5LL6d

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTGKRLAKKVARRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ll6d00
5IT9Y 5FLXY 3J81Y 3JAMY 3J7A1 5A2QY 3J80Y 5LL6d
chains in the Genus database with same CATH superfamily
1ZZFA 2XHWA 2H3EB 1QM9A 2ZITA 1ZS6A 5KOWA 3LOUA 2HKEA 3DRPA 1KEKA 1UW4A 2M52A 2VQFJ 2LQ8A 5HROB 3GFHA 5KT7A 1RWNB 2RS8A 4UOHA 4WBFA 4DR1J 2R7OA 3NMAA 1H74A 1EETB 2IAJB 2PC6A 1S76D 1FI4A 1RU2A 3BBCA 2P9EA 1T8EA 1NHUA 4KBIA 3CCQS 3D9BA 5K5MA 3T6JA 4A8OA 2LP4A 1B70B 3VWSA 1IVZA 4DSKA 1DTTA 4ZS6A 3KUHA 3CPWR 1WC5A 3OR2B 1Z1ZA 3OL8A 2BM1A 2ILZA 5CYMB 4WFBQ 4K4SA 1S99A 1TKZA 1VQYA 2FGCA 4BWJA 1ZOTA 4DV3F 3DKDA 1NK8A 1T9TA 3AOCA 4I1TA 2HRYA 2UUCJ 5J2QB 2N3OA 2B6AA 4NXNJ 1M1HA 2K1RB 2KO1A 3MM7B 1VQLS 1NRKA 2E5GA 3M7VA 3NGUA 3MFIA 1FHTA 1SKRA 4DPOA 4NPOA 3JSMB 1AZSA 2BJ8A 2J7KA 5A76A 2V5HG 1SKSA 2JC0A 4J9NA 3GV7B 3RAXA 2GW8A 1H98A 2IDEA 1UWBB 4O4GB 1NO8A 5ETKA 4ZVUB 4JI8F 4NZ6A 4WPAA 3EE3A 2I8EA 4JI4J 1H38A 3IS9B 3POTB 4Y2AA 4C8NA 4QYZJ 3AD7C 1X4CA 1FVSA 3P45B 1RTJA 4ZVGA 4C98A 3QO9B 5J1PA 1HWIA 3CSKA 4KAIA 1TKTB 1Q95G 2VD3A 4FPRA 2VC0A 4ITSA 2FY1A 2QT7A 3V6DB 2R7UA 1RT4B 3SFGA 4ER8A 3PW5A 1OS5A 2E1RA 2ZOMA 1B4SA 3DLKB 1KLNA 5HBMA 1IQZA 4CP5A 3UVJB 5DGBA 3PX4A 1ROFA 4L3NA 3OD2A 3KJFB 2MTLA 2ZKTA 1NK7A 2BQRA 4LQ9A 4C9DA 3I4PA 4L73A 2WZ1A 1T0TV 4F26A 1YJWS 4IR9A 2FJBB 3GFZA 1S12A 4ECYA 4UOCA 3Q24A 3BN4A 5DM6Q 2KRBA 1S1TB 3VAJA 1KOHA 3HVWA 4QWEA 4DR2J 2BACA 2KT2A 4PYDA 4KGKA 3NAIA 4Q8EA 3BKTA 4LT6A 3SCJE 1NJWA 1RCOB 2C22A 3TUZC 1TL7A 1U8SA 3AA8A 3JAMU 2F40A 4KE5A 4DPWA 2BKPA 1MWQA 3C6UA 3M8SA 4NYZA 2QA4S 3ZTQA 1XR7A 5AJ3J 4PXCA 3Q8VA 4J37A 5H9FJ 3KNGA 3CD5A 4DHVA 2LQBA 5I3QA 4GVLA 2ZHOA 2M88A 4C8YA 2VOPA 2BJ1A 3A12A 4K2XA 2BXJA 3T1YJ 3NS7B 1S0VA 1PBUA 1N88A 3MAQA 2EBGA 2OKQA 3WC2A 3C19A 1FD2A 2HQCA 2AGPA 2N4CA 4NZ0A 3BF4A 4PQAA 2D69A 3FBBA 2VBYA 2E5LF 2YNHB 1XNRJ 1HHTP 1NSAA 1NH8A 2Q43A 1JX4A 1TUGB 1NKEA 1HBUA 4EEYA 3QSYB 3T3FA 3M32A 2XI3A 3U1LA 1TMJA 3TJ9A 3E01A 2VA3A 4A48A 4Y6IA 3CTRA 4J9KA 2RKIB 1O8BA 3BGRB 5CYJA 1Q78A 4IQMA 3M8QB 2XY7A 2CWKA 2YKPA 4LF1A 3BR8A 4R5PB 4DG1B 2Z2LA 5HMXA 4M5GA 2B43A 1FJGF 3R5CA 3PNIA 3BJYA 2UUBJ 4PG8A 2VPXB 3KHGA 1S7IA 5L1KA 5D3GA 5K14B 2BQ3A 1LK5A 1IR1A 2C2ZB 8ATCB 4I2QA 2ZUGA 2BM0A 4XPEA 1L5UA 1VQ7S 1YRTA 3DN9A 5T7LA 1C1CB 3RZAA 3WQPA 4NEYA 4PG6A 3L95X 1KKHA 1U6FA 4C8ZA 3R2CJ 2BVZA 1TKDA 2DXEA 5CD4H 1MLAA 4DSIA 3TI0A 5F41A 2DNZA 5RUBA 2B4VA 1NK4A 2CAJA 3L3CA 2VFVA 2D3O1 2BOPA 2CPFA 2JJ4D 1C4CA 4FYWB 4OZ0A 2YKNA 3IAM9 4OX6A 2DNOA 2HVEA 3G4SS 3N6MA 4QIEA 1D9DA 4I4BA 3TEHB 2DEJA 5HROA 2R7SA 2R7TA 4U95A 1WI6A 1OIAA 1EETA 2IAJA 1HNWJ 1X31C 1FWPA 2EVZA 1E6VB 2CQBA 3MXHP 5IQ6A 2NYHA 1VQ4S 1BD6A 3VAMA 3BQ0A 2KZMA 1ZM3A 3OR2A 1X5OA 4DZ6A 2OAUA 2XZDB 5CYMA 5GAHU 3I9V9 1CS4B 2ZH2A 2Z58B 2NXNA 2ZH5A 3AJ1A 1DARA 5D0GA 4MT1A 5BXIA 3PTWA 1FFGB 2HFVA 3AD8C 5J2QA 4Q43A 3HD2A 1LXJA 3Q2TC 4WKRA 3R5DA 1I3OB 2K1RA 4DV2J 1Q7LB 5BJRA 2Z57B 5D8HB 2MY8A 2GA7A 2F65A 3JSMA 3FSYA 2ADCA 2HFOA 2BANB 1Z2ZA 1M90T 1S9FA 4GC7A 5IT9U 3A8EA 4LR9A 4KHMA 2YH1A 4LF5J 1DHMA 2OO4A 3GCWP 1NSPA 4RKUC 3FVYA 1TTHB 1UWBA 4O4GA 2HNDB 2KN4A 4JI7F 2BJ3A 1P6TA 3MMCB 3IS9A 3A1YG 3POTA 2KZZA 1FRXA 2RDJA 1HNZF 4DV4F 4M5DB 1B0PA 7AT1B 3PEJA 1Q82T 3EDQB 4H4OA 1ZAXA 1Q0NA 2ZVSA 3LGHA 1H7XA 1TKTA 2QG9B 1FDDA 2QA1A 4ANDA 2DR7A 3V6DA 1RT4A 1HR0F 4ED0A 1S1XB 1HW9A 1VDHA 4URSA 2DD8S 4CO3A 1T03B 4FKXA 1X4EA 1VHIA 3M8ZA 2MGZB 3UVJA 1XC9A 5LXYA 5A0YB 3NS6A 3S7RA 1CVJA 2M2BA 1WOOA 3CC4S 1BHNA 4ZPTR 3CCRS 4ZPCA 1ZTWA 1TP7A 1FNXH 2VPYB 5GADU 1KFDA 4ZJOA 2Z56B 2JLEA 2QMWA 1S1TA 5LM7E 1J5OB 1NJIT 1B7YB 4ZMMA 3IMQJ 1GXUA 3H5YA 4IFVB 3OLBA 3QWUA 3N6NA 4Q0BB 1KQSR 2E5JA 3M6WA 4USJC 1NKBA 4F3OA 2IYIA 2MLYA 3FRZA 4IYQA 7FD1A 2GHWA 4DN0A 2QE5A 2HWTA 2BE2B 1QD1A 4Y2CA 3ZZ0A 1WHXA 1R0AB 3KK2B 2WSFC 3MI7X 3T1HJ 5A2QU 2HVZA 1VISA 3M4XA 3V6JA 2UXBF 3W66A 2Z4PA 2V8DA 3P96A 2YNHA 3GJRB 2OIHA 2G2ZA 3HXMA 1HQEB 3HI9A 2OFGX 2X1GA 2M70A 2NCKL 4DL5A 1FO1A 5KFCA 4EZ9A 1RI7A 2RB7A 2YH0A 2V8PA 2OP5A 4M5IA 4LRFA 3CJRA 2RKIA 3ENQA 2BYCA 3BGRA 4XTTA 5GVQA 1KVKA 5LL6d 3M8QA 4K0KF 1NPKA 4PZVA 4R5PA 4DG1A 2D3UA 5C24B 4CCHA 2H4WB 4F2RA 2Q66A 4ZVOB 2BRKA 1OYDA 4N7TA 4IH6A 3UDLA 4AFFA 2UXDF 2MDAA 2D1CA 3NG8A 4K7QA 5K14A 1YITS 1FE4A 2HZCA 5B08A 3CD6S 1S48A 5KFQA 2ZD1B 3MFHA 2P8IA 4LRBA 2MEWA 2KT3A 5B0CA 4JI0J 1C1CA 3P4UB 4WTOB 1H0HB 3MTJA 2FJEB 1X60A 2PEHA 4AUKA 2JRSA 4OQJA 5SUHA 3MD1A 4M1KA 3LUYA 3VCDA 1O51A 2F3JA 3R97A 3CJSA 3PDNA 2XLIA 2KG0A 1TVRB 2WOMB 3OTOJ 2AX0A 4KYZA 1BE4A 4JV5J 1TUWA 2VHGA 2MZRA 2YNGA 4O3SA 2M3DA 2WONB 4HH0A 1KSPA 2P2CB 2RDIA 5CZXA 1VLOA 2I0XA 3ZFVA 3PW0A 3HVAA 3IR5B 3UO0A 5C42B 1R7IA 5B0GA 2ZZMA 2XHCA 3NOGA 4ERDA 3DCAA 4CWBA 4X84A 4ZPVR 2WVDA 4N47A 1W2IA 1NDCA 5DG8A 1E6VA 4ZPDA 2LQ9A 1ZZNA 3DRRB 4KC5A 2VQEF 1ULRA 2CPZA 2W2PP 1IBLJ 1QSSA 2R42A 2NR0A 2CQDA 3UE2A 1AA1B 5J1NA 4F4XA 5EX0A 5KOXA 2QLJB 1RTDB 1BWEA 5CHCB 3FDSA 1EP4B 3PRVA 1CS4A 1IWGA 3LPEA 5JMNA 1TAUA 2M9KA 4KV8B 3PKYA 1SBRA 3QYYA 4YB6A 5AE2A 3MR5A 2YWHA 1GX5A 2OSQA 1VQMS 1WJ9A 3A13A 3S01A 3CCMS 3OVBA 3G2XA 3BYRA 2UUWA 3RB4A 2A3JA 3DMJB 2VIHA 2M0GB 1LKZA 3AFGA 1RWWB 2PDAA 4F0KA 2VONA 3N5FA 2G9OA 3K5MA 1NJZA 2RQKA 4CLWA 2E7VA 2H9ZA 2HWHA 2E9RX 3ZXWA 2BANA 1N5TA 1WWHA 3I0SB 1IQTA 1JJCB 1VRUB 1U1NA 1UJ4A 1RISA 3ILOA 1ICEB 1M5SA 1HWUA 2KJVA 4XDDA 2BJDA 2JC1A 3PRBA 3NCPA 2W7AA 2HNDA 2EG1A 4D3HA 3BPDA 4C8LA 2DVIA 3PIOQ 2RSQA 3MMCA 4EMDA 3D5MA 2N82B 4ZVEA 3PX6A 1WHWA 1LFPA 1JJHA 4MK8A 3UI3A 4K59A 4M5DA 1VBKA 5D77A 3H2LA 1YZ6A 3PEHA 1KBRA 3H2VE 3DXSX 4JI5F 1F0XA 1HLWA 4S0MA 2MQQA 1S1XA 5H9FK 3W9IA 3PJWA 1IKWB 1NHVA 2VJUA 1H73A 2NYIA 4LF8F 1T03A 4M5HA 3TAMA 3OVSA 2MMYA 2F7VA 2MGZA 2QLBB 1U1RA 5A0YA 2I5JB 1XJWB 2WB1D 5AXKA 1B7FA 2VPWB 1EQMA 3R7BB 3PX0A 4QIFA 4X4SA 3IO1A 1V5VA 3RYLA 4ECXA 1GQEA 2HVHA 4DCJB 1TU0B 3QLHB 3GSDA 2VA2A 5BYRA 1RK8A 1J5OA 2QMUB 3NWRA 4B9LA 4ZCMA 1GEHA 2JFDA 4F50A 1UVIA 4DSLA 1N34J 3HFKA 4IFVA 2G4BA 1O0PA 1K47A 4Q0BA 3CJQA 3H59A 4JP8A 3OUYB 4JI6F 1FEEA 3VALA 5AXLA 3P3DA 2ZE2B 1SV5B 3OJUA 1LK7A 3Q22A 1S6QB 3J81Y 3ISNC 4V19X 4BC7A 3M30B 2PMZD 2BE2A 5HVGA 1R0AA 2GGPB 1RUSA 3KK2A 3AQPA 1NCLA 3CDAA 2XMUA 4DV0J 3VGSA 4OZJA 5ETRA 2MLZA 3QRQA 4HACB 3EMTA 1MWZA 2C3OA 5AE3A 1UCNA 2J9CA 4DV1F 2ZOFA 5B0AA 4YS2A 3Q8RB 2DGWA 1HQEA 1GTEA 3MDFA 2OUGA 2HGLA 3TW0A 4CLPA 3Q0AA 2IJFA 2IFXA 4KQZA 2IM2A 2C2RA 4J9VA 3C2PA 3I5CA 3UCGA 3EICA 4R8UB 2B4PA 3GONA 2MQMA 3CD7A 3H7HB 2I1RA 4DV4J 1RAEB 1PJ7A 1RHMB 2K7JA 3U1MA 1WF2A 2WVEA 5C24A 2FVRA 2UZAA 3I82A 1QAXA 1AROP 1HARA 2ACMA 5HI7A 1Q8LA 3D54A 2Y8WA 2NPIA 2ASJA 2ZD1A 3JTNA 1FNOA 2F8EX 5DQGA 4KH1B 2EPIA 4K4XA 2HAFA 3H40A 3OT9A 4AT1B 3BDEA 2HBQB 1Y3JA 3M8PB 2A18A 5KTQA 4IO9Q 4B3RJ 2HG4A 1VQ5S 4P71A 4ZHRB 3TA0A 1F9FA 2DBBA 3W8GA 2WOMA 3NGTA 1VQKS 2J5AA 4KJIA 4FPIA 4OHWA 3EVWA 2HHSA 2CPIA 3T19A 3H8YA 2GVDB 2WONA 1ZPWX 3DLHA 5JXSA 2BJ9A 1T3NA 4NX9A 1XBWA 3TX0A 2CYYA 9RUBA 3SEOA 2J9EA 4CLLA 1RWPB 1R8CA 5C42A 4OV1A 4WP8A 1FWKA 3C46A 2JVOA 2OTJS 1BC6A 4FYXB 1RBLA 3TZWA 1RAGB 2XSJB 2AF6A 3DRRA 2P5VA 1T3OA 2YBVA 1NM2A 3PYDA 3MZIA 4NLDA 5L1LA 3MPYA 1RTDA 4JI2J 1EP4A 4DS4A 1NB2A 1XQIA 1XMOF 4QOTA 4KV8A 3FQKA 2DNGA 3A4TA 3W1YC 2BJEA 4RNHA 2DHXA 2GQCA 1VRQC 1CSJA 4CQ1A 5F8HA 3DMJA 1Z2LA 2XMAA 2RF2B 3V2UC 1HBOB 4EBCA 2FJDB 4RJVA 1JXLA 2HS3A 2LXFA 5F8JA 1S4EA 2HBZB 3N6LA 4QW8A 3I0RB 3I0SA 4O3NA 4CYUB 5JUMA 4J7CA 1VRUA 2UXDJ 5LSLA 3GYNA 3CEDA 3M2VB 1VQNS 4A8WA 3QIPB 2DGTA 1QVFR 1QDUB 2DJWA 4ED2A 2G2YA 3PKMA 2NSCA 3BQ1A 2CFXA 1FVQA 3UWTA 1X5PA 3GYXB 4HI1A 1HBMB 2C3UA 1QUPA 3ZTRA 1UEUA 4P2MA 1U7LA 1KP6A 1LOUA 5I4MA 4MJKA 3QFWA 3MOJB 3SZ2A 4DQSA 2DNQA 2AIRB 5LMNJ 2HHVA 1JLQB 2OI2A 2ABYA 3LAKA 4L76A 3FJ2A 1IKWA 4CLFA 4DS5A 4NA1A 2OH2A 3RBZA 1ELOA 3BR9A 2DY1A 1RADB 3KMQA 4ZDNA 2QLFB 2AGOA 1VS3A 3BGUA 2I5JA 2YWEA 4KGZB 2HEKA 4N8OA 1SC6A 2H65B 2WW4A 3PG9A 1UJ5A 3EVMA 2KDOA 4JI1F 3EGZA 4NLWA 4ED4A 2J76E 3QLHA 3PW4A 1U24A 3T9ZA 4EFAC 3EZUA 4DR5F 3SV4A 4JI3F 2CJYB 1RP5A 3GIKA 2HURA 1RBAA 4G1PA 2VQEJ 1WKKA 5LJ5Y 2AT1B 2VASA 4DSEA 4WK1A 1HWJA 4C0BA 4PRFA 2UU9F 1N33F 2V9WA 3VGVA 3OUYA 4AXIA 3HHKA 3BB5A 3HP6A 3DHXA 4RLEA 1X4DA 2ZE2A 1SV5A 2OEKA 1S6QA 3BH6B 3R6GB 1FRLA 3NCRA 1TFWA 3M30A 3PR4A 1FXDA 1T9YA 3T5HA 3AQOA 3M9NB 2OHDA 3JQMA 3QGGA 1T9VA 3FEZA 2GGPA 5IS2A 1G3OA 4FN5A 3AY0A 1VMBA 4Q5VA 3KJNB 1V6HA 4GC6A 4HACA 2RILA 2BA9A 5KFJA 2HHWA 5LT5A 1FJCA 3IBFB 1U6BA 3LW5C 1IBCB 5KG1A 2J9DE 2XMJA 1B3TA 2RQMA 4HI2A 4B3TF 4M94A 1H6KX 2IVFB 2DRBA 1C1BB 1TKXB 4J90A 2HMIB 3CJKB 3B82A 5GADI 5L46A 3GR0A 2EFPA 1VIXA 2MXYA 2WBRA 2BZ2A 4L74A 4DV5J 3QIDA 4C3LA 1IJFB 4FXDA 4R8UA 2AW0A 3B54A 4RBUA 4C97A 3PIPQ 2XM3A 4OZNA 3U7JA 4NLPA 1DTQB 2KKHA 4PPZA 1RT3B 4Y0FA 1Y5NB 2RAQA 1G2EA 2D3OR 1DAXA 1PAUB 1PYTA 3R3TA 2XWXA 4ZVHA 4XAKA 1BQMB 1IJEB 4PUOB 4DL3A 4LF8J 3H5XA 4AQYF 3QBCA 4EYHB 2HBRB 4H4KC 4Y2KA 1UW9A 4NLRA 4ECQA 8AT1B 3HT3A 2RU3A 2W4CA 2AJ2A 4DR3F 2OPQB 1RWXB 5K8MA 3PO4A 3SI8A 1Q79A 1HQUB 4DFKA 4K5RA 4Q7AA 3M8PA 2R9LA 1U2CA 2XYHB 5DDPC 4LVOP 1O6XA 1PIEA 4ZHRA 3V81B 4W4MA 2VBZA 3NGRA 1RJJA 1Q8KA 3FEYB 4G65A 4RBTA 3S1TA 3DOLB 1PAEX 1KQGB 2E9ZA 3NL0A 4JBCA 2ZHBA 4ZP6A 3CULA 1CQMA 2VG6B 3LGMA 2XYPB 4CH0S 1ZM4A 4NLOA 1HW8A 1ZETA 2B7CB 3OR1B 3KLIB 3SQOP 2AEFA 2ZH1A 4JI6J 3J80U 1WC6A 4RBVA 4F8RA 2CPHA 3CJ5A 5DRKA 2X51A 4LF4J 3BSCA 5HJXA 3AB4B 4FF4A 4X62F 3BBFA 5LSRA 3LP2B 4C6AA 3KHHA 1WC3A 4OHVA 2XSJA 3CIZA 3HDSA 3BN7A 2CQHA 3IN5A 2CQGA 1X4GA 2AV5A 2W01A 3EXCX 4QBUA 2POKA 5J1EB 4KGVB 3IR7B 3TARA 4HL9A 5DJBA 3FUYA 4PWWA 5KT3A 2RRAA 1X4HA 1H7WA 4OX8A 3LGNA 4CNZA 4LSLB 3ITHB 4HHUA 3EUNA 1MROB 1LXNA 5GAEI 5HSPA 2B56A 3GV8B 3AXMA 3RR8A 5HL7Q 1RDRA 4I67A 1FDBA 4LF9F 1NDLA 1RLDA 1TL1B 2K2PA 1NBEB 3MECB 1LW0B 3CMES 2HVIA 2RF2A 1K1QA 2F4FA 3RB6A 3GFXA 2KJWA 3GB0A 1J27A 4X4QA 3D2WA 1NJYA 3QJJA 4QR0A 4PR6A 4D3GA 3I0RA 2JEJA 4CYUA 5T41A 2C3MA 2OLWA 3BS9A 3R8YA 1FFWB 2EG2A 3M2VA 4I69A 2E29A 3T6BA 3QIPA 5KFZA 1KQKA 3A3NB 4FNIA 3OTDA 3I6PA 5L39A 4OJ1A 1MN9A 5KFPA 4NLVA 4WTYA 3GWCA 1HBMA 1YDLA 2BRLA 4A8XA 5C7PA 1S79A 2X3GA 3GE9A 2DGUA 2MSTA 3E51A 2GMJA 1U2FA 2VQFF 1XEZA 4YDDB 3W2WB 2DEIA 1JLQA 3RJMB 1S4FA 2DB1A 4ZIVA 3T5KA 2QA4G 2DPIA 1N5SA 2F5GA 5MLCV 2R8KA 2NLWA 1VHFA 3D0IE 4FZVA 4WP3A 1RAIB 2MKCA 1KTVA 3RBDA 1WTFA 1FX2A 2OPPB 3LWMA 2LYVA 5FLXY 3MM9B 1WDDA 5DG7A 2F8HA 2MQ8A 5DLFA 5IC4B 4DPUA 5EUHA 2QZ8A 4IR1A 1PILA 4WIQA 4WXWA 3RBXA 4TLRA 3ZC4A 4F3QA 1HQ2A 4OYAA 1SI9A 3L4BC 1TAQA 1UVMA 4NCGB 2X1FA 1XERA 2L9DA 1CJKB 1UZDA 4K2JA 2E44A 1NKCA 1RAHB 3TZZA 4WZQA 1FFSB 4ECZA 1SQFA 4MMOA 5DDQC 4JV0A 3KKFA 2MYFA 1SL2A 5H1SV 3OBIA 4RW6B 2DH7A 1HNXJ 2M4MA 4NZ7A 3MPDA 2DNLA 4RW4B 3BYPA 3WBZA 1IXKA 4DSJA 2JVRA 1GT8A 2R4FA 3N4WA 1Y5LB 4L72B 2H48B 3FSIA 1HYSB 4CRJA 4K5SA 2DT9A 5IWAF 2V67A 4ZN1A 4LVNP 2B9XA 2VKZG 1R0CB 3R6LB 4F2SA 5J2NB 4ZOSA 2M5YA 4OHXA 1VC0A 2CJKA 2Z0GA 1C1BA 1TKXA 3DRXA 1EJ7L 2HMIA 2ZZNA 2BW7A 4PABA 2VICA 5KFGA 3CMAS 2ZNYA 3TVKA 4KO0B 3SSSA 1XMBA 2ATLA 5F8NA 5HVHA 4L6V3 1YWXA 4M63A 5ETNA 2CZVC 4OI6A 1Q1KA 2QA2A 3NLCA 3HJFA 1M1KT 3H0PA 2G0JA 3KK3B 1DTQA 2X7IA 1NK0A 2YKQA 3TAPA 1RT3A 2AZ1A 5DQHA 2X1BA 3TQEA 1SKUB 1DFDA 5EWGA 1R89A 2IHR1 2HHHF 4UOGA 3UR0A 1BQMA 4PUOA 4PKDB 3TEGA 4DR2F 1DRZA 3UQSA 1EB0A 4YOEA 4HH1A 3VHQA 2FJAB 3GIRA 1VK8A 2OPQA 2PGCA 1U26A 1MU2B 5ETLA 1HQUA 2CUYA 1BWVA 4LF2A 5E7OB 3DOKB 5AJ3F 3CIMA 1LQ9A 3V81A 4ILRA 2DHAA 2V69A 5F9LA 3BM7A 1LW2B 1U1QA 1K9MT 2ROPA 3DOLA 1TFYA 1JLEB 4KKOB 3T1YF 3ONQA 2LQJA 3N5BA 4RNFA 4A46A 2W9CB 4DF4A 2XBPA 1N33J 1R8AA 4LIRA 3US5A 3RAQA 4X4PA 3OR1A 3KLIA 1EKSA 4W98A 5HP1B 2C2DA 1XNRF 3IP0A 1FE0A 4TQRA 1AYEA 2Y1IA 4J9SA 3LP2A 4IG0B 3VAKA 4HKQA 2XZTB 2BEFA 2AGQA 2VG7B 1V9OA 3BGOP 3FFIB 3ISND 4FKYA 1NPPA 3OV7A 2XEXA 4LF6J 4XIUA 2AJ4A 3OL7A 3LF0A 3K7RA 3PACA 3PYFA 4OHZA 2NZ4A 2AX1A 2C2OB 4TKTA 2RHSB 2AU0A 2MHEA 1K8AT 2Q79A 2VPZB 4LSLA 3ITHA 2FHMA 5K8NA 1MROA 3OFHA 2XG8A 3WZ0A 3HSZA 2K3KA 4C0HA 2UUBF 1FEHA 5EWEA 3OHAA 2C28A 4OZ2A 1K0TA 3IXQA 3G8SA 5FD1A 1TL1A 3MECA 1SIWB 4IDKB 1S6UA 1GTHA 1LW0A 2E1PA 2XI2A 3L7OA 2GV1A 3ILJA 3HK2A 4LREA 2XQCA 1S59A 2L41A 3BSOA 4O23A 2PN6A 4O3PA 1IKVB 3ZZUA 1WHVA 1VC6A 4NEZA 5KFXA 2LECA 4QU7A 4ZK7M 1S1VB 1EX8A 3W2VB 1YIJS 1SH2A 4JOUA 3DXBA 4AQYJ 1X9WA 4AXJA 5L9XA 2E1CA 1RQ0A 4RUBA 1U0SA 4JUZA 1TL4A 3K58A 4XK8C 4I0WA 2B9YA 3OLAA 4YP3A 3TA2A 4LSNB 2J8SA 4OYWA 5GAGU 2ZKUA 3K59A 2BX6A 3W2WA 4FYDA 2JLFA 2HFZA 4ZJQA 2CZ4A 4U67Q 1RA6A 2NXCA 4EU0A 1HNWF 4QWDA 3MUVP 3Q2SC 1WD6A 2YQ0A 2RT3A 4YY3J 5F0UA 1PYOB 2Y8YA 4ZCIA 2V2VA 3EYZA 1DJ0A 2V8HA 2OPPA 3R7SB 3MM9A 3H4DA 4XDCA 2G2OA 1D8YA 1TQLA 3RRGA 1KR4A 1VIOA 3JSRA 3NY0A 4X62J 3UNGC 2LCWA 1KC8T 4C2MA 4F4AA 4JV1A 3N9UC 2DKOB 4TXSA 2RUGA 2WVCA 1OJ4A 2WRMA 4NCGA 5C2CA 1CJKA 3KFWX 2IRYA 3MMBB 3UR3C 2F8MA 1V5IB 4WXOA 2HNYB 2PT0A 5DZ6A 3FMWA 3ENAA 4CIOA 1CPZA 2DRAA 4DR4F 3VGUA 2ZVIA 2LVWA 2COLA 1D9FA 5KG2A 1UZHA 4RW6A 2L3MA 1JLFB 4NLUA 2EFNA 2ZM6J 4RW4A 1BMQB 2FTRA 4TU7A 1CC8A 1JIHA 3CT9A 4W92B 1SQGA 4LF9J 4FYYB 2D3ZA 2HGNA 2B4OA 2JEIA 1WEYA 1XR5A 2D41A 3IM9A 1HYSA 4QZVB 5LSOA 1FTRA 3B4MA 1RT6B 2VU5A 1Q81T 3HJVA 5IOLA 1TK8A 4ZLJA 3LQVA 1SJQA 3UW1A 5JVHQ 2IVYA 3HX9A 1DY3A 2QL9B 2AP6A 5J2NA 1YJRA 3DRYA 3NAHA 1KFSA 3TUIC 2WCXA 4P72A 5IC6B 3G71S 4KO0A 2ZBQA 2MKIA 4C11B 4XPCA 3F0NA 3W7BA 2GIFA 1K1SA 3ENWA 3TJ8A 3SXLA 4ECVA 2V4QA 2XS7A 3EGVA 3KK3A 4B9NA 4UOFA 3W5YA 4PXBA 4G1QB 4ED3A 1F60B 3GSIA 4GKKF 2OEJA 1KVIA 2W9AA 1XR6A 2P9CA 2DR8A 4OI0A 3NCQA 4M5JA 4KSEB 1ZAVA 1S97A 1A7GE 2MKYA 4K4ZA 4FXVA 3CD0A 2CRLA 3W61A 1RAFB 5I3PA 3DOMB 3ZO7A 3AAWB 4Z37A 1YZ7A 1MU2A 3QMQA 2ZH6A 3ADAC 2HZAA 4DOZA 2IM1A 3CB4A 4ELUA 1Z4UA 3DOKA 4EYIB 3MM6A 3M6UA 2CKWA 4ENOA 1X4FA 4K4WA 2EKYA 4M8LA 4ID8A 3BZQA 1REGX 3OFEA 5DLGA 2W9BB 2AZ3A 3AOBA 3FK4A 1JLEA 4KKOA 4DR7F 2W1BA 1TV6B 2W9CA 4WFXA 2CNKB 5H9EK 3PW7A 2CG4A 2LA4A 4DLEA 1N5YB 3T1HF 1JJ4A 1T05B 2BE9B 3IM8A 1BQNB 1TZ0A 3QQCD 4CO4A 3I4HX 2MQPA 3O44A 3X3UA 4O3OA 2GHVC 4WP9A 3MR6A 3KUGA 2BKOA 4LSZB 1R8HA 5IXUA 1F2HA 4IG0A 3DC2A 1ZBTA 4QPTA 2MQOA 3NBPB 5LJ3Y 2VG7A 3FFIA 5DS7A 4USWA 3NXZA 4LIWA 3HFZB 3RBEA 3BKFA 4KY3A 5IWAJ 3ZZYA 2RRNA 5E3PA 2O01C 4ES2A 1SJ3P 1RLCL 4NOHA 1FRJA 2ZWPA 2NZCA 1N36J 1U25A 4LFCJ 2YKMB 5F0WA 1S6PB 3F56A 4CO5A 3DI6B 3CO0P 3M2UB 4WFZA 3OL9A 3MUMP 1R43A 4NYPA 2VUGA 1DQAA 1S72S 4DX5A 4IDKA 2ZC4A 2HQ3A 1SPBP 1SXLA 4H4MB 1S0OA 4JI0F 1HFEL 2DRDA 4EGLA 3SSQA 2FD2A 3CDBA 2CQ2A 1IKVA 4DPTA 2M8DB 1S1VA 3AT1B 2HS0A 3CF5Q 3W2VA 2YQ1A 2HHHJ 3BDPA 2Z30B 1AB8A 3OTOF 2FQQB 2JLGA 4TLQA 1KHWA 3T5LA 4JV5F 2DYAA 2CQPA 2JX2A 1UVNA 1P9YA 1N4LA 3CCLS 2HGMA 1NB7A 1T95A 4J9UE 5IZHA 1CJUB 2GMLA 1C4AA 3LP0B 4LSNA 3VF0B 5KFMA 3DLGB 1WHYA 2YX1A 2QSFA 3ZNUA 2MQLA 1TMMA 5DDOC 5GMEA 1EARA 1Q8IA 4ES3A 4ECRA 2JEGA 3D6HB 1FDNA 3BGFA 1IBLF 2ZH7A 4YB7A 3W65A 3NS5A 4LR8A 1XIQA 4ZVPB 1S5ZA 3UDVA 2EKNA 2Z2ZA 3C15B 3UN2A 5EX3A 3Q86A 4USTA 1WSRA 2XY6A 2W2OP 2C2EA 1G7CB 3FCVA 3AODA 2WVBA 3MPUB 1RT2B 1T94A 4X4NA 2XMMA 5DO2A 2XSFA 2ALYB 1RACB 2QX0A 5KFAA 3MMBA 5AXNA 4Z2XA 2Y3YA 3B6BA 4NCBA 4I56A 2HNYA 5AXMA 1VBXA 3J7YU 4MKVA 3SSRA 3Q8PB 3Q23A 1TK5A 3P6YC 2CQ3A 4U9RA 1NSQA 1VC5A 2K3IA 1JLFA 4YB5A 1X0PA 5DETA 1WOPA 3F44A 2H5JB 4OZ3A 2EC0A 2HS4A 1HI8A 3TYTA 2DH8A 1DLOB 1RT6A 2UVRA 4BS2A 1AW0A 2YPYA 5ETMA 2QV6A 1VI7A 1JJ2R 3D1HA 2ZDPA 3TRGA 3OXGA 2KHDA 3GZ7A 1YBTA 3I5BA 4FP9A 5K8OA 4QIVA 4TVAB 3EXYA 2U2FA 5F3ZA 1I1GA 3BKUA 4YHHF 4X4UA 2H51B 1Q8BA 2WW8A 4C11A 1JLGB 2IMOA 1C0TB 2W8KA 4C48A 1B64A 3WHIA 4X4VA 1S0MA 4PG5A 1U1MA 3OTCA 4ZP7A 1SH0A 4NA2A 4IO1A 4A8MP 4MKBA 2KRRA 4J9QA 1YRXA 1F9HA 3AXKA 3QFHA 4ZN3A 3QRPA 1FDAA 1WF0A 1CQNA 4RUCA 4G1QA 3M1VB 1REVB 1MWYA 3AJDA 3HHLC 2HIYA 1SCJB 4J9OA 3DHWC 1MSWD 3DU6A 3P8BB 2KFNA 2OMOA 3QJLA 5C5JA 3DOMA 1N34F 4GMKA 1JNZB 3KMSA 3D1OA 2Y0SD 2VB6A 5HAOA 4ECSA 1VQPS 3T41A 4LBIA 5E3RA 1UFKA 1GXTA 1Q5YA 3BREA 3AHPA 4EO6A 1WC4A 3KUEA 2YQ3A 2G13A 2G0CA 3HF5A 2FJXA 2W9BA 4F02A 3QSIA 2FVQA 5M2UA 1TV6A 2NS1B 5KG6A 2BUNA 2ATCB 4C8MA 4DV0F 2LEPA 4ILMA 1N5YA 1B0TA 2V2ZA 3QPIA 2KT5A 4NLGA 3MM8B 2CJQA 2KI2A 2IMWP 1T05A 3MM7A 3IWNC 1UA0A 1BQNA 3MCSA 3RG6A 2C3YA 4DR4J 3PHTA 4U8VA 2R3VA 3IWLA 2VF3A 1FKAF 2MKSA 4O4RA 4Q45A 3VAFA 2Y1RI 3L7UA 4F0HA 3NBPA 4M5MA 3HSGA 2OPRB 3DRSB 1WNEA 1QSYA 3LP1B 4OI4A 1QAIA 5I3UB 1U4BA 2K8GA 4ETZA 1VJQA 3GJQB 3VQSA 3W9JA 5MAOA 2ZNZA 3AD9C 2EFOA 4PG7A 3GYGA 2CJBA 3QO9A 3MEEB 3KG4A 2YKMA 2JWNA 3GFYA 1S6PA 2EXUA 2CDRB 3G6YA 1RKJA 1U6ZA 3DI6A 3CVKA 3M2UA 4F4ZA 4C4WA 3LAMA 2A1BA 1ACMB 1SJ1A 3DLKA 1UETA 4H4MA 2IM0A 1KLMB 3H4BA 2KFZA 2AHOB 4I6WA 1HNVB 4FDFA 2RIJA 2G0IA 3BO3A 1X5TA 2OPSB 2DISA 4KRWA 2AYGA 4U96A 1YLXA 2G1HA 4PWDB 5EN1A 2V50A 4B3RF 2HQFA 1GXLA 4GKKJ 5E3AA 2A6OA 3D3CJ 4P6QA 1I6JA 4RW8B 3IA0A 5EDWA 4ALZA 3KLFB 1Q16B 3ET6B 4RU9A 3HSJA 2ASDA 2DH9A 4FYVB 1PKUA 4J9PA 4HHJA 4F4YA 3FNNA 3THVA 4NASA 1CJUA 4P7VA 2LDYA 2XYGB 2QEXS 1RT5B 3LP0A 5AE1A 4ZLNA 1RGVA 5IV4A 4QU6A 3VAIA 2L08A 3DLGA 3CJ0A 4CM0A 3MUTP 4ATNA 3UPFA 4OFZA 2AEMA 1K0VA 4DR7J 3RW6A 1P8GA 2V94A 4ED6A 1RTJB 2RHQB 2YX7A 2MJNA 4U7UD 3MAHA 2I38A 2DXDA 1IKYB 2YWFA 5ETPA 3LTOA 3PY8A 3MMJA 1KONA 4JI2F 2IA0A 3O3LA 1JQGA 3MD3A 4BWMA 4DQIA 4CZCA 1B99A 2P9GA 4IOAQ 1WKLA 1PG5B 3FZBA 4K4UA 1GAOA 4X4RA 1YI2S 3TZYA 2PD1A 2KYZA 1JLBB 1RT2A 1SB6A 1G1XA 3PM9A 2ZFHA 1R8PA 4PEOA 2XMVA 4B3MF 4KH0B 2MZTA 3KJVB 2W7PA 1SJFA 3KXDA 3PZPA 5HQMA 2KXFA 2DIVA 2CQ4A 2Z2MA 1L3SA 1Q53A 4OYIA 5KT5A 4GO7X 4NLQA 2V4JB 2J6TA 2DITA 4OX9J 3J7Z5 3CGIA 3PJ9A 2DNKA 4UUXA 4OJGA 2XMWA 1VFJA 2ZOGA 2VDIA 2Q6BA 1DLOA 1NLKL 4AYBD 1Y11A 3CJ8A 4X64J 3R5JB 2ROEA 3IGVA 4TYAA 4CO1A 1V3RA 5HJYA 2W8LA 5K8PA 5KT6A 1WDTA 2PE8A 3FCWA 5LMNF 5JJBA 3C14B 3K8WA 2MKHA 3HHNB 4DL4A 2RQCA 5D6GA 1JLGA 3QZ8A 1X0FA 2EI5A 5KAKA 4YFUA 2SXLA 2P6TA 2PI4A 3D6MB 2ERRA 3K2YA 4ID5B 1XMQJ 3AA9A 1X4BA 1QTMA 1UP1A 4USKA 1TELA 3UN5A 1QVGR 3AOAA 3TR5A 3M1VA 2UP1A 1XTZA 1REVA 4F4WA 3KLGB 3D7SB 5DG9A 2UVWA 2W25A 4MTPA 1F1BB 5HK4A 4NXMJ 4USUA 1KQFB 2B0GA 2WHOA 2N4DA 4DBQA 1NJXA 1NK6A 2RS2A 3PV8A 1APSA 3SIPB 4ZP8A 4JYAF 2GX8A 5T14A 1U48A 3NKYA 1SIZA 3G82B 1HWLA 2KH9A 1QSLA 4DU8A 2JOQA 1T9WA 4F7VA 2ADBA 1GH8A 1OMSA 4GO5X 1S0NA 1AFJA 4DFPA 2HK3A 4ZKAA 3OW2R 5BYQA 2OELA 2OMLA 1ZTTA 2EEYA 2UXCF 2D7SA 4CTAB 3ILLA 1N5QA 1PC4A 3DDKA 1YJ9S 1EAYC 3OTEA 2CG8A 4YUDA 2YY3A 1NAQA 1X5SA 1P27B 3MM8A 4O0NA 2R2SA 2QYGA 2DHHA 2DGXA 3P5TL 5HMYA 5LXRA 3EWGA 3HKWA 3CJ2A 4AE5A 2OEMA 2YWWA 4ANEA 2EK1A 6FDRA 5D4LA 4IOCQ 3DGPB 1QAJA 2MKKA 1YTYA 4NA3A 4R0JA 5D15A 1XNQJ 5EGYA 4TY9A 2OPRA 1MN7A 4X2BA 2W2NP 2KL8A 4WU2A 5M2PA 3K5LA 3DRSA 2VC1A 4CNYA 3LP1A 2FZCB 4DV5F 2DNMA 3KWMA 2ROGA 1U1OA 1UMJA 5I3UA 1G6BA 4AL6A 1MMNA 1SH3A 3OSNA 2HVDA 3MEEA 4OV6A 3GP9A 1YJTA 1J2VA 2FYXA 3W5ZA 2KU7A 2RNEA 4YHHJ 4RR5A 3HHLB 1I94F 1RT7B 1S57A 1RE1B 1VBZA 3GILA 3H98A 4WJBA 4X4OA 5KG5A 3D28A 2XTJP 2V8VA 5J2MB 4DQPA 1S9GB 7FDRA 3BEGB 2QFJA 1KLMA 1FKPB 2LU1A 3NGSA 1HNVA 2W7OA 4J9MA 2OPSA 2YKAA 4ZVRB 4EO8A 1BUXA 5CH7B 2IRUA 4X65F 5HANA 2R7RA 4PWDA 2AYBA 4P2XA 4ELVA 5B0DA 1RBOB 4H54A 3W62A 4RW8A 4LFAF 3OFFA 4DV7J 3KLFA 2YX4A 2DGVA 3LPYA 3RTVA 4QJVA 3ET6A 3S8SA 4O44B 1H2UX 3N01A 4ZITA 4E2FB 3IGNA 4DL7A 2X1AA 4UQGA 3IFEA 4YMEA 2YNFB 2HHPA 4IG3B 3BO2A 1RT5A 4C8KA 2QLXA 4LRDA 2ZC3A 4I6YA 3PXGa 1JK9B 2DR9A 2DNHA 2R7WA 1SC4B 4LF4F 2IY5B 4USHA 2XGQA 1CULB 5D4OA 1WG1A 3DNCA 3RB0A 4ZCKA 5D4NA 1NZ8A 2FZKB 3IC1A 3PJXA 3NNCA 4WK3A 4F36A 4NCAA 4H4OB 4ZPAA 3HM9A 2QIFA 2WK4A 3JAMY 4NYOA 2FVCA 4DMZA 1IKYA 2HZVA 4RW9B 3R5GA 4BHQA 4ANCA 4R25A 1IM4A 2H5IB 2OJ3A 4ZVFA 4RW7B 4Q44A 3H5UA 1D09B 4KIAA 1CJVB 1EQ0A 4MKAA 1KOOA 1VCTA 1D8ZA 2AJ0A 1JLBA 4MH8A 4DFMA 3EM1A 5U47A 2CDQA 2PI5A 2CJXB 2PEBA 5KFSA 2QYCA 2LFVA 3KJVA 1XN9A 3J81U 5KFUA 4HT7A 1RCXB 2QTWA 3KDOA 3LA0A 4CO2A 4N56A 1UPMB 2V9KA 3JTPA 4QYRA 5KFFA 2V4JA 2B9WA 3O8WA 1JXVA 3HFVA 1QAYA 2B8QA 4F67A 1KVJA 3K17A 5A6PA 2EW9A 4DV6F 4P10A 2OD6A 2GC8A 3FCHA 2BE7D 2GQQA 1YQHA 3HZEA 1U0HB 3G8TA 2PMWA 3HVTB 2IJNA 5THWA 3KYLA 3H20A 2E1MC 3ULHA 3RAMA 1PSDA 1UPPA 2HAIA 4RX6A 2FLPA 1MMDA 2EWHA 1WOSA 1RHJB 3R7NB 2DIUA 1NDPA 1TVRA 3C14A 3RRHA 2BW2A 2RE1A 3C3LA 3FKBA 3SCKE 2FDNA 3QT7A 4LQ3A 1BQXA 1I51B 1FXLA 5C25B 5I42B 4QW9A 3DYAB 3MCOA 1HBNB 2KG1A 3CW2C 4ID5A 3HPOA 4DJBA 3N28A 5CABA 1NDKA 4KHPF 4V1Ak 4I2PB 2HNZB 3J7YI 3CCSS 1OQ3A 1IR2A 3QWPA 2QLWA 1U8WA 3KLGA 2JNJA 4KR0B 4QWCA 3GJSB 2UUAJ 2J0WA 3W9HA 3R1HA 2VBWA 1FERA 1YJNS 2GFFA 4OYPA 1GFWB 1L3UA 3TANA 2A10A 3GCXP 1W2BR 3D6TB 3G82A 4Y00A 1VQSA 4PAAA 5F9NA 4M5KA 3UD5A 3KHRA 4DX8H 2D74B 5CQGA 1HNXF 1JMTA 1Y7PA 4Y34A 2M7SA 1B0VA 3H42A 3TNVA 4CTAA 2JH3A 3WX8A 2W4PA 1RTIB 2UVUA 1R6YA 5G4DA 4LUBA 4YQWA 2WTFA 4LF7J 5E33A 4B3MJ 3FRYA 3HCXA 2QGFB 5KG0A 3CUNA 2HIQA 3BQ2A 1IBKJ 3K5PA 5D78A 2XGPA 2RVJA 3DGPA 2YNGB 1SUQB 2CPYA 3DDNA 4DUZF 1SJ4P 3TJAA 3CE8A 3MEGB 1FJ7A 2F63A 3DM2B 1SL1A 4WIIA 1FT8A 3H25A 3DLLQ 2V8GA 2HFNA 1Y0HA 2F9DA 1V3ZA 1WEXA 1T11A 2NXJA 1FRIA 2QC3A 2HHXA 1R8BA 3NMRA 1YGYA 4OLOA 5IT9Y 2HLTA 3QATA 1CC7A 5GAHI 3HHLA 4LR7A 3FBCA 1RT7A 4B08A 3BBBA 1EHWA 1F3FA 1RT1B 2DGOA 4C8OA 5B0BA 4B9SA 4NRUA 4P7TA 4OX7A 4OMFG 5J2MA 1S9GA 4F25A 1S1UB 1JLAB 1FKPA 1FD8A 3IG1B 4OJHA 2I6WA 3I31A 2MZ1A 4FXWA 4ZVQB 5LMUJ 1S9EB 2WSEC 4Z7CA 3O1LA 4FS1A 4ZA1A 3NOCA 1G4CA 4FBUA 2FLLA 4QR1A 2AJ1A 3J7A1 1J5EJ 3ELHA 4Q8FA 3SCIE 1M0SA 1MNEA 4U7UK 3HHLD 4G3IA 4O44A 5ITHA 5B09A 2ZDOA 4ED7A 5FDLB 4DR6J 4FVMA 3D1QA 1FRMA 1BLUA 4QIGA 2DR6A 3NGDA 4JYAJ 2YNFA 2MJUA 3ISZA 4IG3A 4KFBB 4NMLA 4UZCA 4PXDA 1O5JA 1CG2A 5CCMA 4CDIA 1AUDA 2CPDA 4RUHA 2ZH3A 4WFYA 1CULA 2RMLA 4URQU 2O66A 3DLJA 2CQIA 2UXCJ 3MHYA 3UD4P 4MIBA 4P2SA 2HHUA 1S1WB 2GJIA 1YJVA 4ZPWR 3C16B 3V4MA 3MAAB 4LF6F 4QPXA 3VR1A 2N7YA 2DNYA 3ENVA 4WF9Q 3RUBL 2DNPA 4RW9A 4ECUA 1LNQA 3P49B 3H90A 4RW7A 3CJ3A 1DZ5A 3QJPA 3IWXA 1PO6A 3TZXA 3TAMB 3W64A 2KHCA 3A3PB 4A8KA 1CJVA 3SQGB 3TOQA 4IOBA 3ETMA 1JKHB 1IR0A 1TR0A 2F4VF 2O67A 2BKNA 3OXFA 1PCAA 1Y00A 1NMEB 3K5NA 3G8QA 4ECTA 5A2QY 4HYKA 1X9SA 3VTIA 1HNIB 2CA9A 3LO3A 2IA6A 3MM5B 2EFGA 2Y0BB 4MKYA 3T9NA 2QRRA 3QNWB 1ZH5A 5KFRA 1HD1A 1RAOA 3KOAA 4DF8A 4DL6A 1CEZA 5KG7A 3HSDA 5L38A 2M8HA 1NUEA 1I94J 2BDPA 2GVZB 4NE9C 4HR2A 1IWAA 2YWGA 3HZGA 3QRRA 3C6TB 5F8GA 1LV5A 1U0HA 3HVTA 2LXUA 4DCPB 3MPVA 1UFWA 1A9NB 4DV3J 1F6TA 2OGUA 2ACYA 2V0NA 4C3MA 1N48A 1WTBA 2FHKA 4X65J 3DGVA 1UKUA 2NQPA 1HD0A 1Q7YT 1FNMA 4UZBA 3G9CA 4CO0A 5JVGQ 1QLNA 4LFAJ 3BSAA 5K9FA 1IUJA 5KFOA 4RZRA 2AMCB 4ICLB 4L3KA 1VLYA 2YWKA 4NL5A 3JXOA 3VZHA 5HVFA 4UT4A 4DSFA 1KWMA 5C25A 5I42A 5EHHA 2GVDA 3DYAA 4YY3F 1HBNA 2OSRA 1L3KA 4OYZA 2BQUA 3N0VA 2RU9A 4M5NA 2C42A 5HQLA 2E5IA 4I2PA 3G96A 2HNZA 1SKWA 3VQTA 3BH7B 3PO5A 3NGKA 3TQ1A 4JI8J 4J9LA 4TYBA 4DI6A 2FY8A 3EJMA 1UL3A 2E7XA 1X4AA 2LEBA 3GJTB 2IYGA 3H2UB 3HD1A 4WFNQ 3V4IB 2UV8A 3A8IA 3M8WA 4PWUA 1LWCB 5KFWA 3GTYX 4V19J 3CCVS 1W7WA 4OYOA 5CYQB 3E2EA 2OFHX 3P5BP 1M5VC 4MIAA 2RRBA 2ZH4A 2J7UA 3DFEA 1VK3A 1D3WA 3D0GE 2YPZA 3CNQP 1RHRB 3ZZPA 2ZM6F 4P2FA 1RTIA 5H9EJ 3I9ZA 4CH7A 3GV5B 5ETOA 1FKOB 2PO4A 2YVSA 1HI1A 5GAEU 3JB9k 1KRPA 4I6AA 1BGXT 1HBOA 2AWZA 2GJFA 4IH5A 3PR5B 4N76A 4CLKA 3UDCA 4CLTA 3W5XA 4DPYA 2BMBA 3WC0A 1SUQA 2DGSA 4UY85 1OY8A 3O5TB 3MEGA 4DV6J 3D66A 3VAHA 1PJ5A 2W2QP 1FWLA 2IBOA 3DM2A 2IPOB 4J91A 3I32A 4ZVTB 4ZCLA 5B0EA 4USMA 1HI0P 2W4DA 1JLCB 3BV8A 4FBTA 4DN9A 2CPXA 1AFIA 2J6SA 4C0OC 3WIUA 1S6OA 2CQ1A 2E7WA 4Y2IA 1NXIA 1U1LA 3UD3P 4A8QA 4P73A 2YTCA 3PVXA 2R7VA 2LA6A 2XMTA 2EFVA 4UUWA 4BLGA 1RHUB 2E5LJ 1RYSA 4J5OA 1YK9A 1RT1A 1HMVB 4MIWA 4HVZA 1RHKB 4OZ1A 1CJTB 5ETVA 4EBDA 1S1UA 1JLAA 4RPFA 1EIYB 4QYZK 3IG1A 1ZM2A 3KK1B 3V5RA 3DDIA 2L48A 4KGXB 4P52A 3TUPA 2GZOA 1S9EA 2V34A 4KHPJ 3IAS9 2CVIA 4YB1P 2DO0A 4OI2A 1RTHB 1TK0A 2HBYB 5F8MA 3GG1A 1HIYA 2YNIB 3FSXA 4A4JA 4OIXA 3CDUA 3HO1A 1PC5A 2FHJA 3IRXB 1PGZA 2U1AA 3MR3A 2DY9A 1VBYA 3GIIA 1E6YB 2QJ3A 4A47A 1UFLA 2IBKA 1FJGJ 2H4YB 4RU2A 1F5BA 1ZA1B 4Y65A 4ZP9A 3CC7S 5FDLA 2HQGA 1FTCA 1JB0C 4KFBA 3PHEA 2Q6CA 3FC9A 5L1IA 2MZJA 1C0UB 4RNOA 3MURP 3TVYA 1WC1A 2HHQA 1OSCA 5HO4A 4ZJLA 3CCZA 3Q8SB 4ECWA 5KFVA 3WDOA 1S1WA 2VJVA 3C16A 4PQUB 3MAAA 2FJWA 2FHJD 1ZPVA 2KXHA 5FLXU 2VV5A 5A8KB 2MKJA 2KTQA 1X8DA 5ETQA 2RH3A 1I5OB 3M9OB 3JSYA 2FLNA 2HYIB 3L7PA 1N36F 3EGWB 4FF2A 2FC9A 3ZZOA 4LFCF 2R8HA 1LEOA 4DUZJ 2CPJA 3SQGA 2XC9A 1M5HA 5F8LA 2MZSA 1QY7A 3RRKA 2R2UA 1JKHA 3CJKA 1CBKA 2VBXA 2QO3A 2V63A 2Z2YB 4YEAA 3KLHB 1VQ8S 3L09A 1F2GA 3LH2S 4IQXA 1HNIA 2AYMA 2O1PA 5M2RA 2VG5B 2JEFA 5E3QA 1QTNB 3MM5A 4A8SA 1L3TA 3G6ES 4P75A 2C1EB 1K73T 3TA1A 1S49A 5IM0B 1KHVA 2R2TA 4B9UA 2BR0A 2GVZA 5K20B 2Y9HA 1UAWA 1Y3KA 4DL2A 3AH6A 3C6TA 4WE1B 3DLEB 2B8PA 3M8RA 1N0VC 4PG4A 3RB3A 2CIMA 3HHDA 2UVVA 5DZ7A 2ASLA 2VODA 2GCFA 3TUJC 2ALZA 4TY8B 3K0JA 3FQLA 1LWXA 1M5KC 4B17A 1UJ6A 6FD1A 2ZJPQ 3VVUA 4Q2MA 2NREA 5IFMA 2DO4A 3VGTA 1SL0A 4N77A 2QMXA 3V6HA 1WORA 5D0EA 5KFHA 4HDHA 4ICLA 1KS2A 4A8YA 4HTIA 3UCUP 1Q86T 2R8GA 1RWMB 3QZ7A 2VG6A 4NRTA 1GMVA 3CXCR 3D68A 4NLXA 3TWZA 4MYTA 2L9WA 1ITPA 2MLXA 3VZIA 5DGAA 3MOZA 5HN0A 2A2DA 2ASYA 2Y1JA 2N7CA 1U45A 4JI7J 4YDXA 3KG0A 1ZA2B 4CT9A 2HQDA 3QT8A 1L3VA 3ZZTA 2YKOA 1HNZJ 4WYLA 2MSSA 2XS2A 3A3OB 4BCAA 4OZ5A 5EWFA 3V4IA 1LWEB 4YR2A 1VQ6S 4E8UA 4EZ6A 5ETSA 3K5OA 3GQCA 5J1EA 4KB7A 1LWCA 5KFYA 1XWLA 1HR0J 2HPUA 3EX7B 4KGMA 2FZGB 1YJUA 4LRCA 1HA1A 4CLSA 4CLUA 1Q4RA 5CYQA 5IV3A 2HHTA 4USIA 4KHRA 2PMHA 2CWXA 1C2PA 1QJHA 2W24A 4IRCA 1U02A 1P9QC 2F4VJ 4MYUA 1WACA 1VOMA 2V4RA 3UCZP 1FKOA 2B9EA 2B5JB 2E5HA 5D0RA 1R27B 3E3XA 5KFEA 2ZBIA 2UV8G 2P6SA 1YRUA 5GMDA 3BO4A 3C66A 1UEKA 4U8YA 2RQ4A 1U49A 1NU4A 2ZBRA 4EUVA 4DXLA 1UA1A 1IM6A 1IBMF 4DQQA 5F3TA 4FS2A 3D4JA 2VKRA 2MHNA 4DFJA 3KDNA 1N52B 4X4TA 3KLVA 4OI1A 2E1AA 2BABA 4ZVSB 3MR2A 1JLCA 3EGNA 2Y1LB 1UVKA 3HKZD 3GU0A 2AJQA 1RXOB 4B3SF 4F4KA 4GKJF 3FZ2A 4PYAA 1YVFA 3QGHA 4BC9A 3CJTA 2HRUA 3Q89A 4ED8A 3ZZRA 1RHQB 1YSJA 1S77D 5CCLA 1P1TA 3MMAB 3CC2S 2JZ5A 4URGA 1HWKA 5SZTA 1F5CA 1VRTB 2UXBJ 4ELTA 4J9RA 1HMVA 5G0RB 1KN6A 5KFLA 3ZNJ1 4MK7A 1CJTA 2D9OA 1KTQA 3HVRA 1RZMA 4B9TA 3NWGA 2V2KA 3SYZA 1RYRA 2HK2A 2XZWA 4CLYA 3KK1A 3SV3A 2A0FB 4C7QA 2VDHA 2EK6A 3J7ZT 4IUFA 1UVJA 2XNRA 1RB0A 4GVBB 1RTHA 4TU9A 4AL5A 2I9SA 3OVAA 5KFTA 3MEDB 2YNIA 2L9NA 4BBYA 1P1LA 1TL3B 3GIMA 4K0KJ 4PXEA 3PYGA 4OL8A 1VYAA 3IRXA 4OYBA 4OYXA 4P9SA 1E6YA 3M6XA 4UW2A 4FNHA 3CWJA 3GG0A 3H5SA 4OJ3A 5KG4A 3KLEB 4TNOA 1YHQS 1HPZB 4QCLA 2WBMA 1U1PA 3FBEA 3AJ2A 2DNNA 2R7QA 4HTJA 4UQTA 2NPFA 3SFUA 2Z8QA 1C0UA 2FUG9 4WZMA 1YBAA 4DUTA 4I68A 3U1NA 3IRWP 3CCTA 2Q1LA 3FGVA 4B3OB 4M95A 3JQJA 2ZH9A 2NUUG 3HHEA 1JWWA 2XO7A 5KG3A 4PQUA 2APOA 4L75A 5A8KA 5F8IA 1FK9B 3MTKA 5C2GA 2HW3A 4C3KA 8RUCA 1VQOS 2ZUAA 2QL7B 2ZH8A 2YXLA 2KM8C 1RSCA 4RO0A 3EZ5A 1WG5A 1IKXB 4Z7YA 4B02A 1YKWA 5IQQA 1RA7A 2B4UA 1T9UA 2PA3A 4DUYF 3E8OA 5D0HA 4ZLLA 2XLKA 3OFGA 3KLHA 1NH7A 4F0MA 1S7HA 4LFBF 1W26A 5L1JA 3J7AN 2VG5A 3TVZA 3EZOA 1WSVA 2AYEA 1DURA 2HLUA 3MEKA 4NLYA 3RGIA 3MF5A 1KDNA 3MCNA 5IM0A 2XWYA 2DCLA 5KT2A 3MGJA 1AUSL 2VH7A 3UN3A 2CPEA 3F41A 1Y5IB 2HQIA 3HMJG 4RWWA 2G1DA 3EVOA 3O2IA 4WE1A 2B51A 3DLEA 1MG7A 1NZAA 4OI3A 4E0DA 3CDWA 2FVSA 4DEZA 4TY8A 5HATA 2GJ2A 2QN6B 1U2RA 1N32F 3THPA 1OPZA 4YR3A 4DQRA 4R0EA 2FPHX 1KD1T 2LMIA 4WCEQ 2DCUB 2IIHA 3A8KA 4QWBA 1LW2A 3KTQA 4DL0C 3IBWA 5FJ4A 3O6QA 1X7VA 1JNRB 2NXUA 4LJMA 2FLOA 4NMXA 1D1UA 2H1YA 5E3CA 3EDRB 4GRSA 3JTOA 4FVCA 1UVLA 3Q8UA 4K4VA 5HP1A 3TAQA 2E9TA 4FF1A 5E41A 2J0XA 4LBPA 2DHSA 3ZZZA 1UEVA 3B8HA 4O3RA 2J7WA 4KPCA 2RJZA 1S10A 4NI2B 1GNKA 2XMKA 4DU7A 1F3VA 5J2PB 2NSBA 2NXEA 1F9EB 5HMZA 3F73A 2MB0B 2O5DA 3DU5A 3SBMA 1UTAA 1NPRA 4XO0A 3Q8QB 2DGQA 2A6MA 1QE1B 1LWEA 3MCMA 3R1LA 5E0OA 4JI5J 3J80Y 3JQKA 4U7CA 1YBUA 2DHGA 2DR5A 2LEAA 4P74A 2WSCC 3OPKA 3QAEA 2XLJA 2H5EA 4OX9F 3S6EA 1RABB 4IRDA 2GIRA 2RDDA 1Q5VA 4I7FB 4ED1A 4DCOB 1MW7A 3RR7A 2CNOB 2XCPA 2IC3B 2OTLS 4Y3CA 3UDEA 3KHLA 5E2QA 2B5JA 1WI8A 1FRKA 4H4KA 1RWUA 4E98A 2K06A 1FJEB 3LANA 6AT1B 4X64F 2R2RA 4CM2A 2R8JA 2CJAA 2BJ7A 4G6VB 1OSDA 1LFWA 5B7WA 2LU2A 1H2TZ 2FIUA 2H54B 4RWXA 3CCUS 5IT4A 1CLFA 2VL1A 2QFIA 5A8RB 3TP2A 4FF3A 1URRA 5KFDA 1RAJA 4HDGA 2IM3A 2JHEA 4IRKA 2RD5C 3QGIA 3OTBA 2FJVA 2B3TB 2JFKA 1XMQF 3PFEA 3JYTB 4O3QA 2GIQA 1D0EA 2KXNB 2A2CA 3MMAA 3RU0A 5BR8F 2EFQA 5D4PA 2QSWA 4Y28C 2GMHA 4AD6A 1RU1A 3GMGA 4MFBB 1VRTA 1ZYQA 2FC8A 4MK9A 2DK2A 4USVA 3ZTSA 1SC1B 5G0RA 4NXMF 4X66F 5CA5A 4DV1J 3R9LA 1PBAA 3OXLA 2ZJQQ 2OD4A 1DQ9A 1OQ6A 3M05A 1AXQA 5HLFB 3R27A 1X9MA 2GS8A 4N8NA 1RKIA 3LALA 2VFSA 4GVBA 1U1KA 4JV2A 2MQNA 3MEDA 3CMQA 1YJ7A 2IRXA 3GR1A 4AL7A 4YN3B 1TL3A 5E5NA 4IFYB 2CNNB 2GAHC 5IT0A 4RNMA 3KLEA 3B78A 3W3SA 1N0UA 1WF1A 1N8RT 1HPZA 4RUAA 5A8WB 3GIJA 4LMZA 2GHPA 5DDRC 2HRTA 4ES1A 2C3PA 2ZEJA 1H2VZ 3Q83A 2XY5A 3WX4A 4F3MA 1PJ6A 3UFCX 4B3OA 4DWIA 3W8PA 1HHSA 1PYSB 2HWIA 3CDEA 4OHYA 1XNQF 2C2MB 1YX2A 1FK9A 4EWTA 5GMKa 2EBEA 3W60A 3SDEB 2XO6A 3M2RB 2C2NA 4DR1F 4G1IA 3QT5A 1MMLA 1M1GA 3VAGA 1N6QB 2UUTA 2MPUA 5ETTA 3KJQB 3OL6A 2KVIA 3J81j 3CO9A 3NNHA 3EPGA 2JDJA 3K57A 1IKXA 3BSNA 2LDIA 4EI2A 2CZ9A 2PFFB 2PA8D 2GO8A 1IBMJ 2VFRA 2VFTA 1A0OB 1N5VA 3LWLA 2V2QA 5CAAA 2XCAA 4OZLA 5KFIA 5KFKA 2CQ0A 2GO9A 2AD9A 1NHKL 4A8FA 2FB0A 4HEA9 4B3SJ 4GKJJ 2J9DA 1SC3B 5L9NA 4WKYA 2UUCF 2HSEB 3K8VA 1N54B 5AT1B 5CXTA 4NXNF 3SMZA 1DBDA 2NUHA 4W90B 4DPXA 2LQ5A 1GX6A 4U6PA 4DV7F 1HL6A 2DTJA 2R8IA 1XMOJ 3OSPA 3MWBA 1OPIA 3Q8YA 3G6XA 3IR6B 4UTGA 3QAUA 2CJ9A 3I55S 2ILYA 3HULA 1A6LA 3G86A 5KT4A 1Y10A 3CCWA 4B9MA 3ILIA 3D67A 1FESA 4N41A 3BGLA 2R7XA 4KPYA 4JB8B 4RNNA 4JI4F 3G6VA 3MR7A 2DNRA 2FHOB 3NNAA 2VFUA 4CT8A 1WUUA 2J6UA 2VOOA 1KNZA 2V6AA 1LWFB 3D3BJ 2IDLA 1SQEA 3SCLE 1JXEA 2GNKA 3CCJS 4HT5A 5FIIA 2XS5A 2DPJA 1EKRA 1R3NA 4CLZA 2KM8B 1OY6A 4CI0B 5L8RC 3OJSA 3VVTA 1R6VA 4NI2A 4QR2A 5J2PA 5KFNA 3PW2A 1SVDA 1SJRA 4NLSA 3DRPB 2F9JA 1QE1A 4DX6A 3VV2B 1RTZA 3OQ2A 4MAKA 4ZPBA 1H72C 1OWXA 2J0QD 1YG0A 4ETXA 1ZAWA 3GPAA 1IN0A 4K4TA 3PRDA 2LLZA 2WAQD 4ZLPA 1D9AA 5BYSA 4OLPA 4I7FA 4EBEA 3AB2B 1DTTB 3M8YA 4DUYJ 1NNDA 4K4YA 2IC3A 1H3DA 1UWAA 3T5JA 4JI1J 4O0IA 1OO0B 4DDFA 4DX7A 3MM6B 4WFAQ 3FBFA 2BV3A 1HHQA 4LFBJ 3I87A 4HHHA 3M9MB 1TKZB 1WG4A 2ZWOA 1WC0A 2CVEA 2KB2A 4DR5J 3QT6A 4JI3J 3X1LB 3K89A 2K7KA 3R2DJ 2KFYA 2LXIA 4KT0C 2B6AB 1VGYA 4K50A 2UU9J 3KG1A 1RWVB 5A8RA 4B9VA 3M6VA 2PIIA 1VJWA 4ILLA 3N79A 2XB2D 2MZQA 3R5BA 1AZSB 2HFUA 1TUVA 4LBHA 2ZBPA 3JYTA 1N32J 1NK5A 3UNYA 1URNA 2LKZA 3CCES 1R31A 1GK8A 1NK9A 4QIWD 1RWKB 5HQ8A 4IH7A 3KNAA 2IJRA 4MFBA 4EK2A 2UUAF 3A8JA 1V3SA 4B3TJ 2ZZTA 2HFSA 1XK8A 2E66A 1F5AA 3I56S 4WU3A 3ETOA 4YR0A 4DLGA 1RAAB 2CNLB 2ZHAA 4LRAA 1EZZB 2ZBCA 3U27A 5KFBA 1K44A 5HLFA 4KTQA 4TQSA 2C2KB 3C15A 3NEKA 4TN2A 2Q3PA 1GMWA 5HBMB 5HMWA 3EPIA 3TO8A 2AJFE 3W63A 3G87A 2F1FA 4IFYA 5LOQA 3QGPA 3CJ4A 3BPSP 1Y4ZB 2IVMA 2FGOA 3IBCB 1OYEA 3PFOA 4LF7F 3T1AA 2CXEA 5A8WA 3PYEA 9ATCB 2N3LA 1T7PA 1BY9A 2GQ2A 1U09A 1IBKF 1RWOB 3FEXB 2J0SD 4OYMA 5DM7Q 1OY9A 1N56A 4DR3J 2WB4A 1FA0A 3HT0A 5GAGI 1TL7B 3MPWA 1VR6A 1GMWD 2KYXA 3C6UB 4F04B 1ZM9A 4WWSA 4K8RA 3C8YA 1DQ8A 3NP5A 2ZJRQ 1WEZA 3DLBA 3SDEA 1HKAA 3M2RA 2CQCA 2RUSA 2AKWB 1N6QA 4WYWA 2JSXA 4IKAA 2X3DA 4ZIWA 2O3DA 4PCQA 4UF4A 4TU8A 2B7BB 1GMUA 2PSZA 3TX8A 3I96A 4M5LA 2BOAA 2I2YA 1VQ9S 3HLUA 1FRHA 3U02A 3PCOB 1NSKL 1C0TA 2J8AA 4DZDA 1HBUB 1M5OC 1FF2A 3R5AA 2W2MP 3M32B 1T02A 5LMUF 5DQIA 2FVPA 3ICLA 3E01B 1WKJA 5BR8J 3D6FB 3D0HE 5CZVA 1TL5A 1AT1B 3ZTOA 4DV2F 4Y2MA 4QQBA 2QL5B 1J5EF 2AEJA 5B0FA 1T9XA 4X66J 3B4DA 3WIVA 1FXRA 4PPDA 2BBEA 1U47A 1M5PC 2CADA 4HLBA 3V6KA 4DR6F 2DXFA 5A6WA 4I64A 2VZ9A 4LF5F 5D3GB 1FCAA 1R0BG 3ZTPA 4UY8T 4I2QB 4N5SA 1W25A 5CD4A 2PFDA 3L9ZA 3NRBA 2AQ4A 4NWBA 3JSBA 1Y9OA 1QUVA 2WVFA 3GLJA 4NLTA 5T7LB 2GAGC 4BDPA 2V68A 3OHBA 2XNQA 3RW7A 3JS9A 2MY7A 1LWFA 2D9PA 3FMBA 4Q2LA 4QWAA 4CH1A 2EC2A 1FX4A 3THTA 1BXNA 1NEEA 1WELA 4RL1A 2JL9A 3I5AA 2KVQE 2YKNB 5ADZA 4ED5A 2XULA
chains in the Genus database with same CATH topology
1UJ5A 2HHQA 1ZZFA 1OSCA 2XHWA 5HO4A 3CCZA 2KDOA 4JI1F 1QM9A 3EGZA 2ZITA 4NLWA 3Q8SB 4ECWA 3BREA 5KFVA 5KOWA 3AHPA 4EO6A 3LOUA 3WDOA 1S1WA 2YQ3A 2J76E 2G13A 3DRPA 1KEKA 2G0CA 3HF5A 2FJXA 1UW4A 2M52A 3QLHA 2W9BA 4PQUB 3PW4A 1U24A 2FHJD 2FJWA 4F02A 1ZPVA 3T9ZA 5HROB 4EFAC 2KXHA 3GFHA 5KT7A 2FVQA 2VV5A 2RS8A 5A8KB 2MKJA 5M2UA 3EZUA 4DR5F 2KTQA 1TV6A 3SV4A 1X8DA 2NS1B 4JI3F 5KG6A 2RH3A 2R7OA 3NMAA 1RP5A 3GIKA 1EETB 2IAJB 2BUNA 4C8MA 2PC6A 4G1PA 1S76D 4DV0F 2LEPA 4ILMA 1N5YA 1B0TA 3QPIA 5LJ5Y 2KT5A 3M9OB 2P9EA 2VASA 1NHUA 1T8EA 4NLGA 4DSEA 4WK1A 1HWJA 3JSYA 3MM8B 4KBIA 2CJQA 2KI2A 4C0BA 3CCQS 3MM7A 1T05A 2FLNA 2IMWP 2UU9F 3IWNC 1N33F 1UA0A 3L7PA 5K5MA 1N36F 2V9WA 1BQNA 3EGWB 4FF2A 3MCSA 2FC9A 3T6JA 2C3YA 3ZZOA 3OUYA 4AXIA 4A8OA 3IWLA 4LFCF 2R8HA 3VWSA 4DSKA 1DTTA 3HHKA 2CPJA 3SQGA 3BB5A 2XC9A 3HP6A 1FKAF 3DHXA 2MKSA 1M5HA 4ZS6A 5F8LA 2MZSA 1QY7A 4RLEA 3CPWR 4O4RA 1X4DA 2ZE2A 1SV5A 3RRKA 3OR2B 4Q45A 2R2UA 2Y1RI 3VAFA 1JKHA 1S6QA 1Z1ZA 3CJKA 3OL8A 2BM1A 2ILZA 2VBXA 2QO3A 1FRLA 3NCRA 3NBPA 5CYMB 1TFWA 4WFBQ 4K4SA 3M30A 3PR4A 1FXDA 1S99A 2OPRB 4YEAA 1TKZA 1VQYA 3KLHB 2FGCA 3T5HA 3AQOA 3L09A 4BWJA 1VQ8S 1F2GA 3M9NB 1ZOTA 3LH2S 3QGGA 4DV3F 1NK8A 3DRSB 4IQXA 1HNIA 3FEZA 1WNEA 2GGPA 2AYMA 1QSYA 2O1PA 3LP1B 4I1TA 5M2RA 5IS2A 2HRYA 1G3OA 2VG5B 2JEFA 4FN5A 4OI4A 5E3QA 3MM5A 4A8SA 1L3TA 5J2QB 2N3OA 3G6ES 3AY0A 1VMBA 2B6AA 4Q5VA 5I3UB 1QAIA 1K73T 1U4BA 2K8GA 3TA1A 1V6HA 1S49A 4ETZA 5IM0B 4GC6A 3VQSA 1KHVA 2RILA 2R2TA 5MAOA 2ZNZA 2BA9A 5KFJA 2K1RB 5LT5A 2EFOA 4B9UA 2HHWA 1FJCA 4PG7A 2KO1A 1U6BA 3LW5C 2CJBA 3MM7B 3MEEB 3QO9A 2BR0A 5KG1A 1VQLS 3KG4A 1NRKA 2E5GA 2YKMA 2JWNA 2J9DE 2XMJA 3MFIA 2RQMA 3GFYA 4HI2A 4B3TF 1S6PA 1FHTA 1UAWA 1SKRA 1H6KX 4M94A 1Y3KA 4DL2A 3AH6A 4DPOA 4NPOA 3G6YA 3JSMB 1RKJA 2IVFB 1U6ZA 3C6TA 2DRBA 1C1BB 3DI6A 3CVKA 3M2UA 2J7KA 1TKXB 4WE1B 3DLEB 2HMIB 3M8RA 1N0VC 4PG4A 4F4ZA 2V5HG 4C4WA 3LAMA 2CIMA 3B82A 3CJKB 5GADI 3RB3A 2A1BA 3HHDA 1SJ1A 2UVVA 3DLKA 2EFPA 3GR0A 2ASLA 1SKSA 1VIXA 2VODA 2JC0A 2MXYA 4J9NA 2GCFA 3TUJC 2ALZA 1UETA 4H4MA 2IM0A 4TY8B 2WBRA 1KLMB 3H4BA 2BZ2A 2KFZA 3GV7B 3RAXA 3QIDA 3K0JA 4I6WA 3FQLA 1HNVB 2GW8A 4C3LA 1IJFB 1M5KC 4B17A 4FXDA 1H98A 2RIJA 1UJ6A 6FD1A 3BO3A 1X5TA 1UWBB 2OPSB 4O4GB 4R8UA 2ZJPQ 1NO8A 2AW0A 2DISA 4JI8F 4KRWA 4NZ6A 2AYGA 4Q2MA 4RBUA 4C97A 2NREA 3PIPQ 5IFMA 2DO4A 1SL0A 2I8EA 1H38A 3IS9B 4OZNA 3POTB 4Y2AA 4PWDB 5EN1A 4N77A 4B3RF 2QMXA 3V6HA 3U7JA 1GXLA 4NLPA 1DTQB 2KKHA 5E3AA 4C8NA 4QYZJ 5KFHA 1X4CA 1FVSA 4PPZA 4HDHA 1RT3B 1RTJA 4P6QA 4Y0FA 4ICLA 4ZVGA 1I6JA 1Y5NB 4RW8B 1KS2A 3IA0A 1G2EA 4C98A 3QO9B 2D3OR 5EDWA 4A8YA 1DAXA 4HTIA 5J1PA 4ALZA 1HWIA 3KLFB 1Q16B 3CSKA 4KAIA 1TKTB 2VD3A 3R3TA 4RU9A 2XWXA 3UCUP 4ZVHA 4XAKA 1Q86T 1BQMB 1IJEB 4PUOB 2R8GA 4FPRA 2VC0A 4ITSA 3QZ7A 2QT7A 2FY1A 2VG6A 4NRTA 4DL3A 3V6DB 3H5XA 1RT4B 2ASDA 2R7UA 4AQYF 3CXCR 3SFGA 2DH9A 4NLXA 4EYHB 3PW5A 4H4KC 4Y2KA 4MYTA 4J9PA 1OS5A 2E1RA 2L9WA 4HHJA 4NLRA 2ZOMA 4ECQA 4F4YA 3FNNA 2RU3A 3HT3A 3THVA 2W4CA 3DLKB 3VZIA 5DGAA 4DR3F 3MOZA 5HN0A 4P7VA 2LDYA 2A2DA 1KLNA 2OPQB 2QEXS 1RT5B 3LP0A 5HBMA 1IQZA 2ASYA 5K8MA 3PO4A 3SI8A 2Y1JA 1Q79A 1HQUB 2N7CA 5AE1A 4DFKA 4K5RA 1U45A 1RGVA 4QU6A 3VAIA 4Q7AA 3M8PA 4YDXA 2L08A 3KG0A 3DLGA 5DGBA 2R9LA 4CT9A 3PX4A 3CJ0A 5DDPC 1L3VA 3ZZTA 1ROFA 4L3NA 2YKOA 4LVOP 2ZKTA 3MUTP 1NK7A 4ATNA 4WYLA 4ZHRA 2MSSA 3UPFA 3V81B 4OFZA 2BQRA 4LQ9A 2XS2A 4BCAA 4OZ5A 4C9DA 2VBZA 5EWFA 1K0VA 3I4PA 1RJJA 3FEYB 4RBTA 1P8GA 2V94A 3V4IA 3RW6A 1LWEB 3S1TA 4F26A 4YR2A 4ED6A 1RTJB 1YJWS 4IR9A 1VQ6S 2FJBB 3GFZA 4E8UA 4ECYA 4UOCA 3Q24A 3BN4A 5DM6Q 3DOLB 4EZ6A 3K5OA 3GQCA 2YX7A 5J1EA 4KB7A 2MJNA 1LWCA 2KRBA 1S1TB 3VAJA 1KOHA 5KFYA 1XWLA 1KQGB 2E9ZA 3HVWA 2HPUA 3MAHA 4QWEA 4KGMA 3EX7B 3NL0A 4JBCA 2BACA 2I38A 2ZHBA 4ZP6A 1YJUA 3CULA 1IKYB 2KT2A 1HA1A 1CQMA 2VG6B 2YWFA 3LGMA 4CH0S 1ZM4A 4KGKA 4NLOA 1Q4RA 3PY8A 1HW8A 3NAIA 1ZETA 2B7CB 3MMJA 5CYQA 3OR1B 4Q8EA 4LT6A 3SCJE 3KLIB 1NJWA 2HHTA 4USIA 2C22A 1KONA 4KHRA 4JI2F 2ZH1A 2IA0A 3TUZC 3O3LA 1U8SA 2PMHA 3AA8A 3MD3A 4RBVA 1C2PA 4F8RA 2F40A 4KE5A 4BWMA 4DQIA 4CZCA 1QJHA 2CPHA 3C6UA 2W24A 3CJ5A 5DRKA 4IRCA 3M8SA 4NYZA 2X51A 1P9QC 2P9GA 3BSCA 4MYUA 3AB4B 2QA4S 1WACA 1VOMA 1XR7A 4IOAQ 2V4RA 4FF4A 3FZBA 4PXCA 3UCZP 4K4UA 4X62F 1FKOA 1GAOA 4X4RA 1YI2S 2PD1A 5LSRA 3LP2B 4J37A 5H9FJ 2KYZA 1JLBB 1RT2A 1SB6A 4OHVA 3KHHA 2B5JB 3KNGA 1G1XA 2E5HA 3CD5A 3PM9A 4DHVA 2LQBA 2XSJA 3CIZA 5I3QA 1R27B 2ZHOA 2M88A 2ZFHA 3HDSA 4C8YA 2VOPA 3E3XA 3BN7A 1R8PA 2CQHA 3IN5A 4K2XA 2XMVA 2BXJA 4B3MF 2CQGA 1X4GA 1S0VA 5KFEA 2AV5A 2ZBIA 2UV8G 2MZTA 3EXCX 4QBUA 3KJVB 2P6SA 1YRUA 2W7PA 1N88A 3BO4A 2POKA 5J1EB 3MAQA 3C66A 2EBGA 3IR7B 1SJFA 3TARA 4HL9A 5DJBA 2OKQA 3WC2A 1FD2A 2RQ4A 2AGPA 5KT3A 3PZPA 1U49A 2KXFA 2N4CA 1NU4A 2DIVA 4NZ0A 2CQ4A 2Z2MA 4EUVA 2RRAA 1L3SA 1Q53A 3BF4A 1UA1A 1X4HA 1H7WA 4OX8A 5KT5A 3LGNA 4GO7X 4PQAA 4NLQA 4CNZA 2V4JB 2VBYA 2E5LF 4LSLB 2J6TA 2DITA 3ITHB 1IBMF 3EUNA 1MROB 3J7Z5 2YNHB 1HHTP 3CGIA 4DQQA 5F3TA 4FS2A 2VKRA 1LXNA 2DNKA 4UUXA 2MHNA 4OJGA 5GAEI 2XMWA 4DFJA 2B56A 1NH8A 2Q43A 1JX4A 1N52B 4X4TA 1VFJA 3KLVA 3GV8B 1NKEA 1HBUA 4EEYA 4OI1A 3RR8A 5HL7Q 2E1AA 2BABA 1RDRA 4I67A 3T3FA 3MR2A 1JLCA 1FDBA 2ZOGA 4LF9F 2Q6BA 3M32A 3EGNA 1DLOA 1UVKA 3HKZD 4AYBD 2XI3A 2K2PA 1TL1B 3U1LA 3MECB 2AJQA 4B3SF 4F4KA 4GKJF 3FZ2A 1YVFA 3QGHA 4BC9A 3E01A 2ROEA 1LW0B 3CMES 2VA3A 2HVIA 2HRUA 2RF2A 3IGVA 4TYAA 4A48A 4ED8A 3ZZRA 1K1QA 3RB6A 4Y6IA 1YSJA 3CTRA 1S77D 4CO1A 4J9KA 5CCLA 1P1TA 2RKIB 1O8BA 3MMAB 3CC2S 3GFXA 1V3RA 2KJWA 3BGRB 3GB0A 5CYJA 4X4QA 3D2WA 2JZ5A 1Q78A 4IQMA 4URGA 1NJYA 1HWKA 2W8LA 3QJJA 3M8QB 2XY7A 5SZTA 4QR0A 1F5CA 1VRTB 2YKPA 4PR6A 4D3GA 5K8PA 5KT6A 3BR8A 2PE8A 4R5PB 4ELTA 3I0RA 4DG1B 4J9RA 2JEJA 2Z2LA 5T41A 2C3MA 5LMNF 2OLWA 3BS9A 1HMVA 5HMXA 5JJBA 5G0RB 2B43A 1FJGF 1KN6A 2EG2A 5KFLA 3K8WA 4MK7A 2MKHA 3M2VA 3HHNB 2D9OA 3R5CA 4I69A 4DL4A 1KTQA 3PNIA 2E29A 3HVRA 3BJYA 2RQCA 3NWGA 2V2KA 3T6BA 4PG8A 3SYZA 1RYRA 5D6GA 4B9TA 2VPXB 3QIPA 5KFZA 1JLGA 1KQKA 3KHGA 2XZWA 3QZ8A 4FNIA 3OTDA 3I6PA 5L39A 3KK1A 3SV3A 1X0FA 2EI5A 5KAKA 5L1KA 4YFUA 5D3GA 2SXLA 5K14B 2BQ3A 1LK5A 2P6TA 4I2QA 2ZUGA 4OJ1A 4C7QA 2PI4A 2ERRA 2BM0A 3K2YA 5KFPA 4ID5B 4NLVA 3AA9A 4XPEA 1L5UA 2EK6A 3J7ZT 1X4BA 1VQ7S 4IUFA 4WTYA 1YRTA 3GWCA 1QTMA 1UP1A 1HBMA 3DN9A 1UVJA 2XNRA 2BRLA 5T7LA 1RTHA 4A8XA 4TU9A 1C1CB 1S79A 3RZAA 4AL5A 2I9SA 3OVAA 2X3GA 3GE9A 4PG6A 5KFTA 3L95X 1QVGR 4C8ZA 1U6FA 3MEDB 3TR5A 2DGUA 2YNIA 2L9NA 4BBYA 3M1VA 2BVZA 1TKDA 2UP1A 2MSTA 3E51A 1XTZA 1REVA 4F4WA 1P1LA 1TL3B 5CD4H 2GMJA 1U2FA 3KLGB 3GIMA 4PXEA 4DSIA 4OL8A 5DG9A 3IRXA 2VQFF 3TI0A 2UVWA 5F41A 1E6YA 2DNZA 2W25A 1XEZA 4MTPA 3M6XA 4UW2A 4YDDB 3W2WB 4FNHA 1JLQA 3CWJA 3GG0A 3H5SA 1S4FA 4OJ3A 5KG4A 2B4VA 3KLEB 1KQFB 2DB1A 2B0GA 4TNOA 1NK4A 3L3CA 2VFVA 2WHOA 3T5KA 1YHQS 2QA4G 2DPIA 1N5SA 1HPZB 2N4DA 4DBQA 1NJXA 2BOPA 2WBMA 2CPFA 2JJ4D 1U1PA 4QCLA 5MLCV 2RS2A 3PV8A 1NK6A 1APSA 4PRFA 2R8KA 2NLWA 1C4CA 3AJ2A 2DNNA 2R7QA 4HTJA 1VHFA 3D0IE 4FZVA 4UQTA 4ZP8A 4OZ0A 2NPFA 4JYAF 2GX8A 2MKCA 5T14A 1KTVA 3SFUA 1U48A 2YKNA 1C0UA 2FUG9 2Z8QA 3NKYA 3RBDA 1SIZA 4WZMA 1YBAA 1WTFA 4I68A 3U1NA 3IAM9 3CCTA 3IRWP 4OX6A 2DNOA 1HWLA 2OPPB 3LWMA 2Q1LA 2LYVA 5FLXY 2KH9A 1QSLA 3MM9B 3FGVA 5DG7A 3G4SS 4B3OB 4M95A 2F8HA 2JOQA 2ZH9A 3N6MA 2ADBA 5DLFA 1GH8A 2NUUG 3HHEA 5EUHA 1JWWA 4QIEA 2QZ8A 4GO5X 1S0NA 1AFJA 4DFPA 4IR1A 4ZKAA 1PILA 3OW2R 1D9DA 5BYQA 4I4BA 2XO7A 5KG3A 2OMLA 1ZTTA 2UXCF 4PQUA 4WXWA 2D7SA 4CTAB 4TLRA 2APOA 5HROA 3ZC4A 1N5QA 4F3QA 2R7SA 1PC4A 5A8KA 5F8IA 3DDKA 1FK9B 1YJ9S 2R7TA 1SI9A 1WI6A 3MTKA 3OTEA 4YUDA 2HW3A 1OIAA 1TAQA 2YY3A 1UVMA 1EETA 2IAJA 4NCGB 1NAQA 1X5SA 2X1FA 1XERA 4C3KA 2L9DA 1P27B 2EVZA 1VQOS 1E6VB 3MM8A 2CQBA 3MXHP 5IQ6A 2R2SA 1VQ4S 2ZH8A 1BD6A 2DGXA 3P5TL 5HMYA 5LXRA 2KM8C 2E44A 3HKWA 3CJ2A 4AE5A 1NKCA 3EZ5A 3VAMA 1WG5A 1IKXB 4WZQA 2EK1A 3BQ0A 4B02A 4ECZA 4MMOA 5DDQC 4JV0A 6FDRA 5D4LA 3KKFA 5IQQA 2KZMA 1RA7A 2B4UA 4IOCQ 1ZM3A 2MYFA 3OR2A 1SL2A 1QAJA 5H1SV 1X5OA 3OBIA 2MKKA 1YTYA 4NA3A 2OAUA 2PA3A 4DUYF 4R0JA 4RW6B 5CYMA 5GAHU 3E8OA 2DH7A 3I9V9 2M4MA 5EGYA 4TY9A 4NZ7A 2XLKA 3OFGA 2OPRA 2ZH2A 3KLHA 4X2BA 2DNLA 4RW4B 2ZH5A 4WU2A 3AJ1A 5M2PA 3WBZA 1NH7A 3K5LA 1IXKA 1DARA 1S7HA 3DRSA 2VC1A 4DSJA 2JVRA 4LFBF 4CNYA 3LP1A 5L1JA 2HYIB 2VG5A 3TVZA 4DV5F 2DNMA 1GT8A 3KWMA 2ROGA 2R4FA 3N4WA 1Y5LB 4L72B 5J2QA 1U1OA 1UMJA 3FSIA 1HYSB 2AYEA 1DURA 2HLUA 4K5SA 3MEKA 4NLYA 5I3UA 2DT9A 4Q43A 1G6BA 3MF5A 5IWAF 1LXJA 5IM0A 2XWYA 3Q2TC 2DCLA 5KT2A 4WKRA 3R5DA 2K1RA 3MGJA 4AL6A 1MMNA 1SH3A 1Q7LB 4LVNP 2B9XA 3OSNA 2VH7A 2VKZG 3MEEA 5BJRA 2CPEA 3F41A 1Y5IB 1YJTA 1J2VA 4F2SA 5D8HB 5J2NB 4ZOSA 2HQIA 2MY8A 2M5YA 2GA7A 2KU7A 3HMJG 4OHXA