4DV0J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv0J00
1I94J 5LM7E 4JI8J 4YY3J 2KL8A 5LMUJ 4RJVA 4DUZJ 1N36J 1HNWJ 4YHHJ 4LF4J 4B3RJ 2HHHJ 1N32J 4PWWA 4NXNJ 4JI6J 4DV3J 1XNQJ 3T1HJ 4OX9J 3R2CJ 4JI1J 4DR3J 3D3CJ 5IT9U 4V1Ak 4AQYJ 3D3BJ 4X65J 4DV7J 3W1YC 4LF7J 4JI2J 2UXDJ 4DV1J 4DR6J 4LFCJ 2UXCJ 5IWAJ 4LF8J 4NEZA 4KY3A 4KYZA 4JI7J 4HHUA 2F4VJ 4JV5J 1FJGJ 4DV4J 2ZM6J 4DR1J 3IMQJ 3R2DJ 4JI3J 2UXBJ 4DV5J 4LF6J 2UUAJ 2UU9J 1IBLJ 3T1YJ 1N33J 4K0KJ 4X66J 4DV6J 1XNRJ 4JYAJ 5LMNJ 3J80U 4LFAJ 1HNXJ 2MEWA 4LF5J 2VQEJ 1J5EJ 3JAMU 2MTLA 4DUYJ 4DR2J 4JI5J 3J81U 2UUBJ 1IBKJ 4DV0J 4LF9J 4NXMJ 4KHPJ 2UUCJ 1XMQJ 4B3SJ 3J7AN 4GKKJ 4DV2J 4DR5J 4B3MJ 4X62J 5A2QU 4GKJJ 2KVQE 4JI0J 4DR7J 1N34J 1XMOJ 2VQFJ 2MQ8A 1HNZJ 5AJ3J 3OTOJ 4NEYA 1HR0J 5FLXU 1IBMJ 5BR8J 2E5LJ 4LFBJ 4JI4J 4DR4J 4B3TJ 4X64J
chains in the Genus database with same CATH superfamily
2E5GA 2H4WB 2J0SD 2K1RA 1YRTA 4TY8A 2MY7A 3AB4B 1RWWB 2PI4A 3N79A 4DMZA 2BM1A 1TV6B 2V63A 3EJMA 5C42A 2A10A 1Q4RA 4IG3B 5ADZA 1RKIA 4DN0A 3BBBA 2AYEA 1FVSA 1WI6A 2XS7A 1URRA 2QSWA 3N6MA 4I69A 1MMNA 5CABA 1OQ3A 4J5OA 1JMTA 1CS4A 1NSAA 3VAJA 1U26A 5KG7A 1ZS6A 1RA7A 1VRQC 4A4JA 4ZCIA 2L3MA 4U7UD 2YKNA 3OVSA 4R5PB 2LXIA 3M8PA 1XEZA 3HHLC 4IG0A 4ECVA 1GAOA 4X4OA 3C6UB 2EKNA 1YJUA 1H38A 1V3RA 2WSEC 1HNVB 2WVEA 4YY3J 2BBEA 1FKPA 4X4UA 2ZZTA 1GK8A 2YKQA 1HBNB 1RA6A 2HYIB 3D2WA 4X84A 3AA8A 3HZGA 2ZH7A 4RL1A 4V1Ak 1SUQA 2OPPA 3W65A 3CULA 1Q81T 2HLTA 1FK9B 5DG7A 1Y7PA 3TVYA 2JEJA 3KJQB 3OHAA 1HW9A 3TAPA 4LJMA 4UOGA 2MGZB 2BQUA 2ALZA 2E9RX 3CDBA 4QIVA 4WU2A 3HZEA 3L7UA 1R89A 2CNNB 3QLHB 4O44B 5EHHA 2QLFB 3K58A 3HI9A 3N9UC 3VAMA 3I9ZA 1P1LA 3C6TA 3BGOP 2DHHA 1R6VA 1FEEA 1S7HA 1RT5A 4AL7A 1L3UA 1S6QA 4M8LA 3MEDA 4GKKJ 3QIPB 1FRLA 3OJUA 1OIAA 4RNOA 1EJ7L 1RYRA 1UVIA 1ZZFA 2XYGB 1VHIA 3DGPB 1Q7LB 2CQIA 5GMKa 1YIJS 4MKAA 4P71A 5F8LA 4O3SA 1UCNA 4I6WA 2RUGA 4J90A 2C42A 2JEFA 2F4VF 2R7RA 3ZTOA 4JI4J 3MMBB 5ETPA 2ZKUA 4OHYA 4ZJQA 2P6TA 2V34A 3C8YA 1Q8KA 1BQMB 2YWEA 4X4VA 2AYMA 2N3OA 4JI1J 2YQ0A 3PJ9A 5ETVA 3TEHB 1NJYA 3M32A 3CD5A 1R0BG 4KC5A 4OYWA 2MXYA 4KFBA 3BREA 2CIMA 4RW6B 2W25A 2VFRA 3K8VA 1AXQA 1EAYC 3E01A 5THWA 2FY8A 3V5RA 3DGVA 2FPHX 5KG2A 2CQPA 4EYHB 3OVAA 4F4KA 2JH3A 4KHPF 4NYZA 1Q1KA 5I3UA 2Y8WA 2VQEJ 2EK6A 4ILLA 2UUWA 3T9NA 2RDJA 2HSEB 2MQOA 2MZRA 1D9DA 1NJIT 1NZ8A 2BJDA 1QUVA 2R7TA 2CJXB 2CPJA 2RVJA 4A46A 2BE2A 4KRWA 3W64A 3MM6A 2FJXA 1LW2B 2PA8D 3VALA 2LQJA 4X65F 4DU8A 4IO1A 4LF2A 2W9BA 3HDSA 4F25A 3BQ2A 4PQUA 1WORA 2Q1LA 4YMEA 4U95A 2Y1LB 2DNMA 3KXDA 3GZ7A 1BQNA 3TW0A 3MI7X 4FS2A 2CDQA 5F8HA 3DOLB 2C3MA 4MJKA 1H74A 2UUCF 3C3LA 2FIUA 3HHLA 2AZ1A 3TUPA 5CAAA 2GCFA 2XYHB 3PRBA 4U8YA 1N4LA 1SV5A 1OPIA 4L3NA 5CA5A 3Q89A 3W2VA 2Z57B 3BQ1A 5CCMA 3D1OA 1IKWB 3WX4A 4F4XA 1SC4B 2N4DA 3UDVA 2DH8A 1ULRA 5KFGA 2XC9A 5KT4A 1EETA 2CQGA 4LRAA 2QA1A 2CQ0A 3H59A 2B4UA 1YJVA 4F3QA 3BSNA 4AUKA 4A8XA 2IHR1 3DRXA 5KT5A 2AF6A 1FWPA 4DPYA 4YN3B 3OFHA 1KTVA 3J7ZT 2ZH2A 2V4JA 4IH6A 2CPFA 2YH0A 1UP1A 3MMCB 2FB0A 3QFWA 2YKAA 4HT5A 2KRBA 2MSSA 4DSEA 1RB0A 4RNMA 3ISND 3DYAA 3L95X 1U1RA 1TL1A 2UUBF 1FXRA 2DGWA 2RMLA 5KG5A 1S9EB 4ZCKA 3QJPA 1FTCA 4FVMA 3PYDA 5DDPC 4J9RA 4DV6J 5B0AA 2ZC4A 4OV6A 4DUYJ 3W5XA 1APSA 2X7IA 2DXFA 4LF9J 4CH0S 3BYRA 4USMA 4ED3A 1S48A 5D3GA 3VZIA 3GIIA 4FXVA 3DLEA 2C22A 4JI4F 3R97A 2ERRA 4BS2A 4QQBA 4UW2A 4OV1A 2BM0A 2FVQA 3BPSP 1TMJA 1JJHA 2LXFA 4PPZA 3W8GA 3LUYA 4JI1F 2EVZA 4ANCA 2IDEA 3PW2A 2BVZA 3MEGB 2PC6A 4JP8A 2BYCA 1IQTA 1SKWA 3MGJA 1R31A 1H7WA 2CAJA 2WB1D 3ZZ0A 1X4GA 3HT0A 2F9DA 3KK1B 4P7VA 2VF3A 4LR8A 3D1HA 2PA3A 1YJWS 2ZM6J 3KLIB 4I7FA 2KVIA 3HX9A 1S1UA 1TFYA 1T05B 2RF2B 2RKIB 1I94F 3C14B 3JAMU 1RTJB 3AD8C 4NLXA 1J27A 1RWUA 3QGHA 3NXZA 4DPTA 3JYTB 5IXUA 2RD5C 2E9ZA 2XHCA 2XMTA 2GIQA 3KLHA 1U24A 2VG6B 2NUHA 1D09B 3BBFA 2CQ3A 1RK8A 2FD2A 4NCGB 2CNKB 3DLBA 3TOQA 2WSCC 2XS5A 1S7IA 4AT1B 2QMXA 4DG1B 4OYIA 5KFFA 4U7UK 5EWFA 3BH6B 3LP0A 2XEXA 3GMGA 1ZM4A 2ZDPA 5EN1A 4EO6A 3L4BC 1GMWA 2NYIA 3HJVA 4KTQA 4Q8FA 2VA2A 1BD6A 1S9GB 2BABA 4ELUA 3M6UA 2Q6BA 4P2SA 5DO2A 2E66A 2UVVA 1RDRA 1S77D 1BY9A 4QIGA 2R7XA 1TAUA 5K8OA 1NK6A 1YI2S 3QMQA 1JJCB 4QR1A 1IR0A 2MLXA 3AAWB 4ELTA 1HBUA 2MJNA 3I9V9 3NLCA 2XNRA 2FGCA 4X62J 2HVZA 1FVQA 3MR7A 3EICA 2JVRA 3MAQA 2O1PA 2B7BB 1VRUB 3TO8A 4Y2KA 3LOUA 1OWXA 1CJVA 4L74A 1T94A 3N01A 1XJWB 2J9DE 2I38A 1N32J 2QV6A 2W4PA 4UOFA 4GVBA 3UR3C 5ETLA 1HQEA 1RTDB 5J1EB 4WP8A 4PQAA 5A8RB 2GVZB 3D3BJ 4Q0BB 4OX7A 4WE1A 2H3EB 1LWEB 2FLPA 4H4OA 3PW7A 4F36A 1KSPA 2BMBA 4QOTA 2UXBJ 2MQMA 2EG2A 2HAIA 3WHIA 1JXVA 2KHCA 4K4VA 3G87A 4LSNA 1C0TB 2E5LF 5IT9Y 5F9NA 1U25A 1VISA 4YUDA 1VQMS 4KGXB 5LJ3Y 4RWWA 5F8NA 1TKTB 4B3RF 5CYMB 3SQOP 2WW4A 2MPUA 3TYTA 5GADU 3UN3A 4CYUB 4C8LA 5E3QA 3TI0A 4WIIA 1UA1A 4IH5A 4OZJA 1NH8A 4UUXA 4F50A 3OV7A 3O8WA 1FD2A 4ECXA 3OHBA 2P6SA 5D4PA 4HT7A 3TX0A 2EWHA 1YKWA 2R8KA 5L9XA 4O3PA 3D0GE 2HQFA 4RNNA 2C1EB 3B54A 3M8QB 3UVJB 1XK8A 4OYXA 1QJHA 2V8GA 1N5TA 1NO8A 2DRAA 1NK8A 2RQMA 1DRZA 4N7TA 4MTPA 5K8NA 2WB4A 2MYFA 5BYRA 2CVIA 1U1LA 3OXLA 1Q86T 3FEZA 3MM5B 4P2FA 3HFVA 1B70B 3LP2B 3OFFA 2W2OP 1N56A 2AHOB 4I64A 1RAFB 1N33J 1WACA 1Y5LB 5EWGA 2PO4A 1CJKB 2MKIA 4U96A 3BGFA 1SB6A 4Y2IA 3CCSS 2B43A 2MKJA 1EHWA 3TARA 1HNIB 2F7VA 3T1HF 4R5PA 3AA9A 2LQ9A 1ELOA 4QIEA 4HACA 3SDEB 2ILZA 1V5IB 1BLUA 3P5BP 4NA2A 2YNIB 4PG6A 4ZCLA 1HNVA 1N0UA 2LU1A 4JI8J 5DM7Q 1FXDA 3Q83A 3NP5A 2B0GA 4BCAA 3GIKA 3ELHA 3FNNA 4UY85 1JLGA 1IM4A 2OPSB 2YQ1A 4F4AA 2DH9A 1Z2LA 5A8KA 1NK0A 2ZD1A 2EFVA 5AXNA 4PG7A 1UEUA 4HLBA 3UW1A 4C8ZA 3GIJA 2V9WA 2Z2LA 4HR2A 5B0EA 3V6DA 2ZFHA 4LFCJ 3QBCA 3NG8A 4DX6A 3N28A 4H4KA 1UFLA 3IO1A 4O44A 3MEEB 8ATCB 5H1SV 1NB7A 1VI7A 2V69A 4UQTA 4NL5A 1NHUA 2GO9A 3QAUA 2GHWA 1RTZA 3MAAB 3ILLA 3C2PA 3KNGA 2HQGA 1T9TA 4OI1A 5A2QU 2K8GA 1C2PA 1RCOB 4GO7X 1N32F 4JI7F 5HQLA 3FQKA 2YWKA 1RT7A 4RBTA 3NAIA 4RW4B 3RGIA 1PCAA 1X5PA 3CCQS 3QRQA 4IQXA 3OL6A 1QY7A 1VCTA 5KFHA 4WU3A 5KG1A 4WFBQ 3G71S 2OPRB 2CKWA 2DPIA 2AX0A 1N34F 4FS1A 1DY3A 5LJ5Y 3NNAA 3JB9k 4ICLB 2HRYA 2VG5B 4CO1A 1EQ0A 1U2CA 1X4DA 3LWLA 4LSLB 1XMBA 1C0UA 4KH0B 1N0VC 1SKRA 4QWDA 2CZVC 4I56A 1ZPVA 5A0YA 4ANEA 3HVTB 3G4SS 2KM8B 1REVA 2MQ8A 3PFOA 1JKHB 4ECRA 2G13A 3PNIA 2RB7A 3HO1A 3CPWR 2ZHAA 5GAGU 4TYAA 4G65A 3SFGA 2VG7A 5B08A 5HJYA 5HBMB 3H8YA 2JEGA 3RRHA 3HFZB 5L9NA 3BB5A 4DR3J 2EI5A 2KB2A 4Y2AA 2ZBRA 1K44A 3DM2B 5E5NA 2ALYB 4Y6IA 4CZCA 2Z4PA 4DSKA 2VBZA 1JX4A 1S0MA 4OHZA 4O0NA 1Y10A 4M5JA 3LW5C 2KZMA 3GG1A 2N82B 3QFHA 2MY8A 3GFZA 1K0VA 2XG8A 3QJJA 2LMIA 3OTOF 4UZBA 4CH7A 1B0TA 2BUNA 2CXEA 3BO4A 2PI5A 1KWMA 3CJTA 4DR4F 2DR9A 1VRTB 3TR5A 3T5LA 2QG9B 2IM1A 2BV3A 4J9SA 4ILRA 4KV8A 4ZHRA 1RHKB 3GFYA 4FBTA 3GR0A 1QM9A 3AB2B 5ETNA 4CQ1A 2FLNA 3KLGA 4YOEA 4JI8F 2BJ3A 4XIUA 3MM7B 2IM3A 3D0IE 2E1AA 1NMEB 1O51A 3ET6B 2BXJA 4DX7A 1G1XA 3UDEA 2O67A 4WTOB 2HIQA 3MMCA 2GNKA 1LW0A 2HS4A 4MIWA 2GVDB 3M6WA 1PJ5A 3EDRB 1O5JA 4LFCF 4TKTA 2YKMB 4USTA 1AROP 5GADI 3PEJA 3MM8B 4LQ9A 3DLKB 4K2XA 4F04B 3QATA 3H4DA 3KK3B 2QL5B 1ZM2A 5I42B 2MZTA 5DZ7A 1F9EB 1HNZF 2BKPA 2NQPA 2GX8A 3T1YJ 4O3RA 1TL5A 3TNVA 2HZCA 3K57A 4DXLA 3JSBA 3OR2A 1PC5A 3Q86A 2G2YA 4JI6F 4LMZA 1HKAA 2E7WA 5L1KA 1S57A 1Y00A 1ZBTA 2IBOA 2HZVA 4MK9A 3HLUA 1U47A 1RWKB 5KFVA 2W9CA 4K50A 4FF2A 5LMUJ 4YHHJ 1WHVA 1GQEA 3ITHA 4F26A 3L3CA 1YVFA 4DL4A 2JFKA 4JOUA 2RRBA 3D67A 4KGKA 1R8BA 4OYAA 4CRJA 2C2ZB 2HQDA 4B9UA 3Q24A 2JOQA 3ZO7A 2G0JA 3DI6A 4U67Q 3FKBA 5CH7B 3Q8PB 1HHTP 2VQFF 2HK2A 5EX0A 3OL8A 1IKVB 3CC7S 4PXBA 3KNAA 1T05A 3PHTA 2RKIA 4W90B 2V8DA 4HL9A 3V4IA 3QT5A 1VIOA 3RB3A 3WX8A 4NRUA 1C1BB 2H5EA 3CVKA 1IKXB 3M8WA 3DXBA 4JV0A 3DLHA 3JYTA 4DR5J 2CPZA 3NGSA 5D4LA 1SBRA 3DHWC 2FHOB 1GTEA 2IRXA 3W62A 2E5IA 2B6AB 1OSDA 4NCGA 4NE9C 3JTNA 5KAKA 2GQ2A 2HFUA 1N48A 3SCKE 3M9NB 3QPIA 2EFOA 3A8KA 5LMNF 3D28A 2HRUA 1PYSB 4QPTA 1T03B 3TA2A 3P3DA 2HVEA 3BGUA 2V9KA 1QLNA 1E6YA 4FF4A 3GJSB 2G9OA 2XB2D 1RQ0A 1J2VA 4RO0A 1U1OA 1CJTB 4KKOA 2FQQB 4EMDA 2VC0A 2EC2A 1H2TZ 2LA6A 1IQZA 3F44A 4DR2J 4UUWA 3ILIA 4OI4A 5D77A 2PMHA 5HVFA 1JXEA 5DQHA 1WEZA 1N54B 3WIUA 1VQOS 3C15B 5AE1A 2VPZB 3QO9B 2B5JB 2ZJQQ 4PXDA 3ETMA 1NPKA 2ZUAA 5ETMA 4DN9A 2W9AA 4HDHA 3GYXB 1IBCB 1X60A 4QW8A 2U2FA 3WDOA 2CNOB 2RUSA 1UW9A 3PX4A 3ZZOA 5CHCB 3PXGa 2ZH3A 3ZZPA 1BMQB 3EE3A 1BQXA 3RG6A 4USJC 3AD7C 2EW9A 1XR6A 5J2NB 4K4WA 2BJ1A 1K0TA 2RILA 4EYIB 1UEVA 3P8BB 4TY9A 1WC6A 2EK1A 4ENOA 4PXCA 2JVOA 1Y3KA 3MEKA 3GIMA 3MCNA 4A8FA 2M88A 2DRDA 3GYGA 5FDLA 2OHDA 2QL7B 2V5HG 3CCLS 4ZMMA 1HBMA 4FZVA 1PBAA 1TKTA 4LF4F 5CYMA 1CBKA 1T3OA 4DV0J 2RHQB 2Z56B 4GC7A 3I5AA 4N77A 1TUGB 1VK8A 1GXLA 1DBDA 4DF4A 3R1LA 2CPYA 3K8WA 3F56A 4RBUA 2V6AA 2GJIA 2R7UA 5LMUF 4YHHF 1U4BA 1UFKA 1S4EA 2B4OA 1TL3A 4A8YA 2KL8A 4RJVA 1IBLF 4ETZA 3KK2A 2J9EA 3KLFB 2XWYA 1PAEX 1G6BA 1GXTA 5DZ6A 4J9NA 5A6WA 1NJWA 2OSQA 1X4BA 2ZH9A 4EI2A 1H2VZ 1O6XA 1JLEB 4DV1J 1DTQA 1NAQA 1CQMA 3UN5A 4RU9A 4CDIA 2NREA 4DR1J 3GCWP 3PEHA 3MCMA 2DEIA 3DCAA 2NUUG 2NLWA 1QSSA 1JLCB 3M30A 4Q44A 1N88A 1M1HA 3UE2A 1WWHA 4PPDA 4KB7A 4Y34A 2NZ4A 5C25A 3CMES 4F3MA 2JHEA 2OAUA 1WELA 1X5TA 3ONQA 5ETRA 4MKBA 1SL0A 1QUPA 1R27B 5CCLA 5ETSA 2X1FA 1PJ6A 1TKXA 3JSMA 1JLQA 2HNYB 4QJVA 2L9NA 1MWQA 1B64A 2HQCA 4F0HA 3IFEA 4K0KF 1RHUB 2HURA 3MFIA 1WDTA 4C8MA 4OZLA 2MLZA 4A8SA 4HVZA 4AFFA 5KFDA 3RB0A 2B51A 1MMDA 3UCZP 1CJUA 1FTRA 3PFEA 2I1RA 1AZSB 2H5JB 4BDPA 4MYUA 4DV7J 4JI2J 1S1WB 2ZWPA 4X4RA 1FE0A 2HHSA 3FQLA 4Q5VA 2F4FA 4GKJF 3L9ZA 2VUGA 3LTOA 4DQSA 4RWXA 2ADCA 4KIAA 1ROFA 4NLGA 3MEEA 1WC5A 1S6PB 4QZVB 1UMJA 2EXUA 4DS5A 4M95A 4ED2A 3EGNA 3T1AA 3PHEA 4RBVA 1FFGB 1KNZA 1TK0A 4ECTA 2V8PA 2O5DA 4YP3A 3VGTA 3E3XA 3BS9A 2DGSA 4KR0B 2GFFA 3A4TA 3V4MA 1OS5A 4B3TJ 1YWXA 1KVKA 2DNYA 2W7OA 2DR7A 3OTEA 2J6UA 1LWXA 4DV3J 1NM2A 4X4PA 5HVGA 2JLEA 2V68A 4NYPA 2FTRA 5DS7A 3DDIA 2VBYA 1IBKF 3MOZA 2MB0B 3MR6A 3GB0A 3T3FA 2HMIA 2UXCJ 4W4MA 3BZQA 3V81B 1DLOB 1ZAXA 2HS3A 4OZNA 1FJGJ 4DV4J 2R8HA 4USWA 4WK3A 5J2MB 4XO0A 2LFVA 4DV0F 4C8YA 3TQ1A 3Q8RB 3VGVA 4LF5J 1KLMB 2X51A 2XSJA 2IJNA 1IWGA 2E44A 3QJLA 4LIWA 1P1TA 4FPRA 2ADBA 3R6LB 3HVTA 4TY8B 4UOCA 2MZQA 1NPPA 1UEKA 4YB7A 1H3DA 2HBZB 5C42B 5FLXU 3DMJA 2HGMA 3IWLA 5D6GA 2Y8YA 2P9GA 4ZVGA 3ILJA 3NNHA 1PIEA 1VLYA 2BJ8A 3GFXA 1JB0C 1TQLA 3OW2R 1JLAA 4WFZA 4M5IA 2KKHA 3FCHA 3FFIA 2VHGA 4DV1F 4DSJA 2J0WA 1IN0A 1IR1A 2ZHBA 2DXEA 4NXMF 2R7SA 2KFYA 2XULA 1RWMB 2W2PP 4LF8J 5A6PA 5E41A 2PSZA 3KHHA 3DOKA 2YKNB 1IJEB 4JV1A 1HQ2A 2RNEA 2XZWA 3M8PB 3KOAA 4LFBF 3M6VA 4BLGA 3FSXA 1UZHA 4IG0B 3KJNB 1VQNS 4DUZF 1HMVB 3TJAA 2J76E 2BRLA 1FKPB 1TL7A 1A0OB 4IKAA 2GHPA 3LAMA 4ILMA 5IZHA 3VVTA 2UXDF 4NWBA 1HHSA 3OBIA 3ETOA 1SUQB 4F4ZA 2M70A 4JB8B 1IKYA 3RR7A 1HWUA 2QMUB 1KR4A 3A8EA 5CQGA 3FUYA 1K9MT 4NCBA 3B6BA 2HG4A 3KHRA 1Q0NA 3LPEA 4CI0B 2DVIA 3FSYA 3T5HA 1JQGA 4Y28C 4NLWA 2UVRA 4R25A 2QT7A 4AQYJ 3C6TB 4RW8A 1HWKA 3TZZA 1F5CA 1S0NA 4ZVEA 1RT5B 1F9HA 1ZM9A 1S12A 3GSIA 3FEYB 3NAHA 1S6QB 2BACA 1S99A 4XK8C 3LPYA 1PYTA 3H5SA 3MEDB 2HVDA 2M9KA 3ZTQA 1WKKA 4U9RA 1S1TB 2GV1A 2RDDA 4QBUA 1P8GA 1U6FA 1HNXJ 4KT0C 1DQAA 3IGVA 5C5JA 2HGNA 3T5JA 1KVIA 1VQPS 1WSVA 5KFXA 1Y5NB 3BM7A 3UQSA 4CO2A 2R3VA 3T6JA 4WYLA 3CIZA 2DGQA 4P52A 3OXFA 2R7QA 3GLJA 1GEHA 1B0VA 2GGPB 2GQQA 2N7CA 3M32B 4HDGA 3TZXA 3GIRA 4C48A 4OYOA 1J5OA 3HHNB 2W8KA 1M0SA 2R8IA 4QYZK 2BKNA 5L1JA 2V8HA 3CF5Q 3E01B 3U7JA 1Y4ZB 2UXCF 2FZCB 4DHVA 3GJRB 2DNGA 3OR1A 2UVWA 3FRYA 2XSFA 3S8SA 3T19A 1VQ9S 1OPZA 3X3UA 1XC9A 3NWRA 1S0OA 5GMDA 3HD1A 2CQDA 3M2RA 5I3UB 3H20A 2WTFA 2OTLS 4B3MF 2AJ2A 2IA6A 3B4MA 3RBEA 2QFJA 4LF5F 2NSBA 2XHWA 2GJ2A 4LF6J 3HSZA 2NS1B 3IN5A 2YX4A 1M5VC 4BC9A 1SQGA 2BE2B 4K8RA 5KT2A 1JLBA 2YWFA 4CLPA 2W9BB 1R0AA 4DU7A 3LA0A 1AFIA 4PQUB 2VBXA 1VQ5S 4EGLA 2DKOB 3M8ZA 2Q6CA 1RP5A 4Y65A 3PZPA 2R7OA 5KFSA 2F9JA 2FHJD 4WTYA 2Z8QA 3TUIC 1B0PA 1BQNB 1UWBA 3NEKA 3PJWA 5LSOA 4A8MP 2BANA 1IM6A 5KT6A 2C2KB 4KE5A 2KG1A 1UVKA 2GS8A 5SZTA 1X4CA 4XDCA 4FXWA 1WOSA 1RKJA 3AQPA 1E6VA 5B09A 1SV5B 2KXNB 4FVCA 3D3CJ 3M1VA 2F65A 3ZFVA 4K7QA 3W2VB 2QE5A 1RTHA 4FPIA 2IVMA 4ID5A 2C2OB 2FLOA 1FE4A 1X4EA 1AT1B 1RI7A 4PAAA 2Z30B 1V5VA 2LXUA 1FT8A 4MK7A 4F0MA 1L3KA 3PTWA 1PJ7A 2J7WA 3KDOA 1J5EJ 4FN5A 3EPGA 2Z2MA 2AJFE 2CWXA 2KDOA 2OMLA 3CJ2A 2RS8A 2DO0A 4R8UA 1MWZA 1U45A 3HKWA 5HMWA 3OSNA 3KMQA 2HHXA 2HHWA 2ROGA 3DOMB 1FKAF 4OI0A 2V4JB 3AY0A 3KUEA 1KQFB 4KAIA 1QVGR 4WK1A 3R27A 3DRYA 5GVQA 5J2QA 4NLPA 3UD3P 5IWAF 3DYAB 3CO9A 4JBCA 1TL1B 3T5KA 3AJ1A 4U6PA 1LQ9A 1KOHA 2DNPA 2VZ9A 2PMZD 4Q43A 2PN6A 4WP9A 1FNXH 2KYXA 3S7RA 1TUVA 4QIFA 1KEKA 4QWAA 4QIWD 1HD0A 3NCQA 3DN9A 3UPFA 1CC8A 1WF2A 2D3O1 4KH1B 2OPQA 4ED8A 3MUTP 2U1AA 4NEZA 1Y5IB 3RBXA 1TFWA 1NB2A 4ES1A 2BOPA 3UNYA 3U1MA 4CNZA 2AJ1A 2KZZA 3PV8A 3ULHA 1PSDA 3K59A 5D3GB 2WW8A 4ALZA 3DLEB 1SJRA 2B56A 3PYFA 4PXEA 4LFAJ 4J9UE 1SC6A 1YBUA 2ACMA 1B7YB 5I3PA 5T7LA 3D5MA 4OX9F 3DLGA 4UF4A 2AWZA 1FDAA 3PYGA 1HFEL 2DGTA 1FWKA 1VBKA 2DISA 3GV7B 2XY6A 2E1PA 1XR5A 2DB1A 3JTOA 2W24A 3W9JA 3VAHA 3R5AA 1WG5A 4DFPA 1DQ8A 1XNRF 4JYAF 3KLFA 1WJ9A 4I7FB 2IFXA 2I6WA 1BXNA 4TU7A 4RZRA 1S1UB 3MF5A 2W7AA 1C4AA 2XWXA 5M2UA 4NLVA 1AFJA 2VA3A 2FZKB 3G6YA 2ZNZA 5CYJA 1HQUA 4Z7YA 1XQIA 2PIIA 1HPZB 2ZWOA 4L72B 4M5MA 4OL8A 1VBYA 4HI1A 2AZ3A 1D1UA 2DH7A 1NK5A 2C2RA 1JLCA 2ZOFA 3R5JB 1Q8LA 4YB5A 3S6EA 2KT3A 2Y9HA 3CJKA 3KLHB 5F8IA 1YJ9S 3RUBL 4F67A 2FDNA 4KGZB 1H73A 1NUEA 1KQSR 3KG1A 2E29A 4NZ0A 3TRGA 1CLFA 1EP4A 3MD3A 4ZPVR 2J6TA 4Q8EA 2G2ZA 2QX0A 2DJWA 2HKEA 1VQLS 2IM2A 2DIVA 4DSIA 4ZPCA 1NKEA 3OFEA 5CD4A 3QWPA 4KO0B 1Q8IA 2KXFA 4P9SA 3W63A 4HKQA 5HI7A 2LDIA 1WOPA 3HMJG 2HHHJ 1FNMA 4PWUA 1LWFA 3GWCA 3AFGA 3R2CJ 4URGA 4W92B 4X4NA 3QRPA 1JWWA 4NLUA 1YHQS 2F63A 3AXMA 1KVJA 4I4BA 1SJQA 3SXLA 8AT1B 4DX5A 1UJ4A 1KHVA 2G1DA 1HBUB 3MMAA 4DL0C 3KWMA 4LVOP 1GTHA 3D66A 4P6QA 4FXDA 3PR5B 2ZBPA 4DPWA 3P4UB 2VFSA 4L73A 2VDIA 2KT5A 2RE1A 1CJVB 3H5UA 3DFEA 4Y00A 5HMYA 4QWEA 5M2RA 3WQPA 4GVBB 1HQEB 2HFNA 3KLEA 4OYMA 3GR1A 3MDFA 4L3KA 1RHJB 4WE1B 1RWVB 4ZLPA 3PYEA 5GAHU 2DHSA 2H51B 8RUCA 4OZ2A 2KTQA 3FVYA 3KTQA 3QYYA 4JI5F 2D41A 4WFAQ 4LSNB 5A8WA 2I5JA 1FI4A 4WKRA 1SKSA 3CJ0A 3RB4A 2IDLA 2ZVSA 1UVLA 3W2WA 1FKOA 4DLEA 1ZTTA 1JNRB 5I3QA 2F8MA 3FK4A 4ZIWA 1FJ7A 4ZS6A 3THVA 1D8ZA 2ZDOA 5F9LA 4GC6A 2F5GA 1XNQF 4WBFA 4WF9Q 5KFLA 3G8TA 1EQMA 1YZ6A 3CJ8A 2M4MA 2IRUA 4K4TA 2XGPA 1S0VA 3D6FB 1NKCA 1S4FA 4P72A 3PRVA 3NMRA 3IAM9 3HJFA 1NDCA 3ICLA 3MM9A 1S79A 4B9LA 3VV2B 4OYPA 5IOLA 1MU2B 5KT7A 1NEEA 2QO3A 1UA0A 2ZOMA 4ECSA 1NCLA 3BV8A 1S97A 3NNCA 3AD9C 2BDPA 2APOA 3GV5B 3CJ3A 3NGTA 3FGVA 4GRSA 1FDBA 3W9IA 2OKQA 4K4XA 2X1BA 5HK4A 1BHNA 4HACB 1UWAA 5LT5A 2EFQA 2MHNA 1W2BR 1D0EA 3J81U 3J7A1 3UNGC 1HMVA 2NXUA 4RLEA 4ZVUB 2CQ2A 3F73A 3K0JA 1RHMB 1IUJA 1DTTA 1JLGB 1ZA1B 1PO6A 2PGCA 2D74B 5D4OA 2XLJA 5A8KB 4ZVHA 1R0CB 2UVUA 2RH3A 2ZD1B 2KRRA 2HFZA 5EDWA 1FDNA 4NLYA 4XDDA 3V6DB 3NGRA 3N5FA 4IH7A 2BZ2A 4DPXA 1CEZA 1SIWB 1OYDA 2V2VA 2AMCB 1X5SA 4N8NA 3T41A 4RU2A 3BO2A 2AJQA 3EVMA 1X0PA 3MUVP 4DCOB 2FVSA 3MR2A 1M5PC 4TLRA 4DR7F 2HQ3A 4ZLNA 1YZ7A 4DV5J 4MH8A 4WFYA 1NPRA 3H42A 2HAFA 1XN9A 2UU9J 2DNOA 1S1TA 2CVEA 5LOQA 4DZDA 1EIYB 4YEAA 5J1NA 4B9MA 3SQGB 2RQKA 2DNRA 1BE4A 5DQGA 2C3PA 2ZEJA 1U1QA 2DGUA 4P7TA 1K8AT 3TX8A 1RT7B 4F8RA 4DFMA 3DDNA 3GFHA 1Q5VA 4U7CA 1FXLA 5EUHA 2GGPA 4CO4A 1U09A 3WBZA 1SJ1A 3SCLE 5T14A 4DQPA 2Y1JA 2JNJA 7FD1A 2R7VA 3Q0AA 2FJDB 3QNWB 1XMQF 3CCWA 1C0UB 4KYZA 2W4CA 2E1RA 4WZMA 3WC0A 4JI3J 3UWTA 2KU7A 5DG8A 2KJWA 5A0YB 3NGKA 2VOOA 2K3KA 2ZBIA 1QTNB 1REVB 4RUAA 1C1CA 3GONA 5C24A 3PR4A 3CW2C 1FNOA 1HD1A 5F0UA 3RZAA 2OGUA 2VG7B 1IR2A 1YLXA 4QCLA 4DLGA 1WEXA 4OFZA 5G0RA 2DNLA 4CT8A 3TAMA 2GO8A 3SFUA 2HW3A 5HQ8A 2W2MP 4BHQA 1RAOA 1VQYA 3I0RA 1BC6A 5HP1A 3ZZZA 1KN6A 3GJTB 3I4PA 2C3UA 3OPKA 4TVAB 5D0HA 4V19J 2D3OR 3VQSA 1R43A 1WOOA 1VIXA 2POKA 2DCUB 2RSQA 3CD0A 2AYGA 5DLFA 3OTCA 2X3DA 4RNFA 1AUDA 4KV8B 4ZVFA 3ZZUA 4ZHRB 4HI2A 5EGYA 3CNQP 1RTIA 2HZAA 3KLGB 4EUVA 4L75A 4C3LA 5GAHI 1TKZA 4YY3F 4CNYA 3GP9A 1L5UA 5RUBA 3W8PA 1TMMA 2CJAA 4I1TA 3QZ8A 3DOMA 2DHAA 4N47A 1G2EA 1RXOB 1NHKL 1LW0B 5IC4B 1NK4A 2JEIA 4M5DA 3SSRA 5AJ3J 7AT1B 3PX6A 2DR8A 1IBMJ 1FESA 3S1TA 1CSJA 4MIAA 2VFVA 1S72S 2XCAA 1UFWA 2ASDA 3DRSA 2HNZB 2JRSA 2WK4A 1KHWA 3DRRA 5DDRC 4A8QA 1GH8A 3TUZC 1Y9OA 3PCOB 1WDDA 5HO4A 4G3IA 4ED7A 1O8BA 2YWHA 2E7XA 1MROA 1RT2A 1RBOB 2ZZNA 4DV5F 4B9NA 4LF7J 5KOWA 4GKKF 1RAJA 3GCXP 3LQVA 3OR2B 1RSCA 1VOMA 1GFWB 5HAOA 3E51A 4NA3A 2ZH6A 4IFYA 2DO4A 5K8MA 1QAIA 3SMZA 2KHDA 1PG5B 3R5BA 3H4BA 5E3AA 1U1PA 1NXIA 2V50A 4MKYA 3C46A 4YR2A 2J8AA 4CCHA 2G0IA 2NYHA 1Y0HA 2C2EA 2W9CB 5LSLA 3C16A 5KFYA 3NL0A 3ITHB 1ACMB 3A12A 5B0CA 5LL6d 2XQCA 2FHKA 2AW0A 1HR0J 2XNQA 2BJ7A 4NASA 4X64J 4KHRA 4Z2XA 3HXMA 1Q78A 1MMLA 2RDIA 6FD1A 1MN7A 2ZE2A 2M5YA 2A1BA 1IJFB 4BWMA 1HNWJ 3H5XA 2KFNA 3DI6B 5CZXA 4M5HA 2O01C 5KFBA 1M5SA 2LQ5A 2J8SA 3R8YA 1H2UX 2VQEF 4J9QA 1R8AA 1RAGB 1U0SA 2ATCB 2BE7D 1U2RA 3SV3A 1KONA 3GTYX 4O3QA 1A6LA 1F5AA 1F1BB 3OSPA 3W60A 2DR6A 3V4IB 3IR6B 2UP1A 2BKOA 4B9SA 1HPZA 4I67A 3MR3A 2HHPA 3QGGA 2V2ZA 4FF1A 3IRXA 4FYXB 4DUTA 3NS6A 3NKYA 5B0GA 3WIVA 4PUOB 3VF0B 4F4YA 1NK9A 4UQGA 4FBUA 4M5LA 2K3IA 2OFGX 3G6ES 1YRXA 3HSGA 3IAS9 2VPYB 2DY9A 1R6YA 1PGZA 5BJRA 4ZVPB 5BR8J 1X5OA 3GG0A 4O3NA 4KO0A 3NGDA 1E6YB 4AL5A 1CULB 2JLFA 1BUXA 1TKDA 4KKOB 2PDAA 1XTZA 1S1VA 1MLAA 5DQIA 3M4XA 1OYEA 4WPAA 1AB8A 2MQPA 1VYAA 5HLFA 2VIHA 1NDLA 3UD5A 5DGBA 1NBEB 3MTJA 2B4VA 1JK9B 4A8KA 4I6AA 3EUNA 3PW4A 2VODA 1RAHB 2EFGA 2HFVA 3BSAA 3BDEA 4MT1A 3IS9B 4UY8T 4H4KC 3V6HA 2MLYA 2CQCA 5C7PA 3NBPA 3QGIA 1ZYQA 4Y2MA 3QAEA 1GNKA 2H9ZA 4NLRA 3JQKA 4CLLA 3KJFB 3HFKA 1VQSA 2LEAA 4EO8A 2HIYA 3KJVA 5IS2A 3D6HB 3PY8A 3SV4A 3MFHA 4QU7A 4DV6F 2BRKA 1S5ZA 4QW9A 4ZPBA 2B8QA 3MCSA 4DUYF 4K4YA 1FA0A 4CM2A 2CPDA 4HH1A 2PEBA 4K5RA 4LF9F 5FDLB 1U6BA 3G82A 4FYVB 1HBMB 5LXRA 1JJ2R 3AOBA 5L1IA 3CC2S 1RUSA 2QMWA 4JV2A 2VASA 4JV5J 2B8PA 3TVZA 4K4UA 1HA1A 2MQNA 3BN7A 2ZJPQ 2A2CA 2QTWA 3UD4P 4HTIA 2V2QA 2WBMA 1A7GE 4ZITA 4EZ6A 4J9LA 3OXGA 3ZNUA 3TJ8A 5AXMA 2FVRA 4HHHA 2QIFA 2F3JA 3FEXB 4FNHA 4DL6A 5H9EJ 1TL3B 2P2CB 3EGVA 3LP1B 4MAKA 2KN4A 3KK2B 4KBIA 1HNWF 4WXWA 2ASYA 2RJZA 3N5BA 5FD1A 2ZM6F 4NLOA 1F0XA 4B17A 1DTQB 4J37A 3M05A 5IT4A 3IWXA 3GYNA 4IFVA 4ZJOA 4N56A 1FRKA 5DETA 1YJTA 3OD2A 3HK2A 3O2IA 4F7VA 1WC0A 4UZCA 3RW6A 4ZCMA 4FKXA 1MU2A 2YBVA 3M30B 3MUMP 3H25A 3CCZA 3OFGA 4PWDA 2CQBA 1N5SA 5C25B 2XZDB 1UPPA 1RU1A 3CCUS 3FZBA 1ZETA 3HHLD 1NH7A 2EFPA 2EC0A 3X1LB 1L3VA 2J9CA 2Z2YB 2RQCA 1TKXB 3JSMB 2A0FB 1N6QA 1JLQB 2VFUA 4OHWA 1CC7A 1SIZA 1EKSA 4ZN1A 1T9UA 2B3TB 1WUUA 1RWPB 9RUBA 3VHQA 1GMUA 1GX6A 3FC9A 1LFWA 3NS5A 3Q8YA 4OJHA 4IUFA 4I6YA 3BF4A 3HD2A 1SJ4P 1DURA 1CJUB 3KYLA 2NXNA 1U2FA 2DHGA 3BGRA 1T02A 4USVA 4ZP8A 1KQGB 1ZM3A 3R7BB 5IM0A 2YX1A 1REGX 3UDLA 1V6HA 4C4WA 1F3FA 9ATCB 4C0HA 3HCXA 3ZTSA 1HHQA 1Q79A 4EBCA 4X62F 2F4VJ 3SSQA 2FJEB 1RCXB 3ENAA 3PM9A 2F1FA 2UZAA 1KFDA 2EEYA 2CRLA 2RS2A 3SQGA 2IAJA 1UJ6A 2K06A 1RZMA 3D68A 3VAIA 3CGIA 3CCVS 1TR0A 4OI2A 3JQMA 2RQ4A 4C8NA 3IGNA 5J2PA 2GAHC 2XGQA 1X9MA 1Z4UA 2XBPA 2DYAA 4R0JA 1A9NB 4C7QA 1XR7A 4B9VA 3OVBA 4ZVSB 2UXBF 1HYSA 4C97A 5K14A 4CIOA 2DD8S 3FBFA 5DM6Q 3VWSA 4ZN3A 2HMIB 1VQ7S 1FJEB 1B4SA 3BGLA 1S1XB 3U27A 2XMAA 4AXIA 4P73A 4U8VA 5K8PA 5HROA 1LK7A 4M63A 4DQRA 4PG8A 3CE8A 4X65J 2OO4A 3KKFA 3G2XA 3VZHA 2AJ4A 4H4MA 2XSJB 2FJWA 3R5GA 1H72C 2LQ8A 3EGWB 1U8SA 2OSRA 3CCMS 4E8UA 3J80U 4F2RA 3FBEA 2OP5A 1TELA 4IRCA 4DDFA 2XLKA 3RRKA 3DMJB 2ZH8A 4G1QA 2CZ9A 2KXHA 3PIOQ 2UUCJ 2C2NA 2DGOA 3POTA 1JLAB 3H90A 4MFBA 3FFIB 4MKVA 1NJZA 4RPFA 2JFDA 2WSFC 2M52A 1IXKA 2QLWA 4PR6A 4QYRA 1RACB 4LRBA 2JJ4D 1F60B 2R9LA 1N33F 1YX2A 1VQ6S 1VQ4S 3DOKB 1H98A 4EK2A 1WSRA 2QJ3A 1DHMA 4DQQA 1TAQA 1EX8A 2LKZA 3OTBA 4IYQA 1Q7YT 4CT9A 4LRCA 2ROPA 3A3PB 2PMWA 3CTRA 2CWKA 4FYWB 5KFIA 2FVCA 2DTJA 4S0MA 1TL7B 2ASJA 3LGHA 4P2XA 1GMWD 5JMNA 1S76D 3OLAA 2RU9A 3KMSA 3AQOA 2QA4G 1VK3A 1RT3A 2UUBJ 2YPZA 4YB6A 4ETXA 3QT8A 1IKYB 1TU0B 1U6ZA 4TYBA 2EKYA 2A6MA 3HVAA 2VD3A 1CQNA 5ETTA 3MR5A 5D0GA 2OEKA 1N5YB 1YJ7A 4URSA 4I0WA 3P5TL 3HULA 3AXKA 4C98A 2VC1A 4RW8B 5HL7Q 4GO5X 1N36J 3A3OB 2MKHA 2HNZA 4ZDNA 4LBIA 2G0CA 1F2HA 2EPIA 4AE5A 3HVWA 2VFTA 2WAQD 2WONB 3SI8A 1RBAA 3EPIA 2WCXA 2PE8A 1B3TA 3EGZA 2NCKL 5F8MA 3TZYA 3MXHP 2KO1A 1WKLA 2ZNYA 1SH0A 3FCVA 2CG4A 3OT9A 1K1SA 4LSZB 3CT9A 1NK7A 4NI2A 2XZTB 1L3TA 1HWLA 3HVRA 1I5OB 1HI0P 3KG4A 2VBWA 5CZVA 3UDCA 2X1GA 4G1IA 2R8GA 2GMHA 1J5OB 1NDKA 1WG4A 4RKUC 4OJ3A 1Y3JA 3Q2SC 3I0SA 4C11A 4E98A 1XMOJ 4WIQA 4DFJA 2D7SA 4O3OA 2CYYA 3M9MB 3BJYA 4OMFG 3TUJC 3OR1B 4KQZA 5HATA 2O66A 1I94J 2VV5A 5U47A 2JLGA 2CPHA 3O3LA 3M2RB 2AU0A 2XMJA 4LRFA 2CJQA 5C2GA 2QL9B 3SBMA 3QIDA 4ZVQB 4LT6A 2Y3YA 1SQEA 3MMJA 1SQFA 2B9EA 4ANDA 1ITPA 2FLLA 2VKRA 1P27B 3TA0A 3BKFA 3CJRA 3ZZRA 3RBDA 1JLBB 1T7PA 2C28A 1RAIB 3HHDA 1DZ5A 1R0AB 4PZVA 3SZ2A 5L8RC 4WWSA 2DGVA 2V8VA 3MPWA 4QWCA 5L46A 4LREA 2VJUA 4X66J 3V6JA 4W98A 1TZ0A 4PUOA 1MWYA 3MECA 1RHRB 5I4MA 1UWBB 2KI2A 2IRYA 3UI3A 3A8IA 2BANB 3IM8A 3NMAA 3JXOA 4DR3F 1S6OA 1URNA 4I2PA 5KFQA 2MHEA 1R8CA 3L7PA 3BR9A 2CJKA 2XCPA 2ZHOA 1E6VB 4M5GA 1TVRA 3M1VB 3H7HB 4Q2MA 2LP4A 1NLKL 3IP0A 3O6QA 2XY7A 1ZAWA 4C0BA 2IC3A 1RTHB 4DPOA 4ID5B 4ZJLA 3W61A 1CULA 2M0GB 3DXSX 3MZIA 5GAEU 1M5OC 2R2RA 1X4AA 3DHXA 3P45B 3H5YA 3MAHA 3RJMB 1S10A 1UW4A 2ZC3A 3W3SA 3HP6A 1HW8A 5K9FA 3KHLA 5G4DA 4R8UB 3RR8A 4NX9A 1G7CB 4E2FB 1U8WA 2H1YA 2OD6A 1TUWA 1UPMB 2IYIA 4OIXA 4PEOA 4A48A 1VLOA 2DITA 4M1KA 1WC3A 5J2QB 4FDFA 3IS9A 5D0RA 2NPFA 5KG4A 4C0OC 3R6GB 1YJNS 3J7AN 2DHXA 1I1GA 1U1NA 2W1BA 3IG1A 2D9OA 3E2EA 1QVFR 3DRPB 1AW0A 2J5AA 4PCQA 4DJBA 1FRMA 4NCAA 3WC2A 2V4QA 4B3OB 1N36F 2W8LA 2M2BA 3I4HX 2E5LJ 1FO1A 3RYLA 1FF2A 5IV4A 4IDKA 1JXLA 2OPQB 4LBHA 2KFZA 3T1YF 4B3RJ 3CSKA 3QSYB 3I55S 3CO0P 5KFOA 2HS0A 3R9LA 2QEXS 2FHMA 5L38A 3LH2S 1RT6A 1RU2A 2E1MC 4DR6J 4RNHA 1NHVA 3PO4A 2FC9A 2IVYA 2OUGA 3M2VB 4BBYA 1HWIA 3R5CA 3JSYA 5B0FA 3CD6S 2YNHA 3A3NB 2MDAA 2LDYA 5T7LB 4UOHA 4TQRA 3DLGB 3AHPA 5AE3A 4F4WA 1QTMA 4IO9Q 3QGPA 3H2LA 3V2UC 4C2MA 2YH1A 1YBTA 3GJQB 1VBXA 1KFSA 2VH7A 1WF0A 2AJ0A 4O4GA 3QT7A 1TP7A 4NRTA 5KG6A 1XMOF 3VAGA 1Q95G 1VDHA 4BWJA 1OY6A 2IMWP 2CQHA 3O1LA 3LP1A 3BKUA 1X9SA 2FJBB 2M7SA 3N0VA 2KVQE 1RT4B 2BJ9A 3KG0A 5H9FK 4NLSA 5T41A 2A18A 1SJFA 1CPZA 3Q8SB 5CYQB 3OQ2A 1NKBA 3PDNA 1M5KC 3I5BA 1HQUB 3PO5A 2OIHA 1OO0B 5DGAA 1QAJA 3T1HJ 4ERDA 4MIBA 3OLBA 3FRZA 4G6VB 3BN4A 4A8WA 1SJ3P 3TVKA 4ED0A 2GC8A 1U02A 4MYTA 3OL7A 1F9FA 3F41A 2I2YA 4DR5F 4X66F 3CUNA 3CJKB 4X4QA 1TK5A 3J7Z5 4OYZA 4ZVOB 5D4NA 4R0EA 4O23A 5ITHA 2CJ9A 1EP4B 4C8KA 1FCAA 3QZ7A 1G3OA 4PYDA 3ENWA 2M3DA 4TN2A 6AT1B 3ZXWA 2NXEA 4OZ5A 3M8RA 2ZUGA 3J81j 4ZA1A 3RBZA 1LWFB 4RW9A 2ZKTA 4CTAA 4K2JA 2R7WA 2K7JA 3J81Y 4IR9A 3L7OA 4ZP9A 3H40A 1QAXA 1D9FA 3GPAA 2E5HA 3A13A 1MSWD 2FJVA 4LUBA 1T11A 3LANA 5HN0A 1EZZB 4DR2F 3MMAB 2NXJA 3M2UA 3Q8UA 4IOBA 5MLCV 4EWTA 4UTGA 5IT0A 3AJ2A 1JLFB 4K59A 2LQBA 2QLXA 4JI7J 1PBUA 3OUYA 4RUCA 2BOAA 1KBRA 3GV8B 3LGNA 1OJ4A 3BYPA 3BDPA 1NSQA 4ZVTB 1DFDA 5DDOC 2H65B 3D7SB 2ZJRQ 5CD4H 3KLEB 3CWJA 5MAOA 2QC3A 1VQKS 2ZOGA 3EZOA 5DLGA 4EFAC 1N34J 1JIHA 5AE2A 1LWCA 2AP6A 2OELA 2B9XA 1HBOB 1U0HB 5A8WB 3NWGA 4LF1A 4J91A 2I5JB 5DJBA 3VVUA 4RW7A 3MPDA 4ELVA 4A8OA 2VOPA 1QE1A 2COLA 1S1XA 1FRXA 4DR6F 2BW7A 3W2WB 1FKOB 2CNLB 2HRTA 2R2SA 2HHUA 3NY0A 4DCJB 4AL6A 2MZ1A 2CPXA 4KGVB 4ZPWR 2ZITA 2X1AA 2B9WA 5DRKA 1TV6A 4B02A 2C3YA 1T95A 4ECUA 4IG3A 3VQTA 3EX7B 2V4RA 2OMOA 2AIRB 2FVPA 2L9DA 1H0HB 5GAEI 3A1YG 5B0DA 4DX8H 1NU4A 3ENVA 3JQJA 1VHFA 3SEOA 2GIFA 2XI3A 1SC1B 5LSRA 4YQWA 4DOZA 3LGMA 3OTOJ 2JDJA 3MM9B 3M9OB 1FFSB 4C3KA 3N6NA 4WJBA 4DR4J 4O4RA 3EVOA 4DR1F 3RTVA 2MQQA 1W2IA 4DSLA 4QR0A 3RU0A 1S6UA 4PWWA 4NXNJ 2CUYA 3DLLQ 3C6UA 1UL3A 1ZAVA 4DL7A 4AYBD 1SVDA 3SIPB 3CC4S 1S9FA 2XTJP 3K89A 1RJJA 3K5MA 3D9BA 2E7VA 1HBNA 2RHSB 3A8JA 4ZPDA 1XBWA 1LEOA 1WC4A 4P2MA 3TWZA 5KOXA 1FK9A 1DTTB 4NMXA 4ED1A 1WHXA 2PD1A 3EZUA 4IOCQ 2MGZA 1SI9A 2JWNA 4DWIA 5IQ6A 2MQLA 3QLHA 2N4CA 2OJ3A 1RWNB 1I51B 2GZOA 1LKZA 2HK3A 2MKSA 1KD1T 4ED6A 2LU2A 4DV7F 1W26A 4DPUA 4JI2F 1HNZJ 2NSCA 3EMTA 2OD4A 2QN6B 2LECA 1KRPA 2G4BA 1N5YA 3AODA 4Y2CA 1KDNA 4OQJA 3QIPA 1HI8A 4DL5A 1WI8A 3HHKA 3TEGA 3DGPA 4CH1A 4JI6J 3HT3A 2XI2A 4USIA 2WONA 2R8JA 3MMBA 4CLKA 4NLTA 5ETQA 2R2UA 2LLZA 4K4ZA 3PX0A 4FKYA 2YNGB 4N41A 1NDPA 1BQMA 1VMBA 4HHUA 4XTTA 3RAXA 2CZ4A 4NZ7A 4YR3A 2UV8G 4TNOA 2R2TA 4YB1P 3CEDA 2HWTA 3EXYA 4LR7A 4B3TF 2DK2A 3THTA 2YKOA 2L08A 4RW6A 2FYXA 2J7KA 1RWOB 4DV3F 1YTYA 1OMSA 1PKUA 5HSPA 3UCUP 1AYEA 3SYZA 2IJFA 2VQFJ 1UAWA 3DC2A 1X4FA 2PFDA 3W9HA 3K5PA 1FJGF 2HBYB 4DV4F 3G86A 4OI3A 1RISA 4H54A 1QDUB 4NYOA 2D69A 1DARA 4PKDB 2AV5A 1B99A 1GT8A 4ECYA 1YSJA 3DLJA 1F6TA 1LW2A 1H7XA 3FBBA 4N5SA 4CO0A 1HI1A 4Q2LA 2AEFA 1ZOTA 1C1CB 5C24B 2V67A 5KFAA 3U02A 5L1LA 3VCDA 3BSOA 3DOLA 1WTFA 5LMNJ 3G9CA 2MEWA 2MTLA 5L39A 3KUHA 4OZ1A 5G0RB 4CLTA 3JAMY 2IPOB 2ATLA 3TAMB 4ZVRB 4WCEQ 2JZ5A 1ZH5A 1FFWB 3I0RB 1X4HA 2LA4A 2LVWA 3QT6A 2P9CA 4JI0J 5HP1B 2J0XA 3NS7B 1IKWA 3I82A 4YDXA 2YXLA 3QQCD 1Z1ZA 2ROEA 4LF8F 4NXNF 4USKA 1M5HA 5LM7E 4IRDA 4WYWA 2Y0BB 5KFRA 2P8IA 1B7FA 1K1QA 4ZPTR 3CDEA 3Q23A 2QLJB 4DF8A 1I6JA 1YG0A 4J7CA 4CM0A 3JS9A 1RTIB 2GMJA 5K5MA 4LRDA 2N3LA 1OQ6A 1TKZB 3AOCA 5A76A 2CA9A 4ECZA 5JJBA 2HWIA 2D1CA 2Y0SD 2WOMB 3C66A 1PYOB 3G8QA 2CQ4A 1JNZB 4FNIA 2BQRA 5JXSA 4ID8A 3GU0A 1VS3A 1D3WA 4M5DB 2DNKA 3UN2A 3MPYA 1S9EA 3NOCA 4J9VA 4DL3A 1PC4A 4DFKA 3LWMA 4IR1A 2WVDA 4OLPA 1U1MA 2A6OA 3DRPA 3DRSB 3DRRB 4AQYF 3HPOA 4IRKA 5GMEA 4B3OA 2HQIA 1YJRA 3PKYA 2BW2A 5KFUA 1Q53A 1NSKL 4WFNQ 4OLOA 1MROB 1RT2B 1BWEA 5AT1B 2QLBB 2OEJA 3FDSA 4Y0FA 4LF4J 1DAXA 4P10A 2OEMA 1UVMA 4ER8A 1HNXF 3OTDA 4IFYB 2JL9A 3M6XA 4A47A 1Q8BA 5F3ZA 2B4PA 5KFWA 3PVXA 2DPJA 1KS2A 3M2VA 4K4SA 3MEGA 4XAKA 2FC8A 2MJUA 2H54B 2FUG9 2GAGC 2HBRB 3K7RA 4ZLLA 5KTQA 2CQ1A 1IBLJ 3C16B 1U48A 3DKDA 3DDKA 5CXTA 4YS2A 2YTCA 1EKRA 4IQMA 4X4TA 3KK1A 2P5VA 1WNEA 4WXOA 3SSSA 3KLIA 4L6V3 1QSLA 3ZZYA 3Q2TC 4DV2J 2ZE2B 2Z58B 2RF2A 2E5JA 4I68A 4P75A 2DXDA 3C14A 1RT4A 3O44A 1UETA 1KQKA 5E0OA 4DSFA 1RTJA 2BR0A 4V19X 3Q22A 3GSDA 2YQ3A 2KYZA 3N6LA 1KOOA 5CYQA 4CLZA 4LF6F 1S49A 5D8HB 2HPUA 5LXYA 1X0FA 3B78A 2W01A 5F3TA 1V9OA 2VB6A 3IRXB 3PW5A 2VG6A 3K5NA 2XLIA 3H98A 2DT9A 3RAMA 2AD9A 2V0NA 3UFCX 4KY3A 2FGOA 2XY5A 4DG1A 3VGSA 5HVHA 4WZQA 2OH2A 1F3VA 4K0KJ 2PFFB 3D0HE 4NA1A 1UVJA 1WF1A 4ES3A 2W4DA 4JI0F 1N52B 3E8OA 2WRMA 3IM9A 1S9GA 3NGUA 2IVFB 5HANA 4KJIA 3JTPA 1FEHA 4YDDB 4GKJJ 4DS4A 3DU6A 4KPCA 3LO3A 5E33A 4C6AA 1RADB 3VR1A 1ZA2B 1S1VB 2ZBCA 2E1CA 5SUHA 3B8HA 1OY8A 5HLFB 1HIYA 2IM0A 4HTJA 4RUHA 4DEZA 3IWNC 5ETOA 3EXCX 1MNEA 2XMUA 4Q45A 4KSEB 1J5EF 3Q8VA 3SCJE 2Q43A 5KG3A 3D4JA 3FCWA 1VRUA 1VFJA 1VC6A 1EARA 1JLFA 1P6TA 3BSCA 2RRNA 2W7PA 2J9DA 3D1QA 2CJBA 2B7CB 4DI6A 4K5SA 4CLWA 4CLYA 1YRUA 3NBPB 1RTDA 5J1EA 5A8RA 4E0DA 3M7VA 3DNCA 4NOHA 2GVZA 4Q0BA 3NCPA 3MTKA 1T0TV 1LWEA 4F02A 2OLWA 1RABB 3CIMA 1IBKJ 3TAQA 1F5BA 3KJVB 3FSIA 1UVNA 2HEKA 1C0TA 2XMMA 2VKZG 5GAGI 4F3OA 3WZ0A 5A2QY 3I6PA 2OTJS 1S59A 4OJ1A 3AH6A 3I56S 3RRGA 3AJDA 1HBOA 1U0HA 4CYUA 1UZDA 1N8RT 3G82B 2LYVA 3HHEA 5E3RA 4LIRA 1RT1B 3UCGA 4RX6A 4LFAF 5JUMA 1NJXA 4UT4A 4I2QB 2DGXA 2YY3A 2HHQA 2GA7A 4YR0A 3P49B 3HSJA 3AOAA 3S01A 2CFXA 3M8QA 2K2PA 3UVJA 3H2VE 5IFMA 5H9FJ 1K73T 4ZKAA 1U1KA 4Y3CA 3ZNJ1 5BYQA 3W5YA 3H2UB 6FDRA 2UUAJ 3US5A 2VPXB 4FYYB 4EZ9A 2BX6A 3OJSA 1W25A 4DV2F 3MM5A 2KM8C 4CP5A 3PKMA 5KFCA 5HQMA 2FHJA 3CCTA 3LP2A 1IWAA 4NXMJ 1H6KX 1LK5A 2V94A 1RBLA 5IQQA 4ZP7A 3KHGA 3ADAC 4IFVB 1ICEB 3BKTA 2OFHX 1CJKA 3J80Y 4ZP6A 3CJ5A 1XERA 3RB6A 4LFBJ 1P9QC 2HGLA 7FDRA 1HNIA 4ZIVA 1ZPWX 2JX2A 2MKYA 4DUZJ 4PWDB 3DU5A 1M90T 4MK8A 3SDEA 4HYKA 3KDNA 1MG7A 2P9EA 4J9MA 1L3SA 2YNIA 2IA0A 4DBQA 2BJEA 2RU3A 1O0PA 1NRKA 3BH7B 1R3NA 4KPYA 4C3MA 1R8PA 2UXDJ 1OY9A 1VC5A 2OPSA 3CMQA 3FMWA 4TLQA 1N6QB 4EU0A 2XMKA 2KJVA 5BXIA 1FHTA 3K17A 2QZ8A 2EBEA 4NLDA 3RW7A 3K2YA 2XO7A 5FJ4A 2YX7A 2RAQA 2IY5B 4FYDA 2O3DA 2YNFB 3D6MB 4TXSA 3CJQA 2HHHF 1P9YA 4KGMA 2D3UA 3PACA 5KFEA 2ILYA 3BBCA 4NZ6A 1FRJA 3J7YU 4PG4A 3BGRB 4NMLA 2H4YB 2YWWA 4QWBA 3I31A 4OX8A 1C4CA 1WTBA 2WBRA 5KG0A 5KFJA 3TJ9A 2GW8A 1IVZA 1KP6A 2DIUA 3MAAA 5KT3A 3CCRS 5IM0B 4FF3A 4D3HA 2QYGA 4ES2A 1YDLA 2VJVA 3HM9A 1UJ5A 4URQU 3AT1B 4ECQA 5IT9U 2DR5A 5E3PA 3CJSA 2YWGA 3O5TB 2EG1A 3CDUA 2YNGA 2IAJB 1M1KT 4RW4A 3PG9A 3CD7A 1X9WA 1SC3B 2HVHA 2WVBA 2FJAB 2KT2A 3VGUA 2BE9B 3MCOA 3GILA 2R4FA 5J2PB 1LNQA 1RYSA 1X31C 3KFWX 3MURP 3THPA 1SL1A 1VQ8S 2OPRA 3P96A 3BR8A 1N5VA 3R1HA 2HLUA 4B3SJ 2HNDB 4AD6A 4ICLA 1HYSB 1WC1A 5K14B 3GE9A 2VG5A 4B3MJ 4L76A 3EDQB 4LSLA 2WZ1A 2E9TA 3G6VA 4HHJA 3FZ2A 3G6XA 5HROB 2DY1A 3PRDA 1NNDA 2VONA 1D8YA 2K1RB 4PRFA 3B82A 2AEMA 1HL6A 4Z7CA 4H4MB 2ZH1A 2IMOA 1JKHA 1QD1A 2WVFA 1YQHA 5EX3A 2GJFA 1RE1B 3W1YC 1TL4A 2AX1A 2UUAF 2DNQA 2MZSA 3ZZTA 1X7VA 5FIIA 5HBMA 3U1NA 4G1QB 1BGXT 3R2DJ 1SPBP 3IXQA 3R5DA 3V6KA 3DM2A 3I32A 3POTB 2YVSA 2CPIA 1RWXB 1OSCA 1RAEB 5KFZA 2W2QP 4MFBB 1CS4B 4WP3A 1KTQA 2HBQB 3PJXA 2GIRA 2I8EA 2F40A 4ZLJA 4CO5A 1QAYA 2XM3A 1VRTA 1Q5YA 4NEYA 3VTIA 5IC6B 3ZTRA 4M5KA 1WD6A 2J6SA 1CVJA 2ABYA 3Q8QB 3G96A 2N7YA 1VJWA 4NLQA 3D6TB 4M5NA 1ZZNA 4EBEA 4OI6A 2ACYA 2C2MB 4EEYA 2JC1A 1F2GA 3MPUB 3MOJB 4ED5A 1SH2A 3TANA 2Y1IA 3MM7A 3LAKA 2OPPB 3ET6A 1GX5A 4TQSA 4OYBA 3MPVA 2JC0A 2NXCA 5IWAJ 1WHWA 5IV3A 1RT3B 1T9VA 2GVDA 2DBBA 1UTAA 2WOMA 3L09A 1AA1B 1VGYA 2YKMA 3T6BA 3MWBA 2QSFA 5AXLA 1Q82T 4G1PA 3ZC4A 3EWGA 1X8DA 2VPWB 3MM8A 3DLKA 3EYZA 3M8YA 2SXLA 2BQ3A 2H5IB 2DEJA 4C8OA 1HLWA 5M2PA 3KK3A 4PABA 3I96A 3G8SA 3BO3A 1WHYA 5I42A 2UUTA 5KFPA 2F8EX 2QFIA 1AUSL 1KLNA 3CJ4A 2PT0A 4PYAA 5KFTA 3EM1A 3F0NA 4C9DA 3LF0A 2UV8A 3UO0A 2DNZA 2PEHA 5C2CA 2UU9F 4HH0A 5DG9A 2QA4S 1T9YA 2CPEA 4KHMA 4OX9J 5HMZA 1PILA 4X2BA 3W66A 2D3ZA 1RHQB 4KFBB 4NI2B 4CWBA 3QSIA 1WEYA 2HVIA 4WFXA 3B4DA 2XMWA 4QYZJ 4PG5A 1YBAA 2FY1A 3IMQJ 2HWHA 1FX2A 2G2OA 4D3GA 1XNRJ 3ZTPA 4JYAJ 4RR5A 4B3SF 3I0SB 3IR7B 4C11B 1FRIA 2W2NP 3NOGA 1Y11A 2Q3PA 3P6YC 4OX6A 1IKVA 4OHXA 1MW7A 3U1LA 3MM6B 4LVNP 3HF5A 2I0XA 3R7SB 1C1BA 1FD8A 3I5CA 1IKXA 4JI3F 2AKWB 5HMXA 2EBGA 1RAAB 4X4SA 2B6AA 3UR0A 2DCLA 1K47A 3PW0A 3J7YI 3HHLB 2CG8A 3MECB 5B0BA 1WKJA 3FBCA 3K5LA 4ED4A 5ETKA 2ZBQA 2IIHA 1T03A 1MN9A 4I2PB 1SCJB 2L48A 1TVRB 3N4WA 2XYPB 1EETB 1CJTA 3CXCR 4O0IA 2IC3B 4QR2A 4N76A 4NPOA 5D0EA 1T9WA 2IBKA 3KUGA 3IC1A 4AXJA 1V3SA 2IJRA 1SH3A 2V2KA 2C2DA 2LEBA 2YKPA 1KC8T 3OL9A 3MD1A 2HFOA 2J7UA 2XS2A 4CO3A 4QU6A 5J1PA 4FP9A 2MZJA 3C15A 3T9ZA 5F8JA 3QO9A 2B5JA 4LR9A 3TZWA 1RGVA 2AGOA 4MMOA 4GVLA 3R3TA 5KFNA 1GMVA 2AGQA 3ISNC 1TTHB 3W7BA 3LALA 4OJGA 3VAKA 1TK8A 3QRRA 2VU5A 2CDRB 2I9SA 5B7WA 5E3CA 1VR6A 5K20B 1Q16B 2Y1RI 5KFMA 4ECWA 1VC0A 1W7WA 5AJ3F 2ZVIA 4P74A 2KH9A 3IG1B 1IBMF 2QA2A 3HSDA 5J2NA 2H48B 2FZGB 1NSPA 4F2SA 3CB4A 4JI5J 2NPIA 1T3NA 2VICA 4IDKB 1G4CA 3M8SA 1EB0A 1SKUB 2GHVC 3RAQA 2RRAA 4LF7F 2AT1B 2MMYA 2EFNA 4B9TA 2R42A 3QWUA 1RLCL 2YPYA 1I3OB 5F0WA 1RT6B 2NR0A 1RT1A 1YGYA 3NRBA 4DZ6A 5JVGQ 2YNHB 2AQ4A 1XNQJ 3IBCB 3EZ5A 3H0PA 4I2QA 1N5QA 1DJ0A 3IBWA 3VAFA 3BPDA 4J9OA 3ENQA 2OI2A 4N8OA 2LEPA 4O4GB 2AYBA 4DCPB 3CDWA 3W5ZA 5H9EK 2DNHA 4OHVA 1HR0F 4M94A 2XMVA 1Z2ZA 3IR5B 1DQ9A 2KG0A 1LFPA 1UKUA 1JLEA 2G1HA 4X64F 4F0KA 1LV5A 2Z0GA 4TU8A 3ILOA 5E2QA 4B08A 1FDDA 1T9XA 3ISZA 4J9PA 1WG1A 1T8EA 3FMBA 1R8HA 3D54A 1LXJA 4ITSA 4RUBA 2C3OA 5DDQC 4Q7AA 4Z37A 3I87A 4QPXA 1RLDA 5AXKA 3TA1A 2A3JA 2VDHA 4LQ3A 2BEFA 5FLXY 4ZPAA 2LCWA 1LXNA 2AEJA 4CLSA 2HFSA 3TP2A 3IBFB 1HARA 1HWJA 2X3GA 2IYGA 4DQIA 2A2DA 5KFKA 1NZAA 4IOAQ 2RIJA 1XWLA 4GMKA 4TU9A 4XPEA 3CCJS 2HNYA 3MHYA 2L9WA 3LP0B 3K5OA 3TQEA 3EVWA 2HHVA 3R7NB 3CMAS 4OZ0A 5E7OB 3CCES 5D78A 2Z2ZA 1CG2A 4USHA 4XPCA 4BC7A 5BR8F 4EBDA 1AZSA 2WHOA 2QRRA 1S1WA 3GQCA 4RW9B 2YNFA 4CTAB 2ZH5A 2L41A 1FWLA 2DNNA 2VL1A 1FERA 2HHTA 1YITS 1VJQA 2CADA 3C19A 2QGFB 1S6PA 4DR7J 1FX4A 1FRHA 4ZK7M 3BEGB 3PIPQ 1U7LA 2BA9A 1XIQA 1LOUA 5JVHQ 3HKZD 2ZZMA 3M2UB 5BYSA 5HJXA 2B9YA 1VBZA 5F41A 2M8DB 4ATNA 2J0QD 2M8HA 4J9KA 4OZ3A 3OUYB 5F8GA 3BQ0A 1SXLA 2GMLA 2Q66A 2K7KA 4HEA9 2D9PA 4LBPA 3CDAA 3SCIE 4YFUA 1KKHA 4H4OB 3KLVA 3JSRA 3IA0A 4WKYA 2RT3A 1QSYA 2NZCA 1GXUA 1FJCA 4CLUA 4CLFA 2MKKA 2ZH4A 1M1GA 1R7IA 2ASLA 2AGPA 1SL2A 2XO6A 3V81A 1DLOA 1BWVA 2F8HA 2CJYB 1LWCB 1YK9A 5D15A 1ZTWA 2WVCA 2QYCA 2MSTA 4KHPJ 3IRWP 1XMQJ 2Q79A 2HNDA 1JJ4A 1U49A 4ZOSA 5J2MA 4RW7B 5EWEA 2JSXA 1QE1B 1V3ZA 3FJ2A 3NCRA 2MKCA 4USUA 4JUZA 2DRBA 1KLMA 1PAUB 4DL2A 2GQCA 4JV5F 1D9AA
chains in the Genus database with same CATH topology
1I94J 5LM7E 4JI8J 4YY3J 2KL8A 5LMUJ 4RJVA 4DUZJ 1N36J 1HNWJ 4YHHJ 4LF4J 4B3RJ 2HHHJ 1N32J 4PWWA 4NXNJ 4JI6J 4DV3J 1XNQJ 3T1HJ 4OX9J 3R2CJ 4JI1J 4DR3J 3D3CJ 5IT9U 4V1Ak 4AQYJ 3D3BJ 4X65J 4DV7J 3W1YC 4LF7J 4JI2J 2UXDJ 4DV1J 4DR6J 4LFCJ 2UXCJ 5IWAJ 4LF8J 4NEZA 4KY3A 4KYZA 4JI7J 4HHUA 2F4VJ 4JV5J 1FJGJ 4DV4J 2ZM6J 4DR1J 3IMQJ 3R2DJ 4JI3J 2UXBJ 4DV5J 4LF6J 2UUAJ 2UU9J 1IBLJ 3T1YJ 1N33J 4K0KJ 4X66J 4DV6J 1XNRJ 4JYAJ 5LMNJ 3J80U 4LFAJ 1HNXJ 2MEWA 4LF5J 2VQEJ 1J5EJ 3JAMU 2MTLA 4DUYJ 4DR2J 4JI5J 3J81U 2UUBJ 1IBKJ 4DV0J 4LF9J 4NXMJ 4KHPJ 2UUCJ 1XMQJ 4B3SJ 3J7AN 4GKKJ 4DV2J 4DR5J 4B3MJ 4X62J 5A2QU 4GKJJ 2KVQE 4JI0J 4DR7J 1N34J 1XMOJ 2VQFJ 2MQ8A 1HNZJ 5AJ3J 3OTOJ 4NEYA 1HR0J 5FLXU 1IBMJ 5BR8J 2E5LJ 4LFBJ 4JI4J 4DR4J 4B3TJ 4X64J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 J;  5LM7 E;  4JI8 J;  4YY3 J;  2KL8 A;  5LMU J;  4RJV A;  4DUZ J;  1N36 J;  1HNW J;  4YHH J;  4LF4 J;  4B3R J;  2HHH J;  1N32 J;  4PWW A;  4NXN J;  4JI6 J;  4DV3 J;  1XNQ J;  3T1H J;  4OX9 J;  3R2C J;  4JI1 J;  4DR3 J;  3D3C J;  5IT9 U;  4V1A k;  4AQY J;  3D3B J;  4X65 J;  4DV7 J;  3W1Y C;  4LF7 J;  4JI2 J;  2UXD J;  4DV1 J;  4DR6 J;  4LFC J;  2UXC J;  5IWA J;  4LF8 J;  4NEZ A;  4KY3 A;  4KYZ A;  4JI7 J;  4HHU A;  2F4V J;  4JV5 J;  1FJG J;  4DV4 J;  2ZM6 J;  4DR1 J;  3IMQ J;  3R2D J;  4JI3 J;  2UXB J;  4DV5 J;  4LF6 J;  2UUA J;  2UU9 J;  1IBL J;  3T1Y J;  1N33 J;  4K0K J;  4X66 J;  4DV6 J;  1XNR J;  4JYA J;  5LMN J;  3J80 U;  4LFA J;  1HNX J;  2MEW A;  4LF5 J;  2VQE J;  1J5E J;  3JAM U;  2MTL A;  4DUY J;  4DR2 J;  4JI5 J;  3J81 U;  2UUB J;  1IBK J;  4DV0 J;  4LF9 J;  4NXM J;  4KHP J;  2UUC J;  1XMQ J;  4B3S J;  3J7A N;  4GKK J;  4DV2 J;  4DR5 J;  4B3M J;  4X62 J;  5A2Q U;  4GKJ J;  2KVQ E;  4JI0 J;  4DR7 J;  1N34 J;  1XMO J;  2VQF J;  2MQ8 A;  1HNZ J;  5AJ3 J;  3OTO J;  4NEY A;  1HR0 J;  5FLX U;  1IBM J;  5BR8 J;  2E5L J;  4LFB J;  4JI4 J;  4DR4 J;  4B3T J;  4X64 J; 
#chains in the Genus database with same CATH topology
 2E5G A;  2H4W B;  2J0S D;  2K1R A;  1YRT A;  4TY8 A;  2MY7 A;  3AB4 B;  1RWW B;  2PI4 A;  3N79 A;  4DMZ A;  2BM1 A;  1TV6 B;  2V63 A;  3EJM A;  5C42 A;  2A10 A;  1Q4R A;  4IG3 B;  5ADZ A;  1RKI A;  4DN0 A;  3BBB A;  2AYE A;  1FVS A;  1WI6 A;  2XS7 A;  1URR A;  2QSW A;  3N6M A;  4I69 A;  1MMN A;  5CAB A;  1OQ3 A;  4J5O A;  1JMT A;  1CS4 A;  1NSA A;  3VAJ A;  1U26 A;  5KG7 A;  1ZS6 A;  1RA7 A;  1VRQ C;  4A4J A;  4ZCI A;  2L3M A;  4U7U D;  2YKN A;  3OVS A;  4R5P B;  2LXI A;  3M8P A;  1XEZ A;  3HHL C;  4IG0 A;  4ECV A;  1GAO A;  4X4O A;  3C6U B;  2EKN A;  1YJU A;  1H38 A;  1V3R A;  2WSE C;  1HNV B;  2WVE A;  4YY3 J;  2BBE A;  1FKP A;  4X4U A;  2ZZT A;  1GK8 A;  2YKQ A;  1HBN B;  1RA6 A;  2HYI B;  3D2W A;  4X84 A;  3AA8 A;  3HZG A;  2ZH7 A;  4RL1 A;  4V1A k;  1SUQ A;  2OPP A;  3W65 A;  3CUL A;  1Q81 T;  2HLT A;  1FK9 B;  5DG7 A;  1Y7P A;  3TVY A;  2JEJ A;  3KJQ B;  3OHA A;  1HW9 A;  3TAP A;  4LJM A;  4UOG A;  2MGZ B;  2BQU A;  2ALZ A;  2E9R X;  3CDB A;  4QIV A;  4WU2 A;  3HZE A;  3L7U A;  1R89 A;  2CNN B;  3QLH B;  4O44 B;  5EHH A;  2QLF B;  3K58 A;  3HI9 A;  3N9U C;  3VAM A;  3I9Z A;  1P1L A;  3C6T A;  3BGO P;  2DHH A;  1R6V A;  1FEE A;  1S7H A;  1RT5 A;  4AL7 A;  1L3U A;  1S6Q A;  4M8L A;  3MED A;  4GKK J;  3QIP B;  1FRL A;  3OJU A;  1OIA A;  4RNO A;  1EJ7 L;  1RYR A;  1UVI A;  1ZZF A;  2XYG B;  1VHI A;  3DGP B;  1Q7L B;  2CQI A;  5GMK a;  1YIJ S;  4MKA A;  4P71 A;  5F8L A;  4O3S A;  1UCN A;  4I6W A;  2RUG A;  4J90 A;  2C42 A;  2JEF A;  2F4V F;  2R7R A;  3ZTO A;  4JI4 J;  3MMB B;  5ETP A;  2ZKU A;  4OHY A;  4ZJQ A;  2P6T A;  2V34 A;  3C8Y A;  1Q8K A;  1BQM B;  2YWE A;  4X4V A;  2AYM A;  2N3O A;  4JI1 J;  2YQ0 A;  3PJ9 A;  5ETV A;  3TEH B;  1NJY A;  3M32 A;  3CD5 A;  1R0B G;  4KC5 A;  4OYW A;  2MXY A;  4KFB A;  3BRE A;  2CIM A;  4RW6 B;  2W25 A;  2VFR A;  3K8V A;  1AXQ A;  1EAY C;  3E01 A;  5THW A;  2FY8 A;  3V5R A;  3DGV A;  2FPH X;  5KG2 A;  2CQP A;  4EYH B;  3OVA A;  4F4K A;  2JH3 A;  4KHP F;  4NYZ A;  1Q1K A;  5I3U A;  2Y8W A;  2VQE J;  2EK6 A;  4ILL A;  2UUW A;  3T9N A;  2RDJ A;  2HSE B;  2MQO A;  2MZR A;  1D9D A;  1NJI T;  1NZ8 A;  2BJD A;  1QUV A;  2R7T A;  2CJX B;  2CPJ A;  2RVJ A;  4A46 A;  2BE2 A;  4KRW A;  3W64 A;  3MM6 A;  2FJX A;  1LW2 B;  2PA8 D;  3VAL A;  2LQJ A;  4X65 F;  4DU8 A;  4IO1 A;  4LF2 A;  2W9B A;  3HDS A;  4F25 A;  3BQ2 A;  4PQU A;  1WOR A;  2Q1L A;  4YME A;  4U95 A;  2Y1L B;  2DNM A;  3KXD A;  3GZ7 A;  1BQN A;  3TW0 A;  3MI7 X;  4FS2 A;  2CDQ A;  5F8H A;  3DOL B;  2C3M A;  4MJK A;  1H74 A;  2UUC F;  3C3L A;  2FIU A;  3HHL A;  2AZ1 A;  3TUP A;  5CAA A;  2GCF A;  2XYH B;  3PRB A;  4U8Y A;  1N4L A;  1SV5 A;  1OPI A;  4L3N A;  5CA5 A;  3Q89 A;  3W2V A;  2Z57 B;  3BQ1 A;  5CCM A;  3D1O A;  1IKW B;  3WX4 A;  4F4X A;  1SC4 B;  2N4D A;  3UDV A;  2DH8 A;  1ULR A;  5KFG A;  2XC9 A;  5KT4 A;  1EET A;  2CQG A;  4LRA A;  2QA1 A;  2CQ0 A;  3H59 A;  2B4U A;  1YJV A;  4F3Q A;  3BSN A;  4AUK A;  4A8X A;  2IHR 1;  3DRX A;  5KT5 A;  2AF6 A;  1FWP A;  4DPY A;  4YN3 B;  3OFH A;  1KTV A;  3J7Z T;  2ZH2 A;  2V4J A;  4IH6 A;  2CPF A;  2YH0 A;  1UP1 A;  3MMC B;  2FB0 A;  3QFW A;  2YKA A;  4HT5 A;  2KRB A;  2MSS A;  4DSE A;  1RB0 A;  4RNM A;  3ISN D;  3DYA A;  3L95 X;  1U1R A;  1TL1 A;  2UUB F;  1FXR A;  2DGW A;  2RML A;  5KG5 A;  1S9E B;  4ZCK A;  3QJP A;  1FTC A;  4FVM A;  3PYD A;  5DDP C;  4J9R A;  4DV6 J;  5B0A A;  2ZC4 A;  4OV6 A;  4DUY J;  3W5X A;  1APS A;  2X7I A;  2DXF A;  4LF9 J;  4CH0 S;  3BYR A;  4USM A;  4ED3 A;  1S48 A;  5D3G A;  3VZI A;  3GII A;  4FXV A;  3DLE A;  2C22 A;  4JI4 F;  3R97 A;  2ERR A;  4BS2 A;  4QQB A;  4UW2 A;  4OV1 A;  2BM0 A;  2FVQ A;  3BPS P;  1TMJ A;  1JJH A;  2LXF A;  4PPZ A;  3W8G A;  3LUY A;  4JI1 F;  2EVZ A;  4ANC A;  2IDE A;  3PW2 A;  2BVZ A;  3MEG B;  2PC6 A;  4JP8 A;  2BYC A;  1IQT A;  1SKW A;  3MGJ A;  1R31 A;  1H7W A;  2CAJ A;  2WB1 D;  3ZZ0 A;  1X4G A;  3HT0 A;  2F9D A;  3KK1 B;  4P7V A;  2VF3 A;  4LR8 A;  3D1H A;  2PA3 A;  1YJW S;  2ZM6 J;  3KLI B;  4I7F A;  2KVI A;  3HX9 A;  1S1U A;  1TFY A;  1T05 B;  2RF2 B;  2RKI B;  1I94 F;  3C14 B;  3JAM U;  1RTJ B;  3AD8 C;  4NLX A;  1J27 A;  1RWU A;  3QGH A;  3NXZ A;  4DPT A;  3JYT B;  5IXU A;  2RD5 C;  2E9Z A;  2XHC A;  2XMT A;  2GIQ A;  3KLH A;  1U24 A;  2VG6 B;  2NUH A;  1D09 B;  3BBF A;  2CQ3 A;  1RK8 A;  2FD2 A;  4NCG B;  2CNK B;  3DLB A;  3TOQ A;  2WSC C;  2XS5 A;  1S7I A;  4AT1 B;  2QMX A;  4DG1 B;  4OYI A;  5KFF A;  4U7U K;  5EWF A;  3BH6 B;  3LP0 A;  2XEX A;  3GMG A;  1ZM4 A;  2ZDP A;  5EN1 A;  4EO6 A;  3L4B C;  1GMW A;  2NYI A;  3HJV A;  4KTQ A;  4Q8F A;  2VA2 A;  1BD6 A;  1S9G B;  2BAB A;  4ELU A;  3M6U A;  2Q6B A;  4P2S A;  5DO2 A;  2E66 A;  2UVV A;  1RDR A;  1S77 D;  1BY9 A;  4QIG A;  2R7X A;  1TAU A;  5K8O A;  1NK6 A;  1YI2 S;  3QMQ A;  1JJC B;  4QR1 A;  1IR0 A;  2MLX A;  3AAW B;  4ELT A;  1HBU A;  2MJN A;  3I9V 9;  3NLC A;  2XNR A;  2FGC A;  4X62 J;  2HVZ A;  1FVQ A;  3MR7 A;  3EIC A;  2JVR A;  3MAQ A;  2O1P A;  2B7B B;  1VRU B;  3TO8 A;  4Y2K A;  3LOU A;  1OWX A;  1CJV A;  4L74 A;  1T94 A;  3N01 A;  1XJW B;  2J9D E;  2I38 A;  1N32 J;  2QV6 A;  2W4P A;  4UOF A;  4GVB A;  3UR3 C;  5ETL A;  1HQE A;  1RTD B;  5J1E B;  4WP8 A;  4PQA A;  5A8R B;  2GVZ B;  3D3B J;  4Q0B B;  4OX7 A;  4WE1 A;  2H3E B;  1LWE B;  2FLP A;  4H4O A;  3PW7 A;  4F36 A;  1KSP A;  2BMB A;  4QOT A;  2UXB J;  2MQM A;  2EG2 A;  2HAI A;  3WHI A;  1JXV A;  2KHC A;  4K4V A;  3G87 A;  4LSN A;  1C0T B;  2E5L F;  5IT9 Y;  5F9N A;  1U25 A;  1VIS A;  4YUD A;  1VQM S;  4KGX B;  5LJ3 Y;  4RWW A;  5F8N A;  1TKT B;  4B3R F;  5CYM B;  3SQO P;  2WW4 A;  2MPU A;  3TYT A;  5GAD U;  3UN3 A;  4CYU B;  4C8L A;  5E3Q A;  3TI0 A;  4WII A;  1UA1 A;  4IH5 A;  4OZJ A;  1NH8 A;  4UUX A;  4F50 A;  3OV7 A;  3O8W A;  1FD2 A;  4ECX A;  3OHB A;  2P6S A;  5D4P A;  4HT7 A;  3TX0 A;  2EWH A;  1YKW A;  2R8K A;  5L9X A;  4O3P A;  3D0G E;  2HQF A;  4RNN A;  2C1E B;  3B54 A;  3M8Q B;  3UVJ B;  1XK8 A;  4OYX A;  1QJH A;  2V8G A;  1N5T A;  1NO8 A;  2DRA A;  1NK8 A;  2RQM A;  1DRZ A;  4N7T A;  4MTP A;  5K8N A;  2WB4 A;  2MYF A;  5BYR A;  2CVI A;  1U1L A;  3OXL A;  1Q86 T;  3FEZ A;  3MM5 B;  4P2F A;  3HFV A;  1B70 B;  3LP2 B;  3OFF A;  2W2O P;  1N56 A;  2AHO B;  4I64 A;  1RAF B;  1N33 J;  1WAC A;  1Y5L B;  5EWG A;  2PO4 A;  1CJK B;  2MKI A;  4U96 A;  3BGF A;  1SB6 A;  4Y2I A;  3CCS S;  2B43 A;  2MKJ A;  1EHW A;  3TAR A;  1HNI B;  2F7V A;  3T1H F;  4R5P A;  3AA9 A;  2LQ9 A;  1ELO A;  4QIE A;  4HAC A;  3SDE B;  2ILZ A;  1V5I B;  1BLU A;  3P5B P;  4NA2 A;  2YNI B;  4PG6 A;  4ZCL A;  1HNV A;  1N0U A;  2LU1 A;  4JI8 J;  5DM7 Q;  1FXD A;  3Q83 A;  3NP5 A;  2B0G A;  4BCA A;  3GIK A;  3ELH A;  3FNN A;  4UY8 5;  1JLG A;  1IM4 A;  2OPS B;  2YQ1 A;  4F4A A;  2DH9 A;  1Z2L A;  5A8K A;  1NK0 A;  2ZD1 A;  2EFV A;  5AXN A;  4PG7 A;  1UEU A;  4HLB A;  3UW1 A;  4C8Z A;  3GIJ A;  2V9W A;  2Z2L A;  4HR2 A;  5B0E A;  3V6D A;  2ZFH A;  4LFC J;  3QBC A;  3NG8 A;  4DX6 A;  3N28 A;  4H4K A;  1UFL A;  3IO1 A;  4O44 A;  3MEE B;  8ATC B;  5H1S V;  1NB7 A;  1VI7 A;  2V69 A;  4UQT A;  4NL5 A;  1NHU A;  2GO9 A;  3QAU A;  2GHW A;  1RTZ A;  3MAA B;  3ILL A;  3C2P A;  3KNG A;  2HQG A;  1T9T A;  4OI1 A;  5A2Q U;  2K8G A;  1C2P A;  1RCO B;  4GO7 X;  1N32 F;  4JI7 F;  5HQL A;  3FQK A;  2YWK A;  1RT7 A;  4RBT A;  3NAI A;  4RW4 B;  3RGI A;  1PCA A;  1X5P A;  3CCQ S;  3QRQ A;  4IQX A;  3OL6 A;  1QY7 A;  1VCT A;  5KFH A;  4WU3 A;  5KG1 A;  4WFB Q;  3G71 S;  2OPR B;  2CKW A;  2DPI A;  2AX0 A;  1N34 F;  4FS1 A;  1DY3 A;  5LJ5 Y;  3NNA A;  3JB9 k;  4ICL B;  2HRY A;  2VG5 B;  4CO1 A;  1EQ0 A;  1U2C A;  1X4D A;  3LWL A;  4LSL B;  1XMB A;  1C0U A;  4KH0 B;  1N0V C;  1SKR A;  4QWD A;  2CZV C;  4I56 A;  1ZPV A;  5A0Y A;  4ANE A;  3HVT B;  3G4S S;  2KM8 B;  1REV A;  2MQ8 A;  3PFO A;  1JKH B;  4ECR A;  2G13 A;  3PNI A;  2RB7 A;  3HO1 A;  3CPW R;  2ZHA A;  5GAG U;  4TYA A;  4G65 A;  3SFG A;  2VG7 A;  5B08 A;  5HJY A;  5HBM B;  3H8Y A;  2JEG A;  3RRH A;  3HFZ B;  5L9N A;  3BB5 A;  4DR3 J;  2EI5 A;  2KB2 A;  4Y2A A;  2ZBR A;  1K44 A;  3DM2 B;  5E5N A;  2ALY B;  4Y6I A;  4CZC A;  2Z4P A;  4DSK A;  2VBZ A;  1JX4 A;  1S0M A;  4OHZ A;  4O0N A;  1Y10 A;  4M5J A;  3LW5 C;  2KZM A;  3GG1 A;  2N82 B;  3QFH A;  2MY8 A;  3GFZ A;  1K0V A;  2XG8 A;  3QJJ A;  2LMI A;  3OTO F;  4UZB A;  4CH7 A;  1B0T A;  2BUN A;  2CXE A;  3BO4 A;  2PI5 A;  1KWM A;  3CJT A;  4DR4 F;  2DR9 A;  1VRT B;  3TR5 A;  3T5L A;  2QG9 B;  2IM1 A;  2BV3 A;  4J9S A;  4ILR A;  4KV8 A;  4ZHR A;  1RHK B;  3GFY A;  4FBT A;  3GR0 A;  1QM9 A;  3AB2 B;  5ETN A;  4CQ1 A;  2FLN A;  3KLG A;  4YOE A;  4JI8 F;  2BJ3 A;  4XIU A;  3MM7 B;  2IM3 A;  3D0I E;  2E1A A;  1NME B;  1O51 A;  3ET6 B;  2BXJ A;  4DX7 A;  1G1X A;  3UDE A;  2O67 A;  4WTO B;  2HIQ A;  3MMC A;  2GNK A;  1LW0 A;  2HS4 A;  4MIW A;  2GVD B;  3M6W A;  1PJ5 A;  3EDR B;  1O5J A;  4LFC F;  4TKT A;  2YKM B;  4UST A;  1ARO P;  5GAD I;  3PEJ A;  3MM8 B;  4LQ9 A;  3DLK B;  4K2X A;  4F04 B;  3QAT A;  3H4D A;  3KK3 B;  2QL5 B;  1ZM2 A;  5I42 B;  2MZT A;  5DZ7 A;  1F9E B;  1HNZ F;  2BKP A;  2NQP A;  2GX8 A;  3T1Y J;  4O3R A;  1TL5 A;  3TNV A;  2HZC A;  3K57 A;  4DXL A;  3JSB A;  3OR2 A;  1PC5 A;  3Q86 A;  2G2Y A;  4JI6 F;  4LMZ A;  1HKA A;  2E7W A;  5L1K A;  1S57 A;  1Y00 A;  1ZBT A;  2IBO A;  2HZV A;  4MK9 A;  3HLU A;  1U47 A;  1RWK B;  5KFV A;  2W9C A;  4K50 A;  4FF2 A;  5LMU J;  4YHH J;  1WHV A;  1GQE A;  3ITH A;  4F26 A;  3L3C A;  1YVF A;  4DL4 A;  2JFK A;  4JOU A;  2RRB A;  3D67 A;  4KGK A;  1R8B A;  4OYA A;  4CRJ A;  2C2Z B;  2HQD A;  4B9U A;  3Q24 A;  2JOQ A;  3ZO7 A;  2G0J A;  3DI6 A;  4U67 Q;  3FKB A;  5CH7 B;  3Q8P B;  1HHT P;  2VQF F;  2HK2 A;  5EX0 A;  3OL8 A;  1IKV B;  3CC7 S;  4PXB A;  3KNA A;  1T05 A;  3PHT A;  2RKI A;  4W90 B;  2V8D A;  4HL9 A;  3V4I A;  3QT5 A;  1VIO A;  3RB3 A;  3WX8 A;  4NRU A;  1C1B B;  2H5E A;  3CVK A;  1IKX B;  3M8W A;  3DXB A;  4JV0 A;  3DLH A;  3JYT A;  4DR5 J;  2CPZ A;  3NGS A;  5D4L A;  1SBR A;  3DHW C;  2FHO B;  1GTE A;  2IRX A;  3W62 A;  2E5I A;  2B6A B;  1OSD A;  4NCG A;  4NE9 C;  3JTN A;  5KAK A;  2GQ2 A;  2HFU A;  1N48 A;  3SCK E;  3M9N B;  3QPI A;  2EFO A;  3A8K A;  5LMN F;  3D28 A;  2HRU A;  1PYS B;  4QPT A;  1T03 B;  3TA2 A;  3P3D A;  2HVE A;  3BGU A;  2V9K A;  1QLN A;  1E6Y A;  4FF4 A;  3GJS B;  2G9O A;  2XB2 D;  1RQ0 A;  1J2V A;  4RO0 A;  1U1O A;  1CJT B;  4KKO A;  2FQQ B;  4EMD A;  2VC0 A;  2EC2 A;  1H2T Z;  2LA6 A;  1IQZ A;  3F44 A;  4DR2 J;  4UUW A;  3ILI A;  4OI4 A;  5D77 A;  2PMH A;  5HVF A;  1JXE A;  5DQH A;  1WEZ A;  1N54 B;  3WIU A;  1VQO S;  3C15 B;  5AE1 A;  2VPZ B;  3QO9 B;  2B5J B;  2ZJQ Q;  4PXD A;  3ETM A;  1NPK A;  2ZUA A;  5ETM A;  4DN9 A;  2W9A A;  4HDH A;  3GYX B;  1IBC B;  1X60 A;  4QW8 A;  2U2F A;  3WDO A;  2CNO B;  2RUS A;  1UW9 A;  3PX4 A;  3ZZO A;  5CHC B;  3PXG a;  2ZH3 A;  3ZZP A;  1BMQ B;  3EE3 A;  1BQX A;  3RG6 A;  4USJ C;  3AD7 C;  2EW9 A;  1XR6 A;  5J2N B;  4K4W A;  2BJ1 A;  1K0T A;  2RIL A;  4EYI B;  1UEV A;  3P8B B;  4TY9 A;  1WC6 A;  2EK1 A;  4ENO A;  4PXC A;  2JVO A;  1Y3K A;  3MEK A;  3GIM A;  3MCN A;  4A8F A;  2M88 A;  2DRD A;  3GYG A;  5FDL A;  2OHD A;  2QL7 B;  2V5H G;  3CCL S;  4ZMM A;  1HBM A;  4FZV A;  1PBA A;  1TKT A;  4LF4 F;  5CYM A;  1CBK A;  1T3O A;  4DV0 J;  2RHQ B;  2Z56 B;  4GC7 A;  3I5A A;  4N77 A;  1TUG B;  1VK8 A;  1GXL A;  1DBD A;  4DF4 A;  3R1L A;  2CPY A;  3K8W A;  3F56 A;  4RBU A;  2V6A A;  2GJI A;  2R7U A;  5LMU F;  4YHH F;  1U4B A;  1UFK A;  1S4E A;  2B4O A;  1TL3 A;  4A8Y A;  2KL8 A;  4RJV A;  1IBL F;  4ETZ A;  3KK2 A;  2J9E A;  3KLF B;  2XWY A;  1PAE X;  1G6B A;  1GXT A;  5DZ6 A;  4J9N A;  5A6W A;  1NJW A;  2OSQ A;  1X4B A;  2ZH9 A;  4EI2 A;  1H2V Z;  1O6X A;  1JLE B;  4DV1 J;  1DTQ A;  1NAQ A;  1CQM A;  3UN5 A;  4RU9 A;  4CDI A;  2NRE A;  4DR1 J;  3GCW P;  3PEH A;  3MCM A;  2DEI A;  3DCA A;  2NUU G;  2NLW A;  1QSS A;  1JLC B;  3M30 A;  4Q44 A;  1N88 A;  1M1H A;  3UE2 A;  1WWH A;  4PPD A;  4KB7 A;  4Y34 A;  2NZ4 A;  5C25 A;  3CME S;  4F3M A;  2JHE A;  2OAU A;  1WEL A;  1X5T A;  3ONQ A;  5ETR A;  4MKB A;  1SL0 A;  1QUP A;  1R27 B;  5CCL A;  5ETS A;  2X1F A;  1PJ6 A;  1TKX A;  3JSM A;  1JLQ A;  2HNY B;  4QJV A;  2L9N A;  1MWQ A;  1B64 A;  2HQC A;  4F0H A;  3IFE A;  4K0K F;  1RHU B;  2HUR A;  3MFI A;  1WDT A;  4C8M A;  4OZL A;  2MLZ A;  4A8S A;  4HVZ A;  4AFF A;  5KFD A;  3RB0 A;  2B51 A;  1MMD A;  3UCZ P;  1CJU A;  1FTR A;  3PFE A;  2I1R A;  1AZS B;  2H5J B;  4BDP A;  4MYU A;  4DV7 J;  4JI2 J;  1S1W B;  2ZWP A;  4X4R A;  1FE0 A;  2HHS A;  3FQL A;  4Q5V A;  2F4F A;  4GKJ F;  3L9Z A;  2VUG A;  3LTO A;  4DQS A;  4RWX A;  2ADC A;  4KIA A;  1ROF A;  4NLG A;  3MEE A;  1WC5 A;  1S6P B;  4QZV B;  1UMJ A;  2EXU A;  4DS5 A;  4M95 A;  4ED2 A;  3EGN A;  3T1A A;  3PHE A;  4RBV A;  1FFG B;  1KNZ A;  1TK0 A;  4ECT A;  2V8P A;  2O5D A;  4YP3 A;  3VGT A;  3E3X A;  3BS9 A;  2DGS A;  4KR0 B;  2GFF A;  3A4T A;  3V4M A;  1OS5 A;  4B3T J;  1YWX A;  1KVK A;  2DNY A;  2W7O A;  2DR7 A;  3OTE A;  2J6U A;  1LWX A;  4DV3 J;  1NM2 A;  4X4P A;  5HVG A;  2JLE A;  2V68 A;  4NYP A;  2FTR A;  5DS7 A;  3DDI A;  2VBY A;  1IBK F;  3MOZ A;  2MB0 B;  3MR6 A;  3GB0 A;  3T3F A;  2HMI A;  2UXC J;  4W4M A;  3BZQ A;  3V81 B;  1DLO B;  1ZAX A;  2HS3 A;  4OZN A;  1FJG J;  4DV4 J;  2R8H A;  4USW A;  4WK3 A;  5J2M B;  4XO0 A;  2LFV A;  4DV0 F;  4C8Y A;  3TQ1 A;  3Q8R B;  3VGV A;  4LF5 J;  1KLM B;  2X51 A;  2XSJ A;  2IJN A;  1IWG A;  2E44 A;  3QJL A;  4LIW A;  1P1T A;  4FPR A;  2ADB A;  3R6L B;  3HVT A;  4TY8 B;  4UOC A;  2MZQ A;  1NPP A;  1UEK A;  4YB7 A;  1H3D A;  2HBZ B;  5C42 B;  5FLX U;  3DMJ A;  2HGM A;  3IWL A;  5D6G A;  2Y8Y A;  2P9G A;  4ZVG A;  3ILJ A;  3NNH A;  1PIE A;  1VLY A;  2BJ8 A;  3GFX A;  1JB0 C;  1TQL A;  3OW2 R;  1JLA A;  4WFZ A;  4M5I A;  2KKH A;  3FCH A;  3FFI A;  2VHG A;  4DV1 F;  4DSJ A;  2J0W A;  1IN0 A;  1IR1 A;  2ZHB A;  2DXE A;  4NXM F;  2R7S A;  2KFY A;  2XUL A;  1RWM B;  2W2P P;  4LF8 J;  5A6P A;  5E41 A;  2PSZ A;  3KHH A;  3DOK A;  2YKN B;  1IJE B;  4JV1 A;  1HQ2 A;  2RNE A;  2XZW A;  3M8P B;  3KOA A;  4LFB F;  3M6V A;  4BLG A;  3FSX A;  1UZH A;  4IG0 B;  3KJN B;  1VQN S;  4DUZ F;  1HMV B;  3TJA A;  2J76 E;  2BRL A;  1FKP B;  1TL7 A;  1A0O B;  4IKA A;  2GHP A;  3LAM A;  4ILM A;  5IZH A;  3VVT A;  2UXD F;  4NWB A;  1HHS A;  3OBI A;  3ETO A;  1SUQ B;  4F4Z A;  2M70 A;  4JB8 B;  1IKY A;  3RR7 A;  1HWU A;  2QMU B;  1KR4 A;  3A8E A;  5CQG A;  3FUY A;  1K9M T;  4NCB A;  3B6B A;  2HG4 A;  3KHR A;  1Q0N A;  3LPE A;  4CI0 B;  2DVI A;  3FSY A;  3T5H A;  1JQG A;  4Y28 C;  4NLW A;  2UVR A;  4R25 A;  2QT7 A;  4AQY J;  3C6T B;  4RW8 A;  1HWK A;  3TZZ A;  1F5C A;  1S0N A;  4ZVE A;  1RT5 B;  1F9H A;  1ZM9 A;  1S12 A;  3GSI A;  3FEY B;  3NAH A;  1S6Q B;  2BAC A;  1S99 A;  4XK8 C;  3LPY A;  1PYT A;  3H5S A;  3MED B;  2HVD A;  2M9K A;  3ZTQ A;  1WKK A;  4U9R A;  1S1T B;  2GV1 A;  2RDD A;  4QBU A;  1P8G A;  1U6F A;  1HNX J;  4KT0 C;  1DQA A;  3IGV A;  5C5J A;  2HGN A;  3T5J A;  1KVI A;  1VQP S;  1WSV A;  5KFX A;  1Y5N B;  3BM7 A;  3UQS A;  4CO2 A;  2R3V A;  3T6J A;  4WYL A;  3CIZ A;  2DGQ A;  4P52 A;  3OXF A;  2R7Q A;  3GLJ A;  1GEH A;  1B0V A;  2GGP B;  2GQQ A;  2N7C A;  3M32 B;  4HDG A;  3TZX A;  3GIR A;  4C48 A;  4OYO A;  1J5O A;  3HHN B;  2W8K A;  1M0S A;  2R8I A;  4QYZ K;  2BKN A;  5L1J A;  2V8H A;  3CF5 Q;  3E01 B;  3U7J A;  1Y4Z B;  2UXC F;  2FZC B;  4DHV A;  3GJR B;  2DNG A;  3OR1 A;  2UVW A;  3FRY A;  2XSF A;  3S8S A;  3T19 A;  1VQ9 S;  1OPZ A;  3X3U A;  1XC9 A;  3NWR A;  1S0O A;  5GMD A;  3HD1 A;  2CQD A;  3M2R A;  5I3U B;  3H20 A;  2WTF A;  2OTL S;  4B3M F;  2AJ2 A;  2IA6 A;  3B4M A;  3RBE A;  2QFJ A;  4LF5 F;  2NSB A;  2XHW A;  2GJ2 A;  4LF6 J;  3HSZ A;  2NS1 B;  3IN5 A;  2YX4 A;  1M5V C;  4BC9 A;  1SQG A;  2BE2 B;  4K8R A;  5KT2 A;  1JLB A;  2YWF A;  4CLP A;  2W9B B;  1R0A A;  4DU7 A;  3LA0 A;  1AFI A;  4PQU B;  2VBX A;  1VQ5 S;  4EGL A;  2DKO B;  3M8Z A;  2Q6C A;  1RP5 A;  4Y65 A;  3PZP A;  2R7O A;  5KFS A;  2F9J A;  2FHJ D;  4WTY A;  2Z8Q A;  3TUI C;  1B0P A;  1BQN B;  1UWB A;  3NEK A;  3PJW A;  5LSO A;  4A8M P;  2BAN A;  1IM6 A;  5KT6 A;  2C2K B;  4KE5 A;  2KG1 A;  1UVK A;  2GS8 A;  5SZT A;  1X4C A;  4XDC A;  4FXW A;  1WOS A;  1RKJ A;  3AQP A;  1E6V A;  5B09 A;  1SV5 B;  2KXN B;  4FVC A;  3D3C J;  3M1V A;  2F65 A;  3ZFV A;  4K7Q A;  3W2V B;  2QE5 A;  1RTH A;  4FPI A;  2IVM A;  4ID5 A;  2C2O B;  2FLO A;  1FE4 A;  1X4E A;  1AT1 B;  1RI7 A;  4PAA A;  2Z30 B;  1V5V A;  2LXU A;  1FT8 A;  4MK7 A;  4F0M A;  1L3K A;  3PTW A;  1PJ7 A;  2J7W A;  3KDO A;  1J5E J;  4FN5 A;  3EPG A;  2Z2M A;  2AJF E;  2CWX A;  2KDO A;  2OML A;  3CJ2 A;  2RS8 A;  2DO0 A;  4R8U A;  1MWZ A;  1U45 A;  3HKW A;  5HMW A;  3OSN A;  3KMQ A;  2HHX A;  2HHW A;  2ROG A;  3DOM B;  1FKA F;  4OI0 A;  2V4J B;  3AY0 A;  3KUE A;  1KQF B;  4KAI A;  1QVG R;  4WK1 A;  3R27 A;  3DRY A;  5GVQ A;  5J2Q A;  4NLP A;  3UD3 P;  5IWA F;  3DYA B;  3CO9 A;  4JBC A;  1TL1 B;  3T5K A;  3AJ1 A;  4U6P A;  1LQ9 A;  1KOH A;  2DNP A;  2VZ9 A;  2PMZ D;  4Q43 A;  2PN6 A;  4WP9 A;  1FNX H;  2KYX A;  3S7R A;  1TUV A;  4QIF A;  1KEK A;  4QWA A;  4QIW D;  1HD0 A;  3NCQ A;  3DN9 A;  3UPF A;  1CC8 A;  1WF2 A;  2D3O 1;  4KH1 B;  2OPQ A;  4ED8 A;  3MUT P;  2U1A A;  4NEZ A;  1Y5I B;  3RBX A;  1TFW A;  1NB2 A;  4ES1 A;  2BOP A;  3UNY A;  3U1M A;  4CNZ A;  2AJ1 A;  2KZZ A;  3PV8 A;  3ULH A;  1PSD A;  3K59 A;  5D3G B;  2WW8 A;  4ALZ A;  3DLE B;  1SJR A;  2B56 A;  3PYF A;  4PXE A;  4LFA J;  4J9U E;  1SC6 A;  1YBU A;  2ACM A;  1B7Y B;  5I3P A;  5T7L A;  3D5M A;  4OX9 F;  3DLG A;  4UF4 A;  2AWZ A;  1FDA A;  3PYG A;  1HFE L;  2DGT A;  1FWK A;  1VBK A;  2DIS A;  3GV7 B;  2XY6 A;  2E1P A;  1XR5 A;  2DB1 A;  3JTO A;  2W24 A;  3W9J A;  3VAH A;  3R5A A;  1WG5 A;  4DFP A;  1DQ8 A;  1XNR F;  4JYA F;  3KLF A;  1WJ9 A;  4I7F B;  2IFX A;  2I6W A;  1BXN A;  4TU7 A;  4RZR A;  1S1U B;  3MF5 A;  2W7A A;  1C4A A;  2XWX A;  5M2U A;  4NLV A;  1AFJ A;  2VA3 A;  2FZK B;  3G6Y A;  2ZNZ A;  5CYJ A;  1HQU A;  4Z7Y A;  1XQI A;  2PII A;  1HPZ B;  2ZWO A;  4L72 B;  4M5M A;  4OL8 A;  1VBY A;  4HI1 A;  2AZ3 A;  1D1U A;  2DH7 A;  1NK5 A;  2C2R A;  1JLC A;  2ZOF A;  3R5J B;  1Q8L A;  4YB5 A;  3S6E A;  2KT3 A;  2Y9H A;  3CJK A;  3KLH B;  5F8I A;  1YJ9 S;  3RUB L;  4F67 A;  2FDN A;  4KGZ B;  1H73 A;  1NUE A;  1KQS R;  3KG1 A;  2E29 A;  4NZ0 A;  3TRG A;  1CLF A;  1EP4 A;  3MD3 A;  4ZPV R;  2J6T A;  4Q8E A;  2G2Z A;  2QX0 A;  2DJW A;  2HKE A;  1VQL S;  2IM2 A;  2DIV A;  4DSI A;  4ZPC A;  1NKE A;  3OFE A;  5CD4 A;  3QWP A;  4KO0 B;  1Q8I A;  2KXF A;  4P9S A;  3W63 A;  4HKQ A;  5HI7 A;  2LDI A;  1WOP A;  3HMJ G;  2HHH J;  1FNM A;  4PWU A;  1LWF A;  3GWC A;  3AFG A;  3R2C J;  4URG A;  4W92 B;  4X4N A;  3QRP A;  1JWW A;  4NLU A;  1YHQ S;  2F63 A;  3AXM A;  1KVJ A;  4I4B A;  1SJQ A;  3SXL A;  8AT1 B;  4DX5 A;  1UJ4 A;  1KHV A;  2G1D A;  1HBU B;  3MMA A;  4DL0 C;  3KWM A;  4LVO P;  1GTH A;  3D66 A;  4P6Q A;  4FXD A;  3PR5 B;  2ZBP A;  4DPW A;  3P4U B;  2VFS A;  4L73 A;  2VDI A;  2KT5 A;  2RE1 A;  1CJV B;  3H5U A;  3DFE A;  4Y00 A;  5HMY A;  4QWE A;  5M2R A;  3WQP A;  4GVB B;  1HQE B;  2HFN A;  3KLE A;  4OYM A;  3GR1 A;  3MDF A;  4L3K A;  1RHJ B;  4WE1 B;  1RWV B;  4ZLP A;  3PYE A;  5GAH U;  2DHS A;  2H51 B;  8RUC A;  4OZ2 A;  2KTQ A;  3FVY A;  3KTQ A;  3QYY A;  4JI5 F;  2D41 A;  4WFA Q;  4LSN B;  5A8W A;  2I5J A;  1FI4 A;  4WKR A;  1SKS A;  3CJ0 A;  3RB4 A;  2IDL A;  2ZVS A;  1UVL A;  3W2W A;  1FKO A;  4DLE A;  1ZTT A;  1JNR B;  5I3Q A;  2F8M A;  3FK4 A;  4ZIW A;  1FJ7 A;  4ZS6 A;  3THV A;  1D8Z A;  2ZDO A;  5F9L A;  4GC6 A;  2F5G A;  1XNQ F;  4WBF A;  4WF9 Q;  5KFL A;  3G8T A;  1EQM A;  1YZ6 A;  3CJ8 A;  2M4M A;  2IRU A;  4K4T A;  2XGP A;  1S0V A;  3D6F B;  1NKC A;  1S4F A;  4P72 A;  3PRV A;  3NMR A;  3IAM 9;  3HJF A;  1NDC A;  3ICL A;  3MM9 A;  1S79 A;  4B9L A;  3VV2 B;  4OYP A;  5IOL A;  1MU2 B;  5KT7 A;  1NEE A;  2QO3 A;  1UA0 A;  2ZOM A;  4ECS A;  1NCL A;  3BV8 A;  1S97 A;  3NNC A;  3AD9 C;  2BDP A;  2APO A;  3GV5 B;  3CJ3 A;  3NGT A;  3FGV A;  4GRS A;  1FDB A;  3W9I A;  2OKQ A;  4K4X A;  2X1B A;  5HK4 A;  1BHN A;  4HAC B;  1UWA A;  5LT5 A;  2EFQ A;  2MHN A;  1W2B R;  1D0E A;  3J81 U;  3J7A 1;  3UNG C;  1HMV A;  2NXU A;  4RLE A;  4ZVU B;  2CQ2 A;  3F73 A;  3K0J A;  1RHM B;  1IUJ A;  1DTT A;  1JLG B;  1ZA1 B;  1PO6 A;  2PGC A;  2D74 B;  5D4O A;  2XLJ A;  5A8K B;  4ZVH A;  1R0C B;  2UVU A;  2RH3 A;  2ZD1 B;  2KRR A;  2HFZ A;  5EDW A;  1FDN A;  4NLY A;  4XDD A;  3V6D B;  3NGR A;  3N5F A;  4IH7 A;  2BZ2 A;  4DPX A;  1CEZ A;  1SIW B;  1OYD A;  2V2V A;  2AMC B;  1X5S A;  4N8N A;  3T41 A;  4RU2 A;  3BO2 A;  2AJQ A;  3EVM A;  1X0P A;  3MUV P;  4DCO B;  2FVS A;  3MR2 A;  1M5P C;  4TLR A;  4DR7 F;  2HQ3 A;  4ZLN A;  1YZ7 A;  4DV5 J;  4MH8 A;  4WFY A;  1NPR A;  3H42 A;  2HAF A;  1XN9 A;  2UU9 J;  2DNO A;  1S1T A;  2CVE A;  5LOQ A;  4DZD A;  1EIY B;  4YEA A;  5J1N A;  4B9M A;  3SQG B;  2RQK A;  2DNR A;  1BE4 A;  5DQG A;  2C3P A;  2ZEJ A;  1U1Q A;  2DGU A;  4P7T A;  1K8A T;  3TX8 A;  1RT7 B;  4F8R A;  4DFM A;  3DDN A;  3GFH A;  1Q5V A;  4U7C A;  1FXL A;  5EUH A;  2GGP A;  4CO4 A;  1U09 A;  3WBZ A;  1SJ1 A;  3SCL E;  5T14 A;  4DQP A;  2Y1J A;  2JNJ A;  7FD1 A;  2R7V A;  3Q0A A;  2FJD B;  3QNW B;  1XMQ F;  3CCW A;  1C0U B;  4KYZ A;  2W4C A;  2E1R A;  4WZM A;  3WC0 A;  4JI3 J;  3UWT A;  2KU7 A;  5DG8 A;  2KJW A;  5A0Y B;  3NGK A;  2VOO A;  2K3K A;  2ZBI A;  1QTN B;  1REV B;  4RUA A;  1C1C A;  3GON A;  5C24 A;  3PR4 A;  3CW2 C;  1FNO A;  1HD1 A;  5F0U A;  3RZA A;  2OGU A;  2VG7 B;  1IR2 A;  1YLX A;  4QCL A;  4DLG A;  1WEX A;  4OFZ A;  5G0R A;  2DNL A;  4CT8 A;  3TAM A;  2GO8 A;  3SFU A;  2HW3 A;  5HQ8 A;  2W2M P;  4BHQ A;  1RAO A;  1VQY A;  3I0R A;  1BC6 A;  5HP1 A;  3ZZZ A;  1KN6 A;  3GJT B;  3I4P A;  2C3U A;  3OPK A;  4TVA B;  5D0H A;  4V19 J;  2D3O R;  3VQS A;  1R43 A;  1WOO A;  1VIX A;  2POK A;  2DCU B;  2RSQ A;  3CD0 A;  2AYG A;  5DLF A;  3OTC A;  2X3D A;  4RNF A;  1AUD A;  4KV8 B;  4ZVF A;  3ZZU A;  4ZHR B;  4HI2 A;  5EGY A;  3CNQ P;  1RTI A;  2HZA A;  3KLG B;  4EUV A;  4L75 A;  4C3L A;  5GAH I;  1TKZ A;  4YY3 F;  4CNY A;  3GP9 A;  1L5U A;  5RUB A;  3W8P A;  1TMM A;  2CJA A;  4I1T A;  3QZ8 A;  3DOM A;  2DHA A;  4N47 A;  1G2E A;  1RXO B;  1NHK L;  1LW0 B;  5IC4 B;  1NK4 A;  2JEI A;  4M5D A;  3SSR A;  5AJ3 J;  7AT1 B;  3PX6 A;  2DR8 A;  1IBM J;  1FES A;  3S1T A;  1CSJ A;  4MIA A;  2VFV A;  1S72 S;  2XCA A;  1UFW A;  2ASD A;  3DRS A;  2HNZ B;  2JRS A;  2WK4 A;  1KHW A;  3DRR A;  5DDR C;  4A8Q A;  1GH8 A;  3TUZ C;  1Y9O A;  3PCO B;  1WDD A;  5HO4 A;  4G3I A;  4ED7 A;  1O8B A;  2YWH A;  2E7X A;  1MRO A;  1RT2 A;  1RBO B;  2ZZN A;  4DV5 F;  4B9N A;  4LF7 J;  5KOW A;  4GKK F;  1RAJ A;  3GCX P;  3LQV A;  3OR2 B;  1RSC A;  1VOM A;  1GFW B;  5HAO A;  3E51 A;  4NA3 A;  2ZH6 A;  4IFY A;  2DO4 A;  5K8M A;  1QAI A;  3SMZ A;  2KHD A;  1PG5 B;  3R5B A;  3H4B A;  5E3A A;  1U1P A;  1NXI A;  2V50 A;  4MKY A;  3C46 A;  4YR2 A;  2J8A A;  4CCH A;  2G0I A;  2NYH A;  1Y0H A;  2C2E A;  2W9C B;  5LSL A;  3C16 A;  5KFY A;  3NL0 A;  3ITH B;  1ACM B;  3A12 A;  5B0C A;  5LL6 d;  2XQC A;  2FHK A;  2AW0 A;  1HR0 J;  2XNQ A;  2BJ7 A;  4NAS A;  4X64 J;  4KHR A;  4Z2X A;  3HXM A;  1Q78 A;  1MML A;  2RDI A;  6FD1 A;  1MN7 A;  2ZE2 A;  2M5Y A;  2A1B A;  1IJF B;  4BWM A;  1HNW J;  3H5X A;  2KFN A;  3DI6 B;  5CZX A;  4M5H A;  2O01 C;  5KFB A;  1M5S A;  2LQ5 A;  2J8S A;  3R8Y A;  1H2U X;  2VQE F;  4J9Q A;  1R8A A;  1RAG B;  1U0S A;  2ATC B;  2BE7 D;  1U2R A;  3SV3 A;  1KON A;  3GTY X;  4O3Q A;  1A6L A;  1F5A A;  1F1B B;  3OSP A;  3W60 A;  2DR6 A;  3V4I B;  3IR6 B;  2UP1 A;  2BKO A;  4B9S A;  1HPZ A;  4I67 A;  3MR3 A;  2HHP A;  3QGG A;  2V2Z A;  4FF1 A;  3IRX A;  4FYX B;  4DUT A;  3NS6 A;  3NKY A;  5B0G A;  3WIV A;  4PUO B;  3VF0 B;  4F4Y A;  1NK9 A;  4UQG A;  4FBU A;  4M5L A;  2K3I A;  2OFG X;  3G6E S;  1YRX A;  3HSG A;  3IAS 9;  2VPY B;  2DY9 A;  1R6Y A;  1PGZ A;  5BJR A;  4ZVP B;  5BR8 J;  1X5O A;  3GG0 A;  4O3N A;  4KO0 A;  3NGD A;  1E6Y B;  4AL5 A;  1CUL B;  2JLF A;  1BUX A;  1TKD A;  4KKO B;  2PDA A;  1XTZ A;  1S1V A;  1MLA A;  5DQI A;  3M4X A;  1OYE A;  4WPA A;  1AB8 A;  2MQP A;  1VYA A;  5HLF A;  2VIH A;  1NDL A;  3UD5 A;  5DGB A;  1NBE B;  3MTJ A;  2B4V A;  1JK9 B;  4A8K A;  4I6A A;  3EUN A;  3PW4 A;  2VOD A;  1RAH B;  2EFG A;  2HFV A;  3BSA A;  3BDE A;  4MT1 A;  3IS9 B;  4UY8 T;  4H4K C;  3V6H A;  2MLY A;  2CQC A;  5C7P A;  3NBP A;  3QGI A;  1ZYQ A;  4Y2M A;  3QAE A;  1GNK A;  2H9Z A;  4NLR A;  3JQK A;  4CLL A;  3KJF B;  3HFK A;  1VQS A;  2LEA A;  4EO8 A;  2HIY A;  3KJV A;  5IS2 A;  3D6H B;  3PY8 A;  3SV4 A;  3MFH A;  4QU7 A;  4DV6 F;  2BRK A;  1S5Z A;  4QW9 A;  4ZPB A;  2B8Q A;  3MCS A;  4DUY F;  4K4Y A;  1FA0 A;  4CM2 A;  2CPD A;  4HH1 A;  2PEB A;  4K5R A;  4LF9 F;  5FDL B;  1U6B A;  3G82 A;  4FYV B;  1HBM B;  5LXR A;  1JJ2 R;  3AOB A;  5L1I A;  3CC2 S;  1RUS A;  2QMW A;  4JV2 A;  2VAS A;  4JV5 J;  2B8P A;  3TVZ A;  4K4U A;  1HA1 A;  2MQN A;  3BN7 A;  2ZJP Q;  2A2C A;  2QTW A;  3UD4 P;  4HTI A;  2V2Q A;  2WBM A;  1A7G E;  4ZIT A;  4EZ6 A;  4J9L A;  3OXG A;  3ZNU A;  3TJ8 A;  5AXM A;  2FVR A;  4HHH A;  2QIF A;  2F3J A;  3FEX B;  4FNH A;  4DL6 A;  5H9E J;  1TL3 B;  2P2C B;  3EGV A;  3LP1 B;  4MAK A;  2KN4 A;  3KK2 B;  4KBI A;  1HNW F;  4WXW A;  2ASY A;  2RJZ A;  3N5B A;  5FD1 A;  2ZM6 F;  4NLO A;  1F0X A;  4B17 A;  1DTQ B;  4J37 A;  3M05 A;  5IT4 A;  3IWX A;  3GYN A;  4IFV A;  4ZJO A;  4N56 A;  1FRK A;  5DET A;  1YJT A;  3OD2 A;  3HK2 A;  3O2I A;  4F7V A;  1WC0 A;  4UZC A;  3RW6 A;  4ZCM A;  4FKX A;  1MU2 A;  2YBV A;  3M30 B;  3MUM P;  3H25 A;  3CCZ A;  3OFG A;  4PWD A;  2CQB A;  1N5S A;  5C25 B;  2XZD B;  1UPP A;  1RU1 A;  3CCU S;  3FZB A;  1ZET A;  3HHL D;  1NH7 A;  2EFP A;  2EC0 A;  3X1L B;  1L3V A;  2J9C A;  2Z2Y B;  2RQC A;  1TKX B;  3JSM B;  2A0F B;  1N6Q A;  1JLQ B;  2VFU A;  4OHW A;  1CC7 A;  1SIZ A;  1EKS A;  4ZN1 A;  1T9U A;  2B3T B;  1WUU A;  1RWP B;  9RUB A;  3VHQ A;  1GMU A;  1GX6 A;  3FC9 A;  1LFW A;  3NS5 A;  3Q8Y A;  4OJH A;  4IUF A;  4I6Y A;  3BF4 A;  3HD2 A;  1SJ4 P;  1DUR A;  1CJU B;  3KYL A;  2NXN A;  1U2F A;  2DHG A;  3BGR A;  1T02 A;  4USV A;  4ZP8 A;  1KQG B;  1ZM3 A;  3R7B B;  5IM0 A;  2YX1 A;  1REG X;  3UDL A;  1V6H A;  4C4W A;  1F3F A;  9ATC B;  4C0H A;  3HCX A;  3ZTS A;  1HHQ A;  1Q79 A;  4EBC A;  4X62 F;  2F4V J;  3SSQ A;  2FJE B;  1RCX B;  3ENA A;  3PM9 A;  2F1F A;  2UZA A;  1KFD A;  2EEY A;  2CRL A;  2RS2 A;  3SQG A;  2IAJ A;  1UJ6 A;  2K06 A;  1RZM A;  3D68 A;  3VAI A;  3CGI A;  3CCV S;  1TR0 A;  4OI2 A;  3JQM A;  2RQ4 A;  4C8N A;  3IGN A;  5J2P A;  2GAH C;  2XGQ A;  1X9M A;  1Z4U A;  2XBP A;  2DYA A;  4R0J A;  1A9N B;  4C7Q A;  1XR7 A;  4B9V A;  3OVB A;  4ZVS B;  2UXB F;  1HYS A;  4C97 A;  5K14 A;  4CIO A;  2DD8 S;  3FBF A;  5DM6 Q;  3VWS A;  4ZN3 A;  2HMI B;  1VQ7 S;  1FJE B;  1B4S A;  3BGL A;  1S1X B;  3U27 A;  2XMA A;  4AXI A;  4P73 A;  4U8V A;  5K8P A;  5HRO A;  1LK7 A;  4M63 A;  4DQR A;  4PG8 A;  3CE8 A;  4X65 J;  2OO4 A;  3KKF A;  3G2X A;  3VZH A;  2AJ4 A;  4H4M A;  2XSJ B;  2FJW A;  3R5G A;  1H72 C;  2LQ8 A;  3EGW B;  1U8S A;  2OSR A;  3CCM S;  4E8U A;  3J80 U;  4F2R A;  3FBE A;  2OP5 A;  1TEL A;  4IRC A;  4DDF A;  2XLK A;  3RRK A;  3DMJ B;  2ZH8 A;  4G1Q A;  2CZ9 A;  2KXH A;  3PIO Q;  2UUC J;  2C2N A;  2DGO A;  3POT A;  1JLA B;  3H90 A;  4MFB A;  3FFI B;  4MKV A;  1NJZ A;  4RPF A;  2JFD A;  2WSF C;  2M52 A;  1IXK A;  2QLW A;  4PR6 A;  4QYR A;  1RAC B;  4LRB A;  2JJ4 D;  1F60 B;  2R9L A;  1N33 F;  1YX2 A;  1VQ6 S;  1VQ4 S;  3DOK B;  1H98 A;  4EK2 A;  1WSR A;  2QJ3 A;  1DHM A;  4DQQ A;  1TAQ A;  1EX8 A;  2LKZ A;  3OTB A;  4IYQ A;  1Q7Y T;  4CT9 A;  4LRC A;  2ROP A;  3A3P B;  2PMW A;  3CTR A;  2CWK A;  4FYW B;  5KFI A;  2FVC A;  2DTJ A;  4S0M A;  1TL7 B;  2ASJ A;  3LGH A;  4P2X A;  1GMW D;  5JMN A;  1S76 D;  3OLA A;  2RU9 A;  3KMS A;  3AQO A;  2QA4 G;  1VK3 A;  1RT3 A;  2UUB J;  2YPZ A;  4YB6 A;  4ETX A;  3QT8 A;  1IKY B;  1TU0 B;  1U6Z A;  4TYB A;  2EKY A;  2A6M A;  3HVA A;  2VD3 A;  1CQN A;  5ETT A;  3MR5 A;  5D0G A;  2OEK A;  1N5Y B;  1YJ7 A;  4URS A;  4I0W A;  3P5T L;  3HUL A;  3AXK A;  4C98 A;  2VC1 A;  4RW8 B;  5HL7 Q;  4GO5 X;  1N36 J;  3A3O B;  2MKH A;  2HNZ A;  4ZDN A;  4LBI A;  2G0C A;  1F2H A;  2EPI A;  4AE5 A;  3HVW A;  2VFT A;  2WAQ D;  2WON B;  3SI8 A;  1RBA A;  3EPI A;  2WCX A;  2PE8 A;  1B3T A;  3EGZ A;  2NCK L;  5F8M A;  3TZY A;  3MXH P;  2KO1 A;  1WKL A;  2ZNY A;  1SH0 A;  3FCV A;  2CG4 A;  3OT9 A;  1K1S A;  4LSZ B;  3CT9 A;  1NK7 A;  4NI2 A;  2XZT B;  1L3T A;  1HWL A;  3HVR A;  1I5O B;  1HI0 P;  3KG4 A;  2VBW A;  5CZV A;  3UDC A;  2X1G A;  4G1I A;  2R8G A;  2GMH A;  1J5O B;  1NDK A;  1WG4 A;  4RKU C;  4OJ3 A;  1Y3J A;  3Q2S C;  3I0S A;  4C11 A;  4E98 A;  1XMO J;  4WIQ A;  4DFJ A;  2D7S A;  4O3O A;  2CYY A;  3M9M B;  3BJY A;  4OMF G;  3TUJ C;  3OR1 B;  4KQZ A;  5HAT A;  2O66 A;  1I94 J;  2VV5 A;  5U47 A;  2JLG A;  2CPH A;  3O3L A;  3M2R B;  2AU0 A;  2XMJ A;  4LRF A;  2CJQ A;  5C2G A;  2QL9 B;  3SBM A;  3QID A;  4ZVQ B;  4LT6 A;  2Y3Y A;  1SQE A;  3MMJ A;  1SQF A;  2B9E A;  4AND A;  1ITP A;  2FLL A;  2VKR A;  1P27 B;  3TA0 A;  3BKF A;  3CJR A;  3ZZR A;  3RBD A;  1JLB B;  1T7P A;  2C28 A;  1RAI B;  3HHD A;  1DZ5 A;  1R0A B;  4PZV A;  3SZ2 A;  5L8R C;  4WWS A;  2DGV A;  2V8V A;  3MPW A;  4QWC A;  5L46 A;  4LRE A;  2VJU A;  4X66 J;  3V6J A;  4W98 A;  1TZ0 A;  4PUO A;  1MWY A;  3MEC A;  1RHR B;  5I4M A;  1UWB B;  2KI2 A;  2IRY A;  3UI3 A;  3A8I A;  2BAN B;  3IM8 A;  3NMA A;  3JXO A;  4DR3 F;  1S6O A;  1URN A;  4I2P A;  5KFQ A;  2MHE A;  1R8C A;  3L7P A;  3BR9 A;  2CJK A;  2XCP A;  2ZHO A;  1E6V B;  4M5G A;  1TVR A;  3M1V B;  3H7H B;  4Q2M A;  2LP4 A;  1NLK L;  3IP0 A;  3O6Q A;  2XY7 A;  1ZAW A;  4C0B A;  2IC3 A;  1RTH B;  4DPO A;  4ID5 B;  4ZJL A;  3W61 A;  1CUL A;  2M0G B;  3DXS X;  3MZI A;  5GAE U;  1M5O C;  2R2R A;  1X4A A;  3DHX A;  3P45 B;  3H5Y A;  3MAH A;  3RJM B;  1S10 A;  1UW4 A;  2ZC3 A;  3W3S A;  3HP6 A;  1HW8 A;  5K9F A;  3KHL A;  5G4D A;  4R8U B;  3RR8 A;  4NX9 A;  1G7C B;  4E2F B;  1U8W A;  2H1Y A;  2OD6 A;  1TUW A;  1UPM B;  2IYI A;  4OIX A;  4PEO A;  4A48 A;  1VLO A;  2DIT A;  4M1K A;  1WC3 A;  5J2Q B;  4FDF A;  3IS9 A;  5D0R A;  2NPF A;  5KG4 A;  4C0O C;  3R6G B;  1YJN S;  3J7A N;  2DHX A;  1I1G A;  1U1N A;  2W1B A;  3IG1 A;  2D9O A;  3E2E A;  1QVF R;  3DRP B;  1AW0 A;  2J5A A;  4PCQ A;  4DJB A;  1FRM A;  4NCA A;  3WC2 A;  2V4Q A;  4B3O B;  1N36 F;  2W8L A;  2M2B A;  3I4H X;  2E5L J;  1FO1 A;  3RYL A;  1FF2 A;  5IV4 A;  4IDK A;  1JXL A;  2OPQ B;  4LBH A;  2KFZ A;  3T1Y F;  4B3R J;  3CSK A;  3QSY B;  3I55 S;  3CO0 P;  5KFO A;  2HS0 A;  3R9L A;  2QEX S;  2FHM A;  5L38 A;  3LH2 S;  1RT6 A;  1RU2 A;  2E1M C;  4DR6 J;  4RNH A;  1NHV A;  3PO4 A;  2FC9 A;  2IVY A;  2OUG A;  3M2V B;  4BBY A;  1HWI A;  3R5C A;  3JSY A;  5B0F A;  3CD6 S;  2YNH A;  3A3N B;  2MDA A;  2LDY A;  5T7L B;  4UOH A;  4TQR A;  3DLG B;  3AHP A;  5AE3 A;  4F4W A;  1QTM A;  4IO9 Q;  3QGP A;  3H2L A;  3V2U C;  4C2M A;  2YH1 A;  1YBT A;  3GJQ B;  1VBX A;  1KFS A;  2VH7 A;  1WF0 A;  2AJ0 A;  4O4G A;  3QT7 A;  1TP7 A;  4NRT A;  5KG6 A;  1XMO F;  3VAG A;  1Q95 G;  1VDH A;  4BWJ A;  1OY6 A;  2IMW P;  2CQH A;  3O1L A;  3LP1 A;  3BKU A;  1X9S A;  2FJB B;  2M7S A;  3N0V A;  2KVQ E;  1RT4 B;  2BJ9 A;  3KG0 A;  5H9F K;  4NLS A;  5T41 A;  2A18 A;  1SJF A;  1CPZ A;  3Q8S B;  5CYQ B;  3OQ2 A;  1NKB A;  3PDN A;  1M5K C;  3I5B A;  1HQU B;  3PO5 A;  2OIH A;  1OO0 B;  5DGA A;  1QAJ A;  3T1H J;  4ERD A;  4MIB A;  3OLB A;  3FRZ A;  4G6V B;  3BN4 A;  4A8W A;  1SJ3 P;  3TVK A;  4ED0 A;  2GC8 A;  1U02 A;  4MYT A;  3OL7 A;  1F9F A;  3F41 A;  2I2Y A;  4DR5 F;  4X66 F;  3CUN A;  3CJK B;  4X4Q A;  1TK5 A;  3J7Z 5;  4OYZ A;  4ZVO B;  5D4N A;  4R0E A;  4O23 A;  5ITH A;  2CJ9 A;  1EP4 B;  4C8K A;  1FCA A;  3QZ7 A;  1G3O A;  4PYD A;  3ENW A;  2M3D A;  4TN2 A;  6AT1 B;  3ZXW A;  2NXE A;  4OZ5 A;  3M8R A;  2ZUG A;  3J81 j;  4ZA1 A;  3RBZ A;  1LWF B;  4RW9 A;  2ZKT A;  4CTA A;  4K2J A;  2R7W A;  2K7J A;  3J81 Y;  4IR9 A;  3L7O A;  4ZP9 A;  3H40 A;  1QAX A;  1D9F A;  3GPA A;  2E5H A;  3A13 A;  1MSW D;  2FJV A;  4LUB A;  1T11 A;  3LAN A;  5HN0 A;  1EZZ B;  4DR2 F;  3MMA B;  2NXJ A;  3M2U A;  3Q8U A;  4IOB A;  5MLC V;  4EWT A;  4UTG A;  5IT0 A;  3AJ2 A;  1JLF B;  4K59 A;  2LQB A;  2QLX A;  4JI7 J;  1PBU A;  3OUY A;  4RUC A;  2BOA A;  1KBR A;  3GV8 B;  3LGN A;  1OJ4 A;  3BYP A;  3BDP A;  1NSQ A;  4ZVT B;  1DFD A;  5DDO C;  2H65 B;  3D7S B;  2ZJR Q;  5CD4 H;  3KLE B;  3CWJ A;  5MAO A;  2QC3 A;  1VQK S;  2ZOG A;  3EZO A;  5DLG A;  4EFA C;  1N34 J;  1JIH A;  5AE2 A;  1LWC A;  2AP6 A;  2OEL A;  2B9X A;  1HBO B;  1U0H B;  5A8W B;  3NWG A;  4LF1 A;  4J91 A;  2I5J B;  5DJB A;  3VVU A;  4RW7 A;  3MPD A;  4ELV A;  4A8O A;  2VOP A;  1QE1 A;  2COL A;  1S1X A;  1FRX A;  4DR6 F;  2BW7 A;  3W2W B;  1FKO B;  2CNL B;  2HRT A;  2R2S A;  2HHU A;  3NY0 A;  4DCJ B;  4AL6 A;  2MZ1 A;  2CPX A;  4KGV B;  4ZPW R;  2ZIT A;  2X1A A;  2B9W A;  5DRK A;  1TV6 A;  4B02 A;  2C3Y A;  1T95 A;  4ECU A;  4IG3 A;  3VQT A;  3EX7 B;  2V4R A;  2OMO A;  2AIR B;  2FVP A;  2L9D A;  1H0H B;  5GAE I;  3A1Y G;  5B0D A;  4DX8 H;  1NU4 A;  3ENV A;  3JQJ A;  1VHF A;  3SEO A;  2GIF A;  2XI3 A;  1SC1 B;  5LSR A;  4YQW A;  4DOZ A;  3LGM A;  3OTO J;  2JDJ A;  3MM9 B;  3M9O B;  1FFS B;  4C3K A;  3N6N A;  4WJB A;  4DR4 J;  4O4R A;  3EVO A;  4DR1 F;  3RTV A;  2MQQ A;  1W2I A;  4DSL A;  4QR0 A;  3RU0 A;  1S6U A;  4PWW A;  4NXN J;  2CUY A;  3DLL Q;  3C6U A;  1UL3 A;  1ZAV A;  4DL7 A;  4AYB D;  1SVD A;  3SIP B;  3CC4 S;  1S9F A;  2XTJ P;  3K89 A;  1RJJ A;  3K5M A;  3D9B A;  2E7V A;  1HBN A;  2RHS B;  3A8J A;  4ZPD A;  1XBW A;  1LEO A;  1WC4 A;  4P2M A;  3TWZ A;  5KOX A;  1FK9 A;  1DTT B;  4NMX A;  4ED1 A;  1WHX A;  2PD1 A;  3EZU A;  4IOC Q;  2MGZ A;  1SI9 A;  2JWN A;  4DWI A;  5IQ6 A;  2MQL A;  3QLH A;  2N4C A;  2OJ3 A;  1RWN B;  1I51 B;  2GZO A;  1LKZ A;  2HK3 A;  2MKS A;  1KD1 T;  4ED6 A;  2LU2 A;  4DV7 F;  1W26 A;  4DPU A;  4JI2 F;  1HNZ J;  2NSC A;  3EMT A;  2OD4 A;  2QN6 B;  2LEC A;  1KRP A;  2G4B A;  1N5Y A;  3AOD A;  4Y2C A;  1KDN A;  4OQJ A;  3QIP A;  1HI8 A;  4DL5 A;  1WI8 A;  3HHK A;  3TEG A;  3DGP A;  4CH1 A;  4JI6 J;  3HT3 A;  2XI2 A;  4USI A;  2WON A;  2R8J A;  3MMB A;  4CLK A;  4NLT A;  5ETQ A;  2R2U A;  2LLZ A;  4K4Z A;  3PX0 A;  4FKY A;  2YNG B;  4N41 A;  1NDP A;  1BQM A;  1VMB A;  4HHU A;  4XTT A;  3RAX A;  2CZ4 A;  4NZ7 A;  4YR3 A;  2UV8 G;  4TNO A;  2R2T A;  4YB1 P;  3CED A;  2HWT A;  3EXY A;  4LR7 A;  4B3T F;  2DK2 A;  3THT A;  2YKO A;  2L08 A;  4RW6 A;  2FYX A;  2J7K A;  1RWO B;  4DV3 F;  1YTY A;  1OMS A;  1PKU A;  5HSP A;  3UCU P;  1AYE A;  3SYZ A;  2IJF A;  2VQF J;  1UAW A;  3DC2 A;  1X4F A;  2PFD A;  3W9H A;  3K5P A;  1FJG F;  2HBY B;  4DV4 F;  3G86 A;  4OI3 A;  1RIS A;  4H54 A;  1QDU B;  4NYO A;  2D69 A;  1DAR A;  4PKD B;  2AV5 A;  1B99 A;  1GT8 A;  4ECY A;  1YSJ A;  3DLJ A;  1F6T A;  1LW2 A;  1H7X A;  3FBB A;  4N5S A;  4CO0 A;  1HI1 A;  4Q2L A;  2AEF A;  1ZOT A;  1C1C B;  5C24 B;  2V67 A;  5KFA A;  3U02 A;  5L1L A;  3VCD A;  3BSO A;  3DOL A;  1WTF A;  5LMN J;  3G9C A;  2MEW A;  2MTL A;  5L39 A;  3KUH A;  4OZ1 A;  5G0R B;  4CLT A;  3JAM Y;  2IPO B;  2ATL A;  3TAM B;  4ZVR B;  4WCE Q;  2JZ5 A;  1ZH5 A;  1FFW B;  3I0R B;  1X4H A;  2LA4 A;  2LVW A;  3QT6 A;  2P9C A;  4JI0 J;  5HP1 B;  2J0X A;  3NS7 B;  1IKW A;  3I82 A;  4YDX A;  2YXL A;  3QQC D;  1Z1Z A;  2ROE A;  4LF8 F;  4NXN F;  4USK A;  1M5H A;  5LM7 E;  4IRD A;  4WYW A;  2Y0B B;  5KFR A;  2P8I A;  1B7F A;  1K1Q A;  4ZPT R;  3CDE A;  3Q23 A;  2QLJ B;  4DF8 A;  1I6J A;  1YG0 A;  4J7C A;  4CM0 A;  3JS9 A;  1RTI B;  2GMJ A;  5K5M A;  4LRD A;  2N3L A;  1OQ6 A;  1TKZ B;  3AOC A;  5A76 A;  2CA9 A;  4ECZ A;  5JJB A;  2HWI A;  2D1C A;  2Y0S D;  2WOM B;  3C66 A;  1PYO B;  3G8Q A;  2CQ4 A;  1JNZ B;  4FNI A;  2BQR A;  5JXS A;  4ID8 A;  3GU0 A;  1VS3 A;  1D3W A;  4M5D B;  2DNK A;  3UN2 A;  3MPY A;  1S9E A;  3NOC A;  4J9V A;  4DL3 A;  1PC4 A;  4DFK A;  3LWM A;  4IR1 A;  2WVD A;  4OLP A;  1U1M A;  2A6O A;  3DRP A;  3DRS B;  3DRR B;  4AQY F;  3HPO A;  4IRK A;  5GME A;  4B3O A;  2HQI A;  1YJR A;  3PKY A;  2BW2 A;  5KFU A;  1Q53 A;  1NSK L;  4WFN Q;  4OLO A;  1MRO B;  1RT2 B;  1BWE A;  5AT1 B;  2QLB B;  2OEJ A;  3FDS A;  4Y0F A;  4LF4 J;  1DAX A;  4P10 A;  2OEM A;  1UVM A;  4ER8 A;  1HNX F;  3OTD A;  4IFY B;  2JL9 A;  3M6X A;  4A47 A;  1Q8B A;  5F3Z A;  2B4P A;  5KFW A;  3PVX A;  2DPJ A;  1KS2 A;  3M2V A;  4K4S A;  3MEG A;  4XAK A;  2FC8 A;  2MJU A;  2H54 B;  2FUG 9;  2GAG C;  2HBR B;  3K7R A;  4ZLL A;  5KTQ A;  2CQ1 A;  1IBL J;  3C16 B;  1U48 A;  3DKD A;  3DDK A;  5CXT A;  4YS2 A;  2YTC A;  1EKR A;  4IQM A;  4X4T A;  3KK1 A;  2P5V A;  1WNE A;  4WXO A;  3SSS A;  3KLI A;  4L6V 3;  1QSL A;  3ZZY A;  3Q2T C;  4DV2 J;  2ZE2 B;  2Z58 B;  2RF2 A;  2E5J A;  4I68 A;  4P75 A;  2DXD A;  3C14 A;  1RT4 A;  3O44 A;  1UET A;  1KQK A;  5E0O A;  4DSF A;  1RTJ A;  2BR0 A;  4V19 X;  3Q22 A;  3GSD A;  2YQ3 A;  2KYZ A;  3N6L A;  1KOO A;  5CYQ A;  4CLZ A;  4LF6 F;  1S49 A;  5D8H B;  2HPU A;  5LXY A;  1X0F A;  3B78 A;  2W01 A;  5F3T A;  1V9O A;  2VB6 A;  3IRX B;  3PW5 A;  2VG6 A;  3K5N A;  2XLI A;  3H98 A;  2DT9 A;  3RAM A;  2AD9 A;  2V0N A;  3UFC X;  4KY3 A;  2FGO A;  2XY5 A;  4DG1 A;  3VGS A;  5HVH A;  4WZQ A;  2OH2 A;  1F3V A;  4K0K J;  2PFF B;  3D0H E;  4NA1 A;  1UVJ A;  1WF1 A;  4ES3 A;  2W4D A;  4JI0 F;  1N52 B;  3E8O A;  2WRM A;  3IM9 A;  1S9G A;  3NGU A;  2IVF B;  5HAN A;  4KJI A;  3JTP A;  1FEH A;  4YDD B;  4GKJ J;  4DS4 A;  3DU6 A;  4KPC A;  3LO3 A;  5E33 A;  4C6A A;  1RAD B;  3VR1 A;  1ZA2 B;  1S1V B;  2ZBC A;  2E1C A;  5SUH A;  3B8H A;  1OY8 A;  5HLF B;  1HIY A;  2IM0 A;  4HTJ A;  4RUH A;  4DEZ A;  3IWN C;  5ETO A;  3EXC X;  1MNE A;  2XMU A;  4Q45 A;  4KSE B;  1J5E F;  3Q8V A;  3SCJ E;  2Q43 A;  5KG3 A;  3D4J A;  3FCW A;  1VRU A;  1VFJ A;  1VC6 A;  1EAR A;  1JLF A;  1P6T A;  3BSC A;  2RRN A;  2W7P A;  2J9D A;  3D1Q A;  2CJB A;  2B7C B;  4DI6 A;  4K5S A;  4CLW A;  4CLY A;  1YRU A;  3NBP B;  1RTD A;  5J1E A;  5A8R A;  4E0D A;  3M7V A;  3DNC A;  4NOH A;  2GVZ A;  4Q0B A;  3NCP A;  3MTK A;  1T0T V;  1LWE A;  4F02 A;  2OLW A;  1RAB B;  3CIM A;  1IBK J;  3TAQ A;  1F5B A;  3KJV B;  3FSI A;  1UVN A;  2HEK A;  1C0T A;  2XMM A;  2VKZ G;  5GAG I;  4F3O A;  3WZ0 A;  5A2Q Y;  3I6P A;  2OTJ S;  1S59 A;  4OJ1 A;  3AH6 A;  3I56 S;  3RRG A;  3AJD A;  1HBO A;  1U0H A;  4CYU A;  1UZD A;  1N8R T;  3G82 B;  2LYV A;  3HHE A;  5E3R A;  4LIR A;  1RT1 B;  3UCG A;  4RX6 A;  4LFA F;  5JUM A;  1NJX A;  4UT4 A;  4I2Q B;  2DGX A;  2YY3 A;  2HHQ A;  2GA7 A;  4YR0 A;  3P49 B;  3HSJ A;  3AOA A;  3S01 A;  2CFX A;  3M8Q A;  2K2P A;  3UVJ A;  3H2V E;  5IFM A;  5H9F J;  1K73 T;  4ZKA A;  1U1K A;  4Y3C A;  3ZNJ 1;  5BYQ A;  3W5Y A;  3H2U B;  6FDR A;  2UUA J;  3US5 A;  2VPX B;  4FYY B;  4EZ9 A;  2BX6 A;  3OJS A;  1W25 A;  4DV2 F;  3MM5 A;  2KM8 C;  4CP5 A;  3PKM A;  5KFC A;  5HQM A;  2FHJ A;  3CCT A;  3LP2 A;  1IWA A;  4NXM J;  1H6K X;  1LK5 A;  2V94 A;  1RBL A;  5IQQ A;  4ZP7 A;  3KHG A;  3ADA C;  4IFV B;  1ICE B;  3BKT A;  2OFH X;  1CJK A;  3J80 Y;  4ZP6 A;  3CJ5 A;  1XER A;  3RB6 A;  4LFB J;  1P9Q C;  2HGL A;  7FDR A;  1HNI A;  4ZIV A;  1ZPW X;  2JX2 A;  2MKY A;  4DUZ J;  4PWD B;  3DU5 A;  1M90 T;  4MK8 A;  3SDE A;  4HYK A;  3KDN A;  1MG7 A;  2P9E A;  4J9M A;  1L3S A;  2YNI A;  2IA0 A;  4DBQ A;  2BJE A;  2RU3 A;  1O0P A;  1NRK A;  3BH7 B;  1R3N A;  4KPY A;  4C3M A;  1R8P A;  2UXD J;  1OY9 A;  1VC5 A;  2OPS A;  3CMQ A;  3FMW A;  4TLQ A;  1N6Q B;  4EU0 A;  2XMK A;  2KJV A;  5BXI A;  1FHT A;  3K17 A;  2QZ8 A;  2EBE A;  4NLD A;  3RW7 A;  3K2Y A;  2XO7 A;  5FJ4 A;  2YX7 A;  2RAQ A;  2IY5 B;  4FYD A;  2O3D A;  2YNF B;  3D6M B;  4TXS A;  3CJQ A;  2HHH F;  1P9Y A;  4KGM A;  2D3U A;  3PAC A;  5KFE A;  2ILY A;  3BBC A;  4NZ6 A;  1FRJ A;  3J7Y U;  4PG4 A;  3BGR B;  4NML A;  2H4Y B;  2YWW A;  4QWB A;  3I31 A;  4OX8 A;  1C4C A;  1WTB A;  2WBR A;  5KG0 A;  5KFJ A;  3TJ9 A;  2GW8 A;  1IVZ A;  1KP6 A;  2DIU A;  3MAA A;  5KT3 A;  3CCR S;  5IM0 B;  4FF3 A;  4D3H A;  2QYG A;  4ES2 A;  1YDL A;  2VJV A;  3HM9 A;  1UJ5 A;  4URQ U;  3AT1 B;  4ECQ A;  5IT9 U;  2DR5 A;  5E3P A;  3CJS A;  2YWG A;  3O5T B;  2EG1 A;  3CDU A;  2YNG A;  2IAJ B;  1M1K T;  4RW4 A;  3PG9 A;  3CD7 A;  1X9W A;  1SC3 B;  2HVH A;  2WVB A;  2FJA B;  2KT2 A;  3VGU A;  2BE9 B;  3MCO A;  3GIL A;  2R4F A;  5J2P B;  1LNQ A;  1RYS A;  1X31 C;  3KFW X;  3MUR P;  3THP A;  1SL1 A;  1VQ8 S;  2OPR A;  3P96 A;  3BR8 A;  1N5V A;  3R1H A;  2HLU A;  4B3S J;  2HND B;  4AD6 A;  4ICL A;  1HYS B;  1WC1 A;  5K14 B;  3GE9 A;  2VG5 A;  4B3M J;  4L76 A;  3EDQ B;  4LSL A;  2WZ1 A;  2E9T A;  3G6V A;  4HHJ A;  3FZ2 A;  3G6X A;  5HRO B;  2DY1 A;  3PRD A;  1NND A;  2VON A;  1D8Y A;  2K1R B;  4PRF A;  3B82 A;  2AEM A;  1HL6 A;  4Z7C A;  4H4M B;  2ZH1 A;  2IMO A;  1JKH A;  1QD1 A;  2WVF A;  1YQH A;  5EX3 A;  2GJF A;  1RE1 B;  3W1Y C;  1TL4 A;  2AX1 A;  2UUA F;  2DNQ A;  2MZS A;  3ZZT A;  1X7V A;  5FII A;  5HBM A;  3U1N A;  4G1Q B;  1BGX T;  3R2D J;  1SPB P;  3IXQ A;  3R5D A;  3V6K A;  3DM2 A;  3I32 A;  3POT B;  2YVS A;  2CPI A;  1RWX B;  1OSC A;  1RAE B;  5KFZ A;  2W2Q P;  4MFB B;  1CS4 B;  4WP3 A;  1KTQ A;  2HBQ B;  3PJX A;  2GIR A;  2I8E A;  2F40 A;  4ZLJ A;  4CO5 A;  1QAY A;  2XM3 A;  1VRT A;  1Q5Y A;  4NEY A;  3VTI A;  5IC6 B;  3ZTR A;  4M5K A;  1WD6 A;  2J6S A;  1CVJ A;  2ABY A;  3Q8Q B;  3G96 A;  2N7Y A;  1VJW A;  4NLQ A;  3D6T B;  4M5N A;  1ZZN A;  4EBE A;  4OI6 A;  2ACY A;  2C2M B;  4EEY A;  2JC1 A;  1F2G A;  3MPU B;  3MOJ B;  4ED5 A;  1SH2 A;  3TAN A;  2Y1I A;  3MM7 A;  3LAK A;  2OPP B;  3ET6 A;  1GX5 A;  4TQS A;  4OYB A;  3MPV A;  2JC0 A;  2NXC A;  5IWA J;  1WHW A;  5IV3 A;  1RT3 B;  1T9V A;  2GVD A;  2DBB A;  1UTA A;  2WOM A;  3L09 A;  1AA1 B;  1VGY A;  2YKM A;  3T6B A;  3MWB A;  2QSF A;  5AXL A;  1Q82 T;  4G1P A;  3ZC4 A;  3EWG A;  1X8D A;  2VPW B;  3MM8 A;  3DLK A;  3EYZ A;  3M8Y A;  2SXL A;  2BQ3 A;  2H5I B;  2DEJ A;  4C8O A;  1HLW A;  5M2P A;  3KK3 A;  4PAB A;  3I96 A;  3G8S A;  3BO3 A;  1WHY A;  5I42 A;  2UUT A;  5KFP A;  2F8E X;  2QFI A;  1AUS L;  1KLN A;  3CJ4 A;  2PT0 A;  4PYA A;  5KFT A;  3EM1 A;  3F0N A;  4C9D A;  3LF0 A;  2UV8 A;  3UO0 A;  2DNZ A;  2PEH A;  5C2C A;  2UU9 F;  4HH0 A;  5DG9 A;  2QA4 S;  1T9Y A;  2CPE A;  4KHM A;  4OX9 J;  5HMZ A;  1PIL A;  4X2B A;  3W66 A;  2D3Z A;  1RHQ B;  4KFB B;  4NI2 B;  4CWB A;  3QSI A;  1WEY A;  2HVI A;  4WFX A;  3B4D A;  2XMW A;  4QYZ J;  4PG5 A;  1YBA A;  2FY1 A;  3IMQ J;  2HWH A;  1FX2 A;  2G2O A;  4D3G A;  1XNR J;  3ZTP A;  4JYA J;  4RR5 A;  4B3S F;  3I0S B;  3IR7 B;  4C11 B;  1FRI A;  2W2N P;  3NOG A;  1Y11 A;  2Q3P A;  3P6Y C;  4OX6 A;  1IKV A;  4OHX A;  1MW7 A;  3U1L A;  3MM6 B;  4LVN P;  3HF5 A;  2I0X A;  3R7S B;  1C1B A;  1FD8 A;  3I5C A;  1IKX A;  4JI3 F;  2AKW B;  5HMX A;  2EBG A;  1RAA B;  4X4S A;  2B6A A;  3UR0 A;  2DCL A;  1K47 A;  3PW0 A;  3J7Y I;  3HHL B;  2CG8 A;  3MEC B;  5B0B A;  1WKJ A;  3FBC A;  3K5L A;  4ED4 A;  5ETK A;  2ZBQ A;  2IIH A;  1T03 A;  1MN9 A;  4I2P B;  1SCJ B;  2L48 A;  1TVR B;  3N4W A;  2XYP B;  1EET B;  1CJT A;  3CXC R;  4O0I A;  2IC3 B;  4QR2 A;  4N76 A;  4NPO A;  5D0E A;  1T9W A;  2IBK A;  3KUG A;  3IC1 A;  4AXJ A;  1V3S A;  2IJR A;  1SH3 A;  2V2K A;  2C2D A;  2LEB A;  2YKP A;  1KC8 T;  3OL9 A;  3MD1 A;  2HFO A;  2J7U A;  2XS2 A;  4CO3 A;  4QU6 A;  5J1P A;  4FP9 A;  2MZJ A;  3C15 A;  3T9Z A;  5F8J A;  3QO9 A;  2B5J A;  4LR9 A;  3TZW A;  1RGV A;  2AGO A;  4MMO A;  4GVL A;  3R3T A;  5KFN A;  1GMV A;  2AGQ A;  3ISN C;  1TTH B;  3W7B A;  3LAL A;  4OJG A;  3VAK A;  1TK8 A;  3QRR A;  2VU5 A;  2CDR B;  2I9S A;  5B7W A;  5E3C A;  1VR6 A;  5K20 B;  1Q16 B;  2Y1R I;  5KFM A;  4ECW A;  1VC0 A;  1W7W A;  5AJ3 F;  2ZVI A;  4P74 A;  2KH9 A;  3IG1 B;  1IBM F;  2QA2 A;  3HSD A;  5J2N A;  2H48 B;  2FZG B;  1NSP A;  4F2S A;  3CB4 A;  4JI5 J;  2NPI A;  1T3N A;  2VIC A;  4IDK B;  1G4C A;  3M8S A;  1EB0 A;  1SKU B;  2GHV C;  3RAQ A;  2RRA A;  4LF7 F;  2AT1 B;  2MMY A;  2EFN A;  4B9T A;  2R42 A;  3QWU A;  1RLC L;  2YPY A;  1I3O B;  5F0W A;  1RT6 B;  2NR0 A;  1RT1 A;  1YGY A;  3NRB A;  4DZ6 A;  5JVG Q;  2YNH B;  2AQ4 A;  1XNQ J;  3IBC B;  3EZ5 A;  3H0P A;  4I2Q A;  1N5Q A;  1DJ0 A;  3IBW A;  3VAF A;  3BPD A;  4J9O A;  3ENQ A;  2OI2 A;  4N8O A;  2LEP A;  4O4G B;  2AYB A;  4DCP B;  3CDW A;  3W5Z A;  5H9E K;  2DNH A;  4OHV A;  1HR0 F;  4M94 A;  2XMV A;  1Z2Z A;  3IR5 B;  1DQ9 A;  2KG0 A;  1LFP A;  1UKU A;  1JLE A;  2G1H A;  4X64 F;  4F0K A;  1LV5 A;  2Z0G A;  4TU8 A;  3ILO A;  5E2Q A;  4B08 A;  1FDD A;  1T9X A;  3ISZ A;  4J9P A;  1WG1 A;  1T8E A;  3FMB A;  1R8H A;  3D54 A;  1LXJ A;  4ITS A;  4RUB A;  2C3O A;  5DDQ C;  4Q7A A;  4Z37 A;  3I87 A;  4QPX A;  1RLD A;  5AXK A;  3TA1 A;  2A3J A;  2VDH A;  4LQ3 A;  2BEF A;  5FLX Y;  4ZPA A;  2LCW A;  1LXN A;  2AEJ A;  4CLS A;  2HFS A;  3TP2 A;  3IBF B;  1HAR A;  1HWJ A;  2X3G A;  2IYG A;  4DQI A;  2A2D A;  5KFK A;  1NZA A;  4IOA Q;  2RIJ A;  1XWL A;  4GMK A;  4TU9 A;  4XPE A;  3CCJ S;  2HNY A;  3MHY A;  2L9W A;  3LP0 B;  3K5O A;  3TQE A;  3EVW A;  2HHV A;  3R7N B;  3CMA S;  4OZ0 A;  5E7O B;  3CCE S;  5D78 A;  2Z2Z A;  1CG2 A;  4USH A;  4XPC A;  4BC7 A;  5BR8 F;  4EBD A;  1AZS A;  2WHO A;  2QRR A;  1S1W A;  3GQC A;  4RW9 B;  2YNF A;  4CTA B;  2ZH5 A;  2L41 A;  1FWL A;  2DNN A;  2VL1 A;  1FER A;  2HHT A;  1YIT S;  1VJQ A;  2CAD A;  3C19 A;  2QGF B;  1S6P A;  4DR7 J;  1FX4 A;  1FRH A;  4ZK7 M;  3BEG B;  3PIP Q;  1U7L A;  2BA9 A;  1XIQ A;  1LOU A;  5JVH Q;  3HKZ D;  2ZZM A;  3M2U B;  5BYS A;  5HJX A;  2B9Y A;  1VBZ A;  5F41 A;  2M8D B;  4ATN A;  2J0Q D;  2M8H A;  4J9K A;  4OZ3 A;  3OUY B;  5F8G A;  3BQ0 A;  1SXL A;  2GML A;  2Q66 A;  2K7K A;  4HEA 9;  2D9P A;  4LBP A;  3CDA A;  3SCI E;  4YFU A;  1KKH A;  4H4O B;  3KLV A;  3JSR A;  3IA0 A;  4WKY A;  2RT3 A;  1QSY A;  2NZC A;  1GXU A;  1FJC A;  4CLU A;  4CLF A;  2MKK A;  2ZH4 A;  1M1G A;  1R7I A;  2ASL A;  2AGP A;  1SL2 A;  2XO6 A;  3V81 A;  1DLO A;  1BWV A;  2F8H A;  2CJY B;  1LWC B;  1YK9 A;  5D15 A;  1ZTW A;  2WVC A;  2QYC A;  2MST A;  4KHP J;  3IRW P;  1XMQ J;  2Q79 A;  2HND A;  1JJ4 A;  1U49 A;  4ZOS A;  5J2M A;  4RW7 B;  5EWE A;  2JSX A;  1QE1 B;  1V3Z A;  3FJ2 A;  3NCR A;  2MKC A;  4USU A;  4JUZ A;  2DRB A;  1KLM A;  1PAU B;  4DL2 A;  2GQC A;  4JV5 F;  1D9A A; 
#chains in the Genus database with same CATH homology
 1I94 J;  5LM7 E;  4JI8 J;  4YY3 J;  2KL8 A;  5LMU J;  4RJV A;  4DUZ J;  1N36 J;  1HNW J;  4YHH J;  4LF4 J;  4B3R J;  2HHH J;  1N32 J;  4PWW A;  4NXN J;  4JI6 J;  4DV3 J;  1XNQ J;  3T1H J;  4OX9 J;  3R2C J;  4JI1 J;  4DR3 J;  3D3C J;  5IT9 U;  4V1A k;  4AQY J;  3D3B J;  4X65 J;  4DV7 J;  3W1Y C;  4LF7 J;  4JI2 J;  2UXD J;  4DV1 J;  4DR6 J;  4LFC J;  2UXC J;  5IWA J;  4LF8 J;  4NEZ A;  4KY3 A;  4KYZ A;  4JI7 J;  4HHU A;  2F4V J;  4JV5 J;  1FJG J;  4DV4 J;  2ZM6 J;  4DR1 J;  3IMQ J;  3R2D J;  4JI3 J;  2UXB J;  4DV5 J;  4LF6 J;  2UUA J;  2UU9 J;  1IBL J;  3T1Y J;  1N33 J;  4K0K J;  4X66 J;  4DV6 J;  1XNR J;  4JYA J;  5LMN J;  3J80 U;  4LFA J;  1HNX J;  2MEW A;  4LF5 J;  2VQE J;  1J5E J;  3JAM U;  2MTL A;  4DUY J;  4DR2 J;  4JI5 J;  3J81 U;  2UUB J;  1IBK J;  4DV0 J;  4LF9 J;  4NXM J;  4KHP J;  2UUC J;  1XMQ J;  4B3S J;  3J7A N;  4GKK J;  4DV2 J;  4DR5 J;  4B3M J;  4X62 J;  5A2Q U;  4GKJ J;  2KVQ E;  4JI0 J;  4DR7 J;  1N34 J;  1XMO J;  2VQF J;  2MQ8 A;  1HNZ J;  5AJ3 J;  3OTO J;  4NEY A;  1HR0 J;  5FLX U;  1IBM J;  5BR8 J;  2E5L J;  4LFB J;  4JI4 J;  4DR4 J;  4B3T J;  4X64 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...