5LL6d

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
b'SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTGKRLAKKVARRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ll6d00
3JAMY 3J7A1 5IT9Y 3J80Y 3J81Y 5A2QY 5FLXY 5LL6d
chains in the Genus database with same CATH superfamily
3IN5A 2WONB 4B3RJ 5CQGA 3HHNB 2UUBF 4NLTA 2QMUB 1QJHA 3AODA 4ZHRA 3U27A 4CLWA 6AT1B 1WHVA 1IR0A 3H2LA 2RAQA 2EG2A 2RDDA 2ZZTA 1M5OC 4AD6A 3BGRA 1XEZA 4FXDA 3BKFA 3IBFB 1KWMA 4YB5A 1LV5A 1D09B 4DPXA 4C8LA 2J8SA 2WONA 3PO5A 4F2RA 4OL8A 4DEZA 4QU7A 1S1VA 5HMYA 3GLJA 1LXJA 1IBLF 2V8GA 1U1PA 4DUZJ 4LF7J 3ETMA 2UXBJ 2FJAB 2QLJB 4I64A 2BDPA 1HFEL 2YQ0A 2IM0A 3ZZYA 2PEHA 4CI0B 4OZLA 4OI4A 4KHMA 3GIJA 1NK9A 5EWFA 2RDJA 4OZ2A 4G3IA 1U25A 2MQOA 4OHWA 2NYIA 3CSKA 3MUMP 1YJ7A 2HS0A 3IWNC 3WDOA 1VRTB 2QL5B 1RA6A 1D1UA 3PW2A 3IR7B 1UEVA 3A3OB 1G4CA 4B9SA 1DQAA 4F0KA 4GO7X 1SC1B 4K50A 3MPDA 1LOUA 1KNZA 4CLTA 4URQU 2XHCA 4ID8A 5JUMA 2J6TA 2J5AA 1VRTA 4IFVB 4BWMA 4D3GA 1WDTA 4MKVA 4PYAA 4LSLB 3RTVA 3GYXB 1RP5A 2Z2LA 4OI2A 3EWGA 1UJ4A 4L73A 4DR7J 3ENVA 2CJYB 1NK0A 3WX4A 2HSEB 4LF6F 2LVWA 3U1LA 5KT2A 4L3KA 4TNOA 4TU7A 3ISZA 1F9EB 1UWBA 4IFVA 4NLWA 1NDPA 4B02A 5KFWA 3KDNA 4RX6A 4LSLA 4BS2A 3FNNA 5KT5A 3KUEA 2LXFA 1KEKA 1RWKB 2V50A 4O0IA 4N5SA 4C0BA 2ALYB 2Z0GA 1FNOA 1KDNA 4DUTA 4ILLA 2QMWA 3SQGB 2VPYB 5AE1A 4QYZK 1RU1A 1ITPA 3ZZOA 1YHQS 2VDHA 1F1BB 4X4OA 1W7WA 4IRKA 4LRAA 4USTA 4JI0J 5LT5A 1XMOF 2V8HA 1SBRA 1C4CA 4WU3A 2ZOMA 2MKHA 3J7AN 1XMBA 4MYTA 1QE1B 2VQEJ 3DOKB 1NXIA 2YX4A 3SQGA 1URNA 1VISA 4CDIA 1H72C 2E7VA 4OI3A 2GO8A 3PZPA 5T7LB 4J9SA 2O67A 4LBHA 4F8RA 2CQCA 3RB6A 4CWBA 4GKJF 4YUDA 1WC0A 4NLOA 5ETMA 3K89A 3GJQB 1UL3A 2DNYA 4JV5J 1PYTA 1QE1A 4RW6B 5ETSA 3HCXA 5GMEA 3DOKA 2GMJA 4K4TA 2DNZA 2FJWA 1VQ4S 4P71A 3R5GA 4WF9Q 2CFXA 1WG5A 5T7LA 3W9IA 2C2KB 2XMWA 2FLLA 1ZZFA 3SMZA 3DLBA 1M5SA 1UAWA 2CRLA 4YDXA 1KQFB 3D54A 1DTTB 3BYPA 4F2SA 3CDBA 1XJWB 1IKWB 5ETVA 5F8NA 4FXVA 3S1TA 2LQ8A 2CQPA 5GAGI 1FJCA 4Y3CA 4DV2F 1A7GE 3V4MA 4FKYA 4ZJLA 2ATCB 2CPYA 4USKA 2IRYA 4WFYA 2DK2A 3TZWA 1DTTA 5B0FA 2CQ2A 1UMJA 4DU8A 2V2KA 1CLFA 4U95A 1IKWA 5L1KA 1RZMA 1PIEA 2XS2A 2GQQA 2HPUA 8AT1B 2XS5A 2QFIA 2W01A 4C6AA 3ZTQA 4DR2J 2VDIA 1WEXA 5B08A 4LF9F 2EKNA 4YHHJ 4F7VA 2CYYA 1U24A 1Y5IB 1OS5A 5HJXA 5U47A 3IAM9 1WEZA 2LYVA 3CDAA 4UUXA 5K8NA 1S99A 5KG7A 1VFJA 6FDRA 4ZPVR 3ILJA 4EO8A 2FZCB 1X31C 3D2WA 2OMOA 4JV0A 4URGA 3M6VA 2P9GA 1JKHB 4HTIA 1WOOA 5GADU 1VMBA 4LREA 1MN7A 1SC4B 2A6MA 3BSAA 4H4KA 3KYLA 1Z2ZA 2XYPB 3R7NB 3BO2A 1KQKA 3L7UA 4C3KA 2HFSA 4P2SA 1WF2A 1M5VC 5KFHA 2UXDJ 1RABB 1JJHA 3Q8PB 3C2PA 3HK2A 2VZ9A 1JKHA 1SPBP 2DHHA 1XMQJ 1JJ2R 1JJ4A 3THPA 4N77A 4DR4J 1UCNA 4ED0A 2ZHOA 4BC9A 4B9LA 3GIIA 7FDRA 4H54A 5HO4A 3FZBA 2GIRA 5KG1A 1X0FA 1FT8A 1M5KC 1N52B 2IVFB 4Q0BB 5D0RA 2OEJA 1S77D 1Z2LA 1S57A 4ICLB 3K7RA 4HDHA 3Q8VA 4M8LA 1HQ2A 4DL5A 5K14B 4B3OB 1FJ7A 5D3GB 1ZA2B 2VIHA 2FTRA 2HRTA 4FVMA 3LA0A 3N6LA 3L7OA 5HN0A 1CVJA 4Q0BA 1HD1A 3JQKA 3SV4A 5F9LA 3W3SA 4F04B 3UCZP 4TLQA 2BM1A 4X4SA 3N9UC 4ICLA 3CJ3A 3QGGA 5DS7A 4ZPWR 5F41A 5K14A 4B3OA 5D3GA 4ZPAA 4LT6A 3T1YJ 4MIAA 2LMIA 3W8PA 1YWXA 2KXNB 1X9MA 5EGYA 2HQFA 3IO1A 2RILA 1U2CA 3HX9A 4CT8A 3CVKA 1IKYB 3I5CA 4X4NA 2HHTA 2G9OA 4ED1A 3LO3A 2XGPA 4Y2MA 2YKAA 1DLOB 3PX0A 4NLXA 3LWLA 1XR7A 3GB0A 1WSRA 3HHLC 5KFPA 5C2CA 4CNYA 1R0BG 1Y3KA 2DNHA 4N76A 4LF8F 1KFDA 3DLJA 3MURP 3K5PA 2NQPA 2GW8A 4OZ3A 1RBAA 3VAMA 3V6DB 3ZC4A 1IKYA 3MWBA 4YP3A 1F6TA 3TEGA 2XMVA 1T7PA 2R8HA 1DLOA 3DU5A 2HFZA 2HWHA 3IM9A 2RRBA 2HNDB 1SV5B 3WQPA 3CCSS 4DQPA 4AL7A 5HMWA 2OPRB 3TYTA 4CIOA 1D8ZA 5BYRA 2APOA 2N4DA 1JLGB 3PTWA 3V6DA 1UJ5A 1WG4A 3WZ0A 5D4OA 3CJ4A 3SQOP 2HQIA 1FWPA 4WBFA 3GE9A 3QSYB 1RT3B 2HNDA 2MKIA 4CLPA 1SV5A 4Y28C 1MROB 3K58A 4QJVA 1BMQB 1P8GA 2OPRA 3BS9A 4BBYA 5E0OA 1JLGA 4IRDA 3G86A 4HHUA 5IV3A 3AFGA 5HLFB 4B3TF 4USIA 4RBTA 4QZVB 5E2QA 5ETRA 1RT3A 3G82B 4YEAA 2XSFA 4MH8A 3TEHB 2VD3A 2L9WA 2Z30B 1MROA 2RUGA 4OX6A 3UD4P 2H48B 4U67Q 1F9FA 3BO4A 4ZP7A 1X60A 4CO2A 1SH2A 2EK1A 4LQ3A 2N3LA 1FXDA 4WU2A 5HLFA 2EBGA 2KT2A 4LFBJ 2OPQB 4L75A 5JVHQ 2WBMA 2XC9A 5KFYA 1PBUA 5FIIA 1SJ1A 3MCMA 3G82A 1X4CA 2OHDA 1N5QA 5KFQA 4DPUA 1Q8KA 1SCJB 1K8AT 1H74A 1RWNB 3EE3A 3AA8A 1BQMB 2Q1LA 4B9VA 4M5JA 2OPQA 3UNYA 4QPTA 3P5TL 1W2IA 3C14A 3B8HA 3H5XA 4WYLA 4WYWA 2PFFB 2YQ1A 2CWXA 4G65A 5BYQA 4QOTA 2QA1A 3T9NA 2VQFJ 1MWQA 1PCAA 3PYFA 1TKTB 3DXBA 1CJKB 4QQBA 3E2EA 2DGTA 4DL4A 2V5HG 1FEHA 1BQMA 1F2GA 2H54B 5D4NA 4I67A 4NCBA 2EG1A 3RBZA 4LFAF 2E1RA 4CLZA 3LGNA 1R0AB 3EGWB 3SBMA 1TKTA 2PSZA 2V2VA 1CJKA 4WIIA 4YN3B 1QSSA 3HSGA 3D67A 4ANEA 5EWGA 3UR3C 2LU1A 1T05B 3AOAA 2Y0BB 1SIWB 4L72B 1T3OA 2B8PA 3KHGA 3IA0A 2E9TA 1R0AA 1VLOA 2XMAA 3EYZA 4QIFA 4P52A 5KFVA 2ZBCA 4FYYB 2CNNB 4Y34A 1Q5YA 4KGMA 4I6AA 3SCJE 2D3UA 1UW4A 2A3JA 2AYGA 2CVEA 1H2TZ 2BVZA 1OY8A 1T05A 1DY3A 1PGZA 4X4QA 2DD8S 4XDCA 1TU0B 5KFDA 3H8YA 2OLWA 2R3VA 2V63A 3UWTA 5ETTA 2LP4A 2DGWA 3CO9A 1N88A 2R7VA 4JI8J 1VBZA 5LMNJ 4AQYF 5LM7E 3LPEA 4UOFA 4RL1A 1X4GA 1Y0HA 3VZHA 4LFCF 4QYZJ 1KR4A 2D41A 3R2CJ 3D68A 1Z1ZA 1U02A 4WTOB 1HL6A 3L3CA 4RU9A 4LBPA 1XC9A 2UUBJ 3BPDA 2MZQA 2W7OA 5HMZA 5F8IA 1BGXT 3I4HX 4OHZA 4O3NA 3M2UB 3Q8SB 1WUUA 3PW7A 4OJGA 3TQ1A 3C8YA 3A8EA 4NRTA 4C4WA 3US5A 3R5BA 2L08A 2QFJA 1ACMB 4K4XA 1IBLJ 4J9VA 1JNZB 4OHXA 4E0DA 1LFPA 2LU2A 1Q0NA 4X4TA 3M2UA 4P73A 4CLLA 2UVWA 1HD0A 1Q78A 2NXCA 3BGFA 1S79A 1Q79A 1W2BR 3GSDA 3WC2A 4KGXB 4PR6A 3QT5A 2Q6BA 2YKNB 2ZE2B 2EKYA 1VQ7S 2QL7B 2EC0A 3MFIA 2R7RA 2H5IB 1TUWA 1RHKB 2CZVC 2MEWA 3OLBA 3GG0A 2BUNA 5AXLA 1RT7B 1LEOA 4F3QA 4DV7F 1U1KA 5ETPA 5HBMB 1BQXA 3LF0A 1PJ6A 2DITA 9ATCB 2YKNA 5AXNA 2ZE2A 3OHBA 3FVYA 4K4ZA 2RF2B 4QWAA 3H5YA 1IVZA 3BBBA 4IO9Q 2V9KA 5KFNA 4EI2A 2DHXA 1H2UX 1RT7A 3QIPB 2LECA 2JC1A 4AL5A 4ZP9A 2MZSA 3JB9k 5KG5A 4LF6J 5HBMA 2DB1A 2GCFA 5BXIA 5FLXU 2XNQA 4MYUA 3CDUA 4ECUA 2RF2A 3HJFA 2UVUA 1U1QA 4BCAA 5FJ4A 3BQ2A 1FJGF 4DL3A 2B9WA 2Z2ZA 3GG1A 2CJ9A 2PC6A 3QIPA 1FERA 5CCMA 2EPIA 4OQJA 5E3CA 3A8KA 3OD2A 1DURA 1GK8A 2BKOA 1N54B 2HQGA 2AYBA 2K7KA 4I56A 3OJSA 1XMOJ 4PXDA 4DSLA 3SYZA 3W9JA 5IS2A 3QRQA 3FBBA 5KT4A 1H6KX 2DXDA 2X7IA 3PYDA 1JX4A 2NR0A 2IJFA 2I6WA 1IKVB 1Y5NB 2JEIA 2A18A 2HURA 2H51B 1VCTA 2FVSA 3SSSA 4DL0C 2DNKA 1MW7A 2FGOA 4CLFA 3TX8A 2FJEB 1WOPA 3GV5B 4GKJJ 4U96A 3V4IB 3W66A 3AY0A 4TVAB 2IPOB 4WE1B 1JWWA 4PPZA 3KK1B 2KHDA 4RR5A 3QFHA 3CMAS 4DL2A 5SZTA 1IKVA 4F4XA 3RU0A 1UVJA 1G3OA 4ZIVA 3PY8A 3EZ5A 4DV0F 3V4IA 4DV5F 1ZS6A 4WE1A 3KUGA 3KK1A 3QWPA 2GJIA 2BX6A 2C2NA 1VS3A 4MFBB 5M2PA 2CQDA 1OYDA 1QTNB 2PFDA 2Z2YB 2OD4A 1NJYA 1S0OA 3POTB 1AXQA 4DV2J 1RT4B 2DY1A 3DC2A 3R5JB 2CPEA 1ULRA 2M8HA 4M5KA 1Y5LB 4A8KA 2FLPA 2JNJA 3HHKA 4MFBA 2JLEA 3TAPA 3DNCA 2LA4A 4N8NA 1U8WA 2UZAA 3W5ZA 4CO0A 1RT5B 1HI8A 3K2YA 3CTRA 3POTA 2QGFB 1HR0J 3A4TA 1RT4A 2YNIB 3OXGA 2I0XA 2BJEA 2XMMA 1XQIA 4LF9J 1IJEB 1RLCL 5H9EK 3DXSX 2DO4A 5GAEI 2Q3PA 3I96A 1KRPA 4Y2CA 1FCAA 2FY8A 2HBQB 2RT3A 1RT5A 2FQQB 3IRXB 3SSRA 1CC7A 3Q8UA 2E5IA 1CG2A 2UU9F 5DDQC 2YNIA 2YPYA 2DGVA 1Y3JA 4HI2A 1PG5B 4PCQA 3W5YA 5I3QA 3HVAA 3MOZA 2GS8A 3G9CA 4MK9A 1L3TA 4NI2B 1RDRA 4LUBA 3I5AA 1J2VA 1GTEA 3AAWB 4L6V3 1T9VA 3LP2B 2IM3A 2BV3A 3IRXA 3C6UB 3A1YG 2FVCA 2GHPA 4P2FA 5ETLA 3GFHA 2JLFA 4ECQA 2QRRA 2XS7A 4ILRA 1ZZNA 2QZ8A 2L9NA 1DRZA 2C22A 1PAUB 2U1AA 4NI2A 2RH3A 4TYBA 2AP6A 1FRIA 3LP2A 2EEYA 2FHKA 3C6UA 2DVIA 2HFUA 3UDVA 3GYNA 1KTVA 2F4FA 3R6LB 2ZD1B 3RYLA 2O1PA 4X4PA 5LOQA 5KFTA 3HF5A 5THWA 4DV3F 7FD1A 2MQQA 2RQMA 1SL0A 1FK9B 2VFSA 4HACB 3KMSA 3UR0A 5B0EA 3D7SB 2P8IA 4F0MA 1MLAA 3JS9A 1SJ3P 2ZD1A 1FDBA 2QV6A 3J7A1 5J1PA 3BGLA 1WKJA 3Q2SC 1RQ0A 2DT9A 3DYAB 2CPFA 1FK9A 2DR7A 2HYIB 4HACA 3AB4B 1YBUA 4OYMA 3JAMU 1S0MA 2E9RX 2CNKB 3ENAA 4QBUA 1H7WA 1YJUA 3MEDB 5HVFA 3NEKA 3HHDA 3NGSA 1X5OA 1Q81T 4DG1B 2AX1A 3DYAA 2HVZA 2D69A 3OFEA 5EN1A 1YX2A 4UOCA 4WFNQ 2ZJPQ 3PX6A 3QSIA 1WDDA 4FN5A 3J7ZT 4OYAA 3ZFVA 4LF8J 1JK9B 4YQWA 2QJ3A 4P72A 3MEDA 1YZ7A 1U0SA 3E51A 4DQSA 4DG1A 3ZNJ1 1VQKS 3BZQA 1JLFB 1R8HA 4FVCA 1R89A 1XR6A 2CQGA 4A8WA 4DSFA 4DFKA 1Q86T 1TTHB 4I6YA 4FYXB 1NKCA 2JDJA 4BWJA 1TKZB 3HXMA 2E9ZA 3D4JA 2AU0A 1AUSL 2DJWA 3MPYA 1N56A 2XZWA 2IDEA 3V2UC 4RU2A 1JLFA 2OAUA 1N4LA 2QIFA 2K1RB 1RAEB 1N5YB 2GZOA 4IOAQ 4K5SA 2DY9A 2C3UA 1SJ4P 2RQKA 3MMCB 1TKZA 3ENWA 5D8HB 4QW8A 3CC4S 1AB8A 3GR1A 1Q95G 2HWTA 3WIVA 2ZJRQ 1VYAA 3P5BP 4B3TJ 3O44A 3H59A 5HROB 5A6PA 4IG3B 1D0EA 2UVRA 1N5YA 1YTYA 2OUGA 1UEKA 3AA9A 2MKKA 2JVRA 1R3NA 2Y0SD 5DDPC 2ALZA 2W9BB 2KB2A 3FEYB 3FBFA 4Z2XA 5L39A 3MMCA 1L3UA 1VRQC 4ED2A 1R43A 3NLCA 2EFVA 3OFHA 4ZPBA 3AJ1A 2GFFA 1L3VA 5HROA 4IG3A 3H4BA 2J7KA 5K5MA 1XNQF 3UNGC 3JTPA 2C42A 2W9BA 2GGPB 3AJ2A 1W25A 4AFFA 2EXUA 1X7VA 1FDNA 3O1LA 1FD8A 1OO0B 1KVKA 3FSYA 1S1TB 4ZP6A 3UN3A 2AX0A 2F4VJ 5L9XA 1NJZA 2FHOB 3FQLA 1KP6A 3IBWA 2IBOA 2VV5A 3S01A 2GGPA 1WWHA 1KC8T 3VWSA 2V34A 1K44A 3K0JA 3RBEA 1HBOB 4GVBB 2ASDA 5C42B 4WFAQ 1S1TA 2E1PA 5B0BA 4ZCKA 2AV5A 4HTJA 5IZHA 3EMTA 3IWXA 4LFAJ 3T6JA 1J27A 4I2PB 2DGSA 3RZAA 2Y1IA 1FD2A 1MMDA 4ALZA 2KVQE 1RKJA 3FBEA 3A12A 4NLUA 2WCXA 3M8RA 3EJMA 1HBOA 4ZVUB 3N6MA 4GVBA 5C42A 5A76A 2GO9A 4A46A 1PAEX 4OYIA 5CYMB 2HK3A 1U8SA 2OTLS 3HP6A 5HQLA 4ETXA 4XAKA 2OKQA 3RAQA 4MKAA 3CUNA 4I2PA 3SEOA 1VRUB 1YSJA 1F5AA 5CXTA 3C6TB 1RHJB 2DR9A 2K2PA 2I8EA 1RISA 1HQEB 1QDUB 2XWXA 3IC1A 1R6YA 5A0YB 2FZGB 2V8PA 4DCJB 3FKBA 2B9YA 1RTZA 1RI7A 2VKRA 2D3OR 4X4UA 1HYSA 3RGIA 1EJ7L 2MZ1A 4OZJA 1VRUA 3GWCA 5SUHA 2BJ3A 2FPHX 4NLQA 4DX7A 2YWKA 1YVFA 1X4HA 4QIEA 3LP0B 3RAMA 3W61A 5A0YA 1NHKL 1Q8BA 2MDAA 4AQYJ 3VAGA 2W8LA 2CDRB 3GV8B 1RWPB 5E3QA 1N5SA 5JXSA 1OJ4A 4C8YA 1Q7LB 1X5PA 2ILZA 1IN0A 3W1YC 2MLXA 1KHVA 4GKKJ 4R5PB 1I1GA 1A6LA 1OMSA 5KFFA 4LR7A 1FXLA 4V19J 1UFKA 1J5OB 3LP0A 4IKAA 4PQAA 5KT3A 2WBRA 3MMAB 3QJJA 2HVEA 1ZAVA 2CJQA 3J80U 4N47A 4PWDB 2P5VA 4USUA 3CD5A 3TANA 2CJBA 2GX8A 4ATNA 1RWXB 2KFNA 1NMEB 4R5PA 1LK7A 3OTOF 4NXMF 4LRBA 3TARA 3H5UA 4TYAA 1J5OA 3MMAA 4AE5A 4C9DA 3LAKA 3VALA 3NAIA 1NCLA 2CPJA 2ZBRA 4PWDA 3QZ8A 3I9ZA 4TQRA 3I56S 3FEXB 4I7FB 3K8WA 4PRFA 3P4UB 2K7JA 1ZETA 2WSFC 3ZTPA 2QTWA 2GMLA 3FRZA 1IXKA 3H90A 4F26A 2AKWB 3R1LA 1K0VA 1K9MT 1G2EA 2H5JB 5HJYA 2B4PA 2GAHC 4BHQA 2XMKA 4I7FA 1NO8A 4DWIA 4DV7J 3D3CJ 1M5HA 1SJFA 2UXDF 2CWKA 2BOAA 2OPSB 2VJUA 3R3TA 2X1AA 4F3OA 1T9UA 3GSIA 5GAEU 3O8WA 2VPXB 4NLRA 2DXFA 1NB2A 3LW5C 1VQNS 3KHRA 4NZ0A 1YZ6A 5DM7Q 2XCAA 4WP9A 1U1LA 1NK5A 2MHNA 1X4EA 1RUSA 2OPSA 3VQTA 3CXCR 3KG4A 2DNPA 2HZCA 5D0HA 3NWGA 3JYTB 5H9EJ 1N8RT 3NWRA 2ZDOA 4DN9A 5AT1B 2LQ9A 2IFXA 2FLOA 1FEEA 1YDLA 4F4KA 5H1SV 2ZH4A 3OLAA 4LF4J 3PNIA 2JLGA 1X5TA 2BABA 1S76D 2DXEA 4DU7A 4ZP8A 3JYTA 3HFZB 3FCVA 2VODA 4QIWD 3NGDA 1HNZF 2PGCA 2FC8A 3R6GB 3D3BJ 1V5VA 2L9DA 3OXLA 5EUHA 5CD4H 3VAIA 3J81j 1IBMF 2QMXA 4IQXA 3T1YF 1VBYA 3FBCA 2BKNA 1WJ9A 1X4AA 1NZ8A 2VF3A 1EKSA 2OPPB 2CZ4A 1HBUB 1QAXA 2AD9A 1IKXB 3LWMA 2MY7A 3KJVB 1VQMS 1KS2A 2DR6A 3M05A 1PC4A 4Q7AA 5CAAA 1ZH5A 3DFEA 4UT4A 3NMAA 2R42A 4U7CA 2QSFA 3H20A 2DH7A 4NA2A 3UI3A 4K4UA 1BXNA 5IT0A 2BE9B 2OPPA 1HBUA 3R5CA 4DV0J 3EM1A 1IKXA 3TA1A 1RYSA 3KJVA 1FTRA 3W60A 4FNHA 1VGYA 4K2XA 3FC9A 4EUVA 2H4YB 1H38A 5JMNA 3F0NA 1NDLA 1NJIT 2L3MA 2JX2A 2BMBA 2POKA 5GAHU 1XR5A 3QWUA 4FF3A 4EO6A 4OJHA 1KOOA 1U1OA 3FSXA 2W7PA 4IYQA 2OO4A 2GHVC 3JSYA 2KN4A 4ZDNA 2AYMA 4M5IA 1WF0A 3LALA 4LVOP 4RW9B 2M9KA 2FDNA 2QA4S 4JI1J 2WVFA 1QSLA 3PHTA 3MPVA 4KIAA 2DNGA 4M5DB 2IVYA 2ZM6F 3MR3A 4W90B 3A3PB 3HI9A 4ZVRB 2HMIB 5F8GA 4B3MF 2YTCA 1UVMA 2MJUA 1E6YB 4RW9A 3NS7B 5LSRA 1EIYB 5F0UA 3IAS9 4P74A 4KC5A 3QFWA 2ZUGA 4LF2A 4M5DA 2NLWA 3DDNA 2Y9HA 5E3AA 2AW0A 2EBEA 4TY9A 2HMIA 3FSIA 1QUPA 2ZH8A 2BQRA 2B8QA 1HWIA 1E6YA 3EUNA 2YWGA 4PXCA 4LMZA 2IA0A 3J7Z5 3VGSA 3HVWA 3K57A 4KHPF 5E33A 1TR0A 5CABA 1RTIB 3HD2A 1BWVA 3OW2R 2I5JB 3ISND 1X8DA 1QSYA 4N7TA 1VQLS 4EEYA 1U48A 3QRRA 2XQCA 4Z7CA 5DRKA 4NLSA 3B78A 4C8ZA 1GMWA 1CQNA 1AFIA 5LMUF 4J5OA 5BR8F 4R0JA 5K8PA 2JEGA 1RTIA 3S8SA 4DR6F 4OZ5A 4GRSA 3BREA 4WZQA 3DLEB 2VASA 2I5JA 3AD8C 3LPYA 1R31A 1OQ6A 4DR3F 2FIUA 3NG8A 1ROFA 2WZ1A 2ZH1A 3HHEA 2NXEA 3I4PA 3PV8A 5IM0B 3KLIA 1A0OB 1MMNA 4WKRA 4KRWA 1FDAA 4DV3J 2UXCF 3H4DA 1GTHA 1C1CB 5KFZA 4RNHA 2QLBB 4I4BA 1RXOB 4ED3A 1UKUA 3DLEA 4PAAA 4U6PA 2XY6A 3G2XA 1NPRA 3HSDA 4A47A 4PXEA 2MKCA 1TL5A 4P7VA 1CJVB 3QBCA 4F3MA 4PWWA 3RBXA 4KO0B 3Q8QB 2RIJA 1KLNA 1NSPA 1MNEA 5DQGA 4ZS6A 1M5PC 5KT7A 1Q5VA 2DGQA 4KT0C 5IM0A 3N5FA 3QGPA 4O3PA 2J9DE 1C1CA 1RAJA 2PEBA 1DBDA 2WK4A 3D6TB 4M5NA 1CQMA 1U6FA 2ZWOA 1UZDA 2OFHX 4X4RA 2VOOA 3CWJA 2QSWA 3MF5A 1CJVA 2FHJA 3W64A 1SI9A 4KO0A 4QCLA 4YMEA 3T1AA 1JXVA 2EI5A 3PG9A 3FMBA 1SJRA 1U0HB 4PZVA 1RK8A 1SUQB 1EAYC 1FE4A 3OTBA 1F3FA 2V4JB 3HO1A 4DV4F 2E5HA 2XLIA 3KWMA 3QAEA 3PEJA 4JI8F 5DG9A 4JB8B 3CCUS 5ETKA 2WOMB 3O6QA 1REGX 3CCWA 2ZUAA 1RHUB 2NZ4A 3KK2B 4PG7A 1U0HA 5C25B 3DHXA 1NKEA 1SUQA 2W2OP 4OJ3A 3OHAA 4ZVSB 4UZBA 5BJRA 1C2PA 2GNKA 4J9UE 4U9RA 2V4JA 1T11A 4YFUA 3H5SA 5IOLA 1VC6A 3KLVA 3TNVA 2CG8A 3GQCA 2KJVA 2HZAA 3HSZA 1RTHB 2WOMA 4M5MA 4A8SA 3T5HA 5L9NA 3KK2A 5C25A 2WVCA 5I42B 3SDEB 5KFLA 3TJAA 1XNRF 2PMHA 5ITHA 1NZAA 3I32A 1AW0A 1WC3A 4DR1J 1OWXA 5F8JA 3FZ2A 2X51A 2W7AA 1RTHA 4DSKA 1RHMB 5K20B 4AXIA 4DX6A 4RJVA 2A1BA 3N5BA 4OIXA 2ZZNA 3V6JA 3OL7A 2D1CA 4RNMA 2L48A 3CCQS 4EBCA 2CVIA 1DJ0A 5I42A 3SDEA 2KRRA 4RNNA 2OJ3A 1RJJA 2M3DA 2MZTA 5DQIA 3UFCX 1ICEB 1LWFB 1GMWD 2HHPA 2CAJA 2AZ3A 4LBIA 4LQ9A 2XCPA 2P6SA 5KFOA 1WELA 2XO7A 5A8RB 3N0VA 2CDQA 4EZ6A 4DHVA 2HHXA 4DF8A 1M90T 3M6WA 3HD1A 2C3MA 2OH2A 2VBXA 5H9FK 4O23A 5D0EA 2BJ7A 1XNQJ 3CDEA 5DQHA 1LWFA 3HM9A 2W4DA 2N3OA 4J9RA 3F56A 5LSLA 2HVIA 4P7TA 5A8RA 3MEEB 2MKSA 3RBDA 3IP0A 2FHMA 4RUBA 4Q45A 3W2WB 5IT4A 2GIQA 2P9EA 1FO1A 3I6PA 1D8YA 1F2HA 3LP1B 3HHLB 3T5LA 2O3DA 2YWFA 3MM6B 4ECVA 1QTMA 3HMJG 3MHYA 2KM8B 2DHGA 3OT9A 2G2ZA 4IH6A 3EVMA 1LKZA 1HWLA 2XO6A 3MEEA 3RRKA 2IM2A 1WC4A 5B0GA 3SFGA 1SVDA 3W2WA 3QNWB 2ASJA 2OI2A 3RW6A 3LP1A 3JTOA 3HHLA 4NYZA 2QC3A 3UW1A 4NOHA 1YJ9S 4WP8A 3HULA 3MM6A 4YDDB 3TZYA 2FJXA 2AQ4A 4S0MA 1NKBA 3FGVA 2RRAA 2PA3A 4NYOA 4C98A 1PBAA 4YY3F 2VA2A 1G6BA 5IT9Y 2Y1RI 2XGQA 1WHYA 2IDLA 3TAQA 4V1Ak 4JI3F 2YKMB 1AFJA 5E7OB 3NNHA 8RUCA 1NK8A 2RDIA 2KU7A 1KVIA 4U7UD 3GCXP 1VBKA 2MXYA 3MAAB 3VQSA 3Q22A 4KSEB 2IJRA 3QT7A 1FFWB 4P6QA 1HW8A 2C28A 5ETQA 4YS2A 4IH5A 4WXWA 1OPZA 3QT6A 1GFWB 1EETB 3D6MB 1TK0A 2BYCA 4B9TA 1EKRA 4AT1B 2YKMA 1LFWA 3M8WA 2VOPA 1ZOTA 1UA1A 3MEKA 4DV6F 3U02A 3MAAA 4IOBA 2AJ2A 1EARA 3K5LA 4I0WA 4PYDA 4ZLLA 2EFQA 2G2YA 3CCVS 3DGPB 3K8VA 1U2RA 4PWUA 2JL9A 4RW6A 2LQJA 2HBZB 4FS1A 1ZM3A 1FJEB 4X65F 2HHSA 3CD6S 2PD1A 2V6AA 2KFZA 1EETA 3CJ8A 1E6VB 5C7PA 2V2QA 2VC0A 2G2OA 2AJQA 2MYFA 4NZ6A 3QRPA 2NPIA 1AROP 2MQ8A 3DGPA 1HHTP 3HKWA 4F50A 3GYGA 2CJKA 3H98A 4WWSA 4Q44A 2ZH7A 4FZVA 4B3SF 3UDCA 4EBEA 2HFOA 4ZVEA 3DI6B 1RHRB 1WF1A 5EX0A 4XTTA 3JTNA 1E6VA 4C8MA 3N6NA 3OTOJ 4DFMA 1HR0F 4NXMJ 5C5JA 1BE4A 4ZVPB 4ZVQB 2UUWA 1V9OA 2DRDA 5I4MA 1K0TA 1PKUA 4NLPA 3IBCB 4OV1A 3QQCD 3B6BA 5E3RA 1SKWA 5L46A 1UP1A 4OYWA 1CJTB 3DI6A 1VI7A 4HDGA 3CCTA 3NRBA 2FLNA 2BEFA 1REVB 3X1LB 5B0DA 2LDIA 5F8HA 5F3ZA 1Z4UA 3E8OA 2RU3A 1KQSR 2LQ5A 4TQSA 1WTBA 1S49A 3K59A 3OV7A 3CJRA 1U09A 4ECYA 4LRFA 4X66F 1CJTA 1BHNA 2XZTB 5A8KB 2CQIA 1VK3A 3H25A 4HVZA 1UFLA 1REVA 5HATA 1RB0A 1PJ5A 5CYJA 4CLYA 3HHLD 3BB5A 2OP5A 1QVGR 1MU2B 2YWWA 1I6JA 2DISA 4I6WA 4KYZA 4NA3A 2CQ4A 2W2MP 5A8KA 3N4WA 3V6KA 3NCQA 1K1SA 1OQ3A 2DIVA 3M2VB 4KQZA 3MTKA 1Y10A 2FJDB 1VQ9S 3IR5B 3HPOA 2F7VA 4J9NA 1NJXA 3LOUA 1FXRA 2AJ0A 2B4VA 2FB0A 2ILYA 3K5OA 2U2FA 1SIZA 2BRKA 4KH0B 5G0RB 1MU2A 1EZZB 3DDKA 4L76A 2XULA 1AZSB 3AJDA 1S48A 3OFFA 1NM2A 3THVA 4Y0FA 4NASA 4ECWA 2HVDA 4DX5A 3DU6A 4OYOA 2AT1B 3HVTB 3BQ1A 3M2VA 2YNGB 2MB0B 3FJ2A 3DLHA 3TUZC 1B4SA 4OLPA 4PG8A 4A8XA 3F73A 1OYEA 2B9XA 5G0RA 1AZSA 5KFBA 1FRXA 3B82A 2AJ4A 4ES3A 4FPIA 3DGVA 5A2QU 1HNZJ 4ITSA 3HVTA 2FYXA 1KBRA 3ENQA 5F9NA 2LDYA 2YNGA 3T3FA 3V5RA 2RU9A 2HIQA 4MK8A 4J9LA 5L1LA 3OBIA 1PYOB 2ZJQQ 3FUYA 1IBMJ 1NHVA 5IWAF 2Z2MA 2EFGA 3PRVA 2C3PA 3A3NB 2ATLA 4DQRA 2ADBA 2CADA 1RGVA 1UVKA 3NCRA 4M5LA 1Q7YT 1RWWB 2ROGA 2Q43A 3HZGA 4HYKA 4FKXA 2BKPA 3EDRB 3WBZA 1VDHA 1VC5A 2J0QD 3KNAA 1XWLA 1ZM2A 1OY6A 2KM8C 2PI4A 4LSZB 1W26A 2M88A 4ZN1A 2QLWA 3MGJA 5D6GA 4JV2A 2R2SA 5L1IA 1JLEB 1QAJA 2Q66A 2HW3A 3MECB 3KLFB 1O51A 1J5EF 2LEPA 2IIHA 2JWNA 2W2PP 3BSCA 3BO3A 1OIAA 2LXUA 1AYEA 2UUAF 1HKAA 3EPGA 1HWJA 4K4SA 1TUGB 2E5LF 2EFNA 4FBUA 3MOJB 2ZKTA 2MJNA 3GJRB 3LGMA 2LEBA 2RB7A 3MM5B 3PR4A 3QGHA 1JLEA 4NZ7A 3CPWR 5F8MA 3MECA 3ULHA 4KTQA 3KLFA 1LW2B 4DL7A 2OGUA 4NMXA 2ZM6J 2IY5B 1S9FA 4NEZA 2CPXA 3W65A 3B4DA 2B3TB 4NX9A 2DNLA 4B3MJ 3MXHP 1FI4A 2W4CA 3U1MA 1N5VA 2ACMA 2XTJP 1TL3B 3E01B 1CULB 3MM5A 4FBTA 3TVYA 2COLA 3PYGA 2R7XA 4B17A 1R8CA 5D0GA 2BXJA 1U7LA 1UFWA 4OX9F 1JLQB 4K8RA 1T3NA 1IBCB 1LW2A 3PKMA 2JJ4D 1FDDA 1QLNA 2C2EA 5A2QY 4WP3A 5GADI 1X4FA 3AD9C 3NP5A 1VOMA 1TL3A 2XY7A 2HFVA 3E01A 1AT1B 1CULA 5ADZA 1H98A 4KH1B 2V8DA 3PO4A 2V4RA 4KHPJ 2WW8A 4OV6A 1JLQA 3TA2A 1R8BA 4DV1F 2XG8A 1QAYA 1PILA 3EZUA 3MCOA 2OIHA 1WSVA 1KKHA 2H1YA 3FMWA 4DF4A 2M70A 3I82A 2NSCA 5KFKA 3A8IA 3D0IE 2H65B 2NUHA 2F4VF 4IFYB 5LMUJ 2ZC3A 3GJTB 1EB0A 3CD7A 4I2QB 1P1LA 1D9FA 5BR8J 4C2MA 2VBZA 2YQ3A 1HLWA 3RUBL 1GXLA 4DSJA 4LF5F 4DR6J 2IRUA 4UQGA 4DZ6A 2XY5A 1PO6A 4FXWA 4DR3J 1X5SA 5HANA 2NCKL 2VONA 4IFYA 1U2FA 4I2QA 2UXCJ 1S7HA 1RT1B 2W9AA 3RRHA 1XTZA 5LJ3Y 2KRBA 2F40A 3T9ZA 3HZEA 2MQNA 2J7WA 5J2MB 3OR1B 1IBKF 3TRGA 3PJWA 4ZJOA 3W62A 4TKTA 4WFXA 2XM3A 4X84A 3EX7B 2HS3A 1VHIA 1HBMB 1YJVA 4DPYA 1TK5A 1LW0B 5H9FJ 4OX7A 3DRYA 3Q2TC 1IWAA 3VGVA 3CJSA 2GIFA 1RT1A 2LQBA 1MWYA 1YRXA 5F3TA 2Y3YA 3TUIC 5J2MA 3OR1A 4BC7A 2ZEJA 5D77A 1WG1A 3MFHA 4TU8A 3RRGA 2ZVSA 2F8MA 1IM6A 1TVRB 1WHXA 4EGLA 3J81U 4NYPA 2J9EA 4ZPDA 1LQ9A 1HBMA 1LW0A 4F4ZA 1FWLA 4DXLA 1AUDA 4DOZA 5KG3A 3MAQA 4J9OA 3CE8A 1KD1T 4WKYA 3M2RB 3IS9B 2C2ZB 2X3GA 2KZZA 4F36A 3D6FB 2QG9B 3OXFA 4DV4J 1PC5A 3DDIA 1TVRA 3HDSA 5EX3A 5KFUA 3DHWC 4CQ1A 2ERRA 8ATCB 2D3O1 3DKDA 3EVWA 4ZLPA 3AQPA 1B0TA 2A6OA 3M2RA 3IS9A 1TV6B 3GFZA 1M0SA 1VBXA 4GKKF 3D28A 4LR9A 2E5JA 1NU4A 3KFWX 2HG4A 4K7QA 1S5ZA 3GZ7A 1NLKL 5E5NA 2CQ3A 4ZLNA 1CBKA 2ZHAA 4ED8A 4OFZA 3M8YA 1TV6A 5HL7Q 2O66A 4GC7A 2HGMA 3MCNA 3Q8YA 1F9HA 3IXQA 4RNOA 1XNRJ 1L5UA 4JYAF 2WTFA 1S1VB 2ZNYA 1RAFB 5GAGU 2B56A 5HVHA 1NDCA 5KG2A 2BQ3A 1TL1B 2R2TA 3PM9A 5KOWA 3EVOA 1HIYA 4KJIA 5G4DA 2XZDB 1T9XA 4MIWA 3C3LA 2WAQD 2CQ1A 2DNRA 2AMCB 3L9ZA 3D9BA 2P2CB 4PG4A 4ZA1A 1N36F 4QIGA 1B99A 4TN2A 1BUXA 4KB7A 1TL7B 2MPUA 2W25A 1TL1A 3J81Y 4Q2LA 4JI5F 2RVJA 3QMQA 4ENOA 2NPFA 1NHUA 1O5JA 4DFJA 1B70B 4JOUA 1VQ5S 1NH7A 3HVRA 4KKOB 1S0VA 1EHWA 2HHHF 2WB1D 1NPPA 4C8OA 4CRJA 3W63A 1TL7A 4QWDA 5GVQA 3R8YA 2ASYA 5GMKa 3GR0A 3LTOA 4XPCA 2UP1A 3PX4A 3CC2S 2QO3A 5DDOC 3GPAA 5J2QB 4KPYA 4LVNP 4G6VB 4Y2AA 2I38A 4NA1A 1GX6A 4RKUC 3M6XA 1UWBB 4CH0S 4DPTA 4KKOA 3D66A 1Q82T 2Y8YA 3MPUB 2RS2A 2YNHB 2ZHBA 1L3SA 2FY1A 3P6YC 1NBEB 4RUCA 1UTAA 2OELA 5J2QA 1WC6A 2XNRA 4LF4F 3CGIA 3PFOA 2CXEA 2ZWPA 2J0WA 4X64F 4DFPA 2XYGB 1NK4A 3TOQA 2XMTA 1HBNB 4CTAB 2YNHA 4MKYA 5DM6Q 5IQQA 1N0UA 4GO5X 4JI2F 2GJ2A 4JV1A 5L38A 4YY3J 5KT6A 3P8BB 1P9YA 3Q86A 2Z56B 4P10A 1YIJS 4JI3J 2ZOGA 3JSBA 3TJ8A 3QT8A 3PDNA 3KNGA 3DCAA 5LSOA 3CJ0A 4OJ1A 1FRLA 4EK2A 1HBNA 4CTAA 4MAKA 3MZIA 3P49B 2H5EA 4UF4A 4Z37A 1JLCB 2YX1A 2LFVA 4PXBA 2OEKA 3I31A 2CUYA 4GC6A 1C1BB 1IR2A 1WI8A 3PW5A 1FTCA 1YG0A 1V3RA 5E3PA 4EFAC 1LNQA 4QR1A 3MMJA 4DV6J 1FWKA 1TFWA 1DTQB 3UN5A 4FYDA 3OTDA 1S9EB 3PACA 1FRMA 2VBYA 1YRUA 1JLCA 3PIOQ 5AE2A 3LUYA 5JVGQ 1M1GA 1I5OB 4X65J 4K2JA 2HLTA 2F3JA 1C1BA 2W2QP 2NXNA 3CCES 5J1NA 3CIMA 3M1VB 4IR1A 1KLMB 1SKSA 3GJSB 3U1NA 3W2VB 3HSJA 3IGVA 1ZTTA 1DTQA 3UE2A 1S9EA 3K5MA 4JI1F 1VIXA 3BN4A 2JFKA 4AUKA 4O3OA 1WC5A 2DGUA 4B3SJ 2KVIA 3R27A 2QLFB 1IUJA 1YRTA 1SQEA 2E7XA 1TQLA 4ERDA 3M1VA 2QYCA 1KLMA 4QWBA 2IYGA 4KE5A 4EYHB 4NPOA 3W2VA 5K8MA 2ZBQA 2ZVIA 1YI2S 3IM8A 2E1CA 4Y6IA 1HMVB 3RJMB 2AGQA 1WKKA 1Y4ZB 2F63A 2ZH6A 3ZO7A 4C0OC 3CCJS 3N28A 5HK4A 4USHA 3M9OB 2DHSA 5M2UA 2DBBA 1UEUA 2ZOFA 3TVKA 3VGTA 3UDLA 4ZPTR 2VFVA 1F5BA 2KI2A 2MGZB 1HMVA 1APSA 3ZTRA 2F5GA 4M63A 1BLUA 3NAHA 1Q53A 1UJ6A 1WC1A 4USWA 2ZH5A 2HAFA 5HP1B 4KR0B 2XLJA 4X66J 4DBQA 3H40A 3ICLA 1NSKL 1A9NB 1RU2A 4ANCA 1JXEA 5D4LA 4NCGB 3DOLB 2V9WA 2GVZB 4ZVFA 1XK8A 2HQ3A 2BANB 2B7CB 3R7BB 3TWZA 4UW2A 2MGZA 2J0SD 3DLKB 2VU5A 1NEEA 4A4JA 1U26A 2YBVA 3Q89A 4DZDA 2MHEA 4WTYA 4C48A 5HP1A 4XPEA 7AT1B 1KTQA 2GV1A 2F8EX 1YKWA 2VB6A 3G96A 2BJ9A 4NCGA 5KFGA 2OMLA 4EZ9A 3DOLA 2GVZA 4NRUA 2BANA 3MPWA 2E7WA 5IFMA 3OUYB 3DLKA 1RT2B 4K59A 2P9CA 2MKYA 4E98A 4OZNA 3CJKB 4F4WA 4QW9A 3CO0P 3GFYA 3HFVA 1HNWJ 5IQ6A 4YB7A 5AE3A 4P75A 4DSEA 3PXGa 2ACYA 2HK2A 3S6EA 1RT6B 1GXTA 3H0PA 2AGPA 2RMLA 3OUYA 5MLCV 4ZN3A 1V6HA 4DCOB 1N33F 4Q2MA 1QY7A 1RT2A 4UOHA 1S1WB 4M5HA 4FYVB 4YR0A 4FF4A 4DQIA 3CJKA 2HHQA 2G1HA 4A8OA 1YJTA 2DPIA 4ECRA 4GVLA 5E41A 4TY8B 2CPZA 3M9NB 1RSCA 4OYPA 2X1GA 3TVZA 2J9DA 1VQPS 3VR1A 1DFDA 1RT6A 3C16B 1HI1A 4I68A 3QYYA 3IG1B 5DLFA 4DPOA 2R8KA 5IC4B 5IWAJ 1S1WA 1NAQA 3M8ZA 2QLXA 3GV7B 3SXLA 3JQMA 4IDKB 3I9V9 3UD5A 1C0TB 4QU6A 2XWYA 1SKUB 1GMVA 4TY8A 4P2MA 3KOAA 3UQSA 2D74B 2PO4A 1VQSA 4KHRA 1JLBB 1VHFA 5T41A 1S6OA 3C16A 2HKEA 3SCIE 1X9WA 3IG1A 1S7IA 3ZXWA 2HBRB 4J9MA 5DETA 3OVSA 1I51B 1T94A 3DLLQ 5D78A 2PMWA 1NSQA 1IR1A 4IDKA 1C0TA 1SC6A 4DJBA 3DN9A 4Q8EA 3ILLA 2ROEA 3LAMA 1JLBA 3PEHA 3OVBA 1FX4A 1RCOB 2V2ZA 2R7WA 2B43A 3KJNB 3BKTA 3OQ2A 5CH7B 1J5EJ 5DGAA 2OSRA 2UUAJ 3KLGB 3G6YA 3QPIA 3TJ9A 4UUWA 2FVPA 2E5LJ 2M52A 2J9CA 2HHWA 3T41A 2PT0A 3R5AA 2MLZA 3R9LA 3RB3A 2RE1A 2K8GA 1CPZA 3NOGA 4DR1F 2EW9A 3BYRA 5HVGA 4QR2A 4X4VA 3IFEA 5GMDA 1QM9A 2RS8A 4DX8H 2RSQA 4M1KA 3KLGA 3Q24A 2CG4A 4O44B 4IUFA 5C2GA 3MUVP 2RQCA 4ED6A 4IG0B 2GHWA 2YX7A 2K1RA 3PHEA 4Y00A 2Z58B 5AJ3F 2NYHA 3CW2C 3KKFA 4OX9J 1T9WA 1CSJA 4G1QB 1KQGB 3VF0B 2HGNA 1YBTA 4NCAA 1RA7A 3TX0A 5J2NB 4O44A 5K9FA 1FKAF 4NLYA 1T03B 1VQYA 4GMKA 1N5TA 1UETA 4OHYA 3KXDA 3H2VE 3OL9A 1GT8A 4IG0A 4NXNJ 3HLUA 2EFPA 4J91A 3MAHA 4TU9A 1VQ8S 2KTQA 2W2NP 2HQCA 4RWWA 5DGBA 4DV1J 4G1QA 4X62F 2FGCA 2YY3A 1JMTA 2HQDA 1P1TA 3MTJA 1H73A 1U1NA 4C3LA 5J2NA 5A6WA 3NMRA 2KT3A 1T03A 1F5CA 3BEGB 1GH8A 3VAHA 1YQHA 4CM2A 3SCLE 3MI7X 3QZ7A 2BRLA 2CJAA 1S9GB 5EWEA 2VG7B 2MQMA 4AL6A 5A8WB 1ELOA 3AD7C 1U4BA 4H4MB 4IO1A 1P9QC 4IQMA 1TK8A 1U47A 3C14B 3FCWA 4LF5J 1RWVB 1GEHA 3N01A 2CIMA 2O5DA 4CH7A 3ZZZA 3BSOA 2E66A 4LSNB 1U49A 3PIPQ 4DCPB 1S9GA 2VG7A 4O3QA 5A8WA 1G1XA 1GAOA 4OI6A 3MM8B 4H4MA 4P2XA 2AF6A 1FVSA 2JEFA 3HJVA 4WPAA 1T9TA 3VZIA 4A8QA 1SH0A 2ROPA 4QPXA 1IBKJ 4PUOB 3QLHB 3TW0A 2ZKUA 1TAUA 1VC0A 4LSNA 3PJXA 2B7BB 3DLGB 1RE1B 2YKOA 4KAIA 3KLHB 4CLKA 4EWTA 1RYRA 4RUHA 2PE8A 3MM8A 4EU0A 4NLGA 1BC6A 4QYRA 4H4KC 1ZPWX 4JI4F 2HRUA 3NGRA 4PUOA 4ZCMA 3QLHA 4TLRA 4PPDA 3CEDA 2DNNA 3I5BA 3TP2A 4M5GA 5ETOA 2HHVA 1WD6A 3BH6B 3DLGA 5CYMA 3PFEA 4OYZA 1VK8A 5EDWA 3KLHA 2HRYA 2CA9A 3QATA 2NSBA 4OLOA 3C6TA 2GVDB 3KUHA 1N32F 1YGYA 2AZ1A 2BZ2A 3RAXA 2WSEC 3UN2A 5HSPA 1VJWA 2PDAA 1NUEA 4B08A 3OTEA 1HQEA 2UUCF 2G0JA 3VGUA 5ETNA 2SXLA 3C46A 3EGVA 1YK9A 2KH9A 2ZC4A 2J6UA 2DR5A 1F3VA 5KFSA 4USJC 2F65A 3DOMB 2YKPA 1RTJB 2GC8A 4F25A 2C2OB 2LXIA 2GVDA 4LR8A 3G8QA 2ADCA 2DIUA 5HQMA 4ECTA 4ECZA 5KFEA 2HVHA 2DKOB 5KTQA 4J9PA 2JH3A 3A8JA 4ZK7M 2X1FA 3G4SS 3R1HA 1C4AA 1X4DA 4O0NA 3VCDA 1SQGA 3DOMA 2G0IA 4XK8C 1RTJA 3BR9A 3VTIA 2XMUA 1H7XA 1R7IA 2JHEA 4LIRA 4EYIB 4K4VA 4ES1A 1SXLA 4WJBA 2JC0A 4Q5VA 4JYAJ 2A0FB 1K73T 1U1RA 4K5RA 4MTPA 3GFXA 1JIHA 4IOCQ 3CF5Q 3CCLS 4MJKA 4ZMMA 5JJBA 5K8OA 1L3KA 2MY8A 2JRSA 4HHJA 1RAAB 4LRDA 1FF2A 4O3SA 3AXKA 3D6HB 1X4BA 1CEZA 1R27B 3UDEA 4DS5A 4W4MA 3MMBB 1N36J 2R8JA 4ELUA 2M7SA 4B9UA 1SL2A 2KL8A 4HKQA 2BW2A 1LWEB 2K06A 3D0GE 5L8RC 3NL0A 4OZ0A 3PRBA 4WIQA 3TQEA 3SV3A 4JI5J 2VC1A 1T95A 2UUTA 4HR2A 2BE7D 1LWCB 3NNCA 1NPKA 4F4AA 1ZM9A 3TI0A 2EC2A 2V4QA 1B64A 2Q6CA 2FZKB 2HHHJ 3MMBA 4C3MA 2R9LA 4DLGA 2KFYA 4KV8B 4RW4B 3GTYX 3VVUA 5KFMA 1LWEA 4LJMA 4RZRA 1Q8LA 2I2YA 4HT5A 2NZCA 2VICA 2LKZA 3BJYA 2ZITA 4DMZA 1LWCA 3G87A 3CJTA 3KLEB 2BJ1A 1WNEA 1BY9A 2AEMA 1XIQA 1X9SA 4OHVA 4KV8A 4RW4A 2R2UA 2OTJS 4CLSA 4JI7F 3THTA 4ZPCA 2VL1A 5I3PA 2WSCC 2GMHA 3DRXA 4IH7A 1UVIA 2M0GB 4FS2A 2GQCA 1HW9A 4F4YA 3KLEA 2ZZMA 4X64J 2DNOA 4C7QA 3CJ5A 3ET6B 3M8PB 5LXRA 3BF4A 2VPZB 4QIVA 1G7CB 1VR6A 4F02A 4K0KF 2BQUA 1XN9A 1JQGA 4JI2J 4OI0A 1I94F 1HHQA 4OYBA 2XI2A 3TR5A 3WC0A 2KO1A 4DN0A 4KPCA 2FVQA 2HBYB 4Y2KA 4DR5F 2CJXB 3ET6A 3M8PA 2YPZA 3RR7A 5AXMA 5HI7A 4RBUA 4ETZA 2DGXA 3WIUA 2N82B 3CCRS 1O0PA 2R8IA 1WHWA 3MR6A 4PKDB 4ES2A 2FVRA 3BGOP 4CLUA 1RHQB 4U8VA 3KJQB 4YR3A 2MMYA 1N34F 4F67A 4YB1P 4ZJQA 1HQUB 3NXZA 1RWMB 1UVNA 4X2BA 2VG5B 3I55S 3WHIA 3TAMB 2Z8QA 4NL5A 3S7RA 2RHQB 1TKXB 1PYSB 3VVTA 3PRDA 4FPRA 3OSNA 4ILMA 3J7YI 3FEZA 2R4FA 4R8UB 3CMQA 1XERA 2IRXA 1HARA 2VKZG 3BV8A 2B4UA 1YJRA 3ZTSA 2KYXA 3GP9A 2C2RA 3AOCA 1B7YB 2QA4G 1HQUA 1K47A 2VG5A 4ED4A 4K4YA 2F8HA 1JLAB 1OY9A 4KGZB 3TAMA 3TUPA 3CCZA 1TKXA 2RUSA 5KFJA 2NS1B 3QIDA 3R2DJ 2V94A 3GIKA 1BD6A 4R8UA 3IGNA 5KFCA 1BQNB 2R7OA 4KY3A 3WX8A 2JOQA 4OX8A 2YNFB 1JLAA 2VBWA 2ZH2A 1VJQA 1ZM4A 4J9QA 1TMJA 2A10A 1IWGA 2CKWA 4RO0A 5FLXY 1DAXA 2DNMA 2YVSA 2XYHB 3SZ2A 1BQNA 3V6HA 4J7CA 3GMGA 1S4EA 4QR0A 2D3ZA 4O4GB 2RQ4A 4ZITA 4Q43A 1QAIA 4P9SA 2C2DA 4JI6F 2QE5A 5D4PA 2YNFA 2C3OA 3DM2B 2VHGA 4NMLA 1UZHA 6FD1A 4PG6A 1VLYA 1NRKA 2BE2B 4CO4A 2Y1JA 1IQTA 2OEMA 4YB6A 1URRA 4ZKAA 4FDFA 3KJFB 4ELTA 2XB2D 4O4GA 2OFGX 2NUUG 4ELVA 4CO3A 4UZCA 5F0WA 5BYSA 3EXYA 1FE0A 1HNXF 4AYBD 4EMDA 2QL9B 1KHWA 4NE9C 1RAIB 2HLUA 3DM2A 4WK3A 1QVFR 3TA0A 2CZ9A 2B4OA 2EFOA 2BE2A 4C0HA 9RUBA 4DUYF 5IC6B 2F9JA 1U45A 1CC8A 2HZVA 2AEFA 4M95A 3D1QA 3GIRA 2QT7A 2BR0A 2C2MB 2IJNA 4PQUB 4OMFG 1V3SA 1TL4A 1M1KT 2AHOB 3KHLA 3RB0A 2D7SA 5DLGA 3UD3P 3BGUA 1IJFB 4WFBQ 1TP7A 5FDLB 4N41A 1FFSB 1WKLA 3EGZA 4C8NA 4FYWB 2CPDA 3MEGB 1N6QB 3CD0A 1RADB 2VPWB 3ILOA 1SL1A 4ZIWA 4PQUA 1JJCB 3F44A 2WHOA 4YOEA 1N33J 1F60B 3ZZPA 2M2BA 1H0HB 3P3DA 5RUBA 2GAGC 4XO0A 2QX0A 2YXLA 5FDLA 4R0EA 1TAQA 1K1QA 3L4BC 1RBOB 3VAFA 1KVJA 4W92B 3BQ0A 2YWHA 3MEGA 1N6QA 2EWHA 3TZZA 1MSWD 3FK4A 4WFZA 2DGOA 3I0RB 2R7UA 2BBEA 3OR2B 5C24B 3T5JA 3U7JA 2GA7A 4WCEQ 4DQQA 2H3EB 2AGOA 4DPWA 5DJBA 3O2IA 3H2UB 3ELHA 4W98A 5L1JA 2I9SA 3NBPB 2KHCA 2V0NA 3KMQA 4AXJA 3D1OA 3I0RA 2DYAA 2WVDA 1MWZA 2DCLA 4DDFA 3R5DA 1M1HA 4MMOA 5CHCB 3OR2A 4DS4A 5C24A 3SI8A 1TFYA 3EPIA 4O3RA 1NK7A 1R6VA 3GONA 5GAHI 4ECXA 4MT1A 3ZNUA 2DTJA 2JSXA 1KOHA 1TMMA 4I1TA 2J0XA 3NBPA 4NWBA 1RACB 4BLGA 1FA0A 4FP9A 4URSA 4I69A 2MLYA 3T6BA 5M2RA 3I87A 2UV8A 5B09A 2RRNA 4E2FB 3T1HF 1ZTWA 4DI6A 2DNQA 2MTLA 2CPIA 2VG6B 2HNYB 1Q8IA 2NXJA 1UPPA 2E1MC 3GU0A 1JB0C 1F0XA 2LLZA 3D5MA 3W9HA 3KDOA 4B3RF 3BM7A 4ED5A 3NY0A 1NK6A 1KN6A 5IT9U 5KFRA 2KJWA 3CIZA 1RAOA 2X1BA 2AYEA 3SSQA 3EICA 5LXYA 2XSJB 4USVA 2CNLB 2DEJA 2KDOA 1NSAA 2VG6A 2HNYA 2W4PA 2UV8G 5CA5A 2WW4A 3N79A 5B0AA 2BACA 4DSIA 1UW9A 1O8BA 4HT7A 5AJ3J 3PVXA 4HL9A 3OL6A 1DZ5A 3QO9B 3NNAA 2QYGA 2MZJA 2OSQA 3X3UA 4ZVTB 4J9KA 4DUZF 2H4WB 5J1EB 4LF7F 3IWLA 2UXBF 1YBAA 3BN7A 4KBIA 4HHHA 3ZZ0A 4M94A 2XSJA 3ILIA 4J37A 2WVBA 2G13A 1ZPVA 2G1DA 5KG4A 3CB4A 1GXUA 1N48A 1RAGB 3MD3A 4H4OB 2J6SA 3PKYA 3FDSA 3HT0A 3NGUA 2YWEA 3BDEA 2IHR1 3QO9A 1U1MA 5B0CA 4X62J 2MSSA 2K3KA 3MM7B 2BM0A 5J1EA 5T14A 1RBLA 4LRCA 1WI6A 1SKRA 4Z7YA 4U8YA 3JAMY 2W8KA 2HNZB 4H4OA 3LQVA 1IQZA 3QJLA 3LANA 1UVLA 2W9CB 3VV2B 3FQKA 2O01C 3ETOA 1T8EA 2KG0A 1TELA 2KYZA 3MM7A 1CJUB 1UA0A 4Q8FA 3L7PA 2R7SA 3ADAC 1YLXA 2FHJD 4DR7F 1H2VZ 2HNZA 4A8MP 1H3DA 4B9MA 3ITHB 2ABYA 1SH3A 4RW7B 2B9EA 2W9CA 3BH7B 4UY8T 3RR8A 3ZTOA 2IAJB 1CJUA 2HAIA 4OI1A 2AIRB 2M8DB 3MD1A 4IRCA 1S72S 3SCKE 4R25A 1VIOA 2QEXS 1MN9A 2KXFA 2V69A 3ITHA 2E5GA 2PI5A 1VQOS 4E8UA 4RW7A 1UPMB 3PW0A 4CM0A 3MR2A 2JZ5A 2PN6A 3G8TA 4WXOA 4CYUB 3FFIB 2IAJA 2B51A 4PABA 4D3HA 4JI4J 2V8VA 3W8GA 1MG7A 4JI0F 3GILA 1FHTA 4Y65A 3K17A 3DRPB 2A2CA 3M32B 5IXUA 1V3ZA 4IR9A 2B0GA 3T19A 2VQEF 1PSDA 4C11B 2ZBPA 3NGTA 4ECSA 1HYSB 2E44A 1GX5A 3L95X 4CYUA 2MSTA 3FFIA 2W1BA 1N32J 2IBKA 2VA3A 2V67A 3P96A 4ER8A 4LF1A 3DRSB 2UUCJ 2IA6A 1RWUA 2KG1A 2YH1A 3OSPA 4RPFA 3KHHA 1I3OB 2Z4PA 1T9YA 1HPZB 3DRPA 3M32A 4JV5F 1S6UA 4C8KA 1FFGB 4C11A 3NS6A 3AH6A 2GQ2A 4BDPA 1RKIA 1SB6A 1SC3B 1KFSA 2L41A 3OJUA 1S10A 3DRSA 5LJ5Y 2EK6A 2HWIA 4RUAA 5FD1A 4RBVA 4L74A 5CYQB 2MZRA 1HPZA 2DR8A 2DPJA 3UVJB 5DZ7A 1YJNS 3AB2B 5I3UB 1NH8A 1SQFA 4CP5A 3MCSA 3MR7A 4LFCJ 5EHHA 4RWXA 4UOGA 3Q0AA 4A8FA 1YJWS 2M5YA 2B6AB 1RWOB 1WEYA 2DH8A 1QD1A 3JQJA 5CYQA 3EGNA 1HI0P 3J7YU 2G0CA 3CDWA 3UVJA 2IYIA 3UPFA 5I3UA 3D0HE 4ZCIA 2XMJA 1B7FA 1R8AA 2F1FA 3M4XA 1D9DA 3BKUA 3OL8A 1T0TV 1RAHB 2HS4A 2PIIA 2MQPA 1DQ8A 3B4MA 1GQEA 3R97A 3UCGA 1ZA1B 4CNZA 2ZH3A 1JXLA 3EDQB 2B6AA 4RW8B 5DG8A 4DR2F 3IRWP 3E3XA 4YHHF 2WRMA 3C15B 4FNIA 4NLDA 2BOPA 2IVMA 2KT5A 4ZVHA 4PEOA 4K4WA 2WVEA 2RD5C 2OD6A 1KONA 2Z57B 2VFUA 5B7WA 3MR5A 3EZOA 2LA6A 3TZXA 3TO8A 4YR2A 2BJ8A 1ZBTA 3DMJB 5KFAA 2AWZA 3O3LA 4RW8A 3M7VA 3AOBA 2Y8WA 3BPSP 5MAOA 1U6ZA 3PCOB 5DO2A 1R0CB 3C15A 5KFXA 4ED7A 2XLKA 1HNIB 4G1IA 3NKYA 2J7UA 4KGVB 2AEJA 2QA2A 4PG5A 4FF2A 1FX2A 1S1UB 1S59A 1O6XA 3UO0A 3HT3A 4WZMA 3DMJA 1RLDA 4MK7A 1EP4B 2N7YA 3ZZTA 2W24A 5DZ6A 1OPIA 3VAJA 3G71S 4EBDA 2DRAA 1QUVA 5CZVA 1S6QB 3GCWP 1XMQF 2ASLA 1HNIA 1HNWF 2I1RA 4DR4F 4JI7J 1S1UA 1IM4A 1EQMA 3G6ES 2JFDA 1Y00A 3O5TB 3Q83A 1EP4A 1D3WA 3C19A 4NEYA 1RCXB 4Y2IA 2NXUA 1XBWA 2P6TA 3T5KA 1S6QA 3OVAA 3CJ2A 1S6PB 1FJGJ 3G6XA 1Y11A 2HFNA 3NS5A 4K0KJ 1C0UB 4U7UK 1I94J 3SIPB 2MKJA 5KFIA 2XBPA 4OZ1A 4CH1A 4ZLJA 3I0SB 3KTQA 2PA8D 4WK1A 1DARA 2RKIB 5KAKA 2MQLA 3IR6B 3V81B 1WTFA 4CCHA 3B54A 4HLBA 2XEXA 2J76E 4DR5J 2VFRA 4CO5A 3J80Y 5DG7A 1KSPA 1S6PA 3M8QB 3CULA 4J90A 3LGHA 4JP8A 2VH7A 3BBCA 2IM1A 4CO1A 3AQOA 1C0UA 1Q1KA 1B0PA 3M6UA 2LCWA 4QWEA 2AJFE 2FJBB 1LWXA 2A2DA 1NJWA 3I0SA 2IMOA 2RKIA 3W5XA 3V81A 1Y7PA 4FF1A 2Q79A 1Y9OA 3KG1A 1LK5A 3M8QA 1N34J 4DLEA 4HI1A 2NREA 1NDKA 3OTCA 1ZAXA 2R8GA 5CZXA 1BWEA 2HIYA 1HHSA 4CZCA 2VJVA 5HQ8A 1NB7A 2CPHA 3RB4A 1FRJA 4XIUA 3PYEA 3JSMB 3SFUA 1N0VC 5D15A 2RHSB 3OPKA 2HEKA 5J2PB 2ZNZA 1TUVA 3QGIA 4RNFA 3AHPA 3MUTP 2JEJA 3PJ9A 3BDPA 4DV5J 3MM9B 1ZAWA 2E29A 3GIMA 2CQHA 3M8SA 4V19X 1AA1B 3M30B 4O4RA 1JNRB 2YH0A 3JSMA 2ZFHA 4UTGA 3H42A 3MDFA 4USMA 5CCLA 4ID5B 3Q8RB 1P27B 5J2PA 1FRHA 3QJPA 5DDRC 3F41A 3BBFA 2JVOA 3MM9A 3VAKA 3D1HA 5F8LA 2CQ0A 3OFGA 3ONQA 3M30A 2KXHA 2DO0A 4G1PA 3CCMS 2LEAA 1MMLA 3Q23A 2ZBIA 3HKZD 1GNKA 4ID5A 1UWAA 1RTDB 3W7BA 4JI6J 3CC7S 2DRBA 2XHWA 1FNXH 4NXNF 2FC9A 4LIWA 1HA1A 1FVQA 3A13A 3RW7A 2WB4A 3UCUP 2R7QA 2AJ1A 3NGKA 2F9DA 1Q4RA 1HWKA 2R7TA 1EX8A 4MIBA 3TUJC 2H9ZA 4HH0A 2EVZA 3H7HB 2QN6B 1HNXJ 4A48A 1RTDA 3QAUA 1FESA 5HAOA 1ZYQA 3P45B 2YKQA 4ZVOB 2UU9J 4CT9A 1P6TA 3JXOA 4LFBF 3BR8A 4RLEA 4DUYJ 3G8SA 1PJ7A 4ZVGA 2G4BA 4HH1A 1YITS 4OYXA 4ZOSA 2FD2A 2N7CA 2HGLA 5KG0A 4A8YA 3LH2S 1S97A 1T02A 2D9PA 1B0VA 5LL6d 2KKHA 2IC3B 3NCPA 4ZCLA 2C3YA 3KG0A 2FUG9 3KLIB 1D9AA 4C97A 2V68A 4B9NA 3BSNA 1S4FA 1Q16B 4XDDA 1X0PA 2VQFF 2DCUB 3CNQP 1VQ6S 1WOSA 2X3DA 2Y1LB 4MKBA 1S1XB 2VUGA 1NNDA 1CS4B 3IMQJ 4NLVA 1S12A 3KK3B 2VFTA 5KOXA 1WORA 2IC3A 2C1EB 2DEIA 3ZZUA 1TKDA 3DRRB 1B3TA 4N56A 1U6BA 2CQBA 1FKOB 3R7SB 1EQ0A 3PW4A 2FJVA 4N8OA 1DQ9A 2BA9A 3M9MB 2IMWP 3AT1B 4QWCA 1S1XA 4F0HA 3EXCX 1CS4A 1R8PA 3KK3A 4JBCA 2DH9A 2RNEA 1FKPB 3NOCA 3CMES 3FRYA 2J8AA 4UQTA 3K5NA 3DRRA 3ZZRA 1FKOA 3C66A 2HHUA 1HNVB 3CJQA 2PMZD 4KFBB 1WACA 3HFKA 1OSDA 2ZH9A 5HMXA 1FKPA 5AXKA 2UVVA 5CD4A 1OSCA 2N4CA 1GMUA 3CT9A 2RJZA 3L09A 1FRKA 3ISNC 1HNVA 2B5JB 2GJFA 4ANDA 3PR5B 4TXSA 4KFBA 1HWUA 1TZ0A 2E1AA 4DL6A 4HEA9 2K3IA 3AXMA 4ZHRB 4KGKA 1V5IB 3G6VA 3RG6A 4UY85 3T1HJ 2M4MA 4JUZA 3FCHA 2BJDA 5LMNF 2ZDPA 5KG6A 2CNOB 1LXNA 2R2RA 3BGRB 1SJQA 4L3NA 1DHMA 2B5JA 2XI3A 1FNMA 1S0NA 2KZMA 2DHAA 5IV4A 3VHQA 2BW7A 2D9OA 3JSRA
chains in the Genus database with same CATH topology
4OZ0A 3IN5A 3THVA 4QBUA 2WONB 1H7WA 1YJUA 5CQGA 3MEDB 3PRBA 3HHNB 4Y0FA 2UUBF 4NLTA 3SV3A 4ECWA 1QJHA 4ZHRA 3HHDA 2VC1A 3U27A 1WHVA 3DU6A 1X5OA 1T95A 1IR0A 3H2LA 3HVTB 1Q81T 4DG1B 2AX1A 2EG2A 2UUTA 3BQ1A 3M2VA 2YNGB 3DYAA 1LWCB 2MB0B 1M5OC 2HVZA 3NNCA 3FJ2A 1ZM9A 3TI0A 3DLHA 2V4QA 1B64A 2Q6CA 3BGRA 3OFEA 3TUZC 5EN1A 4OLPA 1XEZA 4UOCA 4FXDA 3MMBA 4C3MA 2R9LA 4DLGA 4PG8A 4WFNQ 4A8XA 2KFYA 3F73A 2ZJPQ 3PX6A 2B9XA 4KV8B 4RW4B 4FN5A 4YB5A 5G0RA 5KFMA 1LV5A 3J7ZT 1LWEA 5KFBA 1FRXA 3B82A 3ZFVA 1JK9B 4LJMA 4C8LA 4YQWA 2AJ4A 2WONA 4ES3A 4RZRA 3MEDA 1Q8LA 3PO5A 4F2RA 4OL8A 4DEZA 4QU7A 1S1VA 5HMYA 2I2YA 1LXJA 3E51A 4ITSA 4HT5A 3HVTA 2V8GA 4DQSA 1U1PA 4DG1A 1IBLF 2LKZA 3ENQA 5F9NA 2ZITA 4DMZA 3BJYA 2FJAB 2LDYA 2YNGA 1LWCA 3T3FA 3V5RA 3KLEB 4I64A 2BDPA 2RU9A 2HIQA 1VQKS 1BY9A 1WNEA 1HFEL 3BZQA 1JLFB 2IM0A 1R8HA 3ZZYA 2PEHA 4MK8A 4CI0B 4OZLA 4J9LA 5L1LA 4OI4A 4FVCA 3OBIA 2ZJQQ 1R89A 4KHMA 1XR6A 3GIJA 1NK9A 1NHVA 2CQGA 4A8WA 4OHVA 5EWFA 4DSFA 1X9SA 4DFKA 2RDJA 5IWAF 4KV8A 2Z2MA 4RW4A 2R2UA 2OTJS 2EFGA 1Q86T 2C3PA 4G3IA 1U25A 2MQOA 4JI7F 4OHWA 2ATLA 4DQRA 2NYIA 4I6YA 2ADBA 3CSKA 3THTA 4ZPCA 3MUMP 1RGVA 1UVKA 2VL1A 3NCRA 1NKCA 2JDJA 3IWNC 2HS0A 5I3PA 2WSCC 2GMHA 1Q7YT 3DRXA 4BWJA 3WDOA 1TKZB 1VRTB 4IH7A 2ROGA 3HXMA 2Q43A 1UVIA 3HZGA 2E9ZA 1RA6A 2M0GB 4HYKA 4FS2A 2AU0A 2GQCA 1HW9A 2DJWA 3MPYA 1N56A 4F4YA 3KLEA 2ZZMA 3WBZA 2XZWA 3V2UC 4RU2A 1JLFA 1D1UA 2OAUA 3PW2A 3IR7B 1UEVA 1VC5A 1N4LA 2DNOA 2QIFA 2J0QD 2K1RB 4C7QA 4B9SA 1DQAA 1XWLA 3CJ5A 3M8PB 3KNAA 4GO7X 1ZM2A 1N5YB 4K50A 2KM8C 2PI4A 1LOUA 1KNZA 5LXRA 4IOAQ 3BF4A 4K5SA 2C3UA 2VPZB 4QIVA 1G7CB 4URQU 4F02A 4K0KF 2BQUA 2M88A 1XN9A 1SJ4P 4ID8A 2QLWA 5JUMA 4OI0A 3MGJA 2J6TA 1I94F 2J5AA 5D6GA 4JV2A 2R2SA 2RQKA 5L1IA 3MMCB 1TKZA 1VRTA 2XI2A 3ENWA 4IFVB 1JLEB 4BWMA 3TR5A 4D3GA 3WC0A 5D8HB 4K4ZA 1QAJA 2KO1A 2Q66A 2HW3A 4QW8A 3CC4S 3MECB 3GR1A 4DN0A 2HWTA 4LSLB 3RTVA 3KLFB 1O51A 2FVQA 2ZJRQ 3GYXB 1RP5A 4Y2KA 4DR5F 2Z2LA 4OI2A 3O44A 2LEPA 1J5EF 2JWNA 3H59A 3M8PA 5HROB 5A6PA 1UJ4A 4IG3B 1D0EA 2UVRA 1N5YA 3BSCA 1YTYA 3BO3A 1OIAA 2LXUA 3RR7A 2UUAF 3EPGA 3ENVA 5AXMA 1HWJA 1NK0A 3AA9A 5HI7A 4K4SA 2MKKA 2JVRA 4RBUA 4ETZA 1R3NA 2Y0SD 5DDPC 1N32F 2E5LF 3WX4A 4LF6F 2LVWA 2ALZA 2W9BB 2DGXA 2EFNA 2KB2A 3U1LA 4FBUA 3MOJB 3FEYB 2ZKTA 2MJNA 3LGMA 5KT2A 2N82B 4TNOA 4TU7A 2LEBA 4Z2XA 5L39A 2RB7A 3ISZA 3MM5B 3CCRS 1UWBA 3MMCA 1O0PA 3PR4A 3QGHA 4IFVA 1JLEA 4NZ7A 4NLWA 2R8IA 3CPWR 1L3UA 1WHWA 3MR6A 4ED2A 5F8MA 1R43A 4PKDB 4ES2A 3MECA 4B02A 5KFWA 4RX6A 2FVRA 4LSLA 4BS2A 3NLCA 3ULHA 2EFVA 3FNNA 3OFHA 4KTQA 3KLFA 4ZPBA 3AJ1A 5KT5A 1LW2B 4DL7A 2GFFA 2LXFA 1L3VA 1KEKA 4YR3A 5HROA 4IG3A 4O0IA 2MMYA 3H4BA 1S9FA 1N34F 2J7KA 4F67A 5K5MA 1XNQF 4YB1P 2CPXA 1HQUB 1UVNA 4N5SA 4X2BA 2VG5B 3UNGC 3B4DA 3I55S 4C0BA 2B3TB 4NX9A 3JTPA 2Z0GA 2DNLA 1FNOA 2C42A 3TAMB 3MXHP 2W9BA 2Z8QA 4NL5A 2GGPB 2W4CA 3S7RA 3U1MA 1N5VA 4ILLA 3AJ2A 1W25A 1TKXB 2QMWA 3SQGB 4AFFA 1TL3B 2VPYB 3E01B 5AE1A 3MM5A 1X7VA 1FDNA 3O1LA 4FBTA 1FD8A 3PRDA 3ZZOA 4FPRA 3TVYA 1OO0B 2COLA 3OSNA 3FSYA 4ILMA 3J7YI 3FEZA 4B17A 1R8CA 1YHQS 2R7XA 2BXJA 2R4FA 4R8UB 4X4OA 1U7LA 1UFWA 4OX9F 4IRKA 1JLQB 1XERA 1T3NA 1S1TB 2IRXA 1LW2A 4ZP6A 3PKMA 1HARA 2VKZG 2B4UA 5LT5A 1YJRA 1XMOF 2AX0A 2JJ4D 5L9XA 1FDDA 2KYXA 2C2RA 1NJZA 1QLNA 2FHOB 2V8HA 1SBRA 3FQLA 1C4CA 2QA4G 4WU3A 2ZOMA 1HQUA 2MKHA 3IBWA 2C2EA 5A2QY 1XMBA 2IBOA 2VG5A 4MYTA 5GADI 1X4FA 1QE1B 4K4YA 1JLAB 2F8HA 3TAMA 2VV5A 3S01A 2GGPA 3DOKB 1WWHA 1VOMA 3CCZA 3NP5A 1KC8T 1TKXA 2YX4A 3SQGA 1URNA 5KFJA 3VWSA 1TL3A 2XY7A 3E01A 5ADZA 4OI3A 3K0JA 2GO8A 1H98A 2NS1B 2V8DA 3QIDA 3RBEA 3PO4A 1HBOB 2V94A 3GIKA 3PZPA 2V4RA 2ASDA 5C42B 1BD6A 2WW8A 5T7LB 4WFAQ 4J9SA 4R8UA 3IGNA 5KFCA 2O67A 1BQNB 1JLQA 3TA2A 1R8BA 2R7OA 1S1TA 4F8RA 2CQCA 4DV1F 3RB6A 2XG8A 5B0BA 4GKJF 1QAYA 1PILA 3EZUA 4YUDA 4NLOA 4ZCKA 2AV5A 4HTJA 5IZHA 2OIHA 3IWXA 2JOQA 4OX8A 3T6JA 1UL3A 2DNYA 2YNFB 4I2PB 2DGSA 1QE1A 3FMWA 3KTQA 4RW6B 3RZAA 4DF4A 2Y1IA 1FD2A 1MMDA 4ALZA 1JLAA 2VBWA 2M70A 1RKJA 3I82A 3DOKA 2ZH2A 2GMJA 1ZM4A 2NSCA 4J9QA 5KFKA 4K4TA 2DNZA 2A10A 3D0IE 4NLUA 2CKWA 2FJWA 2WCXA 2NUHA 5FLXY 3M8RA 1VQ4S 2F4VF 1DAXA 2DNMA 1HBOA 4WF9Q 3N6MA 2YVSA 2CFXA 4IFYB 1WG5A 2ZC3A 5T7LA 5C42A 3CD7A 3SZ2A 4I2QB 2GO9A 1BQNA 4A46A 1P1LA 3V6HA 3GMGA 1D9FA 4C2MA 4QR0A 2D3ZA 2VBZA 2YQ3A 4O4GB 2RQ4A 2XMWA 2FLLA 1ZZFA 5CYMB 1U8SA 2OTLS 4Q43A 3HP6A 1QAIA 3SMZA 1GXLA 4DSJA 4LF5F 4ETXA 3DLBA 4XAKA 2OKQA 2C2DA 4JI6F 2QE5A 1M5SA 1UAWA 5D4PA 3RAQA 2IRUA 2CRLA 4MKAA 4YDXA 3CUNA 2YNFA 1KQFB 4I2PA 3SEOA 2C3OA 3D54A 4UQGA 1DTTB 1VRUB 1YSJA 1F5AA 5CXTA 3C6TB 2XY5A 1PO6A 3DM2B 4NMLA 2DR9A 4FXWA 4F2SA 3CDBA 6FD1A 1X5SA 2K2PA 4PG6A 1VLYA 1IKWB 1NRKA 2BE2B 2I8EA 4CO4A 1RISA 2Y1JA 1IQTA 1HQEB 2VONA 5F8NA 4FXVA 3S1TA 2XWXA 2CQPA 3IC1A 4IFYA 1URRA 4YB6A 4ZKAA 5GAGI 1R6YA 1U2FA 4I2QA 5A0YB 4ELTA 2XB2D 4O4GA 1FJCA 4Y3CA 1S7HA 1A7GE 2OFGX 4DV2F 2NUUG 1RT1B 2B9YA 2W9AA 4ELVA 4CO3A 3V4MA 1RI7A 2VKRA 5F0WA 5BYSA 1XTZA 3RRHA 3EXYA 5LJ3Y 2KRBA 1FE0A 2D3OR 1HNXF 2F40A 4AYBD 3T9ZA 4X4UA 3HZEA 1HYSA 2CPYA 2MQNA 2J7WA 2IRYA 5J2MB 4WFYA 2MZ1A 3OR1B 1IBKF 1KHWA 3TRGA 2DK2A 4OZJA 1DTTA 3PJWA 1VRUA 5B0FA 2CQ2A 4TKTA 4WFXA 1UMJA 2HLUA 3DM2A 3GWCA 4WK3A 2V2KA 4X84A 5SUHA 1QVFR 3TA0A 2FPHX 3EX7B 1CLFA 2HS3A 2B4OA 2EFOA 1IKWA 4NLQA 2BE2A 4C0HA 1HBMB 1YJVA 1TK5A 2YWKA 1YVFA 5L1KA 4DUYF 1LW0B 1X4HA 5H9FJ 2XS2A 2GQQA 3H5XA 2F9JA 2HPUA 4OX7A 4QIEA 3LP0B 3RAMA 5A0YA 2XS5A 3DRYA 3Q2TC 1Q8BA 1U45A 1CC8A 2MDAA 1RT1A 2LQBA 3VAGA 1MWYA 2W8LA 1YRXA 4M95A 3D1QA 2QT7A 5F3TA 3GV8B 3TUIC 5E3QA 2BR0A 1WEXA 5B08A 1N5SA 5JXSA 2IJNA 5J2MA 4PQUB 4OMFG 4LF9F 3OR1A 4C8YA 1V3SA 4BC7A 1Q7LB 1TL4A 1X5PA 1U24A 2ILZA 1Y5IB 2CYYA 5D77A 3KHLA 1WG1A 3RB0A 3MFHA 4TU8A 1M1KT 3RRGA 2ZVSA 2D7SA 1OS5A 1IN0A 5U47A 3IAM9 5DLGA 2F8MA 1WEZA 2LYVA 1TVRB 1WHXA 4EGLA 3UD3P 3CDAA 4NYPA 4UUXA 5K8NA 3BGUA 1IJFB 1KHVA 2J9EA 4WFBQ 4ZPDA 1LQ9A 1S99A 1TP7A 5FDLB 4R5PB 1I1GA 5KG7A 4N41A 1A6LA 1HBMA 1VFJA 6FDRA 5KFFA 4ZPVR 1LW0A 4F4ZA 3EGZA 1FXLA 4V19J 1J5OB 3LP0A 4C8NA 2CPDA 4IKAA 3MEGB 4EO8A 4PQAA 1N6QB 5KT3A 4DOZA 1AUDA 2WBRA 3MMAB 5KG3A 3MAQA 4J9OA 3QJJA 3CE8A 3CD0A 3D2WA 1KD1T 2OMOA 3M2RB 4WKYA 3IS9B 4JV0A 1ZAVA 2CJQA 4URGA 2VPWB 2X3GA 1SL1A 3M6VA 2KZZA 2P9GA 1JKHB 4PQUA 4N47A 3F44A 2P5VA 2WHOA 4PWDB 4YOEA 4HTIA 3OXFA 1F60B 3ZZPA 3CD5A 5GADU 2M2BA 3TANA 1H0HB 3P3DA 1VMBA 1PC5A 2CJBA 1TVRA 2GX8A 4ATNA 3BSAA 4XO0A 3HDSA 5EX3A 4H4KA 3KYLA 5FDLA 1Z2ZA 2KFNA 4R5PA 5KFUA 1LK7A 3OTOF 4R0EA 3DHWC 4NXMF 3BO2A 1KQKA 1TAQA 4CQ1A 2ERRA 1K1QA 4C3KA 3TARA 3H5UA 4TYAA 4ZLPA 3VAFA 3AQPA 4P2SA 1J5OA 4W92B 3BQ0A 1KVJA 2YWHA 3MEGA 1WF2A 1M5VC 5KFHA 1N6QA 3MMAA 5LSOA 2EWHA 1B0TA 4AE5A 1MSWD 4C9DA 1JJHA 3M2RA 4WFZA 2DGOA 3IS9A 3LAKA 3Q8PB 1TV6B 3GFZA 3VALA 3I0RB 3C2PA 1M0SA 3HK2A 3NAIA 2VZ9A 2CPJA 1JKHA 1VBXA 4GKKF 4PWDA 2R7UA 2BBEA 3OR2B 3D28A 1JJ2R 5C24B 3T5JA 3QZ8A 3U7JA 2E5JA 3I9ZA 4TQRA 2GA7A 1NU4A 3KFWX 4WCEQ 4DQQA 2HG4A 3I56S 3FEXB 4I7FB 1JJ4A 3THPA 4N77A 2AGOA 4ED0A 2ZHOA 3K8WA 4PRFA 4BC9A 5DJBA 3O2IA 3H2UB 4B9LA 3GZ7A 2K7JA 1ZETA 3GIIA 7FDRA 2WSFC 5E5NA 2CQ3A 5L1JA 2I9SA 4H54A 2ZHAA 3NBPB 2KHCA 2V0NA 5HO4A 4ED8A 2GMLA 3FZBA 4OFZA 3KMQA 3FRZA 4AXJA 3D1OA 1IXKA 1TV6A 3I0RA 5HL7Q 2O66A 4F26A 2GIRA 5KG1A 1MWZA 2DCLA 2HGMA 4GC7A 1X0FA 1FT8A 1M5KC 4DDFA 3R5DA 1N52B 3IXQA 4MMOA 5CHCB 3OR2A 4RNOA 4DS4A 3R1LA 2IVFB 5C24A 1K0VA 1K9MT 1G2EA 2B4PA 4Q0BB 3SI8A 1TFYA 3EPIA 1L5UA 4BHQA 4O3RA 2XMKA 1NK7A 4I7FA 4JYAF 2WTFA 1NO8A 4DWIA 1S1VB 5GAHI 1M5HA 1S77D 1Z2LA 1SJFA 4ECXA 2UXDF 2DTJA 2JSXA 4ICLB 1KOHA 2OPSB 3K7RA 2ZNYA 3R3TA 4I1TA 4HDHA 2X1AA 4F3OA 2J0XA 5GAEU 5GAGU 2B56A 3NBPA 4NWBA 3O8WA 4M8LA 2VPXB 5KG2A 5K14B 4DL5A 4B3OB 1FJ7A 1FA0A 4FP9A 4URSA 5D3GB 4I69A 3T6BA 5M2RA 1TL1B 2BQ3A 3I87A 2FTRA 2R2TA 2UV8A 3PM9A 4FVMA 4NLRA 5KOWA 3LW5C 3N6LA 1VQNS 5B09A 4KJIA 3KHRA 3L7OA 5G4DA 2RRNA 4NZ0A 5HN0A 1CVJA 4Q0BA 1HD1A 3T1HF 1ZTWA 2DNQA 4MIWA 3SV4A 5F9LA 3W3SA 2CPIA 5DM7Q 2XCAA 3C3LA 2WAQD 1U1LA 3UCZP 1NK5A 2MHNA 4TLQA 2CQ1A 1X4EA 2VG6B 2HNYB 2DNRA 2BM1A 4X4SA 1Q8IA 3N9UC 4ICLA 2OPSA 3CJ3A 3VQTA 3QGGA 4PG4A 4ZA1A 3CXCR 1N36F 2E1MC 4QIGA 4TN2A 3KG4A 1JB0C 2DNPA 4KB7A 4ZPWR 5DS7A 1F0XA 2HZCA 5F41A 2LLZA 3NWGA 5K14A 4B3OA 3JYTB 5D3GA 3D5MA 4ZPAA 2MPUA 4LT6A 2W25A 1TL1A 5H9EJ 4B3RF 1N8RT 3BM7A 4MIAA 2LMIA 3J81Y 1NK6A 4ED5A 1YWXA 2KXNB 4Q2LA 2ZDOA 1X9MA 4DN9A 5EGYA 4JI5F 2RVJA 1KN6A 2LQ9A 5KFRA 2KJWA 3QMQA 3CIZA 3IO1A 2NPFA 2RILA 2IFXA 2X1BA 2AYEA 3HX9A 4CT8A 1NHUA 3CVKA 1O5JA 1IKYB 3I5CA 4DFJA 3SSQA 2FLOA 5LXYA 4X4NA 2XSJB 2HHTA 2G9OA 4ED1A 3LO3A 1FEEA 2KDOA 2XGPA 4JOUA 4Y2MA 2VG6A 1VQ5S 1NH7A 2YKAA 2HNYA 3HVRA 1DLOB 4KKOB 3PX0A 2W4PA 4NLXA 4F4KA 2UV8G