4DV0J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv0J00
4JI0J 4LFCJ 4DUZJ 1I94J 1IBLJ 1N32J 1IBKJ 4NEYA 3JAMU 2ZM6J 2UUAJ 4JI7J 2UXCJ 5LMNJ 1XMOJ 4YHHJ 4JI6J 4DV2J 4DV0J 2F4VJ 3T1HJ 2VQFJ 4LF5J 4B3TJ 4DV6J 4DR5J 3W1YC 4PWWA 4DV7J 2VQEJ 4DR2J 4GKJJ 4JI2J 1N34J 1FJGJ 4JI1J 2UXDJ 4KYZA 4K0KJ 4LF9J 1N33J 1HNWJ 1J5EJ 4LF6J 5LM7E 4RJVA 2UXBJ 3J80U 4KHPJ 5IT9U 4JI5J 4NEZA 4AQYJ 4GKKJ 3IMQJ 4DR1J 4B3SJ 5FLXU 4NXMJ 4KY3A 2E5LJ 4DV1J 2HHHJ 4OX9J 4LFAJ 4JI3J 3J81U 4HHUA 4LF4J 3T1YJ 4X65J 4X64J 5AJ3J 2KVQE 4NXNJ 2UUBJ 4DUYJ 3D3BJ 2MEWA 1IBMJ 4DV5J 4V1Ak 3R2DJ 4X62J 1N36J 5A2QU 4DR3J 2MTLA 3OTOJ 4LF8J 1XNQJ 2MQ8A 5BR8J 4JI8J 4LF7J 1HNXJ 2UU9J 2UUCJ 4X66J 3D3CJ 2KL8A 4YY3J 1XMQJ 4JYAJ 5IWAJ 4DR7J 4JV5J 4DV4J 4LFBJ 3J7AN 5LMUJ 4DV3J 4JI4J 1HR0J 4DR4J 1HNZJ 1XNRJ 4B3MJ 4B3RJ 4DR6J 3R2CJ
chains in the Genus database with same CATH superfamily
1S77D 4ZA1A 1TKXB 3H40A 2BJ9A 4BWJA 4KGXB 2PDAA 2C3YA 3LP1B 3QIDA 2R4FA 1XMOF 3EXCX 4PWUA 4OYMA 2VPZB 2LQJA 3GJQB 4Q5VA 3AD9C 2BA9A 4LSNB 3HHLD 2KHDA 1YBUA 3DDIA 1AYEA 3BPDA 1SL0A 3C14A 4ZPCA 5L8RC 2MZSA 1FF2A 5KFTA 2RVJA 2XI3A 3HI9A 1I1GA 4WIQA 4A8WA 4DPUA 3CCUS 1PIEA 5CZVA 2B8QA 1RT2B 1FEEA 4PG4A 2RD5C 3B54A 1WDDA 1ZPVA 3TZYA 4NXNF 3ENAA 1XC9A 3KOAA 1FWLA 1RWOB 1IKWB 2YKAA 3G86A 4CQ1A 2EXUA 4EEYA 4DN9A 1ZTTA 2GVDA 1HARA 1KHWA 1RSCA 1GFWB 1T9TA 2R7WA 2XS5A 3Q22A 4QPTA 3N9UC 2VG6A 4C6AA 4ZK7M 1Y9OA 2QFJA 1GEHA 2AEJA 3HHLB 2AW0A 1RAEB 3TX8A 4NCBA 2NPIA 2RQ4A 5IT4A 1VMBA 1NK4A 2Y0BB 4WIIA 5J2PA 1Y5IB 3GG0A 2BVZA 3THPA 4LR7A 3ILLA 3K5LA 2DK2A 4ED4A 3UW1A 3TNVA 1SUQA 3U1NA 2DGQA 3VAJA 2MQQA 2V67A 4C8NA 3FMWA 4DSJA 2DNPA 2XSFA 2DH8A 3PRVA 2LU1A 4EMDA 1TL4A 4OZNA 3NWGA 2CXEA 1D9AA 4HHUA 4DEZA 1TKZB 3DHWC 1MROB 4LF4F 4ILLA 3IGNA 3DLLQ 3PFOA 1ZZFA 2CQGA 4C8YA 3LP0B 2GO8A 2XCPA 3IN5A 4P2FA 2E5GA 3HP6A 3IBWA 4Q7AA 2R7SA 1V3ZA 1XMQF 1RQ0A 1CJKA 3SXLA 3MF5A 4RNOA 4C8LA 1ZH5A 4JI0J 3ZC4A 2O5DA 2MZRA 1JJ2R 3NS5A 1DTQB 2V4JA 4RL1A 4DQSA 1VGYA 2HQ3A 2AGOA 1KVKA 1KTVA 3CCES 5DJBA 2PI4A 1FDAA 2DXEA 3H5YA 1RWVB 2GHVC 1D0EA 1MMLA 3MPYA 4P9SA 3J7YU 3W62A 1U8WA 3EGZA 5E41A 5KG1A 1Q5VA 1CJUA 3RBXA 4X4OA 1JLQB 2FJAB 1RTIA 1LWEA 3OHAA 3ETMA 2XYPB 1PILA 2E5JA 2CJAA 4RW4A 1EKSA 4WKYA 3DRYA 4JI1F 4EYIB 1CEZA 3FCWA 2AJ1A 4ILRA 2I5JB 2A2DA 2DHSA 1U47A 3IM8A 2HWTA 2FDNA 4N5SA 1NHUA 1NM2A 4L73A 4ID5B 2YQ3A 4DV4J 4DU7A 2HQCA 3R7BB 2OPPA 4WFBQ 3D6FB 3E3XA 2B0GA 9ATCB 1YVFA 3V2UC 1IBKJ 2RRNA 4FP9A 5A76A 3L7PA 3ZZPA 2COLA 4KGMA 3CTRA 1NAQA 5KFUA 1IXKA 2PFFB 2R7UA 2HK3A 4UOFA 2CQIA 4ITSA 4ICLA 4FKYA 1T03A 4HI1A 2XLKA 1F3FA 3TA2A 3OR2B 4WFZA 1NK8A 3A8EA 4IO9Q 3C19A 2JJ4D 1U2RA 1S1VA 3K7RA 3JTPA 2N3OA 3DRRB 2HAIA 2W01A 2L41A 3I6PA 2W9CA 2B9XA 1C4CA 2XMKA 2ZD1B 4Q45A 3RUBL 2CAJA 2QV6A 2CZ4A 3D9BA 2C28A 1NKEA 2ZH4A 3FEZA 1DTTB 2JOQA 3U27A 2BKPA 2IDLA 2CNKB 2M70A 1HNXJ 4ED2A 4PAAA 3ZXWA 1KTQA 3MPWA 4Y0FA 4OLOA 4IOBA 1EARA 2VDHA 2D3ZA 3W2VA 2N4CA 3FSYA 2CUYA 4Q2MA 4PWDB 2VICA 2ZHBA 4FNHA 4AT1B 1KHVA 4U96A 4HHHA 4LF7F 2ROEA 1BQNB 1RTZA 4Y28C 1UVNA 3HVTA 3A3OB 2GGPB 3IP0A 3X3UA 3W9IA 4DUZF 4C11A 4NLVA 1ZAWA 5A8RA 1DJ0A 2G9OA 3T6JA 2HIYA 2RQMA 4IRCA 2UXBJ 4J9LA 1SV5B 3P3DA 1L3TA 2W2QP 4OIXA 4KGVB 3KTQA 4RW6A 1S0OA 1KKHA 3BQ2A 3DI6A 4QWDA 1IKYB 1R43A 1SJ3P 1XK8A 5G4DA 1RWKB 1HKAA 1YZ7A 1NJWA 3PX0A 4U9RA 3CDEA 5ETKA 3BZQA 2X1BA 4LF8J 1EQ0A 2FJDB 4IH6A 2XMMA 3I55S 4A8YA 1AROP 1Y5NB 1ITPA 1FO1A 4EBDA 1JK9B 5IC4B 3L4BC 2ABYA 4M63A 1WC3A 1FVSA 5EX0A 2HNYA 5IT9Y 5E0OA 4FS2A 3VGVA 2IYIA 2IC3B 4BC7A 3L95X 3CSKA 4CLFA 1JLGA 2H9ZA 2CQBA 3NGRA 4FYVB 3HZEA 4MK7A 4GKJJ 2K7KA 4F3MA 2OFGX 1N33J 2BMBA 4DR2F 1TVRB 1S7IA 2YNFA 5H9EK 4LVOP 3I4PA 4CT9A 4NXMJ 2NQPA 2RQKA 3DYAA 2IBKA 2HFNA 4DR1F 3OQ2A 3B78A 2Y0SD 2FJBB 4X65F 1F9HA 4C48A 1AT1B 5A0YB 1UEVA 1HLWA 3KK2A 3H4BA 1VQ9S 3KG0A 5IFMA 2HKEA 4J9UE 1DURA 2KL8A 2J9DA 3BS9A 3OFFA 1C0UA 1X5SA 4BHQA 1WG4A 2DD8S 2XNQA 2DYAA 3UDCA 3VAGA 2RKIA 4J9SA 3C46A 4PG8A 4DV3F 4GVLA 1DARA 1HWJA 3RR7A 3OJUA 2KXHA 3HSGA 2ZM6F 2F4VJ 2RSQA 3BYPA 5GMEA 3Q8PB 3M1VA 4ES1A 3CJ4A 4LREA 4LBPA 5GAEI 3BN4A 3F0NA 4DPYA 2CNLB 4DR5F 4M5NA 1CC8A 1VQMS 3EYZA 3PO5A 1LNQA 3NNAA 1FERA 2MY7A 3FBEA 1ZM4A 1FRHA 1KDNA 2GMJA 3I56S 3RRGA 6FDRA 2MLZA 1ELOA 2UVRA 1B7FA 5IV3A 2HHTA 3OFGA 4O0IA 3QGIA 4RUAA 3OTEA 3AY0A 4J9VA 4C2MA 3OTOF 1RAGB 3O3LA 2Q3PA 5JVHQ 3HK2A 3N4WA 1LW2B 4URQU 3M8SA 1DHMA 2DH9A 3AOAA 3PRDA 2RDJA 2RHSB 2NUUG 4CNYA 3AD7C 1B64A 1REVA 3J81j 4ZP7A 2MKYA 4WJBA 4X66F 1X4CA 1JNRB 5AXMA 4ZIWA 1H7XA 4F4WA 3VV2B 3LOUA 1P1LA 2R2RA 1S1XB 2CKWA 2DNNA 2E1AA 4CTAB 3C6UA 4I4BA 2PI5A 1OSCA 4LF9F 3ULHA 5HQ8A 4QIGA 4WK3A 3N6MA 1YRUA 3IR5B 4K4ZA 2HHWA 1UFLA 1VBYA 1CLFA 2NXUA 8AT1B 1S76D 3FDSA 2UV8G 5HMZA 5F8MA 5CH7B 3UDVA 2V9KA 4DUYF 2EFPA 2AJQA 3VAHA 3R5CA 3Q8QB 1KVJA 2AX1A 2R8GA 3CJKA 1CS4B 2H54B 3G6ES 4UF4A 5KFBA 5EHHA 4K4SA 4DPXA 2BUNA 2FGCA 2X7IA 3DNCA 3MAHA 1I94J 1Y3JA 3HPOA 1TUWA 2K1RB 4ZPAA 2GX8A 1YRTA 3QT6A 2YH0A 3M6UA 4A8KA 4NLDA 4DQRA 3MFHA 3LP2B 4I2QB 5F0WA 4KGKA 5J1NA 1Q7LB 4M5MA 2HZAA 1YWXA 2W4CA 1Y10A 3BJYA 5ETNA 4DF4A 5M2RA 3C66A 1HQEB 2B6AA 1O8BA 4OV6A 2H5IB 4OX9J 4GC7A 4DV1J 1S9FA 4PYDA 2I6WA 4BLGA 4TY9A 2WRMA 2MZQA 4AQYF 3SQGA 1CQMA 3P49B 2VH7A 1VQPS 4ECRA 4M5LA 1EKRA 4C3KA 2OELA 3JTNA 3ZTQA 3P45B 4USIA 3KHGA 4MK9A 3K57A 4FYWB 2OEJA 3PTWA 1KLMA 3G8SA 4Y2MA 2YX4A 2A6MA 2VUGA 2W2PP 4TYAA 1C1BA 4KV8A 2FB0A 4MKAA 1U09A 1IBLJ 4WE1A 3BGLA 3IG1A 1HI1A 2BZ2A 3TA1A 4K8RA 2OEMA 1IR2A 2OPQB 6AT1B 1OWXA 3SCKE 1U1RA 2VG5A 4OYXA 1SKUB 5RUBA 3R1HA 2ZUGA 3IRWP 4DG1B 3GTYX 2VQEJ 3ET6B 4O3NA 2CDRB 4KO0B 2HHVA 5G0RB 1M5SA 1VQSA 1HNIB 1RAJA 1U1QA 1RAAB 2Y1IA 3AXKA 1PC5A 4TU7A 1S97A 4W90B 2RF2A 1VQ4S 5C7PA 1VRUA 4DFJA 2PN6A 3ZNUA 4ED5A 4I6WA 2MQOA 4RW7B 3QGPA 3NGDA 1FXLA 3GJTB 2G2OA 2MTLA 5HMXA 5BYSA 3OLBA 1WF2A 5H9FJ 3M8YA 4JYAJ 4Y34A 3D4JA 1W2IA 4UOHA 2OMOA 4NYOA 3ZFVA 2FLLA 5IWAF 3C14B 2VA2A 4LFBF 2QTWA 4N47A 4J9PA 2C2RA 2VPXB 1WI6A 3UNYA 4UW2A 3NAHA 2FLPA 1RADB 4NI2B 3W5ZA 3CGIA 1O0PA 2KM8B 1WOSA 4D3GA 2HURA 4USWA 1FRKA 2GCFA 4ZHRB 3IS9A 3VF0B 2JX2A 3POTA 4DCPB 4KH1B 4LFCF 4MJKA 1V5IB 5KFYA 2B5JA 2GVDB 2KZZA 5LSOA 3AJ1A 4GO7X 4AFFA 2J7UA 3DLJA 3EICA 2HVEA 2YWEA 1K47A 5HLFA 2O1PA 3PR5B 3UDLA 4DXLA 2A18A 1W25A 1YRXA 1QAXA 3C16B 5J2PB 2FVRA 4FBTA 2HGLA 4RO0A 3ZZYA 2ZBPA 4LRBA 1NH7A 5K5MA 3TP2A 1OSDA 1SUQB 2J9EA 1LV5A 2AYBA 3OHBA 3GWCA 3F73A 1DLOB 1LXJA 1AXQA 2VONA 1RWNB 2D3O1 3VQTA 4ZN3A 1XR6A 4H54A 2FUG9 1U02A 2HGNA 2LDIA 3FBBA 4OYBA 1RAHB 2ZJRQ 2CPDA 1L3VA 2KYZA 3PYGA 2VQFF 3PZPA 1HNZF 4WFAQ 5KOXA 1FJGJ 2PA8D 2QZ8A 2GVZA 2V2VA 3NMAA 3PACA 3DOMA 4UY8T 4PQUA 2XMJA 4FBUA 1TL3A 2CPFA 1T3OA 1CJKB 3H42A 2KXNB 1XJWB 2CQ0A 1YJWS 5ETLA 2V4JB 4TLRA 3AOCA 2HHHF 5D0HA 1N5VA 4X62J 3C6TA 3D6MB 1N34F 2Z57B 3LPYA 4IH7A 4JUZA 3UI3A 2Y9HA 4U8YA 2PSZA 2RILA 4KGZB 5C42A 5CHCB 4R25A 1RHRB 2HAFA 5D8HB 4B9TA 2CPHA 3B8HA 1GNKA 1RAIB 2WVFA 1CJUB 4C0HA 1RTIB 1C4AA 1LWEB 2J9DE 2VHGA 2YWKA 2XM3A 4R8UA 3HHKA 4RW4B 1JKHB 2IY5B 5KT7A 1NZ8A 4AE5A 3AB4B 1SC4B 3ZTRA 1BWEA 3UNGC 5BR8F 4OZ1A 2ATCB 4TKTA 1UCNA 3BH7B 1ZA1B 4E98A 4ECUA 4KHPJ 3RRKA 2LMIA 2XMAA 3NRBA 1BGXT 2BRLA 3CD6S 2ZNZA 1HNVA 1BY9A 4HYKA 5AJ3J 4OHXA 4BDPA 1KRPA 3MEEA 1HA1A 4FPRA 4RKUC 1U1LA 4OX8A 2KVIA 3W5YA 3FRYA 2MB0B 1QSYA 5CYMB 4ICLB 2RUGA 1GT8A 1SH0A 4P52A 1SKSA 2D9OA 1T03B 2FTRA 2HLTA 2DR5A 5DLGA 3MI7X 4EBCA 3H5SA 4KHMA 1SL1A 2QEXS 1VCTA 2M3DA 4DR6J 4W4MA 2X3DA 5GAHI 2YNIA 3T5KA 3GPAA 4E0DA 3G96A 3R5JB 2ASLA 1R6VA 5FDLA 1Y4ZB 1RZMA 3U02A 1TMJA 2W9CB 1FDBA 1QTMA 4Y2AA 3MHYA 3FNNA 1TMMA 3B6BA 1IBCB 4B9UA 4WZMA 2RDDA 1FNMA 4X4UA 3ELHA 3Q0AA 3MR3A 3Q2TC 5FJ4A 3W2VB 2IVFB 4KSEB 2ZDOA 1NHKL 3PHEA 2QMXA 4W98A 1RHQB 2BDPA 4JV1A 1Y3KA 3CF5Q 3E01A 1Q78A 1RHMB 3HVTB 2FJWA 2P5VA 2AX0A 1I6JA 2CJBA 4I2PA 1T3NA 2CJKA 3K5NA 3J7AN 3LWLA 5EUHA 5A8RB 1TU0B 2WB4A 1PBUA 1NSAA 5K9FA 3QATA 3GV5B 5J1EA 1N36F 4RW6B 1MSWD 4JI0F 2L9NA 1QVFR 1RP5A 3NCRA 2GJIA 4J9QA 3L7OA 3LA0A 3KLFA 2YBVA 4QU6A 4I0WA 3NXZA 3BGOP 3I31A 5LMUF 3R7SB 2YKMA 1H38A 1B99A 3ENVA 2H4WB 3OFEA 2QA1A 2WHOA 3M2UB 2KRRA 2N7YA 1NUEA 4K0KJ 4ZDNA 3PR4A 2G1DA 2GZOA 1F60B 4QYZJ 3OL8A 3BN7A 1RI7A 4OYPA 1RU1A 2VKRA 4P2XA 3QFWA 5LL6d 2HNYB 4F0HA 3CCSS 1DQ9A 1IBMJ 5ETMA 3O2IA 4DZDA 1HBUB 1HNWF 3VQSA 1SPBP 5DS7A 1VQLS 3BQ1A 1JLGB 3MEGA 3CEDA 2DRDA 2B7BB 3PVXA 4MFBA 3T41A 5I3QA 2BBEA 1HBNA 2KT5A 3PIPQ 4PEOA 2YNFB 3UDEA 2RS2A 4DV4F 1IR1A 1H2TZ 4KIAA 2WW4A 4QW9A 1VI7A 3QNWB 4UT4A 3R6GB 2DNYA 2AEMA 1G1XA 2AV5A 2ROGA 2XBPA 5M2UA 3DYAB 2VIHA 2WVCA 3RAMA 1V3RA 3CD5A 3T5JA 2DNHA 2KT3A 4CIOA 3QRRA 2NXJA 3KK2B 4R5PA 1WI8A 5CYQA 3GV8B 3RAQA 1C0UB 2BOAA 1V5VA 1NSPA 2OTLS 4JI6F 1WF0A 3MUVP 3TANA 3TUIC 3DU6A 1KQKA 1VBXA 2RJZA 3NGTA 4NEZA 1NSKL 4JI3J 1Y11A 3BO3A 2NSBA 3K89A 4IFYA 4YMEA 1RYSA 3N28A 3DDKA 3NL0A 5DETA 1KLNA 3DHXA 3LO3A 4XTTA 2VFSA 1S10A 4ZMMA 2ZH7A 2DPJA 1RT7A 3M1VB 2F40A 1J27A 2R3VA 2EC2A 3JS9A 3BGRA 2HWHA 1WDTA 3SCIE 2E1MC 2BKOA 3D28A 1CJTA 2M9KA 2LYVA 5THWA 2HQGA 1PJ5A 3SBMA 3DOLA 2ILYA 4QR2A 1TUVA 2HRTA 4ECSA 3MR6A 1JX4A 3DRPA 4DL3A 1HW9A 1JIHA 1D3WA 4OJGA 1HHQA 1K73T 1WF1A 4IDKA 1KONA 1RT3A 1S1TB 3CJ8A 2Z8QA 3Q83A 3QMQA 5KFIA 3VAFA 4F36A 1X5TA 3SFUA 2LA6A 4P73A 1CSJA 3TZWA 4HH0A 3CCTA 2CJXB 2UVUA 1AFJA 2UXBF 2E7XA 4P74A 3ISZA 1DAXA 3TUJC 1REVB 5IQ6A 1VHFA 1URNA 4HR2A 5J1PA 1IN0A 4LF8F 1XR7A 2K3IA 3UD5A 2BJDA 3GV7B 4LRCA 3C6UB 1S0MA 3DLHA 3OW2R 2R2UA 3NBPA 1WHVA 1OS5A 2RHQB 1HIYA 4B9SA 3TEGA 3HKZD 3KKFA 4P2SA 1Z1ZA 5KOWA 1PJ7A 4OZ3A 2XY5A 1MU2A 3KLEB 2R9LA 2UUTA 4FXVA 2NCKL 4JI1J 2XZTB 3CJKB 4GKJF 3QLHA 5DQGA 3WC2A 7AT1B 2DHGA 4RR5A 1VQKS 2I38A 4IFVB 4DUTA 5GADI 3FC9A 1T05A 3SEOA 4TQSA 4ZLPA 1T8EA 3CUNA 4PABA 1JLEA 1U1OA 4Z37A 3QIPA 5CYJA 2UVVA 2PEHA 1P6TA 2C3UA 5EWFA 1PKUA 3QZ8A 4JP8A 3OJSA 1BC6A 4J37A 2PC6A 2QLJB 5F0UA 5B0BA 3HHEA 3BQ0A 3FEYB 2BQ3A 1LK5A 2A0FB 4JI5F 5B7WA 2RB7A 3DN9A 2WOMB 2Z30B 4HL9A 2B6AB 4K5SA 3MD1A 2BXJA 5IC6B 1H6KX 3TI0A 2KXFA 3DLKA 2BE2B 1F5AA 2UUWA 1TELA 3SQGB 2J0WA 3QPIA 2DHAA 4UUXA 3OTCA 3LGMA 3SSQA 1WUUA 1Q82T 2W7AA 3ILIA 1KLMB 4WBFA 4M5JA 1WG5A 3CJ2A 3JQJA 3PEJA 2OGUA 3NCQA 3TQEA 2MXYA 1P27B 1C1BB 4KV8B 1NPKA 3WDOA 1H0HB 3HLUA 1UPPA 1FKAF 3PEHA 2XYGB 4HACA 4WE1B 1SL2A 3IG1B 3HD1A 1GMVA 4X4VA 2ZDPA 5I3PA 5HBMA 4OI1A 2BANB 1RWXB 5KFVA 2VG5B 1U6BA 2HGMA 5DG9A 2UP1A 4LF7J 3PW5A 1OY9A 4NLYA 1RK8A 2CRLA 2F9DA 4EGLA 1RT1A 3NKYA 4I7FA 2QIFA 5L9NA 2B4UA 2MZTA 2ZKUA 6FD1A 2YX7A 3RJMB 4DUZJ 3M2RA 4DPTA 4CDIA 3GFHA 4WXOA 2LDYA 2RF2B 3IAM9 1N5TA 4YQWA 1VRUB 2QLBB 4IOCQ 5LT5A 5KFEA 4OFZA 1D9DA 1EETA 2XS7A 2EC0A 1CJVA 3HSDA 1EAYC 1HR0F 4DV7J 3FSXA 3I87A 1EQMA 1TL5A 2OP5A 2W7OA 2DNMA 2EG2A 3TJ9A 4OZ2A 3MEKA 5B0FA 1FJ7A 2W7PA 2GIRA 2QJ3A 2RRAA 1ICEB 4I56A 1FRLA 4Z2XA 4QWEA 1X4AA 3W2WA 1RTJB 2W8KA 1XWLA 4Q2LA 5M2PA 3DGVA 2N3LA 4DR3J 3EWGA 3HDSA 3EZOA 2DBBA 4DPOA 4ED1A 3A12A 3JB9k 4ECXA 4M1KA 2CQ4A 1FNOA 3CDUA 3IS9B 1VQNS 2ZZTA 5GAEU 2V6AA 3KHRA 4OMFG 1SJFA 2B5JB 4OV1A 3KJFB 4U7CA 1OYDA 2NLWA 2LXFA 1REGX 5HLFB 1I94F 2W4DA 4AXIA 4YS2A 1MWYA 3TZXA 1SI9A 4G1IA 1U0HA 2IMOA 3GCXP 5LSLA 2R42A 2YKPA 2WONA 3CCVS 4JI2J 4EWTA 1IKXA 4MMOA 4KYZA 3CDAA 1NZAA 3U1MA 5LMNF 4A8FA 2RRBA 3MPVA 5DQIA 1YBTA 3N79A 5F8JA 1CPZA 4OI6A 4CO5A 4RX6A 4A8QA 4E2FB 2E9TA 2VJVA 4UQGA 2RNEA 2ZH1A 2J0XA 8ATCB 1FJEB 4ETZA 2DGOA 2MQ8A 2QA4G 4PYAA 2UU9J 4USTA 2QMUB 2CPIA 3IRXA 4DR7J 1VYAA 5T7LA 4PQUB 3DOMB 1HWKA 5IXUA 2VC0A 4U7UD 1TL3B 4F2RA 4ZVTB 4QR1A 4CM2A 2CQ2A 3GB0A 3IWNC 1WKKA 2E7VA 5D3GA 3GG1A 4A47A 3HJFA 2YWWA 2DB1A 1FHTA 1RE1B 2YNGA 3C6TB 2MSTA 2VB6A 2DRBA 5D77A 4DSFA 2XMTA 4OHWA 4DI6A 4ZCIA 3UWTA 3MM9A 5C42B 2KM8C 3FZBA 2VQEF 3H8YA 3OSNA 2BQUA 5KFRA 3GLJA 1W2BR 3QSYB 2J6SA 4YB6A 2X1AA 1HL6A 1UFKA 3TZZA 2JVRA 1SIZA 4KBIA 2UUBJ 3V6DA 1QD1A 2BRKA 4R8UB 3EM1A 3VALA 1C1CB 2HW3A 2J6TA 3OV7A 2R7OA 1N48A 4X66J 2G0JA 5L1KA 1S6PA 5HVGA 4GKKF 5D4PA 2V0NA 1RGVA 4NLSA 4RU2A 2YXLA 4JYAF 2QL7B 1OPZA 4OZLA 5CXTA 3PO4A 1AUDA 1NK7A 1VFJA 4OJ1A 3NMRA 4B08A 3TUZC 1HNVB 3VVTA 5KFCA 3MURP 4FYXB 1NKBA 3P5TL 3KYLA 3M8ZA 1HBMA 1YKWA 4NCGA 3K59A 3K17A 3DMJA 3D1QA 3D6HB 1ZM9A 3BDPA 2DXDA 2VF3A 2G2ZA 2YNIB 2ALYB 2PMZD 3I5CA 2MZ1A 2AYEA 2YTCA 2CQ3A 2OD4A 4YN3B 1ULRA 3NGSA 5FDLB 2DCLA 5L1IA 4DL0C 2BACA 1TV6A 2GJ2A 3A8IA 4TY8A 1FRJA 2OAUA 1G3OA 3DOKA 3M8WA 2L9DA 4TN2A 4P2MA 2K3KA 3CCZA 2IVYA 4ZVQB 3BM7A 2VC1A 3CWJA 1RT5B 3EVMA 4O3SA 2XY6A 1N32J 2CVIA 1NXIA 4G65A 5J2NA 3D68A 4O0NA 3HT3A 1E6VA 4NLXA 4OYWA 5E33A 2J76E 3QJLA 5IT0A 3VHQA 3R7NB 2IJRA 1X4BA 3MGJA 3E01B 1YJRA 5HL7Q 2A10A 5GMKa 4F4AA 5A2QY 1YTYA 4Y3CA 2A3JA 2ZH5A 4QBUA 3MMAA 3KJNB 2EBEA 3CCLS 5L1LA 2P8IA 4LQ3A 1DQ8A 5K8PA 5LM7E 5F41A 3W63A 1FJGF 1RBAA 4NASA 1AFIA 1MWZA 3M2VA 3QQCD 3UPFA 5J1EB 2ZC4A 1B70B 2C3PA 4IRKA 2E1CA 2ZJQQ 4F8RA 4ANDA 3F41A 2POKA 3KLFB 1RAFB 2XHCA 3TEHB 5K14A 2YKMB 4ZCLA 3V4MA 1HI0P 1T9YA 5LSRA 1XIQA 4NOHA 2Q1LA 1KFSA 1Y7PA 3SMZA 1N56A 3L9ZA 1FX2A 4PCQA 2AIRB 1BMQB 1IQTA 2CZVC 2Q6CA 1YX2A 3Q24A 1QDUB 2HS4A 2VFUA 1Q8LA 4P10A 5IV4A 1S6QA 1HPZA 1AA1B 2FHJA 1GQEA 2MLXA 1S0VA 1IWAA 4K4XA 2O01C 1AUSL 1Z2LA 3MEGB 4OHZA 1GH8A 4USVA 2IM0A 2QLFB 4MFBB 3QGGA 1HBNB 3ADAC 1R31A 4WP9A 3EE3A 4K4TA 3F56A 1Q8IA 4KHPF 4OYAA 3FBCA 4DV6F 4YR2A 1WSVA 4XPCA 4DN0A 2GC8A 1T7PA 5D4LA 2KTQA 4ZN1A 4YUDA 5AJ3F 3TAPA 4ZVFA 1U4BA 3NY0A 2PE8A 2VFRA 2HYIB 4USUA 3KLHA 4ED6A 2VD3A 4D3HA 1VIXA 4R5PB 5CYQB 3R8YA 5HO4A 1RHJB 3G8TA 4CLZA 2L9WA 3OT9A 2AYMA 2D41A 4K2JA 5B0DA 4DZ6A 2H3EB 4LFCJ 1SH3A 4USHA 1FFWB 4DR6F 2QG9B 4V19X 2U2FA 4B02A 1B4SA 4IFYB 5C2CA 4MYUA 2CADA 1PAUB 3MMCA 5FD1A 3BREA 1OQ6A 5AE1A 2CFXA 1FD2A 3H7HB 5KFXA 3D6TB 4Y00A 4BBYA 2HHQA 1RT7B 1LOUA 2W1BA 1MLAA 3K2YA 5F8LA 3BGRB 4URGA 2BJ7A 4YB5A 4KKOA 3WBZA 4WFYA 1CJTB 1YJNS 4KT0C 1RU2A 1VJQA 3MDFA 2N7CA 2BE9B 4C9DA 1KSPA 3GFYA 4FVCA 3DOLB 5CA5A 3GILA 3A3PB 4UOGA 1GX6A 3H5UA 3RGIA 3H5XA 3HFVA 4EO6A 1UETA 3R9LA 3UN2A 3DRPB 1FK9B 4OX7A 1I3OB 1WC1A 4I1TA 5LOQA 4L6V3 3PV8A 1TKTA 2W24A 1GTHA 1HFEL 3IBCB 1JLFA 4BS2A 2Z2ZA 2CPXA 4HTJA 4FPIA 3OL7A 1RT3B 3SFGA 2NXEA 5ITHA 1U2FA 1HNZJ 2ZBCA 1Y0HA 1XNRJ 4B3MJ 1GXUA 1SCJB 3OXFA 3AH6A 1MWQA 2ZUAA 1T02A 4P72A 2JLFA 1GMWD 4ZIVA 1U49A 2QC3A 2CPEA 1Q95G 1BHNA 1GAOA 2YWGA 1FD8A 1F2HA 2HVDA 4NZ6A 3TWZA 2XLJA 2XNRA 1U25A 3CD0A 2OSRA 4DQIA 2JEJA 3M05A 2LEPA 1N34J 2OPRB 3QWUA 4LBHA 3H4DA 3M8QA 4DS5A 4WKRA 4K0KF 3PDNA 2E5LJ 4LFAJ 1MG7A 2Y1RI 4IR1A 2RQCA 3FCHA 5GAHU 4ZPBA 2M8DB 3ISND 1IBMF 3KUEA 1MU2B 4DFPA 2A6OA 4FVMA 4FYYB 1IR0A 4C4WA 3DLBA 4Q0BA 4RUCA 1H2UX 5I3UA 4LSZB 5BR8J 3LANA 1W7WA 3I0RB 4EYHB 3G87A 1T05B 1X0FA 2NS1B 2R2SA 4U6PA 1XN9A 4ZPWR 4AYBD 1SXLA 3GYGA 1JLEB 3QIPB 2OEKA 2XGQA 4LF5J 1TKDA 1LWFA 1LWCA 2GQCA 2C42A 4HDHA 3IA0A 4NPOA 3N5FA 1XERA 3QJPA 1UW4A 2WCXA 4DF8A 4Z7CA 1TK0A 2IAJA 1ZETA 4ALZA 3LGNA 3X1LB 3VAKA 2PIIA 4ELVA 4L74A 3LAKA 3MPDA 1HQUA 5KFSA 5JJBA 1HHSA 3W7BA 3OFHA 4CNZA 4CYUA 1S12A 2XWXA 4JI3F 3DGPA 4ECZA 1WKJA 4DHVA 2Z58B 2BEFA 3CMES 3KJQB 3JYTA 2KG1A 4K4VA 3SDEB 3MAQA 3BSAA 1OQ3A 1V3SA 4ELUA 4PR6A 4PUOA 1EIYB 3D0HE 3G6YA 4HI2A 2LQBA 4C8MA 2J7WA 4KJIA 4N7TA 3VAIA 2GQ2A 3NGUA 3DU5A 4LSNA 1HYSB 4HACB 4NLOA 2FD2A 4TU9A 4CO2A 4OZJA 4K4YA 4I6AA 1PJ6A 7FD1A 5HBMB 1FDNA 4H4MA 4P75A 4NLUA 3NLCA 4I69A 3W1YC 5H9FK 3AODA 2F1FA 5D0EA 1FT8A 3QRQA 1J5OA 2LKZA 1U1NA 5K8NA 1RT1B 2P6TA 4B9MA 2RT3A 1GTEA 4QIFA 5E3CA 3KFWX 2IA0A 2RMLA 3OLAA 4LSLB 3AA9A 3KUGA 2QA4S 1N36J 4RZRA 2ZH9A 5L38A 3HHLA 5DZ7A 1EETB 3TA0A 3ZZRA 4PXDA 1CJVB 1UPMB 3BSCA 2LA4A 1T9UA 2B4OA 2GV1A 5LMUJ 2NR0A 2Z2YB 3DKDA 3Q8SB 4LMZA 1T94A 1WOOA 4J9RA 4BWMA 2IBOA 2Y1LB 4JI7J 2E5IA 3PFEA 2C2KB 3DRSA 5E5NA 3W2WB 3UD3P 3Q86A 1U6ZA 4FDFA 2ZOFA 2F65A 2DO0A 3GU0A 1UMJA 1YITS 2QRRA 1TZ0A 1D9FA 2H51B 1S1WB 3EZUA 3CPWR 3TVKA 1RKJA 1HNWJ 3G4SS 3R97A 2WSFC 2KU7A 4L76A 3ITHB 1H98A 2JEFA 4RW9A 4ZKAA 1RCXB 4O4RA 3FMBA 3GZ7A 4PKDB 1LFPA 2AGQA 1QAIA 1U0HB 3IR6B 3UN5A 2HVZA 1E6YA 2ZH8A 2VBWA 4UZBA 3QWPA 4G6VB 3M30B 4N76A 2W2MP 3V6HA 4JV5J 4B3SF 1IKXB 5I42B 4ENOA 2Z0GA 3UD4P 3OD2A 3T1AA 1KC8T 1MMNA 3GQCA 2C3MA 5ETRA 5EGYA 4NLGA 2C1EB 3NG8A 2B51A 3M32A 1FA0A 2ACYA 4JI6J 1U6FA 1S59A 4ZP6A 3ENWA 3ZNJ1 1G2EA 2O67A 3R5BA 5ETPA 7FDRA 2CJQA 4C97A 1JJ4A 2YVSA 3MCOA 2XZDB 4C98A 4ZVHA 3CXCR 2MHEA 4FXDA 3OPKA 4UQTA 3IRXB 2BX6A 3QYYA 5T7LB 4ES3A 2K06A 4NLTA 4YDDB 3T1HF 5DG8A 4ZVUB 2VG7A 3DXBA 1S48A 1K0VA 1RCOB 4HVZA 4C8OA 1UJ4A 1KQSR 3NAIA 3GR1A 3BBCA 5D3GB 4ZPDA 1U7LA 3CCMS 3UCUP 1RTDA 4A48A 3FK4A 3K5PA 4DCOB 1S4FA 1QAJA 2HLUA 2HWIA 3HZGA 1BWVA 1Q16B 2V8GA 3PX4A 4I67A 4F2SA 3V81A 3MM9B 3EPIA 1NJZA 1HD1A 4QCLA 3B82A 2VOPA 1KOHA 1YK9A 2BV3A 1FTRA 1YHQS 4NMLA 4O4GB 5GADU 2RAQA 4UUWA 2HVIA 1VC0A 3P8BB 3V6DB 2JLEA 3PW2A 4DX8H 3OUYA 5JVGQ 3LH2S 3T5HA 1UWBB 3BO2A 4N8OA 5LJ3Y 2NZ4A 3CJTA 3DRRA 4NZ0A 1X9WA 1S6PB 4DV7F 1ZTWA 1SC3B 1H3DA 1S1UA 4IO1A 4OHVA 3CDWA 3DM2A 3MCSA 1Q53A 5IT9U 1URRA 5D4NA 2IYGA 3IM9A 2E44A 4KY3A 3N6LA 4LIRA 1SIWB 3IFEA 5AE2A 4K5RA 2B9WA 3MAAB 1KR4A 1IWGA 2LLZA 3NS7B 1OY6A 2IVMA 2JRSA 3PKYA 1UZDA 2SXLA 2FLOA 4OQJA 4DR3F 5E2QA 1HBMB 2WBRA 3ZTPA 4NCGB 2FQQB 2DGUA 4OYOA 4EK2A 4TNOA 4CLSA 3S1TA 2GGPA 2QGFB 2C2DA 5J2QB 5B0AA 4ZPVR 2KN4A 5FLXY 5IOLA 1UL3A 2BW7A 3BR9A 1FVQA 2BJ1A 5KG0A 2QN6B 2M52A 1EJ7L 2HS3A 1NMEB 1X9MA 1TV6B 3RBEA 2FC9A 1RT4B 4TY8B 2F63A 3K5MA 4F50A 3ILJA 3WX8A 3DOKB 4JI2F 4RUHA 4JV2A 2AMCB 3M6VA 3TUPA 4JI5J 5IS2A 1NO8A 4FF3A 1NBEB 3QBCA 2XYHB 5KFNA 5J2NB 5B0GA 5KT3A 1HI8A 1E6VB 1B0PA 4USKA 1R27B 1WORA 1BUXA 2FVQA 1FKPA 3AB2B 4U7UK 1OO0B 4F0MA 4FYDA 1LFWA 3H59A 2VL1A 2UU9F 4Y6IA 4QYZK 4DR7F 3MMJA 1HD0A 5KFZA 4OLPA 3M2VB 3L09A 3GJSB 1J2VA 1H2VZ 2FHJD 4TQRA 5KG2A 1Q7YT 1NU4A 3I5BA 4B3TJ 2DNZA 4NYZA 4HEA9 2ZVIA 3JTOA 4L3KA 2OJ3A 5KT2A 4OYZA 5EWEA 3BV8A 3BKUA 4PRFA 2QL5B 5K14B 4MKBA 3QSIA 2C2OB 2MMYA 4QIVA 1RB0A 2FY8A 2AT1B 2ZFHA 1UVMA 2AHOB 4ETXA 5KT4A 2GJFA 3TJ8A 3FFIB 1PCAA 3VTIA 1M5VC 4CCHA 1DQAA 3M9NB 4FS1A 3N0VA 1FRIA 2UUBF 2ASDA 1S6QB 2CPZA 2UUCJ 1HPZB 2PD1A 3RZAA 4C8ZA 1TFYA 5DO2A 5CD4H 5HMYA 4JI4J 4GRSA 1HR0J 2ADBA 4X64F 1WC0A 3W8GA 2CQHA 1QE1A 3SQOP 4PG6A 1QAYA 1RDRA 4KFBA 5HROB 2DNRA 4BCAA 4IRDA 4GVBB 4PQAA 4GMKA 4IOAQ 2EWHA 2GMHA 2JC1A 1G6BA 5D15A 4N8NA 3RBDA 3KLHB 4KHRA 1FKOA 1IKVA 2EFNA 4RJVA 3CCQS 1FESA 2EFQA 1JXLA 2MGZA 2KZMA 3OR1A 3MTKA 2B8PA 2I8EA 2FHOB 3C3LA 5D78A 3HT0A 1UVJA 1N52B 3H25A 3RAXA 3MMCB 4ATNA 4KE5A 2OPSA 4L72B 2GA7A 2EK6A 4IUFA 2E1PA 3E8OA 1JLBA 1N0UA 2C2EA 3MEDB 1X31C 2W9BB 4DDFA 4KKOB 2FPHX 4B3RJ 5DZ6A 3D7SB 1TL1A 2DTJA 3GFXA 4ZVPB 3UVJA 5F8GA 1FX4A 3PX6A 2H5JB 2J5AA 1S1XA 2XHWA 5LMNJ 4UOCA 2IJFA 1SC6A 4M94A 1MMDA 2NXCA 1N32F 1HHTP 2DNQA 2MZJA 2L08A 3EZ5A 4NA3A 4KH0B 2CG4A 4CLUA 1NK5A 1UKUA 2JEGA 1TKTB 4Z7YA 2OTJS 1UVIA 4DU8A 1U8SA 2WK4A 1JLFB 3OL6A 3HVRA 3PJXA 2LEAA 1YLXA 5E3QA 4EZ6A 4ECTA 1HBOA 4YDXA 1NDCA 4QJVA 1FEHA 2HS0A 2RH3A 3I82A 3O8WA 1CG2A 4KQZA 3CC4S 3T1YJ 2I9SA 4DMZA 1UEKA 2GO9A 1UA0A 3K0JA 3IGVA 1UTAA 2X1GA 2VKZG 4F04B 1YG0A 4ED7A 2GIQA 2ZC3A 1TFWA 3BSOA 3OXGA 4QW8A 4Y2IA 1HWIA 3IXQA 2CJYB 4XDCA 3VGUA 3M8QB 2HHSA 3EDQB 2ZH3A 4ZOSA 2HRYA 4ZVSB 4I6YA 2D3UA 3CJQA 3OVAA 1XMBA 5DQHA 2D74B 3BKTA 4ZLLA 5KG6A 2JFDA 2UXCJ 4ECWA 2N82B 2AQ4A 4G1PA 1N4LA 2M88A 4PG7A 4F4XA 2ILZA 2EBGA 4GC6A 2NYIA 5HSPA 4DS4A 2K2PA 1ACMB 2LQ9A 3EGNA 1RTHA 3HFKA 3PNIA 1QSLA 3O44A 5MLCV 2DR7A 4AUKA 1VLOA 4Q0BB 2WTFA 5I3UB 2V8HA 3MZIA 4GKKJ 2QE5A 1GXLA 4K4WA 1R0BG 2MY8A 5LJ5Y 2EKNA 1UJ5A 4GO5X 5F8IA 2CQCA 1WACA 2VJUA 2JVOA 3PM9A 3R2DJ 3KLVA 2JZ5A 1LWFB 1LWCB 3DLEA 5HP1A 3MXHP 4JOUA 4XAKA 3A1YG 1O51A 1B3TA 2C2MB 2IAJB 2OFHX 1R8PA 2ZBQA 5C25A 2MQPA 3KNAA 1U45A 1HQUB 1S99A 3ET6A 3KG4A 4CYUB 4C0BA 3DGPB 2HVHA 2AJ4A 5C2GA 4EU0A 3HFZB 2VG6B 2ZWOA 3BGUA 3RBZA 4P7VA 5MAOA 4DSKA 2WAQD 1SKWA 2FZCB 4WTOB 2QYCA 3JYTB 1DBDA 2YNHA 4WCEQ 3M8PA 3CCWA 4RNFA 3W3SA 2IM2A 3TRGA 4PUOB 4RW7A 4CLYA 4NX9A 2Y8WA 5C5JA 2Z4PA 5DM7Q 1PO6A 2LECA 3T19A 2DRAA 4DL2A 4WF9Q 4M5GA 3D3BJ 4CRJA 3MMBA 3HX9A 4HTIA 3QRPA 2KRBA 3SCJE 3W65A 4PXEA 3HMJG 4H4MB 5HANA 4ZJLA 3RYLA 1SJQA 1RISA 2E66A 2GQQA 4LJMA 4F3QA 4NI2A 2V8DA 3KLGA 1P9YA 5B09A 1J5OB 5L1JA 1SBRA 3TW0A 1WHYA 2KDOA 2HSEB 1NB2A 4MIBA 1T0TV 3JSRA 3GIMA 1NK0A 2ZITA 2OKQA 3BSNA 4ZHRA 3HHDA 1XNRF 4J9MA 4B3MF 2ROPA 2OIHA 1X5PA 3IWLA 2GHPA 2O66A 4IQXA 1G4CA 2DHXA 4X84A 4MIWA 2V63A 1D1UA 3PW4A 2W2OP 2JL9A 1XBWA 3JSBA 3FKBA 1R8HA 2B43A 2UXDJ 2R8HA 3KMSA 4CH1A 3C16A 4ANEA 1RA6A 2PMWA 2DIUA 3FQKA 3U7JA 3IMQJ 3ISNC 3QO9A 4M5KA 1WG1A 3S6EA 1VQ6S 2DH7A 2FZKB 1M5HA 2P9CA 3NGKA 1DLOA 2E5LF 4DSIA 2DR9A 4LFAF 3DRSB 5E7OB 5AXNA 3SV4A 1VR6A 3KHHA 1BD6A 4EZ9A 2BW2A 1J5EF 2X1FA 1MN9A 2HG4A 2HQFA 5EWGA 4XDDA 1ZAVA 1SVDA 4RW9B 5KG4A 2J8AA 1IQZA 1SJRA 1N8RT 3WX4A 1YSJA 4OL8A 4YFUA 1WHXA 3R1LA 3MOZA 3EVWA 1LWXA 3AQOA 3RG6A 2OPPB 4DV6J 3PRBA 3G6XA 2EEYA 4LF5F 2YWFA 4QQBA 1FJCA 1E6YB 1YIJS 4RWXA 5B08A 4CZCA 2XLIA 4U67Q 2WBMA 3LPEA 4B9NA 4CLLA 1QVGR 1S5ZA 2VFVA 4ANCA 2FLNA 4I68A 1TAQA 3M32B 4HDGA 1AZSA 2QLWA 4Q8EA 2J6UA 1ZM3A 1O6XA 5D0GA 3US5A 5L39A 3HKWA 1Q8KA 5KFPA 1S1VB 2OD6A 3OSPA 2B9EA 2J8SA 2YPYA 3KK3A 5KFOA 2FJXA 1JKHA 2EG1A 2UUAJ 3M6WA 2Z2LA 2VG7B 1M1HA 4YHHJ 3CCJS 2D69A 4LR9A 2ZKTA 4PXBA 1VJWA 1JLAA 1RACB 1NK9A 2VASA 1RTDB 3V6JA 2CPJA 3IC1A 2RDIA 2DGXA 5ETOA 1X4GA 3ZZUA 1WEXA 3V81B 1JNZB 5BJRA 3W64A 2OLWA 4QOTA 5KT6A 5CYMA 4CH0S 2KFYA 1XEZA 5KAKA 3KLIA 3FGVA 3CJRA 2V68A 1YJUA 2XGPA 2DNGA 2KJVA 4C11B 2IRYA 2LP4A 4F67A 2L3MA 5D0RA 3F44A 1K8AT 5ETVA 4LRFA 2KYXA 3OUYB 2YY3A 3DI6B 3LGHA 3CJ0A 1SJ4P 1S1UB 3FUYA 1PAEX 3DM2B 4DBQA 5ETSA 4DL6A 2AJ2A 1I5OB 4J91A 4KC5A 3L3CA 3LF0A 3NCPA 4JI7F 3GYXB 1RUSA 2DJWA 5DDRC 1QSSA 3CO0P 1RT6A 2F7VA 4XPEA 2V4RA 1UZHA 3UN3A 5KTQA 1D8ZA 2QYGA 2BOPA 1T11A 1R3NA 2ALZA 2ZBRA 1OY8A 2H65B 1C2PA 5J2MA 4F02A 3DDNA 3THVA 3QJJA 5CABA 5B0CA 2XSJA 1PYOB 3NNCA 2W25A 2ATLA 4ECVA 1S9GA 4RBTA 4H4KA 2HHXA 4M95A 2P9GA 2X51A 4WFXA 3VZHA 2QSWA 3TO8A 2MKIA 4DQQA 3M7VA 5CZXA 4QWBA 2UV8A 5F8NA 5U47A 2Y8YA 3KXDA 4JV5F 4AL5A 2VA3A 3MM7A 2AZ1A 3VAMA 3M2UA 2Y1JA 3K8WA 2EFOA 3EJMA 2ZOMA 2RKIB 4NLQA 4YB7A 1FKPB 2CWXA 2PO4A 4IG3A 3MECA 5KFHA 1VQ8S 2C3OA 3W9JA 2FGOA 2MQNA 1N5QA 2Q43A 1W26A 1HBUA 5F9LA 3K8VA 2VZ9A 2MLYA 2MQMA 4OYIA 5HQLA 2KVQE 4ZLJA 4TYBA 2JH3A 2ZHAA 2GNKA 3PG9A 4LQ9A 1NH8A 3B4MA 3MM5A 2OO4A 1XNQJ 1BQXA 3D3CJ 1TTHB 5AE3A 3KDNA 1LK7A 2AP6A 1KQGB 4WWSA 3GJRB 3O1LA 1YJVA 2CPYA 1Q8BA 3BH6B 2V8PA 4ZJOA 2E1RA 4B17A 1TAUA 1S9EA 1EHWA 3NOGA 2YPZA 3MUMP 4ED8A 2HNZA 1GMUA 2BJEA 2BJ3A 4AL7A 2V34A 3ZO7A 2O3DA 1CVJA 5GVQA 2R7TA 5F9NA 2EKYA 2KT2A 1QE1B 3ZTOA 4N56A 3RB0A 4KFBB 2VPWB 2DNOA 2BABA 2MKCA 4HT7A 3J7ZT 2WVEA 1BE4A 3TR5A 2F9JA 2MYFA 2WVBA 3FRZA 3G71S 1H72C 3JSYA 1ZS6A 3H0PA 4RBVA 3HVAA 4X4SA 1R8BA 3KMQA 1RBOB 3LAMA 1FKOB 1IKVB 4NCAA 2DY1A 1RABB 1JXEA 3E51A 1YJTA 2MKKA 3A8KA 2MGZB 3LW5C 1S1TA 3I9ZA 2YKQA 3OR1B 2XI2A 4CO0A 1KBRA 1X4HA 3BF4A 5DDOC 1WWHA 1IM4A 2FZGB 2OPSB 1D09B 2H5EA 3BGFA 2B56A 3HCXA 1WJ9A 2VOOA 4TXSA 2D1CA 1NRKA 1JLBB 4JB8B 4FXWA 2V50A 2Q6BA 3GE9A 2G0IA 5KFJA 1TL1B 4B3SJ 4WFNQ 3UVJB 3KDOA 1HWUA 4CLKA 4F7VA 3VGSA 2LXIA 2M0GB 4URSA 3AJ2A 2BKNA 1VC6A 3KNGA 4QWCA 3O6QA 1JWWA 4AXJA 2XY7A 4DR4J 2ZWPA 1TR0A 1HBOB 2V2ZA 4CWBA 5JUMA 1X4EA 4R0EA 3KLEA 2JSXA 4ZITA 3VR1A 3JAMU 2V69A 2WVDA 3H90A 3G6VA 3SV3A 2V2KA 1WTFA 3GIIA 1KVIA 2A2CA 1F5CA 3T1HJ 4IFVA 3TOQA 3PW0A 3D54A 3JXOA 1QM9A 4B3TF 4K50A 1F9EB 3ZZTA 2DY9A 4MYTA 4KRWA 3QT8A 3MM8A 3JAMY 1PGZA 2NSCA 4LIWA 3SSRA 2FYXA 3HXMA 1VLYA 4FZVA 2CZ9A 1QY7A 4A8SA 4NMXA 4PZVA 1WOPA 2WOMA 1ZA2B 3T9ZA 1T9VA 2HZCA 3A8JA 4JI8J 1NB7A 1RTHB 2BE2A 3PJ9A 1VQ5S 2PEBA 2UUCF 2M4MA 5HQMA 2JC0A 2NREA 4JI4F 2FJVA 3D0IE 2GS8A 1N5YA 4O3RA 2AJFE 3CC7S 3UFCX 2FJEB 4OI3A 2V9WA 4ZJQA 3I96A 1FWPA 2JEIA 4ZVEA 3DLEB 2DPIA 5HP1B 1GXTA 1JMTA 3KUHA 4ZS6A 1UVLA 4O3PA 4RNHA 3I4HX 4KAIA 4YB1P 4YR3A 2CVEA 4M5IA 4LF6J 2BANA 2MHNA 1JLCA 1QTNB 2CQDA 3AA8A 2YH1A 3FBFA 2GIFA 5C25B 3NWRA 3POTB 5FIIA 1L3UA 3GSIA 3D67A 3KK1A 3T3FA 5KG3A 4M5DA 5AXKA 1C0TA 5HJYA 1UFWA 3FQLA 1B0VA 5EX3A 1VOMA 4ERDA 3ZTSA 2IRXA 2YNHB 3M8PB 3D1HA 3OTDA 1XTZA 2LQ8A 1RBLA 5LXRA 1NPPA 3A13A 2IPOB 2QL9B 1HMVA 5DDQC 2BM1A 5E3PA 2BM0A 4O44A 4B3RF 4MKVA 1U0SA 1RHKB 1AW0A 2ERRA 3KJVA 2FVSA 4IYQA 3NOCA 3MMBB 4PG5A 2J0SD 5D6GA 3P4UB 4CI0B 1RXOB 4ECYA 1K1SA 3CNQP 1RTJA 1P8GA 4IG0A 3RW7A 1RAOA 3KLGB 3WC0A 1F2GA 2EVZA 4A4JA 3BBFA 4WP3A 1PSDA 2ZJPQ 1N6QA 2EI5A 5GAGI 1G7CB 1SJ1A 1FE4A 2D9PA 5EDWA 5DLFA 1GX5A 2R8IA 2AJ0A 2GVZB 4O3OA 3I32A 4K4UA 4DV5J 3GIKA 3T1YF 1S79A 1R0AA 3IBFB 3PYDA 2NPFA 4F4YA 4HKQA 4QR0A 2DGWA 3UQSA 4M8LA 1IUJA 2YQ1A 5HJXA 3UO0A 2P6SA 1RWWB 2MKJA 2CA9A 2MQLA 3MCNA 1OIAA 2ZNYA 2K7JA 1KN6A 4F25A 5BXIA 4RNNA 1EB0A 1L3KA 2CDQA 2HFVA 3CT9A 3QO9B 4H4OA 4DFKA 4DV2J 3GR0A 3WIUA 3VZIA 2Q66A 3EPGA 1N88A 2UXCF 2DCUB 4ZPTR 4RW8A 3CC2S 5CCMA 1YDLA 2IMWP 4CLTA 3D5MA 4MAKA 4RBUA 1O5JA 2B4PA 1VBZA 2MDAA 4Y2KA 4P7TA 3PY8A 4ZP9A 4OZ5A 4N41A 4X4NA 3HM9A 5IM0A 2RS8A 2ZH2A 4X64J 4ZP8A 2CIMA 3SSSA 4Q8FA 3I9V9 1FRXA 4MK8A 2H48B 1FXRA 3AD8C 1H7WA 2BR0A 2NZCA 4WYLA 3M6XA 4QU7A 2R7VA 2NUHA 1ZYQA 1Q0NA 4DOZA 3MEEB 5DRKA 3R2CJ 3MD3A 4PPZA 3UR0A 1F1BB 1NLKL 2CG8A 4EO8A 2F4FA 5KT5A 2F8HA 4DV0J 1AZSB 1WELA 3K58A 1RYRA 4B9VA 1R8AA 2Z56B 1S4EA 2EFGA 1VISA 5L9XA 2H4YB 2YQ0A 2YKNA 1FXDA 1S57A 5KFWA 1RWMB 3HHLC 3BO4A 3KK3B 2D7SA 2IA6A 1C1CA 4DSLA 4DX7A 4NA1A 3Q23A 1MN7A 2MJUA 3D1OA 1OMSA 2HMIA 4ECQA 3NS6A 3V5RA 5A2QU 1JXVA 3SCLE 1JLAB 2MSSA 2I0XA 4ELTA 3DCAA 4OX6A 3W9HA 4HH1A 1X5OA 2B4VA 4EBEA 4YY3J 1BXNA 5AT1B 3H2LA 3D66A 3Q8VA 3JSMA 3RR8A 5A8KA 2Q79A 4LT6A 1YJ9S 2HK2A 3GYNA 1U1KA 2AWZA 3I0SA 1YZ6A 3KLIB 4I2PB 3RU0A 5E3RA 2ZZMA 2HNDA 3AT1B 1IJEB 3PJWA 3V4IA 5E3AA 2ZOGA 2QSFA 3HJVA 1NKCA 2W9AA 3BYRA 4C3LA 4ID8A 2LCWA 3GIJA 4QWAA 2X3GA 2E5HA 1BQMA 2KH9A 4CM0A 4M5HA 1IVZA 2UXDF 2B9YA 2DT9A 3DRXA 3FZ2A 1KD1T 2KFNA 2IIHA 1ZPWX 5SUHA 3T5LA 2G2YA 1B0TA 2AU0A 3BBBA 4F3OA 4KR0B 2QMWA 3G8QA 4CH7A 1U1MA 1RT5A 2ASJA 2D3OR 2PA3A 1RT6B 1FRMA 2WSEC 4W92B 1LXNA 4WZQA 3TVYA 4C7QA 1WKLA 3EUNA 2XO7A 4EFAC 5J2MB 4DX6A 1X8DA 5H9EJ 2DR6A 3C8YA 2AYGA 4NRUA 4LRAA 4LUBA 4MIAA 1RWPB 3W8PA 2J0QD 4OZ0A 2XSJB 3LTOA 3GIRA 3AOBA 4NLPA 3OL9A 1JB0C 5BYRA 4YP3A 4ZLNA 3D0GE 4NA2A 3VVUA 1S9GB 1VQYA 3HO1A 1X0PA 3W60A 3C15A 4FF4A 1SB6A 3S8SA 5L46A 3TAQA 2F3JA 3CMQA 4G1QA 3MM6A 4KB7A 2QX0A 1S0NA 1S6UA 1WC6A 1UAWA 3MM7B 1RWUA 1M5PC 2HFSA 2JHEA 1X9SA 3WZ0A 5T14A 4PPDA 5KFAA 2R2TA 2HFOA 2FC8A 3UCGA 4DLEA 3IAS9 4FF2A 3RB6A 1ZM2A 1UP1A 2XG8A 1TL7A 3V6KA 4J7CA 1A7GE 4IG3B 2XB2D 4L3NA 1V9OA 3MECB 3PIOQ 1LW0A 2F8EX 2VFTA 3CO9A 2G0CA 4RUBA 2HPUA 1XMOJ 1CULA 4K59A 1M90T 4RLEA 2BQRA 2UUAF 4E8UA 3AFGA 3FCVA 4YHHF 4IR9A 4X4QA 4DJBA 2J9CA 3MM5B 2L48A 2LQ5A 3HULA 1PBAA 3HSJA 4DQPA 2FVPA 4X2BA 2XMVA 2BYCA 1YBAA 1IBKF 5T41A 1X4FA 2B7CB 1K1QA 2XZWA 4KTQA 4NL5A 3TYTA 4IDKB 1SQFA 1NPRA 3AJDA 1VK8A 3IO1A 9RUBA 4NXNJ 1RJJA 2DIVA 4QPXA 2PGCA 2I2YA 4IH5A 3QGHA 1S9EB 4N77A 1CQNA 2CWKA 3DLGA 3J7YI 1UJ6A 2HNZB 3M9OB 4JV0A 4ZCMA 4NZ7A 2GMLA 1JJHA 3QT7A 4NE9C 2OH2A 3QAEA 4XO0A 3MTJA 2NYHA 2CNNB 1Q4RA 5K8MA 2CQPA 4DX5A 1B7YB 2FHMA 3J7Z5 3MWBA 3G82A 2R7QA 4DSEA 5GMDA 2KKHA 1HNXF 5HAOA 3Q2SC 5BYQA 4RWWA 2JDJA 5F3ZA 2OI2A 5C24A 3OXLA 2FVCA 4KPCA 3L7UA 3MOJB 3NBPB 2VBYA 2EFVA 4LVNP 3U1LA 1OPIA 2LU2A 1FK9A 1J5EJ 3UR3C 1GK8A 1NDLA 4KPYA 2G4BA 4J9OA 3ICLA 1M1GA 2QFIA 2ZZNA 3BR8A 2YKOA 4LF4J 3CD7A 3CIMA 3VWSA 4MH8A 3TAMA 4Y2CA 4OI4A 3TJAA 2DGVA 5CQGA 2KG0A 5F8HA 5A8WA 2HRUA 3QLHB 1KP6A 3IWXA 1EP4A 1EX8A 1QJHA 3CJSA 2HHPA 2XO6A 1U24A 3MR2A 1NEEA 1U48A 2GAHC 2KB2A 1DY3A 2W4PA 1XMQJ 1RHUB 3R5AA 2ZE2A 3PYFA 4DL7A 2JLGA 4B3OA 3H98A 2GHWA 1NSQA 4XIUA 4A8MP 1U2CA 8RUCA 2R8KA 2UVWA 2OPRA 1SQEA 3IR7B 4F4KA 1N54B 2FHKA 3AAWB 4K2XA 4LR8A 4YOEA 4OI0A 4O23A 1VRTA 4NWBA 2DVIA 3KHLA 3QAUA 2C2NA 3FJ2A 1PG5B 2XMWA 1K9MT 1DFDA 1M0SA 1ROFA 3DLKB 4R0JA 3JQKA 1FFSB 4ZVRB 4XK8C 2H1YA 1TKXA 1UEUA 2DXFA 2GAGC 2IM3A 1GMWA 2V8VA 2XMUA 4WXWA 4J90A 2M5YA 1Q86T 2V5HG 2UZAA 3LP1A 2M7SA 4USMA 2VBZA 4YEAA 3QT5A 3I0RA 1T9XA 1N33F 5ETQA 4QIEA 1XNQF 2XQCA 4NXMF 1PYTA 1U1PA 3MM8B 1X7VA 1AB8A 1CC7A 1DZ5A 4P71A 4EUVA 3T6BA 2ACMA 2N4DA 3MCMA 2RIJA 1RT2A 4ED3A 1T9WA 3TX0A 3Q8RB 1WSRA 4PXCA 4LF1A 2XEXA 3GMGA 4I7FB 1TK5A 4U95A 5HI7A 2Y3YA 4S0MA 1IKWA 3M2RB 1F5BA 3QFHA 3Q8UA 5I4MA 4NLWA 3EVOA 4ER8A 1YQHA 1M5KC 3BEGB 1LEOA 4HHJA 4DFMA 1F9FA 3SI8A 2F4VF 3SDEA 4X4PA 2V94A 2DO4A 2LEBA 1R7IA 1N5YB 4V19J 1TP7A 3EDRB 4WU3A 4TVAB 3OBIA 5HN0A 2G1HA 2R7RA 4NYPA 4RPFA 4WK1A 3NNHA 1S49A 1Z4UA 1OJ4A 1WEZA 4LRDA 4P6QA 1HYSA 1RA7A 3DXSX 5JMNA 4CLWA 1FDDA 3CE8A 2XWYA 3SYZA 2R7XA 1JLCB 1A6LA 5DGBA 2AEFA 3R6LB 4DLGA 4IQMA 3RRHA 5LXYA 1A9NB 1WC4A 1TKZA 2DISA 1MROA 1Q1KA 1WEYA 3N6NA 3KK1B 2PMHA 3WIVA 3MR7A 2K8GA 3GONA 1WHWA 4DL5A 1RLCL 4M5DB 1C0TB 3LP0A 4MTPA 2XTJP 4LSLA 4HLBA 4UZCA 4CO4A 3P6YC 3MPUB 2JNJA 2LVWA 1VS3A 4F0KA 2PFDA 3PHTA 1APSA 3CDBA 2CYYA 1HQ2A 5B0EA 4J5OA 3HHNB 1DTQA 1HMVB 2I1RA 2WONB 2Z2MA 4O44B 5KFKA 4OHYA 4MT1A 2MEWA 2HIQA 3KJVB 3NEKA 2DGSA 2F8MA 1NJYA 2IDEA 4WTYA 2WB1D 1MNEA 4IG0B 4OI2A 2DEIA 3GSDA 2QO3A 2CJ9A 1N0VC 1KQFB 1JLQA 2HBYB 4DR4F 1A0OB 1N6QB 3W66A 1JQGA 1WC5A 2RE1A 1I51B 1SH2A 4LBIA 1S1WA 1WD6A 2HQIA 2KI2A 3ZZOA 2I5JA 3ITHA 2JFKA 3CIZA 3CJ3A 1OYEA 1R0AB 4PWWA 4ZCKA 3VCDA 4ID5A 4DR2J 3Q89A 5KFLA 1FFGB 4OJHA 1QLNA 2MPUA 5CAAA 5SZTA 2FIUA 1KS2A 5A6PA 5F3TA 3DFEA 2IRUA 2YNGB 2W2NP 4DR1J 1NJIT 1RLDA 3H2VE 2DR8A 3M30A 3EX7B 4X65J 3CVKA 4RNMA 1R6YA 5I42A 4H4OB 3JQMA 2HHUA 3ENQA 1ZZNA 1HWLA 5KG5A 3EXYA 5ADZA 1FWKA 3A4TA 4J9KA 4RW8B 5IZHA 2V4QA 1T95A 2M2BA 1VBKA 3OR2A 3ZZZA 3T9NA 4OX9F 4JI8F 4DV1F 4QYRA 4A8XA 4DV3J 3PW7A 1UWAA 4QZVB 1VRQC 4MKYA 4ED0A 2W8LA 4UY85 3EGWB 1XR5A 2GW8A 2ZM6J 4J9NA 4G3IA 5IM0B 1VQOS 2IHR1 2PT0A 1DRZA 2ZD1A 2DEJA 1ZOTA 1H74A 2AD9A 2MJNA 1DTTA 2ZEJA 1L3SA 2YX1A 3CMAS 4DR5J 1N5SA 2IM1A 3Q8YA 2A1BA 3ZZ0A 1IJFB 2YWHA 2BJ8A 1IBLF 1FI4A 4ES2A 1MW7A 2VODA 1R0CB 4I64A 4LF6F 5FLXU 1L5UA 3BPSP 4EI2A 4PWDA 4RU9A 4JBCA 2RUSA 1F3VA 1NHVA 1BQNA 3N5BA 3DMJB 4NRTA 1NNDA 3FSIA 4A46A 3OTOJ 1KOOA 2JWNA 5A6WA 2OMLA 2VDIA 2DNLA 2AKWB 4L75A 4O4GA 5HVFA 5JXSA 2RU3A 1SV5A 2YKNB 2DITA 3EGVA 5ETTA 2HFUA 1UWBA 4F26A 4CLPA 1IKYA 4AL6A 1TQLA 4AD6A 1SC1B 2HMIB 3OVBA 3J7A1 3N01A 1LKZA 4A8OA 1FCAA 2DNKA 5DG7A 2DGTA 3RB4A 1Q79A 3MAAA 1WNEA 2XULA 4LF9J 2HBQB 3J80U 3NP5A 1YJ7A 1NJXA 1YGYA 4TU8A 3JSMB 1KNZA 3M9MB 1ZBTA 3OTBA 5A8KB 2KFZA 4ZVGA 1UVKA 3MMAB 4WPAA 3I0SB 2IC3A 3KG1A 4DUYJ 2IFXA 2E29A 1IM6A 2HNDB 5K20B 2CQ1A 1Y5LB 3V4IB 3LALA 4DV5F 4QIWD 3J80Y 3DC2A 5J2QA 1VIOA 1F0XA 3TQ1A 2HBRB 3S01A 2WSCC 2ADCA 3R27A 1TVRA 3CW2C 2FY1A 1BQMB 1NCLA 1NDPA 4DPWA 5D4OA 1EZZB 5H1SV 2APOA 4IKAA 1VC5A 3R5GA 3K5OA 1RT4A 3RTVA 2AZ3A 4CO3A 4X4RA 2P9EA 3KWMA 5A0YA 4DV2F 1WTBA 4FF1A 2C2ZB 3HVWA 2EK1A 3UE2A 1VDHA 4USJC 4FKXA 5HK4A 3THTA 3AQPA 4CP5A 3HD2A 4AQYJ 1Z2ZA 1FE0A 1PYSB 4FN5A 2HQDA 2OSQA 4FNIA 2WZ1A 2E7WA 3I5AA 5HVHA 3SZ2A 2M8HA 4LF2A 2ZVSA 3HSZA 3SIPB 3C15B 1HW8A 3W61A 2VU5A 4ILMA 5DGAA 2ZBIA 4Y65A 4ZVOB 1CBKA 4WU2A 1M1KT 4O3QA 3WQPA 1QUPA 2XS2A 4WYWA 1X60A 4G1QB 1UA1A 4X62F 3MM6B 4NEYA 3D2WA 3QZ7A 2MKSA 3P96A 5K8OA 3ONQA 5GAGU 3CB4A 2R8JA 3G9CA 3CJ5A 3C2PA 2E9ZA 2QT7A 4DCJB 2U1AA 4DV0F 3PYEA 2HZVA 1M5OC 3P5BP 3RW6A 3FFIA 3LWMA 1TL7B 3R3TA 1VK3A 2ZHOA 1UW9A 2OUGA 1LW2A 2KJWA 3TVZA 4OJ3A 1LW0B 2IJNA 1S6OA 1K44A 3J81U 3GP9A 5KFDA 2ZH6A 3FEXB 1S72S 1CULB 1XQIA 3MFIA 3W5XA 3CULA 1S7HA 4YR0A 3S7RA 4Q44A 3AHPA 1JJCB 2OHDA 3LQVA 5HROA 3AXMA 5IWAJ 4GVBA 3ETOA 4CTAA 3J81Y 4LFBJ 4YY3F 3VGTA 2AF6A 1VHIA 4U8VA 3HF5A 3PXGa 2GFFA 3GCWP 2J7KA 2G13A 2DKOB 1K0TA 2B3TB 3PKMA 1NDKA 3DLGB 1ZAXA 1QUVA 3CCRS 2KHCA 3UCZP 1CS4A 2VV5A 2QLXA 4H4KC 3BB5A 5EN1A 3BDEA 2ASYA 3EMTA 3OVSA 4BC9A 2P2CB 2K1RA 3G2XA 3B4DA 3G82B 3M8RA 3R5DA 5KFGA 3MEDA 1YI2S 2W9BA 2WW8A 4DWIA 1SQGA 3LP2A 1Q81T 2AGPA 4I2QA 4TLQA 2VPYB 1TK8A 1V6HA 5AXLA 5C24B 2RU9A 4C8KA 1P1TA 1F6TA 2CNOB 2NXNA 5CCLA 1H73A 5KG7A 3MR5A 4NLRA 5DDPC 1SKRA 1HQEA 5KFQA 1D8YA 2F5GA 4DL4A 5HMWA 1TUGB 5IQQA 2HEKA 5DM6Q 2DHHA 3TARA 4F4ZA 1KWMA 1VQ7S 3FVYA 4K7QA 1RKIA 4CO1A 1R89A 3O5TB 4B9LA 3E2EA 3TAMB 2VQFJ 2VBXA 4UTGA 2HBZB 4HT5A 5A8WB 1EP4B 3GFZA 2LXUA 1R8CA 2XCAA 4X4TA 3A3NB 1FTCA 2V2QA 1FNXH 1PC4A 1KEKA 1X4DA 4Q43A 2EW9A 5KFMA 2ZE2B 1KFDA 3WHIA 3PCOB 5KFFA 1U26A 3MUTP 1BLUA 4B3OB 3ILOA 2HHHJ 3M4XA 2QA2A 2OPQA 3BKFA 2KO1A 2LFVA 3LUYA 2C22A 2EPIA 1NK6A 4V1Ak 2E9RX 3RB3A 1Q5YA 5HATA 2MKHA 1Y00A 1VRTB 4C3MA 4DG1A 4CT8A 4C0OC 4KO0A 5G0RA 2HFZA 1LQ9A 1HNIA 1P9QC 3H20A 2BE7D 3H2UB 4WP8A 2XC9A 5CD4A
chains in the Genus database with same CATH topology
4JI0J 4LFCJ 4DUZJ 1I94J 1IBLJ 1N32J 1IBKJ 4NEYA 3JAMU 2ZM6J 2UUAJ 4JI7J 2UXCJ 5LMNJ 1XMOJ 4YHHJ 4JI6J 4DV2J 4DV0J 2F4VJ 3T1HJ 2VQFJ 4LF5J 4B3TJ 4DV6J 4DR5J 3W1YC 4PWWA 4DV7J 2VQEJ 4DR2J 4GKJJ 4JI2J 1N34J 1FJGJ 4JI1J 2UXDJ 4KYZA 4K0KJ 4LF9J 1N33J 1HNWJ 1J5EJ 4LF6J 5LM7E 4RJVA 2UXBJ 3J80U 4KHPJ 5IT9U 4JI5J 4NEZA 4AQYJ 4GKKJ 3IMQJ 4DR1J 4B3SJ 5FLXU 4NXMJ 4KY3A 2E5LJ 4DV1J 2HHHJ 4OX9J 4LFAJ 4JI3J 3J81U 4HHUA 4LF4J 3T1YJ 4X65J 4X64J 5AJ3J 2KVQE 4NXNJ 2UUBJ 4DUYJ 3D3BJ 2MEWA 1IBMJ 4DV5J 4V1Ak 3R2DJ 4X62J 1N36J 5A2QU 4DR3J 2MTLA 3OTOJ 4LF8J 1XNQJ 2MQ8A 5BR8J 4JI8J 4LF7J 1HNXJ 2UU9J 2UUCJ 4X66J 3D3CJ 2KL8A 4YY3J 1XMQJ 4JYAJ 5IWAJ 4DR7J 4JV5J 4DV4J 4LFBJ 3J7AN 5LMUJ 4DV3J 4JI4J 1HR0J 4DR4J 1HNZJ 1XNRJ 4B3MJ 4B3RJ 4DR6J 3R2CJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 J;  4LFC J;  4DUZ J;  1I94 J;  1IBL J;  1N32 J;  1IBK J;  4NEY A;  3JAM U;  2ZM6 J;  2UUA J;  4JI7 J;  2UXC J;  5LMN J;  1XMO J;  4YHH J;  4JI6 J;  4DV2 J;  4DV0 J;  2F4V J;  3T1H J;  2VQF J;  4LF5 J;  4B3T J;  4DV6 J;  4DR5 J;  3W1Y C;  4PWW A;  4DV7 J;  2VQE J;  4DR2 J;  4GKJ J;  4JI2 J;  1N34 J;  1FJG J;  4JI1 J;  2UXD J;  4KYZ A;  4K0K J;  4LF9 J;  1N33 J;  1HNW J;  1J5E J;  4LF6 J;  5LM7 E;  4RJV A;  2UXB J;  3J80 U;  4KHP J;  5IT9 U;  4JI5 J;  4NEZ A;  4AQY J;  4GKK J;  3IMQ J;  4DR1 J;  4B3S J;  5FLX U;  4NXM J;  4KY3 A;  2E5L J;  4DV1 J;  2HHH J;  4OX9 J;  4LFA J;  4JI3 J;  3J81 U;  4HHU A;  4LF4 J;  3T1Y J;  4X65 J;  4X64 J;  5AJ3 J;  2KVQ E;  4NXN J;  2UUB J;  4DUY J;  3D3B J;  2MEW A;  1IBM J;  4DV5 J;  4V1A k;  3R2D J;  4X62 J;  1N36 J;  5A2Q U;  4DR3 J;  2MTL A;  3OTO J;  4LF8 J;  1XNQ J;  2MQ8 A;  5BR8 J;  4JI8 J;  4LF7 J;  1HNX J;  2UU9 J;  2UUC J;  4X66 J;  3D3C J;  2KL8 A;  4YY3 J;  1XMQ J;  4JYA J;  5IWA J;  4DR7 J;  4JV5 J;  4DV4 J;  4LFB J;  3J7A N;  5LMU J;  4DV3 J;  4JI4 J;  1HR0 J;  4DR4 J;  1HNZ J;  1XNR J;  4B3M J;  4B3R J;  4DR6 J;  3R2C J; 
#chains in the Genus database with same CATH topology
 1S77 D;  4ZA1 A;  1TKX B;  3H40 A;  2BJ9 A;  4BWJ A;  4KGX B;  2PDA A;  2C3Y A;  3LP1 B;  3QID A;  2R4F A;  1XMO F;  3EXC X;  4PWU A;  4OYM A;  2VPZ B;  2LQJ A;  3GJQ B;  4Q5V A;  3AD9 C;  2BA9 A;  4LSN B;  3HHL D;  2KHD A;  1YBU A;  3DDI A;  1AYE A;  3BPD A;  1SL0 A;  3C14 A;  4ZPC A;  5L8R C;  2MZS A;  1FF2 A;  5KFT A;  2RVJ A;  2XI3 A;  3HI9 A;  1I1G A;  4WIQ A;  4A8W A;  4DPU A;  3CCU S;  1PIE A;  5CZV A;  2B8Q A;  1RT2 B;  1FEE A;  4PG4 A;  2RD5 C;  3B54 A;  1WDD A;  1ZPV A;  3TZY A;  4NXN F;  3ENA A;  1XC9 A;  3KOA A;  1FWL A;  1RWO B;  1IKW B;  2YKA A;  3G86 A;  4CQ1 A;  2EXU A;  4EEY A;  4DN9 A;  1ZTT A;  2GVD A;  1HAR A;  1KHW A;  1RSC A;  1GFW B;  1T9T A;  2R7W A;  2XS5 A;  3Q22 A;  4QPT A;  3N9U C;  2VG6 A;  4C6A A;  4ZK7 M;  1Y9O A;  2QFJ A;  1GEH A;  2AEJ A;  3HHL B;  2AW0 A;  1RAE B;  3TX8 A;  4NCB A;  2NPI A;  2RQ4 A;  5IT4 A;  1VMB A;  1NK4 A;  2Y0B B;  4WII A;  5J2P A;  1Y5I B;  3GG0 A;  2BVZ A;  3THP A;  4LR7 A;  3ILL A;  3K5L A;  2DK2 A;  4ED4 A;  3UW1 A;  3TNV A;  1SUQ A;  3U1N A;  2DGQ A;  3VAJ A;  2MQQ A;  2V67 A;  4C8N A;  3FMW A;  4DSJ A;  2DNP A;  2XSF A;  2DH8 A;  3PRV A;  2LU1 A;  4EMD A;  1TL4 A;  4OZN A;  3NWG A;  2CXE A;  1D9A A;  4HHU A;  4DEZ A;  1TKZ B;  3DHW C;  1MRO B;  4LF4 F;  4ILL A;  3IGN A;  3DLL Q;  3PFO A;  1ZZF A;  2CQG A;  4C8Y A;  3LP0 B;  2GO8 A;  2XCP A;  3IN5 A;  4P2F A;  2E5G A;  3HP6 A;  3IBW A;  4Q7A A;  2R7S A;  1V3Z A;  1XMQ F;  1RQ0 A;  1CJK A;  3SXL A;  3MF5 A;  4RNO A;  4C8L A;  1ZH5 A;  4JI0 J;  3ZC4 A;  2O5D A;  2MZR A;  1JJ2 R;  3NS5 A;  1DTQ B;  2V4J A;  4RL1 A;  4DQS A;  1VGY A;  2HQ3 A;  2AGO A;  1KVK A;  1KTV A;  3CCE S;  5DJB A;  2PI4 A;  1FDA A;  2DXE A;  3H5Y A;  1RWV B;  2GHV C;  1D0E A;  1MML A;  3MPY A;  4P9S A;  3J7Y U;  3W62 A;  1U8W A;  3EGZ A;  5E41 A;  5KG1 A;  1Q5V A;  1CJU A;  3RBX A;  4X4O A;  1JLQ B;  2FJA B;  1RTI A;  1LWE A;  3OHA A;  3ETM A;  2XYP B;  1PIL A;  2E5J A;  2CJA A;  4RW4 A;  1EKS A;  4WKY A;  3DRY A;  4JI1 F;  4EYI B;  1CEZ A;  3FCW A;  2AJ1 A;  4ILR A;  2I5J B;  2A2D A;  2DHS A;  1U47 A;  3IM8 A;  2HWT A;  2FDN A;  4N5S A;  1NHU A;  1NM2 A;  4L73 A;  4ID5 B;  2YQ3 A;  4DV4 J;  4DU7 A;  2HQC A;  3R7B B;  2OPP A;  4WFB Q;  3D6F B;  3E3X A;  2B0G A;  9ATC B;  1YVF A;  3V2U C;  1IBK J;  2RRN A;  4FP9 A;  5A76 A;  3L7P A;  3ZZP A;  2COL A;  4KGM A;  3CTR A;  1NAQ A;  5KFU A;  1IXK A;  2PFF B;  2R7U A;  2HK3 A;  4UOF A;  2CQI A;  4ITS A;  4ICL A;  4FKY A;  1T03 A;  4HI1 A;  2XLK A;  1F3F A;  3TA2 A;  3OR2 B;  4WFZ A;  1NK8 A;  3A8E A;  4IO9 Q;  3C19 A;  2JJ4 D;  1U2R A;  1S1V A;  3K7R A;  3JTP A;  2N3O A;  3DRR B;  2HAI A;  2W01 A;  2L41 A;  3I6P A;  2W9C A;  2B9X A;  1C4C A;  2XMK A;  2ZD1 B;  4Q45 A;  3RUB L;  2CAJ A;  2QV6 A;  2CZ4 A;  3D9B A;  2C28 A;  1NKE A;  2ZH4 A;  3FEZ A;  1DTT B;  2JOQ A;  3U27 A;  2BKP A;  2IDL A;  2CNK B;  2M70 A;  1HNX J;  4ED2 A;  4PAA A;  3ZXW A;  1KTQ A;  3MPW A;  4Y0F A;  4OLO A;  4IOB A;  1EAR A;  2VDH A;  2D3Z A;  3W2V A;  2N4C A;  3FSY A;  2CUY A;  4Q2M A;  4PWD B;  2VIC A;  2ZHB A;  4FNH A;  4AT1 B;  1KHV A;  4U96 A;  4HHH A;  4LF7 F;  2ROE A;  1BQN B;  1RTZ A;  4Y28 C;  1UVN A;  3HVT A;  3A3O B;  2GGP B;  3IP0 A;  3X3U A;  3W9I A;  4DUZ F;  4C11 A;  4NLV A;  1ZAW A;  5A8R A;  1DJ0 A;  2G9O A;  3T6J A;  2HIY A;  2RQM A;  4IRC A;  2UXB J;  4J9L A;  1SV5 B;  3P3D A;  1L3T A;  2W2Q P;  4OIX A;  4KGV B;  3KTQ A;  4RW6 A;  1S0O A;  1KKH A;  3BQ2 A;  3DI6 A;  4QWD A;  1IKY B;  1R43 A;  1SJ3 P;  1XK8 A;  5G4D A;  1RWK B;  1HKA A;  1YZ7 A;  1NJW A;  3PX0 A;  4U9R A;  3CDE A;  5ETK A;  3BZQ A;  2X1B A;  4LF8 J;  1EQ0 A;  2FJD B;  4IH6 A;  2XMM A;  3I55 S;  4A8Y A;  1ARO P;  1Y5N B;  1ITP A;  1FO1 A;  4EBD A;  1JK9 B;  5IC4 B;  3L4B C;  2ABY A;  4M63 A;  1WC3 A;  1FVS A;  5EX0 A;  2HNY A;  5IT9 Y;  5E0O A;  4FS2 A;  3VGV A;  2IYI A;  2IC3 B;  4BC7 A;  3L95 X;  3CSK A;  4CLF A;  1JLG A;  2H9Z A;  2CQB A;  3NGR A;  4FYV B;  3HZE A;  4MK7 A;  4GKJ J;  2K7K A;  4F3M A;  2OFG X;  1N33 J;  2BMB A;  4DR2 F;  1TVR B;  1S7I A;  2YNF A;  5H9E K;  4LVO P;  3I4P A;  4CT9 A;  4NXM J;  2NQP A;  2RQK A;  3DYA A;  2IBK A;  2HFN A;  4DR1 F;  3OQ2 A;  3B78 A;  2Y0S D;  2FJB B;  4X65 F;  1F9H A;  4C48 A;  1AT1 B;  5A0Y B;  1UEV A;  1HLW A;  3KK2 A;  3H4B A;  1VQ9 S;  3KG0 A;  5IFM A;  2HKE A;  4J9U E;  1DUR A;  2KL8 A;  2J9D A;  3BS9 A;  3OFF A;  1C0U A;  1X5S A;  4BHQ A;  1WG4 A;  2DD8 S;  2XNQ A;  2DYA A;  3UDC A;  3VAG A;  2RKI A;  4J9S A;  3C46 A;  4PG8 A;  4DV3 F;  4GVL A;  1DAR A;  1HWJ A;  3RR7 A;  3OJU A;  2KXH A;  3HSG A;  2ZM6 F;  2F4V J;  2RSQ A;  3BYP A;  5GME A;  3Q8P B;  3M1V A;  4ES1 A;  3CJ4 A;  4LRE A;  4LBP A;  5GAE I;  3BN4 A;  3F0N A;  4DPY A;  2CNL B;  4DR5 F;  4M5N A;  1CC8 A;  1VQM S;  3EYZ A;  3PO5 A;  1LNQ A;  3NNA A;  1FER A;  2MY7 A;  3FBE A;  1ZM4 A;  1FRH A;  1KDN A;  2GMJ A;  3I56 S;  3RRG A;  6FDR A;  2MLZ A;  1ELO A;  2UVR A;  1B7F A;  5IV3 A;  2HHT A;  3OFG A;  4O0I A;  3QGI A;  4RUA A;  3OTE A;  3AY0 A;  4J9V A;  4C2M A;  3OTO F;  1RAG B;  3O3L A;  2Q3P A;  5JVH Q;  3HK2 A;  3N4W A;  1LW2 B;  4URQ U;  3M8S A;  1DHM A;  2DH9 A;  3AOA A;  3PRD A;  2RDJ A;  2RHS B;  2NUU G;  4CNY A;  3AD7 C;  1B64 A;  1REV A;  3J81 j;  4ZP7 A;  2MKY A;  4WJB A;  4X66 F;  1X4C A;  1JNR B;  5AXM A;  4ZIW A;  1H7X A;  4F4W A;  3VV2 B;  3LOU A;  1P1L A;  2R2R A;  1S1X B;  2CKW A;  2DNN A;  2E1A A;  4CTA B;  3C6U A;  4I4B A;  2PI5 A;  1OSC A;  4LF9 F;  3ULH A;  5HQ8 A;  4QIG A;  4WK3 A;  3N6M A;  1YRU A;  3IR5 B;  4K4Z A;  2HHW A;  1UFL A;  1VBY A;  1CLF A;  2NXU A;  8AT1 B;  1S76 D;  3FDS A;  2UV8 G;  5HMZ A;  5F8M A;  5CH7 B;  3UDV A;  2V9K A;  4DUY F;  2EFP A;  2AJQ A;  3VAH A;  3R5C A;  3Q8Q B;  1KVJ A;  2AX1 A;  2R8G A;  3CJK A;  1CS4 B;  2H54 B;  3G6E S;  4UF4 A;  5KFB A;  5EHH A;  4K4S A;  4DPX A;  2BUN A;  2FGC A;  2X7I A;  3DNC A;  3MAH A;  1I94 J;  1Y3J A;  3HPO A;  1TUW A;  2K1R B;  4ZPA A;  2GX8 A;  1YRT A;  3QT6 A;  2YH0 A;  3M6U A;  4A8K A;  4NLD A;  4DQR A;  3MFH A;  3LP2 B;  4I2Q B;  5F0W A;  4KGK A;  5J1N A;  1Q7L B;  4M5M A;  2HZA A;  1YWX A;  2W4C A;  1Y10 A;  3BJY A;  5ETN A;  4DF4 A;  5M2R A;  3C66 A;  1HQE B;  2B6A A;  1O8B A;  4OV6 A;  2H5I B;  4OX9 J;  4GC7 A;  4DV1 J;  1S9F A;  4PYD A;  2I6W A;  4BLG A;  4TY9 A;  2WRM A;  2MZQ A;  4AQY F;  3SQG A;  1CQM A;  3P49 B;  2VH7 A;  1VQP S;  4ECR A;  4M5L A;  1EKR A;  4C3K A;  2OEL A;  3JTN A;  3ZTQ A;  3P45 B;  4USI A;  3KHG A;  4MK9 A;  3K57 A;  4FYW B;  2OEJ A;  3PTW A;  1KLM A;  3G8S A;  4Y2M A;  2YX4 A;  2A6M A;  2VUG A;  2W2P P;  4TYA A;  1C1B A;  4KV8 A;  2FB0 A;  4MKA A;  1U09 A;  1IBL J;  4WE1 A;  3BGL A;  3IG1 A;  1HI1 A;  2BZ2 A;  3TA1 A;  4K8R A;  2OEM A;  1IR2 A;  2OPQ B;  6AT1 B;  1OWX A;  3SCK E;  1U1R A;  2VG5 A;  4OYX A;  1SKU B;  5RUB A;  3R1H A;  2ZUG A;  3IRW P;  4DG1 B;  3GTY X;  2VQE J;  3ET6 B;  4O3N A;  2CDR B;  4KO0 B;  2HHV A;  5G0R B;  1M5S A;  1VQS A;  1HNI B;  1RAJ A;  1U1Q A;  1RAA B;  2Y1I A;  3AXK A;  1PC5 A;  4TU7 A;  1S97 A;  4W90 B;  2RF2 A;  1VQ4 S;  5C7P A;  1VRU A;  4DFJ A;  2PN6 A;  3ZNU A;  4ED5 A;  4I6W A;  2MQO A;  4RW7 B;  3QGP A;  3NGD A;  1FXL A;  3GJT B;  2G2O A;  2MTL A;  5HMX A;  5BYS A;  3OLB A;  1WF2 A;  5H9F J;  3M8Y A;  4JYA J;  4Y34 A;  3D4J A;  1W2I A;  4UOH A;  2OMO A;  4NYO A;  3ZFV A;  2FLL A;  5IWA F;  3C14 B;  2VA2 A;  4LFB F;  2QTW A;  4N47 A;  4J9P A;  2C2R A;  2VPX B;  1WI6 A;  3UNY A;  4UW2 A;  3NAH A;  2FLP A;  1RAD B;  4NI2 B;  3W5Z A;  3CGI A;  1O0P A;  2KM8 B;  1WOS A;  4D3G A;  2HUR A;  4USW A;  1FRK A;  2GCF A;  4ZHR B;  3IS9 A;  3VF0 B;  2JX2 A;  3POT A;  4DCP B;  4KH1 B;  4LFC F;  4MJK A;  1V5I B;  5KFY A;  2B5J A;  2GVD B;  2KZZ A;  5LSO A;  3AJ1 A;  4GO7 X;  4AFF A;  2J7U A;  3DLJ A;  3EIC A;  2HVE A;  2YWE A;  1K47 A;  5HLF A;  2O1P A;  3PR5 B;  3UDL A;  4DXL A;  2A18 A;  1W25 A;  1YRX A;  1QAX A;  3C16 B;  5J2P B;  2FVR A;  4FBT A;  2HGL A;  4RO0 A;  3ZZY A;  2ZBP A;  4LRB A;  1NH7 A;  5K5M A;  3TP2 A;  1OSD A;  1SUQ B;  2J9E A;  1LV5 A;  2AYB A;  3OHB A;  3GWC A;  3F73 A;  1DLO B;  1LXJ A;  1AXQ A;  2VON A;  1RWN B;  2D3O 1;  3VQT A;  4ZN3 A;  1XR6 A;  4H54 A;  2FUG 9;  1U02 A;  2HGN A;  2LDI A;  3FBB A;  4OYB A;  1RAH B;  2ZJR Q;  2CPD A;  1L3V A;  2KYZ A;  3PYG A;  2VQF F;  3PZP A;  1HNZ F;  4WFA Q;  5KOX A;  1FJG J;  2PA8 D;  2QZ8 A;  2GVZ A;  2V2V A;  3NMA A;  3PAC A;  3DOM A;  4UY8 T;  4PQU A;  2XMJ A;  4FBU A;  1TL3 A;  2CPF A;  1T3O A;  1CJK B;  3H42 A;  2KXN B;  1XJW B;  2CQ0 A;  1YJW S;  5ETL A;  2V4J B;  4TLR A;  3AOC A;  2HHH F;  5D0H A;  1N5V A;  4X62 J;  3C6T A;  3D6M B;  1N34 F;  2Z57 B;  3LPY A;  4IH7 A;  4JUZ A;  3UI3 A;  2Y9H A;  4U8Y A;  2PSZ A;  2RIL A;  4KGZ B;  5C42 A;  5CHC B;  4R25 A;  1RHR B;  2HAF A;  5D8H B;  4B9T A;  2CPH A;  3B8H A;  1GNK A;  1RAI B;  2WVF A;  1CJU B;  4C0H A;  1RTI B;  1C4A A;  1LWE B;  2J9D E;  2VHG A;  2YWK A;  2XM3 A;  4R8U A;  3HHK A;  4RW4 B;  1JKH B;  2IY5 B;  5KT7 A;  1NZ8 A;  4AE5 A;  3AB4 B;  1SC4 B;  3ZTR A;  1BWE A;  3UNG C;  5BR8 F;  4OZ1 A;  2ATC B;  4TKT A;  1UCN A;  3BH7 B;  1ZA1 B;  4E98 A;  4ECU A;  4KHP J;  3RRK A;  2LMI A;  2XMA A;  3NRB A;  1BGX T;  2BRL A;  3CD6 S;  2ZNZ A;  1HNV A;  1BY9 A;  4HYK A;  5AJ3 J;  4OHX A;  4BDP A;  1KRP A;  3MEE A;  1HA1 A;  4FPR A;  4RKU C;  1U1L A;  4OX8 A;  2KVI A;  3W5Y A;  3FRY A;  2MB0 B;  1QSY A;  5CYM B;  4ICL B;  2RUG A;  1GT8 A;  1SH0 A;  4P52 A;  1SKS A;  2D9O A;  1T03 B;  2FTR A;  2HLT A;  2DR5 A;  5DLG A;  3MI7 X;  4EBC A;  3H5S A;  4KHM A;  1SL1 A;  2QEX S;  1VCT A;  2M3D A;  4DR6 J;  4W4M A;  2X3D A;  5GAH I;  2YNI A;  3T5K A;  3GPA A;  4E0D A;  3G96 A;  3R5J B;  2ASL A;  1R6V A;  5FDL A;  1Y4Z B;  1RZM A;  3U02 A;  1TMJ A;  2W9C B;  1FDB A;  1QTM A;  4Y2A A;  3MHY A;  3FNN A;  1TMM A;  3B6B A;  1IBC B;  4B9U A;  4WZM A;  2RDD A;  1FNM A;  4X4U A;  3ELH A;  3Q0A A;  3MR3 A;  3Q2T C;  5FJ4 A;  3W2V B;  2IVF B;  4KSE B;  2ZDO A;  1NHK L;  3PHE A;  2QMX A;  4W98 A;  1RHQ B;  2BDP A;  4JV1 A;  1Y3K A;  3CF5 Q;  3E01 A;  1Q78 A;  1RHM B;  3HVT B;  2FJW A;  2P5V A;  2AX0 A;  1I6J A;  2CJB A;  4I2P A;  1T3N A;  2CJK A;  3K5N A;  3J7A N;  3LWL A;  5EUH A;  5A8R B;  1TU0 B;  2WB4 A;  1PBU A;  1NSA A;  5K9F A;  3QAT A;  3GV5 B;  5J1E A;  1N36 F;  4RW6 B;  1MSW D;  4JI0 F;  2L9N A;  1QVF R;  1RP5 A;  3NCR A;  2GJI A;  4J9Q A;  3L7O A;  3LA0 A;  3KLF A;  2YBV A;  4QU6 A;  4I0W A;  3NXZ A;  3BGO P;  3I31 A;  5LMU F;  3R7S B;  2YKM A;  1H38 A;  1B99 A;  3ENV A;  2H4W B;  3OFE A;  2QA1 A;  2WHO A;  3M2U B;  2KRR A;  2N7Y A;  1NUE A;  4K0K J;  4ZDN A;  3PR4 A;  2G1D A;  2GZO A;  1F60 B;  4QYZ J;  3OL8 A;  3BN7 A;  1RI7 A;  4OYP A;  1RU1 A;  2VKR A;  4P2X A;  3QFW A;  5LL6 d;  2HNY B;  4F0H A;  3CCS S;  1DQ9 A;  1IBM J;  5ETM A;  3O2I A;  4DZD A;  1HBU B;  1HNW F;  3VQS A;  1SPB P;  5DS7 A;  1VQL S;  3BQ1 A;  1JLG B;  3MEG A;  3CED A;  2DRD A;  2B7B B;  3PVX A;  4MFB A;  3T41 A;  5I3Q A;  2BBE A;  1HBN A;  2KT5 A;  3PIP Q;  4PEO A;  2YNF B;  3UDE A;  2RS2 A;  4DV4 F;  1IR1 A;  1H2T Z;  4KIA A;  2WW4 A;  4QW9 A;  1VI7 A;  3QNW B;  4UT4 A;  3R6G B;  2DNY A;  2AEM A;  1G1X A;  2AV5 A;  2ROG A;  2XBP A;  5M2U A;  3DYA B;  2VIH A;  2WVC A;  3RAM A;  1V3R A;  3CD5 A;  3T5J A;  2DNH A;  2KT3 A;  4CIO A;  3QRR A;  2NXJ A;  3KK2 B;  4R5P A;  1WI8 A;  5CYQ A;  3GV8 B;  3RAQ A;  1C0U B;  2BOA A;  1V5V A;  1NSP A;  2OTL S;  4JI6 F;  1WF0 A;  3MUV P;  3TAN A;  3TUI C;  3DU6 A;  1KQK A;  1VBX A;  2RJZ A;  3NGT A;  4NEZ A;  1NSK L;  4JI3 J;  1Y11 A;  3BO3 A;  2NSB A;  3K89 A;  4IFY A;  4YME A;  1RYS A;  3N28 A;  3DDK A;  3NL0 A;  5DET A;  1KLN A;  3DHX A;  3LO3 A;  4XTT A;  2VFS A;  1S10 A;  4ZMM A;  2ZH7 A;  2DPJ A;  1RT7 A;  3M1V B;  2F40 A;  1J27 A;  2R3V A;  2EC2 A;  3JS9 A;  3BGR A;  2HWH A;  1WDT A;  3SCI E;  2E1M C;  2BKO A;  3D28 A;  1CJT A;  2M9K A;  2LYV A;  5THW A;  2HQG A;  1PJ5 A;  3SBM A;  3DOL A;  2ILY A;  4QR2 A;  1TUV A;  2HRT A;  4ECS A;  3MR6 A;  1JX4 A;  3DRP A;  4DL3 A;  1HW9 A;  1JIH A;  1D3W A;  4OJG A;  1HHQ A;  1K73 T;  1WF1 A;  4IDK A;  1KON A;  1RT3 A;  1S1T B;  3CJ8 A;  2Z8Q A;  3Q83 A;  3QMQ A;  5KFI A;  3VAF A;  4F36 A;  1X5T A;  3SFU A;  2LA6 A;  4P73 A;  1CSJ A;  3TZW A;  4HH0 A;  3CCT A;  2CJX B;  2UVU A;  1AFJ A;  2UXB F;  2E7X A;  4P74 A;  3ISZ A;  1DAX A;  3TUJ C;  1REV B;  5IQ6 A;  1VHF A;  1URN A;  4HR2 A;  5J1P A;  1IN0 A;  4LF8 F;  1XR7 A;  2K3I A;  3UD5 A;  2BJD A;  3GV7 B;  4LRC A;  3C6U B;  1S0M A;  3DLH A;  3OW2 R;  2R2U A;  3NBP A;  1WHV A;  1OS5 A;  2RHQ B;  1HIY A;  4B9S A;  3TEG A;  3HKZ D;  3KKF A;  4P2S A;  1Z1Z A;  5KOW A;  1PJ7 A;  4OZ3 A;  2XY5 A;  1MU2 A;  3KLE B;  2R9L A;  2UUT A;  4FXV A;  2NCK L;  4JI1 J;  2XZT B;  3CJK B;  4GKJ F;  3QLH A;  5DQG A;  3WC2 A;  7AT1 B;  2DHG A;  4RR5 A;  1VQK S;  2I38 A;  4IFV B;  4DUT A;  5GAD I;  3FC9 A;  1T05 A;  3SEO A;  4TQS A;  4ZLP A;  1T8E A;  3CUN A;  4PAB A;  1JLE A;  1U1O A;  4Z37 A;  3QIP A;  5CYJ A;  2UVV A;  2PEH A;  1P6T A;  2C3U A;  5EWF A;  1PKU A;  3QZ8 A;  4JP8 A;  3OJS A;  1BC6 A;  4J37 A;  2PC6 A;  2QLJ B;  5F0U A;  5B0B A;  3HHE A;  3BQ0 A;  3FEY B;  2BQ3 A;  1LK5 A;  2A0F B;  4JI5 F;  5B7W A;  2RB7 A;  3DN9 A;  2WOM B;  2Z30 B;  4HL9 A;  2B6A B;  4K5S A;  3MD1 A;  2BXJ A;  5IC6 B;  1H6K X;  3TI0 A;  2KXF A;  3DLK A;  2BE2 B;  1F5A A;  2UUW A;  1TEL A;  3SQG B;  2J0W A;  3QPI A;  2DHA A;  4UUX A;  3OTC A;  3LGM A;  3SSQ A;  1WUU A;  1Q82 T;  2W7A A;  3ILI A;  1KLM B;  4WBF A;  4M5J A;  1WG5 A;  3CJ2 A;  3JQJ A;  3PEJ A;  2OGU A;  3NCQ A;  3TQE A;  2MXY A;  1P27 B;  1C1B B;  4KV8 B;  1NPK A;  3WDO A;  1H0H B;  3HLU A;  1UPP A;  1FKA F;  3PEH A;  2XYG B;  4HAC A;  4WE1 B;  1SL2 A;  3IG1 B;  3HD1 A;  1GMV A;  4X4V A;  2ZDP A;  5I3P A;  5HBM A;  4OI1 A;  2BAN B;  1RWX B;  5KFV A;  2VG5 B;  1U6B A;  2HGM A;  5DG9 A;  2UP1 A;  4LF7 J;  3PW5 A;  1OY9 A;  4NLY A;  1RK8 A;  2CRL A;  2F9D A;  4EGL A;  1RT1 A;  3NKY A;  4I7F A;  2QIF A;  5L9N A;  2B4U A;  2MZT A;  2ZKU A;  6FD1 A;  2YX7 A;  3RJM B;  4DUZ J;  3M2R A;  4DPT A;  4CDI A;  3GFH A;  4WXO A;  2LDY A;  2RF2 B;  3IAM 9;  1N5T A;  4YQW A;  1VRU B;  2QLB B;  4IOC Q;  5LT5 A;  5KFE A;  4OFZ A;  1D9D A;  1EET A;  2XS7 A;  2EC0 A;  1CJV A;  3HSD A;  1EAY C;  1HR0 F;  4DV7 J;  3FSX A;  3I87 A;  1EQM A;  1TL5 A;  2OP5 A;  2W7O A;  2DNM A;  2EG2 A;  3TJ9 A;  4OZ2 A;  3MEK A;  5B0F A;  1FJ7 A;  2W7P A;  2GIR A;  2QJ3 A;  2RRA A;  1ICE B;  4I56 A;  1FRL A;  4Z2X A;  4QWE A;  1X4A A;  3W2W A;  1RTJ B;  2W8K A;  1XWL A;  4Q2L A;  5M2P A;  3DGV A;  2N3L A;  4DR3 J;  3EWG A;  3HDS A;  3EZO A;  2DBB A;  4DPO A;  4ED1 A;  3A12 A;  3JB9 k;  4ECX A;  4M1K A;  2CQ4 A;  1FNO A;  3CDU A;  3IS9 B;  1VQN S;  2ZZT A;  5GAE U;  2V6A A;  3KHR A;  4OMF G;  1SJF A;  2B5J B;  4OV1 A;  3KJF B;  4U7C A;  1OYD A;  2NLW A;  2LXF A;  1REG X;  5HLF B;  1I94 F;  2W4D A;  4AXI A;  4YS2 A;  1MWY A;  3TZX A;  1SI9 A;  4G1I A;  1U0H A;  2IMO A;  3GCX P;  5LSL A;  2R42 A;  2YKP A;  2WON A;  3CCV S;  4JI2 J;  4EWT A;  1IKX A;  4MMO A;  4KYZ A;  3CDA A;  1NZA A;  3U1M A;  5LMN F;  4A8F A;  2RRB A;  3MPV A;  5DQI A;  1YBT A;  3N79 A;  5F8J A;  1CPZ A;  4OI6 A;  4CO5 A;  4RX6 A;  4A8Q A;  4E2F B;  2E9T A;  2VJV A;  4UQG A;  2RNE A;  2ZH1 A;  2J0X A;  8ATC B;  1FJE B;  4ETZ A;  2DGO A;  2MQ8 A;  2QA4 G;  4PYA A;  2UU9 J;  4UST A;  2QMU B;  2CPI A;  3IRX A;  4DR7 J;  1VYA A;  5T7L A;  4PQU B;  3DOM B;  1HWK A;  5IXU A;  2VC0 A;  4U7U D;  1TL3 B;  4F2R A;  4ZVT B;  4QR1 A;  4CM2 A;  2CQ2 A;  3GB0 A;  3IWN C;  1WKK A;  2E7V A;  5D3G A;  3GG1 A;  4A47 A;  3HJF A;  2YWW A;  2DB1 A;  1FHT A;  1RE1 B;  2YNG A;  3C6T B;  2MST A;  2VB6 A;  2DRB A;  5D77 A;  4DSF A;  2XMT A;  4OHW A;  4DI6 A;  4ZCI A;  3UWT A;  3MM9 A;  5C42 B;  2KM8 C;  3FZB A;  2VQE F;  3H8Y A;  3OSN A;  2BQU A;  5KFR A;  3GLJ A;  1W2B R;  3QSY B;  2J6S A;  4YB6 A;  2X1A A;  1HL6 A;  1UFK A;  3TZZ A;  2JVR A;  1SIZ A;  4KBI A;  2UUB J;  3V6D A;  1QD1 A;  2BRK A;  4R8U B;  3EM1 A;  3VAL A;  1C1C B;  2HW3 A;  2J6T A;  3OV7 A;  2R7O A;  1N48 A;  4X66 J;  2G0J A;  5L1K A;  1S6P A;  5HVG A;  4GKK F;  5D4P A;  2V0N A;  1RGV A;  4NLS A;  4RU2 A;  2YXL A;  4JYA F;  2QL7 B;  1OPZ A;  4OZL A;  5CXT A;  3PO4 A;  1AUD A;  1NK7 A;  1VFJ A;  4OJ1 A;  3NMR A;  4B08 A;  3TUZ C;  1HNV B;  3VVT A;  5KFC A;  3MUR P;  4FYX B;  1NKB A;  3P5T L;  3KYL A;  3M8Z A;  1HBM A;  1YKW A;  4NCG A;  3K59 A;  3K17 A;  3DMJ A;  3D1Q A;  3D6H B;  1ZM9 A;  3BDP A;  2DXD A;  2VF3 A;  2G2Z A;  2YNI B;  2ALY B;  2PMZ D;  3I5C A;  2MZ1 A;  2AYE A;  2YTC A;  2CQ3 A;  2OD4 A;  4YN3 B;  1ULR A;  3NGS A;  5FDL B;  2DCL A;  5L1I A;  4DL0 C;  2BAC A;  1TV6 A;  2GJ2 A;  3A8I A;  4TY8 A;  1FRJ A;  2OAU A;  1G3O A;  3DOK A;  3M8W A;  2L9D A;  4TN2 A;  4P2M A;  2K3K A;  3CCZ A;  2IVY A;  4ZVQ B;  3BM7 A;  2VC1 A;  3CWJ A;  1RT5 B;  3EVM A;  4O3S A;  2XY6 A;  1N32 J;  2CVI A;  1NXI A;  4G65 A;  5J2N A;  3D68 A;  4O0N A;  3HT3 A;  1E6V A;  4NLX A;  4OYW A;  5E33 A;  2J76 E;  3QJL A;  5IT0 A;  3VHQ A;  3R7N B;  2IJR A;  1X4B A;  3MGJ A;  3E01 B;  1YJR A;  5HL7 Q;  2A10 A;  5GMK a;  4F4A A;  5A2Q Y;  1YTY A;  4Y3C A;  2A3J A;  2ZH5 A;  4QBU A;  3MMA A;  3KJN B;  2EBE A;  3CCL S;  5L1L A;  2P8I A;  4LQ3 A;  1DQ8 A;  5K8P A;  5LM7 E;  5F41 A;  3W63 A;  1FJG F;  1RBA A;  4NAS A;  1AFI A;  1MWZ A;  3M2V A;  3QQC D;  3UPF A;  5J1E B;  2ZC4 A;  1B70 B;  2C3P A;  4IRK A;  2E1C A;  2ZJQ Q;  4F8R A;  4AND A;  3F41 A;  2POK A;  3KLF B;  1RAF B;  2XHC A;  3TEH B;  5K14 A;  2YKM B;  4ZCL A;  3V4M A;  1HI0 P;  1T9Y A;  5LSR A;  1XIQ A;  4NOH A;  2Q1L A;  1KFS A;  1Y7P A;  3SMZ A;  1N56 A;  3L9Z A;  1FX2 A;  4PCQ A;  2AIR B;  1BMQ B;  1IQT A;  2CZV C;  2Q6C A;  1YX2 A;  3Q24 A;  1QDU B;  2HS4 A;  2VFU A;  1Q8L A;  4P10 A;  5IV4 A;  1S6Q A;  1HPZ A;  1AA1 B;  2FHJ A;  1GQE A;  2MLX A;  1S0V A;  1IWA A;  4K4X A;  2O01 C;  1AUS L;  1Z2L A;  3MEG B;  4OHZ A;  1GH8 A;  4USV A;  2IM0 A;  2QLF B;  4MFB B;  3QGG A;  1HBN B;  3ADA C;  1R31 A;  4WP9 A;  3EE3 A;  4K4T A;  3F56 A;  1Q8I A;  4KHP F;  4OYA A;  3FBC A;  4DV6 F;  4YR2 A;  1WSV A;  4XPC A;  4DN0 A;  2GC8 A;  1T7P A;  5D4L A;  2KTQ A;  4ZN1 A;  4YUD A;  5AJ3 F;  3TAP A;  4ZVF A;  1U4B A;  3NY0 A;  2PE8 A;  2VFR A;  2HYI B;  4USU A;  3KLH A;  4ED6 A;  2VD3 A;  4D3H A;  1VIX A;  4R5P B;  5CYQ B;  3R8Y A;  5HO4 A;  1RHJ B;  3G8T A;  4CLZ A;  2L9W A;  3OT9 A;  2AYM A;  2D41 A;  4K2J A;  5B0D A;  4DZ6 A;  2H3E B;  4LFC J;  1SH3 A;  4USH A;  1FFW B;  4DR6 F;  2QG9 B;  4V19 X;  2U2F A;  4B02 A;  1B4S A;  4IFY B;  5C2C A;  4MYU A;  2CAD A;  1PAU B;  3MMC A;  5FD1 A;  3BRE A;  1OQ6 A;  5AE1 A;  2CFX A;  1FD2 A;  3H7H B;  5KFX A;  3D6T B;  4Y00 A;  4BBY A;  2HHQ A;  1RT7 B;  1LOU A;  2W1B A;  1MLA A;  3K2Y A;  5F8L A;  3BGR B;  4URG A;  2BJ7 A;  4YB5 A;  4KKO A;  3WBZ A;  4WFY A;  1CJT B;  1YJN S;  4KT0 C;  1RU2 A;  1VJQ A;  3MDF A;  2N7C A;  2BE9 B;  4C9D A;  1KSP A;  3GFY A;  4FVC A;  3DOL B;  5CA5 A;  3GIL A;  3A3P B;  4UOG A;  1GX6 A;  3H5U A;  3RGI A;  3H5X A;  3HFV A;  4EO6 A;  1UET A;  3R9L A;  3UN2 A;  3DRP B;  1FK9 B;  4OX7 A;  1I3O B;  1WC1 A;  4I1T A;  5LOQ A;  4L6V 3;  3PV8 A;  1TKT A;  2W24 A;  1GTH A;  1HFE L;  3IBC B;  1JLF A;  4BS2 A;  2Z2Z A;  2CPX A;  4HTJ A;  4FPI A;  3OL7 A;  1RT3 B;  3SFG A;  2NXE A;  5ITH A;  1U2F A;  1HNZ J;  2ZBC A;  1Y0H A;  1XNR J;  4B3M J;  1GXU A;  1SCJ B;  3OXF A;  3AH6 A;  1MWQ A;  2ZUA A;  1T02 A;  4P72 A;  2JLF A;  1GMW D;  4ZIV A;  1U49 A;  2QC3 A;  2CPE A;  1Q95 G;  1BHN A;  1GAO A;  2YWG A;  1FD8 A;  1F2H A;  2HVD A;  4NZ6 A;  3TWZ A;  2XLJ A;  2XNR A;  1U25 A;  3CD0 A;  2OSR A;  4DQI A;  2JEJ A;  3M05 A;  2LEP A;  1N34 J;  2OPR B;  3QWU A;  4LBH A;  3H4D A;  3M8Q A;  4DS5 A;  4WKR A;  4K0K F;  3PDN A;  2E5L J;  4LFA J;  1MG7 A;  2Y1R I;  4IR1 A;  2RQC A;  3FCH A;  5GAH U;  4ZPB A;  2M8D B;  3ISN D;  1IBM F;  3KUE A;  1MU2 B;  4DFP A;  2A6O A;  4FVM A;  4FYY B;  1IR0 A;  4C4W A;  3DLB A;  4Q0B A;  4RUC A;  1H2U X;  5I3U A;  4LSZ B;  5BR8 J;  3LAN A;  1W7W A;  3I0R B;  4EYH B;  3G87 A;  1T05 B;  1X0F A;  2NS1 B;  2R2S A;  4U6P A;  1XN9 A;  4ZPW R;  4AYB D;  1SXL A;  3GYG A;  1JLE B;  3QIP B;  2OEK A;  2XGQ A;  4LF5 J;  1TKD A;  1LWF A;  1LWC A;  2GQC A;  2C42 A;  4HDH A;  3IA0 A;  4NPO A;  3N5F A;  1XER A;  3QJP A;  1UW4 A;  2WCX A;  4DF8 A;  4Z7C A;  1TK0 A;  2IAJ A;  1ZET A;  4ALZ A;  3LGN A;  3X1L B;  3VAK A;  2PII A;  4ELV A;  4L74 A;  3LAK A;  3MPD A;  1HQU A;  5KFS A;  5JJB A;  1HHS A;  3W7B A;  3OFH A;  4CNZ A;  4CYU A;  1S12 A;  2XWX A;  4JI3 F;  3DGP A;  4ECZ A;  1WKJ A;  4DHV A;  2Z58 B;  2BEF A;  3CME S;  3KJQ B;  3JYT A;  2KG1 A;  4K4V A;  3SDE B;  3MAQ A;  3BSA A;  1OQ3 A;  1V3S A;  4ELU A;  4PR6 A;  4PUO A;  1EIY B;  3D0H E;  3G6Y A;  4HI2 A;  2LQB A;  4C8M A;  2J7W A;  4KJI A;  4N7T A;  3VAI A;  2GQ2 A;  3NGU A;  3DU5 A;  4LSN A;  1HYS B;  4HAC B;  4NLO A;  2FD2 A;  4TU9 A;  4CO2 A;  4OZJ A;  4K4Y A;  4I6A A;  1PJ6 A;  7FD1 A;  5HBM B;  1FDN A;  4H4M A;  4P75 A;  4NLU A;  3NLC A;  4I69 A;  3W1Y C;  5H9F K;  3AOD A;  2F1F A;  5D0E A;  1FT8 A;  3QRQ A;  1J5O A;  2LKZ A;  1U1N A;  5K8N A;  1RT1 B;  2P6T A;  4B9M A;  2RT3 A;  1GTE A;  4QIF A;  5E3C A;  3KFW X;  2IA0 A;  2RML A;  3OLA A;  4LSL B;  3AA9 A;  3KUG A;  2QA4 S;  1N36 J;  4RZR A;  2ZH9 A;  5L38 A;  3HHL A;  5DZ7 A;  1EET B;  3TA0 A;  3ZZR A;  4PXD A;  1CJV B;  1UPM B;  3BSC A;  2LA4 A;  1T9U A;  2B4O A;  2GV1 A;  5LMU J;  2NR0 A;  2Z2Y B;  3DKD A;  3Q8S B;  4LMZ A;  1T94 A;  1WOO A;  4J9R A;  4BWM A;  2IBO A;  2Y1L B;  4JI7 J;  2E5I A;  3PFE A;  2C2K B;  3DRS A;  5E5N A;  3W2W B;  3UD3 P;  3Q86 A;  1U6Z A;  4FDF A;  2ZOF A;  2F65 A;  2DO0 A;  3GU0 A;  1UMJ A;  1YIT S;  2QRR A;  1TZ0 A;  1D9F A;  2H51 B;  1S1W B;  3EZU A;  3CPW R;  3TVK A;  1RKJ A;  1HNW J;  3G4S S;  3R97 A;  2WSF C;  2KU7 A;  4L76 A;  3ITH B;  1H98 A;  2JEF A;  4RW9 A;  4ZKA A;  1RCX B;  4O4R A;  3FMB A;  3GZ7 A;  4PKD B;  1LFP A;  2AGQ A;  1QAI A;  1U0H B;  3IR6 B;  3UN5 A;  2HVZ A;  1E6Y A;  2ZH8 A;  2VBW A;  4UZB A;  3QWP A;  4G6V B;  3M30 B;  4N76 A;  2W2M P;  3V6H A;  4JV5 J;  4B3S F;  1IKX B;  5I42 B;  4ENO A;  2Z0G A;  3UD4 P;  3OD2 A;  3T1A A;  1KC8 T;  1MMN A;  3GQC A;  2C3M A;  5ETR A;  5EGY A;  4NLG A;  2C1E B;  3NG8 A;  2B51 A;  3M32 A;  1FA0 A;  2ACY A;  4JI6 J;  1U6F A;  1S59 A;  4ZP6 A;  3ENW A;  3ZNJ 1;  1G2E A;  2O67 A;  3R5B A;  5ETP A;  7FDR A;  2CJQ A;  4C97 A;  1JJ4 A;  2YVS A;  3MCO A;  2XZD B;  4C98 A;  4ZVH A;  3CXC R;  2MHE A;  4FXD A;  3OPK A;  4UQT A;  3IRX B;  2BX6 A;  3QYY A;  5T7L B;  4ES3 A;  2K06 A;  4NLT A;  4YDD B;  3T1H F;  5DG8 A;  4ZVU B;  2VG7 A;  3DXB A;  1S48 A;  1K0V A;  1RCO B;  4HVZ A;  4C8O A;  1UJ4 A;  1KQS R;  3NAI A;  3GR1 A;  3BBC A;  5D3G B;  4ZPD A;  1U7L A;  3CCM S;  3UCU P;  1RTD A;  4A48 A;  3FK4 A;  3K5P A;  4DCO B;  1S4F A;  1QAJ A;  2HLU A;  2HWI A;  3HZG A;  1BWV A;  1Q16 B;  2V8G A;  3PX4 A;  4I67 A;  4F2S A;  3V81 A;  3MM9 B;  3EPI A;  1NJZ A;  1HD1 A;  4QCL A;  3B82 A;  2VOP A;  1KOH A;  1YK9 A;  2BV3 A;  1FTR A;  1YHQ S;  4NML A;  4O4G B;  5GAD U;  2RAQ A;  4UUW A;  2HVI A;  1VC0 A;  3P8B B;  3V6D B;  2JLE A;  3PW2 A;  4DX8 H;  3OUY A;  5JVG Q;  3LH2 S;  3T5H A;  1UWB B;  3BO2 A;  4N8O A;  5LJ3 Y;  2NZ4 A;  3CJT A;  3DRR A;  4NZ0 A;  1X9W A;  1S6P B;  4DV7 F;  1ZTW A;  1SC3 B;  1H3D A;  1S1U A;  4IO1 A;  4OHV A;  3CDW A;  3DM2 A;  3MCS A;  1Q53 A;  5IT9 U;  1URR A;  5D4N A;  2IYG A;  3IM9 A;  2E44 A;  4KY3 A;  3N6L A;  4LIR A;  1SIW B;  3IFE A;  5AE2 A;  4K5R A;  2B9W A;  3MAA B;  1KR4 A;  1IWG A;  2LLZ A;  3NS7 B;  1OY6 A;  2IVM A;  2JRS A;  3PKY A;  1UZD A;  2SXL A;  2FLO A;  4OQJ A;  4DR3 F;  5E2Q A;  1HBM B;  2WBR A;  3ZTP A;  4NCG B;  2FQQ B;  2DGU A;  4OYO A;  4EK2 A;  4TNO A;  4CLS A;  3S1T A;  2GGP A;  2QGF B;  2C2D A;  5J2Q B;  5B0A A;  4ZPV R;  2KN4 A;  5FLX Y;  5IOL A;  1UL3 A;  2BW7 A;  3BR9 A;  1FVQ A;  2BJ1 A;  5KG0 A;  2QN6 B;  2M52 A;  1EJ7 L;  2HS3 A;  1NME B;  1X9M A;  1TV6 B;  3RBE A;  2FC9 A;  1RT4 B;  4TY8 B;  2F63 A;  3K5M A;  4F50 A;  3ILJ A;  3WX8 A;  3DOK B;  4JI2 F;  4RUH A;  4JV2 A;  2AMC B;  3M6V A;  3TUP A;  4JI5 J;  5IS2 A;  1NO8 A;  4FF3 A;  1NBE B;  3QBC A;  2XYH B;  5KFN A;  5J2N B;  5B0G A;  5KT3 A;  1HI8 A;  1E6V B;  1B0P A;  4USK A;  1R27 B;  1WOR A;  1BUX A;  2FVQ A;  1FKP A;  3AB2 B;  4U7U K;  1OO0 B;  4F0M A;  4FYD A;  1LFW A;  3H59 A;  2VL1 A;  2UU9 F;  4Y6I A;  4QYZ K;  4DR7 F;  3MMJ A;  1HD0 A;  5KFZ A;  4OLP A;  3M2V B;  3L09 A;  3GJS B;  1J2V A;  1H2V Z;  2FHJ D;  4TQR A;  5KG2 A;  1Q7Y T;  1NU4 A;  3I5B A;  4B3T J;  2DNZ A;  4NYZ A;  4HEA 9;  2ZVI A;  3JTO A;  4L3K A;  2OJ3 A;  5KT2 A;  4OYZ A;  5EWE A;  3BV8 A;  3BKU A;  4PRF A;  2QL5 B;  5K14 B;  4MKB A;  3QSI A;  2C2O B;  2MMY A;  4QIV A;  1RB0 A;  2FY8 A;  2AT1 B;  2ZFH A;  1UVM A;  2AHO B;  4ETX A;  5KT4 A;  2GJF A;  3TJ8 A;  3FFI B;  1PCA A;  3VTI A;  1M5V C;  4CCH A;  1DQA A;  3M9N B;  4FS1 A;  3N0V A;  1FRI A;  2UUB F;  2ASD A;  1S6Q B;  2CPZ A;  2UUC J;  1HPZ B;  2PD1 A;  3RZA A;  4C8Z A;  1TFY A;  5DO2 A;  5CD4 H;  5HMY A;  4JI4 J;  4GRS A;  1HR0 J;  2ADB A;  4X64 F;  1WC0 A;  3W8G A;  2CQH A;  1QE1 A;  3SQO P;  4PG6 A;  1QAY A;  1RDR A;  4KFB A;  5HRO B;  2DNR A;  4BCA A;  4IRD A;  4GVB B;  4PQA A;  4GMK A;  4IOA Q;  2EWH A;  2GMH A;  2JC1 A;  1G6B A;  5D15 A;  4N8N A;  3RBD A;  3KLH B;  4KHR A;  1FKO A;  1IKV A;  2EFN A;  4RJV A;  3CCQ S;  1FES A;  2EFQ A;  1JXL A;  2MGZ A;  2KZM A;  3OR1 A;  3MTK A;  2B8P A;  2I8E A;  2FHO B;  3C3L A;  5D78 A;  3HT0 A;  1UVJ A;  1N52 B;  3H25 A;  3RAX A;  3MMC B;  4ATN A;  4KE5 A;  2OPS A;  4L72 B;  2GA7 A;  2EK6 A;  4IUF A;  2E1P A;  3E8O A;  1JLB A;  1N0U A;  2C2E A;  3MED B;  1X31 C;  2W9B B;  4DDF A;  4KKO B;  2FPH X;  4B3R J;  5DZ6 A;  3D7S B;  1TL1 A;  2DTJ A;  3GFX A;  4ZVP B;  3UVJ A;  5F8G A;  1FX4 A;  3PX6 A;  2H5J B;  2J5A A;  1S1X A;  2XHW A;  5LMN J;  4UOC A;  2IJF A;  1SC6 A;  4M94 A;  1MMD A;  2NXC A;  1N32 F;  1HHT P;  2DNQ A;  2MZJ A;  2L08 A;  3EZ5 A;  4NA3 A;  4KH0 B;  2CG4 A;  4CLU A;  1NK5 A;  1UKU A;  2JEG A;  1TKT B;  4Z7Y A;  2OTJ S;  1UVI A;  4DU8 A;  1U8S A;  2WK4 A;  1JLF B;  3OL6 A;  3HVR A;  3PJX A;  2LEA A;  1YLX A;  5E3Q A;  4EZ6 A;  4ECT A;  1HBO A;  4YDX A;  1NDC A;  4QJV A;  1FEH A;  2HS0 A;  2RH3 A;  3I82 A;  3O8W A;  1CG2 A;  4KQZ A;  3CC4 S;  3T1Y J;  2I9S A;  4DMZ A;  1UEK A;  2GO9 A;  1UA0 A;  3K0J A;  3IGV A;  1UTA A;  2X1G A;  2VKZ G;  4F04 B;  1YG0 A;  4ED7 A;  2GIQ A;  2ZC3 A;  1TFW A;  3BSO A;  3OXG A;  4QW8 A;  4Y2I A;  1HWI A;  3IXQ A;  2CJY B;  4XDC A;  3VGU A;  3M8Q B;  2HHS A;  3EDQ B;  2ZH3 A;  4ZOS A;  2HRY A;  4ZVS B;  4I6Y A;  2D3U A;  3CJQ A;  3OVA A;  1XMB A;  5DQH A;  2D74 B;  3BKT A;  4ZLL A;  5KG6 A;  2JFD A;  2UXC J;  4ECW A;  2N82 B;  2AQ4 A;  4G1P A;  1N4L A;  2M88 A;  4PG7 A;  4F4X A;  2ILZ A;  2EBG A;  4GC6 A;  2NYI A;  5HSP A;  4DS4 A;  2K2P A;  1ACM B;  2LQ9 A;  3EGN A;  1RTH A;  3HFK A;  3PNI A;  1QSL A;  3O44 A;  5MLC V;  2DR7 A;  4AUK A;  1VLO A;  4Q0B B;  2WTF A;  5I3U B;  2V8H A;  3MZI A;  4GKK J;  2QE5 A;  1GXL A;  4K4W A;  1R0B G;  2MY8 A;  5LJ5 Y;  2EKN A;  1UJ5 A;  4GO5 X;  5F8I A;  2CQC A;  1WAC A;  2VJU A;  2JVO A;  3PM9 A;  3R2D J;  3KLV A;  2JZ5 A;  1LWF B;  1LWC B;  3DLE A;  5HP1 A;  3MXH P;  4JOU A;  4XAK A;  3A1Y G;  1O51 A;  1B3T A;  2C2M B;  2IAJ B;  2OFH X;  1R8P A;  2ZBQ A;  5C25 A;  2MQP A;  3KNA A;  1U45 A;  1HQU B;  1S99 A;  3ET6 A;  3KG4 A;  4CYU B;  4C0B A;  3DGP B;  2HVH A;  2AJ4 A;  5C2G A;  4EU0 A;  3HFZ B;  2VG6 B;  2ZWO A;  3BGU A;  3RBZ A;  4P7V A;  5MAO A;  4DSK A;  2WAQ D;  1SKW A;  2FZC B;  4WTO B;  2QYC A;  3JYT B;  1DBD A;  2YNH A;  4WCE Q;  3M8P A;  3CCW A;  4RNF A;  3W3S A;  2IM2 A;  3TRG A;  4PUO B;  4RW7 A;  4CLY A;  4NX9 A;  2Y8W A;  5C5J A;  2Z4P A;  5DM7 Q;  1PO6 A;  2LEC A;  3T19 A;  2DRA A;  4DL2 A;  4WF9 Q;  4M5G A;  3D3B J;  4CRJ A;  3MMB A;  3HX9 A;  4HTI A;  3QRP A;  2KRB A;  3SCJ E;  3W65 A;  4PXE A;  3HMJ G;  4H4M B;  5HAN A;  4ZJL A;  3RYL A;  1SJQ A;  1RIS A;  2E66 A;  2GQQ A;  4LJM A;  4F3Q A;  4NI2 A;  2V8D A;  3KLG A;  1P9Y A;  5B09 A;  1J5O B;  5L1J A;  1SBR A;  3TW0 A;  1WHY A;  2KDO A;  2HSE B;  1NB2 A;  4MIB A;  1T0T V;  3JSR A;  3GIM A;  1NK0 A;  2ZIT A;  2OKQ A;  3BSN A;  4ZHR A;  3HHD A;  1XNR F;  4J9M A;  4B3M F;  2ROP A;  2OIH A;  1X5P A;  3IWL A;  2GHP A;  2O66 A;  4IQX A;  1G4C A;  2DHX A;  4X84 A;  4MIW A;  2V63 A;  1D1U A;  3PW4 A;  2W2O P;  2JL9 A;  1XBW A;  3JSB A;  3FKB A;  1R8H A;  2B43 A;  2UXD J;  2R8H A;  3KMS A;  4CH1 A;  3C16 A;  4ANE A;  1RA6 A;  2PMW A;  2DIU A;  3FQK A;  3U7J A;  3IMQ J;  3ISN C;  3QO9 A;  4M5K A;  1WG1 A;  3S6E A;  1VQ6 S;  2DH7 A;  2FZK B;  1M5H A;  2P9C A;  3NGK A;  1DLO A;  2E5L F;  4DSI A;  2DR9 A;  4LFA F;  3DRS B;  5E7O B;  5AXN A;  3SV4 A;  1VR6 A;  3KHH A;  1BD6 A;  4EZ9 A;  2BW2 A;  1J5E F;  2X1F A;  1MN9 A;  2HG4 A;  2HQF A;  5EWG A;  4XDD A;  1ZAV A;  1SVD A;  4RW9 B;  5KG4 A;  2J8A A;  1IQZ A;  1SJR A;  1N8R T;  3WX4 A;  1YSJ A;  4OL8 A;  4YFU A;  1WHX A;  3R1L A;  3MOZ A;  3EVW A;  1LWX A;  3AQO A;  3RG6 A;  2OPP B;  4DV6 J;  3PRB A;  3G6X A;  2EEY A;  4LF5 F;  2YWF A;  4QQB A;  1FJC A;  1E6Y B;  1YIJ S;  4RWX A;  5B08 A;  4CZC A;  2XLI A;  4U67 Q;  2WBM A;  3LPE A;  4B9N A;  4CLL A;  1QVG R;  1S5Z A;  2VFV A;  4ANC A;  2FLN A;  4I68 A;  1TAQ A;  3M32 B;  4HDG A;  1AZS A;  2QLW A;  4Q8E A;  2J6U A;  1ZM3 A;  1O6X A;  5D0G A;  3US5 A;  5L39 A;  3HKW A;  1Q8K A;  5KFP A;  1S1V B;  2OD6 A;  3OSP A;  2B9E A;  2J8S A;  2YPY A;  3KK3 A;  5KFO A;  2FJX A;  1JKH A;  2EG1 A;  2UUA J;  3M6W A;  2Z2L A;  2VG7 B;  1M1H A;  4YHH J;  3CCJ S;  2D69 A;  4LR9 A;  2ZKT A;  4PXB A;  1VJW A;  1JLA A;  1RAC B;  1NK9 A;  2VAS A;  1RTD B;  3V6J A;  2CPJ A;  3IC1 A;  2RDI A;  2DGX A;  5ETO A;  1X4G A;  3ZZU A;  1WEX A;  3V81 B;  1JNZ B;  5BJR A;  3W64 A;  2OLW A;  4QOT A;  5KT6 A;  5CYM A;  4CH0 S;  2KFY A;  1XEZ A;  5KAK A;  3KLI A;  3FGV A;  3CJR A;  2V68 A;  1YJU A;  2XGP A;  2DNG A;  2KJV A;  4C11 B;  2IRY A;  2LP4 A;  4F67 A;  2L3M A;  5D0R A;  3F44 A;  1K8A T;  5ETV A;  4LRF A;  2KYX A;  3OUY B;  2YY3 A;  3DI6 B;  3LGH A;  3CJ0 A;  1SJ4 P;  1S1U B;  3FUY A;  1PAE X;  3DM2 B;  4DBQ A;  5ETS A;  4DL6 A;  2AJ2 A;  1I5O B;  4J91 A;  4KC5 A;  3L3C A;  3LF0 A;  3NCP A;  4JI7 F;  3GYX B;  1RUS A;  2DJW A;  5DDR C;  1QSS A;  3CO0 P;  1RT6 A;  2F7V A;  4XPE A;  2V4R A;  1UZH A;  3UN3 A;  5KTQ A;  1D8Z A;  2QYG A;  2BOP A;  1T11 A;  1R3N A;  2ALZ A;  2ZBR A;  1OY8 A;  2H65 B;  1C2P A;  5J2M A;  4F02 A;  3DDN A;  3THV A;  3QJJ A;  5CAB A;  5B0C A;  2XSJ A;  1PYO B;  3NNC A;  2W25 A;  2ATL A;  4ECV A;  1S9G A;  4RBT A;  4H4K A;  2HHX A;  4M95 A;  2P9G A;  2X51 A;  4WFX A;  3VZH A;  2QSW A;  3TO8 A;  2MKI A;  4DQQ A;  3M7V A;  5CZX A;  4QWB A;  2UV8 A;  5F8N A;  5U47 A;  2Y8Y A;  3KXD A;  4JV5 F;  4AL5 A;  2VA3 A;  3MM7 A;  2AZ1 A;  3VAM A;  3M2U A;  2Y1J A;  3K8W A;  2EFO A;  3EJM A;  2ZOM A;  2RKI B;  4NLQ A;  4YB7 A;  1FKP B;  2CWX A;  2PO4 A;  4IG3 A;  3MEC A;  5KFH A;  1VQ8 S;  2C3O A;  3W9J A;  2FGO A;  2MQN A;  1N5Q A;  2Q43 A;  1W26 A;  1HBU A;  5F9L A;  3K8V A;  2VZ9 A;  2MLY A;  2MQM A;  4OYI A;  5HQL A;  2KVQ E;  4ZLJ A;  4TYB A;  2JH3 A;  2ZHA A;  2GNK A;  3PG9 A;  4LQ9 A;  1NH8 A;  3B4M A;  3MM5 A;  2OO4 A;  1XNQ J;  1BQX A;  3D3C J;  1TTH B;  5AE3 A;  3KDN A;  1LK7 A;  2AP6 A;  1KQG B;  4WWS A;  3GJR B;  3O1L A;  1YJV A;  2CPY A;  1Q8B A;  3BH6 B;  2V8P A;  4ZJO A;  2E1R A;  4B17 A;  1TAU A;  1S9E A;  1EHW A;  3NOG A;  2YPZ A;  3MUM P;  4ED8 A;  2HNZ A;  1GMU A;  2BJE A;  2BJ3 A;  4AL7 A;  2V34 A;  3ZO7 A;  2O3D A;  1CVJ A;  5GVQ A;  2R7T A;  5F9N A;  2EKY A;  2KT2 A;  1QE1 B;  3ZTO A;  4N56 A;  3RB0 A;  4KFB B;  2VPW B;  2DNO A;  2BAB A;  2MKC A;  4HT7 A;  3J7Z T;  2WVE A;  1BE4 A;  3TR5 A;  2F9J A;  2MYF A;  2WVB A;  3FRZ A;  3G71 S;  1H72 C;  3JSY A;  1ZS6 A;  3H0P A;  4RBV A;  3HVA A;  4X4S A;  1R8B A;  3KMQ A;  1RBO B;  3LAM A;  1FKO B;  1IKV B;  4NCA A;  2DY1 A;  1RAB B;  1JXE A;  3E51 A;  1YJT A;  2MKK A;  3A8K A;  2MGZ B;  3LW5 C;  1S1T A;  3I9Z A;  2YKQ A;  3OR1 B;  2XI2 A;  4CO0 A;  1KBR A;  1X4H A;  3BF4 A;  5DDO C;  1WWH A;  1IM4 A;  2FZG B;  2OPS B;  1D09 B;  2H5E A;  3BGF A;  2B56 A;  3HCX A;  1WJ9 A;  2VOO A;  4TXS A;  2D1C A;  1NRK A;  1JLB B;  4JB8 B;  4FXW A;  2V50 A;  2Q6B A;  3GE9 A;  2G0I A;  5KFJ A;  1TL1 B;  4B3S J;  4WFN Q;  3UVJ B;  3KDO A;  1HWU A;  4CLK A;  4F7V A;  3VGS A;  2LXI A;  2M0G B;  4URS A;  3AJ2 A;  2BKN A;  1VC6 A;  3KNG A;  4QWC A;  3O6Q A;  1JWW A;  4AXJ A;  2XY7 A;  4DR4 J;  2ZWP A;  1TR0 A;  1HBO B;  2V2Z A;  4CWB A;  5JUM A;  1X4E A;  4R0E A;  3KLE A;  2JSX A;  4ZIT A;  3VR1 A;  3JAM U;  2V69 A;  2WVD A;  3H90 A;  3G6V A;  3SV3 A;  2V2K A;  1WTF A;  3GII A;  1KVI A;  2A2C A;  1F5C A;  3T1H J;  4IFV A;  3TOQ A;  3PW0 A;  3D54 A;  3JXO A;  1QM9 A;  4B3T F;  4K50 A;  1F9E B;  3ZZT A;  2DY9 A;  4MYT A;  4KRW A;  3QT8 A;  3MM8 A;  3JAM Y;  1PGZ A;  2NSC A;  4LIW A;  3SSR A;  2FYX A;  3HXM A;  1VLY A;  4FZV A;  2CZ9 A;  1QY7 A;  4A8S A;  4NMX A;  4PZV A;  1WOP A;  2WOM A;  1ZA2 B;  3T9Z A;  1T9V A;  2HZC A;  3A8J A;  4JI8 J;  1NB7 A;  1RTH B;  2BE2 A;  3PJ9 A;  1VQ5 S;  2PEB A;  2UUC F;  2M4M A;  5HQM A;  2JC0 A;  2NRE A;  4JI4 F;  2FJV A;  3D0I E;  2GS8 A;  1N5Y A;  4O3R A;  2AJF E;  3CC7 S;  3UFC X;  2FJE B;  4OI3 A;  2V9W A;  4ZJQ A;  3I96 A;  1FWP A;  2JEI A;  4ZVE A;  3DLE B;  2DPI A;  5HP1 B;  1GXT A;  1JMT A;  3KUH A;  4ZS6 A;  1UVL A;  4O3P A;  4RNH A;  3I4H X;  4KAI A;  4YB1 P;  4YR3 A;  2CVE A;  4M5I A;  4LF6 J;  2BAN A;  2MHN A;  1JLC A;  1QTN B;  2CQD A;  3AA8 A;  2YH1 A;  3FBF A;  2GIF A;  5C25 B;  3NWR A;  3POT B;  5FII A;  1L3U A;  3GSI A;  3D67 A;  3KK1 A;  3T3F A;  5KG3 A;  4M5D A;  5AXK A;  1C0T A;  5HJY A;  1UFW A;  3FQL A;  1B0V A;  5EX3 A;  1VOM A;  4ERD A;  3ZTS A;  2IRX A;  2YNH B;  3M8P B;  3D1H A;  3OTD A;  1XTZ A;  2LQ8 A;  1RBL A;  5LXR A;  1NPP A;  3A13 A;  2IPO B;  2QL9 B;  1HMV A;  5DDQ C;  2BM1 A;  5E3P A;  2BM0 A;  4O44 A;  4B3R F;  4MKV A;  1U0S A;  1RHK B;  1AW0 A;  2ERR A;  3KJV A;  2FVS A;  4IYQ A;  3NOC A;  3MMB B;  4PG5 A;  2J0S D;  5D6G A;  3P4U B;  4CI0 B;  1RXO B;  4ECY A;  1K1S A;  3CNQ P;  1RTJ A;  1P8G A;  4IG0 A;  3RW7 A;  1RAO A;  3KLG B;  3WC0 A;  1F2G A;  2EVZ A;  4A4J A;  3BBF A;  4WP3 A;  1PSD A;  2ZJP Q;  1N6Q A;  2EI5 A;  5GAG I;  1G7C B;  1SJ1 A;  1FE4 A;  2D9P A;  5EDW A;  5DLF A;  1GX5 A;  2R8I A;  2AJ0 A;  2GVZ B;  4O3O A;  3I32 A;  4K4U A;  4DV5 J;  3GIK A;  3T1Y F;  1S79 A;  1R0A A;  3IBF B;  3PYD A;  2NPF A;  4F4Y A;  4HKQ A;  4QR0 A;  2DGW A;  3UQS A;  4M8L A;  1IUJ A;  2YQ1 A;  5HJX A;  3UO0 A;  2P6S A;  1RWW B;  2MKJ A;  2CA9 A;  2MQL A;  3MCN A;  1OIA A;  2ZNY A;  2K7J A;  1KN6 A;  4F25 A;  5BXI A;  4RNN A;  1EB0 A;  1L3K A;  2CDQ A;  2HFV A;  3CT9 A;  3QO9 B;  4H4O A;  4DFK A;  4DV2 J;  3GR0 A;  3WIU A;  3VZI A;  2Q66 A;  3EPG A;  1N88 A;  2UXC F;  2DCU B;  4ZPT R;  4RW8 A;  3CC2 S;  5CCM A;  1YDL A;  2IMW P;  4CLT A;  3D5M A;  4MAK A;  4RBU A;  1O5J A;  2B4P A;  1VBZ A;  2MDA A;  4Y2K A;  4P7T A;  3PY8 A;  4ZP9 A;  4OZ5 A;  4N41 A;  4X4N A;  3HM9 A;  5IM0 A;  2RS8 A;  2ZH2 A;  4X64 J;  4ZP8 A;  2CIM A;  3SSS A;  4Q8F A;  3I9V 9;  1FRX A;  4MK8 A;  2H48 B;  1FXR A;  3AD8 C;  1H7W A;  2BR0 A;  2NZC A;  4WYL A;  3M6X A;  4QU7 A;  2R7V A;  2NUH A;  1ZYQ A;  1Q0N A;  4DOZ A;  3MEE B;  5DRK A;  3R2C J;  3MD3 A;  4PPZ A;  3UR0 A;  1F1B B;  1NLK L;  2CG8 A;  4EO8 A;  2F4F A;  5KT5 A;  2F8H A;  4DV0 J;  1AZS B;  1WEL A;  3K58 A;  1RYR A;  4B9V A;  1R8A A;  2Z56 B;  1S4E A;  2EFG A;  1VIS A;  5L9X A;  2H4Y B;  2YQ0 A;  2YKN A;  1FXD A;  1S57 A;  5KFW A;  1RWM B;  3HHL C;  3BO4 A;  3KK3 B;  2D7S A;  2IA6 A;  1C1C A;  4DSL A;  4DX7 A;  4NA1 A;  3Q23 A;  1MN7 A;  2MJU A;  3D1O A;  1OMS A;  2HMI A;  4ECQ A;  3NS6 A;  3V5R A;  5A2Q U;  1JXV A;  3SCL E;  1JLA B;  2MSS A;  2I0X A;  4ELT A;  3DCA A;  4OX6 A;  3W9H A;  4HH1 A;  1X5O A;  2B4V A;  4EBE A;  4YY3 J;  1BXN A;  5AT1 B;  3H2L A;  3D66 A;  3Q8V A;  3JSM A;  3RR8 A;  5A8K A;  2Q79 A;  4LT6 A;  1YJ9 S;  2HK2 A;  3GYN A;  1U1K A;  2AWZ A;  3I0S A;  1YZ6 A;  3KLI B;  4I2P B;  3RU0 A;  5E3R A;  2ZZM A;  2HND A;  3AT1 B;  1IJE B;  3PJW A;  3V4I A;  5E3A A;  2ZOG A;  2QSF A;  3HJV A;  1NKC A;  2W9A A;  3BYR A;  4C3L A;  4ID8 A;  2LCW A;  3GIJ A;  4QWA A;  2X3G A;  2E5H A;  1BQM A;  2KH9 A;  4CM0 A;  4M5H A;  1IVZ A;  2UXD F;  2B9Y A;  2DT9 A;  3DRX A;  3FZ2 A;  1KD1 T;  2KFN A;  2IIH A;  1ZPW X;  5SUH A;  3T5L A;  2G2Y A;  1B0T A;  2AU0 A;  3BBB A;  4F3O A;  4KR0 B;  2QMW A;  3G8Q A;  4CH7 A;  1U1M A;  1RT5 A;  2ASJ A;  2D3O R;  2PA3 A;  1RT6 B;  1FRM A;  2WSE C;  4W92 B;  1LXN A;  4WZQ A;  3TVY A;  4C7Q A;  1WKL A;  3EUN A;  2XO7 A;  4EFA C;  5J2M B;  4DX6 A;  1X8D A;  5H9E J;  2DR6 A;  3C8Y A;  2AYG A;  4NRU A;  4LRA A;  4LUB A;  4MIA A;  1RWP B;  3W8P A;  2J0Q D;  4OZ0 A;  2XSJ B;  3LTO A;  3GIR A;  3AOB A;  4NLP A;  3OL9 A;  1JB0 C;  5BYR A;  4YP3 A;  4ZLN A;  3D0G E;  4NA2 A;  3VVU A;  1S9G B;  1VQY A;  3HO1 A;  1X0P A;  3W60 A;  3C15 A;  4FF4 A;  1SB6 A;  3S8S A;  5L46 A;  3TAQ A;  2F3J A;  3CMQ A;  4G1Q A;  3MM6 A;  4KB7 A;  2QX0 A;  1S0N A;  1S6U A;  1WC6 A;  1UAW A;  3MM7 B;  1RWU A;  1M5P C;  2HFS A;  2JHE A;  1X9S A;  3WZ0 A;  5T14 A;  4PPD A;  5KFA A;  2R2T A;  2HFO A;  2FC8 A;  3UCG A;  4DLE A;  3IAS 9;  4FF2 A;  3RB6 A;  1ZM2 A;  1UP1 A;  2XG8 A;  1TL7 A;  3V6K A;  4J7C A;  1A7G E;  4IG3 B;  2XB2 D;  4L3N A;  1V9O A;  3MEC B;  3PIO Q;  1LW0 A;  2F8E X;  2VFT A;  3CO9 A;  2G0C A;  4RUB A;  2HPU A;  1XMO J;  1CUL A;  4K59 A;  1M90 T;  4RLE A;  2BQR A;  2UUA F;  4E8U A;  3AFG A;  3FCV A;  4YHH F;  4IR9 A;  4X4Q A;  4DJB A;  2J9C A;  3MM5 B;  2L48 A;  2LQ5 A;  3HUL A;  1PBA A;  3HSJ A;  4DQP A;  2FVP A;  4X2B A;  2XMV A;  2BYC A;  1YBA A;  1IBK F;  5T41 A;  1X4F A;  2B7C B;  1K1Q A;  2XZW A;  4KTQ A;  4NL5 A;  3TYT A;  4IDK B;  1SQF A;  1NPR A;  3AJD A;  1VK8 A;  3IO1 A;  9RUB A;  4NXN J;  1RJJ A;  2DIV A;  4QPX A;  2PGC A;  2I2Y A;  4IH5 A;  3QGH A;  1S9E B;  4N77 A;  1CQN A;  2CWK A;  3DLG A;  3J7Y I;  1UJ6 A;  2HNZ B;  3M9O B;  4JV0 A;  4ZCM A;  4NZ7 A;  2GML A;  1JJH A;  3QT7 A;  4NE9 C;  2OH2 A;  3QAE A;  4XO0 A;  3MTJ A;  2NYH A;  2CNN B;  1Q4R A;  5K8M A;  2CQP A;  4DX5 A;  1B7Y B;  2FHM A;  3J7Z 5;  3MWB A;  3G82 A;  2R7Q A;  4DSE A;  5GMD A;  2KKH A;  1HNX F;  5HAO A;  3Q2S C;  5BYQ A;  4RWW A;  2JDJ A;  5F3Z A;  2OI2 A;  5C24 A;  3OXL A;  2FVC A;  4KPC A;  3L7U A;  3MOJ B;  3NBP B;  2VBY A;  2EFV A;  4LVN P;  3U1L A;  1OPI A;  2LU2 A;  1FK9 A;  1J5E J;  3UR3 C;  1GK8 A;  1NDL A;  4KPY A;  2G4B A;  4J9O A;  3ICL A;  1M1G A;  2QFI A;  2ZZN A;  3BR8 A;  2YKO A;  4LF4 J;  3CD7 A;  3CIM A;  3VWS A;  4MH8 A;  3TAM A;  4Y2C A;  4OI4 A;  3TJA A;  2DGV A;  5CQG A;  2KG0 A;  5F8H A;  5A8W A;  2HRU A;  3QLH B;  1KP6 A;  3IWX A;  1EP4 A;  1EX8 A;  1QJH A;  3CJS A;  2HHP A;  2XO6 A;  1U24 A;  3MR2 A;  1NEE A;  1U48 A;  2GAH C;  2KB2 A;  1DY3 A;  2W4P A;  1XMQ J;  1RHU B;  3R5A A;  2ZE2 A;  3PYF A;  4DL7 A;  2JLG A;  4B3O A;  3H98 A;  2GHW A;  1NSQ A;  4XIU A;  4A8M P;  1U2C A;  8RUC A;  2R8K A;  2UVW A;  2OPR A;  1SQE A;  3IR7 B;  4F4K A;  1N54 B;  2FHK A;  3AAW B;  4K2X A;  4LR8 A;  4YOE A;  4OI0 A;  4O23 A;  1VRT A;  4NWB A;  2DVI A;  3KHL A;  3QAU A;  2C2N A;  3FJ2 A;  1PG5 B;  2XMW A;  1K9M T;  1DFD A;  1M0S A;  1ROF A;  3DLK B;  4R0J A;  3JQK A;  1FFS B;  4ZVR B;  4XK8 C;  2H1Y A;  1TKX A;  1UEU A;  2DXF A;  2GAG C;  2IM3 A;  1GMW A;  2V8V A;  2XMU A;  4WXW A;  4J90 A;  2M5Y A;  1Q86 T;  2V5H G;  2UZA A;  3LP1 A;  2M7S A;  4USM A;  2VBZ A;  4YEA A;  3QT5 A;  3I0R A;  1T9X A;  1N33 F;  5ETQ A;  4QIE A;  1XNQ F;  2XQC A;  4NXM F;  1PYT A;  1U1P A;  3MM8 B;  1X7V A;  1AB8 A;  1CC7 A;  1DZ5 A;  4P71 A;  4EUV A;  3T6B A;  2ACM A;  2N4D A;  3MCM A;  2RIJ A;  1RT2 A;  4ED3 A;  1T9W A;  3TX0 A;  3Q8R B;  1WSR A;  4PXC A;  4LF1 A;  2XEX A;  3GMG A;  4I7F B;  1TK5 A;  4U95 A;  5HI7 A;  2Y3Y A;  4S0M A;  1IKW A;  3M2R B;  1F5B A;  3QFH A;  3Q8U A;  5I4M A;  4NLW A;  3EVO A;  4ER8 A;  1YQH A;  1M5K C;  3BEG B;  1LEO A;  4HHJ A;  4DFM A;  1F9F A;  3SI8 A;  2F4V F;  3SDE A;  4X4P A;  2V94 A;  2DO4 A;  2LEB A;  1R7I A;  1N5Y B;  4V19 J;  1TP7 A;  3EDR B;  4WU3 A;  4TVA B;  3OBI A;  5HN0 A;  2G1H A;  2R7R A;  4NYP A;  4RPF A;  4WK1 A;  3NNH A;  1S49 A;  1Z4U A;  1OJ4 A;  1WEZ A;  4LRD A;  4P6Q A;  1HYS A;  1RA7 A;  3DXS X;  5JMN A;  4CLW A;  1FDD A;  3CE8 A;  2XWY A;  3SYZ A;  2R7X A;  1JLC B;  1A6L A;  5DGB A;  2AEF A;  3R6L B;  4DLG A;  4IQM A;  3RRH A;  5LXY A;  1A9N B;  1WC4 A;  1TKZ A;  2DIS A;  1MRO A;  1Q1K A;  1WEY A;  3N6N A;  3KK1 B;  2PMH A;  3WIV A;  3MR7 A;  2K8G A;  3GON A;  1WHW A;  4DL5 A;  1RLC L;  4M5D B;  1C0T B;  3LP0 A;  4MTP A;  2XTJ P;  4LSL A;  4HLB A;  4UZC A;  4CO4 A;  3P6Y C;  3MPU B;  2JNJ A;  2LVW A;  1VS3 A;  4F0K A;  2PFD A;  3PHT A;  1APS A;  3CDB A;  2CYY A;  1HQ2 A;  5B0E A;  4J5O A;  3HHN B;  1DTQ A;  1HMV B;  2I1R A;  2WON B;  2Z2M A;  4O44 B;  5KFK A;  4OHY A;  4MT1 A;  2MEW A;  2HIQ A;  3KJV B;  3NEK A;  2DGS A;  2F8M A;  1NJY A;  2IDE A;  4WTY A;  2WB1 D;  1MNE A;  4IG0 B;  4OI2 A;  2DEI A;  3GSD A;  2QO3 A;  2CJ9 A;  1N0V C;  1KQF B;  1JLQ A;  2HBY B;  4DR4 F;  1A0O B;  1N6Q B;  3W66 A;  1JQG A;  1WC5 A;  2RE1 A;  1I51 B;  1SH2 A;  4LBI A;  1S1W A;  1WD6 A;  2HQI A;  2KI2 A;  3ZZO A;  2I5J A;  3ITH A;  2JFK A;  3CIZ A;  3CJ3 A;  1OYE A;  1R0A B;  4PWW A;  4ZCK A;  3VCD A;  4ID5 A;  4DR2 J;  3Q89 A;  5KFL A;  1FFG B;  4OJH A;  1QLN A;  2MPU A;  5CAA A;  5SZT A;  2FIU A;  1KS2 A;  5A6P A;  5F3T A;  3DFE A;  2IRU A;  2YNG B;  2W2N P;  4DR1 J;  1NJI T;  1RLD A;  3H2V E;  2DR8 A;  3M30 A;  3EX7 B;  4X65 J;  3CVK A;  4RNM A;  1R6Y A;  5I42 A;  4H4O B;  3JQM A;  2HHU A;  3ENQ A;  1ZZN A;  1HWL A;  5KG5 A;  3EXY A;  5ADZ A;  1FWK A;  3A4T A;  4J9K A;  4RW8 B;  5IZH A;  2V4Q A;  1T95 A;  2M2B A;  1VBK A;  3OR2 A;  3ZZZ A;  3T9N A;  4OX9 F;  4JI8 F;  4DV1 F;  4QYR A;  4A8X A;  4DV3 J;  3PW7 A;  1UWA A;  4QZV B;  1VRQ C;  4MKY A;  4ED0 A;  2W8L A;  4UY8 5;  3EGW B;  1XR5 A;  2GW8 A;  2ZM6 J;  4J9N A;  4G3I A;  5IM0 B;  1VQO S;  2IHR 1;  2PT0 A;  1DRZ A;  2ZD1 A;  2DEJ A;  1ZOT A;  1H74 A;  2AD9 A;  2MJN A;  1DTT A;  2ZEJ A;  1L3S A;  2YX1 A;  3CMA S;  4DR5 J;  1N5S A;  2IM1 A;  3Q8Y A;  2A1B A;  3ZZ0 A;  1IJF B;  2YWH A;  2BJ8 A;  1IBL F;  1FI4 A;  4ES2 A;  1MW7 A;  2VOD A;  1R0C B;  4I64 A;  4LF6 F;  5FLX U;  1L5U A;  3BPS P;  4EI2 A;  4PWD A;  4RU9 A;  4JBC A;  2RUS A;  1F3V A;  1NHV A;  1BQN A;  3N5B A;  3DMJ B;  4NRT A;  1NND A;  3FSI A;  4A46 A;  3OTO J;  1KOO A;  2JWN A;  5A6W A;  2OML A;  2VDI A;  2DNL A;  2AKW B;  4L75 A;  4O4G A;  5HVF A;  5JXS A;  2RU3 A;  1SV5 A;  2YKN B;  2DIT A;  3EGV A;  5ETT A;  2HFU A;  1UWB A;  4F26 A;  4CLP A;  1IKY A;  4AL6 A;  1TQL A;  4AD6 A;  1SC1 B;  2HMI B;  3OVB A;  3J7A 1;  3N01 A;  1LKZ A;  4A8O A;  1FCA A;  2DNK A;  5DG7 A;  2DGT A;  3RB4 A;  1Q79 A;  3MAA A;  1WNE A;  2XUL A;  4LF9 J;  2HBQ B;  3J80 U;  3NP5 A;  1YJ7 A;  1NJX A;  1YGY A;  4TU8 A;  3JSM B;  1KNZ A;  3M9M B;  1ZBT A;  3OTB A;  5A8K B;  2KFZ A;  4ZVG A;  1UVK A;  3MMA B;  4WPA A;  3I0S B;  2IC3 A;  3KG1 A;  4DUY J;  2IFX A;  2E29 A;  1IM6 A;  2HND B;  5K20 B;  2CQ1 A;  1Y5L B;  3V4I B;  3LAL A;  4DV5 F;  4QIW D;  3J80 Y;  3DC2 A;  5J2Q A;  1VIO A;  1F0X A;  3TQ1 A;  2HBR B;  3S01 A;  2WSC C;  2ADC A;  3R27 A;  1TVR A;  3CW2 C;  2FY1 A;  1BQM B;  1NCL A;  1NDP A;  4DPW A;  5D4O A;  1EZZ B;  5H1S V;  2APO A;  4IKA A;  1VC5 A;  3R5G A;  3K5O A;  1RT4 A;  3RTV A;  2AZ3 A;  4CO3 A;  4X4R A;  2P9E A;  3KWM A;  5A0Y A;  4DV2 F;  1WTB A;  4FF1 A;  2C2Z B;  3HVW A;  2EK1 A;  3UE2 A;  1VDH A;  4USJ C;  4FKX A;  5HK4 A;  3THT A;  3AQP A;  4CP5 A;  3HD2 A;  4AQY J;  1Z2Z A;  1FE0 A;  1PYS B;  4FN5 A;  2HQD A;  2OSQ A;  4FNI A;  2WZ1 A;  2E7W A;  3I5A A;  5HVH A;  3SZ2 A;  2M8H A;  4LF2 A;  2ZVS A;  3HSZ A;  3SIP B;  3C15 B;  1HW8 A;  3W61 A;  2VU5 A;  4ILM A;  5DGA A;  2ZBI A;  4Y65 A;  4ZVO B;  1CBK A;  4WU2 A;  1M1K T;  4O3Q A;  3WQP A;  1QUP A;  2XS2 A;  4WYW A;  1X60 A;  4G1Q B;  1UA1 A;  4X62 F;  3MM6 B;  4NEY A;  3D2W A;  3QZ7 A;  2MKS A;  3P96 A;  5K8O A;  3ONQ A;  5GAG U;  3CB4 A;  2R8J A;  3G9C A;  3CJ5 A;  3C2P A;  2E9Z A;  2QT7 A;  4DCJ B;  2U1A A;  4DV0 F;  3PYE A;  2HZV A;  1M5O C;  3P5B P;  3RW6 A;  3FFI A;  3LWM A;  1TL7 B;  3R3T A;  1VK3 A;  2ZHO A;  1UW9 A;  2OUG A;  1LW2 A;  2KJW A;  3TVZ A;  4OJ3 A;  1LW0 B;  2IJN A;  1S6O A;  1K44 A;  3J81 U;  3GP9 A;  5KFD A;  2ZH6 A;  3FEX B;  1S72 S;  1CUL B;  1XQI A;  3MFI A;  3W5X A;  3CUL A;  1S7H A;  4YR0 A;  3S7R A;  4Q44 A;  3AHP A;  1JJC B;  2OHD A;  3LQV A;  5HRO A;  3AXM A;  5IWA J;  4GVB A;  3ETO A;  4CTA A;  3J81 Y;  4LFB J;  4YY3 F;  3VGT A;  2AF6 A;  1VHI A;  4U8V A;  3HF5 A;  3PXG a;  2GFF A;  3GCW P;  2J7K A;  2G13 A;  2DKO B;  1K0T A;  2B3T B;  3PKM A;  1NDK A;  3DLG B;  1ZAX A;  1QUV A;  3CCR S;  2KHC A;  3UCZ P;  1CS4 A;  2VV5 A;  2QLX A;  4H4K C;  3BB5 A;  5EN1 A;  3BDE A;  2ASY A;  3EMT A;  3OVS A;  4BC9 A;  2P2C B;  2K1R A;  3G2X A;  3B4D A;  3G82 B;  3M8R A;  3R5D A;  5KFG A;  3MED A;  1YI2 S;  2W9B A;  2WW8 A;  4DWI A;  1SQG A;  3LP2 A;  1Q81 T;  2AGP A;  4I2Q A;  4TLQ A;  2VPY B;  1TK8 A;  1V6H A;  5AXL A;  5C24 B;  2RU9 A;  4C8K A;  1P1T A;  1F6T A;  2CNO B;  2NXN A;  5CCL A;  1H73 A;  5KG7 A;  3MR5 A;  4NLR A;  5DDP C;  1SKR A;  1HQE A;  5KFQ A;  1D8Y A;  2F5G A;  4DL4 A;  5HMW A;  1TUG B;  5IQQ A;  2HEK A;  5DM6 Q;  2DHH A;  3TAR A;  4F4Z A;  1KWM A;  1VQ7 S;  3FVY A;  4K7Q A;  1RKI A;  4CO1 A;  1R89 A;  3O5T B;  4B9L A;  3E2E A;  3TAM B;  2VQF J;  2VBX A;  4UTG A;  2HBZ B;  4HT5 A;  5A8W B;  1EP4 B;  3GFZ A;  2LXU A;  1R8C A;  2XCA A;  4X4T A;  3A3N B;  1FTC A;  2V2Q A;  1FNX H;  1PC4 A;  1KEK A;  1X4D A;  4Q43 A;  2EW9 A;  5KFM A;  2ZE2 B;  1KFD A;  3WHI A;  3PCO B;  5KFF A;  1U26 A;  3MUT P;  1BLU A;  4B3O B;  3ILO A;  2HHH J;  3M4X A;  2QA2 A;  2OPQ A;  3BKF A;  2KO1 A;  2LFV A;  3LUY A;  2C22 A;  2EPI A;  1NK6 A;  4V1A k;  2E9R X;  3RB3 A;  1Q5Y A;  5HAT A;  2MKH A;  1Y00 A;  1VRT B;  4C3M A;  4DG1 A;  4CT8 A;  4C0O C;  4KO0 A;  5G0R A;  2HFZ A;  1LQ9 A;  1HNI A;  1P9Q C;  3H20 A;  2BE7 D;  3H2U B;  4WP8 A;  2XC9 A;  5CD4 A; 
#chains in the Genus database with same CATH homology
 4JI0 J;  4LFC J;  4DUZ J;  1I94 J;  1IBL J;  1N32 J;  1IBK J;  4NEY A;  3JAM U;  2ZM6 J;  2UUA J;  4JI7 J;  2UXC J;  5LMN J;  1XMO J;  4YHH J;  4JI6 J;  4DV2 J;  4DV0 J;  2F4V J;  3T1H J;  2VQF J;  4LF5 J;  4B3T J;  4DV6 J;  4DR5 J;  3W1Y C;  4PWW A;  4DV7 J;  2VQE J;  4DR2 J;  4GKJ J;  4JI2 J;  1N34 J;  1FJG J;  4JI1 J;  2UXD J;  4KYZ A;  4K0K J;  4LF9 J;  1N33 J;  1HNW J;  1J5E J;  4LF6 J;  5LM7 E;  4RJV A;  2UXB J;  3J80 U;  4KHP J;  5IT9 U;  4JI5 J;  4NEZ A;  4AQY J;  4GKK J;  3IMQ J;  4DR1 J;  4B3S J;  5FLX U;  4NXM J;  4KY3 A;  2E5L J;  4DV1 J;  2HHH J;  4OX9 J;  4LFA J;  4JI3 J;  3J81 U;  4HHU A;  4LF4 J;  3T1Y J;  4X65 J;  4X64 J;  5AJ3 J;  2KVQ E;  4NXN J;  2UUB J;  4DUY J;  3D3B J;  2MEW A;  1IBM J;  4DV5 J;  4V1A k;  3R2D J;  4X62 J;  1N36 J;  5A2Q U;  4DR3 J;  2MTL A;  3OTO J;  4LF8 J;  1XNQ J;  2MQ8 A;  5BR8 J;  4JI8 J;  4LF7 J;  1HNX J;  2UU9 J;  2UUC J;  4X66 J;  3D3C J;  2KL8 A;  4YY3 J;  1XMQ J;  4JYA J;  5IWA J;  4DR7 J;  4JV5 J;  4DV4 J;  4LFB J;  3J7A N;  5LMU J;  4DV3 J;  4JI4 J;  1HR0 J;  4DR4 J;  1HNZ J;  1XNR J;  4B3M J;  4B3R J;  4DR6 J;  3R2C J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...