2GNKA

Glnk, a signal protein from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
95
Chain Sequence
b'MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NITROGEN REGULATORY PROTEIN)
publication title GlnK, a PII-homologue: structure reveals ATP binding site and indicates how the T-loops may be involved in molecular recognition.
pubmed doi rcsb
molecule tags Signaling protein
total genus 21
structure length 95
sequence length 112
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gnkA00
4WK3A 4OZLA 4D3HA 1O5JA 4USIA 5D4OA 2NS1B 4C3MA 1Q1KA 1NH8A 2J9DE 2Z0GA 1QY7A 3NCPA 2J9CA 4E98A 1NH7A 4ZK7M 2XZWA 5DRKA 5DS7A 1PILA 3X3UA 2EG1A 4R25A 4USJC 4IYQA 2JJ4D 4CO2A 1XK8A 2RD5C 2PIIA 1V3RA 3M05A 2DCLA 2NUHA 1OSCA 1NAQA 1UMJA 3AA8A 5D4PA 2V5HG 4D3GA 4CO4A 3BZQA 4YB5A 3MHYA 2J9EA 4RWWA 1NZAA 1V6HA 3L7PA 2O66A 4C3LA 2O67A 3NCQA 1H3DA 3TA1A 1P1LA 5D4LA 4RLEA 2XULA 2J9DA 3NCRA 2XBPA 4YB7A 2E66A 2EG2A 4CO1A 1J2VA 3TA2A 3LF0A 4Y65A 4Y6IA 3AA9A 4RX6A 2GX8A 3OPKA 4WK1A 3T9ZA 3O8WA 2GNKA 1UFLA 3AH6A 1V9OA 3TA0A 4CNZA 4AFFA 4CO3A 4CNYA 1GNKA 2ZFHA 2XG8A 3GSDA 4CO0A 1V3SA 1UL3A 3DFEA 4OZJA 3AHPA 4YB6A 1VHFA 1VFJA 3O5TB 2CZ4A 4NYOA 1UKUA 1HWUA 2VD3A 3N5BA 4RWXA 4CO5A 3CE8A 4USHA 4OZNA 5D4NA 4NYPA 4C3KA 5L9NA 3HLUA 2NUUG 2ZOMA 1O51A 1KR4A 2GW8A
chains in the Genus database with same CATH superfamily
4OZLA 4YMEA 2WZ1A 2VFSA 3AD7C 2BQ3A 2DNGA 2ZVIA 4AXIA 4U7CA 1JXEA 2Z0GA 3GIMA 3T6JA 4N77A 2DNHA 1RU2A 3IC1A 3AOBA 3MPWA 2J6TA 2KXHA 4OHVA 3CMES 1ZM9A 3OVSA 2AJ4A 1WOOA 3PW4A 1IBCB 3BGFA 2C3YA 2MDAA 5CXTA 4ZLLA 2ZBCA 3AXKA 4QIEA 5KG5A 3J7A1 4F4YA 3TYTA 1RAGB 1R8AA 2M4MA 3MDFA 3NOCA 3K5PA 3F41A 1Z1ZA 1T9TA 2H51B 3HFZB 2B7CB 3D5MA 2BV3A 2KRBA 4MKVA 1RXOB 4I2QB 2ZNYA 2YH1A 2V67A 1EB0A 3PR4A 1WDTA 4V1Ak 1TKXB 1S77D 1HPZA 2KTQA 4CT9A 3DGPA 2MKJA 2NS1B 3K59A 1RWNB 3KXDA 3PW7A 1LWFA 2MYFA 1K8AT 5J1NA 3X3UA 2YPYA 1NK4A 4C0OC 3M05A 1S49A 1YITS 1WSRA 3WIVA 2RRAA 2AMCB 3DGVA 3CDBA 3I56S 2B4VA 2MTLA 4ZP8A 5IM0A 2VB6A 5KFMA 1SV5B 4NLUA 3D66A 2IM2A 2RU9A 1RKIA 1WG1A 4DR5J 4NXNJ 3DHWC 4DR2F 1MSWD 4TXSA 1P9QC 1E6YA 5CZVA 2J76E 4NLQA 3TVKA 3UQSA 2E7WA 1U1QA 4FF2A 1XMOF 1VR6A 2K7KA 3UVJB 3GYGA 2NPFA 4RUBA 1TK5A 3FCWA 2OJ3A 2ZH3A 1EETB 3QJLA 2HZAA 1KQFB 1YRUA 4PWDA 4LF8J 1JLQB 4I64A 2R7SA 3PX6A 2QL9B 1N33F 5F8HA 2ZOMA 3PZPA 3FCHA 4UF4A 2QN6B 1SKWA 3KKFA 2H3EB 2NLWA 1SJ3P 2HBYB 4CYUA 3IM8A 2R9LA 4RNOA 1N36J 2K3KA 1MMDA 4R5PB 4KYZA 1TTHB 1OIAA 4HVZA 1JNRB 3DI6B 2BJDA 1DRZA 1MROB 3DM2B 4KGZB 2DHGA 2CPXA 1S6QA 3KLEA 2Y1IA 4OJHA 4JI4J 3QGGA 5D4PA 6FDRA 1GX5A 4C9DA 3NNAA 1N5QA 3VGVA 4C3LA 1RWUA 3O3LA 1FA0A 4URQU 1RWWB 2HRUA 3MEEA 4ED1A 4TY8A 1NRKA 1KNZA 3GV5B 2JLFA 1LW2A 3ISNC 1RT2B 2WVCA 5JUMA 1PYTA 2ZBQA 1XNRJ 3CJSA 5L38A 1M1HA 1DZ5A 2UXCJ 2W24A 3U02A 4E0DA 3RAQA 3BB5A 3JSBA 1JLCB 2R4FA 1QAXA 4ZOSA 1CJUA 3P49B 3LGHA 4DSLA 1OY6A 3SV4A 3DCAA 3DHXA 5ETVA 3U1LA 3B78A 1FX4A 3SFUA 1WOSA 5CAAA 1U0SA 3MI7X 2SXLA 2KB2A 3F56A 4O3RA 1RWVB 5MLCV 2RQKA 2IJFA 3LA0A 1UJ5A 1LK7A 4ZN1A 5J2PB 1YBTA 1S12A 4O3OA 3UN3A 4DR7J 3BPDA 1RU1A 2W7PA 3BBBA 4FBTA 1FESA 2GVZB 3ZTRA 1ZZNA 5DG9A 4ETXA 2P9EA 2M8HA 1P9YA 2F8EX 1KOOA 3TA2A 3E2EA 3N6LA 3HSGA 2F63A 3D1QA 2A6MA 1RGVA 4X66F 1VC5A 3H20A 1FNOA 5F0WA 2V2KA 2CPDA 3UD4P 1ZM3A 1JLEA 2NYHA 3NNCA 3QQCD 2XWYA 4WKYA 3FMBA 3QO9A 4KB7A 4X4RA 2VPXB 2GGPB 3NGUA 4HTJA 3FQKA 4J9RA 4KGVB 1WHYA 3M6XA 5IXUA 1YI2S 1SBRA 1FKOA 1B0TA 2IPOB 2CPZA 1UA1A 2EKNA 1PAEX 2BQUA 2MHEA 1SKRA 3CXCR 2DK2A 1C1BB 4H4MB 4X4NA 1BC6A 2HWHA 5G4DA 4C8NA 4EBDA 2FVCA 3SSSA 4D3GA 1CBKA 4A47A 3OR2B 4Y28C 4DSFA 1U1MA 4RNNA 2FLNA 2DRAA 5DETA 2HNDB 4L74A 5D77A 1LKZA 4Q0BA 4RW4B 1FTRA 1OPIA 1MWQA 3N0VA 4FXDA 3QAEA 1T8EA 4C0HA 4C48A 2AYBA 3ENQA 1JLGB 1GNKA 4DL2A 2BKPA 3P45B 4WIIA 4RBUA 4WKRA 1SH0A 1UW9A 2Z2LA 2KHCA 3LAMA 4DN9A 5CCLA 2KG0A 4RWXA 4HR2A 2XYPB 2HZVA 2DR5A 4GKJF 3QIDA 2LQ8A 1YGYA 2E44A 3IMQJ 2CQ1A 2HBZB 3A8EA 2XCAA 2DR9A 3W60A 3Q8YA 5K8OA 4JB8B 1I5OB 4JV2A 4IOCQ 2QEXS 4XAKA 2UVVA 2QA4G 3GV8B 2A6OA 2HQDA 1L3UA 4CLSA 5BXIA 1OSCA 3IG1B 3GSIA 4ID5B 3OTOF 3IR6B 1QD1A 1W26A 2ZBIA 3MM6B 4HT7A 3CCSS 4DV7F 3HO1A 1DFDA 3DRXA 3EICA 5HAOA 2M8DB 5GAGU 3TI0A 3DMJB 3A3NB 5KFIA 2MKKA 1Q8BA 1DQ8A 5IT0A 4I2QA 4LRAA 3MPUB 5GAGI 1AZSB 4H4KA 4DV6J 4NLWA 3CCQS 4PG8A 3CDWA 1TKZB 1TKXA 4DFJA 2GAHC 5GMEA 4M5MA 1NPKA 3IWLA 5K8MA 2ZH9A 2LDIA 1HNZF 2IFXA 5CZXA 4B02A 4KH0B 2CNOB 1ZYQA 4I2PB 3TWZA 1F60B 4XDDA 4B17A 4KHMA 1ZM4A 2DRDA 1SV5A 4A8OA 4DR2J 1OS5A 4P2MA 2HNZB 2IMOA 1ZTWA 1ROFA 4Z7YA 3N4WA 3HM9A 1GT8A 1M5OC 1VQMS 3BV8A 1T9XA 3ETOA 1CS4B 1BXNA 2KT5A 4MYUA 1YDLA 2DNQA 4W92B 2R7TA 3UVJA 1FERA 3MM9B 2IAJB 3ILOA 3RR7A 2GHPA 1ZBTA 1EETA 4GO7X 3RB4A 1IM6A 3ZZUA 1UFKA 4DL5A 1UEKA 1JLQA 5A6WA 3R5CA 3KHLA 3QJPA 7FDRA 4ZJQA 1NU4A 3ENAA 1VQSA 4ES1A 1W25A 3CD6S 3A3PB 2GO8A 2HZCA 1VIOA 4R5PA 3KJQB 1KRPA 3RG6A 4NXMF 3CC4S 4J9OA 2DTJA 3DI6A 2VKRA 3G2XA 1MROA 3GR1A 1N56A 2CJKA 1SKUB 4QYRA 1LK5A 4LRCA 3I9V9 2C2MB 1KWMA 1Q8KA 1I6JA 2DRBA 1FKAF 3TEHB 2YKPA 3PV8A 5AJ3F 1RT2A 2L48A 3MHYA 1HNIB 3MFHA 3EYZA 4Q43A 3NCQA 2E1PA 2YKMB 3W9HA 1TUWA 1C0TB 5L1IA 3KHRA 4MH8A 1F5BA 1NZ8A 2DEJA 5GVQA 1T03B 4DR1F 3FDSA 1JLCA 3M8QB 4GMKA 4QIGA 4HI2A 2YBVA 4LVNP 3T9ZA 2RS2A 4DI6A 3L7OA 3CJTA 4A8SA 3GMGA 3IRXB 3GCXP 1NB2A 3UN2A 1H0HB 5JXSA 2P9GA 2HS3A 2G2OA 2WVFA 1R8CA 2VG5B 4R0EA 5J2PA 2J7UA 1X9SA 3GCWP 2Z57B 3CCZA 3BS9A 3HF5A 2ZZNA 3CJ4A 3G8SA 2VFRA 2ZH2A 4DFMA 2GVZA 2E1RA 2Q79A 5EX3A 3WC2A 1SI9A 2GQ2A 4YR3A 1IQZA 1RWMB 4I6AA 1D9DA 2H1YA 3Q8UA 3M1VA 1JKHB 3EGVA 4I69A 4U9RA 3TEGA 3BGRB 3OLAA 1H73A 2M7SA 4X66J 5B0EA 2ZWOA 3ZZRA 4B9MA 4QPXA 3VALA 4W98A 4HYKA 2HAIA 5DDOC 3IXQA 3HHNB 2HS0A 3MMBB 5B7WA 4R0JA 2ZHAA 4RU2A 3NEKA 4C8ZA 4TYAA 3OR1B 2JSXA 3KJNB 3G6VA 3J7YI 4OHWA 1REGX 1EHWA 4BDPA 4QR0A 2GGPA 1T0TV 2KXNB 2IYIA 5A8WA 2OEKA 1FK9B 1WNEA 1NCLA 2OUGA 2CWKA 3QZ7A 4ECQA 3W64A 1LXJA 2VPZB 2OELA 3W7BA 1WEZA 1MMNA 2BABA 4FN5A 3C8YA 3MCMA 4B9SA 1C1BA 4H4MA 3R97A 1KKHA 1Q78A 2C2EA 1L3TA 4DF8A 3OR2A 3LGMA 3AB4B 4MT1A 1SKSA 2QLXA 3VV2B 2DVIA 2HNDA 3VVTA 2OEMA 1FRHA 3MXHP 4A8QA 1SIWB 3E01B 4MK9A 2XLJA 3CC7S 2ROEA 4F3QA 1JLGA 1OO0B 4FF1A 2L9DA 4DLEA 4J5OA 3BYPA 4BCAA 4IFYB 1RTHB 3M32B 4OMFG 2OFGX 1S72S 3OTEA 1KEKA 3CDUA 1U2RA 2XB2D 4GKJJ 3PW5A 2IY5B 1WC0A 4EYHB 2RU3A 2C2DA 1UVKA 4DUYF 2JNJA 4MKBA 4FYYB 5IFMA 3O2IA 1NKCA 4XIUA 4C11B 3OQ2A 1F2GA 1XBWA 4ANDA 2DCUB 1I3OB 3DDIA 4M5GA 3IG1A 1NM2A 4DV7J 2HNYB 1K1QA 1ZA1B 3MM6A 3C3LA 1RWOB 4OYBA 3PVXA 4OX6A 4DMZA 3DMJA 4KO0B 3M8ZA 3GG1A 1N4LA 1U1RA 3FEYB 3BH7B 4N5SA 1PKUA 3ZTQA 2QFJA 2D3O1 1AZSA 5K8NA 4MFBB 1N6QB 3RRGA 2UUAF 1TKZA 4QIVA 2MKIA 2KVQE 4OJ3A 1FRKA 4LBPA 4ZPCA 1NJXA 3MF5A 1P27B 4LR9A 1RYRA 2B7BB 2VPWB 3HVRA 4M5KA 1FE0A 1TFYA 1CJTB 4UOGA 4LSZB 4PG6A 4BS2A 1RISA 1HQ2A 2Y9HA 3KLHB 4I2PA 4TNOA 5ETMA 1B70B 3CCRS 4NLOA 4OZJA 2KRRA 4ZVTB 2VUGA 1Y00A 2BE2B 1FNXH 3JTPA 2HNZA 2ZJPQ 2IDLA 1IR0A 5EN1A 2GJIA 2AJ1A 2OPQB 4JOUA 1H98A 1WUUA 1KQGB 1CS4A 2XYHB 2B9EA 1C4CA 4RPFA 1IVZA 1HHSA 1N48A 3BQ0A 4M5DB 1S4EA 2M52A 3MM9A 3NAIA 1R89A 2IAJA 3NLCA 4ZHRA 2XY6A 2G2ZA 1NAQA 3EZUA 2RNEA 3ILLA 3UDCA 3RGIA 3EM1A 3FVYA 1V6HA 2FJVA 4JI3F 1AT1B 3CSKA 2UUTA 5D4LA 1HW9A 2QSFA 3IO1A 1S1UB 4HDHA 2FZGB 2NXJA 4PXCA 1Q8LA 1DARA 2MY8A 2DY9A 2B0GA 3H8YA 1R31A 1R3NA 3FUYA 1UZDA 3V5RA 3PHEA 4EO6A 2XC9A 4IQXA 2OLWA 2NCKL 3CTRA 1Q0NA 4ILRA 2Q43A 3CNQP 3GIRA 5KFNA 1DHMA 4IOBA 3SQOP 2F8HA 1VQ7S 2FJAB 3G71S 4ZLNA 3PO5A 1EARA 2HAFA 2GMLA 1HNIA 2DNKA 4I6YA 2GFFA 4X4QA 3CVKA 4X84A 3I0SB 2YKMA 4HLBA 1RT3B 1C0TA 1VQ9S 4DR1J 4LF5F 1B4SA 1T03A 2D41A 3TVZA 3PJWA 3M8QA 1SCJB 1UAWA 3MAAB 5RUBA 2KO1A 2YTCA 3D6MB 4Y3CA 1SQFA 3V4MA 4RLEA 4NPOA 3SDEB 3U7JA 2IRYA 3IRXA 2BQRA 2XYGB 4QJVA 2QGFB 2VG5A 1JLBB 2D9OA 2ZFHA 3UCUP 1QSYA 3U1NA 2UUCJ 2YWKA 3KLFB 5LM7E 1R0AB 4DZ6A 4F04B 1EX8A 3T9NA 2CQ2A 4ATNA 2YPZA 1KR4A 2BJ1A 4LMZA 1JKHA 1NK6A 4D3HA 2CJBA 3LQVA 3T5LA 4UQGA 5J1EA 4C98A 1N0VC 3BGRA 3Q8QB 4PAAA 5C5JA 2XGPA 3K57A 2JEFA 1VK8A 1RTJB 5C2CA 5DRKA 3RR8A 2C3UA 4DHVA 4OX7A 3CIMA 4LF6F 1RHUB 4HEA9 1SIZA 2GA7A 3IR7B 3MMBA 1M5VC 2EFOA 3LO3A 6FD1A 1JJ2R 2CQGA 3Q8RB 4K4XA 1YQHA 2A2CA 3OR1A 2ZE2B 5IC6B 5I42B 4KGKA 1OMSA 2ZUAA 3IRWP 4J7CA 2CPJA 4RBVA 3ENWA 1QUPA 3C14B 1B7YB 2YH0A 5K14B 2EG2A 1FK9A 2HHVA 1ZAWA 5EWFA 3SBMA 1XNQF 3W5YA 1IKVB 1U4BA 5KFEA 1U6BA 2BEFA 4YOEA 2G13A 2CPHA 3Q8SB 2LLZA 4NZ6A 3NMRA 2RDDA 3TQ1A 2ILZA 1NHKL 4DN0A 2XS5A 3TRGA 1T94A 2ZWPA 4FNHA 1H2VZ 4O3SA 2ZKUA 1Q81T 1O51A 3FFIB 4DFPA 4JI5F 2P5VA 5IT9U 3VGSA 4ZN3A 2BX6A 3E01A 5ETOA 4AT1B 2KKHA 3N6NA 1S0MA 4WXOA 4KPYA 5LMNF 3MR5A 3PRDA 1NH7A 3BREA 2N4DA 3IBWA 1TKDA 3LPYA 3FSXA 1RTHA 3M32A 4M5HA 1ZZFA 1A9NB 2C2ZB 2KFZA 3AAWB 4OHXA 4M5LA 3CJRA 3KLIB 1WI6A 5GMDA 4P7TA 2QTWA 5I3PA 4USWA 4L76A 2CJAA 4GC6A 1HR0F 1T11A 2NXEA 4C11A 3DOKA 4LR7A 4X64F 2VJVA 4YHHF 3L3CA 3MOZA 4JV5F 4OYAA 2HNYA 2OPPB 2V2QA 1BQNA 3MM8A 4FPIA 1S76D 3UE2A 1YRTA 5KOXA 2GJFA 1UEVA 2XWXA 1NLKL 2DNLA 2JLEA 4OV1A 3M2RB 2UUAJ 1HQUB 4MFBA 2Q1LA 1N6QA 2GHWA 2CIMA 3T5HA 1QJHA 1UEUA 1T9VA 4YR0A 4CCHA 5DDRC 4RZRA 3A8JA 1AUDA 3MWBA 3M8PB 2R8KA 2ZOFA 3OTDA 1CJTA 3AOCA 5IQ6A 3DLEB 2BJ3A 3KLHA 1SUQB 2DNNA 3B54A 3M30B 2FZCB 1FI4A 2VDHA 1HHTP 3FCVA 3W3SA 5IS2A 1ACMB 2AQ4A 2HWIA 3HPOA 3EPIA 2CUYA 3AH6A 2XLKA 4DQSA 2MJUA 4YB1P 1T02A 4OYWA 5ETKA 1Q8IA 3KOAA 3MAQA 4MYTA 1PBUA 3IWXA 2UV8A 1NJYA 5HMZA 4M5DA 3FK4A 3JSMA 4LQ9A 2B9XA 2C2KB 2W9BB 1JLFB 4DQRA 1WG5A 1RQ0A 2K06A 1RI7A 2JZ5A 2BJ9A 1YJ9S 1U1KA 4LRBA 4KAIA 1U49A 3PCOB 2DNZA 1UPPA 1TELA 1S1UA 4DU8A 2YWGA 4AQYF 1TL5A 2IVYA 2HFSA 3KLVA 2GHVC 1D9AA 1YRXA 2MLYA 2RE1A 1S6PB 3LWMA 2V8DA 2ZDPA 4A48A 4NLSA 1UWBB 3ZFVA 3C6TB 3IR5B 3ZTPA 4O3QA 4TU7A 2EKYA 4HHHA 5A2QU 1W7WA 5KFWA 2XTJP 2MMYA 1WSVA 2OSRA 1GMVA 2AJ0A 2FY1A 1WC4A 3D1OA 1WOPA 2BW2A 4NLYA 2HHSA 1X4BA 4LF7F 4QCLA 2GNKA 1FD2A 4LFCF 5DZ7A 2RRBA 2HS4A 1BQXA 2RB7A 2BRKA 2H5EA 1PC4A 4YB6A 3HSDA 2V8PA 2V50A 1F9HA 2B4OA 5B0GA 4DXLA 3I0SA 4ZPBA 3D28A 4OI1A 1JQGA 4L75A 4CLLA 1RT3A 4IH7A 3D67A 3JSYA 1FFWB 1Z4UA 2HQGA 3ZZTA 1MWYA 3C46A 2UVWA 5F8JA 3OJUA 1D1UA 5D3GA 3MAAA 1SVDA 1LWEB 4MKAA 2AGPA 8AT1B 1R7IA 3HVTB 2XY7A 5E3PA 1X8DA 2DGWA 2I6WA 2A10A 3I5AA 3SDEA 1VRQC 2QRRA 2BVZA 1CC8A 4IDKB 1NHUA 1AUSL 2YWFA 4X4UA 4FXVA 4P9SA 6AT1B 5D0HA 2HVIA 4QIWD 2XM3A 3OUYB 2O66A 2PD1A 1JLBA 1GEHA 3PKYA 4BHQA 2H5IB 3KLFA 1SQEA 1R6VA 4U8VA 2G2YA 1GMWA 1R0AA 1Y0HA 2N3LA 4ZCKA 2AGQA 3QWPA 1AFJA 2V0NA 1T9YA 4ECSA 3TAPA 3OXGA 3GJRB 4L73A 4DPYA 2LA6A 1YHQS 4DZDA 5IQQA 4E2FB 3QT8A 3GV7B 1VRTB 4QIFA 4RUAA 3VVUA 4LF6J 1R0BG 2HKEA 3PM9A 1WELA 2UUWA 4NL5A 4YQWA 2KDOA 2DH8A 1FTCA 2ZE2A 2G1DA 3JS9A 3IP0A 2PC6A 3V6JA 3R9LA 1RT5B 3GPAA 2HWTA 3C14A 1VS3A 5CYQB 4CP5A 1U6ZA 1YZ7A 1XC9A 1X0PA 4BBYA 3V4IB 3RYLA 1IKVA 1NK0A 3WIUA 4OI2A 4DEZA 4ZVHA 4EBEA 2PN6A 3DDKA 2XQCA 1KHVA 2HK3A 1XMBA 1S57A 3TA1A 4PQUA 1YK9A 2DXFA 1RKJA 2V9KA 3LH2S 5CYMB 2ACMA 3CCES 2LA4A 4RKUC 1IN0A 2VKZG 2VA2A 1PSDA 1XTZA 3MPDA 1UW4A 4ZS6A 3SSQA 5BYRA 5ETRA 2GX8A 4KRWA 2J0QD 3FFIA 2O3DA 4NI2B 4OQJA 1URNA 3QYYA 3JQMA 3UN5A 3L95X 2ZHOA 3KHGA 5LMNJ 2XZTB 4KV8A 3KUEA 4JI7F 2EW9A 5C2GA 2GVDB 3OL7A 3QT5A 3F0NA 5AXMA 1H2UX 1CQNA 3DRSB 2HHUA 2B5JA 2HPUA 1ZS6A 3OT9A 1T7PA 3LWLA 4RW9B 2GMHA 3K0JA 2R7VA 4ID8A 2E5HA 2OAUA 3HKZD 1GX6A 1RJJA 3PYEA 1CSJA 3KLIA 3KWMA 1NH8A 2J9DE 1MWZA 2EK6A 2OI2A 1WKJA 4GVLA 2WONB 1TL3B 3L4BC 4NEZA 1BMQB 4AL5A 1HR0J 4E8UA 4MIBA 4X64J 3UR0A 1KVIA 2W01A 3AA8A 3FEZA 3MCOA 4MAKA 2HK2A 4JV5J 2Z30B 1WC3A 3H59A 4DV4J 1NB7A 1FNMA 3R2CJ 1FKPB 2OPPA 5J2NB 3R27A 2MQLA 2D3OR 2KXFA 3V81A 3ELHA 3TP2A 1WACA 4P6QA 2ADBA 3K5MA 1XERA 2CJ9A 3D3BJ 1K1SA 2MKHA 2CPEA 1C2PA 4MTPA 3M2RA 3LP0B 1VHFA 1CEZA 1HQUA 3J80Y 1JLAB 1SJ1A 1HBMB 2KI2A 2FD2A 3N01A 1TL7B 1ZETA 5KFAA 2YX4A 1FX2A 4ECVA 3M8PA 5HL7Q 3I32A 1KQKA 2ZNZA 5HVGA 4P75A 4OLOA 4KGXB 2XS2A 5A6PA 3DLEA 2YQ1A 1SUQA 1RT7B 4X4SA 7AT1B 3M30A 3W9JA 2G1HA 2B4UA 3UDVA 2PIIA 1GMUA 4LFBJ 1HI0P 1SH2A 5JMNA 1FXDA 2GJ2A 1VDHA 2QMXA 3FQLA 2R7UA 1IKYB 4JI8F 2F7VA 1U6FA 1F5CA 4KH1B 4NYZA 1B99A 3T19A 5EGYA 1S1VA 2HQFA 3C15B 2RAQA 4GKKF 2W9BA 4LF4F 1JLFA 2Z2ZA 3OPKA 1LEOA 2XMWA 3CDAA 3BQ1A 2W4DA 2BUNA 1UL3A 2I5JB 5F3TA 3BYRA 2POKA 5HP1B 3VGUA 3CEDA 2QA4S 4OYMA 3DLJA 5LJ5Y 3TJ8A 2QX0A 4AQYJ 1RBOB 3MEGB 4YFUA 2DHXA 5KFHA 2AX0A 2MEWA 1KP6A 3TVYA 1P6TA 2WBMA 1UWBA 4DR3F 2ZZMA 2DJWA 3BGLA 4FDFA 3BSAA 1WEYA 2PMZD 5GAEU 4DQIA 5EUHA 1L3KA 3M2UA 2HG4A 1Y4ZB 3GFHA 3R7BB 3L7PA 5IT9Y 4ZPTR 1S99A 3G8QA 4N56A 2OP5A 4UW2A 1IBKJ 4MIWA 5LOQA 4QW9A 4TQRA 5L1KA 4N76A 3MCNA 2XZDB 3H4BA 4K4TA 1DTQB 2OTLS 1D8ZA 3D54A 3HVTA 1Z2ZA 4DCOB 2IM0A 2VF3A 1NXIA 2AZ1A 3J7Z5 2M9KA 3RB0A 3EUNA 4IDKA 4PYDA 2F3JA 2Y8WA 3T1AA 2E5LF 1H7WA 3OUYA 4ZVEA 2Y8YA 2BE7D 2JX2A 5G0RA 4L72B 3T6BA 5HQMA 5GADU 4QR2A 1I1GA 4CQ1A 1WF0A 3HKWA 3TUPA 3THPA 1S1XB 3UFCX 5LSRA 3AJ2A 9RUBA 1G1XA 1OJ4A 1QSSA 5GADI 2NZCA 1VYAA 1HBOA 4OI0A 4GO5X 1C0UB 3POTB 3VWSA 1O0PA 3HHLB 3EZOA 1Q79A 3M6UA 4ECZA 1VRTA 2AKWB 4MJKA 3PX0A 4NRTA 2G0JA 2PMWA 4PXEA 2MQQA 3MR6A 4IQMA 2BANB 5I4MA 3MFIA 4M95A 2IA0A 2XHWA 4K4UA 2ACYA 1RT5A 1T9UA 3N5BA 2ZDOA 1KVKA 2VBZA 2W7AA 5CYQA 3GJQB 3HMJG 2HRTA 3V4IA 3NNHA 2QMWA 2LDYA 3L7UA 4RW8B 2QL7B 3H40A 1M5HA 3Q24A 1U1OA 8ATCB 3DN9A 2VFTA 5CYMA 1Y3KA 3GWCA 4GRSA 1G6BA 3R6LB 2HFOA 5H9EJ 2MQNA 2VC0A 1OQ6A 1F5AA 4K2XA 4NI2A 3MM5B 1XJWB 2IRUA 3I0RB 1IJEB 2ZZTA 4NCBA 4JI7J 1P8GA 2NQPA 3P5BP 1EQ0A 3RBZA 2PMHA 2GVDA 4KSEB 2GC8A 4NXNF 3H42A 1AROP 1VJWA 4Q2MA 2VC1A 5HK4A 2VODA 3RBXA 4UOCA 1N52B 4AFFA 2U1AA 4CO0A 2R2SA 1YJUA 1EQMA 5A2QY 5B0CA 2R7QA 4DPTA 1YJRA 2ZBRA 4YR2A 2WONA 1VQ8S 2PA3A 3OVBA 4ZA1A 3OLBA 2LCWA 1SXLA 4OI6A 3BGUA 1O6XA 4AYBD 4B3SF 5FLXU 3QSIA 5J2NA 4LSLB 1EIYB 2OD4A 2F4VF 5KFBA 3A1YG 2CZVC 2VZ9A 2VU5A 4TYBA 1K73T 2ZUGA 1W2IA 3VGTA 4Q7AA 5IC4B 4QQBA 4JI4F 2ZJRQ 1X5OA 3PACA 3GP9A 3LP0A 4B9TA 2ZH1A 1JLAA 4EWTA 2H5JB 1HBMA 2DHHA 1I51B 1JXLA 1TL7A 2Q6CA 4ECTA 5KFGA 3CT9A 3Q22A 4P52A 1UFLA 5SUHA 5HO4A 4NLTA 3D6TB 1CJVB 2K1RB 1XNRF 2Z56B 3MEDB 3RB3A 2RDJA 3W62A 4LVOP 4Y2MA 1RT7A 1MMLA 3PJXA 1F2HA 1CVJA 3I5BA 3SEOA 1X60A 4NE9C 4P2FA 1VRUB 1X5SA 3PX4A 2QE5A 4WK3A 4C8OA 5BJRA 2MLZA 5J2QB 1MU2B 5BR8F 3BF4A 1WF2A 4ETZA 2IRXA 4IH5A 3Q2SC 3QMQA 1IKYA 1JXVA 1TUGB 4GKKJ 3D7SB 2ZH4A 3C15A 4LF4J 3V2UC 4DCJB 4PWWA 2V4RA 3TJ9A 4WTOB 4DR7F 3H2VE 2R7OA 2I5JA 4EK2A 4ZJLA 1QVFR 4QWDA 5HP1A 2CNLB 5HVHA 2CQHA 3BN4A 1JJHA 3VF0B 3LF0A 2XI3A 3MEGA 2CDQA 1OYEA 4Z7CA 2XMMA 9ATCB 1KONA 1ELOA 2V9WA 3TA0A 1TU0B 5CD4A 4H4KC 4DR3J 5DO2A 3A4TA 3AQOA 1MG7A 3RU0A 1U1NA 1RB0A 3R2DJ 2KZMA 1DQAA 5EX0A 1FRIA 2W8KA 1CULB 2DO0A 3NP5A 4C3KA 4GVBB 4HACB 4WYWA 5KFPA 4KBIA 1X7VA 2B8QA 4U8YA 1S1WB 2U2FA 3DYAB 2N7YA 5F8LA 2VOPA 3I6PA 5J2MB 2OPSB 2PT0A 3MMCB 3NMAA 5L9XA 3ZZYA 5F8IA 4DL6A 5HI7A 1TMJA 3HXMA 5LMUJ 1EKRA 1DTQA 4ES2A 3M9OB 1H3DA 2RJZA 4U96A 1B3TA 2ZITA 4DF4A 3B4DA 4A8XA 3W1YC 4WTYA 1VLOA 1UVJA 2YKAA 2YWEA 3OFGA 3OV7A 2CPYA 4USTA 3CCUS 2WTFA 3BO2A 3BGOP 1HWKA 1Q5YA 5FJ4A 4IR9A 2XMTA 5A8RB 2QA2A 1EJ7L 2E9RX 2RKIB 4CLFA 1NK9A 2ASJA 1LW0B 1VGYA 4A8MP 2KVIA 2NXNA 2F40A 1SJQA 4M5NA 4IRDA 5KFLA 3MM7B 2VQEF 4Z2XA 1C0UA 3AJ1A 3POTA 1HNVA 4I56A 4IG3B 1NPRA 3HHLA 5CABA 5KT7A 2GCFA 2LMIA 4FNIA 2ZJQQ 1U1LA 3J7ZT 3GB0A 3ZZZA 3QRQA 1QE1A 3NWGA 1W2BR 2V6AA 3H5UA 5DGAA 2BANA 2D69A 1YIJS 3BO3A 5KFXA 1HARA 1OWXA 4HL9A 3LP2B 2YKNB 1N34J 3BDPA 1DTTB 4LT6A 3F73A 2RQMA 4V19J 2DGQA 2RSQA 2PFFB 1HNXF 1OQ3A 4YDXA 2KH9A 1V9OA 4DV6F 4FS2A 1L3SA 1VQPS 3EXCX 4RW8A 3DU5A 4DUTA 4EZ6A 5EWEA 2CZ4A 1U1PA 3FEXB 1Y9OA 4DL3A 1TK8A 3LALA 2GMJA 1YJVA 1WTFA 4PPDA 2YWHA 1ZOTA 2RH3A 4BC9A 4X2BA 2CNKB 2CVEA 7FD1A 3GFZA 1IKXA 3PTWA 5F8NA 4HH1A 3MM5A 2A2DA 2I2YA 3TR5A 4EMDA 4IG0B 3I0RA 4G65A 3CGIA 4IYQA 5DQIA 5J1PA 3R5DA 1U2FA 4RJVA 4C0BA 2V5HG 1CC7A 3NGRA 3OFHA 2DISA 3PEJA 3V6DA 2JFKA 3G4SS 3TUZC 3BQ2A 2LYVA 2BW7A 4Y2AA 3DOLB 5LXYA 2LQJA 3W63A 2NSBA 1OY9A 3N6MA 2KG1A 1D0EA 1X4EA 1IM4A 2W2MP 1AA1B 2V69A 3BBCA 3E51A 1F9EB 2DGXA 1WHWA 2PGCA 4TY9A 1RTDB 2KJWA 4CNZA 2XO6A 4NWBA 4B3SJ 4NA3A 1R43A 1HD0A 3DOMB 3JTOA 4DSJA 2HLTA 4HH0A 3NOGA 2F4VJ 2JFDA 2DBBA 3CE8A 5KFSA 4FS1A 4LSLA 2MZSA 2HIQA 4CM2A 3TAMB 5AE1A 2HFZA 1VK3A 2HVHA 4U7UK 2BM1A 4TVAB 1RZMA 2DR6A 3UNGC 2FIUA 3KTQA 4K59A 4PYAA 1FWLA 1HMVB 4FYDA 1ITPA 5GMKa 2C2OB 3X1LB 2MB0B 2ALYB 3GZ7A 2LXFA 4OZ0A 1H6KX 4WCEQ 5A0YB 2AJ2A 1VIXA 4KIAA 2DY1A 4EGLA 1CJVA 2K1RA 4K5RA 2OPRA 1QAYA 1FRJA 3R8YA 5HJYA 2RIJA 2BXJA 3FBCA 2OEJA 2DNYA 2V34A 3M8SA 2BBEA 2XCPA 4WK1A 3O8WA 1VRUA 3TARA 5H9EK 2QLWA 2W9CB 4PRFA 5BR8J 2Z2YB 1DAXA 5J2QA 4PCQA 1T95A 1FT8A 1Y5IB 1RA7A 4NYOA 2YKQA 3Q89A 2WAQD 5KG3A 2KFYA 4J9PA 4QWEA 3EPGA 4NYPA 4DS4A 3GTYX 2HHQA 5DM7Q 1TL4A 1YSJA 1NSPA 4EEYA 4FPRA 1IWAA 2FHKA 1K0VA 4P71A 1IJFB 2J5AA 3BN7A 3UD3P 5FIIA 2O5DA 4QPTA 1LWCA 3L9ZA 1YTYA 4Y0FA 1REVB 3W8PA 5KFUA 2CDRB 3P5TL 1RAIB 3UI3A 3JTNA 2VIHA 3BKFA 4PKDB 5KT5A 4KQZA 5ETTA 2EVZA 3V6KA 4B9UA 5HANA 1NK5A 2HBRB 4GVBA 5EWGA 4HACA 4PQAA 2AEMA 1YJTA 3UCGA 1IBMJ 4UZBA 2YNHA 3D6FB 1K9MT 5HQLA 1S1WA 2QLBB 3DYAA 4G3IA 4QU7A 5J2MA 2OPSA 4UOHA 3MMCA 2CXEA 4G1QB 4WWSA 4ZVOB 1QSLA 4M94A 3R7NB 3TZXA 2B51A 3FGVA 3CULA 1NHVA 1HHQA 4L3KA 2FLOA 5CA5A 2C3PA 1FJEB 3TOQA 2DH9A 4K4ZA 4K0KF 1CLFA 1RLDA 2IA6A 1I94F 1JJCB 3SCLE 3KDNA 3HK2A 4F0HA 2CQ0A 2QG9B 2X3DA 4MK8A 1N32J 3T5KA 3SSRA 5A8RA 4G1PA 4QW8A 2EFQA 3UNYA 5FLXY 4FYWB 3K8VA 3P96A 2VQFF 2I0XA 1LW0A 2M70A 4ED7A 2Y1RI 4X4OA 1M1GA 4X4PA 1RBAA 4DQQA 2AD9A 4ZITA 2AYMA 2VQEJ 2BMBA 2P6SA 2HBQB 3MM7A 1VCTA 2WSFC 2WSEC 3EVOA 4P74A 2FY8A 4NEYA 4YP3A 1HWUA 5D0RA 4IG3A 4KT0C 5L1LA 4TKTA 5A8KB 4ELUA 4DOZA 4LFAF 4FKXA 5HSPA 1U24A 1GMWD 4CLUA 3C19A 4M63A 5HQ8A 3JAMU 1BGXT 2K7JA 3KK2B 2IM1A 4C7QA 1ZTTA 1G3OA 4U6PA 3K5LA 4GC7A 4RUCA 1NSKL 3W2VB 3K5NA 1T05B 3VAIA 2YKNA 5KG6A 4W4MA 2UXBF 5KFCA 4DX5A 1DTTA 3WHIA 1HNXJ 2W25A 3GU0A 1O8BA 4PG4A 4ZP9A 4B3RF 4JI6F 4W90B 3OHAA 3FBFA 4YEAA 2MQPA 2PFDA 2FLLA 2HGNA 1QVGR 1HBNB 5AE3A 3CD7A 2F9DA 2DNPA 4WIQA 4DDFA 2QZ8A 1X5TA 1S1TB 3OFFA 5F9NA 1LV5A 3NWRA 2DEIA 4IG0A 2H9ZA 3BR9A 4X62J 2LXIA 2EI5A 3SCIE 3UR3C 1TP7A 2MZTA 3NS7B 2MXYA 1TZ0A 1WDDA 3SFGA 5DDQC 2Z58B 1NJZA 2ZBPA 2P9CA 5FDLB 2OFHX 1J5OB 4NASA 5K8PA 3GR0A 2AP6A 1SJRA 4CH0S 2CZ9A 4IKAA 4HHUA 2YWWA 5LT5A 2BJ7A 3DOLA 1NKBA 1V3RA 2VBWA 1JB0C 1NDKA 4NRUA 3PYGA 3J81U 4YB5A 1RTDA 2AWZA 5F3ZA 2EFNA 4F4KA 4X65F 1HBUB 1DJ0A 1S79A 2YXLA 4QR1A 5B08A 3DGPB 1WG4A 3UPFA 1FO1A 1HWIA 4I0WA 4CIOA 1B0VA 4O4RA 4A8KA 1P1TA 2RDIA 4DV5F 2QYCA 2D9PA 3DM2A 1U48A 3TAMA 3IFEA 4FYXB 3SMZA 1WKLA 1VBZA 3OJSA 1APSA 4JUZA 2HQIA 1EAYC 1UP1A 1HMVA 2V63A 4O4GB 2V68A 1RT1B 1X4FA 4NLVA 4TQSA 2HRYA 2PEHA 3MGJA 4YS2A 2VG6B 2NPIA 5A0YA 2AYEA 4USJC 3US5A 1H2TZ 2RD5C 4ED4A 2Y3YA 5F41A 5AE2A 2JHEA 3QPIA 3KJVB 2AIRB 3IWNC 2IVMA 1R8PA 3D1HA 1FRLA 4FBUA 2W2PP 4LF2A 4QU6A 1FDBA 3K7RA 1KSPA 1EKSA 3KNGA 2R7WA 2E66A 1TKTB 1QTMA 3W5ZA 3KYLA 5E3CA 2LVWA 4XO0A 1FCAA 3M6WA 1QLNA 3T41A 3S8SA 4OL8A 4C6AA 2JH3A 2F5GA 4DFKA 4NX9A 2CYYA 1S6QB 1U45A 2UUCF 1S97A 3TUJC 1KQSR 2C42A 5E0OA 4CI0B 1REVA 3HCXA 5AT1B 1HI1A 4C8LA 1NUEA 2J9CA 1LW2B 4PZVA 3QJJA 4M5JA 4ES3A 4DX7A 2CPFA 3J7YU 2R2UA 2BOPA 1RAEB 1ZAVA 4J9KA 4ZCMA 3DLLQ 4NLDA 1XR7A 1N5YB 4KE5A 1CJUB 3QLHB 4UUWA 3G87A 5E3QA 1LFWA 2XNRA 1UJ6A 1A7GE 2N7CA 3MR7A 3G6ES 1KHWA 5AXNA 2AGOA 5DJBA 1CG2A 3U1MA 4IR1A 3AODA 5F8GA 4J9LA 4G1QA 2AYGA 4CO3A 3PJ9A 4AD6A 4HI1A 4OIXA 2AV5A 4DS5A 4A46A 1UVMA 3AT1B 1Y5NB 2N82B 4XDCA 3UCZP 4K0KJ 2DXDA 1ZM2A 4OYIA 1VC6A 2D74B 1I94J 3CD5A 2AHOB 2R3VA 2RT3A 4RW4A 2ZEJA 4C97A 1FRXA 1ZPWX 3OTCA 4RW6B 1KS2A 2ZHBA 1U26A 3EMTA 3LP1B 3B8HA 3HT3A 2DKOB 5IWAJ 3NY0A 4B3OB 2VQFJ 1HQEB 1MNEA 2DR8A 3VQTA 3GONA 3ZO7A 4JI1J 2R8IA 2QO3A 2BOAA 2B9WA 3LGNA 2E9ZA 1OSDA 2LU1A 4DR4J 4KJIA 4K4WA 1HWJA 1T3OA 2G4BA 3PFOA 4FXWA 4ZP6A 4JP8A 5IV4A 2IMWP 4DQPA 3SCKE 2HQCA 3J81j 4DV2F 4LFAJ 5A8KA 1NO8A 3KG4A 4RX6A 1WWHA 2JL9A 1DY3A 1FKOB 4QWAA 1TK0A 1YJWS 3OL8A 1WHXA 4ALZA 1FFGB 2ZC3A 2HGMA 4ID5A 3KK2A 1UVIA 2C2RA 2AEFA 1OYDA 1VQ6S 3W2VA 1VBXA 2UXBJ 3CCJS 4OLPA 1X5PA 4OV6A 1T05A 2L3MA 3D68A 2C3MA 3M4XA 4B3RJ 4JI6J 3ULHA 1M1KT 5H1SV 4LBHA 1GFWB 3CD0A 1HW8A 1S0NA 3G82B 2UVUA 2A1BA 2VFVA 4N8NA 2FYXA 1UMJA 3BR8A 1U09A 4ED5A 2KHDA 1HBNA 1VBKA 4KTQA 2IDEA 3BSCA 2J0XA 4ZVPB 4HHJA 3KK1B 2DGOA 2QLJB 3G6YA 2CVIA 1S1TA 2XO7A 2LQBA 2WB1D 1SJ4P 1PC5A 4J9UE 3CJ8A 2DNOA 2QJ3A 3OVAA 2DB1A 5FDLA 3MCSA 2RF2B 1F3FA 1J5OA 1V5IB 2VICA 2WVDA 4O44B 4WP8A 4EBCA 1S6OA 4M5IA 2CQ3A 2JOQA 2IBKA 1JK9B 3MEKA 1GXUA 2OMLA 2QL5B 1D3WA 2XMKA 2VBXA 4C3MA 3ZXWA 4X65J 4CTAB 4WF9Q 5DLGA 4URSA 1HBUA 3EJMA 4E98A 1XQIA 2CQBA 4AUKA 1FVQA 4KHPJ 1NMEB 1YKWA 5E3RA 3GFYA 3HVWA 3QBCA 2R7XA 3K17A 2CJQA 2VV5A 1V5VA 1RWXB 3MPVA 3R1HA 4O23A 3BSNA 4DV5J 2ZH5A 4CO4A 3MUTP 1RK8A 2FJXA 3QRRA 1G7CB 2BZ2A 2VJUA 4PPZA 2ZM6F 5JJBA 1XMQJ 2KT3A 4F36A 2FHMA 4O4GA 3OSPA 1FDNA 1RT1A 4DL0C 2PSZA 1Q7LB 4ILMA 3HHEA 1SH3A 1G4CA 2ASLA 1C4AA 2VG6A 1WF1A 2VA3A 3NS5A 2QLFB 2GQCA 3HSJA 4CZCA 2FVPA 1JMTA 4UOFA 3IA0A 2R8JA 2UP1A 2NUUG 2G0IA 3KJVA 5F8MA 1RA6A 3ITHB 3O6QA 4LRDA 5DQHA 4B3TF 1RCOB 1PIEA 4DJBA 4F4ZA 1KBRA 3B82A 5LSOA 2CA9A 4EI2A 4B9LA 3J80U 3R5JB 3D2WA 1J5EJ 3QT6A 1UPMB 3SYZA 1VBYA 1TKTA 1SJFA 4P10A 3T1HF 2DCLA 3A8IA 1BLUA 4P2XA 1NSQA 2MZRA 1HA1A 1SL2A 4B3MF 4DX8H 2O67A 3JAMY 3SCJE 4CM0A 3VQSA 4ZVRB 1AFIA 4F2RA 5KT2A 1RT4B 2JVOA 2IHR1 5ETSA 3WX4A 3EDRB 1NJWA 3NG8A 2W2NP 1FVSA 1RTIB 1RAFB 1LWXA 3AY0A 1IR2A 4LIWA 2VONA 3H7HB 3BO4A 2YNGB 3DLBA 2EEYA 3AQPA 5L9NA 2IC3B 1NJIT 4DCPB 1KD1T 3IBFB 4P72A 1KLNA 3PO4A 1IKWB 3ET6B 2GAGC 3B6BA 4DBQA 2A0FB 2WK4A 5DM6Q 1N5YA 2LKZA 3RZAA 1HWLA 3QLHA 2NREA 3TO8A 3KUHA 2QC3A 4OZ3A 2OO4A 5E33A 2IM3A 4EFAC 1RAOA 4Q44A 3W66A 2LQ5A 4KKOB 3WZ0A 4YB7A 3RUBL 1Y7PA 4MK7A 1U02A 1FJ7A 2VOOA 3OD2A 2ZD1B 1LXNA 5DDPC 1FWPA 1DQ9A 4CLTA 3QGPA 2F65A 4L3NA 3JQKA 2DITA 4X4VA 4ZDNA 3J81Y 3CJKB 3CCMS 4RW6A 5ETNA 4DV3F 2X3GA 4DV0J 3M1VB 3LP1A 4WPAA 1IUJA 4HKQA 3OL9A 4B3OA 1N88A 3Q8PB 1YZ6A 1HQEA 1RACB 4IFYA 5KFOA 1AXQA 1T9WA 1O5JA 3THVA 2O01C 2FHJA 5H9FJ 3FBBA 1U7LA 4DX6A 4I1TA 1OPZA 3R5GA 4NOHA 1VQ5S 2LEBA 3CMQA 3H98A 1GH8A 2JJ4D 3HHKA 2CJYB 4DV2J 1VQ4S 4A8YA 1UJ4A 2P6TA 2FQQB 3W61A 2EBGA 4LF9F 1RUSA 5A8WB 4DSEA 3OHBA 3V6HA 3LUYA 2XGQA 3PG9A 2B56A 3QSYB 4I6WA 3TUIC 4DV4F 3M9MB 4CLKA 5KG7A 3I4PA 1NEEA 3ILJA 3HZEA 4KO0A 5KG0A 2R2RA 3M6VA 2OD6A 3HHLD 4XK8C 4LJMA 3A13A 2XMVA 2L9WA 2CRLA 4LSNB 2E29A 2ASYA 2Z8QA 2H48B 2PA8D 2EFVA 5KOWA 3G82A 3VAMA 2X51A 2OSQA 3EX7B 2HFVA 2OIHA 1T3NA 1S9FA 1BD6A 2R2TA 1FDDA 1SC4B 3KK1A 1KFSA 5JVGQ 2H65B 2KYXA 4Q45A 3FSYA 3AXMA 5BYSA 3H5XA 1N5SA 2BE2A 3C16B 3H2LA 4LFBF 1WTBA 1SC3B 3I31A 4RWWA 1NK8A 2BM0A 1C1CB 2F1FA 4ZLJA 3NS6A 3TJAA 4DPWA 2ERRA 2OPQA 4PUOB 2RF2A 5K9FA 1RSCA 1VOMA 2FJWA 3HJVA 4O44A 1X4HA 3LAKA 1NDCA 2ZH6A 3D6HB 4OHZA 2HHTA 3PW0A 4NLXA 3CO9A 2AW0A 2MKYA 2BACA 4JYAF 3TANA 1H7XA 3HDSA 3A3OB 3ZNUA 2AEJA 3GG0A 3PRVA 3ZTSA 3HSZA 5MAOA 3NRBA 1LFPA 3LPEA 4C8YA 2DGTA 3KDOA 4CTAA 4DL4A 1VC0A 1FHTA 4OZ2A 1U2CA 4QWCA 4JI2F 2J8SA 1D8YA 2KN4A 1NKEA 3CJ0A 4JI0F 3KMSA 3C2PA 2B8PA 2X7IA 2ATLA 2KYZA 2JEIA 1E6VB 2MJNA 2F8MA 2H4YB 5M2RA 2QMUB 2ZM6J 1JWWA 3QRPA 3VAFA 1F0XA 1SL1A 4WFZA 1BY9A 1PJ7A 2VFUA 1XN9A 4B9VA 5HROB 2WBRA 4WZMA 4PABA 3UWTA 3PXGa 5C24B 4J90A 4QWBA 1V3ZA 4OX8A 1XMOJ 5EDWA 2VBYA 1IBKF 2E1CA 2J0SD 2VH7A 3EGNA 4ED3A 4F50A 1HL6A 3QIPB 4B3TJ 4HT5A 4NCAA 3ITHA 4ZHRB 2EFGA 4USKA 2XMJA 3VHQA 4WU2A 5KFVA 1N33J 3PEHA 2A18A 3W5XA 5U47A 4USHA 3T1HJ 4OZNA 4ITSA 4DWIA 5ETPA 1U8SA 4FYVB 5L46A 1URRA 4B3MJ 2J7KA 5KTQA 3EXYA 1H74A 2D3ZA 4RR5A 1BWEA 4N8OA 2WB4A 3E3XA 2BKOA 5E3AA 5CH7B 3HULA 3T1YF 3RAXA 4CWBA 3KJFB 4RNMA 1RT4A 2XNQA 2JC0A 3TX8A 4BC7A 5D0GA 3HT0A 2FGCA 1RTIA 3Q83A 2L08A 2COLA 2JLGA 1ZAXA 5KFQA 3Q0AA 2YNGA 2DNRA 1RTJA 2CG8A 3EE3A 2UV8G 2IC3A 2GIRA 3JSRA 2CFXA 2FVRA 4J91A 4AL7A 1Q7YT 2FZKB 1IKWA 3ET6A 1S0OA 2GIQA 2YVSA 3PNIA 2MGZB 5AXKA 3DLHA 5I42A 3M8YA 2CQIA 2RQ4A 4OJGA 2HVEA 3UO0A 5LSLA 1PCAA 5K14A 2QIFA 1F6TA 4ED6A 5D4OA 2DT9A 2PO4A 3R7SB 3PIPQ 3FZBA 1KFDA 4KKOA 4ELTA 1WJ9A 2CQDA 1TMMA 2KZZA 1NK7A 2V4JB 2ZD1A 2WOMB 1S5ZA 2W4PA 3MD3A 3OW2R 4CT8A 3CPWR 2UU9F 4EU0A 2YQ3A 3CJKA 3ADAC 4DV3J 2VL1A 2DGVA 4IRCA 2MZJA 2G9OA 5E7OB 3FBEA 2MSTA 2GQQA 1R27B 2FGOA 2MQMA 5J1EB 4USUA 1UZHA 4RU9A 3CJ5A 2UUBF 2MPUA 1IR1A 4O3NA 3BBFA 5HMYA 2P8IA 2B4PA 3K2YA 2YQ0A 3MMJA 1RYSA 4LF9J 5BYQA 2B6AB 1M90T 3PRBA 1BQMB 1Q1KA 3FJ2A 2FUG9 2JVRA 4RUHA 3MTJA 2YX1A 2LP4A 1FDAA 2DH7A 4ZVFA 4DPOA 1Q82T 4WFBQ 2N4CA 3S01A 1K44A 4PXDA 1GTHA 2N3OA 1R8BA 3UW1A 3WC0A 2J9EA 3CF5Q 3RW6A 2KJVA 1QTNB 2ZOGA 1FXRA 2R8HA 4LSNA 5DLFA 3VTIA 4CO1A 3N79A 4LBIA 4F02A 3GYNA 4MIAA 5M2PA 3S1TA 4J9SA 3VCDA 3HD2A 4F4WA 4OI4A 2MSSA 2QSWA 1X4DA 3H5SA 2NR0A 3C6UB 4G6VB 4TU9A 2HMIB 4LF1A 4NLPA 1VJQA 4S0MA 2RHSB 3KHHA 3K89A 3FMWA 4ZMMA 5DQGA 4NLGA 3C16A 3OTBA 1C1CA 3IBCB 2DHSA 2APOA 3GYXB 1YLXA 4PUOA 2I1RA 3DOKB 2GS8A 3KG1A 2E5GA 2AJQA 2NUHA 2ADCA 3HHLC 3HHDA 3OTOJ 1KTVA 4NMLA 4EO8A 1CJKB 1BQNB 3MM8B 2IYGA 4JYAJ 4ECWA 5KG2A 1RP5A 5H9FK 2X1GA 3R1LA 4WBFA 3HX9A 3QGHA 4JI2J 2IBOA 3G8TA 3ZNJ1 2NZ4A 4KR0B 1RDRA 4F67A 4JI0J 3H4DA 1S48A 4WJBA 2FVSA 1PG5B 2K8GA 1UETA 1KLMB 3RW7A 3DXSX 1E6VA 1S6PA 1HNZJ 2HVZA 3C6TA 3U27A 4DSKA 2OKQA 5LXRA 3BPSP 4OYOA 1PYOB 3EGWB 4TLQA 2FJBB 4J9QA 2YX7A 4ANEA 3PYDA 1RTZA 3HVAA 1AW0A 4DU7A 3SZ2A 1UCNA 4K4VA 3KUGA 5HROA 1QY7A 5HVFA 5C25B 4CO2A 4KFBB 5C24A 1EP4B 4HDGA 2LECA 3K8WA 3GE9A 3KNAA 2M3DA 5A76A 2DIUA 1TUVA 2ATCB 4XTTA 3QIPA 2Y1JA 3RBDA 5LMUF 3JSMB 4F8RA 1S9EB 3VR1A 3CUNA 1LWEA 3H90A 5B0BA 2J6UA 3MMAB 4I68A 3VAGA 4JV1A 4YN3B 1B7FA 4ER8A 4OYXA 2HIYA 4LIRA 3QGIA 1TL1B 3ENVA 3DFEA 1HYSB 5ETQA 4NA1A 4NXMJ 2G0CA 2JC1A 2BDPA 1IXKA 1NDPA 2CJXB 3T1YJ 4OJ1A 2B3TB 1VQNS 3T5JA 1A0OB 2RUSA 1SQGA 2XMUA 4ECUA 4U7UD 1LOUA 4OZ5A 1KVJA 3MAHA 3EWGA 4PEOA 1GK8A 2LU2A 5AJ3J 1PAUB 3FC9A 4NZ0A 2DHAA 2MQOA 4PG7A 4WYLA 3N9UC 4ELVA 2MGZA 4WE1B 3AOAA 3KFWX 4ED0A 4OZ1A 1GXLA 2ASDA 5D3GB 1SC6A 3M2VB 5E41A 2LEAA 2DO4A 1KC8T 3I55S 2FC9A 1N34F 3H2UB 3AHPA 4FF4A 1VFJA 2X1AA 2D1CA 2OTJS 1UKUA 3B4MA 3WQPA 1IWGA 5L8RC 3OXLA 4DL7A 2X1FA 2ZKTA 2MHNA 3FSIA 2V4JA 4IH6A 2PEBA 3TZZA 2WOMA 2NYIA 2YNIB 2UU9J 3DKDA 4YY3F 1J27A 3ZC4A 1B0PA 4LUBA 3DRRB 1XK8A 3TNVA 4CLZA 4V19X 2FJDB 1U8WA 1GXTA 4K4YA 1RAJA 2XMAA 1FE4A 3DRSA 1NSAA 2DGUA 1YBAA 3TW0A 1ICEB 2RILA 2UUBJ 4RW9A 1D09B 3IM9A 2HHWA 5HATA 1FJGF 4BWMA 1RHMB 4Z37A 1PJ6A 2ZH8A 1TL3A 3D0HE 4FVCA 3MUMP 1CQMA 5HJXA 3P3DA 3QFHA 2B6AA 3P8BB 2IVFB 1BQMA 1RAAB 3D4JA 3O1LA 4KY3A 1N5VA 4IOAQ 4RNHA 4CO5A 3G96A 1FKPA 1F3VA 3JXOA 3GIJA 5CD4H 4FVMA 4IFVB 3QAUA 3ZZPA 4PQUB 2L41A 4OX9F 1ZA2B 2PI4A 2I9SA 1M5SA 1MN9A 3JQJA 2HFNA 5FD1A 1Z2LA 2IJRA 1DBDA 4OFZA 3NCPA 2XZWA 4JBCA 4WU3A 4EZ9A 5CHCB 3HD1A 1NPPA 4Y2CA 4QOTA 1S7HA 5D0EA 3KLGB 5F9LA 1F1BB 4KV8B 1BHNA 2V2VA 2BKNA 3MR3A 1FD8A 2HSEB 3CW2C 3PHTA 3DC2A 3ONQA 2HW3A 2JRSA 3C6UA 2B5JB 3MZIA 2HMIA 3NGSA 3SIPB 2UXDF 2PI5A 2WSCC 2AT1B 1WEXA 2BRLA 5HMWA 3AFGA 5M2UA 5IV3A 1TAUA 3W8GA 3LANA 4DUYJ 3NAHA 5KT3A 5CYJA 2E1MC 4OHYA 2VPYB 3T3FA 4QZVB 4L6V3 4RO0A 2BE9B 3PW2A 2CNNB 1VQYA 4RL1A 4ZIWA 5KG4A 2M0GB 4NZ7A 2DPJA 2B9YA 4ZJOA 1WC1A 1MLAA 3PY8A 3I5CA 1CJKA 2WVBA 1UA0A 3V81B 3RTVA 4G1IA 5E2QA 4QBUA 2MLXA 4IO1A 2RS8A 4P2SA 3R5AA 4K7QA 4B9NA 1RWKB 1GTEA 1F9FA 4AXJA 2RQCA 2FVQA 3JB9k 2C2NA 4XPCA 1YG0A 2K2PA 3QT7A 3CIZA 1X31C 4CLYA 2HLUA 3D0IE 4A4JA 3CJ3A 5B0FA 1N54B 4J9MA 2C22A 1KLMA 3VAHA 3NCRA 5HMXA 2DYAA 2A3JA 3P4UB 3UD5A 1YBUA 1Q5VA 4FP9A 4I67A 5KT6A 4ILLA 2O1PA 1XR6A 3HJFA 4AE5A 5EHHA 5AXLA 4PG5A 3RRHA 3DLGB 1EZZB 3ETMA 4KGMA 1RCXB 4ICLB 4N41A 2K3IA 4ZCIA 2UZAA 3CCLS 1IBMF 3N5FA 3ZTOA 1L3VA 3CB4A 3IAS9 3W65A 2VG7B 4O0IA 5C25A 4KFBA 3BJYA 1B64A 1HFEL 5ITHA 1EP4A 1YJ7A 4WP9A 5HN0A 2HEKA 4QYZJ 1VHIA 2E5IA 3W9IA 2ALZA 1S1VB 1X9MA 4F3MA 1M5KC 3EGZA 1S9EA 4ERDA 2YKOA 4UQTA 1RE1B 1RLCL 3QFWA 3MMAA 5I3QA 3CCVS 1FEEA 2UVRA 3MOJB 3NXZA 1X4GA 4JI3J 1TL1A 3TQEA 2JEJA 3CCTA 2Q66A 1TVRB 1SC1B 3TZYA 1HYSA 4K4SA 4WXWA 4NLRA 2XBPA 3DU6A 2QV6A 1N32F 3FRYA 2WCXA 1S9GB 3KMQA 4FKYA 3QNWB 5F0UA 3SV3A 4ECXA 3CJ2A 3MTKA 1S1XA 4BWJA 4XPEA 5KFRA 3RRKA 5T7LB 3MD1A 5DG7A 3WX8A 1V3SA 2W4CA 1GQEA 2R42A 1PBAA 2ZVSA 3M2UB 2Y0BB 1X9WA 2MKCA 3I82A 1QUVA 1QAIA 4CLWA 4UT4A 2W2OP 2BYCA 3I87A 4KHRA 5DGBA 1X0FA 3BSOA 4TN2A 1DURA 3EDQB 4ZK7M 4F0MA 4LF5J 2AX1A 4IUFA 4WE1A 5CQGA 2GZOA 4DUZF 3M2VA 3HFVA 2MQ8A 2EFPA 1TV6B 2DPIA 5K20B 1SPBP 1Q53A 1GAOA 2QYGA 1TAQA 5E5NA 4IO9Q 2FTRA 1WORA 3DLKB 3KK3B 4O0NA 4EYIB 3LW5C 4CLPA 3CCWA 4KPCA 4H4OB 3H0PA 5G0RB 2D3UA 2EPIA 2YNIA 2BR0A 4F7VA 4YY3J 3HP6A 4ED8A 3OFEA 1HBOB 3Q23A 3DRRA 4MMOA 3RAMA 1DLOB 4X62F 2HURA 5HBMB 1VMBA 2QFIA 2LQ9A 1TQLA 1HD1A 3CDEA 2JDJA 5DG8A 5KAKA 1FJGJ 1N5TA 4OYZA 2MZ1A 1HI8A 2FJEB 4OI3A 1RHRB 3NGTA 1IQTA 2HHXA 1RADB 3G86A 4MKYA 3PKMA 4YDDB 3DRYA 3MR2A 1KOHA 3CC2S 3R6GB 3GIKA 4F26A 2J0WA 2FLPA 2BA9A 1NNDA 2ROGA 1XNQJ 2LEPA 3M8RA 2KL8A 2RVJA 1VQLS 2FHJD 3EVMA 5K5MA 3NBPB 2HHHF 3DRPB 4PXBA 2Z4PA 4ZP7A 2AZ3A 4IFVA 4K5SA 2FDNA 4OX9J 1HNWF 1YX2A 1FWKA 1RHJB 4I7FB 3I96A 4DG1B 2Q6BA 3CWJA 3HZGA 1U0HB 4Y00A 2DR7A 2FHOB 3MPYA 2CQCA 3AD9C 3CMAS 5KFFA 4R8UB 3R5BA 4JV0A 4JI5J 4F25A 5C7PA 3GLJA 1LNQA 2CWXA 3ZZOA 4Q5VA 2OH2A 8RUCA 2GW8A 4ED2A 2OGUA 3KLGA 4USIA 4AL6A 3JYTB 4K50A 3SXLA 5I3UB 4DV1F 4LREA 3W2WB 3DDNA 4O3PA 2UXDJ 1HKAA 2XS7A 1Q16B 3MEDA 2DGSA 2WRMA 1FXLA 5ETLA 1G2EA 2WW8A 1S6UA 2J7WA 3D0GE 3BZQA 3RJMB 1H72C 3DXBA 1JX4A 2E1AA 3Q8VA 3BDEA 3M7VA 1K47A 1MU2A 2EWHA 3I9ZA 3MECB 2R8GA 3IS9B 2KFNA 4YHHJ 3AA9A 4LQ3A 2E9TA 5HLFB 2XG8A 3QATA 2YY3A 3FKBA 3PR5B 3IGNA 3GFXA 1VLYA 4Q2LA 1KTQA 5IZHA 1QAJA 3NGDA 2NSCA 2V94A 1Y3JA 2F4FA 4LRFA 5D15A 3VZHA 2EC2A 1KDNA 1ULRA 4RW7B 3BEGB 3OL6A 4F4AA 1MW7A 1RAHB 5L39A 2M2BA 1VI7A 4F2SA 4WFXA 2E7VA 2MKSA 4UY85 2IJNA 5C42B 2XSJB 1CULA 1RT6B 4M8LA 3DLGA 4M1KA 4ICLA 2YNFB 2C3OA 4WZQA 2HYIB 3THTA 2VDIA 2VG7A 4WP3A 3K58A 4A8FA 2KT2A 3UDLA 3FRZA 1N0UA 1WC5A 3EVWA 4F4XA 3I4HX 1PYSB 2BJ8A 3CO0P 4RBTA 4ZPWR 2ILYA 5IOLA 2CQPA 4DSIA 2CADA 3R3TA 4WFAQ 2HHPA 2AU0A 2OHDA 3AB2B 3D9BA 3IN5A 4CH1A 1NDLA 2F9JA 3VZIA 4C2MA 3SI8A 5DZ6A 4ZLPA 4C8KA 2DXEA 3BM7A 4N47A 4ZVGA 1UVNA 1IBLF 3M9NB 1TVRA 5DS7A 2EK1A 2KU7A 4NCGB 5IWAF 1S9GA 3CJQA 4DLGA 2RKIA 2EC0A 4NA2A 2M88A 1UFWA 3LTOA 3PDNA 5KFJA 3QWUA 5T7LA 4JI1F 4DPXA 1RWPB 4DR4F 4ECYA 4LF7J 3UDEA 2XI2A 4LFCJ 2X1BA 3MURP 5GAEI 3A8KA 3H5YA 2H4WB 4CNYA 1SL0A 4ZPDA 4ANCA 3S6EA 1R8HA 1FEHA 3BKTA 3PYFA 5KFTA 1BE4A 1S4FA 4ZCLA 4U95A 2R7RA 4DUZJ 2D7SA 3SQGB 4ZVQB 2MY7A 3NKYA 3LP2A 4USVA 2QT7A 1UTAA 1KN6A 1X4AA 3GIIA 1TV6A 1XEZA 1R6YA 1Y11A 2FC8A 4EUVA 2Z2MA 2VASA 4PR6A 1PILA 3ISZA 1RHKB 5KG1A 3M8WA 1RHQB 3DLKA 2I8EA 2Q3PA 3KK3A 2H54B 4CDIA 2W2QP 4NMXA 2I38A 4Y34A 4DR6F 5KFKA 5JVHQ 3KG0A 4H4OA 3IAM9 4BLGA 1NZAA 4F3OA 2XULA 4B08A 3F44A 4J9VA 5B0AA 2V8GA 4QYZK 1S7IA 4ZIVA 5D8HB 1TFWA 4Q8EA 4ZPAA 2CQ4A 2LXUA 2W1BA 3K5OA 1DLOA 1HNVB 5HBMA 5SZTA 4PWUA 3EZ5A 5KFZA 2EBEA 1YVFA 3AJDA 2CPIA 1PO6A 2W9AA 1QE1B 2B43A 1X4CA 2ZC4A 1WD6A 3BH6B 2DD8S 5CCMA 2C28A 2V2ZA 1H38A 1XWLA 2KM8C 2BJEA 4C4WA 4P73A 2ZH7A 2EG1A 2HQ3A 3GQCA 1LQ9A 2CAJA 2EXUA 2HHHJ 1S59A 4Y2IA 4KHPF 3DOMA 4CRJA 3NBPA 1HPZB 3DRPA 2XSFA 3OXFA 3GJSB 2QA1A 4TU8A 1Q4RA 1HNWJ 5ADZA 1LWFB 3TAQA 1P1LA 2W7OA 2CKWA 2Y0SD 4I7FA 4DG1A 4A8WA 1U0HA 4FZVA 4F0KA 5D6GA 2MZQA 2WVEA 1FJCA 4R8UA 5IM0B 1A6LA 1IKXB 3WBZA 2GO9A 1XMQF 2PE8A 1NBEB 5LJ3Y 1WHVA 4ENOA 3JYTA 3TZWA 4DV1J 4C8MA 4UTGA 4ECRA 2DNMA 3P6YC 5I3UA 4DR5F 5T14A 1E6YB 2ROPA 3W2WA 4H54A 5B09A 4P7VA 3E8OA 2V4QA 3FNNA 3V6DB 1PGZA 4U67Q 3ISND 2FPHX 2J8AA 1D9FA 3OSNA 4Q8FA 4UZCA 4CH7A 2XLIA 1L5UA 1AB8A 4FF3A 1QM9A 2W9CA 2XY5A 4PWDB 4R25A 1WI8A 4LF8F 1BWVA 1S10A 3MECA 1J5EF 3IS9A 4IRKA 3GJTB 4X4TA 3L09A 3D3CJ 3Q86A 1FRMA 2V8VA 4DPUA 4I4BA 2Y1LB 3C66A 1ZH5A 5KFDA 2RRNA 4CYUB 5IT4A 1RABB 5HLFA 1VQOS 1K0TA 3ZZ0A 5THWA 1BUXA 3PFEA 1N36F 3O44A 3WDOA 1UWAA 2C1EB 4N7TA 2V8HA 1J2VA 3KLEB 1JJ4A 3G9CA 4J37A 1HIYA 5T41A 1TR0A 1XR5A 2OMOA 2L9NA 3MEEB 3NL0A 3O5TB 4K2JA 3AD8C 4TY8B 4RW7A 5LL6d 4UUXA 2DIVA 1CPZA 2IIHA 1R0CB 1VQKS 1U25A 2JWNA 3A12A 2RMLA 4USMA 2OPRB 2XHCA 2KM8B 2XEXA 5C42A 2XSJA 2UXCF 1RT6A 2W8LA 4URGA 3J7AN 4Y2KA 1FFSB 1JNZB 2RUGA 2J6SA 2YNFA 3DNCA 1WKKA 5D78A 1VISA 2P2CB 2ABYA 4K8RA 3HFKA 4ZVUB 4KC5A 5KFYA 4ZVSB 1N8RT 1Q95G 1RBLA 1QDUB 1Q86T 3GILA 4OYPA 3LOUA 4JI8J 2M5YA 1Y5LB 3VAJA 5B0DA 1M0SA 1U47A 3ILIA 3RBEA 4TLRA 1Y10A 3MUVP 2RHQB 4Y6IA 4RNFA 2PDAA 1ZPVA 3G6XA 4HTIA 3GSDA 3IGVA 5GAHU 4UY8T 1LWCB 1IBLJ 3PIOQ 2VD3A 5L1JA 4DV0F 2NXUA 2E5JA 5GAHI 2CG4A 3HLUA 4NCGA 2HFUA 2LFVA 5D4NA 3N28A 1HLWA 2GV1A 1AYEA 3ICLA 4ZPVR 1JLEB 3VAKA 1M5PC 1XIQA 3QO9B 4WFNQ 2NXCA 3H25A 2YNHB 1SB6A 1OY8A 2WHOA 5KT4A 4J9NA 1S0VA 3OBIA 4ZKAA 2J9DA 2E7XA 1WC6A 3TX0A 2JEGA 1JIHA 1PJ5A 4WFYA 4Y65A 3Q2TC 2AF6A 2WW4A 3SQGA 3RB6A 2HVDA 3QZ8A 4YUDA 3FZ2A 2GIFA 2AJFE 3BKUA 2HGLA 1YJNS 2VHGA 1FF2A 4Q0BB 1UVLA 3NGKA 1YWXA 2FB0A 3HI9A 3S7RA 4LR8A 2E5LJ 4DR6J 1MN7A
chains in the Genus database with same CATH topology
4M63A 4OZLA 1YJ9S 4YMEA 5HQ8A 1U1KA 1BGXT 2K7JA 2VFSA 4KAIA 2BQ3A 3HVAA 1AW0A 3SZ2A 2DNGA 1U49A 3KK2B 4AXIA 4U7CA 4K4VA 1JXEA 2IM1A 4C7QA 2Z0GA 1ZTTA 1G3OA 1QY7A 2DNZA 4U6PA 3GIMA 3K5LA 5HROA 3T6JA 4GC7A 4N77A 1S1UA 2YWGA 4AQYF 5C25B 4RUCA 4CO2A 1TL5A 4KFBB 5C24A 2DNHA 2IVYA 3W2VB 3K5NA 3KLVA 2GHVC 1D9AA 1YRXA 3IC1A 2RE1A 1EP4B 4HDGA 2LECA 1T05B 3VAIA 2YKNA 5KG6A 3K8WA 2UXBF 3GE9A 3KNAA 3MPWA 1S6PB 5KFCA 1DTTA 2M3DA 3LWMA 2V8DA 2ZDPA 2W25A 2J6TA 2KXHA 4OHVA 4A48A 1O8BA 4NLSA 3CMES 1UWBB 1ZM9A 2DIUA 3ZFVA 3C6TB 1TUVA 4PG4A 3OVSA 3IR5B 4O3QA 4TU7A 2AJ4A 4ZP9A 3PW4A 2EKYA 4B3RF 3QIPA 4JI6F 2Y1JA 3BGFA 4W90B 2C3YA 3OHAA 3RBDA 5KFWA 5LMUF 3JSMB 4F8RA 2MDAA 5CXTA 2MMYA 1S9EB 3VR1A 3CUNA 4YEAA 2OSRA 2ZBCA 1LWEA 4QIEA 2AJ0A 5B0BA 5KG5A 2MQPA 3J7A1 2FY1A 2J6UA 3MMAB 2FLLA 4F4YA 3D1OA 4I68A 2HGNA 3TYTA 2BW2A 3VAGA 4JV1A 4NLYA 1QVGR 1HBNB 1R8AA 1B7FA 5AE3A 1X4BA 2M4MA 4LF7F 3CD7A 3MDFA 2HHSA 4QCLA 2F9DA 3K5PA 4LIRA 3QGIA 3F41A 1Z1ZA 2DNPA 2GNKA 1FD2A 1TL1B 3ENVA 4LFCF 2RRBA 2HS4A 1BQXA 4DDFA 2RB7A 2BRKA 2B7CB 2QZ8A 3D5MA 3DFEA 2H5EA 1PC4A 1X5TA 2BV3A 4YB6A 1HYSB 2KRBA 1S1TB 4NA1A 2B4OA 3OFFA 5F9NA 1LV5A 5B0GA 2G0CA 2JC1A 3I0SA 1IXKA 4ZPBA 2BDPA 3D28A 4OI1A 4IG0A 2H9ZA 3BR9A 4I2QB 2ZNYA 2YH1A 1RT3A 4OJ1A 4IH7A 2B3TB 1VQNS 3JSYA 3T5JA 2LXIA 1Z4UA 2EI5A 3SCIE 3UR3C 1TP7A 3ZZTA 2MZTA 2XMUA 2MXYA 1MWYA 3PR4A 1TZ0A 4ECUA 1TKXB 1S77D 1HPZA 3SFGA 5DDQC 2KTQA 3C46A 2UVWA 5F8JA 3OJUA 4CT9A 1NJZA 1D1UA 3DGPA 2P9CA 5FDLB 5D3GA 2MKJA 2OFHX 2NS1B 1J5OB 3K59A 1LWEB 4MKAA 5K8PA 1LOUA 3GR0A 2AP6A 2AGPA 4OZ5A 1SJRA 4CH0S 1KVJA 4IKAA 3PW7A 1R7IA 3HVTB 3MAHA 1LWFA 2MYFA 5LT5A 2XY7A 5E3PA 3DOLA 1X8DA 1NKBA 1K8AT 2DGWA 2A10A 5J1NA 3I5AA 3X3UA 3SDEA 2LU2A 2QRRA 1NK4A 2BVZA 1CC8A 1V3RA 4C0OC 4IDKB 3M05A 1NHUA 1S49A 1YITS 2YWFA 2VBWA 2RRAA 4X4UA 4FXVA 1JB0C 3CDBA 4NRUA 3I56S 2B4VA 4NZ0A 4ZP8A 2DHAA 2MQOA 2HVIA 4QIWD 5IM0A 2VB6A 4YB5A 5KFMA 3OUYB 1SV5B 1RTDA 2O66A 4NLUA 2AWZA 4PG7A 4WYLA 2PD1A 5F3ZA 1JLBA 2IM2A 2EFNA 4F4KA 2RU9A 4X65F 1RKIA 1HBUB 1WG1A 3N9UC 3PKYA 4BHQA 4ELVA 1DJ0A 2MGZA 3KLFA 4WE1B 1SQEA 1S79A 3DHWC 4DR2F 1MSWD 4TXSA 1P9QC 3KFWX 1R0AA 4QR1A 1Y0HA 1E6YA 2N3LA 4OZ1A 3QWPA 4ZCKA 5CZVA 1GXLA 4ED0A 2J76E 2AGQA 5B08A 1AFJA 2ASDA 2V0NA 4ECSA 5D3GB 1WG4A 4NLQA 1SC6A 1FO1A 1HWIA 3M2VB 4I0WA 3UPFA 1B0VA 4O4RA 3TVKA 5E41A 3TAPA 2LEAA 4A8KA 2DO4A 1P1TA 3UQSA 2E7WA 1KC8T 3I55S 2RDIA 1U1QA 4FF2A 3OXGA 1XMOF 2FC9A 4DV5F 1N34F 2LA6A 2QYCA 2D9PA 3DM2A 3H2UB 1YHQS 2K7KA 3AHPA 1U48A 3TAMA 2NPFA 3IFEA 4FF4A 5IQQA 1VFJA 2X1AA 1TK5A 2D1CA 2OJ3A 3SMZA 1VBZA 3OJSA 2OTJS 1APSA 2ZH3A 1UKUA 3B4MA 1EETB 3GV7B 3QJLA 4JUZA 1VRTB 4QIFA 4RUAA 1KQFB 1YRUA 2HQIA 4PWDA 5L8RC 1JLQB 1UP1A 3OXLA 1HMVA 4I64A 2R7SA 4DL7A 3PX6A 4O4GB 2X1FA 2ZKTA 1N33F 1RT1B 1X4FA 5F8HA 2ZOMA 3PZPA 4NLVA 3PM9A 1WELA 3FCHA 2UUWA 2MHNA 3FSIA 4TQSA 2HRYA 2PEHA 2V4JA 1SKWA 4NL5A 4YQWA 3MGJA 3KKFA 4IH6A 2WOMA 2KDOA 2VG6B 2NLWA 2NYIA 2DH8A 1FTCA 2ZE2A 2YNIB 2NPIA 1SJ3P 2G1DA 5A0YA 2PC6A 3V6JA 2R9LA 4YY3F 4RNOA 1RT5B 2K3KA 2AYEA 1MMDA 2HWTA 4R5PB 3ZC4A 1B0PA 4LUBA 4USJC 3DRRB 4HVZA 1OIAA 1VS3A 1JNRB 3US5A 1H2TZ 3DI6B 5CYQB 1XK8A 2RD5C 2BJDA 1U6ZA 5F41A 5AE2A 1DRZA 2JHEA 1MROB 1XC9A 3DM2B 3TNVA 2DHGA 3QPIA 4V19X 1X0PA 2CPXA 1S6QA 4BBYA 3KLEA 3KJVB 2Y1IA 4OJHA 3V4IB 3RYLA 2FJDB 3IWNC 2IVMA 1IKVA 1NK0A 1GXTA 3QGGA 4K4YA 1R8PA 3D1HA 1RAJA 1FRLA 4OI2A 4FBUA 4DEZA 5D4PA 4ZVHA 6FDRA 1FE4A 1GX5A 2PN6A 3DRSA 3DDKA 4EBEA 1FDBA 3NNAA 4C9DA 2DGUA 1N5QA 1KHVA 3K7RA 1KSPA 1YBAA 3KNGA 3TW0A 2RILA 1XMBA 4C3LA 1RWUA 3TA1A 4PQUA 1RKJA 2V9KA 3LH2S 3O3LA 1FA0A 4URQU 4RW9A 5CYMB 3CCES 2R7WA 2HRUA 2LA4A 3MEEA 2E66A 4ED1A 2HHWA 1TKTB 4RKUC 1FJGF 4BWMA 1QTMA 1IN0A 2VKZG 2VA2A 4TY8A 1NRKA 3KYLA 1KNZA 4Z37A 3GV5B 1PSDA 1XTZA 5E3CA 1UW4A 2LVWA 4ZS6A 4XO0A 2JLFA 1LW2A 3ISNC 1RT2B 2ZH8A 1TL3A 3SSQA 3D0HE 4FVCA 5BYRA 5JUMA 2GX8A 3MUMP 4KRWA 1FCAA 3M6WA 1QLNA 2J0QD 1CQMA 3FFIA 2O3DA 3P3DA 4OQJA 5L38A 1URNA 3S8SA 2B6AA 1DZ5A 3QYYA 4OL8A 2JH3A 4DFKA 3L95X 4NX9A 2CYYA 2ZHOA 3KHGA 2W24A 2IVFB 1BQMA 3U02A 4KV8A 4E0DA 2EW9A 1S6QB 3O1LA 1U45A 2UUCF 4JI7F 1N5VA 3RAQA 3BB5A 3JSBA 1JLCB 4IOAQ 3BDPA 4RNHA 4CO5A 3G96A 1S97A 3OL7A 2R4FA 5AXMA 1FKPA 1H2UX 1CQNA 3DRSB 2HHUA 1QAXA 4ZOSA 3P49B 2B5JA 2HPUA 5CD4H 3GIJA 3TUJC 4DSLA 4FVMA 4IFVB 1KQSR 2C42A 3QAUA 1T7PA 3ZZPA 3DCAA 4CIOA 3LWLA 3SV4A 4PQUB 2L41A 5E0OA 4CI0B 3DHXA 1REVA 4RW9B 4OX9F 2GMHA 3U1LA 3B78A 2PI4A 2I9SA 3K0JA 4ID8A 2R7VA 2E5HA 2OAUA 3HKZD 1GX6A 1M5SA 1RJJA 3SFUA 2HFNA 1CSJA 3KLIA 3MI7X 2SXLA 3KWMA 5FD1A 1Z2LA 2J9DE 1DBDA 2KB2A 1NH8A 1MWZA 3F56A 1HI1A 4C8LA 4O3RA 2EK6A 4OFZA 3NCPA 2J9CA 1LW2B 2XZWA 4JBCA 2RQKA 2IJFA 2WONB 1UJ5A 1TL3B 4WU3A 5MLCV 1LK7A 3QJJA 5J2PB 4AL5A 4EZ9A 5CHCB 4ES3A 4Y2CA 4E8UA 4MIBA 4O3OA 2CPFA 4QOTA 3J7YU 1S7HA 2R2UA 3UR0A 2W7PA 2BOPA 1KVIA 1ZAVA 3FEZA 3AA8A 3KLGB 5F9LA 4FBTA 4MAKA 4J9KA 4ZCMA 4KV8B 3DLLQ 4NLDA 1FESA 3MR3A 1XR7A 1N5YB 3H59A 1FD8A 1ZZNA 1NB7A 3DC2A 5DG9A 3ONQA 1FNMA 4KE5A 4ETXA 1FKPB 2OPPA 2HW3A 2JRSA 3C6UA 2B5JB 5J2NB 3QLHB 3R27A 2MQLA 2P9EA 3MZIA 2HMIA 4UUWA 5E3QA 1LFWA 2D3OR 2XNRA 2KXFA 3V81A 1UJ6A 2UXDF 2PI5A 2WSCC 2M8HA 1A7GE 2N7CA 3TP2A 1WEXA 1WACA 2F8EX 4P6QA 1KOOA 3TA2A 3G6ES 3K5MA 2ADBA 1XERA 2BRLA 2CJ9A 5HMWA 5M2UA 1KHWA 5AXNA 1K1SA 2AGOA 3E2EA 5DJBA 1CG2A 3N6LA 3U1MA 3LANA 4IR1A 1TAUA 2MKHA 3NAHA 5F8GA 4J9LA 5KT3A 2CPEA 4G1QA 5CYJA 2E1MC 2AYGA 4OHYA 4CO3A 2VPYB 3T3FA 1C2PA 3D1QA 4QZVB 4L6V3 4MTPA 3M2RA 3LP0B 1VHFA 1CEZA 4HI1A 4OIXA 1HQUA 2AV5A 1RGVA 4X66F 1VC5A 4DS5A 4A46A 1JLAB 3J80Y 1UVMA 3H20A 1SJ1A 1FNOA 1HBMB 5F0WA 2KI2A 2V2KA 2FD2A 2CPDA 3PW2A 1Y5NB 3N01A 2N82B 4XDCA 3UD4P 1ZETA 1ZM3A 1JLEA 3UCZP 5KFAA 3NNCA 2YX4A 1VQYA 4ECVA 5KG4A 1ZM2A 2M0GB 1VC6A 4NZ7A 2DPJA 3M8PA 2D74B 2XWYA 2B9YA 4WKYA 3CD5A 5HL7Q 3I32A 1KQKA 2RT3A 3FMBA 3QO9A 4KB7A 2ZNZA 4X4RA 4RW4A 2VPXB 4C97A 1FRXA 2GGPB 3PY8A 1ZPWX 3OTCA 3I5CA 4OLOA 4RW6B 1KS2A 4HTJA 1UA0A 3FQKA 4J9RA 3V81B 2XS2A 5A6PA 3RTVA 3DLEA 4G1IA 1WHYA 1SUQA 3M6XA 1RT7B 5E2QA 4X4SA 4QBUA 2ZHBA 4IO1A 5IXUA 1U26A 1YI2S 2RS8A 1SBRA 1FKOA 1B0TA 3LP1B 3B8HA 3M30A 3R5AA 4P2SA 3HT3A 2CPZA 1UA1A 4B3OB 4B9NA 2B4UA 2BQUA 2MHEA 1GTEA 1SKRA 2PIIA 3CXCR 2DK2A 1C1BB 1F9FA 1HQEB 4H4MB 4X4NA 1BC6A 2HWHA 4AXJA 1MNEA 5G4DA 4C8NA 2DR8A 1HI0P 2RQCA 3VQTA 2FVCA 3SSSA 4EBDA 2FVQA 3JB9k 4XPCA 2R8IA 1YG0A 1SH2A 2K2PA 4D3GA 1FXDA 2QO3A 2B9WA 2GJ2A 3CIZA 3LGNA 2HLUA 3D0IE 3OR2B 4A47A 4A4JA 2E9ZA 4Y28C 3CJ3A 1OSDA 5B0FA 4DSFA 1N54B 2LU1A 4J9MA 2C22A 1KLMA 1U1MA 3VAHA 3NCRA 4RNNA 4KJIA 2QMXA 3FQLA 4K4WA 2FLNA 2DRAA 1HWJA 5HMXA 1T3OA 2R7UA 2A3JA 5DETA 1IKYB 3PFOA 4FXWA 4JI8F 2G4BA 2HNDB 2F7VA 1U6FA 1F5CA 4ZP6A 4NYZA 2IMWP 5D77A 4DQPA 3T19A 1LKZA 4Q0BA 4RW4B 1FTRA 1OPIA 1S1VA 4FP9A 5EGYA 4I67A 3SCKE 4GKKF 3N0VA 5KT6A 4DV2F 2W9BA 4FXDA 4ILLA 5A8KA 1JLFA 4LF4F 2O1PA 3QAEA 1XR6A 1T8EA 1NO8A 3KG4A 3OPKA 4RX6A 4C0HA 2XMWA 3CDAA 3BQ1A 3HJFA 2AYBA 4AE5A 5EHHA 1WWHA 2JL9A 2W4DA 4PG5A 5AXLA 3RRHA 3DLGB 3ENQA 1JLGB 1GNKA 4DL2A 1FKOB 4QWAA 2BUNA 1UL3A 2I5JB 1TK0A 4KGMA 5F3TA 4WIIA 4RBUA 4WKRA 1YJWS 1SH0A 3OL8A 1WHXA 4ICLB 4N41A 4ALZA 2POKA 2K3IA 5HP1B 2Z2LA 2ZC3A 2KHCA 3CEDA 3LAMA 2QA4S 2HGMA 4DN9A 4ID5A 4ZCIA 2UZAA 3KK2A 3CCLS 1IBMF 3DLJA 3N5FA 5LJ5Y 1L3VA 1UVIA 3CB4A 3IAS9 5CCLA 2KG0A 4RWXA 2C2RA 2VG7B 4O0IA 3MEGB 4YFUA 2DHXA 5C25A 5KFHA 4KFBA 3BJYA 2AX0A 1VQ6S 3W2VA 2DR5A 1B64A 4GKJF 1VBXA 1HFEL 3QIDA 3CCJS 5ITHA 4OLPA 1EP4A 1X5PA 1T05A 2L3MA 1YGYA 3TVYA 2E44A 5HN0A 1P6TA 2CQ1A 2C3MA 2WBMA 3M4XA 1UWBA 4DR3F 3A8EA 2ZZMA 3ULHA 4QYZJ 2XCAA 2E5IA 2DR9A 1M1KT 5H1SV 2DJWA 2ALZA 3BGLA 1S1VB 1X9MA 3CD0A 1HW8A 5K8OA 4F3MA 3BSAA 1S0NA 4JV2A 4IOCQ 2UVUA 1WEYA 2QEXS 1M5KC 4XAKA 2UVVA 3EGZA 1S9EA 2QA4G 4ERDA 2PMZD 2YKOA 2A1BA 4UQTA 2VFVA 5GAEU 3GV8B 1L3UA 4N8NA 4DQIA 3MMAA 5EUHA 5I3QA 1L3KA 3CCVS 1OSCA 1FEEA 1UMJA 3BR8A 1U09A 3M2UA 3IG1B 4ED5A 2KHDA 2UVRA 2HG4A 3MOJB 1HBNA 1X4GA 1Y4ZB 4KTQA 3GFHA 3BSCA 3IR6B