2GNKA

Glnk, a signal protein from e. coli
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
95
Chain Sequence
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GlnK, a PII-homologue: structure reveals ATP binding site and indicates how the T-loops may be involved in molecular recognition.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords PROTEIN (NITROGEN REGULATORY PROTEIN)
total genus 21
structure length 95
sequence length 112
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gnkA00
5DS7A 2RD5C 4RLEA 2J9DE 3TA0A 4CO5A 2ZOMA 4OZJA 4D3GA 1NH8A 1KR4A 4ZK7M 2O67A 3LF0A 1UL3A 3BZQA 2CZ4A 2EG1A 3T9ZA 1VFJA 4NYOA 4USHA 4NYPA 1Q1KA 3CE8A 1GNKA 5L9NA 2NUHA 1UMJA 4RWWA 4CO4A 2GX8A 3NCPA 2ZFHA 3TA2A 2JJ4D 1NH7A 3AHPA 1UFLA 4R25A 1VHFA 2NUUG 2J9EA 4OZLA 2J9CA 2J9DA 4E98A 2V5HG 3AA9A 2DCLA 3M05A 4RWXA 4WK3A 4CO1A 1QY7A 2VD3A 4OZNA 4RX6A 3O5TB 3NCQA 1V9OA 4CO3A 5D4NA 3OPKA 3GSDA 3AH6A 4YB6A 3NCRA 1PILA 4Y6IA 2PIIA 2O66A 5DRKA 2XG8A 1NAQA 4USIA 2GNKA 4WK1A 3TA1A 4CNZA 1V3SA 2XZWA 3L7PA 4Y65A 1O5JA 1V6HA 4YB5A 1HWUA 3MHYA 2XBPA 3O8WA 3AA8A 4C3MA 2GW8A 2Z0GA 4YB7A 4CO0A 3N5BA 1J2VA 4AFFA 2EG2A 1O51A 1NZAA 1XK8A 5D4PA 4C3KA 4CNYA 1UKUA 4C3LA 4IYQA 4USJC 3DFEA 1V3RA 5D4OA 3X3UA 2E66A 1OSCA 2XULA 1H3DA 2NS1B 5D4LA 4D3HA 3HLUA 1P1LA 4CO2A
chains in the Genus database with same CATH superfamily
4LFAJ 5KFDA 5SZTA 3J80U 4UUWA 1UJ4A 2KT2A 3AJDA 5HROA 1N0VC 3V6DA 1T9XA 1FJEB 3SI8A 1RAAB 4QIGA 4DSFA 2RUSA 4IO9Q 2DNMA 4CLPA 1JMTA 3L95X 4B3OA 3IRXA 2Z2MA 3QWPA 1KRPA 1TAQA 2ROEA 2VG7B 4OYIA 3VGUA 4ECWA 2NYHA 2C3MA 4X64F 1NK7A 3CC2S 3ETOA 1V3ZA 2ZH2A 2QG9B 3OTDA 1VC0A 2WOMA 3ENWA 4NA3A 5ETSA 3W8GA 2OMLA 3DLKA 3CC7S 3K5PA 1OY8A 3CCSS 4EZ9A 3D6TB 3R9LA 1FX4A 2B9EA 1IQZA 4RWWA 2V34A 3TZXA 1RYSA 4CO4A 4JI7J 1LFWA 3NWGA 2NSCA 3MR3A 4DV3F 2V8PA 2GMJA 3QLHB 4UQTA 3ZNJ1 5U47A 5D3GA 3OTOF 4PWWA 1IKVB 2BJEA 2OKQA 4NA1A 4WP9A 1VBYA 1HPZA 1IXKA 3AODA 4MFBB 2GHPA 2A1BA 5D77A 4AXJA 3OHBA 4A8YA 4RR5A 2VV5A 3NGTA 1YJTA 1UA0A 1M5OC 3C46A 2FGCA 2ZHOA 2IBKA 3FK4A 3QWUA 2J6TA 4C2MA 1TV6A 1WI6A 1RZMA 4DR7J 2YNGA 1X5SA 4ITSA 3H4DA 3UDCA 1QLNA 4M63A 2KXHA 2MPUA 3M05A 4LVNP 2I8EA 3VGSA 2QE5A 4JI2J 3QJLA 1D1UA 3HVWA 4DR4F 2Y3YA 3PKMA 1GQEA 1R43A 4DLGA 2N7CA 2HKEA 3NBPA 3TAMA 5J1NA 2F7VA 3BSCA 2HVZA 3PJWA 4FBUA 3EDQB 3E01A 1KONA 1Z1ZA 3U27A 3BDEA 3DOMA 5ETOA 5L9XA 4B3MF 1WHXA 2O1PA 2ZWOA 2NXUA 1IBLF 4W4MA 3ENQA 2F40A 5LJ5Y 4C8YA 1EQMA 3GG0A 2BQUA 1F1BB 3TW0A 2QFIA 1YJWS 1D09B 2H9ZA 4U9RA 1UVIA 1D8YA 1VRQC 4USIA 4QWCA 3OL8A 5BYQA 2B56A 2D9PA 3DLKB 2C2RA 1RWUA 1GMUA 2FQQB 3ZTSA 3PR5B 2GQ2A 1KN6A 2WTFA 3KJNB 4K4YA 2CQPA 3LW5C 2B5JB 5C24A 3S7RA 1SQFA 1EKSA 1YBAA 1N36J 4ED4A 4N41A 5LXRA 3HHLA 3N0VA 2DNRA 4QIWD 2APOA 4DU7A 4I64A 5DG9A 3O8WA 4U7UK 4WKYA 4CLTA 4WFXA 4CT9A 4ECUA 3W3SA 2XLKA 1EIYB 3MCSA 3MOZA 2E5LJ 5C25A 3BO3A 1DFDA 1VK3A 2QA4G 2C22A 2FJDB 2VPXB 1QSLA 4O3RA 3K5MA 4C3KA 2G0CA 2CJXB 1ITPA 2RH3A 3WX8A 3J7YI 1PKUA 4RUCA 1N33F 2BW7A 4USKA 3M1VB 1FFSB 3V4MA 4DOZA 4DX5A 3RTVA 2DNQA 5J2QB 1IBKJ 2DIVA 2HZVA 3HSJA 2GVZA 2FIUA 1WC1A 1XEZA 4WTOB 5KFPA 3WC2A 2VQFF 3MUTP 3QYYA 1HWKA 4USJC 3TVYA 4F8RA 1SVDA 2UVWA 3G6XA 1DARA 3LOUA 5IFMA 4U7UD 1OSCA 2A2DA 1UCNA 1WC4A 2BJ9A 4ECXA 3MZIA 3KK1A 4C8NA 1H3DA 1ZBTA 5LSOA 3C66A 3UWTA 2DT9A 3LALA 1S76D 4B3SF 3HLUA 4CH1A 4LREA 3RW7A 4N8NA 4DI6A 1S72S 3DRSB 1I1GA 1U1QA 4PUOA 1BLUA 3JTNA 4F3QA 4PG5A 2E7VA 3W5XA 3A3PB 4FPRA 1RKJA 3NXZA 3OV7A 4KGVB 2KN4A 1TUVA 3QT7A 2WSFC 4LVOP 1Z2ZA 3HF5A 1UJ5A 1KTQA 3THPA 4BBYA 2CPXA 4YQWA 5HBMA 2L9NA 2HZCA 1HBUB 1SJRA 4M5KA 3RAMA 1Y0HA 1VISA 3EVWA 3TJAA 3J81j 1FXDA 1SQGA 1TVRB 1ZA1B 3ICLA 4HACA 4HEA9 2V9KA 3LWLA 1WHYA 1VQKS 3HFVA 4NYPA 2WBRA 3GJSB 2LQ5A 1MW7A 2DNNA 1XTZA 2I5JB 2D3ZA 2WB1D 2WW4A 3K7RA 1MMDA 2OLWA 4QJVA 3I0RB 5EWFA 1MU2A 4ZDNA 3G9CA 2GS8A 3RUBL 4WP3A 1LKZA 5IXUA 2CYYA 2AF6A 2HHTA 5CYMA 3PW2A 2C2NA 5F3ZA 4OZ2A 1K0VA 1WKJA 3TA2A 3DLHA 1NLKL 2DHGA 2HK2A 2CVEA 4O3OA 1NH7A 3ZFVA 5IWAJ 1E6YB 2W7PA 4IR1A 2ZDPA 2YQ0A 2QV6A 1EQ0A 5K8PA 2MZ1A 4CLKA 4H4MA 2RVJA 2J9CA 1F9FA 3DRSA 3JSBA 2DHAA 2EFQA 1EZZB 1RGVA 3O44A 4ZCKA 5A76A 1BGXT 1K0TA 4MKYA 4KFBB 3M2UA 4NRUA 4QIEA 2G1DA 1E6VB 1YRTA 2LEAA 1TL1B 5KFZA 3TO8A 3CJSA 3H40A 1CJTB 1NK0A 1Y11A 5KFCA 1NKCA 1SC3B 2EFOA 2M88A 2W9BB 3TARA 3CMAS 1HI8A 1WKKA 1LQ9A 3G86A 1KKHA 2AEJA 2QX0A 4DU8A 4EU0A 3PIPQ 4J9SA 5JVGQ 4GO5X 4HH1A 4WBFA 2KL8A 2R9LA 3VR1A 3TI0A 5L39A 4TY8A 3LO3A 1H2UX 1BD6A 2DGSA 2LQJA 3FCVA 3W65A 4C48A 1B64A 1F0XA 3QBCA 3RJMB 3CD0A 4ED7A 4DV3J 3TA1A 3P8BB 2Z2YB 2DPJA 1B0VA 5K14B 2LDIA 3AD8C 3DRRA 2PSZA 1V6HA 5JVHQ 3PRVA 1FD8A 4C4WA 4LSLA 4LF1A 3WX4A 4P75A 2YQ1A 1Y00A 2BACA 2DNGA 2IYIA 2YQ3A 4ANDA 3GIRA 3VAJA 1BQNA 1FKPA 3ZC4A 1ZM9A 4WFZA 1ZOTA 5KFYA 5KFJA 1NDPA 4ECZA 3VQSA 1BWVA 2F9JA 2E1CA 4F50A 3MM7A 5KAKA 3BKFA 3T5LA 1S6OA 1VBXA 3HVTB 2UV8G 4DSLA 2P2CB 4DG1A 3W60A 3BDPA 4LF6F 2W2MP 5KFAA 5IV3A 2QLBB 5KFMA 4EO8A 4LQ3A 2WB4A 2NZCA 2W4CA 2X3DA 3MI7X 4NLPA 4KC5A 1P9QC 1U6FA 3HKWA 2HBZB 4L76A 3T1AA 4XPCA 3V6HA 1U1RA 2QYGA 2DR8A 1IR2A 2EI5A 2B0GA 2OP5A 3D0HE 3I5CA 3G8QA 4ILRA 4WJBA 1DJ0A 1U7LA 3D28A 3LGNA 2RT3A 1X60A 1VBZA 1RT4B 3FBFA 4U96A 3TYTA 1H6KX 2AEMA 3WIUA 3KK3B 4ZOSA 1RTDA 1ZH5A 2XY7A 1AROP 1UVJA 1NJIT 1CQMA 2ZE2B 2BM1A 1TL3B 3KUHA 1FESA 3OD2A 2RILA 5KFKA 3G82B 4DX6A 2MKIA 2HIYA 2HMIA 3CJQA 3I6PA 3SMZA 2XMAA 2DHXA 1VYAA 3J7ZT 2WHOA 2XZTB 3C6TA 2W9CA 3GPAA 1YRXA 3U1LA 1A7GE 1MN9A 4Y28C 1FK9B 3KLFA 4DQIA 2V2VA 2Q66A 3J7AN 3GMGA 2DNZA 4FVMA 4XK8C 4ZCLA 4C8OA 4DR4J 2QLXA 2W4DA 4NLXA 4Y2CA 5I3QA 3MPDA 1NSKL 5E41A 1U1OA 2UUBJ 4UF4A 2MZSA 4ICLB 4S0MA 3M9OB 3GIMA 3Q23A 2M8DB 1W26A 1WG1A 4LF7F 2DKOB 4QZVB 1RT6B 1GXLA 2GJ2A 4E8UA 5IT0A 2PD1A 1UAWA 4ZMMA 2LQBA 4UOCA 4J91A 2EFNA 1UMJA 3M9NB 3HM9A 4RW9B 1YI2S 2ERRA 4QOTA 1QVFR 2R2SA 3UN3A 4XDDA 3I82A 2EEYA 3QRPA 2GMHA 2CG4A 3Q22A 2BBEA 3EXYA 3ONQA 4ZJOA 1NRKA 2IM3A 2MB0B 4FF3A 3DDNA 4A8XA 3WHIA 2XS2A 1S1UB 3FEXB 4M5IA 2DH7A 3E8OA 2A10A 3PCOB 1N34J 5GADU 2K3IA 4QW8A 3DOKB 5HROB 3MR7A 4GMKA 1CJVA 5K14A 3MCNA 2CPDA 2GO9A 3UCZP 3W64A 4DFMA 3U02A 2V4JA 2VPWB 3CT9A 2HFOA 4IOBA 2X1BA 4I2QB 3J81U 2VU5A 1FXLA 3O6QA 2CQ0A 1T11A 5BYRA 3A8IA 1S1WA 3PJ9A 1Y9OA 4UTGA 4ECQA 3PVXA 3FC9A 2R7OA 2QIFA 2UUAJ 3PW7A 2W8LA 4F36A 2DGQA 3IG1A 5FIIA 4YY3F 4F2RA 2F8EX 3D6FB 1U4BA 2XNRA 2QN6B 2W25A 3PNIA 3HHLC 2CFXA 5D0RA 1X4BA 3ZZOA 2DO0A 1C4CA 2OMOA 4K4XA 2ZBCA 5B7WA 4DV2J 3TUZC 5DO2A 3F0NA 4LF4F 2DR7A 4LMZA 3MUVP 4H4KA 4WF9Q 1KP6A 2YX7A 2XZWA 4DEZA 2P6SA 4OJHA 2YNGB 5ETVA 4A8MP 2HQDA 2ZH5A 4X4SA 2OEKA 3R5DA 1VIXA 2NXCA 3ADAC 3GILA 3LWMA 4OX6A 5FD1A 1QVGR 1F9HA 4ZPVR 1BC6A 2RS2A 3UCGA 2C2MB 3Q8YA 4KHPF 1QAYA 2R4FA 3N5BA 4LSZB 5T41A 3N9UC 1DY3A 1RWXB 4OYPA 3Q8UA 3M2RA 5AXMA 2CZVC 1RT1A 2H5JB 2XZDB 2J6UA 1N54B 1ZM3A 1OJ4A 3KNGA 1ZTWA 1JIHA 1XC9A 1UEKA 3PEJA 4UOGA 3MD3A 3ISNC 1WF1A 1JLQB 4LF7J 4NI2B 1YZ6A 4YP3A 3IN5A 5GAEU 4X4RA 2RDJA 1HQ2A 4P6QA 2LKZA 2MQPA 4IYQA 1S1VA 3MMCB 2VG7A 1O8BA 3QJJA 2QA4S 1UPMB 4OZ3A 4Y2KA 2LXFA 4I4BA 4YN3B 3BR8A 1RT2A 3PO5A 2OPQA 4IFYB 3CF5Q 2D3OR 2WONA 3H2LA 3DDIA 3TVKA 1QAJA 2FJVA 1TL7A 4I6WA 1S9FA 1F2GA 3AD7C 3T19A 1IJEB 2J76E 2C3OA 1M0SA 1FF2A 1F6TA 1T3OA 2DGVA 3K8VA 5E0OA 4X62F 1RT6A 5HVFA 2ZJRQ 1U6ZA 4DR1J 2YKMB 3GCWP 5KOXA 3NRBA 1Q79A 1X9MA 2AJ4A 1S1TB 3A4TA 2KRBA 3LTOA 2XI3A 4CP5A 3B54A 2AHOB 1N52B 4TYBA 5HI7A 2B3TB 2ZM6J 1S1UA 3G6VA 5KG5A 4DSEA 1K8AT 1TFWA 1HNVB 3DXSX 4H4OA 2M9KA 1SL1A 2G9OA 4ZK7M 5KFWA 5ETPA 4X2BA 1HNXJ 2CZ4A 4USWA 4WIQA 1F9EB 2JFKA 3DRXA 4DWIA 5IM0B 1S79A 2E1AA 5G4DA 1JJ2R 3TQ1A 4B9NA 3HJFA 3X1LB 2VOPA 4YY3J 5ETQA 1V5IB 5EHHA 2XGPA 3H5XA 4C98A 1NJYA 1GNKA 2UUTA 5F0UA 2AKWB 3S8SA 4IKAA 4AYBD 4X66J 1N33J 3BO4A 5FDLB 3CDUA 5A0YB 4B3RJ 1R31A 4YMEA 4QYZK 3U1MA 3OSNA 2HGNA 3RB0A 4CTAA 2A2CA 4R5PA 2RNEA 1XR5A 4EUVA 2OPPA 3K58A 2UXBJ 1HLWA 3CCMS 1TKZB 2WSCC 4OHYA 1PAUB 2MQNA 4A8WA 1RT7A 1C0UA 3MPVA 1K44A 4P9SA 4RBTA 2MKYA 2BKPA 1UPPA 3PKYA 3BKTA 2FHJA 1ZTTA 1ZYQA 1AUSL 4WU3A 1T95A 2AGQA 3GIKA 3D0IE 4EFAC 2XY5A 4MKVA 3M8RA 1SIWB 4CRJA 1TVRA 3GWCA 3UNYA 3NOGA 9RUBA 4XO0A 3FVYA 1ZETA 2XHCA 2XSFA 4NYZA 4F4AA 4V19J 1CJUB 3RR7A 2R2TA 3UDEA 3BREA 1U48A 2R8HA 3MXHP 2KG0A 5KG4A 5J2PB 3Q2SC 1T9WA 2KJWA 3GLJA 4Z7CA 5A8RA 3RAQA 4X62J 4A48A 2CQCA 5DRKA 1G1XA 4DPUA 2X51A 4I2QA 2NXJA 3FQKA 4L74A 4F7VA 4ED1A 4OYMA 3C15B 2AYGA 6AT1B 2FVPA 4DCOB 4P72A 3KJVB 2WBMA 3CULA 1XNRF 2ZNYA 1HWUA 2YBVA 3FFIB 3MHYA 1RHMB 4QPTA 5D0HA 4JV5F 5FJ4A 1WSRA 4QYZJ 3VWSA 4DPTA 2V2KA 3OUYA 1NPPA 1R27B 1IWAA 2WVFA 3HP6A 4NCBA 4K8RA 2DYAA 2RJZA 4N47A 2FJEB 3LP2B 2Z0GA 2VG6A 1M1HA 2VFSA 3K2YA 3NLCA 4JUZA 2J0WA 3D54A 4J9MA 2C42A 2AW0A 1SKWA 1M1KT 4ED2A 1U6BA 4KKOB 4MMOA 2IMOA 1U1KA 2UXDF 3CB4A 1NCLA 1DRZA 3JAMY 3JAMU 4DCJB 4CNYA 4KE5A 4TQSA 1FERA 2ZD1A 4WKRA 1CULA 3B82A 4OMFG 4Y2MA 2KXNB 5H9FJ 3KHHA 1NK6A 3MEDA 4PG4A 1UZHA 5H9EJ 1W7WA 3OL9A 3D1HA 4J9QA 1RTIA 3GJQB 7FDRA 4DV5F 4A8SA 4JI7F 4RNHA 2LECA 3T1HF 4LF4J 3QO9A 4DL7A 2KZZA 4G1QA 5M2RA 4KGKA 3HFZB 3DMJB 3WBZA 4QYRA 1GK8A 3BGFA 2J0QD 1OMSA 2HFNA 1RE1B 2R8KA 2YKNB 2VF3A 4GVBA 1MU2B 3UNGC 5K20B 1HNZJ 1RABB 4XPEA 2BR0A 2ZBRA 5KG3A 5LL6d 4TU9A 3VGTA 1NBEB 4RLEA 2WONB 3PZPA 3T1YJ 2VICA 1K73T 4DR7F 4MKAA 2FHMA 3BSAA 1TL7B 3N01A 4KQZA 4LRBA 4GKKJ 2XCAA 2OUGA 4P2SA 4BWMA 1JLBB 4KY3A 4CH7A 1E6YA 3DRPB 4NASA 1YLXA 1DLOA 2KFZA 2MZQA 2ASJA 2CJYB 2PMHA 3CMQA 3CCES 4XIUA 2ZOFA 1H38A 4ZITA 2Z2ZA 3NGKA 4JI3J 2XS7A 5B09A 2LYVA 3PYDA 4FYYB 5DQHA 4ENOA 3ULHA 1JLQA 4BHQA 4DDFA 2ZH6A 4PG6A 4O44B 4RW8A 3M32B 2F8MA 4FKXA 3K17A 4NL5A 2JEIA 5I3PA 5B0GA 1Y5NB 4FPIA 4AT1B 3DCAA 3AFGA 2DRBA 2GIFA 4RPFA 3ELHA 4N76A 2DNOA 3IFEA 2E5LF 2ZWPA 4OI2A 2KRRA 2ZITA 4F3MA 2RMLA 2BJ8A 2MKHA 4O4RA 1FRKA 4DPYA 1C1BA 3L4BC 2DXDA 4RZRA 2MHEA 4E98A 3H5YA 2MYFA 2QO3A 3KKFA 1NK8A 3DRRB 4ETXA 4PEOA 4K0KJ 2DNLA 4NWBA 2QJ3A 3OR1A 2XWYA 3DM2A 4Y34A 4B3TJ 4LUBA 1RCXB 4WK3A 3UO0A 2JH3A 3TZZA 2PA8D 2AT1B 3TP2A 2VUGA 4B3SJ 2VL1A 3CXCR 2KJVA 1FJGJ 2YPZA 3D6MB 3GV5B 1JLCB 3KLEB 2KFYA 1RT5A 3DRYA 3P5BP 1V9OA 1RTHA 2DB1A 4DV1J 1SL0A 4JI6J 1S1WB 1HNWF 3ZZPA 1R6YA 3DN9A 3HCXA 3V5RA 3W7BA 1YQHA 2IFXA 2D41A 3IO1A 5B0BA 4N56A 3AJ1A 4JI8F 3F73A 5ITHA 3C3LA 1MG7A 2PI4A 3EPIA 2NPFA 3OR2B 4C8MA 1OY9A 1QE1A 3PRBA 2ALYB 2B51A 2GHWA 1GTHA 3CJTA 1NMEB 2RU3A 4OIXA 2CQIA 2VIHA 1BY9A 3BJYA 1UW9A 5D0GA 1B0PA 2V67A 1YKWA 4L6V3 4YB5A 3I56S 3KTQA 1O0PA 4YHHF 2U2FA 1RKIA 4M5DA 4YFUA 4C8ZA 1LXNA 3QJPA 2OTJS 4PR6A 2CPIA 5DM7Q 1NPKA 1D9AA 4PYDA 4EI2A 3F44A 2H3EB 4P7TA 4YB7A 1M1GA 2H1YA 2QL5B 1JKHA 4K4VA 2HHXA 4AFFA 4IH5A 4A4JA 2RHQB 3W61A 3CJ3A 4QIFA 2MMYA 1HNIB 2PA3A 1XK8A 2HHVA 5GAEI 1NUEA 1CSJA 3HHDA 3RYLA 5HSPA 4K50A 1FRXA 2VZ9A 3CCVS 5C5JA 3R5BA 3IA0A 2E9TA 4KHRA 4YS2A 5LJ3Y 3PO4A 2GA7A 4B3MJ 2UUCF 4K7QA 1AUDA 1HW8A 3VZIA 2HVIA 4HVZA 3QGIA 2X1GA 1KHWA 3LP2A 4HACB 2DJWA 4OV6A 4OQJA 4UW2A 2C3YA 3R8YA 3TX8A 1Y5LB 4LSNA 2V94A 3IWLA 4J5OA 4DV0F 3GV8B 2ZUGA 2LP4A 4DLEA 1SI9A 2QTWA 1SV5B 1Q82T 5BJRA 3DLBA 3US5A 2ZZMA 3RBEA 2HVDA 3EGNA 2ROPA 2HQ3A 3CCTA 3EXCX 5DDQC 1B99A 2V8VA 4AQYJ 2KVIA 4LFCF 2QEXS 2EBGA 3MM9A 4FXVA 5HVGA 3Q8RB 3ETMA 5ETMA 1T3NA 1TL3A 2AGPA 1IKWB 4LIRA 1VIOA 1XNRJ 1UJ6A 4WTYA 4WYWA 3PACA 5B0DA 1RHKB 5L1LA 2IAJB 4GKJF 3KJQB 3M8PB 1T9YA 1WOPA 3DDKA 2UXCF 5IC4B 4ZPBA 1SJ1A 4M5NA 2QLJB 4TQRA 1N48A 1K47A 2MKJA 3FQLA 4RNOA 2ILYA 2V0NA 3UD3P 3MF5A 4Y00A 2MLZA 3AOAA 2ZOGA 3QFWA 1RTJB 3J81Y 4PYAA 3ITHA 4KR0B 3OR2A 4ZJQA 1MLAA 4OYOA 4DN0A 5IV4A 2W2OP 1TTHB 2BJ1A 4OZ0A 3AOCA 3S6EA 4OJ1A 4JV2A 5DLGA 2X1FA 3CD7A 3RG6A 1DQAA 2DNHA 3GR0A 1M5KC 3JQKA 2CDQA 1SB6A 3LAMA 2PMWA 4J90A 1LNQA 1UWBB 3L7UA 4KO0A 2K1RB 5D78A 4G1QB 2V4RA 2R8IA 5HP1B 2AD9A 2OPPB 2GHVC 2C2KB 2ZDOA 3IRXB 2CPFA 4FYXB 1NKEA 4PPDA 3KUEA 6FD1A 3MDFA 3T1HJ 1VHFA 4QWEA 3NS5A 2ZD1B 1C4AA 1ZZFA 3TAPA 2LQ9A 2IDLA 4OYWA 2AJFE 2JEFA 4DQSA 4B9TA 4NZ6A 2MSTA 1HYSB 3VCDA 4KKOA 2RRAA 4KAIA 1U2FA 5CD4H 5HQ8A 4JI5F 3R5CA 1LWEA 1N32F 2PC6A 2EBEA 2Q3PA 3C8YA 1OY6A 4LR8A 1FXRA 4RX6A 2H5IB 2J5AA 2MLXA 4IRDA 3IWXA 3UDVA 1U0HB 3ZZTA 3QIPB 1AB8A 2HRTA 5D4NA 4ELTA 3UR0A 4F4XA 1JLGB 1VMBA 3WZ0A 4U67Q 1S0OA 1L3UA 4O23A 4IG0B 2HS0A 3V2UC 1S1XB 2LU1A 2BE2B 3UR3C 1IM6A 1IR1A 1NAQA 2VB6A 1YDLA 2ZHBA 2CDRB 1I6JA 2F4VJ 1T9TA 3MPWA 2YKQA 1V3SA 4LRFA 3UE2A 1VC6A 5C2CA 5EX3A 5LSRA 3BR9A 1VQLS 3CCRS 3EZOA 4CLYA 4OI4A 1B7YB 4USUA 1LW0B 5GMKa 1F5BA 1HD0A 2GIQA 4FYVB 3SCJE 4DR5J 3UN5A 4X65F 3QGGA 4QIVA 4JI4J 2OFGX 2PGCA 4LF5F 2HFVA 2V6AA 2Z56B 4HI1A 4EZ6A 1FNMA 1YX2A 2OHDA 2Q6BA 3G87A 2YXLA 1S0VA 4FN5A 4ER8A 3GU0A 4OZ1A 5K8NA 2RE1A 1F2HA 4GKJJ 5F8IA 5A8WB 1DQ8A 1S9EA 1N5SA 1U26A 1SH0A 2RDDA 2VFUA 3VZHA 2FZKB 2VPYB 3BGRA 3W9JA 3NAHA 3BGRB 4GC6A 1KSPA 2MY8A 1NSQA 3HVTA 4RW8B 4ZPTR 3MUMP 1T03B 2BYCA 4ZVRB 3NOCA 4FYWB 2BQRA 4NPOA 3MD1A 2WOMB 3NMRA 1VGYA 3VVUA 1U1LA 3FRZA 3TJ8A 1D9FA 4OI6A 2DRDA 2R3VA 4QWAA 3PR4A 4EBEA 4DR6J 5HBMB 4DR2F 3OVAA 1U0HA 3I32A 3MAHA 4PXDA 2DY1A 1NEEA 1YJRA 1REGX 2WVBA 1NKBA 1YBUA 4RW7A 2OPSA 1S6QB 2FHKA 2N7YA 4L3KA 4P71A 3ZZRA 3KLHB 3W5ZA 4X4OA 5A8KB 1S6UA 1KOOA 1HQEB 1ZZNA 2OIHA 1NK5A 2B4OA 3M8WA 2EFPA 2AGOA 1IR0A 1P1LA 3PW4A 1WI8A 3CJ8A 4K4TA 1TKTA 3EGVA 5CH7B 1S49A 4F2SA 2JX2A 4F02A 4L72B 4EBCA 5HL7Q 1VRUB 1BE4A 1P8GA 4CIOA 5B0EA 1DURA 1LWFB 1TKXB 3TZYA 2BRKA 3QNWB 2YKAA 1KR4A 4I69A 2VA3A 2A6OA 2XEXA 1FEHA 1Q5VA 2IPOB 1WEYA 4RNFA 5LT5A 2M3DA 4KH0B 4U8VA 2LA6A 5CYJA 1WKLA 4I1TA 3E2EA 1UZDA 1REVB 3BGUA 2DPIA 2AQ4A 2K2PA 4BC9A 1CULB 1XJWB 2WZ1A 4O3QA 4V19X 1HQUA 1LW2A 1RT3B 4M5JA 3KK2A 1ZPVA 3KHGA 4PXCA 1X31C 1FFGB 5HANA 2ZE2A 1IWGA 2B4UA 2IVMA 3SQGA 5KFBA 3TUIC 1KD1T 1H7WA 1FNOA 4NLDA 4I7FA 1MSWD 3HVRA 1BHNA 5KT2A 2RUGA 4ZPAA 7FD1A 1XMOJ 1RYRA 4IOAQ 2AYEA 3M8SA 3NP5A 1JLFB 3OT9A 4FP9A 3DI6B 4NE9C 1H74A 2HQFA 2J9EA 2QYCA 1Y7PA 3HZGA 1DTTB 4M5LA 4NI2A 3RGIA 2XHWA 3D7SB 3ET6A 4ZVOB 2POKA 1VQ4S 3BBCA 4ELUA 5J1EA 3ILJA 3I0RA 3TEGA 4RW6A 1AZSB 1HHQA 1RWVB 1T02A 2E1MC 3MMBA 3FZ2A 2DGUA 2JWNA 3LP0B 4URSA 3FRYA 1QY7A 1RT7B 1U2CA 3HHLD 2W01A 5HVHA 1KOHA 3R7SB 3CD5A 3CCUS 2EK1A 3J80Y 3NCQA 1IKXA 4CO2A 1Q81T 1YG0A 3GIJA 3MR6A 3SZ2A 2B8PA 3GSDA 2X3GA 3KLFB 3FCWA 3W1YC 2RQ4A 2E29A 2VBZA 2Z8QA 3QT6A 5CZXA 3T6JA 4JP8A 1WDDA 3UN2A 4QR1A 1I94F 2E9ZA 1NJZA 3JS9A 3C6UB 3OLBA 1EKRA 2B4VA 4HHUA 3VAGA 4DR1F 1HQUB 1RUSA 1RAHB 3L7PA 3BPDA 5KTQA 3RRGA 1O5JA 4LF8J 3V81A 3JXOA 3HZEA 1N34F 1A6LA 4CLWA 5GAGI 1A0OB 1EP4A 3J7Z5 1D9DA 4NMXA 2KU7A 3JSYA 1RB0A 2C1EB 5K9FA 4AD6A 4XTTA 2G4BA 2K3KA 3IMQJ 4A46A 2EG2A 1VHIA 3QZ8A 2BZ2A 3H0PA 3BKUA 3AQOA 2V4JB 3CCZA 3M1VA 5FDLA 1BWEA 2N4DA 1VCTA 3FDSA 1HQEA 5HATA 1YSJA 1UW4A 1URNA 3IBCB 4NXNJ 1JKHB 5A2QU 4ZN1A 4HTJA 1N5VA 4OZ5A 3OTOJ 3MM8A 4CLLA 2ADBA 1T0TV 3KLVA 2NREA 1R8BA 3C16A 1DTQA 5HLFA 3NS7B 2I9SA 5HLFB 1LEOA 3C14A 4HI2A 4ZJLA 1RLCL 2F65A 1UFWA 4BS2A 3H42A 3HX9A 2V8DA 1KQGB 3HPOA 2DXEA 1CVJA 1JK9B 2OGUA 3PEHA 5D4LA 2HIQA 5L1IA 3D3CJ 1FCAA 2PEHA 5KFVA 2AEFA 4H54A 2YKMA 4DR5F 1JLEA 3W2WB 2B7BB 3IRWP 5A6WA 4DQQA 2CQDA 1QSSA 5DS7A 4ILLA 1MROB 1N5QA 2CNNB 3W8PA 3ZTRA 5DDPC 2GFFA 1RHRB 1RAOA 3N4WA 3HK2A 1HBUA 1Q4RA 2RDIA 2YY3A 3GFXA 2ZEJA 1QUVA 3B4DA 5CQGA 2IDEA 2C2ZB 2EXUA 1NH8A 4ZVQB 2M70A 5KFQA 1T05A 2IAJA 2MQQA 4HHJA 2XNQA 1KBRA 4FDFA 1O6XA 2RIJA 2E44A 2JLFA 5KG2A 2YNHB 3KHRA 2E7XA 4C6AA 2R7WA 4M8LA 2FLOA 1BXNA 2R7RA 1KNZA 1TAUA 1W25A 4YDXA 1QTNB 4OHZA 3S01A 3D6HB 2ZH4A 4I68A 1VQYA 2OO4A 2NUHA 1MWQA 4K4SA 1PC4A 2JVOA 4ZCIA 5J2MB 1QD1A 2V68A 2ABYA 3BPSP 4LRDA 4RUAA 3M2RB 3KLHA 2B7CB 3BQ2A 4K4WA 1Q7YT 1T8EA 2VG5A 5BXIA 4Q5VA 4F4KA 2KKHA 4TLQA 3SSQA 3VALA 2JJ4D 2YWEA 4LF9J 5CD4A 3AHPA 2O3DA 4HDGA 2FVRA 2DTJA 1NHVA 4MYTA 2XC9A 1WF0A 2K8GA 2QA1A 4Q7AA 1TFYA 2GCFA 3BS9A 1EARA 2MGZB 2IYGA 2ACYA 2DCUB 2JL9A 3D4JA 2CQ2A 3DYAA 3O3LA 1U1NA 3NNHA 3PM9A 2D74B 3PXGa 4CYUB 1MWZA 1GXUA 4DPOA 2FD2A 3T5JA 1WACA 1JNRB 4ZIWA 4R8UB 2R7XA 1WOSA 1R8CA 2FB0A 1Y3KA 3D66A 5EX0A 4QPXA 2CPHA 3QO9B 1JLAA 1Q53A 2FVQA 3DI6A 5D15A 2XLIA 2ZH8A 1UA1A 2JVRA 4RO0A 1C2PA 2QGFB 3KUGA 2AIRB 2ZH1A 4ERDA 3C16B 3DLGA 4WIIA 5KFGA 3LPEA 4ED0A 2O5DA 1XWLA 2EFGA 4JV1A 2GMLA 4F0KA 5EGYA 4ZCMA 2FVCA 3HSDA 2PIIA 5GAHI 1JB0C 1OS5A 3SFGA 2ZBQA 3Q0AA 1SUQA 2AZ3A 2GNKA 3AQPA 1S6PB 2HAFA 1RXOB 2M2BA 3ENVA 2JHEA 4CH0S 1FTCA 3BO2A 1U0SA 4DFPA 1RK8A 4P52A 3H90A 3ZZYA 1ACMB 1WTFA 4X66F 3M2VA 3OTCA 4ICLA 3GFHA 2Q1LA 4MIBA 2XCPA 4DL4A 2QL9B 3KLEA 2XMTA 3M6XA 1LWFA 1Q5YA 1RWKB 1TKXA 3MECA 3OFHA 5LMUJ 5HK4A 3T1YF 4DXLA 1S77D 4PPZA 1FK9A 2HAIA 3A8EA 3CDEA 3IM8A 3CJRA 1NSAA 2HW3A 5J2QA 3DKDA 2VOOA 1O51A 3ILIA 1TQLA 3POTA 2ZVIA 5KG6A 4DMZA 4FYDA 3PHEA 5LSLA 2XMKA 2RF2B 2OEJA 1TL1A 2E5HA 3JQJA 3IBWA 2AJ0A 3NGUA 4I2PB 4OHXA 2JC1A 1N88A 3F56A 4H4MB 4ZVHA 4WFAQ 4DL2A 4KJIA 3TX0A 4IDKB 1IKXB 4OX7A 4UOHA 5LXYA 1CJUA 5I3UA 3TUPA 3Q86A 4HYKA 2FDNA 1GEHA 3Q8QB 4UY8T 2Y8WA 2CQ1A 5HJXA 2O01C 4I56A 4HT7A 3RBZA 2HNZA 3MMAA 5E5NA 2FJAB 2WCXA 3R6GB 1HBMB 4U8YA 4ID5A 4A8KA 1RACB 3BM7A 1JNZB 1RA7A 2H4WB 5KFXA 5T14A 1XMOF 2YH1A 5J1EB 4X4VA 1RQ0A 4MAKA 4F0HA 4Q2LA 5KG7A 1DHMA 1NDLA 2NSBA 1AZSA 2W9CB 2W8KA 3C6TB 2I5JA 1NM2A 2AJ2A 1DQ9A 2YX4A 4HDHA 3CJ2A 4IFVA 5C42A 4RU9A 5A8RB 4WCEQ 2V4QA 1QTMA 2JEJA 1TKZA 3M6VA 2HNZB 1OYEA 2CQBA 2Q79A 4CO5A 2C2EA 1TUGB 4DX7A 2CQ3A 1NPRA 2GAHC 1XR7A 4OZJA 3KLIA 2XMMA 7AT1B 3MR5A 1I5OB 1RWMB 1R0AA 3ZO7A 5DLFA 2R2UA 2IM0A 2O67A 1JLBA 3BZQA 5KT7A 2W9AA 1HL6A 2EG1A 4YDDB 1VFJA 2HPUA 1GXTA 1RLDA 3V6DB 2G2ZA 3GYGA 4WFBQ 3CE8A 2EC2A 4TKTA 4DV1F 4WYLA 2VONA 3BN4A 1VK8A 2CQGA 3RRKA 2MZRA 2ZJQQ 3ZXWA 3HI9A 1SBRA 2HNYA 4FF4A 1U2RA 5IQ6A 5KFFA 4BLGA 1C1CA 1PJ6A 4J9UE 2CVIA 1FRHA 3FBBA 3CJKB 3TJ9A 2Z57B 4NZ0A 3D2WA 1B4SA 1HHTP 1D3WA 2DHHA 3W66A 3H4BA 1VJWA 3CCWA 5C7PA 1IKVA 1NJXA 4CCHA 1UFLA 2DD8S 2JLEA 4ZPCA 4DR2J 4JI0J 5D0EA 2L41A 2ILZA 2ADCA 5K8OA 4CM2A 2HNDB 1IJFB 1SJ3P 5CAAA 2Q43A 1JLEB 4IRKA 2ZC3A 3MEGA 4G65A 3MM5A 2JC0A 2VFTA 4NLSA 5DJBA 5GMDA 4ZP9A 1AFIA 3GV7B 5L38A 5H1SV 2MTLA 9ATCB 1M90T 3N79A 3OQ2A 3AXMA 2UUBF 1VQSA 1CJKA 3MM6A 2UP1A 2ZJPQ 1XNQJ 2AX1A 1DTQB 2PFDA 1UFKA 4LBPA 3MM8B 3M8ZA 4ED5A 2BKNA 2EKYA 5HP1A 4B3OB 4DUYF 2IM2A 2IVFB 5G0RB 2B5JA 3Q8VA 3OSPA 3NWRA 2UV8A 2RQMA 2XTJP 4ZP8A 3NGRA 4OX9F 3KJVA 2DNYA 1R8AA 3FMWA 2FC9A 1HNZF 4K4ZA 5D8HB 5KOWA 1VBKA 2IRXA 4CM0A 2FLLA 4X4NA 5GAGU 4NLUA 2ZH3A 4HT5A 3Q8SB 1Q8KA 2MSSA 1SL2A 1X4HA 5A8WA 1QE1B 2XMUA 4V1Ak 1S9EB 3O1LA 4TYAA 2HSEB 3K59A 5J2PA 2LDYA 3DLGB 3R5GA 3M8PA 3KLIB 1R0AB 4OYZA 4NEZA 3EZUA 1MMLA 4FBTA 1JLAB 2DGOA 2LXIA 3TNVA 5AJ3J 3H2VE 3K8WA 3H59A 4KV8A 1NZAA 1X5TA 2AX0A 3O2IA 3N6MA 4IFVB 5D4PA 4A47A 4YR2A 1X8DA 1FD2A 2W24A 3OR1B 4EEYA 3GFYA 4FS1A 3HJVA 1FJGF 3JYTB 4FZVA 4LBIA 3ZNUA 4PQAA 3DU6A 3I87A 4B3RF 1Q16B 4QU6A 1FRMA 4JI6F 4TNOA 1V5VA 3KYLA 4B3TF 2MGZA 2X1AA 1ZAWA 3SDEB 2BEFA 4P7VA 2WW8A 2ATLA 2C3UA 1PO6A 2MZJA 3CD6S 5IT9U 3TRGA 1A9NB 2IJFA 5LM7E 4DBQA 2YNIA 1PCAA 5T7LA 5D3GB 1P6TA 3P45B 1WEXA 1LK5A 5F9LA 2LQ8A 1HBNA 1SKRA 1L5UA 1KQKA 3TUJC 3GJRB 2GVDA 4CLFA 1LWEB 4N5SA 1RHJB 4WPAA 4I67A 3NGDA 3KMSA 2NS1B 3Q2TC 5JJBA 2OPRA 3OJUA 4YHHJ 2VJVA 1CJVB 1CLFA 3OTBA 3MPUB 3G8TA 4AUKA 4ES3A 3EYZA 2Z2LA 1UETA 2BKOA 3R7BB 4ED6A 2NR0A 2BMBA 1BQXA 2GAGC 1FDBA 2ZZTA 5LMUF 1S7HA 1RU1A 1NB7A 3FSYA 5HAOA 3OVBA 2AJ1A 3FBCA 3H8YA 2AZ1A 1HA1A 2JFDA 3KK1B 4W90B 5JUMA 1SC6A 2YKPA 2Z58B 3QGPA 2PFFB 4K2JA 1L3TA 4ECVA 1SH3A 4QR2A 4M5DB 4U95A 3HHNB 4P73A 1F60B 4RKUC 4F4YA 1PJ5A 3IWNC 2ALZA 2AP6A 1HW9A 6FDRA 2IY5B 1PAEX 4BWJA 1DZ5A 4HKQA 1T7PA 4RJVA 2B9YA 1Q8BA 5H9FK 2CKWA 3HD1A 2L9DA 3ZTOA 1PSDA 3ISZA 1SUQB 2GQCA 5KFSA 3NL0A 4ANCA 4GVBB 1HI1A 3D67A 3PYGA 1RAGB 4DV2F 2NYIA 2VA2A 4KSEB 3JSMB 1N56A 3FMBA 1IBCB 4OHVA 1MMNA 1WOOA 2R8GA 4OJ3A 5GADI 4C97A 2JDJA 1VR6A 5E3PA 3EPGA 5F8NA 1S1VB 3I9ZA 3MMCA 1TMMA 4M5GA 3BGLA 1RTZA 4USTA 4PCQA 4DHVA 3J7YU 3MTKA 3KLGA 3DOLB 2MDAA 1Y10A 2FZGB 5KFHA 2DY9A 3AT1B 4RW9A 1WHVA 2F3JA 3VAMA 3R5JB 4LR7A 2OPRB 1OPZA 1W2BR 2H54B 1FVSA 2VFRA 1SV5A 4ZKAA 4DV4F 4RWXA 5E2QA 2UXCJ 1WDTA 4RL1A 2MQOA 4N7TA 4RW7B 4USMA 3D0GE 3G96A 2RKIA 2YNFB 4NXMF 2IRUA 2DGWA 1HBMA 1SJFA 1QAIA 1HD1A 1TU0B 2Y0BB 2V63A 5ETKA 4ZVTB 1HPZB 4MFBA 2OSRA 3I31A 4P2FA 3VV2B 3N5FA 3GZ7A 5L46A 1ZPWX 3PYEA 1FDDA 1FDNA 4ATNA 2KH9A 3OFEA 5E3CA 1PBUA 2GGPA 4J9NA 3OXGA 5K8MA 1UP1A 3FFIA 4R0JA 1RBOB 4KIAA 3M4XA 3VAHA 1PJ7A 2HFUA 5F41A 5IQQA 1JXLA 3D3BJ 4NLRA 3SFUA 1VRTA 1U47A 4FNIA 4J37A 3VGVA 4ALZA 5KT6A 1Q8IA 4RUHA 2R7UA 4PXBA 4DCPB 4DV6J 2Y1JA 5LOQA 3IG1B 4KGMA 1B70B 4QWBA 4LFAF 1YJVA 2P6TA 1S57A 2R7QA 4C3MA 4ZHRB 1S4EA 3B78A 2BRLA 3ISND 4CO0A 4F0MA 1HBOB 3C2PA 2DITA 2VQEF 3GONA 1UVNA 2J7UA 2RB7A 1N0UA 3MFIA 4GO7X 4WU2A 1UEVA 2CJAA 2VDIA 3G2XA 3KDOA 3W2WA 1XNQF 1S1XA 1BQMA 4DQPA 4JI2F 1FA0A 2DXFA 2K06A 3DLEB 1P1TA 1J27A 1C0UB 3A1YG 3A3OB 4IFYA 4F4ZA 4CLZA 2BOPA 1UKUA 1VI7A 2DEJA 4IH7A 5IWAF 1N8RT 4L3NA 3W9HA 3ZZ0A 1AYEA 3K5OA 2V9WA 2ZHAA 4ECTA 2L48A 5EDWA 2FYXA 4Y0FA 5MAOA 4ZVEA 4FF1A 3HKZD 4EMDA 2V8GA 5IOLA 2VKRA 3MCMA 1VQMS 1VQNS 3TVZA 3SQGB 3WDOA 2FC8A 2GC8A 3IBFB 1NHKL 1S7IA 2CJBA 2BVZA 2F1FA 3LP1B 5C2GA 4GKKF 2GV1A 3PG9A 5A8KA 3MFHA 4DR3J 1RT1B 2VBYA 1PIEA 4W98A 4DL3A 2DNKA 3B4MA 2JEGA 1F3FA 4KH1B 2NQPA 5BR8J 5IM0A 1GFWB 1TMJA 8AT1B 2YNIB 1C1BB 2HLTA 1YGYA 2XMWA 2YWWA 2AJQA 4D3GA 1OIAA 1RWPB 3I9V9 1RAIB 4LF6J 4X4UA 2E5IA 4IG3A 4L73A 3FGVA 2VG5B 4FVCA 3T9ZA 8ATCB 2HVHA 1BQMB 4WWSA 2OI2A 1MN7A 4O44A 5HMYA 3JYTA 1XERA 1WC0A 3M32A 1S10A 3DHXA 3FUYA 2MKSA 3LGHA 5J2NB 2WVEA 4Y2IA 5I42B 3JSRA 3RBXA 3G4SS 5KFOA 2MJUA 2VASA 1P9YA 2BJDA 3KK3A 1RTDB 5KFTA 1KFSA 4OI3A 1BUXA 1K9MT 4IR9A 2CXEA 3H20A 1YHQS 1Y5IB 1U02A 2ASLA 1IKWA 2V50A 5B0AA 2RS8A 3ZZZA 4Q2MA 1VC5A 4OFZA 1S9GB 2XQCA 4EYIB 1J5EJ 1EHWA 2KI2A 3RZAA 3T41A 2E5GA 1JJCB 1OPIA 2IRYA 3MMBB 4MT1A 1NK9A 3NKYA 2CADA 2YKNA 1X7VA 2LFVA 2YVSA 3L09A 5AXLA 3H5SA 4ETZA 3R1HA 4ID5B 4PWUA 4DF4A 2H65B 4DG1B 4PWDA 1QDUB 1IUJA 3PW0A 1KDNA 3KFWX 1URRA 1WD6A 1VLYA 2BX6A 4ZVSB 1OQ6A 3TOQA 3IS9A 3RRHA 1C0TA 2XWXA 2UXDJ 1FKAF 5HMWA 2YH0A 5AE1A 5E3AA 2HVEA 4G1PA 2MKCA 3VAIA 2G2YA 1KLMA 2E1RA 1GMVA 1PC5A 1RTIB 2RU9A 4NXNF 3OPKA 4Z7YA 3BF4A 1B7FA 2RKIB 2YNFA 2CZ9A 4CLUA 4MK8A 2XS5A 1CS4A 3SYZA 2XYHB 3NCRA 4QR0A 4Y6IA 1IBMJ 2FY8A 2H48B 2HWTA 3I5AA 4P2MA 5KG0A 2RF2A 1N5YB 3V4IA 1D0EA 2W7AA 1G6BA 2VC0A 3KWMA 4I2PA 4L75A 3V4IB 2FLPA 2CPEA 3KJFB 1FJCA 2B43A 1ZA2B 2QRRA 3AD9C 2BJ3A 3CDAA 3IM9A 1REVA 3LH2S 2NXEA 4TY8B 5E3RA 3POTB 3MEGB 2VG6B 3SXLA 3DGPA 4FNHA 4GVLA 2BJ7A 4EGLA 4ANEA 4CDIA 3Q8PB 5HN0A 4IG0A 1NDCA 2L9WA 3I55S 1W2IA 1AW0A 1XR6A 2JZ5A 3AA8A 1JXVA 2IVYA 2KT3A 2YWKA 3AY0A 4RW4B 2GW8A 5KFUA 2XM3A 1HI0P 4JI1J 3CCJS 3W2VA 1SKUB 3M2VB 2W9BA 1FWKA 2EWHA 4RU2A 2W7OA 3DGPB 2AYBA 5CYQA 2HHUA 1E6VA 3PHTA 3PV8A 5ADZA 3QMQA 2MQLA 4F67A 4RNNA 2QMUB 3PJXA 1KHVA 3G82A 4OJGA 3SSSA 1JX4A 3EVOA 3C6UA 3I0SB 3MGJA 4MIAA 4TVAB 3SEOA 1H2TZ 3DOMB 1S6QA 2CNLB 3NGSA 2QL7B 4NXMJ 4JYAF 3AB4B 2FHJD 4NZ7A 1RT5B 4CLSA 3K5NA 3CUNA 4E0DA 2M52A 2RSQA 3DFEA 5CCMA 1V3RA 1U1MA 4NOHA 4YR3A 5M2UA 2JLGA 2I0XA 2BANB 1N6QA 1NZ8A 4HR2A 3GE9A 2IHR1 1XMQJ 2BOAA 4KO0B 1GAOA 2AU0A 4ZN3A 1Q0NA 3KNAA 4NLGA 4LFBJ 4OX9J 4LF9F 4ZVUB 5J2NA 4ECYA 2Y1RI 4R8UA 4D3HA 5I42A 2MZTA 2PI5A 4JI5J 4JYAJ 1JJ4A 2Q6CA 2XLJA 2UU9J 2D69A 4EWTA 3MOJB 2HHQA 3SBMA 3LPYA 4J9VA 3QATA 3UD4P 2HRUA 4HHHA 2MKKA 3TA0A 1PYSB 1FI4A 3BEGB 2ZOMA 1FKOB 1RDRA 3M8QA 4O3NA 1YZ7A 1S9GA 2JSXA 3CDWA 3SQOP 1N36F 2HGLA 2J0SD 1JLFA 1KVKA 1X4GA 4ZPWR 2YWHA 5F3TA 1LV5A 4YR0A 1Q7LB 2FGOA 2JRSA 2FZCB 2DGTA 4NYOA 3CVKA 3EMTA 4IDKA 4UOFA 4WXOA 2ASYA 5I3UB 3AXKA 2CJKA 1KS2A 3FKBA 1TP7A 3L9ZA 4C8LA 3PX6A 2YNHA 2XI2A 3UQSA 4IO1A 1X4EA 1MWYA 2XO7A 4MIWA 3L3CA 2P9CA 4G3IA 1WTBA 1RHQB 4IQMA 2BDPA 1SQEA 2BXJA 3DRPA 5THWA 2B6AB 2DH9A 3QAEA 4GRSA 4IG3B 1EB0A 1PYTA 4TLRA 5CABA 1VQOS 2HHHJ 4NX9A 3CJ0A 2BV3A 5L1JA 1M5PC 4ES2A 4TY9A 3MECB 4C0BA 2KYXA 3RB6A 2VKZG 2ZKUA 4U7CA 3T9NA 1YIJS 4OX8A 2G0IA 3EVMA 3H7HB 1T9UA 4KT0C 2V69A 5CCLA 2R8JA 3DXBA 1LFPA 4KFBA 2CG8A 4DUZJ 1QM9A 2ROGA 5JMNA 2MXYA 1KVIA 5AXNA 3GYXB 5FLXU 5FLXY 1N5YA 1X4DA 2N4CA 2VFVA 5F8GA 2HQGA 2OPSB 3IP0A 4OYBA 4DS4A 2U1AA 1U45A 3R2DJ 3O5TB 3ILOA 4O4GB 5AXKA 1U49A 4DSKA 4O4GA 2UVRA 1PG5B 1JWWA 3NG8A 4LFBF 4X4PA 5H9EK 1VJQA 3AH6A 3IS9B 3QPIA 3UVJB 2RRNA 2PN6A 1YRUA 2HFSA 1GMWA 3I96A 2UU9F 4NLOA 4WXWA 4P74A 5KG1A 4IRCA 2QSWA 3EWGA 1SIZA 3HT0A 3R6LB 4G6VB 3THTA 1KVJA 2HBQB 2CPYA 1RBAA 2YTCA 3QSIA 3C19A 2M5YA 1R0CB 1XMBA 3VAKA 1M5HA 1OYDA 1R6VA 3V6JA 5T7LB 3QRRA 4DR3F 2ZUAA 1X5OA 3HHKA 2ZBIA 3OW2R 4ECRA 3IC1A 3E01B 3BQ0A 4B9LA 1FFWB 1JLCA 1NO8A 2C2OB 2UUWA 3MMJA 4FKYA 3OFFA 3SDEA 3R3TA 1J2VA 2R42A 1RAFB 3E3XA 3GJTB 3UW1A 4J9OA 2FJWA 5A2QY 1X4CA 2XYPB 1WC5A 2CNOB 1LWXA 4OLPA 4B9VA 4DSIA 2MQ8A 4PUOB 1U8SA 3DM2B 2KFNA 3THVA 4P2XA 1UVLA 3QSYB 1NXIA 4ECSA 3CO9A 3HT3A 3UI3A 2LCWA 1X4AA 4DQRA 3EGZA 4QQBA 2HHHF 3KG4A 2GGPB 4JI8J 3UPFA 5HJYA 2PO4A 1HWIA 4XDCA 3G6YA 2Y1IA 4ZLLA 3TEHB 4IQXA 3M8QB 4LIWA 4BDPA 3BBFA 2E66A 4K2XA 2OTLS 4TN2A 1HNWJ 3K5LA 2Z4PA 2ZZNA 3RW6A 2BW2A 2XULA 2KT5A 3SV4A 1MROA 4JV0A 2WK4A 1ELOA 1JXEA 2QLWA 3GTYX 5C42B 5F9NA 4ED8A 4AL6A 1U8WA 3DC2A 5KT3A 2F4VF 2R7TA 1AFJA 2CPJA 3EICA 5IC6B 3HDSA 2W2NP 1DTTA 2PDAA 1GT8A 5KFRA 2ATCB 2WRMA 3KMQA 2PMZD 2UVVA 2J9DE 3OTEA 1EJ7L 5EUHA 1CBKA 1CC8A 3ZTPA 2HHPA 1BQNB 1FKPB 4DL6A 1Z2LA 2OD6A 4A8QA 3HFKA 2Z30B 3KLGB 1KFDA 2CWKA 4BCAA 5KFNA 4MYUA 1L3KA 3LF0A 4LSLB 3R27A 5KT5A 3PY8A 3UFCX 4KHPJ 3D68A 2HS3A 4I7FB 2QZ8A 2MLYA 5B0CA 1X4FA 4DV7J 4URGA 3KK2B 3CNQP 1LOUA 4MTPA 1NU4A 2EFVA 2R7VA 5HMXA 1IBLJ 4KHMA 1VQ6S 4O3SA 3CCLS 3HMJG 1KLNA 4ZLJA 3DGVA 4RBVA 4LQ9A 5DDRC 1M5VC 4WZQA 2XMJA 3MEKA 4C11A 2KO1A 2ZH7A 1XMQF 4HL9A 1T94A 2FTRA 4NLVA 1RBLA 2KM8B 4EBDA 2ZFHA 3HXMA 4WE1A 1S0MA 3BYPA 2LA4A 3PYFA 4N8OA 4WFNQ 8RUCA 3H2UB 3R1LA 1FE4A 3I5BA 1S4FA 4B9MA 5AJ3F 4PAAA 3RAXA 3W63A 2ZKTA 1SH2A 2J9DA 1NNDA 1RCOB 1XQIA 4I6AA 2FJBB 3VQTA 3C15A 3MPYA 1RSCA 2J0XA 1S6PA 2E7WA 2QA2A 2LVWA 3LQVA 4LT6A 4CQ1A 3CPWR 4DUYJ 1XN9A 3F41A 3K89A 3UD5A 5KT4A 2LEBA 2BUNA 3P5TL 4ZP7A 2XGQA 3EZ5A 2HMIB 1ZAVA 2IJNA 2GVDB 2VPZB 1EETB 2DISA 4DV5J 5DGAA 1HBNB 5EWGA 1WORA 3IR7B 4OV1A 2MEWA 1FO1A 2RRBA 3GG1A 1CEZA 2CQHA 1C0TB 2YWGA 1KLMB 5L1KA 2NCKL 3RB3A 3PRDA 4USVA 4ELVA 1S97A 1FX2A 5MLCV 3R7NB 1OO0B 3A8KA 4PQUB 4PRFA 4UY85 3BSOA 1RU2A 2J7WA 1SC1B 2O66A 5DGBA 3CSKA 4CNZA 1GX5A 4WK1A 3GFZA 4X84A 1HWLA 1SJQA 3JB9k 2A3JA 3DYAB 2V2QA 4Y65A 2EKNA 4OI1A 1N5TA 4OLOA 1QJHA 4CI0B 2AMCB 2GJIA 5D6GA 5HQLA 1ICEB 1LWCA 2B9WA 2UVUA 2Y0SD 2RQKA 2DIUA 2YX1A 2UXBF 1VLOA 4X4TA 1CQNA 1FT8A 3NBPB 4LR9A 1HWJA 5ETRA 3TAMB 2HFZA 4GC7A 3QT5A 1J5EF 5DQGA 3AAWB 1RWOB 3CTRA 1T9VA 5DDOC 3IAM9 2D3O1 2XB2D 3IGNA 4OYXA 3GCXP 4U6PA 1CC7A 2P9GA 3NY0A 3PIOQ 1LW2B 1NDKA 3MTJA 4P10A 2WAQD 1P27B 2L3MA 3TQEA 4DN9A 2H51B 2XMVA 4JI3F 4LJMA 3IGVA 3W2VB 3K57A 3KHLA 2VQEJ 2XY6A 1T05B 2Y8YA 3DHWC 4C3LA 1N4LA 1JLGA 2CNKB 1LXJA 5IT4A 1VRUA 3HHEA 3PFEA 2EC0A 3X3UA 4QCLA 1L3VA 4M94A 3Q83A 2DHSA 1CJKB 3MM6B 4MKBA 2N82B 3V6KA 3M7VA 4AXIA 4K0KF 1IBMF 1HYSA 5KFLA 2IA6A 4Z37A 4M95A 3GSIA 3M30B 1R7IA 5HQMA 5ETLA 3M2UB 4NMLA 1GX6A 2N3OA 2RD5C 3EM1A 4K4UA 4PG7A 2RHSB 1RT2B 4O3PA 4I0WA 5K5MA 4AL7A 2VH7A 3D1QA 3HO1A 3P3DA 1YBTA 2PE8A 2FY1A 2F63A 3JTOA 2CJQA 1BMQB 1HNVA 4H4OB 4PXEA 1PBAA 1WF2A 5CA5A 3QRQA 1UL3A 3JTPA 2GO8A 3PX4A 2NXNA 2M8HA 2NPIA 3OXFA 3CJKA 2M4MA 2D1CA 2G2OA 3TWZA 1WG4A 4PWDB 4XAKA 5CYMB 1RTJA 3A3NB 4UQGA 3BQ1A 2FVSA 4OI0A 3GP9A 3QT8A 2F5GA 3FSIA 2IA0A 4NRTA 2LU2A 2PEBA 4KV8B 1UVKA 4PQUA 4YB1P 4TU7A 3MR2A 2C28A 2OPQB 2R2RA 3BH7B 1VS3A 1K1QA 2A6MA 4F4WA 1IN0A 1HARA 1XBWA 2B6AA 2DBBA 2JNJA 3BGOP 3FEYB 1EETA 1GMWD 4ZHRA 4Q44A 3H25A 4OZLA 3V81B 5AE3A 2VODA 1EX8A 3I4PA 3AA9A 4RUBA 1J5OA 3MM9B 2IC3B 2HZAA 5AT1B 1RHUB 2CIMA 4HH0A 5I4MA 3NMAA 1CG2A 3PX0A 3P49B 3M6UA 5RUBA 4KBIA 4ZVFA 3R2CJ 2HHSA 4NA2A 2FLNA 5SUHA 2OH2A 3IR5B 4B9UA 2VBWA 2L08A 2LLZA 2OAUA 3CO0P 3DMJA 1ZAXA 1FE0A 3FEZA 1VDHA 3MMAB 3MAAB 4MK9A 3TZWA 5CZVA 1KC8T 4DV7F 4WZMA 1YTYA 1WWHA 4CO3A 4ZIVA 5IT9Y 1JJHA 5DZ6A 2MHNA 3QLHA 2HG4A 3OVSA 3QQCD 3SCIE 1FKOA 4CTAB 2CWXA 2LMIA 4ED3A 2P9EA 2GZOA 1AA1B 1HNXF 4DL0C 4K5SA 5IZHA 4RW6B 3OHAA 1G4CA 3T3FA 4B02A 1D8ZA 4DV0J 2KG1A 3GB0A 3NEKA 4PZVA 4F04B 2V2ZA 3SCLE 4ID8A 1SJ4P 4DX8H 3I4HX 3MM5B 3DOKA 1HNIA 2ACMA 1G7CB 1ZS6A 2V8HA 3NAIA 4KGZB 4KPCA 4WFYA 2W2QP 4NCGA 3U7JA 1F3VA 1IKYB 1WC6A 3CW2C 2WVDA 2KZMA 1X9WA 1DAXA 3EE3A 2EK6A 3A12A 2H5EA 2K1RA 2IMWP 2M0GB 2XSJA 1NHUA 1H72C 5E3QA 4EYHB 4Q0BA 1KTVA 1FEEA 3EUNA 1X5PA 4F26A 2DR9A 3JSMA 3D5MA 5DETA 4DV4J 4EK2A 1I51B 4TXSA 1SKSA 1HKAA 5B08A 3QZ7A 1FJ7A 5E33A 1Y4ZB 1RT3A 2FPHX 3QAUA 3R97A 1SPBP 4UT4A 4CYUA 4J9LA 1VQ5S 2XO6A 2QMXA 2F9DA 4DUZF 2OJ3A 1XIQA 2QC3A 1HIYA 4NLWA 4QW9A 5DG7A 4F25A 3DU5A 1SC4B 1RTHB 2HBRB 3FNNA 3MAAA 2CPZA 5CHCB 3HSZA 4IH6A 4B08A 4NLYA 2X7IA 1RAEB 1R89A 1EP4B 1U1PA 3D9BA 3FSXA 1B3TA 5F8JA 5J2MA 1ROFA 1UEUA 2UZAA 4HLBA 3A8JA 4LBHA 2D3UA 4Y3CA 2CJ9A 4DS5A 4JB8B 3LUYA 2J8SA 1J5OB 1HR0J 1R8HA 1APSA 2VC1A 3N6LA 4J9RA 4M5MA 4HTIA 1HMVB 2YPYA 2G1HA 3CJ5A 4K5RA 4ZP6A 4ZA1A 3S1TA 3EX7B 1PYOB 3CC4S 2KXFA 2MJNA 2C2DA 1TR0A 4G1IA 5DZ7A 3LA0A 3PDNA 3B6BA 5EWEA 2OELA 1AXQA 4QWDA 3VTIA 2DRAA 4AL5A 3CIZA 2OD4A 1HMVA 1NSPA 2DEIA 1Q1KA 1Q78A 4NLTA 1T03A 3SV3A 4N77A 2DK2A 3P4UB 1R0BG 2MQMA 3VF0B 3PW5A 2F8HA 3QFHA 3FZBA 2GIRA 1L3SA 1WSVA 2OFHX 4LRCA 2I6WA 3RU0A 3D1OA 1RISA 1AT1B 3DOLA 4MH8A 2K7JA 4JOUA 4DPWA 1WC3A 1UWAA 1RWNB 1U09A 2NLWA 3C14B 3GR1A 5GVQA 2P8IA 5A6PA 5DQIA 2UUCJ 1RT4A 2I38A 3P6YC 4JI1F 2OEMA 4R25A 2E5JA 1PGZA 1Q8LA 1TL5A 2IM1A 3DLEA 4X65J 2KYZA 4JI4F 4LF5J 3VAFA 2HK3A 4KYZA 1RA6A 2EVZA 3I0SA 2IBOA 1R3NA 2N3LA 3G71S 3Q89A 3DLJA 2VHGA 4NLQA 1TKDA 4UUXA 1MNEA 1OWXA 2QLFB 2HGMA 4CO1A 1SCJB 1YK9A 3M8YA 4BC7A 4AQYF 4LFCJ 1Z4UA 2IIHA 2AWZA 3M6WA 3QIDA 4IOCQ 1F5AA 2XSJB 4CT8A 4Q0BB 2ZC4A 4AE5A 2P5VA 4H4KC 4R0EA 4DSJA 2A0FB 2A18A 1TELA 3FCHA 3KG0A 5G0RA 4Q45A 4ES1A 3CCQS 1IKYA 3CJ4A 2AV5A 1S48A 1TK8A 4NCGB 4Y2AA 4DR6F 2OSQA 4M1KA 5CXTA 3K0JA 1WHWA 4Q8FA 2W1BA 4YB6A 1CJTA 5GAHU 1X0PA 2VDHA 1FTRA 2DVIA 1UTAA 1FWLA 2J7KA 1KQFB 1Q95G 3WIVA 5HMZA 2BE7D 1F5CA 2SXLA 2WVCA 3BBBA 1WELA 1U25A 3E51A 5IS2A 1VQ9S 3RR8A 5C25B 3SIPB 3KOAA 3PTWA 1G2EA 3CDBA 1YJNS 2XBPA 2BABA 3PFOA 1X0FA 3BN7A 2B9XA 1JQGA 4YEAA 3WC0A 2WSEC 4WP8A 2J8AA 4X64J 2D7SA 1GTEA 3BB5A 3OL6A 2B4PA 1WEZA 4PABA 3NNCA 1M5SA 3T5HA 1OSDA 1YVFA 2CA9A 3OBIA 4DZ6A 3G8SA 1RI7A 4MK7A 5JXSA 3ZZUA 4ZLNA 2KHDA 1YITS 5ETNA 3VVTA 4J7CA 3GQCA 4J9KA 3WQPA 1QUPA 2HHWA 3BV8A 1H0HB 4UZCA 2HYIB 5L8RC 2HWIA 3BH6B 1WG5A 2VBXA 1NB2A 3OL7A 1H7XA 1Y3JA 5AE2A 2I2YA 5B0FA 1WNEA 4LRAA 1HBOA 1N32J 3OXLA 3EDRB 2BA9A 2BANA 1N6QB 3RB4A 1DLOB 3H98A 1B0TA 3ENAA 2XYGB 5F0WA 1X9SA 1LW0A 1GH8A 2G13A 3SSRA 2QSFA 4K59A 3EJMA 3W5YA 2UUAF 3FJ2A 1EAYC 2EW9A 1FNXH 4F3OA 2LXUA 1DBDA 3LANA 4FXWA 4CZCA 4FXDA 4KPYA 2IJRA 1WUUA 5CYQB 4KTQA 4DFJA 2QT7A 1FHTA 3IXQA 3TR5A 3NNAA 3UDLA 3T6BA 2E1PA 2LEPA 4DPXA 1FDAA 5F8MA 4A8FA 1YJ7A 1TK0A 4C8KA 4TU8A 2ZVSA 1YWXA 4RW4A 4CWBA 1S0NA 4YOEA 4YUDA 2NZ4A 4C0OC 3QIPA 4NCAA 4A8OA 4DF8A 4W92B 3TANA 2EPIA 3AOBA 3N28A 1SXLA 4USHA 3MEDB 2PT0A 3LGMA 2RAQA 3ZTQA 2KB2A 3HD2A 1IBKF 1RADB 3MEEB 4C0HA 3BSNA 3JQMA 3MEEA 4RBUA 4ZVPB 4QU7A 2F4FA 5L9NA 3KDNA 4NEYA 2M7SA 2BE9B 3L7OA 4OYAA 3LP1A 3B8HA 4OL8A 4ZLPA 4JV5J 1S59A 2HNDA 1G3OA 2GX8A 3U1NA 5M2PA 3EGWB 5LMNJ 2JOQA 3Q24A 2KM8C 1NK4A 2HWHA 3NCPA 4UZBA 3OUYB 2E9RX 3R5AA 3HHLB 4C7QA 2K7KA 1UWBA 3M9MB 3LAKA 1K1SA 2B8QA 1HR0F 2FJXA 1R8PA 1ULRA 2NUUG 4C11B 2GVZB 3HULA 2HQIA 1TZ0A 4B17A 1C1CB 2V5HG 4IUFA 2KHCA 3A13A 4FF2A 2KTQA 2R7SA 2HNYB 1TKTB 2DCLA 3UCUP 4KGXB 4MJKA 4J9PA 1KEKA 3GIIA 3SCKE 4B9SA 3IR6B 3W9IA 2BQ3A 2DNPA 2VD3A 3CGIA 4OZNA 1HHSA 4ZVGA 2Y1LB 3NS6A 2DR5A 3J7A1 3HSGA 1CS4B 5GMEA 4ILMA 1S5ZA 4O0IA 1VQ8S 2CAJA 5F8LA 2KVQE 2D9OA 5KFEA 3OLAA 2ZM6F 3QGHA 4Z2XA 2HS4A 5DG8A 5EN1A 2G0JA 4LF2A 2H4YB 1FRJA 1S12A 2ZH9A 3T5KA 1H98A 1LWCB 3AJ2A 2MY7A 1FRLA 2VQFJ 3OFGA 1RWWB 5BYSA 1PILA 5C24B 3MURP 2Y9HA 1H2VZ 4OHWA 1VRTB 1YJUA 2FUG9 4DJBA 2GQQA 2XG8A 3W62A 3LP0A 1CPZA 1RJJA 5KFIA 1I3OB 3G6ES 2BE2A 1TV6B 2ASDA 3AB2B 1QSYA 3IAS9 1LK7A 3CEDA 2HRYA 1TL4A 2ZNZA 3CIMA 2HQCA 4O0NA 3MM7B 2DR6A 4DZDA 1IM4A 5BR8F 2BM0A 3ET6B 3FBEA 1KWMA 4Q43A 2J6SA 4DL5A 1VQ7S 4DUTA 4LSNB 1ZM2A 2RQCA 2DH8A 1IVZA 2DGXA 2DO4A 2HBYB 3MAQA 3RBDA 4PG8A 4X4QA 2AYMA 2YKOA 4EO6A 1WJ9A 4JI0F 5A0YA 2ZBPA 1U24A 4R5PB 3TAQA 1Q86T 3OJSA 1H73A 1FWPA 3CWJA 4ZS6A 4M5HA 2COLA 1VOMA 2CRLA 1TUWA 1NJWA 2CUYA 2C3PA 3M30A 4ZPDA 5J1PA 1ZM4A 3DLLQ 3HVAA 3KG1A 5HO4A 3UVJA 3DNCA 3GYNA 2YWFA 3P96A 1UVMA 4KB7A 1S99A 4FS2A 2IC3A 1KQSR 1HFEL 4KRWA 4Q8EA 2HEKA 3N6NA 2W2PP 1VQPS 2FHOB 2QMWA 4RNMA 2HURA 4DFKA 4JBCA 4C9DA 1IQTA 5ETTA 4URQU 1FRIA 1RAJA 2I1RA 4WE1B 3MWBA 5D4OA 1QAXA 3H5UA 4PKDB 3ILLA 3KXDA 3CMES 3BYRA 1OQ3A 1RP5A 4QBUA 5LMNF 1YJ9S 2HLUA 1FVQA 2CQ4A 3VHQA 4LF8F 2GJFA 2KDOA 1S1TA 1TK5A 5E7OB 3MCOA 2VJUA 3ITHB 2W4PA 4DV6F 1I94J 5F8HA 2QFJA 5DM6Q 4E2FB 4I6YA
chains in the Genus database with same CATH topology
5KFDA 5SZTA 5HROA 4UUWA 1UJ4A 2KT2A 1N0VC 3V6DA 1FJEB 3SI8A 4QIGA 4DSFA 4IO9Q 2DNMA 1JMTA 3L95X 4B3OA 3IRXA 2Z2MA 3QWPA 1KRPA 1TAQA 2ROEA 2VG7B 4ECWA 2C3MA 4X64F 1NK7A 3CC2S 3ETOA 1V3ZA 2ZH2A 3OTDA 1VC0A 2WOMA 3ENWA 4NA3A 2OMLA 3DLKA 3CC7S 3K5PA 3CCSS 4EZ9A 1IQZA 4RWWA 1RYSA 4CO4A 1LFWA 3NWGA 2NSCA 3MR3A 4DV3F 2GMJA 3QLHB 4UQTA 5U47A 5D3GA 3OTOF 1IKVB 2BJEA 2OKQA 4NA1A 1VBYA 1HPZA 1IXKA 4MFBB 3OHBA 2GHPA 2A1BA 5D77A 4AXJA 4A8YA 1HNZF 1UA0A 2VV5A 3C46A 1YJTA 1M5OC 2FGCA 2ZHOA 2IBKA 3QWUA 2J6TA 4C2MA 1TV6A 1WI6A 2YNGA 1X5SA 4ITSA 3H4DA 3UDCA 1QLNA 4M63A 2KXHA 2MPUA 3M05A 4LVNP 2I8EA 3QJLA 2QE5A 1D1UA 3HVWA 4DR4F 3PKMA 1GQEA 1R43A 4DLGA 2N7CA 3NBPA 3TAMA 5J1NA 2F7VA 3BSCA 2HVZA 3PJWA 4FBUA 3E01A 1KONA 1Z1ZA 3U27A 3BDEA 3DOMA 5L9XA 4B3MF 1WHXA 2O1PA 1IBLF 2NXUA 3ENQA 2F40A 5LJ5Y 4C8YA 3GG0A 2BQUA 3TW0A 1YJWS 2H9ZA 4U9RA 1UVIA 1D8YA 4USIA 4QWCA 3OL8A 2B56A 2D9PA 3DLKB 2C2RA 1RWUA 3PR5B 2GQ2A 1KN6A 2WTFA 4K4YA 2CQPA 3LW5C 2B5JB 5C24A 3S7RA 1YBAA 4N41A 5LXRA 3HHLA 3N0VA 2DNRA 4QIWD 2APOA 4I64A 5DG9A 3O8WA 4U7UK 4WKYA 4WFXA 4CT9A 4ECUA 3W3SA 2XLKA 3MCSA 3MOZA 5C25A 3BO3A 1DFDA 1VK3A 2QA4G 2C22A 2FJDB 2VPXB 1QSLA 4O3RA 3K5MA 4C3KA 2G0CA 2RH3A 3J7YI 4RUCA 1N33F 3M1VB 3V4MA 4DOZA 3RTVA 2DNQA 5J2QB 2DIVA 3WC2A 2FIUA 1XEZA 5KFPA 2VQFF 3MUTP 3QYYA 1HWKA 4USJC 3TVYA 4F8RA 2UVWA 3G6XA 1DARA 3LOUA 5IFMA 1OSCA 2A2DA 4ECXA 3MZIA 3KK1A 4C8NA 1H3DA 1ZBTA 5LSOA 3C66A 3UWTA 2DT9A 3LALA 1S76D 4B3SF 3HLUA 4CH1A 3RW7A 4N8NA 1S72S 3DRSB 1I1GA 1U1QA 4PUOA 1BLUA 3JTNA 4F3QA 4PG5A 4FPRA 1RKJA 3OV7A 2KN4A 1TUVA 4LVOP 2WSFC 4BBYA 1Z2ZA 3HF5A 1UJ5A 1KTQA 3THPA 4YQWA 2CPXA 2X1AA 5HBMA 2L9NA 2HZCA 1HBUB 1SJRA 3RAMA 1Y0HA 1VQLS 1FXDA 1TVRB 3ICLA 3LWLA 4HEA9 2V9KA 1VQKS 1WHYA 4NYPA 2WBRA 2LQ5A 1MW7A 2DNNA 1XTZA 2I5JB 2D3ZA 2WB1D 3K7RA 5EWFA 1MMDA 2OLWA 4QJVA 3I0RB 3G9CA 1MU2A 4ZDNA 1LKZA 5IXUA 2CYYA 2AF6A 2HHTA 5CYMA 3PW2A 5F3ZA 1K0VA 3TA2A 3DLHA 2DHGA 4O3OA 2CVEA 3ZFVA 1NH7A 2W7PA 4IR1A 1E6YB 2ZDPA 2QV6A 5K8PA 2MZ1A 4H4MA 2RVJA 2J9CA 1F9FA 3DRSA 3JSBA 2DHAA 2EFQA 4ZCKA 1RGVA 3O44A 1K0TA 1BGXT 4MKYA 4KFBB 3M2UA 4NRUA 4QIEA 2G1DA 1E6VB 1YRTA 2LEAA 1TL1B 5KFZA 3TO8A 3H40A 1NK0A 5KFCA 1NKCA 3TARA 2M88A 2EFOA 2W9BB 3CMAS 1HI8A 1LQ9A 3G86A 4EU0A 3PIPQ 4J9SA 5JVGQ 4GO5X 4HH1A 2R9LA 3VR1A 3TI0A 5L39A 4TY8A 3LO3A 1H2UX 1BD6A 2DGSA 2LQJA 1B64A 1F0XA 4ED7A 3CD0A 3TA1A 2DPJA 1B0VA 5K14B 2LDIA 3DRRA 2PSZA 1V6HA 5JVHQ 1FD8A 4C4WA 4LSLA 3WX4A 1Y00A 2BACA 2DNGA 2IYIA 2YQ3A 3VAJA 1BQNA 1FKPA 3ZC4A 1ZM9A 4WFZA 1ZOTA 5KFYA 5KFJA 4ECZA 3VQSA 2F9JA 2E1CA 4F50A 3MM7A 5KAKA 3T5LA 1VBXA 1S6OA 3HVTB 2UV8G 4DSLA 4DG1A 3BDPA 4LF6F 5KFAA 5KFMA 4LQ3A 4EO8A 2WB4A 3MI7X 2W4CA 4NLPA 4KC5A 1P9QC 1U6FA 3HKWA 4XPCA 3T1AA 1U1RA 3V6HA 2DR8A 2EI5A 2B0GA 2OP5A 3D0HE 3I5CA 3G8QA 4ILRA 4WJBA 1DJ0A 1U7LA 3D28A 3LGNA 2RT3A 1VBZA 1RT4B 3TYTA 1H6KX 3KK3B 1RTDA 1ZH5A 4ZOSA 2XY7A 1AROP 1UVJA 1NJIT 1CQMA 2ZE2B 2BM1A 1TL3B 1FESA 2MKIA 2RILA 5KFKA 2HMIA 3I6PA 3SMZA 2DHXA 3J7ZT 2WHOA 3C6TA 2W9CA 1YRXA 3U1LA 1A7GE 4Y28C 1FK9B 3KLFA 4DQIA 2Q66A 3GMGA 2DNZA 4FVMA 4XK8C 4ZCLA 4C8OA 2QLXA 2W4DA 4NLXA 4Y2CA 5I3QA 5E41A 1U1OA 3GIMA 2MZSA 4ICLB 3M9OB 3Q23A 2M8DB 1WG1A 4LF7F 4QZVB 1RT6B 1GXLA 2GJ2A 4E8UA 5IT0A 2PD1A 1UAWA 4ZMMA 2LQBA 4UOCA 2EFNA 1UMJA 3M9NB 3HM9A 4RW9B 1YI2S 2ERRA 4QOTA 2R2SA 4XDDA 3I82A 2GMHA 2CG4A 3Q22A 2BBEA 3EXYA 3ONQA 4FF3A 1NRKA 2IM3A 2MB0B 3DDNA 4A8XA 2XS2A 1S1UB 3FEXB 2DH7A 3E8OA 2A10A 5GADU 2K3IA 4QW8A 3DOKB 5HROB 4GMKA 5K14A 2CPDA 2GO9A 3UCZP 4DFMA 3U02A 2V4JA 2VPWB 3CT9A 2HFOA 4IOBA 2X1BA 4I2QB 3O6QA 2CQ0A 5BYRA 1S1WA 1Y9OA 4ECQA 3PVXA 2R7OA 2QIFA 3PW7A 2DGQA 3IG1A 5FIIA 4YY3F 4F2RA 2F8EX 1U4BA 2XNRA 2W25A 3PNIA 3HHLC 2CFXA 3ZZOA 1X4BA 2DO0A 1C4CA 2OMOA 4K4XA 2ZBCA 5B7WA 3TUZC 5DO2A 4LF4F 4LMZA 2DR7A 3MUVP 4H4KA 4WF9Q 2YX7A 2XZWA 4DEZA 2P6SA 4OJHA 2YNGB 4A8MP 2ZH5A 3R5DA 1VIXA 3GILA 3LWMA 4OX6A 5FD1A 1QVGR 4ZPVR 1BC6A 2RS2A 3UCGA 4KHPF 1QAYA 2R4FA 3N5BA 5T41A 3N9UC 3M2RA 5AXMA 2CZVC 1RT1A 2J6UA 1N54B 1ZM3A 3KNGA 1ZTWA 1JIHA 1XC9A 3PEJA 3MD3A 3ISNC 1WF1A 1JLQB 4YP3A 3IN5A 5GAEU 4X4RA 2RDJA 4P6QA 2LKZA 2MQPA 4IYQA 1S1VA 3MMCB 2VG7A 1O8BA 3QJJA 2QA4S 4Y2KA 2LXFA 4I4BA 3BR8A 1RT2A 3PO5A 2OPQA 4IFYB 3CF5Q 2D3OR 2WONA 3H2LA 3TVKA 1QAJA 2FJVA 4I6WA 1S9FA 1F2GA 3T19A 1TK5A 1IJEB 2C3OA 1M0SA 1T3OA 1FF2A 2DGVA 2J76E 3K8VA 5E0OA 4X62F 1RT6A 2ZJRQ 1U6ZA 2YKMB 5KOXA 3NRBA 1Q79A 1X9MA 2AJ4A 1S1TB 2KRBA 2XI3A 3G6VA 2RRAA 4TYBA 1N52B 1K8AT 5HI7A 2B3TB 4DSEA 1S1UA 1TFWA 5KG5A 1HNVB 3DXSX 4H4OA 2M9KA 1SL1A 2G9OA 4ZK7M 5KFWA 4X2BA 2CZ4A 4DWIA 2JFKA 3DRXA 5IM0B 1S79A 2E1AA 5G4DA 1JJ2R 3TQ1A 4B9NA 3HJFA 3X1LB 2VOPA 2XGPA 5EHHA 3H5XA 4C98A 1NJYA 1GNKA 2UUTA 5F0UA 3S8SA 4IKAA 4AYBD 3BO4A 5FDLB 3CDUA 5A0YB 1R31A 4YMEA 3U1MA 3OSNA 2HGNA 3RB0A 4CTAA 2A2CA 4R5PA 2RNEA 1XR5A 4EUVA 2OPPA 3K58A 3CCMS 1TKZB 2WSCC 4OHYA 2MQNA 4A8WA 1RT7A 1C0UA 3MPVA 4RBTA 3PKYA 2FHJA 1ZTTA 1ZYQA 4WU3A 1T95A 2AGQA 3GIKA 3D0IE 4EFAC 3M8RA 1SIWB 1TVRA 3GWCA 4XO0A 3FVYA 1ZETA 2XSFA 4V19J 4NYZA 2R2TA 3BREA 1U48A 2R8HA 3MXHP 2KG0A 5KG4A 5J2PB 3Q2SC 2KJWA 3RAQA 5A8RA 4A48A 2CQCA 5DRKA 1G1XA 2X51A 4I2QA 3FQKA 4ED1A 2AYGA 2FVPA 3KJVB 2WBMA 3CULA 1XNRF 2ZNYA 1HWUA 3FFIB 3MHYA 4QPTA 4JV5F 5FJ4A 4QYZJ 3VWSA 3OUYA 2V2KA 1R27B 4NCBA 3HP6A 2RJZA 4N47A 2FJEB 3LP2B 2Z0GA 2VG6A 2VFSA 3K2YA 3NLCA 4JUZA 2J0WA 3D54A 4J9MA 2C42A 2AW0A 1SKWA 1M1KT 4ED2A 1U6BA 4KKOB 4MMOA 2IMOA 1U1KA 2UXDF 3CB4A 1DRZA 3JAMY 4CNYA 4KE5A 4TQSA 1FERA 2ZD1A 4WKRA 3B82A 4OMFG 4Y2MA 2KXNB 5H9FJ 3KHHA 1NK6A 3MEDA 4PG4A 3OL9A 5H9EJ 3D1HA 4J9QA 1RTIA 7FDRA 4DV5F 4A8SA 4JI7F 4RNHA 2LECA 3T1HF 2KZZA 3QO9A 4DL7A 4G1QA 5M2RA 4KGKA 3DMJB 3WBZA 4QYRA 3BGFA 2J0QD 2HFNA 2R8KA 2YKNB 1MU2B 3UNGC 4XPEA 2BR0A 5KG3A 5LL6d 4TU9A 4RLEA 2WONB 3PZPA 1K73T 4DR7F 4MKAA 2FHMA 3BSAA 3N01A 4KQZA 2XCAA 4P2SA 4BWMA 1JLBB 4CH7A 1E6YA 3DRPB 1DLOA 2KFZA 2MZQA 2ASJA 2PMHA 3CCES 4XIUA 2ZOFA 1H38A 3NGKA 2XS7A 5B09A 2LYVA 2ZH6A 3ULHA 1JLQA 4BHQA 4DDFA 4PG6A 4O44B 4RW8A 3M32B 2F8MA 4NL5A 2JEIA 5I3PA 5B0GA 1Y5NB 3DCAA 2DRBA 4N76A 2DNOA 3IFEA 2E5LF 4OI2A 2KRRA 2ZITA 4F3MA 2RMLA 2MKHA 4O4RA 1FRKA 1C1BA 4RZRA 3H5YA 2MHEA 4E98A 2MYFA 2QO3A 3KKFA 1NK8A 3DRRB 4ETXA 2DNLA 4NWBA 3OR1A 2XWYA 3DM2A 4Y34A 4LUBA 4WK3A 2JH3A 2PA8D 3TP2A 2VUGA 2VL1A 3CXCR 2KJVA 3GV5B 1JLCB 3KLEB 2KFYA 1RT5A 3DRYA 1SL0A 1V9OA 1RTHA 2DB1A 1HNWF 1S1WB 3ZZPA 1R6YA 3DN9A 3V5RA 3W7BA 5B0BA 1YQHA 2IFXA 2D41A 3IO1A 5DQHA 4N56A 3AJ1A 4JI8F 3F73A 5ITHA 3C3LA 2PI4A 3EPIA 2NPFA 3OR2B 4C8MA 1QE1A 3PRBA 2B51A 2GHWA 1GTHA 2RU3A 4OIXA 2CQIA 1BY9A 3BJYA 1B0PA 4YB5A 4L6V3 3KTQA 3I56S 1O0PA 4YHHF 2U2FA 1RKIA 4M5DA 4YFUA 4C8ZA 1LXNA 3QJPA 2OTJS 4PR6A 2CPIA 5DM7Q 1D9AA 3F44A 4P7TA 4YB7A 4K4VA 1JKHA 2HHXA 4AFFA 4IH5A 4A4JA 3CJ3A 4QIFA 2MMYA 1HNIB 2PA3A 1XK8A 2HHVA 5GAEI 1CSJA 3HHDA 3RYLA 4K50A 1FRXA 2VZ9A 3CCVS 5C5JA 3R5BA 3IA0A 2E9TA 4KHRA 5LJ3Y 3PO4A 2GA7A 2UUCF 1AUDA 2HVIA 1HW8A 3VZIA 4HVZA 3QGIA 2X1GA 1KHWA 3LP2A 4OQJA 2DJWA 4UW2A 3TX8A 2C3YA 1Y5LB 4LSNA 2V94A 3IWLA 4J5OA 4DV0F 3GV8B 2ZUGA 4DLEA 1SI9A 1SV5B 1Q82T 5BJRA 3US5A 2ZZMA 3RBEA 3EGNA 2ROPA 2HQ3A 3CCTA 3EXCX 5DDQC 2V8VA 4LFCF 2KVIA 2QEXS 2EBGA 3MM9A 4FXVA 3Q8RB 1T3NA 1TL3A 2AGPA 1IKWB 4LIRA 1VIOA 4I67A 1UJ6A 4WTYA 4WYWA 3PACA 5B0DA 5L1LA 4GKJF 2IAJB 3M8PB 3DDKA 2UXCF 4ZPBA 1SJ1A 4TQRA 1N48A 3FQLA 2MKJA 4RNOA 2ILYA 2V0NA 3UD3P 3MF5A 4Y00A 2ZOGA 1RTJB 3J81Y 3ITHA 4KR0B 3OR2A 4DN0A 4JV2A 4OZ0A 3S6EA 4OJ1A 2X1FA 5DLGA 3CD7A 1M5KC 1DQAA 2DNHA 3GR0A 3LAMA 2CDQA 1SB6A 4KO0A 5D78A 1UWBB 2R8IA 2K1RB 2V4RA 4G1QB 5HP1B 2AD9A 2OPPB 2GHVC 2ZDOA 3IRXB 2CPFA 1NKEA 4PPDA 6FD1A 3MDFA 1VHFA 4QWEA 3NS5A 2ZD1B 1C4AA 1ZZFA 3TAPA 2LQ9A 2AJFE 2JEFA 4DQSA 4B9TA 4NZ6A 2MSTA 1HYSB 3VCDA 4KKOA 4KAIA 1U2FA 5CD4H 5HQ8A 4JI5F 3R5CA 1LWEA 1N32F 2PC6A 2EBEA 2Q3PA 3C8YA 4RX6A 4IRDA 1FXRA 2HHSA 2J5AA 3IWXA 3ZZTA 3QIPB 5D4NA 4ELTA 3UR0A 4F4XA 1JLGB 1VMBA 3WZ0A 4U67Q 1S0OA 1L3UA 4O23A 4IG0B 2HS0A 3V2UC