2GNKA

Glnk, a signal protein from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
95
Chain Sequence
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NITROGEN REGULATORY PROTEIN)
publication title GlnK, a PII-homologue: structure reveals ATP binding site and indicates how the T-loops may be involved in molecular recognition.
pubmed doi rcsb
molecule tags Signaling protein
total genus 21
structure length 95
sequence length 112
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gnkA00
1NH8A 5D4OA 2EG1A 1UKUA 3N5BA 3TA0A 2PIIA 2J9DE 4USJC 3AH6A 4C3KA 2O67A 2GW8A 2ZFHA 1XK8A 3NCQA 3M05A 4YB5A 1O51A 4CO2A 3AA9A 4Y65A 2V5HG 3AHPA 1GNKA 4E98A 2Z0GA 2XZWA 2NUHA 4CNYA 1NAQA 5D4NA 4D3HA 2J9CA 4CO4A 4C3LA 3DFEA 1UFLA 3NCPA 2VD3A 4YB6A 5D4LA 2XULA 4D3GA 3O8WA 2NUUG 1UMJA 2NS1B 2J9EA 1QY7A 2E66A 4Y6IA 5D4PA 1NZAA 4WK3A 4NYOA 1PILA 2ZOMA 4RWWA 4OZNA 3MHYA 3LF0A 4OZLA 5L9NA 2JJ4D 2J9DA 1V6HA 4CO5A 4RWXA 1VHFA 3HLUA 5DRKA 5DS7A 2DCLA 2XBPA 1UL3A 3OPKA 4CO1A 4OZJA 3CE8A 2RD5C 1V9OA 2EG2A 4NYPA 4USHA 1P1LA 2O66A 1HWUA 4C3MA 2GNKA 4USIA 1J2VA 4IYQA 3TA1A 1O5JA 3X3UA 2CZ4A 1OSCA 4ZK7M 3GSDA 3T9ZA 4RLEA 3BZQA 4WK1A 1Q1KA 4YB7A 2GX8A 2XG8A 3AA8A 4RX6A 4CO0A 1V3SA 4R25A 3TA2A 4CNZA 1VFJA 4CO3A 3NCRA 1H3DA 3L7PA 1KR4A 3O5TB 1V3RA 4AFFA 1NH7A
chains in the Genus database with same CATH superfamily
2DNRA 3CWJA 2UU9J 1KHWA 3UNYA 1YJWS 4F4WA 2OJ3A 4HTJA 4X84A 3G82B 5ETPA 3R5GA 4JUZA 1HQUA 3GR1A 5C24A 3HVRA 4CYUA 5D4NA 4AL5A 3TO8A 1XN9A 2I8EA 4ED0A 1X4HA 4WE1A 2YQ0A 4QWBA 4CLWA 1QSLA 4WBFA 3M2UB 2E7VA 2CNNB 1W2IA 4EBEA 4ZPBA 2MY7A 3FNNA 4B3RJ 4DS4A 1SC3B 4WZMA 3CCMS 5SZTA 1YWXA 1IKXB 2HRUA 1XQIA 5DDQC 3PCOB 2RF2B 4NRUA 4ANDA 5H9EK 1S6OA 1LW0B 5DQHA 5FLXY 1YJRA 1N34F 1JIHA 4LVOP 4EEYA 2G4BA 2OPQB 2ZD1B 1VHIA 3MOZA 3CO0P 3QAEA 2HHUA 2NXNA 1U8SA 1MWZA 1XIQA 3KHLA 2LU1A 4NLQA 2DISA 4XTTA 2VV5A 1TUVA 2Q3PA 4F3MA 4AQYF 4NCBA 3N4WA 4KBIA 1RBAA 4ENOA 1L3VA 3IN5A 3FFIB 5B7WA 1D3WA 5LMUF 5IS2A 2CG8A 4U95A 3GFYA 5E2QA 4ED2A 1RT5A 1TL3A 2IJNA 2PA8D 1XBWA 1WKLA 4QWDA 5KFUA 1IBKF 1J5OA 4G6VB 5HQ8A 2KJVA 4DFJA 2CG4A 1VQ8S 2OMOA 4PUOB 3SEOA 1I6JA 1WEYA 2RB7A 3TANA 2XNRA 3BR9A 2GJ2A 4WYWA 3SV3A 4YDXA 4LF6J 2QLBB 3NGRA 1S72S 2V68A 4PCQA 2ZJRQ 3CE8A 3EM1A 4TY8B 2AYGA 2MZJA 5F3ZA 2E7XA 4LF9J 1VS3A 2FJEB 2QLJB 3OXFA 4JI4F 4Q8FA 1PYSB 5A8RB 1F9EB 1RAFB 1FDBA 4LMZA 1WG5A 1M5SA 2MJNA 2QGFB 3QZ8A 2VQEJ 3UDLA 2D41A 3CIZA 1IKYB 5LSRA 1NK7A 1HQ2A 1P27B 2DNLA 3FJ2A 2DH7A 1FCAA 1XWLA 3GQCA 3PW0A 1OQ6A 2XNQA 3JSMA 1U2FA 3KLEB 3NWRA 1X5SA 3ZTQA 1JLBA 1I94J 2UXDF 1E6YB 4DX8H 2A6OA 2GMHA 4ITSA 2JEIA 5C2CA 3POTA 1TL4A 2O3DA 5KG4A 2NCKL 2F8EX 5IQQA 3VAJA 1JLQB 3ILOA 1HFEL 2F7VA 1BLUA 3GV5B 2L08A 4RNOA 3RRHA 1Q16B 3F56A 2GVZB 3FQKA 4LF5J 3VTIA 4F4XA 5ETNA 1SKUB 4DV3J 5BXIA 4OHVA 3WIVA 3D0HE 1RI7A 4CP5A 2RRNA 3QT6A 1KVJA 3HHEA 3LWLA 4OHZA 3UDVA 2ZEJA 2XI2A 1JLGB 1JLAA 5AXNA 2FPHX 1U47A 1K9MT 1TKZA 1HQEA 1C1BA 1K1SA 2MQLA 2XLIA 5LMNJ 2DNYA 2PMWA 3BS9A 3QIPB 1T9TA 4P10A 1FK9A 3WC0A 1YK9A 5KT2A 3R5DA 2AX0A 4M5JA 1U2CA 5HLFB 3KK3A 2C3MA 5KFYA 3W2WA 1L3SA 2DBBA 4OZLA 2YVSA 2YNGB 1K8AT 1YG0A 2P9CA 5AXMA 2OD4A 1GK8A 2IYGA 3DLGA 1S4FA 2WONA 1NK9A 5IC4B 1QM9A 2GJIA 1HWJA 3BPSP 4WTOB 4DZDA 1KDNA 2WVEA 3GIJA 1NK4A 5DQIA 3DGPA 2D3UA 3TZYA 1YLXA 3OJUA 3V81A 2XTJP 4KGMA 2ASLA 4NLGA 1JLEB 1X4DA 4F4KA 3UD4P 2QSWA 4O3QA 1HNZJ 1S57A 3EMTA 2W8KA 3GMGA 3QRRA 1JX4A 2HIQA 4HYKA 1H7XA 3HHDA 2Z0GA 3E51A 5HROB 5DJBA 1VISA 3HM9A 4D3HA 4A8KA 4NLVA 3UNGC 5J2QB 2HBZB 2F8HA 5E3AA 4Q2MA 2R7XA 5KFQA 3GONA 3KXDA 3CCUS 2DITA 3Q86A 4KQZA 3K57A 1YJNS 5DGAA 4RW9B 4ZPVR 2JEGA 2LQ5A 1KD1T 2DO4A 2W9BA 3H4DA 3LP0A 3GIIA 1FKOA 5D78A 5HBMB 3R6GB 4KPYA 2AJ4A 1VC5A 3JSYA 3B82A 3D28A 3Q8UA 2AEMA 1IBLF 2XY7A 1Q53A 1RT4A 2U1AA 1J2VA 3HJFA 3VAIA 4ED8A 3VCDA 4HHJA 4WP3A 1SUQA 3TP2A 1NHKL 1K1QA 4X4UA 4OZ5A 2X51A 5IFMA 4MAKA 4DQSA 5LM7E 1X9SA 1REGX 3MM9A 3BO4A 4NLOA 1TL5A 5T7LB 4AL6A 3W1YC 4NZ0A 2FYXA 1YJ7A 3CNQP 3W60A 2C3OA 2EVZA 3P4UB 4QWEA 2EWHA 5CHCB 1F60B 2R2TA 4S0MA 2J9EA 3CCQS 2D69A 1BC6A 1FJCA 2VJUA 2I1RA 2HIYA 2JEFA 4M5DB 1CC8A 4DR3F 3LPEA 2LQJA 3HHLD 2HWTA 2BANB 3UWTA 2VG6B 4FXWA 5IQ6A 3KLHB 4YEAA 3SFGA 4JOUA 1HWUA 5JMNA 1KFDA 1XR5A 4TXSA 4CQ1A 1BD6A 2LEPA 2AT1B 2HWIA 2VBYA 2CPEA 3MMAB 1PCAA 2DKOB 3UN5A 3Q83A 1YBTA 1VQSA 3UO0A 1VBXA 3MEEB 5DZ7A 4RW4B 1KBRA 1PJ5A 4KIAA 2VFSA 3IBCB 3ZXWA 2L9NA 5KFJA 3MR2A 1LNQA 2HNDB 3A3PB 4FVCA 2VZ9A 1CLFA 3UN2A 3DRSA 2E9TA 1NSPA 3MM6A 2DGQA 1CJKB 3M32A 3GG0A 3EPIA 2C2DA 5DG8A 1MWYA 5IM0A 3HT3A 2KG0A 4J9NA 2J7KA 5IT4A 3GP9A 4YDDB 1R6VA 4WJBA 1X0PA 2WVDA 3ETMA 4DLEA 1PC5A 3J7ZT 1JLFB 1TTHB 5G0RB 3PACA 1UJ6A 3R6LB 3KUGA 2NLWA 1N36F 2CKWA 4MIAA 1U1LA 2X1BA 2KG1A 3CMES 2D74B 1SC6A 3DLEB 2HVDA 2QSFA 2OFGX 5CD4H 3D0GE 1DQ8A 2IPOB 2XMKA 1UVLA 1ZPVA 3PX4A 4NA1A 1NHVA 1RYSA 1ZYQA 1YJVA 3FEYB 1RZMA 5CXTA 2OEJA 2UUBF 2HHQA 3D68A 1GMUA 1WDDA 1OIAA 3IAM9 1YTYA 4QR0A 3ITHA 3PR5B 2VB6A 3GJTB 3VF0B 3ZTOA 3O2IA 2UV8A 4IFYB 4G1IA 5ADZA 4QCLA 3T6JA 5FDLB 4KHPJ 5D0EA 3BB5A 3CJSA 2AWZA 5KFZA 5JJBA 2ZBRA 4CLKA 2MQOA 4CTAA 4J9UE 4P52A 1RT2A 2KFNA 4CLYA 4FYYB 2UXBJ 4P2XA 1P8GA 3BBCA 3MM8A 3E8OA 1FF2A 2VPYB 4QIFA 4Z2XA 3GCWP 4OHXA 4YOEA 2HHWA 4GRSA 2XHWA 2FVRA 2DNQA 3O6QA 4Z7YA 2IMOA 2EEYA 4FPIA 3MEDB 3TX0A 2CQPA 4LIRA 2ASJA 2WW4A 2CZVC 1FT8A 1DFDA 3KNAA 2J9DE 2W01A 2W2PP 3OSPA 1WEZA 5EDWA 5JUMA 4Q0BA 3BF4A 4F4ZA 4DV1F 2ZH7A 3HVTA 2MGZB 2HMIB 2N7CA 3AXMA 2WOMA 3BQ1A 3KYLA 2EC0A 3Q8VA 3C6TB 5CA5A 2ZH8A 2RUSA 3VQTA 2F4FA 4Y6IA 3QIDA 2IY5B 2MQPA 2AP6A 1FX2A 1N33F 4DPWA 1A6LA 1ZA1B 4B9VA 1U25A 3C15B 3IWXA 4OYOA 2DCLA 3T5KA 4JI0J 3MEGB 1CC7A 3U27A 3SV4A 3HHLA 5HATA 3MR7A 5F41A 3A12A 3TA1A 4O4GB 2YTCA 3HD2A 3OFEA 5H9FK 1DLOB 3K59A 3GYNA 3SI8A 5IT9U 4RX6A 1R31A 4LBIA 5F8HA 2WCXA 1SH3A 3PIOQ 4NI2B 4MKAA 4DR6J 3OBIA 1CVJA 4DQRA 5MAOA 4DSEA 4RUAA 3GCXP 4DUYJ 1APSA 2LFVA 3NCQA 4WFAQ 1IR2A 5F8LA 4PPZA 1IQZA 3KG4A 2K1RB 3TRGA 1VBKA 1NZ8A 2E1CA 5J2NB 4FF4A 3DRPB 3ENQA 2DH9A 4ES1A 3MAAA 5B0FA 1QJHA 4IUFA 3JQJA 3HX9A 5KG3A 4DR1J 5F0UA 4JI5F 5I3PA 5CYQA 2JX2A 1B3TA 2H9ZA 1VQNS 3FMBA 5A8WB 4QIWD 1AW0A 2A18A 3QSIA 2FJVA 3BM7A 3JB9k 4X4OA 4U9RA 4JBCA 4FNHA 1TQLA 1Q8IA 3NGSA 5L1JA 4X64J 3HHLC 1N5TA 2KKHA 4F0KA 4KGKA 1Q95G 4LFBJ 4MTPA 2B8QA 3K8WA 3C8YA 2HS0A 4ICLB 5KFFA 1N48A 1LOUA 2CPFA 4PXCA 3PVXA 3SDEA 5LXYA 3M05A 2CQBA 4KGXB 4Q2LA 2NSBA 1NO8A 3MOJB 2Y0BB 3HZEA 1RWMB 4U8YA 4NL5A 3W3SA 1HPZA 6AT1B 2ZE2B 4GO5X 1IKWA 2R8IA 3D4JA 4DUZF 2B7CB 2HRYA 3FGVA 1BUXA 4Y3CA 3HPOA 4MKBA 2G2YA 2FD2A 3OV7A 1MSWD 8ATCB 1VQYA 3DHXA 1KP6A 2CQCA 2MDAA 5THWA 2B7BB 1SBRA 3EWGA 5KFCA 1X4FA 5HVFA 3FBCA 3FBEA 4RW7A 4A47A 4OI1A 5F8JA 1EP4A 1URRA 4YP3A 4BWMA 2FDNA 2B9EA 3FEXB 3HSZA 3HJVA 1HLWA 4OYZA 1S48A 3CJ3A 1KVKA 1M1GA 3TAMA 3TAQA 4CM2A 3DLKB 2JH3A 1MN9A 1ZM3A 2HHSA 8RUCA 4URSA 2ZBQA 3QO9A 2B0GA 2FJWA 1HR0F 2XZWA 4RL1A 1TVRB 1F0XA 3OXGA 2XY5A 4NCGB 5K14B 2EFVA 3P49B 1IQTA 2IBOA 3CF5Q 1JJ2R 2FHOB 3I6PA 2D9PA 3PTWA 1KFSA 3VZIA 3QFHA 3J7Z5 3WDOA 3AD7C 3MUVP 2RMLA 2DHAA 1BE4A 3Q23A 3HK2A 1H2UX 1REVB 1S97A 2R9LA 1NDPA 2Q79A 4KB7A 4FBTA 1JLCB 4FS1A 5E41A 1T3NA 3OTDA 4LBHA 2YNFB 5KFDA 2RU3A 3KK2A 3DXBA 2O01C 4HVZA 2KRRA 4WP8A 3SYZA 2FLOA 1JKHB 2BJ3A 5EWFA 1S12A 4NPOA 2MZSA 3H2LA 1U26A 3KJQB 3Q8RB 2I38A 1RUSA 3KMQA 3TR5A 3CDAA 3MUTP 1H38A 3MD1A 2CJKA 3BYRA 4I69A 4DQIA 1QTNB 3IC1A 2UU9F 4TYAA 1NDCA 4GKKJ 2LA4A 4HACA 2FVQA 2VH7A 4OIXA 3QWPA 1X0FA 4IO1A 1HD1A 4X62F 4KKOA 4RWWA 3G8TA 3M2RB 4ZP8A 3J7YI 1V5VA 3MMCB 1MN7A 4ZPDA 2EBEA 2UUAF 1Q7LB 1UVJA 4BWJA 2DRDA 3DRRB 1XMBA 2E5LJ 2KFZA 3UW1A 3DDNA 2QMUB 1NJZA 3LH2S 4E8UA 2E5GA 3MPUB 3S7RA 5I3UB 2A6MA 2R7VA 4PKDB 3G82A 1DBDA 2PN6A 3MECB 1XMOJ 3AOCA 2C3PA 3M8PB 3PIPQ 3CC2S 2GAHC 1PAUB 4ZMMA 3ZZ0A 4MMOA 3C2PA 4KY3A 3CJTA 4DG1A 5C42A 2VFVA 3H42A 1S1VB 3A3OB 3MPDA 1WOSA 3UN3A 1JNRB 2YH1A 3RB6A 2G1DA 2MKHA 2M2BA 3OL7A 3EZ5A 2NR0A 1UWBB 4UOCA 3HFZB 4PWDB 5D77A 1VBYA 1YZ6A 3LP2B 4IKAA 2BACA 2CJ9A 4CCHA 3BSAA 1LW0A 3WX4A 5CAAA 4X4QA 2ZZNA 2BEFA 2HAFA 1D1UA 1T9WA 4K5RA 4J9LA 3G8QA 2Q66A 2CIMA 3PEJA 4IDKB 3H25A 3OD2A 3H5YA 1J5EJ 1S7IA 2YKNB 3W2VA 4M1KA 5K8NA 2IAJB 3TNVA 4H4MB 1T03A 3LAMA 1FX4A 3FFIA 2QFJA 1T9UA 2KRBA 4EU0A 2D1CA 1CULB 2G0CA 5KAKA 1DHMA 2P6TA 1UKUA 1IBCB 4CLFA 2NYIA 4B3MJ 4ZIWA 4ECVA 4LRDA 1GXUA 3RB0A 4CIOA 5CQGA 4YFUA 1T9VA 4Y65A 2XLKA 1X5TA 1R8BA 1M5VC 2RQCA 5KT3A 1BMQB 4M5IA 4X4NA 1WC3A 1RTJB 1HNVB 3CUNA 2FGCA 2KO1A 4IG0B 4DPUA 3VZHA 1F5CA 1VQ5S 2DGUA 2DHXA 4CWBA 3AOBA 1F9HA 2FY1A 4NCAA 1RBLA 2JJ4D 1U1KA 1Q81T 1KQFB 2F63A 5DRKA 5A8RA 4IFVA 4EBCA 1ITPA 1X4GA 5BR8F 4GC6A 3QGHA 4ANCA 4NEZA 4PYAA 1X5PA 1QUVA 4DMZA 2XS2A 2G1HA 4FBUA 3LTOA 1NM2A 2BJ8A 4PABA 3H59A 1Q1KA 4DFMA 2IHR1 4NMXA 2CYYA 3BDPA 4DV5J 2HSEB 4CNZA 1XNQF 1WTFA 4W98A 2PA3A 5HMXA 4EO8A 2DNKA 3JQMA 1WF1A 2B4OA 2ZFHA 2GC8A 3TUZC 2POKA 4ZJQA 4ZP7A 3RBZA 3RB3A 1GXTA 4L6V3 4O23A 3R1LA 2N4CA 3UVJA 3N28A 2OPPB 4KRWA 2HEKA 2ZDOA 4NRTA 1WI6A 1UTAA 4OQJA 4QPTA 3HKZD 1LWCA 5L1KA 5I4MA 1YITS 3FZ2A 5J2PA 2GVDB 8AT1B 2P6SA 4M5GA 3I32A 4USWA 4M5NA 2GVZA 4LBPA 5B09A 3IS9A 3OR1B 3R2DJ 2R2UA 2DPJA 4F8RA 2HHTA 2WB1D 1DURA 2CVEA 3V6DB 4QBUA 3KTQA 3BJYA 1TKXB 5LSOA 4BBYA 1HBMB 2DK2A 2UZAA 1MNEA 4OLPA 2PGCA 1N5VA 2C28A 4DLGA 4RNNA 1IKVA 3Q89A 2XM3A 2UUWA 4GVLA 1VLYA 2WK4A 3MCNA 2H4YB 5GMEA 4C2MA 3OFFA 4OZ1A 3TAPA 4ZLNA 4Y2MA 4LR7A 4DPXA 1IBMJ 1N32F 5FLXU 2MSTA 1VQOS 4K5SA 2LEAA 3QIPA 2JVOA 2GHVC 3AHPA 4E98A 4ZLJA 2VASA 4MYTA 5D3GB 4KPCA 3TVZA 4PPDA 2VD3A 1GQEA 1FDNA 3CJ4A 5HQMA 3F44A 2ASYA 1ZBTA 3NKYA 2AIRB 2OTLS 1FRLA 2V69A 4OV6A 1HI8A 3GG1A 1TL7B 3MMBA 2AW0A 2PD1A 4DDFA 4C0BA 3HP6A 1SJ1A 3HZGA 2AKWB 5H9EJ 1JLEA 2CJXB 5DG9A 3CD7A 3MGJA 3PYDA 4MH8A 4WFYA 1V3SA 1FDDA 4CO3A 2BDPA 4GO7X 3AD9C 2R8JA 4HI2A 5KG2A 1S6QA 3TOQA 1LFWA 3PKYA 5CYMB 3L3CA 4QR2A 1RSCA 2GQ2A 3IR5B 4OYMA 3CCZA 3EXCX 4OJHA 3GV8B 5GMKa 2W7OA 3UCUP 4TNOA 1SL1A 3A4TA 1MU2B 3W63A 1WUUA 5DQGA 3W9HA 1RCXB 5HO4A 1VYAA 2N7YA 5CYJA 4ED1A 2J7WA 1RWKB 2VPZB 4EUVA 4OZJA 3QLHB 4MIWA 2LCWA 4JI8F 1U1OA 1EKSA 1FRIA 2P5VA 2AYBA 1U0HB 2KFYA 1FHTA 2XS7A 2HQIA 2D3ZA 2XO6A 3NS6A 1VRUA 5T7LA 2NZ4A 3NOCA 4QJVA 1S6UA 3ULHA 1V3ZA 2ZVSA 4ETXA 2HHVA 1S1UB 2J8SA 1KONA 2YKQA 1RU2A 1L3TA 4QIGA 2CQGA 4LF1A 2L3MA 5ETRA 2D3OR 2B5JA 2FZCB 1U2RA 3UD5A 2UVWA 5EUHA 4M5DA 2R7RA 2W7AA 2BZ2A 2CNOB 4ELTA 4I2QA 5HJYA 3J7AN 2X7IA 4WK3A 2DNOA 1N56A 1VIXA 2N3LA 4K2JA 3N9UC 3KLHA 4OZ3A 1RGVA 3H40A 2F9DA 1U1RA 3HF5A 2RD5C 4K4SA 1TV6B 3QNWB 1VR6A 2F8MA 1R0AA 3CMAS 3GJQB 3FDSA 3DMJB 4OX8A 1HBUB 1EETB 2CQDA 4BDPA 2LQ9A 3DXSX 2AQ4A 2RQ4A 3NNCA 4RUHA 2KM8B 1ZPWX 3SIPB 1W7WA 2WSEC 1RYRA 2PI5A 2RS8A 1Y7PA 2R2RA 1F3VA 1Y00A 1FJGF 1HHTP 3F41A 1UA1A 1WD6A 3JAMY 5A76A 3I9V9 5L9XA 4N8OA 4FNIA 3I5BA 1VLOA 5SUHA 2VPXB 5ETVA 2ZWPA 4DF4A 2HURA 3I9ZA 4N76A 2LQ8A 3D54A 2XULA 3CW2C 4MKYA 4DSIA 3PZPA 2D7SA 1JLFA 4WIIA 2E9ZA 4HH1A 4B3TJ 3MD3A 2AF6A 2IM2A 3G2XA 4NMLA 2AJ2A 5ETOA 2FJAB 2ROPA 4NX9A 4Y2KA 3KLGB 2UVVA 3A8EA 2DH8A 3OPKA 4WFNQ 3G71S 1YI2S 5FIIA 3DLEA 3S1TA 4LF7J 2EFNA 1ULRA 5LL6d 4DOZA 3KK1B 4M5MA 2ZM6F 3OLBA 3NBPA 1QAIA 3GPAA 3A3NB 2BX6A 2F40A 2QA4S 1DRZA 4W4MA 2AGPA 1U48A 1S1XB 2R4FA 1RAIB 5C25B 2PSZA 2VPWB 1DY3A 3RYLA 3BGOP 1CJUB 3J80Y 1RDRA 2XY6A 3C16B 1ZAXA 4NLRA 3IBWA 5B0GA 2PDAA 4CNYA 1FEEA 1Z2LA 5FDLA 4K4ZA 1G2EA 4HLBA 3LO3A 4LUBA 1CQMA 3I55S 4F25A 3Q8PB 2ZH6A 5F8NA 3MM5A 2RILA 2CQ0A 2VDIA 1TK0A 2NQPA 1V6HA 2CQ4A 2KYZA 3GWCA 4CO1A 1VC0A 1OY9A 4A8MP 4B9SA 2UP1A 5ETKA 1SJRA 2CFXA 3V4IA 2CQHA 4AE5A 1ZS6A 3PW4A 5DO2A 3M2VA 2KYXA 3DOLB 1RHQB 2OIHA 3V6HA 5A0YB 3WX8A 4OYPA 4N5SA 1FKAF 1OS5A 5DLFA 1DTTB 3M6VA 1C0UA 2LQBA 2HMIA 3FCHA 4J9SA 4DXLA 3ZO7A 2OSRA 3C6TA 1NJXA 2AD9A 4MYUA 2OELA 3UDCA 4LFCF 4OL8A 4QYRA 3PRDA 4CH0S 1FD2A 1YVFA 4RBUA 3PYFA 2F9JA 2RU9A 3HFKA 1Y3JA 4C11B 3GU0A 4X4VA 2QMWA 4ZVQB 2CJAA 1RK8A 2MZ1A 2C2NA 2ALZA 2ZHAA 1U6FA 1BGXT 4IOCQ 4IG3B 4B9TA 1RLDA 3ELHA 1VJWA 2EG2A 5GAEU 2RKIB 1RP5A 2OO4A 4YY3J 1X4CA 5HI7A 4NI2A 5EWEA 3VGTA 1ELOA 4V19X 2E1PA 3OUYB 1VFJA 4AT1B 1SB6A 5GAHI 5KTQA 3PJ9A 4DS5A 3PFEA 3KFWX 2UUCJ 3AOAA 1I5OB 1S1WB 4FKXA 5J2NA 2PO4A 2FZGB 2V0NA 1T9YA 1RT6B 2YWEA 4A8QA 2QA4G 4RU2A 1LQ9A 1OWXA 1Y3KA 4AXJA 2J8AA 4LR9A 4FPRA 4HT7A 1O6XA 3RG6A 2XSJB 1RB0A 3M8QA 2CPHA 2W2OP 2YH0A 2YKAA 4F02A 2P9GA 1RWUA 3O44A 3FKBA 4RO0A 2BE2A 4YHHJ 3RBDA 2EK6A 2BVZA 2BOPA 3MMJA 2UXCF 4OYBA 4AD6A 5B08A 2ROEA 3EDRB 4H4OA 4DEZA 2YNHB 3RZAA 4F3OA 1H7WA 3BSOA 1N5QA 4FDFA 1HNIB 1RT3B 1LFPA 1BQNB 3OT9A 4OI6A 4ZP6A 4ZVHA 3H5XA 4QU6A 2ZH1A 5B0AA 3UPFA 4P2FA 4BHQA 1DTQB 2X3GA 3I0RB 4C48A 1U49A 2LXUA 2OEKA 3DM2A 2BMBA 1PO6A 3ZZTA 2V5HG 1TL1A 3AFGA 3GSIA 4N41A 4O3SA 1FRJA 2ZE2A 3US5A 1F3FA 4NXMF 3GYXB 5KT7A 4FF3A 3QRQA 3CO9A 2VKRA 3Q8QB 2DXDA 1VJQA 3DLJA 2V8VA 2H5EA 4CLTA 2OPRB 1TMMA 3K58A 3PM9A 4X4TA 4OI2A 4G1PA 2GGPB 3KWMA 5E0OA 4ILMA 4I1TA 2L9WA 3N6NA 3HT0A 3P8BB 4A8YA 3EXYA 2E5JA 1KLNA 1UEUA 4NLPA 3BSNA 2FY8A 1U1NA 4B9LA 2O1PA 2ACYA 2XCAA 2AMCB 2Z2YB 1XNRJ 4ER8A 3HI9A 2J0SD 4IH6A 1KQKA 1NH8A 4C8LA 3CJ0A 2FB0A 1TVRA 4DV0F 4ECWA 1HKAA 2VQFJ 1TKTA 4NCGA 5KFHA 2AU0A 5K14A 2ZJPQ 4YB5A 3MI7X 1RTZA 1S0OA 4P2SA 1YX2A 4TY9A 2ASDA 1UCNA 5KT5A 3CDUA 5K8MA 2MHNA 2V6AA 4OI4A 3H7HB 4RBTA 4LRBA 3J7A1 4DR2F 1BQMA 5KG5A 3CCJS 4Q5VA 1VQ9S 4DPTA 4DL5A 4IH5A 3FSYA 3ZZZA 3JYTB 2E44A 4JI6J 4A8SA 1JLCA 2DXFA 3ILLA 1SJQA 3ADAC 4X66F 3SQGA 1CJVB 4DV7J 2R7TA 1HQUB 1FWPA 1PKUA 2XMWA 1Q8KA 3K5OA 5C24B 4XPCA 4K4VA 4CH7A 2JC0A 4CYUB 2GIRA 4JI7J 3T3FA 3A8JA 3KUHA 5JVGQ 1P1TA 5ETLA 3D9BA 4ECYA 1EB0A 2HGNA 3OTOJ 1JKHA 2RE1A 3PRVA 1D0EA 3LA0A 3DU5A 1LXJA 2SXLA 2ZHOA 5H9FJ 1Y11A 3SCLE 2PEBA 3L7OA 3CDWA 2CJQA 3UR3C 3R5JB 4TYBA 3IRWP 4K4XA 1RAOA 1T05A 5KT4A 3C19A 4KHRA 3UD3P 1R27B 3ISND 1H6KX 2ZZTA 1YDLA 3M2RA 3KJNB 3HVAA 1ZAVA 6FDRA 2W25A 1FERA 3MMCA 1NMEB 4UQGA 4JI2J 2MY8A 3DRRA 2MQQA 2V2QA 1Y0HA 2WTFA 1UL3A 2DPIA 1N5YA 1RT5B 1TL3B 4KR0B 2CQ2A 1XC9A 4EK2A 3AB2B 2Y8YA 1N34J 3MECA 3MR5A 4ECRA 4ZVRB 2CJYB 4I6AA 2XYGB 2DD8S 2BJ9A 4Z7CA 1K0TA 2RQMA 4DR7F 5DGBA 4GKJF 4AQYJ 1NLKL 2VOOA 3GTYX 4TKTA 3AODA 4G65A 2C42A 5GAGU 3SCIE 1VGYA 5E7OB 4RNHA 1HI1A 1NRKA 4R5PB 3LP2A 2HK2A 4GVBA 3I4PA 4TN2A 1IBKJ 1Y5IB 3H90A 2XZDB 5KFTA 1UVKA 3DNCA 3R5CA 3NGDA 2OSQA 2RSQA 2DNNA 1I1GA 4OZ0A 1R8HA 3PHTA 2DHSA 1HW8A 4C98A 3CJKB 2CQIA 4QIEA 2YKNA 5AJ3F 5EHHA 1HBOA 4DV2J 1JJ4A 3MAHA 2K3KA 2IAJA 4H4MA 2VKZG 3CCRS 2WVCA 2IYIA 2HFOA 1RWWB 4JI4J 3NGTA 1CULA 2ZC3A 4HDHA 2FLNA 1C2PA 5EWGA 2AEJA 1JLBB 2VC1A 2ILYA 2DIVA 4LJMA 4OZ2A 1B7YB 3QJJA 1N52B 3Q2TC 4O0NA 3BGUA 3VAKA 4QWAA 4L76A 3M6XA 2HZAA 4B3OA 2RS2A 5KG1A 3SCJE 4CM0A 5IOLA 4LFAF 4N7TA 4M95A 1TK8A 2GV1A 4WU3A 3CXCR 1VQPS 4CO4A 3DOMA 3Q2SC 2JHEA 3TJAA 4OHWA 1SI9A 1QY7A 3H4BA 2CZ9A 4CT9A 2OLWA 4P7TA 4NA3A 4OZNA 2B9WA 3F0NA 4DSJA 5CH7B 2B9XA 1SH2A 3OHAA 2V9WA 2E7WA 1S1TA 1JLAB 3Q22A 3V2UC 3BQ0A 3KUEA 4YMEA 4ZCIA 3T1YF 3VGVA 3CB4A 1TKZB 1C1BB 5GAGI 4IR9A 5DDRC 5DG7A 2VF3A 4C6AA 4DL3A 4DX5A 2LA6A 2HQGA 3NGKA 1NPRA 2H1YA 2EW9A 1FK9B 2CZ4A 2XS5A 4FYVB 3WZ0A 4UZCA 1DQAA 2IDLA 3KK3B 3L7PA 2YPYA 2CAJA 4U96A 3CJ5A 1H98A 4DN9A 3CSKA 4JI1J 3DLGB 1ZETA 4LF8F 1YRTA 3M4XA 1Y9OA 1BXNA 2OPPA 5L1IA 5CCMA 3SSSA 3SXLA 1EHWA 1KEKA 3U02A 1D9FA 3DGPB 2MQMA 7AT1B 1XMQF 2FUG9 3V81B 1FNXH 2KHCA 2IA0A 2GVDA 5GVQA 1HNXJ 3EZUA 2KZMA 3LANA 1IJFB 5CCLA 3V6KA 3NOGA 2H5IB 2X3DA 2E29A 4X4RA 3V6DA 3DI6B 1HBMA 1RTDA 2RUGA 2PMZD 5DM7Q 3FSXA 4ELUA 5IV3A 3QRPA 3BH6B 4WKRA 1RU1A 1HNWF 4KO0B 1FJEB 3CMQA 2ZITA 1CSJA 4WKYA 3D6TB 2YKMA 4WK1A 3KNGA 3B4MA 4YUDA 3EZOA 4UT4A 1T8EA 3I96A 2J5AA 3BKUA 3IGNA 1FRHA 2EG1A 3K2YA 2HLTA 3LP0B 3LQVA 3VGUA 5D0HA 5D3GA 2A1BA 3RRKA 2J0XA 2ZKTA 3UI3A 2DT9A 3FUYA 2V94A 4NOHA 3CULA 3OR2A 4F4AA 1SJ3P 2JVRA 1R7IA 4PG5A 4K59A 4HDGA 1RTHA 3ZTSA 1SUQB 3KDNA 3B54A 2FIUA 1S0VA 1L3KA 1IN0A 2KT2A 2YX7A 2KVQE 4RNMA 3BKFA 4QW8A 1HHQA 3MM9B 1WC5A 5KFWA 3RBEA 1WACA 3ISNC 4JV5F 3EX7B 2J9DA 2Z2LA 2DY1A 1RKIA 4N77A 3K5LA 4NLWA 5HJXA 3W64A 1WELA 1WF2A 4NXNJ 3OHBA 2GFFA 4H4KA 2HHXA 3T9NA 4U7CA 2JRSA 4N47A 1IBLJ 3OSNA 3M9NB 2N4DA 2AJQA 3M30A 4ZVGA 2M7SA 1U6BA 4P75A 4PWWA 2Z2MA 2E1AA 2QRRA 1NSQA 5GADI 2B6AB 2FLPA 4DJBA 4DSFA 2YKOA 1KWMA 2R7OA 2EK1A 4YS2A 1MROA 1P9QC 1M5PC 4CT8A 3MURP 1UA0A 4KC5A 2C2MB 4ILLA 1NK6A 2E5IA 3KLVA 1RWOB 2HHPA 2CADA 3C6UB 1E6VB 3N0VA 2CPJA 1RCOB 2W1BA 2H48B 2VFTA 2R42A 1UFWA 4N8NA 5KOXA 2XZTB 3M8WA 3BGFA 4DR3J 2ZNZA 2XB2D 1T0TV 4WPAA 3IAS9 5AE1A 2JC1A 4YQWA 3R9LA 2A3JA 4IO9Q 1P1LA 1F2HA 3DRSB 3MDFA 3MM6B 5IT9Y 3M32B 4DHVA 1GTHA 4FVMA 2Y0SD 4H4KC 5K8OA 3W5ZA 3IM9A 4QZVB 3TX8A 1U02A 3PX0A 2VFUA 3TA2A 3SCKE 3N5FA 1KTVA 1ZZFA 4DWIA 2DNHA 2DGVA 1DZ5A 1B99A 4ZITA 4KH0B 2M5YA 5AE3A 4LREA 4P2MA 1S0MA 4C3LA 3KMSA 1PC4A 1N88A 4O0IA 4KH1B 3KG1A 2OUGA 2K2PA 3JTNA 4DL4A 3G9CA 5HMZA 4WFXA 1G6BA 3J81Y 1RAAB 4DL2A 1IR1A 4TQSA 4O3PA 1B0VA 2XC9A 5L9NA 1R8AA 3CIMA 4LRCA 3DMJA 4DBQA 1LKZA 2MB0B 1U45A 1F1BB 1D8YA 2ZKUA 3LWMA 1MG7A 1S10A 4LSNA 3ZC4A 3ITHB 1HWLA 2HKEA 1YJ9S 5D0GA 1U1QA 1OSCA 1IUJA 2BBEA 4B08A 3D5MA 3E3XA 1QUPA 3SBMA 1PJ7A 2IVFB 2RHQB 2ZBPA 3K5MA 2MZQA 4FXDA 4CTAB 3TJ8A 1RT2B 2QN6B 3QJPA 1VK3A 1B0PA 5U47A 3MM8B 3BH7B 3PO5A 2XSFA 1KKHA 2ZH5A 1WORA 2UUBJ 1I3OB 1HYSB 3TZXA 2UVUA 5IV4A 1UW9A 4HTIA 2W4DA 3LGHA 1P6TA 2E1RA 4I4BA 4I7FA 5LXRA 4DI6A 3KK1A 3GZ7A 4LVNP 3MEKA 1WC6A 1NKCA 4Q0BB 1H2VZ 2PEHA 2KB2A 3QATA 4NYPA 2W4PA 1N4LA 2DEIA 1NSAA 4DV6F 2WOMB 3V6JA 4KHMA 3VQSA 1EARA 4Y0FA 5KFPA 1X4AA 3W9IA 1PJ6A 1F9FA 1S1XA 3D66A 2MSSA 3QSYB 1VK8A 2KM8C 2EXUA 3ZZPA 3RR8A 2I0XA 3C16A 4DCOB 3JQKA 2FTRA 3FK4A 3VVUA 2CVIA 3RW6A 4O3OA 3NS5A 1TP7A 3HHLB 1K73T 3I56S 4UTGA 4U67Q 3KLIA 3NS7B 5HN0A 1X7VA 3BQ2A 4Q7AA 2X1AA 3T19A 1W26A 4DV1J 4Q8EA 2Z8QA 3N6LA 3PY8A 3CC4S 1RJJA 1RTIB 5A8KA 2YNIA 4C8NA 3A8KA 4NWBA 4G3IA 1WC4A 1YRUA 1N33J 2CWKA 4OJ1A 1B64A 2IMWP 2XBPA 4K4YA 3IM8A 2V8DA 4U7UD 1V9OA 3R7BB 3O1LA 4RKUC 1WEXA 3E01B 2NYHA 2V4RA 4JP8A 2QL7B 1LWFB 3MAAB 4PWUA 2DR8A 1QAYA 3N01A 3OJSA 1DTTA 5KFAA 4XDCA 4J9MA 3GJSB 5J1EA 4FS2A 4RW6A 2FC8A 3JS9A 2QO3A 3R5BA 4FF1A 4JYAJ 3SZ2A 2HYIB 1SQFA 1U0SA 3OXLA 3A8IA 2B43A 4PG6A 1FESA 3BPDA 1IR0A 2J9CA 4ECUA 2L9DA 2F3JA 2DGSA 2HNZA 1FKPB 4HR2A 4HI1A 5HVGA 4DR4J 2RDJA 1WDTA 3ICLA 2NUUG 4L72B 2GS8A 7FD1A 5A2QU 2B51A 4OYIA 4ECQA 4JI5J 3SDEB 5IXUA 4ID5A 1ZZNA 3W62A 2Y1JA 3FZBA 4JB8B 4K0KF 3CD0A 3D7SB 3IBFB 2Q43A 5DLGA 4TLQA 3PX6A 2B4UA 3DOKB 1EKRA 4C8YA 1F2GA 2AGOA 2CPDA 5L39A 4RJVA 1FXLA 1EQ0A 1HBNB 4IQMA 2VG7B 1Q0NA 2C2EA 4G1QB 2C2OB 1IKWB 2ADCA 3QJLA 1RT6A 5EGYA 3Q8YA 2AHOB 5E3CA 3IG1A 2FVPA 3UE2A 2XSJA 2OH2A 3MCMA 3DYAB 3C14A 3M1VA 3S01A 3T1HF 1WF0A 4OX9F 4ZVSB 3PKMA 2JLGA 1VRTB 4O44A 1YGYA 5I42A 3TUIC 3S8SA 1EP4B 1UJ5A 5J2MA 4PEOA 1NDKA 2DY9A 4R8UA 4L74A 2W9CA 4NYOA 3TAMB 1VRQC 2GMLA 1NK8A 3KHRA 4DUZJ 2PI4A 2YNHA 3ENWA 4UY85 3QPIA 2PFDA 4C4WA 2YWKA 2JOQA 1RABB 1RT3A 1T3OA 5HK4A 1BQNA 1JXLA 1HMVA 4ED6A 2YX1A 3JXOA 2BKPA 3R8YA 2XGPA 3I5AA 3AY0A 3I0RA 3OL8A 3QBCA 1QE1B 2OGUA 1WKJA 4HHHA 2H3EB 1UJ4A 5T41A 5FD1A 2QIFA 3FRYA 3TA0A 2BM1A 2P9EA 3LPYA 3TVYA 4J9QA 1SKRA 1XNRF 3HSJA 2NUHA 3RAMA 1HR0J 2M8HA 3RB4A 1TFYA 2OPRA 3CCLS 3VAFA 1RQ0A 1RT1A 3P45B 1S6PA 2YXLA 4UZBA 4LSLB 3WHIA 4L73A 3L4BC 3BBFA 1GAOA 1FEHA 4QWCA 2IM3A 3G87A 2J76E 4B3SF 5F0WA 1WSRA 2DNPA 3DDIA 1R43A 1PBAA 3PYGA 2DTJA 4QPXA 1J27A 3GIKA 4CLUA 2QG9B 1SJ4P 2KHDA 3UFCX 5F8GA 4WTYA 4JI3F 4HACB 1LWEB 2BJ1A 1SJFA 2Y1RI 4KKOB 4WIQA 5KFMA 2GJFA 2M3DA 2MZTA 4F50A 5M2PA 1AROP 2NSCA 5D15A 1XTZA 3MR3A 4OYXA 1X8DA 2V4JA 4J5OA 1FJ7A 3L9ZA 4LR8A 1UEVA 5L1LA 2ZUAA 3MUMP 3C66A 1XR6A 3JYTA 4GC7A 2P2CB 2FQQB 4XDDA 2Z58B 3D3BJ 1LK7A 3D6MB 2K3IA 1IVZA 1CJVA 3D0IE 1R89A 3PJXA 3AJ2A 3P5BP 1JNZB 2F1FA 3RU0A 4X62J 1A0OB 4NLXA 3VAHA 4ZN1A 3PYEA 2AYMA 2I5JA 4URGA 4DG1B 5C42B 2UUAJ 1RAEB 4WXOA 3SSQA 5KFEA 3K0JA 4QIVA 3X1LB 4MK8A 1FA0A 2RVJA 3J7YU 4JI2F 2DR7A 1U09A 3DC2A 2VIHA 2G2ZA 1VC6A 3R27A 3EYZA 2DGTA 5BYQA 4ED5A 3O5TB 4Z37A 5M2UA 4ECXA 3LALA 4TU9A 4NZ7A 1NXIA 4HKQA 2AJ0A 3VALA 2BOAA 1XK8A 5KOWA 1UPPA 2KN4A 2BV3A 4BLGA 3I0SA 2YY3A 5K5MA 1UFKA 3W2VB 1F5BA 4CLZA 3KHGA 1T03B 2OMLA 1M0SA 3O8WA 3R2CJ 1CS4A 2NPIA 2L48A 1SVDA 1XERA 4PXDA 1RWNB 4CZCA 2F4VF 2Z30B 2XGQA 4FYDA 2IC3B 1RXOB 1WG4A 3TWZA 2IDEA 2V8HA 1JK9B 3MM7A 1B70B 4USHA 1SC1B 2DYAA 4EZ6A 3PR4A 3DCAA 4J7CA 4XPEA 2M4MA 3BZQA 5BYRA 4YB7A 3BGRA 4PXEA 4DU7A 2VBZA 3U1NA 4RZRA 4DV2F 1Q5YA 3LW5C 2BQUA 5F9LA 4C97A 2VA3A 3KKFA 2HQDA 3D6FB 2QEXS 2WBMA 1VMBA 4IFVB 4R5PA 3NP5A 1HI0P 1ZH5A 3NGUA 3W61A 4DV4J 4PQUB 2RQKA 2C2ZB 2JWNA 2JDJA 2GA7A 1RT7B 4WXWA 2C3YA 4I6WA 3CJKA 1KVIA 1Q82T 3MPVA 2AX1A 1B0TA 2WB4A 4B3RF 2CQ3A 2XMMA 1LW2A 1YKWA 4KAIA 1X4BA 1OY6A 2MZRA 3MWBA 3G6ES 4LF2A 1F6TA 3CC7S 2FHKA 3NG8A 1SXLA 4DSLA 5BR8J 3QAUA 2HVEA 2HG4A 1QD1A 3UVJB 2BRLA 2FGOA 3FBFA 2HLUA 3NNHA 1O5JA 2M70A 2RT3A 3GSDA 3RR7A 3OVSA 5ETMA 4ZCLA 2IRYA 3OFHA 3GYGA 3M2UA 3KJFB 4NASA 1LWCB 2M8DB 1XNQJ 5J2PB 3QT8A 3GFHA 2F65A 2ZUGA 2R7WA 2X1GA 5LOQA 1JXVA 3ZZUA 4RBVA 5CABA 1IKXA 2QX0A 3IS9B 4F67A 1NK5A 1YJTA 3HVWA 5LJ3Y 1EAYC 2HRTA 2RF2A 3T1AA 2V2KA 2VJVA 3W65A 4JI1F 3G86A 2FZKB 4YB6A 1UVMA 4H54A 4D3GA 1IKVB 2OP5A 2OPQA 2ZD1A 5E3PA 4XIUA 4P72A 3IMQJ 1AFJA 3N79A 1NCLA 3DRXA 1URNA 2V2ZA 1AUSL 5L38A 2YWHA 3G8SA 4TU7A 1U1PA 4ANEA 4DU8A 2BE9B 1IWGA 3FEZA 4LF6F 1Q7YT 4Y00A 2OEMA 2DGWA 1HNXF 1H2TZ 4QQBA 2BW2A 3EE3A 3EGZA 3T5LA 2KTQA 1R0BG 4LF9F 4J9PA 3JSBA 3Q24A 3I82A 1OPZA 1S9GB 1N54B 5K20B 4CO0A 1FNOA 1N6QB 2VQEF 3OW2R 4PUOA 1JWWA 4EO6A 1O0PA 2R2SA 3T5JA 1N5SA 2VBXA 3MMBB 3QGPA 4UOFA 3L09A 2KH9A 1CG2A 4C8MA 1N32J 4TU8A 2DXEA 2R8GA 3EVWA 5CZXA 2AZ3A 4TY8A 3PRBA 2OKQA 3M6UA 4NLUA 1WKKA 2QT7A 3DI6A 3H2UB 1I94F 2B9YA 3TZWA 2HFSA 2ZC4A 2HFVA 1EJ7L 1YIJS 1S6QB 4AUKA 3NY0A 4MIBA 1ZTWA 5EN1A 1CQNA 4KO0A 1IKYA 1NBEB 3QZ7A 2FLLA 1F5AA 3OL6A 5I3QA 1S9EB 1GMWD 3P5TL 3QMQA 1WJ9A 4IOBA 2HHHJ 3I87A 2CDQA 2JLFA 3KLEA 2HFZA 4LF5F 2MEWA 4DV3F 4NXNF 1WC0A 4RUBA 5BJRA 2FHMA 1RADB 4RW8B 4I2PB 1RHJB 1E6YA 2K8GA 4KE5A 4E0DA 1GXLA 4J37A 2A2DA 2LKZA 2RDIA 5KFVA 3KJVB 3H5SA 3KHHA 1JLQA 4IOAQ 4FZVA 3AJDA 1SCJB 2BW7A 3EICA 4OYAA 3THPA 5LMNF 2R3VA 3RAXA 3HO1A 1XEZA 2DCUB 1VRUB 5KFSA 4ZPAA 5F8IA 2LEBA 2PMHA 2BYCA 4WFZA 3MFIA 4YR0A 2QE5A 1ZA2B 4NYZA 4ZVOB 5HL7Q 2VC0A 1AA1B 1NSKL 3OTEA 2CPYA 2B5JB 1JLGA 2QL5B 2AYEA 2E9RX 3THVA 4P6QA 4JI8J 5F3TA 1IM4A 4USIA 3TYTA 2HFUA 1EIYB 4I2QB 1VCTA 3DRYA 2B6AA 3R97A 1PSDA 2VODA 2BQRA 4PG7A 4ZPWR 4BS2A 5ETSA 2GX8A 2QFIA 4NE9C 3QT7A 1WOOA 1VQ4S 2YKPA 1G4CA 4QW9A 2FC9A 4E2FB 3ZFVA 5HLFA 3HMJG 2Z4PA 3AAWB 4I56A 1HNZF 2YNGA 4Q43A 2Y1IA 4YN3B 1O51A 3C6UA 1R0AB 1E6VA 2VL1A 1WHVA 1JMTA 2LYVA 3DGVA 1T11A 2EI5A 4BC9A 2DB1A 3D6HB 2EKYA 3CPWR 2GQCA 1T02A 1PIEA 5F9NA 2WSCC 2IA6A 2A10A 4ZJLA 2WBRA 1RAGB 3D1QA 3DLHA 4MK7A 3IGVA 4RWXA 2CUYA 1S59A 1NJYA 2HBYB 2DNGA 2APOA 1U4BA 5HROA 3K5NA 1KOHA 2BUNA 5IWAJ 2BE7D 4FF2A 5J2QA 2V8PA 2XG8A 3FSIA 4UQTA 5LJ5Y 2YWFA 2W4CA 3J81j 1SIZA 3ZZYA 3AB4B 4ED4A 4IH7A 5KG7A 3HKWA 4NLSA 3GE9A 1FJGJ 3AQPA 4DF8A 4RW9A 3V4MA 4OMFG 3HULA 2IVMA 2DR6A 1NNDA 5HBMA 1GNKA 1LEOA 3M8SA 3RUBL 1FTCA 2FHJD 3NBPB 4QOTA 4I68A 3EVMA 2MYFA 3MCSA 2CWXA 4USMA 1JJHA 1NPKA 4M5HA 3K5PA 1QAJA 4HEA9 2GZOA 2RH3A 1LWXA 3OVBA 2LDIA 5JVHQ 3RAQA 1HL6A 5DS7A 3CEDA 1S9FA 1NB2A 1RWPB 2OHDA 4ZKAA 4KJIA 4A8XA 4M5LA 5HQLA 2ZM6J 1U24A 1GMWA 1X60A 4DUTA 5AT1B 3BDEA 3MM5B 1TZ0A 2ZVIA 4K50A 4OX6A 4O4RA 1RBOB 3PW5A 3U7JA 2XCPA 1OY8A 4ZHRB 3CCWA 1HYSA 1WI8A 1ZM9A 2GMJA 2M88A 3WBZA 1KHVA 2BANA 1KNZA 2VG6A 2XWYA 2C22A 1NJIT 4B02A 4DX7A 2AGQA 1MMLA 2HVIA 2DRBA 3R7SB 3ILIA 2XYHB 3V4IB 5EX0A 2KXNB 2E5HA 4YB1P 2EKNA 4M8LA 2ZBCA 3M2VB 2EFQA 1DARA 1GH8A 1NPPA 4DL7A 1AXQA 1NDLA 2H65B 3CCTA 1C0UB 3MMAA 2B4PA 3FVYA 4HH0A 4EFAC 1G3OA 3MEEA 4RW4A 2HNYB 2QV6A 1RA7A 1ZM4A 3BN7A 4QR1A 3MZIA 1C0TB 3AXKA 1WHXA 2HNDA 2V34A 4V19J 5KFBA 1CJKA 4ES3A 4R25A 2JFKA 2K7KA 2B8PA 2AJFE 2HBRB 4AFFA 3D1OA 3MXHP 3W7BA 2PC6A 4YR3A 1C1CB 3ET6B 4C0OC 3THTA 1UPMB 1RTIA 5G0RA 3M8RA 2HS4A 5KFIA 1IJEB 1RHUB 3PEHA 3L95X 4LFCJ 3LOUA 4JYAF 1QDUB 3RBXA 3QWUA 3GIMA 3IA0A 4P71A 1Y5LB 1CJTB 1UMJA 4UOHA 4KHPF 2Y1LB 3IFEA 1TELA 1FFGB 1SKWA 1TUGB 1KS2A 1WC1A 2ROGA 2GAGC 4ED3A 2I2YA 2MQNA 4Y34A 3E01A 5B0EA 3FMWA 1T9XA 2UXBF 1HHSA 4DR4F 1LWFA 3LAKA 4BC7A 3KLFB 3M8YA 3W5XA 1TFWA 3EUNA 3M8QB 2XLJA 3J81U 3CTRA 3QT5A 2ACMA 5ETQA 2G0JA 2M0GB 2YQ3A 4RUCA 2FJDB 4IFYA 4A4JA 1FD8A 4QU7A 2LDYA 5HP1B 3PXGa 2BE2B 1K0VA 2OPSB 1S79A 1M5HA 1AZSB 1B7FA 3W5YA 1U7LA 4Y2AA 5JXSA 3ONQA 4WFBQ 4MFBB 4CLLA 2EC2A 5DZ6A 1FKPA 1SKSA 1Q5VA 3BV8A 3PNIA 5GAHU 4H4OB 1SPBP 5A6WA 1A7GE 2YQ1A 2VOPA 3G96A 2COLA 4X2BA 1TUWA 2VA2A 4LQ9A 3EJMA 3HDSA 1GX5A 5B0DA 2LXIA 2NZCA 2FHJA 1FDAA 4K4TA 3MEDA 2C2KB 2BKOA 3I4HX 4ZDNA 4ECTA 3GIRA 1QAXA 3DOKA 4ZA1A 3CJRA 1VHFA 3DM2B 1TKDA 2UXCJ 4JI0F 1TL1B 4AYBD 3I5CA 1HBNA 2VG7A 4KFBB 2EFGA 2BJ7A 4G1QA 4F4YA 2GNKA 1RAHB 3H20A 1U8WA 2MGZA 2BKNA 1Q4RA 4ILRA 3K17A 2MTLA 5MLCV 2RRAA 4DR6F 3DYAA 2VUGA 4KT0C 3ZZOA 4DR5J 2HK3A 2PIIA 4DUYF 1VRTA 1SV5B 4CLPA 3C15A 2DJWA 4ELVA 1RWVB 4A8WA 5AXLA 3MEGA 1SQEA 5LSLA 4P73A 2KL8A 3CD5A 1TU0B 2V50A 4NXMJ 4Y28C 2HW3A 1QLNA 1GFWB 4O4GA 2ALYB 1DLOA 3AD8C 3VR1A 1FE4A 3K8VA 1YQHA 4ZOSA 4DR1F 3H0PA 3GJRB 1TKTB 2W2QP 3SFUA 2D3O1 4ZLPA 1WG1A 5E5NA 2LXFA 2XMVA 2DRAA 3BO3A 4UUWA 1H72C 1QE1A 1M1KT 4PQAA 1CBKA 1M90T 1OYEA 1YZ7A 1VQMS 4USUA 1BQMB 2JNJA 2OFHX 2UUTA 4X64F 4OJGA 2K1RA 3ENAA 4OHYA 2IM1A 3OTCA 3BREA 3DRPA 3EGNA 4OX7A 5KG6A 4LFBF 1H3DA 1WHWA 2IRXA 3BN4A 5K9FA 2WHOA 3SQGB 3AT1B 4JV1A 5B0BA 3BSCA 2MLYA 4DV0J 2UVRA 1FNMA 3TARA 3PG9A 5A8WA 3SQOP 2ADBA 1VQLS 4FYXB 4K8RA 4W90B 1LXNA 4OYWA 2QLWA 4ZP9A 2VBWA 2LMIA 4LSLA 3OLAA 3IWNC 1O8BA 4L3NA 3KDOA 4KTQA 5DETA 2XMAA 4DR2J 4PR6A 4USKA 4ZN3A 3OTBA 2YWWA 2MJUA 2HZCA 1S77D 1KQGB 4CLSA 4ICLA 1SQGA 4X66J 1WNEA 1LWEA 1T05B 2A0FB 1Z1ZA 2JFDA 4KV8B 2B56A 4F26A 1X31C 3NL0A 4F04B 2GIQA 1NKEA 3IRXB 2RNEA 3NEKA 2VU5A 2M52A 1K47A 1WTBA 2OD6A 1V3RA 5J1NA 4XO0A 1HARA 3MF5A 2C1EB 2RIJA 3LP1B 3GV7B 5L8RC 2HFNA 5KFOA 2ZH3A 1OYDA 1N5YB 3G6VA 1BWVA 4CI0B 2RRBA 1YHQS 5J1PA 5EX3A 2CDRB 4W92B 5GMDA 2WW8A 2AZ1A 2RDDA 1SL2A 1KLMB 1FWKA 2QYGA 2ABYA 2OAUA 3UCGA 2JEJA 2VG5B 3W9JA 4WCEQ 3TEGA 1H73A 3PFOA 2C2RA 1NZAA 2RJZA 3EGWB 1X4EA 4ZLLA 2ZOMA 2HS3A 2MLZA 3RRGA 3M9OB 1ACMB 2VICA 2ATLA 4AXIA 1BWEA 2AEFA 3GB0A 2IJFA 3DLKA 1Q79A 2OTJS 2W2MP 2CPZA 4C3MA 1T94A 4GVBB 4LRAA 2GQQA 3P6YC 1NK0A 1OJ4A 4J91A 2BA9A 1YBUA 1MMNA 2Z57B 3UQSA 4X65J 2BQ3A 1LV5A 3RW7A 1RISA 3FQLA 3VVTA 3TZZA 2KDOA 4DR7J 1XJWB 1NH7A 4F3QA 1MW7A 3H98A 4GKJJ 4EYIB 1PBUA 3JTOA 4P9SA 3PV8A 2V2VA 1HBOB 1REVA 1UZDA 2XHCA 3IP0A 2V4QA 1D09B 4PG4A 3NMRA 4CRJA 4NLYA 1KSPA 4PG8A 3M8ZA 3FC9A 4GKKF 2YNFA 5K8PA 4ZVFA 4LF4J 2BABA 4Y2IA 1CEZA 2IC3A 4WE1B 4EMDA 1AT1B 4DV4F 3UCZP 4U7UK 3VAMA 3MTJA 2H5JB 3PHEA 4B3OB 1GT8A 3H5UA 3WC2A 4FYWB 5AJ3J 3CCVS 3DOMB 2E5LF 1MLAA 1NHUA 2W7PA 2QYCA 4RR5A 1FWLA 2DR9A 4ZCMA 3FCVA 1H74A 5AE2A 1XMOF 5DDPC 1S1TB 2JZ5A 4USJC 4PQUA 1VDHA 3CJ2A 1RHKB 1RT7A 1R0CB 2MKKA 3RTVA 1IXKA 4LFAJ 3S6EA 2CA9A 1IWAA 2KVIA 4DPYA 2HWHA 2M9KA 4CDIA 1L3UA 1X9MA 4CH1A 2NS1B 2WZ1A 2MKCA 4A8OA 1MWQA 5DM6Q 4R0EA 4B17A 5C7PA 2NREA 1R8PA 2DHGA 5I3UA 3MHYA 1FE0A 2XMTA 4LSZB 1J5OB 4K7QA 3M8PA 3W8GA 1QTMA 3MAQA 3PW7A 4PXBA 4C0HA 4EI2A 3T1YJ 2R8HA 3MCOA 3K7RA 1RHRB 1J5EF 1S1VA 1M5KC 1C4AA 3BYPA 1VI7A 4DN0A 3VV2B 2A2CA 3GLJA 1U6ZA 5ETTA 5LMUJ 2G2OA 4LIWA 1UWBA 3TW0A 4PWDA 3QQCD 3A1YG 4B3MF 2BXJA 3T6BA 4UW2A 1RTDB 3IR7B 4DL6A 2QL9B 3AH6A 4NLTA 1P9YA 2WVFA 4LF8J 2GW8A 3C46A 1KC8T 1GEHA 1WOPA 2ZDPA 4YR2A 1HA1A 3U1LA 4ZPTR 1NAQA 4IDKA 4O3NA 3N6MA 2DGOA 3P3DA 5AXKA 2H4WB 2IJRA 2YKMB 4QYZJ 1XMQJ 4F7VA 4GMKA 5ITHA 1XR7A 1FXRA 4F0HA 3JSMB 4P7VA 2HQFA 3TUJC 1UP1A 3LF0A 2CPXA 3LGMA 2ZH4A 5KFGA 4NLDA 1LK5A 3OR2B 2ERRA 3NNAA 3A13A 1S9GA 4JV2A 1BHNA 2J0WA 2Q6BA 4DSKA 1HWKA 1RTHB 3POTB 1N6QA 1FRXA 2HVHA 1YJUA 1HNWJ 2W8LA 4ERDA 2MKSA 4PYDA 2XWXA 4KYZA 3TUPA 4TVAB 2DHHA 1UEKA 3HSGA 1Y5NB 1NEEA 2KI2A 4C7QA 4RPFA 4DCPB 4DV5F 3B8HA 3TQ1A 1B4SA 1RTJA 5D0RA 4HHUA 3ZTRA 4ALZA 4KSEB 1HNVA 4IG0A 2XO7A 3GFXA 2Y8WA 1M1HA 2LLZA 2Z2ZA 2HHHF 2PFFB 1NU4A 2WVBA 3MTKA 3EVOA 2MQ8A 4WYLA 4ZVUB 2HQCA 3MPYA 1SH0A 2ILZA 1Y4ZB 4K4WA 4DX6A 2UXDJ 3HD1A 5KFXA 3DFEA 3M30B 1L5UA 5D4LA 2HBQB 1RHMB 3HCXA 1HQEB 2DVIA 2N3OA 4LQ3A 1FRMA 1FFSB 3SSRA 4MK9A 1S9EA 3OVAA 4JV5J 1MROB 3JSRA 3W2WB 4F2RA 3VHQA 3ZZRA 2W2NP 3G6YA 1D8ZA 2KXHA 3KG0A 5HVHA 4RW8A 2ZBIA 4I2PA 2WONB 1VOMA 4TLRA 2ZWOA 1W25A 5C5JA 4DQPA 5CZVA 2JLEA 2CJBA 2I9SA 3KJVA 2KU7A 2RHSB 2R8KA 3CVKA 1M5OC 1ICEB 1IBMF 3Q0AA 4C3KA 2HAIA 5B0CA 1Q86T 2GCFA 7FDRA 4CO2A 4J90A 3UDEA 4ETZA 5GADU 1IM6A 2EPIA 2NXEA 2KJWA 3OR1A 6FD1A 2LU2A 1TKXA 4AL7A 2O5DA 2G13A 2IM0A 3NAHA 2PT0A 4XK8C 2ZH2A 1FFWB 1DJ0A 3CD6S 3RJMB 4CO5A 3ZNJ1 1OMSA 5DDOC 1JQGA 1RE1B 4ATNA 1S76D 5IC6B 2IIHA 2DGXA 1TR0A 2H54B 2O66A 3L7UA 4J9OA 2W9BB 3MFHA 1W2BR 3GR0A 1FKOB 3DLLQ 2LECA 3R1HA 1RT4B 3MPWA 5HANA 3BKTA 5E3QA 1ZAWA 4NA2A 5IWAF 1Z2ZA 4EWTA 4LSNB 3MR6A 1TL7A 2QMXA 3D2WA 4LRFA 3BGLA 4C8OA 4M94A 4ED7A 4EGLA 2ZNYA 5A2QY 1YSJA 2XYPB 3R3TA 1X9WA 5D4PA 4ZCKA 3CGIA 1PILA 3ILJA 3M6WA 5M2RA 3DKDA 3PW2A 1V5IB 5HMWA 1DAXA 1RKJA 1FXDA 2AJ1A 2Q1LA 3Q8SB 5CYMA 2Q6CA 4TQRA 2I6WA 1ZOTA 2J6TA 3WIUA 1UVNA 1WHYA 2JL9A 4J9RA 2GHPA 4L75A 3ETOA 3HHNB 4MJKA 3BEGB 4M63A 2GIFA 3CJQA 1D9AA 3QYYA 4I7FB 4B9NA 2RAQA 1VBZA 2WAQD 2KZZA 5KFKA 2CPIA 1MU2A 2V8GA 3U1MA 5RUBA 4I0WA 2Z56B 4WWSA 4USVA 5FJ4A 3K89A 3TJ9A 4ZVTB 2HVZA 3QLHA 5E33A 4FKYA 2ZOFA 4EYHB 1S99A 4IRDA 2N82B 4C9DA 1U0HA 2WRMA 4ZVEA 3JTPA 4WP9A 1VQ7S 4UY8T 2ATCB 3C3LA 1PG5B 5IM0B 1PYTA 4FXVA 4ZPCA 1S1UA 1Z4UA 4OJ3A 4N56A 3KLIB 1TAUA 2VONA 5C2GA 1NJWA 1KOOA 1JB0C 3CT9A 3EPGA 1OQ3A 1TK5A 5D8HB 4DV6J 4OLOA 3NLCA 3W66A 1CPZA 2VHGA 4B9MA 4X4PA 5A8KB 4ZHRA 2YNIB 3I31A 3TQEA 5T14A 2BR0A 2G0IA 1Q8LA 3EGVA 4A8FA 1QVGR 1NB7A 3IXQA 3AQOA 2UV8G 3H8YA 2IBKA 3CDBA 4EBDA 1OSDA 1H0HB 2B3TB 1OO0B 1TV6A 1N0UA 4I64A 1PAEX 3FRZA 2XMJA 4ECSA 1KN6A 1HBUA 5KFLA 5J1EB 4RW6B 1EETA 5HSPA 1HD0A 4DFKA 2LP4A 2F5GA 3QGGA 1RACB 4IRKA 2HPUA 2DIUA 4B3TF 5KFRA 2HNYA 4F0MA 3PO4A 1RAJA 1YBAA 1N36J 2EFOA 1ZTTA 1C0TA 3OQ2A 2WSFC 1SL0A 3M9MB 4RNFA 4LF7F 3EDQB 4K2XA 2HNZB 1YRXA 2DEJA 4IYQA 4I67A 4J9KA 3B6BA 5KT6A 1HW9A 1HIYA 1ROFA 4R0JA 1D9DA 1S0NA 5HMYA 1C1CA 2IVYA 1S5ZA 4IRCA 2U2FA 3ET6A 3G6XA 1N0VC 4ID5B 1S4EA 2HQ3A 5E3RA 4V1Ak 3N5BA 4LT6A 2KT3A 2GO8A 3LGNA 3LUYA 2MMYA 1UWAA 4FP9A 2O67A 3VGSA 2R7UA 3T5HA 1ZM2A 1UW4A 2R7QA 3KLGA 1CJTA 4C8KA 4C8ZA 2Y9HA 3NXZA 3NCPA 3T41A 1RA6A 3DLBA 3CCSS 2JSXA 3R5AA 1JJCB 3HVTB 5A6PA 2EFPA 4F2SA 1T95A 5D6GA 3IG1B 3KLFA 5C25A 5L46A 3C14B 3M1VB 5IT0A 1R6YA 2ZOGA 4K0KJ 1KTQA 1CJUA 2QTWA 4XAKA 2DO0A 3O3LA 4O44B 1G7CB 2BM0A 5I42B 3D1HA 5HP1A 4I6YA 4J9VA 2OPSA 3NRBA 5J2MB 9ATCB 4MT1A 1AZSA 2ZZMA 1S7HA 2KXFA 4MFBA 2K7JA 4A46A 1FRKA 4R8UB 3FCWA 2W9CB 1GTEA 1OPIA 2KT5A 1KR4A 3QFWA 4KGVB 2G9OA 2QA1A 1PGZA 2E1MC 3VWSA 3TEHB 4Y2CA 3NWGA 3ZTPA 2R7SA 4EZ9A 3AA9A 3T1HJ 1HMVB 4BCAA 2FVCA 2HZVA 3IWLA 4K4UA 3CCES 3M7VA 4OX9J 4DR5F 2MLXA 2QZ8A 1RWXB 4OFZA 1NUEA 2GHWA 4IR1A 4OI3A 1UETA 1GMVA 2QJ3A 5BYSA 1T7PA 5GAEI 1U1MA 3DOLA 2YBVA 4KFBA 2BJDA 5A0YA 1AB8A 2K06A 3HHKA 4PRFA 2W24A 4ECZA 2FJXA 4A48A 2J0QD 4OI0A 2MKIA 1Q78A 2MPUA 3CJ8A 4YY3F 5CYQB 2OI2A 3IR6B 2BJEA 1RT1B 2D9OA 3B4DA 1S6PB 1KRPA 3AA8A 4PAAA 1QSSA 2Y3YA 1BQXA 1SV5A 3W8PA 1UZHA 1UVIA 1AYEA 2CRLA 2J7UA 4C11A 2UUCF 3QGIA 1SC4B 2J6UA 2P8IA 4UF4A 1TAQA 5CD4A 1N8RT 2MKJA 1PYOB 2QC3A 4Q45A 4IG3A 3JAMU 3IO1A 2RKIA 2VFRA 1FVSA 5F8MA 3SMZA 4U8VA 4RU9A 3WQPA 4ES2A 2DR5A 3PJWA 4U6PA 2BRKA 3FBBA 2NPFA 2E66A 3V5RA 4L3KA 1EZZB 1C4CA 3D3CJ 2ZJQQ 3OUYA 3DN9A 5KG0A 5LT5A 1AUDA 3TI0A 5IZHA 4YHHF 2LVWA 2V4JB 2X1FA 1HPZB 2QLXA 1Y10A 2PE8A 3BO2A 4B3SJ 4USTA 1S1WA 2V9KA 3F73A 1FO1A 2CXEA 1JXEA 4HL9A 4WZQA 4ZVPB 1WWHA 1QSYA 2XQCA 3X3UA 1BY9A 4JI3J 3T9ZA 4RLEA 2ZH9A 4ZJOA 2NXJA 1R3NA 4RW7B 3GFZA 4UOGA 2ZHBA 1Q8BA 5D4OA 4DPOA 2I5JB 1EQMA 2XMUA 2MXYA 2L41A 1I51B 9RUBA 4O3RA 2NXCA 2AV5A 1MMDA 3J80U 2DNZA 3ZNUA 3GILA 3G4SS 4P74A 2CNLB 2HGLA 3HFVA 4URQU 2HGMA 3KOAA 1HWIA 1NKBA 1HNIA 3QO9B 4DCJB 5KFNA 1VQKS 1VQ6S 2MKYA 1AFIA 2QLFB 2YPZA 4PZVA 4WF9Q 3OL9A 1TMJA 1KQSR 3NMAA 1FVQA 1SIWB 1A9NB 2YX4A 4KGZB 4KV8A 4ZS6A 1DTQA 2IRUA 3IRXA 5G4DA 3D67A 3DU6A 3DDKA 3I0SB 2DNMA 2IFXA 2H51B 3ISZA 4NEYA 5H1SV 2YWGA 1CS4B 3LP1A 1X5OA 2B4VA 1RLCL 2CQ1A 3UR0A 3NCRA 1EX8A 2XI3A 3BBBA 1VIOA 4ID8A 2QA2A 3PDNA 4IQXA 1KLMA 2VQFF 3HSDA 3KK2B 4X65F 1UAWA 2GO9A 2VG5A 4NZ6A 3MM7B 3P96A 4FN5A 2GGPA 4DL0C 3B78A 2FVSA 3HXMA 4MKVA 2C3UA 2EBGA 3H2VE 3CDEA 4UUXA 1UFLA 3DHWC 2V67A 2XEXA 3BGRB 4DQQA 1G1XA 2VDHA 1S49A 4M5KA 4JV0A 5HAOA 2CNKB 1GX6A 1QVFR 3R7NB 4DZ6A 4JI6F 1WSVA 3ENVA 3VAGA 3BR8A 1FI4A 4WU2A 2F4VJ 1DQ9A 1FTRA 2V63A 4DV7F 3HLUA 4DFPA 4B9UA 4LF4F 3RGIA 1R8CA 3NAIA 4JI7F 1K44A 4OV1A 2J6SA 3TVKA 3AJ1A 3E2EA 4ZK7M 4Q44A 3OTOF 2NXUA 2W9AA 2MHEA 3OFGA 4HT5A 4F36A 4X4SA 2FJBB 4ZIVA 4QYZK 1LW2B
chains in the Genus database with same CATH topology
4FXDA 4CTAB 4C2MA 4KT0C 3ZZOA 1RT2B 3OFFA 4OZ1A 3TAPA 3QJPA 1VK3A 2DNRA 2PIIA 3CWJA 4Y2MA 1KHWA 4DUYF 1B0PA 5U47A 3MM8B 1YJWS 1VRTA 4F4WA 1N32F 2OJ3A 2MSTA 4HTJA 3PO5A 1SV5B 2XSFA 4K5SA 1VQOS 2LEAA 3QIPA 2JVOA 4X84A 2DJWA 2GHVC 4ELVA 4JUZA 1HQUA 3AHPA 3GR1A 4A8WA 5AXLA 5C24A 4E98A 3HVRA 2ZH5A 3MEGA 2VASA 1SQEA 4MYTA 5D4NA 4AL5A 3TO8A 1HYSB 1XN9A 2UVUA 5LSLA 2I8EA 4ED0A 5D3GB 1X4HA 4WE1A 3TVZA 4QWBA 4PPDA 2VD3A 3CD5A 1QSLA 1GQEA 4Y28C 2HW3A 3M2UB 1QLNA 1FDNA 3CJ4A 4O4GA 4HTIA 1W2IA 4EBEA 3F44A 2ASYA 1DLOA 1ZBTA 4ZPBA 3VR1A 3NKYA 1FE4A 3K8VA 1YQHA 2MY7A 2W4DA 4ZOSA 1P6TA 3FNNA 4DR1F 2E1RA 4I4BA 4DS4A 2OTLS 4I7FA 5LXRA 4WZMA 1TKTB 3KK1A 3SFUA 1FRLA 3CCMS 3GZ7A 4LVNP 5SZTA 4ZLPA 1HI8A 3GG1A 3MEKA 1YWXA 1IKXB 2HRUA 1WG1A 5E5NA 5DDQC 1NKCA 4Q0BB 3MMBA 2AW0A 2RF2B 2PD1A 4NRUA 2LXFA 4DDFA 1H2VZ 2XMVA 2PEHA 2KB2A 4C0BA 1S6OA 2W4PA 4NYPA 1N4LA 2DRAA 3BO3A 4UUWA 1LW0B 3HP6A 1QE1A 1M1KT 4PQAA 1SJ1A 4DV6F 5DQHA 2WOMB 5FLXY 3V6JA 1YJRA 1M90T 4KHMA 3VQSA 3HZGA 4Y0FA 1N34F 5KFPA 1X4AA 1VQMS 1BQMB 5H9EJ 1JIHA 2OFHX 2UUTA 1JLEA 4X64F 4OJGA 2K1RA 4LVOP 1F9FA 4EEYA 2G4BA 2OPQB 1S1XA 2IM1A 2ZD1B 5DG9A 4OHYA 3OTCA 3BREA 3CD7A 3MOZA 3MGJA 3DRPA 2MSSA 3EGNA 3QAEA 1VK8A 2HHUA 4MH8A 4OX7A 4WFYA 5KG6A 1U8SA 2KM8C 4LFBF 1MWZA 1V3SA 3KHLA 1FDDA 3ZZPA 3RR8A 2I0XA 2LU1A 4NLQA 1H3DA 2DISA 1WHWA 2IRXA 3BN4A 5K9FA 4CO3A 2BDPA 2VV5A 1TUVA 2Q3PA 3CULA 4F3MA 4AQYF 4NCBA 2WHOA 3N4WA 4KBIA 3SQGB 4GO7X 2FTRA 4JV1A 1L3VA 5B0BA 2R8JA 3BSCA 4HI2A 3IN5A 5KG2A 1S6QA 3TOQA 2CVIA 2UVRA 3RW6A 4O3OA 3NS5A 3FFIB 5B7WA 1D3WA 1LFWA 1TP7A 3HHLB 3PKYA 1FNMA 1K73T 5CYMB 3I56S 3TARA 5LMUF 5IS2A 4U67Q 3KLIA 3GFYA 5A8WA 5E2QA 2ADBA 3L3CA 1VQLS 5HN0A 4ED2A 1X7VA 4QR2A 1RT5A 1TL3A 3BQ2A 4Q7AA 2X1AA 2GQ2A 2IJNA 4W90B 3T19A 2PA8D 3IR5B 1LXNA 1XBWA 2QLWA 4ZP9A 4QWDA 2VBWA 2LMIA 4LSLA 4Q8EA 5KFUA 2Z8QA 3OLAA 3N6LA 1IBKF 3IWNC 1O8BA 4L3NA 4KTQA 5DETA 3PY8A 3CCZA 3CC4S 1J5OA 4G6VB 5HQ8A 2KJVA 1RJJA 1RTIB 3EXCX 4DFJA 2CG4A 5A8KA 1VQ8S 4PR6A 2OMOA 4PUOB 3SEOA 2YNIA 4OJHA 4C8NA 1I6JA 3GV8B 5GMKa 1WEYA 3OTBA 4NWBA 2W7OA 2RB7A 2MJUA 3UCUP 2HZCA 4TNOA 4G3IA 1YRUA 3TANA 1S77D 2XNRA 1KQGB 3BR9A 1SL1A 2GJ2A 4WYWA 1MU2B 3SV3A 5DQGA 4ICLA 5HO4A 2N7YA 5CYJA 4OJ1A 4YDXA 4ED1A 2J7WA 2VPZB 4EUVA 1B64A 2IMWP 2XBPA 1WNEA 1S72S 4PCQA 1LWEA 4K4YA 2V8DA 1T05B 4OZJA 1Z1ZA 2JFDA 2ZJRQ 3CE8A 4TY8B 2AYGA 3QLHB 4MIWA 1V9OA 2MZJA 2LCWA 4JI8F 3O1LA 4RKUC 1U1OA 1WEXA 1FRIA 2P5VA 5F3ZA 4KV8B 2B56A 3E01B 4F26A 2AYBA 2V4RA 2KFYA 1FHTA 2E7XA 4Q8FA 1VS3A 2FJEB 1LWFB 3OXFA 4JI4F 2XS7A 5A8RB 4PWUA 2DR8A 3NL0A 2GIQA 1NKEA 3IRXB 2RNEA 2HQIA 1QAYA 3N01A 3OJSA 2D3ZA 1FDBA 1DTTA 2M52A 5KFAA 3NS6A 4XDCA 4J9MA 1VRUA 4LMZA 5T7LA 1WG5A 5J1EA 1M5SA 2MJNA 4FS2A 4RW6A 2NZ4A 3QZ8A 1WTBA 2FC8A 2OD6A 4QJVA 1V3RA 3UDLA 5J1NA 1S6UA 4XO0A 3ULHA 1HARA 3MF5A 1V3ZA 2ZVSA 4ETXA 2HHVA 1S1UB 2QO3A 3R5BA 2D41A 2RIJA 1KONA 4FF1A 3LP1B 3GV7B 3CIZA 1IKYB 5LSRA 2YKQA 5L8RC 2HFNA 5KFOA 1NK7A 3SZ2A 1P27B 2ZH3A 1N5YB 1L3TA 3G6VA 2HYIB 4CI0B 2RRBA 4QIGA 2DNLA 1YHQS 3FJ2A 2DH7A 2CQGA 5EX3A 5J1PA 3OXLA 1FCAA 1XWLA 4W92B 2L3MA 2B43A 2WW8A 4PG6A 3GQCA 1FESA 3PW0A 2D3OR 2B5JA 1SL2A 1KLMB 1U2RA 1OQ6A 1IR0A 2ABYA 2J9CA 2XNQA 2UVWA 3JSMA 4ECUA 2L9DA 1U2FA 2OAUA 5EUHA 3UCGA 2F3JA 2DGSA 2HNZA 1FKPB 2JEJA 2VG5B 3KLEB 4M5DA 2R7RA 2W7AA 2BZ2A 4HI1A 4WCEQ 1X5SA 4ELTA 4I2QA 2RDJA 3ICLA 2NUUG 3PFOA 2C2RA 4L72B 1NZAA 4WK3A 2RJZA 2DNOA 3EGWB 1X4EA 1JLBA 1N56A 1VIXA 2ZOMA 2N3LA 7FD1A 2UXDF 3N9UC 1E6YB 2B51A 3KLHA 4DX8H 2GMHA 4ITSA 2JEIA 2HS3A 3RRGA 4ECQA 3SDEB 5IXUA 3POTA 4ID5A 3M9OB 1ZZNA 1TL4A 2O3DA 1RGVA 3H40A 2F9DA 2Y1JA 2ATLA 4AXIA 3FZBA 5KG4A 1BWEA 2F8EX 4K0KF 3CD0A 5IQQA 3GB0A 1U1RA 2IJFA 3DLKA 1Q79A 3VAJA 1JLQB 2OTJS 3HF5A 2Q43A 2RD5C 5DLGA 4TLQA 3PX6A 4K4SA 1TV6B 1HFEL 2CPZA 2F7VA 1R0AA 2F8MA 4C3MA 1T94A 1BLUA 2B4UA 3DOKB 3GV5B 3CMAS 4C8YA 2GQQA 2L08A 3P6YC 3FDSA 1NK0A 3DMJB 4OX8A 1F2GA 1HBUB 2AGOA 2BA9A 2CPDA 4RNOA 3RRHA 1EETB 2CQDA 5L39A 1MMNA 2LQ9A 4BDPA 3UQSA 3DXSX 2AQ4A 1FXLA 1Q16B 2RQ4A 1HBNB 4IQMA 2BQ3A 3NNCA 1LV5A 2VG7B 4RUHA 3F56A 3RW7A 1RISA 3FQKA 2C2EA 4G1QB 3VTIA 4F4XA 3FQLA 1IKWB 1ZPWX 2KM8B 2ADCA 2WSEC 1RYRA 4OHVA 2PI5A 2KDOA 3QJLA 2RS8A 3D0HE 1RI7A 2RRNA 1RT6A 1Y7PA 1NH7A 4F3QA 5EGYA 1MW7A 5E3CA 2R2RA 1KVJA 3H98A 3HHEA 3LWLA 4OHZA 1Y00A 4EYIB 1FJGF 3JTOA 1HHTP 3IG1A 2FVPA 3PV8A 2XI2A 3F41A 1UA1A 3UE2A 1JLGB 2XSJA 1WD6A 3JAMY 2OH2A 1JLAA 3I9V9 1HBOB 5AXNA 2FPHX 1U47A 3DYAB 5L9XA 1REVA 4N8OA 3M1VA 3S01A 3T1HF 4FNIA 3I5BA 1K9MT 1TKZA 1WF0A 4OX9F 2V4QA 1HQEA 1C1BA 3PKMA 1K1SA 5SUHA 2VPXB 2MQLA 4PG4A 2XLIA 3NMRA 2JLGA 4DF4A 1VRTB 4NLYA 4O44A 1KSPA 1YGYA 3I9ZA 4N76A 5I42A 3TUIC 3D54A 4PG8A 3S8SA 1EP4B 2DNYA 1UJ5A 3BS9A 3QIPB 5J2MA 2XULA 4GKKF 1FK9A 2YNFA 3WC0A 5K8PA 4ZVFA 4MKYA 4DSIA 2BABA 4Y2IA 3PZPA 5KT2A 4R8UA 1CEZA 2D7SA 3R5DA 2IC3A 2AX0A 2W9CA 4NYOA 1JLFA 4WE1B 4WIIA 3TAMB 2E9ZA 2GMLA 4HH1A 5HLFB 3KK3A 2C3MA 3MD3A 2AF6A 2IM2A 4NMLA 4U7UK 2DBBA 5KFYA 3W2WA 4OZLA 3KHRA 3VAMA 1L3SA 2YVSA 2YNGB 2PI4A 3MTJA 2FJAB 1K8AT 2ROPA 3PHEA 2YNHA 4NX9A 1YG0A 4B3OB 2P9CA 5AXMA 3ENWA 2OD4A 1GT8A 4Y2KA 4UY85 3QPIA 3KLGB 2IYGA 2UVVA 3DLGA 3H5UA 1S4FA 3WC2A 2WONA 1NK9A 3A8EA 2DH8A 3OPKA 4C4WA 4WFNQ 1QM9A 2YWKA 3G71S 1YI2S 2JOQA 1RT3A 1T3OA 5FIIA 3DLEA 3S1TA 2GJIA 3CCVS 1HWJA 1BQNA 1JXLA 2EFNA 1ULRA 5LL6d 4DOZA 3KK1B 1HMVA 4ED6A 2E5LF 2YX1A 3GIJA 1NHUA 1NK4A 2W7PA 5DQIA 2QYCA 2ZM6F 3DGPA 2D3UA 3OLBA 2XGPA 3OJUA 3I5AA 3NBPA 3AY0A 3I0RA 3OL8A 3V81A 1QAIA 4KGMA 2ASLA 1QE1B 2DR9A 4ZCMA 5AE2A 4NLGA 2F40A 1XMOF 2QA4S 1UJ4A 1JLEB 1DRZA 2AGPA 5T41A 1S1XB 1X4DA 5DDPC 1S1TB 2JZ5A 5FD1A 1U48A 4F4KA 2QIFA 3FRYA 2R4FA 3TA0A 5C25B 2PSZA 2BM1A 4USJC 3UD4P 4PQUA 2VPWB 2QSWA 4O3QA 3RYLA 3J80Y 2P9EA 3CJ2A 1RDRA 3LPYA 1RT7A 3GMGA 3TVYA 2W8KA 4J9QA 2XY6A 1JX4A 1SKRA 1ZAXA 4NLRA 1XNRF 2HIQA 2MKKA 3IBWA 4HYKA 3RTVA 1H7XA 5B0GA 1IXKA 3HHDA 2Z0GA 2PDAA 3E51A 5HROB 2NUHA 4CNYA 1FEEA 1Z2LA 5DJBA 3RAMA 5FDLA 3HM9A 4D3HA 3S6EA 4K4ZA 1G2EA 2M8HA 4HLBA 3LO3A 4LUBA 4A8KA 3RB4A 1TFYA 4NLVA 2KVIA 2OPRA 3UNGC 5J2QB 2F8HA 5E3AA 3CCLS 2HWHA 2M9KA 1CQMA 3VAFA 3I55S 1RQ0A 1RT1A 4Q2MA 4F25A 1L3UA 1S6PA 1X9MA 2R7XA 5KFQA 4CH1A 2NS1B 4A8OA 2MKCA 3Q8PB 5DM6Q 4R0EA 3CCUS 4B17A 2ZH6A 5F8NA 2DITA 2NREA 4LSLB 1R8PA 2DHGA 4KQZA 3MM5A 3K57A 2RILA 5I3UA 3MHYA 2CQ0A 1FE0A 1YJNS 2XMTA 1GAOA 5DGAA 1FEHA 4QWCA 2IM3A 4RW9B 1TK0A 1J5OB 4ZPVR 2JEGA 2J76E 2NQPA 2LQ5A 1V6HA 2CQ4A 5F0WA 4B3SF 1KD1T 2DO4A 2DNPA 2W9BA 3M8PA 1QTMA 1R43A 3H4DA 3LP0A 3MAQA 3PW7A 3GIIA 4PXBA 4C0HA 1FKOA 2KYZA 2DTJA 5D78A 5HBMB 4QPXA 4KPYA 2AJ4A 3GWCA 4CO1A 3GIKA 3JSYA 2R8HA 1VC5A 1VC0A 1SJ4P 3B82A 3D28A 2KHDA 3K7RA 1IBLF 3UFCX 4A8MP 2XY7A 1Q53A 1RT4A 2U1AA 1J5EF 5F8GA 1J2VA 1S1VA 4B9SA 3HJFA 3VAIA 1M5KC 4WTYA 1C4AA 4ED8A 2UP1A 3VCDA 4HHJA 4JI3F 1LWEB 1SJRA 1SJFA 1SUQA 2CFXA 2Y1RI 1VI7A 4DN0A 2A2CA 3V4IA 2CQHA 3TP2A 4AE5A 1U6ZA 1K1QA 4X4UA 4OZ5A 3PW4A 5DO2A 3M2VA 4KKOB 2X51A 5IFMA 2KYXA 3DOLB 4LIWA 5KFMA 1UWBA 2M3DA 3TW0A 2MZTA 4F50A 4MAKA 2OIHA 5M2PA 3V6HA 4PWDA 5A0YB 4DQSA 1AROP 3A1YG 2NSCA 4N5SA 1FKAF 1X9SA 4B3MF 1OS5A 2BXJA 3T6BA 3MM9A 4UW2A 3BO4A 1XTZA 5DLFA 3IR7B 1DTTB 3M6VA 4NLOA 3MR3A 4DL6A 1RTDB 1C0UA 1X8DA 2LQBA 1TL5A 3AH6A 4NLTA 5T7LB 2V4JA 4AL6A 2HMIA 2GW8A 3C46A 3FCHA 4J5OA 4J9SA 1KC8T 1FJ7A 2OSRA 3C6TA 1UEVA 5L1LA 2ZDPA 4YR2A 1HA1A 3U1LA 4NZ0A 1NJXA 2AD9A 3MUMP 4ZPTR 3C66A 4MYUA 1NAQA 2C3OA 1XR6A 2EVZA 3UDCA 3JYTA 4LFCF 4IDKA 4O3NA 4GC7A 4OL8A 4QYRA 3N6MA 2DGOA 3P3DA 3PRDA 4CH0S 1FD2A 5AXKA 1YVFA 4XDDA 2YKMB 4RBUA 4QWEA 4QYZJ 2EWHA 1LK7A 2F9JA 5CHCB 2K3IA 1F60B 4GMKA 2R2TA 2RU9A 5ITHA 3HFKA 2J9EA 3CCQS 1XR7A 1Y3JA 3D0IE 1BC6A 1R89A 3PJXA 1FXRA 3AJ2A 4P7VA 4C11B 3JSMB 1FJCA 1JNZB 3TUJC 2F1FA 1UP1A 3RU0A 4X4VA 2I1RA 2JEFA 2QMWA 4M5DB 3LF0A 2CPXA 4NLXA 2CJAA 1CC8A 1RK8A 3LGMA 2MZ1A 4DR3F 3VAHA 2ZH4A 2ALZA 2LQJA 5KFGA 2ZHAA 3HHLD 2AYMA 1U6FA 2HWTA 4NLDA 1BGXT 2BANB 2I5JA 3UWTA 4URGA 4DG1B 5C42B 1LK5A <