1CLFA

Clostridium pasteurianum ferredoxin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
AYKIADSCVSCGACASECPVNAISQGDSIFVIDADTCIDCGNCANVCPVGAPVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer (iron-sulfur protein)
molecule keywords FERREDOXIN
publication title Solution structure of the oxidized 2[4Fe-4S] ferredoxin from Clostridium pasteurianum.
pubmed doi rcsb
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1clfA00
1H7XA 1KQGB 2C3UA 1FRXA 1Y5IB 2V2KA 1Q16B 2WAQD 3OR1B 1D3WA 4ID8A 1FTCA 1BQXA 2V4JB 3MM5A 3EXYA 2WSFC 3PNIA 1Y5NB 1K0TA 1G6BA 4KT0C 5BYQA 1H7WA 2WSEC 1FF2A 5BYRA 2O01C 3MM6A 1GTHA 2GMJA 1G3OA 3IR7B 4OV1A 3EGWB 3MM9A 1HFEL 2FGOA 2C3YA 2PDAA 2XSJB 1FRKA 2Y0SD 7FDRA 1FRHA 3MMBA 1VJWA 4OMFG 1PC5A 1C4CA 1H0HB 1PC4A 2VPXB 1RGVA 3MM7A 4XK8C 3MMAB 1BWEA 2C3PA 2VKRA 2C42A 2PA8D 1FRMA 3LW5C 4XDCA 2VPWB 2PMZD 1BLUA 1FDAA 5E7OB 3EUNA 1FDBA 1B0VA 2FDNA 1WTFA 2V4JA 1JNRB 1AXQA 1B0TA 3MM5B 3MMCA 2IVFB 1DFDA 1KEKA 1SIZA 3OR2A 1JB0C 4L6V3 1FDNA 2FJBB 1GAOA 4Y28C 5L8RC 1FEHA 1KQFB 5BYSA 1FXRA 1GT8A 2VPYB 1FXDA 1Y4ZB 3MM6B 4YDDB 1XERA 1R27B 1BD6A 1H98A 3IR5B 5CH7B 7FD1A 2FD2A 3MM8A 1F5BA 2Z8QA 2ZVSA 5CHCB 2FJEB 3MMBB 1C4AA 3GYXB 2WSCC 1FDDA 3OR1A 1FERA 1GTEA 5FD1A 1Y5LB 3MMAA 6FD1A 2WB1D 2FJAB 1IQZA 4XDDA 1FCAA 1FD2A 2UZAA 1IR0A 2GMHA 1SJ1A 4DHVA 2C3MA 3C8YA 3IR6B 2VPZB 1FRJA 3MMCB 3MM9B 2C3OA 1FRLA 1DAXA 4AYBD 2FJDB 1JNZB 3OR2B 4RKUC 1FRIA 2XSJA 1F5CA 1BC6A 6FDRA 3MM7B 1A6LA 1CLFA 4CI0B 1B0PA 1DURA 1SIWB 1F2GA 3MM8B 1ROFA 3HKZD
chains in the Genus database with same CATH superfamily
2HG4A 4OX7A 1KQGB 3KK3B 2HAFA 2Y3YA 3UFCX 3S8SA 5HBMB 4WP3A 4DR7J 3PKYA 3C15A 5C24A 4NLWA 1JK9B 2EPIA 5BYRA 1RT3A 1R8BA 3SV3A 1EETA 3QLHA 3JSBA 3ZZTA 4LF7J 3MAAB 2CQ4A 4AQYJ 1JLCA 1WELA 2CDQA 2AEJA 1HNVA 4NCBA 2GVZB 3L7PA 2VG7A 4ZVHA 3QRPA 1LWCB 4OX6A 3DKDA 4B17A 8AT1B 2ZOFA 4PQAA 4NA1A 2IYIA 2VA2A 3NG8A 1RBAA 3NS6A 3ZZPA 1AA1B 2B51A 1MROB 2YKMB 3TAMB 3P5BP 3MOJB 3UR3C 3ILOA 2QMXA 3SEOA 2GGPB 2CAJA 2DRAA 2G4BA 3CCQS 1S12A 2DNPA 5F9LA 3HHLA 4CI0B 2UUTA 1URRA 4Y34A 1IWAA 3G82A 3POTB 1P1LA 2ZBQA 2A2CA 2AYEA 4QU7A 2FHOB 1UVNA 2W25A 1A0OB 2UV8G 3OL6A 3CD0A 2YNHA 3OLAA 1H6KX 3MM9A 2LQBA 2XSJB 4F36A 1FRHA 4ZA1A 4LF4J 4WU2A 2CYYA 3H40A 1RT1A 4AFFA 3MMAB 1QVGR 1RKIA 3NNCA 1ELOA 1VCTA 4GKJF 5IV3A 3J7A1 2F8HA 1NJWA 1DRZA 3MMCA 3AJ2A 4OZNA 2OIHA 2AJQA 4CLZA 2ZFHA 3HULA 2WBRA 3K8VA 3OPKA 4BBYA 2QA4S 4CLTA 3M8PA 2AZ1A 1AFIA 2ZH9A 4UUWA 2GJFA 1B7YB 2R7VA 3DMJB 1DTQB 2P9GA 1CJKA 2OLWA 4DOZA 1EAYC 4CM2A 3EICA 4KHMA 5GMEA 4ED6A 1T05B 1D1UA 1CLFA 4C0OC 5A8KB 4Y2KA 2E5IA 4J9NA 2RRBA 4LF5F 3KG0A 5LSLA 2AJ2A 3M2VA 3W2VA 1URNA 5L46A 5CZVA 4A8KA 1U26A 3BV8A 1R7IA 4JI1J 4I1TA 1ZPWX 5KFUA 4RUBA 3CVKA 2GIQA 1DARA 1RABB 1YZ7A 1RXOB 2RVJA 4ANDA 4K4UA 3WDOA 3THVA 4CO0A 4LBIA 3GILA 4IRKA 1TAUA 3S6EA 2H4YB 1RTDB 2BKPA 1ZYQA 4R8UA 4TY8A 2R8HA 5SUHA 2AJ4A 3CDUA 1B4SA 5EWGA 5JJBA 1IKVA 1X4GA 1M0SA 1FJCA 1AFJA 2A0FB 1QSLA 2POKA 2QMUB 3KLHB 5CCMA 4QR2A 3DLBA 1FNXH 4I2QB 3KLIB 4H4KA 5A76A 3ET6A 1P9QC 4LF9F 1DAXA 1SQFA 4OI6A 3D3BJ 2J8SA 5D77A 4U7UD 3MM8B 1N5YA 2V2KA 4EU0A 4WK1A 4UOHA 1HBUA 2YH0A 3UVJB 2MQNA 2OMOA 1SV5B 2WVBA 1RWOB 4M5MA 1H7WA 4F4AA 3F0NA 2R7OA 3IAS9 2C22A 2EWHA 1RT4B 2FGOA 5J2NA 3ILIA 2DH8A 2F9DA 2IPOB 1H0HB 2VBWA 2HMIB 3C6TB 1X4BA 4GC6A 1XNRJ 2WZ1A 2WRMA 2MQQA 2ZH2A 2U2FA 4ZMMA 2CQBA 2QLBB 2KH9A 2Z2ZA 4DX6A 4ZPVR 2V68A 1X5OA 2GQCA 4MMOA 1YWXA 3M30B 2IVYA 2FVSA 2Q1LA 4OX8A 3I6PA 1PJ5A 2GAHC 1LWFB 2XMTA 3W66A 1L3SA 5DGAA 3DXSX 4OJ3A 1FI4A 1VRTB 3AB2B 4DR4F 4LSLA 3MM7B 2RSQA 2DBBA 2KYXA 2E1MC 3NGRA 1Q8IA 1AT1B 5AXLA 3IBCB 3B8HA 2EBEA 3NCQA 4P73A 4OHVA 4CQ1A 4USJC 3GIRA 5F8HA 4UOCA 4IDKA 2HFVA 1P6TA 5F8JA 4HL9A 3KYLA 1VQOS 2Y0SD 5F9NA 1RGVA 3N01A 4C3KA 1CG2A 4QIFA 3MCOA 3RU0A 4P71A 3TRGA 3N79A 3TOQA 5KT3A 1IKXA 1XTZA 4LFCJ 2DCUB 4L3KA 2LCWA 2P5VA 1U1LA 2DNRA 2AT1B 3V4MA 4C11B 3KK1B 1ZM2A 3EDQB 2CPHA 3IR5B 1TL1A 4U9RA 1FEEA 4DV0F 3NGSA 1RT7B 4DUYF 1NK5A 2NUUG 1FDDA 2HZVA 1I94F 2VDIA 2NCKL 1UKUA 3GG1A 2IJRA 4K4TA 4DQPA 2XWYA 1S6UA 5T14A 3IXQA 3TQ1A 2OEKA 4OI4A 1Q53A 5JVGQ 3MURP 2F4VJ 4TN2A 2R7SA 1GQEA 3DLLQ 4O3SA 4JI7F 2C2EA 3MUTP 4XPCA 3E2EA 2LDYA 1NPRA 1FF2A 3KNGA 3BPSP 1Y0HA 1KRPA 2GX8A 4U7UK 1PC5A 1UWBB 4O3OA 1U09A 3GFZA 5IOLA 1RAOA 3OLBA 4F0MA 3SQGB 3W9IA 5C2CA 4B3MF 2UVWA 2XC9A 4O3PA 3CCMS 4WYLA 1RI7A 3OBIA 1CEZA 1X9SA 4RJVA 2KFZA 5IM0B 2HYIB 2DVIA 2B6AB 4TNOA 2FHMA 5EDWA 1VLOA 3Q8SB 4CLKA 3A3PB 2RQMA 1U6ZA 2RMLA 4NCGB 2D7SA 4OIXA 2HHPA 1HYSB 2CQ2A 3JQJA 1HARA 2XS2A 5L39A 4C8LA 3GONA 5IV4A 2F8MA 4W98A 4RW8B 3CJ3A 2D3O1 1HBNB 1P8GA 4D3HA 3ICLA 2DJWA 4CO5A 2DHHA 1P9YA 2HVZA 2OUGA 3BGUA 2LMIA 3JSMB 2JEIA 5HMZA 2IRXA 4TYBA 1JLAA 1C4CA 1UPPA 3DM2B 4K7QA 1NM2A 4X4RA 3ZNUA 4C9DA 2IJNA 2C2DA 1K73T 1SUQA 4CH1A 2VASA 4MAKA 1O6XA 1OPIA 2ZVSA 2W2OP 3KK3A 4X84A 2ASLA 4B02A 5KFQA 1EHWA 1ZM4A 5BJRA 2ZH8A 4IR1A 2ZDOA 2RT3A 3N4WA 5E33A 2CPXA 2KU7A 3KFWX 2YWEA 3QZ7A 4CO2A 3TJAA 4ZPAA 3MAAA 1F3VA 3UQSA 3FBCA 3H5UA 2M5YA 1IKYB 3THTA 2GVZA 1OPZA 1YGYA 5EGYA 1J5OA 1RE1B 1QLNA 3W5YA 4DR3F 4OZLA 4LQ3A 1F60B 4F4KA 4RL1A 3J7Z5 2UVRA 1FRKA 2E5LF 4FF2A 2YKMA 1MROA 2VPXB 3UD3P 4P74A 3TAMA 1ZBTA 3K59A 3FZBA 1UVMA 3SFUA 4NXMJ 3OJSA 5DQHA 1SQEA 2DT9A 3VTIA 4M5LA 3TX8A 5L9XA 5IFMA 2HFNA 4L6V3 1HHTP 4WYWA 4LIWA 2AMCB 2WB4A 3ADAC 4X4UA 1U1KA 3ULHA 2JFKA 1EKRA 3AOAA 3POTA 4K0KF 4MIWA 3P49B 3HJVA 4UY85 3DGPB 3I31A 4K4XA 1UFKA 2UV8A 3HPOA 1KOOA 4I4BA 1CSJA 3EGVA 3BO4A 2XSJA 4AXIA 4P10A 4ZOSA 2MQPA 2I2YA 2BJ7A 3RBDA 2DPIA 3BGFA 4CH7A 1UJ4A 4KPYA 2E5JA 3Q8QB 2PFDA 1U1OA 1N0VC 1IJEB 4N76A 1XIQA 4LSZB 2LDIA 2HWHA 1TP7A 2HFUA 3CW2C 4DV1J 5F3ZA 2DH9A 1Q8BA 4G6VB 3DMJA 1DTQA 4LRAA 2B7BB 1I5OB 2CZVC 2LQJA 1J5EF 4ZVUB 2DEIA 1Y10A 1T05A 3G6XA 2B4UA 5A8KA 2YWFA 2JVRA 1U1PA 3N28A 3PHTA 3D7SB 3EYZA 2WOMB 2VC0A 4F3OA 1IJFB 6FD1A 3LAKA 1TKXB 2Z2YB 1SBRA 1Q81T 1KTVA 1U7LA 2FJVA 3JQMA 5IXUA 4P7VA 3K0JA 1VQ4S 2FIUA 3TA2A 4IOAQ 2PMHA 3LALA 1U1MA 1F2GA 3D0HE 3MMJA 2KG0A 2HQFA 3QFWA 2ACYA 3BDEA 2HK2A 2W2QP 1SJ4P 2O1PA 4OI2A 4CRJA 2NXJA 4CO1A 2MDAA 2RS2A 4ZLLA 5AJ3F 2QL9B 3W5ZA 4DR6F 3I56S 1VQ9S 2LA4A 2DHXA 3VHQA 3AXKA 2R8JA 1UP1A 2CG4A 2N3LA 3SV4A 2O3DA 2AJ0A 2DIUA 4A8MP 1M5PC 1C0TB 1ZETA 4YY3J 5L1IA 4TY9A 3MM8A 3HFZB 3RTVA 2AX0A 4FPIA 2KI2A 2W9CB 4ED4A 2DNNA 5D4OA 5H9EK 3ILJA 1SV5A 2C3MA 3C8YA 4FF4A 3DOMB 1FRLA 4J90A 3PFEA 1RT4A 2W7AA 2ZZTA 3QFHA 2LFVA 1KHVA 2PN6A 5KG4A 2HMIA 3C6TA 3IFEA 5GAEI 3QT5A 2L9NA 3MEEB 2QA2A 5HMXA 2N7YA 2W8LA 5HJXA 4X62J 1NPPA 2C2OB 2NQPA 3DYAB 3EZ5A 5DO2A 3DRRB 4F0KA 4RBTA 1LXNA 3P8BB 1X8DA 3UWTA 5M2UA 4NLOA 4DV2F 3B82A 3M30A 4USHA 1FVSA 2B9WA 2GO8A 5D4LA 3GV5B 1LWFA 4HHUA 3GV7B 3OFGA 1TK8A 3MUVP 1VJQA 4RPFA 2EK6A 2FHJA 4DV6J 1QDUB 1VS3A 2HHTA 4RU2A 4KHPF 3MCMA 1VQ6S 4ED0A 4OYBA 3RRGA 1OSCA 4IFYB 5CYQA 4DSIA 1HMVA 3QWPA 3ISND 3D67A 2QC3A 5DLFA 2D3OR 4QCLA 5H9FK 2DGOA 3T6BA 2XB2D 3IRWP 2DD8S 1N32F 1U48A 4NE9C 3VAJA 2HFSA 3MTJA 3TVZA 2HQGA 1REGX 4UUXA 3CCTA 4BDPA 1EQ0A 5C25B 1UMJA 2M8HA 2OHDA 2ZWOA 4FNIA 1XR7A 3MUMP 1KTQA 3KUHA 2AKWB 5HMWA 1VBKA 2WSFC 1N48A 1F2HA 3PG9A 4C11A 2W9AA 3DHXA 3KK1A 3KMSA 2AIRB 4Y2AA 3H0PA 1RT7A 4N41A 4IH6A 3I87A 3VVUA 3I0SA 4DQRA 3Q89A 4M1KA 4DR7F 2W9BB 1RISA 2QGFB 2H54B 2RDJA 2VQEJ 3Q86A 1YJ9S 2QEXS 5L1LA 5D15A 2GIFA 1M5OC 3TZZA 4NASA 1L3TA 2XTJP 2IM0A 3GMGA 4AUKA 2GFFA 5K8OA 3CC7S 3W2WB 1GMUA 1NJXA 4LF6J 2M4MA 4PXDA 2OEJA 4BC9A 1UWBA 3PO5A 1X0FA 5HQ8A 4P2XA 1RWUA 4ZPTR 2FPHX 2V9WA 2AX1A 3M8WA 1VQ7S 2YX1A 3PHEA 2E5HA 2HZAA 3SQGA 4OZ5A 5HO4A 5F8IA 3P3DA 4IRDA 4ANCA 3UNGC 1HR0J 3CTRA 4DPYA 3NS7B 4M95A 4MJKA 1D9DA 4ECVA 4L74A 2HIQA 2A10A 3NAHA 5IM0A 2B6AA 2QL7B 1GFWB 4NWBA 5HLFB 1HPZB 4ILMA 4Q7AA 4NCGA 4JP8A 3QJPA 4TLQA 4NZ0A 1HYSA 2VBZA 4ECTA 3UCGA 3T19A 1WDTA 1I6JA 3FKBA 2UXBF 3CC4S 4LFAJ 2FD2A 2L3MA 2VH7A 4N56A 3HX9A 3EPGA 4RW8A 1TKTB 1WHWA 2YKPA 5FD1A 1HBNA 2DNYA 2EFVA 1OY6A 3GPAA 3BQ1A 3NMAA 1QSSA 1UVKA 3JSMA 2X3GA 2CIMA 4DV5J 4X66J 3T1YF 1PYSB 1NK0A 2GMLA 3GTYX 1UJ5A 3DLJA 2CJYB 5LMUF 3NLCA 1VC6A 4EO6A 3TUIC 3GQCA 2LP4A 2NZCA 4G3IA 3RZAA 5C7PA 4B3OA 3CDBA 1Y11A 4C8KA 4A8YA 3A8KA 1TL5A 5E3AA 3JYTA 2C28A 3L9ZA 2D3ZA 3FMBA 4XDCA 2YQ3A 2HHWA 2VA3A 3J7AN 1DHMA 1S9EB 5U47A 4YMEA 3QPIA 5IC6B 3CDWA 2IVMA 5HMYA 3ZZ0A 1IKYA 2GA7A 4V1Ak 4Y3CA 4OI0A 3ENVA 3TAQA 2AQ4A 2E7WA 2O5DA 4WCEQ 4B9VA 3GIJA 2IBOA 3LP0B 1FRIA 3BSNA 3KDNA 3LANA 5D6GA 4OI1A 1H72C 2JZ5A 1RHQB 5HI7A 4QZVB 4FXDA 1MMLA 1ZS6A 2UU9J 1EKSA 2XYGB 4AL5A 2LXIA 5B0AA 4F3QA 5M2PA 4YR0A 2Q43A 1V3SA 3JTNA 1D0EA 3QT7A 3PEHA 1NCLA 1F9FA 3CJ5A 3RJMB 2ZOGA 1JLEB 2DXFA 2CPDA 3CNQP 4WK3A 4NRUA 3CDAA 4DFKA 3DGPA 3GLJA 2R7RA 4NXNF 2F7VA 3LH2S 2QLWA 2HFOA 1G2EA 3JS9A 2NXEA 2XQCA 3M2UB 4W92B 1HW9A 5B0CA 2X1BA 3MHYA 1SXLA 2XLJA 3GYNA 1KKHA 1S72S 3I4PA 1EB0A 1NBEB 1RTHB 1VQPS 3HT0A 3OVBA 1XNRF 4OLPA 3TW0A 4DFPA 4NEYA 3FBFA 5FIIA 4CH0S 3OR2B 1GEHA 4LRFA 3BZQA 5CXTA 1TR0A 2VZ9A 1WG1A 4KGZB 2Y0BB 4G65A 1VRUA 4I2PA 4RNOA 3L3CA 2H51B 4NLUA 4ZLJA 3G9CA 3PR5B 2AHOB 1TMJA 4CLLA 5AXNA 2B4OA 2CQDA 3Q8YA 1HNZJ 4NRTA 2NZ4A 4HT5A 2WOMA 3Q8RB 2ZJRQ 2HZCA 1EARA 3UN3A 5F8LA 3F44A 3UDEA 1TKXA 2DHSA 1TK0A 2EEYA 4ICLB 1VQSA 2NXNA 2LQ9A 2RRNA 1Q82T 2CADA 3H42A 3GFXA 5KFPA 4M5KA 3KK2B 3NS5A 1SL0A 1GAOA 4XTTA 4YDDB 4KGXB 4A46A 1SKWA 4QWDA 4P72A 1RT2A 2R7QA 3CGIA 3CXCR 1HHSA 2M88A 3GJRB 2VODA 2MY7A 1APSA 4A47A 1RBOB 1W2IA 4HH1A 5KFBA 4LQ9A 1KSPA 1XWLA 2OSQA 2AGQA 5LJ3Y 1S0VA 5K8MA 2DH7A 2CPIA 1H7XA 5IWAF 4X2BA 3OFHA 1WHYA 4NYPA 4V19J 1H38A 4YOEA 1OSDA 1X5TA 2AZ3A 3CCSS 4K8RA 1C0TA 1G7CB 4ZN3A 3DRYA 2L9WA 1NKEA 2VG5A 2W9CA 2G0JA 2VPWB 5JXSA 5A8WB 3V6JA 3T5JA 4EBCA 2RRAA 1NHKL 1BQNB 5KFSA 1RAEB 4HTIA 1M5SA 4O3RA 2BJ8A 1C0UB 2H9ZA 3DOMA 5I3QA 5D0EA 5KFAA 4USTA 2FGCA 3ZZYA 5G4DA 1EIYB 4DSKA 2HW3A 4UY8T 3P5TL 3DLEB 3EJMA 1AUSL 2VDHA 1TL3B 4LF2A 4LR9A 1HNIB 3MEEA 2HSEB 5AXMA 4GKJJ 1V3RA 2CQ3A 4NZ6A 3M8QB 3AA9A 2H5EA 3M6XA 2W2NP 3DRRA 4C6AA 2K7JA 4UZCA 3M9OB 4OHZA 1H74A 2OFHX 2B7CB 2HGNA 4DI6A 1WF1A 3IRXB 3H5YA 2ZUAA 1RU2A 3I5AA 1YJVA 4AD6A 1RHRB 3DLHA 3W5XA 2XYPB 3HSDA 1WJ9A 4WP8A 3OSPA 3J81U 4FVMA 2KM8B 4NL5A 4IQXA 1FWPA 4R25A 1S4FA 5CYJA 2OMLA 5DG8A 4LF5J 2N3OA 4JI6F 2YY3A 3HHDA 2BW7A 1SC1B 1U8WA 3FEZA 2LLZA 2R7XA 2Z4PA 3JAMU 3UD5A 1UW4A 3C16A 1RK8A 5KFOA 1RAGB 4ZHRB 3HCXA 2HVHA 2MKSA 2KG1A 1KDNA 1C1CB 3PYEA 4P9SA 4PZVA 5T41A 4PAAA 5D3GB 1WI6A 4E8UA 4EZ9A 3T5HA 3CWJA 3PJXA 2WBMA 4P2FA 1KD1T 2GO9A 2BABA 2JLEA 2EFGA 3PW2A 4ANEA 3UW1A 4DEZA 4LT6A 1CVJA 3ZTOA 2W9BA 4M5HA 2XSFA 4RR5A 1UA1A 4FDFA 3BO2A 2ZBIA 5CD4A 3CCZA 4ZVGA 2FHKA 3W8GA 5IT9U 3Q0AA 2UUWA 2Q3PA 5E7OB 3HVAA 4WTYA 1NB2A 1D09B 1AXQA 3PTWA 2IVFB 3W2WA 3P4UB 2MEWA 2Y1LB 3DCAA 3PZPA 3QJJA 3HHLC 3GSDA 1PBUA 3RW6A 3MR2A 3G96A 1E6VB 2BE9B 4LRBA 2LECA 3BKUA 4CP5A 4N8NA 3FBBA 4ECWA 2YNGB 9ATCB 4DU7A 4NXMF 1WD6A 5J1EB 2DO0A 2HBQB 3I9V9 3R2DJ 1WC6A 4F04B 4F50A 1U47A 3CMAS 3PRVA 2Y8YA 3FVYA 1F9HA 3NOGA 5HLFA 1HPZA 2RQCA 4I0WA 1FFSB 5D0HA 3PNIA 4KO0B 4N8OA 2GMJA 4DR4J 1YKWA 4DL0C 4EFAC 3TEHB 1HBOB 3QT8A 2O67A 1TKTA 1ZTWA 1WSVA 1OIAA 2ROPA 3BJYA 1U24A 1B0TA 3BB5A 2F9JA 2FQQB 4U95A 1UAWA 2JHEA 4X65F 4MIAA 4UT4A 2HLTA 2OPRB 4HI1A 3Q8PB 3N0VA 1O5JA 3NAIA 1T9UA 3JSRA 3S7RA 3WZ0A 5KFCA 1T9VA 1WWHA 4RKUC 4DBQA 3SXLA 1MW7A 4DV0J 1D8YA 3D9BA 1SIWB 4DUYJ 3VAMA 2R7TA 5A0YB 4ED8A 1HWLA 2F63A 1N5SA 2V4JB 1M90T 1S9EA 4J9PA 2W8KA 2HBYB 1S5ZA 2L41A 4USKA 3R8YA 2ILZA 2YKAA 4YDXA 1KQSR 1TL7B 3M8RA 2Y1RI 2GHPA 1BMQB 1YHQS 3I32A 3UE2A 1YBUA 2BM1A 1SB6A 4JI7J 3FCVA 4WFAQ 2L08A 4M5DA 4H4KC 1VQYA 1RA6A 4NLVA 2OPSB 2R2SA 2CFXA 2HBZB 2BKOA 5DQGA 3LP0A 4PG5A 4H54A 1RAFB 3KJQB 2ZE2B 1XERA 2EG1A 2YBVA 4C8OA 2RU9A 1ZA1B 2KZZA 3DHWC 4DR1F 4FNHA 1RBLA 4NEZA 4GMKA 3UCZP 1GTEA 1SC3B 1BWVA 4ED7A 3PACA 3R5BA 3ITHB 1GNKA 1UEKA 2XY7A 2CJKA 1S9GB 4B3MJ 3FZ2A 4ZP8A 2ASJA 1KLMB 4PKDB 2B4VA 4B9LA 1JLEA 1LKZA 1HI1A 2QA4G 3HDSA 4RW9B 1JLBA 2CJBA 2HVDA 3J81Y 1U4BA 4QWBA 1RKJA 2MMYA 3H8YA 4M5GA 4ZJLA 4JV2A 3M2UA 3NY0A 1RCXB 3I55S 4L3NA 4CNYA 5LXYA 4ES2A 4B9SA 1JJ2R 1V3ZA 3C19A 3VGUA 4J5OA 1L5UA 1B7FA 1BWEA 3HFKA 3JAMY 1RTHA 1JLGA 2N4DA 1RAHB 3C6UB 3HVTA 3H5XA 3I9ZA 5KFMA 3MEKA 2MQ8A 3LQVA 4KGVB 2ILYA 3BGLA 3OR2A 4USIA 4F02A 4Y28C 2FJBB 4WXOA 3DLKB 4R0EA 2U1AA 2ADBA 4TKTA 4X62F 5IT0A 4NLSA 3RAQA 3D3CJ 4DL7A 3R27A 4AXJA 2BKNA 1FFWB 1Q8KA 3RBZA 4LR8A 3MPDA 4QIVA 5C42B 1S48A 3MGJA 2GHVC 5K5MA 4DR2F 1GXUA 1IBLJ 1S1XB 2UVVA 2XI3A 5EN1A 2COLA 5D0RA 3KK2A 3ZZUA 5DETA 2J6SA 3K5NA 5IT9Y 1JXVA 1MWYA 3VQTA 3OQ2A 4FBUA 4RU9A 1VGYA 2V8VA 4RZRA 4B08A 4ILLA 3FFIB 2GQ2A 4NLYA 2W24A 4FYDA 3H20A 4NX9A 4QPTA 2PEBA 2VC1A 4CLPA 3NWGA 1JLFB 1L3VA 3VALA 4ZPWR 2BJ1A 4K4YA 3N6MA 3MM6B 4NYZA 3RAXA 4ZN1A 1MMDA 1OY8A 1BD6A 2FVPA 4GO7X 1OQ3A 3A8IA 4Q0BB 3FEXB 3OXGA 3JSYA 3DU5A 5DM6Q 5KFWA 4QW9A 2OPQB 2M2BA 1UEVA 1HHQA 3TWZA 4JYAF 3WIVA 1IR2A 3PR4A 2CJQA 4OYIA 2D3UA 4C8YA 2BZ2A 3TP2A 2RQ4A 3O44A 4I68A 4K0KJ 4JI8F 3PVXA 5A8WA 1RYSA 4JI0F 2ZM6F 1YITS 5GADU 4DG1B 4KJIA 1BQNA 3EXCX 4WZQA 2K2PA 2DISA 3IM8A 5I4MA 3O3LA 1FT8A 4O0IA 4OI3A 2E7VA 3IP0A 5LMNJ 2VUGA 3DLEA 3LOUA 2BJDA 2E7XA 1HNIA 3D1QA 2QJ3A 1GXTA 4KKOA 1IUJA 4I56A 1S6OA 2JVOA 3H7HB 2ZH7A 3IG1A 2W1BA 2UXCF 2RHSB 2XI2A 3QAUA 1NDCA 4YP3A 3M8QA 3W64A 4RLEA 5B09A 1JB0C 1FDNA 1KC8T 1K1SA 1S79A 2KT2A 2MZQA 1H73A 3IRXA 2VQFF 4F4XA 4CT9A 1I51B 3NGTA 1AUDA 4PWDB 4Q2MA 4PEOA 5HATA 5CYMB 1ZOTA 4A8FA 2XZDB 1J5EJ 4C98A 1S1VB 2ROGA 3CD6S 5E5NA 4I67A 5CD4H 4NA2A 2F3JA 3PDNA 2JEGA 3CMQA 2ERRA 3RB4A 1S77D 4M8LA 2ZJQQ 3SI8A 2F5GA 3NEKA 3T9NA 1Y5NB 1K0TA 1R8AA 1J2VA 4F4ZA 2NYHA 1DQAA 3F56A 2CPJA 3IAM9 3FDSA 3GE9A 3DRSB 2EVZA 3RBEA 3WX8A 4CO3A 1MU2B 4ZHRA 4Y2IA 2B9YA 4OMFG 3JTOA 8ATCB 4DV5F 1XC9A 3BGOP 1C1CA 5THWA 3LO3A 2A1BA 3QIDA 2XMAA 1N34J 1FNMA 3A3NB 3VAHA 4B9MA 2JNJA 3W60A 4IO1A 3F73A 4J9QA 4J9RA 4Z7YA 1VQLS 2IBKA 5M2RA 4HVZA 2ZHAA 4RW6A 4DL5A 5AJ3J 4JI2F 2DY9A 1NSKL 4ZVPB 3BO3A 1FK9A 2P6SA 2KT5A 2DNLA 5AT1B 2CNLB 3QMQA 3QQCD 1T9YA 3B78A 5HAOA 3HHEA 1AZSB 2ZKUA 4CYUA 1JQGA 1BHNA 2RHQB 1DLOB 4IG3B 1S1TA 1MN9A 3BM7A 1JJ4A 4IG0B 3IWLA 3TJ9A 5EX3A 1Q7YT 4IOCQ 1TUGB 4WPAA 2FVCA 5EHHA 3AAWB 2I6WA 3ENWA 2KL8A 5DZ6A 2O66A 1D9FA 1T03B 4DFJA 2BE2B 5B0BA 2FY1A 1S6QB 1S97A 3H25A 3L7OA 2D74B 5KFDA 4WKRA 2FZKB 3ETOA 2DR9A 1HA1A 4CLYA 4PWWA 3SSRA 5AE1A 3MI7X 3D6MB 2YNGA 1SI9A 1VIOA 5AE3A 5J1EA 4CDIA 5F8GA 5L8RC 1L3KA 1M1GA 1JKHB 4JUZA 2MLYA 1F1BB 4I7FB 1W7WA 2QLXA 3A3OB 2EC2A 1BXNA 3GSIA 3DLGB 1IQZA 3BKTA 4MYUA 3TUPA 4GVBB 3PW5A 1NEEA 4KO0A 1KNZA 3S1TA 2FLOA 4M5JA 3HHKA 4KHPJ 1QD1A 3QO9A 1E6YB 4GC7A 4N47A 2JC1A 1HBOA 1WORA 1QAYA 1PCAA 2DNHA 2OTLS 2X3DA 4B3TF 4RX6A 3L95X 3FK4A 4PPZA 4D3GA 4BS2A 1O51A 3CMES 4KSEB 2MZJA 2UUAJ 1N32J 4OHWA 3JB9k 1I1GA 2C3YA 5LSOA 2VOOA 1WACA 4HACB 1QUVA 2ZD1B 2JWNA 5J1NA 1FVQA 1YK9A 1HW8A 2IMOA 2M8DB 2OD6A 3PX6A 5C2GA 4ED3A 1DZ5A 1UCNA 3OTCA 1W2BR 3PIOQ 2QA1A 1VLYA 2H1YA 2JX2A 2HLUA 5A0YA 2RIJA 2K06A 1Y3KA 1NJIT 1Y5LB 4QIEA 4WFNQ 2DNMA 4FYXB 3FSXA 4ELTA 3BF4A 4EEYA 3FRZA 3AD7C 4KH1B 2ZUGA 3R9LA 2RNEA 3VF0B 1IXKA 2VBXA 2DGSA 3BGRB 2UUCF 4CT8A 2JH3A 3AXMA 5H9EJ 3MEGA 1FKAF 2DYAA 4QBUA 1HNXF 1CJTB 3OTDA 2DXDA 3BSCA 5B08A 4F3MA 2YNFB 3BREA 3OTOJ 4FVCA 1JXLA 3J80U 4OX9F 4KGMA 1TKZB 4Z2XA 2ZE2A 2LXFA 3BYRA 1OY9A 2HGLA 3HVRA 3RYLA 2VBYA 4O23A 5BR8F 4J9SA 3ITHA 2EG2A 3KJVB 2ZZNA 4Y2CA 1N6QB 3DXBA 2ZNZA 4ZCKA 2V8DA 3PCOB 1N8RT 5F3TA 3GZ7A 4Q8EA 2WONB 2D41A 4ZVTB 4PUOB 3CJSA 4NLTA 4DU8A 3AJDA 4ZIVA 1X4DA 3SBMA 5CZXA 1R0BG 2HRUA 3BBCA 4I69A 2W4PA 2JRSA 4RW4B 3T5KA 3KHLA 3R3TA 4NI2A 4RBUA 1WOSA 4DL2A 1AROP 2UXBJ 2YPYA 1ZAWA 3QBCA 3B4MA 2YPZA 5IC4B 1SL1A 5H9FJ 1EP4B 2HK3A 3DI6B 1HWJA 4HTJA 3SIPB 4UOGA 1TTHB 4ITSA 2MHEA 3I96A 3C6UA 4URGA 4K2XA 4KIAA 3G8TA 3HSJA 1S1WB 4ZVEA 4PR6A 2DGTA 3DLKA 3PW0A 1WDDA 3T1YJ 5AE2A 3OD2A 1GH8A 2K1RB 3N9UC 5LMUJ 5C42A 1M5VC 2WW4A 4NLQA 5K8NA 3DNCA 1WTFA 2ZH6A 1TZ0A 1ZAXA 3D1HA 3EDRB 2AW0A 5KT5A 2YWHA 2P2CB 1S1XA 4B9TA 3G4SS 3PX4A 4Q2LA 2HVIA 3G86A 4FPRA 1FD2A 2UZAA 4CTAB 4QYZJ 9RUBA 1WC1A 1FJ7A 1NMEB 3W7BA 2C3OA 3OJUA 1VIXA 5KFIA 1R8PA 3V2UC 2IIHA 3RB3A 1OYEA 4DS5A 4HHJA 3FSIA 3N6NA 2PIIA 4RWXA 4I6AA 2XHCA 2GV1A 3MPYA 4FP9A 1JLFA 1RHMB 4KR0B 3ZZRA 2QLFB 2XNRA 3IGVA 1MSWD 3TNVA 3MM6A 4YEAA 2E5GA 5LT5A 4NOHA 4Q0BA 1YJNS 2CWKA 2DTJA 4ECYA 3OTBA 3OFEA 3FNNA 2OPQA 1M5KC 1RJJA 4ZPCA 5BYSA 4FS1A 4OZ1A 1N88A 3R7SB 4DG1A 4NXNJ 3OHBA 2MKIA 2JJ4D 1FJGF 4JI3J 4DPOA 3IR6B 5GAHI 5GAHU 1KOHA 4NLPA 3WC2A 4KQZA 2KDOA 1ZM9A 5KFXA 1Q16B 2RS8A 2MSTA 1MWZA 4A8OA 1NDLA 3TUZC 3VAFA 3PXGa 1WSRA 4M5NA 4DLEA 2RB7A 3VAIA 4QU6A 3G8SA 1KFDA 3E3XA 3T1AA 2OAUA 4NLDA 4HI2A 3CJ4A 2IRUA 2OEMA 1CS4B 3SSQA 4U67Q 5KG2A 3U1MA 5FJ4A 5CYMA 4TQRA 2LQ8A 4LFBJ 5A8RB 1S1VA 3EZUA 2W01A 4RUCA 2CZ9A 2DRDA 5HL7Q 1C4AA 4HT7A 1D8ZA 1HBMB 3ENQA 1VK8A 3C15B 2ZH3A 2MQOA 2FTRA 2VPZB 3U1LA 1KWMA 3M1VB 2B43A 4FS2A 3QRRA 3J80Y 5HQMA 4LIRA 1VQMS 1H2VZ 1FTCA 1VFJA 2V67A 1GMVA 3AH6A 5B0DA 3T6JA 2BM0A 2K3KA 1N52B 2MZRA 3S01A 3GIKA 1ZA2B 2O01C 4OV1A 2NUHA 1UETA 4XO0A 5DRKA 3ISNC 2WTFA 2R7UA 4G1QB 4Y00A 4I64A 5IWAJ 5ETSA 3R5CA 4DL3A 3K5LA 1IM6A 1VQNS 1TVRA 2C1EB 2WW8A 1GMWD 2ASDA 3MECB 2KVIA 2PMWA 2BJ3A 5DQIA 3NCPA 5LXRA 4FKXA 3MM5B 4K4ZA 1RWXB 3AB4B 1AZSA 3OVSA 2RD5C 4B3SF 2EK1A 2BX6A 5KG1A 4OYOA 1RHJB 1DLOA 4ER8A 4IG3A 3K5PA 5D4PA 2HNDA 2YXLA 5ETOA 4IG0A 3M6VA 3CEDA 2BDPA 2VF3A 2L9DA 3LP1B 1B99A 3VAKA 3KG1A 2YNHB 3GJTB 3E01B 1U2RA 3MM9B 2BE2A 4AYBD 1S6QA 4KV8B 1F5CA 3SZ2A 2RAQA 4DX7A 4ECZA 4K5RA 5KG6A 3LA0A 2HFZA 3HP6A 3D4JA 3W61A 4OYXA 1RHKB 5G0RB 2LEPA 3FQKA 3M9MB 2LQ5A 7FDRA 4IH5A 3M8PB 4I7FA 1RDRA 4TLRA 5HJYA 3PYGA 3SYZA 1UA0A 3O2IA 3DLGA 5E3RA 1PAUB 4LUBA 4ZJQA 3GP9A 1FD8A 4LF1A 4QIGA 4B9UA 1DFDA 1SIZA 2XCAA 5I3PA 4P52A 1E6YA 2CPEA 1GT8A 3A8JA 1FHTA 2MSSA 3C46A 4EBDA 4JI6J 2AGPA 5GAGI 5KFVA 3GJSB 4ZVOB 2M70A 4Z7CA 3M2RB 1BC6A 5KT4A 6FDRA 2H65B 4NMXA 1ROFA 1U8SA 2ZD1A 4OJ1A 2C3UA 3R6LB 2W7OA 4DCPB 4ZVRB 1OS5A 1IQTA 4DR5F 3HSGA 5HANA 5HVHA 3KOAA 3W63A 1RLDA 2H5JB 2ASYA 3V4IA 3NXZA 2OD4A 2PI5A 3IA0A 1X9WA 2J9DE 2IC3A 5HN0A 2D9OA 2XY6A 4XK8C 1C1BB 1IBLF 1EX8A 3D0GE 3MD3A 4DCJB 3V6KA 5HBMA 2J5AA 4NYOA 4DSJA 2V2QA 4KC5A 4DWIA 3BGRA 1Q79A 1IBKF 3PO4A 4F4WA 4X4NA 4MH8A 1IBMF 1RTIB 1RWKB 3WQPA 1MMNA 2HPUA 3AA8A 3OW2R 1CJTA 4MK9A 4U8VA 2YNFA 4URQU 2AYMA 2ATCB 1XR5A 1TKZA 2HKEA 3HKWA 2IYGA 1LWCA 3A13A 3OV7A 3U1NA 1VHFA 2MZ1A 2YH1A 3TARA 4WIIA 1RSCA 2DR5A 4DF8A 4ALZA 2IY5B 4OZJA 1SKRA 2MZTA 3DOLB 2K7KA 3BBBA 1MNEA 3LGMA 1N6QA 1T9WA 4KBIA 2R8GA 2GGPA 2E1AA 4O3NA 1RT6B 4UOFA 2WONA 4PUOA 1HWIA 1GMWA 3EGZA 3TJ8A 4TQSA 4DZ6A 1Y7PA 1V9OA 2DEJA 4RW4A 2V8HA 2XCPA 3Q2TC 2E66A 1H98A 1EP4A 5CABA 1A7GE 1TL4A 2UXDJ 1U0SA 3NKYA 2XS5A 5LMNF 1RU1A 3VZHA 3LF0A 2V2VA 3MMAA 1RWPB 2D1CA 1LWEB 1RT5B 2ZJPQ 4ED2A 3C3LA 2H4WB 4L75A 4NLRA 4O0NA 3TZXA 2K1RA 4X65J 2HS0A 4RNFA 4PG6A 5KT2A 1YJWS 2FVQA 3R5AA 4HR2A 2XWXA 4HEA9 5EWFA 5KFGA 1IKXB 3GFYA 5HVFA 2ZEJA 1N36F 3LWMA 4WF9Q 1TL1B 1H2UX 3I4HX 4DMZA 1Q7LB 2V2ZA 3L09A 3BKFA 1RWWB 3ILLA 3KXDA 4UQTA 3SSSA 1YRTA 2QRRA 2HS4A 1OYDA 1OMSA 3KMQA 2VV5A 4ZITA 3GJQB 4PG7A 3OVAA 2GW8A 4Z37A 2XMMA 4F2SA 1WOOA 3PM9A 2FJEB 2QZ8A 1KR4A 4NMLA 1IM4A 1IR1A 4C3LA 2OPPB 3A4TA 2WB1D 2OTJS 4P7TA 1N5TA 3K89A 1RTDA 2B56A 1N34F 4MKBA 4X64F 3X1LB 1DY3A 4ECSA 4OJGA 2HRYA 4DR1J 1TAQA 3FMWA 1GX6A 2QG9B 4QIWD 3MOZA 3U7JA 4K4SA 2VD3A 3MAQA 2BMBA 3KLHA 3JQKA 2WVDA 4OLOA 3QWUA 3KLIA 4I2QA 4KT0C 1LV5A 4IUFA 2XLKA 2G2ZA 5A2QU 2EFPA 3KG4A 1O0PA 1RA7A 1NH7A 1T94A 1T0TV 4FF1A 1WG4A 1L3UA 1YJTA 2BXJA 1SH0A 3HLUA 2VU5A 2HHHF 3UVJA 4M63A 4Q45A 2KYZA 3HXMA 4X4VA 3KHGA 1Z4UA 5DGBA 1R0AB 4K5SA 3K8WA 4GVLA 2PT0A 2YNIB 4MFBB 3HZGA 3BR9A 2J9EA 1K44A 3C2PA 3AOCA 2B4PA 2BEFA 2X7IA 3R2CJ 5GAEU 1JLQB 1UEUA 4CCHA 1YTYA 3V81B 2XBPA 3IMQJ 2J7UA 3MEDB 3EPIA 3CO9A 1VOMA 1JIHA 1CS4A 3WIUA 4ZIWA 1MWQA 3CJ0A 4U7CA 1B3TA 4J91A 2W7PA 2PO4A 2RDIA 2EBGA 4ED1A 1TK5A 5KT7A 1HNWJ 5A8RA 2FVRA 4G1IA 1FNOA 1RUSA 1EJ7L 4DR2J 2E9RX 4ZLPA 3T5LA 1XBWA 3TA1A 3OT9A 1PJ6A 3K58A 2DCLA 1VRTA 1TFWA 4LBHA 3MM7A 1HBMA 1NLKL 1IWGA 3HFVA 1YG0A 5CA5A 4ELVA 2OP5A 1HQUB 3UI3A 2XHWA 5DDQC 4TYAA 2BANB 4PG4A 3M1VA 3OFFA 2UUAF 2IMWP 2G0CA 1S1UB 3ZXWA 2RU3A 3SCKE 4J37A 2HRTA 2IJFA 1J5OB 1N33J 2NSBA 1VDHA 2E1PA 2R2TA 2AYGA 5DLGA 4G1QA 2Q6CA 3VGSA 1PGZA 3G71S 3MECA 4GRSA 2NR0A 2RF2B 5GMDA 2RE1A 2JSXA 2QSWA 1V6HA 3MM5A 1PG5B 2ABYA 2ZC4A 5BXIA 4JYAJ 1SCJB 1R31A 3MR6A 1XMOF 4W90B 3R6GB 4A4JA 5HROB 2N82B 5LL6d 3MTKA 1U6FA 4JI8J 4BC7A 4J9KA 2VKRA 4I6YA 3LP1A 3DDNA 4JI0J 2ZM6J 2FLPA 5J2PB 3K5OA 1RAAB 2KJWA 4PQUB 2CWXA 3E01A 5EX0A 3M6UA 3CJKB 2DR8A 4KV8A 1KQFB 3OTOF 2EKNA 2G9OA 1NJZA 2AJFE 1SJQA 1SQGA 3AY0A 5ETPA 3SCIE 3MPVA 3R97A 1RAJA 1I3OB 2I1RA 3OTEA 5HP1B 2YKOA 2RILA 3TUJC 2UXCJ 5J2MB 5G0RA 3W62A 1UFWA 4JI5J 3UPFA 1JNZB 1YDLA 2ZH1A 4O4GB 2YX7A 3VR1A 1KP6A 1P27B 5C5JA 3MZIA 2VQFJ 3SCLE 1YRUA 1GX5A 2GNKA 4KGKA 3ETMA 1KN6A 2BBEA 1XNQF 1T02A 2OFGX 3NOCA 1UVJA 1SL2A 4YS2A 1HWUA 4LJMA 4I6WA 1S0NA 3TYTA 3MWBA 4FF3A 4ECQA 3L7UA 4C3MA 4BCAA 2SXLA 1B64A 3V6DB 2MKCA 4P75A 2GHWA 2CNKB 1U1RA 5ETKA 2F40A 1T3NA 2B5JB 4QQBA 2Q6BA 1X7VA 3WX4A 1R6YA 1T7PA 3M2RA 2KT3A 3KLEB 3QGIA 5E3PA 1XMQF 3H2LA 1KBRA 3D68A 2DIVA 3AHPA 1CQNA 1TKDA 3LAMA 4EO8A 1BY9A 3DM2A 4JI4J 3F41A 2B3TB 4R5PB 3GYGA 2HEKA 2XZTB 1X4EA 2UUBF 3GV8B 3GCXP 5D78A 3KLVA 5KFYA 4OYAA 3FCHA 4Y2MA 4CLWA 1XQIA 4JI2J 4H4OB 3KJFB 2J9DA 3NNAA 1C1BA 2QFIA 1DQ8A 4ECXA 4HHHA 4M94A 2YKQA 3JXOA 5A2QY 1T8EA 1AB8A 1MLAA 3Q23A 2HGMA 4XIUA 3LP2B 2R8IA 4YN3B 2JLGA 2MY8A 4LR7A 8RUCA 2PEHA 5ETTA 1NK7A 2V69A 1C2PA 2HAIA 4BWJA 3OHAA 1YQHA 1UW9A 4MYTA 1RTIA 4JV5F 3CD7A 3PIPQ 5CAAA 3W1YC 3CCLS 3QT6A 4BLGA 2R42A 5CQGA 2QE5A 2DR6A 1PBAA 3NWRA 3QNWB 4ES1A 1X60A 1UVLA 3W8PA 3DOLA 4J9OA 3D6HB 3BH7B 3G6VA 2J0QD 4C0BA 2J0XA 4NLGA 4EBEA 5L9NA 4RW7B 1S76D 5K20B 5KT6A 4MKAA 2CPYA 1RT6A 1NNDA 1RACB 2E29A 4PYDA 3BYPA 4L73A 1X4AA 2K8GA 3BH6B 4B3RF 4ZPBA 2DK2A 1PKUA 2I5JB 2DNOA 4KTQA 3QIPB 2OKQA 1Q1KA 4JI3F 3OUYB 3MPWA 1SJRA 3MXHP 3CT9A 5CYQB 2JEJA 3GB0A 1QTNB 3P6YC 1HMVB 1RYRA 4Y65A 4B3TJ 3D66A 3NGKA 1LWEA 1RT5A 4Q43A 4USUA 1LW2B 4F8RA 2CNOB 1PYTA 1B0VA 1Q5VA 2J9CA 2BRLA 2QL5B 1JNRB 2Z57B 2KM8C 5ETVA 4KAIA 5F0UA 2ACMA 1OWXA 4RNHA 2RKIB 4ENOA 1T9TA 4DX5A 1S57A 2VJUA 2RH3A 1NHUA 2APOA 1N56A 4QPXA 2AF6A 1K0VA 2NPIA 4KE5A 1KLNA 2Z58B 3B54A 4A48A 4K2JA 2OSRA 3MFIA 5DDRC 1YBAA 3GR0A 2M3DA 4K4WA 1S59A 3QGHA 1JX4A 3MFHA 4LFBF 1PILA 2GIRA 3CULA 2VL1A 4X4PA 4DV4F 4JV0A 2IHR1 2MKHA 3BSAA 4GO5X 3I0SB 3DC2A 5D4NA 3NGDA 4DQQA 3G6ES 4AE5A 1LK5A 2NLWA 1NPKA 3KLGB 3K17A 5GMKa 1YJUA 2DGUA 2UUCJ 2P6TA 1VJWA 4RWWA 1PC4A 3FQLA 3LTOA 2XNQA 5J2QB 3QATA 2OPPA 1WHVA 1YZ6A 3BQ2A 1HNXJ 2XMWA 2JC0A 2W2PP 2L48A 2K3IA 4C8ZA 3KKFA 4OX9J 2CUYA 3PYFA 1ACMB 2MGZB 1U49A 1Q4RA 2GCFA 1R27B 4C8NA 3D5MA 5KOXA 5KOWA 5CHCB 1TELA 2DNKA 4DPTA 4DUZF 2V94A 1UZDA 3LPEA 5KFLA 2JEFA 5BR8J 5DG9A 4PYAA 4WIQA 1KQKA 1VK3A 2CQPA 3OL7A 2LXUA 3J7ZT 2FYXA 4FBTA 1B0PA 3OXLA 2CQIA 3NGUA 3G8QA 1NAQA 4LF8F 3A8EA 3TVKA 4FZVA 1IBCB 4WJBA 4OHYA 4DV7F 1UPMB 2CQCA 1R0AA 2Z56B 4Q44A 2BV3A 4ECRA 3IS9B 2H3EB 2V6AA 2YNIA 4MFBA 1WEYA 1UFLA 1QUPA 3HMJG 1ZZNA 3TVYA 4DL6A 2F4FA 3VGTA 1JLQA 5J1PA 3Q24A 2IM2A 2J76E 2V4RA 2FC8A 3QGGA 3V81A 4OHXA 2BQRA 1FXDA 3DYAA 3MEDA 2M9KA 1B70B 4RO0A 3HO1A 4ZLNA 2EW9A 1QSYA 2XG8A 3FSYA 1HKAA 2CJXB 3MD1A 3D6TB 4B3OB 2CDRB 5KFTA 2AP6A 4DN9A 2X1GA 3QYYA 1FE0A 3A1YG 2A2DA 3D1OA 2QLJB 2FJWA 2HHQA 5HSPA 1WNEA 2HURA 3JYTB 1KVIA 1YI2S 2CQHA 1FKOB 3O6QA 2Q79A 1DURA 5DDOC 3N6LA 1X5SA 1S10A 4IFYA 1F5AA 3QZ8A 2XEXA 1R89A 3LGNA 1ZTTA 3ONQA 2ZKTA 5I3UB 1HQUA 4F25A 3TZYA 3IC1A 3VV2B 2BANA 2EC0A 1LW0B 3QSIA 4FYYB 1U0HB 4E98A 2V63A 2CKWA 2Z2LA 2KXNB 3CUNA 1S1UA 4NLXA 3KUGA 3NNHA 3PYDA 1WF0A 2BOPA 3LW5C 2PA8D 2W4CA 2DGVA 2E9TA 5C25A 3Q8VA 2IDEA 4YHHJ 2XMVA 4DV3F 3EUNA 1TQLA 3PFOA 4ZVSB 4KYZA 5ADZA 4WZMA 5ETNA 4JB8B 1FXRA 1Q95G 3FRYA 4X4QA 1FTRA 2A6MA 3MMBB 2OO4A 4U96A 1KVKA 1NJYA 4ZCLA 4YQWA 1NZAA 4ZS6A 2RF2A 2LA6A 2E1RA 1FX2A 2ZBRA 1Z2LA 3KDOA 2YWKA 3K7RA 1ULRA 3ENAA 3M32B 1KVJA 3N5BA 2FHJD 2JDJA 4EI2A 2BYCA 5HROA 1IKWB 1WHXA 3HVWA 2LVWA 4DQSA 4AT1B 7AT1B 2EFQA 2GJ2A 5J2PA 2CVEA 1S49A 2BUNA 4CM0A 2XMJA 4J9UE 2MQLA 4PQUA 1FJGJ 3CJKA 3UDVA 1UTAA 2IAJB 5FLXU 1F9EB 3VVTA 1WI8A 1SC4B 1W26A 1YSJA 2RUGA 2QFJA 5HP1A 1RAIB 3TX0A 2VG6B 4O44B 3R5DA 5J2MA 1NK9A 4C48A 2V4QA 2XLIA 2AEMA 4MTPA 4O4GA 2I8EA 2C2KB 2Y9HA 3R7BB 4ZP9A 4FKYA 3M05A 4DXLA 2HBRB 2N7CA 5CH7B 1VRUB 4I2PB 3NMRA 3EX7B 4WFXA 1FKPB 1FCAA 2JL9A 3IBWA 3US5A 2B0GA 5IQQA 2ROEA 1RTJB 4IO9Q 4X4OA 2JFDA 3QAEA 4IQMA 3FUYA 3CE8A 4OYMA 3ZNJ1 3BQ0A 3V6DA 1LFPA 3EVWA 2ZH4A 2ALYB 2QT7A 3OSNA 2Z0GA 4KPCA 2B5JA 2UXDF 2RDDA 4EYHB 1UVIA 1FX4A 2X1AA 2DGQA 5LM7E 1X0PA 3HSZA 2HWIA 3KLEA 2X1FA 1RT2B 3WHIA 3PJ9A 2GZOA 3P45B 4KH0B 2GVDB 1Q86T 3Q8UA 4RNNA 2XGQA 3BN7A 1KHWA 4R5PA 5F41A 1RADB 1T9XA 3DRPB 2R8KA 2IFXA 4G1PA 2IDLA 2QN6B 1R0CB 2RJZA 3AJ1A 4H4OA 1RWVB 2KFNA 1UZHA 1YBTA 2OELA 3LUYA 1FERA 2BJ9A 4O4RA 3E8OA 2H5IB 4IR9A 4RNMA 4J9MA 3LP2A 3KWMA 4DLGA 2QX0A 4IH7A 4TXSA 3UCUP 3OL9A 4B3SJ 2LU1A 2HHVA 4HYKA 2VG5B 2XZWA 5EUHA 4F67A 1CC8A 3EMTA 2E9ZA 2HQ3A 3Q2SC 3UO0A 3UD4P 2AU0A 3RAMA 3I0RB 4FXVA 2BVZA 5IT4A 2R2RA 1PIEA 5JVHQ 3MF5A 1BUXA 3VQSA 5CCLA 1XJWB 4RW7A 3CJ2A 4V19X 1FDBA 2IRYA 3IGNA 4NZ7A 2PGCA 4ECUA 1U02A 1F6TA 2GQQA 1X31C 2J6TA 1S7IA 2Y1IA 3KUEA 2OGUA 4XDDA 2ZBPA 2I5JA 2KZMA 3UNYA 4PRFA 3QIPA 4PABA 5B7WA 3OUYA 1SJFA 1IVZA 4ZCMA 4GKKF 3BN4A 2NS1B 4ETXA 3T1HJ 4LVNP 2YKNB 2WAQD 3PX0A 1D3WA 1LW2A 1BQXA 1YLXA 3AFGA 1UL3A 2MJUA 2CPFA 2RKIA 3C16B 4C4WA 4XPEA 5RUBA 3TI0A 4J9VA 2FZCB 5B0EA 2C2RA 5K8PA 5ITHA 1W25A 1DTTB 1WOPA 2KFYA 2MZSA 4DR5J 3ZZZA 4UQGA 4JBCA 1VRQC 2XY5A 1SC6A 1SH3A 2ADCA 1QJHA 2XO6A 3CDEA 4DPWA 1HNWF 1F0XA 4LREA 3TQEA 3RUBL 3KHHA 3KLFB 2DGXA 5T7LB 2KXFA 4FYVB 1TUWA 1BQMB 2GJIA 3V5RA 4EGLA 1LWXA 3U02A 1S6PB 3UDLA 4ICLA 1QAXA 2J6UA 3KLGA 5D8HB 1TMMA 5E3CA 1IBKJ 4YB5A 3RBXA 4QYZK 4OYPA 4LF7F 3DDKA 2NSCA 5J2QA 1IBMJ 1SVDA 3H90A 4AQYF 1GK8A 2XMUA 4ID8A 4NCAA 5FLXY 3EZOA 3CCJS 4PXEA 3OL8A 2MGZA 1N33F 3TZWA 2G1HA 4MK8A 2CNNB 2HS3A 4P2SA 2IM3A 3ZO7A 4ZVFA 5KFNA 3D0IE 4ZK7M 2QV6A 4QW8A 1RLCL 3B6BA 1YJRA 5IQ6A 5IS2A 1V5IB 1R3NA 3ZFVA 4R0JA 3PV8A 1HQEB 4IYQA 2DB1A 3IWXA 3SFGA 2MKJA 2ZDPA 1T3OA 1VBYA 3QJLA 2VHGA 5DJBA 5KFEA 2ZITA 4Q5VA 3CCES 3PY8A 2BJEA 3FC9A 4EMDA 4DN0A 3N5FA 1SJ1A 3VAGA 1C0UA 2V34A 3IS9A 2CG8A 3CD5A 4LF4F 5MAOA 3UN2A 4DSFA 3PRDA 1TU0B 1TL3A 3GIIA 3KJNB 3T9ZA 5LOQA 3R5GA 2KB2A 3MPUB 1V5VA 3UDCA 5BYQA 4WE1B 4YR2A 5K9FA 4UW2A 4JI5F 4BHQA 2C42A 3H4BA 4HLBA 1BLUA 1WF2A 4KHRA 2CQ0A 4Y6IA 2WVFA 5EWEA 2J7WA 1N36J 1LNQA 4MIBA 4NPOA 3X3UA 4ILRA 4DUTA 4P6QA 2G2OA 1FKOA 1QE1B 1WC0A 5KFKA 3TO8A 2HQDA 4FXWA 1LQ9A 5I3UA 5MLCV 2Y1JA 5KFHA 1LW0A 4JI1F 1U0HA 4JV1A 1VQ5S 4ID5B 3D2WA 1F3FA 1VC0A 3R1HA 3RR8A 2PD1A 4C7QA 4L72B 2JOQA 4N5SA 3HJFA 4M5DB 2D9PA 2VFTA 1K8AT 1XMBA 4YFUA 1T11A 4PXBA 4JI4F 2VB6A 2MQMA 2QSFA 5D3GA 3O1LA 4X64J 2I0XA 1QM9A 2YVSA 3MMBA 4CLUA 4W4MA 4PPDA 3BR8A 3Q22A 4A8QA 2KHCA 1FA0A 2V0NA 1EQMA 2PI4A 3M32A 1PJ7A 4FN5A 2ALZA 1YX2A 1IKWA 2H48B 1FEHA 1NSAA 2XS7A 3BSOA 2E1CA 1JLBB 3TANA 1Y00A 1LXJA 1CJVB 1HLWA 4CWBA 5F0WA 1NSQA 1Y3JA 2C2ZB 2HHHJ 3PJWA 2QYCA 2GC8A 1SJ3P 4DHVA 1S9FA 2GAGC 3LPYA 2IAJA 2DNQA 1AYEA 1NZ8A 3C14B 2WCXA 3DOKB 4KY3A 3SQOP 1JLGB 1H2TZ 3HVTB 2VG6A 1E6VA 5JMNA 1S0MA 4O44A 2HNZB 3DRXA 1OO0B 2HWTA 3EXYA 4JOUA 1NK4A 5E41A 3IWNC 2J8AA 5DDPC 4QJVA 4WFBQ 3GU0A 2UVUA 3W65A 1XN9A 1FWLA 3RG6A 3AD9C 3W9HA 1FKPA 2AGOA 3CIZA 1FDAA 1HQ2A 2XMKA 1VHIA 1ITPA 1X9MA 1RTJA 3UN5A 1YJ7A 3MCNA 4ZP6A 1Y4ZB 4DFMA 2DGWA 1RWMB 1F5BA 4ZVQB 4N77A 2BQ3A 2FLNA 2XO7A 5IZHA 2AYBA 2OH2A 4YB7A 2Y8WA 2IA0A 4YB1P 1FJEB 2EI5A 2CJ9A 4Y0FA 3JTPA 4K59A 3KNAA 2R2UA 2FLLA 2GVDA 2FUG9 1LFWA 2V50A 4IKAA 2OPRA 5HK4A 4WP9A 3DRPA 1OJ4A 2J0SD 2EFOA 4LFCF 1NO8A 3HD2A 4E0DA 1Q8LA 2VKZG 4HDGA 2HQIA 4PWUA 4CLFA 2YWGA 2KHDA 5I42B 3FJ2A 3MR7A 2B9EA 1WG5A 2XM3A 1DBDA 5SZTA 2VONA 2OJ3A 4C0HA 3T3FA 3SMZA 4OL8A 2V4JA 3UR0A 3DGVA 1XMOJ 1VI7A 4EZ6A 3ZTSA 2VPYB 2NXCA 3GIMA 3OXFA 1G1XA 3ZTQA 1N5VA 1TL7A 2BA9A 3D54A 2F4VF 2EKYA 2XGPA 5L1KA 1U45A 3CJ8A 1UJ6A 4BWMA 1VR6A 3I0RA 4DS4A 4EYIB 5HQLA 3FCWA 1RWNB 4DSLA 2MHNA 2OPSA 3R5JB 1OQ6A 3KTQA 3HI9A 4J9LA 2PC6A 4USVA 1FESA 2VICA 4KKOB 1Y9OA 2DPJA 4IFVB 3IG1B 4C97A 3C66A 5E3QA 3DU6A 3I5BA 4DPUA 2VFUA 1QVFR 1ZH5A 3RW7A 3HD1A 1S9GA 3I82A 5F8MA 1KLMA 1M1HA 2FB0A 5KG7A 5GVQA 5KFZA 2YX4A 1XNQJ 1Q5YA 4URSA 5LJ5Y 4RW9A 5D0GA 4H4MB 4MKVA 3NP5A 5LSRA 1REVB 1BE4A 1O8BA 3THPA 4QR1A 2QYGA 5KG5A 7FD1A 3HHNB 5HVGA 1CJUB 2YKNA 1R8CA 3ZZOA 1KONA 2XYHB 3MR3A 1K1QA 2LEBA 4C2MA 3FGVA 3MDFA 3NBPB 2AJ1A 2Z30B 3AD8C 4OZ0A 5DS7A 1XMQJ 5ETQA 2NXUA 2ZBCA 1YRXA 1MN7A 2W2MP 2DO4A 1DTTA 4ES3A 3RR7A 3OR1B 2LYVA 3IBFB 5K14B 5FDLB 2BQUA 2UUBJ 4XAKA 2HHUA 1WC5A 4RW6B 4U8YA 3CF5Q 4OQJA 4LVOP 3H2UB 3KLFA 5L38A 5T7LA 1FK9B 4O3QA 3J81j 1BQMA 4M5IA 5E0OA 1PAEX 2AD9A 1S6PA 4DF4A 1JWWA 1YVFA 1XK8A 4LF9J 3I5CA 1RCOB 1X4CA 1SKSA 4CYUB 1J27A 2MLZA 1S99A 4LSNB 1S1TB 4WWSA 4F26A 3CB4A 2Z8QA 1KFSA 2WSCC 4JV5J 4ZKAA 3FFIA 3SDEB 1N54B 4WBFA 2EXUA 2V8PA 4UZBA 4YHHF 4K4VA 1Z1ZA 4IRCA 1A9NB 3CPWR 4UF4A 2PFFB 3G2XA 4DZDA 4YUDA 2KRRA 3CIMA 1HWKA 2QO3A 1CULB 4Q8FA 2CRLA 4OFZA 3AT1B 2LKZA 1NK6A 3IO1A 3CO0P 4HDHA 1D9AA 1G6BA 4KFBB 2DKOB 3M4XA 1HQEA 5F8NA 2PDAA 4ZJOA 2RQKA 4B3RJ 2M7SA 2DR7A 4A8WA 1S4EA 4ZPDA 2ZH5A 2ZNYA 2BE7D 1SH2A 2KTQA 1X4FA 3U27A 2V9KA 3BPDA 1IN0A 3HZEA 3T41A 3QO9B 3WC0A 5AXKA 4EWTA 2BRKA 3PEJA 2HNYB 4LRCA 1H3DA 1NKCA 1QY7A 4YB6A 4CNZA 1IR0A 5KTQA 4MKYA 1Q0NA 1TV6B 4WE1A 1U1QA 2QTWA 3J7YI 3J7YU 1BGXT 3CJRA 3D28A 3M8ZA 4N7TA 3EVMA 1RB0A 3AQPA 4X4TA 2FY8A 4DV1F 2WHOA 2QIFA 1UWAA 3Q83A 3CCWA 4PWDA 3P96A 4OYWA 4QOTA 1WUUA 4RBVA 2ZZMA 2UP1A 1NXIA 4F0HA 3IR7B 3EGWB 1QE1A 1HI8A 4DV4J 1NDPA 1Z2ZA 3GCWP 4F2RA 1I94J 2YQ0A 4QWCA 1X4HA 1VISA 1YIJS 5C24B 4S0MA 2P9EA 4ID5A 1RT3B 3DRSA 3MEGB 1EETB 1JMTA 3QLHB 1MU2A 2CQ1A 2HHXA 3GYXB 3TEGA 3BDPA 4KB7A 1LOUA 2ZHOA 2A18A 4AL6A 2Q66A 1JLCB 1CPZA 2P8IA 1HI0P 3GR1A 4X4SA 4ERDA 1HNVB 5E2QA 2EFNA 2VG7B 1XR6A 3BBFA 1JXEA 1G4CA 1K9MT 2IA6A 1U1NA 3B4DA 1VBXA 1U6BA 4DUZJ 1MG7A 1DQ9A 5KFFA 3M8SA 2KO1A 4KRWA 4CLSA 2VFVA 1ZZFA 3EWGA 5B0GA 4YR3A 3QGPA 2J7KA 1HD0A 4YY3F 2IM1A 3HHLB 3W9JA 1CJVA 1NB7A 1R8HA 2MTLA 4LF8J 1RTZA 2CQGA 4PG8A 3DN9A 3G82B 2PMZD 2FJXA 4ZP7A 4PXCA 5ETRA 1FXLA 4NI2B 1NHVA 2JLFA 4DV7J 3A12A 1QTMA 2CVIA 1KS2A 3HK2A 3R7NB 3C14A 1P1TA 1T03A 3DOKA 2RUSA 2B8PA 2ZVIA 3AODA 4OJHA 4RUHA 1JJHA 2R7WA 2MPUA 1RT1B 2HNZA 2MLXA 1N4LA 2NREA 1RP5A 4B9NA 2DNZA 1NDKA 3D6FB 3MMCB 1LEOA 4TVAB 3RRKA 2R9LA 4WXWA 1JKHA 4ED5A 1FE4A 1NU4A 1Y5IB 3E51A 1RQ0A 3V6HA 3H5SA 1M1KT 3ISZA 1CJKB 3RGIA 4GVBA 3DFEA 4HH0A 2WSEC 5B0FA 2VJVA 1GTHA 4DV6F 2PE8A 4IOBA 1S0OA 4HKQA 1N0UA 2M0GB 3NCRA 1FRMA 4F4YA 4QR0A 2YWWA 3T1HF 3M2VB 3W2VB 4WTOB 2FZGB 5GAGU 4ZCIA 2CPZA 3HF5A 2KJVA 3EM1A 4USWA 3CJQA 2Z2MA 2XULA 1TUVA 4FYWB 4P2MA 2G0IA 1ZAVA 4ATNA 4DL4A 3KHRA 4ETZA 2NPFA 4HACA 5KFJA 1SKUB 2CJAA 2DRBA 4DR3J 4DV3J 3R1LA 3GFHA 4R8UB 2G1DA 4OZ2A 4OYZA 4TY8B 2E5LJ 2QMWA 4LBPA 1U2CA 2FJDB 2I38A 1HL6A 1JJCB 5H1SV 1NKBA 1DJ0A 5I42A 1IKVB 1VBZA 2DNGA 1T95A 3GWCA 2MYFA 1WC3A 2VFRA 3H2VE 1X5PA 3LGHA 3ET6B 3TR5A 1WKKA 2KVQE 1XEZA 5ETLA 3ZTPA 3EGNA 4DSEA 4USMA 5A6WA 2DXEA 1FO1A 2R4FA 3MAHA 2KKHA 2C2NA 2NYIA 1VQ8S 3FEYB 2VQEF 5GADI 1RZMA 3MCSA 2ATLA 1N5YB 4WKYA 5KFRA 1CC7A 1U2FA 3O5TB 2AV5A 1NK8A 1HBUB 3CSKA 3EVOA 3HT3A 1KEKA 2VOPA 1WTBA 3HM9A 2MJNA 2A6OA 4LF6F 3VWSA 1VYAA 3K5MA 3QRQA 5J2NB 4IFVA 2ZC3A 2V5HG 4DQIA 1VMBA 2FJAB 1GXLA 3CC2S 4UTGA 2MB0B 4QWEA 2VFSA 2R3VA 1WEZA 2CA9A 3KJVA 3DDIA 4E2FB 2CZ4A 1HR0F 2D69A 3G87A 3K57A 3NRBA 2A3JA 1A6LA 4AL7A 3HKZD 4WFYA 1QAJA 1FRXA 4CO4A 2OI2A 4H4MA 4TU8A 4OZ3A 3VGVA 4TU7A 1REVA 1ZPVA 4U6PA 2LEAA 4QWAA 3FBEA 3TA0A 3BEGB 3AOBA 3M9NB 1PYOB 2G13A 4L76A 1PO6A 2YTCA 4LFAF 4LSLB 1K47A 1CJUA 1WKJA 2P9CA 3M7VA 1ZM3A 3CCRS 3DI6A 1WEXA 3M6WA 4CZCA 4DDFA 3RB0A 2ZWPA 2FDNA 3NBPA 5DZ7A 2HHSA 4IDKB 2KN4A 2AWZA 1S1WA 3BS9A 3PRBA 2V8GA 3LWLA 2BOAA 4X66F 4A8XA 3PKMA 3VZIA 4TU9A 3GG0A 3OR1A 3EE3A 2E44A 5K14A 5DM7Q 5KAKA 4K50A 5FDLA 1EZZB 2B8QA 3ZC4A 2HQCA 5ETMA 3TAPA 1FRJA 1FFGB 4DR6J 2GS8A 1M5HA 5L1JA 2DY1A 1TVRB 1WC4A 4LRDA 2MKKA 3HHLD 4QYRA 1SPBP 3ELHA 3H4DA 4CTAA 2CXEA 2ZOMA 1G3OA 4LSNA 5KG3A 2HNDB 3K2YA 2WVEA 3IN5A 1ICEB 1NUEA 2BACA 2YQ1A 3SDEA 3H98A 1R6VA 5JUMA 4DCOB 3CCUS 2KRBA 4NA3A 1FWKA 1NSPA 1VQKS 2FC9A 4CIOA 2PA3A 1CQMA 2B9XA 3VCDA 4MT1A 1R43A 3MR5A 3IM9A 1HIYA 1CULA 2MXYA 2F8EX 2UU9F 4C8MA 2HIYA 2F65A 3AQOA 5KG0A 2PSZA 4F7VA 2AEFA 4KFBA 2DITA 3WBZA 1QAIA 2MKYA 2ZHBA 2DHAA 2KXHA 3G6YA 1RHUB 3O8WA 4DV2J 3W3SA 3PW7A 1NH8A 5DG7A 4EUVA 2WK4A 4DPXA 3M8YA 4WU3A 2W4DA 4LMZA 3RRHA 3QSYB 3CJTA 2WVCA 4J7CA 2VIHA 2LU2A 2DHGA 6AT1B 4GKKJ 1HFEL 1LK7A 3H59A 3SCJE 4DX8H 4EK2A 1CBKA 2C3PA 2HNYA 1WKLA 2X51A 1PSDA 1TFYA 1TV6A 4PCQA 4OV6A 5A6PA 3RB6A 1Q78A 2HVEA 4MK7A 3PW4A 4WFZA 2F1FA 1JLAB 4RUAA 2J0WA 3NL0A 4A8SA 2BR0A 1HD1A 1NRKA 2C2MB 1U25A 2N4CA 3ZTRA 1SUQB 2GMHA 3CCVS 3V4IB 1VC5A 4ZDNA 4DJBA 3L4BC 2BW2A 2G2YA 1N5QA 2IC3B 1S7HA 1AW0A 1HNZF 2M52A 4ELUA 2I9SA
chains in the Genus database with same CATH topology
2HG4A 4ECZA 4OX7A 2CPIA 1H7XA 1KQGB 5IWAF 2NS1B 3KK3B 4ETXA 3OFHA 4X2BA 1WHYA 4LVNP 2YKNB 2WAQD 4K5RA 3PX0A 5KG6A 4NYPA 1D3WA 2HFZA 3HP6A 3UFCX 3S8SA 1LW2A 4V19J 5HBMB 1H38A 1BQXA 4YOEA 1OSDA 3PKYA 5C24A 1UL3A 1X5TA 4NLWA 1JK9B 2MJUA 2CPFA 2EPIA 5G0RB 2RKIA 2LEPA 5BYRA 4C4WA 3FQKA 3M9MB 1RT3A 2LQ5A 3CCSS 4XPEA 1R8BA 3TI0A 1C0TA 1G7CB 3SV3A 1EETA 7FDRA 3DRYA 4IH5A 3M8PB 4I7FA 2L9WA 3QLHA 3JSBA 3ZZTA 1RDRA 4TLRA 5B0EA 1NKEA 2VG5A 2CQ4A 2C2RA 3SYZA 5K8PA 2W9CA 1UA0A 5ITHA 3O2IA 1W25A 1DTTB 3DLGA 1JLCA 2KFYA 1WELA 2MZSA 5E3RA 2VPWB 4LUBA 5JXSA 5A8WB 3V6JA 2CDQA 3T5JA 4EBCA 1HNVA 2RRAA 4NCBA 3L7PA 1BQNB 5KFSA 1FD8A 3ZZZA 4JBCA 4UQGA 2VG7A 4HTIA 1M5SA 4ZVHA 2XY5A 4O3RA 4QIGA 1LWCB 1C0UB 1SC6A 2H9ZA 1SH3A 3DOMA 4OX6A 2ADCA 4B9UA 5I3QA 1QJHA 1DFDA 4B17A 1SIZA 3CDEA 5I3PA 2XCAA 2ZOFA 1HNWF 5KFAA 1E6YA 1F0XA 1GT8A 2CPEA 2FGCA 4PQAA 4NA1A 2IYIA 3KHHA 3ZZYA 2VA2A 3KLFB 1FHTA 5G4DA 4DSKA 2HW3A 4UY8T 2DGXA 3NG8A 3P5TL 3NS6A 5T7LB 3DLEB 3ZZPA 2MSSA 3C46A 1TL3B 2B51A 1MROB 2YKMB 4EBDA 2KXFA 1HNIB 1BQMB 3MEEA 2GJIA 3V5RA 4EGLA 3TAMB 2AGPA 3U02A 3MOJB 3UR3C 5GAGI 1S6PB 5AXMA 5KFVA 3UDLA 1V3RA 2CQ3A 2QMXA 4ICLA 1QAXA 3SEOA 2GGPB 2J6UA 4NZ6A 3M8QB 3KLGA 5D8HB 3AA9A 2H5EA 2DRAA 3M6XA 2M70A 3DRRA 5E3CA 3M2RB 4YB5A 2G4BA 1BC6A 3CCQS 5KT4A 6FDRA 2DNPA 2K7JA 5F9LA 3HHLA 3M9OB 4CI0B 2UUTA 4OHZA 1URRA 2OFHX 2B7CB 2HGNA 1ROFA 1U8SA 1WF1A 2ZD1A 3IRXB 4OJ1A 3DDKA 2NSCA 5J2QA 3H5YA 4Y34A 4LF7F 2C3UA 2W7OA 3POTB 3I5AA 4AQYF 2XMUA 1OS5A 4ID8A 4NCAA 1P1LA 1YJVA 5FLXY 1IQTA 4DR5F 2A2CA 3DLHA 2AYEA 4QU7A 3KOAA 3CCJS 2FHOB 1UVNA 2W25A 4PXEA 3OL8A 2UV8G 2ASYA 3OL6A 2MGZA 3CD0A 3OSPA 3V4IA 2YNHA 1N33F 4FVMA 2OD4A 2KM8B 2PI5A 4MK8A 3IA0A 2HS3A 3OLAA 4NL5A 1H6KX 4P2SA 3MM9A 2LQBA 4IQXA 2XSJB 1X9WA 1FRHA 2J9DE 2IC3A 5HN0A 4ZA1A 2D9OA 4WU2A 2CYYA 2XY6A 2IM3A 3H40A 4R25A 1RT1A 4XK8C 1C1BB 3MMAB 1S4FA 4AFFA 4ZVFA 5KFNA 1IBLF 5CYJA 2OMLA 3D0IE 5DG8A 2N3OA 1QVGR 1RKIA 3D0GE 4JI6F 4ZK7M 2QV6A 3NNCA 3MD3A 2YY3A 1ELOA 3HHDA 4QW8A 3V6KA 5HBMA 4GKJF 3J7A1 2F8HA 1NJWA 3FEZA 1DRZA 2J5AA 3MMCA 1YJRA 3AJ2A 2LLZA 2R7XA 4OZNA 4NYOA 2Z4PA 4DSJA 2OIHA 2AJQA 5IQ6A 2ZFHA 4KC5A 5IS2A 1R3NA 4DWIA 1UW4A 4R0JA 3ZFVA 3BGRA 1Q79A 2WBRA 3PV8A 3K8VA 3OPKA 1HQEB 4IYQA 1IBKF 1RK8A 2DB1A 3IWXA 3SFGA 3PO4A 4F4WA 4BBYA 4X4NA 2MKJA 5KFOA 2ZDPA 2QA4S 1T3OA 4ZHRB 1VBYA 3M8PA 4MH8A 1IBMF 2HVHA 1RTIB 2MKSA 2KG1A 1AFIA 2ZH9A 1MMNA 3QJLA 2HPUA 1C1CB 3AA8A 5DJBA 4UUWA 3OW2R 4MK9A 5KFEA 2ZITA 4Q5VA 3CCES 2R7VA 2YNFA 3PY8A 2BJEA 4URQU 3DMJB 1DTQB 2P9GA 5T41A 2AYMA 2OLWA 4DN0A 5D3GB 3N5FA 1XR5A 1SJ1A 1TKZA 1WI6A 4DOZA 3VAGA 3HKWA 4E8UA 2IYGA 1LWCA 1C0UA 3OV7A 3U1NA 4EZ9A 1VHFA 4KHMA 3IS9A 2MZ1A 3T5HA 2YH1A 3CWJA 4ED6A 3TARA 4WIIA 3PJXA 1T05B 1D1UA 2DR5A 4DF8A 2WBMA 1CLFA 4ALZA 3CD5A 4C0OC 4LF4F 5A8KB 5MAOA 4OZJA 1KD1T 4DSFA 4Y2KA 2GO9A 2E5IA 2MZTA 2BABA 3DOLB 4J9NA 1SKRA 2K7KA 3PRDA 2RRBA 2JLEA 1MNEA 2EFGA 1TL3A 3PW2A 4LF5F 3GIIA 3KG0A 5LSLA 3M2VA 3UW1A 3T9ZA 3W2VA 4DEZA 1URNA 3LGMA 2KB2A 1N6QA 5CZVA 4A8KA 4KBIA 1U26A 3UDCA 1R7IA 4LT6A 2R8GA 1CVJA 4I1TA 5BYQA 1ZPWX 2W9BA 2GGPA 2E1AA 5KFUA 4O3NA 2XSFA 3CVKA 4WE1B 1RT6B 2GIQA 4YR2A 2WONA 1UA1A 5K9FA 3BO2A 1DARA 2ZBIA 4PUOA 3CCZA 4UW2A 4JI5F 4BHQA 1HWIA 4ZVGA 2RVJA 4K4UA 3EGZA 3WDOA 3THVA 4CO0A 2FHKA 2C42A 3H4BA 3GILA 4TQSA 4IRKA 4HLBA 3Q0AA 1BLUA 1WF2A 4KHRA 2CQ0A 4Y6IA 1TAUA 1Y7PA 2UUWA 3S6EA 1V9OA 5EWEA 2Q3PA 5E7OB 1RTDB 3HVAA 4WTYA 2J7WA 1ZYQA 4RW4A 2V8HA 4R8UA 4TY8A 2R8HA 1AXQA 2IVFB 5SUHA 3W2WA 4MIBA 2AJ4A 2XCPA 4NPOA 3CDUA 3X3UA 3Q2TC 3DCAA 4ILRA 2E66A 3PZPA 3QJJA 4P6QA 5EWGA 5JJBA 1FKOA 3HHLC 3GSDA 1IKVA 1QE1B 1H98A 1EP4A 1X4GA 1M0SA 1FJCA 1AFJA 1A7GE 3RW6A 3MR2A 1TL4A 3G96A 5KFKA 1QSLA 2POKA 1E6VB 3NKYA 3TO8A 2XS5A 5LMNF 4FXWA 1LQ9A 3LF0A 3VZHA 2LECA 3MMAA 4N8NA 3KLHB 2D1CA 1LWEB 1RT5B 5CCMA 2ZJPQ 4ECWA 5I3UA 4QR2A 3DLBA 1FNXH 2YNGB 5MLCV 4I2QB 3KLIB 4ED2A 4H4KA 2Y1JA 5KFHA 1LW0A 4NXMF 1WD6A 1P9QC 5J1EB 2DO0A 4LF9F 3I9V9 4JI1F 3C3LA 1DAXA 4NLRA 4JV1A 4OI6A 4F50A 1VQ5S 1U47A 3CMAS 4ID5B 5D77A 3FVYA 3D2WA 2K1RA 1VC0A 3R1HA 3RR8A 3MM8B 2HS0A 2PD1A 4L72B 2JOQA 4C7QA 4RNFA 4N5SA 4PG6A 1N5YA 3HJFA 2V2KA 4M5DB 5HLFA 1HPZA 2D9PA 5KT2A 1YJWS 2FVQA 2RQCA 4EU0A 4WK1A 3R5AA 2VFTA 2XWXA 1K8AT 1HBUA 1XMBA 2YH0A 4HEA9 4I0WA 5KFGA 5EWFA 1IKXB 4YFUA 4PXBA 4JI4F 2MQNA 3PNIA 2OMOA 3GFYA 2VB6A 4KO0B 2MQMA 1SV5B 2QSFA 4N8OA 1N36F 5D3GA 1H7WA 3O1LA 2I0XA 3LWMA 4WF9Q 2R7OA 3IAS9 2GMJA 2C22A 2EWHA 1TL1B 1H2UX 3I4HX 1RT4B 4DL0C 1QM9A 2FGOA 4DMZA 2YVSA 5J2NA 1Q7LB 2DH8A 4EFAC 2F9DA 1HBOB 3MMBA 2O67A 3L09A 1H0HB 1TKTA 2VBWA 2HMIB 3C6TB 4UQTA 1ZTWA 1X4BA 4GC6A 4PPDA 3SSSA 1YRTA 2QRRA 2WRMA 1OIAA 3BR8A 3Q22A 4A8QA 2HS4A 2ROPA 2KHCA 3KMQA 1FA0A 2V0NA 2MQQA 3BJYA 2ZH2A 2VV5A 1U24A 2PI4A 1B0TA 3M32A 4PG7A 3BB5A 4FN5A 3OVAA 2ALZA 2GW8A 2U2FA 4Z37A 2XMMA 2F9JA 4ZMMA 1IKWA 4F2SA 1FEHA 2CQBA 2KH9A 2XS7A 3PM9A 3BSOA 1UAWA 2E1CA 1JLBB 2FJEB 2JHEA 2QZ8A 3TANA 1Y00A 4ZPVR 1KR4A 4MIAA 4X65F 1LXJA 2HLTA 1X5OA 2OPRB 4NMLA 1IM4A 4HI1A 5F0WA 4C3LA 3Q8PB 2GQCA 2OPPB 1Y3JA 3N0VA 4MMOA 2WB1D 1YWXA 2OTJS 3M30B 1O5JA 2IVYA 2FVSA 3PJWA 2Q1LA 4OX8A 3I6PA 4P7TA 3NAIA 1N5TA 2QYCA 1LWFB 2XMTA 2GC8A 1SJ3P 1RTDA 2B56A 3JSRA 4DHVA 1L3SA 1S9FA 3S7RA 5DGAA 3LPYA 1N34F 3WZ0A 2IAJA 3DXSX 4OJ3A 5KFCA 1VRTB 4MKBA 4X64F 2DNQA 1WWHA 4RKUC 4DBQA 3AB2B 3SXLA 3X1LB 4DR4F 4LSLA 3MM7B 1MW7A 2WCXA 4ECSA 2RSQA 3DOKB 2DBBA 1D8YA 4OJGA 2HRYA 1SIWB 2KYXA 1TAQA 2E1MC 3FMWA 1GX6A 3VAMA 2R7TA 5A0YB 4QIWD 1Q8IA 4ED8A 3MOZA 5AXLA 1JLGB 1H2TZ 1HWLA 3U7JA 3B8HA 2EBEA 1N5SA 1E6VA 2VG6A 3HVTB 3NCQA 2VD3A 4O44A 1S0MA 2HNZB 4K4SA 3DRXA 4OHVA 4CQ1A 4USJC 3MAQA 2V4JB 1M90T 3KLHA 5F8HA 1OO0B 2HWTA 1S9EA 3EXYA 4IDKA 4UOCA 4J9PA 4JOUA 2W8KA 1NK4A 4OLOA 5E41A 3IWNC 3QWUA 3KLIA 4I2QA 4KT0C 2L41A 1LV5A 1P6TA 2J8AA 4IUFA 5DDPC 2XLKA 4QJVA 5F8JA 2ILZA 2YKAA 4YDXA 4HL9A 3KYLA 4WFBQ 2EFPA 1VQOS 1KQSR 2Y0SD 3KG4A 3M8RA 1O0PA 2UVUA 2Y1RI 1XN9A 2GHPA 5F9NA 1RA7A 1YHQS 3I32A 1NH7A 1T94A 3UE2A 1RGVA 4FF1A 3N01A 2BM1A 1SB6A 4C3KA 1CG2A 1WG4A 1L3UA 1FKPA 1YJTA 2BXJA 1SH0A 3HLUA 4QIFA 4WFAQ 2L08A 3CIZA 4M5DA 2AGOA 1FDAA 4H4KC 1VQYA 2HHHF 3RU0A 3TRGA 2XMKA 1RA6A 3N79A 3TOQA 4M63A 1IKXA 1XTZA 4NLVA 5KT3A 4Q45A 2KYZA 3HXMA 2DCUB 1X9MA 4X4VA 1RTJA 2OPSB 3KHGA 2R2SA 2CFXA 2LCWA 2P5VA 1Z4UA 5DQGA 5DGBA 3LP0A 4PG5A 4H54A 1R0AB 4ZP6A 2DNRA 3V4MA 1U1LA 1Y4ZB 2ZE2B 4DFMA 4C11B 1XERA 4K5SA 2EG1A 3KK1B 1ZM2A 2DGWA 4C8OA 2CPHA 3IR5B 2RU9A 3K8WA 2PT0A 2KZZA 1TL1A 3DHWC 2YNIB 4U9RA 1F5BA 1FEEA 4MFBB 4DV0F 3HZGA 3BR9A 2FLNA 4N77A 4DR1F 2BQ3A 4FNHA 1RT7B 4DUYF 2J9EA 4GMKA 1NK5A 2NUUG 2XO7A 1FDDA 3C2PA 5IZHA 2AYBA 2OH2A 3UCZP 1GTEA 2B4PA 1I94F 4YB7A 4ED7A 2IA0A 3PACA 5GAEU 1JLQB 1UKUA 1UEUA 3GG1A 3R5BA 3ITHB 1GNKA 2XY7A 4YB1P 2CJKA 1S9GB 4K4TA 4DQPA 2XWYA 3FZ2A 4ZP8A 1FJEB 4CCHA 1YTYA 1S6UA 2EI5A 2ASJA 3V81B 1KLMB 2XBPA 2CJ9A 5T14A 3IXQA 4Y0FA 3JTPA 2B4VA 4K59A 4PKDB 3KNAA 2J7UA 3TQ1A 3MEDB 4B9LA 1JLEA 3EPIA 2R2UA 3CO9A 1VOMA 1LKZA 1HI1A 1JIHA 4OI4A 1Q53A 5JVGQ 2QA4G 3MURP 2FLLA 3HDSA 4RW9B 1JLBA 2FUG9 1LFWA 2CJBA 4TN2A 2R7SA 3J81Y 1U4BA 3CJ0A 4U7CA 1GQEA 4IKAA 3DLLQ 4QWBA 2W7PA 2OPRA 2PO4A 4O3SA 2RDIA 2EBGA 4ED1A 4JI7F 1RKJA 2C2EA 3MUTP 2MMYA 1TK5A 3H8YA 5KT7A 5A8RA 2FVRA 3DRPA 2J0SD 4JV2A 4XPCA 2EFOA 4G1IA 4LFCF 1FNOA 1NO8A 2LDYA 3M2UA 3E2EA 1FF2A 4E0DA 2E9RX 3KNGA 4ZLPA 1XBWA 3T5LA 3TA1A 1Q8LA 4L3NA 2VKZG 4CNYA 4HDGA 3I55S 2HQIA 5LXYA 4PWUA 3K58A 2DCLA 4ES2A 4B9SA 1VRTA 1JJ2R 2YWGA 1Y0HA 2KHDA 1KRPA 2GX8A 1V3ZA 3FJ2A 4U7UK 5I42B 4J5OA 1TFWA 1PC5A 1L5UA 3MM7A 1WG5A 1B7FA 1HBMA 1UWBB 1BWEA 3HFKA 1DBDA 4O3OA 5SZTA 3JAMY 1U09A 3GFZA 1RTHA 2VONA 1YG0A