4DV0J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv0J00
4DR5J 4GKJJ 4NXNJ 3IMQJ 3OTOJ 2UUBJ 4YHHJ 4JI0J 4JI8J 4DR1J 4B3RJ 1XNQJ 1IBLJ 4NXMJ 4V1Ak 4DV1J 1IBMJ 3D3BJ 4KHPJ 1N32J 4RJVA 4JI2J 4DV0J 4DV3J 2ZM6J 1N33J 4NEZA 4B3SJ 4AQYJ 1XMOJ 3R2CJ 3W1YC 5BR8J 5A2QU 4JI5J 2MTLA 1HR0J 1FJGJ 4DR7J 4K0KJ 4PWWA 4LF4J 4JI3J 4DR2J 4DV4J 4NEYA 4HHUA 3J80U 1N36J 4LFAJ 1HNZJ 4KYZA 2KVQE 4JI4J 4B3TJ 3T1YJ 5LMUJ 4DUZJ 4LFBJ 4X65J 4DV2J 2UUCJ 5LMNJ 5AJ3J 4JI7J 2E5LJ 2UUAJ 4JYAJ 2UXDJ 3J7AN 4LF6J 2MEWA 2MQ8A 3R2DJ 4X64J 1N34J 4X66J 2UXBJ 4LF5J 4LF9J 3J81U 4DV7J 4DUYJ 1HNXJ 4LF7J 4DV5J 5IWAJ 3T1HJ 4OX9J 4DR4J 1J5EJ 4KY3A 2HHHJ 1I94J 1IBKJ 4X62J 4B3MJ 2UXCJ 4JV5J 5IT9U 5LM7E 4YY3J 1XNRJ 1HNWJ 2KL8A 4LF8J 4JI6J 4DR6J 4GKKJ 4LFCJ 2VQEJ 4DV6J 3D3CJ 5FLXU 3JAMU 1XMQJ 2F4VJ 4DR3J 4JI1J 2VQFJ 2UU9J
chains in the Genus database with same CATH superfamily
2PIIA 4EO6A 5KFNA 4MKYA 4UZCA 3NEKA 2NXEA 5KFUA 1T8EA 2HHPA 1N6QB 1KQSR 2HWIA 3EUNA 1WF2A 1X5PA 3EICA 3TAMA 2VG7A 1X5TA 2CQ0A 2DNRA 1HWIA 1EQMA 2NREA 4Q7AA 1YX2A 2CPHA 1UP1A 4DL2A 2V8PA 3SBMA 3R9LA 4ZITA 2RD5C 2IBOA 2OFGX 2AD9A 3KXDA 2OD6A 5HI7A 3IP0A 2HS3A 1S6PB 4NLUA 4TLRA 1AT1B 3TUIC 2CIMA 4HDGA 4USIA 4ZS6A 4FXDA 1FKOB 3IFEA 1CS4B 4ZVSB 2BMBA 2NPIA 3HI9A 3SIPB 4QBUA 1RADB 2IRXA 2LEPA 4DV5F 5IWAF 3EXYA 1HNIA 2K7JA 2MZ1A 1NKCA 3DNCA 3DLGB 2AYGA 4DSIA 3DLLQ 2FZGB 1WHXA 1I5OB 2BM1A 2IFXA 4KO0B 3T6BA 4C7QA 3V4IA 2QA1A 3E8OA 2G2ZA 5H9EJ 2EEYA 1FRKA 3GE9A 2XYPB 4MYUA 3L7UA 4DDFA 4J9KA 3QYYA 5BR8J 3W5XA 3GV8B 2GVZA 4JI5J 4ILMA 1NJXA 2HRYA 4RU9A 3VV2B 1CJTB 3CJ5A 4OZ0A 4DSFA 4LVNP 2VUGA 3KK2B 3GTYX 3ITHA 4KTQA 1HBNA 3UW1A 4EBDA 3LO3A 4CCHA 4OL8A 1NB2A 2BOAA 2F63A 4QYRA 4DX7A 1NK7A 2PFFB 2NS1B 5EGYA 2JLGA 4AXIA 3PIOQ 5JXSA 1K0TA 1GMVA 2F4VF 4ED5A 2RT3A 2J8AA 4FYVB 1VBXA 2RMLA 3T1AA 2UU9F 4FKXA 3DC2A 1XMBA 3R5CA 3PX6A 1FRIA 2IVYA 3KLIA 2JX2A 3GILA 4EK2A 2AW0A 2XLJA 3DOMA 2ILYA 3PNIA 1IR1A 3RRKA 4C4WA 1FEHA 5C2GA 3RBXA 3OTOF 1TKZA 1GNKA 1Y00A 1WWHA 3HMJG 5D3GB 5IFMA 1T7PA 4KT0C 2HK3A 4A47A 4JYAJ 4UOFA 2HVEA 1Q8KA 4X2BA 1NLKL 2IC3B 2DGXA 1WC5A 3L7PA 2N3OA 1HI8A 1VJQA 2WW4A 3DLEA 3UDCA 2UXBJ 2FJDB 1FX4A 4U8VA 1WNEA 4EFAC 3IXQA 1Q7LB 1CJVA 4UW2A 5IQQA 4DV5J 1N32F 3WIUA 4DQIA 1BQMB 3RYLA 3MM9A 2XS5A 3BKFA 2V8VA 3FSXA 2DNLA 2L9WA 2OSRA 4ANEA 4PQUA 3PACA 3DOKA 2VD3A 3PVXA 2C28A 1IBKJ 5KG6A 3P3DA 2OD4A 2N4CA 3M9OB 2OPPA 5J2NA 4F4ZA 2X1BA 1UPMB 2FHKA 1JK9B 3TA1A 1VQ8S 1HMVA 2JDJA 3PYDA 4IDKA 4KRWA 3SFUA 1HBOA 1NHKL 2HBZB 4WFYA 2OPRB 4JI5F 3HHLD 2H54B 4CO1A 2GC8A 5F8LA 1RWKB 3OL8A 1F5AA 2HLUA 1FKPA 2KN4A 1F60B 4LFCJ 1BQXA 3CEDA 1T9WA 5DQHA 3F0NA 2MKCA 3BH7B 4PPDA 4L3KA 2MQQA 2AZ3A 2OMLA 2I38A 1PC5A 5E3CA 4DV4F 4ILRA 3GFHA 4NI2B 4NYOA 6FDRA 3DOMB 1UVLA 1RAHB 2V63A 3CJTA 4PXEA 1P9QC 3PO5A 2WBRA 4RO0A 1RWXB 4U7UK 3QAUA 3M2RB 1KR4A 3GLJA 3IA0A 2QMXA 2RQKA 3CDEA 4LSZB 4OHZA 3V6JA 4A8FA 1S6QA 1VRTB 1FI4A 1MU2B 2AMCB 2OGUA 3M30A 4UQTA 2YH1A 2BW7A 1X7VA 2BBEA 2OPQA 3HFVA 5DDQC 4WYLA 1OQ3A 3DDKA 4QIVA 4X4SA 2GIQA 3RR8A 2VBXA 3NS6A 2BDPA 1DTTA 2GO8A 2GIRA 1X4EA 4YR3A 4QU6A 2CPXA 3QIDA 1APSA 2MPUA 3W7BA 5I3QA 3OV7A 1FHTA 5HL7Q 1HWUA 1BY9A 2OP5A 3CJSA 4J9VA 2EBEA 1C1CB 4G1QB 1RWUA 4TQRA 1GXLA 2MQMA 4LRCA 4CH7A 2DB1A 4HR2A 2HFOA 3T1HF 4ATNA 4RJVA 4OX9F 2AGQA 4MK7A 2BABA 5KG5A 4ZJLA 5IM0B 2IAJB 3HZEA 3Q24A 1FE0A 2MJNA 5FDLB 2FVPA 5L1JA 2XB2D 2J9DA 2VL1A 4CTAB 3DRRB 3MURP 3A3PB 1O8BA 1QAXA 2VODA 4WFNQ 3H5YA 2ALZA 5FDLA 2R42A 3G9CA 3P6YC 1SH3A 1R8HA 3QAEA 3LH2S 3EZOA 4WE1A 4B9UA 1YJUA 1IKXA 2GGPB 4FDFA 1NK6A 3TVZA 4HLBA 3TYTA 4MAKA 4O3OA 4LFCF 2RUSA 5CYMA 1FCAA 3VVUA 5B09A 5DQIA 3BGUA 4ETXA 3U1MA 1Y9OA 5CZVA 1NEEA 1VBZA 1GH8A 2QLXA 1UPPA 1QE1B 4F3MA 1CQNA 4FPIA 2VFVA 1S76D 2CPEA 1WC1A 3OTBA 3CCLS 2FHJD 4M5IA 3SSQA 4C2MA 3D9BA 4DQRA 1Q81T 3QZ7A 1WJ9A 3HXMA 3OXGA 5FIIA 5LSOA 1RKIA 1YRTA 3KFWX 3NG8A 5EX0A 2EK6A 4L72B 3MD3A 4RW7A 2FY8A 5LMNJ 1RAEB 3AHPA 1BD6A 3MM6A 2FC8A 3SFGA 2A3JA 2UUAJ 3QT6A 3FZ2A 3HSDA 3JSMB 2VG6B 4LT6A 2ZHAA 4DSEA 1F5BA 3ELHA 1X0PA 3R2DJ 2XSFA 1PCAA 1SIWB 1TL4A 3DHWC 4YB6A 4X64J 1MLAA 1V5VA 4KAIA 5E3RA 5DGBA 2XMVA 4XIUA 2XCAA 1S1UA 4KGMA 3W60A 3M8PA 5BYQA 4Y2MA 1G7CB 2CJXB 3OJSA 3D7SB 4A8XA 1F5CA 3M6WA 4NLOA 3H2VE 5ADZA 3C14B 3QJPA 2DY1A 1YG0A 4DV3F 4RLEA 1KP6A 3OLAA 2A18A 1RAAB 2P6TA 2QRRA 4Q8EA 3ILJA 5LJ5Y 3NNHA 3JTPA 2F40A 4OX8A 1TL3A 4OJ3A 4QWEA 2HHXA 1NUEA 1N5SA 3M6VA 3UCZP 5A6PA 3AODA 1YGYA 3RRHA 2FVRA 3KLGA 3SQOP 2DEJA 3PEJA 4CLUA 1VQ5S 2R7OA 4MFBB 2V67A 3A8EA 4Y2AA 1EETA 1X4AA 3R3TA 4WP9A 1VQMS 2VV5A 2B9XA 1C4CA 3DDIA 2QYGA 4IG0B 4OZ3A 4XPCA 2O1PA 2LQ9A 4M5DB 3IRXA 3OR2B 4RWWA 2WVFA 2DR5A 1GMUA 2RIJA 4ZIVA 1N56A 4HTJA 4M5NA 3V81B 3CJ3A 3EE3A 4FVMA 4CLSA 3H2LA 3F41A 3ZZUA 4LFAF 1H0HB 2K3IA 2HAIA 2IJNA 1GTHA 4RX6A 5KFHA 2W9AA 3T1YF 3R6LB 3CMES 3HJVA 3PW4A 5GAEI 3C15A 4NXNJ 1R27B 2CNOB 2JH3A 2CADA 3P5BP 4ED0A 4Z2XA 4MKBA 2ADBA 2AX1A 3GFYA 1RWOB 3HJFA 2DJWA 1OY8A 2MQPA 4DSJA 2E5LF 2UUAF 9RUBA 1U1LA 2FGOA 2DNKA 1VK3A 2YY3A 1RT7B 4P75A 5HSPA 2IPOB 1C1CA 1GFWB 1EQ0A 2BKNA 4HI2A 3H20A 4NLDA 4LF5F 1U1NA 4OYWA 4ZVUB 3RZAA 3UPFA 3PFEA 4W92B 3W9JA 7FDRA 2R8JA 3ZNUA 3KLFA 4PPZA 1A6LA 3P45B 1EB0A 1DRZA 5F8JA 3QSYB 2W2OP 2WCXA 3KLGB 1TKTA 2OTLS 1F9EB 2JWNA 2RILA 3QT8A 3M2UB 1RT2A 1O0PA 1FTRA 4OIXA 2DGUA 4C97A 1S9GB 5KOXA 2LEBA 4C8LA 1D3WA 5E2QA 1GQEA 3MR6A 4TXSA 4WWSA 5I3UB 3I0SA 2D3UA 1T02A 1LWCA 4TU7A 5L1LA 2DIUA 4K4TA 4PAAA 2LXIA 1S9EB 2C2KB 4O23A 1XN9A 1H2VZ 5J1PA 4DN0A 3CD6S 1RK8A 3FUYA 5KG1A 4DPWA 3PR4A 3K17A 1KTVA 4GKKF 3L7OA 1IKWA 2H5JB 3GSIA 2GMJA 3NXZA 2VG5A 2RU3A 3KHHA 2V9WA 3ILOA 1X4BA 4ZDNA 4RW4B 2VIHA 2KI2A 5A8KB 4DR2J 3FFIB 4JOUA 4DI6A 4OZJA 4WK1A 1RXOB 3K2YA 5KFDA 4QR2A 3H5SA 2J0SD 4I2PB 3NS7B 1RDRA 2DXFA 5KFYA 5HMZA 2XS7A 1VISA 3LPYA 4JV0A 3H5XA 1WI8A 1RT5B 1FJEB 2EFPA 1SBRA 1TELA 2Y1RI 4GVBB 4F4WA 3OBIA 4RW8A 4YB5A 2WONB 3EWGA 4JV5J 2HHWA 1WKJA 4NRUA 4ED2A 5A8RA 3QO9A 1KLMB 3BR9A 4DR1F 2E9TA 1M1HA 3DRRA 4HI1A 5HBMB 3J7AN 4IYQA 4DCJB 2W4PA 1X9SA 2G2OA 3MD1A 1IBLF 3FEZA 3MMJA 2ZZMA 2B6AA 3Q86A 2IRYA 3S1TA 3WC0A 2MLZA 5KFRA 3VAHA 1B0TA 2K1RB 2J6UA 5CCLA 5IWAJ 5AXLA 4DV0F 1DHMA 1LWEA 3MM5A 3EVWA 2CAJA 2RAQA 1D9FA 3KMSA 2OIHA 3AA8A 4MKAA 2HHHJ 3W5ZA 1JLCA 2KU7A 3DFEA 4DEZA 4ZVGA 1D9AA 3MAHA 4QWCA 2NYHA 3GJRB 2DXDA 2ZHOA 4CZCA 3G2XA 3K5PA 2MKKA 2HGMA 3N5BA 4I7FA 5C25B 2BA9A 2IAJA 2FJEB 2R2SA 2DRAA 1U26A 4FN5A 3TUPA 4OZ2A 3WX8A 1IWAA 5ETQA 3ENAA 2Z58B 3VVTA 4S0MA 2QL9B 3RAMA 3ZTSA 4OHYA 1BWEA 4LF8J 1N48A 2WB1D 2QLJB 5DM7Q 5IQ6A 5BJRA 3G4SS 1T9XA 2RQCA 5JVGQ 4K4SA 3TW0A 4I2QB 3MECB 3NBPB 1X31C 3OFEA 2N82B 4JI3F 1BQNB 1OWXA 3CD7A 3J7YU 4K4ZA 2XLIA 3VF0B 4C11A 3HF5A 2PMWA 2B43A 2ACMA 3MR3A 1HQEB 3BPDA 4OYMA 4B3TF 1U0HA 1WEXA 4JI1J 1VQ4S 2W2PP 3MEDB 4ZVRB 3I56S 1IBCB 1TKDA 4LRAA 4LFBF 1S12A 4ECSA 1T9UA 1Q78A 3U7JA 4NMLA 2P2CB 2XMAA 1JJ2R 4DUYJ 2AJ4A 3NMRA 4F3QA 1LFWA 3ZO7A 4DPXA 3CIZA 5EWFA 2RDJA 2HWTA 1DAXA 1YJRA 2B6AB 1TKXA 5E33A 4DR1J 4JI0J 4BDPA 2C2MB 4K5RA 5KTQA 1OS5A 4LQ9A 2K1RA 4JB8B 1FKOA 4WYWA 5GAGU 1RHUB 4ZVPB 5F9NA 1AROP 5MLCV 2HNYA 4CT8A 2WVDA 2AT1B 1JLBA 4NL5A 4DV1J 3KLFB 2HRTA 2PFDA 3AB2B 1MNEA 2XGQA 5ETNA 5DJBA 4KHPJ 2LLZA 1N5QA 2Z2ZA 5DS7A 4LVOP 4AXJA 2Z4PA 1YK9A 2W9CB 3NOGA 3Q83A 5HK4A 1D9DA 2CA9A 1ROFA 2UVWA 1B70B 3FCVA 3CJQA 3MR5A 1IBKF 1NK4A 2CFXA 3CW2C 1J27A 3DRPA 1RHQB 1B3TA 4OZ1A 4Z7YA 1DQAA 1NDLA 2ZH6A 3THVA 1I1GA 1FD8A 3FMWA 3C6TB 3BKUA 2M7SA 3HVWA 4R0JA 3I5CA 1AZSB 5BYSA 1Y3KA 3SI8A 2HFSA 2E5GA 2C22A 1FJGJ 3TVKA 4I68A 1NH8A 2KT5A 4K0KJ 2V0NA 2V5HG 1CJTA 1LQ9A 1U7LA 5E3PA 2HGNA 1EETB 2GGPA 1U1PA 4L6V3 1U49A 4EZ9A 3PTWA 1VQNS 2YNIA 1U2CA 4HHUA 5DG9A 1JX4A 1UCNA 2KJVA 3IAM9 3TQ1A 5T41A 2OEKA 2GAHC 1JXVA 4QIEA 4DR3F 4G65A 1HBOB 3JQMA 4E98A 2LEAA 2XYHB 3O1LA 1XR7A 2PMHA 4Z37A 4DUZJ 3RR7A 4ZHRA 2JC1A 1X4CA 2R2UA 1TU0B 2VDIA 1NAQA 2E1MC 1ZM2A 3FSIA 1RT1A 1YDLA 2JVOA 2XM3A 3MUVP 4YB7A 4JI0F 4DL4A 4IQXA 2WSFC 4YQWA 1HHTP 1S1UB 4USJC 2X1AA 3M1VA 4USVA 1CBKA 2MEWA 2QV6A 3NWRA 2P9GA 3H8YA 2ATLA 2RKIB 4AUKA 5K14B 3DMJB 2E1CA 1KNZA 1X5OA 1SCJB 2VICA 3TAQA 3KJVB 3KHRA 4DV1F 5D4PA 5G0RB 2VA3A 2M8DB 1F0XA 2RSQA 3MPWA 3T1HJ 3L3CA 1VQLS 3N6LA 1F9FA 3T5LA 4GVLA 3OFHA 5D4OA 4OMFG 4QJVA 1EHWA 2CJBA 2YQ1A 3GR0A 3NWGA 4NLWA 2J0QD 2BJ3A 4TQSA 1JLQA 1RAGB 2M0GB 2POKA 3RBZA 3KUGA 4A46A 3R1HA 3PV8A 3DGPB 2V2VA 8RUCA 3NMAA 4N76A 3S7RA 4UOGA 3H5UA 1KSPA 1OY6A 1GEHA 2GHPA 3OR2A 1R8AA 3BDPA 2PO4A 3CCVS 2KL8A 1SKSA 1U6ZA 5M2RA 1S0VA 3AJ1A 1Y5NB 4G1PA 4WXWA 3K0JA 1SL2A 4OHVA 5IT0A 1FDDA 3NP5A 5IZHA 2F8MA 2MKSA 1O51A 5SUHA 3FCWA 1SKUB 2DGWA 1Q53A 3VGVA 2MLYA 2RE1A 2ASLA 2XNQA 3NBPA 3TOQA 4IR9A 5D15A 3GJQB 4FXWA 2BJ8A 3TX0A 2DR9A 4AE5A 4RL1A 3L4BC 1IJFB 3ETOA 4Q43A 5KFMA 1S1WA 2E29A 1TAQA 4UF4A 4UOHA 2NXCA 2OHDA 1JNZB 3LP0B 3MM9B 4F3OA 2R3VA 4C9DA 4B02A 4JI8J 2XWYA 4RW9A 2UXDF 5H9FK 4YEAA 2HLTA 1YJNS 4DG1B 2MSTA 3D66A 5F8HA 2JNJA 4HT7A 3CCRS 2ZJQQ 4K8RA 4B3MF 1R0CB 3ICLA 3CMAS 1Q8IA 1UFWA 2K2PA 2ZZTA 1U6FA 2AYEA 2ZUAA 3BZQA 2M88A 1UETA 2EFGA 2Q3PA 2QMWA 4WP8A 4DPTA 3MTKA 5L9NA 2HZVA 2EPIA 3QIPB 4P2FA 4AYBD 4DV3J 2CPZA 4IO9Q 2H65B 4ED6A 4ECTA 2XG8A 4NEZA 1OYEA 1T9TA 5HJXA 1YI2S 1N33J 5FJ4A 1PJ6A 4CH1A 5HQMA 3HSJA 1CC8A 1WORA 4EBEA 2HMIB 2QA2A 1M0SA 5M2PA 2J6SA 4AQYJ 3BBCA 1LWXA 4CLTA 2CKWA 1VQOS 3HVTA 1EAYC 5A2QU 3LP2B 2CQCA 2CQ1A 5CYMB 1RTDA 1MU2A 1WELA 2QGFB 2VG5B 1FEEA 4LSLA 3TEGA 5JUMA 3ZTPA 1H2TZ 2NZCA 4ZK7M 4DL5A 1XC9A 1NKEA 5KFZA 3FSYA 4IO1A 4ES3A 1K0VA 3RW6A 2WVCA 3QRQA 2M3DA 2V68A 3GV7B 1LXJA 2HRUA 2JZ5A 3C6UA 1OY9A 2EK1A 1M5SA 3M05A 2H51B 3IR7B 4KGKA 4MIWA 1UEUA 3FEXB 5K20B 1IKVB 3TRGA 3J80U 2LCWA 5F0UA 4DU8A 1SPBP 2RRBA 3IS9A 1PAUB 4KV8A 1FWLA 3MCSA 1ZA2B 1ZS6A 1QD1A 1HWKA 4O0NA 3HHLB 1ICEB 4K4UA 3MEEA 4OFZA 4F26A 4B17A 2N4DA 4UT4A 3PJ9A 4OV6A 2QN6B 5THWA 3ZZPA 4LSNB 1C0TB 4P73A 3K5OA 4KQZA 4RZRA 5A2QY 4RU2A 2ZZNA 2NSBA 3H42A 2HHTA 2UXDJ 2O5DA 3C3LA 5DZ7A 2F65A 2WZ1A 2Y9HA 4K59A 1R89A 3H98A 5G0RA 1N34J 3KLHB 1SI9A 3TA2A 5HAOA 3M1VB 1RU1A 4X84A 1VDHA 1BQMA 2BYCA 4CI0B 4M94A 1TUVA 2FUG9 1HNXJ 3KLHA 4FZVA 4QPXA 4M5MA 5DDRC 2ZC4A 2DNQA 2M4MA 3D5MA 3W61A 4Z7CA 3MCMA 2AJQA 3K8VA 2A1BA 4B9NA 2C3UA 2PGCA 1S9FA 2OH2A 3NNCA 3UN5A 1TK5A 4QIGA 1HI0P 3DGVA 3NLCA 3CWJA 1HNZJ 2XMMA 5LM7E 3Q23A 1QSLA 3KK1A 3F44A 4YN3B 3Q8UA 3NCQA 5H9FJ 1CLFA 3Q8YA 1RYRA 4ZPCA 1IR2A 3MMBB 2ZH2A 2RVJA 1QAYA 1RQ0A 1TUGB 1NO8A 3O3LA 2DVIA 2OO4A 1FWPA 4DWIA 1MMNA 4ZP6A 2D69A 4ZPDA 1UEKA 4GC7A 3LUYA 3TANA 1A7GE 2R8GA 4XPEA 2Z30B 4D3HA 3IO1A 3BSNA 1IQTA 2D7SA 3W8GA 4PQAA 1RB0A 3GIRA 1YSJA 2V4JB 2VQFJ 2V8HA 3D2WA 1HQ2A 2Q66A 1YKWA 2ZVIA 1MWZA 4QIFA 3CCMS 3MCNA 2DNOA 4H4OA 2KM8B 5LSRA 2JEJA 1PKUA 2MKYA 4Q45A 4ZP7A 4M5GA 5ETVA 1UJ6A 2P5VA 4K4YA 1VQSA 2C2OB 2HS0A 2VFRA 5D4NA 5B0AA 3MMAA 4FS2A 4IFVA 4B3RJ 2B3TB 1JLBB 4ZVQB 4ZOSA 5J2PA 1M1GA 2AP6A 2CJAA 4CLYA 3MMAB 4TVAB 2E66A 2GA7A 1Y4ZB 5HMXA 1MN9A 3JSMA 4WPAA 4OYXA 1F2GA 5F3ZA 2GV1A 5HMWA 3N9UC 1DURA 1SUQA 3LQVA 3DMJA 1WHWA 3M32B 2BJEA 1C0TA 4PG6A 4OI6A 1C1BB 2HHHF 1SV5B 2W7OA 4ECXA 1I94F 1SQFA 2HNZB 3FBBA 1VJWA 2DGOA 2MZRA 3C66A 4UZBA 4DFKA 2U1AA 1AB8A 1CULB 4MH8A 1XMOJ 1WEYA 1CJKA 2FDNA 4CRJA 5KFPA 3PRBA 5DDOC 3J81j 5GAEU 3D6TB 1AUDA 1HNWF 3ITHB 1TFYA 2DR8A 4ITSA 2YWHA 3VAJA 1HBUA 5T14A 2QFJA 2LA6A 2MTLA 3Q2SC 1FDBA 1KOHA 4NI2A 1NSQA 3V4MA 1JJHA 3SV3A 4ED8A 4RW4A 2BX6A 1HLWA 3E2EA 1WTBA 3R5JB 1Q8BA 2XMJA 4L74A 3MUTP 1S0OA 2VBWA 3BH6B 3PHTA 4USHA 4RUBA 1REVA 2MQOA 2QA4S 3SV4A 4C8YA 2DO0A 4ZCIA 1HMVB 4WK3A 4MKVA 2R9LA 1RI7A 4LIWA 5DZ6A 4ZVOB 3SQGB 3VTIA 3PKYA 3H40A 2VQFF 2BE2B 1ZTTA 1FA0A 4X4OA 1DQ9A 1QTMA 4UUWA 5T7LA 3QGPA 4A48A 3FMBA 3DYAA 2FJVA 4LMZA 2I2YA 2G1HA 3A13A 2VHGA 4DCOB 1X4DA 2UUCJ 4GKJJ 2HQGA 1P9YA 1E6YA 1X4FA 2KYZA 2OEJA 3DLGA 1QY7A 4YHHF 3BJYA 4DX5A 4G1QA 1RABB 2ZHBA 1H3DA 1Q0NA 2KRBA 2RQMA 1RAFB 1VQPS 5L38A 1Y10A 2FZKB 2J7WA 2YPYA 3ZZRA 4FYDA 2AWZA 1UJ5A 4CO3A 3PX4A 1AW0A 3CJKB 3N0VA 1XBWA 5CD4A 4IQMA 4HH1A 3SDEB 2CJQA 4ZPTR 5K14A 3HLUA 3J7Z5 1SIZA 3PO4A 4KHPF 2FZCB 2Q6BA 1J5EJ 1QAIA 2BJDA 4K4VA 3BO2A 5IV4A 3CCTA 1QVFR 1FRXA 3SCIE 1TTHB 2AGOA 3MHYA 2XSJB 2QLFB 3OSPA 2WVBA 2NLWA 3M2VB 2VZ9A 2D3OR 3OT9A 1K47A 4QR0A 3RTVA 3DOLA 1YBAA 4NLTA 4ECQA 1NPRA 1S1TB 3I96A 4N41A 3EJMA 3Q8SB 1HNWJ 3VGSA 3MPVA 3G82B 1NCLA 1LW0A 1E6VB 3DM2B 4KHRA 2E5JA 4JI6J 4FBTA 4LUBA 4WIIA 4ALZA 5JMNA 4IUFA 2KM8C 1U0SA 4CT9A 2YBVA 1PIEA 1RP5A 1KONA 2HQDA 2JSXA 3NGRA 4C11B 1RZMA 2Z2LA 5FLXU 4X4TA 1FKPB 4YDDB 4KKOB 1UW9A 3CPWR 3JS9A 1GK8A 1S0NA 2F4VJ 2GVDB 1CJKB 1DARA 3KKFA 3NGSA 1UFKA 1F3VA 3FRYA 1KQFB 4QOTA 4H4KC 1NK9A 1L3SA 5KFBA 4WCEQ 3UNGC 1SJQA 2X51A 3EM1A 3HHEA 3GCXP 3MR2A 4IOCQ 2H9ZA 2QSFA 4KFBA 4OHWA 1LKZA 3AXKA 3B4MA 4YHHJ 1FRLA 2B4VA 2DNGA 3NGTA 2B8QA 4C3KA 2F9DA 1M5HA 3KDNA 5EWGA 5AXMA 3BO3A 1S4EA 2V8GA 1JLFA 1SKWA 4OYZA 2ZDPA 2FPHX 2B4UA 3WX4A 4LRDA 5DLGA 3GQCA 2YNHB 3QT5A 1XNQJ 2UXBF 1J5OA 2GQQA 4URSA 3PY8A 1KN6A 2IJRA 1PYOB 3MM7A 4WF9Q 3IWNC 4DV7F 2I5JB 1JIHA 3M8WA 4WFAQ 3R6GB 3HT3A 3OJUA 4ZIWA 4JI2J 3MXHP 4Y2IA 1N8RT 5KG0A 1HKAA 1MW7A 4JV1A 3VZHA 3KLEA 4O3QA 4KGZB 4RNOA 4ECYA 2P9EA 2MXYA 3EPIA 5DLFA 2XY5A 2JRSA 3GMGA 4H4MB 1SH2A 1LK7A 3BYPA 2CQ3A 2VJVA 3FVYA 4CO5A 3V2UC 3SDEA 2EI5A 1O6XA 1H2UX 5CYQA 5D0GA 3D6HB 4JBCA 3EPGA 1RCOB 3G87A 4WKRA 4RNHA 4DV6F 3AFGA 4WZQA 1C0UA 2ZNZA 1YZ7A 4IRKA 4EU0A 1W2IA 1W25A 3TJ9A 3DRXA 2RHQB 3DI6A 1LW2B 1UJ4A 4NEYA 4B9VA 1IKWB 1T94A 1VC5A 1ZOTA 2HHUA 3FBEA 2BE9B 1YBTA 1PJ5A 3M8QB 4RBUA 2KVQE 2BKOA 4URQU 4CLKA 4ES1A 2JLEA 5LMUJ 2Q79A 1U1MA 1T3NA 3ZFVA 2C3MA 4GKJF 1ITPA 1EX8A 5F8NA 2M8HA 2GO9A 4TY8A 2C2EA 4P2XA 4J91A 4QR1A 5C24B 3V5RA 1TL1A 4ZCMA 1FRJA 1TL5A 3PG9A 2FIUA 1RUSA 1Z1ZA 4JI8F 1CS4A 4G3IA 3O44A 2KJWA 1FX2A 3AY0A 1T9YA 3BN7A 3Q8PB 3BPSP 4NCGB 4NLPA 3FJ2A 3M8PB 3CT9A 2FD2A 5HJYA 3AD7C 4C8OA 5DO2A 4RNNA 1YZ6A 2GQCA 4ZCLA 4FVCA 4P72A 3W2WA 3ZZZA 3KWMA 5D78A 5F8IA 1SL1A 1KDNA 1LXNA 1KWMA 3SEOA 1FNMA 3NKYA 4YB1P 4OX9J 3T9NA 1WI6A 4B3OA 2L9DA 5CZXA 1OJ4A 3FZBA 2EW9A 1JKHA 3M2VA 4JP8A 4H4MA 4KY3A 2HGLA 2YNFA 2DIVA 4KGXB 4LJMA 4DCPB 2EKYA 4DL3A 2BQ3A 2W9BB 8ATCB 1KTQA 1JLEA 3HSGA 2FB0A 2BW2A 4NYPA 3NOCA 5E3AA 4J9PA 4ECVA 2Y1JA 6AT1B 5IT9U 1DJ0A 1RHMB 3MM7B 1UEVA 3BB5A 1NNDA 1WD6A 1G6BA 1RWWB 1S1XB 3D0HE 1NB7A 2DNYA 4I6WA 1XTZA 5KT7A 2IDEA 4ELTA 2A2DA 3H4BA 1LWFA 3I82A 4ZA1A 2AU0A 4I1TA 4HKQA 1AUSL 1S49A 2NXJA 4TU8A 5IV3A 1H98A 3TJAA 2DPIA 2QA4G 3V6KA 1BLUA 3FBFA 4O4RA 1IKXB 2I0XA 2VFTA 1RBAA 2Q43A 3CDBA 2DH7A 2HBRB 2NXUA 4C98A 3JAMY 3TWZA 2MMYA 3MWBA 5KFCA 2KDOA 4QQBA 4LSNA 5D0HA 4O3NA 1Q82T 5KFTA 1HNVB 3CD0A 3CC2S 3ISZA 4F4YA 2F9JA 4K5SA 1KD1T 3ISND 2NZ4A 5C7PA 3MEGB 5AJ3F 4O3RA 1UVNA 4CM0A 1K73T 1FTCA 1GXUA 4URGA 2HAFA 3UDLA 2HNYB 4MT1A 2P9CA 3DRYA 3CC7S 3IGNA 3LWMA 2WVEA 2VC0A 2DY9A 1N34F 4YMEA 4ZLLA 3R1LA 2PI4A 1YBUA 5KT3A 4UQGA 2DCLA 3TA0A 4LF9F 1F9HA 2PD1A 2ASYA 3IN5A 2E44A 1PYSB 3CMQA 3UR3C 1URRA 2RS8A 3BGRA 1JLEB 4WFBQ 2D9PA 1RAJA 4YR2A 3QO9B 2AHOB 1OPZA 4ED4A 4ZKAA 4DF8A 2FHOB 3HULA 3EMTA 2CDQA 2LU2A 3UDVA 2VU5A 4IRDA 3MFIA 2HPUA 3CJ8A 2DISA 2YH0A 4V19J 3MEKA 5ETPA 4PYDA 1L3KA 1UW4A 3BGLA 5I42A 4IOAQ 3JSBA 2KKHA 3CDUA 2DD8S 3OQ2A 4MTPA 4I2QA 4XK8C 4BC7A 2ZJPQ 1R6VA 4DLEA 2C2DA 3LGHA 5KFSA 3VAIA 1UWBB 3UDEA 3CJ2A 3I4PA 2B9YA 4EZ6A 3NNAA 4Q44A 4PXDA 2MKIA 1VI7A 4OHXA 3B78A 1YIJS 4WXOA 4NASA 3AB4B 5ETOA 1G3OA 3BGOP 1NK5A 3TZZA 1P1TA 5K8OA 2BVZA 2CVIA 2QC3A 2F7VA 2KG0A 1DY3A 4C8NA 1N36J 1EP4A 3CF5Q 5IS2A 4O4GA 1VYAA 3JB9k 3M9NB 4NE9C 4TY8B 1S7IA 1QDUB 1T3OA 1ULRA 2QLWA 3MEEB 1HPZB 2CG4A 4AL5A 4QYZK 4IFVB 4X4VA 1X5SA 2FJBB 2A6MA 1RHJB 2QYCA 1RT5A 3KUEA 2GVDA 2CVEA 5IT4A 2I9SA 1HPZA 2C42A 4X66J 4CLWA 3X1LB 2EFQA 1HA1A 2GJ2A 4FP9A 3SCJE 2AX0A 1RKJA 2HQCA 2VONA 3N6NA 1KS2A 3OXLA 1S6UA 3CCJS 2XEXA 5EUHA 3M8RA 2HK2A 4GC6A 2ZITA 3AOBA 4HTIA 4HEA9 5E0OA 2XZWA 3RBDA 2GJFA 1SH0A 1VBYA 2F3JA 5HQLA 3R8YA 2HIYA 4LF5J 2RDIA 3KOAA 2CWXA 2HNDA 5GMDA 3DLEB 3J81U 3I31A 3NS5A 1VQKS 5AE1A 1L3VA 2F5GA 1RTDB 2O67A 3HO1A 3ZZYA 2JC0A 3LP1A 3CC4S 1UMJA 2XO6A 1BMQB 2R7QA 1TK8A 3U27A 2E1RA 2NSCA 3I5BA 4JUZA 2ZM6F 4BHQA 2XY6A 4PWDB 2YXLA 4OJGA 4RWXA 1FJ7A 2UV8A 3GJSB 5B0BA 5KFQA 1SJFA 1S1TA 1AA1B 3UFCX 4B3OB 2DHGA 4L73A 3G6VA 1F1BB 1Q79A 3I5AA 2CUYA 2ZH5A 3KK1B 4PWDA 2HURA 5BR8F 4TNOA 4F0KA 2HW3A 4Y00A 2DH8A 1ACMB 4C48A 5B0FA 5KT5A 1GAOA 2LDYA 3MM8A 1Q4RA 2H5IB 4NZ6A 1HR0F 4YY3F 1GXTA 2J0XA 4GKKJ 2RNEA 4NWBA 4KJIA 1UZDA 3CO9A 4HVZA 4DXLA 3UCUP 4PRFA 1MROB 1FNOA 4ZN3A 1XK8A 5EX3A 5DETA 3OL7A 4IG0A 1YJ9S 1CC7A 1EARA 2UUWA 5U47A 1IUJA 2HKEA 1JLAA 1Q1KA 2DGVA 5ETSA 1S1VB 1TV6B 4DZDA 3G8SA 1XERA 1S1WB 1S4FA 4ZMMA 3UI3A 1VQ6S 1S99A 1E6YB 3GB0A 1B4SA 4B9TA 1TV6A 2ROEA 4A8YA 3ENQA 2KZMA 2PSZA 3IS9B 3M8SA 4K50A 1K1SA 1A9NB 2MKHA 1WC3A 2ROGA 3DLKA 4K2XA 1I6JA 3M8ZA 1KQGB 1XQIA 2KXHA 4C3MA 3J7A1 1NPKA 3T9ZA 4N5SA 1R0AB 1DTQA 5ETRA 3GIKA 3RAXA 1SJ3P 7FD1A 4V1Ak 3SSSA 2XCPA 4Y6IA 2G0IA 3G71S 2E1AA 1IKYA 3D3BJ 3C2PA 5GMKa 4A8WA 4P6QA 1N32J 4W4MA 3CCQS 3LTOA 2X3DA 2XULA 5ETLA 4EWTA 4BWMA 2JVRA 3MTJA 3V6HA 3C16B 3O5TB 1K9MT 3JYTB 2GIFA 5DRKA 3CO0P 3FQKA 4M63A 1WDDA 2RF2B 4CO4A 3G82A 3BDEA 3CDAA 3H59A 3KJFB 3PJWA 3LGNA 1C1BA 4MIBA 4ETZA 1TKTB 4F4AA 5C2CA 2EFVA 4H54A 4U95A 2CPDA 1HQEA 2DCUB 2IMOA 2R4FA 1H72C 3GP9A 3IWLA 4KSEB 2DTJA 2F1FA 2V50A 1B99A 4L76A 5B08A 1U1OA 4AFFA 4ZVFA 3D68A 2ADCA 1KOOA 2IM2A 1KQKA 3Q2TC 5A8KA 2YQ0A 3TJ8A 3C46A 3UD5A 2ZBPA 2PI5A 1F3FA 3H4DA 1HIYA 4GRSA 1VHFA 2X7IA 2COLA 2HFNA 3BBFA 1D1UA 2YVSA 4DV4J 2KYXA 2R7VA 2C2RA 1FD2A 1U1QA 4D3GA 3O8WA 2NXNA 3D6MB 3FEYB 4C0HA 4ELUA 1N5YA 3DYAB 3R7NB 5HP1A 1ZBTA 4B3TJ 3PM9A 4JI1F 3DLKB 1D0EA 1TVRA 5CD4H 1TL1B 4I6AA 4O4GB 1VOMA 2V8DA 2FGCA 4OZLA 2RU9A 4FXVA 4B9SA 1UVKA 2XZDB 3R5BA 5GAHU 3DLHA 2OKQA 3QGHA 2KHDA 3WBZA 1FF2A 2V4JA 3R5GA 7AT1B 4A8KA 4PEOA 2KFNA 2K8GA 1PGZA 4CLLA 3CCES 1QSYA 2GNKA 4RW8B 3P5TL 3RB3A 3QFHA 4X4UA 3V81A 1Q8LA 2ZEJA 3OL9A 1JXEA 4KKOA 1FXRA 2QL5B 3J7YI 1XNQF 1CJVB 3KMQA 2N7CA 3P4UB 1WACA 2LQBA 2BKPA 2Z57B 1YJTA 1QUVA 5CHCB 1SQGA 1NZAA 2XMKA 2XGPA 2ZJRQ 1RWNB 3GWCA 3R27A 4FYXB 3HZGA 4HYKA 1T03B 1IBMF 2D9OA 1YJVA 1KC8T 2RRNA 3GFXA 3MMCA 2G2YA 1FDAA 2MSSA 2QFIA 3KG0A 4ZVHA 4K4WA 4DFMA 4OV1A 5GVQA 3DOLB 4OYAA 1Q7YT 4NLGA 2HS4A 1S9EA 2DITA 5B7WA 4E8UA 5HMYA 3A3NB 1M5PC 4FF4A 1N52B 2M52A 3M6XA 2XSJA 2YNFB 3GJTB 1VHIA 1YVFA 4J9UE 1IWGA 2XMUA 2CPFA 4OYBA 3SCKE 1T11A 1RT6B 4LBHA 5KFFA 4DPOA 2DRDA 2Y0SD 5LT5A 1FWKA 2EVZA 5MAOA 5J2MB 5LSLA 5EWEA 3H25A 2KG1A 2V4RA 2XYGB 4L75A 4NCAA 1QM9A 3U1LA 1Q5VA 1RWMB 3ILIA 3R5DA 2A6OA 3VWSA 5HQ8A 1NH7A 3J7ZT 3KHLA 4C8ZA 4NLSA 2VG6A 4HHHA 1BWVA 3GIJA 4ANDA 1U2FA 2CWKA 3A12A 4XDDA 4PKDB 2FC9A 2ZKTA 4DPUA 6FD1A 3Q89A 5LMUF 2G0JA 2Q1LA 2V9KA 4E2FB 2NUUG 3OVAA 1URNA 2DNPA 3I6PA 5F8MA 1SC1B 3IR5B 4DL7A 1H7WA 1DBDA 3IMQJ 2XTJP 1U0HB 3OTOJ 2R2RA 2G0CA 3CULA 2OFHX 3RB6A 2LFVA 2YKMB 3T5JA 1HNVA 1JJ4A 3TVYA 3FCHA 5T7LB 3IGVA 1S5ZA 2FLPA 3H2UB 2W4DA 3KHGA 3MCOA 4LF6F 3US5A 2ZH9A 3A8IA 3BR8A 5DQGA 1IKYB 2ZWPA 2YKAA 1NHUA 4I69A 1YJWS 4NXMJ 2XHWA 3QWPA 3S6EA 3UVJB 4F0MA 1M5KC 1IBMJ 1S6PA 1RTJB 1R8BA 2AIRB 2QIFA 2XO7A 1S0MA 4XTTA 2RQ4A 3RB4A 1ZZNA 1HW8A 2IMWP 3IRXB 2ZH3A 4I7FB 1ZTWA 2CQIA 5K5MA 4IDKB 3UR0A 5HO4A 3BM7A 2YPZA 3K8WA 3HK2A 3AH6A 3EGVA 1WOSA 4P10A 2VPWB 3OD2A 2W8KA 1IVZA 2HHQA 1YRUA 2EC0A 1SV5A 1HL6A 3W1YC 2UZAA 3TZWA 2YX1A 2HVZA 2PMZD 1JXLA 1TL3B 4M5KA 4EUVA 3QLHA 4B9MA 1KFDA 2IYIA 2Z2MA 1RYSA 2J0WA 4CLFA 2GMHA 3HM9A 4Y0FA 1R6YA 1X0FA 4J9MA 2L08A 2FVQA 4WU2A 1FK9A 1Y0HA 1NJIT 1KHWA 2KTQA 1CG2A 4PG5A 1S7HA 1RT7A 3PRVA 3SCLE 2OPPB 5KFIA 4CNYA 1SQEA 1NM2A 3Q8QB 3UD4P 1DTQB 2AF6A 2H48B 2X3GA 2JEIA 4FPRA 1NSPA 2AJFE 2MGZA 4J9SA 3T1YJ 2WONA 2M2BA 2ZBQA 5DGAA 1FJCA 1VLYA 1W7WA 2C3PA 4KV8B 1W2BR 2P8IA 2QTWA 2EG1A 4ID8A 4FF1A 5CQGA 3G6XA 2HSEB 2X1FA 5AJ3J 4LR7A 4FF3A 1HARA 1N0VC 3GG1A 2A2CA 3RU0A 4M5JA 4IOBA 3DDNA 1VQ7S 4IH7A 4NYZA 3SMZA 3EDQB 4CDIA 1IM4A 4EYIB 4EYHB 2DHHA 3SSRA 2CZVC 4P7VA 1M5OC 3LP2A 1S59A 3PW2A 2D3ZA 4EEYA 5HLFB 4PG4A 4LF7J 5E7OB 1IXKA 1HQUA 4NLVA 4YUDA 3GIIA 4ICLA 1S97A 2KT3A 1TZ0A 1CULA 3BN4A 4P7TA 2YKMA 4RW6A 5I42B 2DRBA 1DTTB 3NCPA 1QUPA 3W64A 5E5NA 3ZTRA 4F0HA 5KT2A 3T5HA 2MHEA 1WOOA 3QGIA 5ETKA 3A8JA 5D6GA 2A10A 1U2RA 4C6AA 5A76A 2WHOA 4M1KA 2KFZA 3ENVA 3Q8VA 2CRLA 2Z56B 2ALYB 2ZBIA 3DCAA 5E3QA 1ZYQA 3EVOA 2YX4A 2HMIA 3NRBA 3GYGA 3NGUA 1RJJA 1QE1A 5AT1B 1SUQB 2EG2A 4LREA 3KNGA 4R5PB 1U6BA 3JSYA 1KVJA 3MFHA 3WDOA 3OUYB 4AL7A 3L95X 3D0IE 3O6QA 5CH7B 2G13A 1NDPA 2MLXA 2PE8A 5A8WB 3MGJA 2R8HA 1M1KT 1D8YA 4WTOB 1VRUA 1G4CA 3TAPA 1XMQJ 2J9EA 5DDPC 2L3MA 2GZOA 2O66A 3MPUB 1IJEB 2DKOB 2XI3A 1DZ5A 1RT1B 2ILZA 1LOUA 2VG7B 2E9RX 2MZQA 2EFOA 3OVBA 2DNMA 1C4AA 2I1RA 3CCZA 4N8NA 2C3OA 4NRTA 4X65F 2NPFA 5GADU 3MEDA 5AXNA 4XO0A 1SJRA 5IOLA 2WAQD 5HP1B 2JEFA 1ZZFA 2GHVC 3LF0A 1CPZA 2B4OA 1MMDA 1LNQA 3ENWA 1JQGA 1X4GA 2E7VA 3AQOA 3K57A 1TMMA 2CDRB 2DBBA 1H73A 4BCAA 3GONA 3D4JA 3H7HB 3T19A 4X64F 5CXTA 3P8BB 5J1EB 4X66F 3I4HX 4CH0S 2DO4A 3PYEA 4ICLB 1P6TA 4TYBA 3PW7A 3RAQA 3CTRA 2KZZA 1Q16B 4DMZA 1V5IB 3E51A 2CZ9A 5A0YA 3MMBA 3UN2A 4C0BA 1JWWA 1WSRA 3IR6B 4DV0J 5KFLA 2Y1IA 4U7CA 3TI0A 2K3KA 3S01A 1XR6A 3DRPB 2UVRA 2VB6A 4IFYB 3QIPA 4X62F 4CIOA 3PYFA 1VC6A 1UVIA 2J7UA 3ISNC 1NSAA 4LR9A 1ZM3A 4NLYA 3JYTA 2OI2A 5IXUA 1WSVA 3W9HA 2QEXS 4RBTA 3KG1A 1JLCB 4J7CA 4USKA 1TL7A 1Z4UA 4OZ5A 2UV8G 2RRAA 2XNRA 3M9MB 4F4KA 3LP1B 4RUAA 4ERDA 1R8CA 1T95A 1FE4A 2BXJA 4Y3CA 2VFUA 3HX9A 3OR1B 2R8IA 2VBZA 5J2MA 3MI7X 3ILLA 3KK2A 3EGZA 1IM6A 1RTZA 3LANA 1ZM9A 2BRLA 2MQNA 4LFAJ 2CJKA 4DHVA 3UD3P 2W24A 3TAMB 2ATCB 2ZWOA 4NZ0A 1FO1A 1NPPA 3PJXA 5C24A 3H90A 4DQPA 2HVIA 3QGGA 5K8PA 1WHYA 4NXNF 3GPAA 4TLQA 3K89A 1RAIB 4UOCA 3IBFB 2ACYA 3PYGA 4G1IA 1R43A 2EC2A 4HHJA 3N01A 5B0CA 3OVSA 1H38A 2UUBF 3KTQA 1WF0A 4DSKA 1U4BA 3LW5C 2NCKL 2GW8A 2E5LJ 1VS3A 1MG7A 1WTFA 2QZ8A 4H4KA 2IYGA 4PCQA 1UVJA 2M9KA 3LAMA 4R8UA 3FQLA 1PO6A 3MOJB 3AD9C 4N77A 5DM6Q 1N88A 2HFUA 2KXFA 4IH5A 1BXNA 5F0WA 3HHLC 2LYVA 1Y7PA 2ZH1A 1AZSA 3TZXA 4YDXA 2CQ4A 2DNHA 2ZD1A 4Y2CA 1RWPB 4WIQA 1TMJA 2DHSA 2V2KA 1VCTA 4LIRA 5IC6B 4DS4A 2IRUA 2YQ3A 3C19A 3GSDA 1FFGB 3LPEA 2V4QA 1NKBA 2NR0A 3HCXA 2BZ2A 2I8EA 1KRPA 1F2HA 2W2NP 2GX8A 2WW8A 1OYDA 5SZTA 1YLXA 2WSEC 2QE5A 1JLQB 3QRPA 5BXIA 4F50A 1XMOF 4KHMA 2E5HA 1SC3B 2DXEA 3DGPA 2MGZB 4YY3J 1RGVA 3BKTA 3Q8RB 2W9BA 2HVHA 4PXCA 1V3ZA 1NSKL 3GG0A 1NZ8A 1S57A 1YJ7A 2IA6A 4WKYA 5M2UA 2MDAA 4UY85 4RUCA 1YQHA 1WEZA 2J8SA 3W5YA 4O3SA 2F4FA 2Y0BB 2DGSA 3ONQA 4HT5A 3HP6A 4Q0BB 4ED7A 1NRKA 4P71A 4A4JA 3IM9A 4WFXA 2RKIA 4IR1A 3C15B 2BQRA 2ZOFA 3ZXWA 2DH9A 4QWAA 3HT0A 5D3GA 1Z2ZA 1ZAXA 2VF3A 2XS2A 3KDOA 4P2MA 4FBUA 3ZTQA 1PJ7A 2AEJA 2KVIA 3U02A 1ZA1B 4U6PA 1AFIA 4A8QA 2BJ1A 3ZZOA 2VPYB 3DLJA 4DV2F 2CPJA 4O3PA 3W2VB 2BE2A 2X1GA 4Q5VA 2B0GA 3FKBA 2RS2A 3OXFA 4JYAF 1T03A 3VZIA 2B9WA 1SKRA 4TY9A 2LXUA 1WC4A 2Z8QA 1RTHA 1CJUA 1GMWD 2H4YB 2WTFA 2I5JA 3BO4A 1VQYA 3EZ5A 4HACB 1PBUA 3GFZA 1RISA 1AYEA 5KFJA 2LECA 3T3FA 3OW2R 1PSDA 5LXYA 3NCRA 3A8KA 4USMA 1KVIA 3WIVA 2J5AA 4M95A 4TKTA 2LMIA 2IM1A 4RR5A 4M5DA 3IRWP 3E01A 5DG8A 4Q2MA 1Q5YA 2E7XA 1RAOA 2ERRA 1FESA 4MK9A 2W1BA 1WC6A 1PYTA 1XIQA 5I3UA 4WZMA 5L8RC 1UFLA 3C14A 2BRKA 4WE1B 4QCLA 1RWVB 2DGQA 3HVTB 5CABA 5L1KA 3BS9A 4J9QA 4DL6A 2FYXA 2VPXB 1WG4A 2FJAB 1N0UA 2IBKA 2OELA 5GADI 3HHNB 4NLRA 1M5VC 3JQKA 4ZPWR 5EDWA 4LF8F 2OPSA 1U25A 2V6AA 4QW9A 2XLKA 4DR7J 2KT2A 3U1NA 1K44A 1TL7B 4C0OC 5KG4A 4KC5A 3HHKA 4PWWA 3UCGA 3VQTA 3K5MA 1MWQA 2W7PA 2WK4A 2V34A 4N56A 4I56A 2EXUA 3TARA 4OLPA 2ABYA 4IG3B 4USTA 4DG1A 2R7UA 2MQLA 2OPQB 3OUYA 4CLZA 1RA6A 2C2NA 2QLBB 1RU2A 3TUZC 4GVBA 3MEGA 4NA1A 2JEGA 2V2ZA 1HHSA 2W4CA 3VGTA 4EBCA 3MM6B 2R2TA 4ZN1A 4XDCA 1SC6A 4ID5B 4Q2LA 5A0YB 3OLBA 3K59A 5H9EK 3K7RA 1Q86T 3OFGA 1UA0A 2FVCA 2XZTB 1C2PA 4NPOA 3VCDA 2BOPA 1KKHA 2YTCA 1WDTA 3GR1A 2EWHA 3KG4A 3MECA 4XAKA 1BE4A 2Y3YA 2ZC3A 3FDSA 2DHXA 4IFYA 2RF2A 2SXLA 3FNNA 3NAIA 1X8DA 2BANA 3AD8C 4FYWB 4R25A 1NXIA 1Y5IB 2CQPA 1L3TA 2Y8WA 2APOA 2AGPA 3MOZA 4NXMF 1FKAF 4PZVA 4QIWD 4R8UB 4I4BA 3LAKA 3PCOB 1FXLA 4NZ7A 2IA0A 2D74B 2J76E 1TUWA 3DN9A 4J9NA 3BYRA 2MYFA 4JI2F 4DR4J 2GS8A 5D8HB 5D0RA 4ZLJA 4LBIA 3DU5A 3W2VA 1MMLA 3DXBA 3OPKA 4P74A 5L9XA 5F8GA 2KXNB 3MAQA 4EI2A 3D28A 4JV2A 3K5NA 1V6HA 4AQYF 2XWXA 1ZM4A 3D1OA 2QJ3A 4OLOA 1PILA 1U24A 4DF4A 2HWHA 4DZ6A 3C16A 3GU0A 4ANCA 3RW7A 1TVRB 1FK9B 4CYUB 2CJYB 2DEIA 5K8MA 4DR7F 1MN7A 2VH7A 1RTIA 3RBEA 3JTOA 4ES2A 3TUJC 3VQSA 4ZCKA 2J6TA 2HHVA 4J9RA 4CP5A 1KLMA 2DR7A 2FJXA 5KFWA 1WC0A 3EZUA 2W2QP 1RA7A 1RTIB 4CM2A 1NJZA 3ULHA 5AE3A 4ED1A 2B7BB 4V19X 2OTJS 1S6QB 1VRTA 1V9OA 3M30B 3GIMA 3HD2A 4H4OB 4DR3J 2FLNA 2KFYA 1WG5A 4OI3A 2J9CA 2JHEA 4KFBB 4CO2A 3QLHB 4K4XA 1O5JA 4FYYB 2VDHA 1PC4A 8AT1B 5LXRA 4TYAA 4Y34A 4HDHA 2QL7B 4OJHA 4RPFA 3MMCB 3M7VA 1BHNA 4OZNA 5GMEA 2IVFB 1JKHB 5LMNF 3PX0A 2JFKA 2HQIA 2WOMB 3B6BA 3D6FB 1H74A 2HNDB 4A8OA 4P2SA 4OQJA 1XEZA 2FTRA 2YNIB 4O44B 4U7UD 2ZFHA 4M8LA 4PYAA 3KNAA 3B8HA 1HQUB 3AOCA 4ECRA 4OX7A 1HWJA 1I51B 5C42B 3UNYA 1XMQF 1HFEL 4KPYA 2GAGC 2HVDA 4YOEA 2V69A 1LK5A 5J1EA 3EGNA 4HACA 5I4MA 1GMWA 5CA5A 3DKDA 1B0VA 3UVJA 3RB0A 3D54A 3MAAA 2CQGA 5C42A 4DR4F 2DR6A 1WHVA 5K9FA 1SJ1A 4KO0A 2HEKA 2YNGA 3CSKA 1OSDA 3UQSA 3M32A 2HG4A 2KH9A 4ED3A 3NL0A 2KHCA 5F41A 2D3O1 2CQBA 1R3NA 1FXDA 4DFJA 1VC0A 2ZUGA 2UP1A 1X4HA 3EGWB 1NJWA 3O2IA 4L3NA 2AJ2A 2HNZA 3KJVA 4WP3A 3V4IB 1RT4A 2C3YA 1PAEX 2QSWA 3GZ7A 4HH0A 2CQDA 3THTA 3VAMA 2H1YA 3PR5B 1RLDA 1VRUB 3TNVA 3CCUS 2RH3A 1FFSB 4O0IA 2YKOA 1JNRB 1RT4B 2MHNA 1UWBA 3LALA 5J1NA 4F02A 1NHVA 2K06A 1KVKA 1SJ4P 3QRRA 1TKXB 5HVGA 3QZ8A 4F8RA 3BQ2A 1S48A 3THPA 1QJHA 3PEHA 5KFEA 1JMTA 1GX6A 2HFZA 3IBWA 3Q22A 2AYBA 2NQPA 4YP3A 3W8PA 1TQLA 3HHLA 3L09A 1VBKA 5HVFA 1K8AT 1TKZB 3W63A 4LRFA 5A8RB 1KEKA 2OEMA 2AV5A 4X4RA 4X65J 2OJ3A 4NCBA 3ET6A 4M5LA 1H6KX 1AFJA 3I87A 2QT7A 4DFPA 1RSCA 3E01B 2U2FA 4UUXA 3TP2A 2BACA 2WBMA 1EJ7L 2ZE2B 4OX6A 3I9V9 1B0PA 5KFOA 3CD5A 2B8PA 3V6DA 1QVGR 1YTYA 2CZ4A 3TO8A 2CNLB 3HSZA 3MAAB 1DLOA 2O01C 4N7TA 2J7KA 2BANB 4KB7A 5FD1A 3WHIA 5F9LA 1SL0A 4DQSA 2AJ1A 3RGIA 5KFXA 4ZP8A 3D0GE 1D8ZA 3IBCB 1EIYB 1PBAA 4ILLA 2EFNA 1CEZA 1CJUB 1R8PA 3N4WA 3HVRA 3HD1A 2GMLA 3WQPA 2GHWA 1VGYA 3D1QA 1N33F 3R5AA 3JTNA 4BC9A 1ZPWX 2MZTA 2G9OA 1WKLA 2GVZB 4F04B 4X62J 1X9WA 4K2JA 4WJBA 2QG9B 3AXMA 2UXCJ 5HATA 4CLPA 3FGVA 1CSJA 2Z0GA 3JQJA 3G96A 3DLBA 2IIHA 2MKJA 4PQUB 3LA0A 4NLXA 3BQ0A 1VQ9S 1U1KA 1LW2A 4F25A 2A0FB 5I3PA 1IKVA 1ZAVA 1MROA 3BGFA 4Y28C 5L46A 5A8WA 1HNIB 2ZOMA 4CYUA 3SXLA 4J5OA 4Y65A 4KIAA 2B7CB 4F36A 2BV3A 5ITHA 1V3SA 2JL9A 4R5PA 2W8LA 3QPIA 3QWUA 2QX0A 4Q8FA 2LDIA 4DR2F 1VK8A 3HHDA 4QU7A 2E9ZA 2JFDA 3PHEA 4DX8H 2WSCC 4DR5J 2CPIA 4WFZA 2CPYA 1JB0C 4NOHA 1RBLA 4W98A 5KG3A 3LWLA 2V94A 1Y11A 3POTB 1PG5B 2AZ1A 1SXLA 1QAJA 3ADAC 2UVUA 2VC1A 5B0DA 2UUBJ 4RW6B 4JI7F 2AYMA 3BREA 3C6UB 1FT8A 3ZZTA 1AXQA 4OI2A 2GFFA 3W2WB 3GCWP 3FFIA 1U48A 4MMOA 1VMBA 1IBLJ 3PKMA 3IM8A 1LFPA 4QW8A 2R8KA 4LR8A 4X4QA 1RTHB 2D41A 4DUYF 2HYIB 1HNXF 4FNIA 2ZBRA 3UO0A 3G8TA 3I0RB 3QBCA 3KYLA 2HBYB 3RRGA 2FVSA 3GYXB 1X9MA 1HI1A 2ZVSA 1J5EF 1ZETA 1S9GA 3QSIA 1KFSA 2CXEA 3SYZA 4B3SJ 2PDAA 1N5TA 2N7YA 3MUMP 4CWBA 1S1VA 3AJDA 3R2CJ 2NUHA 3SZ2A 3I55S 1FNXH 2C1EB 1B7YB 3PXGa 2KO1A 4Q0BA 4RNFA 2M5YA 4BLGA 5HVHA 1C0UB 3DXSX 3CIMA 4JI6F 3BSOA 3OR1A 4BBYA 1HR0J 5AXKA 3ZTOA 4ECZA 3MZIA 4ZPAA 2B4PA 3N6MA 3R97A 3Q0AA 4PG8A 2YKPA 5CAAA 4JI3J 1E6VA 1XR5A 2LKZA 3DM2A 3ETMA 4PWUA 3OFFA 2YKQA 1UA1A 2BJ7A 3D67A 3W9IA 1NDKA 4GO7X 4I64A 4C3LA 4JI4J 4FF2A 1N5VA 2DHAA 1RT6A 3FC9A 3TZYA 4DR5F 1S1XA 2R7XA 2LP4A 1WKKA 4I2PA 4ZP9A 4U67Q 2MZSA 4LFBJ 3QQCD 2HQ3A 4R0EA 3BSCA 1YHQS 3EXCX 4QWDA 2BUNA 2HHSA 4DV2J 1GX5A 2BM0A 2XMTA 1V3RA 2G1DA 3CUNA 3W3SA 2CJ9A 4K7QA 1RT3B 1HW9A 1FFWB 4BWJA 4FS1A 5HROA 2BQUA 1LEOA 3QMQA 1RTJA 3B4DA 2FY1A 3I0RA 1MSWD 1JLGA 2ASDA 1HD1A 5KFVA 3CJRA 5B0EA 1QTNB 4DOZA 4QYZJ 2JLFA 3PDNA 1VIXA 3RUBL 4LBPA 4DV7J 4GMKA 4DN9A 4O44A 5CYQB 4OYOA 3PIPQ 1T05A 2XMWA 2ZH4A 3IWXA 4J37A 3DOKB 4UTGA 1HBNB 3CJ4A 1IR0A 4DL0C 3K58A 2DPJA 3HPOA 2O3DA 2LU1A 1U1RA 2PT0A 1UVMA 2B5JA 3VGUA 3PZPA 5C25A 4B3MJ 1VRQC 2FLLA 4MFBA 1NK8A 2MY8A 4FKYA 2B5JB 2YNGB 4I0WA 1XNRJ 1RT2B 4U9RA 1K1QA 1HWLA 3AOAA 4X4PA 3NGKA 4U8YA 1S79A 1HD0A 1WOPA 2DK2A 4ZLPA 4DR6J 2M70A 1FJGF 4NX9A 1U02A 1JJCB 2MZJA 5HANA 3WZ0A 5A6WA 3K5LA 4DV6J 1WF1A 4K0KF 1RLCL 1LW0B 3OTCA 3J80Y 1LWFB 2XC9A 5D77A 5GAGI 1MWYA 4F2SA 2B51A 4LRBA 3R7BB 2VBYA 4ZHRB 1TFWA 2B56A 5LL6d 4JV5F 3HFKA 2IM0A 2YWWA 4P52A 4RBVA 5G4DA 1HNZF 4JI4F 2VOPA 1HHQA 3C8YA 5ETMA 4JI7J 4N8OA 2HZAA 1RE1B 3TR5A 5H1SV 4DUZF 2AQ4A 3S8SA 3FRZA 4WBFA 2ROPA 1CQMA 2ZDOA 3VR1A 4CNZA 4KPCA 2W01A 2ZH7A 2DNZA 2UUCF 2LQ8A 2ZOGA 3KLIB 1N6QA 3HDSA 1M90T 2FQQB 2VA2A 1Q95G 4DJBA 4E0DA 5HLFA 4UY8T 2YWFA 3HFZB 3EYZA 3QJLA 4RKUC 3VAGA 3QNWB 4I6YA 3JXOA 3MPDA 4HL9A 2JOQA 3AA9A 3BGRB 3FBCA 5KFKA 2FHJA 2R7WA 3N79A 4N47A 1VIOA 4AL6A 3A4TA 1UZHA 3DRSB 1J5OB 2CNKB 4NA3A 1HBMA 2Z2YB 2AJ0A 2MY7A 2L41A 5GAHI 2KB2A 4OI0A 3AAWB 1FVQA 4B9LA 3I0SB 2W9CA 4WU3A 3PW5A 1NJYA 1S6OA 1UKUA 3ZC4A 3C6TA 3MDFA 3PRDA 4KGVB 5IM0A 1HYSA 4AT1B 3M4XA 2FHMA 1U45A 1OMSA 3M2UA 4PG7A 1GTEA 4ENOA 2V2QA 5D0EA 3W62A 4YS2A 3B82A 3N5FA 4F4XA 1XNRF 1ZH5A 3D1HA 1NDCA 4USWA 2R7RA 3CGIA 2DNNA 2ZBCA 2KRRA 4QPTA 3OL6A 5L1IA 2F8EX 4A8SA 3P49B 2AKWB 1HBUB 4G6VB 4ZVEA 1DQ8A 1REVB 4PABA 3QT7A 4KBIA 4MIAA 3T5KA 5LJ3Y 1ZAWA 2VKRA 4CO0A 2YWKA 3AQPA 3GYNA 2AEFA 4IH6A 4NMXA 4KYZA 3ZNJ1 1L3UA 3KJQB 2RHSB 3LP0A 5J2QA 1H7XA 3VAKA 1NU4A 4OI4A 2PEHA 3TEHB 5C5JA 3I9ZA 3BV8A 2R7TA 3UN3A 3AJ2A 2E7WA 3TQEA 3B54A 4BS2A 2OAUA 3M2RA 2ASJA 3BF4A 1VLOA 2EBGA 2PC6A 4MYTA 5KG2A 3G86A 3BEGB 4PUOB 3LOUA 2K7KA 2VFSA 3ZZ0A 4W90B 1BC6A 2H4WB 3CVKA 5KT6A 2P6SA 2MQ8A 4MK8A 1ZPVA 4DS5A 3T6JA 4LF6J 3CJKA 1OQ6A 3TX8A 4Y2KA 4F67A 4MJKA 1A0OB 3P96A 2BJ9A 4LF9J 1R31A 2DYAA 3W66A 4PR6A 3V6DB 2LQ5A 2ZNYA 5KFAA 3J81Y 3HKWA 2OPSB 2RJZA 5K8NA 2UVVA 2HBQB 4ER8A 1HYSB 1Y5LB 3L9ZA 4WTYA 3M6UA 1B7FA 4KR0B 5L39A 3NAHA 5RUBA 2QMUB 2WRMA 3MR7A 2XQCA 1EKSA 2WOMA 1NK0A 4PXBA 2YKNA 3HKZD 1R7IA 1LWEB 3MM5B 5E41A 4RNMA 1S10A 4RUHA 4ZLNA 2OPRA 5CYJA 3BSAA 2VPZB 2RUGA 1XWLA 2L9NA 3KK3A 4DLGA 1I3OB 2W25A 2IM3A 3SQGA 1KBRA 2CG8A 5BYRA 4ELVA 3BBBA 4CTAA 2YWGA 5J2NB 4ZJQA 2LXFA 3CDWA 1NBEB 3EVMA 3BQ1A 3PFOA 3F56A 3DRSA 4DUTA 3OTDA 3G6ES 2GCFA 1HBMB 2MJUA 2W7AA 2XHCA 4LF2A 3VHQA 4ZPVR 3CCSS 1L5UA 1FRMA 3MM8B 4LQ3A 3G8QA 4LF4F 1RT3A 1EKRA 5HROB 1B64A 1OSCA 1G1XA 2UUTA 4P9SA 3QJJA 3IG1A 2C2ZB 3MPYA 1IN0A 1N36F 2Y1LB 4NLQA 1LV5A 1JLGB 5KG7A 4LF1A 4KE5A 2VQEJ 2IY5B 2OMOA 2OLWA 1R0BG 4ZJOA 3NGDA 1WUUA 2PEBA 2ZH8A 4IRCA 1KHVA 1RCXB 5JVHQ 4YFUA 2H3EB 2HIQA 2B9EA 2JJ4D 2N3LA 3VAFA 5KFGA 1OPIA 2R7SA 2IVMA 3A1YG 1KLNA 2PA8D 4IKAA 4I67A 4GO5X 2CQ2A 3EX7B 5DG7A 2I6WA 2F8HA 1SC4B 3LGMA 2ZD1B 2VOOA 1TAUA 4DQQA 5JJBA 3VALA 1TP7A 2LVWA 5EHHA 2IHR1 1JLFB 1UWAA 2PA3A 5AE2A 1X60A 2HFVA 1F6TA 4NA2A 5J2PB 2XI2A 4LF7F 2WB4A 2BE7D 1FDNA 5LOQA 1CVJA 4EO8A 2ZKUA 3CE8A 1SB6A 1U8SA 2DT9A 2ZM6J 1P1LA 2E5IA 3UWTA 3CXCR 2D1CA 1EZZB 1U09A 4KH1B 4OYIA 3CB4A 2YX7A 2XBPA 4ZPBA 2CYYA 1REGX 5B0GA 1LWCB 2H5EA 1UTAA 1T05B 1JLAB 2FLOA 4DPYA 2G4BA 2UXCF 2RB7A 1RHKB 4F2RA 1SVDA 1Z2LA 1U47A 3AT1B 1YITS 1OO0B 3G6YA 1U8WA 3CNQP 2FJWA 1BUXA 4OYPA 3OTEA 2LA4A 1UL3A 4F7VA 2PN6A 5FLXY 3DI6B 1QLNA 3H0PA 3HVAA 1TR0A 2DGTA 5KOWA 1RBOB 4LSLB 4PUOA 1EP4B 4C8KA 4LF4J 1ELOA 2YWEA 3M8YA 1VR6A 3UE2A 1RHRB 3JSRA 4OJ1A 4EGLA 2HZCA 1T9VA 3NY0A 3POTA 3T41A 4A8MP 1TK0A 4DR6F 4B08A 5EN1A 2VQEF 3OHBA 4J9OA 2VKZG 3ET6B 4RW7B 2LQJA 4OI1A 4ZVTB 1N54B 2GQ2A 3OHAA 3QFWA 1WG1A 5J2QB 2XY7A 1P27B 1N4LA 3EDRB 3FK4A 4J90A 2Y8YA 1OIAA 2IJFA 1DFDA 5CCMA 3QATA 2VASA 3DHXA 1FERA 4DU7A 2W2MP 4ID5A 4TU9A 3KLEB 4CQ1A 4B3RF 2IDLA 2RDDA 1RACB 1W26A 2GJIA 3IG1B 1T0TV 3E3XA 3F73A 2E1PA 1S77D 3CJ0A 2OSQA 2CQHA 2VJUA 3I32A 1BGXT 1FVSA 2J9DE 4DBQA 4NCGA 4RW9B 3N28A 1UAWA 3DU6A 3MF5A 4ECUA 1D09B 2Q6CA 5KT4A 1R0AA 3CCWA 2EKNA 2YNHA 3RJMB 2BR0A 4FNHA 4C8MA 9ATCB 3IAS9 1IQZA 3KUHA 5D4LA 4QWBA 3A3OB 2MB0B 4U96A 3KK3B 1I94J 2CNNB 1FRHA 5ETTA 4B3SF 4J9LA 2HQFA 2L48A 2NYIA 4YR0A 5IT9Y 3KJNB 2YKNB 3PW0A 4TN2A 2QO3A 3M8QA 4KH0B 4ECWA 1N5YB 1YRXA 1J2VA 3IC1A 1Y3JA 5IC4B 3KLVA 2OUGA 3W65A 1S72S 4IG3A 4DSLA 1G2EA 1QSSA 3R7SB 1BQNA 4QZVB 4X4NA 1P8GA 3RG6A 3X3UA 3D3CJ 2AEMA 4EMDA 4USUA 3GV5B 1GT8A 3WC2A 5KAKA 2ZE2A 2BEFA 5HN0A 4AD6A 3JAMU 1XJWB 5HBMA 5F3TA 2IC3A 1NMEB 4DX6A 4M5HA 3OSNA 1DLOB 1VFJA 1YWXA 2UU9J
chains in the Genus database with same CATH topology
4DR5J 4GKJJ 4NXNJ 3IMQJ 3OTOJ 2UUBJ 4YHHJ 4JI0J 4JI8J 4DR1J 4B3RJ 1XNQJ 1IBLJ 4NXMJ 4V1Ak 4DV1J 1IBMJ 3D3BJ 4KHPJ 1N32J 4RJVA 4JI2J 4DV0J 4DV3J 2ZM6J 1N33J 4NEZA 4B3SJ 4AQYJ 1XMOJ 3R2CJ 3W1YC 5BR8J 5A2QU 4JI5J 2MTLA 1HR0J 1FJGJ 4DR7J 4K0KJ 4PWWA 4LF4J 4JI3J 4DR2J 4DV4J 4NEYA 4HHUA 3J80U 1N36J 4LFAJ 1HNZJ 4KYZA 2KVQE 4JI4J 4B3TJ 3T1YJ 5LMUJ 4DUZJ 4LFBJ 4X65J 4DV2J 2UUCJ 5LMNJ 5AJ3J 4JI7J 2E5LJ 2UUAJ 4JYAJ 2UXDJ 3J7AN 4LF6J 2MEWA 2MQ8A 3R2DJ 4X64J 1N34J 4X66J 2UXBJ 4LF5J 4LF9J 3J81U 4DV7J 4DUYJ 1HNXJ 4LF7J 4DV5J 5IWAJ 3T1HJ 4OX9J 4DR4J 1J5EJ 4KY3A 2HHHJ 1I94J 1IBKJ 4X62J 4B3MJ 2UXCJ 4JV5J 5IT9U 5LM7E 4YY3J 1XNRJ 1HNWJ 2KL8A 4LF8J 4JI6J 4DR6J 4GKKJ 4LFCJ 2VQEJ 4DV6J 3D3CJ 5FLXU 3JAMU 1XMQJ 2F4VJ 4DR3J 4JI1J 2VQFJ 2UU9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 J;  4GKJ J;  4NXN J;  3IMQ J;  3OTO J;  2UUB J;  4YHH J;  4JI0 J;  4JI8 J;  4DR1 J;  4B3R J;  1XNQ J;  1IBL J;  4NXM J;  4V1A k;  4DV1 J;  1IBM J;  3D3B J;  4KHP J;  1N32 J;  4RJV A;  4JI2 J;  4DV0 J;  4DV3 J;  2ZM6 J;  1N33 J;  4NEZ A;  4B3S J;  4AQY J;  1XMO J;  3R2C J;  3W1Y C;  5BR8 J;  5A2Q U;  4JI5 J;  2MTL A;  1HR0 J;  1FJG J;  4DR7 J;  4K0K J;  4PWW A;  4LF4 J;  4JI3 J;  4DR2 J;  4DV4 J;  4NEY A;  4HHU A;  3J80 U;  1N36 J;  4LFA J;  1HNZ J;  4KYZ A;  2KVQ E;  4JI4 J;  4B3T J;  3T1Y J;  5LMU J;  4DUZ J;  4LFB J;  4X65 J;  4DV2 J;  2UUC J;  5LMN J;  5AJ3 J;  4JI7 J;  2E5L J;  2UUA J;  4JYA J;  2UXD J;  3J7A N;  4LF6 J;  2MEW A;  2MQ8 A;  3R2D J;  4X64 J;  1N34 J;  4X66 J;  2UXB J;  4LF5 J;  4LF9 J;  3J81 U;  4DV7 J;  4DUY J;  1HNX J;  4LF7 J;  4DV5 J;  5IWA J;  3T1H J;  4OX9 J;  4DR4 J;  1J5E J;  4KY3 A;  2HHH J;  1I94 J;  1IBK J;  4X62 J;  4B3M J;  2UXC J;  4JV5 J;  5IT9 U;  5LM7 E;  4YY3 J;  1XNR J;  1HNW J;  2KL8 A;  4LF8 J;  4JI6 J;  4DR6 J;  4GKK J;  4LFC J;  2VQE J;  4DV6 J;  3D3C J;  5FLX U;  3JAM U;  1XMQ J;  2F4V J;  4DR3 J;  4JI1 J;  2VQF J;  2UU9 J; 
#chains in the Genus database with same CATH topology
 2PII A;  4EO6 A;  5KFN A;  4MKY A;  4UZC A;  3NEK A;  2NXE A;  5KFU A;  1T8E A;  2HHP A;  1N6Q B;  1KQS R;  2HWI A;  3EUN A;  1WF2 A;  1X5P A;  3EIC A;  3TAM A;  2VG7 A;  1X5T A;  2CQ0 A;  2DNR A;  1HWI A;  1EQM A;  2NRE A;  4Q7A A;  1YX2 A;  2CPH A;  1UP1 A;  4DL2 A;  2V8P A;  3SBM A;  3R9L A;  4ZIT A;  2RD5 C;  2IBO A;  2OFG X;  2AD9 A;  3KXD A;  2OD6 A;  5HI7 A;  3IP0 A;  2HS3 A;  1S6P B;  4NLU A;  4TLR A;  1AT1 B;  3TUI C;  2CIM A;  4HDG A;  4USI A;  4ZS6 A;  4FXD A;  1FKO B;  3IFE A;  1CS4 B;  4ZVS B;  2BMB A;  2NPI A;  3HI9 A;  3SIP B;  4QBU A;  1RAD B;  2IRX A;  2LEP A;  4DV5 F;  5IWA F;  3EXY A;  1HNI A;  2K7J A;  2MZ1 A;  1NKC A;  3DNC A;  3DLG B;  2AYG A;  4DSI A;  3DLL Q;  2FZG B;  1WHX A;  1I5O B;  2BM1 A;  2IFX A;  4KO0 B;  3T6B A;  4C7Q A;  3V4I A;  2QA1 A;  3E8O A;  2G2Z A;  5H9E J;  2EEY A;  1FRK A;  3GE9 A;  2XYP B;  4MYU A;  3L7U A;  4DDF A;  4J9K A;  3QYY A;  5BR8 J;  3W5X A;  3GV8 B;  2GVZ A;  4JI5 J;  4ILM A;  1NJX A;  2HRY A;  4RU9 A;  3VV2 B;  1CJT B;  3CJ5 A;  4OZ0 A;  4DSF A;  4LVN P;  2VUG A;  3KK2 B;  3GTY X;  3ITH A;  4KTQ A;  1HBN A;  3UW1 A;  4EBD A;  3LO3 A;  4CCH A;  4OL8 A;  1NB2 A;  2BOA A;  2F63 A;  4QYR A;  4DX7 A;  1NK7 A;  2PFF B;  2NS1 B;  5EGY A;  2JLG A;  4AXI A;  3PIO Q;  5JXS A;  1K0T A;  1GMV A;  2F4V F;  4ED5 A;  2RT3 A;  2J8A A;  4FYV B;  1VBX A;  2RML A;  3T1A A;  2UU9 F;  4FKX A;  3DC2 A;  1XMB A;  3R5C A;  3PX6 A;  1FRI A;  2IVY A;  3KLI A;  2JX2 A;  3GIL A;  4EK2 A;  2AW0 A;  2XLJ A;  3DOM A;  2ILY A;  3PNI A;  1IR1 A;  3RRK A;  4C4W A;  1FEH A;  5C2G A;  3RBX A;  3OTO F;  1TKZ A;  1GNK A;  1Y00 A;  1WWH A;  3HMJ G;  5D3G B;  5IFM A;  1T7P A;  4KT0 C;  2HK3 A;  4A47 A;  4JYA J;  4UOF A;  2HVE A;  1Q8K A;  4X2B A;  1NLK L;  2IC3 B;  2DGX A;  1WC5 A;  3L7P A;  2N3O A;  1HI8 A;  1VJQ A;  2WW4 A;  3DLE A;  3UDC A;  2UXB J;  2FJD B;  1FX4 A;  4U8V A;  1WNE A;  4EFA C;  3IXQ A;  1Q7L B;  1CJV A;  4UW2 A;  5IQQ A;  4DV5 J;  1N32 F;  3WIU A;  4DQI A;  1BQM B;  3RYL A;  3MM9 A;  2XS5 A;  3BKF A;  2V8V A;  3FSX A;  2DNL A;  2L9W A;  2OSR A;  4ANE A;  4PQU A;  3PAC A;  3DOK A;  2VD3 A;  3PVX A;  2C28 A;  1IBK J;  5KG6 A;  3P3D A;  2OD4 A;  2N4C A;  3M9O B;  2OPP A;  5J2N A;  4F4Z A;  2X1B A;  1UPM B;  2FHK A;  1JK9 B;  3TA1 A;  1VQ8 S;  1HMV A;  2JDJ A;  3PYD A;  4IDK A;  4KRW A;  3SFU A;  1HBO A;  1NHK L;  2HBZ B;  4WFY A;  2OPR B;  4JI5 F;  3HHL D;  2H54 B;  4CO1 A;  2GC8 A;  5F8L A;  1RWK B;  3OL8 A;  1F5A A;  2HLU A;  1FKP A;  2KN4 A;  1F60 B;  4LFC J;  1BQX A;  3CED A;  1T9W A;  5DQH A;  3F0N A;  2MKC A;  3BH7 B;  4PPD A;  4L3K A;  2MQQ A;  2AZ3 A;  2OML A;  2I38 A;  1PC5 A;  5E3C A;  4DV4 F;  4ILR A;  3GFH A;  4NI2 B;  4NYO A;  6FDR A;  3DOM B;  1UVL A;  1RAH B;  2V63 A;  3CJT A;  4PXE A;  1P9Q C;  3PO5 A;  2WBR A;  4RO0 A;  1RWX B;  4U7U K;  3QAU A;  3M2R B;  1KR4 A;  3GLJ A;  3IA0 A;  2QMX A;  2RQK A;  3CDE A;  4LSZ B;  4OHZ A;  3V6J A;  4A8F A;  1S6Q A;  1VRT B;  1FI4 A;  1MU2 B;  2AMC B;  2OGU A;  3M30 A;  4UQT A;  2YH1 A;  2BW7 A;  1X7V A;  2BBE A;  2OPQ A;  3HFV A;  5DDQ C;  4WYL A;  1OQ3 A;  3DDK A;  4QIV A;  4X4S A;  2GIQ A;  3RR8 A;  2VBX A;  3NS6 A;  2BDP A;  1DTT A;  2GO8 A;  2GIR A;  1X4E A;  4YR3 A;  4QU6 A;  2CPX A;  3QID A;  1APS A;  2MPU A;  3W7B A;  5I3Q A;  3OV7 A;  1FHT A;  5HL7 Q;  1HWU A;  1BY9 A;  2OP5 A;  3CJS A;  4J9V A;  2EBE A;  1C1C B;  4G1Q B;  1RWU A;  4TQR A;  1GXL A;  2MQM A;  4LRC A;  4CH7 A;  2DB1 A;  4HR2 A;  2HFO A;  3T1H F;  4ATN A;  4RJV A;  4OX9 F;  2AGQ A;  4MK7 A;  2BAB A;  5KG5 A;  4ZJL A;  5IM0 B;  2IAJ B;  3HZE A;  3Q24 A;  1FE0 A;  2MJN A;  5FDL B;  2FVP A;  5L1J A;  2XB2 D;  2J9D A;  2VL1 A;  4CTA B;  3DRR B;  3MUR P;  3A3P B;  1O8B A;  1QAX A;  2VOD A;  4WFN Q;  3H5Y A;  2ALZ A;  5FDL A;  2R42 A;  3G9C A;  3P6Y C;  1SH3 A;  1R8H A;  3QAE A;  3LH2 S;  3EZO A;  4WE1 A;  4B9U A;  1YJU A;  1IKX A;  2GGP B;  4FDF A;  1NK6 A;  3TVZ A;  4HLB A;  3TYT A;  4MAK A;  4O3O A;  4LFC F;  2RUS A;  5CYM A;  1FCA A;  3VVU A;  5B09 A;  5DQI A;  3BGU A;  4ETX A;  3U1M A;  1Y9O A;  5CZV A;  1NEE A;  1VBZ A;  1GH8 A;  2QLX A;  1UPP A;  1QE1 B;  4F3M A;  1CQN A;  4FPI A;  2VFV A;  1S76 D;  2CPE A;  1WC1 A;  3OTB A;  3CCL S;  2FHJ D;  4M5I A;  3SSQ A;  4C2M A;  3D9B A;  4DQR A;  1Q81 T;  3QZ7 A;  1WJ9 A;  3HXM A;  3OXG A;  5FII A;  5LSO A;  1RKI A;  1YRT A;  3KFW X;  3NG8 A;  5EX0 A;  2EK6 A;  4L72 B;  3MD3 A;  4RW7 A;  2FY8 A;  5LMN J;  1RAE B;  3AHP A;  1BD6 A;  3MM6 A;  2FC8 A;  3SFG A;  2A3J A;  2UUA J;  3QT6 A;  3FZ2 A;  3HSD A;  3JSM B;  2VG6 B;  4LT6 A;  2ZHA A;  4DSE A;  1F5B A;  3ELH A;  1X0P A;  3R2D J;  2XSF A;  1PCA A;  1SIW B;  1TL4 A;  3DHW C;  4YB6 A;  4X64 J;  1MLA A;  1V5V A;  4KAI A;  5E3R A;  5DGB A;  2XMV A;  4XIU A;  2XCA A;  1S1U A;  4KGM A;  3W60 A;  3M8P A;  5BYQ A;  4Y2M A;  1G7C B;  2CJX B;  3OJS A;  3D7S B;  4A8X A;  1F5C A;  3M6W A;  4NLO A;  3H2V E;  5ADZ A;  3C14 B;  3QJP A;  2DY1 A;  1YG0 A;  4DV3 F;  4RLE A;  1KP6 A;  3OLA A;  2A18 A;  1RAA B;  2P6T A;  2QRR A;  4Q8E A;  3ILJ A;  5LJ5 Y;  3NNH A;  3JTP A;  2F40 A;  4OX8 A;  1TL3 A;  4OJ3 A;  4QWE A;  2HHX A;  1NUE A;  1N5S A;  3M6V A;  3UCZ P;  5A6P A;  3AOD A;  1YGY A;  3RRH A;  2FVR A;  3KLG A;  3SQO P;  2DEJ A;  3PEJ A;  4CLU A;  1VQ5 S;  2R7O A;  4MFB B;  2V67 A;  3A8E A;  4Y2A A;  1EET A;  1X4A A;  3R3T A;  4WP9 A;  1VQM S;  2VV5 A;  2B9X A;  1C4C A;  3DDI A;  2QYG A;  4IG0 B;  4OZ3 A;  4XPC A;  2O1P A;  2LQ9 A;  4M5D B;  3IRX A;  3OR2 B;  4RWW A;  2WVF A;  2DR5 A;  1GMU A;  2RIJ A;  4ZIV A;  1N56 A;  4HTJ A;  4M5N A;  3V81 B;  3CJ3 A;  3EE3 A;  4FVM A;  4CLS A;  3H2L A;  3F41 A;  3ZZU A;  4LFA F;  1H0H B;  2K3I A;  2HAI A;  2IJN A;  1GTH A;  4RX6 A;  5KFH A;  2W9A A;  3T1Y F;  3R6L B;  3CME S;  3HJV A;  3PW4 A;  5GAE I;  3C15 A;  4NXN J;  1R27 B;  2CNO B;  2JH3 A;  2CAD A;  3P5B P;  4ED0 A;  4Z2X A;  4MKB A;  2ADB A;  2AX1 A;  3GFY A;  1RWO B;  3HJF A;  2DJW A;  1OY8 A;  2MQP A;  4DSJ A;  2E5L F;  2UUA F;  9RUB A;  1U1L A;  2FGO A;  2DNK A;  1VK3 A;  2YY3 A;  1RT7 B;  4P75 A;  5HSP A;  2IPO B;  1C1C A;  1GFW B;  1EQ0 A;  2BKN A;  4HI2 A;  3H20 A;  4NLD A;  4LF5 F;  1U1N A;  4OYW A;  4ZVU B;  3RZA A;  3UPF A;  3PFE A;  4W92 B;  3W9J A;  7FDR A;  2R8J A;  3ZNU A;  3KLF A;  4PPZ A;  1A6L A;  3P45 B;  1EB0 A;  1DRZ A;  5F8J A;  3QSY B;  2W2O P;  2WCX A;  3KLG B;  1TKT A;  2OTL S;  1F9E B;  2JWN A;  2RIL A;  3QT8 A;  3M2U B;  1RT2 A;  1O0P A;  1FTR A;  4OIX A;  2DGU A;  4C97 A;  1S9G B;  5KOX A;  2LEB A;  4C8L A;  1D3W A;  5E2Q A;  1GQE A;  3MR6 A;  4TXS A;  4WWS A;  5I3U B;  3I0S A;  2D3U A;  1T02 A;  1LWC A;  4TU7 A;  5L1L A;  2DIU A;  4K4T A;  4PAA A;  2LXI A;  1S9E B;  2C2K B;  4O23 A;  1XN9 A;  1H2V Z;  5J1P A;  4DN0 A;  3CD6 S;  1RK8 A;  3FUY A;  5KG1 A;  4DPW A;  3PR4 A;  3K17 A;  1KTV A;  4GKK F;  3L7O A;  1IKW A;  2H5J B;  3GSI A;  2GMJ A;  3NXZ A;  2VG5 A;  2RU3 A;  3KHH A;  2V9W A;  3ILO A;  1X4B A;  4ZDN A;  4RW4 B;  2VIH A;  2KI2 A;  5A8K B;  4DR2 J;  3FFI B;  4JOU A;  4DI6 A;  4OZJ A;  4WK1 A;  1RXO B;  3K2Y A;  5KFD A;  4QR2 A;  3H5S A;  2J0S D;  4I2P B;  3NS7 B;  1RDR A;  2DXF A;  5KFY A;  5HMZ A;  2XS7 A;  1VIS A;  3LPY A;  4JV0 A;  3H5X A;  1WI8 A;  1RT5 B;  1FJE B;  2EFP A;  1SBR A;  1TEL A;  2Y1R I;  4GVB B;  4F4W A;  3OBI A;  4RW8 A;  4YB5 A;  2WON B;  3EWG A;  4JV5 J;  2HHW A;  1WKJ A;  4NRU A;  4ED2 A;  5A8R A;  3QO9 A;  1KLM B;  3BR9 A;  4DR1 F;  2E9T A;  1M1H A;  3DRR A;  4HI1 A;  5HBM B;  3J7A N;  4IYQ A;  4DCJ B;  2W4P A;  1X9S A;  2G2O A;  3MD1 A;  1IBL F;  3FEZ A;  3MMJ A;  2ZZM A;  2B6A A;  3Q86 A;  2IRY A;  3S1T A;  3WC0 A;  2MLZ A;  5KFR A;  3VAH A;  1B0T A;  2K1R B;  2J6U A;  5CCL A;  5IWA J;  5AXL A;  4DV0 F;  1DHM A;  1LWE A;  3MM5 A;  3EVW A;  2CAJ A;  2RAQ A;  1D9F A;  3KMS A;  2OIH A;  3AA8 A;  4MKA A;  2HHH J;  3W5Z A;  1JLC A;  2KU7 A;  3DFE A;  4DEZ A;  4ZVG A;  1D9A A;  3MAH A;  4QWC A;  2NYH A;  3GJR B;  2DXD A;  2ZHO A;  4CZC A;  3G2X A;  3K5P A;  2MKK A;  2HGM A;  3N5B A;  4I7F A;  5C25 B;  2BA9 A;  2IAJ A;  2FJE B;  2R2S A;  2DRA A;  1U26 A;  4FN5 A;  3TUP A;  4OZ2 A;  3WX8 A;  1IWA A;  5ETQ A;  3ENA A;  2Z58 B;  3VVT A;  4S0M A;  2QL9 B;  3RAM A;  3ZTS A;  4OHY A;  1BWE A;  4LF8 J;  1N48 A;  2WB1 D;  2QLJ B;  5DM7 Q;  5IQ6 A;  5BJR A;  3G4S S;  1T9X A;  2RQC A;  5JVG Q;  4K4S A;  3TW0 A;  4I2Q B;  3MEC B;  3NBP B;  1X31 C;  3OFE A;  2N82 B;  4JI3 F;  1BQN B;  1OWX A;  3CD7 A;  3J7Y U;  4K4Z A;  2XLI A;  3VF0 B;  4C11 A;  3HF5 A;  2PMW A;  2B43 A;  2ACM A;  3MR3 A;  1HQE B;  3BPD A;  4OYM A;  4B3T F;  1U0H A;  1WEX A;  4JI1 J;  1VQ4 S;  2W2P P;  3MED B;  4ZVR B;  3I56 S;  1IBC B;  1TKD A;  4LRA A;  4LFB F;  1S12 A;  4ECS A;  1T9U A;  1Q78 A;  3U7J A;  4NML A;  2P2C B;  2XMA A;  1JJ2 R;  4DUY J;  2AJ4 A;  3NMR A;  4F3Q A;  1LFW A;  3ZO7 A;  4DPX A;  3CIZ A;  5EWF A;  2RDJ A;  2HWT A;  1DAX A;  1YJR A;  2B6A B;  1TKX A;  5E33 A;  4DR1 J;  4JI0 J;  4BDP A;  2C2M B;  4K5R A;  5KTQ A;  1OS5 A;  4LQ9 A;  2K1R A;  4JB8 B;  1FKO A;  4WYW A;  5GAG U;  1RHU B;  4ZVP B;  5F9N A;  1ARO P;  5MLC V;  2HNY A;  4CT8 A;  2WVD A;  2AT1 B;  1JLB A;  4NL5 A;  4DV1 J;  3KLF B;  2HRT A;  2PFD A;  3AB2 B;  1MNE A;  2XGQ A;  5ETN A;  5DJB A;  4KHP J;  2LLZ A;  1N5Q A;  2Z2Z A;  5DS7 A;  4LVO P;  4AXJ A;  2Z4P A;  1YK9 A;  2W9C B;  3NOG A;  3Q83 A;  5HK4 A;  1D9D A;  2CA9 A;  1ROF A;  2UVW A;  1B70 B;  3FCV A;  3CJQ A;  3MR5 A;  1IBK F;  1NK4 A;  2CFX A;  3CW2 C;  1J27 A;  3DRP A;  1RHQ B;  1B3T A;  4OZ1 A;  4Z7Y A;  1DQA A;  1NDL A;  2ZH6 A;  3THV A;  1I1G A;  1FD8 A;  3FMW A;  3C6T B;  3BKU A;  2M7S A;  3HVW A;  4R0J A;  3I5C A;  1AZS B;  5BYS A;  1Y3K A;  3SI8 A;  2HFS A;  2E5G A;  2C22 A;  1FJG J;  3TVK A;  4I68 A;  1NH8 A;  2KT5 A;  4K0K J;  2V0N A;  2V5H G;  1CJT A;  1LQ9 A;  1U7L A;  5E3P A;  2HGN A;  1EET B;  2GGP A;  1U1P A;  4L6V 3;  1U49 A;  4EZ9 A;  3PTW A;  1VQN S;  2YNI A;  1U2C A;  4HHU A;  5DG9 A;  1JX4 A;  1UCN A;  2KJV A;  3IAM 9;  3TQ1 A;  5T41 A;  2OEK A;  2GAH C;  1JXV A;  4QIE A;  4DR3 F;  4G65 A;  1HBO B;  3JQM A;  4E98 A;  2LEA A;  2XYH B;  3O1L A;  1XR7 A;  2PMH A;  4Z37 A;  4DUZ J;  3RR7 A;  4ZHR A;  2JC1 A;  1X4C A;  2R2U A;  1TU0 B;  2VDI A;  1NAQ A;  2E1M C;  1ZM2 A;  3FSI A;  1RT1 A;  1YDL A;  2JVO A;  2XM3 A;  3MUV P;  4YB7 A;  4JI0 F;  4DL4 A;  4IQX A;  2WSF C;  4YQW A;  1HHT P;  1S1U B;  4USJ C;  2X1A A;  3M1V A;  4USV A;  1CBK A;  2MEW A;  2QV6 A;  3NWR A;  2P9G A;  3H8Y A;  2ATL A;  2RKI B;  4AUK A;  5K14 B;  3DMJ B;  2E1C A;  1KNZ A;  1X5O A;  1SCJ B;  2VIC A;  3TAQ A;  3KJV B;  3KHR A;  4DV1 F;  5D4P A;  5G0R B;  2VA3 A;  2M8D B;  1F0X A;  2RSQ A;  3MPW A;  3T1H J;  3L3C A;  1VQL S;  3N6L A;  1F9F A;  3T5L A;  4GVL A;  3OFH A;  5D4O A;  4OMF G;  4QJV A;  1EHW A;  2CJB A;  2YQ1 A;  3GR0 A;  3NWG A;  4NLW A;  2J0Q D;  2BJ3 A;  4TQS A;  1JLQ A;  1RAG B;  2M0G B;  2POK A;  3RBZ A;  3KUG A;  4A46 A;  3R1H A;  3PV8 A;  3DGP B;  2V2V A;  8RUC A;  3NMA A;  4N76 A;  3S7R A;  4UOG A;  3H5U A;  1KSP A;  1OY6 A;  1GEH A;  2GHP A;  3OR2 A;  1R8A A;  3BDP A;  2PO4 A;  3CCV S;  2KL8 A;  1SKS A;  1U6Z A;  5M2R A;  1S0V A;  3AJ1 A;  1Y5N B;  4G1P A;  4WXW A;  3K0J A;  1SL2 A;  4OHV A;  5IT0 A;  1FDD A;  3NP5 A;  5IZH A;  2F8M A;  2MKS A;  1O51 A;  5SUH A;  3FCW A;  1SKU B;  2DGW A;  1Q53 A;  3VGV A;  2MLY A;  2RE1 A;  2ASL A;  2XNQ A;  3NBP A;  3TOQ A;  4IR9 A;  5D15 A;  3GJQ B;  4FXW A;  2BJ8 A;  3TX0 A;  2DR9 A;  4AE5 A;  4RL1 A;  3L4B C;  1IJF B;  3ETO A;  4Q43 A;  5KFM A;  1S1W A;  2E29 A;  1TAQ A;  4UF4 A;  4UOH A;  2NXC A;  2OHD A;  1JNZ B;  3LP0 B;  3MM9 B;  4F3O A;  2R3V A;  4C9D A;  4B02 A;  4JI8 J;  2XWY A;  4RW9 A;  2UXD F;  5H9F K;  4YEA A;  2HLT A;  1YJN S;  4DG1 B;  2MST A;  3D66 A;  5F8H A;  2JNJ A;  4HT7 A;  3CCR S;  2ZJQ Q;  4K8R A;  4B3M F;  1R0C B;  3ICL A;  3CMA S;  1Q8I A;  1UFW A;  2K2P A;  2ZZT A;  1U6F A;  2AYE A;  2ZUA A;  3BZQ A;  2M88 A;  1UET A;  2EFG A;  2Q3P A;  2QMW A;  4WP8 A;  4DPT A;  3MTK A;  5L9N A;  2HZV A;  2EPI A;  3QIP B;  4P2F A;  4AYB D;  4DV3 J;  2CPZ A;  4IO9 Q;  2H65 B;  4ED6 A;  4ECT A;  2XG8 A;  4NEZ A;  1OYE A;  1T9T A;  5HJX A;  1YI2 S;  1N33 J;  5FJ4 A;  1PJ6 A;  4CH1 A;  5HQM A;  3HSJ A;  1CC8 A;  1WOR A;  4EBE A;  2HMI B;  2QA2 A;  1M0S A;  5M2P A;  2J6S A;  4AQY J;  3BBC A;  1LWX A;  4CLT A;  2CKW A;  1VQO S;  3HVT A;  1EAY C;  5A2Q U;  3LP2 B;  2CQC A;  2CQ1 A;  5CYM B;  1RTD A;  1MU2 A;  1WEL A;  2QGF B;  2VG5 B;  1FEE A;  4LSL A;  3TEG A;  5JUM A;  3ZTP A;  1H2T Z;  2NZC A;  4ZK7 M;  4DL5 A;  1XC9 A;  1NKE A;  5KFZ A;  3FSY A;  4IO1 A;  4ES3 A;  1K0V A;  3RW6 A;  2WVC A;  3QRQ A;  2M3D A;  2V68 A;  3GV7 B;  1LXJ A;  2HRU A;  2JZ5 A;  3C6U A;  1OY9 A;  2EK1 A;  1M5S A;  3M05 A;  2H51 B;  3IR7 B;  4KGK A;  4MIW A;  1UEU A;  3FEX B;  5K20 B;  1IKV B;  3TRG A;  3J80 U;  2LCW A;  5F0U A;  4DU8 A;  1SPB P;  2RRB A;  3IS9 A;  1PAU B;  4KV8 A;  1FWL A;  3MCS A;  1ZA2 B;  1ZS6 A;  1QD1 A;  1HWK A;  4O0N A;  3HHL B;  1ICE B;  4K4U A;  3MEE A;  4OFZ A;  4F26 A;  4B17 A;  2N4D A;  4UT4 A;  3PJ9 A;  4OV6 A;  2QN6 B;  5THW A;  3ZZP A;  4LSN B;  1C0T B;  4P73 A;  3K5O A;  4KQZ A;  4RZR A;  5A2Q Y;  4RU2 A;  2ZZN A;  2NSB A;  3H42 A;  2HHT A;  2UXD J;  2O5D A;  3C3L A;  5DZ7 A;  2F65 A;  2WZ1 A;  2Y9H A;  4K59 A;  1R89 A;  3H98 A;  5G0R A;  1N34 J;  3KLH B;  1SI9 A;  3TA2 A;  5HAO A;  3M1V B;  1RU1 A;  4X84 A;  1VDH A;  1BQM A;  2BYC A;  4CI0 B;  4M94 A;  1TUV A;  2FUG 9;  1HNX J;  3KLH A;  4FZV A;  4QPX A;  4M5M A;  5DDR C;  2ZC4 A;  2DNQ A;  2M4M A;  3D5M A;  3W61 A;  4Z7C A;  3MCM A;  2AJQ A;  3K8V A;  2A1B A;  4B9N A;  2C3U A;  2PGC A;  1S9F A;  2OH2 A;  3NNC A;  3UN5 A;  1TK5 A;  4QIG A;  1HI0 P;  3DGV A;  3NLC A;  3CWJ A;  1HNZ J;  2XMM A;  5LM7 E;  3Q23 A;  1QSL A;  3KK1 A;  3F44 A;  4YN3 B;  3Q8U A;  3NCQ A;  5H9F J;  1CLF A;  3Q8Y A;  1RYR A;  4ZPC A;  1IR2 A;  3MMB B;  2ZH2 A;  2RVJ A;  1QAY A;  1RQ0 A;  1TUG B;  1NO8 A;  3O3L A;  2DVI A;  2OO4 A;  1FWP A;  4DWI A;  1MMN A;  4ZP6 A;  2D69 A;  4ZPD A;  1UEK A;  4GC7 A;  3LUY A;  3TAN A;  1A7G E;  2R8G A;  4XPE A;  2Z30 B;  4D3H A;  3IO1 A;  3BSN A;  1IQT A;  2D7S A;  3W8G A;  4PQA A;  1RB0 A;  3GIR A;  1YSJ A;  2V4J B;  2VQF J;  2V8H A;  3D2W A;  1HQ2 A;  2Q66 A;  1YKW A;  2ZVI A;  1MWZ A;  4QIF A;  3CCM S;  3MCN A;  2DNO A;  4H4O A;  2KM8 B;  5LSR A;  2JEJ A;  1PKU A;  2MKY A;  4Q45 A;  4ZP7 A;  4M5G A;  5ETV A;  1UJ6 A;  2P5V A;  4K4Y A;  1VQS A;  2C2O B;  2HS0 A;  2VFR A;  5D4N A;  5B0A A;  3MMA A;  4FS2 A;  4IFV A;  4B3R J;  2B3T B;  1JLB B;  4ZVQ B;  4ZOS A;  5J2P A;  1M1G A;  2AP6 A;  2CJA A;  4CLY A;  3MMA B;  4TVA B;  2E66 A;  2GA7 A;  1Y4Z B;  5HMX A;  1MN9 A;  3JSM A;  4WPA A;  4OYX A;  1F2G A;  5F3Z A;  2GV1 A;  5HMW A;  3N9U C;  1DUR A;  1SUQ A;  3LQV A;  3DMJ A;  1WHW A;  3M32 B;  2BJE A;  1C0T A;  4PG6 A;  4OI6 A;  1C1B B;  2HHH F;  1SV5 B;  2W7O A;  4ECX A;  1I94 F;  1SQF A;  2HNZ B;  3FBB A;  1VJW A;  2DGO A;  2MZR A;  3C66 A;  4UZB A;  4DFK A;  2U1A A;  1AB8 A;  1CUL B;  4MH8 A;  1XMO J;  1WEY A;  1CJK A;  2FDN A;  4CRJ A;  5KFP A;  3PRB A;  5DDO C;  3J81 j;  5GAE U;  3D6T B;  1AUD A;  1HNW F;  3ITH B;  1TFY A;  2DR8 A;  4ITS A;  2YWH A;  3VAJ A;  1HBU A;  5T14 A;  2QFJ A;  2LA6 A;  2MTL A;  3Q2S C;  1FDB A;  1KOH A;  4NI2 A;  1NSQ A;  3V4M A;  1JJH A;  3SV3 A;  4ED8 A;  4RW4 A;  2BX6 A;  1HLW A;  3E2E A;  1WTB A;  3R5J B;  1Q8B A;  2XMJ A;  4L74 A;  3MUT P;  1S0O A;  2VBW A;  3BH6 B;  3PHT A;  4USH A;  4RUB A;  1REV A;  2MQO A;  2QA4 S;  3SV4 A;  4C8Y A;  2DO0 A;  4ZCI A;  1HMV B;  4WK3 A;  4MKV A;  2R9L A;  1RI7 A;  4LIW A;  5DZ6 A;  4ZVO B;  3SQG B;  3VTI A;  3PKY A;  3H40 A;  2VQF F;  2BE2 B;  1ZTT A;  1FA0 A;  4X4O A;  1DQ9 A;  1QTM A;  4UUW A;  5T7L A;  3QGP A;  4A48 A;  3FMB A;  3DYA A;  2FJV A;  4LMZ A;  2I2Y A;  2G1H A;  3A13 A;  2VHG A;  4DCO B;  1X4D A;  2UUC J;  4GKJ J;  2HQG A;  1P9Y A;  1E6Y A;  1X4F A;  2KYZ A;  2OEJ A;  3DLG A;  1QY7 A;  4YHH F;  3BJY A;  4DX5 A;  4G1Q A;  1RAB B;  2ZHB A;  1H3D A;  1Q0N A;  2KRB A;  2RQM A;  1RAF B;  1VQP S;  5L38 A;  1Y10 A;  2FZK B;  2J7W A;  2YPY A;  3ZZR A;  4FYD A;  2AWZ A;  1UJ5 A;  4CO3 A;  3PX4 A;  1AW0 A;  3CJK B;  3N0V A;  1XBW A;  5CD4 A;  4IQM A;  4HH1 A;  3SDE B;  2CJQ A;  4ZPT R;  5K14 A;  3HLU A;  3J7Z 5;  1SIZ A;  3PO4 A;  4KHP F;  2FZC B;  2Q6B A;  1J5E J;  1QAI A;  2BJD A;  4K4V A;  3BO2 A;  5IV4 A;  3CCT A;  1QVF R;  1FRX A;  3SCI E;  1TTH B;  2AGO A;  3MHY A;  2XSJ B;  2QLF B;  3OSP A;  2WVB A;  2NLW A;  3M2V B;  2VZ9 A;  2D3O R;  3OT9 A;  1K47 A;  4QR0 A;  3RTV A;  3DOL A;  1YBA A;  4NLT A;  4ECQ A;  1NPR A;  1S1T B;  3I96 A;  4N41 A;  3EJM A;  3Q8S B;  1HNW J;  3VGS A;  3MPV A;  3G82 B;  1NCL A;  1LW0 A;  1E6V B;  3DM2 B;  4KHR A;  2E5J A;  4JI6 J;  4FBT A;  4LUB A;  4WII A;  4ALZ A;  5JMN A;  4IUF A;  2KM8 C;  1U0S A;  4CT9 A;  2YBV A;  1PIE A;  1RP5 A;  1KON A;  2HQD A;  2JSX A;  3NGR A;  4C11 B;  1RZM A;  2Z2L A;  5FLX U;  4X4T A;  1FKP B;  4YDD B;  4KKO B;  1UW9 A;  3CPW R;  3JS9 A;  1GK8 A;  1S0N A;  2F4V J;  2GVD B;  1CJK B;  1DAR A;  3KKF A;  3NGS A;  1UFK A;  1F3V A;  3FRY A;  1KQF B;  4QOT A;  4H4K C;  1NK9 A;  1L3S A;  5KFB A;  4WCE Q;  3UNG C;  1SJQ A;  2X51 A;  3EM1 A;  3HHE A;  3GCX P;  3MR2 A;  4IOC Q;  2H9Z A;  2QSF A;  4KFB A;  4OHW A;  1LKZ A;  3AXK A;  3B4M A;  4YHH J;  1FRL A;  2B4V A;  2DNG A;  3NGT A;  2B8Q A;  4C3K A;  2F9D A;  1M5H A;  3KDN A;  5EWG A;  5AXM A;  3BO3 A;  1S4E A;  2V8G A;  1JLF A;  1SKW A;  4OYZ A;  2ZDP A;  2FPH X;  2B4U A;  3WX4 A;  4LRD A;  5DLG A;  3GQC A;  2YNH B;  3QT5 A;  1XNQ J;  2UXB F;  1J5O A;  2GQQ A;  4URS A;  3PY8 A;  1KN6 A;  2IJR A;  1PYO B;  3MM7 A;  4WF9 Q;  3IWN C;  4DV7 F;  2I5J B;  1JIH A;  3M8W A;  4WFA Q;  3R6G B;  3HT3 A;  3OJU A;  4ZIW A;  4JI2 J;  3MXH P;  4Y2I A;  1N8R T;  5KG0 A;  1HKA A;  1MW7 A;  4JV1 A;  3VZH A;  3KLE A;  4O3Q A;  4KGZ B;  4RNO A;  4ECY A;  2P9E A;  2MXY A;  3EPI A;  5DLF A;  2XY5 A;  2JRS A;  3GMG A;  4H4M B;  1SH2 A;  1LK7 A;  3BYP A;  2CQ3 A;  2VJV A;  3FVY A;  4CO5 A;  3V2U C;  3SDE A;  2EI5 A;  1O6X A;  1H2U X;  5CYQ A;  5D0G A;  3D6H B;  4JBC A;  3EPG A;  1RCO B;  3G87 A;  4WKR A;  4RNH A;  4DV6 F;  3AFG A;  4WZQ A;  1C0U A;  2ZNZ A;  1YZ7 A;  4IRK A;  4EU0 A;  1W2I A;  1W25 A;  3TJ9 A;  3DRX A;  2RHQ B;  3DI6 A;  1LW2 B;  1UJ4 A;  4NEY A;  4B9V A;  1IKW B;  1T94 A;  1VC5 A;  1ZOT A;  2HHU A;  3FBE A;  2BE9 B;  1YBT A;  1PJ5 A;  3M8Q B;  4RBU A;  2KVQ E;  2BKO A;  4URQ U;  4CLK A;  4ES1 A;  2JLE A;  5LMU J;  2Q79 A;  1U1M A;  1T3N A;  3ZFV A;  2C3M A;  4GKJ F;  1ITP A;  1EX8 A;  5F8N A;  2M8H A;  2GO9 A;  4TY8 A;  2C2E A;  4P2X A;  4J91 A;  4QR1 A;  5C24 B;  3V5R A;  1TL1 A;  4ZCM A;  1FRJ A;  1TL5 A;  3PG9 A;  2FIU A;  1RUS A;  1Z1Z A;  4JI8 F;  1CS4 A;  4G3I A;  3O44 A;  2KJW A;  1FX2 A;  3AY0 A;  1T9Y A;  3BN7 A;  3Q8P B;  3BPS P;  4NCG B;  4NLP A;  3FJ2 A;  3M8P B;  3CT9 A;  2FD2 A;  5HJY A;  3AD7 C;  4C8O A;  5DO2 A;  4RNN A;  1YZ6 A;  2GQC A;  4ZCL A;  4FVC A;  4P72 A;  3W2W A;  3ZZZ A;  3KWM A;  5D78 A;  5F8I A;  1SL1 A;  1KDN A;  1LXN A;  1KWM A;  3SEO A;  1FNM A;  3NKY A;  4YB1 P;  4OX9 J;  3T9N A;  1WI6 A;  4B3O A;  2L9D A;  5CZX A;  1OJ4 A;  3FZB A;  2EW9 A;  1JKH A;  3M2V A;  4JP8 A;  4H4M A;  4KY3 A;  2HGL A;  2YNF A;  2DIV A;  4KGX B;  4LJM A;  4DCP B;  2EKY A;  4DL3 A;  2BQ3 A;  2W9B B;  8ATC B;  1KTQ A;  1JLE A;  3HSG A;  2FB0 A;  2BW2 A;  4NYP A;  3NOC A;  5E3A A;  4J9P A;  4ECV A;  2Y1J A;  6AT1 B;  5IT9 U;  1DJ0 A;  1RHM B;  3MM7 B;  1UEV A;  3BB5 A;  1NND A;  1WD6 A;  1G6B A;  1RWW B;  1S1X B;  3D0H E;  1NB7 A;  2DNY A;  4I6W A;  1XTZ A;  5KT7 A;  2IDE A;  4ELT A;  2A2D A;  3H4B A;  1LWF A;  3I82 A;  4ZA1 A;  2AU0 A;  4I1T A;  4HKQ A;  1AUS L;  1S49 A;  2NXJ A;  4TU8 A;  5IV3 A;  1H98 A;  3TJA A;  2DPI A;  2QA4 G;  3V6K A;  1BLU A;  3FBF A;  4O4R A;  1IKX B;  2I0X A;  2VFT A;  1RBA A;  2Q43 A;  3CDB A;  2DH7 A;  2HBR B;  2NXU A;  4C98 A;  3JAM Y;  3TWZ A;  2MMY A;  3MWB A;  5KFC A;  2KDO A;  4QQB A;  4LSN A;  5D0H A;  4O3N A;  1Q82 T;  5KFT A;  1HNV B;  3CD0 A;  3CC2 S;  3ISZ A;  4F4Y A;  2F9J A;  4K5S A;  1KD1 T;  3ISN D;  2NZ4 A;  5C7P A;  3MEG B;  5AJ3 F;  4O3R A;  1UVN A;  4CM0 A;  1K73 T;  1FTC A;  1GXU A;  4URG A;  2HAF A;  3UDL A;  2HNY B;  4MT1 A;  2P9C A;  3DRY A;  3CC7 S;  3IGN A;  3LWM A;  2WVE A;  2VC0 A;  2DY9 A;  1N34 F;  4YME A;  4ZLL A;  3R1L A;  2PI4 A;  1YBU A;  5KT3 A;  4UQG A;  2DCL A;  3TA0 A;  4LF9 F;  1F9H A;  2PD1 A;  2ASY A;  3IN5 A;  2E44 A;  1PYS B;  3CMQ A;  3UR3 C;  1URR A;  2RS8 A;  3BGR A;  1JLE B;  4WFB Q;  2D9P A;  1RAJ A;  4YR2 A;  3QO9 B;  2AHO B;  1OPZ A;  4ED4 A;  4ZKA A;  4DF8 A;  2FHO B;  3HUL A;  3EMT A;  2CDQ A;  2LU2 A;  3UDV A;  2VU5 A;  4IRD A;  3MFI A;  2HPU A;  3CJ8 A;  2DIS A;  2YH0 A;  4V19 J;  3MEK A;  5ETP A;  4PYD A;  1L3K A;  1UW4 A;  3BGL A;  5I42 A;  4IOA Q;  3JSB A;  2KKH A;  3CDU A;  2DD8 S;  3OQ2 A;  4MTP A;  4I2Q A;  4XK8 C;  4BC7 A;  2ZJP Q;  1R6V A;  4DLE A;  2C2D A;  3LGH A;  5KFS A;  3VAI A;  1UWB B;  3UDE A;  3CJ2 A;  3I4P A;  2B9Y A;  4EZ6 A;  3NNA A;  4Q44 A;  4PXD A;  2MKI A;  1VI7 A;  4OHX A;  3B78 A;  1YIJ S;  4WXO A;  4NAS A;  3AB4 B;  5ETO A;  1G3O A;  3BGO P;  1NK5 A;  3TZZ A;  1P1T A;  5K8O A;  2BVZ A;  2CVI A;  2QC3 A;  2F7V A;  2KG0 A;  1DY3 A;  4C8N A;  1N36 J;  1EP4 A;  3CF5 Q;  5IS2 A;  4O4G A;  1VYA A;  3JB9 k;  3M9N B;  4NE9 C;  4TY8 B;  1S7I A;  1QDU B;  1T3O A;  1ULR A;  2QLW A;  3MEE B;  1HPZ B;  2CG4 A;  4AL5 A;  4QYZ K;  4IFV B;  4X4V A;  1X5S A;  2FJB B;  2A6M A;  1RHJ B;  2QYC A;  1RT5 A;  3KUE A;  2GVD A;  2CVE A;  5IT4 A;  2I9S A;  1HPZ A;  2C42 A;  4X66 J;  4CLW A;  3X1L B;  2EFQ A;  1HA1 A;  2GJ2 A;  4FP9 A;  3SCJ E;  2AX0 A;  1RKJ A;  2HQC A;  2VON A;  3N6N A;  1KS2 A;  3OXL A;  1S6U A;  3CCJ S;  2XEX A;  5EUH A;  3M8R A;  2HK2 A;  4GC6 A;  2ZIT A;  3AOB A;  4HTI A;  4HEA 9;  5E0O A;  2XZW A;  3RBD A;  2GJF A;  1SH0 A;  1VBY A;  2F3J A;  5HQL A;  3R8Y A;  2HIY A;  4LF5 J;  2RDI A;  3KOA A;  2CWX A;  2HND A;  5GMD A;  3DLE B;  3J81 U;  3I31 A;  3NS5 A;  1VQK S;  5AE1 A;  1L3V A;  2F5G A;  1RTD B;  2O67 A;  3HO1 A;  3ZZY A;  2JC0 A;  3LP1 A;  3CC4 S;  1UMJ A;  2XO6 A;  1BMQ B;  2R7Q A;  1TK8 A;  3U27 A;  2E1R A;  2NSC A;  3I5B A;  4JUZ A;  2ZM6 F;  4BHQ A;  2XY6 A;  4PWD B;  2YXL A;  4OJG A;  4RWX A;  1FJ7 A;  2UV8 A;  3GJS B;  5B0B A;  5KFQ A;  1SJF A;  1S1T A;  1AA1 B;  3UFC X;  4B3O B;  2DHG A;  4L73 A;  3G6V A;  1F1B B;  1Q79 A;  3I5A A;  2CUY A;  2ZH5 A;  3KK1 B;  4PWD A;  2HUR A;  5BR8 F;  4TNO A;  4F0K A;  2HW3 A;  4Y00 A;  2DH8 A;  1ACM B;  4C48 A;  5B0F A;  5KT5 A;  1GAO A;  2LDY A;  3MM8 A;  1Q4R A;  2H5I B;  4NZ6 A;  1HR0 F;  4YY3 F;  1GXT A;  2J0X A;  4GKK J;  2RNE A;  4NWB A;  4KJI A;  1UZD A;  3CO9 A;  4HVZ A;  4DXL A;  3UCU P;  4PRF A;  1MRO B;  1FNO A;  4ZN3 A;  1XK8 A;  5EX3 A;  5DET A;  3OL7 A;  4IG0 A;  1YJ9 S;  1CC7 A;  1EAR A;  2UUW A;  5U47 A;  1IUJ A;  2HKE A;  1JLA A;  1Q1K A;  2DGV A;  5ETS A;  1S1V B;  1TV6 B;  4DZD A;  3G8S A;  1XER A;  1S1W B;  1S4F A;  4ZMM A;  3UI3 A;  1VQ6 S;  1S99 A;  1E6Y B;  3GB0 A;  1B4S A;  4B9T A;  1TV6 A;  2ROE A;  4A8Y A;  3ENQ A;  2KZM A;  2PSZ A;  3IS9 B;  3M8S A;  4K50 A;  1K1S A;  1A9N B;  2MKH A;  1WC3 A;  2ROG A;  3DLK A;  4K2X A;  1I6J A;  3M8Z A;  1KQG B;  1XQI A;  2KXH A;  4C3M A;  3J7A 1;  1NPK A;  3T9Z A;  4N5S A;  1R0A B;  1DTQ A;  5ETR A;  3GIK A;  3RAX A;  1SJ3 P;  7FD1 A;  4V1A k;  3SSS A;  2XCP A;  4Y6I A;  2G0I A;  3G71 S;  2E1A A;  1IKY A;  3D3B J;  3C2P A;  5GMK a;  4A8W A;  4P6Q A;  1N32 J;  4W4M A;  3CCQ S;  3LTO A;  2X3D A;  2XUL A;  5ETL A;  4EWT A;  4BWM A;  2JVR A;  3MTJ A;  3V6H A;  3C16 B;  3O5T B;  1K9M T;  3JYT B;  2GIF A;  5DRK A;  3CO0 P;  3FQK A;  4M63 A;  1WDD A;  2RF2 B;  4CO4 A;  3G82 A;  3BDE A;  3CDA A;  3H59 A;  3KJF B;  3PJW A;  3LGN A;  1C1B A;  4MIB A;  4ETZ A;  1TKT B;  4F4A A;  5C2C A;  2EFV A;  4H54 A;  4U95 A;  2CPD A;  1HQE A;  2DCU B;  2IMO A;  2R4F A;  1H72 C;  3GP9 A;  3IWL A;  4KSE B;  2DTJ A;  2F1F A;  2V50 A;  1B99 A;  4L76 A;  5B08 A;  1U1O A;  4AFF A;  4ZVF A;  3D68 A;  2ADC A;  1KOO A;  2IM2 A;  1KQK A;  3Q2T C;  5A8K A;  2YQ0 A;  3TJ8 A;  3C46 A;  3UD5 A;  2ZBP A;  2PI5 A;  1F3F A;  3H4D A;  1HIY A;  4GRS A;  1VHF A;  2X7I A;  2COL A;  2HFN A;  3BBF A;  1D1U A;  2YVS A;  4DV4 J;  2KYX A;  2R7V A;  2C2R A;  1FD2 A;  1U1Q A;  4D3G A;  3O8W A;  2NXN A;  3D6M B;  3FEY B;  4C0H A;  4ELU A;  1N5Y A;  3DYA B;  3R7N B;  5HP1 A;  1ZBT A;  4B3T J;  3PM9 A;  4JI1 F;  3DLK B;  1D0E A;  1TVR A;  5CD4 H;  1TL1 B;  4I6A A;  4O4G B;  1VOM A;  2V8D A;  2FGC A;  4OZL A;  2RU9 A;  4FXV A;  4B9S A;  1UVK A;  2XZD B;  3R5B A;  5GAH U;  3DLH A;  2OKQ A;  3QGH A;  2KHD A;  3WBZ A;  1FF2 A;  2V4J A;  3R5G A;  7AT1 B;  4A8K A;  4PEO A;  2KFN A;  2K8G A;  1PGZ A;  4CLL A;  3CCE S;  1QSY A;  2GNK A;  4RW8 B;  3P5T L;  3RB3 A;  3QFH A;  4X4U A;  3V81 A;  1Q8L A;  2ZEJ A;  3OL9 A;  1JXE A;  4KKO A;  1FXR A;  2QL5 B;  3J7Y I;  1XNQ F;  1CJV B;  3KMQ A;  2N7C A;  3P4U B;  1WAC A;  2LQB A;  2BKP A;  2Z57 B;  1YJT A;  1QUV A;  5CHC B;  1SQG A;  1NZA A;  2XMK A;  2XGP A;  2ZJR Q;  1RWN B;  3GWC A;  3R27 A;  4FYX B;  3HZG A;  4HYK A;  1T03 B;  1IBM F;  2D9O A;  1YJV A;  1KC8 T;  2RRN A;  3GFX A;  3MMC A;  2G2Y A;  1FDA A;  2MSS A;  2QFI A;  3KG0 A;  4ZVH A;  4K4W A;  4DFM A;  4OV1 A;  5GVQ A;  3DOL B;  4OYA A;  1Q7Y T;  4NLG A;  2HS4 A;  1S9E A;  2DIT A;  5B7W A;  4E8U A;  5HMY A;  3A3N B;  1M5P C;  4FF4 A;  1N52 B;  2M52 A;  3M6X A;  2XSJ A;  2YNF B;  3GJT B;  1VHI A;  1YVF A;  4J9U E;  1IWG A;  2XMU A;  2CPF A;  4OYB A;  3SCK E;  1T11 A;  1RT6 B;  4LBH A;  5KFF A;  4DPO A;  2DRD A;  2Y0S D;  5LT5 A;  1FWK A;  2EVZ A;  5MAO A;  5J2M B;  5LSL A;  5EWE A;  3H25 A;  2KG1 A;  2V4R A;  2XYG B;  4L75 A;  4NCA A;  1QM9 A;  3U1L A;  1Q5V A;  1RWM B;  3ILI A;  3R5D A;  2A6O A;  3VWS A;  5HQ8 A;  1NH7 A;  3J7Z T;  3KHL A;  4C8Z A;  4NLS A;  2VG6 A;  4HHH A;  1BWV A;  3GIJ A;  4AND A;  1U2F A;  2CWK A;  3A12 A;  4XDD A;  4PKD B;  2FC9 A;  2ZKT A;  4DPU A;  6FD1 A;  3Q89 A;  5LMU F;  2G0J A;  2Q1L A;  2V9K A;  4E2F B;  2NUU G;  3OVA A;  1URN A;  2DNP A;  3I6P A;  5F8M A;  1SC1 B;  3IR5 B;  4DL7 A;  1H7W A;  1DBD A;  3IMQ J;  2XTJ P;  1U0H B;  3OTO J;  2R2R A;  2G0C A;  3CUL A;  2OFH X;  3RB6 A;  2LFV A;  2YKM B;  3T5J A;  1HNV A;  1JJ4 A;  3TVY A;  3FCH A;  5T7L B;  3IGV A;  1S5Z A;  2FLP A;  3H2U B;  2W4D A;  3KHG A;  3MCO A;  4LF6 F;  3US5 A;  2ZH9 A;  3A8I A;  3BR8 A;  5DQG A;  1IKY B;  2ZWP A;  2YKA A;  1NHU A;  4I69 A;  1YJW S;  4NXM J;  2XHW A;  3QWP A;  3S6E A;  3UVJ B;  4F0M A;  1M5K C;  1IBM J;  1S6P A;  1RTJ B;  1R8B A;  2AIR B;  2QIF A;  2XO7 A;  1S0M A;  4XTT A;  2RQ4 A;  3RB4 A;  1ZZN A;  1HW8 A;  2IMW P;  3IRX B;  2ZH3 A;  4I7F B;  1ZTW A;  2CQI A;  5K5M A;  4IDK B;  3UR0 A;  5HO4 A;  3BM7 A;  2YPZ A;  3K8W A;  3HK2 A;  3AH6 A;  3EGV A;  1WOS A;  4P10 A;  2VPW B;  3OD2 A;  2W8K A;  1IVZ A;  2HHQ A;  1YRU A;  2EC0 A;  1SV5 A;  1HL6 A;  3W1Y C;  2UZA A;  3TZW A;  2YX1 A;  2HVZ A;  2PMZ D;  1JXL A;  1TL3 B;  4M5K A;  4EUV A;  3QLH A;  4B9M A;  1KFD A;  2IYI A;  2Z2M A;  1RYS A;  2J0W A;  4CLF A;  2GMH A;  3HM9 A;  4Y0F A;  1R6Y A;  1X0F A;  4J9M A;  2L08 A;  2FVQ A;  4WU2 A;  1FK9 A;  1Y0H A;  1NJI T;  1KHW A;  2KTQ A;  1CG2 A;  4PG5 A;  1S7H A;  1RT7 A;  3PRV A;  3SCL E;  2OPP B;  5KFI A;  4CNY A;  1SQE A;  1NM2 A;  3Q8Q B;  3UD4 P;  1DTQ B;  2AF6 A;  2H48 B;  2X3G A;  2JEI A;  4FPR A;  1NSP A;  2AJF E;  2MGZ A;  4J9S A;  3T1Y J;  2WON A;  2M2B A;  2ZBQ A;  5DGA A;  1FJC A;  1VLY A;  1W7W A;  2C3P A;  4KV8 B;  1W2B R;  2P8I A;  2QTW A;  2EG1 A;  4ID8 A;  4FF1 A;  5CQG A;  3G6X A;  2HSE B;  2X1F A;  5AJ3 J;  4LR7 A;  4FF3 A;  1HAR A;  1N0V C;  3GG1 A;  2A2C A;  3RU0 A;  4M5J A;  4IOB A;  3DDN A;  1VQ7 S;  4IH7 A;  4NYZ A;  3SMZ A;  3EDQ B;  4CDI A;  1IM4 A;  4EYI B;  4EYH B;  2DHH A;  3SSR A;  2CZV C;  4P7V A;  1M5O C;  3LP2 A;  1S59 A;  3PW2 A;  2D3Z A;  4EEY A;  5HLF B;  4PG4 A;  4LF7 J;  5E7O B;  1IXK A;  1HQU A;  4NLV A;  4YUD A;  3GII A;  4ICL A;  1S97 A;  2KT3 A;  1TZ0 A;  1CUL A;  3BN4 A;  4P7T A;  2YKM A;  4RW6 A;  5I42 B;  2DRB A;  1DTT B;  3NCP A;  1QUP A;  3W64 A;  5E5N A;  3ZTR A;  4F0H A;  5KT2 A;  3T5H A;  2MHE A;  1WOO A;  3QGI A;  5ETK A;  3A8J A;  5D6G A;  2A10 A;  1U2R A;  4C6A A;  5A76 A;  2WHO A;  4M1K A;  2KFZ A;  3ENV A;  3Q8V A;  2CRL A;  2Z56 B;  2ALY B;  2ZBI A;  3DCA A;  5E3Q A;  1ZYQ A;  3EVO A;  2YX4 A;  2HMI A;  3NRB A;  3GYG A;  3NGU A;  1RJJ A;  1QE1 A;  5AT1 B;  1SUQ B;  2EG2 A;  4LRE A;  3KNG A;  4R5P B;  1U6B A;  3JSY A;  1KVJ A;  3MFH A;  3WDO A;  3OUY B;  4AL7 A;  3L95 X;  3D0I E;  3O6Q A;  5CH7 B;  2G13 A;  1NDP A;  2MLX A;  2PE8 A;  5A8W B;  3MGJ A;  2R8H A;  1M1K T;  1D8Y A;  4WTO B;  1VRU A;  1G4C A;  3TAP A;  1XMQ J;  2J9E A;  5DDP C;  2L3M A;  2GZO A;  2O66 A;  3MPU B;  1IJE B;  2DKO B;  2XI3 A;  1DZ5 A;  1RT1 B;  2ILZ A;  1LOU A;  2VG7 B;  2E9R X;  2MZQ A;  2EFO A;  3OVB A;  2DNM A;  1C4A A;  2I1R A;  3CCZ A;  4N8N A;  2C3O A;  4NRT A;  4X65 F;  2NPF A;  5GAD U;  3MED A;  5AXN A;  4XO0 A;  1SJR A;  5IOL A;  2WAQ D;  5HP1 B;  2JEF A;  1ZZF A;  2GHV C;  3LF0 A;  1CPZ A;  2B4O A;  1MMD A;  1LNQ A;  3ENW A;  1JQG A;  1X4G A;  2E7V A;  3AQO A;  3K57 A;  1TMM A;  2CDR B;  2DBB A;  1H73 A;  4BCA A;  3GON A;  3D4J A;  3H7H B;  3T19 A;  4X64 F;  5CXT A;  3P8B B;  5J1E B;  4X66 F;  3I4H X;  4CH0 S;  2DO4 A;  3PYE A;  4ICL B;  1P6T A;  4TYB A;  3PW7 A;  3RAQ A;  3CTR A;  2KZZ A;  1Q16 B;  4DMZ A;  1V5I B;  3E51 A;  2CZ9 A;  5A0Y A;  3MMB A;  3UN2 A;  4C0B A;  1JWW A;  1WSR A;  3IR6 B;  4DV0 J;  5KFL A;  2Y1I A;  4U7C A;  3TI0 A;  2K3K A;  3S01 A;  1XR6 A;  3DRP B;  2UVR A;  2VB6 A;  4IFY B;  3QIP A;  4X62 F;  4CIO A;  3PYF A;  1VC6 A;  1UVI A;  2J7U A;  3ISN C;  1NSA A;  4LR9 A;  1ZM3 A;  4NLY A;  3JYT A;  2OI2 A;  5IXU A;  1WSV A;  3W9H A;  2QEX S;  4RBT A;  3KG1 A;  1JLC B;  4J7C A;  4USK A;  1TL7 A;  1Z4U A;  4OZ5 A;  2UV8 G;  2RRA A;  2XNR A;  3M9M B;  4F4K A;  3LP1 B;  4RUA A;  4ERD A;  1R8C A;  1T95 A;  1FE4 A;  2BXJ A;  4Y3C A;  2VFU A;  3HX9 A;  3OR1 B;  2R8I A;  2VBZ A;  5J2M A;  3MI7 X;  3ILL A;  3KK2 A;  3EGZ A;  1IM6 A;  1RTZ A;  3LAN A;  1ZM9 A;  2BRL A;  2MQN A;  4LFA J;  2CJK A;  4DHV A;  3UD3 P;  2W24 A;  3TAM B;  2ATC B;  2ZWO A;  4NZ0 A;  1FO1 A;  1NPP A;  3PJX A;  5C24 A;  3H90 A;  4DQP A;  2HVI A;  3QGG A;  5K8P A;  1WHY A;  4NXN F;  3GPA A;  4TLQ A;  3K89 A;  1RAI B;  4UOC A;  3IBF B;  2ACY A;  3PYG A;  4G1I A;  1R43 A;  2EC2 A;  4HHJ A;  3N01 A;  5B0C A;  3OVS A;  1H38 A;  2UUB F;  3KTQ A;  1WF0 A;  4DSK A;  1U4B A;  3LW5 C;  2NCK L;  2GW8 A;  2E5L J;  1VS3 A;  1MG7 A;  1WTF A;  2QZ8 A;  4H4K A;  2IYG A;  4PCQ A;  1UVJ A;  2M9K A;  3LAM A;  4R8U A;  3FQL A;  1PO6 A;  3MOJ B;  3AD9 C;  4N77 A;  5DM6 Q;  1N88 A;  2HFU A;  2KXF A;  4IH5 A;  1BXN A;  5F0W A;  3HHL C;  2LYV A;  1Y7P A;  2ZH1 A;  1AZS A;  3TZX A;  4YDX A;  2CQ4 A;  2DNH A;  2ZD1 A;  4Y2C A;  1RWP B;  4WIQ A;  1TMJ A;  2DHS A;  2V2K A;  1VCT A;  4LIR A;  5IC6 B;  4DS4 A;  2IRU A;  2YQ3 A;  3C19 A;  3GSD A;  1FFG B;  3LPE A;  2V4Q A;  1NKB A;  2NR0 A;  3HCX A;  2BZ2 A;  2I8E A;  1KRP A;  1F2H A;  2W2N P;  2GX8 A;  2WW8 A;  1OYD A;  5SZT A;  1YLX A;  2WSE C;  2QE5 A;  1JLQ B;  3QRP A;  5BXI A;  4F50 A;  1XMO F;  4KHM A;  2E5H A;  1SC3 B;  2DXE A;  3DGP A;  2MGZ B;  4YY3 J;  1RGV A;  3BKT A;  3Q8R B;  2W9B A;  2HVH A;  4PXC A;  1V3Z A;  1NSK L;  3GG0 A;  1NZ8 A;  1S57 A;  1YJ7 A;  2IA6 A;  4WKY A;  5M2U A;  2MDA A;  4UY8 5;  4RUC A;  1YQH A;  1WEZ A;  2J8S A;  3W5Y A;  4O3S A;  2F4F A;  2Y0B B;  2DGS A;  3ONQ A;  4HT5 A;  3HP6 A;  4Q0B B;  4ED7 A;  1NRK A;  4P71 A;  4A4J A;  3IM9 A;  4WFX A;  2RKI A;  4IR1 A;  3C15 B;  2BQR A;  2ZOF A;  3ZXW A;  2DH9 A;  4QWA A;  3HT0 A;  5D3G A;  1Z2Z A;  1ZAX A;  2VF3 A;  2XS2 A;  3KDO A;  4P2M A;  4FBU A;  3ZTQ A;  1PJ7 A;  2AEJ A;  2KVI A;  3U02 A;  1ZA1 B;  4U6P A;  1AFI A;  4A8Q A;  2BJ1 A;  3ZZO A;  2VPY B;  3DLJ A;  4DV2 F;  2CPJ A;  4O3P A;  3W2V B;  2BE2 A;  2X1G A;  4Q5V A;  2B0G A;  3FKB A;  2RS2 A;  3OXF A;  4JYA F;  1T03 A;  3VZI A;  2B9W A;  1SKR A;  4TY9 A;  2LXU A;  1WC4 A;  2Z8Q A;  1RTH A;  1CJU A;  1GMW D;  2H4Y B;  2WTF A;  2I5J A;  3BO4 A;  1VQY A;  3EZ5 A;  4HAC B;  1PBU A;  3GFZ A;  1RIS A;  1AYE A;  5KFJ A;  2LEC A;  3T3F A;  3OW2 R;  1PSD A;  5LXY A;  3NCR A;  3A8K A;  4USM A;  1KVI A;  3WIV A;  2J5A A;  4M95 A;  4TKT A;  2LMI A;  2IM1 A;  4RR5 A;  4M5D A;  3IRW P;  3E01 A;  5DG8 A;  4Q2M A;  1Q5Y A;  2E7X A;  1RAO A;  2ERR A;  1FES A;  4MK9 A;  2W1B A;  1WC6 A;  1PYT A;  1XIQ A;  5I3U A;  4WZM A;  5L8R C;  1UFL A;  3C14 A;  2BRK A;  4WE1 B;  4QCL A;  1RWV B;  2DGQ A;  3HVT B;  5CAB A;  5L1K A;  3BS9 A;  4J9Q A;  4DL6 A;  2FYX A;  2VPX B;  1WG4 A;  2FJA B;  1N0U A;  2IBK A;  2OEL A;  5GAD I;  3HHN B;  4NLR A;  1M5V C;  3JQK A;  4ZPW R;  5EDW A;  4LF8 F;  2OPS A;  1U25 A;  2V6A A;  4QW9 A;  2XLK A;  4DR7 J;  2KT2 A;  3U1N A;  1K44 A;  1TL7 B;  4C0O C;  5KG4 A;  4KC5 A;  3HHK A;  4PWW A;  3UCG A;  3VQT A;  3K5M A;  1MWQ A;  2W7P A;  2WK4 A;  2V34 A;  4N56 A;  4I56 A;  2EXU A;  3TAR A;  4OLP A;  2ABY A;  4IG3 B;  4UST A;  4DG1 A;  2R7U A;  2MQL A;  2OPQ B;  3OUY A;  4CLZ A;  1RA6 A;  2C2N A;  2QLB B;  1RU2 A;  3TUZ C;  4GVB A;  3MEG A;  4NA1 A;  2JEG A;  2V2Z A;  1HHS A;  2W4C A;  3VGT A;  4EBC A;  3MM6 B;  2R2T A;  4ZN1 A;  4XDC A;  1SC6 A;  4ID5 B;  4Q2L A;  5A0Y B;  3OLB A;  3K59 A;  5H9E K;  3K7R A;  1Q86 T;  3OFG A;  1UA0 A;  2FVC A;  2XZT B;  1C2P A;  4NPO A;  3VCD A;  2BOP A;  1KKH A;  2YTC A;  1WDT A;  3GR1 A;  2EWH A;  3KG4 A;  3MEC A;  4XAK A;  1BE4 A;  2Y3Y A;  2ZC3 A;  3FDS A;  2DHX A;  4IFY A;  2RF2 A;  2SXL A;  3FNN A;  3NAI A;  1X8D A;  2BAN A;  3AD8 C;  4FYW B;  4R25 A;  1NXI A;  1Y5I B;  2CQP A;  1L3T A;  2Y8W A;  2APO A;  2AGP A;  3MOZ A;  4NXM F;  1FKA F;  4PZV A;  4QIW D;  4R8U B;  4I4B A;  3LAK A;  3PCO B;  1FXL A;  4NZ7 A;  2IA0 A;  2D74 B;  2J76 E;  1TUW A;  3DN9 A;  4J9N A;  3BYR A;  2MYF A;  4JI2 F;  4DR4 J;  2GS8 A;  5D8H B;  5D0R A;  4ZLJ A;  4LBI A;  3DU5 A;  3W2V A;  1MML A;  3DXB A;  3OPK A;  4P74 A;  5L9X A;  5F8G A;  2KXN B;  3MAQ A;  4EI2 A;  3D28 A;  4JV2 A;  3K5N A;  1V6H A;  4AQY F;  2XWX A;  1ZM4 A;  3D1O A;  2QJ3 A;  4OLO A;  1PIL A;  1U24 A;  4DF4 A;  2HWH A;  4DZ6 A;  3C16 A;  3GU0 A;  4ANC A;  3RW7 A;  1TVR B;  1FK9 B;  4CYU B;  2CJY B;  2DEI A;  5K8M A;  4DR7 F;  1MN7 A;  2VH7 A;  1RTI A;  3RBE A;  3JTO A;  4ES2 A;  3TUJ C;  3VQS A;  4ZCK A;  2J6T A;  2HHV A;  4J9R A;  4CP5 A;  1KLM A;  2DR7 A;  2FJX A;  5KFW A;  1WC0 A;  3EZU A;  2W2Q P;  1RA7 A;  1RTI B;  4CM2 A;  1NJZ A;  3ULH A;  5AE3 A;  4ED1 A;  2B7B B;  4V19 X;  2OTJ S;  1S6Q B;  1VRT A;  1V9O A;  3M30 B;  3GIM A;  3HD2 A;  4H4O B;  4DR3 J;  2FLN A;  2KFY A;  1WG5 A;  4OI3 A;  2J9C A;  2JHE A;  4KFB B;  4CO2 A;  3QLH B;  4K4X A;  1O5J A;  4FYY B;  2VDH A;  1PC4 A;  8AT1 B;  5LXR A;  4TYA A;  4Y34 A;  4HDH A;  2QL7 B;  4OJH A;  4RPF A;  3MMC B;  3M7V A;  1BHN A;  4OZN A;  5GME A;  2IVF B;  1JKH B;  5LMN F;  3PX0 A;  2JFK A;  2HQI A;  2WOM B;  3B6B A;  3D6F B;  1H74 A;  2HND B;  4A8O A;  4P2S A;  4OQJ A;  1XEZ A;  2FTR A;  2YNI B;  4O44 B;  4U7U D;  2ZFH A;  4M8L A;  4PYA A;  3KNA A;  3B8H A;  1HQU B;  3AOC A;  4ECR A;  4OX7 A;  1HWJ A;  1I51 B;  5C42 B;  3UNY A;  1XMQ F;  1HFE L;  4KPY A;  2GAG C;  2HVD A;  4YOE A;  2V69 A;  1LK5 A;  5J1E A;  3EGN A;  4HAC A;  5I4M A;  1GMW A;  5CA5 A;  3DKD A;  1B0V A;  3UVJ A;  3RB0 A;  3D54 A;  3MAA A;  2CQG A;  5C42 A;  4DR4 F;  2DR6 A;  1WHV A;  5K9F A;  1SJ1 A;  4KO0 A;  2HEK A;  2YNG A;  3CSK A;  1OSD A;  3UQS A;  3M32 A;  2HG4 A;  2KH9 A;  4ED3 A;  3NL0 A;  2KHC A;  5F41 A;  2D3O 1;  2CQB A;  1R3N A;  1FXD A;  4DFJ A;  1VC0 A;  2ZUG A;  2UP1 A;  1X4H A;  3EGW B;  1NJW A;  3O2I A;  4L3N A;  2AJ2 A;  2HNZ A;  3KJV A;  4WP3 A;  3V4I B;  1RT4 A;  2C3Y A;  1PAE X;  2QSW A;  3GZ7 A;  4HH0 A;  2CQD A;  3THT A;  3VAM A;  2H1Y A;  3PR5 B;  1RLD A;  1VRU B;  3TNV A;  3CCU S;  2RH3 A;  1FFS B;  4O0I A;  2YKO A;  1JNR B;  1RT4 B;  2MHN A;  1UWB A;  3LAL A;  5J1N A;  4F02 A;  1NHV A;  2K06 A;  1KVK A;  1SJ4 P;  3QRR A;  1TKX B;  5HVG A;  3QZ8 A;  4F8R A;  3BQ2 A;  1S48 A;  3THP A;  1QJH A;  3PEH A;  5KFE A;  1JMT A;  1GX6 A;  2HFZ A;  3IBW A;  3Q22 A;  2AYB A;  2NQP A;  4YP3 A;  3W8P A;  1TQL A;  3HHL A;  3L09 A;  1VBK A;  5HVF A;  1K8A T;  1TKZ B;  3W63 A;  4LRF A;  5A8R B;  1KEK A;  2OEM A;  2AV5 A;  4X4R A;  4X65 J;  2OJ3 A;  4NCB A;  3ET6 A;  4M5L A;  1H6K X;  1AFJ A;  3I87 A;  2QT7 A;  4DFP A;  1RSC A;  3E01 B;  2U2F A;  4UUX A;  3TP2 A;  2BAC A;  2WBM A;  1EJ7 L;  2ZE2 B;  4OX6 A;  3I9V 9;  1B0P A;  5KFO A;  3CD5 A;  2B8P A;  3V6D A;  1QVG R;  1YTY A;  2CZ4 A;  3TO8 A;  2CNL B;  3HSZ A;  3MAA B;  1DLO A;  2O01 C;  4N7T A;  2J7K A;  2BAN B;  4KB7 A;  5FD1 A;  3WHI A;  5F9L A;  1SL0 A;  4DQS A;  2AJ1 A;  3RGI A;  5KFX A;  4ZP8 A;  3D0G E;  1D8Z A;  3IBC B;  1EIY B;  1PBA A;  4ILL A;  2EFN A;  1CEZ A;  1CJU B;  1R8P A;  3N4W A;  3HVR A;  3HD1 A;  2GML A;  3WQP A;  2GHW A;  1VGY A;  3D1Q A;  1N33 F;  3R5A A;  3JTN A;  4BC9 A;  1ZPW X;  2MZT A;  2G9O A;  1WKL A;  2GVZ B;  4F04 B;  4X62 J;  1X9W A;  4K2J A;  4WJB A;  2QG9 B;  3AXM A;  2UXC J;  5HAT A;  4CLP A;  3FGV A;  1CSJ A;  2Z0G A;  3JQJ A;  3G96 A;  3DLB A;  2IIH A;  2MKJ A;  4PQU B;  3LA0 A;  4NLX A;  3BQ0 A;  1VQ9 S;  1U1K A;  1LW2 A;  4F25 A;  2A0F B;  5I3P A;  1IKV A;  1ZAV A;  1MRO A;  3BGF A;  4Y28 C;  5L46 A;  5A8W A;  1HNI B;  2ZOM A;  4CYU A;  3SXL A;  4J5O A;  4Y65 A;  4KIA A;  2B7C B;  4F36 A;  2BV3 A;  5ITH A;  1V3S A;  2JL9 A;  4R5P A;  2W8L A;  3QPI A;  3QWU A;  2QX0 A;  4Q8F A;  2LDI A;  4DR2 F;  1VK8 A;  3HHD A;  4QU7 A;  2E9Z A;  2JFD A;  3PHE A;  4DX8 H;  2WSC C;  4DR5 J;  2CPI A;  4WFZ A;  2CPY A;  1JB0 C;  4NOH A;  1RBL A;  4W98 A;  5KG3 A;  3LWL A;  2V94 A;  1Y11 A;  3POT B;  1PG5 B;  2AZ1 A;  1SXL A;  1QAJ A;  3ADA C;  2UVU A;  2VC1 A;  5B0D A;  2UUB J;  4RW6 B;  4JI7 F;  2AYM A;  3BRE A;  3C6U B;  1FT8 A;  3ZZT A;  1AXQ A;  4OI2 A;  2GFF A;  3W2W B;  3GCW P;  3FFI A;  1U48 A;  4MMO A;  1VMB A;  1IBL J;  3PKM A;  3IM8 A;  1LFP A;  4QW8 A;  2R8K A;  4LR8 A;  4X4Q A;  1RTH B;  2D41 A;  4DUY F;  2HYI B;  1HNX F;  4FNI A;  2ZBR A;  3UO0 A;  3G8T A;  3I0R B;  3QBC A;  3KYL A;  2HBY B;  3RRG A;  2FVS A;  3GYX B;  1X9M A;  1HI1 A;  2ZVS A;  1J5E F;  1ZET A;  1S9G A;  3QSI A;  1KFS A;  2CXE A;  3SYZ A;  4B3S J;  2PDA A;  1N5T A;  2N7Y A;  3MUM P;  4CWB A;  1S1V A;  3AJD A;  3R2C J;  2NUH A;  3SZ2 A;  3I55 S;  1FNX H;  2C1E B;  1B7Y B;  3PXG a;  2KO1 A;  4Q0B A;  4RNF A;  2M5Y A;  4BLG A;  5HVH A;  1C0U B;  3DXS X;  3CIM A;  4JI6 F;  3BSO A;  3OR1 A;  4BBY A;  1HR0 J;  5AXK A;  3ZTO A;  4ECZ A;  3MZI A;  4ZPA A;  2B4P A;  3N6M A;  3R97 A;  3Q0A A;  4PG8 A;  2YKP A;  5CAA A;  4JI3 J;  1E6V A;  1XR5 A;  2LKZ A;  3DM2 A;  3ETM A;  4PWU A;  3OFF A;  2YKQ A;  1UA1 A;  2BJ7 A;  3D67 A;  3W9I A;  1NDK A;  4GO7 X;  4I64 A;  4C3L A;  4JI4 J;  4FF2 A;  1N5V A;  2DHA A;  1RT6 A;  3FC9 A;  3TZY A;  4DR5 F;  1S1X A;  2R7X A;  2LP4 A;  1WKK A;  4I2P A;  4ZP9 A;  4U67 Q;  2MZS A;  4LFB J;  3QQC D;  2HQ3 A;  4R0E A;  3BSC A;  1YHQ S;  3EXC X;  4QWD A;  2BUN A;  2HHS A;  4DV2 J;  1GX5 A;  2BM0 A;  2XMT A;  1V3R A;  2G1D A;  3CUN A;  3W3S A;  2CJ9 A;  4K7Q A;  1RT3 B;  1HW9 A;  1FFW B;  4BWJ A;  4FS1 A;  5HRO A;  2BQU A;  1LEO A;  3QMQ A;  1RTJ A;  3B4D A;  2FY1 A;  3I0R A;  1MSW D;  1JLG A;  2ASD A;  1HD1 A;  5KFV A;  3CJR A;  5B0E A;  1QTN B;  4DOZ A;  4QYZ J;  2JLF A;  3PDN A;  1VIX A;  3RUB L;  4LBP A;  4DV7 J;  4GMK A;  4DN9 A;  4O44 A;  5CYQ B;  4OYO A;  3PIP Q;  1T05 A;  2XMW A;  2ZH4 A;  3IWX A;  4J37 A;  3DOK B;  4UTG A;  1HBN B;  3CJ4 A;  1IR0 A;  4DL0 C;  3K58 A;  2DPJ A;  3HPO A;  2O3D A;  2LU1 A;  1U1R A;  2PT0 A;  1UVM A;  2B5J A;  3VGU A;  3PZP A;  5C25 A;  4B3M J;  1VRQ C;  2FLL A;  4MFB A;  1NK8 A;  2MY8 A;  4FKY A;  2B5J B;  2YNG B;  4I0W A;  1XNR J;  1RT2 B;  4U9R A;  1K1Q A;  1HWL A;  3AOA A;  4X4P A;  3NGK A;  4U8Y A;  1S79 A;  1HD0 A;  1WOP A;  2DK2 A;  4ZLP A;  4DR6 J;  2M70 A;  1FJG F;  4NX9 A;  1U02 A;  1JJC B;  2MZJ A;  5HAN A;  3WZ0 A;  5A6W A;  3K5L A;  4DV6 J;  1WF1 A;  4K0K F;  1RLC L;  1LW0 B;  3OTC A;  3J80 Y;  1LWF B;  2XC9 A;  5D77 A;  5GAG I;  1MWY A;  4F2S A;  2B51 A;  4LRB A;  3R7B B;  2VBY A;  4ZHR B;  1TFW A;  2B56 A;  5LL6 d;  4JV5 F;  3HFK A;  2IM0 A;  2YWW A;  4P52 A;  4RBV A;  5G4D A;  1HNZ F;  4JI4 F;  2VOP A;  1HHQ A;  3C8Y A;  5ETM A;  4JI7 J;  4N8O A;  2HZA A;  1RE1 B;  3TR5 A;  5H1S V;  4DUZ F;  2AQ4 A;  3S8S A;  3FRZ A;  4WBF A;  2ROP A;  1CQM A;  2ZDO A;  3VR1 A;  4CNZ A;  4KPC A;  2W01 A;  2ZH7 A;  2DNZ A;  2UUC F;  2LQ8 A;  2ZOG A;  3KLI B;  1N6Q A;  3HDS A;  1M90 T;  2FQQ B;  2VA2 A;  1Q95 G;  4DJB A;  4E0D A;  5HLF A;  4UY8 T;  2YWF A;  3HFZ B;  3EYZ A;  3QJL A;  4RKU C;  3VAG A;  3QNW B;  4I6Y A;  3JXO A;  3MPD A;  4HL9 A;  2JOQ A;  3AA9 A;  3BGR B;  3FBC A;  5KFK A;  2FHJ A;  2R7W A;  3N79 A;  4N47 A;  1VIO A;  4AL6 A;  3A4T A;  1UZH A;  3DRS B;  1J5O B;  2CNK B;  4NA3 A;  1HBM A;  2Z2Y B;  2AJ0 A;  2MY7 A;  2L41 A;  5GAH I;  2KB2 A;  4OI0 A;  3AAW B;  1FVQ A;  4B9L A;  3I0S B;  2W9C A;  4WU3 A;  3PW5 A;  1NJY A;  1S6O A;  1UKU A;  3ZC4 A;  3C6T A;  3MDF A;  3PRD A;  4KGV B;  5IM0 A;  1HYS A;  4AT1 B;  3M4X A;  2FHM A;  1U45 A;  1OMS A;  3M2U A;  4PG7 A;  1GTE A;  4ENO A;  2V2Q A;  5D0E A;  3W62 A;  4YS2 A;  3B82 A;  3N5F A;  4F4X A;  1XNR F;  1ZH5 A;  3D1H A;  1NDC A;  4USW A;  2R7R A;  3CGI A;  2DNN A;  2ZBC A;  2KRR A;  4QPT A;  3OL6 A;  5L1I A;  2F8E X;  4A8S A;  3P49 B;  2AKW B;  1HBU B;  4G6V B;  4ZVE A;  1DQ8 A;  1REV B;  4PAB A;  3QT7 A;  4KBI A;  4MIA A;  3T5K A;  5LJ3 Y;  1ZAW A;  2VKR A;  4CO0 A;  2YWK A;  3AQP A;  3GYN A;  2AEF A;  4IH6 A;  4NMX A;  4KYZ A;  3ZNJ 1;  1L3U A;  3KJQ B;  2RHS B;  3LP0 A;  5J2Q A;  1H7X A;  3VAK A;  1NU4 A;  4OI4 A;  2PEH A;  3TEH B;  5C5J A;  3I9Z A;  3BV8 A;  2R7T A;  3UN3 A;  3AJ2 A;  2E7W A;  3TQE A;  3B54 A;  4BS2 A;  2OAU A;  3M2R A;  2ASJ A;  3BF4 A;  1VLO A;  2EBG A;  2PC6 A;  4MYT A;  5KG2 A;  3G86 A;  3BEG B;  4PUO B;  3LOU A;  2K7K A;  2VFS A;  3ZZ0 A;  4W90 B;  1BC6 A;  2H4W B;  3CVK A;  5KT6 A;  2P6S A;  2MQ8 A;  4MK8 A;  1ZPV A;  4DS5 A;  3T6J A;  4LF6 J;  3CJK A;  1OQ6 A;  3TX8 A;  4Y2K A;  4F67 A;  4MJK A;  1A0O B;  3P96 A;  2BJ9 A;  4LF9 J;  1R31 A;  2DYA A;  3W66 A;  4PR6 A;  3V6D B;  2LQ5 A;  2ZNY A;  5KFA A;  3J81 Y;  3HKW A;  2OPS B;  2RJZ A;  5K8N A;  2UVV A;  2HBQ B;  4ER8 A;  1HYS B;  1Y5L B;  3L9Z A;  4WTY A;  3M6U A;  1B7F A;  4KR0 B;  5L39 A;  3NAH A;  5RUB A;  2QMU B;  2WRM A;  3MR7 A;  2XQC A;  1EKS A;  2WOM A;  1NK0 A;  4PXB A;  2YKN A;  3HKZ D;  1R7I A;  1LWE B;  3MM5 B;  5E41 A;  4RNM A;  1S10 A;  4RUH A;  4ZLN A;  2OPR A;  5CYJ A;  3BSA A;  2VPZ B;  2RUG A;  1XWL A;  2L9N A;  3KK3 A;  4DLG A;  1I3O B;  2W25 A;  2IM3 A;  3SQG A;  1KBR A;  2CG8 A;  5BYR A;  4ELV A;  3BBB A;  4CTA A;  2YWG A;  5J2N B;  4ZJQ A;  2LXF A;  3CDW A;  1NBE B;  3EVM A;  3BQ1 A;  3PFO A;  3F56 A;  3DRS A;  4DUT A;  3OTD A;  3G6E S;  2GCF A;  1HBM B;  2MJU A;  2W7A A;  2XHC A;  4LF2 A;  3VHQ A;  4ZPV R;  3CCS S;  1L5U A;  1FRM A;  3MM8 B;  4LQ3 A;  3G8Q A;  4LF4 F;  1RT3 A;  1EKR A;  5HRO B;  1B64 A;  1OSC A;  1G1X A;  2UUT A;  4P9S A;  3QJJ A;  3IG1 A;  2C2Z B;  3MPY A;  1IN0 A;  1N36 F;  2Y1L B;  4NLQ A;  1LV5 A;  1JLG B;  5KG7 A;  4LF1 A;  4KE5 A;  2VQE J;  2IY5 B;  2OMO A;  2OLW A;  1R0B G;  4ZJO A;  3NGD A;  1WUU A;  2PEB A;  2ZH8 A;  4IRC A;  1KHV A;  1RCX B;  5JVH Q;  4YFU A;  2H3E B;  2HIQ A;  2B9E A;  2JJ4 D;  2N3L A;  3VAF A;  5KFG A;  1OPI A;  2R7S A;  2IVM A;  3A1Y G;  1KLN A;  2PA8 D;  4IKA A;  4I67 A;  4GO5 X;  2CQ2 A;  3EX7 B;  5DG7 A;  2I6W A;  2F8H A;  1SC4 B;  3LGM A;  2ZD1 B;  2VOO A;  1TAU A;  4DQQ A;  5JJB A;  3VAL A;  1TP7 A;  2LVW A;  5EHH A;  2IHR 1;  1JLF B;  1UWA A;  2PA3 A;  5AE2 A;  1X60 A;  2HFV A;  1F6T A;  4NA2 A;  5J2P B;  2XI2 A;  4LF7 F;  2WB4 A;  2BE7 D;  1FDN A;  5LOQ A;  1CVJ A;  4EO8 A;  2ZKU A;  3CE8 A;  1SB6 A;  1U8S A;  2DT9 A;  2ZM6 J;  1P1L A;  2E5I A;  3UWT A;  3CXC R;  2D1C A;  1EZZ B;  1U09 A;  4KH1 B;  4OYI A;  3CB4 A;  2YX7 A;  2XBP A;  4ZPB A;  2CYY A;  1REG X;  5B0G A;  1LWC B;  2H5E A;  1UTA A;  1T05 B;  1JLA B;  2FLO A;  4DPY A;  2G4B A;  2UXC F;  2RB7 A;  1RHK B;  4F2R A;  1SVD A;  1Z2L A;  1U47 A;  3AT1 B;  1YIT S;  1OO0 B;  3G6Y A;  1U8W A;  3CNQ P;  2FJW A;  1BUX A;  4OYP A;  3OTE A;  2LA4 A;  1UL3 A;  4F7V A;  2PN6 A;  5FLX Y;  3DI6 B;  1QLN A;  3H0P A;  3HVA A;  1TR0 A;  2DGT A;  5KOW A;  1RBO B;  4LSL B;  4PUO A;  1EP4 B;  4C8K A;  4LF4 J;  1ELO A;  2YWE A;  3M8Y A;  1VR6 A;  3UE2 A;  1RHR B;  3JSR A;  4OJ1 A;  4EGL A;  2HZC A;  1T9V A;  3NY0 A;  3POT A;  3T41 A;  4A8M P;  1TK0 A;  4DR6 F;  4B08 A;  5EN1 A;  2VQE F;  3OHB A;  4J9O A;  2VKZ G;  3ET6 B;  4RW7 B;  2LQJ A;  4OI1 A;  4ZVT B;  1N54 B;  2GQ2 A;  3OHA A;  3QFW A;  1WG1 A;  5J2Q B;  2XY7 A;  1P27 B;  1N4L A;  3EDR B;  3FK4 A;  4J90 A;  2Y8Y A;  1OIA A;  2IJF A;  1DFD A;  5CCM A;  3QAT A;  2VAS A;  3DHX A;  1FER A;  4DU7 A;  2W2M P;  4ID5 A;  4TU9 A;  3KLE B;  4CQ1 A;  4B3R F;  2IDL A;  2RDD A;  1RAC B;  1W26 A;  2GJI A;  3IG1 B;  1T0T V;  3E3X A;  3F73 A;  2E1P A;  1S77 D;  3CJ0 A;  2OSQ A;  2CQH A;  2VJU A;  3I32 A;  1BGX T;  1FVS A;  2J9D E;  4DBQ A;  4NCG A;  4RW9 B;  3N28 A;  1UAW A;  3DU6 A;  3MF5 A;  4ECU A;  1D09 B;  2Q6C A;  5KT4 A;  1R0A A;  3CCW A;  2EKN A;  2YNH A;  3RJM B;  2BR0 A;  4FNH A;  4C8M A;  9ATC B;  3IAS 9;  1IQZ A;  3KUH A;  5D4L A;  4QWB A;  3A3O B;  2MB0 B;  4U96 A;  3KK3 B;  1I94 J;  2CNN B;  1FRH A;  5ETT A;  4B3S F;  4J9L A;  2HQF A;  2L48 A;  2NYI A;  4YR0 A;  5IT9 Y;  3KJN B;  2YKN B;  3PW0 A;  4TN2 A;  2QO3 A;  3M8Q A;  4KH0 B;  4ECW A;  1N5Y B;  1YRX A;  1J2V A;  3IC1 A;  1Y3J A;  5IC4 B;  3KLV A;  2OUG A;  3W65 A;  1S72 S;  4IG3 A;  4DSL A;  1G2E A;  1QSS A;  3R7S B;  1BQN A;  4QZV B;  4X4N A;  1P8G A;  3RG6 A;  3X3U A;  3D3C J;  2AEM A;  4EMD A;  4USU A;  3GV5 B;  1GT8 A;  3WC2 A;  5KAK A;  2ZE2 A;  2BEF A;  5HN0 A;  4AD6 A;  3JAM U;  1XJW B;  5HBM A;  5F3T A;  2IC3 A;  1NME B;  4DX6 A;  4M5H A;  3OSN A;  1DLO B;  1VFJ A;  1YWX A;  2UU9 J; 
#chains in the Genus database with same CATH homology
 4DR5 J;  4GKJ J;  4NXN J;  3IMQ J;  3OTO J;  2UUB J;  4YHH J;  4JI0 J;  4JI8 J;  4DR1 J;  4B3R J;  1XNQ J;  1IBL J;  4NXM J;  4V1A k;  4DV1 J;  1IBM J;  3D3B J;  4KHP J;  1N32 J;  4RJV A;  4JI2 J;  4DV0 J;  4DV3 J;  2ZM6 J;  1N33 J;  4NEZ A;  4B3S J;  4AQY J;  1XMO J;  3R2C J;  3W1Y C;  5BR8 J;  5A2Q U;  4JI5 J;  2MTL A;  1HR0 J;  1FJG J;  4DR7 J;  4K0K J;  4PWW A;  4LF4 J;  4JI3 J;  4DR2 J;  4DV4 J;  4NEY A;  4HHU A;  3J80 U;  1N36 J;  4LFA J;  1HNZ J;  4KYZ A;  2KVQ E;  4JI4 J;  4B3T J;  3T1Y J;  5LMU J;  4DUZ J;  4LFB J;  4X65 J;  4DV2 J;  2UUC J;  5LMN J;  5AJ3 J;  4JI7 J;  2E5L J;  2UUA J;  4JYA J;  2UXD J;  3J7A N;  4LF6 J;  2MEW A;  2MQ8 A;  3R2D J;  4X64 J;  1N34 J;  4X66 J;  2UXB J;  4LF5 J;  4LF9 J;  3J81 U;  4DV7 J;  4DUY J;  1HNX J;  4LF7 J;  4DV5 J;  5IWA J;  3T1H J;  4OX9 J;  4DR4 J;  1J5E J;  4KY3 A;  2HHH J;  1I94 J;  1IBK J;  4X62 J;  4B3M J;  2UXC J;  4JV5 J;  5IT9 U;  5LM7 E;  4YY3 J;  1XNR J;  1HNW J;  2KL8 A;  4LF8 J;  4JI6 J;  4DR6 J;  4GKK J;  4LFC J;  2VQE J;  4DV6 J;  3D3C J;  5FLX U;  3JAM U;  1XMQ J;  2F4V J;  4DR3 J;  4JI1 J;  2VQF J;  2UU9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...