2XYPB

Caspase-3:cas26049945
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xypB00
2HBQB 5IC4B 1NMEB 1RHKB 3GJRB 2XZDB 5K20B 3SIPB 2XYPB 2Y0BB 2C2MB 1RHJB 2P2CB 1RHMB 3KJQB 2QL5B 2H48B 4LSZB 1RHQB 1PYOB 3QNWB 2C2KB 2CNOB 4ZVSB 1SC4B 3GJQB 3RJMB 1RWXB 3GJTB 2QL7B 2HBYB 3NS7B 2H51B 3R5JB 2XYHB 2H4WB 4ZVTB 4DCOB 2HBRB 3R7NB 2CDRB 1RE1B 1SC1B 3GJSB 3R6GB 1F9EB 3P4UB 2QL9B 1BMQB 1RWPB 1PAUB 1RWNB 1RHUB 2CJXB 2CNKB 2QLFB 1ICEB 2H4YB 5IC6B 2H65B 2CNNB 3IBFB 1RWOB 3P45B 2C2ZB 2QLJB 1I51B 1RWVB 4ZVQB 3D6FB 3EDRB 2DKOB 1GFWB 2FQQB 1I3OB 4DCJB 2CJYB 1RWKB 1QDUB 4JB8B 2Y1LB 4DCPB 2H5IB 2QLBB 3D6HB 3R6LB 2H5JB 2HBZB 1RHRB 1IBCB 3KJFB 1SC3B 2XYGB 2XZTB 3EDQB 4ZVRB 3R7BB 3KJNB 2CNLB 3IBCB 1RWMB 3D6MB 2C2OB 4ZVUB 3R7SB 4ZVOB 4ZVPB 1QTNB 1RWWB 2H54B 2C1EB
chains in the Genus database with same CATH superfamily
1WACA 1VDHA 1IVZA 3DOLA 2NXUA 2IM3A 2XMVA 7FD1A 3IG1B 3AXKA 4LVNP 3CCTA 3A13A 1RWUA 1RHJB 4NZ0A 5B0FA 1JWWA 1FX2A 1KTVA 3F73A 1RHQB 4ECXA 1NJYA 3D1QA 2M52A 2H3EB 4USTA 4ZK7M 1YRTA 3W60A 4CO1A 4RU2A 4JI3F 2BE2A 1PILA 2ZWPA 4A8YA 1S97A 1PBUA 5B0DA 5C7PA 4LT6A 3PW4A 3PHEA 1AZSA 2E1RA 2C3MA 3CCJS 1B3TA 5KFVA 2EC0A 2EEYA 3NOGA 1L3KA 3RB0A 1UCNA 5L39A 2HS4A 4X65J 4QU7A 1WHVA 2R7UA 5JXSA 2P6SA 1EETB 1UWBB 2E9TA 2OD4A 2UUCJ 2BM0A 4CZCA 1UW9A 1UVKA 3H90A 1RAOA 5KFCA 1ZM2A 3MPWA 4YHHF 3ILLA 1LFPA 4Y2MA 3DCAA 5BYRA 1CQMA 1R6VA 2ALYB 1Y3JA 1N52B 4DS5A 1HWIA 2GVZB 4O3QA 3LP0A 4URSA 5HVGA 1J27A 3QPIA 4OX6A 1JXLA 1NHVA 1RYSA 3SCIE 2QMXA 3M2UA 4U7UD 5ADZA 4OI4A 2BRKA 3MMBB 4O3SA 2ZZMA 3KUGA 4C3LA 3CDAA 5IT4A 4GVLA 3QNWB 1SC4B 1IKVB 2C3OA 4M5KA 4K4TA 3D7SB 1RT6A 1S1XA 2CADA 1U6ZA 2QFIA 3POTB 3DLKA 3G4SS 1NCLA 3R5DA 1WD6A 4CH1A 5EDWA 3FGVA 2RF2A 1CG2A 4LRCA 2LEPA 4LFAJ 4DHVA 1T9VA 2YKMB 4DCJB 1FNOA 4B9TA 5ETKA 2PEHA 1UVNA 3HSJA 4DPTA 1I6JA 2HWIA 3TYTA 4JI6F 4HH1A 3RG6A 1Q7LB 2VASA 1SJRA 4DI6A 3GV8B 1FE0A 1Y11A 5A6PA 1FWKA 2HRUA 1KN6A 3BZQA 1BGXT 3Q8YA 1UVLA 3KHRA 1YDLA 3MEGB 4X84A 1SV5A 3H25A 2DTJA 2QG9B 4JUZA 3TZYA 1NKEA 4DV6J 1HQEB 2HZVA 2QZ8A 1XR5A 4MAKA 3TP2A 2C2KB 2YNIA 2EXUA 1ITPA 2H4WB 3J7YI 3TOQA 1TKXB 1S1VB 3UCUP 4B9SA 2DB1A 2BANA 1HBUA 1VOMA 4KGKA 1VMBA 1U26A 1F9HA 4OJ1A 5AE2A 3MF5A 3NWRA 4DR3F 5B0CA 5IM0B 2Q1LA 2LU1A 3ZTPA 1NHUA 1UWBA 2DGUA 2LQ9A 5LOQA 2AF6A 1S10A 3FEZA 1NO8A 1Q81T 3MOJB 3CCWA 3KLHA 5HSPA 2UU9J 3LTOA 1FCAA 1RQ0A 4NCGB 3DYAB 1BQXA 5HN0A 2KRRA 2DEIA 1UVIA 2EK6A 4FNHA 2VBYA 4M5JA 3OPKA 2IVYA 2CPEA 5DJBA 2GVZA 2XY6A 4DLEA 2M4MA 3J7YU 2M9KA 3T5KA 1XBWA 2PSZA 5E3PA 3MTKA 1QLNA 3NP5A 4ID5B 2XCAA 5HP1B 3DU5A 4PRFA 2XYHB 3MEEB 4QW8A 2CDRB 3KLVA 1YHQS 1ZAXA 3QGPA 2EI5A 1RSCA 4I56A 2YNGB 5IFMA 2HPUA 4OZNA 1FKOA 4X66J 2FPHX 1QSYA 2F4VJ 1PSDA 3EGZA 2D74B 1YLXA 5KG7A 3HK2A 4XO0A 4K7QA 3TUPA 4P10A 4LFBJ 2QO3A 4YOEA 3PYEA 3V6JA 3T3FA 5F8NA 1P6TA 2KJWA 3FZBA 4TN2A 1M5HA 2VL1A 4K8RA 2V9KA 2YKMA 3TVZA 4E2FB 1NLKL 2J6TA 2R7QA 1BXNA 3BR9A 4M1KA 2K8GA 4LFCF 1P9QC 4V1Ak 1ZPVA 3VF0B 2VOPA 4DUYF 3S1TA 2MJUA 5BYQA 3OSNA 2BDPA 3IXQA 3RAMA 3CW2C 4A8QA 1CC7A 2P6TA 2NUUG 4TU8A 1FE4A 3MEGA 2XGPA 2VG7B 3A1YG 2IVFB 1U6FA 1HBMB 4O0IA 1X5SA 4M95A 3M2RA 2FVPA 4UOGA 2CPHA 1RP5A 3GCWP 2YKOA 3CVKA 2YWWA 1VBKA 4N76A 4DDFA 3R27A 2E9ZA 2JX2A 2X7IA 4ZPCA 2WCXA 1GQEA 1DQAA 2JLGA 3IMQJ 5K9FA 3ZZUA 3IRWP 3G6YA 5D0HA 1ZBTA 1N5YB 3TZWA 3UVJB 3K5MA 1IKYB 1SH3A 1OY6A 4Q0BB 5IM0A 2BKOA 1RT3B 4BC7A 3ISNC 4IOBA 1X4CA 2VQEF 3ILJA 2ZBRA 4LF6F 4NLPA 5IQQA 1VQSA 1OWXA 2L9WA 2HYIB 1BWEA 2E9RX 3ADAC 3L7UA 3KJQB 2Q43A 4RW9B 5DG7A 2M0GB 3GV7B 5HAOA 2JVRA 4Q2MA 3T1HJ 2W9CA 4K2XA 2CQHA 2HK3A 1XMQJ 1UVMA 2ADCA 1NEEA 4ID5A 5HP1A 2ROGA 2UUAF 1H6KX 4WXWA 2XS2A 1TKDA 4FBTA 1GX5A 3FBEA 4B3SJ 3ZXWA 1MROB 1GXLA 2BZ2A 2DO0A 2YNGA 3BGFA 1GH8A 3ISZA 3DLGA 4U7CA 4GKKF 1TR0A 3SV3A 1VRTB 5LSOA 1OO0B 2B56A 4MK9A 3SYZA 4P2XA 3UNYA 1VBXA 5F9LA 2YX4A 1VRUB 2MQNA 3AXMA 3QRRA 3GJRB 4YR2A 3ULHA 4C0BA 4IR9A 1UJ4A 1V3SA 2VH7A 4ZMMA 3WC2A 3KK1B 3MCMA 2G0CA 4DXLA 3KMSA 2LKZA 1LK5A 3UQSA 1VHIA 1V3ZA 2FLOA 2A1BA 2GA7A 4DR7J 2ZD1B 5F0WA 2XI3A 3IC1A 3HVTB 4C8MA 2CPIA 4ZVTB 1VQNS 4OX7A 4N7TA 3NXZA 2AGQA 1QSLA 3LWMA 1AUDA 4JI7F 1BWVA 3M1VA 2BACA 3UCGA 3Q8SB 2AHOB 1GTEA 3IBFB 2GV1A 3KG4A 4KGMA 4P7VA 3QJLA 2RU3A 1VJQA 3QMQA 4CH7A 2V4RA 4LF9F 1FT8A 2M5YA 2BW7A 1HI8A 5J2NA 1N36J 1T9UA 2XSJB 2DNRA 4DZ6A 3SI8A 1RWMB 3D6MB 4IFYB 1LOUA 4NYZA 2XB2D 2BJ3A 2ZWOA 2VBWA 1PO6A 4V19J 3MCOA 4ANCA 1RAIB 5F41A 2R7XA 3OD2A 1WSRA 4B9NA 2LCWA 3PO4A 2QL5B 2ALZA 1RAJA 2CQ3A 2V2VA 2CQ4A 1F5AA 2KN4A 2IM1A 3W5XA 3TUIC 4CNZA 1UTAA 2MJNA 4MIBA 1U45A 5EGYA 3FCWA 2CNKB 4K2JA 1N32F 4BWJA 4DQRA 3H4DA 4X64J 4F02A 3EXYA 3US5A 4KPCA 2HHHF 5E3QA 4J9PA 2GJIA 2GJ2A 3NNHA 1FF2A 4I6WA 4UW2A 3RW7A 2ATLA 3ZTOA 2C2NA 1RT1A 2DNMA 2QLBB 5HJYA 2H5JB 1MROA 1N4LA 2Y9HA 4P2SA 1VQKS 1Y9OA 2GFFA 1SXLA 4A48A 1U1LA 2BR0A 1VK8A 2HVIA 1QVGR 3F56A 5ETMA 4DR2J 3GZ7A 1GNKA 2CIMA 3SIPB 3T19A 1VRUA 5HMXA 1MN9A 2ASJA 1Q8KA 3T6BA 4MKBA 3HDSA 2ZBQA 3PY8A 2X3DA 3CSKA 4K0KJ 4K4SA 4LRAA 4FYVB 2DK2A 2GGPA 2CJXB 3C8YA 4YB1P 1WNEA 3M9OB 5K8PA 4C97A 1B0PA 5DS7A 3BGRA 3CC7S 5KFMA 1SH0A 4KHPF 2BEFA 3W61A 4ECQA 1AXQA 1FJGJ 1EKRA 3GE9A 4RNHA 1SH2A 4DBQA 4PQUA 3K2YA 4NXNJ 2FJDB 3MPYA 2HQ3A 2ZZTA 1IM6A 4OHVA 2RKIA 2WOMA 2DNNA 4CWBA 2MZQA 4AQYJ 2FVRA 2HFVA 1PIEA 2FZCB 1UA0A 4LRDA 1VQOS 3EXCX 4DL0C 1S1WB 2GNKA 2KO1A 1B64A 1TU0B 2RAQA 3FSIA 5L1KA 3U1NA 1A6LA 1VC0A 2M70A 3M9NB 2Y0SD 5L1JA 1L5UA 3KUHA 1QM9A 2QJ3A 3GJQB 1S76D 1FKPB 3DN9A 1HBOB 4F4YA 4EU0A 2IRXA 2Q79A 4MYTA 2V4JB 3ZZZA 4ZVHA 5IXUA 3MTJA 2ASLA 2J8AA 2CJ9A 4OZLA 1T95A 1T03B 3I56S 1LQ9A 1Q79A 3SEOA 2C2EA 5KT3A 1RADB 4EMDA 1WJ9A 4RW6A 3FQKA 2VB6A 4XDDA 4LQ3A 1UW4A 2WB1D 1MWQA 4IQXA 2F63A 3GYXB 4DFKA 3DNCA 4JI4J 3MM9A 2YY3A 1E6YB 3LP2A 3MD3A 2PMZD 1C0UB 2W8LA 3M6WA 3R7SB 2DJWA 2COLA 1RT2B 3JSRA 1W2IA 4LR9A 2G9OA 2EG2A 4RUBA 3T1YF 4NOHA 2I8EA 2V2QA 3N79A 4O44B 3W7BA 2V34A 5KFFA 4IQMA 2V67A 5KTQA 4LUBA 1TFYA 2DHGA 4TYBA 3TARA 2YWFA 5F8JA 2VJUA 1R8AA 3OR2A 3EZOA 4FP9A 5DZ7A 4E98A 1V3RA 1TKTA 3PW7A 1Q5VA 4DQQA 2YKAA 2ZJRQ 2R2UA 4G3IA 4IG3B 4DL4A 2KXFA 2V4QA 1JNRB 1IM4A 3DLHA 3PV8A 2E1CA 3NBPA 3CNQP 4EO8A 1C2PA 2YPYA 1NDCA 3V4MA 3D0GE 4I6YA 4XTTA 5IT9U 1M5SA 2MKJA 4ZJLA 3HFZB 4CM2A 1OY8A 4X4VA 3MECB 3TAQA 1K73T 1Q8IA 4FYYB 1WKJA 2N4CA 2J9DE 4FKXA 2CQCA 4OZJA 1WHXA 5E0OA 2AJ1A 3UDCA 2ZM6F 2CG8A 3PYFA 4N56A 5C42A 2M7SA 5CYMB 5CZVA 5L1IA 1NRKA 4FF1A 4R8UB 2WONB 1FKPA 3QLHB 2CRLA 5GMDA 2BXJA 1IXKA 1H7WA 4YY3J 1S0OA 1NSPA 3G2XA 4JV5F 2YH0A 1S7HA 2KTQA 3WZ0A 2UV8A 2IMWP 1WTFA 4QIGA 2KYZA 4U96A 4ZVFA 3OXGA 3VTIA 5DLFA 4LR7A 1BD6A 3TQEA 2FHJA 2KFZA 3BO3A 2QSWA 3I31A 1Y5LB 1KS2A 4FF3A 4ED2A 1R3NA 1W7WA 5E41A 3R3TA 3I9V9 2Y0BB 2E5HA 1V9OA 4URQU 4WXOA 4K4ZA 2RMLA 2P9GA 4K59A 2HK2A 3A12A 3J81j 1CLFA 1ZYQA 3H5YA 3V81B 3KWMA 4DFJA 4JBCA 4IH7A 2LEBA 1WHYA 5LL6d 4J9QA 4W90B 4RW7B 1APSA 2AV5A 3WDOA 2OMLA 1YI2S 1NDPA 4C2MA 5D3GA 5I42A 2DIVA 2K7KA 3FVYA 1X4FA 2R8GA 2R7RA 1VK3A 2JLFA 1HNIB 2JWNA 4IG3A 4DR6J 4ELTA 5T7LB 4ELUA 4WYWA 1KKHA 3K59A 4USMA 1GXTA 1DJ0A 5F8LA 2X1BA 2NPFA 4QW9A 4R0JA 4BLGA 3OLBA 3FDSA 1QAJA 2DPIA 3BQ1A 4ECWA 5KFSA 4YB5A 1NJZA 3KNGA 2MZSA 3TNVA 3UD5A 2LU2A 4ZJQA 1HWJA 1XMOJ 1FK9A 4K4WA 4C8NA 2OFHX 3PX0A 3SCLE 1WC6A 4Q2LA 3B54A 1S1UB 3D67A 3UW1A 4KV8B 5DO2A 3MURP 1HNXF 1IKXA 2BQ3A 3RRKA 4Q44A 4A8KA 2IJNA 4EBCA 1GX6A 3RR8A 1XNQF 4QPXA 3R5CA 2XMWA 3HP6A 2FLNA 1SL0A 2AJ0A 2DNLA 4K5SA 3FKBA 3QYYA 3SDEA 2W9AA 1HPZB 1O5JA 2Z58B 3A3PB 3ITHB 2HFNA 2MKSA 2AJQA 5AXMA 4EYHB 1J5EJ 3NG8A 5I3UB 5B0GA 4OYIA 4F4XA 1UEKA 2I1RA 4D3HA 2DNYA 4TLRA 1FI4A 1LW0B 2ZE2B 2HS0A 5B0EA 4ECRA 5SZTA 3GB0A 4ZN1A 2Q66A 3VWSA 5J2PB 1BC6A 3FBBA 2LDYA 5F8GA 3PDNA 1U49A 4GKJJ 3PFOA 1NH8A 3P3DA 7AT1B 2I5JB 3VQTA 2ZKTA 2R42A 3CB4A 2Y1JA 3CCZA 4QWDA 3N01A 4DSFA 4X62F 5A0YA 2NXJA 1IJFB 1HWKA 3P45B 1EB0A 9RUBA 2XWXA 2HQGA 3M7VA 2CQGA 3FMBA 2LECA 4I68A 3HLUA 1FX4A 3ELHA 3SQOP 1JK9B 5HANA 3W2VB 4DF4A 4P52A 3PG9A 2AP6A 4OV1A 4AXJA 5BR8J 1HHTP 4O0NA 5LMUJ 3DRSA 3W63A 1CJKB 3Q24A 3AJ1A 5T7LA 3TX0A 4FDFA 4UOFA 4ED5A 2A6MA 1S4FA 5K8MA 3G8TA 1JJ4A 2ZITA 4ECZA 3T5JA 4IFVB 2UZAA 1C1BB 4X66F 4OFZA 2F9DA 3SCJE 1NNDA 4JI3J 1VR6A 2KFYA 4R5PA 3I4PA 2VFSA 1HFEL 4AL6A 3MPUB 4C0HA 1RHUB 4XDCA 3AODA 3P5TL 2HQCA 2FZKB 4IDKA 1I51B 3QZ7A 2VZ9A 5KFTA 1UA1A 3OBIA 2XLJA 2FQQB 3E2EA 3O44A 1KVJA 2XC9A 4NYPA 2F8MA 2DXFA 1T3OA 4YHHJ 2W9BA 4CLTA 3EDQB 1V5VA 4O4GB 2QSFA 1U2CA 1HPZA 4WP9A 1J5OA 5KG0A 1KTQA 5KG6A 2KXNB 2ZDOA 1NBEB 5J1EA 3DLEB 4WF9Q 5KFXA 3D66A 5I3UA 2PGCA 3X3UA 2EBEA 1PYTA 2WVEA 1UEVA 1EZZB 2DH8A 2P8IA 1RBLA 2ZHOA 5D4NA 2XO6A 3BQ2A 3MHYA 2HNDB 4RBUA 1RT4B 3U27A 3PIPQ 3BREA 1F2HA 2AT1B 4ZHRB 3THTA 3MM5A 3JSMA 4ID8A 3JTPA 5J2PA 2IDEA 4P2MA 1S6UA 1U1PA 1DLOB 3EWGA 1D9FA 2CQIA 1IUJA 2H4YB 2B8PA 1ELOA 2V5HG 4UQGA 5KFZA 1PJ5A 3Q8UA 1ZM9A 5BXIA 3H7HB 4WE1A 3IRXB 2AYMA 5K8NA 1MMNA 5C24A 2ZJPQ 2CQDA 2B0GA 2HWTA 2EVZA 5ETLA 4ZCMA 2VDHA 4L73A 2RIJA 1JLGB 2DHXA 3G6ES 3RGIA 1RACB 3KDOA 4JI6J 2P9EA 1IWGA 2VFUA 1EP4B 3CJ0A 1QE1A 1YJNS 4F04B 4RZRA 2C2DA 5IC4B 2DR9A 4LF8F 2HFZA 1AUSL 2VPWB 1G1XA 4G1QB 1WOSA 2VG5B 2OEMA 1JX4A 4PUOA 2AYBA 1PAEX 3MEDB 2QGFB 4IO1A 4ECSA 3RB3A 1VJWA 2U1AA 4CRJA 4WFNQ 3V4IB 3DI6A 3FRZA 3R2DJ 1W2BR 2OEKA 2W24A 4M5HA 4Y3CA 1BQMA 3VR1A 1C1BA 2HBRB 2PI5A 4G6VB 4C4WA 1FTCA 1X5OA 3TW0A 3AAWB 3W65A 4FPIA 2G2OA 2OSQA 2PD1A 2R7TA 4DN0A 3HHLD 4DR3J 3H2UB 4YS2A 2QEXS 3I82A 2YVSA 4ZJOA 4EK2A 3PW2A 4OMFG 3FZ2A 2GO8A 1R43A 3E8OA 3D68A 4LBHA 2WRMA 2Z2MA 3AY0A 2J0QD 2G2ZA 3C2PA 4OI2A 5L9NA 1CS4A 3HHEA 3DGPA 4USVA 4DUZF 1GMUA 3TANA 1U47A 4NLDA 1KC8T 1E6VA 2OPQA 3O6QA 2M3DA 4ELVA 1LWCA 3PEJA 2ASDA 3Q83A 1BLUA 4CLZA 4I4BA 3IFEA 3D0HE 2RDIA 1IBLF 2UVWA 1BMQB 1F5BA 3J81U 4FBUA 2XCPA 4MK8A 4ZHRA 5IC6B 2UVRA 4M63A 2Y3YA 1OJ4A 1Q53A 5AE3A 1RCXB 4LSLB 2JDJA 2BKPA 5H1SV 1F6TA 5B7WA 2YNHA 5KFEA 2RVJA 3V6HA 2RQKA 3QGIA 2VD3A 2RJZA 3SQGA 3JAMU 4F4ZA 1Z4UA 4DL6A 4ZVRB 2W2OP 3KFWX 1H72C 3CJQA 2R7VA 3K57A 1NPPA 2BABA 3M05A 4F4KA 1ZZNA 5IT0A 3W66A 4LFCJ 3DOMB 4GC6A 2HAIA 4ZPAA 5EUHA 1KQSR 4C6AA 4DUYJ 3P5BP 3MCSA 1ZPWX 4CQ1A 2BV3A 2J76E 1XK8A 2H48B 3QQCD 2VG5A 4DX6A 5KG3A 4ECUA 1QAIA 4GO5X 4IYQA 2OFGX 5CCLA 5T14A 2AKWB 3V4IA 3GJSB 3THPA 2RSQA 4F2SA 1X31C 4F4AA 4DUTA 3CCLS 1UL3A 3TEHB 4NL5A 1S7IA 1N0UA 3M6VA 3R5AA 1N6QA 4QR2A 4OI0A 2Z8QA 5D6GA 3MMCA 3DLBA 1RDRA 1X4GA 3FCHA 1S4EA 5GAGU 4ZKAA 1K1SA 2DIUA 4OZ5A 5LMNJ 2DH9A 3M8YA 5J2QB 3KK2B 1YZ7A 3RBZA 1TV6A 4H4MA 3D4JA 3I0RA 1UKUA 2VQEJ 1HNWF 1GMWD 3CT9A 2AEJA 4FYXB 4RWXA 2PA3A 4F50A 5C25A 3DGVA 2WB4A 3R5GA 1FJEB 4LVOP 3VQSA 5GADI 3T5LA 2DHAA 2PI4A 2PN6A 1PC5A 2YQ1A 3BH6B 1F9FA 3Q22A 2OGUA 2IC3A 2DR7A 2KM8B 2JH3A 2VIHA 1FRXA 3CJTA 4IH6A 3PYGA 3EZ5A 1FESA 4DSJA 4EZ6A 5DGBA 2J0SD 2BJ7A 2EFPA 3IN5A 4OYPA 3TUJC 2UUAJ 1RKIA 1TZ0A 2CZ9A 1ZA2B 5A2QY 2EWHA 5T41A 4WKYA 2J0XA 1V6HA 1S59A 3VAFA 2HAFA 2KHDA 4P2FA 2DNGA 3CD5A 3I4HX 4GKKJ 3MFHA 3MWBA 1NSKL 4DV1F 1KDNA 4J5OA 4DU8A 3JYTB 2V94A 3SSSA 1J2VA 5FD1A 4X4UA 2V2ZA 1XWLA 5GADU 1RWWB 4DV3F 5K8OA 4OV6A 2MPUA 1S5ZA 2B51A 2K1RA 2DRDA 1S6QA 4JI1F 1RT5B 5KG2A 1BE4A 2RRNA 2DT9A 2UV8G 4A8XA 3HSDA 3A4TA 3G8SA 3SFUA 3ZNUA 1AYEA 3X1LB 1AT1B 3ICLA 1FXLA 4TY8A 3Q2TC 2VONA 1FWPA 3CJ2A 1F2GA 2XBPA 2W01A 2Q6CA 1RK8A 2ZKUA 1FXRA 3Q2SC 1H38A 4USIA 1RA7A 2D3ZA 2AJFE 4I2PB 3BYPA 3HF5A 1M1HA 4KQZA 4MKYA 4BCAA 4NA1A 4IUFA 2DISA 2OTJS 4QWEA 3FSYA 5IS2A 1S9GA 2CZ4A 2J0WA 3OT9A 3UNGC 2JHEA 1MLAA 1HNVA 1UMJA 4LF9J 2OH2A 4PWUA 4M5DA 3RYLA 2HHPA 2AMCB 3KLEB 4MH8A 4QZVB 3UDLA 3R2CJ 1NMEB 5I3PA 1T8EA 1N88A 4FXWA 3W1YC 2DITA 4M94A 3M4XA 3CDWA 4NE9C 2CVEA 3A8KA 3OR1B 4GVBB 3DHWC 3KOAA 2D69A 3UFCX 1JMTA 3FBCA 3G82B 4X2BA 2QFJA 2A10A 2HBYB 1RABB 4U6PA 3BS9A 2M88A 1VIXA 2XZWA 2ZC3A 4PXBA 3CUNA 4B3TF 1R89A 3HVWA 3PZPA 1N32J 2AWZA 2RRAA 2V68A 4GMKA 2HHHJ 2IM2A 2EKNA 3HHKA 5D0EA 1RTHB 2GS8A 4NLQA 1Y5IB 3H4BA 3AH6A 2AZ1A 3WIVA 3QRQA 3R1HA 1YTYA 4OYXA 3GP9A 1ZS6A 1NH7A 4Y2CA 4E8UA 1HARA 5AXKA 2OUGA 1SJ4P 4JI5F 2B7CB 2L48A 4Y0FA 3JYTA 3N4WA 4NPOA 1YZ6A 2KT5A 2KH9A 2XMUA 8AT1B 2B4OA 4WZMA 4DPYA 2GJFA 1TAQA 3KG0A 1RAHB 1SVDA 2CQBA 2QN6B 3O5TB 4YY3F 2EFOA 1F5CA 1RXOB 1N48A 1WKLA 3MAHA 4I0WA 3H20A 3EGNA 3TUZC 2HQIA 1FERA 3JQMA 2CDQA 4F25A 3OXLA 2C3YA 3MM8A 2HNYB 1Q5YA 3QWPA 4CLUA 4HT5A 4KHPJ 5E33A 4DV5F 3CDUA 3Q8QB 2ZBPA 3OTDA 4X4QA 2WTFA 3WC0A 5EX3A 5B08A 2AX0A 2MQPA 2HIQA 3TVKA 3BO2A 4YR0A 3LO3A 3ENVA 1U1MA 1HD1A 1JKHB 3TAMA 3JB9k 4J9VA 1UJ5A 2DCLA 2DGQA 1OY9A 4X4SA 1VQ6S 1TUWA 4AL5A 2DHSA 3N5BA 1FJ7A 3MPVA 4BWMA 3CDEA 3GIMA 1K47A 2CJAA 4FPRA 3WBZA 4PXCA 2YX7A 3NOCA 3RJMB 1Q7YT 4GVBA 1SUQB 4LMZA 2KM8C 1QY7A 2HRTA 3DOKB 1YIJS 1Q86T 2XNQA 4RW8A 3R6GB 1NXIA 1S12A 2RUGA 1ULRA 3DC2A 3G6XA 4DS4A 1WC3A 4L3KA 3PR4A 2WSEC 2ZH5A 3GR1A 3MFIA 1QAYA 1SQGA 4ECYA 4EGLA 3FQLA 1NPRA 3QBCA 5L8RC 4KH0B 2CZVC 1RTHA 2BJ8A 4XPEA 3MEKA 2BE2B 4F8RA 4TVAB 2IM0A 4PABA 1YKWA 3GU0A 2F9JA 3T1YJ 3QAEA 4ZCKA 3ZFVA 3CCRS 3TJAA 1DRZA 3C16A 2P2CB 1ZM4A 3PX4A 4LSZB 4QIEA 2A0FB 1I1GA 4URGA 2C3PA 2X1AA 3HVRA 4U9RA 4HHHA 4I6AA 4H4OA 3I55S 2GQ2A 1YGYA 1FHTA 3CIZA 1X0FA 2XHWA 4NCBA 1PKUA 1EKSA 4Q43A 3CMAS 1TL7A 3W64A 4BBYA 3SV4A 4WFXA 3B82A 3QIDA 4LIRA 1RWOB 2LA6A 3M2UB 3F44A 2HFSA 1GFWB 3WX8A 4C8LA 4NLXA 3LW5C 4Y28C 4DG1A 3HXMA 1RHRB 2HNYA 1IBKF 3IBCB 1RBOB 2HHWA 2IY5B 2LYVA 3M6UA 1RT6B 4A4JA 3OL9A 1S1XB 1OPZA 3DLKB 4ZIVA 1CSJA 2A2CA 1OMSA 1A7GE 2POKA 1R0BG 3CJSA 3DM2B 5DG9A 3M8RA 4O3RA 2A6OA 3K8VA 2FC8A 3NGRA 1JKHA 4FYDA 2IMOA 5CYJA 2FHMA 1FEEA 2O66A 4P73A 2VC1A 4NLRA 3DKDA 3C15B 3W5YA 4LF7F 1N0VC 1TKZA 2PT0A 2OPSA 4QCLA 1LV5A 2ZM6J 3OSPA 4JI0J 2BE9B 5HROB 1YBTA 4ECTA 2KVQE 1K8AT 1FO1A 4JV2A 1UZHA 2XG8A 2ZH9A 5FLXU 1Y0HA 3CC4S 3DOKA 4H4KC 2HMIB 3HI9A 5LMUF 1UFLA 2UUWA 1KVKA 4JV5J 3NEKA 1SIWB 5KFOA 3LPYA 1SV5B 4TNOA 2UUBJ 3BN7A 3PFEA 1IKWB 2MZTA 4KFBA 2ZVSA 2GHWA 1KOHA 3M9MB 5ETTA 3LALA 2YNIB 4RL1A 5JUMA 1SL2A 2ZNYA 4ZVUB 1Y3KA 1AA1B 1DFDA 1QTNB 4LQ9A 2F8HA 2V9WA 1NPKA 1VLYA 6FDRA 1M5VC 3ONQA 2BANB 3PACA 2O5DA 3B4MA 1HBUB 3SZ2A 4RBVA 2BJ1A 1TUGB 2JEJA 3KXDA 3E01A 2Z2YB 2VUGA 1MWYA 2LA4A 4ANEA 2B9YA 2D9PA 1YBUA 1GEHA 2XWYA 4QQBA 4HACA 2HGNA 1AFIA 2WW8A 3KLHB 2HZAA 3UN2A 3TVYA 2NPIA 4C98A 4DPXA 3IAM9 3QIPB 2HNZB 2W8KA 4WTOB 4HDHA 4YR3A 4LF4F 2F65A 3TEGA 4RUCA 2E5JA 1Q4RA 3CE8A 1OIAA 2I6WA 3G96A 3DLLQ 1U0HA 5HQMA 4N5SA 2NCKL 4B08A 1X60A 2P5VA 3TA1A 1GXUA 1KNZA 1PBAA 4HKQA 1OYDA 2KT3A 3L7PA 4KKOB 3BBCA 1LWEA 1NK9A 3GMGA 4ZPDA 5G0RA 1U0SA 3OV7A 4M5MA 2DXDA 4NCAA 2XYPB 3CD7A 1FKOB 3BKTA 3SMZA 3DRRB 4QWCA 4IRDA 2Z2ZA 4B9VA 3ZO7A 5ITHA 3V6KA 1QTMA 3DM2A 5JVHQ 3W62A 1DAXA 5KFGA 3HD1A 1AROP 4XAKA 4ZS6A 2FJEB 4DQPA 2GQQA 3MDFA 3C15A 3EVWA 1IQTA 4I69A 3JXOA 2CAJA 4NMXA 4FKYA 5HROA 3QJPA 2LFVA 1HNXJ 1NKBA 3C14B 5CHCB 2LMIA 5A8KA 1XNQJ 2LEAA 3LANA 5CD4H 2HMIA 2VG6B 3NMRA 4DX7A 2Z57B 1GMWA 1WC4A 2J6SA 1NHKL 1KWMA 2GVDA 2E29A 3BYRA 4WFBQ 2V69A 2XMKA 4JI2F 4NLTA 3NCRA 3BKUA 1IKWA 4LIWA 3HD2A 3M2RB 2GHVC 1JLQA 3C66A 2XZDB 2DVIA 3V6DA 4L74A 2B6AB 4AUKA 1T05A 4FF4A 4KRWA 3LGNA 3DRPB 1D9DA 3BDEA 2YKPA 3K7RA 3L3CA 4OYZA 1JJ2R 3NRBA 3DMJA 3GJTB 2R9LA 2HLTA 4ILRA 2KXHA 3FEXB 3BGLA 1Q8BA 2Q3PA 3UD4P 1FDNA 3F41A 2DR8A 1PCAA 2QLWA 4HI1A 5JVGQ 3OHAA 2LQ5A 2FJVA 1EQMA 4DX8H 3PJ9A 1WG5A 2FVSA 2I2YA 4X62J 2QRRA 2AEMA 2XHCA 3M8SA 2FLLA 2ZC4A 2C2ZB 1ZETA 2QLJB 2OPRA 3QIPA 2HNZA 2JNJA 1UEUA 1R0AB 4NLGA 2GC8A 3AFGA 2YBVA 4IG0B 1P8GA 1KHWA 3W9JA 2W9CB 3TQ1A 4JI8F 4WZQA 2CNLB 1WSVA 1C0TB 4B17A 1SL1A 1TL5A 4TY9A 4KKOA 1Q1KA 3OTEA 2VQFF 4C8ZA 2X51A 2H5EA 3CJ4A 5HO4A 3MR2A 2AX1A 2PC6A 3TA0A 3ZTRA 5CYQB 1TVRA 1WELA 1WF0A 3DDNA 3RBXA 1IWAA 2MKYA 3DLGB 5AE1A 3DRRA 5C2GA 1T3NA 3OFGA 4AYBD 4TQRA 1SC1B 1KP6A 3A8JA 1VIOA 1F9EB 1SI9A 2CPDA 3CCUS 4WU2A 5ETNA 2C28A 1ICEB 4C11B 4KGXB 1M5OC 5CZXA 2RHSB 1KOOA 3PYDA 5FLXY 2FHKA 3CO9A 1MMLA 2QA1A 3VAGA 1P9YA 3CF5Q 3C14A 1TMMA 3BV8A 4TKTA 1U6BA 3MCNA 1YJVA 3VGVA 2LP4A 4FZVA 3A8EA 2ZH2A 2VG6A 4C0OC 4NZ6A 1RJJA 2G0IA 3I5BA 4F3OA 2R7WA 3IP0A 1NSAA 2UXDF 3FMWA 3BBBA 3LP1B 2ROPA 3EX7B 2OP5A 2JC1A 2W4PA 3M1VB 2HFOA 3DXBA 2AYGA 1T11A 3PRDA 2OPPA 2YWEA 2B6AA 1REVB 3C3LA 3DRPA 5EWGA 4M8LA 1M0SA 1XJWB 4DCOB 5J2NB 4OZ2A 1YJUA 5D0GA 1NU4A 2WSFC 3KLGA 3GLJA 1LFWA 2HFUA 5LMNF 1H0HB 1S6PA 2J9CA 3CDBA 3ISND 2YWHA 2VBZA 2H9ZA 3W3SA 2JFDA 1D8YA 2YXLA 1FDDA 4ZITA 4FVCA 2Y1LB 1RISA 5KFAA 1ZOTA 3IS9A 2K06A 3L7OA 1R0AA 2VODA 2W2NP 5U47A 3Q89A 4Y2IA 1JLAB 1Y10A 3EGWB 1D9AA 4IG0A 4J9UE 1U1NA 1R8BA 3GILA 4J9NA 4K4YA 2APOA 4LF8J 1RA6A 4OX9F 3N6LA 1C0TA 2ZH7A 2M8HA 1KHVA 2RE1A 2D7SA 2EFNA 4MFBA 1K0TA 3TA2A 4Y00A 1GTHA 1RT1B 2IPOB 5IV4A 2C2RA 5CYQA 2DNHA 1SKRA 5J1PA 1SQEA 3PIOQ 2YQ3A 1WF1A 2CKWA 1WEXA 2XY5A 1G7CB 4OHWA 1U2RA 1NK0A 1KRPA 4OYWA 4CP5A 3OUYA 4XK8C 4USKA 2MEWA 1H3DA 2ZH4A 4KE5A 2W7OA 3G6VA 4EBEA 3KLFB 2JEFA 1CJUB 4ECVA 2MY7A 2JLEA 2MYFA 1FDBA 4C11A 1MU2A 2D3O1 4IH5A 4LRBA 1VQYA 5LSLA 3D6HB 5DZ6A 4F36A 3CULA 2B9XA 2Z30B 5KT2A 5KFWA 2HHQA 1H7XA 2J7WA 1HBNA 1H73A 5HATA 2DNKA 5ETQA 1W25A 3Q23A 5KFRA 5C2CA 1TL4A 4X4OA 2GGPB 2GX8A 1DBDA 3AD9C 2CPYA 3PEHA 2L3MA 3KDNA 3BGRB 4DUZJ 3LP1A 1D1UA 5J2MA 5DETA 4CO3A 5C5JA 1F3VA 3BSOA 1XIQA 4QYZK 2CPXA 4CLPA 3CPWR 1VC5A 3R7NB 1RTJA 1Q0NA 4PQUB 4YB7A 1REVA 2MKHA 2KRBA 4GC7A 1IBLJ 1MWZA 1VQMS 2RKIB 2WOMB 2I38A 3SFGA 2B43A 2HVHA 4RR5A 1LWFA 3ZZ0A 2DY9A 3AT1B 3KNAA 4PEOA 1I3OB 4DL2A 1C1CA 3Q8RB 4RO0A 2BE7D 1S99A 4PG6A 4FF2A 2IA0A 2ZH6A 5CA5A 2LQJA 2DGWA 3KG1A 2MQOA 2CWKA 3IR6B 2DHHA 4I7FA 3TAPA 3CC2S 2ZVIA 1NM2A 5AXLA 2FJXA 1KEKA 1K0VA 4ZP8A 5D0RA 3SCKE 3LAMA 3IO1A 1TL1A 1UVJA 2KZMA 1JLAA 3PTWA 4GO7X 5KT6A 1X9SA 4KC5A 1RUSA 4NASA 1R8PA 2BOPA 1X8DA 3NGDA 5KFUA 2ZFHA 5AJ3F 5HVFA 4RW6B 1CJVB 1HLWA 4ZPTR 2YWKA 3B6BA 3QT5A 4HTIA 3U1LA 1ZA1B 4UF4A 1QUVA 3HKZD 3N5FA 3RAXA 1MN7A 3AOAA 3MM9B 3LP2B 4DEZA 3HT3A 4B3MF 4DV7F 3IM8A 2DGOA 1FNXH 3OTOF 1HQ2A 2ADBA 3L95X 2F3JA 4F67A 4WIIA 3T41A 4L76A 4RBTA 3TZXA 4PZVA 4LF5F 3KLFA 2DGVA 1CJUA 4MYUA 3CTRA 1JLBA 1EJ7L 4L6V3 4P75A 2WHOA 5E3CA 4CO4A 2O67A 2W2QP 3OR2B 3HM9A 1HNWJ 3KK3B 5K5MA 3D1HA 3NAIA 4V19X 1JIHA 1TKTB 3FK4A 4AD6A 2QMWA 4KT0C 1SKSA 1VS3A 3RTVA 1K44A 3D54A 2EKYA 1VHFA 1KQKA 1Q78A 1FFGB 4C48A 3NBPB 3EVOA 2MTLA 3N6NA 5KG4A 2YQ0A 3UE2A 5HVHA 3U1MA 3I6PA 5DQIA 3PM9A 4YDDB 1U1KA 2R2RA 1Q16B 2CG4A 1DZ5A 1VISA 4Z37A 4ZP7A 4UOCA 1KONA 3A3OB 5F8HA 3OQ2A 2XLIA 1ROFA 4KPYA 1GAOA 5HBMB 3VZHA 2NUHA 2A18A 3MZIA 1BQNA 1BHNA 3MUTP 2OMOA 3HKWA 3N0VA 2HBZB 1VCTA 4B3OB 2R8KA 4DV1J 1UWAA 1FRHA 1S1TA 1NDKA 3MAAA 3HX9A 5C42B 2DNQA 4USJC 2ASYA 5L1LA 2XY7A 1TK8A 1N8RT 2HHSA 4DV3J 2NR0A 1FD8A 3PNIA 5ETVA 4DR5F 2KDOA 3FRYA 1I5OB 2L9DA 4NEZA 4JI1J 4UUXA 5F3TA 4J9RA 2EFQA 5JJBA 5HMZA 2NSBA 2FZGB 4UQTA 1R0CB 2B3TB 1FXDA 5KFDA 3T1AA 3CO0P 5KFBA 2F8EX 2N3OA 1M90T 3CD0A 4TYAA 1DHMA 2VFTA 4DPUA 2WVFA 1CJVA 1HI0P 2DR6A 2K2PA 3Q8PB 4PWWA 1YSJA 1KFSA 4DLGA 4CTAB 1HYSA 3W8GA 4ZLNA 1IBMF 3KHHA 1JB0C 2NXCA 1L3SA 2NQPA 3W5ZA 2IYIA 2C22A 3VAKA 3OXFA 2DNOA 2XMTA 4YFUA 3OL6A 3M30B 1RBAA 5K14B 5EN1A 2W25A 1FFSB 2E7VA 2GW8A 1RTDB 4RW4B 4HI2A 1VQ4S 3VVTA 1S0MA 5D3GB 5I42B 1H74A 3QFWA 2JL9A 3IR5B 1QUPA 1YK9A 4USWA 1NB2A 3KK3A 2CJBA 4GRSA 1UAWA 2WVBA 3W9HA 1VRQC 3ETOA 4P71A 5CCMA 3NLCA 4ED0A 2KG1A 1EQ0A 3AJ2A 3NKYA 1L3UA 3RBEA 1MG7A 4ZVEA 1PG5B 4B3TJ 2V8GA 3MM6A 2K7JA 3J7A1 3GWCA 3PCOB 3D1OA 4PXEA 2FIUA 3H98A 2BA9A 1WOOA 1N33F 4ED1A 2R7SA 2UXBF 4DPOA 3MR7A 1WHWA 4MTPA 3LOUA 2EFVA 5HBMA 4J9SA 1G3OA 2MGZA 1FK9B 2BJEA 3KJNB 3M32A 1D09B 2MY8A 4B3OA 2N7YA 1EAYC 1S6OA 4ICLA 4BDPA 2V63A 4DQSA 4JI0F 4XIUA 4JI5J 2BX6A 3AOCA 3QT8A 4RPFA 3HO1A 1IKXB 2VPZB 3W2WA 2VU5A 3FBFA 4K4XA 4ZPWR 2VF3A 5I3QA 4U67Q 4FS1A 4DF8A 4RLEA 2XEXA 2AZ3A 3EZUA 4K4VA 1AFJA 5AT1B 2N7CA 3SDEB 3LGHA 1HR0F 2J9DA 4OYOA 2EFGA 2DH7A 3HFKA 1YVFA 2QX0A 1RWNB 5KT4A 2UUBF 4ANDA 3I0SA 4ZIWA 4JYAF 2OJ3A 5D77A 1RYRA 3R9LA 2QE5A 2VV5A 3PW5A 2DEJA 3D6FB 2N3LA 2ZOMA 5E3RA 5KT7A 3O1LA 4CTAA 2V8HA 4LSNA 4NA3A 2F7VA 2OLWA 2ZBCA 4DV5J 2MQMA 3FFIA 3EYZA 4KB7A 4EWTA 4R25A 2NS1B 1DTQA 3M6XA 4CT9A 4ILMA 2IRUA 4OLPA 3ET6A 3CMES 5LJ5Y 3E51A 4U7UK 3UDEA 4PPZA 3MUMP 3M30A 5K14A 4NMLA 2DO4A 5A0YB 2SXLA 3RB4A 3GSDA 1RTDA 4L3NA 2Q6BA 4RW4A 1RHMB 2LQ8A 3BKFA 1RI7A 3VALA 2W2MP 2ILZA 1FWLA 2E44A 4AL7A 2LVWA 5KFPA 4HVZA 3DRSB 1PAUB 5M2RA 3IG1A 2KI2A 3UCZP 1WC5A 4QWBA 5CAAA 3BM7A 1FRJA 1TUVA 5F3ZA 3EE3A 3DRYA 1B0VA 3EDRB 4KSEB 2JRSA 4PYDA 1DURA 2GQCA 4NLSA 2V8DA 1IBCB 2L08A 4ZA1A 1HW9A 3DRXA 2FUG9 1U1QA 3I5AA 4CYUB 4B9MA 2ZH3A 1PJ7A 4P7TA 1ACMB 3LWLA 1EETA 4LJMA 4R5PB 2O3DA 4HT7A 5D4LA 5HLFB 3ZTSA 2E7XA 1X5PA 1RAEB 3TJ9A 4UT4A 1CJTB 1NK4A 1VI7A 1ZTTA 2PFDA 3GR0A 4IDKB 3SSRA 4EBDA 3H42A 3CCQS 4WJBA 3R1LA 4CI0B 3WQPA 2W9BB 2DGSA 2FHJD 3P4UB 5HK4A 3JQKA 2DY1A 1R31A 4DL3A 2QLFB 1J5OB 3MMBA 3PJXA 1AB8A 2MLXA 2E5LF 2FYXA 2KT2A 5J1EB 8RUCA 1IKVA 2MXYA 5A8RB 4OI6A 2FY8A 4FVMA 8ATCB 2E1AA 1P1LA 1Y00A 4DV4F 2OTLS 3RRGA 3POTA 3ENWA 3ZZOA 1S48A 4Z7YA 4AE5A 3P96A 3M8WA 2VBXA 4NLVA 1IBKJ 4O23A 2FJWA 4PR6A 5JMNA 3MM5B 3JSMB 2GIFA 2MLYA 4FNIA 3NGKA 5MLCV 2HZCA 2FDNA 1HWLA 3GV5B 3MXHP 2F1FA 3AA8A 3IA0A 5E3AA 1YITS 3WX4A 2U2FA 4WE1B 4DV2F 4ED6A 3QJJA 1HI1A 5C24B 4HLBA 2DRAA 4LF7J 1RU1A 4J90A 2J6UA 2DCUB 4MK7A 2E5GA 4B3RF 4YDXA 4C8OA 4N8OA 3PX6A 1SJ1A 3BB5A 3CGIA 5AXNA 3P49B 1DQ8A 3ZNJ1 4YMEA 1QE1B 3H2LA 1SKWA 3CIMA 4B9UA 1HQEA 5L38A 4PUOB 2N82B 4C8KA 1S0VA 1EX8A 2J8SA 1NSQA 4ZOSA 3GFXA 3F0NA 2RHQB 2YWGA 4X4RA 1TKXA 1YJ7A 3TRGA 2XMAA 1S1VA 3DI6B 5KFKA 1Y5NB 4DQIA 1K9MT 2UUTA 2HQDA 3C46A 4ENOA 1BQMB 1IJEB 1T9WA 5F0UA 4DWIA 4CYUA 1U02A 2VA2A 2AYEA 4RWWA 5RUBA 3BF4A 4WTYA 4B9LA 1LXJA 5KG5A 5B0BA 2HHTA 1YBAA 5HLFA 2NYIA 1B70B 5CABA 3S8SA 2FB0A 1FKAF 1CJTA 2FVQA 4LF2A 3D5MA 2E1MC 2B5JB 4NCGA 3DYAA 2PFFB 3QSIA 5HMYA 3N28A 4PWDB 1XR6A 3MD1A 2XO7A 1KLNA 4IKAA 3EPIA 1FRMA 3CWJA 1WF2A 5GAHI 4LF4J 1NK7A 1CS4B 3GFZA 3Q86A 5IWAJ 3DGPB 3ILOA 4NRTA 1X4DA 1U48A 3T5HA 3GG0A 3NGUA 4ERDA 5EWFA 3TX8A 3D0IE 1E6VB 2OPQB 3MEEA 4ATNA 3PW0A 4QWAA 1LWCB 1ZAWA 3BBFA 3D2WA 2NZCA 2ACMA 5H9EK 5A8RA 3FEYB 4ZP6A 2C2OB 2HS3A 2I9SA 2Z2LA 1I94F 2ACYA 1FRLA 3FNNA 4USHA 5SUHA 4FXVA 2KL8A 1WKKA 2W4DA 5A2QU 3EICA 2YNHB 4OYMA 4TXSA 2OKQA 3CMQA 2W7AA 5EHHA 5GAHU 1JJCB 4P6QA 2FY1A 3SQGB 4DR4F 2ZJQQ 2OO4A 3OVAA 2BRLA 2QL9B 1FTRA 2XS5A 2DGTA 1DY3A 3C19A 3KYLA 4EFAC 2R8IA 4NYOA 1SCJB 4N77A 3VCDA 4EZ9A 1R27B 5DDRC 3PJWA 1T02A 1MW7A 2YTCA 5KFQA 3JTOA 4ZVQB 2ZZNA 1NUEA 2JFKA 3NGSA 3M8QB 2VG7A 4UUWA 4M5NA 3KLIB 2B4PA 4N41A 1HBMA 3IM9A 2D1CA 3CD6S 3K8WA 1JLCB 1HW8A 2MKCA 5DDOC 3PO5A 4JI2J 4WKRA 4Y34A 2GMHA 1N34F 1YRXA 1N5YA 1N6QB 4PAAA 3UVJA 5A6WA 1IKYA 4Q5VA 3MMCB 4Q0BA 1DQ9A 3HSZA 2WAQD 3BQ0A 1RT3A 4Q8FA 4NXMF 1RAAB 1TMJA 4F0KA 1S77D 3OJSA 1XERA 1S9FA 4HH0A 2Z0GA 2B5JA 1TV6B 3OW2R 1VLOA 2FLPA 5H9FK 5E5NA 4H4MB 4P9SA 2GAHC 2A3JA 4F0HA 3I0RB 2VKRA 4PWDA 2RNEA 3AOBA 4RW9A 2VHGA 4HR2A 1X7VA 1RWVB 5C25B 2J5AA 4X4PA 1VC6A 4RJVA 1HD0A 1SB6A 4TLQA 3B8HA 1RCOB 2CUYA 3L4BC 1HA1A 4HL9A 5KOWA 1H2VZ 1HKAA 2IC3B 2N4DA 2KFNA 4JI8J 1XR7A 4K5RA 2C1EB 1FVQA 3UI3A 2RUSA 3R5BA 2YKQA 2R3VA 2VQFJ 3HSGA 5DDPC 2H1YA 2DXEA 1UFWA 3DDKA 1VRTA 3MI7X 2GIQA 2DR5A 4ED8A 2DGXA 4WPAA 1F0XA 4AT1B 3CJ3A 1VQLS 2GAGC 3C6UB 3OFHA 2MKIA 3IR7B 5ETSA 2A2DA 2HSEB 1TP7A 1UPMB 1M5KC 4RUHA 1KLMB 1U25A 3KK1A 1LNQA 2BBEA 1YRUA 4HTJA 2PMWA 2XSFA 1VQ7S 2K1RB 2ZUAA 3O3LA 3L9ZA 2ZD1A 3HCXA 1MSWD 2GZOA 1S6QB 4YB6A 3HVAA 4EYIB 5GAGI 4Q8EA 4DCPB 4KJIA 3HVTA 1SC6A 5H9EJ 5HI7A 4CH0S 4CIOA 5E7OB 4NRUA 2JJ4D 3MAQA 4C3MA 1X0PA 2X1GA 3M8QA 4TY8B 4KO0B 3KLIA 1SPBP 3HHDA 2E5IA 2G4BA 3MR6A 2ZDPA 1JNZB 2GMJA 1S0NA 2UXDJ 4X4NA 2BVZA 1JLCA 3EPGA 5K20B 4PYAA 2XNRA 4UY85 2MSSA 1LK7A 3K58A 4HHJA 4DSIA 1RTZA 2DPJA 1S9GB 1RAGB 2XSJA 2W2PP 4IFYA 4WFZA 2YPZA 3MR3A 1HNVB 4OZ0A 4W92B 4IOAQ 2Y1IA 3PKMA 1YJ9S 4M5DB 2NZ4A 2PDAA 1XNRF 3GFHA 4ES3A 1U1RA 3PRVA 5L46A 1IR0A 1RKJA 4U95A 5KFIA 4QJVA 2UXCJ 2RU9A 1B0TA 4RNOA 5D4OA 4W98A 4LBIA 4O4RA 2VICA 2XLKA 3NNCA 2ZH8A 2EC2A 5MAOA 2HHXA 1FRKA 1SC3B 4J7CA 2WSCC 1SJ3P 3D6TB 2V8VA 4PG7A 3EVMA 2BJ9A 5GMEA 2UP1A 3NCPA 3AB4B 4P74A 3UR0A 4OX9J 2C2MB 4LRFA 4DL5A 3SBMA 3MMJA 2ILYA 2NXNA 4C3KA 2IFXA 1QJHA 4ZLPA 4WP8A 1O6XA 4OJ3A 3LUYA 4L72B 4CO2A 3R5JB 5FDLB 2J7UA 5H9FJ 1N5VA 2MZ1A 4QPTA 4BS2A 3I5CA 3VVUA 2IIHA 1KQGB 3C6UA 3G8QA 5E2QA 1X5TA 3H5XA 2HURA 1KLMA 2KB2A 1CPZA 2ZBIA 3ILIA 2BM1A 4I67A 3LF0A 2MQ8A 1RB0A 4KHMA 2NXEA 2CQ2A 4OIXA 1TAUA 2RQCA 2GHPA 3BO4A 3GSIA 3GQCA 4CLWA 2CJQA 3EGVA 1N56A 4DV0F 1V5IB 3UN5A 4KO0A 2NYHA 3T6JA 3GONA 5M2UA 1IR1A 4C9DA 1WG4A 3MM8B 2CVIA 4KIAA 3GYGA 1CEZA 1WC1A 1JJHA 2ATCB 2XI2A 2G13A 3H59A 2MHNA 4ER8A 4WIQA 2KJVA 1VYAA 4ZN3A 1WUUA 1S1WA 5J1NA 2FHOB 5CQGA 4OLOA 3TAMB 3GCXP 1M1GA 3KHLA 2ZOFA 3VGUA 2GCFA 2DKOB 1EARA 5DQGA 4MIAA 2GIRA 1HBOA 3NS5A 1HNZF 2V4JA 1U24A 5KFLA 3DDIA 1VQ9S 3HHNB 3IBWA 2WBMA 3CCES 2DD8S 4DSEA 1T03A 2MDAA 2BOAA 4RW8B 2B9WA 4CO5A 2WVCA 4EI2A 3R8YA 3QGGA 3AQOA 5KFJA 1WOPA 2G1DA 1QD1A 3D28A 3ETMA 3EM1A 4K50A 1S57A 3KJVB 2VJVA 3CEDA 4G1PA 4OI3A 2DYAA 1E6YA 3U02A 5AJ3J 1C0UA 2B8QA 1U8WA 2XMMA 1RTIB 3IWLA 2BW2A 1RT2A 2EBGA 2X3GA 4M5LA 1N5SA 1TELA 3A3NB 3FUYA 3KUEA 4J9KA 5FJ4A 1K1QA 2OEJA 4B3MJ 2DNZA 4DV7J 4FS2A 2CFXA 4X65F 4O44A 4WFYA 5FDLA 3QATA 5CH7B 1O8BA 3CJ5A 2QT7A 1SIZA 3OTOJ 4IRKA 1G4CA 5IOLA 2UUCF 2XMJA 3T9ZA 2W7PA 3C16B 1CVJA 2CQ0A 4WBFA 2JVOA 4LF5J 2MSTA 1UPPA 4A8OA 1SJQA 3AHPA 4OHYA 3D9BA 2PIIA 4H4OB 2HBQB 1R8CA 3T9NA 3N9UC 3AQPA 4KYZA 3BPDA 3GIIA 2IDLA 5FIIA 1TL7B 1ZZFA 4I64A 4JV1A 2FTRA 2RS2A 4WFAQ 5KFYA 2PO4A 2G0JA 2X1FA 5G4DA 4OHXA 2IHR1 1O51A 1P27B 4ZLJA 3C6TB 3RAQA 4NA2A 3I87A 2HWHA 1NK8A 1Q95G 3V5RA 2QA2A 4DG1B 1FFWB 3MM7B 1WI8A 2ZEJA 1RGVA 2BUNA 4QIVA 4DOZA 4RNMA 3G9CA 2F5GA 4IOCQ 3I96A 3MECA 4O3PA 2JC0A 4DFPA 3ZZPA 1CULB 4LFAF 3B4DA 2YNFB 4DX5A 4I2QB 1SBRA 4TU9A 3OVSA 3CCVS 3GPAA 5CYMA 4WK3A 2AJ4A 1ZAVA 1S49A 4R8UA 2WONA 2XZTB 1TKZB 2OPSB 3QLHA 1OPIA 4ZVOB 4ZVPB 4J91A 3NWGA 3HHLB 2BQUA 2VPXB 3S7RA 3ENQA 2EPIA 4Y2AA 4YQWA 3NY0A 2GMLA 4MMOA 2XM3A 2Y8WA 2D9OA 4OHZA 4QIFA 4DR5J 1VGYA 4DV6F 2ZUGA 2Y8YA 3P8BB 3NCQA 1LEOA 3LH2S 2NLWA 4MT1A 4CO0A 2M2BA 5HJXA 3KJVA 4DR1J 4G65A 4KFBB 1BY9A 4DZDA 3FSXA 5HMWA 2D3UA 3FJ2A 3NGTA 1RTIA 2HLUA 3AD8C 2FD2A 4PPDA 4WWSA 3RZAA 3OL7A 4Y2KA 2ZH1A 4OYAA 1IBMJ 5KFNA 3V81A 1WEYA 2CJYB 1XEZA 3THVA 3RB6A 3E01B 2P9CA 1ZTWA 5DRKA 3NNAA 2CA9A 5D4PA 4RW7A 2UU9F 3IWXA 5A76A 3PXGa 2KHCA 4HACB 4Z7CA 4NZ7A 5DLGA 5I4MA 4LF1A 2AIRB 1FD2A 3ZTQA 2VA3A 1NB7A 1HNIA 3DXSX 3K17A 2V50A 1HIYA 1MMDA 2HVDA 3QSYB 3RRHA 4HHUA 1OYEA 1B7FA 1U0HB 1S72S 4CDIA 2QLXA 5IT9Y 2KU7A 2AW0A 4ILLA 4QBUA 4A8MP 1RE1B 1Q82T 1AW0A 1UFKA 5B09A 2DNPA 5LT5A 3C6TA 5IZHA 1A0OB 1L3VA 2F4VF 1LWEB 4F3MA 2IA6A 4CLKA 3EJMA 5G0RB 4RNNA 4L75A 2H65B 3MM7A 4LFBF 2CPFA 2DRBA 1NJXA 4DFMA 3TI0A 3H5SA 4F26A 3RBDA 1N33J 1GT8A 1CULA 4NX9A 2IAJB 1KVIA 2UXBJ 4O3OA 2YNFA 4I2QA 5D15A 2BQRA 1S1UA 1TK5A 4KV8A 3UPFA 3PR5B 3DHXA 2CPZA 2ZOGA 2VFRA 4M5GA 1VBZA 3K5LA 5DGAA 2YX1A 1PYSB 3HHLA 2DBBA 5GAEI 4ALZA 5DM6Q 1PYOB 4QIWD 4M5IA 5A8KB 1HQUB 4ZVSB 3ITHA 3GIRA 1RLCL 1RWXB 2R7OA 3NS7B 5THWA 1U09A 4ETXA 2GVDB 3HULA 3ZZRA 4G1IA 1HR0J 5KG1A 1G6BA 1LW0A 3DLJA 1EIYB 2ZE2A 4JYAJ 4E0DA 3JQJA 4J9OA 4H54A 4DJBA 4A8FA 1GMVA 1JLQB 1ZH5A 1N5TA 1U8SA 2W1BA 1OSCA 2W4CA 3V6DB 5B0AA 1T05B 1EHWA 3W8PA 2BJDA 1KSPA 2OIHA 1NJIT 2I5JA 4CCHA 3AJDA 1F3FA 2VFVA 3DMJB 1HWUA 3BGUA 4JOUA 3AD7C 5GAEU 2D3OR 2ROEA 2WBRA 2HIYA 1RHKB 3MUVP 4NLYA 2D41A 3J80U 3JSBA 3KKFA 2KKHA 5ETOA 1HHQA 2B4VA 1QVFR 2B9EA 2LLZA 2IBOA 3TO8A 2ABYA 4KTQA 5BJRA 3W2VA 4CLSA 3T1HF 2OPRB 2CYYA 4JV0A 2JZ5A 1Y7PA 1CJKA 1XMQF 2RH3A 1SQFA 4UOHA 1X4EA 5IWAF 1Y4ZB 2E7WA 3D3BJ 3BSNA 4B3SF 3H40A 1HHSA 4QU6A 3LGMA 1D0EA 3CJKB 2JEIA 4IFVA 3JSYA 1N5QA 3RUBL 4MKAA 1REGX 2HVEA 1PC4A 4JB8B 5HQ8A 1TVRB 4UY8T 3J7Z5 4OJHA 4WYLA 3EUNA 2OHDA 3I32A 4U8VA 4CLYA 1X4BA 2FJBB 2EK1A 2AEFA 4ZP9A 3W9IA 4ZLLA 1JLFB 5L9XA 2IAJA 2HGLA 4KAIA 3HHLC 1KBRA 2V0NA 3KHGA 1WEZA 4FN5A 1CQNA 3BH7B 4MIWA 1X9WA 4CM0A 2RQMA 4DR7F 4N47A 2JOQA 1OQ3A 3K89A 2MZRA 4ZDNA 1XN9A 2PE8A 2KYXA 3QZ8A 1B4SA 4O4GA 2H51B 2LXUA 2PA8D 2AGPA 2MHEA 2V8PA 4RU9A 3LPEA 5M2PA 3H8YA 1HQUA 3QT6A 1JQGA 3DLEA 1Z1ZA 6AT1B 2FJAB 3QWUA 1OQ6A 4KBIA 2QC3A 2E5LJ 3QT7A 2HNDA 3VGSA 3H0PA 3A8IA 1RT4A 3S6EA 4W4MA 1U1OA 3VGTA 1Q8LA 2H5IB 2LDIA 1B99A 1N36F 2OPPB 3KJFB 2L41A 1KD1T 2MB0B 1RAFB 3EMTA 3TWZA 2ZHBA 1XC9A 4DV4J 2KVIA 1WDTA 4F0MA 2MKKA 1DLOA 4ETZA 3OHBA 1XMBA 3HPOA 2IJRA 2K3KA 4QR1A 4OZ1A 2ZHAA 3O8WA 4NLWA 3TJ8A 3D3CJ 2K3IA 4WP3A 3KLGB 3IRXA 4MJKA 4ZPBA 2JEGA 1R7IA 1S6PB 2QV6A 4KY3A 1D3WA 1JLGA 3UR3C 3GIJA 2RS8A 1P1TA 1T9YA 2RDDA 1YG0A 4DV2J 4RKUC 4A8SA 4EUVA 4LR8A 1NZAA 3UN3A 2QL7B 1EP4A 2BKNA 3IS9B 3BGOP 3OFEA 4NWBA 2R8HA 3H5UA 4B3RJ 3QAUA 1NK5A 2HHUA 4G1QA 1S9EB 1TK0A 3BDPA 4X64F 3RU0A 1T9XA 3MEDA 1F1BB 3IWNC 2CNNB 3BR8A 4D3GA 4DN9A 3LAKA 4F7VA 3PKYA 2RD5C 2LXFA 3PRBA 2V6AA 5ETRA 3S01A 3CCMS 1VFJA 1CC8A 1FA0A 1URRA 4OL8A 1C4AA 3UWTA 3CJKA 3O2IA 1MNEA 2AGOA 1VBYA 3HJVA 1T9TA 2RQ4A 4MFBB 2IBKA 1HL6A 1R8HA 1RT7B 3IAS9 3I9ZA 2QTWA 1B7YB 1KR4A 2ZNZA 3L09A 4DR2F 5DM7Q 3QGHA 1DTTB 1T7PA 4X4TA 1TL3B 3OUYB 1JLFA 5BYSA 2R4FA 2AJ2A 2MQQA 3KTQA 4IR1A 1HMVB 4Z2XA 3HT0A 4OYBA 4AXIA 1S79A 2QYCA 4LF6J 1WWHA 1MU2B 5D8HB 5IV3A 3MR5A 5HQLA 2VOOA 3GG1A 4DSLA 4ZCIA 2FGOA 4IRCA 2JSXA 4PG4A 3NMAA 4K0KF 3PVXA 2CXEA 3BEGB 3QRPA 1A9NB 1HBNB 3NL0A 4OQJA 3OVBA 2VKZG 2YKNB 4CT8A 3VAIA 4NI2B 4ED3A 3QFHA 2VC0A 2HG4A 2EW9A 2HGMA 1SKUB 1LW2B 4DL7A 2QA4S 1X9MA 1FJGF 3K5NA 4NXNF 5J2MB 3Q8VA 1YJWS 4ES2A 1JXVA 4PQAA 3MPDA 2O1PA 2OI2A 3VAMA 4AQYF 3OTCA 1RTJB 2Z4PA 2OD6A 1FRIA 3OJUA 1I94J 4LSLA 2L9NA 1Z2ZA 3N6MA 4O3NA 2KZZA 4PCQA 5EWEA 3J80Y 2HW3A 3M8ZA 2R2TA 4F2RA 4ITSA 1LWFB 5DG8A 5LSRA 3G86A 4A46A 3WHIA 2UXCF 2CNOB 4KGZB 2AD9A 3HZEA 1LWXA 1C1CB 3TZZA 4TQSA 1VQPS 1UZDA 3SXLA 2QMUB 2I0XA 3GYNA 2WW4A 3DFEA 1X4HA 3CCSS 4DR4J 5KOXA 4NLOA 3DOMA 2MLZA 2R2SA 4I7FB 4AFFA 4DPWA 2HVZA 4A8WA 4QR0A 4BHQA 2FGCA 4N8NA 1S9EA 1TL1B 2OAUA 1RWKB 5CXTA 1PJ6A 4FXDA 4JI4F 1URNA 4JI7J 4J9MA 2CQPA 2PEBA 2J9EA 2UVUA 4UZBA 1NK6A 2M8DB 2C42A 2HHVA 1U7LA 3QO9B 2G2YA 3CJ8A 5KFHA 1U2FA 2F4FA 1IR2A 1M5PC 1OS5A 1RT7A 1N34J 1T94A 3GIKA 4CLLA 2Z56B 1R6YA 1DTTA 5GMKa 2XQCA 2WVDA 2QA4G 1TL3A 1WDDA 3LA0A 5KAKA 2IVMA 5J2QA 3KK2A 1LKZA 1HMVA 6FD1A 2FVCA 2B4UA 1H2TZ 4NXMJ 4R0EA 1TFWA 4YN3B 1O0PA 1JLBB 5LXYA 3PHTA 3HMJG 2Y1RI 4NEYA 4ZVGA 4YP3A 1DARA 1FEHA 4PXDA 5LM7E 4OJGA 4KR0B 3M2VB 5D78A 1WC0A 2YKNA 3UDVA 2RDJA 4NI2A 1D8ZA 3J81Y 4I1TA 4PG8A 1LW2A 3VHQA 4OX8A 1KFDA 2H54B 1TQLA 5EX0A 4KHRA 1NJWA 1GK8A 4C7QA 2J7KA 3VV2B 4RUAA 5IQ6A 2NSCA 2WZ1A 4B02A 3FCVA 5A8WB 1RLDA 5F8MA 4CNYA 2XULA 3JAMY 3GFYA 4K4UA 3OLAA 3UD3P 3Q0AA 4FYWB 1NKCA 2HRYA 3R97A 1NAQA 2RB7A 4A47A 3SSQA 1BQNB 2FC9A 2MZJA 2R8JA 2KG0A 1VQ5S 1RU2A 1S1TB 7FDRA 2F40A 3G87A 1SJFA 3MAAB 3AB2B 1OSDA 3M8PB 1RT5A 1ZM3A 1X4AA 1UP1A 1IQZA 2OELA 1FJCA 3BSCA 4F3QA 4ZCLA 4OZ3A 2E66A 1JLEB 3ZC4A 2MQLA 2XS7A 1QDUB 4DU7A 4U8YA 3ZZYA 1KQFB 2O01C 3JTNA 4ED4A 4J37A 4I2PA 3VAJA 2OSRA 2V2KA 5KT5A 1XQIA 3DU6A 2QIFA 1Z2LA 4UZCA 4YEAA 4Q7AA 5F9NA 3H2VE 1WI6A 2CWXA 4JP8A 4WU3A 3QO9A 3OTBA 5DQHA 1WG1A 2VDIA 3LQVA 4WCEQ 1HYSB 1YJTA 1YQHA 1UETA 2CPJA 2RILA 1YWXA 4OI1A 4PKDB 4ES1A 1WORA 3KLEA 3OL8A 3MMAB 4XPCA 2IYGA 3NS6A 2HEKA 4J9LA 1XNRJ 2B7BB 3BSAA 1UJ6A 3OFFA 1WTBA 4MKVA 2CQ1A 3OR1A 3ZZTA 4EEYA 3UO0A 4Q45A 2RRBA 4TU7A 1YJRA 3G82A 4DR6F 3FC9A 2HKEA 4C8YA 2GO9A 3M2VA 4DMZA 2XGQA 2XTJP 4UTGA 3DOLB 4P72A 2IJFA 3CJRA 4HYKA 4USUA 3HFVA 3WIUA 4H4KA 4DSKA 1N54B 2XYGB 1H98A 2G1HA 1VQ8S 3VAHA 1RZMA 3IGVA 2EG1A 3BN4A 4QYRA 3MM6B 4HEA9 3E3XA 4RX6A 1PGZA 4ED7A 1L3TA 2QYGA 1XMOF 3CXCR 1M1KT 1AZSB 1QAXA 2CJKA 3JS9A 3K0JA 3HZGA 5A8WA 2LXIA 4LBPA 3MGJA 3B78A 2AQ4A 3MOZA 3VZIA 3KMQA 1T0TV 2VPYB 3BJYA 1H2UX 2MGZB 4NLUA 3BPSP 4RNFA 3M32B 1U4BA 3J7AN 3V2UC 4IO9Q 4ICLB 3RR7A 1IN0A 2NREA 1CBKA 3M8PA 2BMBA 3W2WB 2RT3A 4HDGA 3LP0B 1JXEA 3U7JA 2BYCA 1JLEA 4S0MA 3P6YC 3IGNA 5LJ3Y 3R7BB 5GVQA 1J5EF 5LXRA 4ZPVR 1F60B 4QYZJ 5DDQC 2MMYA 1XTZA 2LQBA 4LREA 4EO6A 2E1PA 2UVVA 3I0SB 4DV0J 5ETPA 4DR1F 3ENAA 4Y6IA 3RW6A 3GTYX 1YX2A 2HQFA 4BC9A 2C3UA 4GKJF 5CD4A 4LSNB 1LXNA 5F8IA 2YH1A 1C4CA 3FFIB 3J7ZT 3HJFA 2RF2B 1TTHB 4CLFA 1RWPB 5HL7Q 1FDAA 1BUXA 1DTQB 3TR5A 2WK4A 1NZ8A 3MMAA 3ET6B 1W26A 4YUDA 3G71S 1FVSA 3K5PA 1FNMA 4WK1A 1SUQA 1NDLA 4QOTA 1QSSA 3R6LB 3K5OA 1G2EA 5BR8F 1HNZJ 3AA9A 2AU0A 4Y65A 4KGVB 2PMHA 2ERRA 4PG5A 3NAHA 9ATCB 4F4WA 2IRYA 4KH1B
chains in the Genus database with same CATH topology
2HBQB 5IC4B 1NMEB 1RHKB 3GJRB 2XZDB 5K20B 3SIPB 2XYPB 2Y0BB 2C2MB 1RHJB 2P2CB 1RHMB 3KJQB 2QL5B 2H48B 4LSZB 1RHQB 1PYOB 3QNWB 2C2KB 2CNOB 4ZVSB 1SC4B 3GJQB 3RJMB 1RWXB 3GJTB 2QL7B 2HBYB 3NS7B 2H51B 3R5JB 2XYHB 2H4WB 4ZVTB 4DCOB 2HBRB 3R7NB 2CDRB 1RE1B 1SC1B 3GJSB 3R6GB 1F9EB 3P4UB 2QL9B 1BMQB 1RWPB 1PAUB 1RWNB 1RHUB 2CJXB 2CNKB 2QLFB 1ICEB 2H4YB 5IC6B 2H65B 2CNNB 3IBFB 1RWOB 3P45B 2C2ZB 2QLJB 1I51B 1RWVB 4ZVQB 3D6FB 3EDRB 2DKOB 1GFWB 2FQQB 1I3OB 4DCJB 2CJYB 1RWKB 1QDUB 4JB8B 2Y1LB 4DCPB 2H5IB 2QLBB 3D6HB 3R6LB 2H5JB 2HBZB 1RHRB 1IBCB 3KJFB 1SC3B 2XYGB 2XZTB 3EDQB 4ZVRB 3R7BB 3KJNB 2CNLB 3IBCB 1RWMB 3D6MB 2C2OB 4ZVUB 3R7SB 4ZVOB 4ZVPB 1QTNB 1RWWB 2H54B 2C1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBQ B;  5IC4 B;  1NME B;  1RHK B;  3GJR B;  2XZD B;  5K20 B;  3SIP B;  2XYP B;  2Y0B B;  2C2M B;  1RHJ B;  2P2C B;  1RHM B;  3KJQ B;  2QL5 B;  2H48 B;  4LSZ B;  1RHQ B;  1PYO B;  3QNW B;  2C2K B;  2CNO B;  4ZVS B;  1SC4 B;  3GJQ B;  3RJM B;  1RWX B;  3GJT B;  2QL7 B;  2HBY B;  3NS7 B;  2H51 B;  3R5J B;  2XYH B;  2H4W B;  4ZVT B;  4DCO B;  2HBR B;  3R7N B;  2CDR B;  1RE1 B;  1SC1 B;  3GJS B;  3R6G B;  1F9E B;  3P4U B;  2QL9 B;  1BMQ B;  1RWP B;  1PAU B;  1RWN B;  1RHU B;  2CJX B;  2CNK B;  2QLF B;  1ICE B;  2H4Y B;  5IC6 B;  2H65 B;  2CNN B;  3IBF B;  1RWO B;  3P45 B;  2C2Z B;  2QLJ B;  1I51 B;  1RWV B;  4ZVQ B;  3D6F B;  3EDR B;  2DKO B;  1GFW B;  2FQQ B;  1I3O B;  4DCJ B;  2CJY B;  1RWK B;  1QDU B;  4JB8 B;  2Y1L B;  4DCP B;  2H5I B;  2QLB B;  3D6H B;  3R6L B;  2H5J B;  2HBZ B;  1RHR B;  1IBC B;  3KJF B;  1SC3 B;  2XYG B;  2XZT B;  3EDQ B;  4ZVR B;  3R7B B;  3KJN B;  2CNL B;  3IBC B;  1RWM B;  3D6M B;  2C2O B;  4ZVU B;  3R7S B;  4ZVO B;  4ZVP B;  1QTN B;  1RWW B;  2H54 B;  2C1E B; 
#chains in the Genus database with same CATH topology
 1WAC A;  1VDH A;  1IVZ A;  3DOL A;  2NXU A;  2IM3 A;  2XMV A;  7FD1 A;  3IG1 B;  3AXK A;  4LVN P;  3CCT A;  3A13 A;  1RWU A;  1RHJ B;  4NZ0 A;  5B0F A;  1JWW A;  1FX2 A;  1KTV A;  3F73 A;  1RHQ B;  4ECX A;  1NJY A;  3D1Q A;  2M52 A;  2H3E B;  4UST A;  4ZK7 M;  1YRT A;  3W60 A;  4CO1 A;  4RU2 A;  4JI3 F;  2BE2 A;  1PIL A;  2ZWP A;  4A8Y A;  1S97 A;  1PBU A;  5B0D A;  5C7P A;  4LT6 A;  3PW4 A;  3PHE A;  1AZS A;  2E1R A;  2C3M A;  3CCJ S;  1B3T A;  5KFV A;  2EC0 A;  2EEY A;  3NOG A;  1L3K A;  3RB0 A;  1UCN A;  5L39 A;  2HS4 A;  4X65 J;  4QU7 A;  1WHV A;  2R7U A;  5JXS A;  2P6S A;  1EET B;  1UWB B;  2E9T A;  2OD4 A;  2UUC J;  2BM0 A;  4CZC A;  1UW9 A;  1UVK A;  3H90 A;  1RAO A;  5KFC A;  1ZM2 A;  3MPW A;  4YHH F;  3ILL A;  1LFP A;  4Y2M A;  3DCA A;  5BYR A;  1CQM A;  1R6V A;  2ALY B;  1Y3J A;  1N52 B;  4DS5 A;  1HWI A;  2GVZ B;  4O3Q A;  3LP0 A;  4URS A;  5HVG A;  1J27 A;  3QPI A;  4OX6 A;  1JXL A;  1NHV A;  1RYS A;  3SCI E;  2QMX A;  3M2U A;  4U7U D;  5ADZ A;  4OI4 A;  2BRK A;  3MMB B;  4O3S A;  2ZZM A;  3KUG A;  4C3L A;  3CDA A;  5IT4 A;  4GVL A;  3QNW B;  1SC4 B;  1IKV B;  2C3O A;  4M5K A;  4K4T A;  3D7S B;  1RT6 A;  1S1X A;  2CAD A;  1U6Z A;  2QFI A;  3POT B;  3DLK A;  3G4S S;  1NCL A;  3R5D A;  1WD6 A;  4CH1 A;  5EDW A;  3FGV A;  2RF2 A;  1CG2 A;  4LRC A;  2LEP A;  4LFA J;  4DHV A;  1T9V A;  2YKM B;  4DCJ B;  1FNO A;  4B9T A;  5ETK A;  2PEH A;  1UVN A;  3HSJ A;  4DPT A;  1I6J A;  2HWI A;  3TYT A;  4JI6 F;  4HH1 A;  3RG6 A;  1Q7L B;  2VAS A;  1SJR A;  4DI6 A;  3GV8 B;  1FE0 A;  1Y11 A;  5A6P A;  1FWK A;  2HRU A;  1KN6 A;  3BZQ A;  1BGX T;  3Q8Y A;  1UVL A;  3KHR A;  1YDL A;  3MEG B;  4X84 A;  1SV5 A;  3H25 A;  2DTJ A;  2QG9 B;  4JUZ A;  3TZY A;  1NKE A;  4DV6 J;  1HQE B;  2HZV A;  2QZ8 A;  1XR5 A;  4MAK A;  3TP2 A;  2C2K B;  2YNI A;  2EXU A;  1ITP A;  2H4W B;  3J7Y I;  3TOQ A;  1TKX B;  1S1V B;  3UCU P;  4B9S A;  2DB1 A;  2BAN A;  1HBU A;  1VOM A;  4KGK A;  1VMB A;  1U26 A;  1F9H A;  4OJ1 A;  5AE2 A;  3MF5 A;  3NWR A;  4DR3 F;  5B0C A;  5IM0 B;  2Q1L A;  2LU1 A;  3ZTP A;  1NHU A;  1UWB A;  2DGU A;  2LQ9 A;  5LOQ A;  2AF6 A;  1S10 A;  3FEZ A;  1NO8 A;  1Q81 T;  3MOJ B;  3CCW A;  3KLH A;  5HSP A;  2UU9 J;  3LTO A;  1FCA A;  1RQ0 A;  4NCG B;  3DYA B;  1BQX A;  5HN0 A;  2KRR A;  2DEI A;  1UVI A;  2EK6 A;  4FNH A;  2VBY A;  4M5J A;  3OPK A;  2IVY A;  2CPE A;  5DJB A;  2GVZ A;  2XY6 A;  4DLE A;  2M4M A;  3J7Y U;  2M9K A;  3T5K A;  1XBW A;  2PSZ A;  5E3P A;  3MTK A;  1QLN A;  3NP5 A;  4ID5 B;  2XCA A;  5HP1 B;  3DU5 A;  4PRF A;  2XYH B;  3MEE B;  4QW8 A;  2CDR B;  3KLV A;  1YHQ S;  1ZAX A;  3QGP A;  2EI5 A;  1RSC A;  4I56 A;  2YNG B;  5IFM A;  2HPU A;  4OZN A;  1FKO A;  4X66 J;  2FPH X;  1QSY A;  2F4V J;  1PSD A;  3EGZ A;  2D74 B;  1YLX A;  5KG7 A;  3HK2 A;  4XO0 A;  4K7Q A;  3TUP A;  4P10 A;  4LFB J;  2QO3 A;  4YOE A;  3PYE A;  3V6J A;  3T3F A;  5F8N A;  1P6T A;  2KJW A;  3FZB A;  4TN2 A;  1M5H A;  2VL1 A;  4K8R A;  2V9K A;  2YKM A;  3TVZ A;  4E2F B;  1NLK L;  2J6T A;  2R7Q A;  1BXN A;  3BR9 A;  4M1K A;  2K8G A;  4LFC F;  1P9Q C;  4V1A k;  1ZPV A;  3VF0 B;  2VOP A;  4DUY F;  3S1T A;  2MJU A;  5BYQ A;  3OSN A;  2BDP A;  3IXQ A;  3RAM A;  3CW2 C;  4A8Q A;  1CC7 A;  2P6T A;  2NUU G;  4TU8 A;  1FE4 A;  3MEG A;  2XGP A;  2VG7 B;  3A1Y G;  2IVF B;  1U6F A;  1HBM B;  4O0I A;  1X5S A;  4M95 A;  3M2R A;  2FVP A;  4UOG A;  2CPH A;  1RP5 A;  3GCW P;  2YKO A;  3CVK A;  2YWW A;  1VBK A;  4N76 A;  4DDF A;  3R27 A;  2E9Z A;  2JX2 A;  2X7I A;  4ZPC A;  2WCX A;  1GQE A;  1DQA A;  2JLG A;  3IMQ J;  5K9F A;  3ZZU A;  3IRW P;  3G6Y A;  5D0H A;  1ZBT A;  1N5Y B;  3TZW A;  3UVJ B;  3K5M A;  1IKY B;  1SH3 A;  1OY6 A;  4Q0B B;  5IM0 A;  2BKO A;  1RT3 B;  4BC7 A;  3ISN C;  4IOB A;  1X4C A;  2VQE F;  3ILJ A;  2ZBR A;  4LF6 F;  4NLP A;  5IQQ A;  1VQS A;  1OWX A;  2L9W A;  2HYI B;  1BWE A;  2E9R X;  3ADA C;  3L7U A;  3KJQ B;  2Q43 A;  4RW9 B;  5DG7 A;  2M0G B;  3GV7 B;  5HAO A;  2JVR A;  4Q2M A;  3T1H J;  2W9C A;  4K2X A;  2CQH A;  2HK3 A;  1XMQ J;  1UVM A;  2ADC A;  1NEE A;  4ID5 A;  5HP1 A;  2ROG A;  2UUA F;  1H6K X;  4WXW A;  2XS2 A;  1TKD A;  4FBT A;  1GX5 A;  3FBE A;  4B3S J;  3ZXW A;  1MRO B;  1GXL A;  2BZ2 A;  2DO0 A;  2YNG A;  3BGF A;  1GH8 A;  3ISZ A;  3DLG A;  4U7C A;  4GKK F;  1TR0 A;  3SV3 A;  1VRT B;  5LSO A;  1OO0 B;  2B56 A;  4MK9 A;  3SYZ A;  4P2X A;  3UNY A;  1VBX A;  5F9L A;  2YX4 A;  1VRU B;  2MQN A;  3AXM A;  3QRR A;  3GJR B;  4YR2 A;  3ULH A;  4C0B A;  4IR9 A;  1UJ4 A;  1V3S A;  2VH7 A;  4ZMM A;  3WC2 A;  3KK1 B;  3MCM A;  2G0C A;  4DXL A;  3KMS A;  2LKZ A;  1LK5 A;  3UQS A;  1VHI A;  1V3Z A;  2FLO A;  2A1B A;  2GA7 A;  4DR7 J;  2ZD1 B;  5F0W A;  2XI3 A;  3IC1 A;  3HVT B;  4C8M A;  2CPI A;  4ZVT B;  1VQN S;  4OX7 A;  4N7T A;  3NXZ A;  2AGQ A;  1QSL A;  3LWM A;  1AUD A;  4JI7 F;  1BWV A;  3M1V A;  2BAC A;  3UCG A;  3Q8S B;  2AHO B;  1GTE A;  3IBF B;  2GV1 A;  3KG4 A;  4KGM A;  4P7V A;  3QJL A;  2RU3 A;  1VJQ A;  3QMQ A;  4CH7 A;  2V4R A;  4LF9 F;  1FT8 A;  2M5Y A;  2BW7 A;  1HI8 A;  5J2N A;  1N36 J;  1T9U A;  2XSJ B;  2DNR A;  4DZ6 A;  3SI8 A;  1RWM B;  3D6M B;  4IFY B;  1LOU A;  4NYZ A;  2XB2 D;  2BJ3 A;  2ZWO A;  2VBW A;  1PO6 A;  4V19 J;  3MCO A;  4ANC A;  1RAI B;  5F41 A;  2R7X A;  3OD2 A;  1WSR A;  4B9N A;  2LCW A;  3PO4 A;  2QL5 B;  2ALZ A;  1RAJ A;  2CQ3 A;  2V2V A;  2CQ4 A;  1F5A A;  2KN4 A;  2IM1 A;  3W5X A;  3TUI C;  4CNZ A;  1UTA A;  2MJN A;  4MIB A;  1U45 A;  5EGY A;  3FCW A;  2CNK B;  4K2J A;  1N32 F;  4BWJ A;  4DQR A;  3H4D A;  4X64 J;  4F02 A;  3EXY A;  3US5 A;  4KPC A;  2HHH F;  5E3Q A;  4J9P A;  2GJI A;  2GJ2 A;  3NNH A;  1FF2 A;  4I6W A;  4UW2 A;  3RW7 A;  2ATL A;  3ZTO A;  2C2N A;  1RT1 A;  2DNM A;  2QLB B;  5HJY A;  2H5J B;  1MRO A;  1N4L A;  2Y9H A;  4P2S A;  1VQK S;  1Y9O A;  2GFF A;  1SXL A;  4A48 A;  1U1L A;  2BR0 A;  1VK8 A;  2HVI A;  1QVG R;  3F56 A;  5ETM A;  4DR2 J;  3GZ7 A;  1GNK A;  2CIM A;  3SIP B;  3T19 A;  1VRU A;  5HMX A;  1MN9 A;  2ASJ A;  1Q8K A;  3T6B A;  4MKB A;  3HDS A;  2ZBQ A;  3PY8 A;  2X3D A;  3CSK A;  4K0K J;  4K4S A;  4LRA A;  4FYV B;  2DK2 A;  2GGP A;  2CJX B;  3C8Y A;  4YB1 P;  1WNE A;  3M9O B;  5K8P A;  4C97 A;  1B0P A;  5DS7 A;  3BGR A;  3CC7 S;  5KFM A;  1SH0 A;  4KHP F;  2BEF A;  3W61 A;  4ECQ A;  1AXQ A;  1FJG J;  1EKR A;  3GE9 A;  4RNH A;  1SH2 A;  4DBQ A;  4PQU A;  3K2Y A;  4NXN J;  2FJD B;  3MPY A;  2HQ3 A;  2ZZT A;  1IM6 A;  4OHV A;  2RKI A;  2WOM A;  2DNN A;  4CWB A;  2MZQ A;  4AQY J;  2FVR A;  2HFV A;  1PIE A;  2FZC B;  1UA0 A;  4LRD A;  1VQO S;  3EXC X;  4DL0 C;  1S1W B;  2GNK A;  2KO1 A;  1B64 A;  1TU0 B;  2RAQ A;  3FSI A;  5L1K A;  3U1N A;  1A6L A;  1VC0 A;  2M70 A;  3M9N B;  2Y0S D;  5L1J A;  1L5U A;  3KUH A;  1QM9 A;  2QJ3 A;  3GJQ B;  1S76 D;  1FKP B;  3DN9 A;  1HBO B;  4F4Y A;  4EU0 A;  2IRX A;  2Q79 A;  4MYT A;  2V4J B;  3ZZZ A;  4ZVH A;  5IXU A;  3MTJ A;  2ASL A;  2J8A A;  2CJ9 A;  4OZL A;  1T95 A;  1T03 B;  3I56 S;  1LQ9 A;  1Q79 A;  3SEO A;  2C2E A;  5KT3 A;  1RAD B;  4EMD A;  1WJ9 A;  4RW6 A;  3FQK A;  2VB6 A;  4XDD A;  4LQ3 A;  1UW4 A;  2WB1 D;  1MWQ A;  4IQX A;  2F63 A;  3GYX B;  4DFK A;  3DNC A;  4JI4 J;  3MM9 A;  2YY3 A;  1E6Y B;  3LP2 A;  3MD3 A;  2PMZ D;  1C0U B;  2W8L A;  3M6W A;  3R7S B;  2DJW A;  2COL A;  1RT2 B;  3JSR A;  1W2I A;  4LR9 A;  2G9O A;  2EG2 A;  4RUB A;  3T1Y F;  4NOH A;  2I8E A;  2V2Q A;  3N79 A;  4O44 B;  3W7B A;  2V34 A;  5KFF A;  4IQM A;  2V67 A;  5KTQ A;  4LUB A;  1TFY A;  2DHG A;  4TYB A;  3TAR A;  2YWF A;  5F8J A;  2VJU A;  1R8A A;  3OR2 A;  3EZO A;  4FP9 A;  5DZ7 A;  4E98 A;  1V3R A;  1TKT A;  3PW7 A;  1Q5V A;  4DQQ A;  2YKA A;  2ZJR Q;  2R2U A;  4G3I A;  4IG3 B;  4DL4 A;  2KXF A;  2V4Q A;  1JNR B;  1IM4 A;  3DLH A;  3PV8 A;  2E1C A;  3NBP A;  3CNQ P;  4EO8 A;  1C2P A;  2YPY A;  1NDC A;  3V4M A;  3D0G E;  4I6Y A;  4XTT A;  5IT9 U;  1M5S A;  2MKJ A;  4ZJL A;  3HFZ B;  4CM2 A;  1OY8 A;  4X4V A;  3MEC B;  3TAQ A;  1K73 T;  1Q8I A;  4FYY B;  1WKJ A;  2N4C A;  2J9D E;  4FKX A;  2CQC A;  4OZJ A;  1WHX A;  5E0O A;  2AJ1 A;  3UDC A;  2ZM6 F;  2CG8 A;  3PYF A;  4N56 A;  5C42 A;  2M7S A;  5CYM B;  5CZV A;  5L1I A;  1NRK A;  4FF1 A;  4R8U B;  2WON B;  1FKP A;  3QLH B;  2CRL A;  5GMD A;  2BXJ A;  1IXK A;  1H7W A;  4YY3 J;  1S0O A;  1NSP A;  3G2X A;  4JV5 F;  2YH0 A;  1S7H A;  2KTQ A;  3WZ0 A;  2UV8 A;  2IMW P;  1WTF A;  4QIG A;  2KYZ A;  4U96 A;  4ZVF A;  3OXG A;  3VTI A;  5DLF A;  4LR7 A;  1BD6 A;  3TQE A;  2FHJ A;  2KFZ A;  3BO3 A;  2QSW A;  3I31 A;  1Y5L B;  1KS2 A;  4FF3 A;  4ED2 A;  1R3N A;  1W7W A;  5E41 A;  3R3T A;  3I9V 9;  2Y0B B;  2E5H A;  1V9O A;  4URQ U;  4WXO A;  4K4Z A;  2RML A;  2P9G A;  4K59 A;  2HK2 A;  3A12 A;  3J81 j;  1CLF A;  1ZYQ A;  3H5Y A;  3V81 B;  3KWM A;  4DFJ A;  4JBC A;  4IH7 A;  2LEB A;  1WHY A;  5LL6 d;  4J9Q A;  4W90 B;  4RW7 B;  1APS A;  2AV5 A;  3WDO A;  2OML A;  1YI2 S;  1NDP A;  4C2M A;  5D3G A;  5I42 A;  2DIV A;  2K7K A;  3FVY A;  1X4F A;  2R8G A;  2R7R A;  1VK3 A;  2JLF A;  1HNI B;  2JWN A;  4IG3 A;  4DR6 J;  4ELT A;  5T7L B;  4ELU A;  4WYW A;  1KKH A;  3K59 A;  4USM A;  1GXT A;  1DJ0 A;  5F8L A;  2X1B A;  2NPF A;  4QW9 A;  4R0J A;  4BLG A;  3OLB A;  3FDS A;  1QAJ A;  2DPI A;  3BQ1 A;  4ECW A;  5KFS A;  4YB5 A;  1NJZ A;  3KNG A;  2MZS A;  3TNV A;  3UD5 A;  2LU2 A;  4ZJQ A;  1HWJ A;  1XMO J;  1FK9 A;  4K4W A;  4C8N A;  2OFH X;  3PX0 A;  3SCL E;  1WC6 A;  4Q2L A;  3B54 A;  1S1U B;  3D67 A;  3UW1 A;  4KV8 B;  5DO2 A;  3MUR P;  1HNX F;  1IKX A;  2BQ3 A;  3RRK A;  4Q44 A;  4A8K A;  2IJN A;  4EBC A;  1GX6 A;  3RR8 A;  1XNQ F;  4QPX A;  3R5C A;  2XMW A;  3HP6 A;  2FLN A;  1SL0 A;  2AJ0 A;  2DNL A;  4K5S A;  3FKB A;  3QYY A;  3SDE A;  2W9A A;  1HPZ B;  1O5J A;  2Z58 B;  3A3P B;  3ITH B;  2HFN A;  2MKS A;  2AJQ A;  5AXM A;  4EYH B;  1J5E J;  3NG8 A;  5I3U B;  5B0G A;  4OYI A;  4F4X A;  1UEK A;  2I1R A;  4D3H A;  2DNY A;  4TLR A;  1FI4 A;  1LW0 B;  2ZE2 B;  2HS0 A;  5B0E A;  4ECR A;  5SZT A;  3GB0 A;  4ZN1 A;  2Q66 A;  3VWS A;  5J2P B;  1BC6 A;  3FBB A;  2LDY A;  5F8G A;  3PDN A;  1U49 A;  4GKJ J;  3PFO A;  1NH8 A;  3P3D A;  7AT1 B;  2I5J B;  3VQT A;  2ZKT A;  2R42 A;  3CB4 A;  2Y1J A;  3CCZ A;  4QWD A;  3N01 A;  4DSF A;  4X62 F;  5A0Y A;  2NXJ A;  1IJF B;  1HWK A;  3P45 B;  1EB0 A;  9RUB A;  2XWX A;  2HQG A;  3M7V A;  2CQG A;  3FMB A;  2LEC A;  4I68 A;  3HLU A;  1FX4 A;  3ELH A;  3SQO P;  1JK9 B;  5HAN A;  3W2V B;  4DF4 A;  4P52 A;  3PG9 A;  2AP6 A;  4OV1 A;  4AXJ A;  5BR8 J;  1HHT P;  4O0N A;  5LMU J;  3DRS A;  3W63 A;  1CJK B;  3Q24 A;  3AJ1 A;  5T7L A;  3TX0 A;  4FDF A;  4UOF A;  4ED5 A;  2A6M A;  1S4F A;  5K8M A;  3G8T A;  1JJ4 A;  2ZIT A;  4ECZ A;  3T5J A;  4IFV B;  2UZA A;  1C1B B;  4X66 F;  4OFZ A;  2F9D A;  3SCJ E;  1NND A;  4JI3 J;  1VR6 A;  2KFY A;  4R5P A;  3I4P A;  2VFS A;  1HFE L;  4AL6 A;  3MPU B;  4C0H A;  1RHU B;  4XDC A;  3AOD A;  3P5T L;  2HQC A;  2FZK B;  4IDK A;  1I51 B;  3QZ7 A;  2VZ9 A;  5KFT A;  1UA1 A;  3OBI A;  2XLJ A;  2FQQ B;  3E2E A;  3O44 A;  1KVJ A;  2XC9 A;  4NYP A;  2F8M A;  2DXF A;  1T3O A;  4YHH J;  2W9B A;  4CLT A;  3EDQ B;  1V5V A;  4O4G B;  2QSF A;  1U2C A;  1HPZ A;  4WP9 A;  1J5O A;  5KG0 A;  1KTQ A;  5KG6 A;  2KXN B;  2ZDO A;  1NBE B;  5J1E A;  3DLE B;  4WF9 Q;  5KFX A;  3D66 A;  5I3U A;  2PGC A;  3X3U A;  2EBE A;  1PYT A;  2WVE A;  1UEV A;  1EZZ B;  2DH8 A;  2P8I A;  1RBL A;  2ZHO A;  5D4N A;  2XO6 A;  3BQ2 A;  3MHY A;  2HND B;  4RBU A;  1RT4 B;  3U27 A;  3PIP Q;  3BRE A;  1F2H A;  2AT1 B;  4ZHR B;  3THT A;  3MM5 A;  3JSM A;  4ID8 A;  3JTP A;  5J2P A;  2IDE A;  4P2M A;  1S6U A;  1U1P A;  1DLO B;  3EWG A;  1D9F A;  2CQI A;  1IUJ A;  2H4Y B;  2B8P A;  1ELO A;  2V5H G;  4UQG A;  5KFZ A;  1PJ5 A;  3Q8U A;  1ZM9 A;  5BXI A;  3H7H B;  4WE1 A;  3IRX B;  2AYM A;  5K8N A;  1MMN A;  5C24 A;  2ZJP Q;  2CQD A;  2B0G A;  2HWT A;  2EVZ A;  5ETL A;  4ZCM A;  2VDH A;  4L73 A;  2RIJ A;  1JLG B;  2DHX A;  3G6E S;  3RGI A;  1RAC B;  3KDO A;  4JI6 J;  2P9E A;  1IWG A;  2VFU A;  1EP4 B;  3CJ0 A;  1QE1 A;  1YJN S;  4F04 B;  4RZR A;  2C2D A;  5IC4 B;  2DR9 A;  4LF8 F;  2HFZ A;  1AUS L;  2VPW B;  1G1X A;  4G1Q B;  1WOS A;  2VG5 B;  2OEM A;  1JX4 A;  4PUO A;  2AYB A;  1PAE X;  3MED B;  2QGF B;  4IO1 A;  4ECS A;  3RB3 A;  1VJW A;  2U1A A;  4CRJ A;  4WFN Q;  3V4I B;  3DI6 A;  3FRZ A;  3R2D J;  1W2B R;  2OEK A;  2W24 A;  4M5H A;  4Y3C A;  1BQM A;  3VR1 A;  1C1B A;  2HBR B;  2PI5 A;  4G6V B;  4C4W A;  1FTC A;  1X5O A;  3TW0 A;  3AAW B;  3W65 A;  4FPI A;  2G2O A;  2OSQ A;  2PD1 A;  2R7T A;  4DN0 A;  3HHL D;  4DR3 J;  3H2U B;  4YS2 A;  2QEX S;  3I82 A;  2YVS A;  4ZJO A;  4EK2 A;  3PW2 A;  4OMF G;  3FZ2 A;  2GO8 A;  1R43 A;  3E8O A;  3D68 A;  4LBH A;  2WRM A;  2Z2M A;  3AY0 A;  2J0Q D;  2G2Z A;  3C2P A;  4OI2 A;  5L9N A;  1CS4 A;  3HHE A;  3DGP A;  4USV A;  4DUZ F;  1GMU A;  3TAN A;  1U47 A;  4NLD A;  1KC8 T;  1E6V A;  2OPQ A;  3O6Q A;  2M3D A;  4ELV A;  1LWC A;  3PEJ A;  2ASD A;  3Q83 A;  1BLU A;  4CLZ A;  4I4B A;  3IFE A;  3D0H E;  2RDI A;  1IBL F;  2UVW A;  1BMQ B;  1F5B A;  3J81 U;  4FBU A;  2XCP A;  4MK8 A;  4ZHR A;  5IC6 B;  2UVR A;  4M63 A;  2Y3Y A;  1OJ4 A;  1Q53 A;  5AE3 A;  1RCX B;  4LSL B;  2JDJ A;  2BKP A;  5H1S V;  1F6T A;  5B7W A;  2YNH A;  5KFE A;  2RVJ A;  3V6H A;  2RQK A;  3QGI A;  2VD3 A;  2RJZ A;  3SQG A;  3JAM U;  4F4Z A;  1Z4U A;  4DL6 A;  4ZVR B;  2W2O P;  3KFW X;  1H72 C;  3CJQ A;  2R7V A;  3K57 A;  1NPP A;  2BAB A;  3M05 A;  4F4K A;  1ZZN A;  5IT0 A;  3W66 A;  4LFC J;  3DOM B;  4GC6 A;  2HAI A;  4ZPA A;  5EUH A;  1KQS R;  4C6A A;  4DUY J;  3P5B P;  3MCS A;  1ZPW X;  4CQ1 A;  2BV3 A;  2J76 E;  1XK8 A;  2H48 B;  3QQC D;  2VG5 A;  4DX6 A;  5KG3 A;  4ECU A;  1QAI A;  4GO5 X;  4IYQ A;  2OFG X;  5CCL A;  5T14 A;  2AKW B;  3V4I A;  3GJS B;  3THP A;  2RSQ A;  4F2S A;  1X31 C;  4F4A A;  4DUT A;  3CCL S;  1UL3 A;  3TEH B;  4NL5 A;  1S7I A;  1N0U A;  3M6V A;  3R5A A;  1N6Q A;  4QR2 A;  4OI0 A;  2Z8Q A;  5D6G A;  3MMC A;  3DLB A;  1RDR A;  1X4G A;  3FCH A;  1S4E A;  5GAG U;  4ZKA A;  1K1S A;  2DIU A;  4OZ5 A;  5LMN J;  2DH9 A;  3M8Y A;  5J2Q B;  3KK2 B;  1YZ7 A;  3RBZ A;  1TV6 A;  4H4M A;  3D4J A;  3I0R A;  1UKU A;  2VQE J;  1HNW F;  1GMW D;  3CT9 A;  2AEJ A;  4FYX B;  4RWX A;  2PA3 A;  4F50 A;  5C25 A;  3DGV A;  2WB4 A;  3R5G A;  1FJE B;  4LVO P;  3VQS A;  5GAD I;  3T5L A;  2DHA A;  2PI4 A;  2PN6 A;  1PC5 A;  2YQ1 A;  3BH6 B;  1F9F A;  3Q22 A;  2OGU A;  2IC3 A;  2DR7 A;  2KM8 B;  2JH3 A;  2VIH A;  1FRX A;  3CJT A;  4IH6 A;  3PYG A;  3EZ5 A;  1FES A;  4DSJ A;  4EZ6 A;  5DGB A;  2J0S D;  2BJ7 A;  2EFP A;  3IN5 A;  4OYP A;  3TUJ C;  2UUA J;  1RKI A;  1TZ0 A;  2CZ9 A;  1ZA2 B;  5A2Q Y;  2EWH A;  5T41 A;  4WKY A;  2J0X A;  1V6H A;  1S59 A;  3VAF A;  2HAF A;  2KHD A;  4P2F A;  2DNG A;  3CD5 A;  3I4H X;  4GKK J;  3MFH A;  3MWB A;  1NSK L;  4DV1 F;  1KDN A;  4J5O A;  4DU8 A;  3JYT B;  2V94 A;  3SSS A;  1J2V A;  5FD1 A;  4X4U A;  2V2Z A;  1XWL A;  5GAD U;  1RWW B;  4DV3 F;  5K8O A;  4OV6 A;  2MPU A;  1S5Z A;  2B51 A;  2K1R A;  2DRD A;  1S6Q A;  4JI1 F;  1RT5 B;  5KG2 A;  1BE4 A;  2RRN A;  2DT9 A;  2UV8 G;  4A8X A;  3HSD A;  3A4T A;  3G8S A;  3SFU A;  3ZNU A;  1AYE A;  3X1L B;  1AT1 B;  3ICL A;  1FXL A;  4TY8 A;  3Q2T C;  2VON A;  1FWP A;  3CJ2 A;  1F2G A;  2XBP A;  2W01 A;  2Q6C A;  1RK8 A;  2ZKU A;  1FXR A;  3Q2S C;  1H38 A;  4USI A;  1RA7 A;  2D3Z A;  2AJF E;  4I2P B;  3BYP A;  3HF5 A;  1M1H A;  4KQZ A;  4MKY A;  4BCA A;  4NA1 A;  4IUF A;  2DIS A;  2OTJ S;  4QWE A;  3FSY A;  5IS2 A;  1S9G A;  2CZ4 A;  2J0W A;  3OT9 A;  3UNG C;  2JHE A;  1MLA A;  1HNV A;  1UMJ A;  4LF9 J;  2OH2 A;  4PWU A;  4M5D A;  3RYL A;  2HHP A;  2AMC B;  3KLE B;  4MH8 A;  4QZV B;  3UDL A;  3R2C J;  1NME B;  5I3P A;  1T8E A;  1N88 A;  4FXW A;  3W1Y C;  2DIT A;  4M94 A;  3M4X A;  3CDW A;  4NE9 C;  2CVE A;  3A8K A;  3OR1 B;  4GVB B;  3DHW C;  3KOA A;  2D69 A;  3UFC X;  1JMT A;  3FBC A;  3G82 B;  4X2B A;  2QFJ A;  2A10 A;  2HBY B;  1RAB B;  4U6P A;  3BS9 A;  2M88 A;  1VIX A;  2XZW A;  2ZC3 A;  4PXB A;  3CUN A;  4B3T F;  1R89 A;  3HVW A;  3PZP A;  1N32 J;  2AWZ A;  2RRA A;  2V68 A;  4GMK A;  2HHH J;  2IM2 A;  2EKN A;  3HHK A;  5D0E A;  1RTH B;  2GS8 A;  4NLQ A;  1Y5I B;  3H4B A;  3AH6 A;  2AZ1 A;  3WIV A;  3QRQ A;  3R1H A;  1YTY A;  4OYX A;  3GP9 A;  1ZS6 A;  1NH7 A;  4Y2C A;  4E8U A;  1HAR A;  5AXK A;  2OUG A;  1SJ4 P;  4JI5 F;  2B7C B;  2L48 A;  4Y0F A;  3JYT A;  3N4W A;  4NPO A;  1YZ6 A;  2KT5 A;  2KH9 A;  2XMU A;  8AT1 B;  2B4O A;  4WZM A;  4DPY A;  2GJF A;  1TAQ A;  3KG0 A;  1RAH B;  1SVD A;  2CQB A;  2QN6 B;  3O5T B;  4YY3 F;  2EFO A;  1F5C A;  1RXO B;  1N48 A;  1WKL A;  3MAH A;  4I0W A;  3H20 A;  3EGN A;  3TUZ C;  2HQI A;  1FER A;  3JQM A;  2CDQ A;  4F25 A;  3OXL A;  2C3Y A;  3MM8 A;  2HNY B;  1Q5Y A;  3QWP A;  4CLU A;  4HT5 A;  4KHP J;  5E33 A;  4DV5 F;  3CDU A;  3Q8Q B;  2ZBP A;  3OTD A;  4X4Q A;  2WTF A;  3WC0 A;  5EX3 A;  5B08 A;  2AX0 A;  2MQP A;  2HIQ A;  3TVK A;  3BO2 A;  4YR0 A;  3LO3 A;  3ENV A;  1U1M A;  1HD1 A;  1JKH B;  3TAM A;  3JB9 k;  4J9V A;  1UJ5 A;  2DCL A;  2DGQ A;  1OY9 A;  4X4S A;  1VQ6 S;  1TUW A;  4AL5 A;  2DHS A;  3N5B A;  1FJ7 A;  3MPV A;  4BWM A;  3CDE A;  3GIM A;  1K47 A;  2CJA A;  4FPR A;  3WBZ A;  4PXC A;  2YX7 A;  3NOC A;  3RJM B;  1Q7Y T;  4GVB A;  1SUQ B;  4LMZ A;  2KM8 C;  1QY7 A;  2HRT A;  3DOK B;  1YIJ S;  1Q86 T;  2XNQ A;  4RW8 A;  3R6G B;  1NXI A;  1S12 A;  2RUG A;  1ULR A;  3DC2 A;  3G6X A;  4DS4 A;  1WC3 A;  4L3K A;  3PR4 A;  2WSE C;  2ZH5 A;  3GR1 A;  3MFI A;  1QAY A;  1SQG A;  4ECY A;  4EGL A;  3FQL A;  1NPR A;  3QBC A;  5L8R C;  4KH0 B;  2CZV C;  1RTH A;  2BJ8 A;  4XPE A;  3MEK A;  2BE2 B;  4F8R A;  4TVA B;  2IM0 A;  4PAB A;  1YKW A;  3GU0 A;  2F9J A;  3T1Y J;  3QAE A;  4ZCK A;  3ZFV A;  3CCR S;  3TJA A;  1DRZ A;  3C16 A;  2P2C B;  1ZM4 A;  3PX4 A;  4LSZ B;  4QIE A;  2A0F B;  1I1G A;  4URG A;  2C3P A;  2X1A A;  3HVR A;  4U9R A;  4HHH A;  4I6A A;  4H4O A;  3I55 S;  2GQ2 A;  1YGY A;  1FHT A;  3CIZ A;  1X0F A;  2XHW A;  4NCB A;  1PKU A;  1EKS A;  4Q43 A;  3CMA S;  1TL7 A;  3W64 A;  4BBY A;  3SV4 A;  4WFX A;  3B82 A;  3QID A;  4LIR A;  1RWO B;  2LA6 A;  3M2U B;  3F44 A;  2HFS A;  1GFW B;  3WX8 A;  4C8L A;  4NLX A;  3LW5 C;  4Y28 C;  4DG1 A;  3HXM A;  1RHR B;  2HNY A;  1IBK F;  3IBC B;  1RBO B;  2HHW A;  2IY5 B;  2LYV A;  3M6U A;  1RT6 B;  4A4J A;  3OL9 A;  1S1X B;  1OPZ A;  3DLK B;  4ZIV A;  1CSJ A;  2A2C A;  1OMS A;  1A7G E;  2POK A;  1R0B G;  3CJS A;  3DM2 B;  5DG9 A;  3M8R A;  4O3R A;  2A6O A;  3K8V A;  2FC8 A;  3NGR A;  1JKH A;  4FYD A;  2IMO A;  5CYJ A;  2FHM A;  1FEE A;  2O66 A;  4P73 A;  2VC1 A;  4NLR A;  3DKD A;  3C15 B;  3W5Y A;  4LF7 F;  1N0V C;  1TKZ A;  2PT0 A;  2OPS A;  4QCL A;  1LV5 A;  2ZM6 J;  3OSP A;  4JI0 J;  2BE9 B;  5HRO B;  1YBT A;  4ECT A;  2KVQ E;  1K8A T;  1FO1 A;  4JV2 A;  1UZH A;  2XG8 A;  2ZH9 A;  5FLX U;  1Y0H A;  3CC4 S;  3DOK A;  4H4K C;  2HMI B;  3HI9 A;  5LMU F;  1UFL A;  2UUW A;  1KVK A;  4JV5 J;  3NEK A;  1SIW B;  5KFO A;  3LPY A;  1SV5 B;  4TNO A;  2UUB J;  3BN7 A;  3PFE A;  1IKW B;  2MZT A;  4KFB A;  2ZVS A;  2GHW A;  1KOH A;  3M9M B;  5ETT A;  3LAL A;  2YNI B;  4RL1 A;  5JUM A;  1SL2 A;  2ZNY A;  4ZVU B;  1Y3K A;  1AA1 B;  1DFD A;  1QTN B;  4LQ9 A;  2F8H A;  2V9W A;  1NPK A;  1VLY A;  6FDR A;  1M5V C;  3ONQ A;  2BAN B;  3PAC A;  2O5D A;  3B4M A;  1HBU B;  3SZ2 A;  4RBV A;  2BJ1 A;  1TUG B;  2JEJ A;  3KXD A;  3E01 A;  2Z2Y B;  2VUG A;  1MWY A;  2LA4 A;  4ANE A;  2B9Y A;  2D9P A;  1YBU A;  1GEH A;  2XWY A;  4QQB A;  4HAC A;  2HGN A;  1AFI A;  2WW8 A;  3KLH B;  2HZA A;  3UN2 A;  3TVY A;  2NPI A;  4C98 A;  4DPX A;  3IAM 9;  3QIP B;  2HNZ B;  2W8K A;  4WTO B;  4HDH A;  4YR3 A;  4LF4 F;  2F65 A;  3TEG A;  4RUC A;  2E5J A;  1Q4R A;  3CE8 A;  1OIA A;  2I6W A;  3G96 A;  3DLL Q;  1U0H A;  5HQM A;  4N5S A;  2NCK L;  4B08 A;  1X60 A;  2P5V A;  3TA1 A;  1GXU A;  1KNZ A;  1PBA A;  4HKQ A;  1OYD A;  2KT3 A;  3L7P A;  4KKO B;  3BBC A;  1LWE A;  1NK9 A;  3GMG A;  4ZPD A;  5G0R A;  1U0S A;  3OV7 A;  4M5M A;  2DXD A;  4NCA A;  2XYP B;  3CD7 A;  1FKO B;  3BKT A;  3SMZ A;  3DRR B;  4QWC A;  4IRD A;  2Z2Z A;  4B9V A;  3ZO7 A;  5ITH A;  3V6K A;  1QTM A;  3DM2 A;  5JVH Q;  3W62 A;  1DAX A;  5KFG A;  3HD1 A;  1ARO P;  4XAK A;  4ZS6 A;  2FJE B;  4DQP A;  2GQQ A;  3MDF A;  3C15 A;  3EVW A;  1IQT A;  4I69 A;  3JXO A;  2CAJ A;  4NMX A;  4FKY A;  5HRO A;  3QJP A;  2LFV A;  1HNX J;  1NKB A;  3C14 B;  5CHC B;  2LMI A;  5A8K A;  1XNQ J;  2LEA A;  3LAN A;  5CD4 H;  2HMI A;  2VG6 B;  3NMR A;  4DX7 A;  2Z57 B;  1GMW A;  1WC4 A;  2J6S A;  1NHK L;  1KWM A;  2GVD A;  2E29 A;  3BYR A;  4WFB Q;  2V69 A;  2XMK A;  4JI2 F;  4NLT A;  3NCR A;  3BKU A;  1IKW A;  4LIW A;  3HD2 A;  3M2R B;  2GHV C;  1JLQ A;  3C66 A;  2XZD B;  2DVI A;  3V6D A;  4L74 A;  2B6A B;  4AUK A;  1T05 A;  4FF4 A;  4KRW A;  3LGN A;  3DRP B;  1D9D A;  3BDE A;  2YKP A;  3K7R A;  3L3C A;  4OYZ A;  1JJ2 R;  3NRB A;  3DMJ A;  3GJT B;  2R9L A;  2HLT A;  4ILR A;  2KXH A;  3FEX B;  3BGL A;  1Q8B A;  2Q3P A;  3UD4 P;  1FDN A;  3F41 A;  2DR8 A;  1PCA A;  2QLW A;  4HI1 A;  5JVG Q;  3OHA A;  2LQ5 A;  2FJV A;  1EQM A;  4DX8 H;  3PJ9 A;  1WG5 A;  2FVS A;  2I2Y A;  4X62 J;  2QRR A;  2AEM A;  2XHC A;  3M8S A;  2FLL A;  2ZC4 A;  2C2Z B;  1ZET A;  2QLJ B;  2OPR A;  3QIP A;  2HNZ A;  2JNJ A;  1UEU A;  1R0A B;  4NLG A;  2GC8 A;  3AFG A;  2YBV A;  4IG0 B;  1P8G A;  1KHW A;  3W9J A;  2W9C B;  3TQ1 A;  4JI8 F;  4WZQ A;  2CNL B;  1WSV A;  1C0T B;  4B17 A;  1SL1 A;  1TL5 A;  4TY9 A;  4KKO A;  1Q1K A;  3OTE A;  2VQF F;  4C8Z A;  2X51 A;  2H5E A;  3CJ4 A;  5HO4 A;  3MR2 A;  2AX1 A;  2PC6 A;  3TA0 A;  3ZTR A;  5CYQ B;  1TVR A;  1WEL A;  1WF0 A;  3DDN A;  3RBX A;  1IWA A;  2MKY A;  3DLG B;  5AE1 A;  3DRR A;  5C2G A;  1T3N A;  3OFG A;  4AYB D;  4TQR A;  1SC1 B;  1KP6 A;  3A8J A;  1VIO A;  1F9E B;  1SI9 A;  2CPD A;  3CCU S;  4WU2 A;  5ETN A;  2C28 A;  1ICE B;  4C11 B;  4KGX B;  1M5O C;  5CZX A;  2RHS B;  1KOO A;  3PYD A;  5FLX Y;  2FHK A;  3CO9 A;  1MML A;  2QA1 A;  3VAG A;  1P9Y A;  3CF5 Q;  3C14 A;  1TMM A;  3BV8 A;  4TKT A;  1U6B A;  3MCN A;  1YJV A;  3VGV A;  2LP4 A;  4FZV A;  3A8E A;  2ZH2 A;  2VG6 A;  4C0O C;  4NZ6 A;  1RJJ A;  2G0I A;  3I5B A;  4F3O A;  2R7W A;  3IP0 A;  1NSA A;  2UXD F;  3FMW A;  3BBB A;  3LP1 B;  2ROP A;  3EX7 B;  2OP5 A;  2JC1 A;  2W4P A;  3M1V B;  2HFO A;  3DXB A;  2AYG A;  1T11 A;  3PRD A;  2OPP A;  2YWE A;  2B6A A;  1REV B;  3C3L A;  3DRP A;  5EWG A;  4M8L A;  1M0S A;  1XJW B;  4DCO B;  5J2N B;  4OZ2 A;  1YJU A;  5D0G A;  1NU4 A;  2WSF C;  3KLG A;  3GLJ A;  1LFW A;  2HFU A;  5LMN F;  1H0H B;  1S6P A;  2J9C A;  3CDB A;  3ISN D;  2YWH A;  2VBZ A;  2H9Z A;  3W3S A;  2JFD A;  1D8Y A;  2YXL A;  1FDD A;  4ZIT A;  4FVC A;  2Y1L B;  1RIS A;  5KFA A;  1ZOT A;  3IS9 A;  2K06 A;  3L7O A;  1R0A A;  2VOD A;  2W2N P;  5U47 A;  3Q89 A;  4Y2I A;  1JLA B;  1Y10 A;  3EGW B;  1D9A A;  4IG0 A;  4J9U E;  1U1N A;  1R8B A;  3GIL A;  4J9N A;  4K4Y A;  2APO A;  4LF8 J;  1RA6 A;  4OX9 F;  3N6L A;  1C0T A;  2ZH7 A;  2M8H A;  1KHV A;  2RE1 A;  2D7S A;  2EFN A;  4MFB A;  1K0T A;  3TA2 A;  4Y00 A;  1GTH A;  1RT1 B;  2IPO B;  5IV4 A;  2C2R A;  5CYQ A;  2DNH A;  1SKR A;  5J1P A;  1SQE A;  3PIO Q;  2YQ3 A;  1WF1 A;  2CKW A;  1WEX A;  2XY5 A;  1G7C B;  4OHW A;  1U2R A;  1NK0 A;  1KRP A;  4OYW A;  4CP5 A;  3OUY A;  4XK8 C;  4USK A;  2MEW A;  1H3D A;  2ZH4 A;  4KE5 A;  2W7O A;  3G6V A;  4EBE A;  3KLF B;  2JEF A;  1CJU B;  4ECV A;  2MY7 A;  2JLE A;  2MYF A;  1FDB A;  4C11 A;  1MU2 A;  2D3O 1;  4IH5 A;  4LRB A;  1VQY A;  5LSL A;  3D6H B;  5DZ6 A;  4F36 A;  3CUL A;  2B9X A;  2Z30 B;  5KT2 A;  5KFW A;  2HHQ A;  1H7X A;  2J7W A;  1HBN A;  1H73 A;  5HAT A;  2DNK A;  5ETQ A;  1W25 A;  3Q23 A;  5KFR A;  5C2C A;  1TL4 A;  4X4O A;  2GGP B;  2GX8 A;  1DBD A;  3AD9 C;  2CPY A;  3PEH A;  2L3M A;  3KDN A;  3BGR B;  4DUZ J;  3LP1 A;  1D1U A;  5J2M A;  5DET A;  4CO3 A;  5C5J A;  1F3V A;  3BSO A;  1XIQ A;  4QYZ K;  2CPX A;  4CLP A;  3CPW R;  1VC5 A;  3R7N B;  1RTJ A;  1Q0N A;  4PQU B;  4YB7 A;  1REV A;  2MKH A;  2KRB A;  4GC7 A;  1IBL J;  1MWZ A;  1VQM S;  2RKI B;  2WOM B;  2I38 A;  3SFG A;  2B43 A;  2HVH A;  4RR5 A;  1LWF A;  3ZZ0 A;  2DY9 A;  3AT1 B;  3KNA A;  4PEO A;  1I3O B;  4DL2 A;  1C1C A;  3Q8R B;  4RO0 A;  2BE7 D;  1S99 A;  4PG6 A;  4FF2 A;  2IA0 A;  2ZH6 A;  5CA5 A;  2LQJ A;  2DGW A;  3KG1 A;  2MQO A;  2CWK A;  3IR6 B;  2DHH A;  4I7F A;  3TAP A;  3CC2 S;  2ZVI A;  1NM2 A;  5AXL A;  2FJX A;  1KEK A;  1K0V A;  4ZP8 A;  5D0R A;  3SCK E;  3LAM A;  3IO1 A;  1TL1 A;  1UVJ A;  2KZM A;  1JLA A;  3PTW A;  4GO7 X;  5KT6 A;  1X9S A;  4KC5 A;  1RUS A;  4NAS A;  1R8P A;  2BOP A;  1X8D A;  3NGD A;  5KFU A;  2ZFH A;  5AJ3 F;  5HVF A;  4RW6 B;  1CJV B;  1HLW A;  4ZPT R;  2YWK A;  3B6B A;  3QT5 A;  4HTI A;  3U1L A;  1ZA1 B;  4UF4 A;  1QUV A;  3HKZ D;  3N5F A;  3RAX A;  1MN7 A;  3AOA A;  3MM9 B;  3LP2 B;  4DEZ A;  3HT3 A;  4B3M F;  4DV7 F;  3IM8 A;  2DGO A;  1FNX H;  3OTO F;  1HQ2 A;  2ADB A;  3L95 X;  2F3J A;  4F67 A;  4WII A;  3T41 A;  4L76 A;  4RBT A;  3TZX A;  4PZV A;  4LF5 F;  3KLF A;  2DGV A;  1CJU A;  4MYU A;  3CTR A;  1JLB A;  1EJ7 L;  4L6V 3;  4P75 A;  2WHO A;  5E3C A;  4CO4 A;  2O67 A;  2W2Q P;  3OR2 B;  3HM9 A;  1HNW J;  3KK3 B;  5K5M A;  3D1H A;  3NAI A;  4V19 X;  1JIH A;  1TKT B;  3FK4 A;  4AD6 A;  2QMW A;  4KT0 C;  1SKS A;  1VS3 A;  3RTV A;  1K44 A;  3D54 A;  2EKY A;  1VHF A;  1KQK A;  1Q78 A;  1FFG B;  4C48 A;  3NBP B;  3EVO A;  2MTL A;  3N6N A;  5KG4 A;  2YQ0 A;  3UE2 A;  5HVH A;  3U1M A;  3I6P A;  5DQI A;  3PM9 A;  4YDD B;  1U1K A;  2R2R A;  1Q16 B;  2CG4 A;  1DZ5 A;  1VIS A;  4Z37 A;  4ZP7 A;  4UOC A;  1KON A;  3A3O B;  5F8H A;  3OQ2 A;  2XLI A;  1ROF A;  4KPY A;  1GAO A;  5HBM B;  3VZH A;  2NUH A;  2A18 A;  3MZI A;  1BQN A;  1BHN A;  3MUT P;  2OMO A;  3HKW A;  3N0V A;  2HBZ B;  1VCT A;  4B3O B;  2R8K A;  4DV1 J;  1UWA A;  1FRH A;  1S1T A;  1NDK A;  3MAA A;  3HX9 A;  5C42 B;  2DNQ A;  4USJ C;  2ASY A;  5L1L A;  2XY7 A;  1TK8 A;  1N8R T;  2HHS A;  4DV3 J;  2NR0 A;  1FD8 A;  3PNI A;  5ETV A;  4DR5 F;  2KDO A;  3FRY A;  1I5O B;  2L9D A;  4NEZ A;  4JI1 J;  4UUX A;  5F3T A;  4J9R A;  2EFQ A;  5JJB A;  5HMZ A;  2NSB A;  2FZG B;  4UQT A;  1R0C B;  2B3T B;  1FXD A;  5KFD A;  3T1A A;  3CO0 P;  5KFB A;  2F8E X;  2N3O A;  1M90 T;  3CD0 A;  4TYA A;  1DHM A;  2VFT A;  4DPU A;  2WVF A;  1CJV A;  1HI0 P;  2DR6 A;  2K2P A;  3Q8P B;  4PWW A;  1YSJ A;  1KFS A;  4DLG A;  4CTA B;  1HYS A;  3W8G A;  4ZLN A;  1IBM F;  3KHH A;  1JB0 C;  2NXC A;  1L3S A;  2NQP A;  3W5Z A;  2IYI A;  2C22 A;  3VAK A;  3OXF A;  2DNO A;  2XMT A;  4YFU A;  3OL6 A;  3M30 B;  1RBA A;  5K14 B;  5EN1 A;  2W25 A;  1FFS B;  2E7V A;  2GW8 A;  1RTD B;  4RW4 B;  4HI2 A;  1VQ4 S;  3VVT A;  1S0M A;  5D3G B;  5I42 B;  1H74 A;  3QFW A;  2JL9 A;  3IR5 B;  1QUP A;  1YK9 A;  4USW A;  1NB2 A;  3KK3 A;  2CJB A;  4GRS A;  1UAW A;  2WVB A;  3W9H A;  1VRQ C;  3ETO A;  4P71 A;  5CCM A;  3NLC A;  4ED0 A;  2KG1 A;  1EQ0 A;  3AJ2 A;  3NKY A;  1L3U A;  3RBE A;  1MG7 A;  4ZVE A;  1PG5 B;  4B3T J;  2V8G A;  3MM6 A;  2K7J A;  3J7A 1;  3GWC A;  3PCO B;  3D1O A;  4PXE A;  2FIU A;  3H98 A;  2BA9 A;  1WOO A;  1N33 F;  4ED1 A;  2R7S A;  2UXB F;  4DPO A;  3MR7 A;  1WHW A;  4MTP A;  3LOU A;  2EFV A;  5HBM A;  4J9S A;  1G3O A;  2MGZ A;  1FK9 B;  2BJE A;  3KJN B;  3M32 A;  1D09 B;  2MY8 A;  4B3O A;  2N7Y A;  1EAY C;  1S6O A;  4ICL A;  4BDP A;  2V63 A;  4DQS A;  4JI0 F;  4XIU A;  4JI5 J;  2BX6 A;  3AOC A;  3QT8 A;  4RPF A;  3HO1 A;  1IKX B;  2VPZ B;  3W2W A;  2VU5 A;  3FBF A;  4K4X A;  4ZPW R;  2VF3 A;  5I3Q A;  4U67 Q;  4FS1 A;  4DF8 A;  4RLE A;  2XEX A;  2AZ3 A;  3EZU A;  4K4V A;  1AFJ A;  5AT1 B;  2N7C A;  3SDE B;  3LGH A;  1HR0 F;  2J9D A;  4OYO A;  2EFG A;  2DH7 A;  3HFK A;  1YVF A;  2QX0 A;  1RWN B;  5KT4 A;  2UUB F;  4AND A;  3I0S A;  4ZIW A;  4JYA F;  2OJ3 A;  5D77 A;  1RYR A;  3R9L A;  2QE5 A;  2VV5 A;  3PW5 A;  2DEJ A;  3D6F B;  2N3L A;  2ZOM A;  5E3R A;  5KT7 A;  3O1L A;  4CTA A;  2V8H A;  4LSN A;  4NA3 A;  2F7V A;  2OLW A;  2ZBC A;  4DV5 J;  2MQM A;  3FFI A;  3EYZ A;  4KB7 A;  4EWT A;  4R25 A;  2NS1 B;  1DTQ A;  3M6X A;  4CT9 A;  4ILM A;  2IRU A;  4OLP A;  3ET6 A;  3CME S;  5LJ5 Y;  3E51 A;  4U7U K;  3UDE A;  4PPZ A;  3MUM P;  3M30 A;  5K14 A;  4NML A;  2DO4 A;  5A0Y B;  2SXL A;  3RB4 A;  3GSD A;  1RTD A;  4L3N A;  2Q6B A;  4RW4 A;  1RHM B;  2LQ8 A;  3BKF A;  1RI7 A;  3VAL A;  2W2M P;  2ILZ A;  1FWL A;  2E44 A;  4AL7 A;  2LVW A;  5KFP A;  4HVZ A;  3DRS B;  1PAU B;  5M2R A;  3IG1 A;  2KI2 A;  3UCZ P;  1WC5 A;  4QWB A;  5CAA A;  3BM7 A;  1FRJ A;  1TUV A;  5F3Z A;  3EE3 A;  3DRY A;  1B0V A;  3EDR B;  4KSE B;  2JRS A;  4PYD A;  1DUR A;  2GQC A;  4NLS A;  2V8D A;  1IBC B;  2L08 A;  4ZA1 A;  1HW9 A;  3DRX A;  2FUG 9;  1U1Q A;  3I5A A;  4CYU B;  4B9M A;  2ZH3 A;  1PJ7 A;  4P7T A;  1ACM B;  3LWL A;  1EET A;  4LJM A;  4R5P B;  2O3D A;  4HT7 A;  5D4L A;  5HLF B;  3ZTS A;  2E7X A;  1X5P A;  1RAE B;  3TJ9 A;  4UT4 A;  1CJT B;  1NK4 A;  1VI7 A;  1ZTT A;  2PFD A;  3GR0 A;  4IDK B;  3SSR A;  4EBD A;  3H42 A;  3CCQ S;  4WJB A;  3R1L A;  4CI0 B;  3WQP A;  2W9B B;  2DGS A;  2FHJ D;  3P4U B;  5HK4 A;  3JQK A;  2DY1 A;  1R31 A;  4DL3 A;  2QLF B;  1J5O B;  3MMB A;  3PJX A;  1AB8 A;  2MLX A;  2E5L F;  2FYX A;  2KT2 A;  5J1E B;  8RUC A;  1IKV A;  2MXY A;  5A8R B;  4OI6 A;  2FY8 A;  4FVM A;  8ATC B;  2E1A A;  1P1L A;  1Y00 A;  4DV4 F;  2OTL S;  3RRG A;  3POT A;  3ENW A;  3ZZO A;  1S48 A;  4Z7Y A;  4AE5 A;  3P96 A;  3M8W A;  2VBX A;  4NLV A;  1IBK J;  4O23 A;  2FJW A;  4PR6 A;  5JMN A;  3MM5 B;  3JSM B;  2GIF A;  2MLY A;  4FNI A;  3NGK A;  5MLC V;  2HZC A;  2FDN A;  1HWL A;  3GV5 B;  3MXH P;  2F1F A;  3AA8 A;  3IA0 A;  5E3A A;  1YIT S;  3WX4 A;  2U2F A;  4WE1 B;  4DV2 F;  4ED6 A;  3QJJ A;  1HI1 A;  5C24 B;  4HLB A;  2DRA A;  4LF7 J;  1RU1 A;  4J90 A;  2J6U A;  2DCU B;  4MK7 A;  2E5G A;  4B3R F;  4YDX A;  4C8O A;  4N8O A;  3PX6 A;  1SJ1 A;  3BB5 A;  3CGI A;  5AXN A;  3P49 B;  1DQ8 A;  3ZNJ 1;  4YME A;  1QE1 B;  3H2L A;  1SKW A;  3CIM A;  4B9U A;  1HQE A;  5L38 A;  4PUO B;  2N82 B;  4C8K A;  1S0V A;  1EX8 A;  2J8S A;  1NSQ A;  4ZOS A;  3GFX A;  3F0N A;  2RHQ B;  2YWG A;  4X4R A;  1TKX A;  1YJ7 A;  3TRG A;  2XMA A;  1S1V A;  3DI6 B;  5KFK A;  1Y5N B;  4DQI A;  1K9M T;  2UUT A;  2HQD A;  3C46 A;  4ENO A;  1BQM B;  1IJE B;  1T9W A;  5F0U A;  4DWI A;  4CYU A;  1U02 A;  2VA2 A;  2AYE A;  4RWW A;  5RUB A;  3BF4 A;  4WTY A;  4B9L A;  1LXJ A;  5KG5 A;  5B0B A;  2HHT A;  1YBA A;  5HLF A;  2NYI A;  1B70 B;  5CAB A;  3S8S A;  2FB0 A;  1FKA F;  1CJT A;  2FVQ A;  4LF2 A;  3D5M A;  2E1M C;  2B5J B;  4NCG A;  3DYA A;  2PFF B;  3QSI A;  5HMY A;  3N28 A;  4PWD B;  1XR6 A;  3MD1 A;  2XO7 A;  1KLN A;  4IKA A;  3EPI A;  1FRM A;  3CWJ A;  1WF2 A;  5GAH I;  4LF4 J;  1NK7 A;  1CS4 B;  3GFZ A;  3Q86 A;  5IWA J;  3DGP B;  3ILO A;  4NRT A;  1X4D A;  1U48 A;  3T5H A;  3GG0 A;  3NGU A;  4ERD A;  5EWF A;  3TX8 A;  3D0I E;  1E6V B;  2OPQ B;  3MEE A;  4ATN A;  3PW0 A;  4QWA A;  1LWC B;  1ZAW A;  3BBF A;  3D2W A;  2NZC A;  2ACM A;  5H9E K;  5A8R A;  3FEY B;  4ZP6 A;  2C2O B;  2HS3 A;  2I9S A;  2Z2L A;  1I94 F;  2ACY A;  1FRL A;  3FNN A;  4USH A;  5SUH A;  4FXV A;  2KL8 A;  1WKK A;  2W4D A;  5A2Q U;  3EIC A;  2YNH B;  4OYM A;  4TXS A;  2OKQ A;  3CMQ A;  2W7A A;  5EHH A;  5GAH U;  1JJC B;  4P6Q A;  2FY1 A;  3SQG B;  4DR4 F;  2ZJQ Q;  2OO4 A;  3OVA A;  2BRL A;  2QL9 B;  1FTR A;  2XS5 A;  2DGT A;  1DY3 A;  3C19 A;  3KYL A;  4EFA C;  2R8I A;  4NYO A;  1SCJ B;  4N77 A;  3VCD A;  4EZ9 A;  1R27 B;  5DDR C;  3PJW A;  1T02 A;  1MW7 A;  2YTC A;  5KFQ A;  3JTO A;  4ZVQ B;  2ZZN A;  1NUE A;  2JFK A;  3NGS A;  3M8Q B;  2VG7 A;  4UUW A;  4M5N A;  3KLI B;  2B4P A;  4N41 A;  1HBM A;  3IM9 A;  2D1C A;  3CD6 S;  3K8W A;  1JLC B;  1HW8 A;  2MKC A;  5DDO C;  3PO5 A;  4JI2 J;  4WKR A;  4Y34 A;  2GMH A;  1N34 F;  1YRX A;  1N5Y A;  1N6Q B;  4PAA A;  3UVJ A;  5A6W A;  1IKY A;  4Q5V A;  3MMC B;  4Q0B A;  1DQ9 A;  3HSZ A;  2WAQ D;  3BQ0 A;  1RT3 A;  4Q8F A;  4NXM F;  1RAA B;  1TMJ A;  4F0K A;  1S77 D;  3OJS A;  1XER A;  1S9F A;  4HH0 A;  2Z0G A;  2B5J A;  1TV6 B;  3OW2 R;  1VLO A;  2FLP A;  5H9F K;  5E5N A;  4H4M B;  4P9S A;  2GAH C;  2A3J A;  4F0H A;  3I0R B;  2VKR A;  4PWD A;  2RNE A;  3AOB A;  4RW9 A;  2VHG A;  4HR2 A;  1X7V A;  1RWV B;  5C25 B;  2J5A A;  4X4P A;  1VC6 A;  4RJV A;  1HD0 A;  1SB6 A;  4TLQ A;  3B8H A;  1RCO B;  2CUY A;  3L4B C;  1HA1 A;  4HL9 A;  5KOW A;  1H2V Z;  1HKA A;  2IC3 B;  2N4D A;  2KFN A;  4JI8 J;  1XR7 A;  4K5R A;  2C1E B;  1FVQ A;  3UI3 A;  2RUS A;  3R5B A;  2YKQ A;  2R3V A;  2VQF J;  3HSG A;  5DDP C;  2H1Y A;  2DXE A;  1UFW A;  3DDK A;  1VRT A;  3MI7 X;  2GIQ A;  2DR5 A;  4ED8 A;  2DGX A;  4WPA A;  1F0X A;  4AT1 B;  3CJ3 A;  1VQL S;  2GAG C;  3C6U B;  3OFH A;  2MKI A;  3IR7 B;  5ETS A;  2A2D A;  2HSE B;  1TP7 A;  1UPM B;  1M5K C;  4RUH A;  1KLM B;  1U25 A;  3KK1 A;  1LNQ A;  2BBE A;  1YRU A;  4HTJ A;  2PMW A;  2XSF A;  1VQ7 S;  2K1R B;  2ZUA A;  3O3L A;  3L9Z A;  2ZD1 A;  3HCX A;  1MSW D;  2GZO A;  1S6Q B;  4YB6 A;  3HVA A;  4EYI B;  5GAG I;  4Q8E A;  4DCP B;  4KJI A;  3HVT A;  1SC6 A;  5H9E J;  5HI7 A;  4CH0 S;  4CIO A;  5E7O B;  4NRU A;  2JJ4 D;  3MAQ A;  4C3M A;  1X0P A;  2X1G A;  3M8Q A;  4TY8 B;  4KO0 B;  3KLI A;  1SPB P;  3HHD A;  2E5I A;  2G4B A;  3MR6 A;  2ZDP A;  1JNZ B;  2GMJ A;  1S0N A;  2UXD J;  4X4N A;  2BVZ A;  1JLC A;  3EPG A;  5K20 B;  4PYA A;  2XNR A;  4UY8 5;  2MSS A;  1LK7 A;  3K58 A;  4HHJ A;  4DSI A;  1RTZ A;  2DPJ A;  1S9G B;  1RAG B;  2XSJ A;  2W2P P;  4IFY A;  4WFZ A;  2YPZ A;  3MR3 A;  1HNV B;  4OZ0 A;  4W92 B;  4IOA Q;  2Y1I A;  3PKM A;  1YJ9 S;  4M5D B;  2NZ4 A;  2PDA A;  1XNR F;  3GFH A;  4ES3 A;  1U1R A;  3PRV A;  5L46 A;  1IR0 A;  1RKJ A;  4U95 A;  5KFI A;  4QJV A;  2UXC J;  2RU9 A;  1B0T A;  4RNO A;  5D4O A;  4W98 A;  4LBI A;  4O4R A;  2VIC A;  2XLK A;  3NNC A;  2ZH8 A;  2EC2 A;  5MAO A;  2HHX A;  1FRK A;  1SC3 B;  4J7C A;  2WSC C;  1SJ3 P;  3D6T B;  2V8V A;  4PG7 A;  3EVM A;  2BJ9 A;  5GME A;  2UP1 A;  3NCP A;  3AB4 B;  4P74 A;  3UR0 A;  4OX9 J;  2C2M B;  4LRF A;  4DL5 A;  3SBM A;  3MMJ A;  2ILY A;  2NXN A;  4C3K A;  2IFX A;  1QJH A;  4ZLP A;  4WP8 A;  1O6X A;  4OJ3 A;  3LUY A;  4L72 B;  4CO2 A;  3R5J B;  5FDL B;  2J7U A;  5H9F J;  1N5V A;  2MZ1 A;  4QPT A;  4BS2 A;  3I5C A;  3VVU A;  2IIH A;  1KQG B;  3C6U A;  3G8Q A;  5E2Q A;  1X5T A;  3H5X A;  2HUR A;  1KLM A;  2KB2 A;  1CPZ A;  2ZBI A;  3ILI A;  2BM1 A;  4I67 A;  3LF0 A;  2MQ8 A;  1RB0 A;  4KHM A;  2NXE A;  2CQ2 A;  4OIX A;  1TAU A;  2RQC A;  2GHP A;  3BO4 A;  3GSI A;  3GQC A;  4CLW A;  2CJQ A;  3EGV A;  1N56 A;  4DV0 F;  1V5I B;  3UN5 A;  4KO0 A;  2NYH A;  3T6J A;  3GON A;  5M2U A;  1IR1 A;  4C9D A;  1WG4 A;  3MM8 B;  2CVI A;  4KIA A;  3GYG A;  1CEZ A;  1WC1 A;  1JJH A;  2ATC B;  2XI2 A;  2G13 A;  3H59 A;  2MHN A;  4ER8 A;  4WIQ A;  2KJV A;  1VYA A;  4ZN3 A;  1WUU A;  1S1W A;  5J1N A;  2FHO B;  5CQG A;  4OLO A;  3TAM B;  3GCX P;  1M1G A;  3KHL A;  2ZOF A;  3VGU A;  2GCF A;  2DKO B;  1EAR A;  5DQG A;  4MIA A;  2GIR A;  1HBO A;  3NS5 A;  1HNZ F;  2V4J A;  1U24 A;  5KFL A;  3DDI A;  1VQ9 S;  3HHN B;  3IBW A;  2WBM A;  3CCE S;  2DD8 S;  4DSE A;  1T03 A;  2MDA A;  2BOA A;  4RW8 B;  2B9W A;  4CO5 A;  2WVC A;  4EI2 A;  3R8Y A;  3QGG A;  3AQO A;  5KFJ A;  1WOP A;  2G1D A;  1QD1 A;  3D28 A;  3ETM A;  3EM1 A;  4K50 A;  1S57 A;  3KJV B;  2VJV A;  3CED A;  4G1P A;  4OI3 A;  2DYA A;  1E6Y A;  3U02 A;  5AJ3 J;  1C0U A;  2B8Q A;  1U8W A;  2XMM A;  1RTI B;  3IWL A;  2BW2 A;  1RT2 A;  2EBG A;  2X3G A;  4M5L A;  1N5S A;  1TEL A;  3A3N B;  3FUY A;  3KUE A;  4J9K A;  5FJ4 A;  1K1Q A;  2OEJ A;  4B3M J;  2DNZ A;  4DV7 J;  4FS2 A;  2CFX A;  4X65 F;  4O44 A;  4WFY A;  5FDL A;  3QAT A;  5CH7 B;  1O8B A;  3CJ5 A;  2QT7 A;  1SIZ A;  3OTO J;  4IRK A;  1G4C A;  5IOL A;  2UUC F;  2XMJ A;  3T9Z A;  2W7P A;  3C16 B;  1CVJ A;  2CQ0 A;  4WBF A;  2JVO A;  4LF5 J;  2MST A;  1UPP A;  4A8O A;  1SJQ A;  3AHP A;  4OHY A;  3D9B A;  2PII A;  4H4O B;  2HBQ B;  1R8C A;  3T9N A;  3N9U C;  3AQP A;  4KYZ A;  3BPD A;  3GII A;  2IDL A;  5FII A;  1TL7 B;  1ZZF A;  4I64 A;  4JV1 A;  2FTR A;  2RS2 A;  4WFA Q;  5KFY A;  2PO4 A;  2G0J A;  2X1F A;  5G4D A;  4OHX A;  2IHR 1;  1O51 A;  1P27 B;  4ZLJ A;  3C6T B;  3RAQ A;  4NA2 A;  3I87 A;  2HWH A;  1NK8 A;  1Q95 G;  3V5R A;  2QA2 A;  4DG1 B;  1FFW B;  3MM7 B;  1WI8 A;  2ZEJ A;  1RGV A;  2BUN A;  4QIV A;  4DOZ A;  4RNM A;  3G9C A;  2F5G A;  4IOC Q;  3I96 A;  3MEC A;  4O3P A;  2JC0 A;  4DFP A;  3ZZP A;  1CUL B;  4LFA F;  3B4D A;  2YNF B;  4DX5 A;  4I2Q B;  1SBR A;  4TU9 A;  3OVS A;  3CCV S;  3GPA A;  5CYM A;  4WK3 A;  2AJ4 A;  1ZAV A;  1S49 A;  4R8U A;  2WON A;  2XZT B;  1TKZ B;  2OPS B;  3QLH A;  1OPI A;  4ZVO B;  4ZVP B;  4J91 A;  3NWG A;  3HHL B;  2BQU A;  2VPX B;  3S7R A;  3ENQ A;  2EPI A;  4Y2A A;  4YQW A;  3NY0 A;  2GML A;  4MMO A;  2XM3 A;  2Y8W A;  2D9O A;  4OHZ A;  4QIF A;  4DR5 J;  1VGY A;  4DV6 F;  2ZUG A;  2Y8Y A;  3P8B B;  3NCQ A;  1LEO A;  3LH2 S;  2NLW A;  4MT1 A;  4CO0 A;  2M2B A;  5HJX A;  3KJV A;  4DR1 J;  4G65 A;  4KFB B;  1BY9 A;  4DZD A;  3FSX A;  5HMW A;  2D3U A;  3FJ2 A;  3NGT A;  1RTI A;  2HLU A;  3AD8 C;  2FD2 A;  4PPD A;  4WWS A;  3RZA A;  3OL7 A;  4Y2K A;  2ZH1 A;  4OYA A;  1IBM J;  5KFN A;  3V81 A;  1WEY A;  2CJY B;  1XEZ A;  3THV A;  3RB6 A;  3E01 B;  2P9C A;  1ZTW A;  5DRK A;  3NNA A;  2CA9 A;  5D4P A;  4RW7 A;  2UU9 F;  3IWX A;  5A76 A;  3PXG a;  2KHC A;  4HAC B;  4Z7C A;  4NZ7 A;  5DLG A;  5I4M A;  4LF1 A;  2AIR B;  1FD2 A;  3ZTQ A;  2VA3 A;  1NB7 A;  1HNI A;  3DXS X;  3K17 A;  2V50 A;  1HIY A;  1MMD A;  2HVD A;  3QSY B;  3RRH A;  4HHU A;  1OYE A;  1B7F A;  1U0H B;  1S72 S;  4CDI A;  2QLX A;  5IT9 Y;  2KU7 A;  2AW0 A;  4ILL A;  4QBU A;  4A8M P;  1RE1 B;  1Q82 T;  1AW0 A;  1UFK A;  5B09 A;  2DNP A;  5LT5 A;  3C6T A;  5IZH A;  1A0O B;  1L3V A;  2F4V F;  1LWE B;  4F3M A;  2IA6 A;  4CLK A;  3EJM A;  5G0R B;  4RNN A;  4L75 A;  2H65 B;  3MM7 A;  4LFB F;  2CPF A;  2DRB A;  1NJX A;  4DFM A;  3TI0 A;  3H5S A;  4F26 A;  3RBD A;  1N33 J;  1GT8 A;  1CUL A;  4NX9 A;  2IAJ B;  1KVI A;  2UXB J;  4O3O A;  2YNF A;  4I2Q A;  5D15 A;  2BQR A;  1S1U A;  1TK5 A;  4KV8 A;  3UPF A;  3PR5 B;  3DHX A;  2CPZ A;  2ZOG A;  2VFR A;  4M5G A;  1VBZ A;  3K5L A;  5DGA A;  2YX1 A;  1PYS B;  3HHL A;  2DBB A;  5GAE I;  4ALZ A;  5DM6 Q;  1PYO B;  4QIW D;  4M5I A;  5A8K B;  1HQU B;  4ZVS B;  3ITH A;  3GIR A;  1RLC L;  1RWX B;  2R7O A;  3NS7 B;  5THW A;  1U09 A;  4ETX A;  2GVD B;  3HUL A;  3ZZR A;  4G1I A;  1HR0 J;  5KG1 A;  1G6B A;  1LW0 A;  3DLJ A;  1EIY B;  2ZE2 A;  4JYA J;  4E0D A;  3JQJ A;  4J9O A;  4H54 A;  4DJB A;  4A8F A;  1GMV A;  1JLQ B;  1ZH5 A;  1N5T A;  1U8S A;  2W1B A;  1OSC A;  2W4C A;  3V6D B;  5B0A A;  1T05 B;  1EHW A;  3W8P A;  2BJD A;  1KSP A;  2OIH A;  1NJI T;  2I5J A;  4CCH A;  3AJD A;  1F3F A;  2VFV A;  3DMJ B;  1HWU A;  3BGU A;  4JOU A;  3AD7 C;  5GAE U;  2D3O R;  2ROE A;  2WBR A;  2HIY A;  1RHK B;  3MUV P;  4NLY A;  2D41 A;  3J80 U;  3JSB A;  3KKF A;  2KKH A;  5ETO A;  1HHQ A;  2B4V A;  1QVF R;  2B9E A;  2LLZ A;  2IBO A;  3TO8 A;  2ABY A;  4KTQ A;  5BJR A;  3W2V A;  4CLS A;  3T1H F;  2OPR B;  2CYY A;  4JV0 A;  2JZ5 A;  1Y7P A;  1CJK A;  1XMQ F;  2RH3 A;  1SQF A;  4UOH A;  1X4E A;  5IWA F;  1Y4Z B;  2E7W A;  3D3B J;  3BSN A;  4B3S F;  3H40 A;  1HHS A;  4QU6 A;  3LGM A;  1D0E A;  3CJK B;  2JEI A;  4IFV A;  3JSY A;  1N5Q A;  3RUB L;  4MKA A;  1REG X;  2HVE A;  1PC4 A;  4JB8 B;  5HQ8 A;  1TVR B;  4UY8 T;  3J7Z 5;  4OJH A;  4WYL A;  3EUN A;  2OHD A;  3I32 A;  4U8V A;  4CLY A;  1X4B A;  2FJB B;  2EK1 A;  2AEF A;  4ZP9 A;  3W9I A;  4ZLL A;  1JLF B;  5L9X A;  2IAJ A;  2HGL A;  4KAI A;  3HHL C;  1KBR A;  2V0N A;  3KHG A;  1WEZ A;  4FN5 A;  1CQN A;  3BH7 B;  4MIW A;  1X9W A;  4CM0 A;  2RQM A;  4DR7 F;  4N47 A;  2JOQ A;  1OQ3 A;  3K89 A;  2MZR A;  4ZDN A;  1XN9 A;  2PE8 A;  2KYX A;  3QZ8 A;  1B4S A;  4O4G A;  2H51 B;  2LXU A;  2PA8 D;  2AGP A;  2MHE A;  2V8P A;  4RU9 A;  3LPE A;  5M2P A;  3H8Y A;  1HQU A;  3QT6 A;  1JQG A;  3DLE A;  1Z1Z A;  6AT1 B;  2FJA B;  3QWU A;  1OQ6 A;  4KBI A;  2QC3 A;  2E5L J;  3QT7 A;  2HND A;  3VGS A;  3H0P A;  3A8I A;  1RT4 A;  3S6E A;  4W4M A;  1U1O A;  3VGT A;  1Q8L A;  2H5I B;  2LDI A;  1B99 A;  1N36 F;  2OPP B;  3KJF B;  2L41 A;  1KD1 T;  2MB0 B;  1RAF B;  3EMT A;  3TWZ A;  2ZHB A;  1XC9 A;  4DV4 J;  2KVI A;  1WDT A;  4F0M A;  2MKK A;  1DLO A;  4ETZ A;  3OHB A;  1XMB A;  3HPO A;  2IJR A;  2K3K A;  4QR1 A;  4OZ1 A;  2ZHA A;  3O8W A;  4NLW A;  3TJ8 A;  3D3C J;  2K3I A;  4WP3 A;  3KLG B;  3IRX A;  4MJK A;  4ZPB A;  2JEG A;  1R7I A;  1S6P B;  2QV6 A;  4KY3 A;  1D3W A;  1JLG A;  3UR3 C;  3GIJ A;  2RS8 A;  1P1T A;  1T9Y A;  2RDD A;  1YG0 A;  4DV2 J;  4RKU C;  4A8S A;  4EUV A;  4LR8 A;  1NZA A;  3UN3 A;  2QL7 B;  1EP4 A;  2BKN A;  3IS9 B;  3BGO P;  3OFE A;  4NWB A;  2R8H A;  3H5U A;  4B3R J;  3QAU A;  1NK5 A;  2HHU A;  4G1Q A;  1S9E B;  1TK0 A;  3BDP A;  4X64 F;  3RU0 A;  1T9X A;  3MED A;  1F1B B;  3IWN C;  2CNN B;  3BR8 A;  4D3G A;  4DN9 A;  3LAK A;  4F7V A;  3PKY A;  2RD5 C;  2LXF A;  3PRB A;  2V6A A;  5ETR A;  3S01 A;  3CCM S;  1VFJ A;  1CC8 A;  1FA0 A;  1URR A;  4OL8 A;  1C4A A;  3UWT A;  3CJK A;  3O2I A;  1MNE A;  2AGO A;  1VBY A;  3HJV A;  1T9T A;  2RQ4 A;  4MFB B;  2IBK A;  1HL6 A;  1R8H A;  1RT7 B;  3IAS 9;  3I9Z A;  2QTW A;  1B7Y B;  1KR4 A;  2ZNZ A;  3L09 A;  4DR2 F;  5DM7 Q;  3QGH A;  1DTT B;  1T7P A;  4X4T A;  1TL3 B;  3OUY B;  1JLF A;  5BYS A;  2R4F A;  2AJ2 A;  2MQQ A;  3KTQ A;  4IR1 A;  1HMV B;  4Z2X A;  3HT0 A;  4OYB A;  4AXI A;  1S79 A;  2QYC A;  4LF6 J;  1WWH A;  1MU2 B;  5D8H B;  5IV3 A;  3MR5 A;  5HQL A;  2VOO A;  3GG1 A;  4DSL A;  4ZCI A;  2FGO A;  4IRC A;  2JSX A;  4PG4 A;  3NMA A;  4K0K F;  3PVX A;  2CXE A;  3BEG B;  3QRP A;  1A9N B;  1HBN B;  3NL0 A;  4OQJ A;  3OVB A;  2VKZ G;  2YKN B;  4CT8 A;  3VAI A;  4NI2 B;  4ED3 A;  3QFH A;  2VC0 A;  2HG4 A;  2EW9 A;  2HGM A;  1SKU B;  1LW2 B;  4DL7 A;  2QA4 S;  1X9M A;  1FJG F;  3K5N A;  4NXN F;  5J2M B;  3Q8V A;  1YJW S;  4ES2 A;  1JXV A;  4PQA A;  3MPD A;  2O1P A;  2OI2 A;  3VAM A;  4AQY F;  3OTC A;  1RTJ B;  2Z4P A;  2OD6 A;  1FRI A;  3OJU A;  1I94 J;  4LSL A;  2L9N A;  1Z2Z A;  3N6M A;  4O3N A;  2KZZ A;  4PCQ A;  5EWE A;  3J80 Y;  2HW3 A;  3M8Z A;  2R2T A;  4F2R A;  4ITS A;  1LWF B;  5DG8 A;  5LSR A;  3G86 A;  4A46 A;  3WHI A;  2UXC F;  2CNO B;  4KGZ B;  2AD9 A;  3HZE A;  1LWX A;  1C1C B;  3TZZ A;  4TQS A;  1VQP S;  1UZD A;  3SXL A;  2QMU B;  2I0X A;  3GYN A;  2WW4 A;  3DFE A;  1X4H A;  3CCS S;  4DR4 J;  5KOX A;  4NLO A;  3DOM A;  2MLZ A;  2R2S A;  4I7F B;  4AFF A;  4DPW A;  2HVZ A;  4A8W A;  4QR0 A;  4BHQ A;  2FGC A;  4N8N A;  1S9E A;  1TL1 B;  2OAU A;  1RWK B;  5CXT A;  1PJ6 A;  4FXD A;  4JI4 F;  1URN A;  4JI7 J;  4J9M A;  2CQP A;  2PEB A;  2J9E A;  2UVU A;  4UZB A;  1NK6 A;  2M8D B;  2C42 A;  2HHV A;  1U7L A;  3QO9 B;  2G2Y A;  3CJ8 A;  5KFH A;  1U2F A;  2F4F A;  1IR2 A;  1M5P C;  1OS5 A;  1RT7 A;  1N34 J;  1T94 A;  3GIK A;  4CLL A;  2Z56 B;  1R6Y A;  1DTT A;  5GMK a;  2XQC A;  2WVD A;  2QA4 G;  1TL3 A;  1WDD A;  3LA0 A;  5KAK A;  2IVM A;  5J2Q A;  3KK2 A;  1LKZ A;  1HMV A;  6FD1 A;  2FVC A;  2B4U A;  1H2T Z;  4NXM J;  4R0E A;  1TFW A;  4YN3 B;  1O0P A;  1JLB B;  5LXY A;  3PHT A;  3HMJ G;  2Y1R I;  4NEY A;  4ZVG A;  4YP3 A;  1DAR A;  1FEH A;  4PXD A;  5LM7 E;  4OJG A;  4KR0 B;  3M2V B;  5D78 A;  1WC0 A;  2YKN A;  3UDV A;  2RDJ A;  4NI2 A;  1D8Z A;  3J81 Y;  4I1T A;  4PG8 A;  1LW2 A;  3VHQ A;  4OX8 A;  1KFD A;  2H54 B;  1TQL A;  5EX0 A;  4KHR A;  1NJW A;  1GK8 A;  4C7Q A;  2J7K A;  3VV2 B;  4RUA A;  5IQ6 A;  2NSC A;  2WZ1 A;  4B02 A;  3FCV A;  5A8W B;  1RLD A;  5F8M A;  4CNY A;  2XUL A;  3JAM Y;  3GFY A;  4K4U A;  3OLA A;  3UD3 P;  3Q0A A;  4FYW B;  1NKC A;  2HRY A;  3R97 A;  1NAQ A;  2RB7 A;  4A47 A;  3SSQ A;  1BQN B;  2FC9 A;  2MZJ A;  2R8J A;  2KG0 A;  1VQ5 S;  1RU2 A;  1S1T B;  7FDR A;  2F40 A;  3G87 A;  1SJF A;  3MAA B;  3AB2 B;  1OSD A;  3M8P B;  1RT5 A;  1ZM3 A;  1X4A A;  1UP1 A;  1IQZ A;  2OEL A;  1FJC A;  3BSC A;  4F3Q A;  4ZCL A;  4OZ3 A;  2E66 A;  1JLE B;  3ZC4 A;  2MQL A;  2XS7 A;  1QDU B;  4DU7 A;  4U8Y A;  3ZZY A;  1KQF B;  2O01 C;  3JTN A;  4ED4 A;  4J37 A;  4I2P A;  3VAJ A;  2OSR A;  2V2K A;  5KT5 A;  1XQI A;  3DU6 A;  2QIF A;  1Z2L A;  4UZC A;  4YEA A;  4Q7A A;  5F9N A;  3H2V E;  1WI6 A;  2CWX A;  4JP8 A;  4WU3 A;  3QO9 A;  3OTB A;  5DQH A;  1WG1 A;  2VDI A;  3LQV A;  4WCE Q;  1HYS B;  1YJT A;  1YQH A;  1UET A;  2CPJ A;  2RIL A;  1YWX A;  4OI1 A;  4PKD B;  4ES1 A;  1WOR A;  3KLE A;  3OL8 A;  3MMA B;  4XPC A;  2IYG A;  3NS6 A;  2HEK A;  4J9L A;  1XNR J;  2B7B B;  3BSA A;  1UJ6 A;  3OFF A;  1WTB A;  4MKV A;  2CQ1 A;  3OR1 A;  3ZZT A;  4EEY A;  3UO0 A;  4Q45 A;  2RRB A;  4TU7 A;  1YJR A;  3G82 A;  4DR6 F;  3FC9 A;  2HKE A;  4C8Y A;  2GO9 A;  3M2V A;  4DMZ A;  2XGQ A;  2XTJ P;  4UTG A;  3DOL B;  4P72 A;  2IJF A;  3CJR A;  4HYK A;  4USU A;  3HFV A;  3WIU A;  4H4K A;  4DSK A;  1N54 B;  2XYG B;  1H98 A;  2G1H A;  1VQ8 S;  3VAH A;  1RZM A;  3IGV A;  2EG1 A;  3BN4 A;  4QYR A;  3MM6 B;  4HEA 9;  3E3X A;  4RX6 A;  1PGZ A;  4ED7 A;  1L3T A;  2QYG A;  1XMO F;  3CXC R;  1M1K T;  1AZS B;  1QAX A;  2CJK A;  3JS9 A;  3K0J A;  3HZG A;  5A8W A;  2LXI A;  4LBP A;  3MGJ A;  3B78 A;  2AQ4 A;  3MOZ A;  3VZI A;  3KMQ A;  1T0T V;  2VPY B;  3BJY A;  1H2U X;  2MGZ B;  4NLU A;  3BPS P;  4RNF A;  3M32 B;  1U4B A;  3J7A N;  3V2U C;  4IO9 Q;  4ICL B;  3RR7 A;  1IN0 A;  2NRE A;  1CBK A;  3M8P A;  2BMB A;  3W2W B;  2RT3 A;  4HDG A;  3LP0 B;  1JXE A;  3U7J A;  2BYC A;  1JLE A;  4S0M A;  3P6Y C;  3IGN A;  5LJ3 Y;  3R7B B;  5GVQ A;  1J5E F;  5LXR A;  4ZPV R;  1F60 B;  4QYZ J;  5DDQ C;  2MMY A;  1XTZ A;  2LQB A;  4LRE A;  4EO6 A;  2E1P A;  2UVV A;  3I0S B;  4DV0 J;  5ETP A;  4DR1 F;  3ENA A;  4Y6I A;  3RW6 A;  3GTY X;  1YX2 A;  2HQF A;  4BC9 A;  2C3U A;  4GKJ F;  5CD4 A;  4LSN B;  1LXN A;  5F8I A;  2YH1 A;  1C4C A;  3FFI B;  3J7Z T;  3HJF A;  2RF2 B;  1TTH B;  4CLF A;  1RWP B;  5HL7 Q;  1FDA A;  1BUX A;  1DTQ B;  3TR5 A;  2WK4 A;  1NZ8 A;  3MMA A;  3ET6 B;  1W26 A;  4YUD A;  3G71 S;  1FVS A;  3K5P A;  1FNM A;  4WK1 A;  1SUQ A;  1NDL A;  4QOT A;  1QSS A;  3R6L B;  3K5O A;  1G2E A;  5BR8 F;  1HNZ J;  3AA9 A;  2AU0 A;  4Y65 A;  4KGV B;  2PMH A;  2ERR A;  4PG5 A;  3NAH A;  9ATC B;  4F4W A;  2IRY A;  4KH1 B; 
#chains in the Genus database with same CATH homology
 2HBQ B;  5IC4 B;  1NME B;  1RHK B;  3GJR B;  2XZD B;  5K20 B;  3SIP B;  2XYP B;  2Y0B B;  2C2M B;  1RHJ B;  2P2C B;  1RHM B;  3KJQ B;  2QL5 B;  2H48 B;  4LSZ B;  1RHQ B;  1PYO B;  3QNW B;  2C2K B;  2CNO B;  4ZVS B;  1SC4 B;  3GJQ B;  3RJM B;  1RWX B;  3GJT B;  2QL7 B;  2HBY B;  3NS7 B;  2H51 B;  3R5J B;  2XYH B;  2H4W B;  4ZVT B;  4DCO B;  2HBR B;  3R7N B;  2CDR B;  1RE1 B;  1SC1 B;  3GJS B;  3R6G B;  1F9E B;  3P4U B;  2QL9 B;  1BMQ B;  1RWP B;  1PAU B;  1RWN B;  1RHU B;  2CJX B;  2CNK B;  2QLF B;  1ICE B;  2H4Y B;  5IC6 B;  2H65 B;  2CNN B;  3IBF B;  1RWO B;  3P45 B;  2C2Z B;  2QLJ B;  1I51 B;  1RWV B;  4ZVQ B;  3D6F B;  3EDR B;  2DKO B;  1GFW B;  2FQQ B;  1I3O B;  4DCJ B;  2CJY B;  1RWK B;  1QDU B;  4JB8 B;  2Y1L B;  4DCP B;  2H5I B;  2QLB B;  3D6H B;  3R6L B;  2H5J B;  2HBZ B;  1RHR B;  1IBC B;  3KJF B;  1SC3 B;  2XYG B;  2XZT B;  3EDQ B;  4ZVR B;  3R7B B;  3KJN B;  2CNL B;  3IBC B;  1RWM B;  3D6M B;  2C2O B;  4ZVU B;  3R7S B;  4ZVO B;  4ZVP B;  1QTN B;  1RWW B;  2H54 B;  2C1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...