5LL6d

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTGKRLAKKVARRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
total genus 28
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ll6d00
5A2QY 5FLXY 3J80Y 3JAMY 3J7A1 5IT9Y 5LL6d 3J81Y
chains in the Genus database with same CATH superfamily
2QLBB 4DV2F 3TUPA 2C3UA 2B6AA 2KU7A 4WKYA 1IR1A 4P2FA 2EFQA 2HHWA 4ZOSA 4DSIA 1EB0A 4N76A 2M4MA 3B4DA 3JTNA 1TR0A 4I7FA 3QGGA 1ZAWA 2Y0BB 1JLAB 2MJUA 3GZ7A 4LRFA 2AMCB 4JI8F 2OSQA 3HHLA 3Q2SC 2R8KA 1XNQF 4ZVUB 2I6WA 1BUXA 4DPTA 1Q0NA 1QE1B 3DYAB 1QAXA 4ZP9A 1QTNB 5GAGI 2DO0A 5IM0B 3OL9A 2BABA 3ZZZA 2N7YA 2CQ2A 1C4AA 2LXFA 1FVQA 3FCVA 1GFWB 5B0DA 5ETQA 5IS2A 4KYZA 4DWIA 2BJDA 1OS5A 2CXEA 5EHHA 3MFHA 1FK9B 2BM1A 4DHVA 3H5XA 3W5ZA 1RTDB 2VB6A 3MCSA 4OZNA 1NDKA 2J9EA 2RU9A 4DR6J 1T94A 3DC2A 4C0HA 5GAEU 5KFXA 4UZBA 1MMDA 1EZZB 2W8LA 5HI7A 3VAJA 4GKKJ 2LCWA 2XYGB 1RHRB 1TL7A 1RHJB 4E2FB 7FDRA 4OV6A 3PJ9A 3K8WA 4FS2A 1RHUB 3PRVA 3R6GB 4JV0A 2XNRA 4ES3A 2QL7B 1AUDA 3D5MA 3CCQS 4IG3B 2RUSA 3T41A 2ZBQA 3TQ1A 2EC2A 1JX4A 4DN9A 4PXEA 3VVTA 5DM7Q 3D6FB 4L6V3 1R0BG 3TZWA 3BQ0A 5CABA 5DDRC 3GONA 2J0SD 2RS8A 2OPQB 2RQKA 2H1YA 3HSGA 1CVJA 1U2CA 3LTOA 3PTWA 4I67A 2HAFA 1PC5A 2MHEA 1JLCA 4B17A 1GEHA 1S12A 1TVRA 1VC5A 4BC9A 1M1HA 5KT7A 2VC1A 3RYLA 4LR8A 1UVJA 2MQQA 5DQHA 4U96A 2ADCA 3HHLD 1N0VC 2H5JB 3H5YA 3B8HA 2VHGA 4DG1A 1Q16B 3V4IA 3DRRA 1QSYA 1NU4A 4K4SA 3D68A 1NJYA 1REVA 3VR1A 1MW7A 3MOJB 2L08A 2MY8A 2VH7A 3ZFVA 4KGMA 2AJ4A 2VU5A 1UFWA 3OL6A 4MK8A 2XZDB 2XO6A 2ASJA 2HFOA 1T05B 1BHNA 4R0EA 1LKZA 1F3VA 5K20B 3LPYA 5KFPA 1Q53A 1BQMB 1VQ7S 4TU9A 2G2ZA 4HR2A 1HBMB 3C2PA 1W7WA 2AGPA 3A8KA 2W01A 4QW9A 4PXDA 3I87A 1EJ7L 2GMLA 2FLLA 3D0GE 4WFXA 1XMOF 4NLGA 2QRRA 3IG1B 3PR5B 2ZM6F 3TEHB 4UQGA 4JI5J 2J6TA 2AEMA 3A3NB 4HEA9 4Y2AA 2AGQA 2JVRA 4HACB 3PO5A 2JVOA 4F26A 3PR4A 2Q79A 2A2DA 5B08A 2E7WA 1X9WA 2I0XA 1RWVB 4G1PA 4DSJA 5KT4A 3KHRA 2CUYA 1X0FA 3KLFA 1U1LA 2P6SA 3ZZOA 4F25A 2CZ4A 1TFYA 1RXOB 3RBZA 3KK2A 2KXHA 1T03B 1KD1T 4OYPA 4F8RA 2PMHA 4UUXA 4PZVA 1X5OA 4DUTA 3L7PA 4LREA 3ILOA 2HNZA 1D3WA 2E1CA 1FCAA 2WAQD 1FE0A 3CT9A 3A13A 4KSEB 3QRPA 4KY3A 4NL5A 4CT8A 2CJ9A 3DLLQ 2K1RB 1DZ5A 2W2PP 2BQRA 5KFWA 4B3OB 4ECVA 1HYSB 2ASDA 4YS2A 3D54A 2XS7A 2KM8B 3K0JA 3CJSA 4J9PA 3BKTA 2YH0A 5EDWA 1QTMA 3ILLA 2HLUA 3HHDA 2GJ2A 4KH1B 4PPZA 2GVDB 5KFKA 3PM9A 4PXBA 3HVWA 2FD2A 3DOKA 2K2PA 4EYHB 2IAJA 1VQ5S 1JLEA 2D3OR 4QWAA 2ZVSA 1IBKF 3MHYA 5F3TA 3EVMA 4NEZA 3ZZ0A 5I3PA 1T9WA 3GFXA 5CYMB 1VHFA 1SH2A 2ZH7A 4DFMA 4NWBA 5D4PA 4ECRA 3E51A 4PXCA 4YP3A 3IFEA 4V1Ak 3JAMY 1VQMS 1QD1A 5GMDA 3VGUA 2DR5A 1BGXT 3MM7A 4X65F 3TUJC 1EP4B 2M88A 2Z2MA 2OUGA 1VIOA 2H5EA 2A6OA 1PYTA 2XCPA 1RKJA 2DPIA 4ZLLA 2IM3A 2HIQA 5D0GA 1S77D 3X3UA 3E3XA 2V2KA 2HGMA 4M95A 1SKRA 2MB0B 2BJ9A 3I0SA 3GIIA 4A8KA 5A8WB 1R31A 3CC2S 3BQ1A 2YPYA 3I5CA 4LJMA 2XMKA 3GYNA 2M5YA 3ETOA 2L9WA 3J81j 2IM2A 3P4UB 2CNLB 4LIRA 2YPZA 2H9ZA 2VBYA 3RB0A 3TOQA 2PD1A 4USTA 4DV0J 2C2RA 4C98A 5E3QA 2GAGC 2LMIA 4YOEA 1FXDA 2WTFA 4M63A 3BH7B 3I56S 2VG7A 3OXFA 5LXRA 1VQYA 4K2JA 3Q8SB 2EBEA 3WHIA 5H1SV 2IA0A 2LU1A 1DLOA 3MR6A 4BLGA 3QQCD 2CPJA 2WB1D 3MMJA 1F9FA 2RB7A 1F5CA 2HBQB 4DQQA 4B3MF 2AEJA 2GA7A 5F8IA 3OVAA 2N4CA 1HW8A 3PFOA 1OSCA 1OMSA 4LRBA 2OEJA 1S6QA 4J9VA 2O66A 3RZAA 2KFZA 3HCXA 1CG2A 4FF1A 1QM9A 2MLXA 4FN5A 3MM6B 3BSCA 4N56A 3GFZA 4JI6J 4RX6A 4K4TA 4DUZF 3M8YA 4YB6A 5L1LA 2W25A 5KFEA 1CJVB 4N5SA 4A8SA 3G86A 2FJAB 3C19A 4ECZA 4ZPTR 1M0SA 1PCAA 1N54B 4F4ZA 4HVZA 4F4YA 2UUTA 3Q24A 2BMBA 2IJRA 4KPCA 1HQ2A 3C15B 1FJEB 2CA9A 4YR0A 1HI8A 1UMJA 3OR1B 2A6MA 3T5KA 1R8BA 1Q4RA 3CEDA 3CCMS 5AT1B 1U4BA 2KG0A 3LP0A 1IBLF 1PJ5A 4B3RJ 1TAQA 2OSRA 3D0HE 2Y1LB 1K73T 4C8NA 2W9CB 1RUSA 2XG8A 2GO8A 2QV6A 4LFCJ 4PWUA 3G8QA 3J7AN 1N5YA 1DTTA 2K7JA 1FDNA 2E5LJ 2G2YA 3R6LB 2YNGA 3SCIE 4P6QA 1W2IA 1MNEA 1CC7A 1JLFA 3CJ8A 1V5VA 1FRLA 3ET6B 1CULB 3SCJE 1YIJS 4ZVSB 3B78A 4DX8H 3KDOA 4CCHA 4DX6A 4JI7J 1GH8A 5DG8A 2HQFA 4JI1J 3UW1A 1VGYA 2FLNA 3H25A 1KLMA 1U6FA 2A10A 2YWGA 4HDHA 4C0BA 4RZRA 5KFLA 1E6VB 5H9FK 4LF8F 3TJ9A 3OVBA 1NJIT 3TUIC 3P3DA 1YTYA 1IWAA 4ES1A 2CQHA 2ZC3A 2HEKA 2J7KA 3DLKA 3M8PB 1H0HB 1TKDA 4LF4F 4L3NA 1FDBA 1F9HA 1RLDA 2FY8A 3UD4P 2HK3A 1NB2A 4NYOA 2R2SA 2FVCA 5IM0A 3AA8A 2AX1A 2ZUAA 4A8YA 4K0KJ 4I2QA 1UZDA 3MXHP 4IRKA 3VVUA 5F8NA 5M2PA 3MUVP 1IVZA 1JMTA 2UUCF 3QWPA 1UVNA 1RHKB 2XSJB 4DSEA 4YB1P 3OLAA 2MJNA 1FK9A 1VR6A 2IDLA 4DV2J 1RTDA 3NP5A 2I5JB 4MKBA 3NS5A 5H9FJ 1DBDA 1NRKA 2XI3A 1GQEA 4GVBB 1P9YA 3FBEA 3FCWA 2QSWA 4EBEA 4K4WA 4OYMA 2VFVA 2H3EB 4ECQA 3MECB 1VJWA 4KV8A 2AQ4A 2XWXA 2WCXA 3RGIA 4JI8J 2VKRA 2B0GA 3A3PB 2AV5A 1XNQJ 4O3QA 2VBXA 5CQGA 1ZPVA 1YJUA 3KLHB 4CRJA 4IG3A 4B3TF 4IDKA 1U25A 1CJKB 2YKAA 1N5QA 3HFVA 3K58A 1M5VC 1JJ4A 1HPZB 3RRHA 3QATA 2CJXB 3W5XA 3L09A 1EIYB 4L75A 2E5IA 1SB6A 2NZCA 4NYPA 2OPQA 4UZCA 2LVWA 4ED8A 3DHXA 4H4KA 3GG1A 3WC0A 2D41A 4Y65A 1F5AA 1K1QA 1N34F 4LBHA 1N5TA 9ATCB 5A8KB 2FZCB 2H4YB 4R8UB 2BJ8A 2RDIA 4F50A 2HHTA 4A8WA 2IVMA 4MTPA 1KTVA 2DTJA 3R5GA 3CCSS 5DETA 1XEZA 3EM1A 1FESA 4KAIA 3WX8A 4LF7F 2CJYB 2VPXB 3VV2B 2ZH9A 3B6BA 3NGDA 4A46A 2ZJRQ 3RR7A 4K5RA 3HZGA 2WHOA 3KLIB 1N32F 2B43A 1S1XA 5KFNA 2HHHF 3HFKA 2DXEA 3PKYA 1IKWB 2MQNA 2V6AA 3ADAC 3TAQA 4DV4F 2BBEA 3BGOP 3W9IA 1TK0A 2C2NA 5HVFA 3O2IA 3FKBA 2CVIA 1IKXA 4WIQA 2R7OA 1XWLA 2R2UA 2QA4G 1DTQB 3JSBA 2DHHA 1Z2ZA 2G4BA 3SYZA 1RABB 3AA9A 1T05A 4C8ZA 3SEOA 2PMWA 3FJ2A 4XDDA 3LF0A 2Y1RI 1QDUB 1BQMA 1D1UA 4DR1F 1HBMA 2RMLA 3VZHA 2V4JB 1J5EF 1LFWA 3MM5B 2FDNA 1BE4A 2F7VA 3IG1A 4F0HA 4FYYB 1FWKA 4LMZA 1TKTB 3QJPA 4H4MB 4HACA 3OFGA 3NAIA 2LP4A 3ZTOA 5K9FA 3I0RA 3JTOA 3MR2A 1V5IB 3H8YA 4F02A 2RIJA 1FKOB 5A6PA 2KKHA 2CJQA 4GC7A 4HHHA 3AH6A 1NEEA 2KRBA 2ALYB 3SSSA 4ZP7A 1LK5A 3NGSA 2X51A 2V9KA 1WC1A 2DNOA 1Y3JA 3AQPA 2JJ4D 5M2UA 1OIAA 4WIIA 1T03A 1GTEA 4UOCA 1ZYQA 1YKWA 4DUYF 2ZITA 3PG9A 3AOAA 1FRKA 5I42B 4NLQA 1R27B 3OTBA 3LGNA 3DXSX 3BQ2A 2J0XA 2GHWA 2M70A 2K3IA 4B9MA 3J7ZT 2OPPB 1Q95G 2MZ1A 3P5TL 3EGVA 2H65B 1UAWA 1XMOJ 1RT7B 4PQUA 1DQ9A 4ZVQB 3CDBA 4IQXA 2KDOA 1O51A 1R8HA 4P74A 2MMYA 1N52B 4XPCA 1S0OA 3KG4A 2FC8A 2ILYA 2DGXA 5KAKA 2B4OA 1REGX 3PZPA 1HYSA 3V6KA 2IHR1 2J7WA 4O4GA 4RW9B 4RWXA 3QGIA 3DLHA 3IBWA 4PG8A 3J7Z5 3UD3P 4YB5A 2HFSA 5KT3A 4RUHA 1DHMA 2GVDA 2XLIA 3ISNC 2AYGA 3UNGC 4CZCA 1KEKA 3QAUA 3DRPB 2LECA 5L39A 3G87A 4HHJA 3PACA 2C2OB 2LXUA 3SDEA 5HN0A 1WG5A 2V4QA 2M8DB 5F8JA 3ZZRA 2QN6B 4AD6A 3BSNA 2MKYA 2HVHA 3W7BA 2DGSA 4FNHA 2ZBRA 1R8CA 2DY1A 1SXLA 2J5AA 4L76A 4WJBA 3SV3A 2RQ4A 5CYMA 3KHHA 2ZJPQ 5H9EJ 2HHPA 3VAFA 3IGNA 1BMQB 4AUKA 3FQLA 2RHSB 1J5OA 2GNKA 3GV7B 3D3BJ 1YJVA 1XERA 1RTHB 1U45A 1XNRF 3MMCA 4BWMA 4ID8A 4IYQA 2RSQA 2NSCA 2FPHX 3V6DB 2EFVA 3LAMA 3R7NB 4KTQA 1FEEA 1N56A 2LA4A 2IYIA 4WCEQ 1N5SA 2OP5A 5A8WA 4GRSA 4DL0C 3N6LA 2H51B 3Q8QB 3TO8A 1RZMA 2OEKA 3QJJA 1MU2B 3C8YA 5EWFA 4ZPAA 1NKEA 2G0JA 4PWDB 1IBKJ 2XGQA 3TYTA 4ZDNA 5KG2A 3NMRA 4XK8C 3HLUA 3OL7A 5SZTA 3M2RB 2OH2A 1R0AA 2HLTA 5C24B 1HFEL 4QYZJ 1KNZA 4EBCA 2DK2A 1KQKA 3OTCA 1N6QB 2YWHA 2MLYA 1IQZA 1HARA 3CDWA 3I32A 2BJEA 3CE8A 4N8NA 7FD1A 2R7QA 4TN2A 4ECWA 3EMTA 8RUCA 4X65J 3Q8PB 3BDPA 1N33F 1OY8A 1F60B 1VBKA 3BN4A 4ZPCA 2FHJA 3BH6B 2MSTA 1X5TA 2ZOGA 2WSCC 3OR2A 1Q86T 3MEDB 3MM6A 4GVLA 3ZNJ1 3OSNA 2PA8D 3FZBA 5DLGA 2RH3A 4YQWA 1IQTA 1CJVA 2O01C 4C3KA 5ETKA 3PHEA 1K0VA 2B4UA 1ELOA 1U8WA 3K7RA 2K3KA 4RNMA 3M6XA 4RBTA 5KT5A 1SH0A 4LVNP 3VHQA 1E6YB 2BZ2A 1C1BB 3HT0A 4RUAA 3C15A 4WTYA 2PDAA 1ZZFA 1PYOB 4Q0BB 3W65A 4NLUA 3UN2A 3GU0A 3TWZA 2DGTA 1VI7A 4B3MJ 2W9CA 5DDOC 4ZPBA 5CYJA 1UFKA 3GJQB 2AF6A 4OYBA 3QGHA 2QFIA 3SZ2A 1NH8A 3WQPA 1RAAB 5GMEA 4DPUA 1RJJA 3MZIA 1TK8A 2KH9A 3MPYA 2WONB 2CPEA 2VFTA 5C25B 4DUZJ 3R5JB 3GV5B 2DR6A 5J2NB 4WWSA 2XNQA 3OTEA 1FEHA 3ET6A 1CULA 5IT9Y 1DRZA 3V81B 1HQEB 4FXVA 4OLOA 3UDEA 3TJ8A 3TVZA 3KTQA 2CQPA 1UEKA 4O3PA 1HWKA 3C14A 2BQ3A 1Q8IA 3BGFA 3IM8A 1I51B 4CO2A 3GYXB 1O8BA 2BDPA 3ICLA 1S79A 3ZZTA 4PYAA 2VICA 1E6VA 4KC5A 2BE2B 4USHA 1IBLJ 1NDCA 2FHJD 5KG6A 2VJVA 1RDRA 3CJ5A 5DJBA 2B7BB 2BKOA 3CSKA 4XO0A 1RQ0A 2CQGA 3H90A 4NI2B 3M8PA 4AYBD 2AIRB 4ZCIA 1UJ5A 4RR5A 2ZHOA 3R97A 2D3O1 3S6EA 1GAOA 2R2RA 4NLVA 2CNKB 4P9SA 4DX5A 3CD0A 5F8MA 1HBUB 1UWBB 2EC0A 1EQMA 4EO6A 3BBBA 1JLBB 5IC6B 2XSJA 2OJ3A 4NRUA 3OUYB 2RU3A 1PJ7A 1JKHB 2IFXA 4KFBB 1OO0B 1T9UA 3OV7A 5B0CA 2BANB 2LDYA 2I5JA 2R7VA 4TQSA 4YR2A 3RB4A 4C8OA 2AWZA 4GVBA 3H2VE 1OQ3A 1HI0P 4KGZB 4LF8J 3GR0A 2VBZA 2Z30B 1VQOS 2VJUA 4D3GA 2V67A 3MECA 1S9EB 3DDIA 3LAKA 2GGPB 3R5DA 1DQ8A 3KLHA 3A1YG 5I3UA 3WX4A 1B3TA 2JWNA 4LF4J 3CCUS 1CJKA 3IR5B 4DL7A 3LOUA 1HPZA 2RILA 2PEHA 4RJVA 5A8RB 2F9DA 2BRKA 1M1KT 4NCAA 3LP2B 2VF3A 3HHNB 1HL6A 1X4DA 4KGVB 2UUCJ 2H5IB 3GWCA 2DIUA 1WHYA 2LYVA 4R8UA 2ZZNA 3VAGA 4K8RA 2NZ4A 5LSRA 1FFGB 3HPOA 1RWMB 2C1EB 5K5MA 2GHVC 2XO7A 1YRUA 2Q43A 1QY7A 4M5JA 3KLIA 2FY1A 3NRBA 3M4XA 1IKWA 2HS4A 4DL4A 2HK2A 2Q66A 4Y34A 1TL1B 1Z1ZA 3S1TA 4OV1A 4QBUA 5FLXU 4QWDA 1Y7PA 4DQIA 3DGPB 4B3TJ 1U47A 3MURP 3PO4A 1JLGB 3FCHA 1F3FA 3ILJA 2DYAA 2MHNA 3AODA 5CXTA 3P6YC 1DTQA 4J9SA 3P5BP 1WHVA 3KJVB 1JXLA 1GXUA 2QSFA 4KO0B 3BGRB 1A9NB 1LW0B 1N34J 4JV1A 5ITHA 3K5MA 2YX7A 2V34A 2YH1A 2YQ1A 5E3CA 2R7WA 3NL0A 3D1HA 2ROGA 3W66A 2KB2A 4EEYA 4LF7J 2V4JA 4HDGA 1Y10A 2WVCA 3K5PA 3MM5A 1X5SA 2ZDOA 1N32J 2XSFA 2HHHJ 4M5MA 5ETVA 4ZMMA 1VRUB 4CLTA 2F63A 1NKCA 1TKTA 2DXDA 3UN3A 4RNFA 2YWFA 4H4MA 4DV4J 2QG9B 1QAYA 3KNGA 3O5TB 1FKOA 5E0OA 3H20A 2BKPA 3MF5A 1G4CA 3M6WA 2EI5A 3U7JA 5C2CA 2Y9HA 4B9NA 4MFBB 5KFQA 4LF2A 1I94F 3HF5A 4M1KA 1UW9A 5I42A 3WC2A 4A48A 1SL2A 2Z58B 4DR1J 5I3QA 1Y3KA 3DOLB 1SKUB 1J5EJ 3VWSA 3IAM9 1FJ7A 2OPPA 1RT7A 3IS9B 2HGLA 2DPJA 2OFGX 4CH0S 3GTYX 3D6HB 1URNA 2XS5A 2GQ2A 2NQPA 2BACA 4CLPA 3C66A 6AT1B 1WC4A 2VUGA 4RW9A 2KZMA 1NJXA 3AHPA 4K7QA 2JC0A 1N4LA 3EPIA 3B54A 1RWWB 1YJTA 3PX6A 4ID5B 1N88A 3H5UA 1U24A 2V2VA 1NZ8A 5IV3A 1U09A 2HBYB 2RDDA 5E41A 2MTLA 3DRPA 1U8SA 2AJQA 1B0PA 2O3DA 4DUYJ 4NZ7A 1FXLA 4ZVHA 3PIOQ 2KFYA 3FRYA 2OPRB 3IBCB 5GAEI 4B9UA 1YJ7A 2M2BA 5DRKA 4C11B 3BYPA 4WXOA 2HS3A 1S0NA 1RP5A 4U7CA 1KONA 5JJBA 4TYAA 3CWJA 3W8PA 1FERA 2UXBF 4HL9A 1T3NA 4A8OA 4F7VA 2DRDA 2MZSA 4ELTA 3I82A 5HMZA 5L1KA 1XC9A 2J0WA 1PAEX 2IBOA 2A1BA 3LGHA 1T8EA 4C8KA 2MPUA 1VISA 1ZA1B 3V6DA 2Q6CA 3N5FA 4RPFA 4F4XA 4M5DB 3R9LA 1H7XA 4KR0B 2M7SA 2AJ0A 1ZA2B 3MD3A 1CJUB 3ZC4A 3D9BA 5HVHA 4HI1A 3AJ2A 2CDQA 1ZPWX 4Y3CA 1MU2A 3IMQJ 3D2WA 3Q8VA 3GR1A 3IGVA 2CQBA 3PDNA 1IBMF 4PWDA 4YEAA 5GADU 3M9NB 2HZCA 1WKJA 3GE9A 4WPAA 2Z56B 3KJQB 1KBRA 4LQ3A 3EGZA 2CG4A 1Q8KA 3M2RA 3GFHA 3TI0A 4NCBA 2HWTA 3W5YA 1N6QA 4QR1A 2LFVA 4OYAA 4WE1B 4DJBA 4K4YA 1YQHA 2OFHX 5THWA 3EWGA 1KLNA 1WSVA 4RUCA 4A8QA 2IIHA 3NCPA 4CI0B 1VBXA 2BW7A 4Y00A 2Y0SD 2DGOA 2GIQA 5D3GB 1P9QC 2VL1A 3DLGB 5DGBA 2MKCA 1FFSB 1TTHB 2XI2A 1C1CB 2ZVIA 4N8OA 3NOGA 5FDLB 3FGVA 2NLWA 3DLJA 2C3PA 3VGTA 3CDAA 4JI3F 3MPWA 2AGOA 5T7LB 1BY9A 2F8HA 1RT5A 4OZ0A 1X9SA 4DFPA 3QT5A 5DLFA 5E33A 3VALA 2UVVA 3HKWA 3DI6B 2B8QA 1SV5B 4HT7A 4AQYF 2HSEB 3J7A1 5KFZA 1QJHA 1F2HA 1D9FA 2EFNA 1UVLA 1WHXA 2YQ0A 2QA1A 5AE2A 4WP8A 4IUFA 1OYEA 1TV6A 1SIWB 3SBMA 2FLPA 2K7KA 4Q0BA 5KOWA 3DRYA 3LPEA 5KFMA 4NE9C 1HWUA 4DSLA 2ZZMA 1N33J 1LV5A 1NPKA 1HNXF 1YBTA 1SKSA 2B9XA 3JTPA 4FVMA 3TAPA 1UVMA 2RUGA 1IBCB 4FPIA 4QIGA 2PSZA 5KFDA 4F4AA 2E9ZA 2BV3A 2XZTB 3FBCA 5J2NA 2UV8G 5HMXA 3A8EA 2HWHA 3SXLA 3V81A 1HQEA 2J9DA 3RAQA 5DZ7A 3MMAA 2DR7A 2XMJA 3BR9A 2WVEA 4NMLA 3EE3A 2V9WA 1LXNA 1D8ZA 5BJRA 1FKPB 3P49B 3M32B 1GMUA 1SQEA 3GSIA 1WF2A 2KJVA 4YY3F 2ZUGA 4X64J 1KFSA 4QWEA 2MXYA 5EX3A 4UUWA 3SSQA 1MMNA 4ED4A 3KK3B 4ILMA 4GO5X 3EDRB 4MYTA 5L9NA 4KIAA 1RADB 3PX0A 3PV8A 1NLKL 2GFFA 5ADZA 4NI2A 3ZZYA 4IOCQ 3W60A 4G65A 1N5VA 5DDPC 5KFJA 3V2UC 3L4BC 2B5JB 3FEZA 3QAEA 5HL7Q 4RW4B 3OTOF 2FJVA 4N7TA 4DSFA 5LT5A 1HBUA 3EICA 2W9BB 1AT1B 3AAWB 2NCKL 5HBMB 1N8RT 3N01A 1U2FA 1TK5A 5IT0A 3CCWA 3A8JA 3UCGA 4KFBA 4K4ZA 4NLDA 3QLHB 4ZCKA 4QU6A 2BANA 4ZPWR 1YJNS 1H2VZ 2ZE2B 3FEYB 3ZO7A 4TYBA 2FZGB 5HVGA 4WP3A 2OD6A 4K4UA 1S1VB 4TXSA 2X1FA 1YG0A 4CLLA 4ICLB 3BR8A 1IM4A 2DD8S 1CLFA 3AFGA 4Z7YA 3T6BA 4F3QA 3M8QA 3IR7B 2XULA 2Y3YA 4J7CA 4CDIA 2GZOA 2D3UA 2C3YA 2GGPA 2P8IA 4DL6A 1JLQB 1NK6A 1RAFB 3AB2B 5I4MA 4ZS6A 5KG4A 3M8RA 3JSMB 2E9RX 5A8RA 2OHDA 3IAS9 2DGQA 1ULRA 1JNZB 4NLPA 2QFJA 4MKYA 4B08A 3CC7S 3ENQA 1KR4A 3LP2A 1UWAA 3GJRB 1T11A 2V4RA 3CD5A 1JB0C 4F36A 2KI2A 5LMUF 1X5PA 3E2EA 5KG3A 5A6WA 2M52A 3P45B 4LF5F 5B0AA 4TY9A 3KOAA 2PFFB 2VC0A 3LANA 5L38A 2VDIA 3ENVA 3R27A 5L46A 3TZXA 3T9ZA 5J2PB 2G2OA 1KP6A 3SIPB 3HVTB 3DDNA 3ISZA 2B4PA 1VQ6S 2N4DA 2AYEA 2V8PA 3TAMB 3SQGB 1R8PA 3JQKA 4RU9A 3UDVA 1YGYA 3T1AA 1KVKA 1VLYA 2J8SA 2QTWA 4GC6A 1WORA 1IR2A 1JLGA 1VHIA 2GAHC 1FNOA 4CIOA 3IO1A 1VC0A 2Q1LA 1S1UB 2RQCA 1YRTA 3KJVA 4W4MA 4KO0A 3BGRA 1LW0A 1NHKL 1MROB 3AD7C 1KVJA 4Z7CA 4LR7A 5JMNA 2AU0A 3Q2TC 3ZTQA 2VASA 2KXNB 1S6OA 3THVA 1R43A 4ZP6A 4DR3F 3ELHA 3N4WA 3NMAA 4AT1B 2L9DA 1SJFA 3MPUB 4ATNA 2MKSA 5HROB 1QVGR 4DCJB 1VRUA 2F4FA 1D0EA 3N0VA 5AE3A 3V5RA 2RRBA 3K59A 4MK9A 3CJ3A 1TAUA 4QIVA 4C3MA 3O44A 3HHLC 2NPFA 3TP2A 4ZHRA 3KNAA 2DHAA 2WBMA 2X3DA 1NCLA 2NXJA 2EG1A 4LRAA 4TNOA 2W7AA 2W2MP 4IH7A 2MLZA 4MIBA 4MFBA 3QT7A 4I4BA 2NPIA 4UW2A 4FKYA 3JQJA 1S9GB 4NMXA 5HMWA 2DNPA 5KFUA 2N3LA 1TKXB 1S9FA 3VTIA 5HQMA 1Y5NB 2BXJA 4WXWA 1UP1A 2O1PA 4LBPA 3DOLA 4ETXA 2BR0A 3UNYA 4DV3F 4NEYA 5CYQB 2PMZD 1SUQA 1ZM3A 2C42A 4QR0A 5J1NA 3IS9A 3QMQA 1CC8A 2GIFA 5IQQA 2B9YA 2E1PA 2G9OA 1O6XA 3ZXWA 2LQBA 4AL7A 3HM9A 1M5PC 2CJAA 4OIXA 2W24A 4NA2A 2RVJA 1IM6A 3OTDA 2MSSA 3HD2A 1IJEB 4I0WA 1XMBA 1Z4UA 4ID5A 1UPMB 3EGNA 1L3UA 2Z2LA 4QQBA 4ZVPB 2DNYA 1T9TA 2HKEA 3VQTA 2R7XA 2LA6A 3D67A 4ANEA 4XIUA 1YWXA 1GMWA 1I94J 2KVQE 2E1MC 4TQRA 2F5GA 4PABA 2WVBA 2OPRA 3BGUA 4ZLNA 1VQ4S 2BJ3A 2DISA 4QOTA 2I2YA 4C11A 5F9LA 1RU1A 3FC9A 4WZQA 4AL6A 2B9WA 3ZTPA 3J7YU 1LWCA 5D4NA 4BC7A 1SVDA 3V6JA 2J9DE 2I38A 4RBVA 2R9LA 2YNFB 2C2DA 4NX9A 1HNZJ 1YK9A 2R4FA 5M2RA 4OHYA 1D8YA 2QLXA 4DX7A 4PUOB 1X0PA 4OYWA 5HAOA 2FTRA 3NGTA 5K14B 1U1KA 4IRDA 1NK8A 4QWCA 3Q83A 1RBLA 2CWXA 4ZJLA 3GSDA 4Q2LA 1RT1B 1RSCA 3W64A 4IO9Q 1RISA 4WFBQ 4PG4A 4M5DA 5CD4H 1VQ8S 3W1YC 1CJUA 2LXIA 1EAYC 3P96A 3HJVA 2LLZA 3I55S 2DRBA 4FNIA 1AYEA 4ZCMA 4P2MA 4OI1A 2JFDA 3AOCA 3LALA 2MKKA 4WZMA 3PNIA 3GMGA 4J5OA 4WYLA 5E5NA 3FMWA 1SL1A 3THTA 1CS4B 2XEXA 1WJ9A 3RAMA 2V8HA 2E66A 1L3TA 4Q45A 3CIMA 4C97A 5B7WA 1NK0A 3A12A 1RE1B 3AXKA 5LM7E 1L3SA 3HMJG 2UXBJ 4WE1A 2JFKA 3D4JA 1X7VA 4LF6F 3OXGA 4YB7A 2QX0A 4X4SA 4MMOA 4ALZA 3K17A 2XY7A 1SJ3P 1NH7A 3DLGA 5ETSA 1KQFB 2BX6A 4O23A 5GAHU 2KYZA 1R7IA 1C1CA 3L9ZA 3VF0B 3H4DA 3AQOA 3F73A 3NG8A 5FDLA 1GMWD 2NYIA 4NLWA 5T14A 1NNDA 1FDDA 3AJDA 3UCZP 4OZ5A 4QIFA 1IBMJ 1IR0A 1NK7A 1KHVA 4EU0A 3DI6A 1SV5A 4NLYA 4ILRA 4F2SA 2KO1A 3CTRA 3K2YA 4V19X 2UXDF 4CYUB 1WF0A 3AT1B 5J2MB 1CQMA 1HQUB 1SQGA 4PYDA 1XBWA 3NS7B 4ES2A 5E3RA 3IA0A 3RRKA 3W9HA 4D3HA 1Q7LB 3HX9A 2XTJP 5MAOA 2GC8A 4UQTA 3TX0A 2VZ9A 1S97A 1Y9OA 2YWKA 1SJ1A 3NLCA 3WBZA 3Q0AA 1XMQF 1S4FA 2DNNA 3DRXA 3RBEA 3LWLA 3D66A 3L7UA 4RW8B 1B64A 4JI3J 1U0HB 1WHWA 3T1YF 4YFUA 4FVCA 1Y4ZB 1TUVA 1LQ9A 5F3ZA 3AOBA 3R5BA 1I5OB 1X4CA 2HHVA 1QAIA 4USVA 4ZCLA 4QWBA 2DGVA 4AQYJ 3DM2B 2EW9A 1LEOA 4C8MA 3I31A 3M8WA 1FKPA 2VONA 1P1TA 1TU0B 3D1OA 1S6PB 5L1JA 2IDEA 1CBKA 2IPOB 4LIWA 1EHWA 4KQZA 2B6AB 4R5PB 5JUMA 2HYIB 5IWAF 4NCGB 3M8ZA 1FXRA 3G2XA 4FXDA 3WZ0A 2GQCA 4ELUA 3BKFA 3KK3A 1T3OA 4I7FB 1CQNA 2V8DA 3TANA 4KKOA 1HNXJ 2WVDA 2V69A 1ACMB 3CJ0A 3C6TB 2RS2A 2MDAA 2IVFB 1RWXB 2HNYA 1AXQA 3FVYA 2B9EA 4ELVA 2IRUA 5HQLA 2B5JA 4OJGA 1VQLS 5DGAA 5HLFB 2VG6B 4HHUA 3KLVA 1NK9A 4EO8A 1KRPA 2CPIA 2DHXA 2WW4A 3OD2A 2OGUA 2W9BA 4B9SA 1FWPA 2OTLS 4J9LA 2FVSA 5HP1B 1T02A 5FJ4A 4N47A 2Y1JA 3CO0P 3QLHA 4N41A 4DL2A 3TZYA 3TQEA 4UOHA 5MLCV 3PFEA 2XMVA 2XYPB 2ZE2A 3K5NA 1F9EB 3M9MB 4YY3J 2QMWA 1OPIA 4L3KA 2VOOA 1S1VA 4OJHA 4BCAA 4ICLA 1AUSL 2ZHBA 2KYXA 4ZIVA 3RW7A 4FYVB 4X62F 4U9RA 1YBUA 2DH9A 2HBZB 1B0TA 1T95A 1RI7A 1U1NA 2HHSA 1FNMA 5LSOA 5ETLA 2HZVA 3KK1B 2F40A 5CHCB 3JSMA 2L9NA 2C28A 1DARA 2GMHA 4RWWA 1JNRB 4TU8A 3OTOJ 2R8HA 2MKIA 5K8MA 3UDLA 4ZLJA 2GQQA 2FVPA 3I5AA 4IQMA 1S0MA 1OPZA 3S7RA 3FBFA 1F6TA 3N5BA 4FYXB 4UF4A 4UY8T 2WK4A 2BVZA 5BXIA 3VAHA 3PRBA 1HBNB 2XMMA 5L8RC 2AHOB 1GK8A 5G0RB 3TNVA 4U8VA 4DLGA 4F0MA 1LOUA 2JEFA 2I1RA 3CD7A 2BOPA 3VAIA 4RW7B 4KJIA 1Q5VA 1FE4A 4JUZA 1WKLA 2BYCA 3TZZA 4RNOA 1C4CA 4FS1A 2AZ1A 3HVTA 4G1IA 2DEJA 3F0NA 1ICEB 5K8OA 4UY85 4G6VB 2QJ3A 3TAMA 3OFEA 3SQGA 5HANA 3Q89A 3I4PA 2POKA 3DRRB 3S8SA 4O3OA 1UPPA 2R7UA 1U1RA 1HR0F 2YKOA 4RW6B 5KFTA 3IBFB 3SCKE 5KFYA 3D28A 1KS2A 4A8MP 2KL8A 4H4OB 3Q23A 4W90B 1MROA 2F1FA 1VLOA 2ADBA 2YKNB 5LMUJ 4DQSA 1WTBA 4GKJF 4EFAC 4OI0A 3OVSA 4LF5J 2WOMB 1VRQC 5IXUA 3PYGA 4RO0A 3G8TA 2VQEF 2OI2A 1WEXA 2OPSB 5HROA 1FTCA 1FRIA 2CVEA 4I6AA 4USWA 2IVYA 2KVIA 3QSIA 4U67Q 3R8YA 1C0UB 1RTZA 3W2WB 1WI6A 4HLBA 3I9V9 2KFNA 4Q43A 4G1QB 5GVQA 2HGNA 2W9AA 4M5NA 2DNZA 3OQ2A 2YY3A 5C42A 3F44A 4CLWA 4DFJA 2XBPA 4DR4F 3IRXA 1MWZA 4AE5A 3OSPA 3L7OA 1IXKA 2WSFC 2F4VF 4Z2XA 1APSA 1S5ZA 3UE2A 3KJFB 3N6MA 3HP6A 2JC1A 4ZK7M 4DZDA 4Q7AA 4M94A 3UQSA 3NCRA 2CFXA 1UCNA 2EK6A 3FZ2A 4EYIB 3ZTSA 2F65A 4IO1A 4DR3J 4C0OC 3M1VB 3C46A 4K5SA 5CYQA 1WD6A 4NLTA 2YX1A 1B70B 3CUNA 3MTJA 3MAAB 5D0RA 1I1GA 4O44B 4OMFG 5IT9U 3A3OB 3SMZA 2XMWA 2HFVA 4QPXA 3G4SS 2VG5A 1AA1B 4I2PA 2M3DA 4WYWA 1YJRA 2ZBIA 1RWPB 1FX4A 1W25A 1V6HA 1S49A 2DXFA 3CJRA 4DU7A 5A2QY 3V4MA 4OHXA 2EFPA 1U1OA 4H4KC 3JB9k 4TU7A 1U48A 2LDIA 3CCTA 2DCUB 5LSLA 4JI0F 3H42A 3EXYA 3RBDA 4DV3J 1JLAA 2QLJB 3QFWA 4DQRA 1VFJA 2JDJA 2VFRA 1KWMA 4Q44A 5EWEA 2YNFA 3BBCA 3UFCX 4CP5A 4CNZA 4LFBF 1QE1A 4OX6A 3DYAA 3VZIA 2NUUG 1NM2A 5CZXA 1N0UA 2BRLA 4A8FA 3FRZA 2JLEA 1GMVA 2HRUA 3Q22A 3VGSA 4ZLPA 3DLEB 3IWLA 4ZITA 1U1QA 3MOZA 1RHMB 1RYRA 1HI1A 4Q5VA 2DCLA 2HS0A 3GYGA 1RT2B 2XY5A 1WUUA 1GTHA 5FIIA 1S4EA 2I8EA 4X84A 3OLBA 2FQQB 2F3JA 2ZH4A 2B8PA 3DN9A 4E8UA 3H4BA 2V8GA 3D7SB 4LBIA 2GVZB 5KFGA 2J6SA 1CS4A 2DH7A 3G8SA 1V3ZA 2PA3A 2VQFF 3MUTP 2QGFB 4WFNQ 4DPYA 2W1BA 2ZH6A 3RTVA 5J2QB 1RLCL 1B4SA 1WC6A 3NGRA 3EPGA 4CH1A 5K8PA 2W2QP 2V63A 1RCOB 1FVSA 1RWUA 3NAHA 4KH0B 4KHRA 1NSQA 4ZIWA 3G6XA 1G3OA 5DO2A 1JXEA 2E7VA 4DU8A 4WFAQ 2QL5B 2M8HA 3FSXA 5AXLA 2NYHA 2QEXS 2R8IA 4U6PA 3VGVA 2FVQA 4PPDA 2XMTA 2BEFA 1VBZA 4ZVFA 2IM1A 3EVOA 1UZHA 1VQSA 2LEBA 5D4OA 3H0PA 1VRTB 4M5GA 3EZUA 2MKJA 1KOOA 3FMBA 2EEYA 5F0UA 3A4TA 1KFDA 3C6UB 1FDAA 2PEBA 2HURA 3QIPB 4B9VA 1VJQA 6FDRA 2P9CA 4ED2A 2HFNA 1NZAA 3RJMB 5CCLA 1HNWF 1M5KC 3BS9A 4ANDA 2N7CA 4IR9A 4CYUA 2ZZTA 2DVIA 5KFFA 5J2MA 3QBCA 1HQUA 4CTAB 3GQCA 2Y8YA 3IWNC 1FKAF 4QW8A 4LF6J 4HH0A 4L73A 3CULA 2DJWA 1D09B 4AFFA 3PKMA 4P71A 2ACMA 2XGPA 4CH7A 2DY9A 2HRYA 4DXLA 4X66F 2KM8C 4F04B 1YVFA 3R7SB 1DTTB 3HULA 3HVAA 4OZ2A 2EBGA 5FD1A 2YNGB 2AW0A 2GJIA 3QIDA 4CNYA 5KFSA 5KFHA 1U2RA 4U7UD 1JLFB 2Y1IA 4FP9A 4F3MA 2BKNA 1RU2A 4J91A 5J1EB 3PEHA 1MMLA 4LVOP 1S6UA 3PYDA 3TVKA 3R2CJ 3NWRA 4CT9A 4OX9F 3MR5A 1H98A 3CJKB 1RYSA 3DM2A 4AXIA 5LMNF 1R3NA 1LNQA 2E7XA 1S6PA 4MKVA 2UXDJ 3M2UB 3QSYB 4UT4A 1KLMB 4R5PA 4URGA 3W3SA 4NCGA 4F0KA 2KJWA 1X4FA 1Q8BA 2FGOA 2Z57B 2QA4S 2UUAF 4DSKA 2ALZA 1IN0A 1D9AA 1HBOB 3VAKA 2ROPA 3C6TA 1YBAA 3DLKB 2DEIA 2WW8A 3EJMA 1XMQJ 4J9MA 3KLEB 2AJ1A 1PYSB 4Y28C 1JJHA 3T1YJ 2MYFA 4ER8A 4FBUA 1Q1KA 1S1WB 2J0QD 4I2QB 5HLFA 2VG6A 2D9OA 4USMA 2HQ3A 1WOOA 2DNRA 1XQIA 3BF4A 4TLQA 3S01A 2UUWA 3OHBA 2KT3A 4W92B 4USKA 1TQLA 2ZM6J 5HP1A 2DH8A 3A8IA 4PG7A 1WWHA 4DR7F 2K1RA 3KUGA 2CQ0A 4PAAA 1BQNB 4OJ3A 2FGCA 3IWXA 2FYXA 4WU2A 2XYHB 4B3OA 2ZWPA 1IKYB 1HNIB 5IWAJ 1ZBTA 2KG1A 2N82B 1OWXA 1BXNA 3I5BA 1RT3B 2RKIB 1SPBP 1WTFA 2CAJA 2W2NP 1U6BA 2ATLA 2AP6A 2P9EA 4KV8B 2HWIA 3CCES 3SFUA 1O5JA 4QYRA 2OIHA 4EZ9A 3HFZB 2FHKA 4NLRA 1PJ6A 1WG1A 1VIXA 1ZETA 4UTGA 4IDKB 3KK1A 2HQCA 4O0NA 4ANCA 3Q8UA 2HVDA 2EKNA 1Q82T 3Q86A 1VCTA 2BE7D 4WKRA 5GADI 4LSNB 4USJC 4DQPA 1RTIB 2B51A 3MTKA 4AL5A 4KBIA 4HH1A 4NASA 1PC4A 3DXBA 5AXKA 4ZVRB 2R8GA 3JYTB 2ERRA 2HVEA 3ULHA 1G1XA 2R3VA 2E5GA 1HBNA 2ASLA 5G0RA 1Z2LA 1B7FA 3OJUA 1VQNS 1F0XA 4N77A 2R7TA 5D4LA 2HRTA 3W8GA 4RW7A 4S0MA 1EP4A 1FD2A 5D8HB 3KFWX 4JYAF 3TVYA 3OFHA 4JP8A 1EETB 1U49A 1S1XB 2EKYA 2UVUA 2CQIA 4X62J 4K50A 2H4WB 2PGCA 2W4DA 5B0BA 4RLEA 1UEVA 1NDPA 4IOBA 2LEPA 4DV5F 2ZH1A 3VQSA 2KT5A 1IKXB 1HNVB 4MKAA 1UFLA 2PE8A 1L3KA 4OX7A 4RW6A 4DL5A 4M5IA 3IP0A 3KKFA 1RT6B 1AB8A 1S7HA 3LW5C 4H4OA 1J2VA 1AROP 1NDLA 1CJTB 5HQ8A 2JHEA 2YKNA 1H2UX 2YNHB 5EWGA 5CA5A 2C3MA 4G3IA 2MQ8A 2LQ9A 1FHTA 2WOMA 3DCAA 1HD0A 1EX8A 4K59A 4PWWA 2OPSA 2U1AA 3ZZUA 2HG4A 1C0UA 3W2WA 1R6YA 4LQ9A 4NXNF 3GJSB 2CRLA 3G6YA 4G1QA 1JQGA 1A0OB 3H7HB 3I0RB 1ZAVA 3M6VA 2VDHA 2E44A 4ZKAA 1HR0J 2XQCA 1IKVB 4IR1A 1XIQA 4LF9F 1HW9A 1SQFA 2CPHA 1KKHA 2ZKUA 2NS1B 4XTTA 4X4RA 3OR1A 1TMJA 2XWYA 1VK8A 3ITHB 3F56A 2YWEA 4YDDB 2OD4A 4GKJJ 2J7UA 2QYGA 4C4WA 2DNKA 2IJFA 5F8GA 2J76E 1V9OA 2HZAA 5KFAA 2PFDA 2FC9A 3M1VA 3I6PA 4B3SF 2VQEJ 3T1HF 4PQUB 3HD1A 4ZVOB 5HK4A 3LWMA 4IH5A 3MAAA 1Y5LB 4KGXB 4O44A 1SL0A 4WK1A 2RRNA 1W26A 4OQJA 4E0DA 2CPFA 4O4GB 1TUWA 4LSLB 1NSAA 4K4VA 2AJFE 3PY8A 3GP9A 2Z8QA 3M2VB 4DR4J 3SSRA 4DFKA 2ABYA 4V19J 2MZQA 2F4VJ 2RT3A 4ED7A 3H40A 4CO3A 3RR8A 3F41A 1SJQA 1HWJA 4Y0FA 3SDEB 1JJCB 5BYRA 2JEIA 1FT8A 3KMQA 2CPDA 5HJYA 2KZZA 2WB4A 5CCMA 2XM3A 4IOAQ 5F8LA 2C2KB 5ETTA 4OLPA 1RWNB 1DAXA 2NUHA 4FXWA 1QVFR 2XLJA 4Q8FA 2YX4A 1KSPA 5IOLA 4A4JA 1RB0A 1J5OB 2DRAA 3BREA 1BLUA 2FJBB 5JVHQ 3MMCB 3HT3A 5KOXA 3T5JA 1LXJA 4FF2A 2A2CA 3R1LA 1EQ0A 1X4BA 5EUHA 1WI8A 3B4MA 1SI9A 4YDXA 3DLEA 1BC6A 4LT6A 1SBRA 3X1LB 1JK9B 1FRJA 2QO3A 2UXCF 1RT2A 5L1IA 1R6VA 4I56A 2V68A 1T0TV 2QZ8A 4EMDA 1Q81T 2ATCB 3H2LA 5KG5A 1H74A 2UV8A 3I9ZA 3GIMA 1DQAA 5LOQA 2GVZA 4FPRA 4JI0J 1ROFA 1JJ2R 1G2EA 4A8XA 3MAQA 1U0SA 1K0TA 1R0AB 1EKRA 3FNNA 4P73A 2BM0A 5DG7A 3CJ2A 4DV1F 5J2QA 3FSIA 1XJWB 3D3CJ 3DKDA 3M30B 2R2TA 4OI4A 4LFBJ 1ZTTA 4ECXA 3DU5A 4JV5F 4WTOB 2IM0A 3SQOP 3HDSA 2ZH3A 2QMUB 4ILLA 3QFHA 3OR2B 4BWJA 1EKSA 4I6WA 4PR6A 3M05A 3GILA 5A8KA 1VYAA 2PC6A 4HI2A 3ILIA 3M6UA 2KHDA 5D78A 3TARA 1KN6A 1K1SA 3QNWB 9RUBA 4ZJQA 2EFGA 2RF2B 1VRTA 2YTCA 2DNLA 2P9GA 4IH6A 4OJ1A 1VBYA 1QUPA 3RG6A 5DQGA 3C6UA 2BE9B 2CQ1A 3QIPA 3ONQA 2VQFJ 4YR3A 4P7VA 5EN1A 4DBQA 3WIUA 3QO9B 3CDUA 4OL8A 5C2GA 1ZAXA 4MT1A 3GJTB 4DL3A 2HVZA 3CVKA 4CTAA 2YNIB 4YHHF 2K06A 4MJKA 5EX0A 5AXMA 3J81Y 2C2EA 1NJZA 1YSJA 4I1TA 3CMQA 5DQIA 4ZN3A 1H73A 2I9SA 1UA1A 1ITPA 2OEMA 2KN4A 3U02A 4F67A 5F41A 1WEZA 2XHCA 1R89A 1S48A 3BSOA 3UVJB 2X1BA 2AZ3A 2IYGA 1YJ9S 2E29A 5J1EA 2LU2A 3PJXA 3UDCA 3HHKA 3DMJB 3E01B 2PO4A 3CJKA 3LP1B 3U1MA 3C14B 3D0IE 3C16B 3W61A 1HNWJ 7AT1B 2DGUA 2MEWA 5GMKa 3M2UA 3T9NA 1RAOA 3O3LA 3O6QA 2JRSA 4DN0A 1NMEB 4FF4A 1LW2B 4KE5A 1WOPA 1KQSR 4OI6A 4HTJA 4GO7X 5ETNA 2HPUA 3MAHA 3QGPA 3FDSA 3BGLA 1HBOA 4X66J 4IRCA 2IY5B 4CQ1A 5ETOA 1ZH5A 3BPDA 4KT0C 4QU7A 4C8YA 4K2XA 4DZ6A 3KLEA 1FI4A 2FUG9 2CQ3A 4OZ1A 2HQIA 2WBRA 1S72S 2FJDB 3ENAA 2YKMB 1S1WA 2AT1B 5HSPA 1DURA 2LQ8A 8AT1B 2MZJA 5BR8F 4OX9J 3PX4A 2COLA 3J7YI 3NS6A 5SUHA 2KXFA 5LMNJ 1BQNA 2JX2A 3NBPB 3RW6A 2E1RA 3CNQP 1FJCA 2MGZB 2ZOMA 1TZ0A 3TUZC 4RL1A 3JS9A 1IKYA 1UJ6A 1HNIA 3IRWP 2BW2A 2ZDPA 3E8OA 3PW5A 4URSA 3I4HX 1RAHB 1WC3A 1I3OB 1JXVA 1RT3A 2RKIA 5LXYA 1AFIA 3D6MB 3D6TB 2UUAJ 2P6TA 4USUA 3SI8A 2HHUA 4CWBA 1SC4B 3TR5A 2NSBA 4OFZA 1TMMA 3UWTA 1M5OC 3IC1A 3PW4A 5I3UB 3BDEA 1VS3A 3W9JA 2ZH8A 4LFAF 2C2MB 5GAGU 2Z2ZA 4ZVTB 2R42A 2MQPA 2G13A 1G7CB 4ITSA 2K8GA 3U1NA 1ZTWA 1RAJA 3W2VB 4LSNA 4DV6F 1RTIA 1YX2A 3K57A 2NXUA 2W4CA 3OJSA 3PIPQ 4ERDA 2RDJA 2ZKTA 4PG6A 2G0IA 3JYTA 4DR7J 2V94A 3GIJA 4KHPF 3N9UC 4J37A 4X4TA 2U2FA 1RTHA 3VCDA 4R25A 2DIVA 4X4UA 3CO9A 1EETA 2ZHAA 1VOMA 2ZC4A 1U1PA 5GAHI 1GT8A 2IJNA 3L3CA 3GV8B 3P8BB 1PG5B 2EPIA 3BM7A 2ZWOA 2A0FB 1WDTA 5DZ6A 3KWMA 3JXOA 3HSDA 2F8EX 1HNVA 1VK3A 1SH3A 3MMBB 2AKWB 2IRYA 3WDOA 1RTJB 1U6ZA 1XR5A 4DS5A 1Q7YT 2DB1A 1RT6A 1Y5IB 3MM9B 4DS4A 3U27A 2DNQA 1PBAA 5C24A 3G71S 2QMXA 1F2GA 1CJTA 4UOFA 2YNHA 5K8NA 5DM6Q 1NPRA 2AYBA 3HHEA 2CQDA 4QIWD 2E5HA 3EGWB 1RGVA 3W62A 1XNRJ 1S59A 1QSSA 3NKYA 4BBYA 2HBRB 3R7BB 4JYAJ 4USIA 4PQAA 3OXLA 2XS2A 4HYKA 3MEKA 3MEDA 3HJFA 4DEZA 1XK8A 3M8SA 2HAIA 1Q8LA 5LL6d 3GFYA 4CLZA 2VKZG 4KPYA 4DV5J 1WSRA 3QPIA 1GNKA 3GPAA 1NSPA 1IKVA 1I6JA 3QWUA 2DNHA 1E6YA 2DHSA 2GHPA 4OYXA 1C1BA 1NK5A 1BWEA 3GIRA 4M5LA 3KG0A 2LQ5A 3ITHA 3BKUA 3CJ4A 1OJ4A 2DNMA 4O3RA 5B09A 3HK2A 2G1HA 4P75A 4FBTA 3H2UB 2N3OA 3W63A 1GX6A 1ZZNA 3TRGA 1FWLA 5KFOA 3QRQA 4ECYA 3BJYA 2R8JA 4OYOA 1RACB 5IC4B 1UETA 4ZN1A 2WONA 5H9EK 4NXNJ 1PKUA 4OX8A 4NZ0A 5C25A 1U1MA 2CPYA 1YHQS 3TEGA 4LSLA 4PEOA 3CC4S 4QPTA 1H72C 3M2VA 1PBUA 5KG0A 5HJXA 3PEJA 4DR2F 3M7VA 4ED5A 4X4NA 3RRGA 4LF9J 3RU0A 1T9YA 1YZ6A 2KT2A 1VC6A 4I69A 1JWWA 1FJGF 2CYYA 2V2QA 3G96A 3T6JA 4BHQA 4DCOB 2BE2A 3AB4B 4PRFA 3KLGB 4B3SJ 2KHCA 2NXCA 1H38A 4TKTA 3T1HJ 4JBCA 5E2QA 3MWBA 1KHWA 2VOPA 2YXLA 1KDNA 4DPOA 4IG0B 2RQMA 4QYZK 3NNCA 4FZVA 1P1LA 3TW0A 1FA0A 4BDPA 5IQ6A 1C0TB 2D3ZA 2ROEA 2ACYA 1X4AA 2E9TA 2C2ZB 5ETMA 1QUVA 2RHQB 2L3MA 2MQLA 4DPXA 1U7LA 5KG7A 1UWBA 3DNCA 1N48A 2DHGA 4ED0A 1JLBA 1Y00A 5IFMA 1W2BR 3HI9A 4QZVB 3OUYA 5RUBA 1RAEB 1JKHA 2VIHA 1PILA 1FRMA 2J6UA 5AXNA 2VODA 1KTQA 2HIYA 1OSDA 6FD1A 3QZ8A 3RUBL 1WNEA 4W98A 1WDDA 2ZH5A 1M5HA 1UL3A 3DFEA 3KMSA 2L41A 1Y0HA 1TL5A 3TJAA 3LQVA 4A47A 2HMIB 4ZVEA 3V6HA 1SCJB 1TP7A 1HD1A 1RWOB 2CJBA 4OZ3A 1S9EA 5AE1A 1HLWA 3I96A 4EI2A 2UVWA 3M30A 2A3JA 4OYZA 5ETRA 1H3DA 4DOZA 1CSJA 4KB7A 1K8AT 3MR7A 2ZD1B 2HHXA 2E1AA 3GIKA 5AJ3F 3BPSP 4JI4F 2CQCA 4C7QA 5B0EA 4M5KA 3CD6S 2ZBPA 4FYWB 3MFIA 1VQKS 3QRRA 2Y8WA 2OTJS 4ENOA 4NOHA 3CDEA 2UXCJ 2MQOA 2GMJA 4L74A 4CO4A 4DF4A 4RNNA 4ZA1A 1NKBA 3IN5A 1BD6A 2RF2A 2OMLA 4EUVA 2EFOA 4LRDA 3DRSB 1RT5B 1SJ4P 1WC0A 2VBWA 3GLJA 3NWGA 3UI3A 4Q8EA 3D1QA 2XCAA 3QO9A 1BWVA 1P6TA 2H54B 1TL1A 1LFPA 3PCOB 4CM0A 4DV1J 2YNIA 1TV6B 3MEEB 1FRXA 2IRXA 3DGPA 3KUEA 4X64F 1NAQA 5HMYA 3EYZA 4JV5J 3HVRA 2VPWB 2D7SA 3KG1A 1D9DA 1HMVB 2QE5A 4TVAB 4JI2F 3NCQA 1WC5A 4EWTA 3VAMA 3IXQA 3ZNUA 2C3OA 5HO4A 3MM8B 2QIFA 1RKIA 3MCNA 4WU3A 4F2RA 1RA6A 1F5BA 1S1TB 3UVJA 2ILZA 1FD8A 1RT4B 4NLXA 3NOCA 4CLKA 3DU6A 3N28A 2YWWA 3DMJA 4P2XA 3E01A 3MMAB 3LP1A 2M9KA 5D6GA 3MI7X 4P7TA 4PCQA 1UJ4A 3C16A 5KFCA 1VMBA 1FX2A 4QCLA 1M90T 3R5CA 4YHHJ 2KRRA 1LW2A 1MLAA 3ISND 1SC6A 4X4QA 8ATCB 1O0PA 3CCZA 1NJWA 4MIAA 4OI3A 1BQXA 3DOMB 2CZVC 3TA0A 3ZZPA 3POTB 1M5SA 2JNJA 3K5OA 2VFUA 2F9JA 2WVFA 1TKZB 3O1LA 5C5JA 1DY3A 5F0WA 2UU9F 3CCVS 2YKMA 1HIYA 2CNOB 1X4EA 2DITA 3DGVA 4MYUA 1IUJA 5BYSA 1GXLA 4DR5F 2X1GA 3CCJS 5IV4A 1ZM9A 3RB3A 2M0GB 2AX0A 1L3VA 1HHQA 1HWIA 3LO3A 5A0YB 5IZHA 4NA3A 3NBPA 2MGZA 4X4OA 1SJRA 5G4DA 4YUDA 2RAQA 2YBVA 2OAUA 5A2QU 2GCFA 2RD5C 2OMOA 3KUHA 1YJWS 3M8QB 2XC9A 3QYYA 3TA1A 3SV4A 2IC3B 3LGMA 2C22A 2YQ3A 3PJWA 3CIZA 4NLOA 3ETMA 4CM2A 5DS7A 1HHTP 1IJFB 4YN3B 3JSRA 1RBAA 3DLBA 1LWFB 2CG8A 2MY7A 3G6VA 2BOAA 4B9LA 1LK7A 1CEZA 3W2VA 3R3TA 5BR8J 1OQ6A 2UVRA 2XLKA 2GJFA 1K47A 2VA2A 1Y11A 2UUBF 2FZKB 4PG5A 2CWKA 1HWLA 1H7WA 2DR8A 5E3PA 4JOUA 3MR3A 3PW7A 4O3SA 1URRA 4ED1A 1CPZA 3G82B 2XHWA 4NPOA 5LJ5Y 4DLEA 1V3RA 3US5A 4L72B 4HTIA 1SIZA 1C2PA 1IWGA 5B0GA 3T5LA 1UKUA 3UD5A 3HZEA 3J80U 4MH8A 2D1CA 2EVZA 2ZEJA 4IFVB 1RHQB 1MSWD 4LFAJ 4C3LA 2P2CB 4WK3A 1MG7A 2UP1A 2OKQA 3CW2C 1FTRA 4O4RA 3MMBA 4IFYB 4O3NA 3KDNA 1N36F 4FF3A 1RTJA 2MKHA 4DV6J 2AYMA 3ZTRA 4F3OA 1NPPA 3MM9A 3GCWP 3MEGB 1X31C 2DNGA 1Q5YA 3BEGB 3PW0A 4CO0A 2ZNYA 4NXMF 1KC8T 2UZAA 2YVSA 5CH7B 3UN5A 3EX7B 4P72A 4KHPJ 3OPKA 1MN9A 5JXSA 1TL3B 3EUNA 1T9XA 5DDQC 1QAJA 5D3GA 2DT9A 4RBUA 2QL9B 2IMWP 4J9KA 1LWEB 2APOA 3CB4A 4TY8B 2W4PA 3AXMA 1KQGB 3FFIB 4LR9A 3KHLA 3FQKA 2QT7A 5T7LA 1K44A 4DCPB 4DV7F 2O5DA 4QR2A 2Z2YB 3UR3C 4ZHRB 1YITS 4NYZA 2D74B 1FRHA 3CGIA 4X4VA 4CLFA 1PAUB 1S57A 4C6AA 2HW3A 3BBFA 3FK4A 4WFZA 2ZBCA 2GS8A 2SXLA 3CMES 1ZM4A 4I64A 2L48A 3BO2A 4ED3A 4EGLA 1L5UA 3QJLA 2B56A 3MUMP 2X3GA 3U1LA 1YDLA 1HHSA 3TX8A 2WSEC 4K4XA 2PI4A 2DR9A 2HVIA 2HNDB 1AZSB 5D0EA 1SUQB 4ZVGA 5KFIA 1P8GA 5D15A 2AEFA 3GG0A 5CZVA 1HNZF 4P2SA 2RNEA 4CO1A 4XAKA 1YI2S 4H54A 2DO4A 3EVWA 2IBKA 3KJNB 3H5SA 2F8MA 5IT4A 3BV8A 4ECSA 4XDCA 2AD9A 4WF9Q 2G0CA 2DBBA 2W7PA 1S7IA 5KFBA 1WEYA 3M32A 2VFSA 1MWQA 2ZOFA 2R7SA 4RKUC 1NBEB 2VPZB 1KOHA 1Q79A 2OELA 1NK4A 4DR6F 4OZLA 1FO1A 2R7RA 5KFRA 5F8HA 1WKKA 4MAKA 3CCRS 3KLGA 3ENWA 4GKKF 1GX5A 2PN6A 1T9VA 2CJKA 1LWCB 2H48B 2RE1A 3HHLB 2X1AA 1XR7A 2CDRB 4IG0A 4DF8A 3BB5A 1C0TA 2Z4PA 3OHAA 4C8LA 1TUGB 1G6BA 3EZOA 2V0NA 4RW4A 2OLWA 2PT0A 4XPEA 3Q8YA 2MZRA 2NREA 3N6NA 5F9NA 5HBMA 4OZJA 4DR2J 1ZOTA 2BJ7A 3HSJA 1RBOB 1SC3B 4NLSA 4C48A 5KFVA 1FJGJ 2V2ZA 1H2TZ 4C9DA 2IA6A 1X4HA 5DG9A 3CPWR 2RRAA 3EXCX 2HMIA 1M1GA 3MDFA 1TL7B 2JOQA 3UPFA 4P52A 4FKXA 2DGWA 5D0HA 1UA0A 3C3LA 1YLXA 3HKZD 1JLQA 3CJTA 4LRCA 4LSZB 3KYLA 1NXIA 2D9PA 2ZD1A 2B7CB 2LKZA 2CZ9A 3DDKA 3KHGA 1NB7A 2YKQA 3BO3A 1RA7A 1HKAA 4Z37A 2GV1A 1YRXA 3EDQB 4MIWA 2BQUA 2CPXA 2LEAA 3CCLS 5KG1A 4U95A 3DRSA 4WBFA 1JLCB 2QA2A 4J9RA 1VQPS 4I6YA 4QIEA 1TVRB 4Y2MA 2BJ1A 3T19A 3RAXA 3T3FA 3T5HA 1OY9A 5J2PA 2BUNA 2Z0GA 3Q8RB 2CQ4A 1SKWA 2CADA 4JI5F 2MZTA 3K89A 1OYDA 3MEEA 1B99A 2VV5A 4DG1B 3V4IB 5E7OB 1SC1B 3K5LA 4OHZA 1REVB 1UVIA 4EK2A 5T41A 4OI2A 2NXNA 3PYEA 5AJ3J 2JLFA 1NO8A 4JI4J 1HMVA 1S1UA 4YMEA 5L9XA 5CAAA 1RAGB 3MM8A 4PKDB 4C2MA 4F4KA 3K8VA 3MCOA 3KXDA 4ETZA 5JVGQ 3RBXA 2IMOA 2NR0A 1S1TA 2JZ5A 5C7PA 3MGJA 2QC3A 2FLOA 1RT4A 3G9CA 1J27A 2JEGA 2J8AA 4I68A 1RAIB 4CLUA 4DDFA 3FSYA 1GXTA 2X7IA 1X9MA 2XY6A 2ASYA 5BYQA 3CF5Q 2HFZA 3R2DJ 3FEXB 3QZ7A 1F1BB 3NGUA 3NNAA 4ZJOA 2O67A 4X2BA 4IKAA 2CPZA 1ZM2A 2AJ2A 1OY6A 4OYIA 4DI6A 4KKOB 3KLFB 2QLWA 4F4WA 4JI2J 4NRTA 5D77A 4ECUA 2XZWA 4J90A 3DOMA 1LWXA 4Y2CA 5CD4A 3KK2B 2CIMA 2HNYB 3POTA 3NNHA 2J9CA 5HATA 1PSDA 1TKZA 2ZJQQ 1S9GA 1UTAA 1MN7A 1K9MT 4UOGA 1TKXA 2GIRA 4URQU 4HT5A 4Y2IA 3H59A 2FB0A 4Q2MA 5ETPA 4ZP8A 3WIVA 2KTQA 2HNZB 2EK1A 3PRDA 1X8DA 1R0CB 2VA3A 1A6LA 4KGKA 4RU2A 5A0YA 1NHVA 3QT6A 4Y6IA 3L95X 2FIUA 3BN7A 4FYDA 4M5HA 1QLNA 5KT2A 3UR0A 1WG4A 2A18A 2D69A 2CNNB 1WF1A 1NHUA 3UCUP 1QSLA 2QLFB 2HQDA 2PI5A 1P27B 4ZPDA 1UW4A 2W2OP 4QJVA 2YKPA 1YZ7A 5KT6A 1S10A 3UO0A 3OL8A 4FDFA 3LA0A 2FJXA 2IC3A 1WELA 1FFWB 3DOKB 2JLGA 2IAJB 2B3TB 3PHTA 2XMAA 3AY0A 2HFUA 1JIHA 1JLEB 1NSKL 1NUEA 2ZH2A 2EG2A 4MK7A 4DMZA 1LWFA 1XR6A 2UU9J 3DHWC 3BSAA 1X60A 4DV0F 2WZ1A 3AJ1A 2W8KA 4OHWA 4DR5J 1R8AA 3FUYA 3IR6B 4R0JA 1DFDA 3FBBA 4EBDA 3IM9A 2G1DA 3R1HA 4ED6A 2JH3A 2E5JA 1HA1A 2RJZA 3LH2S 3NEKA 3JAMU 1U26A 4LUBA 4U7UK 3BO4A 2FJEB 5U47A 4PUOA 3MD1A 3TA2A 3MM7B 3NGKA 5LJ3Y 1TL4A 5K14A 4ZPVR 3G82A 3QT8A 1RT1A 4B02A 1XN9A 1WACA 3I0SB 3GCXP 4IFVA 4JI6F 1FF2A 4EZ6A 2WRMA 3J80Y 4CLYA 4M8LA 3JSYA 4RUBA 3N79A 4RNHA 5FLXY 3MCMA 4IFYA 4O0IA 3HXMA 4BS2A 4NA1A 4OHVA 4J9OA 1RCXB 2GW8A 4LF1A 1A7GE 2VD3A 4WP9A 1B0VA 3OFFA 3MEGA 2PIIA 3G6ES 1VDHA 4U8YA 2VG7B 2CKWA 2UUBJ 3B82A 2V50A 2EWHA 1ZS6A 3SFGA 5J1PA 1VQ9S 1DLOB 4CO5A 3NXZA 1TL3A 2Q6BA 4B3RF 2FHOB 3AD8C 2GX8A 5EGYA 4WFYA 3SCLE 4J9QA 1H6KX 4LFCF 1LWEA 3M9OB 3PW2A 1RWKB 1S6QB 3H98A 2ZNZA 3HSZA 4TY8A 1UEUA 2P5VA 4J9NA 3FFIA 2LQJA 4DPWA 2E5LF 1X4GA 1U02A 1RK8A 3PVXA 1Q78A 1XTZA 3CJQA 5KTQA 2Q3PA 3BYRA 2V8VA 3BZQA 2BA9A 1S76D 5A76A 3NY0A 2XMUA 3R5AA 4J9UE 5C42B 2FJWA 1N36J 4NZ6A 4Y2KA 2QYCA 3IRXB 2DKOB 4JI7F 2HQGA 3OW2R 3JQMA 4GMKA 3OT9A 2FHMA 4JI1F 3J81U 1TFWA 1V3SA 4X4PA 4NXMJ 3MPDA 3LUYA 3O8WA 3OBIA 1FNXH 5B0FA 2W7OA 1EARA 3PXGa 3LP0B 2JEJA 2HNDA 1AZSA 4KRWA 1WOSA 2JL9A 2XB2D 1AW0A 1N5YB 2JSXA 3EZ5A 3HO1A 3PYFA 1AFJA 3GB0A 4AXJA 2MQMA 1PO6A 1T7PA 3AD9C 5E3AA 2GO9A 4B9TA 2HHQA 4JB8B 3THPA 3CXCR 1TELA 4CLSA 3RB6A 1PGZA 2VPYB 3MPVA 4RW8A 3CMAS 1U0HA 1DJ0A 4E98A 4DV7J 2ZFHA 2NXEA 1MWYA 4K0KF 1S99A 2VG5B 2FVRA 4I2PB 4TLRA 4ECTA 4JV2A 4HKQA 4KHMA 1PIEA 1KVIA 2V5HG 1UVKA 2EXUA 1B7YB 2OO4A 2B4VA 4P10A 1S0VA
chains in the Genus database with same CATH topology
3QPIA 2VBZA 1GNKA 3TAMA 3OFEA 3SQGA 4DV2F 2C3UA 1VQOS 1IKVA 2B6AA 3I4PA 1I6JA 2POKA 4D3GA 3DRRB 3MECA 3QWUA 2KU7A 4WKYA 2DNHA 1E6YA 1S9EB 3S8SA 2EFQA 2HHWA 2DHSA 4O3OA 2GHPA 3LAKA 4ZOSA 1C1BA 2R7UA 1NK5A 1U1RA 4DSIA 1BWEA 4N76A 2GGPB 3R5DA 1HR0F 2M4MA 3B4DA 3JTNA 3KG0A 1TR0A 2YKOA 1DQ8A 4I7FA 4RW6B 3QGGA 5KFTA 3A1YG 3SCKE 3KLHA 2LQ5A 5I3UA 3WX4A 2JWNA 5KFYA 1ZAWA 3ITHA 3CCUS 3D28A 1JLAB 2MJUA 3CJ4A 3IR5B 4DL7A 2DNMA 3GZ7A 1KS2A 4A8MP 4O3RA 3LOUA 1HPZA 2RILA 2PEHA 4H4OB 3Q23A 4JI8F 2OSQA 4W90B 5A8RB 5B09A 3HHLA 3HK2A 1MROA 2F9DA 3Q2SC 2F1FA 2R8KA 1XNQF 2BRKA 2ADBA 1M1KT 2YKNB 4NCAA 3LP2B 1QE1B 4DQSA 3HHNB 1WTBA 4FBTA 3DYAB 1HL6A 1X4DA 1QAXA 3H2UB 4ZP9A 4EFAC 2N3OA 4GKJF 4OI0A 1GX6A 5GAGI 2DO0A 5IM0B 1ZZNA 3TRGA 3OVSA 5KFOA 4ECYA 3BJYA 3OL9A 3GWCA 2WOMB 2BABA 2R8JA 5IXUA 2DIUA 1WHYA 3ZZZA 2N7YA 2LYVA 2CQ2A 4R8UA 1UETA 1C4AA 2LXFA 3G8TA 2ZZNA 1FVQA 2WONA 4OX8A 4NZ0A 5B0DA 5C25A 1U1MA 3VAGA 2VQEF 2CPYA 5IS2A 2NZ4A 1WEXA 5LSRA 1YHQS 3HPOA 4DWIA 2OPSB 2BJDA 5HROA 1FTCA 1FRIA 2CVEA 4I6AA 1OS5A 2IVYA 2KVIA 5EHHA 4U67Q 4LSLA 3MFHA 5K5MA 2GHVC 1C0UB 2XO7A 3CC4S 3W2WB 1YRUA 1WI6A 1FK9B 2BM1A 4QPTA 2Q43A 4HLBA 4DHVA 3I9V9 3H5XA 1QY7A 2KFNA 4Q43A 3M2VA 1RTDB 4G1QB 5KG0A 3KLIA 5GVQA 2VB6A 3MCSA 4OZNA 3PEJA 2HGNA 4DR2F 2FY1A 3NRBA 2J9EA 4ED5A 2RU9A 4X4NA 3M4XA 3RRGA 1IKWA 1T94A 3DC2A 4C0HA 2HS4A 5GAEU 2W9AA 5KFXA 2DNZA 3RU0A 4DL4A 2Q66A 2KT2A 3OQ2A 1VC6A 4Y34A 1MMDA 2YY3A 5C42A 4I69A 1TL1B 3F44A 1JWWA 4DFJA 1FJGF 2W8LA 1Z1ZA 5HI7A 2XBPA 3S1TA 3VAJA 4OV1A 4QBUA 2LCWA 2CYYA 4QWDA 1Y7PA 3IRXA 4DR4F 1MWZA 4AE5A 4DQIA 3OSPA 3L7OA 1IXKA 1U47A 3G96A 2WSFC 3T6JA 4BHQA 7FDRA 3MURP 2F4VF 4Z2XA 1APSA 3PO4A 1JLGB 3FCHA 3UE2A 2BE2A 3AB4B 3K8WA 4PRFA 4FS2A 3N6MA 2MHNA 4JV0A 3HP6A 2XNRA 2JC1A 4ES3A 3KLGB 4ZK7M 1AUDA 3D5MA 5CXTA 3P6YC 4Q7AA 3CCQS 1DTQA 2KHCA 4M94A 4J9SA 4IG3B 3UQSA 1H38A 3NCRA 2CFXA 4TKTA 1WHVA 2EK6A 3KJVB 3FZ2A 3TQ1A 4EYIB 1JXLA 4JBCA 1GXUA 5E2QA 3MWBA 1KHWA 4IO1A 1JX4A 2VOPA 2QSFA 4KO0B 3BGRB 1A9NB 1LW0B 4DN9A 4PXEA 5DM7Q 4L6V3 4DPOA 4C0OC 4JV1A 5ITHA 3M1VB 4IG0B 2RQMA 3NNCA 3K5MA 3C46A 2YX7A 4FZVA 4K5SA 5CYQA 1P1LA 1WD6A 3BQ0A 3TW0A 1FA0A 5DDRC 4BDPA 5IQ6A 1C0TB 2D3ZA 2ROEA 2ACYA 2J0SD 2RS8A 4NLTA 2YH1A 2OPQB 2RQKA 1X4AA 2E9TA 1CVJA 5E3CA 1QUVA 2YX1A 2R7WA 3NL0A 2L3MA 2MQLA 3D1HA 2ROGA 3CUNA 3MTJA 4EEYA 2KB2A 1U7LA 2V4JA 5KG7A 4HDGA 1I1GA 4O44B 4OMFG 4I67A 1UWBA 3DNCA 3K5PA 3MM5A 1N48A 3SMZA 1X5SA 2DHGA 4ED0A 2XMWA 2ZDOA 1JLBA 4QPXA 2XSFA 1Y00A 5IFMA 1W2BR 3HI9A 4ZMMA 1PC5A 3G4SS 4QZVB 1VRUB 2MHEA 2VG5A 1JLCA 4I2PA 2M3DA 3OUYA 4WYWA 1NKCA 1JKHA 1TKTA 1YJRA 2ZBIA 4B17A 4RNFA 2YWFA 1PILA 1FRMA 2J6UA 1TVRA 1VC5A 4H4MA 4BC9A 5AXNA 5KT7A 2VC1A 3RYLA 1UVJA 2MQQA 1W25A 5DQHA 2VODA 1KTQA 1V6HA 1S49A 1OSDA 6FD1A 3QZ8A 2ADCA 3HHLD 1WNEA 1QAYA 3KNGA 2ZH5A 1M5HA 5A2QY 3O5TB 3V4MA 4OHXA 1N0VC 1FKOA 1UL3A 3DFEA 3KMSA 2L41A 1Y0HA 5E0OA 3H20A 3H5YA 1TL5A 3B8HA 2EFPA 1U1OA 3LQVA 4A47A 2HMIB 4ZVEA 4DG1A 1Q16B 3V4IA 3DRRA 1QSYA 3V6HA 1NU4A 4H4KC 3JB9k 4K4SA 1TP7A 1HD1A 1NJYA 2CJBA 3MF5A 1S9EA 1REVA 2EI5A 3M6WA 3U7JA 3VR1A 5AE1A 1MW7A 4TU7A 1U48A 3MOJB 2L08A 2MY8A 2VH7A 3ZFVA 2LDIA 3CCTA 4KGMA 2DCUB 5LSLA 4JI0F 4B9NA 2AJ4A 3I96A 4MFBB 5KFQA 3EXYA 3M30A 2UVWA 3RBDA 2A3JA 1UFWA 1I94F 3HF5A 4M1KA 1JLAA 3OL6A 4MK8A 1H3DA 4DQRA 1VFJA 4DOZA 2JDJA 2VFRA 5I42A 1CSJA 4KB7A 4Q44A 1K8AT 3WC2A 2ASJA 2ZD1B 2HHXA 2HFOA 4A48A 1T05B 1SL2A 2E1AA 3GIKA 5AJ3F 4R0EA 5I3QA 1Y3KA 5EWEA 4JI4F 3DOLB 2CQCA 4C7QA 2YNFA 3VWSA 3IAM9 5B0EA 3UFCX 2OPPA 4CNZA 4LFBF 1LKZA 1QE1A 4OX6A 1FJ7A 3CD6S 3DYAA 3MFIA 3VZIA 2NUUG 1VQKS 1RT7A 3LPYA 5KFPA 1Q53A 1BQMB 3IS9B 1VQ7S 2HGLA 4TU9A 2DPJA 2OFGX 5CZXA 2OTJS 1HBMB 4CH0S 3C2PA 1N0UA 4NOHA 2XS5A 1URNA 2NQPA 2GQ2A 3CDEA 2BACA 2AGPA 2MQOA 2BRLA 2GMJA 3FRZA 4PXDA 4QW9A 4A8FA 3I87A 2GMLA 2JLEA 4CO4A 2FLLA 2HRUA 4DF4A 3D0GE 4WFXA 4RNNA 3Q22A 4ZA1A 1NKBA 1XMOF 4NLGA 4ZLPA 2QRRA 3IN5A 1BD6A 2RF2A 2OMLA 4EUVA 3DLEB 3C66A 3IWLA 1U1QA 3MOZA 2EFOA 3IG1B 3PR5B 3DRSB 1RT5B 2VUGA 2ZM6F 4RW9A 1SJ4P 4UQGA 2KZMA 2VBWA 1NJXA 1RYRA 2J6TA 3AHPA 1HI1A 4Q5VA 4HEA9 2DCLA 2HS0A 2JC0A 3NWGA 1RT2B 4Y2AA 3UI3A 2AGQA 1N4LA 2JVRA 3EPIA 2XY5A 1YJTA 3PX6A 4Q8EA 4ID5B 3PO5A 1GTHA 3D1QA 1N88A 3H5UA 5FIIA 2JVOA 4F26A 1U24A 2Q79A 2I8EA 3PR4A 4X84A 2A2DA 2XCAA 3OLBA 2F3JA 2ZH4A 1U09A 3DN9A 5B08A 2E7WA 4E8UA 1X9WA 3QO9A 1P6TA 2I0XA 3H4BA 4G1PA 2V8GA 5E41A 4DSJA 3DRPA 5KT4A 1TL1A 1LFPA 5KFGA 1U8SA 3KHRA 2J6SA 2AJQA 2DH7A 3G8SA 1X0FA 1B0PA 1TV6B 1V3ZA 2O3DA 2YNIA 3MEEB 2PA3A 4NZ7A 1FXLA 1FRXA 2IRXA 3DGPA 3KLFA 2VQFF 3MUTP 1U1LA 2P6SA 4WFNQ 4ZVHA 4X64F 1NAQA 3ZZOA 5HMYA 4F25A 3EYZA 2CZ4A 3PIOQ 2KFYA 1TFYA 3FRYA 2OPRB 3HVRA 2VPWB 5GAEI 2D7SA 3KG1A 3KK2A 2KXHA 1D9DA 2ZH6A 3RTVA 4B9UA 5J2QB 2M2BA 5DRKA 4C11B 1T03B 1KD1T 1HMVB 2QE5A 3EPGA 4WXOA 2PMHA 4UUXA 4JI2F 4CH1A 4F8RA 2HS3A 1S0NA 5K8PA 3NCQA 1RP5A 1X5OA 4EWTA 3VAMA 3IXQA 4U7CA 1KONA 1FVSA 1RWUA 3NAHA 5JJBA 4TYAA 4KHRA 2C3OA 3L7PA 3CWJA 5HO4A 3MM8B 2QIFA 3G6XA 1RKIA 1FERA 1G3OA 4WU3A 5DO2A 2UXBF 4HL9A 4F2RA 1JXEA 1T3NA 2HNZA 4A8OA 4WFAQ 1RA6A 1D3WA 2MZSA 1F5BA 1S1TB 2E1CA 2M8HA 1FCAA 2WAQD 1FE0A 3CT9A 2ILZA 4KSEB 1FD8A 4ELTA 3FSXA 1RT4B 3I82A 5HMZA 5L1KA 5AXLA 1XC9A 2QEXS 2J0WA 4NL5A 4CT8A 2R8IA 2CJ9A 2IBOA 3DLLQ 4NLXA 2K1RB 2A1BA 4U6PA 2FVQA 4PPDA 2XMTA 3DU6A 3N28A 1DZ5A 1VBZA 4ZVFA 3DMJA 2IM1A 3E01A 3MMAB 2BQRA 1T8EA 2MPUA 5KFWA 1VQSA 4C8KA 2LEBA 3V6DA 4B3OB 4ECVA 5D4OA 1HYSB 3LP1A 2ASDA 1VRTB 2Q6CA 3D54A 3N5FA 3EZUA 2M9KA 2MKJA 5D6GA 2XS7A 2KM8B 1KOOA 4M5DB 4F4XA 3MI7X 3K0JA 4J9PA 1H7XA 3FMBA 2M7SA 4KR0B 4P7TA 1UJ4A 2AJ0A 4PCQA 5KFCA 2YH0A 3MD3A 1VMBA 5F0UA 3ZC4A 5EDWA 1KFDA 3C6UB 4HI1A 1FDAA 1QTMA 3AJ2A 4QCLA 1M90T 3R5CA 3QJLA 2CDQA 3QIPB 2HLUA 3HHDA 4B9VA 1ZPWX 2KRRA 2GJ2A 4Y3CA 6FDRA 1MU2A 1LW2A 4PPZA 2P9CA 3ISND 5KFKA 4ED2A 2HFNA 3PM9A 3D2WA 1SC6A 1NZAA 3GR1A 3IGVA 2CQBA 3PDNA 4PXBA 5CCLA 4X4QA 1IBMF 1HNWF 1M5KC 4PWDA 3HVWA 2FD2A 4YEAA 5GADU 3BS9A 1O0PA 2N7CA 4IR9A 2DVIA 3M9NB 3DOKA 5KFFA 2HZCA 2K2PA 5J2MA 4EYHB 3GE9A 1HQUA 4CTAB 2IAJA 3GQCA 3IWNC 4LQ3A 3CCZA 3EGZA 1NJWA 1VQ5S 4MIAA 2CG4A 1FKAF 4QW8A 1JLEA 2D3OR 3M2RA 4QWAA 4HH0A 4OI3A 3GFHA 3TI0A 3CULA 2DJWA 1BQXA 2ZVSA 4NCBA 2CZVC 2HWTA 4AFFA 1IBKF 3MHYA 3TA0A 3ZZPA 1N6QA 3PKMA 5F3TA 2XGPA 3POTB 1M5SA 3K5OA 4QR1A 2VFUA 2F9JA 4CH7A 4WE1B 1TKZB 4DJBA 3ZZ0A 4K4YA 5I3PA 3O1LA 1YQHA 2OFHX 2HRYA 5C5JA 5THWA 4X66F 2KM8C 5F0WA 1YVFA 3GFXA 2UU9F 1KLNA 3CCVS 1DTTB 2YKMA 4RUCA 5CYMB 4A8QA 4MYUA 1X4EA 2DITA 1VHFA 1IUJA 5BYSA 1GXLA 3NCPA 4DR5F 4CI0B 1VBXA 1SH2A 4Y00A 2Y0SD 2DGOA 2GIQA 5D3GB 1P9QC 3HVAA 2X1GA 2ZH7A 2VL1A 3DLGB 4DFMA 2EBGA 4NWBA 5D4PA 5FD1A 3CCJS 1ZM9A 5DGBA 4ECRA 2MKCA 2YNGB 3E51A 2AW0A 2GJIA 4PXCA 3QIDA 4CNYA 4YP3A 3RB3A 2M0GB 2AX0A 2XI2A 5KFSA 1L3VA 3IFEA 3JAMY 5KFHA 1VQMS 1HWIA 1C1CB 1U2RA 3LO3A 1BGXT 5A0YB 5IZHA 2DR5A 1JLFB 2Y1IA 4FP9A 4F3MA 4NA3A 3MM7A 4X65F 4N8OA 5J1EB 3PEHA 1MMLA 4LVOP 1S6UA 3FGVA 3NBPA 5FDLB 3TUJC 3TVKA 2NLWA 1EP4B 2M88A 3DLJA 2Z2MA 4CT9A 1VIOA 2C3PA 2MGZA 4X4OA 2H5EA 4OX9F 3CDAA 3MR5A 1H98A 4JI3F 1SJRA 3MPWA 2XCPA 1RKJA 2DPIA 5G4DA 3CJKB 2AGOA 5T7LB 2IM3A 1BY9A 2HIQA 1RYSA 3DM2A 4AXIA 4YUDA 1S77D 2F8HA 1RT5A 3X3UA 3E3XA 4OZ0A 1X9SA 4DFPA 5LMNF 2V2KA 1R3NA 2HGMA 5DLFA 4M95A 1SKRA 2MB0B 2E7XA 3I0SA 3GIIA 2OAUA 4A8KA 1S6PA 5E33A 5A8WB 1R31A 3VALA 3M2UB 3CC2S 2GCFA 2UVVA 3BQ1A 2RD5C 3HKWA 3DI6B 3I5CA 2OMOA 1SV5B 4HT7A 1KLMB 4LJMA 4AQYF 4R5PA 3J7A1 2XMKA 4URGA 3GYNA 5KFZA 2M5YA 3ETOA 1QJHA 3M8QB 1YJWS 2L9WA 4NCGA 2XC9A 3QYYA 3W3SA 2IM2A 2KJWA 3TA1A 1D9FA 2EFNA 1UVLA 3SV4A 1WHXA 4LIRA 2QA1A 5AE2A 1X4FA 2H9ZA 2IC3B 2VBYA 3LGMA 3RB0A 4IUFA 2C22A 2YQ3A 3TOQA 2PD1A 3PJWA 1Q8BA 2FGOA 3CIZA 2QA4S 2UUAF 1TV6A 4NLOA 1SIWB 2C2RA 2FLPA 2ALZA 4DSKA 4C98A 2K7KA 5E3QA 5DS7A 4Q0BA 1IN0A 2LMIA 5KOWA 1HHTP 4YOEA 1IJFB 1D9AA 1FXDA 1HBOB 3DRYA 2WTFA 3VAKA 4M63A 2ROPA 5KFMA 3I56S 3C6TA 3JSRA 1YBAA 3DLBA 3DLKB 1LWFB 1HWUA 2VG7A 3OXFA 5LXRA 1VQYA 2MY7A 2WW8A 3G6VA 3Q8SB 4DSLA 2EBEA 4B9LA 2ZZMA 1LK7A 4J9MA 1CEZA 3W2VA 5H1SV 3KLEB 2AJ1A 2IA0A 2LU1A 1LV5A 1HNXF 3R3TA 1DLOA 2B9XA 3JTPA 4FVMA 3MR6A 3TAPA 1SKSA 4Y28C 1UVMA 1OQ6A 2UVRA 1JJHA 2CPJA 2XLKA 2RUGA 2MYFA 2WB1D 4FBUA 2VA2A 3MMJA 1F9FA 1Q1KA 2RB7A 4QIGA 1S1WB 2UUBF 1F5CA 4I2QB 2J0QD 5HLFA 4DQQA 4B3MF 2VG6A 4PG5A 2GA7A 5F8IA 3OVAA 2D9OA 2PSZA 2N4CA 1HW8A 1HWLA 5KFDA 1H7WA 2HQ3A 3PFOA 2DR8A 1OSCA 2DNRA 5E3PA 2E9ZA 2BV3A 4JOUA 3BF4A 3MR3A 3PW7A 4TLQA 3S01A 2UUWA 1S6QA 3OHBA 2O66A 4O3SA 2KT3A 3RZAA 5J2NA 1URRA 4W92B 2UV8G 4ED1A 2KFZA 5HMXA 1CPZA 1TQLA 1CG2A 2DH8A 3A8EA 5HP1A 2HWHA 1QM9A 4FF1A 4PG7A 1WWHA 4FN5A 4DR7F 3MM6B 3BSCA 3SXLA 2K1RA 3V81A 2CQ0A 4N56A 1HQEA 1BQNB <