2XYPB

Caspase-3:cas26049945
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xypB00
2H5JB 2H4YB 2DKOB 3R7SB 2H51B 2HBQB 2QLFB 3D6MB 3IBCB 4ZVUB 1QTNB 3KJQB 2QLJB 1RHUB 3R6LB 2QL5B 1NMEB 4ZVRB 1RHQB 3GJRB 2XYHB 2C2MB 2H5IB 1RWMB 1RHJB 4ZVQB 2CNLB 2C2OB 1QDUB 2CNKB 4DCJB 3GJSB 4ZVSB 2H4WB 1RHMB 3NS7B 2CDRB 5IC6B 1I3OB 2CNNB 4ZVPB 1F9EB 2H54B 5IC4B 3P45B 2CJXB 3GJTB 1SC3B 1RWOB 2QL7B 2HBYB 3R7BB 2P2CB 1GFWB 3GJQB 3R5JB 3R6GB 2CNOB 2C1EB 2XYGB 2XZDB 3RJMB 4LSZB 1PAUB 1IBCB 3P4UB 3KJFB 2H65B 1SC1B 3EDQB 2XZTB 4ZVOB 1RHRB 2H48B 2XYPB 1RWKB 2HBZB 4DCOB 1RWWB 2FQQB 2HBRB 3D6FB 2QL9B 1I51B 4ZVTB 1BMQB 2C2KB 3EDRB 4DCPB 3IBFB 4JB8B 1RWPB 5K20B 2Y1LB 1SC4B 1RWVB 3KJNB 3QNWB 3R7NB 2Y0BB 2CJYB 1RE1B 1RWXB 3SIPB 2C2ZB 1PYOB 1RHKB 1RWNB 3D6HB 1ICEB 2QLBB
chains in the Genus database with same CATH superfamily
2UXDF 1NJYA 1JLFA 1T9UA 5AJ3F 1JLAA 3QFWA 2ZBRA 1RTDB 4I6YA 4UUXA 4C7QA 1RHUB 2UU9J 4PXCA 1S1VA 4NCGA 1WC4A 3QLHA 3FMBA 2IJNA 2ADCA 1UJ5A 1N54B 4WJBA 1HBUA 2EEYA 3NWGA 1P8GA 1N5SA 2ZUGA 3NAIA 1H38A 3D28A 3QSYB 4NCBA 4IH6A 4UTGA 3MEEB 4FNIA 4B3RF 5LL6d 2BYCA 3LO3A 5KFOA 4K4UA 4PWDA 2WB1D 2XC9A 2VFVA 3RGIA 4DU7A 2C2RA 4GMKA 4J90A 3UD4P 1RTIA 2VFSA 3P96A 1E6YB 3NNCA 4KSEB 1S0NA 2XS5A 2CPZA 2CZ4A 1NSKL 2KDOA 1C1CA 1I5OB 4LSLB 3H20A 1X5PA 3H90A 3DOLA 2H4YB 4B3TF 3QJJA 3IBCB 1KOOA 2UVRA 2XM3A 1C4AA 2EC2A 3CW2C 1DURA 2DB1A 3M2RA 3NLCA 1RWMB 4OI2A 3RAXA 2CPHA 1SIZA 2BOPA 3ZNUA 3CSKA 5KFUA 3WDOA 1QAXA 3M1VA 3NS7B 2CA9A 5CYQB 4UZBA 4YQWA 4JI5F 4MIAA 1WC5A 4JYAJ 2AKWB 1WOOA 2FHMA 1OQ3A 2IA6A 3BDPA 2JEJA 4NPOA 4QPXA 3Q23A 3SSSA 1NRKA 2DK2A 3BO2A 2IMWP 2BR0A 4JI3F 1VC6A 4KIAA 4XPEA 2N3OA 2VQEJ 4G1IA 4H4OB 2QFIA 2B4OA 3CULA 2GGPA 3UFCX 2QTWA 1RE1B 3S01A 1TMMA 3KG4A 1FWKA 5CCLA 2XLKA 3NOCA 2IHR1 1F1BB 1FESA 1CS4B 2I1RA 1ZTTA 4HLBA 2PSZA 4FVCA 2IAJB 1D09B 2UVWA 4KR0B 2HZAA 3QGPA 4BLGA 4OHYA 3G8TA 2XB2D 1OPZA 1Z1ZA 5L1KA 4NLTA 3TW0A 4X4UA 4NRTA 4NE9C 1DJ0A 4LR8A 2NREA 1AXQA 1WTFA 3KDNA 4GVBB 1JLBA 1S6OA 1LWEA 4DL3A 1KBRA 4A8WA 3HFZB 4IOBA 2YKNA 4USHA 4WXOA 1FDAA 2ZNZA 2OUGA 2CAJA 4A47A 1FXDA 2FVRA 1IXKA 3L9ZA 3GV5B 3KHRA 2W2QP 4ZPTR 2NXUA 2VFTA 3LP2B 2EVZA 5MAOA 3KMQA 3L7OA 1RAGB 4TN2A 5C2GA 4EK2A 4ETZA 3Q22A 3S7RA 1RWPB 1XR7A 3D6TB 4DQSA 1RT2A 3NMAA 2M70A 1CJUB 2YXLA 3IFEA 3LGMA 2MQPA 2CPEA 1WEXA 2DR6A 2VC0A 3AJDA 4B9VA 3ZO7A 2HZVA 1T94A 4USJC 1VGYA 3VGTA 4K0KF 3Q2SC 1U49A 2IM0A 1Y00A 1TV6B 2EFVA 3SEOA 2YKMA 4HT7A 2OELA 1BQXA 2B7BB 2DH8A 2W1BA 3EWGA 4PG5A 4LREA 4XIUA 2VOPA 1JLQA 1HIYA 2P2CB 1U0HB 1TAUA 3MI7X 2DTJA 4DJBA 2NUUG 3MFHA 4A8QA 3IC1A 5HK4A 5J2NA 4E98A 4LSZB 2A0FB 4AFFA 2D3OR 3ILJA 4PCQA 3AOCA 5J2PA 1PJ6A 2FVSA 2IJFA 1NK7A 4KB7A 5L9NA 5C24A 3LH2S 2DNZA 3J80U 1QSLA 3IA0A 4KRWA 1NHVA 1U2FA 2IYGA 5F9LA 4ED8A 4DSKA 3PV8A 2G2ZA 2ZH3A 3QAEA 2J7WA 3GFYA 1RHKB 4EEYA 2WAQD 1KNZA 2CDQA 3WIUA 5LXRA 1HYSB 2HGNA 5IT4A 3A4TA 4I2QA 1R3NA 4ZVRB 5T7LA 1NB2A 4PR6A 2ALYB 1QUVA 3VQTA 2G2YA 1HMVA 4PQUB 2Q79A 4RR5A 3TZXA 1OYEA 2GFFA 3DRSB 2ZHOA 1X31C 4CO1A 1VBYA 2OPPB 2JZ5A 4NCAA 3AA8A 1FWLA 1BE4A 1S5ZA 4ZJOA 4ED2A 1XN9A 5KFQA 2Y3YA 5GMEA 3GR1A 4HACB 4ILRA 3OL9A 2GQ2A 2VG7A 3TR5A 4YDXA 4AQYF 1KC8T 1U8WA 2RF2A 3JYTA 4DFMA 2CWKA 2V68A 2DGOA 6FD1A 4JV0A 1QVGR 3D6MB 3W2VB 4IH7A 2XQCA 2DGXA 4F4KA 3M7VA 3PJ9A 1SV5B 1TKDA 2D3O1 2KTQA 3R6LB 4IRKA 3UQSA 1IBMF 4NXNF 2ROGA 2XBPA 4YHHJ 2KYXA 3ZZOA 3VTIA 4WWSA 2BE2B 3K17A 3MCSA 4A8MP 2B6AB 1X4EA 5HQMA 2BE7D 5KFTA 4ZN1A 2R8JA 4RW9A 2F8MA 4UF4A 4ZVPB 4ENOA 1GH8A 3MGJA 2FJBB 1KVKA 2MY8A 1FRIA 1EX8A 4P52A 3UVJA 3GB0A 5AXKA 1EP4A 1QY7A 3G87A 2LQ5A 4RNMA 5E2QA 4DR1J 1UVLA 1AW0A 1PC4A 2GO9A 5KAKA 1IBCB 2RHSB 3KJFB 1SC1B 2XCPA 2E5IA 3HVWA 3AHPA 3HMJG 3IRWP 3Q8SB 1S79A 4TNOA 1LWFB 3KMSA 1ZA2B 2W2OP 1EETB 3BDEA 2XY5A 3BREA 4JI8J 2HG4A 4ZA1A 5HROA 2BKNA 3Q8PB 1MNEA 4U67Q 2EG2A 5ETPA 2HQCA 4U9RA 3VCDA 5HQ8A 1FKOA 1RT1A 4PG6A 4GKJJ 2OMLA 4UW2A 2MXYA 2W9AA 4FYYB 5KG7A 4A8SA 3CVKA 2QLXA 4Q8FA 5KOWA 1NB7A 4K50A 2CPYA 3LP1A 2VKRA 3CJKB 4JOUA 2CXEA 1IWGA 3W62A 2CJQA 3MM5B 2XMAA 4F25A 4CNYA 2LQ8A 3M30B 3A1YG 2ZH1A 3BQ1A 2HS0A 1AZSA 2J0XA 4IKAA 3A13A 1T9TA 3CPWR 3FC9A 1TELA 5IWAF 3DGVA 5ETLA 4DSLA 1X7VA 1BD6A 5HATA 2EBGA 4PUOB 2J8SA 4M5KA 4KGKA 1HNVA 1NBEB 3G9CA 3NOGA 4QPTA 4I64A 3DM2B 5E3AA 4Q0BA 3N4WA 3IWLA 5FLXY 2G13A 2KZMA 4ED4A 1GMUA 4M5JA 4DL7A 1YJ7A 1L3KA 4Q5VA 3PW2A 4ZVSB 2FLOA 1Q5VA 4F4AA 4USIA 2ZC3A 1NM2A 1K44A 2B4PA 4BC9A 2ZH9A 4OZ3A 4C3KA 5ITHA 1L3UA 4LF7J 1S1VB 4NCGB 2HHHF 4RW4B 1G1XA 2G1HA 1VCTA 1WI8A 1HBUB 3PEHA 2V8GA 3FBFA 1TUWA 3MCMA 1XJWB 4F02A 2ZITA 4P75A 1CG2A 4P2MA 3Q8UA 2B9XA 3VGSA 1KVJA 4PWDB 5CAAA 3RUBL 3DLEA 5B7WA 4LF8J 4ER8A 4QU7A 3M6XA 1RTIB 4FYDA 3EXCX 4QWAA 4P2FA 2WSFC 4KHPJ 1YTYA 3D9BA 3NNAA 2POKA 3MR5A 1X0PA 4ZVEA 1OY9A 3MHYA 1S6UA 5KFGA 3NWRA 2BA9A 2R2UA 2H5IB 2MQLA 1JX4A 4NOHA 1I94J 4AL7A 1C1CB 4N77A 2QYGA 2QO3A 5HVGA 2IBOA 2JC1A 2MEWA 2DR7A 4X4TA 4F2SA 2YPYA 5KFCA 1FJGJ 4K7QA 4LIRA 5AT1B 1M1HA 1NK8A 3CJ3A 4M1KA 2V69A 2HKEA 4ID5A 5SZTA 3M2RB 4F3QA 1LK7A 2JEIA 2VONA 1PG5B 1RWWB 4TLQA 5C7PA 2BANB 4DN0A 4M5IA 2M9KA 5KFMA 5L38A 1PYSB 2U2FA 3BYRA 3DC2A 2IM1A 3C8YA 3FGVA 4QOTA 4WBFA 2H5JB 2ZE2A 3PW0A 3KNAA 3MM8B 1N32F 4ERDA 1HR0J 2GGPB 4FVMA 2VJVA 1RHJB 2HQ3A 5FD1A 2QSWA 1UZHA 2R2TA 4OYPA 2VBYA 3A8EA 5A8RA 5GAGI 3MECA 4FYWB 4YN3B 1SJ1A 2UV8A 4F3OA 3M2UB 3VWSA 2MKIA 3J7A1 4RU2A 3W2WA 2Q6CA 4U8VA 4UOFA 4CO5A 2ZOFA 1S9EA 3EVWA 5U47A 3JSYA 1NXIA 5F0UA 2FVPA 2H48B 3OR2A 1IKWA 5JVHQ 4USWA 3MF5A 5GMKa 3VHQA 3M8PA 2AGOA 1Q53A 2XG8A 3B4DA 2IM3A 1LWEB 3W9IA 2NSBA 3EGZA 4ED5A 3T1YJ 2D9OA 2YKNB 4JI6J 4F8RA 2HNYA 5I42A 1V3SA 2D9PA 4LBHA 2CQCA 3L3CA 3OTOJ 3M05A 2F4VF 1DQ8A 4ECZA 4FP9A 2DHHA 1IM4A 3MDFA 3HO1A 4M8LA 2DCUB 3NEKA 2ZJQQ 4E8UA 3OL7A 4JI0J 3ISND 3R5JB 2Z4PA 4ZIVA 1J5EJ 1FWPA 5LJ3Y 2OFHX 2W9BA 2HVIA 4LQ9A 3OUYB 1HNIA 2YKMB 4ECTA 2HFSA 3T1AA 2C22A 4GKKF 3K8WA 3A8JA 3PW5A 3GQCA 2FD2A 1JLQB 4U8YA 2FLPA 1N56A 3HFVA 3M9OB 4IRDA 4JV2A 1UKUA 3JQJA 1Q8KA 3KLEB 4KTQA 4LF5F 5F8GA 4PG8A 3J7ZT 4OMFG 2DPJA 2AYBA 3GLJA 2PE8A 4ZJLA 2RU3A 5K9FA 4OQJA 2HLUA 1DTTB 4ZLNA 3JSMA 2UP1A 2DISA 3T1HJ 2FHJD 2MKYA 3TRGA 4RW7A 5T7LB 4A48A 3PEJA 3CD7A 4ECSA 4ED7A 5A6PA 4N8NA 4CH7A 2Q66A 3M8RA 1HMVB 3QZ7A 3CO0P 1QAIA 5ETNA 1XMOJ 1JK9B 2IC3A 3L09A 2XMJA 3NGUA 2QJ3A 3JQKA 5IT0A 2DXEA 3MM9A 4NLRA 1PYOB 3BSCA 4WIIA 3A3OB 4KGVB 3T9ZA 2ROPA 4DV3F 4HTIA 4J7CA 4GRSA 2VG7B 4AE5A 2KHCA 4X4QA 1S6QA 5ETQA 4ETXA 2VBZA 2EFNA 1YBUA 4NL5A 3KLHB 2RF2B 2VQFJ 3IG1A 2B5JB 3PKYA 4K59A 1DAXA 2OSRA 2W24A 1B70B 4DR4J 3W8GA 4IQMA 3PX4A 2CQ0A 1UWAA 1NDLA 4ZPWR 1D3WA 1X4HA 3N0VA 3BN4A 3NXZA 3QO9A 4DLGA 4X2BA 3G71S 3SFGA 3J81Y 1KFSA 1N33F 4RW9B 1A9NB 4C8YA 2WRMA 2E5LJ 3UVJB 5K20B 1UCNA 3SQGB 1EP4B 2GVZB 1NHKL 4TY9A 5BR8F 3GYXB 2XMMA 2R7UA 1X4CA 3AODA 3OVBA 2AZ3A 2VC1A 5IT9Y 1UEVA 1VQSA 3GSIA 2VH7A 3DGPB 3MMBA 3J81j 2HHQA 2YPZA 3K7RA 1N5YA 1WHVA 3ILLA 3HFKA 2B9EA 5EGYA 1NMEB 5MLCV 2VDHA 3QT8A 3VVTA 2EFOA 1HWJA 3TARA 3DXBA 1RU2A 2JRSA 4OJGA 3D5MA 3VAHA 2DHAA 1F9EB 4DR3F 4Q44A 3A3NB 2N4CA 5KG5A 4NXMJ 3R6GB 3HT0A 2AEMA 4DZDA 1S1WA 1S48A 1IBKJ 4F50A 4J5OA 5KOXA 3KK1B 2HLTA 3AXMA 1HBMA 3RZAA 5HMZA 1RYSA 1FRLA 1TTHB 2ZH5A 4G1PA 4K2JA 1XNRJ 3LP1B 2W4PA 3VAJA 3AH6A 1O51A 5FLXU 4DOZA 2VDIA 3CO9A 1RWXB 1MMDA 1NSPA 5KT6A 1HQEA 2DGVA 2E5HA 1GX6A 4DFKA 1T7PA 4NASA 3CCLS 4O3QA 5CH7B 2Z8QA 1AZSB 2YNFA 1R8HA 3TX0A 4DV5J 2ZJPQ 4JI4F 2ZD1B 2W2MP 4USMA 5K14A 5AJ3J 1IUJA 2KXHA 4O0IA 1S59A 2BXJA 3TA2A 2YH1A 1U24A 2VPXB 2MZRA 1F60B 3RAQA 4ANCA 2GJ2A 1SC3B 1WKKA 1X4GA 5G0RA 5KFAA 3MAAA 3CCZA 4OLPA 4Q0BB 5CQGA 3VF0B 1Q8BA 1FRKA 4DX5A 3W5XA 5EWGA 3TP2A 1ZAWA 1TR0A 5DJBA 5GADU 4NLGA 4B08A 2E9RX 5E7OB 1QLNA 5DM6Q 2CPJA 4MKYA 2ROEA 4OYXA 4OYAA 1RWNB 2XMWA 2GA7A 3DOMA 2ZZNA 1LW0B 2YWWA 2OEKA 1UETA 1T9XA 2MSTA 1DQAA 3BR8A 2KFZA 4DV2F 4JI1J 2CG8A 3P5BP 1RKJA 1VI7A 4ZS6A 3DLEB 4B3TJ 1RAAB 3W64A 1DRZA 4I6WA 3QRQA 3PRVA 3BSNA 1M0SA 2DH9A 2K3KA 2QMUB 1LOUA 4K5SA 5A2QY 3NS6A 1WSVA 3CB4A 1C0TA 5DO2A 2VF3A 4Y2KA 5H1SV 1WC3A 4QYZJ 5J1NA 2HWTA 2MY7A 4JI5J 4DSFA 4OIXA 2V67A 1RHRB 1NDCA 1PJ7A 2BEFA 2BM1A 4DQQA 3FEXB 4C6AA 4KQZA 3DU5A 2MTLA 3S1TA 3KTQA 3PIOQ 2DNOA 3AQPA 2JDJA 4KGZB 2QL7B 1SUQA 3ILIA 2UZAA 5KG6A 1KHVA 4DS4A 1H2TZ 2F5GA 4ES2A 2VIHA 3V81B 3WIVA 1TK5A 4FYXB 2YQ0A 5CHCB 4RUHA 5F41A 2OLWA 2KT2A 2VB6A 4OYOA 4CO4A 5I3UA 1SI9A 2IPOB 2LEBA 5L1JA 1U6BA 1T9VA 4HYKA 2ZE2B 1RLDA 3I55S 2GO8A 2QA1A 1GFWB 1FHTA 1Y3KA 4NA1A 2AJ0A 3NGSA 1K1QA 1S4EA 4CT9A 2HHPA 1AB8A 5A8RB 2GHWA 2H5EA 3MECB 2MQQA 4P73A 2M7SA 3CIZA 2HAIA 2R7XA 4OYMA 5J1EA 1G2EA 1ZM9A 1IKXB 3U1MA 3HVRA 3DLKB 2OMOA 3D68A 2L9NA 4LF6J 1R8PA 5THWA 2BRKA 3WC0A 2JEGA 2V8VA 2DO0A 2U1AA 2YNIA 5DM7Q 4ED0A 1W2BR 3QZ8A 2MZSA 4IG0A 1SH2A 3M8PB 1G4CA 2ZDPA 3ONQA 3KOAA 3EGWB 1FRXA 4UQTA 4IDKA 3BF4A 2MZ1A 2GHVC 4O4RA 1YQHA 4WCEQ 4Q43A 4ELUA 3MTJA 3C16A 1H2VZ 2HNYB 4DV6F 3O3LA 4CZCA 2LLZA 3V5RA 3M32A 4QQBA 4LFAF 4K0KJ 4O3OA 1SC6A 1A6LA 3B6BA 3GIJA 1VQMS 5C42B 3E2EA 4WZQA 1UFLA 4MKVA 2FHJA 3ITHA 3CJRA 1TKTA 4ZPCA 3RR7A 1TUVA 1IBLF 2XSFA 2FIUA 2VG5A 4ES3A 4DX7A 1YBTA 2YX7A 9RUBA 4IFYA 1GX5A 4IUFA 5D4OA 3H5SA 4OZ5A 2BJ7A 3QIPB 3IGVA 1WNEA 2B51A 2A3JA 1QVFR 4YB6A 1XTZA 2CQBA 5DG7A 4C8LA 2AW0A 4JV5F 2VG6A 4B3MJ 4DUZF 5LMUF 3AOBA 4KH1B 1O6XA 4L3NA 3BGLA 1KR4A 3R3TA 3IWXA 5ETKA 1KDNA 2AD9A 1HNIB 2NS1B 1RT7B 4MK7A 1FDNA 3H2UB 2RDIA 4HDHA 3DCAA 1R89A 2WVCA 2CG4A 3W3SA 4RW6A 2DHSA 4EO8A 3EX7B 1FNOA 1IWAA 4DCJB 1S10A 3I56S 1FRMA 3GR0A 4DUYF 1MU2A 2O01C 3Q0AA 1UFWA 2BJ1A 4IRCA 5HBMB 4WE1B 4X66F 2KO1A 3BBCA 2HHVA 4YB1P 1FRJA 1KOHA 1OS5A 5ETTA 2UUBF 1YZ6A 1FVSA 3HDSA 4J91A 5BYQA 2UXBF 1VQ5S 1TUGB 1ZAVA 2FJDB 4QR1A 1SQGA 4U96A 3JSMB 3DYAB 1WG4A 1Y10A 1EKRA 3AOAA 2WBRA 2X1BA 5KG4A 4MYUA 4KGXB 4RW7B 1ZPWX 1U4BA 3SIPB 4HHJA 4RO0A 3BSOA 3UDCA 2V0NA 4AQYJ 5H9EJ 3MMCA 2ZWPA 3SV4A 1FF2A 4X64F 4ED1A 2OO4A 3BKTA 4C8KA 1S99A 1X5OA 4KBIA 2IC3B 5AE3A 4ZJQA 3B4MA 2N7CA 2OD4A 3MM9B 2A18A 3BV8A 1HQUA 1Z4UA 4WKRA 4CO2A 2X7IA 2JLEA 4C8MA 1JJ4A 1IBMJ 1REVA 4ZVHA 1VQ4S 1R31A 2LXIA 3M9MB 2V50A 3UN3A 3LTOA 4Q2LA 5KT5A 1QSSA 4F7VA 1S6QB 4ED6A 1NPKA 3HHLB 1BUXA 2HGLA 1YHQS 5IT9U 2HK2A 5H9FJ 2W7PA 1OY6A 3IG1B 3ZZRA 4CIOA 4DX8H 3QGHA 2DR5A 1BC6A 3O5TB 8ATCB 3PX0A 2EFQA 4USTA 1V9OA 2DNYA 2YTCA 2K3IA 4RLEA 3QO9B 1Z2LA 1WUUA 3RBZA 4AUKA 1HNXF 4DPYA 3IAS9 4KT0C 1HBOA 1PKUA 3HSDA 2VOOA 5D4LA 1FA0A 1Q5YA 3TJAA 3NP5A 4TU9A 3DI6B 3SSRA 1YK9A 2B43A 1MWYA 3F56A 1B0TA 1PBAA 2AYEA 2W4DA 1JB0C 1CBKA 1V5IB 2QGFB 1U2RA 3SYZA 2CNKB 2UUAJ 2AJQA 4K4ZA 2HVZA 4OFZA 3L95X 4KV8A 4A4JA 1N0VC 1U1NA 1LEOA 3ZC4A 2N3LA 1RUSA 3MMBB 4IR1A 4CH0S 3GFHA 3TZYA 4MKBA 3NY0A 1R0CB 3GG1A 1JQGA 1U09A 3HF5A 1UEKA 4D3HA 3AT1B 2B9WA 1U26A 1FFWB 2ZBPA 3N6MA 4OX9J 5F8JA 3Q8RB 3UPFA 1I51B 2QYCA 2J9CA 1F6TA 4DG1B 4MIBA 5CXTA 4HHUA 1N8RT 3K5PA 1C0UA 3KUGA 2LEAA 1S1WB 4F26A 1PYTA 5ETRA 5B0DA 1VBXA 1HBMB 2MJUA 3R9LA 4UT4A 1OSDA 4CCHA 5IWAJ 2GZOA 2OPQB 4JI7F 1IQTA 2G1DA 4RZRA 2D74B 1FFSB 4MK9A 2NLWA 3CMQA 2M52A 4IQXA 1PBUA 3KUEA 3G8QA 4EBEA 4DR5F 1AFJA 5HLFA 1R0AA 1Y5NB 3MAHA 2CDRB 4WFAQ 4FXVA 1HQEB 1KTVA 3KLVA 5HN0A 1ACMB 3R97A 3RB0A 3WQPA 4NWBA 1IJEB 2HWHA 1RT5B 4BS2A 2YNFB 2O66A 4C11A 2P5VA 2Z2MA 1RB0A 1YVFA 5KTQA 3LAMA 3F41A 5K14B 1QD1A 1K1SA 4BDPA 4DCOB 1N4LA 1E6VA 3CE8A 1K73T 1ITPA 3PCOB 3IO1A 2JHEA 1Q8IA 3G96A 3GG0A 1UL3A 1FNXH 3PVXA 5G0RB 3HULA 2J6UA 3MAAB 4LF4F 2AJ2A 3JTPA 5H9FK 3G82B 2V8PA 2Z2LA 3F0NA 5A2QU 3J7AN 2NR0A 3TX8A 4NEZA 1RA7A 4CLKA 3F73A 2CQ3A 3MEDB 5KFVA 4KJIA 1M1GA 3P3DA 4ZDNA 2V94A 3GJSB 2F9DA 4RW8A 2HSEB 4I69A 2HQDA 1HI8A 1XQIA 4V1Ak 4AXJA 3DOMB 2L9DA 3TA1A 1Q16B 3DNCA 2HBYB 1S76D 2ATLA 3IAM9 3WX8A 2HZCA 3OT9A 4ECWA 4RUCA 3C6TA 4WU2A 3MM6A 3MM7A 4QBUA 2G0IA 2IVYA 1KKHA 2E1RA 3OFEA 1WSRA 3N5FA 4GVLA 3RB6A 1FVQA 2Y0BB 2WVDA 3PJXA 2FGOA 2HFNA 1VBZA 2XHCA 1GK8A 3ETOA 4DSEA 4B17A 2P9EA 2E5GA 3NBPA 3FMWA 3WX4A 1RSCA 2RT3A 3R5AA 1LWCB 4WF9Q 1BQNA 4N47A 4FNHA 4FBUA 2CQDA 4PXBA 2Y0SD 4UQGA 2MKKA 3DN9A 3KLGA 2AEJA 1N32J 4DR2J 3OPKA 5B0GA 1NDPA 2CPFA 3DMJA 3D0GE 4CLPA 3PR5B 1SUQB 3I5BA 1B64A 3TA0A 2M8DB 4HTJA 2LQJA 2KJWA 4CLLA 1TZ0A 3I4HX 1RISA 3GIMA 1RTHB 3DU6A 1FTCA 4ZP6A 3I4PA 2NXNA 2FZKB 5I3UB 1PO6A 2CIMA 3GSDA 2WVBA 4D3GA 4ZCKA 1YG0A 1DHMA 4EBCA 2KFNA 3MCOA 2JVRA 3KHHA 3OV7A 2CJKA 2FDNA 4R25A 2GCFA 2QZ8A 3MWBA 2X3GA 1ICEB 3OLAA 2LMIA 3IMQJ 2J5AA 1S7HA 3W7BA 4PXEA 3GILA 4DS5A 5EWFA 4ECYA 2AIRB 2LDIA 4M5NA 2W8KA 1BWVA 2ASYA 1HNZJ 4J9RA 1S1UA 2D69A 4DFJA 4LRBA 1L5UA 4ES1A 4M94A 4G3IA 3NGRA 4QIFA 5L46A 5EN1A 1SKUB 2Q1LA 1NPPA 2ASJA 4FF4A 2HFZA 2YWHA 2ZWOA 1O8BA 1I3OB 1MMLA 2CNNB 2F4VJ 2QFJA 2ZOMA 1WTBA 3JTNA 3DRPA 3G86A 3OL6A 1URNA 3TEGA 4JYAF 1DTQA 4IG0B 1MROA 2KN4A 3Q24A 2HRUA 5C25B 4J9MA 3IR7B 2R3VA 4QW9A 3C16B 1WJ9A 2Z2YB 1PCAA 2WTFA 1UA1A 2VQEF 4OHVA 2RH3A 4WZMA 2VZ9A 3IBFB 1B99A 1NNDA 1U6FA 4DV1J 1Y5IB 3CDUA 1ZZNA 4IFVA 1JLEA 5D3GA 1TKTB 2XWXA 1F9FA 4H54A 4GKKJ 2PGCA 2R2SA 2VG5B 3PRBA 4PWWA 1QTNB 5KFKA 3DRRA 3SCIE 2BW7A 1OYDA 1FERA 2VUGA 4K2XA 1VQOS 2D1CA 2AJFE 4NLUA 3V6KA 2Q6BA 4LF5J 4B3SJ 3CD6S 2FZGB 3HJFA 1CLFA 5IC6B 4FKXA 2OHDA 3D54A 3P5TL 2KVQE 4XPCA 3D0IE 4WIQA 3VAFA 3PACA 1DBDA 4J9KA 4RW6B 1TKZB 2DNPA 4AXIA 1T11A 3IRXB 4B9UA 3TUJC 1FCAA 4DBQA 2CVIA 1CVJA 2ZBCA 4OI1A 2BE9B 2HNZA 1HWLA 1GXTA 2AHOB 3H4DA 1MU2B 3PY8A 2C3MA 1R43A 5IV4A 2UVVA 1RCXB 2MLXA 1RWVB 1HNWF 4W4MA 2QC3A 2NCKL 1TVRA 2RKIA 3CC4S 4KAIA 2OPRA 5GAHU 1ZM2A 1GAOA 1HHQA 3UDEA 4B9LA 4CT8A 3I0RA 2GHPA 5KFHA 2BJ9A 3M2VA 2FC8A 3FSIA 1T9WA 2XLIA 5D0RA 3H0PA 1UA0A 2XNQA 2FJWA 2V9KA 3IP0A 4PPDA 2FLLA 4FS1A 3W66A 4P71A 2VBXA 4DV3J 3SZ2A 2OGUA 3VAKA 4LJMA 1NSAA 4ELVA 2AQ4A 2HRYA 2E7VA 2DD8S 3MMCB 5F8LA 3R7BB 2BM0A 4YR3A 2Y1JA 3MFIA 2G4BA 1XR5A 3GTYX 3VAGA 1OPIA 5JXSA 4ICLA 2MZQA 4ZP8A 4MJKA 1HQUB 3D0HE 1YJNS 2ACMA 2JNJA 4K4XA 4M5DA 1BMQB 3MPVA 3CF5Q 1U7LA 1X4FA 3FJ2A 1YJ9S 3DXSX 1N33J 1YJTA 3D1QA 3HHKA 5KFJA 5CYMA 2EI5A 1UPPA 2PO4A 2D3UA 4RBVA 1HBNA 1FE0A 5BR8J 2AWZA 4DU8A 2YWKA 1IM6A 1R6VA 2ZZTA 2CPXA 2LEPA 4N7TA 3EE3A 1YIJS 1QDUB 5IFMA 1J27A 1CJKA 2ACYA 4WFZA 1TU0B 3SSQA 4NLVA 2HQIA 4EI2A 5DLFA 1L3SA 1OWXA 1IKYA 4QU6A 1UMJA 1HBOB 2QT7A 3IGNA 2VPYB 3CJTA 3QRRA 1M5KC 4C2MA 1ZS6A 4Z7CA 2PD1A 2HVHA 1UEUA 2J0QD 2JOQA 3CJSA 2CFXA 1RT4B 4MYTA 3D66A 3TI0A 2BQ3A 2QEXS 2CZVC 3UCGA 3DLGA 4LVNP 4MK8A 3PYDA 2HK3A 4KV8B 5HANA 1WELA 1X5TA 1A0OB 3EDRB 2WOMA 4Y34A 4IG3A 4KKOA 4Y00A 1K8AT 4PG7A 1KSPA 3HK2A 1RTJA 5A8WB 4MMOA 2LXFA 1LW2A 3SXLA 1UW9A 3C66A 2QMWA 3GV8B 4F3MA 3K59A 2LKZA 3FVYA 3K89A 2FJEB 3R1HA 4TVAB 2KYZA 2LU2A 3QPIA 4GC7A 1KWMA 4K5RA 2FB0A 1P1LA 3PG9A 1AFIA 3Q2TC 4KFBA 4MFBB 3P8BB 3M8ZA 4OZ1A 2LVWA 3NS5A 2YNGA 4PAAA 1YRXA 2HHXA 2ZBIA 4DV4F 1OQ6A 2JWNA 2BACA 4JI4J 3ISNC 1ZTWA 3AXKA 1T95A 3LAKA 4O23A 4OX8A 2MSSA 2DIUA 2MHNA 3KFWX 1RCOB 3L4BC 4J9NA 4YDDB 3QGIA 3KK2B 4TYBA 1VHFA 1XR6A 1D9FA 4B02A 2Z30B 4N56A 3CCJS 1G6BA 1R0AB 3BH6B 1SJ4P 2BRLA 2WB4A 1NLKL 1BGXT 4I6AA 2Z56B 2NSCA 4J9UE 5E33A 4C11B 3KXDA 1NAQA 1MW7A 3EGVA 2XSJA 1T02A 3FSXA 1N5QA 4UY8T 4RWXA 3CDWA 1E6VB 3D2WA 2YWGA 3HVAA 4GKJF 2PA3A 4DX6A 2EK1A 2AGPA 2ZNYA 3FK4A 2OD6A 2I5JA 3TJ9A 4CLTA 3US5A 4WYLA 5GAEI 1M5PC 1JWWA 3H4BA 3B8HA 2RIJA 3ZZ0A 4F67A 2F7VA 1FJEB 2YNHB 2NYIA 3R27A 2CNOB 2ZDOA 2BOAA 3R2DJ 4LRDA 3K58A 2ZZMA 2ERRA 1GTEA 3G8SA 1BQMA 1IVZA 3CWJA 3A8IA 2OEJA 2GW8A 3CT9A 1WDTA 5KT3A 1VYAA 2DNMA 2RU9A 3MPUB 4DDFA 4UOGA 5HP1B 3IN5A 4V19X 3TWZA 3EPGA 4GO7X 1Q82T 5DDOC 4LF9J 3QATA 4DR6J 1RT6A 1Q95G 1N52B 2DNGA 5HMWA 5K8OA 4YS2A 1FT8A 3SBMA 1NK4A 2PMHA 3VV2B 9ATCB 1HI1A 1ZH5A 3MM7B 1WG1A 4QZVB 4NLYA 2XEXA 1NEEA 3OXGA 2HWIA 4RPFA 3H59A 2A1BA 1SVDA 1X4BA 1F2HA 2AMCB 3MEEA 4G1QB 4RU9A 1WOSA 4J9QA 3M8SA 4Y28C 2KM8C 5A0YA 1SKWA 3KHGA 1LNQA 2Z0GA 3AY0A 3MUTP 5T14A 2R7QA 5DLGA 5E3QA 1U6ZA 3I5CA 1T0TV 2G2OA 4KY3A 2R4FA 5FJ4A 1S9GB 2CZ9A 4J9VA 3KLGB 1IR1A 1JNZB 2B8PA 3H98A 3DMJB 1UVKA 1L3TA 4QCLA 4ECVA 3C3LA 3GU0A 3GWCA 3BKUA 1TL4A 1S1TB 4H4KC 4I0WA 2WW4A 4LF8F 4I7FB 2VPWB 3GV7B 2DVIA 1VR6A 3KJVA 2P6SA 3CJ2A 2RSQA 2EBEA 5LM7E 4U7UD 3MUVP 3W9JA 1B4SA 2UUCF 2X51A 3HX9A 3FQKA 5DG8A 2CNLB 1I94F 1RBOB 1BHNA 1Y0HA 3TAPA 3CEDA 1WDDA 4EMDA 4QIGA 3RYLA 4IO1A 2R8GA 5LMNJ 2LQ9A 2VD3A 4RBTA 4H4OA 5J1PA 1RWKB 1S72S 3NCQA 2K2PA 4OI6A 1T3OA 2GJIA 4V19J 2DXDA 5D0HA 4B9NA 1Q7LB 4DPTA 1KQKA 3DRPB 1IBLJ 1U8SA 3R7NB 4CYUB 2R7WA 1TL5A 1YITS 7FDRA 4Z7YA 4OX6A 1W26A 2V5HG 1CS4A 2CJ9A 4B9SA 3PJWA 3JS9A 1CQNA 3E3XA 4MT1A 4PABA 4JV5J 4DUZJ 5LMUJ 2YX4A 1NDKA 1RK8A 4ZP9A 4FYVB 4PG4A 1YJVA 1AYEA 2IRUA 1PIEA 1NZAA 5B08A 4HEA9 3V4MA 1JLEB 4O4GB 2FYXA 4WYWA 1W7WA 1V3ZA 3MR6A 2LYVA 4GVBA 1RHMB 4OZJA 4F0HA 4K4TA 4C98A 2Q3PA 4ZCIA 2KG0A 4HH0A 4OZ2A 3PW4A 4I1TA 3DRRB 2I9SA 2RRAA 2RE1A 4Q8EA 3LW5C 3VALA 4N41A 3SQOP 2FVCA 5B0BA 3I82A 3ZZYA 4X66J 3OTCA 1O5JA 2XGPA 2H9ZA 3V4IB 3KK3A 2UUBJ 3U27A 4HR2A 1VQPS 2DNHA 2UXBJ 2B7CB 1NH8A 5M2RA 5DQGA 4TU7A 2AP6A 2RD5C 3P6YC 3BN7A 3OLBA 1U1MA 4CM0A 5JJBA 1N36F 2EFPA 1HWIA 1NPRA 1SKRA 6AT1B 2B4VA 3KJQB 1GQEA 3NKYA 3CCWA 4EZ9A 1RHQB 3OTEA 2GQQA 2YWFA 3OTOF 5E41A 4ECXA 2BABA 7FD1A 2W01A 3QWPA 1JJCB 1TVRB 2RKIB 3DFEA 2OPRB 5DZ6A 2AU0A 2XO6A 4EZ6A 1F5BA 3OVAA 3UD3P 5D8HB 5DQHA 5LSRA 3MEGB 3I0RB 5HQLA 2RDDA 2M3DA 3AD7C 4LFCF 5M2UA 4LSNB 3J7YI 1JXVA 4L72B 5F3TA 5A76A 3HVTA 3NCPA 3MUMP 1B0PA 2DGQA 4KC5A 3BKFA 2ZM6F 3FCWA 1T05B 3OD2A 4N76A 3OFFA 1ROFA 1YJRA 3TAMA 3EZ5A 4TXSA 2DNQA 4ICLB 7AT1B 1B3TA 3O8WA 2HHTA 3OFGA 2G9OA 2YQ1A 3NGTA 1JLFB 4C9DA 2ZH4A 5HJYA 4M5DB 1OJ4A 1JLAB 2FTRA 2J9DE 3ZZPA 1HW9A 3OTBA 3RW7A 3THVA 2L3MA 1NO8A 2Z2ZA 3QLHB 1HNXJ 1D9AA 4KPYA 1LFWA 3SV3A 4WU3A 2HQGA 4LRCA 3PR4A 3DRSA 2FY1A 1VQ8S 2GVDA 1NJIT 1D9DA 2J9DA 2MQ8A 2OTLS 4F0MA 3P45B 3T1HF 1U1OA 1VDHA 4DPWA 2B0GA 3G2XA 5LOQA 1TAQA 4HI2A 2KKHA 1VMBA 3MXHP 3VGUA 1YZ7A 3I96A 3H5UA 2ZFHA 2DY1A 3H25A 3FNNA 2LCWA 3VQSA 4DQPA 1CJKB 3K8VA 3D3CJ 4RKUC 1H6KX 3ET6A 1A7GE 2YVSA 1VLOA 2V2KA 4ZVTB 5I4MA 3WC2A 4X84A 4LRFA 3LA0A 1IKYB 4DCPB 3ZTPA 4WK1A 4A8XA 2PC6A 4CO0A 5KFFA 3DHXA 2IYIA 1SV5A 1VQ9S 3FQLA 5HVFA 3DLGB 2IFXA 4IH5A 4OL8A 3DOLB 5IZHA 2F9JA 3I31A 3POTA 2WOMB 4EYHB 3BPSP 3R5CA 4HHHA 4KKOB 2C3YA 1ZA1B 2OAUA 2C2OB 1U1PA 1K47A 2I0XA 2VQFF 1LW2B 2HVDA 4K4WA 4ANDA 2FY8A 4NLWA 5DDQC 4M5LA 2CJAA 3BQ0A 3RRKA 1ZBTA 2XI3A 1IJFB 3RBXA 3M1VB 3FBEA 4DR4F 3KLIA 3JB9k 4U95A 3CCRS 4DEZA 4DR5J 2M88A 3H42A 3CJ0A 3D7SB 2YNGB 3ZZTA 2PMWA 5CYJA 1H0HB 2ALZA 5HJXA 1LWFA 1F3VA 1RGVA 3BBBA 1WKLA 2F63A 1QM9A 3OBIA 4RL1A 2E5LF 2IDLA 2DCLA 2QG9B 3EVOA 1HARA 4E0DA 3CD0A 4B9MA 5HSPA 2AJ4A 3ZXWA 1TL3A 4BHQA 3NMRA 1CULA 1HPZA 2QLFB 3FCHA 1PAEX 4LMZA 2RQKA 5L1IA 2QL5B 3RR8A 4L3KA 4EWTA 3E01A 3CC2S 1N5TA 4Q45A 3NAHA 1XMBA 1TK0A 2FZCB 1ZM4A 1IKVA 2MZJA 1VBKA 2EPIA 3CJKA 3G4SS 2B9YA 3MM5A 2V8DA 2Q43A 1XWLA 2BJ8A 3HCXA 2I8EA 3MR3A 2BZ2A 2XMTA 3W65A 4Z37A 4NXMF 2DHXA 5KFZA 1JLBB 1IBKF 3HT3A 3U1NA 3THTA 5CA5A 5KG3A 2I5JB 5LSOA 2IY5B 2J7UA 4OYWA 1N34F 1XNRF 4LRAA 1Q0NA 2Y1LB 3KJNB 1M5SA 2XTJP 5D6GA 2JJ4D 4QYRA 3AA9A 1DY3A 2YWEA 1RABB 3RW6A 1RT2B 2D41A 1VC0A 2E9ZA 1W2IA 3Q8VA 4C3LA 4CLSA 5HMXA 1JMTA 1WOPA 3PHEA 4NZ7A 1ZZFA 4DF8A 3PO4A 3LP0A 4K4SA 2V6AA 4EO6A 2E29A 5HVHA 1RT6B 1HL6A 3QIDA 4RJVA 4WP8A 1MLAA 4OHWA 1TK8A 4ZCMA 3CCVS 5KFNA 4RW4A 1HI0P 1WWHA 2B56A 3KG1A 4ZVFA 3V6DA 4FXWA 1KRPA 2AV5A 3L7UA 2R42A 3DLBA 1M90T 4YY3F 5J2NB 2P9GA 1Q86T 4Y2CA 5A0YB 2DNRA 4ZLPA 1N48A 2RUSA 5CABA 5J2PB 4ZMMA 4I56A 2MB0B 4C3MA 2PN6A 5C24B 1J5OA 1RDRA 1WF2A 4URGA 1S0OA 4QR2A 5GAGU 5F8HA 3IR6B 5B0AA 4R8UA 2B3TB 3GE9A 2V34A 2MYFA 4ILLA 4L74A 4I2QB 1U47A 4JI1F 3DRXA 1KQSR 3W5ZA 4N5SA 3ULHA 3JXOA 3VAIA 5AXLA 2VHGA 3KJVB 4NA3A 4EUVA 5FDLA 2D3ZA 2CJXB 3B78A 2VA2A 4A8YA 1RAFB 2CQ2A 4AL6A 4DXLA 5LJ5Y 1PSDA 2MZTA 5J2MA 1TP7A 1RQ0A 1Y3JA 1HD1A 2FJXA 2BANA 4OV1A 1EKSA 3CJ5A 1UW4A 3EDQB 4YP3A 3O6QA 1QAJA 3CMES 4ZPVR 1LK5A 4RWWA 5HL7Q 2Y9HA 3ENWA 1UP1A 3LPYA 3S6EA 1VJQA 1F0XA 3MM8A 3D6HB 1U48A 1IR2A 3JYTB 2JLGA 3HPOA 2MDAA 1LKZA 4EYIB 2V2VA 4LFBF 3M6VA 1D1UA 3GP9A 3TYTA 3KKFA 1KONA 1XNQF 3QMQA 4PZVA 4O3NA 2CVEA 2COLA 3LWMA 1R27B 3DOKA 3SDEA 2DRDA 3M2UA 3PKMA 2EKYA 4IR9A 4HI1A 2QX0A 3UDVA 2NXCA 4K4YA 2MGZA 1WHXA 4OI3A 3ICLA 3WZ0A 3R8YA 4F36A 4KGMA 1ZPVA 2QL9B 1R8CA 3TVYA 1S4FA 2MMYA 4P6QA 2LA6A 4CM2A 1YKWA 4ZPAA 3Q83A 4NLSA 3I0SA 2Z58B 4LF6F 5KFRA 1F2GA 2FHOB 5KFYA 3K2YA 4A46A 1HNWJ 5HROB 3KK3B 1VISA 1T03A 3O44A 4Y2AA 2IBKA 1FKOB 1RT1B 3M9NB 1FFGB 1JLCA 2RDJA 3NCRA 2E1PA 1GMWD 2KG1A 2J6TA 2VL1A 1GNKA 3T41A 2PI5A 2Z57B 4RNOA 3OUYA 3MMJA 3PFEA 1FDDA 1MWZA 1H98A 5K5MA 3RJMB 4DR7F 2WK4A 3GCWP 3UN5A 2V4RA 4WK3A 1NZ8A 1RTZA 1AA1B 1WD6A 2FUG9 1Y5LB 4JI2F 1TFYA 2KU7A 2HHUA 3SMZA 3KLEA 4B3MF 3W61A 3ZTRA 2UXDJ 2J76E 4EU0A 4WP3A 3BS9A 4M5GA 4PXDA 3HVTB 2DHGA 1YJWS 3FFIA 2HURA 2QLJB 1WKJA 1OY8A 3GONA 1VQ7S 4H4MA 4DUTA 1X5SA 2E44A 3RB3A 1HNVB 3EZUA 1DTTA 2I6WA 1H73A 2HAFA 2M8HA 4DV0F 1QJHA 1B7FA 2J9EA 3ENQA 5BYRA 3MOJB 1Q81T 3TAMB 4BBYA 4B3RJ 4QWBA 2IIHA 6FDRA 3N79A 3W1YC 1NKEA 1ELOA 5ADZA 3TUPA 4C8OA 2ZH7A 3GIKA 3FCVA 1RACB 2PEHA 3RU0A 3CCES 3OJSA 3T5HA 2GMLA 3FKBA 2HBZB 4M95A 3PYGA 3FDSA 4C48A 2GVDB 3Q86A 5L39A 3TZZA 2BMBA 1B0VA 2KRBA 3CC7S 4DV7F 5J2QA 4DSJA 3C14A 3K5OA 1P9QC 4L6V3 2IM2A 3C46A 1XIQA 5KG2A 3KWMA 1D8YA 2UUWA 1FJ7A 3T5LA 1AT1B 3HD1A 5LT5A 3MTKA 1OO0B 3ET6B 3T5JA 1XBWA 2P6TA 3KLHA 1WACA 3C19A 3RTVA 2B5JA 4BCAA 3NNHA 3BH7B 3E8OA 4QWCA 2XS7A 5B0FA 1HLWA 4WFNQ 4IYQA 2WCXA 4DPUA 5KG1A 2VU5A 4L76A 3RRHA 2X1GA 1H7WA 3EYZA 5HO4A 1EZZB 2J8AA 2PT0A 4JI3J 4NLDA 3POTB 3AJ1A 4NMXA 3MD1A 4FDFA 1PAUB 4DV4J 2V2QA 4ID5B 2MLZA 4LR9A 2KL8A 2J0WA 3U7JA 3SQGA 1TL1A 2GVZA 3HHDA 4OZLA 3SFUA 4M5MA 3PYFA 3HSJA 4PRFA 4QIVA 3KLIB 4P7TA 1VIOA 4ATNA 5RUBA 3DGPA 1S97A 3AD8C 1J2VA 2KXNB 2QLBB 5A8KA 3R5DA 2HIYA 4X65F 2W7OA 1V3RA 1EAYC 2ASDA 2LXUA 2BUNA 1NK6A 1R8BA 2ADBA 4MTPA 4WTYA 2LU1A 4XDDA 3LWLA 2PDAA 2RUGA 1XEZA 3ZZZA 2LDYA 2V4JA 1WHWA 2H1YA 3ZTSA 3I87A 4J9OA 3EM1A 4DFPA 2UUAF 3EXYA 3J7Z5 1AUDA 1TL3B 5IXUA 1CULB 1HPZB 1GEHA 4BWMA 5DGBA 3HHLD 4FPIA 1GXLA 1EQ0A 2CPDA 1I1GA 4FXDA 3ENAA 3KK1A 2ASLA 4C0HA 2X1FA 1EJ7L 5I3PA 3E01B 3R1LA 2RJZA 1T3NA 3HSZA 2E7XA 3W2WB 1S9FA 3T5KA 2GIRA 1IKVB 3OQ2A 1U1KA 4PYAA 1S9EB 4KH0B 4OX9F 2HBRB 1CJTA 3NG8A 3OR2B 1IKWB 2DNLA 1WC0A 3GYNA 1NCLA 1BXNA 2N4DA 1EB0A 3VZIA 2C2DA 2M4MA 3U02A 5I42B 2FPHX 2W25A 5ETVA 2ZD1A 3PO5A 4B9TA 4X62F 3PXGa 3O1LA 2M0GB 3PFOA 1QTMA 1KFDA 4ZHRA 1ZETA 4Y3CA 3KYLA 3KNGA 3H8YA 2YKOA 5DQIA 2NUHA 4A8KA 2RRBA 1SCJB 3C6UA 5AE2A 4KO0A 1KLMA 2N82B 2H4WB 5E3CA 2BW2A 3EUNA 4PKDB 4YMEA 2OTJS 5IOLA 5EWEA 2DXFA 1RZMA 2HFOA 1FDBA 5DZ7A 3R2CJ 3AQOA 3FRZA 1LXJA 4FBTA 3SCJE 4YFUA 2VICA 3LP0B 1KHWA 2O3DA 3PIPQ 3LF0A 4NYPA 3PM9A 2E1AA 2W9BB 4LBPA 3D6FB 4JUZA 4CQ1A 3ZTOA 2F1FA 5B09A 4JB8B 2A6OA 3OL8A 3DKDA 2LP4A 3V6DB 1JJ2R 3N9UC 4ZVGA 4ECUA 1LW0A 3IWNC 5F9NA 1FXLA 2E7WA 2F4FA 4L73A 5D78A 1VQKS 2HYIB 4JV1A 2NPFA 2R2RA 2DRAA 3TQ1A 1Q7YT 2OFGX 4ZPDA 1WF1A 3H2LA 2CADA 2AF6A 1J5OB 2KRRA 2BBEA 3KUHA 4FZVA 3AJ2A 3SCKE 2VV5A 2R7VA 2UUCJ 3DLLQ 4WFXA 1X9SA 4R8UB 1FI4A 2F8EX 2WONA 2YQ3A 2K1RA 5D0GA 4ZLLA 3EMTA 2FJVA 2XHWA 4M5HA 2DITA 5E3PA 1TKXA 1UVMA 3IS9A 1TMJA 2PI4A 3BZQA 1F9HA 2XWYA 4H4KA 5FDLB 2RB7A 2IRYA 1HKAA 1VRUA 2J7KA 3IXQA 4K8RA 1APSA 4YOEA 2IRXA 3QFHA 1RBLA 2RQ4A 4USUA 5J2MB 1YDLA 3Q8QB 3V81A 4USKA 3J81U 4A8FA 4OHXA 4I67A 4NXNJ 1RI7A 5IM0A 4ZIWA 4HVZA 2C42A 4U7UK 1ULRA 2R9LA 2MQNA 5K8NA 3CD5A 4CNZA 2VPZB 3GIRA 4DR2F 4LVOP 5DRKA 1GMWA 4TKTA 4F4WA 4LBIA 1FKPA 4EFAC 3H5YA 1NKBA 2YY3A 3K5LA 4DL2A 3I9V9 5CD4H 4X4RA 3HZGA 2XYGB 3OW2R 3C2PA 1KN6A 3N5BA 3M8QA 1S1XA 1M5OC 2FJAB 4A8OA 3CNQP 3DOKB 3SDEB 1CEZA 3UNGC 5HI7A 2ZOGA 1IKXA 1RXOB 4FN5A 3OSPA 2EXUA 3DLKA 4RUAA 1TQLA 1H7XA 2MQMA 4AYBD 1MN7A 2KI2A 2QN6B 5D0EA 2JLFA 2P8IA 2MGZB 4YR2A 1ZM3A 2DEIA 3MD3A 3CCQS 1RAHB 1GXUA 2HGMA 4Y65A 4YUDA 4TYAA 3MOZA 1JLGA 2DBBA 3JSBA 1U0SA 4YR0A 4MAKA 5BJRA 4DMZA 5SUHA 1WC6A 1HNZF 1YSJA 3AB2B 2WVFA 4NZ6A 4P10A 1N5YB 1N36J 2XLJA 1JJHA 1P6TA 2IMOA 1C4CA 4MKAA 3C15A 2LFVA 3CJQA 3I0SB 5C42A 4XTTA 2VASA 1DZ5A 3X1LB 4QR0A 1H3DA 5CD4A 5I3QA 4TQRA 2UXCF 2MLYA 4E2FB 4OZ0A 5JVGQ 2ATCB 2LQBA 3MEKA 1U1LA 1YBAA 1T03B 2BDPA 4CLFA 3E51A 1FK9A 4F4XA 1JLCB 2DGTA 2DGWA 2CQHA 3QIPA 1MG7A 1SXLA 3TEHB 2RQCA 4DQIA 4LFCJ 3OR1A 2C3OA 3CXCR 4CI0B 4QJVA 2OPSA 4CTAA 4BWJA 3CJ4A 4DV1F 4ZITA 2JVOA 3EICA 4FKYA 5KT7A 1RT7A 1RYRA 2JFKA 5HMYA 2ZM6J 2ZH8A 2APOA 1WHYA 2ZJRQ 3B54A 1CC8A 1FO1A 5HAOA 2BKOA 3PX6A 3GIIA 1FD8A 1VC5A 2GNKA 1GT8A 4G65A 3FZ2A 5HBMA 4WE1A 4B3SF 1FJCA 1VIXA 1SIWB 3CCSS 5FIIA 3FFIB 3GJTB 3FBBA 2HHHJ 4I4BA 2XMUA 4H4MB 1NHUA 4DL6A 4TY8A 1BWEA 1NSQA 3PTWA 1VRTA 2DH7A 2HW3A 1AUSL 2ZKTA 5IV3A 2XZTB 3DYAA 3CCUS 4R0EA 4F0KA 3V6JA 1X4AA 1S12A 5C5JA 1SC4B 3QNWB 3T3FA 2OJ3A 5DGAA 4XO0A 4KYZA 5CZXA 2ZEJA 4OZNA 2YH0A 2DKOB 1RBAA 2DO4A 3UDLA 1SJRA 4UZCA 2RVJA 2XCAA 1TL7A 1FD2A 4ITSA 1JIHA 1NU4A 5JUMA 4L75A 2PIIA 5J2QB 1V5VA 3C14B 2CQIA 3EJMA 4ECRA 3M4XA 2RMLA 2WSCC 3NL0A 3M6UA 3UW1A 3BPDA 2UVUA 1QE1A 1XMQF 2UV8G 2QA4G 1DARA 2HHSA 2FHKA 3HHLA 4RNFA 4QWEA 1U2CA 3V6HA 3UCZP 1OIAA 1R7IA 2CKWA 1M1KT 4C4WA 1C0TB 4JBCA 2EK6A 1VQNS 3M8YA 5IQ6A 5L9XA 3MR7A 1X60A 1DLOA 3OTDA 2R7TA 2XMVA 2UU9F 5AXMA 4P2XA 3HD2A 2K7JA 2AX0A 1ZYQA 5DDPC 1PILA 3DDNA 2PFDA 2BJEA 2HEKA 1SL0A 3IBWA 3NGKA 2LA4A 2XY6A 4GO5X 3DI6A 3QSIA 4LUBA 3ZTQA 5GADI 4CLZA 1XK8A 4C0OC 1AROP 4NLQA 3EZOA 1SH0A 4ECQA 1TL1B 1LFPA 1RLCL 2XYHB 2FC9A 4PQAA 1SH3A 4IO9Q 1SQFA 2V2ZA 2AGQA 2VFUA 4ZP7A 3I9ZA 5T41A 3H7HB 3UNYA 2ZVSA 4TQSA 1XC9A 5A8KB 2KFYA 4X4VA 4NEYA 3TOQA 3PHTA 2Y1IA 3D4JA 5IC4B 4DN9A 3DDKA 4Z2XA 4WXWA 3OFHA 4UUWA 3CDAA 1UJ6A 2Y1RI 4ZN3A 5KFPA 1YWXA 3NRBA 1SJQA 2RAQA 3CUNA 1F5CA 2V4JB 4ZKAA 3GFXA 2GS8A 3BJYA 2WSEC 4DG1A 1BLUA 4NLOA 4PPZA 1UJ4A 1MMNA 3D67A 3JQMA 2NQPA 3PZPA 1VOMA 2SXLA 5J1EB 2BQRA 1S6PA 2CQ1A 1D8ZA 3X3UA 1NKCA 1N34J 2BJDA 2OPQA 4RUBA 1CJTB 4CLUA 1SBRA 2YNIB 2K06A 3G6YA 2R8HA 2M2BA 1RAIB 1RT5A 3B82A 4IDKB 2OH2A 2KB2A 3KDOA 3DDIA 1SB6A 3H2VE 2BKPA 2HHWA 1MN9A 5ETSA 4C0BA 2AJ1A 5KT4A 3M32B 1LXNA 2CYYA 2DYAA 4O0NA 1X9WA 4ZHRB 2E1CA 2MKHA 3I32A 1ZAXA 1HA1A 2YKPA 2CQPA 2R8KA 1M5VC 1QSYA 4F4YA 3ITHB 3C6UB 3RAMA 2CQ4A 4KO0B 3LGNA 2PFFB 1KLMB 3MCNA 1VFJA 2H3EB 4USVA 1YJUA 4IFYB 3G82A 2QLWA 1SJFA 5CZVA 4YY3J 2J0SD 1EIYB 1JKHA 2ZKUA 4C8ZA 2GMHA 2VG6B 1EHWA 3QWUA 5G4DA 2IVMA 1K9MT 4FF1A 5AXNA 2HVEA 1UZDA 1KTQA 3MEDA 2FGCA 2WVEA 3ILOA 3SCLE 3HLUA 1CJVA 3L7PA 2AZ1A 4O44A 4KHMA 3UR0A 4P74A 8AT1B 4ELTA 2DR8A 5KT2A 2KHDA 4DI6A 4P72A 1H2UX 2ZC4A 1NK0A 2GJFA 2ZUAA 1Y9OA 3BGRA 3FRYA 3TZWA 1HFEL 4QIEA 2Y8WA 4X4PA 3EVMA 4YEAA 4RBUA 4O3RA 2KM8B 4NX9A 4ANEA 1DQ9A 4DPXA 3KHLA 2RRNA 5KFLA 4UOCA 3A3PB 3IM9A 3CGIA 4ZOSA 1HW8A 2O67A 4F04B 2LECA 8RUCA 4Y2IA 4OLOA 3NGDA 2V4QA 2GX8A 2WONB 3BR9A 2C2EA 2K1RB 3ZNJ1 3QYYA 4LF9F 1Y11A 2XY7A 4DR6F 3CMAS 2DGUA 2CPIA 1TKXB 1S0MA 3IS9B 3T19A 1LWCA 3TANA 2PA8D 1EARA 1KP6A 1PJ5A 4LR7A 2BX6A 2F8HA 1VRUB 3RBDA 4CH1A 4C97A 4ILMA 2VODA 4OYBA 2V9WA 2A2CA 3MR2A 2E1MC 4LFBJ 1Q1KA 3TQEA 1VRQC 3FEZA 3HZEA 1PC5A 1UAWA 3MPWA 1XNQJ 4XK8C 4R5PA 5IQQA 4CP5A 4ZPBA 4I2PA 1RTHA 1G7CB 1REVB 3SI8A 3GJQB 5IM0B 3LALA 4NI2A 2NZ4A 4OJHA 2BQUA 3PW7A 5B0CA 1WORA 5KFEA 5M2PA 4CRJA 3BGUA 1FKPB 1GMVA 1RA6A 3R5BA 1KEKA 1UPMB 3W63A 4ZCLA 1N6QA 3MPYA 3T6BA 5E0OA 1GTHA 3M8QB 4HKQA 1S1XB 3ETMA 1UWBA 3R7SB 2KT5A 5AE1A 3BBFA 5EUHA 3H5XA 2G0CA 4Y2MA 3MURP 2I38A 1RADB 3FSYA 4CWBA 3W9HA 2JC0A 2EW9A 1Q78A 3DLHA 3GMGA 5KFXA 3AD9C 4DR3J 1VS3A 2D7SA 2HNDA 1VJWA 2KZZA 4F4ZA 4W90B 2QA2A 1JLGB 4DWIA 5C25A 2OSQA 1KLNA 1IQZA 4OI0A 5LMNF 1KVIA 3N01A 4PEOA 2GMJA 5EDWA 5F0WA 1P9YA 4I68A 5E5NA 1RT3A 2FLNA 3C15B 1U02A 2VJUA 2DJWA 2XMKA 3CTRA 2R7RA 4DR7J 1S7IA 4P2SA 2NYHA 1NJZA 3VVUA 2ILYA 4LQ3A 4YB7A 1FK9B 3DLJA 4YHHF 5B0EA 1DFDA 3MMAA 1WEYA 2C2NA 5D4NA 2GAGC 2JSXA 3A8KA 4JI2J 1C0UB 2X1AA 2W9CA 4WKYA 2KH9A 4ZLJA 1VHIA 5A6WA 3GFZA 4PYDA 3OR1B 3QT6A 4QYZK 2C2MB 4Y0FA 1Q4RA 2OPSB 4CTAB 4J9LA 3MAQA 3OXFA 5F8NA 3FUYA 1NH7A 3H40A 3G6ES 4DR1F 2CJBA 1KQGB 1UVJA 4GC6A 3T9NA 1FEEA 3BSAA 1C1BA 3QBCA 4M63A 4NA2A 3QJLA 4OJ1A 1TKZA 2GIFA 1IR0A 2W2PP 5HLFB 3IRXA 4RX6A 2KJVA 3N28A 4DV0J 5CCMA 2R7OA 2XZDB 3BQ2A 1I6JA 2Y8YA 4LF1A 2JH3A 2HS3A 3V2UC 4X4OA 3TNVA 1M5HA 2XULA 3WBZA 2B8QA 4JI8F 2L41A 1NK5A 3KLFA 5L8RC 2HIQA 1LV5A 3K0JA 1RAOA 3GPAA 3TUZC 3EPIA 2IJRA 2HFVA 2CJYB 4TY8B 3IM8A 1VRTB 4B3OA 2DT9A 2HMIA 3OSNA 3CDEA 4DV7J 3TVZA 1RP5A 4LT6A 3TJ8A 1C2PA 4AT1B 5E3RA 4DV2J 3JAMY 3GJRB 2HS4A 1FX4A 3DRYA 2MQOA 4P7VA 2I2YA 3DHWC 3Q89A 4PWUA 1F5AA 1RAEB 1OSCA 1KQFB 2QV6A 2EKNA 1FKAF 3BEGB 4AL5A 4NYZA 5KFSA 1NJXA 4WPAA 3GCXP 4RW8B 3G6XA 4DHVA 2ZHBA 1S0VA 1RWOB 4ZK7M 5LXYA 4F2RA 1BY9A 1TL7B 4Y6IA 2ZBQA 1VK8A 1X0FA 3PRDA 2RQMA 2YBVA 1RTDA 1X8DA 3HHNB 1NUEA 4OI4A 1VK3A 4OYIA 1JXEA 1QE1B 3C6TB 3LPEA 4EGLA 5EHHA 3MM6B 3LQVA 2WHOA 4G6VB 2XI2A 3CCTA 5D77A 2VA3A 5GMDA 4RNNA 1R0BG 2AYMA 1CSJA 1R8AA 5EX3A 2RHQB 2A10A 3W60A 2MKSA 3NBPB 3OJUA 2OP5A 4LF7F 1DLOB 4DL5A 4J37A 4X65J 1E6YA 3K57A 3M6WA 5LSLA 1BQNB 2MPUA 3UCUP 1RJJA 4DL4A 4YB5A 3ENVA 1O0PA 2AX1A 1RT4A 1URRA 4KHRA 2HRTA 4LSLA 2K7KA 2RS2A 1EQMA 2XZWA 3HSGA 1OMSA 4U6PA 3HKWA 2BJ3A 4KHPF 1CPZA 5L1LA 4HT5A 5A8WA 5BXIA 5KG0A 4NMLA 1B7YB 2M5YA 2O5DA 3ELHA 1WI6A 2MKJA 2ZVIA 2HPUA 1T8EA 1JXLA 4IOAQ 3CCMS 4BC7A 3FZBA 5CYQA 3ADAC 1PGZA 2H51B 2HBQB 1VQLS 3OHBA 4DF4A 1FX2A 3BGFA 4ZVUB 2PMZD 3HKZD 3W5YA 4CLWA 3QT7A 4MFBA 5GAEU 2P9CA 4X4NA 1FJGF 2VBWA 3CJ8A 1FNMA 1VQYA 1L3VA 1S1UB 2ZH6A 4QW8A 1SL1A 1S6PB 4DV6J 2CWXA 3THPA 4X62J 1KS2A 3BO3A 3KG0A 4LFAJ 1FE4A 4NLXA 1P1TA 1QAYA 2BV3A 2DGSA 4AD6A 2E5JA 4W92B 3UI3A 3KK2A 2DNKA 5EX0A 3D3BJ 3UR3C 4FPRA 2XS2A 2QIFA 1WC1A 2GIQA 3PNIA 1DTQB 4TLRA 1MROB 3OHAA 3TAQA 2C3PA 1SL2A 5H9EK 1JNRB 3PDNA 3JTOA 1KD1T 2O1PA 3LGHA 2L08A 2IAJA 5D4PA 4DZ6A 1TFWA 2WZ1A 3BO4A 2RS8A 4W98A 1CC7A 1WEZA 4K4VA 2C2ZB 1HR0F 2MJNA 2F3JA 3VZHA 4IFVB 4DPOA 4HDGA 3UE2A 5D3GB 3UD5A 1FEHA 5BYSA 3R5GA 3LOUA 2IA0A 4EBDA 2DRBA 1FTRA 3MPDA 2V8HA 5KFWA 4LIWA 5F3ZA 4CDIA 2MHEA 2ZHAA 3Q8YA 2RILA 1YRTA 2EC0A 2QE5A 3QJPA 4FF2A 4DUYJ 4IOCQ 1H72C 2OI2A 3ISZA 4NLPA 1JKHB 3TVKA 1HWKA 3LP2A 2DR9A 1SKSA 4NRUA 2C3UA 2YNHA 3FEYB 2CQGA 2X3DA 4O3SA 2GQCA 2ABYA 2K8GA 4Q7AA 1YLXA 2XGQA 3U1LA 2C28A 1CJVB 2C1EB 3WHIA 2VFRA 3VAMA 1CJUA 4O44B 5DG9A 5IS2A 5KFDA 3CIMA 3T1YF 1Z2ZA 3AFGA 4O3PA 2J6SA 4JI6F 1N5VA 1G3OA 2FQQB 3D1HA 2KXFA 5HP1A 1QUPA 2HNZB 3BGRB 3BM7A 2JFDA 4MIWA 2IDEA 3TUIC 1R6YA 1TV6A 2N7YA 1W25A 1Q8LA 1YRUA 3G6VA 3D1OA 3EGNA 1UTAA 2DNNA 1REGX 4X64J 4HH1A 3BYPA 1U0HA 4RNHA 4G1QA 2DEJA 2A2DA 3RRGA 4J9PA 4S0MA 2EFGA 3M2VB 4JI0F 3QQCD 4DSIA 2WW8A 1J5EF 2L48A 3LUYA 3M8WA 2F65A 2DY9A 1U1RA 1IN0A 4NYOA 1NJWA 3GZ7A 1S9GA 1RWUA 2GV1A 2NZCA 5ETOA 4DQRA 3UN2A 1NK9A 4N8OA 5DS7A 1HYSA 3PYEA 5DETA 4LF2A 2QRRA 2E9TA 1U1QA 2C2KB 1MSWD 1S1TA 2BVZA 2QSFA 4R5PB 3I6PA 2W4CA 4I7FA 2PEBA 4I2PB 5KFBA 2R7SA 4NI2B 4ID8A 1K0VA 3A12A 4PQUA 1UVNA 3W8PA 4OX7A 4XAKA 2E66A 2ZH2A 4U7CA 2IVFB 5CYMB 4J9SA 2OPPA 3TO8A 3J80Y 5GAHI 1SQEA 1HBNB 3OXLA 1N6QB 4UOHA 4UY85 3HJVA 4HACA 3HP6A 3K5NA 2WBMA 4URSA 3HHLC 1UWBB 1Y4ZB 2JX2A 3LANA 3CDBA 2DPIA 3QGGA 3BB5A 1U45A 1VQ6S 2XNRA 2R8IA 2OEMA 1XMOF 2KT3A 4QWDA 3FBCA 3RBEA 1S57A 1HHTP 1H74A 2YX1A 5F8MA 3W2VA 2UUTA 4ZVOB 2XYPB 2UXCJ 3ZZUA 2GC8A 3IR5B 1UFKA 2YKAA 5K8MA 3MZIA 1V6HA 4CYUA 2HNDB 1XERA 1N88A 4WFBQ 2GAHC 1MWQA 3RG6A 1D0EA 3ZFVA 2NPIA 4R0JA 2VKZG 3VGVA 2BE2A 1CQMA 2B6AA 5K8PA 5ETMA 4IG3B 2QA4S 2AEFA 3QT5A 4XDCA 2F40A 1RTJB 1F3FA 1WG5A 1HHSA 1UVIA 1RT3B 1RKIA 1Q79A 3O2IA 3VR1A 3AB4B 1S49A 1Y7PA 2EWHA 4JI7J 3UO0A 4FF3A 4O4GA 1P27B 4HL9A 3J7YU 2KVIA 1HD0A 2NXJA 2NXEA 4KFBB 3N6NA 3K5MA 3BGOP 3HI9A 3MMAB 2W8LA 3RB4A 2OIHA 4Q2MA 2H54B 1LWXA 3P49B 1YGYA 4KE5A 2W9CB 1X4DA 4OYZA 1EETA 4CLYA 1HWUA 3AAWB 3QRPA 4WP9A 2HFUA 4TU8A 3V4IA 1K0TA 4P9SA 4NZ0A 4CO3A 2JL9A 4WFYA 1WF0A 1YI2S 2ILZA 2W2NP 3JAMU 3HXMA 1C1BB 2A6MA 4C8NA 2V63A 4X4SA 2W7AA 4OV6A 3JSRA 4LF4J 2OKQA 5DDRC 2MKCA 1HQ2A 2EG1A 3I5AA 2AT1B 1LQ9A 1X9MA 1RAJA 2YKQA 1N0UA 4ALZA 5GVQA 2XSJB 2DIVA 2QMXA 3KLFB 5F8IA 2L9WA 1VLYA 3T6JA 4ZVQB 2CRLA 2CUYA 3N6LA 3MEGA 5KFIA 3M30A 4DLEA 4KPCA 3HM9A 1FXRA 1T9YA 4DL0C 4B3OB 1S77D 1FRHA 5C2CA 4LSNA 1ZOTA 4OHZA 3S8SA 2HMIB 2B4UA 2AYGA 1YX2A 5D15A 4OJ3A 3QAUA 1SJ3P 2G0JA 2XO7A 4MH8A 2HQFA 4QIWD 4ED3A 1RU1A 3P4UB 1XMQJ 2H65B 1U25A 4PUOA 4URQU 1BQMB 3OVSA 1T05A 5JMNA 3F44A 4FS2A 3UWTA 3GYGA 4WTOB 3DM2A 2JEFA 4JP8A 2FVQA 1SPBP 3HHEA 2RNEA 4DV5F
chains in the Genus database with same CATH topology
2H5JB 2H4YB 2DKOB 3R7SB 2H51B 2HBQB 2QLFB 3D6MB 3IBCB 4ZVUB 1QTNB 3KJQB 2QLJB 1RHUB 3R6LB 2QL5B 1NMEB 4ZVRB 1RHQB 3GJRB 2XYHB 2C2MB 2H5IB 1RWMB 1RHJB 4ZVQB 2CNLB 2C2OB 1QDUB 2CNKB 4DCJB 3GJSB 4ZVSB 2H4WB 1RHMB 3NS7B 2CDRB 5IC6B 1I3OB 2CNNB 4ZVPB 1F9EB 2H54B 5IC4B 3P45B 2CJXB 3GJTB 1SC3B 1RWOB 2QL7B 2HBYB 3R7BB 2P2CB 1GFWB 3GJQB 3R5JB 3R6GB 2CNOB 2C1EB 2XYGB 2XZDB 3RJMB 4LSZB 1PAUB 1IBCB 3P4UB 3KJFB 2H65B 1SC1B 3EDQB 2XZTB 4ZVOB 1RHRB 2H48B 2XYPB 1RWKB 2HBZB 4DCOB 1RWWB 2FQQB 2HBRB 3D6FB 2QL9B 1I51B 4ZVTB 1BMQB 2C2KB 3EDRB 4DCPB 3IBFB 4JB8B 1RWPB 5K20B 2Y1LB 1SC4B 1RWVB 3KJNB 3QNWB 3R7NB 2Y0BB 2CJYB 1RE1B 1RWXB 3SIPB 2C2ZB 1PYOB 1RHKB 1RWNB 3D6HB 1ICEB 2QLBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5J B;  2H4Y B;  2DKO B;  3R7S B;  2H51 B;  2HBQ B;  2QLF B;  3D6M B;  3IBC B;  4ZVU B;  1QTN B;  3KJQ B;  2QLJ B;  1RHU B;  3R6L B;  2QL5 B;  1NME B;  4ZVR B;  1RHQ B;  3GJR B;  2XYH B;  2C2M B;  2H5I B;  1RWM B;  1RHJ B;  4ZVQ B;  2CNL B;  2C2O B;  1QDU B;  2CNK B;  4DCJ B;  3GJS B;  4ZVS B;  2H4W B;  1RHM B;  3NS7 B;  2CDR B;  5IC6 B;  1I3O B;  2CNN B;  4ZVP B;  1F9E B;  2H54 B;  5IC4 B;  3P45 B;  2CJX B;  3GJT B;  1SC3 B;  1RWO B;  2QL7 B;  2HBY B;  3R7B B;  2P2C B;  1GFW B;  3GJQ B;  3R5J B;  3R6G B;  2CNO B;  2C1E B;  2XYG B;  2XZD B;  3RJM B;  4LSZ B;  1PAU B;  1IBC B;  3P4U B;  3KJF B;  2H65 B;  1SC1 B;  3EDQ B;  2XZT B;  4ZVO B;  1RHR B;  2H48 B;  2XYP B;  1RWK B;  2HBZ B;  4DCO B;  1RWW B;  2FQQ B;  2HBR B;  3D6F B;  2QL9 B;  1I51 B;  4ZVT B;  1BMQ B;  2C2K B;  3EDR B;  4DCP B;  3IBF B;  4JB8 B;  1RWP B;  5K20 B;  2Y1L B;  1SC4 B;  1RWV B;  3KJN B;  3QNW B;  3R7N B;  2Y0B B;  2CJY B;  1RE1 B;  1RWX B;  3SIP B;  2C2Z B;  1PYO B;  1RHK B;  1RWN B;  3D6H B;  1ICE B;  2QLB B; 
#chains in the Genus database with same CATH topology
 2UXD F;  1NJY A;  1JLF A;  1T9U A;  5AJ3 F;  1JLA A;  3QFW A;  2ZBR A;  1RTD B;  4I6Y A;  4UUX A;  4C7Q A;  1RHU B;  2UU9 J;  4PXC A;  1S1V A;  4NCG A;  1WC4 A;  3QLH A;  3FMB A;  2IJN A;  2ADC A;  1UJ5 A;  1N54 B;  4WJB A;  1HBU A;  2EEY A;  3NWG A;  1P8G A;  1N5S A;  2ZUG A;  3NAI A;  1H38 A;  3D28 A;  3QSY B;  4NCB A;  4IH6 A;  4UTG A;  3MEE B;  4FNI A;  4B3R F;  5LL6 d;  2BYC A;  3LO3 A;  5KFO A;  4K4U A;  4PWD A;  2WB1 D;  2XC9 A;  2VFV A;  3RGI A;  4DU7 A;  2C2R A;  4GMK A;  4J90 A;  3UD4 P;  1RTI A;  2VFS A;  3P96 A;  1E6Y B;  3NNC A;  4KSE B;  1S0N A;  2XS5 A;  2CPZ A;  2CZ4 A;  1NSK L;  2KDO A;  1C1C A;  1I5O B;  4LSL B;  3H20 A;  1X5P A;  3H90 A;  3DOL A;  2H4Y B;  4B3T F;  3QJJ A;  3IBC B;  1KOO A;  2UVR A;  2XM3 A;  1C4A A;  2EC2 A;  3CW2 C;  1DUR A;  2DB1 A;  3M2R A;  3NLC A;  1RWM B;  4OI2 A;  3RAX A;  2CPH A;  1SIZ A;  2BOP A;  3ZNU A;  3CSK A;  5KFU A;  3WDO A;  1QAX A;  3M1V A;  3NS7 B;  2CA9 A;  5CYQ B;  4UZB A;  4YQW A;  4JI5 F;  4MIA A;  1WC5 A;  4JYA J;  2AKW B;  1WOO A;  2FHM A;  1OQ3 A;  2IA6 A;  3BDP A;  2JEJ A;  4NPO A;  4QPX A;  3Q23 A;  3SSS A;  1NRK A;  2DK2 A;  3BO2 A;  2IMW P;  2BR0 A;  4JI3 F;  1VC6 A;  4KIA A;  4XPE A;  2N3O A;  2VQE J;  4G1I A;  4H4O B;  2QFI A;  2B4O A;  3CUL A;  2GGP A;  3UFC X;  2QTW A;  1RE1 B;  3S01 A;  1TMM A;  3KG4 A;  1FWK A;  5CCL A;  2XLK A;  3NOC A;  2IHR 1;  1F1B B;  1FES A;  1CS4 B;  2I1R A;  1ZTT A;  4HLB A;  2PSZ A;  4FVC A;  2IAJ B;  1D09 B;  2UVW A;  4KR0 B;  2HZA A;  3QGP A;  4BLG A;  4OHY A;  3G8T A;  2XB2 D;  1OPZ A;  1Z1Z A;  5L1K A;  4NLT A;  3TW0 A;  4X4U A;  4NRT A;  4NE9 C;  1DJ0 A;  4LR8 A;  2NRE A;  1AXQ A;  1WTF A;  3KDN A;  4GVB B;  1JLB A;  1S6O A;  1LWE A;  4DL3 A;  1KBR A;  4A8W A;  3HFZ B;  4IOB A;  2YKN A;  4USH A;  4WXO A;  1FDA A;  2ZNZ A;  2OUG A;  2CAJ A;  4A47 A;  1FXD A;  2FVR A;  1IXK A;  3L9Z A;  3GV5 B;  3KHR A;  2W2Q P;  4ZPT R;  2NXU A;  2VFT A;  3LP2 B;  2EVZ A;  5MAO A;  3KMQ A;  3L7O A;  1RAG B;  4TN2 A;  5C2G A;  4EK2 A;  4ETZ A;  3Q22 A;  3S7R A;  1RWP B;  1XR7 A;  3D6T B;  4DQS A;  1RT2 A;  3NMA A;  2M70 A;  1CJU B;  2YXL A;  3IFE A;  3LGM A;  2MQP A;  2CPE A;  1WEX A;  2DR6 A;  2VC0 A;  3AJD A;  4B9V A;  3ZO7 A;  2HZV A;  1T94 A;  4USJ C;  1VGY A;  3VGT A;  4K0K F;  3Q2S C;  1U49 A;  2IM0 A;  1Y00 A;  1TV6 B;  2EFV A;  3SEO A;  2YKM A;  4HT7 A;  2OEL A;  1BQX A;  2B7B B;  2DH8 A;  2W1B A;  3EWG A;  4PG5 A;  4LRE A;  4XIU A;  2VOP A;  1JLQ A;  1HIY A;  2P2C B;  1U0H B;  1TAU A;  3MI7 X;  2DTJ A;  4DJB A;  2NUU G;  3MFH A;  4A8Q A;  3IC1 A;  5HK4 A;  5J2N A;  4E98 A;  4LSZ B;  2A0F B;  4AFF A;  2D3O R;  3ILJ A;  4PCQ A;  3AOC A;  5J2P A;  1PJ6 A;  2FVS A;  2IJF A;  1NK7 A;  4KB7 A;  5L9N A;  5C24 A;  3LH2 S;  2DNZ A;  3J80 U;  1QSL A;  3IA0 A;  4KRW A;  1NHV A;  1U2F A;  2IYG A;  5F9L A;  4ED8 A;  4DSK A;  3PV8 A;  2G2Z A;  2ZH3 A;  3QAE A;  2J7W A;  3GFY A;  1RHK B;  4EEY A;  2WAQ D;  1KNZ A;  2CDQ A;  3WIU A;  5LXR A;  1HYS B;  2HGN A;  5IT4 A;  3A4T A;  4I2Q A;  1R3N A;  4ZVR B;  5T7L A;  1NB2 A;  4PR6 A;  2ALY B;  1QUV A;  3VQT A;  2G2Y A;  1HMV A;  4PQU B;  2Q79 A;  4RR5 A;  3TZX A;  1OYE A;  2GFF A;  3DRS B;  2ZHO A;  1X31 C;  4CO1 A;  1VBY A;  2OPP B;  2JZ5 A;  4NCA A;  3AA8 A;  1FWL A;  1BE4 A;  1S5Z A;  4ZJO A;  4ED2 A;  1XN9 A;  5KFQ A;  2Y3Y A;  5GME A;  3GR1 A;  4HAC B;  4ILR A;  3OL9 A;  2GQ2 A;  2VG7 A;  3TR5 A;  4YDX A;  4AQY F;  1KC8 T;  1U8W A;  2RF2 A;  3JYT A;  4DFM A;  2CWK A;  2V68 A;  2DGO A;  6FD1 A;  4JV0 A;  1QVG R;  3D6M B;  3W2V B;  4IH7 A;  2XQC A;  2DGX A;  4F4K A;  3M7V A;  3PJ9 A;  1SV5 B;  1TKD A;  2D3O 1;  2KTQ A;  3R6L B;  4IRK A;  3UQS A;  1IBM F;  4NXN F;  2ROG A;  2XBP A;  4YHH J;  2KYX A;  3ZZO A;  3VTI A;  4WWS A;  2BE2 B;  3K17 A;  3MCS A;  4A8M P;  2B6A B;  1X4E A;  5HQM A;  2BE7 D;  5KFT A;  4ZN1 A;  2R8J A;  4RW9 A;  2F8M A;  4UF4 A;  4ZVP B;  4ENO A;  1GH8 A;  3MGJ A;  2FJB B;  1KVK A;  2MY8 A;  1FRI A;  1EX8 A;  4P52 A;  3UVJ A;  3GB0 A;  5AXK A;  1EP4 A;  1QY7 A;  3G87 A;  2LQ5 A;  4RNM A;  5E2Q A;  4DR1 J;  1UVL A;  1AW0 A;  1PC4 A;  2GO9 A;  5KAK A;  1IBC B;  2RHS B;  3KJF B;  1SC1 B;  2XCP A;  2E5I A;  3HVW A;  3AHP A;  3HMJ G;  3IRW P;  3Q8S B;  1S79 A;  4TNO A;  1LWF B;  3KMS A;  1ZA2 B;  2W2O P;  1EET B;  3BDE A;  2XY5 A;  3BRE A;  4JI8 J;  2HG4 A;  4ZA1 A;  5HRO A;  2BKN A;  3Q8P B;  1MNE A;  4U67 Q;  2EG2 A;  5ETP A;  2HQC A;  4U9R A;  3VCD A;  5HQ8 A;  1FKO A;  1RT1 A;  4PG6 A;  4GKJ J;  2OML A;  4UW2 A;  2MXY A;  2W9A A;  4FYY B;  5KG7 A;  4A8S A;  3CVK A;  2QLX A;  4Q8F A;  5KOW A;  1NB7 A;  4K50 A;  2CPY A;  3LP1 A;  2VKR A;  3CJK B;  4JOU A;  2CXE A;  1IWG A;  3W62 A;  2CJQ A;  3MM5 B;  2XMA A;  4F25 A;  4CNY A;  2LQ8 A;  3M30 B;  3A1Y G;  2ZH1 A;  3BQ1 A;  2HS0 A;  1AZS A;  2J0X A;  4IKA A;  3A13 A;  1T9T A;  3CPW R;  3FC9 A;  1TEL A;  5IWA F;  3DGV A;  5ETL A;  4DSL A;  1X7V A;  1BD6 A;  5HAT A;  2EBG A;  4PUO B;  2J8S A;  4M5K A;  4KGK A;  1HNV A;  1NBE B;  3G9C A;  3NOG A;  4QPT A;  4I64 A;  3DM2 B;  5E3A A;  4Q0B A;  3N4W A;  3IWL A;  5FLX Y;  2G13 A;  2KZM A;  4ED4 A;  1GMU A;  4M5J A;  4DL7 A;  1YJ7 A;  1L3K A;  4Q5V A;  3PW2 A;  4ZVS B;  2FLO A;  1Q5V A;  4F4A A;  4USI A;  2ZC3 A;  1NM2 A;  1K44 A;  2B4P A;  4BC9 A;  2ZH9 A;  4OZ3 A;  4C3K A;  5ITH A;  1L3U A;  4LF7 J;  1S1V B;  4NCG B;  2HHH F;  4RW4 B;  1G1X A;  2G1H A;  1VCT A;  1WI8 A;  1HBU B;  3PEH A;  2V8G A;  3FBF A;  1TUW A;  3MCM A;  1XJW B;  4F02 A;  2ZIT A;  4P75 A;  1CG2 A;  4P2M A;  3Q8U A;  2B9X A;  3VGS A;  1KVJ A;  4PWD B;  5CAA A;  3RUB L;  3DLE A;  5B7W A;  4LF8 J;  4ER8 A;  4QU7 A;  3M6X A;  1RTI B;  4FYD A;  3EXC X;  4QWA A;  4P2F A;  2WSF C;  4KHP J;  1YTY A;  3D9B A;  3NNA A;  2POK A;  3MR5 A;  1X0P A;  4ZVE A;  1OY9 A;  3MHY A;  1S6U A;  5KFG A;  3NWR A;  2BA9 A;  2R2U A;  2H5I B;  2MQL A;  1JX4 A;  4NOH A;  1I94 J;  4AL7 A;  1C1C B;  4N77 A;  2QYG A;  2QO3 A;  5HVG A;  2IBO A;  2JC1 A;  2MEW A;  2DR7 A;  4X4T A;  4F2S A;  2YPY A;  5KFC A;  1FJG J;  4K7Q A;  4LIR A;  5AT1 B;  1M1H A;  1NK8 A;  3CJ3 A;  4M1K A;  2V69 A;  2HKE A;  4ID5 A;  5SZT A;  3M2R B;  4F3Q A;  1LK7 A;  2JEI A;  2VON A;  1PG5 B;  1RWW B;  4TLQ A;  5C7P A;  2BAN B;  4DN0 A;  4M5I A;  2M9K A;  5KFM A;  5L38 A;  1PYS B;  2U2F A;  3BYR A;  3DC2 A;  2IM1 A;  3C8Y A;  3FGV A;  4QOT A;  4WBF A;  2H5J B;  2ZE2 A;  3PW0 A;  3KNA A;  3MM8 B;  1N32 F;  4ERD A;  1HR0 J;  2GGP B;  4FVM A;  2VJV A;  1RHJ B;  2HQ3 A;  5FD1 A;  2QSW A;  1UZH A;  2R2T A;  4OYP A;  2VBY A;  3A8E A;  5A8R A;  5GAG I;  3MEC A;  4FYW B;  4YN3 B;  1SJ1 A;  2UV8 A;  4F3O A;  3M2U B;  3VWS A;  2MKI A;  3J7A 1;  4RU2 A;  3W2W A;  2Q6C A;  4U8V A;  4UOF A;  4CO5 A;  2ZOF A;  1S9E A;  3EVW A;  5U47 A;  3JSY A;  1NXI A;  5F0U A;  2FVP A;  2H48 B;  3OR2 A;  1IKW A;  5JVH Q;  4USW A;  3MF5 A;  5GMK a;  3VHQ A;  3M8P A;  2AGO A;  1Q53 A;  2XG8 A;  3B4D A;  2IM3 A;  1LWE B;  3W9I A;  2NSB A;  3EGZ A;  4ED5 A;  3T1Y J;  2D9O A;  2YKN B;  4JI6 J;  4F8R A;  2HNY A;  5I42 A;  1V3S A;  2D9P A;  4LBH A;  2CQC A;  3L3C A;  3OTO J;  3M05 A;  2F4V F;  1DQ8 A;  4ECZ A;  4FP9 A;  2DHH A;  1IM4 A;  3MDF A;  3HO1 A;  4M8L A;  2DCU B;  3NEK A;  2ZJQ Q;  4E8U A;  3OL7 A;  4JI0 J;  3ISN D;  3R5J B;  2Z4P A;  4ZIV A;  1J5E J;  1FWP A;  5LJ3 Y;  2OFH X;  2W9B A;  2HVI A;  4LQ9 A;  3OUY B;  1HNI A;  2YKM B;  4ECT A;  2HFS A;  3T1A A;  2C22 A;  4GKK F;  3K8W A;  3A8J A;  3PW5 A;  3GQC A;  2FD2 A;  1JLQ B;  4U8Y A;  2FLP A;  1N56 A;  3HFV A;  3M9O B;  4IRD A;  4JV2 A;  1UKU A;  3JQJ A;  1Q8K A;  3KLE B;  4KTQ A;  4LF5 F;  5F8G A;  4PG8 A;  3J7Z T;  4OMF G;  2DPJ A;  2AYB A;  3GLJ A;  2PE8 A;  4ZJL A;  2RU3 A;  5K9F A;  4OQJ A;  2HLU A;  1DTT B;  4ZLN A;  3JSM A;  2UP1 A;  2DIS A;  3T1H J;  2FHJ D;  2MKY A;  3TRG A;  4RW7 A;  5T7L B;  4A48 A;  3PEJ A;  3CD7 A;  4ECS A;  4ED7 A;  5A6P A;  4N8N A;  4CH7 A;  2Q66 A;  3M8R A;  1HMV B;  3QZ7 A;  3CO0 P;  1QAI A;  5ETN A;  1XMO J;  1JK9 B;  2IC3 A;  3L09 A;  2XMJ A;  3NGU A;  2QJ3 A;  3JQK A;  5IT0 A;  2DXE A;  3MM9 A;  4NLR A;  1PYO B;  3BSC A;  4WII A;  3A3O B;  4KGV B;  3T9Z A;  2ROP A;  4DV3 F;  4HTI A;  4J7C A;  4GRS A;  2VG7 B;  4AE5 A;  2KHC A;  4X4Q A;  1S6Q A;  5ETQ A;  4ETX A;  2VBZ A;  2EFN A;  1YBU A;  4NL5 A;  3KLH B;  2RF2 B;  2VQF J;  3IG1 A;  2B5J B;  3PKY A;  4K59 A;  1DAX A;  2OSR A;  2W24 A;  1B70 B;  4DR4 J;  3W8G A;  4IQM A;  3PX4 A;  2CQ0 A;  1UWA A;  1NDL A;  4ZPW R;  1D3W A;  1X4H A;  3N0V A;  3BN4 A;  3NXZ A;  3QO9 A;  4DLG A;  4X2B A;  3G71 S;  3SFG A;  3J81 Y;  1KFS A;  1N33 F;  4RW9 B;  1A9N B;  4C8Y A;  2WRM A;  2E5L J;  3UVJ B;  5K20 B;  1UCN A;  3SQG B;  1EP4 B;  2GVZ B;  1NHK L;  4TY9 A;  5BR8 F;  3GYX B;  2XMM A;  2R7U A;  1X4C A;  3AOD A;  3OVB A;  2AZ3 A;  2VC1 A;  5IT9 Y;  1UEV A;  1VQS A;  3GSI A;  2VH7 A;  3DGP B;  3MMB A;  3J81 j;  2HHQ A;  2YPZ A;  3K7R A;  1N5Y A;  1WHV A;  3ILL A;  3HFK A;  2B9E A;  5EGY A;  1NME B;  5MLC V;  2VDH A;  3QT8 A;  3VVT A;  2EFO A;  1HWJ A;  3TAR A;  3DXB A;  1RU2 A;  2JRS A;  4OJG A;  3D5M A;  3VAH A;  2DHA A;  1F9E B;  4DR3 F;  4Q44 A;  3A3N B;  2N4C A;  5KG5 A;  4NXM J;  3R6G B;  3HT0 A;  2AEM A;  4DZD A;  1S1W A;  1S48 A;  1IBK J;  4F50 A;  4J5O A;  5KOX A;  3KK1 B;  2HLT A;  3AXM A;  1HBM A;  3RZA A;  5HMZ A;  1RYS A;  1FRL A;  1TTH B;  2ZH5 A;  4G1P A;  4K2J A;  1XNR J;  3LP1 B;  2W4P A;  3VAJ A;  3AH6 A;  1O51 A;  5FLX U;  4DOZ A;  2VDI A;  3CO9 A;  1RWX B;  1MMD A;  1NSP A;  5KT6 A;  1HQE A;  2DGV A;  2E5H A;  1GX6 A;  4DFK A;  1T7P A;  4NAS A;  3CCL S;  4O3Q A;  5CH7 B;  2Z8Q A;  1AZS B;  2YNF A;  1R8H A;  3TX0 A;  4DV5 J;  2ZJP Q;  4JI4 F;  2ZD1 B;  2W2M P;  4USM A;  5K14 A;  5AJ3 J;  1IUJ A;  2KXH A;  4O0I A;  1S59 A;  2BXJ A;  3TA2 A;  2YH1 A;  1U24 A;  2VPX B;  2MZR A;  1F60 B;  3RAQ A;  4ANC A;  2GJ2 A;  1SC3 B;  1WKK A;  1X4G A;  5G0R A;  5KFA A;  3MAA A;  3CCZ A;  4OLP A;  4Q0B B;  5CQG A;  3VF0 B;  1Q8B A;  1FRK A;  4DX5 A;  3W5X A;  5EWG A;  3TP2 A;  1ZAW A;  1TR0 A;  5DJB A;  5GAD U;  4NLG A;  4B08 A;  2E9R X;  5E7O B;  1QLN A;  5DM6 Q;  2CPJ A;  4MKY A;  2ROE A;  4OYX A;  4OYA A;  1RWN B;  2XMW A;  2GA7 A;  3DOM A;  2ZZN A;  1LW0 B;  2YWW A;  2OEK A;  1UET A;  1T9X A;  2MST A;  1DQA A;  3BR8 A;  2KFZ A;  4DV2 F;  4JI1 J;  2CG8 A;  3P5B P;  1RKJ A;  1VI7 A;  4ZS6 A;  3DLE B;  4B3T J;  1RAA B;  3W64 A;  1DRZ A;  4I6W A;  3QRQ A;  3PRV A;  3BSN A;  1M0S A;  2DH9 A;  2K3K A;  2QMU B;  1LOU A;  4K5S A;  5A2Q Y;  3NS6 A;  1WSV A;  3CB4 A;  1C0T A;  5DO2 A;  2VF3 A;  4Y2K A;  5H1S V;  1WC3 A;  4QYZ J;  5J1N A;  2HWT A;  2MY7 A;  4JI5 J;  4DSF A;  4OIX A;  2V67 A;  1RHR B;  1NDC A;  1PJ7 A;  2BEF A;  2BM1 A;  4DQQ A;  3FEX B;  4C6A A;  4KQZ A;  3DU5 A;  2MTL A;  3S1T A;  3KTQ A;  3PIO Q;  2DNO A;  3AQP A;  2JDJ A;  4KGZ B;  2QL7 B;  1SUQ A;  3ILI A;  2UZA A;  5KG6 A;  1KHV A;  4DS4 A;  1H2T Z;  2F5G A;  4ES2 A;  2VIH A;  3V81 B;  3WIV A;  1TK5 A;  4FYX B;  2YQ0 A;  5CHC B;  4RUH A;  5F41 A;  2OLW A;  2KT2 A;  2VB6 A;  4OYO A;  4CO4 A;  5I3U A;  1SI9 A;  2IPO B;  2LEB A;  5L1J A;  1U6B A;  1T9V A;  4HYK A;  2ZE2 B;  1RLD A;  3I55 S;  2GO8 A;  2QA1 A;  1GFW B;  1FHT A;  1Y3K A;  4NA1 A;  2AJ0 A;  3NGS A;  1K1Q A;  1S4E A;  4CT9 A;  2HHP A;  1AB8 A;  5A8R B;  2GHW A;  2H5E A;  3MEC B;  2MQQ A;  4P73 A;  2M7S A;  3CIZ A;  2HAI A;  2R7X A;  4OYM A;  5J1E A;  1G2E A;  1ZM9 A;  1IKX B;  3U1M A;  3HVR A;  3DLK B;  2OMO A;  3D68 A;  2L9N A;  4LF6 J;  1R8P A;  5THW A;  2BRK A;  3WC0 A;  2JEG A;  2V8V A;  2DO0 A;  2U1A A;  2YNI A;  5DM7 Q;  4ED0 A;  1W2B R;  3QZ8 A;  2MZS A;  4IG0 A;  1SH2 A;  3M8P B;  1G4C A;  2ZDP A;  3ONQ A;  3KOA A;  3EGW B;  1FRX A;  4UQT A;  4IDK A;  3BF4 A;  2MZ1 A;  2GHV C;  4O4R A;  1YQH A;  4WCE Q;  4Q43 A;  4ELU A;  3MTJ A;  3C16 A;  1H2V Z;  2HNY B;  4DV6 F;  3O3L A;  4CZC A;  2LLZ A;  3V5R A;  3M32 A;  4QQB A;  4LFA F;  4K0K J;  4O3O A;  1SC6 A;  1A6L A;  3B6B A;  3GIJ A;  1VQM S;  5C42 B;  3E2E A;  4WZQ A;  1UFL A;  4MKV A;  2FHJ A;  3ITH A;  3CJR A;  1TKT A;  4ZPC A;  3RR7 A;  1TUV A;  1IBL F;  2XSF A;  2FIU A;  2VG5 A;  4ES3 A;  4DX7 A;  1YBT A;  2YX7 A;  9RUB A;  4IFY A;  1GX5 A;  4IUF A;  5D4O A;  3H5S A;  4OZ5 A;  2BJ7 A;  3QIP B;  3IGV A;  1WNE A;  2B51 A;  2A3J A;  1QVF R;  4YB6 A;  1XTZ A;  2CQB A;  5DG7 A;  4C8L A;  2AW0 A;  4JV5 F;  2VG6 A;  4B3M J;  4DUZ F;  5LMU F;  3AOB A;  4KH1 B;  1O6X A;  4L3N A;  3BGL A;  1KR4 A;  3R3T A;  3IWX A;  5ETK A;  1KDN A;  2AD9 A;  1HNI B;  2NS1 B;  1RT7 B;  4MK7 A;  1FDN A;  3H2U B;  2RDI A;  4HDH A;  3DCA A;  1R89 A;  2WVC A;  2CG4 A;  3W3S A;  4RW6 A;  2DHS A;  4EO8 A;  3EX7 B;  1FNO A;  1IWA A;  4DCJ B;  1S10 A;  3I56 S;  1FRM A;  3GR0 A;  4DUY F;  1MU2 A;  2O01 C;  3Q0A A;  1UFW A;  2BJ1 A;  4IRC A;  5HBM B;  4WE1 B;  4X66 F;  2KO1 A;  3BBC A;  2HHV A;  4YB1 P;  1FRJ A;  1KOH A;  1OS5 A;  5ETT A;  2UUB F;  1YZ6 A;  1FVS A;  3HDS A;  4J91 A;  5BYQ A;  2UXB F;  1VQ5 S;  1TUG B;  1ZAV A;  2FJD B;  4QR1 A;  1SQG A;  4U96 A;  3JSM B;  3DYA B;  1WG4 A;  1Y10 A;  1EKR A;  3AOA A;  2WBR A;  2X1B A;  5KG4 A;  4MYU A;  4KGX B;  4RW7 B;  1ZPW X;  1U4B A;  3SIP B;  4HHJ A;  4RO0 A;  3BSO A;  3UDC A;  2V0N A;  4AQY J;  5H9E J;  3MMC A;  2ZWP A;  3SV4 A;  1FF2 A;  4X64 F;  4ED1 A;  2OO4 A;  3BKT A;  4C8K A;  1S99 A;  1X5O A;  4KBI A;  2IC3 B;  5AE3 A;  4ZJQ A;  3B4M A;  2N7C A;  2OD4 A;  3MM9 B;  2A18 A;  3BV8 A;  1HQU A;  1Z4U A;  4WKR A;  4CO2 A;  2X7I A;  2JLE A;  4C8M A;  1JJ4 A;  1IBM J;  1REV A;  4ZVH A;  1VQ4 S;  1R31 A;  2LXI A;  3M9M B;  2V50 A;  3UN3 A;  3LTO A;  4Q2L A;  5KT5 A;  1QSS A;  4F7V A;  1S6Q B;  4ED6 A;  1NPK A;  3HHL B;  1BUX A;  2HGL A;  1YHQ S;  5IT9 U;  2HK2 A;  5H9F J;  2W7P A;  1OY6 A;  3IG1 B;  3ZZR A;  4CIO A;  4DX8 H;  3QGH A;  2DR5 A;  1BC6 A;  3O5T B;  8ATC B;  3PX0 A;  2EFQ A;  4UST A;  1V9O A;  2DNY A;  2YTC A;  2K3I A;  4RLE A;  3QO9 B;  1Z2L A;  1WUU A;  3RBZ A;  4AUK A;  1HNX F;  4DPY A;  3IAS 9;  4KT0 C;  1HBO A;  1PKU A;  3HSD A;  2VOO A;  5D4L A;  1FA0 A;  1Q5Y A;  3TJA A;  3NP5 A;  4TU9 A;  3DI6 B;  3SSR A;  1YK9 A;  2B43 A;  1MWY A;  3F56 A;  1B0T A;  1PBA A;  2AYE A;  2W4D A;  1JB0 C;  1CBK A;  1V5I B;  2QGF B;  1U2R A;  3SYZ A;  2CNK B;  2UUA J;  2AJQ A;  4K4Z A;  2HVZ A;  4OFZ A;  3L95 X;  4KV8 A;  4A4J A;  1N0V C;  1U1N A;  1LEO A;  3ZC4 A;  2N3L A;  1RUS A;  3MMB B;  4IR1 A;  4CH0 S;  3GFH A;  3TZY A;  4MKB A;  3NY0 A;  1R0C B;  3GG1 A;  1JQG A;  1U09 A;  3HF5 A;  1UEK A;  4D3H A;  3AT1 B;  2B9W A;  1U26 A;  1FFW B;  2ZBP A;  3N6M A;  4OX9 J;  5F8J A;  3Q8R B;  3UPF A;  1I51 B;  2QYC A;  2J9C A;  1F6T A;  4DG1 B;  4MIB A;  5CXT A;  4HHU A;  1N8R T;  3K5P A;  1C0U A;  3KUG A;  2LEA A;  1S1W B;  4F26 A;  1PYT A;  5ETR A;  5B0D A;  1VBX A;  1HBM B;  2MJU A;  3R9L A;  4UT4 A;  1OSD A;  4CCH A;  5IWA J;  2GZO A;  2OPQ B;  4JI7 F;  1IQT A;  2G1D A;  4RZR A;  2D74 B;  1FFS B;  4MK9 A;  2NLW A;  3CMQ A;  2M52 A;  4IQX A;  1PBU A;  3KUE A;  3G8Q A;  4EBE A;  4DR5 F;  1AFJ A;  5HLF A;  1R0A A;  1Y5N B;  3MAH A;  2CDR B;  4WFA Q;  4FXV A;  1HQE B;  1KTV A;  3KLV A;  5HN0 A;  1ACM B;  3R97 A;  3RB0 A;  3WQP A;  4NWB A;  1IJE B;  2HWH A;  1RT5 B;  4BS2 A;  2YNF B;  2O66 A;  4C11 A;  2P5V A;  2Z2M A;  1RB0 A;  1YVF A;  5KTQ A;  3LAM A;  3F41 A;  5K14 B;  1QD1 A;  1K1S A;  4BDP A;  4DCO B;  1N4L A;  1E6V A;  3CE8 A;  1K73 T;  1ITP A;  3PCO B;  3IO1 A;  2JHE A;  1Q8I A;  3G96 A;  3GG0 A;  1UL3 A;  1FNX H;  3PVX A;  5G0R B;  3HUL A;  2J6U A;  3MAA B;  4LF4 F;  2AJ2 A;  3JTP A;  5H9F K;  3G82 B;  2V8P A;  2Z2L A;  3F0N A;  5A2Q U;  3J7A N;  2NR0 A;  3TX8 A;  4NEZ A;  1RA7 A;  4CLK A;  3F73 A;  2CQ3 A;  3MED B;  5KFV A;  4KJI A;  1M1G A;  3P3D A;  4ZDN A;  2V94 A;  3GJS B;  2F9D A;  4RW8 A;  2HSE B;  4I69 A;  2HQD A;  1HI8 A;  1XQI A;  4V1A k;  4AXJ A;  3DOM B;  2L9D A;  3TA1 A;  1Q16 B;  3DNC A;  2HBY B;  1S76 D;  2ATL A;  3IAM 9;  3WX8 A;  2HZC A;  3OT9 A;  4ECW A;  4RUC A;  3C6T A;  4WU2 A;  3MM6 A;  3MM7 A;  4QBU A;  2G0I A;  2IVY A;  1KKH A;  2E1R A;  3OFE A;  1WSR A;  3N5F A;  4GVL A;  3RB6 A;  1FVQ A;  2Y0B B;  2WVD A;  3PJX A;  2FGO A;  2HFN A;  1VBZ A;  2XHC A;  1GK8 A;  3ETO A;  4DSE A;  4B17 A;  2P9E A;  2E5G A;  3NBP A;  3FMW A;  3WX4 A;  1RSC A;  2RT3 A;  3R5A A;  1LWC B;  4WF9 Q;  1BQN A;  4N47 A;  4FNH A;  4FBU A;  2CQD A;  4PXB A;  2Y0S D;  4UQG A;  2MKK A;  3DN9 A;  3KLG A;  2AEJ A;  1N32 J;  4DR2 J;  3OPK A;  5B0G A;  1NDP A;  2CPF A;  3DMJ A;  3D0G E;  4CLP A;  3PR5 B;  1SUQ B;  3I5B A;  1B64 A;  3TA0 A;  2M8D B;  4HTJ A;  2LQJ A;  2KJW A;  4CLL A;  1TZ0 A;  3I4H X;  1RIS A;  3GIM A;  1RTH B;  3DU6 A;  1FTC A;  4ZP6 A;  3I4P A;  2NXN A;  2FZK B;  5I3U B;  1PO6 A;  2CIM A;  3GSD A;  2WVB A;  4D3G A;  4ZCK A;  1YG0 A;  1DHM A;  4EBC A;  2KFN A;  3MCO A;  2JVR A;  3KHH A;  3OV7 A;  2CJK A;  2FDN A;  4R25 A;  2GCF A;  2QZ8 A;  3MWB A;  2X3G A;  1ICE B;  3OLA A;  2LMI A;  3IMQ J;  2J5A A;  1S7H A;  3W7B A;  4PXE A;  3GIL A;  4DS5 A;  5EWF A;  4ECY A;  2AIR B;  2LDI A;  4M5N A;  2W8K A;  1BWV A;  2ASY A;  1HNZ J;  4J9R A;  1S1U A;  2D69 A;  4DFJ A;  4LRB A;  1L5U A;  4ES1 A;  4M94 A;  4G3I A;  3NGR A;  4QIF A;  5L46 A;  5EN1 A;  1SKU B;  2Q1L A;  1NPP A;  2ASJ A;  4FF4 A;  2HFZ A;  2YWH A;  2ZWO A;  1O8B A;  1I3O B;  1MML A;  2CNN B;  2F4V J;  2QFJ A;  2ZOM A;  1WTB A;  3JTN A;  3DRP A;  3G86 A;  3OL6 A;  1URN A;  3TEG A;  4JYA F;  1DTQ A;  4IG0 B;  1MRO A;  2KN4 A;  3Q24 A;  2HRU A;  5C25 B;  4J9M A;  3IR7 B;  2R3V A;  4QW9 A;  3C16 B;  1WJ9 A;  2Z2Y B;  1PCA A;  2WTF A;  1UA1 A;  2VQE F;  4OHV A;  2RH3 A;  4WZM A;  2VZ9 A;  3IBF B;  1B99 A;  1NND A;  1U6F A;  4DV1 J;  1Y5I B;  3CDU A;  1ZZN A;  4IFV A;  1JLE A;  5D3G A;  1TKT B;  2XWX A;  1F9F A;  4H54 A;  4GKK J;  2PGC A;  2R2S A;  2VG5 B;  3PRB A;  4PWW A;  1QTN B;  5KFK A;  3DRR A;  3SCI E;  2BW7 A;  1OYD A;  1FER A;  2VUG A;  4K2X A;  1VQO S;  2D1C A;  2AJF E;  4NLU A;  3V6K A;  2Q6B A;  4LF5 J;  4B3S J;  3CD6 S;  2FZG B;  3HJF A;  1CLF A;  5IC6 B;  4FKX A;  2OHD A;  3D54 A;  3P5T L;  2KVQ E;  4XPC A;  3D0I E;  4WIQ A;  3VAF A;  3PAC A;  1DBD A;  4J9K A;  4RW6 B;  1TKZ B;  2DNP A;  4AXI A;  1T11 A;  3IRX B;  4B9U A;  3TUJ C;  1FCA A;  4DBQ A;  2CVI A;  1CVJ A;  2ZBC A;  4OI1 A;  2BE9 B;  2HNZ A;  1HWL A;  1GXT A;  2AHO B;  3H4D A;  1MU2 B;  3PY8 A;  2C3M A;  1R43 A;  5IV4 A;  2UVV A;  1RCX B;  2MLX A;  1RWV B;  1HNW F;  4W4M A;  2QC3 A;  2NCK L;  1TVR A;  2RKI A;  3CC4 S;  4KAI A;  2OPR A;  5GAH U;  1ZM2 A;  1GAO A;  1HHQ A;  3UDE A;  4B9L A;  4CT8 A;  3I0R A;  2GHP A;  5KFH A;  2BJ9 A;  3M2V A;  2FC8 A;  3FSI A;  1T9W A;  2XLI A;  5D0R A;  3H0P A;  1UA0 A;  2XNQ A;  2FJW A;  2V9K A;  3IP0 A;  4PPD A;  2FLL A;  4FS1 A;  3W66 A;  4P71 A;  2VBX A;  4DV3 J;  3SZ2 A;  2OGU A;  3VAK A;  4LJM A;  1NSA A;  4ELV A;  2AQ4 A;  2HRY A;  2E7V A;  2DD8 S;  3MMC B;  5F8L A;  3R7B B;  2BM0 A;  4YR3 A;  2Y1J A;  3MFI A;  2G4B A;  1XR5 A;  3GTY X;  3VAG A;  1OPI A;  5JXS A;  4ICL A;  2MZQ A;  4ZP8 A;  4MJK A;  1HQU B;  3D0H E;  1YJN S;  2ACM A;  2JNJ A;  4K4X A;  4M5D A;  1BMQ B;  3MPV A;  3CF5 Q;  1U7L A;  1X4F A;  3FJ2 A;  1YJ9 S;  3DXS X;  1N33 J;  1YJT A;  3D1Q A;  3HHK A;  5KFJ A;  5CYM A;  2EI5 A;  1UPP A;  2PO4 A;  2D3U A;  4RBV A;  1HBN A;  1FE0 A;  5BR8 J;  2AWZ A;  4DU8 A;  2YWK A;  1IM6 A;  1R6V A;  2ZZT A;  2CPX A;  2LEP A;  4N7T A;  3EE3 A;  1YIJ S;  1QDU B;  5IFM A;  1J27 A;  1CJK A;  2ACY A;  4WFZ A;  1TU0 B;  3SSQ A;  4NLV A;  2HQI A;  4EI2 A;  5DLF A;  1L3S A;  1OWX A;  1IKY A;  4QU6 A;  1UMJ A;  1HBO B;  2QT7 A;  3IGN A;  2VPY B;  3CJT A;  3QRR A;  1M5K C;  4C2M A;  1ZS6 A;  4Z7C A;  2PD1 A;  2HVH A;  1UEU A;  2J0Q D;  2JOQ A;  3CJS A;  2CFX A;  1RT4 B;  4MYT A;  3D66 A;  3TI0 A;  2BQ3 A;  2QEX S;  2CZV C;  3UCG A;  3DLG A;  4LVN P;  4MK8 A;  3PYD A;  2HK3 A;  4KV8 B;  5HAN A;  1WEL A;  1X5T A;  1A0O B;  3EDR B;  2WOM A;  4Y34 A;  4IG3 A;  4KKO A;  4Y00 A;  1K8A T;  4PG7 A;  1KSP A;  3HK2 A;  1RTJ A;  5A8W B;  4MMO A;  2LXF A;  1LW2 A;  3SXL A;  1UW9 A;  3C66 A;  2QMW A;  3GV8 B;  4F3M A;  3K59 A;  2LKZ A;  3FVY A;  3K89 A;  2FJE B;  3R1H A;  4TVA B;  2KYZ A;  2LU2 A;  3QPI A;  4GC7 A;  1KWM A;  4K5R A;  2FB0 A;  1P1L A;  3PG9 A;  1AFI A;  3Q2T C;  4KFB A;  4MFB B;  3P8B B;  3M8Z A;  4OZ1 A;  2LVW A;  3NS5 A;  2YNG A;  4PAA A;  1YRX A;  2HHX A;  2ZBI A;  4DV4 F;  1OQ6 A;  2JWN A;  2BAC A;  4JI4 J;  3ISN C;  1ZTW A;  3AXK A;  1T95 A;  3LAK A;  4O23 A;  4OX8 A;  2MSS A;  2DIU A;  2MHN A;  3KFW X;  1RCO B;  3L4B C;  4J9N A;  4YDD B;  3QGI A;  3KK2 B;  4TYB A;  1VHF A;  1XR6 A;  1D9F A;  4B02 A;  2Z30 B;  4N56 A;  3CCJ S;  1G6B A;  1R0A B;  3BH6 B;  1SJ4 P;  2BRL A;  2WB4 A;  1NLK L;  1BGX T;  4I6A A;  2Z56 B;  2NSC A;  4J9U E;  5E33 A;  4C11 B;  3KXD A;  1NAQ A;  1MW7 A;  3EGV A;  2XSJ A;  1T02 A;  3FSX A;  1N5Q A;  4UY8 T;  4RWX A;  3CDW A;  1E6V B;  3D2W A;  2YWG A;  3HVA A;  4GKJ F;  2PA3 A;  4DX6 A;  2EK1 A;  2AGP A;  2ZNY A;  3FK4 A;  2OD6 A;  2I5J A;  3TJ9 A;  4CLT A;  3US5 A;  4WYL A;  5GAE I;  1M5P C;  1JWW A;  3H4B A;  3B8H A;  2RIJ A;  3ZZ0 A;  4F67 A;  2F7V A;  1FJE B;  2YNH B;  2NYI A;  3R27 A;  2CNO B;  2ZDO A;  2BOA A;  3R2D J;  4LRD A;  3K58 A;  2ZZM A;  2ERR A;  1GTE A;  3G8S A;  1BQM A;  1IVZ A;  3CWJ A;  3A8I A;  2OEJ A;  2GW8 A;  3CT9 A;  1WDT A;  5KT3 A;  1VYA A;  2DNM A;  2RU9 A;  3MPU B;  4DDF A;  4UOG A;  5HP1 B;  3IN5 A;  4V19 X;  3TWZ A;  3EPG A;  4GO7 X;  1Q82 T;  5DDO C;  4LF9 J;  3QAT A;  4DR6 J;  1RT6 A;  1Q95 G;  1N52 B;  2DNG A;  5HMW A;  5K8O A;  4YS2 A;  1FT8 A;  3SBM A;  1NK4 A;  2PMH A;  3VV2 B;  9ATC B;  1HI1 A;  1ZH5 A;  3MM7 B;  1WG1 A;  4QZV B;  4NLY A;  2XEX A;  1NEE A;  3OXG A;  2HWI A;  4RPF A;  3H59 A;  2A1B A;  1SVD A;  1X4B A;  1F2H A;  2AMC B;  3MEE A;  4G1Q B;  4RU9 A;  1WOS A;  4J9Q A;  3M8S A;  4Y28 C;  2KM8 C;  5A0Y A;  1SKW A;  3KHG A;  1LNQ A;  2Z0G A;  3AY0 A;  3MUT P;  5T14 A;  2R7Q A;  5DLG A;  5E3Q A;  1U6Z A;  3I5C A;  1T0T V;  2G2O A;  4KY3 A;  2R4F A;  5FJ4 A;  1S9G B;  2CZ9 A;  4J9V A;  3KLG B;  1IR1 A;  1JNZ B;  2B8P A;  3H98 A;  3DMJ B;  1UVK A;  1L3T A;  4QCL A;  4ECV A;  3C3L A;  3GU0 A;  3GWC A;  3BKU A;  1TL4 A;  1S1T B;  4H4K C;  4I0W A;  2WW4 A;  4LF8 F;  4I7F B;  2VPW B;  3GV7 B;  2DVI A;  1VR6 A;  3KJV A;  2P6S A;  3CJ2 A;  2RSQ A;  2EBE A;  5LM7 E;  4U7U D;  3MUV P;  3W9J A;  1B4S A;  2UUC F;  2X51 A;  3HX9 A;  3FQK A;  5DG8 A;  2CNL B;  1I94 F;  1RBO B;  1BHN A;  1Y0H A;  3TAP A;  3CED A;  1WDD A;  4EMD A;  4QIG A;  3RYL A;  4IO1 A;  2R8G A;  5LMN J;  2LQ9 A;  2VD3 A;  4RBT A;  4H4O A;  5J1P A;  1RWK B;  1S72 S;  3NCQ A;  2K2P A;  4OI6 A;  1T3O A;  2GJI A;  4V19 J;  2DXD A;  5D0H A;  4B9N A;  1Q7L B;  4DPT A;  1KQK A;  3DRP B;  1IBL J;  1U8S A;  3R7N B;  4CYU B;  2R7W A;  1TL5 A;  1YIT S;  7FDR A;  4Z7Y A;  4OX6 A;  1W26 A;  2V5H G;  1CS4 A;  2CJ9 A;  4B9S A;  3PJW A;  3JS9 A;  1CQN A;  3E3X A;  4MT1 A;  4PAB A;  4JV5 J;  4DUZ J;  5LMU J;  2YX4 A;  1NDK A;  1RK8 A;  4ZP9 A;  4FYV B;  4PG4 A;  1YJV A;  1AYE A;  2IRU A;  1PIE A;  1NZA A;  5B08 A;  4HEA 9;  3V4M A;  1JLE B;  4O4G B;  2FYX A;  4WYW A;  1W7W A;  1V3Z A;  3MR6 A;  2LYV A;  4GVB A;  1RHM B;  4OZJ A;  4F0H A;  4K4T A;  4C98 A;  2Q3P A;  4ZCI A;  2KG0 A;  4HH0 A;  4OZ2 A;  3PW4 A;  4I1T A;  3DRR B;  2I9S A;  2RRA A;  2RE1 A;  4Q8E A;  3LW5 C;  3VAL A;  4N41 A;  3SQO P;  2FVC A;  5B0B A;  3I82 A;  3ZZY A;  4X66 J;  3OTC A;  1O5J A;  2XGP A;  2H9Z A;  3V4I B;  3KK3 A;  2UUB J;  3U27 A;  4HR2 A;  1VQP S;  2DNH A;  2UXB J;  2B7C B;  1NH8 A;  5M2R A;  5DQG A;  4TU7 A;  2AP6 A;  2RD5 C;  3P6Y C;  3BN7 A;  3OLB A;  1U1M A;  4CM0 A;  5JJB A;  1N36 F;  2EFP A;  1HWI A;  1NPR A;  1SKR A;  6AT1 B;  2B4V A;  3KJQ B;  1GQE A;  3NKY A;  3CCW A;  4EZ9 A;  1RHQ B;  3OTE A;  2GQQ A;  2YWF A;  3OTO F;  5E41 A;  4ECX A;  2BAB A;  7FD1 A;  2W01 A;  3QWP A;  1JJC B;  1TVR B;  2RKI B;  3DFE A;  2OPR B;  5DZ6 A;  2AU0 A;  2XO6 A;  4EZ6 A;  1F5B A;  3OVA A;  3UD3 P;  5D8H B;  5DQH A;  5LSR A;  3MEG B;  3I0R B;  5HQL A;  2RDD A;  2M3D A;  3AD7 C;  4LFC F;  5M2U A;  4LSN B;  3J7Y I;  1JXV A;  4L72 B;  5F3T A;  5A76 A;  3HVT A;  3NCP A;  3MUM P;  1B0P A;  2DGQ A;  4KC5 A;  3BKF A;  2ZM6 F;  3FCW A;  1T05 B;  3OD2 A;  4N76 A;  3OFF A;  1ROF A;  1YJR A;  3TAM A;  3EZ5 A;  4TXS A;  2DNQ A;  4ICL B;  7AT1 B;  1B3T A;  3O8W A;  2HHT A;  3OFG A;  2G9O A;  2YQ1 A;  3NGT A;  1JLF B;  4C9D A;  2ZH4 A;  5HJY A;  4M5D B;  1OJ4 A;  1JLA B;  2FTR A;  2J9D E;  3ZZP A;  1HW9 A;  3OTB A;  3RW7 A;  3THV A;  2L3M A;  1NO8 A;  2Z2Z A;  3QLH B;  1HNX J;  1D9A A;  4KPY A;  1LFW A;  3SV3 A;  4WU3 A;  2HQG A;  4LRC A;  3PR4 A;  3DRS A;  2FY1 A;  1VQ8 S;  2GVD A;  1NJI T;  1D9D A;  2J9D A;  2MQ8 A;  2OTL S;  4F0M A;  3P45 B;  3T1H F;  1U1O A;  1VDH A;  4DPW A;  2B0G A;  3G2X A;  5LOQ A;  1TAQ A;  4HI2 A;  2KKH A;  1VMB A;  3MXH P;  3VGU A;  1YZ7 A;  3I96 A;  3H5U A;  2ZFH A;  2DY1 A;  3H25 A;  3FNN A;  2LCW A;  3VQS A;  4DQP A;  1CJK B;  3K8V A;  3D3C J;  4RKU C;  1H6K X;  3ET6 A;  1A7G E;  2YVS A;  1VLO A;  2V2K A;  4ZVT B;  5I4M A;  3WC2 A;  4X84 A;  4LRF A;  3LA0 A;  1IKY B;  4DCP B;  3ZTP A;  4WK1 A;  4A8X A;  2PC6 A;  4CO0 A;  5KFF A;  3DHX A;  2IYI A;  1SV5 A;  1VQ9 S;  3FQL A;  5HVF A;  3DLG B;  2IFX A;  4IH5 A;  4OL8 A;  3DOL B;  5IZH A;  2F9J A;  3I31 A;  3POT A;  2WOM B;  4EYH B;  3BPS P;  3R5C A;  4HHH A;  4KKO B;  2C3Y A;  1ZA1 B;  2OAU A;  2C2O B;  1U1P A;  1K47 A;  2I0X A;  2VQF F;  1LW2 B;  2HVD A;  4K4W A;  4AND A;  2FY8 A;  4NLW A;  5DDQ C;  4M5L A;  2CJA A;  3BQ0 A;  3RRK A;  1ZBT A;  2XI3 A;  1IJF B;  3RBX A;  3M1V B;  3FBE A;  4DR4 F;  3KLI A;  3JB9 k;  4U95 A;  3CCR S;  4DEZ A;  4DR5 J;  2M88 A;  3H42 A;  3CJ0 A;  3D7S B;  2YNG B;  3ZZT A;  2PMW A;  5CYJ A;  1H0H B;  2ALZ A;  5HJX A;  1LWF A;  1F3V A;  1RGV A;  3BBB A;  1WKL A;  2F63 A;  1QM9 A;  3OBI A;  4RL1 A;  2E5L F;  2IDL A;  2DCL A;  2QG9 B;  3EVO A;  1HAR A;  4E0D A;  3CD0 A;  4B9M A;  5HSP A;  2AJ4 A;  3ZXW A;  1TL3 A;  4BHQ A;  3NMR A;  1CUL A;  1HPZ A;  2QLF B;  3FCH A;  1PAE X;  4LMZ A;  2RQK A;  5L1I A;  2QL5 B;  3RR8 A;  4L3K A;  4EWT A;  3E01 A;  3CC2 S;  1N5T A;  4Q45 A;  3NAH A;  1XMB A;  1TK0 A;  2FZC B;  1ZM4 A;  1IKV A;  2MZJ A;  1VBK A;  2EPI A;  3CJK A;  3G4S S;  2B9Y A;  3MM5 A;  2V8D A;  2Q43 A;  1XWL A;  2BJ8 A;  3HCX A;  2I8E A;  3MR3 A;  2BZ2 A;  2XMT A;  3W65 A;  4Z37 A;  4NXM F;  2DHX A;  5KFZ A;  1JLB B;  1IBK F;  3HT3 A;  3U1N A;  3THT A;  5CA5 A;  5KG3 A;  2I5J B;  5LSO A;  2IY5 B;  2J7U A;  4OYW A;  1N34 F;  1XNR F;  4LRA A;  1Q0N A;  2Y1L B;  3KJN B;  1M5S A;  2XTJ P;  5D6G A;  2JJ4 D;  4QYR A;  3AA9 A;  1DY3 A;  2YWE A;  1RAB B;  3RW6 A;  1RT2 B;  2D41 A;  1VC0 A;  2E9Z A;  1W2I A;  3Q8V A;  4C3L A;  4CLS A;  5HMX A;  1JMT A;  1WOP A;  3PHE A;  4NZ7 A;  1ZZF A;  4DF8 A;  3PO4 A;  3LP0 A;  4K4S A;  2V6A A;  4EO6 A;  2E29 A;  5HVH A;  1RT6 B;  1HL6 A;  3QID A;  4RJV A;  4WP8 A;  1MLA A;  4OHW A;  1TK8 A;  4ZCM A;  3CCV S;  5KFN A;  4RW4 A;  1HI0 P;  1WWH A;  2B56 A;  3KG1 A;  4ZVF A;  3V6D A;  4FXW A;  1KRP A;  2AV5 A;  3L7U A;  2R42 A;  3DLB A;  1M90 T;  4YY3 F;  5J2N B;  2P9G A;  1Q86 T;  4Y2C A;  5A0Y B;  2DNR A;  4ZLP A;  1N48 A;  2RUS A;  5CAB A;  5J2P B;  4ZMM A;  4I56 A;  2MB0 B;  4C3M A;  2PN6 A;  5C24 B;  1J5O A;  1RDR A;  1WF2 A;  4URG A;  1S0O A;  4QR2 A;  5GAG U;  5F8H A;  3IR6 B;  5B0A A;  4R8U A;  2B3T B;  3GE9 A;  2V34 A;  2MYF A;  4ILL A;  4L74 A;  4I2Q B;  1U47 A;  4JI1 F;  3DRX A;  1KQS R;  3W5Z A;  4N5S A;  3ULH A;  3JXO A;  3VAI A;  5AXL A;  2VHG A;  3KJV B;  4NA3 A;  4EUV A;  5FDL A;  2D3Z A;  2CJX B;  3B78 A;  2VA2 A;  4A8Y A;  1RAF B;  2CQ2 A;  4AL6 A;  4DXL A;  5LJ5 Y;  1PSD A;  2MZT A;  5J2M A;  1TP7 A;  1RQ0 A;  1Y3J A;  1HD1 A;  2FJX A;  2BAN A;  4OV1 A;  1EKS A;  3CJ5 A;  1UW4 A;  3EDQ B;  4YP3 A;  3O6Q A;  1QAJ A;  3CME S;  4ZPV R;  1LK5 A;  4RWW A;  5HL7 Q;  2Y9H A;  3ENW A;  1UP1 A;  3LPY A;  3S6E A;  1VJQ A;  1F0X A;  3MM8 A;  3D6H B;  1U48 A;  1IR2 A;  3JYT B;  2JLG A;  3HPO A;  2MDA A;  1LKZ A;  4EYI B;  2V2V A;  4LFB F;  3M6V A;  1D1U A;  3GP9 A;  3TYT A;  3KKF A;  1KON A;  1XNQ F;  3QMQ A;  4PZV A;  4O3N A;  2CVE A;  2COL A;  3LWM A;  1R27 B;  3DOK A;  3SDE A;  2DRD A;  3M2U A;  3PKM A;  2EKY A;  4IR9 A;  4HI1 A;  2QX0 A;  3UDV A;  2NXC A;  4K4Y A;  2MGZ A;  1WHX A;  4OI3 A;  3ICL A;  3WZ0 A;  3R8Y A;  4F36 A;  4KGM A;  1ZPV A;  2QL9 B;  1R8C A;  3TVY A;  1S4F A;  2MMY A;  4P6Q A;  2LA6 A;  4CM2 A;  1YKW A;  4ZPA A;  3Q83 A;  4NLS A;  3I0S A;  2Z58 B;  4LF6 F;  5KFR A;  1F2G A;  2FHO B;  5KFY A;  3K2Y A;  4A46 A;  1HNW J;  5HRO B;  3KK3 B;  1VIS A;  1T03 A;  3O44 A;  4Y2A A;  2IBK A;  1FKO B;  1RT1 B;  3M9N B;  1FFG B;  1JLC A;  2RDJ A;  3NCR A;  2E1P A;  1GMW D;  2KG1 A;  2J6T A;  2VL1 A;  1GNK A;  3T41 A;  2PI5 A;  2Z57 B;  4RNO A;  3OUY A;  3MMJ A;  3PFE A;  1FDD A;  1MWZ A;  1H98 A;  5K5M A;  3RJM B;  4DR7 F;  2WK4 A;  3GCW P;  3UN5 A;  2V4R A;  4WK3 A;  1NZ8 A;  1RTZ A;  1AA1 B;  1WD6 A;  2FUG 9;  1Y5L B;  4JI2 F;  1TFY A;  2KU7 A;  2HHU A;  3SMZ A;  3KLE A;  4B3M F;  3W61 A;  3ZTR A;  2UXD J;  2J76 E;  4EU0 A;  4WP3 A;  3BS9 A;  4M5G A;  4PXD A;  3HVT B;  2DHG A;  1YJW S;  3FFI A;  2HUR A;  2QLJ B;  1WKJ A;  1OY8 A;  3GON A;  1VQ7 S;  4H4M A;  4DUT A;  1X5S A;  2E44 A;  3RB3 A;  1HNV B;  3EZU A;  1DTT A;  2I6W A;  1H73 A;  2HAF A;  2M8H A;  4DV0 F;  1QJH A;  1B7F A;  2J9E A;  3ENQ A;  5BYR A;  3MOJ B;  1Q81 T;  3TAM B;  4BBY A;  4B3R J;  4QWB A;  2IIH A;  6FDR A;  3N79 A;  3W1Y C;  1NKE A;  1ELO A;  5ADZ A;  3TUP A;  4C8O A;  2ZH7 A;  3GIK A;  3FCV A;  1RAC B;  2PEH A;  3RU0 A;  3CCE S;  3OJS A;  3T5H A;  2GML A;  3FKB A;  2HBZ B;  4M95 A;  3PYG A;  3FDS A;  4C48 A;  2GVD B;  3Q86 A;  5L39 A;  3TZZ A;  2BMB A;  1B0V A;  2KRB A;  3CC7 S;  4DV7 F;  5J2Q A;  4DSJ A;  3C14 A;  3K5O A;  1P9Q C;  4L6V 3;  2IM2 A;  3C46 A;  1XIQ A;  5KG2 A;  3KWM A;  1D8Y A;  2UUW A;  1FJ7 A;  3T5L A;  1AT1 B;  3HD1 A;  5LT5 A;  3MTK A;  1OO0 B;  3ET6 B;  3T5J A;  1XBW A;  2P6T A;  3KLH A;  1WAC A;  3C19 A;  3RTV A;  2B5J A;  4BCA A;  3NNH A;  3BH7 B;  3E8O A;  4QWC A;  2XS7 A;  5B0F A;  1HLW A;  4WFN Q;  4IYQ A;  2WCX A;  4DPU A;  5KG1 A;  2VU5 A;  4L76 A;  3RRH A;  2X1G A;  1H7W A;  3EYZ A;  5HO4 A;  1EZZ B;  2J8A A;  2PT0 A;  4JI3 J;  4NLD A;  3POT B;  3AJ1 A;  4NMX A;  3MD1 A;  4FDF A;  1PAU B;  4DV4 J;  2V2Q A;  4ID5 B;  2MLZ A;  4LR9 A;  2KL8 A;  2J0W A;  3U7J A;  3SQG A;  1TL1 A;  2GVZ A;  3HHD A;  4OZL A;  3SFU A;  4M5M A;  3PYF A;  3HSJ A;  4PRF A;  4QIV A;  3KLI B;  4P7T A;  1VIO A;  4ATN A;  5RUB A;  3DGP A;  1S97 A;  3AD8 C;  1J2V A;  2KXN B;  2QLB B;  5A8K A;  3R5D A;  2HIY A;  4X65 F;  2W7O A;  1V3R A;  1EAY C;  2ASD A;  2LXU A;  2BUN A;  1NK6 A;  1R8B A;  2ADB A;  4MTP A;  4WTY A;  2LU1 A;  4XDD A;  3LWL A;  2PDA A;  2RUG A;  1XEZ A;  3ZZZ A;  2LDY A;  2V4J A;  1WHW A;  2H1Y A;  3ZTS A;  3I87 A;  4J9O A;  3EM1 A;  4DFP A;  2UUA F;  3EXY A;  3J7Z 5;  1AUD A;  1TL3 B;  5IXU A;  1CUL B;  1HPZ B;  1GEH A;  4BWM A;  5DGB A;  3HHL D;  4FPI A;  1GXL A;  1EQ0 A;  2CPD A;  1I1G A;  4FXD A;  3ENA A;  3KK1 A;  2ASL A;  4C0H A;  2X1F A;  1EJ7 L;  5I3P A;  3E01 B;  3R1L A;  2RJZ A;  1T3N A;  3HSZ A;  2E7X A;  3W2W B;  1S9F A;  3T5K A;  2GIR A;  1IKV B;  3OQ2 A;  1U1K A;  4PYA A;  1S9E B;  4KH0 B;  4OX9 F;  2HBR B;  1CJT A;  3NG8 A;  3OR2 B;  1IKW B;  2DNL A;  1WC0 A;  3GYN A;  1NCL A;  1BXN A;  2N4D A;  1EB0 A;  3VZI A;  2C2D A;  2M4M A;  3U02 A;  5I42 B;  2FPH X;  2W25 A;  5ETV A;  2ZD1 A;  3PO5 A;  4B9T A;  4X62 F;  3PXG a;  3O1L A;  2M0G B;  3PFO A;  1QTM A;  1KFD A;  4ZHR A;  1ZET A;  4Y3C A;  3KYL A;  3KNG A;  3H8Y A;  2YKO A;  5DQI A;  2NUH A;  4A8K A;  2RRB A;  1SCJ B;  3C6U A;  5AE2 A;  4KO0 A;  1KLM A;  2N82 B;  2H4W B;  5E3C A;  2BW2 A;  3EUN A;  4PKD B;  4YME A;  2OTJ S;  5IOL A;  5EWE A;  2DXF A;  1RZM A;  2HFO A;  1FDB A;  5DZ7 A;  3R2C J;  3AQO A;  3FRZ A;  1LXJ A;  4FBT A;  3SCJ E;  4YFU A;  2VIC A;  3LP0 B;  1KHW A;  2O3D A;  3PIP Q;  3LF0 A;  4NYP A;  3PM9 A;  2E1A A;  2W9B B;  4LBP A;  3D6F B;  4JUZ A;  4CQ1 A;  3ZTO A;  2F1F A;  5B09 A;  4JB8 B;  2A6O A;  3OL8 A;  3DKD A;  2LP4 A;  3V6D B;  1JJ2 R;  3N9U C;  4ZVG A;  4ECU A;  1LW0 A;  3IWN C;  5F9N A;  1FXL A;  2E7W A;  2F4F A;  4L73 A;  5D78 A;  1VQK S;  2HYI B;  4JV1 A;  2NPF A;  2R2R A;  2DRA A;  3TQ1 A;  1Q7Y T;  2OFG X;  4ZPD A;  1WF1 A;  3H2L A;  2CAD A;  2AF6 A;  1J5O B;  2KRR A;  2BBE A;  3KUH A;  4FZV A;  3AJ2 A;  3SCK E;  2VV5 A;  2R7V A;  2UUC J;  3DLL Q;  4WFX A;  1X9S A;  4R8U B;  1FI4 A;  2F8E X;  2WON A;  2YQ3 A;  2K1R A;  5D0G A;  4ZLL A;  3EMT A;  2FJV A;  2XHW A;  4M5H A;  2DIT A;  5E3P A;  1TKX A;  1UVM A;  3IS9 A;  1TMJ A;  2PI4 A;  3BZQ A;  1F9H A;  2XWY A;  4H4K A;  5FDL B;  2RB7 A;  2IRY A;  1HKA A;  1VRU A;  2J7K A;  3IXQ A;  4K8R A;  1APS A;  4YOE A;  2IRX A;  3QFH A;  1RBL A;  2RQ4 A;  4USU A;  5J2M B;  1YDL A;  3Q8Q B;  3V81 A;  4USK A;  3J81 U;  4A8F A;  4OHX A;  4I67 A;  4NXN J;  1RI7 A;  5IM0 A;  4ZIW A;  4HVZ A;  2C42 A;  4U7U K;  1ULR A;  2R9L A;  2MQN A;  5K8N A;  3CD5 A;  4CNZ A;  2VPZ B;  3GIR A;  4DR2 F;  4LVO P;  5DRK A;  1GMW A;  4TKT A;  4F4W A;  4LBI A;  1FKP A;  4EFA C;  3H5Y A;  1NKB A;  2YY3 A;  3K5L A;  4DL2 A;  3I9V 9;  5CD4 H;  4X4R A;  3HZG A;  2XYG B;  3OW2 R;  3C2P A;  1KN6 A;  3N5B A;  3M8Q A;  1S1X A;  1M5O C;  2FJA B;  4A8O A;  3CNQ P;  3DOK B;  3SDE B;  1CEZ A;  3UNG C;  5HI7 A;  2ZOG A;  1IKX A;  1RXO B;  4FN5 A;  3OSP A;  2EXU A;  3DLK A;  4RUA A;  1TQL A;  1H7X A;  2MQM A;  4AYB D;  1MN7 A;  2KI2 A;  2QN6 B;  5D0E A;  2JLF A;  2P8I A;  2MGZ B;  4YR2 A;  1ZM3 A;  2DEI A;  3MD3 A;  3CCQ S;  1RAH B;  1GXU A;  2HGM A;  4Y65 A;  4YUD A;  4TYA A;  3MOZ A;  1JLG A;  2DBB A;  3JSB A;  1U0S A;  4YR0 A;  4MAK A;  5BJR A;  4DMZ A;  5SUH A;  1WC6 A;  1HNZ F;  1YSJ A;  3AB2 B;  2WVF A;  4NZ6 A;  4P10 A;  1N5Y B;  1N36 J;  2XLJ A;  1JJH A;  1P6T A;  2IMO A;  1C4C A;  4MKA A;  3C15 A;  2LFV A;  3CJQ A;  3I0S B;  5C42 A;  4XTT A;  2VAS A;  1DZ5 A;  3X1L B;  4QR0 A;  1H3D A;  5CD4 A;  5I3Q A;  4TQR A;  2UXC F;  2MLY A;  4E2F B;  4OZ0 A;  5JVG Q;  2ATC B;  2LQB A;  3MEK A;  1U1L A;  1YBA A;  1T03 B;  2BDP A;  4CLF A;  3E51 A;  1FK9 A;  4F4X A;  1JLC B;  2DGT A;  2DGW A;  2CQH A;  3QIP A;  1MG7 A;  1SXL A;  3TEH B;  2RQC A;  4DQI A;  4LFC J;  3OR1 A;  2C3O A;  3CXC R;  4CI0 B;  4QJV A;  2OPS A;  4CTA A;  4BWJ A;  3CJ4 A;  4DV1 F;  4ZIT A;  2JVO A;  3EIC A;  4FKY A;  5KT7 A;  1RT7 A;  1RYR A;  2JFK A;  5HMY A;  2ZM6 J;  2ZH8 A;  2APO A;  1WHY A;  2ZJR Q;  3B54 A;  1CC8 A;  1FO1 A;  5HAO A;  2BKO A;  3PX6 A;  3GII A;  1FD8 A;  1VC5 A;  2GNK A;  1GT8 A;  4G65 A;  3FZ2 A;  5HBM A;  4WE1 A;  4B3S F;  1FJC A;  1VIX A;  1SIW B;  3CCS S;  5FII A;  3FFI B;  3GJT B;  3FBB A;  2HHH J;  4I4B A;  2XMU A;  4H4M B;  1NHU A;  4DL6 A;  4TY8 A;  1BWE A;  1NSQ A;  3PTW A;  1VRT A;  2DH7 A;  2HW3 A;  1AUS L;  2ZKT A;  5IV3 A;  2XZT B;  3DYA A;  3CCU S;  4R0E A;  4F0K A;  3V6J A;  1X4A A;  1S12 A;  5C5J A;  1SC4 B;  3QNW B;  3T3F A;  2OJ3 A;  5DGA A;  4XO0 A;  4KYZ A;  5CZX A;  2ZEJ A;  4OZN A;  2YH0 A;  2DKO B;  1RBA A;  2DO4 A;  3UDL A;  1SJR A;  4UZC A;  2RVJ A;  2XCA A;  1TL7 A;  1FD2 A;  4ITS A;  1JIH A;  1NU4 A;  5JUM A;  4L75 A;  2PII A;  5J2Q B;  1V5V A;  3C14 B;  2CQI A;  3EJM A;  4ECR A;  3M4X A;  2RML A;  2WSC C;  3NL0 A;  3M6U A;  3UW1 A;  3BPD A;  2UVU A;  1QE1 A;  1XMQ F;  2UV8 G;  2QA4 G;  1DAR A;  2HHS A;  2FHK A;  3HHL A;  4RNF A;  4QWE A;  1U2C A;  3V6H A;  3UCZ P;  1OIA A;  1R7I A;  2CKW A;  1M1K T;  4C4W A;  1C0T B;  4JBC A;  2EK6 A;  1VQN S;  3M8Y A;  5IQ6 A;  5L9X A;  3MR7 A;  1X60 A;  1DLO A;  3OTD A;  2R7T A;  2XMV A;  2UU9 F;  5AXM A;  4P2X A;  3HD2 A;  2K7J A;  2AX0 A;  1ZYQ A;  5DDP C;  1PIL A;  3DDN A;  2PFD A;  2BJE A;  2HEK A;  1SL0 A;  3IBW A;  3NGK A;  2LA4 A;  2XY6 A;  4GO5 X;  3DI6 A;  3QSI A;  4LUB A;  3ZTQ A;  5GAD I;  4CLZ A;  1XK8 A;  4C0O C;  1ARO P;  4NLQ A;  3EZO A;  1SH0 A;  4ECQ A;  1TL1 B;  1LFP A;  1RLC L;  2XYH B;  2FC9 A;  4PQA A;  1SH3 A;  4IO9 Q;  1SQF A;  2V2Z A;  2AGQ A;  2VFU A;  4ZP7 A;  3I9Z A;  5T41 A;  3H7H B;  3UNY A;  2ZVS A;  4TQS A;  1XC9 A;  5A8K B;  2KFY A;  4X4V A;  4NEY A;  3TOQ A;  3PHT A;  2Y1I A;  3D4J A;  5IC4 B;  4DN9 A;  3DDK A;  4Z2X A;  4WXW A;  3OFH A;  4UUW A;  3CDA A;  1UJ6 A;  2Y1R I;  4ZN3 A;  5KFP A;  1YWX A;  3NRB A;  1SJQ A;  2RAQ A;  3CUN A;  1F5C A;  2V4J B;  4ZKA A;  3GFX A;  2GS8 A;  3BJY A;  2WSE C;  4DG1 A;  1BLU A;  4NLO A;  4PPZ A;  1UJ4 A;  1MMN A;  3D67 A;  3JQM A;  2NQP A;  3PZP A;  1VOM A;  2SXL A;  5J1E B;  2BQR A;  1S6P A;  2CQ1 A;  1D8Z A;  3X3U A;  1NKC A;  1N34 J;  2BJD A;  2OPQ A;  4RUB A;  1CJT B;  4CLU A;  1SBR A;  2YNI B;  2K06 A;  3G6Y A;  2R8H A;  2M2B A;  1RAI B;  1RT5 A;  3B82 A;  4IDK B;  2OH2 A;  2KB2 A;  3KDO A;  3DDI A;  1SB6 A;  3H2V E;  2BKP A;  2HHW A;  1MN9 A;  5ETS A;  4C0B A;  2AJ1 A;  5KT4 A;  3M32 B;  1LXN A;  2CYY A;  2DYA A;  4O0N A;  1X9W A;  4ZHR B;  2E1C A;  2MKH A;  3I32 A;  1ZAX A;  1HA1 A;  2YKP A;  2CQP A;  2R8K A;  1M5V C;  1QSY A;  4F4Y A;  3ITH B;  3C6U B;  3RAM A;  2CQ4 A;  4KO0 B;  3LGN A;  2PFF B;  1KLM B;  3MCN A;  1VFJ A;  2H3E B;  4USV A;  1YJU A;  4IFY B;  3G82 A;  2QLW A;  1SJF A;  5CZV A;  4YY3 J;  2J0S D;  1EIY B;  1JKH A;  2ZKU A;  4C8Z A;  2GMH A;  2VG6 B;  1EHW A;  3QWU A;  5G4D A;  2IVM A;  1K9M T;  4FF1 A;  5AXN A;  2HVE A;  1UZD A;  1KTQ A;  3MED A;  2FGC A;  2WVE A;  3ILO A;  3SCL E;  3HLU A;  1CJV A;  3L7P A;  2AZ1 A;  4O44 A;  4KHM A;  3UR0 A;  4P74 A;  8AT1 B;  4ELT A;  2DR8 A;  5KT2 A;  2KHD A;  4DI6 A;  4P72 A;  1H2U X;  2ZC4 A;  1NK0 A;  2GJF A;  2ZUA A;  1Y9O A;  3BGR A;  3FRY A;  3TZW A;  1HFE L;  4QIE A;  2Y8W A;  4X4P A;  3EVM A;  4YEA A;  4RBU A;  4O3R A;  2KM8 B;  4NX9 A;  4ANE A;  1DQ9 A;  4DPX A;  3KHL A;  2RRN A;  5KFL A;  4UOC A;  3A3P B;  3IM9 A;  3CGI A;  4ZOS A;  1HW8 A;  2O67 A;  4F04 B;  2LEC A;  8RUC A;  4Y2I A;  4OLO A;  3NGD A;  2V4Q A;  2GX8 A;  2WON B;  3BR9 A;  2C2E A;  2K1R B;  3ZNJ 1;  3QYY A;  4LF9 F;  1Y11 A;  2XY7 A;  4DR6 F;  3CMA S;  2DGU A;  2CPI A;  1TKX B;  1S0M A;  3IS9 B;  3T19 A;  1LWC A;  3TAN A;  2PA8 D;  1EAR A;  1KP6 A;  1PJ5 A;  4LR7 A;  2BX6 A;  2F8H A;  1VRU B;  3RBD A;  4CH1 A;  4C97 A;  4ILM A;  2VOD A;  4OYB A;  2V9W A;  2A2C A;  3MR2 A;  2E1M C;  4LFB J;  1Q1K A;  3TQE A;  1VRQ C;  3FEZ A;  3HZE A;  1PC5 A;  1UAW A;  3MPW A;  1XNQ J;  4XK8 C;  4R5P A;  5IQQ A;  4CP5 A;  4ZPB A;  4I2P A;  1RTH A;  1G7C B;  1REV B;  3SI8 A;  3GJQ B;  5IM0 B;  3LAL A;  4NI2 A;  2NZ4 A;  4OJH A;  2BQU A;  3PW7 A;  5B0C A;  1WOR A;  5KFE A;  5M2P A;  4CRJ A;  3BGU A;  1FKP B;  1GMV A;  1RA6 A;  3R5B A;  1KEK A;  1UPM B;  3W63 A;  4ZCL A;  1N6Q A;  3MPY A;  3T6B A;  5E0O A;  1GTH A;  3M8Q B;  4HKQ A;  1S1X B;  3ETM A;  1UWB A;  3R7S B;  2KT5 A;  5AE1 A;  3BBF A;  5EUH A;  3H5X A;  2G0C A;  4Y2M A;  3MUR P;  2I38 A;  1RAD B;  3FSY A;  4CWB A;  3W9H A;  2JC0 A;  2EW9 A;  1Q78 A;  3DLH A;  3GMG A;  5KFX A;  3AD9 C;  4DR3 J;  1VS3 A;  2D7S A;  2HND A;  1VJW A;  2KZZ A;  4F4Z A;  4W90 B;  2QA2 A;  1JLG B;  4DWI A;  5C25 A;  2OSQ A;  1KLN A;  1IQZ A;  4OI0 A;  5LMN F;  1KVI A;  3N01 A;  4PEO A;  2GMJ A;  5EDW A;  5F0W A;  1P9Y A;  4I68 A;  5E5N A;  1RT3 A;  2FLN A;  3C15 B;  1U02 A;  2VJU A;  2DJW A;  2XMK A;  3CTR A;  2R7R A;  4DR7 J;  1S7I A;  4P2S A;  2NYH A;  1NJZ A;  3VVU A;  2ILY A;  4LQ3 A;  4YB7 A;  1FK9 B;  3DLJ A;  4YHH F;  5B0E A;  1DFD A;  3MMA A;  1WEY A;  2C2N A;  5D4N A;  2GAG C;  2JSX A;  3A8K A;  4JI2 J;  1C0U B;  2X1A A;  2W9C A;  4WKY A;  2KH9 A;  4ZLJ A;  1VHI A;  5A6W A;  3GFZ A;  4PYD A;  3OR1 B;  3QT6 A;  4QYZ K;  2C2M B;  4Y0F A;  1Q4R A;  2OPS B;  4CTA B;  4J9L A;  3MAQ A;  3OXF A;  5F8N A;  3FUY A;  1NH7 A;  3H40 A;  3G6E S;  4DR1 F;  2CJB A;  1KQG B;  1UVJ A;  4GC6 A;  3T9N A;  1FEE A;  3BSA A;  1C1B A;  3QBC A;  4M63 A;  4NA2 A;  3QJL A;  4OJ1 A;  1TKZ A;  2GIF A;  1IR0 A;  2W2P P;  5HLF B;  3IRX A;  4RX6 A;  2KJV A;  3N28 A;  4DV0 J;  5CCM A;  2R7O A;  2XZD B;  3BQ2 A;  1I6J A;  2Y8Y A;  4LF1 A;  2JH3 A;  2HS3 A;  3V2U C;  4X4O A;  3TNV A;  1M5H A;  2XUL A;  3WBZ A;  2B8Q A;  4JI8 F;  2L41 A;  1NK5 A;  3KLF A;  5L8R C;  2HIQ A;  1LV5 A;  3K0J A;  1RAO A;  3GPA A;  3TUZ C;  3EPI A;  2IJR A;  2HFV A;  2CJY B;  4TY8 B;  3IM8 A;  1VRT B;  4B3O A;  2DT9 A;  2HMI A;  3OSN A;  3CDE A;  4DV7 J;  3TVZ A;  1RP5 A;  4LT6 A;  3TJ8 A;  1C2P A;  4AT1 B;  5E3R A;  4DV2 J;  3JAM Y;  3GJR B;  2HS4 A;  1FX4 A;  3DRY A;  2MQO A;  4P7V A;  2I2Y A;  3DHW C;  3Q89 A;  4PWU A;  1F5A A;  1RAE B;  1OSC A;  1KQF B;  2QV6 A;  2EKN A;  1FKA F;  3BEG B;  4AL5 A;  4NYZ A;  5KFS A;  1NJX A;  4WPA A;  3GCX P;  4RW8 B;  3G6X A;  4DHV A;  2ZHB A;  1S0V A;  1RWO B;  4ZK7 M;  5LXY A;  4F2R A;  1BY9 A;  1TL7 B;  4Y6I A;  2ZBQ A;  1VK8 A;  1X0F A;  3PRD A;  2RQM A;  2YBV A;  1RTD A;  1X8D A;  3HHN B;  1NUE A;  4OI4 A;  1VK3 A;  4OYI A;  1JXE A;  1QE1 B;  3C6T B;  3LPE A;  4EGL A;  5EHH A;  3MM6 B;  3LQV A;  2WHO A;  4G6V B;  2XI2 A;  3CCT A;  5D77 A;  2VA3 A;  5GMD A;  4RNN A;  1R0B G;  2AYM A;  1CSJ A;  1R8A A;  5EX3 A;  2RHQ B;  2A10 A;  3W60 A;  2MKS A;  3NBP B;  3OJU A;  2OP5 A;  4LF7 F;  1DLO B;  4DL5 A;  4J37 A;  4X65 J;  1E6Y A;  3K57 A;  3M6W A;  5LSL A;  1BQN B;  2MPU A;  3UCU P;  1RJJ A;  4DL4 A;  4YB5 A;  3ENV A;  1O0P A;  2AX1 A;  1RT4 A;  1URR A;  4KHR A;  2HRT A;  4LSL A;  2K7K A;  2RS2 A;  1EQM A;  2XZW A;  3HSG A;  1OMS A;  4U6P A;  3HKW A;  2BJ3 A;  4KHP F;  1CPZ A;  5L1L A;  4HT5 A;  5A8W A;  5BXI A;  5KG0 A;  4NML A;  1B7Y B;  2M5Y A;  2O5D A;  3ELH A;  1WI6 A;  2MKJ A;  2ZVI A;  2HPU A;  1T8E A;  1JXL A;  4IOA Q;  3CCM S;  4BC7 A;  3FZB A;  5CYQ A;  3ADA C;  1PGZ A;  2H51 B;  2HBQ B;  1VQL S;  3OHB A;  4DF4 A;  1FX2 A;  3BGF A;  4ZVU B;  2PMZ D;  3HKZ D;  3W5Y A;  4CLW A;  3QT7 A;  4MFB A;  5GAE U;  2P9C A;  4X4N A;  1FJG F;  2VBW A;  3CJ8 A;  1FNM A;  1VQY A;  1L3V A;  1S1U B;  2ZH6 A;  4QW8 A;  1SL1 A;  1S6P B;  4DV6 J;  2CWX A;  3THP A;  4X62 J;  1KS2 A;  3BO3 A;  3KG0 A;  4LFA J;  1FE4 A;  4NLX A;  1P1T A;  1QAY A;  2BV3 A;  2DGS A;  4AD6 A;  2E5J A;  4W92 B;  3UI3 A;  3KK2 A;  2DNK A;  5EX0 A;  3D3B J;  3UR3 C;  4FPR A;  2XS2 A;  2QIF A;  1WC1 A;  2GIQ A;  3PNI A;  1DTQ B;  4TLR A;  1MRO B;  3OHA A;  3TAQ A;  2C3P A;  1SL2 A;  5H9E K;  1JNR B;  3PDN A;  3JTO A;  1KD1 T;  2O1P A;  3LGH A;  2L08 A;  2IAJ A;  5D4P A;  4DZ6 A;  1TFW A;  2WZ1 A;  3BO4 A;  2RS8 A;  4W98 A;  1CC7 A;  1WEZ A;  4K4V A;  2C2Z B;  1HR0 F;  2MJN A;  2F3J A;  3VZH A;  4IFV B;  4DPO A;  4HDG A;  3UE2 A;  5D3G B;  3UD5 A;  1FEH A;  5BYS A;  3R5G A;  3LOU A;  2IA0 A;  4EBD A;  2DRB A;  1FTR A;  3MPD A;  2V8H A;  5KFW A;  4LIW A;  5F3Z A;  4CDI A;  2MHE A;  2ZHA A;  3Q8Y A;  2RIL A;  1YRT A;  2EC0 A;  2QE5 A;  3QJP A;  4FF2 A;  4DUY J;  4IOC Q;  1H72 C;  2OI2 A;  3ISZ A;  4NLP A;  1JKH B;  3TVK A;  1HWK A;  3LP2 A;  2DR9 A;  1SKS A;  4NRU A;  2C3U A;  2YNH A;  3FEY B;  2CQG A;  2X3D A;  4O3S A;  2GQC A;  2ABY A;  2K8G A;  4Q7A A;  1YLX A;  2XGQ A;  3U1L A;  2C28 A;  1CJV B;  2C1E B;  3WHI A;  2VFR A;  3VAM A;  1CJU A;  4O44 B;  5DG9 A;  5IS2 A;  5KFD A;  3CIM A;  3T1Y F;  1Z2Z A;  3AFG A;  4O3P A;  2J6S A;  4JI6 F;  1N5V A;  1G3O A;  2FQQ B;  3D1H A;  2KXF A;  5HP1 A;  1QUP A;  2HNZ B;  3BGR B;  3BM7 A;  2JFD A;  4MIW A;  2IDE A;  3TUI C;  1R6Y A;  1TV6 A;  2N7Y A;  1W25 A;  1Q8L A;  1YRU A;  3G6V A;  3D1O A;  3EGN A;  1UTA A;  2DNN A;  1REG X;  4X64 J;  4HH1 A;  3BYP A;  1U0H A;  4RNH A;  4G1Q A;  2DEJ A;  2A2D A;  3RRG A;  4J9P A;  4S0M A;  2EFG A;  3M2V B;  4JI0 F;  3QQC D;  4DSI A;  2WW8 A;  1J5E F;  2L48 A;  3LUY A;  3M8W A;  2F65 A;  2DY9 A;  1U1R A;  1IN0 A;  4NYO A;  1NJW A;  3GZ7 A;  1S9G A;  1RWU A;  2GV1 A;  2NZC A;  5ETO A;  4DQR A;  3UN2 A;  1NK9 A;  4N8O A;  5DS7 A;  1HYS A;  3PYE A;  5DET A;  4LF2 A;  2QRR A;  2E9T A;  1U1Q A;  2C2K B;  1MSW D;  1S1T A;  2BVZ A;  2QSF A;  4R5P B;  3I6P A;  2W4C A;  4I7F A;  2PEB A;  4I2P B;  5KFB A;  2R7S A;  4NI2 B;  4ID8 A;  1K0V A;  3A12 A;  4PQU A;  1UVN A;  3W8P A;  4OX7 A;  4XAK A;  2E66 A;  2ZH2 A;  4U7C A;  2IVF B;  5CYM B;  4J9S A;  2OPP A;  3TO8 A;  3J80 Y;  5GAH I;  1SQE A;  1HBN B;  3OXL A;  1N6Q B;  4UOH A;  4UY8 5;  3HJV A;  4HAC A;  3HP6 A;  3K5N A;  2WBM A;  4URS A;  3HHL C;  1UWB B;  1Y4Z B;  2JX2 A;  3LAN A;  3CDB A;  2DPI A;  3QGG A;  3BB5 A;  1U45 A;  1VQ6 S;  2XNR A;  2R8I A;  2OEM A;  1XMO F;  2KT3 A;  4QWD A;  3FBC A;  3RBE A;  1S57 A;  1HHT P;  1H74 A;  2YX1 A;  5F8M A;  3W2V A;  2UUT A;  4ZVO B;  2XYP B;  2UXC J;  3ZZU A;  2GC8 A;  3IR5 B;  1UFK A;  2YKA A;  5K8M A;  3MZI A;  1V6H A;  4CYU A;  2HND B;  1XER A;  1N88 A;  4WFB Q;  2GAH C;  1MWQ A;  3RG6 A;  1D0E A;  3ZFV A;  2NPI A;  4R0J A;  2VKZ G;  3VGV A;  2BE2 A;  1CQM A;  2B6A A;  5K8P A;  5ETM A;  4IG3 B;  2QA4 S;  2AEF A;  3QT5 A;  4XDC A;  2F40 A;  1RTJ B;  1F3F A;  1WG5 A;  1HHS A;  1UVI A;  1RT3 B;  1RKI A;  1Q79 A;  3O2I A;  3VR1 A;  3AB4 B;  1S49 A;  1Y7P A;  2EWH A;  4JI7 J;  3UO0 A;  4FF3 A;  4O4G A;  1P27 B;  4HL9 A;  3J7Y U;  2KVI A;  1HD0 A;  2NXJ A;  2NXE A;  4KFB B;  3N6N A;  3K5M A;  3BGO P;  3HI9 A;  3MMA B;  2W8L A;  3RB4 A;  2OIH A;  4Q2M A;  2H54 B;  1LWX A;  3P49 B;  1YGY A;  4KE5 A;  2W9C B;  1X4D A;  4OYZ A;  1EET A;  4CLY A;  1HWU A;  3AAW B;  3QRP A;  4WP9 A;  2HFU A;  4TU8 A;  3V4I A;  1K0T A;  4P9S A;  4NZ0 A;  4CO3 A;  2JL9 A;  4WFY A;  1WF0 A;  1YI2 S;  2ILZ A;  2W2N P;  3JAM U;  3HXM A;  1C1B B;  2A6M A;  4C8N A;  2V63 A;  4X4S A;  2W7A A;  4OV6 A;  3JSR A;  4LF4 J;  2OKQ A;  5DDR C;  2MKC A;  1HQ2 A;  2EG1 A;  3I5A A;  2AT1 B;  1LQ9 A;  1X9M A;  1RAJ A;  2YKQ A;  1N0U A;  4ALZ A;  5GVQ A;  2XSJ B;  2DIV A;  2QMX A;  3KLF B;  5F8I A;  2L9W A;  1VLY A;  3T6J A;  4ZVQ B;  2CRL A;  2CUY A;  3N6L A;  3MEG A;  5KFI A;  3M30 A;  4DLE A;  4KPC A;  3HM9 A;  1FXR A;  1T9Y A;  4DL0 C;  4B3O B;  1S77 D;  1FRH A;  5C2C A;  4LSN A;  1ZOT A;  4OHZ A;  3S8S A;  2HMI B;  2B4U A;  2AYG A;  1YX2 A;  5D15 A;  4OJ3 A;  3QAU A;  1SJ3 P;  2G0J A;  2XO7 A;  4MH8 A;  2HQF A;  4QIW D;  4ED3 A;  1RU1 A;  3P4U B;  1XMQ J;  2H65 B;  1U25 A;  4PUO A;  4URQ U;  1BQM B;  3OVS A;  1T05 A;  5JMN A;  3F44 A;  4FS2 A;  3UWT A;  3GYG A;  4WTO B;  3DM2 A;  2JEF A;  4JP8 A;  2FVQ A;  1SPB P;  3HHE A;  2RNE A;  4DV5 F; 
#chains in the Genus database with same CATH homology
 2H5J B;  2H4Y B;  2DKO B;  3R7S B;  2H51 B;  2HBQ B;  2QLF B;  3D6M B;  3IBC B;  4ZVU B;  1QTN B;  3KJQ B;  2QLJ B;  1RHU B;  3R6L B;  2QL5 B;  1NME B;  4ZVR B;  1RHQ B;  3GJR B;  2XYH B;  2C2M B;  2H5I B;  1RWM B;  1RHJ B;  4ZVQ B;  2CNL B;  2C2O B;  1QDU B;  2CNK B;  4DCJ B;  3GJS B;  4ZVS B;  2H4W B;  1RHM B;  3NS7 B;  2CDR B;  5IC6 B;  1I3O B;  2CNN B;  4ZVP B;  1F9E B;  2H54 B;  5IC4 B;  3P45 B;  2CJX B;  3GJT B;  1SC3 B;  1RWO B;  2QL7 B;  2HBY B;  3R7B B;  2P2C B;  1GFW B;  3GJQ B;  3R5J B;  3R6G B;  2CNO B;  2C1E B;  2XYG B;  2XZD B;  3RJM B;  4LSZ B;  1PAU B;  1IBC B;  3P4U B;  3KJF B;  2H65 B;  1SC1 B;  3EDQ B;  2XZT B;  4ZVO B;  1RHR B;  2H48 B;  2XYP B;  1RWK B;  2HBZ B;  4DCO B;  1RWW B;  2FQQ B;  2HBR B;  3D6F B;  2QL9 B;  1I51 B;  4ZVT B;  1BMQ B;  2C2K B;  3EDR B;  4DCP B;  3IBF B;  4JB8 B;  1RWP B;  5K20 B;  2Y1L B;  1SC4 B;  1RWV B;  3KJN B;  3QNW B;  3R7N B;  2Y0B B;  2CJY B;  1RE1 B;  1RWX B;  3SIP B;  2C2Z B;  1PYO B;  1RHK B;  1RWN B;  3D6H B;  1ICE B;  2QLB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...