1AZSA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
190
Chain Sequence
DMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (lyase/hydrolase)
molecule keywords VC1
publication title Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 58
structure length 190
sequence length 190
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1azsA00
4OYZA 1YBUA 4OYIA 4OYPA 1CJKA 4OYOA 3MR7A 2WZ1A 5IV4A 1CJTA 1TL7A 1CJVA 4OZ2A 1CULB 1FX2A 1WC1A 2GVDB 1FX4A 1CS4A 4OZ3A 4CLFA 2BW7A 3ET6A 4CLLA 4USTA 4P2FA 4CM2A 3R5GA 1WC6A 5D0HA 1CJKB 1Y10A 4OYBA 4USUA 1Y11A 1CJTB 1TL7B 1CJVB 4CLKA 1WC4A 1YK9A 3MAAA 5D0EA 1CJUA 1CS4B 4P2XA 3C16A 4WP9A 3ET6B 4CLPA 4WPAA 1U0HA 3C15A 4USVA 3C14A 5D0RA 1YBTA 1AZSA 3MAAB 4OYXA 4USWA 1AB8A 1CJUB 1WC0A 3G82A 3C16B 2QV6A 1WC5A 4P2MA 1U0HB 2GVZA 3C15B 4CLTA 3C14B 4CLUA 3UVJA 1AZSB 4NI2A 4OYWA 3G82B 4WP8A 4OYAA 4CLWA 4CLZA 2GVZB 4OYMA 5D0GA 3UVJB 4CLSA 4NI2B 1CULA 4CLYA 5IV3A 5D15A 2GVDA 2W01A 4CM0A 1WC3A 4WP3A
chains in the Genus database with same CATH superfamily
5LM7E 2XYPB 3PVXA 4EUVA 2U2FA 4CCHA 3MHYA 3DI6B 4USTA 1MNEA 4DR1J 4YY3F 1SH0A 5JMNA 2XYHB 1SL0A 2B7BB 2EC2A 1NK4A 1NH8A 3FBCA 3M9NB 2N3OA 4QIWD 3HHKA 4LRBA 3PYDA 2IC3B 4EK2A 3FMWA 2VQFF 4P75A 3PXGa 2KI2A 3G86A 2CQPA 5HQ8A 2XHCA 3Q24A 4ZJQA 3CEDA 5AXMA 2LQ8A 2KRRA 2ZNYA 4KRWA 2BQRA 1XC9A 1RWVB 1L3VA 3GIKA 4AD6A 3V5RA 2LQBA 2UP1A 2CPYA 4EBEA 3ZZOA 3RB3A 3D6MB 3H90A 3Q83A 4RWWA 1RT4B 3IWXA 5HP1A 2M3DA 2VICA 4GRSA 2CPEA 4IFYA 1WI6A 2FGOA 1PCAA 4NE9C 4DL7A 4Y3CA 1BHNA 1GK8A 1Q16B 3NGRA 4Q2MA 4DX7A 1TV6B 5D8HB 1NHVA 2VBXA 5GMEA 5CCLA 4A8YA 5CYMA 4X62F 2XY5A 4KKOA 3EPGA 2NXNA 2V8HA 1A9NB 3MUTP 1EARA 3TVYA 1X4CA 2QJ3A 4DPUA 4NXNF 4B3SJ 3ET6B 2MZJA 1FO1A 5E3AA 2R2TA 2IMOA 5KFGA 1DTQB 1WOSA 4WE1A 2B4UA 1LWEB 4OZJA 1RT6B 2HFVA 1WC5A 1NSKL 1F9EB 4C3KA 4DV0F 2KZMA 5DLGA 2UU9F 3WDOA 3D0HE 3J80Y 2J76E 1S72S 3GONA 4OX9J 1Y3JA 1OYEA 5IWAJ 3AB2B 5KOXA 3CCZA 3EVWA 3ZFVA 1VC5A 3L9ZA 3G8TA 3NS7B 1TAQA 3HJFA 5E0OA 1CBKA 2G9OA 4JI4J 2O67A 1ZAWA 2VQEJ 1S49A 3NY0A 4CNZA 4OYOA 1QVGR 5CHCB 2M2BA 1DJ0A 2ZE2B 4X66J 2ZH5A 3V6KA 1BXNA 3EMTA 4LF5J 1MROB 2VBZA 4J9PA 2VU5A 1M5SA 2YWGA 4NA2A 3ZXWA 4ZCMA 2AF6A 3CF5Q 3TZWA 4G1IA 2Q6CA 2HWHA 2XEXA 2DR7A 2DNPA 4K4ZA 4C8MA 5D0RA 2I5JB 3CDUA 4HHHA 5IT9Y 4WYLA 4ZVEA 3F56A 4K2JA 2F3JA 3KJVA 2XSJA 2FY1A 2KT5A 1JLEA 4OLPA 3Q8VA 4AL7A 1HQEA 4H54A 1EZZB 4O0IA 3C8YA 1S4EA 1NK8A 1IVZA 1RBOB 3TO8A 1Q4RA 4M95A 4R8UA 1VMBA 3BGRA 4KV8B 3OTOJ 2IJRA 4KGXB 4DR6F 3GIIA 2L41A 3OW2R 3FCWA 3BJYA 2BJ3A 1R8HA 1FDBA 4RW8B 4C3MA 4B9VA 1JJ2R 4HHUA 2DK2A 4E2FB 1TL3A 2BRKA 5DETA 4QIVA 2R2UA 3D68A 5HANA 1HWUA 1FI4A 3NGUA 1E6VA 1NDKA 2ZZNA 3Q8SB 3KLIB 4O0NA 2Z8QA 2YNGA 1U1NA 3AOBA 4P52A 1HBMA 5KFZA 4QYZK 3T5KA 2BABA 3CULA 1S6QA 1VBYA 2WTFA 1WKJA 2KDOA 3VVTA 2FPHX 4DSIA 4N5SA 2YWWA 1JK9B 2ZBIA 4Q45A 2PD1A 1X4HA 3JXOA 4PAAA 1FTCA 3PFEA 5J2NA 4DQSA 5K5MA 3LP2B 3NGSA 1JIHA 3C3LA 4ZVSB 1WJ9A 4V19X 4DZDA 2GZOA 2DGSA 3DRRB 4FZVA 1RTJA 2B5JA 2AWZA 4I6AA 2P2CB 2UVVA 2I38A 2Z56B 3LP1B 1EP4A 3M8PB 2RD5C 5F8MA 2MB0B 2IBOA 3QJJA 2XMAA 2XLIA 3NS5A 3AB4B 2B6AA 1NJIT 1VQ6S 2SXLA 5KFCA 3FBEA 2B3TB 2KG1A 1NDLA 2Z2YB 1S1VA 3KK3B 1H72C 5D3GA 5HLFB 2Z30B 3TZXA 3MR3A 2YNHA 3H25A 2LU2A 4KFBA 4J9QA 3ILIA 4H4MA 2EFGA 2JC0A 1UWBB 1YBTA 1KQSR 1JLAB 3TANA 3DRYA 4Q5VA 3VF0B 3KFWX 2A6OA 3D5MA 4LFAF 3T19A 4Y2KA 2LU1A 3OTBA 4JV2A 2FVQA 1XR6A 3DYAA 3M2VA 3JQJA 2C2ZB 1K1SA 4S0MA 1KRPA 1ZS6A 1L3TA 4R0JA 3EZ5A 2QRRA 3GP9A 3TA1A 4PEOA 1N0UA 3MR6A 1M1HA 2BKPA 1ELOA 2EI5A 3MEEB 1UKUA 1P9QC 5IV4A 4ZPTR 1HMVA 1K9MT 2F4VJ 4AXIA 4IO1A 5KFWA 2YWHA 4CTAB 3CC7S 1NAQA 3D6FB 2YNFA 2RRAA 3HFZB 2DTJA 4X65F 3TUZC 2MJUA 4URSA 3POTA 4TY8B 3BH6B 2R42A 3PCOB 5ETTA 2DXDA 4EBDA 1PO6A 4FXWA 4C98A 4QR0A 2OPPA 4NZ6A 5CYQA 1NBEB 2BKNA 1HNIB 4DPWA 3WIVA 1S10A 1RAFB 2MZQA 3R6GB 2HAIA 1VDHA 4DUYJ 4LSNB 1HHQA 3M6XA 1VQKS 1K1QA 1AFJA 5BYQA 5M2RA 1SC4B 2CJAA 2V2ZA 1LKZA 2DGTA 1YVFA 2VV5A 3BBBA 1R0CB 1VC6A 1T9UA 3O44A 2B51A 2IJNA 6AT1B 1XR7A 2E9RX 1H2UX 2ZM6F 8ATCB 4ELTA 4LR8A 4IDKA 3KHLA 2F9DA 4ZP7A 3ADAC 1UEUA 4ZN3A 3BPDA 4HHJA 1NB2A 1VIXA 3R6LB 5CD4H 2YWKA 3ZZTA 1NPKA 3B4DA 1TKXA 1J5EF 3R8YA 1BWEA 2BOAA 3THPA 4OMFG 3QT5A 4RBUA 3LPEA 2HGLA 1H38A 1F2HA 2ZH6A 5K20B 3PW5A 4DX5A 2RQ4A 3CJ0A 2NZCA 4ZHRA 4DV1J 1F3FA 4C0BA 4NMXA 2DY9A 4FYDA 1ZBTA 3F0NA 4ECQA 1HNWF 2V34A 2GGPB 1FRIA 4F04B 1C4AA 2GMLA 4KJIA 4JYAJ 3K58A 1UP1A 5AXLA 2IY5B 1L3UA 3ZTPA 2AJ2A 3TAPA 1LW2B 2Y8WA 1ULRA 1YWXA 1NKCA 4IRDA 2B43A 4USUA 5GADU 2JLFA 2UV8G 4PZVA 1D9DA 2OLWA 1HIYA 2VC0A 2JSXA 1BQMA 2E9ZA 3HFKA 3W63A 1T94A 2AZ1A 3I4HX 4ZP6A 5F8GA 5KOWA 2W9CB 3HVTA 1RKIA 3OJSA 3OTEA 3OSPA 2R7OA 2ATLA 1UFKA 2VG5B 4WU3A 2W25A 2Y1IA 1FE4A 1WACA 4FVCA 1BD6A 3LH2S 2UXDF 3MM8A 4RX6A 1Q79A 3BQ2A 1SBRA 2K7KA 1XWLA 4KAIA 2HIQA 1S6PB 1EHWA 2BQUA 1AUDA 4G1QB 2NLWA 1RU2A 1N32F 3R9LA 1DTTA 4DBQA 2XMTA 1RTDA 4QPXA 2CQ3A 3CJKA 4C0OC 1IR1A 4TYAA 2ZNZA 2HMIA 1E6YA 2OPPB 2KT2A 2JEJA 2L9DA 3AQOA 1NXIA 4I6WA 3V6DB 1NM2A 1NZ8A 1NJYA 2HHPA 3W9IA 1VR6A 4ILLA 1P27B 2HK2A 3N01A 4WFBQ 3UR0A 3CD0A 3PX6A 1OJ4A 2W2PP 4JI2J 1N34F 3LGHA 4DV7J 1PSDA 3I96A 2MGZB 4U7UD 2XGQA 5KFMA 4PG4A 3ONQA 1X9MA 3HSJA 2CQCA 2PMHA 1IKVB 4EBCA 2HNDA 1UZHA 4J9RA 1LXNA 4H4OA 4FKYA 3MM7B 3R5BA 2FHJD 2V68A 2GV1A 1HW8A 4C8KA 4QZVB 4DV4J 4DR7J 4K5SA 2FC9A 2D1CA 1N5VA 2G13A 4U8YA 5A8KA 3IXQA 4FNHA 2E5JA 1S4FA 1RWPB 4DCJB 4J37A 5CQGA 5L1KA 2MY8A 3UDLA 2ATCB 3CW2C 3Q8PB 1RAGB 4DN9A 1PC4A 4KY3A 2WOMA 4RBVA 1RADB 4KHPF 4P6QA 2O3DA 4A8SA 4JBCA 3VAGA 3HCXA 4HH1A 1TKTB 2E44A 2BJDA 3JS9A 3W9JA 4TXSA 2IFXA 3UDVA 4NEZA 4MK9A 4WZMA 3CMAS 2ZH7A 4DPTA 2H5JB 5DM7Q 3GE9A 2GIQA 1JJHA 3HP6A 1I94J 3QBCA 3QLHA 2HG4A 5B0CA 3QIPB 2C2MB 3JB9k 3C16B 1ICEB 4X84A 4N8OA 3CJSA 2QFIA 4PG5A 4ID5A 2RHSB 2Z4PA 2QGFB 1SC1B 4TYBA 3BYRA 5E7OB 5KFRA 3LPYA 5HJYA 4U96A 5DDQC 2UVWA 5ETMA 2M70A 1HYSB 3JTPA 3KUGA 4LSLA 1S9FA 5KFPA 2IAJA 4WWSA 5L9NA 3U02A 5D4PA 2ZDOA 5T14A 4IKAA 1YJUA 1YJVA 4JP8A 4HYKA 5HVFA 2VJUA 2PFDA 3DLBA 3AOAA 4W98A 3R5GA 1XQIA 3CCMS 3ULHA 2KVIA 3MMCB 3HHLA 3I0SB 3EZUA 5A6WA 3QZ8A 3DLKA 1S5ZA 5M2PA 2J0SD 3H2VE 5B0GA 3NOGA 3ILJA 5EDWA 2NSBA 3DOLA 3FCHA 4BCAA 1KFDA 3V4IB 3MCOA 4NA1A 1S48A 4HTJA 2CWKA 1JLQA 2DPIA 3EJMA 3D0GE 2CXEA 5ITHA 3G82B 2CADA 3OBIA 4ATNA 2NXJA 2KH9A 3SCJE 5HMXA 1VHFA 4NZ7A 4NXMF 2GO9A 2OFHX 2B9WA 1HQUA 3IRXA 3KOAA 4H4OB 1OY9A 3N6MA 2VQFJ 1WTBA 4EU0A 1K47A 4LVNP 1Q0NA 3TEGA 3MECA 2AEJA 1FKPB 2QN6B 3FMBA 1B7YB 1W7WA 1IWGA 4ZMMA 3C6UB 2W8LA 3FRYA 4YDDB 4CYUB 3MAAA 4LF7F 7FD1A 1SUQB 1QE1A 3CJ8A 1N5YA 1NB7A 5LXRA 3C15A 3C14A 2CIMA 3A8KA 4MT1A 1RWUA 1YITS 2B56A 2QFJA 2RKIB 1TKZA 1JKHB 3QMQA 3THTA 5F0UA 4WIIA 2QSWA 4C4WA 2ZBPA 1U1OA 1HL6A 3IAS9 1Y5LB 2GHVC 1BC6A 1KTQA 3H4DA 4X62J 3CDAA 2C2KB 1U1MA 3M8QB 2DNRA 2LFVA 2NPIA 2GA7A 3SCKE 5DQIA 3DRXA 2ZC4A 4ILRA 4NXNJ 2DNGA 5DS7A 2H65B 2DHXA 3CJ2A 4JI7F 5T41A 4B3OB 3I5AA 5EN1A 3PRVA 1TFWA 3G8SA 2HSEB 2VPYB 1UPMB 2EWHA 4A8WA 4DV0J 4LREA 2V2KA 3W8GA 2UU9J 2DNZA 5IT0A 5I42A 1HNZF 2LDYA 3H8YA 4Q7AA 5KFVA 1VRUB 3QRQA 2AMCB 4CH1A 3G6ES 4USWA 3H5SA 3GZ7A 3RB4A 5F8LA 3D6TB 3CDEA 1VHIA 3LAKA 3MOJB 3AA9A 5CYJA 1FT8A 5K14A 4DL0C 2B8QA 1T9VA 3W65A 3R3TA 3GJRB 1S6UA 4NZ0A 3ZTRA 4WFXA 4LFCF 2XLKA 4DEZA 3KLGA 2QA1A 4OL8A 5L38A 1S97A 5KFSA 1NMEB 2QL5B 1RAJA 2A2DA 1YBUA 1Z4UA 4BDPA 3CD5A 4V19J 4DV3F 1T3NA 4Y34A 3GFYA 5KG1A 1T9YA 2EFVA 3LGNA 3VZHA 2GMJA 4AFFA 3Q22A 3UDEA 1RT7B 2R7RA 3RR7A 3TQEA 3PACA 4F3MA 1CJKB 4M5KA 3R1HA 2WCXA 4L3KA 2J8SA 1LWFA 4RUAA 3D7SB 1X4EA 5D4OA 3JTOA 1S7HA 2BA9A 1F1BB 4C3LA 4DR6J 1M5HA 5J2MA 3ILOA 1RTHA 2OHDA 1EQMA 4ALZA 4YR0A 2DHAA 3UD3P 3BR9A 1U0HB 4DV5F 3NNCA 4LBHA 5KFBA 1VIOA 4HACA 2NREA 4DMZA 2R7VA 4DV2F 1I6JA 1T7PA 3G8QA 4CWBA 1GFWB 3MEDA 5E3PA 3R7SB 4N8NA 4TVAB 1DBDA 3R5JB 1N4LA 2PI4A 5D15A 4FBTA 1NUEA 4FF4A 4UOGA 2MKCA 5LXYA 1R7IA 3BO3A 2QYCA 1JLCB 4P7TA 3DGPB 5GAGI 4ED3A 3KLEB 1F2GA 2DT9A 2DKOB 3SCIE 2JDJA 4WYWA 1UW9A 1Y10A 3TARA 3OUYA 4ZVRB 4KGKA 2IIHA 4WBFA 1U2RA 1D09B 4Z7YA 3DM2A 1AUSL 4OQJA 4P2XA 2WAQD 2ZOMA 7AT1B 2OSQA 3CXCR 4DSKA 1W2BR 1TL4A 2BANB 2OELA 2PMZD 1FJ7A 3KHGA 2M88A 3KTQA 1U24A 3K5MA 3GSIA 2NCKL 1ZA2B 3NAHA 1RKJA 1X4GA 4TKTA 2JLGA 3DKDA 5ETNA 3Q2TC 1WG5A 2ZC3A 1QY7A 2QZ8A 1RAHB 1ZM2A 3TAMB 3ICLA 3HSGA 2HZAA 3S01A 2NR0A 2ASLA 2RIJA 2OPQB 3OVBA 2VASA 5IFMA 1BMQB 2JEIA 2V50A 2LEBA 2F8EX 3QNWB 4ZLLA 4AYBD 4NRTA 5FIIA 2GVDB 4M5DA 3TUJC 2E1RA 3R5CA 3QO9A 5K9FA 3L95X 4QWAA 2C2OB 1J5OA 2AX1A 3P3DA 3QRRA 4LQ3A 3PZPA 1TL7B 5IOLA 4LFAJ 1S12A 4AE5A 2W2NP 3S8SA 3KHRA 3M8SA 2HVIA 1B7FA 5T7LA 2BE7D 4PKDB 2P9EA 5ADZA 2FHKA 4AUKA 1U09A 5D6GA 9RUBA 2AJQA 2FVPA 2VG6A 1UA0A 2YWFA 2DD8S 1X5OA 5IQQA 3IS9B 1UETA 1P9YA 1T03B 5HI7A 3EDRB 4OLOA 3PX4A 1KEKA 2V6AA 1FVQA 4DXLA 1X8DA 3KLFB 4O44B 4L6V3 4X65J 2O01C 2HFOA 4O4GA 4I2PA 1WEZA 2QE5A 2HNYB 1RHUB 3DMJB 3K2YA 1DQ9A 1T05B 2VFTA 1XMQF 4JUZA 4CQ1A 1X9WA 2PEHA 4RWXA 2PSZA 1JNRB 1GTHA 5GAHU 2BKOA 5HBMB 2GW8A 1HBNB 1HBOB 1RA6A 4ZA1A 1S9EA 2ADBA 3HM9A 3ZZ0A 4RW6A 3GLJA 4ZJOA 3LP0B 4XK8C 4OX6A 3FK4A 3JYTB 3OL7A 2W9BB 4TU7A 4ENOA 1IWAA 2L9NA 2ZJPQ 2D3ZA 2QV6A 4IH6A 3HDSA 2HRYA 1KC8T 5JUMA 4C97A 3M2UB 2FD2A 4RNHA 4EZ9A 4J9MA 3EGNA 2EC0A 3TYTA 4YN3B 1Y9OA 3SXLA 2AU0A 1A6LA 1FK9A 4O3QA 4NRUA 4M63A 3RR8A 2HURA 2EFNA 3RAMA 2ZM6J 2V63A 1RCOB 3MF5A 3M32A 2F40A 5ETRA 1EB0A 4DL3A 3B78A 2ALZA 1IR0A 4J9KA 1KBRA 5KG2A 4ZVGA 1N6QB 1AW0A 3JQMA 1J5EJ 4U67Q 3ZZRA 4K4UA 4RNMA 2LYVA 2X3DA 1RT5B 3UD4P 3ITHB 5DZ7A 1RWWB 1VRTA 2HS3A 2HFUA 5DZ6A 3CJQA 3CT9A 1R8PA 1C0UA 1SL2A 1HPZA 1RUSA 1Q53A 1HNWJ 2YY3A 3MMBB 1QSYA 2N4CA 1RZMA 4I4BA 3D6HB 3RW6A 1JXEA 1LWCA 2ZH9A 3NMRA 7FDRA 3VAMA 2K06A 3C6TA 1FRJA 3MMAA 3BO2A 2VA3A 1WNEA 4KYZA 3B6BA 2AKWB 5C7PA 2H5EA 2WSEC 2YKMB 4A8XA 5D78A 2CQGA 1U6FA 2JH3A 3QGPA 2YKNA 5T7LB 3PW7A 2JX2A 4ZIWA 3KUEA 2PGCA 4QIGA 1S1TA 3TAQA 4JI6F 4ANEA 5KTQA 2A18A 5K8NA 2DR9A 4YB6A 2HGMA 5F0WA 1T0TV 3W64A 3QPIA 3D9BA 3IAM9 2BRLA 5K8OA 3GCXP 2R9LA 2MPUA 1DLOA 2UXDJ 4WTYA 3HJVA 1LK7A 3MPDA 4ICLB 2DRAA 3AH6A 4WPAA 3NCQA 1JQGA 4PABA 3SSSA 4UOFA 1N32J 1IM6A 3T9NA 1ZETA 1X31C 3SFUA 3GG1A 2R2RA 2WSFC 2LDIA 2KXHA 5A8WB 1S9EB 3TR5A 3EDQB 1S7IA 4RO0A 1X7VA 1H73A 2CDRB 4KPCA 4F02A 3K57A 4ID8A 4Y2CA 1D1UA 3C2PA 1B64A 3OFHA 4F4KA 2UVUA 3EUNA 1C1BA 3K5PA 5H9FK 3R5DA 2GQCA 3HLUA 4O3OA 3T1HF 1N34J 1P8GA 2AZ3A 3CIMA 3FVYA 2ILZA 3H0PA 1RACB 3NWRA 2Y0BB 4NLPA 4F4XA 4OZNA 4LMZA 3THVA 5F3ZA 4UUWA 4FN5A 4Y2MA 3DOKA 4X4UA 2XBPA 4OI0A 1N36F 2VODA 2V4RA 3ZC4A 3ISZA 4ZK7M 2G0CA 4NLOA 5HROA 2KTQA 1WF1A 1YDLA 4I64A 3J81U 2GJ2A 2FY8A 1NCLA 4DSEA 4IFVB 1TELA 2WVCA 2YKAA 1KHWA 1VK8A 2IA6A 3I6PA 3MFHA 2Y0SD 4RLEA 1FKOB 1JLFB 5AE3A 4KHPJ 1FTRA 2KVQE 3OSNA 2GVZB 4ED8A 1N8RT 3QZ7A 3KYLA 3IMQJ 3W1YC 4QIEA 3K5NA 1SV5B 2AJFE 3VAFA 2ZD1A 3NGKA 4OYPA 3JAMU 1TVRA 3O5TB 3KLVA 4OZ3A 4QWEA 2AT1B 4DSFA 5D4NA 2CQIA 4QU6A 3P6YC 1PILA 2HNZA 3KK1A 4OYBA 4EYHB 3MM5A 2K1RA 3PM9A 3GYXB 1XMBA 5ETKA 4DPOA 1VC0A 4FF2A 4C8LA 1IKXB 3HF5A 3BS9A 2XNRA 4RUCA 3D2WA 3CNQP 2RQCA 4YR2A 2UUBF 5M2UA 2CVEA 2ZBRA 3MM6B 2OD6A 4ZPVR 2QT7A 4BC9A 2BZ2A 2VFRA 4AL6A 1AFIA 1NPPA 4ZVTB 5LJ3Y 4C11A 3G2XA 1BY9A 2FHJA 2ZKTA 4F4WA 2I0XA 4PG8A 4MKAA 4NWBA 1KR4A 1RT2A 2BYCA 4TNOA 2LP4A 3MMJA 5KT6A 3NG8A 4RW7A 1A7GE 2WZ1A 2EFOA 4ED2A 2VF3A 4Q43A 4DLGA 3M2RA 3DOMB 4LF1A 3KLHB 4HDHA 3TUPA 1Q81T 4V1Ak 3PO4A 5FLXU 5F8HA 1CJVB 5C24A 1VYAA 2MY7A 3CSKA 1KVIA 3W5ZA 4Y6IA 3TI0A 2C2EA 1O5JA 1K0TA 5MLCV 4NXMJ 3NNHA 1PG5B 4RW9A 3SMZA 2DEIA 2OEJA 2R8KA 2HLUA 3A1YG 2HHVA 2OPRB 4D3GA 3VZIA 4GVBA 1MU2B 2ZVSA 3GV5B 3G71S 5DJBA 3TUIC 2BW2A 4C7QA 4U6PA 1JLGB 1VRQC 1F5CA 1TZ0A 4DPXA 5HROB 4MK7A 3I56S 2NQPA 2BX6A 1LW0A 2HHQA 2CPFA 1GAOA 2VBYA 4LF7J 1UPPA 2MKSA 4PWDA 3MPVA 1TP7A 1RYSA 5GADI 2A0FB 1VQ5S 3SDEA 1FXLA 5F8JA 4P71A 4KO0A 4JV1A 1RQ0A 3CDWA 4I68A 1FWLA 4USHA 2WONB 4MYUA 3N5BA 4PR6A 1EETB 1BQNA 1TVRB 3M30B 2RU3A 4ZPWR 3FUYA 3FNNA 4GKKF 2UVRA 3VR1A 4IYQA 4U9RA 2VFUA 2IVMA 1OSCA 2X7IA 3HK2A 1SKSA 4JI7J 1Z1ZA 1P1TA 1NEEA 5I4MA 3H5YA 2HS4A 2VDHA 3HX9A 3OXGA 4YB1P 1RI7A 1VJQA 1HNZJ 2AD9A 2CZ9A 1V6HA 9ATCB 2AV5A 4BWMA 3PYGA 3TVKA 2IMWP 4A8FA 3HVRA 1CULB 4KIAA 3R27A 3QSIA 1H0HB 2AIRB 2M4MA 3GPAA 4IOCQ 1GH8A 3HXMA 1RWMB 2G1HA 1SJ3P 3NXZA 1S79A 1RJJA 1CJTB 2PFFB 4IRKA 3OHAA 1UEVA 2CWXA 3IN5A 5RUBA 2KO1A 2R4FA 2W4CA 3CTRA 2NUHA 3L3CA 5L9XA 4LFCJ 5KFQA 5J2PB 4J9NA 2VG7A 4AT1B 3EGVA 3GIRA 4DR2F 4DV6F 3AY0A 5HN0A 1M90T 4PXEA 5J2QB 1QSLA 3EGZA 2UUAF 4LF6F 1DURA 5DQHA 4PUOA 4DV3J 4ES1A 4CH7A 1RTZA 4FNIA 4MJKA 2OEKA 1RA7A 1OYDA 2K3KA 2PN6A 2PT0A 4JV5F 1ZM4A 4WFNQ 1IM4A 1JJ4A 4EWTA 3UVJB 1LWXA 2LQ5A 5EWFA 4WIQA 4WP3A 4DG1A 4RW9B 3HVWA 4UT4A 2MKIA 2XMUA 1TL1A 4IG0A 5AE1A 3IR6B 4M5HA 3RJMB 4GVBB 2J0WA 2KFNA 3UQSA 4XTTA 4PYDA 4IR1A 1UWAA 5B0DA 4DV5J 2MLXA 3KNAA 2I9SA 1PYSB 1ZPWX 2BJEA 4DV2J 4F0HA 2RUGA 4KGZB 2JZ5A 3OJUA 3UN5A 1MWQA 2ROPA 1VQ8S 2BE2A 3J80U 3MEGB 3OD2A 2UXBF 1J2VA 2I8EA 4K50A 4NI2A 3H4BA 3JSMA 3QATA 1Q5VA 1RTIA 2OO4A 3SFGA 1IKWA 3KNGA 1IKYB 1YJWS 5DRKA 2DHHA 1C2PA 3SV4A 1U0SA 1X4FA 3EWGA 1WG1A 3VQTA 4K7QA 3HO1A 4NLDA 4B9UA 3LGMA 3J7AN 5EX3A 1YLXA 2RF2B 4Q44A 1YBAA 1WORA 2ZWPA 1FXRA 4DL6A 3FQKA 1RAOA 1R43A 4CM2A 1S1XA 4DF4A 5D0HA 4KPYA 4NEYA 2OD4A 1YI2S 3FEYB 1Y4ZB 4ELVA 3FEZA 4Q0BA 3PR4A 1HBUB 2AJ4A 3I0RA 3G6YA 1K44A 5IT9U 2CG8A 2ZEJA 2W4DA 2JJ4D 2DYAA 4FPRA 5B0EA 1ZH5A 2PIIA 4DR4F 4NASA 2HHXA 4KE5A 3H5XA 4RL1A 1X5TA 4J7CA 3M6UA 3MAHA 3RYLA 2ASDA 3AXMA 1RU1A 4ZVFA 3I9V9 3NBPA 2CJ9A 1HKAA 2XULA 5AE2A 1VQSA 1C0TA 2RQMA 3BQ0A 2HFSA 5K8MA 1CSJA 2CDQA 4C8ZA 2F8HA 4YS2A 4WJBA 2RUSA 2MTLA 1REVB 1K73T 1G7CB 2MXYA 2IYGA 3DRPB 1L3SA 4FS1A 4H4KA 3T6JA 4NCGB 2V5HG 3QJLA 3EZOA 5ETSA 2XMKA 3FFIB 1HFEL 1KQGB 5KG7A 1I3OB 4Y2AA 3GV8B 1K0VA 3PY8A 1U4BA 3VTIA 5DM6Q 1XR5A 5B0BA 4K4WA 3HHDA 3DC2A 1WF2A 2JFDA 3A3OB 3MD1A 1HNXF 1UVNA 1D9FA 1EJ7L 5C42A 2IVFB 3G6XA 4X64F 2WVEA 4ZCLA 3L7PA 3ENQA 3A3NB 3DLGB 1U2FA 2HAFA 1Y00A 3RB6A 1XMQJ 4DR5F 3N6NA 2LEAA 4EMDA 3OFGA 1UCNA 2QA4S 1Q8KA 5JVHQ 1YJ7A 2GJIA 5LSLA 1R8BA 2QLJB 3B54A 3Q23A 4LF2A 5BJRA 4PXBA 3ZZYA 3P5BP 3CJ4A 3BKTA 3IGNA 2QC3A 4R5PB 4XPEA 5A8RA 3CJTA 3CMES 4MKVA 3UN3A 1SJQA 1WKLA 1WD6A 1MN9A 2ILYA 2DNOA 3FDSA 3CCES 3W2VB 2RDJA 1YK9A 4GO7X 3D0IE 2G0JA 3TZZA 1CJUA 1CS4B 3G9CA 3GR1A 4A8MP 4LF8F 2MJNA 2MSSA 3LTOA 2DNMA 1MMDA 4ES2A 5LL6d 5DO2A 3H2LA 2LKZA 4M5IA 3N28A 4OHVA 4KHMA 3DCAA 3BSCA 1NO8A 2M52A 2W7AA 3M8ZA 3IM8A 2N3LA 2FQQB 3A4TA 4PWWA 4F67A 4ED0A 3DHWC 2RE1A 5KFUA 5E3QA 5H9FJ 5CZXA 3UN2A 1OIAA 4HH0A 1TK0A 3CO9A 3VGUA 2NXCA 4Y2IA 4MH8A 2RDDA 5DG8A 5I3UA 4DL5A 2MQ8A 3GG0A 4C48A 1Q86T 2Z57B 2CNOB 5IZHA 3NAIA 5ETLA 1RT1B 4ES3A 2FVRA 3CCLS 3KG1A 3PW0A 2GHWA 4ZITA 3TP2A 5DQGA 4ZVPB 3IC1A 1NZAA 2E1AA 2EXUA 2ZHAA 2FIUA 3NLCA 4RW4A 2EK6A 1H2TZ 4CO5A 3OR2B 3MGJA 4ZCKA 1OPIA 3A8IA 3QIDA 1XN9A 3CIZA 3M6VA 4E8UA 3MM9A 4G65A 5THWA 2DISA 4DL2A 2HVDA 2ASYA 2OUGA 4X4PA 2V8GA 4HT5A 4P2MA 5KFEA 3V81B 4M5JA 4JI6J 2DR6A 2J5AA 3V6JA 3OQ2A 2EKNA 3CDBA 1XNQF 1SC6A 2R8IA 3SIPB 3LQVA 4UQGA 4PQUA 5FD1A 4RNNA 4WU2A 3ZZZA 5KFFA 1VISA 3NCPA 5DGBA 3S6EA 1FCAA 2RILA 2DCLA 5IM0A 4OYIA 4WZQA 1OS5A 2M8DB 4C9DA 3DRSB 2G2ZA 1VQMS 4KHRA 2HVEA 1U47A 2ZFHA 1OY6A 5G0RB 3IG1A 5LMNF 4DR3F 3KG0A 2BXJA 3HMJG 3GYGA 2E5HA 1C1CB 2ZZTA 1RDRA 1PKUA 2COLA 1NK7A 1HWKA 1U7LA 2HVHA 1OPZA 3CD6S 3N4WA 2ABYA 2AHOB 2KXNB 1DAXA 1YIJS 1WOPA 3Q89A 3B4MA 2DVIA 2QLXA 5A0YA 4AQYF 2IDEA 1YJ9S 1Q95G 3T1HJ 4OV1A 1NPRA 4C8OA 2DRDA 2XI2A 4JB8B 2J9DA 5HQLA 4HDGA 4U7CA 2XY6A 2X1AA 3SYZA 5KT2A 1ZTTA 2HW3A 2KYXA 3HZGA 4NOHA 1N36J 2V2VA 2FUG9 4P72A 4U8VA 2MZRA 4OJ1A 5AT1B 1TMMA 1S6OA 3NMAA 1VQYA 1NH7A 2QEXS 1WEYA 4G6VB 3KJNB 5HP1B 3SQGA 4X4QA 2IPOB 5KFDA 4IFYB 3TJAA 4QW8A 3BSNA 4MK8A 2CJKA 3NNAA 3RRKA 1NK6A 1FRKA 1WDDA 1HLWA 3A8EA 3BZQA 3OFFA 3FQLA 1R89A 3S1TA 2WRMA 1KOHA 5CYMB 3MZIA 4KKOB 3OL6A 2AEMA 1D0EA 1AZSA 5I3UB 1OY8A 2WK4A 3RTVA 1FEEA 5JXSA 2D3O1 5KG6A 4NLYA 3AD7C 4LT6A 1Y3KA 3K89A 3B8HA 3D1QA 1LXJA 4WE1B 2OFGX 3TOQA 4WFAQ 2V9KA 2RS2A 1F5AA 3CJ3A 1ZM3A 1JLBA 4TLQA 4HKQA 3E01A 4NCAA 3DLJA 1UJ6A 3Q8RB 3MWBA 2RRBA 2FC8A 3OTCA 2NSCA 4LF9F 5GAHI 1RWKB 2A6MA 3RBZA 2GIFA 2W8KA 3PJWA 5E2QA 3V4MA 1S0NA 3HULA 3W2WA 2OPSA 2KM8B 3T1YF 4P2SA 1XK8A 1EQ0A 4K4TA 2QL9B 3G96A 3NL0A 1VBKA 2XZTB 2FHOB 2MHEA 1R0AA 2OIHA 3D3CJ 5J1EA 2UUBJ 1G1XA 2MHNA 2P6SA 5LJ5Y 1G4CA 2BR0A 4XIUA 4IG3A 4E98A 2FDNA 4TLRA 2E9TA 2XHWA 5L39A 2MKKA 2D7SA 3IG1B 3IWLA 1I1GA 4OIXA 2YNIA 3I5CA 5A2QY 2NUUG 2FZKB 4OYWA 3K59A 1F9FA 3ISNC 5HVHA 4UOCA 3KJVB 2XSJB 3G6VA 3OLAA 1JLEB 3HI9A 1VBXA 1HQEB 2Y8YA 1WSVA 2GC8A 2YVSA 4I0WA 2KYZA 1P1LA 4R8UB 2W4PA 3BGRB 1U26A 2ZHOA 2ZJRQ 1KLNA 1SIWB 4KT0C 1KQKA 1HD0A 3PRBA 1TL3B 5L1JA 1SKRA 3LOUA 2VONA 2K3IA 1E6VB 1OO0B 3IP0A 3AQPA 2HFNA 3KK2A 2YNGB 3MCSA 1HBMB 1KLMA 1U1KA 1S6QB 1OWXA 2Q43A 2LVWA 4CIOA 3VAJA 4BBYA 2GS8A 1VQ7S 4WF9Q 3RRGA 1RB0A 4DS5A 4WXWA 4I2QA 3U1LA 1T9TA 5D77A 2CNKB 2RH3A 3W61A 1XNRF 3QFWA 2WBRA 4LRFA 1NK5A 1RHJB 4OI4A 2FLOA 5J2NB 2OKQA 4YQWA 4P74A 1GT8A 1UMJA 3OVAA 4FF3A 1FA0A 2YX1A 4NLSA 3F44A 3FSXA 2NZ4A 5C5JA 3CJRA 3T5JA 1RTJB 2B5JB 5EWGA 4USKA 1CG2A 2GNKA 2JHEA 2HEKA 2CNLB 1EP4B 2HIYA 5GMDA 1C4CA 2NXUA 1GMVA 3PJXA 2OP5A 2IA0A 3BF4A 2DIVA 2AGOA 4K8RA 2X1GA 1GMUA 4GKKJ 4O23A 1RXOB 2B6AB 1NK9A 4FXDA 2EFPA 2ACMA 5CH7B 2QG9B 2E66A 1YHQS 4XPCA 4J90A 1S1VB 4QR1A 5D3GB 1DHMA 3W2WB 4FF1A 1S1UA 1PYOB 2YNHB 2KM8C 3PX0A 2DGXA 4EI2A 3CVKA 4KFBB 4H4MB 2HRTA 3AHPA 3OR1A 2L08A 1OSDA 1NJZA 2ZWOA 3ENAA 3WX4A 4G3IA 1UJ5A 1F9HA 2DGWA 4ECTA 4EO8A 1T9WA 1U1QA 1VOMA 2E1CA 3T5HA 4TY9A 3DYAB 2CAJA 3M2VB 3PV8A 3Q8QB 3M4XA 4IQMA 5ETVA 1W26A 1XMOF 4O3PA 5EWEA 3FRZA 3JSRA 2KL8A 3RU0A 1RT3A 4HR2A 2V4JA 1YJTA 1S1WA 2JOQA 5L1IA 4DR2J 5FDLA 4DV6J 1KOOA 1HMVB 4B08A 2UUAJ 4LF6J 3DFEA 4CO4A 3GU0A 1TTHB 2FZCB 3IRWP 2QX0A 2G2YA 3J7ZT 3PR5B 2YNFB 2EG2A 1DQ8A 1FD8A 3GFZA 4JV5J 3POTB 3CO0P 1ZYQA 2FZGB 3WC2A 5EX0A 3MTKA 1O51A 2Z2MA 3E2EA 2AGQA 4FP9A 4HVZA 1FHTA 1K8AT 2A2CA 8RUCA 3ZTQA 5GAEU 5CYQB 4OX7A 3P49B 1DFDA 4F7VA 1U48A 2MMYA 2F5GA 1CC7A 4KGMA 1H7XA 2BDPA 1IQTA 2QTWA 3CCRS 5AXNA 4M1KA 2ZUAA 3DI6A 2JVOA 2MKYA 1VI7A 4X4RA 3IFEA 2F8MA 4DFPA 2KFYA 4ZVUB 1V5VA 4K2XA 2M0GB 1WC1A 3J81j 2ZH3A 1HWIA 2CJQA 2XO7A 3FJ2A 5KG0A 1MG7A 1QUPA 3LUYA 4LRDA 2CZ4A 2IC3A 3OXFA 4I1TA 1MSWD 4QR2A 4R25A 2D9OA 2UXBJ 2XMVA 3ZTOA 2V8PA 4O3NA 4F8RA 1HWLA 3QT6A 2LA4A 4DCOB 5KFOA 2HBZB 4IDKB 4J9LA 2AGPA 2FLLA 2AYBA 4NLXA 2AEFA 3GB0A 2BACA 1TKXB 1RT4A 4PG6A 4LR9A 2YQ3A 2QO3A 5KFNA 2HBYB 1IBMF 1HI1A 2VJVA 4ZLJA 3MUMP 4NPOA 4PQAA 3DLLQ 2MQLA 1TV6A 2CPDA 1QM9A 3BB5A 3N9UC 3D67A 3MAQA 4ZHRB 1GEHA 4NLUA 1FNMA 3OL9A 2R7SA 5KFHA 2J9DE 1T95A 1R6YA 2UXCF 3QT7A 1KONA 1V3ZA 3ET6A 3I87A 1B70B 4DR4J 2AQ4A 1X0FA 2PO4A 1DTQA 3I82A 1LWEA 1RT6A 4ZPCA 4DZ6A 2EG1A 4ZVQB 1F6TA 1N33F 4E0DA 1RAEB 1WHWA 1BQMB 4GC7A 2BBEA 1H3DA 4YB7A 4RJVA 4NYZA 3R97A 4EO6A 1RT3B 4LUBA 3HVTB 2KJVA 1NSQA 4FYVB 2LMIA 1NJXA 5FDLB 3GSDA 3FKBA 2X1FA 1Y5NB 3J7YU 4FXVA 1U2CA 5F8NA 3MM8B 3PRDA 2YH1A 1SH2A 3W5YA 2ZE2A 3W3SA 1R6VA 1V5IB 1MROA 3LAMA 2IVYA 3GV7B 1TK8A 2MDAA 3H42A 1HW9A 1DTTB 4CNYA 1U8WA 1DRZA 1RTDB 3DNCA 4ECVA 2H3EB 3AXKA 2C3OA 2GHPA 2DNQA 1HNXJ 2GCFA 5KAKA 3F41A 3CJKB 3L7UA 4U7UK 4ERDA 2HMIB 4ZP8A 4P2FA 1E6YB 4HI1A 1RAAB 4YR3A 1KD1T 3KDOA 5H9EJ 1NNDA 4X64J 1M0SA 2I5JA 4CLKA 1TKDA 1CPZA 3AT1B 1SPBP 2IM1A 4DR5J 2QLBB 4C6AA 3WHIA 4J9UE 3MEKA 2PA8D 2KXFA 3A3PB 2B9EA 4KV8A 3PEJA 1PJ6A 4NYOA 1UVJA 2ZH8A 2BEFA 5HJXA 3CE8A 1EAYC 3QAEA 4M5NA 2J6SA 3RG6A 5L1LA 4OZ5A 3VAIA 1YG0A 1WTFA 4RW8A 4ANCA 4C8NA 2HNDB 1FESA 1F5BA 2J9CA 3L7OA 2M5YA 1IXKA 3FZBA 3BGUA 1GQEA 4DL4A 3WC0A 2XGPA 4F4AA 1NJWA 4NA3A 3KLIA 4HT7A 2J8AA 3RBEA 2L3MA 2HVZA 4CT8A 4LF8J 2HQDA 1RBAA 2N4DA 3WQPA 1N5QA 1WHXA 4FYWB 5A8KB 1FX4A 3D4JA 3SZ2A 5HSPA 1VK3A 2JL9A 2JLEA 2ZVIA 4JOUA 1KTVA 4ZS6A 4JI1F 1VQPS 4QOTA 2WOMB 3QGGA 1U1PA 2VPZB 2E1PA 3LP2A 1RHMB 1EIYB 1AYEA 2UUWA 3SCLE 1TUGB 2QMXA 3EICA 3IO1A 1FE0A 2LA6A 2FLNA 2YBVA 2OI2A 3QWUA 1GXUA 4WFZA 1U1LA 2XWYA 1FWPA 4L76A 2CJYB 2BJ9A 3DRRA 2XC9A 2BOPA 3QLHB 3VGTA 2B4OA 1VQOS 4IR9A 3LP1A 3M8RA 2VB6A 3M8PA 1UA1A 4ID5B 3RUBL 1M5OC 3JSBA 5BYSA 3GFXA 4DFKA 1KHVA 2WVFA 1AXQA 4UQTA 1HHTP 3KK3A 2PA3A 1ZM9A 2FJEB 3EXYA 4TQSA 5HLFA 4LRCA 1WEXA 1X0PA 4DFMA 1SKWA 4L73A 1RE1B 4LSLB 3MFIA 2HHSA 3NRBA 5KFYA 2IAJB 1UWBA 5CAAA 3BR8A 2DO0A 1JLAA 2BM0A 2GX8A 4G1PA 4F3QA 5B0FA 2HHHF 2J7WA 2ZOFA 4IOBA 3UCGA 1XNQJ 1V9OA 3HHLB 3MOZA 4ECRA 3OXLA 2UUCF 3DGVA 4FPIA 4PPZA 4UZBA 3DLKB 2V69A 3AAWB 3LWLA 1PJ7A 4DQIA 2VKZG 1WOOA 4HL9A 1L3KA 1VS3A 4OZ1A 5KFAA 3DOLB 4DR3J 5LMNJ 2KG0A 1RHRB 4C8YA 3AFGA 4OI1A 3FCVA 3MEEA 4YEAA 1JLQB 2C1EB 2PMWA 4CTAA 3GIJA 2VPWB 3VALA 1FJCA 6FD1A 2A10A 3BSOA 2HS0A 4FDFA 1KVKA 4LQ9A 4TY8A 5I3QA 1HQUB 4AQYJ 3IRXB 4UUXA 2BE9B 4KBIA 3TX8A 3PDNA 2XB2D 3MECB 2HFZA 3NGTA 5IT4A 1HNIA 4YP3A 2XM3A 3M8WA 3MAAB 4U95A 3BGFA 3K7RA 3E51A 3BGOP 1QE1B 3QJPA 4IH7A 1S59A 1N5YB 5CXTA 3PEHA 3CUNA 1EKSA 4LSNA 2Q66A 1ROFA 2B4VA 1TK5A 3C15B 2DB1A 1WKKA 3C14B 2AYEA 1WF0A 1KWMA 2J0XA 3KMSA 4OYAA 1TKZB 2J6TA 2QLFB 1QTNB 3FGVA 1S0OA 2DNHA 2RAQA 3F73A 1FNOA 3FSYA 3DLEA 5SZTA 2VFSA 3TJ9A 1PAEX 4KSEB 2XG8A 3PYEA 1VQLS 2BQ3A 1PBUA 2VH7A 4QU7A 3E8OA 4ED6A 2XCAA 1SJ4P 1X60A 1YQHA 3CCSS 1QAYA 2EVZA 6FDRA 2CPXA 4UF4A 2MZ1A 2E5GA 4EGLA 2GQQA 1DY3A 4YB5A 1RWXB 2YXLA 5LMUF 2X51A 2W2MP 3BKFA 1ZZNA 2FJAB 5A76A 4K4XA 2ZJQQ 3PHTA 3MPYA 5I42B 1X9SA 4ZVHA 4JV0A 2CPZA 2EBGA 1KVJA 2BMBA 5A6PA 4LF9J 3LF0A 4N56A 1MLAA 2G4BA 2KKHA 2ZKUA 3SSQA 2GGPA 3T1YJ 3KJFB 4KH1B 3DDKA 2LCWA 3QSYB 1D8ZA 3UWTA 4YHHF 3ENWA 4MKBA 4OYMA 5K14B 4XDCA 4KTQA 2R7QA 1U6BA 1LW2A 1SQGA 1V3SA 3HHLC 2VOPA 4PXCA 1VLOA 3QGIA 3MR7A 3KLGB 2JRSA 5KT7A 3AJ2A 2I2YA 2EPIA 2XS7A 2VDIA 4IOAQ 4XDDA 2W9CA 1AA1B 2V9WA 1SCJB 1D9AA 2ROGA 2IRXA 1U25A 3MR5A 4RZRA 2VG5A 2HBQB 2E7WA 3OHBA 5FJ4A 2UV8A 2XWXA 3QT8A 3UI3A 2W9AA 5E3CA 5E41A 2CJBA 4K4SA 1S6PA 1AB8A 4JI5F 4F0KA 4L75A 3UCZP 1LWFB 4G1QA 2KHDA 4LR7A 5KG5A 2KU7A 4QWDA 2DNKA 3OT9A 4GMKA 2M8HA 1FERA 5J2MB 1RTHB 1QAIA 4WP8A 1S0VA 4DPYA 1MWYA 4HACB 3V6DA 4L72B 1XERA 2DH7A 2EKYA 3MEDB 1S0MA 2FJXA 5CA5A 1U49A 4OX8A 3SEOA 1FJGF 1BQXA 4A4JA 3ELHA 2MGZA 5B0AA 4TN2A 4Z2XA 4I56A 3IR5B 1U02A 1XNRJ 3MPWA 1IKVA 3OLBA 3CPWR 4URGA 4B3MF 3DLEB 3MM7A 4X4NA 2FYXA 3OUYB 3W9HA 4LF4F 4F26A 4FS2A 3DM2B 2YKQA 1GMWD 5GVQA 4DUZF 4Q2LA 4A48A 4M8LA 4DI6A 2DRBA 4Q8FA 3HKZD 4M5GA 4USIA 2F65A 3TQ1A 2QYGA 2H1YA 3CWJA 1NLKL 1FXDA 2C2DA 4ECSA 2B7CB 4DWIA 4ECYA 2H4WB 4OV6A 1LFWA 1XTZA 1KS2A 3CMQA 3S7RA 1Y5IB 1TKTA 2ERRA 3MXHP 5E5NA 2KJWA 4CLFA 3ENVA 4DLEA 4ZPDA 1CEZA 3U1MA 1Q1KA 2DJWA 3QIPA 1QLNA 3R7NB 4M5DB 1UZDA 3C16A 3QO9B 4NLGA 1CLFA 1J5OB 1ACMB 1MMNA 4ZIVA 2C2NA 3FSIA 2LECA 1G3OA 1YRXA 2H51B 1RCXB 3TW0A 1YZ6A 2HQCA 3KKFA 5MAOA 1M5PC 3VVUA 4KH0B 3PIPQ 1IBKF 1XMOJ 3BN7A 2VIHA 1HYSA 2DCUB 4CLWA 4Y65A 4OHXA 1SKUB 4MIWA 1TU0B 3LWMA 2VG6B 1SXLA 5ETPA 4AXJA 3O3LA 1H74A 2CQ2A 3WIUA 2PEBA 4KR0B 1N52B 4CM0A 3UO0A 2W1BA 2CQ4A 3ETMA 1JNZB 2APOA 3D1HA 2QL7B 3MMCA 4O3SA 2CPHA 1IBCB 3I0SA 2QIFA 2N82B 4O4GB 3GJTB 4I2PB 2K7JA 3A13A 1RSCA 2FLPA 1DARA 2PE8A 3JQKA 3Q8YA 3Q86A 1Y11A 3HHNB 2DEJA 4HEA9 5D4LA 5KFJA 1HI0P 4NLVA 5IQ6A 2CRLA 4L3NA 1XBWA 1QD1A 3MD3A 3V4IA 2LXIA 1BWVA 3NS6A 3C19A 5LT5A 4RW6B 3G82A 2CNNB 1HQ2A 5F8IA 2BV3A 4DF8A 5AJ3F 4NYPA 1PJ5A 2C3UA 1UJ4A 3EVMA 2YWEA 4F25A 4X4TA 2V8VA 3EX7B 1RK8A 1Z2ZA 3I32A 2FVSA 1YJNS 4I6YA 1YRTA 1SI9A 1F3VA 2RSQA 2AJ0A 1DZ5A 3R1LA 4YOEA 2HQGA 1ITPA 5IS2A 4Y00A 2P6TA 1U6ZA 1FKPA 2ZBCA 4DU8A 3GR0A 1FRHA 4FYXB 1GNKA 4RR5A 5EHHA 1FK9B 3C6UA 3PO5A 4ZLPA 4CYUA 2RQKA 1X5SA 2XYGB 3M32B 1HARA 3OPKA 1SUQA 3K8VA 3CD7A 2WB4A 2D9PA 3HT3A 1I5OB 3ZNJ1 4UTGA 2WBMA 2MLZA 3Q8UA 1KQFB 4AL5A 3MUVP 3MCNA 2CQ1A 2RKIA 1T9XA 2CA9A 1N54B 2DH9A 1JKHA 3MR2A 1IBMJ 5J1NA 1KN6A 2WHOA 4ZKAA 2MYFA 1SJ1A 2MKJA 2HWIA 2YQ0A 4J5OA 5HAOA 1VRTB 1FRMA 1F0XA 2DBBA 5F9LA 1C0UB 1HPZB 1TR0A 4ETZA 3BDEA 3G87A 3M8QA 2BUNA 3MCMA 2N7YA 2IHR1 1WELA 1LEOA 1SJRA 1M1GA 2UXCJ 1ZAXA 1LWCB 3UW1A 4ETXA 2KN4A 3BN4A 3C6TB 3MMAB 3UNYA 3K8WA 4B3OA 1N5TA 2OSRA 1JX4A 3BGLA 2O66A 5I3PA 3UFCX 5CABA 1N33J 2HQFA 4OZLA 4HTIA 1ZZFA 2YKNB 2MZTA 1VRUA 3VGVA 2J9EA 4RNFA 3GQCA 1S1TB 4NLRA 3AJDA 4LFBF 1GX5A 4D3HA 2H9ZA 3QQCD 4MMOA 4ITSA 1IBLF 4FVMA 4K4YA 2DHSA 3D3BJ 4W90B 4QBUA 2RT3A 2IM2A 3RW7A 1DLOB 4DUTA 1QVFR 2LQJA 4WFYA 4K0KF 3OVSA 2Y1JA 4CO2A 2WW8A 2LLZA 2WVDA 4CT9A 1UVMA 3BPSP 1RP5A 4QWBA 4RU9A 2WVBA 2FJDB 2HQIA 2GIRA 2XY7A 5F3TA 4W92B 4DSLA 2IM3A 1WSRA 1YX2A 1MWZA 2ZH4A 3TZYA 3DN9A 4DX8H 2GMHA 2H5IB 1VFJA 4OHYA 1RT7A 4OZ0A 3K17A 4DDFA 1PIEA 1CJKA 5DDPC 2YQ1A 3CCTA 4BS2A 2F4FA 1X4DA 2WB1D 4P7VA 4F2RA 4YY3J 1C1BB 2QMUB 4JI3F 3X1LB 2DITA 3VV2B 1Q8IA 1N5SA 2C3YA 3H98A 3JSYA 2ALYB 3E3XA 2FGCA 5HO4A 5EGYA 4J9OA 2JWNA 2P5VA 1RGVA 2J7UA 3LA0A 4DQRA 1SQEA 2DGQA 1QUVA 4IQXA 1APSA 1U0HA 3ZNUA 2YX4A 3DOKB 3IBWA 1Q7LB 1RHKB 4O3RA 2CQHA 2Q3PA 4CI0B 3T5LA 2MQPA 3GYNA 3TA0A 2GAGC 1LV5A 2VL1A 1FJEB 3CCQS 2OJ3A 3QGHA 4M5LA 2F9JA 4GKJF 3IR7B 2OMLA 2AYMA 4IH5A 1JLCA 1TMJA 4HI2A 3DGPA 2HGNA 1ZOTA 1TQLA 1W25A 3IM9A 4JI1J 2FJBB 4B9TA 3KLEA 4ZPBA 2D41A 1MW7A 1HA1A 2MQOA 3KUHA 4B9LA 4ZLNA 5U47A 4QQBA 4DFJA 1U8SA 1S77D 2CJXB 1XJWB 5HK4A 5DDRC 4OI2A 2BANA 2G2OA 2HK3A 2MEWA 2ZD1B 3VHQA 3PHEA 5EUHA 2NS1B 3M1VA 3US5A 1DQAA 3HD1A 1KSPA 4QYZJ 1YTYA 2HNZB 3CCUS 2M9KA 3KK1B 1OQ3A 1WUUA 1SB6A 3MM5B 2K1RB 3N79A 1J27A 1UL3A 2NPFA 4ZP9A 5GAEI 3TAMA 3H5UA 1VGYA 1ZPVA 1NU4A 1KKHA 3TJ8A 2XMWA 2OPQA 2W2OP 3D28A 1HR0F 3I5BA 1LK5A 4ED1A 2KHCA 1RWNB 1Q82T 2IDLA 2V4QA 2QSFA 2GVDA 2R7WA 3ZO7A 1LNQA 1MMLA 2HRUA 3J7A1 2HHHJ 3HPOA 2E5IA 4C11B 4CRJA 2VZ9A 2HPUA 1TL7A 2DXFA 4WK3A 3O6QA 1UAWA 2R7XA 2VUGA 2F1FA 2NYIA 4PPDA 1RT2B 2UUCJ 4CLLA 2YKPA 1WC6A 4RW7B 3HT0A 3VGSA 2L9WA 2OTLS 3M2RB 3ETOA 1B3TA 3BV8A 2ACYA 2IRUA 3OV7A 2Y9HA 5KT3A 4F0MA 3AA8A 3GJQB 3N0VA 2NYHA 4USVA 1U1RA 3FEXB 2DGUA 5C24B 1VQ9S 3IS9A 2XS5A 1T03A 3H59A 1FFSB 2Q79A 3MURP 3P45B 3HVAA 4NL5A 1IUJA 3AD8C 3KLFA 4O44A 2BJ1A 3GILA 2G1DA 2IYIA 2HNYA 4OHZA 3DMJA 1N88A 4CO1A 1T05A 4Z37A 3KWMA 4GVLA 1JXVA 1SH3A 1N48A 1X5PA 1YSJA 3K5OA 4ZOSA 5HBMA 1OQ6A 1HBNA 1HBOA 4LRAA 3EXCX 4QCLA 2I6WA 1WI8A 1LW0B 2M7SA 4RKUC 5BR8F 1UW4A 3FZ2A 3UE2A 2ZUGA 3LP0A 4PWDB 3GIMA 2Q1LA 2DH8A 3TWZA 3GJSB 3QAUA 1FFWB 3JYTA 3M9OB 3SDEB 1H98A 2XZDB 2W9BA 3BH7B 4DHVA 4MTPA 2FVCA 2B9YA 1S76D 3UNGC 2PDAA 4GO5X 3I31A 3VCDA 3UCUP 3KJQB 2MSTA 3PTWA 1ZA1B 4KO0B 4LBIA 4ILMA 3M2UA 2MZSA 2R7UA 3EM1A 2E5LF 3DDIA 2Z2ZA 3J7YI 5HMYA 3R2DJ 5BXIA 5CD4A 3H7HB 4NLWA 4JI8F 2LXUA 1KFSA 3M1VB 1BQNB 2KRBA 3ISND 4ECXA 2OH2A 2ZHBA 1WHYA 1EX8A 5L8RC 5LMUJ 4K59A 4CO0A 1WWHA 3LW5C 4NX9A 1N6QA 1WC3A 2ZITA 2QLWA 3BSAA 5HMWA 4QYRA 2DGVA 4Y0FA 2DO4A 5KT4A 3IBFB 2XLJA 1RT5A 1GTEA 3ITHA 3SQOP 3HD2A 2HHWA 4ZCIA 1JJCB 3T41A 4LJMA 3O2IA 1NSAA 4B3TF 3R5AA 2VC1A 3CC2S 2FTRA 2H4YB 3MMBA 4ZDNA 1BE4A 5F41A 3KXDA 4B3RF 2MQQA 4LBPA 4KC5A 2R3VA 4YHHJ 2XZWA 4KGVB 3DHXA 4PG7A 3HSDA 4FBUA 1A0OB 1REGX 2E7XA 2GJFA 2A1BA 4O4RA 4K5RA 2YKMA 2ZOGA 3UDCA 4CLUA 4DN0A 3TA2A 2CFXA 2VG7B 5K8PA 1FEHA 1LQ9A 2AW0A 1RWOB 1W2IA 2OEMA 2RNEA 4PUOB 1S57A 2JC1A 4WK1A 1PYTA 3CGIA 1IJEB 1PBAA 4BWJA 1Q8BA 2L48A 2D74B 2W7PA 2HHUA 4YUDA 3NCRA 4ICLA 4A8KA 1B99A 4JI5J 3T3FA 3AD9C 4DG1B 2JFKA 3CCWA 4QJVA 1TL1B 3W60A 2HZCA 4IG0B 2K2PA 2HQ3A 1WC4A 4RNOA 3MDFA 4R0EA 3TEHB 2Y1LB 4JI0F 3A12A 1H6KX 2IBKA 1QSSA 4A8QA 4CDIA 3DDNA 2C3PA 5H1SV 4J9VA 4A46A 1FRLA 3L4BC 2RS8A 5A8WA 2XMJA 2FJVA 1FNXH 2IM0A 1UEKA 3BBFA 1QAJA 4M5MA 4DR1F 3M9MB 4B02A 3N5FA 1VJWA 1I51B 2H48B 3HFVA 1FDNA 1HI8A 1TAUA 4OI6A 2BE2B 3NOCA 1FJGJ 3HKWA 5HATA 3AJ1A 4F4ZA 1O8BA 3PNIA 4NI2B 2X1BA 2Z58B 1UVIA 2C28A 3FBFA 3JSMB 2ADCA 1RTIB 4MIBA 5C25A 3HZEA 1IKWB 4B3MJ 4N77A 4DU7A 2GFFA 2VHGA 4LF4J 4RPFA 2V0NA 4BHQA 1KP6A 1R8CA 1U45A 2RDIA 3N6LA 3D1OA 5LSRA 4DUZJ 3RZAA 3FC9A 4PYAA 4WP9A 3MTJA 4ZJLA 1T8EA 3OFEA 4IFVA 1S1XB 4MKYA 2CQBA 2D3UA 4UW2A 4J91A 1FKOA 2K8GA 1WC0A 1GXLA 1JLFA 4Q0BB 2EK1A 3GTYX 3I0RB 1Y0HA 5A2QU 1SQFA 2G0IA 2GVZA 2VD3A 3K0JA 4B3SF 1NDCA 2YPYA 1R3NA 2VOOA 2E7VA 1SV5A 3UD5A 1S99A 4USJC 3W5XA 4OHWA 3NBPB 3U7JA 4RUHA 3KMQA 1C0TB 5CZVA 4NLTA 1FDDA 1NHUA 4OX9F 1SIZA 5ETOA 2JEGA 2LEPA 5H9EK 1R0BG 2CUYA 1D3WA 2QA4G 1L5UA 5C2CA 3KHHA 5IWAF 1B0PA 1FD2A 5DDOC 3NEKA 3ZZPA 4CP5A 1YZ7A 3EPIA 3IBCB 2WSCC 4ZN1A 3TRGA 5DGAA 3IWNC 5DG9A 1IKXA 3HHEA 3TX0A 1T02A 4JI4F 3W66A 2VQEF 4ANDA 1IBKJ 2BM1A 3D66A 2EFQA 1G6BA 3M8YA 4X66F 3M7VA 5ETQA 1F60B 5HL7Q 3MM6A 4LF5F 2DXEA 4I69A 3D54A 2JVRA 1IQZA 3VAKA 2XMMA 3M6WA 3VQSA 1CVJA 5GMKa 1GX6A 4LVOP 3V6HA 1Y7PA 1TL5A 3CB4A 2DY1A 1TFYA 3NKYA 4MFBA 1QTMA 3I4PA 3DU6A 1Q7YT 4YDXA 3P5TL 1GMWA 5C42B 4PCQA 2W2QP 4N47A 3C46A 3ZZUA 2VKRA 2RMLA 4QPTA 3BBCA 4WKRA 4LSZB 1O6XA 1Q78A 2GO8A 4ER8A 5C2GA 1WDTA 3DOMA 3KLHA 2W01A 3H40A 2B4PA 3PIOQ 3UR3C 1CJVA 1SJFA 3BO4A 4N76A 1CQNA 3OTOF 3OTDA 3RRHA 1R31A 2O1PA 4GC6A 3V2UC 1JXLA 4ECZA 5A8RB 3MPUB 5AJ3J 3L09A 5D0EA 2JNJA 3GFHA 3LANA 3TVZA 4B17A 1N56A 1M5VC 3PKYA 2OPRA 5C25B 1LOUA 1XIQA 2VBWA 1MU2A 1CJUB 3H2UB 4XO0A 4KQZA 1JLGA 2V94A 1X4AA 1TUVA 1D8YA 1RABB 2QMWA 1GXTA 4CLTA 3CCVS 4F36A 2E1MC 3GMGA 2DR5A 3R2CJ 1O0PA 2VFVA 2ZBQA 2KZZA 2MQMA 2YPZA 4F50A 2YTCA 3IGVA 3RBDA 4DQQA 4CH0S 2ZDPA 2BVZA 4BC7A 2HWTA 4OZ2A 4URQU 2U1AA 2BW7A 4F3OA 4B9MA 1NRKA 2KFZA 2WONA 4QWCA 2C2RA 1EETA 4DSJA 2HYIB 2CVIA 4WKYA 5HVGA 4ECUA 4Y28C 4EYIB 2CYYA 2VA2A 1YGYA 3M30A 2BJ8A 4W4MA 4PXDA 4RW4B 2R7TA 5B09A 3IA0A 4UOHA 2O5DA 5KFXA 3MM9B 3K5LA 4DJBA 4OFZA 2YKOA 4H4KC 3P8BB 4IUFA 5G4DA 4LFBJ 3U1NA 1N0VC 2A3JA 1CULA 1SC3B 1VQ4S 2C22A 1IBLJ 1WHVA 4USMA 1B4SA 1HWJA 4YFUA 1CJTA 4DOZA 4PQUB 3DU5A 2BJ7A 3H20A 2YH0A 4K0KJ 3T6BA 4MFBB 2PC6A 2RVJA 1B0VA 5IM0B 3DXSX 4NMLA 2AP6A 1RYRA 1FDAA 3BM7A 2XTJP 5J2PA 4TQRA 1TUWA 1BUXA 4B9SA 2F4VF 1AT1B 2LQ9A 5J2QA 3NGDA 3CC4S 3SV3A 3M05A 2FB0A 5KFIA 3BYPA 2Y1RI 4UZCA 3G4SS 3O1LA 4UY8T 3WZ0A 3O8WA 2JEFA 1R27B 2FHMA 3W7BA 4TU8A 4HLBA 5DLFA 3UVJA 3P96A 2KB2A 5A0YB 3UPFA 4ZVOB 1RLCL 1EKRA 2OMOA 2AX0A 4JI3J 1RAIB 1NSPA 2RB7A 2CQDA 3WX8A 2HKEA 3PYFA 2DGOA 1NK0A 4QW9A 5L46A 1M1KT 2C42A 3LALA 1UVLA 2P9GA 1VCTA 3PKMA 2EW9A 1RHQB 2DHGA 1FX2A 2HBRB 1FWKA 1CQMA 5KFLA 3FBBA 4DUYF 2V67A 2XS2A 4KB7A 4F4YA 3GCWP 5F9NA 2CPIA 1VBZA 2ZZMA 5KG4A 1HD1A 4Q8EA 1ZTWA 2F63A 3SQGB 2EEYA 2XCPA 2DR8A 1UVKA 4UY85 3MEGA 3RB0A 4OJGA 4GKJJ 3P4UB 3R7BB 1G2EA 1JMTA 4ZPAA 3W8PA 2Z0GA 3OL8A 1IKYA 4Z7CA 3EYZA 2RU9A 3Q0AA 2PI5A 1AZSB 2D69A 4I67A 1Q8LA 4A8OA 3HSZA 3SBMA 4RUBA 4CLZA 3PW2A 3PFOA 2Q6BA 2RF2A 1IR2A 3Q2SC 4CLSA 1Q5YA 3LO3A 2N7CA 2B0GA 4NLQA 4L74A 3RAXA 2H54B 2HZVA 4CO3A 1JLBB 4P10A 2HLTA 1HNVA 4FYYB 3E01B 1IJFB 3I55S 4X2BA 4B9NA 1YKWA 1QAXA 1QJHA 1M5KC 4DV1F 1HBUA 1JWWA 4N7TA 2R2SA 2OPSB 3U27A 2ZH1A 2UZAA 4I7FA 2UUTA 1VQNS 1S9GA 5LOQA 4OJ3A 4ECWA 3NP5A 4JYAF 4P9SA 1JB0C 2DNNA 1NKBA 1KDNA 2R8HA 3BEGB 1R0AB 1HR0J 2F7VA 5J1EB 4OYXA 1URRA 5HMZA 5LSOA 4C0HA 2DNLA 2ROEA 5JJBA 1NHKL 1Z2LA 3ILLA 3J81Y 1H2VZ 3CJ5A 2WW4A 2E29A 3I9ZA 2J6UA 4IG3B 4TU9A 3RGIA 3RBXA 2V2QA 4F2SA 2Z2LA 2R8JA 1T3OA 2FJWA 2DPJA 3DXBA 2MKHA 4EZ6A 2YNIB 1REVA 1SVDA 4NCBA 4ED5A 5D0GA 3DRPA 4CLYA 1HHSA 4DCPB 4NCGA 3W62A 1BGXT 4N41A 1SL1A 5SUHA 3QRPA 4OYZA 3ZTSA 3FFIA 1URNA 2CG4A 5J1PA 4M94A 3JAMY 4EEYA 3MI7X 2XO6A 3PG9A 4MIAA 3C66A 2XI3A 4A47A 3JTNA 2I1RA 3BREA 4DS4A 2IRYA 1CC8A 1FF2A 3SSRA 2YX7A 2KT3A 3AOCA 5KFTA 1IN0A 4X4OA 1XEZA 4LIRA 3QYYA 4ED4A 3DLGA 4ELUA 2VPXB 2XSFA 1R8AA 4IRCA 1FVSA 2ASJA 1YRUA 3KK2B 2C3MA 1B0TA 1KLMB 5KFKA 2W7OA 4P73A 1FRXA 4JI2F 5IXUA 4DV7F 2CQ0A 5BR8J 2LXFA 2R8GA 3WBZA 2OAUA 4I2QB 3TNVA 2V8DA 1QDUB 4R5PA 1RLDA 4K4VA 5IV3A 3J7Z5 2AJ1A 2CZVC 1VLYA 2P9CA 5E33A 2RRNA 3W2VA 4QIFA 2B8PA 2XNQA 3HHLD 4WXOA 4DV4F 4DR7F 1CS4A 2E5LJ 1YJRA 2RJZA 1LFPA 4WTOB 1FFGB 3RAQA 1PGZA 5FLXY 1AROP 5B08A 4JI8J 3KG4A 4X4SA 2W24A 1H7WA 5CCMA 2J7KA 3KDNA 1WG4A 4PRFA 2HHTA 1HNVB 1ZAVA 2P8IA 4EFAC 4X4VA 2D3OR 1RISA 2NXEA 4CZCA 1S1UB 4FKXA 4I7FB 1PAUB 3A8JA 2OTJS 1S9GB 3BDPA 1I94F 4XAKA 3SI8A 1MN7A 3GWCA 2CPJA 4LIWA 3OR1B 1RBLA 1UFWA 1UFLA 1KNZA 2EBEA 3VWSA 4MYTA 5E3RA 4B3TJ 1RT1A 2AYGA 1UTAA 4PWUA 2IJFA 3DLHA 2DIUA 5JVGQ 2DNYA 4B3RJ 1P6TA 3B82A 5IC4B 5B7WA 5HQMA 2POKA 1FKAF 2ZH2A 3BQ1A 3T9ZA 4C2MA 3OR2A 4BLGA 2XQCA 3PJ9A 2B9XA 5AXKA 2J0QD 3EVOA 2CKWA 5GAGU 3QWPA 3QFHA 2V4JB 4CLPA 4RBTA 4IO9Q 3PW4A 3EE3A 1S1WB 5BYRA 5KG3A 1X4BA 4J9SA 4WCEQ 3V81A 2QA2A 2OGUA 1V3RA 4MAKA 2Y3YA 2RHQB 3CCJS 1PC5A 1NKEA 2MQNA 5IC6B 4YMEA 3T1AA 1T11A 3BKUA 4RU2A 8AT1B 1OMSA 4OI3A 4ED7A 3DRSA 3AODA 2X3GA 4DX6A 4DQPA 2GAHC 5DG7A 3NWGA 3EGWB 5G0RA 5KT5A 3VAHA 1BLUA 3X3UA 4OJHA 1C1CA 2MLYA 4JI0J 1NDPA 2GQ2A
chains in the Genus database with same CATH topology
4OYZA 1YBUA 4OYIA 4OYPA 1CJKA 4OYOA 3MR7A 2WZ1A 5IV4A 1CJTA 1TL7A 1CJVA 4OZ2A 1CULB 1FX2A 1WC1A 2GVDB 1FX4A 1CS4A 4OZ3A 4CLFA 2BW7A 3ET6A 4CLLA 4USTA 4P2FA 4CM2A 3R5GA 1WC6A 5D0HA 1CJKB 1Y10A 4OYBA 4USUA 1Y11A 1CJTB 1TL7B 1CJVB 4CLKA 1WC4A 1YK9A 3MAAA 5D0EA 1CJUA 1CS4B 4P2XA 3C16A 4WP9A 3ET6B 4CLPA 4WPAA 1U0HA 3C15A 4USVA 3C14A 5D0RA 1YBTA 1AZSA 3MAAB 4OYXA 4USWA 1AB8A 1CJUB 1WC0A 3G82A 3C16B 2QV6A 1WC5A 4P2MA 1U0HB 2GVZA 3C15B 4CLTA 3C14B 4CLUA 3UVJA 1AZSB 4NI2A 4OYWA 3G82B 4WP8A 4OYAA 4CLWA 4CLZA 2GVZB 4OYMA 5D0GA 3UVJB 4CLSA 4NI2B 1CULA 4CLYA 5IV3A 5D15A 2GVDA 2W01A 4CM0A 1WC3A 4WP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYZ A;  1YBU A;  4OYI A;  4OYP A;  1CJK A;  4OYO A;  3MR7 A;  2WZ1 A;  5IV4 A;  1CJT A;  1TL7 A;  1CJV A;  4OZ2 A;  1CUL B;  1FX2 A;  1WC1 A;  2GVD B;  1FX4 A;  1CS4 A;  4OZ3 A;  4CLF A;  2BW7 A;  3ET6 A;  4CLL A;  4UST A;  4P2F A;  4CM2 A;  3R5G A;  1WC6 A;  5D0H A;  1CJK B;  1Y10 A;  4OYB A;  4USU A;  1Y11 A;  1CJT B;  1TL7 B;  1CJV B;  4CLK A;  1WC4 A;  1YK9 A;  3MAA A;  5D0E A;  1CJU A;  1CS4 B;  4P2X A;  3C16 A;  4WP9 A;  3ET6 B;  4CLP A;  4WPA A;  1U0H A;  3C15 A;  4USV A;  3C14 A;  5D0R A;  1YBT A;  1AZS A;  3MAA B;  4OYX A;  4USW A;  1AB8 A;  1CJU B;  1WC0 A;  3G82 A;  3C16 B;  2QV6 A;  1WC5 A;  4P2M A;  1U0H B;  2GVZ A;  3C15 B;  4CLT A;  3C14 B;  4CLU A;  3UVJ A;  1AZS B;  4NI2 A;  4OYW A;  3G82 B;  4WP8 A;  4OYA A;  4CLW A;  4CLZ A;  2GVZ B;  4OYM A;  5D0G A;  3UVJ B;  4CLS A;  4NI2 B;  1CUL A;  4CLY A;  5IV3 A;  5D15 A;  2GVD A;  2W01 A;  4CM0 A;  1WC3 A;  4WP3 A; 
#chains in the Genus database with same CATH topology
 5LM7 E;  2XYP B;  3PVX A;  4EUV A;  2U2F A;  4CCH A;  3MHY A;  3DI6 B;  4UST A;  1MNE A;  4DR1 J;  4YY3 F;  1SH0 A;  5JMN A;  2XYH B;  1SL0 A;  2B7B B;  2EC2 A;  1NK4 A;  1NH8 A;  3FBC A;  3M9N B;  2N3O A;  4QIW D;  3HHK A;  4LRB A;  3PYD A;  2IC3 B;  4EK2 A;  3FMW A;  2VQF F;  4P75 A;  3PXG a;  2KI2 A;  3G86 A;  2CQP A;  5HQ8 A;  2XHC A;  3Q24 A;  4ZJQ A;  3CED A;  5AXM A;  2LQ8 A;  2KRR A;  2ZNY A;  4KRW A;  2BQR A;  1XC9 A;  1RWV B;  1L3V A;  3GIK A;  4AD6 A;  3V5R A;  2LQB A;  2UP1 A;  2CPY A;  4EBE A;  3ZZO A;  3RB3 A;  3D6M B;  3H90 A;  3Q83 A;  4RWW A;  1RT4 B;  3IWX A;  5HP1 A;  2M3D A;  2VIC A;  4GRS A;  2CPE A;  4IFY A;  1WI6 A;  2FGO A;  1PCA A;  4NE9 C;  4DL7 A;  4Y3C A;  1BHN A;  1GK8 A;  1Q16 B;  3NGR A;  4Q2M A;  4DX7 A;  1TV6 B;  5D8H B;  1NHV A;  2VBX A;  5GME A;  5CCL A;  4A8Y A;  5CYM A;  4X62 F;  2XY5 A;  4KKO A;  3EPG A;  2NXN A;  2V8H A;  1A9N B;  3MUT P;  1EAR A;  3TVY A;  1X4C A;  2QJ3 A;  4DPU A;  4NXN F;  4B3S J;  3ET6 B;  2MZJ A;  1FO1 A;  5E3A A;  2R2T A;  2IMO A;  5KFG A;  1DTQ B;  1WOS A;  4WE1 A;  2B4U A;  1LWE B;  4OZJ A;  1RT6 B;  2HFV A;  1WC5 A;  1NSK L;  1F9E B;  4C3K A;  4DV0 F;  2KZM A;  5DLG A;  2UU9 F;  3WDO A;  3D0H E;  3J80 Y;  2J76 E;  1S72 S;  3GON A;  4OX9 J;  1Y3J A;  1OYE A;  5IWA J;  3AB2 B;  5KOX A;  3CCZ A;  3EVW A;  3ZFV A;  1VC5 A;  3L9Z A;  3G8T A;  3NS7 B;  1TAQ A;  3HJF A;  5E0O A;  1CBK A;  2G9O A;  4JI4 J;  2O67 A;  1ZAW A;  2VQE J;  1S49 A;  3NY0 A;  4CNZ A;  4OYO A;  1QVG R;  5CHC B;  2M2B A;  1DJ0 A;  2ZE2 B;  4X66 J;  2ZH5 A;  3V6K A;  1BXN A;  3EMT A;  4LF5 J;  1MRO B;  2VBZ A;  4J9P A;  2VU5 A;  1M5S A;  2YWG A;  4NA2 A;  3ZXW A;  4ZCM A;  2AF6 A;  3CF5 Q;  3TZW A;  4G1I A;  2Q6C A;  2HWH A;  2XEX A;  2DR7 A;  2DNP A;  4K4Z A;  4C8M A;  5D0R A;  2I5J B;  3CDU A;  4HHH A;  5IT9 Y;  4WYL A;  4ZVE A;  3F56 A;  4K2J A;  2F3J A;  3KJV A;  2XSJ A;  2FY1 A;  2KT5 A;  1JLE A;  4OLP A;  3Q8V A;  4AL7 A;  1HQE A;  4H54 A;  1EZZ B;  4O0I A;  3C8Y A;  1S4E A;  1NK8 A;  1IVZ A;  1RBO B;  3TO8 A;  1Q4R A;  4M95 A;  4R8U A;  1VMB A;  3BGR A;  4KV8 B;  3OTO J;  2IJR A;  4KGX B;  4DR6 F;  3GII A;  2L41 A;  3OW2 R;  3FCW A;  3BJY A;  2BJ3 A;  1R8H A;  1FDB A;  4RW8 B;  4C3M A;  4B9V A;  1JJ2 R;  4HHU A;  2DK2 A;  4E2F B;  1TL3 A;  2BRK A;  5DET A;  4QIV A;  2R2U A;  3D68 A;  5HAN A;  1HWU A;  1FI4 A;  3NGU A;  1E6V A;  1NDK A;  2ZZN A;  3Q8S B;  3KLI B;  4O0N A;  2Z8Q A;  2YNG A;  1U1N A;  3AOB A;  4P52 A;  1HBM A;  5KFZ A;  4QYZ K;  3T5K A;  2BAB A;  3CUL A;  1S6Q A;  1VBY A;  2WTF A;  1WKJ A;  2KDO A;  3VVT A;  2FPH X;  4DSI A;  4N5S A;  2YWW A;  1JK9 B;  2ZBI A;  4Q45 A;  2PD1 A;  1X4H A;  3JXO A;  4PAA A;  1FTC A;  3PFE A;  5J2N A;  4DQS A;  5K5M A;  3LP2 B;  3NGS A;  1JIH A;  3C3L A;  4ZVS B;  1WJ9 A;  4V19 X;  4DZD A;  2GZO A;  2DGS A;  3DRR B;  4FZV A;  1RTJ A;  2B5J A;  2AWZ A;  4I6A A;  2P2C B;  2UVV A;  2I38 A;  2Z56 B;  3LP1 B;  1EP4 A;  3M8P B;  2RD5 C;  5F8M A;  2MB0 B;  2IBO A;  3QJJ A;  2XMA A;  2XLI A;  3NS5 A;  3AB4 B;  2B6A A;  1NJI T;  1VQ6 S;  2SXL A;  5KFC A;  3FBE A;  2B3T B;  2KG1 A;  1NDL A;  2Z2Y B;  1S1V A;  3KK3 B;  1H72 C;  5D3G A;  5HLF B;  2Z30 B;  3TZX A;  3MR3 A;  2YNH A;  3H25 A;  2LU2 A;  4KFB A;  4J9Q A;  3ILI A;  4H4M A;  2EFG A;  2JC0 A;  1UWB B;  1YBT A;  1KQS R;  1JLA B;  3TAN A;  3DRY A;  4Q5V A;  3VF0 B;  3KFW X;  2A6O A;  3D5M A;  4LFA F;  3T19 A;  4Y2K A;  2LU1 A;  3OTB A;  4JV2 A;  2FVQ A;  1XR6 A;  3DYA A;  3M2V A;  3JQJ A;  2C2Z B;  1K1S A;  4S0M A;  1KRP A;  1ZS6 A;  1L3T A;  4R0J A;  3EZ5 A;  2QRR A;  3GP9 A;  3TA1 A;  4PEO A;  1N0U A;  3MR6 A;  1M1H A;  2BKP A;  1ELO A;  2EI5 A;  3MEE B;  1UKU A;  1P9Q C;  5IV4 A;  4ZPT R;  1HMV A;  1K9M T;  2F4V J;  4AXI A;  4IO1 A;  5KFW A;  2YWH A;  4CTA B;  3CC7 S;  1NAQ A;  3D6F B;  2YNF A;  2RRA A;  3HFZ B;  2DTJ A;  4X65 F;  3TUZ C;  2MJU A;  4URS A;  3POT A;  4TY8 B;  3BH6 B;  2R42 A;  3PCO B;  5ETT A;  2DXD A;  4EBD A;  1PO6 A;  4FXW A;  4C98 A;  4QR0 A;  2OPP A;  4NZ6 A;  5CYQ A;  1NBE B;  2BKN A;  1HNI B;  4DPW A;  3WIV A;  1S10 A;  1RAF B;  2MZQ A;  3R6G B;  2HAI A;  1VDH A;  4DUY J;  4LSN B;  1HHQ A;  3M6X A;  1VQK S;  1K1Q A;  1AFJ A;  5BYQ A;  5M2R A;  1SC4 B;  2CJA A;  2V2Z A;  1LKZ A;  2DGT A;  1YVF A;  2VV5 A;  3BBB A;  1R0C B;  1VC6 A;  1T9U A;  3O44 A;  2B51 A;  2IJN A;  6AT1 B;  1XR7 A;  2E9R X;  1H2U X;  2ZM6 F;  8ATC B;  4ELT A;  4LR8 A;  4IDK A;  3KHL A;  2F9D A;  4ZP7 A;  3ADA C;  1UEU A;  4ZN3 A;  3BPD A;  4HHJ A;  1NB2 A;  1VIX A;  3R6L B;  5CD4 H;  2YWK A;  3ZZT A;  1NPK A;  3B4D A;  1TKX A;  1J5E F;  3R8Y A;  1BWE A;  2BOA A;  3THP A;  4OMF G;  3QT5 A;  4RBU A;  3LPE A;  2HGL A;  1H38 A;  1F2H A;  2ZH6 A;  5K20 B;  3PW5 A;  4DX5 A;  2RQ4 A;  3CJ0 A;  2NZC A;  4ZHR A;  4DV1 J;  1F3F A;  4C0B A;  4NMX A;  2DY9 A;  4FYD A;  1ZBT A;  3F0N A;  4ECQ A;  1HNW F;  2V34 A;  2GGP B;  1FRI A;  4F04 B;  1C4A A;  2GML A;  4KJI A;  4JYA J;  3K58 A;  1UP1 A;  5AXL A;  2IY5 B;  1L3U A;  3ZTP A;  2AJ2 A;  3TAP A;  1LW2 B;  2Y8W A;  1ULR A;  1YWX A;  1NKC A;  4IRD A;  2B43 A;  4USU A;  5GAD U;  2JLF A;  2UV8 G;  4PZV A;  1D9D A;  2OLW A;  1HIY A;  2VC0 A;  2JSX A;  1BQM A;  2E9Z A;  3HFK A;  3W63 A;  1T94 A;  2AZ1 A;  3I4H X;  4ZP6 A;  5F8G A;  5KOW A;  2W9C B;  3HVT A;  1RKI A;  3OJS A;  3OTE A;  3OSP A;  2R7O A;  2ATL A;  1UFK A;  2VG5 B;  4WU3 A;  2W25 A;  2Y1I A;  1FE4 A;  1WAC A;  4FVC A;  1BD6 A;  3LH2 S;  2UXD F;  3MM8 A;  4RX6 A;  1Q79 A;  3BQ2 A;  1SBR A;  2K7K A;  1XWL A;  4KAI A;  2HIQ A;  1S6P B;  1EHW A;  2BQU A;  1AUD A;  4G1Q B;  2NLW A;  1RU2 A;  1N32 F;  3R9L A;  1DTT A;  4DBQ A;  2XMT A;  1RTD A;  4QPX A;  2CQ3 A;  3CJK A;  4C0O C;  1IR1 A;  4TYA A;  2ZNZ A;  2HMI A;  1E6Y A;  2OPP B;  2KT2 A;  2JEJ A;  2L9D A;  3AQO A;  1NXI A;  4I6W A;  3V6D B;  1NM2 A;  1NZ8 A;  1NJY A;  2HHP A;  3W9I A;  1VR6 A;  4ILL A;  1P27 B;  2HK2 A;  3N01 A;  4WFB Q;  3UR0 A;  3CD0 A;  3PX6 A;  1OJ4 A;  2W2P P;  4JI2 J;  1N34 F;  3LGH A;  4DV7 J;  1PSD A;  3I96 A;  2MGZ B;  4U7U D;  2XGQ A;  5KFM A;  4PG4 A;  3ONQ A;  1X9M A;  3HSJ A;  2CQC A;  2PMH A;  1IKV B;  4EBC A;  2HND A;  1UZH A;  4J9R A;  1LXN A;  4H4O A;  4FKY A;  3MM7 B;  3R5B A;  2FHJ D;  2V68 A;  2GV1 A;  1HW8 A;  4C8K A;  4QZV B;  4DV4 J;  4DR7 J;  4K5S A;  2FC9 A;  2D1C A;  1N5V A;  2G13 A;  4U8Y A;  5A8K A;  3IXQ A;  4FNH A;  2E5J A;  1S4F A;  1RWP B;  4DCJ B;  4J37 A;  5CQG A;  5L1K A;  2MY8 A;  3UDL A;  2ATC B;  3CW2 C;  3Q8P B;  1RAG B;  4DN9 A;  1PC4 A;  4KY3 A;  2WOM A;  4RBV A;  1RAD B;  4KHP F;  4P6Q A;  2O3D A;  4A8S A;  4JBC A;  3VAG A;  3HCX A;  4HH1 A;  1TKT B;  2E44 A;  2BJD A;  3JS9 A;  3W9J A;  4TXS A;  2IFX A;  3UDV A;  4NEZ A;  4MK9 A;  4WZM A;  3CMA S;  2ZH7 A;  4DPT A;  2H5J B;  5DM7 Q;  3GE9 A;  2GIQ A;  1JJH A;  3HP6 A;  1I94 J;  3QBC A;  3QLH A;  2HG4 A;  5B0C A;  3QIP B;  2C2M B;  3JB9 k;  3C16 B;  1ICE B;  4X84 A;  4N8O A;  3CJS A;  2QFI A;  4PG5 A;  4ID5 A;  2RHS B;  2Z4P A;  2QGF B;  1SC1 B;  4TYB A;  3BYR A;  5E7O B;  5KFR A;  3LPY A;  5HJY A;  4U96 A;  5DDQ C;  2UVW A;  5ETM A;  2M70 A;  1HYS B;  3JTP A;  3KUG A;  4LSL A;  1S9F A;  5KFP A;  2IAJ A;  4WWS A;  5L9N A;  3U02 A;  5D4P A;  2ZDO A;  5T14 A;  4IKA A;  1YJU A;  1YJV A;  4JP8 A;  4HYK A;  5HVF A;  2VJU A;  2PFD A;  3DLB A;  3AOA A;  4W98 A;  3R5G A;  1XQI A;  3CCM S;  3ULH A;  2KVI A;  3MMC B;  3HHL A;  3I0S B;  3EZU A;  5A6W A;  3QZ8 A;  3DLK A;  1S5Z A;  5M2P A;  2J0S D;  3H2V E;  5B0G A;  3NOG A;  3ILJ A;  5EDW A;  2NSB A;  3DOL A;  3FCH A;  4BCA A;  1KFD A;  3V4I B;  3MCO A;  4NA1 A;  1S48 A;  4HTJ A;  2CWK A;  1JLQ A;  2DPI A;  3EJM A;  3D0G E;  2CXE A;  5ITH A;  3G82 B;  2CAD A;  3OBI A;  4ATN A;  2NXJ A;  2KH9 A;  3SCJ E;  5HMX A;  1VHF A;  4NZ7 A;  4NXM F;  2GO9 A;  2OFH X;  2B9W A;  1HQU A;  3IRX A;  3KOA A;  4H4O B;  1OY9 A;  3N6M A;  2VQF J;  1WTB A;  4EU0 A;  1K47 A;  4LVN P;  1Q0N A;  3TEG A;  3MEC A;  2AEJ A;  1FKP B;  2QN6 B;  3FMB A;  1B7Y B;  1W7W A;  1IWG A;  4ZMM A;  3C6U B;  2W8L A;  3FRY A;  4YDD B;  4CYU B;  3MAA A;  4LF7 F;  7FD1 A;  1SUQ B;  1QE1 A;  3CJ8 A;  1N5Y A;  1NB7 A;  5LXR A;  3C15 A;  3C14 A;  2CIM A;  3A8K A;  4MT1 A;  1RWU A;  1YIT S;  2B56 A;  2QFJ A;  2RKI B;  1TKZ A;  1JKH B;  3QMQ A;  3THT A;  5F0U A;  4WII A;  2QSW A;  4C4W A;  2ZBP A;  1U1O A;  1HL6 A;  3IAS 9;  1Y5L B;  2GHV C;  1BC6 A;  1KTQ A;  3H4D A;  4X62 J;  3CDA A;  2C2K B;  1U1M A;  3M8Q B;  2DNR A;  2LFV A;  2NPI A;  2GA7 A;  3SCK E;  5DQI A;  3DRX A;  2ZC4 A;  4ILR A;  4NXN J;  2DNG A;  5DS7 A;  2H65 B;  2DHX A;  3CJ2 A;  4JI7 F;  5T41 A;  4B3O B;  3I5A A;  5EN1 A;  3PRV A;  1TFW A;  3G8S A;  2HSE B;  2VPY B;  1UPM B;  2EWH A;  4A8W A;  4DV0 J;  4LRE A;  2V2K A;  3W8G A;  2UU9 J;  2DNZ A;  5IT0 A;  5I42 A;  1HNZ F;  2LDY A;  3H8Y A;  4Q7A A;  5KFV A;  1VRU B;  3QRQ A;  2AMC B;  4CH1 A;  3G6E S;  4USW A;  3H5S A;  3GZ7 A;  3RB4 A;  5F8L A;  3D6T B;  3CDE A;  1VHI A;  3LAK A;  3MOJ B;  3AA9 A;  5CYJ A;  1FT8 A;  5K14 A;  4DL0 C;  2B8Q A;  1T9V A;  3W65 A;  3R3T A;  3GJR B;  1S6U A;  4NZ0 A;  3ZTR A;  4WFX A;  4LFC F;  2XLK A;  4DEZ A;  3KLG A;  2QA1 A;  4OL8 A;  5L38 A;  1S97 A;  5KFS A;  1NME B;  2QL5 B;  1RAJ A;  2A2D A;  1YBU A;  1Z4U A;  4BDP A;  3CD5 A;  4V19 J;  4DV3 F;  1T3N A;  4Y34 A;  3GFY A;  5KG1 A;  1T9Y A;  2EFV A;  3LGN A;  3VZH A;  2GMJ A;  4AFF A;  3Q22 A;  3UDE A;  1RT7 B;  2R7R A;  3RR7 A;  3TQE A;  3PAC A;  4F3M A;  1CJK B;  4M5K A;  3R1H A;  2WCX A;  4L3K A;  2J8S A;  1LWF A;  4RUA A;  3D7S B;  1X4E A;  5D4O A;  3JTO A;  1S7H A;  2BA9 A;  1F1B B;  4C3L A;  4DR6 J;  1M5H A;  5J2M A;  3ILO A;  1RTH A;  2OHD A;  1EQM A;  4ALZ A;  4YR0 A;  2DHA A;  3UD3 P;  3BR9 A;  1U0H B;  4DV5 F;  3NNC A;  4LBH A;  5KFB A;  1VIO A;  4HAC A;  2NRE A;  4DMZ A;  2R7V A;  4DV2 F;  1I6J A;  1T7P A;  3G8Q A;  4CWB A;  1GFW B;  3MED A;  5E3P A;  3R7S B;  4N8N A;  4TVA B;  1DBD A;  3R5J B;  1N4L A;  2PI4 A;  5D15 A;  4FBT A;  1NUE A;  4FF4 A;  4UOG A;  2MKC A;  5LXY A;  1R7I A;  3BO3 A;  2QYC A;  1JLC B;  4P7T A;  3DGP B;  5GAG I;  4ED3 A;  3KLE B;  1F2G A;  2DT9 A;  2DKO B;  3SCI E;  2JDJ A;  4WYW A;  1UW9 A;  1Y10 A;  3TAR A;  3OUY A;  4ZVR B;  4KGK A;  2IIH A;  4WBF A;  1U2R A;  1D09 B;  4Z7Y A;  3DM2 A;  1AUS L;  4OQJ A;  4P2X A;  2WAQ D;  2ZOM A;  7AT1 B;  2OSQ A;  3CXC R;  4DSK A;  1W2B R;  1TL4 A;  2BAN B;  2OEL A;  2PMZ D;  1FJ7 A;  3KHG A;  2M88 A;  3KTQ A;  1U24 A;  3K5M A;  3GSI A;  2NCK L;  1ZA2 B;  3NAH A;  1RKJ A;  1X4G A;  4TKT A;  2JLG A;  3DKD A;  5ETN A;  3Q2T C;  1WG5 A;  2ZC3 A;  1QY7 A;  2QZ8 A;  1RAH B;  1ZM2 A;  3TAM B;  3ICL A;  3HSG A;  2HZA A;  3S01 A;  2NR0 A;  2ASL A;  2RIJ A;  2OPQ B;  3OVB A;  2VAS A;  5IFM A;  1BMQ B;  2JEI A;  2V50 A;  2LEB A;  2F8E X;  3QNW B;  4ZLL A;  4AYB D;  4NRT A;  5FII A;  2GVD B;  4M5D A;  3TUJ C;  2E1R A;  3R5C A;  3QO9 A;  5K9F A;  3L95 X;  4QWA A;  2C2O B;  1J5O A;  2AX1 A;  3P3D A;  3QRR A;  4LQ3 A;  3PZP A;  1TL7 B;  5IOL A;  4LFA J;  1S12 A;  4AE5 A;  2W2N P;  3S8S A;  3KHR A;  3M8S A;  2HVI A;  1B7F A;  5T7L A;  2BE7 D;  4PKD B;  2P9E A;  5ADZ A;  2FHK A;  4AUK A;  1U09 A;  5D6G A;  9RUB A;  2AJQ A;  2FVP A;  2VG6 A;  1UA0 A;  2YWF A;  2DD8 S;  1X5O A;  5IQQ A;  3IS9 B;  1UET A;  1P9Y A;  1T03 B;  5HI7 A;  3EDR B;  4OLO A;  3PX4 A;  1KEK A;  2V6A A;  1FVQ A;  4DXL A;  1X8D A;  3KLF B;  4O44 B;  4L6V 3;  4X65 J;  2O01 C;  2HFO A;  4O4G A;  4I2P A;  1WEZ A;  2QE5 A;  2HNY B;  1RHU B;  3DMJ B;  3K2Y A;  1DQ9 A;  1T05 B;  2VFT A;  1XMQ F;  4JUZ A;  4CQ1 A;  1X9W A;  2PEH A;  4RWX A;  2PSZ A;  1JNR B;  1GTH A;  5GAH U;  2BKO A;  5HBM B;  2GW8 A;  1HBN B;  1HBO B;  1RA6 A;  4ZA1 A;  1S9E A;  2ADB A;  3HM9 A;  3ZZ0 A;  4RW6 A;  3GLJ A;  4ZJO A;  3LP0 B;  4XK8 C;  4OX6 A;  3FK4 A;  3JYT B;  3OL7 A;  2W9B B;  4TU7 A;  4ENO A;  1IWA A;  2L9N A;  2ZJP Q;  2D3Z A;  2QV6 A;  4IH6 A;  3HDS A;  2HRY A;  1KC8 T;  5JUM A;  4C97 A;  3M2U B;  2FD2 A;  4RNH A;  4EZ9 A;  4J9M A;  3EGN A;  2EC0 A;  3TYT A;  4YN3 B;  1Y9O A;  3SXL A;  2AU0 A;  1A6L A;  1FK9 A;  4O3Q A;  4NRU A;  4M63 A;  3RR8 A;  2HUR A;  2EFN A;  3RAM A;  2ZM6 J;  2V63 A;  1RCO B;  3MF5 A;  3M32 A;  2F40 A;  5ETR A;  1EB0 A;  4DL3 A;  3B78 A;  2ALZ A;  1IR0 A;  4J9K A;  1KBR A;  5KG2 A;  4ZVG A;  1N6Q B;  1AW0 A;  3JQM A;  1J5E J;  4U67 Q;  3ZZR A;  4K4U A;  4RNM A;  2LYV A;  2X3D A;  1RT5 B;  3UD4 P;  3ITH B;  5DZ7 A;  1RWW B;  1VRT A;  2HS3 A;  2HFU A;  5DZ6 A;  3CJQ A;  3CT9 A;  1R8P A;  1C0U A;  1SL2 A;  1HPZ A;  1RUS A;  1Q53 A;  1HNW J;  2YY3 A;  3MMB B;  1QSY A;  2N4C A;  1RZM A;  4I4B A;  3D6H B;  3RW6 A;  1JXE A;  1LWC A;  2ZH9 A;  3NMR A;  7FDR A;  3VAM A;  2K06 A;  3C6T A;  1FRJ A;  3MMA A;  3BO2 A;  2VA3 A;  1WNE A;  4KYZ A;  3B6B A;  2AKW B;  5C7P A;  2H5E A;  2WSE C;  2YKM B;  4A8X A;  5D78 A;  2CQG A;  1U6F A;  2JH3 A;  3QGP A;  2YKN A;  5T7L B;  3PW7 A;  2JX2 A;  4ZIW A;  3KUE A;  2PGC A;  4QIG A;  1S1T A;  3TAQ A;  4JI6 F;  4ANE A;  5KTQ A;  2A18 A;  5K8N A;  2DR9 A;  4YB6 A;  2HGM A;  5F0W A;  1T0T V;  3W64 A;  3QPI A;  3D9B A;  3IAM 9;  2BRL A;  5K8O A;  3GCX P;  2R9L A;  2MPU A;  1DLO A;  2UXD J;  4WTY A;  3HJV A;  1LK7 A;  3MPD A;  4ICL B;  2DRA A;  3AH6 A;  4WPA A;  3NCQ A;  1JQG A;  4PAB A;  3SSS A;  4UOF A;  1N32 J;  1IM6 A;  3T9N A;  1ZET A;  1X31 C;  3SFU A;  3GG1 A;  2R2R A;  2WSF C;  2LDI A;  2KXH A;  5A8W B;  1S9E B;  3TR5 A;  3EDQ B;  1S7I A;  4RO0 A;  1X7V A;  1H73 A;  2CDR B;  4KPC A;  4F02 A;  3K57 A;  4ID8 A;  4Y2C A;  1D1U A;  3C2P A;  1B64 A;  3OFH A;  4F4K A;  2UVU A;  3EUN A;  1C1B A;  3K5P A;  5H9F K;  3R5D A;  2GQC A;  3HLU A;  4O3O A;  3T1H F;  1N34 J;  1P8G A;  2AZ3 A;  3CIM A;  3FVY A;  2ILZ A;  3H0P A;  1RAC B;  3NWR A;  2Y0B B;  4NLP A;  4F4X A;  4OZN A;  4LMZ A;  3THV A;  5F3Z A;  4UUW A;  4FN5 A;  4Y2M A;  3DOK A;  4X4U A;  2XBP A;  4OI0 A;  1N36 F;  2VOD A;  2V4R A;  3ZC4 A;  3ISZ A;  4ZK7 M;  2G0C A;  4NLO A;  5HRO A;  2KTQ A;  1WF1 A;  1YDL A;  4I64 A;  3J81 U;  2GJ2 A;  2FY8 A;  1NCL A;  4DSE A;  4IFV B;  1TEL A;  2WVC A;  2YKA A;  1KHW A;  1VK8 A;  2IA6 A;  3I6P A;  3MFH A;  2Y0S D;  4RLE A;  1FKO B;  1JLF B;  5AE3 A;  4KHP J;  1FTR A;  2KVQ E;  3OSN A;  2GVZ B;  4ED8 A;  1N8R T;  3QZ7 A;  3KYL A;  3IMQ J;  3W1Y C;  4QIE A;  3K5N A;  1SV5 B;  2AJF E;  3VAF A;  2ZD1 A;  3NGK A;  4OYP A;  3JAM U;  1TVR A;  3O5T B;  3KLV A;  4OZ3 A;  4QWE A;  2AT1 B;  4DSF A;  5D4N A;  2CQI A;  4QU6 A;  3P6Y C;  1PIL A;  2HNZ A;  3KK1 A;  4OYB A;  4EYH B;  3MM5 A;  2K1R A;  3PM9 A;  3GYX B;  1XMB A;  5ETK A;  4DPO A;  1VC0 A;  4FF2 A;  4C8L A;  1IKX B;  3HF5 A;  3BS9 A;  2XNR A;  4RUC A;  3D2W A;  3CNQ P;  2RQC A;  4YR2 A;  2UUB F;  5M2U A;  2CVE A;  2ZBR A;  3MM6 B;  2OD6 A;  4ZPV R;  2QT7 A;  4BC9 A;  2BZ2 A;  2VFR A;  4AL6 A;  1AFI A;  1NPP A;  4ZVT B;  5LJ3 Y;  4C11 A;  3G2X A;  1BY9 A;  2FHJ A;  2ZKT A;  4F4W A;  2I0X A;  4PG8 A;  4MKA A;  4NWB A;  1KR4 A;  1RT2 A;  2BYC A;  4TNO A;  2LP4 A;  3MMJ A;  5KT6 A;  3NG8 A;  4RW7 A;  1A7G E;  2WZ1 A;  2EFO A;  4ED2 A;  2VF3 A;  4Q43 A;  4DLG A;  3M2R A;  3DOM B;  4LF1 A;  3KLH B;  4HDH A;  3TUP A;  1Q81 T;  4V1A k;  3PO4 A;  5FLX U;  5F8H A;  1CJV B;  5C24 A;  1VYA A;  2MY7 A;  3CSK A;  1KVI A;  3W5Z A;  4Y6I A;  3TI0 A;  2C2E A;  1O5J A;  1K0T A;  5MLC V;  4NXM J;  3NNH A;  1PG5 B;  4RW9 A;  3SMZ A;  2DEI A;  2OEJ A;  2R8K A;  2HLU A;  3A1Y G;  2HHV A;  2OPR B;  4D3G A;  3VZI A;  4GVB A;  1MU2 B;  2ZVS A;  3GV5 B;  3G71 S;  5DJB A;  3TUI C;  2BW2 A;  4C7Q A;  4U6P A;  1JLG B;  1VRQ C;  1F5C A;  1TZ0 A;  4DPX A;  5HRO B;  4MK7 A;  3I56 S;  2NQP A;  2BX6 A;  1LW0 A;  2HHQ A;  2CPF A;  1GAO A;  2VBY A;  4LF7 J;  1UPP A;  2MKS A;  4PWD A;  3MPV A;  1TP7 A;  1RYS A;  5GAD I;  2A0F B;  1VQ5 S;  3SDE A;  1FXL A;  5F8J A;  4P71 A;  4KO0 A;  4JV1 A;  1RQ0 A;  3CDW A;  4I68 A;  1FWL A;  4USH A;  2WON B;  4MYU A;  3N5B A;  4PR6 A;  1EET B;  1BQN A;  1TVR B;  3M30 B;  2RU3 A;  4ZPW R;  3FUY A;  3FNN A;  4GKK F;  2UVR A;  3VR1 A;  4IYQ A;  4U9R A;  2VFU A;  2IVM A;  1OSC A;  2X7I A;  3HK2 A;  1SKS A;  4JI7 J;  1Z1Z A;  1P1T A;  1NEE A;  5I4M A;  3H5Y A;  2HS4 A;  2VDH A;  3HX9 A;  3OXG A;  4YB1 P;  1RI7 A;  1VJQ A;  1HNZ J;  2AD9 A;  2CZ9 A;  1V6H A;  9ATC B;  2AV5 A;  4BWM A;  3PYG A;  3TVK A;  2IMW P;  4A8F A;  3HVR A;  1CUL B;  4KIA A;  3R27 A;  3QSI A;  1H0H B;  2AIR B;  2M4M A;  3GPA A;  4IOC Q;  1GH8 A;  3HXM A;  1RWM B;  2G1H A;  1SJ3 P;  3NXZ A;  1S79 A;  1RJJ A;  1CJT B;  2PFF B;  4IRK A;  3OHA A;  1UEV A;  2CWX A;  3IN5 A;  5RUB A;  2KO1 A;  2R4F A;  2W4C A;  3CTR A;  2NUH A;  3L3C A;  5L9X A;  4LFC J;  5KFQ A;  5J2P B;  4J9N A;  2VG7 A;  4AT1 B;  3EGV A;  3GIR A;  4DR2 F;  4DV6 F;  3AY0 A;  5HN0 A;  1M90 T;  4PXE A;  5J2Q B;  1QSL A;  3EGZ A;  2UUA F;  4LF6 F;  1DUR A;  5DQH A;  4PUO A;  4DV3 J;  4ES1 A;  4CH7 A;  1RTZ A;  4FNI A;  4MJK A;  2OEK A;  1RA7 A;  1OYD A;  2K3K A;  2PN6 A;  2PT0 A;  4JV5 F;  1ZM4 A;  4WFN Q;  1IM4 A;  1JJ4 A;  4EWT A;  3UVJ B;  1LWX A;  2LQ5 A;  5EWF A;  4WIQ A;  4WP3 A;  4DG1 A;  4RW9 B;  3HVW A;  4UT4 A;  2MKI A;  2XMU A;  1TL1 A;  4IG0 A;  5AE1 A;  3IR6 B;  4M5H A;  3RJM B;  4GVB B;  2J0W A;  2KFN A;  3UQS A;  4XTT A;  4PYD A;  4IR1 A;  1UWA A;  5B0D A;  4DV5 J;  2MLX A;  3KNA A;  2I9S A;  1PYS B;  1ZPW X;  2BJE A;  4DV2 J;  4F0H A;  2RUG A;  4KGZ B;  2JZ5 A;  3OJU A;  3UN5 A;  1MWQ A;  2ROP A;  1VQ8 S;  2BE2 A;  3J80 U;  3MEG B;  3OD2 A;  2UXB F;  1J2V A;  2I8E A;  4K50 A;  4NI2 A;  3H4B A;  3JSM A;  3QAT A;  1Q5V A;  1RTI A;  2OO4 A;  3SFG A;  1IKW A;  3KNG A;  1IKY B;  1YJW S;  5DRK A;  2DHH A;  1C2P A;  3SV4 A;  1U0S A;  1X4F A;  3EWG A;  1WG1 A;  3VQT A;  4K7Q A;  3HO1 A;  4NLD A;  4B9U A;  3LGM A;  3J7A N;  5EX3 A;  1YLX A;  2RF2 B;  4Q44 A;  1YBA A;  1WOR A;  2ZWP A;  1FXR A;  4DL6 A;  3FQK A;  1RAO A;  1R43 A;  4CM2 A;  1S1X A;  4DF4 A;  5D0H A;  4KPY A;  4NEY A;  2OD4 A;  1YI2 S;  3FEY B;  1Y4Z B;  4ELV A;  3FEZ A;  4Q0B A;  3PR4 A;  1HBU B;  2AJ4 A;  3I0R A;  3G6Y A;  1K44 A;  5IT9 U;  2CG8 A;  2ZEJ A;  2W4D A;  2JJ4 D;  2DYA A;  4FPR A;  5B0E A;  1ZH5 A;  2PII A;  4DR4 F;  4NAS A;  2HHX A;  4KE5 A;  3H5X A;  4RL1 A;  1X5T A;  4J7C A;  3M6U A;  3MAH A;  3RYL A;  2ASD A;  3AXM A;  1RU1 A;  4ZVF A;  3I9V 9;  3NBP A;  2CJ9 A;  1HKA A;  2XUL A;  5AE2 A;  1VQS A;  1C0T A;  2RQM A;  3BQ0 A;  2HFS A;  5K8M A;  1CSJ A;  2CDQ A;  4C8Z A;  2F8H A;  4YS2 A;  4WJB A;  2RUS A;  2MTL A;  1REV B;  1K73 T;  1G7C B;  2MXY A;  2IYG A;  3DRP B;  1L3S A;  4FS1 A;  4H4K A;  3T6J A;  4NCG B;  2V5H G;  3QJL A;  3EZO A;  5ETS A;  2XMK A;  3FFI B;  1HFE L;  1KQG B;  5KG7 A;  1I3O B;  4Y2A A;  3GV8 B;  1K0V A;  3PY8 A;  1U4B A;  3VTI A;  5DM6 Q;  1XR5 A;  5B0B A;  4K4W A;  3HHD A;  3DC2 A;  1WF2 A;  2JFD A;  3A3O B;  3MD1 A;  1HNX F;  1UVN A;  1D9F A;  1EJ7 L;  5C42 A;  2IVF B;  3G6X A;  4X64 F;  2WVE A;  4ZCL A;  3L7P A;  3ENQ A;  3A3N B;  3DLG B;  1U2F A;  2HAF A;  1Y00 A;  3RB6 A;  1XMQ J;  4DR5 F;  3N6N A;  2LEA A;  4EMD A;  3OFG A;  1UCN A;  2QA4 S;  1Q8K A;  5JVH Q;  1YJ7 A;  2GJI A;  5LSL A;  1R8B A;  2QLJ B;  3B54 A;  3Q23 A;  4LF2 A;  5BJR A;  4PXB A;  3ZZY A;  3P5B P;  3CJ4 A;  3BKT A;  3IGN A;  2QC3 A;  4R5P B;  4XPE A;  5A8R A;  3CJT A;  3CME S;  4MKV A;  3UN3 A;  1SJQ A;  1WKL A;  1WD6 A;  1MN9 A;  2ILY A;  2DNO A;  3FDS A;  3CCE S;  3W2V B;  2RDJ A;  1YK9 A;  4GO7 X;  3D0I E;  2G0J A;  3TZZ A;  1CJU A;  1CS4 B;  3G9C A;  3GR1 A;  4A8M P;  4LF8 F;  2MJN A;  2MSS A;  3LTO A;  2DNM A;  1MMD A;  4ES2 A;  5LL6 d;  5DO2 A;  3H2L A;  2LKZ A;  4M5I A;  3N28 A;  4OHV A;  4KHM A;  3DCA A;  3BSC A;  1NO8 A;  2M52 A;  2W7A A;  3M8Z A;  3IM8 A;  2N3L A;  2FQQ B;  3A4T A;  4PWW A;  4F67 A;  4ED0 A;  3DHW C;  2RE1 A;  5KFU A;  5E3Q A;  5H9F J;  5CZX A;  3UN2 A;  1OIA A;  4HH0 A;  1TK0 A;  3CO9 A;  3VGU A;  2NXC A;  4Y2I A;  4MH8 A;  2RDD A;  5DG8 A;  5I3U A;  4DL5 A;  2MQ8 A;  3GG0 A;  4C48 A;  1Q86 T;  2Z57 B;  2CNO B;  5IZH A;  3NAI A;  5ETL A;  1RT1 B;  4ES3 A;  2FVR A;  3CCL S;  3KG1 A;  3PW0 A;  2GHW A;  4ZIT A;  3TP2 A;  5DQG A;  4ZVP B;  3IC1 A;  1NZA A;  2E1A A;  2EXU A;  2ZHA A;  2FIU A;  3NLC A;  4RW4 A;  2EK6 A;  1H2T Z;  4CO5 A;  3OR2 B;  3MGJ A;  4ZCK A;  1OPI A;  3A8I A;  3QID A;  1XN9 A;  3CIZ A;  3M6V A;  4E8U A;  3MM9 A;  4G65 A;  5THW A;  2DIS A;  4DL2 A;  2HVD A;  2ASY A;  2OUG A;  4X4P A;  2V8G A;  4HT5 A;  4P2M A;  5KFE A;  3V81 B;  4M5J A;  4JI6 J;  2DR6 A;  2J5A A;  3V6J A;  3OQ2 A;  2EKN A;  3CDB A;  1XNQ F;  1SC6 A;  2R8I A;  3SIP B;  3LQV A;  4UQG A;  4PQU A;  5FD1 A;  4RNN A;  4WU2 A;  3ZZZ A;  5KFF A;  1VIS A;  3NCP A;  5DGB A;  3S6E A;  1FCA A;  2RIL A;  2DCL A;  5IM0 A;  4OYI A;  4WZQ A;  1OS5 A;  2M8D B;  4C9D A;  3DRS B;  2G2Z A;  1VQM S;  4KHR A;  2HVE A;  1U47 A;  2ZFH A;  1OY6 A;  5G0R B;  3IG1 A;  5LMN F;  4DR3 F;  3KG0 A;  2BXJ A;  3HMJ G;  3GYG A;  2E5H A;  1C1C B;  2ZZT A;  1RDR A;  1PKU A;  2COL A;  1NK7 A;  1HWK A;  1U7L A;  2HVH A;  1OPZ A;  3CD6 S;  3N4W A;  2ABY A;  2AHO B;  2KXN B;  1DAX A;  1YIJ S;  1WOP A;  3Q89 A;  3B4M A;  2DVI A;  2QLX A;  5A0Y A;  4AQY F;  2IDE A;  1YJ9 S;  1Q95 G;  3T1H J;  4OV1 A;  1NPR A;  4C8O A;  2DRD A;  2XI2 A;  4JB8 B;  2J9D A;  5HQL A;  4HDG A;  4U7C A;  2XY6 A;  2X1A A;  3SYZ A;  5KT2 A;  1ZTT A;  2HW3 A;  2KYX A;  3HZG A;  4NOH A;  1N36 J;  2V2V A;  2FUG 9;  4P72 A;  4U8V A;  2MZR A;  4OJ1 A;  5AT1 B;  1TMM A;  1S6O A;  3NMA A;  1VQY A;  1NH7 A;  2QEX S;  1WEY A;  4G6V B;  3KJN B;  5HP1 B;  3SQG A;  4X4Q A;  2IPO B;  5KFD A;  4IFY B;  3TJA A;  4QW8 A;  3BSN A;  4MK8 A;  2CJK A;  3NNA A;  3RRK A;  1NK6 A;  1FRK A;  1WDD A;  1HLW A;  3A8E A;  3BZQ A;  3OFF A;  3FQL A;  1R89 A;  3S1T A;  2WRM A;  1KOH A;  5CYM B;  3MZI A;  4KKO B;  3OL6 A;  2AEM A;  1D0E A;  1AZS A;  5I3U B;  1OY8 A;  2WK4 A;  3RTV A;  1FEE A;  5JXS A;  2D3O 1;  5KG6 A;  4NLY A;  3AD7 C;  4LT6 A;  1Y3K A;  3K89 A;  3B8H A;  3D1Q A;  1LXJ A;  4WE1 B;  2OFG X;  3TOQ A;  4WFA Q;  2V9K A;  2RS2 A;  1F5A A;  3CJ3 A;  1ZM3 A;  1JLB A;  4TLQ A;  4HKQ A;  3E01 A;  4NCA A;  3DLJ A;  1UJ6 A;  3Q8R B;  3MWB A;  2RRB A;  2FC8 A;  3OTC A;  2NSC A;  4LF9 F;  5GAH I;  1RWK B;  2A6M A;  3RBZ A;  2GIF A;  2W8K A;  3PJW A;  5E2Q A;  3V4M A;  1S0N A;  3HUL A;  3W2W A;  2OPS A;  2KM8 B;  3T1Y F;  4P2S A;  1XK8 A;  1EQ0 A;  4K4T A;  2QL9 B;  3G96 A;  3NL0 A;  1VBK A;  2XZT B;  2FHO B;  2MHE A;  1R0A A;  2OIH A;  3D3C J;  5J1E A;  2UUB J;  1G1X A;  2MHN A;  2P6S A;  5LJ5 Y;  1G4C A;  2BR0 A;  4XIU A;  4IG3 A;  4E98 A;  2FDN A;  4TLR A;  2E9T A;  2XHW A;  5L39 A;  2MKK A;  2D7S A;  3IG1 B;  3IWL A;  1I1G A;  4OIX A;  2YNI A;  3I5C A;  5A2Q Y;  2NUU G;  2FZK B;  4OYW A;  3K59 A;  1F9F A;  3ISN C;  5HVH A;  4UOC A;  3KJV B;  2XSJ B;  3G6V A;  3OLA A;  1JLE B;  3HI9 A;  1VBX A;  1HQE B;  2Y8Y A;  1WSV A;  2GC8 A;  2YVS A;  4I0W A;  2KYZ A;  1P1L A;  4R8U B;  2W4P A;  3BGR B;  1U26 A;  2ZHO A;  2ZJR Q;  1KLN A;  1SIW B;  4KT0 C;  1KQK A;  1HD0 A;  3PRB A;  1TL3 B;  5L1J A;  1SKR A;  3LOU A;  2VON A;  2K3I A;  1E6V B;  1OO0 B;  3IP0 A;  3AQP A;  2HFN A;  3KK2 A;  2YNG B;  3MCS A;  1HBM B;  1KLM A;  1U1K A;  1S6Q B;  1OWX A;  2Q43 A;  2LVW A;  4CIO A;  3VAJ A;  4BBY A;  2GS8 A;  1VQ7 S;  4WF9 Q;  3RRG A;  1RB0 A;  4DS5 A;  4WXW A;  4I2Q A;  3U1L A;  1T9T A;  5D77 A;  2CNK B;  2RH3 A;  3W61 A;  1XNR F;  3QFW A;  2WBR A;  4LRF A;  1NK5 A;  1RHJ B;  4OI4 A;  2FLO A;  5J2N B;  2OKQ A;  4YQW A;  4P74 A;  1GT8 A;  1UMJ A;  3OVA A;  4FF3 A;  1FA0 A;  2YX1 A;  4NLS A;  3F44 A;  3FSX A;  2NZ4 A;  5C5J A;  3CJR A;  3T5J A;  1RTJ B;  2B5J B;  5EWG A;  4USK A;  1CG2 A;  2GNK A;  2JHE A;  2HEK A;  2CNL B;  1EP4 B;  2HIY A;  5GMD A;  1C4C A;  2NXU A;  1GMV A;  3PJX A;  2OP5 A;  2IA0 A;  3BF4 A;  2DIV A;  2AGO A;  4K8R A;  2X1G A;  1GMU A;  4GKK J;  4O23 A;  1RXO B;  2B6A B;  1NK9 A;  4FXD A;  2EFP A;  2ACM A;  5CH7 B;  2QG9 B;  2E66 A;  1YHQ S;  4XPC A;  4J90 A;  1S1V B;  4QR1 A;  5D3G B;  1DHM A;  3W2W B;  4FF1 A;  1S1U A;  1PYO B;  2YNH B;  2KM8 C;  3PX0 A;  2DGX A;  4EI2 A;  3CVK A;  4KFB B;  4H4M B;  2HRT A;  3AHP A;  3OR1 A;  2L08 A;  1OSD A;  1NJZ A;  2ZWO A;  3ENA A;  3WX4 A;  4G3I A;  1UJ5 A;  1F9H A;  2DGW A;  4ECT A;  4EO8 A;  1T9W A;  1U1Q A;  1VOM A;  2E1C A;  3T5H A;  4TY9 A;  3DYA B;  2CAJ A;  3M2V B;  3PV8 A;  3Q8Q B;  3M4X A;  4IQM A;  5ETV A;  1W26 A;  1XMO F;  4O3P A;  5EWE A;  3FRZ A;  3JSR A;  2KL8 A;  3RU0 A;  1RT3 A;  4HR2 A;  2V4J A;  1YJT A;  1S1W A;  2JOQ A;  5L1I A;  4DR2 J;  5FDL A;  4DV6 J;  1KOO A;  1HMV B;  4B08 A;  2UUA J;  4LF6 J;  3DFE A;  4CO4 A;  3GU0 A;  1TTH B;  2FZC B;  3IRW P;  2QX0 A;  2G2Y A;  3J7Z T;  3PR5 B;  2YNF B;  2EG2 A;  1DQ8 A;  1FD8 A;  3GFZ A;  4JV5 J;  3POT B;  3CO0 P;  1ZYQ A;  2FZG B;  3WC2 A;  5EX0 A;  3MTK A;  1O51 A;  2Z2M A;  3E2E A;  2AGQ A;  4FP9 A;  4HVZ A;  1FHT A;  1K8A T;  2A2C A;  8RUC A;  3ZTQ A;  5GAE U;  5CYQ B;  4OX7 A;  3P49 B;  1DFD A;  4F7V A;  1U48 A;  2MMY A;  2F5G A;  1CC7 A;  4KGM A;  1H7X A;  2BDP A;  1IQT A;  2QTW A;  3CCR S;  5AXN A;  4M1K A;  2ZUA A;  3DI6 A;  2JVO A;  2MKY A;  1VI7 A;  4X4R A;  3IFE A;  2F8M A;  4DFP A;  2KFY A;  4ZVU B;  1V5V A;  4K2X A;  2M0G B;  1WC1 A;  3J81 j;  2ZH3 A;  1HWI A;  2CJQ A;  2XO7 A;  3FJ2 A;  5KG0 A;  1MG7 A;  1QUP A;  3LUY A;  4LRD A;  2CZ4 A;  2IC3 A;  3OXF A;  4I1T A;  1MSW D;  4QR2 A;  4R25 A;  2D9O A;  2UXB J;  2XMV A;  3ZTO A;  2V8P A;  4O3N A;  4F8R A;  1HWL A;  3QT6 A;  2LA4 A;  4DCO B;  5KFO A;  2HBZ B;  4IDK B;  4J9L A;  2AGP A;  2FLL A;  2AYB A;  4NLX A;  2AEF A;  3GB0 A;  2BAC A;  1TKX B;  1RT4 A;  4PG6 A;  4LR9 A;  2YQ3 A;  2QO3 A;  5KFN A;  2HBY B;  1IBM F;  1HI1 A;  2VJV A;  4ZLJ A;  3MUM P;  4NPO A;  4PQA A;  3DLL Q;  2MQL A;  1TV6 A;  2CPD A;  1QM9 A;  3BB5 A;  3N9U C;  3D67 A;  3MAQ A;  4ZHR B;  1GEH A;  4NLU A;  1FNM A;  3OL9 A;  2R7S A;  5KFH A;  2J9D E;  1T95 A;  1R6Y A;  2UXC F;  3QT7 A;  1KON A;  1V3Z A;  3ET6 A;  3I87 A;  1B70 B;  4DR4 J;  2AQ4 A;  1X0F A;  2PO4 A;  1DTQ A;  3I82 A;  1LWE A;  1RT6 A;  4ZPC A;  4DZ6 A;  2EG1 A;  4ZVQ B;  1F6T A;  1N33 F;  4E0D A;  1RAE B;  1WHW A;  1BQM B;  4GC7 A;  2BBE A;  1H3D A;  4YB7 A;  4RJV A;  4NYZ A;  3R97 A;  4EO6 A;  1RT3 B;  4LUB A;  3HVT B;  2KJV A;  1NSQ A;  4FYV B;  2LMI A;  1NJX A;  5FDL B;  3GSD A;  3FKB A;  2X1F A;  1Y5N B;  3J7Y U;  4FXV A;  1U2C A;  5F8N A;  3MM8 B;  3PRD A;  2YH1 A;  1SH2 A;  3W5Y A;  2ZE2 A;  3W3S A;  1R6V A;  1V5I B;  1MRO A;  3LAM A;  2IVY A;  3GV7 B;  1TK8 A;  2MDA A;  3H42 A;  1HW9 A;  1DTT B;  4CNY A;  1U8W A;  1DRZ A;  1RTD B;  3DNC A;  4ECV A;  2H3E B;  3AXK A;  2C3O A;  2GHP A;  2DNQ A;  1HNX J;  2GCF A;  5KAK A;  3F41 A;  3CJK B;  3L7U A;  4U7U K;  4ERD A;  2HMI B;  4ZP8 A;  4P2F A;  1E6Y B;  4HI1 A;  1RAA B;  4YR3 A;  1KD1 T;  3KDO A;  5H9E J;  1NND A;  4X64 J;  1M0S A;  2I5J A;  4CLK A;  1TKD A;  1CPZ A;  3AT1 B;  1SPB P;  2IM1 A;  4DR5 J;  2QLB B;  4C6A A;  3WHI A;  4J9U E;  3MEK A;  2PA8 D;  2KXF A;  3A3P B;  2B9E A;  4KV8 A;  3PEJ A;  1PJ6 A;  4NYO A;  1UVJ A;  2ZH8 A;  2BEF A;  5HJX A;  3CE8 A;  1EAY C;  3QAE A;  4M5N A;  2J6S A;  3RG6 A;  5L1L A;  4OZ5 A;  3VAI A;  1YG0 A;  1WTF A;  4RW8 A;  4ANC A;  4C8N A;  2HND B;  1FES A;  1F5B A;  2J9C A;  3L7O A;  2M5Y A;  1IXK A;  3FZB A;  3BGU A;  1GQE A;  4DL4 A;  3WC0 A;  2XGP A;  4F4A A;  1NJW A;  4NA3 A;  3KLI A;  4HT7 A;  2J8A A;  3RBE A;  2L3M A;  2HVZ A;  4CT8 A;  4LF8 J;  2HQD A;  1RBA A;  2N4D A;  3WQP A;  1N5Q A;  1WHX A;  4FYW B;  5A8K B;  1FX4 A;  3D4J A;  3SZ2 A;  5HSP A;  1VK3 A;  2JL9 A;  2JLE A;  2ZVI A;  4JOU A;  1KTV A;  4ZS6 A;  4JI1 F;  1VQP S;  4QOT A;  2WOM B;  3QGG A;  1U1P A;  2VPZ B;  2E1P A;  3LP2 A;  1RHM B;  1EIY B;  1AYE A;  2UUW A;  3SCL E;  1TUG B;  2QMX A;  3EIC A;  3IO1 A;  1FE0 A;  2LA6 A;  2FLN A;  2YBV A;  2OI2 A;  3QWU A;  1GXU A;  4WFZ A;  1U1L A;  2XWY A;  1FWP A;  4L76 A;  2CJY B;  2BJ9 A;  3DRR A;  2XC9 A;  2BOP A;  3QLH B;  3VGT A;  2B4O A;  1VQO S;  4IR9 A;  3LP1 A;  3M8R A;  2VB6 A;  3M8P A;  1UA1 A;  4ID5 B;  3RUB L;  1M5O C;  3JSB A;  5BYS A;  3GFX A;  4DFK A;  1KHV A;  2WVF A;  1AXQ A;  4UQT A;  1HHT P;  3KK3 A;  2PA3 A;  1ZM9 A;  2FJE B;  3EXY A;  4TQS A;  5HLF A;  4LRC A;  1WEX A;  1X0P A;  4DFM A;  1SKW A;  4L73 A;  1RE1 B;  4LSL B;  3MFI A;  2HHS A;  3NRB A;  5KFY A;  2IAJ B;  1UWB A;  5CAA A;  3BR8 A;  2DO0 A;  1JLA A;  2BM0 A;  2GX8 A;  4G1P A;  4F3Q A;  5B0F A;  2HHH F;  2J7W A;  2ZOF A;  4IOB A;  3UCG A;  1XNQ J;  1V9O A;  3HHL B;  3MOZ A;  4ECR A;  3OXL A;  2UUC F;  3DGV A;  4FPI A;  4PPZ A;  4UZB A;  3DLK B;  2V69 A;  3AAW B;  3LWL A;  1PJ7 A;  4DQI A;  2VKZ G;  1WOO A;  4HL9 A;  1L3K A;  1VS3 A;  4OZ1 A;  5KFA A;  3DOL B;  4DR3 J;  5LMN J;  2KG0 A;  1RHR B;  4C8Y A;  3AFG A;  4OI1 A;  3FCV A;  3MEE A;  4YEA A;  1JLQ B;  2C1E B;  2PMW A;  4CTA A;  3GIJ A;  2VPW B;  3VAL A;  1FJC A;  6FD1 A;  2A10 A;  3BSO A;  2HS0 A;  4FDF A;  1KVK A;  4LQ9 A;  4TY8 A;  5I3Q A;  1HQU B;  4AQY J;  3IRX B;  4UUX A;  2BE9 B;  4KBI A;  3TX8 A;  3PDN A;  2XB2 D;  3MEC B;  2HFZ A;  3NGT A;  5IT4 A;  1HNI A;  4YP3 A;  2XM3 A;  3M8W A;  3MAA B;  4U95 A;  3BGF A;  3K7R A;  3E51 A;  3BGO P;  1QE1 B;  3QJP A;  4IH7 A;  1S59 A;  1N5Y B;  5CXT A;  3PEH A;  3CUN A;  1EKS A;  4LSN A;  2Q66 A;  1ROF A;  2B4V A;  1TK5 A;  3C15 B;  2DB1 A;  1WKK A;  3C14 B;  2AYE A;  1WF0 A;  1KWM A;  2J0X A;  3KMS A;  4OYA A;  1TKZ B;  2J6T A;  2QLF B;  1QTN B;  3FGV A;  1S0O A;  2DNH A;  2RAQ A;  3F73 A;  1FNO A;  3FSY A;  3DLE A;  5SZT A;  2VFS A;  3TJ9 A;  1PAE X;  4KSE B;  2XG8 A;  3PYE A;  1VQL S;  2BQ3 A;  1PBU A;  2VH7 A;  4QU7 A;  3E8O A;  4ED6 A;  2XCA A;  1SJ4 P;  1X60 A;  1YQH A;  3CCS S;  1QAY A;  2EVZ A;  6FDR A;  2CPX A;  4UF4 A;  2MZ1 A;  2E5G A;  4EGL A;  2GQQ A;  1DY3 A;  4YB5 A;  1RWX B;  2YXL A;  5LMU F;  2X51 A;  2W2M P;  3BKF A;  1ZZN A;  2FJA B;  5A76 A;  4K4X A;  2ZJQ Q;  3PHT A;  3MPY A;  5I42 B;  1X9S A;  4ZVH A;  4JV0 A;  2CPZ A;  2EBG A;  1KVJ A;  2BMB A;  5A6P A;  4LF9 J;  3LF0 A;  4N56 A;  1MLA A;  2G4B A;  2KKH A;  2ZKU A;  3SSQ A;  2GGP A;  3T1Y J;  3KJF B;  4KH1 B;  3DDK A;  2LCW A;  3QSY B;  1D8Z A;  3UWT A;  4YHH F;  3ENW A;  4MKB A;  4OYM A;  5K14 B;  4XDC A;  4KTQ A;  2R7Q A;  1U6B A;  1LW2 A;  1SQG A;  1V3S A;  3HHL C;  2VOP A;  4PXC A;  1VLO A;  3QGI A;  3MR7 A;  3KLG B;  2JRS A;  5KT7 A;  3AJ2 A;  2I2Y A;  2EPI A;  2XS7 A;  2VDI A;  4IOA Q;  4XDD A;  2W9C A;  1AA1 B;  2V9W A;  1SCJ B;  1D9A A;  2ROG A;  2IRX A;  1U25 A;  3MR5 A;  4RZR A;  2VG5 A;  2HBQ B;  2E7W A;  3OHB A;  5FJ4 A;  2UV8 A;  2XWX A;  3QT8 A;  3UI3 A;  2W9A A;  5E3C A;  5E41 A;  2CJB A;  4K4S A;  1S6P A;  1AB8 A;  4JI5 F;  4F0K A;  4L75 A;  3UCZ P;  1LWF B;  4G1Q A;  2KHD A;  4LR7 A;  5KG5 A;  2KU7 A;  4QWD A;  2DNK A;  3OT9 A;  4GMK A;  2M8H A;  1FER A;  5J2M B;  1RTH B;  1QAI A;  4WP8 A;  1S0V A;  4DPY A;  1MWY A;  4HAC B;  3V6D A;  4L72 B;  1XER A;  2DH7 A;  2EKY A;  3MED B;  1S0M A;  2FJX A;  5CA5 A;  1U49 A;  4OX8 A;  3SEO A;  1FJG F;  1BQX A;  4A4J A;  3ELH A;  2MGZ A;  5B0A A;  4TN2 A;  4Z2X A;  4I56 A;  3IR5 B;  1U02 A;  1XNR J;  3MPW A;  1IKV A;  3OLB A;  3CPW R;  4URG A;  4B3M F;  3DLE B;  3MM7 A;  4X4N A;  2FYX A;  3OUY B;  3W9H A;  4LF4 F;  4F26 A;  4FS2 A;  3DM2 B;  2YKQ A;  1GMW D;  5GVQ A;  4DUZ F;  4Q2L A;  4A48 A;  4M8L A;  4DI6 A;  2DRB A;  4Q8F A;  3HKZ D;  4M5G A;  4USI A;  2F65 A;  3TQ1 A;  2QYG A;  2H1Y A;  3CWJ A;  1NLK L;  1FXD A;  2C2D A;  4ECS A;  2B7C B;  4DWI A;  4ECY A;  2H4W B;  4OV6 A;  1LFW A;  1XTZ A;  1KS2 A;  3CMQ A;  3S7R A;  1Y5I B;  1TKT A;  2ERR A;  3MXH P;  5E5N A;  2KJW A;  4CLF A;  3ENV A;  4DLE A;  4ZPD A;  1CEZ A;  3U1M A;  1Q1K A;  2DJW A;  3QIP A;  1QLN A;  3R7N B;  4M5D B;  1UZD A;  3C16 A;  3QO9 B;  4NLG A;  1CLF A;  1J5O B;  1ACM B;  1MMN A;  4ZIV A;  2C2N A;  3FSI A;  2LEC A;  1G3O A;  1YRX A;  2H51 B;  1RCX B;  3TW0 A;  1YZ6 A;  2HQC A;  3KKF A;  5MAO A;  1M5P C;  3VVU A;  4KH0 B;  3PIP Q;  1IBK F;  1XMO J;  3BN7 A;  2VIH A;  1HYS A;  2DCU B;  4CLW A;  4Y65 A;  4OHX A;  1SKU B;  4MIW A;  1TU0 B;  3LWM A;  2VG6 B;  1SXL A;  5ETP A;  4AXJ A;  3O3L A;  1H74 A;  2CQ2 A;  3WIU A;  2PEB A;  4KR0 B;  1N52 B;  4CM0 A;  3UO0 A;  2W1B A;  2CQ4 A;  3ETM A;  1JNZ B;  2APO A;  3D1H A;  2QL7 B;  3MMC A;  4O3S A;  2CPH A;  1IBC B;  3I0S A;  2QIF A;  2N82 B;  4O4G B;  3GJT B;  4I2P B;  2K7J A;  3A13 A;  1RSC A;  2FLP A;  1DAR A;  2PE8 A;  3JQK A;  3Q8Y A;  3Q86 A;  1Y11 A;  3HHN B;  2DEJ A;  4HEA 9;  5D4L A;  5KFJ A;  1HI0 P;  4NLV A;  5IQ6 A;  2CRL A;  4L3N A;  1XBW A;  1QD1 A;  3MD3 A;  3V4I A;  2LXI A;  1BWV A;  3NS6 A;  3C19 A;  5LT5 A;  4RW6 B;  3G82 A;  2CNN B;  1HQ2 A;  5F8I A;  2BV3 A;  4DF8 A;  5AJ3 F;  4NYP A;  1PJ5 A;  2C3U A;  1UJ4 A;  3EVM A;  2YWE A;  4F25 A;  4X4T A;  2V8V A;  3EX7 B;  1RK8 A;  1Z2Z A;  3I32 A;  2FVS A;  1YJN S;  4I6Y A;  1YRT A;  1SI9 A;  1F3V A;  2RSQ A;  2AJ0 A;  1DZ5 A;  3R1L A;  4YOE A;  2HQG A;  1ITP A;  5IS2 A;  4Y00 A;  2P6T A;  1U6Z A;  1FKP A;  2ZBC A;  4DU8 A;  3GR0 A;  1FRH A;  4FYX B;  1GNK A;  4RR5 A;  5EHH A;  1FK9 B;  3C6U A;  3PO5 A;  4ZLP A;  4CYU A;  2RQK A;  1X5S A;  2XYG B;  3M32 B;  1HAR A;  3OPK A;  1SUQ A;  3K8V A;  3CD7 A;  2WB4 A;  2D9P A;  3HT3 A;  1I5O B;  3ZNJ 1;  4UTG A;  2WBM A;  2MLZ A;  3Q8U A;  1KQF B;  4AL5 A;  3MUV P;  3MCN A;  2CQ1 A;  2RKI A;  1T9X A;  2CA9 A;  1N54 B;  2DH9 A;  1JKH A;  3MR2 A;  1IBM J;  5J1N A;  1KN6 A;  2WHO A;  4ZKA A;  2MYF A;  1SJ1 A;  2MKJ A;  2HWI A;  2YQ0 A;  4J5O A;  5HAO A;  1VRT B;  1FRM A;  1F0X A;  2DBB A;  5F9L A;  1C0U B;  1HPZ B;  1TR0 A;  4ETZ A;  3BDE A;  3G87 A;  3M8Q A;  2BUN A;  3MCM A;  2N7Y A;  2IHR 1;  1WEL A;  1LEO A;  1SJR A;  1M1G A;  2UXC J;  1ZAX A;  1LWC B;  3UW1 A;  4ETX A;  2KN4 A;  3BN4 A;  3C6T B;  3MMA B;  3UNY A;  3K8W A;  4B3O A;  1N5T A;  2OSR A;  1JX4 A;  3BGL A;  2O66 A;  5I3P A;  3UFC X;  5CAB A;  1N33 J;  2HQF A;  4OZL A;  4HTI A;  1ZZF A;  2YKN B;  2MZT A;  1VRU A;  3VGV A;  2J9E A;  4RNF A;  3GQC A;  1S1T B;  4NLR A;  3AJD A;  4LFB F;  1GX5 A;  4D3H A;  2H9Z A;  3QQC D;  4MMO A;  4ITS A;  1IBL F;  4FVM A;  4K4Y A;  2DHS A;  3D3B J;  4W90 B;  4QBU A;  2RT3 A;  2IM2 A;  3RW7 A;  1DLO B;  4DUT A;  1QVF R;  2LQJ A;  4WFY A;  4K0K F;  3OVS A;  2Y1J A;  4CO2 A;  2WW8 A;  2LLZ A;  2WVD A;  4CT9 A;  1UVM A;  3BPS P;  1RP5 A;  4QWB A;  4RU9 A;  2WVB A;  2FJD B;  2HQI A;  2GIR A;  2XY7 A;  5F3T A;  4W92 B;  4DSL A;  2IM3 A;  1WSR A;  1YX2 A;  1MWZ A;  2ZH4 A;  3TZY A;  3DN9 A;  4DX8 H;  2GMH A;  2H5I B;  1VFJ A;  4OHY A;  1RT7 A;  4OZ0 A;  3K17 A;  4DDF A;  1PIE A;  1CJK A;  5DDP C;  2YQ1 A;  3CCT A;  4BS2 A;  2F4F A;  1X4D A;  2WB1 D;  4P7V A;  4F2R A;  4YY3 J;  1C1B B;  2QMU B;  4JI3 F;  3X1L B;  2DIT A;  3VV2 B;  1Q8I A;  1N5S A;  2C3Y A;  3H98 A;  3JSY A;  2ALY B;  3E3X A;  2FGC A;  5HO4 A;  5EGY A;  4J9O A;  2JWN A;  2P5V A;  1RGV A;  2J7U A;  3LA0 A;  4DQR A;  1SQE A;  2DGQ A;  1QUV A;  4IQX A;  1APS A;  1U0H A;  3ZNU A;  2YX4 A;  3DOK B;  3IBW A;  1Q7L B;  1RHK B;  4O3R A;  2CQH A;  2Q3P A;  4CI0 B;  3T5L A;  2MQP A;  3GYN A;  3TA0 A;  2GAG C;  1LV5 A;  2VL1 A;  1FJE B;  3CCQ S;  2OJ3 A;  3QGH A;  4M5L A;  2F9J A;  4GKJ F;  3IR7 B;  2OML A;  2AYM A;  4IH5 A;  1JLC A;  1TMJ A;  4HI2 A;  3DGP A;  2HGN A;  1ZOT A;  1TQL A;  1W25 A;  3IM9 A;  4JI1 J;  2FJB B;  4B9T A;  3KLE A;  4ZPB A;  2D41 A;  1MW7 A;  1HA1 A;  2MQO A;  3KUH A;  4B9L A;  4ZLN A;  5U47 A;  4QQB A;  4DFJ A;  1U8S A;  1S77 D;  2CJX B;  1XJW B;  5HK4 A;  5DDR C;  4OI2 A;  2BAN A;  2G2O A;  2HK3 A;  2MEW A;  2ZD1 B;  3VHQ A;  3PHE A;  5EUH A;  2NS1 B;  3M1V A;  3US5 A;  1DQA A;  3HD1 A;  1KSP A;  4QYZ J;  1YTY A;  2HNZ B;  3CCU S;  2M9K A;  3KK1 B;  1OQ3 A;  1WUU A;  1SB6 A;  3MM5 B;  2K1R B;  3N79 A;  1J27 A;  1UL3 A;  2NPF A;  4ZP9 A;  5GAE I;  3TAM A;  3H5U A;  1VGY A;  1ZPV A;  1NU4 A;  1KKH A;  3TJ8 A;  2XMW A;  2OPQ A;  2W2O P;  3D28 A;  1HR0 F;  3I5B A;  1LK5 A;  4ED1 A;  2KHC A;  1RWN B;  1Q82 T;  2IDL A;  2V4Q A;  2QSF A;  2GVD A;  2R7W A;  3ZO7 A;  1LNQ A;  1MML A;  2HRU A;  3J7A 1;  2HHH J;  3HPO A;  2E5I A;  4C11 B;  4CRJ A;  2VZ9 A;  2HPU A;  1TL7 A;  2DXF A;  4WK3 A;  3O6Q A;  1UAW A;  2R7X A;  2VUG A;  2F1F A;  2NYI A;  4PPD A;  1RT2 B;  2UUC J;  4CLL A;  2YKP A;  1WC6 A;  4RW7 B;  3HT0 A;  3VGS A;  2L9W A;  2OTL S;  3M2R B;  3ETO A;  1B3T A;  3BV8 A;  2ACY A;  2IRU A;  3OV7 A;  2Y9H A;  5KT3 A;  4F0M A;  3AA8 A;  3GJQ B;  3N0V A;  2NYH A;  4USV A;  1U1R A;  3FEX B;  2DGU A;  5C24 B;  1VQ9 S;  3IS9 A;  2XS5 A;  1T03 A;  3H59 A;  1FFS B;  2Q79 A;  3MUR P;  3P45 B;  3HVA A;  4NL5 A;  1IUJ A;  3AD8 C;  3KLF A;  4O44 A;  2BJ1 A;  3GIL A;  2G1D A;  2IYI A;  2HNY A;  4OHZ A;  3DMJ A;  1N88 A;  4CO1 A;  1T05 A;  4Z37 A;  3KWM A;  4GVL A;  1JXV A;  1SH3 A;  1N48 A;  1X5P A;  1YSJ A;  3K5O A;  4ZOS A;  5HBM A;  1OQ6 A;  1HBN A;  1HBO A;  4LRA A;  3EXC X;  4QCL A;  2I6W A;  1WI8 A;  1LW0 B;  2M7S A;  4RKU C;  5BR8 F;  1UW4 A;  3FZ2 A;  3UE2 A;  2ZUG A;  3LP0 A;  4PWD B;  3GIM A;  2Q1L A;  2DH8 A;  3TWZ A;  3GJS B;  3QAU A;  1FFW B;  3JYT A;  3M9O B;  3SDE B;  1H98 A;  2XZD B;  2W9B A;  3BH7 B;  4DHV A;  4MTP A;  2FVC A;  2B9Y A;  1S76 D;  3UNG C;  2PDA A;  4GO5 X;  3I31 A;  3VCD A;  3UCU P;  3KJQ B;  2MST A;  3PTW A;  1ZA1 B;  4KO0 B;  4LBI A;  4ILM A;  3M2U A;  2MZS A;  2R7U A;  3EM1 A;  2E5L F;  3DDI A;  2Z2Z A;  3J7Y I;  5HMY A;  3R2D J;  5BXI A;  5CD4 A;  3H7H B;  4NLW A;  4JI8 F;  2LXU A;  1KFS A;  3M1V B;  1BQN B;  2KRB A;  3ISN D;  4ECX A;  2OH2 A;  2ZHB A;  1WHY A;  1EX8 A;  5L8R C;  5LMU J;  4K59 A;  4CO0 A;  1WWH A;  3LW5 C;  4NX9 A;  1N6Q A;  1WC3 A;  2ZIT A;  2QLW A;  3BSA A;  5HMW A;  4QYR A;  2DGV A;  4Y0F A;  2DO4 A;  5KT4 A;  3IBF B;  2XLJ A;  1RT5 A;  1GTE A;  3ITH A;  3SQO P;  3HD2 A;  2HHW A;  4ZCI A;  1JJC B;  3T41 A;  4LJM A;  3O2I A;  1NSA A;  4B3T F;  3R5A A;  2VC1 A;  3CC2 S;  2FTR A;  2H4Y B;  3MMB A;  4ZDN A;  1BE4 A;  5F41 A;  3KXD A;  4B3R F;  2MQQ A;  4LBP A;  4KC5 A;  2R3V A;  4YHH J;  2XZW A;  4KGV B;  3DHX A;  4PG7 A;  3HSD A;  4FBU A;  1A0O B;  1REG X;  2E7X A;  2GJF A;  2A1B A;  4O4R A;  4K5R A;  2YKM A;  2ZOG A;  3UDC A;  4CLU A;  4DN0 A;  3TA2 A;  2CFX A;  2VG7 B;  5K8P A;  1FEH A;  1LQ9 A;  2AW0 A;  1RWO B;  1W2I A;  2OEM A;  2RNE A;  4PUO B;  1S57 A;  2JC1 A;  4WK1 A;  1PYT A;  3CGI A;  1IJE B;  1PBA A;  4BWJ A;  1Q8B A;  2L48 A;  2D74 B;  2W7P A;  2HHU A;  4YUD A;  3NCR A;  4ICL A;  4A8K A;  1B99 A;  4JI5 J;  3T3F A;  3AD9 C;  4DG1 B;  2JFK A;  3CCW A;  4QJV A;  1TL1 B;  3W60 A;  2HZC A;  4IG0 B;  2K2P A;  2HQ3 A;  1WC4 A;  4RNO A;  3MDF A;  4R0E A;  3TEH B;  2Y1L B;  4JI0 F;  3A12 A;  1H6K X;  2IBK A;  1QSS A;  4A8Q A;  4CDI A;  3DDN A;  2C3P A;  5H1S V;  4J9V A;  4A46 A;  1FRL A;  3L4B C;  2RS8 A;  5A8W A;  2XMJ A;  2FJV A;  1FNX H;  2IM0 A;  1UEK A;  3BBF A;  1QAJ A;  4M5M A;  4DR1 F;  3M9M B;  4B02 A;  3N5F A;  1VJW A;  1I51 B;  2H48 B;  3HFV A;  1FDN A;  1HI8 A;  1TAU A;  4OI6 A;  2BE2 B;  3NOC A;  1FJG J;  3HKW A;  5HAT A;  3AJ1 A;  4F4Z A;  1O8B A;  3PNI A;  4NI2 B;  2X1B A;  2Z58 B;  1UVI A;  2C28 A;  3FBF A;  3JSM B;  2ADC A;  1RTI B;  4MIB A;  5C25 A;  3HZE A;  1IKW B;  4B3M J;  4N77 A;  4DU7 A;  2GFF A;  2VHG A;  4LF4 J;  4RPF A;  2V0N A;  4BHQ A;  1KP6 A;  1R8C A;  1U45 A;  2RDI A;  3N6L A;  3D1O A;  5LSR A;  4DUZ J;  3RZA A;  3FC9 A;  4PYA A;  4WP9 A;  3MTJ A;  4ZJL A;  1T8E A;  3OFE A;  4IFV A;  1S1X B;  4MKY A;  2CQB A;  2D3U A;  4UW2 A;  4J91 A;  1FKO A;  2K8G A;  1WC0 A;  1GXL A;  1JLF A;  4Q0B B;  2EK1 A;  3GTY X;  3I0R B;  1Y0H A;  5A2Q U;  1SQF A;  2G0I A;  2GVZ A;  2VD3 A;  3K0J A;  4B3S F;  1NDC A;  2YPY A;  1R3N A;  2VOO A;  2E7V A;  1SV5 A;  3UD5 A;  1S99 A;  4USJ C;  3W5X A;  4OHW A;  3NBP B;  3U7J A;  4RUH A;  3KMQ A;  1C0T B;  5CZV A;  4NLT A;  1FDD A;  1NHU A;  4OX9 F;  1SIZ A;  5ETO A;  2JEG A;  2LEP A;  5H9E K;  1R0B G;  2CUY A;  1D3W A;  2QA4 G;  1L5U A;  5C2C A;  3KHH A;  5IWA F;  1B0P A;  1FD2 A;  5DDO C;  3NEK A;  3ZZP A;  4CP5 A;  1YZ7 A;  3EPI A;  3IBC B;  2WSC C;  4ZN1 A;  3TRG A;  5DGA A;  3IWN C;  5DG9 A;  1IKX A;  3HHE A;  3TX0 A;  1T02 A;  4JI4 F;  3W66 A;  2VQE F;  4AND A;  1IBK J;  2BM1 A;  3D66 A;  2EFQ A;  1G6B A;  3M8Y A;  4X66 F;  3M7V A;  5ETQ A;  1F60 B;  5HL7 Q;  3MM6 A;  4LF5 F;  2DXE A;  4I69 A;  3D54 A;  2JVR A;  1IQZ A;  3VAK A;  2XMM A;  3M6W A;  3VQS A;  1CVJ A;  5GMK a;  1GX6 A;  4LVO P;  3V6H A;  1Y7P A;  1TL5 A;  3CB4 A;  2DY1 A;  1TFY A;  3NKY A;  4MFB A;  1QTM A;  3I4P A;  3DU6 A;  1Q7Y T;  4YDX A;  3P5T L;  1GMW A;  5C42 B;  4PCQ A;  2W2Q P;  4N47 A;  3C46 A;  3ZZU A;  2VKR A;  2RML A;  4QPT A;  3BBC A;  4WKR A;  4LSZ B;  1O6X A;  1Q78 A;  2GO8 A;  4ER8 A;  5C2G A;  1WDT A;  3DOM A;  3KLH A;  2W01 A;  3H40 A;  2B4P A;  3PIO Q;  3UR3 C;  1CJV A;  1SJF A;  3BO4 A;  4N76 A;  1CQN A;  3OTO F;  3OTD A;  3RRH A;  1R31 A;  2O1P A;  4GC6 A;  3V2U C;  1JXL A;  4ECZ A;  5A8R B;  3MPU B;  5AJ3 J;  3L09 A;  5D0E A;  2JNJ A;  3GFH A;  3LAN A;  3TVZ A;  4B17 A;  1N56 A;  1M5V C;  3PKY A;  2OPR A;  5C25 B;  1LOU A;  1XIQ A;  2VBW A;  1MU2 A;  1CJU B;  3H2U B;  4XO0 A;  4KQZ A;  1JLG A;  2V94 A;  1X4A A;  1TUV A;  1D8Y A;  1RAB B;  2QMW A;  1GXT A;  4CLT A;  3CCV S;  4F36 A;  2E1M C;  3GMG A;  2DR5 A;  3R2C J;  1O0P A;  2VFV A;  2ZBQ A;  2KZZ A;  2MQM A;  2YPZ A;  4F50 A;  2YTC A;  3IGV A;  3RBD A;  4DQQ A;  4CH0 S;  2ZDP A;  2BVZ A;  4BC7 A;  2HWT A;  4OZ2 A;  4URQ U;  2U1A A;  2BW7 A;  4F3O A;  4B9M A;  1NRK A;  2KFZ A;  2WON A;  4QWC A;  2C2R A;  1EET A;  4DSJ A;  2HYI B;  2CVI A;  4WKY A;  5HVG A;  4ECU A;  4Y28 C;  4EYI B;  2CYY A;  2VA2 A;  1YGY A;  3M30 A;  2BJ8 A;  4W4M A;  4PXD A;  4RW4 B;  2R7T A;  5B09 A;  3IA0 A;  4UOH A;  2O5D A;  5KFX A;  3MM9 B;  3K5L A;  4DJB A;  4OFZ A;  2YKO A;  4H4K C;  3P8B B;  4IUF A;  5G4D A;  4LFB J;  3U1N A;  1N0V C;  2A3J A;  1CUL A;  1SC3 B;  1VQ4 S;  2C22 A;  1IBL J;  1WHV A;  4USM A;  1B4S A;  1HWJ A;  4YFU A;  1CJT A;  4DOZ A;  4PQU B;  3DU5 A;  2BJ7 A;  3H20 A;  2YH0 A;  4K0K J;  3T6B A;  4MFB B;  2PC6 A;  2RVJ A;  1B0V A;  5IM0 B;  3DXS X;  4NML A;  2AP6 A;  1RYR A;  1FDA A;  3BM7 A;  2XTJ P;  5J2P A;  4TQR A;  1TUW A;  1BUX A;  4B9S A;  2F4V F;  1AT1 B;  2LQ9 A;  5J2Q A;  3NGD A;  3CC4 S;  3SV3 A;  3M05 A;  2FB0 A;  5KFI A;  3BYP A;  2Y1R I;  4UZC A;  3G4S S;  3O1L A;  4UY8 T;  3WZ0 A;  3O8W A;  2JEF A;  1R27 B;  2FHM A;  3W7B A;  4TU8 A;  4HLB A;  5DLF A;  3UVJ A;  3P96 A;  2KB2 A;  5A0Y B;  3UPF A;  4ZVO B;  1RLC L;  1EKR A;  2OMO A;  2AX0 A;  4JI3 J;  1RAI B;  1NSP A;  2RB7 A;  2CQD A;  3WX8 A;  2HKE A;  3PYF A;  2DGO A;  1NK0 A;  4QW9 A;  5L46 A;  1M1K T;  2C42 A;  3LAL A;  1UVL A;  2P9G A;  1VCT A;  3PKM A;  2EW9 A;  1RHQ B;  2DHG A;  1FX2 A;  2HBR B;  1FWK A;  1CQM A;  5KFL A;  3FBB A;  4DUY F;  2V67 A;  2XS2 A;  4KB7 A;  4F4Y A;  3GCW P;  5F9N A;  2CPI A;  1VBZ A;  2ZZM A;  5KG4 A;  1HD1 A;  4Q8E A;  1ZTW A;  2F63 A;  3SQG B;  2EEY A;  2XCP A;  2DR8 A;  1UVK A;  4UY8 5;  3MEG A;  3RB0 A;  4OJG A;  4GKJ J;  3P4U B;  3R7B B;  1G2E A;  1JMT A;  4ZPA A;  3W8P A;  2Z0G A;  3OL8 A;  1IKY A;  4Z7C A;  3EYZ A;  2RU9 A;  3Q0A A;  2PI5 A;  1AZS B;  2D69 A;  4I67 A;  1Q8L A;  4A8O A;  3HSZ A;  3SBM A;  4RUB A;  4CLZ A;  3PW2 A;  3PFO A;  2Q6B A;  2RF2 A;  1IR2 A;  3Q2S C;  4CLS A;  1Q5Y A;  3LO3 A;  2N7C A;  2B0G A;  4NLQ A;  4L74 A;  3RAX A;  2H54 B;  2HZV A;  4CO3 A;  1JLB B;  4P10 A;  2HLT A;  1HNV A;  4FYY B;  3E01 B;  1IJF B;  3I55 S;  4X2B A;  4B9N A;  1YKW A;  1QAX A;  1QJH A;  1M5K C;  4DV1 F;  1HBU A;  1JWW A;  4N7T A;  2R2S A;  2OPS B;  3U27 A;  2ZH1 A;  2UZA A;  4I7F A;  2UUT A;  1VQN S;  1S9G A;  5LOQ A;  4OJ3 A;  4ECW A;  3NP5 A;  4JYA F;  4P9S A;  1JB0 C;  2DNN A;  1NKB A;  1KDN A;  2R8H A;  3BEG B;  1R0A B;  1HR0 J;  2F7V A;  5J1E B;  4OYX A;  1URR A;  5HMZ A;  5LSO A;  4C0H A;  2DNL A;  2ROE A;  5JJB A;  1NHK L;  1Z2L A;  3ILL A;  3J81 Y;  1H2V Z;  3CJ5 A;  2WW4 A;  2E29 A;  3I9Z A;  2J6U A;  4IG3 B;  4TU9 A;  3RGI A;  3RBX A;  2V2Q A;  4F2S A;  2Z2L A;  2R8J A;  1T3O A;  2FJW A;  2DPJ A;  3DXB A;  2MKH A;  4EZ6 A;  2YNI B;  1REV A;  1SVD A;  4NCB A;  4ED5 A;  5D0G A;  3DRP A;  4CLY A;  1HHS A;  4DCP B;  4NCG A;  3W62 A;  1BGX T;  4N41 A;  1SL1 A;  5SUH A;  3QRP A;  4OYZ A;  3ZTS A;  3FFI A;  1URN A;  2CG4 A;  5J1P A;  4M94 A;  3JAM Y;  4EEY A;  3MI7 X;  2XO6 A;  3PG9 A;  4MIA A;  3C66 A;  2XI3 A;  4A47 A;  3JTN A;  2I1R A;  3BRE A;  4DS4 A;  2IRY A;  1CC8 A;  1FF2 A;  3SSR A;  2YX7 A;  2KT3 A;  3AOC A;  5KFT A;  1IN0 A;  4X4O A;  1XEZ A;  4LIR A;  3QYY A;  4ED4 A;  3DLG A;  4ELU A;  2VPX B;  2XSF A;  1R8A A;  4IRC A;  1FVS A;  2ASJ A;  1YRU A;  3KK2 B;  2C3M A;  1B0T A;  1KLM B;  5KFK A;  2W7O A;  4P73 A;  1FRX A;  4JI2 F;  5IXU A;  4DV7 F;  2CQ0 A;  5BR8 J;  2LXF A;  2R8G A;  3WBZ A;  2OAU A;  4I2Q B;  3TNV A;  2V8D A;  1QDU B;  4R5P A;  1RLD A;  4K4V A;  5IV3 A;  3J7Z 5;  2AJ1 A;  2CZV C;  1VLY A;  2P9C A;  5E33 A;  2RRN A;  3W2V A;  4QIF A;  2B8P A;  2XNQ A;  3HHL D;  4WXO A;  4DV4 F;  4DR7 F;  1CS4 A;  2E5L J;  1YJR A;  2RJZ A;  1LFP A;  4WTO B;  1FFG B;  3RAQ A;  1PGZ A;  5FLX Y;  1ARO P;  5B08 A;  4JI8 J;  3KG4 A;  4X4S A;  2W24 A;  1H7W A;  5CCM A;  2J7K A;  3KDN A;  1WG4 A;  4PRF A;  2HHT A;  1HNV B;  1ZAV A;  2P8I A;  4EFA C;  4X4V A;  2D3O R;  1RIS A;  2NXE A;  4CZC A;  1S1U B;  4FKX A;  4I7F B;  1PAU B;  3A8J A;  2OTJ S;  1S9G B;  3BDP A;  1I94 F;  4XAK A;  3SI8 A;  1MN7 A;  3GWC A;  2CPJ A;  4LIW A;  3OR1 B;  1RBL A;  1UFW A;  1UFL A;  1KNZ A;  2EBE A;  3VWS A;  4MYT A;  5E3R A;  4B3T J;  1RT1 A;  2AYG A;  1UTA A;  4PWU A;  2IJF A;  3DLH A;  2DIU A;  5JVG Q;  2DNY A;  4B3R J;  1P6T A;  3B82 A;  5IC4 B;  5B7W A;  5HQM A;  2POK A;  1FKA F;  2ZH2 A;  3BQ1 A;  3T9Z A;  4C2M A;  3OR2 A;  4BLG A;  2XQC A;  3PJ9 A;  2B9X A;  5AXK A;  2J0Q D;  3EVO A;  2CKW A;  5GAG U;  3QWP A;  3QFH A;  2V4J B;  4CLP A;  4RBT A;  4IO9 Q;  3PW4 A;  3EE3 A;  1S1W B;  5BYR A;  5KG3 A;  1X4B A;  4J9S A;  4WCE Q;  3V81 A;  2QA2 A;  2OGU A;  1V3R A;  4MAK A;  2Y3Y A;  2RHQ B;  3CCJ S;  1PC5 A;  1NKE A;  2MQN A;  5IC6 B;  4YME A;  3T1A A;  1T11 A;  3BKU A;  4RU2 A;  8AT1 B;  1OMS A;  4OI3 A;  4ED7 A;  3DRS A;  3AOD A;  2X3G A;  4DX6 A;  4DQP A;  2GAH C;  5DG7 A;  3NWG A;  3EGW B;  5G0R A;  5KT5 A;  3VAH A;  1BLU A;  3X3U A;  4OJH A;  1C1C A;  2MLY A;  4JI0 J;  1NDP A;  2GQ2 A; 
#chains in the Genus database with same CATH homology
 4OYZ A;  1YBU A;  4OYI A;  4OYP A;  1CJK A;  4OYO A;  3MR7 A;  2WZ1 A;  5IV4 A;  1CJT A;  1TL7 A;  1CJV A;  4OZ2 A;  1CUL B;  1FX2 A;  1WC1 A;  2GVD B;  1FX4 A;  1CS4 A;  4OZ3 A;  4CLF A;  2BW7 A;  3ET6 A;  4CLL A;  4UST A;  4P2F A;  4CM2 A;  3R5G A;  1WC6 A;  5D0H A;  1CJK B;  1Y10 A;  4OYB A;  4USU A;  1Y11 A;  1CJT B;  1TL7 B;  1CJV B;  4CLK A;  1WC4 A;  1YK9 A;  3MAA A;  5D0E A;  1CJU A;  1CS4 B;  4P2X A;  3C16 A;  4WP9 A;  3ET6 B;  4CLP A;  4WPA A;  1U0H A;  3C15 A;  4USV A;  3C14 A;  5D0R A;  1YBT A;  1AZS A;  3MAA B;  4OYX A;  4USW A;  1AB8 A;  1CJU B;  1WC0 A;  3G82 A;  3C16 B;  2QV6 A;  1WC5 A;  4P2M A;  1U0H B;  2GVZ A;  3C15 B;  4CLT A;  3C14 B;  4CLU A;  3UVJ A;  1AZS B;  4NI2 A;  4OYW A;  3G82 B;  4WP8 A;  4OYA A;  4CLW A;  4CLZ A;  2GVZ B;  4OYM A;  5D0G A;  3UVJ B;  4CLS A;  4NI2 B;  1CUL A;  4CLY A;  5IV3 A;  5D15 A;  2GVD A;  2W01 A;  4CM0 A;  1WC3 A;  4WP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...