW6A 1CJTB 3QNWB 5H9FJ 3RZAA 1S4EA 2XY6A 4ECZA 1UVLA 3G6XA 5DDOC 4DR5J 2E7VA 3GLJA 1UMJA 3WZ0A 1FRMA 3O8WA 1JLAA 1ROFA 1SC1B 4FXWA 5LXYA 2DHXA 2RQCA 3PX4A 1HNWF 3A4TA 5B0FA 1XMOF 4Q44A 3AHPA 2VFTA 3OSNA 2FHJD 4KO0B 1SVDA 2BJ8A 3GYXB 1NDCA 4ZPCA 5T41A 2WW4A 4FYYB 4J9PA 5KFRA 3FRZA 4CT9A 4EYIB 3POTA 3QJJA 3I32A 4RWXA 4HYKA 1BQMB 3IBCB 2IAJB 4O0IA 1M5KC 1U24A 1AFIA 5C24B 3FBBA 3R7SB 3PW0A 3G6VA 3EZOA 2RJZA 4XPEA 3KK3B 1VK8A 3QLHA 2MQPA 3W2WB 2R2SA 4F3QA 2HVDA 1C1CA 5ETRA 1U47A 1Q79A 3GR1A 2QN6B 1LXNA 3THTA 4I0WA 4CH7A 1UWBA 4WPAA 5KFKA 3QWPA 1JLFB 2GS8A 3QATA 4J90A 1A0OB 3FNNA 5FLXU 4DR5F 5C7PA 4KGMA 4ED2A 5J1NA 4F25A 3RGIA 2ZH4A 3NP5A 4PABA 4ED0A 4ALZA 3I5AA 3WIUA 1TK0A 1Q8IA 2DRAA 3E2EA 4FN5A 5LM7E 2M9KA 1FNMA 1GMWA 3EGNA 5DQIA 3ZZ0A 1FWLA 2WBRA 4LF7J 3R2CJ 3IC1A 1TL4A 4NRUA 5IT4A 4FP9A 2JOQA 3UW1A 5GVQA 3BH6B 1SJ3P 3GJRB 4RLEA 2MEWA 3ITHA 1IVZA 4FF2A 1N4LA 1RBOB 1W7WA 1MWYA 4LSLB 5HQLA 2UXCF 3HO1A 3FC9A 2AJ4A 4Y3CA 4RL1A 1HPZB 4EZ9A 5LMNF 2IBKA 1FFGB 3I0RB 3N6NA 1O6XA 4Q8FA 2YNHA 2KXFA 4NEZA 3JSMA 2Z4PA 4X4NA 1YJRA 3SV3A 2VG6B 2UUTA 3Q83A 3V4IA 1S1UB 1WELA 5A8RB 2GAGC 2AT1B 4OHWA 3LGHA 3T5JA 4URSA 4ECSA 4RNMA 4N5SA 3DXBA 3WX4A 2AGQA 5HATA 1FJ7A 4XTTA 1TKXB 3CJ2A 3EXCX 4QIGA 1GT8A 4MKAA 3NNHA 4F4XA 1N5YA 1OQ3A 3UR0A 2V2KA 3Q8VA 3OSPA 4S0MA 3HLUA 1A7GE 3M2VB 3TAPA 2HNZB 4RW4B 2BKOA 4EUVA 2EWHA 1O51A 3N79A 4PQAA 2F4FA 1TVRB 2UZAA 4OLOA 2J6TA 1XMBA 5A8KA 2CPJA 1LWCB 4TY9A 4DEZA 4IG0B 3GFXA 4WFZA 4C97A 2R2UA 4A8WA 4JI2J 2HFNA 2ZEJA 1YJWS 1OYEA 4PR6A 1EQ0A 4C0OC 1KHWA 2YPYA 1VQ9S 3KTQA 3PCOB 4KGZB 2Z56B 2E1MC 1YZ7A 3ETMA 3M8YA 4DL2A 4OYBA 1IR0A 2VUGA 3BB5A 4J9LA 3THPA 3BYRA 3EZ5A 1F5BA 1Q0NA 4TY8A 1QUVA 3GQCA 4YOEA 1F6TA 1WC1A 1GH8A 2UP1A 3SV4A 3FSXA 2XMKA 4UY85 3LP1A 3ISND 3H4DA 3RB4A 2J6SA 1NBEB 3S7RA 1B64A 1DBDA 1PYSB 2ACYA 1EZZB 4ZP7A 4F02A 2A2CA 3ICLA 4LUBA 4IRKA 2UVRA 4NCBA 1TVRA 2YKMB 3T1YF 5F9NA 3Q22A 2ZZTA 3I5CA 3C15A 4X4PA 3D6HB 1G7CB 3R2DJ 2OEMA 2HQCA 5B0BA 1BC6A 3W5XA 5D0HA 4B3OB 3CMQA 1PGZA 1XWLA 3L3CA 4CYUA 5I42A 2CRLA 1GEHA 4EGLA 4C9DA 4M5LA 5DZ6A 4L74A 1TTHB 4WFAQ 4ILLA 1FVSA 4BDPA 2YPZA 2CJXB 2UVWA 5E2QA 1U1RA 4MIAA 3OFHA 3US5A 2MZJA 3ZZUA 2MKCA 5T7LB 4YDDB 1VIXA 3A3NB 3K17A 4HDGA 3KLEB 4A8OA 4YDXA 5CA5A 3O3LA 1KS2A 4KGKA 1VRUB 1RI7A 4J37A 4KHRA 4OYXA 2CWKA 2J0XA 2YQ0A 2EBGA 4QWDA 5DG7A 1MU2B 1Y5IB 5B0CA 3J7YU 3M8QB 3Q8RB 1S0OA 2FJEB 3OLAA 5KFPA 1TL3B 3NNAA 2HURA 2U1AA 2YKOA 3IRXB 2W4PA 1HBMB 1OSDA 3MAAA 2KRRA 2QRRA 3I4HX 1FKOB 1H72C 3KJQB 4G1IA 1R0AA 1I5OB 2W8KA 1TKTA 4NMLA 2CPIA 2N3LA 3R5BA 4OZ5A 2DISA 1W26A 2CJYB 5FD1A 3OTOJ 5DM7Q 1N32F 1XBWA 3HM9A 4LF6J 5K8PA 3PHTA 2OFHX 2RRNA 4F67A 2HBZB 4WKRA 2MLXA 2DIVA 3PDNA 3V6DB 1IJEB 2VG6A 1FKPA 4JI0F 2DGOA 1G1XA 4X62J 4USTA 3MM9A 1T8EA 1QAJA 4USWA 2E5LJ 2XZTB 1LK5A 5KFTA 4KV8A 3UQSA 2ZBCA 1ZPVA 3LOUA 3BEGB 3B6BA 4NA3A 5HVGA 2QX0A 2XCAA 3RB6A 1HL6A 5K14B 4IH7A 2HQIA 2A0FB 1KQGB 3KK2A 4DUZJ 3V4IB 3J81Y 2ROGA 2AYBA 1EIYB 2RDDA 1WG1A 1WKJA 2CA9A 4Q45A 4GKJF 2QYCA 4ANCA 1LQ9A 1KRPA 4IOBA 3UD4P 2OSQA 3RBEA 5E3AA 4DR4F 5F9LA 2BJDA 4DWIA 4X66F 3AB2B 3H59A 1YK9A 2CDQA 4I2QB 4RUAA 3ELHA 1AXQA 1B3TA 2YQ1A 4ZMMA 4RW4A 2BQRA 4WK1A 1NLKL 2MKIA 1WWHA 5HN0A 1JLCA 2VB6A 3RRGA 1FA0A 1OPZA 3EJMA 5B0DA 2BKPA 5H1SV 3M8PA 3T9ZA 6AT1B 3ENWA 4Q7AA 4LF8J 2QT7A 1W2IA 3D0HE 3TVKA 4JV2A 3SFUA 2KFNA 4ID5B 1VBYA 3BDEA 4J9VA 3HD1A 3M9MB 2JX2A 3GPAA 1YBTA 4WE1A 4Q0BB 2GC8A 4ETXA 4J9RA 4ZIVA 4P73A 4JI4J 4KHPJ 1K0VA 2RQMA 4EMDA 4QIVA 2I9SA 5AE3A 1NDPA 1V5VA 3Q8YA 2W8LA 5HQMA 2QO3A 3K0JA 1UL3A 4IG3A 4DV5F 4DZDA 2R7SA 2XULA 5GAHI 4WTOB 4CLPA 2VQEF 5J2PA 4TVAB 3VGTA 1HHQA 4BHQA 1FRIA 1SPBP 2QEXS 3JQMA 1JLQB 2IJRA 2KT5A 2XSFA 2K7KA 4MMOA 4CLLA 4ZCIA 2MZ1A 2BBEA 3Q2SC 3OVSA 3PYGA 3FMWA 3CCUS 5CYQA 1IBMJ 2E7WA 5CYMA 1FWPA 5KG4A 4PQUA 1OSCA 3BH7B 2KZZA 3QIPA 3SDEB 1EHWA 4MKBA 2A3JA 3EYZA 5T7LA 4ZCKA 2PT0A 2PI5A 2FGOA 5KFWA 4DX8H 3PW2A 5CAAA 2XLIA 1AZSA 3MM5A 1S9EB 2CNOB 4U96A 5DZ7A 4TU7A 1QAXA 1VCTA 2XS5A 2DNNA 2H48B 2YKNB 3W7BA 5CABA 3EMTA 2HFSA 5CYJA 2XNQA 1MMLA 4LRDA 1S1VB 1H73A 3DLLQ 4K50A 5GAEI 3HHDA 1TP7A 1LWXA 1EETB 4ZOSA 3AXMA 1VLYA 4Q5VA 3I96A 2BYCA 4P6QA 5KFEA 1ZAVA 4NXNJ 3M2RA 1RWMB 1HR0F 4YUDA 4MKVA 2DGUA 4TQSA 1T94A 2HBRB 2KB2A 2G4BA 4ED7A 3LANA 1NPPA 3WQPA 5KFQA 1IBLF 3V6DA 3C3LA 3A1YG 4MYTA 3ZTSA 3CJ0A 2XWXA 3SDEA 1NKBA 3ET6A 4ZVQB 2FY1A 5KFDA 4K4ZA 2Z2MA 2D3UA 3KHLA 1RAJA 1S9EA 5JVHQ 2HHXA 3K5OA 2BACA 5M2RA 4C3KA 3HSGA 3KK2B 4QIWD 2FVRA 4TN2A 1M5PC 3AY0A 3KJNB 4LRCA 2DHHA 2Y0BB 3MCMA 4FVCA 2LU2A 1O5JA 4KV8B 1BE4A 5A6WA 4DV7J 4KFBA 2E44A 2ZOFA 1SQEA 4PG6A 2IRYA 3TVYA 3JXOA 1VISA 1PC5A 1C0UB 1ZAWA 2KRBA 4WU2A 2OAUA 3QBCA 4ZA1A 3OL6A 1LW2B 3MTJA 3GFYA 3OVAA 2JC0A 2VODA 1SJ1A 4IH5A 3L4BC 4K4YA 4R8UA 1DZ5A 1FFWB 1M1GA 2Z2ZA 4YEAA 1R8BA 1KFSA 3DOLB 3BDPA 4USVA 4LFAF 3M8PB 2DCLA 4LR7A 3U1MA 3M30B 3P3DA 4X64J 1JXLA 1NCLA 2KHCA 2V8DA 3J80U 2DEJA 2C2DA 4WYLA 2RU3A 4DV4J 2ZZMA 1TKDA 4CO1A 2VQFJ 3OL7A 1E6YA 4X65F 1CJKB 1XR7A 2AIRB 2GCFA 2WK4A 4RR5A 4DCOB 3KJVB 3PZPA 1IKWB 4ZVSB 1FDNA 4E0DA 1CS4B 2IM3A 5IM0B 4I7FA 1U1NA 2AW0A 5T14A 2L48A 4ECWA 1DTTA 3DRPB 5F8JA 3HJVA 3LO3A 2R8GA 3Q0AA 3PYFA 1F9FA 5LL6d 1BQNA 4GVLA 4ICLA 4A47A 2H4YB 2WOMA 2ZE2A 4O44A 3V5RA 3JQKA 1AUSL 1V3ZA 1Q8KA 3HHLC 2PEBA 1NK8A 2XMAA 1X5PA 3CD6S 4OZ2A 4R8UB 2F8HA 4MIWA 5A8KB 2F9DA 4XDDA 2J0SD 1FXLA 1HD0A 2DCUB 3LTOA 2DNLA 1RSCA 4L6V3 1FEHA 2CYYA 4LJMA 3BN4A 3FBFA 1BQMA 4EO8A 1UVNA 2NS1B 3DMJB 3ZTPA 3TVZA 4DQSA 3A3PB 3OL8A 2B9EA 3ZO7A 1LOUA 2HRYA 4MFBB 1FJEB 2UV8A 5CYQB 2ZHOA 2GV1A 3ZZZA 2Y1LB 4PQUB 2HAIA 1CQNA 3GFHA 4ZVUB 2ZM6F 1EETA 2M70A 2FC9A 1S0MA 3GJTB 3RYLA 3KLFB 2IBOA 1LWEA 1HIYA 2CQPA 1JX4A 4C11B 1YJTA 1P9QC 5F8GA 4L76A 3M2RB 3SQGB 1UVMA 4O44B 3TUJC 4Y2CA 2B5JB 3IGVA 1HHTP 2R3VA 4ED1A 1DURA 2YX4A 2D3O1 4ECYA 2OMOA 3PNIA 1WKLA 3DYAA 4K4XA 2WVCA 3NBPA 4YHHJ 3QT5A 3W60A 2UXBJ 2EFNA 2GJ2A 3TUZC 3SCIE 4JOUA 2QLBB 4O3SA 2DR5A 3H5XA 1YKWA 1MROB 4HHJA 2HKEA 4O3OA 2Y8YA 4KJIA 2DNKA 3W9IA 4N76A 2UVVA 2V4RA 4PPDA 5G4DA 3QSIA 2EVZA 2RF2A 4PPZA 3LGNA 4WP3A 3W1YC 1BWVA 3S8SA 3AOAA 4ZDNA 2VKZG 2HFOA 3GONA 2V6AA 2VH7A 2VJUA 1UFWA 3M2UB 4ZCLA 3CJKA 3UO0A 3DLGA 3X3UA 4ZHRA 1S1WB 1RYSA 4C11A 2HW3A 3BGFA 3ILLA 3GJSB 3JSRA 3ZTRA 4J9KA 2R8HA 1RT4B 2I1RA 4O3QA 2HNZA 3G4SS 3CO9A 4MK9A 2DGQA 2VBZA 4ZIWA 1HBMA 1HI0P 3B4DA 3MMCA 4NRTA 4K2JA 6FD1A 2CQ4A 1S97A 2GW8A 2VOOA 5G0RA 4CRJA 4AT1B 2LP4A 3ZFVA 2A6OA 5ETQA 4IG0A 5D4OA 2XQCA 1YJNS 2DGXA 2HNYA 4G1QB 4DG1A 5H9FK 2WVDA 2OSRA 2B6AB 2GMHA 3Q8UA 2IAJA 1U0SA 4KHPF 1FE0A 5HMXA 2BE2A 2PE8A 4QW9A 1RABB 2I0XA 4CTAB 3DDIA 5KFZA 3I9ZA 4M5NA 3HSZA 3W8GA 4ECRA 1HLWA 1PC4A 1UW4A 1HW9A 2COLA 1OY9A 1WOOA 3GB0A 4FKXA 5C25A 3KJFB 5HANA 2WONA 4E2FB 4WFYA 4DSLA 1IKVA 4Y2AA 3TA2A 2CZVC 4OJ1A 1FRHA 5HJYA 3CCRS 3H2UB 3M32B 1V3RA 3FSYA 1U2FA 1IBCB 3D5MA 2WB1D 1TL5A 1RT7B 2G1HA 3AD7C 1HKAA 3DRXA 3MM7B 3ZTQA 4ZPTR 4PXCA 3TZXA 3MUVP 2JLGA 1M5SA 3OT9A 2M2BA 5JVGQ 1N6QA 2NPFA 4IRDA 3K5PA 1Q5YA 2HZAA 3D4JA 2KVIA 4M95A 2O67A 4X4VA 2WVFA 4O0NA 4D3HA 4CWBA 1U02A 1ZM2A 5A0YB 1D9AA 2V68A 4WZMA 1T3OA 2LECA 2QSFA 3IXQA 4DX6A 2D3ZA 3N9UC 4MK8A 4IQXA 3I0RA 2FHJA 4FYXB 4N7TA 1RHQB 3MM8B 5D0EA 1MLAA 2J7KA 4B3MF 2DNHA 1F2GA 3O2IA 2HIYA 1RAGB 1RXOB 3DRSB 4EFAC 1QTNB 2C2ZB 2QFIA 3TR5A 5I4MA 2XO6A 5J2NA 4DQPA 1T02A 2AX1A 5A8RA 2XLKA 3QWUA 4HI1A 3AOBA 3KK1A 2ZJQQ 3DMJA 2DHSA 2XGPA 4I2PA 3BSNA 4ID5A 1SUQA 3W5ZA 1T9WA 3H42A 5HSPA 4NI2B 2OHDA 1VBKA 2Y1IA 4KB7A 3TP2A 2B56A 1MU2A 2JVOA 2QJ3A 3LP0B 2W4DA 4QU6A 2CQ3A 2JSXA 2JLFA 4JB8B 1KVKA 3NL0A 3MEDB 3QGPA 4G1PA 4U6PA 1Y5NB 4CT8A 1Q53A 3PKYA 1NKEA 3CULA 3MAAB 2ZH1A 5KFJA 3VALA 2DVIA 3ISNC 2HYIB 3JAMY 3FZ2A 1H0HB 1WC0A 3CO0P 3LQVA 4ZITA 3I55S 1N5YB 3D6FB 4ECQA 2DXEA 4R5PA 3BO4A 2R8JA 1QM9A 2CQ0A 3CIZA 1WEZA 2E1RA 2MLYA 3VCDA 1MNEA 1UA0A 1S6PB 4KKOB 1KD1T 1TKZB 2E5GA 4RBTA 2FJXA 2JEFA 2HFZA 3VAHA 1S59A 4IFYB 1VQYA 1B99A 1JJ4A 1SI9A 1T11A 2GA7A 3IWLA 4UF4A 5EWGA 1IJFB 3OXFA 3T5HA 1EB0A 3DLGB 4JI8J 4UY8T 2CZ4A 2NUUG 2IDLA 2VPZB 3BN7A 4ZVEA 3U1NA 4LVNP 3T1HF 1E6YB 2B8PA 3QIDA 5KFAA 3H4BA 2C28A 1S7IA 3I5BA 1QAIA 1RAFB 1UVJA 4ZLJA 1WUUA 2JJ4D 2RS2A 3PO5A 1T05B 3MF5A 2YKAA 3K5MA 3MHYA 5EX0A 4CO4A 1D9FA 2HVIA 3MEEA 4NZ7A 1J5OA 1HD1A 3VVTA 4D3GA 1KVJA 1N5SA 4NASA 4DV6F 1XK8A 3TZWA 2GGPB 2WOMB 4CCHA 1KTVA 4Z2XA 2JHEA 1S49A 3V81B 1OO0B 1PYOB 2NZ4A 1ZZFA 4URGA 1REGX 1S6PA 2HWTA 1YX2A 4KKOA 3NGDA 3ULHA 3QSYB 3NAIA 4CIOA 4TLQA 2VD3A 4F4AA 3BBCA 4JI7F 5HBMB 1TL1A 4JI6J 3IAS9 1HBOA 4HH0A 5E3PA 1U45A 3TJ9A 1RWXB 2GJIA 4ETZA 5KFHA 2ZH8A 4UTGA 3TYTA 4ER8A 2ZZNA 3PACA 5HMWA 4LRAA 4TLRA 3D67A 1CJVA 1NDKA 4ZLPA 2V63A 1U4BA 3OLBA 4A8YA 2C22A 1D9DA 1U8SA 3OW2R 1N8RT 3K5NA 3SEOA 4KR0B 4YFUA 5H9EJ 3HI9A 5GADI 2MTLA 1FD8A 2KI2A 1VDHA 3UE2A 4EBDA 4B3TF 4F8RA 3GIJA 2PIIA 2KXHA 3HZGA 2ZKTA 3KLIA 3KWMA 4ITSA 3DNCA 4DR2F 2KM8B 1C0TA 3P49B 4LR8A 2ADCA 1GAOA 4XIUA 3IFEA 2R7RA 3LH2S 2XO7A 1WDTA 2DBBA 1NDLA 3L7OA 3MECA 1CBKA 4BCAA 2HHSA 1HWLA 1U7LA 2JVRA 1HNIB 1VGYA 1Y3JA 2VA2A 3FRYA 1LXJA 4CO5A 1Y9OA 3V6KA 1F9HA 2HFVA 2LU1A 2XI2A 4V1Ak 2Q66A 4OI2A 3DGPA 5HAOA 3K2YA 2CPYA 5GAGU 2DJWA 3KXDA 1RTIA 3CCJS 2JH3A 4NOHA 1W2BR 4P74A 4DN0A 3S1TA 4F4YA 2BJ9A 4OI6A 4EWTA 1A6LA 4LIRA 4QIFA 1WDDA 3TUPA 1LWFB 2GHPA 3IS9B 3I6PA 5B0AA 1ZZNA 3GCXP 1VLOA 1Y3KA 4I1TA 3DLKA 4WU3A 2YXLA 1JQGA 3EVMA 2HMIA 3GCWP 3MM9B 4TQRA 1YRTA 3NS7B 3FFIB 3UDEA 5DDQC 2VONA 3DC2A 2XMMA 2YQ3A 3U7JA 9ATCB 3PYEA 5F8IA 2ZJRQ 5A76A 3DLEB 1C0TB 3EUNA 2DR8A 1CC7A 4N77A 4WXOA 1VRQC 4C3LA 2VBXA 4K2XA 3TAMB 1NB7A 4LF9F 3HJFA 4QCLA 4X2BA 3V6HA 3JTPA 2E1CA 1RLDA 4DUYJ 1YQHA 2BOPA 5DGBA 1YLXA 3MMCB 2RRBA 2DXFA 5HJXA 4MAKA 1XC9A 5L1KA 3OFEA 1FJGJ 3A12A 4KBIA 2M7SA 3GE9A 2PA8D 5ETKA 1S6OA 2QYGA 4B3TJ 4GKKJ 2PMWA 5L39A 3W62A 4J9OA 5D3GB 2P9CA 2HGNA 1N5TA 2JL9A 3NGKA 3O44A 3CCVS 5E3QA 3CJSA 3PVXA 5HK4A 1UPPA 2RDIA 1HHSA 1VC0A 3AXKA 2YKQA 1QSYA 2LKZA 4DSJA 3X1LB 2W24A 2X3GA 2MPUA 3GIRA 4OYOA
chains in the Genus database with same CATH topology
1QJHA 2XMVA 3JYTA 4ZS6A 1D8ZA 1C1BB 2IHR1 2FLLA 4OIXA 3SI8A 3CD7A 3M6UA 4K4SA 3VQTA 1RTDB 4L3NA 2VZ9A 3GV5B 1S76D 4ED6A 5LT5A 3VAFA 3HVTB 1REVA 1IQZA 5KG1A 1RT2A 5E5NA 4CNZA 3SCKE 3QZ8A 1WG4A 3V81A 2BUNA 2RKIB 4ECXA 2MSSA 1X4BA 3OFFA 3CDWA 3SSRA 2A1BA 2DR9A 3BO3A 3AJ2A 4M5DA 1GNKA 1NHUA 1WD6A 4I6WA 2XSJA 5LMUF 2XI3A 4HI2A 4ZVFA 4I4BA 4ECUA 1J2VA 3QPIA 4ZKAA 4X4QA 1ZETA 4HH1A 1BGXT 3BZQA 4N47A 4WFXA 3W2WA 5THWA 2IC3A 4AL5A 4BBYA 5B0GA 2PGCA 2XNRA 1WHVA 2QMWA 1IKWA 2BM0A 2XEXA 4FNIA 3VZHA 3N28A 3PKMA 4LMZA 2FHKA 4DL0C 3AB4B 3P5TL 3BM7A 1HWKA 3B8HA 3CDEA 3FEYB 2MMYA 1R8AA 3VAJA 5EUHA 4LIWA 4WYWA 2KZMA 1P6TA 3BGRB 1RT4A 5KFMA 3KMQA 3L7PA 3TO8A 3IRWP 3UCGA 4DOZA 4DQRA 2GIQA 3TA1A 2W9BB 1CLFA 2CIMA 4NLYA 5ITHA 3GIKA 1JLEA 3PV8A 5HLFB 4NCAA 5I3UB 4F50A 1HQUB 1MMDA 2DNQA 2HWHA 4RU9A 1KQSR 1JNZB 5KFVA 3BJYA 2FHOB 2LDYA 3K58A 4OHVA 2WTFA 2O01C 2D3OR 4N8NA 1GXUA 3G9CA 2W9CA 2IC3B 1ZTWA 2QA1A 2KFZA 2QSWA 4ZK7M 5DM6Q 2W9AA 4FF3A 1RTJB 3FFIA 1BLUA 4BWJA 3T5KA 1FJCA 2LQJA 2QLXA 3VF0B 3PR5B 1JXEA 3QJPA 2ZD1B 4B08A 4C0HA 2ZH7A 2JFDA 4GO7X 4PKDB 4DR6F 3DHXA 2L3MA 3MM7A 4X4OA 4FF1A 3GWCA 4O3RA 2NUHA 4QIEA 3SCJE 2EFVA 2ZBIA 5IM0A 4JI8F 3DI6B 3C6UA 2YVSA 2OTJS 4FZVA 1VOMA 4JUZA 3PX0A 4KHMA 3WDOA 5JJBA 1RDRA 1URNA 4ES1A 1NK0A 1NJXA 1M90T 1FKPB 2RF2B 3PJXA 4EU0A 3POTB 3SYZA 4K59A 3H5UA 2E9RX 4NLTA 1S9GA 4IOAQ 1U2RA 4DFJA 1QSSA 2J9CA 1QLNA 3VAIA 4ECTA 1S1TB 2YWEA 2B4PA 3NCRA 2BDPA 4DQQA 4LF4F 1RT5A 3MR5A 3LP1B 3QZ7A 1X7VA 1EP4A 3LAKA 4LF6F 4XDCA 2UUBF 3CJ5A 2VFSA 2KDOA 5KG0A 5EX3A 1RQ0A 2RNEA 1XNRF 2DHGA 4QU7A 4C4WA 2HZCA 1H7WA 5KFUA 3GILA 4DSFA 2FGCA 5L9NA 2JEGA 2X1GA 4Y34A 2IRUA 2VG7A 3NWGA 3HXMA 1KSPA 2DGTA 2FLNA 4FVMA 5DO2A 5F0WA 1YJ9S 2FDNA 2N4DA 1FTRA 4E98A 2NSBA 2V8VA 1S9GB 2N3OA 2UUAF 1TAUA 5AXLA 4CQ1A 2O5DA 3QO9B 3HX9A 4I56A 3SSQA 4WE1B 2DR7A 1KLMB 5C5JA 1WG5A 3TOQA 4G6VB 2ASYA 4OHZA 2I8EA 3R1HA 1TL3A 1E6VA 3WC0A 2HMIB 2NREA 2BANB 4NPOA 4B9MA 2KT2A 2BR0A 5KFBA 2GQQA 2ZH5A 3M1VA 1IUJA 1QUPA 3DLEA 1L3TA 3NBPB 3E8OA 4QOTA 1N56A 2MKSA 2IA6A 3NMAA 1JLAB 4B9SA 2NR0A 5D78A 1MWZA 4RW9A 3U02A 3M4XA 1U1OA 2MHEA 3KLVA 5FDLB 3H5YA 1X0PA 3CDAA 5IFMA 1N33F 1JLEB 2DNZA 2IMOA 2OPQA 3VTIA 1FXDA 1LWCA 2HS3A 2MHNA 1Q8BA 2RE1A 1UAWA 2ZOMA 2OD4A 3RB3A 4GO5X 4NXMF 4U67Q 2VC1A 1L3SA 2JFKA 3IR5B 3UDLA 4PUOB 1I1GA 2VOPA 3CMES 4ELUA 4DUYF 1N5VA 1WF2A 2Q1LA 3KJVA 5KFXA 3D1HA 1E6VB 3T6BA 4AQYF 4ID8A 1C1BA 3MEGB 1NK7A 4C2MA 3CCSS 1NHVA 5D4PA 3CF5Q 1IKYB 4QYZJ 2E1AA 3P6YC 2XG8A 4FBUA 4OX7A 1P8GA 3HFKA 3HVTA 2X1FA 3MMAA 5GMKa 1GTEA 4CO2A 2AJFE 5E41A 2JDJA 4NLUA 3LWMA 4JI3F 3F56A 2EI5A 4TKTA 1RTIB 2GO9A 4X84A 4WFNQ 3KFWX 4OX9F 3G96A 5LJ5Y 1QE1B 1FERA 4DR3F 2B43A 2VA3A 3H40A 1LWFA 2QV6A 3IS9A 2AF6A 2Q43A 1ZAXA 5IT0A 1F60B 2XS7A 4A8XA 2IYGA 2IVYA 5HMZA 2QA4G 3I0SB 3HVRA 2E9TA 1FNXH 2AYMA 4X64F 2ATLA 5C25B 3HHNB 2KT3A 1TKXA 3HKWA 1O0PA 4KFBB 4FS2A 5KT6A 5AXKA 1G3OA 1MMNA 1KN6A 1HNVA 3HDSA 4B9UA 2PEHA 5F41A 3MR3A 2B51A 3MOJB 4B3SF 1HI1A 2MB0B 1SV5A 2G9OA 2XBPA 4Y2MA 5LSLA 1IKXA 4YB5A 2ZHBA 1CPZA 1U1PA 1N48A 3NKYA 1TL1B 2ZNZA 4NCGA 3T5LA 5L1LA 1NH7A 3CPWR 4DS5A 4O4GB 5KG7A 4DF4A 5BYSA 4NYOA 5GAGI 1CVJA 4OZLA 4V19J 1K1SA 4PG5A 3BF4A 1GXLA 3JSYA 4YR3A 5M2PA 2NQPA 1VI7A 4Z37A 3HK2A 2IJFA 1RTDA 2MJNA 2WB4A 3CTRA 4CH0S 2FVSA 2DPJA 4DFMA 3LALA 1WF1A 2AJ0A 3CC4S 1Q16B 1NO8A 2D1CA 1RT2B 3S01A 4K4UA 3NAHA 3LF0A 4I64A 4R0EA 3C6TA 4KIAA 1NKCA 2Y0SD 4OQJA 2G13A 1L3UA 5F8HA 4K4TA 1TK8A 2ASLA 1HMVA 2KG0A 1YSJA 3O5TB 3C6UB 2P5VA 1VRTB 1NJIT 1VHFA 2CVEA 4B3OA 2V4JA 2JEIA 4PXBA 3LUYA 2C3YA 2OPPB 1R8PA 2QMXA 3V4MA 2XLJA 2YNHB 2D9PA 2LQ9A 1Q4RA 1RKIA 3KG4A 4TNOA 2AYEA 2P6TA 2R8IA 2A2DA 3DDKA 3IR7B 5ADZA 2FB0A 1W25A 1RP5A 1U49A 4IR9A 3MI7X 4RU2A 4ZPAA 5BR8F 1DFDA 1LKZA 4O4RA 3DXSX 2MSTA 1S9FA 2VC0A 3SXLA 1YJUA 3MM6A 2DB1A 3SQGA 1FK9A 1WHYA 3MWBA 4QWEA 1U48A 3QYYA 2W9BA 4NLGA 1VQ7S 1PSDA 3PW7A 1S79A 2CJAA 2EG1A 2XMUA 6FDRA 3IAM9 4ZPVR 3CCES 2DITA 2Y1RI 2KO1A 1RYRA 2OLWA 2R7OA 1GTHA 2LMIA 4ED8A 5F8LA 1B0PA 1UFLA 2YNIB 1NJWA 3KK1B 1PO6A 1X4GA 4KPYA 3R3TA 2KJVA 2KG1A 2CJ9A 2AX0A 4ZHRB 4YHHF 1K9MT 5IQQA 4NA2A 1J5EF 2HS0A 2O1PA 5HP1B 2CPDA 4KT0C 2HNDA 4TU9A 1IQTA 3VR1A 1QSLA 3NMRA 2ZOGA 4AUKA 2GQCA 1XMQF 2UU9F 3EGWB 3PIOQ 3G8SA 2ZH3A 1RA7A 3FMBA 2M8HA 4M5DB 5I3PA 4RNNA 3Q8SB 3IGNA 2ASDA 2ALZA 1VQ8S 2ILZA 3LP2A 1SC6A 3MMJA 4DSEA 4RW9B 2U2FA 3IWNC 3BS9A 1HWUA 2LCWA 1BWEA 4EZ6A 3I9V9 2YWKA 2GNKA 1FHTA 1APSA 3MOZA 4LSNB 3UI3A 2E5HA 1Z4UA 4PWDA 4DV4F 2DNPA 1U6BA 1FVQA 1UEUA 4A46A 4C8NA 1LWEB 3KG0A 4GKKF 3TA0A 2C3OA 2XWYA 3HHLA 2YNGA 3DHWC 2GHWA 4DFKA 2A10A 2QZ8A 1IBKF 5CZXA 2OH2A 1JLGA 2P9GA 1KFDA 3CCTA 3CB4A 4LQ9A 4PXDA 3I4PA 2WAQD 2PO4A 2R7WA 3HF5A 3MPYA 1Y7PA 2HVZA 2HWIA 2V4JB 4HEA9 5KG5A 3MPWA 2G0CA 1GXTA 2NYIA 3N6MA 2MGZB 3DRYA 1MROA 3CXCR 5KFOA 3GIMA 1XNQF 3PW5A 3ZZTA 2C3PA 3QAEA 1YBAA 2VFRA 4OJGA 1N5QA 5LSOA 4OJ3A 4WTYA 4TY8B 1KHVA 3WC2A 5K14A 2RIJA 2YKNA 1SH2A 1FNOA 3BR9A 1XTZA 3LP0A 4P7VA 2X1AA 2VQEF 1FK9B 3CJ3A 2FJDB 5I3QA 3THVA 3M05A 4OHYA 4WK3A 4CZCA 4X4UA 3AQOA 1KEKA 3LAMA 2IA0A 1I6JA 4QWBA 3KHHA 2ZVSA 1MW7A 2B9XA 1RTHA 2CQCA 2F8EX 1HWJA 1SH3A 2CQBA 3FVYA 4XK8C 3UNGC 1U1MA 3GFZA 5DETA 1HBNA 1C4CA 1X4HA 4PWUA 3TUIC 1HNIA 4MFBA 3T6JA 1B7FA 3KLHB 1CG2A 1JK9B 1JLCB 1Z1ZA 2IVMA 3K5LA 4DR7F 3MEKA 1ZBTA 2VPWB 4DV7F 1P27B 1G2EA 2CQDA 5IT9Y 1ZM3A 2XSJB 4ES2A 1UETA 3T1AA 5AXMA 2B7BB 1DLOA 1BD6A 1YG0A 2DK2A 3HPOA 4QQBA 2ABYA 2LXUA 1S1UA 2WBMA 4PG7A 1S1XB 3FJ2A 1KOHA 2EG2A 2HNDB 2YNIA 3DCAA 3I87A 4ED5A 1GX5A 3FCHA 2KYXA 2DGWA 3ENQA 3D2WA 2LDIA 1U09A 3L95X 3UFCX 5IZHA 5C42A 1RK8A 2DHAA 1WF0A 3RAXA 3LGMA 2DNYA 4F4WA 3TAMA 3KMSA 1HBNB 1KLNA 4F3MA 3UD3P 2YH0A 2LYVA 2V8GA 2YWGA 4PG4A 2LA6A 3ENVA 3CCZA 3MMBA 2KM8C 3FEZA 1HBOB 1B0VA 4RX6A 2EPIA 1TZ0A 7FD1A 3RB0A 4OZ0A 2OPPA 5C24A 5KFNA 2E29A 1UP1A 4OLPA 3QAUA 2YX7A 3IA0A 4MK7A 2RQ4A 2P6SA 4UUWA 2KYZA 1UKUA 2AP6A 3WBZA 2MZRA 4H54A 4I67A 3PHEA 4NYZA 3KNAA 2W25A 1T95A 1AW0A 3FQKA 2FHMA 2MZTA 4IQMA 5KT3A 3Q2TC 3CJKB 5G0RB 1M5VC 3G8TA 2DT9A 2FJAB 3DI6A 2KXNB 2BA9A 2MQMA 4QZVB 1VC6A 2K3IA 3DRRB 4IDKA 4Y65A 1JLBA 2C42A 3GZ7A 2XHWA 4NYPA 4CI0B 4JI4F 2AJQA 3J7YI 2ZC3A 4RBVA 2CPFA 1M5OC 2E7XA 3MMBB 4XO0A 4WFBQ 5DQHA 3BSCA 1F0XA 1SIWB 4I69A 4IFYA 2ZH9A 1FKAF 2VL1A 1LW0B 4KTQA 3D0IE 2E5IA 3JTOA 2MDAA 1DQAA 1GX6A 2CQHA 4HLBA 1QVGR 4QBUA 3PM9A 1OS5A 4WCEQ 4ZP6A 2HHWA 2VQFF 1TV6B 1R6YA 1UA1A 1R43A 2J8AA 1TR0A 3RTVA 3SFGA 2CFXA 1WNEA 1T05A 7FDRA 1JKHB 3D0GE 3F44A 4J9NA 1IKYA 2JLEA 3H2VE 2DNMA 3T3FA 2M3DA 2X51A 2ZHAA 1T7PA 3TARA 5HL7Q 1N0UA 3IR6B 3DFEA 5CCLA 1N36F 3M9NB 3DM2A 4NLDA 2WHOA 3M6WA 2HLTA 2OPRB 2CQ2A 2GFFA 1VQSA 2LXIA 2YTCA 1VRTA 2HLUA 1HQEA 3EX7B 4RW6A 2PSZA 4E8UA 4CH1A 3CC2S 1Q81T 2AYGA 2DNGA 3BQ0A 3OUYA 2JRSA 3DOMA 1N34F 2M5YA 4LVOP 4MJKA 3BSOA 4HT7A 4WF9Q 1S0NA 1K8AT 1VQNS 4R0JA 3G71S 3W2VA 1Y4ZB 1QTMA 2ZITA 4HVZA 4TU8A 1S99A 3R27A 1I94F 1OPIA 3E01A 4I7FB 4JBCA 2UUWA 1LV5A 3N5FA 2PN6A 3HVWA 3MM6B 2IYIA 3FEXB 4ES3A 3FDSA 1UJ4A 3N4WA 3AH6A 1XN9A 1R8CA 3NS6A 1VQ6S 2HG4A 4EYHB 3CCMS 2SXLA 2FTRA 5DLGA 4NCGB 4AFFA 4M63A 1KTQA