4DV0J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv0J00
1HR0J 5IWAJ 2VQEJ 4GKKJ 5AJ3J 2E5LJ 4DV4J 4GKJJ 2UXDJ 2VQFJ 4V1Ak 5FLXU 4B3TJ 1HNXJ 2KVQE 1I94J 2UXCJ 1FJGJ 4X65J 4DR6J 4JI4J 4DR4J 4YHHJ 5LMUJ 2ZM6J 2MEWA 4X62J 1HNZJ 4JI8J 4DV6J 4X64J 4DR5J 3R2DJ 4JI0J 5LM7E 4DV3J 4DR1J 3J81U 1XMOJ 2UUAJ 4LF9J 5A2QU 4DV1J 4LFBJ 4OX9J 4JI2J 1N33J 4AQYJ 3OTOJ 5BR8J 4DUYJ 2UXBJ 3J7AN 3T1YJ 2UUBJ 5IT9U 1N34J 4LF8J 4NXMJ 4B3RJ 4PWWA 4LF4J 2UUCJ 4KY3A 4DV0J 1XMQJ 1IBMJ 4JI5J 4YY3J 4DR2J 4JYAJ 4NEYA 4JV5J 4B3MJ 4B3SJ 4RJVA 3R2CJ 2F4VJ 4NXNJ 4LFCJ 2KL8A 3W1YC 1XNQJ 1XNRJ 4K0KJ 1IBLJ 4DR3J 1IBKJ 4LF7J 4HHUA 3D3BJ 4DV7J 1N36J 4DV2J 3D3CJ 4NEZA 4KHPJ 2HHHJ 5LMNJ 3J80U 2MTLA 4DR7J 4KYZA 1J5EJ 4DUZJ 1N32J 3T1HJ 4LF5J 3IMQJ 4JI3J 4JI7J 4DV5J 2MQ8A 4X66J 1HNWJ 2UU9J 4JI6J 4LFAJ 3JAMU 4JI1J 4LF6J
chains in the Genus database with same CATH superfamily
1CS4A 4QU7A 2DO4A 2W9AA 3RAQA 1SJ1A 2QZ8A 3LWMA 1M5KC 1NPRA 3BREA 4CLYA 3J81j 4PUOA 4OZ0A 5KG6A 3DHWC 4OI0A 5DETA 1TKXA 5KFPA 3MM6B 1B0VA 5AXLA 4PQAA 2AZ3A 3IN5A 2NXJA 2KT2A 4U96A 1Q95G 1PJ7A 3M9OB 3HXMA 2J0QD 2J9DA 4ECWA 4PG8A 1TL7A 5D78A 3K5LA 2DEJA 1YG0A 4G1IA 4FKYA 1NUEA 4DSLA 1FJGF 1Z2ZA 3M8SA 4R0JA 3M8QB 1LXNA 5KFFA 1R27B 1UFWA 4DR3J 4R0EA 4YR2A 4M5KA 2WTFA 2FQQB 8ATCB 3UFCX 4M5JA 3PRVA 4NL5A 2RD5C 1TFYA 5CXTA 4I7FA 2G0CA 1OIAA 1RU2A 1NZ8A 3S6EA 3UDVA 3DRXA 3CPWR 2FD2A 2XMMA 4CO1A 3QSIA 4OZJA 2I8EA 4WFXA 2VUGA 2W9CB 2JLEA 1XN9A 3MM7B 3TZWA 1U1MA 3GCWP 4DPWA 3IP0A 1RJJA 1FRXA 2Q79A 3EGVA 1JLQA 4KFBB 3S7RA 3MURP 4EUVA 5KAKA 3I56S 2CZ9A 1HBUB 4I6WA 4WU2A 5IOLA 3OLBA 2AD9A 2AJFE 1VJWA 5ETQA 1JLGB 3TR5A 3TUPA 5D3GA 4NLSA 3HFZB 4DV6F 1HQ2A 1HBOA 2DHAA 1P8GA 4QCLA 2CFXA 4DUZJ 4RX6A 2CJXB 2B4VA 2CNNB 2GV1A 3W3SA 2CJQA 1N34F 1MROA 1WC0A 3JAMU 2KB2A 4OQJA 3WX8A 1V6HA 3BGRB 1VIOA 2P5VA 5KT3A 1CPZA 3HVTA 2R3VA 2MLYA 4NLXA 1S72S 2Z58B 3IRWP 1RUSA 2BDPA 4TY9A 5DQGA 1VI7A 1RADB 1LW0A 1C0TA 4ZCIA 2Z2YB 3DLEA 3D5MA 1RBOB 3G9CA 2EFPA 5MLCV 1O5JA 2PA3A 3C66A 3NGTA 5FDLB 3T1YJ 4F4YA 5B0FA 2KXFA 5E3PA 1BLUA 5AE3A 3ITHA 4M5DB 3HFKA 1FXRA 5F8LA 2LQ5A 3CO9A 3OUYA 5GAHI 4Y3CA 3K5NA 2HS4A 3I82A 2D41A 2HHPA 2XMAA 4U8YA 1T02A 2DGTA 3QRPA 3TA2A 1OPZA 2YWEA 2AV5A 4I2PB 2R2SA 2YNIB 4OZ5A 1U2FA 4PYAA 5JJBA 2RDDA 2OPQA 4R5PA 1Q7YT 5ETNA 2NR0A 1U0SA 1IQZA 1SH0A 2WHOA 2W2NP 3VHQA 4Y0FA 1N54B 3UN3A 1SQFA 3S1TA 2HMIB 3HO1A 3W7BA 1V5IB 3G4SS 1PC5A 2QA4G 4ZCKA 3DNCA 2V4JA 1T11A 1UW9A 3TVKA 4LFAF 1E6YA 4P73A 4BC7A 5DM6Q 5K9FA 3CJKA 4C6AA 2OPPB 2RDJA 3IC1A 2WRMA 2WVBA 1ZAXA 2ACYA 3B54A 4C2MA 4D3GA 3KJVB 3GFZA 5HP1A 4C8LA 2VBZA 1WI8A 2FLNA 1WSVA 1N36J 2I5JB 1R43A 5U47A 4OJGA 1KSPA 4UQTA 1JXEA 4ZLJA 1F9FA 1L3SA 3QO9B 4ZPWR 3T9NA 2AKWB 3BYPA 3PG9A 5ETSA 4E2FB 5IWAJ 3W66A 3NRBA 3TNVA 1XMQF 3V4IB 4M5MA 2OUGA 2GIQA 2NLWA 2QTWA 5KT4A 4NLWA 1CEZA 3HVWA 3PIOQ 1NK0A 2WONB 1EETA 2CKWA 2V8DA 1M1KT 5HVGA 1KOHA 1N0VC 3BF4A 3KHHA 1TFWA 4P72A 3EZOA 2RNEA 1NNDA 1VBKA 1B70B 4KGVB 1KNZA 4QW8A 5KT5A 3MM5A 4RBUA 2HVHA 3CCVS 3C6UB 1HR0F 1F3FA 3ADAC 4U95A 2RJZA 3CCJS 2PEHA 5CHCB 4DFMA 1S6PA 4NEYA 5D0RA 3CW2C 3A3OB 4F3MA 2JOQA 3CCSS 1RHUB 5CQGA 3TOQA 1X4EA 2OD4A 4DV3F 1Y9OA 1AXQA 5HBMB 2K06A 4LSLA 5DLGA 3DU6A 4GC6A 1B7FA 2XWXA 4TLQA 1R0BG 4IKAA 1Y10A 4BS2A 4ZVEA 5KT7A 1G6BA 4DV0F 1VISA 2Y9HA 1PG5B 2OP5A 4Z37A 4NRTA 4E98A 1AUDA 2RILA 1KQFB 3JQKA 4ZPCA 4U67Q 1AFJA 2ZE2A 4ECXA 1TL1A 1OSDA 2OPRB 1MMNA 1JLBA 5HROB 4QJVA 1FVQA 2GO8A 1VQ8S 2DR5A 4LF8J 4RL1A 1XK8A 5AXNA 4IH6A 4MKBA 4OYAA 2VQFF 4USHA 4F3QA 1R8CA 1KDNA 4M5IA 3PW4A 2CQPA 1N6QB 2HWHA 5EWEA 2UVWA 1C1BA 1KVJA 3RAMA 2L9WA 2HRTA 3DI6B 1SIWB 4K4TA 4IOCQ 4LBPA 6FDRA 1S6QB 4NI2B 2DTJA 4R8UB 4U7UD 2WBMA 3KWMA 2J8AA 2D3ZA 1R8BA 4H4MA 2XMTA 4L6V3 5LT5A 4ECYA 3GMGA 4YDDB 2ILYA 1N56A 2MXYA 5EHHA 4GKJJ 1S7IA 2AHOB 2EI5A 4TQRA 3BO4A 1FTRA 4M1KA 2JNJA 2UXBF 2HHVA 3W5XA 2YNGA 3CE8A 4DV7F 4NRUA 1YZ7A 4FDFA 2LXFA 1OPIA 2J6SA 1CLFA 2C3UA 5B0DA 4CLLA 4F4WA 3H5UA 1HPZA 2YQ3A 1VQ6S 4N41A 2H4YB 2U2FA 4AL7A 2CPDA 2M8DB 3F44A 5C5JA 4P9SA 3UDEA 3AA9A 2KJWA 2XBPA 3MMAA 3B4MA 2EK1A 2LEAA 2H51B 3JQMA 2RQMA 1OSCA 2DVIA 1TELA 2R7QA 3PX0A 1VOMA 1EKRA 1YLXA 1VQPS 2AW0A 1AZSA 2PIIA 2KFZA 1SUQB 2KYXA 2XCAA 4ANEA 2YTCA 5M2RA 4OI4A 3WX4A 2CA9A 3C15A 1F5CA 4NCGA 4OYOA 1UVIA 1FE0A 4HR2A 4LRBA 2HBQB 2AX0A 2FUG9 5HK4A 1QD1A 2N3OA 5DGBA 1HA1A 3W65A 3CMQA 2R7WA 1N8RT 5F0UA 1BY9A 3I32A 1ZM2A 2XNQA 1DZ5A 4KQZA 2ZH7A 3PNIA 1XMOJ 2UUAJ 2FJVA 1NK8A 5DG7A 2W1BA 1WHWA 3NCPA 2BE2A 4IDKB 4IH5A 3L09A 4K7QA 4IG0B 3T41A 4WP9A 2NXCA 3Q22A 3Q2SC 3KLVA 4FXWA 2FZKB 1FWLA 3KG4A 2XLKA 1NK6A 4Y28C 1PIEA 3VR1A 5CD4A 5HQMA 3SQGA 1HMVB 3DRRB 2HHUA 2EKYA 4ED8A 5A8WB 5KFZA 4YHHF 3KK3B 2DR6A 4X64F 4O0NA 5IT4A 3BSCA 2JLGA 3DRSA 2K7KA 5I3UB 3W60A 4KHPJ 4K4ZA 3E51A 1YJ7A 1DLOA 2ZH5A 2QLXA 5AT1B 4PXCA 2VG5B 2MZQA 1S79A 3DHXA 2PC6A 1WORA 2GFFA 1NDLA 4C8NA 1UVLA 2GVZB 4I2QB 1WTFA 4NWBA 2DH8A 1YJWS 3MM7A 5K14B 1VQLS 1N88A 4G1PA 1IKVB 1S1UB 3CJ2A 5DRKA 4DSJA 4C0OC 1HD1A 3QAEA 4GRSA 1JLFA 2UUTA 1S49A 4IRDA 3LA0A 3OW2R 3SDEA 2K3KA 4HKQA 1OY8A 1RAJA 1XC9A 1U1RA 4DI6A 3OL8A 1ZOTA 1S6OA 3NBPB 2PMWA 3MR7A 3KLGA 2PFDA 2H3EB 3H2UB 4W98A 5JMNA 1FRMA 4WU3A 1YVFA 2JZ5A 4FXDA 5E5NA 3HZGA 2CPFA 2RKIA 4DMZA 4FF3A 3JYTA 5IS2A 3NWGA 2WK4A 1HWLA 2MJNA 5E3RA 3MPYA 4NOHA 3KUHA 3TAQA 4ELTA 1WEXA 1BWVA 2M5YA 2LKZA 4PABA 4CLZA 3AFGA 3KLEB 1N5QA 4KR0B 5FDLA 2DNHA 1UJ4A 3O44A 4Q0BB 2J8SA 2L41A 4G65A 1HHTP 2R8KA 1SH3A 2Z0GA 4A8QA 1SL2A 1BQNB 2MQMA 4ED0A 4G3IA 3I31A 2R2UA 5A2QY 3ILOA 5ETKA 4QIGA 1EAYC 3N6LA 4I2PA 1RU1A 2MKYA 3W9IA 2YNIA 3OHAA 1C0UA 3C19A 4WXOA 2HHQA 3BSAA 5JXSA 5L1JA 2QMUB 2BV3A 1LXJA 1R8HA 4JI8F 3P3DA 2PI5A 2CG4A 1KTQA 2LCWA 1TQLA 5KFCA 3Q0AA 3PJXA 3QLHB 2V4RA 2XMUA 1Q82T 7AT1B 5L1KA 4O0IA 3M30A 5HQ8A 3GJSB 1UJ5A 4X66J 1RZMA 3KLIA 2HK3A 3H40A 2I1RA 3MEGB 4DFJA 3RBZA 4IO9Q 1U4BA 4DL6A 2QMWA 2X1GA 4DJBA 4DSIA 2CQ3A 1DQ9A 2NUUG 1HNXJ 5CABA 3UQSA 1S99A 1FXLA 4QYRA 2HVEA 3IA0A 2DY1A 3ULHA 1IVZA 1XTZA 5KFDA 2FVQA 3KJVA 3MAAB 1MSWD 1QE1B 4Y00A 2C2EA 1HBMB 4DF4A 2HS0A 3PYEA 3LP0A 5KFIA 4RUHA 2AWZA 3KDNA 1RT6B 3BYRA 1ZA1B 1Q86T 4CCHA 1G2EA 1I94F 1XERA 3MMBA 4RU9A 1WEZA 5B0EA 5DDRC 3HD1A 4YMEA 1NMEB 4KT0C 3W8GA 1F6TA 2P6SA 3R27A 3V2UC 3UE2A 4ITSA 4IG3A 2DNPA 3FCWA 1YZ6A 2HSEB 1FHTA 2JWNA 2PDAA 2XZTB 1FF2A 4DXLA 2OAUA 1FK9A 1C1CB 2AX1A 5HLFB 5LSOA 5IQQA 2ZFHA 1DQAA 3IAM9 2OLWA 1RT3A 2L3MA 2HPUA 1W2IA 2IJNA 1XQIA 1A7GE 4LJMA 4JI2F 4ANDA 2IFXA 5GADI 2DITA 4OYWA 4MKVA 1HWIA 5KG3A 3R97A 3FMBA 1ZM3A 4OYMA 1BC6A 4ZVPB 3RBDA 1IM6A 1IUJA 1S1VA 2APOA 4DCPB 1SVDA 3C2PA 2LYVA 4EZ9A 4MYTA 1JX4A 2HNZA 1XR5A 2Z57B 1RT7A 3HPOA 2GAGC 1AA1B 1ULRA 3OR1A 2OD6A 3GFHA 4IR9A 4P6QA 2OEKA 2ATCB 3TJ8A 2EBGA 2XS7A 1Z2LA 4PEOA 5GAGU 2A18A 2B8QA 4LSNA 3AY0A 3QT6A 4CZCA 2UU9J 3MM8A 1NSKL 2H54B 4RUAA 2O1PA 1HLWA 3OJUA 5G4DA 2K2PA 2UZAA 4CM0A 3P5BP 3GIIA 1UKUA 2JFDA 2WOMB 3K58A 4JV5F 3DLHA 1TUGB 3RU0A 4OZ2A 3OTEA 2HW3A 3R1HA 3Q8VA 3K0JA 5D4LA 1T7PA 3MAQA 3V6DB 1MLAA 1REGX 4LFBJ 2RIJA 4OLOA 4AL6A 5BR8J 2OEMA 2B9EA 4AL5A 1FDDA 1U1PA 1HNVB 3DRYA 4WK1A 2YKNB 4DQPA 2EFQA 4B3RJ 4GMKA 3FQKA 5ETRA 3MEEB 2HKEA 1EP4A 1Y3KA 4RUCA 5KOXA 4RJVA 3QRRA 2VBYA 2YBVA 4JI4F 2ZM6F 1DARA 4NYPA 2KT5A 3D67A 5H9EK 5LMNJ 4DV1F 2ALYB 1TZ0A 1WELA 3PW2A 1W2BR 4ECUA 1WKJA 1M5PC 4HEA9 4ENOA 3T9ZA 4TN2A 3QT8A 1IBMF 3X1LB 3J7ZT 2HQDA 3GYNA 2IM2A 2HVZA 3WIVA 3EVWA 4NMLA 4NLTA 3TEHB 2E5IA 4IRKA 3MUTP 2HLUA 4ZIVA 2GMHA 2XHCA 3NAHA 3T5KA 4RW7B 5EWGA 2W4DA 4HACA 3IM9A 4ID8A 3PY8A 4JUZA 2VBXA 1LW2B 1YRUA 1SUQA 2SXLA 2N3LA 2IVMA 1FCAA 1KHWA 1JJ2R 2HGMA 1SBRA 4KV8B 1TV6A 1URRA 1APSA 4LRDA 1FDAA 1FO1A 4NX9A 2YNHA 1T3NA 4ES3A 5DG8A 5B0AA 1KWMA 1JMTA 1WOPA 3T1AA 1SJRA 2BOPA 1FKPA 3JSMA 3VCDA 3L3CA 2DGSA 5A76A 1RTIB 3QBCA 4QR1A 4NPOA 4GVBA 4X65J 2ALZA 3MR6A 1QVFR 4ECSA 1NB7A 4OFZA 2ZZMA 2BUNA 3E2EA 1PAUB 1GMVA 3H4BA 1D3WA 5KFWA 4F25A 1RT5A 1KONA 1HWKA 3HX9A 3IS9A 2EK6A 4C8KA 2FYXA 5DM7Q 2B4OA 4N77A 4C8ZA 1YX2A 4HYKA 2HFSA 5HMXA 5LXYA 1M5OC 2VICA 1TU0B 1KLMB 4FP9A 4DSEA 3ZZPA 5D6GA 4I0WA 4ID5B 1S1XB 3POTA 1VLOA 4UOHA 3QQCD 9ATCB 1S1UA 3PX4A 4LF7J 2XMKA 1Q0NA 2Y1RI 2FY1A 2HURA 3B82A 1Y0HA 1QAIA 1U09A 2KVIA 4N47A 4JI7J 2VONA 1X9MA 2G2ZA 2Z56B 2R7VA 1YGYA 4CH1A 3UCZP 1GT8A 5A6PA 4C9DA 1L3TA 1IXKA 4A8XA 1Y11A 3OL7A 4O23A 2VASA 1U02A 4L76A 3D0GE 2UXCJ 3UD3P 5HO4A 4X4NA 3TRGA 4MKAA 2MEWA 2R7RA 1SV5B 1CULA 3PX6A 1TKTA 4AXIA 2HWTA 4P2SA 4KGXB 3ZNUA 3R6GB 2QJ3A 3LALA 5CH7B 5DLFA 1UPPA 4O44B 5LJ5Y 2GAHC 3AJDA 1U7LA 3A8KA 4OZNA 3CCUS 1HBNA 3W64A 2UXDF 4KIAA 2L48A 3US5A 3KG0A 2VJUA 2I38A 2HNYA 3P5TL 2BQ3A 2J9EA 3ZO7A 4C8MA 2GNKA 5A8KB 4TYAA 2R7TA 3NKYA 3ENQA 1M5HA 2YQ1A 3O2IA 4C11A 2C28A 2OFGX 3R3TA 3BB5A 5A0YA 3G86A 4DL3A 3AXMA 5D15A 4OHWA 4DX8H 2CPYA 1DAXA 2Y8WA 3HJFA 1TVRB 4MFBB 2JC1A 3M2RB 4CLKA 2C2MB 2JRSA 2F8EX 2ZH9A 4X62J 3PJ9A 2FLOA 4P2FA 4TLRA 4PXEA 1O51A 2V2VA 4KHMA 5CYQB 4JI3F 4ZP8A 1R0CB 5HSPA 1YWXA 2W8LA 1H3DA 1ITPA 4QPTA 2CJYB 2XMJA 3O5TB 4DV4F 5I42B 1YRTA 1KVKA 1K0TA 1Z1ZA 2QMXA 4K4WA 1N5SA 4R25A 1YBAA 4KPYA 4MJKA 1UZHA 2RF2B 2YKAA 4ZLNA 1ZTWA 1CQNA 4CI0B 4XO0A 1QUPA 5ETOA 3BSOA 3VV2B 4X4VA 2K1RB 1FNXH 1EQ0A 4F0MA 2N7CA 3Q8PB 1ZETA 2QC3A 1KHVA 2UVUA 4RLEA 4CLSA 1C4CA 1QY7A 5F8IA 3I6PA 5FLXU 1RT2A 1DQ8A 1NBEB 5G0RA 4J9MA 4J9UE 1RWVB 1D1UA 3C14B 5IV4A 4TQSA 1KFDA 3DC2A 1OJ4A 3CJ0A 4J7CA 1ZTTA 3CTRA 2DGQA 4CLWA 3UN5A 2GQQA 2VD3A 4KGZB 1ZPVA 3FBEA 3MECB 3THTA 3Q86A 1PYTA 1MMDA 2V2KA 4WYWA 3V6HA 4H4KA 3OVAA 1BUXA 4B17A 5LSRA 2KXNB 1HHQA 2KI2A 2LQ8A 2EEYA 3L95X 4BWJA 2DXDA 5DO2A 4DL0C 3GPAA 2B9WA 3JSYA 2HNDB 3RB3A 2DJWA 2BM0A 1WD6A 5CYMB 1S9GB 4MAKA 4RU2A 3D6TB 1N32J 2KTQA 5I3PA 2Q6CA 4UOCA 3TQ1A 4N7TA 3QRQA 1L3UA 4USUA 1HNWJ 2W2QP 2XM3A 1X4HA 2LA6A 5B0CA 4LF4F 4W90B 3H7HB 4TVAB 2PFFB 1RT4A 1MMLA 1GMWA 2VU5A 3LOUA 1JJ4A 1HNIA 1RP5A 3WDOA 2W4PA 4RBVA 3R2DJ 3DOLB 4CLFA 4A8WA 5DQHA 3QWUA 3FRYA 2XCPA 1LWFB 2GMLA 1CJVB 4A8FA 4PWDB 4WFZA 5L9NA 1FRLA 3PZPA 2CNLB 2DHHA 3DLBA 2GA7A 3A8JA 2AJ4A 3E8OA 2G1DA 3GV7B 3AOBA 4G1QA 1L3KA 4MIWA 1AT1B 2FZCB 3IBCB 3MPUB 3M32A 1SJFA 1V3RA 4PXBA 2FGCA 5IT9Y 4B3MJ 2K8GA 3MM9A 3Q8RB 5IM0A 1MU2A 1HNZF 2IM0A 1EB0A 2BJ9A 2O67A 2FHJD 4RO0A 3J80U 2GX8A 5B09A 1LWCB 2WVDA 4C3LA 3I0RA 1J5OA 1T0TV 4U8VA 3MUMP 2LDYA 4PPDA 4RW9A 2KH9A 2WW8A 2R7XA 1JKHA 3IBWA 4DL2A 3DLKB 2RHQB 3ICLA 3MMCB 4CO0A 2XTJP 4PPZA 4F36A 1KD1T 1GX5A 3KMSA 3FZBA 1EHWA 1RWNB 1U6ZA 4J90A 3MOJB 3LANA 1Q8IA 5JUMA 2VA2A 4K4YA 2KU7A 2ZHBA 2V9WA 1HQUB 1K1QA 2FJXA 3J7AN 3UVJA 4FPIA 2XNRA 2DNZA 1WC4A 3UNGC 2XMVA 3VZHA 3GYXB 3LP1B 4WIQA 2F8MA 3BS9A 5GMDA 4YY3J 4CO5A 1S1TA 1SCJB 5D8HB 1X5TA 5KFJA 3IRXA 4ZKAA 4DG1A 2VKRA 3MUVP 3RYLA 3F41A 2BMBA 2MZSA 2IRYA 2HHHJ 1B99A 3NNCA 1Q8LA 3TZZA 4IQMA 3HMJG 6FD1A 2W7OA 4QWEA 4ED3A 2GGPB 2RUGA 4YB5A 2M70A 4O4GB 4OYZA 1PJ6A 2GQ2A 1H72C 2XI2A 3D54A 3VAFA 1DHMA 4LF5F 1URNA 3BDPA 4OMFG 2ILZA 4M94A 1CJKA 3J81Y 4NA3A 1VRQC 1UZDA 2EVZA 3MD1A 5DQIA 4HI1A 1VDHA 2KHDA 2BACA 4MK8A 1PYSB 3FVYA 1U6FA 1X5PA 2MZ1A 3FSIA 3M8RA 2CXEA 2M88A 1ZS6A 2Q66A 2W9BA 1J5EJ 3W5ZA 3D6MB 1RE1B 2GZOA 4K59A 2GIFA 2JVOA 2HIQA 3QZ8A 5L8RC 2UUWA 2F63A 3NMAA 4I1TA 3OBIA 2VG7B 2RMLA 2E9ZA 1VHFA 2BJDA 4WFBQ 4KKOB 2ZOMA 3KK1B 3PRBA 3MTJA 2ASDA 2LQ9A 5IQ6A 1RAHB 5C24A 4WFYA 1YJRA 3M2UA 1IKYB 5AXMA 2IC3B 4QQBA 3LUYA 2P2CB 1O8BA 2CPJA 4FNIA 4Q44A 2ZC3A 1F3VA 2V8HA 3ZZZA 2C2ZB 3LGNA 3W2VB 3DYAB 4X2BA 1D9FA 1TP7A 1YIJS 4YN3B 2HQFA 3DN9A 1WF1A 3WBZA 2JEGA 2WAQD 2VV5A 4ICLB 3EVMA 3W62A 2RRNA 2AYBA 1S4FA 1NH8A 2BBEA 5THWA 1G3OA 4OI3A 3M6XA 3TUZC 4C0BA 3DLGA 4XTTA 2WB1D 2BANA 2QLJB 4V1Ak 2HRUA 4B3TJ 1O6XA 2DGXA 2CWXA 1O0PA 1XWLA 2C2OB 4F02A 3GIJA 3ZZTA 4JB8B 3HSGA 5IT0A 3DRPB 1DURA 1RT1B 4DPOA 3DOMA 1TUWA 1UFLA 4B9SA 5HJYA 5F8MA 2A6MA 2B56A 2E29A 1VK8A 3HD2A 2JLFA 1S97A 1FKAF 4LVNP 2YPYA 1LFWA 4ELUA 1P9QC 8RUCA 3K5OA 4WPAA 3E01B 3GR0A 3DXBA 3GIMA 5KFXA 2NCKL 2NSBA 1LFPA 3MEKA 4KB7A 2ZD1A 3OHBA 2L9NA 3OXGA 2DRDA 3KLFA 1KQSR 1QSSA 4FS2A 3VWSA 1FT8A 1HL6A 2CZ4A 1YJVA 5J2PB 1DY3A 5HJXA 1N5TA 2KFYA 5D0EA 4JYAF 2PT0A 4LRFA 3OR2A 1W25A 5KFRA 4BCAA 5D77A 1XNQF 3LGMA 1TAUA 4CP5A 2IHR1 4P74A 2Z4PA 2YNFB 3EM1A 3GYGA 1OQ3A 3GB0A 1U0HA 4C98A 5H9FJ 2ZDPA 2DB1A 2AJ1A 4PZVA 1EIYB 5GAGI 2IDLA 3ILLA 5EDWA 4RW4A 3V81B 1K9MT 4LF6F 4ED4A 2R2RA 2XS5A 3LTOA 1MN7A 1DRZA 2ZBPA 3HHDA 1QUVA 3M1VA 5DJBA 5E0OA 1DTTA 4CLPA 2OEJA 1WHYA 3CDEA 1I6JA 1T9WA 1FFWB 4OI1A 4DU7A 2UP1A 4QIEA 1GTEA 3M8PB 4U9RA 2B6AA 3KLHB 4DS4A 3AQPA 4ZPAA 4NLGA 1Y7PA 1ACMB 4A47A 1N33F 2YKMB 4RNOA 2AGOA 1LV5A 3VZIA 2VFVA 4MT1A 4QW9A 1HQEB 5CA5A 2RVJA 1JLAB 2VODA 1CC8A 5LXRA 1CC7A 3BPSP 1CJUA 4NLUA 3ZZUA 2FLLA 1UCNA 5C42A 4W4MA 3VGVA 4LR9A 3HZEA 1WKKA 4B9LA 2IPOB 4UF4A 1RTDA 2BKOA 1WF0A 2VPXB 2O66A 2O3DA 3CDUA 4CWBA 1AB8A 1FERA 4F67A 3OTCA 1NB2A 4L75A 2K7JA 2OTJS 4X4TA 2XZDB 4L72B 5CYMA 1SB6A 5B0GA 1RI7A 1X4AA 3MMJA 2FJBB 2E66A 4DZ6A 2Z30B 1R0AB 2VC1A 4O3OA 3SEOA 2BX6A 1YK9A 4WIIA 2JH3A 3HSDA 1HFEL 4ZCMA 1HYSB 1BQXA 4KYZA 2XYPB 2HZVA 2F5GA 2D9OA 4EEYA 2BABA 3CJRA 2RAQA 5A6WA 2VG6B 3GLJA 3U1LA 3G2XA 3DOLA 2G0JA 2IMOA 3CEDA 3SI8A 1RWPB 4J9NA 3EDQB 5J2QA 2E9TA 1GX6A 2IAJA 5L1LA 1FJGJ 2HAFA 2FTRA 3DMJA 3NS7B 1QAJA 7FD1A 1FEEA 4DV2F 2GIRA 3CCWA 3M8ZA 1RXOB 2F1FA 4JBCA 4WFNQ 1FJ7A 4EYHB 1VQ4S 2AZ1A 1U6BA 5A8RA 4CLTA 4IFVB 1FXDA 3BV8A 1QM9A 2N7YA 1IN0A 2FVPA 5LMNF 4DN9A 4RNHA 2DNNA 2FB0A 7FDRA 4D3HA 3C6TA 1PSDA 1RLCL 2W4CA 5BYRA 2OHDA 1RAOA 3H98A 3ETOA 1FKOA 2BJ3A 3MOZA 2CG8A 3BGUA 1JB0C 1F60B 5HAOA 2ZH2A 2NYIA 4DHVA 2ROEA 2UUBF 3OFFA 2J7WA 3CCLS 3V6KA 4QIFA 2Y0BB 2YWFA 5ETVA 3RZAA 4ZHRA 2KVQE 1PAEX 5J2MA 3OXFA 1T3OA 1T8EA 4DV6J 2D9PA 3L9ZA 4O3QA 3AD8C 4EGLA 3MEDB 4DR7F 4K5SA 3PFOA 2ZEJA 1N5YA 1FRKA 3R5JB 3MPWA 2EC2A 4DPXA 1N34J 3K57A 1S1WA 2XY5A 3P6YC 2AP6A 3U1MA 5AJ3F 4DFPA 2C42A 4RW6B 2RRBA 2DYAA 5EGYA 1VCTA 3DGPB 2FY8A 3H0PA 3ENAA 3P45B 5E33A 1HI1A 2QFIA 3BKUA 3G8TA 2BRKA 3NOGA 1UVMA 2Z2LA 2GVDB 4JV1A 2UV8G 3I0SB 1IWGA 2ATLA 3RGIA 1VK3A 4QWDA 1T05B 2XI3A 4X65F 2CPIA 2F4FA 4WWSA 2RU3A 1Y3JA 3I9ZA 4KO0B 1S0MA 2RS2A 2V69A 3FZ2A 2AF6A 3V5RA 2MQNA 2VPZB 3D1OA 4QR0A 3OLAA 2N4DA 2RE1A 4NXNF 3F0NA 2NZCA 2DK2A 1IBKF 4DCJB 3I87A 3AB4B 3TYTA 3QZ7A 1RHRB 5D0GA 4L3NA 5HATA 3VAKA 4DV5F 3OFEA 3KDOA 3MHYA 2B5JB 5F3TA 1S0OA 3BR8A 1FTCA 1FVSA 2VFUA 4DUTA 2W01A 2AJQA 3GWCA 3FCVA 4OYIA 4KRWA 2GQCA 2HQIA 2HBYB 4CO3A 4PCQA 3MPVA 2BE9B 3QIPA 1Y4ZB 3PO5A 1X4DA 2B0GA 3NGUA 4RUBA 1Q4RA 1RTJA 4ZJOA 2LA4A 4ZP6A 1KQGB 1VC0A 4DUYF 4QYZK 4MIBA 1D9DA 4BLGA 3Q8QB 4NYZA 2WCXA 1A6LA 4CYUB 3DOKB 2GO9A 2MHNA 4LFAJ 4MIAA 1V9OA 4PKDB 4NXMF 1CJTB 2NPIA 1VC6A 1UWAA 2BKNA 2FJDB 1JJCB 4IH7A 4O4RA 3DM2A 4K50A 4UOGA 2VDIA 4DLEA 4JOUA 4K4XA 3KG1A 1UPMB 4IQXA 4DR6J 3ZNJ1 3PACA 4CTAB 4ZVHA 3CC4S 4KBIA 4C48A 1T03B 2J76E 1REVB 3K8VA 1RCOB 5LL6d 3BO3A 1SKRA 2AIRB 1BQMA 1U24A 3TX0A 4CO4A 3H90A 3N9UC 3ZTQA 1WC6A 3MD3A 3BBCA 2MKSA 3FEZA 4HL9A 1NK5A 2DHXA 1XMQJ 3H5SA 4DX6A 3UI3A 1YQHA 2QT7A 3M05A 5J1EA 1XNRJ 1D8ZA 4RKUC 1VRUB 1CSJA 2DNYA 1GNKA 1X60A 4TY8B 5E7OB 1IR2A 2NREA 3FDSA 4N56A 3MGJA 3CJ8A 3HSZA 4ZLLA 4YUDA 1LWEB 1TKZB 3PW7A 2P6TA 1RGVA 1HR0J 2XHWA 1T9VA 1JLCB 3ZZRA 4F04B 4OJHA 4NCBA 2DNKA 1H98A 3U02A 4EBDA 1RWUA 2NSCA 3G82A 4WYLA 1U1KA 3AD9C 3NOCA 3G6ES 5DDPC 4DV3J 4HH0A 2XG8A 4Q8FA 3RAXA 2XSJB 3FGVA 4WE1B 1K47A 1BXNA 3CMES 4GO5X 2G9OA 2LQJA 3D9BA 1H74A 3ETMA 4CLUA 1B3TA 3M7VA 1VRTB 4EI2A 5F3ZA 4UUXA 2ZBRA 4DV0J 3CGIA 4OJ3A 5F0WA 2MGZB 2IVFB 5L39A 3PHEA 4OV6A 5C25B 4C3KA 5J2PA 1XBWA 3W9JA 4EWTA 4IFYB 2RB7A 1RTHA 2F40A 3IR6B 2GHPA 4DL4A 3QAUA 3QMQA 1E6VA 1YHQS 3QT7A 3TAMA 2NZ4A 3F56A 3QT5A 3HHEA 4J9VA 5J2NA 3UD4P 1JXVA 2W7AA 2ZBQA 4B3OB 2HHWA 2VQFJ 1JLEB 2CJAA 1H73A 3FFIB 1X4FA 2PD1A 2LU1A 2ADCA 1RA7A 5T41A 1IKXA 1UWBA 4HVZA 1V5VA 4IUFA 2E1RA 2QA1A 2KM8C 3IM8A 3IO1A 3N5BA 5CZVA 2KZMA 1MW7A 1R31A 1X7VA 4WP8A 3IGVA 3NGDA 1NDCA 4JP8A 1R8AA 2HS3A 4WZMA 3AXKA 3UCGA 4KC5A 2J0WA 3ZZYA 2ZZNA 1NLKL 1BWEA 2AQ4A 2KG1A 1CG2A 2CIMA 2I6WA 2B7BB 1CS4B 4XPEA 4UZBA 2XYGB 4JI5J 1TTHB 4B9UA 4ZN3A 3EJMA 2R8IA 2HYIB 1WDTA 1Z4UA 2CYYA 3A4TA 3LAMA 5LMUF 3W61A 4USIA 2YXLA 3K8WA 3VF0B 4WK3A 4DV7J 4PUOB 1UETA 1NO8A 3VAMA 3HM9A 1TKXB 2KT3A 1NJIT 1S57A 4ZMMA 2QN6B 4LBIA 2ASYA 3AB2B 4QWAA 2BM1A 2X1AA 2MLZA 1TL7B 2YH0A 4DSFA 2F4VF 1F2GA 2U1AA 2V8PA 3B78A 4KH1B 2Z2MA 2ZDOA 3DXSX 5A2QU 4H4OA 3HDSA 1WI6A 1EX8A 3R5DA 2COLA 4B08A 4M8LA 3D0IE 4I7FB 3CIZA 4CQ1A 1KBRA 4QWCA 1NH7A 5KFMA 2XGQA 4P71A 3Q24A 4DQIA 5BJRA 1HW8A 2R2TA 3ENWA 3OTOF 3HHLA 4PQUA 1JLQB 5L46A 4DQRA 3HT3A 1VLYA 3D68A 3CD6S 5HQLA 4ZJLA 4XPCA 1LK5A 4U7UK 3KUGA 4B3SF 4CT9A 5KT6A 3E3XA 4YHHJ 2KRBA 4X64J 4UY85 5D3GB 1TR0A 2VPYB 2VHGA 3IWNC 1HBOB 2FJWA 3NMRA 2XB2D 3SCIE 3CJTA 2R7SA 2DT9A 1G4CA 2LFVA 3FCHA 1FWKA 1PCAA 4N8OA 1NZAA 4LT6A 1MROB 3TA0A 3GQCA 3HVAA 2J7UA 4DU8A 2R42A 2ACMA 5HN0A 3CB4A 2X7IA 4ZA1A 3HVTB 3CXCR 4PAAA 4OYBA 4JI0F 1S48A 1VQNS 5KFNA 2RQKA 5C2CA 3MFHA 1LW0B 1C0TB 4L73A 3DLEB 2EFOA 4JV0A 2P8IA 2FHMA 2YWWA 2XO6A 1GXUA 2BA9A 2YQ0A 1S10A 3C16A 4ZVGA 1NCLA 1OYEA 1KTVA 2MPUA 4P7VA 3N79A 3FSXA 3D66A 3HCXA 3DCAA 4F4AA 3D2WA 3K17A 2OPSA 4UZCA 1RWXB 3ITHB 3OTDA 3J7YU 4DR2F 3W9HA 3V4MA 3JTNA 2DNOA 4LR7A 3OUYB 4LFCF 3LPYA 2DRBA 3IG1B 2FLPA 2RUSA 2KM8B 3GV8B 4HTIA 2V2QA 1IBLF 4F50A 3CJ4A 2E5JA 1NJXA 2CNOB 1PO6A 1VIXA 1K1SA 3SSSA 2B9XA 5HANA 1LQ9A 2Y3YA 3N6NA 4O3NA 2OPQB 1GEHA 1J5EF 4R5PB 5HVFA 1BD6A 3LP2B 1IKWB 1H2VZ 2B4UA 3PVXA 4DR4F 2W2OP 2W2MP 4M5HA 4DR5F 4QBUA 1NK7A 3FBBA 3MM6A 4Q2MA 2YKOA 1YRXA 3UO0A 2M8HA 1S12A 4ECRA 1VQSA 2A3JA 4LUBA 2DD8S 4DQSA 2CQGA 3S01A 2V4JB 1DBDA 2MQ8A 3UR3C 2KXHA 3CWJA 1VHIA 3PCOB 3MCSA 2DNMA 2UUCF 1E6YB 2ZNYA 4C8OA 4C4WA 3CJKB 1DTQB 4FF4A 2FHJA 4LRAA 1PGZA 3EGZA 3M8QA 1JWWA 5HP1B 4JI8J 1RBLA 2AGQA 1WG1A 3DU5A 3RBXA 5KG2A 2JEIA 3AQOA 4K4UA 2AU0A 2YKPA 3UDCA 3D1HA 2POKA 5HI7A 4V19J 3Q89A 2E5LF 2J6UA 4JV2A 2UV8A 2PMHA 3N0VA 5D4NA 1DFDA 2MZRA 1BGXT 3QATA 2W9CA 4RPFA 3R1LA 2O5DA 1EETB 4TXSA 3FK4A 1TL4A 2FJAB 4LF9F 2ZWOA 3PKMA 4OV1A 4OJ1A 4ILLA 1FEHA 5KFSA 4KFBA 4TU7A 4RW8B 2C3PA 1RLDA 1W26A 1B4SA 1HBUA 3MM5B 1AFIA 3CMAS 2KJVA 4TU9A 3VAHA 1PJ5A 3BH6B 5F9NA 4PR6A 2CPXA 1I94J 1JLGA 3T5JA 3CF5Q 3CNQP 1WOSA 1PKUA 4FF2A 3OVSA 1YJTA 2M4MA 4FN5A 1TK8A 3PYGA 2A2CA 2OELA 3MF5A 3GIKA 3ISND 3EXCX 3MDFA 2Y1JA 1Q7LB 1ZM9A 1RABB 2XSFA 4K2JA 2DNLA 4LSLB 3GSDA 3A3PB 3DDIA 2Q3PA 2PA8D 1WJ9A 3OFHA 1WEYA 1MN9A 3H59A 4EK2A 4U6PA 3BGRA 2B3TB 1SIZA 3PIPQ 4OHZA 1VQ7S 5BYQA 2V2ZA 3PJWA 2LQBA 3EYZA 3JSBA 2KL8A 3BBBA 3AODA 1S6UA 3L7OA 3THVA 1LK7A 1QSLA 2ROGA 1UVJA 1WHXA 3GE9A 4ETXA 4LREA 2ZE2B 2JSXA 2QX0A 1TL1B 2OJ3A 4KJIA 2VH7A 1X5SA 1JLBB 4M5DA 1RACB 1Y5IB 1VS3A 4J9PA 1RCXB 5ETTA 2D7SA 2VJVA 2YWGA 3VVUA 3WC0A 2CWKA 4I68A 1C1BB 4K0KF 5KG1A 3BDEA 3GIRA 1A0OB 2LMIA 3T1HF 1FD2A 1KP6A 4H4MB 2DR9A 3MR3A 3MPDA 2AMCB 1NRKA 2NQPA 3QGGA 3G6VA 4LIWA 1M0SA 2ZBCA 1GMUA 2ZVSA 3BR9A 1UA0A 4JV5J 2HMIA 1U26A 2H48B 1Q79A 1N48A 3NNAA 3NS6A 3D7SB 4F2SA 2YNGB 1IR1A 1JIHA 2E1MC 3D3CJ 1V3SA 4OX9F 1OQ6A 3D6HB 3FBCA 4AQYF 3PTWA 3IXQA 1YBUA 1NSQA 4QPXA 3L7UA 1ICEB 2MYFA 3M6VA 4L74A 1HPZB 2OPPA 1NKBA 1U47A 1QDUB 5DS7A 3HHKA 4JI4J 3MMAB 2ZM6J 2I5JA 1OYDA 3BKTA 4ZP9A 2CPZA 3VGSA 3OSPA 1VR6A 4DV1J 3VQTA 1FJCA 2JVRA 3QO9A 3G8QA 1IJFB 1AZSB 4I56A 3JSRA 4I67A 4JI6F 5FJ4A 4ED2A 4NLVA 4LF1A 3NGKA 3V4IA 1KFSA 3SMZA 1IBMJ 3C15B 4KPCA 4NCGB 2WONA 2DPIA 1R6YA 2BJ1A 2A0FB 2A6OA 4F8RA 3JB9k 3NAIA 1QVGR 3CVKA 2WVFA 2K3IA 2QE5A 4Y6IA 4ECZA 2AEMA 3C6UA 2BE2B 3G6XA 4DZDA 3PV8A 1RYSA 1H7XA 4PG6A 5K5MA 1N52B 2IM3A 4OLPA 1T94A 2VKZG 5KFQA 1JXLA 3CDBA 3OFGA 4FXVA 3PFEA 4UQGA 2Z8QA 4WP3A 4CIOA 3UW1A 1RB0A 3SQGB 5HBMA 3TJ9A 1Y5NB 2LVWA 5EWFA 1RWOB 1SC3B 2QLFB 3DRSB 1KOOA 4P52A 2HBZB 1XR7A 2BZ2A 1DLOB 1I1GA 1HIYA 4OIXA 1U8WA 3Q8YA 1S7HA 3C3LA 3R5GA 4ZDNA 4ZVQB 1IQTA 4JI1F 1S77D 3CJSA 1X31C 2PI4A 1IR0A 4O3PA 4FPRA 2C2DA 2QEXS 1F5AA 2BYCA 5FIIA 3BN7A 2R7UA 2VFRA 1JLFB 4DR1F 4AE5A 3SDEB 4PRFA 3NCRA 2I9SA 3LF0A 2OPRA 3RR8A 5DZ6A 5HROA 3PEHA 4DL7A 5J1PA 4Q7AA 3KLGB 3T5HA 2ZOFA 2JFKA 3MFIA 3HK2A 5B08A 2E5GA 4GC7A 3NP5A 3LO3A 1N6QA 2ZUGA 4X4PA 3DI6A 2RKIB 2HFOA 1S6QA 4NI2A 2HAIA 4R8UA 3JYTB 2CUYA 3KK2B 2VC0A 2PE8A 1UP1A 2F65A 2CQIA 2V0NA 3O6QA 3PDNA 3FUYA 2F7VA 3NY0A 1UEVA 2NXNA 3TI0A 4GO7X 4RR5A 3EPIA 4O3SA 3KXDA 2P9EA 4HHHA 4WXWA 3K89A 2IBOA 2UVVA 4W92B 8AT1B 2FIUA 4ECTA 2PO4A 2WBRA 1U8SA 3LH2S 3KUEA 4PG5A 3QGPA 2BQRA 3AA8A 3MTKA 4N76A 3BGFA 3KHLA 1GQEA 4B9MA 4MK9A 3D4JA 3IG1A 2J0XA 1J27A 3CCTA 1Q78A 4MTPA 4YFUA 1PILA 1FRHA 2UXDJ 4EZ6A 1RAFB 4HI2A 4ZP7A 3VQSA 5DZ7A 1GMWD 4X84A 2DR8A 1AUSL 2H65B 3EZUA 2V8GA 4J9LA 3H2LA 1C0UB 1T9TA 5H9FK 2QL7B 2DGWA 1AW0A 4DR3F 2MKJA 3JTOA 1S0VA 2HGNA 3LP2A 1IKWA 2EWHA 1C4AA 2D74B 4HLBA 4ZPTR 3R5BA 2ZITA 4BBYA 2QA4S 4CH7A 3M30B 5IT9U 2OSQA 2ADBA 3KLIB 1ZPWX 5HL7Q 4URGA 3RRGA 5GVQA 2JEJA 1XMBA 3TVYA 3OSNA 4ETZA 3P4UB 1SC4B 3OTBA 5T7LB 3MI7X 3FC9A 2AYMA 4ECVA 3WIUA 1DTQA 2MTLA 4IDKA 3EMTA 3WC2A 4ED6A 3UPFA 3TAPA 4IG0A 5L9XA 4JI3J 3ISNC 3HULA 2MHEA 4DR6F 3H5XA 1ZZNA 4UT4A 3R8YA 3VTIA 3R7NB 2FHKA 4BHQA 2M0GB 1X0FA 4DV4J 3EDRB 4EYIB 3LP0B 1HMVA 3DRRA 2YH1A 2EPIA 5A8WA 3Q23A 3KK3A 4BC9A 5GMEA 3MMBB 3CSKA 2C1EB 5I3UA 2VG5A 3RBEA 4DUZF 4IG3B 4OI2A 2GVZA 4I2QA 5K14A 3RRHA 4BWMA 2G2OA 4QWBA 1WOOA 3X3UA 1IKVA 1XNRF 1FK9B 1VQ9S 2JJ4D 3IR7B 2WVCA 4WZQA 4M5GA 4X4SA 4RW8A 2E1PA 3U7JA 3M6UA 3K5PA 3PR4A 1RT3B 3SCLE 2FGOA 1MWYA 1VQKS 4IO1A 2LLZA 3CC2S 2OKQA 4AFFA 3RB4A 4ED5A 1FI4A 2HGLA 4FS1A 3NBPA 2HLTA 1T9XA 5GAEU 4B02A 1NDKA 2DO0A 1S1VB 3T1YF 3IWXA 1X9WA 1P9YA 3VGUA 1EJ7L 3NGRA 2G1HA 2Y1LB 2HNZB 2RQCA 2XMWA 4ZIWA 1RT7B 4HTJA 3TUIC 3LWLA 4FKXA 5E3AA 1HKAA 3SIPB 1PYOB 2QG9B 5ITHA 3OR1B 4RNFA 3OT9A 1FDBA 2JHEA 4URSA 2JL9A 2Y0SD 2XLJA 1R8PA 3J81U 3IBFB 4EO8A 1FA0A 1HWJA 1RA6A 4ZVTB 4LSNB 2ZVIA 2RT3A 3AD7C 3DDNA 2HHTA 1NPKA 3TZXA 2EG1A 1RDRA 4YB1P 3MM8B 3KLEA 1OS5A 1VBXA 4LF4J 1HHSA 2BVZA 3CJ5A 1U1QA 1EKSA 2ZOGA 4Q0BA 3I4PA 1YJUA 4DQQA 4CO2A 2RDIA 3O1LA 3BGOP 1BQNA 4ZN1A 5KFGA 4OZ3A 2UVRA 3N4WA 3WZ0A 1TL3B 2FC8A 4FVMA 3UWTA 1RWKB 5RUBA 4M95A 2W8KA 3QJJA 2EC0A 4A8KA 1V3ZA 1UEUA 3QYYA 3PO4A 4USWA 2H1YA 2XYHB 4LR8A 1EP4B 2ZHAA 2RU9A 3MCOA 1HNZJ 3QLHA 4KE5A 3VGTA 1N36F 2ZJPQ 2ZJQQ 3ZTPA 2W24A 2R8HA 4O3RA 1FESA 2V9KA 2L08A 4OX7A 3VALA 5EN1A 4JI5F 2BQUA 1U49A 1K73T 5C2GA 5EX0A 3MEGA 3I96A 2QFJA 2ABYA 4J37A 1UA1A 3JXOA 5IWAF 2C3YA 3CDWA 2DPJA 4ZJQA 1LEOA 2A1BA 1IBCB 3GJQB 2F9JA 3I5AA 1U45A 1UAWA 2KFNA 1F9EB 2ZBIA 4DX5A 2E7VA 1UVNA 4NZ0A 4C0HA 2FVSA 1QAYA 5KFKA 3NL0A 3MAAA 3CCRS 1QE1A 2R7OA 1P6TA 2QV6A 2BRLA 1RK8A 2XO7A 1SL1A 3F73A 4LVOP 1HBMA 1K44A 3CD0A 2GW8A 1NPPA 2QL5B 1X8DA 1RT6A 1PC4A 2RS8A 4HACB 2W2PP 2XY6A 1PBAA 4YOEA 3PRDA 1XR6A 3I55S 3JAMY 2DISA 3BKFA 3SBMA 3B6BA 3D6FB 2ZKUA 4CH0S 3W5YA 5F41A 5KFAA 3G8SA 1TV6B 4K4VA 2V34A 3VAJA 1C1CA 1WHVA 3ENVA 5HLFA 2YNHB 3T3FA 4ALZA 2HIYA 1KQKA 4QZVB 4ES1A 5GMKa 3NCQA 4A8OA 4AUKA 1KR4A 2EKNA 4LQ9A 4MYUA 2P9CA 2V8VA 1FKPB 3JSMB 2CQCA 3PM9A 4NLPA 4NE9C 3BEGB 3A13A 4I6YA 2ZH8A 1M90T 3W1YC 3J7YI 5MAOA 4GVBB 4Y2MA 2EFVA 3ZXWA 1JNRB 2V6AA 4XDCA 4ED1A 3BBFA 4LF5J 3OXLA 4CNYA 4A8SA 3SYZA 1RT5B 3IS9B 3L7PA 1J2VA 2ZHOA 4LF8F 5SUHA 3GP9A 1B0PA 3OQ2A 4WTYA 1WWHA 4GKKJ 4DWIA 4H4KC 2LEBA 3GFYA 2IRXA 3CJQA 4FYYB 4DOZA 4FYXB 2QSWA 2H5EA 3OVBA 5IC6B 3POTB 3ZFVA 1NM2A 2X3DA 2KYZA 5SZTA 2HZAA 4OZLA 1WG4A 1VYAA 3GONA 3EXYA 4ZCLA 2OMLA 3VVTA 1NK9A 2WOMA 2HFVA 1UW4A 4GKJF 3JTPA 2X3GA 5AE1A 2GCFA 4F7VA 4A8YA 2G13A 2R8JA 3V6DA 5I3QA 1U48A 2IA6A 1WKLA 1TK0A 4HT7A 1CULB 2XWYA 4NMXA 1TKTB 1HNVA 3HKZD 3BQ0A 2HBRB 2YKNA 3KK2A 3MEEA 5D4OA 2GHWA 1HBNB 5B7WA 1NSAA 2BJ7A 4P2XA 4FBUA 2ZWPA 2HNYB 1WUUA 1JNZB 2VZ9A 3KHGA 2AEFA 3ZTSA 4Y2AA 3G96A 3EZ5A 2ZZTA 1EARA 1VQYA 2KRRA 4C11B 3J7A1 2BE7D 1IJEB 4Y2CA 3W63A 3FKBA 4ZPDA 2FPHX 4EFAC 2CQHA 2BEFA 2V50A 5A0YB 2CQDA 4MK7A 1ZBTA 1K0VA 3TA1A 2B9YA 1JK9B 4FYVB 2GJFA 5F9LA 4Q5VA 3N28A 1ELOA 3M8YA 1RTZA 1Q5YA 3MCNA 1P1TA 3T6BA 4Z7YA 3DKDA 4ZPVR 2XY7A 2IYIA 2QLWA 4NZ7A 2KN4A 3FSYA 4RWXA 1XMOF 2UUAF 3CC7S 3D3BJ 1NU4A 1KRPA 4LBHA 3I4HX 4RW7A 5ETLA 5L1IA 2LXUA 4OHVA 2HWIA 4LIRA 1LW2A 3TARA 4CRJA 2MSSA 2B8PA 3CD7A 3MWBA 2QYGA 2GMJA 1RHQB 2YX1A 2M7SA 1NK4A 5I4MA 1H6KX 4KV8A 2FJEB 3OD2A 5HVHA 4KHPF 3EE3A 4J9QA 1SKSA 4X4UA 2LDIA 5EX3A 1H0HB 1SPBP 2NPFA 3W2WB 3EGWB 3Q83A 1LNQA 5T7LA 4J9KA 2KZZA 2ZKTA 1GFWB 4LQ3A 3BPDA 2DGOA 1RTIA 2WVEA 1SQGA 2WW4A 3M2VB 4JYAJ 1FFSB 1RT2B 1VQMS 5G0RB 1SC1B 1XNQJ 2QA2A 3H2VE 3HF5A 5CCMA 3KFWX 1FNOA 3ONQA 4AYBD 3W8PA 1UL3A 3R5CA 1TUVA 3H42A 1YJ9S 1HI8A 1KLNA 2NYHA 5KFEA 1VQ5S 4LF6J 2J0SD 2VQEJ 1KLMA 3RW6A 3PW5A 4ID5A 2IY5B 2AYEA 2B51A 3PW0A 1S1XA 1ZAWA 4ILMA 2M2BA 5EUHA 1F0XA 1NEEA 4FBTA 4NLYA 1FE4A 2CQ2A 2DCUB 5BYSA 3TVZA 3GILA 3MCMA 4QYZJ 2PMZD 2DHSA 5F8GA 1NDPA 1C2PA 4UUWA 4ELVA 1N33J 3N6MA 2WSCC 1FX4A 4QU6A 5KT2A 2NUHA 3HKWA 3MXHP 3BSNA 3H5YA 1G1XA 2YVSA 2B4PA 3QGHA 4C97A 2XQCA 2IMWP 4OZ1A 3CUNA 1SV5A 4F26A 1L3VA 4CDIA 1RT4B 2E9RX 1UMJA 3B4DA 3DFEA 3KYLA 1HNIB 2MJUA 3EPGA 4O44A 5IC4B 4XK8C 1P1LA 3ZC4A 2IVYA 1X4BA 4ZPBA 3N01A 1D9AA 3EWGA 4F0HA 3MZIA 4OYXA 1T9UA 4WBFA 3A8IA 5KFTA 2HFZA 4G1QB 4EMDA 1RSCA 2VOOA 2C3MA 1WF2A 1YTYA 3M32B 5A8KA 2QL9B 4KGMA 3MM9B 4AXJA 1B0TA 5IM0B 1MU2B 5T14A 1PBUA 1AROP 1MWQA 3N5FA 2QYCA 3T19A 3SSRA 4DSKA 1NHUA 3SSQA 2ZH1A 4ERDA 4X66F 1W7WA 3I0RB 1J5OB 4Q2LA 4RBTA 4M5NA 3A8EA 2RH3A 3MR5A 4RW9B 1TVRA 4MFBA 1Y5LB 2YWHA 3TJAA 1JKHB 3M2RA 3CD5A 3TANA 2FVCA 3RTVA 3SZ2A 1TL3A 1HNXF 1RHJB 4V19X 2ASJA 1EQMA 4WKRA 2D3UA 3FEYB 2FZGB 5CYQA 3PKYA 1SL0A 1ZM4A 3SXLA 4DV2J 1U2RA 4DBQA 1MNEA 1FNMA 3IMQJ 1HI0P 4RWWA 3TQEA 1M1HA 2YY3A 1Q8BA 3UVJB 5I42A 1RYRA 3SFUA 2MZTA 2MSTA 5CZXA 3O8WA 2XGPA 4Y2IA 2IJFA 4J5OA 2IIHA 1S1TB 2QRRA 4KSEB 2VDHA 3IRXB 2RF2A 4DG1B 3BO2A 2H5JB 4PWUA 5IZHA 4J9OA 5K8PA 1SI9A 3RB6A 5CYJA 4KAIA 2K1RA 1ZAVA 2R8GA 4YEAA 1VGYA 4AD6A 2UUBJ 5KOWA 1RISA 2WZ1A 3PR5B 4AT1B 3PYFA 1SJ3P 4J9RA 3NGSA 3AOAA 2O01C 3ZTOA 3C14A 3CT9A 1UEKA 5K8NA 1GTHA 2R4FA 2VB6A 3AJ1A 4DR7J 3S8SA 1Y00A 4UW2A 3MECA 1SH2A 3NWRA 2XLIA 1HW9A 1CJKB 1M1GA 1T9YA 3BZQA 3CDAA 3UN2A 4ZVRB 5AJ3J 2V68A 1OY6A 2XEXA 2DH7A 1FRJA 2DCLA 2CVIA 4WJBA 3FEXB 2HNDA 2ZNZA 2YKQA 4B9NA 2C2KB 1XEZA 5M2PA 1S9GA 3BM7A 3CIMA 2J5AA 2NXEA 1NJWA 4UTGA 2M3DA 2H9ZA 3ET6B 2W9BB 4FYDA 1U2CA 2Q1LA 1FWPA 2UU9F 4FNHA 4S0MA 2A10A 3HHNB 3A1YG 1TL5A 2MZJA 2DXEA 1LKZA 3R9LA 2MQOA 3GJRB 1FJEB 4ZOSA 2DRAA 4NXNJ 1QTMA 3BH7B 2W7PA 5BXIA 2OIHA 3GU0A 3SQOP 1IBKJ 4HHUA 2H5IB 2DNGA 1LWFA 1CJVA 1KS2A 4PWDA 4LFBF 2HVDA 5C24B 3M2UB 3R5AA 1A9NB 5KFBA 5BR8F 1U1OA 4UOFA 4DV5J 2OMOA 3Q8SB 4B3RF 3H25A 3TX8A 3GG0A 4I69A 3BJYA 5E2QA 4KH0B 2R9LA 2MY7A 3AAWB 3QJPA 2OO4A 1N5VA 3VAGA 4F4ZA 1LWCA 4ZITA 4DN0A 2DXFA 2CQ1A 4XDDA 4DUYJ 1WNEA 1Q5VA 2PEBA 3DLKA 3MMCA 3FMWA 4ZLPA 4NXMJ 3CCQS 4Q43A 2MB0B 3DLGB 1UVKA 4ECQA 4ZVUB 2BANB 1NXIA 5KFVA 5LOQA 5CD4H 2HRYA 1FFGB 2DR7A 2C3OA 1NKEA 2E1CA 1MG7A 3DOMB 2HQ3A 1HQUA 3RRKA 3TEGA 2V4QA 3CO0P 2D69A 3IWLA 4TKTA 3LP1A 4P7TA 2KKHA 2CADA 4F2RA 3EICA 5KG0A 4M63A 2CDQA 2GHVC 4QR2A 1F9HA 3DLLQ 5J1NA 3ILIA 3DLJA 4OI6A 3BQ2A 3R7BB 1YI2S 1YITS 3KOAA 3CCES 2J9CA 4NZ6A 1GK8A 3HT0A 1FRIA 2DEIA 1OMSA 2J7KA 2BR0A 2ZD1B 1NHVA 4QIVA 3KLFB 3WHIA 3SV4A 5GAEI 4Y2KA 1H7WA 2MQQA 5KFHA 2GGPA 1RKIA 3M6WA 2X1FA 2FVRA 5AE2A 2WSEC 4O4GA 3GFXA 3U1NA 3OR2B 4PG4A 4NLQA 1LOUA 3QJLA 1X4CA 5KG4A 2E7WA 1F2HA 2F9DA 5KFLA 1U0HB 3HHLD 5ADZA 3UDLA 2AJ2A 4B9VA 4RW4B 2DIVA 3ILJA 2QGFB 1JQGA 3W2WA 3M1VB 1DTTB 4TYBA 3KNGA 3THPA 2X1BA 1SJ4P 1NKCA 1YSJA 4LF7F 3QFHA 5LM7E 5IFMA 2V67A 1RHMB 4MH8A 4RZRA 2KDOA 3M2VA 1GXLA 2B6AB 4C7QA 4JI7F 1S0NA 1RWMB 1IWAA 3T5LA 4H54A 4NYOA 2Y1IA 3J7Z5 3WQPA 2EFNA 2VG7A 1SKUB 3M8WA 1HWUA 5AXKA 1CJUB 3NXZA 3R7SB 5D0HA 2HFUA 3ZZOA 4KKOA 1WACA 2KO1A 2UXCF 3KK1A 1I3OB 3RJMB 5C42B 2D3O1 1QLNA 1WC1A 1R3NA 1MWZA 1Q8KA 3NS5A 2EFGA 3GSIA 4X4RA 1IKYA 6AT1B 1RTDB 1UTAA 3AHPA 1Q53A 4UY8T 3AOCA 3H4DA 1RKJA 2IC3A 1K8AT 2CRLA 4LF2A 3C8YA 1R6VA 3DGVA 4F0KA 2MLXA 5GAHU 1HARA 2BXJA 3W2VA 3CCZA 3DYAA 3L4BC 1FDNA 1QSYA 1WC3A 3LPEA 4NCAA 2GJIA 3GZ7A 3D28A 3HLUA 3A3NB 5LMUJ 4I6AA 3QPIA 3UCUP 3C46A 4ICLA 5K20B 4IOBA 1X0PA 4I64A 3JS9A 4HH1A 2DNQA 2JX2A 2RHSB 3H8YA 2L9DA 2CAJA 2F3JA 4ZS6A 4FVCA 5ETMA 5KTQA 4HHJA 2LXIA 1Q16B 5J2QB 3NNHA 1U1LA 2F4VJ 1RQ0A 2OTLS 2IAJB 4DPUA 3DRPA 4WF9Q 1RT1A 4A4JA 4X62F 2YX4A 2VOPA 5HMYA 2QLBB 4DF8A 3DMJB 2CJKA 2LU2A 5DDQC 2VF3A 4Z2XA 2HQGA 4LMZA 1VMBA 1VQOS 1P27B 5A8RB 3BGLA 2J6TA 1T95A 3TWZA 2RSQA 2MY8A 2GC8A 3O3LA 2P9GA 3E01A 3C6TB 1S9EB 4A46A 4KGKA 4Q45A 1FKOB 5HMWA 1SC6A 3U27A 4LSZB 1RAGB 2G2YA 4N8NA 1TK5A 4DPTA 1Q1KA 5DGAA 3D1QA 1VBZA 3SCJE 3OTOJ 3G6YA 3IFEA 2CVEA 3IGNA 5B0BA 1U1NA 4HDGA 2VL1A 3ZZ0A 1CBKA 1D8YA 4PWWA 4FYWB 4NLRA 3GCXP 4C8YA 2FDNA 1CVJA 4B3SJ 4J9SA 3EVOA 4ZHRB 1QTNB 5J2MB 2YNFA 1X4GA 1NJYA 4K8RA 2ZUAA 4J91A 2E7XA 3RG6A 3GJTB 2OFHX 1VC5A 3BQ1A 4ANCA 3AH6A 3P8BB 4M5LA 4ZVSB 2ZC4A 2ROPA 3V81A 4P75A 2CQ4A 2WSFC 1KN6A 2LEPA 2EG2A 3QIDA 3HJVA 1N5YB 3K7RA 1S1WB 2MKKA 3B8HA 2BJEA 5E3CA 3ELHA 2DY9A 3KMQA 1EZZB 2NS1B 5IV3A 3M8PA 2VFTA 2VFSA 3KLHA 2V5HG 1KVIA 4JI0J 2YPZA 2YKMA 1N32F 4N5SA 3BN4A 1HQEA 2F8HA 1JLAA 1NSPA 4LRCA 2UXBJ 1HNWF 3QFWA 1GAOA 2D3OR 3KNAA 4EBCA 1ROFA 2IRUA 1QJHA 3HI9A 4CM2A 5DDOC 3T6JA 4USKA 2PGCA 3M9NB 4DR2J 5CAAA 2PN6A 3R6LB 3MR2A 2OI2A 4YB6A 4LFCJ 5JVHQ 2QIFA 2VBWA 4P2MA 1IBLJ 2G4BA 2RQ4A 4GKKF 3K2YA 4ES2A 1H2TZ 1UFKA 3EGNA 2YX7A 3FQLA 4RNNA 2BW7A 4FZVA 3TW0A 4EU0A 3UNYA 2FC9A 1B7YB 1N0UA 1JJHA 3ET6A 3A12A 2C2RA 4YR0A 4QIWD 4B3MF 1YJNS 2E1AA 2Y8YA 1R0AA 4YB7A 4YQWA 4DR4J 2N4CA 2DGUA 2JEFA 3OL6A 4USVA 4X4QA 4DR5J 4KHRA 1HYSA 4EO6A 2LECA 3QIPB 3AJ2A 4I4BA 1S59A 2M9KA 3CCMS 1YKWA 2VG6A 4F4KA 2CQBA 2ZH6A 2A2DA 1B64A 2V63A 2HK2A 1RTJB 3GTYX 2HHSA 3RB0A 5KG7A 2ERRA 2UUCJ 2CNKB 2DGVA 2MKCA 4DX7A 1WSRA 3KJQB 1QAXA 1VFJA 4MKYA 3P49B 3DDKA 3DM2B 1VBYA 4MMOA 5KFUA 2CQ0A 4DEZA 2XULA 2B7CB 2DIUA 1TAQA 3TP2A 4NLDA 4NASA 4URQU 4Y34A 1KC8T 2N82B 3PHTA 3NEKA 5KG5A 2AGPA 2XZWA 5H1SV 4IFVA 1BQMB 1LWXA 2QSFA 3K5MA 4TNOA 4YR3A 1ZA2B 2E5LJ 4ZVFA 3V6JA 4YY3F 3G87A 4XAKA 2MMYA 2C22A 3NLCA 1RHKB 3UR0A 4USMA 2CPHA 4DLGA 5K8MA 2MQPA 5FLXY 3HSJA 1OY9A 5J1EB 1RAAB 2HHHF 4LF9J 4WTOB 4PG7A 2VIHA 2IBKA 2AJ0A 1ZZFA 2OH2A 4A8MP 4YDXA 3FBFA 3HHLC 3KHRA 4B9TA 4TU8A 1R7IA 2CDRB 3QSYB 3Q8UA 2I0XA 3PYDA 4YP3A 1RBAA 2HEKA 2RRAA 1S4EA 1D0EA 4DL5A 3R2CJ 3NG8A 3I9V9 1NJZA 3MEDA 3SV3A 4HT5A 3G82B 4P10A 1XIQA 4KTQA 1NHKL 4GVLA 2OSRA 3LQVA 3LAKA 2YWKA 5H9EJ 4U7CA 3GG1A 2J9DE 1GXTA 4RW6A 3P96A 4QOTA 4C3MA 1OWXA 2M52A 1KKHA 2D1CA 3DGPA 1BE4A 3QGIA 3RR7A 4DFKA 3GR1A 2DH9A 2QO3A 4A48A 5KFOA 1KEKA 4IYQA 5M2UA 2JC0A 3SFGA 2GVDA 2EW9A 4DS5A 4G6VB 4ATNA 3I0SA 4WFAQ 1RTHB 1T05A 2GJ2A 2G0IA 4ZK7M 1H2UX 1ZYQA 1YBTA 2IA0A 2E5HA 4KO0A 3OPKA 1I51B 1E6VB 1OO0B 4OX8A 4K5RA 3TAMB 2DHGA 2NXUA 2HZCA 2C2NA 4USJC 5J2NB 1X5OA 4CNZA 3HFVA 4USTA 4DCOB 3LGHA 2DKOB 1BMQB 2KHCA 1RWWB 2AYGA 1VJQA 1IM4A 2ASLA 1IKXB 1UWBB 4K0KJ 4Z7CA 3TZYA 2VQEF 3FNNA 4F3OA 1G7CB 4ILRA 1R89A 2DBBA 3T1HJ 4OL8A 1TKDA 3FRZA 3D0HE 1F5BA 2B5JA 3RW7A 1M5VC 4PYDA 3CULA 3K59A 4ZVOB 3IR5B 3J80Y 5KFYA 2MQLA 2Q6BA 3PXGa 4K2XA 3GV5B 1SKWA 4OHXA 4IR1A 1SQEA 2EXUA 3EX7B 5CCLA 1WC5A 3MAHA 1GH8A 4YS2A 5ETPA 2CPEA 1WTBA 4DPYA 3TO8A 1SXLA 4OX9J 2IM1A 4PXDA 4AQYJ 4CYUA 4NA1A 3DOKA 4Y65A 1CJTA 2XS2A 5LJ3Y 3TUJC 1UJ6A 4NA2A 3KJFB 4B3TF 4FF1A 2CJ9A 2MDAA 3UD5A 4WKYA 3EUNA 5JVGQ 4CTAA 1T03A 3IAS9 1S76D 1WG5A 1REVA 2KG0A 1AYEA 5F8NA 1HD0A 4H4OB 3PEJA 2OGUA 1S9FA 4ED7A 1S6PB 3Q2TC 4JI6J 9RUBA 2JDJA 2BKPA 2EBEA 2IYGA 5F8JA 4NLOA 2MKIA 3ZTRA 2BW2A 3I5BA 2XC9A 5F8HA 2BJ8A 1TMJA 4E0DA 2MKHA 4OHYA 1VRUA 2X51A 4OX6A 1WDDA 1SJQA 4TY8A 2ZH3A 2IDEA 1TMMA 2VPWB 3KTQA 4JI2J 2I2YA 5LSLA 4Q8EA 1FX2A 1LWEA 1TKZA 2FHOB 4DDFA 5C7PA 3HHLB 1X9SA 4PQUB 1JLCA 1DJ0A 4CT8A 1H38A 4XIUA 1S5ZA 3OJSA 3CJ3A 2ZJRQ 1L5UA 3OV7A 1NAQA 3AT1B 1D09B 2HHXA 2XSJA 1BHNA 3FJ2A 4HDHA 1N4LA 4NEZA 3LW5C 2WB4A 4L3KA 4WE1A 3SCKE 1S9EA 3OL9A 2HFNA 3G71S 3HP6A 4JI1J 1VRTA 5D4PA 5E41A 4ER8A 4OYPA 3KJNB 3M4XA 5DG9A 1RAEB 2MGZA 4X4OA 3VAIA 1RAIB 3JQJA 3HVRA 3M9MB 2BOAA 5C25A 1M5SA 5K8OA 4IOAQ 2LP4A 3I5CA 2B43A 4IFYA 3RUBL 2HVIA 4DR1J 2DNRA 2GS8A 2VA3A 2E44A 5L38A 4EBEA 1ZH5A 3KKFA 1CQMA 1F1BB 5FD1A 2AEJA 1I5OB 3C16B 5HMZA 2Z2ZA 3QNWB 4BDPA 4B3OA 1JLEA 5E3QA 4WCEQ 3ISZA 4K4SA 3FFIA 2PSZA 4KY3A 5GADU 2OPSB 4E8UA 1U25A 4IRCA 4F4XA 5IXUA 2Q43A 2H4WB 1FD8A 2ZH4A 2HG4A 2CZVC 1YDLA 2V94A 2W25A 2IJRA 2CJBA 1XJWB 3QWPA 3H20A 1Q81T 2HQCA 2AT1B 4RNMA
chains in the Genus database with same CATH topology
1HR0J 5IWAJ 2VQEJ 4GKKJ 5AJ3J 2E5LJ 4DV4J 4GKJJ 2UXDJ 2VQFJ 4V1Ak 5FLXU 4B3TJ 1HNXJ 2KVQE 1I94J 2UXCJ 1FJGJ 4X65J 4DR6J 4JI4J 4DR4J 4YHHJ 5LMUJ 2ZM6J 2MEWA 4X62J 1HNZJ 4JI8J 4DV6J 4X64J 4DR5J 3R2DJ 4JI0J 5LM7E 4DV3J 4DR1J 3J81U 1XMOJ 2UUAJ 4LF9J 5A2QU 4DV1J 4LFBJ 4OX9J 4JI2J 1N33J 4AQYJ 3OTOJ 5BR8J 4DUYJ 2UXBJ 3J7AN 3T1YJ 2UUBJ 5IT9U 1N34J 4LF8J 4NXMJ 4B3RJ 4PWWA 4LF4J 2UUCJ 4KY3A 4DV0J 1XMQJ 1IBMJ 4JI5J 4YY3J 4DR2J 4JYAJ 4NEYA 4JV5J 4B3MJ 4B3SJ 4RJVA 3R2CJ 2F4VJ 4NXNJ 4LFCJ 2KL8A 3W1YC 1XNQJ 1XNRJ 4K0KJ 1IBLJ 4DR3J 1IBKJ 4LF7J 4HHUA 3D3BJ 4DV7J 1N36J 4DV2J 3D3CJ 4NEZA 4KHPJ 2HHHJ 5LMNJ 3J80U 2MTLA 4DR7J 4KYZA 1J5EJ 4DUZJ 1N32J 3T1HJ 4LF5J 3IMQJ 4JI3J 4JI7J 4DV5J 2MQ8A 4X66J 1HNWJ 2UU9J 4JI6J 4LFAJ 3JAMU 4JI1J 4LF6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 J;  5IWA J;  2VQE J;  4GKK J;  5AJ3 J;  2E5L J;  4DV4 J;  4GKJ J;  2UXD J;  2VQF J;  4V1A k;  5FLX U;  4B3T J;  1HNX J;  2KVQ E;  1I94 J;  2UXC J;  1FJG J;  4X65 J;  4DR6 J;  4JI4 J;  4DR4 J;  4YHH J;  5LMU J;  2ZM6 J;  2MEW A;  4X62 J;  1HNZ J;  4JI8 J;  4DV6 J;  4X64 J;  4DR5 J;  3R2D J;  4JI0 J;  5LM7 E;  4DV3 J;  4DR1 J;  3J81 U;  1XMO J;  2UUA J;  4LF9 J;  5A2Q U;  4DV1 J;  4LFB J;  4OX9 J;  4JI2 J;  1N33 J;  4AQY J;  3OTO J;  5BR8 J;  4DUY J;  2UXB J;  3J7A N;  3T1Y J;  2UUB J;  5IT9 U;  1N34 J;  4LF8 J;  4NXM J;  4B3R J;  4PWW A;  4LF4 J;  2UUC J;  4KY3 A;  4DV0 J;  1XMQ J;  1IBM J;  4JI5 J;  4YY3 J;  4DR2 J;  4JYA J;  4NEY A;  4JV5 J;  4B3M J;  4B3S J;  4RJV A;  3R2C J;  2F4V J;  4NXN J;  4LFC J;  2KL8 A;  3W1Y C;  1XNQ J;  1XNR J;  4K0K J;  1IBL J;  4DR3 J;  1IBK J;  4LF7 J;  4HHU A;  3D3B J;  4DV7 J;  1N36 J;  4DV2 J;  3D3C J;  4NEZ A;  4KHP J;  2HHH J;  5LMN J;  3J80 U;  2MTL A;  4DR7 J;  4KYZ A;  1J5E J;  4DUZ J;  1N32 J;  3T1H J;  4LF5 J;  3IMQ J;  4JI3 J;  4JI7 J;  4DV5 J;  2MQ8 A;  4X66 J;  1HNW J;  2UU9 J;  4JI6 J;  4LFA J;  3JAM U;  4JI1 J;  4LF6 J; 
#chains in the Genus database with same CATH topology
 1CS4 A;  4QU7 A;  2DO4 A;  2W9A A;  3RAQ A;  1SJ1 A;  2QZ8 A;  3LWM A;  1M5K C;  1NPR A;  3BRE A;  4CLY A;  3J81 j;  4PUO A;  4OZ0 A;  5KG6 A;  3DHW C;  4OI0 A;  5DET A;  1TKX A;  5KFP A;  3MM6 B;  1B0V A;  5AXL A;  4PQA A;  2AZ3 A;  3IN5 A;  2NXJ A;  2KT2 A;  4U96 A;  1Q95 G;  1PJ7 A;  3M9O B;  3HXM A;  2J0Q D;  2J9D A;  4ECW A;  4PG8 A;  1TL7 A;  5D78 A;  3K5L A;  2DEJ A;  1YG0 A;  4G1I A;  4FKY A;  1NUE A;  4DSL A;  1FJG F;  1Z2Z A;  3M8S A;  4R0J A;  3M8Q B;  1LXN A;  5KFF A;  1R27 B;  1UFW A;  4DR3 J;  4R0E A;  4YR2 A;  4M5K A;  2WTF A;  2FQQ B;  8ATC B;  3UFC X;  4M5J A;  3PRV A;  4NL5 A;  2RD5 C;  1TFY A;  5CXT A;  4I7F A;  2G0C A;  1OIA A;  1RU2 A;  1NZ8 A;  3S6E A;  3UDV A;  3DRX A;  3CPW R;  2FD2 A;  2XMM A;  4CO1 A;  3QSI A;  4OZJ A;  2I8E A;  4WFX A;  2VUG A;  2W9C B;  2JLE A;  1XN9 A;  3MM7 B;  3TZW A;  1U1M A;  3GCW P;  4DPW A;  3IP0 A;  1RJJ A;  1FRX A;  2Q79 A;  3EGV A;  1JLQ A;  4KFB B;  3S7R A;  3MUR P;  4EUV A;  5KAK A;  3I56 S;  2CZ9 A;  1HBU B;  4I6W A;  4WU2 A;  5IOL A;  3OLB A;  2AD9 A;  2AJF E;  1VJW A;  5ETQ A;  1JLG B;  3TR5 A;  3TUP A;  5D3G A;  4NLS A;  3HFZ B;  4DV6 F;  1HQ2 A;  1HBO A;  2DHA A;  1P8G A;  4QCL A;  2CFX A;  4DUZ J;  4RX6 A;  2CJX B;  2B4V A;  2CNN B;  2GV1 A;  3W3S A;  2CJQ A;  1N34 F;  1MRO A;  1WC0 A;  3JAM U;  2KB2 A;  4OQJ A;  3WX8 A;  1V6H A;  3BGR B;  1VIO A;  2P5V A;  5KT3 A;  1CPZ A;  3HVT A;  2R3V A;  2MLY A;  4NLX A;  1S72 S;  2Z58 B;  3IRW P;  1RUS A;  2BDP A;  4TY9 A;  5DQG A;  1VI7 A;  1RAD B;  1LW0 A;  1C0T A;  4ZCI A;  2Z2Y B;  3DLE A;  3D5M A;  1RBO B;  3G9C A;  2EFP A;  5MLC V;  1O5J A;  2PA3 A;  3C66 A;  3NGT A;  5FDL B;  3T1Y J;  4F4Y A;  5B0F A;  2KXF A;  5E3P A;  1BLU A;  5AE3 A;  3ITH A;  4M5D B;  3HFK A;  1FXR A;  5F8L A;  2LQ5 A;  3CO9 A;  3OUY A;  5GAH I;  4Y3C A;  3K5N A;  2HS4 A;  3I82 A;  2D41 A;  2HHP A;  2XMA A;  4U8Y A;  1T02 A;  2DGT A;  3QRP A;  3TA2 A;  1OPZ A;  2YWE A;  2AV5 A;  4I2P B;  2R2S A;  2YNI B;  4OZ5 A;  1U2F A;  4PYA A;  5JJB A;  2RDD A;  2OPQ A;  4R5P A;  1Q7Y T;  5ETN A;  2NR0 A;  1U0S A;  1IQZ A;  1SH0 A;  2WHO A;  2W2N P;  3VHQ A;  4Y0F A;  1N54 B;  3UN3 A;  1SQF A;  3S1T A;  2HMI B;  3HO1 A;  3W7B A;  1V5I B;  3G4S S;  1PC5 A;  2QA4 G;  4ZCK A;  3DNC A;  2V4J A;  1T11 A;  1UW9 A;  3TVK A;  4LFA F;  1E6Y A;  4P73 A;  4BC7 A;  5DM6 Q;  5K9F A;  3CJK A;  4C6A A;  2OPP B;  2RDJ A;  3IC1 A;  2WRM A;  2WVB A;  1ZAX A;  2ACY A;  3B54 A;  4C2M A;  4D3G A;  3KJV B;  3GFZ A;  5HP1 A;  4C8L A;  2VBZ A;  1WI8 A;  2FLN A;  1WSV A;  1N36 J;  2I5J B;  1R43 A;  5U47 A;  4OJG A;  1KSP A;  4UQT A;  1JXE A;  4ZLJ A;  1F9F A;  1L3S A;  3QO9 B;  4ZPW R;  3T9N A;  2AKW B;  3BYP A;  3PG9 A;  5ETS A;  4E2F B;  5IWA J;  3W66 A;  3NRB A;  3TNV A;  1XMQ F;  3V4I B;  4M5M A;  2OUG A;  2GIQ A;  2NLW A;  2QTW A;  5KT4 A;  4NLW A;  1CEZ A;  3HVW A;  3PIO Q;  1NK0 A;  2WON B;  1EET A;  2CKW A;  2V8D A;  1M1K T;  5HVG A;  1KOH A;  1N0V C;  3BF4 A;  3KHH A;  1TFW A;  4P72 A;  3EZO A;  2RNE A;  1NND A;  1VBK A;  1B70 B;  4KGV B;  1KNZ A;  4QW8 A;  5KT5 A;  3MM5 A;  4RBU A;  2HVH A;  3CCV S;  3C6U B;  1HR0 F;  1F3F A;  3ADA C;  4U95 A;  2RJZ A;  3CCJ S;  2PEH A;  5CHC B;  4DFM A;  1S6P A;  4NEY A;  5D0R A;  3CW2 C;  3A3O B;  4F3M A;  2JOQ A;  3CCS S;  1RHU B;  5CQG A;  3TOQ A;  1X4E A;  2OD4 A;  4DV3 F;  1Y9O A;  1AXQ A;  5HBM B;  2K06 A;  4LSL A;  5DLG A;  3DU6 A;  4GC6 A;  1B7F A;  2XWX A;  4TLQ A;  1R0B G;  4IKA A;  1Y10 A;  4BS2 A;  4ZVE A;  5KT7 A;  1G6B A;  4DV0 F;  1VIS A;  2Y9H A;  1PG5 B;  2OP5 A;  4Z37 A;  4NRT A;  4E98 A;  1AUD A;  2RIL A;  1KQF B;  3JQK A;  4ZPC A;  4U67 Q;  1AFJ A;  2ZE2 A;  4ECX A;  1TL1 A;  1OSD A;  2OPR B;  1MMN A;  1JLB A;  5HRO B;  4QJV A;  1FVQ A;  2GO8 A;  1VQ8 S;  2DR5 A;  4LF8 J;  4RL1 A;  1XK8 A;  5AXN A;  4IH6 A;  4MKB A;  4OYA A;  2VQF F;  4USH A;  4F3Q A;  1R8C A;  1KDN A;  4M5I A;  3PW4 A;  2CQP A;  1N6Q B;  2HWH A;  5EWE A;  2UVW A;  1C1B A;  1KVJ A;  3RAM A;  2L9W A;  2HRT A;  3DI6 B;  1SIW B;  4K4T A;  4IOC Q;  4LBP A;  6FDR A;  1S6Q B;  4NI2 B;  2DTJ A;  4R8U B;  4U7U D;  2WBM A;  3KWM A;  2J8A A;  2D3Z A;  1R8B A;  4H4M A;  2XMT A;  4L6V 3;  5LT5 A;  4ECY A;  3GMG A;  4YDD B;  2ILY A;  1N56 A;  2MXY A;  5EHH A;  4GKJ J;  1S7I A;  2AHO B;  2EI5 A;  4TQR A;  3BO4 A;  1FTR A;  4M1K A;  2JNJ A;  2UXB F;  2HHV A;  3W5X A;  2YNG A;  3CE8 A;  4DV7 F;  4NRU A;  1YZ7 A;  4FDF A;  2LXF A;  1OPI A;  2J6S A;  1CLF A;  2C3U A;  5B0D A;  4CLL A;  4F4W A;  3H5U A;  1HPZ A;  2YQ3 A;  1VQ6 S;  4N41 A;  2H4Y B;  2U2F A;  4AL7 A;  2CPD A;  2M8D B;  3F44 A;  5C5J A;  4P9S A;  3UDE A;  3AA9 A;  2KJW A;  2XBP A;  3MMA A;  3B4M A;  2EK1 A;  2LEA A;  2H51 B;  3JQM A;  2RQM A;  1OSC A;  2DVI A;  1TEL A;  2R7Q A;  3PX0 A;  1VOM A;  1EKR A;  1YLX A;  1VQP S;  2AW0 A;  1AZS A;  2PII A;  2KFZ A;  1SUQ B;  2KYX A;  2XCA A;  4ANE A;  2YTC A;  5M2R A;  4OI4 A;  3WX4 A;  2CA9 A;  3C15 A;  1F5C A;  4NCG A;  4OYO A;  1UVI A;  1FE0 A;  4HR2 A;  4LRB A;  2HBQ B;  2AX0 A;  2FUG 9;  5HK4 A;  1QD1 A;  2N3O A;  5DGB A;  1HA1 A;  3W65 A;  3CMQ A;  2R7W A;  1N8R T;  5F0U A;  1BY9 A;  3I32 A;  1ZM2 A;  2XNQ A;  1DZ5 A;  4KQZ A;  2ZH7 A;  3PNI A;  1XMO J;  2UUA J;  2FJV A;  1NK8 A;  5DG7 A;  2W1B A;  1WHW A;  3NCP A;  2BE2 A;  4IDK B;  4IH5 A;  3L09 A;  4K7Q A;  4IG0 B;  3T41 A;  4WP9 A;  2NXC A;  3Q22 A;  3Q2S C;  3KLV A;  4FXW A;  2FZK B;  1FWL A;  3KG4 A;  2XLK A;  1NK6 A;  4Y28 C;  1PIE A;  3VR1 A;  5CD4 A;  5HQM A;  3SQG A;  1HMV B;  3DRR B;  2HHU A;  2EKY A;  4ED8 A;  5A8W B;  5KFZ A;  4YHH F;  3KK3 B;  2DR6 A;  4X64 F;  4O0N A;  5IT4 A;  3BSC A;  2JLG A;  3DRS A;  2K7K A;  5I3U B;  3W60 A;  4KHP J;  4K4Z A;  3E51 A;  1YJ7 A;  1DLO A;  2ZH5 A;  2QLX A;  5AT1 B;  4PXC A;  2VG5 B;  2MZQ A;  1S79 A;  3DHX A;  2PC6 A;  1WOR A;  2GFF A;  1NDL A;  4C8N A;  1UVL A;  2GVZ B;  4I2Q B;  1WTF A;  4NWB A;  2DH8 A;  1YJW S;  3MM7 A;  5K14 B;  1VQL S;  1N88 A;  4G1P A;  1IKV B;  1S1U B;  3CJ2 A;  5DRK A;  4DSJ A;  4C0O C;  1HD1 A;  3QAE A;  4GRS A;  1JLF A;  2UUT A;  1S49 A;  4IRD A;  3LA0 A;  3OW2 R;  3SDE A;  2K3K A;  4HKQ A;  1OY8 A;  1RAJ A;  1XC9 A;  1U1R A;  4DI6 A;  3OL8 A;  1ZOT A;  1S6O A;  3NBP B;  2PMW A;  3MR7 A;  3KLG A;  2PFD A;  2H3E B;  3H2U B;  4W98 A;  5JMN A;  1FRM A;  4WU3 A;  1YVF A;  2JZ5 A;  4FXD A;  5E5N A;  3HZG A;  2CPF A;  2RKI A;  4DMZ A;  4FF3 A;  3JYT A;  5IS2 A;  3NWG A;  2WK4 A;  1HWL A;  2MJN A;  5E3R A;  3MPY A;  4NOH A;  3KUH A;  3TAQ A;  4ELT A;  1WEX A;  1BWV A;  2M5Y A;  2LKZ A;  4PAB A;  4CLZ A;  3AFG A;  3KLE B;  1N5Q A;  4KR0 B;  5FDL A;  2DNH A;  1UJ4 A;  3O44 A;  4Q0B B;  2J8S A;  2L41 A;  4G65 A;  1HHT P;  2R8K A;  1SH3 A;  2Z0G A;  4A8Q A;  1SL2 A;  1BQN B;  2MQM A;  4ED0 A;  4G3I A;  3I31 A;  2R2U A;  5A2Q Y;  3ILO A;  5ETK A;  4QIG A;  1EAY C;  3N6L A;  4I2P A;  1RU1 A;  2MKY A;  3W9I A;  2YNI A;  3OHA A;  1C0U A;  3C19 A;  4WXO A;  2HHQ A;  3BSA A;  5JXS A;  5L1J A;  2QMU B;  2BV3 A;  1LXJ A;  1R8H A;  4JI8 F;  3P3D A;  2PI5 A;  2CG4 A;  1KTQ A;  2LCW A;  1TQL A;  5KFC A;  3Q0A A;  3PJX A;  3QLH B;  2V4R A;  2XMU A;  1Q82 T;  7AT1 B;  5L1K A;  4O0I A;  3M30 A;  5HQ8 A;  3GJS B;  1UJ5 A;  4X66 J;  1RZM A;  3KLI A;  2HK3 A;  3H40 A;  2I1R A;  3MEG B;  4DFJ A;  3RBZ A;  4IO9 Q;  1U4B A;  4DL6 A;  2QMW A;  2X1G A;  4DJB A;  4DSI A;  2CQ3 A;  1DQ9 A;  2NUU G;  1HNX J;  5CAB A;  3UQS A;  1S99 A;  1FXL A;  4QYR A;  2HVE A;  3IA0 A;  2DY1 A;  3ULH A;  1IVZ A;  1XTZ A;  5KFD A;  2FVQ A;  3KJV A;  3MAA B;  1MSW D;  1QE1 B;  4Y00 A;  2C2E A;  1HBM B;  4DF4 A;  2HS0 A;  3PYE A;  3LP0 A;  5KFI A;  4RUH A;  2AWZ A;  3KDN A;  1RT6 B;  3BYR A;  1ZA1 B;  1Q86 T;  4CCH A;  1G2E A;  1I94 F;  1XER A;  3MMB A;  4RU9 A;  1WEZ A;  5B0E A;  5DDR C;  3HD1 A;  4YME A;  1NME B;  4KT0 C;  3W8G A;  1F6T A;  2P6S A;  3R27 A;  3V2U C;  3UE2 A;  4ITS A;  4IG3 A;  2DNP A;  3FCW A;  1YZ6 A;  2HSE B;  1FHT A;  2JWN A;  2PDA A;  2XZT B;  1FF2 A;  4DXL A;  2OAU A;  1FK9 A;  1C1C B;  2AX1 A;  5HLF B;  5LSO A;  5IQQ A;  2ZFH A;  1DQA A;  3IAM 9;  2OLW A;  1RT3 A;  2L3M A;  2HPU A;  1W2I A;  2IJN A;  1XQI A;  1A7G E;  4LJM A;  4JI2 F;  4AND A;  2IFX A;  5GAD I;  2DIT A;  4OYW A;  4MKV A;  1HWI A;  5KG3 A;  3R97 A;  3FMB A;  1ZM3 A;  4OYM A;  1BC6 A;  4ZVP B;  3RBD A;  1IM6 A;  1IUJ A;  1S1V A;  2APO A;  4DCP B;  1SVD A;  3C2P A;  2LYV A;  4EZ9 A;  4MYT A;  1JX4 A;  2HNZ A;  1XR5 A;  2Z57 B;  1RT7 A;  3HPO A;  2GAG C;  1AA1 B;  1ULR A;  3OR1 A;  2OD6 A;  3GFH A;  4IR9 A;  4P6Q A;  2OEK A;  2ATC B;  3TJ8 A;  2EBG A;  2XS7 A;  1Z2L A;  4PEO A;  5GAG U;  2A18 A;  2B8Q A;  4LSN A;  3AY0 A;  3QT6 A;  4CZC A;  2UU9 J;  3MM8 A;  1NSK L;  2H54 B;  4RUA A;  2O1P A;  1HLW A;  3OJU A;  5G4D A;  2K2P A;  2UZA A;  4CM0 A;  3P5B P;  3GII A;  1UKU A;  2JFD A;  2WOM B;  3K58 A;  4JV5 F;  3DLH A;  1TUG B;  3RU0 A;  4OZ2 A;  3OTE A;  2HW3 A;  3R1H A;  3Q8V A;  3K0J A;  5D4L A;  1T7P A;  3MAQ A;  3V6D B;  1MLA A;  1REG X;  4LFB J;  2RIJ A;  4OLO A;  4AL6 A;  5BR8 J;  2OEM A;  2B9E A;  4AL5 A;  1FDD A;  1U1P A;  1HNV B;  3DRY A;  4WK1 A;  2YKN B;  4DQP A;  2EFQ A;  4B3R J;  4GMK A;  3FQK A;  5ETR A;  3MEE B;  2HKE A;  1EP4 A;  1Y3K A;  4RUC A;  5KOX A;  4RJV A;  3QRR A;  2VBY A;  2YBV A;  4JI4 F;  2ZM6 F;  1DAR A;  4NYP A;  2KT5 A;  3D67 A;  5H9E K;  5LMN J;  4DV1 F;  2ALY B;  1TZ0 A;  1WEL A;  3PW2 A;  1W2B R;  4ECU A;  1WKJ A;  1M5P C;  4HEA 9;  4ENO A;  3T9Z A;  4TN2 A;  3QT8 A;  1IBM F;  3X1L B;  3J7Z T;  2HQD A;  3GYN A;  2IM2 A;  2HVZ A;  3WIV A;  3EVW A;  4NML A;  4NLT A;  3TEH B;  2E5I A;  4IRK A;  3MUT P;  2HLU A;  4ZIV A;  2GMH A;  2XHC A;  3NAH A;  3T5K A;  4RW7 B;  5EWG A;  2W4D A;  4HAC A;  3IM9 A;  4ID8 A;  3PY8 A;  4JUZ A;  2VBX A;  1LW2 B;  1YRU A;  1SUQ A;  2SXL A;  2N3L A;  2IVM A;  1FCA A;  1KHW A;  1JJ2 R;  2HGM A;  1SBR A;  4KV8 B;  1TV6 A;  1URR A;  1APS A;  4LRD A;  1FDA A;  1FO1 A;  4NX9 A;  2YNH A;  1T3N A;  4ES3 A;  5DG8 A;  5B0A A;  1KWM A;  1JMT A;  1WOP A;  3T1A A;  1SJR A;  2BOP A;  1FKP A;  3JSM A;  3VCD A;  3L3C A;  2DGS A;  5A76 A;  1RTI B;  3QBC A;  4QR1 A;  4NPO A;  4GVB A;  4X65 J;  2ALZ A;  3MR6 A;  1QVF R;  4ECS A;  1NB7 A;  4OFZ A;  2ZZM A;  2BUN A;  3E2E A;  1PAU B;  1GMV A;  3H4B A;  1D3W A;  5KFW A;  4F25 A;  1RT5 A;  1KON A;  1HWK A;  3HX9 A;  3IS9 A;  2EK6 A;  4C8K A;  2FYX A;  5DM7 Q;  2B4O A;  4N77 A;  4C8Z A;  1YX2 A;  4HYK A;  2HFS A;  5HMX A;  5LXY A;  1M5O C;  2VIC A;  1TU0 B;  1KLM B;  4FP9 A;  4DSE A;  3ZZP A;  5D6G A;  4I0W A;  4ID5 B;  1S1X B;  3POT A;  1VLO A;  4UOH A;  3QQC D;  9ATC B;  1S1U A;  3PX4 A;  4LF7 J;  2XMK A;  1Q0N A;  2Y1R I;  2FY1 A;  2HUR A;  3B82 A;  1Y0H A;  1QAI A;  1U09 A;  2KVI A;  4N47 A;  4JI7 J;  2VON A;  1X9M A;  2G2Z A;  2Z56 B;  2R7V A;  1YGY A;  4CH1 A;  3UCZ P;  1GT8 A;  5A6P A;  4C9D A;  1L3T A;  1IXK A;  4A8X A;  1Y11 A;  3OL7 A;  4O23 A;  2VAS A;  1U02 A;  4L76 A;  3D0G E;  2UXC J;  3UD3 P;  5HO4 A;  4X4N A;  3TRG A;  4MKA A;  2MEW A;  2R7R A;  1SV5 B;  1CUL A;  3PX6 A;  1TKT A;  4AXI A;  2HWT A;  4P2S A;  4KGX B;  3ZNU A;  3R6G B;  2QJ3 A;  3LAL A;  5CH7 B;  5DLF A;  1UPP A;  4O44 B;  5LJ5 Y;  2GAH C;  3AJD A;  1U7L A;  3A8K A;  4OZN A;  3CCU S;  1HBN A;  3W64 A;  2UXD F;  4KIA A;  2L48 A;  3US5 A;  3KG0 A;  2VJU A;  2I38 A;  2HNY A;  3P5T L;  2BQ3 A;  2J9E A;  3ZO7 A;  4C8M A;  2GNK A;  5A8K B;  4TYA A;  2R7T A;  3NKY A;  3ENQ A;  1M5H A;  2YQ1 A;  3O2I A;  4C11 A;  2C28 A;  2OFG X;  3R3T A;  3BB5 A;  5A0Y A;  3G86 A;  4DL3 A;  3AXM A;  5D15 A;  4OHW A;  4DX8 H;  2CPY A;  1DAX A;  2Y8W A;  3HJF A;  1TVR B;  4MFB B;  2JC1 A;  3M2R B;  4CLK A;  2C2M B;  2JRS A;  2F8E X;  2ZH9 A;  4X62 J;  3PJ9 A;  2FLO A;  4P2F A;  4TLR A;  4PXE A;  1O51 A;  2V2V A;  4KHM A;  5CYQ B;  4JI3 F;  4ZP8 A;  1R0C B;  5HSP A;  1YWX A;  2W8L A;  1H3D A;  1ITP A;  4QPT A;  2CJY B;  2XMJ A;  3O5T B;  4DV4 F;  5I42 B;  1YRT A;  1KVK A;  1K0T A;  1Z1Z A;  2QMX A;  4K4W A;  1N5S A;  4R25 A;  1YBA A;  4KPY A;  4MJK A;  1UZH A;  2RF2 B;  2YKA A;  4ZLN A;  1ZTW A;  1CQN A;  4CI0 B;  4XO0 A;  1QUP A;  5ETO A;  3BSO A;  3VV2 B;  4X4V A;  2K1R B;  1FNX H;  1EQ0 A;  4F0M A;  2N7C A;  3Q8P B;  1ZET A;  2QC3 A;  1KHV A;  2UVU A;  4RLE A;  4CLS A;  1C4C A;  1QY7 A;  5F8I A;  3I6P A;  5FLX U;  1RT2 A;  1DQ8 A;  1NBE B;  5G0R A;  4J9M A;  4J9U E;  1RWV B;  1D1U A;  3C14 B;  5IV4 A;  4TQS A;  1KFD A;  3DC2 A;  1OJ4 A;  3CJ0 A;  4J7C A;  1ZTT A;  3CTR A;  2DGQ A;  4CLW A;  3UN5 A;  2GQQ A;  2VD3 A;  4KGZ B;  1ZPV A;  3FBE A;  3MEC B;  3THT A;  3Q86 A;  1PYT A;  1MMD A;  2V2K A;  4WYW A;  3V6H A;  4H4K A;  3OVA A;  1BUX A;  4B17 A;  5LSR A;  2KXN B;  1HHQ A;  2KI2 A;  2LQ8 A;  2EEY A;  3L95 X;  4BWJ A;  2DXD A;  5DO2 A;  4DL0 C;  3GPA A;  2B9W A;  3JSY A;  2HND B;  3RB3 A;  2DJW A;  2BM0 A;  1WD6 A;  5CYM B;  1S9G B;  4MAK A;  4RU2 A;  3D6T B;  1N32 J;  2KTQ A;  5I3P A;  2Q6C A;  4UOC A;  3TQ1 A;  4N7T A;  3QRQ A;  1L3U A;  4USU A;  1HNW J;  2W2Q P;  2XM3 A;  1X4H A;  2LA6 A;  5B0C A;  4LF4 F;  4W90 B;  3H7H B;  4TVA B;  2PFF B;  1RT4 A;  1MML A;  1GMW A;  2VU5 A;  3LOU A;  1JJ4 A;  1HNI A;  1RP5 A;  3WDO A;  2W4P A;  4RBV A;  3R2D J;  3DOL B;  4CLF A;  4A8W A;  5DQH A;  3QWU A;  3FRY A;  2XCP A;  1LWF B;  2GML A;  1CJV B;  4A8F A;  4PWD B;  4WFZ A;  5L9N A;  1FRL A;  3PZP A;  2CNL B;  2DHH A;  3DLB A;  2GA7 A;  3A8J A;  2AJ4 A;  3E8O A;  2G1D A;  3GV7 B;  3AOB A;  4G1Q A;  1L3K A;  4MIW A;  1AT1 B;  2FZC B;  3IBC B;  3MPU B;  3M32 A;  1SJF A;  1V3R A;  4PXB A;  2FGC A;  5IT9 Y;  4B3M J;  2K8G A;  3MM9 A;  3Q8R B;  5IM0 A;  1MU2 A;  1HNZ F;  2IM0 A;  1EB0 A;  2BJ9 A;  2O67 A;  2FHJ D;  4RO0 A;  3J80 U;  2GX8 A;  5B09 A;  1LWC B;  2WVD A;  4C3L A;  3I0R A;  1J5O A;  1T0T V;  4U8V A;  3MUM P;  2LDY A;  4PPD A;  4RW9 A;  2KH9 A;  2WW8 A;  2R7X A;  1JKH A;  3IBW A;  4DL2 A;  3DLK B;  2RHQ B;  3ICL A;  3MMC B;  4CO0 A;  2XTJ P;  4PPZ A;  4F36 A;  1KD1 T;  1GX5 A;  3KMS A;  3FZB A;  1EHW A;  1RWN B;  1U6Z A;  4J90 A;  3MOJ B;  3LAN A;  1Q8I A;  5JUM A;  2VA2 A;  4K4Y A;  2KU7 A;  2ZHB A;  2V9W A;  1HQU B;  1K1Q A;  2FJX A;  3J7A N;  3UVJ A;  4FPI A;  2XNR A;  2DNZ A;  1WC4 A;  3UNG C;  2XMV A;  3VZH A;  3GYX B;  3LP1 B;  4WIQ A;  2F8M A;  3BS9 A;  5GMD A;  4YY3 J;  4CO5 A;  1S1T A;  1SCJ B;  5D8H B;  1X5T A;  5KFJ A;  3IRX A;  4ZKA A;  4DG1 A;  2VKR A;  3MUV P;  3RYL A;  3F41 A;  2BMB A;  2MZS A;  2IRY A;  2HHH J;  1B99 A;  3NNC A;  1Q8L A;  3TZZ A;  4IQM A;  3HMJ G;  6FD1 A;  2W7O A;  4QWE A;  4ED3 A;  2GGP B;  2RUG A;  4YB5 A;  2M70 A;  4O4G B;  4OYZ A;  1PJ6 A;  2GQ2 A;  1H72 C;  2XI2 A;  3D54 A;  3VAF A;  1DHM A;  4LF5 F;  1URN A;  3BDP A;  4OMF G;  2ILZ A;  4M94 A;  1CJK A;  3J81 Y;  4NA3 A;  1VRQ C;  1UZD A;  2EVZ A;  3MD1 A;  5DQI A;  4HI1 A;  1VDH A;  2KHD A;  2BAC A;  4MK8 A;  1PYS B;  3FVY A;  1U6F A;  1X5P A;  2MZ1 A;  3FSI A;  3M8R A;  2CXE A;  2M88 A;  1ZS6 A;  2Q66 A;  2W9B A;  1J5E J;  3W5Z A;  3D6M B;  1RE1 B;  2GZO A;  4K59 A;  2GIF A;  2JVO A;  2HIQ A;  3QZ8 A;  5L8R C;  2UUW A;  2F63 A;  3NMA A;  4I1T A;  3OBI A;  2VG7 B;  2RML A;  2E9Z A;  1VHF A;  2BJD A;  4WFB Q;  4KKO B;  2ZOM A;  3KK1 B;  3PRB A;  3MTJ A;  2ASD A;  2LQ9 A;  5IQ6 A;  1RAH B;  5C24 A;  4WFY A;  1YJR A;  3M2U A;  1IKY B;  5AXM A;  2IC3 B;  4QQB A;  3LUY A;  2P2C B;  1O8B A;  2CPJ A;  4FNI A;  4Q44 A;  2ZC3 A;  1F3V A;  2V8H A;  3ZZZ A;  2C2Z B;  3LGN A;  3W2V B;  3DYA B;  4X2B A;  1D9F A;  1TP7 A;  1YIJ S;  4YN3 B;  2HQF A;  3DN9 A;  1WF1 A;  3WBZ A;  2JEG A;  2WAQ D;  2VV5 A;  4ICL B;  3EVM A;  3W62 A;  2RRN A;  2AYB A;  1S4F A;  1NH8 A;  2BBE A;  5THW A;  1G3O A;  4OI3 A;  3M6X A;  3TUZ C;  4C0B A;  3DLG A;  4XTT A;  2WB1 D;  2BAN A;  2QLJ B;  4V1A k;  2HRU A;  4B3T J;  1O6X A;  2DGX A;  2CWX A;  1O0P A;  1XWL A;  2C2O B;  4F02 A;  3GIJ A;  3ZZT A;  4JB8 B;  3HSG A;  5IT0 A;  3DRP B;  1DUR A;  1RT1 B;  4DPO A;  3DOM A;  1TUW A;  1UFL A;  4B9S A;  5HJY A;  5F8M A;  2A6M A;  2B56 A;  2E29 A;  1VK8 A;  3HD2 A;  2JLF A;  1S97 A;  1FKA F;  4LVN P;  2YPY A;  1LFW A;  4ELU A;  1P9Q C;  8RUC A;  3K5O A;  4WPA A;  3E01 B;  3GR0 A;  3DXB A;  3GIM A;  5KFX A;  2NCK L;  2NSB A;  1LFP A;  3MEK A;  4KB7 A;  2ZD1 A;  3OHB A;  2L9N A;  3OXG A;  2DRD A;  3KLF A;  1KQS R;  1QSS A;  4FS2 A;  3VWS A;  1FT8 A;  1HL6 A;  2CZ4 A;  1YJV A;  5J2P B;  1DY3 A;  5HJX A;  1N5T A;  2KFY A;  5D0E A;  4JYA F;  2PT0 A;  4LRF A;  3OR2 A;  1W25 A;  5KFR A;  4BCA A;  5D77 A;  1XNQ F;  3LGM A;  1TAU A;  4CP5 A;  2IHR 1;  4P74 A;  2Z4P A;  2YNF B;  3EM1 A;  3GYG A;  1OQ3 A;  3GB0 A;  1U0H A;  4C98 A;  5H9F J;  2ZDP A;  2DB1 A;  2AJ1 A;  4PZV A;  1EIY B;  5GAG I;  2IDL A;  3ILL A;  5EDW A;  4RW4 A;  3V81 B;  1K9M T;  4LF6 F;  4ED4 A;  2R2R A;  2XS5 A;  3LTO A;  1MN7 A;  1DRZ A;  2ZBP A;  3HHD A;  1QUV A;  3M1V A;  5DJB A;  5E0O A;  1DTT A;  4CLP A;  2OEJ A;  1WHY A;  3CDE A;  1I6J A;  1T9W A;  1FFW B;  4OI1 A;  4DU7 A;  2UP1 A;  4QIE A;  1GTE A;  3M8P B;  4U9R A;  2B6A A;  3KLH B;  4DS4 A;  3AQP A;  4ZPA A;  4NLG A;  1Y7P A;  1ACM B;  4A47 A;  1N33 F;  2YKM B;  4RNO A;  2AGO A;  1LV5 A;  3VZI A;  2VFV A;  4MT1 A;  4QW9 A;  1HQE B;  5CA5 A;  2RVJ A;  1JLA B;  2VOD A;  1CC8 A;  5LXR A;  1CC7 A;  3BPS P;  1CJU A;  4NLU A;  3ZZU A;  2FLL A;  1UCN A;  5C42 A;  4W4M A;  3VGV A;  4LR9 A;  3HZE A;  1WKK A;  4B9L A;  2IPO B;  4UF4 A;  1RTD A;  2BKO A;  1WF0 A;  2VPX B;  2O66 A;  2O3D A;  3CDU A;  4CWB A;  1AB8 A;  1FER A;  4F67 A;  3OTC A;  1NB2 A;  4L75 A;  2K7J A;  2OTJ S;  4X4T A;  2XZD B;  4L72 B;  5CYM A;  1SB6 A;  5B0G A;  1RI7 A;  1X4A A;  3MMJ A;  2FJB B;  2E66 A;  4DZ6 A;  2Z30 B;  1R0A B;  2VC1 A;  4O3O A;  3SEO A;  2BX6 A;  1YK9 A;  4WII A;  2JH3 A;  3HSD A;  1HFE L;  4ZCM A;  1HYS B;  1BQX A;  4KYZ A;  2XYP B;  2HZV A;  2F5G A;  2D9O A;  4EEY A;  2BAB A;  3CJR A;  2RAQ A;  5A6W A;  2VG6 B;  3GLJ A;  3U1L A;  3G2X A;  3DOL A;  2G0J A;  2IMO A;  3CED A;  3SI8 A;  1RWP B;  4J9N A;  3EDQ B;  5J2Q A;  2E9T A;  1GX6 A;  2IAJ A;  5L1L A;  1FJG J;  2HAF A;  2FTR A;  3DMJ A;  3NS7 B;  1QAJ A;  7FD1 A;  1FEE A;  4DV2 F;  2GIR A;  3CCW A;  3M8Z A;  1RXO B;  2F1F A;  4JBC A;  4WFN Q;  1FJ7 A;  4EYH B;  1VQ4 S;  2AZ1 A;  1U6B A;  5A8R A;  4CLT A;  4IFV B;  1FXD A;  3BV8 A;  1QM9 A;  2N7Y A;  1IN0 A;  2FVP A;  5LMN F;  4DN9 A;  4RNH A;  2DNN A;  2FB0 A;  7FDR A;  4D3H A;  3C6T A;  1PSD A;  1RLC L;  2W4C A;  5BYR A;  2OHD A;  1RAO A;  3H98 A;  3ETO A;  1FKO A;  2BJ3 A;  3MOZ A;  2CG8 A;  3BGU A;  1JB0 C;  1F60 B;  5HAO A;  2ZH2 A;  2NYI A;  4DHV A;  2ROE A;  2UUB F;  3OFF A;  2J7W A;  3CCL S;  3V6K A;  4QIF A;  2Y0B B;  2YWF A;  5ETV A;  3RZA A;  4ZHR A;  2KVQ E;  1PAE X;  5J2M A;  3OXF A;  1T3O A;  1T8E A;  4DV6 J;  2D9P A;  3L9Z A;  4O3Q A;  3AD8 C;  4EGL A;  3MED B;  4DR7 F;  4K5S A;  3PFO A;  2ZEJ A;  1N5Y A;  1FRK A;  3R5J B;  3MPW A;  2EC2 A;  4DPX A;  1N34 J;  3K57 A;  1S1W A;  2XY5 A;  3P6Y C;  2AP6 A;  3U1M A;  5AJ3 F;  4DFP A;  2C42 A;  4RW6 B;  2RRB A;  2DYA A;  5EGY A;  1VCT A;  3DGP B;  2FY8 A;  3H0P A;  3ENA A;  3P45 B;  5E33 A;  1HI1 A;  2QFI A;  3BKU A;  3G8T A;  2BRK A;  3NOG A;  1UVM A;  2Z2L A;  2GVD B;  4JV1 A;  2UV8 G;  3I0S B;  1IWG A;  2ATL A;  3RGI A;  1VK3 A;  4QWD A;  1T05 B;  2XI3 A;  4X65 F;  2CPI A;  2F4F A;  4WWS A;  2RU3 A;  1Y3J A;  3I9Z A;  4KO0 B;  1S0M A;  2RS2 A;  2V69 A;  3FZ2 A;  2AF6 A;  3V5R A;  2MQN A;  2VPZ B;  3D1O A;  4QR0 A;  3OLA A;  2N4D A;  2RE1 A;  4NXN F;  3F0N A;  2NZC A;  2DK2 A;  1IBK F;  4DCJ B;  3I87 A;  3AB4 B;  3TYT A;  3QZ7 A;  1RHR B;  5D0G A;  4L3N A;  5HAT A;  3VAK A;  4DV5 F;  3OFE A;  3KDO A;  3MHY A;  2B5J B;  5F3T A;  1S0O A;  3BR8 A;  1FTC A;  1FVS A;  2VFU A;  4DUT A;  2W01 A;  2AJQ A;  3GWC A;  3FCV A;  4OYI A;  4KRW A;  2GQC A;  2HQI A;  2HBY B;  4CO3 A;  4PCQ A;  3MPV A;  2BE9 B;  3QIP A;  1Y4Z B;  3PO5 A;  1X4D A;  2B0G A;  3NGU A;  4RUB A;  1Q4R A;  1RTJ A;  4ZJO A;  2LA4 A;  4ZP6 A;  1KQG B;  1VC0 A;  4DUY F;  4QYZ K;  4MIB A;  1D9D A;  4BLG A;  3Q8Q B;  4NYZ A;  2WCX A;  1A6L A;  4CYU B;  3DOK B;  2GO9 A;  2MHN A;  4LFA J;  4MIA A;  1V9O A;  4PKD B;  4NXM F;  1CJT B;  2NPI A;  1VC6 A;  1UWA A;  2BKN A;  2FJD B;  1JJC B;  4IH7 A;  4O4R A;  3DM2 A;  4K50 A;  4UOG A;  2VDI A;  4DLE A;  4JOU A;  4K4X A;  3KG1 A;  1UPM B;  4IQX A;  4DR6 J;  3ZNJ 1;  3PAC A;  4CTA B;  4ZVH A;  3CC4 S;  4KBI A;  4C48 A;  1T03 B;  2J76 E;  1REV B;  3K8V A;  1RCO B;  5LL6 d;  3BO3 A;  1SKR A;  2AIR B;  1BQM A;  1U24 A;  3TX0 A;  4CO4 A;  3H90 A;  3N9U C;  3ZTQ A;  1WC6 A;  3MD3 A;  3BBC A;  2MKS A;  3FEZ A;  4HL9 A;  1NK5 A;  2DHX A;  1XMQ J;  3H5S A;  4DX6 A;  3UI3 A;  1YQH A;  2QT7 A;  3M05 A;  5J1E A;  1XNR J;  1D8Z A;  4RKU C;  1VRU B;  1CSJ A;  2DNY A;  1GNK A;  1X60 A;  4TY8 B;  5E7O B;  1IR2 A;  2NRE A;  3FDS A;  4N56 A;  3MGJ A;  3CJ8 A;  3HSZ A;  4ZLL A;  4YUD A;  1LWE B;  1TKZ B;  3PW7 A;  2P6T A;  1RGV A;  1HR0 J;  2XHW A;  1T9V A;  1JLC B;  3ZZR A;  4F04 B;  4OJH A;  4NCB A;  2DNK A;  1H98 A;  3U02 A;  4EBD A;  1RWU A;  2NSC A;  3G82 A;  4WYL A;  1U1K A;  3AD9 C;  3NOC A;  3G6E S;  5DDP C;  4DV3 J;  4HH0 A;  2XG8 A;  4Q8F A;  3RAX A;  2XSJ B;  3FGV A;  4WE1 B;  1K47 A;  1BXN A;  3CME S;  4GO5 X;  2G9O A;  2LQJ A;  3D9B A;  1H74 A;  3ETM A;  4CLU A;  1B3T A;  3M7V A;  1VRT B;  4EI2 A;  5F3Z A;  4UUX A;  2ZBR A;  4DV0 J;  3CGI A;  4OJ3 A;  5F0W A;  2MGZ B;  2IVF B;  5L39 A;  3PHE A;  4OV6 A;  5C25 B;  4C3K A;  5J2P A;  1XBW A;  3W9J A;  4EWT A;  4IFY B;  2RB7 A;  1RTH A;  2F40 A;  3IR6 B;  2GHP A;  4DL4 A;  3QAU A;  3QMQ A;  1E6V A;  1YHQ S;  3QT7 A;  3TAM A;  2NZ4 A;  3F56 A;  3QT5 A;  3HHE A;  4J9V A;  5J2N A;  3UD4 P;  1JXV A;  2W7A A;  2ZBQ A;  4B3O B;  2HHW A;  2VQF J;  1JLE B;  2CJA A;  1H73 A;  3FFI B;  1X4F A;  2PD1 A;  2LU1 A;  2ADC A;  1RA7 A;  5T41 A;  1IKX A;  1UWB A;  4HVZ A;  1V5V A;  4IUF A;  2E1R A;  2QA1 A;  2KM8 C;  3IM8 A;  3IO1 A;  3N5B A;  5CZV A;  2KZM A;  1MW7 A;  1R31 A;  1X7V A;  4WP8 A;  3IGV A;  3NGD A;  1NDC A;  4JP8 A;  1R8A A;  2HS3 A;  4WZM A;  3AXK A;  3UCG A;  4KC5 A;  2J0W A;  3ZZY A;  2ZZN A;  1NLK L;  1BWE A;  2AQ4 A;  2KG1 A;  1CG2 A;  2CIM A;  2I6W A;  2B7B B;  1CS4 B;  4XPE A;  4UZB A;  2XYG B;  4JI5 J;  1TTH B;  4B9U A;  4ZN3 A;  3EJM A;  2R8I A;  2HYI B;  1WDT A;  1Z4U A;  2CYY A;  3A4T A;  3LAM A;  5LMU F;  3W61 A;  4USI A;  2YXL A;  3K8W A;  3VF0 B;  4WK3 A;  4DV7 J;  4PUO B;  1UET A;  1NO8 A;  3VAM A;  3HM9 A;  1TKX B;  2KT3 A;  1NJI T;  1S57 A;  4ZMM A;  2QN6 B;  4LBI A;  2ASY A;  3AB2 B;  4QWA A;  2BM1 A;  2X1A A;  2MLZ A;  1TL7 B;  2YH0 A;  4DSF A;  2F4V F;  1F2G A;  2U1A A;  2V8P A;  3B78 A;  4KH1 B;  2Z2M A;  2ZDO A;  3DXS X;  5A2Q U;  4H4O A;  3HDS A;  1WI6 A;  1EX8 A;  3R5D A;  2COL A;  4B08 A;  4M8L A;  3D0I E;  4I7F B;  3CIZ A;  4CQ1 A;  1KBR A;  4QWC A;  1NH7 A;  5KFM A;  2XGQ A;  4P71 A;  3Q24 A;  4DQI A;  5BJR A;  1HW8 A;  2R2T A;  3ENW A;  3OTO F;  3HHL A;  4PQU A;  1JLQ B;  5L46 A;  4DQR A;  3HT3 A;  1VLY A;  3D68 A;  3CD6 S;  5HQL A;  4ZJL A;  4XPC A;  1LK5 A;  4U7U K;  3KUG A;  4B3S F;  4CT9 A;  5KT6 A;  3E3X A;  4YHH J;  2KRB A;  4X64 J;  4UY8 5;  5D3G B;  1TR0 A;  2VPY B;  2VHG A;  3IWN C;  1HBO B;  2FJW A;  3NMR A;  2XB2 D;  3SCI E;  3CJT A;  2R7S A;  2DT9 A;  1G4C A;  2LFV A;  3FCH A;  1FWK A;  1PCA A;  4N8O A;  1NZA A;  4LT6 A;  1MRO B;  3TA0 A;  3GQC A;  3HVA A;  2J7U A;  4DU8 A;  2R42 A;  2ACM A;  5HN0 A;  3CB4 A;  2X7I A;  4ZA1 A;  3HVT B;  3CXC R;  4PAA A;  4OYB A;  4JI0 F;  1S48 A;  1VQN S;  5KFN A;  2RQK A;  5C2C A;  3MFH A;  1LW0 B;  1C0T B;  4L73 A;  3DLE B;  2EFO A;  4JV0 A;  2P8I A;  2FHM A;  2YWW A;  2XO6 A;  1GXU A;  2BA9 A;  2YQ0 A;  1S10 A;  3C16 A;  4ZVG A;  1NCL A;  1OYE A;  1KTV A;  2MPU A;  4P7V A;  3N79 A;  3FSX A;  3D66 A;  3HCX A;  3DCA A;  4F4A A;  3D2W A;  3K17 A;  2OPS A;  4UZC A;  1RWX B;  3ITH B;  3OTD A;  3J7Y U;  4DR2 F;  3W9H A;  3V4M A;  3JTN A;  2DNO A;  4LR7 A;  3OUY B;  4LFC F;  3LPY A;  2DRB A;  3IG1 B;  2FLP A;  2RUS A;  2KM8 B;  3GV8 B;  4HTI A;  2V2Q A;  1IBL F;  4F50 A;  3CJ4 A;  2E5J A;  1NJX A;  2CNO B;  1PO6 A;  1VIX A;  1K1S A;  3SSS A;  2B9X A;  5HAN A;  1LQ9 A;  2Y3Y A;  3N6N A;  4O3N A;  2OPQ B;  1GEH A;  1J5E F;  4R5P B;  5HVF A;  1BD6 A;  3LP2 B;  1IKW B;  1H2V Z;  2B4U A;  3PVX A;  4DR4 F;  2W2O P;  2W2M P;  4M5H A;  4DR5 F;  4QBU A;  1NK7 A;  3FBB A;  3MM6 A;  4Q2M A;  2YKO A;  1YRX A;  3UO0 A;  2M8H A;  1S12 A;  4ECR A;  1VQS A;  2A3J A;  4LUB A;  2DD8 S;  4DQS A;  2CQG A;  3S01 A;  2V4J B;  1DBD A;  2MQ8 A;  3UR3 C;  2KXH A;  3CWJ A;  1VHI A;  3PCO B;  3MCS A;  2DNM A;  2UUC F;  1E6Y B;  2ZNY A;  4C8O A;  4C4W A;  3CJK B;  1DTQ B;  4FF4 A;  2FHJ A;  4LRA A;  1PGZ A;  3EGZ A;  3M8Q A;  1JWW A;  5HP1 B;  4JI8 J;  1RBL A;  2AGQ A;  1WG1 A;  3DU5 A;  3RBX A;  5KG2 A;  2JEI A;  3AQO A;  4K4U A;  2AU0 A;  2YKP A;  3UDC A;  3D1H A;  2POK A;  5HI7 A;  4V19 J;  3Q89 A;  2E5L F;  2J6U A;  4JV2 A;  2UV8 A;  2PMH A;  3N0V A;  5D4N A;  1DFD A;  2MZR A;  1BGX T;  3QAT A;  2W9C A;  4RPF A;  3R1L A;  2O5D A;  1EET B;  4TXS A;  3FK4 A;  1TL4 A;  2FJA B;  4LF9 F;  2ZWO A;  3PKM A;  4OV1 A;  4OJ1 A;  4ILL A;  1FEH A;  5KFS A;  4KFB A;  4TU7 A;  4RW8 B;  2C3P A;  1RLD A;  1W26 A;  1B4S A;  1HBU A;  3MM5 B;  1AFI A;  3CMA S;  2KJV A;  4TU9 A;  3VAH A;  1PJ5 A;  3BH6 B;  5F9N A;  4PR6 A;  2CPX A;  1I94 J;  1JLG A;  3T5J A;  3CF5 Q;  3CNQ P;  1WOS A;  1PKU A;  4FF2 A;  3OVS A;  1YJT A;  2M4M A;  4FN5 A;  1TK8 A;  3PYG A;  2A2C A;  2OEL A;  3MF5 A;  3GIK A;  3ISN D;  3EXC X;  3MDF A;  2Y1J A;  1Q7L B;  1ZM9 A;  1RAB B;  2XSF A;  4K2J A;  2DNL A;  4LSL B;  3GSD A;  3A3P B;  3DDI A;  2Q3P A;  2PA8 D;  1WJ9 A;  3OFH A;  1WEY A;  1MN9 A;  3H59 A;  4EK2 A;  4U6P A;  3BGR A;  2B3T B;  1SIZ A;  3PIP Q;  4OHZ A;  1VQ7 S;  5BYQ A;  2V2Z A;  3PJW A;  2LQB A;  3EYZ A;  3JSB A;  2KL8 A;  3BBB A;  3AOD A;  1S6U A;  3L7O A;  3THV A;  1LK7 A;  1QSL A;  2ROG A;  1UVJ A;  1WHX A;  3GE9 A;  4ETX A;  4LRE A;  2ZE2 B;  2JSX A;  2QX0 A;  1TL1 B;  2OJ3 A;  4KJI A;  2VH7 A;  1X5S A;  1JLB B;  4M5D A;  1RAC B;  1Y5I B;  1VS3 A;  4J9P A;  1RCX B;  5ETT A;  2D7S A;  2VJV A;  2YWG A;  3VVU A;  3WC0 A;  2CWK A;  4I68 A;  1C1B B;  4K0K F;  5KG1 A;  3BDE A;  3GIR A;  1A0O B;  2LMI A;  3T1H F;  1FD2 A;  1KP6 A;  4H4M B;  2DR9 A;  3MR3 A;  3MPD A;  2AMC B;  1NRK A;  2NQP A;  3QGG A;  3G6V A;  4LIW A;  1M0S A;  2ZBC A;  1GMU A;  2ZVS A;  3BR9 A;  1UA0 A;  4JV5 J;  2HMI A;  1U26 A;  2H48 B;  1Q79 A;  1N48 A;  3NNA A;  3NS6 A;  3D7S B;  4F2S A;  2YNG B;  1IR1 A;  1JIH A;  2E1M C;  3D3C J;  1V3S A;  4OX9 F;  1OQ6 A;  3D6H B;  3FBC A;  4AQY F;  3PTW A;  3IXQ A;  1YBU A;  1NSQ A;  4QPX A;  3L7U A;  1ICE B;  2MYF A;  3M6V A;  4L74 A;  1HPZ B;  2OPP A;  1NKB A;  1U47 A;  1QDU B;  5DS7 A;  3HHK A;  4JI4 J;  3MMA B;  2ZM6 J;  2I5J A;  1OYD A;  3BKT A;  4ZP9 A;  2CPZ A;  3VGS A;  3OSP A;  1VR6 A;  4DV1 J;  3VQT A;  1FJC A;  2JVR A;  3QO9 A;  3G8Q A;  1IJF B;  1AZS B;  4I56 A;  3JSR A;  4I67 A;  4JI6 F;  5FJ4 A;  4ED2 A;  4NLV A;  4LF1 A;  3NGK A;  3V4I A;  1KFS A;  3SMZ A;  1IBM J;  3C15 B;  4KPC A;  4NCG B;  2WON A;  2DPI A;  1R6Y A;  2BJ1 A;  2A0F B;  2A6O A;  4F8R A;  3JB9 k;  3NAI A;  1QVG R;  3CVK A;  2WVF A;  2K3I A;  2QE5 A;  4Y6I A;  4ECZ A;  2AEM A;  3C6U A;  2BE2 B;  3G6X A;  4DZD A;  3PV8 A;  1RYS A;  1H7X A;  4PG6 A;  5K5M A;  1N52 B;  2IM3 A;  4OLP A;  1T94 A;  2VKZ G;  5KFQ A;  1JXL A;  3CDB A;  3OFG A;  4FXV A;  3PFE A;  4UQG A;  2Z8Q A;  4WP3 A;  4CIO A;  3UW1 A;  1RB0 A;  3SQG B;  5HBM A;  3TJ9 A;  1Y5N B;  2LVW A;  5EWF A;  1RWO B;  1SC3 B;  2QLF B;  3DRS B;  1KOO A;  4P52 A;  2HBZ B;  1XR7 A;  2BZ2 A;  1DLO B;  1I1G A;  1HIY A;  4OIX A;  1U8W A;  3Q8Y A;  1S7H A;  3C3L A;  3R5G A;  4ZDN A;  4ZVQ B;  1IQT A;  4JI1 F;  1S77 D;  3CJS A;  1X31 C;  2PI4 A;  1IR0 A;  4O3P A;  4FPR A;  2C2D A;  2QEX S;  1F5A A;  2BYC A;  5FII A;  3BN7 A;  2R7U A;  2VFR A;  1JLF B;  4DR1 F;  4AE5 A;  3SDE B;  4PRF A;  3NCR A;  2I9S A;  3LF0 A;  2OPR A;  3RR8 A;  5DZ6 A;  5HRO A;  3PEH A;  4DL7 A;  5J1P A;  4Q7A A;  3KLG B;  3T5H A;  2ZOF A;  2JFK A;  3MFI A;  3HK2 A;  5B08 A;  2E5G A;  4GC7 A;  3NP5 A;  3LO3 A;  1N6Q A;  2ZUG A;  4X4P A;  3DI6 A;  2RKI B;  2HFO A;  1S6Q A;  4NI2 A;  2HAI A;  4R8U A;  3JYT B;  2CUY A;  3KK2 B;  2VC0 A;  2PE8 A;  1UP1 A;  2F65 A;  2CQI A;  2V0N A;  3O6Q A;  3PDN A;  3FUY A;  2F7V A;  3NY0 A;  1UEV A;  2NXN A;  3TI0 A;  4GO7 X;  4RR5 A;  3EPI A;  4O3S A;  3KXD A;  2P9E A;  4HHH A;  4WXW A;  3K89 A;  2IBO A;  2UVV A;  4W92 B;  8AT1 B;  2FIU A;  4ECT A;  2PO4 A;  2WBR A;  1U8S A;  3LH2 S;  3KUE A;  4PG5 A;  3QGP A;  2BQR A;  3AA8 A;  3MTK A;  4N76 A;  3BGF A;  3KHL A;  1GQE A;  4B9M A;  4MK9 A;  3D4J A;  3IG1 A;  2J0X A;  1J27 A;  3CCT A;  1Q78 A;  4MTP A;  4YFU A;  1PIL A;  1FRH A;  2UXD J;  4EZ6 A;  1RAF B;  4HI2 A;  4ZP7 A;  3VQS A;  5DZ7 A;  1GMW D;  4X84 A;  2DR8 A;  1AUS L;  2H65 B;  3EZU A;  2V8G A;  4J9L A;  3H2L A;  1C0U B;  1T9T A;  5H9F K;  2QL7 B;  2DGW A;  1AW0 A;  4DR3 F;  2MKJ A;  3JTO A;  1S0V A;  2HGN A;  3LP2 A;  1IKW A;  2EWH A;  1C4A A;  2D74 B;  4HLB A;  4ZPT R;  3R5B A;  2ZIT A;  4BBY A;  2QA4 S;  4CH7 A;  3M30 B;  5IT9 U;  2OSQ A;  2ADB A;  3KLI B;  1ZPW X;  5HL7 Q;  4URG A;  3RRG A;  5GVQ A;  2JEJ A;  1XMB A;  3TVY A;  3OSN A;  4ETZ A;  3P4U B;  1SC4 B;  3OTB A;  5T7L B;  3MI7 X;  3FC9 A;  2AYM A;  4ECV A;  3WIU A;  1DTQ A;  2MTL A;  4IDK A;  3EMT A;  3WC2 A;  4ED6 A;  3UPF A;  3TAP A;  4IG0 A;  5L9X A;  4JI3 J;  3ISN C;  3HUL A;  2MHE A;  4DR6 F;  3H5X A;  1ZZN A;  4UT4 A;  3R8Y A;  3VTI A;  3R7N B;  2FHK A;  4BHQ A;  2M0G B;  1X0F A;  4DV4 J;  3EDR B;  4EYI B;  3LP0 B;  1HMV A;  3DRR A;  2YH1 A;  2EPI A;  5A8W A;  3Q23 A;  3KK3 A;  4BC9 A;  5GME A;  3MMB B;  3CSK A;  2C1E B;  5I3U A;  2VG5 A;  3RBE A;  4DUZ F;  4IG3 B;  4OI2 A;  2GVZ A;  4I2Q A;  5K14 A;  3RRH A;  4BWM A;  2G2O A;  4QWB A;  1WOO A;  3X3U A;  1IKV A;  1XNR F;  1FK9 B;  1VQ9 S;  2JJ4 D;  3IR7 B;  2WVC A;  4WZQ A;  4M5G A;  4X4S A;  4RW8 A;  2E1P A;  3U7J A;  3M6U A;  3K5P A;  3PR4 A;  1RT3 B;  3SCL E;  2FGO A;  1MWY A;  1VQK S;  4IO1 A;  2LLZ A;  3CC2 S;  2OKQ A;  4AFF A;  3RB4 A;  4ED5 A;  1FI4 A;  2HGL A;  4FS1 A;  3NBP A;  2HLT A;  1T9X A;  5GAE U;  4B02 A;  1NDK A;  2DO0 A;  1S1V B;  3T1Y F;  3IWX A;  1X9W A;  1P9Y A;  3VGU A;  1EJ7 L;  3NGR A;  2G1H A;  2Y1L B;  2HNZ B;  2RQC A;  2XMW A;  4ZIW A;  1RT7 B;  4HTJ A;  3TUI C;  3LWL A;  4FKX A;  5E3A A;  1HKA A;  3SIP B;  1PYO B;  2QG9 B;  5ITH A;  3OR1 B;  4RNF A;  3OT9 A;  1FDB A;  2JHE A;  4URS A;  2JL9 A;  2Y0S D;  2XLJ A;  1R8P A;  3J81 U;  3IBF B;  4EO8 A;  1FA0 A;  1HWJ A;  1RA6 A;  4ZVT B;  4LSN B;  2ZVI A;  2RT3 A;  3AD7 C;  3DDN A;  2HHT A;  1NPK A;  3TZX A;  2EG1 A;  1RDR A;  4YB1 P;  3MM8 B;  3KLE A;  1OS5 A;  1VBX A;  4LF4 J;  1HHS A;  2BVZ A;  3CJ5 A;  1U1Q A;  1EKS A;  2ZOG A;  4Q0B A;  3I4P A;  1YJU A;  4DQQ A;  4CO2 A;  2RDI A;  3O1L A;  3BGO P;  1BQN A;  4ZN1 A;  5KFG A;  4OZ3 A;  2UVR A;  3N4W A;  3WZ0 A;  1TL3 B;  2FC8 A;  4FVM A;  3UWT A;  1RWK B;  5RUB A;  4M95 A;  2W8K A;  3QJJ A;  2EC0 A;  4A8K A;  1V3Z A;  1UEU A;  3QYY A;  3PO4 A;  4USW A;  2H1Y A;  2XYH B;  4LR8 A;  1EP4 B;  2ZHA A;  2RU9 A;  3MCO A;  1HNZ J;  3QLH A;  4KE5 A;  3VGT A;  1N36 F;  2ZJP Q;  2ZJQ Q;  3ZTP A;  2W24 A;  2R8H A;  4O3R A;  1FES A;  2V9K A;  2L08 A;  4OX7 A;  3VAL A;  5EN1 A;  4JI5 F;  2BQU A;  1U49 A;  1K73 T;  5C2G A;  5EX0 A;  3MEG A;  3I96 A;  2QFJ A;  2ABY A;  4J37 A;  1UA1 A;  3JXO A;  5IWA F;  2C3Y A;  3CDW A;  2DPJ A;  4ZJQ A;  1LEO A;  2A1B A;  1IBC B;  3GJQ B;  2F9J A;  3I5A A;  1U45 A;  1UAW A;  2KFN A;  1F9E B;  2ZBI A;  4DX5 A;  2E7V A;  1UVN A;  4NZ0 A;  4C0H A;  2FVS A;  1QAY A;  5KFK A;  3NL0 A;  3MAA A;  3CCR S;  1QE1 A;  2R7O A;  1P6T A;  2QV6 A;  2BRL A;  1RK8 A;  2XO7 A;  1SL1 A;  3F73 A;  4LVO P;  1HBM A;  1K44 A;  3CD0 A;  2GW8 A;  1NPP A;  2QL5 B;  1X8D A;  1RT6 A;  1PC4 A;  2RS8 A;  4HAC B;  2W2P P;  2XY6 A;  1PBA A;  4YOE A;  3PRD A;  1XR6 A;  3I55 S;  3JAM Y;  2DIS A;  3BKF A;  3SBM A;  3B6B A;  3D6F B;  2ZKU A;  4CH0 S;  3W5Y A;  5F41 A;  5KFA A;  3G8S A;  1TV6 B;  4K4V A;  2V34 A;  3VAJ A;  1C1C A;  1WHV A;  3ENV A;  5HLF A;  2YNH B;  3T3F A;  4ALZ A;  2HIY A;  1KQK A;  4QZV B;  4ES1 A;  5GMK a;  3NCQ A;  4A8O A;  4AUK A;  1KR4 A;  2EKN A;  4LQ9 A;  4MYU A;  2P9C A;  2V8V A;  1FKP B;  3JSM B;  2CQC A;  3PM9 A;  4NLP A;  4NE9 C;  3BEG B;  3A13 A;  4I6Y A;  2ZH8 A;  1M90 T;  3W1Y C;  3J7Y I;  5MAO A;  4GVB B;  4Y2M A;  2EFV A;  3ZXW A;  1JNR B;  2V6A A;  4XDC A;  4ED1 A;  3BBF A;  4LF5 J;  3OXL A;  4CNY A;  4A8S A;  3SYZ A;  1RT5 B;  3IS9 B;  3L7P A;  1J2V A;  2ZHO A;  4LF8 F;  5SUH A;  3GP9 A;  1B0P A;  3OQ2 A;  4WTY A;  1WWH A;  4GKK J;  4DWI A;  4H4K C;  2LEB A;  3GFY A;  2IRX A;  3CJQ A;  4FYY B;  4DOZ A;  4FYX B;  2QSW A;  2H5E A;  3OVB A;  5IC6 B;  3POT B;  3ZFV A;  1NM2 A;  2X3D A;  2KYZ A;  5SZT A;  2HZA A;  4OZL A;  1WG4 A;  1VYA A;  3GON A;  3EXY A;  4ZCL A;  2OML A;  3VVT A;  1NK9 A;  2WOM A;  2HFV A;  1UW4 A;  4GKJ F;  3JTP A;  2X3G A;  5AE1 A;  2GCF A;  4F7V A;  4A8Y A;  2G13 A;  2R8J A;  3V6D A;  5I3Q A;  1U48 A;  2IA6 A;  1WKL A;  1TK0 A;  4HT7 A;  1CUL B;  2XWY A;  4NMX A;  1TKT B;  1HNV A;  3HKZ D;  3BQ0 A;  2HBR B;  2YKN A;  3KK2 A;  3MEE A;  5D4O A;  2GHW A;  1HBN B;  5B7W A;  1NSA A;  2BJ7 A;  4P2X A;  4FBU A;  2ZWP A;  2HNY B;  1WUU A;  1JNZ B;  2VZ9 A;  3KHG A;  2AEF A;  3ZTS A;  4Y2A A;  3G96 A;  3EZ5 A;  2ZZT A;  1EAR A;  1VQY A;  2KRR A;  4C11 B;  3J7A 1;  2BE7 D;  1IJE B;  4Y2C A;  3W63 A;  3FKB A;  4ZPD A;  2FPH X;  4EFA C;  2CQH A;  2BEF A;  2V50 A;  5A0Y B;  2CQD A;  4MK7 A;  1ZBT A;  1K0V A;  3TA1 A;  2B9Y A;  1JK9 B;  4FYV B;  2GJF A;  5F9L A;  4Q5V A;  3N28 A;  1ELO A;  3M8Y A;  1RTZ A;  1Q5Y A;  3MCN A;  1P1T A;  3T6B A;  4Z7Y A;  3DKD A;  4ZPV R;  2XY7 A;  2IYI A;  2QLW A;  4NZ7 A;  2KN4 A;  3FSY A;  4RWX A;  1XMO F;  2UUA F;  3CC7 S;  3D3B J;  1NU4 A;  1KRP A;  4LBH A;  3I4H X;  4RW7 A;  5ETL A;  5L1I A;  2LXU A;  4OHV A;  2HWI A;  4LIR A;  1LW2 A;  3TAR A;  4CRJ A;  2MSS A;  2B8P A;  3CD7 A;  3MWB A;  2QYG A;  2GMJ A;  1RHQ B;  2YX1 A;  2M7S A;  1NK4 A;  5I4M A;  1H6K X;  4KV8 A;  2FJE B;  3OD2 A;  5HVH A;  4KHP F;  3EE3 A;  4J9Q A;  1SKS A;  4X4U A;  2LDI A;  5EX3 A;  1H0H B;  1SPB P;  2NPF A;  3W2W B;  3EGW B;  3Q83 A;  1LNQ A;  5T7L A;  4J9K A;  2KZZ A;  2ZKT A;  1GFW B;  4LQ3 A;  3BPD A;  2DGO A;  1RTI A;  2WVE A;  1SQG A;  2WW4 A;  3M2V B;  4JYA J;  1FFS B;  1RT2 B;  1VQM S;  5G0R B;  1SC1 B;  1XNQ J;  2QA2 A;  3H2V E;  3HF5 A;  5CCM A;  3KFW X;  1FNO A;  3ONQ A;  4AYB D;  3W8P A;  1UL3 A;  3R5C A;  1TUV A;  3H42 A;  1YJ9 S;  1HI8 A;  1KLN A;  2NYH A;  5KFE A;  1VQ5 S;  4LF6 J;  2J0S D;  2VQE J;  1KLM A;  3RW6 A;  3PW5 A;  4ID5 A;  2IY5 B;  2AYE A;  2B51 A;  3PW0 A;  1S1X A;  1ZAW A;  4ILM A;  2M2B A;  5EUH A;  1F0X A;  1NEE A;  4FBT A;  4NLY A;  1FE4 A;  2CQ2 A;  2DCU B;  5BYS A;  3TVZ A;  3GIL A;  3MCM A;  4QYZ J;  2PMZ D;  2DHS A;  5F8G A;  1NDP A;  1C2P A;  4UUW A;  4ELV A;  1N33 J;  3N6M A;  2WSC C;  1FX4 A;  4QU6 A;  5KT2 A;  2NUH A;  3HKW A;  3MXH P;  3BSN A;  3H5Y A;  1G1X A;  2YVS A;  2B4P A;  3QGH A;  4C97 A;  2XQC A;  2IMW P;  4OZ1 A;  3CUN A;  1SV5 A;  4F26 A;  1L3V A;  4CDI A;  1RT4 B;  2E9R X;  1UMJ A;  3B4D A;  3DFE A;  3KYL A;  1HNI B;  2MJU A;  3EPG A;  4O44 A;  5IC4 B;  4XK8 C;  1P1L A;  3ZC4 A;  2IVY A;  1X4B A;  4ZPB A;  3N01 A;  1D9A A;  3EWG A;  4F0H A;  3MZI A;  4OYX A;  1T9U A;  4WBF A;  3A8I A;  5KFT A;  2HFZ A;  4G1Q B;  4EMD A;  1RSC A;  2VOO A;  2C3M A;  1WF2 A;  1YTY A;  3M32 B;  5A8K A;  2QL9 B;  4KGM A;  3MM9 B;  4AXJ A;  1B0T A;  5IM0 B;  1MU2 B;  5T14 A;  1PBU A;  1ARO P;  1MWQ A;  3N5F A;  2QYC A;  3T19 A;  3SSR A;  4DSK A;  1NHU A;  3SSQ A;  2ZH1 A;  4ERD A;  4X66 F;  1W7W A;  3I0R B;  1J5O B;  4Q2L A;  4RBT A;  4M5N A;  3A8E A;  2RH3 A;  3MR5 A;  4RW9 B;  1TVR A;  4MFB A;  1Y5L B;  2YWH A;  3TJA A;  1JKH B;  3M2R A;  3CD5 A;  3TAN A;  2FVC A;  3RTV A;  3SZ2 A;  1TL3 A;  1HNX F;  1RHJ B;  4V19 X;  2ASJ A;  1EQM A;  4WKR A;  2D3U A;  3FEY B;  2FZG B;  5CYQ A;  3PKY A;  1SL0 A;  1ZM4 A;  3SXL A;  4DV2 J;  1U2R A;  4DBQ A;  1MNE A;  1FNM A;  3IMQ J;  1HI0 P;  4RWW A;  3TQE A;  1M1H A;  2YY3 A;  1Q8B A;  3UVJ B;  5I42 A;  1RYR A;  3SFU A;  2MZT A;  2MST A;  5CZX A;  3O8W A;  2XGP A;  4Y2I A;  2IJF A;  4J5O A;  2IIH A;  1S1T B;  2QRR A;  4KSE B;  2VDH A;  3IRX B;  2RF2 A;  4DG1 B;  3BO2 A;  2H5J B;  4PWU A;  5IZH A;  4J9O A;  5K8P A;  1SI9 A;  3RB6 A;  5CYJ A;  4KAI A;  2K1R A;  1ZAV A;  2R8G A;  4YEA A;  1VGY A;  4AD6 A;  2UUB J;  5KOW A;  1RIS A;  2WZ1 A;  3PR5 B;  4AT1 B;  3PYF A;  1SJ3 P;  4J9R A;  3NGS A;  3AOA A;  2O01 C;  3ZTO A;  3C14 A;  3CT9 A;  1UEK A;  5K8N A;  1GTH A;  2R4F A;  2VB6 A;  3AJ1 A;  4DR7 J;  3S8S A;  1Y00 A;  4UW2 A;  3MEC A;  1SH2 A;  3NWR A;  2XLI A;  1HW9 A;  1CJK B;  1M1G A;  1T9Y A;  3BZQ A;  3CDA A;  3UN2 A;  4ZVR B;  5AJ3 J;  2V68 A;  1OY6 A;  2XEX A;  2DH7 A;  1FRJ A;  2DCL A;  2CVI A;  4WJB A;  3FEX B;  2HND A;  2ZNZ A;  2YKQ A;  4B9N A;  2C2K B;  1XEZ A;  5M2P A;  1S9G A;  3BM7 A;  3CIM A;  2J5A A;  2NXE A;  1NJW A;  4UTG A;  2M3D A;  2H9Z A;  3ET6 B;  2W9B B;  4FYD A;  1U2C A;  2Q1L A;  1FWP A;  2UU9 F;  4FNH A;  4S0M A;  2A10 A;  3HHN B;  3A1Y G;  1TL5 A;  2MZJ A;  2DXE A;  1LKZ A;  3R9L A;  2MQO A;  3GJR B;  1FJE B;  4ZOS A;  2DRA A;  4NXN J;  1QTM A;  3BH7 B;  2W7P A;  5BXI A;  2OIH A;  3GU0 A;  3SQO P;  1IBK J;  4HHU A;  2H5I B;  2DNG A;  1LWF A;  1CJV A;  1KS2 A;  4PWD A;  4LFB F;  2HVD A;  5C24 B;  3M2U B;  3R5A A;  1A9N B;  5KFB A;  5BR8 F;  1U1O A;  4UOF A;  4DV5 J;  2OMO A;  3Q8S B;  4B3R F;  3H25 A;  3TX8 A;  3GG0 A;  4I69 A;  3BJY A;  5E2Q A;  4KH0 B;  2R9L A;  2MY7 A;  3AAW B;  3QJP A;  2OO4 A;  1N5V A;  3VAG A;  4F4Z A;  1LWC A;  4ZIT A;  4DN0 A;  2DXF A;  2CQ1 A;  4XDD A;  4DUY J;  1WNE A;  1Q5V A;  2PEB A;  3DLK A;  3MMC A;  3FMW A;  4ZLP A;  4NXM J;  3CCQ S;  4Q43 A;  2MB0 B;  3DLG B;  1UVK A;  4ECQ A;  4ZVU B;  2BAN B;  1NXI A;  5KFV A;  5LOQ A;  5CD4 H;  2HRY A;  1FFG B;  2DR7 A;  2C3O A;  1NKE A;  2E1C A;  1MG7 A;  3DOM B;  2HQ3 A;  1HQU A;  3RRK A;  3TEG A;  2V4Q A;  3CO0 P;  2D69 A;  3IWL A;  4TKT A;  3LP1 A;  4P7T A;  2KKH A;  2CAD A;  4F2R A;  3EIC A;  5KG0 A;  4M63 A;  2CDQ A;  2GHV C;  4QR2 A;  1F9H A;  3DLL Q;  5J1N A;  3ILI A;  3DLJ A;  4OI6 A;  3BQ2 A;  3R7B B;  1YI2 S;  1YIT S;  3KOA A;  3CCE S;  2J9C A;  4NZ6 A;  1GK8 A;  3HT0 A;  1FRI A;  2DEI A;  1OMS A;  2J7K A;  2BR0 A;  2ZD1 B;  1NHV A;  4QIV A;  3KLF B;  3WHI A;  3SV4 A;  5GAE I;  4Y2K A;  1H7W A;  2MQQ A;  5KFH A;  2GGP A;  1RKI A;  3M6W A;  2X1F A;  2FVR A;  5AE2 A;  2WSE C;  4O4G A;  3GFX A;  3U1N A;  3OR2 B;  4PG4 A;  4NLQ A;  1LOU A;  3QJL A;  1X4C A;  5KG4 A;  2E7W A;  1F2H A;  2F9D A;  5KFL A;  1U0H B;  3HHL D;  5ADZ A;  3UDL A;  2AJ2 A;  4B9V A;  4RW4 B;  2DIV A;  3ILJ A;  2QGF B;  1JQG A;  3W2W A;  3M1V B;  1DTT B;  4TYB A;  3KNG A;  3THP A;  2X1B A;  1SJ4 P;  1NKC A;  1YSJ A;  4LF7 F;  3QFH A;  5LM7 E;  5IFM A;  2V67 A;  1RHM B;  4MH8 A;  4RZR A;  2KDO A;  3M2V A;  1GXL A;  2B6A B;  4C7Q A;  4JI7 F;  1S0N A;  1RWM B;  1IWA A;  3T5L A;  4H54 A;  4NYO A;  2Y1I A;  3J7Z 5;  3WQP A;  2EFN A;  2VG7 A;  1SKU B;  3M8W A;  1HWU A;  5AXK A;  1CJU B;  3NXZ A;  3R7S B;  5D0H A;  2HFU A;  3ZZO A;  4KKO A;  1WAC A;  2KO1 A;  2UXC F;  3KK1 A;  1I3O B;  3RJM B;  5C42 B;  2D3O 1;  1QLN A;  1WC1 A;  1R3N A;  1MWZ A;  1Q8K A;  3NS5 A;  2EFG A;  3GSI A;  4X4R A;  1IKY A;  6AT1 B;  1RTD B;  1UTA A;  3AHP A;  1Q53 A;  4UY8 T;  3AOC A;  3H4D A;  1RKJ A;  2IC3 A;  1K8A T;  2CRL A;  4LF2 A;  3C8Y A;  1R6V A;  3DGV A;  4F0K A;  2MLX A;  5GAH U;  1HAR A;  2BXJ A;  3W2V A;  3CCZ A;  3DYA A;  3L4B C;  1FDN A;  1QSY A;  1WC3 A;  3LPE A;  4NCA A;  2GJI A;  3GZ7 A;  3D28 A;  3HLU A;  3A3N B;  5LMU J;  4I6A A;  3QPI A;  3UCU P;  3C46 A;  4ICL A;  5K20 B;  4IOB A;  1X0P A;  4I64 A;  3JS9 A;  4HH1 A;  2DNQ A;  2JX2 A;  2RHS B;  3H8Y A;  2L9D A;  2CAJ A;  2F3J A;  4ZS6 A;  4FVC A;  5ETM A;  5KTQ A;  4HHJ A;  2LXI A;  1Q16 B;  5J2Q B;  3NNH A;  1U1L A;  2F4V J;  1RQ0 A;  2OTL S;  2IAJ B;  4DPU A;  3DRP A;  4WF9 Q;  1RT1 A;  4A4J A;  4X62 F;  2YX4 A;  2VOP A;  5HMY A;  2QLB B;  4DF8 A;  3DMJ B;  2CJK A;  2LU2 A;  5DDQ C;  2VF3 A;  4Z2X A;  2HQG A;  4LMZ A;  1VMB A;  1VQO S;  1P27 B;  5A8R B;  3BGL A;  2J6T A;  1T95 A;  3TWZ A;  2RSQ A;  2MY8 A;  2GC8 A;  3O3L A;  2P9G A;  3E01 A;  3C6T B;  1S9E B;  4A46 A;  4KGK A;  4Q45 A;  1FKO B;  5HMW A;  1SC6 A;  3U27 A;  4LSZ B;  1RAG B;  2G2Y A;  4N8N A;  1TK5 A;  4DPT A;  1Q1K A;  5DGA A;  3D1Q A;  1VBZ A;  3SCJ E;  3OTO J;  3G6Y A;  3IFE A;  2CVE A;  3IGN A;  5B0B A;  1U1N A;  4HDG A;  2VL1 A;  3ZZ0 A;  1CBK A;  1D8Y A;  4PWW A;  4FYW B;  4NLR A;  3GCX P;  4C8Y A;  2FDN A;  1CVJ A;  4B3S J;  4J9S A;  3EVO A;  4ZHR B;  1QTN B;  5J2M B;  2YNF A;  1X4G A;  1NJY A;  4K8R A;  2ZUA A;  4J91 A;  2E7X A;  3RG6 A;  3GJT B;  2OFH X;  1VC5 A;  3BQ1 A;  4ANC A;  3AH6 A;  3P8B B;  4M5L A;  4ZVS B;  2ZC4 A;  2ROP A;  3V81 A;  4P75 A;  2CQ4 A;  2WSF C;  1KN6 A;  2LEP A;  2EG2 A;  3QID A;  3HJV A;  1N5Y B;  3K7R A;  1S1W B;  2MKK A;  3B8H A;  2BJE A;  5E3C A;  3ELH A;  2DY9 A;  3KMQ A;  1EZZ B;  2NS1 B;  5IV3 A;  3M8P A;  2VFT A;  2VFS A;  3KLH A;  2V5H G;  1KVI A;  4JI0 J;  2YPZ A;  2YKM A;  1N32 F;  4N5S A;  3BN4 A;  1HQE A;  2F8H A;  1JLA A;  1NSP A;  4LRC A;  2UXB J;  1HNW F;  3QFW A;  1GAO A;  2D3O R;  3KNA A;  4EBC A;  1ROF A;  2IRU A;  1QJH A;  3HI9 A;  4CM2 A;  5DDO C;  3T6J A;  4USK A;  2PGC A;  3M9N B;  4DR2 J;  5CAA A;  2PN6 A;  3R6L B;  3MR2 A;  2OI2 A;  4YB6 A;  4LFC J;  5JVH Q;  2QIF A;  2VBW A;  4P2M A;  1IBL J;  2G4B A;  2RQ4 A;  4GKK F;  3K2Y A;  4ES2 A;  1H2T Z;  1UFK A;  3EGN A;  2YX7 A;  3FQL A;  4RNN A;  2BW7 A;  4FZV A;  3TW0 A;  4EU0 A;  3UNY A;  2FC9 A;  1B7Y B;  1N0U A;  1JJH A;  3ET6 A;  3A12 A;  2C2R A;  4YR0 A;  4QIW D;  4B3M F;  1YJN S;  2E1A A;  2Y8Y A;  1R0A A;  4YB7 A;  4YQW A;  4DR4 J;  2N4C A;  2DGU A;  2JEF A;  3OL6 A;  4USV A;  4X4Q A;  4DR5 J;  4KHR A;  1HYS A;  4EO6 A;  2LEC A;  3QIP B;  3AJ2 A;  4I4B A;  1S59 A;  2M9K A;  3CCM S;  1YKW A;  2VG6 A;  4F4K A;  2CQB A;  2ZH6 A;  2A2D A;  1B64 A;  2V63 A;  2HK2 A;  1RTJ B;  3GTY X;  2HHS A;  3RB0 A;  5KG7 A;  2ERR A;  2UUC J;  2CNK B;  2DGV A;  2MKC A;  4DX7 A;  1WSR A;  3KJQ B;  1QAX A;  1VFJ A;  4MKY A;  3P49 B;  3DDK A;  3DM2 B;  1VBY A;  4MMO A;  5KFU A;  2CQ0 A;  4DEZ A;  2XUL A;  2B7C B;  2DIU A;  1TAQ A;  3TP2 A;  4NLD A;  4NAS A;  4URQ U;  4Y34 A;  1KC8 T;  2N82 B;  3PHT A;  3NEK A;  5KG5 A;  2AGP A;  2XZW A;  5H1S V;  4IFV A;  1BQM B;  1LWX A;  2QSF A;  3K5M A;  4TNO A;  4YR3 A;  1ZA2 B;  2E5L J;  4ZVF A;  3V6J A;  4YY3 F;  3G87 A;  4XAK A;  2MMY A;  2C22 A;  3NLC A;  1RHK B;  3UR0 A;  4USM A;  2CPH A;  4DLG A;  5K8M A;  2MQP A;  5FLX Y;  3HSJ A;  1OY9 A;  5J1E B;  1RAA B;  2HHH F;  4LF9 J;  4WTO B;  4PG7 A;  2VIH A;  2IBK A;  2AJ0 A;  1ZZF A;  2OH2 A;  4A8M P;  4YDX A;  3FBF A;  3HHL C;  3KHR A;  4B9T A;  4TU8 A;  1R7I A;  2CDR B;  3QSY B;  3Q8U A;  2I0X A;  3PYD A;  4YP3 A;  1RBA A;  2HEK A;  2RRA A;  1S4E A;  1D0E A;  4DL5 A;  3R2C J;  3NG8 A;  3I9V 9;  1NJZ A;  3MED A;  3SV3 A;  4HT5 A;  3G82 B;  4P10 A;  1XIQ A;  4KTQ A;  1NHK L;  4GVL A;  2OSR A;  3LQV A;  3LAK A;  2YWK A;  5H9E J;  4U7C A;  3GG1 A;  2J9D E;  1GXT A;  4RW6 A;  3P96 A;  4QOT A;  4C3M A;  1OWX A;  2M52 A;  1KKH A;  2D1C A;  3DGP A;  1BE4 A;  3QGI A;  3RR7 A;  4DFK A;  3GR1 A;  2DH9 A;  2QO3 A;  4A48 A;  5KFO A;  1KEK A;  4IYQ A;  5M2U A;  2JC0 A;  3SFG A;  2GVD A;  2EW9 A;  4DS5 A;  4G6V B;  4ATN A;  3I0S A;  4WFA Q;  1RTH B;  1T05 A;  2GJ2 A;  2G0I A;  4ZK7 M;  1H2U X;  1ZYQ A;  1YBT A;  2IA0 A;  2E5H A;  4KO0 A;  3OPK A;  1I51 B;  1E6V B;  1OO0 B;  4OX8 A;  4K5R A;  3TAM B;  2DHG A;  2NXU A;  2HZC A;  2C2N A;  4USJ C;  5J2N B;  1X5O A;  4CNZ A;  3HFV A;  4UST A;  4DCO B;  3LGH A;  2DKO B;  1BMQ B;  2KHC A;  1RWW B;  2AYG A;  1VJQ A;  1IM4 A;  2ASL A;  1IKX B;  1UWB B;  4K0K J;  4Z7C A;  3TZY A;  2VQE F;  3FNN A;  4F3O A;  1G7C B;  4ILR A;  1R89 A;  2DBB A;  3T1H J;  4OL8 A;  1TKD A;  3FRZ A;  3D0H E;  1F5B A;  2B5J A;  3RW7 A;  1M5V C;  4PYD A;  3CUL A;  3K59 A;  4ZVO B;  3IR5 B;  3J80 Y;  5KFY A;  2MQL A;  2Q6B A;  3PXG a;  4K2X A;  3GV5 B;  1SKW A;  4OHX A;  4IR1 A;  1SQE A;  2EXU A;  3EX7 B;  5CCL A;  1WC5 A;  3MAH A;  1GH8 A;  4YS2 A;  5ETP A;  2CPE A;  1WTB A;  4DPY A;  3TO8 A;  1SXL A;  4OX9 J;  2IM1 A;  4PXD A;  4AQY J;  4CYU A;  4NA1 A;  3DOK A;  4Y65 A;  1CJT A;  2XS2 A;  5LJ3 Y;  3TUJ C;  1UJ6 A;  4NA2 A;  3KJF B;  4B3T F;  4FF1 A;  2CJ9 A;  2MDA A;  3UD5 A;  4WKY A;  3EUN A;  5JVG Q;  4CTA A;  1T03 A;  3IAS 9;  1S76 D;  1WG5 A;  1REV A;  2KG0 A;  1AYE A;  5F8N A;  1HD0 A;  4H4O B;  3PEJ A;  2OGU A;  1S9F A;  4ED7 A;  1S6P B;  3Q2T C;  4JI6 J;  9RUB A;  2JDJ A;  2BKP A;  2EBE A;  2IYG A;  5F8J A;  4NLO A;  2MKI A;  3ZTR A;  2BW2 A;  3I5B A;  2XC9 A;  5F8H A;  2BJ8 A;  1TMJ A;  4E0D A;  2MKH A;  4OHY A;  1VRU A;  2X51 A;  4OX6 A;  1WDD A;  1SJQ A;  4TY8 A;  2ZH3 A;  2IDE A;  1TMM A;  2VPW B;  3KTQ A;  4JI2 J;  2I2Y A;  5LSL A;  4Q8E A;  1FX2 A;  1LWE A;  1TKZ A;  2FHO B;  4DDF A;  5C7P A;  3HHL B;  1X9S A;  4PQU B;  1JLC A;  1DJ0 A;  4CT8 A;  1H38 A;  4XIU A;  1S5Z A;  3OJS A;  3CJ3 A;  2ZJR Q;  1L5U A;  3OV7 A;  1NAQ A;  3AT1 B;  1D09 B;  2HHX A;  2XSJ A;  1BHN A;  3FJ2 A;  4HDH A;  1N4L A;  4NEZ A;  3LW5 C;  2WB4 A;  4L3K A;  4WE1 A;  3SCK E;  1S9E A;  3OL9 A;  2HFN A;  3G71 S;  3HP6 A;  4JI1 J;  1VRT A;  5D4P A;  5E41 A;  4ER8 A;  4OYP A;  3KJN B;  3M4X A;  5DG9 A;  1RAE B;  2MGZ A;  4X4O A;  3VAI A;  1RAI B;  3JQJ A;  3HVR A;  3M9M B;  2BOA A;  5C25 A;  1M5S A;  5K8O A;  4IOA Q;  2LP4 A;  3I5C A;  2B43 A;  4IFY A;  3RUB L;  2HVI A;  4DR1 J;  2DNR A;  2GS8 A;  2VA3 A;  2E44 A;  5L38 A;  4EBE A;  1ZH5 A;  3KKF A;  1CQM A;  1F1B B;  5FD1 A;  2AEJ A;  1I5O B;  3C16 B;  5HMZ A;  2Z2Z A;  3QNW B;  4BDP A;  4B3O A;  1JLE A;  5E3Q A;  4WCE Q;  3ISZ A;  4K4S A;  3FFI A;  2PSZ A;  4KY3 A;  5GAD U;  2OPS B;  4E8U A;  1U25 A;  4IRC A;  4F4X A;  5IXU A;  2Q43 A;  2H4W B;  1FD8 A;  2ZH4 A;  2HG4 A;  2CZV C;  1YDL A;  2V94 A;  2W25 A;  2IJR A;  2CJB A;  1XJW B;  3QWP A;  3H20 A;  1Q81 T;  2HQC A;  2AT1 B;  4RNM A; 
#chains in the Genus database with same CATH homology
 1HR0 J;  5IWA J;  2VQE J;  4GKK J;  5AJ3 J;  2E5L J;  4DV4 J;  4GKJ J;  2UXD J;  2VQF J;  4V1A k;  5FLX U;  4B3T J;  1HNX J;  2KVQ E;  1I94 J;  2UXC J;  1FJG J;  4X65 J;  4DR6 J;  4JI4 J;  4DR4 J;  4YHH J;  5LMU J;  2ZM6 J;  2MEW A;  4X62 J;  1HNZ J;  4JI8 J;  4DV6 J;  4X64 J;  4DR5 J;  3R2D J;  4JI0 J;  5LM7 E;  4DV3 J;  4DR1 J;  3J81 U;  1XMO J;  2UUA J;  4LF9 J;  5A2Q U;  4DV1 J;  4LFB J;  4OX9 J;  4JI2 J;  1N33 J;  4AQY J;  3OTO J;  5BR8 J;  4DUY J;  2UXB J;  3J7A N;  3T1Y J;  2UUB J;  5IT9 U;  1N34 J;  4LF8 J;  4NXM J;  4B3R J;  4PWW A;  4LF4 J;  2UUC J;  4KY3 A;  4DV0 J;  1XMQ J;  1IBM J;  4JI5 J;  4YY3 J;  4DR2 J;  4JYA J;  4NEY A;  4JV5 J;  4B3M J;  4B3S J;  4RJV A;  3R2C J;  2F4V J;  4NXN J;  4LFC J;  2KL8 A;  3W1Y C;  1XNQ J;  1XNR J;  4K0K J;  1IBL J;  4DR3 J;  1IBK J;  4LF7 J;  4HHU A;  3D3B J;  4DV7 J;  1N36 J;  4DV2 J;  3D3C J;  4NEZ A;  4KHP J;  2HHH J;  5LMN J;  3J80 U;  2MTL A;  4DR7 J;  4KYZ A;  1J5E J;  4DUZ J;  1N32 J;  3T1H J;  4LF5 J;  3IMQ J;  4JI3 J;  4JI7 J;  4DV5 J;  2MQ8 A;  4X66 J;  1HNW J;  2UU9 J;  4JI6 J;  4LFA J;  3JAM U;  4JI1 J;  4LF6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...