4OJGA

The crystal structure of v84d mutant of s. solfataricus acylphosphatase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
EMLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKDDYSFSEYKGEFEDFETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acylphosphatase
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 23
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ojgA00
2K7JA 1APSA 1CC8A 1VQYA 2JDJA 3FMBA 2XMWA 2ZDPA 4OJ1A 1KVIA 3TOQA 5B0EA 3VTIA 2GGPA 4Y2MA 1AW0A 2XMMA 2HLUA 2OKQA 2XMJA 2HQIA 3HF5A 1AFIA 4QOTA 3LO3A 5B08A 1X8DA 1Q4RA 2OD4A 3BB5A 3WDOA 5B0CA 1FE4A 2ZDOA 2ROEA 2VV5A 2XMVA 3MCSA 4Y2KA 1N5SA 3KG1A 1FVSA 2BJEA 2KT3A 2OFGX 4EFAC 2W4CA 1YRXA 1JWWA 1V3ZA 1X0PA 4ZA1A 1YJUA 2EW9A 2OFHX 2KKHA 3BR8A 1YJVA 1URRA 2ROPA 2OMOA 3E8OA 4FNIA 2QLWA 2GA7A 2W4PA 1Q8BA 2RILA 1S6UA 1W2IA 1Q8LA 2K1RB 2K2PA 3KG0A 1Q53A 4NPOA 2RMLA 1CC7A 1MWZA 3HX9A 1Y3JA 4YDXA 4A46A 1TL5A 2BBEA 3KNGA 2K1RA 3BDEA 2PD1A 3I9ZA 1N5VA 2GFFA 2FTRA 3IWXA 3UDCA 5K9FA 5B09A 2GCFA 5T7LB 3HDSA 4A47A 2QLXA 1OPZA 1FESA 3FRYA 3CJKB 3QMQA 2AW0A 2XMTA 5A6WA 4Q2LA 2XMUA 2HFOA 5T7LA 2CRLA 1GXUA 2K7KA 4OJHA 1P6TA 2W4DA 3IWLA 3K7RA 4ZOSA 1K0VA 1YJRA 2RU9A 1U7LA 1FD8A 3HFKA 3CJKA 2LQ9A 1R6YA 2L3MA 2FB0A 3BM7A 2G9OA 1Y3KA 4OJGA 1JK9B 1XBWA 1Y9OA 3GZ7A 3HHLB 4HL9A 2BUNA 2LXFA 3BN7A 5B0GA 1AFJA 1ULRA 2OAUA 4DL0C 3DXSX 4OIXA 1KQKA 1QUPA 2QIFA 1FE0A 1X7VA 1Y0HA 3MZIA 1OSDA 4HI1A 5B0BA 3HHLA 4NL5A 2HIQA 1RJJA 2N4DA 3LGNA 2ROGA 5IXUA 2HFNA 3HHLC 2KYZA 1TUVA 4FNHA 5B0AA 4HH0A 3KKFA 1OQ3A 1YJTA 1VQSA 5F0UA 1IUJA 4YEAA 2N7YA 2OP5A 3LGMA 2FHMA 1GXTA 2AJ1A 1N5QA 2AJ0A 2BJDA 1N5TA 1OQ6A 5F0WA 5A6PA 1SI9A 3T9NA 1CPZA 4F67A 4A48A 2AP6A 2ASYA 3F44A 2VH7A 2PGCA 2OD6A 2GV1A 2KT2A 1P8GA 2N4CA 3HHLD 3QGPA 4DPOA 3DCAA 2IYIA 1FVQA 3BF4A 4DN9A 2XMKA 3TRGA 4A4JA 2QYCA 2LDIA 4OJ3A 2FIUA 5B0FA 1KVJA 3TNVA 4Q2MA 1TL4A 2LQBA 1LQ9A 4Y2IA 1SQEA 1SB6A 2IYGA 5B0DA 1FEEA 1TZ0A 2GO8A 2IFXA 4HH1A 2RSQA 4HI2A 4U9RA 2Q3PA 1S6OA 3BGUA 2BYCA 2GGPB 2HLTA 1TR0A 1YG0A 5KAKA 1MWYA 1WD6A 2ACYA 3FGVA
chains in the Genus database with same CATH superfamily
2UXBJ 3TW0A 2W7OA 2GGPA 2BX6A 3JXOA 3BKUA 1S4EA 4LF2A 2ZDOA 3RB4A 2FLPA 4EFAC 1B7YB 2HRYA 4K4XA 4ZDNA 1KHWA 3DOKB 4O3NA 2U1AA 5E3QA 3E2EA 2IJFA 4DX8H 1UVNA 3EZOA 2I9SA 2VFSA 1SH3A 2MPUA 2CZ9A 4K4SA 4F2RA 4PPZA 2W9BA 5LOQA 5C25B 1X9SA 2J9DE 4I64A 2AMCB 5EX0A 2DR5A 4AXIA 1JK9B 1W7WA 3AJDA 4ED1A 3BH7B 3PW4A 1N6QA 2DO0A 2DH8A 3AT1B 2YNHA 5IS2A 1WDDA 4B02A 3V6JA 1NHKL 4DPYA 4A8XA 2J7WA 4KO0B 1RT3A 4ECZA 1K73T 5I3UB 2CJXB 3VAGA 2HHWA 3MOJB 1X4BA 2EBGA 2IAJA 3H42A 1ACMB 1R0AB 2R7OA 3LP2B 1XR5A 1JLQA 4OJ1A 1RA6A 2PSZA 5KFKA 1L5UA 3QAEA 2KRBA 1S1UB 5HP1A 4ZCKA 1K1QA 2X1FA 1OS5A 1X31C 4ZK7M 2KT3A 3NOGA 3A3NB 2ATCB 3DLKB 4N56A 5IC4B 4M5GA 3GR1A 1VJQA 4TQSA 4X84A 4ZVFA 4XIUA 3DC2A 1FA0A 1NZ8A 1D3WA 4NCGB 5FD1A 2C3MA 3P5BP 1HBNA 4EI2A 4C0BA 4JV0A 4K50A 4P2MA 3CJRA 4JP8A 1KLMA 3W2WA 5CCLA 4RW7B 3DXSX 1ZZNA 1Y0HA 2HHPA 4DR3J 3LP0B 4FXVA 4DSJA 1WWHA 1M5OC 3N0VA 2KYZA 2RDIA 1S0NA 1ZPWX 3WZ0A 2DXFA 3ILIA 2CQ2A 2NREA 3M1VA 2VH7A 3ENAA 1Q78A 4KTQA 2E44A 5IZHA 3KTQA 3PYFA 2F8MA 5KFOA 1YBAA 5HQMA 4LIRA 1WEZA 2HNYB 2LU1A 1NSKL 1UJ6A 1EHWA 4WIIA 5KFUA 8RUCA 2Y0BB 2IVFB 3WDOA 4CWBA 1RB0A 2KXFA 1T3OA 2PE8A 3LWLA 4EO8A 3RRHA 1FERA 1S6UA 4IDKA 1VIXA 3G71S 5BR8F 3I4PA 2JC1A 3AB2B 3CD0A 4CH0S 4JI3J 1VQ6S 4NLQA 2XMTA 1SJRA 3M05A 2KRRA 4ICLA 3KFWX 4JI4J 2HRUA 1WKKA 4MTPA 1EETB 2NPFA 2RUSA 1N36J 2QIFA 3ENVA 2C42A 1CJVB 4R0JA 3W9HA 2OTJS 2KHCA 2WVFA 1HI0P 3MMAB 5DLGA 4XDDA 1KFSA 2DHHA 3OSPA 3CC4S 3G6YA 4ZMMA 4DSEA 4HH1A 4KHRA 1APSA 3R6GB 3TJ8A 1KOOA 3FMBA 4NLGA 1EKRA 1S49A 3CCTA 4Q43A 1TKZB 3TANA 2HFZA 1KONA 2HNZB 2W4CA 2ZM6J 1XMQF 2KU7A 4URGA 2Y0SD 3PFEA 4Y28C 4GMKA 3IBWA 1JJCB 3LUYA 3CC2S 3GJQB 1H74A 2DH9A 3DRPA 2L3MA 3BH6B 5C5JA 1TFWA 2L9NA 1DTTB 4UW2A 2OMLA 4RZRA 3CCVS 3W8GA 1OSDA 2CPFA 5C7PA 3TEHB 2HIYA 5GADI 4L73A 2ASLA 3JTOA 5E3CA 1MW7A 3L95X 4DCPB 4RW9A 3D0IE 3TRGA 3CJ0A 2GQ2A 4KPYA 4K2JA 4EWTA 2WOMA 4BLGA 3J7AN 1ZS6A 2XSFA 4DEZA 4W90B 2Q43A 4P74A 5EHHA 3MEGA 2YWFA 1H7XA 2F8EX 4HDGA 4L3KA 2MZTA 4QZVB 4URQU 1RAOA 1C4AA 3RW7A 3G4SS 1LKZA 4HHUA 4DCJB 1UEKA 3K89A 2QA2A 5T7LB 4A47A 1B99A 2XS7A 4KGZB 3RUBL 4RUAA 5F9NA 4NZ0A 5FLXY 3Q8UA 1F3FA 4FBTA 2GX8A 2LQ8A 1HW9A 2MMYA 3CTRA 1VYAA 4XTTA 4LSNB 2V2QA 5KFAA 1RYRA 1ZH5A 5D0RA 2VBZA 1IXKA 4EEYA 3ILJA 4LQ3A 3W7BA 2BJDA 1WNEA 3MM9B 5LXRA 4WFBQ 2M70A 2Y1LB 4O3QA 4LF9J 1RWWB 1WG1A 4KYZA 3OUYB 2XG8A 4R5PB 2ZEJA 2L08A 3IBFB 3VTIA 3C6UB 1VI7A 4F0HA 1F1BB 1ROFA 2GIFA 4X66F 2DGSA 1JWWA 4CTAB 2JVOA 3MURP 3Q23A 8AT1B 2V2ZA 4YDXA 5HQ8A 4QIVA 2MYFA 2UXCJ 5K9FA 5KOXA 1LK7A 2B4UA 1GMWA 4V1Ak 3R5BA 4C8LA 3GMGA 1SH0A 1PIEA 5J2MB 4KV8A 3NMRA 2W01A 4ZPVR 4TXSA 3MMJA 1RCXB 3R1HA 1TL3B 1TVRA 5BJRA 1S9EB 2UUBJ 1IN0A 1ZAWA 2Q6CA 1N52B 2B3TB 2FQQB 3HHLD 5U47A 1FVQA 1FKOA 4H4KA 3EX7B 3VGUA 1Z1ZA 1F5CA 4H4KC 1RTHA 4YHHJ 1RK8A 4ID8A 3CC7S 2D3UA 4O23A 1UETA 2ZKUA 3GQCA 4J37A 2XMMA 2W7AA 4MIBA 2XMJA 3AD9C 5E33A 1U0HA 1ZM2A 5B0CA 2AGPA 2A18A 1N5SA 2VG5B 4A8YA 1B0PA 1YX2A 3MF5A 5CZVA 4MKVA 3M8PB 2N7CA 4C48A 3NP5A 2EI5A 5L46A 3DM2A 2J7KA 3MFIA 5M2RA 9ATCB 3QT7A 2LXUA 1UWBB 2HGNA 2W24A 1U1RA 3R9LA 2HQ3A 5CA5A 4QR0A 2OAUA 5I42B 1S6QA 1YIJS 4C11B 1UJ4A 3CULA 4MFBA 3R5AA 5L1IA 3LGMA 1X5TA 3QO9B 2RAQA 4DZ6A 2VOOA 4ANEA 3MM6A 3IM9A 4ZVUB 3UCGA 3J7YI 4RU2A 1LQ9A 1GMUA 3I5BA 5KAKA 2DRBA 3VCDA 4I68A 3D4JA 1FTRA 3VV2B 2V67A 3K8WA 1WF2A 2ZM6F 2FD2A 1U2FA 3PZPA 1HMVB 4B3MJ 3IXQA 2AJFE 2MGZB 3SZ2A 2GA7A 1C0UB 2I1RA 2K1RB 3MUVP 3FCWA 2UUWA 1JXVA 1FRHA 3BDEA 5KFDA 3K2YA 2ZWOA 3CJTA 2DHAA 2ZH2A 4U7UK 1X4DA 5IV4A 1D8YA 2W4DA 3CJKA 5A8RB 1N33J 4BBYA 2ZOFA 3A3OB 1RHRB 1NH7A 4QWEA 4QCLA 1UWAA 2KT5A 2DHXA 3CJSA 4OZNA 2B4OA 1EP4A 3BO3A 4F0MA 4M5KA 3OJUA 3PTWA 5F0UA 2FJXA 4DR1J 1FDDA 4IUFA 5JJBA 2YQ0A 5CYMA 3BKTA 4FYVB 4O4GA 2KTQA 1VGYA 3ZZUA 3W1YC 3PX0A 4MYUA 2OPSA 5EWGA 1N54B 1BQNA 3M9MB 3DOMB 3DOLA 2XLJA 3NCRA 3H2VE 4ENOA 4LUBA 4OV1A 2QFJA 5HI7A 5E7OB 1YJUA 3BR8A 2CG8A 4LFAJ 2YNIA 1X4CA 2WTFA 3BBFA 2HWIA 2KH9A 2UU9F 3MPYA 5GADU 1R8AA 2XI3A 3FDSA 3C2PA 1U8WA 3LAKA 3H20A 3RBZA 3AXMA 4R25A 2RQCA 2XY5A 4OHZA 2P9CA 3DLJA 1YJRA 1UVIA 1DQ8A 2MZQA 4RWWA 3G87A 3W64A 3HI9A 4PG8A 2YX1A 3BN7A 5A76A 2QO3A 5HLFB 1SL0A 2HNDA 2F7VA 3OLAA 3D54A 1SXLA 2X51A 3EGNA 4YY3F 3P4UB 3V4IA 3G2XA 1BY9A 4RW4B 3ZTRA 2KL8A 5AJ3F 3KLEA 2EFQA 1FDNA 1YGYA 3W5XA 2VQFF 1YWXA 4WF9Q 4TVAB 5K5MA 4X4RA 4J9RA 4WYLA 4DSLA 2VODA 3DLHA 2DISA 2OUGA 1RABB 4DR5F 2ACYA 4YR2A 2HBZB 3EDQB 4OZ3A 5HROB 3ET6B 2CJAA 4FPIA 1S1VA 1WTBA 3B78A 4DV3F 2ROEA 3DLBA 2IY5B 4K5SA 4LFCF 1PSDA 1X0PA 4ILRA 4X2BA 1FDAA 1JQGA 2GQQA 4O3SA 1T03A 4PXEA 2HZAA 3IWXA 1N32J 2PMHA 1KN6A 3W9JA 3NMAA 1AZSB 3M2UB 3SMZA 5KT5A 1U7LA 4U6PA 1FEHA 4DL4A 4AT1B 2B6AB 2R7RA 4X4PA 4B17A 4CLLA 5IFMA 1S59A 3G82B 4DQQA 4PABA 2GMLA 2V69A 4ZHRA 2R7WA 3KLIB 2UUBF 2ASJA 2EFGA 2WSFC 1RWUA 2HMIB 2I5JB 1G3OA 4QPTA 4ZJLA 2E29A 3AQOA 2FPHX 3ENQA 2PGCA 2HHSA 3HXMA 1XR6A 2FIUA 4WU3A 2H3EB 1DAXA 1S9FA 4U8VA 1JLCA 2Z2LA 2JEJA 4I56A 1T9VA 3DRSB 2ZOMA 3MPDA 4A8OA 2FVSA 2D7SA 4JI5F 3J81j 4RL1A 2YNGA 3P8BB 1QVFR 2CVIA 1FE4A 2J9CA 1NEEA 3DGVA 3GV5B 2W4PA 1T8EA 1RAIB 3UNGC 1CJKB 2ZVIA 2BMBA 1AUSL 2FJEB 4JI7F 3HD2A 3KHRA 3T5JA 2IBKA 3GONA 4QPXA 1HD0A 4WTYA 3NG8A 5J2QA 4DV7F 3K5PA 2LLZA 4ER8A 1SJQA 4CYUB 1Q95G 4RW6A 2ZKTA 2FVRA 3KUGA 5L9NA 2YQ3A 3IBCB 2FUG9 3SCLE 1DHMA 1DBDA 4C4WA 1RHQB 2KM8B 1OY9A 5DRKA 2KJVA 1U1PA 2G0JA 1H2VZ 2DHGA 4CLTA 4HYKA 2AF6A 1WJ9A 5A2QU 3P49B 1DRZA 3R7SB 4C8KA 2MKYA 1DURA 2V8VA 1JB0C 3E3XA 5EDWA 3SFUA 4B3MF 3NGDA 2EFNA 1MROB 3DLGA 2B8QA 5KG0A 1FKPA 3N9UC 3BR9A 1RADB 1HNWJ 3CCES 2DGUA 2AZ3A 1YTYA 3R97A 4A46A 1TL5A 1WEXA 1V3SA 3KOAA 4WP8A 4LSLA 2VC0A 3BSNA 2E9TA 3H7HB 2CQ4A 2K7KA 2W2MP 1T7PA 2HYIB 3M32A 4KGXB 3J7YU 2XY6A 2JSXA 3ZNUA 4DUZF 3B8HA 1QVGR 1U6BA 2HS4A 1GXLA 1VQNS 5CYQB 3OJSA 1RWPB 3DDIA 1HL6A 1OJ4A 2VIHA 2DNKA 1MN7A 3L09A 3PJWA 1NDKA 5B0DA 4HI2A 1X5PA 1NK9A 5KFXA 5E41A 1TMMA 3GU0A 4JI0F 2OH2A 1Y4ZB 4QWBA 2GJFA 3AY0A 4FVCA 2GO9A 2VL1A 1LW0A 2QLWA 2RQ4A 5A8KB 1K9MT 1UTAA 4DL7A 3KG0A 2MJNA 3M30B 2HHVA 1X5OA 3OTEA 3DI6B 2VU5A 3R7BB 3GCXP 4RW8A 3FQKA 3A4TA 5AXMA 4P72A 5LMUJ 1KHVA 2HFSA 3LOUA 5KG6A 3I5AA 2QX0A 5F3ZA 2EKNA 2H65B 4I7FA 2B5JB 3ICLA 3GZ7A 2BJ7A 4WKYA 1JX4A 3PYGA 3KLGB 3U02A 1LEOA 4DV5F 1GK8A 1IBKF 1U2CA 3X3UA 2V8DA 1SC6A 1CBKA 2IMWP 2UUAJ 2BE2A 1CULB 1OQ3A 5FJ4A 4WP3A 2CPEA 3FFIB 3VVTA 4F67A 2HQDA 3A8EA 3M8WA 3N6MA 2OPRA 2F40A 2FZKB 3A8IA 4ZCLA 1U6FA 1SB6A 2HURA 5K14B 1TL1A 3SQGA 1BXNA 1JKHA 1MN9A 3ZO7A 3L3CA 4TU8A 3PCOB 1K0TA 1TL7B 5SUHA 2E9RX 2DGTA 4QU7A 4M5DB 1HNXF 1U1NA 4DV6F 3VQTA 1V3ZA 3ZXWA 4Q45A 2WBRA 2DNPA 5DZ7A 2NXUA 4MJKA 1HYSA 2CWKA 1N32F 2YX7A 3T6JA 1S4FA 2OEMA 1J5OA 3IP0A 4JBCA 1DY3A 4V19J 2VQEJ 4IFVA 3NBPA 1HD1A 5HMXA 2W25A 2WZ1A 1PILA 3G8SA 3HJFA 4OYPA 4C3KA 4KKOB 2VF3A 4UY85 5HVFA 5GMDA 1W25A 1CVJA 4HTIA 2E66A 2DR8A 1FXLA 4Q8FA 2RT3A 5L8RC 5IWAF 3UN3A 3H8YA 3H2LA 2XMKA 4LQ9A 1SJFA 1EQ0A 5J2PB 4LSZB 2AYBA 4B9VA 4YP3A 2MLYA 2FZGB 2CQ0A 2R4FA 3M9NB 3HF5A 5CH7B 1Q7YT 3A12A 2FJBB 3GIMA 4HTJA 3B54A 2KO1A 1HNVB 4ZVTB 2G2OA 4C8NA 2K2PA 2ZNYA 2O66A 1CC7A 3I0SB 2OPPB 3OVAA 2PI4A 4OZ2A 2BDPA 3H0PA 1S1WB 3D1OA 1RT7A 4DPXA 1XN9A 4OYWA 5CD4H 1CJUB 4H54A 3UD4P 3THTA 2WB1D 4CLZA 2ZBCA 1MMLA 1M5KC 1YJ9S 3AH6A 2E5IA 2DYAA 4O0IA 5DETA 2J6UA 5C42A 2RH3A 4K59A 1E6YB 5LXYA 3T5KA 2R7TA 1R8CA 2JEIA 2J6SA 1GXTA 2DCLA 1RT1A 2HRTA 3F44A 3V6DA 4ZLPA 1TTHB 3D67A 2DNQA 5HMZA 2XS5A 1G4CA 4EBDA 4MYTA 5DG9A 4WPAA 3DGPA 3QT5A 2GVZA 1RT2A 1CC8A 5F41A 1D1UA 2UXDF 1TQLA 1HBUB 1HNWF 3OXFA 2LU2A 2FHJA 2VPZB 2YNFB 2R2RA 1FRKA 3E8OA 3I96A 4QWDA 2MKCA 4ELUA 4A8FA 2QA1A 4USTA 1Y3JA 4DUYF 3DOKA 2CJYB 2DY9A 4J9LA 3PG9A 4X62F 2V8GA 3TQEA 1A9NB 2RRAA 5C25A 1U25A 1RWNB 4DR6J 1FNOA 4ZJQA 1NKCA 1Q82T 1KEKA 3M8QB 2PIIA 4F4AA 4J90A 4K4ZA 3N4WA 2GMJA 1RHMB 3DHWC 1VC0A 2C28A 2GNKA 4FXWA 1VRQC 2QV6A 4AYBD 1L3VA 3ZZTA 4KO0A 3KJQB 5I3UA 2DY1A 2IVYA 3CSKA 3TZWA 1WC3A 3G96A 4RX6A 4WFNQ 5F8MA 3AOBA 4NCAA 4YB1P 2G4BA 3BGFA 1RLDA 1R0AA 1E6VB 4Z7YA 3LP2A 2UUTA 2XMVA 5HJYA 2VA2A 3LA0A 1U2RA 1S1UA 2VG6B 3TVYA 4NXNJ 1RTDB 2PO4A 4ZP8A 1NAQA 1YBUA 1NBEB 1ZM9A 3DLKA 2JZ5A 4J5OA 4CO4A 2YPZA 2CFXA 2JLFA 3PW2A 5DM7Q 4NCGA 3NEKA 1RCOB 3DU6A 2LXIA 5F8GA 3HVTB 1WOSA 1IKWB 4QIEA 4XK8C 2UUAF 2HIQA 4RW7A 1EKSA 4KSEB 5HATA 3LP0A 5ITHA 5D3GB 5KFTA 3H40A 1EB0A 1FJGF 3WHIA 3GIJA 2K3KA 1ZM3A 2AKWB 3L7UA 3M8SA 3CVKA 2V63A 5K8MA 4RO0A 1S48A 4DQSA 4Y2CA 3D6HB 2HBQB 1WD6A 5CAAA 6FDRA 3PV8A 4Z7CA 2HG4A 4FS2A 1PYTA 2HNYA 5B08A 5E5NA 3R6LB 1NRKA 3CJ4A 4F4ZA 2MZSA 2M4MA 3O44A 2DNHA 1O0PA 1PJ5A 2VPXB 2DGQA 3NAHA 1Q1KA 1GTEA 2XWYA 1Y10A 1Z2LA 4DR2J 3JAMU 3SQOP 2KFYA 5GAGI 4L75A 3CD7A 3TJ9A 4DV1F 4OZ0A 3GCWP 5JXSA 1ULRA 4C3MA 5KFVA 1A6LA 1RTHB 5CCMA 2ZE2B 1EETA 4UY8T 3UI3A 3CO9A 2DKOB 4KGMA 3D0HE 3UVJB 1CJVA 2MKIA 3EUNA 1VCTA 4B9TA 3C66A 3HT0A 3AB4B 2MLZA 2GW8A 3CGIA 4M5LA 4U96A 4A4JA 3MMAA 5DZ6A 5FDLB 2XQCA 1WKJA 4ECQA 2F4VJ 1XC9A 3BSCA 3MXHP 2HK3A 4DPWA 2EVZA 4QWCA 4USHA 3CCLS 2VFRA 4Y2KA 4EU0A 3ITHB 5E2QA 2FLOA 1TKZA 3ISZA 4CLPA 2HNZA 2J76E 2A2CA 3IGVA 3SSRA 3TUPA 5KT2A 1SJ4P 3K0JA 3M8YA 3OV7A 3VAFA 3D68A 1YI2S 5DO2A 1J27A 2GVDB 2N82B 4XPEA 3OL6A 1JLGB 1JNZB 1DTTA 3A8KA 3ZTSA 3AJ2A 3IR7B 5GMKa 5ETTA 5K8PA 5EUHA 3RRGA 4N8OA 2Y8WA 3OD2A 2CXEA 3RR7A 3HZEA 1GTHA 3LALA 3NOCA 3Q0AA 1SC4B 3POTB 3MEDB 4QW9A 1BMQB 1Y5NB 3RRKA 2V4RA 5IOLA 5C2CA 1FJEB 4B3TJ 1CQMA 2V8PA 2XI2A 2DRDA 5HBMB 3B6BA 5KFZA 1DZ5A 2VV5A 1FVSA 2EW9A 5J1EB 3EICA 3GFXA 2GAGC 2VOPA 2FY1A 1WF0A 1GX6A 1D0EA 2Y1JA 3GYXB 2R2TA 1U1MA 4J9OA 4UQGA 5T7LA 2HWTA 1VDHA 1GQEA 4TYBA 2AGQA 3D6TB 5ETKA 2AEJA 2IRXA 3M8RA 3S01A 2RQKA 2DIVA 3EVWA 3DRRB 5E0OA 1RTZA 2LA4A 4LSNA 2BKOA 2R2SA 3U1MA 2DEIA 1WI6A 4P2FA 2QYCA 3MM9A 2A10A 2CKWA 2GO8A 4GVBB 4FYWB 3OUYA 4IOCQ 2XEXA 3LH2S 4I6WA 1AW0A 2DNNA 4R5PA 1NCLA 2ABYA 4G1PA 4C98A 2Q66A 3C6UA 4I69A 1U0SA 3ZC4A 1V6HA 4M5NA 4F25A 1X5SA 2E5HA 4X4QA 4GKJF 2VC1A 4CTAA 3ETMA 3MCMA 1NKEA 3K59A 5KFLA 4P75A 3SSSA 1M0SA 4B3SJ 4GKKJ 3QSYB 4NE9C 4KFBB 4DR4J 4U7UD 3GJRB 4MIAA 1VRUB 3BS9A 3D0GE 2IM2A 3HULA 4NLDA 4DN0A 5J2MA 2Z30B 1HBOB 1HHSA 2OEKA 1KC8T 1PBUA 4RUCA 3FBEA 1VQSA 1TL3A 2Z58B 4DFPA 2WCXA 3FCVA 1NNDA 5L9XA 2FVCA 1S9EA 3NXZA 2NXJA 2OD6A 4B3OB 1NMEB 2XC9A 3JQJA 5G4DA 3NY0A 4DL5A 1RTJB 3H5UA 5H9EJ 4FF3A 3ELHA 1N8RT 3WQPA 4NLYA 3ISNC 1IBMJ 2V2VA 3LO3A 5LSOA 2F3JA 4X65J 2DNLA 2G1HA 1BC6A 2VG5A 1NZAA 4ZPDA 2RKIB 3KLFB 4DR2F 3NGRA 4EBCA 1HNZJ 3M8PA 1RU2A 1EX8A 1PKUA 1R8HA 1TUGB 1HPZB 2QL5B 4AFFA 2CPIA 1UWBA 4UQTA 4N47A 3AQPA 2AEFA 4G65A 3AA9A 2D74B 4LRBA 1M1KT 4I2PB 5I42A 5HL7Q 2Z8QA 4C11A 4ILLA 4FXDA 2V8HA 4LF5J 1NLKL 3E51A 3QO9A 2E9ZA 2OLWA 2F4VF 2UZAA 2P6TA 4S0MA 1YZ7A 3OSNA 3TA1A 1YVFA 3VR1A 3QRRA 2PEHA 1B4SA 5HMYA 4Y0FA 1YITS 3R1LA 3EVMA 1UVJA 2KXHA 3B4MA 3BSOA 4E98A 4JV5J 4I6YA 3J7A1 5GAGU 4F26A 4A8SA 4RJVA 2BR0A 2L9WA 2M8HA 3F73A 1O5JA 2QG9B 1HMVA 1S12A 1VQOS 1VQKS 5IQQA 4CRJA 3H90A 3EGVA 3PW7A 2MGZA 1JLEB 1C0UA 2K1RA 1N5VA 2A1BA 1N88A 5AXKA 1FI4A 5IT4A 3QMQA 4ZS6A 4F3MA 3O5TB 1NK7A 2MQLA 2BKPA 4UOGA 2A6OA 4JB8B 2EFPA 5A8RA 4CLUA 1H6KX 3KK3B 1C4CA 2M7SA 4RBTA 4YEAA 9RUBA 2ZJRQ 2BOPA 1UW9A 3JSYA 2XCAA 4AQYJ 1PCAA 3MUMP 5DDPC 1IM4A 4LRCA 5DGAA 1EJ7L 4P7TA 5GAEI 2PA3A 3QT6A 4KHPF 2Y3YA 4K7QA 4PYAA 3CMAS 3QGIA 1RZMA 4J9MA 2MJUA 1TP7A 4L72B 3TVKA 1X9MA 2JC0A 3OBIA 4ZVSB 4WFYA 3DOMA 3ILLA 3BQ0A 3OL9A 2DXEA 2QGFB 1HBMB 4J7CA 3BPDA 4BS2A 3EGWB 3KUEA 4CLYA 1VC6A 1S97A 1T9UA 1TELA 4OZLA 3MMCB 2H48B 1XNRJ 3GPAA 2RU9A 4NLOA 1Q86T 1UVMA 2ZH4A 1C1BB 2DNMA 4DOZA 2CNNB 2LXFA 3VGTA 1JXEA 2KFNA 2FY8A 1HA1A 3MPWA 4HVZA 4NLPA 4PEOA 4J9NA 1BLUA 3A3PB 5HLFA 3O6QA 1MNEA 1XIQA 1U4BA 1VIOA 1OIAA 5E3AA 3MMBB 3UR3C 4A48A 4NYPA 4RW4A 2ZVSA 2IBOA 2HHQA 2QMXA 3KWMA 3KYLA 2IYGA 2CJQA 4PYDA 1CSJA 4GO7X 1F6TA 1GX5A 2R42A 2K7JA 3MCOA 1RHUB 1NK8A 3RBXA 1YJWS 2LECA 2LQ5A 4IR9A 5HROA 3ET6A 4A8MP 3ULHA 3AA8A 2IC3B 1TV6B 4FNIA 4PQUB 1MMNA 2EEYA 3CEDA 3TX8A 4KC5A 3N5BA 2JEFA 4PR6A 2RHQB 3D28A 4B3SF 3RB6A 1S0VA 2E5LF 1HKAA 4ITSA 3MD3A 1UVLA 2GS8A 2BA9A 4ED5A 1HIYA 4ID5B 1UFWA 4ERDA 2XHCA 3OFFA 4F50A 1RAEB 1AZSA 3M2UA 3KNAA 2KVQE 2WHOA 2UUCF 2B6AA 3QRPA 5DJBA 3JSRA 2GJ2A 2FJDB 3A1YG 2N4DA 3G8QA 4PG5A 3MUTP 1WORA 3KLIA 4O44B 2HMIA 2I5JA 4YB7A 2AU0A 4ES2A 4Q7AA 4YMEA 3K5MA 4G6VB 4CI0B 4PWWA 1A7GE 4OYMA 1NKBA 1M5HA 5MAOA 5KFYA 4P6QA 2QN6B 4AL7A 3NNAA 3MPVA 3HHNB 3CXCR 3DRSA 4MMOA 1RYSA 2W7PA 5BR8J 1B0VA 4RWXA 2AT1B 2ZH1A 3JYTB 2Q1LA 4J9UE 3MR7A 1UP1A 3Q8RB 4FP9A 1RBAA 2BW2A 4OHWA 2RU3A 3D7SB 3OT9A 1HNZF 4IOAQ 3CCQS 1CJKA 2CIMA 4W98A 1FESA 5LSLA 1QJHA 3UDEA 4ZLNA 4JOUA 3HSDA 3RYLA 1NUEA 4IO1A 2HZCA 2ZNZA 4I1TA 3BBCA 4QJVA 3FK4A 1FE0A 4PZVA 1TU0B 5D6GA 2V6AA 1NK5A 3HD1A 3P45B 2YKAA 4FZVA 1O6XA 4CYUA 3DU5A 4ECRA 2FHMA 2M8DB 4EBEA 2JHEA 1M1GA 2CPYA 4Y65A 1RAHB 2AEMA 4DU7A 3K17A 4DL3A 2HLTA 2KM8C 1VQPS 5C24B 3PR4A 2C3UA 4KR0B 5D8HB 4ZJOA 3FEXB 4OQJA 1XMQJ 4OHVA 2F5GA 3MR2A 2XHWA 4X64J 1VLYA 1VOMA 3HHEA 4QYZJ 1NK0A 1MROA 4LF1A 1Q8BA 4ANCA 3I55S 3KG4A 3O2IA 1MWZA 3EPGA 3BPSP 1RWKB 3NCPA 3J81Y 5FIIA 3BO2A 4BDPA 1DQAA 3I56S 4IQXA 4PWUA 2LQ9A 2R7QA 5ETVA 4C2MA 2YKPA 1T0TV 2MSSA 4DL0C 2WONB 5KG5A 4JI8F 1LWXA 2RF2B 2HVEA 4QYZK 4Z2XA 2R9LA 2JOQA 5CYQA 4IG0B 4TLRA 5B0FA 5KFHA 1UVKA 4NWBA 3C8YA 1SUQB 1S7IA 1SL2A 1SQFA 2J0WA 3Q2SC 3FGVA 4XPCA 1VQYA 4TNOA 4C8OA 5AE2A 3L7PA 3FVYA 2WRMA 3THVA 2XO7A 1G6BA 2I0XA 1MWQA 4LF6J 3MEEB 4NLSA 5L38A 1MSWD 1U26A 4MH8A 2F9JA 2D9OA 4YOEA 2IM1A 1JNRB 5A8KA 4AL5A 1WUUA 2JLGA 3M30A 3DI6A 1XNRF 2J6TA 4QW8A 3FRYA 4HACB 4LBIA 3GG1A 1G2EA 2DGWA 1B3TA 2BE9B 4ILMA 3EE3A 3BYRA 3HHLB 2MZ1A 2YKNB 3RTVA 2B5JA 2F63A 5GAEU 3QSIA 1UZDA 3KLGA 1S6PB 3HM9A 1FFWB 3T9NA 1I1GA 1XNQF 1CULA 1T3NA 1PJ7A 1ZOTA 2V68A 2XMAA 3OLBA 3DCAA 3FFIA 2O01C 2WBMA 1C0TB 3W2VB 3QFHA 1XJWB 4X66J 5K14A 2VHGA 4X4NA 3I87A 3QBCA 3IRXB 1R31A 2YY3A 4ZLLA 3CDBA 5A8WB 2XZWA 1DJ0A 2MQNA 3GIIA 1FTCA 1TL7A 3PX4A 2BE7D 4M5DA 1BWVA 4WXWA 1W2IA 1YJNS 4N8NA 4PKDB 2F1FA 3UDVA 2E5GA 2BJ3A 4K4VA 3JAMY 3H4BA 3US5A 3GLJA 1IBLF 3P6YC 3V6KA 1TFYA 1FO1A 1GMVA 2A2DA 4M94A 1K0VA 2XZTB 3BM7A 3TR5A 3TQ1A 1FRIA 5LJ5Y 3D2WA 2E1PA 4KKOA 4OX6A 1W26A 1Z2ZA 2LVWA 1MU2B 1C1CB 1YJTA 5CQGA 1K8AT 1SPBP 1NDLA 4M5IA 4NA3A 3IN5A 2ZBIA 4CIOA 3WIUA 2ASYA 1ZTWA 5J1NA 2E1CA 1F9HA 4HEA9 2GV1A 1QTMA 3TUJC 5HO4A 2LMIA 1ZA2B 1RKJA 3T1HJ 1R8PA 4LFBJ 2YH0A 3UNYA 3P96A 1HR0F 4WFZA 1RLCL 1UMJA 5J2PA 4P9SA 3VAHA 1GT8A 3FSYA 3Q24A 2QEXS 4AUKA 3SCKE 4TKTA 1V9OA 2RMLA 4F4KA 1HWIA 1HNVA 3HX9A 4E8UA 4KH1B 1JLBB 2NQPA 2JH3A 1D9AA 3HVRA 2K3IA 4PAAA 3I0SA 2OPPA 3NNHA 2OELA 4F4XA 1S1WA 2HFOA 2VJUA 4B3RF 3LANA 2V2KA 1CJUA 3NS6A 3O1LA 3KK1B 2J7UA 4BC9A 2XWXA 3DKDA 2XCPA 2X1BA 4OZ5A 4HI1A 2A6MA 2DPJA 1RTIB 4ZLJA 1HW8A 2YXLA 1Q8IA 3VZHA 4FKYA 2B43A 1E6YA 1ELOA 2WW8A 4Y34A 3GV8B 1VJWA 2QL7B 3CCZA 4I4BA 2X1GA 2GHWA 4NRUA 3GSIA 2QLBB 2XNRA 3VAKA 2Z2YB 3D1QA 4X64F 4CO5A 1RBLA 3HPOA 2P2CB 4J9VA 2ILZA 3TOQA 3QWPA 4CO1A 3HP6A 1KLNA 1Q4RA 5LMNF 4NX9A 5L39A 4DJBA 4FBUA 2B4PA 1HBUA 3UN2A 1EAYC 2D9PA 3DYAB 3M7VA 3S6EA 4CCHA 2YNFA 1WC0A 1FJCA 2XYHB 2PFDA 3I9ZA 1Y5LB 2BM1A 4MKBA 1O51A 5ETMA 4X4UA 4C9DA 4OYIA 1Y9OA 2GJIA 2OPQB 5D0EA 2FGOA 1SH2A 1AXQA 2QLFB 3HSJA 3EZUA 3KJNB 4DG1B 4OYAA 3ILOA 1G1XA 3M8QA 4ZP7A 3SBMA 2ACMA 3NCQA 2CQBA 1F5BA 5FLXU 4UOFA 5F8HA 2LA6A 4KRWA 3UN5A 2V4QA 2HVIA 1HARA 2DVIA 3BREA 3UCUP 2NSCA 4WFXA 3H2UB 4F2SA 3ZTOA 3KDOA 2UP1A 4NXMF 2J9EA 4D3HA 3KLHB 4JI1J 2UU9J 4F02A 1DLOB 4LF6F 1E6VA 1GAOA 2G0IA 5EWEA 1RE1B 4I0WA 2DH7A 4DLEA 3LQVA 2MZJA 4ED6A 2VG6A 5F8LA 4FN5A 2ZH5A 1RTDA 2OGUA 4K0KF 5KT4A 1FXRA 3JSBA 1XMBA 5KFJA 2XMUA 4B9UA 4YY3J 3ZTQA 4KBIA 4A8WA 2ZOGA 1G7CB 5AJ3J 4M5MA 3A8JA 2IVMA 3HVTA 2VQFJ 3KLVA 2FC8A 1IKWA 3UPFA 2RUGA 2X7IA 3CDEA 2KN4A 1QSSA 1R0CB 4DR5J 1OQ6A 1QM9A 2JL9A 5D3GA 3V5RA 5KT7A 2ZWPA 2GIQA 4DV3J 1NJZA 4LFCJ 4J9PA 4U67Q 3MWBA 2ZH8A 1F3VA 3OTDA 4LIWA 4WZQA 3FUYA 2BQUA 4L3NA 4E0DA 2EC0A 2BKNA 1YJVA 2AIRB 2MQMA 4ES1A 2GIRA 3K5LA 4NPOA 3TWZA 4OI2A 2HHHF 5KG3A 3PR5B 4ETZA 4ED3A 1CEZA 3HKWA 4M8LA 4DQRA 3QPIA 2RD5C 2Z0GA 3Q8SB 4H4MB 4WP9A 4HT7A 2MB0B 2IDEA 4F8RA 4RKUC 1OY8A 2CPHA 4UZBA 4KIAA 1WEYA 3THPA 2HS3A 2GHVC 3DLLQ 1GMWD 4PG6A 3W8PA 2ZE2A 4FNHA 4RNMA 2DHSA 1SKUB 5I3PA 3IAM9 3UVJA 3NLCA 5D0HA 3UD5A 2J8AA 3GYNA 4IR1A 2P8IA 4NZ6A 4ED0A 4DCOB 3TI0A 3SV4A 3T1HF 4LFBF 2OI2A 4JI5J 4DF4A 3LF0A 3BQ2A 2Z2MA 1KVJA 1UL3A 1H98A 4IG3B 1KKHA 4PCQA 2DGOA 1QD1A 3ZTPA 1TKTB 2UVWA 5MLCV 5FDLA 2Q3PA 4AE5A 2VDHA 1IJFB 3MR3A 1A0OB 4XDCA 4F36A 2R8KA 4JI7J 4CLFA 1RACB 2MY7A 3ITHA 1Q53A 4LT6A 3UW1A 3JB9k 5IQ6A 4DV7J 3MAAB 3CDUA 2P9GA 4USJC 2VONA 4M1KA 3MOZA 3PEHA 2UVRA 1FK9B 2OSQA 1VISA 1UPMB 1SV5B 1NJIT 1TAQA 4OHYA 1F9FA 1GEHA 4OX9F 4RNHA 3LGNA 4DU8A 3NS7B 4UOCA 4TLQA 2GVDA 1JLGA 2R7VA 4NA1A 4DUTA 2OTLS 1Q79A 2CPDA 2FZCB 2BACA 3SEOA 3DMJB 4BHQA 1P8GA 2XULA 3GJTB 1T95A 3LP1B 2YWWA 2DTJA 4LF8F 2H9ZA 3POTA 3MEDA 1L3KA 4RR5A 1LWEB 1TAUA 3W60A 2LEBA 2RE1A 3RR8A 3M6UA 3J80Y 3V2UC 5HBMA 4RPFA 3PX6A 3CNQP 2DRAA 2XTJP 4C0HA 1TKXB 2ADBA 5M2PA 5HQLA 5J1EA 3G6ES 5ETPA 3CCUS 4CP5A 3N01A 5B09A 1AT1B 3VAIA 5ETLA 5HN0A 4DUZJ 2M5YA 3R2DJ 3PKYA 3QNWB 7AT1B 3EZ5A 1FRLA 1H73A 2YBVA 5L1KA 3QJLA 1I5OB 4ED2A 3F0NA 2HAIA 4KAIA 2IIHA 2XS2A 3ZZPA 4WE1B 2CDRB 2HGLA 1FXDA 1WHVA 3CPWR 1JLAB 3MTKA 2CJBA 3SV3A 3DRRA 2OHDA 4ANDA 4LVNP 4ELVA 4JI0J 2B51A 2FHOB 1WF1A 2V5HG 1FEEA 4WK3A 3U7JA 2RB7A 2GZOA 2SXLA 4QIGA 1RISA 4JI1F 1XMOF 3RBEA 4GVBA 4ECWA 1FWPA 1HQEB 3F56A 4V19X 2I38A 4HLBA 5KFNA 3HCXA 1OMSA 1FNMA 2ZBPA 4LREA 4DDFA 1KSPA 3TEGA 3DRXA 4OZJA 3L4BC 1J5EJ 3KNGA 1CLFA 1AROP 2GFFA 3GFHA 1RHKB 1H38A 1FWLA 1OYEA 4DV5J 4LJMA 4ZPAA 4J91A 1IBKJ 4DFMA 4ZPTR 4ZVQB 3PIPQ 1IR2A 1XEZA 1SC3B 4NLWA 2QJ3A 4PXBA 4KFBA 2H5JB 1VRUA 3SDEB 3MFHA 3BO4A 2P5VA 5IXUA 2BANB 1HBOA 4EUVA 1EZZB 3SYZA 5DDQC 1S79A 1XQIA 5IT9Y 1XERA 4C0OC 3OQ2A 4ED4A 5CHCB 1IKXB 4B3OA 2FJVA 4U9RA 1MLAA 1HNXJ 3GIKA 4DV6J 1OPIA 2BYCA 1RTJA 5A0YB 2P6SA 1FX2A 1JLFB 2Q79A 2OD4A 4NLTA 3HMJG 3M8ZA 2F4FA 2BJEA 3I0RB 1VBZA 2FJAB 1NM2A 3ENWA 5ETRA 2RILA 2YKOA 4P52A 3K8VA 3A13A 1NXIA 2ZH3A 1IVZA 1RU1A 2ZUAA 4CZCA 2RKIA 2C3YA 2G1DA 2GCFA 1ZM4A 2YKQA 1HHTP 3IRWP 1OPZA 3KLFA 2LP4A 3C3LA 5E3RA 7FD1A 2AQ4A 1HPZA 3MR5A 2ZH7A 2HQGA 1R27B 4G1QB 1X7VA 2XLKA 3EPIA 3TYTA 4NRTA 5IWAJ 1RI7A 3EYZA 1VQ4S 2MXYA 4I2PA 2E5JA 2DO4A 2M52A 3V4MA 4DPOA 3MECB 1AB8A 4HKQA 3SI8A 4CH7A 1P27B 1GNKA 4ECXA 1FD2A 1Q5YA 2PDAA 4OX7A 1PYOB 3I6PA 3PRBA 1U49A 4FF4A 3PY8A 2HPUA 1NH8A 4OFZA 2LCWA 4IOBA 1N34F 4C7QA 2AYGA 4EZ6A 1LFWA 2NCKL 5D77A 2WVBA 4D3GA 1XK8A 1SKSA 1JLEA 1SKRA 4WK1A 3EM1A 2B9YA 1N0VC 1Y5IB 4KQZA 4NASA 3PNIA 1FD8A 3G86A 4OJGA 4IYQA 2IM3A 2YTCA 3MZIA 2PEBA 5ETQA 3TUZC 5C2GA 3VZIA 3KK3A 2JRSA 3H98A 2G2YA 4P73A 2W8KA 4F3QA 4CQ1A 2UXDJ 1WC6A 3L7OA 3CIZA 1F5AA 2VDIA 2UV8A 3QIDA 2CNOB 5K8NA 4DUYJ 4QOTA 3BB5A 1VBKA 3FSIA 2R8IA 2MKSA 4ZN3A 5KFWA 1NJXA 2CZ4A 1NU4A 2HQFA 4FF1A 2MQQA 4G3IA 3OTOJ 1HBMA 2RIJA 4X62J 3QIPB 2AGOA 5T14A 4B9SA 5D78A 1R0BG 3FBBA 2D1CA 4RNOA 5DDRC 1U6ZA 2MKHA 1VQ5S 5L1LA 3M6XA 1QSYA 3T41A 3IWLA 2AYMA 4CT8A 3TZZA 3MMCA 2NYHA 2NUHA 2JFKA 5AE3A 2B9WA 3K5OA 3IMQJ 4DF8A 2D3ZA 1C1BA 2YKMB 3M9OB 3MAQA 4QYRA 2O5DA 4ECSA 4OI0A 1TK8A 1Q0NA 5CD4A 5G0RB 3QFWA 3JQKA 5F0WA 3D9BA 4YDDB 4WKRA 2R7UA 1CS4B 1VBXA 4DN9A 3MMBA 2XGQA 5KFQA 4IFYB 2F65A 4LRFA 1I94J 2R7XA 3Q8PB 5HSPA 4C8ZA 4CLSA 2ZHAA 5DS7A 5LSRA 2YWKA 1RT4B 4Z37A 2Z2ZA 3FMWA 1T11A 1J5EF 5M2UA 2IC3A 4H4OB 5IC6B 1TV6A 2MY8A 4DBQA 4A8KA 2LEPA 4PQUA 5KG7A 3LPEA 3CCMS 3V81B 2CRLA 2E7VA 2BJ1A 5AXLA 1FJGJ 4FYXB 3KHGA 4ID5A 4Q5VA 2ZJQQ 2LKZA 3RB0A 4DQIA 2XBPA 4WWSA 2AJ2A 2V94A 1WI8A 2YWHA 4Y00A 1UFLA 1UFKA 1UEUA 4O44A 4EGLA 5IM0B 1S10A 1HWKA 4Q2MA 2LQBA 4OZ1A 3OXLA 5KFPA 1SVDA 2RSQA 1RBOB 1DFDA 4ECUA 1T94A 2ZHOA 5HANA 1T9YA 2EK1A 4DI6A 1Q5VA 2H54B 1HQUB 5JMNA 1NHVA 2DCUB 3BGRB 2QRRA 4JI2F 1LWFB 3T6BA 3JYTA 1VHIA 3W3SA 2PFFB 4DV1J 2BRLA 1RAFB 2NPIA 4LF4F 1LNQA 2OIHA 1R89A 2KDOA 4LVOP 4Q0BB 3X1LB 1OO0B 1PBAA 2Z4PA 3OFEA 2V9WA 3CD6S 2BABA 4DX5A 1BD6A 1QUPA 4O0NA 4DFJA 3PVXA 3NWRA 5I4MA 3VALA 3MM7B 3E01B 1VRTB 3ZZ0A 2ZBRA 3W63A 3D1HA 1WDTA 5BYRA 3QYYA 1YBTA 3FCHA 1BQXA 3H4DA 3EWGA 3I9V9 1JMTA 2A3JA 1X4HA 2CQHA 1RWMB 1HNIB 2NUUG 1D9FA 3FSXA 3U27A 1U1LA 2FYXA 3AD7C 5C24A 2J0QD 4JYAF 4NZ7A 3TUIC 1VLOA 2ZJPQ 4CNYA 3R8YA 3FEYB 5ETOA 3C16B 2B56A 2UXBF 3BSAA 3O8WA 3NNCA 1RAJA 3UWTA 1KDNA 3I4HX 4OI4A 5BXIA 4PUOB 1B7FA 4IRCA 3PDNA 2AW0A 3R5GA 1RHJB 4IO9Q 1DARA 4ZOSA 1NSAA 4YB5A 2DBBA 2QA4G 2CJKA 5KTQA 1WOOA 5B0BA 1WG4A 1XR7A 4TU9A 1K44A 2CG4A 1EQMA 2W9CB 2WONA 2BW7A 5HK4A 3PO4A 2RF2A 3RGIA 4RU9A 2DITA 4C6AA 3C15B 2N3LA 1S9GA 1JXLA 3PM9A 4YR3A 3Q8VA 4IG0A 3KXDA 1TZ0A 3K5NA 4R8UB 3EDRB 4F04B 4ED8A 2QLJB 3IM8A 3D6MB 1SUQA 3PJ9A 2R7SA 1NJYA 3GV7B 3AFGA 4QR1A 4QU6A 2Y1IA 2J9DA 5DG8A 1HI8A 3OTOF 1U24A 2ROPA 8ATCB 2FC9A 4CH1A 4NMLA 4Y2AA 2M3DA 2EWHA 1RAAB 3FRZA 3MEEA 2BRKA 2LQJA 1KR4A 3ZNJ1 2QT7A 2FHJD 2Z56B 3R2CJ 4LR9A 4IH5A 1Q81T 2RDJA 1NB7A 1QE1B 4HACA 1R6YA 2KHDA 4K5RA 1Y3KA 1D09B 5KOWA 1ITPA 1KNZA 3HHLA 2NLWA 2YKNA 4M63A 3HHLC 1U1QA 2NXCA 4TQRA 4ZVEA 2BXJA 2I2YA 1S6PA 3WC2A 3KHLA 1CPZA 3IG1B 4TY8B 1VQMS 3KHHA 1KQFB 3UD3P 2YWGA 4DR3F 3QGPA 3R5CA 3I5CA 2B7BB 3H25A 3BBBA 1I94F 5EX3A 2QC3A 5E3PA 1C0TA 2ERRA 3MM5B 4GKJJ 1R6VA 3W2VA 2WVDA 5GVQA 1KOHA 3N5FA 3R5JB 3RJMB 2VFUA 3IRXA 1LFPA 1TMJA 3CIMA 3KG1A 4ZKAA 1N48A 2ADCA 2H51B 3T9ZA 1QAIA 1IKVB 4MK7A 5A8WA 1LW2B 1M90T 2GQCA 1H2TZ 1GFWB 1Q8LA 2CWXA 2ZZMA 4DV4J 2XM3A 2BZ2A 3M2VB 2IRYA 1REVB 4USWA 1FNXH 3ZZZA 3PW0A 2QLXA 2DJWA 3DDKA 2XNQA 2VFVA 3CJ5A 2KYXA 4OJHA 2KVIA 3K7RA 2RNEA 5H9FJ 2R8HA 2RVJA 1B64A 4FDFA 2B9EA 1AFJA 4JI3F 2C2OB 5CABA 5IV3A 3L9ZA 3RAXA 2VG7B 4JI4F 1NHUA 3GIRA 5RUBA 3MDFA 3OR2B 1MU2A 1N36F 1C1CA 1RQ0A 2JNJA 3QQCD 1BQMB 2X3GA 1X9WA 4CNZA 1BUXA 3AODA 3B4DA 2V4JB 2D3O1 4Y2IA 3N79A 5JVGQ 1KBRA 2IHR1 1VHFA 4B9LA 3I31A 2RHSB 1MWYA 1I3OB 1T05B 2RJZA 2LDYA 5H9FK 4DPUA 1UA0A 3W5ZA 3KMQA 3NGTA 4KE5A 2F8HA 1KWMA 2MQPA 2HK2A 2HSEB 2MQOA 3VQSA 3U1LA 1F0XA 2G0CA 4YB6A 4DS5A 4C3LA 1S99A 1JLBA 3DN9A 3ZZYA 4RUHA 2XSJB 4UF4A 4N76A 3HFKA 3FZBA 1ZZFA 3IR5B 3GG0A 2AZ1A 2VPWB 2C2DA 1D8ZA 1WOPA 4RUBA 3IA0A 3IS9B 3KK1A 5HAOA 4AXJA 3LAMA 4X4SA 5LM7E 1RTIA 1L3TA 2KZZA 5KFMA 2IMOA 1H3DA 1D9DA 2FGCA 5J2NB 2B0GA 2G13A 1HLWA 4WU2A 1R7IA 5DG7A 1FFSB 1R8BA 1WHWA 2IPOB 1SQGA 3AXKA 3CJ8A 2CQ3A 3C46A 1V5VA 2NR0A 2D69A 3DLEB 1B70B 2ZZTA 3PW5A 1WKLA 5KFIA 3OVSA 1S0OA 1VQ7S 5KT6A 3MCNA 4GVLA 1S1TB 2M88A 3TJAA 2WAQD 1RT5B 1BHNA 1LWCB 3BDPA 3DYAA 4NLRA 1RAGB 1NPPA 3Q2TC 2NS1B 4YN3B 3F41A 4OYZA 3PXGa 2DNRA 3GFZA 3S1TA 4F0KA 2JJ4D 5ETNA 3OL8A 2WB4A 3OVBA 2C2KB 1YDLA 1EARA 2R3VA 1Y7PA 1FX4A 3TA2A 2OPQA 1HHQA 2MKKA 2ASDA 4DG1A 2J0XA 2VPYB 4KJIA 4KHPJ 1Q16B 3VWSA 5KFSA 1FRMA 3OHAA 3WX8A 3IO1A 3GP9A 4HHJA 2ZH9A 1LXNA 1WHXA 2H4WB 4NYOA 2DGVA 3CWJA 2ZFHA 1SJ3P 5DM6Q 3W5YA 2ZDPA 4LF9F 1I6JA 3HSGA 3KDNA 1CJTB 4K4YA 1QY7A 3SSQA 2VKRA 2CQGA 5KFBA 2QSWA 4OLOA 1WHYA 2WVCA 4USMA 3KLHA 2FVPA 4P10A 1X4EA 2BEFA 1DLOA 2HVZA 3C6TB 3MTJA 3I82A 3IWNC 3KK2B 4ZIWA 3T1AA 3UDCA 3NAIA 4IRDA 2ZHBA 2HFUA 3CCWA 1U02A 1M5PC 2JVRA 1X4GA 4USUA 2YWEA 1IR0A 4ECVA 3CMES 3OTCA 1S1XB 2UXCF 3OHBA 1KQKA 1DTQB 5KG4A 2QA4S 3T19A 3Q86A 4TN2A 2D41A 5K20B 1IKYB 2IRUA 3KMSA 1XWLA 1NDPA 2LEAA 1WC5A 3JSMA 4PWDB 3CE8A 2E7WA 5J1PA 1TL4A 3MM8B 3G8TA 3W66A 2ATLA 1CG2A 3NGSA 3OR1B 3TA0A 1BE4A 2FDNA 1RWXB 4OV6A 3RAMA 2B4VA 5IT0A 4B9NA 4YHHF 1RT6B 2QE5A 4DV4F 1LXJA 3TZYA 1F60B 2E5LJ 2CPXA 1OWXA 4HT5A 2C2RA 2QFIA 1IR1A 4MK8A 4DSKA 1KQSR 4DS4A 3CJQA 2VJVA 4ZVGA 2ZZNA 5KFCA 4C8MA 3T5HA 2HKEA 4RNFA 3M2RB 2UUCJ 4FF2A 3PHEA 4WFAQ 2I6WA 4H4MA 1N0UA 4F4YA 2DNOA 4OHXA 5K8OA 1KTVA 3QLHB 3AAWB 1RSCA 4UZCA 4KB7A 4NI2B 1SIZA 2V50A 4HH0A 1SCJB 3PHTA 3AOAA 2CDQA 3OL7A 4PG7A 3HO1A 4NA2A 2M2BA 3NGUA 4QWAA 2E7XA 4F3OA 4CT9A 1U48A 2IA6A 4Q8EA 2DB1A 4DX7A 4CM0A 3KJVB 3H5YA 4QIFA 3TAMB 3PYEA 4IG3A 2ZD1B 4GRSA 4BC7A 2JDJA 1N5YA 1TKTA 3MGJA 2B8PA 3IAS9 2ILYA 2DNGA 2HQIA 5KT3A 2NZCA 1VK8A 4M95A 4OMFG 4NCBA 1FRXA 5LT5A 5H9EK 3ISND 2EFOA 4DWIA 3CCRS 1K1SA 2BJ9A 5DQGA 3EVOA 1RXOB 4QBUA 2CYYA 4N5SA 1S0MA 1X0FA 3MAAA 5KFRA 4I2QB 1S5ZA 2CQCA 2XLIA 2Z57B 3JQMA 3WX4A 4GO5X 1FWKA 2C1EB 4ZVHA 4CO0A 1FK9A 1OY6A 1SV5A 2FHKA 5A2QY 1BGXT 1UEVA 4A8QA 4YR0A 1N33F 1ZAVA 2POKA 5AT1B 3T1YJ 3CMQA 4NYZA 1MG7A 1PC5A 1QLNA 2ZITA 3DMJA 2DR7A 1YZ6A 4DR1F 3LP1A 2QL9B 2GGPB 3I32A 4PQAA 3BZQA 4DV0J 2O3DA 3OXGA 2ZC4A 3UDLA 2BVZA 2RS2A 3VHQA 2HWHA 4O3OA 4IH7A 3ZFVA 4IRKA 1QAXA 1YRXA 2CA9A 3Q8QB 1LWEA 3P5TL 3H5SA 4XAKA 4DHVA 2ALZA 2VA3A 4K4UA 2PD1A 2W9BB 4CDIA 1TKXA 2DT9A 4LFAF 2H5IB 1Y11A 1KTQA 2GMHA 4JI8J 2C3OA 1RUSA 2G9OA 3RB3A 3CT9A 2EG1A 1N6QB 3D6FB 2W2PP 4J9KA 2YNHB 4NEZA 2UVVA 1OYDA 2FLNA 2EXUA 4Y3CA 1TKDA 3QZ7A 2IM0A 3PIOQ 4WE1A 2VBWA 1RT3B 3WC0A 3FBCA 4EZ9A 1FHTA 1U1KA 4FPRA 2VICA 1JLAA 2IAJB 2XY7A 1UCNA 4ZIVA 4P7VA 3QGGA 1O8BA 1JLQB 3BEGB 1YG0A 5HP1B 3RAQA 2M0GB 1RWVB 2VB6A 2OKQA 2JWNA 2QYGA 2WK4A 4NOHA 4MAKA 4DV2J 1HQEA 3NRBA 2HHTA 2OFHX 4QQBA 1UJ5A 5D4LA 1NSPA 2K06A 1YHQS 2V34A 3HSZA 2C22A 4CLKA 4MKYA 4RNNA 2EC2A 1HBNB 4JI6J 3R27A 2DXDA 2I8EA 1P1TA 5HMWA 1CQNA 3GJSB 5A6WA 3LW5C 2AD9A 4C8YA 2KI2A 1KLMB 1YQHA 3W2WB 2OJ3A 2CNLB 3BQ1A 1XNQJ 5F8NA 1AA1B 3T3FA 1RJJA 2ROGA 3ZZRA 1RKIA 2CVEA 1HWUA 1S76D 3FZ2A 2FJWA 4IKAA 5F3TA 3SDEA 3M1VB 2BANA 1OSCA 3FNNA 2KG0A 1S72S 3G9CA 4PPDA 2FVQA 3NGKA 4FKXA 1WC1A 3UCZP 4CLWA 3SXLA 2J0SD 3BGUA 1IKXA 3JTPA 5A0YA 1SIWB 4QR2A 1PG5B 2YH1A 4F7VA 2HBYB 4LR8A 1ZYQA 1JLFA 3OFGA 1FFGB 3K57A 1KFDA 1AYEA 4IDKB 2EK6A 3C14A 1IBLJ 3I0RA 3FJ2A 2EKYA 2FTRA 2DK2A 1WC4A 4ICLB 1X4AA 1YRTA 3FC9A 1LK5A 1H2UX 2VZ9A 4ZPWR 2EG2A 4J9QA 1NSQA 2DPIA 3HKZD 4G1QA 2PI5A 1HR0J 4ZCMA 2KB2A 3UE2A 4OL8A 2WW4A 4ELTA 3CJ2A 3MECA 5HVGA 3BGLA 1TR0A 2UVUA 1VK3A 4YUDA 5KG2A 3GFYA 4PG4A 7FDRA 4DR7J 2MQ8A 2ZH6A 5CYJA 4DXLA 1PAUB 2NSBA 1S77D 3VAMA 2BJ8A 4B3RJ 4WCEQ 5HVHA 2OO4A 2BQ3A 4ZITA 1UPPA 4ALZA 3ONQA 3QRQA 3DRPB 2NXEA 2CQDA 4YS2A 2AWZA 2QMUB 4LBPA 1KVKA 4UOHA 3VVUA 5GMEA 2YX4A 2X1AA 1Q7LB 3OW2R 3SFGA 3N6LA 1SKWA 4ED7A 3J81U 4DMZA 4U7CA 4OX8A 3T1YF 1KD1T 2HHUA 4ZPCA 1WG5A 3D3CJ 4RW9B 3HHKA 3VAJA 4UT4A 5H1SV 1U45A 2RRBA 1N5QA 3MEKA 2IDLA 4MKAA 1UAWA 2O67A 4L74A 4LRDA 2WOMB 3TP2A 5SZTA 2DR9A 1SQEA 4EYIB 4KPCA 5LMNJ 3MEGB 4DV0F 4I67A 1H7WA 2CQPA 4USKA 2VUGA 1M5SA 3CJ3A 4ZPBA 3Q22A 4DL6A 4W92B 2W8LA 5CXTA 3MPUB 2B7CB 2E1RA 1IQTA 5HJXA 1VQLS 4G1IA 4UUWA 3EXYA 1S57A 3QIPA 4NEYA 5KFGA 3NKYA 2NYIA 4I6AA 3M4XA 3PKMA 2B9XA 2KXNB 5LJ3Y 1S9GB 3D5MA 3RBDA 3S8SA 1YK9A 5LMUF 4N7TA 4P2SA 3D3BJ 4ES3A 4BWMA 2JLEA 4MK9A 1ZA1B 4W4MA 4MT1A 4N77A 3GR0A 2Y8YA 4ZVOB 2YKMA 3BN4A 4UUXA 3KKFA 2ZC3A 2KG1A 4WIQA 2CPJA 3CUNA 1P1LA 4WZMA 2ZUGA 5G0RA 5DQHA 1X4FA 4NXMJ 1P9QC 2C2NA 1YLXA 1BWEA 1FT8A 4K4TA 4ECTA 1IM6A 1CS4A 2RS8A 1S6OA 3IGNA 3N28A 3PYDA 4OI1A 4K2XA 4IFYA 4Y2MA 3TAQA 4DV2F 2WSCC 1P9YA 3KJFB 4B9MA 2VKZG 3SIPB 1U8SA 3HJVA 3TO8A 4K0KJ 3OTBA 4NLVA 4JI6F 1RT4A 1NPKA 1VMBA 4JV1A 4H4OA 4NLXA 3DFEA 1L3SA 1FJ7A 2JEGA 4KV8B 1WSVA 3V81A 2VASA 4HL9A 2OSRA 2HGMA 4R0EA 3OFHA 2PMWA 2VQEF 4F4WA 1TVRB 2MTLA 4OI3A 1QTNB 4X4VA 2MEWA 2A0FB 2BM0A 1TUVA 1HWJA 1IUJA 4ECYA 3HT3A 4IQMA 2PN6A 3DXBA 3LWMA 2R8GA 4K8RA 2HFVA 1N5TA 1FKOB 2HW3A 3Q89A 5D4PA 3V6HA 1QSLA 3QWUA 5GAHI 3TNVA 1L3UA 3FEZA 3HK2A 1PGZA 5IM0A 4U8YA 1RWOB 2W2NP 3TZXA 2V0NA 3UO0A 3GE9A 1U0HB 5F9LA 2RQMA 5F8IA 2JFDA 3RW6A 2HHHJ 1QUVA 4XO0A 2OFGX 2H4YB 3LGHA 4TY9A 1HQUA 2Y9HA 3K58A 1K47A 3DM2B 1QDUB 1HFEL 3BGRA 1Q8KA 1LWFA 1SJ1A 4CM2A 3HHDA 3CCJS 1FKAF 1QAYA 2U2FA 1KS2A 2C2MB 2XYPB 1S6QB 2HQCA 4Q0BA 2ZBQA 3J7Z5 2BUNA 3MAHA 5DGBA 1REGX 4WYWA 4MFBB 1T9XA 4NL5A 3JS9A 2FLLA 2COLA 2H5EA 3P3DA 3U1NA 2QSFA 2UV8G 3MM7A 5LL6d 3HZGA 3MM6B 3EXCX 3E01A 3IFEA 1VRTA 4ZP6A 2L41A 1VFJA 2VBXA 3Q8YA 4GC6A 4ZN1A 5EWFA 1ICEB 1I51B 3TARA 5F8JA 2DGXA 2EFVA 4LRAA 3MR6A 3LPYA 3CO0P 1HNIA 4OYBA 2DNZA 1FRJA 4DR7F 2KFZA 1TK5A 2MDAA 3MCSA 4ZA1A 4ZP9A 2YQ1A 6FD1A 3C16A 4N41A 3EJMA 3CD5A 1JJ2R 3CF5Q 2MLXA 4HHHA 4M5JA 3CJKB 4LR7A 1NB2A 4OX9J 4PUOA 1GXUA 1YKWA 2FB0A 1U1OA 1PO6A 1XBWA 2CNKB 1EP4B 3LTOA 3VGSA 2GC8A 1RP5A 1WSRA 1ZPVA 5CYMB 3FBFA 1VQ9S 4O4GB 4LF8J 4DR6F 2W9CA 1SI9A 2K8GA 2OPSB 1T9WA 2R2UA 1F2HA 3DNCA 3GB0A 3C15A 3QATA 4ZVRB 3PRVA 1BQNB 2H1YA 2MHEA 1KQGB 3DOLB 4KY3A 4L6V3 1UA1A 1IBCB 3DRYA 4NLUA 4R8UA 1VR6A 1URNA 1AFIA 2YNIB 1RGVA 4X4TA 2DIUA 1IWGA 4WJBA 4WXOA 1YJ7A 3R5DA 4ETXA 3CCSS 2CAJA 3CB4A 2C2ZB 2D3OR 3AOCA 2HS0A 1Y00A 3FQLA 2LFVA 4USVA 4NXNF 1ZAXA 2HNDB 2CUYA 1T9TA 4KHMA 1QE1A 3GWCA 5ETSA 3V4IB 2C2EA 5THWA 4LBHA 3R3TA 3QAUA 3KLEB 2AJ1A 4DSIA 1W2BR 1XMOJ 2IYIA 3IG1A 4TY8A 4OJ3A 1YRUA 2P9EA 3TX0A 4EK2A 1HQ2A 2MSTA 5JUMA 2E1AA 3MHYA 6AT1B 2N7YA 2AJQA 2HHXA 3QT8A 2XMWA 5DLFA 1S1VB 1LV5A 4RLEA 3MM5A 2JX2A 4ATNA 1N56A 4O4RA 2AV5A 2IA0A 5KG1A 2EPIA 3W61A 4FYYB 1T03B 1R43A 1IKVA 1LW2A 2QTWA 3QJJA 1WELA 3M2VA 2WSEC 1REVA 5BYSA 1RDRA 4CO3A 4TYAA 2LYVA 1JIHA 2XO6A 3JSMB 1XTZA 5B0GA 4ZHRB 4CO2A 2PA8D 3HFVA 4GC7A 3BYPA 2G2ZA 3UQSA 1S7HA 1VC5A 3CDWA 1DQ9A 2CZVC 3UFCX 3UR0A 2VG7A 2HEKA 2BQRA 2AP6A 2MKJA 3OR2A 3Q83A 2XZDB 1JLCB 1FCAA 1BQMA 3RZAA 2AX1A 1RA7A 3C19A 4PXDA 2V4JA 2YNGB 1JJ4A 2HVDA 1NK4A 1QAJA 3EMTA 4U95A 2AYEA 1VBYA 2HLUA 3DHXA 2CADA 1T05A 4E2FB 2W9AA 1SL1A 2HBRB 5T41A 1T02A 3W9IA 2PC6A 2W1BA 2X3DA 1VS3A 1PYSB 2KJWA 5KFEA 4KH0B 4L76A 4QIWD 2BBEA 3BJYA 3ETOA 1V5IB 2GAHC 2YPYA 2N3OA 1IJEB 2WVEA 4AL6A 1PJ6A 5J2QB 2XSJA 3ZZOA 4K4WA 5GAHU 2VFTA 4RW6B 3NL0A 3J7ZT 1V3RA 2Y1RI 2O1PA 3CDAA 1ZBTA 1C2PA 4EMDA 1N5YB 3IS9A 2L48A 5B0AA 4YFUA 2C3PA 2DNYA 4ZCIA 3N6NA 4LF7J 5D15A 3NWGA 5J2NA 4JUZA 1N34J 4BCAA 1SBRA 2MHNA 3GSDA 3BGOP 5B7WA 3DLGB 5KFFA 1FKPB 1X8DA 2VD3A 1U09A 2HVHA 2NZ4A 1LOUA 3DLEA 1HI1A 1URRA 2OEJA 3H59A 2DEJA 2J8SA 1R3NA 4B3TF 1S1TA 4DFKA 4LSLB 1RT5A 3BKFA 4Q44A 1LWCA 2DR6A 2W2OP 1F2GA 2QMWA 2KZMA 4DL2A 3GYGA 3G6VA 2RRNA 3M32B 4WTOB 1ZTTA 3WIVA 5D4NA 3QGHA 3J80U 1B0TA 4OLPA 4OI6A 3SCJE 1J2VA 2HZVA 3IC1A 4LMZA 4YQWA 1M1HA 2HFNA 3PO5A 5CZXA 3PFOA 4EYHB 2QZ8A 1NDCA 5A6PA 4X4OA 2EBEA 1FF2A 1UZHA 2CPZA 2HAFA 2V9KA 1JJHA 3W62A 3HVWA 5EGYA 2CQ1A 4OYXA 1KRPA 4P2XA 2R8JA 5ADZA 2IFXA 3AHPA 3WBZA 2IJRA 3FKBA 5B0EA 3H5XA 1LW0B 1VQ8S 1PC4A 1EIYB 1CJTA 3PEJA 2OMOA 1IWAA 3G6XA 4RW8B 2AX0A 3IR6B 4IH6A 3C6TA 2CQIA 3HLUA 1SC1B 3QZ8A 3HFZB 4DLGA 3KK2A 4NMXA 2BV3A 4I7FB 4URSA 5DQIA 2J5AA 3MD1A 4OYOA 4UTGA 1MMDA 3VGVA 4FVMA 4Y6IA 1NPRA 3EGZA 3BV8A 1YSJA 5JVHQ 2F9DA 4KGVB 1S1XA 2BE2B 1DTQA 4GKKF 4DR4F 3RG6A 3CW2C 2OP5A 1FDBA 5I3QA 3M6VA 3OPKA 2OPRB 2AJ0A 1IKYA 2APOA 3JTNA 5BYQA 2AJ4A 2GHPA 2N4CA 1TL1B 4TU7A 4KGKA 3SQGB 3BF4A 1JKHB 3TAPA 5AE1A 4JV2A 3G82A 1WACA 4PWDA 3QJPA 1PAEX 3MM8A 5L1JA 2RDDA 3GILA 1KVIA 3AJ1A 1TK0A 3OR1A 5IT9U 3NS5A 2BOAA 1KP6A 4B08A 3MI7X 1HYSB 3PJXA 3PACA 3KUHA 1RT6A 2ALYB 2XGPA 3DDNA 3R7NB 1J5OB 1IBMF 1IQZA 3W65A 4IFVB 3NBPB 1X60A 3D66A 2W2QP 4O3PA 4BWJA 4X65F 1F9EB 1H0HB 1GH8A 4MIWA 2E1MC 4EO6A 2VBYA 3S7RA 4M5HA 2YVSA 4RBUA 3M2RA 4DZDA 3RU0A 4OIXA 1HWLA 2CJ9A 1Z4UA 4C97A 3QLHA 4NI2A 4FYDA 3GTYX 5EN1A 2KT2A 5D4OA 2PT0A 3SCIE 3TVZA 3C14B 1M5VC 1TUWA 2L9DA 4LF5F 4JI2J 3KJVA 3TAMA 2ZD1A 2XYGB 4PXCA 4HR2A 4P71A 3T5LA 4HDHA 4DSFA 2M9KA 4J9SA 1AUDA 4LF4J 2DD8S 2KKHA 1NK6A 2XB2D 4AD6A 1NO8A 3PRDA 4JV5F 1H72C 1RT7B 5D0GA 1UKUA 2NXNA 2AHOB 2PMZD 4DX6A 4ZVPB 4PRFA 5AXNA 3HDSA 4Q2LA 1P6TA 4WBFA 4DPTA 3AD8C 4I2QA 4USIA 5C42B 5DDOC 3M6WA 1WTFA 3ADAC 4O3RA 1RT1B 1UW4A 2IJNA 1ZETA 4LF7F 3V6DB 1N4LA 3HVAA 4KT0C 3VF0B 1NJWA 3O3LA 3B82A 4FS1A 1U47A 2LDIA 2Q6BA 3DGPB 2GVZB 4JYAJ 4DQPA 1RT2B 2MZRA 4RBVA 4AQYF
chains in the Genus database with same CATH topology
4BC7A 5F8MA 4WFNQ 2JDJA 1N5YA 3TW0A 1TKTA 3MGJA 2W7OA 4NCAA 4YB1P 2GGPA 2G4BA 3IAS9 3MWBA 3BGFA 2ZH8A 2ILYA 1R0AA 2DNGA 1E6VB 2HQIA 3LP2A 5KT3A 1VK8A 3OTDA 2UUTA 4OMFG 4M95A 4NCBA 1FRXA 4LIWA 2ZDOA 4WZQA 2XMVA 2BQUA 3RB4A 2VA2A 2FLPA 4L3NA 5LT5A 4EFAC 4E0DA 2EC0A 1U2RA 1S1UA 2HRYA 2VG6B 4K4XA 4ZDNA 3ISND 1YJVA 1KHWA 3TVYA 3DOKB 2MQMA 4ES1A 2GIRA 3K5LA 1RTDB 2PO4A 4ZP8A 2EFOA 4O3NA 2U1AA 1NAQA 5E3QA 4NPOA 2IJFA 3E2EA 4DX8H 1UVNA 1ZM9A 4DWIA 3CCRS 1K1SA 4OI2A 2HHHF 2I9SA 5DQGA 3DLKA 2VFSA 5KG3A 3PR5B 4ETZA 4ED3A 1CEZA 3HKWA 4M8LA 2JZ5A 4DQRA 4J5OA 1SH3A 2MPUA 4K4SA 3QPIA 4F2RA 2RD5C 2Z0GA 3Q8SB 4H4MB 4QBUA 2CYYA 4N5SA 4CO4A 4HT7A 2MB0B 1S0MA 4PPZA 2CFXA 2JLFA 2W9BA 3PW2A 4F8RA 5C25B 5DM7Q 4NCGA 1X0FA 1X9SA 5KFRA 4I2QB 3DU6A 4RKUC 2J9DE 2CPHA 2CQCA 4I64A 2LXIA 5EX0A 2XLIA 2DR5A 4AXIA 1JK9B 3WX4A 4GO5X 5F8GA 4KIAA 4ED1A 1WEYA 4ZVHA 3HVTB 1FK9A 3THPA 2HS3A 4CO0A 1IKWB 1SV5A 2FHKA 3PW4A 2GHVC 3DLLQ 4QIEA 4XK8C 5A2QY 2HIQA 1BGXT 4PG6A 4RW7A 1N6QA 2UUAF 2DO0A 2DH8A 1UEVA 2ZE2A 4A8QA 4KSEB 4FNHA 2YNHA 3LP0A 5ITHA 5IS2A 4RNMA 2DHSA 5KFTA 4YR0A 3H40A 5D3GB 1N33F 1ZAVA 2POKA 4B02A 5I3PA 1FJGF 3IAM9 3GIJA 3NLCA 2J8AA 3GYNA 4IR1A 2K3KA 3V6JA 1ZM3A 4NZ6A 4NYZA 4ED0A 3TI0A 4A8XA 3M8SA 1PC5A 2J7WA 4KO0B 3SV4A 1RT3A 3T1HF 3CVKA 4ECZA 1QLNA 1K73T 4LFBF 5I3UB 5K8MA 2ZITA 3LF0A 3BQ2A 4DF4A 1S48A 3DMJA 2DR7A 2Z2MA 3VAGA 1KVJA 1UL3A 2HHWA 1H98A 3MOJB 4DQSA 1X4BA 4IG3B 2EBGA 2IAJA 4DR1F 4PCQA 4Y2CA 2DGOA 1TKTB 2UVWA 3LP1A 2GGPB 3I32A 5FDLA 5MLCV 4PQAA 1WD6A 2Q3PA 4AE5A 1R0AB 2R7OA 3LP2B 1XR5A 3BZQA 2O3DA 1JLQA 4OJ1A 1RA6A 2PSZA 3OXGA 6FDRA 5KFKA 3PV8A 2ZC4A 1L5UA 2HG4A 3QAEA 3UDLA 4FS2A 1IJFB 2BVZA 1S1UB 2KRBA 3MR3A 2RS2A 5HP1A 4XDCA 2HNYA 5B08A 4ZCKA 2HWHA 5E5NA 4O3OA 4IH7A 1K1QA 2X1FA 1NRKA 1OS5A 3ZFVA 1QAXA 2R8KA 4IRKA 4ZK7M 2KT3A 1YRXA 3CJ4A 3Q8QB 1LWEA 4F4ZA 3P5TL 3H5SA 2MZSA 2M4MA 3DLKB 4XAKA 4DHVA 2MY7A 3ITHA 4N56A 1Q53A 2ALZA 3GR1A 4LT6A 3UW1A 3O44A 2DNHA 1O0PA 3JB9k 2VA3A 4TQSA 5IQ6A 4K4UA 2VPXB 2PD1A 2DGQA 3NAHA 4X84A 4ZVFA 4XIUA 2W9BB 3DC2A 1FA0A 1Q1KA 1TKXA 1D3WA 4NCGB 5FD1A 2DT9A 2C3MA 1GTEA 3CDUA 2XWYA 1HBNA 4LFAF 1Z2LA 2P9GA 4USJC 2VONA 4M1KA 2KFYA 3MOZA 1KTQA 2GMHA 5GAGI 4C0BA 4JV0A 3PEHA 2C3OA 4K50A 3CD7A 2UVRA 1FK9B 2OSQA 4DV1F 4OZ0A 1SV5B 2G9OA 3RB3A 1KLMA 3W2WA 5JXSA 5CCLA 1ULRA 3CT9A 2EG1A 1TAQA 4RW7B 3DXSX 5KFVA 4C3MA 1ZZNA 1N6QB 4OHYA 1A6LA 1RTHB 5CCMA 1Y0HA 1F9FA 2ZE2B 2HHPA 4J9KA 2YNHB 1EETA 4OX9F 3LP0B 2UVVA 4RNHA 4UY8T 3UI3A 3LGNA 4FXVA 2FLNA 4DSJA 4UOCA 3CO9A 1WWHA 4KGMA 3D0HE 4TLQA 4Y3CA 3QZ7A 1TKDA 1M5OC 3N0VA 2KYZA 2RDIA 2IM0A 1JLGA 1S0NA 2R7VA 1ZPWX 3WZ0A 4NA1A 2MKIA 3PIOQ 3EUNA 2VBWA 1RT3B 4WE1A 3WC0A 4EZ9A 1FHTA 2CQ2A 2NREA 2OTLS 1Q79A 2CPDA 1U1KA 3SEOA 2BACA 3DMJB 3M1VA 2VH7A 4FPRA 4B9TA 1JLAA 3C66A 4BHQA 1P8GA 2XULA 2IAJB 3AB4B 2XY7A 2GW8A 1Q78A 3CGIA 4A4JA 4KTQA 1T95A 2E44A 3LP1B 3MMAA 5IZHA 5FDLB 4P7VA 4ECQA 3KTQA 2DTJA 3QGGA 1O8BA 2F8MA 5KFOA 1XC9A 1JLQB 1YBAA 4LF8F 3BEGB 2H9ZA 3BSCA 1YG0A 3POTA 3MEDA 1WEZA 4LIRA 3MXHP 5HP1B 3RAQA 1L3KA 2M0GB 2HNYB 2VB6A 2LU1A 2EVZA 2OKQA 1UJ6A 4QWCA 2JWNA 4USHA 4WIIA 1LWEB 5KFUA 2WK4A 1TAUA 3CCLS 3WDOA 2IVFB 2VFRA 2KXFA 4NOHA 1T3OA 2PE8A 4Y2KA 2LEBA 4MAKA 3LWLA 2RE1A 4EU0A 3ITHB 5E2QA 4EO8A 3RR8A 2FLOA 3M6UA 1HQEA 1TKZA 3NRBA 3J80Y 2OFHX 3RRHA 2HHTA 3V2UC 5HBMA 1FERA 4QQBA 1UJ5A 3PX6A 1S6UA 3ISZA 5D4LA 2DRAA 2HNZA 2J76E 4IDKA 4C0HA 1YHQS 1VIXA 1TKXB 2ADBA 5M2PA 2C22A 2A2CA 5J1EA 3G71S 3G6ES 4MKYA 4RNNA 1HBNB 5BR8F 3I4PA 2JC1A 3AB2B 3CD0A 3R27A 4CH0S 3CCUS 3IGVA 2I8EA 3N01A 5B09A 1VQ6S 3VAIA 1P1TA 5HMWA 5HN0A 3SSRA 2M5YA 5KT2A 3PKYA 1CQNA 1SJ4P 3K0JA 4NLQA 2XMTA 5A6WA 3LW5C 2AD9A 1SJRA 3M05A 3EZ5A 2KI2A 4C8YA 2KRRA 4ICLA 1KLMB 1FRLA 1YQHA 3W2WB 3OV7A 3VAFA 3KFWX 2HRUA 4MTPA 2OJ3A 1EETB 2NPFA 5L1KA 3QJLA 1YI2S 3BQ1A 2QIFA 5DO2A 4ED2A 3ENVA 4XPEA 5F8NA 2HAIA 2N82B 4KAIA 3OL6A 2XS2A 3T3FA 1JLGB 2C42A 3ZZPA 1RJJA 4WE1B 2ROGA 1JNZB 1DTTA 3ZZRA 1RKIA 2CVEA 1HWUA 2HGLA 1FXDA 3FZ2A 1S76D 4R0JA 4IKAA 5F3TA 3SDEA 2FJWA 3AJ2A 3IR7B 5GMKa 3M1VB 1WHVA 3CPWR 1JLAB 2BANA 3MTKA 5EUHA 2CJBA 5K8PA 1OSCA 3SV3A 3RRGA 3DRRA 4N8OA 2OTJS 3FNNA 2KHCA 2KG0A 1S72S 3RR7A 1HI0P 3MMAB 3HZEA 4LVNP 4XDDA 5DLGA 1KFSA 4ELVA 3G9CA 4PPDA 2FVQA 3NGKA 3OSPA 1GTHA 2B51A 2FHOB 3LALA 1WF1A 3CC4S 3UCZP 3G6YA 3Q0AA 2V5HG 4ZMMA 3POTB 3MEDB 4QW9A 1FEEA 4DSEA 4WK3A 3U7JA 1Y5NB 3SXLA 2J0SD 4HH1A 2RB7A 3RRKA 4KHRA 2V4RA 3BGUA 1IKXA 2SXLA 4QIGA 1RISA 1APSA 3JTPA 4JI1F 1KOOA 3FMBA 4NLGA 1XMOF 1FJEB 3RBEA 5A0YA 1SIWB 4QR2A 1CQMA 1S49A 4ECWA 3CCTA 4Q43A 2YH1A 2XI2A 1HQEB 1TKZB 5HBMB 3TANA 5KFZA 1ZYQA 1DZ5A 2VV5A 1JLFA 3F56A 3OFGA 2HFZA 4V19X 1FVSA 1KONA 3K57A 2HNZB 2I38A 2W4CA 1KFDA 4HLBA 5KFNA 4IDKB 2EW9A 2EK6A 1FNMA 1XMQF 4DDFA 5J1EB 1KSPA 3GFXA 3DRXA 2KU7A 3I0RA 4URGA 4OZJA 2FY1A 2VOPA 1WF0A 3FJ2A 1GX6A 2Y0SD 1D0EA 3PFEA 2Y1JA 3KNGA 3GYXB 2R2TA 4Y28C 4GMKA 1CLFA 1AROP 2GFFA 3GFHA 4J9OA 2EKYA 2FTRA 1U1MA 2DK2A 1H38A 3IBWA 4ICLB 1X4AA 1YRTA 3LUYA 4LJMA 4UQGA 4ZPAA 3CC2S 1LK5A 4DFMA 4ZPTR 5T7LA 2HWTA 2DH9A 3PIPQ 1H2UX 1GQEA 1XEZA 3DRPA 2L3MA 4NLWA 4PXBA 4TYBA 5C5JA 1TFWA 2VZ9A 2AGQA 4ZPWR 4KFBA 2L9NA 1DTTB 2EG2A 2IRXA 4UW2A 3M8RA 2OMLA 4RZRA 4J9QA 3S01A 3CCVS 1OSDA 1VRUA 3SDEB 2CPFA 3MFHA 3BO4A 2DPIA 2RQKA 2P5VA 2DIVA 5IXUA 3HKZD 2BANB 4G1QA 3DRRB 5E0OA 1HBOA 4EUVA 3SYZA 5GADI 2PI5A 5DDQC 2ASLA 3JTOA 1S79A 2LA4A 4LSNA 5IT9Y 5E3CA 4ZCMA 1MW7A 2KB2A 1XERA 3L95X 3UE2A 2R2SA 4OL8A 4RW9A 4C0OC 3D0IE 3U1MA 3OQ2A 1WI6A 3TRGA 4ELTA 5CHCB 2QYCA 3MM9A 3CJ2A 2A10A 2CKWA 1IKXB 3CJ0A 2GQ2A 4B3OA 4KPYA 4EWTA 3MECA 2WOMA 2FJVA 2GO8A 4U9RA 3BGLA 3GIKA 2XSFA 1OPIA 2BYCA 4DEZA 1RTJA 4W90B 1TR0A 2Q43A 2P6SA 5A0YB 2UVUA 3OUYA 5EHHA 4IOCQ 2XEXA 3MEGA 3LH2S 1VK3A 4I6WA 4YUDA 2YWFA 1H7XA 2F8EX 5KG2A 1AW0A 2DNNA 4R5PA 1JLFB 4HDGA 2ABYA 2MZTA 3GFYA 4G1PA 4QZVB 4C98A 2Q79A 2Q66A 2OD4A 4NLTA 4URQU 3HMJG 4PG4A 3C6UA 4I69A 7FDRA 1C4AA 2BJEA 3I0RB 1VBZA 2FJAB 3ZC4A 1V6HA 2ZH6A 4F25A 1X5SA 5CYJA 2E5HA 4X4QA 4GKJF 3ENWA 3RW7A 2RILA 3G4SS 2NSBA 1LKZA 1S77D 2VC1A 2YKOA 4CTAA 3VAMA 3K8VA 4WCEQ 2ZH3A 2OO4A 2BQ3A 4CZCA 2RKIA 2C3YA 1NKEA 2G1DA 2QA2A 2GCFA 5T7LB 4ALZA 1ZM4A 2YKQA 3K59A 1HHTP 4A47A 3ONQA 5KFLA 3IRWP 1OPZA 3KLFA 3DRPB 3C3LA 3SSSA 2XS7A 4RUAA 5F9NA 4NZ0A 5E3RA 5FLXY 2CQDA 7FD1A 1M0SA 2AWZA 2AQ4A 1HPZA 4KFBB 4FBTA 3MR5A 2GX8A 4MIAA 1VRUB 2ZH7A 2YX4A 3BS9A 2X1AA 1R27B 3D0GE 2IM2A 4NLDA 4DN0A 1HW9A 1Q7LB 1X7VA 2MMYA 4G1QB 3OW2R 5J2MA 1HBOB 2XLKA 3SFGA 3N6LA 3EPIA 3TYTA 1SKWA 4NRTA 1HHSA 1RI7A 1KC8T 3CTRA 4ED7A 4DMZA 4U7CA 4LSNB 3EYZA 4OX8A 5KFAA 4RUCA 1VQ4S 3T1YF 1RYRA 1KD1T 1ZH5A 2HHUA 2MXYA 1VQSA 4ZPCA 4I2PA 2E5JA 1TL3A 1IXKA 1WG5A 2VBZA 4RW9B 3HHKA 4EEYA 2DO4A 3VAJA 4DFPA 5H1SV 1U45A 2RRBA 4LQ3A 1N5QA 3W7BA 2BJDA 3MEKA 2WCXA 1NNDA 5L9XA 2FVCA 1WNEA 2M52A 3MM9B 1S9EA 5LXRA 4MKAA 4WFBQ 2OD6A 1UAWA 3V4MA 4B3OB 2XC9A 2M70A 4DPOA 2O67A 3MECB 5G4DA 4O3QA 2WOMB 3TP2A 1WG1A 4HKQA 5SZTA 3SI8A 4CH7A 4DL5A 2DR9A 1RTJB 3H5UA 1P27B 1SQEA 4EYIB 5H9EJ 4FF3A 4J9PA 3OUYB 3MEGB