2GNKA

Glnk, a signal protein from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
95
Chain Sequence
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN (NITROGEN REGULATORY PROTEIN)
publication title GlnK, a PII-homologue: structure reveals ATP binding site and indicates how the T-loops may be involved in molecular recognition.
pubmed doi rcsb
total genus 21
structure length 95
sequence length 112
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gnkA00
5DRKA 4Y6IA 4WK3A 3TA2A 5D4OA 3LF0A 3O8WA 2EG2A 1NZAA 1H3DA 2NS1B 3TA0A 2VD3A 4CO0A 2DCLA 3X3UA 2ZOMA 3L7PA 1V6HA 3DFEA 4OZLA 1PILA 3AHPA 3O5TB 2XBPA 4RLEA 2XULA 4C3KA 4CO4A 4C3LA 3GSDA 3AA8A 3CE8A 4OZNA 3HLUA 4OZJA 4IYQA 4USJC 4CO5A 4RX6A 1NH7A 2J9DA 4NYOA 1V9OA 3AA9A 2GX8A 4CO3A 3NCPA 1OSCA 2NUUG 4D3GA 1UKUA 2O66A 1V3RA 2ZFHA 3N5BA 5D4PA 1NH8A 4CO1A 2NUHA 2E66A 1O5JA 3AH6A 2O67A 4YB7A 1UL3A 2V5HG 2XZWA 5D4NA 1GNKA 3OPKA 3NCRA 5D4LA 2J9CA 3TA1A 4YB5A 2J9DE 2XG8A 1VFJA 4RWWA 4USIA 1QY7A 1J2VA 2EG1A 4YB6A 1KR4A 4Y65A 1UFLA 2CZ4A 4C3MA 4R25A 3T9ZA 4CO2A 1V3SA 3M05A 4RWXA 1XK8A 3MHYA 2RD5C 2J9EA 1HWUA 1P1LA 1Q1KA 4AFFA 2PIIA 4CNZA 3BZQA 3NCQA 1NAQA 1O51A 1UMJA 1VHFA 4WK1A 5DS7A 4ZK7M 4USHA 4E98A 2GW8A 5L9NA 4NYPA 2JJ4D 2Z0GA 4CNYA 4D3HA 2GNKA
chains in the Genus database with same CATH superfamily
4KE5A 4F0KA 3HXMA 2YWEA 1Q81T 2AJ4A 3I87A 4CCHA 3P4UB 1PILA 3K5LA 3N6MA 1FO1A 2ZC3A 1RTJB 1BE4A 3IR7B 1WHXA 1S9EA 1YGYA 2MSTA 1SC1B 5B0GA 4IRDA 2WZ1A 2HZCA 4KGKA 2EBEA 3HSDA 2GV1A 4X65F 1IQTA 3MEGA 3AD8C 5J1NA 4I1TA 2HIYA 5CYJA 1S1WB 2OGUA 2CJQA 4RW6A 3QGGA 2IAJA 2CAJA 2NQPA 2QL7B 3BH7B 4FF1A 3AT1B 3RBEA 3Q8RB 4ZVHA 4OIXA 2ZUGA 4LF9F 3ZXWA 4OYMA 2AJ0A 4ZVPB 1ZM2A 2HVEA 4ECYA 4MKAA 3R7NB 3QRRA 2LFVA 1TFWA 3OD2A 1IWGA 1SIWB 1BWVA 4WK1A 2VFUA 4FNIA 4X64F 5KFZA 5AXLA 1AFJA 3SDEA 1UVLA 3W7BA 2EG2A 1M5KC 3PIOQ 4DSEA 2MGZB 4RUAA 1J5EJ 1S1WA 2B9WA 1GX6A 1TK8A 3ZZ0A 4XTTA 2GFFA 5B7WA 1QAYA 2DGOA 2N7CA 5IT0A 5DM7Q 2KKHA 4NXNF 2AJQA 3KUHA 2MZQA 4W92B 2VBWA 2Y0BB 3C6UA 3RBZA 4DFJA 2VG7B 3KYLA 1YI2S 1LFPA 2LECA 1NH8A 2RQMA 3ETOA 2UXBF 5KFDA 2HGMA 2BKPA 5J2NB 5T14A 3MAAA 2HHPA 1URNA 3V81A 4C11A 1IBLJ 1GX5A 3ENQA 4GRSA 1WOPA 2A18A 4N47A 2OPPB 2X3DA 3H20A 1N5VA 4DQRA 4IG0B 1MMLA 1IBMF 2LLZA 3LQVA 3IAM9 2ACYA 4UOFA 1R0AB 1MU2A 3KUEA 2V34A 3VCDA 3FCHA 1K1QA 1X0FA 3QZ7A 4N7TA 3DI6A 1JX4A 1JJCB 2VDHA 3CE8A 2L48A 4ER8A 4USKA 4NEYA 2CJXB 1WC3A 2YXLA 1U2RA 2AT1B 2UVVA 3CWJA 3M1VB 3HP6A 4CLSA 2WVCA 1FESA 1OO0B 4LF7J 1Q5YA 3CULA 4RWWA 8AT1B 4GKJJ 4KC5A 5DQHA 1FHTA 1R0AA 4ED8A 1E6VA 4OYIA 2MQOA 3TX8A 5KG6A 4KR0B 4OZ0A 2ZNYA 1EKRA 1KFSA 2Q6CA 1FWPA 3KDNA 1KOOA 1VQ7S 2ASJA 3R1HA 1YJ7A 2CRLA 4WFYA 1K47A 1FRXA 3T1HJ 3N0VA 1S57A 2CZ9A 4WBFA 5D4OA 1PAEX 1YLXA 5A8WB 2XO6A 1NK9A 3WC2A 2ZBQA 5I42A 4WTOB 3MR2A 3I4PA 2UVRA 4I67A 4ZIVA 4YR2A 3GSIA 2C2RA 2XS7A 4U6PA 1TQLA 4LIWA 3PYGA 1FRMA 4KB7A 1WKKA 1L3VA 1GEHA 4ZJQA 4P2SA 3BBCA 1Q7YT 4QR2A 4ID5A 3T1YJ 3AJDA 1BQNA 2M52A 2LQJA 4TU7A 5H9EK 2JSXA 2EFQA 2Y9HA 2J9EA 5A8WA 4I7FB 3QRPA 3G96A 1M5VC 1K73T 2D3UA 1SH2A 5KFFA 1GMWA 1X31C 1IBCB 1VGYA 1T7PA 3FFIA 2LP4A 4CNYA 1SL0A 3QJJA 5KT5A 4IKAA 4NA2A 1IQZA 3IG1B 2W7OA 4NCGA 3BQ1A 1YBUA 2XS5A 2MQQA 1CJKA 4ZHRB 3OJUA 1ZM9A 1FJ7A 1ZS6A 3BGOP 5KG5A 5K9FA 4LVOP 2MQ8A 3NOCA 2BKNA 1G3OA 4PAAA 1JLGA 4EZ6A 1PGZA 4NMLA 2W24A 4DLEA 4FYYB 1KQKA 1HBUA 4DV5F 3GQCA 4ED7A 3UN3A 2D3OR 5AJ3J 1YJNS 5C2GA 3IO1A 2O67A 2ZDPA 3B54A 2QJ3A 3AY0A 1RAJA 2FGCA 2GAGC 1JNZB 3TA1A 3PRVA 4ED0A 3DC2A 3J7Z5 1EP4B 2EI5A 2MKKA 4CYUB 2CPFA 4FBTA 2RDIA 3ILJA 2MB0B 5C5JA 4NZ0A 4ZITA 1LWFA 1YJUA 5F8LA 2RRBA 2OPQA 5G4DA 2AYMA 2LEBA 1HNXF 3GILA 4HTIA 1YJ9S 1D09B 3EMTA 2HHHF 1TMJA 1KVKA 4KAIA 4XDCA 3GONA 4ZPVR 5LMNF 2E44A 5IFMA 3A1YG 1IKYA 2RS8A 4R5PA 1NB7A 2FZGB 4A8SA 3OW2R 3R27A 4DS4A 1HPZB 5BR8F 2UXCJ 4G65A 5M2RA 4DX6A 4CYUA 2AP6A 4IG3A 4U96A 3RZAA 4NPOA 3KLFA 3KHGA 4UF4A 3FBCA 2YKQA 3OJSA 3CDEA 5C42B 3OLBA 3DDKA 4YB5A 3DYAB 2K7JA 2FLLA 1JLQA 3M6XA 3S7RA 1FNXH 2XMUA 2CPEA 3MECB 1NLKL 1QAXA 2KVIA 2X7IA 1Q53A 1I1GA 2R7XA 2FGOA 3WIVA 2V67A 3W62A 5A6PA 4LF1A 2JC0A 2Z0GA 2GHPA 2QMWA 1HWJA 2OPRA 4HI2A 2WTFA 2AGQA 3UR0A 3ET6B 3NNHA 2YNHB 4RNFA 3X1LB 4F4AA 3QIDA 5IOLA 2QA2A 4M5GA 2CZVC 4DLGA 4DL2A 3T1AA 3N28A 2NR0A 3UE2A 5C42A 1KP6A 4AE5A 5C7PA 2KG0A 3PKMA 1YJRA 3D6TB 1U1LA 3Q23A 5GAGI 4B9MA 3NGSA 3FK4A 2UU9F 3MECA 5HI7A 4JI1J 2UVUA 1VRQC 3AODA 3MR6A 2B4UA 2XG8A 1M1HA 3N6NA 2C2EA 4NLWA 3W2WA 1KD1T 3SYZA 2Y1JA 4RU9A 3RW6A 2AZ3A 1DZ5A 1R8PA 2HAIA 1HWIA 1RT5A 3ET6A 1NKCA 3VGTA 2OMLA 1XR5A 1UVIA 1ZPWX 3DRRB 4ZMMA 1U6FA 1UWBB 2YNGA 2E9TA 1LW0B 1D8YA 3HVTB 4O44B 1ROFA 3DKDA 2B3TB 4NCBA 2MYFA 1YK9A 4YEAA 5IXUA 1HHSA 1RWNB 4DPXA 1UVKA 3W66A 2WVEA 3H25A 2PO4A 5E3RA 3VZIA 1RHQB 5LMUF 2C1EB 1UL3A 2MQNA 4PR6A 4P7VA 2ZVIA 2HHSA 1KR4A 3V2UC 1XWLA 3A3PB 3Q8PB 1IM4A 2EPIA 4C48A 4O44A 2DNNA 2A0FB 5CZVA 2GO9A 3MPDA 1HL6A 2KYZA 2M8DB 4C8ZA 3PCOB 3AOCA 4TQSA 4OYWA 5KFVA 1X9WA 2D74B 1RLDA 3QGPA 4Q43A 3FSIA 1RE1B 1HR0J 3HX9A 3JYTB 1LEOA 4GC7A 4HDGA 2VPXB 3PVXA 2ZITA 4IYQA 1FWKA 2D9PA 3LP0B 3MAHA 3MPUB 2HWIA 4PUOB 3TWZA 2WHOA 1U1QA 3M2UB 2XS2A 2GQ2A 7FD1A 4MAKA 2QSWA 3OTOF 4OV1A 3NGUA 1U8SA 2KZMA 2GZOA 1RAEB 3CD7A 2J0QD 3LP1B 4C3MA 3HULA 2BUNA 1KDNA 1GH8A 1HNWJ 4AL5A 3TNVA 3SCJE 1HBOB 2D69A 2BOPA 1B0VA 1TL7B 4DL6A 3EVMA 5AE3A 1ZBTA 1B64A 4PPZA 2ZM6J 1TP7A 4Q8EA 4B3MJ 3G82A 3VQTA 3HZEA 2XYGB 2MZJA 3UD4P 5FJ4A 2M0GB 1RAAB 2BX6A 4EZ9A 4ZLJA 3LF0A 1UEUA 3LGHA 4YMEA 4DCPB 4PUOA 1WF2A 1CPZA 1VQKS 4FP9A 3V4MA 1N36J 2XHWA 2GA7A 3O1LA 3K17A 2NREA 2XB2D 2HVIA 4W4MA 5HJYA 1Z2LA 3H5UA 1NNDA 3EYZA 2DIVA 2I8EA 3LP1A 3QT7A 4RW8B 2OEKA 2YKNB 1IR0A 5A8RB 1HBOA 3NOGA 1TL7A 3CIMA 1LNQA 2HNYB 3P49B 1CULA 3CD0A 4F0HA 2RSQA 3ELHA 2CZ4A 3IA0A 3HFKA 5K8MA 3ISZA 4M5DB 3UD5A 3HFVA 4JYAJ 4ECVA 1TKZA 2FD2A 3PYEA 2KRBA 3DLEA 4OI2A 1CC8A 3NBPA 2JLFA 2HGNA 3C15A 4QWDA 4Q8FA 1JLCA 1RXOB 4PG6A 3AXKA 3M4XA 2KHDA 2K1RA 2R7OA 3CD6S 4OMFG 2W25A 3R5CA 5B0FA 1X4FA 4GC6A 8RUCA 3TOQA 3A3NB 2JVOA 4OL8A 2AW0A 3NWGA 2HQFA 4NLSA 2R7QA 2PMZD 4CLYA 1U09A 3I82A 2DITA 4O4RA 3MM5B 1JKHA 2I0XA 2HNZB 1YSJA 2DNLA 1LWXA 5L8RC 2DRBA 2B8PA 4FYVB 2VG6B 1QJHA 3LPEA 2DR7A 2I1RA 5A6WA 3DRPB 3M2RA 3TRGA 4LREA 2QTWA 1NZ8A 2QGFB 3R8YA 5L38A 1JXEA 1ZA2B 4QJVA 4KGVB 4ZLLA 1VLYA 5KT6A 5G0RA 2A6MA 2N82B 2UXDF 1S9FA 1DRZA 4JI4J 4TLQA 3J81j 4WKRA 2W01A 2ZOGA 3VAGA 4M8LA 2X3GA 4RUBA 3F73A 2DNQA 2FHJA 1RWPB 1C0UB 3LAKA 4OFZA 3M9NB 4YOEA 3D1HA 3MEKA 4QOTA 4LF8F 3VZHA 4A4JA 4C8LA 3QGIA 4KJIA 2DXEA 4C7QA 2HLTA 2HHVA 5D0GA 3N6LA 4P9SA 2BJ1A 1GNKA 2P5VA 2BJ3A 3PZPA 4LF4J 4PWUA 5JUMA 2LQBA 3VTIA 1PJ6A 3CCRS 2PD1A 4RNOA 4P73A 4OZ3A 1MROA 1SBRA 2HFOA 1W2BR 1OY8A 2VG5B 2DB1A 1BMQB 1HQ2A 2DNRA 2AIRB 3AXMA 1NK6A 4X84A 3UCZP 1TKTB 3Q2TC 5CCLA 3MCOA 1VC6A 3R3TA 1QE1B 4UOGA 4WPAA 4OZNA 2KU7A 1LFWA 1H0HB 3GIKA 1FDBA 1FXDA 1S9GB 2AEJA 2Q79A 3GMGA 3MAQA 2KB2A 4KPYA 3BKUA 4NLOA 4JV1A 4DSJA 4YDXA 4X4PA 3NRBA 1KC8T 2UZAA 1KN6A 3KLHA 1WJ9A 2ZVSA 1N33J 2XMJA 1CVJA 3RAXA 3TEGA 2PC6A 2E5JA 5DGAA 4HH1A 1OSDA 1X7VA 2AZ1A 2VG5A 1RK8A 3BGUA 3N5BA 3KJQB 3ZTOA 5D4PA 2IHR1 3VAFA 3C2PA 4A8QA 4OLPA 1X5OA 2QA4S 2CQCA 2M2BA 2HLUA 3W2VB 5HROB 2UV8G 3QIPB 1JXVA 2Z56B 1U4BA 1CG2A 1DY3A 4QIEA 2ZUAA 5KT4A 5U47A 1Q7LB 2BVZA 2GGPA 4PWDA 1LW2B 3THVA 1EJ7L 4B02A 2ZH5A 4HT7A 4RR5A 5J1EB 4BWJA 2HS0A 3SI8A 1WHWA 3WQPA 2QLJB 3EGVA 1RAHB 2ZOFA 2ZZMA 1JXLA 2N4DA 1GXTA 3M8ZA 5HMWA 1WC4A 4I4BA 1H3DA 2W9BA 1A9NB 3QQCD 3OR2A 5IZHA 4KFBA 4W98A 4ZPTR 5CXTA 2HMIB 2HFZA 3JSRA 5B0CA 2MY7A 3W2VA 4C3LA 2B8QA 3SSRA 3SEOA 2VUGA 3OHBA 1N0UA 5CA5A 3MMCB 4F50A 3OL7A 2E9ZA 4DFMA 3HHLC 4V19X 4EU0A 2JL9A 3T5HA 3QWUA 1NH7A 4JI7F 1LW2A 2VBZA 1TVRA 2EFPA 2VKZG 3I9ZA 4QYZK 4IO9Q 2VHGA 3KNGA 1SH3A 4DR7J 5F9NA 4FVCA 4QWAA 4TYBA 1D9AA 2DYAA 1OPZA 4AXJA 1JLEA 1RACB 2XY6A 4DR4F 4KGXB 1GTHA 3RGIA 1NCLA 4J9OA 2NXUA 3J80U 4J37A 3VF0B 1SL1A 1XNRF 4XK8C 1FRIA 4TY8B 4Y0FA 4F4WA 1N5YA 3O6QA 1HW8A 2F9DA 2OP5A 4EBDA 2F4FA 3DOLB 4IFYB 1HQUA 3LWLA 4CIOA 2VQEF 4RW7B 4WFAQ 4DCOB 4R8UA 2QV6A 4IFVA 4WF9Q 2YKMB 1CS4B 4ANEA 5LT5A 4DV7J 4FS1A 3PR5B 1Q86T 2F4VF 4PRFA 2HHXA 1R31A 4HT5A 1U49A 3HHEA 2MDAA 2FY1A 1FK9B 2V69A 3IXQA 5ETQA 4X62J 1DQAA 2XMKA 2EFGA 4H4KA 1MG7A 1D8ZA 2YNIB 1KKHA 3CCTA 1VRTB 3PIPQ 1NM2A 3AJ1A 1NJYA 2MPUA 2ZEJA 3DOLA 2M88A 1BC6A 4CNZA 3CJ8A 1S99A 4OYZA 4CLUA 2FJXA 3PW4A 2HBQB 2JJ4D 3T5KA 2IM3A 4X65J 4USWA 3ITHB 3N4WA 4DCJB 3N01A 3MGJA 3H7HB 2V63A 1ZM3A 1U6ZA 3VQSA 3I55S 1FK9A 4F4KA 2XBPA 1H38A 4LF9J 4DQQA 2LA4A 2QC3A 2X1GA 1TK0A 1O8BA 2ZHAA 4WCEQ 3ZNUA 2YNIA 2BJDA 4USJC 4ZJLA 2IDEA 4A8MP 1EB0A 4NI2B 1NB2A 2PGCA 2XYHB 5KFYA 2EEYA 3QT6A 2IM2A 4IR9A 2R8JA 4NZ7A 1NJWA 1T9YA 4RO0A 1EX8A 1UZHA 4DUZF 2P6SA 1VFJA 5J2PB 5L1KA 4PYDA 1OJ4A 3OV7A 3DDIA 4URGA 3PR4A 1WKLA 1VQOS 4ENOA 1OPIA 1HBMA 4IUFA 2E7XA 2DO0A 4NXNJ 2J0XA 2ZWPA 1IKXB 3NXZA 4GVBB 3QFWA 3HHLD 3SZ2A 2HRTA 2APOA 4ZIWA 5GMEA 1RCOB 1S77D 2UXBJ 2HHQA 4LRFA 3IGNA 3W5ZA 1FJGF 3POTA 2HHWA 3JQMA 3PRBA 3VGUA 2QRRA 3A8JA 3BN7A 4X4TA 1R7IA 3DM2A 3T9NA 4PEOA 2W9CA 3UNYA 4UTGA 1AFIA 9RUBA 5A0YA 1AYEA 3SSQA 1EAYC 1T9WA 5C24B 4ED3A 2QMXA 1VIOA 4C98A 2BJ9A 1XTZA 4ZS6A 1YBAA 1QVFR 3FSYA 3R2CJ 2FPHX 5LSRA 3GTYX 4KPCA 2IJRA 2YX7A 3MCNA 4DJBA 4QIGA 4PXDA 4ZDNA 4A8KA 3OUYB 5L9NA 3EWGA 2W8LA 1T9UA 2RU3A 1NK0A 4QIVA 1SCJB 4B3SF 4ECXA 2FDNA 1KWMA 2QLXA 4TU8A 4GO7X 1SKSA 3M2VB 2M70A 2QT7A 4FXDA 1JLFB 4J9VA 2HPUA 4CO0A 4JI3F 2Y8YA 1V5IB 3G87A 5EGYA 3KOAA 2GMHA 4MYTA 3SSSA 2B7CB 2HZAA 2BYCA 5DJBA 2R7WA 3G2XA 3K2YA 1U0HA 3RG6A 5CD4A 1VRUA 4U95A 1RADB 4C8NA 1LXNA 4CT8A 4JI6F 5GMKa 3OUYA 3EPIA 3PO4A 1KS2A 1U6BA 3KLVA 5IM0B 5E0OA 3H5XA 3TVYA 4DG1A 3BSCA 3FZBA 2RS2A 2UP1A 5KFOA 1WKJA 2C2DA 3HHLB 4PXCA 1JLFA 4UUWA 1FKOB 2EK1A 4KO0A 5HJXA 4LF5F 3C66A 5DDPC 5I3QA 1S0NA 5K14B 2J6UA 3V6HA 3HDSA 5ETLA 3J7ZT 1HI8A 3VAJA 3MMAB 4WIIA 2HNDA 3H2UB 4K4ZA 3O8WA 4ILRA 3RRKA 3FRYA 1RHJB 3X3UA 3BO4A 4DX7A 3GJSB 2CQPA 3JSBA 5KG2A 2XULA 2XTJP 4WZQA 4KBIA 4Z37A 1NK8A 1CSJA 1G2EA 2HVHA 3L9ZA 2BE2B 2HAFA 1SJ4P 2GC8A 3DRYA 4LBPA 4IRKA 2XZTB 2A6OA 4C0HA 4IQMA 3UDCA 3IP0A 2J7WA 5HLFB 3KK1A 4C4WA 5DDOC 5ETPA 4CTAB 1H72C 3CMES 4R0JA 1DLOA 3DGPA 4NRUA 3TVKA 3DMJB 3US5A 3AQPA 1N56A 3TAMB 4FKXA 2COLA 1UWAA 3IMQJ 7FDRA 2Z2ZA 3W64A 2E5GA 4H4MA 4DV5J 2YPZA 3TW0A 2VPZB 3C16A 3M8PA 4PXBA 4ZPWR 1FRJA 2VFTA 2C2NA 5EDWA 2MKHA 5F8IA 4JBCA 5IS2A 3O5TB 3I5CA 4DPUA 1NSAA 4X4UA 1SH0A 5HN0A 3NWRA 2V0NA 2QLBB 4NMXA 1KFDA 5L46A 4PQAA 2XI2A 4ZVUB 1REVA 3HZGA 3MI7X 1M0SA 3B4MA 2HHHJ 1RLCL 3HM9A 5JVGQ 4KKOA 2KI2A 2D1CA 5BYQA 1VK3A 1P9YA 3OFFA 4WE1B 5D4NA 2RB7A 2CKWA 2R7UA 2WW8A 4Y28C 5LMNJ 3GP9A 4K8RA 2VPWB 2POKA 2J6TA 4RL1A 2OH2A 1RSCA 2KXFA 3KG1A 1XK8A 1ULRA 5BR8J 1XN9A 4EI2A 4ZVEA 4DR1J 2CPDA 1QAIA 2JC1A 4UQTA 2C42A 4EEYA 1RHMB 1FVSA 3LGMA 1HI1A 2HHUA 4LSNB 1N34F 1APSA 3MMBA 3Q22A 4HACA 4JI2F 2IA6A 1R8AA 1CC7A 5LXRA 1T3OA 3FBBA 2V94A 3L7UA 3V4IB 2YH1A 2AF6A 2CJYB 1M1KT 5E3CA 1CJUB 3CC2S 1MMNA 1R3NA 4NA1A 2V2QA 2IRXA 1N5SA 2VF3A 1JLAA 3KHRA 3UR3C 2OTLS 1LWEB 2QN6B 1UJ5A 3R97A 1YZ7A 1R0CB 4K5SA 1RYSA 4KT0C 3FBFA 5AXMA 2MMYA 5A76A 4CQ1A 4FF2A 4Q45A 2PMWA 4IDKB 4KYZA 4PPDA 4F3OA 4NLYA 2RUGA 1HD1A 3AQOA 2VJUA 1JQGA 3OBIA 2JFKA 1RWXB 1WACA 3FEXB 1NPRA 2RF2B 3MTKA 5JMNA 3UW1A 2BANA 1CLFA 3CEDA 1JB0C 1D0EA 3IS9A 2CPJA 4ED6A 5HQMA 3CCJS 2UU9J 3ZTQA 4LFAF 4ZN3A 2CDQA 4OJGA 1VDHA 2DNPA 1KRPA 3CCMS 4LRCA 2GQQA 2YWFA 3BGRB 1F0XA 4EO6A 1U7LA 3DRSA 2QYGA 4OX9F 5KFKA 4UY85 3ZZOA 1RAIB 1S0MA 3MCSA 2GX8A 4NXMF 1IKVB 2NLWA 2IRUA 4O3PA 4DL4A 2XZWA 4DV0J 1RT7B 1Y10A 3NEKA 5D3GA 3EVOA 3CCQS 2FVSA 2LQ5A 1SV5A 4PYAA 3Q89A 4YY3F 3GB0A 1UVNA 2VODA 2DPJA 2VU5A 1U8WA 2C2ZB 1SB6A 1QSYA 1WOOA 3V6JA 1G1XA 2V2KA 4M5MA 4JI8F 1C1CB 4A8YA 3GG1A 2IBKA 2RAQA 3MCMA 3BGRA 5F8MA 3SQGA 4J9LA 3OHAA 1FXLA 2GJIA 1OS5A 3G9CA 1HHQA 1CJTB 1Q95G 3GJTB 1T9TA 4OLOA 2YQ3A 1NDPA 4N8OA 1BGXT 3T6BA 4OHVA 2YKPA 2CA9A 4NASA 5KFGA 1SKRA 4YN3B 1S1XB 4Y2KA 3KHLA 5DZ6A 1EETA 3I9V9 2IVYA 1LXJA 3RB4A 1JJHA 1NEEA 2WONB 4OJ1A 4ECZA 1VI7A 4C0OC 2UUCF 2F63A 3CT9A 1RT2A 4G6VB 3AJ2A 3E01A 1RABB 2G0CA 3KLGA 3IGVA 1IKWB 3PW5A 2ZJPQ 1Q79A 1A6LA 2PMHA 5HBMA 3QT5A 3FDSA 1YVFA 5KFEA 3ZO7A 4BDPA 4CWBA 4RUHA 3S6EA 1LQ9A 3AFGA 1S5ZA 3OR1B 1TUVA 3ZZRA 2J5AA 4DS5A 3BYRA 3OTOJ 1QUPA 2C3UA 2KHCA 2RHQB 2W2OP 1C4CA 4DR2F 5KG4A 1IR2A 2WONA 1U25A 2Y3YA 4KH0B 2VFSA 3M9OB 4WFNQ 3MD1A 3PXGa 5B09A 4ELTA 3B4DA 4AQYJ 2CG8A 2NUUG 3V6DA 2ZD1A 4HL9A 3OVAA 3CGIA 1HWLA 3MEEB 1IKWA 3KTQA 3NGKA 2HVZA 3R5JB 4USMA 3K57A 1UEVA 3BPSP 4Q7AA 3NCRA 4F3QA 2IM0A 4OX7A 4I56A 2L41A 3FMBA 5E7OB 1YX2A 3WC0A 2R7SA 2WSCC 2IY5B 3OR1A 4P7TA 1MWZA 3A8EA 4OX8A 5KFAA 3KJVA 2ZBRA 3JAMU 2DGWA 4KGZB 3HHKA 4AFFA 4I2PB 2HS3A 3RJMB 4ZN1A 3JQJA 2SXLA 3PEHA 1KVIA 4ETXA 3L95X 3T41A 2XSJB 1TU0B 1FT8A 2V68A 2QZ8A 1RKIA 2R42A 4I6AA 1KQSR 1FRHA 3MM8A 4CDIA 1EZZB 1N54B 3H2LA 2MLXA 3FEYB 1JMTA 1S6PA 4UQGA 3FRZA 4ETZA 3FQLA 3GFYA 1UVMA 1WWHA 3CO0P 5CAAA 4DR5F 3CCWA 5EUHA 4MIBA 1CJVB 4O0IA 3J7YU 1XC9A 5J2QB 3PY8A 3SFUA 5IC4B 4N41A 1JIHA 1OY6A 3RUBL 1YWXA 1UW9A 2CVIA 3DLLQ 4P52A 5FDLB 2CJAA 1IBLF 4Y2MA 2ASDA 2DCUB 3TZXA 4XIUA 2XLJA 4U9RA 1UZDA 2X1FA 2Z2YB 1ZAWA 4DOZA 2D7SA 2HQIA 3ICLA 5H9FK 4K2XA 3SCIE 4M5NA 3MR5A 4BWMA 4ICLB 2HYIB 2RRAA 2EKYA 4F36A 2YKAA 1XEZA 4QZVB 4CH7A 1F60B 1KBRA 3GFXA 1H2VZ 1GMUA 1RDRA 1X60A 2R7VA 4EMDA 4MFBB 4ZLPA 1QTNB 3QAEA 3NLCA 1VIXA 1ZPVA 4OHWA 5D0RA 1S0OA 2KO1A 3D54A 2FZKB 1TL1B 1ZTWA 3M9MB 1HIYA 4A48A 4BS2A 1J5OA 4I0WA 1YJWS 3EGNA 3OQ2A 3NGRA 4ZP8A 4PG5A 2FZCB 4F4ZA 3M30A 2R8IA 1N32F 4WIQA 2BM1A 2RE1A 1DARA 2OFGX 1JLBB 1RT6A 2J7UA 3GLJA 1FDDA 2UXDJ 2C2KB 1RA7A 1XNQF 3QO9B 2XMMA 2PT0A 1S59A 2XEXA 1TL3A 5K8PA 4XDDA 3M8QA 1AT1B 2A2CA 4L76A 3GV7B 3OFEA 4DL7A 1NKBA 1RP5A 1S1TA 4X4NA 4YDDB 2RT3A 1S1VA 3W8PA 2JEFA 1BXNA 2XCAA 2IC3B 5ETNA 1FKPB 1S72S 1FXRA 2DBBA 5GAHU 3JSMB 2IFXA 2K7KA 3GPAA 2HGLA 4OJHA 3LUYA 1FFWB 3TA0A 1KVJA 3GWCA 3QLHB 1T05B 2C2OB 4IO1A 2B5JA 2DNHA 3GFZA 4JI5F 3T1YF 1SQGA 4LF6F 2R9LA 3KJFB 2M5YA 4CLKA 5LSOA 1RT1A 1S9EB 3M8YA 3EPGA 2KFYA 1NSQA 4AXIA 2ZKUA 1WOSA 4EWTA 2CQ1A 5E41A 3BKFA 1D9FA 4C8OA 3CC4S 2ZH9A 3DOKA 3G6XA 2RQKA 2HBRB 4LSLA 4RW6B 2IAJB 2FJAB 3GIIA 2RIJA 3W65A 1MLAA 4ECRA 1M5SA 2ASLA 5F8NA 1FKPA 1Z1ZA 1MNEA 1P9QC 3IR6B 2VA2A 5C25A 2F5GA 3FCVA 2ALYB 5D77A 3ZTPA 1RAGB 3QLHA 4Y2IA 1T05A 2I6WA 2O5DA 3O3LA 5HVGA 5KFTA 4ZP9A 4ECUA 1UTAA 4RNNA 5DM6Q 3SDEB 4FNHA 3LH2S 4KV8A 1ZM4A 5DG9A 3PHEA 3W1YC 1LK7A 2GQCA 3NMAA 3Q8UA 5ITHA 2Z57B 2ZC4A 3F41A 4OI1A 4C3KA 2N3OA 2BABA 3EXYA 3CJ4A 5LJ5Y 4RJVA 5DG8A 3DRXA 9ATCB 1FA0A 2BW2A 4TNOA 1VHIA 1OQ6A 3C6UB 1N4LA 4O3OA 4W90B 4LRAA 3O2IA 3W61A 3NS5A 1TKXB 4B17A 5A2QU 1HNZJ 4R25A 3MAAB 1I3OB 2V8DA 4CZCA 2X51A 2ROPA 3U1NA 4URSA 3V81B 2LEAA 4C11B 2PEHA 4C0BA 4BBYA 1RUSA 1PO6A 2HW3A 3K89A 2H4YB 4JI7J 1X4DA 4YR3A 3LWMA 2WK4A 4NLTA 4K4TA 1WEZA 1MU2B 4MH8A 3CCLS 2AV5A 3KWMA 2BZ2A 1EHWA 1GMWD 2G4BA 4KGMA 4IH6A 4WXWA 4PCQA 3DI6B 1RTDA 3CDUA 2W7AA 2MKJA 1RWMB 1HHTP 1TKXA 2VASA 3KJNB 2PI4A 1AZSA 2R8GA 1MMDA 3HKZD 3DHWC 4ECSA 4C2MA 1TKDA 3GR0A 4DU8A 2E66A 2ADCA 3UN5A 4RNHA 1KEKA 4WXOA 2Z2MA 4DSKA 4YHHJ 3P96A 2HEKA 2UUBF 3DXSX 4OYXA 3TZWA 1VBKA 4AL6A 1E6VB 2VQEJ 2B51A 3C14A 2WSEC 5L1JA 4OX6A 2W4CA 1U1NA 2FHKA 2BQRA 1T9VA 1HBNA 1WG5A 1O51A 5E3PA 1U1RA 3A13A 5KFLA 2F4VJ 3AD9C 2R8HA 3EXCX 2YVSA 4LSZB 5DZ7A 2DHAA 1HD0A 3KK2A 3CD5A 4TY9A 5CCMA 3DFEA 2NYIA 1T95A 5J1PA 5I42B 2WVDA 1NPPA 4NEZA 2N7YA 3M32B 3BKTA 3H4DA 4CH0S 3PJXA 1NRKA 2E5HA 1WEYA 1YZ6A 4CO5A 2FHMA 3ZFVA 1UW4A 3KXDA 3VAHA 1X9MA 1FJEB 1DURA 2BQ3A 4OHXA 1SJRA 4Y34A 2ZH2A 1FF2A 2MTLA 4ID5B 4NCAA 1BQNB 4HDHA 1FD2A 2VH7A 3IR5B 4JP8A 2XMWA 1OYDA 3JXOA 2V8GA 2VC0A 3MM6A 3ULHA 3QATA 3I5BA 4NLGA 3FVYA 5E3QA 3K0JA 2GW8A 5CQGA 4TLRA 3M32A 5F8GA 2LVWA 5KFPA 4D3HA 2G13A 3FFIB 4LRDA 4IR1A 1HWKA 4DUYJ 2U1AA 3HSZA 4NCGB 3D1QA 4WFXA 1HNIA 3MEDA 1CJKB 5I3UA 4IOAQ 4QU6A 2PI5A 3P5TL 3KUGA 3H4BA 4KY3A 3NP5A 1TK5A 3T5JA 5IWAF 2ZZTA 3QBCA 1JLGB 2MZ1A 3PJWA 4WYWA 4J9NA 4RKUC 4QCLA 1QLNA 2V8HA 2LMIA 2M7SA 2DO4A 1G4CA 3IAS9 1S4EA 1HBUB 1Q0NA 4F4YA 2OO4A 4Z2XA 2JEIA 2ZDOA 1OWXA 1P1TA 4LR9A 5ETTA 4DV1F 4USIA 3DNCA 2HFNA 5MLCV 4LF2A 4UW2A 1FJGJ 4OZ1A 2JVRA 5L1IA 4ID8A 2HK2A 1LWFB 1RA6A 2OPQB 3QRQA 4L3NA 5KG0A 2FLOA 4X4OA 1PYSB 1VQ8S 1Z4UA 5CABA 2PSZA 3BBBA 3MM7A 3KMSA 4XPEA 2BV3A 4K4YA 4LMZA 3L7PA 1IKYB 5HP1A 4R5PB 3DLKB 4ZVTB 4PKDB 2ZBIA 2F40A 3KK3A 2Q1LA 4NLVA 3BSAA 2PFDA 2OPSB 5ADZA 4OYAA 1MSWD 1RTHA 3NCPA 1RT3A 4IG3B 5D8HB 4LR8A 3KLFB 1RTIA 5THWA 3D6FB 2GVDA 2QLFB 4B3MF 4JI3J 4I2QA 1Y5NB 1T0TV 2OFHX 3GZ7A 1Y3KA 3MHYA 1QVGR 1JLQB 2AX0A 3MPYA 1VC0A 3KFWX 3HHDA 3TEHB 2JEGA 4LRBA 3WDOA 4WP9A 1XMQF 1TL4A 3T5LA 3CJ0A 4K7QA 3R5GA 3DLKA 1PCAA 2DNYA 3UNGC 1UJ6A 1RHRB 4RU2A 1N36F 3H40A 1KHVA 2AYGA 4GKKF 2DH8A 3BGFA 3ENWA 4P2FA 2OPSA 4WP3A 4DR6F 5AE2A 4JI6J 2OPRB 4YUDA 2O1PA 2Y1LB 2G1HA 3MDFA 4ZPAA 2V9WA 1RWVB 1R43A 2DHSA 1M5HA 1F1BB 3CDWA 4ED2A 4LF5J 4JV5F 4RW9A 2V50A 1HLWA 1S49A 2PN6A 2NUHA 2OSQA 1U0SA 2GJ2A 2WRMA 4FF3A 3CJKA 5K8NA 4HYKA 3CC7S 1R27B 1EARA 4Z7YA 2EG1A 3GJQB 5HSPA 2BMBA 4OI4A 5BJRA 3W2WB 2G2ZA 1F5CA 2V8PA 2OI2A 1T8EA 1RBAA 2ZNZA 2RVJA 3B8HA 1RT5B 2CPHA 2B43A 1Q4RA 2J6SA 2X1AA 4S0MA 3CJSA 4C8MA 1HNVA 2KDOA 4U7UK 3P6YC 4Q0BB 1JJ2R 3CW2C 1BWEA 2HWHA 1F2GA 2CJKA 2ZH4A 2YNGB 3D6MB 2WW4A 2QL9B 2RU9A 3R5AA 2W8KA 1JK9B 2BE9B 2H48B 3SQOP 1F9HA 2H4WB 2IDLA 4QYZJ 1NHVA 4DXLA 4G1QA 3DLGB 1ZAXA 2OELA 4OQJA 2DGVA 5M2UA 4M95A 4GMKA 1UPMB 1XMBA 2O66A 1X4GA 4YQWA 3C6TA 1QUVA 2J0WA 1U2FA 2VBYA 1RHKB 4F26A 4DR3F 3HJVA 4EO8A 2JLEA 2MXYA 3HT3A 2XWXA 1RWUA 4Q0BA 2CADA 3D28A 2FTRA 5T41A 5KT2A 4WYLA 4L74A 4ZCMA 2DNKA 4AD6A 1Q1KA 3I31A 2XYPB 1FFSB 1LWCB 1M90T 3TUJC 1FNOA 2HSEB 1H74A 3CJ3A 5SZTA 4QIFA 1VQYA 2MY8A 1QSSA 3DLGA 4UT4A 4RNMA 4B3TF 2D41A 3ILIA 1PSDA 2CQ3A 3SMZA 3UVJA 3NAIA 3ENVA 3OT9A 3L3CA 4IOCQ 2DHHA 2DD8S 5HATA 2KYXA 3GSDA 4MIWA 1F2HA 2V6AA 4BC9A 3QSYB 2YKOA 4RBTA 1ZAVA 2W2PP 1RT4A 2RRNA 1OIAA 3Q0AA 1NK7A 3R7BB 1N34J 3F56A 3H90A 3HK2A 4Z7CA 1S10A 3TX0A 2CQ2A 2V5HG 1LWCA 3ILOA 1SQFA 4JI2J 2Z58B 2VFVA 3CDAA 4P2MA 2G1DA 5KFMA 1B0PA 2W2NP 4YB6A 4QWCA 3GR1A 1NDLA 2DGSA 4HHUA 1VQMS 4M1KA 2JX2A 5F41A 4DSFA 1WELA 4O3NA 2QLWA 4H4OA 1AB8A 4QPTA 2PIIA 2WBMA 1UMJA 1Q8LA 3DOMA 3I0RA 5LL6d 4N56A 1WSRA 3BSNA 2F65A 2EW9A 4F8RA 4WZMA 3VHQA 1PAUB 3G82B 3G8SA 4K0KF 2QX0A 4I68A 4CLLA 2DCLA 2DR9A 2KT5A 4DWIA 1D9DA 4CP5A 4B3RF 4DZ6A 4O3SA 3I6PA 1DTTA 1BUXA 1VR6A 5HMYA 3H98A 1FE0A 2H54B 1WSVA 1F9FA 2UV8A 2B56A 1SC4B 1N52B 2GJFA 2FHJD 2Z2LA 3P45B 4UOHA 4LFAJ 2FVRA 3FC9A 4FPIA 2EBGA 1SQEA 4LQ3A 5KG7A 3RB0A 1CULB 2HWTA 5AE1A 1TFYA 2XWYA 2L9WA 3D66A 1UVJA 3DGVA 2WOMA 3GE9A 3TP2A 4K59A 3LP2A 2NXEA 1SXLA 4X2BA 2HK3A 2KVQE 2HVDA 3NL0A 2CNKB 1TKZB 5T7LA 1PJ5A 4FXWA 4OX9J 3DLEB 4F02A 4NXMJ 3NBPB 1DTQB 4LFCF 2IVFB 3C15B 2VOOA 4C9DA 3I32A 4PWWA 1JLCB 2K1RB 3N9UC 1X5TA 3UI3A 3BO3A 3AHPA 1L3SA 3TAPA 4YY3J 4H4KC 2DIUA 4KRWA 1WC1A 3VV2B 2MZRA 4DX5A 3MWBA 3C19A 2ZE2A 4DPTA 3PKYA 4A46A 3N5FA 5IT4A 1Q8BA 4DR7F 2M9KA 4JI8J 4DBQA 4TXSA 3Q8QB 2ZWOA 5IV3A 4N5SA 1JKHB 3I4HX 5J2MA 3CIZA 4I64A 4ILMA 2GO8A 5B0BA 5ETOA 4DV4F 3HVWA 4PXEA 1DTQA 1FX4A 3FZ2A 2AJ2A 3QFHA 4ILLA 4M5KA 4RW4A 3TJAA 3M2RB 4O0NA 1RU1A 4C97A 4FF4A 4V1Ak 2R2TA 1NAQA 4CLZA 5F8HA 1Z2ZA 2BM0A 2BA9A 5G0RB 2GNKA 1VISA 4DV7F 1W7WA 3U27A 2DNGA 3CSKA 4QW8A 1P27B 4QU7A 2NS1B 5B08A 2LCWA 3TUPA 5E3AA 4LT6A 3BREA 5KFWA 4X4SA 3V6KA 4RLEA 2UUCJ 1NKEA 1FCAA 3FQKA 2C3OA 2MHNA 1YRXA 5LOQA 4LFBJ 1S6OA 4MYUA 4ATNA 1TTHB 2HQDA 1NMEB 1QSLA 3MUVP 1KOHA 4USUA 3SCKE 5A8KB 5CYQA 3GG0A 2BBEA 2IM1A 2L9NA 5KOWA 2MQPA 2AEMA 3THPA 1BQMA 4DR2J 1MROB 2P6TA 5EHHA 3GYGA 2JRSA 4FN5A 2GHWA 3RAMA 3JQKA 1VCTA 2CXEA 4NE9C 2L3MA 1I94F 1WDDA 4FYXB 2HKEA 3GCXP 3W9HA 3FMWA 2OSRA 2ZHOA 2K2PA 2JEJA 4QR1A 2DR8A 1RTJA 5CZXA 3AA8A 3KLHB 2V2ZA 5A8KA 5D78A 2FJWA 3UDVA 4DL3A 3MOJB 3QYYA 1SPBP 5JVHQ 2NXJA 4LUBA 2FJEB 4NOHA 2UUAF 2HZVA 3OPKA 3EICA 1NSKL 4TU9A 4QW9A 3J80Y 2YNFB 4P6QA 1U1KA 2FVQA 5F3TA 1UFKA 2KRRA 4DR5J 4O3RA 2D3ZA 3VAKA 2GGPB 4PWDB 5KFHA 1VJQA 1FD8A 4DFPA 2IIHA 3EZ5A 4OYPA 4K4VA 3D1OA 1QTMA 1GXLA 3C3LA 2BRKA 5KTQA 4OI0A 4WWSA 4YFUA 5KFRA 2MGZA 1ZZNA 1WC5A 1NDCA 2WB4A 4N76A 4QYRA 2W9BB 3OR2B 2NPIA 4KFBB 4U67Q 4ANDA 3HPOA 2E1AA 1V3ZA 3HVRA 2YNFA 2VG7A 3HLUA 1GFWB 5F9LA 1MWYA 4CO3A 1ZYQA 3FGVA 5ETKA 5CYMB 4ECTA 2A10A 3EE3A 1TVRB 4J9SA 3LGNA 2WCXA 5J2NA 3Q2SC 2DGXA 3CJRA 1KQFB 2F8HA 2EC0A 3MR7A 1S76D 4EBEA 4LVNP 2AYEA 3R2DJ 1SIZA 2ZHBA 4CLTA 4ZA1A 1JLEB 1AXQA 1GXUA 2OPPA 1JWWA 4IG0A 2V2VA 3NCQA 5GAGU 1UFWA 1M5OC 1NO8A 4H54A 1JNRB 4FKYA 2DT9A 1HA1A 4B9SA 1VQLS 4Q2MA 1N32J 5F0UA 1VS3A 1WC0A 3VGSA 2R2SA 2E1CA 3RYLA 4IRCA 1N5YB 1C2PA 1REGX 2FVCA 6FD1A 4GO5X 1XNQJ 3KKFA 4FZVA 3TQEA 1U26A 1R8CA 5CYMA 2I9SA 2MEWA 1HQUB 1FEHA 4RBVA 2A2DA 1XERA 4R8UB 3PX0A 3B82A 2F9JA 4IFVB 2YX4A 3LA0A 3NNCA 3M1VA 3GFHA 1YQHA 2I38A 2HG4A 1Y3JA 3BJYA 5LXYA 2B7BB 4DPYA 2HURA 4G1IA 3R7SB 2DKOB 3SBMA 2N4CA 3DHXA 1K8AT 3MFIA 1FERA 1K0VA 4LJMA 4USTA 5HO4A 1KLMB 2RJZA 3BQ0A 1IBKF 2OEMA 3M05A 3WZ0A 1TMMA 2O01C 2G2OA 1HWUA 1P1LA 2LU2A 2RMLA 1GK8A 4JI5J 4DEZA 4LF6J 1TUWA 4MKVA 3I0SB 2CQHA 3Q24A 2F3JA 2I2YA 3CTRA 2KG1A 1XMOJ 4QWEA 2HRYA 1Y5IB 1S97A 2DPIA 4IH7A 2RILA 1DQ9A 2YBVA 2W1BA 1V6HA 3ZTRA 2JLGA 1H2UX 2NZ4A 1RCXB 3A8KA 1FRLA 2DGUA 1RBLA 2P2CB 3RAQA 1XIQA 3HI9A 1PBUA 1KLMA 4K50A 3BSOA 4KHRA 3BO2A 3FCWA 4Q2LA 4N8NA 3KLEB 2MHEA 5L1LA 2KT3A 4YR0A 1KTVA 3TANA 1YDLA 3R6GB 3I0SA 5AT1B 3MPVA 1Q8IA 2W4DA 4ZVFA 5K20B 3RRHA 3T3FA 2RDDA 4I7FA 3BR8A 4WJBA 1IR1A 3F44A 3EZOA 2BOAA 1HBMB 2DH9A 3BF4A 3D4JA 2AJ1A 4X66F 2F7VA 2MKYA 3IG1A 1CBKA 3ILLA 4ZHRA 4JV0A 2RNEA 1JJ4A 3TAQA 1YG0A 2XY5A 3KLEA 4ELUA 2XC9A 3AOAA 2CFXA 1Q5VA 1RWKB 2L9DA 3ZZZA 2VDIA 3W60A 4WU3A 3S1TA 1R6VA 4X64J 3POTB 4J91A 1TL5A 5L39A 3EDQB 2VQFF 1G7CB 2XI3A 5KT3A 1A0OB 3QNWB 2MKCA 3L09A 3DM2B 3M7VA 2W9CB 1G6BA 3D3BJ 3UCGA 5A0YB 4DR1F 2DISA 1B0TA 2RUSA 2WVBA 1EP4A 2BACA 1FNMA 1KSPA 4JOUA 4F3MA 3PFEA 2LA6A 4ZCIA 2B4VA 5KAKA 3PHTA 3LANA 2XMVA 4QIWD 1DHMA 3LALA 5DDRC 2RKIB 4ZJOA 4JV2A 2DNMA 4HHJA 1DBDA 1UP1A 3G8QA 1NU4A 3SV4A 4NYPA 2E29A 2EXUA 5KFUA 4KHPF 4C8YA 3H5SA 4P10A 1QAJA 2ROGA 4ZCKA 2MJNA 3HT0A 2DK2A 3VVUA 4YP3A 2DNOA 1HPZA 3A3OB 1DQ8A 1GTEA 2UUBJ 1IBMJ 2OTJS 3Q83A 3K58A 2ZH3A 4TKTA 2CQGA 2VB6A 2O3DA 1U0HB 1NJXA 2IJNA 1VRUB 2RKIA 4EK2A 3EGZA 1VQ5S 1W25A 3G6VA 2V4RA 3UCUP 1MN7A 3IC1A 3DYAA 3DLBA 2B9EA 4ZVSB 2K06A 3LO3A 3BPDA 3OTBA 4DG1B 2PA3A 4KTQA 1X4BA 4KO0B 2OIHA 1KQGB 3LPYA 2HNDB 4TYAA 2YNHA 1C1BB 4HKQA 1VYAA 2VD3A 1URRA 2OUGA 3OXLA 4XO0A 2R3VA 1FVQA 3CJ2A 4ECQA 3QJPA 2VA3A 4L72B 2KXNB 4F67A 4DV0F 1B3TA 3TZYA 4P75A 4OZJA 5ETVA 2AU0A 4NYOA 1KLNA 3G4SS 1PYTA 2IRYA 2YWGA 4K4WA 5H9FJ 1XR6A 5HVFA 3CJTA 5D0EA 2N3LA 2JWNA 4PABA 4O3QA 3KK1B 2R2RA 3WX8A 4EYHB 3EZUA 1IUJA 2OHDA 2C2MB 1DLOB 1C1BA 3VWSA 1R89A 1Y11A 3DGPB 4WTYA 5F3ZA 1YHQS 2DRDA 5KT7A 1BY9A 5IWAJ 3DRRA 5EWEA 4BLGA 5DGBA 3D67A 4USHA 3P5BP 1UWBA 2R7RA 5M2PA 2CNOB 2PA8D 4XPCA 1ITPA 3JB9k 3OLAA 1LW0A 4H4MB 4OV6A 2ZBPA 3HVTA 3C16B 3LOUA 3M8PB 3CCSS 3S01A 1HMVB 1X5PA 1VLOA 1N0VC 3MMJA 4DV1J 4KHMA 2D3O1 2DGQA 3CJQA 3BEGB 1AW0A 1RZMA 3MURP 3BDPA 4ZLNA 2FIUA 5KFBA 1RQ0A 3FKBA 1VQ4S 5ETMA 4ES2A 2ZH1A 2AQ4A 3BH6B 4DV2F 1VBZA 2VC1A 3AA9A 1RWWB 1H7XA 1P6TA 1REVB 4ED4A 5KG1A 1V3RA 4OI6A 3OL6A 5IV4A 2LDYA 1NJIT 2ILZA 4KKOB 1AUSL 3I96A 2NPFA 3U7JA 1XBWA 5D4LA 1XR7A 5KFIA 1J2VA 2PEBA 3E3XA 3UPFA 1X0PA 1NHUA 2E5LF 3UD3P 3NAHA 1Q8KA 2YY3A 3PX6A 2VIHA 3UDLA 3NMRA 1R8HA 4L3KA 1HMVA 2FVPA 1OYEA 3GIMA 3NS7B 3BGLA 4DZDA 2MKIA 1ELOA 2EWHA 1N8RT 2XMAA 1QD1A 3RTVA 1LOUA 4DSIA 2CJBA 2QL5B 3PG9A 4GVLA 3MMBB 3WHIA 4HACB 2H1YA 4AQYF 1O0PA 4E8UA 4OHYA 1KNZA 1HNXJ 4J7CA 3JYTA 1C4AA 4AUKA 1M5PC 2LDIA 1ZOTA 4ZPDA 3LP0A 1XMQJ 1JLAB 3EJMA 3M2UA 2FQQB 2HQGA 1F5AA 2XCPA 2LXUA 3KNAA 2XNRA 3VAMA 4GKKJ 2IYGA 3CCUS 1UCNA 2EK6A 3D68A 2IA0A 5I3PA 1Y7PA 4DR6J 1QM9A 1HI0P 3M6VA 4DDFA 1NXIA 3D9BA 1Y0HA 1WHYA 1S7HA 3MPWA 4RUCA 2VJVA 3SXLA 1Y00A 5C2CA 1UPPA 3D3CJ 1LK5A 2VV5A 1FFGB 2DXFA 2BANB 2HFSA 2QO3A 2WB1D 4JV5J 3M8WA 2BKOA 3G71S 1RB0A 2A1BA 4ZVOB 3IS9B 3CCES 3QT8A 1RAFB 1NBEB 4IOBA 5SUHA 4TVAB 1XQIA 5HK4A 4K4UA 4ZVRB 4J5OA 3GV5B 3JS9A 3KG0A 3SFGA 4HTJA 4MT1A 4IH5A 2FC8A 3PFOA 1RYRA 1PBAA 4RW8A 3TVZA 3DRSB 2EFOA 2RQCA 3PTWA 4B9LA 2YKNA 2FHOB 2RQ4A 2HQCA 5A8RA 1B99A 3HVAA 1S48A 3OSPA 2ZJRQ 4WFBQ 2R2UA 6AT1B 2HNYA 2BW7A 2CQ4A 3NKYA 2E1RA 3ENAA 1BD6A 2AD9A 5D3GB 2FJDB 2OKQA 4MIAA 1SV5B 1U2CA 4M5DA 4WFZA 2RD5C 2W7PA 2ADBA 5HL7Q 2CVEA 3EVWA 5KFQA 5KFNA 2AX1A 4WKYA 2IPOB 3DN9A 2Z8QA 1YTYA 5ETRA 3SQGB 1PJ7A 4ZPCA 3IM9A 2MQLA 5KOXA 4DMZA 1GMVA 2E1MC 2P9GA 4DR3J 3KHHA 1X4EA 4A8WA 1WG4A 4M5IA 2KJVA 1UETA 1WG1A 4A8XA 3G8TA 2G9OA 4M5JA 3TYTA 3MM5A 1FE4A 3BYPA 3WIUA 4PG8A 4J9MA 2HNZA 4EUVA 3RW7A 3JAMY 1HARA 2CQBA 1CQNA 1WC6A 4QBUA 1EETB 2EVZA 1NHKL 3HHNB 4YB7A 2VG6A 2CUYA 4B3TJ 1RWOB 3QSIA 1YRUA 1F9EB 3DRPA 2BE7D 3RBXA 5D15A 1Q82T 2HBZB 3CJ5A 2EC2A 1A7GE 3CO9A 2HS4A 2AKWB 5KFCA 1HFEL 2E5IA 5LMUJ 1PC4A 1RT2B 4NLPA 1Y5LB 3E01B 4JI0F 3OTCA 3KLGB 3GV8B 2Q66A 5DS7A 1E6YB 3PYFA 2ACMA 5HBMB 3WBZA 2LXIA 1SJFA 3IWNC 2X1BA 3KDOA 1YBTA 2YWHA 1IJFB 1PKUA 2KFZA 2ZOMA 1VC5A 4Y2AA 1ZH5A 1FJCA 1SC6A 4DV6F 1X4HA 3R5DA 1C0UA 2YQ0A 4MTPA 4NRTA 4DL5A 2J8AA 2OD6A 1EKSA 2ZH7A 3J7A1 1FDAA 5CHCB 1OSCA 1TAUA 4DV3F 3MF5A 3V6DB 2C3PA 2ZD1B 4ES3A 2E7WA 3VR1A 2ZH6A 4NA3A 2H5EA 2Y0SD 4AYBD 2R7TA 4K0KJ 2J9DE 4J9QA 1E6YA 2K3KA 3NS6A 1MWQA 3T9ZA 4ALZA 2FUG9 1VQNS 3KJVB 1TKTA 3M6WA 4B3RJ 4ED1A 1T11A 1FTCA 1VHFA 3CPWR 4K4SA 1QE1A 1X8DA 3HD2A 2LXFA 2KTQA 1S9GA 4Q5VA 2B4OA 3MM8B 2KT2A 2OEJA 4CM0A 2ZBCA 1WI8A 1U45A 1S6PB 5H9EJ 2VPYB 2JH3A 4FBUA 3MUMP 2YPYA 4U7CA 4K4XA 2EFVA 4O4GB 4CO4A 1VQ6S 2GHVC 5MAOA 4J9KA 4OZ5A 5GAEU 4CLWA 3W63A 1HNZF 1C0TB 2JOQA 1K44A 2ZFHA 4DX8H 5KFXA 3G86A 5HROA 1SKUB 3RRGA 3QIPA 1WTBA 2QIFA 4LFCJ 3K5PA 5H1SV 1J5EF 5LJ3Y 1PIEA 1Q78A 2H51B 4QR0A 1ZZFA 1U1OA 4YB1P 3AAWB 3PW7A 3K5NA 8ATCB 2KXHA 1S12A 1VMBA 5J1EA 4DFKA 2WAQD 3HCXA 5DLGA 4O4GA 3B78A 3QMQA 4M63A 4UOCA 4F2RA 2H5JB 5BYRA 3RB6A 1C0TA 3IWXA 4C6AA 2EFNA 1TV6B 3CB4A 4NLRA 2Q6BA 4G1PA 2HMIA 2XGQA 2LQ9A 2DR5A 4NLDA 5BXIA 4OZLA 5IC6B 4DV4J 3RBDA 3M8SA 3MMCA 2DXDA 3QWPA 4J9RA 3TR5A 3ONQA 2DH7A 3MTJA 1IWAA 5DETA 3MFHA 4YHHF 4F4XA 2HHTA 4DPWA 5D0HA 1YIJS 4I6WA 5LM7E 1L3UA 1CQMA 1J5OB 1NK5A 5FD1A 4C8KA 1X5SA 1T9XA 5D6GA 4MMOA 3M30B 3H0PA 4U8VA 4B3OB 2EKNA 1RT6B 4ED5A 1WEXA 2ATLA 4PZVA 4EBCA 2PFFB 4DQIA 1RJJA 3QPIA 1VQ9S 1VBXA 2BRLA 1UFLA 4CM2A 5B0AA 3PRDA 3MR3A 2CPIA 1TL3B 4CRJA 5EX0A 4XAKA 1PC5A 2KL8A 1TV6A 4NZ6A 3M8QB 2ZZNA 3EUNA 5DLFA 3TJ9A 1S7IA 4I6YA 2V9KA 5KFJA 1R0BG 4TY8A 2B9YA 1S1TB 3P8BB 2VZ9A 1S1VB 3P3DA 4LF7F 2Y1IA 4CLPA 3LW5C 4IFYA 3RU0A 4GKJF 3DLHA 2CQ0A 1F6TA 4RW7A 3TZZA 4O23A 1BLUA 1D1UA 4B3OA 5B0DA 1DFDA 2J7KA 2YKMA 1CS4A 2ZH8A 2B5JB 3CMAS 3K59A 2CPYA 2HQ3A 2W2MP 5A2QY 4RX6A 2CIMA 1RT1B 1YJTA 3T1HF 2Q3PA 1EQ0A 1EIYB 2CYYA 3E51A 1NPKA 3DXBA 3HD1A 3GCWP 1I94J 1RHUB 4NLXA 3DOKB 2DGTA 4LSLB 3ZZUA 2AWZA 4V19J 4Y65A 1VRTA 4LF8J 3N79A 4A8OA 2LU1A 5C25B 1OMSA 4DUYF 1VBYA 5GADU 3BZQA 3Q8VA 1KONA 1NSPA 4M5HA 4DU7A 1X4AA 3NNAA 3PNIA 2FY8A 2AHOB 3ITHA 2M3DA 4BCAA 1J27A 2DVIA 4OI3A 2CQDA 3PW2A 4KQZA 2UUAJ 1B7FA 3ZZYA 2XHCA 3MXHP 3W3SA 4MKYA 2DHXA 4U7UD 3PACA 2E9RX 4QQBA 1F3VA 4ZVGA 1B7YB 4KV8B 5DDQC 2Z30B 2XY7A 2FC9A 3NGTA 5DQIA 2FLPA 1S0VA 3E2EA 2Y8WA 3OXGA 4NI2A 3UN2A 1H73A 1L3TA 5EWGA 2J0SD 2AJFE 2CQIA 3GIJA 3K8WA 3W9JA 5E5NA 3K7RA 4LIRA 4OHZA 1RGVA 5HANA 1SI9A 5J2PA 5CH7B 2QMUB 4FXVA 2VFRA 4OJ3A 2MZTA 5EX3A 5HAOA 2M4MA 1F3FA 2QE5A 4CO2A 3CCZA 1IKXA 2AGOA 1FKAF 4GVBA 1CEZA 3FSXA 2KM8C 5AJ3F 3OL8A 5E2QA 4WP8A 3TJ8A 1N5QA 4ELVA 1HQEB 3V5RA 3IBWA 5GAEI 3ISNC 2BJEA 3CCVS 2C22A 2VL1A 3K5OA 2A3JA 3E8OA 4K5RA 4L73A 5GMDA 1SL2A 3VVTA 1RTDB 3U02A 2AGPA 2PDAA 2DEIA 4J9PA 4DI6A 2YWWA 1SC3B 5C24A 1VK8A 1AZSB 3CF5Q 3ZC4A 3A8IA 2ZJQQ 4B9NA 3MOZA 2RDJA 1WDTA 2FLNA 2V4QA 1D3WA 4UZBA 1HQEA 3BR9A 4ZCLA 2UXCF 4FYDA 5HMXA 2AYBA 3J7YI 2H65B 3J81Y 3C14B 3AB4B 3EX7B 3L4BC 5FLXY 3A4TA 2OAUA 1HBNB 4TQRA 4QWBA 3EDRB 3HF5A 2KFNA 2JFDA 4EGLA 3M2VA 3WX4A 5AXNA 1VQPS 3OFHA 4DR4J 3HO1A 1L5UA 5GVQA 2ILYA 1S6UA 3KK2B 3LAMA 3D7SB 2C28A 4YS2A 1NK4A 1XNRJ 1IBKJ 1H98A 4RBUA 5BYSA 5DQGA 3R6LB 3MZIA 2GIRA 2VONA 2GIQA 3ZZPA 2DY9A 3PW0A 3SV3A 2MSSA 3IRXB 1U02A 4UUXA 4R0EA 1LKZA 2QA1A 5IM0A 2J9CA 2MLZA 2DTJA 2XLIA 4KSEB 5FIIA 2XGPA 3HHLA 3TQ1A 3H8YA 5EN1A 1FKOA 1IJEB 3OSNA 5K14A 1N6QB 1AA1B 3MM6B 2F8MA 5LSLA 1O6XA 1S4FA 3MMAA 2NSBA 2QFJA 4JI1F 2OLWA 3W5YA 4ZP7A 4AT1B 3PV8A 3DLJA 2HBYB 4X4RA 4DHVA 2UUTA 2NSCA 1NJZA 4OYBA 2H9ZA 2Q43A 4FVMA 2UVWA 1UJ4A 4ERDA 5HMZA 2P9EA 1PG5B 3IRXA 3JSYA 1HNIB 3MEDB 5I3UB 1QDUB 2B0GA 2ZKTA 2ERRA 1IVZA 3TO8A 3OVSA 2BE2A 2B4PA 3G6ES 2FB0A 4J90A 2RHSB 3D0HE 2KH9A 4DQPA 3O44A 2DY1A 4DUTA 2JZ5A 3GIRA 5F0WA 2MZSA 2W4PA 4CLFA 2K3IA 3PDNA 1N6QA 2G0JA 2C3YA 4X66J 5KG3A 5HLFA 4X4VA 4CTAA 3UDEA 5GAHI 2Z4PA 2NYHA 5GADI 4ES1A 1RTZA 3B6BA 1UA0A 2F1FA 3D6HB 1LV5A 3S8SA 2AEFA 3ISND 3DMJA 4USVA 2BDPA 2W2QP 2OMOA 3TAMA 2H3EB 1UA1A 4DSLA 3J81U 4DUZJ 4PG7A 2VQFJ 2P8IA 4B08A 1XJWB 4F7VA 5FLXU 1V5VA 4K2JA 3T6JA 4E98A 5DO2A 3JTNA 1DJ0A 2YH0A 3HSJA 4ZVQB 3OXFA 4G3IA 1PYOB 4CH1A 5DG7A 5RUBA 4N77A 4NLUA 3MM7B 3DCAA 1IXKA 4F04B 2OJ3A 3IM8A 5KFSA 5EWFA 2VBXA 5HP1B 2H5IB 3NG8A 4P74A 3KK3B 3FUYA 3HKWA 2CPXA 4DPOA 2CPZA 1T02A 3C8YA 1I6JA 3BDEA 1RTHB 4PQUB 4WE1A 5HQLA 1RT3B 4DN0A 4KHPJ 3R1LA 1RTIB 1YITS 1UAWA 2GVDB 3PX4A 4J9UE 1HR0F 2GAHC 1V3SA 1SJ1A 4I2QB 4WU2A 1TELA 4HR2A 1FEEA 2C3MA 3UO0A 3BQ2A 4EFAC 4LSNA 4L75A 3IRWP 4ZK7M 3PM9A 4E2FB 4LBHA 2BQUA 1GT8A 2E7VA 2DR6A 3DU6A 3Q8SB 2RH3A 4B9VA 1WUUA 4P2XA 3V4IA 1OQ3A 3EM1A 3OFGA 4ECWA 3W9IA 4URQU 1K0TA 1F5BA 4PQUA 2QFIA 1CJUA 2NZCA 3K5MA 2VOPA 1HNWF 4B3SJ 2YX1A 1LWEA 3D5MA 5K8OA 2GMJA 1GAOA 3CVKA 2ZM6F 3TI0A 2J9DA 4I69A 4FYWB 2KM8B 2CWKA 1KTQA 3BB5A 1MN9A 1W2IA 4IDKA 4RW9B 2GCFA 4NLQA 4FPRA 2KJWA 1NDKA 3G6YA 3ZNJ1 3NY0A 3H42A 3MUTP 1SVDA 2QA4G 4IQXA 1AUDA 4TN2A 3CJKB 3RR7A 1U24A 1SJ3P 2RF2A 5AXKA 4PG4A 1RBOB 1TR0A 4LR7A 2B6AB 2YQ1A 1MW7A 3PEJA 3SIPB 4F0MA 2G0IA 4ITSA 1RAOA 2DRAA 3D0IE 2AMCB 2J8SA 4F2SA 4ANCA 3UQSA 4P71A 1HNVB 4WK3A 1P8GA 1OY9A 1FDNA 4CI0B 1H6KX 3T19A 4NX9A 3HSGA 3THTA 2WVFA 4KIAA 2CNNB 2ALZA 2B9XA 4AL7A 4JYAF 3IBFB 3ZZTA 3AD7C 3RB3A 2U2FA 1RKJA 1RISA 1X4CA 1IKVA 2LYVA 4OYOA 4MJKA 3AB2B 4G1QB 3FEZA 1HKAA 1I51B 2CJ9A 4NWBA 4ZOSA 1HYSB 4B9TA 2B6AA 3UWTA 1RT7A 1ZETA 3KG4A 4DN9A 2BR0A 3C6TB 3U1LA 2MJUA 4LBIA 3H59A 3ADAC 4MKBA 4BHQA 2OD4A 1S1UB 5IT9Y 4QPXA 1X9SA 1NUEA 3GYXB 2KN4A 4CT9A 3TARA 3W5XA 1C1CA 2XZDB 3BS9A 3TUIC 2XO7A 3GYNA 2UUWA 1RI7A 1Y4ZB 1WI6A 2V8VA 3CUNA 4DV2J 2YTCA 1WF0A 1CJTA 3QAUA 3TUZC 4ZP6A 4M94A 4LFBF 5I4MA 1HW9A 4Y6IA 2CG4A 1NZAA 7AT1B 2G2YA 1FRKA 3D2WA 1HYSA 2LKZA 2XLKA 4OZ2A 2LQ8A 2MKSA 3UFCX 1U1MA 3UVJB 1ACMB 1K1SA 2E5LJ 3DU5A 1BHNA 1S1XA 1S1UA 3M8RA 4BC7A 4HI1A 5HVHA 2ASYA 4L6V3 1T3NA 4FS2A 2DEJA 3OTEA 1N48A 3BV8A 2BJ8A 3CDBA 1RT4B 4JI4F 1IN0A 1U47A 4MK8A 1RU2A 4U8YA 1O5JA 4HEA9 2DJWA 3F0NA 1SKWA 3C46A 2QG9B 1BQXA 4M5LA 2CDRB 1FX2A 1QY7A 4KH1B 1SUQB 2ATCB 1EQMA 2W9AA 1AROP 2DHGA 1WD6A 5HQ8A 2HFUA 2BXJA 2D9OA 4DF4A 2K8GA 4H4OB 3MD3A 3BN4A 2IJFA 5IQQA 4RPFA 4MK9A 1N5TA 3DOMB 3I0RB 1VOMA 2V4JB 3IBCB 2VICA 1I5OB 1TUGB 4NL5A 2IBOA 2JDJA 4B9UA 4NYZA 4LF4F 2IMOA 4LQ9A 3JTOA 3D0GE 5F8JA 4Y2CA 5JJBA 4DQSA 2F8EX 1ICEB 2GIFA 3IWLA 3FBEA 1N88A 2LEPA 3ZTSA 4P72A 2NXNA 4JB8B 4HHHA 4RZRA 5B0EA 1SUQA 1DTTB 1DAXA 4UY8T 1V9OA 4D3GA 3NGDA 1UKUA 5K5MA 3MEEA 2R4FA 4DL0C 3HFZB 2FJBB 4JUZA 1SJQA 3AH6A 3L7OA 2P9CA 3Q8YA 1L3KA 2V4JA 3GJRB 1VJWA 5IT9U 1N33F 5IQ6A 4DF8A 4RWXA 4I2PA 1KHWA 3RR8A 2MQMA 2FJVA 2XSJA 2WOMB 3LP2B 3VAIA 3OL9A 4UZCA 2MLYA 2XNQA 2HRUA 3H2VE 3J7AN 3OTDA 4Y00A 3DDNA 1WF1A 5T7LB 1GQEA 3R5BA 3ETMA 3FNNA 1WORA 2ROEA 1WHVA 1YKWA 3PYDA 1H2TZ 5DRKA 3HJFA 3TA2A 1B70B 2Y1RI 3I56S 3CMQA 1FTRA 4X4QA 2NXCA 5CD4H 1M1GA 2GVZB 2E1PA 2GS8A 1CJVA 1H7WA 5J2QA 2JHEA 1S79A 4HLBA 5L9XA 3A12A 3BM7A 2XM3A 2IYIA 1YJVA 1B4SA 2ZE2B 5FDLA 3LTOA 4F25A 3W8GA 2GMLA 2WSFC 2QYCA 2PE8A 4ZPBA 4MK7A 4HVZA 2HIQA 2BEFA 3IN5A 3MM9B 1T03B 5J2MB 3VALA 1FI4A 4Y3CA 4HH0A 2CWXA 4A8FA 3HMJG 2R8KA 4ICLA 3BBFA 1K9MT 1TAQA 2GVZA 4RW4B 1U1PA 2JNJA 2YWKA 3CNQP 3R9LA 1WTFA 2KZZA 1U48A 4MFBA 2DNZA 5JXSA 3KMQA 3CXCR 1R8BA 5ETSA 2VKRA 2IVMA 1UEKA 2XSFA 3QZ8A 4FDFA 1TL1A 3MM9A 1T03A 3I5AA 1S6QB 1TZ0A 3FJ2A 3KLIB 3M6UA 4EYIB 2I5JB 2FYXA 2XMTA 4E0DA 1R6YA 2BJ7A 2NCKL 1ZA1B 2ABYA 4A47A 1YRTA 3OVBA 1W26A 3H5YA 3JTPA 3EGWB 4JI0J 2CNLB 1JLBA 1FWLA 1IM6A 4CO1A 2XQCA 2IMWP 1T94A 3QO9A 1Y9OA 1VQSA 2QSFA 3Q86A 3AOBA 3U1MA 3QGHA 2L08A 6FDRA 5E33A 4ZKAA 3PO5A 3QJLA 4Q44A 3IFEA 5CYQB 1XMOF 2J76E 2WBRA 4DV6J 3MEGB 3PJ9A 2QEXS 1Q16B 1BQMB 3VGVA 3GU0A 2IC3A 1S6QA 3K8VA 3KLIA 2HFVA 3SCLE 1ZTTA 4X62F 1WNEA 4DV3J 2I5JA 2M8HA 3JSMA
chains in the Genus database with same CATH topology
4DMZA 4DR6F 4KE5A 2E1MC 5AE2A 3HXMA 2YWEA 1Q81T 2OPRB 4YUDA 2AJ4A 2O1PA 2P9GA 3I87A 2HHQA 3KHHA 3IGNA 4CCHA 1X4EA 1FJGF 4A8WA 1WG4A 1PILA 3K5LA 3POTA 3MDFA 2HHWA 3N6MA 1FO1A 4ZPAA 2V9WA 3PRBA 2KJVA 1UETA 1WG1A 2ZC3A 1R43A 2DHSA 1RTJB 2QRRA 4A8XA 3G8TA 2G9OA 3TYTA 3IR7B 1M5HA 1WHXA 3CDWA 3BN7A 3MM5A 1S9EA 1YGYA 4X4TA 2MSTA 1FE4A 4ED2A 1R7IA 3DM2A 5B0GA 4IRDA 3T9NA 4PG8A 2HZCA 4KGKA 4J9MA 4JV5F 4RW9A 2W9CA 2EBEA 2HNZA 2GV1A 4EUVA 3RW7A 4X65F 1AFIA 1S49A 3JAMY 5A0YA 1IQTA 3MEGA 5J1NA 1HARA 2CQBA 1CQNA 4I1TA 2PN6A 4QBUA 1EETB 2NUHA 2EVZA 3SSQA 2OSQA 5CYJA 1S1WB 2GJ2A 2CJQA 2WRMA 3HHNB 5C24B 4YB7A 4ED3A 4FF3A 4RW6A 3QGGA 2IAJA 2QMXA 3CJKA 2NQPA 1VIOA 4C98A 4FF1A 3RBEA 2VG6A 5K8NA 4HYKA 3CC7S 3Q8RB 4ZVHA 1YRUA 1XTZA 4ZS6A 1R27B 2EG1A 3DRPA 4OIXA 2ZUGA 4LF9F 1YBAA 2AJ0A 1QVFR 1Q82T 4OI4A 3CJ5A 5BJRA 1A7GE 3CO9A 3W2WB 3FSYA 2FPHX 2HS4A 5LSRA 1ZM2A 5KFCA 1HFEL 4ECYA 1F5CA 4MKAA 2E5IA 1T8EA 1PC4A 2YX7A 1RT2B 2ZNZA 2RVJA 4NLPA 3B8HA 1RT5B 1Y5LB 2B43A 2CPHA 4DJBA 3E01B 1TFWA 1Q4RA 4JI0F 4QIGA 3OTCA 1SIWB 3KLGB 4PXDA 4ZDNA 2J6SA 3GV8B 4A8KA 3OUYB 4WK1A 5DS7A 2X1AA 2Q66A 5L9NA 2VFUA 2W8LA 1E6YB 2RU3A 4C8MA 1NK0A 4FNIA 5HBMB 4QIVA 1HNVA 4X64F 4B3SF 4ECXA 2KDOA 4U7UK 3P6YC 4Q0BB 2FDNA 3WBZA 5KFZA 2LXIA 5AXLA 1JJ2R 1AFJA 2QLXA 4TU8A 3SDEA 1BWEA 2HWHA 1SJFA 4GO7X 1UVLA 3IWNC 3W7BA 1SKSA 1F2GA 2EG2A 3M2VB 1M5KC 3PIOQ 2M70A 2QT7A 2X1BA 2CJKA 4FXDA 1JLFB 4DSEA 2ZH4A 2HPUA 4CO0A 2MGZB 2YNGB 4JI3F 2KFZA 2YWHA 1IJFB 2RU9A 4RUAA 3R5AA 2W8KA 2ZOMA 1VC5A 4Y2AA 1JK9B 1ZH5A 1FJCA 1S1WA 1SC6A 2B9WA 5EGYA 3KOAA 2GMHA 4MYTA 4DV6F 3SSSA 1X4HA 2B7CB 1GX6A 1TK8A 2BYCA 5DJBA 3R5DA 3ZZ0A 1C0UA 4MTPA 2R7WA 2GFFA 4NRTA 5B7WA 4DL5A 3K2YA 1QAYA 2J8AA 2DGOA 2OD6A 2N7CA 5IT0A 5DM7Q 4QYZJ 2KKHA 4NXNF 2ZH7A 1NHVA 2AJQA 2MZQA 4G1QA 4W92B 2VBWA 3DLGB 1VRUA 3C6UA 3J7A1 1ZAXA 4OQJA 5M2UA 2DGVA 1FDAA 4M95A 4GMKA 5CHCB 4DFJA 2VG7B 1OSCA 1TAUA 4C8NA 1XMBA 4DV3F 1LXNA 2O66A 3KYLA 4CT8A 1X4GA 4YQWA 1LFPA 2LECA 1YI2S 1NH8A 3C6TA 1QUVA 3MF5A 2J0WA 1U2FA 2RQMA 3V6DB 3ETOA 2UXBF 2C3PA 2ZD1B 4ES3A 2E7WA 2VBYA 3VR1A 2ZH6A 4JI6F 5GMKa 4NA3A 4F26A 5KFDA 2H5EA 2Y0SD 4AYBD 2R7TA 3OUYA 2HGMA 3EPIA 4DR3F 2J9DE 4EO8A 3PO4A 2JLEA 4J9QA 2MXYA 1KS2A 3HT3A 1E6YA 2K3KA 3NS6A 5J2NB 5T14A 2XWXA 1RWUA 1U6BA 3KLVA 5IM0B 4Q0BA 3D28A 5E0OA 2FTRA 2HHPA 5T41A 3TVYA 4DG1A 3H5XA 1URNA 5KT2A 3BSCA 3V81A 3T9ZA 3FZBA 4WYLA 2RS2A 2UP1A 4ALZA 5KFOA 4C11A 4ZCMA 2C2DA 3HHLB 4PXCA 2DNKA 1GX5A 1JLFA 4UUWA 3ENQA 1FKOB 1Q1KA 2FUG9 3I31A 2EK1A 1VQNS 3KJVB 1TKTA 3M6WA 4ED1A 4KO0A 4LF5F 3C66A 5DDPC 2A18A 4N47A 5I3QA 1FTCA 1S0NA 5K14B 2J6UA 1LWCB 1VHFA 2OPPB 3V6HA 3H20A 3HDSA 3J7ZT 1QE1A 3CPWR 1M90T 1N5VA 4DQRA 4K4SA 4IG0B 1HI8A 1MMLA 1X8DA 1IBMF 3TUJC 1FNOA 2LLZA 3VAJA 3CJ3A 3LQVA 5SZTA 3MMAB 4WIIA 3IAM9 2LXFA 2HNDA 2KTQA 2ACYA 1R0AB 1MU2A 4QIFA 1VQYA 2MY8A 1S9GA 3H2UB 1QSSA 3DLGA 3VCDA 4RNMA 4Q5VA 2B4OA 3MM8B 4K4ZA 4B3TF 3FCHA 1K1QA 2KT2A 2D41A 3O8WA 4ILRA 1PSDA 3RRKA 2ZBCA 2CQ3A 1WI8A 1X0FA 1U45A 3SMZA 3QZ7A 1S6PB 3FRYA 3NAIA 5H9EJ 3X3UA 2VPYB 3BO4A 2JH3A 3ENVA 3DI6A 3L3CA 2CQPA 4IOCQ 4FBUA 1JX4A 2DD8S 3JSBA 3MUMP 5KG2A 4U7CA 2XULA 4K4XA 2EFVA 4O4GB 4CO4A 1VQ6S 2GHVC 5MAOA 2KYXA 3GSDA 4MIWA 4J9KA 4WZQA 4KBIA 3CE8A 4OZ5A 1CSJA 2L48A 4Z37A 5GAEU 1NK8A 1G2EA 2HVHA 4BC9A 2YKOA 4RBTA 1U2RA 1ZAVA 1HNZF 2BE2B 1RT4A 2RRNA 1SJ4P 1C0TB 2GC8A 2JOQA 3CWJA 2UVVA 3DRYA 1OIAA 4IRKA 3M1VB 2ZFHA 3HP6A 3Q0AA 4DX8H 1NK7A 4C0HA 4IQMA 5KFXA 3G86A 3UDCA 3F56A 3HK2A 5HROA 1S10A 3RRGA 3QIPA 2CQ2A 2V5HG 1FESA 1OO0B 2QIFA 2J7WA 3K5PA 1LWCA 1WTBA 5HLFB 3KK1A 4C4WA 3CULA 5H1SV 1J5EF 5LJ3Y 5DDOC 1Q78A 4CTAB 2VFVA 3CMES 4RWWA 3CDAA 4R0JA 4QR0A 4KC5A 1ZZFA 2G1DA 5DQHA 5KFMA 1B0PA 1U1OA 1DLOA 1FHTA 4YB6A 4YB1P 4QWCA 1R0AA 3GR1A 4ED8A 1E6VA 3DGPA 4NRUA 2DGSA 2MQOA 1VQMS 3TX8A 4M1KA 3AAWB 5KG6A 4KR0B 3PW7A 2JX2A 3K5NA 4OZ0A 5F41A 4DSFA 2ZNYA 3TVKA 2KXHA 1WELA 4O3NA 2QLWA 4H4OA 1KFSA 1VMBA 2Q6CA 4QPTA 3DMJB 5J1EA 3US5A 4DFKA 3AQPA 2WAQD 1N56A 2PIIA 2WBMA 1KOOA 3TAMB 1VQ7S 2ASJA 3R1HA 5DLGA 1UMJA 1Q8LA 3DOMA 2COLA 3I0RA 4O4GA 2CRLA 5LL6d 4N56A 3B78A 3QMQA 4WFYA 3BSNA 4M63A 7FDRA 4UOCA 2EW9A 4F8RA 4F2RA 4WZMA 1FRXA 2E5GA 4H4MA 5BYRA 3TW0A 2VPZB 3G8SA 3M8PA 3N0VA 4PXBA 4K0KF 4ZPWR 5D4OA 3RB6A 1C0TA 3IWXA 5A8WB 2EFNA 1FRJA 2VFTA 5EDWA 4I68A 1NK9A 1TV6B 3CB4A 4NLRA 2MKHA 2Q6BA 4G1PA 5F8IA 2HMIA 4JBCA 2XGQA 2DCLA 2LQ9A 2DR5A 2DR9A 4NLDA 3WC2A 2KT5A 5IS2A 4OZLA 5I42A 4DWIA 3O5TB 3RBDA 3M8SA 3I5CA 1D9DA 3MR2A 4X4UA 3MMCA 1SH0A 5HN0A 3I4PA 2V0NA 2UVRA 3QWPA 4J9RA 4I67A 4B3RF 3TR5A 3ONQA 4YR2A 3I6PA 4O3SA 2DH7A 2C2RA 1KFDA 2XS7A 3MTJA 4U6PA 1DTTA 2XI2A 1TQLA 4PQAA 5DETA 4YHHF 3MFHA 4F4XA 5HMYA 4LIWA 2HHTA 1FRMA 3H98A 1FE0A 1YIJS 4KB7A 4I6WA 1REVA 1L3UA 3HZGA 1L3VA 1CQMA 3MI7X 1J5OB 1NK5A 5FD1A 1M0SA 3B4MA 1F9FA 4P2SA 4C8KA 1X5SA 2UV8A 5JVGQ 3HM9A 5D6GA 2B56A 1N52B 4KKOA 2KI2A 4MMOA 3M30B 2D1CA 5BYQA 1VK3A 2FHJD 3OFFA 4B3OB 1Q7YT 2Z2LA 4QR2A 4WE1B 5D4NA 2RB7A 4ID5A 2CKWA 1RT6B 4ED5A 1WEXA 2ATLA 2FVRA 2R7UA 2WW8A 2EBGA 4EBCA 2PFFB 4DQIA 4Y28C 1BQNA 1RJJA 2M52A 1SQEA 4LQ3A 2LQJA 5KG7A 3QPIA 4TU7A 1VQ9S 3RB0A 2VPWB 2POKA 2HWTA 1VBXA 2J6TA 2BRLA 1UFLA 5AE1A 5B0AA 2OH2A 2KXFA 3KG1A 1TFYA 2XWYA 2JSXA 3PRDA 2L9WA 2EFQA 3MR3A 1XK8A 2CPIA 1UVJA 1TL3B 2J9EA 5A8WA 2WOMA 3GE9A 5EX0A 4K59A 1ULRA 3TP2A 3LP2A 4XAKA 1PC5A 1SXLA 4I7FB 1TV6A 3G96A 1M5VC 4NZ6A 3M8QB 2ZZNA 4X2BA 1XN9A 4ZVEA 2CPDA 3EUNA 1K73T 3NL0A 2D3UA 1SH2A 2JC1A 1QAIA 5DLFA 5KFFA 4UQTA 1TKZB 5T7LA 4FXWA 4I6YA 2V9KA 2C42A 4EEYA 1FVSA 5KFJA 3LGMA 1VGYA 1HI1A 3DLEB 4TY8A 2B9YA 4F02A 1S1TB 4LSNB 1N34F 2HHUA 1APSA 2VZ9A 1S1VB 3NBPB 1T7PA 3FFIA 1DTQB 3MMBA 3P3DA 4CNYA 3Q22A 1SL0A 4LF7F 4LFCF 5KT5A 4IKAA 3QJJA 4NA2A 2IVFB 1IQZA 3IG1B 2VOOA 4JI2F 4C9DA 2W7OA 4NCGA 2Y1IA 3BQ1A 3I32A 2IA6A 1R8AA 3LW5C 4IFYA 2XS5A 2MQQA 3RU0A 4ZHRB 4GKJF 1JLCB 3DLHA 3OJUA 1CC7A 5LXRA 1T3OA 1ZM9A 1FJ7A 2V94A 3V4IB 2K1RB 2CQ0A 3N9UC 2YH1A 5KG5A 4RW7A 1X5TA 4LVOP 5K9FA 4O23A 2AF6A 3UI3A 3BO3A 1BLUA 3AHPA 1L3SA 1D1UA 4B3OA 3TAPA 1G3OA 5B0DA 4H4KC 1M1KT 5E3CA 1DFDA 2J7KA 3CC2S 1MMNA 2YKMA 2DIUA 1R3NA 4NA1A 2ZH8A 4KRWA 1JLGA 2MZRA 4EZ6A 2IRXA 1N5SA 3MWBA 2B5JB 2ZE2A 3PKYA 1JLAA 3KHRA 4A46A 3CMAS 3N5FA 1PGZA 5IT4A 2CPYA 1Q8BA 3UR3C 3K59A 4NMLA 4DR7F 2OTLS 2M9KA 1LWEB 1UJ5A 2HQ3A 5A2QY 4DBQA 4TXSA 2W24A 4RX6A 3Q8QB 2CIMA 4K5SA 4DLEA 1RYSA 4KT0C 5AXMA 1RT1B 1YJTA 2MMYA 1KQKA 4N5SA 1HBUA 4CQ1A 4DV5F 3T1HF 1JKHB 2Q3PA 3GQCA 4FF2A 4ED7A 3I4HX 2D3OR 2CYYA 5J2MA 1YJNS 3E51A 3DXBA 3IO1A 4Q45A 2O67A 2ZDPA 4IDKB 3CIZA 3AY0A 4I64A 1RAJA 4ILMA 2FGCA 4PPDA 4F3OA 4NLYA 1JNZB 4NLXA 2RUGA 3DOKB 1HD1A 3AQOA 2GO8A 3TA1A 5B0BA 4ED0A 3DC2A 3J7Z5 2DGTA 4LSLB 1EP4B 4DV4F 3HVWA 3ZZUA 3OBIA 4PXEA 1DTQA 3FZ2A 2JFKA 2AWZA 4V19J 4Y65A 1WACA 1VRTA 3FEXB 2EI5A 3N79A 2RF2B 2MKKA 4A8OA 4ILLA 2CPFA 3MTKA 2LU1A 4FBTA 2RDIA 4RW4A 2MB0B 5C5JA 3M2RB 5C25B 4NZ0A 4C97A 1LWFA 3UW1A 4DUYF 1VBYA 4FF4A 1YJUA 5F8LA 2RRBA 5GADU 2OPQA 2BANA 5G4DA 3BZQA 2AYMA 2R2TA 1CLFA 2LEBA 1NAQA 3CEDA 1HNXF 3GILA 1KONA 4HTIA 1YJ9S 2HHHF 1JB0C 5F8HA 1X4AA 1D0EA 1Z2ZA 2BM0A 3IS9A 2CPJA 4ED6A 3NNAA 3CCJS 3PNIA 2BA9A 3ITHA 2M3DA 4KAIA 4XDCA 5G0RB 4BCAA 4LFAF 2DVIA 2CDQA 2GNKA 4OI3A 4OJGA 4DV7F 2CQDA 4ZPVR 3PW2A 3U27A 4KQZA 2DNGA 5LMNF 1B7FA 3CSKA 2E44A 4QW8A 1P27B 5IFMA 2DNPA 3A1YG 4QU7A 3ZZYA 2NS1B 1KRPA 3MXHP 1IKYA 2RS8A 4MKYA 3W3SA 2DHXA 5B08A 4R5PA 2LCWA 1NB7A 3CCMS 4A8SA 3PACA 5E3AA 2E9RX 2GQQA 4LT6A 4QQBA 3BREA 4ZVGA 5KFWA 4X4SA 2YWFA 4KV8B 3V6KA 3OW2R 4RLEA 5DDQC 3BGRB 3R27A 4DS4A 2XY7A 1HPZB 1F0XA 4EO6A 2FC9A 5BR8F 1NKEA 5DQIA 2FLPA 1FCAA 1U7LA 3FQKA 1S0VA 3DRSA 2C3OA 3E2EA 2MHNA 1YRXA 5M2RA 3OXGA 4OX9F 5KFKA 4UY85 3ZZOA 1S0MA 3MCSA 1L3TA 5EWGA 1S6OA 2J0SD 2AP6A 2GX8A 4MYUA 4NXMF 2AJFE 1IKVB 2CQIA 4IG3A 3GIJA 3K8WA 3RZAA 2NLWA 4ATNA 4NPOA 2IRUA 5E5NA 3KLFA 3K7RA 1QSLA 4O3PA 4DL4A 3MUVP 3KHGA 4LIRA 4OHZA 1KOHA 2XZWA 1RGVA 2YKQA 3OJSA 1RT7B 1SI9A 3CDEA 5C42B