1CLFA

Clostridium pasteurianum ferredoxin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
AYKIADSCVSCGACASECPVNAISQGDSIFVIDADTCIDCGNCANVCPVGAPVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Solution structure of the oxidized 2[4Fe-4S] ferredoxin from Clostridium pasteurianum.
pubmed doi rcsb
molecule tags Electron transfer (iron-sulfur protein)
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1clfA00
1BLUA 2VPZB 1BD6A 1G6BA 1VJWA 1BQXA 1H0HB 1SIZA 1DURA 5CH7B 1FF2A 1B0VA 1C4AA 1GAOA 5E7OB 1RGVA 3MM9A 1FDNA 5FD1A 2V4JB 2GMHA 1FDDA 4CI0B 4XDDA 2XSJB 1SJ1A 3PNIA 1HFEL 3IR5B 1BWEA 1Y4ZB 2FD2A 2VPYB 1PC4A 2FDNA 3MM6A 1IR0A 1FTCA 1FXRA 3OR2B 3OR1B 3MM5B 2C42A 4OMFG 1FRLA 3MM7A 2WSFC 1Y5IB 3C8YA 3IR6B 1FXDA 2FGOA 2WSEC 3LW5C 1D3WA 1JNRB 1FCAA 3MM8B 1CLFA 2V4JA 3EUNA 1F5CA 2VKRA 3MMAB 3EXYA 1B0TA 1KEKA 2XSJA 4L6V3 5BYRA 1DFDA 3EGWB 1FRKA 1H7XA 1H7WA 2V2KA 4RKUC 3OR2A 1KQGB 1C4CA 1FRHA 3MM5A 4Y28C 6FDRA 1GT8A 1XERA 3MMCB 4XK8C 2Z8QA 2VPWB 5BYQA 2GMJA 2O01C 1IQZA 2C3PA 2PA8D 6FD1A 1GTEA 1AXQA 2C3UA 1GTHA 3MM8A 4YDDB 1Y5LB 3GYXB 1SIWB 1KQFB 1PC5A 2VPXB 1A6LA 4XDCA 7FDRA 2FJEB 1BC6A 1G3OA 1Y5NB 1FERA 4OV1A 1FD2A 1FDAA 1FRIA 2C3OA 2C3YA 2PMZD 4DHVA 1JB0C 1B0PA 3MM6B 3MMBB 2FJBB 4ID8A 2PDAA 2WSCC 3OR1A 5L8RC 1F2GA 1ROFA 1JNZB 5CHCB 1FRMA 2Y0SD 2FJDB 2ZVSA 1FRJA 3IR7B 3HKZD 1H98A 2C3MA 7FD1A 2FJAB 1FRXA 4KT0C 3MM9B 1DAXA 1FEHA 1WTFA 3MMAA 5BYSA 1R27B 2WAQD 2IVFB 4AYBD 2UZAA 2WB1D 3MMBA 1FDBA 1Q16B 1K0TA 1F5BA 3MM7B 3MMCA
chains in the Genus database with same CATH superfamily
1G6BA 4U9RA 1KTQA 1C4AA 5DG7A 3A8EA 5FD1A 5HLFA 2GMHA 1YZ6A 3P45B 3DLEB 4TN2A 5L9XA 1N5YA 2AJ0A 1RHKB 5A0YB 3CJKA 1X4DA 3I56S 1D3WA 3QO9A 2JEGA 4E0DA 1HI1A 1GEHA 2VKRA 3UO0A 2VUGA 2XM3A 4ES2A 4M94A 2FJWA 2PFDA 1WKJA 1WHVA 4RKUC 5HVHA 3Q8UA 4ANDA 3NBPA 4AXIA 1GXUA 1EHWA 1Z2ZA 3GYNA 3CJ2A 2C2EA 1ZM2A 3QIPA 2YNHA 1FDAA 3T5JA 2C3OA 1M1KT 1M5HA 4BC7A 2KT5A 3GV8B 3QT7A 3MAHA 1PYSB 3ENQA 3Q8YA 3P5TL 5FDLB 3BM7A 3AOBA 5KFGA 1Q81T 3QGHA 4FF4A 5J2NA 4CTAA 2ADBA 1X4GA 4B9MA 4AL5A 2ZVIA 2BOAA 2MSSA 4Z37A 2MQQA 2NZ4A 5I3UA 1GAOA 3SQGB 5J1EB 4UY8T 2V8VA 4DCPB 4OI6A 5ETQA 1RWPB 4HDGA 4NYZA 2ABYA 1JLEA 2XMWA 3FCHA 4DV2J 2VDIA 3ZC4A 5H9FJ 2QSFA 4NLRA 2LU1A 4I6AA 2VD3A 1YQHA 4ED6A 3F73A 2XYHB 3C6TB 4YQWA 2MLZA 4EEYA 2BMBA 1RCXB 2VBYA 2VONA 3PYEA 2XHWA 1LK7A 4PG4A 4LF9J 1KSPA 3OFHA 3DRRB 3S7RA 1VOMA 4N76A 3H2UB 1BHNA 3E2EA 3KJFB 3CJ5A 3O6QA 4W92B 2QMWA 4DPXA 3HX9A 5IT9U 3R9LA 1X4BA 2RKIA 3LGNA 4OHVA 2QLFB 3DLBA 2ZH3A 4OZ2A 3BV8A 2WVFA 4CYUB 3MUMP 3RB4A 3BPSP 2Y1IA 2BBEA 2H4WB 4NA1A 4AL6A 2X1GA 1I5OB 3UD4P 1NH7A 2EW9A 5B7WA 4JI5J 5KT3A 4YR3A 1IWGA 3OFGA 2UU9F 1VLOA 1MMDA 1HYSB 1RT1A 4I2QB 3MTKA 3CJ0A 4YMEA 2JH3A 2IA0A 5DM7Q 4ECVA 1S0VA 3HHLB 4CWBA 1L3UA 3KUGA 4L6V3 1HBMA 2YNIA 2A3JA 1LNQA 3QRQA 4K59A 1U4BA 2W9BB 1WG5A 4C8OA 2ERRA 2CVIA 2L08A 1KLMB 2BJ3A 4B17A 1S12A 1RWOB 2VG7B 4OZ0A 1CBKA 3ENAA 4DQRA 2YY3A 4QYRA 3J81U 1QAIA 3AXKA 4FS2A 2CQIA 2B9WA 1RACB 4CT9A 1FHTA 2EC2A 1URNA 5T14A 5CD4A 3EVOA 4TLQA 2HHVA 1RTHB 1RT7A 4F0KA 1N0UA 2HGLA 4GC6A 2AT1B 3MWBA 3D68A 1OYDA 4IFYA 2WOMB 4K2JA 4KGXB 4UUXA 5LMNF 5K9FA 1HQEB 4F4ZA 5K14A 4IRDA 1S6PA 3IRXA 1N36J 4RLEA 5HMWA 5DLFA 4AUKA 1VQSA 2YNGB 1IKWA 4I67A 1EAYC 4CH7A 3DXBA 3JS9A 1CQNA 3AY0A 4ED8A 2FHJD 3DMJB 1CS4B 1H74A 2IVMA 3HSZA 4FNIA 3G2XA 3UFCX 4EI2A 4OHYA 1VK8A 1QJHA 1HNXJ 2RH3A 2DNLA 4ZPTR 4ZJQA 1JWWA 2HWTA 3DM2B 4NLPA 3MD1A 5D77A 2FVSA 2VODA 3QGIA 3D54A 4DMZA 2XLKA 3T1YF 1CJKA 4U96A 3M8RA 1YX2A 5IOLA 3NWGA 4DSKA 1S1UB 2MJNA 4QOTA 4NLUA 3ET6A 5DETA 2XZWA 1OY8A 2CG8A 4KKOB 4GVBA 4N47A 3MXHP 2CQ0A 4TY9A 4NMLA 3V5RA 1TKDA 4KFBA 3FEZA 2DNKA 2J9DA 4OLOA 3P49B 2FC8A 3QT6A 3F41A 2AJQA 2ZKTA 2GMJA 3BSNA 3A3NB 2CPJA 5J1NA 4LF6J 2OTJS 2B4PA 4QU6A 4NWBA 2XNRA 2FJEB 1FJGJ 3KLEB 2AEFA 1HARA 3EZUA 1W2IA 1W2BR 4C3LA 2KVIA 2YTCA 2FJDB 4A8WA 4F67A 3M6VA 3UI3A 3B4MA 2F4VF 1TQLA 3E01A 3US5A 1DTTA 2AMCB 1VQKS 2DNZA 5CYJA 2ZH4A 1UEKA 4DPWA 1KS2A 3GIJA 2AGPA 2W9CA 2ZNYA 4DS4A 2GVZB 3KLGA 2UUAF 2DIVA 4G6VB 2HKEA 1SJ1A 1B3TA 1J27A 3PKMA 2QIFA 1E6YB 3FSYA 3MR7A 2FGOA 2H65B 2UVWA 4JI3J 2BABA 1OPIA 2RS2A 4PRFA 1FNOA 4LF8F 1IKVA 2NZCA 5GAHU 1A0OB 2Q43A 2DIUA 1GTEA 3CCLS 8RUCA 1AXQA 2HG4A 4JI0F 1TKXB 3OL8A 2PMZD 1B0PA 4IG3A 4U7UK 4N8NA 2CQ2A 5I4MA 1YTYA 3WX8A 2IJFA 4LF2A 4Q5VA 2G2YA 1WTFA 4NXNF 3NCPA 2MZ1A 1EX8A 1U2FA 2DXDA 1FJEB 4RZRA 3A8IA 4FPIA 4GKKF 1T05B 5CD4H 5KT4A 5FLXU 4AL7A 4LF4F 4ED2A 1FKPA 3HMJG 1S0OA 5KFEA 4NX9A 4X4QA 3MM9A 4WFXA 3IN5A 1Q53A 2C2NA 2QEXS 2LA4A 1FKOA 2IM0A 3JQKA 3D4JA 3JAMU 1Y7PA 2XGQA 2X51A 4P52A 4DV1F 4FYXB 2QFIA 4ED1A 1Q8KA 4ZLNA 1IBKJ 1GNKA 2CJAA 4DSEA 2J9DE 3LAKA 2V2KA 1F3FA 3QLHB 3N01A 3EDRB 4OYXA 1N48A 3BGFA 4LIWA 4MK7A 4ITSA 2MKYA 2JVRA 4P74A 2FC9A 1FFGB 4PR6A 1IWAA 4BWMA 2Y3YA 5LM7E 3VVTA 2WRMA 3Q22A 2FLNA 4TQSA 2KDOA 3FKBA 4ZIWA 4YS2A 2DR8A 1JLBB 4OI1A 2DH9A 4KRWA 3SV3A 2N3OA 4M5NA 2HIYA 1VMBA 1AFJA 1TK8A 3I0RA 3QMQA 1VQLS 4LR9A 4IFVA 5KG6A 4URQU 3TAMA 3SFGA 3TZZA 2V0NA 4WWSA 1RCOB 3RRKA 1NRKA 5L1KA 3K59A 4V19J 1NDKA 2A10A 4A8FA 4DR4J 1G1XA 2KO1A 2XNQA 4J91A 5B0DA 4XPEA 1KLNA 2RJZA 5U47A 3GFHA 3QFWA 1WC3A 4J9MA 1NJIT 2EK1A 4KE5A 2RIJA 3MEGA 4YY3J 5F8HA 3UVJA 5L1IA 2DJWA 4EK2A 2D3OR 4WU3A 2AHOB 4OJHA 5HATA 1KHWA 3PX0A 3MM8A 5E3AA 3BS9A 4Y6IA 1Q5VA 4WCEQ 4HTJA 2R8IA 1U0HB 4NLQA 1N5TA 3GG0A 1J5EJ 5G0RB 3CDAA 2F8MA 3M30A 1RT3B 5KFBA 1YJTA 5K8NA 2G2ZA 3KLFB 2FJAB 2KG1A 4FPRA 1ZA2B 2DEJA 4O3SA 3C14A 1KVJA 1NHVA 2MQMA 4ZCKA 4QWBA 4PXCA 3C16B 2H48B 1FDBA 1QM9A 1RDRA 2XLJA 5AJ3J 3QRRA 2ACYA 4CO5A 2HMIA 2HNYA 2WHOA 3H25A 3M8SA 4L73A 5GMDA 1KD1T 2XS7A 2P2CB 4RW7A 1RT6A 1X4AA 1BQNA 2AJ4A 5CCMA 3C6UB 4FN5A 4KHPF 3HULA 3DDKA 2XYGB 2WSEC 3MAAB 2ZH5A 1JNRB 2H5JB 3MMAB 2ZHAA 3PY8A 1XNRJ 2FZGB 2VG6A 4DN0A 2OO4A 3QAUA 1QSYA 2YKMA 1UMJA 4CNYA 1TELA 2OAUA 3PIPQ 3M8QB 3JTOA 5AT1B 5IT0A 5CYQA 4HLBA 1HWUA 1RT4A 4DL0C 1M90T 3GSIA 2GQQA 3IS9B 4JI2J 4CLSA 3OVAA 3TWZA 1TV6B 3LA0A 4DFPA 3IGNA 3C2PA 2WVDA 3KLIB 1Q8LA 1LWEA 3ZTQA 3EPIA 1UWBA 3W9IA 1FI4A 4C8NA 3G71S 3D6HB 1S48A 2VICA 1UVNA 1Q78A 4PPDA 2ADCA 2PEBA 2FDNA 4RU2A 5KAKA 5JXSA 3DU6A 3LALA 4ALZA 5DDQC 4K50A 1RP5A 4X4RA 4O3RA 2Y1JA 1VQ6S 2HBYB 5DJBA 2JLGA 1BE4A 4K4TA 1Z4UA 2DGWA 3OFFA 1SIWB 4ENOA 4DV4J 3OL6A 2PN6A 2AU0A 2CPEA 2YNFB 3A3OB 2KVQE 2OPPA 2ZC4A 3CCSS 3UN3A 2MZQA 3NY0A 3NGDA 2JLFA 1SKUB 2OIHA 3Q89A 4DWIA 2HSEB 1ZETA 4X62J 1T02A 1ZM9A 3KWMA 3PZPA 2NPIA 1IBMF 4DR3J 1G4CA 1CJVA 1MROB 3MEEB 3M2RA 1RWVB 4USKA 1RWXB 2I1RA 4P10A 5IT9Y 3OJSA 2PSZA 4KAIA 5SUHA 2IDEA 4Q2LA 3GIMA 4O0NA 1NAQA 1PJ5A 3OR1B 1HNZJ 4PWWA 3GV5B 4DSJA 4PG5A 3TEGA 5IXUA 5KFHA 2UXBF 3EXYA 3G4SS 3SSRA 3S6EA 3Q8SB 4FNHA 5I42A 4JI6J 4KGVB 3THVA 3MZIA 5KOWA 2D1CA 3QAEA 2O01C 5RUBA 4KH1B 3VWSA 4O0IA 1I94J 4K4WA 3GWCA 2BA9A 3I9V9 1WKLA 2YQ1A 3MUVP 2GIQA 2HVDA 4M5HA 3QSYB 4KC5A 1NBEB 5KFFA 2MB0B 1HBOB 5C2GA 2HFZA 2IC3A 3FDSA 2QE5A 1X31C 1ZA1B 2R7SA 2ATCB 1WHWA 1HIYA 2B9YA 3D1OA 5HP1A 3BQ0A 1RBOB 3ETMA 4RBTA 2J6SA 2GHWA 2P8IA 4D3GA 4IRKA 1QSLA 3UR0A 1RBLA 3J81Y 2ZBIA 3OJUA 1UW4A 1P9YA 2V69A 3PX6A 1S99A 1LWFB 3H2VE 3CGIA 2VBWA 3HHDA 2DK2A 1UEUA 1S10A 3RB0A 3IC1A 3SCIE 1WG4A 4IR9A 2LVWA 9ATCB 3I9ZA 2BE9B 4G65A 5D3GB 2CXEA 4DV3F 2VL1A 3MTJA 4GKJF 1F2GA 2CQPA 3QZ7A 3FBBA 4IUFA 4B02A 3MR2A 4RW9B 1RAEB 2CQBA 4KJIA 4ZPAA 5JJBA 2DR6A 4NCAA 1DTQA 1P8GA 3RB3A 3W63A 2E5JA 2ZH8A 2YKAA 2DNHA 3MM7B 1IBCB 3RG6A 2Z2MA 3VAKA 5H9FK 5IV3A 1YBAA 3UN2A 2XMAA 5KG4A 1S9GA 4DR7J 1TUGB 1HNIA 2K3IA 2F5GA 3IG1B 2CQCA 2KB2A 2ZM6J 2ZZNA 1GK8A 4Q0BA 1WNEA 3H5XA 3ITHA 4JI5F 2DB1A 2FY8A 3BPDA 1S5ZA 3BR8A 3V81B 2Z2LA 5DZ6A 1X5TA 3MM5A 4EO8A 3SDEB 1RTJA 6FD1A 3CMQA 1HBNA 3MEDA 1BXNA 1M5VC 1URRA 3TI0A 2IAJA 3MM6B 1RXOB 2ZH1A 3Q8RB 3VR1A 1XR6A 4ZVFA 3G8SA 8AT1B 3CSKA 1UFKA 1YG0A 2FHKA 2KU7A 4WYLA 4E2FB 2FVQA 3ICLA 4R8UA 3BSAA 1J5OB 1BMQB 3W9HA 1JIHA 4KGMA 1RT5B 1JLCB 1VBZA 2MGZA 4QBUA 3MMCA 2DITA 2OTLS 1Y3JA 4F8RA 4NCGA 3G6VA 3JQMA 4DR5J 2XMTA 1X5SA 2W4PA 1TTHB 2RD5C 5F0UA 5KFZA 4EBEA 1P6TA 2NXCA 1YJRA 1Y5IB 3V6JA 3PO5A 3IP0A 1I6JA 5E33A 4JB8B 1F5CA 3E3XA 1EQMA 1P27B 4Q8EA 2JX2A 2RMLA 2W7OA 2CWXA 1HMVB 2BQ3A 1JLQB 1LQ9A 1EP4B 3GSDA 3M8PA 3CVKA 1OWXA 1KFDA 4C6AA 3D0IE 2RQKA 1UVIA 2E9TA 4PZVA 5BJRA 4DFKA 1WTBA 3HZGA 2X1AA 2IMWP 1ZAVA 2KFZA 2UZAA 4ID5B 3UCUP 1OSDA 4FF2A 2E5HA 2Q6BA 2CVEA 2YX1A 2OJ3A 1SC6A 4O3QA 2VA2A 2L9WA 4E98A 3FUYA 1BWEA 2XSFA 3PCOB 5BR8J 4JI7F 5AE1A 2VC1A 4J9LA 5CYMA 4HYKA 4KV8B 2DHHA 1GMVA 3OXGA 1R6VA 3FC9A 3K5PA 3N0VA 1HNVA 3UCGA 4C0HA 2E7VA 1SJ3P 3EMTA 2W4CA 1VCTA 3JAMY 1JLAA 1PIEA 2XWXA 5HI7A 3W5ZA 4RNHA 3J7AN 2DHXA 2VPXB 1DQAA 1TR0A 4QWAA 3PEHA 2B8PA 1IM4A 1XBWA 3GCXP 2K1RA 2OEJA 1LFWA 3BGRA 4Q44A 3DI6A 5JVHQ 3POTA 1H2UX 2VQFJ 5J2MB 2J9CA 1TAQA 4DFJA 1VHFA 3H42A 2KXHA 2WB1D 4LF6F 4YB7A 1HI8A 1U1NA 2DVIA 3JSMB 3OXLA 1U1QA 4IRCA 3FFIA 1FDNA 4CI0B 2D3UA 2ZDOA 3CJ3A 4LRCA 4OZLA 4RNNA 2YH1A 2W2NP 3GCWP 2FD2A 4F0MA 1REVA 2M4MA 4WYWA 3EXCX 4X4PA 3I0SB 1ZZFA 4OX6A 1C1CA 2MEWA 1QDUB 1NPRA 3C19A 1VI7A 1FRHA 3M8YA 2VFSA 2K8GA 3M4XA 1TU0B 1YHQS 1S6QA 2YXLA 3HVWA 1BQMB 1VQMS 2L9DA 2UUTA 3K0JA 4QIGA 4ILRA 4NLSA 4DHVA 1VIXA 3OHBA 1OS5A 3K7RA 4WFZA 5GAHI 4HI1A 1S1VA 2U1AA 4LFAF 5HLFB 4CLUA 5A6WA 1U2RA 3VQTA 3GR1A 2J7KA 2ZJQQ 3KUHA 1N5YB 2NLWA 4C9DA 4KTQA 1O5JA 1H2TZ 4MJKA 3D2WA 5F0WA 4IO1A 4O4RA 1XR7A 2ZE2A 3CT9A 4HT5A 1QSSA 4XTTA 4C48A 2M52A 1P1TA 3W2VA 2MQNA 2CADA 5A8WB 5CAAA 3R1LA 1LXJA 2RQMA 1S6OA 4CLYA 3AT1B 4MFBB 2CDRB 4K0KJ 2UVUA 1RSCA 4U7UD 3QIPB 5B0BA 2YNHB 2LXIA 3KJVB 2CZ9A 4F4KA 3OR2A 3KFWX 1AZSA 2IJNA 2JVOA 4WIQA 2R2UA 3U1NA 3R7BB 4HDHA 4ED4A 4WKYA 2NPFA 5F8JA 4XDCA 4A8OA 2CJQA 4K5RA 5J2NB 4CTAB 2EC0A 2HBRB 5L8RC 1HHSA 1IBKF 4JI8J 1HI0P 3PM9A 2RU3A 3HKZD 4NYOA 1NNDA 3OTCA 7FD1A 2N7YA 2I0XA 3OUYA 1FEHA 3MFIA 2K7JA 3EZOA 3VZIA 3X1LB 3GU0A 4IQXA 4Q43A 1NK4A 4KR0B 2HFSA 3OSPA 1SIZA 2RF2B 2OLWA 2FZCB 1WHXA 2FQQB 4ZN1A 1VLYA 2BJEA 2GMLA 4CLWA 1HW8A 3NEKA 4LR7A 4ZVTB 2DTJA 1HWLA 2BEFA 3RRHA 3ZTPA 1SXLA 3KLHB 1U49A 1RK8A 2XSJA 2CFXA 3U02A 4XO0A 3MPDA 2RKIB 4DR4F 2HNZA 1JLFA 4WE1B 2FLLA 3SI8A 4DG1A 5D8HB 4C0OC 4X66J 1N56A 2GVDB 3CC2S 2V8PA 1U02A 2HQCA 1X0FA 4OL8A 5M2PA 2W7PA 3RRGA 2OKQA 2JRSA 5KFPA 2L48A 1X4CA 3MPUB 3MCMA 3TZYA 1F5BA 4QW9A 3MFHA 4HR2A 2VPZB 4M5KA 4GC7A 4R5PA 2R7OA 1B0VA 5T7LA 2DGVA 3NGTA 4R25A 1SCJB 3IGVA 1BWVA 3LP1A 4DS5A 2CPIA 3GIKA 3DGVA 5C2CA 2ZFHA 3O3LA 1H38A 1VQNS 4PQUA 3RBDA 1CG2A 4QJVA 3K5LA 1OJ4A 4Y3CA 2Y9HA 2C2MB 1RADB 2ZD1A 1SL1A 3EUNA 2RRBA 2YKNA 3DRYA 9RUBA 5F8NA 3HHKA 4DV7F 3RGIA 4ECTA 4M5DA 4ELUA 3K89A 5KG2A 3N28A 2HZVA 5DQIA 5ETPA 3KDOA 4MH8A 3EX7B 2YX7A 4WPAA 1R0AB 2C28A 1T9VA 3A1YG 1RT7B 2HNDA 2CAJA 3CIZA 4I56A 4BWJA 1CC7A 3FEYB 1PAEX 4PKDB 2BM0A 2WAQD 2DY1A 4IFYB 4JV5J 1UAWA 1HR0F 2KM8C 2V4QA 4DR2F 4C8ZA 2CPFA 3W8GA 2ASJA 1VBXA 1BLUA 2D7SA 3K5OA 2EXUA 2MZSA 1OY6A 3SBMA 1S6PB 2J5AA 3IRXB 5JVGQ 2UXCF 3UNYA 5FIIA 5ETNA 2CWKA 5B0FA 2JSXA 5J2QA 1IKWB 4DJBA 4JI2F 1YRTA 4Q8FA 3MURP 2DGTA 4F2SA 4I64A 2XS5A 4ZDNA 4CLLA 1T95A 2LECA 2EVZA 2Y0BB 1G7CB 1TL3A 3BGLA 3HK2A 3HM9A 1SV5A 2DNNA 3HT0A 1VQ4S 2KFNA 1Q0NA 4QWEA 3BJYA 1L5UA 3PRBA 3DOKA 3MD3A 2R8JA 3DCAA 4YHHF 2P6TA 4UZBA 1SJFA 4UW2A 1NK5A 3NNHA 1TK0A 1S1XA 4FS1A 2X3DA 3CCVS 3ET6B 1M5SA 2HHHJ 5LOQA 4WIIA 1KR4A 2Z58B 1ELOA 2BR0A 5DGBA 2XY7A 2B9XA 4GVBB 1XMOJ 4LSLB 2F1FA 4F26A 3MMBA 1EB0A 4P71A 2BRLA 4YFUA 1VJWA 4KFBB 3CWJA 3DYAA 1JLGA 5LSOA 2P5VA 1JJCB 2FTRA 3PKYA 4DL2A 3TVKA 4A8XA 4X62F 3VAJA 4ZJLA 4OI2A 1X4HA 2A6MA 2AF6A 2Y1LB 2KKHA 1SUQB 5IV4A 1ZAWA 1YBTA 2F40A 3OTEA 1ULRA 1D8ZA 2DNGA 3TEHB 3FEXB 2W24A 1KBRA 2I5JA 1Q79A 3E01B 3AD9C 4RW6A 1HNZF 5IS2A 4EO6A 2VBXA 3I6PA 2MKIA 1TL7A 4CO0A 2Z30B 2HHUA 4DF8A 2VJVA 1RTZA 2NYHA 4QWDA 5H1SV 2MY7A 3CB4A 3RR8A 2W9CB 1O0PA 4JI6F 3FSXA 3VAFA 2YX4A 1F1BB 2BE7D 2YH0A 1DHMA 1IBLF 3IXQA 4FYVB 4EYIB 1I94F 3D66A 1Q16B 1FNMA 3GFXA 3KG4A 3TRGA 2ZEJA 4UZCA 2VKZG 4FYDA 1S4EA 5KFRA 4MK8A 4N8OA 4TLRA 1OMSA 4MT1A 4F4YA 3I32A 3VF0B 5ETOA 4DLEA 3AD8C 3L3CA 2E5LJ 2GO9A 2RVJA 1R31A 4IG3B 5EWEA 1NM2A 3LQVA 2NQPA 8ATCB 4DQQA 4P7VA 2VB6A 1NDCA 2HK3A 1WD6A 5GAEU 1WC4A 4P2MA 1H2VZ 1T7PA 2GHVC 2BM1A 2KL8A 5B08A 2CPZA 2F65A 1FKPB 3N6LA 3GPAA 4RNOA 1YJ7A 2YBVA 3AJDA 1V3ZA 3MM9B 5AXLA 4JUZA 2QT7A 2R42A 2JDJA 1FKOB 3DFEA 1AUDA 3EGVA 1LW2A 4GRSA 3FBCA 1HFEL 4CO2A 1L3TA 1WOPA 2APOA 2DR7A 4OMFG 4B3TF 4FKXA 3BSOA 2L9NA 3MGJA 2IBKA 5LMUJ 4NASA 1DY3A 5DM6Q 2OPRA 4RUCA 3ZZTA 3NS5A 2BYCA 1R8AA 2H3EB 2KHCA 3BO2A 3NS7B 4LIRA 4FXWA 3SQGA 2H1YA 1VC5A 3I0RB 2ZM6F 4G1QB 5KFWA 4A46A 4DR6J 4IFVB 4AFFA 3W5YA 5IM0A 3TAMB 3A8JA 2QMUB 3VALA 1H98A 3SEOA 3J7ZT 4J9RA 2H5EA 4JYAJ 5F9LA 1AUSL 1QE1A 3H4DA 4BC9A 3DOLA 3ONQA 4JI1F 4ERDA 3OVBA 4S0MA 4ELTA 3GV7B 3SQOP 2MKCA 1VJQA 1SH2A 1RHJB 1KOOA 2NCKL 3TP2A 1M5KC 3T5KA 2DNPA 4NRUA 4TY8A 2JC1A 3LTOA 2U2FA 3MM8B 3M7VA 2VZ9A 3CDUA 4CYUA 1WOOA 3HO1A 3M30B 4MAKA 1RI7A 4LR8A 5HROA 2PA3A 4P75A 1UA1A 3RAXA 5SZTA 2DH8A 4DSIA 2MDAA 1FRIA 1LWXA 4DQSA 4X64J 3W8PA 3ZTSA 5H9EJ 4B9NA 3TARA 1YJNS 4NZ0A 1PCAA 1T9WA 3HKWA 2M70A 2XYPB 1FO1A 2KT3A 3N4WA 1U1MA 1TVRA 4RW7B 4A48A 1X7VA 1RT6B 1N32F 1BQNB 4QU7A 1FT8A 2UXDJ 1GMWD 4BLGA 1RWWB 4B3MJ 3THTA 3V6DA 2R2TA 2LA6A 4DPTA 2FUG9 3ILIA 3AB2B 4DV5F 1NHKL 3MUTP 1QTMA 2XI2A 1UL3A 2B8QA 1KNZA 2ROPA 1X5PA 2D41A 2AZ3A 2VG6B 4KB7A 1SL0A 4UQGA 4B3SF 3BREA 3R5DA 2VG7A 4OQJA 4ILMA 3GFZA 3F56A 4PG8A 2J0QD 1R0BG 1HQ2A 3D0GE 5A76A 2DD8S 2BW7A 1IJEB 3PW0A 2EFVA 3P6YC 3PYDA 2LDIA 3EPGA 5DGAA 2YWEA 1HA1A 3C15A 3CC7S 3FCVA 1RT4B 3QPIA 3LPEA 4QYZJ 2RS8A 5HBMA 2E1AA 4F4WA 2WK4A 5T41A 4ED7A 3Q24A 3A8KA 4AXJA 4ELVA 4MIAA 1FJ7A 4IQMA 4OZ3A 1WEXA 1KVKA 1UWBB 1XK8A 1HQEA 3MPYA 1R89A 3SIPB 2DGOA 1RU1A 4F50A 3OFEA 4ES3A 2KYXA 2NXNA 2HAIA 3D28A 4ER8A 4HEA9 4M1KA 1KWMA 2DNMA 3DOMA 4ETZA 1N34J 3DLLQ 1LFPA 2IIHA 2IFXA 1CS4A 2V2VA 3EM1A 4A8QA 3KJNB 3ZFVA 3A13A 2RQCA 4FBTA 1KP6A 3DM2A 5A8KA 2B4UA 3AB4B 2R7WA 2NXEA 1SB6A 2J0SD 4NLVA 1AFIA 3OW2R 2WTFA 3KK1B 3NRBA 2OPPB 4RW8A 4C3KA 2F8EX 3M8ZA 3DXSX 1UWAA 5KTQA 2OEMA 1SC1B 2ZWPA 2E1MC 5D0HA 5EUHA 2RQ4A 3I5BA 2R8HA 4X65J 1PC5A 1FE0A 4G3IA 3W64A 1CJVB 1Y9OA 3TUZC 2LQ9A 5AXKA 3OTDA 2ZVSA 3G8QA 1MW7A 1U2CA 1APSA 3KYLA 1QTNB 2V67A 3BQ2A 1C0UA 4DUZF 4ETXA 3CNQP 3AJ2A 3O2IA 3PW5A 4CO4A 3NAIA 2K06A 3J7A1 1Y3KA 3HSDA 3G8TA 3KMSA 4PYDA 2P9GA 1FFSB 5K20B 1IN0A 2ALZA 2ATLA 4HI2A 2GNKA 5EX0A 4IDKA 2EKNA 3KLEA 5L1JA 4F3QA 2JLEA 4HKQA 1FRLA 1VDHA 4ZHRA 4R0EA 3NWRA 1GXLA 3NKYA 2JC0A 3OT9A 1J2VA 5I3QA 1DJ0A 4LBIA 1RAOA 4ECZA 1HNWJ 2LCWA 3J80U 4O3PA 1FX4A 5DRKA 2J76E 3Q86A 2JWNA 2FVCA 3DLKB 1SQGA 3MECB 2GVZA 3ETOA 1VC6A 2AGOA 4CM2A 2XS2A 1C1BA 5HQMA 4DX7A 5DG9A 1FFWB 1NJWA 2CZ4A 2WVBA 4U67Q 4ZK7M 3KXDA 5M2RA 5DS7A 3OSNA 1SJRA 3N5FA 3HFZB 1Y0HA 4A8SA 2EG2A 1WKKA 2V4RA 3ZZRA 4OYMA 2R8GA 3HHEA 3T1HF 2ZBQA 4F02A 4NLDA 1UVLA 1FKAF 4B9LA 4JI8F 4TU8A 1U1RA 4U8VA 3EGZA 1EQ0A 3PYGA 1DQ9A 1PGZA 4LF5F 4MKBA 4L74A 2NYIA 4IKAA 3UN5A 3DN9A 3SCKE 4UY85 3HFVA 3QWUA 2X1FA 2FVPA 3LWLA 2G1DA 3FGVA 1DRZA 1T05A 5F8IA 3HFKA 2R7RA 2JL9A 4M5MA 2J7WA 1VRUB 1RWKB 4W4MA 2CQDA 1MSWD 4B9TA 4O4GA 2KTQA 1DTQB 4I6WA 4IOCQ 1CJTA 4FYYB 2MMYA 4XIUA 3A12A 2RUGA 1IKYB 3ZO7A 2ZKUA 4OYPA 1C0TA 1FRXA 3UDEA 2ZDPA 1ACMB 3M1VA 1WEZA 2J9EA 1S9GB 1TUVA 1IR2A 2M7SA 4KH0B 5E0OA 1HNIB 3CCRS 4J9KA 3UE2A 2CPXA 5KFKA 4ZPDA 3CDWA 3ITHB 5F3ZA 5M2UA 4AE5A 2HQIA 3BGUA 3QJJA 5C7PA 1OPZA 1KFSA 1OIAA 2KYZA 5LJ3Y 4LRDA 3GFYA 2PMWA 3QSIA 3MM5B 3PHTA 3H2LA 4F4AA 3ISNC 1RTJB 3IR6B 2JEIA 2DXFA 2EFQA 3FNNA 3KJQB 3MEDB 1JJHA 3QZ8A 3EDQB 4DSFA 2EBEA 2J0XA 2IJRA 2DXEA 4I7FB 4DX6A 1UTAA 2R4FA 1A9NB 1UJ4A 2M2BA 3R6GB 1Q82T 4GVLA 4R8UB 1HWJA 2BUNA 3G86A 2IA6A 1ZAXA 3PR4A 5F8GA 2MGZB 4L72B 1R0CB 4A8KA 3NMRA 3MCNA 2DPJA 4I0WA 5J1PA 3M6UA 3HT3A 1RTIA 1EETB 3R2CJ 1YBUA 2L41A 4BBYA 3H4BA 3AQPA 3FZBA 5CZXA 2CDQA 4BS2A 2LFVA 1I3OB 2MQPA 1DURA 4NCBA 2AEMA 1MWYA 2E5GA 1R43A 3G9CA 4MK9A 4KQZA 4OFZA 3IA0A 2LKZA 2DNRA 3MPWA 2W4DA 3PJ9A 4K4YA 2MTLA 3BYPA 1YSJA 2V68A 3M8PB 4JV5F 1PO6A 4BDPA 3P5BP 4PWDB 2B7CB 1PBUA 1IJFB 4I2PA 3C16A 3BQ1A 4TYAA 1NB7A 1QLNA 3OV7A 5K8OA 1LW0A 1WACA 2GHPA 4DPYA 2AYEA 2DEIA 2C2OB 2D9OA 1YJ9S 2RE1A 4YB5A 3DGPA 3U1MA 3QQCD 1FVQA 1N8RT 2AZ1A 3N5BA 4M63A 3MAAA 4EZ9A 3LOUA 3KG1A 1DAXA 4UOFA 4UOCA 3MMAA 3PEJA 4ZPCA 3RB6A 2ZUGA 1Q86T 5E3RA 4UOGA 2ZH2A 3IAM9 5CYMB 2YWHA 1WG1A 3CW2C 3D6FB 4BHQA 2GA7A 3QJLA 2RILA 4K4VA 2R7VA 3M8QA 3I82A 1VYAA 3K5NA 3BKUA 3IBFB 3I5AA 2CQ1A 3D3BJ 2E7WA 4FKYA 1JLAB 2CKWA 1NJXA 1FWKA 1DARA 3L4BC 1XIQA 1WEYA 2LXFA 2CG4A 2DO0A 2K7KA 4B3OA 1FRKA 1QY7A 1OQ3A 2D69A 4YN3B 3CCMS 2RUSA 3ILOA 1CC8A 1YDLA 2K1RB 4OYAA 4RX6A 3R7NB 3BGRB 4NEZA 2KN4A 1NMEB 3DI6B 3POTB 1V3RA 4LSNA 1RLCL 4OV1A 3CJTA 4WTYA 2VF3A 2IRUA 1G2EA 1V3SA 4DFMA 2WSCC 2HVEA 1IKXA 1JKHB 1NSAA 5L1LA 2AP6A 3B82A 2RB7A 3FFIB 5IWAJ 1UJ6A 3T1YJ 3DHWC 2BANA 2VFRA 4O44A 1REVB 1YJUA 5ADZA 2DHSA 2GGPB 5E5NA 3NG8A 1K0TA 3CD5A 2Q1LA 1Q4RA 2XMVA 2AKWB 2GIRA 2E1PA 3DNCA 4C11A 1E6VB 2CNKB 2UVVA 3L7UA 1CJUA 3TUJC 2YPZA 2B9EA 1C1CB 2N4CA 2JFKA 4BCAA 2PIIA 3HD1A 3UW1A 1NJZA 2LQ5A 2CRLA 1S6QB 4XAKA 1VISA 2W2OP 3ZZPA 5CABA 1FE4A 1PJ7A 3CJ4A 1WDDA 1UEVA 3OTOJ 1MROA 5B09A 5C24B 3FSIA 3J7YU 3NGRA 2XMUA 2XWYA 2M9KA 3DLJA 1JMTA 5HL7Q 2DGXA 1NKCA 2ZZTA 4PXDA 1U1LA 3I96A 1RAFB 4DV0F 3VGTA 4ZVHA 2I2YA 5E3PA 3OR1A 2VOPA 5KFNA 3RW6A 5AXNA 4KHMA 1NPKA 4DX8H 5GAEI 2NSCA 2ZE2B 4C2MA 1VK3A 1TL4A 1CULA 3W2VB 5J2PB 1PAUB 3RZAA 2UUAJ 1CSJA 2ILYA 3KUEA 2V8HA 3NMAA 4YOEA 4TU9A 3CTRA 2W2PP 4B08A 1JJ4A 2H9ZA 4WFNQ 1S9EA 3BH6B 3D67A 2OI2A 3OR2B 2DRBA 4PXBA 1U6BA 1HBOA 4QWCA 2E1RA 4NLOA 1XMQF 3WQPA 1NU4A 1UPMB 4QR1A 2V2ZA 2P9CA 5HJYA 3KK2A 2Y8WA 4CIOA 4LF8J 1REGX 4HL9A 2HHXA 2G9OA 3TR5A 2WONB 4JI0J 1YRUA 4EGLA 2FZKB 2OD4A 3I4PA 2MZTA 1KQFB 4JI4F 2CQ4A 4ZVQB 2M8DB 3OXFA 4PCQA 4ZN3A 3TQEA 1FRMA 4NXNJ 3LP2A 1NSQA 4GKKJ 3DRXA 1HPZA 3UD5A 5LL6d 2CNNB 1Q8IA 1B7YB 2DR5A 3HD2A 2QRRA 4OI3A 2OFGX 4EFAC 4DR6F 4GMKA 4F36A 2E1CA 5LT5A 4UOHA 2FHJA 2XSJB 1U8SA 3CEDA 4DV1J 4OLPA 4JYAF 4MMOA 1RHMB 4TNOA 3Q83A 1RTDB 3NLCA 3QGGA 2B4OA 4RW9A 3T3FA 1KEKA 2BW2A 2HK2A 1S1TA 3H90A 1PBAA 2POKA 3CO0P 3ZNJ1 1NK7A 5D15A 1BUXA 3K2YA 5GMKa 3V4MA 4CM0A 3AQOA 3VAGA 4DPUA 1GX5A 5LSRA 4IH6A 1YIJS 2CJXB 1WJ9A 1JXVA 4DV6J 1QAJA 3SSSA 1TAUA 4MYUA 1FRJA 2RDDA 4R5PB 1SKWA 2C3MA 3PDNA 4MKVA 2UP1A 2DNYA 3U7JA 1SI9A 3LP1B 3SFUA 3CF5Q 4IOAQ 5L46A 1NKBA 4PQUB 3KNAA 3H5YA 3RBZA 3UWTA 3SDEA 2BZ2A 4K8RA 3PX4A 1R8HA 3S1TA 2ZD1B 2ZJRQ 2F4FA 1B70B 2YKNB 3M6WA 3BO4A 3IO1A 2CPHA 3MM6A 3KMQA 1MMLA 3FCWA 3ZTRA 4M5DB 4EWTA 2UXDF 4OYWA 3VAIA 4B3MF 3IM9A 1TL1A 3W65A 1KTVA 3FBEA 3OLAA 1NJYA 1TL5A 3OD2A 6FDRA 3W7BA 1RT5A 3OL9A 1XERA 5E3QA 1QAXA 3MAQA 3QGPA 5H9EK 1M5PC 3CCTA 2HNDB 4MIWA 2K3KA 5A8RA 5B0CA 2HHWA 4KGZB 1WWHA 4FF3A 4URSA 4TXSA 3IFEA 2GW8A 4NPOA 1X9MA 4HHHA 3J80Y 1VFJA 4CLKA 3W2WA 2ZC3A 3NGKA 1XR5A 4K7QA 1PILA 3HHLC 2MLYA 5J2QB 4USJC 3SCJE 3TA0A 1U6FA 3NNAA 3EICA 3CUNA 1FF2A 4J9QA 4C8LA 1KC8T 1VBKA 4KHPJ 4DLGA 5MAOA 5HK4A 2ACMA 3T6JA 2GZOA 3AD7C 4YP3A 2GJFA 4QYZK 4F25A 4FBUA 3TVZA 2CQ3A 4WF9Q 1N34F 4ZVOB 3H59A 1H3DA 1ZYQA 3JQJA 5KFXA 2OELA 2IM1A 1S1XB 1Y00A 4XK8C 3PRVA 1F9HA 4K4ZA 5KT2A 5CZVA 2NS1B 3G82B 2B3TB 2IPOB 4ZCLA 3N9UC 2FB0A 2EFOA 3MMBB 2HS0A 2XCAA 1EKSA 5THWA 3VAMA 2WVCA 3T19A 3BO3A 2N82B 2VU5A 4WP9A 1T03B 3DYAB 3PW7A 4OYBA 1JLGB 2XY5A 2HBQB 3F44A 2KJVA 4FF1A 4RNFA 4LVOP 4NXMJ 4X65F 3ELHA 3AJ1A 4WP3A 2J8SA 2AJ1A 5JUMA 2D3O1 1PJ6A 5CH7B 1EJ7L 3WX4A 4ZVEA 4XDDA 4QIFA 4O3OA 3OTBA 1WF1A 2XZDB 1YRXA 3BF4A 1C2PA 3BN7A 1FEEA 3QT8A 3LH2S 2I5JB 3FQLA 1HLWA 1FCAA 2LP4A 2W8LA 1VS3A 4RW6B 3IRWP 3P8BB 4LSZB 1TL7B 4DZDA 1N6QB 2BE2A 2B56A 1NZAA 3D6MB 4HACA 1QUPA 5HO4A 3JSMA 2FJVA 4USMA 2UUBF 4HT7A 1JB0C 2CYYA 2MXYA 3UR3C 3SSQA 1TKTA 3D0HE 2YVSA 1KQSR 5C42A 2OFHX 1HNWF 2VJUA 4YUDA 3TNVA 2HS3A 2Z4PA 2OSRA 2Z2YB 4J5OA 3RBXA 3BR9A 4UQTA 3M2UB 3K17A 2DKOB 3GILA 1MN9A 4OHWA 4CP5A 4DR1F 2HZAA 4KO0A 1DBDA 1U0SA 3Q23A 3KK3B 7AT1B 1S7HA 1Z1ZA 4ZP6A 1VQPS 3FJ2A 1NO8A 4TVAB 3MI7X 2QZ8A 2UXBJ 3BEGB 3WC0A 2GCFA 1S76D 3LGMA 5KFIA 4WFBQ 3R5BA 4RUBA 3TOQA 2V94A 4Y28C 4F3MA 5F8LA 3VQSA 5K8PA 2Z8QA 5C5JA 4ECYA 5KG0A 1O51A 1K8AT 1HD0A 2DRAA 4H4OA 2V9WA 2C3YA 2W8KA 3DHXA 5A8WA 2QL5B 4WTOB 2Q79A 4ZKAA 2B5JB 1LW2B 4DBQA 2GAHC 4XPCA 2BOPA 4ECXA 4MFBA 3C46A 4C97A 2IHR1 2AGQA 3KJVA 4QR0A 1MWQA 2XMMA 3RTVA 4NYPA 4B3RJ 3L7PA 4ZPBA 2CPDA 5KFSA 3O1LA 3UDCA 3ZTOA 4GO5X 2XG8A 2OPRB 1UVKA 1DLOB 2OPQA 5D0GA 3EYZA 3R6LB 1HKAA 2HHPA 2CQHA 2DHGA 4DV2F 3AOCA 1VIOA 3SV4A 1M1GA 4I4BA 2GQCA 2MKJA 1KQGB 5IM0B 2CQGA 5D4NA 4YDXA 1MU2A 4V19X 2OEKA 1TFWA 4USHA 4LF9F 1Y5LB 4DV3J 2Y1RI 1QE1B 4GKJJ 2RF2A 2ZJPQ 3EJMA 2VG5A 1JX4A 4ANCA 5D4PA 3ZZ0A 3DOLB 1EIYB 4I6YA 3BH7B 3TAQA 3J81j 1M0SA 3VTIA 4RBVA 4Y34A 4CLPA 3HSGA 3KLHA 1K1QA 4RO0A 3MMJA 3QWPA 3UCZP 3S8SA 1FXLA 4KPCA 4M5JA 5C25A 5B0GA 4TY8B 4P7TA 2CJBA 1OY9A 2Q66A 1W26A 2CZVC 4WE1A 4DQIA 2B6AA 2QLXA 4NRTA 4H4MA 4Q7AA 2YKQA 4ZP8A 2GVDA 3GJSB 5EGYA 1IR0A 2B7BB 2CUYA 3BKTA 5HROB 5HQ8A 4HVZA 4K4XA 2OP5A 4JOUA 4TU7A 4RWXA 2ILZA 3V6KA 2O67A 4H54A 1P1LA 2KZZA 1C4CA 3BKFA 3I5CA 4DEZA 1TKZB 4N5SA 3CJRA 1VGYA 3GYXB 3U27A 1TVRB 3PW4A 1X4EA 1FD2A 2FHOB 3HP6A 1HBUA 5KT6A 2MQLA 3T41A 3V6DB 3JXOA 2MQOA 2QA1A 1U1PA 1WOSA 3SYZA 1XWLA 2HHQA 1ZH5A 1R8PA 3NCQA 2E5IA 2BQUA 2PEHA 1F9EB 1YWXA 4YEAA 4ILLA 2JZ5A 4FDFA 1KN6A 4LBHA 1GQEA 3ENVA 3MF5A 4G1IA 4Q2MA 2B43A 4P72A 1WC6A 2ALYB 3RU0A 3IWNC 4RUHA 4EBCA 3G96A 3C15B 3AAWB 3M9NB 1NH8A 3CE8A 3WZ0A 1R0AA 1S1WA 1CQMA 1JQGA 2XULA 2R3VA 5HBMB 3V4IA 2HQGA 1QUVA 1FA0A 1WHYA 2VFTA 1S9FA 1U25A 3DRPA 1N36F 4WXOA 5KFOA 2AQ4A 2BKNA 2N3LA 5LXYA 1RHQB 1MWZA 2C3PA 4CCHA 1KDNA 3K58A 4ED3A 2XY6A 3D1QA 4HTIA 1X60A 4ECSA 2RNEA 4KY3A 2EEYA 2QJ3A 1IUJA 2ZBCA 2LU2A 5DDPC 4B9VA 3DOMB 4EYHB 5CHCB 1T9UA 5E2QA 1HNXF 4LUBA 2GX8A 2G0JA 3NGSA 1JXEA 2NR0A 4M8LA 4J9SA 2LEAA 4ZVRB 3TO8A 1S0NA 4RW4B 3TA2A 2VC0A 1VRTB 4LT6A 4ZCIA 5KG7A 5FLXY 5A8KB 1XMBA 1H0HB 3M32A 2QGFB 5E7OB 1RGVA 2HFOA 4JI7J 4NI2A 2LLZA 2ROEA 5F8MA 1SH3A 3TX8A 4ICLA 2FVRA 4RW8B 5IWAF 2VA3A 3LO3A 1RAGB 3VHQA 4F0HA 4RL1A 4NL5A 3BYRA 3SXLA 3BSCA 3SMZA 1LKZA 4ZLJA 5A6PA 4PABA 1H7XA 3CCWA 4LSLA 3L09A 2ZOGA 4Y0FA 2OUGA 2G1HA 3Q8QB 2A2DA 1K47A 4OYOA 2QA4G 3GTYX 1C0UB 2CNLB 5GMEA 2JEFA 2XQCA 4X84A 3W9JA 1FJGF 1HQUA 5DLGA 3J7YI 2AD9A 4W98A 3OTOF 2XO6A 2DO4A 3K8WA 1SUQA 3LPYA 1K73T 1VRQC 2DNOA 4Y2MA 4IDKB 3KNGA 5G4DA 5I3PA 3Q0AA 1ZBTA 2HYIB 2X1BA 4HH1A 4ZHRB 3FVYA 5F9NA 2R7UA 3G6XA 1FDDA 2UUCJ 1AA1B 2LMIA 3HCXA 1WSVA 4DSLA 4ZVUB 1FTCA 4DCJB 2ASDA 4Y2KA 1RZMA 1WSRA 5KG5A 2ZHOA 1CLFA 5GAGI 4RBUA 4ZP9A 3BN4A 4QZVB 4CO3A 3EGNA 1C1BB 4JI3F 3CULA 4WZQA 3D5MA 2BJDA 2QL7B 3OQ2A 1UFLA 4ECUA 1FERA 3OBIA 3UD3P 3CJKB 4LFAJ 4K4UA 1U1OA 2VQEJ 3QO9B 3GR0A 1N33J 5IC4B 3AH6A 3ZZYA 3Q2SC 3NBPB 1RB0A 4DZ6A 3KDNA 2HVIA 2ZUAA 4KSEB 2IYIA 2MKKA 2J6TA 3MEKA 1IR1A 4NLYA 1Q7YT 5D4OA 3TZXA 3TYTA 2PT0A 1XN9A 1FX2A 2MZRA 3D1HA 3KKFA 3HJFA 2KXFA 2CJ9A 4WBFA 2V4JA 2KZMA 2G2OA 1PYTA 3JYTA 3H20A 2NREA 2Q3PA 4C4WA 4O4GB 4YR0A 1CJTB 3W61A 3GJQB 3NS6A 1D9AA 3BGOP 2PO4A 1HL6A 5I3UB 2ZHBA 3P3DA 3EVWA 1C0TB 2E7XA 2Q6CA 5GADU 3M1VB 2QX0A 1JLEB 2D3ZA 1WUUA 3CCQS 2FYXA 3IR7B 3TUPA 1VQ9S 1T3OA 2C2ZB 4N41A 3NXZA 1HD1A 5DZ7A 2B4VA 4DX5A 4V1Ak 1IVZA 5KG1A 4ECWA 4DV6F 1U48A 4WFYA 4A8YA 3W66A 3CIMA 1RKIA 1SC4B 2PD1A 4G1QA 3PO4A 2EG1A 4H4KC 3DLGA 1F9FA 2ZH7A 1JXLA 2LQ8A 5GVQA 2V34A 3M2VA 3LP0A 3R3TA 4YY3F 2VASA 3R2DJ 2AJ2A 4QPTA 5EDWA 3FMBA 1YGYA 1GTHA 2VFUA 2KT2A 1RT1B 1IQTA 1F5AA 2BKPA 1RTIB 2A0FB 1RWNB 2RSQA 3CCJS 4LFCJ 1JNZB 2V9KA 3CPWR 2QTWA 2YQ0A 1J5EF 1VQOS 4D3HA 1LWCA 2HRTA 4USVA 1HBMB 2P9EA 2YNIB 4MTPA 2MJUA 4JV1A 4UF4A 4YB1P 1S49A 4F04B 4LFBJ 5D0EA 4DUTA 1N52B 2M5YA 5AJ3F 2MQ8A 1KONA 4AQYJ 4LMZA 2BACA 4NLWA 3HVTA 4PUOA 4I2PB 4OJGA 2HS4A 4WU2A 3G87A 1X4FA 1LW0B 1NCLA 3T9ZA 2HQ3A 1W7WA 2MZJA 2RRNA 4DV7J 2KH9A 1T8EA 1RE1B 1KHVA 2ZWOA 3DGPB 1XNRF 2AEJA 1ZTWA 1FTRA 2QLWA 1PG5B 1IXKA 4C7QA 2WZ1A 2IBOA 3B6BA 4QIVA 1TP7A 3PHEA 2OSQA 3KHHA 3ZZZA 3NL0A 2EKYA 3EWGA 1W25A 5K14B 3AFGA 1VQ8S 1HR0J 4W90B 4DR2J 1V5IB 1GMUA 3GJTB 3GZ7A 3I87A 1OYEA 1I1GA 2UXCJ 4MKAA 1BD6A 1NSPA 2UVRA 4FVCA 5IQQA 3ENWA 1TZ0A 2QYCA 3PNIA 1T9YA 4I69A 1GH8A 1IM6A 4B3OB 3ILLA 1FJCA 5IT4A 4DL7A 5EN1A 3BZQA 3P4UB 4HH0A 3GYGA 1EKRA 4NXMF 1S59A 4LSNB 2Z2ZA 2C2DA 1VQYA 2GFFA 1CJKB 4N56A 3T1AA 5DO2A 1SQFA 4G1PA 1IKXB 3W1YC 1UW9A 4YHHJ 3TQ1A 2FY1A 2BJ7A 2BANB 2F7VA 2H51B 4O44B 3AOAA 2W2MP 4ZVPB 4DV4F 4ID8A 4WKRA 3R1HA 1NPPA 3K5MA 2B51A 4FYWB 3B54A 2XGPA 4C11B 4F7VA 4N77A 1CJUB 3KK1A 1R27B 2IVFB 3OLBA 3DRSA 5HJXA 2JHEA 4AD6A 4DR3F 4IG0A 4OZ1A 3V2UC 1MMNA 3M9OB 4OI4A 2HLTA 3ISZA 1WF0A 3QRPA 1TMJA 2B0GA 3GQCA 4ZITA 3GP9A 2OPSA 1NUEA 3AXMA 3LAMA 3PRDA 3SCLE 1SKRA 1XEZA 1DTTB 2GAGC 3EVMA 3IBCB 3DC2A 4ATNA 2CPYA 4LREA 1GFWB 2F9JA 3O5TB 3KLGB 4PPZA 3HLUA 2V50A 2AJFE 1CULB 2WCXA 2FJBB 4NA3A 3DLHA 1ICEB 1IBLJ 2FIUA 4KT0C 4X4SA 2ASLA 3RBEA 2OD6A 1NK6A 4C0BA 1S9EB 1VC0A 1RT2A 4Z7CA 1IKVB 4EBDA 2A6OA 2VH7A 2PFFB 4ZVSB 3MCOA 2QLBB 1FWLA 3DLKA 3MECA 4OX7A 1VHIA 3KK2B 1FNXH 5AXMA 1FK9A 2XBPA 2YQ3A 4JV0A 5LSLA 1FXRA 2HFVA 5DG8A 5EWFA 3VAHA 2PC6A 1VBYA 1S7IA 2O66A 3E51A 5KFTA 4B3RF 3N6MA 1V5VA 4ZIVA 3DLEA 5BYRA 4KBIA 1H7WA 4F3OA 3HSJA 4DL4A 4IOBA 2M8HA 5A0YA 1CEZA 1F6TA 4ZLPA 3WIVA 4DU8A 3LP2B 2MHEA 3H5UA 1HPZB 2XB2D 2FJXA 4GO7X 2HWHA 2ZH9A 4PYAA 2F3JA 3DDNA 3RR7A 4RU9A 3TUIC 2VV5A 3GG1A 2VBZA 2FLPA 3B4DA 4WXWA 3QBCA 1N0VC 4KYZA 4USUA 3BBCA 5DDOC 4ED5A 4QR2A 5FDLA 3J7Z5 1Y11A 1N54B 5DQHA 1VRUA 1S1TB 1ZPWX 4B3TJ 2G13A 4CQ1A 1WELA 2I38A 1R6YA 4LF1A 1IKYA 2RHSB 3BB5A 4DR7F 4LQ9A 4YR2A 5J1EA 1NDPA 3A3PB 2XEXA 2WB4A 1AT1B 4I68A 2OMOA 2RDIA 3TA1A 1UA0A 2UV8A 1I51B 4J9NA 3JTPA 3GJRB 3W3SA 2EPIA 5ETMA 3H8YA 4USTA 2HBZB 3C6TA 4ANEA 2PMHA 4JBCA 3R5AA 3R5JB 4IH5A 5ETRA 4DDFA 2MSTA 3DRRA 4DU7A 2JJ4D 5AE2A 3MEGB 2DCLA 3O44A 2Z57B 3NCRA 3HVAA 1R7IA 3PIOQ 2MLXA 3UVJB 5IFMA 1T9TA 4JI1J 3G6ES 4ZMMA 2AYBA 1WORA 4J9PA 2VDHA 1EARA 3M9MB 2Z0GA 4I7FA 2C22A 1U7LA 1X9SA 1TL1B 2NUUG 2UUWA 4LQ3A 4DR5F 2DNQA 2MKSA 2F63A 1Q95G 4ZCMA 3C14B 1HYSA 1X0PA 4C3MA 2I8EA 3QFHA 4ZS6A 5ETTA 1RLDA 4I2QA 5A8RB 3QJPA 2KM8B 3JB9k 4Y2IA 3FMWA 3ULHA 1EETA 3R5CA 1B99A 5A2QU 2QSWA 4X4NA 3PG9A 4NLTA 4CO1A 2HMIB 4EUVA 2HNYB 3W2WB 4CH1A 4DUYJ 3HHLA 1F0XA 1U1KA 3I31A 3WDOA 1HW9A 2OMLA 4IO9Q 2XZTB 3VZHA 3I55S 2QN6B 2W9BA 1N32J 1NEEA 5KFDA 5KFUA 3C3LA 3OL7A 1NDLA 3CDEA 2AX0A 4PWDA 4OV6A 1KLMA 4U7CA 4DV5J 2YKMB 3UQSA 1T3NA 1NK9A 1RYSA 3PV8A 1H73A 1SKSA 1S77D 4CLFA 1N88A 4B3SJ 5CYQB 2C2RA 1F2HA 5MLCV 2XLIA 3TZWA 1RAIB 2YWKA 4C8MA 5BR8F 3BBFA 1RTHA 1SVDA 2BJ1A 4PG6A 1RUSA 4E8UA 5ETSA 2WOMA 1LWEB 3R27A 3HF5A 2W7AA 2LQJA 4J9VA 1ZM4A 4JV2A 7FDRA 2V8DA 4P2FA 1O6XA 4DCOB 4NOHA 1YI2S 3ISND 2YNGA 1UZDA 2BXJA 4LBPA 3LUYA 3VGVA 5L9NA 3B8HA 2V5HG 2HGMA 2W9AA 5F3TA 3TW0A 3DMJA 1KOHA 2NXUA 3PR5B 1Q8BA 1D0EA 2DPIA 2HLUA 4UT4A 3GMGA 1NHUA 1HWKA 1RA6A 2RAQA 2VQFF 3NOCA 3MPVA 3CC4S 2LXUA 2NUHA 1PSDA 4OX9J 1RISA 4PAAA 1TFYA 2IRYA 3DDIA 1YLXA 2M3DA 2BE2B 4ZJOA 1SPBP 2DHAA 3ZNUA 2IM3A 4HACB 1S1UA 1JKHA 2NSBA 1FXDA 4QCLA 3CCUS 4OZ5A 5HMZA 1YZ7A 4K2XA 3CD7A 5IC6B 5E41A 2J8AA 2G0IA 3PTWA 1XNQJ 4KKOA 4N7TA 3M2RB 3JTNA 2GGPA 2GS8A 2UUCF 1TKTB 5C42B 2PA8D 3BDEA 4LF7J 2X7IA 1E6VA 1H6KX 3TANA 4NLGA 4P2XA 5LXRA 1K1SA 2W1BA 2E66A 2GJ2A 2A1BA 2O3DA 5ETVA 1WC0A 4DUZJ 2MHNA 2P6SA 4KO0B 1UVMA 4L75A 1XTZA 4L3KA 4TYBA 4DPOA 1S6UA 1Q5YA 1X9WA 2FPHX 5I42B 3ADAC 2DCUB 4ZVGA 4KIAA 5C24A 2AIRB 5KFMA 5HMXA 4DXLA 5EX3A 2IM2A 2C2KB 3HDSA 2RRAA 1RYRA 4OHZA 3UDLA 4WK1A 2VQEF 1U24A 2C1EB 3PACA 1N33F 4AT1B 2WW4A 2IC3B 4DL5A 3V6HA 4H4OB 1GMWA 2F8HA 4J9UE 3W62A 4K0KF 3LWMA 5J2PA 2VOOA 4X4TA 1E6YA 1N5SA 5HP1B 3C66A 2ZNZA 3CJQA 2E29A 4WZMA 1T94A 3Q8VA 4CNZA 4DI6A 1ZS6A 2HIQA 2BVZA 5L38A 3RAQA 1N5QA 4I1TA 1VR6A 4DOZA 2HFUA 5HANA 3KOAA 3R97A 3PFOA 1ROFA 2ZBPA 4K5SA 4OZNA 2R9LA 1UKUA 1M5OC 3T1HJ 1TKXA 3GIRA 4DN9A 4U95A 5GADI 4P73A 4KHRA 1RHRB 2NXJA 1VQ5S 3CJ8A 2OPQB 2WONA 3F0NA 4URGA 4LF5J 4Z2XA 2BX6A 2V6AA 2JFDA 1KKHA 5KFCA 3JSBA 4LJMA 2G4BA 1MU2B 3SZ2A 3LW5C 5HSPA 2QA4S 1U8WA 3KTQA 2VG5B 3Q2TC 4NZ6A 3L95X 3THPA 3UDVA 2HQDA 4LRBA 2VPWB 1PKUA 2HEKA 2O5DA 3CCZA 1A6LA 3N6NA 2BDPA 1RKJA 1DZ5A 3NP5A 2HFNA 1U26A 2ZOMA 3QLHA 5C25B 4X66F 1LEOA 3OVSA 5KT5A 4Q0BB 3CMES 2B6AB 1RTDA 1BGXT 4H4MB 4WJBA 3TJ8A 4IR1A 2BRKA 3RYLA 5BYSA 1A7GE 2I6WA 1D9FA 1UPPA 3FQKA 2XO7A 3AA9A 3FZ2A 4CRJA 1JLBA 2ROGA 1HBNB 4MKYA 1NZ8A 5ETKA 4LFCF 1DQ8A 1KQKA 4F2RA 2H4YB 1OSCA 2IAJB 1Y4ZB 4PEOA 2R8KA 4P6QA 5KFAA 3VGSA 3BBBA 2OGUA 3CDBA 3NOGA 5F41A 5DQGA 4X2BA 2IVYA 1CPZA 3MR5A 2HHSA 2BJ9A 3PW2A 2CJKA 1HBUB 4LFBF 5ETLA 4RWWA 3PXGa 2AYGA 1S97A 1TUWA 2MPUA 3MMCB 2N7CA 1D09B 4AQYF 2LDYA 3MOZA 4EU0A 4NCGB 3CJSA 2QL9B 2QMXA 2IRXA 2GIFA 1EZZB 2UU9J 1O8BA 3KHGA 1GXTA 3TAPA 5KT7A 3Q8PB 1P9QC 4DQPA 5HN0A 2W01A 1BY9A 1T9XA 3QYYA 3FRYA 3EZ5A 2Z56B 1U0HA 4K4SA 4OX8A 2HHTA 3MOJB 5G0RA 1MN7A 1RT3A 2CJYB 4LRFA 1S1WB 4NLXA 3KLFA 1BQXA 5KFLA 5B0EA 1U47A 3V4IB 3BDPA 1ZOTA 1RA7A 4U6PA 2LQBA 1JK9B 3DKDA 3DRPB 4A4JA 1S72S 2W25A 1AYEA 3HJVA 1X8DA 1WI6A 2WVEA 1RAJA 3CCES 1KVIA 3IM8A 4PWUA 3KHRA 1NK0A 1PYOB 4FXVA 1U6ZA 3T5LA 3KHLA 2DISA 3C6UA 5FJ4A 1RBAA 1L3KA 1RU2A 1CVJA 1WC5A 1T0TV 1F60B 2AWZA 3PYFA 1K9MT 3UNGC 4Y00A 3RW7A 3M32B 3MR6A 3H40A 3FK4A 3EE3A 2BQRA 5LMNJ 3CXCR 2VHGA 4NI2B 4ES1A 3D7SB 3TVYA 1HNVB 4ICLB 2BV3A 2HHHF 2ZZMA 3H98A 4TKTA 4QW8A 1S4FA 2DY9A 3GB0A 2D9PA 4FZVA 1XMOF 1NK8A 2ZH6A 2ZBRA 4P2SA 3IS9A 2KXNB 2RDJA 2RHQB 2VIHA 3HPOA 1AROP 2YKOA 1TV6A 3G82A 2PI5A 3AHPA 1WI8A 3KLIA 1AB8A 3B78A 1YITS 2YWGA 3IAS9 3HZEA 2AX1A 1RWMB 1T03A 1T11A 1XJWB 1N5VA 4HHUA 2DT9A 3IMQJ 2AV5A 3GE9A 1SJQA 3CD6S 2KHDA 1HQUB 4MYTA 1QD1A 3QIDA 1D1UA 2N4DA 2KRRA 4USIA 4DF4A 2F9DA 4Q45A 5HAOA 2IDLA 1N4LA 1TK5A 5D6GA 2OHDA 4M5LA 3T9NA 4WK3A 2HURA 1V6HA 2E9RX 2LEPA 3R5GA 1HWIA 2YNFA 2IY5B 2A2CA 2DBBA 1N6QA 3N79A 1ZPVA 3T6BA 3FBFA 2R7XA 2QG9B 2M0GB 4B9UA 4WP8A 1L3VA 1AW0A 2ASYA 4JP8A 3RJMB 1LV5A 3U1LA 1L3SA 2YWWA 2WBRA 3MEEA 3S01A 2V63A 4OYZA 2CNOB 3MCSA 3IBWA 1S1VB 2UV8G 3QNWB 3PJXA 4OJ1A 2XC9A 1YJWS 5D0RA 3P96A 3HHLD 2HAFA 4X4UA 4RR5A 1ZM3A 1DFDA 3M2UA 3GIIA 2F4VJ 2QFJA 2DYAA 1GT8A 2E5LF 4ZA1A 2RU9A 5BYQA 4Y65A 2KJWA 3NAHA 4DV0J 2C3UA 4ZOSA 3VV2B 4YDDB 1BC6A 3L7OA 1Y5NB 5B0AA 3KK3A 3HI9A 4ECRA 2R2SA 2YPYA 4ECQA 1SBRA 2MY8A 1YVFA 5HVGA 2EFPA 4X4OA 1UETA 5A2QY 4OHXA 4U8YA 5GAGU 3CMAS 3TJAA 5D78A 4IH7A 4R0JA 2AYMA 4F4XA 5EWGA 1R8CA 4ZPWR 1OO0B 1AZSB 3D6TB 5KFQA 4KPYA 2V4JB 5DDRC 3JSYA 3JYTB 1XMQJ 2PE8A 3CO9A 2COLA 1JJ2R 1ZTTA 2W2QP 3C8YA 4DL3A 3GONA 2B5JA 1FD8A 1Y10A 3OUYB 5EHHA 2XMJA 1OQ6A 2R2RA 1UFWA 3G6YA 3EGWB 4QIWD 1WDTA 5JMNA 4C98A 5LMUF 2GQ2A 4O23A 3PVXA 3HHNB 1LWFA 4JI4J 3W5XA 2G0CA 2DGQA 2MKHA 1RQ0A 5LJ5Y 3NGUA 4KGKA 1LXNA 4M5IA 4LF4J 4QPXA 3DU5A 2HW3A 2QYGA 1R8BA 1UVJA 1DLOA 2PDAA 2E9ZA 4RJVA 4Y2CA 5BXIA 3HVRA 4CT8A 5D3GA 1ZZNA 2EWHA 3MR3A 2HWIA 1WF2A 2HNZB 4PG7A 1FVSA 3R7SB 1JLFB 4L3NA 4H4KA 4DG1B 2PGCA 4A8MP 3DLGB 2IMOA 1K44A 5HMYA 2E44A 3ZZOA 1FWPA 2J7UA 3M2VB 3LP0B 3GLJA 2ZOFA 3PJWA 4C8KA 4HHJA 3ZXWA 2LYVA 2HVZA 2C42A 4QQBA 2JNJA 2DGUA 3MM7A 4NMXA 2IYGA 4M95A 2FLOA 3KG0A 5CCLA 2H54B 3VGUA 5E3CA 2D74B 4EMDA 4OI0A 2EFNA 2YKPA 3E8OA 2SXLA 5KG3A 2M88A 4RNMA 3IG1A 1YJVA 2EK6A 2XTJP 5CQGA 1SH0A 5T7LB 3OHAA 1TMMA 3LGHA 4FXDA 1RABB 1LWCB 4CDIA 3NNCA 5CXTA 3HXMA 4RPFA 4OIXA 3V81A 2V8GA 2JOQA 1LOUA 6AT1B 2FHMA 3WBZA 5KFVA 2HVHA 4RUAA 2Y0SD 3O8WA 1MG7A 4X64F 1SQEA 4QIEA 1QVFR 2HGNA 2XI3A 2QO3A 3WC2A 1S79A 3AA8A 2KFYA 1RHUB 3HVTB 3QT5A 4AYBD 4PUOB 2J0WA 4DUYF 3TJ9A 2QV6A 4FVMA 3M05A 3H0PA 4WFAQ 1TKZA 3K8VA 1RAHB 1SC3B 2CA9A 1B64A 3H5SA 2HPUA 3IR5B 2RT3A 1J5OA 4MIBA 3UPFA 2VPYB 5CA5A 4Z7YA 1JLCA 4DL6A 2WSFC 3T5HA 1B7FA 2PI4A 2EI5A 2X3GA 5HQLA 4OZJA 1UP1A 1S0MA 1Z2LA 4B9SA 3RUBL 3WIUA 5KFJA 2GO8A 1XC9A 2H5IB 4CZCA 2XCPA 2JEJA 5KOXA 4UTGA 2AW0A 3WHIA 3M6XA 1NB2A 2GV1A 1Q1KA 1UZHA 1R3NA 1G3OA 3FRZA 3MHYA 2HQFA 4NE9C 1NXIA 1HMVA 2YWFA 4NA2A 1U09A 4TQRA 1JLQA 2DGSA 1EP4A 1F3VA 1LK5A 2HRYA 2WW8A 4OYIA 5IQ6A 1UCNA 1QAYA 1TL3B 1SV5B 2V2QA 4CLTA 3VVUA 3D9BA 2DR9A 3JSRA 4J9OA 3DOKB 3W60A 2VFVA 2DH7A 1QVGR 3QATA 1V9OA 2R7QA 5KFYA 3TX0A 1PC4A 2J6UA 4ID5A 3MDFA 1Q7LB 1D8YA 1NSKL 1SL2A 3K57A 1B0TA 4J7CA 4PXEA 1KRPA 3IWLA 4OX9F 4RW4A 2R7TA 2HZCA 1VRTA 4LVNP 4KV8A 1U45A 3PFEA 3D3CJ 1XQIA 4O3NA 1SJ4P 4J37A 1VQ7S 4PQAA 4ED0A 4M5GA 2K2PA 2KG0A 2KI2A 1RAAB 2XMKA 2CIMA 3DRSB 1HHTP 4EZ6A 3KLVA 1GX6A 5K8MA 2DRDA 4J90A 4P9SA 2EFGA 1XNQF 4IG0B 3M8WA 5K5MA 2Y8YA 1X5OA 1RWUA 2EBGA 1S57A 4LF7F 2QC3A 2GC8A 4USWA 3CD0A 1WC1A 4IYQA 3X3UA 1D9DA 5D4LA 3A4TA 1M1HA 1NLKL 2OPSB 1MLAA 1RJJA 1B4SA 4CLZA 5J2MA 3H7HB 3RAMA 5HVFA 3OPKA 3I4HX 3LF0A 4NEYA 3IWXA 2QLJB 2ZITA 3VCDA 2FGCA 3ZZUA 4ZP7A 1UJ5A 1FESA 1HHQA 5AE3A 1MNEA 4ZLLA 2L3MA 5ITHA 2UUBJ 1NKEA 1IQZA 1IBMJ 4Y2AA 3I0SA 2HRUA 1YK9A 2KRBA 2LEBA 4L76A 2XHCA 2BJ8A 2A18A 4UUWA 2MYFA 4LRAA 2GJIA 1RT2B 1K0VA 2OH2A 4NZ7A 4ZPVR 3R8YA 4X4VA 1ITPA 5L39A 1BQMA 1YKWA 3AODA 4CH0S 4A47A 3LANA 4FP9A 3ILJA 2O1PA 2WBMA 1FK9B 2I9SA 4DR1J 2BKOA 4YB6A 3L9ZA 1H72C 4C8YA 4OJ3A 2QA2A 5IZHA
chains in the Genus database with same CATH topology
2PFFB 1CSJA 2ILYA 1H2TZ 2V8HA 1G6BA 4MJKA 3NMAA 4YOEA 4U9RA 4TU9A 3DLKA 3CTRA 1KTQA 3MECA 4OX7A 1C4AA 4B08A 3D2WA 5F0WA 5DG7A 3A8EA 5FD1A 3KK2B 1JJ4A 5HLFA 2H9ZA 4IO1A 4WFNQ 1FNXH 2GMHA 4O4RA 1XR7A 3DLEB 2ZE2A 3CT9A 4TN2A 5AXMA 4HT5A 1FK9A 2XBPA 1QSSA 2YQ3A 1S9EA 2M52A 1P1TA 5L9XA 4JV0A 3W2VA 1N5YA 2MQNA 2AJ0A 3OR2B 5LSLA 1FXRA 5A0YB 5A8WB 3CJKA 2DRBA 1X4DA 4PXBA 1U6BA 1HBOA 4QWCA 2E1RA 5DG8A 3R1LA 1LXJA 4NLOA 5EWFA 3VAHA 1XMQF 1NU4A 2RQMA 1S6OA 2PC6A 4QR1A 1VBYA 3I56S 2O66A 1D3WA 3QO9A 2JEGA 3E51A 5KFTA 2P9CA 3KK2A 4E0DA 4MFBB 4B3RF 4CIOA 1HI1A 3N6MA 2VKRA 2UVUA 3QIPB 2VUGA 3DLEA 5B0BA 2YNHB 5BYRA 4ES2A 4HL9A 2LXIA 4KBIA 4M94A 3KJVB 1H7WA 2FJWA 2G9OA 4F3OA 2HHXA 3TR5A 4DL4A 4F4KA 1WHVA 4IOBA 4RKUC 2M8HA 3OR2A 5A0YA 2WONB 3NBPA 1YRUA 1CEZA 4ZLPA 3KFWX 4AXIA 1GXUA 1Z2ZA 2IJNA 2JVOA 3GYNA 3LP2B 2MHEA 3CJ2A 2C2EA 3H5UA 4EGLA 2R2UA 2OD4A 3I4PA 3U1NA 2MZTA 4HDHA 4WKYA 1KQFB 2NPFA 1ZM2A 5F8JA 4XDCA 1HPZB 3QIPA 4A8OA 2CJQA 4JI4F 2CQ4A 2YNHA 1FDAA 4K5RA 3T5JA 2XB2D 2FJXA 2C3OA 4GO7X 2HWHA 3OXFA 5J2NB 4CTAB 2ZH9A 1M5HA 1M1KT 2F3JA 4PCQA 4BC7A 2EC0A 2KT5A 3DDNA 3GV8B 5L8RC 3MAHA 3RR7A 1HHSA 1IBKF 4RU9A 1FRMA 2VV5A 3TUIC 1HI0P 3ENQA 3GG1A 3PM9A 2RU3A 3HKZD 4NYOA 3LP2A 1NNDA 3OTCA 3P5TL 5FDLB 7FD1A 2VBZA 2N7YA 2I0XA 3BM7A 3OUYA 3DRXA 2FLPA 1FEHA 3MFIA 2K7JA 1HPZA 3VZIA 3B4DA 5KFGA 1Q81T 3QGHA 4FF4A 5LL6d 5J2NA 4CTAA 4WXWA 3X1LB 1Q8IA 2DR5A 1N0VC 2ADBA 1X4GA 4B9MA 4AL5A 2QRRA 2MSSA 5DDOC 4Z37A 4OI3A 2MQQA 4Q43A 1NK4A 4IQXA 2NZ4A 4ED5A 5I3UA 2OFGX 4QR2A 4KR0B 5FDLA 4EFAC 3OSPA 1SIZA 4DR6F 1GAOA 4GMKA 3SQGB 3J7Z5 5J1EB 1N54B 4UY8T 5DQHA 2V8VA 1VRUA 2RF2B 2OLWA 5LT5A 2E1CA 2FHJA 2XSJB 4OI6A 1S1TB 1ZPWX 1WHXA 1U8SA 2G13A 3CEDA 4CQ1A 1VLYA 2BJEA 1WELA 2GMLA 4OLPA 2I38A 4HDGA 4NYZA 4JYAF 2ABYA 1JLEA 1R6YA 4MMOA 1HW8A 2XMWA 3FCHA 1IKYA 3ZC4A 5H9FJ 2DTJA 4TNOA 2QSFA 1HWLA 3BB5A 4NLRA 1RTDB 4DR7F 2LU1A 4LQ9A 4YR2A 4I6AA 2VD3A 3NLCA 3RRHA 1SXLA 3KLHB 5J1EA 1YQHA 4ED6A 3QGGA 3F73A 2B4OA 4RW9A 3T3FA 2XEXA 1RK8A 1KEKA 2XSJA 1U49A 2CFXA 3C6TB 2BW2A 4YQWA 1S1TA 2WB4A 3U02A 4EEYA 4I68A 2OMOA 2VBYA 4XO0A 2VONA 2POKA 2XHWA 1NK7A 2RKIB 1LK7A 4PG4A 4DR4F 2RDIA 1KSPA 3TA1A 2HNZA 3OFHA 3DRRB 3S7RA 1VOMA 3K2YA 1UA0A 5GMKa 2UV8A 3V4MA 1JLFA 4WE1B 2FLLA 3AQOA 4J9NA 3VAGA 3SI8A 4DG1A 4N76A 3JTPA 3W3SA 3H2UB 2EPIA 1GX5A 3E2EA 5D8HB 3H8YA 4C0OC 5LSRA 4IH6A 3C6TA 3CJ5A 1N56A 3CC2S 2PMHA 3O6QA 4JBCA 1YIJS 4W92B 3R5AA 4IH5A 2QMWA 4DDFA 3HX9A 1X0FA 1X4BA 4OL8A 2RKIA 3LGNA 4OHVA 5M2PA 2W7PA 1QAJA 3SSSA 3RRGA 2OKQA 2JRSA 2MSTA 3DRRA 2JJ4D 4MYUA 1TAUA 1FRJA 5AE2A 4R5PB 1SKWA 3MEGB 2ZH3A 5KFPA 2L48A 3DLBA 2DCLA 2C3MA 3PDNA 2UP1A 3O44A 3NCRA 1X4CA 1R7IA 2DNYA 3HVAA 5IFMA 3U7JA 3PIOQ 1SI9A 3MUMP 3RB4A 2Y1IA 2BBEA 4NA1A 3LP1B 4AL6A 3G6ES 2X1GA 4ZMMA 3SFUA 3CF5Q 3UD4P 4IOAQ 2AYBA 1NH7A 2EW9A 5B7WA 1NKBA 5KT3A 4J9PA 4PQUB 3KNAA 1F5BA 4QW9A 3H5YA 3UWTA 3MFHA 4YR3A 3M9MB 3SDEA 2VPZB 2BZ2A 4GC7A 4R5PA 3OFGA 3PX4A 2UU9F 1R8HA 2R7OA 2Z0GA 4I7FA 3S1TA 1B0VA 2ZD1B 5T7LA 2DGVA 4R25A 1MMDA 2ZJRQ 2C22A 1HYSB 1U7LA 3IGVA 1RT1A 1X9SA 2YKNB 3LP1A 1TL1B 4I2QB 4DS5A 3M6WA 3MTKA 2NUUG 2UUWA 3CJ0A 3IO1A 2CPIA 3BO4A 3GIKA 2CPHA 4LQ3A 4DR5F 2ZFHA 3MM6A 2DNQA 3O3LA 1H38A 1VQNS 4PQUA 3RBDA 3KMQA 4YMEA 1CG2A 1MMLA 4M5DB 2JH3A 4EWTA 2IA0A 2MKSA 4QJVA 3K5LA 5DM7Q 4ECVA 2UXDF 4Y3CA 3VAIA 2ZD1A 1SL1A 1S0VA 3HHLB 4B3MF 3EUNA 4ZCMA 1L3UA 2RRBA 1HYSA 1X0PA 4C3MA 2I8EA 4L6V3 4ZS6A 2YKNA 1HBMA 5A8RB 1TL1A 4I2QA 3QJPA 2YNIA 3DRYA 2KM8B 2A3JA 3JB9k 1KTVA 4Y2IA 5F8NA 3FMWA 3ULHA 3OLAA 1NJYA 1TL5A 1EETA 3HHKA 6FDRA 3R5CA 3W7BA 1RT5A 3OL9A 1XERA 5E3QA 4K59A 4DV7F 1U4BA 2W9BB 1QAXA 4ECTA 1WG5A 2QSWA 3QGPA 4M5DA 3MAQA 4X4NA 4ELUA 4NLTA 4CO1A 2HMIB 4C8OA 4EUVA 2ERRA 2HNYB 3W2WB 5KG2A 4CH1A 1M5PC 3HHLA 3N28A 3CCTA 2CVIA 2HNDB 4MIWA 5DQIA 2K3KA 1F0XA 1U1KA 4MH8A 5A8RA 5B0CA 2HHWA 3EX7B 2YX7A 1WWHA 2L08A 3I31A 4FF3A 1KLMB 4URSA 4TXSA 3WDOA 1HW9A 2OMLA 4IO9Q 4B17A 3VZHA 3IFEA 2GW8A 4NPOA 1X9MA 2VG7B 1R0AB 3I55S 2W9BA 3J80Y 1VFJA 2C28A 4OZ0A 1NEEA 3W2WA 2ZC3A 5KFDA 3A1YG 1RT7B 1XR5A 2HNDA 3NGKA 5KFUA 4DQRA 3C3LA 2YY3A 3CIZA 3OL7A 4I56A 4QYRA 1CC7A 3FEYB 3CDEA 4PKDB 4BWJA 1PILA 2AX0A 3HHLC 4PWDA 2BM0A 1QAIA 2WAQD 1KLMA 4IFYB 4U7CA 4FS2A 1UAWA 2CQIA 2B9WA 2KM8C 2V4QA 2YKMB 4USJC 5J2QB 4DR2F 1HR0F 4CT9A 1FHTA 3SCJE 4C8ZA 2CPFA 2ASJA 3UQSA 1URNA 1VBXA 1BLUA 2D7SA 1U6FA 3TA0A 1T3NA 1NK9A 1RYSA 5T14A 3K5OA 3PV8A 3NNAA 3CUNA 1SKSA 1S77D 2MZSA 1FF2A 4J9QA 1S6PB 2J5AA 4TLQA 2HHVA 1RTHB 4C8LA 3IRXB 1RT7A 1KC8T 5JVGQ 1N88A 1N0UA 2UXCF 5CYQB 5FIIA 2C2RA 4DLGA 2HGLA 5MAOA 4GC6A 5MLCV 5B0FA 2JSXA 3MWBA 3T6JA 4IFYA 2WOMB 2XLIA 5J2QA 4UUXA 1IKWB 5LMNF 4DJBA 4JI2F 1YRTA 5K9FA 1HQEB 2YWKA 4Q8FA 4YP3A 4F4ZA 5K14A 4C8MA 5BR8F 3MURP 2DGTA 4F2SA 4IRDA 4F25A 1S6PA 4I64A 4FBUA 1RTHA 3IRXA 3TVZA 2XS5A 2CQ3A 4WF9Q 1N34F 4PG6A 4ZDNA 4RLEA 1T95A 2LECA 5HMWA 3H59A 2EVZA 5DLFA 4E8UA 4AUKA 1H3DA 1ZYQA 2WOMA 5KFXA 1G7CB 1VQSA 1LWEB 1TL3A 2YNGB 3BGLA 1IKWA 3R27A 3HK2A 3HF5A 1SV5A 1S1XB 1Y00A 2DNNA 2IM1A 2W7AA 3HM9A 1VQ4S 4XK8C 2KFNA 4CH7A 4QWEA 3BJYA 1L5UA 3DXBA 3PRBA 3DOKA 3MD3A 1CQNA 4K4ZA 2LQJA 3AY0A 1ZM4A 5KT2A 4ED8A 2R8JA 5CZVA 4JV2A 2NS1B 2FHJD 3DCAA 3DMJB 7FDRA 2IVMA 4FNIA 3UFCX 2V8DA 2B3TB 4YHHF 4ZCLA 2P6TA 3N9UC 4OHYA 1VK8A 1NK5A 1SJFA 4NOHA 4UW2A 2FB0A 1QJHA 1YI2S 3NNHA 2RH3A 2EFOA 1TK0A 3ISND 2YNGA 3MMBB 2HS0A 2DNLA 4ZPTR 2XCAA 1S1XA 4FS1A 2BXJA 1JWWA 2HWTA 3DM2B 4NLPA 3LUYA 5L9NA 3B8HA 5THWA 3VAMA 3MD1A 5D77A 3T19A 2N82B 3CCVS 3BO3A 1M5SA 1T03B 3DYAB 2V5HG 2FVSA 2HGMA 2W9AA 3PW7A 5F3TA 3TW0A 2VODA 1JLGB 4WIIA 2XY5A 3DMJA 3F44A 1KOHA 1KR4A 2NXUA 3PR5B 1ELOA 1Q8BA 2KJVA 3QGIA 1D0EA 2BR0A 2DPIA 3D54A 2HLUA 4DMZA 5DGBA 2XY7A 2B9XA 4FF1A 2XLKA 3GMGA 4RNFA 1NHUA 1HWKA 4LVOP 4LSLB 3T1YF 2F1FA 1RA6A 3MMBA 4F26A 4X65F 3M8RA 2VQFF 3AJ1A 3NWGA 4DSKA 2AJ1A 1S1UB 3MPVA 2MJNA 2BRLA 5JUMA 4YFUA 3CC4S 4QOTA 2LXUA 4NLUA 1VJWA 2NUHA 1PSDA 4KFBB 5CH7B 3CWJA 3DYAA 2XZWA 5DETA 1RISA 1JLGA 5LSOA 3WX4A 2P5VA 4ZVEA 1TFYA 4XDDA 4QIFA 2FTRA 4O3OA 3PKYA 4KKOB 2IRYA 4DL2A 3OTBA 1WF1A 4N47A 3TVKA 4A8XA 4X62F 2M3DA 3MXHP 2CQ0A 4TY9A 2BE2B 3VAJA 4NMLA 2DHAA 1YRXA 2IM3A 3V5RA 1S1UA 1JKHA 3BF4A 1C2PA 2NSBA 1FXDA 4OI2A 1X4HA 3CCUS 1TKDA 3BN7A 1FEEA 4QCLA 3LH2S 4OZ5A 5HMZA 2AF6A 4K2XA 4KFBA 2I5JB 3CD7A 3FQLA 1FCAA 2KKHA 3FEZA 1SUQB 2W8LA 5E41A 1VS3A 1ZAWA 2J8AA 4RW6B 3IRWP 2DNKA 2J9DA 4KKOA 4OLOA 2F40A 3P49B 3M2RB 2FC8A 3OTEA 3JTNA 1N6QB 3F41A 1ULRA 2GGPA 2BE2A 2UUCF 2AJQA 2B56A 1NZAA 1TKTB 1D8ZA 2ZKTA 5C42B 2DNGA 2GMJA 3BSNA 1QUPA 2PA8D 5HO4A 3JSMA 3FEXB 2W24A 2CPJA 3BDEA 2I5JA 5J1NA 2FJVA 1Q79A 3E01B 2OTJS 2B4PA 4QU6A 4NWBA 2XNRA 2FJEB 4RW6A 1HNZF 1E6VA 1H6KX 3TANA 5IS2A 4EO6A 4HT7A 3KLEB 2VBXA 2UUBF 4NLGA 3I6PA 2MKIA 1HARA 3EZUA 1W2IA 5LXRA 1W2BR 4C3LA 2KVIA 1JB0C 4CO0A 2CYYA 2MXYA 3UR3C 2HHUA 1K1SA 3SSQA 4DF8A 2E66A 2YTCA 1TKTA 2GJ2A 2A1BA 2O3DA 3D0HE 2FJDB 2YVSA 5C42A 1KQSR 2OFHX 1HNWF 4QWDA 2MHNA 4A8WA 5H1SV 4YUDA 2MY7A 2P6SA 4KO0B 3CB4A 3M6VA 3TNVA 4F67A 2W9CB 3RR8A 3UI3A 1O0PA 2HS3A 3B4MA 4JI6F 3FSXA 1TQLA 3E01A 1UVMA 1XTZA 2Z4PA 2OSRA 2F4VF 3VAFA 2YX4A 4TYBA 4J5OA 3US5A 1DTTA 3BR9A 4UQTA 4DPOA 2YH0A 1DHMA 1S6UA 3M2UB 1X9WA 1IBLF 3IXQA 4EYIB 1VQKS 2FPHX 5I42B 1I94F 2DCUB 4ZVGA 2DNZA 4KIAA 3GILA 5CYJA 1Q16B 5C24A 4OHWA 2ZH4A 1FNMA 3GFXA 5KFMA 4DR1F 3KG4A 3TRGA 5HMXA 1KS2A 3GIJA 4KO0A 2AGPA 2W9CA 2ZNYA 4DS4A 5EX3A 1DBDA 3KLGA 2IM2A 2RRAA 3HDSA 2UUAF 3Q23A 2DIVA 1RYRA 4OHZA 2VKZG 3UDLA 4G6VB 4WK1A 4FYDA 1SJ1A 3KK3B 2VQEF 1U24A 1S7HA 5KFRA 1Z1ZA 3PACA 4MK8A 4ZP6A 1VQPS 3FJ2A 1NO8A 1N33F 3PKMA 4N8OA 2QIFA 4TLRA 3MI7X 2QZ8A 1E6YB 3FSYA 3BEGB 2IC3B