4OJGA

The crystal structure of v84d mutant of s. solfataricus acylphosphatase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
b'EMLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKDDYSFSEYKGEFEDFETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 23
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ojgA00
5KAKA 3TNVA 2XMMA 1V3ZA 2ROEA 3GZ7A 3IWXA 1WD6A 2BYCA 3UDCA 1AW0A 2KT2A 3IWLA 2GO8A 1TUVA 2IYGA 2KT3A 2FIUA 2N4DA 4DN9A 3BM7A 3F44A 5B08A 5A6PA 1LQ9A 1TL4A 2EW9A 1XBWA 3BR8A 2HFNA 1R6YA 2LQ9A 1S6OA 1N5SA 1P8GA 2Q3PA 5F0UA 5B0AA 2IFXA 3I9ZA 1N5TA 2PGCA 2OD4A 1FEEA 2GCFA 1KQKA 4ZA1A 2OFHX 3CJKB 1JWWA 1VQSA 1OQ3A 3DCAA 2XMJA 1YRXA 1OPZA 2XMVA 3KG1A 3MZIA 3FMBA 3QMQA 2QLXA 5F0WA 1OSDA 4ZOSA 3WDOA 3LGNA 5B0DA 3BN7A 2ACYA 3HX9A 3BF4A 3FRYA 5B09A 2AP6A 5B0CA 2XMUA 2K2PA 2BJDA 2GFFA 1TR0A 1U7LA 3TOQA 2VH7A 2PD1A 3BGUA 2RILA 2ASYA 2OAUA 2FHMA 2G9OA 1FESA 1CC8A 4FNIA 3VTIA 2W4CA 1FD8A 1YJVA 3BB5A 1SB6A 1FE0A 4YEAA 1Y9OA 2OMOA 2JDJA 2W4DA 2AJ0A 1Y3KA 4DPOA 2XMWA 4OIXA 2LXFA 2OD6A 3E8OA 1N5VA 4HL9A 4DL0C 5B0BA 1TZ0A 5IXUA 2ZDOA 2N7YA 2QIFA 3DXSX 4OJGA 4HI1A 5B0FA 1FVQA 2GGPA 4HH0A 1URRA 2RMLA 2AW0A 2VV5A 3BDEA 1Q4RA 3HFKA 5B0GA 3T9NA 1YG0A 2LQBA 1P6TA 3HHLA 4Y2KA 5K9FA 1APSA 4HI2A 2GV1A 2L3MA 2IYIA 1JK9B 2RSQA 1MWYA 4Y2IA 3HHLC 1AFIA 4F67A 4NL5A 2KKHA 1S6UA 2RU9A 1SQEA 2K7JA 3HDSA 1KVIA 1CC7A 3K7RA 2AJ1A 4EFAC 1AFJA 3KNGA 4OJHA 1GXTA 1Q8BA 2BJEA 1W2IA 1X0PA 3KKFA 2OP5A 1FE4A 1Q8LA 5A6WA 2N4CA 2K1RA 3QGPA 5T7LB 2ZDPA 3LGMA 5T7LA 2ROGA 3LO3A 4HH1A 5B0EA 1IUJA 1KVJA 4OJ3A 4Q2LA 2OFGX 3HHLD 4A46A 2GGPB 4YDXA 2HIQA 1SI9A 1K0VA 2CRLA 1YJRA 1Y3JA 3TRGA 2HLTA 3HHLB 2GA7A 4A4JA 2HFOA 1N5QA 1GXUA 2KYZA 1X8DA 2HLUA 3FGVA 4Y2MA 1X7VA 2W4PA 4U9RA 2K7KA 4A47A 1VQYA 1TL5A 2QLWA 1OQ6A 2FB0A 4OJ1A 2ROPA 4Q2MA 2FTRA 3KG0A 2QYCA 2OKQA 1QUPA 1FVSA 1CPZA 1ULRA 1YJTA 3MCSA 1Y0HA 1MWZA 2K1RB 4A48A 1RJJA 3CJKA 2BUNA 4QOTA 1Q53A 1YJUA 2BBEA 2HQIA 3HF5A 2LDIA 2XMTA 2XMKA 4NPOA 4FNHA
chains in the Genus database with same CATH superfamily
3D66A 4CO4A 2DH8A 1C0TA 5E0OA 4IG0B 3R2DJ 3F44A 3HJFA 2MQPA 1REVB 2NXCA 3O8WA 3MMCB 4K4VA 1VQSA 5IC6B 3PO5A 2XGQA 3AODA 3RRKA 4A8WA 2XGPA 1IR0A 3H8YA 4LVOP 2ZBIA 2MSTA 4KFBA 1HWKA 2E1MC 3N5BA 3C15B 1B7FA 1P1TA 2GC8A 2JZ5A 1OPIA 3AA9A 5ETPA 3C6UB 1RA6A 3G8QA 3KXDA 1S6PA 2CNOB 1XERA 2X51A 2QLJB 3RGIA 2QA1A 1ICEB 3QLHB 3I5AA 4CP5A 4I6AA 1K1QA 2JSXA 4HEA9 3CCUS 4JI3F 2YNIA 2CQ0A 2XS5A 1OQ6A 2A6OA 4JI6J 5KT5A 4U67Q 5E5NA 1FDAA 1HQEB 1FX2A 1DBDA 3H59A 4ILMA 2GIFA 2ZH5A 4AXJA 4OI4A 5HANA 1XBWA 5KFXA 3J7YU 4ZVGA 3V4IA 1R31A 1JLCA 4NLGA 1IQZA 1BY9A 4J9NA 4XTTA 2VJUA 1S49A 4FF2A 2VFTA 2GFFA 2IDLA 4KHPF 4FBUA 2CAJA 5IT4A 2ASYA 4DX6A 4IH5A 4X66F 1DTQA 3POTA 3J7ZT 4M5MA 1T11A 5D6GA 5D15A 5C24B 3S6EA 1AZSB 4FXVA 2E9TA 1GXLA 5BR8F 3HDSA 2DR9A 3T41A 4K0KF 3OJUA 3B6BA 3W5YA 4TXSA 2W2MP 2OHDA 3ENQA 1LXJA 3NOCA 3FKBA 2FJBB 1IKYB 5DG8A 5ADZA 2W4PA 4OFZA 3RW7A 1FVSA 3MMAB 1OY6A 3HD1A 1Z1ZA 3QT5A 2DR8A 2HQDA 2J0QD 2QMUB 4DL7A 3PW4A 4NLTA 4ZHRA 1F0XA 4WPAA 1S1VB 3G96A 3DRPA 3JSMA 4CCHA 2HRTA 4F04B 4WXOA 2K2PA 2RIJA 2CPEA 4USWA 3ISND 2MB0B 4DPWA 2CWXA 3MUVP 2WB4A 4JV1A 4WIIA 4ECVA 1HBOA 2V8DA 1U8SA 1M5KC 1JIHA 3FC9A 3EYZA 4NEZA 1IN0A 1LWFB 4KGXB 1NJYA 4LF9F 4RW6A 1S0OA 1JLAA 5KT2A 1FRXA 2RUGA 2XS7A 1Q86T 1XMOJ 2UXDF 3UDLA 3RAMA 5KFPA 4N7TA 2DXEA 2Y1LB 1REGX 2Q6CA 4DU8A 1N54B 1RT1B 2MKYA 3PHEA 4DX5A 1NKBA 2J76E 4I2PA 4DQQA 1QTMA 2KU7A 3KHLA 4YUDA 2JX2A 4CRJA 1WTBA 3RRHA 2I5JB 2G2ZA 3MD1A 5GAEU 3BDPA 1WF0A 1X9SA 1WC3A 2Z2MA 5JMNA 2W7PA 5DM7Q 2NXNA 4O3SA 3R1HA 2OGUA 2HVEA 3AT1B 3TAQA 3X1LB 5A8WA 4U95A 3GV8B 3NNAA 1WF1A 5LXYA 1VBXA 3TARA 3P8BB 2AIRB 2AHOB 2ZC4A 1EB0A 5A2QU 1IM6A 2MZSA 1N4LA 2D9OA 3UD4P 8RUCA 4DZ6A 5GMKa 2FLPA 3AOCA 4DR4F 2WTFA 2J5AA 3PHTA 4DV6F 4OHWA 4NMXA 4B9MA 1VQYA 5GADI 1ZZNA 1D1UA 1SC3B 2V6AA 5DGAA 3LALA 1IXKA 1H3DA 1N36F 5C5JA 2IRUA 2Q1LA 4JI8F 2YY3A 2WVDA 1QY7A 4PRFA 2ZFHA 4WFAQ 4XPEA 1C1CA 1TUGB 4UZBA 4OX9F 4DUYJ 3ISNC 3VVTA 1W25A 2O01C 3CJRA 3VAFA 2Y3YA 2DTJA 3QQCD 4DV7F 4WFXA 5D4LA 2KJWA 5LSLA 2W24A 4OI0A 4UOHA 3UD3P 3IS9A 3OL9A 1HWJA 1RHQB 4NMLA 4DFJA 1Q8IA 4Z2XA 3MM8A 1D0EA 1MWYA 4LT6A 4F3MA 4IRCA 3MAQA 3CSKA 4L75A 5B0EA 2YKAA 3LAMA 2XZTB 2KN4A 4M5NA 1TP7A 5GAHU 2EKYA 5HROA 4KGMA 1RCXB 4DR2J 4A8FA 1T03A 2DNKA 3UO0A 4PG5A 5LMUJ 1N33J 2AEMA 1TL7A 3FBCA 4QOTA 1RCOB 3AH6A 1RQ0A 1WSRA 3VALA 1P9QC 5GMEA 2GVZB 4OYWA 1WC4A 1LWCA 1TL4A 2EW9A 4RW4A 5JVGQ 4IO9Q 1P8GA 4J9OA 1IWAA 1M5SA 3VAHA 1OPZA 2AJ2A 3C19A 5J2NA 2WOMA 1VRQC 1RT5B 2GIRA 4OZJA 3FCHA 4K5SA 2B9EA 1IBMJ 2VQEF 3MURP 2JFKA 4MK8A 4F36A 2YKPA 2ZZMA 1ZM9A 1YTYA 1HWIA 4DL0C 1WDTA 2J6TA 2V2ZA 3M8ZA 4KHRA 3LWMA 4DR7F 4WK1A 4DL4A 3ILLA 3TUIC 3ZNUA 1HR0J 1EJ7L 1VQ8S 2LDYA 4OZLA 1U24A 3KNGA 2EKNA 4DLGA 3HI9A 1VQKS 4QIFA 1X4GA 3BKTA 3T1YF 1JX4A 3OVAA 2O5DA 4M5KA 3MCSA 5CYJA 5DG7A 2B43A 1TL1A 1RTIA 4C8MA 3DNCA 3CJQA 1U1PA 1WD6A 3BKUA 1SC6A 2R7QA 4NLOA 3LP1A 1CULA 5GAGU 3R3TA 4Y0FA 1CJVA 3OVSA 1V3RA 5EUHA 4U6PA 5F41A 4AXIA 2J7WA 4DWIA 2PD1A 1HWLA 4ZN3A 4HDHA 4M95A 4HHJA 2RUSA 1WG1A 2QIFA 3KJVA 4G1PA 4B9SA 3OHBA 1ZTWA 5L46A 2DNRA 3GQCA 3FVYA 4JI7J 2DNQA 5DQHA 4GRSA 2NZ4A 1UA0A 4A8OA 2QZ8A 3Q86A 4CT8A 4F7VA 2Y1JA 4Y6IA 2OIHA 1J2VA 2WSFC 3HKZD 3J7YI 4FYWB 4FKXA 3C14A 1GX6A 3PVXA 2O66A 1FFSB 3TA2A 2KYZA 1TVRB 4QIVA 1CVJA 5HVGA 3UW1A 4P72A 3OL7A 2FB0A 4P2XA 4NCBA 2JFDA 2OUGA 1Q53A 2V63A 4NLSA 3WX8A 2ZBQA 4WK3A 3DLLQ 3H25A 2HGMA 5KFIA 1OSCA 2J7UA 4I0WA 4YR0A 3CJKB 4QWDA 2C3PA 2YH0A 2QLFB 1UFWA 3GIRA 2EI5A 1F60B 4FVCA 2Z2YB 1TKTA 3ZTQA 3BH6B 1IBLF 2FVCA 1U47A 2HQ3A 3R27A 1DAXA 3K5LA 2DR5A 1UPPA 5K8NA 1TZ0A 2AMCB 3E2EA 4GMKA 2QLBB 3H0PA 5K9FA 1T7PA 1OYEA 2DT9A 3U1MA 4TVAB 3FSXA 1HWUA 3QATA 4R0JA 1L3VA 1YK9A 5DZ7A 3KLFB 1VQNS 1CJTB 5KFAA 2A10A 2YKMA 5D0EA 2Q66A 3CCES 2OPSA 3PW7A 3LPYA 2GJIA 1WHVA 3W63A 1S97A 3ITHB 4DUZF 4QW8A 2F9JA 2BOPA 3JSYA 2GVDB 1YJTA 4WZMA 4LVNP 2VBYA 2VDHA 3GB0A 3W9JA 1SXLA 3M2RB 1C0TB 3RR8A 3GZ7A 1IJEB 2BANB 1IKXA 1UVLA 1KHVA 4HHHA 2KRRA 4NLQA 2JL9A 1S4FA 2UXCJ 2C3OA 1LK5A 1T9XA 3PRDA 1X4AA 3BO4A 3V6KA 2AX0A 2BQUA 1ZAXA 1JKHB 1UFLA 3ENVA 2QTWA 3GILA 1NJWA 5LMNJ 5F8MA 4I2QB 2JDJA 1NJIT 5KFUA 1S9GA 4RW8B 1TMJA 2R8GA 5J2QA 3MAAA 4KC5A 2O67A 1TTHB 3QGHA 5CD4A 5IT9Y 3A1YG 1S6PB 2B4PA 3NNCA 1UVKA 1RLCL 4QR2A 3J81Y 5GAEI 1PO6A 3D5MA 2DNNA 3D3CJ 2YNIB 2RRAA 3R8YA 4LREA 3KJFB 1ULRA 2DGOA 2D3O1 1UPMB 1GMUA 2R8HA 4JV5F 3CJ8A 3DI6B 1VQ4S 1KNZA 3NS7B 3PEHA 1MW7A 2VA3A 1MLAA 4UQGA 2IYGA 1V9OA 3RYLA 3V4IB 2ASLA 4YB7A 4IH6A 4G1IA 3HJVA 4ZN1A 3DXBA 4B3OA 3HZGA 3SMZA 3LTOA 3POTB 1U6ZA 1PYSB 2J0WA 3DLBA 5IXUA 3IWNC 2HVDA 1WC0A 2KB2A 4IH7A 3D1QA 2BOAA 5L8RC 4UUWA 3FMWA 2IRYA 4KIAA 2BR0A 3KLVA 1A6LA 2KYXA 3N5FA 3TI0A 4NA2A 2P8IA 4YDXA 1NKEA 1T9TA 1WF2A 1W26A 1N34J 4JI1F 3P5TL 1BQNA 5CYMA 3J81j 1IJFB 4EYIB 2IA6A 3NMRA 1VDHA 4Z7YA 1F5BA 3MXHP 1FNMA 3NBPA 5AXMA 1NM2A 4YY3J 3AD8C 1S7HA 2CXEA 2R7RA 4DR5J 1XNQJ 5HSPA 1L3TA 3VAGA 5KT7A 5KG4A 5KG5A 3MM7A 1N0UA 4OYOA 1S0MA 1Q8KA 5A8RB 3JSMB 4LF8J 5HP1B 5B09A 3CGIA 4DX8H 4B9NA 2V69A 3M6WA 2A0FB 2XY6A 2J0XA 4FYDA 3NGTA 4ICLA 1FE0A 1S9EB 1Y9OA 3OPKA 1HBOB 4K2XA 3K5MA 2LXFA 3S01A 3S8SA 3BBBA 5IV4A 3UDEA 4ZPVR 3S1TA 4G1QA 3N0VA 2OSQA 1FWKA 4JYAJ 5KOWA 1JLAB 4ANDA 3SQGA 3HVTA 1N8RT 3GR1A 2BJ8A 1XMQF 1RB0A 2UXBJ 4HKQA 2XWYA 1S1WA 5LSRA 5ETLA 3QWUA 2KXFA 4LIWA 4USTA 3Q8SB 4A47A 2RHQB 4ZLJA 2DNOA 4Q0BA 1FJGF 2RQCA 2BJ3A 3FCVA 4LR9A 2VIHA 2XHWA 2BBEA 4I2PB 2YWHA 2IBKA 5CCMA 3QO9A 2HS4A 3IR5B 3KWMA 3AY0A 1DFDA 2QSFA 3RB4A 3SDEB 3CCLS 1X5PA 4DV0F 5I3QA 1I1GA 3RBZA 3BQ2A 5AJ3F 4EU0A 2XMJA 5F0WA 1NPPA 3TP2A 2B7CB 2JHEA 3TZWA 1PIEA 2DO0A 2RQKA 4V1Ak 3MEDA 1RLDA 4LRDA 5D4OA 3WZ0A 2RILA 5A8WB 4X2BA 3BO3A 4FNIA 2EFPA 3ZZRA 2QRRA 3PW0A 2KXHA 1X4HA 1FTRA 1QJHA 5ETVA 5E3CA 1QLNA 2HHUA 1FWPA 3OSNA 2WW4A 1DJ0A 2V0NA 3DLGA 1RAJA 3GG1A 2ATLA 4ZVHA 4JI5J 3ZTSA 1H72C 3QIDA 4ZITA 2RD5C 5FDLA 3TAMB 4FPRA 2OEKA 1YVFA 4LR7A 1QUPA 1EKSA 2EFNA 2N7CA 1S6QB 1F6TA 3GR0A 2MZRA 3L9ZA 3LAKA 4B17A 4X65J 3H2LA 3D54A 4GC6A 4I67A 2VPYB 1D9FA 1N52B 3C2PA 4F50A 2ZH7A 4CNYA 3FFIA 3G6XA 2V2VA 2OPPA 1TK8A 9RUBA 1RTZA 1TR0A 2EK1A 2HWTA 4PG8A 3CMES 3EXYA 2KI2A 4CLSA 5A76A 1HBUA 4NI2B 1H0HB 1SH2A 2KT5A 3IS9B 2D3ZA 3KHHA 1T9WA 1P1LA 4OMFG 2UVVA 3W66A 2HQCA 3MM8B 2QG9B 3H5SA 1XR6A 2W9CA 4DSLA 1JLFA 1AUDA 5C42A 4W92B 4RNOA 5KT3A 3R7NB 3IXQA 4OZ3A 2F8HA 5HBMA 2IAJA 4K4ZA 1T03B 3BSAA 2BM1A 2M8DB 2OELA 4H4KA 2LKZA 4O4RA 4H4KC 3DLEA 2CFXA 1TELA 3SEOA 4QW9A 1LWCB 4U8YA 3OTEA 1NXIA 2OD4A 5HN0A 3I56S 5KFNA 5KT6A 5J2NB 2WOMB 2KFYA 2QGFB 1ZS6A 4MKAA 3N4WA 2V5HG 3RBEA 4DQIA 4USJC 3GJQB 2V67A 1T9YA 3LWLA 1U1KA 5DJBA 1TK0A 2AJ0A 5HLFA 3T9NA 4NLYA 2AJQA 4LRCA 3CB4A 1HHSA 4MKBA 4NZ7A 2RNEA 4FP9A 1FE4A 1PBAA 4ED2A 4DQSA 2M2BA 1CEZA 2BW7A 2M70A 2WVEA 3HFZB 2QEXS 2UUAF 2AT1B 2HLUA 3PIPQ 3PKMA 3PCOB 1TL1B 1NCLA 1RTIB 1HNXF 1FWLA 4RNHA 3TJAA 2F4VF 5D78A 2HZVA 1HNZJ 3LP1B 4BHQA 1CULB 3OR2A 2CWKA 3TUPA 2RH3A 2BDPA 1JJCB 1FKOB 3G87A 3H7HB 3VV2B 4ZKAA 4JI4J 4RUCA 1HW8A 2HS0A 3DYAA 6AT1B 2VG6A 3SBMA 4DV5J 3NL0A 2W4CA 4Q7AA 1YJNS 4KPCA 2YQ1A 4JUZA 4F02A 3FDSA 4TKTA 2AJFE 2NYIA 3PJXA 1M5PC 2WONB 2C2OB 3JQKA 1SC1B 2Q79A 1U1RA 1NH8A 5ETMA 3JSRA 1VK8A 1PC4A 4L76A 2C2ZB 5H9EK 3JB9k 2JH3A 4F3QA 4DS4A 2B8PA 4DL3A 1ZA1B 3MUTP 1G7CB 3E51A 3EDRB 4DPYA 2FHOB 1DARA 1GH8A 3LUYA 3H4DA 2DRDA 2BX6A 2NS1B 4O0NA 4LBPA 4MIWA 1R27B 2UUBJ 4ECYA 4ZVEA 5D0RA 1RT3B 3G8TA 4Z7CA 3W65A 3ENAA 1SIZA 1N5SA 3G86A 3QRQA 2I8EA 2HNYA 4DSKA 2Y9HA 2QLXA 3EM1A 4EZ9A 3TJ9A 2C3UA 2VPXB 1KVKA 1PILA 1MSWD 3OSPA 5JXSA 4N56A 3C16A 2BKPA 4MKVA 2QL7B 2BRKA 2DYAA 1ZAWA 3PFEA 2YNFA 4ZPAA 5B0BA 2AEJA 4HTJA 2A3JA 3C8YA 2VPZB 3HKWA 2CQ3A 1QTNB 4HI2A 2HFSA 1WKLA 2AJ1A 3SZ2A 4FVMA 4JI2J 3QPIA 2D7SA 1LWEA 2YKMB 3HO1A 1T9UA 3MTKA 2HIYA 2OPSB 2DPIA 1YJRA 1U2FA 4K8RA 4N41A 3MPUB 2R7UA 2CQ2A 3MEEA 1D9DA 4PAAA 2OO4A 4KV8A 1RWKB 2B6AB 2F1FA 1KBRA 3CCVS 2WSEC 1LK7A 4MYTA 4EZ6A 5DDRC 4URGA 3MMBA 3IGNA 2ZVSA 2QV6A 1IKXB 2CNKB 1SJ1A 2GCFA 2QL5B 4PEOA 1OSDA 1NRKA 1SL1A 4QYRA 2UVWA 3KUEA 2GIQA 2RQMA 3OR1A 1GAOA 4J9LA 3NS6A 3HHNB 2JEJA 3OTDA 1UMJA 5J2QB 3TUZC 4OJGA 2FHKA 4URSA 5AXNA 3GSIA 5HJYA 5EWFA 1C2PA 3CXCR 3K7RA 2GAGC 2RKIB 2ZDPA 4UUXA 2C42A 3EGWB 1NLKL 2JOQA 1LKZA 3C46A 2GA7A 3TVKA 4FYYB 3A4TA 5KFGA 4CLWA 2KTQA 2R42A 1YIJS 1RT4B 1XNRF 4PWDB 3GG0A 3GJRB 1DQ9A 1UL3A 2B9WA 4C2MA 4UOGA 4FS1A 2CQBA 2WBMA 3NWGA 1X5OA 1VISA 3A8EA 1KFSA 3NEKA 3QSIA 3ICLA 4LFBF 2HFUA 2OTJS 3H98A 5KG7A 4B3OB 5KFYA 5D4NA 4LBHA 2KVQE 4ZVOB 3V81A 2XY5A 1VRTA 1PJ6A 3E3XA 2CQPA 2N7YA 4C97A 4PG6A 4RNMA 2RAQA 2VG7B 4WBFA 3UNGC 4TQRA 2GV1A 4LFAF 2PSZA 1WG5A 3I4HX 1IVZA 4M94A 1V5VA 4ES3A 2H4YB 2CG8A 1TKXB 2D74B 1EP4A 3DGVA 5CABA 1RHUB 2WK4A 3CJ3A 1WSVA 1K0VA 3MM5A 1BQNB 2HFOA 5CYMB 4OI1A 4K4SA 5KFHA 1HD0A 1A7GE 2FLLA 3VZIA 5G0RB 1FDBA 4L73A 1KRPA 1T95A 2KDOA 4CO5A 3EX7B 2HFVA 4TNOA 2KM8C 3T1HF 3MM7B 2NUHA 3PY8A 2PC6A 3DCAA 2XSFA 1HBNA 1RSCA 4XPCA 4DPUA 2JLGA 1YSJA 2L08A 2A2CA 3SXLA 2XLJA 3FZBA 3QJJA 1BQMA 4ICLB 4EBCA 4L74A 1G6BA 2BQ3A 3H40A 3M2UA 3W5ZA 1TKDA 4P75A 1R8CA 2DBBA 3J7AN 3MFIA 5M2RA 4G1QB 2JWNA 1RWUA 4OYIA 4ZIWA 1RWXB 4Y2IA 2GQCA 4JI0J 2MTLA 2B4OA 4XK8C 1UZDA 2YVSA 3HVTB 1GX5A 4WTYA 4CO2A 4MIBA 4WFZA 5L38A 2E5LF 3U1NA 1LV5A 3D0IE 1S1WB 4EMDA 1UEUA 4WE1A 4IG0A 3QFWA 4C11A 1BWEA 3FGVA 3D4JA 4Q0BB 2RJZA 1QD1A 4AQYJ 2KH9A 1REVA 3L4BC 2K1RB 1RJJA 3GFXA 2RS2A 4RX6A 1VI7A 5ETTA 3CCTA 3I5CA 4B9VA 4M8LA 4P52A 1FEHA 3GFZA 2E1CA 5D0HA 4RLEA 1XIQA 5IT0A 3VGUA 4IRKA 2IA0A 5HK4A 4B3RF 2DHGA 3QNWB 3MEDB 5L1LA 3A3OB 3C6UA 4X4SA 5JUMA 1KOHA 1YJVA 4PXCA 5LSOA 2W7AA 3R2CJ 4RUBA 4OZ0A 2C2EA 1NHUA 1RWWB 3DLGB 1UA1A 4A8SA 4RPFA 1BD6A 4RNNA 3PYDA 3VAKA 2GGPB 4JV0A 2H65B 1RADB 2UU9J 4CH1A 2AX1A 4IFYB 5FDLB 5I4MA 1EAYC 1CPZA 5K8MA 4LF6J 2G0JA 3P5BP 4NPOA 3ETMA 4E2FB 1HNVA 2VKZG 3GP9A 2XZWA 4J37A 3GV5B 1S0NA 4P73A 1KTVA 3K59A 1OQ3A 4EEYA 2OPPB 1U1QA 3PXGa 5DDQC 3FRYA 3M6VA 1U7LA 4ZP9A 4C8LA 4YEAA 3BGOP 3I55S 4OIXA 4DSEA 2FHJD 3PEJA 3AB2B 2XEXA 2OTLS 2Y0BB 3D1OA 2W9CB 1JLFB 2C3MA 5C42B 3UCGA 3NRBA 4J9VA 3FEYB 2IRXA 2ROGA 5HBMB 4OJ3A 3NCRA 2AWZA 4ED3A 1VLOA 1PAUB 1IBKJ 3SSRA 5IS2A 3J7Z5 1V3SA 4J7CA 4GO5X 4OI2A 2OKQA 4DU7A 4PYAA 4LF5J 2ASDA 3GYXB 2NREA 3DLEB 4KTQA 2CA9A 3H2VE 1NK8A 2CPHA 3ZC4A 3NGDA 5A8KA 2J7KA 4J90A 5KFMA 1U02A 1S1UB 5F0UA 5CCLA 3ZFVA 3MDFA 3OL6A 2DO4A 1KP6A 2C3YA 2W8LA 1VIOA 4IOBA 1IKVB 3IR6B 2HHVA 5J1NA 1EARA 4N77A 3HSJA 3H4BA 1ITPA 1RP5A 2VFUA 5IT9U 1LFWA 2JEGA 5KFLA 3MR3A 2ZNYA 2XNQA 2KHCA 4DQRA 5KFKA 3EZOA 1PJ5A 1RT1A 3N01A 4YHHJ 1IM4A 4DFPA 2DITA 2MHEA 3EGVA 2VDIA 3RB6A 2DGTA 3QBCA 5F8HA 3MM6A 3F56A 3GSDA 3Q24A 2WSCC 2IY5B 3HULA 3W64A 1X8DA 3KDNA 1EQMA 4MYUA 1TAUA 2I5JA 2L48A 4M5DB 4C8OA 2PIIA 1Y5LB 2EG2A 1PYTA 4OX7A 4CH7A 2DHHA 3OR2B 5JVHQ 3AFGA 2VBXA 1VQ6S 1QDUB 2DVIA 2CPIA 4GKKF 1DHMA 1U1LA 3MM9B 3WDOA 2ACYA 2QMWA 3DYAB 2FHJA 5ETOA 3BBCA 4NLVA 1HLWA 1T02A 3OVBA 2HBZB 3JQMA 3HM9A 2JLFA 4I1TA 3QAEA 2B7BB 2XTJP 4OL8A 4V19J 5J1PA 2N3LA 2Z2ZA 3V6HA 5DO2A 4R5PA 1RHRB 2OPRA 5GVQA 3EVOA 1UVNA 3OXFA 1CC7A 3LANA 4QYZK 4NLUA 3QGPA 1MROA 2G2OA 1UJ6A 2FLOA 4OQJA 4OX6A 4FZVA 1K9MT 2KL8A 5CA5A 4LRBA 2FC8A 3CF5Q 4Y34A 3JYTA 3ILOA 2DJWA 5E3QA 4ECSA 4B3TJ 1NHKL 1WEYA 2ZUAA 4CLYA 2VFRA 3B4DA 1XMBA 4D3HA 3VAIA 3UDCA 4DSJA 5BYQA 4L6V3 1HQ2A 4N5SA 1ELOA 1AUSL 3HSGA 3Q8VA 2DNHA 2ZM6J 2BJDA 2IVYA 2OSRA 3C16B 1RAAB 4X4RA 3D2WA 3AA8A 4E8UA 3CJ0A 5C2CA 3I6PA 1K44A 2MXYA 4NXNF 4BDPA 2ASJA 1NEEA 2FVPA 2DNLA 3FQLA 4LSLA 3IFEA 3HFKA 5B0GA 3DDKA 1P6TA 2ZHOA 4B3MF 3I9V9 3DC2A 4LUBA 3CCJS 4UQTA 1W2IA 1X0PA 1LWEB 5L39A 3KLGA 1Q82T 1WI6A 3MEEB 2GVZA 3MEKA 2LXIA 1NAQA 4KV8B 3KTQA 1VBYA 3MR7A 4FF3A 5HVFA 3CD0A 3MMBB 4F3OA 4DCPB 1B0VA 3CCZA 4NXMF 3ZNJ1 2NR0A 2G2YA 5FJ4A 2JVRA 4M5GA 5KFEA 5AT1B 1RT5A 1RAIB 5KFRA 3UN3A 4DL5A 4N76A 1RWMB 4XDCA 2HMIB 2QE5A 3P6YC 2UUTA 1HNIA 3LF0A 1GMVA 1K8AT 2FVRA 6FDRA 4JI3J 3LP0A 5CXTA 3CJ5A 3OR1B 3R6GB 4K5RA 1S10A 3PJ9A 4HT5A 2W9BA 1J5EF 4J9PA 2EBEA 2GMJA 4DG1A 3R5CA 1VQ9S 4EBEA 1NKCA 1ACMB 1NNDA 2E29A 4J9KA 1RBOB 2CG4A 2MQLA 1FXDA 2KHDA 4QPXA 1Q81T 4Q44A 4KQZA 3MOJB 4QIEA 2ZHAA 2PMHA 3HP6A 1Y3JA 2JRSA 1ZETA 4X66J 3M9OB 1VR6A 4IRDA 1C4AA 4DV1F 1EZZB 1XTZA 2IM1A 1H2VZ 2ALZA 5BR8J 1W2BR 1MNEA 1XWLA 1F9HA 1OY9A 2DISA 2BYCA 4K0KJ 3KLEB 1FI4A 1WI8A 2B4UA 4WU3A 2MQNA 2BA9A 2MY7A 4UTGA 2FY1A 5BYSA 4MK9A 4NYOA 1WHXA 4DMZA 5F8LA 4NRTA 2H51B 2EEYA 2RRBA 4DR1F 1CC8A 1JB0C 1UVJA 1VRTB 5HJXA 3CMAS 3OW2R 4J9QA 1G2EA 4RW9B 2V34A 4RUAA 2QN6B 2IJRA 4NYZA 2E5JA 5LOQA 1JXLA 1TVRA 3UVJA 1TL3B 2YX4A 1LOUA 1YQHA 3GCWP 4USUA 1YJ9S 3KKFA 2W01A 1VQPS 1M5OC 3ONQA 1G1XA 4FF4A 1YHQS 4KR0B 1IQTA 2DR7A 4M5IA 4RUHA 1UKUA 3DHWC 5ETKA 1TL5A 5J2PA 3LP2A 3C6TB 2QT7A 1H74A 4IKAA 3CJKA 2NPIA 2BE7D 2VC1A 3CO9A 4WYLA 4LF9J 1TFYA 4YOEA 4MK7A 4MT1A 1S0VA 2YKNA 3QT8A 2KT3A 2N4DA 2LU1A 2HFZA 2AYEA 1X4EA 4QU7A 2UXDJ 3EMTA 3W8GA 2RQ4A 5IWAF 2Y8WA 3GMGA 4NLRA 2Z0GA 4RJVA 2VZ9A 1WOSA 3ZXWA 2HQGA 2YX7A 2CJXB 4CO1A 3O3LA 4NE9C 3M8RA 2JEFA 1S7IA 4MJKA 2JVOA 1O5JA 1KHWA 3RUBL 1BQMB 1FESA 1DRZA 5AXKA 1C1BA 1B64A 4KB7A 3M2UB 3KLFA 1FJCA 2XMWA 2KG1A 2H1YA 2HBQB 2OI2A 1UWAA 5IM0A 4YN3B 4Q5VA 1KLNA 3TUJC 4Y00A 1NH7A 4IFVB 3OLBA 4ZP8A 2ALYB 4PXEA 3THTA 2H5EA 2NQPA 3BPSP 2FJEB 3QAUA 4CT9A 1F5CA 2VUGA 3M2RA 5CZXA 4NCGB 2YNGB 2NUUG 4WE1B 1PAEX 4C11B 2BANA 2E7WA 2VL1A 3M32A 4Q2MA 3EVWA 2XCAA 3Q23A 1QAYA 1SKRA 5DZ6A 2UUWA 1AW0A 4LSZB 3SV3A 1JKHA 1H98A 1YZ7A 1QAIA 1L3UA 4DR4J 1O0PA 3I9ZA 4I2QA 3PO4A 4DV6J 1HNWJ 1JWWA 1LNQA 1RTJA 4RW8A 4LRAA 4NZ6A 1S57A 4RL1A 1OWXA 4C0HA 4RBVA 4URQU 4IR1A 1C0UA 1N36J 4OYPA 3TA1A 4JI8J 4DR3F 1N5VA 3ZZ0A 3CCSS 1RYRA 3T5JA 2CJAA 4HH0A 1Q4RA 4Y2KA 4P74A 3D0GE 3J80U 4OX9J 2CPXA 6FD1A 2XO6A 3I5BA 2D1CA 3SV4A 2MGZA 2Y1RI 3M1VB 4DV7J 1WC5A 3KMSA 3JTNA 3DI6A 5E3RA 3UWTA 1VCTA 1LWXA 4FYVB 2CYYA 2FC9A 2FTRA 2CKWA 3QT7A 4Z37A 2V8PA 2E1RA 3D68A 4X4TA 3WQPA 1R43A 4CLUA 3CE8A 5A2QY 1HNVB 1V3ZA 3DHXA 1U6BA 5D3GA 4ILLA 4DCOB 2HNDA 4UY85 4I7FA 2PEHA 2ZVIA 4I68A 3ET6A 1N6QB 2GX8A 5D4PA 5B0DA 4YFUA 4CWBA 4OYZA 3P45B 4KAIA 1RHMB 1XR5A 1BGXT 2XI3A 2CJYB 1KQFB 3EXCX 1MU2A 5KOXA 1S79A 2HRYA 1URNA 3M8PA 5IC4B 3ELHA 1B0PA 2PFFB 1HW9A 2C2DA 4IR9A 3CCMS 2ZZTA 1Q5VA 2GHVC 2VQEJ 2RE1A 4J9RA 3RAQA 1JJ4A 4RO0A 2AGOA 4X4PA 4KPYA 4LSNA 3DLHA 3O2IA 2WVFA 4DR7J 4UOCA 2M7SA 5A8RA 4R8UA 4DCJB 5HP1A 5DGBA 3IG1A 4R25A 5A8KB 5K14A 1LQ9A 1S9EA 1WOOA 3T1YJ 2WB1D 4R0EA 1YRXA 1HQUA 3Q2SC 2LEAA 3OQ2A 3JTPA 1TU0B 2BV3A 1HD1A 1S99A 2H5IB 2RF2A 4ZS6A 1UEKA 7AT1B 3PZPA 3VGVA 3F41A 2X1GA 2D3OR 3V6JA 3UR0A 2V8GA 1PCAA 2AV5A 3PFOA 1EIYB 2B8QA 2ILYA 3EGNA 3OV7A 3LPEA 4C0BA 2DCUB 2XLIA 2NXJA 3OTBA 4ZLPA 2DEIA 2ZH3A 3MM6B 2AYBA 5F8IA 1JNRB 1KDNA 4XO0A 4QU6A 1N5QA 1PSDA 2BVZA 3IBFB 4K2JA 3SDEA 1CQNA 2Y1IA 1VHIA 3SSSA 1PKUA 1KQSR 1FJ7A 2R2TA 5GMDA 4TLRA 3BO2A 4EI2A 2LYVA 4DJBA 3KUHA 4DOZA 4ES2A 3HVRA 1HIYA 4IG3A 3HHEA 1RXOB 4X4OA 2DNYA 4AL7A 3DGPA 3W3SA 3G6ES 5HI7A 4Y2CA 3M6XA 2L9NA 4OLPA 2IJFA 3WIVA 1OO0B 1S5ZA 3P4UB 4DF8A 2JNJA 3R7SB 1SKUB 3IA0A 2H5JB 2XWXA 2DB1A 4B3SF 2W9AA 3CJTA 3DXSX 4R5PB 1JMTA 1VLYA 2OPRB 1AFIA 4YDDB 2FVSA 5KFDA 3L7UA 3TAMA 1F2GA 3CCWA 1MROB 3TYTA 4JB8B 1IBLJ 1S6QA 2RT3A 2NZCA 1TMMA 3JYTB 3PX4A 3K5PA 4X84A 5KT4A 2AJ4A 1SJQA 1SIWB 2E9ZA 1G4CA 4AUKA 3LA0A 3CW2C 2BKOA 2B51A 2LEBA 1W7WA 3MMJA 1C4CA 3TZXA 1U45A 3CJ4A 3RJMB 4IUFA 4OZNA 2XCPA 4KSEB 5EHHA 1T3NA 4NI2A 3QWPA 4ZA1A 5I3PA 4OX8A 5KFFA 4DUZJ 4FXDA 2CPJA 4HTIA 2E44A 4X4VA 2AP6A 5HMYA 5HMZA 3MF5A 4C8NA 3X3UA 3AD7C 2P5VA 4LIRA 1CJUA 2C2NA 3CDBA 4LSLB 4AL5A 2W2PP 4KGZB 3NOGA 3K58A 2HG4A 2CADA 1YG0A 1SL2A 2PMZD 3CUNA 2GHPA 2M9KA 1Q8BA 2LFVA 3TQEA 3KLGB 3L7OA 4RZRA 1BWVA 1GK8A 1WKKA 1ZZFA 1U6FA 2FJXA 3EUNA 5E3PA 4FPIA 5EGYA 4E0DA 2HHHF 4QWAA 1UWBA 4G65A 2EFVA 4NLPA 3SYZA 3IAS9 1NPKA 2QX0A 5ETRA 1FD2A 1JLQA 2HQFA 3VR1A 1RGVA 3HSDA 3PDNA 2H54B 1Q16B 1IR2A 1HNIB 4C8KA 1SH3A 3IO1A 5I42A 4USMA 2M88A 1HKAA 2R7OA 3LP0B 4TU7A 1K1SA 1U0SA 3JTOA 1KR4A 1MN9A 4MIAA 4H54A 4JV5J 4USVA 2W9BB 5C2GA 3QFHA 2HKEA 3BB5A 3VQTA 3ZTOA 3E8OA 2LECA 2KO1A 3ILIA 1YKWA 4DG1B 4QPTA 2AU0A 1LXNA 1NK0A 2HGNA 3FNNA 2CQGA 5KFOA 2RSQA 3KMQA 3MPDA 4A8YA 4O3PA 4O44A 2VG5B 1FJEB 4LF7F 4CM0A 4DHVA 1S4EA 2M8HA 3HLUA 1UP1A 4CQ1A 1NUEA 1KC8T 3ULHA 1FKOA 1DURA 3PRVA 1FXRA 5D0GA 1T94A 1T3OA 5KAKA 3DU6A 1RWVB 2DR6A 2KT2A 5DETA 4ID5B 3D28A 4KO0A 1FO1A 2HFNA 2BJ1A 3SCIE 3N28A 3TW0A 4JI1J 2KFNA 2BKNA 3BGRA 1VJWA 2HZCA 1RBAA 4LQ9A 4XAKA 2IVFB 5F9LA 1CJKA 3BV8A 2WONA 4GKJF 2WCXA 1D9AA 3MCMA 5THWA 2QSWA 4H4OB 3I0SA 3US5A 2VODA 3JAMU 1F3FA 3NAHA 3OFEA 4M63A 3K5NA 4PZVA 4IOAQ 3WX4A 4DV3F 2E5IA 3UVJB 1H38A 5EWEA 1TQLA 2F7VA 3S7RA 1IUJA 4KY3A 1VS3A 1YWXA 1TFWA 4DFKA 2VBWA 1WJ9A 1WACA 1QAJA 4CTAA 1JLGB 2MLYA 3R9LA 1RT3A 3QZ7A 5F3TA 5J2PB 3LP2B 1DQAA 4PABA 1VC6A 2MEWA 1Y0HA 4K4XA 8AT1B 3OT9A 2XMKA 2YKNB 4EO6A 3AJ1A 3D9BA 2Z2LA 2N3OA 1XMQJ 1B4SA 1TUWA 4FDFA 4BC9A 2ZOMA 2R7XA 2F3JA 3OUYB 1SCJB 1Z2LA 3K8VA 4ERDA 3KLHA 1FJGJ 4ETXA 1IKWA 2A6MA 4F4KA 2V4RA 2PI5A 3H5XA 1C1BB 1P27B 4USHA 4D3GA 3H20A 1H2UX 3NCQA 5IM0B 4DV0J 1URRA 2ILZA 4AT1B 5AJ3J 2KKHA 2CZVC 4QIWD 2B6AA 4PXBA 1MWQA 4LFCF 1IR1A 1QSSA 4TY8B 3HHKA 1WDDA 3OTOF 1AYEA 4WZQA 4X4QA 2GZOA 1K0TA 3CC4S 3M32B 2UZAA 2Z58B 1FRKA 3BGFA 3RBXA 4QR1A 4W90B 3D67A 1VBKA 4OYBA 4B9UA 1R8HA 2VHGA 1D8ZA 4F4WA 3HSZA 4L72B 3AQOA 4M1KA 2HURA 4RKUC 1UTAA 5KFQA 2F9DA 4WKYA 2XY7A 1AA1B 1JLBA 1RU2A 4RWWA 1RTJB 3CT9A 4BLGA 3QMQA 3I82A 4ZOSA 5M2PA 1X9WA 4DV4F 1OJ4A 3DOMA 3T5HA 3TJ8A 3ISZA 1N32F 2W2OP 1C0UB 3N79A 3HXMA 2VONA 2ACMA 2RKIA 5L1KA 3T5LA 2QMXA 3B8HA 2XMAA 2GNKA 1KTQA 2VJVA 4QJVA 4QYZJ 4X64F 4HI1A 2U1AA 3VZHA 1WTFA 4YHHF 4L3KA 4DV2F 2MGZB 4O23A 2YBVA 1RT4A 4PWDA 4DEZA 4C3MA 2AYMA 3GE9A 3P96A 2FYXA 4M5HA 4Y28C 3M4XA 2GJ2A 5DLGA 5L1JA 1R8BA 3UR3C 2J9CA 3KK3A 5KG1A 2E7VA 1SJFA 3UPFA 5D3GB 2W1BA 8ATCB 2HNDB 2GHWA 2MZJA 3KLIB 4ZVFA 4BWMA 5MAOA 4I7FB 4XDDA 2QFJA 3FCWA 4RW7A 2G1DA 4B9TA 1Y7PA 2ZE2B 2HNZB 1H73A 3ET6B 3TANA 3M8YA 1HBMA 2D9PA 3BF4A 2RB7A 1Y11A 3H90A 4FBTA 2VG7A 3U27A 1NSPA 3KHRA 2NPFA 3VTIA 3I31A 1H2TZ 2WW8A 1TKXA 4C4WA 1SQGA 1MU2B 2CNLB 4WXWA 3EWGA 3DDIA 2BACA 3M8PB 3MOZA 3BEGB 3BZQA 3L7PA 3HCXA 1Q0NA 2HS3A 1RI7A 3VHQA 5G0RA 3BREA 2UUCF 2X1AA 2HVIA 1G3OA 2VASA 4LSNB 4V19X 3MD3A 5CZVA 2FJAB 3AXMA 5KFZA 4LF1A 4HLBA 4TU9A 1M90T 3K8WA 1TV6A 3B78A 5IFMA 5HQLA 3JQJA 1E6YB 2XMTA 4R8UB 1XK8A 2GS8A 3IG1B 2R8KA 4LF4F 2ZC3A 1FDDA 5K14B 4N47A 2MZQA 1FFGB 1M0SA 1Q95G 3OTCA 4DPTA 2ZKUA 2UUAJ 1UW9A 3VGTA 1HQUB 3SCKE 2DY9A 3NG8A 2HHSA 3EPGA 2RF2B 3GPAA 2JC1A 2YKOA 4GVBA 4ZVQB 3FSIA 2VQFF 1HNXJ 2FLNA 5HL7Q 2F4VJ 2MDAA 3H5YA 4DPOA 4U96A 2N82B 2KVIA 2VFSA 4USKA 3IM9A 1KFDA 3T9ZA 1AT1B 2YWGA 1S76D 2K1RA 1NU4A 2HBRB 1ZM4A 4LR8A 1KWMA 4KH1B 3A8JA 1WC6A 4DR6F 2ZKTA 1KSPA 3HHLB 4A4JA 3D0HE 4B08A 3F0NA 1VRUB 3QT6A 4K4WA 2Z30B 5KFBA 4WP3A 2MKKA 1BC6A 1KLMB 5J2MA 2R2RA 2DH9A 5HMWA 1ZA2B 2POKA 1NK5A 4IG3B 3BM7A 4ZCMA 2XC9A 4YB1P 5SZTA 3Q8UA 1HMVA 4P2MA 1RT7B 3TR5A 4QWEA 4PUOA 3DGPB 3FMBA 1HPZA 4HVZA 2ZH8A 2GJFA 2PI4A 1BUXA 1NJZA 4EYHB 2I6WA 4PCQA 3TOQA 3M2VB 1WKJA 1K73T 2HHQA 5K8PA 3LQVA 3CC2S 4IDKA 2DXDA 4TU8A 2OMOA 1M1KT 3G82B 2GGPA 4TYAA 1TAQA 4P7VA 1ZYQA 3OL8A 5A0YB 4IFYA 3HMJG 4CO0A 2HWHA 1V6HA 2PA8D 1YLXA 4YR3A 2P6TA 5KFWA 3M30B 1WOPA 1X7VA 2CZ9A 1SV5A 4EK2A 4OYAA 1RUSA 1CSJA 2LDIA 4WTOB 4DI6A 3TAPA 4LRFA 3PR5B 5H9FK 2MSSA 4P9SA 1R6YA 2F8MA 1NDPA 1GFWB 1GMWD 2IM2A 2HYIB 4ED5A 3A13A 4ZPTR 3UCZP 1NDCA 4AYBD 3H5UA 4U7UK 5EDWA 4ID8A 1CJUB 5B7WA 5DM6Q 2J9EA 2HZAA 4N8NA 3VWSA 3T1AA 2CPDA 2RMLA 4DUTA 2VV5A 3BDEA 3BGLA 4O3NA 3BN4A 4CLZA 4ZJQA 2WVBA 1FX4A 2QL9B 3CCQS 1HL6A 4OJHA 1NK7A 4DL2A 1K47A 1NSQA 4ETZA 4ER8A 1RK8A 3CDAA 1SI9A 2Z57B 1VQ5S 1VYAA 3I32A 4MAKA 3LH2S 3MECA 1SKWA 4OZ5A 1UWBB 4U9RA 1S1UA 4E98A 3I87A 1RHKB 1JLQB 2YWKA 1VMBA 3KK1B 4BBYA 1BQXA 1PG5B 3PX6A 4MFBB 2OMLA 3MFHA 4X62F 2PN6A 3BYPA 4HT7A 5EX3A 5JJBA 3W2WB 3CULA 2XSJA 1X4BA 1IKVA 5D8HB 1FKPB 4CI0B 5I42B 4PYDA 4CZCA 3OFGA 1I94F 4L3NA 2I1RA 4ECRA 3MTJA 5DQIA 2DD8S 4F0MA 1IBCB 2NCKL 1O6XA 1XNRJ 2VOPA 5FIIA 2J6SA 4W4MA 3IMQJ 1FRIA 2FQQB 3QYYA 3FBBA 1UETA 4LFBJ 3QJPA 2IVMA 1DY3A 2VOOA 4O44B 2A2DA 1L5UA 2OP5A 4RBTA 3A12A 2ZUGA 3KG4A 2DK2A 4M5DA 2AYGA 3ZZTA 1RYSA 3R1LA 4ES1A 2G0IA 5FLXY 2K7KA 2ZHBA 4W98A 4LFAJ 5J1EA 3MM9A 4UOFA 2DNZA 3CVKA 2LVWA 1RTHB 2BABA 1GMWA 1ZH5A 3DN9A 1HNWF 1TUVA 3HFVA 3HPOA 4KO0B 2R9LA 2BZ2A 1FEEA 3IBCB 3BGRB 1GT8A 2IJNA 1S59A 2DEJA 3VF0B 3GFHA 3BQ1A 5G4DA 1N48A 1CJKB 3GJSB 2XYHB 2MZ1A 2YH1A 2E66A 2WHOA 3QGGA 3I0SB 2FPHX 5C25A 5CQGA 2I2YA 2MJNA 4JI6F 3T1HJ 3R5AA 2LQBA 3FUYA 3MPYA 1GQEA 1QVGR 2IBOA 2N4CA 3DMJB 4NEYA 2CQIA 3LO3A 1U26A 4C48A 1E6VA 2P9GA 4CTAB 1UVMA 1WG4A 2M52A 2MJUA 2XI2A 1FTCA 4NA1A 1TK5A 2LCWA 3IR7B 3FSYA 5F8NA 4LQ3A 4LJMA 4PG4A 2ZOFA 3IWLA 3KJNB 1DZ5A 2LQ5A 2E5LJ 5B0AA 2PGCA 5KG2A 3O6QA 3BKFA 4ED0A 9ATCB 5K20B 4J9MA 1GTEA 1VBZA 4RR5A 3DLKB 4KYZA 3KLHB 4B02A 1ZM2A 2R8IA 2X3DA 5B0CA 4P2SA 2YKQA 1IKWB 2ADBA 2YNHB 4CO3A 2NYHA 2O3DA 5HVHA 3DM2B 1JJHA 4ELTA 4UF4A 3G6YA 1FVQA 3NGRA 2GO9A 1S1XA 2E1AA 4A8MP 1QVFR 1YX2A 1L3KA 3TZZA 4B3RJ 3KJQB 4DX7A 2MPUA 5E33A 2PFDA 4KH0B 4ZPDA 4K4UA 2CJQA 3V4MA 4ENOA 2HMIA 4DDFA 1SJRA 1S12A 3EZ5A 3FK4A 2VA2A 1WWHA 2BUNA 4Y3CA 4NA3A 2ZD1A 4FNHA 3RZAA 2FGOA 3BBFA 2CDRB 3ZTRA 4QBUA 2B0GA 4OYMA 3DOKA 1F3VA 1FXLA 1JLBB 1SQFA 4FN5A 1EETA 2KZZA 5DG9A 2V9WA 3DOMB 3F73A 4AE5A 2E7XA 4OV6A 2XS2A 1XMOF 4P6QA 3BGUA 2ZWPA 1PGZA 1UZHA 3EPIA 3I0RA 3PW5A 1XN9A 4F26A 3GV7B 2F5GA 4I6YA 2CUYA 3NAIA 4C98A 2JJ4D 2KRBA 5BJRA 2V4QA 3M8QA 1RAOA 1KVIA 3GONA 3VQSA 2VFVA 5A6WA 3FEZA 4BS2A 1I51B 4FYXB 2K8GA 4HACA 2XYPB 2MKSA 4C7QA 3TRGA 4WWSA 1N56A 3KLEA 2Z4PA 2GQQA 4A48A 3TQ1A 2CJKA 3KK3B 1YJUA 3W2VA 4PR6A 1SUQA 4ZMMA 5KG3A 4ZPWR 3GYNA 1KD1T 1UCNA 5F8GA 1F2HA 3PYFA 1EQ0A 1I5OB 2X1FA 4RW7B 1S6OA 1HFEL 2V4JB 4U8VA 1F1BB 3FEXB 1GEHA 1L3SA 2X3GA 1HBMB 3AOAA 3HX9A 2HAFA 4RW9A 1QSYA 2V94A 1MG7A 3R5GA 1DLOA 2K06A 2ZBRA 2HVHA 3AQPA 4KKOB 3GIMA 1JXVA 1TL3A 5SUHA 3HVWA 1I3OB 3RB3A 1UEVA 4WFBQ 4WJBA 3E01B 2RDIA 4QIGA 3N6MA 2W25A 4X4NA 4KBIA 2RHSB 3C6TA 2R7VA 1LW0B 1S72S 3V6DB 1KOOA 4ELUA 2IIHA 1R7IA 2BMBA 2AGQA 2IC3A 2FZKB 5KG0A 4I4BA 4DUYF 3UQSA 2YX1A 3QIPA 2RRNA 5MLCV 4FS2A 5DDOC 1J5OA 2QYGA 4HHUA 1M1HA 5U47A 1S48A 1TV6B 2P9EA 1RT2A 2R8JA 3UI3A 1UAWA 2BE2B 2EPIA 2NXEA 3WC2A 4DFMA 3T6JA 3DLJA 4NWBA 4QZVB 4NX9A 2DKOB 3DRRA 1VJQA 1XEZA 2PO4A 2QA4S 2C2KB 5CD4H 3DFEA 2XMVA 1ZM3A 5HO4A 3LGNA 3V2UC 2B5JA 4WIQA 1YRTA 2OJ3A 1YRUA 4GVBB 4IFVA 3PG9A 1VGYA 2J9DE 4DR2F 2NLWA 4ECQA 5LMUF 4NCGA 1UFKA 2YNGA 1T05A 2RVJA 1N33F 4PQAA 4GKKJ 1PJ7A 4PQUA 2EXUA 4KFBB 2MQQA 5CH7B 1ZBTA 1YJWS 3P49B 1U0HA 4QWBA 3K57A 3NGUA 2CRLA 3CCRS 3MWBA 3WHIA 3TA0A 4DS5A 2CPZA 1IBMF 4UY8T 5J2MB 1HHTP 4NOHA 3ILJA 1VOMA 1HMVB 1X60A 5K8OA 1R6VA 2ZBPA 4PUOB 4K7QA 2FUG9 3M8WA 3AAWB 1HR0F 1HPZB 4AFFA 2ZJQQ 3K89A 4IDKB 3M1VA 2Q6BA 2KXNB 1JLCB 3VGSA 2BXJA 4YP3A 4ANEA 4ATNA 1SBRA 3A3PB 3T6BA 2ERRA 2LEPA 1R0AA 3M7VA 5KFTA 2K3KA 4UZCA 1DTQB 4NLDA 4OZ2A 4A46A 2DGUA 2CQHA 1B70B 1OIAA 1MMDA 3MPVA 4NXNJ 1SV5B 3OHAA 3QRPA 2QA2A 4DZDA 4ILRA 3KOAA 3R5JB 4B3MJ 2BM0A 3TWZA 3D6TB 1RHJB 2CQCA 4WFYA 3MHYA 2H4WB 1N6QA 3TNVA 5DS7A 4ECWA 2EFOA 4H4MA 1MMLA 1CBKA 4C0OC 5LT5A 3Q2TC 1X4DA 3OD2A 3ZO7A 2DIVA 1T9VA 4JI7F 3SSQA 1GTHA 4NCAA 2R4FA 2M0GB 3M8SA 3G2XA 2IMOA 2J6UA 4OHVA 7FDRA 5E7OB 2FD2A 3IGVA 3EVMA 1O51A 2OAUA 4ZHRB 4NXMJ 3UE2A 4NRUA 2IMWP 2VPWB 5ETNA 5KFSA 4HYKA 1YDLA 2E5HA 1SJ4P 1KONA 1YZ6A 3DRPB 1X31C 2QA4G 3EJMA 2UP1A 1HHQA 4BWJA 1U49A 2RU9A 3RBDA 3IP0A 4ECZA 4C3KA 2HRUA 5GAHI 4ZLNA 2E5GA 3FQKA 1U4BA 1RT6A 4OV1A 1NZAA 3MR6A 1FDNA 2GMHA 1J5EJ 3MECB 4CNZA 3K0JA 3M6UA 1RDRA 2B56A 5AE2A 1OS5A 3DDNA 4YMEA 4RW6B 4ED8A 2WRMA 1FHTA 1FRLA 3MUMP 2X1BA 4J9UE 4CH0S 2ROEA 3B54A 3CIMA 2XSJB 2B9YA 2P9CA 2HK3A 2FZCB 5CYQA 4GVLA 3NLCA 3BR9A 3DU5A 1U09A 2RDDA 4DV1J 4ELVA 1GNKA 1WORA 1D8YA 2UVUA 3J81U 4ED6A 4TLQA 1SB6A 1FRHA 4OHYA 3NGSA 2WBRA 2V68A 4A8KA 1RAHB 3RW6A 1H7XA 2R7SA 2U2FA 2R2SA 4WCEQ 2GW8A 4PXDA 1NB2A 3OFFA 3UNYA 2J0SD 4DR1J 4CLLA 2ZBCA 5IQQA 2UXCF 2M5YA 2MYFA 1JLEA 4F4ZA 5L1IA 2PDAA 3OBIA 3A3NB 5J1EB 1PBUA 4K59A 4C3LA 2VB6A 3TVZA 1R3NA 2FJWA 5GAGI 5LMNF 3TEGA 2DGVA 2VKRA 1B0TA 1ZTTA 2VC0A 1QUVA 2GAHC 4JP8A 3SCLE 1U25A 4KRWA 3MPWA 2E9RX 2HHPA 2FDNA 2EWHA 3KK2A 4RU9A 1D3WA 2DXFA 1FK9A 4O4GA 4KHMA 3W9HA 4OI6A 4DPXA 1C1CB 5C25B 4KJIA 3SI8A 1O8BA 2ZWOA 1RBLA 3I96A 3QSYB 2C22A 2FZGB 5IWAJ 2L3MA 3PRBA 1HI1A 3RRGA 1S1TA 4PPZA 2AZ3A 1GXTA 2C2RA 2OPQA 3DRYA 3FZ2A 3WBZA 3MCNA 2DGQA 2Z56B 4K50A 1E6VB 2HVZA 4IQMA 2R3VA 1KN6A 1R8PA 3WC0A 3GIJA 5I3UA 3ENWA 3PJWA 2ROPA 4YB5A 5L9NA 1Q7LB 3GIIA 2LQ8A 3D6FB 1RTDA 3U1LA 5CHCB 1BXNA 2MQOA 4EWTA 4WYWA 3GU0A 5HROB 5LJ3Y 4YB6A 1VC0A 4GC7A 3RU0A 3SFUA 2LQ9A 3NKYA 4WFNQ 3QZ8A 1TL7B 2HGLA 1XC9A 3OJSA 3K17A 4NASA 1Y00A 5C7PA 4Q8FA 4QR0A 3OLAA 4RW4B 3PTWA 5LJ5Y 1N34F 2F63A 2WZ1A 4O3QA 1Q78A 2ZITA 3IBWA 4RWXA 3HD2A 2D3UA 1VQOS 1S1XB 4DQPA 4UW2A 4YY3F 2APOA 2B9XA 4CLFA 2Z8QA 3AOBA 4DR5F 3NS5A 1XNQF 3P3DA 4IOCQ 5T7LA 3LGMA 4HH1A 4FF1A 4ZCIA 1VHFA 1WHWA 3PM9A 4RBUA 2M3DA 3T3FA 1CS4A 1YITS 4F25A 2CVEA 4DR3J 4LF8F 3BYRA 3TX8A 4U7CA 3IRXA 2IHR1 1M1GA 5ITHA 2EBGA 2NSCA 2ZD1B 3HF5A 2MKCA 3SCJE 3CDEA 1B3TA 3T19A 1R0BG 1ROFA 2MQMA 4EO8A 3D1HA 2BJ9A 2VD3A 3DOKB 1ZPVA 4F4YA 3O1LA 1EETB 2BRLA 3K5OA 1RWNB 3NP5A 1AROP 3MZIA 4JYAF 4NYPA 3BN7A 4ZCLA 2V8VA 1EHWA 2MHNA 1Y5IB 1FF2A 3O5TB 4QWCA 2UXBF 3I0RB 1FFWB 1CJVB 3W8PA 2V2QA 4XIUA 2VG5A 1FRMA 1H6KX 4KHPJ 2AZ1A 2F65A 2OD6A 2W2NP 2HEKA 4EGLA 2AW0A 1LFPA 2ZH2A 1X5TA 2DRAA 3M8QB 1Y5NB 4WF9Q 4BCAA 1VQLS 1P9YA 3ZZOA 1NK6A 3ZZPA 2W2QP 2BQRA 4HACB 2HBYB 3KJVB 4F2RA 3UFCX 4NLWA 1FT8A 1FNOA 3CNQP 1GXUA 3AXKA 4MMOA 4ID5A 1N88A 2V8HA 5H9FJ 3KYLA 1I6JA 1TKZA 1U8WA 1MWZA 2HHXA 2R7TA 4WP8A 3J80Y 3HT0A 3ZZZA 3W2VB 1B7YB 3C14B 1SUQB 1VQ7S 4C8ZA 1LEOA 4OLOA 4WKRA 4ZK7M 5A6PA 2JLEA 2XLKA 3AJ2A 4DSIA 3W9IA 5AE3A 2OFHX 4H4OA 4OHZA 1RWPB 3VCDA 1NSAA 3K2YA 3T5KA 3A8IA 4OHXA 1DLOB 4JI5F 2KG0A 4Y2AA 5T41A 3GIKA 1Y4ZB 5EX0A 3BQ0A 1R89A 4K4TA 4Q43A 1JLGA 1TKTB 4DL6A 2IM0A 4X65F 2JC0A 2HIQA 3Q8QB 2IC3B 3MR5A 3L95X 1F9FA 3IM8A 3DOLA 3FBFA 1XQIA 3QIPB 5D77A 1Y10A 2L9DA 1J5OB 1HI8A 1NDLA 4ED7A 1RT2B 3OUYA 4TQSA 2ZH6A 2XULA 4ZVPB 4PWUA 2XMMA 2A1BA 3R7BB 2BW2A 2DHSA 1Q5YA 5M2UA 3DRRB 1RABB 4DF4A 1VC5A 1U2RA 4CYUA 2ZH1A 1YGYA 3MGJA 4B9LA 3G9CA 1FNXH 2ZOGA 3CDUA 2B5JB 3HVAA 1ZAVA 1X4FA 2G1HA 1SKSA 1QM9A 4Q8EA 5IOLA 4N8OA 5HQ8A 4CDIA 1Y3KA 1ZOTA 4TY8A 2RS8A 2ATCB 4HL9A 2ABYA 1T05B 3Q8RB 3PW2A 3GWCA 3CC7S 1Q79A 4F67A 4TN2A 4ITSA 4PQUB 1PYOB 4KT0C 1SL0A 3ZZYA 2AEFA 2DIUA 3CJSA 1U0HB 1S9GB 2XHCA 5FLXU 3Q8YA 3G71S 3MAAB 1VFJA 3O44A 3NMAA 4B3SJ 1IWGA 2EFGA 1CLFA 3DRSA 2MZTA 5BXIA 5DRKA 2EC2A 4ZIVA 3Q8PB 3VAMA 4ZVTB 4A8QA 1PC5A 5DQGA 1LW2A 2GO8A 3PYGA 5B08A 2YPZA 2MMYA 2ZJPQ 1HARA 1N5YA 3PIOQ 3MEGA 3W60A 3Q83A 3W5XA 5H9EJ 4MKYA 2FJVA 4RNFA 1X0FA 4PPDA 3OXGA 5B0FA 3Q22A 3BSOA 2YTCA 3NWRA 2ZH4A 1R0AB 4ED4A 4G6VB 2BJEA 1RA7A 1HI0P 1HNZF 1HYSA 4S0MA 2OFGX 3HHLD 4Y2MA 4DSFA 3KLIA 3RB0A 4JI4F 3KG0A 2ZE2A 2HNZA 1SJ3P 3W62A 1NJXA 3MCOA 4DV5F 1R0CB 7FD1A 4DLEA 5HAOA 4ZP6A 1U48A 3IWXA 4H4MB 2NXUA 2QC3A 2YWWA 1RWOB 2OH2A 3NBPB 2QO3A 2HHHJ 4C8YA 3D3BJ 4LF2A 2PEBA 5DDPC 1HA1A 2G9OA 3VVUA 1X4CA 3KNAA 1M5HA 4J91A 3G6VA 1QE1A 2LU2A 4LMZA 4F4AA 3IN5A 2VF3A 3DRXA 1JK9B 2MLXA 4C6AA 1S6UA 2UUBF 1YBAA 1EX8A 5KFVA 2DH7A 4YQWA 1RT6B 3VAJA 2MY8A 1E6YA 1KVJA 1RAEB 4LBIA 3Q89A 2LLZA 1DTTA 4K4YA 2JEIA 2QYCA 3SQGB 2J8AA 2VU5A 4M5JA 1X9MA 1NK4A 3LW5C 4HR2A 4ECXA 4KE5A 2XNRA 2CQ4A 3UDVA 2E1PA 2FIUA 4DN9A 2CZ4A 2YWFA 4F0HA 4LF7J 3BR8A 5CYQB 3FJ2A 2Q3PA 2P6SA 4OYXA 2MKIA 3MMCA 1UVIA 4ZP7A 4JV2A 3QO9B 2XMUA 4JI2F 3W1YC 3N6LA 4ED1A 5E2QA 2EC0A 5IV3A 2WAQD 2MQ8A 3SQOP 2UV8A 3KHGA 3C15A 3THVA 3HHLA 3BSCA 2LP4A 3HHLC 4IO1A 1UJ5A 3R5DA 4CLTA 1VRUA 2OEJA 3M05A 3Q0AA 4ECTA 2P2CB 4DBQA 1NO8A 1KLMA 3I4PA 5FD1A 4MH8A 4NZ0A 4GKJJ 2DPJA 2DRBA 1YI2S 3QLHA 1RACB 2XQCA 3CDWA 5IQ6A 1KS2A 4WP9A 1U1NA 1NMEB 5DLFA 1JLEB 1RU1A 4OJ1A 1UW4A 3NGKA 5KFCA 1RT7A 4DV3J 1HQEA 2H9ZA 5T14A 2HHWA 1Q7YT 3EDQB 4JBCA 1UJ4A 3TZYA 2PT0A 2YQ0A 1DQ8A 3TX0A 3WIUA 3M2VA 3RG6A 1NK9A 2MKHA 2D41A 2I0XA 1FCAA 3G82A 1OY8A 3H42A 4I56A 3KK2B 1RAGB 2ADCA 1FK9B 4O4GB 3RR7A 2UV8G 2D69A 5ETSA 5A0YA 3MR2A 3KFWX 1FD8A 3BH7B 4AL6A 2LQJA 3LGHA 3FFIB 4I69A 4DN0A 5F3ZA 5C24A 1AZSA 2M4MA 4IQXA 3M30A 1S1TB 2XB2D 1AFJA 3W61A 2RDJA 1HBUB 2OPQB 3G8SA 3B82A 2CJBA 2KFZA 4ZCKA 1VQMS 2H3EB 1FKAF 2EK6A 2HLTA 3PX0A 4G3IA 1IKYA 5I3UB 2G13A 3D7SB 3JAMY 2J8SA 3CTRA 1SVDA 1NPRA 4ZDNA 1EKRA 1RTDB 3MMAA 3TO8A 1QSLA 2HQIA 3KDOA 3L09A 2CQDA 1RKJA 2MKJA 2IAJB 3AB4B 4I6WA 1RISA 3RTVA 4LFCJ 2V9KA 1JQGA 5LM7E 3RAXA 3R5BA 3OTOJ 5L9XA 3B4MA 1S1VA 2QJ3A 2SXLA 1CQMA 3U02A 3IRWP 2BE9B 3QRRA 5BYRA 3C66A 3HHDA 2EG1A 2F8EX 1B99A 3EICA 1SPBP 4IYQA 2R2UA 3N6NA 1T0TV 4F2SA 1NDKA 3CJ2A 1LWFA 5KTQA 4GO7X 1SQEA 3BPDA 4DV4J 1SC4B 5T7LB 2BJ7A 3CPWR 5HLFB 1JJ2R 3KK1A 1N32J 5HATA 4MFBA 1CS4B 3KUGA 1BLUA 5F9NA 2CJ9A 2CQ1A 1X5SA 2IM3A 3EGZA 2EVZA 4FKYA 3W2WA 2G0CA 2KJVA 4X64J 3IRXB 1FKPA 3EZUA 1AB8A 3PKYA 4DV2J 1U1MA 4CM2A 3GJTB 2VBZA 2DHXA 1OYDA 1NHVA 5F8JA 2A18A 2B4VA 3JS9A 2IFXA 1AXQA 3KG1A 4ZVSB 2CVIA 4JI0F 3L3CA 3DKDA 5H1SV 1A0OB 1NBEB 1Z2ZA 1BE4A 2CPFA 2HK2A 3V5RA 5E3AA 1NZ8A 3A8KA 4AQYF 4O0IA 3PV8A 4TYBA 2OLWA 2UVRA 2VG6B 5EN1A 1Q1KA 2CDQA 3IAM9 2YPYA 2QFIA 1Q8LA 3R97A 1S9FA 3CO0P 3GLJA 1NB7A 1YJ7A 1BMQB 4P7TA 4U7UD 4PKDB 1QAXA 2MLZA 1RTHA 1N0VC 3UN2A 3D6MB 4ANCA 2AD9A 2ZJRQ 2YQ3A 1TKZB 2AF6A 3NNHA 2L41A 3HZEA 1CG2A 2Y0SD 5ETQA 5E41A 4YS2A 2LA6A 4UT4A 3GTYX 2KZMA 1BHNA 2PMWA 4WU2A 4X4UA 2UUCJ 1JXEA 4MTPA 2G4BA 2NSBA 3AD9C 2DGWA 1XR7A 3NXZA 5EWGA 4OZ1A 2ZNZA 1FA0A 4CIOA 2XZDB 3FRZA 2PA3A 3MAHA 4O3OA 1WUUA 5KFJA 4A8XA 3CWJA 2UU9F 4LF4J 2HNYB 3DMJA 2HHTA 2DNPA 2ZDOA 4CLPA 1WEXA 2BEFA 4LF6F 5AXLA 2IYIA 3MI7X 4NL5A 2YNFB 4QQBA 2XM3A 1Z4UA 2VQFJ 4KGVB 3DOLB 1MMNA 2X7IA 1KQGB 3ZTPA 4P71A 2C1EB 2PE8A 2H48B 3DLKA 3THPA 4EUVA 1R8AA 2XO7A 1KEKA 2LXUA 2YNHA 4USIA 4ZJLA 5IZHA 1WC1A 1WEZA 4CYUB 4KGKA 1KKHA 4CLKA 4DR6J 2AGPA 4ZVRB 3DM2A 4ZPCA 3CIZA 3QJLA 2F40A 1VIXA 3OFHA 3G4SS 4O3RA 3R6LB 3ADAC 1FRJA 3PYEA 3GCXP 2FJDB 1F9EB 2DGSA 1IBKF 5CAAA 4M5LA 2COLA 4EBDA 1A9NB 4LF5F 3HK2A 4P10A 1M5VC 4Y65A 3AHPA 3JXOA 4C9DA 3FBEA 5AE1A 1MN7A 4HDGA 1YBUA 4RU2A 3GYGA 1U2CA 3JSBA 3PR4A 4Q2LA 2OEMA 3EE3A 3CD7A 3SIPB 2IPOB 2RU3A 4F8RA 3ETOA 2GMLA 3NY0A 2DGXA 5LL6d 4ALZA 3PNIA 3DRSB 3TEHB 1RZMA 3IC1A 4ECUA 2F4FA 2DNMA 3BS9A 1RKIA 3U7JA 2WVCA 2CNNB 2DCLA 1YBTA 1U1OA 2XYGB 3HT3A 1LW2B 1WHYA 1SH0A 2HAIA 3AJDA 1KQKA 4OI3A 2XG8A 1N5YB 4YR2A 3J7A1 4ZLLA 2W7OA 5GADU 3MEGB 3C3LA 2VH7A 4FXWA 2IDEA 3TVYA 2B3TB 2ZEJA 2FY8A 4PWWA 2FGCA 2L9WA 3PACA 2CPYA 2EFQA 2ZZNA 2K7JA 2J9DA 4J5OA 2C28A 4EFAC 3V81B 1RAFB 2W8KA 1WNEA 5LXRA 2HPUA 2XBPA 1HYSB 3NCPA 3UN5A 1FERA 5HMXA 2AKWB 2LMIA 2V50A 4F0KA 2FVQA 1OMSA 4BC7A 3QGIA 4Q45A 3CEDA 1F5AA 2C2MB 2O1PA 4AD6A 4QCLA 3M9MB 2QLWA 2V4JA 4ZPBA 1EP4B 3OXLA 5RUBA 3LOUA 1H7WA 2K3IA 3MM5B 4JOUA 3M9NB 2ZH9A 4KKOA 1V5IB 3H2UB 1RE1B 5KG6A 3UD5A 2I9SA 3CMQA 1N5TA 4I64A 5K5MA 4PG7A 4J9SA 4NLXA 2DY1A 3E01A 2Q43A 2KM8B 4F4XA 2AQ4A 2FHMA 2YXLA 3CD5A 1WELA 4X62J 3W7BA 3UCUP 1LW0A 2LA4A 2W4DA 3ZZUA 3V6DA 1JNZB 1QE1B 2GQ2A 2HWIA 5HQMA 4DXLA 1HBNB 4B3TF 1APSA 1I94J 1XJWB 1J27A 2I38A 3BJYA 3GFYA 4TY9A 1CJTA 2DHAA 3SFGA 2BE2A 2HSEB 2YWEA 1VK3A 1T8EA 3CD6S 1ZPWX 2Y8YA 1D09B 1DTTB 3N9UC 3ITHA 3BSNA 4ZJOA 2V2KA 4ZVUB 1NSKL 2GVDA 2ZM6F 1S77D 3D6HB 2R7WA 2VICA 2CIMA 2HW3A 2DNGA 4P2FA
chains in the Genus database with same CATH topology
4CO4A 2DH8A 1C0TA 4CH0S 2QV6A 2ROEA 5E0OA 3VR1A 1RGVA 4IG0B 3CIMA 2XSJB 3PDNA 1IKXB 3F44A 1Q16B 3HJFA 2B9YA 2P9CA 1HNIB 4C8KA 2MQPA 5CYQA 1REVB 1SJ1A 3NLCA 3MMCB 3O8WA 1SH3A 2GCFA 3IO1A 5I42A 4K4VA 3BR9A 3DU5A 1U09A 1VQSA 2M88A 2R7OA 3PO5A 3LP0B 1OSDA 2XGQA 4TU7A 1NRKA 1K1SA 1SL1A 3RRKA 4A8WA 3JTOA 4QYRA 2XGPA 1IR0A 3H8YA 2UVWA 4LVOP 1KR4A 2GIQA 2RQMA 2ZBIA 4ELVA 1GNKA 4MIAA 3OR1A 1GAOA 4J9LA 1D8YA 2UVUA 4H54A 3RR8A 3NS6A 2W9BB 2MSTA 4KFBA 3BB5A 4TLQA 4ED6A 1SB6A 2JEJA 3HHNB 1HWKA 2E1MC 3OTDA 1UMJA 3N5BA 3VQTA 2LECA 3E8OA 2KO1A 5J2QB 3TUZC 4OJGA 1B7FA 4DG1B 1P1TA 4QPTA 1FRHA 2FHKA 2GC8A 2AU0A 4OHYA 1LXNA 1NK0A 4URSA 2JZ5A 5AXNA 2WBRA 1OPIA 2HGNA 3AA9A 3FNNA 5EWFA 2CQGA 5KFOA 4A8KA 2RSQA 1C2PA 3KMQA 3C6UB 4A8YA 3RW6A 1RA6A 3CXCR 3K7RA 3G8QA 1H7XA 4O3PA 2U2FA 2R7SA 2R2SA 4O44A 2RKIB 1S6PA 2VG5B 4WCEQ 1FJEB 2GW8A 4PXDA 2ZDPA 1XERA 2X51A 4UUXA 4LF7F 2C42A 3EGWB 4DHVA 3OFFA 2J0SD 2JOQA 2QA1A 1LKZA 2ZBCA 3C46A 3QLHB 2GA7A 3I5AA 5IQQA 2M8HA 3HLUA 4I6AA 2UXCF 3TVKA 2M5YA 1K1QA 2MYFA 1UP1A 2JSXA 4CQ1A 4HEA9 3CCUS 5KFGA 1KC8T 4JI3F 3ULHA 2KTQA 2YNIA 2CQ0A 1JLEA 1OQ6A 5L1IA 4F4ZA 2XS5A 5KT5A 1YIJS 2PDAA 3OBIA 4U67Q 1FKOA 1RT4B 1DURA 5E5NA 5J1EB 1FDAA 1HQEB 4K59A 1XNRF 4C3LA 2VB6A 4PWDB 1FXRA 1DBDA 3TVZA 1R3NA 2FJWA 1T94A 3GG0A 1T3OA 3H59A 5GAGI 4ILMA 5KAKA 3DU6A 5LMNF 1DQ9A 1UL3A 2B9WA 2DGVA 4C2MA 2VKRA 1B0TA 2ZH5A 1ZTTA 2VC0A 1QUVA 2KT2A 5DETA 4AXJA 4FS1A 4OI4A 2CQBA 2WBMA 4ID5B 3D28A 3NWGA 1X5OA 3SCLE 1U25A 1XBWA 4KO0A 5KFXA 1FO1A 2HFNA 3J7YU 3SCIE 3A8EA 3N28A 1KFSA 4KRWA 3TW0A 4ZVGA 3V4IA 3MPWA 2E9RX 2KFNA 1R31A 1JLCA 2HHPA 4NLGA 3ICLA 4LFBF 3BGRA 1IQZA 2FDNA 1BY9A 1VJWA 2EWHA 4J9NA 2HZCA 2OTJS 3H98A 1S49A 4LQ9A 3KK2A 4XAKA 5KG7A 2IVFB 4FF2A 4B3OB 2VFTA 2GFFA 5F9LA 4RU9A 1D3WA 4KHPF 1FK9A 4O4GA 5KFYA 5D4NA 4FBUA 5IT4A 4KHMA 2ASYA 4OI6A 4IH5A 2WONA 4GKJF 1C1CB 2WCXA 3V81A 1D9AA 2XY5A 5THWA 5C25B 2QSWA 4X66F 4H4OB 3I0SA 3US5A 4KJIA 1DTQA 1VRTA 3POTA 3J7ZT 3SI8A 3E3XA 2VODA 1O8BA 2CQPA 5D6GA 2N7YA 5C24B 3I96A 3NAHA 3OFEA 3S6EA 4PG6A 4C97A 4M63A 3K5NA 4RNMA 2C22A 4IOAQ 4FXVA 2E9TA 3WX4A 2VG7B 3UNGC 4TQRA 2E5IA 4DV3F 2GV1A 2L3MA 4LFAF 3PRBA 1HI1A 3RRGA 1GXLA 5BR8F 3HDSA 2PSZA 1WG5A 3I4HX 2DR9A 1H38A 1S1TA 4PPZA 1TQLA 4ES3A 5EWEA 2F7VA 4M94A 1GXTA 3S7RA 2C2RA 2OPQA 1TKXB 2D74B 4K0KF 1EP4A 3OJUA 3DRYA 3FZ2A 3WBZA 2DGQA 4K50A 4TXSA 1IUJA 1VS3A 1YWXA 2WK4A 3ENQA 4DFKA 1LXJA 2VBWA 1TFWA 1E6VB 3CJ3A 1K0VA 3MM5A 2FJBB 1BQNB 1IKYB 1WACA 2HFOA 2HVZA 5CYMB 4OI1A 1QAJA 4CTAA 1JLGB 5DG8A 4IQMA 5ADZA 1RT3A 5KFHA 4K4SA 3QZ7A 5F3TA 1KN6A 1R8PA 2W4PA 3WC0A 1HD0A 5J2PB 3GIJA 5I3UA 3ENWA 3LP2B 1DQAA 4OFZA 1VC6A 3PJWA 1A7GE 2ROPA 3RW7A 4YB5A 2FLLA 5L9NA 1FVSA 1Q7LB 3VZIA 3GIIA 5G0RB 1FDBA 1Y0HA 3MMAB 1RTDA 1KRPA 4K4XA 1T95A 2XMKA 3U1LA 1Z1ZA 2DR8A 5CHCB 2KDOA 4CO5A 2MQOA 4EWTA 2YKNB 4TNOA 3EX7B 4WYWA 4EO6A 5HROB 3AJ1A 2J0QD 2Z2LA 2N3OA 4DL7A 3PW4A 5LJ3Y 4YB6A 2KM8C 1VC0A 4NLTA 4ZHRA 4BC9A 4GC7A 2ZOMA 3T1HF 3RU0A 3SFUA 1F0XA 2LQ9A 2NUHA 3MM7B 3NKYA 3PY8A 4WFNQ 1S1VB 3G96A 2F3JA 2R7XA 3QZ8A 3OUYB 2HGLA 2PC6A 3DCAA 1XC9A 3OJSA 1Z2LA 3DRPA 3K8VA 1Y00A 2XSFA 3JSMA 4CCHA 4ERDA 3KLHA 4ETXA 1HBNA 4WXOA 4XPCA 2K2PA 2JLGA 1YSJA 2RIJA 4Q8FA 2L08A 1IKWA 2A2CA 3SXLA 4F4KA 2XLJA 3FZBA 2CPEA 4QR0A 2V4RA 3QJJA 2PI5A 1BQMA 3ISND 4RW4B 3OLAA 3H5XA 1C1BB 4ICLB 1P27B 5LJ5Y 2MB0B 1N34F 4USHA 4EBCA 4O3QA 1G6BA 1Q78A 2ZITA 4D3GA 3MUVP 2WB4A 2BQ3A 4JV1A 3H40A 3M2UA 4WIIA 4ECVA 3H20A 1HBOA 1H2UX 3IBWA 1TKDA 4RWXA 2V8DA 1U8SA 1M5KC 3NCQA 5IM0B 1JIHA 1R8CA 2DBBA 2D3UA 1URRA 3EYZA 1VQOS 2ILZA 1S1XB 3MFIA 5M2RA 4G1QB 2JWNA 1RWUA 1IN0A 1LWFB 4DQPA 4UW2A 4Y2IA 2GQCA 1NJYA 4YY3F 2KKHA 2CZVC 4LF9F 2APOA 4QIWD 2B6AA 2B4OA 4XK8C 2B9XA 4RW6A 2YVSA 1S0OA 2Z8QA 1JLAA 5KT2A 3HVTB 4PXBA 1GX5A 4WTYA 4DR5F 1FRXA 4LFCF 3NS5A 4CO2A 4MIBA 1XNQF 2RUGA 3P3DA 4IOCQ 1QSSA 5T7LA 3LGMA 2XS7A 4WFZA 4TY8B 4HH1A 4FF1A 3HHKA 1VHFA 4ZCIA 5L38A 1Q86T 3UDLA 2UXDF 1WHWA 3PM9A 4RBUA 3OTOF 3U1NA 2E5LF 2M3DA 3RAMA 5KFPA 1LV5A 3T3FA 3D0IE 4WZQA 1S1WB 1YITS 1UEUA 4WE1A 4X4QA 4IG0A 4C11A 4F25A 1K0TA 1BWEA 2CVEA 3FGVA 3M32B 3CC4S 2Q6CA 2UZAA 4LF8F 1FRKA 3TX8A 3BGFA 4Q0BB 2RJZA 1N54B 4U7CA 3IRXA 2IHR1 1RT1B 4QR1A 2KH9A 4W90B 1REVA 5ITHA 2EBGA 2K1RB 2NSCA 1RJJA 3GFXA 3PHEA 1NKBA 4B9UA 1R8HA 2ZD1B 3HF5A 2RS2A 4RX6A 1D8ZA 4F4WA 2J76E 4I2PA 4L72B 1VI7A 2MKCA 3AQOA 3SCJE 3CDEA 4DQQA 3CCTA 3I5CA 4M1KA 3T19A 1ROFA 2MQMA 4RKUC 5KFQA 2F9DA 1QTMA 4EO8A 4WKYA 2KU7A 3KHLA 3D1HA 4B9VA 2XY7A 2VD3A 3DOKB 4M8LA 4YUDA 2JX2A 1WTBA 1ZPVA 3RRHA 4F4YA 1FEHA 3O1LA 3GFZA 2E1CA 2I5JB 1EETB 3MD1A 1JLBA 2BRLA 4RLEA 5GAEU 5IT0A 3K5OA 3BDPA 4RWWA 1WF0A 3NP5A 1AROP 1RTJB 3CT9A 3MZIA 1X9SA 4IRKA 2IA0A 3QMQA 4JYAF 2Z2MA 3I82A 4NYPA 4ZOSA 5M2PA 2W7PA 5DM7Q 1X9WA 3BN7A 4DV4F 4B3RF 4ZCLA 4O3SA 3DOMA 2V8VA 2DHGA 3R1HA 2MHNA 1Y5IB 3T5HA 3MEDB 5L1LA 1FF2A 3ISZA 3O5TB 3C6UA 4QWCA 1N32F 3TAQA 2UXBF 4X4SA 1C0UB 3N79A 5JUMA 3X1LB 1KOHA 5A8WA 3HXMA 3I0RB 3GV8B 2VONA 1YJVA 3NNAA 4XIUA 2RKIA 5L1KA 2VG5A 3T5LA 1FRMA 1H6KX 1WF1A 2QMXA 5LXYA 2OD6A 3B8HA 4PXCA 5LSOA 1KTQA 2GNKA 2W7AA 4QJVA 4QYZJ 4X64F 1VBXA 4HI1A 3TARA 2U1AA 4EGLA 2AW0A 3VZHA 4OZ0A 1WTFA 1LFPA 2ZH2A 4YHHF 1X5TA 2ZC4A 4DV2F 2C2EA 2DRAA 1NHUA 3M8QB 2MGZB 3DLGB 1Y5NB 4A8SA 1UA1A 1BD6A 4WF9Q 4BCAA 2MZSA 4O23A 4RNNA 1VQLS 3ZZOA 1N4LA 1NK6A 1RT4A 2D9OA 3ZZPA 2BQRA 3UD4P 4PWDA 5GMKa 3VAKA 4DEZA 2FLPA 3KJVB 4F2RA 4C3MA 2GGPB 4JV0A 4DR4F 2AYMA 3GE9A 3P96A 2WTFA 2J5AA 3UFCX 4CH1A 4NLWA 1FT8A 4DV6F 1FNOA 1GXUA 2AX1A 4OHWA 4IFYB 5FDLB 4MMOA 5I4MA 4ID5A 4B9MA 1VQYA 1N88A 2V8HA 5H9FJ 3KYLA 4Y28C 1I6JA 3M4XA 2GJ2A 1CPZA 1TKZA 5GADI 5DLGA 1ZZNA 1MWZA 5K8MA 2HHXA 1D1UA 5L1JA 2R7TA 1R8BA 3UR3C 3J80Y 2J9CA 5DGAA 3ZZZA 3W2VB 3KK3A 3LALA 1IXKA 5KG1A 4NPOA 1SJFA 1H3DA 3UPFA 1SUQB 5C5JA 1N36F 1VQ7S 2IRUA 2Q1LA 4C8ZA 1HNVA 5D3GB 2VKZG 2HNDB 4JI8F 2GHWA 4OLOA 2MZJA 2XZWA 4WKRA 2YY3A 4ZK7M 5A6PA 1QY7A 3KLIB 2JLEA 4PRFA 4ZVFA 4BWMA 5MAOA 4I7FB 4XDDA 2QFJA 2XLKA 2ZFHA 4WFAQ 4J37A 3GV5B 4XPEA 1C1CA 4RW7A 2G1DA 3AJ2A 1Y7PA 2ZE2B 2HNZB 1S0NA 4B9TA 4DSIA 5AE3A 1KTVA 2OFHX 4H4OA 4OHZA 3K59A 4OX9F 3VCDA 1OQ3A 4EEYA 3ISNC 3K2YA 3TANA 1W25A 1HBMA 2O01C 2D9PA 2OPPB 3T5KA 4OHXA 1U1QA 3PXGa 5DDQC 3VAFA 1DLOB 3BF4A 3FRYA 2DTJA 2RB7A 4DV7F 4WFXA 3M6VA 4JI5F 5D4LA 2VG7A 4FBTA 3U27A 2KJWA 1U7LA 2KG0A 4Y2AA 5T41A 4ZP9A 4C8LA 3GIKA 3KHRA 1Y4ZB 2NPFA 3VTIA 5LSLA 5EX0A 2W24A 4OI0A 3I31A 4YEAA 1H2TZ 2WW8A 1TKXA 4C4WA 3I55S 4OIXA 3UD3P 3IS9A 3BQ0A 4DSEA 1MU2B 4WXWA 3OL9A 2FHJD 1R89A 3PEJA 3AB2B 1HWJA 4NMLA 2XEXA 2BACA 4DFJA 2OTLS 4K4TA 1Q8IA 3M8PB 4Z2XA 3D1OA 3MM8A 4Q43A 1D0EA 1JLGA 1MWYA 2W9CB 3MOZA 1JLFB 3BEGB 3BZQA 3L7PA 1TKTB 2C3MA 4LT6A 5C42B 3UCGA 4F3MA 4DL6A 4IRCA 2IM0A 2HS3A 1RI7A 3NRBA 5G0RA 3FEYB 3CSKA 3MAQA 3BREA 4X65F 2JC0A 2IRXA 2UUCF 2ROGA 5HBMB 5B0EA 2YKAA 3LAMA 2X1AA 4OJ3A 2HVIA 1G3OA 3NCRA 2KN4A 2HIQA 2AWZA 2VASA 3Q8QB 2IC3B 3MR5A 4ED3A 1TP7A 3L95X 1F9FA 4LSNB 4V19X 5GAHU 2EKYA 5HROA 3MD3A 3DOLA 4KGMA 5CZVA 3SSRA 2FJAB 3QIPB 5D77A 5IS2A 4A8FA