5LL6d

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
b'SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTGKRLAKKVARRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
molecule tags Ribosome
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
total genus 28
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ll6d00
3JAMY 3J80Y 5A2QY 5FLXY 5LL6d 3J7A1 5IT9Y 3J81Y
chains in the Genus database with same CATH superfamily
2RKIB 3PW0A 5GADU 2PI5A 2MQPA 1RHUB 3VAIA 2AGPA 1IBMF 4X66F 4DR7J 2DHSA 1GH8A 2QYGA 4H54A 2NYIA 2KVQE 2DKOB 2EFQA 2KT5A 3WQPA 2D1CA 2AGQA 4I2PA 3PX4A 4X84A 3CCQS 5ETOA 1HNXJ 1XWLA 3H25A 4DV2J 4DV4F 1RDRA 2OPRB 5GMKa 1N5YB 4F67A 2A10A 1ZAXA 1CJTB 1S1WA 1Z2LA 3MTJA 4C98A 5HN0A 1YI2S 5F8MA 2K2PA 2W9AA 2HGNA 2B4PA 2OELA 4IH5A 1TK0A 3QIDA 3P3DA 3DLEA 2AWZA 2WONB 3FEXB 1S6PA 4OI2A 4ZVUB 2ZDPA 2C42A 4JI6F 5A8KB 5SZTA 3CXCR 2OPQB 3U27A 1PYSB 1FDAA 1CQMA 5G0RB 2EKNA 2H9ZA 4FN5A 4DL0C 4ZLPA 1YJWS 2VA3A 3AXKA 1HKAA 3GSIA 2FVQA 5D4NA 2E7WA 2ZC3A 4M8LA 3UR3C 5J2MA 4NLWA 2IIHA 4RBVA 4RNHA 3CW2C 1RWUA 2VBZA 3BF4A 5A8WB 1T9TA 4LT6A 2OMOA 5F8LA 1F1BB 4ECWA 5IFMA 1BQNA 4ECRA 5E3AA 3P49B 4RUAA 2RJZA 2ALYB 3R97A 4J9MA 3JSYA 2MQMA 4TYBA 3KUHA 5K8PA 2KTQA 1FNOA 5HATA 4MKYA 3JSRA 5CAAA 1I6JA 4K4ZA 1XMQJ 1NJZA 1H72C 2HEKA 5A6WA 3ZNUA 5IV3A 5E41A 3OXFA 3VGSA 3F44A 1JJ2R 2ADCA 3DOMA 1Y5NB 3UW1A 1Q5VA 1JWWA 3G9CA 4MYUA 1VRQC 4YY3F 4RW7A 1LOUA 2VFTA 3DOKB 1KWMA 2DEJA 3AJDA 2AGOA 4NLUA 1FHTA 1NK4A 4F8RA 1GMVA 1NDPA 2LCWA 3MPUB 4GVBA 4KB7A 5AT1B 4KT0C 2YNFA 4DI6A 3G6ES 1BHNA 5DDOC 5EWFA 1B3TA 2G13A 1HW8A 1U1OA 3D0GE 5HMWA 2UXDJ 2C2NA 5GAHI 1K44A 2DNPA 1UEUA 3DI6A 4QIFA 4ZS6A 4PR6A 3ZZPA 4HACA 4L76A 2J9DE 2DNGA 3DOMB 4H4KC 1UVJA 3WIUA 1HA1A 3ZZRA 5I42B 3HFKA 1QUVA 1SQFA 3MM8A 4K4WA 2CZ9A 3S01A 3T6JA 1X5OA 2CQBA 4OYBA 4WJBA 3UI3A 4NCBA 3EXCX 4GMKA 2X3GA 4KO0A 5HO4A 3MTKA 2XTJP 2VZ9A 5C2CA 2VPZB 5EGYA 1WD6A 2NQPA 5IWAJ 2G9OA 4I1TA 3Q22A 3I32A 3B4MA 2ZOFA 4USUA 1TL4A 5GADI 3FRZA 2XZTB 1OYEA 1RQ0A 2G2ZA 2NUHA 1K73T 4ECYA 2BA9A 3TJAA 3OR1B 2V68A 4RW9B 4J9LA 5IOLA 3D5MA 4MIWA 1PGZA 2FD2A 3N4WA 4OHVA 3W5YA 2DNOA 3FEZA 4FVCA 4HDHA 5I3UB 3F73A 1SL1A 2UUAJ 3D0HE 4DPXA 3N6LA 4QBUA 4JI3J 1KLMB 2ATLA 3VAFA 1S4FA 3EGNA 1HL6A 4DUYF 4DL6A 4TYAA 4NLSA 3POTB 4ILRA 2JHEA 1NXIA 3SQGA 3GFXA 3HSDA 3DRXA 1BUXA 3KHHA 4OL8A 1XQIA 4QCLA 3SIPB 1FD8A 4DL3A 3R1LA 1KNZA 1Q78A 4HEA9 1YJUA 3PR4A 2YKMB 1K1SA 3H8YA 2RVJA 4WF9Q 5JXSA 2GQCA 1PYOB 1SKUB 5ETSA 4IRCA 1NH8A 4YN3B 4ZLNA 4DPOA 5KFFA 2JFDA 2VQEJ 1YK9A 2X1AA 3AD7C 1ITPA 2FGOA 4MIBA 1WF2A 1V3SA 4NXNJ 2IPOB 2ZUGA 3Q8UA 4N7TA 4OX9F 1RWPB 1V3ZA 2DY1A 2C3PA 2AP6A 2FC9A 2CNLB 3S6EA 1FE0A 5LSOA 5BYQA 5CCMA 8RUCA 1L3KA 1U6ZA 2MZJA 1QSLA 4UOGA 1D9FA 2B5JA 5MAOA 2H54B 4LIWA 3S1TA 4YR0A 2EC0A 1FKOB 1S72S 3PHEA 3D6MB 3HHKA 3I56S 4L72B 3M8ZA 2V2VA 4R0JA 2BUNA 2CQIA 3DLGA 4RUCA 4ZP7A 3TOQA 4G1IA 2R3VA 2JL9A 1L3VA 1YBAA 1GXTA 2ZNZA 4F36A 1NJIT 1QAIA 1RT4A 3AQPA 2AV5A 1CLFA 1U0HB 3HSGA 2WSFC 3K57A 3W9JA 4DV6J 4CWBA 1SQGA 2R8HA 2D9PA 4IFYA 3M6WA 5EWGA 2BJ3A 2QL9B 2W7AA 3LPYA 1WUUA 3NGTA 5E0OA 2RU9A 2ZHBA 2VPWB 2EBGA 2I5JA 2OPSA 1BQMB 3B54A 4ZCIA 4O0IA 4TY8B 3NBPB 5DZ7A 4DCJB 4DL4A 4B02A 2J0SD 3CCMS 5C25A 4KHRA 1HMVA 1HQ2A 1R8CA 1TL7A 2ACYA 4PG7A 4Y0FA 3NGDA 3Q2TC 2VPYB 2AHOB 5M2UA 1OSCA 5CCLA 2VUGA 1SB6A 4FBTA 2VB6A 2V0NA 1WI8A 5L38A 4CLKA 4DX5A 1N33F 2PFFB 4ELUA 3HZEA 5C2GA 1WDTA 1YZ6A 2E1PA 2X1GA 2PSZA 4KFBB 2GA7A 1T11A 3DFEA 1RWVB 2VF3A 5A8WA 4J9QA 3R6GB 4L6V3 4PXCA 5IM0A 1V5VA 3DXBA 4CYUB 4LF9J 1VRTB 3SSQA 1S10A 1NDLA 1NSPA 1K0TA 2MLYA 4B3RJ 2MKHA 3BYPA 5KT2A 1P1LA 5KT6A 3UO0A 4DV1F 1Q8KA 2FJEB 2F8EX 4NRTA 3PY8A 2HQIA 4X66J 2ZH1A 1CG2A 1ZTTA 4IRDA 1YJVA 3CWJA 4WFYA 4GO7X 1UW4A 2H1YA 1DTQB 1F60B 1PJ5A 3R6LB 5L39A 3VAKA 1VHIA 3CB4A 3NCQA 1GNKA 4IDKA 4QWEA 1GMWD 2B7BB 1RT1B 2E1RA 4MTPA 5J1NA 2RRBA 4FNHA 2AJFE 4C97A 2IVYA 3QJPA 2MKKA 4WFAQ 4USKA 3T1AA 5LSLA 1VBZA 2MJUA 2XQCA 4E0DA 5CABA 4QIWD 1TMJA 4F0KA 1X4DA 1NKBA 1C1CA 2KKHA 4P75A 3NWGA 4UT4A 3RRHA 2AEMA 1VS3A 1S1VB 3FZ2A 1OWXA 2G0IA 3MECA 3JSMA 4OZNA 2HZCA 2Z4PA 4EWTA 3A13A 4NLGA 3BJYA 2HHVA 3IM9A 3FJ2A 2V67A 3D54A 4O4GA 3D1QA 4PYAA 4A46A 4QWBA 4ZLLA 3BREA 3I5BA 1IUJA 4ZPCA 1C0TA 2OGUA 3MEKA 3MR7A 4XIUA 3OR2B 4ZVEA 3JQJA 3PZPA 3R2CJ 1F5AA 5HP1A 3JYTA 2KL8A 1YBUA 1YTYA 4B9UA 2NSBA 5HBMA 3VQTA 2L41A 4B3RF 2UVVA 2XMMA 4RUBA 1G1XA 3BV8A 2BV3A 3CSKA 2VA2A 1HBUA 2F63A 4OYIA 4AT1B 1J2VA 2OTLS 2OFHX 3NOCA 1O6XA 4WP3A 4B3SF 2I9SA 1NBEB 3KK2B 4DQSA 2UXBJ 2KT3A 1RTHB 3C16B 2QLBB 4Y2IA 4PUOB 2MGZB 3TW0A 1S9EA 1WHVA 4CO0A 3UQSA 1B7FA 5HMZA 1FD2A 3TAPA 1A9NB 2JVRA 2DGQA 4WPAA 3GCWP 1LEOA 4I2QA 1NZ8A 3CD6S 2VBXA 4ANDA 1AFJA 1C4AA 2I0XA 5DGAA 4R5PB 1I94F 3LUYA 4DPWA 1TAUA 1REVA 2Y0BB 1RCOB 3MPVA 2XLJA 2MLZA 3CJTA 2Y0SD 3ITHA 5DS7A 2CQ1A 3HHDA 4XTTA 3F0NA 3UDVA 2QA1A 1NU4A 2ZDOA 4B9TA 2A18A 1LFWA 3D1HA 3GR1A 1N6QA 3KK2A 4RNNA 2CQPA 2H5IB 4USJC 4DFJA 2J7UA 1VHFA 2QLXA 3JSBA 4PYDA 3ZTSA 3CDWA 5D77A 4OX8A 1NZAA 1WKLA 3O1LA 4ZCKA 1Y3JA 3A12A 4DQQA 2DIUA 2O67A 1Q81T 3ISZA 5CYQB 1UPPA 3R3TA 1IKVA 5KAKA 2BJDA 1F9HA 5K20B 3O6QA 4F7VA 1NHKL 2LA6A 1IKWA 3CDEA 1WI6A 2X1BA 4PWDA 4QWDA 3PFOA 5IV4A 1S5ZA 2JC1A 1U2CA 3X1LB 2CADA 1AUSL 4ZLJA 5L9NA 3GIRA 2HVHA 1DTTA 1O51A 3Q8YA 1NJWA 4JI7J 1F0XA 3HMJG 1TKDA 3KUGA 1PSDA 4B3SJ 3R5BA 1RAHB 2MXYA 1C1CB 3H4BA 3MWBA 4I6AA 4WP9A 3TP2A 4OJ3A 4IG0B 4A8SA 1H73A 3N6MA 4CNYA 2G4BA 1KQFB 5IT0A 4FXDA 4ZVQB 2HW3A 4ES2A 1NB2A 4I4BA 3GYNA 3TVYA 3MEDA 4NXNF 4DSKA 2Y8WA 3TZYA 3ZTPA 1JLEB 2AJ1A 2RHQB 3NKYA 1T9WA 3W63A 4NLRA 4O3OA 3ZZUA 2BANB 2WB1D 3SDEB 1L3SA 3I87A 4RU2A 1N32J 1VMBA 3OD2A 3K5MA 5F8HA 2IRYA 2M0GB 2LXUA 2YPYA 1H98A 3BH7B 3NXZA 3PIPQ 4NA1A 3MCOA 4GKJF 3ZXWA 1WOPA 2FB0A 3NGSA 4EGLA 2R8IA 5LMNF 4YS2A 2H5JB 5DETA 2NUUG 2HBRB 5D4OA 3NGUA 5L1JA 4WU2A 3GJSB 2DR7A 2VBWA 5J2NB 2E29A 1BWEA 3SMZA 1SC4B 1WG1A 2DIVA 1HYSB 5B0GA 1NEEA 3DLJA 3ET6A 2YNHA 2BANA 1TUWA 3K5PA 3SDEA 3T19A 5EN1A 3BM7A 1UEVA 4DFKA 1RHMB 5KG3A 1VIXA 2IM2A 4P72A 3IXQA 2DNRA 2DT9A 3IN5A 3G87A 3WBZA 4JI6J 3CTRA 3PV8A 1JMTA 1C0UB 2VV5A 3GPAA 1NK7A 1NH7A 1T95A 1R6YA 2DNNA 4ZVGA 3HVWA 1G6BA 1YWXA 1N0UA 2E5GA 1JJ4A 1QUPA 2PIIA 2B5JB 4RNOA 2ZZTA 2BOAA 5CZXA 2CXEA 1TL1A 2HAIA 4QOTA 3PDNA 1KFSA 1FKPB 1T9XA 5AXLA 2KXHA 1KHVA 1SV5A 4I64A 2I5JB 4P52A 5KG6A 2N7CA 4QPXA 3V4IA 4YOEA 3ZZZA 2N82B 1Q79A 3CJ4A 3DGVA 4A4JA 1IBMJ 1M1GA 1FWPA 3JQKA 2CPXA 1JLFA 3QBCA 3I6PA 4DR2F 1PILA 2JJ4D 3K59A 4N56A 2CIMA 5L1LA 3DOKA 3UPFA 2MB0B 1TK5A 3AY0A 1RJJA 4P2XA 1H6KX 4R0EA 5KT5A 1XNRF 5E5NA 4BWJA 1QAYA 3GJRB 1QAJA 2DCUB 2FJAB 3W9IA 1RT5B 2N4DA 4RBTA 2V34A 2BQRA 1Q4RA 5LMNJ 2ZHOA 3M8WA 3OLBA 4UF4A 3PO5A 2J5AA 4JV5J 2A0FB 3BBBA 4X4VA 1S1VA 3MECB 2YKNB 1F2HA 1SJQA 5KFLA 1U09A 4IOAQ 2F5GA 3RR8A 2MHEA 1N5TA 2IVMA 3R9LA 3H5YA 4F4ZA 1OY9A 1B0VA 1RHJB 2QV6A 1TKTA 2WBRA 3PM9A 2MMYA 3DRYA 3PYGA 2OH2A 1WKJA 3V81B 1LV5A 1WACA 3EUNA 4Y65A 1VOMA 1AZSB 2HFZA 2J9CA 3M7VA 4C8MA 3RW7A 4ZIWA 4J9SA 1R8BA 2RILA 2R42A 5G0RA 2F4VJ 5KT3A 4A8FA 2JLEA 4IDKB 1F5BA 3BSCA 2RDDA 4FS1A 1G4CA 3VWSA 2XMUA 3BGUA 3GSDA 4I0WA 3WC2A 3MEDB 7AT1B 2V4QA 1GAOA 2V8VA 3KJVA 3LA0A 3D4JA 4CLLA 3CCSS 4OI0A 4I56A 4NLYA 1WSRA 1S9GB 1Q1KA 4ID5A 4K2JA 2JZ5A 2GO9A 2HQCA 2V9KA 1UZDA 2MHNA 3IBWA 3IM8A 4IH7A 4ZVPB 4J9RA 5I42A 1NK5A 1FWLA 1AFIA 2VFVA 3MDFA 2V8HA 3HFZB 3GIJA 5D0RA 2ASDA 3QRPA 5BYSA 3PACA 4OI4A 3DU6A 3W1YC 4K2XA 5IT9Y 3FNNA 2FLLA 5FDLB 5A76A 2E44A 1VLOA 2FZGB 2QYCA 1TFWA 3NLCA 2DRBA 4C8KA 3MMBB 3PEJA 1C1BA 1LW0B 1FESA 2R2TA 1JXVA 1SI9A 1LW2B 2I1RA 1WF1A 5F8IA 5DQIA 3GB0A 4LBPA 3KJNB 3OTBA 1VQKS 2KB2A 4IG3B 4A8YA 4E98A 1SC3B 3C15A 2QFJA 1KR4A 2YBVA 3DLKB 3OFEA 2PA3A 2VONA 1HI8A 2HIYA 4X4QA 2XWYA 5J1PA 1J5EF 4U7CA 2GHWA 3KNGA 3J7YU 2A2DA 2ABYA 1IR1A 3KKFA 4IFYB 4R5PA 3OL9A 2CPFA 2V50A 1HBMB 3QYYA 2VASA 2Z2LA 4PAAA 5HL7Q 3U1LA 3VVTA 2VG5A 3DRRB 2IRXA 3PG9A 1T02A 5DM6Q 1F3FA 2DNLA 2M4MA 2HWIA 1X7VA 5HLFA 4HTJA 4LF7F 1S9EB 1YG0A 4U8VA 5G4DA 3SCJE 3OLAA 3R5CA 4EK2A 3SV3A 1HYSA 5IS2A 5EDWA 4DR4J 3DLGB 1JLBA 5LSRA 4NYOA 4BHQA 2IBOA 3V4MA 1DRZA 5F41A 1R8PA 1SC6A 4DL2A 1S1XA 3IRXB 1M0SA 1FRKA 2GO8A 2ZH8A 4WWSA 2W4CA 2KM8B 1CC8A 1YBTA 2KU7A 4LRAA 3KLFA 4LF1A 2CPHA 2MY8A 1BQMA 3Q2SC 1WOSA 1FF2A 2MKYA 3MOZA 1N5VA 3CIZA 3RAMA 2EKYA 8ATCB 4P10A 5F9NA 1UETA 4DU7A 3TAQA 2Y1JA 1HNZF 4QU7A 1YKWA 1TKZB 3M8RA 4FP9A 4M1KA 5KFNA 3BO3A 3H2VE 4UOHA 3FEYB 4M5JA 1M5OC 3D3CJ 2J0WA 4LFBJ 1Q95G 2DXDA 5HVHA 2ZKTA 1PC5A 2CUYA 3H7HB 1UTAA 2AX0A 4YY3J 4OZLA 1S0OA 5IXUA 2UVRA 3CGIA 2JC0A 4KGXB 3WHIA 1IWAA 4WIIA 4QYZJ 4UZCA 1NCLA 2DHXA 5ETRA 5EHHA 3O8WA 3KLGA 3HO1A 3UDEA 4USMA 1DTTB 1Y0HA 1OQ6A 2ZEJA 4M5NA 2AJ2A 2J8AA 3GMGA 3W7BA 5ETLA 3CUNA 4KE5A 4RPFA 3H4DA 2BQ3A 2AKWB 3BGRA 2YXLA 3T1YF 5CYQA 2OI2A 1IWGA 4Q2MA 1FJCA 4ZDNA 3L09A 4TY9A 4C8LA 1WTFA 2OD4A 1KQKA 5HQMA 2OEJA 2POKA 1H2UX 3L7PA 1S0NA 4NCGB 4U95A 2E7XA 4OJHA 4ECZA 5D15A 1FDBA 4DL7A 1M5SA 1GMUA 4JI8F 2RH3A 4UUXA 4Q43A 2LKZA 5U47A 2AYBA 2GMHA 2FY8A 2UU9J 1M5KC 4L73A 4CH0S 1NSKL 2FGCA 2G2OA 1EX8A 5K8OA 2CPDA 3AB4B 1LWXA 1LWCA 4KV8A 4NZ7A 4O44B 5I4MA 2YWWA 4M5DB 2DR9A 1MW7A 3AB2B 2Z56B 3MCMA 3S8SA 5KFEA 3NNCA 3LAKA 2FJVA 4LFAJ 4ELTA 3GYGA 1NK0A 3QIPB 4HLBA 1LFPA 1CEZA 4CLFA 1IKYB 2OO4A 2D3OR 1IM4A 2YQ1A 1CULA 1TL5A 3DCAA 3IG1A 2LQ8A 2HNYA 4OZ3A 2Y1IA 1IN0A 4NYZA 1U49A 1EKSA 4QIEA 1XR5A 3QGHA 1FNXH 1Z4UA 3ILOA 4O3QA 3BEGB 1DURA 3H2LA 1R6VA 3L7OA 1KQGB 2DB1A 3UDCA 2MQOA 4ECQA 2MEWA 4M5HA 3UCZP 4Y2MA 2HS3A 1RT7B 2MSTA 1NMEB 1CJVA 2PMZD 4ECXA 3NNHA 2IY5B 4Y2AA 2DGOA 4EZ6A 4FYDA 3CF5Q 4HH0A 1NM2A 3CJ3A 1Y00A 5GAGU 5D3GA 4NE9C 5CZVA 3DXSX 3MXHP 4X4TA 1SC1B 4Q0BA 4IUFA 5KFUA 1RXOB 2IYIA 3M9MB 4NL5A 3AODA 4FYWB 2VG6B 1CULB 2YNIA 1W25A 4ZP8A 2QL5B 1FEEA 1RSCA 1PYTA 2FHJA 3KWMA 5E3PA 2GCFA 2XWXA 1FKOA 2GIRA 3TEHB 2ZH4A 2H48B 1UMJA 2ILZA 2E9ZA 2D3ZA 2F9JA 5LXYA 2BKOA 1PBUA 3BPSP 3C15B 2HHHJ 3D28A 1T3NA 2WW4A 4K4UA 2VQFJ 3KK3B 3OVAA 2OAUA 2E5HA 5KT7A 3EDRB 4Z37A 2ZD1B 1SJ1A 1IBCB 1VQ5S 2GNKA 4JI5J 5F3TA 3OTCA 4MK9A 3KNAA 2HHTA 3EICA 1S99A 3FSXA 1S4EA 1RT7A 2K7JA 4P2FA 1D9AA 4DG1B 2DH7A 3IRWP 1AA1B 2KRRA 1U1MA 2O5DA 1RT3B 1SJRA 2IFXA 3FQLA 3SSSA 2XMVA 1FX4A 1VDHA 4HHUA 2FHJD 2NYHA 7FDRA 2C2MB 3PJ9A 4FF1A 1FJ7A 1WG5A 5AXKA 2M3DA 2EVZA 4CYUA 5L1KA 1U2RA 1X4EA 4ZVOB 2OPPB 1KHWA 2XYGB 3K5OA 4PWWA 4O3NA 2QFIA 2RS8A 3POTA 3SQGB 3UN2A 2CJAA 1HPZA 2W9BB 5D6GA 1S9FA 4YUDA 3JSMB 2AT1B 3UD4P 2FJXA 4RWXA 4Q2LA 1S1UB 3HCXA 4ECTA 4DJBA 2HVEA 1R7IA 1ZM2A 2JLGA 2KT2A 2F40A 2BJ9A 4NLPA 3VV2B 4U6PA 4YFUA 1WG4A 1RT3A 1FJEB 4IG0A 4DV5J 1ZA2B 4X62J 1FDDA 2UUCF 3BZQA 4USTA 2KZZA 1V9OA 1PCAA 3DYAA 5H1SV 4DSFA 1KOHA 5GMDA 2DR6A 5THWA 2C3MA 4EFAC 1I94J 3IP0A 3QGPA 3I0SA 2JRSA 2HSEB 2LFVA 2N7YA 3SBMA 2WONA 3C6TB 4L75A 2KFYA 3CO0P 4DPUA 1VQ7S 2ROEA 3BN7A 1IKVB 2CDQA 3G96A 2FIUA 1U2FA 4CT9A 4DV0F 3I0RA 2N3LA 1FEHA 4J9OA 3DRSB 1S1TB 1RT4B 4A48A 5ADZA 5D0GA 3MCNA 3MPDA 3T5LA 1TVRB 4JI2F 4LRFA 1IJFB 2QTWA 2QZ8A 4CLYA 4DR5J 1H7XA 2QLJB 2CZVC 2XMKA 3JAMY 3HJFA 2CPYA 2N4CA 3AD9C 3TZZA 3DLBA 3BBCA 4P2MA 1HQEA 3G82A 1N5SA 3OT9A 4LREA 4C3KA 1P9YA 1OS5A 1R8HA 3DU5A 3Q83A 4FVMA 4DR3J 3BPDA 2B51A 3M30B 2ASYA 2IM0A 3IMQJ 5F0WA 2UU9F 1VK3A 1XNQJ 5J2QA 1CJUA 4JYAJ 4NI2B 2FVPA 4WZQA 4NEYA 5T14A 2MPUA 3CJ0A 2GJFA 2RMLA 3O3LA 1FK9A 2HFOA 2WVBA 3CD0A 4RZRA 2VOPA 3K5NA 3EX7B 2NPIA 4MKBA 3PCOB 1M1HA 2MGZA 3TX8A 1SJ3P 2LXIA 2FTRA 1QLNA 3AD8C 1CSJA 3H0PA 4X62F 2W7OA 2UUCJ 1DHMA 2MY7A 3QIPA 2B43A 4IR9A 1WORA 3V6JA 4Y34A 2A2CA 1RT2A 1JLBB 1KVIA 1U1RA 3R5JB 3B8HA 4ECVA 2E1AA 2E7VA 1RWXB 2K3KA 4DFMA 3DLLQ 4N8NA 5IQQA 3VAJA 4DV6F 3D2WA 1R0CB 2BJ1A 1S76D 2YWGA 3G82B 2MDAA 3A4TA 3M9NB 1FFGB 4JP8A 5T7LA 1W7WA 3MEGA 3M1VB 4KGZB 3CULA 2XC9A 1IR2A 1BD6A 2V2ZA 3MPWA 4MK7A 4F3MA 1SIWB 4YDDB 1AB8A 4OHXA 2FJDB 4LRCA 4QPTA 1VQPS 2J6SA 2DXEA 4BDPA 1YJ7A 1DQ9A 2C2KB 2ILYA 5KFZA 2XHCA 3NNAA 1TZ0A 2Z2ZA 3PW4A 2DH9A 1JLQB 3J7ZT 1IKWB 3GONA 3D66A 3I5CA 3CJKB 5H9EK 3C6TA 3R7NB 2KG0A 5SUHA 4NOHA 2EFVA 1XMOJ 1N33J 4MFBA 1F6TA 2QA4S 1UFKA 4A8MP 1JLEA 1SH0A 3KJQB 4I2PB 3N0VA 3PYFA 4KBIA 4KRWA 3KK3A 4K4TA 3ZC4A 2DR8A 4N5SA 1K0VA 3L4BC 2PMWA 1SBRA 4AL7A 3IC1A 1G2EA 1FXLA 3MFHA 4JV2A 4OX9J 3M8SA 1RWMB 3DM2B 2Z2MA 2LLZA 2BKNA 3PVXA 2JVOA 4WP8A 3W2VA 3DHWC 4B9LA 1PAUB 3P8BB 5T41A 3C2PA 2VOOA 1QY7A 2H65B 2ROPA 1I3OB 1Y10A 2CNKB 3MEGB 2KI2A 4LFCJ 5L9XA 1IKXA 1RAEB 2GAHC 3VQSA 4W90B 5AE1A 8AT1B 4PPZA 4YHHF 1RYRA 4E8UA 2NXNA 3E01B 5C5JA 2C3OA 2MZRA 3K89A 2J9DA 5FIIA 3WIVA 3ZZYA 5GAEU 3OHBA 1HNWF 2QLWA 4YB5A 4LR8A 4KR0B 1FRHA 3GFYA 3RW6A 1VQ4S 1Q16B 4XPCA 3TJ8A 3VF0B 2B4UA 3B82A 4DR5F 4JI2J 4OYXA 4YR2A 2M8HA 2DXFA 1RHQB 4K50A 2I38A 3HHLC 1OY6A 5F9LA 3MMAA 2CDRB 4A8WA 1NHVA 2FJBB 3KDNA 3D67A 4PXDA 3R1HA 2IMOA 2MZSA 2OPSB 2Q79A 2XYHB 1SKSA 1TK8A 1KC8T 1DBDA 2RF2B 3QT7A 1L3UA 2V9WA 4XAKA 4FS2A 4PQAA 1YDLA 1JJCB 5CYMA 3TNVA 3RB6A 5J2QB 2V4JB 3H5XA 1FA0A 4C8YA 4I7FA 4ZA1A 4B9VA 3NGKA 1X5PA 1R43A 2MZTA 1Y9OA 3ZNJ1 1LXNA 2B0GA 4KPCA 1OPIA 3HKWA 3RU0A 3V6KA 2CQ0A 3MOJB 3EXYA 4CO5A 3JTOA 4M5GA 2QIFA 4AXIA 1U02A 3CPWR 4OV6A 1BMQB 4DX6A 5F3ZA 3OVBA 1N54B 4JI4J 2HK2A 4C11B 2CPZA 3FRYA 1S1TA 2BXJA 3GWCA 4PWUA 2GHPA 2BM0A 3J80U 1K8AT 1HBOA 4HI1A 2GIQA 3KJFB 3VVUA 3N28A 1ULRA 1EP4B 5D0EA 3AFGA 4DXLA 3M32A 2NXEA 2DD8S 5K8NA 3DDNA 1U1LA 3V4IB 2BR0A 2W2OP 1N5QA 4OX7A 2DYAA 2CJ9A 4JYAF 1HNXF 5L1IA 1S97A 3CMQA 1GTHA 4Q45A 3NMAA 4M5KA 3N5FA 4ZKAA 1RAGB 3PRVA 2FYXA 1S7IA 2L9WA 1CPZA 5IT4A 1FNMA 3ENWA 3BSAA 4ETXA 3KYLA 5AE2A 3Q8PB 1ZETA 4ZVRB 2P6TA 2GVZB 4Z7YA 1RTJA 1N56A 3HVAA 2Q43A 3SQOP 4WTYA 1FJGJ 4CTAB 1TKXB 3NWRA 4TVAB 1RT2B 2V8GA 2KHCA 2DNKA 2M9KA 5B08A 3ET6B 4CRJA 3BQ1A 4OLPA 4CM0A 4DV0J 4HYKA 5HVGA 5JJBA 2UP1A 2ZM6F 3T5HA 1SPBP 3RRKA 5KOWA 2PA8D 4I68A 3W60A 1UJ5A 5J2NA 4QIVA 1XMBA 3L9ZA 2GIFA 3BDEA 1BLUA 5BR8F 3UD3P 2OIHA 4NXMJ 3TA2A 1FFSB 4Y28C 5KFOA 2OSRA 3C14A 5M2RA 2VBYA 4BS2A 3BH6B 4PWDB 4RL1A 3OL6A 2QA4G 1TV6A 4DOZA 3QWPA 4LF7J 3BGRB 4N77A 1RLDA 4X4RA 4R8UA 2P9EA 1VC5A 2QO3A 1NK6A 3AAWB 1U1QA 2ZHAA 2OPRA 4DV2F 2OSQA 4RW6A 4OYZA 3MPYA 4BC7A 1HBMA 1NLKL 2XMAA 4P2SA 2D41A 3ENVA 3R5GA 3OHAA 1HNVA 3HSJA 3K2YA 3W61A 2KM8C 1RTDB 1AUDA 4JI5F 1URNA 3J7Z5 3CT9A 4XPEA 3TI0A 2BDPA 4UW2A 4KJIA 1HHSA 4HVZA 3LP1A 1Q8IA 4WU3A 4KGVB 4ZVTB 4CP5A 4CLPA 2WK4A 5LJ5Y 2Y1LB 2IM1A 3H5SA 4C6AA 4ZHRB 4F02A 1RBLA 3M32B 3MD1A 4BLGA 2B7CB 2IBKA 4ELVA 2Z0GA 3KG1A 2AYGA 2XSJA 2MQNA 2DNHA 5E33A 5ETNA 5CA5A 3M30A 5K8MA 2FJWA 3T9NA 1JXLA 1B70B 2V69A 3H59A 3JS9A 1NDKA 2KN4A 4ETZA 4XDCA 3HHLB 2V2QA 3CDUA 4OHWA 1I5OB 2AEJA 3HX9A 2RU3A 1JLGA 1ZM3A 3Q86A 4OX6A 4DR4F 2M52A 1S1UA 3MM6A 1Z2ZA 5KFGA 3BSNA 1KLNA 3LP2A 4DV5F 3GQCA 1ZPWX 4TQSA 4HHHA 4ITSA 3W3SA 1WSVA 4WXWA 2OP5A 3NEKA 1NJXA 1RADB 1UPMB 1YX2A 4RJVA 2HG4A 4A8OA 3MMCA 2WSEC 5HQ8A 5KFDA 1UVIA 3PIOQ 5AXNA 4I69A 2YWFA 3G2XA 3DN9A 3H98A 2RF2A 3OSPA 2JOQA 2KHDA 4IQMA 3I0SB 3QT6A 2I6WA 1T7PA 3I9V9 4CCHA 2FVSA 2H51B 3A8JA 3MM7A 1Y3KA 4UUWA 5J2MB 2IJNA 2Z2YB 5DZ6A 3OUYA 2DK2A 2KYZA 1S49A 3HT0A 4F0HA 5H9FJ 1QDUB 4BC9A 4ZIVA 3QFWA 3W9HA 1S6QB 3T6BA 2MZ1A 2O1PA 2R7TA 3LW5C 2EWHA 5B09A 2ZD1A 2XS7A 4MK8A 2D3O1 2P9CA 1ZYQA 1NDCA 3C66A 1NKEA 2QRRA 3RB4A 2JEJA 2WZ1A 1TKXA 3D0IE 3GCXP 2MQ8A 3OJSA 3FSIA 2AMCB 1HI0P 3FBCA 1KQSR 2QN6B 3K0JA 1YJRA 3BGOP 1JJHA 3Q23A 2C3UA 5KFAA 5GMEA 4GVLA 3IFEA 4ATNA 3PRBA 3QQCD 1RA7A 2XB2D 1WC5A 5A0YB 2V6AA 3SI8A 2JFKA 4K8RA 5HROA 5LJ3Y 1EETB 1D09B 2VG6A 1JK9B 1FT8A 3M1VA 3PYDA 3RBXA 3IS9A 1RTIB 3KLIA 4RKUC 2KXNB 2CVIA 3B6BA 4FPIA 2WW8A 2LMIA 3OR1A 2D3UA 2ZH3A 1F5CA 2HMIA 2AYEA 3ILLA 2GHVC 3G8QA 1X4FA 1WELA 2A1BA 1BXNA 2D7SA 4K4VA 4Q8EA 1RKJA 3EPIA 3I9ZA 4UOFA 1SIZA 2WHOA 1QD1A 2KH9A 1VQYA 4EUVA 3JTNA 3QNWB 1V6HA 1TL7B 3UD5A 2YQ3A 1KP6A 4EYIB 4FYYB 2ZWPA 5KG0A 2W8LA 1Q53A 4P71A 3AJ2A 3MAAA 1YZ7A 1GMWA 1TKTB 4PKDB 2LQBA 2XI3A 4M5MA 3T1HF 3KOAA 2F3JA 4WKRA 3QMQA 3BSOA 4H4OB 2XY7A 2XS2A 4PG6A 1CJUB 3N79A 4OYAA 4QW9A 5IZHA 4DR7F 3DMJB 2VICA 2FHKA 2EXUA 4LSZB 4QQBA 5KFVA 4LQ3A 3QGGA 3L7UA 2VG5B 3DRRA 1GTEA 1PG5B 2LECA 4PQUA 5CH7B 1SJ4P 2CQDA 3CVKA 1U6FA 3C16A 3GYXB 1X31C 5HI7A 2DPIA 4K4SA 2JWNA 5C24B 4WE1A 3HKZD 3V6HA 3RTVA 2V2KA 4KTQA 3CCVS 1IBKJ 2E9RX 3GJQB 3GP9A 9RUBA 4LR9A 2RB7A 2CJXB 1VISA 3IR5B 4FXWA 4ZPVR 1HI1A 4EMDA 2HS0A 1FVSA 2DGVA 3PJXA 4WYWA 2APOA 2MZQA 3FBFA 2CJYB 1UWAA 1LWEB 2BE7D 3JXOA 3P5TL 1X4HA 3QGIA 2ZH2A 1VBYA 1QJHA 3FMWA 3R7BB 4EI2A 4ZMMA 1O8BA 4IO1A 2B9EA 1EJ7L 2G2YA 5E7OB 1NHUA 2NREA 4OQJA 2IA6A 5CYJA 1PJ6A 4OV1A 2R7OA 3NS6A 4UOCA 2HQDA 3QRRA 3RBZA 2HURA 1D1UA 5DQGA 1HD0A 3H40A 4UY8T 3MURP 1IQTA 3VAMA 1RHRB 1SJFA 2W4PA 1YIJS 4Q7AA 4JI3F 3FZBA 4K7QA 1TAQA 4M5LA 3FCHA 3W2WA 2CWKA 1HWUA 3ADAC 3DLEB 3IWLA 3C8YA 5HAOA 2ZH6A 2B8QA 1IQZA 1EP4A 1D3WA 4Q8FA 2F8HA 2AZ1A 2XZWA 3CDAA 1IM6A 1XJWB 1ZBTA 4QJVA 3TA0A 3TAMB 1HNZJ 1IJEB 2NZ4A 3AA8A 4JV1A 1F9FA 2UVUA 1JLAA 2A6OA 1RGVA 1TU0B 4JI0F 1EZZB 4B17A 2I2YA 1E6YB 1BQXA 3QLHA 3G4SS 2XHWA 3EGZA 2EFOA 1HWKA 3DOLB 3PYEA 3G8TA 1JX4A 3MM5A 2R9LA 2YH1A 2OKQA 2UZAA 2CFXA 2P2CB 3L95X 4MKAA 2ZM6J 3KK1B 2VIHA 3PX0A 3TANA 4ECSA 2BVZA 4HHJA 1NNDA 4ICLB 4I6WA 1DY3A 3DMJA 2Z57B 2WOMA 3BBFA 5KFHA 1REVB 2A6MA 2GMLA 2PFDA 2V8DA 3W62A 5DG8A 4B9MA 1WHYA 1LKZA 4KO0B 4DQIA 3KLEA 1V5IB 4ZPBA 2J6TA 4P74A 3PR5B 3TWZA 4AQYF 2OUGA 4DFPA 1HQUB 2IAJB 1HLWA 1TL3B 3FUYA 4WFXA 2FC8A 4E2FB 4DZ6A 2GQQA 5HVFA 2YNIB 1UWBB 1TTHB 3M8PB 1FFWB 4KYZA 3TQ1A 4PG8A 2HAFA 4NMLA 4P6QA 3T9ZA 3AT1B 3GJTB 3M8YA 3HHLD 4ER8A 1JNZB 1AXQA 3MMBA 2UV8G 4G3IA 4YB1P 3HPOA 3IGVA 2C2OB 2DGSA 2QGFB 3AA9A 3CCJS 4QWAA 2NS1B 1UVNA 2XNRA 3THPA 4CO2A 2BE2B 4PZVA 2HMIB 2JH3A 2HHHF 4GKKF 2KFZA 4NX9A 2KYXA 1ZAWA 3MD3A 2W2QP 3QO9B 4K5RA 2ZKUA 4O4GB 4CO4A 1D8YA 2B6AB 5FLXU 2QA2A 4URQU 1WC0A 1UWBA 2DJWA 1S0VA 3DDKA 1MN7A 2BW7A 2YX7A 3W2VB 3PTWA 2CQCA 4Q44A 1T94A 4ID8A 3U7JA 2HHXA 1RAJA 2Q3PA 3ZO7A 3S7RA 4LVOP 4C0HA 2XCPA 2W7PA 2QJ3A 3BKTA 3QPIA 4I7FB 2VPXB 2NPFA 2MLXA 1QVFR 1VQNS 4EO8A 2WOMB 3IBFB 2GW8A 4RUHA 1MROB 4GC6A 3SZ2A 1HFEL 2R2UA 5I3PA 2XY6A 2SXLA 2DHHA 1C1BB 1LW0A 1WF0A 3X3UA 2W1BA 1SH2A 2X51A 4PUOA 3W8PA 4X2BA 1FRIA 4UQGA 1MMNA 1GXUA 5HJXA 4UQTA 2XLIA 3QLHB 3V5RA 3AOBA 5EWEA 4B9SA 2AJQA 4WKYA 1NUEA 5HQLA 4NLXA 2BJ8A 1B0TA 4AQYJ 2Z8QA 3TAMA 3NRBA 4NPOA 2DNMA 3M2RA 3QJJA 2H3EB 3AOCA 2ALZA 1JLCB 3W2WB 3UDLA 4U67Q 1CJTA 4WFBQ 2R7SA 2X1FA 1Y11A 2HNZA 1P8GA 3BR9A 3HVTA 3KHGA 2NLWA 2BOPA 1ELOA 2WB4A 3D3BJ 2V94A 3NP5A 2VFUA 4DSLA 2YWKA 1UVLA 3EVMA 4CO1A 2BE9B 1WEYA 1ZPVA 2GC8A 4XO0A 1M1KT 2RKIA 1M5VC 3EWGA 3EPGA 4P73A 3DOLA 5KFTA 3Q0AA 2XY5A 4OZ1A 4A8KA 4EU0A 4DLGA 2HNDA 4NZ6A 4UY85 1EHWA 1ROFA 3LF0A 3NBPA 2U1AA 3US5A 2B9YA 2CPJA 3QZ7A 4QZVB 2FHMA 3QSYB 3BDPA 2F1FA 3HXMA 2AD9A 4ES1A 5E3CA 2YKNA 3CNQP 2E1MC 2BJEA 1FO1A 3FVYA 3LAMA 1OJ4A 3OFGA 4V1Ak 3W64A 5GAHU 3PX6A 2W4DA 5J2PA 3KTQA 4ERDA 1NK9A 3GFHA 3ULHA 2B3TB 3I5AA 3TUJC 4DV1J 1QTMA 4IR1A 1BC6A 1Q5YA 3KXDA 4C11A 1MG7A 1ZM9A 1RI7A 3JAMU 1RB0A 1LQ9A 4CLUA 3MAQA 2HFSA 2CA9A 2ZOGA 3GTYX 2RQ4A 1X0FA 1TFYA 1W26A 1UFWA 3MR2A 3SV4A 3QO9A 5EX3A 5D3GB 4IFVA 4IKAA 3DGPB 2BACA 3ELHA 3SCKE 3TUIC 4M95A 2ASLA 1EKRA 4D3HA 1QSSA 2BABA 2RHSB 1R0BG 2MKIA 2YQ0A 2A3JA 2YNFB 4DMZA 1S48A 3R2DJ 4KH1B 4WXOA 1RE1B 3MI7X 1L3TA 2CQHA 5DRKA 4X64J 2KJWA 4LJMA 1RCXB 1RKIA 2Y9HA 1T9VA 4H4KA 1VQ6S 3OSNA 4DSJA 1B64A 4NRUA 2J9EA 3GIIA 1UKUA 4WTOB 2R7VA 3E8OA 1NO8A 5KFSA 2HBYB 2VC0A 4TY8A 2IAJA 2O01C 2J7KA 1HBUB 3BO4A 1VK8A 1U1KA 2X7IA 3UFCX 4KKOA 4A8XA 1UEKA 5C24A 4LF2A 3G71S 5JMNA 2AYMA 2EK1A 4KV8B 2DH8A 2L48A 1X4GA 4DF4A 5B0FA 3SCIE 2HRYA 4HDGA 3KK1A 3C6UA 3E2EA 4AFFA 3WX4A 3TUZC 1J5EJ 2VU5A 1DLOB 1RLCL 3CC4S 4DX7A 1P1TA 1YVFA 5JVHQ 3T1HJ 5AXMA 1XMOF 2ZJRQ 4LF5F 2LP4A 3BKFA 4DL5A 1RWOB 1T0TV 4QWCA 1KTQA 2QSFA 3DM2A 3K8WA 4DR6F 1IXKA 1KEKA 1Q8LA 3M8QA 2B4VA 2FQQB 1CQNA 4C8ZA 1URRA 4X4NA 1YJNS 1K9MT 4FKXA 3CCWA 1XMQF 1HHTP 3PFEA 3N01A 4Y2KA 1N36F 2VH7A 4ZJQA 1YITS 2V5HG 2FLOA 3RAQA 3LOUA 4PRFA 4TQRA 3ZTOA 4M94A 1IVZA 1FRXA 2FLPA 2ZBIA 5D0HA 3OFFA 1AW0A 4RBUA 4X4UA 1NPKA 4EEYA 1RACB 1XBWA 1WHXA 3SFUA 3LO3A 4B3OB 5FLXY 4ZN1A 4C4WA 2CQ3A 4JB8B 2FZKB 2LDIA 3CJQA 4DF8A 1VQ9S 1SL0A 2RNEA 1U1NA 5KT4A 4KY3A 3A3OB 3CEDA 5KFQA 2LQ9A 1VBXA 1RWNB 3A3PB 5HK4A 3EZ5A 1U0SA 5E2QA 5L8RC 1DFDA 1DLOA 1C2PA 2R8GA 1P6TA 3DI6B 3MEEB 4USIA 5IM0B 4F4KA 1K47A 2LQJA 2BW2A 5HMXA 4DS4A 2HQ3A 2HWTA 2Y3YA 3E51A 2WRMA 1FRJA 2CJQA 3GU0A 1SQEA 4NWBA 2UUTA 2ZBQA 5ETPA 3UNYA 2OJ3A 3BKUA 4BBYA 4U8YA 1XC9A 4J9NA 1CS4B 1OSDA 1T9UA 1RHKB 4RW7B 3UWTA 5ETQA 2UXDF 3EZUA 4F50A 2IM3A 4RW8B 1MWQA 3ZFVA 1U45A 1SL2A 2FZCB 1IKYA 4KIAA 1X8DA 1REGX 1HW9A 1FK9B 3Q8SB 4JV5F 3GV8B 3MR5A 2YKQA 2G0JA 3AHPA 3NMRA 4DZDA 4KAIA 2G0CA 3AXMA 5KFYA 4F3OA 2RAQA 3O44A 5CYMB 2K1RB 4I2QB 3THVA 2H4WB 2YX4A 1OPZA 1VRUA 2NXJA 1VJWA 4NYPA 5GVQA 1VC6A 2IVFB 4AL6A 1RTHA 4CZCA 4RW4B 1FXDA 4Z7CA 2L9NA 3H5UA 2BKPA 4S0MA 4YQWA 2KFNA 3NY0A 4ZOSA 2C3YA 3RJMB 4J9KA 3MUMP 2PD1A 4NASA 5HBMB 2BEFA 1PC4A 5AE3A 3N5BA 1EQ0A 4ALZA 3CIMA 2COLA 2W24A 2CNNB 2LVWA 4GVBB 3GV5B 2KRBA 2RUSA 1ZM4A 4WFZA 1LXJA 4FXVA 1H7WA 3UR0A 2QMUB 1FX2A 1SV5B 4LF5J 1N5YA 2ZITA 3NS5A 4G1PA 2D9OA 2HNYB 1FE4A 4C0BA 4ED1A 3RB3A 3FSYA 1VLYA 2QC3A 1FKAF 5A0YA 3UE2A 5HROB 1Q7LB 3G8SA 2PMHA 2ZBPA 3M6XA 3SSRA 3TVZA 3KG4A 4GRSA 5J2PB 3M6UA 3OFHA 1QM9A 3MUVP 4O0NA 3B4DA 3QAEA 2YPZA 3UN3A 1S7HA 4CIOA 1GXLA 1U7LA 4ZPTR 1LWCB 1TP7A 4K0KJ 2DGXA 1M5PC 1JQGA 1EARA 3HF5A 3HZGA 2LDYA 3MAHA 4KKOB 3D1OA 3LANA 5KFRA 4AE5A 2ASJA 3G86A 2YNHB 2EFGA 4K59A 4DR1J 1XNRJ 1X4AA 2K8GA 1ZOTA 4OZ0A 5KFMA 3QATA 3IR6B 1TV6B 4OFZA 3KDOA 2OLWA 5KFWA 1JLQA 2FUG9 2ZOMA 3MGJA 5DLGA 4PG5A 4OYPA 3J81U 2U2FA 5I3UA 5KFPA 5MLCV 4NLOA 1APSA 4RW9A 1HD1A 3FK4A 3NAHA 4WYLA 1MN9A 2Q1LA 3VGVA 3W5XA 1VQ8S 4WK3A 2KG1A 1PKUA 3EZOA 1I51B 2NZCA 4A8QA 4AL5A 5C42A 3I82A 5JUMA 4ED5A 2IHR1 3NL0A 1HWJA 3QWUA 1RAOA 4TLQA 3BQ0A 1TR0A 1N36J 1PBAA 3KG0A 3R27A 4TLRA 2XGPA 3UVJA 3RB0A 4J90A 3DRPA 3HVRA 2CPEA 2GVZA 4J9UE 1XR6A 2KVIA 4ZK7M 2ZJPQ 4QYRA 3MHYA 3HHLA 1RAFB 1VIOA 1ZA1B 2WSCC 3I96A 4DX8H 2J6UA 4M5IA 4DV3F 2B8PA 3MAAB 4DUYJ 1VBKA 2K1RA 1H3DA 2FVCA 3D6HB 2DGTA 1S0MA 4HACB 4WFNQ 3CO9A 2XO7A 4MKVA 2RSQA 2C28A 4DDFA 2LXFA 1Y5IB 5H9EJ 1PJ7A 2L3MA 3EGWB 1FKPA 2GAGC 5CD4H 5F8JA 3MMAB 2Y1RI 1YLXA 2ZE2B 5FD1A 2YWHA 2UUBF 5KFJA 4G6VB 2XBPA 1WHWA 3ZTQA 4GKJJ 2JEIA 1YSJA 5KG7A 2ZH7A 1KVKA 4LF4F 3QAUA 3GIMA 2W9CB 1X9WA 4LUBA 5A8RA 3OTOF 3KUEA 1RTDA 1FERA 2HRTA 1FRMA 4RW4A 4USHA 2ZJQQ 4L3KA 2F7VA 3LH2S 1A0OB 3CJSA 1GX5A 3UVJB 4NXMF 1TMMA 4LVNP 2IC3A 3VGTA 4DQRA 4KHPJ 3JQMA 3NG8A 4NA2A 3ZZ0A 5LM7E 1OIAA 3EDQB 3MZIA 3KLEB 1UP1A 5LL6d 2GS8A 3MFIA 3DNCA 1MMDA 1MLAA 3CJRA 4DU8A 3LWMA 1Q7YT 4ED0A 4DHVA 4FYVB 3RRGA 1L5UA 3NCRA 1RK8A 4QYZK 1BWVA 4MJKA 4X4OA 3HT3A 4DPTA 4LFBF 3V2UC 4RLEA 4DUZJ 2EW9A 2L9DA 3ILIA 3EJMA 4MT1A 3J7AN 3RGIA 5AJ3J 1J27A 1MWZA 5LMUJ 2WBMA 1HIYA 2QSWA 5IC4B 1SKWA 5KG1A 4PG4A 2R7RA 1UJ4A 3ETOA 1T03B 1KOOA 2C2DA 4C0OC 4YHHJ 3JYTB 4XK8C 3HVTB 3MMJA 3HP6A 3PW5A 1N34J 3C3LA 4RU9A 3VAGA 5ETKA 2BQUA 2J0XA 3MMCB 4U7UK 3M8QB 4DLEA 3OQ2A 4FNIA 4U9RA 2OPPA 1J5OB 2GGPA 2NCKL 2W25A 2FLNA 2ZZNA 3K5LA 2R2SA 2HHPA 3T3FA 4IQXA 5JVGQ 1H38A 3ZZOA 4B9NA 1KDNA 1M5HA 2HFUA 2IMWP 5KG2A 3B78A 1ICEB 4OMFG 1U48A 4B3MJ 1VC0A 1LWFA 2VFRA 4L74A 4MAKA 3BYRA 1XERA 2O3DA 3R5DA 4DG1A 4JI8J 4DR2J 1OYDA 4KH0B 4B3OA 2EG2A 1LNQA 1U25A 1H2TZ 3PW7A 1KTVA 4HI2A 3L3CA 1WC3A 4ANEA 2CPIA 3BO2A 1O5JA 1AYEA 2OMLA 1DTQA 4Y6IA 3D6FB 3OBIA 1FRLA 3W66A 4ED6A 2HBZB 3LP1B 4LFAF 3HLUA 4UTGA 4RNFA 4DV3J 4HKQA 4L3NA 2B4OA 1XN9A 5EX0A 4LF9F 1VCTA 4OZ5A 1YJTA 2K3IA 2VODA 4ZCMA 2VQFF 3IA0A 2V4RA 3Q8RB 2EI5A 1MNEA 5CHCB 3RZAA 4TN2A 1BE4A 4FPRA 5IQ6A 3J7A1 1Y4ZB 4EBEA 1RAIB 4V19X 3MR6A 1H74A 4USWA 4F04B 1NJYA 4ED4A 2M70A 4C3LA 2B9XA 2BE2A 5B0BA 4JI4F 3C19A 2BRKA 4JI0J 4BWMA 1ACMB 3OTOJ 1KS2A 1R8AA 2XG8A 2R4FA 1QTNB 5HSPA 2W9CA 5DLFA 1OMSA 3DDIA 5DDRC 4BCAA 3R8YA 4K0KF 4N47A 2AU0A 2JDJA 5KTQA 4C8NA 1U1PA 2XSJB 2QT7A 3K17A 5DGBA 2FVRA 1FCAA 2VG7A 1KD1T 4DR1F 4DSEA 2M7SA 3E01A 3LPEA 4IOBA 1LW2A 5C7PA 4URGA 4I67A 2LEPA 3AOAA 5KFCA 3ETMA 3G6VA 1FTCA 2C1EB 4FBUA 4O3RA 3M2UB 3TUPA 4LF6J 2AF6A 3THTA 5DDQC 2GV1A 2WTFA 5KFBA 1GFWB 3A8IA 1RU2A 3VTIA 3WX8A 2XULA 2CRLA 1WDDA 2UVWA 1AROP 2UXBF 2ERRA 4J7CA 3EVWA 3BQ2A 4IH6A 4LIRA 3H42A 4PEOA 1Y7PA 4RW6B 4RR5A 2XEXA 1FDNA 3QFHA 4OZ2A 2XO6A 1MU2A 3CMES 3RR7A 4ZPWR 3J80Y 1DARA 2YH0A 3I0RB 4F4AA 4EYHB 2AW0A 1SUQA 1DAXA 1KLMA 2D69A 3FFIB 3PRDA 4RO0A 4X4SA 2KZMA 3HI9A 2EK6A 1S1WB 3GILA 3P5BP 4G65A 4C9DA 5D78A 5J1EA 1WC1A 3LTOA 2LYVA 3DYAB 1BY9A 3OL7A 3CDBA 2GQ2A 3FMBA 1IBKF 1N48A 5HMYA 5FJ4A 1DJ0A 1VRUB 2ATCB 2YKAA 2LEBA 1CC7A 4F4YA 3OW2R 2HYIB 3W8GA 3KHLA 1CJKA 4NZ0A 1VQOS 2EFPA 2V4JA 4RWWA 4LR7A 2AJ4A 2EBEA 3NS7B 3F41A 3M9OB 5B0CA 2BMBA 2DRDA 5AJ3F 4KPYA 4N8OA 5ETTA 4TNOA 3IWNC 2HHSA 1JIHA 2UXCF 3QSIA 4KGKA 2RQMA 3KLFB 5BYRA 1SCJB 4ED3A 4IG3A 1VR6A 3DLHA 2C2EA 3GLJA 1JLGB 1FJGF 3LGHA 5DG9A 3FQKA 3KMQA 4YEAA 2DR5A 2GVDA 4LFCF 4DN9A 2DPJA 1IBLJ 3DC2A 3GE9A 4CH1A 2EFNA 3I55S 1DQ8A 4PXEA 6AT1B 2QL7B 2ZE2A 5IWAF 4KHPF 3K58A 2GX8A 2ZFHA 3I4PA 4ENOA 1W2BR 1WTBA 1A7GE 1B7YB 3BB5A 3PXGa 3TO8A 3OJUA 3GIKA 3MCSA 1MROA 2Q6BA 5BR8J 2HGLA 5LOQA 5GAGI 1GX6A 3IG1B 4ED2A 2YY3A 4XDDA 2RT3A 1Q82T 2IA0A 2I8EA 3FKBA 1ZAVA 3CMAS 4V19J 1RABB 1X60A 1X5TA 4JI1J 4JV0A 3T41A 2AJ0A 2GGPB 1WC4A 3DRSA 1NPPA 1C0UA 3EYZA 3DLKA 4DPYA 3P4UB 3CCES 1WEZA 4ZPAA 3NOGA 2WVCA 1UCNA 2IDEA 4C8OA 3UCGA 2EPIA 1R0AB 1EB0A 3AH6A 2CQ4A 1PIEA 4ICLA 2RS2A 4F2RA 3W65A 3HJVA 3HSZA 1NKCA 1Q0NA 3WZ0A 1G7CB 3A1YG 2M88A 4W92B 4GKKJ 3SFGA 1AZSA 4NCGA 2ADBA 4CT8A 2HZVA 3EVOA 1CS4A 1RAAB 3NGRA 4DCPB 3C14B 4HTIA 4NA3A 2ZUAA 1RISA 1S6PB 3TRGA 5BXIA 1VQMS 2DO4A 2WVEA 1CBKA 1G3OA 1WOOA 2JEGA 2HNZB 4F25A 2HPUA 1NPRA 4Y3CA 4DUZF 1HPZB 2YTCA 4UZBA 5E3QA 1Y5LB 1WWHA 3EMTA 1B0PA 2DCLA 1N52B 3OXLA 4CNZA 2C2RA 1S9GA 2YKPA 1HR0F 4YDXA 2VJVA 1VYAA 2VKZG 1CVJA 2DHGA 3W5ZA 2AQ4A 3ENAA 2KJVA 3T1YJ 1NRKA 4DCOB 4CTAA 2J0QD 4OJ1A 5LT5A 2EC2A 1BQNB 1X5SA 2KO1A 3CD7A 5B7WA 2DNZA 2NXCA 3V6DB 2Z30B 3CC7S 4LF6F 4K4YA 2CKWA 3BGLA 4OI3A 3JTPA 4WIQA 3GG0A 2QEXS 2IJFA 2C2ZB 2R8KA 2XYPB 1F3VA 2HLTA 4DN0A 2KXFA 3TYTA 2ZC4A 3VHQA 3V81A 4CI0B 4O23A 2IYGA 1JLAB 2E5LF 1U24A 1UW9A 4ZHRA 3HULA 3QRQA 1YRTA 2MKSA 1WEXA 1T05A 1R31A 1R3NA 3CJKA 4Q5VA 4P9SA 4F4WA 1X9SA 4EBCA 3AJ1A 4HL9A 1UFLA 2CJBA 4O4RA 4NEZA 4USVA 1S1XB 4U7UD 2BBEA 3GZ7A 4FF4A 4IFVB 3MM8B 2PE8A 4LF8F 1N8RT 2F65A 4WE1B 1HARA 4KSEB 4ECUA 3M2VB 1N34F 2WCXA 3MR3A 1IBLF 1IR0A 1VRTA 2RQCA 2MYFA 4N76A 2PO4A 2MJNA 2QX0A 2R2RA 4OYMA 3RUBL 4B08A 4ZPDA 5C42B 1LK7A 2NSCA 1JLFB 3ENQA 1VQSA 1QAXA 1U4BA 2XGQA 4D3GA 4FF2A 1CJVB 2P8IA 3UNGC 1NB7A 4H4OA 3VZHA 3EM1A 3SEOA 2QG9B 2KDOA 1BGXT 2EEYA 2QE5A 4G1QA 5KFIA 4DWIA 3LGMA 4U96A 1F2GA 1EQMA 5K9FA 4EO6A 1OO0B 1ZZFA 4F4XA 3RAXA 4Y2CA 2R7WA 1RBAA 2JX2A 1D9DA 3IRXA 5I3QA 1RTZA 3GFZA 4J9VA 1RU1A 1I1GA 5D4PA 3TX0A 1FTRA 4P7VA 4FYXB 4H4MA 3A3NB 4RX6A 4X64F 3TEGA 1HNIB 4FZVA 4IYQA 1VGYA 4B3MF 4QR2A 4DSIA 2HHWA 3OR2A 5FDLA 3RYLA 3T5JA 3LP0A 4ED8A 2FY1A 6FD1A 2HRUA 3OVSA 5KFKA 2W2MP 5DJBA 3DHXA 1XTZA 3D7SB 4B3TF 1IKXB 2DGUA 3M05A 3K8VA 3MUTP 5BJRA 4KGMA 3M2RB 1OQ3A 1JKHB 1EETA 3MM9A 5K14A 4TU9A 4JBCA 1YRXA 4OIXA 4CLWA 3NCPA 2OPQA 1UVKA 2WVFA 2YVSA 3CJ5A 3I4HX 4R25A 1SXLA 3VZIA 5A8KA 3KMSA 3CC2S 3ISND 2H5EA 4QU6A 7FD1A 1RWKB 2RE1A 1VJQA 4DR3F 3LGNA 1SUQB 2CNOB 1LK5A 1S59A 3SXLA 4FKYA 1N88A 4AD6A 3TARA 1HWLA 1A6LA 3F56A 3IWXA 2JSXA 1FVQA 4J91A 2LQ5A 2HVIA 2HVZA 2MSSA 5DG7A 3Q89A 2VC1A 4DUTA 1DZ5A 5B0DA 2RQKA 1R0AA 3N9UC 1PO6A 3TVKA 2ZZMA 1YGYA 5DDPC 2F4FA 5ETVA 3I31A 2EG1A 2ROGA 2OTJS 4ZITA 1NSAA 4LRDA 4IOCQ 4CLTA 3IS9B 3KLIB 3ITHB 4DEZA 4O3SA 2OEMA 3CE8A 1Q86T 3U1MA 3Q8QB 4DV7J 3KLHA 1EAYC 1MMLA 1WNEA 4KC5A 2B6AA 2UUWA 3R5AA 1NAQA 1JB0C 2OFGX 2XMTA 3HHEA 5HANA 3D6TB 5IC6B 5GAEI 4N41A 1U47A 2RIJA 1J5OA 2GMJA 4ZJOA 4OLOA 3LP0B 1UJ6A 3IAS9 2ZBCA 1HR0J 3IBCB 4QR1A 3HD1A 2J8SA 3FC9A 1T9YA 3PHTA 1HBOB 4ZN3A 2HHQA 1S6OA 2AEFA 2O66A 3J81j 4MIAA 3PEHA 2GVDB 2HKEA 5H9FK 3HM9A 1SVDA 1T3OA 2HFNA 1UVMA 1U8SA 2GJIA 2YKOA 1RWWB 2Q6CA 1H2VZ 2GZOA 1T8EA 2CYYA 4M63A 5M2PA 5HP1B 2J7WA 2XM3A 5A2QY 4J5OA 1ZTWA 4QW8A 1KFDA 2PDAA 2UXCJ 3TZWA 1TUGB 1C0TB 1WKKA 1HQUA 4G1QB 4AXJA 3ONQA 5F8GA 4ZCLA 4YMEA 1UA0A 5EUHA 3SCLE 3MEEA 2AZ3A 3H20A 4AYBD 3IR7B 3LWLA 2P5VA 2B9WA 2E5LJ 3GV7B 4O44A 3VALA 1CJKB 2AX1A 3U1NA 1TELA 1E6VB 3EGVA 4TU8A 2ZH9A 3JB9k 4I6YA 4URSA 2IDLA 4OHZA 1B99A 2E66A 1HQEB 4TU7A 1FWKA 1KBRA 2VKRA 5B0AA 5D4LA 3A8EA 1ZZNA 3MM5B 4DBQA 3FBEA 3G6YA 3DRPB 3MM6B 2CZ4A 3CCRS 4IRKA 4ZJLA 4LSLB 2NR0A 2PC6A 3K7RA 3HHNB 2XLKA 1S12A 2DGWA 2DTJA 3VR1A 3PO4A 4ANCA 4ZP6A 1P27B 3UCUP 1SH3A 1UAWA 4LSNB 2HVDA 3HK2A 1TUVA 1NSQA 2DISA 5A2QU 4ZP9A 2DITA 1RZMA 3U02A 3OPKA 4OI1A 4JOUA 1UA1A 4ZVHA 4CO3A 2VFSA 5KG5A 2E1CA 4ILMA 2OD6A 2XZDB 3M8PA 4DV4J 3T5KA 5DM7Q 2RD5C 1HHQA 2CG8A 1XK8A 2PEHA 2WVDA 2C22A 1TQLA 1C4CA 2BYCA 2W2PP 2ZVSA 4HH1A 3TA1A 1FXRA 4RNMA 4ID5B 5D8HB 1JNRB 2K7KA 2YKMA 3OV7A 2BJ7A 2CWXA 3Q8VA 1HNVB 4KFBA 3QT5A 2F8MA 2R7XA 4NLVA 2HQGA 4OHYA 4LF8J 2DO0A 2P6SA 1RT1A 2M5YA 3E3XA 2HBQB 3CJ2A 4LRBA 2W9BA 2RUGA 4MFBB 4R8UB 3QT8A 2LEAA 1X0PA 3CD5A 1JLCA 5KFXA 1D0EA 1AT1B 4IO9Q 2Q66A 1XEZA 1DQAA 2HLUA 4LF4J 4JI1F 1HMVB 3J81Y 3P45B 1X4CA 1E6YA 1UL3A 5B0EA 3OL8A 1X4BA 2YWEA 2IRUA 2PT0A 4NMXA 3LALA 2HQFA 3QZ8A 4C48A 4J37A 1GEHA 2FHOB 3WC0A 2OHDA 2ZWOA 1N32F 1RUSA 3FFIA 4Z2XA 1ZS6A 1S79A 2AIRB 3FCVA 1O0PA 2CQGA 3J7YI 1ZH5A 1N4LA 2DRAA 1QE1B 4PQUB 4J9PA 3BN4A 1U0HA 1SKRA 4DQPA 4CDIA 5F8NA 3NAIA 3BS9A 2UUBJ 4C2MA 4W4MA 1JXEA 3KLGB 4ILLA 4TXSA 2VD3A 5K5MA 1HNIA 4YR3A 1N6QB 1RBOB 1RTJB 4F0MA 2D74B 2PEBA 3HFVA 2BM1A 5LMUF 4GC7A 4LMZA 3R7SB 2E9TA 1E6VA 2ZH5A 2CVEA 2W01A 3BGFA 2N3OA 2DHAA 4YB6A 1U26A 1K1QA 2HS4A 3M2UA 4GO5X 2XCAA 3KHRA 4MYTA 4F3QA 2HIQA 1QVGR 4Q0BB 4YP3A 1S6UA 2OEKA 4OYWA 2DVIA 4JI7F 2Y8YA 2UV8A 4NI2A 2W8KA 2VG7B 1R27B 1KONA 2J76E 2X3DA 3M4XA 4LBHA 4RW8A 3RG6A 4X4PA 3PNIA 2BZ2A 4LSNA 1KN6A 2MQQA 2QLFB 4FDFA 2HGMA 4DS5A 1LWFB 3ISNC 4O3PA 4CLZA 2JNJA 2B56A 3FCWA 1RT6B 3V6DA 1RYSA 4ES3A 4EZ9A 4LSLA 5LXRA 4FF3A 4P7TA 5IT9U 2ZBRA 4NLQA 4F26A 4EBDA 1MWYA 1TL3A 2HWHA 2DBBA 3WDOA 5L46A 5RUBA 4KHMA 2VQEF 4AUKA 3IAM9 4K4XA 4QR0A 1QE1A 2XNQA 2XSFA 1HBNA 2VL1A 2YNGA 3ICLA 4NLTA 3SYZA 1XNQF 3D9BA 2LU1A 4M5DA 4OYOA 3O5TB 4ZVSB 2PI4A 1GK8A 1S77D 2JEFA 3VCDA 1Z1ZA 2DY9A 3OXGA 5A6PA 3HDSA 2IJRA 2VJUA 5CXTA 1T03A 3ZTRA 3EE3A 4PCQA 2HNDB 3Q24A 3IO1A 2NXUA 1Q8BA 1WC6A 4X65J 2LU2A 2XMWA 5CD4A 3UN5A 4C3MA 1YRUA 5J1EB 3MM7B 3OUYB 3VAHA 2XS5A 3RBDA 3PW2A 4NLDA 1VFJA 3GR0A 1RA6A 1VQLS 1YQHA 3P6YC 2HFVA 4WCEQ 3LQVA 1XR7A 2FDNA 6FDRA 4K5SA 1V3RA 5DO2A 3TQEA 3H90A 5ETMA 4WZMA 2GFFA 2LA4A 4C7QA 2R7UA 2L08A 2PN6A 3M6VA 4ZVFA 2W2NP 1HNWJ 1H0HB 1RTIA 4OJGA 1OY8A 9ATCB 2IC3B 2FPHX 1U8WA 3A8KA 3LP2B 3P96A 1MSWD 4KQZA 5T7LB 1GT8A 1X9MA 1RT6A 2HZAA 4MH8A 4CLSA 2PGCA 1EIYB 4CH7A 5A8RB 2BRLA 3GG1A 4WBFA 2DNYA 3N6NA 4JUZA 2K06A 4HT5A 4TKTA 3H2UB 3KJVB 2E5JA 4Y00A 2G1DA 3CCLS 2RRAA 2RRNA 2ZVIA 1GQEA 2UUAF 3PKYA 1NK8A 2R7QA 1TKZA 2QMWA 4WK1A 5F0UA 3HD2A 4H4MB 2P9GA 4MMOA 1WJ9A 2G1HA 2WAQD 3D68A 3CJ8A 2H4YB 3O2IA 2ZNYA 1KRPA 1LWEA 4PPDA 5ITHA 2Z58B 4W98A 1S6QA 2RDIA 1P9QC 2CAJA 4PXBA 1U6BA 4CQ1A 3PKMA 5E3RA 1YHQS 2VDHA 1S57A 4HR2A 1QSYA 2M8DB 2YX1A 1M90T 2HK3A 3IGNA 3ZZTA 2BX6A 2F9DA 4X65F 1F9EB 2XMJA 4B3TJ 3CCTA 3ILJA 4LBIA 3C46A 1R89A 3PJWA 3OTDA 1RP5A 4OI6A 3TZXA 1JKHA 3MM9B 5K14B 3RBEA 2F4VF 2HHUA 3FDSA 3BR8A 2CJKA 1HBNB 2YNGB 4NCAA 3C6UB 5HLFB 3KLVA 1FI4A 3DGPA 1PAEX 1KVJA 1RT5A 3MF5A 2DNQA 1D8ZA 4YB7A 1W2IA 3G6XA 2MQLA 3DKDA 2MKJA 4QIGA 3M2VA 4PABA 2QMXA 5CQGA 2ACMA 1VI7A 1TVRA 2GJ2A 2XI2A 2DEIA 3OTEA 4HT7A 1YJ9S 2CG4A 2V63A 4F2SA 3CCUS 4LQ9A 4DV7F 1HWIA 2MTLA 2V8PA 1N0VC 3QJLA 2JLFA 5C25B 3TJ9A 4CM2A 1KSPA 2R8JA 2E5IA 3TR5A 2M2BA 2VDIA 5HJYA 5KOXA 2RDJA 2VHGA 1T05B 1MU2B 1B4SA 5DQHA 4ED7A 1XIQA 3CCZA 3KFWX 2MKCA 3AQOA 1UZHA 1TL1B 3FGVA 4OZJA 5KG4A 3KLHB 4A47A 4DR6J 2CQ2A 3VGUA 1KKHA 3FBBA
chains in the Genus database with same CATH topology
2RKIB 3PW0A 5GADU 2PI5A 2MQPA 3VAIA 1IBMF 2AGPA 4X66F 2DHSA 1GH8A 4H54A 2NYIA 2EFQA 2KT5A 2AGQA 2D1CA 4I2PA 3PX4A 4X84A 3CCQS 1XWLA 3H25A 4DV4F 1RDRA 2OPRB 5GMKa 1N5YB 4F67A 2A10A 1ZAXA 1Z2LA 1S1WA 3MTJA 4C98A 5HN0A 1YI2S 5F8MA 2K2PA 2W9AA 2HGNA 2B4PA 4IH5A 1TK0A 3QIDA 3P3DA 3DLEA 2AWZA 2WONB 3FEXB 1S6PA 4OI2A 4JI6F 2ZDPA 2C42A 5A8KB 5SZTA 3CXCR 2OPQB 3U27A 1FDAA 1CQMA 5G0RB 4FN5A 2H9ZA 4ZLPA 4DL0C 1YJWS 2VA3A 2FVQA 5D4NA 2E7WA 2ZC3A 4M8LA 3UR3C 5J2MA 4NLWA 3OSNA 4RBVA 4RNHA 1RWUA 2VBZA 3BF4A 5A8WB 4LT6A 5F8LA 2OMOA 4ECWA 5IFMA 1BQNA 5E3AA 3P49B 4RUAA 2RJZA 3JSYA 2MQMA 4TYBA 5K8PA 2KTQA 1FNOA 4MKYA 3JSRA 1I6JA 4K4ZA 1NJZA 5E41A 5A6WA 1JJ2R 3OXFA 3F44A 2ADCA 3DOMA 1Y5NB 3UW1A 1JWWA 3G9CA 4MYUA 4YY3F 4RW7A 1LOUA 2VFTA 3DOKB 2AGOA 4NLUA 1FHTA 1NK4A 4F8RA 2LCWA 4KB7A 4KT0C 2YNFA 3G6ES 5DDOC 5EWFA 2G13A 1HW8A 1U1OA 3D0GE 5HMWA 5GAHI 2DNPA 1UEUA 3DI6A 4QIFA 4ZS6A 4PR6A 3ZZPA 2J9DE 2DNGA 4H4KC 1UVJA 1HA1A 3ZZRA 5I42B 3HFKA 1QUVA 3MM8A 4K4WA 3S01A 3T6JA 1X5OA 2CQBA 4WJBA 3UI3A 4NCBA 3EXCX 4GMKA 2X3GA 4KO0A 5HO4A 3MTKA 2VZ9A 2VPZB 5EGYA 1WD6A 2NQPA 2G9OA 4I1TA 3Q22A 3I32A 3B4MA 2ZOFA 1TL4A 5GADI 3FRZA 1RQ0A 2NUHA 1K73T 4ECYA 2BA9A 4J9LA 3OR1B 4RW9B 1PGZA 3D5MA 4MIWA 2FD2A 3N4WA 4OHVA 5I3UB 2DNOA 3FEZA 4FVCA 4HDHA 1SL1A 3F73A 3D0HE 3N6LA 4QBUA 1KLMB 2ATLA 3VAFA 1S4FA 3EGNA 1HL6A 4DUYF 4DL6A 4TYAA 4NLSA 3POTB 4ILRA 2JHEA 3SQGA 3GFXA 3DRXA 3KHHA 4OL8A 4QCLA 1FD8A 4DL3A 3R1LA 1KNZA 1Q78A 4HEA9 1YJUA 3PR4A 2YKMB 1K1SA 3H8YA 2RVJA 4WF9Q 5JXSA 2GQCA 4IRCA 1NH8A 4DPOA 5KFFA 2JFDA 2X1AA 2FGOA 4MIBA 1WF2A 1V3SA 2ZUGA 4OX9F 1V3ZA 2C3PA 2AP6A 2FC9A 3S6EA 1FE0A 5LSOA 5BYQA 5CCMA 1L3KA 1U6ZA 2MZJA 1QSLA 1D9FA 2B5JA 5MAOA 4LIWA 3S1TA 4YR0A 2EC0A 1FKOB 1S72S 3PHEA 3HHKA 3I56S 4L72B 4R0JA 2BUNA 2CQIA 3DLGA 4RUCA 4ZP7A 3TOQA 4G1IA 1L3VA 2JL9A 1YBAA 1GXTA 2ZNZA 1QAIA 1NJIT 1RT4A 3AQPA 2AV5A 1CLFA 2WSFC 3K57A 2R8HA 2D9PA 4IFYA 3M6WA 5EWGA 2W7AA 3LPYA 5E0OA 2ZHBA 2RU9A 2VPWB 2EBGA 2I5JA 2OPSA 1BQMB 4ZCIA 4O0IA 4TY8B 3NBPB 4DL4A 4B02A 2J0SD 3CCMS 5C25A 4KHRA 1HMVA 2ACYA 1R8CA 4PG7A 3Q2TC 4Y0FA 3NGDA 2VPYB 5M2UA 1OSCA 5CCLA 2VUGA 1SB6A 4FBTA 2VB6A 2V0NA 1WI8A 5L38A 2PFFB 1N33F 4ELUA 3HZEA 2X1GA 2PSZA 4KFBB 2GA7A 3DFEA 5A8WA 4J9QA 4L6V3 4PXCA 5IM0A 3DXBA 1VRTB 3SSQA 1S10A 1K0TA 2MKHA 5KT2A 1P1LA 5KT6A 4DV1F 2FJEB 2F8EX 4NRTA 3PY8A 2HQIA 4IRDA 2ZH1A 1CG2A 1ZTTA 1YJVA 3CWJA 4WFYA 4GO7X 1UW4A 1DTQB 1F60B 5L39A 3VAKA 3CB4A 3NCQA 4IDKA 1GNKA 4QWEA 2B7BB 5J1NA 1RT1B 2E1RA 4MTPA 4C97A 2RRBA 4FNHA 2AJFE 2IVYA 3QJPA 2MKKA 4WFAQ 3T1AA 5LSLA 2MJUA 4E0DA 4QIWD 1X4DA 1NKBA 1C1CA 2KKHA 3NWGA 3RRHA 3RAXA 3G6VA 1VS3A 1S1VB 3FZ2A 1OWXA 3MECA 3KMQA 3JSMA 4OZNA 2HZCA 2Z4PA 4EWTA 4NLGA 3BJYA 2HHVA 3FJ2A 4O4GA 3D54A 4A46A 3D1QA 4QWBA 3BREA 3I5BA 1IUJA 4ZPCA 1C0TA 3MEKA 4XIUA 3OR2B 4ZVEA 3PZPA 1F5AA 5HP1A 3JYTA 4B9UA 1YTYA 2NSBA 5HBMA 3VQTA 2L41A 4B3RF 2UVVA 2XMMA 1G1XA 2BV3A 3CSKA 2VA2A 1HBUA 1J2VA 2OTLS 2OFHX 4B3SF 2I9SA 3KK2B 4DQSA 2KT3A 1RTHB 4Y2IA 4PUOB 2MGZB 3TW0A 1S9EA 1WHVA 4CO0A 3UQSA 1B7FA 5HMZA 1FD2A 3TAPA 1A9NB 2JVRA 2DGQA 4I2QA 3CD6S 2VBXA 1AFJA 1C4AA 2I0XA 5DGAA 4R5PB 1I94F 3LUYA 1TAUA 1REVA 2XLJA 3MPVA 3ITHA 2Y0SD 5DS7A 2CQ1A 3HHDA 2QA1A 1NU4A 2ZDOA 4B9TA 2A18A 1LFWA 3D1HA 3GR1A 1N6QA 3KK2A 4RNNA 2CQPA 4USJC 4DFJA 2J7UA 1VHFA 2QLXA 3JSBA 3CDWA 5D77A 4OX8A 1NZAA 3O1LA 4ZCKA 1Y3JA 4DQQA 2DIUA 2O67A 1Q81T 3ISZA 5CYQB 3R3TA 5KAKA 1IKVA 1X0FA 2BJDA 2OH2A 3O6QA 3CDEA 2LA6A 1IKWA 1WI6A 2X1BA 4PWDA 4QWDA 3PFOA 2JC1A 3X1LB 5L9NA 2HVHA 1DTTA 1O51A 1NJWA 1F0XA 3HMJG 1TKDA 1PSDA 3R5BA 2MXYA 3H4BA 1C1CB 3MWBA 4I6AA 3TP2A 4OJ3A 4IG0B 4A8SA 3N6MA 4CNYA 2G4BA 1KQFB 5IT0A 4FXDA 4ES2A 4I4BA 3GYNA 3TVYA 3MEDA 4NXNF 4DSKA 1JLEB 2AJ1A 3NKYA 2ADBA 1L3SA 4NLRA 4O3OA 3ZZUA 2BANB 2WB1D 3SDEB 4RU2A 3I87A 1VMBA 3K5MA 5F8HA 2IRYA 2M0GB 2LXUA 1H98A 3PIPQ 4NA1A 4GKJF 2FB0A 4EGLA 2R8IA 5LMNF 5DETA 2NUUG 5D4OA 5L1JA 4WU2A 2DR7A 2VBWA 5J2NB 2E29A 1BWEA 3SMZA 1WG1A 2DIVA 1HYSB 5B0GA 1NEEA 3DLJA 2YNHA 2BANA 3SDEA 3K5PA 3T19A 5EN1A 3BM7A 1UEVA 4DFKA 5KG3A 1VIXA 2IM2A 3IN5A 3IXQA 2DNRA 2DT9A 3WBZA 3CTRA 3PV8A 1JMTA 1C0UB 2VV5A 1NK7A 1NH7A 1T95A 1R6YA 2DNNA 4ZVGA 3HVWA 1G6BA 1YWXA 1N0UA 2E5GA 1JJ4A 1QUPA 2PIIA 2B5JB 4RNOA 5CZXA 2HAIA 1TL1A 4QOTA 1KFSA 3PDNA 1FKPB 5AXLA 2KXHA 1KHVA 1SV5A 4I64A 2I5JB 5KG6A 2N7CA 4QPXA 3V4IA 4YOEA 3ZZZA 2N82B 1Q79A 3CJ4A 4A4JA 2CPXA 1JLFA 3I6PA 4DR2F 1PILA 2JJ4D 3K59A 4N56A 2CIMA 5L1LA 3DOKA 3UPFA 2MB0B 1TK5A 3AY0A 1RJJA 4R0EA 1H6KX 5KT5A 1XNRF 5E5NA 4BWJA 1QAYA 1QAJA 2DCUB 2FJAB 1RT5B 2N4DA 4RBTA 2BQRA 1Q4RA 2ZHOA 3OLBA 3PO5A 2J5AA 4X4VA 1S1VA 3MECB 2YKNB 1SJQA 5KFLA 1U09A 4IOAQ 3RR8A 2MHEA 1N5TA 2IVMA 4F4ZA 3H5YA 1B0VA 2QV6A 2WBRA 1TKTA 3PM9A 2MMYA 3DRYA 3V81B 1LV5A 1WACA 3EUNA 4Y65A 1VOMA 2HFZA 2J9CA 4C8MA 3RW7A 4J9SA 1R8BA 2RILA 5G0RA 5KT3A 4A8FA 2JLEA 4IDKB 1F5BA 3BSCA 4FS1A 3VWSA 2XMUA 3BGUA 3GSDA 4I0WA 3WC2A 3MEDB 2V4QA 1GAOA 2V8VA 3KJVA 3CCSS 4OI0A 4I56A 4NLYA 1S9GB 1Q1KA 4ID5A 2JZ5A 2GO9A 2V9KA 3IBWA 2MHNA 4IH7A 4J9RA 5I42A 1NK5A 1AFIA 2VFVA 3MDFA 2V8HA 3GIJA 2ASDA 5BYSA 3PACA 4OI4A 3DU6A 5IT9Y 4K2XA 3FNNA 2FLLA 5FDLB 2E44A 2QYCA 1TFWA 3NLCA 2DRBA 4C8KA 3MMBB 3PEJA 1C1BA 1LW0B 1FESA 2R2TA 1SI9A 1LW2B 2I1RA 1WF1A 5F8IA 5DQIA 3GB0A 1VQKS 3OTBA 2KB2A 4IG3B 4A8YA 4E98A 2QFJA 1KR4A 3DLKB 3OFEA 2PA3A 2VONA 1HI8A 4X4QA 2XWYA 5J1PA 1J5EF 4U7CA 2GHWA 3KNGA 3J7YU 2A2DA 2ABYA 3OL9A 3KKFA 4IFYB 4R5PA 2CPFA 1HBMB 3QYYA 2VASA 2Z2LA 5HL7Q 3U1LA 2VG5A 3DRRB 2IRXA 1T02A 5DM6Q 2DNLA 2M4MA 2HWIA 1X7VA 5HLFA 4HTJA 4LF7F 1S9EB 1YG0A 5G4DA 3SCJE 3OLAA 3SV3A 3R5CA 1HYSA 5IS2A 5EDWA 3DLGB 1JLBA 5LSRA 4NYOA 4BHQA 2IBOA 3V4MA 1DRZA 5F41A 1R8PA 1SC6A 4DL2A 1S1XA 3IRXB 1M0SA 1FRKA 2GO8A 2ZH8A 2W4CA 2KM8B 1CC8A 3KLFA 2KU7A 2CPHA 2MY8A 1BQMA 3Q2SC 1FF2A 3MOZA 1N5VA 3CIZA 3RAMA 2EKYA 5F9NA 1UETA 3TAQA 1HNZF 2Y1JA 4QU7A 1TKZB 3M8RA 4FP9A 4M1KA 5KFNA 3BO3A 3H2VE 3FEYB 1M5OC 2J0WA 2ZKTA 1PC5A 1S0OA 2AX0A 2UVRA 4OZLA 5IXUA 3CGIA 2JC0A 4WIIA 4QYZJ 3HO1A 5EHHA 2DHXA 3O8WA 3KLGA 1DTTB 1Y0HA 1OQ6A 2J8AA 3GMGA 3W7BA 3CUNA 4KE5A 3H4DA 2BQ3A 3BGRA 3T1YF 5CYQA 4Q2MA 1FJCA 4ZDNA 3L09A 4TY9A 4C8LA 1WTFA 2OD4A 1KQKA 2POKA 1H2UX 3L7PA 1S0NA 4NCGB 2E7XA 4OJHA 4ECZA 4DL7A 1FDBA 1M5SA 4JI8F 2RH3A 4UUXA 4Q43A 2LKZA 5U47A 2AYBA 2GMHA 1M5KC 4CH0S 2FGCA 5K8OA 2CPDA 3AB4B 1LWCA 4KV8A 4NZ7A 5I4MA 4O44B 4M5DB 2DR9A 1MW7A 3AB2B 3S8SA 5KFEA 3NNCA 3LAKA 2FJVA 4ELTA 3QIPB 4HLBA 1LFPA 1CEZA 1IKYB 2OO4A 2D3OR 1IM4A 1TL5A 3DCAA 3IG1A 2Y1IA 2HNYA 1U49A 1IN0A 4NYZA 4QIEA 1XR5A 3QGHA 1FNXH 1Z4UA 4O3QA 3BEGB 1DURA 3H2LA 3L7OA 1KQGB 2DB1A 3UDCA 2MQOA 4ECQA 3UCZP 4Y2MA 2HS3A 1RT7B 2MSTA 2PMZD 4ECXA 3NNHA 4Y2AA 2DGOA 4EZ6A 4FYDA 3CF5Q 4HH0A 3CJ3A 1Y00A 5GAGU 5D3GA 5CZVA 3DXSX 3MXHP 4X4TA 4Q0BA 4IUFA 5KFUA 2IYIA 3M9MB 4NL5A 2VG6B 2YNIA 1W25A 4ZP8A 1FEEA 2FHJA 5E3PA 3KWMA 2GCFA 2XWXA 1FKOA 2GIRA 2ZH4A 2E9ZA 1UMJA 2ILZA 2D3ZA 2F9JA 5LXYA 3D28A 1T3NA 4K4UA 3KK3B 3OVAA 2OAUA 2E5HA 5KT7A 4Z37A 2ZD1B 1SJ1A 1VQ5S 2GNKA 5F3TA 3OTCA 4MK9A 3KNAA 2HHTA 1S99A 3FSXA 1RT7A 2K7JA 1D9AA 4DG1B 2DH7A 3IRWP 2KRRA 1U1MA 2O5DA 1RT3B 1SJRA 2IFXA 3FQLA 3SSSA 2XMVA 2FHJD 7FDRA 4FF1A 1WG5A 5AXKA 2M3DA 2EVZA 5L1KA 1U2RA 1X4EA 2OPPB 1KHWA 3K5OA 2ASLA 1VBZA 4O3NA 3POTA 2RS8A 3SQGB 1NK0A 2W9BB 2CJAA 1HPZA 1S9FA 5D6GA 4WZQA 4YUDA 3JSMB 3UD4P 2FJXA 4RWXA 4Q2LA 1S1UB 4ECTA 4DJBA 2JLGA 1R7IA 1ZM2A 2KT2A 2F40A 4U6PA 4NLPA 4YFUA 1WG4A 1RT3A 1FJEB 4IG0A 2UUCF 1FDDA 3BZQA 2KZZA 1V9OA 3DYAA 5H1SV 4DSFA 1KOHA 5THWA 2C3MA 4EFAC 3QGPA 3I0SA 2JRSA 2N7YA 2WONA 3C6TB 2KFYA 1VQ7S 2ROEA 3BN7A 1IKVB 2CDQA 3G96A 2FIUA 1U2FA 4CT9A 4DV0F 3I0RA 2N3LA 1FEHA 4J9OA 3DRSB 1S1TB 1RT4B 4A48A 5ADZA 3T5LA 1TVRB 4JI2F 1IJFB 2QZ8A 1H7XA 3JAMY 2CZVC 2XMKA 3HJFA 2CPYA 2N4CA 3DLBA 1HQEA 1N5SA 4C3KA 1R8HA 1OS5A 4FVMA 3DU5A 2B51A 3M30B 2ASYA 2IM0A 5F0WA 2UU9F 1VK3A 5J2QA 2FVPA 5T14A 2MPUA 3CJ0A 2RMLA 3O3LA 1FK9A 2HFOA 4RZRA 3CD0A 2VOPA 3K5NA 3EX7B 2NPIA 4MKBA 1SJ3P 2MGZA 3TX8A 2LXIA 2FTRA 1QLNA 1CSJA 4X62F 2W7OA 1DHMA 2MY7A 3QIPA 2B43A 4IR9A 3V6JA 4Y34A 2A2CA 1RT2A 1JLBB 1KVIA 1U1RA 3B8HA 4ECVA 2E1AA 2K3KA 4DFMA 3DLLQ 4N8NA 5IQQA 3VAJA 4DV6F 3D2WA 1S76D 2YWGA 2MDAA 3M9NB 3CULA 5T7LA 3MEGA 3M1VB 2XC9A 1BD6A 4MK7A 3MPWA 4F3MA 4YDDB 1SIWB 4OHXA 2FJDB 4QPTA 1VQPS 2J6SA 4BDPA 1DQ9A 2ILYA 5KFZA 3NNAA 1TZ0A 3PW4A 2DH9A 1JLQB 3J7ZT 1IKWB 3I5CA 3CJKB 3C6TA 2KG0A 5SUHA 4NOHA 2EFVA 4MFBA 2QA4S 4A8MP 1JLEA 1SH0A 4KBIA 4I2PB 3N0VA 4KRWA 3KK3A 4K4TA 3ZC4A 2DR8A 4N5SA 1K0VA 1SBRA 4AL7A 3IC1A 1G2EA 1FXLA 3MFHA 4JV2A 3M8SA 3DM2B 3PVXA 2Z2MA 2LLZA 4B9LA 2JVOA 3W2VA 3DHWC 3C2PA 2VOOA 5T41A 1QY7A 2ROPA 3MEGB 2KI2A 5L9XA 1IKXA 4W90B 3VQSA 5AE1A 4YHHF 4PPZA 1RYRA