4OJGA

The crystal structure of v84d mutant of s. solfataricus acylphosphatase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
EMLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKDDYSFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Acylphosphatase
total genus 23
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ojgA00
2LQ9A 3BF4A 4OJGA 5T7LB 4DL0C 1YJVA 5B0CA 5B08A 1AFJA 1Y3KA 2HLUA 2BBEA 5K9FA 5B0DA 1Q53A 5F0UA 2KT2A 2W4DA 2BJEA 2HLTA 1MWZA 3BM7A 1TZ0A 2HQIA 4OJ3A 2N4DA 4HH0A 2HFOA 2LDIA 1QUPA 2ASYA 4QOTA 5B0BA 3QGPA 3HHLD 4A46A 2K2PA 3CJKA 1URRA 1S6OA 2OMOA 3WDOA 3DCAA 1IUJA 4YEAA 1LQ9A 2BYCA 2OFHX 2PD1A 1KQKA 2FIUA 1Q4RA 1TL5A 1P6TA 2FHMA 1AW0A 1KVIA 2ROGA 2BJDA 3TNVA 2W4PA 3F44A 3HF5A 2GV1A 3QMQA 4Y2KA 1FD8A 2AP6A 1Y9OA 1Q8BA 2RSQA 2QLWA 1N5TA 2VV5A 5A6WA 3UDCA 5KAKA 2RMLA 3DXSX 3IWXA 3LGNA 4A4JA 3CJKB 2LXFA 2OAUA 5B0GA 2L3MA 2RILA 1SQEA 1CPZA 2GGPA 1JK9B 4Y2IA 2QYCA 3BN7A 3MCSA 2OKQA 4HL9A 5T7LA 2W4CA 1N5VA 2HIQA 2IYIA 2CRLA 4OJHA 4A48A 4F67A 2PGCA 4DPOA 1X8DA 1CC8A 1FE4A 1TR0A 5B0AA 2OD6A 3KKFA 1W2IA 1Y0HA 3MZIA 2ROEA 3HHLA 3K7RA 1YJTA 3FRYA 3TRGA 1AFIA 3HDSA 1OPZA 2FB0A 1V3ZA 4Q2MA 3LO3A 3E8OA 4NPOA 2N4CA 2XMUA 1YG0A 1SI9A 2XMVA 3HHLB 1FVSA 1OQ3A 2G9OA 2GFFA 1OQ6A 4FNHA 1X7VA 2K1RA 2QLXA 2IFXA 4U9RA 1TUVA 2N7YA 2RU9A 4EFAC 3KG0A 2XMKA 2ZDOA 1CC7A 1GXTA 2OP5A 4ZOSA 2EW9A 1N5SA 3HX9A 4ZA1A 5F0WA 5A6PA 1SB6A 2VH7A 5IXUA 2Q3PA 2GA7A 2GGPB 2FTRA 4HI1A 1ULRA 3IWLA 3KG1A 1MWYA 1U7LA 1FE0A 5B0EA 4FNIA 3FGVA 2AW0A 1JWWA 2IYGA 2GCFA 3GZ7A 2K7KA 2ZDPA 4Y2MA 2KKHA 3BDEA 1FVQA 1GXUA 1N5QA 1OSDA 2GO8A 2XMMA 1K0VA 3HFKA 2LQBA 1Q8LA 1APSA 2ROPA 2K7JA 3BGUA 4HH1A 3BR8A 4Q2LA 2QIFA 2XMTA 4HI2A 2KT3A 2AJ1A 3I9ZA 1YJUA 5B0FA 1X0PA 1VQYA 2OFGX 1TL4A 3LGMA 4YDXA 1Y3JA 4OIXA 5B09A 4A47A 2OD4A 1WD6A 2XMJA 4NL5A 1VQSA 3TOQA 3FMBA 3T9NA 3KNGA 1YJRA 4DN9A 3HHLC 2K1RB 2XMWA 1RJJA 2AJ0A 2KYZA 2JDJA 1P8GA 1XBWA 1FESA 3BB5A 3VTIA 1S6UA 1YRXA 1FEEA 2ACYA 1KVJA 2HFNA 1R6YA 4OJ1A 2BUNA
chains in the Genus database with same CATH superfamily
2DH9A 2NYHA 1D1UA 2I2YA 4DSIA 4NYZA 1HBUA 1HQUA 1D8YA 2H54B 2J6TA 3CO9A 3OXLA 1MU2B 3W64A 4NCBA 2KXNB 4Y2CA 3CCJS 5HROA 4PG5A 5KFDA 1LFPA 3KJQB 1RXOB 1REGX 2J5AA 4N8NA 5EWGA 5CYMA 2ACMA 3DRPB 2V4QA 2XNQA 4KY3A 1S10A 1RK8A 1S5ZA 4W98A 2HS0A 3HHLD 5CABA 2UU9J 5HAOA 4UOFA 3JYTA 3D0IE 4K4UA 5E2QA 3MECA 3HM9A 4DSJA 4W4MA 3M05A 3CE8A 5KG6A 5L38A 2FHMA 1AW0A 3H7HB 3MAAB 2EG1A 3K57A 1F5CA 3OQ2A 4OL8A 3LP0A 1JXVA 1VMBA 2BM0A 3OHBA 4DSEA 4K4VA 3D4JA 4TU9A 1FJEB 3A8IA 4G1PA 1CG2A 3IWXA 3QIDA 2XGQA 3BO3A 1VQMS 2F7VA 1FKPA 1X31C 2QRRA 2OKQA 4DV3J 1HIYA 3G82A 1IQZA 2GAGC 2RHSB 1CS4A 3DRRA 5E0OA 3VAKA 1ZM2A 3MECB 1DJ0A 1ZZFA 3EVMA 3H2UB 3CCRS 4LFCJ 4LJMA 1RAOA 4GVBB 4JV5J 4RU2A 5EN1A 5J1EB 3NOGA 4YHHJ 2WBMA 4L72B 4C8LA 3AJDA 1SV5A 1SJQA 2YKPA 5IOLA 3UD4P 4IRKA 2KRRA 1QTNB 2QE5A 3NLCA 2DEIA 2XMVA 3QT8A 3ELHA 4F02A 3CD5A 4HTJA 2G9OA 1K47A 3MR3A 5GAEU 2WTFA 2MB0B 4PG6A 2MLXA 2IFXA 2QL9B 2V4JA 3U27A 2R3VA 4ES2A 4O0NA 1P1TA 3MM9B 4DQSA 2F4FA 4B3TJ 2XYPB 3LF0A 5KT5A 3HVWA 4CIOA 2XHWA 2FC8A 4TQSA 1RT2B 2V8VA 1XTZA 1LWFA 5L1JA 2BDPA 5DDQC 3H5XA 1GXTA 4K4ZA 2RQ4A 5KFWA 2NPIA 1LFWA 1EP4A 2HNZA 1NEEA 5GAGI 2IY5B 1RLDA 1UETA 1S49A 2EVZA 3CW2C 4TLRA 2V50A 3FDSA 3DYAA 3DRYA 4ED4A 3TZYA 3DDKA 3TAMB 3MUMP 3W62A 4H4OB 4B02A 1BQMA 3M6WA 2FYXA 1F2GA 1TKXA 3CB4A 4G65A 2YKNB 4URQU 1WHVA 1FFGB 2ZNZA 4WIQA 3M6VA 4WE1B 4USTA 4BS2A 1RAFB 3MMCB 3FZBA 4I64A 2W8LA 3W5XA 5J2QB 1NDCA 2LFVA 4USUA 1GX5A 5CD4H 2BMBA 4UY85 4TYBA 3MEDA 2BZ2A 3Q2SC 4UOCA 1SC6A 2VPYB 3OFGA 2ZH6A 2VA2A 4PRFA 3EVOA 3MM6B 1RTDA 3LGMA 4P72A 1LWFB 3FBBA 2GIRA 1NJIT 1TL7A 8AT1B 1E6YA 3KNGA 4IDKA 2HEKA 2NS1B 1BD6A 3WZ0A 1TK0A 1SKWA 2WVBA 3G8SA 1S1WB 3C66A 5AE3A 5D4LA 3W66A 1DTQA 1YBTA 3DRPA 1GNKA 3HVAA 3LQVA 1P8GA 2XYHB 3DHWC 2ZHAA 1X60A 2VBWA 2D3O1 1XNRJ 2HS3A 5RUBA 1C1BB 2YX1A 3AA9A 4K4YA 5DGAA 3R5DA 3I9V9 3KG4A 3SDEB 3J81Y 5KFLA 1IKVA 5B08A 3OJUA 3QQCD 4LBHA 4DF4A 2FDNA 2V4RA 5LXRA 2ADCA 2EFGA 3DM2A 4B9MA 2WVFA 3RAMA 1XK8A 1HHQA 2IVMA 3WC0A 4YQWA 4QJVA 3U1LA 2QA4S 2DR9A 5HBMB 5KFIA 2FHKA 5U47A 2N4DA 3R97A 1ZTWA 2KJWA 2PEHA 5ITHA 4KGVB 1YRTA 1IJFB 1Q7LB 3AXMA 3RRHA 2ZE2B 4DCPB 4QYZK 1FWKA 1NU4A 3T9ZA 3CXCR 4CWBA 5H1SV 2RUSA 2Q1LA 3O5TB 1VQ7S 5HQMA 2ZZNA 2OEJA 4LFBF 4FPIA 1KQKA 1X9MA 1U2CA 3K17A 1IWGA 1BUXA 1U48A 4DWIA 3P49B 1P6TA 2OH2A 2QO3A 4ELUA 2MKSA 1U1QA 2HBRB 4MYUA 3FCVA 3MMAA 3KMSA 2YBVA 1HBOA 1NJWA 1MWQA 3IO1A 2BW7A 2ZH8A 4FDFA 4FYVB 1NXIA 2PC6A 2FZGB 2H3EB 2WZ1A 2Z2LA 3CSKA 2B5JB 2CPEA 4NLQA 4A4JA 4QWCA 2O3DA 4ED3A 3CCTA 3OBIA 3TAMA 1JK9B 2V9WA 3QRQA 1SKSA 2DGOA 2DNLA 2KZZA 5MAOA 5DDPC 1SVDA 3FK4A 5HN0A 5ADZA 5E3RA 3H0PA 3J7YI 1ZETA 3AD7C 4FYXB 3HD2A 1SXLA 1FJ7A 1DLOA 5GAEI 5IT4A 1KVKA 2H5IB 4GMKA 3SCIE 2MZ1A 3KLEB 3TAQA 2DRAA 4HR2A 2OMLA 2WBRA 2ZEJA 1EIYB 3E8OA 1WACA 1C0TA 2XMUA 1WSVA 3BV8A 1NKEA 1RYSA 2HGLA 4I6WA 4P2XA 1RGVA 3SMZA 2B4VA 2NZCA 1T3NA 3W2WB 1M5PC 4DR2J 2RT3A 1T0TV 4KHPF 4RW7A 2HNYB 2N7CA 3ZZZA 2ZOFA 2MQ8A 2DHSA 3DRSA 4HDGA 3M7VA 1KWMA 2WSFC 4ZCKA 4JUZA 4ICLA 5CAAA 5DM6Q 5BJRA 3KJVA 4A8FA 4F25A 1N5YA 4YY3J 1S79A 3FSXA 4OYAA 2P9EA 4WZMA 1BGXT 1Z4UA 4H4KC 3MWBA 1I6JA 3W60A 5LSLA 2JX2A 2VG7B 3TX8A 5KG5A 4HEA9 5IXUA 2IAJA 1L3VA 3RRGA 2V68A 2GA7A 2GGPB 4UUWA 2NUUG 5F8IA 1IJEB 1Q8KA 1Q86T 1VQLS 2U2FA 1Q5YA 4GC7A 2GJIA 2MLYA 1X4FA 4QPXA 1XERA 3VAHA 2VODA 3BJYA 3Q8UA 2VICA 1OWXA 1Y5LB 4UW2A 3QZ7A 1F3FA 3QATA 3TJ9A 3HMJG 2BRLA 1N5QA 3VQSA 2MQPA 2J76E 3M2VB 2VONA 2LQBA 3C16A 2PA8D 3KOAA 2LXIA 1VQOS 3GV8B 4UOHA 1TVRA 5IV3A 1FRKA 4I6AA 5KFXA 3AOCA 5GMKa 2W24A 2R7RA 1M90T 1J5OB 3CCUS 1IKYB 2A6MA 1RWXB 2ZD1A 2JHEA 1K1SA 3U1MA 4K50A 1HWIA 4OI0A 1SC1B 2FY8A 3HO1A 3K0JA 2ZBIA 4N7TA 3HHLC 4PXBA 3IG1A 5KFBA 1LWCA 1YTYA 1U4BA 2Z2YB 3NKYA 4RW9B 4ZLPA 4RW6B 4V19J 1UWBB 2BRKA 2JOQA 4PAAA 3BQ2A 2DVIA 4WXOA 1KVJA 1E6VA 2DXEA 1RT1B 2L9NA 4PZVA 5B0DA 5J2NB 2CZ4A 2EC0A 1LEOA 3N01A 1W26A 5T7LB 3TZZA 4ZVTB 4WU3A 2ZKTA 1LV5A 3M8QA 1KQSR 2FHJD 1Q78A 2QL7B 2IA0A 3NCQA 4FVMA 5F0UA 1GTHA 2PMWA 3H42A 4OI1A 2IJRA 5A2QY 4CH1A 3I55S 5E3PA 1S12A 4JI2J 1V5VA 2HFOA 2LDIA 4KRWA 4P9SA 2DNQA 1S1XA 2Z56B 1HBNB 1Q16B 5KFZA 1KSPA 1SC4B 3WQPA 2PT0A 3WDOA 4NCAA 1WC1A 2RRAA 1SJFA 2BEFA 3LPEA 5CYQB 4ZPVR 1RT3A 4CNYA 1A0OB 2BYCA 3OL6A 2R8HA 4OI6A 4DBQA 1T9YA 4ZHRB 2XBPA 3UVJA 2ERRA 1JLGA 1REVA 4B3RJ 3PXGa 3G6ES 2HHTA 5L9NA 1VQ9S 4M5LA 1S72S 1EKRA 3QMQA 3CJ3A 1I94F 4DL6A 3C6TB 1BC6A 1HQ2A 3LGNA 4IFYB 3TVKA 3CJKB 3I6PA 2RKIB 3K5NA 5DG7A 4C8YA 2GGPA 4NLVA 4ZVSB 4ILRA 5T7LA 4EZ6A 2M7SA 2IPOB 1N5VA 2DY9A 3CEDA 3ZTSA 2YVSA 5GAHI 3ZNJ1 2PGCA 2HMIB 1D0EA 2M70A 4DV4J 1KRPA 1NNDA 4W90B 3CJ4A 2VQEJ 3RB0A 1W2IA 1VOMA 2ZUAA 3QLHB 2W9BA 3PFOA 1T03A 1D09B 1WC5A 2H4WB 5HK4A 4AT1B 4LF4J 3D6FB 2AEJA 2XULA 2VKZG 1CEZA 1EARA 3MM5A 1W7WA 2CQ3A 2V2VA 3G2XA 4PXDA 3MMBB 1SL0A 3FKBA 2D3OR 2GZOA 4R0EA 1N6QB 4ZLJA 4KPCA 4X64J 1OQ6A 1WHWA 5LJ5Y 3O1LA 1XMQJ 4WIIA 1SCJB 2V8GA 4WE1A 4IG0B 3D6TB 2N3OA 3L9ZA 2IRXA 1LWEA 3B82A 1IM4A 1MMLA 2OLWA 1HL6A 1RQ0A 4DCJB 1N36F 3D68A 3NGUA 1CC7A 4TY8A 5AJ3F 4KB7A 2YWFA 2EFPA 3CJRA 5I3PA 4ZJOA 1DARA 3L7PA 1IKWA 1IBMF 2FPHX 1JLEA 3IRXB 1CJUA 2ADBA 1GH8A 2NSBA 1VJWA 1IR2A 1GQEA 4GVBA 1L3KA 1F6TA 1U7LA 2OTJS 2AYBA 3QBCA 4IH7A 2BXJA 2QL5B 7AT1B 1U1RA 2J8SA 1VR6A 3L95X 5D4NA 4DV7F 2PO4A 3MPVA 3M2RA 3SQOP 1J5EF 4LF8F 2XI3A 4DPXA 4JYAF 4F2SA 4PWUA 4WCEQ 4X84A 1YI2S 1CJVA 3CDAA 4HH1A 1N6QA 3BGRA 3JS9A 3DYAB 2XC9A 2GHVC 1BWEA 2YNFA 5KOWA 2CJBA 2W7OA 5DRKA 4X62J 1O51A 4N76A 1VQYA 5A8RA 2W1BA 2YWGA 2WW4A 3UO0A 4X4UA 4EI2A 4UQTA 5B09A 2HAFA 2V8PA 1S9GB 3HVTA 2VD3A 1M5SA 1HNIB 4NE9C 3BKFA 1T95A 3A12A 3JSRA 3Q83A 4J9MA 5GAGU 1O8BA 1U2RA 2NXCA 4DN9A 2VG7A 1WG1A 5FDLB 1S97A 2X3DA 4DS5A 2RNEA 4OX8A 4F4AA 4QIGA 2W01A 1LXJA 4GKKJ 4CYUB 4QWDA 2F63A 2V34A 4ES1A 2KXFA 1Y4ZB 2FVCA 1R6YA 2BUNA 3HSZA 3NNCA 4L3KA 5IM0B 4QR1A 3OV7A 2I9SA 2FZCB 1NRKA 1JXEA 2W2QP 4P2FA 2W9BB 2DHGA 4OHWA 1OMSA 3PKYA 1X0FA 2OTLS 3I4HX 3BGLA 3ZC4A 4JI4F 5C2CA 3THPA 2DGVA 3CDUA 1BQNB 1S7HA 4FS2A 2C3PA 4K5RA 9ATCB 2YWHA 1RDRA 4IR9A 3W9IA 2GVDA 1S7IA 1FKPB 4RWWA 1KR4A 3GJSB 5E41A 5GADI 3CJKA 4FN5A 4TKTA 2GC8A 2M8HA 3ENVA 1UCNA 4WWSA 4J9LA 1RAAB 2B51A 3E01B 3AB2B 3GE9A 1UEUA 1NK5A 4CT9A 1J5OA 5DG9A 3POTB 1PGZA 4MKYA 1SKRA 2FVSA 3IR6B 1DQ8A 2ZC3A 3AD9C 1HNVB 3GCWP 4G1QB 3ULHA 4MFBA 4U7UD 5JMNA 4RNFA 1GMVA 1XNQJ 4IDKB 1FD8A 3A3NB 4TYAA 2AYGA 5CCMA 3QJPA 5CYJA 5KAKA 1G4CA 4MTPA 4RW6A 2CPIA 4PG4A 3ZXWA 1RISA 3LTOA 4RJVA 4CLWA 1TL1B 4DPYA 3ONQA 4USKA 4Y2IA 1S1UB 2H1YA 5JXSA 1LKZA 5IM0A 3TARA 4ICLB 3CJ8A 4ALZA 3CT9A 2E7WA 4NCGB 3GONA 2BANA 2CNLB 2V94A 4NLUA 4RLEA 2CJYB 3D6HB 2WVCA 3RW7A 5HROB 2E1CA 4FYDA 2C2OB 2Z4PA 2ROEA 4ZPBA 4QWEA 2YY3A 4Q5VA 1YJTA 4QWAA 2XMAA 1NZAA 1RHRB 3FRYA 2MJNA 1IBLJ 3HDSA 5C7PA 1WC6A 1ZA1B 2DNZA 2FGCA 2B9WA 5HBMA 3W5YA 3EM1A 1JLFB 1SI9A 2ZC4A 3I32A 1WC3A 3THTA 5D4PA 1QAIA 1KNZA 1OYEA 4NZ0A 1RAEB 4NA2A 4QR2A 2LQ5A 4YR3A 1RT6B 1NLKL 1O5JA 3D5MA 1AT1B 1T02A 3KLIA 5BXIA 3JQKA 3VAGA 3CCZA 3PZPA 2L41A 1UVKA 2COLA 1U45A 4PQUB 1SH0A 1S6QB 3AFGA 1UMJA 2V69A 4C3MA 4RU9A 2O1PA 2XHCA 4LF7F 1WKKA 3UNYA 1RU1A 3D1QA 4O44B 2J8AA 2KXHA 2IAJB 4FP9A 5CZVA 3RU0A 4LSZB 4EMDA 3SXLA 1NPKA 1NB7A 4DL3A 1LOUA 1XWLA 4LRFA 2VJUA 4I2PB 4ENOA 4HI1A 2DR6A 4USHA 1FTCA 2HPUA 3MPYA 2ALYB 4QWBA 4G6VB 4ZLNA 1VIXA 2FVRA 3SFGA 1HFEL 1UEVA 2HHWA 2CG4A 3M32B 3TUZC 1FXRA 2AJFE 2XMMA 4PG7A 4AFFA 4LF5F 1WNEA 2QA1A 2E9RX 2Y8YA 2GQ2A 1RTJA 3FSYA 5J1PA 2HHUA 4J9NA 3SSSA 3TQ1A 2EG2A 1N0UA 3SBMA 2KT3A 4M5DA 2MSTA 5I3UB 4LRAA 3Q8RB 1CS4B 3IFEA 4UT4A 2R8IA 3T1HJ 3FRZA 1NDPA 4HTIA 1C0UA 2BW2A 3MM7A 5FD1A 3POTA 3TEHB 1HHSA 1ZA2B 1CQMA 3KK1A 4NL5A 3CD7A 3KJVB 5KT6A 1RWPB 3D66A 3NGKA 5ETOA 1LW0A 1KTQA 1VS3A 3KLGA 2MEWA 2PE8A 4JI3F 2K1RB 3H5SA 4H4KA 4K8RA 4KQZA 1RJJA 4D3HA 5BYRA 3QT7A 1S77D 1VC0A 2FC9A 1DRZA 3AHPA 1WOPA 3IGNA 4OYBA 3ISZA 1JLAB 3NBPA 5DQIA 2HFNA 2ZBRA 4JI8F 4X66J 3SQGB 4JP8A 5AXNA 2LCWA 4RUAA 3QT6A 3G8QA 2LA6A 2XO6A 3HKWA 1GX6A 1T11A 3BBFA 4M5MA 2LDYA 1TKZA 4C0BA 3QIPB 1BXNA 2W25A 3D67A 3CUNA 4ZP9A 5HLFB 1Q81T 3MEGB 1UTAA 1CJVB 3KUGA 2UUBJ 1VRTA 2KHDA 1URNA 3I5BA 3PFEA 4IG3A 4OV1A 2ASYA 2EFNA 5E5NA 3UR3C 4NZ6A 4C3KA 4K4XA 2OUGA 3EUNA 5D0RA 2CPDA 3HPOA 2Z2MA 4YEAA 1F60B 3Q86A 3DOMB 1S9GA 3Q23A 2IVFB 5EDWA 1LWCB 1U1MA 4JV1A 1EETB 3UDLA 3W2VA 4UZCA 2YPYA 1X9WA 4O3PA 1H6KX 1Q8BA 1YITS 3HK2A 4RZRA 1VHFA 3MR7A 4XDCA 7FD1A 5B0GA 3C3LA 4DSFA 3VHQA 4I2PA 3V5RA 4JV5F 2H5JB 1QY7A 3DN9A 3D9BA 3KLFA 2IYIA 1R0CB 1E6VB 2MZJA 1PYOB 3P5TL 3WIUA 3CJ5A 3IBWA 3V4IB 2E1MC 3BDPA 5LOQA 3BR9A 1AUDA 2ZWPA 2Q79A 3OFEA 4Y6IA 4C97A 1N32J 1RUSA 3KKFA 4FBUA 5EHHA 4DR3F 1RE1B 1UEKA 1HBNA 3FBCA 1DURA 5J1NA 3DMJA 2FJEB 2CDQA 3HHKA 3GV5B 1C4AA 2F8EX 3SIPB 4NOHA 3TRGA 3BQ0A 1BQXA 4YDDB 3EXCX 1ZZNA 3BREA 5EWEA 1T05B 1CBKA 4J9OA 3OL7A 2I8EA 1D9FA 2Q66A 1FVSA 1VQKS 1RCXB 2E29A 2NCKL 2HHPA 2DITA 2YH1A 5A8KB 1TUVA 4URGA 1JB0C 1FERA 4MYTA 5M2RA 4OX9F 1B0VA 1WTFA 1ZBTA 2AJ2A 5HQ8A 3MR2A 2HK3A 3HFVA 3EPGA 3GSIA 2CAJA 3KJFB 4Q43A 4IOAQ 2VQFJ 4K4SA 3F73A 3IWNC 2QLJB 2OP5A 3C16B 3JAMU 4NYPA 4ER8A 3RR7A 3ZZYA 1HBMA 2IJFA 3MMBA 2H9ZA 1QVFR 4OYIA 2QLFB 1NJXA 1FDBA 2ABYA 4TNOA 4NI2A 4AUKA 3FQLA 1RHMB 2FTRA 3R5BA 3RBZA 4ZHRA 3OL8A 2QMWA 1T03B 5HVFA 4WTOB 1C0UB 2ZJRQ 4CP5A 4X66F 2UVUA 3E2EA 1Y7PA 1KOOA 3ZO7A 2UUAJ 2R8GA 2DH8A 1W25A 3MMAB 1XMOF 1K9MT 4WP3A 2QFJA 4Q8EA 2VDIA 2G2OA 2DGSA 1BWVA 2GO8A 2XS7A 3HFKA 2R2UA 2RKIA 3NRBA 3MCMA 2E7XA 2UXDJ 4I4BA 3IRXA 3M6UA 1PYTA 2HAIA 2AJ1A 1WG5A 3SCJE 5KFRA 4KH0B 2LXUA 4C3LA 2HZCA 3DRSB 3UI3A 4CH0S 2AEFA 2B0GA 2GVZB 3JTNA 1HBUB 1HQUB 1TV6A 3DNCA 4NWBA 3JXOA 4OV6A 5EWFA 3RR8A 4DZDA 4X65J 2CJ9A 4ZN3A 4DQPA 3OFFA 4MH8A 3RB6A 1EQ0A 1WD6A 3UCGA 1LWEB 1V3RA 4ZPTR 3HT0A 3W65A 2KO1A 5DDOC 4DUZJ 3QWUA 3HP6A 4DV1F 5BR8J 1S1XB 3CCVS 5E3CA 2BM1A 2UUTA 3N28A 4QIEA 1VLYA 1FESA 3MD3A 4OLPA 2CNOB 3KHLA 3SYZA 1WG4A 3K5MA 4JI5F 2XS2A 4ECWA 3UR0A 2ZITA 5F9NA 2HRYA 4WP9A 2JZ5A 1BHNA 5KFFA 2RD5C 1NB2A 2HQ3A 4NEYA 3EX7B 2V6AA 3OSNA 2KFZA 2BKNA 4DF8A 3UVJB 1PO6A 3LP1B 1PBAA 3BYRA 5CHCB 3AODA 4TN2A 1RADB 2HWIA 4EYIB 1Q53A 1BQNA 2HVZA 2RS8A 2PN6A 4A8KA 3OR2B 3BM7A 3DGVA 3MPUB 4P73A 5KFJA 4U6PA 1LK5A 3VGSA 2RDDA 5B0BA 5LL6d 1YWXA 1SUQB 1TV6B 3EGNA 4I56A 4Y00A 4CTAA 2XTJP 4ZVPB 2BJ7A 1G7CB 3SSQA 4ZVQB 2XLIA 1GEHA 3CCSS 3RBEA 3QAEA 4YR2A 1IBKF 4IO9Q 2W4PA 2E5GA 2MHEA 2DIUA 2B5JA 2VHGA 2AP6A 2DTJA 2RSQA 2VV5A 2QLWA 4N56A 1ACMB 2F9DA 3JTPA 2VQFF 4F50A 3W63A 4OZ2A 3PKMA 3N0VA 5BYSA 4DS4A 3E51A 3NNAA 2UXBJ 1HNXJ 4I1TA 4ZCLA 2QYCA 4HL9A 4KFBA 3SDEA 3NS7B 3TEGA 4Y0FA 2NREA 1DTTB 1Q5VA 1R31A 1CC8A 1U0SA 3EXYA 1LW2A 2CQGA 2Z58B 3O6QA 3MCOA 3ZTOA 2W9CA 5C24A 4B9LA 1KKHA 4DR2F 2JVRA 4DV6J 3HI9A 2UUAF 2CPZA 3ET6B 1OPZA 2HVIA 1AXQA 4LF6F 1C2PA 3M2UA 2UXCF 1HI0P 5D6GA 4OZNA 2VU5A 1Q8IA 1QTMA 4CLUA 1S0VA 4RX6A 1FDNA 2AMCB 3SSRA 4N47A 2SXLA 2MQLA 1BLUA 4LRBA 3GYXB 4ITSA 4CCHA 1C1CA 1G6BA 5D3GA 2PA3A 4RBUA 2BVZA 2ZH2A 1G1XA 1TL1A 2YWEA 1UFWA 1FA0A 1S0MA 2R7XA 2BABA 2EBGA 1NK9A 3HFZB 3M2UB 3BQ1A 2XLKA 2V2QA 4GVLA 1YKWA 5D15A 5BR8F 4MT1A 3CCWA 2HHVA 3AB4B 1O0PA 4ID5B 5LMNJ 1YDLA 2LEPA 3PG9A 4DR4J 4JI5J 3GCXP 3HSGA 3PJXA 1QM9A 1S48A 2LMIA 2WCXA 3B78A 3KG1A 3MM8A 4IOBA 4KGZB 3GG0A 4FNIA 5A8WA 1VBXA 1NSKL 2JLGA 1U09A 2BANB 2CQ2A 4ZVFA 4IR1A 1NDLA 3MM5B 5L8RC 4ZJLA 3S8SA 2AIRB 4DV5J 4RUHA 3QFHA 1TELA 4ED5A 1TTHB 3QJLA 4F2RA 4RR5A 2QZ8A 3DRXA 4DX8H 2ROPA 5IZHA 3D0HE 1SQGA 3OT9A 4KC5A 5KFHA 1DHMA 3DLKA 5JUMA 1JLFA 3AXKA 3FQKA 2WHOA 3TW0A 4JV2A 1FNOA 2ZWOA 1T9VA 1Y5NB 1PJ6A 1WC0A 1A6LA 2ASLA 2R7UA 4OIXA 3GYNA 1DAXA 4USJC 2ZH5A 1AZSA 2QYGA 3MFHA 3N6MA 3FMBA 4IRDA 1IBKJ 1K0TA 2CPJA 3TR5A 4FF2A 4O0IA 4L3NA 4OI2A 1DTQB 1IR0A 2HNYA 2NXUA 3RAXA 1U1KA 3LAKA 1YIJS 4KJIA 2HHSA 3G86A 1RT1A 2J7UA 3C15A 1Q95G 3ISND 4IRCA 3GQCA 1FRHA 2CWKA 4MK7A 4OX7A 3T41A 2F4VJ 5ETKA 4XAKA 1UL3A 3TA0A 3I4PA 3MPWA 4UUXA 1MROA 5AE1A 5ETPA 3NS6A 1RCOB 1SBRA 1AFJA 4MIAA 3V4MA 2AT1B 2WB1D 3P8BB 5C24B 3F0NA 3V6DB 4DFJA 2GHWA 2Z8QA 4IKAA 2XY5A 4B3OA 3UN5A 2W4DA 2VG6A 2BQRA 4C0HA 4K4WA 2HQIA 2KFNA 1SQFA 4DV6F 1S9EA 1RBOB 2BQUA 1KLNA 3J7YU 1Q7YT 2CQ4A 5ETRA 2IRYA 2UXCJ 1NKCA 2R7OA 1S6OA 1KEKA 5IS2A 8RUCA 4RBVA 2P8IA 3S01A 2Q43A 3KLHA 1PBUA 2HYIB 2C28A 2UVWA 4LIRA 1EHWA 2G2YA 1L3SA 1MSWD 4CM2A 4GKJJ 1Z1ZA 2R7QA 1B4SA 4OYWA 3M8WA 5E7OB 1U26A 4ZDNA 4KIAA 2DCUB 1ZAXA 2B3TB 4LRDA 3IAS9 1JLQA 4IFYA 1TMMA 3MEGA 3KLGB 3BO2A 2YNGB 2IHR1 1C1BA 1WKJA 2DGQA 1N5TA 2VG6B 3BGRB 5LSOA 2HG4A 4KE5A 4R5PA 1XNRF 3K59A 4NA3A 4X4TA 4M95A 1WI8A 2GS8A 3MM7B 1FXDA 3T5JA 5HJYA 2GMJA 2IBOA 2KL8A 3PJWA 3DOMA 1IWAA 4LBIA 3ENQA 5H9EJ 1HNIA 1T8EA 1N52B 2ZKUA 4NASA 3T1AA 4EEYA 4F4YA 2HFZA 1S6QA 5EUHA 2X7IA 1FI4A 3GIMA 3C6UA 4S0MA 4QCLA 2FB0A 2J0QD 4AL7A 5GMDA 3M4XA 2GX8A 2N4CA 1V5IB 4RWXA 2HW3A 4CYUA 4WZQA 4N8OA 5KFOA 1U8SA 3ILOA 1NJYA 4YHHF 3R1HA 1RT2A 2AZ1A 1SJ4P 3I5CA 2ZH3A 1YX2A 2PMHA 2QLXA 4TU8A 1FRMA 5ETQA 3ZNUA 4J9QA 2GAHC 4C9DA 5LT5A 4N41A 2F8HA 4QYZJ 2BQ3A 4KV8B 3TAPA 2GQQA 1DQ9A 5G0RA 5HMZA 2B43A 4IYQA 4MIWA 2XCAA 2RHQB 3ISNC 2B8PA 3DLJA 4XK8C 1TP7A 4ZPCA 5A8RB 4FZVA 1HD0A 5L1IA 4B3TF 5AXMA 4HKQA 5FJ4A 5J2MB 3ADAC 3VCDA 3EZ5A 4F4ZA 3AH6A 1RKJA 2DD8S 2BE2A 2L9DA 4P6QA 1MWYA 3RBDA 3MMCA 1RBLA 2F3JA 3HCXA 3TVYA 2POKA 3FJ2A 4KGKA 1ITPA 3M30B 3JYTB 4C8MA 4NXNJ 4NLRA 1HYSA 1KHWA 3AJ1A 3ILLA 1OO0B 3VQTA 5C25A 4EWTA 1NHKL 2HURA 3GLJA 3KDOA 2J7WA 4KHPJ 2FQQB 3Q89A 2IJNA 3BYPA 4AQYJ 3OVBA 4KSEB 2R7TA 1SV5B 2MPUA 3HZGA 1QSLA 4ELTA 3JAMY 1S6PB 1Y3JA 2MYFA 3EDRB 1HR0J 4IOCQ 2R7VA 7FDRA 2OD4A 3GIRA 4CI0B 3OR2A 2DNKA 1UWBA 2QC3A 4WP8A 2YKAA 2APOA 4ED8A 1YJRA 4Y2AA 4BC7A 2AGQA 2QEXS 3G82B 4M5IA 3V2UC 4R8UB 5KFMA 3CTRA 2VFVA 3LAMA 4LRCA 4G3IA 1S9EB 2H65B 2KYZA 3H25A 3GU0A 1R8PA 3D0GE 5ETMA 5KG0A 4ILMA 4P74A 4V1Ak 3EYZA 4JI1F 2D3UA 2C2ZB 1JX4A 4BCAA 1YJ9S 4AL6A 2FLNA 1ZYQA 4LQ9A 2DRBA 1XR5A 3SZ2A 3PJ9A 2B7CB 3O3LA 2CPHA 1WDDA 3OLBA 4WJBA 3PTWA 4RL1A 3KUEA 2CVEA 3Q8QB 4HT5A 5CYQA 2KM8C 3KK2B 3QGIA 1VFJA 2OPRB 3UNGC 1R8BA 1G3OA 3DRRB 3DLHA 6FD1A 3T1YJ 2HNDB 4MK9A 4F0KA 2A2DA 1WUUA 2EKYA 2CQHA 2J9DA 3J80Y 1AYEA 2MKJA 3Q8YA 3OXGA 3UD3P 1L3TA 2B8QA 4DHVA 3N9UC 2FJAB 3R27A 4Y3CA 2JNJA 4Y65A 1Q0NA 2RJZA 3MF5A 1YHQS 2U1AA 1T3OA 2NXNA 3IM9A 1JJ4A 4HT7A 1I51B 1UJ4A 2EKNA 2LLZA 5A0YA 3RBXA 3RAQA 3PCOB 3WIVA 3OD2A 2UV8G 3ZTQA 5HMXA 5LMUF 4O3QA 1NK0A 3QYYA 3UDCA 3MR5A 2RMLA 3DXSX 3C15B 3W61A 4ZPWR 1NSPA 3UDVA 1L5UA 1DZ5A 4OZ3A 1JJ2R 1HWKA 4PPZA 1RTDB 1WHYA 3BN7A 3EDQB 2VZ9A 4ZIWA 2Q6CA 3NGRA 1S57A 1UJ6A 3GR0A 3TQEA 1WF0A 4LF1A 3UN3A 4ANCA 2KG1A 1X8DA 2HNZB 1FE4A 2E5HA 2HS4A 2K3IA 5HLFA 1SUQA 4K59A 4OHXA 2HNDA 2IBKA 2LYVA 3ZTPA 2O5DA 4IG0A 4K5SA 2C3MA 4LFCF 2YPZA 4I2QA 4O4GB 1X4GA 2ILZA 5JVHQ 3GR1A 3GPAA 3CJ2A 3DM2B 3HHLB 2ZHBA 4GRSA 2KHCA 1VIOA 3MEKA 1KONA 1HWLA 2RH3A 1U1LA 2AYEA 2O01C 1DTTA 2RQKA 4PR6A 4C8NA 3NGSA 3PYFA 2A10A 4DDFA 4DEZA 3PVXA 4RW8A 1HR0F 2Y0SD 2O67A 4PEOA 3VVTA 1I3OB 2M5YA 2KG0A 2J6UA 2AJ4A 3VV2B 3DFEA 3HX9A 4ZA1A 2DHXA 2X1AA 2CJKA 4IQXA 4YN3B 2XG8A 1VQ5S 2VDHA 2AHOB 3GTYX 5AXLA 3FZ2A 1X5OA 1DY3A 1IBCB 3K89A 4YY3F 5F8MA 3ETMA 4G1QA 2PI5A 1JNRB 3IWLA 3VGVA 4JI1J 5FLXY 3M2VA 4RUBA 3HSJA 4KT0C 4ZIVA 1F3VA 2ZOGA 5IC6B 2JEFA 2K7KA 3SV4A 4LF4F 1XJWB 2OSQA 2KKHA 3BDEA 3NCRA 4Y2MA 5HMYA 1MW7A 4Z7YA 5M2PA 2Z30B 3U1NA 4F26A 2QFIA 2HZVA 4BWMA 5F8JA 3SI8A 3J81U 1RHJB 3NNHA 3MOJB 1U6BA 4RUCA 3GIIA 4HI2A 4CO0A 2VF3A 2KI2A 3FNNA 4NLXA 1YLXA 3OPKA 4PWDA 1MMNA 2AGPA 4KTQA 1FD2A 3ETOA 1ZPWX 1FXLA 4RW4B 2CJXB 1WHXA 3EGVA 4DG1B 2DO0A 3FCWA 3TOQA 4B3SF 4XIUA 2ZZTA 1IKWB 2RU3A 1N4LA 5B7WA 3LP2B 3NWGA 1N0VC 2H4YB 4L75A 5GAHU 2MQQA 2BKOA 4CO5A 1QVGR 2CPYA 2DBBA 4C8ZA 4OZ0A 4TXSA 2ZM6F 3NAIA 3RGIA 3W9HA 3KLHB 1U47A 4Y28C 1YRXA 2ACYA 5HATA 4ERDA 1M5HA 1KLMA 2UZAA 1F9HA 2G1DA 4O3NA 4ZKAA 4DL0C 2HFUA 1MNEA 1RTIA 5B0CA 5CA5A 3KHRA 1JKHA 2HLUA 3LH2S 2HQDA 2VUGA 5IV4A 3VAIA 4ZP8A 1BE4A 3IR7B 4ZP7A 1V6HA 2GJ2A 5KOXA 4FYWB 2N82B 1VRQC 4DFMA 1MWZA 1NZ8A 4PG8A 5C25B 2CZ9A 1S0NA 3R7SB 1S1UA 4TY9A 3CDBA 2UVRA 3G87A 1FFWB 3BS9A 2I5JA 1N88A 1PJ5A 2YX4A 3MAAA 4A46A 4X62F 2I6WA 1KFSA 5IQ6A 4RNMA 2VFRA 3OW2R 2C2RA 4OMFG 1UAWA 2D69A 3RRKA 1VC6A 4BHQA 2HRTA 3PR5B 2RS2A 2PD1A 1RB0A 2HQFA 2B9EA 1RTJB 3N6NA 4F36A 4USMA 1X4EA 3ZZ0A 2IM0A 3LP2A 3N4WA 4DPWA 1B3TA 2A1BA 1B7YB 3I5AA 2XWYA 1UWAA 4KPYA 2KB2A 4Q45A 3A8EA 1R8AA 2VJVA 1RT7A 2DYAA 2FJBB 3OHAA 3GIKA 2X51A 3PRBA 2CKWA 5AXKA 3SQGA 1RWKB 1YZ7A 2HIQA 4JB8B 2VOOA 3R5CA 4A48A 4F67A 3CIZA 3D1OA 2HVDA 4DPOA 3H40A 5IFMA 5T14A 2OD6A 1VRUB 1FJGJ 1H3DA 1RBAA 3HHDA 1S1TB 3W8PA 4DPUA 1U2FA 3DDIA 5HSPA 1PG5B 1VBZA 2DKOB 1CJKA 4P7TA 5J2MA 1O6XA 3FMWA 4DQRA 3LO3A 4I7FB 3CCQS 4XPCA 3BPDA 1FDDA 1SJ1A 2B4OA 4C0OC 1WEYA 5HJXA 3K5OA 3PIPQ 2IIHA 5J2PB 4FNHA 3LUYA 3UCUP 4PWDB 3IC1A 1U6ZA 2PFDA 3I0RA 1C0TB 3M30A 3H59A 1CULA 2M52A 4FKYA 4J37A 5THWA 1GK8A 3DU5A 3UWTA 4ZPDA 3QT5A 2DNYA 3WHIA 4ATNA 3CIMA 2ZDOA 3AT1B 3GFXA 3D54A 1F9FA 1BQMB 1PYSB 2PFFB 4B3SJ 4A8XA 4ZOSA 2EW9A 3GYGA 5F0WA 3NGTA 4NI2B 3P45B 4ZN1A 1HNWF 4HDHA 1HI8A 4CO4A 2HQGA 3VF0B 4K7QA 4QIWD 1S0OA 3DHXA 2Q3PA 2ZNYA 2HBYB 4FVCA 4L73A 1VBYA 3R2DJ 1IKYA 4ZVRB 3LPYA 5LMNF 4A8SA 2W2MP 3GFZA 1ULRA 3HULA 2DJWA 1VRUA 2E44A 3BSAA 3N5BA 3R6GB 2MZRA 4U96A 4ZVGA 2DY1A 2Y3YA 4KV8A 4DU7A 2P9CA 3D2WA 2B4UA 1UVNA 1S4EA 2WVDA 2CZVC 2E1RA 2CQCA 2W7AA 4CNZA 5KG4A 5LXYA 2VPZB 2X3GA 3AD8C 3BGUA 3TVZA 3BR8A 3MURP 2KVIA 3RJMB 3LWMA 2VASA 4I68A 4DV0J 1FEHA 3CNQP 3LP0B 4P52A 3V6JA 2D3ZA 4HHJA 1UJ5A 4QW9A 4LF8J 2GIQA 4ZS6A 3DMJB 2KH9A 4DUZF 4ECRA 1VQ4S 3R5AA 6FDRA 2WW8A 2E1PA 4WFNQ 2LEBA 1YZ6A 4L76A 2GNKA 3C14A 3K58A 3VVUA 2MMYA 3CMQA 1FHTA 3G4SS 3D1HA 4ANEA 1V9OA 3M8RA 4G1IA 3MUVP 4LF7J 5E33A 2RAQA 4AD6A 3H2VE 3S6EA 1IR1A 1QUVA 2BV3A 1WOOA 2LU1A 3CO0P 4X4VA 2BOPA 1FJCA 4EGLA 2FLLA 3CCES 2V8HA 1IXKA 1H98A 2JLEA 4F3MA 2C3UA 4DX6A 4J7CA 2DGXA 3QIPA 3BGFA 3EICA 1OJ4A 2DXFA 4YP3A 3GIJA 2AQ4A 1HNZF 2BACA 2LQ9A 1S1WA 2OPPB 1Y3KA 1U8WA 2YX7A 1RWWB 1PAUB 2QJ3A 4KGXB 2B6AA 4YB5A 4F8RA 4LF5J 3IS9B 4CLSA 1VI7A 3I96A 4LVOP 3KK3B 2E5LJ 2DNGA 3DLKB 3OVSA 1K1QA 3CMAS 1GMWA 2HGNA 2M8DB 4DPTA 2YQ3A 3BH6B 3KLFB 2I1RA 1UVMA 3IMQJ 4JI0F 4RNOA 3A8KA 2GMHA 3BO4A 3MXHP 5CYMB 1D9DA 2DR5A 3DCAA 1IUJA 2BJ3A 1M1HA 3PY8A 1AZSB 1LQ9A 2V63A 4OYXA 1Q4RA 2BJ8A 4OHYA 1TUGB 4OQJA 2ROGA 4DR1F 4LF9F 2BJDA 4DFPA 4PYAA 3TNVA 2XS5A 1UPMB 2AX0A 2G4BA 3TUIC 1VCTA 4M5DB 3NBPB 4U7CA 4DR6J 4X4RA 2W9AA 2YKOA 4JI6J 4KHRA 3LW5C 1RAIB 2LXFA 1S6PA 2ZBPA 1TL3B 2AU0A 1CPZA 3OSPA 2UVVA 2JFKA 4KKOA 4ZCIA 3HJFA 2W4CA 2MGZB 3DOKB 1YBAA 1EX8A 1YSJA 4Z2XA 2MZTA 2R2SA 1EQMA 4LF6J 2QMUB 1RHQB 5AJ3J 1MMDA 1R27B 3CD0A 3NOCA 1OPIA 2G0JA 4OYZA 4Z37A 2BKPA 5CXTA 2RVJA 1NO8A 3D3CJ 1RI7A 2CXEA 2MLZA 3O2IA 3K7RA 5D4OA 4WPAA 2UUBF 2L9WA 3M8SA 3IGVA 1GTEA 1U24A 2OPRA 2HIYA 4NLPA 2RDJA 3DKDA 1H2UX 2ZVSA 2V4JB 4J90A 1FTRA 1TL7B 1OS5A 1S4FA 2DIVA 2CYYA 4WFXA 2ZZMA 3CC2S 1RWUA 4NRUA 3J7AN 4QZVB 4DU8A 2KM8B 3JB9k 1VLOA 2IRUA 2FGOA 2RU9A 3NG8A 4Q8FA 4ED7A 1MLAA 2CQBA 1JLBA 4FYYB 3W2WA 4CRJA 1UFLA 2Y1JA 1YGYA 4WK3A 4ID5A 3N6LA 4I2QB 4O4GA 3I87A 4CLFA 1FKOB 2MKYA 3LWLA 3NS5A 1HLWA 3CWJA 3KUHA 3V81B 1N33J 5IQQA 3TI0A 3DLLQ 3PYGA 4FXDA 1H73A 1DBDA 2IYGA 3KWMA 1XIQA 1JLEB 4MMOA 3FFIB 1P9QC 3ENAA 1HNZJ 3QRPA 1JLQB 1A9NB 2Y8WA 1CLFA 1YQHA 1CJKB 2YNHA 3SEOA 4J9KA 3D6MB 5KFYA 3N79A 3PR4A 2M3DA 2E5LF 1H2VZ 1TUWA 3M8PA 4Q2LA 2XI2A 4X4QA 3C19A 5HMWA 3OL9A 4ZVEA 2CQ1A 3MHYA 3LP1A 4OX9J 2BJ1A 1X4CA 4YDXA 5C5JA 3H4BA 3K5PA 4I0WA 2OHDA 4EU0A 3PO5A 4DUYJ 2RF2A 3LANA 1KS2A 4B3MJ 1UW9A 2F4VF 2ZVIA 4JOUA 2EK1A 4CTAB 2KT5A 4ZCMA 3PEHA 1RHUB 3P3DA 3CCMS 4CLKA 3I82A 1NK8A 5D8HB 1TQLA 1MROB 4YB1P 3D7SB 3IRWP 1HW9A 1RT5B 4A8OA 4BWJA 2K3KA 2A18A 1XQIA 3UQSA 3CDWA 5KT7A 2XNRA 3X3UA 3BF4A 2D74B 2AD9A 3RUBL 3IG1B 4WTYA 2PI4A 1B99A 4QYRA 3CC7S 4LFAJ 2DO4A 2UU9F 4C98A 3G71S 2KT2A 2QA2A 3BBCA 2M9KA 1H0HB 2O66A 5GVQA 3RB3A 1NBEB 5K14A 1ZS6A 2V2KA 4OJ3A 2ZH9A 3TX0A 1HWUA 2HHQA 2RRBA 4NYOA 5F8LA 5MLCV 2CVIA 4U67Q 1HKAA 1GFWB 2IVYA 3MCNA 3MI7X 3W7BA 1URRA 3QZ8A 5L46A 2MQOA 2V67A 2VG5A 4KO0B 1KQGB 3PM9A 5KG7A 3JSBA 4J9UE 3C14B 1JLCA 2FIUA 5DZ6A 4DLEA 4YB6A 5SZTA 1UVLA 5T41A 3TWZA 1IM6A 2E7VA 1T9UA 3ITHB 3PW0A 1VQ6S 3CULA 1R43A 3L3CA 4DV1J 4OX6A 1R0AB 2GV1A 3NMRA 1PJ7A 2AGOA 3NMAA 4C11A 4A8YA 1F5AA 2XSFA 4FS1A 3S1TA 5J2QA 2OPSA 1M5KC 2YKMB 3ENWA 4NXMF 1JLGB 1RAHB 1REVB 1F1BB 1UP1A 2QG9B 3MAHA 4MKVA 3VGUA 4AYBD 4CLYA 1JJHA 4X4OA 3T5KA 4M5HA 2CRLA 3E3XA 1NPPA 4J5OA 4KO0A 2IDEA 4OHVA 3Q8VA 1RKIA 3TO8A 3UE2A 2C22A 2HHHF 2YH0A 3L09A 2Y0BB 2RE1A 2I5JB 3H20A 4YUDA 3FSIA 1N48A 1NH7A 1MG7A 4O3OA 2GQCA 5K8PA 3K2YA 1WORA 1C1CB 2ZBCA 4QIVA 1YK9A 3OUYB 1JNZB 1Q79A 2ZD1B 2HWTA 4MIBA 2IM3A 3R5JB 5GMEA 1SJ3P 2DT9A 1QLNA 1S9FA 4ID8A 4LF2A 2IC3B 2JC1A 4TY8B 2DK2A 1UW4A 2XGPA 3QRRA 4TLQA 3HT3A 3AOAA 4EFAC 2CQIA 1NDKA 1SIWB 1FRIA 1SJRA 3ZZUA 4BLGA 4CO3A 1ZM9A 3R1LA 2R2RA 1B64A 2OPQA 3VR1A 1FFSB 1N5SA 1X9SA 1N5YB 4YFUA 4B08A 2UXBF 3A1YG 3W3SA 4KH1B 4LT6A 3KK1B 5HVGA 4L6V3 5A8WB 4OZLA 1N34F 3QO9B 4PUOA 1IKXA 4U7UK 3OTCA 1FX2A 3FGVA 4AXIA 2PEBA 1WEXA 3G8TA 3NP5A 1L3UA 1H38A 3TUJC 3G9CA 1RTHA 1GXUA 2C1EB 4MJKA 1FDAA 1TKXB 5D78A 1RT7B 2LVWA 2PSZA 4CT8A 3HXMA 5J2PA 5K8MA 1NSQA 2C2DA 1U6FA 5GADU 2B4PA 1D9AA 5KT4A 2QIFA 4WYWA 3UN2A 3OJSA 3D3BJ 3M32A 2CQPA 1FK9A 4CZCA 3KJNB 4PWWA 4NMLA 3FEXB 1HQEB 4U95A 3P5BP 3GFHA 1WWHA 2FD2A 1S1TA 3GB0A 3KHGA 3VALA 1T7PA 3A4TA 3ICLA 2UXDF 1NUEA 1ZAVA 1ICEB 2F9JA 4RPFA 3ZZOA 3J7A1 4WXWA 2CJQA 3R6LB 2DGUA 3MAQA 3R7NB 3V6HA 3RTVA 5A8KA 5K8NA 4DV2F 1UA1A 4E0DA 4X65F 1SC3B 3OR1A 2OPSB 2AJ0A 4M5GA 1QD1A 2D1CA 2YKQA 1RWVB 2E1AA 3RG6A 3ILIA 2MKIA 3NY0A 1IQTA 1VJQA 2D41A 3OTBA 3Q22A 2MZQA 4LBPA 5D3GB 4OJ1A 3W2VB 3MEEA 1SIZA 3UPFA 3DOLB 1YJVA 2Y1RI 2GVDB 4DV5F 3C8YA 3IP0A 2PIIA 2XB2D 3B6BA 3K5LA 4Q0BB 1D8ZA 2MKHA 2OI2A 5C42B 1UPPA 1TU0B 1JJCB 3JTOA 2FY1A 3M8PB 2FLPA 4RNHA 2NUHA 2FJDB 2DR8A 4LFBJ 4TVAB 1QUPA 2VC1A 2E9ZA 3EWGA 4J9PA 4F4XA 2HZAA 3LGHA 4NMXA 1PAEX 1NPRA 4P2SA 2OMOA 3M8YA 4MKBA 2EC2A 4OYOA 5DETA 1QJHA 2QSWA 5LMUJ 5E3QA 4R5PB 4UQGA 3PW7A 1N56A 4F0HA 1QSYA 2VOPA 1X4AA 3VAJA 1X4DA 2LU2A 3DGPA 2HKEA 3SCKE 2ZBQA 3F44A 2Y1IA 1Y9OA 5FIIA 2NSCA 2KN4A 2XZTB 1X4HA 2XYGB 5ETSA 5C42A 2MXYA 5KFGA 2KDOA 2FVPA 3BSCA 4C6AA 4AL5A 3H2LA 2QGFB 4UOGA 2NR0A 3DOLA 1RZMA 4FBTA 3K8VA 3VAMA 4I69A 1LW0B 1KTVA 1NHUA 1VQNS 3BH7B 3KYLA 2C2KB 1QSSA 4QIFA 1XN9A 2BE7D 4DZ6A 1F2HA 3TUPA 2X1GA 3IAM9 3IA0A 4CLPA 1HNXF 3H8YA 4QR0A 4H4MB 4LSNB 3W1YC 4ANDA 4J91A 3KTQA 2ZH1A 1F5BA 4ED6A 5J2NA 1AFIA 2HBZB 4OYMA 2YNIB 1B7FA 3IXQA 2C3OA 2F8MA 4NLGA 1DLOB 2J9EA 4NLDA 5H9FJ 2MKCA 4DCOB 2OPPA 2IM1A 3O44A 1FNMA 4CO2A 2GO9A 3EVWA 1EJ7L 4M63A 4NEZA 2J0SD 4GKJF 1G2EA 1RLCL 2AF6A 2V5HG 4R25A 3KXDA 4YOEA 2P6TA 3AAWB 4LMZA 2N7YA 3OXFA 1HBMB 2Q6BA 2XMKA 4RW7B 4ZJQA 3Q24A 4ECQA 1RU2A 2R9LA 2VFSA 2KYXA 3EMTA 1QAXA 1B0PA 3ZFVA 5KT3A 1VQ8S 3Q2TC 4ED0A 2YNIA 3MM9A 2A6OA 1E6YB 4ILLA 5DZ7A 5KG1A 5A0YB 1R8HA 2JC0A 1OY6A 4PABA 1A7GE 1RAJA 1RHKB 2ZOMA 3MDFA 4H4OA 5ETLA 1TAQA 1JWWA 1M0SA 3BEGB 4OZ1A 2EEYA 4QQBA 2YNGA 3HKZD 3PEJA 3QSYB 2R4FA 2E5IA 4KFBB 1RYRA 2DISA 1EAYC 3CPWR 4UTGA 2HVHA 3IBFB 4M94A 1WKLA 2VKRA 4D3GA 3IR5B 3G6YA 1VISA 4DI6A 4DX7A 3P4UB 3M2RB 4IFVA 3ZTRA 2CNKB 4Y34A 2DPIA 3US5A 4OI4A 4K0KF 4B9SA 1ROFA 2RRNA 3SCLE 5AT1B 3W9JA 1RSCA 1TKTA 2VFTA 2F40A 4DMZA 5I4MA 2QT7A 2HK2A 1GXLA 3BKUA 5D0EA 5L39A 5F8HA 5HVHA 1NSAA 2CUYA 2JRSA 1U0HB 2N3LA 5CD4A 4ZITA 2OIHA 3JQJA 2KJVA 3I31A 1S6UA 3BSOA 3PACA 1FEEA 1WELA 3S7RA 5EGYA 4J9VA 3BPSP 3ET6A 4OJGA 4RW9A 3UFCX 3AJ2A 5F3ZA 5KFNA 3MM6A 4NXNF 2L48A 3EE3A 1R0BG 3CGIA 4IO1A 5LSRA 3HD1A 3R2CJ 3EGZA 2M88A 4FPRA 2BJEA 5ETNA 2V0NA 3VZHA 4K2XA 5H9FK 1TZ0A 4XDDA 2BE9B 4HH0A 1VQPS 3M8QB 4QOTA 3QGPA 1TL3A 1EKSA 1WJ9A 2WSCC 3PW5A 3SFUA 3VZIA 5KFUA 1SPBP 4DR5F 4DL4A 4V19X 1YRUA 4B3RF 4N5SA 2HFVA 1I94J 2EXUA 1RT4B 1VK8A 2EK6A 2V8DA 1SH2A 4KGMA 3F41A 4DOZA 4HYKA 3RW6A 2EFQA 2DHHA 2OELA 1TL5A 2EPIA 3FCHA 4NLWA 4RO0A 2YTCA 5KFAA 3HZEA 1Q82T 3KLVA 1IKVB 3PIOQ 3CF5Q 1CJUB 3KNAA 4Y2KA 2W2PP 4EK2A 1Y00A 3DXBA 4ECSA 2UUWA 1EP4B 1MU2A 1FWPA 2AEMA 3CJ0A 4ECVA 4E2FB 1EETA 3QGGA 2XCPA 2DPJA 3WBZA 1FJGF 2JSXA 1KLMB 1M1GA 5KTQA 1HARA 3R5GA 4MAKA 3AQOA 1RTZA 1RT4A 3BGOP 3KK2A 2LA4A 3KK3A 3T5HA 2VFUA 2CPXA 2KU7A 1JLBB 2IA6A 4P7VA 3JSMA 3OVAA 3FBFA 2XZWA 4PXCA 2V9KA 2ZFHA 3T1YF 3OUYA 2QSFA 2X1BA 5K14B 1R7IA 1P9YA 2W2NP 3G6XA 1Y10A 1LWXA 1YG0A 2FLOA 4B3OB 4I67A 1N36J 3B8HA 1OQ3A 3J7ZT 2WONB 2LKZA 3DI6B 3DDNA 5G0RB 4NZ7A 2BJ9A 4K0KJ 8ATCB 2OSRA 4U9RA 1U1OA 1DFDA 4ZK7M 3B4MA 2WOMB 4DX5A 1HNWJ 1TVRB 4KR0B 4OFZA 4URSA 4WBFA 5KFVA 5DGBA 2DNRA 3H90A 3MD1A 3DLEB 2DB1A 1VC5A 1FNXH 2RB7A 2BE2B 5A6PA 4F4WA 5HL7Q 2AYMA 4RNNA 2QTWA 1OIAA 5I42B 2ZUGA 2MGZA 3DLGA 4LSLA 1HA1A 2ZH4A 2R7WA 4PPDA 1KC8T 3PYEA 4DV2J 3GILA 3T6JA 1X5SA 4GO5X 5HP1B 1J5EJ 4ECYA 1SL2A 5D77A 5B0EA 2NXJA 4LR9A 4CH7A 3T5LA 4DQIA 2AW0A 1GAOA 4LUBA 5IWAJ 1RTHB 1C4CA 1CQNA 2ATCB 2LECA 4F3OA 2C2MB 5I3UA 1FVQA 4CLTA 4DUTA 2G0CA 2YKNA 1HNVA 2HGMA 4M8LA 3NGDA 3GP9A 2A0FB 1K0VA 2G2ZA 2IC3A 2WRMA 2YKMA 2C2EA 1APSA 1ZTTA 1NJZA 2J0WA 3M6XA 2CA9A 1WF1A 3RB4A 4JI2F 2VPWB 4BC9A 5I42A 4R0JA 1TFYA 3DOKA 2MJUA 3V6DA 3NCPA 1JKHB 2OFGX 3FEYB 4DR5J 3QPIA 3A3OB 2VC0A 2CWXA 3HSDA 4ZP6A 2YWWA 3DLEA 1HW8A 3QNWB 3MR6A 2HHXA 3J81j 1V3SA 4PXEA 3RZAA 5A2QU 4AQYF 2JEGA 1WSRA 2HMIA 5IT9U 2GHPA 4EUVA 1X5TA 4ZVOB 2NQPA 1T9WA 1ZH5A 1Y11A 4CQ1A 1H7WA 5CZXA 1RWNB 4B9VA 2FUG9 5CCLA 2YXLA 2ASJA 1J27A 4QW8A 2XY7A 3RYLA 3PX4A 5FLXU 1K44A 4ECZA 5DQGA 2XM3A 2E66A 4P75A 3OFHA 2XLJA 3CMES 4LREA 3CD6S 5KT2A 4JI4J 5B0AA 2RIJA 3C6UB 4NLSA 3FBEA 3UCZP 4X2BA 1VHIA 3EZUA 3ITHA 1KFDA 1S59A 3PW4A 2WK4A 3H5UA 4DV4F 3PHEA 4FXVA 2QV6A 1KHVA 2MZSA 5CH7B 2VQEF 3JSYA 1SKUB 3BBBA 1RA7A 2JVOA 4ZPAA 2QX0A 1HD1A 1YJNS 4WFAQ 4EYHB 3BN4A 3MMJA 2VBZA 3QWPA 2FVQA 2FHOB 4M5JA 2DNPA 2MY8A 2VB6A 3A3PB 1VRTB 3TZWA 1FK9B 2H5EA 2UV8A 3G96A 3EGWB 4DR4F 1JMTA 1U02A 2BX6A 4ETZA 3CJSA 3QSIA 2LQJA 2IMOA 1HMVB 2P6SA 4IQMA 4X64F 2ZE2A 1XMQF 3KMQA 1QE1B 4HACB 5D0HA 4BBYA 1AA1B 3AQPA 4A8QA 2AX1A 1HYSB 2AKWB 2OEMA 3GJQB 4YMEA 5F41A 5HQLA 4WU2A 3KHHA 1WOSA 3M9OB 2EFOA 2DXDA 3THVA 4M5KA 1UVJA 4MFBB 3U02A 4F7VA 5L1KA 2RILA 3L7OA 2F5GA 2QLBB 4IH6A 3ZZRA 3TZXA 4B9NA 2KVQE 1T94A 1OSCA 4C8OA 1IBLF 2VBYA 3OLAA 5M2UA 3MOZA 2HSEB 4M5NA 2RF2B 3IBCB 2AZ3A 1TR0A 2YWKA 4PQAA 3LA0A 5IWAF 3IN5A 3DC2A 3HHLA 2D7SA 1OYDA 4R8UA 3FC9A 1PCAA 3V81A 4LQ3A 1Y5IB 1D3WA 1V3ZA 2G13A 1CULB 2B56A 2NYIA 3EJMA 3R3TA 1H2TZ 4NPOA 1M5VC 4DQQA 2CJAA 2DEJA 3UW1A 3KLEA 2CDRB 3HJVA 2CFXA 2GFFA 3QO9A 1RP5A 4DLGA 4PUOB 3HHNB 2Y9HA 3DLBA 1WC4A 2YNHB 4A8WA 3V6KA 1SL1A 1TK8A 5KFQA 3BZQA 2YNFB 3FVYA 2RQMA 4O3RA 4HVZA 4P10A 2KRBA 3KG0A 1FWLA 1PC5A 1NHVA 2F1FA 2EFVA 2R8JA 1VDHA 5HO4A 3MM8B 2OGUA 3GWCA 1UZHA 2ATLA 2NLWA 2C3YA 5F3TA 4DFKA 5CQGA 5K8OA 1RWMB 1JXLA 3T19A 3HVRA 1HHTP 4WFBQ 5IT0A 4PKDB 4XTTA 2MY7A 2BR0A 5IT9Y 3MTJA 4H4MA 1OY8A 4LSNA 2WAQD 3W5ZA 4EBDA 2L08A 1EZZB 2JFDA 3L4BC 4EZ9A 1NK6A 5DG8A 1FRXA 4Z7CA 4I7FA 4XO0A 4WFYA 9RUBA 2ZDPA 1R0AA 4WF9Q 2GIFA 2AV5A 2R42A 5KFKA 3T1HF 4CLZA 2ZJQQ 4DSLA 4KAIA 1YVFA 1Q8LA 5E3AA 5LJ3Y 1GT8A 4BDPA 2DR7A 1Q1KA 1F0XA 1FRLA 2AWZA 5DO2A 2HFSA 4CDIA 1RWOB 5EX0A 1NKBA 1KDNA 2B9YA 4I6YA 2P5VA 4JI3J 3J80U 1FT8A 1QE1A 1S99A 4O4RA 2A2CA 1AUSL 3MGJA 4HHUA 2QN6B 4YS2A 2HVEA 4ZLLA 3E01A 2G0IA 3PYDA 4C8KA 1WDTA 4JI8J 2M0GB 4P71A 4FKXA 2XMWA 3M1VB 2H51B 1P27B 1RABB 4F04B 4C2MA 5FDLA 3VAFA 2R7SA 4W92B 2JDJA 1JLCB 5H9EK 3U7JA 3L7UA 4USIA 4NLOA 1B0TA 1T9XA 1TKDA 3T6BA 2CADA 2LEAA 4KHMA 2YQ1A 1VBKA 1IVZA 1KP6A 2PDAA 5DS7A 5KFPA 3DGPB 5L1LA 1AROP 3P96A 4HACA 2DNOA 2ZM6J 2BBEA 1FCAA 3FEZA 3H4DA 3TJ8A 3M9NB 3KFWX 2ALZA 2CNNB 4NCGA 2HLTA 3EPIA 4DV0F 2Y1LB 4HLBA 3WX4A 2K2PA 2V2ZA 4LR8A 1N8RT 5ETVA 4DL2A 3X1LB 4OZ5A 3MUTP 1NMEB 4LVNP 4RKUC 5F8GA 1KD1T 3OTEA 1NAQA 2EWHA 4CO1A 2OFHX 2JL9A 1NH8A 4IUFA 2XEXA 3LALA 1CVJA 1H74A 2KZMA 3G6VA 3CJQA 1KVIA 3GSDA 2FJVA 2JWNA 4NXMJ 3HHEA 1W2BR 2GVZA 1TMJA 3AY0A 2UP1A 3HF5A 3Q0AA 3MFIA 1XC9A 4B9UA 3OTOF 1YBUA 4WFZA 4RW4A 3H98A 1ZPVA 5ETTA 2OAUA 3UDEA 4HHHA 4RBTA 5DDRC 3TANA 2JH3A 2NXEA 1KN6A 2XSJA 2MSSA 4GO7X 3B4DA 4ETXA 2J0XA 3ILJA 4OJHA 2M4MA 4Q7AA 3P6YC 5JVGQ 2DRDA 2KTQA 2DNMA 4OZJA 4YB7A 3PO4A 4Q0BA 3PX0A 1M1KT 4F0MA 5HANA 1U0HA 1NM2A 2QA4G 4LR7A 3J7Z5 4F4KA 3R7BB 2IMWP 1TFWA 3DLGB 4Q2MA 3BKTA 3PNIA 2DH7A 4FXWA 1VYAA 2CPFA 6AT1B 4WYLA 2FJXA 4DR7F 2DNHA 4C48A 2OO4A 5KFSA 1RA6A 3CCLS 1ZM4A 2LP4A 2MQNA 3CVKA 3QJJA 1NK4A 2GJFA 1S76D 2PMZD 4DR1J 4LF9J 3FUYA 1F9EB 3Q8SB 4Q44A 1WTBA 1WF2A 3HVTB 3QFWA 2X1FA 2RUGA 5EX3A 4DR6F 1N34J 1TAUA 4PQUA 3C2PA 1HI1A 3M1VA 4C11B 2QMXA 2W9CB 4TU7A 2RQCA 2Z57B 4LSLB 4RW8B 4IH5A 4FF4A 5KG3A 3KLIB 1U25A 1H7XA 2VIHA 3MEDB 2C42A 1XMOJ 4KYZA 4DG1A 5DLFA 1U49A 2DHAA 4ED2A 2F65A 3WC2A 2XY6A 5DJBA 1TKTB 1MN7A 5A76A 1FE0A 5DM7Q 2FZKB 1RT3B 2VPXB 1JQGA 3ZZTA 1IBMJ 1UKUA 3TJAA 2VBXA 1M5OC 4UY8T 2FHJA 3GJTB 3UD5A 1KOHA 4ZMMA 1SH3A 1S1VB 2D9PA 4UF4A 5IC4B 3BSNA 2WONA 1FO1A 1J2VA 2IDLA 4K2JA 1KBRA 2JLFA 4LIWA 5KG2A 3C6TA 4QU7A 4OI3A 1TKZB 5L9XA 3I9ZA 2ILYA 3NWRA 4DV7J 2J6SA 5B0FA 1LXNA 2MDAA 1I5OB 2ZJPQ 4JI7J 1AB8A 1JIHA 2ZHOA 4JYAJ 1HPZA 2I38A 1BMQB 3JSMB 3GV7B 4K4TA 1R8CA 4NLYA 4NRTA 4A47A 4O3SA 2E9TA 2HRUA 1H72C 2KFYA 2XMJA 4ECUA 2R8KA 2EI5A 2K8GA 1IN0A 1PKUA 1FKOA 1PSDA 1Z2ZA 4JBCA 4KBIA 3T9NA 4CLLA 3Q8PB 3AOBA 2H48B 3AA8A 3I0RB 2DGWA 3K8WA 4ZVHA 2BOAA 4B9TA 3OTDA 2BA9A 2MHNA 2LQ8A 3DI6A 1N33F 4O23A 2J9DE 3MPDA 3OTOJ 4N77A 5F9LA 1LW2B 3PRVA 3GG1A 3MZIA 4C4WA 1CJTA 1XR6A 3NEKA 4WKYA 1FRJA 2XZDB 4X4PA 1GMUA 3GJRB 1WEZA 5K20B 4GKKF 2B9XA 3M8ZA 5K9FA 4E98A 1X4BA 2JEJA 1UVIA 1N32F 2JEIA 1TK5A 1JLAA 2J9CA 2VG5B 3V4IA 1HWJA 3CDEA 3CJTA 3GFYA 1HBOB 4IFVB 4NX9A 1PIEA 4DR3J 2CQ0A 1YJWS 1QAYA 4J9RA 4WK1A 4E8UA 4IG3B 1CSJA 2I0XA 1FKAF 1HQEA 1XMBA 1RAGB 2K06A 4U8YA 3I56S 3T3FA 4DR7J 1UA0A 3FFIA 2JJ4D 5D0GA 1P1LA 2IM2A 2GMLA 4EBCA 4M1KA 2CIMA 3TYTA 2VL1A 4DN0A 4JI0J 4B3MF 3PRDA 2Z2ZA 4EBEA 1RACB 4NLTA 2OJ3A 1NCLA 4MK8A 3M9MB 3O8WA 4ECXA 1EB0A 2C2NA 1U1NA 1RT5A 5I3QA 5A6WA 1T9TA 3WX8A 5KFEA 3MTKA 4DJBA 2XWXA 2L3MA 1QDUB 1SQEA 4EO8A 2UUCF 4OYPA 3MCSA 4DL5A 1XNQF 3MEEB 2DGTA 1ZAWA 2J7KA 2WB4A 1HMVA 5K5MA 5LM7E 4LFAF 2EBEA 1VGYA 4JI6F 3VWSA 4OHZA 2XQCA 4ED1A 4ECTA 2W7PA 4JV0A 1Y0HA 2HWHA 2R2TA 1XEZA 3D28A 3H5YA 2ZH7A 1S1VA 2AJQA 2NPFA 4QU6A 1FX4A 2B7BB 1YJ7A 3DU6A 3I0SA 5F8NA 3PDNA 4CM0A 4FF1A 5AE2A 3IS9A 2HBQB 1R3NA 1IKXB 2WVEA 5HI7A 4WKRA 2W8KA 5HP1A 1X5PA 3NXZA 1PILA 1Z2LA 1X7VA 1K8AT 2K1RA 2G1HA 3IM8A 2P9GA 3NAHA 3A13A 4QBUA 5DLGA 4PCQA 4JI7F 1B70B 4DXLA 4A8MP 1T05A 2VA3A 2DCLA 3LOUA 5C2GA 1LK7A 2HQCA 5DQHA 5J1EA 3C46A 2OPQB 1NK7A 1U1PA 3QLHA 4AE5A 2OEKA 1LNQA 4YR0A 2D9OA 1KQFB 2GW8A 4J9SA 2NZ4A 1SB6A 2VH7A 5SUHA 4ELVA 4F3QA 3I0SB 4GC6A 4DV3F 3F56A 2XSJB 5KFTA 4DL7A 4UZBA 3HLUA 1WI6A 5KFCA 4USVA 4AXJA 2HHHJ 4TQRA 1ZOTA 3PX6A 1HPZB 2CQDA 4ES3A 4NA1A 4EO6A 2GCFA 3GZ7A 3CC4S 1ZM3A 1K73T 4FF3A 1OY9A 3PHTA 4KKOB 3TP2A 1RT6A 4H54A 4MKAA 1DQAA 1OSDA 3KDNA 1PC4A 1UZDA 2YQ0A 3JQMA 1I1GA 2MKKA 2WSEC 5JJBA 1MN9A 2M2BA 3SV3A 1BY9A 1GMWD 2K7JA 4OLOA 1XR7A 2XO7A 4DSKA 3GMGA 3R9LA 2XMTA 4XPEA 4USWA 3R8YA 4C7QA 2FJWA 1YJUA 2P2CB 1FF2A 2MTLA 1ELOA 1X0PA 5G4DA 4U8VA 4O44A 1R89A 2DNNA 1UFKA 1TL4A 1N54B 1VK3A 4ZVUB 4P2MA 1CJTB 2Z0GA 4B17A 3A8JA 2W2OP 3QGHA 1VQSA 3NL0A 4PYDA 4X4NA 2E5JA 2A3JA 3TA2A 2RDIA 3OR1B 1R6VA 2CG8A 3ZZPA 3PV8A 1RTIB 4QPTA 4L74A 5BYQA 3VGTA 4DUYF 1XBWA 3BB5A 3EZOA 3W8GA 3VTIA 3PW2A 2ASDA 3B54A 1QAJA 2MQMA 4X4SA 3QAUA 2UUCJ 2WOMA 3TA1A 2B6AB 3N5FA
chains in the Genus database with same CATH topology
2DH9A 1D1UA 2I2YA 4DSIA 4NYZA 1HBUA 1HQUA 1D8YA 2J6TA 3CO9A 3OXLA 1MU2B 4NCBA 2KXNB 4Y2CA 3CCJS 5HROA 4PG5A 5KFDA 1LFPA 5EWGA 2J5AA 4N8NA 5CYMA 3DRPB 2V4QA 2XNQA 1S10A 1RK8A 2HS0A 3HHLD 3JYTA 3D0IE 4K4UA 5E2QA 3MECA 4DSJA 3M05A 3CE8A 5KG6A 5L38A 2FHMA 1AW0A 2EG1A 3K57A 1F5CA 3OQ2A 4OL8A 3LP0A 2BM0A 1VMBA 3OHBA 4DSEA 4TU9A 1FJEB 4G1PA 1CG2A 3IWXA 3QIDA 2XGQA 3BO3A 1VQMS 2F7VA 1FKPA 2QRRA 2OKQA 5E0OA 1IQZA 3DRRA 3VAKA 1ZM2A 3MECB 1DJ0A 1ZZFA 3H2UB 3CCRS 4LJMA 4RU2A 5EN1A 5J1EB 2WBMA 4L72B 4C8LA 1SV5A 1SJQA 2YKPA 3UD4P 4IRKA 2KRRA 2QE5A 3NLCA 2XMVA 4F02A 3CD5A 4HTJA 2G9OA 3MR3A 5GAEU 2WTFA 2MB0B 4PG6A 2IFXA 3U27A 2V4JA 4ES2A 1P1TA 3MM9B 4DQSA 3LF0A 5KT5A 3HVWA 4CIOA 2XHWA 2FC8A 4TQSA 1RT2B 2V8VA 1XTZA 1LWFA 5L1JA 2BDPA 5DDQC 3H5XA 1GXTA 4K4ZA 2RQ4A 5KFWA 2NPIA 1LFWA 1EP4A 2HNZA 1NEEA 5GAGI 1UETA 1S49A 2EVZA 4TLRA 3FDSA 3DYAA 3DRYA 3DDKA 3TAMB 3MUMP 4H4OB 4B02A 1BQMA 3M6WA 1F2GA 1TKXA 3CB4A 2YKNB 4URQU 1WHVA 2ZNZA 3M6VA 4WE1B 4BS2A 3MMCB 3FZBA 4I64A 2W8LA 5J2QB 5CD4H 1GX5A 4UY85 4TYBA 3MEDA 2BZ2A 3Q2SC 4UOCA 1SC6A 2VPYB 3OFGA 2ZH6A 2VA2A 3MM6B 1RTDA 3LGMA 1LWFB 2GIRA 1NJIT 1E6YA 3KNGA 4IDKA 2NS1B 1BD6A 3WZ0A 1TK0A 1SKWA 3G8SA 1S1WB 3C66A 5AE3A 5D4LA 1DTQA 3DRPA 1GNKA 3HVAA 3LQVA 1P8GA 3DHWC 2ZHAA 2VBWA 2HS3A 1C1BB 2YX1A 3AA9A 4K4YA 5DGAA 3R5DA 3I9V9 3KG4A 3SDEB 3J81Y 5KFLA 1IKVA 5B08A 3OJUA 4DF4A 2FDNA 2V4RA 5LXRA 2ADCA 2EFGA 3DM2A 4B9MA 1XK8A 2IVMA 3WC0A 2QA4S 4YQWA 4QJVA 3U1LA 2DR9A 5HBMB 5KFIA 2FHKA 5U47A 2N4DA 1ZTWA 2KJWA 2PEHA 5ITHA 1YRTA 1IJFB 1Q7LB 3RRHA 2ZE2B 3T9ZA 1NU4A 3CXCR 5H1SV 2Q1LA 3O5TB 1VQ7S 2ZZNA 4LFBF 4DWIA 1KQKA 1X9MA 3P49B 1U48A 1P6TA 2OH2A 2QO3A 4ELUA 2MKSA 1U1QA 4MYUA 3KMSA 3MMAA 1NJWA 1HBOA 3IO1A 2ZH8A 2PC6A 2Z2LA 3CSKA 2B5JB 2CPEA 4NLQA 4A4JA 4QWCA 2O3DA 4ED3A 3CCTA 3OBIA 3TAMA 1JK9B 2V9WA 1SKSA 2DGOA 2DNLA 2KZZA 5MAOA 5DDPC 5HN0A 5ADZA 5E3RA 1ZETA 3J7YI 1FJ7A 1SXLA 1DLOA 5GAEI 5IT4A 3SCIE 4GMKA 2MZ1A 3KLEB 3TAQA 2DRAA 2OMLA 2WBRA 3E8OA 1WACA 1C0TA 2XMUA 1NKEA 1RYSA 2HGLA 4I6WA 1T3NA 1RGVA 3SMZA 2B4VA 3W2WB 1M5PC 2RT3A 4KHPF 4RW7A 2HNYB 2N7CA 3ZZZA 2ZOFA 4DFKA 2DHSA 3DRSA 4HDGA 4ZCKA 2WSFC 4JUZA 5DM6Q 4A8FA 4ICLA 5BJRA 3KJVA 4F25A 1N5YA 1S79A 3FSXA 4WZMA 2P9EA 1BGXT 1Z4UA 4H4KC 3MWBA 1I6JA 5LSLA 2JX2A 2VG7B 3TX8A 5KG5A 4HEA9 5IXUA 2IAJA 1L3VA 3RRGA 4UUWA 2GA7A 2GGPB 5F8IA 2NUUG 4DSKA 1IJEB 1Q86T 1VQLS 2U2FA 4GC7A 2GJIA 1X4FA 4QPXA 1XERA 3VAHA 2VODA 3BJYA 1OWXA 1Y5LB 4UW2A 3QZ7A 5LMNF 4DR4F 3HMJG 2BRLA 1N5QA 3VQSA 2MQPA 2J76E 3M2VB 2VONA 2LQBA 2PA8D 3KOAA 2LXIA 1VQOS 3GV8B 1TVRA 1FRKA 4I6AA 5KFXA 5GMKa 2W24A 2R7RA 1M90T 1J5OB 3CCUS 1IKYB 2ZD1A 2JHEA 1K1SA 3U1MA 4K50A 1HWIA 4OI0A 3HO1A 3K0JA 2ZBIA 3HHLC 4PXBA 3IG1A 5KFBA 1LWCA 1YTYA 1U4BA 3NKYA 4RW9B 4ZLPA 4RW6B 4V19J 1UWBB 2BRKA 2JOQA 2DVIA 3BQ2A 1KVJA 4WXOA 1E6VA 1RT1B 2L9NA 5B0DA 5J2NB 2CZ4A 2EC0A 3N01A 5T7LB 4WU3A 2ZKTA 1LV5A 3M8QA 1KQSR 2FHJD 1Q78A 2IA0A 3NCQA 4FVMA 5F0UA 1GTHA 4OI1A 5A2QY 4CH1A 3I55S 5E3PA 4KRWA 2HFOA 2LDIA 2DNQA 1S1XA 1HBNB 1Q16B 5KFZA 1KSPA 2PT0A 3WDOA 4NCAA 2RRAA 1SJFA 5CYQB 4ZPVR 1RT3A 4CNYA 3OL6A 2BYCA 2R8HA 4OI6A 4DBQA 4ZHRB 2XBPA 2ERRA 2HHTA 1JLGA 1REVA 3PXGa 3G6ES 5L9NA 1VQ9S 1S72S 3QMQA 1I94F 3CJ3A 4DL6A 3C6TB 1BC6A 3LGNA 4IFYB 3TVKA 3CJKB 3I6PA 2RKIB 3K5NA 5DG7A 4C8YA 2GGPA 4NLVA 5T7LA 4ILRA 4EZ6A 2M7SA 1N5VA 3CEDA 5GAHI 2YVSA 2PGCA 2HMIB 1D0EA 2M70A 1KRPA 4W90B 1NNDA 3CJ4A 3RB0A 1W2IA 1VOMA 2W9BA 3QLHB 1T03A 3PFOA 2XULA 2VKZG 1CEZA 3MM5A 2CQ3A 4PXDA 3MMBB 1SL0A 2D3OR 4R0EA 1N6QB 1OQ6A 1WHWA 5LJ5Y 3O1LA 4WIIA 2V8GA 4WE1A 4IG0B 2N3OA 2IRXA 1LWEA 3B82A 1IM4A 2OLWA 1MMLA 1HL6A 1RQ0A 1N36F 1CC7A 4TY8A 4KB7A 2YWFA 2EFPA 5I3PA 1DARA 3L7PA 1IKWA 1IBMF 2FPHX 1JLEA 3IRXB 2ADBA 1GH8A 2NSBA 1VJWA 1GQEA 1L3KA 1U7LA 2OTJS 2AYBA 4IH7A 2BXJA 1U1RA 3L95X 5D4NA 4DV7F 2PO4A 3MPVA 3M2RA 1J5EF 4LF8F 2XI3A 4JYAF 4F2SA 4PWUA 4WCEQ 4X84A 1YI2S 3CDAA 4HH1A 1N6QA 3BGRA 3DYAB 2XC9A 2GHVC 1BWEA 2YNFA 5KOWA 2CJBA 2W7OA 5DRKA 1O51A 4N76A 1VQYA 5A8RA 2YWGA 4X4UA 4UQTA 5B09A 1S9GB 3HVTA 2VD3A 1M5SA 1HNIB 3JSRA 1T95A 4J9MA 5GAGU 1O8BA 1U2RA 4DN9A 2VG7A 1WG1A 5FDLB 1S97A 4DS5A 2RNEA 4OX8A 4QIGA 1LXJA 4QWDA 4ES1A 2KXFA 1Y4ZB 2FVCA 1R6YA 2BUNA 3NNCA 5IM0B 4QR1A 3OV7A 2I9SA 1NRKA 1JXEA 2W9BB 2OTLS 2DHGA 4OHWA 3PKYA 1X0FA 3I4HX 3BGLA 3ZC4A 4JI4F 3THPA 2DGVA 3CDUA 1BQNB 1S7HA 4FS2A 2C3PA 4K5RA 2YWHA 1RDRA 4IR9A 5E41A 5GADI 4RWWA 1FKPB 1KR4A 3CJKA 4FN5A 4TKTA 2GC8A 2M8HA 3ENVA 4J9LA 2B51A 3E01B 3AB2B 3GE9A 1UEUA 1NK5A 4CT9A 1J5OA 5DG9A 3POTB 1PGZA 4MKYA 1SKRA 2FVSA 3IR6B 1DQ8A 2ZC3A 4G1QB 1HNVB 3ULHA 4MFBA 4RNFA 4IDKB 1FD8A 4TYAA 2AYGA 5CCMA 3QJPA 5CYJA 5KAKA 4MTPA 4RW6A 2CPIA 4PG4A 1RISA 1TL1B 3ONQA 4Y2IA 5IM0A 1S1UB 5JXSA 1LKZA 3TARA 4ICLB 4ALZA 3CT9A 2E7WA 4NCGB 4NLUA 2BANA 2V94A 4RLEA 5HROB 4ECRA 3RW7A 2E1CA 4FYDA 2Z4PA 2ROEA 4ZPBA 4QWEA 2YY3A 4Q5VA 1YJTA 4QWAA 1NZAA 3FRYA 2MJNA 3HDSA 5HBMA 2DNZA 2FGCA 2B9WA 1JLFB 1SI9A 2ZC4A 3I32A 3THTA 1QAIA 5D4PA 1KNZA 4NZ0A 4NA2A 4QR2A 2LQ5A 4YR3A 1RT6B 1O5JA 3D5MA 1T02A 3KLIA 3VAGA 3CCZA 3PZPA 2L41A 1UVKA 2COLA 1U45A 4PQUB 1SH0A 1S6QB 1UMJA 4C3MA 4RU9A 2O1PA 4LF7F 3D1QA 4O44B 5CZVA 2J8AA 2KXHA 2IAJB 4FP9A 3RU0A 1NB7A 3SXLA 4DL3A 1LOUA 1XWLA 4I2PB 4HI1A 4USHA 1FTCA 2HPUA 3MPYA 4QWBA 4G6VB 1VIXA 2FVRA 3SFGA 1HFEL 1UEVA 2HHWA 2CG4A 3M32B 3TUZC 1FXRA 2AJFE 2XMMA 4PG7A 4AFFA 4LF5F 1WNEA 2QA1A 2E9RX 2GQ2A 1RTJA 3FSYA 5J1PA 2HHUA 4J9NA 3SSSA 3TQ1A 2EG2A 1N0UA 5I3UB 2KT3A 4M5DA 2MSTA 3Q8RB 3IFEA 2R8IA 3FRZA 4HTIA 1C0UA 2BW2A 3MM7A 5FD1A 3POTA 1HHSA 1CQMA 3KK1A 4NL5A 3CD7A 3KJVB 5KT6A 3NGKA 3KLGA 1LW0A 1KTQA 1VS3A 2PE8A 4JI3F 2K1RB 3H5SA 4H4KA 4KQZA 4D3HA 1RJJA 5BYRA 1S77D 1VC0A 2FC9A 1DRZA 3AHPA 3IGNA 3ISZA 1JLAB 3NBPA 5DQIA 2HFNA 4JI8F 3SQGB 5AXNA 2LCWA 4RUAA 3G8QA 2LA6A 3HKWA 1GX6A 2LDYA 1TKZA 4C0BA 3QIPB 2W25A 5HLFB 3CUNA 4ZP9A 1Q81T 3MEGB 1URNA 1VRTA 2KHDA 3I5BA 3PFEA 4IG3A 4OV1A 2ASYA 2EFNA 5E5NA 3UR3C 4NZ6A 4C3KA 4K4XA 3EUNA 2CPDA 3HPOA 2Z2MA 4YEAA 1F60B 1S9GA 3Q23A 2IVFB 5EDWA 1LWCB 1U1MA 4JV1A 1EETB 3UDLA 3W2VA 1X9WA 4O3PA 1H6KX 1Q8BA 1YITS 3HK2A 4RZRA 1VHFA 4XDCA 7FD1A 5B0GA 3C3LA 4DSFA 4I2PA 3V5RA 4JV5F 3KLFA 1QY7A 3DN9A 2IYIA 2MZJA 1E6VB 3P5TL 3CJ5A 3IBWA 3V4IB 2E1MC 3BDPA 1AUDA 3BR9A 2Q79A 3OFEA 4Y6IA 4C97A 3KKFA 4FBUA 5EHHA 4DR3F 5J1NA 1HBNA 1DURA 3DMJA 2FJEB 2CDQA 3HHKA 3GV5B 1C4AA 2F8EX 3TRGA 4NOHA 3BQ0A 1ZZNA 1BQXA 4YDDB 3EXCX 3BREA 5EWEA 1T05B 4J9OA 3OL7A 2I8EA 1D9FA 2Q66A 1FVSA 1VQKS 2E29A 2HHPA 2DITA 2YH1A 5A8KB 1TUVA 4URGA 1JB0C 1FERA 4MYTA 5M2RA 4OX9F 1B0VA 1WTFA 1ZBTA 5HQ8A 3MR2A 3EPGA 4Q43A 4IOAQ 4K4SA 3F73A 3IWNC 2OP5A 3RR7A 4NYPA 3ZZYA 1HBMA 2IJFA 3MMBA 2H9ZA 1QVFR 1NJXA 1FDBA 2ABYA 4TNOA 4AUKA 3FQLA 2FTRA 3R5BA 4ZHRA 3OL8A 1T03B 2QMWA 1C0UB 2ZJRQ 4X66F 2UVUA 3E2EA 1Y7PA 1KOOA 2R8GA 2DH8A 1W25A 3MMAB 1XMOF 1K9MT 2QFJA 4Q8EA 2DGSA 2GO8A 2XS7A 3HFKA 2R2UA 2RKIA 3NRBA 2E7XA 4I4BA 3IRXA 3M6UA 3SCJE 2HAIA 2AJ1A 1WG5A 5KFRA 4C3LA 4CH0S 2LXUA 3HM9A 2HZCA 3DRSB 3UI3A 2B0GA 3JTNA 3RR8A 1HBUB 1HQUB 1TV6A 3DNCA 4NWBA 5EWFA