2FQQB

Crystal structure of human caspase-1 (cys285->ala, cys362->ala, cys364->ala, cys397->ala) in complex with 1-methyl-3-trifluoromethyl-1h-thieno[2,3-c]pyrazole-5-carboxylic acid (2-mercapto-ethyl)-amide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYAASADVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRAFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Caspase-1
publication title A common allosteric site and mechanism in caspases
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2fqqB00
1ICEB 3KJFB 3RJMB 2HBQB 3EDRB 2QLFB 1RWKB 2QLBB 4LSZB 3GJQB 4ZVRB 5IC4B 2CNLB 3R5JB 4ZVOB 3R6GB 2C1EB 1RHUB 2H5IB 1PYOB 3SIPB 3IBFB 2P2CB 1RHKB 1RWMB 1I51B 3QNWB 1RWXB 2CJYB 2CNNB 2DKOB 3IBCB 2H4WB 4ZVSB 2Y0BB 1PAUB 2HBRB 3KJQB 3KJNB 1RWNB 2XYHB 1SC1B 2C2ZB 2CDRB 1QDUB 1I3OB 2QL5B 1RWPB 3D6FB 2H48B 3NS7B 2CNKB 1SC4B 2QL7B 1RHRB 1RWVB 4JB8B 2H4YB 3P4UB 1RWWB 2CJXB 2H51B 4ZVQB 2CNOB 3D6HB 2QLJB 1F9EB 3GJSB 1GFWB 4ZVTB 2HBYB 2H54B 1QTNB 4ZVPB 2FQQB 2XZDB 4ZVUB 2C2KB 2C2MB 1RHJB 2XZTB 2C2OB 3GJTB 1SC3B 3EDQB 1RWOB 3P45B 3R7SB 1NMEB 4DCJB 5K20B 2HBZB 5IC6B 1BMQB 1RHMB 2QL9B 2H5JB 3D6MB 4DCOB 1RE1B 3R7BB 4DCPB 1IBCB 2Y1LB 2XYGB 3GJRB 2XYPB 2H65B 3R6LB 3R7NB 1RHQB
chains in the Genus database with same CATH superfamily
4H4OA 3MMBA 3EICA 5HP1A 4OYBA 4RW8A 5EWFA 4LRBA 2CA9A 2IYIA 3UCUP 3CCMS 1RT6B 4NLOA 1WG4A 4K0KF 2AT1B 4CWBA 4F26A 4TNOA 4WIQA 1U1LA 3OJSA 4AL5A 4N47A 1JKHA 2FVQA 3ET6A 5LMNJ 3LOUA 5KFRA 1HNZF 3HHNB 3WC0A 4FBUA 1FWPA 4HEA9 4RW4A 1EJ7L 1ZAVA 4B9SA 3PO5A 1FX2A 1TAUA 1EB0A 2ZBPA 4JI3F 5HVFA 1PBUA 3CJ4A 1WG5A 3HVAA 2H54B 2KFZA 4O44B 1KHWA 3TP2A 1TMJA 4F4XA 3R5GA 5IT9U 3GIJA 3JS9A 4OJHA 1FVQA 4ZN1A 2OI2A 1LV5A 1R8PA 3CJ8A 1FRKA 1X5SA 4O0NA 3RRGA 4Y2MA 1F3FA 3R27A 1UW4A 3T9ZA 5LXYA 2H5EA 1C0TB 3RAMA 5H9FJ 3WDOA 1YJWS 3SMZA 3OPKA 5HBMA 4PZVA 4LFBF 2H5IB 2LQJA 3E2EA 3EE3A 5F8LA 1YJNS 1YBAA 3ILJA 5KFCA 2P6SA 2HHWA 3TZWA 2MMYA 3MR5A 3IS9A 2W2QP 4I2QB 1XN9A 4Z37A 2BR0A 2K8GA 2WOMB 4LF7J 1SH3A 3LP1A 4PAAA 3IAM9 2HLTA 4O4RA 1AROP 4AD6A 4DFJA 1K1QA 2RNEA 1DURA 2Q43A 2YH0A 3K0JA 5GMDA 3CMQA 2XG8A 4ZVQB 1V6HA 4FKYA 1P8GA 5I42A 2OKQA 5C42B 2ZC4A 4LBIA 1SI9A 1TFWA 4CO2A 3QRRA 3W8GA 4JI2J 1GTHA 2QLXA 3H8YA 3GFXA 2ZH4A 3HSJA 1ZPVA 4K4UA 1RAOA 2W9CB 2FPHX 3I32A 4EO6A 3J80U 5KFWA 4QQBA 5KFXA 2OFGX 2RF2B 2ATCB 2XLIA 2FLLA 1XJWB 1U02A 5LMUJ 3LPEA 1N5QA 2LCWA 1B4SA 1KLMA 2HQFA 5FDLB 4KC5A 1IKWA 3DLBA 4AQYJ 3MCMA 3PACA 3CMES 3BPSP 3KMSA 1VQMS 1GNKA 4OZ1A 4J90A 1UZDA 4H4MA 3CJSA 3L7UA 2I0XA 1UAWA 4NA3A 3K17A 4NCGB 1T8EA 4TVAB 2VIHA 1C2PA 2EVZA 2VQFJ 3K5NA 2KM8B 2AP6A 4I69A 1DHMA 3CDWA 1LEOA 2J76E 3JSRA 2MLZA 1Y7PA 1SQEA 3H20A 3L4BC 1R3NA 2DT9A 3THTA 3HXMA 2C2MB 2CAJA 3N5FA 3K58A 3V6DA 4V19J 3M6UA 3BN4A 4ZCLA 5HLFB 4F0HA 5L38A 4ZA1A 1EKRA 1MWQA 1U24A 4ZP8A 3G9CA 4MT1A 2NPFA 1FRXA 3OHAA 1YSJA 2BRKA 3WC2A 3SQGB 3MPYA 3SI8A 5LMUF 2HNYB 1QSSA 2GGPB 5IC4B 5ETKA 3MUVP 1YRUA 4P72A 2F63A 3VR1A 1LWFA 1HQUA 4N7TA 4AQYF 2P5VA 2HURA 2UXCJ 1IWAA 2WVFA 1ZTTA 3CVKA 3ZZ0A 4KTQA 1G4CA 2OTJS 3BO3A 2YQ1A 1S57A 5KT7A 1U8SA 3HVTB 4M63A 3N6LA 2VV5A 2VQFF 2ZVSA 1KNZA 1M5PC 2UVVA 4Q2MA 1XQIA 4JUZA 1FD2A 3DHWC 5CXTA 5I3QA 3ZXWA 3L9ZA 3W2VA 2DNHA 2MKCA 2MKHA 4JP8A 4CT8A 2P9EA 2YNIB 2F9DA 3EWGA 4RW9B 1LNQA 4ZLJA 1IBCB 4FF2A 1HFEL 5EHHA 3W7BA 2KO1A 2J6SA 5E3RA 1Z1ZA 3BSNA 1A9NB 4NLGA 2KN4A 3QMQA 4URGA 3BREA 4KH0B 2I5JA 1HNWF 2QRRA 1S48A 4LF8F 1JJ4A 5CYQB 3D0GE 3M2RB 2F7VA 1U47A 1B3TA 4ID8A 2V4JB 1U26A 2UXCF 5E2QA 3IG1A 4F4WA 1PSDA 1BUXA 2Y0BB 4NA2A 4GKJJ 4EBEA 2OGUA 3MR6A 3RAXA 1HBNB 5CZXA 1WELA 2VG7A 2H4YB 3TO8A 2CPIA 5M2UA 2WVEA 5DRKA 2HZVA 2BE7D 3MEGB 3TAMB 1XR5A 1VQ5S 1K1SA 4X4NA 4O3OA 3JSYA 2V2QA 2DR5A 2Y9HA 5GADI 3CIZA 4V19X 1ZZNA 1X4DA 1M0SA 3BZQA 4OIXA 2YKNA 3QLHB 3QIPA 3KMQA 4YR0A 1X9WA 3SCIE 4F0MA 1HBOA 4PPZA 3BO2A 3KTQA 3GFYA 2D3O1 2R7UA 5AXMA 2G1HA 4K7QA 3MOZA 2CADA 3TRGA 2B3TB 1GH8A 2QZ8A 4WXWA 3IXQA 1TP7A 2VODA 2PMWA 3NWGA 3QT6A 3R1LA 4RU9A 1YJUA 3PJ9A 3HHEA 1FRLA 1UJ4A 2C3YA 2BE2B 4GKJF 2CJKA 4HL9A 5C25A 1Y5LB 4PEOA 4LMZA 2DNQA 4R8UB 4UZCA 4RW6B 3B54A 3N5BA 1F9HA 4NCBA 4BWJA 3W5XA 2B7BB 5IQ6A 3D3BJ 5HL7Q 4MKVA 3CGIA 5LM7E 1Q53A 4JI4J 1TL7B 2AEJA 4R0JA 3MECB 5B0AA 4LRDA 4GMKA 1BMQB 1JXEA 2M0GB 3ISNC 4FYXB 4IH7A 3AQOA 3OFFA 2HMIA 1X5OA 4KRWA 1QUPA 3NGUA 3I0SB 1FE4A 2M8HA 4DZ6A 2ZKUA 1WTFA 3CE8A 3HSZA 4J9KA 3DRPB 3AY0A 1T9VA 2DNOA 3BSAA 3M05A 1Y0HA 5A8RA 3J81Y 1VQNS 3TQEA 1EETB 4GKKJ 4M5DA 2LDIA 3HKZD 2CJAA 1H2VZ 4MFBB 4DX8H 3NMAA 2M9KA 5U47A 3KLVA 1X7VA 1ZBTA 2YNGB 3A4TA 3ZTSA 2WRMA 2VPZB 4F7VA 3TX0A 3ZTQA 2CJXB 5KFEA 1S59A 4WFZA 3GJSB 2F65A 2ZDPA 2GHPA 4JI4F 3ZZTA 3O8WA 2AIRB 2N4CA 2V4RA 1NJIT 1ZM3A 4OV1A 5KT2A 3MM9A 2DH7A 2HFUA 4CLZA 3US5A 1U6FA 5K9FA 1VC6A 2FVCA 4V1Ak 2RJZA 4UOCA 3OXFA 4Y28C 4RNNA 5D0HA 2WBMA 3BF4A 4NL5A 1PC5A 1SJQA 1EQ0A 2ADCA 1Q8IA 4CLPA 3D1OA 2CQIA 2NREA 1WC3A 1DY3A 2ZUAA 3SCKE 2B4OA 1S72S 2YPZA 2KM8C 4GKKF 2HFVA 1JNZB 2JHEA 2OAUA 1SVDA 3UW1A 4O44A 2E29A 1S6QA 2F40A 4LQ3A 3S8SA 4LR7A 1U48A 2XULA 3UDVA 1W7WA 5H9EK 4P74A 2MKYA 3F44A 1MWYA 2CRLA 3HX9A 3IR5B 4X65J 4K50A 2Y1IA 3CD0A 5E3CA 4LF5J 2UU9J 1VQ6S 3CD7A 1C0TA 2ERRA 3DGPB 5G0RA 1IUJA 4IOBA 3RYLA 1DTTA 4HDGA 3N28A 4ZKAA 5GAHU 2VG5B 3ZZOA 2ZJQQ 1EARA 1BQNA 4UT4A 3HCXA 3MHYA 3DLKB 2JDJA 5KFTA 2CYYA 3R7NB 3ZZZA 4U6PA 3M30B 3O6QA 2BJ8A 3V4IB 3A3PB 3HZEA 1NK9A 1NK6A 2Y0SD 4NZ0A 2Z56B 3PRVA 4FS2A 3DRXA 4WFXA 3T19A 2OEMA 2HHUA 2CNLB 1ZM4A 3W3SA 2KJWA 4ZPTR 1VQKS 4LBHA 1CQNA 4PXCA 4TU7A 2LKZA 5F8MA 5B7WA 5F8GA 2HVIA 2M70A 4K59A 2QFIA 4DSLA 2BJ9A 1Y10A 4X65F 4YY3J 2XZWA 2MQOA 2W9CA 1RAJA 2YNFA 3OR2A 4LF5F 2UU9F 1UVMA 1U4BA 3M4XA 1KOHA 3QAEA 2RF2A 4ZCIA 1B99A 2PFFB 4Q5VA 4QOTA 1OO0B 5FDLA 4ZN3A 3FVYA 2LXIA 3ZNJ1 3SSRA 4DV1J 2RD5C 2CQBA 4ELVA 2DBBA 1UA1A 3KLIB 3RR7A 2HNDA 2KXNB 5D4NA 5CYMB 3VAMA 2FZGB 3VTIA 3KK2A 1EP4A 3BSCA 1X8DA 1DFDA 2QLFB 2R7TA 2ZH6A 4DSKA 4DUZJ 3BBBA 4Y0FA 1HYSB 4ZLPA 3HHLB 1B7YB 2XGQA 5D4OA 2BOPA 1S4FA 2B9XA 3BGLA 1Q82T 1G7CB 5DG8A 4USUA 3CW2C 2RHSB 4YY3F 3V81A 4A8KA 4NLUA 3D9BA 2X1GA 2EW9A 5BJRA 5JUMA 3EXCX 1U0SA 2IVMA 3CEDA 3MTKA 1RU2A 1LFWA 3PRDA 2HFNA 4KIAA 2E5JA 4FP9A 3ONQA 1S0OA 2IMOA 3MM6B 4UF4A 2F4VJ 1HHQA 2B4PA 2LLZA 2XMKA 2ZFHA 2MQNA 2EFQA 3UN3A 4DV1F 4L72B 1KTVA 3TZZA 4CO3A 3D6MB 2CWXA 4MH8A 4OZ3A 2W8LA 4OV6A 2J5AA 2HK3A 3D0IE 2QSWA 3T1HF 4C7QA 1WSRA 4LQ9A 4DV2F 2C3PA 1WC1A 5FLXY 2O66A 4G65A 1XNRJ 2GCFA 2PA3A 1S7HA 2GA7A 4EWTA 3WQPA 3P6YC 3HT3A 1UVLA 1VBKA 2YNIA 1UP1A 3Q8YA 1IM6A 3GCWP 4XPCA 3HP6A 2MQMA 4XDDA 1QE1A 4WF9Q 3VGVA 3AXKA 2ROGA 1T9WA 4S0MA 4M5NA 1SL2A 2MQ8A 4J9NA 5HANA 3T5KA 4K4TA 2DNLA 3D3CJ 1VK8A 3TVYA 2KT5A 1PBAA 2FQQB 3R5BA 2ZH9A 2EBGA 3SDEA 5CYQA 1HNVB 2C2OB 3TAQA 2V4JA 3K5PA 2XMTA 1X0FA 2OH2A 1VLYA 5DGAA 2HYIB 2KRRA 3UPFA 4W90B 2CG4A 3R6LB 5HMWA 3KJFB 2R8GA 2BANB 4GO7X 3ZZRA 3D68A 1UVIA 2KG0A 3C14A 3HI9A 2XHCA 5FIIA 3UCZP 3RB4A 4OFZA 4EI2A 4IQMA 1S10A 1T9YA 3MEGA 3SIPB 4EUVA 3GTYX 4LR8A 2NZ4A 1SJ4P 2FYXA 2AYMA 2OPPB 1S77D 4Q0BB 1DTQB 2FLNA 4TLRA 3TZXA 2BQRA 3C6TB 4DOZA 1CS4A 2KFYA 2Q79A 2B6AB 2E1PA 1R8HA 1VRUB 1LWXA 4L73A 3PZPA 1WI6A 2HIQA 4OYOA 3RBXA 3G6YA 3F41A 1OS5A 4QPXA 4DEZA 1JLQB 4CLYA 3CJKB 2DNZA 1S1WB 4B3RJ 3VVUA 4MK9A 3JQKA 3QSYB 1T03A 2NSBA 3E01A 1Q5VA 5KT5A 4RUCA 4LT6A 4J5OA 2PMHA 4QR2A 5ETTA 2BE2A 1Q81T 4RUHA 3T1YJ 1R43A 2DGQA 4ILMA 1K44A 4DPYA 1RHQB 4JV1A 3CJRA 2MYFA 4R8UA 3QT8A 3W9JA 3GYNA 1FRMA 3EPIA 3CDBA 1N32J 4HT7A 2JLGA 3M32A 5HATA 1F0XA 4DSIA 4Q2LA 1FRIA 1VQSA 2YWGA 1RDRA 3EZ5A 2XBPA 1OQ3A 1N6QA 1RWXB 4OI4A 4WZMA 2LQ9A 2PI5A 3DMJB 3ISND 4M5MA 2BJ1A 2XEXA 3IR7B 3QAUA 2Z2LA 3GR0A 4WWSA 1RISA 3TJ8A 2JH3A 2JZ5A 2GVZB 3G96A 4ILRA 3S1TA 2WONB 4KO0B 1X4BA 3I0SA 3BGFA 1F9EB 3H5UA 4DUYF 3DRPA 1HKAA 4HHHA 1QVGR 2MDAA 2GO9A 2DO4A 1NKBA 2XLKA 5ETRA 2VPWB 3T3FA 2QIFA 3B4DA 3OXLA 3T1YF 4MFBA 2XYPB 4LSLB 5F3ZA 2PEBA 3A8JA 3N9UC 4X4QA 4YQWA 4NLPA 2YNGA 1OMSA 1Q5YA 4QYZJ 4TQRA 1N0UA 1JLCB 2AJ0A 4W4MA 1UW9A 3KLGA 2HS3A 2FVRA 4UQTA 1S76D 1NZ8A 4NLQA 4ED3A 1VBZA 1REVA 2Z8QA 2PEHA 1O51A 1NZAA 2DIUA 3KUEA 3G82A 5AE2A 1OPZA 4P75A 1RT5B 4H54A 1SIZA 1RTHB 3OD2A 2ZDOA 2O5DA 3OVBA 3P4UB 4UY85 4YEAA 2AHOB 2GFFA 2FGCA 1XMOJ 4RZRA 3J7Z5 5F8NA 1TELA 3GP9A 4B3OA 2EFVA 2AWZA 3GYGA 3W9HA 3HHLC 4PUOA 1XNQJ 3KKFA 2K7JA 3H40A 1L3SA 2R7VA 1S1TB 4DCOB 3VQSA 3MAHA 2JRSA 3OW2R 4MMOA 5K14A 3OFHA 2VB6A 4KKOB 2B0GA 3RRKA 1V5IB 3HVWA 2D1CA 3EZUA 4O3SA 1J5EJ 2KT3A 3OXGA 2V8GA 5IM0A 3R6GB 4UTGA 3CJQA 3P96A 2QA2A 5F41A 4I2PB 3M9OB 5ETOA 2VHGA 5F8IA 4X62J 3DOMB 2VG5A 3KLFB 4ED6A 1M1HA 3PY8A 1S1XB 4DZDA 3T1AA 1URRA 5ETMA 4ANEA 4ER8A 4WCEQ 2RB7A 4IO1A 4JI5J 2YWFA 4NLVA 3MCNA 3N6NA 2R8HA 2IRXA 3GONA 4FN5A 1XMOF 3I82A 3AQPA 4NMXA 5E5NA 4DV5J 3DOKB 2W7PA 3CPWR 1FFWB 1RTDB 2XZDB 3FRYA 2IM2A 3TUJC 4ES3A 1XNQF 3SV3A 4DL7A 2EG2A 4M94A 2NLWA 3JSBA 2XTJP 2CPYA 3KK3B 3C66A 2UUCJ 1D3WA 3V6HA 1L3VA 4ELUA 2VG6A 5L8RC 2MQPA 1EAYC 4ENOA 2VFUA 4KFBA 3H25A 3HFZB 4BWMA 4XK8C 1J5EF 1JLEB 1R7IA 1FJCA 5F3TA 1TKTB 1RAAB 4USKA 4NZ6A 1SV5A 4JI1F 2RMLA 4YR2A 2M5YA 4J9VA 3DLGA 4NRUA 4MKBA 2A18A 1RT1A 1GMWA 3M6WA 3BO4A 1MNEA 2MGZA 3QNWB 2KRBA 2A1BA 1VISA 4K4YA 1IBLF 2HBRB 2RT3A 1DQAA 3JQJA 4IOAQ 4TKTA 2KZMA 4M8LA 3BEGB 5BYSA 4KHRA 4P52A 4JI5F 4M5GA 3J81j 5CYMA 1TFYA 4L75A 1H72C 2ZZNA 2Z2YB 5E3QA 1OSCA 9RUBA 1YJ7A 3PIPQ 2HRYA 4DV5F 2JWNA 3S7RA 1S9FA 4A8QA 3FEXB 5B0FA 3PR4A 4NEZA 3H2UB 4J9UE 1HYSA 1RADB 3DLJA 3FZBA 4WTOB 2UUCF 3MDFA 1JJHA 1OY6A 3K59A 4ECYA 5A8WB 4GVBB 2CZ4A 2RRBA 3QO9A 2MXYA 2UV8A 1CC8A 1E6VB 1OPIA 1T9TA 3H2VE 1MN7A 3HD1A 2YKAA 3R3TA 4I56A 1RTJB 3U27A 2CQ0A 4ECTA 3MM6A 2X3DA 3VZIA 5HI7A 1N88A 4OHWA 1U1RA 4WU2A 2IA6A 3D0HE 3OTDA 2P8IA 4K4SA 4M95A 1XBWA 4ZJLA 1IR0A 1FEHA 1XR7A 1S49A 1HI0P 1LWCB 4P7VA 4LRFA 2ZBQA 1LW0B 4IFYB 1VBYA 3TANA 4LF2A 2KI2A 3OBIA 2XB2D 3ILOA 2V8DA 5GMKa 2AJ4A 5KFFA 3Q23A 4PG4A 1VYAA 4F2SA 4OX8A 4ZHRB 5DGBA 1H3DA 2GW8A 5T7LB 3GG0A 4AYBD 3FGVA 3SXLA 1UFKA 3PV8A 2CPFA 4NEYA 1TL4A 3RJMB 4WTYA 2OP5A 3CDAA 4K4ZA 3Q2TC 2AJFE 3PYEA 4NPOA 4R5PB 5BYQA 1U1PA 5J2NB 4DV3F 3M9NB 4DJBA 2XO6A 3DLEA 3ZZYA 3I6PA 3J7A1 2L9WA 2J6TA 2HHVA 2RRNA 2ZD1A 4ZP6A 4WPAA 2UUTA 4FXWA 1FKOB 1KKHA 4OI2A 3UD3P 4C9DA 4Y6IA 3K5MA 1VQ9S 1VQ4S 1JX4A 4RBTA 3BN7A 3THPA 3UR3C 4JI0J 4B08A 5GAGU 1AXQA 2ZNZA 1T0TV 2BANA 1UJ6A 1GFWB 3OL8A 1PJ7A 5IQQA 3W2WB 5CABA 2XMWA 3DCAA 1ZETA 4HHJA 2K1RB 5KFUA 1VJQA 3HJFA 5KG1A 4EBCA 5CCMA 3QFHA 2AV5A 4L3KA 1DTQA 1FDAA 3PFOA 3C6TA 3BH7B 3M8QB 2B6AA 1IR2A 3NY0A 2QLBB 1F5AA 5F9NA 2ZH1A 2OPRA 1VJWA 4NX9A 1APSA 2YKPA 3L09A 3DC2A 4C4WA 2YVSA 5KFDA 3CJKA 2F4FA 3AB2B 1O8BA 2DKOB 4DS4A 4DV0J 3ZZUA 5T14A 4XTTA 1S97A 2C2ZB 4JI0F 2C42A 1QAJA 4CH7A 2LEAA 2LFVA 2E66A 3AA9A 2KYXA 4I6AA 1RT7B 1IKVB 4P2MA 3TUZC 2DO0A 4YFUA 1ZM2A 2DCUB 5L1LA 2X51A 3CC4S 5J2MA 3MEDB 4DL0C 3NMRA 5LT5A 2V9KA 4LR9A 2E5LJ 3GIRA 5I3PA 3P45B 1R6VA 2YWWA 1NH7A 2X1FA 3CNQP 1Y5NB 4YB5A 3A1YG 4B9LA 4G1QB 4NCAA 1FK9B 3DMJA 4J91A 3A13A 1SB6A 4B9TA 2DY1A 3CCRS 2CKWA 1UWAA 2GVZA 2CPXA 2ZHAA 1ULRA 3ENAA 1VFJA 2IRYA 2V5HG 3DYAB 2E1CA 4N41A 3TR5A 4ED0A 2Q3PA 1IKXB 2VFTA 1H2TZ 4BLGA 3LP2B 4ZCMA 4DR5F 3AJDA 3N4WA 4OX9F 2CG8A 1SC1B 4CM2A 2XSFA 3WIUA 4DQQA 2KDOA 2ZBRA 2XS5A 4J9MA 2OIHA 4JI6J 1TVRB 2DJWA 2ZITA 4NI2B 1BD6A 3DRSA 4B02A 4PG8A 2PD1A 1NJWA 1Q16B 4JI7J 1REGX 2V68A 1QTNB 4I1TA 2M88A 4ZVUB 2E5LF 1B70B 1JLCA 1TMMA 3K8WA 2GQQA 1ZTWA 1X4FA 3GJTB 3MFHA 3POTA 1S12A 5HMZA 4WFYA 2RKIB 2C3UA 2A2CA 3M8WA 2VDIA 1S99A 2DTJA 1WD6A 4C11B 3I5BA 3G6ES 4OZJA 5HQMA 3N0VA 2HS0A 2VA3A 1RTHA 2KKHA 2YNHB 4USWA 1M5OC 1R8BA 3OTOJ 2RUGA 3NCRA 4ZP9A 4G3IA 4E8UA 3PM9A 5B0CA 2AYGA 1WHWA 3PNIA 4NA1A 3D5MA 5KFYA 5J1EA 2DYAA 4GC6A 4QIFA 4K5RA 1AFJA 3RW6A 2CQ1A 4YHHJ 2UV8G 5HROB 2KJVA 1TR0A 3FBFA 1S1TA 1F2HA 3CJTA 3Q8QB 4CO1A 2R7SA 4CLUA 4D3GA 5B09A 2YWKA 4JI6F 3LAMA 1FNOA 2AEMA 2VBXA 2EEYA 2GQCA 3ITHA 4CRJA 2HBYB 1XEZA 2BM0A 5IWAJ 1HWIA 1GX5A 2E1AA 5F0UA 3MM8B 4J9OA 1CPZA 2HWTA 4I2PA 4PG6A 1DZ5A 2GAHC 2QL9B 3G8SA 2Y8WA 3DOMA 1GTEA 3BS9A 2B5JB 3JSMA 1S1XA 3MAAB 3NBPB 3MEEB 1DLOA 2NXEA 5AXLA 2WHOA 2V2VA 5LOQA 4DL3A 3OTOF 3UNGC 2MLXA 4U8VA 2HGNA 1FD8A 4FXDA 3MTJA 3NCPA 2Z58B 1WOOA 1Y4ZB 2EC0A 2CNNB 3CCVS 3VALA 1LK7A 4A8OA 3HVRA 2FY1A 2CQCA 1UWBB 1K0VA 2M4MA 4ECVA 2G9OA 4MIWA 2DHHA 4PWWA 4KQZA 2UXBF 3MZIA 3H2LA 2C3MA 3TUIC 5IWAF 4RW7B 4DUTA 2G2YA 4NMLA 3K57A 1HPZB 4ZVPB 1JLBA 4USHA 4F02A 1NNDA 3MPWA 3TA2A 3Q8UA 2XNRA 4M5JA 2J9CA 3D4JA 3PXGa 1SJFA 2BUNA 2OPQA 4MAKA 1I94J 2PA8D 2AJ2A 2C28A 2LVWA 4OL8A 1K8AT 1I1GA 3H4DA 2W8KA 2GV1A 1AFIA 4UQGA 5J2QB 1GK8A 1TL3B 2ZKTA 2B56A 3DI6B 1UVKA 1S9GA 1T9UA 4DL6A 2AYBA 5GADU 4I7FB 2CNKB 4WJBA 3UNYA 3IWLA 2FD2A 3ENWA 3KNGA 5DETA 2ZH2A 1UZHA 5KFMA 1E6VA 2W9BB 5D6GA 2HQ3A 4CP5A 3RG6A 4UOHA 3UR0A 1H2UX 3J7AN 2HWIA 1A0OB 5JJBA 3GV5B 3QATA 5HQ8A 1PILA 1RTJA 1YBUA 1DRZA 3MUMP 3C15B 2BQUA 3NS6A 2JEFA 2DNMA 5M2PA 3M8PA 3OL9A 1FEEA 3H98A 7FDRA 1MMNA 1HR0J 3CCQS 1LWCA 1CJUB 1NM2A 1LW0A 3X1LB 1U45A 1PYOB 2DXFA 4FXVA 1SJ1A 3NGRA 1TV6B 2ROEA 2CPJA 1FESA 3RR8A 2AMCB 1LK5A 3IGNA 1BC6A 1VHFA 2X1BA 5F9LA 2BYCA 2XYHB 4DR1J 4LVOP 1LW2A 1AT1B 2HIYA 4UY8T 2DB1A 4DR3F 3VF0B 3QRQA 3VGSA 2F8EX 2GNKA 3J7ZT 3BKFA 4E0DA 5K8PA 1LWEA 2DGOA 3DRRB 2BACA 3PKYA 4LF6F 3PYGA 4DQRA 5F8JA 3MFIA 2XSJA 3U7JA 4PRFA 4HVZA 1P1TA 3SCLE 3KJVB 4J9LA 3FDSA 3LGHA 1YKWA 1RA6A 3IWXA 3D6TB 1MW7A 4ZS6A 2G2ZA 1FKOA 1TL1B 4QIVA 2XQCA 4ED2A 2IRUA 5HAOA 3LTOA 1N56A 1QD1A 2E9ZA 3C46A 1HR0F 3OUYA 1U8WA 3DHXA 1D9DA 5THWA 2I6WA 1HHSA 3BQ0A 1J2VA 1YGYA 2JLEA 3FSXA 4K2XA 2APOA 4AFFA 4BBYA 4PXBA 2ILZA 4W92B 2YX7A 4RL1A 1O0PA 3W2WA 3MD1A 3F56A 1Q1KA 2K1RA 2RDJA 1PYTA 1IJFB 1VRTB 2VPYB 1UPPA 4RR5A 3DM2A 3R97A 4DFKA 4AE5A 4ZVHA 4DLGA 3N01A 2AF6A 3U1MA 3MUTP 5KFHA 4YUDA 4ZPCA 5IFMA 4KGMA 2J7UA 1BHNA 2DRBA 5HO4A 1NU4A 4ECWA 3GV8B 2DHAA 5KT3A 2WZ1A 2CQ4A 4M5IA 2F9JA 4A8MP 3HULA 2NZCA 4F3MA 1N34J 5L9XA 2F3JA 4DCJB 4DU7A 4N8OA 1RHMB 3EGWB 4C8OA 2HEKA 1JXLA 1KQSR 1T05B 4X4RA 2HSEB 4WYLA 4XIUA 4IFVB 2POKA 4PYAA 4BDPA 1RT3B 1F3VA 1NXIA 3FRZA 3UCGA 4HACB 3UDCA 2WBRA 1KQKA 2PN6A 1G6BA 1FJEB 3MEDA 1Y3JA 5K8OA 2NXJA 4MYUA 4X84A 4ED1A 1SL0A 3F0NA 2VQEJ 4DPOA 1PCAA 3OSPA 2V67A 4G1QA 1HQEB 1NJZA 1Y9OA 4B9VA 4UW2A 3P49B 3TQ1A 2HHPA 1K9MT 3OLAA 5C24B 4RUAA 4KSEB 4MKYA 4KGVB 3DYAA 3NEKA 2RSQA 1TUVA 2YWEA 3GB0A 2UUBJ 1E6YA 1N48A 1CVJA 1IKXA 2BJ7A 2R7WA 2K06A 4WE1A 4XAKA 3LP2A 1PG5B 2XY7A 3AT1B 2Y1LB 3H59A 2FGOA 2JC1A 2Y3YA 4DHVA 1CJKA 3MM7B 2I1RA 4WK3A 4HH1A 1IKYB 2MZRA 4IRCA 3K8VA 4NI2A 4HKQA 4C6AA 4ZPWR 1HNZJ 2PO4A 2RS8A 2WVDA 7AT1B 4ZJQA 2W01A 2BA9A 3VAIA 2CJBA 2HHHJ 1GXLA 1VQ8S 2VQEF 2R7QA 4C8YA 5K5MA 1YHQS 3M6XA 4RX6A 1P9QC 1BWVA 2D3OR 2ZJPQ 4CLTA 1VC0A 3OTBA 1S9EB 3CD6S 4W98A 3JAMU 3PO4A 2D9OA 3DGVA 2CNOB 3R8YA 5GAEI 4NLXA 4C11A 2QV6A 2DNPA 2IJNA 1VCTA 1B0PA 3GG1A 2GJFA 1XTZA 2UUBF 3B82A 4K5SA 1J5OA 1JLGB 1HHTP 2DR7A 1RE1B 2DK2A 5DLGA 4Q44A 2RQCA 4LFBJ 3MEKA 4DQSA 2XCPA 1HNIA 4NLYA 1H38A 5KAKA 2MQLA 1A6LA 1JLAB 3K7RA 3MMCB 2ILYA 2VD3A 3DLHA 1KFSA 2D3ZA 1HWUA 1C1CB 1XMQF 1CULA 3FJ2A 5GVQA 3GJQB 4QWDA 1KD1T 1WI8A 2R3VA 3Q0AA 4WK1A 4EEYA 3NOGA 1RHUB 1AYEA 1IM4A 2R42A 5EUHA 5KG0A 1M1GA 1NJXA 2PIIA 2HHHF 1T94A 2AD9A 3LGMA 3J81U 2XMJA 1IBKJ 3FEZA 3VGTA 2IC3A 3H5SA 3FNNA 4WKRA 4X4OA 2VPXB 2B5JA 2H51B 3FC9A 2UXDF 3BSOA 3NBPA 2JEGA 1X31C 3H5YA 1NKCA 3EYZA 2FC8A 4J9SA 4CH1A 4QWAA 4ANCA 2QG9B 3PJXA 4IH6A 3SBMA 4PQAA 1VR6A 1U6ZA 2N7YA 2GHVC 3H0PA 1RAIB 1FXRA 2VFRA 4RW7A 4LF1A 2N3LA 3IFEA 2LA4A 1IBKF 2M7SA 2RS2A 1WJ9A 2PSZA 1T3NA 1HMVB 5KG7A 2OFHX 3KK1B 4N5SA 3HSDA 3Q2SC 5DS7A 1JLFB 1Y11A 2BKNA 1Z4UA 2LA6A 2HG4A 2AKWB 4DPTA 5L46A 1ZAXA 4IDKB 1YZ7A 4QWBA 1RLCL 5KOWA 4HTJA 1Q86T 2YH1A 3UQSA 2E1MC 3VHQA 4O3NA 2WVBA 2LXUA 1U25A 3ZTPA 4G1PA 3QIDA 2XYGB 2HFSA 4C8NA 2LQBA 4XDCA 1R0AB 2EFGA 3EDRB 2GX8A 4ED8A 1IR1A 5KFPA 5A8KB 4N76A 5D77A 3ISZA 4OYMA 2F1FA 1MU2B 2BMBA 2FC9A 5CZVA 4C2MA 2RAQA 2W9BA 3KHLA 1HBUB 3V6KA 2JL9A 2MJUA 3FQLA 3UDLA 4H4KC 3W1YC 2FDNA 1FKAF 3U1NA 5EGYA 3QPIA 4KAIA 4KBIA 3C15A 2M3DA 1RAGB 2ZHOA 4DX5A 3HZGA 3I96A 1C1BA 2DNRA 2EFPA 2G0JA 1H6KX 4A8WA 4Z7YA 1V3ZA 3CJ3A 3GPAA 3LANA 5ETNA 2JJ4D 1W2IA 4Q43A 1UCNA 3IRXA 4RLEA 1RCXB 3QGPA 1WKLA 4DQIA 2HGMA 4JBCA 2MB0B 1KEKA 2XZTB 1TV6A 2HBZB 3I56S 3BR8A 3CCZA 4OLOA 3KLHB 1HNWJ 3HKWA 1R31A 4LF8J 1ITPA 4IO9Q 2XNQA 4J37A 4ZP7A 3H5XA 5HQLA 2HHSA 2ZE2A 4FNIA 3CC2S 2AU0A 3CUNA 2D74B 4YN3B 4LSNA 2XO7A 2C1EB 4OHVA 4B9MA 3I0RB 4I68A 4C0BA 3HLUA 3AD9C 3DRRA 1YTYA 1BE4A 4YS2A 1O6XA 4ZVEA 1S6UA 2DEJA 2VDHA 3BGRB 4PQUA 3ZNUA 2OHDA 3Q8PB 3IWNC 4PXDA 1FVSA 3CXCR 4QWCA 4KGZB 1Q7LB 2LECA 2BJEA 4QYRA 4DG1B 2D41A 1A7GE 2FZCB 3ILIA 3TVKA 3MMBB 4UUWA 2VF3A 4RW8B 3J7YI 2CFXA 3R9LA 1EX8A 2CQPA 3CCES 4YB7A 5DM6Q 3FBEA 4Z7CA 1Z2LA 2C22A 3C16B 1H7XA 2G2OA 1UEKA 4QR0A 2YKOA 2IM0A 2HKEA 4B3SJ 3ET6B 4DPWA 1L3UA 1N5VA 4DMZA 2OO4A 2BKOA 4P2FA 2L41A 1NO8A 4G1IA 3BM7A 4QIEA 5HMYA 4KV8B 1TL5A 4F3OA 3P3DA 5EWGA 1WF0A 4F4ZA 2P6TA 4F4KA 1Q78A 1NJYA 2ACYA 1JIHA 2XS7A 3NGTA 2FIUA 5BXIA 4DSFA 2RQ4A 4ZMMA 2PDAA 2QMUB 5E41A 4ZPBA 1T05A 2Z30B 4BHQA 2XY5A 3MCSA 3Q24A 5HVHA 1TKZA 4A48A 4WYWA 4LBPA 1DAXA 2J8AA 5LSOA 1S0MA 1PJ6A 3C8YA 4QW8A 4HACA 2RRAA 4NE9C 3M8RA 2ZEJA 1ZOTA 2R2TA 5HBMB 3JTPA 4ATNA 1P6TA 5DQGA 1SUQA 2P9CA 1QY7A 4D3HA 4B3SF 4X2BA 3QQCD 3L7PA 3EJMA 2IYGA 3ILLA 2UUAJ 4IR1A 2X3GA 3AJ2A 4NYPA 5D0EA 1SKUB 4F4AA 3M9MB 1ZYQA 4B9UA 4WXOA 3T9NA 5I42B 2C2NA 2UVRA 4NLDA 3KJQB 4GVLA 2VBWA 1NDCA 5M2RA 4K2JA 1JXVA 4USVA 2ZOMA 4YDDB 2KT2A 3DDIA 4J7CA 2AJ1A 4QWEA 1W25A 7FD1A 2ZH5A 1DQ8A 2FUG9 4DF4A 1IKYA 2BOAA 1WKJA 1G2EA 2C2KB 2VKZG 4IRKA 3VWSA 1NSQA 1KLMB 2B4VA 1NUEA 2OD4A 3M6VA 3W8PA 3VAFA 1NK4A 8ATCB 1RB0A 5A6PA 3NG8A 2XWYA 2UUAF 5H9EJ 1J27A 2MZQA 6FDRA 4O0IA 2DPJA 4H4MB 2IAJB 3UD4P 1TK5A 2AZ1A 3V2UC 3EVOA 3PR5B 4DL5A 1VQPS 1T7PA 4EZ9A 4HYKA 5IT0A 2WW8A 3CC7S 1VIXA 1FDDA 1N5TA 3DOLB 4TXSA 2V0NA 1RT6A 2CQHA 2DH9A 4Q8EA 2IM3A 4DU8A 3V6DB 1JLGA 3FCVA 2W4DA 1CG2A 2ROPA 1HW8A 1MSWD 1ROFA 2EKYA 2XC9A 3MMCA 2O1PA 2VZ9A 2W2PP 3KYLA 2V6AA 4Q8FA 3O44A 3OL7A 4OMFG 5L1JA 2E7WA 1SC3B 4JV2A 5DO2A 1LWFB 2QJ3A 1U6BA 2FZKB 4N77A 1N8RT 4OJGA 1RK8A 1UVJA 4Y3CA 2EG1A 2CZVC 2WAQD 3UVJB 5SUHA 2DXDA 1KONA 4OYAA 3W63A 2VFSA 4YB1P 3Q22A 2HFZA 3LP0B 1OYEA 1ZA1B 3PW4A 2JEIA 4F25A 1IBMJ 1NBEB 3NNCA 2VH7A 4RPFA 2HAFA 1IN0A 3FMBA 4X64J 3D67A 5LSLA 2V63A 1W2BR 1WG1A 2LMIA 3U1LA 4K8RA 4KT0C 3W2VB 2LYVA 1LFPA 2IBOA 1UA0A 4KH1B 4KGXB 4P10A 3VVTA 1FHTA 5KFIA 1HQ2A 1S7IA 3K5LA 3T5JA 3HPOA 3OFEA 4K4WA 2J0XA 4ZVTB 4IRDA 4I2QA 1XC9A 3BGUA 3A12A 2GO8A 5AE3A 3QRPA 2WOMA 3CB4A 1N5YB 2HK2A 3O1LA 4O3PA 1QM9A 2I5JB 1KP6A 2DITA 4C0HA 3SQOP 3T5LA 2FB0A 3G86A 3B4MA 3IRWP 3IG1B 1WACA 3OV7A 5C42A 4C8MA 2BM1A 3KK1A 2OSRA 3LQVA 4F0KA 2WTFA 2X1AA 2J0QD 4DXLA 2YBVA 1IBMF 2I38A 2KXHA 4IDKA 2P2CB 3GLJA 1TTHB 2CXEA 5DDOC 2Q1LA 1U1MA 4CT9A 3CSKA 2BXJA 3BGOP 4X64F 3CJ5A 3IC1A 1NPRA 1I6JA 4OYXA 3WHIA 3DXBA 1M5VC 2RQMA 3OR1B 3BDEA 3OJUA 2YKNB 1MN9A 1D09B 2IJRA 5C5JA 1F6TA 2HPUA 1LOUA 4F4YA 1U2FA 2JLFA 1NK0A 3OLBA 4PXEA 1XWLA 3V5RA 1GXUA 3Q8VA 5D8HB 1DJ0A 1X5TA 3VGUA 1VMBA 1ZS6A 2ASLA 3DLLQ 4NCGA 4WFNQ 2FHJA 1HBUA 1FJGJ 4DS5A 3T1HJ 3F73A 4DV2J 2VASA 2BV3A 2DGWA 5C25B 4M5KA 1OQ6A 3RAQA 1D9AA 2UVWA 1RKJA 5HLFA 1YJ9S 3RB0A 5MAOA 2CJYB 5AT1B 1UFLA 1FF2A 3AD7C 4QR1A 4DV7F 1KR4A 4LREA 4X4VA 2WK4A 3SQGA 2HNYA 2IHR1 2GGPA 1NK8A 2Q6BA 2XCAA 4OHYA 1LXNA 2VC1A 4LJMA 4ZPAA 2CPHA 3HFKA 1Q8LA 1NSPA 4KHPJ 4DPUA 3KWMA 3A8IA 4OJ3A 3DRYA 4NXNJ 3I0RA 4LF4F 3HVTA 1AUDA 1FJGF 4GRSA 1KQGB 2Z4PA 4GC7A 3G87A 1RQ0A 3M8SA 2E5HA 3CF5Q 2OSQA 1YDLA 2VONA 2R8IA 2HFOA 2JOQA 3NAHA 2KVIA 2KG1A 5IOLA 4F3QA 1Y3KA 3M8YA 4RW9A 4QPTA 5B0EA 2FJVA 1VBXA 1RHKB 3MXHP 2JVRA 1WDDA 2V8VA 2GC8A 4XPEA 5DDRC 3C2PA 4YB6A 1T9XA 4ZVGA 3A8KA 3EZOA 1OWXA 3C16A 4BC9A 1X9MA 3KDOA 3MM9B 2B4UA 2Y8YA 1RHRB 3M2RA 2VFVA 1T11A 4A8FA 1RZMA 4LIWA 3KHRA 4KHPF 4LFAJ 4BC7A 2D7SA 4RNOA 3IGVA 3UO0A 2W9AA 4NXNF 4KV8A 2I8EA 3I31A 2FJWA 1HBNA 2XGPA 3CWJA 1OIAA 1KN6A 1HWLA 1SCJB 3BBCA 2HW3A 3BB5A 3I4HX 3TAMA 3NWRA 1S6QB 2LP4A 4O3QA 2GS8A 2PFDA 3I55S 1RJJA 4QW9A 4ZOSA 1KLNA 3QJLA 3EGVA 1NHVA 2QT7A 3W5YA 1KDNA 2BW2A 2QEXS 3QLHA 2LEPA 1NB7A 4FVCA 4CO0A 2PT0A 4JV5J 4FPRA 3B6BA 1FI4A 2MKIA 3EX7B 4DR4J 3IM8A 1ZZFA 5ETSA 5G0RB 3G6XA 2K3KA 4DUYJ 1DTTB 2KB2A 4FZVA 2W4PA 3NS7B 4ZIWA 1I5OB 2C2EA 5C2CA 2D3UA 1BQNB 5LMNF 1NPPA 1L3KA 4LFAF 2V2KA 4PG7A 1SQGA 3TA0A 3SSQA 1U1NA 4P2XA 4Y65A 3IAS9 2NUUG 4CQ1A 2G0IA 3MF5A 3PHTA 3TI0A 4RW6A 1N36J 3HF5A 3OTCA 4OYZA 4DN9A 4NLTA 3HM9A 4WP9A 1KWMA 4UUXA 3OSNA 3RTVA 3THVA 5EWEA 2O67A 3PW2A 3JTOA 4CTAB 3AD8C 1H0HB 1TL7A 2XMUA 1EQMA 2L9NA 3MECA 1BGXT 4JV5F 3H4BA 4ZVOB 3R5DA 1UTAA 5KG3A 2YNFB 4DR7J 2GIFA 3OR2B 1M1KT 2UUWA 4FYVB 2FTRA 2FJDB 3CCTA 4DR4F 1P9YA 4KE5A 5DQIA 1AA1B 1RSCA 2E9RX 5H9FK 3SV4A 3QZ7A 1RWPB 5F8HA 2Q6CA 5IV3A 1RBLA 2HNDB 1EETA 1S1VB 3PJWA 2QMXA 4LF7F 3LWMA 5RUBA 3KK2B 2IAJA 1EP4B 1N5SA 4ERDA 4LFCJ 1CQMA 1DARA 3FZ2A 2J0WA 1YQHA 4J9QA 5KT4A 3PX4A 2AGPA 1KTQA 2E44A 1N36F 5LJ5Y 4WFAQ 4TYAA 2B9EA 1RAHB 1YG0A 4ZPVR 1ZAWA 2OTLS 4DQPA 3PG9A 2E1RA 2JEJA 4WBFA 3W66A 1U1QA 1ICEB 4NLWA 2YPYA 3DOLA 4P6QA 4JI2F 4MKAA 1S4EA 4PWDB 2O3DA 5KG4A 1WOSA 1FTRA 3V81B 1JMTA 4DI6A 4DR7F 2DGXA 4WIIA 3SEOA 3V6JA 5D15A 1IQZA 1GX6A 4U96A 2IFXA 3K2YA 5KFZA 4RO0A 2GMLA 4UZBA 5ETLA 2JNJA 3NNHA 1HIYA 1M90T 1CC7A 2ASYA 4RNHA 1G1XA 4IUFA 1V3RA 1SKWA 2RQKA 1MWZA 4PPDA 3UVJA 4LFCF 5A6WA 2GJIA 2DNGA 4LF9J 4FVMA 3LP0A 4C0OC 5E3AA 3EVMA 2KZZA 3BYRA 1RAEB 4F04B 2JFKA 3T6JA 1K73T 4ELTA 4JI1J 1B0VA 3TARA 3ZC4A 4CLSA 2JC0A 3DGPA 2J9DA 4B3TJ 4OI3A 1SKRA 2DH8A 1XMBA 4C98A 4AXIA 3SCJE 2IIHA 4N56A 1Q95G 2ZVIA 4L6V3 4WFBQ 3W65A 1IBLJ 1RU1A 3W5ZA 1QE1B 2CQDA 3IP0A 2NYIA 1U49A 3T41A 3FSYA 3DLKA 4USJC 2KL8A 4CYUB 3M30A 2ASDA 1RTZA 1N5YA 3TYTA 3V4IA 1F5CA 3D1HA 3TAPA 2OELA 3SDEB 2RHQB 5MLCV 3CJ0A 1DQ9A 2WCXA 2R8JA 1C4CA 2Y1RI 4RNMA 4JYAJ 2WB1D 2HRTA 2ZH7A 2XS2A 2ABYA 1NDPA 3K5OA 2DGVA 2MY7A 4LF9F 4RWXA 1L5UA 1NLKL 3C14B 2BQ3A 2CQ2A 1RHJB 4BCAA 3P8BB 3FQKA 3KNAA 2AYEA 4PWUA 2XLJA 1T3OA 5D4LA 3L95X 1PKUA 1VOMA 1JNRB 1SC6A 4B3TF 5A76A 3OR1A 2QSFA 2B8PA 5CHCB 3WX4A 1RAFB 3CTRA 1HLWA 4P71A 1CS4B 1U7LA 1QAXA 2MJNA 1D8YA 2GHWA 2DHSA 3FK4A 3A3OB 3KLIA 3UWTA 3B8HA 2BKPA 1D1UA 3MURP 3OHBA 4U7UD 3NAIA 4EYIB 4NLSA 2R7XA 5HVGA 1RLDA 3OVAA 1T03B 2PC6A 1VRQC 1RABB 4RBVA 3E01B 4JYAF 1SC4B 3TNVA 3JTNA 3HHLA 2N3OA 2K2PA 1TK8A 8RUCA 3JAMY 3WBZA 5KG2A 2BE9B 4FYYB 2GQ2A 4M1KA 4KHMA 1WSVA 5KT6A 3CCJS 2ZC3A 1FXLA 3M32B 2YY3A 2RVJA 2SXLA 2NXCA 2QO3A 4EU0A 1RWUA 4DV3J 3RBDA 1N6QB 5LL6d 1JQGA 3W64A 1VQLS 2OD6A 3QYYA 1HWKA 2A6OA 4HHUA 1RACB 1ELOA 3OT9A 1S0NA 4C8KA 3VQTA 1RBAA 2YTCA 3NS5A 4TYBA 4EFAC 5FJ4A 4OJ1A 5CH7B 1KQFB 3ULHA 3VAHA 3I5CA 4OX6A 5KOXA 4AT1B 3IBWA 1AZSB 2FHOB 4ZVSB 4AUKA 2LEBA 1OYDA 5D78A 3M1VB 4ZJOA 2CZ9A 2QL5B 5IV4A 1BLUA 1LXJA 2IBKA 2N82B 2HZAA 1P1LA 5IT9Y 3IR6B 1KC8T 4CO5A 4DX6A 2BVZA 4IG0B 2LDYA 1IVZA 2JVOA 1R0CB 4IH5A 3ZFVA 3KLGB 2H5JB 3P5TL 1PIEA 1XR6A 5KFSA 2XI3A 2YWHA 4B17A 3BKUA 1REVB 1SIWB 4PYDA 3TWZA 3RZAA 4X4PA 4CNYA 3G82B 4IG3B 4NYOA 5I3UB 2LU1A 1HNVA 4ZK7M 2GMJA 2DGSA 5IZHA 4AL6A 2W2MP 1CJTB 1F2GA 2H1YA 1RA7A 3GIKA 4WZQA 4M5HA 2ZUGA 5LXRA 5GAEU 2BX6A 4B3OB 3LAKA 2F5GA 5E0OA 4PUOB 2KH9A 2MQQA 5A2QU 1VDHA 1VC5A 4NZ7A 4F67A 1JK9B 1BY9A 1NSKL 1KRPA 5I4MA 5GMEA 5K14B 4DSEA 4LRAA 4Q0BA 2OPPA 3SSSA 3Q86A 2KTQA 1HARA 2GZOA 1BWEA 5ETVA 3D66A 3RU0A 1KSPA 2NS1B 3GE9A 4TN2A 4DV6J 1VRUA 1D8ZA 1IWGA 5IM0B 2OEKA 1QAYA 3J80Y 3KDNA 1RTIB 3KG4A 1NPKA 2G4BA 1PO6A 1FX4A 1WNEA 2WSEC 1QAIA 5HJYA 1JLQA 3FFIB 2MZSA 4OZNA 4ZITA 5KG5A 2N7CA 1S1WA 3KHGA 1QSLA 2GJ2A 3FMWA 4F50A 3KHHA 2DPIA 3KUHA 4OZ0A 3HK2A 2B51A 3QWPA 4DR5J 1WTBA 4OX9J 5D0GA 1Q7YT 5L1KA 3CD5A 4KJIA 4QBUA 3VAKA 5K8MA 1YITS 1YRXA 2D9PA 2V8HA 1UMJA 1JJ2R 2QA1A 4IKAA 1Q4RA 2PI4A 2BBEA 2IJFA 2OPSB 3GIIA 1LQ9A 5ETPA 2BJ3A 2EKNA 3AODA 2V94A 1V3SA 2NXNA 2R8KA 4CTAA 5DG9A 3PCOB 2VG6B 2QC3A 4EZ6A 4OYWA 2RUSA 4KFBB 3EUNA 2ZNYA 3HT0A 5KFBA 2M2BA 2FJAB 4DV6F 3Q8RB 1SV5B 2UVUA 3DLGB 5IC6B 2VJUA 2WONA 4KO0A 1RT1B 2F8MA 3VAJA 2MGZB 1BXNA 3MMJA 1D0EA 2UZAA 4ANDA 4AL7A 4ECSA 2J8SA 2HBQB 1VGYA 4EMDA 4HI2A 4C3LA 4KYZA 1C0UB 3UE2A 1M5SA 5HJXA 4YOEA 3AFGA 1X4GA 1UVNA 1S1VA 5LSRA 4DFMA 4CO4A 5T41A 5EDWA 4I4BA 4LSLA 2MPUA 3GQCA 3CO0P 1CJVB 2V69A 3BPDA 2OMOA 2K3IA 1CEZA 3NGDA 1I3OB 1VQOS 2H48B 1YJRA 4ETZA 1SBRA 2IY5B 2HVEA 2QE5A 4OZ2A 4ZPDA 5BYRA 1UEUA 1LKZA 5KFKA 3D6HB 4PWDA 1FNMA 1UFWA 3QO9B 4QU7A 4QZVB 3HO1A 1UJ5A 2EXUA 5L1IA 1GQEA 1RT5A 2XWXA 2CPEA 3OFGA 4NLRA 1X4EA 3GILA 1S79A 2HS4A 2HVDA 2MKJA 3MR3A 3DN9A 1F5BA 1U2CA 2P9GA 5J1NA 1FT8A 2QFJA 3BBFA 4ID5B 2MKKA 3UFCX 3DKDA 2ZOGA 3JYTB 4USTA 4ZVRB 3ZTOA 2IA0A 1Q8BA 3MWBA 3SFGA 2R2RA 4MK8A 4IOCQ 2O01C 1R89A 1PJ5A 5B0BA 2DR6A 2I2YA 3IBCB 4KKOA 3GFZA 2H4WB 4X4UA 1SQFA 4ETXA 4DUZF 2QX0A 2UXBJ 3LO3A 2HQCA 2G13A 4I6WA 3DU5A 4YDXA 4QIWD 2AW0A 3MOJB 2ALYB 4Y2AA 2CQ3A 2AZ3A 2IPOB 1TUGB 4C8LA 4DR2J 3AHPA 3MR2A 4PR6A 3QFWA 3KLFA 3PW5A 4HDHA 1F60B 3FBCA 3UD5A 2DD8S 2NUHA 4U9RA 4ZDNA 5DG7A 4ED5A 3EDQB 1NMEB 2GIRA 2DY9A 1S6PB 2OMLA 2CQGA 4CYUA 3DLEB 1AUSL 1U09A 4QIGA 1FO1A 2F4VF 2HZCA 2ZD1B 1HD1A 2H65B 3M7VA 1ZM9A 3DOKA 3IMQJ 5JVGQ 2J6UA 1RTDA 3ZO7A 3ENVA 2W24A 1WKKA 1YIJS 4TY8B 1X4CA 3R5JB 3KK3A 3TOQA 2YX1A 3R2CJ 3IBFB 2FY8A 3T6BA 1I51B 3KOAA 2QTWA 5C7PA 3EXYA 3MPUB 2ZJRQ 1BQXA 3EGZA 1K0TA 2LXFA 2XHWA 4FKXA 6AT1B 1JLEA 4FF1A 1YRTA 1TKTA 5HMXA 1V9OA 3R5CA 3J7YU 2W4CA 3M2UB 1XNRF 3AOBA 1FWKA 1FA0A 5B0GA 3UN5A 1NCLA 3RGIA 4DR2F 4R0EA 5CCLA 4ITSA 3ETMA 4L3NA 4DWIA 1VK3A 2R9LA 1F1BB 4DSJA 2B9YA 4MIAA 1PGZA 1CBKA 4DX7A 3ICLA 1NK5A 1NK7A 2F8HA 2RU9A 3JXOA 2HRUA 3MPDA 2OPRB 1FFSB 1HA1A 2U1AA 4F2RA 2YXLA 3PX6A 2W1BA 2DNKA 3MPVA 3AXMA 3CO9A 5AXNA 4DPXA 2VOOA 4U7CA 3WZ0A 4YR3A 1H7WA 4NWBA 2NPIA 1WEXA 4ALZA 4MTPA 4DR3J 4KR0B 3CCSS 1QSYA 5A8WA 1R6YA 1FERA 4GVBA 4Y00A 2DHXA 3HDSA 5J2MB 1S1UB 5DDQC 4HLBA 2CDRB 2H9ZA 2OUGA 4LF6J 2DNNA 3WIVA 2CIMA 2HHTA 1S6OA 3VCDA 1XIQA 2WSCC 4YMEA 1TU0B 2L3MA 3GZ7A 2OJ3A 4RNFA 3DXSX 5DDPC 5G4DA 1NHUA 4DN0A 4DF8A 4Y2CA 4OZLA 4ICLB 3BV8A 2NXUA 3QGHA 4KPCA 4KPYA 3PKMA 4IFYA 5ETQA 3R5AA 1AZSA 4B3RF 3QT5A 2Z2ZA 3M1VA 4ECUA 1HW9A 3KFWX 3X3UA 4A8XA 3CCWA 4RKUC 1WORA 2DGTA 4ECQA 2VC0A 1RT4B 4WU3A 4ZHRA 1U1KA 1UETA 3MM5B 3CJ2A 5T7LA 3G71S 4MYTA 3DRSB 4IG0A 3OTEA 1OJ4A 1N32F 2KYZA 1H74A 4R5PA 2KHDA 4ILLA 5J2NA 1IXKA 3POTB 4DV4J 1QJHA 1G3OA 1WF1A 2XMVA 2DISA 1M5KC 1N52B 1WHXA 2OEJA 1O5JA 4CLFA 2ZOFA 3O2IA 1X4AA 1PAEX 3N79A 1WDTA 2R2SA 4IG3A 5I3UA 5J2PB 3UI3A 1K47A 2MY8A 4C3MA 3AJ1A 2DR9A 1WWHA 1XK8A 1CJTA 1YWXA 5F0WA 4ZLNA 2FHJD 3FEYB 4YP3A 2FJBB 2R7RA 2C3OA 3OVSA 4OI6A 1WUUA 3T5HA 2DRAA 1IQTA 2KFNA 1U2RA 5J1EB 1WF2A 2E9TA 3JB9k 5BR8J 1WHYA 1UEVA 2ASJA 2AGQA 2M8DB 3LUYA 2Z57B 2L9DA 1NB2A 2RILA 5DQHA 1YJTA 3TEGA 3W62A 3ITHB 1WC6A 3FUYA 5CQGA 3IM9A 1S0VA 2CWKA 2J9EA 3M8QA 5J1PA 4FYWB 4K4XA 1FXDA 4K4VA 1RTIA 4DV4F 4QYZK 3E51A 1HBMB 3FFIA 2GVDB 3DU6A 3JSMB 5JVHQ 4I64A 1JWWA 3V4MA 4TU8A 1DLOB 3RUBL 4WKYA 2MZTA 3EM1A 3GV7B 3HJVA 5K20B 4N8NA 1RT7A 1IKVA 2AX1A 1GEHA 3HFVA 2IVYA 2ZWOA 4A46A 4B3MJ 1EZZB 2K7KA 2KVQE 3FCHA 5BR8F 2HVHA 4DFPA 2OPSA 1KS2A 5EN1A 4O23A 3C6UB 1MLAA 1P27B 1EIYB 4X66J 3MGJA 1N0VC 4TQSA 1FK9A 4L74A 3IA0A 4C48A 2FVSA 3TUPA 2BABA 2A6MA 4NXMJ 1JLBB 3QGGA 4WP3A 2BJDA 2J9DE 2A2DA 2JX2A 2FJXA 4JB8B 1WOPA 2C2DA 3RW7A 4X62F 2AX0A 5HN0A 2NYHA 4I67A 1X4HA 2OPQB 1MROB 2VUGA 5EX3A 4ED4A 1RT2B 1C0UA 4IR9A 3PEJA 4QJVA 4FNHA 4O4GB 2ZBCA 2PMZD 4O3RA 1XMQJ 1TVRA 1HNXJ 4E98A 2Y1JA 4B3MF 1NRKA 2W2OP 1N33J 1CJVA 3I5AA 1RP5A 5ADZA 4A8YA 1S9GB 2J7WA 3R2DJ 4X66F 1FRJA 4OHZA 2OLWA 2RKIA 3IN5A 3B78A 4B9NA 2RDIA 2V4QA 4CCHA 4Y34A 4U67Q 4NXMF 3QBCA 2HLUA 1FNXH 2UXDJ 5KG6A 3KJNB 1RWNB 3QWUA 2YNHA 3JQMA 1Y00A 1FDNA 2QL7B 4NRTA 3HMJG 2H3EB 2FJEB 2FHMA 2ZWPA 4LRCA 4USIA 1OY9A 3M8PB 4ID5A 1ZH5A 3JYTA 3G4SS 3NL0A 4F36A 5DM7Q 1U1OA 5HROA 3ENQA 1TKXB 3MCOA 2HNZB 3ZTRA 4PG5A 5DJBA 2HGLA 1HNXF 3BQ2A 3CCLS 1N33F 2ALZA 2CJ9A 2XM3A 4IQXA 1X60A 5DZ7A 3FBBA 5KTQA 2Z0GA 3CMAS 5GAHI 3RRHA 4NOHA 1AW0A 1LW2B 3MM8A 2MHEA 2V50A 5KFQA 3U02A 1URNA 3BQ1A 4GO5X 1R0BG 2BRLA 2VU5A 1OSDA 2A3JA 4WP8A 1LWEB 2L48A 2G1DA 5DZ6A 1FKPB 3MAAA 1PAUB 3MEEA 3BKTA 3KLEB 2VBZA 2B8QA 2XSJB 3M2VB 1S6PA 4EYHB 1VLOA 3MMAB 1FE0A 1FCAA 3QZ8A 4Q45A 1UKUA 2QLJB 3GWCA 4E2FB 1N54B 1W26A 2WVCA 1TQLA 3FSIA 3KG1A 2ZHBA 3OUYB 4TY8A 5CD4H 2RH3A 4KGKA 3UDEA 1UWBA 1RWOB 3AH6A 4CI0B 2ZBIA 1SH0A 4DCPB 1HI8A 4A8SA 2YQ0A 1AB8A 1SL1A 5A0YB 1HPZA 3PW7A 3M2UA 3I9ZA 2AJQA 3NGKA 2R4FA 3M8ZA 3TZYA 3N6MA 1BQMB 3LPYA 1CLFA 3DM2B 4C3KA 3KUGA 2DIVA 4P9SA 1ZPWX 4RWWA 2A0FB 3O3LA 4CZCA 1RUSA 3GSDA 5D3GB 1QVFR 5KFGA 1RBOB 2DR8A 1X5PA 5DLFA 1FFGB 4HH0A 4MJKA 1RKIA 5CA5A 4CNZA 5CD4A 4TLQA 3MR7A 2EPIA 3LWLA 1RWWB 3O5TB 3RB3A 2QGFB 2MSSA 4HTIA 5C2GA 5J2QA 1U0HB 1TL3A 4U7UK 3E8OA 1QTMA 5E3PA 2DXEA 2E5IA 3DFEA 3DI6A 1NAQA 4G6VB 3AA8A 3EVWA 2RDDA 3NCQA 2E5GA 4I7FA 1HI1A 3HD2A 3PEHA 4P73A 2JFDA 2KU7A 2A10A 3PX0A 3OL6A 2V8PA 2DHGA 5KFOA 2XMAA 1S1UA 1B64A 5CYJA 3LA0A 2BZ2A 2ZZMA 1KHVA 1QUVA 2MZ1A 1KVKA 5KFVA 1YJVA 3HHDA 3PIOQ 2IDLA 3LALA 2QLWA 2YKMB 2HQDA 1SJ3P 1MMDA 1DBDA 2EFNA 3GIMA 3CDEA 1R8AA 3GMGA 3HHKA 3GYXB 3L7OA 3FKBA 3VZHA 2HAIA 3VV2B 3I87A 4ICLA 4CLWA 1QLNA 4RU2A 1RXOB 1CJUA 1GT8A 3D6FB 3WX8A 1YZ6A 4Y2KA 1E6YB 2CVIA 1MMLA 4WE1B 1B7FA 1PYSB 3GR1A 4DV0F 3NRBA 2U2FA 2CUYA 3CULA 1CJKB 1RYSA 2MTLA 1RT4A 1CSJA 3NGSA 1KFDA 3E3XA 4CM0A 3NOCA 2ZH8A 3TJ9A 3MM5A 1KOOA 3QJPA 4MIBA 2B7CB 1GMWD 2FHKA 3FCWA 1NDKA 4KY3A 2GAGC 4P2SA 1NEEA 4L76A 5KFJA 2MEWA 9ATCB 5B08A 4F8RA 3PRBA 4ECZA 4JV0A 2MKSA 2WB4A 2VOPA 5L39A 1X9SA 3KJVA 1RWMB 4FS1A 2E7VA 5J2PA 1TL1A 2NCKL 2CPDA 2DCLA 1GMVA 1X0PA 1N4LA 3GSIA 1YLXA 4I6YA 1C4AA 4H4OB 4ZVFA 5ITHA 3NLCA 5HP1B 1JB0C 4PKDB 5CAAA 1NKEA 1TK0A 3HHLD 4P7TA 1J5OB 1B0TA 5JMNA 2C2RA 3PFEA 4HI1A 1HNIB 4DLEA 1JKHB 1YBTA 1HL6A 4ZCKA 3NXZA 3C19A 1VRTA 1SJRA 1CULB 3QSIA 3CT9A 4U95A 2RE1A 4NYZA 5H1SV 4JI7F 4RW4B 2VKRA 2ATLA 3CDUA 3AOAA 2NQPA 4USMA 3A3NB 2DEIA 2RIJA 2QA4S 1RYRA 1Y5IB 2FLOA 3P5BP 4ES2A 2COLA 2W25A 4TY9A 4ES1A 1HBMA 5FLXU 3TEHB 3D28A 2CJQA 3LF0A 2IC3B 4H4KA 2CVEA 2GVDA 5IS2A 1GAOA 1WC4A 3PVXA 1VI7A 2BEFA 4J9PA 4IFVA 5FD1A 1R8CA 1RT3A 2DNYA 4OI1A 3AOCA 1WC5A 2D69A 3PYDA 1RWVB 2WSFC 4RJVA 4FPIA 2EBEA 4YHHF 4PCQA 3C6UA 2XY6A 3S01A 3PHEA 3IS9B 3I4PA 3TW0A 2MHNA 1HWJA 2J0SD 1HQEA 3LP1B 2B9WA 1ACMB 4NASA 5B0DA 3ADAC 2V2ZA 1T95A 3D54A 2QYGA 4CDIA 5C24A 2EI5A 3Q83A 4FDFA 4FF3A 2IDEA 4EGLA 3KG0A 4LUBA 4EO8A 5L9NA 1GMUA 1SXLA 2DGUA 5D0RA 4DL2A 1VQ7S 1MROA 2XI2A 3QGIA 1RT2A 2MSTA 3EPGA 6FD1A 3MM7A 1S5ZA 3PTWA 4QCLA 2RU3A 5E7OB 4O4GA 1H98A 3BJYA 1KBRA 1RI7A 1VQYA 2QA4G 3PW0A 2W7AA 5AJ3J 2ZH3A 5HK4A 2WW4A 1IKWB 2XMMA 1EHWA 2VL1A 4IYQA 4MK7A 3C3LA 3EGNA 4DL4A 1YX2A 1Q79A 3W60A 5K8NA 2ZM6J 4ED7A 2EK6A 4JOUA 1F9FA 3AB4B 1S9EA 4J9RA 1T02A 4DR6J 2QMWA 5EX0A 2NR0A 3S6EA 2PGCA 4AXJA 1TAQA 2AQ4A 4LSZB 1XERA 2AGOA 3LH2S 3RBZA 1FWLA 3MI7X 3G2XA 3H42A 2DRDA 2HHQA 1I94F 1C1BB 2QYCA 2B43A 2YX4A 1JLAA 3PDNA 5SZTA 1TKXA 4LVNP 2HNZA 3RB6A 3IRXB 1RGVA 1C1CA 1RCOB 2KHCA 4EBDA 2FLPA 4URSA 5AJ3F 3TVZA 3LW5C 3G8TA 4OLPA 3G8QA 3ZZPA 5IXUA 3SZ2A 2BDPA 5A2QY 1SKSA 5KFAA 1HQUB 3VAGA 2ZM6F 3KXDA 2ZE2B 2EK1A 3BDPA 5KFLA 4U8YA 1GXTA 4PABA 4LSNB 1VS3A 4DR6F 4ZLLA 3PYFA 3GFHA 4I0WA 1FKPA 1SPBP 1NH8A 1OY8A 3KLEA 4FBTA 1NHKL 3G6VA 2Q66A 3M2VA 1R27B 4PQUB 3MMAA 3OQ2A 2DVIA 1EKSA 3EMTA 2HVZA 2BW7A 2MZJA 1ZA2B 2E7XA 2EFOA 1YK9A 3HSGA 4DDFA 1D9FA 3Q89A 4OHXA 5HSPA 4X4SA 5E33A 1Z2ZA 3R1HA 2YKQA 4OQJA 1Q8KA 4JI8J 5JXSA 1WEYA 3K89A 1QDUB 8AT1B 1IJEB 5D4PA 2J7KA 1VIOA 5KFNA 4ECRA 4RBUA 3TJAA 1FTCA 5A0YA 2LU2A 1TUWA 4A4JA 2VJVA 3W9IA 4OYIA 4CLKA 4DR1F 3NKYA 1BQMA 1JJCB 1YI2S 2Z2MA 3QJJA 1HMVA 4Q7AA 1HD0A 4M5LA 3L3CA 1TKDA 2GMHA 4KB7A 4C97A 1JLFA 5D3GA 2I9SA 1PC4A 1KVIA 2VBYA 3RBEA 2UP1A 5LJ3Y 3D2WA 2VG7B 4HT5A 3A8EA 3D7SB 3BYPA 2AEFA 1RWKB 2W7OA 4CIOA 1Q0NA 3DDKA 4DV7J 2GIQA 1L3TA 4ZIVA 2W2NP 2LQ8A 3W61A 2HHXA 4X4TA 1SH2A 1UL3A 3SFUA 1U0HA 3QIPB 1FDBA 1WHVA 3IO1A 2VA2A 1TKZB 3SYZA 1R0AA 1HBOB 4ECXA 4OX7A 4JI8F 4TU9A 3DDNA 3ETOA 3MD3A 5A8KA 2EC2A 4Z2XA 1NDLA 4RUBA 1MU2A 2HWHA 2CPZA 3BR9A 3GCXP 1SUQB 2LQ5A 4LF4J 2IMWP 2JSXA 2L08A 2FVPA 1WC0A 1TZ0A 2YKMA 4OI0A 3GU0A 4CH0S 2X7IA 2ZZTA 4OYPA 2R7OA 1KVJA 4URQU 5IT4A 1MG7A 2R2UA 2VICA 4Y2IA 3CCUS 1N34F 1VHIA 4XO0A 4FF4A 4EK2A 2YQ3A 1FJ7A 3D1QA 1NSAA 3ELHA 2NSCA 3NP5A 4QU6A 2V34A 4K0KJ 3DNCA 2EWHA 3BH6B 5AE1A 2PE8A 3KLHA 4BS2A 1M5HA 2IM1A 2ADBA 2M52A 2HMIB 4DBQA 4UOFA 4A47A 3AAWB 2KXFA 4LIRA 3TA1A 3UN2A 3QT7A 4CLLA 1FRHA 5A8RB 2G0CA 1V5VA 1UPMB 4R25A 3MAQA 4JI3J 3NNAA 4M5DB 1WEZA 3H7HB 3I9V9 3BGRA 4C8ZA 2HQGA 2IVFB 4UOGA 5AXKA 2N4DA 3H90A 5GAGI 3Q8SB 4OZ5A 3R7SB 3LGNA 2HQIA 1H73A 2CDQA 4HR2A 2V9WA 4FYDA 2ACMA 3R7BB 2QN6B 3CIMA 2MLYA 3TX8A 3GJRB 1YVFA 4DG1A
chains in the Genus database with same CATH topology
1ICEB 3KJFB 3RJMB 2HBQB 3EDRB 2QLFB 1RWKB 2QLBB 4LSZB 3GJQB 4ZVRB 5IC4B 2CNLB 3R5JB 4ZVOB 3R6GB 2C1EB 1RHUB 2H5IB 1PYOB 3SIPB 3IBFB 2P2CB 1RHKB 1RWMB 1I51B 3QNWB 1RWXB 2CJYB 2CNNB 2DKOB 3IBCB 2H4WB 4ZVSB 2Y0BB 1PAUB 2HBRB 3KJQB 3KJNB 1RWNB 2XYHB 1SC1B 2C2ZB 2CDRB 1QDUB 1I3OB 2QL5B 1RWPB 3D6FB 2H48B 3NS7B 2CNKB 1SC4B 2QL7B 1RHRB 1RWVB 4JB8B 2H4YB 3P4UB 1RWWB 2CJXB 2H51B 4ZVQB 2CNOB 3D6HB 2QLJB 1F9EB 3GJSB 1GFWB 4ZVTB 2HBYB 2H54B 1QTNB 4ZVPB 2FQQB 2XZDB 4ZVUB 2C2KB 2C2MB 1RHJB 2XZTB 2C2OB 3GJTB 1SC3B 3EDQB 1RWOB 3P45B 3R7SB 1NMEB 4DCJB 5K20B 2HBZB 5IC6B 1BMQB 1RHMB 2QL9B 2H5JB 3D6MB 4DCOB 1RE1B 3R7BB 4DCPB 1IBCB 2Y1LB 2XYGB 3GJRB 2XYPB 2H65B 3R6LB 3R7NB 1RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICE B;  3KJF B;  3RJM B;  2HBQ B;  3EDR B;  2QLF B;  1RWK B;  2QLB B;  4LSZ B;  3GJQ B;  4ZVR B;  5IC4 B;  2CNL B;  3R5J B;  4ZVO B;  3R6G B;  2C1E B;  1RHU B;  2H5I B;  1PYO B;  3SIP B;  3IBF B;  2P2C B;  1RHK B;  1RWM B;  1I51 B;  3QNW B;  1RWX B;  2CJY B;  2CNN B;  2DKO B;  3IBC B;  2H4W B;  4ZVS B;  2Y0B B;  1PAU B;  2HBR B;  3KJQ B;  3KJN B;  1RWN B;  2XYH B;  1SC1 B;  2C2Z B;  2CDR B;  1QDU B;  1I3O B;  2QL5 B;  1RWP B;  3D6F B;  2H48 B;  3NS7 B;  2CNK B;  1SC4 B;  2QL7 B;  1RHR B;  1RWV B;  4JB8 B;  2H4Y B;  3P4U B;  1RWW B;  2CJX B;  2H51 B;  4ZVQ B;  2CNO B;  3D6H B;  2QLJ B;  1F9E B;  3GJS B;  1GFW B;  4ZVT B;  2HBY B;  2H54 B;  1QTN B;  4ZVP B;  2FQQ B;  2XZD B;  4ZVU B;  2C2K B;  2C2M B;  1RHJ B;  2XZT B;  2C2O B;  3GJT B;  1SC3 B;  3EDQ B;  1RWO B;  3P45 B;  3R7S B;  1NME B;  4DCJ B;  5K20 B;  2HBZ B;  5IC6 B;  1BMQ B;  1RHM B;  2QL9 B;  2H5J B;  3D6M B;  4DCO B;  1RE1 B;  3R7B B;  4DCP B;  1IBC B;  2Y1L B;  2XYG B;  3GJR B;  2XYP B;  2H65 B;  3R6L B;  3R7N B;  1RHQ B; 
#chains in the Genus database with same CATH topology
 4H4O A;  3MMB A;  3EIC A;  5HP1 A;  4OYB A;  4RW8 A;  5EWF A;  4LRB A;  2CA9 A;  2IYI A;  3UCU P;  3CCM S;  1RT6 B;  4NLO A;  1WG4 A;  4K0K F;  2AT1 B;  4CWB A;  4F26 A;  4TNO A;  4WIQ A;  1U1L A;  3OJS A;  4AL5 A;  4N47 A;  1JKH A;  2FVQ A;  3ET6 A;  5LMN J;  3LOU A;  5KFR A;  1HNZ F;  3HHN B;  3WC0 A;  4FBU A;  1FWP A;  4HEA 9;  4RW4 A;  1EJ7 L;  1ZAV A;  4B9S A;  3PO5 A;  1FX2 A;  1TAU A;  1EB0 A;  2ZBP A;  4JI3 F;  5HVF A;  1PBU A;  3CJ4 A;  1WG5 A;  3HVA A;  2H54 B;  2KFZ A;  4O44 B;  1KHW A;  3TP2 A;  1TMJ A;  4F4X A;  3R5G A;  5IT9 U;  3GIJ A;  3JS9 A;  4OJH A;  1FVQ A;  4ZN1 A;  2OI2 A;  1LV5 A;  1R8P A;  3CJ8 A;  1FRK A;  1X5S A;  4O0N A;  3RRG A;  4Y2M A;  1F3F A;  3R27 A;  1UW4 A;  3T9Z A;  5LXY A;  2H5E A;  1C0T B;  3RAM A;  5H9F J;  3WDO A;  1YJW S;  3SMZ A;  3OPK A;  5HBM A;  4PZV A;  4LFB F;  2H5I B;  2LQJ A;  3E2E A;  3EE3 A;  5F8L A;  1YJN S;  1YBA A;  3ILJ A;  5KFC A;  2P6S A;  2HHW A;  3TZW A;  2MMY A;  3MR5 A;  3IS9 A;  2W2Q P;  4I2Q B;  1XN9 A;  4Z37 A;  2BR0 A;  2K8G A;  2WOM B;  4LF7 J;  1SH3 A;  3LP1 A;  4PAA A;  3IAM 9;  2HLT A;  4O4R A;  1ARO P;  4AD6 A;  4DFJ A;  1K1Q A;  2RNE A;  1DUR A;  2Q43 A;  2YH0 A;  3K0J A;  5GMD A;  3CMQ A;  2XG8 A;  4ZVQ B;  1V6H A;  4FKY A;  1P8G A;  5I42 A;  2OKQ A;  5C42 B;  2ZC4 A;  4LBI A;  1SI9 A;  1TFW A;  4CO2 A;  3QRR A;  3W8G A;  4JI2 J;  1GTH A;  2QLX A;  3H8Y A;  3GFX A;  2ZH4 A;  3HSJ A;  1ZPV A;  4K4U A;  1RAO A;  2W9C B;  2FPH X;  3I32 A;  4EO6 A;  3J80 U;  5KFW A;  4QQB A;  5KFX A;  2OFG X;  2RF2 B;  2ATC B;  2XLI A;  2FLL A;  1XJW B;  1U02 A;  5LMU J;  3LPE A;  1N5Q A;  2LCW A;  1B4S A;  1KLM A;  2HQF A;  5FDL B;  4KC5 A;  1IKW A;  3DLB A;  4AQY J;  3MCM A;  3PAC A;  3CME S;  3BPS P;  3KMS A;  1VQM S;  1GNK A;  4OZ1 A;  4J90 A;  1UZD A;  4H4M A;  3CJS A;  3L7U A;  2I0X A;  1UAW A;  4NA3 A;  3K17 A;  4NCG B;  1T8E A;  4TVA B;  2VIH A;  1C2P A;  2EVZ A;  2VQF J;  3K5N A;  2KM8 B;  2AP6 A;  4I69 A;  1DHM A;  3CDW A;  1LEO A;  2J76 E;  3JSR A;  2MLZ A;  1Y7P A;  1SQE A;  3H20 A;  3L4B C;  1R3N A;  2DT9 A;  3THT A;  3HXM A;  2C2M B;  2CAJ A;  3N5F A;  3K58 A;  3V6D A;  4V19 J;  3M6U A;  3BN4 A;  4ZCL A;  5HLF B;  4F0H A;  5L38 A;  4ZA1 A;  1EKR A;  1MWQ A;  1U24 A;  4ZP8 A;  3G9C A;  4MT1 A;  2NPF A;  1FRX A;  3OHA A;  1YSJ A;  2BRK A;  3WC2 A;  3SQG B;  3MPY A;  3SI8 A;  5LMU F;  2HNY B;  1QSS A;  2GGP B;  5IC4 B;  5ETK A;  3MUV P;  1YRU A;  4P72 A;  2F63 A;  3VR1 A;  1LWF A;  1HQU A;  4N7T A;  4AQY F;  2P5V A;  2HUR A;  2UXC J;  1IWA A;  2WVF A;  1ZTT A;  3CVK A;  3ZZ0 A;  4KTQ A;  1G4C A;  2OTJ S;  3BO3 A;  2YQ1 A;  1S57 A;  5KT7 A;  1U8S A;  3HVT B;  4M63 A;  3N6L A;  2VV5 A;  2VQF F;  2ZVS A;  1KNZ A;  1M5P C;  2UVV A;  4Q2M A;  1XQI A;  4JUZ A;  1FD2 A;  3DHW C;  5CXT A;  5I3Q A;  3ZXW A;  3L9Z A;  3W2V A;  2DNH A;  2MKC A;  2MKH A;  4JP8 A;  4CT8 A;  2P9E A;  2YNI B;  2F9D A;  3EWG A;  4RW9 B;  1LNQ A;  4ZLJ A;  1IBC B;  4FF2 A;  1HFE L;  5EHH A;  3W7B A;  2KO1 A;  2J6S A;  5E3R A;  1Z1Z A;  3BSN A;  1A9N B;  4NLG A;  2KN4 A;  3QMQ A;  4URG A;  3BRE A;  4KH0 B;  2I5J A;  1HNW F;  2QRR A;  1S48 A;  4LF8 F;  1JJ4 A;  5CYQ B;  3D0G E;  3M2R B;  2F7V A;  1U47 A;  1B3T A;  4ID8 A;  2V4J B;  1U26 A;  2UXC F;  5E2Q A;  3IG1 A;  4F4W A;  1PSD A;  1BUX A;  2Y0B B;  4NA2 A;  4GKJ J;  4EBE A;  2OGU A;  3MR6 A;  3RAX A;  1HBN B;  5CZX A;  1WEL A;  2VG7 A;  2H4Y B;  3TO8 A;  2CPI A;  5M2U A;  2WVE A;  5DRK A;  2HZV A;  2BE7 D;  3MEG B;  3TAM B;  1XR5 A;  1VQ5 S;  1K1S A;  4X4N A;  4O3O A;  3JSY A;  2V2Q A;  2DR5 A;  2Y9H A;  5GAD I;  3CIZ A;  4V19 X;  1ZZN A;  1X4D A;  1M0S A;  3BZQ A;  4OIX A;  2YKN A;  3QLH B;  3QIP A;  3KMQ A;  4YR0 A;  1X9W A;  3SCI E;  4F0M A;  1HBO A;  4PPZ A;  3BO2 A;  3KTQ A;  3GFY A;  2D3O 1;  2R7U A;  5AXM A;  2G1H A;  4K7Q A;  3MOZ A;  2CAD A;  3TRG A;  2B3T B;  1GH8 A;  2QZ8 A;  4WXW A;  3IXQ A;  1TP7 A;  2VOD A;  2PMW A;  3NWG A;  3QT6 A;  3R1L A;  4RU9 A;  1YJU A;  3PJ9 A;  3HHE A;  1FRL A;  1UJ4 A;  2C3Y A;  2BE2 B;  4GKJ F;  2CJK A;  4HL9 A;  5C25 A;  1Y5L B;  4PEO A;  4LMZ A;  2DNQ A;  4R8U B;  4UZC A;  4RW6 B;  3B54 A;  3N5B A;  1F9H A;  4NCB A;  4BWJ A;  3W5X A;  2B7B B;  5IQ6 A;  3D3B J;  5HL7 Q;  4MKV A;  3CGI A;  5LM7 E;  1Q53 A;  4JI4 J;  1TL7 B;  2AEJ A;  4R0J A;  3MEC B;  5B0A A;  4LRD A;  4GMK A;  1BMQ B;  1JXE A;  2M0G B;  3ISN C;  4FYX B;  4IH7 A;  3AQO A;  3OFF A;  2HMI A;  1X5O A;  4KRW A;  1QUP A;  3NGU A;  3I0S B;  1FE4 A;  2M8H A;  4DZ6 A;  2ZKU A;  1WTF A;  3CE8 A;  3HSZ A;  4J9K A;  3DRP B;  3AY0 A;  1T9V A;  2DNO A;  3BSA A;  3M05 A;  1Y0H A;  5A8R A;  3J81 Y;  1VQN S;  3TQE A;  1EET B;  4GKK J;  4M5D A;  2LDI A;  3HKZ D;  2CJA A;  1H2V Z;  4MFB B;  4DX8 H;  3NMA A;  2M9K A;  5U47 A;  3KLV A;  1X7V A;  1ZBT A;  2YNG B;  3A4T A;  3ZTS A;  2WRM A;  2VPZ B;  4F7V A;  3TX0 A;  3ZTQ A;  2CJX B;  5KFE A;  1S59 A;  4WFZ A;  3GJS B;  2F65 A;  2ZDP A;  2GHP A;  4JI4 F;  3ZZT A;  3O8W A;  2AIR B;  2N4C A;  2V4R A;  1NJI T;  1ZM3 A;  4OV1 A;  5KT2 A;  3MM9 A;  2DH7 A;  2HFU A;  4CLZ A;  3US5 A;  1U6F A;  5K9F A;  1VC6 A;  2FVC A;  4V1A k;  2RJZ A;  4UOC A;  3OXF A;  4Y28 C;  4RNN A;  5D0H A;  2WBM A;  3BF4 A;  4NL5 A;  1PC5 A;  1SJQ A;  1EQ0 A;  2ADC A;  1Q8I A;  4CLP A;  3D1O A;  2CQI A;  2NRE A;  1WC3 A;  1DY3 A;  2ZUA A;  3SCK E;  2B4O A;  1S72 S;  2YPZ A;  2KM8 C;  4GKK F;  2HFV A;  1JNZ B;  2JHE A;  2OAU A;  1SVD A;  3UW1 A;  4O44 A;  2E29 A;  1S6Q A;  2F40 A;  4LQ3 A;  3S8S A;  4LR7 A;  1U48 A;  2XUL A;  3UDV A;  1W7W A;  5H9E K;  4P74 A;  2MKY A;  3F44 A;  1MWY A;  2CRL A;  3HX9 A;  3IR5 B;  4X65 J;  4K50 A;  2Y1I A;  3CD0 A;  5E3C A;  4LF5 J;  2UU9 J;  1VQ6 S;  3CD7 A;  1C0T A;  2ERR A;  3DGP B;  5G0R A;  1IUJ A;  4IOB A;  3RYL A;  1DTT A;  4HDG A;  3N28 A;  4ZKA A;  5GAH U;  2VG5 B;  3ZZO A;  2ZJQ Q;  1EAR A;  1BQN A;  4UT4 A;  3HCX A;  3MHY A;  3DLK B;  2JDJ A;  5KFT A;  2CYY A;  3R7N B;  3ZZZ A;  4U6P A;  3M30 B;  3O6Q A;  2BJ8 A;  3V4I B;  3A3P B;  3HZE A;  1NK9 A;  1NK6 A;  2Y0S D;  4NZ0 A;  2Z56 B;  3PRV A;  4FS2 A;  3DRX A;  4WFX A;  3T19 A;  2OEM A;  2HHU A;  2CNL B;  1ZM4 A;  3W3S A;  2KJW A;  4ZPT R;  1VQK S;  4LBH A;  1CQN A;  4PXC A;  4TU7 A;  2LKZ A;  5F8M A;  5B7W A;  5F8G A;  2HVI A;  2M70 A;  4K59 A;  2QFI A;  4DSL A;  2BJ9 A;  1Y10 A;  4X65 F;  4YY3 J;  2XZW A;  2MQO A;  2W9C A;  1RAJ A;  2YNF A;  3OR2 A;  4LF5 F;  2UU9 F;  1UVM A;  1U4B A;  3M4X A;  1KOH A;  3QAE A;  2RF2 A;  4ZCI A;  1B99 A;  2PFF B;  4Q5V A;  4QOT A;  1OO0 B;  5FDL A;  4ZN3 A;  3FVY A;  2LXI A;  3ZNJ 1;  3SSR A;  4DV1 J;  2RD5 C;  2CQB A;  4ELV A;  2DBB A;  1UA1 A;  3KLI B;  3RR7 A;  2HND A;  2KXN B;  5D4N A;  5CYM B;  3VAM A;  2FZG B;  3VTI A;  3KK2 A;  1EP4 A;  3BSC A;  1X8D A;  1DFD A;  2QLF B;  2R7T A;  2ZH6 A;  4DSK A;  4DUZ J;  3BBB A;  4Y0F A;  1HYS B;  4ZLP A;  3HHL B;  1B7Y B;  2XGQ A;  5D4O A;  2BOP A;  1S4F A;  2B9X A;  3BGL A;  1Q82 T;  1G7C B;  5DG8 A;  4USU A;  3CW2 C;  2RHS B;  4YY3 F;  3V81 A;  4A8K A;  4NLU A;  3D9B A;  2X1G A;  2EW9 A;  5BJR A;  5JUM A;  3EXC X;  1U0S A;  2IVM A;  3CED A;  3MTK A;  1RU2 A;  1LFW A;  3PRD A;  2HFN A;  4KIA A;  2E5J A;  4FP9 A;  3ONQ A;  1S0O A;  2IMO A;  3MM6 B;  4UF4 A;  2F4V J;  1HHQ A;  2B4P A;  2LLZ A;  2XMK A;  2ZFH A;  2MQN A;  2EFQ A;  3UN3 A;  4DV1 F;  4L72 B;  1KTV A;  3TZZ A;  4CO3 A;  3D6M B;  2CWX A;  4MH8 A;  4OZ3 A;  2W8L A;  4OV6 A;  2J5A A;  2HK3 A;  3D0I E;  2QSW A;  3T1H F;  4C7Q A;  1WSR A;  4LQ9 A;  4DV2 F;  2C3P A;  1WC1 A;  5FLX Y;  2O66 A;  4G65 A;  1XNR J;  2GCF A;  2PA3 A;  1S7H A;  2GA7 A;  4EWT A;  3WQP A;  3P6Y C;  3HT3 A;  1UVL A;  1VBK A;  2YNI A;  1UP1 A;  3Q8Y A;  1IM6 A;  3GCW P;  4XPC A;  3HP6 A;  2MQM A;  4XDD A;  1QE1 A;  4WF9 Q;  3VGV A;  3AXK A;  2ROG A;  1T9W A;  4S0M A;  4M5N A;  1SL2 A;  2MQ8 A;  4J9N A;  5HAN A;  3T5K A;  4K4T A;  2DNL A;  3D3C J;  1VK8 A;  3TVY A;  2KT5 A;  1PBA A;  2FQQ B;  3R5B A;  2ZH9 A;  2EBG A;  3SDE A;  5CYQ A;  1HNV B;  2C2O B;  3TAQ A;  2V4J A;  3K5P A;  2XMT A;  1X0F A;  2OH2 A;  1VLY A;  5DGA A;  2HYI B;  2KRR A;  3UPF A;  4W90 B;  2CG4 A;  3R6L B;  5HMW A;  3KJF B;  2R8G A;  2BAN B;  4GO7 X;  3ZZR A;  3D68 A;  1UVI A;  2KG0 A;  3C14 A;  3HI9 A;  2XHC A;  5FII A;  3UCZ P;  3RB4 A;  4OFZ A;  4EI2 A;  4IQM A;  1S10 A;  1T9Y A;  3MEG A;  3SIP B;  4EUV A;  3GTY X;  4LR8 A;  2NZ4 A;  1SJ4 P;  2FYX A;  2AYM A;  2OPP B;  1S77 D;  4Q0B B;  1DTQ B;  2FLN A;  4TLR A;  3TZX A;  2BQR A;  3C6T B;  4DOZ A;  1CS4 A;  2KFY A;  2Q79 A;  2B6A B;  2E1P A;  1R8H A;  1VRU B;  1LWX A;  4L73 A;  3PZP A;  1WI6 A;  2HIQ A;  4OYO A;  3RBX A;  3G6Y A;  3F41 A;  1OS5 A;  4QPX A;  4DEZ A;  1JLQ B;  4CLY A;  3CJK B;  2DNZ A;  1S1W B;  4B3R J;  3VVU A;  4MK9 A;  3JQK A;  3QSY B;  1T03 A;  2NSB A;  3E01 A;  1Q5V A;  5KT5 A;  4RUC A;  4LT6 A;  4J5O A;  2PMH A;  4QR2 A;  5ETT A;  2BE2 A;  1Q81 T;  4RUH A;  3T1Y J;  1R43 A;  2DGQ A;  4ILM A;  1K44 A;  4DPY A;  1RHQ B;  4JV1 A;  3CJR A;  2MYF A;  4R8U A;  3QT8 A;  3W9J A;  3GYN A;  1FRM A;  3EPI A;  3CDB A;  1N32 J;  4HT7 A;  2JLG A;  3M32 A;  5HAT A;  1F0X A;  4DSI A;  4Q2L A;  1FRI A;  1VQS A;  2YWG A;  1RDR A;  3EZ5 A;  2XBP A;  1OQ3 A;  1N6Q A;  1RWX B;  4OI4 A;  4WZM A;  2LQ9 A;  2PI5 A;  3DMJ B;  3ISN D;  4M5M A;  2BJ1 A;  2XEX A;  3IR7 B;  3QAU A;  2Z2L A;  3GR0 A;  4WWS A;  1RIS A;  3TJ8 A;  2JH3 A;  2JZ5 A;  2GVZ B;  3G96 A;  4ILR A;  3S1T A;  2WON B;  4KO0 B;  1X4B A;  3I0S A;  3BGF A;  1F9E B;  3H5U A;  4DUY F;  3DRP A;  1HKA A;  4HHH A;  1QVG R;  2MDA A;  2GO9 A;  2DO4 A;  1NKB A;  2XLK A;  5ETR A;  2VPW B;  3T3F A;  2QIF A;  3B4D A;  3OXL A;  3T1Y F;  4MFB A;  2XYP B;  4LSL B;  5F3Z A;  2PEB A;  3A8J A;  3N9U C;  4X4Q A;  4YQW A;  4NLP A;  2YNG A;  1OMS A;  1Q5Y A;  4QYZ J;  4TQR A;  1N0U A;  1JLC B;  2AJ0 A;  4W4M A;  1UW9 A;  3KLG A;  2HS3 A;  2FVR A;  4UQT A;  1S76 D;  1NZ8 A;  4NLQ A;  4ED3 A;  1VBZ A;  1REV A;  2Z8Q A;  2PEH A;  1O51 A;  1NZA A;  2DIU A;  3KUE A;  3G82 A;  5AE2 A;  1OPZ A;  4P75 A;  1RT5 B;  4H54 A;  1SIZ A;  1RTH B;  3OD2 A;  2ZDO A;  2O5D A;  3OVB A;  3P4U B;  4UY8 5;  4YEA A;  2AHO B;  2GFF A;  2FGC A;  1XMO J;  4RZR A;  3J7Z 5;  5F8N A;  1TEL A;  3GP9 A;  4B3O A;  2EFV A;  2AWZ A;  3GYG A;  3W9H A;  3HHL C;  4PUO A;  1XNQ J;  3KKF A;  2K7J A;  3H40 A;  1L3S A;  2R7V A;  1S1T B;  4DCO B;  3VQS A;  3MAH A;  2JRS A;  3OW2 R;  4MMO A;  5K14 A;  3OFH A;  2VB6 A;  4KKO B;  2B0G A;  3RRK A;  1V5I B;  3HVW A;  2D1C A;  3EZU A;  4O3S A;  1J5E J;  2KT3 A;  3OXG A;  2V8G A;  5IM0 A;  3R6G B;  4UTG A;  3CJQ A;  3P96 A;  2QA2 A;  5F41 A;  4I2P B;  3M9O B;  5ETO A;  2VHG A;  5F8I A;  4X62 J;  3DOM B;  2VG5 A;  3KLF B;  4ED6 A;  1M1H A;  3PY8 A;  1S1X B;  4DZD A;  3T1A A;  1URR A;  5ETM A;  4ANE A;  4ER8 A;  4WCE Q;  2RB7 A;  4IO1 A;  4JI5 J;  2YWF A;  4NLV A;  3MCN A;  3N6N A;  2R8H A;  2IRX A;  3GON A;  4FN5 A;  1XMO F;  3I82 A;  3AQP A;  4NMX A;  5E5N A;  4DV5 J;  3DOK B;  2W7P A;  3CPW R;  1FFW B;  1RTD B;  2XZD B;  3FRY A;  2IM2 A;  3TUJ C;  4ES3 A;  1XNQ F;  3SV3 A;  4DL7 A;  2EG2 A;  4M94 A;  2NLW A;  3JSB A;  2XTJ P;  2CPY A;  3KK3 B;  3C66 A;  2UUC J;  1D3W A;  3V6H A;  1L3V A;  4ELU A;  2VG6 A;  5L8R C;  2MQP A;  1EAY C;  4ENO A;  2VFU A;  4KFB A;  3H25 A;  3HFZ B;  4BWM A;  4XK8 C;  1J5E F;  1JLE B;  1R7I A;  1FJC A;  5F3T A;  1TKT B;  1RAA B;  4USK A;  4NZ6 A;  1SV5 A;  4JI1 F;  2RML A;  4YR2 A;  2M5Y A;  4J9V A;  3DLG A;  4NRU A;  4MKB A;  2A18 A;  1RT1 A;  1GMW A;  3M6W A;  3BO4 A;  1MNE A;  2MGZ A;  3QNW B;  2KRB A;  2A1B A;  1VIS A;  4K4Y A;  1IBL F;  2HBR B;  2RT3 A;  1DQA A;  3JQJ A;  4IOA Q;  4TKT A;  2KZM A;  4M8L A;  3BEG B;  5BYS A;  4KHR A;  4P52 A;  4JI5 F;  4M5G A;  3J81 j;  5CYM A;  1TFY A;  4L75 A;  1H72 C;  2ZZN A;  2Z2Y B;  5E3Q A;  1OSC A;  9RUB A;  1YJ7 A;  3PIP Q;  2HRY A;  4DV5 F;  2JWN A;  3S7R A;  1S9F A;  4A8Q A;  3FEX B;  5B0F A;  3PR4 A;  4NEZ A;  3H2U B;  4J9U E;  1HYS A;  1RAD B;  3DLJ A;  3FZB A;  4WTO B;  2UUC F;  3MDF A;  1JJH A;  1OY6 A;  3K59 A;  4ECY A;  5A8W B;  4GVB B;  2CZ4 A;  2RRB A;  3QO9 A;  2MXY A;  2UV8 A;  1CC8 A;  1E6V B;  1OPI A;  1T9T A;  3H2V E;  1MN7 A;  3HD1 A;  2YKA A;  3R3T A;  4I56 A;  1RTJ B;  3U27 A;  2CQ0 A;  4ECT A;  3MM6 A;  2X3D A;  3VZI A;  5HI7 A;  1N88 A;  4OHW A;  1U1R A;  4WU2 A;  2IA6 A;  3D0H E;  3OTD A;  2P8I A;  4K4S A;  4M95 A;  1XBW A;  4ZJL A;  1IR0 A;  1FEH A;  1XR7 A;  1S49 A;  1HI0 P;  1LWC B;  4P7V A;  4LRF A;  2ZBQ A;  1LW0 B;  4IFY B;  1VBY A;  3TAN A;  4LF2 A;  2KI2 A;  3OBI A;  2XB2 D;  3ILO A;  2V8D A;  5GMK a;  2AJ4 A;  5KFF A;  3Q23 A;  4PG4 A;  1VYA A;  4F2S A;  4OX8 A;  4ZHR B;  5DGB A;  1H3D A;  2GW8 A;  5T7L B;  3GG0 A;  4AYB D;  3FGV A;  3SXL A;  1UFK A;  3PV8 A;  2CPF A;  4NEY A;  1TL4 A;  3RJM B;  4WTY A;  2OP5 A;  3CDA A;  4K4Z A;  3Q2T C;  2AJF E;  3PYE A;  4NPO A;  4R5P B;  5BYQ A;  1U1P A;  5J2N B;  4DV3 F;  3M9N B;  4DJB A;  2XO6 A;  3DLE A;  3ZZY A;  3I6P A;  3J7A 1;  2L9W A;  2J6T A;  2HHV A;  2RRN A;  2ZD1 A;  4ZP6 A;  4WPA A;  2UUT A;  4FXW A;  1FKO B;  1KKH A;  4OI2 A;  3UD3 P;  4C9D A;  4Y6I A;  3K5M A;  1VQ9 S;  1VQ4 S;  1JX4 A;  4RBT A;  3BN7 A;  3THP A;  3UR3 C;  4JI0 J;  4B08 A;  5GAG U;  1AXQ A;  2ZNZ A;  1T0T V;  2BAN A;  1UJ6 A;  1GFW B;  3OL8 A;  1PJ7 A;  5IQQ A;  3W2W B;  5CAB A;  2XMW A;  3DCA A;  1ZET A;  4HHJ A;  2K1R B;  5KFU A;  1VJQ A;  3HJF A;  5KG1 A;  4EBC A;  5CCM A;  3QFH A;  2AV5 A;  4L3K A;  1DTQ A;  1FDA A;  3PFO A;  3C6T A;  3BH7 B;  3M8Q B;  2B6A A;  1IR2 A;  3NY0 A;  2QLB B;  1F5A A;  5F9N A;  2ZH1 A;  2OPR A;  1VJW A;  4NX9 A;  1APS A;  2YKP A;  3L09 A;  3DC2 A;  4C4W A;  2YVS A;  5KFD A;  3CJK A;  2F4F A;  3AB2 B;  1O8B A;  2DKO B;  4DS4 A;  4DV0 J;  3ZZU A;  5T14 A;  4XTT A;  1S97 A;  2C2Z B;  4JI0 F;  2C42 A;  1QAJ A;  4CH7 A;  2LEA A;  2LFV A;  2E66 A;  3AA9 A;  2KYX A;  4I6A A;  1RT7 B;  1IKV B;  4P2M A;  3TUZ C;  2DO0 A;  4YFU A;  1ZM2 A;  2DCU B;  5L1L A;  2X51 A;  3CC4 S;  5J2M A;  3MED B;  4DL0 C;  3NMR A;  5LT5 A;  2V9K A;  4LR9 A;  2E5L J;  3GIR A;  5I3P A;  3P45 B;  1R6V A;  2YWW A;  1NH7 A;  2X1F A;  3CNQ P;  1Y5N B;  4YB5 A;  3A1Y G;  4B9L A;  4G1Q B;  4NCA A;  1FK9 B;  3DMJ A;  4J91 A;  3A13 A;  1SB6 A;  4B9T A;  2DY1 A;  3CCR S;  2CKW A;  1UWA A;  2GVZ A;  2CPX A;  2ZHA A;  1ULR A;  3ENA A;  1VFJ A;  2IRY A;  2V5H G;  3DYA B;  2E1C A;  4N41 A;  3TR5 A;  4ED0 A;  2Q3P A;  1IKX B;  2VFT A;  1H2T Z;  4BLG A;  3LP2 B;  4ZCM A;  4DR5 F;  3AJD A;  3N4W A;  4OX9 F;  2CG8 A;  1SC1 B;  4CM2 A;  2XSF A;  3WIU A;  4DQQ A;  2KDO A;  2ZBR A;  2XS5 A;  4J9M A;  2OIH A;  4JI6 J;  1TVR B;  2DJW A;  2ZIT A;  4NI2 B;  1BD6 A;  3DRS A;  4B02 A;  4PG8 A;  2PD1 A;  1NJW A;  1Q16 B;  4JI7 J;  1REG X;  2V68 A;  1QTN B;  4I1T A;  2M88 A;  4ZVU B;  2E5L F;  1B70 B;  1JLC A;  1TMM A;  3K8W A;  2GQQ A;  1ZTW A;  1X4F A;  3GJT B;  3MFH A;  3POT A;  1S12 A;  5HMZ A;  4WFY A;  2RKI B;  2C3U A;  2A2C A;  3M8W A;  2VDI A;  1S99 A;  2DTJ A;  1WD6 A;  4C11 B;  3I5B A;  3G6E S;  4OZJ A;  5HQM A;  3N0V A;  2HS0 A;  2VA3 A;  1RTH A;  2KKH A;  2YNH B;  4USW A;  1M5O C;  1R8B A;  3OTO J;  2RUG A;  3NCR A;  4ZP9 A;  4G3I A;  4E8U A;  3PM9 A;  5B0C A;  2AYG A;  1WHW A;  3PNI A;  4NA1 A;  3D5M A;  5KFY A;  5J1E A;  2DYA A;  4GC6 A;  4QIF A;  4K5R A;  1AFJ A;  3RW6 A;  2CQ1 A;  4YHH J;  2UV8 G;  5HRO B;  2KJV A;  1TR0 A;  3FBF A;  1S1T A;  1F2H A;  3CJT A;  3Q8Q B;  4CO1 A;  2R7S A;  4CLU A;  4D3G A;  5B09 A;  2YWK A;  4JI6 F;  3LAM A;  1FNO A;  2AEM A;  2VBX A;  2EEY A;  2GQC A;  3ITH A;  4CRJ A;  2HBY B;  1XEZ A;  2BM0 A;  5IWA J;  1HWI A;  1GX5 A;  2E1A A;  5F0U A;  3MM8 B;  4J9O A;  1CPZ A;  2HWT A;  4I2P A;  4PG6 A;  1DZ5 A;  2GAH C;  2QL9 B;  3G8S A;  2Y8W A;  3DOM A;  1GTE A;  3BS9 A;  2B5J B;  3JSM A;  1S1X A;  3MAA B;  3NBP B;  3MEE B;  1DLO A;  2NXE A;  5AXL A;  2WHO A;  2V2V A;  5LOQ A;  4DL3 A;  3OTO F;  3UNG C;  2MLX A;  4U8V A;  2HGN A;  1FD8 A;  4FXD A;  3MTJ A;  3NCP A;  2Z58 B;  1WOO A;  1Y4Z B;  2EC0 A;  2CNN B;  3CCV S;  3VAL A;  1LK7 A;  4A8O A;  3HVR A;  2FY1 A;  2CQC A;  1UWB B;  1K0V A;  2M4M A;  4ECV A;  2G9O A;  4MIW A;  2DHH A;  4PWW A;  4KQZ A;  2UXB F;  3MZI A;  3H2L A;  2C3M A;  3TUI C;  5IWA F;  4RW7 B;  4DUT A;  2G2Y A;  4NML A;  3K57 A;  1HPZ B;  4ZVP B;  1JLB A;  4USH A;  4F02 A;  1NND A;  3MPW A;  3TA2 A;  3Q8U A;  2XNR A;  4M5J A;  2J9C A;  3D4J A;  3PXG a;  1SJF A;  2BUN A;  2OPQ A;  4MAK A;  1I94 J;  2PA8 D;  2AJ2 A;  2C28 A;  2LVW A;  4OL8 A;  1K8A T;  1I1G A;  3H4D A;  2W8K A;  2GV1 A;  1AFI A;  4UQG A;  5J2Q B;  1GK8 A;  1TL3 B;  2ZKT A;  2B56 A;  3DI6 B;  1UVK A;  1S9G A;  1T9U A;  4DL6 A;  2AYB A;  5GAD U;  4I7F B;  2CNK B;  4WJB A;  3UNY A;  3IWL A;  2FD2 A;  3ENW A;  3KNG A;  5DET A;  2ZH2 A;  1UZH A;  5KFM A;  1E6V A;  2W9B B;  5D6G A;  2HQ3 A;  4CP5 A;  3RG6 A;  4UOH A;  3UR0 A;  1H2U X;  3J7A N;  2HWI A;  1A0O B;  5JJB A;  3GV5 B;  3QAT A;  5HQ8 A;  1PIL A;  1RTJ A;  1YBU A;  1DRZ A;  3MUM P;  3C15 B;  2BQU A;  3NS6 A;  2JEF A;  2DNM A;  5M2P A;  3M8P A;  3OL9 A;  1FEE A;  3H98 A;  7FDR A;  1MMN A;  1HR0 J;  3CCQ S;  1LWC A;  1CJU B;  1NM2 A;  1LW0 A;  3X1L B;  1U45 A;  1PYO B;  2DXF A;  4FXV A;  1SJ1 A;  3NGR A;  1TV6 B;  2ROE A;  2CPJ A;  1FES A;  3RR8 A;  2AMC B;  1LK5 A;  3IGN A;  1BC6 A;  1VHF A;  2X1B A;  5F9L A;  2BYC A;  2XYH B;  4DR1 J;  4LVO P;  1LW2 A;  1AT1 B;  2HIY A;  4UY8 T;  2DB1 A;  4DR3 F;  3VF0 B;  3QRQ A;  3VGS A;  2F8E X;  2GNK A;  3J7Z T;  3BKF A;  4E0D A;  5K8P A;  1LWE A;  2DGO A;  3DRR B;  2BAC A;  3PKY A;  4LF6 F;  3PYG A;  4DQR A;  5F8J A;  3MFI A;  2XSJ A;  3U7J A;  4PRF A;  4HVZ A;  1P1T A;  3SCL E;  3KJV B;  4J9L A;  3FDS A;  3LGH A;  1YKW A;  1RA6 A;  3IWX A;  3D6T B;  1MW7 A;  4ZS6 A;  2G2Z A;  1FKO A;  1TL1 B;  4QIV A;  2XQC A;  4ED2 A;  2IRU A;  5HAO A;  3LTO A;  1N56 A;  1QD1 A;  2E9Z A;  3C46 A;  1HR0 F;  3OUY A;  1U8W A;  3DHX A;  1D9D A;  5THW A;  2I6W A;  1HHS A;  3BQ0 A;  1J2V A;  1YGY A;  2JLE A;  3FSX A;  4K2X A;  2APO A;  4AFF A;  4BBY A;  4PXB A;  2ILZ A;  4W92 B;  2YX7 A;  4RL1 A;  1O0P A;  3W2W A;  3MD1 A;  3F56 A;  1Q1K A;  2K1R A;  2RDJ A;  1PYT A;  1IJF B;  1VRT B;  2VPY B;  1UPP A;  4RR5 A;  3DM2 A;  3R97 A;  4DFK A;  4AE5 A;  4ZVH A;  4DLG A;  3N01 A;  2AF6 A;  3U1M A;  3MUT P;  5KFH A;  4YUD A;  4ZPC A;  5IFM A;  4KGM A;  2J7U A;  1BHN A;  2DRB A;  5HO4 A;  1NU4 A;  4ECW A;  3GV8 B;  2DHA A;  5KT3 A;  2WZ1 A;  2CQ4 A;  4M5I A;  2F9J A;  4A8M P;  3HUL A;  2NZC A;  4F3M A;  1N34 J;  5L9X A;  2F3J A;  4DCJ B;  4DU7 A;  4N8O A;  1RHM B;  3EGW B;  4C8O A;  2HEK A;  1JXL A;  1KQS R;  1T05 B;  4X4R A;  2HSE B;  4WYL A;  4XIU A;  4IFV B;  2POK A;  4PYA A;  4BDP A;  1RT3 B;  1F3V A;  1NXI A;  3FRZ A;  3UCG A;  4HAC B;  3UDC A;  2WBR A;  1KQK A;  2PN6 A;  1G6B A;  1FJE B;  3MED A;  1Y3J A;  5K8O A;  2NXJ A;  4MYU A;  4X84 A;  4ED1 A;  1SL0 A;  3F0N A;  2VQE J;  4DPO A;  1PCA A;  3OSP A;  2V67 A;  4G1Q A;  1HQE B;  1NJZ A;  1Y9O A;  4B9V A;  4UW2 A;  3P49 B;  3TQ1 A;  2HHP A;  1K9M T;  3OLA A;  5C24 B;  4RUA A;  4KSE B;  4MKY A;  4KGV B;  3DYA A;  3NEK A;  2RSQ A;  1TUV A;  2YWE A;  3GB0 A;  2UUB J;  1E6Y A;  1N48 A;  1CVJ A;  1IKX A;  2BJ7 A;  2R7W A;  2K06 A;  4WE1 A;  4XAK A;  3LP2 A;  1PG5 B;  2XY7 A;  3AT1 B;  2Y1L B;  3H59 A;  2FGO A;  2JC1 A;  2Y3Y A;  4DHV A;  1CJK A;  3MM7 B;  2I1R A;  4WK3 A;  4HH1 A;  1IKY B;  2MZR A;  4IRC A;  3K8V A;  4NI2 A;  4HKQ A;  4C6A A;  4ZPW R;  1HNZ J;  2PO4 A;  2RS8 A;  2WVD A;  7AT1 B;  4ZJQ A;  2W01 A;  2BA9 A;  3VAI A;  2CJB A;  2HHH J;  1GXL A;  1VQ8 S;  2VQE F;  2R7Q A;  4C8Y A;  5K5M A;  1YHQ S;  3M6X A;  4RX6 A;  1P9Q C;  1BWV A;  2D3O R;  2ZJP Q;  4CLT A;  1VC0 A;  3OTB A;  1S9E B;  3CD6 S;  4W98 A;  3JAM U;  3PO4 A;  2D9O A;  3DGV A;  2CNO B;  3R8Y A;  5GAE I;  4NLX A;  4C11 A;  2QV6 A;  2DNP A;  2IJN A;  1VCT A;  1B0P A;  3GG1 A;  2GJF A;  1XTZ A;  2UUB F;  3B82 A;  4K5S A;  1J5O A;  1JLG B;  1HHT P;  2DR7 A;  1RE1 B;  2DK2 A;  5DLG A;  4Q44 A;  2RQC A;  4LFB J;  3MEK A;  4DQS A;  2XCP A;  1HNI A;  4NLY A;  1H38 A;  5KAK A;  2MQL A;  1A6L A;  1JLA B;  3K7R A;  3MMC B;  2ILY A;  2VD3 A;  3DLH A;  1KFS A;  2D3Z A;  1HWU A;  1C1C B;  1XMQ F;  1CUL A;  3FJ2 A;  5GVQ A;  3GJQ B;  4QWD A;  1KD1 T;  1WI8 A;  2R3V A;  3Q0A A;  4WK1 A;  4EEY A;  3NOG A;  1RHU B;  1AYE A;  1IM4 A;  2R42 A;  5EUH A;  5KG0 A;  1M1G A;  1NJX A;  2PII A;  2HHH F;  1T94 A;  2AD9 A;  3LGM A;  3J81 U;  2XMJ A;  1IBK J;  3FEZ A;  3VGT A;  2IC3 A;  3H5S A;  3FNN A;  4WKR A;  4X4O A;  2VPX B;  2B5J A;  2H51 B;  3FC9 A;  2UXD F;  3BSO A;  3NBP A;  2JEG A;  1X31 C;  3H5Y A;  1NKC A;  3EYZ A;  2FC8 A;  4J9S A;  4CH1 A;  4QWA A;  4ANC A;  2QG9 B;  3PJX A;  4IH6 A;  3SBM A;  4PQA A;  1VR6 A;  1U6Z A;  2N7Y A;  2GHV C;  3H0P A;  1RAI B;  1FXR A;  2VFR A;  4RW7 A;  4LF1 A;  2N3L A;  3IFE A;  2LA4 A;  1IBK F;  2M7S A;  2RS2 A;  1WJ9 A;  2PSZ A;  1T3N A;  1HMV B;  5KG7 A;  2OFH X;  3KK1 B;  4N5S A;  3HSD A;  3Q2S C;  5DS7 A;  1JLF B;  1Y11 A;  2BKN A;  1Z4U A;  2LA6 A;  2HG4 A;  2AKW B;  4DPT A;  5L46 A;  1ZAX A;  4IDK B;  1YZ7 A;  4QWB A;  1RLC L;  5KOW A;  4HTJ A;  1Q86 T;  2YH1 A;  3UQS A;  2E1M C;  3VHQ A;  4O3N A;  2WVB A;  2LXU A;  1U25 A;  3ZTP A;  4G1P A;  3QID A;  2XYG B;  2HFS A;  4C8N A;  2LQB A;  4XDC A;  1R0A B;  2EFG A;  3EDR B;  2GX8 A;  4ED8 A;  1IR1 A;  5KFP A;  5A8K B;  4N76 A;  5D77 A;  3ISZ A;  4OYM A;  2F1F A;  1MU2 B;  2BMB A;  2FC9 A;  5CZV A;  4C2M A;  2RAQ A;  2W9B A;  3KHL A;  1HBU B;  3V6K A;  2JL9 A;  2MJU A;  3FQL A;  3UDL A;  4H4K C;  3W1Y C;  2FDN A;  1FKA F;  3U1N A;  5EGY A;  3QPI A;  4KAI A;  4KBI A;  3C15 A;  2M3D A;  1RAG B;  2ZHO A;  4DX5 A;  3HZG A;  3I96 A;  1C1B A;  2DNR A;  2EFP A;  2G0J A;  1H6K X;  4A8W A;  4Z7Y A;  1V3Z A;  3CJ3 A;  3GPA A;  3LAN A;  5ETN A;  2JJ4 D;  1W2I A;  4Q43 A;  1UCN A;  3IRX A;  4RLE A;  1RCX B;  3QGP A;  1WKL A;  4DQI A;  2HGM A;  4JBC A;  2MB0 B;  1KEK A;  2XZT B;  1TV6 A;  2HBZ B;  3I56 S;  3BR8 A;  3CCZ A;  4OLO A;  3KLH B;  1HNW J;  3HKW A;  1R31 A;  4LF8 J;  1ITP A;  4IO9 Q;  2XNQ A;  4J37 A;  4ZP7 A;  3H5X A;  5HQL A;  2HHS A;  2ZE2 A;  4FNI A;  3CC2 S;  2AU0 A;  3CUN A;  2D74 B;  4YN3 B;  4LSN A;  2XO7 A;  2C1E B;  4OHV A;  4B9M A;  3I0R B;  4I68 A;  4C0B A;  3HLU A;  3AD9 C;  3DRR A;  1YTY A;  1BE4 A;  4YS2 A;  1O6X A;  4ZVE A;  1S6U A;  2DEJ A;  2VDH A;  3BGR B;  4PQU A;  3ZNU A;  2OHD A;  3Q8P B;  3IWN C;  4PXD A;  1FVS A;  3CXC R;  4QWC A;  4KGZ B;  1Q7L B;  2LEC A;  2BJE A;  4QYR A;  4DG1 B;  2D41 A;  1A7G E;  2FZC B;  3ILI A;  3TVK A;  3MMB B;  4UUW A;  2VF3 A;  4RW8 B;  3J7Y I;  2CFX A;  3R9L A;  1EX8 A;  2CQP A;  3CCE S;  4YB7 A;  5DM6 Q;  3FBE A;  4Z7C A;  1Z2L A;  2C22 A;  3C16 B;  1H7X A;  2G2O A;  1UEK A;  4QR0 A;  2YKO A;  2IM0 A;  2HKE A;  4B3S J;  3ET6 B;  4DPW A;  1L3U A;  1N5V A;  4DMZ A;  2OO4 A;  2BKO A;  4P2F A;  2L41 A;  1NO8 A;  4G1I A;  3BM7 A;  4QIE A;  5HMY A;  4KV8 B;  1TL5 A;  4F3O A;  3P3D A;  5EWG A;  1WF0 A;  4F4Z A;  2P6T A;  4F4K A;  1Q78 A;  1NJY A;  2ACY A;  1JIH A;  2XS7 A;  3NGT A;  2FIU A;  5BXI A;  4DSF A;  2RQ4 A;  4ZMM A;  2PDA A;  2QMU B;  5E41 A;  4ZPB A;  1T05 A;  2Z30 B;  4BHQ A;  2XY5 A;  3MCS A;  3Q24 A;  5HVH A;  1TKZ A;  4A48 A;  4WYW A;  4LBP A;  1DAX A;  2J8A A;  5LSO A;  1S0M A;  1PJ6 A;  3C8Y A;  4QW8 A;  4HAC A;  2RRA A;  4NE9 C;  3M8R A;  2ZEJ A;  1ZOT A;  2R2T A;  5HBM B;  3JTP A;  4ATN A;  1P6T A;  5DQG A;  1SUQ A;  2P9C A;  1QY7 A;  4D3H A;  4B3S F;  4X2B A;  3QQC D;  3L7P A;  3EJM A;  2IYG A;  3ILL A;  2UUA J;  4IR1 A;  2X3G A;  3AJ2 A;  4NYP A;  5D0E A;  1SKU B;  4F4A A;  3M9M B;  1ZYQ A;  4B9U A;  4WXO A;  3T9N A;  5I42 B;  2C2N A;  2UVR A;  4NLD A;  3KJQ B;  4GVL A;  2VBW A;  1NDC A;  5M2R A;  4K2J A;  1JXV A;  4USV A;  2ZOM A;  4YDD B;  2KT2 A;  3DDI A;  4J7C A;  2AJ1 A;  4QWE A;  1W25 A;  7FD1 A;  2ZH5 A;  1DQ8 A;  2FUG 9;  4DF4 A;  1IKY A;  2BOA A;  1WKJ A;  1G2E A;  2C2K B;  2VKZ G;  4IRK A;  3VWS A;  1NSQ A;  1KLM B;  2B4V A;  1NUE A;  2OD4 A;  3M6V A;  3W8P A;  3VAF A;  1NK4 A;  8ATC B;  1RB0 A;  5A6P A;  3NG8 A;  2XWY A;  2UUA F;  5H9E J;  1J27 A;  2MZQ A;  6FDR A;  4O0I A;  2DPJ A;  4H4M B;  2IAJ B;  3UD4 P;  1TK5 A;  2AZ1 A;  3V2U C;  3EVO A;  3PR5 B;  4DL5 A;  1VQP S;  1T7P A;  4EZ9 A;  4HYK A;  5IT0 A;  2WW8 A;  3CC7 S;  1VIX A;  1FDD A;  1N5T A;  3DOL B;  4TXS A;  2V0N A;  1RT6 A;  2CQH A;  2DH9 A;  4Q8E A;  2IM3 A;  4DU8 A;  3V6D B;  1JLG A;  3FCV A;  2W4D A;  1CG2 A;  2ROP A;  1HW8 A;  1MSW D;  1ROF A;  2EKY A;  2XC9 A;  3MMC A;  2O1P A;  2VZ9 A;  2W2P P;  3KYL A;  2V6A A;  4Q8F A;  3O44 A;  3OL7 A;  4OMF G;  5L1J A;  2E7W A;  1SC3 B;  4JV2 A;  5DO2 A;  1LWF B;  2QJ3 A;  1U6B A;  2FZK B;  4N77 A;  1N8R T;  4OJG A;  1RK8 A;  1UVJ A;  4Y3C A;  2EG1 A;  2CZV C;  2WAQ D;  3UVJ B;  5SUH A;  2DXD A;  1KON A;  4OYA A;  3W63 A;  2VFS A;  4YB1 P;  3Q22 A;  2HFZ A;  3LP0 B;  1OYE A;  1ZA1 B;  3PW4 A;  2JEI A;  4F25 A;  1IBM J;  1NBE B;  3NNC A;  2VH7 A;  4RPF A;  2HAF A;  1IN0 A;  3FMB A;  4X64 J;  3D67 A;  5LSL A;  2V63 A;  1W2B R;  1WG1 A;  2LMI A;  3U1L A;  4K8R A;  4KT0 C;  3W2V B;  2LYV A;  1LFP A;  2IBO A;  1UA0 A;  4KH1 B;  4KGX B;  4P10 A;  3VVT A;  1FHT A;  5KFI A;  1HQ2 A;  1S7I A;  3K5L A;  3T5J A;  3HPO A;  3OFE A;  4K4W A;  2J0X A;  4ZVT B;  4IRD A;  4I2Q A;  1XC9 A;  3BGU A;  3A12 A;  2GO8 A;  5AE3 A;  3QRP A;  2WOM A;  3CB4 A;  1N5Y B;  2HK2 A;  3O1L A;  4O3P A;  1QM9 A;  2I5J B;  1KP6 A;  2DIT A;  4C0H A;  3SQO P;  3T5L A;  2FB0 A;  3G86 A;  3B4M A;  3IRW P;  3IG1 B;  1WAC A;  3OV7 A;  5C42 A;  4C8M A;  2BM1 A;  3KK1 A;  2OSR A;  3LQV A;  4F0K A;  2WTF A;  2X1A A;  2J0Q D;  4DXL A;  2YBV A;  1IBM F;  2I38 A;  2KXH A;  4IDK A;  2P2C B;  3GLJ A;  1TTH B;  2CXE A;  5DDO C;  2Q1L A;  1U1M A;  4CT9 A;  3CSK A;  2BXJ A;  3BGO P;  4X64 F;  3CJ5 A;  3IC1 A;  1NPR A;  1I6J A;  4OYX A;  3WHI A;  3DXB A;  1M5V C;  2RQM A;  3OR1 B;  3BDE A;  3OJU A;  2YKN B;  1MN9 A;  1D09 B;  2IJR A;  5C5J A;  1F6T A;  2HPU A;  1LOU A;  4F4Y A;  1U2F A;  2JLF A;  1NK0 A;  3OLB A;  4PXE A;  1XWL A;  3V5R A;  1GXU A;  3Q8V A;  5D8H B;  1DJ0 A;  1X5T A;  3VGU A;  1VMB A;  1ZS6 A;  2ASL A;  3DLL Q;  4NCG A;  4WFN Q;  2FHJ A;  1HBU A;  1FJG J;  4DS5 A;  3T1H J;  3F73 A;  4DV2 J;  2VAS A;  2BV3 A;  2DGW A;  5C25 B;  4M5K A;  1OQ6 A;  3RAQ A;  1D9A A;  2UVW A;  1RKJ A;  5HLF A;  1YJ9 S;  3RB0 A;  5MAO A;  2CJY B;  5AT1 B;  1UFL A;  1FF2 A;  3AD7 C;  4QR1 A;  4DV7 F;  1KR4 A;  4LRE A;  4X4V A;  2WK4 A;  3SQG A;  2HNY A;  2IHR 1;  2GGP A;  1NK8 A;  2Q6B A;  2XCA A;  4OHY A;  1LXN A;  2VC1 A;  4LJM A;  4ZPA A;  2CPH A;  3HFK A;  1Q8L A;  1NSP A;  4KHP J;  4DPU A;  3KWM A;  3A8I A;  4OJ3 A;  3DRY A;  4NXN J;  3I0R A;  4LF4 F;  3HVT A;  1AUD A;  1FJG F;  4GRS A;  1KQG B;  2Z4P A;  4GC7 A;  3G87 A;  1RQ0 A;  3M8S A;  2E5H A;  3CF5 Q;  2OSQ A;  1YDL A;  2VON A;  2R8I A;  2HFO A;  2JOQ A;  3NAH A;  2KVI A;  2KG1 A;  5IOL A;  4F3Q A;  1Y3K A;  3M8Y A;  4RW9 A;  4QPT A;  5B0E A;  2FJV A;  1VBX A;  1RHK B;  3MXH P;  2JVR A;  1WDD A;  2V8V A;  2GC8 A;  4XPE A;  5DDR C;  3C2P A;  4YB6 A;  1T9X A;  4ZVG A;  3A8K A;  3EZO A;  1OWX A;  3C16 A;  4BC9 A;  1X9M A;  3KDO A;  3MM9 B;  2B4U A;  2Y8Y A;  1RHR B;  3M2R A;  2VFV A;  1T11 A;  4A8F A;  1RZM A;  4LIW A;  3KHR A;  4KHP F;  4LFA J;  4BC7 A;  2D7S A;  4RNO A;  3IGV A;  3UO0 A;  2W9A A;  4NXN F;  4KV8 A;  2I8E A;  3I31 A;  2FJW A;  1HBN A;  2XGP A;  3CWJ A;  1OIA A;  1KN6 A;  1HWL A;  1SCJ B;  3BBC A;  2HW3 A;  3BB5 A;  3I4H X;  3TAM A;  3NWR A;  1S6Q B;  2LP4 A;  4O3Q A;  2GS8 A;  2PFD A;  3I55 S;  1RJJ A;  4QW9 A;  4ZOS A;  1KLN A;  3QJL A;  3EGV A;  1NHV A;  2QT7 A;  3W5Y A;  1KDN A;  2BW2 A;  2QEX S;  3QLH A;  2LEP A;  1NB7 A;  4FVC A;  4CO0 A;  2PT0 A;  4JV5 J;  4FPR A;  3B6B A;  1FI4 A;  2MKI A;  3EX7 B;  4DR4 J;  3IM8 A;  1ZZF A;  5ETS A;  5G0R B;  3G6X A;  2K3K A;  4DUY J;  1DTT B;  2KB2 A;  4FZV A;  2W4P A;  3NS7 B;  4ZIW A;  1I5O B;  2C2E A;  5C2C A;  2D3U A;  1BQN B;  5LMN F;  1NPP A;  1L3K A;  4LFA F;  2V2K A;  4PG7 A;  1SQG A;  3TA0 A;  3SSQ A;  1U1N A;  4P2X A;  4Y65 A;  3IAS 9;  2NUU G;  4CQ1 A;  2G0I A;  3MF5 A;  3PHT A;  3TI0 A;  4RW6 A;  1N36 J;  3HF5 A;  3OTC A;  4OYZ A;  4DN9 A;  4NLT A;  3HM9 A;  4WP9 A;  1KWM A;  4UUX A;  3OSN A;  3RTV A;  3THV A;  5EWE A;  2O67 A;  3PW2 A;  3JTO A;  4CTA B;  3AD8 C;  1H0H B;  1TL7 A;  2XMU A;  1EQM A;  2L9N A;  3MEC A;  1BGX T;  4JV5 F;  3H4B A;  4ZVO B;  3R5D A;  1UTA A;  5KG3 A;  2YNF B;  4DR7 J;  2GIF A;  3OR2 B;  1M1K T;  2UUW A;  4FYV B;  2FTR A;  2FJD B;  3CCT A;  4DR4 F;  1P9Y A;  4KE5 A;  5DQI A;  1AA1 B;  1RSC A;  2E9R X;  5H9F K;  3SV4 A;  3QZ7 A;  1RWP B;  5F8H A;  2Q6C A;  5IV3 A;  1RBL A;  2HND B;  1EET A;  1S1V B;  3PJW A;  2QMX A;  4LF7 F;  3LWM A;  5RUB A;  3KK2 B;  2IAJ A;  1EP4 B;  1N5S A;  4ERD A;  4LFC J;  1CQM A;  1DAR A;  3FZ2 A;  2J0W A;  1YQH A;  4J9Q A;  5KT4 A;  3PX4 A;  2AGP A;  1KTQ A;  2E44 A;  1N36 F;  5LJ5 Y;  4WFA Q;  4TYA A;  2B9E A;  1RAH B;  1YG0 A;  4ZPV R;  1ZAW A;  2OTL S;  4DQP A;  3PG9 A;  2E1R A;  2JEJ A;  4WBF A;  3W66 A;  1U1Q A;  1ICE B;  4NLW A;  2YPY A;  3DOL A;  4P6Q A;  4JI2 F;  4MKA A;  1S4E A;  4PWD B;  2O3D A;  5KG4 A;  1WOS A;  1FTR A;  3V81 B;  1JMT A;  4DI6 A;  4DR7 F;  2DGX A;  4WII A;  3SEO A;  3V6J A;  5D15 A;  1IQZ A;  1GX6 A;  4U96 A;  2IFX A;  3K2Y A;  5KFZ A;  4RO0 A;  2GML A;  4UZB A;  5ETL A;  2JNJ A;  3NNH A;  1HIY A;  1M90 T;  1CC7 A;  2ASY A;  4RNH A;  1G1X A;  4IUF A;  1V3R A;  1SKW A;  2RQK A;  1MWZ A;  4PPD A;  3UVJ A;  4LFC F;  5A6W A;  2GJI A;  2DNG A;  4LF9 J;  4FVM A;  3LP0 A;  4C0O C;  5E3A A;  3EVM A;  2KZZ A;  3BYR A;  1RAE B;  4F04 B;  2JFK A;  3T6J A;  1K73 T;  4ELT A;  4JI1 J;  1B0V A;  3TAR A;  3ZC4 A;  4CLS A;  2JC0 A;  3DGP A;  2J9D A;  4B3T J;  4OI3 A;  1SKR A;  2DH8 A;  1XMB A;  4C98 A;  4AXI A;  3SCJ E;  2IIH A;  4N56 A;  1Q95 G;  2ZVI A;  4L6V 3;  4WFB Q;  3W65 A;  1IBL J;  1RU1 A;  3W5Z A;  1QE1 B;  2CQD A;  3IP0 A;  2NYI A;  1U49 A;  3T41 A;  3FSY A;  3DLK A;  4USJ C;  2KL8 A;  4CYU B;  3M30 A;  2ASD A;  1RTZ A;  1N5Y A;  3TYT A;  3V4I A;  1F5C A;  3D1H A;  3TAP A;  2OEL A;  3SDE B;  2RHQ B;  5MLC V;  3CJ0 A;  1DQ9 A;  2WCX A;  2R8J A;  1C4C A;  2Y1R I;  4RNM A;  4JYA J;  2WB1 D;  2HRT A;  2ZH7 A;  2XS2 A;  2ABY A;  1NDP A;  3K5O A;  2DGV A;  2MY7 A;  4LF9 F;  4RWX A;  1L5U A;  1NLK L;  3C14 B;  2BQ3 A;  2CQ2 A;  1RHJ B;  4BCA A;  3P8B B;  3FQK A;  3KNA A;  2AYE A;  4PWU A;  2XLJ A;  1T3O A;  5D4L A;  3L95 X;  1PKU A;  1VOM A;  1JNR B;  1SC6 A;  4B3T F;  5A76 A;  3OR1 A;  2QSF A;  2B8P A;  5CHC B;  3WX4 A;  1RAF B;  3CTR A;  1HLW A;  4P71 A;  1CS4 B;  1U7L A;  1QAX A;  2MJN A;  1D8Y A;  2GHW A;  2DHS A;  3FK4 A;  3A3O B;  3KLI A;  3UWT A;  3B8H A;  2BKP A;  1D1U A;  3MUR P;  3OHB A;  4U7U D;  3NAI A;  4EYI B;  4NLS A;  2R7X A;  5HVG A;  1RLD A;  3OVA A;  1T03 B;  2PC6 A;  1VRQ C;  1RAB B;  4RBV A;  3E01 B;  4JYA F;  1SC4 B;  3TNV A;  3JTN A;  3HHL A;  2N3O A;  2K2P A;  1TK8 A;  8RUC A;  3JAM Y;  3WBZ A;  5KG2 A;  2BE9 B;  4FYY B;  2GQ2 A;  4M1K A;  4KHM A;  1WSV A;  5KT6 A;  3CCJ S;  2ZC3 A;  1FXL A;  3M32 B;  2YY3 A;  2RVJ A;  2SXL A;  2NXC A;  2QO3 A;  4EU0 A;  1RWU A;  4DV3 J;  3RBD A;  1N6Q B;  5LL6 d;  1JQG A;  3W64 A;  1VQL S;  2OD6 A;  3QYY A;  1HWK A;  2A6O A;  4HHU A;  1RAC B;  1ELO A;  3OT9 A;  1S0N A;  4C8K A;  3VQT A;  1RBA A;  2YTC A;  3NS5 A;  4TYB A;  4EFA C;  5FJ4 A;  4OJ1 A;  5CH7 B;  1KQF B;  3ULH A;  3VAH A;  3I5C A;  4OX6 A;  5KOX A;  4AT1 B;  3IBW A;  1AZS B;  2FHO B;  4ZVS B;  4AUK A;  2LEB A;  1OYD A;  5D78 A;  3M1V B;  4ZJO A;  2CZ9 A;  2QL5 B;  5IV4 A;  1BLU A;  1LXJ A;  2IBK A;  2N82 B;  2HZA A;  1P1L A;  5IT9 Y;  3IR6 B;  1KC8 T;  4CO5 A;  4DX6 A;  2BVZ A;  4IG0 B;  2LDY A;  1IVZ A;  2JVO A;  1R0C B;  4IH5 A;  3ZFV A;  3KLG B;  2H5J B;  3P5T L;  1PIE A;  1XR6 A;  5KFS A;  2XI3 A;  2YWH A;  4B17 A;  3BKU A;  1REV B;  1SIW B;  4PYD A;  3TWZ A;  3RZA A;  4X4P A;  4CNY A;  3G82 B;  4IG3 B;  4NYO A;  5I3U B;  2LU1 A;  1HNV A;  4ZK7 M;  2GMJ A;  2DGS A;  5IZH A;  4AL6 A;  2W2M P;  1CJT B;  1F2G A;  2H1Y A;  1RA7 A;  3GIK A;  4WZQ A;  4M5H A;  2ZUG A;  5LXR A;  5GAE U;  2BX6 A;  4B3O B;  3LAK A;  2F5G A;  5E0O A;  4PUO B;  2KH9 A;  2MQQ A;  5A2Q U;  1VDH A;  1VC5 A;  4NZ7 A;  4F67 A;  1JK9 B;  1BY9 A;  1NSK L;  1KRP A;  5I4M A;  5GME A;  5K14 B;  4DSE A;  4LRA A;  4Q0B A;  2OPP A;  3SSS A;  3Q86 A;  2KTQ A;  1HAR A;  2GZO A;  1BWE A;  5ETV A;  3D66 A;  3RU0 A;  1KSP A;  2NS1 B;  3GE9 A;  4TN2 A;  4DV6 J;  1VRU A;  1D8Z A;  1IWG A;  5IM0 B;  2OEK A;  1QAY A;  3J80 Y;  3KDN A;  1RTI B;  3KG4 A;  1NPK A;  2G4B A;  1PO6 A;  1FX4 A;  1WNE A;  2WSE C;  1QAI A;  5HJY A;  1JLQ A;  3FFI B;  2MZS A;  4OZN A;  4ZIT A;  5KG5 A;  2N7C A;  1S1W A;  3KHG A;  1QSL A;  2GJ2 A;  3FMW A;  4F50 A;  3KHH A;  2DPI A;  3KUH A;  4OZ0 A;  3HK2 A;  2B51 A;  3QWP A;  4DR5 J;  1WTB A;  4OX9 J;  5D0G A;  1Q7Y T;  5L1K A;  3CD5 A;  4KJI A;  4QBU A;  3VAK A;  5K8M A;  1YIT S;  1YRX A;  2D9P A;  2V8H A;  1UMJ A;  1JJ2 R;  2QA1 A;  4IKA A;  1Q4R A;  2PI4 A;  2BBE A;  2IJF A;  2OPS B;  3GII A;  1LQ9 A;  5ETP A;  2BJ3 A;  2EKN A;  3AOD A;  2V94 A;  1V3S A;  2NXN A;  2R8K A;  4CTA A;  5DG9 A;  3PCO B;  2VG6 B;  2QC3 A;  4EZ6 A;  4OYW A;  2RUS A;  4KFB B;  3EUN A;  2ZNY A;  3HT0 A;  5KFB A;  2M2B A;  2FJA B;  4DV6 F;  3Q8R B;  1SV5 B;  2UVU A;  3DLG B;  5IC6 B;  2VJU A;  2WON A;  4KO0 A;  1RT1 B;  2F8M A;  3VAJ A;  2MGZ B;  1BXN A;  3MMJ A;  1D0E A;  2UZA A;  4AND A;  4AL7 A;  4ECS A;  2J8S A;  2HBQ B;  1VGY A;  4EMD A;  4HI2 A;  4C3L A;  4KYZ A;  1C0U B;  3UE2 A;  1M5S A;  5HJX A;  4YOE A;  3AFG A;  1X4G A;  1UVN A;  1S1V A;  5LSR A;  4DFM A;  4CO4 A;  5T41 A;  5EDW A;  4I4B A;  4LSL A;  2MPU A;  3GQC A;  3CO0 P;  1CJV B;  2V69 A;  3BPD A;  2OMO A;  2K3I A;  1CEZ A;  3NGD A;  1I3O B;  1VQO S;  2H48 B;  1YJR A;  4ETZ A;  1SBR A;  2IY5 B;  2HVE A;  2QE5 A;  4OZ2 A;  4ZPD A;  5BYR A;  1UEU A;  1LKZ A;  5KFK A;  3D6H B;  4PWD A;  1FNM A;  1UFW A;  3QO9 B;  4QU7 A;  4QZV B;  3HO1 A;  1UJ5 A;  2EXU A;  5L1I A;  1GQE A;  1RT5 A;  2XWX A;  2CPE A;  3OFG A;  4NLR A;  1X4E A;  3GIL A;  1S79 A;  2HS4 A;  2HVD A;  2MKJ A;  3MR3 A;  3DN9 A;  1F5B A;  1U2C A;  2P9G A;  5J1N A;  1FT8 A;  2QFJ A;  3BBF A;  4ID5 B;  2MKK A;  3UFC X;  3DKD A;  2ZOG A;  3JYT B;  4UST A;  4ZVR B;  3ZTO A;  2IA0 A;  1Q8B A;  3MWB A;  3SFG A;  2R2R A;  4MK8 A;  4IOC Q;  2O01 C;  1R89 A;  1PJ5 A;  5B0B A;  2DR6 A;  2I2Y A;  3IBC B;  4KKO A;  3GFZ A;  2H4W B;  4X4U A;  1SQF A;  4ETX A;  4DUZ F;  2QX0 A;  2UXB J;  3LO3 A;  2HQC A;  2G13 A;  4I6W A;  3DU5 A;  4YDX A;  4QIW D;  2AW0 A;  3MOJ B;  2ALY B;  4Y2A A;  2CQ3 A;  2AZ3 A;  2IPO B;  1TUG B;  4C8L A;  4DR2 J;  3AHP A;  3MR2 A;  4PR6 A;  3QFW A;  3KLF A;  3PW5 A;  4HDH A;  1F60 B;  3FBC A;  3UD5 A;  2DD8 S;  2NUH A;  4U9R A;  4ZDN A;  5DG7 A;  4ED5 A;  3EDQ B;  1NME B;  2GIR A;  2DY9 A;  1S6P B;  2OML A;  2CQG A;  4CYU A;  3DLE B;  1AUS L;  1U09 A;  4QIG A;  1FO1 A;  2F4V F;  2HZC A;  2ZD1 B;  1HD1 A;  2H65 B;  3M7V A;  1ZM9 A;  3DOK A;  3IMQ J;  5JVG Q;  2J6U A;  1RTD A;  3ZO7 A;  3ENV A;  2W24 A;  1WKK A;  1YIJ S;  4TY8 B;  1X4C A;  3R5J B;  3KK3 A;  3TOQ A;  2YX1 A;  3R2C J;  3IBF B;  2FY8 A;  3T6B A;  1I51 B;  3KOA A;  2QTW A;  5C7P A;  3EXY A;  3MPU B;  2ZJR Q;  1BQX A;  3EGZ A;  1K0T A;  2LXF A;  2XHW A;  4FKX A;  6AT1 B;  1JLE A;  4FF1 A;  1YRT A;  1TKT A;  5HMX A;  1V9O A;  3R5C A;  3J7Y U;  2W4C A;  3M2U B;  1XNR F;  3AOB A;  1FWK A;  1FA0 A;  5B0G A;  3UN5 A;  1NCL A;  3RGI A;  4DR2 F;  4R0E A;  5CCL A;  4ITS A;  3ETM A;  4L3N A;  4DWI A;  1VK3 A;  2R9L A;  1F1B B;  4DSJ A;  2B9Y A;  4MIA A;  1PGZ A;  1CBK A;  4DX7 A;  3ICL A;  1NK5 A;  1NK7 A;  2F8H A;  2RU9 A;  3JXO A;  2HRU A;  3MPD A;  2OPR B;  1FFS B;  1HA1 A;  2U1A A;  4F2R A;  2YXL A;  3PX6 A;  2W1B A;  2DNK A;  3MPV A;  3AXM A;  3CO9 A;  5AXN A;  4DPX A;  2VOO A;  4U7C A;  3WZ0 A;  4YR3 A;  1H7W A;  4NWB A;  2NPI A;  1WEX A;  4ALZ A;  4MTP A;  4DR3 J;  4KR0 B;  3CCS S;  1QSY A;  5A8W A;  1R6Y A;  1FER A;  4GVB A;  4Y00 A;  2DHX A;  3HDS A;  5J2M B;  1S1U B;  5DDQ C;  4HLB A;  2CDR B;  2H9Z A;  2OUG A;  4LF6 J;  2DNN A;  3WIV A;  2CIM A;  2HHT A;  1S6O A;  3VCD A;  1XIQ A;  2WSC C;  4YME A;  1TU0 B;  2L3M A;  3GZ7 A;  2OJ3 A;  4RNF A;  3DXS X;  5DDP C;  5G4D A;  1NHU A;  4DN0 A;  4DF8 A;  4Y2C A;  4OZL A;  4ICL B;  3BV8 A;  2NXU A;  3QGH A;  4KPC A;  4KPY A;  3PKM A;  4IFY A;  5ETQ A;  3R5A A;  1AZS A;  4B3R F;  3QT5 A;  2Z2Z A;  3M1V A;  4ECU A;  1HW9 A;  3KFW X;  3X3U A;  4A8X A;  3CCW A;  4RKU C;  1WOR A;  2DGT A;  4ECQ A;  2VC0 A;  1RT4 B;  4WU3 A;  4ZHR A;  1U1K A;  1UET A;  3MM5 B;  3CJ2 A;  5T7L A;  3G71 S;  4MYT A;  3DRS B;  4IG0 A;  3OTE A;  1OJ4 A;  1N32 F;  2KYZ A;  1H74 A;  4R5P A;  2KHD A;  4ILL A;  5J2N A;  1IXK A;  3POT B;  4DV4 J;  1QJH A;  1G3O A;  1WF1 A;  2XMV A;  2DIS A;  1M5K C;  1N52 B;  1WHX A;  2OEJ A;  1O5J A;  4CLF A;  2ZOF A;  3O2I A;  1X4A A;  1PAE X;  3N79 A;  1WDT A;  2R2S A;  4IG3 A;  5I3U A;  5J2P B;  3UI3 A;  1K47 A;  2MY8 A;  4C3M A;  3AJ1 A;  2DR9 A;  1WWH A;  1XK8 A;  1CJT A;  1YWX A;  5F0W A;  4ZLN A;  2FHJ D;  3FEY B;  4YP3 A;  2FJB B;  2R7R A;  2C3O A;  3OVS A;  4OI6 A;  1WUU A;  3T5H A;  2DRA A;  1IQT A;  2KFN A;  1U2R A;  5J1E B;  1WF2 A;  2E9T A;  3JB9 k;  5BR8 J;  1WHY A;  1UEV A;  2ASJ A;  2AGQ A;  2M8D B;  3LUY A;  2Z57 B;  2L9D A;  1NB2 A;  2RIL A;  5DQH A;  1YJT A;  3TEG A;  3W62 A;  3ITH B;  1WC6 A;  3FUY A;  5CQG A;  3IM9 A;  1S0V A;  2CWK A;  2J9E A;  3M8Q A;  5J1P A;  4FYW B;  4K4X A;  1FXD A;  4K4V A;  1RTI A;  4DV4 F;  4QYZ K;  3E51 A;  1HBM B;  3FFI A;  2GVD B;  3DU6 A;  3JSM B;  5JVH Q;  4I64 A;  1JWW A;  3V4M A;  4TU8 A;  1DLO B;  3RUB L;  4WKY A;  2MZT A;  3EM1 A;  3GV7 B;  3HJV A;  5K20 B;  4N8N A;  1RT7 A;  1IKV A;  2AX1 A;  1GEH A;  3HFV A;  2IVY A;  2ZWO A;  4A46 A;  4B3M J;  1EZZ B;  2K7K A;  2KVQ E;  3FCH A;  5BR8 F;  2HVH A;  4DFP A;  2OPS A;  1KS2 A;  5EN1 A;  4O23 A;  3C6U B;  1MLA A;  1P27 B;  1EIY B;  4X66 J;  3MGJ A;  1N0V C;  4TQS A;  1FK9 A;  4L74 A;  3IA0 A;  4C48 A;  2FVS A;  3TUP A;  2BAB A;  2A6M A;  4NXM J;  1JLB B;  3QGG A;  4WP3 A;  2BJD A;  2J9D E;  2A2D A;  2JX2 A;  2FJX A;  4JB8 B;  1WOP A;  2C2D A;  3RW7 A;  4X62 F;  2AX0 A;  5HN0 A;  2NYH A;  4I67 A;  1X4H A;  2OPQ B;  1MRO B;  2VUG A;  5EX3 A;  4ED4 A;  1RT2 B;  1C0U A;  4IR9 A;  3PEJ A;  4QJV A;  4FNH A;  4O4G B;  2ZBC A;  2PMZ D;  4O3R A;  1XMQ J;  1TVR A;  1HNX J;  4E98 A;  2Y1J A;  4B3M F;  1NRK A;  2W2O P;  1N33 J;  1CJV A;  3I5A A;  1RP5 A;  5ADZ A;  4A8Y A;  1S9G B;  2J7W A;  3R2D J;  4X66 F;  1FRJ A;  4OHZ A;  2OLW A;  2RKI A;  3IN5 A;  3B78 A;  4B9N A;  2RDI A;  2V4Q A;  4CCH A;  4Y34 A;  4U67 Q;  4NXM F;  3QBC A;  2HLU A;  1FNX H;  2UXD J;  5KG6 A;  3KJN B;  1RWN B;  3QWU A;  2YNH A;  3JQM A;  1Y00 A;  1FDN A;  2QL7 B;  4NRT A;  3HMJ G;  2H3E B;  2FJE B;  2FHM A;  2ZWP A;  4LRC A;  4USI A;  1OY9 A;  3M8P B;  4ID5 A;  1ZH5 A;  3JYT A;  3G4S S;  3NL0 A;  4F36 A;  5DM7 Q;  1U1O A;  5HRO A;  3ENQ A;  1TKX B;  3MCO A;  2HNZ B;  3ZTR A;  4PG5 A;  5DJB A;  2HGL A;  1HNX F;  3BQ2 A;  3CCL S;  1N33 F;  2ALZ A;  2CJ9 A;  2XM3 A;  4IQX A;  1X60 A;  5DZ7 A;  3FBB A;  5KTQ A;  2Z0G A;  3CMA S;  5GAH I;  3RRH A;  4NOH A;  1AW0 A;  1LW2 B;  3MM8 A;  2MHE A;  2V50 A;  5KFQ A;  3U02 A;  1URN A;  3BQ1 A;  4GO5 X;  1R0B G;  2BRL A;  2VU5 A;  1OSD A;  2A3J A;  4WP8 A;  1LWE B;  2L48 A;  2G1D A;  5DZ6 A;  1FKP B;  3MAA A;  1PAU B;  3MEE A;  3BKT A;  3KLE B;  2VBZ A;  2B8Q A;  2XSJ B;  3M2V B;  1S6P A;  4EYH B;  1VLO A;  3MMA B;  1FE0 A;  1FCA A;  3QZ8 A;  4Q45 A;  1UKU A;  2QLJ B;  3GWC A;  4E2F B;  1N54 B;  1W26 A;  2WVC A;  1TQL A;  3FSI A;  3KG1 A;  2ZHB A;  3OUY B;  4TY8 A;  5CD4 H;  2RH3 A;  4KGK A;  3UDE A;  1UWB A;  1RWO B;  3AH6 A;  4CI0 B;  2ZBI A;  1SH0 A;  4DCP B;  1HI8 A;  4A8S A;  2YQ0 A;  1AB8 A;  1SL1 A;  5A0Y B;  1HPZ A;  3PW7 A;  3M2U A;  3I9Z A;  2AJQ A;  3NGK A;  2R4F A;  3M8Z A;  3TZY A;  3N6M A;  1BQM B;  3LPY A;  1CLF A;  3DM2 B;  4C3K A;  3KUG A;  2DIV A;  4P9S A;  1ZPW X;  4RWW A;  2A0F B;  3O3L A;  4CZC A;  1RUS A;  3GSD A;  5D3G B;  1QVF R;  5KFG A;  1RBO B;  2DR8 A;  1X5P A;  5DLF A;  1FFG B;  4HH0 A;  4MJK A;  1RKI A;  5CA5 A;  4CNZ A;  5CD4 A;  4TLQ A;  3MR7 A;  2EPI A;  3LWL A;  1RWW B;  3O5T B;  3RB3 A;  2QGF B;  2MSS A;  4HTI A;  5C2G A;  5J2Q A;  1U0H B;  1TL3 A;  4U7U K;  3E8O A;  1QTM A;  5E3P A;  2DXE A;  2E5I A;  3DFE A;  3DI6 A;  1NAQ A;  4G6V B;  3AA8 A;  3EVW A;  2RDD A;  3NCQ A;  2E5G A;  4I7F A;  1HI1 A;  3HD2 A;  3PEH A;  4P73 A;  2JFD A;  2KU7 A;  2A10 A;  3PX0 A;  3OL6 A;  2V8P A;  2DHG A;  5KFO A;  2XMA A;  1S1U A;  1B64 A;  5CYJ A;  3LA0 A;  2BZ2 A;  2ZZM A;  1KHV A;  1QUV A;  2MZ1 A;  1KVK A;  5KFV A;  1YJV A;  3HHD A;  3PIO Q;  2IDL A;  3LAL A;  2QLW A;  2YKM B;  2HQD A;  1SJ3 P;  1MMD A;  1DBD A;  2EFN A;  3GIM A;  3CDE A;  1R8A A;  3GMG A;  3HHK A;  3GYX B;  3L7O A;  3FKB A;  3VZH A;  2HAI A;  3VV2 B;  3I87 A;  4ICL A;  4CLW A;  1QLN A;  4RU2 A;  1RXO B;  1CJU A;  1GT8 A;  3D6F B;  3WX8 A;  1YZ6 A;  4Y2K A;  1E6Y B;  2CVI A;  1MML A;  4WE1 B;  1B7F A;  1PYS B;  3GR1 A;  4DV0 F;  3NRB A;  2U2F A;  2CUY A;  3CUL A;  1CJK B;  1RYS A;  2MTL A;  1RT4 A;  1CSJ A;  3NGS A;  1KFD A;  3E3X A;  4CM0 A;  3NOC A;  2ZH8 A;  3TJ9 A;  3MM5 A;  1KOO A;  3QJP A;  4MIB A;  2B7C B;  1GMW D;  2FHK A;  3FCW A;  1NDK A;  4KY3 A;  2GAG C;  4P2S A;  1NEE A;  4L76 A;  5KFJ A;  2MEW A;  9ATC B;  5B08 A;  4F8R A;  3PRB A;  4ECZ A;  4JV0 A;  2MKS A;  2WB4 A;  2VOP A;  5L39 A;  1X9S A;  3KJV A;  1RWM B;  4FS1 A;  2E7V A;  5J2P A;  1TL1 A;  2NCK L;  2CPD A;  2DCL A;  1GMV A;  1X0P A;  1N4L A;  3GSI A;  1YLX A;  4I6Y A;  1C4A A;  4H4O B;  4ZVF A;  5ITH A;  3NLC A;  5HP1 B;  1JB0 C;  4PKD B;  5CAA A;  1NKE A;  1TK0 A;  3HHL D;  4P7T A;  1J5O B;  1B0T A;  5JMN A;  2C2R A;  3PFE A;  4HI1 A;  1HNI B;  4DLE A;  1JKH B;  1YBT A;  1HL6 A;  4ZCK A;  3NXZ A;  3C19 A;  1VRT A;  1SJR A;  1CUL B;  3QSI A;  3CT9 A;  4U95 A;  2RE1 A;  4NYZ A;  5H1S V;  4JI7 F;  4RW4 B;  2VKR A;  2ATL A;  3CDU A;  3AOA A;  2NQP A;  4USM A;  3A3N B;  2DEI A;  2RIJ A;  2QA4 S;  1RYR A;  1Y5I B;  2FLO A;  3P5B P;  4ES2 A;  2COL A;  2W25 A;  4TY9 A;  4ES1 A;  1HBM A;  5FLX U;  3TEH B;  3D28 A;  2CJQ A;  3LF0 A;  2IC3 B;  4H4K A;  2CVE A;  2GVD A;  5IS2 A;  1GAO A;  1WC4 A;  3PVX A;  1VI7 A;  2BEF A;  4J9P A;  4IFV A;  5FD1 A;  1R8C A;  1RT3 A;  2DNY A;  4OI1 A;  3AOC A;  1WC5 A;  2D69 A;  3PYD A;  1RWV B;  2WSF C;  4RJV A;  4FPI A;  2EBE A;  4YHH F;  4PCQ A;  3C6U A;  2XY6 A;  3S01 A;  3PHE A;  3IS9 B;  3I4P A;  3TW0 A;  2MHN A;  1HWJ A;  2J0S D;  1HQE A;  3LP1 B;  2B9W A;  1ACM B;  4NAS A;  5B0D A;  3ADA C;  2V2Z A;  1T95 A;  3D54 A;  2QYG A;  4CDI A;  5C24 A;  2EI5 A;  3Q83 A;  4FDF A;  4FF3 A;  2IDE A;  4EGL A;  3KG0 A;  4LUB A;  4EO8 A;  5L9N A;  1GMU A;  1SXL A;  2DGU A;  5D0R A;  4DL2 A;  1VQ7 S;  1MRO A;  2XI2 A;  3QGI A;  1RT2 A;  2MST A;  3EPG A;  6FD1 A;  3MM7 A;  1S5Z A;  3PTW A;  4QCL A;  2RU3 A;  5E7O B;  4O4G A;  1H98 A;  3BJY A;  1KBR A;  1RI7 A;  1VQY A;  2QA4 G;  3PW0 A;  2W7A A;  5AJ3 J;  2ZH3 A;  5HK4 A;  2WW4 A;  1IKW B;  2XMM A;  1EHW A;  2VL1 A;  4IYQ A;  4MK7 A;  3C3L A;  3EGN A;  4DL4 A;  1YX2 A;  1Q79 A;  3W60 A;  5K8N A;  2ZM6 J;  4ED7 A;  2EK6 A;  4JOU A;  1F9F A;  3AB4 B;  1S9E A;  4J9R A;  1T02 A;  4DR6 J;  2QMW A;  5EX0 A;  2NR0 A;  3S6E A;  2PGC A;  4AXJ A;  1TAQ A;  2AQ4 A;  4LSZ B;  1XER A;  2AGO A;  3LH2 S;  3RBZ A;  1FWL A;  3MI7 X;  3G2X A;  3H42 A;  2DRD A;  2HHQ A;  1I94 F;  1C1B B;  2QYC A;  2B43 A;  2YX4 A;  1JLA A;  3PDN A;  5SZT A;  1TKX A;  4LVN P;  2HNZ A;  3RB6 A;  3IRX B;  1RGV A;  1C1C A;  1RCO B;  2KHC A;  4EBD A;  2FLP A;  4URS A;  5AJ3 F;  3TVZ A;  3LW5 C;  3G8T A;  4OLP A;  3G8Q A;  3ZZP A;  5IXU A;  3SZ2 A;  2BDP A;  5A2Q Y;  1SKS A;  5KFA A;  1HQU B;  3VAG A;  2ZM6 F;  3KXD A;  2ZE2 B;  2EK1 A;  3BDP A;  5KFL A;  4U8Y A;  1GXT A;  4PAB A;  4LSN B;  1VS3 A;  4DR6 F;  4ZLL A;  3PYF A;  3GFH A;  4I0W A;  1FKP A;  1SPB P;  1NH8 A;  1OY8 A;  3KLE A;  4FBT A;  1NHK L;  3G6V A;  2Q66 A;  3M2V A;  1R27 B;  4PQU B;  3MMA A;  3OQ2 A;  2DVI A;  1EKS A;  3EMT A;  2HVZ A;  2BW7 A;  2MZJ A;  1ZA2 B;  2E7X A;  2EFO A;  1YK9 A;  3HSG A;  4DDF A;  1D9F A;  3Q89 A;  4OHX A;  5HSP A;  4X4S A;  5E33 A;  1Z2Z A;  3R1H A;  2YKQ A;  4OQJ A;  1Q8K A;  4JI8 J;  5JXS A;  1WEY A;  3K89 A;  1QDU B;  8AT1 B;  1IJE B;  5D4P A;  2J7K A;  1VIO A;  5KFN A;  4ECR A;  4RBU A;  3TJA A;  1FTC A;  5A0Y A;  2LU2 A;  1TUW A;  4A4J A;  2VJV A;  3W9I A;  4OYI A;  4CLK A;  4DR1 F;  3NKY A;  1BQM A;  1JJC B;  1YI2 S;  2Z2M A;  3QJJ A;  1HMV A;  4Q7A A;  1HD0 A;  4M5L A;  3L3C A;  1TKD A;  2GMH A;  4KB7 A;  4C97 A;  1JLF A;  5D3G A;  2I9S A;  1PC4 A;  1KVI A;  2VBY A;  3RBE A;  2UP1 A;  5LJ3 Y;  3D2W A;  2VG7 B;  4HT5 A;  3A8E A;  3D7S B;  3BYP A;  2AEF A;  1RWK B;  2W7O A;  4CIO A;  1Q0N A;  3DDK A;  4DV7 J;  2GIQ A;  1L3T A;  4ZIV A;  2W2N P;  2LQ8 A;  3W61 A;  2HHX A;  4X4T A;  1SH2 A;  1UL3 A;  3SFU A;  1U0H A;  3QIP B;  1FDB A;  1WHV A;  3IO1 A;  2VA2 A;  1TKZ B;  3SYZ A;  1R0A A;  1HBO B;  4ECX A;  4OX7 A;  4JI8 F;  4TU9 A;  3DDN A;  3ETO A;  3MD3 A;  5A8K A;  2EC2 A;  4Z2X A;  1NDL A;  4RUB A;  1MU2 A;  2HWH A;  2CPZ A;  3BR9 A;  3GCX P;  1SUQ B;  2LQ5 A;  4LF4 J;  2IMW P;  2JSX A;  2L08 A;  2FVP A;  1WC0 A;  1TZ0 A;  2YKM A;  4OI0 A;  3GU0 A;  4CH0 S;  2X7I A;  2ZZT A;  4OYP A;  2R7O A;  1KVJ A;  4URQ U;  5IT4 A;  1MG7 A;  2R2U A;  2VIC A;  4Y2I A;  3CCU S;  1N34 F;  1VHI A;  4XO0 A;  4FF4 A;  4EK2 A;  2YQ3 A;  1FJ7 A;  3D1Q A;  1NSA A;  3ELH A;  2NSC A;  3NP5 A;  4QU6 A;  2V34 A;  4K0K J;  3DNC A;  2EWH A;  3BH6 B;  5AE1 A;  2PE8 A;  3KLH A;  4BS2 A;  1M5H A;  2IM1 A;  2ADB A;  2M52 A;  2HMI B;  4DBQ A;  4UOF A;  4A47 A;  3AAW B;  2KXF A;  4LIR A;  3TA1 A;  3UN2 A;  3QT7 A;  4CLL A;  1FRH A;  5A8R B;  2G0C A;  1V5V A;  1UPM B;  4R25 A;  3MAQ A;  4JI3 J;  3NNA A;  4M5D B;  1WEZ A;  3H7H B;  3I9V 9;  3BGR A;  4C8Z A;  2HQG A;  2IVF B;  4UOG A;  5AXK A;  2N4D A;  3H90 A;  5GAG I;  3Q8S B;  4OZ5 A;  3R7S B;  3LGN A;  2HQI A;  1H73 A;  2CDQ A;  4HR2 A;  2V9W A;  4FYD A;  2ACM A;  3R7B B;  2QN6 B;  3CIM A;  2MLY A;  3TX8 A;  3GJR B;  1YVF A;  4DG1 A; 
#chains in the Genus database with same CATH homology
 1ICE B;  3KJF B;  3RJM B;  2HBQ B;  3EDR B;  2QLF B;  1RWK B;  2QLB B;  4LSZ B;  3GJQ B;  4ZVR B;  5IC4 B;  2CNL B;  3R5J B;  4ZVO B;  3R6G B;  2C1E B;  1RHU B;  2H5I B;  1PYO B;  3SIP B;  3IBF B;  2P2C B;  1RHK B;  1RWM B;  1I51 B;  3QNW B;  1RWX B;  2CJY B;  2CNN B;  2DKO B;  3IBC B;  2H4W B;  4ZVS B;  2Y0B B;  1PAU B;  2HBR B;  3KJQ B;  3KJN B;  1RWN B;  2XYH B;  1SC1 B;  2C2Z B;  2CDR B;  1QDU B;  1I3O B;  2QL5 B;  1RWP B;  3D6F B;  2H48 B;  3NS7 B;  2CNK B;  1SC4 B;  2QL7 B;  1RHR B;  1RWV B;  4JB8 B;  2H4Y B;  3P4U B;  1RWW B;  2CJX B;  2H51 B;  4ZVQ B;  2CNO B;  3D6H B;  2QLJ B;  1F9E B;  3GJS B;  1GFW B;  4ZVT B;  2HBY B;  2H54 B;  1QTN B;  4ZVP B;  2FQQ B;  2XZD B;  4ZVU B;  2C2K B;  2C2M B;  1RHJ B;  2XZT B;  2C2O B;  3GJT B;  1SC3 B;  3EDQ B;  1RWO B;  3P45 B;  3R7S B;  1NME B;  4DCJ B;  5K20 B;  2HBZ B;  5IC6 B;  1BMQ B;  1RHM B;  2QL9 B;  2H5J B;  3D6M B;  4DCO B;  1RE1 B;  3R7B B;  4DCP B;  1IBC B;  2Y1L B;  2XYG B;  3GJR B;  2XYP B;  2H65 B;  3R6L B;  3R7N B;  1RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...