5LXYA

Structure of the minimal rbm7 - zcchc8 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-binding protein 7
publication title Structure of the RBM7-ZCCHC8 core of the NEXT complex reveals connections to splicing factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 78
sequence length 78
chains with identical sequence B, E, G, I, K, M
ec nomenclature
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lxyA00
2MZJA 1H6KX 3G8SA 3CCES 2HVZA 1K8AT 1VBYA 2MQMA 4A8XA 4CIOA 3H2UB 2KYXA 1XN9A 2I38A 2AYEA 5DDPC 2RS8A 2G1DA 2CPHA 4Y00A 2MKJA 1OPIA 1WWHA 2M2BA 2EK1A 3I56S 1URNA 2MMYA 2Q79A 3R27A 3VALA 2DK2A 2LXIA 3MURP 3VF0B 2G0CA 3NNHA 2CJKA 3NNCA 4LIRA 1HA1A 3VAIA 3CMES 2CQ1A 2VONA 5D77A 5GAHU 3CC7S 2CQ2A 2QEXS 3FEYB 4YOEA 1X4EA 1NO8A 2CQHA 3BO4A 1VQLS 4W90B 3NMRA 2KXNB 1KOOA 4IUFA 4LJMA 2DH8A 1H2TZ 1N88A 3MUMP 2M8HA 2MSSA 2MJUA 2MQPA 1FXLA 1WI6A 2XNRA 2CQDA 2E5GA 2E5JA 2DGUA 3S6EA 3EGNA 3L3CA 3CUNA 1SJRA 3RW6A 3VAKA 3NNAA 3CCMS 1WF1A 2GHPA 2XB2D 3SDEB 1A7GE 4PKDB 3CXCR 1WI8A 2KT5A 1X4FA 2DH7A 2OSRA 4YUDA 2LMIA 5GVQA 2DGOA 2XNQA 2MZTA 2KH9A 5DDRC 2LECA 2J8AA 2AYGA 2DGXA 2DNPA 3HI9A 4P6QA 3PIOQ 5IM0A 1VQOS 2MJNA 1VQ4S 2JX2A 2MPUA 3VAGA 1VQ8S 4TLQA 2LKZA 3S7RA 2MQOA 1X4AA 3CCLS 2CPZA 1WTBA 1KC8T 1WHYA 3MUTP 1VQ5S 2MXYA 2MB0B 1U2FA 2M9KA 1ZH5A 2DO0A 1HD1A 2VOOA 1Q81T 2X1GA 2MYFA 4RU2A 1YITS 1P1TA 1X5OA 2JVOA 2OJ3A 4OZ1A 2OTLS 2XS7A 3LPYA 3H2VE 2RU3A 4C4WA 3J7ZT 4WFBQ 2M7SA 2L41A 3NS6A 3N9UC 2DISA 1U1MA 3G9CA 4TU8A 3IRWP 3PIPQ 4EGLA 1NJIT 1U1RA 5LXRA 2MGZB 4FXWA 4WFNQ 4TU7A 1JJ4A 2U2FA 3P49B 1FJCA 1WEXA 1WHWA 1OIAA 2MKHA 1X5PA 1X4GA 3VAMA 3OW2R 2V94A 2E5IA 3SXLA 4UQTA 1VQ9S 2U1AA 2RS2A 1HD0A 1X0FA 1FT8A 2DNYA 5MLCV 3VAFA 1N52B 3P6YC 2DNHA 2CQIA 2PE8A 1X4BA 2J0SD 5HL7Q 2CQGA 2CQBA 3CMAS 3VAJA 2AYMA 1SXLA 1AUDA 2K3KA 3SDEA 2RQ4A 4PRFA 1WHVA 3BO2A 1U1LA 4QU6A 2YKAA 1QM9A 1YTYA 5H1SV 2DGTA 3Q2TC 3UWTA 1S79A 3DXBA 2N3LA 1P27B 2MKKA 1UAWA 4LMZA 3MUVP 3MD3A 2HGLA 3U1MA 2ADCA 3CCSS 4QPTA 1X5SA 2X1FA 4FXVA 2I2YA 1U1QA 1RKJA 1Q82T 2L9WA 2MQNA 1U1KA 2HGNA 2RRAA 1M5VC 2HZCA 2RT3A 2XS5A 2MQQA 2KRRA 5EN1A 2LCWA 2QA4S 2JRSA 2MKIA 2CPFA 2CPIA 2KI2A 2DNNA 3S8SA 1WEYA 2A3JA 1PO6A 1K9MT 1SJFA 4ZKAA 1W2BR 1S72S 2VODA 1VBXA 5FJ4A 2MGZA 1X5TA 1WG5A 2KM8B 1HL6A 1L3KA 2D9OA 2UP1A 3EGZA 4J5OA 2LQ5A 3J7YU 2EK6A 2RQCA 1M90T 1ZZFA 4OZ0A 4F26A 2DH9A 1H2UX 2CPDA 1N8RT 3JB9k 3MD1A 2LYVA 2F9JA 1YWXA 4ERDA 2KVIA 1YJWS 4UY8T 4ED5A 3CCVS 2FPHX 2FC8A 4WFAQ 1YJNS 3MI7X 2FC9A 2MY8A 3P3DA 3Q2SC 2OSQA 3G4SS 2JWNA 4CH0S 5JVHQ 3HHNB 1X4CA 1JJ2R 1SJ4P 4M5DB 3CD6S 3BS9A 2NLWA 2KXFA 2K8GA 2PEHA 1YI2S 1YHQS 2DNLA 2KXHA 3US5A 3G71S 5HO4A 1DHMA 3THPA 2N3OA 2KHCA 1D8ZA 2CQ4A 3U1LA 1PGZA 3K0JA 1OO0B 2YWKA 5DDOC 2D9PA 1KD1T 2DNMA 3MDFA 1SJQA 3CCJS 3IWNC 2L08A 5GAEU 1VQ7S 3B4DA 2LXUA 3RW7A 1VQMS 2NZ4A 3UE2A 5DM6Q 5LSLA 2DHAA 2KU7A 3TO8A 2LA6A 2G4BA 1M5PC 3R1LA 5CYJA 5CXTA 2ERRA 5LJ5Y 3TYTA 3CF5Q 5LSOA 1DZ5A 1DBDA 2DO4A 4BS2A 2QFJA 3G96A 3CULA 2MSTA 4WF9Q 2LEBA 1WEZA 3S01A 2M8DB 4IOAQ 2AD9A 2X1BA 2RRBA 2LEAA 1N54B 3G6ES 1YIJS 1WELA 2DIVA 3THTA 4V19X 4CH1A 2KN4A 3SMZA 3DLLQ 1VQNS 3CPWR 5GADU 2MKSA 1DRZA 4WKRA 3UD4P 2CPEA 4C7QA 3ZZZA 2DHSA 2AYBA 2CPJA 1A9NB 1QVGR 2DHXA 3CCUS 1R8HA 3ZZYA 2KM8C 2MQLA 2CQPA 2DNZA 5LJ3Y 2CQ0A 4Z2XA 5LXYA 1Q7YT 3B4MA 3TP2A 3CCRS 2N82B 3CTRA 2MKCA 2RVJA 2YH0A 2MZ1A 1VQKS 1FNXH 1X4DA 2DGVA 2XSFA 5IFMA 1F9FA 1VC6A 4QQBA 1KQSR 2DGSA 1FHTA 4WCEQ 1YJ9S 1R8PA 2ADBA 2F9DA 2RUGA 2RNEA 1JJHA 2EVZA 2FHOB 3CCQS 5GAGU 1FO1A 1CVJA 4QU7A 4WIIA 1VQPS 2MHNA 5D78A 1BY9A 1NU4A 4W92B 2DNGA 3VAHA 1ZZNA 4U67Q 1FJ7A 1RK8A 1VC5A 1U6FA 2ZJPQ 3NS5A 4C0OC 1WG1A 3UD3P 3R1HA 2D3OR 4IOCQ 3D2WA 4F25A 2MZQA 1M5OC 1WF2A 2M70A 2YH1A 1OWXA 2LA4A 2DNKA 1D9AA 2OIHA 3MOJB 2CQCA 4CQ1A 2DNOA 3I55S 1VQ6S 1H2VZ 2DITA 1FJEB 2M0GB 2CQ3A 2KFYA 5DDQC 2CPXA 1UP1A 2KRBA 2DB1A 2N7CA 1WHXA 4Y0FA 2FY1A 3FEXB 1KOHA 2DNQA 2MZRA 2M4MA 2ZJRQ 1U1OA 2E44A 3CC4S 2M52A 2F3JA 2CPYA 5BJRA 1U1NA 1VBZA 4TU9A 2M88A 3CC2S 2ZJQQ 2J0QD 2B0GA 3P5TL 1M5KC 1M1KT 2HYIB 2HGMA 1K73T 5DM7Q 5ITHA 2JVRA 1UW4A 2J76E 4IO9Q 2OTJS 3LQVA 2YTCA 1U6BA 1WG4A 2DIUA 1WF0A 1O0PA 2DGQA 3ULHA 2E5HA 1JMTA 1X4HA 2MY7A 3BO3A 5IQQA 3UCUP 1QVFR 1VC0A 5CA5A 2DGWA 5JVGQ 1SJ3P 3UCGA 3MXHP 1UFWA 2VOPA 2KG0A 2XS2A 2X1AA 1Q86T 1B7FA 3BEGB 5IM0B 2KG1A 5DETA 2DHGA 3UCZP 2BZ2A 1U1PA 2DNRA 5GMKa 2SXLA 1G2EA 3V4MA 3EX7B 2GO9A 2BOPA 2MZSA 2WBRA 4YB1P 4PR6A 3G8TA 2O3DA 4F02A 1IQTA
chains in the Genus database with same CATH superfamily
1TQLA 2XGPA 2ZWOA 1LWCB 1RT7A 3LA0A 4F36A 2CPHA 1JNZB 1WWHA 2OPPA 1GEHA 4CM0A 2LXIA 2NSCA 2QN6B 4DR6J 2R7RA 3CMES 5GAHU 2KYZA 4YOEA 1SL1A 3O5TB 4RNNA 1H2TZ 5B0EA 2ZH2A 2HHTA 1FTRA 3KLHB 1PIEA 1SJRA 3HHKA 3MPUB 1U24A 4LRCA 4YN3B 2W2OP 3MR6A 2L9NA 4CM2A 4R5PA 2OP5A 4RNFA 2KFZA 3NL0A 2KZMA 2AGPA 2WRMA 1BWVA 2M9KA 2ILZA 5L1LA 4ECYA 2HNZA 3ENQA 5BYRA 2OJ3A 1MU2B 2P6TA 2X3GA 3M6UA 1QD1A 3IS9A 3OR2A 4ZPBA 3NS6A 2B4OA 2OEMA 3C2PA 3V4IA 4CLZA 3QT7A 2BKNA 4DL0C 1WD6A 3TOQA 3F41A 4IOBA 4OX9J 3ILOA 2P2CB 1BHNA 2RHSB 4Q45A 4P74A 3I87A 4TYAA 4ZP7A 2RF2B 1XNRF 2H4WB 1WKJA 2CIMA 1Q8IA 1QAYA 3JQMA 4YB5A 2LLZA 2AF6A 2J7WA 3AXMA 3N5BA 3UNGC 3NCRA 2DGTA 3Q2TC 4LF7J 4YDXA 1JLEA 3CCSS 2VBWA 4KHPJ 1ZM3A 2QLXA 3LP2B 1JLQA 2HGNA 3BB5A 1RKIA 3MAHA 4K5SA 2A3JA 2XMAA 4CO5A 1W2BR 4Y6IA 5L38A 4G1IA 4WIQA 1AUSL 2KM8B 1KQGB 4M5MA 1PG5B 5DQHA 3J7YU 4X4OA 3FQLA 1UA1A 5C5JA 5CZVA 1FKPB 5C25B 2AWZA 1YWXA 2FJWA 2KVIA 4ED5A 2J9DE 2D3O1 4PYDA 5T41A 1V3SA 2UUBF 1RBLA 1OJ4A 1YI2S 5ETVA 3VZHA 4AUKA 4CT8A 2JEIA 1NEEA 3WHIA 3DLKB 3K0JA 2PGCA 1VGYA 2ALYB 1ZAXA 4DR2F 2L08A 5GAEU 4DN9A 3DOLA 9RUBA 4IFVA 3HZGA 4JI5J 3CO9A 4FN5A 2V8GA 5LSOA 2BABA 4W4MA 4HDGA 2P9EA 1Y5IB 3HFZB 2YNFB 3GONA 3QGPA 3D1OA 4X65J 2WHOA 2WB1D 4ZVRB 4FKYA 4OLOA 3ISZA 1S6PB 3T1HF 4WKRA 4ZVGA 4DFPA 1FWKA 3VGUA 1NKEA 4OYBA 3ZZYA 1T0TV 5A8KA 3MCSA 4DL7A 1VQKS 5DS7A 2UVVA 3BH7B 3T6JA 2ZBCA 3OL6A 4ED6A 3ZTOA 1Y5NB 2CJBA 3R6LB 4KPCA 3HVTA 3LO3A 4HHHA 1TZ0A 3GFXA 4NA1A 3ZXWA 1FJ7A 1G4CA 2DXFA 5KFCA 3T41A 2LA4A 2OIHA 3DFEA 3K5NA 5GAHI 3I55S 3MEKA 2CQ3A 4P9SA 1IXKA 4NMXA 2RU9A 1HHQA 1WHXA 5E33A 2ROEA 1RA6A 2ASJA 6AT1B 4WKYA 3M2VB 2HFSA 2UXCF 1XTZA 2XSJB 1FRLA 3BYPA 1GAOA 1FDAA 4DR3F 3NWGA 5E0OA 3FZ2A 5KFDA 3OQ2A 2AEMA 1QLNA 2OI2A 3DKDA 4RWWA 3DGPB 2VOPA 3VTIA 3NGUA 3HX9A 1FA0A 3BEGB 2KG1A 2CRLA 2EKYA 3UD5A 1KFDA 2B43A 4F50A 1IQTA 2O3DA 3KHRA 4Z37A 1VBYA 4CIOA 3TRGA 3M2RA 3ZZPA 2ZOFA 1AB8A 2VJUA 2I38A 5H9FJ 2LXFA 1SKRA 3MPWA 1UVMA 2YKMB 5E2QA 4UOGA 1XR6A 2RB7A 3CIMA 1RXOB 2CNKB 4B17A 1XNQF 3PX0A 2XI3A 4YY3J 2Q6BA 2VL1A 2FJXA 3CCTA 4ITSA 2E5LF 2BANB 4J91A 2WVCA 3HVAA 1NH8A 2ZOGA 2EI5A 3RW6A 5IC4B 5G4DA 2ROGA 1UCNA 2BX6A 2VFSA 2J8AA 3HD1A 3HI9A 4DFMA 4F4ZA 1ZM2A 2V68A 2V8VA 2GA7A 2B9XA 4RU2A 4B08A 1MMDA 2XS7A 3PW7A 2ZZMA 3IWXA 2OEJA 3J7YI 3KK2B 1IBMF 1S1UB 4L6V3 5C24A 3OXLA 3GV5B 2M7SA 1U1MA 3IRWP 2BJ1A 1U0SA 4TU7A 3C14A 1N5YB 3EM1A 2C3PA 2HFNA 2W8LA 2I5JB 2R8JA 3BN4A 2C28A 4ZLNA 2QA2A 3LGMA 3MM7A 1T9VA 3Q8PB 3HFVA 1CBKA 4NLRA 4DX8H 2FJAB 4LREA 3AQPA 5GAEI 1D9FA 2YKAA 1Z4UA 2PIIA 3WBZA 1B64A 3TAMB 3JSYA 2JOQA 1N32J 1G6BA 3DRPA 4L75A 4P71A 5B0AA 1U0HA 2HZCA 5E3AA 2UXDF 3VGTA 1MWYA 3VVUA 4ZKAA 4K5RA 4IH7A 1WG5A 3ZTSA 3PR4A 4QYRA 3PX4A 5BR8J 2RQCA 2YWEA 4C11A 2YWHA 2DYAA 3JYTB 3LGHA 2FJBB 2FC9A 3H98A 1D1UA 4EWTA 4QWEA 4MK7A 4OX7A 1NHVA 1NCLA 2IRYA 4PEOA 1GXLA 4J7CA 2XY7A 2ILYA 2CA9A 2CFXA 5HO4A 1F2GA 2YQ0A 4M5JA 4ID5A 2VQFJ 2D9PA 3P45B 2DNMA 2B51A 4K4UA 4DG1A 4A8SA 3M30B 1NPRA 2CDRB 3IGVA 1A6LA 1SC1B 2OHDA 4RW7B 3TO8A 4U95A 4ECTA 5KFTA 3BBCA 2WW8A 4DUZF 4KSEB 2V63A 3RBDA 3PFOA 1CSJA 1WEZA 4K0KJ 2QL9B 3H40A 1Y5LB 4N76A 1HWUA 2FJEB 3DLJA 2ZWPA 2BE2B 2PSZA 3DYAA 3ZZZA 1A9NB 1ITPA 2ALZA 1BQNA 3ENAA 2WB4A 5LXYA 4OI6A 3B4MA 4WTYA 1BQXA 1X7VA 1S0NA 3MR2A 2ZKUA 1WORA 3SQOP 1RP5A 2F9DA 4WP8A 1DLOA 1TL1B 2JHEA 5CQGA 1X8DA 4LVOP 3B6BA 3R1HA 2HHSA 3FUYA 3K89A 4K2JA 3Q8QB 2BW7A 4B9SA 1U49A 2DITA 4OI4A 1C4AA 5KT6A 2CPXA 4MK8A 1N5TA 2MHEA 5CYQB 1KOHA 4FS2A 5AJ3F 3SCLE 1IJEB 1XEZA 4HEA9 4L3KA 2A6OA 2QA4G 4XTTA 2FVRA 1S99A 3KFWX 4WFZA 2FVQA 4KFBA 1UFKA 3TUPA 3CDWA 4ALZA 1SI9A 4O3QA 2JVRA 5C42A 3KXDA 1O0PA 4PWWA 2VG6A 3X3UA 4J9PA 4F3QA 5KFRA 1CLFA 1RDRA 3R2CJ 1VK8A 4K50A 4M5HA 2WZ1A 4YQWA 1FX2A 3HHLA 4M94A 3QLHB 3SFUA 4RBUA 3GR1A 4PR6A 1RTDA 1DTQB 1EARA 1EX8A 4RX6A 3SBMA 3E51A 4ILRA 2V0NA 1JKHB 5LL6d 4OHWA 3I56S 4H4MA 5CH7B 2E1AA 2VFUA 3ZO7A 2ZH4A 3M32B 2GMLA 2BV3A 5DLFA 4JUZA 2VONA 1X4EA 2CQHA 1ZA1B 3GYNA 4B3RF 2HWIA 2FJDB 2LVWA 3D67A 5J2MA 1DQAA 4OZNA 4CWBA 4DQIA 1C0UB 4RW4A 1HBMB 3WIUA 2IA0A 1XMOJ 1CS4A 1NPKA 1QAJA 2OSRA 4RW6B 1GFWB 3RJMB 3H0PA 3VAGA 2MQOA 4B9LA 4CLUA 2GAGC 2V8DA 2MXYA 3MMAB 4HHJA 4DV3F 2Y1IA 2BQRA 3K59A 3H2VE 5HVHA 2BM0A 3QT5A 1X60A 5I3UA 2HMIA 2DISA 1SKUB 2HNDB 3GG1A 3WQPA 3SYZA 3I5BA 1U6ZA 4USVA 3HF5A 2V94A 2YNHA 1TU0B 4JP8A 4LSZB 4ICLB 3MR5A 2U1AA 3RGIA 1V9OA 2PMWA 1SL2A 4AL6A 4UY85 2QFIA 3MAAB 3Q24A 1ZETA 3D6MB 3CMAS 3T1AA 2W1BA 1SXLA 1F5AA 4Q44A 5J2PB 4FDFA 4CLKA 1LK5A 2Y3YA 4RUHA 1MMLA 1TL4A 1RTIB 3KJVA 3DDKA 3U27A 4MYUA 1P1LA 5F8IA 4QR2A 4OYPA 4V1Ak 2CJAA 3W62A 1XMQF 4L72B 3W2VB 3U1MA 3GLJA 4U7CA 2ZOMA 3MM6A 1M5VC 3T1YJ 1QAIA 3OJUA 4AQYF 2YQ1A 1K9MT 3PVXA 3HVWA 1P8GA 2OD4A 4LF2A 3TUZC 3TQ1A 5EX3A 1M90T 1HNZF 1FK9B 1W25A 1YBTA 2KJWA 3MECB 4RR5A 4WU2A 3FQKA 3CCVS 4J9QA 1PJ5A 4ZP6A 1RT5A 2NYIA 2WONB 4USWA 4QWBA 3M9NB 4ZJOA 2PMZD 1F0XA 3PJ9A 1RHRB 3MFIA 3N5FA 1F3FA 1R8CA 4NLXA 1HNIA 2B4PA 3US5A 1SV5A 3DMJB 3L09A 2ZM6F 1JLFA 5L1IA 2QYCA 2XY6A 4JBCA 3H7HB 4GMKA 4RNHA 2V69A 1KD1T 4CO0A 1N33J 4ZP8A 1VQMS 1CULA 4EMDA 2B9EA 2QSFA 1M5PC 3CF5Q 4DJBA 3DHXA 3MEDB 1B0VA 4FYYB 3CULA 2BXJA 2IBOA 3GG0A 2MQ8A 2M8DB 4LUBA 3KNAA 3T5KA 1DFDA 4ZN3A 5CYMB 3G6ES 1EB0A 1DRZA 3EDQB 3QAUA 4C7QA 2VIHA 2QLBB 1S48A 4ANDA 1RHUB 5RUBA 2CQPA 3NRBA 3BDEA 3J7A1 4O4GA 2KFNA 5HAOA 4JI4F 1YBUA 2MZ1A 2I0XA 1UPPA 2C22A 4BBYA 3DLGA 4DR4F 3KLFB 4WIIA 1GXUA 1HHSA 1CJUA 1VQPS 3Q83A 3IRXB 5E5NA 1I94F 2ASYA 1D9AA 4I7FA 3M8QA 4ZN1A 4KE5A 4LT6A 3J81j 5HN0A 1IBKJ 3PJWA 5HQ8A 4A8KA 4KGVB 3M2UA 4ZCIA 3MMBA 1EKSA 3HKZD 2AEFA 4DV0J 3V81A 3ILJA 4NZ6A 2YTCA 4NLQA 3W2WA 1LW2B 4NA2A 2QT7A 3FCVA 3UI3A 2OPRB 1S7IA 3N28A 1FRIA 2NPIA 3QIPA 1QE1A 2C2OB 1OYEA 2B8QA 2DNRA 4ES3A 2X3DA 1LQ9A 3HSZA 4U7UK 2BA9A 2IVMA 2BOPA 4K4YA 3G8TA 1EIYB 2MZJA 4K2XA 1UEVA 1GMVA 2CG4A 1DY3A 4Y2IA 2M2BA 2VD3A 2IC3A 2HS4A 3M1VA 2DK2A 3QGGA 3RR7A 4NXMF 1B70B 3CJ2A 4IKAA 3CC7S 4X66J 4ECQA 2JDJA 3MUMP 1HPZA 2VQEF 4A47A 1RB0A 1LXNA 1WI8A 2WVFA 2WOMB 3HMJG 2KH9A 2EFNA 2OPPB 4PXDA 1VQOS 1UMJA 3VV2B 3E8OA 4R0EA 1Q5VA 4WXOA 1H98A 2V4RA 4DPWA 2R2RA 3HLUA 1P1TA 4PCQA 3RB4A 4LF9J 3QFHA 2CADA 4DR1F 5D8HB 1XIQA 1RTJA 1WHWA 2R42A 3HHLD 1IKVA 1X4GA 4J9UE 4Q2MA 2GV1A 3MR7A 4TQSA 1E6VA 2W9CA 4EBEA 5KG1A 4ZLJA 4C3LA 3TANA 2G0JA 4B9MA 4RJVA 2LDYA 2GQ2A 1CEZA 2ZNZA 1XWLA 3NKYA 4F8RA 3KJNB 3PY8A 3CCWA 4ED3A 1WDTA 2F8HA 3D4JA 3J7Z5 1RHQB 3A8EA 2Q1LA 3V4IB 4EZ9A 1UW9A 1XERA 4RL1A 4CLSA 3MMCB 2AZ3A 3N79A 2O01C 2PMHA 1WC0A 2F8EX 3LTOA 5KG4A 1WSVA 1X5TA 1YQHA 3FEZA 1F6TA 3W3SA 5D3GB 1Q53A 1P9YA 1VIOA 3S1TA 1EAYC 3PNIA 5IXUA 3ISNC 4IDKB 1H7WA 1KLNA 4PG6A 4Q8EA 1ZS6A 1KKHA 3JTOA 4CH0S 4MIWA 1X4CA 5ETRA 2AV5A 4M5DB 3M6XA 4FF1A 4JV0A 4CLFA 5AE2A 4NX9A 3JSRA 2K06A 4G1PA 3JSMA 1JK9B 1HQEB 2RRNA 4F4KA 2LXUA 2GVZA 2B56A 2UXBJ 3D9BA 4JV5J 3DOKA 2JLGA 3AOAA 1RWOB 4B9UA 2OPQB 1LEOA 4DR6F 3IWLA 2VB6A 4KH1B 1VHIA 3QSYB 4CYUB 5A0YA 3THTA 3DLLQ 2VPZB 2ZD1B 1C1BA 2CPEA 1HNXF 3H20A 4IYQA 2RSQA 1S6UA 4FBTA 2V67A 4D3HA 4N77A 2LQJA 1RYSA 1NKBA 4IFVB 8ATCB 2HVEA 4WCEQ 2EBGA 1R8PA 5J1NA 2RUGA 1K1SA 3IG1B 2HW3A 5DG9A 3J80Y 2MHNA 5D78A 1GX6A 3I5AA 1I1GA 5KG0A 2BE7D 3NS5A 1LWFB 1YX2A 2IRXA 4F25A 2JH3A 2V8HA 5A8KB 1VQ6S 4KQZA 1UP1A 5B09A 1YZ7A 4PPZA 5BYQA 1AYEA 2CJ9A 3TA1A 1UKUA 2FLNA 1FRHA 1REGX 2VG7A 2E44A 2QO3A 2ZH5A 4DUYF 2V9KA 4M8LA 3A8KA 1NB7A 2LP4A 1S9GA 3H5SA 1M1KT 3LUYA 5ITHA 3V6DB 3IMQJ 4KO0A 1GXTA 3SCKE 2R4FA 3AA9A 4GVBB 1FDNA 4RUBA 3ULHA 1CJKB 3F73A 3LPEA 2I8EA 2ZEJA 2ROPA 3K2YA 4M5LA 1CJTA 3SQGA 4KHPF 1Y3KA 1K1QA 4WK1A 3UCZP 4OYMA 2IMWP 4ED4A 4OI2A 2SXLA 2IPOB 1JLCB 3G6XA 1EQMA 4X4PA 2HSEB 1PC4A 5DZ6A 4OFZA 1N6QB 1H6KX 1VDHA 3CCES 4ECSA 1RAGB 1OY6A 1CJVA 3GB0A 5KFMA 3I96A 3CJKA 3QAEA 3FCWA 1S4FA 1VI7A 3VALA 3GJTB 1TVRB 3NNHA 4LIRA 2UUCJ 3VAIA 4ZHRA 3OL9A 2K7JA 2KVQE 3BO4A 2C2NA 3VVTA 2HBQB 3O1LA 2DH8A 4OI3A 3CDBA 2MQPA 3R7NB 5HMWA 2HQIA 3FFIA 5HQMA 4UW2A 1HR0J 4WPAA 1A7GE 3EVMA 1RISA 1TK8A 2DR5A 1SC6A 4P7TA 1HIYA 5HMYA 2DNPA 2AGQA 2A2DA 4RBTA 1BQMB 5K9FA 3S7RA 1DARA 4G1QB 2F1FA 3OLAA 1MWQA 3I0RB 1Q81T 4I6AA 4DV1F 2R7XA 1FCAA 2JVOA 4KHMA 1FKAF 1RAOA 4GC6A 3PYGA 3A13A 3LOUA 3DRSA 5DGBA 3J7ZT 2RDIA 1JLBB 5LMUF 3QT8A 3TAQA 5A8RA 3DOMA 3R7SB 5H9FK 4XPEA 2BEFA 3TZYA 4CI0B 1TP7A 2L3MA 3LP0A 1S1TA 2FDNA 4M5NA 1NZAA 1T9WA 4B3TJ 2VV5A 3K5MA 2FVSA 1TKXA 1RCXB 1WTFA 4UQGA 1N34J 2BDPA 1SPBP 5MLCV 1LWEA 3MM8A 3H4BA 2AYMA 3QJPA 2XHCA 3DM2A 3C19A 4DX6A 1S1VA 2RJZA 2UUAF 4JI3F 3M6WA 2NXEA 2YX1A 5H1SV 3EICA 4R0JA 2ZC4A 3BQ0A 4BLGA 1P27B 3J7AN 4QWAA 1ROFA 2ADCA 3RRKA 3KKFA 3HFKA 2I2YA 1ACMB 2BJ3A 5EN1A 2IM0A 2CPIA 2JFKA 4X62F 1LFPA 5CD4H 3ZZRA 2FHKA 1N0UA 5KOWA 4E98A 4MFBB 5DLGA 1H3DA 4KKOB 3PYDA 2DH9A 4F26A 1VISA 3O3LA 1FKOB 4LFAJ 2GVDA 3FZBA 2BJEA 1YJWS 2HFZA 4DU7A 5EWEA 1YJNS 1LK7A 2QC3A 3P3DA 3QWUA 1IKXA 4B02A 3G4SS 2F4FA 3BKTA 1S97A 4A8MP 2WSCC 1QJHA 4YB7A 4DF4A 2GQQA 2NZCA 4OL8A 1UEKA 3D7SB 2ZDPA 3BGLA 5LMNJ 2DNLA 2AP6A 4A8OA 3SEOA 5IT9U 4ECWA 1PGZA 2V2QA 1YK9A 3MDFA 1VQ7S 1HNWF 4OI1A 4B3OB 2PA3A 1ELOA 2KU7A 2LFVA 2VZ9A 5LJ5Y 4HACA 5KFBA 2DR6A 2D3ZA 2HFOA 3FC9A 2LEBA 2D1CA 2Z58B 2ZVIA 3QJLA 2IM2A 4MKYA 4RPFA 5A8WB 1RHMB 2DIVA 1S6OA 3ONQA 1S76D 5GADU 2MKSA 4DL5A 4CH7A 3IP0A 4ID5B 1TL7A 2JC1A 4DSJA 4DV6J 4OV6A 1S1XA 1QVGR 1JLGA 4DCPB 1R8HA 1V5VA 5HVFA 3QFWA 1XR5A 2DTJA 4AYBD 2ZVSA 5I4MA 2FIUA 4N8OA 4DSLA 4NXNF 3F44A 1QTMA 4JYAJ 1GTHA 4DCJB 4WFXA 2DGSA 1TL3A 3MHYA 4JI1F 1BGXT 2RNEA 4M5IA 3HO1A 4OYOA 5DQIA 3NBPB 3BSOA 2CYYA 4PPDA 1WG1A 3UDLA 3BJYA 2IM3A 2XMMA 3KK1A 3TUIC 4F7VA 3ADAC 3DN9A 3QGHA 1HYSA 2KFYA 5B0CA 1VK3A 2QJ3A 3W5ZA 5KT2A 4KV8A 2PC6A 2FJVA 2AJ2A 2BJDA 4OHVA 4X84A 2M5YA 1Z1ZA 4IG0A 3R5CA 4TU9A 1VRUA 2B0GA 3TA0A 2OPSA 1M5KC 2WSEC 2DRDA 4DV4J 1GT8A 3ENVA 1T94A 2GMHA 4R8UA 1VMBA 5HP1B 1YJVA 2CKWA 4LBIA 2Y1RI 2E5HA 1D09B 4IR1A 1RAFB 3GJSB 3KHHA 4X4NA 3MXHP 5KOXA 1Q86T 1N32F 3DRRA 5KG6A 2JFDA 3DRYA 3OBIA 2QLWA 2YBVA 3EX7B 1Y10A 3Q23A 4BC7A 3G8SA 5T14A 2ZZNA 4RLEA 2BRKA 4O0NA 5MAOA 3H2UB 2XG8A 1PILA 1FDBA 1B7YB 1RWWB 5BR8F 3HT0A 2Y8YA 4ZVEA 3MURP 5IS2A 2CJKA 2R9LA 4DV7J 5KT7A 1TV6B 2VF3A 2CQ2A 2F8MA 1NO8A 1NJWA 2UU9F 2WCXA 3NMRA 4NRUA 3KLGB 3M9MB 2M8HA 5ETTA 2YKPA 1KHVA 3K17A 4L76A 4DV2F 2OD6A 3B54A 1R0AA 2BJ7A 4LF6J 2QRRA 3GJRB 1OS5A 2P8IA 3W61A 2Z0GA 3D1HA 1FF2A 5K14A 2A1BA 3CCLS 2ZBPA 4CZCA 3QZ7A 4YB6A 1JX4A 4LF4F 1FRJA 4G6VB 1KS2A 4QW9A 3V2UC 4QIGA 2HQGA 2JSXA 1K44A 3KDNA 2MLXA 4LBPA 3JQJA 2R7WA 5HJXA 4C4WA 4X4RA 1S57A 3N9UC 4KR0B 2MGZB 1Y7PA 1WEXA 3OHBA 3SXLA 3U7JA 4HTIA 2JC0A 1WNEA 3PRBA 2DNHA 4RW9B 1S0MA 1NM2A 1GQEA 1J2VA 2AEJA 2B6AB 2LU2A 3EXYA 4P52A 1FE0A 1VRTB 3D0IE 4HKQA 1T8EA 4CTAB 3NAHA 1QM9A 3BZQA 3ZZTA 2HQFA 4O3SA 2R8GA 3QWPA 4U7UD 5T7LA 2MKKA 4M5GA 2P5VA 1RT2A 2VBXA 5U47A 1IKWA 1X5SA 4FNHA 3QGIA 1NJYA 4I2PA 4GKJJ 4JI6J 1RKJA 5HATA 2ZZTA 4C8MA 4NWBA 4K59A 5KFIA 1RT3A 1G7CB 5GADI 4LFCJ 4ZA1A 2YQ3A 3D5MA 5IZHA 2OGUA 3FSXA 1VBXA 2QYGA 5AXMA 1EP4A 3M8PA 2J6TA 2GNKA 1REVA 2FYXA 1HWKA 1HL6A 1L3KA 2UP1A 3EGZA 2XHWA 1FD8A 3BSCA 2YNGA 3H4DA 1NMEB 3GSIA 4I6WA 1R0CB 4YEAA 4EZ6A 4KGKA 2YX7A 5H9EJ 2MY8A 3D3CJ 2RAQA 2FTRA 2YKNA 2XYPB 1NSPA 2QL5B 3UVJA 3IXQA 2EFGA 4C98A 5HROB 1R7IA 1SVDA 1HBNB 2QSWA 3KLIA 5KFHA 1QUPA 3AODA 3NEKA 5A6PA 2R3VA 4E8UA 3AD8C 4Y3CA 2OAUA 2W25A 4UOCA 1D9DA 3R1LA 5SUHA 5ETPA 5IT9Y 1I6JA 2D41A 1NK8A 1XR7A 3KLEB 5AT1B 4YMEA 4J9VA 1WELA 3PJXA 3MM5A 4KB7A 2CPJA 3HSJA 1KVIA 2PN6A 3CCUS 2HRTA 1AZSA 4ECVA 2F4VF 4NRTA 4TN2A 4UOHA 2WVEA 2BJ8A 3IO1A 4DBQA 1FNXH 4RW8B 1NAQA 2V2KA 4OLPA 4FYVB 2EVZA 1NDKA 2CZ9A 2XMTA 5AE1A 2CZ4A 2KT2A 2H65B 2EBEA 5KFEA 4JI2F 3SZ2A 3KK3B 3VAHA 3Q0AA 1VC5A 1U6FA 3FK4A 3HT3A 4A8FA 4C0BA 3K7RA 2DNKA 4CQ1A 1B99A 4NLPA 3CJSA 4C8NA 4LSLB 2FHMA 3QO9B 2DB1A 2O67A 2C2MB 2J6SA 1T9XA 4UUXA 1U1OA 2WK4A 2Q3PA 4NLTA 3LP1A 4U96A 3L7UA 3NGRA 4AFFA 2J5AA 3I4HX 4OZJA 4DSEA 4LF5F 1KR4A 1LKZA 4I7FB 2ZH6A 4NCGB 1HQUB 2DGWA 4DR7F 3D6FB 4IRDA 5KFGA 1S9EA 3BGOP 3CJ4A 3HZEA 4K8RA 4MT1A 3OTOF 1GMWA 3W8PA 3AH6A 1KDNA 1FEHA 5BXIA 2V8PA 5CABA 2DR8A 2P6SA 4IQXA 1F1BB 2RS8A 1L3TA 1HQ2A 3R5BA 4A4JA 3IAM9 1Q95G 3G82A 1R6YA 2MMYA 4B9VA 1RAJA 2DXEA 1LOUA 1RWPB 1M1GA 4IQMA 5L1KA 1JXLA 1XNRJ 4QWDA 1VQLS 5HMZA 2DPJA 4ZPWR 1U7LA 5EUHA 2C2RA 4YS2A 2CVIA 4WE1A 2IAJA 2OFHX 4QIEA 1S4EA 3W5YA 2GHPA 1GK8A 1X9SA 2KKHA 3MEEA 3QNWB 4ECRA 1Z2ZA 2XNQA 3QRPA 4LRBA 1N33F 4HLBA 4OJ1A 1P6TA 2NXCA 3NP5A 2W9BB 1FNMA 1IKYA 4F3MA 4LIWA 2CPZA 2GGPA 2XWYA 4O3NA 2HVIA 2HWHA 1YRTA 1FEEA 1LWCA 3AAWB 1N5SA 4ZDNA 1JNRB 4TNOA 4AL5A 3T5JA 3ENWA 4KGMA 1FJCA 3B8HA 2E66A 2QMUB 3HK2A 4YFUA 3D0GE 1IWAA 1FFWB 1DAXA 5B0GA 2GO8A 2E1MC 4ER8A 4A46A 3ZFVA 4UQTA 5ETNA 3OV7A 5D0RA 5THWA 3Q8VA 3KG0A 2CQIA 2PE8A 1X4BA 3RB0A 2B3TB 4ZVOB 3KLHA 1UZDA 1SKWA 3HKWA 3IM9A 2HQDA 1VFJA 3UWTA 4F2RA 3JTPA 3DCAA 3JSBA 3TVKA 2N4DA 2D7SA 1RSCA 3ELHA 4BWJA 4YHHJ 3K5LA 2DPIA 1MU2A 2ZFHA 2RT3A 1S59A 3T1HJ 2KRRA 2I9SA 3U02A 4OYWA 1S10A 4IO1A 2CPFA 1PO6A 4I2QB 2E7XA 4C6AA 1Y4ZB 2XZWA 2ZE2B 5KFLA 3CIZA 1UVJA 4USHA 2D9OA 3OFEA 5B0BA 1MSWD 2CNOB 1HHTP 1N0VC 5I42B 2G2OA 5G0RB 5D4PA 2J7UA 3QPIA 4W98A 3W65A 2RF2A 2AKWB 3PACA 3CJ8A 5K8MA 5KFQA 5D4OA 5KT3A 5GMEA 3DRXA 1VJWA 3B4DA 3R5JB 1RU2A 3LP2A 3TNVA 1KRPA 3NGDA 1F5CA 2G4BA 1BXNA 1DZ5A 4QW8A 3G96A 4R25A 2UXCJ 4USMA 3WIVA 3BREA 4P2MA 4OQJA 2YPZA 3QQCD 2RRBA 5L1JA 2NUHA 1VLOA 2A6MA 1RU1A 2ZHAA 3UD4P 2NXUA 4BCAA 5AXNA 1BWEA 5C25A 4O3PA 3ET6B 1TL5A 1T3OA 1WC5A 1RA7A 3IBCB 2NSBA 3MWBA 3CCRS 3CTRA 4C8LA 2RVJA 4U8YA 3ZZUA 3SSSA 1PAUB 5KFSA 1MN7A 5J2NB 4DV5F 5F8NA 2DEIA 1CVJA 3DLKA 4P7VA 4LF9F 2FHJA 1U45A 1NK7A 4LSNB 4Y2MA 2DHHA 4M95A 4I56A 2HHUA 3PYEA 3D2WA 4TLRA 1VOMA 9ATCB 1L3SA 5HBMB 2YNFA 3HM9A 2E5LJ 4G65A 4WFYA 1S6PA 5I3QA 3CJ0A 5CAAA 1RTZA 3W1YC 2JZ5A 4F4YA 5L46A 4FYXB 4PUOB 3C8YA 1UW4A 5HI7A 1SIZA 1NLKL 1RCOB 3KNGA 3LANA 3OR1B 3PO5A 1TAQA 2W24A 3UDEA 3C16B 5JVGQ 4A8QA 2UVWA 1CC7A 2JLFA 2XS2A 4P75A 1B7FA 5SZTA 2AIRB 4FNIA 3JXOA 1TKZB 1U1PA 2QMXA 4K4TA 1UWBB 2K2PA 5LM7E 2MZSA 1Z2LA 4HI2A 3LWLA 1UPMB 2AT1B 4JI0J 4GO7X 5F8JA 1HI0P 1V3RA 5DDPC 2HFVA 2MKJA 2QV6A 2HHHF 1HNVB 3HJVA 1IWGA 4I64A 3AOBA 3GV7B 5JUMA 2G0CA 4PWUA 3N0VA 3FRZA 3M2VA 3W7BA 3RRHA 3GU0A 2WW4A 3HSDA 5D6GA 2VJVA 1KOOA 4AT1B 2MSSA 4P2FA 1AROP 8RUCA 3L3CA 3CUNA 4KT0C 4USKA 3KJQB 2Q6CA 1NSAA 1HBUB 1C1CB 4LF8J 2LMIA 4ES2A 3BYRA 4ELTA 2GHVC 2AU0A 4KGZB 1YG0A 4IG3B 4I67A 2MPUA 3BDPA 2Y1LB 4TLQA 2LQ8A 4JV5F 1X4AA 1VQ5S 4ECZA 2W2MP 1R6VA 4DHVA 4F0MA 3AD9C 2GQCA 3QRRA 2L48A 2AHOB 2C42A 3FBFA 4MAKA 1ZAWA 1AXQA 2NXNA 3H5UA 3ZZ0A 4FXWA 1JJ4A 2YKMA 4DQPA 4LR9A 3GFYA 1RTHB 2VDHA 1YJTA 1S49A 5FDLB 1B0TA 2HAFA 3MM9B 1TKTB 2RS2A 3O8WA 5E3CA 5K8OA 3VWSA 2DD8S 2VA3A 2BANA 2DRBA 2WVBA 2G2ZA 3NXZA 2YY3A 2IMOA 5EWGA 3J81U 1DTTB 1VIXA 3MPVA 3TAPA 5B08A 4DL2A 2PEBA 4DUZJ 1HBOB 3UO0A 3MD3A 2AGOA 1HW9A 1U1QA 1N5VA 3GIRA 3ITHB 4H4OB 3KK2A 1RUSA 1S1UA 5K20B 3S8SA 3UDVA 2RILA 1FERA 3QATA 3N6NA 1N5YA 4C8KA 2EK6A 1IR2A 2VICA 3CWJA 2I5JA 2AQ4A 3CJRA 4KTQA 1GMUA 4D3GA 2FPHX 1HWJA 4AXIA 4C8ZA 3HDSA 1NBEB 5IV4A 2J0XA 3D68A 1LW0B 2UUTA 1SJ4P 1U2RA 2NXJA 1SUQB 2NREA 2I1RA 3BS9A 1YHQS 4QYZJ 3CJ3A 2BYCA 3TAMA 4PQUB 5DDOC 1E6YB 3CMQA 3SV3A 3IWNC 4KBIA 4XPCA 5AJ3J 1RT1B 4CP5A 4NCBA 2HLUA 3EGWB 4O3RA 1NDCA 2XZTB 4OJGA 4ZPCA 2UV8A 5E3QA 2JEFA 1Q1KA 1ZPWX 2ZUGA 1S9FA 1L5UA 2K1RB 4ZPDA 3JYTA 3R2DJ 2DNZA 1YGYA 3PKYA 1Q7YT 3TP2A 2RE1A 4OV1A 1FJGF 2XZDB 1EJ7L 4DZDA 1VC6A 3OFHA 4WYLA 3OHAA 1YJ9S 2AJ0A 2J0WA 3CCQS 3DU5A 4CO1A 4FF3A 1N56A 3M30A 2BQ3A 4PG7A 2N7YA 4RW7A 1OWXA 3GP9A 3EVWA 5J2QB 2F63A 2CQCA 4B3SF 2QLFB 2C3UA 1TMMA 2E29A 5F0UA 4B3RJ 2FY1A 4B3TF 1JXEA 2FVPA 3BBBA 2OO4A 4NEZA 1TAUA 3KDOA 2BE2A 1HI8A 2HS0A 2M88A 4IRCA 1S6QB 2ZJQQ 2HYIB 4BHQA 3BH6B 2OTJS 4HTJA 4CCHA 1UJ5A 3RBEA 3BSNA 5KG2A 1KQKA 3HSGA 4DV3J 3I0SB 3UCGA 4U6PA 4KV8B 1TL1A 2QX0A 2VG5B 4USUA 4E0DA 2YWGA 1MW7A 4HYKA 1RI7A 1LWXA 3PEHA 1GH8A 2WBRA 1WACA 2HNYB 3UN3A 1S5ZA 2POKA 4ZPAA 1FWLA 2HEKA 4CO2A 3DI6B 3RTVA 4DL3A 4EFAC 3LH2S 2G1DA 3MEGB 4Y00A 5CYQA 2EK1A 3R27A 1PCAA 3FKBA 3PW4A 2FHJD 4JI8F 3OPKA 1H38A 1R0BG 2JL9A 4LJMA 5E41A 1VQSA 4WP3A 1TTHB 5LMNF 2GFFA 3I4PA 3VAKA 2DR9A 2V50A 3SDEB 3NOGA 2GJIA 3OD2A 4FYWB 3RRGA 1KP6A 1NPPA 2IY5B 2VA2A 3CEDA 4ZVQB 4AQYJ 2CUYA 2XMKA 3QLHA 4DLGA 1S0VA 3RAQA 5D4NA 2MLZA 4LFBF 1DTQA 1HNZJ 2RKIB 4WFBQ 2L41A 3FGVA 4EGLA 2ZBRA 3NCPA 2H54B 4WFNQ 4DV6F 5EWFA 5IT0A 5F8GA 4HDHA 3OXGA 4ID8A 3N6MA 5F9LA 4PG8A 4J37A 4FS1A 1RWKB 4DPYA 3UR3C 3P6YC 4JYAF 1O51A 1R43A 3PW0A 2ZM6J 2KDOA 2RDDA 2YNIB 2R2TA 1C0UA 1HBMA 1RQ0A 3GWCA 3A3OB 3I32A 2HIYA 1U1LA 4FVCA 2BJ9A 4NI2B 4RW6A 1N5QA 2IA6A 3IR5B 3J81Y 1RACB 3E01B 3MMAA 3VQSA 2FZGB 4Y65A 2FGOA 3M8ZA 3D3BJ 3SSQA 2CJYB 5HSPA 4ECXA 2IYIA 2JRSA 2O5DA 1WEYA 1RYRA 4ELVA 2HNDA 4DZ6A 2W4PA 1HLWA 3LWMA 4JI4J 2A10A 1Y9OA 2RUSA 3SCJE 1RJJA 4ICLA 3ILIA 5EHHA 4DR4J 1APSA 3MAAA 5ETSA 3V5RA 1WC4A 3HHNB 2ZH8A 5J2PA 4ZCMA 2PT0A 1U47A 1RTIA 3BGRB 1I94J 2WTFA 2E1RA 3THPA 3UN5A 2CQ4A 4H54A 3G6VA 3W2VA 5IWAF 5LSLA 2YKOA 1T03A 2LA6A 4Z7YA 3GFHA 2C2EA 1EKRA 4TYBA 3LALA 1U02A 3T9ZA 1YIJS 2BE9B 2EC2A 3CW2C 4OMFG 2UVUA 4M5KA 1FK9A 2DHSA 3MECA 1DQ9A 2BKPA 5LJ3Y 2EFOA 4F67A 2CQ0A 2VPYB 4LF6F 4NE9C 3LW5C 4TY8B 2WONA 5KFKA 2V2ZA 3W9HA 5H9EK 2DJWA 3GYGA 5K5MA 5HLFB 4DX5A 2AZ1A 1O6XA 2EG1A 3DMJA 3CO0P 3AT1B 1B4SA 3C6TB 4MK9A 4NXMJ 1T05B 2M70A 3C6UB 4ZJLA 4DL4A 1YBAA 3GFZA 1YKWA 5KFPA 2M0GB 3MEDA 1ULRA 4DN0A 3VCDA 2P9CA 1M1HA 2BW2A 3Q86A 3P96A 1J5EJ 4X2BA 3OJSA 3RUBL 3GIMA 4X64F 3ZNJ1 5CYMA 2H3EB 3POTA 2Z2ZA 1WC3A 2VC0A 3I9V9 2VPWB 1QDUB 3K5OA 2DCUB 3H5XA 2J0QD 2VFRA 1ZTTA 4B9NA 3MAQA 3LAKA 1JIHA 1RT4B 3EZUA 3MMJA 3UFCX 3NS7B 2YPYA 4F4WA 2Z2LA 3EPGA 3IBFB 3TJAA 1UFWA 2X7IA 3UDCA 2HPUA 4JI6F 3KLFA 5IM0B 1SH0A 1W26A 1NKCA 1IR0A 4DR1J 5I3PA 3IRXA 4RUCA 2A18A 3TX8A 1UWAA 4DPXA 2AYEA 4ZS6A 2GX8A 3L7PA 5F9NA 1RT6B 2ZH7A 2RQKA 2ABYA 3AJ2A 3PX6A 2R8IA 1N36F 3MGJA 3HHEA 2Y0BB 2HRYA 3OUYB 2V9WA 2GZOA 2ZC3A 2KL8A 3E3XA 2XNRA 1RWVB 4C0HA 4DPUA 2K7KA 4X4QA 1LW2A 3EGNA 5AE3A 1M5HA 1JQGA 3CCMS 5B0FA 4WU3A 4YUDA 2DGOA 2V4JB 2OPRA 4NLYA 2LECA 1WKLA 2AYGA 4Q0BB 3KUEA 4TXSA 2RH3A 2C3OA 1DJ0A 4ED1A 2LKZA 3RB6A 3UNYA 1FFGB 1SJ1A 3JQKA 4CLPA 1YRUA 4PG4A 2EXUA 1HMVB 2XLKA 3C3LA 2B8PA 4H4KC 3D1QA 2IAJB 3SI8A 2CNNB 4P2SA 4ZIVA 2OFGX 5D0HA 2EWHA 1NZ8A 1J5OB 3BPDA 3PRVA 1MROB 2FLOA 2PD1A 2Z2MA 4K4XA 4Q5VA 2A2CA 3CJTA 2W2PP 1S1WB 2R7VA 3PTWA 2ZH1A 1IBLF 2J0SD 3V6KA 4GO5X 4PWDB 3TWZA 4Q8FA 1IQZA 3TJ8A 3T5LA 5HK4A 3GIJA 3O2IA 5F8HA 2E9ZA 1GTEA 2RQ4A 2AJFE 2DY9A 2HZAA 2F7VA 2WOMA 4L3NA 1RAAB 4DMZA 1KLMB 3N6LA 2KT3A 2V5HG 4ZOSA 4K7QA 1L3VA 2GJ2A 4J9RA 2XMJA 2RRAA 2MQQA 3CSKA 2CJXB 2MKIA 5LOQA 1HNXJ 3NG8A 7FD1A 1UFLA 4C3MA 5DG8A 1EETB 3SFGA 4JI7F 3TR5A 4F0HA 5J1EB 3R5AA 3VGSA 1ZM4A 1RBOB 2R8KA 4HI1A 4NLWA 5JJBA 4F4XA 4O44A 2GAHC 1JLAB 2PO4A 2E1CA 2VKZG 2ATLA 2VFTA 4X4SA 4ED2A 2XTJP 4ZPVR 3OTBA 4UT4A 1TFWA 2HG4A 2V34A 5IV3A 2KXHA 3G71S 4UZCA 1G3OA 3C15B 3CJQA 2VPXB 4ZITA 3MMCA 1Y0HA 4URSA 3VHQA 7AT1B 2DHAA 2HWTA 4DUYJ 4NOHA 5CYJA 4ZVPB 1KEKA 2HFUA 3Q8SB 2J9DA 4BS2A 2XQCA 4JV1A 4WP9A 4F3OA 1EZZB 2XMWA 1V3ZA 2B5JB 2BR0A 5D3GA 2KN4A 2P9GA 2HIQA 4ZVHA 1C0TB 3OSNA 2ZUAA 4ZK7M 4IDKA 2MQLA 3ETOA 3NAIA 2H48B 1AFIA 2MKCA 5ETKA 4N47A 1FTCA 2V2VA 3DGVA 4U9RA 2C1EB 4IFYB 4M5DA 1TUVA 5KT5A 4YR0A 4JOUA 1WJ9A 3BV8A 1S12A 4IH6A 3M8SA 4NPOA 3DLEB 4NZ7A 1RK8A 5C2GA 1HQEA 2ZJPQ 3UD3P 3I6PA 4URGA 4ES1A 2OUGA 1RT7B 1DQ8A 2KHDA 4C3KA 4NLSA 2OPQA 2WAQD 3UW1A 4HT5A 3W8GA 4FYDA 3NLCA 1XBWA 4CYUA 3OVAA 2NS1B 3MR3A 5KG5A 4CLLA 2ZD1A 2C2KB 1Q8BA 2QLJB 4X4TA 4URQU 3OFGA 3LQVA 4EBDA 1OPZA 5KFZA 4LQ9A 3BO3A 4MIAA 3AQOA 3KHLA 1VC0A 2QGFB 2GIRA 4GVLA 1SH3A 1SJ3P 4DSIA 4DV1J 3DHWC 2X1AA 3IG1A 4R5PB 2DY1A 3W9IA 4YHHF 5JMNA 1KNZA 2QE5A 5FLXU 1LV5A 2CWXA 5LMUJ 1O5JA 2GO9A 2HNZB 3A3NB 4NA3A 1LWFA 1XJWB 1T11A 2H9ZA 4B3MJ 3I5CA 3HHLC 1GNKA 2IDLA 4DQSA 2F40A 4WYWA 2Z2YB 4P73A 4UZBA 3IS9B 3OR2B 4G3IA 3TVZA 3QSIA 4YP3A 2MLYA 2PI5A 4QIWD 3GR0A 1H74A 4OHXA 4OJHA 2NQPA 1XQIA 3VQTA 4XIUA 5ETMA 4CO4A 2QEXS 1BD6A 4KJIA 4Z7CA 2OLWA 4W90B 2UUAJ 4OZLA 4JI3J 3GV8B 2MJUA 3V6DA 3Q8YA 3R7BB 1WI6A 4EYIB 4GVBA 1ZM9A 3OL7A 1TUGB 1S0OA 1NK9A 1FNOA 1CJKA 4FZVA 1RE1B 1VRQC 2HVDA 5FIIA 4LRDA 1NDLA 1Q8LA 2MZTA 5DDRC 3W66A 3TJ9A 4P6QA 2XWXA 1VQ8S 1JLEB 5ADZA 3EJMA 4X62J 1WTBA 1JLCA 1WHYA 1U2FA 1YJRA 2HHVA 1JLQB 2MYFA 4JB8B 2MDAA 1AT1B 1N6QA 5M2UA 2KTQA 3EUNA 3D6TB 3LPYA 3QMQA 4I69A 1FRXA 4DFKA 2IRUA 3DLBA 3G9CA 1PJ6A 1C4CA 4TU8A 1U1RA 3L7OA 4V19J 3KOAA 1TVRA 1KN6A 4NASA 1NH7A 3KJFB 1FDDA 3ZC4A 4N5SA 2ACYA 1FT8A 1N52B 2R2UA 5HL7Q 1YJ7A 3VAJA 3L9ZA 2BUNA 1L3UA 3H59A 1F5BA 1I51B 1NSKL 4O23A 5KFWA 1HNWJ 4N7TA 1WHVA 1SC4B 5F41A 2LU1A 3AD7C 3LF0A 1KQFB 3BKUA 3TEGA 1S79A 2YVSA 1BQMA 3RG6A 1N4LA 1UVNA 4G1QA 3AA8A 2X1FA 3DOLB 3I0RA 5L39A 2MQNA 2E1PA 2JLEA 1N48A 2J9EA 2F65A 3D28A 3QIDA 3M6VA 2KI2A 1JLBA 4LRFA 2W4CA 4J90A 4NYZA 1M0SA 4USJC 1I5OB 2E7VA 5DG7A 4NXNJ 4PAAA 1OY9A 1TUWA 4YR3A 3HJFA 4JI1J 2HHQA 1PYOB 1ZOTA 4H4KA 4DOZA 1U48A 4HH1A 4EUVA 2XO6A 2M3DA 2BBEA 4OI0A 4DWIA 2PEHA 5ETQA 3Q22A 4NLUA 3M05A 4OX9F 1WUUA 3PFEA 3HVTB 1ZAVA 3AXKA 4JI0F 4KRWA 3L95X 4Q2LA 3RW7A 2G0IA 4OJ3A 1RAEB 2GW8A 4LQ3A 3N4WA 5K8PA 5A76A 5DJBA 3EZOA 4LF7F 2YKQA 4IOAQ 3HP6A 4L73A 2H1YA 2B4VA 1VS3A 1VQNS 4MFBA 3TARA 3CNQP 4KKOA 1AFJA 2FLLA 6FDRA 4Q43A 1FKOA 1RZMA 4K4WA 1FRKA 3AJ1A 4RZRA 4Y2KA 4WTOB 4AL7A 4Z2XA 2N82B 4XAKA 3PZPA 4LF8F 3AHPA 4ILMA 2RHQB 4LBHA 3EDRB 1Y11A 3KMSA 1JJHA 4CNYA 3CGIA 1UA0A 2FZCB 3M9OB 4FPIA 4DPTA 4FBUA 4QYZK 4C8OA 5KFNA 3RYLA 4GKKJ 3NY0A 3PCOB 2MZQA 4B3OA 4ETZA 3M2RB 4FKXA 4NL5A 5L9XA 2BKOA 2O1PA 2UU9J 2ACMA 4KY3A 3R5GA 4RUAA 2CXEA 5A8WA 4JI5F 3GZ7A 5BJRA 5DQGA 4DV2J 5HQLA 4MMOA 3CC2S 1VJQA 2G9OA 1HFEL 2HGMA 4DR5J 5DM7Q 3QZ8A 4X65F 4HR2A 2DIUA 1WF0A 3PG9A 3BGUA 4NLGA 3OTDA 3AY0A 2LQ9A 4LF4J 5F0WA 4FPRA 4ENOA 3MF5A 3V4MA 3NBPA 3D54A 5CCMA 4YB1P 2HVZA 3W5XA 2QG9B 1M5SA 1ZPVA 4PQAA 2XO7A 5GMDA 2DCLA 5C24B 5FLXY 2BM1A 1QSSA 2FD2A 3JTNA 2IHR1 4DEZA 1CPZA 2FY8A 3OLBA 3C14B 6FD1A 1QAXA 3TEHB 5F8MA 1R31A 2UVRA 3FEYB 3IA0A 3MM7B 3Q8UA 4ZCKA 2OEKA 2CQDA 5HP1A 2DT9A 2AJQA 1KTVA 1TELA 4A8WA 3NNAA 3SSRA 1UZHA 5KFOA 4C8YA 1SQFA 3CXCR 2KT5A 1JB0C 2DH7A 1QSLA 2IVFB 5K8NA 2R7QA 5D4LA 1NNDA 3B78A 4MKAA 2W01A 2Z8QA 1KC8T 1NRKA 3DRPB 5KG3A 1ZH5A 1F3VA 4TY9A 1YITS 4DSKA 2ZHOA 4OZ1A 1U0HB 3Q8RB 2G1HA 1CC8A 3G6YA 5IT4A 1PBUA 4EO8A 5LXRA 3IFEA 4LF1A 3K8WA 3R5DA 1FX4A 2J9CA 3IM8A 1TV6A 4C11B 3A8IA 1VQ9S 1UJ4A 1WDDA 4KHRA 2DNYA 3T9NA 3KLGA 2EFVA 3MZIA 4ZLLA 3OTEA 2K3KA 1WSRA 1ZBTA 4YY3F 1G1XA 3OXFA 2VBZA 4LMZA 4QPTA 4DG1B 1RWUA 4OX6A 5CCLA 3HVRA 3HXMA 1RWNB 2GIQA 4QCLA 1FVQA 1PJ7A 2AJ4A 1URRA 5IC6B 1TK0A 1S72S 2MGZA 3DU6A 2F4VJ 2W9AA 1HARA 3IC1A 4DS5A 2ZKTA 3DYAB 1Q79A 1H2UX 2CPDA 4OZ5A 3MD1A 1BQNB 4RW9A 2FC8A 4WFAQ 3MI7X 1OQ6A 1Q16B 1Y00A 2Q43A 2B6AA 5JVHQ 4JI2J 1JJ2R 1KTQA 2FLPA 1VRTA 3CE8A 2NLWA 2KXFA 4CTAA 1DLOB 4KH0B 3M8RA 2GHWA 4NMLA 3WC0A 1D8ZA 2IJRA 2CWKA 2GMJA 3PRDA 1SJQA 2UUWA 3ZTQA 2CG8A 3PM9A 3UE2A 5LT5A 4OYZA 2DO4A 4RNMA 3N01A 5E3PA 2H5JB 3CD0A 4KPYA 3S01A 2HVHA 4WXWA 3ILLA 4O4RA 4DF8A 2VKRA 4LF5J 3SCIE 4CH1A 3SMZA 2VHGA 4KFBB 4Y28C 2XCPA 3H8YA 2AYBA 4NEYA 4DR7J 3OL8A 4DU8A 5C42B 4KAIA 2KJVA 1T03B 3OTOJ 2R7OA 5M2RA 4AXJA 2VG6B 2DGVA 2HHPA 2W4DA 2PFFB 1Q0NA 2LQBA 5HROA 1MWZA 2RDJA 2JNJA 1HBNA 5GAGU 3AFGA 1FO1A 1FI4A 5A2QU 3HHLB 3I31A 2WSFC 1X31C 3WX4A 3LGNA 1WF2A 4ZIWA 2YH1A 1RTDB 2HURA 2VQFF 4Y0FA 4H4MB 2DNQA 3KLEA 3LAMA 4F2SA 3CC4S 2XC9A 3D6HB 2UZAA 2L9DA 1U8WA 4K0KF 4YDDB 5J2MB 2OKQA 2HS3A 4RW4B 2J6UA 2QA1A 3EPIA 1JMTA 4RW8A 1CS4B 2O66A 5CA5A 3CB4A 3GSDA 3HULA 4ZVSB 3O44A 5KAKA 2DHGA 2BZ2A 5FD1A 1NK4A 3POTB 1WC6A 3KK3A 2AX0A 1PSDA 3CVKA 4C2MA 2MQMA 1MMNA 2KYXA 1U26A 5HVGA 4LSLA 5I3UB 3J80U 2HMIB 3QO9A 1OPIA 1U4BA 2GS8A 3MFHA 1D8YA 2YNHB 4DS4A 1K0VA 2FVCA 4L74A 5KFXA 1N88A 1FXLA 3HD2A 3KG1A 2E5GA 2E5JA 1PC5A 4RBVA 2NYHA 4QIFA 4PXCA 3KJVB 4PKDB 4NCGA 1HQUA 2DBBA 4KYZA 2G2YA 2EW9A 2XGQA 1VBKA 1VR6A 2FZKB 2VDIA 1WKKA 3THVA 3BR8A 4P10A 3G86A 3WZ0A 3MM6B 2W7OA 3H25A 3IBWA 1C2PA 2J7KA 4QR1A 4IR9A 4MIBA 5C2CA 3IR6B 4OHZA 4I68A 1OIAA 4NYPA 5KFFA 2HAIA 3VAMA 2R8HA 3FMWA 2E5IA 4PXBA 5F3TA 3M4XA 2EFPA 1NDPA 1VCTA 4FP9A 3F56A 1NB2A 4KIAA 1TKDA 1FXDA 3TQEA 4F0KA 1RT5B 1AUDA 1QY7A 4TKTA 4PRFA 3RBZA 3BO2A 1GX5A 1HNIB 3MCMA 1SV5B 4N56A 4MKVA 1JLFB 2VH7A 3HPOA 2W9BA 1F60B 1UEUA 3MUVP 3G87A 1XMOF 2I6WA 1KVKA 1X9WA 1CULB 1R8BA 1J5EF 5BYSA 1MG7A 2WBMA 2LCWA 2Y9HA 4ZJQA 3H42A 1SJFA 5L8RC 4MYTA 2VODA 1XK8A 1T95A 2XI2A 4OZ0A 3FVYA 3DXSX 3JB9k 4C48A 3RZAA 4ERDA 4UY8T 5E3RA 4DV5J 4QZVB 5D0EA 5GAGI 4O4GB 4UUWA 1X9MA 5IQ6A 4RWXA 4IRKA 1Q4RA 2PI4A 1KBRA 2K8GA 4OYAA 3DLGB 3OVBA 1BUXA 2HKEA 4LRAA 3U1LA 1CJUB 4K4VA 3NGKA 5CZXA 4KGXB 3W60A 1KONA 2NZ4A 2Z4PA 4O44B 4NLDA 3AB2B 3UN2A 3TYTA 1DBDA 3M8QB 3DNCA 2MSTA 4WF9Q 2K3IA 1QUVA 3R3TA 4I2QA 2LEAA 3QRQA 2ZE2A 3M2UB 3MMBB 4M63A 1V6HA 4N8NA 1VLYA 2IFXA 1YRXA 4UTGA 4ELUA 3WC2A 3T1YF 3V81B 4HH0A 3AJDA 2GC8A 4KC5A 5I42A 1F9EB 4CLWA 3MOZA 2ZITA 3TA2A 5G0RA 3W2WB 4CDIA 1YZ6A 5EDWA 1PKUA 3EZ5A 1U25A 1DURA 1S7HA 2FQQB 3ISND 2ADBA 3OVSA 1SB6A 3MTKA 4LR7A 2NCKL 3QIPB 1QE1B 1Q7LB 1OYDA 2DNGA 5J1PA 2HHHJ 4ZCLA 4DQQA 2VUGA 3EVOA 2HK2A 4I0WA 4OHYA 2DNOA 1T3NA 4ECUA 5HJYA 4X4UA 5A2QY 3FEXB 2IC3B 2M4MA 3M1VB 5KT4A 2F3JA 2CPYA 4RNOA 4WZQA 4QIVA 3GCXP 2C3MA 1YDLA 2CNLB 2DEJA 3JS9A 3P5TL 4NLVA 4FVMA 1WC1A 3RAMA 4ZLPA 3OT9A 3ET6A 1K73T 5E7OB 4ZMMA 3FBEA 4XK8C 4EBCA 4Y34A 1HPZB 2PDAA 2DGQA 2J8SA 4EI2A 3SIPB 3K58A 2MY7A 3UCUP 3X1LB 2VFVA 2KG0A 1UJ6A 2UUBJ 1KVJA 5J2NA 1RLCL 5DETA 4DFJA 5LSRA 2V4QA 3HHDA 4LSNA 5A6WA 3FBCA 3TUJC 5F3ZA 3SV4A 2HHWA 4UF4A 1AW0A 4DR2J 2DRAA 3PHEA 1B0PA 4ZP9A 3EWGA 1H72C 2GIFA 5HBMA 1D0EA 3KWMA 1URNA 1RTJB 1IM4A 1OQ3A 1TMJA 1IKVB 2CQ1A 3PKMA 1E6VB 3BQ2A 3O6QA 2W9CB 2HQCA 3MPDA 1IBKF 2CJQA 1UETA 4PUOA 2IJNA 1FESA 1V5IB 4QWCA 2DGUA 3OR1A 3S6EA 2ATCB 2XB2D 4DV0F 1XMBA 3Q89A 2APOA 2NR0A 3C16A 1X4FA 2CVEA 4EYHB 4DQRA 3TZWA 4DXLA 4ED0A 5DO2A 3K5PA 4J9KA 1T9YA 3NGTA 5KFYA 2AX1A 1TKZA 3I82A 3CT9A 3MUTP 4UOFA 1UWBA 4ZVUB 1HD1A 1HI1A 1ICEB 2XEXA 2OTLS 3PYFA 4CLTA 2EG2A 2RU3A 4ATNA 4ANEA 1YJUA 2BACA 2PA8D 5KFAA 3IAS9 3PIPQ 3BGFA 1HNVA 3U1NA 3P49B 1BE4A 5D15A 1X5PA 1NSQA 4CNZA 3HCXA 2XBPA 3TI0A 3FMBA 3NGSA 4EEYA 3TZXA 1HD0A 1X0FA 4OX8A 2ZDOA 3NCQA 3EYZA 2A0FB 2CQGA 2CQBA 3KYLA 3ZZOA 1VYAA 4USIA 1RAIB 4CLYA 4LVNP 1RHJB 2RMLA 4X66F 4DR3J 4EU0A 1HBUA 1C1CA 1YTYA 1FVSA 1FKPA 1R89A 4YR2A 1NJXA 4EO6A 2EFQA 2DR7A 1UAWA 2DVIA 4IG3A 4ANCA 3ZTRA 2PFDA 3JSMB 1WOOA 2GVZB 4IH5A 2BRLA 2L9WA 2HK3A 3DOKB 2EKNA 1KWMA 3KUGA 2QA4S 1S77D 1PAEX 4NLOA 3A8JA 2XLJA 3W64A 5A0YB 1RTHA 3T5HA 2BVZA 1FJGJ 7FDRA 3RBXA 1C1BB 1SQEA 2HQ3A 1ZZFA 3VGVA 5FDLA 3MM9A 1HW8A 1TKTA 2RIJA 5IOLA 1N8RT 1JWWA 4WBFA 2LYVA 4AD6A 4ETXA 3OFFA 3Q2SC 1RADB 1XNQJ 2JWNA 1K0TA 3TX0A 4OYXA 1DTTA 3CD6S 3A3PB 4FF2A 1I3OB 4B3SJ 3ETMA 3IN5A 1CQNA 4B3MF 1HBOA 2OMOA 3BKFA 4MTPA 4P2XA 1IR1A 3CCJS 3UQSA 3QYYA 3JAMU 3RAXA 5DM6Q 3VZIA 2VC1A 5CXTA 3ITHA 4ZVFA 4H4OA 2CZVC 3BQ1A 5HANA 3GIKA 5D0GA 2FUG9 3UPFA 2VG7B 3NWRA 1IBMJ 1N54B 4NYOA 3PHTA 4NZ0A 2W7PA 1S9GB 3BSAA 1FD2A 2DHXA 4KO0B 1IN0A 2B4UA 3CCZA 4DDFA 2YH0A 4RO0A 3GIIA 1LW0A 1SQGA 1KQSR 1SUQA 1CJTB 3SQGB 3M7VA 2ZNYA 2FHOB 3FDSA 2XSJA 3P8BB 3R6GB 4HL9A 1BY9A 3V6HA 4PQUA 4A8YA 3MCOA 1E6YA 4GC7A 2D3OR 1RT1A 1TR0A 4MJKA 2QL7B 3M8WA 2FB0A 1CJVB 1SCJB 3MOJB 4JI8J 1H2VZ 3CJKB 1SBRA 2KRBA 1CQMA 3DGPA 1OSDA 3DDNA 5DRKA 2UXDJ 1FFSB 2UXBF 1MN9A 2ZH9A 2B9YA 2ZBIA 1Q5YA 3QBCA 1VBZA 4ZHRB 5EGYA 1NUEA 3L4BC 2K1RA 4WJBA 3FSIA 3PDNA 2IIHA 3FFIB 1U6BA 4WWSA 2LDIA 3BPSP 5IQQA 2NPFA 4C97A 4J9OA 1UVIA 1NXIA 4LFBJ 2XYGB 2QZ8A 1GMWD 1F2HA 3K57A 3FSYA 3PW2A 5KFVA 4WZMA 1G2EA 4BC9A 3EE3A 1R27B 2AMCB 5J2QA 1XN9A 1JXVA 3CD5A 3DRSB 3PEJA 1KHWA 2KZZA 3DLHA 4K4SA 1BLUA 5A8RB 3DOMB 2Q79A 4DLEA 5JXSA 5B7WA 3VF0B 3LP0B 3NNCA 1S1TB 1HA1A 4Q7AA 4B9TA 2R7SA 1TKXB 1S6QA 1UL3A 4BWMA 1R8AA 3P5BP 4Y2CA 1NHUA 3K8VA 4IUFA 3C66A 2F5GA 2R7TA 4U8VA 2CDQA 3GMGA 3H90A 1LWEB 3MM8B 1IUJA 3DM2B 3OSPA 5M2PA 1T02A 1S1VB 1W7WA 1YLXA 3I0SA 2GJFA 5GVQA 4PXEA 2DGXA 3UR0A 3PIOQ 1K47A 2VG5A 3M8YA 1VQ4S 2JX2A 4LR8A 4FXDA 4XO0A 4PZVA 5F8LA 1KSPA 2DO0A 2HNYA 1X0PA 4NCAA 3ZNUA 1X5OA 3A12A 1TK5A 3FRYA 3KTQA 3KUHA 3DI6A 5EX0A 3RU0A 2XMUA 3MEGA 1OMSA 4ZVTB 2U2FA 3DDIA 2W8KA 3OW2R 2EPIA 3T6BA 1OSCA 1RHKB 2GVDB 3CJ5A 1F9HA 3VAFA 1LFWA 4CT9A 4DCOB 1IKXB 2UUCF 1LNQA 4M1KA 2EEYA 3SDEA 3FNNA 5IWAJ 4QU6A 5KFJA 4F4AA 4F04B 2COLA 3DXBA 4GKKF 2N3LA 2W7AA 3GJQB 1YSJA 4K4ZA 1HR0F 2YXLA 4TVAB 4FXVA 4O3OA 3NMAA 3GYXB 2OH2A 1U1KA 3CD7A 4CRJA 2XS5A 1BC6A 3FBBA 4HACB 2RKIA 2DNNA 4GRSA 1AA1B 2BQUA 4USTA 4J5OA 4DR5F 2HZVA 1TL7B 1PBAA 2E9TA 2HBYB 1S1XB 1JLGB 3GCWP 1NK5A 2C2DA 2H4YB 2OSQA 2YNIA 1JJCB 2MTLA 4HVZA 3T3FA 1LXJA 1U2CA 2JJ4D 1IBCB 2NUUG 1Y3JA 1N34F 1TL3B 3WDOA 4QPXA 4NI2A 3PO4A 2B7CB 2BMBA 1YVFA 3ICLA 2D74B 2V6AA 2HRUA 1O8BA 1RWXB 3E01A 4X64J 1R3NA 1UVKA 3KK1B 1CG2A 1HYSB 1IM6A 1FRMA 3D0HE 2QFJA 2RD5C 2CAJA 1IJFB 2YWWA 3QT6A 3ZTPA 3BR9A 1OY8A 2N4CA 3JAMY 2YWFA 1T9TA 2Y1JA 4IG0B 2XYHB 3CPWR 1SKSA 3R9LA 1VRUB 2OPSB 3H5YA 2KM8C 1QTNB 4R8UB 4QBUA 3AOCA 2XSFA 1F9FA 2E7WA 4QQBA 2DXDA 2ASDA 4LFAF 3BGRA 1SL0A 1T9UA 1H0HB 3DRRB 1FWPA 2QTWA 4X4VA 4QU7A 1QSYA 4XDCA 1NK0A 4W92B 3G2XA 4C0OC 3TW0A 1VHFA 4IOCQ 1M5OC 5C7PA 1H7XA 2IJFA 1XMQJ 2AJ1A 2XM3A 4XDDA 1FJEB 1VQYA 2JEGA 2IDEA 5AXKA 5DDQC 1N36J 4RU9A 2Z57B 2C3YA 2MZRA 2ZJRQ 1XC9A 4MKBA 1NJZA 5DZ7A 1U1NA 2IVYA 3PR5B 5KFUA 2AW0A 4PG5A 1HKAA 5CD4A 2J76E 2HLTA 3FJ2A 4IO9Q 1NK6A 4OZ2A 1JKHA 4TY8A 1X4HA 1R0AB 1QVFR 2GCFA 3M32A 1EHWA 2XULA 1U8SA 5HLFA 1RGVA 3IR7B 4ILLA 2XCAA 2Z56B 5K14B 3C6TA 4ED8A 4F02A 1RABB 1T05A 1K8AT 4A8XA 3C6UA 4ED7A 1SIWB 2XY5A 2VASA 2X51A 3C46A 3PW5A 2IM1A 1IBLJ 2MEWA 4OZ3A 2OELA 5D77A 4O0IA 4I6YA 3QJJA 2QMWA 2KXNB 4MH8A 3P4UB 4HHUA 1RT4A 2KO1A 2UV8G 3A1YG 1NHKL 4TQRA 1WF1A 1Q78A 3KMQA 1FXRA 2HBRB 4DV4F 4E2FB 1UVLA 5IM0A 5T7LB 2QIFA 1J27A 1A0OB 1RT2B 2MJNA 4S0MA 1KFSA 1IKWB 2EC0A 2FGCA 2XMVA 2MB0B 1MLAA 4JI7J 4I2PB 2DKOB 2VOOA 2X1GA 1ZTWA 3GE9A 1RT3B 2HBZB 1D3WA 4WK3A 4JV2A 1RT6A 1RWMB 1NJIT 3VR1A 1EP4B 3M8PB 1REVB 1H73A 3GPAA 2MKHA 4PYAA 4DL6A 2H5EA 2YNGB 4N41A 3IGNA 4AE5A 2ZHBA 3I9ZA 2R7UA 3A4TA 2Q66A 3MPYA 3MTJA 3BN7A 3OUYA 1W2IA 2LEPA 3GTYX 2R2SA 4J9MA 4DV7F 4DUTA 1PYSB 2YKNB 2W2QP 4DSFA 3UVJB 3E2EA 3KLVA 2D3UA 2V4JA 4Q0BA 3KLIB 3F0NA 1ZYQA 2HGLA 4Y2AA 3W9JA 4CO3A 3G8QA 1Q82T 5CHCB 1HMVA 3AB4B 3CDEA 4ZPTR 2BOAA 4C9DA 5FJ4A 4A48A 3GILA 1J5OA 1MROA 3CDAA 2LQ5A 2MKYA 3KG4A 1MNEA 8AT1B 4DPOA 3MM5B 2E9RX 1WOPA 2RQMA 2F9JA 5ETOA 2HHXA 1S1WA 1AZSB 3V6JA 1WOSA 1FE4A 4PWDA 1PYTA 3D66A 4J9SA 3MCNA 1RBAA 3H2LA 2JEJA 3EGVA 1IVZA 5AXLA 2VQEJ 1U09A 1DHMA 2N3OA 3BM7A 1KLMA 2KHCA 2C2ZB 1OO0B 2YWKA 3WX8A 1HWIA 2Y8WA 2G13A 3TVYA 1B3TA 5ETLA 3BBFA 2ERRA 1P9QC 3TZZA 2H51B 2Z30B 4I1TA 4BDPA 4J9LA 2AD9A 1EETA 2X1BA 3OTCA 3B82A 4GKJF 3W63A 2H5IB 3LP1B 5J1EA 4V19X 4LFCF 2B7BB 3CDUA 5DGAA 3NOCA 1RAHB 2ZBQA 2B9WA 1JLAA 4P72A 2ASLA 2D69A 1ZA2B 4DX7A 1RLDA 5KTQA 3RB3A 1SC3B 1X4DA 5IFMA 1FHTA 1HWLA 3FCHA 1S9EB 4RKUC 3PV8A 4HT7A 3C15A 4FF4A 2WVDA 4PABA 1NU4A 2VBYA 4OIXA 2KB2A 3EXCX 1ZZNA 1TFYA 4U67Q 1Q8KA 4J9NA 3RR8A 2VU5A 4EK2A 1SH2A 4QR0A 5L9NA 2N7CA 1EQ0A 3BF4A 3DC2A 2ZH3A 3G82B 2B5JA 2M52A 1T7PA 2YX4A 5HMXA 4QOTA 1C0TA 3KHGA 4QJVA 4I4BA 2IYGA 1WG4A 2XLIA 4WE1B 1UTAA 2Y0SD 2IBKA 3T19A 5B0DA 4OYIA 4IFYA 3R8YA 3PXGa 3GQCA 3MEEB 3EMTA 4DI6A 3R97A 2OMLA 1IKYB 2W2NP 3DLEA 5GMKa 2GGPB 5KG7A 1BMQB
chains in the Genus database with same CATH topology
1TQLA 1H6KX 3CCES 2POKA 4ZPAA 4ECSA 2MQMA 1MMNA 3GB0A 2KYXA 5KFMA 2XGPA 3I96A 4CO2A 1LWCB 1RT7A 3DI6B 1U26A 3RTVA 4DL3A 4EFAC 3LH2S 3CJKA 2G1DA 2CPHA 3MEGB 4Y00A 4LSLA 5I3UB 2HMIB 3QO9A 3QAEA 1JNZB 1OPIA 5CYQA 1WWHA 1U4BA 2OPPA 2EK1A 1S4FA 1VI7A 3R27A 3VALA 1TVRB 2LXIA 3PW4A 3MFHA 3NNHA 1D8YA 2FHJD 2NSCA 4LIRA 4JI8F 3VAIA 2R7RA 2YNHB 4ZHRA 3OPKA 4DS4A 3CMES 5GAHU 1H38A 2KYZA 3OL9A 1K0VA 2K7JA 2JL9A 4YOEA 2FVCA 3BO4A 5KFXA 1SL1A 3O5TB 3O1LA 4LJMA 2DH8A 4RNNA 5E41A 1H2TZ 1N88A 5B0EA 4OI3A 3CDBA 2MQPA 2ZH2A 5HMWA 3KG1A 1FXLA 2HHTA 1VQSA 2HQIA 3FFIA 2E5GA 2E5JA 1FTRA 1PC5A 4RBVA 3KLHB 5LMNF 2GFFA 1SJRA 3HHKA 3I4PA 3VAKA 2DR9A 4UW2A 1U24A 3SDEB 4QIFA 4PXCA 3KJVB 1A7GE 4PKDB 3MR6A 4NCGA 2GJIA 1HQUA 2DBBA 2L9NA 3RRGA 1RISA 1TK8A 2DR5A 2EW9A 1SC6A 4P7TA 2XGQA 2VA2A 5HMYA 2DNPA 2AGQA 4R5PA 2OP5A 2A2DA 4RBTA 1BQMB 5K9FA 3CEDA 4RNFA 3S7RA 2KFZA 1DARA 3NL0A 2KZMA 4G1QB 2XMKA 2F1FA 3QLHA 3THVA 2AGPA 3OLAA 2WRMA 4DLGA 1S0VA 2M9KA 3RAQA 2ILZA 5L1LA 3I0RB 5D4NA 4ECYA 1Q81T 2HNZA 3BR8A 4I6AA 4DV1F 1FCAA 2R7XA 3ENQA 5BYRA 2JVOA 4LFBF 4KHMA 3G86A 1FKAF 1MU2B 4GC6A 2OJ3A 2P6TA 3WZ0A 2X3GA 3MM6B 2W7OA 3M6UA 3H25A 1DTQA 3IBWA 3LOUA 1C2PA 3DRSA 5DGBA 2RKIB 2J7KA 3IS9A 3OR2A 4WFBQ 3J7ZT 4QR1A 4ZPBA 2RDIA 4IR9A 2L41A 1JLBB 3NS6A 4MIBA 5LMUF 2B4OA 3FGVA 4EGLA 3NCPA 3TAQA 5A8RA 3DOMA 4WFNQ 3IR6B 3C2PA 4OHZA 5EWFA 4I68A 4DV6F 3V4IA 5IT0A 4XPEA 1OIAA 4NYPA 5F8GA 4CI0B 1TP7A 2L3MA 3LP0A 3OXGA 4HDHA 5KFFA 1S1TA 2FDNA 2HAIA 1NZAA 4ID8A 3VAMA 3N6MA 2R8HA 3FMWA 2E5IA 2VV5A 4PG8A 5F9LA 3K5MA 2FVSA 4J37A 4PXBA 1TKXA 5F3TA 4FS1A 1WTFA 4DL0C 4UQGA 3M4XA 2BDPA 1WD6A 2EFPA 5MLCV 3UR3C 3TOQA 3P6YC 3F41A 4FP9A 4IOBA 3F56A 4JYAF 1O51A 4KIAA 1TKDA 1R43A 1FXDA 3PW0A 1LWEA 3MM8A 2KDOA 3H4BA 2YNIB 2AYMA 2R2TA 3QJPA 1C0UA 4Q45A 1RT5B 3I87A 1HBMA 1RQ0A 4TYAA 4ZP7A 2RF2B 3GWCA 1AUDA 1XNRF 3DM2A 2CIMA 3I32A 1Q8IA 1QY7A 4TKTA 4PRFA 3BO2A 1S1VA 1QAYA 1U1LA 4YB5A 2RJZA 1GX5A 1HNIB 4FVCA 2LLZA 2UUAF 2AF6A 2J7WA 4RW6A 4JI3F 3N5BA 3UNGC 3M6WA 2YX1A 1SV5B 5H1SV 3NCRA 4R0JA 2DGTA 2ZC4A 4N56A 3Q2TC 1JLFB 3BQ0A 1N5QA 2VH7A 1P27B 3HPOA 2W9BA 1F60B 4QWAA 1ROFA 4YDXA 1JLEA 1UEUA 3MUVP 2IA6A 2ADCA 3RRKA 3CCSS 3KKFA 3IR5B 3J81Y 2VBWA 1XMOF 1ZM3A 2QLXA 1X9WA 3E01B 3LP2B 3MMAA 3VQSA 3HFKA 2I2YA 1JLQA 1R8BA 4Y65A 2FGOA 1J5EF 2HGNA 5BYSA 3SSQA 3BB5A 4ECXA 2WBMA 1RKIA 2LCWA 2IM0A 2IYIA 5EN1A 2JRSA 3MAHA 2O5DA 4K5SA 2CPIA 1WEYA 2A3JA 2JFKA 4CO5A 1RYRA 4X62F 1SJFA 1W2BR 4Y6IA 4ELVA 1LFPA 5L8RC 5L38A 4MYTA 5CD4H 2VODA 3ZZRA 2FHKA 2HNDA 4G1IA 1XK8A 1N0UA 2KM8B 2W4PA 5KOWA 1KQGB 4E98A 3LWMA 4MFBB 2A10A 5DLGA 1Y9OA 1H3DA 5DQHA 3J7YU 4X4OA 3FQLA 1T95A 1UA1A 2XI2A 4KKOB 4OZ0A 2DH9A 1FKPB 1RJJA 5CZVA 3SCJE 4F26A 4ICLA 5C5JA 3O3LA 5C25B 1FKOB 2AWZA 3FVYA 3DXSX 3JB9k 3RZAA 3FZBA 2BJEA 1YWXA 5EHHA 2FJWA 4ERDA 2KVIA 5E3RA 2HFZA 1YJWS 4UY8T 4ED5A 5EWEA 4QZVB 5GAGI 1APSA 1YJNS 4O4GB 4UUWA 1LK7A 3P3DA 3QWUA 1IKXA 4B02A 3G4SS 1X9MA 2J9DE 3V5RA 5IQ6A 1S97A 4RWXA 3HHNB 5T41A 1V3SA 2WSCC 4A8MP 2UUBF 2ZH8A 5J2PA 4IRKA 4ZCMA 1QJHA 4YB7A 2PT0A 4DF4A 2GQQA 1U47A 1Q4RA 2PI4A 1RTIA 4OL8A 3BGRB 2K8GA 2ZDPA 2WTFA 3BGLA 1YI2S 2E1RA 2DNLA 3DLGB 2AP6A 3OVBA 3THPA 3VZHA 4A8OA 4AUKA 4CT8A 3SEOA 4ECWA 1NEEA 2JEIA 2CQ4A 3DLKB 4H54A 3U1LA 4K4VA 1PGZA 3NGKA 3K0JA 5CZXA 2PGCA 3G6VA 1VGYA 3MDFA 3W2VA 1ZAXA 4DR2F 2L08A 5GAEU 1VQ7S 1HNWF 4DN9A 1KONA 3DOLA 2NZ4A 2Z4PA 4IFVA 5IWAF 4OI1A 4B3OB 3HZGA 2PA3A 3CO9A 4O44B 5LSLA 1ELOA 3AB2B 2KU7A 2YKOA 4FN5A 4NLDA 1T03A 2LA6A 2C2EA 3GFHA 2V8GA 2VZ9A 5LJ5Y 3TYTA 5LSOA 1DBDA 2BABA 3M8QB 5KFBA 3DNCA 2D3ZA 4HDGA 2MSTA 2K3IA 2HFOA 2LEBA 4WF9Q 1QUVA 2D1CA 2P9EA 3R3TA 4I2QA 1Y5IB 2YNFB 4TYBA 3QJLA 3LALA 2IM2A 4MKYA 3QGPA 3D1OA 2LEAA 2WHOA 2WB1D 5A8WB 2ZE2A 3M2UB 3T9ZA 1YIJS 2DIVA 4OLOA 3ISZA 1S6OA 3MMBB 1S6PB 4M63A 1V6HA 4N8NA 3ONQA 1VLYA 2IFXA 4OMFG 1S76D 5GADU 2MKSA 1YRXA 4CH7A 4DL5A 4ZVGA 3T1HF 4DFPA 4WKRA 4ID5B 4ELUA 2UVUA 2JC1A 1FK9A 4DSJA 3WC2A 3T1YF 3V81B 2DHSA 4HH0A 4KC5A 2GC8A 1S1XA 3MECA 1NKEA 1QVGR 1JLGA 1DQ9A 5I42A 1R8HA 3ZZYA 5LJ3Y 2EFOA 4F67A 1XR5A 2CQ0A 5A8KA 2DTJA 2ZITA 3MOZA 2VPYB 3TA2A 4AYBD 2ZVSA 5I4MA 5G0RA 4LF6F 3MCSA 2FIUA 3W2WB 4N8OA 5EDWA 4DL7A 1VQKS 5DS7A 3EZ5A 3LW5C 4TY8B 4DSLA 2WONA 1U25A 2UVVA 5KFKA 1DURA 1S7HA 3T6JA 2ZBCA 4NXNF 3F44A 1QTMA 3OL6A 1GTHA 4WFXA 4ED6A 1Y5NB 2DJWA 2DGSA 3ISND 1TL3A 2CJBA 3MHYA 5K5MA 5HLFB 4JI1F 2ADBA 3OVSA 1SB6A 3MTKA 1BGXT 2RNEA 3HVTA 3DMJA 2EG1A 3LO3A 3HO1A 5DQIA 3QIPB 1QE1B 1TZ0A 3GFXA 4NA1A 1Q7LB 2DNGA 1FJ7A 5J1PA 3NBPB 3BSOA 2CYYA 3C6TB 4ZCLA 4PPDA 4DQQA 1WG1A 3UDLA 4MK9A 1T05B 5KFCA 3BJYA 2VUGA 2M70A 3C6UB 2IM3A 2XMMA 3KK1A 2LA4A 4I0WA 2OIHA 4OHYA 3DFEA 3TUIC 3K5NA 4DL4A