4OJGA

The crystal structure of v84d mutant of s. solfataricus acylphosphatase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
EMLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKDDYSFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 23
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ojgA00
3FMBA 4DPOA 2W4DA 5A6WA 3HFKA 2XMUA 2AW0A 2GGPA 4HI1A 1GXTA 1SQEA 1JK9B 2XMKA 2AJ1A 1TL5A 1CPZA 3MCSA 3BN7A 4OJ1A 3KNGA 1YG0A 2LXFA 4A48A 5KAKA 5B0BA 1FVQA 1KVJA 1Y3KA 1ULRA 2BJEA 2RSQA 2BBEA 2ROPA 4A47A 1YJRA 1X7VA 2FB0A 2K1RB 4QOTA 4DN9A 1QUPA 4Y2MA 3TNVA 2HLTA 3FRYA 3CJKA 4EFAC 2ROGA 4NPOA 4YDXA 4OJHA 1X8DA 2ZDPA 1KQKA 5B0FA 3BM7A 1CC7A 1AFIA 1OQ6A 4OJ3A 2QYCA 2QIFA 3BF4A 1VQSA 2VV5A 2VH7A 3LGNA 2XMWA 5T7LA 2QLWA 1GXUA 3KG1A 4A46A 1R6YA 2OD4A 2W4CA 5B0GA 1VQYA 2BYCA 3BDEA 2XMMA 4Q2MA 5B0CA 2FIUA 1N5TA 3K7RA 2KT3A 3TOQA 5B09A 1CC8A 2AP6A 3HF5A 2XMJA 1MWYA 1Q53A 4HL9A 4Q2LA 3T9NA 4FNHA 2Q3PA 4U9RA 1XBWA 1N5QA 2FHMA 3HHLB 2K7JA 1Q4RA 1W2IA 2HQIA 1YJVA 2FTRA 4F67A 2N7YA 1V3ZA 1YJUA 2GA7A 2GV1A 2LQBA 2ZDOA 2IYIA 3LGMA 4ZA1A 4Y2KA 1WD6A 5B0EA 1SB6A 2G9OA 2OKQA 2KKHA 2PD1A 4HH0A 1X0PA 4OIXA 1MWZA 2HLUA 2ROEA 4OJGA 3MZIA 1IUJA 3DXSX 2GGPB 1OQ3A 2LDIA 3LO3A 1TZ0A 2OFGX 1URRA 2PGCA 5B0AA 2CRLA 2OMOA 1APSA 2QLXA 1N5VA 2K1RA 2EW9A 1S6OA 3BR8A 3FGVA 3KG0A 2HFNA 2GFFA 1U7LA 2XMTA 1AW0A 4FNIA 3CJKB 1P8GA 3TRGA 5IXUA 1AFJA 3HHLD 5B08A 2XMVA 2RU9A 4HH1A 2HFOA 2W4PA 1FEEA 1Y0HA 2N4DA 1Q8LA 2JDJA 3F44A 4ZOSA 5T7LB 1YRXA 2IYGA 3HDSA 2RILA 1FD8A 1SI9A 2OP5A 4NL5A 1K0VA 2LQ9A 1TUVA 2OD6A 5A6PA 1LQ9A 3QMQA 2KYZA 2IFXA 3IWXA 1RJJA 1N5SA 1TL4A 4YEAA 1OSDA 2KT2A 1FE4A 2BUNA 3VTIA 1S6UA 3DCAA 3HHLA 2BJDA 1KVIA 1Y3JA 1YJTA 3BB5A 2K2PA 2N4CA 3E8OA 3GZ7A 5B0DA 5F0WA 3BGUA 4DL0C 3KKFA 1FE0A 3WDOA 4A4JA 1TR0A 3QGPA 3I9ZA 2HIQA 1OPZA 1Y9OA 2RMLA 2K7KA 5K9FA 2ACYA 2AJ0A 2GO8A 1FVSA 3UDCA 1Q8BA 1JWWA 2GCFA 2L3MA 1P6TA 1FESA 2OAUA 2OFHX 3HHLC 3IWLA 4HI2A 2ASYA 4Y2IA 5F0UA 3HX9A
chains in the Genus database with same CATH superfamily
4UY85 2D9OA 5LOQA 1JLQA 2HHHF 2UVUA 2MYFA 4RW8A 5AXLA 1UEUA 3BO3A 3NCRA 2ILZA 3Q0AA 5DQIA 4J9SA 5CH7B 1SQFA 5L46A 4AL6A 3HD2A 3W8PA 4NEZA 4JI3F 1MROA 1PGZA 3MMBB 1VQYA 4IG3A 2HW3A 4QZVB 1JLFA 1TV6A 3FQKA 4G1QB 1TMMA 1H73A 3DOLA 3HHLB 2MQQA 4CO0A 1ZTWA 3M8WA 4USTA 3TZWA 4ECWA 2FLOA 4KFBA 2JOQA 3V4IB 1SPBP 1SIZA 3CJRA 3VAKA 2CIMA 4E0DA 3AD7C 3MCOA 2A6OA 4EEYA 1VCTA 1U48A 3FFIB 3M8SA 2HQDA 1Y5NB 2MY8A 3TAQA 3J81Y 1L3VA 3OT9A 4TY9A 3LP1B 1B7FA 3R7SB 4CO4A 1D0EA 4URQU 4GRSA 4X64J 3M2UB 4EMDA 2CPEA 4CNYA 4KHPF 3AXKA 4PR6A 3UI3A 5F8HA 3QZ7A 5HAOA 3EZOA 3I31A 1G4CA 4QQBA 1TL5A 2KZMA 4ZVPB 5F8MA 1TAUA 1WELA 3PFOA 2ZITA 1HR0F 2RQCA 1KDNA 4X84A 4LBHA 3QT7A 2UUCF 4OYPA 2GHVC 4PG6A 1JJHA 1LFPA 4Z7YA 2GV1A 1YBTA 2LXUA 2V6AA 3K57A 4JV2A 2QA4S 4DV5J 4EU0A 3KK3A 3GG1A 2HHXA 4DOZA 4C3KA 2EKNA 3DOKB 2NXUA 1U1NA 1T8EA 1RE1B 1LWEA 5EDWA 4OYMA 4A8WA 1X9WA 1T7PA 1WACA 1S72S 3F44A 2I2YA 4LSLB 2J9DE 3I5AA 1PILA 1IKXA 2FY1A 1C4AA 2BUNA 5KFOA 2UVRA 3PIPQ 2FQQB 4J9RA 3KMQA 1T3NA 3IRWP 2APOA 2ZBRA 3OTEA 3SIPB 4DX7A 1Y11A 2XWYA 3L95X 1S76D 1C0TA 2ZH9A 1S59A 4DR5J 3BGOP 4MK9A 2YNFA 4NLVA 2DRDA 5LJ5Y 3OHAA 3H2VE 2KG0A 2YKPA 3JTOA 2BANA 3ZTSA 1Q82T 2HMIA 1IKWA 2VUGA 3NXZA 3MCMA 4KKOB 2VIHA 4NXMJ 4OZ1A 4JI2J 6AT1B 3SV4A 1NPKA 4F3QA 2XCAA 2F8HA 2VQEJ 1FJGJ 4RLEA 1JLQB 2AJFE 4RW8B 3UWTA 2XO7A 3CIMA 2DNPA 3ETOA 4F4AA 4Y0FA 3E3XA 3FJ2A 4HHHA 3MTKA 4UY8T 3HDSA 3OW2R 1MROB 2AIRB 5U47A 4IG3B 4JV1A 3Q86A 1JLFB 3T1AA 1U6ZA 3DOLB 2XS7A 1RGVA 1RAGB 2ZH3A 4USWA 2B9YA 2E7VA 3UDCA 3DLKA 4EYIB 5LL6d 3KLGB 1SJRA 3CGIA 4KFBB 4IYQA 1B0VA 3J7YI 4ZN1A 2ZBCA 4DU8A 3N6NA 4A47A 4TKTA 4HTJA 3FRYA 3JSBA 3DU5A 1IBLJ 2VC0A 2HVZA 3PV8A 3ET6A 4RUHA 3TAPA 3HD1A 1R7IA 3K17A 1R0BG 3WQPA 2XMJA 1NZ8A 2DHSA 2RRBA 2UXBJ 4KPYA 4ZCKA 3PR5B 1F5AA 4CO2A 4DPWA 4JI7J 2KVIA 4LVOP 2HS0A 3RGIA 4DL2A 1KTQA 3F41A 1UFLA 3H4BA 1N36J 4UF4A 1SIWB 1TKTA 1NJWA 1IR2A 3IMQJ 3OLBA 5GMDA 3QNWB 2RILA 4PWWA 1BWEA 3BDPA 4AXIA 4XK8C 1OJ4A 1Q95G 2H4WB 1F1BB 2LKZA 4NMXA 3NCPA 3L09A 3KK3B 1UVLA 2P6TA 2MQOA 5B7WA 2DEIA 4C8ZA 1SKWA 2IHR1 1JLCA 4CT8A 1NDPA 1LWEB 2Q43A 1NKEA 1IKXB 2HRUA 2R2RA 4XPEA 5IM0A 4NCBA 1VISA 2VG7A 1RAFB 4LJMA 4OX9J 1ZAVA 3EDQB 4ES1A 1I51B 2HZCA 2CPDA 1U25A 1KNZA 4YS2A 1N5VA 1N54B 3JQJA 4WXWA 3KDNA 2WVCA 4M5DA 3RAQA 2OIHA 1S77D 2YNFB 3B4DA 5A8KA 3TW0A 4HDGA 4UT4A 3J81U 2AHOB 2BANB 2VFUA 3MPYA 1TKZA 1RJJA 4DL4A 4I67A 3C6UA 2HMIB 2VBYA 1FWLA 1IKWB 1TVRA 2B0GA 2IBOA 2N4CA 1YRUA 3RRKA 5M2RA 3WDOA 3NWGA 4A8XA 3PKMA 1T9UA 2EKYA 4J9NA 1IXKA 5IC6B 2JLFA 2IJNA 2UV8A 3QWPA 3GV8B 4X64F 3LP0A 3L7UA 4M5NA 1ZZFA 3BBFA 4PYDA 3J7Z5 4CP5A 3RYLA 1MMLA 2U1AA 1HBMA 2FZKB 2HNYA 4ECZA 2V5HG 3OTOJ 2BJ8A 2RS8A 1XMOJ 3DLKB 1NK9A 3CD5A 3N28A 3BO4A 2LU2A 2RF2A 4R25A 4ZCLA 4F0KA 4WZQA 4DUTA 5KFZA 2W4PA 4M5LA 4DV5F 2BKPA 4I7FB 2HBRB 3ET6B 1YZ7A 2FC8A 4O3RA 1Z4UA 2Z8QA 2V2VA 5FJ4A 3D7SB 2P6SA 3OSNA 2CPZA 1XMQJ 1VGYA 4ZJQA 1RWWB 1NSKL 4P74A 3NGTA 4X65J 2RVJA 1RTZA 2JHEA 4J90A 4CO3A 3TNVA 2L08A 2L41A 1NAQA 2IM1A 1TKTB 2QYCA 4CH0S 3RUBL 3RBDA 2JH3A 1U1QA 2ZH7A 3WHIA 2BQ3A 3FCVA 4G65A 3M32A 1N5TA 2O01C 4YR3A 1CBKA 4DR5F 5JVHQ 3R97A 3FNNA 3OR2A 1FERA 2RDJA 1ZAWA 1QM9A 4DV0J 5KFLA 2PMHA 2KJVA 5DLFA 4NLWA 5D4LA 1RHUB 1RT5A 5KFCA 3AJ1A 4NXMF 4GC7A 4DSLA 4OV1A 5LSOA 4JI2F 1JLCB 4R8UA 2VQEF 3LF0A 1FJGF 2Z2MA 2GVZA 2ZBPA 3I32A 2MZSA 4IRCA 5IM0B 2W7PA 2VG7B 2M0GB 1JLBA 2DISA 3BQ2A 4DR7J 1RCOB 4FXWA 2MJUA 1N32J 2CQDA 4DJBA 2IIHA 2AJ2A 2DBBA 4DPUA 1XJWB 3CDEA 5C42A 3GYXB 1Q8IA 1U1MA 4K4VA 4ELTA 4M5DB 2RKIA 2QG9B 4X62J 3MFIA 1TKZB 1KEKA 3H5XA 3C6UB 2Z2ZA 5E3CA 1IBLF 1TVRB 1YJVA 2GA7A 4I0WA 1SJ4P 1GK8A 4W92B 1DTTA 3M1VA 3ZTRA 3W1YC 2E9ZA 4ZP7A 1MWZA 1YWXA 3Q22A 1S4EA 1APSA 3LP0B 3KG0A 2FHOB 3PM9A 4JI7F 3MUTP 1G3OA 2M3DA 2GQCA 1SI9A 1IBMJ 2XZDB 1S12A 1N36F 2R7TA 1L3UA 3R8YA 2Z30B 1HBMB 2DNRA 1FJ7A 4U8YA 4I6YA 3J7ZT 3BR9A 2HNYB 2NUUG 3BGLA 2X51A 4LF6J 3QT6A 2DT9A 4P9SA 5E41A 3EZ5A 2AJ1A 3M8ZA 2GNKA 2RF2B 1TTHB 4P71A 2ALZA 4UOFA 1HL6A 2XC9A 5IT4A 5B0GA 5KT3A 3FRZA 2CWKA 3WIUA 5HL7Q 4Q2LA 3P3DA 1WC5A 2C1EB 5C24A 4HH0A 2L9WA 1X0PA 4MKVA 3LO3A 3PDNA 4OX9F 4DR3J 1LWCA 4PCQA 3UCGA 1L3SA 4L72B 4F2SA 5KFSA 3K5NA 2R9LA 2HQ3A 1R6VA 3KK1A 2DGSA 1LQ9A 4DN0A 3RAXA 3HKWA 3M32B 3M2VA 1TK0A 3GIRA 1U2FA 2AEMA 3OR2B 4YP3A 4HYKA 1GTHA 4J9VA 3PFEA 2HS4A 1FEHA 3ADAC 3IM9A 4E2FB 2HRYA 2UXDJ 1RT5B 4NLGA 2GS8A 5D3GA 4R8UB 1KQKA 3PHTA 4QJVA 3T6BA 3R6GB 4PG4A 3CJSA 2GVZB 4NMLA 5BXIA 4DFKA 2GHPA 2DITA 3BO2A 2IRUA 2YTCA 4NXNJ 1JLBB 2MLYA 1RISA 2KVQE 4W90B 1WHXA 4K7QA 1IQZA 4TY8A 2DNGA 1X31C 1S7IA 1PIEA 2QLXA 3SEOA 5C42B 2HKEA 1UTAA 2YPZA 1S6OA 4K4XA 1AA1B 1X4FA 2DCUB 3OTOF 1XMOF 4CNZA 4OHVA 1Q8LA 2W2OP 4ILMA 1BUXA 2RKIB 1UA1A 2LQ9A 5LMUJ 3TVZA 4ED1A 2A0FB 1KP6A 3HZEA 2YWEA 5HVFA 2K2PA 2OTLS 4RX6A 4UZCA 1EB0A 4DMZA 4F4KA 1DTTB 1NEEA 3M1VB 2OAUA 2DH7A 4GMKA 5HMWA 2X1AA 4YQWA 3EZUA 1LKZA 2CYYA 2AYMA 2FUG9 4C0BA 6FDRA 2Y8YA 2Y9HA 3P5BP 3I0SA 1XMQF 2CG4A 4WU2A 2YH1A 2KO1A 5DLGA 3D6MB 5KFHA 2XGPA 1DJ0A 4X65F 2LMIA 5LXRA 1QVGR 3AA9A 2D3OR 1BQXA 2EC0A 1CJTA 5K8MA 2VOPA 3WC2A 1IJEB 5J2QA 4NYZA 3HCXA 1YBUA 4DV0F 1G2EA 4Q44A 1XTZA 1RT4A 4PG8A 2HURA 3U7JA 4FYDA 1Q7YT 4JP8A 4OYOA 1N52B 3CUNA 3VR1A 1HKAA 2VBZA 3CJ0A 4FF4A 3RBEA 1FTCA 3I9ZA 4M5HA 2AJ0A 5C24B 3IBCB 3JSMA 2ZD1A 2FGOA 1RWPB 1IWAA 2Z4PA 2QN6B 1GEHA 4DI6A 2B5JA 3MEGA 4FKYA 4DR7F 2E1CA 1LWCB 1N32F 4RO0A 1X4AA 2LP4A 3H25A 3H5SA 4QWCA 3KK1B 1RHMB 4QIEA 3Q8YA 2LEPA 4R5PA 1M5HA 3M2VB 1YKWA 2CXEA 2KU7A 3RBZA 1FRLA 2GQQA 2VONA 1T03A 5B0EA 3P4UB 4KGVB 2YKAA 4CLFA 3OD2A 4OI3A 3VAIA 4RBUA 4BCAA 1FRKA 4DX5A 5D3GB 1MW7A 3UNYA 2XMTA 2DR7A 2COLA 1MSWD 4OYIA 1CLFA 1W2BR 4B02A 1NDLA 4F36A 2LQ5A 5J1PA 1KONA 4QIVA 1U6FA 5MAOA 2MZTA 1K0TA 3KOAA 2CQ3A 4EO6A 3M8PA 2ACYA 1IBMF 3F73A 4P72A 4OLPA 4TY8B 4NA1A 2IBKA 5ETOA 4ZPAA 3QAEA 3NGKA 1QAYA 1S1VA 1OWXA 4ECUA 2R7UA 3NS5A 3HM9A 3GFZA 4LF6F 1U02A 1SKUB 1JXLA 2RAQA 3MFHA 2XSFA 4DCJB 1WC0A 4DUYJ 4WBFA 4KC5A 2WVEA 5DDQC 2FTRA 3UDLA 3M9NB 4JB8B 3VAHA 2NSBA 3BPDA 3V5RA 3RAMA 4ZCIA 3D6FB 4NWBA 2YKOA 3I0SB 4ER8A 4N56A 4KR0B 1RZMA 3Q89A 4DR3F 2Q6BA 1RB0A 2CJBA 3AB4B 1NLKL 3PJXA 3FBBA 2AX0A 1CJTB 4A4JA 2HZVA 1RSCA 3X3UA 2L3MA 4Y2IA 2CQBA 3RBXA 5J2QB 4RUBA 2PMWA 3KMSA 4U7UK 4I69A 2BJ1A 1U47A 4I64A 2YNHA 3OVSA 3HT3A 4Y34A 1BY9A 4NLDA 1RT4B 2UXDF 4RJVA 3KLFA 5A0YA 3ZZRA 5KFFA 4ZPWR 5B09A 1H2VZ 2XYGB 1XNQJ 3MPWA 3SZ2A 5D4OA 3MOZA 2GZOA 2V8VA 4PZVA 2Z2YB 3S01A 3VGUA 4Y2KA 4ZLPA 4X2BA 1KFSA 4EO8A 1ZS6A 3H2UB 3JSMB 2ZD1B 2J6TA 1NU4A 2HNZA 1DQ9A 2UUTA 5HQMA 4NXNF 3MEGB 4IO9Q 4ENOA 2XNQA 1FK9B 3G87A 4IKAA 3EGNA 2HBZB 1I1GA 2JRSA 1GX5A 2E7XA 2CQCA 2RNEA 5A6PA 3MEKA 4F4XA 4X4RA 3UDEA 4R5PB 2J76E 2MKHA 4CTAA 4FYYB 1TK8A 2LXIA 2V67A 1T03B 2YX4A 1RADB 1UEVA 1M90T 2XYPB 3A3NB 5LMUF 2ZNZA 5H9EK 3UNGC 1GXLA 5HMXA 1DZ5A 2VB6A 3CCES 4I6WA 2Y8WA 4MJKA 2BKOA 3H90A 3ONQA 3GTYX 1Y4ZB 1F9HA 1OQ6A 2MQNA 2KRBA 4JI6J 2ADBA 1R6YA 4U67Q 3T5HA 4GVBA 1WWHA 3MURP 2OH2A 4FXDA 3C16A 2CZ9A 4B9UA 1V3ZA 2ZDOA 2IYIA 2M70A 5K8OA 4J9UE 3M8PB 2ZVIA 1UWBA 1RAAB 3CWJA 3AD9C 4Q8FA 2R7SA 4C0HA 1XMBA 1XEZA 1S1VB 1YITS 3AQPA 3KHRA 3CMAS 4DWIA 2AX1A 2HPUA 3S8SA 3NGRA 4PAAA 1RP5A 4ERDA 2ATLA 4DPYA 2G13A 2MZRA 1C1BA 4B08A 3GCXP 3NKYA 1FVSA 2MY7A 4FBTA 2CQ4A 3QJLA 3VAJA 3QRQA 1WDTA 5ETTA 3TO8A 1VIXA 4N5SA 1GXUA 4NLOA 1KTVA 5FDLA 2FD2A 4P7TA 4KGKA 4DV3J 3PRBA 3C19A 4DR4J 1SJFA 1VC5A 1BE4A 2AJQA 4DR2J 4OHZA 1I3OB 4UQGA 1OMSA 2GW8A 3DLHA 4LFAJ 4ANDA 2YNHB 4C9DA 1N88A 2QV6A 3KHLA 3NOGA 3KLFB 5A0YB 2X1FA 2KYZA 4DV1J 4ELVA 2Z58B 4IFYA 3G9CA 2AD9A 2BMBA 3D1HA 2IAJA 4LF2A 1U1PA 3QGGA 3EXYA 4C6AA 5KT7A 2ZHOA 3M6XA 2RQMA 2H4YB 1L5UA 5ETRA 2ZOMA 1WDDA 3HFKA 2FC9A 4KT0C 2HNZB 4DQRA 3L4BC 4LIRA 1FVQA 1S0MA 5I4MA 1J2VA 4YDXA 3BM7A 2F4VJ 1RHRB 5E3QA 2W7OA 2KT5A 3B4MA 3TEGA 4Q2MA 1F5CA 2B8PA 3D67A 1WI8A 4B3TJ 4CTAB 3AXMA 5DZ6A 1ROFA 1YHQS 3DFEA 2B4VA 3MPVA 3G8QA 4DUYF 2ZH2A 3IN5A 4HKQA 2XM3A 1E6YA 3HI9A 2RE1A 2IMWP 1RU2A 3VAMA 4CI0B 3HHNB 5IXUA 9ATCB 2C3OA 4NZ0A 1JLAA 2PDAA 1IBKJ 1FDBA 1X4CA 4NI2A 4RPFA 1HNVA 3DU6A 4GVBB 2EG2A 3UD5A 1Q79A 1M0SA 1WG5A 2PFFB 3C16B 3N79A 3LUYA 2BJ3A 3OLAA 3RJMB 3W3SA 2H48B 1UWBB 3RRGA 1Q78A 3GYGA 1UJ5A 2MZQA 3SCLE 3GIIA 2FVRA 5ADZA 1JK9B 1YGYA 3WC0A 2MTLA 2MB0B 4WTYA 4NYOA 3EYZA 3H42A 4G6VB 1ACMB 3KLHA 2VV5A 2WHOA 2OO4A 4M8LA 3LQVA 3ZNJ1 1GMVA 3ZXWA 4IH7A 1C1BB 3MR2A 4DF8A 4DEZA 4F67A 2EFQA 3TVKA 4LREA 3FBEA 1MMDA 3PNIA 1XNQF 3W5YA 2RH3A 1IUJA 3B82A 2HHWA 1Q5VA 2CRLA 4NZ6A 1UJ6A 1FCAA 4BC7A 2AGQA 3HT0A 2F4FA 1VQNS 3OPKA 4LT6A 2MMYA 4RW7A 4F26A 3IO1A 1VJWA 1PCAA 1N0UA 1NK4A 2ASJA 5BYQA 1KHWA 3QMQA 4CLKA 2HAFA 5FDLB 3TX0A 4P2XA 1XR7A 3CJ4A 2XNRA 5CAAA 3N0VA 4YFUA 2W24A 2Q66A 2V94A 2Z56B 3V4MA 3GJRB 4JI5J 5DQGA 2CJYB 3OL8A 1NJXA 4QBUA 2LLZA 2XY6A 2HLTA 3RB6A 2XEXA 1YX2A 3VGTA 4LF1A 1T94A 4RW9A 2AU0A 3BF4A 3KYLA 1RLDA 3KLEA 2YQ0A 2XMMA 5EWGA 2MLXA 4CLTA 4IFYB 2YWHA 3TQ1A 4DFPA 1U09A 4JI6F 3W63A 4OYBA 2YXLA 1T9WA 1V5IB 2GVDA 3CT9A 4DZDA 3VAFA 3PW7A 4CH7A 3F56A 3FK4A 2O67A 4CLPA 2UXCJ 2VPXB 3X1LB 3NL0A 2GIFA 3MUMP 1OY8A 2DNZA 2KT2A 4QW9A 2MGZA 4GKKJ 5A2QY 1XNRF 4KJIA 1Q81T 1Q1KA 1RTIB 4RR5A 1FESA 1D1UA 3W7BA 1E6YB 4S0MA 2AYBA 3GFXA 4HHUA 1YG0A 3BSNA 4J9MA 4H4KC 1X4DA 2ROPA 1UWAA 3QLHA 4BWJA 2DR6A 4DS5A 3BBBA 4WXOA 2VFTA 4KIAA 2A1BA 3R5AA 3PYEA 3SSRA 1JLAB 3UN3A 3VGVA 1UVMA 2K3KA 2DR8A 3KUGA 4K5RA 1SL0A 4A8QA 2M2BA 4NI2B 1HNVB 4C3LA 3GFYA 2BVZA 5CYQA 2GJFA 1NH7A 1WF2A 4OYXA 4BC9A 4OZLA 3CCQS 4ES3A 1H74A 1FI4A 2NXCA 4DV3F 4DR4F 2FJDB 2IA6A 3VZIA 3F0NA 3KLHB 3IBFB 2DGOA 4DR2F 3K8WA 4X4NA 3MAHA 4O4RA 2HFZA 3A8EA 4Q43A 4LFAF 4ZLNA 1UMJA 4ZHRA 5D8HB 4ZVOB 4MT1A 1YJTA 2AMCB 4ZP9A 3OJSA 2XGQA 4OZJA 4DV1F 1M5OC 1RAIB 4RW6A 1VQ4S 5H9FK 4CLWA 2E5GA 1S1XA 4RU9A 2DRAA 1RHKB 1X7VA 1HI1A 4KY3A 1G6BA 2VU5A 2XLJA 4RW7B 2CQ0A 2NYIA 3DN9A 4HT7A 3TYTA 3NNCA 1I5OB 2HWIA 4ZLLA 3RB4A 1N6QA 1VMBA 2HGNA 1LXNA 3QFWA 1HQUA 2F4VF 4Y6IA 1WKKA 1QAJA 3CNQP 1QVFR 5HBMA 2W9BA 4PG5A 3OL7A 2M9KA 3S7RA 5DETA 2VKRA 5DGAA 4B3TF 3GWCA 2BV3A 3HVAA 1OO0B 1F3VA 2B4OA 4WTOB 4EYHB 3I96A 3UCZP 1EZZB 4RW9B 5JMNA 3TANA 3CD7A 2N3LA 4ZPDA 3KLEB 5KT2A 2JFDA 3MECA 1WJ9A 2DHHA 4CLSA 3J81j 2G0JA 5KT4A 1IBKF 3ZFVA 3EVWA 2R7OA 4Z7CA 2NZCA 2GVDB 4FZVA 4RNFA 4WE1A 2C3MA 1RTJA 3I87A 4DFMA 1UFKA 3A12A 3QT5A 1OS5A 4C3MA 3ZZ0A 3QIPA 2FYXA 2CWXA 2WW8A 3LGHA 4LF8J 3CF5Q 1FT8A 3MAQA 1BD6A 1WF1A 4NEYA 2MGZB 5KFKA 3Q23A 2LQBA 4DZ6A 2J7KA 1PJ5A 3U02A 1FKPA 2ZJQQ 1H2UX 2ZZTA 3UFCX 2MKKA 4K4YA 4Q45A 1NPRA 4WKYA 1HI0P 3QLHB 2IM3A 5ETQA 1TL3A 5F3ZA 3S1TA 2W2NP 5A76A 1NPPA 5L39A 3R2CJ 5D0RA 5D4NA 1F0XA 5HROA 4M5JA 5CD4A 5CYQB 3PZPA 7AT1B 2OFHX 2H3EB 5ETSA 4Z37A 3E51A 2OTJS 2R7QA 1N48A 1GT8A 2XZWA 4JI5F 2RQ4A 2XMWA 2NS1B 3QT8A 5H1SV 1R8PA 4ZHRB 4U9RA 4CZCA 2DGUA 2JEFA 1Q0NA 3NNAA 4IDKA 3DGPA 1FNXH 3TZYA 4AFFA 1F2HA 4RW6B 5KT6A 2PA3A 4IFVA 3RU0A 1S1XB 3CCRS 3OTDA 1BHNA 2BOAA 5KOXA 4OX6A 3EVMA 1UL3A 3RR8A 3G6XA 3TJAA 3IG1A 2ZC4A 2ZFHA 1U0SA 3BJYA 2FHJA 5M2PA 1NNDA 1X5TA 1KLMA 3RZAA 4ZVFA 5JUMA 1MG7A 1N6QB 2B56A 2UXCF 5KFAA 5KG2A 1YTYA 1HQUB 5A2QU 3UCUP 2XCPA 4DL5A 5K9FA 2W9BB 3NS7B 3I6PA 5KFQA 1FX2A 2ABYA 2VFSA 3FMBA 2HQCA 2ZE2A 2G4BA 1S5ZA 4GKKF 5GAHU 1KVJA 2G2ZA 1ZTTA 1NCLA 4WFAQ 2CAJA 4TU8A 4Q0BB 1T9VA 4RL1A 3MECB 1RK8A 3MR7A 4BLGA 2BJ9A 3KHGA 4RNNA 4V19J 1WSVA 4WP9A 2E5HA 3PHEA 2F9DA 2YQ1A 2VBWA 3JTNA 1C4CA 3UDVA 2HLUA 4WE1B 4XDCA 1RTJB 1H2TZ 1HMVA 1KS2A 2ZKUA 1C2PA 4CLYA 1T9TA 2QMXA 3QRPA 1KVIA 3G6VA 2GFFA 1ZM3A 2HG4A 5SZTA 1M5SA 3QIPB 3B54A 4K5SA 2WW4A 2PEHA 2C42A 3BZQA 3CPWR 5ETVA 2DYAA 3CCSS 3JSRA 3OHBA 4NLTA 2AV5A 2KJWA 1FE0A 1UPMB 4M95A 1YRTA 3L7OA 1FKPB 3QPIA 2KHCA 4HI2A 2A18A 1ELOA 4LSZB 3CCLS 2WONA 1CJKA 1VQ6S 1P1TA 4N76A 1FFWB 1AUDA 3AJDA 1AFIA 1Q86T 1TL3B 2M7SA 2M8HA 1CQMA 3DGVA 2BE7D 1NO8A 5F41A 5GAGU 4O0NA 2CQHA 1WOSA 1SV5B 5DRKA 4YOEA 4I56A 5HROB 1R8AA 3ZZTA 4DHVA 5AJ3F 2CNOB 3NG8A 1LXJA 2LYVA 4ECTA 2MEWA 1FRXA 3IM8A 3HJVA 2V8PA 3O1LA 3BR8A 2XWXA 2PT0A 2EI5A 3K5PA 1KOOA 2QLJB 3WIVA 3GG0A 2FZCB 3IXQA 4OZNA 2QLFB 3WZ0A 1LEOA 1TKXA 4NLXA 3SBMA 2DK2A 4QWAA 2DHXA 2FLNA 5B0DA 1VQ9S 2BZ2A 1H3DA 3W5ZA 1LK7A 1N5YA 4IDKB 1Q8BA 3BSOA 4ZVQB 4C0OC 1P6TA 2CVIA 2W9CA 4M5KA 4JV5J 4A8SA 3DGPB 4DPOA 4K2JA 4USVA 2PE8A 4IFVB 1WC3A 2W2QP 4ZLJA 1S0NA 3QRRA 1AUSL 1JXVA 3IG1B 1NJYA 2E1AA 1KLMB 5KFRA 5KFGA 3A13A 4RZRA 4C8MA 1FTRA 3OXLA 4RWWA 1XC9A 4F0MA 4LF8F 2KFZA 2HHPA 2GO9A 2ZE2B 3DXSX 4FPRA 2G0IA 1LWFA 4Y00A 3M30A 4FYXB 4C98A 2H5JB 4GKJJ 4EZ6A 5DS7A 2L9DA 1PG5B 1CJVA 2BM0A 1M5PC 3VVTA 1QSLA 3HSZA 3V6DA 3G82A 2J9DA 3NGDA 5CABA 2B6AA 3CMQA 1NJIT 2HQGA 3M9MB 1ICEB 4TN2A 4NLPA 3WX8A 2DIUA 2YKMA 1ITPA 4X4VA 1HMVB 2LXFA 3DRSA 1VOMA 1RKIA 2Z0GA 3EMTA 1HBNA 4B9SA 2V2QA 1TU0B 3L3CA 4PABA 2YKNA 2JC0A 3O3LA 3HVRA 3ELHA 1QUVA 4UUWA 3UR0A 4HL9A 3NCQA 2CUYA 2HZAA 1OYDA 2HQIA 4J9OA 2BDPA 3BYPA 3W5XA 3SMZA 1P9YA 2AYGA 1KQFB 1KWMA 2OGUA 2CQ2A 3D6TB 3J80Y 5CZXA 3CD0A 2WONB 1CJKB 1ZM9A 1RKJA 5E33A 2PMZD 2ZH5A 1K8AT 4LRFA 4DQPA 1G1XA 4H4OA 1VK3A 1QTNB 2WVBA 2C2MB 3O5TB 2XG8A 4USKA 5LT5A 2QC3A 2C2EA 4LRDA 3JTPA 4YDDB 3BKFA 3E8OA 2R8IA 2DCLA 3GPAA 5LJ3Y 2V68A 3RRHA 1RWUA 3UR3C 4XO0A 3G8TA 3OL6A 2KRRA 3AD8C 2HFUA 2KG1A 2FGCA 2M88A 2BBEA 1SL2A 3CJKA 5B0FA 4DV6J 3SI8A 4RWXA 2C22A 3KLGA 1EQMA 4TVAB 4AT1B 1TUGB 4U6PA 2IM2A 3QBCA 4ALZA 1TKXB 2CJXB 5D0GA 3R5GA 3H5UA 4P7VA 2KL8A 4Y65A 1N5YB 3K0JA 2KKHA 2W9CB 3CJ2A 2FDNA 5KFXA 3PEJA 4F04B 2H9ZA 1DRZA 1IN0A 5J2MA 1VK8A 1HWJA 5KG0A 1IWGA 1SJ1A 4IOBA 5KFDA 3KLIA 3SFGA 3VZHA 2UU9J 2PIIA 4ZVRB 2MJNA 3ULHA 2HBQB 1H6KX 3M2RA 4MK8A 5KG3A 2V8GA 3QAUA 1KC8T 2KM8C 4CO5A 1GMUA 5G4DA 4LF4J 4DSJA 4OI6A 2GCFA 5KFNA 3G4SS 1C0UA 2GGPA 5EX3A 1Y5LB 4ECVA 1CPZA 3HLUA 3G8SA 3DLEA 1LWFB 1FA0A 3M30B 2D41A 1I94J 9RUBA 2ZDPA 1IR0A 3AOAA 1CJVB 2MQLA 1FX4A 5ETLA 3V6DB 3G82B 3W2WA 3EICA 1LW2A 5C25A 4JOUA 8AT1B 5HATA 4CM2A 2B6AB 1MWYA 2P9CA 4F0HA 2CG8A 1PC4A 4QWDA 5K8PA 3LP2A 1V3RA 2R8JA 1NK6A 4YY3J 1UA0A 3UW1A 1X5SA 3MZIA 4LMZA 5IV4A 2YKMB 3DRSB 2MKIA 4TXSA 5J1NA 1NKCA 2HAIA 1RWVB 1HBNB 1SJQA 4RNMA 4L3KA 4ZVUB 2YKNB 4CO1A 2D1CA 5EWFA 3BKTA 1TL4A 2N82B 1FRMA 3JSYA 3CJ5A 2BJDA 3AA8A 1RT2A 4L3NA 2DNYA 3KLVA 3DNCA 4UOGA 4DL3A 1YLXA 1K1SA 2LFVA 4J7CA 4DX8H 1X5PA 4ZVSB 1LK5A 2QMUB 4JV5F 2ZH6A 1OY9A 2XI3A 4H4OB 1D9FA 3LTOA 2R7RA 2KT3A 2EG1A 3RTVA 1Q53A 4FNHA 2W2PP 1Q4RA 1R3NA 5DGBA 2WTFA 4CLZA 4HEA9 4O0IA 3ILOA 4Y28C 2HRTA 5EX0A 1OPIA 3OR1A 3BBCA 4O23A 4LF7J 3JB9k 3OVBA 5JXSA 2KI2A 2ZUGA 2HQFA 3CJKB 4J37A 4EBEA 2N4DA 4IO1A 2CJAA 2YPYA 4OLOA 2E66A 4HTIA 4WCEQ 2OD6A 1GTEA 3BGFA 3CEDA 1VBXA 4GKJF 5AE1A 3R5JB 2RS2A 2ZHBA 4FXVA 4KRWA 5MLCV 2IJFA 4I7FA 3CJ8A 4HVZA 2E1MC 1M1GA 2WK4A 3OFHA 3IR5B 2CPIA 4NOHA 2UV8G 4B9NA 4RBVA 5J2MB 4LR9A 2BJ7A 4DV4J 3KLIB 3I0RA 2B3TB 2CPJA 1SC1B 2BRLA 3VQSA 3M8QA 3M2RB 1EP4A 2XTJP 3LOUA 3FKBA 4CQ1A 3DM2A 1KKHA 4WKRA 2DEJA 1C0UB 4DLGA 1QAXA 2GGPB 2OFGX 4F3MA 4NE9C 3J80U 3J7YU 3DLEB 2BX6A 1AW0A 3FGVA 1HWIA 2HIYA 1FEEA 4CYUA 3P45B 2G2YA 3T1YJ 2H65B 3W2WB 2MDAA 2YX7A 2QLBB 1LW2B 5C25B 2UUBJ 2LEAA 1UEKA 2OPSB 1Y9OA 1FD2A 3LANA 3LP2B 3FDSA 2MZ1A 2H5IB 5DDPC 1JB0C 2O66A 1AT1B 3T6JA 4H4MA 3LALA 5HP1A 4Q8EA 1UKUA 1SQGA 2VPWB 2AWZA 3PR4A 1QSYA 2C2KB 3R1LA 3T19A 1VBYA 1FXLA 1SUQA 4CLLA 2DXDA 1CC8A 2E9RX 4DV6F 1RT2B 1NK8A 3BPSP 4A8YA 3AFGA 1WHVA 4I4BA 1HI8A 3VALA 4LFBJ 4NRTA 3I4HX 2GC8A 3BSAA 2I8EA 3P5TL 5IS2A 1OQ3A 1YJNS 1PAEX 1TUWA 1X4GA 2CNNB 1RA7A 3D5MA 3HZGA 4DPTA 3AOCA 1V3SA 2ASDA 3W66A 4ZVEA 3UD3P 4I68A 4EBDA 1NUEA 3H5YA 2VZ9A 4URSA 1SC3B 4EZ9A 4K59A 2OLWA 3I55S 2P9GA 3BB5A 2UU9F 2CQGA 3GSDA 4ZIVA 2HIQA 4NA3A 1VQMS 3OR1B 3GP9A 1SJ3P 2AW0A 2XMKA 3ZTQA 4KGMA 3D28A 2RSQA 2CFXA 4LF4F 4NPOA 2WBRA 1KSPA 2BR0A 5T7LA 4USIA 4AD6A 3NGSA 2ZH8A 1QDUB 2H54B 3U27A 1N56A 3D68A 1I94F 1RAJA 2RHSB 1IM6A 2NPFA 2CPFA 4GO7X 4QPTA 5CA5A 2MSSA 1EQ0A 4WIIA 3MAAA 5H9EJ 1SKRA 3D6HB 4EUVA 3TA0A 1NSPA 2PGCA 5GVQA 3ISND 1F9EB 2OMLA 2ZZNA 1VIOA 5GADI 4HH1A 4YY3F 2LA4A 3MDFA 1X60A 2C3YA 2IYGA 3I0RB 3UE2A 5F8NA 4ZJLA 4ED6A 2ADCA 4KB7A 2F65A 2DKOB 4MYUA 3M8QB 1FNOA 1WNEA 1EP4B 3R3TA 3UD4P 1BQNA 2LDYA 4PPDA 4M94A 3R5CA 3KJNB 5CCMA 4AQYJ 3US5A 3DM2B 1PYTA 2NCKL 4PPZA 1REVA 1D8ZA 1S97A 1QY7A 4K2XA 2YNIB 3BN7A 4J5OA 2HVIA 1WC4A 3MXHP 2VHGA 1ZM2A 3CE8A 3I56S 5IOLA 3CVKA 2BEFA 1H7WA 1U8SA 5ITHA 4CYUB 2EK1A 3K89A 1XR6A 3D3CJ 3GJTB 2W01A 3EDRB 5J2NA 3M8YA 2DPIA 1UZHA 4MTPA 3A8IA 3QGHA 4ZJOA 4HT5A 3ENAA 4KAIA 2J0WA 1WSRA 2D3O1 1B0TA 4H4MB 3CD6S 5HP1B 5C2CA 2FPHX 5F9LA 3KNAA 2MLZA 1QJHA 1HHTP 2YWFA 1SUQB 3C15A 3CC7S 2WVDA 4LF7F 4C7QA 1N5SA 1OSDA 3TEHB 3D1QA 3OQ2A 4EGLA 3QGPA 4PXCA 2F7VA 3MPDA 2OSQA 5GAGI 1K47A 2BXJA 2F9JA 4J9QA 2HK3A 4WK3A 3B78A 3DKDA 3DLBA 3T9ZA 1A0OB 3W8GA 1ZM4A 1GNKA 3G71S 2L9NA 3W9IA 2DNNA 4N47A 1HR0J 2UXBF 1U2CA 5CHCB 3MM6A 4DV2J 4DV4F 1WHWA 1NDKA 2N7YA 2J0QD 3LW5C 2H5EA 3N6LA 2BQUA 1S79A 3HK2A 1WOPA 1Y5IB 1FWPA 2G1DA 2HS3A 4PUOA 4HHJA 1YJWS 4P6QA 1URNA 1J5EJ 2K06A 3DI6A 1RA6A 4NRUA 5T7LB 4ZS6A 4URGA 1FNMA 3CIZA 3NMAA 1VQPS 1LW0A 2KFNA 5BYSA 3SCKE 1N0VC 3ENVA 3KJFB 4DSEA 4ID5A 3ISNC 3AODA 4WP8A 1PC5A 3CCTA 1MMNA 3T1YF 3PW2A 4USJC 3CO9A 3IWLA 1NDCA 3EE3A 1S0OA 1D8YA 1WTBA 3MAAB 5F8IA 3HP6A 4M5GA 2POKA 3NBPA 2OPRA 2R8GA 2AGPA 1PBUA 5AT1B 5D77A 1QAIA 3FBCA 3MMCA 2QL9B 1RBOB 2J9EA 4BWMA 4FS2A 2W9AA 8ATCB 3TUJC 3AY0A 4JV0A 3V2UC 2W7AA 5DZ7A 3I4PA 2ZC3A 1QE1A 1W2IA 1KQGB 3K58A 4IUFA 3HSDA 3PCOB 4ZP8A 1BQNB 2B51A 3CCMS 3M6WA 5GAEI 1U6BA 2OKQA 1NHKL 4WYWA 5HQ8A 4CWBA 2LECA 3PVXA 1REVB 4O3QA 3THTA 4KO0A 2AYEA 4PWDA 3RB0A 1DLOB 1R8CA 3QWUA 4LFBF 3C66A 2AGOA 1RDRA 1ZA2B 3G2XA 2VDHA 3W9HA 5G0RA 3NGUA 5J2NB 2UZAA 1S48A 2V0NA 4WFZA 3SSQA 1VQLS 4PQUA 2HHTA 1CJUA 3GQCA 2VA2A 4ED8A 2GX8A 4BBYA 2R42A 4FDFA 1SQEA 1RTDA 3CW2C 2J6UA 2BJEA 3TZXA 4FF3A 2FJBB 3MD3A 3RB3A 2QL5B 1RWNB 5K5MA 5HJYA 1UETA 5DJBA 3C15B 1F9FA 2D3ZA 1B7YB 1I6JA 2C2OB 2G2OA 2VC1A 1RU1A 4QU7A 4RNOA 1TMJA 4LR8A 3FEYB 1S10A 4OV6A 2R3VA 3SQOP 5KFYA 4G3IA 4ANCA 1Q8KA 3KDOA 3JYTB 4F4YA 2BE9B 1NB7A 3T41A 4I2QA 4LRBA 2MKJA 2JNJA 2YVSA 2P9EA 3DRXA 4ITSA 1YRXA 3FC9A 3PYFA 3FMWA 3V81A 3AOBA 2C3UA 1S6UA 1YI2S 3MM6B 4OI4A 3K5MA 2IRXA 2GO8A 1UPPA 2OPQA 2P5VA 2XMUA 3FQLA 1GH8A 2ZH1A 1A6LA 4PUOB 4Y2MA 4AQYF 3ENQA 2CJQA 5ETNA 4A8OA 3DI6B 1U49A 2VF3A 1RAEB 4BDPA 2JX2A 1LW0B 2YNGA 4MKYA 4RKUC 3TP2A 3GIMA 1LOUA 1NHVA 5L9NA 3GJQB 4ID5B 1EX8A 2BABA 2QE5A 5I3UA 2DNQA 3FVYA 1NKBA 2EW9A 4QPXA 4ED5A 1B4SA 3NBPB 2OPRB 2FHKA 3HHLD 4LVNP 3NWRA 1AB8A 3MMCB 5KFEA 2XSJA 5KOWA 1HYSA 1VC0A 1Y00A 1FE4A 5FIIA 4C8OA 1WHYA 1QE1B 3IWNC 1FK9A 1GMWD 2XYHB 1VQ7S 4AUKA 1U24A 1V5VA 5L1LA 3SCIE 2CQ1A 3ZZYA 2J0SD 1ZAXA 5E2QA 1RBLA 2I1RA 5KAKA 1V9OA 2B9XA 4KO0B 2WAQD 2J7UA 4PWDB 3KXDA 3OL9A 2E44A 3PJWA 4HDHA 4DV7J 3BSCA 4AL5A 4X62F 4AE5A 3HMJG 1FJCA 5G0RB 3VAGA 1U0HA 2PI4A 1GAOA 2QFIA 5E7OB 1T11A 4PQUB 3NAIA 5BYRA 3A8KA 1B0PA 1CJUB 1RTDB 5H9FJ 4DV2F 2V63A 3EGWB 2C2ZB 1CULA 3C46A 2XQCA 1JXEA 3IR7B 1TAQA 4LIWA 1HBUA 2OEMA 3Q8UA 5J2PA 3AB2B 3R9LA 4TQSA 5KG6A 3AQOA 1YVFA 1HA1A 4YEAA 2EFPA 2J7WA 3QJJA 1J5EF 2V34A 2F40A 2JWNA 3G6YA 2F8EX 1TQLA 2F8MA 1KQSR 3TX8A 3WBZA 4C8YA 1WC1A 4ZK7M 1CG2A 2KYXA 2FB0A 2BA9A 4FP9A 4I2QB 3TJ9A 4DL6A 2QA1A 3NNHA 2E1PA 4D3GA 3HFVA 3R7NB 2F63A 1RTHA 4IH6A 2G0CA 4ZPBA 2VG6B 1O0PA 2YQ3A 3BDEA 2VODA 3Q2SC 2XMAA 2AEFA 3HSGA 3V81B 1VLOA 2UVWA 4ECSA 3CCUS 1VI7A 2CQIA 4X66J 1HHQA 5F3TA 3ILJA 2OPQB 5IC4B 3BH7B 4G1PA 1Z2ZA 1KR4A 2LA6A 5KFJA 2YWWA 2P8IA 2ASLA 4DQIA 1T9YA 1O8BA 3TZZA 3PO5A 3THVA 1VC6A 2YNGB 5K20B 4ZPTR 1ZH5A 1YZ6A 1TP7A 7FDRA 2RIJA 1PBAA 3GJSB 4B17A 2FY8A 3HHLC 4I1TA 1WC6A 1SL1A 1RWXB 3KG4A 5I3UB 1VQOS 4HI1A 4K4UA 1JIHA 3KNGA 3K5OA 1TV6B 2ROGA 2C2DA 4ILLA 1KFDA 1ZBTA 3QZ8A 3C14A 2XSJB 2R7XA 1HYSB 3K7RA 3V6JA 3DC2A 2FHMA 3MR6A 3EX7B 5I3PA 1RACB 4V19X 3D0HE 2XULA 3BGRA 4F8RA 1R89A 2O1PA 5CYJA 2PD1A 2UP1A 2PEBA 5AXKA 1URRA 5D4PA 2K1RA 4PXBA 1SC4B 2B4PA 3T5LA 3PW0A 1GX6A 3RG6A 3MEDA 5C2GA 2ZJRQ 5KG7A 2MHNA 4Y2CA 3K8VA 4KBIA 2ZWOA 4L6V3 5A8RA 1U0HB 5EHHA 4RW4A 3LWMA 2R2TA 2NXEA 1EAYC 2E5LJ 1MNEA 3KKFA 2BM1A 2MQ8A 4IR9A 2MKYA 4L73A 3G86A 3MM5A 4H4KA 4RUCA 2BRKA 2L48A 2W4DA 4MYTA 4TU7A 2YX1A 1TKDA 1BWVA 4K8RA 4JYAJ 2QT7A 4QOTA 1CULB 5RUBA 2EXUA 4L74A 4TNOA 1HNIA 1HBUB 1D9DA 1DURA 3MR5A 5J2PB 1JJ2R 5E3AA 1MU2A 2OD4A 1PJ7A 3IC1A 4NYPA 3BH6B 2ZZMA 3ZO7A 3EGVA 3ICLA 3WX4A 2WBMA 4YB1P 4WU3A 3EXCX 3PX4A 2HGLA 4UQTA 4HR2A 3IAS9 1U7LA 4DL7A 1P8GA 1EIYB 1JLEA 2NREA 4OHWA 4ZOSA 2YY3A 2RDDA 1RTHB 4WWSA 4P2MA 3NMRA 3ZZPA 1UVIA 3D9BA 2CPXA 2RUGA 3DCAA 1FDNA 3T1HJ 1C0TB 1HW9A 4UZBA 1S6QA 4NLYA 4F4ZA 4F3OA 2ASYA 4GC6A 3R6LB 3OV7A 4NCAA 4FVMA 2PO4A 3C6TA 1CEZA 2QRRA 3HSJA 1CSJA 3H98A 2CDQA 1SH0A 4JUZA 1AROP 2JVRA 2Q3PA 1XBWA 2ZBIA 4DV7F 3DRYA 1U1OA 5FLXY 3LWLA 4QYZK 2W25A 2G9OA 5IZHA 1KD1T 4LFCJ 4USHA 1SBRA 2KHDA 4OJGA 1QD1A 3OXGA 2ZJPQ 3E01A 1F5BA 1JMTA 1NSAA 4X4TA 1HIYA 3A3PB 3C14B 3M8RA 3P8BB 2DNOA 1KHVA 1DQAA 3R2DJ 3EWGA 3TWZA 2I5JA 2JSXA 4ECQA 2HSEB 2VJUA 1K73T 4Y3CA 2JZ5A 1DHMA 4QW8A 3BGRB 1T02A 1P9QC 3G96A 1WKJA 1RWKB 4PXEA 4WPAA 4J9PA 4KYZA 1NRKA 4V1Ak 1ULRA 2K1RB 3GIJA 1UVKA 1RTIA 3A4TA 3TVYA 3MEDB 1SCJB 2ZOFA 2VH7A 2ZM6J 1YSJA 5CQGA 3KG1A 3ZZZA 1X4BA 4A8KA 3L7PA 2I0XA 1UVJA 5A8RB 1BXNA 2KH9A 4RW4B 2DHAA 1N5QA 2MZJA 4B9TA 2PFDA 1WOOA 3IP0A 1E6VA 4HACA 4ETXA 5LSRA 2GHWA 4ZA1A 4F50A 1FJEB 3MM5B 2YH0A 2YWKA 6FD1A 1EJ7L 4C11A 4KHRA 2JFKA 2NSCA 1IKYA 2OI2A 4JI4J 3RW7A 2E1RA 3ZTOA 2KB2A 4X66F 2C2NA 3HFZB 2M52A 1HNIB 4OYWA 4YMEA 5D0EA 1MU2B 1F3FA 5BR8J 2HYIB 2D3UA 3KUHA 5AE2A 2AZ1A 3DLGA 2RD5C 4LF5J 3W60A 3UVJA 3BEGB 4CCHA 3PACA 4UOHA 4J9LA 2AZ3A 3H40A 2MSTA 4GVLA 1N8RT 3GV7B 2B8QA 3PW5A 4OZ3A 1Y3KA 5HI7A 4UUXA 1JJCB 4PQAA 3DMJA 1FRIA 1GQEA 5AE3A 3LAKA 2E9TA 1SH2A 1JLEB 1Y10A 5DQHA 4A8MP 2ZUAA 3GE9A 1H7XA 2J8SA 2Y3YA 3DHWC 4LBPA 2AF6A 4ZCMA 4C4WA 3PIOQ 2IRYA 3MM8A 2RRAA 1XWLA 4DG1A 2JLGA 4J9KA 1NSQA 4DLEA 3CO0P 2R2UA 2CNKB 1HQ2A 5HVHA 2R8HA 1S6QB 3MR3A 1SB6A 4U7CA 1N34J 4NZ7A 5A8KB 2PN6A 4B9MA 4ZKAA 4OI1A 1UP1A 3C6TB 4FN5A 1R43A 4ZVHA 4C97A 3M7VA 1XIQA 2XMVA 4ATNA 4DDFA 4IQMA 1LWXA 1WEXA 2DXFA 1S1TA 3ZC4A 5IWAJ 4KGZB 2GMJA 1AXQA 1S57A 3OFGA 3K5LA 1R8HA 1JX4A 2DGTA 2DY9A 3EGZA 3I5BA 1S9GA 2D74B 3D1OA 4OHXA 4R0EA 2J8AA 2VFRA 1HNWJ 2EFNA 2E5LF 2VG5A 4QU6A 3NAHA 2NPIA 4D3HA 3E01B 4QWBA 1K44A 3VGSA 4DSKA 2HK2A 2WOMA 3LGNA 2VD3A 3AT1B 1R27B 1RT6A 4A46A 2IVYA 2ZWPA 4JYAF 2KN4A 2I5JB 2ZNYA 4LF9J 5KFWA 3VVUA 1VRQC 4BS2A 1S9EA 2HEKA 3PJ9A 4O44A 2EEYA 4CRJA 5DG9A 3IGNA 3GONA 1T9XA 2NYHA 4ZN3A 1KRPA 1ZPVA 1TZ0A 4QR1A 2OMOA 1R0CB 4DUZJ 2XLKA 4FBUA 1ZETA 3JQKA 2CVEA 1RT1A 3PW4A 3DLJA 1AFJA 5E3PA 2AQ4A 5A8WA 3CTRA 1Y0HA 3TA2A 5IQQA 3OFFA 1VYAA 1ZZNA 4NA2A 2OP5A 4NL5A 4IOAQ 1HBOA 3BQ1A 1H0HB 3PYGA 3DRPA 3MTJA 1QTMA 2CNLB 1JKHA 2HHQA 1B64A 1E6VB 1OY6A 4HACB 4LRAA 3D0GE 2PC6A 1UW4A 4C11B 4LR7A 1GXTA 3T1HF 3AJ2A 4ZPVR 1IKYB 2V69A 2D9PA 1O51A 4KH1B 4JI1J 3T3FA 3R7BB 3TI0A 3P96A 1HD0A 1RABB 3UPFA 1PYSB 3FUYA 2FLLA 1IQTA 1M1HA 1DARA 4DSIA 3CC4S 4FVCA 3SQGA 1RHQB 2JL9A 2M8DB 1X4HA 4AXJA 3DLGB 4TQRA 5KTQA 3UVJB 2NR0A 1XERA 2KFYA 5FLXU 1HPZA 3IRXA 4I2PA 4C48A 5LSLA 2MKCA 1ZA1B 1R31A 3KJQB 4Y2AA 3DMJB 3PY8A 3T5KA 4UOCA 2DJWA 2A6MA 2N7CA 4LFCF 1JQGA 2ZVSA 4O3OA 1K0VA 2QX0A 2UVVA 3MM8B 3HVTA 4DG1B 3DLLQ 4DCOB 4ES2A 3PX6A 1BGXT 1UAWA 3PG9A 4ED0A 1JWWA 2QA4G 3ITHA 1C1CA 2EPIA 2Q79A 1RYSA 3IGVA 4DX6A 3BYRA 2HWTA 4ANEA 3W64A 2DNKA 2IA0A 5HMYA 2R8KA 5HLFA 3CJ3A 1S1TB 4DCPB 2Y1IA 3EM1A 3PEHA 2BQRA 3IR6B 4WZMA 5J1EA 3FCHA 3O8WA 1TL1A 1MN7A 4B3RJ 2ZM6F 5JJBA 4Q0BA 1HNXJ 1S9GB 1O5JA 1CVJA 4XDDA 2V4RA 4X4PA 5D78A 2N3OA 2CPHA 2VG5B 2OSRA 4N8NA 2DRBA 2WOMB 2Y0BB 3HHEA 1RT6B 3MF5A 3FSIA 8RUCA 1TUVA 4JI4F 1FF2A 4XPCA 2H1YA 5AXMA 3ILIA 3NLCA 2OEKA 1S9EB 2GIRA 1WUUA 5BR8F 4O44B 3W62A 4LF5F 3O6QA 1T0TV 2PI5A 4A48A 1RT1B 1RYRA 5IV3A 5A8WB 4NLQA 1VQSA 2OELA 3U1NA 2GAGC 1HBOB 2ZH4A 4RUAA 3H7HB 3DRPB 1VQKS 4C8NA 1B99A 1YJUA 1JKHB 1FWKA 2BACA 3KTQA 5HANA 2MXYA 2AKWB 3CJQA 5KFIA 2NUHA 4LUBA 4ETZA 2X3GA 1SV5A 1TFYA 1S4FA 1M5VC 1N34F 1EKSA 3NOCA 2KTQA 3GIKA 1MWQA 4ED2A 3SQGB 2G1HA 1YQHA 1MLAA 2FVSA 5IWAF 1HPZB 3IRXB 4I2PB 4WYLA 4EWTA 3QO9A 2CADA 1RHJB 2B9EA 2OJ3A 3MCSA 5B0BA 4KV8A 1VFJA 1FFSB 3U1LA 2V9KA 4C8LA 4NLRA 2CQPA 2IVMA 2M5YA 2DGXA 1U1LA 2WB1D 5EGYA 1HNWF 5KG1A 2IVFB 4N41A 5B0CA 3TOQA 1YBAA 3P6YC 4F25A 3HHDA 3HVTB 1QSSA 5ETKA 4OZ5A 2CJ9A 2RT3A 1VHFA 3ITHB 1NMEB 2AT1B 4RNHA 1C1CB 2ROEA 1S7HA 3VF0B 3DHXA 2GMLA 4LF9F 1O6XA 4YR2A 3RR7A 1WKLA 3GV5B 2MHEA 3JXOA 4NLUA 1Y7PA 5B08A 2J9CA 5HLFB 2BW7A 5CCLA 5F8JA 4DUZF 4FS1A 3BQ0A 3FCWA 3CB4A 3IS9A 5J1EB 2WCXA 1TL1B 5F0WA 2WSCC 3E2EA 3NRBA 5JVGQ 3MHYA 2CA9A 3THPA 2M4MA 3P49B 2Y1LB 2CZVC 2D69A 2XHCA 1AYEA 4DS4A 1M5KC 3OUYA 4EFAC 2QJ3A 1CC7A 2HBYB 4MK7A 2LQJA 4LQ9A 2UUAJ 2V2ZA 5L38A 2AP6A 2B7BB 3M05A 4X4QA 1HLWA 4JI1F 4TLRA 3TQEA 2JVOA 3TR5A 5EUHA 5I42A 1H38A 4P2SA 5DM6Q 4OIXA 5HMZA 5BJRA 5KG5A 3HXMA 1VS3A 3ZZOA 2XI2A 1RWOB 1D3WA 1Z1ZA 5L1KA 2OUGA 2HFVA 2HHUA 1DY3A 3PRDA 2B5JB 4K50A 3GZ7A 1LFWA 1HFEL 2A2DA 1U8WA 4CT9A 2LVWA 2F3JA 3EVOA 4OYZA 4NX9A 3OJUA 3KHHA 3J7A1 1XN9A 3C3LA 2VBXA 2R7WA 3MM7A 3IFEA 3PX0A 2OHDA 4ZP6A 2QLWA 1NK7A 4Q5VA 2LU1A 4QCLA 1RAHB 2UUWA 3MOJB 1NK0A 1TL7A 3PTWA 2DGQA 2MPUA 2BKNA 3RW6A 4XIUA 4AL7A 2FJXA 1L3TA 4NASA 4KSEB 3QO9B 3A3OB 1P1LA 2RJZA 4F7VA 4B3RF 1D9AA 4KV8B 3C8YA 2XHWA 2DD8S 1HNXF 2BW2A 5L1JA 3O2IA 4K4TA 4KTQA 1CS4A 1YK9A 4QWEA 3D0IE 1U1KA 4DXLA 5KFVA 3IWXA 4GO5X 3QIDA 3JQMA 4ZITA 3DDNA 2DHGA 3GLJA 4FF2A 5FD1A 2HNDA 1RBAA 4W4MA 5KFMA 2DO0A 2RMLA 1XNRJ 3NEKA 3TUPA 1FRHA 3R5DA 3Q8RB 1JNZB 3T5JA 1UJ4A 1BMQB 4DU7A 4LSNA 1XK8A 4KGXB 3R27A 3A1YG 2J5AA 5DM7Q 3GR1A 5F8GA 5K14A 1NHUA 2KM8B 3HULA 3CCZA 2K7JA 3IS9B 2IPOB 2DXEA 4ED7A 2XBPA 2HFSA 1VRUA 3J7AN 3GILA 3IAM9 3CSKA 4ZIWA 2GJ2A 4JI8J 2DVIA 4X4UA 2DTJA 2GQ2A 3GFHA 1R8BA 2VFVA 4PRFA 4MKAA 3OUYB 5IT0A 4QR0A 2DH9A 2ZEJA 1U1RA 2HFOA 5F8LA 2JDJA 3OVAA 1M1KT 2FVQA 2J6SA 4IQXA 3ISZA 4NCGA 3VTIA 2KZZA 1Y3JA 2K3IA 2HVDA 2CKWA 4MAKA 2CDRB 5I42B 2EBGA 4DFJA 2F1FA 2RB7A 1SVDA 3FBFA 3HVWA 3H4DA 2U2FA 2W2MP 1QUPA 3OTCA 5T14A 1FHTA 3TUZC 2QSWA 2JJ4D 3TAMA 1A9NB 2W4CA 3BREA 2QL7B 2B43A 4LQ3A 2IMOA 4WFYA 2HHVA 3AH6A 1FO1A 3SSSA 1VLYA 2FLPA 1Q5YA 3BS9A 4M1KA 3A8JA 4OZ0A 1PSDA 4M63A 2RDIA 1T3OA 5C7PA 1D09B 2HFNA 1N4LA 1AZSA 3MM7B 3SDEA 1FD8A 2PA8D 4R0JA 4TU9A 4OMFG 1HWKA 2VA3A 2B9WA 2R4FA 3TUIC 1TL7B 4L76A 2WZ1A 3BGUA 3MEEA 3TARA 3PKYA 3MMAA 4BHQA 1RXOB 5E3RA 2IJRA 2EVZA 3LH2S 3MCNA 3LPEA 3BV8A 1YJRA 2V50A 2ZKTA 2ILYA 1JLGA 1VJQA 1SXLA 4MH8A 3UN2A 4U95A 1CS4B 4K0KJ 2Q6CA 2HGMA 5LMNJ 4U7UD 2NQPA 1WG4A 3MD1A 5L8RC 3EJMA 4JI0J 2UUAF 3CCVS 2HNDB 3OFEA 5D6GA 2RRNA 2E5JA 4ZPCA 3N4WA 3D2WA 4EI2A 2C28A 4WFNQ 2W8KA 4MMOA 4ED4A 4LSNB 2DB1A 1UFWA 2W1BA 2XS2A 4KQZA 4P73A 2DY1A 5K14B 4OQJA 4ECXA 1YJ9S 2E5IA 1G7CB 2JEGA 1WI6A 4QIFA 3VHQA 2QZ8A 1VRUB 1ZYQA 3KK2A 2HWHA 2ATCB 5C5JA 4FYVB 2YKQA 3D4JA 1PYOB 1GFWB 5ETPA 3HJFA 2A10A 1P27B 5CXTA 1KOHA 4OJ1A 1FFGB 4MIWA 2OPSA 1H98A 4M5IA 1X8DA 4P10A 4MFBA 5KFPA 2QYGA 3LAMA 3N01A 3C2PA 3OBIA 3DDKA 4NCGB 3AAWB 3D3BJ 2F5GA 4N8OA 2XY7A 4OX8A 3IBWA 3V6HA 3Q8QB 2HVEA 3I5CA 5GMEA 2XO6A 1HD1A 2IAJB 3N5BA 3NY0A 4ZDNA 2V8HA 1BC6A 1J5OA 1H72C 5IQ6A 2VJVA 1T05A 4OYAA 1RI7A 3B8HA 5DG7A 3SYZA 3TAMB 1N33J 1BLUA 5DG8A 1NJZA 3QGIA 1LV5A 3H20A 1SKSA 3FEXB 2VQFJ 2P2CB 3VWSA 2CZ4A 4FKXA 4U96A 7FD1A 4IRDA 1OPZA 1FKAF 1S0VA 4X4OA 4Z2XA 2DNLA 3MPUB 2KXNB 2OPPA 1RLCL 2Y1JA 1YJ7A 4DQSA 2VOOA 2GJIA 4PKDB 1FDAA 3GR0A 3W2VA 4USMA 3AHPA 3W65A 1AZSB 3SV3A 4OI0A 3SDEB 1HW8A 2ALYB 3DOMA 3L9ZA 4F02A 5KFUA 5M2UA 2Z57B 3HF5A 3KJVA 4I6AA 3JAMY 3HKZD 1Q16B 1VDHA 3MEEB 4E8UA 4B3SJ 2FJWA 1J27A 2AEJA 3MMAB 2XY5A 4WP3A 3OXFA 1B3TA 1RT3A 2JLEA 2ERRA 4JI8F 2VKZG 4H54A 5CZVA 1JLGB 4OI2A 2FVCA 1U2RA 3GMGA 5L9XA 1DAXA 1MN9A 1WG1A 5I3QA 1HHSA 2Y1RI 2IM0A 3CDUA 3TA1A 1WTFA 2O5DA 3NP5A 2I6WA 2FVPA 5F0UA 5DDRC 1R0AA 1IBCB 2Q1LA 5CYMA 4C2MA 1S99A 2XZTB 5T41A 2I38A 3S6EA 3CULA 1HWLA 1VRTA 4DN9A 4FYWB 3R1HA 2HHSA 3LA0A 4WJBA 5E0OA 3MUVP 2OEJA 2BOPA 1WEYA 2RU3A 2KXHA 2YNIA 4JBCA 5EWEA 4CM0A 4DR6J 2ZOGA 5HVGA 1UZDA 1FXRA 4PG7A 1EKRA 1X0FA 1EARA 4B3MJ 1WD6A 3KK2B 2VPZB 5AJ3J 4CDIA 1U4BA 1YDLA 2LQ8A 1W25A 4PWUA 2FJVA 2EFOA 4FF1A 1TFWA 1ZPWX 1KLNA 1SC6A 1XQIA 1IM4A 4F2RA 3OTBA 3G6ES 1JJ4A 4MFBB 1IVZA 3DRRA 4K4ZA 2RQKA 2FZGB 3N5FA 4QIGA 2DGVA 1NZAA 4DL0C 1DQ8A 2K7KA 3CDWA 4ICLA 2DPJA 4O4GA 5HN0A 3ILLA 1PJ6A 4QR2A 1REGX 3GU0A 5D15A 2H51B 4PEOA 4UTGA 3M4XA 1J5OB 4N77A 1T05B 1LNQA 4OZ2A 2WB4A 2BYCA 5HSPA 1X4EA 2O3DA 4CIOA 2QGFB 1FRJA 3EPGA 2VL1A 2IDLA 2R7VA 4K0KF 4TYAA 4A8FA 2QSFA 3FEZA 1FXDA 5LMNF 2OPPB 1B70B 2BE2A 3MI7X 5K8NA 5KT5A 3CCWA 3I9V9 4JI0F 3FZBA 3QJPA 1HNZJ 3W2VB 2CPYA 4O3PA 4WIQA 1X9SA 3CDBA 5F9NA 5KFBA 4K4WA 2RU9A 2MQMA 1ZOTA 4DQQA 4YR0A 4QYRA 3DOMB 2VICA 1RAOA 2NXNA 2V8DA 3Q8PB 2Y0SD 1HWUA 1DTQA 1IJFB 3KJVB 2EC2A 2GIQA 2WSEC 1OIAA 2GAHC 4CH1A 1EHWA 2DR5A 3GSIA 4M5MA 1CQNA 1TR0A 3I82A 5THWA 4P75A 4YHHJ 1VBZA 3HX9A 4ELUA 3QFHA 1OYEA 4IG0A 5A6WA 3LPYA 1Z2LA 4YB6A 1RT3B 1WORA 4UW2A 3DDIA 1V6HA 4OFZA 4IOCQ 4ZMMA 4NLSA 4P2FA 4WK1A 1UCNA 1NXIA 1S1WA 3FSYA 4B9VA 4IRKA 5GMKa 2DNHA 2QTWA 1RCXB 4EBCA 1BQMA 3Q24A 4U8VA 4YB7A 3LGMA 1SH3A 2NZ4A 1NB2A 3QSYB 3M9OB 2KXFA 1R0AB 3D54A 5CYMB 2K8GA 3H0PA 1KVKA 3UN5A 2DR9A 5GAHI 5IT9Y 2X1BA 5B0AA 2GMHA 1VRTB 2C2RA 4TYBA 2MQPA 4W98A 4AYBD 2B7CB 2J0XA 4B9LA 4ID8A 2V4QA 1RWMB 3R5BA 1VQ8S 2IFXA 2PSZA 3VCDA 4DR1J 1WF0A 2VDIA 2IDEA 4DF4A 2HHHJ 4E98A 1DLOA 4XTTA 5AXNA 5KFTA 3DYAA 3KFWX 5ETMA 1N33F 1VQ5S 2V4JA 3ENWA 2NXJA 2QMWA 2VQFF 4C8KA 4JI3J 1FDDA 3ZTPA 4O3SA 2IC3A 1HQEA 2V2KA 2KDOA 3CMES 3BKUA 5GADU 5HBMB 1S49A 1S6PA 5SUHA 5HJXA 3QSIA 3DRRB 3MWBA 2DH8A 2CJKA 3POTA 2AJ4A 2QFJA 4ZVTB 2EWHA 2EK6A 4B3OA 3MMJA 3IA0A 3JAMU 1K1QA 3H8YA 3B6BA 1VBKA 4ICLB 1UVNA 1UW9A 1FKOA 1RQ0A 4O4GB 4YN3B 4B3SF 1U26A 3PO4A 5CD4H 2RUSA 4KHPJ 4MIBA 4KE5A 3FSXA 3JYTA 1NK5A 4K4SA 4N7TA 3K59A 5HO4A 1NH8A 1A7GE 4IH5A 1EETA 2QA2A 3MM9A 3QYYA 2RHQB 4QYZJ 3JS9A 2JEIA 2QO3A 3Q8VA 2BE2B 4CLUA 4DBQA 3CC2S 1K9MT 2FJEB 3H2LA 5DO2A 2UUCJ 4OJ3A 3EUNA 4WFBQ 4X4SA 2DO4A 4G1IA 4QIWD 3QQCD 1NBEB 3D66A 4ZVGA 2ZBQA 3CXCR 2LEBA 2SXLA 1DTQB 1YIJS 5LXYA 5IFMA 1OSCA 1PAUB 4USUA 3W61A 1RT7A 3TJ8A 5KG4A 1S1UA 4KHMA 1IKVA 4DSFA 2Z2LA 4IG0B 1TELA 4DR6F 1IR1A 3HPOA 2A3JA 2C3PA 3GCWP 3CJTA 3UO0A 4B3MF 4ECRA 4FNIA 2EBEA 3SCJE 3TRGA 3NS6A 5E5NA 3BN4A 2XS5A 4L75A 3UQSA 3MMBA 4HLBA 2MKSA 2UUBF 2VPYB 3Q8SB 1TK5A 1VHIA 3CCJS 1S1WB 4G1QA 1T95A 1F2GA 3HHLA 3KWMA 1BQMB 3W9JA 2JC1A 3VV2B 1DFDA 4YB5A 2B4UA 4LBIA 3V4IA 2ZHAA 5L1IA 1GMWA 3GYNA 3N6MA 3KUEA 4XAKA 2EFGA 4OJHA 2X1GA 2X3DA 3ETMA 3FFIA 1X5OA 3Q2TC 1PKUA 2XLIA 3U1MA 2V9WA 3V6KA 1S9FA 3LP1A 5DDOC 2FIUA 3T9NA 1PO6A 1Q7LB 3PRVA 4J91A 2DIVA 3M2UA 2JEJA 5HK4A 3PXGa 4EK2A 3DYAB 1DBDA 4YUDA 2XB2D 2HVHA 3K2YA 2E7WA 2V4JB 4KPCA 2NLWA 2FHJD 2LDIA 1VR6A 1L3KA 2IC3B 3DXBA 1F60B 1HQEB 1XR5A 4LRCA 3EPIA 1W7WA 1S6PB 2WRMA 3ZNUA 3ZZUA 3PYDA 1HNZF 4FPIA 3HHKA 3POTB 1JNRB 4OX7A 2IY5B 5HQLA 1W26A 4B3OB 2VASA 2ACMA 2WSFC 1WEZA 4ILRA 2DNMA 2R2SA 5EN1A 4WFXA 3O44A 1X9MA 5GAEU 3SFUA 1HARA 3M6UA 4IR1A 1FKOB 4TLQA 2LCWA 4KH0B 3DOKA 1U45A 1KBRA 4YHHF 4RU2A 2X7IA 1NM2A 2QIFA 4ED3A 2WVFA 4LSLA 1KN6A 3GB0A 3VQTA 3OSPA 3H59A 4O3NA 4F4WA 2YBVA 1F6TA 2D7SA 2I9SA 3Q83A 3SXLA 4MKBA 5LM7E 3FZ2A 1EETB 3MM9B 3CDAA 3N9UC 2VG6A 3HO1A 4RBTA 2QEXS 4DPXA 5D0HA 2EFVA 1QLNA 2E29A 5IT9U 4OHYA 4PXDA 2YWGA 3QATA 3MGJA 4WF9Q 4PYAA 2DGWA 3M6VA 1RUSA 2A2CA 4MIAA 4KKOA 2W8LA 1RT7B 4ECYA 1S1UB 4Q7AA 4P52A 4OL8A 1IKVB 2FJAB 4DR1F
chains in the Genus database with same CATH topology
4UY85 3OR1B 2D9OA 2ZOMA 3HFKA 2FC9A 4KT0C 1SJ3P 2AW0A 4LF5F 2XMKA 1JLQA 3O6QA 2HHHF 2HNZB 2UVUA 4DQRA 2PI5A 2MYFA 4LIRA 4RW8A 4A48A 1FVQA 4KGMA 1S0MA 3D28A 2RSQA 5AXLA 5I4MA 2CFXA 1J2VA 4LF4F 1UEUA 3BO3A 3NCRA 4NPOA 4YDXA 1RT1B 2WBRA 2ILZA 1RYRA 3Q0AA 3BM7A 5A8WB 5DQIA 4J9SA 1KSPA 4NLQA 1VQSA 5CH7B 2BR0A 4AL6A 5T7LA 5E3QA 2W7OA 3U1NA 2KT5A 1MROA 3B4MA 1PGZA 3MMBB 4USIA 4JI3F 1VQYA 1HBOB 4IG3A 4Q2MA 2HW3A 2ZH8A 2ZH4A 4RUAA 4QZVB 1F5CA 3U27A 1JLFA 1N56A 1TV6A 3FQKA 4G1QB 1I94F 1RAJA 3DRPB 1VQKS 1WI8A 3DOLA 3HHLB 4C8NA 4CTAB 4CO0A 2MQQA 1ZTWA 1ROFA 2NPFA 2CPFA 1YHQS 1YJUA 3DFEA 4GO7X 4QPTA 5CA5A 1JKHB 2B4VA 2MSSA 3MPVA 2BACA 3G8QA 4DUYF 4WIIA 4ECWA 2ZH2A 2FLOA 3IN5A 4KFBA 5H9EJ 1SKRA 3KTQA 4HKQA 2MXYA 2JOQA 3V4IB 1E6YA 3HI9A 3TA0A 5KFIA 2NUHA 4EUVA 4LUBA 4ETZA 1SIZA 2X3GA 1SV5A 2RE1A 3VAKA 2IMWP 2PGCA 1TFYA 1S4FA 2CIMA 3VAMA 5GVQA 4E0DA 3ISND 2OMLA 4CI0B 3HHNB 1M5VC 2ZZNA 1VIOA 4EEYA 5IXUA 5GADI 1U48A 3FFIB 3M8SA 1N34F 4HH1A 2C3OA 4YY3F 2LA4A 1Y5NB 3MDFA 4NZ0A 2MY8A 3TAQA 1JLAA 2C3YA 2PDAA 3J81Y 2KTQA 2IYGA 3I0RB 1FDBA 3UE2A 3GIKA 1X4CA 5F8NA 4ED6A 1L3VA 2ADCA 4KB7A 4ED2A 4TY9A 3LP1B 3SQGB 1HNVA 1B7FA 3DU6A 2EG2A 1Q79A 1M0SA 1WG5A 4CO4A 4MYUA 3M8QB 2PFFB 1FNOA 1D0EA 4URQU 1EP4B 3R3TA 1WNEA 3UD4P 1YQHA 3N79A 1BQNA 3M2UB 2CPEA 4CNYA 2LDYA 4KHPF 2FVSA 4PPDA 3LUYA 4PR6A 4M94A 5IWAF 3R5CA 5CCMA 3OLAA 3US5A 1HPZB 3IRXB 4I2PB 3W3SA 3UI3A 1UWBB 4WYLA 3DM2B 3RRGA 5F8HA 3QZ7A 3I31A 1Q78A 4EWTA 4PPZA 3QO9A 1REVA 1UJ5A 2MZQA 1D8ZA 4QQBA 3SCLE 5ADZA 3GIIA 2FVRA 1S97A 1QY7A 1JK9B 4K2XA 1TL5A 2YNIB 2KZMA 1YGYA 2OJ3A 3MCSA 3BN7A 3WC0A 5B0BA 4KV8A 1VFJA 2MB0B 3U1LA 4J5OA 4WTYA 2HVIA 4NYOA 3EYZA 3MXHP 5F8MA 1TAUA 1ZM2A 4G6VB 3CE8A 1WELA 3I56S 3CVKA 2V9KA 3KLHA 3PFOA 4C8LA 2VV5A 2CQPA 4NLRA 2IVMA 1H7WA 1U8SA 2DGXA 2M5YA 1U1LA 5ITHA 2ZITA 2EK1A 2WB1D 2WHOA 1HR0F 1XR6A 5EGYA 2OO4A 2RQCA 4M8LA 4X84A 1HNWF 3LQVA 5KG1A 2UUCF 2IVFB 4N41A 5B0CA 3TOQA 4IH7A 1YBAA 1C1BB 2GHVC 3P6YC 4F25A 3HHDA 3HVTB 5J2NA 3MR2A 4DF8A 1QSSA 4PG6A 4DEZA 1JJHA 4F67A 1LFPA 2GV1A 2EFQA 2DPIA 4MTPA 4OZ5A 2CJ9A 2RT3A 2LXUA 1VHFA 3K57A 3TVKA 4JV2A 2QA4S 3ITHB 3QGHA 4RNHA 4EU0A 3KK3A 1MMDA 1C1CB 3PNIA 2ROEA 1XNQF 4HT5A 1S7HA 3GG1A 3VF0B 2HHXA 3DHXA 2GMLA 4KAIA 4LF9F 2J0WA 1IUJA 2RH3A 3B82A 2HHWA 4YR2A 4DOZA 3RR7A 3GV5B 1B0TA 4H4MB 2CRLA 4C3KA 4NZ6A 1UJ6A 5HP1B 3CD6S 1FCAA 2MHEA 3DOKB 4BC7A 2AGQA 2NXUA 1U1NA 1T8EA 5EDWA 1LWEA 4A8WA 4NLUA 1VQNS 1Y7PA 2FPHX 5B08A 5F9LA 3OPKA 4LT6A 1X9WA 1WACA 2MMYA 4RW7A 4F26A 1T7PA 1S72S 2J9CA 3IO1A 1VJWA 3F44A 2I2YA 1N0UA 4LSLB 5HLFB 1HHTP 1QJHA 2J9DE 2YWFA 3I5AA 1PILA 1SUQB 1IKXA 5CCLA 1NK4A 3CC7S 5F8JA 2ASJA 5BYQA 1KHWA 4LF7F 2FY1A 4DUZF 3QMQA 4FS1A 5FDLB 4C7QA 1N5SA 1C4AA 3BQ0A 1OSDA 2BUNA 1XR7A 3CJ4A 2XNRA 5KFOA 3CB4A 3IS9A 5J1EB 2UVRA 2WCXA 3D1QA 1TL1B 3PIPQ 3N0VA 4YFUA 3OQ2A 5F0WA 4EGLA 3QGPA 2W24A 4J9RA 2WSCC 2Q66A 3KMQA 2V94A 1T3NA 3IRWP 4PXCA 2APOA 2F7VA 3E2EA 3NRBA 5JVGQ 2OSQA 3OTEA 5GAGI 3V4MA 2BXJA 3MHYA 2F9JA 5DQGA 4J9QA 3THPA 2M4MA 2XWYA 3P49B 2CZVC 3L95X 3OL8A 1NJXA 1S76D 4DS4A 4QBUA 1C0TA 2LLZA 2XY6A 1M5KC 3OUYA 2HLTA 2ZH9A 4EFAC 4WK3A 3RB6A 3B78A 2XEXA 4MK9A 3DLBA 1CC7A 1T94A 4RW9A 3T9ZA 4MK7A 2AU0A 1ZM4A 2LQJA 2YNFA 3BF4A 4LQ9A 4NLVA 3KYLA 1GNKA 3G71S 3KLEA 5LJ5Y 3OHAA 2L9NA 3H2VE 2KG0A 2DNNA 2YKPA 3JTOA 2BANA 4N47A 2XMMA 1Q82T 5EWGA 5L38A 2UXBF 2HMIA 2AP6A 2B7BB 3M05A 1IKWA 2VUGA 4X4QA 4JI1F 4IFYB 2YWHA 3TQ1A 5CHCB 4DFPA 1U09A 4KKOB 3MM6A 4DV4F 4TLRA 2JVOA 1WHWA 3TR5A 2N7YA 5EUHA 2J0QD 4JI6F 3LW5C 2H5EA 4OZ1A 5I42A 3N6LA 2BQUA 1S79A 3SV4A 1H38A 4P2SA 4F3QA 2XCAA 2F8HA 3HK2A 3CT9A 5DM6Q 4OIXA 5HMZA 5BJRA 1Y5IB 4RLEA 3VAFA 2G1DA 2HS3A 1JLQB 3PW7A 2AJFE 4CH7A 4RW8B 4PUOA 4HHJA 3UWTA 5KG5A 3HXMA 2XO7A 1VS3A 3CIMA 2DNPA 3F56A 3ZZOA 2O67A 2XI2A 3ETOA 1YJWS 4P6QA 1D3WA 1Z1ZA 4Y0FA 1URNA 3DI6A 1RA6A 3E3XA 3FJ2A 2VPXB 4NRUA 5T7LB 5L1KA 3MTKA 4UY8T 3NL0A 3HDSA 3X1LB 4ZS6A 4URGA 1FNMA 3CIZA 3OW2R 3NMAA 1VQPS 1MROB 1LW0A 2KFNA 3MUMP 5U47A 2HHUA 4IG3B 4JV1A 5BYSA 3SCKE 2DNZA 1N0VC 3ENVA 3PRDA 1JLFB 2KT2A 4QW9A 2B5JB 3T1AA 2MGZA 1U6ZA 5A2QY 4DSEA 3DOLB 4ID5A 1XNRF 3GZ7A 2XS7A 4K50A 4KJIA 1Q81T 1Q1KA 1RGVA 1LFWA 1HFEL 3ISNC 2ZH3A 1RTIB 1PC5A 3CCTA 1MMNA 3T1YF 2B9YA 2A2DA 4USJC 3PW2A 3CO9A 3UDCA 1FESA 3DLKA 3IWLA 4CT9A 4EYIB 2LVWA 2F3JA 5LL6d 3KLGB 1S0OA 1D8YA 1WTBA 1SJRA 3CGIA 4KFBB 1D1UA 3W7BA 5F8IA 4NX9A 1E6YB 4IYQA 2AYBA 1B0VA 3GFXA 3OJUA 3J7YI 3KHHA 1YG0A 2ZBCA 3BSNA 3HP6A 4J9MA 3N6NA 4H4KC 4A47A 1X4DA 4TKTA 2ROPA 3J7A1 2POKA 1XN9A 4HTJA 3NBPA 3FRYA 3QLHA 3C3LA 3JSBA 4BWJA 2OPRA 2VBXA 3DU5A 2R7WA 4DS5A 2R8GA 4WXOA 2VFTA 3MM7A 3IFEA 2VC0A 2AGPA 5D77A 3PX0A 4KIAA 2HVZA 2A1BA 3MMCA 3R5AA 4ZP6A 3PV8A 1QAIA 3SSRA 1JLAB 2QLWA 1NK7A 1UVMA 2K3KA 2DR8A 4RUHA 3TAPA 4K5RA 1SL0A 4Q5VA 1R7IA 2J9EA 4BWMA 4FS2A 2LU1A 4A8QA 2M2BA 2W9AA 1HNVB 4QCLA 2XMJA 3TUJC 2UUWA 3AY0A 4JV0A 3V2UC 4C3LA 3MOJB 2W7AA 1NK0A 3I4PA 2DHSA 3GFYA 2DGQA 2ZC3A 1QE1A 2MPUA 2RRBA 1W2IA 1KQGB 3K58A 4KPYA 2BVZA 4IUFA 5CYQA 4ZCKA 4ZP8A 1BQNB 1NH7A 3PR5B 3RW6A 2B51A 3CCMS 1WF2A 4XIUA 4AL7A 2FJXA 4BC9A 3M6WA 4OZLA 3CCQS 1F5AA 4CO2A 5GAEI 1U6BA 2OKQA 4WYWA 5HQ8A 1L3TA 2LECA 4ES3A 2KVIA 4LVOP 2HS0A 3PVXA 4KSEB 3QO9B 1REVB 4O3QA 3THTA 4DL2A 1P1LA 4DV3F 1KTQA 3F41A 2RJZA 4DR4F 2FJDB 4B3RF 1D9AA 4KV8B 4KO0A 1UFLA 3C8YA 2IA6A 2AYEA 2XHWA 4PWDA 3VZIA 3RB0A 2DD8S 3H4BA 1DLOB 1HNXF 1R8CA 1SIWB 1TKTA 3QWUA 1NJWA 4LFBF 2BW2A 5L1JA 3KLHB 3C66A 3O2IA 4K4TA 3OLBA 2AGOA 1RDRA 2DGOA 3K8WA 4DR2F 4KTQA 4X4NA 4QWEA 3D0IE 3MAHA 1U1KA 2RILA 4O4RA 2HFZA 3A8EA 5G0RA 4Q43A 4LFAF 5KFVA 3IWXA 4GO5X 3QIDA 1UMJA 3DDNA 2DHGA 4ZHRA 5D8HB 1BWEA 3BDPA 4AXIA 5J2NB 4FF2A 4XK8C 5FD1A 2HNDA 1YJTA 2UZAA 1S48A 4ZP9A 2V0NA 5KFMA 3OJSA 2DO0A 4WFZA 3SSQA 2RMLA 2XGQA 1VQLS 4PQUA 2LKZA 1FRHA 3NCPA 4OZJA 2HHTA 3R5DA 4DV1F 3Q8RB 1M5OC 3L09A 3KK3B 3GQCA 1JNZB 2VA2A 4ED8A 3T5JA 1UJ4A 2GX8A 2P6TA 4RW6A 4BBYA 1VQ4S 1UVLA 1RTDA 1SQEA 2MQOA 5B7WA 2E5GA 2J6UA 1S1XA 4RU9A 2DRAA 4LSNA 2BJEA 4C8ZA 1SKWA 1X7VA 1XK8A 2IHR1 1JLCA 1HI1A 3R27A 4CT8A 3A1YG 2J5AA 2FJBB 4FF3A 3MD3A 1LWEB 1G6BA 3RB3A 2XLJA 5DM7Q 2Q43A 3GR1A 4RW7B 2CQ0A 2NYIA 5K5MA 5F8GA 3DN9A 4HT7A 3TYTA 5K14A 1NHUA 1UETA 5DJBA 3NNCA 1NKEA 1IKXB 1F9FA 2KM8B 2HWIA 3CCZA 2D3ZA 2HRUA 2R2RA 3RB4A 1I6JA 1N6QA 1VMBA 2VC1A 4XPEA 5IM0A 4NCBA 2HGNA 1LXNA 4QU7A 2K7JA 3IS9B 2VG7A 4RNOA 1HQUA 4ED7A 4Y6IA 2F4VF 2XBPA 1QAJA 3FEYB 4LJMA 1VRUA 1ZAVA 3GILA 3IAM9 1QVFR 3CSKA 1S10A 5HBMA 2W9BA 4PG5A 3OL7A 2M9KA 2GJ2A 3S7RA 2DVIA 4ES1A 4X4UA 2DTJA 5DETA 5KFYA 4G3IA 2VKRA 2HZCA 2CPDA 3JYTB 1U25A 2GQ2A 4F4YA 5DGAA 4B3TF 1KNZA 3GFHA 1R8BA 1NB7A 3GWCA 2VFVA 1N5VA 2BV3A 1N54B 3HVAA 1OO0B 4WXWA 4I2QA 4PRFA 2B4OA 4MKAA 4EYHB 2MKJA 3I96A 3OUYB 5IT0A 4QR0A 2DH9A 2YVSA 2P9EA 3UCZP 4M5DA 3RAQA 2OIHA 1S77D 1U1RA 2HFOA 3DRXA 4RW9B 2YNFB 5F8LA 2JDJA 3B4DA 3OVAA 3TANA 4ITSA 1M1KT 5A8KA 3CD7A 1YRXA 2N3LA 4ZPDA 3TW0A 3KLEB 4HDGA 2FVQA 5KT2A 2J6SA 2JFDA 3MECA 2BANB 2VFUA 3FMWA 4IQXA 3MPYA 1TKZA 3ISZA 1RJJA 4DL4A 3V81A 4I67A 3C6UA