1AZSA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
190
Chain Sequence
DMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VC1
publication title Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Complex (lyase/hydrolase)
total genus 58
structure length 190
sequence length 190
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1azsA00
4OYWA 5IV3A 4OYPA 3MAAA 1AB8A 3MR7A 1TL7B 1Y10A 1CJKB 5D0EA 3C16A 4CLLA 3C15A 3C14B 4CLUA 1WC4A 2GVZB 4CLZA 4OZ3A 2GVDB 4OYAA 4USWA 5D0RA 3R5GA 1CJTB 5IV4A 2QV6A 1YBTA 5D0HA 1U0HA 1CULA 1WC0A 4OYMA 3C16B 4CLWA 1WC3A 4OYBA 4CLTA 5D15A 4P2MA 1AZSB 1CJUB 1CJVA 4NI2B 3UVJB 3G82A 3ET6A 5D0GA 1Y11A 4OYXA 1CULB 1WC5A 4WPAA 4WP8A 3MAAB 1TL7A 4CLPA 2BW7A 4CLKA 3C15B 1CS4A 1YK9A 3C14A 2GVZA 3G82B 4OZ2A 4P2XA 2WZ1A 4CM2A 1CJTA 1WC1A 4USTA 1WC6A 4CLFA 4CM0A 1U0HB 4CLSA 1FX4A 1FX2A 4USUA 4P2FA 4CLYA 1CJKA 4OYIA 4WP9A 2W01A 1CS4B 4OYOA 1AZSA 1CJUA 1CJVB 4NI2A 4USVA 3UVJA 1YBUA 2GVDA 3ET6B 4OYZA 4WP3A
chains in the Genus database with same CATH superfamily
5CZXA 2GCFA 2I6WA 3OBIA 4U7CA 3NCRA 3ZZZA 1HI0P 2V8VA 2YVSA 2V8PA 1EETB 2RDDA 4NRTA 3C46A 2BR0A 3CD5A 2H3EB 4NOHA 3AQOA 2X51A 2QYGA 1M0SA 3ZNJ1 4F8RA 2E5JA 3PFEA 1S1VA 1R8PA 4P2MA 2FY1A 2D9OA 3BQ0A 1J5EF 2JFKA 3Q2TC 3R5JB 4KT0C 5J2MA 1M5PC 1U1KA 2FIUA 3C14A 3IAS9 3C66A 4MIAA 4BWJA 5CA5A 2BV3A 1LFPA 1HBMB 2HGLA 2QMUB 3OVAA 3DHWC 2BJ9A 3KWMA 1Q82T 1M1KT 1FX2A 1SB6A 4FF2A 1ELOA 4ALZA 3CSKA 2LXUA 1TFYA 3CPWR 1F3FA 2VFSA 4DR6F 4DDFA 3HHDA 2XHWA 2FD2A 3RBDA 3CGIA 1TL4A 2DR9A 2R7OA 3QGGA 4CZCA 3GJRB 4WIQA 3P3DA 2CUYA 3SMZA 2WVBA 5AXNA 3VAGA 1F5BA 1MMDA 3R5GA 4ECTA 3TWZA 4J9MA 2QSWA 1NB2A 7FDRA 3TNVA 2W25A 3GE9A 4DV1J 1SCJB 1WC3A 1JNRB 1CJUB 4DUZF 4C8NA 4C8OA 1T3NA 3B4DA 2F65A 3LWLA 1HYSA 3VVUA 1OJ4A 4ED1A 1NHVA 2J0SD 3HP6A 5LJ3Y 1OY9A 3TANA 3RRGA 5DZ7A 1IKWA 3GILA 2VG7B 3R5BA 2DRAA 3N4WA 1U1NA 2OD4A 1RAIB 5I42B 2JWNA 2DK2A 4DEZA 5GAEU 3LW5C 2Q3PA 1EJ7L 3UVJA 3SQGB 4B3SJ 2KG0A 2HWTA 3EICA 5D3GB 1U1LA 3H5YA 1D8ZA 4TQSA 2HQIA 1RT6A 5KG7A 4K59A 2RQMA 1YJ9S 1NSPA 4QBUA 5AE2A 3J7YU 2YQ0A 3DLEA 4CLUA 4JI0F 1VLOA 4ECYA 1TKDA 2EW9A 3QYYA 4IG3B 4J9LA 3J7ZT 5KT7A 5H9FK 2AF6A 2NCKL 3UWTA 2YX7A 5GMKa 2VBZA 1G2EA 4B9LA 2EC0A 4KHRA 1NU4A 4YOEA 3NGUA 1BQNB 5KG4A 2OEJA 1JIHA 4KH0B 4ZKAA 2JEGA 1EETA 2V8GA 3EZ5A 1T11A 1DHMA 1R8AA 4J9OA 1S9EB 3NY0A 4H54A 1NNDA 4U95A 1KKHA 1NJXA 2DH9A 3L09A 3W2VA 2IVYA 1WKKA 4JV5J 1NPPA 2WBMA 3MEEA 3POTB 2N4CA 4TQRA 2V2VA 3CNQP 4G65A 1EZZB 1VFJA 2AZ1A 4P10A 4FN5A 2CPDA 4UZBA 1GH8A 2BOAA 2OPSB 2O66A 2QMWA 4I2QB 1WNEA 2F8MA 2DNZA 2BM0A 1TZ0A 3K8WA 3J7AN 3W64A 2DIVA 4ID8A 4IRCA 4CTAB 2R7SA 1K73T 3EXYA 1HBMA 2X7IA 4TLQA 4ZVRB 3PR5B 1VRQC 3TA1A 3ZZUA 2ZNZA 3GPAA 4UF4A 5CYQB 1PBAA 1SPBP 3KTQA 1RISA 3HT0A 1PC4A 1N5TA 2V4QA 3MTKA 1ZA1B 4AL7A 4YMEA 1DQAA 3KOAA 1FVQA 3CTRA 4DG1B 5J2PB 1JJCB 5KFFA 5L38A 4UZCA 3OFGA 3X1LB 4CM0A 1RKIA 4K5RA 1RA6A 3PACA 1RWOB 4BC9A 1CJUA 1F2GA 1FJCA 4DL7A 4JBCA 1NKCA 1RZMA 4BS2A 2KO1A 4RBTA 5DLFA 2B9WA 4YR2A 2C22A 1H73A 4NA2A 1XNRJ 3A3NB 3NL0A 4NYPA 4WCEQ 2EFGA 2B9XA 2OLWA 1NSKL 3KKFA 3LWMA 3MEGB 4UOGA 4N8NA 1GXTA 2OD6A 2ZH8A 1F60B 2CJBA 4A8WA 3T1YF 2VBWA 2NZ4A 2NUHA 3GG0A 2EFQA 4TNOA 1RHJB 3QT8A 1G1XA 3E8OA 3J81Y 2UU9J 4XTTA 4E2FB 1A7GE 3W60A 2R8JA 1A0OB 2L08A 2XY6A 1FDAA 1RACB 1ICEB 3CCLS 5A8KB 1EP4B 3LH2S 3RB4A 1TL7B 2V69A 4DV3F 3HO1A 4URGA 2GAGC 3M7VA 2JZ5A 2RHQB 3CDUA 4ZP6A 3CO9A 3IM8A 2IAJB 5EDWA 4PG7A 3W7BA 2YX1A 4OLPA 1S9EA 2DO4A 2C1EB 2DBBA 2VG6B 4G1QB 3IR6B 4E0DA 1UPPA 4ZITA 4Z2XA 4FS2A 5AXKA 3GONA 4DU8A 3PX6A 5ETNA 1VBZA 4OV6A 2AIRB 2QA4S 1X60A 1Q78A 2X3DA 3Q8SB 3BBBA 2AYEA 4LIRA 1RWXB 4DXLA 2M52A 4A8FA 2RJZA 5HANA 4I2QA 4FNHA 1HI8A 2OSRA 3RZAA 3TA0A 3PW0A 5SUHA 4CTAA 1WTBA 5IT0A 2BKOA 1OWXA 2KRRA 3JSRA 3H4BA 1NJIT 2YWKA 3DOMB 1FXLA 2DYAA 3B54A 5CYQA 2W2PP 2YNFB 3CJQA 2UXBJ 3NKYA 1SJ4P 2J9DA 2HKEA 2ZH6A 2DNQA 2VA3A 2UUCF 2EG2A 1GMVA 4ZVEA 2PEBA 4OJHA 2RKIB 1CJKB 1ZZNA 1YHQS 4DG1A 3K5PA 5J2PA 1J5OB 4RUCA 3OR1A 2GO8A 2X3GA 4USIA 4ZCLA 1R8HA 2X1AA 3TAMB 1B70B 3WHIA 2XSJB 3QSIA 4DR2F 3L3CA 1AFJA 3OJUA 5CAAA 1Y4ZB 4O4GA 2D9PA 3P5TL 2ZDOA 1VQSA 1OY8A 4JI6J 2Y0BB 3G8SA 3CC7S 4ZVUB 2FHJD 4RNNA 1QM9A 2XM3A 2DEJA 3U27A 1TV6A 1FRHA 2DGXA 1SQFA 2RH3A 3MMAB 3IWNC 2H5EA 5L1LA 2BYCA 2HBZB 4EBEA 2FY8A 2ZWOA 2W01A 3DOLA 4LRBA 4GKKF 4NEZA 3MEGA 4YN3B 1VCTA 1LWCB 2E5LF 4USKA 1R3NA 1UETA 3HHLD 4C48A 1P9YA 2CA9A 4OJGA 4IFYA 2MSSA 3KFWX 4N76A 2AU0A 3SQOP 1K0VA 1N6QB 5HSPA 4DQSA 3CIZA 5FLXY 2K2PA 4DV4J 4QYZK 3EZOA 1M1GA 3SCLE 4URQU 2FJXA 4LF7J 1IR1A 4OYXA 5A8KA 2D3OR 4KFBB 1TL7A 2MHNA 3EZUA 3PW2A 4OI3A 4LFCJ 2DGSA 2IAJA 1MNEA 4DMZA 1TK0A 4OX6A 1SBRA 1N32F 2ZKTA 4DPYA 3V6JA 1M5SA 3H0PA 3D5MA 1BC6A 4G1QA 1X4HA 3H98A 4ED8A 1DARA 2KT2A 1MROB 1LK7A 3P96A 3QJJA 4ZN3A 3T5LA 3NMAA 4RNOA 4AXJA 3J7Z5 5J1EA 5L8RC 4ZVQB 1GK8A 3QT7A 4IQMA 3LP0B 1AB8A 4ECZA 1FWLA 4PUOB 2VOOA 3LOUA 3HM9A 1F0XA 3KK1B 4ZLLA 2ZJRQ 3HLUA 4DV0J 3PY8A 3H4DA 3M32A 2BQ3A 2YNHB 1AROP 3NWRA 3DOMA 1XK8A 3ZZ0A 4PKDB 2Z30B 4ANCA 4ELTA 2RQ4A 1S9GB 1RAFB 1B0PA 3MPYA 2YNFA 1X4FA 1Y9OA 1PJ6A 3DLJA 2HQDA 2HVEA 4UOCA 3MCSA 3GIKA 3NS7B 4F4KA 4AT1B 2RKIA 1J5OA 1TP7A 4HKQA 3QMQA 5KFNA 3MDFA 2I5JA 3FSXA 2W2NP 3OXFA 4LR9A 1CQMA 4N7TA 1TQLA 1HI1A 2VBXA 1Q4RA 2V5HG 2XSJA 1Y3JA 2OUGA 3ET6B 5KFLA 5HL7Q 2PA3A 4RPFA 2F4VF 3R1LA 3HHNB 4NPOA 4KHPF 2FHOB 3DLKB 1O6XA 3KHHA 3T5HA 4O4RA 1T03B 4DSIA 3OUYB 3DN9A 3L7PA 3WBZA 1YBTA 2YH1A 1L3KA 3MMAA 5KOWA 4ZPWR 3D6HB 3QGHA 5B0EA 2DGVA 3C16B 4IOCQ 1S1WB 3C8YA 1C2PA 3AHPA 2GAHC 4RBVA 4OI2A 3A3PB 1FK9A 1FERA 1YZ6A 2ERRA 1LWXA 2GIFA 4WPAA 4AL5A 2BANB 2NZCA 4KH1B 1VDHA 3O6QA 1W2BR 3I5BA 5D77A 1N6QA 4P75A 2PFDA 3SXLA 1QVFR 3FFIB 4J91A 3S7RA 2ZITA 3TX0A 3DOKB 4IFVB 3CJRA 4F50A 2DHSA 3HFVA 1Q7YT 2E1CA 1ZS6A 3DMJA 2RNEA 1YRUA 3QLHB 4JB8B 5IC6B 2DXDA 3ADAC 1NO8A 5LL6d 4KFBA 2M8HA 5KT4A 1WOOA 2R7VA 3PVXA 5K8MA 3VV2B 3MPDA 4FYDA 2DY9A 4U9RA 2QLFB 1QAJA 2UP1A 4L3KA 4X4QA 3NLCA 1X7VA 3ILIA 2GJIA 4CCHA 1EB0A 1YI2S 1U24A 4I0WA 3GP9A 1U49A 1MROA 3F41A 1UA1A 1RAEB 4LRAA 5IM0A 1JJ4A 2U1AA 2JC0A 3FGVA 1KC8T 5DG9A 3LP0A 4KQZA 3R8YA 3GFZA 3CXCR 5E41A 4P74A 1YVFA 2AHOB 4GVBA 4DUTA 3KK1A 4X84A 3GU0A 1UVKA 1ZAWA 4LBPA 2FB0A 2YNHA 2VFRA 2HBRB 2CZ4A 1WHVA 3X3UA 1KP6A 2VQFJ 4ZLPA 3BEGB 2ZJQQ 2GJFA 1S9GA 4DZDA 2ZFHA 1YBUA 1OQ3A 4OLOA 3ILOA 4NLPA 5IS2A 4WKYA 2IRXA 4DV2F 4LFBF 1AFIA 3THTA 4PAAA 1EARA 3HD1A 1Y00A 2IIHA 4ZVSB 2E7WA 4QR0A 1RBOB 2LU2A 2DRBA 5KFTA 3US5A 4TY8B 1F5AA 3BQ2A 1VS3A 1T9XA 3T3FA 1ITPA 2HGNA 1VGYA 4C0OC 2QFJA 4H4KA 2RVJA 3HZGA 1NEEA 3ET6A 1K8AT 3O44A 2KDOA 3M8ZA 1F9HA 4DR4F 4KY3A 3G71S 1VC5A 3PDNA 2UXBF 3IFEA 4W98A 2P8IA 4CRJA 2BDPA 4A4JA 5F9NA 3DLKA 2BQRA 2I0XA 2F3JA 1FESA 1T03A 1RADB 3BGFA 3M6UA 3O3LA 3FQKA 2UV8G 1U25A 4O3RA 5K14A 3D6TB 2VDHA 5U47A 3MUVP 2UXCJ 1Q7LB 4DLGA 1G6BA 1RUSA 4WTOB 2MGZB 3A4TA 1XNQF 1UVNA 2VJVA 1RTZA 1S0MA 2BANA 4ILLA 4UQTA 1D0EA 5J1PA 1HBOB 3DRRB 3R1HA 2VU5A 5KT3A 1CG2A 1RT5B 4NXMJ 2YNIB 2DB1A 3QZ7A 3FFIA 1AYEA 1RTIA 1CULA 2BX6A 4MKBA 4PXBA 4P72A 1XEZA 4G1PA 3HPOA 5E2QA 2F40A 1GXLA 3QLHA 2HIYA 1T8EA 4OL8A 4JOUA 3B6BA 4RUHA 1UVIA 5HQLA 3D67A 1AUDA 1NSQA 2CPFA 2RUGA 3IGNA 1RTJA 2DJWA 4LRFA 3T41A 3JSMB 3GQCA 1VISA 2DHAA 5F8IA 1WC1A 2LEPA 2GNKA 5HK4A 2CNLB 4EBCA 2QN6B 3RTVA 1KOHA 1V3RA 1Q95G 4DFJA 5B08A 3ISND 3QIPB 2IFXA 4GVLA 3G2XA 2AGQA 3IAM9 1RWMB 4DV4F 3MCOA 2QRRA 1M5VC 2XS2A 3QGPA 2J6UA 2BW2A 3HD2A 2MJNA 1Q8IA 4Z7CA 3QGIA 4A8SA 1JMTA 3HHLC 1MMLA 2RF2B 4YP3A 2C2DA 5CZVA 3DDIA 3FZ2A 1ZAXA 1S7HA 1SI9A 2VQEJ 5CYJA 4Y28C 5LOQA 3CDBA 4R5PA 3R6LB 1YKWA 5E5NA 4DL3A 2IC3B 2C3UA 2EWHA 2MZJA 2UUBF 2HS3A 2G1HA 4IG0A 1SKWA 3CD7A 5FDLB 2R9LA 3K57A 2XGQA 5DDOC 4DCPB 4R25A 1IWGA 3MFIA 1ZPVA 5F8JA 3M30B 4J9RA 1NK9A 4IKAA 4EYIB 3AJ2A 1N5SA 3VF0B 1FKAF 3T9NA 1JK9B 4EZ9A 4CM2A 5GAGU 1PBUA 3RBXA 2FZGB 2XYGB 3T9ZA 2KU7A 5A6PA 1PGZA 1S4FA 4YB6A 5LMUJ 4LF5J 4RW6B 1KRPA 2G0JA 3ZTSA 2BRKA 3UDVA 3W63A 2ZVSA 1RBAA 2OIHA 2MLXA 5IWAJ 1JXEA 4QWBA 3V4MA 2DH8A 2GIRA 4TY9A 4QIGA 1S0OA 2MDAA 4FNIA 1IR0A 3RR7A 1IQZA 5C24A 3PYDA 2ASDA 1F3VA 3JAMU 4QOTA 1S99A 2KVIA 4JYAJ 2NYIA 1XMQJ 2W2QP 4WWSA 1U48A 2IMOA 2DEIA 2RU3A 4NYZA 4Y34A 3D1QA 2CJKA 2YX4A 2H65B 2MSTA 1H74A 4K4VA 3DU5A 4WFYA 1OY6A 3QZ8A 5DJBA 4ILRA 1HBOA 3DRRA 4W90B 2Q43A 1RT5A 1UVLA 2CQIA 1VQLS 2KRBA 5LM7E 3NG8A 2H51B 1WG1A 4ES1A 1D8YA 5D8HB 2MTLA 5KFYA 5AJ3J 2VIHA 1OQ6A 4WP3A 1HFEL 1W7WA 1JLFB 2QYCA 2I2YA 4DFPA 3QT6A 2DNNA 2OSQA 1JLQB 4HT5A 1EKSA 3BN4A 3JSMA 2GVDB 2GO9A 2E1MC 2UUTA 3PHTA 2HRYA 4NZ6A 5DM7Q 4DPWA 5DDRC 1FA0A 4DS5A 2XZTB 1Y7PA 1X8DA 1D9AA 5E3QA 5D4PA 4HH0A 2HWIA 4TU7A 3I4HX 4ECQA 2BQUA 1KN6A 2BBEA 2Z2YB 1WELA 4JI3J 2MKCA 3AFGA 4QPXA 2E1PA 3FCVA 3M1VA 3GR1A 1WG4A 4ETXA 3GIMA 2CJXB 2D74B 2G9OA 3CW2C 1IJEB 1UMJA 3ZTPA 2E9ZA 2RF2A 4DX8H 3OL6A 2GQQA 1S97A 5HJXA 4WE1B 2DIUA 1RWUA 2CQGA 3AY0A 3SCJE 2B4OA 2XGPA 2IC3A 4WF9Q 1FE0A 7FD1A 2IMWP 2W2MP 2XWYA 3TW0A 4NLWA 3DI6B 1GXUA 2E7VA 3OR2B 1SJFA 3I0SB 2FHKA 2V2QA 1WI6A 2J76E 3ZNUA 4QU7A 2QFIA 3M30A 5EWEA 3D66A 4ES2A 4OYAA 2HZCA 3UN3A 2QMXA 2MQPA 3MAHA 4WBFA 2DHGA 4XIUA 1TELA 5EWFA 4M95A 2P9EA 4QJVA 1YZ7A 2VQFF 4NXNJ 3BSCA 3RW7A 2EFVA 4YB5A 1N34J 3C2PA 4ZCIA 3DRSB 2DRDA 4DSJA 1SH2A 4NZ0A 2J8AA 4ANDA 1YJVA 5ETLA 1EKRA 1U1QA 3HXMA 2NXJA 1TAQA 4L75A 4ID5A 4R0JA 2G13A 2IM2A 5THWA 5KFZA 1FDDA 4ED2A 3OV7A 2WVCA 2O5DA 4LF4F 1ZOTA 4BHQA 2VC0A 3KUEA 4AQYF 3JAMY 2PD1A 2W8LA 4ZPCA 5DQGA 4DR7F 5A8WA 3CCZA 5LSRA 8ATCB 4P52A 1LW0B 3RBZA 2HVZA 1HIYA 2V68A 4UT4A 2GHVC 3H2VE 1NM2A 1WSVA 1BUXA 5DM6Q 4A8MP 3VR1A 3JSYA 1QSYA 4YS2A 4ITSA 2EXUA 4RZRA 1LXNA 4GRSA 3A12A 3M2RA 1RGVA 1HNZF 1JLFA 2XLKA 4C2MA 2DY1A 2CNOB 2K8GA 3EPIA 2RRNA 2KTQA 1U1OA 2MQOA 2BACA 1UVMA 3RAXA 2ZZNA 3IS9A 1OSDA 2Y3YA 4Q5VA 4P2FA 4K8RA 4WFNQ 4M5MA 3PIPQ 1VK3A 2HZVA 1Q8BA 2JC1A 3M6WA 5F41A 5T41A 1X4BA 2OMOA 4U7UK 1NK5A 5K8NA 2HG4A 3KK2B 4DSLA 5IOLA 2LVWA 1UVJA 2CKWA 2QL7B 3FMWA 1U6FA 4ZHRB 4JI5J 5KG5A 1VC0A 3BM7A 5B09A 5GADI 3UD3P 3UR3C 4O44B 4PWUA 4LBHA 4WE1A 4M8LA 3ENVA 4ECRA 3FC9A 2OTLS 5E3RA 4EK2A 3CCSS 4NLXA 3QATA 2R7UA 2COLA 4RR5A 3OPKA 2RS8A 3DI6A 2MKSA 3ETOA 5HVGA 5D6GA 2FGCA 4CLPA 5KFKA 2XTJP 2NR0A 2EG1A 2H54B 1YITS 3ILLA 5F3ZA 3PRVA 3R97A 1TKTB 2FC9A 3DLLQ 1WWHA 3BKUA 3IWXA 4PQAA 5DDPC 1DTQB 4LF1A 4ES3A 1S0VA 3HVAA 2MYFA 2XULA 3M9OB 4Q7AA 3TI0A 3ISNC 3TVKA 3P45B 1ZM2A 4HTJA 3DRSA 3G8TA 3R9LA 1X9SA 2YPZA 4EYHB 4Q0BB 1FHTA 2BJEA 1I51B 4DBQA 4Q2LA 2RDIA 1R27B 2AYBA 3H5XA 3PRBA 1NSAA 1TFWA 3KJQB 3CJSA 4LF5F 2LDYA 2JH3A 5HROB 1K0TA 2XHCA 3OTEA 4UW2A 1XR5A 5KFRA 3MECB 1R6VA 4ED3A 5IWAF 5A8RB 1LW0A 1CEZA 5HN0A 2AT1B 3LAMA 3JS9A 1U02A 3NS6A 4CLFA 3V5RA 4QW9A 2F8HA 5BR8J 4RW7B 3H59A 4J9NA 5CH7B 2BE9B 2UV8A 2EFPA 4LSZB 2UXDJ 1RAHB 5KFSA 1NHKL 2AQ4A 3GJSB 1VLYA 3R7SB 3ZO7A 2QEXS 2XMKA 2NSCA 2HFUA 4OYPA 1VQ8S 3QWPA 3Q8UA 2ZBRA 1JKHB 4M5HA 5HBMA 4P2SA 3PW4A 4OZ3A 4DF8A 3R2CJ 1H0HB 4JI7J 5IXUA 1N33J 2DNRA 3BDPA 5KFUA 4GO5X 3FSYA 1FD8A 1QE1B 4L3NA 4FXWA 1NDPA 2DNKA 3M9NB 3MCMA 4RWWA 4FZVA 4QCLA 4HLBA 1WHYA 2GGPA 4Y2MA 1WC5A 3KK2A 2W9BA 4LIWA 2UVVA 2C2KB 1ZM3A 4QWAA 4K0KJ 4ZHRA 3EGVA 1EHWA 1JB0C 3UCZP 1NXIA 5FIIA 1R0CB 2DHHA 5KT6A 3EVMA 4USMA 3R6GB 1V9OA 1FKPB 4LVOP 2KJVA 2FYXA 4DX7A 4TLRA 4WZQA 2CWXA 4GKJF 5H9FJ 3GMGA 2ZE2B 2XI3A 2E44A 1HWLA 2QL9B 1N54B 3JYTA 2DGQA 3BO4A 2BZ2A 3TRGA 5F3TA 2YY3A 3CO0P 2GHWA 2H9ZA 1KVKA 2KB2A 1TKTA 4C6AA 3E2EA 2HNYB 1REVA 2QV6A 3LUYA 2W9AA 1HPZA 4B9NA 1FFWB 1SJQA 1DTQA 3D0HE 3DM2B 2KXFA 4OQJA 4I69A 1IKXB 5C2GA 1BHNA 1C4CA 4X62F 2G1DA 2XMVA 4B9SA 1GMUA 3V6KA 1I1GA 2R2RA 3T19A 3KXDA 2IPOB 5M2PA 4O3SA 3D3CJ 3WIVA 5B0CA 1UFWA 5E7OB 2POKA 3SDEB 2AEJA 4B9VA 4MMOA 3SSSA 1SC6A 1Z2ZA 5G0RA 3OHBA 3CCES 3UNGC 4NCBA 4C4WA 3OXGA 3PW7A 2ZHBA 4H4MA 2G0CA 3IP0A 3H2LA 1NJWA 4DR6J 3MECA 2RMLA 1HNWF 5A8RA 2Z8QA 1Q1KA 3HULA 1YTYA 4GC7A 4ECXA 2VKRA 2J6TA 3I96A 5GAEI 2Z2MA 3W3SA 1F2HA 5CD4H 2Q79A 2WVFA 2IVFB 3EVWA 4RW7A 4F0HA 4LF9F 1P8GA 2MEWA 3MM7A 3KG0A 2QZ8A 2HYIB 3I9V9 2V2ZA 5KFWA 1S48A 4CO5A 2Q6CA 1NDCA 2QJ3A 2OH2A 1CSJA 1QLNA 3OXLA 3ENWA 3VWSA 3HK2A 2Z2LA 3OVBA 1JKHA 4OI1A 5E3CA 3PR4A 2E5GA 3BR8A 4BCAA 4WU3A 4CT9A 4ED0A 3M8PA 1DRZA 2CDRB 2WB4A 3MMCB 2ZD1B 3T1AA 5A2QY 4OYZA 3W66A 3GYNA 3LANA 5HMXA 3S8SA 2WVDA 3A1YG 5C25B 4F4AA 1W2IA 1P6TA 1RT4A 1T02A 2KT5A 3R2DJ 2R2TA 3PJXA 4UY8T 4JI0J 5L9NA 3PTWA 3QAEA 2LA4A 4FDFA 3M6XA 2YXLA 1T0TV 4PPDA 4Y2CA 4HACB 4CLWA 3QWUA 1SV5B 3D54A 1FKPA 2FZCB 2B5JB 1ZBTA 4YB1P 1XQIA 2CRLA 5AT1B 2CXEA 4DL6A 2LQJA 2ZE2A 3IBFB 3N6MA 3PYEA 3F0NA 4DR1F 1YDLA 2YKNB 3CJ8A 1RB0A 2JDJA 4OZ2A 1RLCL 1GX6A 2W8KA 4DV5J 3PX0A 2BE7D 2VICA 2RQCA 2HNYA 3M8SA 4IH6A 3FEYB 4I7FB 4YHHF 2MJUA 2V6AA 1BE4A 3DM2A 3GLJA 1RAGB 3OFHA 1IBCB 1IKXA 5HO4A 3ISZA 2UVWA 4KGZB 3M9MB 2CG4A 3DXSX 1TK8A 2BKPA 4K4ZA 3D6FB 1IVZA 3MEKA 4DSKA 4KHMA 1WC4A 2DR7A 3V4IB 2JNJA 3Q2SC 2NPIA 4CQ1A 3SDEA 2GHPA 1PILA 3OHAA 4Q43A 3CUNA 4IDKA 3A13A 2DHXA 3VQTA 4MJKA 1TKZB 3FSIA 1I94F 2ZBCA 3I56S 1ACMB 4YB7A 3P8BB 3R7NB 5HVFA 2X1BA 3VALA 4X66J 5AE1A 3GCWP 4M1KA 1S1VB 2BA9A 5G4DA 2ASYA 3ZZPA 1UPMB 2J9EA 6FD1A 2R7XA 4IR1A 1RYRA 2W2OP 3FJ2A 5KFBA 3CF5Q 3CD0A 2HHSA 4YFUA 5J2MB 5F8NA 3V6DA 2CPJA 4PABA 1DJ0A 3VTIA 2XMTA 2KM8C 4AE5A 3ZZRA 2ZH1A 1SL0A 1GMWD 3IA0A 1IWAA 3SV4A 2NXCA 3VZHA 2HS0A 2MQQA 3QPIA 3UN2A 4LQ3A 5EX0A 1M5HA 4NWBA 4WJBA 2J7UA 1CJTB 3PO4A 1YJWS 3JSBA 2IDLA 2R8KA 3ULHA 1IUJA 3EDRB 5KFXA 4LRCA 2HHUA 4RO0A 1VQ7S 2YWFA 3W8PA 4C3KA 3MMCA 3QRQA 1MWQA 2ZD1A 2DCLA 5BR8F 1WEYA 1V5VA 1VMBA 5KFCA 2NREA 3EPGA 2WSFC 1YGYA 2M5YA 5C25A 4I1TA 4O3NA 2V9KA 5KG6A 1S6OA 4B3TF 4DS4A 4O0IA 1JNZB 3RAQA 4BBYA 3HJVA 5EX3A 3T6JA 1XMOF 3MM5B 3G4SS 2ZOMA 3AT1B 4LSLB 2L48A 4HACA 3J80Y 1SV5A 4JI7F 2PI5A 2B5JA 1LEOA 1IKWB 2A2CA 4CDIA 2GS8A 2GQCA 4QYZJ 1QUVA 1RAOA 3MR7A 3OL7A 1MMNA 3LP2B 4PPZA 2YKNA 2HURA 4DV3J 2CJAA 2G2OA 2O3DA 2MZSA 3H20A 1SC4B 3TYTA 4K0KF 4I7FA 4F25A 2A3JA 3MM8B 4O0NA 1NDKA 4GC6A 2CPEA 1YWXA 3CC4S 3MWBA 2F8EX 2JSXA 2PC6A 3G82A 1Y5LB 3MTJA 3SIPB 4HYKA 2C2EA 2PMHA 3BZQA 1UZDA 3E3XA 1JJHA 4E8UA 1H72C 2FQQB 2Y9HA 1P1TA 3ZXWA 4NLOA 3V4IA 4PG4A 1IJFB 2RHSB 2IM3A 2RSQA 1X0PA 2UVUA 3HSJA 1B4SA 2R4FA 3A8KA 4ED4A 2ZVIA 3DKDA 2B4VA 4RW8A 4RU2A 1BGXT 1TKZA 1KS2A 2GZOA 2F4FA 2VODA 3MR3A 2GA7A 2A18A 3WIUA 1IQTA 2HGMA 1RT2A 3VAHA 3PFOA 1U45A 5CXTA 5C42B 5F0UA 3W2VB 4B3MJ 2LEAA 2RILA 2RB7A 1W25A 5HMYA 2UUCJ 1Q8LA 3MEEB 4KSEB 1XR7A 2JEJA 2IM1A 3K5NA 3M8QA 3MMJA 3TVYA 4KGMA 3WX8A 5B0AA 1UFKA 2KYXA 4QWEA 2IY5B 3BSNA 3EXCX 2V8HA 1RHUB 2VHGA 3K7RA 5DG8A 3S01A 2D3UA 3NGRA 4AFFA 1Q16B 1FNXH 1IN0A 4H4OB 2FJWA 2RDJA 4DR2J 1S6QA 1AUSL 2CQ3A 2M7SA 3FKBA 4FYXB 1URNA 1NDLA 3EWGA 2IJFA 3PJ9A 3Q23A 4RX6A 3D6MB 1CJTA 1CPZA 2J9DE 1QSLA 1N5YA 1DURA 1IBMF 4KGXB 4K2XA 3RB0A 2CZ9A 4WP9A 4EBDA 2CQHA 3JTPA 1R8CA 2VONA 3D1HA 4JI1F 4GO7X 4GKKJ 4X4TA 3K0JA 2MB0B 5C7PA 4ZVGA 3NAIA 3SFGA 2E5LJ 3BGUA 2H1YA 2B7BB 2VPWB 4CLLA 3KHLA 3QFWA 2EKNA 4DQIA 2IRYA 1QY7A 2Z4PA 4TVAB 3MM5A 3TOQA 4C8LA 4LSLA 5D0HA 1Z1ZA 2ABYA 2H4YB 2Q1LA 3D2WA 4K7QA 1B3TA 5DETA 1H2VZ 3C19A 2CPHA 5F8HA 5GAHU 2E9TA 3BBFA 3K2YA 4J9QA 2EEYA 2OELA 4WYWA 3LP2A 4OX9F 4AUKA 4NLGA 1KD1T 5HP1B 3CB4A 1RE1B 2VFTA 1IBKF 4OJ3A 4QIVA 2L41A 2A0FB 1S6PB 1LQ9A 3MM8A 3RW6A 2EPIA 5D4NA 1N32J 1DLOA 4QU6A 4LMZA 4UY85 1JLAB 1U1RA 4CP5A 4CH7A 2HNDA 1H7XA 2XYPB 4JI2J 3NRBA 2H5IB 3J7A1 2QC3A 3PYGA 4I6AA 5KFVA 5J2QB 1LNQA 2W7OA 1TL1A 4FXDA 2ZHOA 4FYYB 5T14A 3QBCA 1RA7A 4R8UB 1GTHA 2DNYA 1RU2A 4K4YA 4X4RA 2HAIA 1FNMA 2GMHA 5AXMA 1J27A 2HRUA 4DV5F 5L1IA 2IM0A 2ZWPA 5ITHA 2A10A 1UWAA 2FJAB 4LT6A 4NYOA 1UWBB 5LSOA 1S6UA 1U6ZA 1VHFA 2ZH2A 3Q86A 5F8GA 4ELVA 5F9LA 5C42A 4WK3A 3QFHA 5A76A 2VF3A 3TX8A 2LLZA 4CLKA 2GW8A 1CVJA 4MH8A 3QRRA 2QLBB 3W61A 2E5IA 4P2XA 2BJDA 2WB1D 4YY3F 3UO0A 1FO1A 2N82B 3W2WA 3UW1A 2VUGA 4CLYA 2OI2A 3ITHA 1FFGB 3UCGA 1HMVB 2J6SA 4NEYA 3NS5A 4H4OA 4GMKA 4J9KA 2NXEA 1VC6A 1RAJA 2CPZA 2XMJA 3GJTB 4MTPA 2F4VJ 1HNVB 3QIDA 1HD1A 2M88A 1XMBA 5DGAA 4KO0B 3WQPA 2FUG9 4J9UE 4DL4A 4KHPJ 3D4JA 1YX2A 2AJ1A 1YJ7A 4X66F 2RE1A 2K7KA 1LK5A 1SUQB 1KNZA 1Y5NB 2AWZA 4PYDA 4ZJQA 2I1RA 2LMIA 5CYMA 3GIIA 3OR1B 1S10A 5HI7A 2XBPA 1RTDB 2VJUA 3IG1B 3MAAB 1NLKL 2J0WA 4PR6A 3PEJA 1U2FA 5HQ8A 1CS4A 3MM9A 4F0KA 2V67A 3KLFB 1FI4A 3MZIA 1VK8A 1NKBA 2R8HA 5HQMA 2IBKA 1D9FA 1P27B 4O4GB 2ZC4A 3WZ0A 1SVDA 2RD5C 5EN1A 2JVRA 1RT7B 4LFAF 2HVDA 2LKZA 2CQ4A 2FLOA 2J7KA 4M5NA 2BRLA 4U96A 4TU9A 1TV6B 1KSPA 4F7VA 2CNKB 4NA3A 2LXFA 3BPSP 3IBWA 3FBBA 4WYLA 4LVNP 5JMNA 4B02A 1KTQA 3OTCA 3DOLB 4EO8A 1VBKA 4AXIA 4LF8J 3PKMA 5HP1A 3I31A 2MQMA 5JUMA 3CCMS 3KLEB 2HEKA 1G3OA 1S6PA 4IFYB 2XG8A 2MZQA 2HHQA 1N52B 4OYBA 1JLAA 1TAUA 1AZSB 3M8WA 2ZOFA 4YDXA 4IYQA 1KHWA 5D78A 1Y0HA 5J2QA 3DRPB 2DNGA 2HSEB 1HR0F 3FK4A 4R8UA 2FVCA 3MOJB 1V3SA 2VFVA 1KBRA 4OI0A 1KQKA 2NXNA 2XZWA 4YDDB 2ALZA 2GFFA 5E0OA 3WDOA 2VASA 3J81j 2IA0A 2W1BA 4U67Q 3KHGA 2MKIA 1UWBA 3SSRA 2Y1LB 2IVMA 3GFYA 2UUWA 4F3MA 2W7AA 1N8RT 4W4MA 3U1NA 3QQCD 3HHLB 1IKYA 3KNGA 4DV2J 3IR5B 2W24A 4LFBJ 5J1EB 3HT3A 4P6QA 4X4VA 4G6VB 3D68A 1M90T 4KKOA 3W9IA 4KTQA 2BJ1A 1NAQA 2B9YA 1WC0A 3D28A 4WFAQ 1SKSA 5B0GA 1I6JA 1HMVA 2CQBA 3AODA 3NGSA 4HI1A 3KUGA 2YKQA 2FVRA 5RUBA 3M32B 3DFEA 2HVHA 1OS5A 2KG1A 1SIZA 4CO4A 1S77D 5DS7A 3U1MA 1HNVA 4DR4J 3CCJS 3KG1A 4KO0A 1YK9A 2B9EA 4PRFA 4J90A 4N77A 2XO6A 5J2NB 1T9WA 5KFAA 3PM9A 4B3MF 4M5KA 2O01C 3HMJG 1B99A 2EI5A 1SUQA 4B3OA 1OYDA 4NMXA 3MI7X 1X5OA 4HT7A 1L3TA 3VAIA 2A6MA 2YKAA 4XPCA 1DAXA 1RTDA 3VVTA 3M8RA 2I5JB 4KGVB 3IG1A 4A8YA 3H5UA 3MAAA 3VZIA 2ZH7A 2C2OB 2GV1A 1XNQJ 4NX9A 3BB5A 1QUPA 1B64A 4W92B 3EGWB 3FBCA 3KLFA 1X9WA 1GNKA 3FBEA 2DH7A 2CJ9A 1RQ0A 4C0BA 3CC2S 3TJ8A 1OO0B 2BABA 1RT7A 4TKTA 3UN5A 2D3O1 3HJFA 1X0FA 3AB4B 5L39A 5EWGA 4CNYA 5BYSA 1A9NB 2Z0GA 3RR8A 1SC3B 2VC1A 4FBTA 4R0EA 1J2VA 1XN9A 2R7RA 4K4XA 2DXFA 1M5OC 4JV0A 4ED6A 1FWKA 1DQ9A 1FK9B 4ZS6A 4P73A 4XAKA 3I4PA 3KLEA 5KG3A 4FKXA 2LXIA 4FF1A 2HFNA 3O5TB 4RUBA 4ZIWA 2M4MA 4QIWD 2Y8YA 1AZSA 4V19X 2DGUA 1EIYB 1HHTP 4V19J 3O1LA 1ZM9A 5GAGI 2AJ2A 4KPYA 4AYBD 3O2IA 5EGYA 1O8BA 3DRPA 3KK3B 2JEFA 1T9UA 3CIMA 1OSCA 3DMJB 1LWFA 2F5GA 1ZH5A 2M0GB 1XIQA 2FHJA 3K89A 4C3LA 3ZZOA 2J8SA 4PYAA 3IRXB 4YUDA 1U1MA 4O3PA 4DQPA 2VDIA 2Y1IA 2HPUA 2R7WA 4KE5A 4XDCA 2OPRB 1HKAA 3I32A 2L9WA 2D69A 1JJ2R 2VKZG 2BKNA 4Y2KA 2UUBJ 4ZLNA 2HBYB 4PWWA 1RKJA 2K3KA 2F1FA 1B0VA 2IYGA 4JI2F 2MZ1A 2CQCA 3HHLA 2NXUA 1VJWA 5KFOA 4ZVOB 2ZJPQ 5IM0B 3MR2A 1YG0A 2KI2A 1ULRA 3OFFA 3M2UB 4DR3F 1KLNA 4XK8C 5CABA 4DN9A 1FWPA 3SEOA 2VL1A 4MYTA 2ZBPA 4GVBB 1QTMA 1IKVA 3BO3A 1DFDA 3MXHP 3M2VA 3CJKA 1LFWA 5HMZA 2AYMA 3TR5A 3NXZA 2L3MA 2DCUB 2MKYA 1F6TA 3BGLA 3Q8YA 3UE2A 4CLZA 4KAIA 4LR7A 5D0RA 4JI4F 5J2NA 1SL1A 2OFGX 4IRKA 1KQFB 2HNZA 5KG2A 1ZTTA 2YPYA 3PYFA 3G6YA 3DGPB 3BKTA 4OFZA 4B17A 2YNGB 2AMCB 4BWMA 1X31C 3S1TA 2C3YA 1YRXA 5ETQA 4AD6A 3QO9B 3SCKE 5T7LA 1U2CA 2RAQA 5K20B 4IRDA 4CO3A 4XO0A 1WG5A 4IQXA 1KR4A 1TMMA 4NLUA 4KJIA 5DLGA 4Q45A 1B7YB 1U47A 1WC6A 3KLHB 1TL3B 4DCJB 4JI8F 3CMAS 3QRPA 3R5CA 2Y8WA 2KHCA 4N8OA 2HHWA 3IM9A 3TAPA 1HW9A 1BWVA 3EYZA 2CWKA 2VG5A 4Q8FA 2N4DA 4CO1A 3GFHA 3VAKA 1CBKA 3IO1A 2B3TB 3DDNA 1JLGB 3W5XA 3NAHA 5E3PA 5K14B 3LF0A 2WK4A 2VA2A 2EFNA 2HAFA 3Q24A 2QA1A 2W4PA 2WW8A 4JP8A 4J37A 2N3LA 3AB2B 4O3OA 1FEHA 4I4BA 3DLGA 3OTBA 1QJHA 1WI8A 3HDSA 1GX5A 2K1RA 1ZYQA 4WFZA 2QX0A 4NI2B 3SI8A 3SYZA 2E29A 2YKOA 3FVYA 1RTIB 1CULB 4LR8A 4LUBA 3W9JA 3HI9A 1R8BA 3HX9A 3KK3A 3C15B 1MN9A 2CQ2A 3TO8A 3L7UA 5HAOA 3R27A 1UTAA 2HW3A 4HH1A 3BPDA 3AD8C 4L73A 4A8KA 1QSSA 4Y3CA 3CULA 2PFFB 3IRXA 4LF8F 1RTJB 1REGX 1B0TA 3N6LA 4DL2A 2ROEA 3CJ0A 2GMLA 2OPRA 1RCOB 4PQUB 3MEDB 5KFDA 1BXNA 4PEOA 2E9RX 1D1UA 3SCIE 5ETOA 3CT9A 1H38A 2OKQA 1R0AB 4EGLA 4NLVA 1X5PA 1DQ8A 3F44A 2SXLA 1FJGJ 2XYHB 3M2UA 4PG5A 1SQEA 2EFOA 5GVQA 1V6HA 3PV8A 2AX0A 5K8PA 2Z56B 2PIIA 3FRZA 4EEYA 4RJVA 4TN2A 3NCPA 4R5PB 2B6AB 4YR3A 1F9FA 3U1LA 3U7JA 4A8XA 2XLIA 2CPIA 3N6NA 1VBYA 1U8SA 4IG0B 2LQBA 1F5CA 3AOBA 3BGOP 3N9UC 4MFBB 1U7LA 3DGPA 2RU9A 4I6YA 3PJWA 2YNGA 3MD1A 1QDUB 2J5AA 4FF3A 2OEKA 4LF4J 1GEHA 2AGPA 3DRXA 3QO9A 2LQ5A 3MUTP 1HA1A 4AQYJ 1S1XB 3B78A 4MK7A 2HQ3A 2ZC3A 4DR7J 1FKOA 3MFHA 4C8KA 3N79A 3DXBA 5B0DA 3GJQB 2CJQA 2HFVA 3CCTA 1TL3A 1D3WA 3KLHA 3MD3A 1ZAVA 4C11B 2KXHA 3I5AA 3T1HF 1RLDA 3L9ZA 3R5AA 1HNXJ 1PG5B 1VHIA 2V4RA 5LJ5Y 5C24B 6AT1B 3CJ2A 4C3MA 3GFXA 3IC1A 3JXOA 2VB6A 1P1LA 4DHVA 1LKZA 1N36F 3CEDA 1JLGA 2W4CA 3KJNB 3TUZC 1HNZJ 1MN7A 3RUBL 4HTIA 1TUVA 1O5JA 2YKMA 2IJRA 1X4DA 3FUYA 5IT4A 5CQGA 2Q66A 3DU6A 3KYLA 1GTEA 2KFZA 2CFXA 1SH0A 1FJ7A 2W9CB 1IR2A 5C5JA 2ZH5A 4PXDA 4NI2A 1P9QC 1D09B 2WBRA 4J9VA 2HQGA 3M05A 4M94A 4Y65A 5KOXA 2ROPA 2ILYA 1UEKA 3C15A 4RL1A 3PXGa 3GV8B 2GVZB 5JVHQ 3PX4A 2ILZA 2C2NA 3KLGB 1UJ5A 4J9PA 3QAUA 3NMRA 2KXNB 5LXRA 3JQMA 4IH5A 3J81U 2YBVA 2W7PA 5KFEA 4NRUA 3BO2A 4PQUA 4LJMA 3MEDA 4L6V3 2OGUA 1O51A 1GT8A 5LMNJ 1UFLA 1SKUB 1VYAA 3KLIA 1PJ5A 1HQUA 2P9GA 4F3OA 2CQDA 3K5LA 3H42A 2M3DA 1R0AA 5I3UB 1QAIA 1QTNB 2CZVC 2HQCA 1AT1B 2AJ0A 3BF4A 4X4OA 3M1VB 2EKYA 4X64F 2K7JA 4CO2A 5AE3A 3AAWB 2PT0A 3ZZYA 2WONB 2YWGA 1KWMA 4F3QA 3K5MA 1S79A 4USJC 4HDGA 1H2UX 4C7QA 1BQXA 1VIXA 3BH7B 1Y10A 3W62A 3MR5A 1F9EB 2B6AA 4EUVA 3MURP 1BMQB 2CDQA 4DPOA 2DNPA 4DL0C 1BWEA 8RUCA 1VQYA 2BXJA 3NGDA 3DDKA 1SKRA 2ZEJA 4MFBA 4CIOA 4QR1A 1S57A 4UQGA 2LEBA 1SC1B 2J0XA 3TQEA 4I67A 1VQ9S 2DVIA 3N01A 3TUIC 1FD2A 5L1KA 1SJRA 1YJTA 4USHA 3IR7B 1S1XA 3MF5A 4EO6A 2EVZA 2RRAA 1WSRA 2EBGA 3HVTB 2RT3A 2K3IA 5FJ4A 4OV1A 1KEKA 4D3HA 1UCNA 1NKEA 2QA2A 2WTFA 1YIJS 4C11A 3W65A 1VRUB 2OPQB 1TUWA 4B9TA 5LT5A 3MHYA 1W26A 4ID5B 4X65F 3Q8PB 7AT1B 1SH3A 3AH6A 3NGTA 2AEMA 4U8YA 2BJ3A 2JHEA 1EX8A 5A8WB 3CMQA 3UPFA 4CI0B 2V4JB 1RWWB 2E1RA 3TUPA 4FYVB 4DWIA 1RP5A 2W9CA 3VAFA 3K17A 2WW4A 2AP6A 3N28A 4OMFG 2M70A 2VG7A 2BEFA 3GIJA 4NCAA 4FKYA 4UOHA 5I42A 2IA6A 3AXKA 3QT5A 1GQEA 2GVZA 4OI6A 1EQMA 3M2RB 3SQGA 3KLGA 5D3GA 5K8OA 1U09A 2DNOA 2MXYA 3AD9C 5FLXU 3QJPA 2LQ9A 2LQ8A 2H48B 2QLWA 3IS9B 3JB9k 4IG3A 5B7WA 1VRTB 4GKJJ 3TQ1A 4RU9A 2IBOA 1FVSA 5I3UA 2ZBQA 4ATNA 2XO7A 2N7YA 5A6WA 2XS7A 2XSFA 1M5KC 1BQNA 4DV6F 2DR5A 4QIEA 4PZVA 2YKPA 3HVRA 2AJ4A 3Q89A 2NSBA 2WONA 1T9YA 2P2CB 4WKRA 2I8EA 1K47A 1RWNB 2UVRA 4X62J 2BW7A 2AZ3A 4ZJLA 2MZTA 1PKUA 3POTA 1UKUA 3IGVA 1RTHB 3N5BA 3BH6B 4WIIA 2Q6BA 2QLJB 3VGTA 1KQGB 1VQPS 4CLSA 3OJSA 2EBEA 2OPSA 4OZNA 4M5DB 1FJGF 1AXQA 1WF2A 4K5SA 3ELHA 4DLEA 1HW8A 1KFDA 3CCQS 1NZAA 2QA4G 3JTNA 5L46A 5ADZA 2BVZA 3HVTA 5BJRA 1NPRA 2UUAJ 4K4TA 3LPEA 1HNWJ 5ETTA 2FJEB 1WOSA 2ZKUA 4OHXA 2PO4A 4DV7J 1LWEB 3Q8QB 3OFEA 3UFCX 1VRUA 2OPQA 2ACMA 2C2MB 3JQKA 4DJBA 2XMWA 4N5SA 1GAOA 5HJYA 4MKVA 4LF9J 3OTDA 4JV1A 2G2ZA 2ZH9A 3F73A 5SZTA 1VQMS 1FXDA 3D3BJ 3NOGA 2NYHA 4ECWA 2QT7A 4LSNB 3PO5A 4EZ6A 1UP1A 1OMSA 1UAWA 1H7WA 4WZMA 3BSOA 1L3VA 4F4XA 4FYWB 4I64A 3RYLA 2JLGA 2GX8A 2V4JA 2XS5A 1RYSA 3MR6A 3V6HA 1U8WA 1UW4A 2KM8B 4OYOA 1TUGB 1QAYA 3AD7C 4HHUA 1A6LA 2CQ1A 2BUNA 3D1OA 1RHRB 1HNXF 4JUZA 4AL6A 4WK1A 3TZZA 4YQWA 3FRYA 4RW4B 1JWWA 3OLAA 1VR6A 1DTTB 4Y6IA 2ZZTA 4DQRA 4C8ZA 3LTOA 1Y5IB 4DV1F 4IH7A 3ZC4A 4M5IA 2ZH3A 3ENQA 3GV5B 1X5TA 4KRWA 5ETKA 4EFAC 3K5OA 4BC7A 5HBMB 1TMJA 5D15A 4NMLA 4CH0S 2VPYB 2WSCC 1VRTA 4IO9Q 4NCGB 4ZPTR 1EQ0A 4HR2A 3GWCA 3VGVA 1PCAA 2CQPA 4K50A 1YBAA 3DGVA 4FBUA 2PMZD 2DD8S 1S59A 4DR1J 4A47A 2FJBB 4USTA 4QR2A 1T7PA 2GGPB 1EP4A 4LQ9A 2W9BB 2LECA 1FX4A 2B8QA 1S12A 2P6TA 1NK8A 4B3SF 2XLJA 3DLBA 1IBLJ 4YHHJ 3RB6A 4Y0FA 1G4CA 3L7OA 4F02A 3BBCA 1PYOB 2L9DA 2ASJA 4TYBA 2VG6A 3GSDA 5LMNF 3D9BA 1VOMA 1RTHA 3EX7B 2KL8A 3DC2A 5H9EJ 1E6YB 2AEFA 3JYTB 3IN5A 3G6VA 2PE8A 2HS4A 4M5DA 3AJDA 3TZXA 3TJ9A 3GG1A 1SJ1A 4RKUC 2BE2B 2D7SA 4D3GA 3I55S 1REVB 3LGNA 3KUHA 1KQSR 1WKLA 2G4BA 1I94J 3FZBA 1HPZB 4ZCKA 3HKZD 3OSNA 2ATLA 2XZDB 4PXEA 1ZTWA 3BSAA 4F26A 3IXQA 3CJ3A 3BKFA 4JV5F 1LWEA 2ZUGA 3UR0A 1K1QA 3CE8A 1CJKA 4ZK7M 5E3AA 2RUSA 4OX8A 4P71A 4ZIVA 3BYPA 2GIQA 4C8YA 2A2DA 4M5JA 3TAMA 5KFPA 4LSNA 5G0RB 5CD4A 2HHVA 5ETRA 4FP9A 4H4MB 2QIFA 3NWGA 1F1BB 3GB0A 1HNIB 4RBUA 4F0MA 1FTCA 2DR6A 2C2ZB 4O23A 1RWVB 2DITA 2U2FA 3PRDA 4QWDA 5JJBA 5DZ6A 3MAQA 2L9NA 3E01B 3MM7B 5KFQA 3PZPA 1DBDA 4EU0A 4ZVHA 5BYRA 3RB3A 4RW4A 4I68A 1DTTA 2X1FA 2APOA 1FEEA 1LWCA 3TZWA 3U02A 2PN6A 3B4MA 4B3TJ 3FEZA 3GR0A 5ETSA 1XMOJ 2XI2A 1V5IB 2DPIA 2AW0A 1Q5VA 1C1BB 2FVQA 1X4GA 4U7UD 4DOZA 2ZHAA 2XC9A 1O0PA 1VQ5S 3DNCA 1FRJA 4NLYA 2NUUG 5IV3A 4FXVA 3EM1A 3M8PB 4NCGA 5D0EA 2WRMA 2MQNA 4P7TA 2VPXB 1XNRF 4EI2A 5I3PA 4KYZA 4DZ6A 3G9CA 2CVEA 4ETZA 2Y1JA 2MPUA 1RAAB 1HWKA 1JLCB 1LXJA 4NLSA 4IR9A 1UL3A 2KZZA 1FFSB 1IM4A 1QVGR 1RT4B 4MK8A 3WC2A 2LA6A 2HRTA 1ZPWX 4PG6A 3Q22A 1Y11A 3CJ5A 2DR8A 6FDRA 2OTJS 1N88A 4WP8A 2HQFA 3SV3A 4CH1A 4MKYA 1PSDA 2UU9F 1IM6A 2BOPA 4ZVFA 2V8DA 2VOPA 1E6YA 3GV7B 3C3LA 4M5LA 2EK6A 1WDDA 3D7SB 4HHJA 2V34A 4OJ1A 2DXEA 4PUOA 4OYIA 1N0UA 4RLEA 3OVSA 2BE2A 3UD5A 3CCUS 1KLMB 2HHHJ 2H4WB 2MZRA 4X4UA 5EHHA 2HK3A 2OPPB 5HLFB 4K4SA 2EC2A 3R3TA 1XTZA 5A0YB 4Q8EA 4DCOB 2LFVA 1UJ6A 5IV4A 2QL5B 2R7QA 4KB7A 2FLPA 2V2KA 2VBYA 1NCLA 3KDNA 5KG1A 4MK9A 4FVCA 3RRHA 3A8IA 1WJ9A 3PCOB 3CDAA 3S6EA 3BYRA 2CYYA 4F67A 3FCWA 4IDKB 4C9DA 4HVZA 1WHWA 2R3VA 1XBWA 1S7IA 2KJWA 2OFHX 4C97A 1KDNA 2UUAF 4KPCA 4OZJA 2ADCA 1HNIA 2V63A 2FLLA 1RCXB 5GAHI 2JRSA 2AJFE 3GYXB 1V3ZA 4J9SA 1IBMJ 4DV7F 1WEZA 2GC8A 1YLXA 3OUYA 2LDIA 3GZ7A 3I5CA 2XEXA 3OTOJ 3V6DB 2QTWA 2DTJA 4JI1J 1HQEB 3LP1B 3E01A 3THVA 3C16A 1S1WA 3Q8VA 2R8IA 3RAMA 4NL5A 2NLWA 2VFUA 4WTYA 1SIWB 2YH0A 2P5VA 3VHQA 2DNMA 4NASA 4DFKA 2KFNA 4E98A 1M1HA 4O3QA 2YWHA 2V50A 1UEUA 1NBEB 1HHQA 3JTOA 3OW2R 1R0BG 2KH9A 2BM1A 1C1BA 5M2RA 4ENOA 3GYGA 2NQPA 5D0GA 2B0GA 4JI6F 1ZZFA 3TP2A 4KR0B 4WFXA 1FT8A 1FE4A 1R6YA 1HWIA 3K58A 3DOKA 2MQ8A 4IFVA 1XWLA 1N0VC 1QD1A 2M9KA 1Q86T 4F4YA 3HFZB 1YSJA 5LSLA 4OX9J 1E6VB 1JLCA 3FBFA 3CCRS 3LA0A 1IBKJ 1OYEA 2ZDPA 3HSZA 1WUUA 3BREA 2FPHX 3NCQA 3MPUB 4NLRA 1L3UA 5K5MA 1T3OA 1MWZA 2OJ3A 1NK6A 2JJ4D 4F04B 4ZLJA 3M8YA 4QZVB 5M2UA 1FCAA 1R31A 2JEIA 2ZBIA 1Y3KA 5GMEA 4OI4A 3HHEA 1RJJA 3Q0AA 5I3QA 1FRXA 1JLBB 1SQGA 4NLQA 3TVZA 1N56A 4DUYJ 1XERA 4N41A 1L5UA 2FVSA 3BJYA 1N5QA 3VAMA 3W1YC 4C98A 4ANEA 4YR0A 2MY8A 3PNIA 3HZEA 1HWJA 3R5DA 2W4DA 3H25A 5J1NA 2AKWB 5LXYA 2QLXA 4LF7F 3W5ZA 4OHYA 1NJZA 1RI7A 4DX6A 4HL9A 1X4CA 1KLMA 3BGRB 1D9DA 2VV5A 2ATCB 1TU0B 2FJDB 2MQLA 5DRKA 3RGIA 2Y0SD 1IBLF 5GMDA 4ED5A 2CIMA 3PIOQ 4LFCF 5K9FA 2M2BA 4FPIA 4M5GA 2OPPA 5HLFA 2E66A 2LCWA 5KG0A 3G82B 3LGMA 5A0YA 1NUEA 2EK1A 5JXSA 2HBQB 1PYSB 1C4AA 4ECUA 1NK7A 4MKAA 4YY3J 1BLUA 3HVWA 2DGTA 1UZHA 2ASLA 4I56A 3T5KA 4TY8A 4ZVPB 1RHMB 1NK0A 2DT9A 5IZHA 4HHHA 4RW8B 1NMEB 4DV0F 5HATA 3UDCA 2OMLA 2CQ0A 1APSA 2R2SA 1RT2B 2XY7A 1VQOS 1HLWA 3W9HA 4F36A 4B3RJ 1VQKS 1XR6A 3QSYB 1VJQA 1VQ6S 3M8QB 1C0UB 3ZTRA 1S49A 3HCXA 3G96A 1HQEA 3LP1A 3LPYA 4A46A 1T9TA 4Q2MA 2ZZMA 2KVQE 4DSFA 2NS1B 1AA1B 1R89A 3O8WA 2AGOA 5D4OA 2MMYA 1LV5A 4LREA 2MGZA 1S6QB 2PEHA 2GJ2A 4USUA 3I82A 3FEXB 5ETVA 2P9CA 3PG9A 4K2JA 5KFIA 1R7IA 4LFAJ 5KFMA 4OHWA 4USVA 1T94A 3NP5A 4FPRA 4NE9C 2YNIA 2ZUAA 2E5HA 1ZM4A 1S72S 1N5YB 1X4AA 5KTQA 1UJ4A 2HZAA 2PDAA 1SJ3P 1VI7A 2BJ8A 2JVOA 2AV5A 4USWA 3N5FA 1NRKA 3KMQA 1PAUB 5CHCB 3TJAA 2B7CB 1E6VA 3CVKA 3Q83A 4LBIA 1KHVA 4ZPVR 1FJEB 4FS1A 2CVIA 2GMJA 4IUFA 2FDNA 3ETMA 3UNYA 4B08A 4MIWA 4DF4A 1L3SA 1CLFA 1U4BA 3NEKA 1LW2B 4K4WA 1GMWA 4QPTA 1JLBA 2GQ2A 3QIPA 4WFBQ 3AXMA 5D4LA 1XJWB 2DISA 1HR0J 3E51A 5AXLA 4CYUB 1UW9A 3M4XA 1FNOA 2DGWA 2DO0A 3KNAA 4KBIA 4M63A 4URSA 1CC8A 3UDEA 2WVEA 3BR9A 2KFYA 3BGRA 3VQSA 2C28A 4FVMA 5H1SV 2PMWA 4N56A 1DLOB 4QYRA 2B8PA 2KKHA 1MU2B 2HNDB 4ZP7A 2BMBA 5FDLA 2FLNA 2FJVA 2FHMA 1C1CB 2BJ7A 5H9EK 3UI3A 1NH8A 3TAQA 4G3IA 4X2BA 4MIBA 1TL1B 5CCMA 4ZP8A 4MAKA 4HI2A 4PCQA 3NOCA 2B43A 1K1SA 4I2PB 3EDQB 3F56A 2Z2ZA 2IHR1 4HEA9 1PJ7A 4A48A 1S0NA 4RW6A 5IT9U 4RWXA 3OT9A 2O1PA 2AD9A 2HHHF 1RABB 1U6BA 2C3MA 2OO4A 2R8GA 3BN7A 3AQPA 2HFOA 3LGHA 2O67A 4XPEA 2NPFA 2V9WA 3ILJA 1IXKA 4HDHA 2J9CA 5DQIA 4H4KC 2JLEA 3G6XA 3CD6S 1C0UA 4J7CA 2HFSA 4KIAA 1RXOB 3W2WB 4UOFA 3ITHB 2CNNB 1I5OB 2E7XA 3KJFB 3SBMA 5F8MA 2IRUA 4ZDNA 3ZTQA 2LU1A 2I9SA 2QGFB 3ONQA 2JLFA 1T9VA 2HMIB 4LF6J 1WDTA 2F63A 4ED7A 5CYMB 3NBPB 1H3DA 3MPWA 1WKJA 1WF0A 2HK2A 3OTOF 5KFJA 2OP5A 4Y2IA 4EWTA 2ACYA 4ZMMA 2KZMA 4JV2A 4OIXA 3T5JA 4ZN1A 2UXCF 3CCWA 1VQ4S 1CS4B 3MM9B 1JLQA 3OL8A 3RBEA 2G0IA 2N7CA 4DR5J 2GVDA 1BQMB 4TXSA 5CCLA 2QSFA 2B4UA 1LW2A 1WHXA 2I38A 2K06A 2MLZA 2HLTA 3IMQJ 3LO3A 4NXMF 2OAUA 2YTCA 3GIRA 3Q8RB 2ZM6J 1HARA 2UZAA 1OIAA 1TKXB 4ZPDA 4NA1A 3WX4A 3KJVB 3P5BP 2YQ1A 2XY5A 4CYUA 3CJ4A 4LF2A 2AX1A 2WAQD 1YJNS 3BS9A 4UUWA 3W5YA 3UD4P 3PKYA 2XQCA 3B82A 3RG6A 4Q44A 3IRWP 4ZVTB 4UUXA 3H5SA 1RT3B 2R42A 3AA8A 1MU2A 1RSCA 2RIJA 2C2RA 1X5SA 1FRKA 4L72B 1C1CA 2MY7A 2YWEA 3OR2A 4DUYF 4ER8A 4ECVA 3I0SA 2B4PA 3A3OB 5IQQA 4ZPAA 1JX4A 4DL5A 4DR3J 2MKJA 4ELUA 5BYQA 4I2PA 3HHKA 3G87A 4QW8A 3RRKA 3GSIA 2VQEF 2ZH4A 5F0WA 5IT9Y 2IDEA 4MT1A 4F4ZA 4JI4J 1R43A 1DY3A 2OEMA 4ZOSA 1IKYB 2KYZA 3EJMA 1Q5YA 1DZ5A 4DFMA 1H98A 2PA8D 4BDPA 2HHPA 2JFDA 1MLAA 2RS2A 3LAKA 5DDQC 1HQ2A 2FC8A 1N4LA 4KKOB 3AOAA 3GCXP 2HVIA 4ERDA 2LYVA 4OZ1A 5ETPA 4IOAQ 4S0MA 3TA2A 1BY9A 4ZCMA 1FXRA 2Y1RI 3KDOA 5KT5A 2C3PA 3JQJA 1YJUA 5LMUF 4TYAA 1ROFA 4ZPBA 3RU0A 1U0HB 3W8GA 2H5JB 1EAYC 4JI8J 4B3RF 2MKHA 2ADBA 2HMIA 3K8VA 2CAJA 4PG8A 3RJMB 1OPZA 4B3OB 5F8LA 4OYWA 4Z7YA 2DNLA 2D3ZA 3NBPA 4CWBA 2RRBA 2D41A 4JYAF 1XMQF 3PW5A 1KFSA 4V1Ak 1JXLA 2WOMB 2XMAA 2ROGA 3TARA 4YEAA 1Z2LA 4OZ0A 3CJTA 4RW9B 2D1CA 4DPXA 1FRIA 1BQMA 1MSWD 1H2TZ 4RNFA 5DO2A 3KG4A 5ETMA 5JVGQ 5A2QU 5KFHA 4Y00A 3DHXA 3OLBA 3QJLA 4CNZA 4ZA1A 1WACA 1S9FA 1NH7A 5KAKA 2WZ1A 1WORA 1S1TB 1TKXA 2JX2A 2FGOA 1XC9A 1YJRA 1UEVA 2FZKB 5AJ3F 3KJVA 4I6WA 2CPYA 3KLVA 3IWLA 3CCVS 1K9MT 3LALA 2N3OA 1HBNB 2XMMA 4O44A 1RU1A 2MKKA 1RT3A 3CMES 3MM6B 1HWUA 3SSQA 1YRTA 3P6YC 3BDEA 2R2UA 3OQ2A 2A6OA 3HFKA 5KT2A 4JI3F 4KV8B 1TR0A 3H40A 3VCDA 3HSDA 1WF1A 4CLTA 2ZOGA 2PGCA 1LWFB 3TEGA 5BXIA 1TVRB 3V2UC 2HWHA 4NLTA 4QIFA 2VPZB 3QNWB 4C0HA 3TUJC 3CDEA 3THPA 1MWYA 5DQHA 3I0RB 5HMWA 3NNHA 3N0VA 4BLGA 4F4WA 4G1IA 1MG7A 9ATCB 3P49B 1WOPA 2M8DB 3PEHA 3MMBB 1J5EJ 1BD6A 3SZ2A 1Q81T 2XWXA 5I4MA 2J0QD 2JL9A 4Q0BA 3EGNA 2ZNYA 3EVOA 4KGKA 2Z58B 4QQBA 5MAOA 2CJYB 3ZFVA 1Q53A 2X1GA 3UCUP 4TU8A 4KC5A 1IKVB 1GFWB 2HHXA 5FD1A 4OZLA 1U1PA 1U0HA 3M2VB 3CJKB 5HROA 4OYMA 5DGBA 3KHRA 4B9UA 1X4EA 4NXNF 3OD2A 2VZ9A 3HKWA 3T1HJ 4X4SA 1C0TB 2G2YA 3H90A 1S4EA 1N34F 2VD3A 2HHTA 2HNZB 4Y2AA 4A8OA 2QE5A 5IC4B 4B9MA 3IBCB 3MOZA 2DGOA 3EMTA 2KN4A 1KVJA 3J7YI 2E1AA 4L76A 1N36J 4OHVA 2HFZA 1SXLA 2XB2D 3ZZTA 2XCPA 1NHUA 1MW7A 5T7LB 3BQ1A 3EGZA 4DUZJ 4ECSA 4PXCA 3V81B 3SFUA 2WOMA 3MPVA 5L1JA 4RW9A 3GTYX 3I87A 1CJVB 2V94A 2J7WA 2CADA 5B0BA 4FF4A 1VIOA 4Z37A 1RT1B 1Q8KA 1U2RA 4LF6F 1FTRA 2HIQA 1S1UB 3I9ZA 1N48A 1QE1A 4XDDA 3LQVA 2F7VA 3K59A 2IJNA 2VG5B 5E33A 4DPUA 1S1TA 1TL5A 3L95X 1X9MA 5HVHA 4UTGA 3VGUA 3C6TB 1CQNA 1QAXA 1JLEB 3DLHA 5L9XA 1RK8A 3FCHA 3FNNA 2ALYB 3J80U 1S76D 1RHQB 1HBNA 4RNHA 3UQSA 4DN0A 4LRDA 1B7FA 3NGKA 3AJ1A 4DR5F 4ZJOA 4RNMA 3DLGB 1PC5A 3R7BB 4ZP9A 3G8QA 2K1RB 3MM6A 1I3OB 1RWPB 4OHZA 2MLYA 1KONA 2OHDA 3DYAB 4L74A 2ZM6F 1AW0A 4KV8A 5KFGA 4X64J 3NNAA 1KVIA 1TVRA 1PO6A 3C6UB 4JI5F 4NLDA 4DI6A 3I6PA 2LP4A 3CWJA 8AT1B 2QO3A 3ICLA 1KOOA 3NNCA 2XCAA 4ICLB 1Q79A 3TEHB 3I0RA 1K44A 4DX5A 1UA0A 1T05B 4U6PA 1OPIA 4P9SA 5IFMA 5EUHA 1HBUB 3CDWA 1PYTA 1S5ZA 4N47A 3G6ES 3MMBA 3H7HB 2P6SA 3M6VA 4PWDB 1ZETA 2WHOA 2RQKA 2VH7A 2PSZA 4F2SA 1YQHA 3AA9A 4EMDA 1RBLA 3HF5A 3L4BC 9RUBA 4K4UA 1NJYA 1VQNS 2AJQA 3MCNA 1JXVA 1NPKA 2B56A 1FF2A 2XNQA 1NK4A 4DPTA 5B0FA 4CO0A 4J5OA 2Z57B 4RUAA 3PHEA 4NZ7A 3VAJA 4F2RA 4DQQA 5GADU 4U8VA 2V0NA 1C0TA 1PAEX 3D0IE 1VBXA 3KMSA 4X65J 3MUMP 4OX7A 1FDNA 4A8QA 3EUNA 3C14B 2C42A 3T6BA 3UDLA 2AYGA 3MGJA 1WEXA 1U0SA 5C2CA 1NB7A 2DKOB 5DG7A 4IO1A 2HLUA 3V81A 2KT3A 1SL2A 3DRYA 1RDRA 1FKOB 3OL9A 1FRLA 2A1BA 1CJVA 1TK5A 1TTHB 3P4UB 1FRMA 2YWWA 4P7VA 3WC0A 1Z4UA 4IOBA 1N5VA 3ENAA 2PI4A 1RT1A 3A8JA 1HL6A 1RWKB 4WXOA 1S1UA 3VGSA 3OSPA 2WCXA 3FQLA 4DSEA 4QWCA 2FVPA 2UXDF 1HD0A 1T95A 3C6TA 2FTRA 2B51A 1JLEA 3B8HA 2YKMB 3T1YJ 2XNRA 4C8MA 3D0GE 1CC7A 4WXWA 4MYUA 1HYSB 4X4NA 2YQ3A 1LOUA 1WTFA 1HHSA 1URRA 3ZTOA 5IQ6A 4DU7A 3AOCA 2XMUA 1N33F 3FDSA 2KHDA 1Q0NA 3EE3A 4WU2A 3DYAA 1RHKB 2DNHA 5MLCV 2F9JA 3A8EA 1H6KX 1U26A 4DV6J 1WD6A 3UVJB 1JQGA 1RT6B 2JOQA 3C6UA 2IYIA 3DLEB 2CPXA 1ZA2B 3TZYA 2QG9B 2C3OA 4CT8A 2CG8A 2MHEA 2F9DA 4ICLA 3H2UB 1FDBA 4ILMA 1NZ8A 1T05A 3KLIB 4X4PA 3DCAA 1HQUB 2WSEC 2DPJA 1HBUA 1KTVA 3FMBA 3G86A 2R7TA 4PWDA 3H8YA 1G7CB 4OZ5A 3BV8A 3HSGA 1PIEA
chains in the Genus database with same CATH topology
4OYWA 5IV3A 4OYPA 3MAAA 1AB8A 3MR7A 1TL7B 1Y10A 1CJKB 5D0EA 3C16A 4CLLA 3C15A 3C14B 4CLUA 1WC4A 2GVZB 4CLZA 4OZ3A 2GVDB 4OYAA 4USWA 5D0RA 3R5GA 1CJTB 5IV4A 2QV6A 1YBTA 5D0HA 1U0HA 1CULA 1WC0A 4OYMA 3C16B 4CLWA 1WC3A 4OYBA 4CLTA 5D15A 4P2MA 1AZSB 1CJUB 1CJVA 4NI2B 3UVJB 3G82A 3ET6A 5D0GA 1Y11A 4OYXA 1CULB 1WC5A 4WPAA 4WP8A 3MAAB 1TL7A 4CLPA 2BW7A 4CLKA 3C15B 1CS4A 1YK9A 3C14A 2GVZA 3G82B 4OZ2A 4P2XA 2WZ1A 4CM2A 1CJTA 1WC1A 4USTA 1WC6A 4CLFA 4CM0A 1U0HB 4CLSA 1FX4A 1FX2A 4USUA 4P2FA 4CLYA 1CJKA 4OYIA 4WP9A 2W01A 1CS4B 4OYOA 1AZSA 1CJUA 1CJVB 4NI2A 4USVA 3UVJA 1YBUA 2GVDA 3ET6B 4OYZA 4WP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYW A;  5IV3 A;  4OYP A;  3MAA A;  1AB8 A;  3MR7 A;  1TL7 B;  1Y10 A;  1CJK B;  5D0E A;  3C16 A;  4CLL A;  3C15 A;  3C14 B;  4CLU A;  1WC4 A;  2GVZ B;  4CLZ A;  4OZ3 A;  2GVD B;  4OYA A;  4USW A;  5D0R A;  3R5G A;  1CJT B;  5IV4 A;  2QV6 A;  1YBT A;  5D0H A;  1U0H A;  1CUL A;  1WC0 A;  4OYM A;  3C16 B;  4CLW A;  1WC3 A;  4OYB A;  4CLT A;  5D15 A;  4P2M A;  1AZS B;  1CJU B;  1CJV A;  4NI2 B;  3UVJ B;  3G82 A;  3ET6 A;  5D0G A;  1Y11 A;  4OYX A;  1CUL B;  1WC5 A;  4WPA A;  4WP8 A;  3MAA B;  1TL7 A;  4CLP A;  2BW7 A;  4CLK A;  3C15 B;  1CS4 A;  1YK9 A;  3C14 A;  2GVZ A;  3G82 B;  4OZ2 A;  4P2X A;  2WZ1 A;  4CM2 A;  1CJT A;  1WC1 A;  4UST A;  1WC6 A;  4CLF A;  4CM0 A;  1U0H B;  4CLS A;  1FX4 A;  1FX2 A;  4USU A;  4P2F A;  4CLY A;  1CJK A;  4OYI A;  4WP9 A;  2W01 A;  1CS4 B;  4OYO A;  1AZS A;  1CJU A;  1CJV B;  4NI2 A;  4USV A;  3UVJ A;  1YBU A;  2GVD A;  3ET6 B;  4OYZ A;  4WP3 A; 
#chains in the Genus database with same CATH topology
 5CZX A;  2GCF A;  2I6W A;  3OBI A;  4U7C A;  3NCR A;  3ZZZ A;  1HI0 P;  2V8V A;  2YVS A;  2V8P A;  1EET B;  2RDD A;  4NRT A;  3C46 A;  2BR0 A;  3CD5 A;  2H3E B;  4NOH A;  3AQO A;  2X51 A;  2QYG A;  1M0S A;  3ZNJ 1;  4F8R A;  2E5J A;  3PFE A;  1S1V A;  1R8P A;  4P2M A;  2FY1 A;  2D9O A;  3BQ0 A;  1J5E F;  2JFK A;  3Q2T C;  3R5J B;  4KT0 C;  5J2M A;  1M5P C;  1U1K A;  2FIU A;  3C14 A;  3IAS 9;  3C66 A;  4MIA A;  4BWJ A;  5CA5 A;  2BV3 A;  1LFP A;  1HBM B;  2HGL A;  2QMU B;  3OVA A;  3DHW C;  2BJ9 A;  3KWM A;  1Q82 T;  1M1K T;  1FX2 A;  1SB6 A;  4FF2 A;  1ELO A;  4ALZ A;  3CSK A;  2LXU A;  1TFY A;  3CPW R;  1F3F A;  2VFS A;  4DR6 F;  4DDF A;  3HHD A;  2XHW A;  2FD2 A;  3RBD A;  3CGI A;  1TL4 A;  2DR9 A;  2R7O A;  3QGG A;  4CZC A;  3GJR B;  4WIQ A;  3P3D A;  2CUY A;  3SMZ A;  2WVB A;  5AXN A;  3VAG A;  1F5B A;  1MMD A;  3R5G A;  4ECT A;  3TWZ A;  4J9M A;  2QSW A;  1NB2 A;  7FDR A;  3TNV A;  2W25 A;  3GE9 A;  4DV1 J;  1SCJ B;  1WC3 A;  1JNR B;  1CJU B;  4DUZ F;  4C8N A;  4C8O A;  1T3N A;  3B4D A;  2F65 A;  3LWL A;  1HYS A;  3VVU A;  1OJ4 A;  4ED1 A;  1NHV A;  2J0S D;  3HP6 A;  5LJ3 Y;  1OY9 A;  3TAN A;  3RRG A;  5DZ7 A;  1IKW A;  3GIL A;  2VG7 B;  3R5B A;  2DRA A;  3N4W A;  1U1N A;  2OD4 A;  1RAI B;  5I42 B;  2JWN A;  2DK2 A;  4DEZ A;  5GAE U;  3LW5 C;  2Q3P A;  1EJ7 L;  3UVJ A;  3SQG B;  4B3S J;  2KG0 A;  2HWT A;  3EIC A;  5D3G B;  1U1L A;  3H5Y A;  1D8Z A;  4TQS A;  2HQI A;  1RT6 A;  5KG7 A;  4K59 A;  2RQM A;  1YJ9 S;  1NSP A;  4QBU A;  5AE2 A;  3J7Y U;  2YQ0 A;  3DLE A;  4CLU A;  4JI0 F;  1VLO A;  4ECY A;  1TKD A;  2EW9 A;  3QYY A;  4IG3 B;  4J9L A;  3J7Z T;  5KT7 A;  5H9F K;  2AF6 A;  2NCK L;  3UWT A;  2YX7 A;  5GMK a;  2VBZ A;  1G2E A;  4B9L A;  2EC0 A;  4KHR A;  1NU4 A;  4YOE A;  3NGU A;  1BQN B;  5KG4 A;  2OEJ A;  1JIH A;  4KH0 B;  4ZKA A;  2JEG A;  1EET A;  2V8G A;  3EZ5 A;  1T11 A;  1DHM A;  1R8A A;  4J9O A;  1S9E B;  3NY0 A;  4H54 A;  1NND A;  4U95 A;  1KKH A;  1NJX A;  2DH9 A;  3L09 A;  3W2V A;  2IVY A;  1WKK A;  4JV5 J;  1NPP A;  2WBM A;  3MEE A;  3POT B;  2N4C A;  4TQR A;  2V2V A;  3CNQ P;  4G65 A;  1EZZ B;  1VFJ A;  2AZ1 A;  4P10 A;  4FN5 A;  2CPD A;  4UZB A;  1GH8 A;  2BOA A;  2OPS B;  2O66 A;  2QMW A;  4I2Q B;  1WNE A;  2F8M A;  2DNZ A;  2BM0 A;  1TZ0 A;  3K8W A;  3J7A N;  3W64 A;  2DIV A;  4ID8 A;  4IRC A;  4CTA B;  2R7S A;  1K73 T;  3EXY A;  1HBM A;  2X7I A;  4TLQ A;  4ZVR B;  3PR5 B;  1VRQ C;  3TA1 A;  3ZZU A;  2ZNZ A;  3GPA A;  4UF4 A;  5CYQ B;  1PBA A;  1SPB P;  3KTQ A;  1RIS A;  3HT0 A;  1PC4 A;  1N5T A;  2V4Q A;  3MTK A;  1ZA1 B;  4AL7 A;  4YME A;  1DQA A;  3KOA A;  1FVQ A;  3CTR A;  4DG1 B;  5J2P B;  1JJC B;  5KFF A;  5L38 A;  4UZC A;  3OFG A;  3X1L B;  4CM0 A;  1RKI A;  4K5R A;  1RA6 A;  3PAC A;  1RWO B;  4BC9 A;  1CJU A;  1F2G A;  1FJC A;  4DL7 A;  4JBC A;  1NKC A;  1RZM A;  4BS2 A;  2KO1 A;  4RBT A;  5DLF A;  2B9W A;  4YR2 A;  2C22 A;  1H73 A;  4NA2 A;  1XNR J;  3A3N B;  3NL0 A;  4NYP A;  4WCE Q;  2EFG A;  2B9X A;  2OLW A;  1NSK L;  3KKF A;  3LWM A;  3MEG B;  4UOG A;  4N8N A;  1GXT A;  2OD6 A;  2ZH8 A;  1F60 B;  2CJB A;  4A8W A;  3T1Y F;  2VBW A;  2NZ4 A;  2NUH A;  3GG0 A;  2EFQ A;  4TNO A;  1RHJ B;  3QT8 A;  1G1X A;  3E8O A;  3J81 Y;  2UU9 J;  4XTT A;  4E2F B;  1A7G E;  3W60 A;  2R8J A;  1A0O B;  2L08 A;  2XY6 A;  1FDA A;  1RAC B;  1ICE B;  3CCL S;  5A8K B;  1EP4 B;  3LH2 S;  3RB4 A;  1TL7 B;  2V69 A;  4DV3 F;  3HO1 A;  4URG A;  2GAG C;  3M7V A;  2JZ5 A;  2RHQ B;  3CDU A;  4ZP6 A;  3CO9 A;  3IM8 A;  2IAJ B;  5EDW A;  4PG7 A;  3W7B A;  2YX1 A;  4OLP A;  1S9E A;  2DO4 A;  2C1E B;  2DBB A;  2VG6 B;  4G1Q B;  3IR6 B;  4E0D A;  1UPP A;  4ZIT A;  4Z2X A;  4FS2 A;  5AXK A;  3GON A;  4DU8 A;  3PX6 A;  5ETN A;  1VBZ A;  4OV6 A;  2AIR B;  2QA4 S;  1X60 A;  1Q78 A;  2X3D A;  3Q8S B;  3BBB A;  2AYE A;  4LIR A;  1RWX B;  4DXL A;  2M52 A;  4A8F A;  2RJZ A;  5HAN A;  4I2Q A;  4FNH A;  1HI8 A;  2OSR A;  3RZA A;  3TA0 A;  3PW0 A;  5SUH A;  4CTA A;  1WTB A;  5IT0 A;  2BKO A;  1OWX A;  2KRR A;  3JSR A;  3H4B A;  1NJI T;  2YWK A;  3DOM B;  1FXL A;  2DYA A;  3B54 A;  5CYQ A;  2W2P P;  2YNF B;  3CJQ A;  2UXB J;  3NKY A;  1SJ4 P;  2J9D A;  2HKE A;  2ZH6 A;  2DNQ A;  2VA3 A;  2UUC F;  2EG2 A;  1GMV A;  4ZVE A;  2PEB A;  4OJH A;  2RKI B;  1CJK B;  1ZZN A;  1YHQ S;  4DG1 A;  3K5P A;  5J2P A;  1J5O B;  4RUC A;  3OR1 A;  2GO8 A;  2X3G A;  4USI A;  4ZCL A;  1R8H A;  2X1A A;  3TAM B;  1B70 B;  3WHI A;  2XSJ B;  3QSI A;  4DR2 F;  3L3C A;  1AFJ A;  3OJU A;  5CAA A;  1Y4Z B;  4O4G A;  2D9P A;  3P5T L;  2ZDO A;  1VQS A;  1OY8 A;  4JI6 J;  2Y0B B;  3G8S A;  3CC7 S;  4ZVU B;  2FHJ D;  4RNN A;  1QM9 A;  2XM3 A;  2DEJ A;  3U27 A;  1TV6 A;  1FRH A;  2DGX A;  1SQF A;  2RH3 A;  3MMA B;  3IWN C;  2H5E A;  5L1L A;  2BYC A;  2HBZ B;  4EBE A;  2FY8 A;  2ZWO A;  2W01 A;  3DOL A;  4LRB A;  4GKK F;  4NEZ A;  3MEG A;  4YN3 B;  1VCT A;  1LWC B;  2E5L F;  4USK A;  1R3N A;  1UET A;  3HHL D;  4C48 A;  1P9Y A;  2CA9 A;  4OJG A;  4IFY A;  2MSS A;  3KFW X;  4N76 A;  2AU0 A;  3SQO P;  1K0V A;  1N6Q B;  5HSP A;  4DQS A;  3CIZ A;  5FLX Y;  2K2P A;  4DV4 J;  4QYZ K;  3EZO A;  1M1G A;  3SCL E;  4URQ U;  2FJX A;  4LF7 J;  1IR1 A;  4OYX A;  5A8K A;  2D3O R;  4KFB B;  1TL7 A;  2MHN A;  3EZU A;  3PW2 A;  4OI3 A;  4LFC J;  2DGS A;  2IAJ A;  1MNE A;  4DMZ A;  1TK0 A;  4OX6 A;  1SBR A;  1N32 F;  2ZKT A;  4DPY A;  3V6J A;  1M5S A;  3H0P A;  3D5M A;  1BC6 A;  4G1Q A;  1X4H A;  3H98 A;  4ED8 A;  1DAR A;  2KT2 A;  1MRO B;  1LK7 A;  3P96 A;  3QJJ A;  4ZN3 A;  3T5L A;  3NMA A;  4RNO A;  4AXJ A;  3J7Z 5;  5J1E A;  5L8R C;  4ZVQ B;  1GK8 A;  3QT7 A;  4IQM A;  3LP0 B;  1AB8 A;  4ECZ A;  1FWL A;  4PUO B;  2VOO A;  3LOU A;  3HM9 A;  1F0X A;  3KK1 B;  4ZLL A;  2ZJR Q;  3HLU A;  4DV0 J;  3PY8 A;  3H4D A;  3M32 A;  2BQ3 A;  2YNH B;  1ARO P;  3NWR A;  3DOM A;  1XK8 A;  3ZZ0 A;  4PKD B;  2Z30 B;  4ANC A;  4ELT A;  2RQ4 A;  1S9G B;  1RAF B;  1B0P A;  3MPY A;  2YNF A;  1X4F A;  1Y9O A;  1PJ6 A;  3DLJ A;  2HQD A;  2HVE A;  4UOC A;  3MCS A;  3GIK A;  3NS7 B;  4F4K A;  4AT1 B;  2RKI A;  1J5O A;  1TP7 A;  4HKQ A;  3QMQ A;  5KFN A;  3MDF A;  2I5J A;  3FSX A;  2W2N P;  3OXF A;  4LR9 A;  1CQM A;  4N7T A;  1TQL A;  1HI1 A;  2VBX A;  1Q4R A;  2V5H G;  2XSJ A;  1Y3J A;  2OUG A;  3ET6 B;  5KFL A;  5HL7 Q;  2PA3 A;  4RPF A;  2F4V F;  3R1L A;  3HHN B;  4NPO A;  4KHP F;  2FHO B;  3DLK B;  1O6X A;  3KHH A;  3T5H A;  4O4R A;  1T03 B;  4DSI A;  3OUY B;  3DN9 A;  3L7P A;  3WBZ A;  1YBT A;  2YH1 A;  1L3K A;  3MMA A;  5KOW A;  4ZPW R;  3D6H B;  3QGH A;  5B0E A;  2DGV A;  3C16 B;  4IOC Q;  1S1W B;  3C8Y A;  1C2P A;  3AHP A;  2GAH C;  4RBV A;  4OI2 A;  3A3P B;  1FK9 A;  1FER A;  1YZ6 A;  2ERR A;  1LWX A;  2GIF A;  4WPA A;  4AL5 A;  2BAN B;  2NZC A;  4KH1 B;  1VDH A;  3O6Q A;  1W2B R;  3I5B A;  5D77 A;  1N6Q A;  4P75 A;  2PFD A;  3SXL A;  1QVF R;  3FFI B;  4J91 A;  3S7R A;  2ZIT A;  3TX0 A;  3DOK B;  4IFV B;  3CJR A;  4F50 A;  2DHS A;  3HFV A;  1Q7Y T;  2E1C A;  1ZS6 A;  3DMJ A;  2RNE A;  1YRU A;  3QLH B;  4JB8 B;  5IC6 B;  2DXD A;  3ADA C;  1NO8 A;  5LL6 d;  4KFB A;  2M8H A;  5KT4 A;  1WOO A;  2R7V A;  3PVX A;  5K8M A;  3VV2 B;  3MPD A;  4FYD A;  2DY9 A;  4U9R A;  2QLF B;  1QAJ A;  2UP1 A;  4L3K A;  4X4Q A;  3NLC A;  1X7V A;  3ILI A;  2GJI A;  4CCH A;  1EB0 A;  1YI2 S;  1U24 A;  4I0W A;  3GP9 A;  1U49 A;  1MRO A;  3F41 A;  1UA1 A;  1RAE B;  4LRA A;  5IM0 A;  1JJ4 A;  2U1A A;  2JC0 A;  3FGV A;  1KC8 T;  5DG9 A;  3LP0 A;  4KQZ A;  3R8Y A;  3GFZ A;  3CXC R;  5E41 A;  4P74 A;  1YVF A;  2AHO B;  4GVB A;  4DUT A;  3KK1 A;  4X84 A;  3GU0 A;  1UVK A;  1ZAW A;  4LBP A;  2FB0 A;  2YNH A;  2VFR A;  2HBR B;  2CZ4 A;  1WHV A;  3X3U A;  1KP6 A;  2VQF J;  4ZLP A;  3BEG B;  2ZJQ Q;  2GJF A;  1S9G A;  4DZD A;  2ZFH A;  1YBU A;  1OQ3 A;  4OLO A;  3ILO A;  4NLP A;  5IS2 A;  4WKY A;  2IRX A;  4DV2 F;  4LFB F;  1AFI A;  3THT A;  4PAA A;  1EAR A;  3HD1 A;  1Y00 A;  2IIH A;  4ZVS B;  2E7W A;  4QR0 A;  1RBO B;  2LU2 A;  2DRB A;  5KFT A;  3US5 A;  4TY8 B;  1F5A A;  3BQ2 A;  1VS3 A;  1T9X A;  3T3F A;  1ITP A;  2HGN A;  1VGY A;  4C0O C;  2QFJ A;  4H4K A;  2RVJ A;  3HZG A;  1NEE A;  3ET6 A;  1K8A T;  3O44 A;  2KDO A;  3M8Z A;  1F9H A;  4DR4 F;  4KY3 A;  3G71 S;  1VC5 A;  3PDN A;  2UXB F;  3IFE A;  4W98 A;  2P8I A;  4CRJ A;  2BDP A;  4A4J A;  5F9N A;  3DLK A;  2BQR A;  2I0X A;  2F3J A;  1FES A;  1T03 A;  1RAD B;  3BGF A;  3M6U A;  3O3L A;  3FQK A;  2UV8 G;  1U25 A;  4O3R A;  5K14 A;  3D6T B;  2VDH A;  5U47 A;  3MUV P;  2UXC J;  1Q7L B;  4DLG A;  1G6B A;  1RUS A;  4WTO B;  2MGZ B;  3A4T A;  1XNQ F;  1UVN A;  2VJV A;  1RTZ A;  1S0M A;  2BAN A;  4ILL A;  4UQT A;  1D0E A;  5J1P A;  1HBO B;  3DRR B;  3R1H A;  2VU5 A;  5KT3 A;  1CG2 A;  1RT5 B;  4NXM J;  2YNI B;  2DB1 A;  3QZ7 A;  3FFI A;  1AYE A;  1RTI A;  1CUL A;  2BX6 A;  4MKB A;  4PXB A;  4P72 A;  1XEZ A;  4G1P A;  3HPO A;  5E2Q A;  2F40 A;  1GXL A;  3QLH A;  2HIY A;  1T8E A;  4OL8 A;  4JOU A;  3B6B A;  4RUH A;  1UVI A;  5HQL A;  3D67 A;  1AUD A;  1NSQ A;  2CPF A;  2RUG A;  3IGN A;  1RTJ A;  2DJW A;  4LRF A;  3T41 A;  3JSM B;  3GQC A;  1VIS A;  2DHA A;  5F8I A;  1WC1 A;  2LEP A;  2GNK A;  5HK4 A;  2CNL B;  4EBC A;  2QN6 B;  3RTV A;  1KOH A;  1V3R A;  1Q95 G;  4DFJ A;  5B08 A;  3ISN D;  3QIP B;  2IFX A;  4GVL A;  3G2X A;  2AGQ A;  3IAM 9;  1RWM B;  4DV4 F;  3MCO A;  2QRR A;  1M5V C;  2XS2 A;  3QGP A;  2J6U A;  2BW2 A;  3HD2 A;  2MJN A;  1Q8I A;  4Z7C A;  3QGI A;  4A8S A;  1JMT A;  3HHL C;  1MML A;  2RF2 B;  4YP3 A;  2C2D A;  5CZV A;  3DDI A;  3FZ2 A;  1ZAX A;  1S7H A;  1SI9 A;  2VQE J;  5CYJ A;  4Y28 C;  5LOQ A;  3CDB A;  4R5P A;  3R6L B;  1YKW A;  5E5N A;  4DL3 A;  2IC3 B;  2C3U A;  2EWH A;  2MZJ A;  2UUB F;  2HS3 A;  2G1H A;  4IG0 A;  1SKW A;  3CD7 A;  5FDL B;  2R9L A;  3K57 A;  2XGQ A;  5DDO C;  4DCP B;  4R25 A;  1IWG A;  3MFI A;  1ZPV A;  5F8J A;  3M30 B;  4J9R A;  1NK9 A;  4IKA A;  4EYI B;  3AJ2 A;  1N5S A;  3VF0 B;  1FKA F;  3T9N A;  1JK9 B;  4EZ9 A;  4CM2 A;  5GAG U;  1PBU A;  3RBX A;  2FZG B;  2XYG B;  3T9Z A;  2KU7 A;  5A6P A;  1PGZ A;  1S4F A;  4YB6 A;  5LMU J;  4LF5 J;  4RW6 B;  1KRP A;  2G0J A;  3ZTS A;  2BRK A;  3UDV A;  3W63 A;  2ZVS A;  1RBA A;  2OIH A;  2MLX A;  5IWA J;  1JXE A;  4QWB A;  3V4M A;  2DH8 A;  2GIR A;  4TY9 A;  4QIG A;  1S0O A;  2MDA A;  4FNI A;  1IR0 A;  3RR7 A;  1IQZ A;  5C24 A;  3PYD A;  2ASD A;  1F3V A;  3JAM U;  4QOT A;  1S99 A;  2KVI A;  4JYA J;  2NYI A;  1XMQ J;  2W2Q P;  4WWS A;  1U48 A;  2IMO A;  2DEI A;  2RU3 A;  4NYZ A;  4Y34 A;  3D1Q A;  2CJK A;  2YX4 A;  2H65 B;  2MST A;  1H74 A;  4K4V A;  3DU5 A;  4WFY A;  1OY6 A;  3QZ8 A;  5DJB A;  4ILR A;  1HBO A;  3DRR A;  4W90 B;  2Q43 A;  1RT5 A;  1UVL A;  2CQI A;  1VQL S;  2KRB A;  5LM7 E;  3NG8 A;  2H51 B;  1WG1 A;  4ES1 A;  1D8Y A;  5D8H B;  2MTL A;  5KFY A;  5AJ3 J;  2VIH A;  1OQ6 A;  4WP3 A;  1HFE L;  1W7W A;  1JLF B;  2QYC A;  2I2Y A;  4DFP A;  3QT6 A;  2DNN A;  2OSQ A;  1JLQ B;  4HT5 A;  1EKS A;  3BN4 A;  3JSM A;  2GVD B;  2GO9 A;  2E1M C;  2UUT A;  3PHT A;  2HRY A;  4NZ6 A;  5DM7 Q;  4DPW A;  5DDR C;  1FA0 A;  4DS5 A;  2XZT B;  1Y7P A;  1X8D A;  1D9A A;  5E3Q A;  5D4P A;  4HH0 A;  2HWI A;  4TU7 A;  3I4H X;  4ECQ A;  2BQU A;  1KN6 A;  2BBE A;  2Z2Y B;  1WEL A;  4JI3 J;  2MKC A;  3AFG A;  4QPX A;  2E1P A;  3FCV A;  3M1V A;  3GR1 A;  1WG4 A;  4ETX A;  3GIM A;  2CJX B;  2D74 B;  2G9O A;  3CW2 C;  1IJE B;  1UMJ A;  3ZTP A;  2E9Z A;  2RF2 A;  4DX8 H;  3OL6 A;  2GQQ A;  1S97 A;  5HJX A;  4WE1 B;  2DIU A;  1RWU A;  2CQG A;  3AY0 A;  3SCJ E;  2B4O A;  2XGP A;  2IC3 A;  4WF9 Q;  1FE0 A;  7FD1 A;  2IMW P;  2W2M P;  2XWY A;  3TW0 A;  4NLW A;  3DI6 B;  1GXU A;  2E7V A;  3OR2 B;  1SJF A;  3I0S B;  2FHK A;  2V2Q A;  1WI6 A;  2J76 E;  3ZNU A;  4QU7 A;  2QFI A;  3M30 A;  5EWE A;  3D66 A;  4ES2 A;  4OYA A;  2HZC A;  3UN3 A;  2QMX A;  2MQP A;  3MAH A;  4WBF A;  2DHG A;  4XIU A;  1TEL A;  5EWF A;  4M95 A;  2P9E A;  4QJV A;  1YZ7 A;  2VQF F;  4NXN J;  3BSC A;  3RW7 A;  2EFV A;  4YB5 A;  1N34 J;  3C2P A;  4ZCI A;  3DRS B;  2DRD A;  4DSJ A;  1SH2 A;  4NZ0 A;  2J8A A;  4AND A;  1YJV A;  5ETL A;  1EKR A;  1U1Q A;  3HXM A;  2NXJ A;  1TAQ A;  4L75 A;  4ID5 A;  4R0J A;  2G13 A;  2IM2 A;  5THW A;  5KFZ A;  1FDD A;  4ED2 A;  3OV7 A;  2WVC A;  2O5D A;  4LF4 F;  1ZOT A;  4BHQ A;  2VC0 A;  3KUE A;  4AQY F;  3JAM Y;  2PD1 A;  2W8L A;  4ZPC A;  5DQG A;  4DR7 F;  5A8W A;  3CCZ A;  5LSR A;  8ATC B;  4P52 A;  1LW0 B;  3RBZ A;  2HVZ A;  1HIY A;  2V68 A;  4UT4 A;  2GHV C;  3H2V E;  1NM2 A;  1WSV A;  1BUX A;  5DM6 Q;  4A8M P;  3VR1 A;  3JSY A;  1QSY A;  4YS2 A;  4ITS A;  2EXU A;  4RZR A;  1LXN A;  4GRS A;  3A12 A;  3M2R A;  1RGV A;  1HNZ F;  1JLF A;  2XLK A;  4C2M A;  2DY1 A;  2CNO B;  2K8G A;  3EPI A;  2RRN A;  2KTQ A;  1U1O A;  2MQO A;  2BAC A;  1UVM A;  3RAX A;  2ZZN A;  3IS9 A;  1OSD A;  2Y3Y A;  4Q5V A;  4P2F A;  4K8R A;  4WFN Q;  4M5M A;  3PIP Q;  1VK3 A;  2HZV A;  1Q8B A;  2JC1 A;  3M6W A;  5F41 A;  5T41 A;  1X4B A;  2OMO A;  4U7U K;  1NK5 A;  5K8N A;  2HG4 A;  3KK2 B;  4DSL A;  5IOL A;  2LVW A;  1UVJ A;  2CKW A;  2QL7 B;  3FMW A;  1U6F A;  4ZHR B;  4JI5 J;  5KG5 A;  1VC0 A;  3BM7 A;  5B09 A;  5GAD I;  3UD3 P;  3UR3 C;  4O44 B;  4PWU A;  4LBH A;  4WE1 A;  4M8L A;  3ENV A;  4ECR A;  3FC9 A;  2OTL S;  5E3R A;  4EK2 A;  3CCS S;  4NLX A;  3QAT A;  2R7U A;  2COL A;  4RR5 A;  3OPK A;  2RS8 A;  3DI6 A;  2MKS A;  3ETO A;  5HVG A;  5D6G A;  2FGC A;  4CLP A;  5KFK A;  2XTJ P;  2NR0 A;  2EG1 A;  2H54 B;  1YIT S;  3ILL A;  5F3Z A;  3PRV A;  3R97 A;  1TKT B;  2FC9 A;  3DLL Q;  1WWH A;  3BKU A;  3IWX A;  4PQA A;  5DDP C;  1DTQ B;  4LF1 A;  4ES3 A;  1S0V A;  3HVA A;  2MYF A;  2XUL A;  3M9O B;  4Q7A A;  3TI0 A;  3ISN C;  3TVK A;  3P45 B;  1ZM2 A;  4HTJ A;  3DRS A;  3G8T A;  3R9L A;  1X9S A;  2YPZ A;  4EYH B;  4Q0B B;  1FHT A;  2BJE A;  1I51 B;  4DBQ A;  4Q2L A;  2RDI A;  1R27 B;  2AYB A;  3H5X A;  3PRB A;  1NSA A;  1TFW A;  3KJQ B;  3CJS A;  4LF5 F;  2LDY A;  2JH3 A;  5HRO B;  1K0T A;  2XHC A;  3OTE A;  4UW2 A;  1XR5 A;  5KFR A;  3MEC B;  1R6V A;  4ED3 A;  5IWA F;  5A8R B;  1LW0 A;  1CEZ A;  5HN0 A;  2AT1 B;  3LAM A;  3JS9 A;  1U02 A;  3NS6 A;  4CLF A;  3V5R A;  4QW9 A;  2F8H A;  5BR8 J;  4RW7 B;  3H59 A;  4J9N A;  5CH7 B;  2BE9 B;  2UV8 A;  2EFP A;  4LSZ B;  2UXD J;  1RAH B;  5KFS A;  1NHK L;  2AQ4 A;  3GJS B;  1VLY A;  3R7S B;  3ZO7 A;  2QEX S;  2XMK A;  2NSC A;  2HFU A;  4OYP A;  1VQ8 S;  3QWP A;  3Q8U A;  2ZBR A;  1JKH B;  4M5H A;  5HBM A;  4P2S A;  3PW4 A;  4OZ3 A;  4DF8 A;  3R2C J;  1H0H B;  4JI7 J;  5IXU A;  1N33 J;  2DNR A;  3BDP A;  5KFU A;  4GO5 X;  3FSY A;  1FD8 A;  1QE1 B;  4L3N A;  4FXW A;  1NDP A;  2DNK A;  3M9N B;  3MCM A;  4RWW A;  4FZV A;  4QCL A;  4HLB A;  1WHY A;  2GGP A;  4Y2M A;  1WC5 A;  3KK2 A;  2W9B A;  4LIW A;  2UVV A;  2C2K B;  1ZM3 A;  4QWA A;  4K0K J;  4ZHR A;  3EGV A;  1EHW A;  1JB0 C;  3UCZ P;  1NXI A;  5FII A;  1R0C B;  2DHH A;  5KT6 A;  3EVM A;  4USM A;  3R6G B;  1V9O A;  1FKP B;  4LVO P;  2KJV A;  2FYX A;  4DX7 A;  4TLR A;  4WZQ A;  2CWX A;  4GKJ F;  5H9F J;  3GMG A;  2ZE2 B;  2XI3 A;  2E44 A;  1HWL A;  2QL9 B;  1N54 B;  3JYT A;  2DGQ A;  3BO4 A;  2BZ2 A;  3TRG A;  5F3T A;  2YY3 A;  3CO0 P;  2GHW A;  2H9Z A;  1KVK A;  2KB2 A;  1TKT A;  4C6A A;  3E2E A;  2HNY B;  1REV A;  2QV6 A;  3LUY A;  2W9A A;  1HPZ A;  4B9N A;  1FFW B;  1SJQ A;  1DTQ A;  3D0H E;  3DM2 B;  2KXF A;  4OQJ A;  4I69 A;  1IKX B;  5C2G A;  1BHN A;  1C4C A;  4X62 F;  2G1D A;  2XMV A;  4B9S A;  1GMU A;  3V6K A;  1I1G A;  2R2R A;  3T19 A;  3KXD A;  2IPO B;  5M2P A;  4O3S A;  3D3C J;  3WIV A;  5B0C A;  1UFW A;  5E7O B;  2POK A;  3SDE B;  2AEJ A;  4B9V A;  4MMO A;  3SSS A;  1SC6 A;  1Z2Z A;  5G0R A;  3OHB A;  3CCE S;  3UNG C;  4NCB A;  4C4W A;  3OXG A;  3PW7 A;  2ZHB A;  4H4M A;  2G0C A;  3IP0 A;  3H2L A;  1NJW A;  4DR6 J;  3MEC A;  2RML A;  1HNW F;  5A8R A;  2Z8Q A;  1Q1K A;  3HUL A;  1YTY A;  4GC7 A;  4ECX A;  2VKR A;  2J6T A;  3I96 A;  5GAE I;  2Z2M A;  3W3S A;  1F2H A;  5CD4 H;  2Q79 A;  2WVF A;  2IVF B;  3EVW A;  4RW7 A;  4F0H A;  4LF9 F;  1P8G A;  2MEW A;  3MM7 A;  3KG0 A;  2QZ8 A;  2HYI B;  3I9V 9;  2V2Z A;  5KFW A;  1S48 A;  4CO5 A;  2Q6C A;  1NDC A;  2QJ3 A;  2OH2 A;  1CSJ A;  1QLN A;  3OXL A;  3ENW A;  3VWS A;  3HK2 A;  2Z2L A;  3OVB A;  1JKH A;  4OI1 A;  5E3C A;  3PR4 A;  2E5G A;  3BR8 A;  4BCA A;  4WU3 A;  4CT9 A;  4ED0 A;  3M8P A;  1DRZ A;  2CDR B;  2WB4 A;  3MMC B;  2ZD1 B;  3T1A A;  5A2Q Y;  4OYZ A;  3W66 A;  3GYN A;  3LAN A;  5HMX A;  3S8S A;  2WVD A;  3A1Y G;  5C25 B;  4F4A A;  1W2I A;  1P6T A;  1RT4 A;  1T02 A;  2KT5 A;  3R2D J;  2R2T A;  3PJX A;  4UY8 T;  4JI0 J;  5L9N A;  3PTW A;  3QAE A;  2LA4 A;  4FDF A;  3M6X A;  2YXL A;  1T0T V;  4PPD A;  4Y2C A;  4HAC B;  4CLW A;  3QWU A;  1SV5 B;  3D54 A;  1FKP A;  2FZC B;  2B5J B;  1ZBT A;  4YB1 P;  1XQI A;  2CRL A;  5AT1 B;  2CXE A;  4DL6 A;  2LQJ A;  2ZE2 A;  3IBF B;  3N6M A;  3PYE A;  3F0N A;  4DR1 F;  1YDL A;  2YKN B;  3CJ8 A;  1RB0 A;  2JDJ A;  4OZ2 A;  1RLC L;  1GX6 A;  2W8K A;  4DV5 J;  3PX0 A;  2BE7 D;  2VIC A;  2RQC A;  2HNY A;  3M8S A;  4IH6 A;  3FEY B;  4I7F B;  4YHH F;  2MJU A;  2V6A A;  1BE4 A;  3DM2 A;  3GLJ A;  1RAG B;  3OFH A;  1IBC B;  1IKX A;  5HO4 A;  3ISZ A;  2UVW A;  4KGZ B;  3M9M B;  2CG4 A;  3DXS X;  1TK8 A;  2BKP A;  4K4Z A;  3D6F B;  1IVZ A;  3MEK A;  4DSK A;  4KHM A;  1WC4 A;  2DR7 A;  3V4I B;  2JNJ A;  3Q2S C;  2NPI A;  4CQ1 A;  3SDE A;  2GHP A;  1PIL A;  3OHA A;  4Q43 A;  3CUN A;  4IDK A;  3A13 A;  2DHX A;  3VQT A;  4MJK A;  1TKZ B;  3FSI A;  1I94 F;  2ZBC A;  3I56 S;  1ACM B;  4YB7 A;  3P8B B;  3R7N B;  5HVF A;  2X1B A;  3VAL A;  4X66 J;  5AE1 A;  3GCW P;  4M1K A;  1S1V B;  2BA9 A;  5G4D A;  2ASY A;  3ZZP A;  1UPM B;  2J9E A;  6FD1 A;  2R7X A;  4IR1 A;  1RYR A;  2W2O P;  3FJ2 A;  5KFB A;  3CF5 Q;  3CD0 A;  2HHS A;  4YFU A;  5J2M B;  5F8N A;  3V6D A;  2CPJ A;  4PAB A;  1DJ0 A;  3VTI A;  2XMT A;  2KM8 C;  4AE5 A;  3ZZR A;  2ZH1 A;  1SL0 A;  1GMW D;  3IA0 A;  1IWA A;  3SV4 A;  2NXC A;  3VZH A;  2HS0 A;  2MQQ A;  3QPI A;  3UN2 A;  4LQ3 A;  5EX0 A;  1M5H A;  4NWB A;  4WJB A;  2J7U A;  1CJT B;  3PO4 A;  1YJW S;  3JSB A;  2IDL A;  2R8K A;  3ULH A;  1IUJ A;  3EDR B;  5KFX A;  4LRC A;  2HHU A;  4RO0 A;  1VQ7 S;  2YWF A;  3W8P A;  4C3K A;  3MMC A;  3QRQ A;  1MWQ A;  2ZD1 A;  2DCL A;  5BR8 F;  1WEY A;  1V5V A;  1VMB A;  5KFC A;  2NRE A;  3EPG A;  2WSF C;  1YGY A;  2M5Y A;  5C25 A;  4I1T A;  4O3N A;  2V9K A;  5KG6 A;  1S6O A;  4B3T F;  4DS4 A;  4O0I A;  1JNZ B;  3RAQ A;  4BBY A;  3HJV A;  5EX3 A;  3T6J A;  1XMO F;  3MM5 B;  3G4S S;  2ZOM A;  3AT1 B;  4LSL B;  2L48 A;  4HAC A;  3J80 Y;  1SV5 A;  4JI7 F;  2PI5 A;  2B5J A;  1LEO A;  1IKW B;  2A2C A;  4CDI A;  2GS8 A;  2GQC A;  4QYZ J;  1QUV A;  1RAO A;  3MR7 A;  3OL7 A;  1MMN A;  3LP2 B;  4PPZ A;  2YKN A;  2HUR A;  4DV3 J;  2CJA A;  2G2O A;  2O3D A;  2MZS A;  3H20 A;  1SC4 B;  3TYT A;  4K0K F;  4I7F A;  4F25 A;  2A3J A;  3MM8 B;  4O0N A;  1NDK A;  4GC6 A;  2CPE A;  1YWX A;  3CC4 S;  3MWB A;  2F8E X;  2JSX A;  2PC6 A;  3G82 A;  1Y5L B;  3MTJ A;  3SIP B;  4HYK A;  2C2E A;  2PMH A;  3BZQ A;  1UZD A;  3E3X A;  1JJH A;  4E8U A;  1H72 C;  2FQQ B;  2Y9H A;  1P1T A;  3ZXW A;  4NLO A;  3V4I A;  4PG4 A;  1IJF B;  2RHS B;  2IM3 A;  2RSQ A;  1X0P A;  2UVU A;  3HSJ A;  1B4S A;  2R4F A;  3A8K A;  4ED4 A;  2ZVI A;  3DKD A;  2B4V A;  4RW8 A;  4RU2 A;  1BGX T;  1TKZ A;  1KS2 A;  2GZO A;  2F4F A;  2VOD A;  3MR3 A;  2GA7 A;  2A18 A;  3WIU A;  1IQT A;  2HGM A;  1RT2 A;  3VAH A;  3PFO A;  1U45 A;  5CXT A;  5C42 B;  5F0U A;  3W2V B;  4B3M J;  2LEA A;  2RIL A;  2RB7 A;  1W25 A;  5HMY A;  2UUC J;  1Q8L A;  3MEE B;  4KSE B;  1XR7 A;  2JEJ A;  2IM1 A;  3K5N A;  3M8Q A;  3MMJ A;  3TVY A;  4KGM A;  3WX8 A;  5B0A A;  1UFK A;  2KYX A;  4QWE A;  2IY5 B;  3BSN A;  3EXC X;  2V8H A;  1RHU B;  2VHG A;  3K7R A;  5DG8 A;  3S01 A;  2D3U A;  3NGR A;  4AFF A;  1Q16 B;  1FNX H;  1IN0 A;  4H4O B;  2FJW A;  2RDJ A;  4DR2 J;  1S6Q A;  1AUS L;  2CQ3 A;  2M7S A;  3FKB A;  4FYX B;  1URN A;  1NDL A;  3EWG A;  2IJF A;  3PJ9 A;  3Q23 A;  4RX6 A;  3D6M B;  1CJT A;  1CPZ A;  2J9D E;  1QSL A;  1N5Y A;  1DUR A;  1IBM F;  4KGX B;  4K2X A;  3RB0 A;  2CZ9 A;  4WP9 A;  4EBD A;  2CQH A;  3JTP A;  1R8C A;  2VON A;  3D1H A;  4JI1 F;  4GO7 X;  4GKK J;  4X4T A;  3K0J A;  2MB0 B;  5C7P A;  4ZVG A;  3NAI A;  3SFG A;  2E5L J;  3BGU A;  2H1Y A;  2B7B B;  2VPW B;  4CLL A;  3KHL A;  3QFW A;  2EKN A;  4DQI A;  2IRY A;  1QY7 A;  2Z4P A;  4TVA B;  3MM5 A;  3TOQ A;  4C8L A;  4LSL A;  5D0H A;  1Z1Z A;  2ABY A;  2H4Y B;  2Q1L A;  3D2W A;  4K7Q A;  1B3T A;  5DET A;  1H2V Z;  3C19 A;  2CPH A;  5F8H A;  5GAH U;  2E9T A;  3BBF A;  3K2Y A;  4J9Q A;  2EEY A;  2OEL A;  4WYW A;  3LP2 A;  4OX9 F;  4AUK A;  4NLG A;  1KD1 T;  5HP1 B;  3CB4 A;  1RE1 B;  2VFT A;  1IBK F;  4OJ3 A;  4QIV A;  2L41 A;  2A0F B;  1S6P B;  1LQ9 A;  3MM8 A;  3RW6 A;  2EPI A;  5D4N A;  1N32 J;  1DLO A;  4QU6 A;  4LMZ A;  4UY8 5;  1JLA B;  1U1R A;  4CP5 A;  4CH7 A;  2HND A;  1H7X A;  2XYP B;  4JI2 J;  3NRB A;  2H5I B;  3J7A 1;  2QC3 A;  3PYG A;  4I6A A;  5KFV A;  5J2Q B;  1LNQ A;  2W7O A;  1TL1 A;  4FXD A;  2ZHO A;  4FYY B;  5T14 A;  3QBC A;  1RA7 A;  4R8U B;  1GTH A;  2DNY A;  1RU2 A;  4K4Y A;  4X4R A;  2HAI A;  1FNM A;  2GMH A;  5AXM A;  1J27 A;  2HRU A;  4DV5 F;  5L1I A;  2IM0 A;  2ZWP A;  5ITH A;  2A10 A;  1UWA A;  2FJA B;  4LT6 A;  4NYO A;  1UWB B;  5LSO A;  1S6U A;  1U6Z A;  1VHF A;  2ZH2 A;  3Q86 A;  5F8G A;  4ELV A;  5F9L A;  5C42 A;  4WK3 A;  3QFH A;  5A76 A;  2VF3 A;  3TX8 A;  2LLZ A;  4CLK A;  2GW8 A;  1CVJ A;  4MH8 A;  3QRR A;  2QLB B;  3W61 A;  2E5I A;  4P2X A;  2BJD A;  2WB1 D;  4YY3 F;  3UO0 A;  1FO1 A;  2N82 B;  3W2W A;  3UW1 A;  2VUG A;  4CLY A;  2OI2 A;  3ITH A;  1FFG B;  3UCG A;  1HMV B;  2J6S A;  4NEY A;  3NS5 A;  4H4O A;  4GMK A;  4J9K A;  2NXE A;  1VC6 A;  1RAJ A;  2CPZ A;  2XMJ A;  3GJT B;  4MTP A;  2F4V J;  1HNV B;  3QID A;  1HD1 A;  2M88 A;  1XMB A;  5DGA A;  4KO0 B;  3WQP A;  2FUG 9;  4J9U E;  4DL4 A;  4KHP J;  3D4J A;  1YX2 A;  2AJ1 A;  1YJ7 A;  4X66 F;  2RE1 A;  2K7K A;  1LK5 A;  1SUQ B;  1KNZ A;  1Y5N B;  2AWZ A;  4PYD A;  4ZJQ A;  2I1R A;  2LMI A;  5CYM A;  3GII A;  3OR1 B;  1S10 A;  5HI7 A;  2XBP A;  1RTD B;  2VJU A;  3IG1 B;  3MAA B;  1NLK L;  2J0W A;  4PR6 A;  3PEJ A;  1U2F A;  5HQ8 A;  1CS4 A;  3MM9 A;  4F0K A;  2V67 A;  3KLF B;  1FI4 A;  3MZI A;  1VK8 A;  1NKB A;  2R8H A;  5HQM A;  2IBK A;  1D9F A;  1P27 B;  4O4G B;  2ZC4 A;  3WZ0 A;  1SVD A;  2RD5 C;  5EN1 A;  2JVR A;  1RT7 B;  4LFA F;  2HVD A;  2LKZ A;  2CQ4 A;  2FLO A;  2J7K A;  4M5N A;  2BRL A;  4U96 A;  4TU9 A;  1TV6 B;  1KSP A;  4F7V A;  2CNK B;  4NA3 A;  2LXF A;  3BPS P;  3IBW A;  3FBB A;  4WYL A;  4LVN P;  5JMN A;  4B02 A;  1KTQ A;  3OTC A;  3DOL B;  4EO8 A;  1VBK A;  4AXI A;  4LF8 J;  3PKM A;  5HP1 A;  3I31 A;  2MQM A;  5JUM A;  3CCM S;  3KLE B;  2HEK A;  1G3O A;  1S6P A;  4IFY B;  2XG8 A;  2MZQ A;  2HHQ A;  1N52 B;  4OYB A;  1JLA A;  1TAU A;  1AZS B;  3M8W A;  2ZOF A;  4YDX A;  4IYQ A;  1KHW A;  5D78 A;  1Y0H A;  5J2Q A;  3DRP B;  2DNG A;  2HSE B;  1HR0 F;  3FK4 A;  4R8U A;  2FVC A;  3MOJ B;  1V3S A;  2VFV A;  1KBR A;  4OI0 A;  1KQK A;  2NXN A;  2XZW A;  4YDD B;  2ALZ A;  2GFF A;  5E0O A;  3WDO A;  2VAS A;  3J81 j;  2IA0 A;  2W1B A;  4U67 Q;  3KHG A;  2MKI A;  1UWB A;  3SSR A;  2Y1L B;  2IVM A;  3GFY A;  2UUW A;  4F3M A;  2W7A A;  1N8R T;  4W4M A;  3U1N A;  3QQC D;  3HHL B;  1IKY A;  3KNG A;  4DV2 J;  3IR5 B;  2W24 A;  4LFB J;  5J1E B;  3HT3 A;  4P6Q A;  4X4V A;  4G6V B;  3D68 A;  1M90 T;  4KKO A;  3W9I A;  4KTQ A;  2BJ1 A;  1NAQ A;  2B9Y A;  1WC0 A;  3D28 A;  4WFA Q;  1SKS A;  5B0G A;  1I6J A;  1HMV A;  2CQB A;  3AOD A;  3NGS A;  4HI1 A;  3KUG A;  2YKQ A;  2FVR A;  5RUB A;  3M32 B;  3DFE A;  2HVH A;  1OS5 A;  2KG1 A;  1SIZ A;  4CO4 A;  1S77 D;  5DS7 A;  3U1M A;  1HNV A;  4DR4 J;  3CCJ S;  3KG1 A;  4KO0 A;  1YK9 A;  2B9E A;  4PRF A;  4J90 A;  4N77 A;  2XO6 A;  5J2N B;  1T9W A;  5KFA A;  3PM9 A;  4B3M F;  4M5K A;  2O01 C;  3HMJ G;  1B99 A;  2EI5 A;  1SUQ A;  4B3O A;  1OYD A;  4NMX A;  3MI7 X;  1X5O A;  4HT7 A;  1L3T A;  3VAI A;  2A6M A;  2YKA A;  4XPC A;  1DAX A;  1RTD A;  3VVT A;  3M8R A;  2I5J B;  4KGV B;  3IG1 A;  4A8Y A;  3H5U A;  3MAA A;  3VZI A;  2ZH7 A;  2C2O B;  2GV1 A;  1XNQ J;  4NX9 A;  3BB5 A;  1QUP A;  1B64 A;  4W92 B;  3EGW B;  3FBC A;  3KLF A;  1X9W A;  1GNK A;  3FBE A;  2DH7 A;  2CJ9 A;  1RQ0 A;  4C0B A;  3CC2 S;  3TJ8 A;  1OO0 B;  2BAB A;  1RT7 A;  4TKT A;  3UN5 A;  2D3O 1;  3HJF A;  1X0F A;  3AB4 B;  5L39 A;  5EWG A;  4CNY A;  5BYS A;  1A9N B;  2Z0G A;  3RR8 A;  1SC3 B;  2VC1 A;  4FBT A;  4R0E A;  1J2V A;  1XN9 A;  2R7R A;  4K4X A;  2DXF A;  1M5O C;  4JV0 A;  4ED6 A;  1FWK A;  1DQ9 A;  1FK9 B;  4ZS6 A;  4P73 A;  4XAK A;  3I4P A;  3KLE A;  5KG3 A;  4FKX A;  2LXI A;  4FF1 A;  2HFN A;  3O5T B;  4RUB A;  4ZIW A;  2M4M A;  4QIW D;  2Y8Y A;  1AZS A;  4V19 X;  2DGU A;  1EIY B;  1HHT P;  4V19 J;  3O1L A;  1ZM9 A;  5GAG I;  2AJ2 A;  4KPY A;  4AYB D;  3O2I A;  5EGY A;  1O8B A;  3DRP A;  3KK3 B;  2JEF A;  1T9U A;  3CIM A;  1OSC A;  3DMJ B;  1LWF A;  2F5G A;  1ZH5 A;  2M0G B;  1XIQ A;  2FHJ A;  3K89 A;  4C3L A;  3ZZO A;  2J8S A;  4PYA A;  3IRX B;  4YUD A;  1U1M A;  4O3P A;  4DQP A;  2VDI A;  2Y1I A;  2HPU A;  2R7W A;  4KE5 A;  4XDC A;  2OPR B;  1HKA A;  3I32 A;  2L9W A;  2D69 A;  1JJ2 R;  2VKZ G;  2BKN A;  4Y2K A;  2UUB J;  4ZLN A;  2HBY B;  4PWW A;  1RKJ A;  2K3K A;  2F1F A;  1B0V A;  2IYG A;  4JI2 F;  2MZ1 A;  2CQC A;  3HHL A;  2NXU A;  1VJW A;  5KFO A;  4ZVO B;  2ZJP Q;  5IM0 B;  3MR2 A;  1YG0 A;  2KI2 A;  1ULR A;  3OFF A;  3M2U B;  4DR3 F;  1KLN A;  4XK8 C;  5CAB A;  4DN9 A;  1FWP A;  3SEO A;  2VL1 A;  4MYT A;  2ZBP A;  4GVB B;  1QTM A;  1IKV A;  3BO3 A;  1DFD A;  3MXH P;  3M2V A;  3CJK A;  1LFW A;  5HMZ A;  2AYM A;  3TR5 A;  3NXZ A;  2L3M A;  2DCU B;  2MKY A;  1F6T A;  3BGL A;  3Q8Y A;  3UE2 A;  4CLZ A;  4KAI A;  4LR7 A;  5D0R A;  4JI4 F;  5J2N A;  1SL1 A;  2OFG X;  4IRK A;  1KQF B;  2HNZ A;  5KG2 A;  1ZTT A;  2YPY A;  3PYF A;  3G6Y A;  3DGP B;  3BKT A;  4OFZ A;  4B17 A;  2YNG B;  2AMC B;  4BWM A;  1X31 C;  3S1T A;  2C3Y A;  1YRX A;  5ETQ A;  4AD6 A;  3QO9 B;  3SCK E;  5T7L A;  1U2C A;  2RAQ A;  5K20 B;  4IRD A;  4CO3 A;  4XO0 A;  1WG5 A;  4IQX A;  1KR4 A;  1TMM A;  4NLU A;  4KJI A;  5DLG A;  4Q45 A;  1B7Y B;  1U47 A;  1WC6 A;  3KLH B;  1TL3 B;  4DCJ B;  4JI8 F;  3CMA S;  3QRP A;  3R5C A;  2Y8W A;  2KHC A;  4N8O A;  2HHW A;  3IM9 A;  3TAP A;  1HW9 A;  1BWV A;  3EYZ A;  2CWK A;  2VG5 A;  4Q8F A;  2N4D A;  4CO1 A;  3GFH A;  3VAK A;  1CBK A;  3IO1 A;  2B3T B;  3DDN A;  1JLG B;  3W5X A;  3NAH A;  5E3P A;  5K14 B;  3LF0 A;  2WK4 A;  2VA2 A;  2EFN A;  2HAF A;  3Q24 A;  2QA1 A;  2W4P A;  2WW8 A;  4JP8 A;  4J37 A;  2N3L A;  3AB2 B;  4O3O A;  1FEH A;  4I4B A;  3DLG A;  3OTB A;  1QJH A;  1WI8 A;  3HDS A;  1GX5 A;  2K1R A;  1ZYQ A;  4WFZ A;  2QX0 A;  4NI2 B;  3SI8 A;  3SYZ A;  2E29 A;  2YKO A;  3FVY A;  1RTI B;  1CUL B;  4LR8 A;  4LUB A;  3W9J A;  3HI9 A;  1R8B A;  3HX9 A;  3KK3 A;  3C15 B;  1MN9 A;  2CQ2 A;  3TO8 A;  3L7U A;  5HAO A;  3R27 A;  1UTA A;  2HW3 A;  4HH1 A;  3BPD A;  3AD8 C;  4L73 A;  4A8K A;  1QSS A;  4Y3C A;  3CUL A;  2PFF B;  3IRX A;  4LF8 F;  1RTJ B;  1REG X;  1B0T A;  3N6L A;  4DL2 A;  2ROE A;  3CJ0 A;  2GML A;  2OPR A;  1RCO B;  4PQU B;  3MED B;  5KFD A;  1BXN A;  4PEO A;  2E9R X;  1D1U A;  3SCI E;  5ETO A;  3CT9 A;  1H38 A;  2OKQ A;  1R0A B;  4EGL A;  4NLV A;  1X5P A;  1DQ8 A;  3F44 A;  2SXL A;  1FJG J;  2XYH B;  3M2U A;  4PG5 A;  1SQE A;  2EFO A;  5GVQ A;  1V6H A;  3PV8 A;  2AX0 A;  5K8P A;  2Z56 B;  2PII A;  3FRZ A;  4EEY A;  4RJV A;  4TN2 A;  3NCP A;  4R5P B;  2B6A B;  4YR3 A;  1F9F A;  3U1L A;  3U7J A;  4A8X A;  2XLI A;  2CPI A;  3N6N A;  1VBY A;  1U8S A;  4IG0 B;  2LQB A;  1F5C A;  3AOB A;  3BGO P;  3N9U C;  4MFB B;  1U7L A;  3DGP A;  2RU9 A;  4I6Y A;  3PJW A;  2YNG A;  3MD1 A;  1QDU B;  2J5A A;  4FF3 A;  2OEK A;  4LF4 J;  1GEH A;  2AGP A;  3DRX A;  3QO9 A;  2LQ5 A;  3MUT P;  1HA1 A;  4AQY J;  1S1X B;  3B78 A;  4MK7 A;  2HQ3 A;  2ZC3 A;  4DR7 J;  1FKO A;  3MFH A;  4C8K A;  3N79 A;  3DXB A;  5B0D A;  3GJQ B;  2CJQ A;  2HFV A;  3CCT A;  1TL3 A;  1D3W A;  3KLH A;  3MD3 A;  1ZAV A;  4C11 B;  2KXH A;  3I5A A;  3T1H F;  1RLD A;  3L9Z A;  3R5A A;  1HNX J;  1PG5 B;  1VHI A;  2V4R A;  5LJ5 Y;  5C24 B;  6AT1 B;  3CJ2 A;  4C3M A;  3GFX A;  3IC1 A;  3JXO A;  2VB6 A;  1P1L A;  4DHV A;  1LKZ A;  1N36 F;  3CED A;  1JLG A;  2W4C A;  3KJN B;  3TUZ C;  1HNZ J;  1MN7 A;  3RUB L;  4HTI A;  1TUV A;  1O5J A;  2YKM A;  2IJR A;  1X4D A;  3FUY A;  5IT4 A;  5CQG A;  2Q66 A;  3DU6 A;  3KYL A;  1GTE A;  2KFZ A;  2CFX A;  1SH0 A;  1FJ7 A;  2W9C B;  1IR2 A;  5C5J A;  2ZH5 A;  4PXD A;  4NI2 A;  1P9Q C;  1D09 B;  2WBR A;  4J9V A;  2HQG A;  3M05 A;  4M94 A;  4Y65 A;  5KOX A;  2ROP A;  2ILY A;  1UEK A;  3C15 A;  4RL1 A;  3PXG a;  3GV8 B;  2GVZ B;  5JVH Q;  3PX4 A;  2ILZ A;  2C2N A;  3KLG B;  1UJ5 A;  4J9P A;  3QAU A;  3NMR A;  2KXN B;  5LXR A;  3JQM A;  4IH5 A;  3J81 U;  2YBV A;  2W7P A;  5KFE A;  4NRU A;  3BO2 A;  4PQU A;  4LJM A;  3MED A;  4L6V 3;  2OGU A;  1O51 A;  1GT8 A;  5LMN J;  1UFL A;  1SKU B;  1VYA A;  3KLI A;  1PJ5 A;  1HQU A;  2P9G A;  4F3O A;  2CQD A;  3K5L A;  3H42 A;  2M3D A;  1R0A A;  5I3U B;  1QAI A;  1QTN B;  2CZV C;  2HQC A;  1AT1 B;  2AJ0 A;  3BF4 A;  4X4O A;  3M1V B;  2EKY A;  4X64 F;  2K7J A;  4CO2 A;  5AE3 A;  3AAW B;  2PT0 A;  3ZZY A;  2WON B;  2YWG A;  1KWM A;  4F3Q A;  3K5M A;  1S79 A;  4USJ C;  4HDG A;  1H2U X;  4C7Q A;  1BQX A;  1VIX A;  3BH7 B;  1Y10 A;  3W62 A;  3MR5 A;  1F9E B;  2B6A A;  4EUV A;  3MUR P;  1BMQ B;  2CDQ A;  4DPO A;  2DNP A;  4DL0 C;  1BWE A;  8RUC A;  1VQY A;  2BXJ A;  3NGD A;  3DDK A;  1SKR A;  2ZEJ A;  4MFB A;  4CIO A;  4QR1 A;  1S57 A;  4UQG A;  2LEB A;  1SC1 B;  2J0X A;  3TQE A;  4I67 A;  1VQ9 S;  2DVI A;  3N01 A;  3TUI C;  1FD2 A;  5L1K A;  1SJR A;  1YJT A;  4USH A;  3IR7 B;  1S1X A;  3MF5 A;  4EO6 A;  2EVZ A;  2RRA A;  1WSR A;  2EBG A;  3HVT B;  2RT3 A;  2K3I A;  5FJ4 A;  4OV1 A;  1KEK A;  4D3H A;  1UCN A;  1NKE A;  2QA2 A;  2WTF A;  1YIJ S;  4C11 A;  3W65 A;  1VRU B;  2OPQ B;  1TUW A;  4B9T A;  5LT5 A;  3MHY A;  1W26 A;  4ID5 B;  4X65 F;  3Q8P B;  7AT1 B;  1SH3 A;  3AH6 A;  3NGT A;  2AEM A;  4U8Y A;  2BJ3 A;  2JHE A;  1EX8 A;  5A8W B;  3CMQ A;  3UPF A;  4CI0 B;  2V4J B;  1RWW B;  2E1R A;  3TUP A;  4FYV B;  4DWI A;  1RP5 A;  2W9C A;  3VAF A;  3K17 A;  2WW4 A;  2AP6 A;  3N28 A;  4OMF G;  2M70 A;  2VG7 A;  2BEF A;  3GIJ A;  4NCA A;  4FKY A;  4UOH A;  5I42 A;  2IA6 A;  3AXK A;  3QT5 A;  1GQE A;  2GVZ A;  4OI6 A;  1EQM A;  3M2R B;  3SQG A;  3KLG A;  5D3G A;  5K8O A;  1U09 A;  2DNO A;  2MXY A;  3AD9 C;  5FLX U;  3QJP A;  2LQ9 A;  2LQ8 A;  2H48 B;  2QLW A;  3IS9 B;  3JB9 k;  4IG3 A;  5B7W A;  1VRT B;  4GKJ J;  3TQ1 A;  4RU9 A;  2IBO A;  1FVS A;  5I3U A;  2ZBQ A;  4ATN A;  2XO7 A;  2N7Y A;  5A6W A;  2XS7 A;  2XSF A;  1M5K C;  1BQN A;  4DV6 F;  2DR5 A;  4QIE A;  4PZV A;  2YKP A;  3HVR A;  2AJ4 A;  3Q89 A;  2NSB A;  2WON A;  1T9Y A;  2P2C B;  4WKR A;  2I8E A;  1K47 A;  1RWN B;  2UVR A;  4X62 J;  2BW7 A;  2AZ3 A;  4ZJL A;  2MZT A;  1PKU A;  3POT A;  1UKU A;  3IGV A;  1RTH B;  3N5B A;  3BH6 B;  4WII A;  2Q6B A;  2QLJ B;  3VGT A;  1KQG B;  1VQP S;  4CLS A;  3OJS A;  2EBE A;  2OPS A;  4OZN A;  4M5D B;  1FJG F;  1AXQ A;  1WF2 A;  4K5S A;  3ELH A;  4DLE A;  1HW8 A;  1KFD A;  3CCQ S;  1NZA A;  2QA4 G;  3JTN A;  5L46 A;  5ADZ A;  2BVZ A;  3HVT A;  5BJR A;  1NPR A;  2UUA J;  4K4T A;  3LPE A;  1HNW J;  5ETT A;  2FJE B;  1WOS A;  2ZKU A;  4OHX A;  2PO4 A;  4DV7 J;  1LWE B;  3Q8Q B;  3OFE A;  3UFC X;  1VRU A;  2OPQ A;  2ACM A;  2C2M B;  3JQK A;  4DJB A;  2XMW A;  4N5S A;  1GAO A;  5HJY A;  4MKV A;  4LF9 J;  3OTD A;  4JV1 A;  2G2Z A;  2ZH9 A;  3F73 A;  5SZT A;  1VQM S;  1FXD A;  3D3B J;  3NOG A;  2NYH A;  4ECW A;  2QT7 A;  4LSN B;  3PO5 A;  4EZ6 A;  1UP1 A;  1OMS A;  1UAW A;  1H7W A;  4WZM A;  3BSO A;  1L3V A;  4F4X A;  4FYW B;  4I64 A;  3RYL A;  2JLG A;  2GX8 A;  2V4J A;  2XS5 A;  1RYS A;  3MR6 A;  3V6H A;  1U8W A;  1UW4 A;  2KM8 B;  4OYO A;  1TUG B;  1QAY A;  3AD7 C;  4HHU A;  1A6L A;  2CQ1 A;  2BUN A;  3D1O A;  1RHR B;  1HNX F;  4JUZ A;  4AL6 A;  4WK1 A;  3TZZ A;  4YQW A;  3FRY A;  4RW4 B;  1JWW A;  3OLA A;  1VR6 A;  1DTT B;  4Y6I A;  2ZZT A;  4DQR A;  4C8Z A;  3LTO A;  1Y5I B;  4DV1 F;  4IH7 A;  3ZC4 A;  4M5I A;  2ZH3 A;  3ENQ A;  3GV5 B;  1X5T A;  4KRW A;  5ETK A;  4EFA C;  3K5O A;  4BC7 A;  5HBM B;  1TMJ A;  5D15 A;  4NML A;  4CH0 S;  2VPY B;  2WSC C;  1VRT A;  4IO9 Q;  4NCG B;  4ZPT R;  1EQ0 A;  4HR2 A;  3GWC A;  3VGV A;  1PCA A;  2CQP A;  4K50 A;  1YBA A;  3DGV A;  4FBU A;  2PMZ D;  2DD8 S;  1S59 A;  4DR1 J;  4A47 A;  2FJB B;  4UST A;  4QR2 A;  1T7P A;  2GGP B;  1EP4 A;  4LQ9 A;  2W9B B;  2LEC A;  1FX4 A;  2B8Q A;  1S12 A;  2P6T A;  1NK8 A;  4B3S F;  2XLJ A;  3DLB A;  1IBL J;  4YHH J;  3RB6 A;  4Y0F A;  1G4C A;  3L7O A;  4F02 A;  3BBC A;  1PYO B;  2L9D A;  2ASJ A;  4TYB A;  2VG6 A;  3GSD A;  5LMN F;  3D9B A;  1VOM A;  1RTH A;  3EX7 B;  2KL8 A;  3DC2 A;  5H9E J;  1E6Y B;  2AEF A;  3JYT B;  3IN5 A;  3G6V A;  2PE8 A;  2HS4 A;  4M5D A;  3AJD A;  3TZX A;  3TJ9 A;  3GG1 A;  1SJ1 A;  4RKU C;  2BE2 B;  2D7S A;  4D3G A;  3I55 S;  1REV B;  3LGN A;  3KUH A;  1KQS R;  1WKL A;  2G4B A;  1I94 J;  3FZB A;  1HPZ B;  4ZCK A;  3HKZ D;  3OSN A;  2ATL A;  2XZD B;  4PXE A;  1ZTW A;  3BSA A;  4F26 A;  3IXQ A;  3CJ3 A;  3BKF A;  4JV5 F;  1LWE A;  2ZUG A;  3UR0 A;  1K1Q A;  3CE8 A;  1CJK A;  4ZK7 M;  5E3A A;  2RUS A;  4OX8 A;  4P71 A;  4ZIV A;  3BYP A;  2GIQ A;  4C8Y A;  2A2D A;  4M5J A;  3TAM A;  5KFP A;  4LSN A;  5G0R B;  5CD4 A;  2HHV A;  5ETR A;  4FP9 A;  4H4M B;  2QIF A;  3NWG A;  1F1B B;  3GB0 A;  1HNI B;  4RBU A;  4F0M A;  1FTC A;  2DR6 A;  2C2Z B;  4O23 A;  1RWV B;  2DIT A;  2U2F A;  3PRD A;  4QWD A;  5JJB A;  5DZ6 A;  3MAQ A;  2L9N A;  3E01 B;  3MM7 B;  5KFQ A;  3PZP A;  1DBD A;  4EU0 A;  4ZVH A;  5BYR A;  3RB3 A;  4RW4 A;  4I68 A;  1DTT A;  2X1F A;  2APO A;  1FEE A;  1LWC A;  3TZW A;  3U02 A;  2PN6 A;  3B4M A;  4B3T J;  3FEZ A;  3GR0 A;  5ETS A;  1XMO J;  2XI2 A;  1V5I B;  2DPI A;  2AW0 A;  1Q5V A;  1C1B B;  2FVQ A;  1X4G A;  4U7U D;  4DOZ A;  2ZHA A;  2XC9 A;  1O0P A;  1VQ5 S;  3DNC A;  1FRJ A;  4NLY A;  2NUU G;  5IV3 A;  4FXV A;  3EM1 A;  3M8P B;  4NCG A;  5D0E A;  2WRM A;  2MQN A;  4P7T A;  2VPX B;  1XNR F;  4EI2 A;  5I3P A;  4KYZ A;  4DZ6 A;  3G9C A;  2CVE A;  4ETZ A;  2Y1J A;  2MPU A;  1RAA B;  1HWK A;  1JLC B;  1LXJ A;  4NLS A;  4IR9 A;  1UL3 A;  2KZZ A;  1FFS B;  1IM4 A;  1QVG R;  1RT4 B;  4MK8 A;  3WC2 A;  2LA6 A;  2HRT A;  1ZPW X;  4PG6 A;  3Q22 A;  1Y11 A;  3CJ5 A;  2DR8 A;  6FDR A;  2OTJ S;  1N88 A;  4WP8 A;  2HQF A;  3SV3 A;  4CH1 A;  4MKY A;  1PSD A;  2UU9 F;  1IM6 A;  2BOP A;  4ZVF A;  2V8D A;  2VOP A;  1E6Y A;  3GV7 B;  3C3L A;  4M5L A;  2EK6 A;  1WDD A;  3D7S B;  4HHJ A;  2V34 A;  4OJ1 A;  2DXE A;  4PUO A;  4OYI A;  1N0U A;  4RLE A;  3OVS A;  2BE2 A;  3UD5 A;  3CCU S;  1KLM B;  2HHH J;  2H4W B;  2MZR A;  4X4U A;  5EHH A;  2HK3 A;  2OPP B;  5HLF B;  4K4S A;  2EC2 A;  3R3T A;  1XTZ A;  5A0Y B;  4Q8E A;  4DCO B;  2LFV A;  1UJ6 A;  5IV4 A;  2QL5 B;  2R7Q A;  4KB7 A;  2FLP A;  2V2K A;  2VBY A;  1NCL A;  3KDN A;  5KG1 A;  4MK9 A;  4FVC A;  3RRH A;  3A8I A;  1WJ9 A;  3PCO B;  3CDA A;  3S6E A;  3BYR A;  2CYY A;  4F67 A;  3FCW A;  4IDK B;  4C9D A;  4HVZ A;  1WHW A;  2R3V A;  1XBW A;  1S7I A;  2KJW A;  2OFH X;  4C97 A;  1KDN A;  2UUA F;  4KPC A;  4OZJ A;  2ADC A;  1HNI A;  2V63 A;  2FLL A;  1RCX B;  5GAH I;  2JRS A;  2AJF E;  3GYX B;  1V3Z A;  4J9S A;  1IBM J;  4DV7 F;  1WEZ A;  2GC8 A;  1YLX A;  3OUY A;  2LDI A;  3GZ7 A;  3I5C A;  2XEX A;  3OTO J;  3V6D B;  2QTW A;  2DTJ A;  4JI1 J;  1HQE B;  3LP1 B;  3E01 A;  3THV A;  3C16 A;  1S1W A;  3Q8V A;  2R8I A;  3RAM A;  4NL5 A;  2NLW A;  2VFU A;  4WTY A;  1SIW B;  2YH0 A;  2P5V A;  3VHQ A;  2DNM A;  4NAS A;  4DFK A;  2KFN A;  4E98 A;  1M1H A;  4O3Q A;  2YWH A;  2V50 A;  1UEU A;  1NBE B;  1HHQ A;  3JTO A;  3OW2 R;  1R0B G;  2KH9 A;  2BM1 A;  1C1B A;  5M2R A;  4ENO A;  3GYG A;  2NQP A;  5D0G A;  2B0G A;  4JI6 F;  1ZZF A;  3TP2 A;  4KR0 B;  4WFX A;  1FT8 A;  1FE4 A;  1R6Y A;  1HWI A;  3K58 A;  3DOK A;  2MQ8 A;  4IFV A;  1XWL A;  1N0V C;  1QD1 A;  2M9K A;  1Q86 T;  4F4Y A;  3HFZ B;  1YSJ A;  5LSL A;  4OX9 J;  1E6V B;  1JLC A;  3FBF A;  3CCR S;  3LA0 A;  1IBK J;  1OYE A;  2ZDP A;  3HSZ A;  1WUU A;  3BRE A;  2FPH X;  3NCQ A;  3MPU B;  4NLR A;  1L3U A;  5K5M A;  1T3O A;  1MWZ A;  2OJ3 A;  1NK6 A;  2JJ4 D;  4F04 B;  4ZLJ A;  3M8Y A;  4QZV B;  5M2U A;  1FCA A;  1R31 A;  2JEI A;  2ZBI A;  1Y3K A;  5GME A;  4OI4 A;  3HHE A;  1RJJ A;  3Q0A A;  5I3Q A;  1FRX A;  1JLB B;  1SQG A;  4NLQ A;  3TVZ A;  1N56 A;  4DUY J;  1XER A;  4N41 A;  1L5U A;  2FVS A;  3BJY A;  1N5Q A;  3VAM A;  3W1Y C;  4C98 A;  4ANE A;  4YR0 A;  2MY8 A;  3PNI A;  3HZE A;  1HWJ A;  3R5D A;  2W4D A;  3H25 A;  5J1N A;  2AKW B;  5LXY A;  2QLX A;  4LF7 F;  3W5Z A;  4OHY A;  1NJZ A;  1RI7 A;  4DX6 A;  4HL9 A;  1X4C A;  1KLM A;  3BGR B;  1D9D A;  2VV5 A;  2ATC B;  1TU0 B;  2FJD B;  2MQL A;  5DRK A;  3RGI A;  2Y0S D;  1IBL F;  5GMD A;  4ED5 A;  2CIM A;  3PIO Q;  4LFC F;  5K9F A;  2M2B A;  4FPI A;  4M5G A;  2OPP A;  5HLF A;  2E66 A;  2LCW A;  5KG0 A;  3G82 B;  3LGM A;  5A0Y A;  1NUE A;  2EK1 A;  5JXS A;  2HBQ B;  1PYS B;  1C4A A;  4ECU A;  1NK7 A;  4MKA A;  4YY3 J;  1BLU A;  3HVW A;  2DGT A;  1UZH A;  2ASL A;  4I56 A;  3T5K A;  4TY8 A;  4ZVP B;  1RHM B;  1NK0 A;  2DT9 A;  5IZH A;  4HHH A;  4RW8 B;  1NME B;  4DV0 F;  5HAT A;  3UDC A;  2OML A;  2CQ0 A;  1APS A;  2R2S A;  1RT2 B;  2XY7 A;  1VQO S;  1HLW A;  3W9H A;  4F36 A;  4B3R J;  1VQK S;  1XR6 A;  3QSY B;  1VJQ A;  1VQ6 S;  3M8Q B;  1C0U B;  3ZTR A;  1S49 A;  3HCX A;  3G96 A;  1HQE A;  3LP1 A;  3LPY A;  4A46 A;  1T9T A;  4Q2M A;  2ZZM A;  2KVQ E;  4DSF A;  2NS1 B;  1AA1 B;  1R89 A;  3O8W A;  2AGO A;  5D4O A;  2MMY A;  1LV5 A;  4LRE A;  2MGZ A;  1S6Q B;  2PEH A;  2GJ2 A;  4USU A;  3I82 A;  3FEX B;  5ETV A;  2P9C A;  3PG9 A;  4K2J A;  5KFI A;  1R7I A;  4LFA J;  5KFM A;  4OHW A;  4USV A;  1T94 A;  3NP5 A;  4FPR A;  4NE9 C;  2YNI A;  2ZUA A;  2E5H A;  1ZM4 A;  1S72 S;  1N5Y B;  1X4A A;  5KTQ A;  1UJ4 A;  2HZA A;  2PDA A;  1SJ3 P;  1VI7 A;  2BJ8 A;  2JVO A;  2AV5 A;  4USW A;  3N5F A;  1NRK A;  3KMQ A;  1PAU B;  5CHC B;  3TJA A;  2B7C B;  1E6V A;  3CVK A;  3Q83 A;  4LBI A;  1KHV A;  4ZPV R;  1FJE B;  4FS1 A;  2CVI A;  2GMJ A;  4IUF A;  2FDN A;  3ETM A;  3UNY A;  4B08 A;  4MIW A;  4DF4 A;  1L3S A;  1CLF A;  1U4B A;  3NEK A;  1LW2 B;  4K4W A;  1GMW A;  4QPT A;  1JLB A;  2GQ2 A;  3QIP A;  4WFB Q;  3AXM A;  5D4L A;  1XJW B;  2DIS A;  1HR0 J;  3E51 A;  5AXL A;  4CYU B;  1UW9 A;  3M4X A;  1FNO A;  2DGW A;  2DO0 A;  3KNA A;  4KBI A;  4M63 A;  4URS A;  1CC8 A;  3UDE A;  2WVE A;  3BR9 A;  2KFY A;  3BGR A;  3VQS A;  2C28 A;  4FVM A;  5H1S V;  2PMW A;  4N56 A;  1DLO B;  4QYR A;  2B8P A;  2KKH A;  1MU2 B;  2HND B;  4ZP7 A;  2BMB A;  5FDL A;  2FLN A;  2FJV A;  2FHM A;  1C1C B;  2BJ7 A;  5H9E K;  3UI3 A;  1NH8 A;  3TAQ A;  4G3I A;  4X2B A;  4MIB A;  1TL1 B;  5CCM A;  4ZP8 A;  4MAK A;  4HI2 A;  4PCQ A;  3NOC A;  2B43 A;  1K1S A;  4I2P B;  3EDQ B;  3F56 A;  2Z2Z A;  2IHR 1;  4HEA 9;  1PJ7 A;  4A48 A;  1S0N A;  4RW6 A;  5IT9 U;  4RWX A;  3OT9 A;  2O1P A;  2AD9 A;  2HHH F;  1RAB B;  1U6B A;  2C3M A;  2OO4 A;  2R8G A;  3BN7 A;  3AQP A;  2HFO A;  3LGH A;  2O67 A;  4XPE A;  2NPF A;  2V9W A;  3ILJ A;  1IXK A;  4HDH A;  2J9C A;  5DQI A;  4H4K C;  2JLE A;  3G6X A;  3CD6 S;  1C0U A;  4J7C A;  2HFS A;  4KIA A;  1RXO B;  3W2W B;  4UOF A;  3ITH B;  2CNN B;  1I5O B;  2E7X A;  3KJF B;  3SBM A;  5F8M A;  2IRU A;  4ZDN A;  3ZTQ A;  2LU1 A;  2I9S A;  2QGF B;  3ONQ A;  2JLF A;  1T9V A;  2HMI B;  4LF6 J;  1WDT A;  2F63 A;  4ED7 A;  5CYM B;  3NBP B;  1H3D A;  3MPW A;  1WKJ A;  1WF0 A;  2HK2 A;  3OTO F;  5KFJ A;  2OP5 A;  4Y2I A;  4EWT A;  2ACY A;  4ZMM A;  2KZM A;  4JV2 A;  4OIX A;  3T5J A;  4ZN1 A;  2UXC F;  3CCW A;  1VQ4 S;  1CS4 B;  3MM9 B;  1JLQ A;  3OL8 A;  3RBE A;  2G0I A;  2N7C A;  4DR5 J;  2GVD A;  1BQM B;  4TXS A;  5CCL A;  2QSF A;  2B4U A;  1LW2 A;  1WHX A;  2I38 A;  2K06 A;  2MLZ A;  2HLT A;  3IMQ J;  3LO3 A;  4NXM F;  2OAU A;  2YTC A;  3GIR A;  3Q8R B;  2ZM6 J;  1HAR A;  2UZA A;  1OIA A;  1TKX B;  4ZPD A;  4NA1 A;  3WX4 A;  3KJV B;  3P5B P;  2YQ1 A;  2XY5 A;  4CYU A;  3CJ4 A;  4LF2 A;  2AX1 A;  2WAQ D;  1YJN S;  3BS9 A;  4UUW A;  3W5Y A;  3UD4 P;  3PKY A;  2XQC A;  3B82 A;  3RG6 A;  4Q44 A;  3IRW P;  4ZVT B;  4UUX A;  3H5S A;  1RT3 B;  2R42 A;  3AA8 A;  1MU2 A;  1RSC A;  2RIJ A;  2C2R A;  1X5S A;  1FRK A;  4L72 B;  1C1C A;  2MY7 A;  2YWE A;  3OR2 A;  4DUY F;  4ER8 A;  4ECV A;  3I0S A;  2B4P A;  3A3O B;  5IQQ A;  4ZPA A;  1JX4 A;  4DL5 A;  4DR3 J;  2MKJ A;  4ELU A;  5BYQ A;  4I2P A;  3HHK A;  3G87 A;  4QW8 A;  3RRK A;  3GSI A;  2VQE F;  2ZH4 A;  5F0W A;  5IT9 Y;  2IDE A;  4MT1 A;  4F4Z A;  4JI4 J;  1R43 A;  1DY3 A;  2OEM A;  4ZOS A;  1IKY B;  2KYZ A;  3EJM A;  1Q5Y A;  1DZ5 A;  4DFM A;  1H98 A;  2PA8 D;  4BDP A;  2HHP A;  2JFD A;  1MLA A;  2RS2 A;  3LAK A;  5DDQ C;  1HQ2 A;  2FC8 A;  1N4L A;  4KKO B;  3AOA A;  3GCX P;  2HVI A;  4ERD A;  2LYV A;  4OZ1 A;  5ETP A;  4IOA Q;  4S0M A;  3TA2 A;  1BY9 A;  4ZCM A;  1FXR A;  2Y1R I;  3KDO A;  5KT5 A;  2C3P A;  3JQJ A;  1YJU A;  5LMU F;  4TYA A;  1ROF A;  4ZPB A;  3RU0 A;  1U0H B;  3W8G A;  2H5J B;  1EAY C;  4JI8 J;  4B3R F;  2MKH A;  2ADB A;  2HMI A;  3K8V A;  2CAJ A;  4PG8 A;  3RJM B;  1OPZ A;  4B3O B;  5F8L A;  4OYW A;  4Z7Y A;  2DNL A;  2D3Z A;  3NBP A;  4CWB A;  2RRB A;  2D41 A;  4JYA F;  1XMQ F;  3PW5 A;  1KFS A;  4V1A k;  1JXL A;  2WOM B;  2XMA A;  2ROG A;  3TAR A;  4YEA A;  1Z2L A;  4OZ0 A;  3CJT A;  4RW9 B;  2D1C A;  4DPX A;  1FRI A;  1BQM A;  1MSW D;  1H2T Z;  4RNF A;  5DO2 A;  3KG4 A;  5ETM A;  5JVG Q;  5A2Q U;  5KFH A;  4Y00 A;  3DHX A;  3OLB A;  3QJL A;  4CNZ A;  4ZA1 A;  1WAC A;  1S9F A;  1NH7 A;  5KAK A;  2WZ1 A;  1WOR A;  1S1T B;  1TKX A;  2JX2 A;  2FGO A;  1XC9 A;  1YJR A;  1UEV A;  2FZK B;  5AJ3 F;  3KJV A;  4I6W A;  2CPY A;  3KLV A;  3IWL A;  3CCV S;  1K9M T;  3LAL A;  2N3O A;  1HBN B;  2XMM A;  4O44 A;  1RU1 A;  2MKK A;  1RT3 A;  3CME S;  3MM6 B;  1HWU A;  3SSQ A;  1YRT A;  3P6Y C;  3BDE A;  2R2U A;  3OQ2 A;  2A6O A;  3HFK A;  5KT2 A;  4JI3 F;  4KV8 B;  1TR0 A;  3H40 A;  3VCD A;  3HSD A;  1WF1 A;  4CLT A;  2ZOG A;  2PGC A;  1LWF B;  3TEG A;  5BXI A;  1TVR B;  3V2U C;  2HWH A;  4NLT A;  4QIF A;  2VPZ B;  3QNW B;  4C0H A;  3TUJ C;  3CDE A;  3THP A;  1MWY A;  5DQH A;  3I0R B;  5HMW A;  3NNH A;  3N0V A;  4BLG A;  4F4W A;  4G1I A;  1MG7 A;  9ATC B;  3P49 B;  1WOP A;  2M8D B;  3PEH A;  3MMB B;  1J5E J;  1BD6 A;  3SZ2 A;  1Q81 T;  2XWX A;  5I4M A;  2J0Q D;  2JL9 A;  4Q0B A;  3EGN A;  2ZNY A;  3EVO A;  4KGK A;  2Z58 B;  4QQB A;  5MAO A;  2CJY B;  3ZFV A;  1Q53 A;  2X1G A;  3UCU P;  4TU8 A;  4KC5 A;  1IKV B;  1GFW B;  2HHX A;  5FD1 A;  4OZL A;  1U1P A;  1U0H A;  3M2V B;  3CJK B;  5HRO A;  4OYM A;  5DGB A;  3KHR A;  4B9U A;  1X4E A;  4NXN F;  3OD2 A;  2VZ9 A;  3HKW A;  3T1H J;  4X4S A;  1C0T B;  2G2Y A;  3H90 A;  1S4E A;  1N34 F;  2VD3 A;  2HHT A;  2HNZ B;  4Y2A A;  4A8O A;  2QE5 A;  5IC4 B;  4B9M A;  3IBC B;  3MOZ A;  2DGO A;  3EMT A;  2KN4 A;  1KVJ A;  3J7Y I;  2E1A A;  4L76 A;  1N36 J;  4OHV A;  2HFZ A;  1SXL A;  2XB2 D;  3ZZT A;  2XCP A;  1NHU A;  1MW7 A;  5T7L B;  3BQ1 A;  3EGZ A;  4DUZ J;  4ECS A;  4PXC A;  3V81 B;  3SFU A;  2WOM A;  3MPV A;  5L1J A;  4RW9 A;  3GTY X;  3I87 A;  1CJV B;  2V94 A;  2J7W A;  2CAD A;  5B0B A;  4FF4 A;  1VIO A;  4Z37 A;  1RT1 B;  1Q8K A;  1U2R A;  4LF6 F;  1FTR A;  2HIQ A;  1S1U B;  3I9Z A;  1N48 A;  1QE1 A;  4XDD A;  3LQV A;  2F7V A;  3K59 A;  2IJN A;  2VG5 B;  5E33 A;  4DPU A;  1S1T A;  1TL5 A;  3L95 X;  1X9M A;  5HVH A;  4UTG A;  3VGU A;  3C6T B;  1CQN A;  1QAX A;  1JLE B;  3DLH A;  5L9X A;  1RK8 A;  3FCH A;  3FNN A;  2ALY B;  3J80 U;  1S76 D;  1RHQ B;  1HBN A;  4RNH A;  3UQS A;  4DN0 A;  4LRD A;  1B7F A;  3NGK A;  3AJ1 A;  4DR5 F;  4ZJO A;  4RNM A;  3DLG B;  1PC5 A;  3R7B B;  4ZP9 A;  3G8Q A;  2K1R B;  3MM6 A;  1I3O B;  1RWP B;  4OHZ A;  2MLY A;  1KON A;  2OHD A;  3DYA B;  4L74 A;  2ZM6 F;  1AW0 A;  4KV8 A;  5KFG A;  4X64 J;  3NNA A;  1KVI A;  1TVR A;  1PO6 A;  3C6U B;  4JI5 F;  4NLD A;  4DI6 A;  3I6P A;  2LP4 A;  3CWJ A;  8AT1 B;  2QO3 A;  3ICL A;  1KOO A;  3NNC A;  2XCA A;  4ICL B;  1Q79 A;  3TEH B;  3I0R A;  1K44 A;  4DX5 A;  1UA0 A;  1T05 B;  4U6P A;  1OPI A;  4P9S A;  5IFM A;  5EUH A;  1HBU B;  3CDW A;  1PYT A;  1S5Z A;  4N47 A;  3G6E S;  3MMB A;  3H7H B;  2P6S A;  3M6V A;  4PWD B;  1ZET A;  2WHO A;  2RQK A;  2VH7 A;  2PSZ A;  4F2S A;  1YQH A;  3AA9 A;  4EMD A;  1RBL A;  3HF5 A;  3L4B C;  9RUB A;  4K4U A;  1NJY A;  1VQN S;  2AJQ A;  3MCN A;  1JXV A;  1NPK A;  2B56 A;  1FF2 A;  2XNQ A;  1NK4 A;  4DPT A;  5B0F A;  4CO0 A;  4J5O A;  2Z57 B;  4RUA A;  3PHE A;  4NZ7 A;  3VAJ A;  4F2R A;  4DQQ A;  5GAD U;  4U8V A;  2V0N A;  1C0T A;  1PAE X;  3D0I E;  1VBX A;  3KMS A;  4X65 J;  3MUM P;  4OX7 A;  1FDN A;  4A8Q A;  3EUN A;  3C14 B;  2C42 A;  3T6B A;  3UDL A;  2AYG A;  3MGJ A;  1WEX A;  1U0S A;  5C2C A;  1NB7 A;  2DKO B;  5DG7 A;  4IO1 A;  2HLU A;  3V81 A;  2KT3 A;  1SL2 A;  3DRY A;  1RDR A;  1FKO B;  3OL9 A;  1FRL A;  2A1B A;  1CJV A;  1TK5 A;  1TTH B;  3P4U B;  1FRM A;  2YWW A;  4P7V A;  3WC0 A;  1Z4U A;  4IOB A;  1N5V A;  3ENA A;  2PI4 A;  1RT1 A;  3A8J A;  1HL6 A;  1RWK B;  4WXO A;  1S1U A;  3VGS A;  3OSP A;  2WCX A;  3FQL A;  4DSE A;  4QWC A;  2FVP A;  2UXD F;  1HD0 A;  1T95 A;  3C6T A;  2FTR A;  2B51 A;  1JLE A;  3B8H A;  2YKM B;  3T1Y J;  2XNR A;  4C8M A;  3D0G E;  1CC7 A;  4WXW A;  4MYU A;  1HYS B;  4X4N A;  2YQ3 A;  1LOU A;  1WTF A;  1HHS A;  1URR A;  3ZTO A;  5IQ6 A;  4DU7 A;  3AOC A;  2XMU A;  1N33 F;  3FDS A;  2KHD A;  1Q0N A;  3EE3 A;  4WU2 A;  3DYA A;  1RHK B;  2DNH A;  5MLC V;  2F9J A;  3A8E A;  1H6K X;  1U26 A;  4DV6 J;  1WD6 A;  3UVJ B;  1JQG A;  1RT6 B;  2JOQ A;  3C6U A;  2IYI A;  3DLE B;  2CPX A;  1ZA2 B;  3TZY A;  2QG9 B;  2C3O A;  4CT8 A;  2CG8 A;  2MHE A;  2F9D A;  4ICL A;  3H2U B;  1FDB A;  4ILM A;  1NZ8 A;  1T05 A;  3KLI B;  4X4P A;  3DCA A;  1HQU B;  2WSE C;  2DPJ A;  1HBU A;  1KTV A;  3FMB A;  3G86 A;  2R7T A;  4PWD A;  3H8Y A;  1G7C B;  4OZ5 A;  3BV8 A;  3HSG A;  1PIE A; 
#chains in the Genus database with same CATH homology
 4OYW A;  5IV3 A;  4OYP A;  3MAA A;  1AB8 A;  3MR7 A;  1TL7 B;  1Y10 A;  1CJK B;  5D0E A;  3C16 A;  4CLL A;  3C15 A;  3C14 B;  4CLU A;  1WC4 A;  2GVZ B;  4CLZ A;  4OZ3 A;  2GVD B;  4OYA A;  4USW A;  5D0R A;  3R5G A;  1CJT B;  5IV4 A;  2QV6 A;  1YBT A;  5D0H A;  1U0H A;  1CUL A;  1WC0 A;  4OYM A;  3C16 B;  4CLW A;  1WC3 A;  4OYB A;  4CLT A;  5D15 A;  4P2M A;  1AZS B;  1CJU B;  1CJV A;  4NI2 B;  3UVJ B;  3G82 A;  3ET6 A;  5D0G A;  1Y11 A;  4OYX A;  1CUL B;  1WC5 A;  4WPA A;  4WP8 A;  3MAA B;  1TL7 A;  4CLP A;  2BW7 A;  4CLK A;  3C15 B;  1CS4 A;  1YK9 A;  3C14 A;  2GVZ A;  3G82 B;  4OZ2 A;  4P2X A;  2WZ1 A;  4CM2 A;  1CJT A;  1WC1 A;  4UST A;  1WC6 A;  4CLF A;  4CM0 A;  1U0H B;  4CLS A;  1FX4 A;  1FX2 A;  4USU A;  4P2F A;  4CLY A;  1CJK A;  4OYI A;  4WP9 A;  2W01 A;  1CS4 B;  4OYO A;  1AZS A;  1CJU A;  1CJV B;  4NI2 A;  4USV A;  3UVJ A;  1YBU A;  2GVD A;  3ET6 B;  4OYZ A;  4WP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...