2NYHA

Crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
GMTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPMWSYQLAFTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative Dioxygenase (YP_555069.1) from Burkholderia Xenovorans LB400 at 1.70 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords Putative dioxygenase
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08883 DOPA_dioxygen Dopa 4,5-dioxygenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits DOPA-like domains 2nyhA00
2P8IA 2NYHA 2PEBA
chains in the Genus database with same CATH superfamily
5I3UB 1GX5A 1WG1A 2QX0A 2B3TB 4P10A 1VLYA 1Q86T 4YDDB 4NA3A 4YUDA 4LJMA 2CJQA 2OPPB 1X9SA 4CDIA 4DR5F 1JLAB 3POTA 1ELOA 3DC2A 1BC6A 2E66A 1AROP 2GGPB 5KFYA 4F4ZA 3BR9A 4A47A 3A4TA 1HD1A 2RDDA 2P8IA 3M8SA 3LGNA 1R8PA 1LWXA 4Y2MA 4TLQA 3RU0A 2GMHA 2OO4A 3GE9A 1SPBP 3JYTA 5T14A 3EPGA 1H98A 1QUPA 3LWLA 1HNVB 2W9BA 2EXUA 2J6UA 1XIQA 2C2KB 3DRPA 3GIMA 3VHQA 2G0JA 3G82B 4N7TA 3S7RA 4YR0A 4ZPAA 4DF8A 2XTJP 2E1RA 2BJ1A 3FBEA 3Q8SB 2ZH7A 1VOMA 2OSRA 2AEFA 2YKMB 2Z8QA 3D68A 4Y2IA 3SFGA 1IBMJ 2CNNB 2C42A 4NE9C 3D6TB 4I6AA 3PO4A 4KO0A 1DFDA 4OX6A 3BKTA 3QT7A 1RP5A 5CQGA 5I3PA 5EX3A 5JJBA 3D1QA 4EWTA 2FZKB 5FLXU 4ECQA 2WB1D 2KXFA 2DNLA 5DGAA 1MSWD 1NM2A 4KHMA 5FD1A 3CJRA 1C4AA 4U96A 4J9VA 4M5GA 4NCBA 1DRZA 4KHPF 2QSWA 5GMDA 2ATLA 4FYDA 1M5KC 4CO0A 3OJUA 3RRHA 1H38A 1FWKA 1ZPWX 3Q8UA 1AW0A 2KT2A 1F3FA 1FK9B 2F9DA 4M5LA 4RW9A 2ZC4A 1TQLA 3D67A 1JB0C 3OXGA 1U7LA 3UO0A 3QWUA 1S72S 3CGIA 2WSFC 3QNWB 4DLGA 2AMCB 5B0DA 3FBBA 2HIYA 2J7UA 2I5JB 2HIQA 2Y3YA 4A8MP 1YGYA 3P5TL 1M1HA 3I0RB 4BWJA 1QLNA 2FLOA 2ZBPA 3JQJA 1WC4A 4OYIA 3H0PA 1VQ5S 1RWXB 2YWWA 2QLWA 1VRUB 2QLBB 3W62A 1G2EA 3C6UB 2JC0A 3V6DA 2HK3A 2ZBRA 5DGBA 3OTOJ 2GVZA 3Q8QB 3V81B 5EWEA 3WBZA 2CQ0A 4QIFA 2Y1LB 2DY1A 3T5JA 2JEFA 3BSCA 5FLXY 3D66A 3CC4S 5A8WB 1IKVB 1PSDA 2D7SA 4NWBA 2CAJA 4QW9A 4NYOA 4NCGA 1S76D 4C8YA 2J8SA 2VFTA 5J2QA 1W2IA 1O6XA 1R0BG 2GVDB 4R0EA 2W2NP 1U8WA 1VIXA 2N4CA 2FJEB 5ETNA 3W8GA 1N6QB 1P6TA 2ILZA 4OYOA 5IT0A 4PWDB 2DNGA 1TAQA 1KQGB 3PR5B 3L9ZA 2CFXA 4TQSA 3GIJA 2DR8A 2BANA 3BQ2A 1V9OA 1YJWS 4LF6J 4YOEA 1T03B 4HVZA 1GTHA 2B43A 2RHQB 1R6VA 2OFGX 3M8WA 5KFVA 3VZHA 1RXOB 4DI6A 1HNZJ 1B0PA 2KHDA 1U2RA 5K14B 3TX0A 2BRKA 3BKUA 3OUYB 4ICLB 1QAJA 2KT5A 1NH7A 1RSCA 4HI1A 2VONA 3CDEA 1FRHA 4IOBA 2BRLA 5AXNA 2XI2A 1SKUB 4JI5J 4DV0J 2XLJA 4RU9A 1DZ5A 4LRFA 1IUJA 1DARA 2MKJA 3R1HA 2UUBF 1ICEB 4KO0B 2C2OB 2RH3A 3THVA 3NNHA 1QM9A 2CXEA 2DHGA 2VG6A 3DLGB 3ENQA 4B08A 1WHYA 5IXUA 5KFEA 3ICLA 4UOCA 1HHQA 5MLCV 4YR2A 3RUBL 3VR1A 4KH0B 1VBKA 4J9RA 1ROFA 4ZJQA 5KT7A 5A6WA 3HFVA 2E7XA 1K8AT 3CB4A 1IBCB 1OYDA 3SSSA 4DPYA 4JYAJ 1KVJA 4G3IA 1I94J 1NK8A 1BHNA 3QZ8A 2UVRA 2P9EA 2HHHJ 2N3OA 1NKCA 3VAFA 2KJVA 1ZYQA 3K5LA 1P1LA 1SQGA 2OMOA 4PYDA 2HQDA 4QR0A 3PW7A 2UVVA 1K0TA 4HACB 4HL9A 2O01C 1U6ZA 2DJWA 4CWBA 3TEGA 5J1PA 4TU9A 3KLFB 1NU4A 3R2DJ 1ZOTA 3BQ0A 4B9SA 4LQ9A 4ETZA 1ZM9A 5K8OA 2CQCA 1RYRA 2MEWA 2J0XA 4DV6F 1WD6A 2YPZA 5ETRA 4WYLA 3M4XA 3M2UA 3GG0A 4X64J 2AU0A 1RACB 2LP4A 2KM8C 2HFZA 5KFKA 4JI0J 2UVUA 2CJAA 1JLFA 3FSYA 2ZZTA 4JP8A 4O4GB 4CCHA 4EYHB 2RF2A 3Q2SC 1N5YB 4LFCF 1FEEA 5FJ4A 5CYMA 4OHVA 4L3NA 3ILOA 2DR6A 1CJKA 1WC1A 1UA1A 4CLFA 4ER8A 2DRAA 1O51A 2YNIB 1XNRF 5JVHQ 4KGKA 4J9UE 3E3XA 4WE1B 1X4FA 5D78A 4ZJLA 4C0BA 4L3KA 4R8UA 2DT9A 2XB2D 3K8WA 3ISZA 1Q8KA 5C42A 1SXLA 4ELVA 2VPXB 3MDFA 3PFOA 1Q53A 4LRDA 1RTIA 2B5JB 3CMQA 3ENWA 2HAIA 4URSA 4E98A 1YTYA 1UA0A 2RNEA 5ETQA 1VQ7S 1SH0A 4WIQA 4OFZA 1VK8A 1NHVA 1LWEB 1WHXA 3HKZD 4RUHA 1L5UA 3OVBA 1RAAB 4WTYA 2BZ2A 4YB7A 3F41A 3ZZRA 1M5HA 1YLXA 3CCMS 3DOKB 1VQOS 5HJYA 3V5RA 4WU2A 5K8MA 1BE4A 1RU2A 1SKSA 4TVAB 3DLKA 1IN0A 1SC4B 2B7BB 3OL6A 5L1IA 4PWDA 1UKUA 3PYFA 3P8BB 2MKCA 4YB1P 4JOUA 4DSFA 3UE2A 3SV4A 1RAIB 4UTGA 3M1VA 1NBEB 2EFNA 3OPKA 1ITPA 3PX4A 4CNZA 5L1JA 4K0KF 2BE2B 2QLXA 3I31A 1M5VC 4OMFG 1RWKB 3UNYA 4OI0A 4DZDA 4RU2A 1XWLA 4JI6J 4DCPB 3DFEA 1F5AA 2AZ1A 2VA3A 4WXOA 3BQ1A 2HFNA 5KFTA 3NL0A 5A8RA 2CA9A 2V69A 3OD2A 4CM0A 4ZHRB 2KI2A 4ANCA 2H3EB 4TYBA 1RWWB 2ZWOA 1SQFA 5D77A 5F0WA 2V6AA 3U1NA 4X4SA 2R8JA 4F4WA 3FDSA 3ENVA 2BVZA 1TKXB 4FPIA 3DGPA 2HVZA 1U0HB 2IVYA 1JKHB 3QBCA 1UWBA 2W2OP 2OJ3A 5I42A 5A8KB 4RBVA 1RT2A 5G0RA 5LXYA 4X65J 1K9MT 5I3QA 4ELUA 2B8PA 3DLKB 2JFDA 3AD7C 4IKAA 3ZC4A 4C6AA 2W7PA 4J9OA 4F25A 2UXBF 4MKYA 1SJQA 1TV6B 2FHMA 3HJVA 3CNQP 5K5MA 4XK8C 4DU8A 1N34F 3HMJG 1V3ZA 4UQTA 4URQU 3SFUA 4A8YA 1MN9A 3AFGA 2J0WA 1N4LA 1NJIT 2AEMA 2R7WA 2M5YA 3KFWX 1JLGA 2M0GB 2DCUB 4KV8A 3WX8A 1WEYA 2QLJB 2K2PA 4FF4A 1CJUA 3C14A 2ZVSA 3AD9C 3MTJA 2VG5A 2WBMA 4NLYA 3DLJA 5D0RA 1S1XB 1ZAVA 2AKWB 2XZTB 3TEHB 3D54A 1AFIA 1GTEA 5HQLA 3FEXB 4WF9Q 3CJ3A 3GJSB 3H2VE 2OD6A 5CYQB 1TFYA 2ZE2A 2YNGB 2Q3PA 2ZH6A 3CC2S 4S0MA 4P72A 3M9NB 2HRTA 3E01A 1JXLA 3MF5A 5LMNJ 5E2QA 1Q16B 2N3LA 3O2IA 3VGTA 1GXLA 3GMGA 3BYPA 4FS1A 3SCKE 3MMBA 4JB8B 2WTFA 4ZPDA 4NXNF 4F4KA 1FKAF 2VD3A 4ECRA 4J37A 2MQ8A 3UR3C 1RT3A 2ABYA 4BCAA 3G8TA 4NLGA 3KJQB 2E9TA 4LSLA 3W60A 2U1AA 4ZN1A 2MQPA 2IA6A 2BJDA 2XI3A 3BYRA 3US5A 1XNQJ 4AT1B 4DV4J 1JLAA 1OMSA 4FN5A 1DY3A 1HI8A 4PXEA 3ZZ0A 4DFMA 4OYZA 1SL2A 2PFDA 1JLBA 3NGUA 2R8GA 2Z56B 2YKQA 3MM9A 3NGRA 2J8AA 2H54B 3BGRA 4LRAA 1VBYA 3K5OA 2VQFF 2FZGB 1NZ8A 2VG7B 1DTTB 2EFPA 2B9WA 3GV7B 4JI3F 1SC1B 1U45A 1KS2A 1SIZA 3RW7A 2VOPA 1X7VA 1ZZFA 2ZOFA 2EFQA 3MEKA 3Q89A 1WC6A 2ATCB 4NRTA 5C24B 2G2YA 2RD5C 2YWHA 2XQCA 1Q8BA 2C3UA 2AJ4A 5J1EA 1TKTA 2F40A 4FXVA 4OL8A 1B0TA 1OQ3A 3W8PA 3WX4A 4EO8A 1PIEA 3H98A 4ZCMA 3T41A 3POTB 1OO0B 1SIWB 2MQNA 5B08A 1HR0J 2FVSA 4PUOA 4DV2F 4RWWA 1A9NB 4EK2A 3W9IA 4OJ3A 4ZOSA 4N76A 5KT6A 8ATCB 3VGVA 1NNDA 2DNRA 5A8KA 2PIIA 1B7FA 3I0RA 4I68A 1Q7LB 2GX8A 1HARA 3OTCA 2UP1A 4MK9A 5LXRA 2DNPA 2GAGC 2DHSA 2WK4A 2WVBA 4UT4A 2APOA 3UCUP 3OVSA 2GO8A 2ZH2A 3ZTQA 2Z0GA 4LR8A 5K8PA 1YHQS 4DR2J 4B3SF 4F0MA 4ES1A 2O5DA 4IYQA 2HHXA 4HH0A 1QJHA 5B7WA 3KDOA 1Y5IB 5CYMB 1LW0A 3T5KA 2E29A 4LVOP 2KFYA 3TJ9A 3KDNA 3IRXA 4ZVOB 2XCAA 2ZEJA 1RTDA 4UOHA 2Q6BA 2RILA 3OT9A 3S8SA 1HNWF 1X5SA 2V8HA 5ADZA 5F3TA 1FWLA 3Q8RB 1VLOA 4RR5A 3RJMB 1U1MA 4EO6A 1W25A 3C16A 5C5JA 1MMNA 3KK2B 4F50A 4LF9F 2A1BA 2WRMA 4I2QB 3PJWA 3TVKA 3MM8B 1FK9A 2M2BA 2W2PP 1B99A 3ZNJ1 3W65A 1SVDA 5BXIA 3SZ2A 1KLNA 4IRDA 4NYPA 1TL3A 2HBRB 3FK4A 3MR5A 3IP0A 3GR0A 4N8OA 1RT3B 4QR1A 3L09A 5DS7A 2H4YB 5D6GA 4ZP8A 2E5JA 2DGUA 2BKNA 4N77A 1VQLS 1X4BA 4DL4A 3EGVA 2IYIA 4L73A 1LKZA 4PG4A 2J0QD 2HHHF 4P74A 3HHKA 3DOMB 1BQMA 2DGOA 3I9V9 3RGIA 5AJ3J 3OR2B 4ZVPB 3MM9B 1Q82T 4WFNQ 4QWDA 2HBZB 1UVLA 1FO1A 2F4VJ 3PDNA 3FJ2A 2BDPA 2HMIB 2CPYA 2LU1A 1K73T 2MZ1A 2VJUA 1KLMA 2E5LF 1C0UB 2OEKA 3DRPB 2BXJA 2NREA 4ZIWA 2YNHA 5LMUF 4URGA 2UUBJ 4IOAQ 2AGOA 3DRXA 1FWPA 2BKOA 2VBYA 3T3FA 1T9YA 1YG0A 2R7TA 3BBBA 2D9OA 3IGVA 4RW8A 2ZH5A 3VAMA 2NUUG 1S1VB 3F0NA 4U7UK 3U02A 1TR0A 1ZA2B 3KLGB 1RAFB 2GW8A 1KC8T 1PJ5A 1RCXB 2BJ8A 4DU7A 4DV7J 4X66J 2KJWA 3D1HA 7AT1B 3I5BA 3MAQA 3QAUA 3M6XA 2V4JA 3NGKA 4Q8FA 4B3OB 4I56A 5GADI 4HI2A 1ZZNA 2MY8A 2RUGA 2N7YA 5FDLA 4OLPA 1VQPS 2UUWA 1P1TA 2EW9A 2OP5A 3W9HA 2ZOMA 5CZVA 1WKLA 3B6BA 2KYXA 1QAYA 2VPZB 3MAAB 4KYZA 2FJBB 4Z37A 2RSQA 2FLPA 1OPZA 2O1PA 1QVGR 1WWHA 3KK1B 4OI3A 1EETB 1LEOA 1CEZA 4RBUA 1VQYA 3CJTA 1SJ1A 2W25A 5LJ3Y 3TW0A 4NXMF 3CCRS 4OZNA 1X8DA 4ZLNA 4B9LA 1FNOA 1YRXA 1RK8A 2AJ2A 4G65A 1GX6A 2VJVA 3R5DA 4FKYA 4GKJJ 1ZAWA 2IDEA 3HP6A 1R8AA 2E7VA 4DR1J 1DTQA 2RDIA 3HVTA 2BR0A 4F0HA 5E0OA 4HT7A 1NPKA 3BZQA 5DG9A 2OEMA 4FYVB 2W8LA 2DH8A 1N5VA 3MMAB 4DR7F 4PQAA 1C0TB 3LA0A 4I6WA 4I2PA 1FJEB 4EU0A 1WF1A 2AEJA 1VR6A 4D3GA 4YR3A 3R7SB 4DV0F 1NJYA 1NJWA 2KYZA 2HURA 4RX6A 3AOCA 3HSGA 1RAHB 1WSRA 2NSBA 3DLEA 3IN5A 4QQBA 2AX1A 4USMA 3JXOA 2CQDA 1TTHB 1P27B 2CDRB 2FJDB 2VKZG 1P8GA 4RW7A 1FVSA 2V2QA 4RW4A 4DPUA 4O4GA 3PX0A 1RWUA 1JXEA 1S79A 3THPA 1UZHA 2HQIA 2XEXA 4WBFA 4CT8A 6AT1B 3K17A 2B5JA 4HTJA 4NZ0A 2D3UA 3RB3A 3ET6B 2VG7A 2Z2ZA 3R2CJ 3GFYA 1XMOJ 4IFVA 1A7GE 1WHVA 1CBKA 1NUEA 2MJUA 2VFVA 4RNOA 1RKIA 2I8EA 2C22A 3I32A 4X66F 3BBFA 4DR5J 1NK7A 1CJVB 3MR6A 1DBDA 2IAJB 3QRQA 1BQNB 1S9GB 2GQQA 3DYAA 4M5JA 4DUZF 2BOPA 1LQ9A 5H1SV 3CVKA 3CJSA 3DRRB 5HAOA 1GH8A 4KC5A 4JI2F 2JLEA 4NA1A 4O3RA 4A8XA 5B0BA 3M1VB 1U8SA 4HEA9 4P7TA 4HKQA 2CZVC 1Y11A 2YQ0A 1EHWA 3J7A1 4KGXB 3V4IA 3R7NB 4NLOA 4LBHA 1PO6A 2OLWA 2XMUA 2XLKA 2B6AA 2B9YA 3N5FA 2F9JA 3C6UA 3V6DB 2PA8D 1TL5A 4C0OC 4Q2LA 3KMSA 3VAJA 5ETTA 2R7VA 1FKOA 3EGZA 1EIYB 2CPIA 5A2QU 5BR8F 4B9TA 3NY0A 3DOLB 5CD4H 4B3RF 1GAOA 3W64A 2VOOA 4CO1A 2GNKA 1UFKA 2AJ1A 3H20A 2AHOB 2V50A 3J80Y 3W3SA 2ZH3A 4MK7A 4LSZB 3G96A 4NRUA 3ENAA 4CZCA 1PC5A 5CHCB 4ZPWR 2D41A 1U0SA 1GFWB 3JSBA 1NJZA 1E6VB 4H4KC 3TA2A 5KG4A 5AXKA 1URNA 1HQUB 3QGGA 1KONA 1QUVA 5G0RB 4C11B 5CAAA 2H5IB 1LFWA 3B82A 2H48B 3PYDA 3QT6A 5IM0A 1FTRA 2ALYB 3CCZA 5KFAA 2WSEC 3KNAA 3V6JA 1N56A 3MMCB 1REGX 3BGLA 2E1PA 4TYAA 4NLPA 1REVA 3TUJC 2V2KA 3LAMA 3HHLB 1VQKS 2C3PA 2JC1A 1U1NA 3BB5A 4DN9A 1WOSA 4RNFA 2HNDB 3NGDA 3C19A 2DH7A 2FLLA 2DNKA 1NHUA 4CO5A 4CLUA 3PW2A 1FJ7A 5KFQA 1DQ8A 2B4OA 2PC6A 3GONA 1SUQB 4NLVA 3Q23A 4OQJA 4DSIA 5E3RA 4Q0BA 2G1HA 5KFZA 1TUWA 4J91A 1VYAA 5GAGU 1I5OB 3DLHA 3FGVA 3GFZA 1TVRA 5IS2A 4OX9F 2DNQA 4ZIVA 4NLWA 4M5HA 5LMUJ 2YH1A 3B78A 2CPFA 4ZDNA 4ICLA 2HAFA 1RZMA 5ITHA 2XNQA 3BREA 1I3OB 1TKZB 2BA9A 5HMXA 5KFJA 3NLCA 2FD2A 5EHHA 1VI7A 3V81A 1RT6A 3QIDA 2M8HA 4J5OA 2YNFA 2QMWA 4ZVFA 4CLKA 3FEYB 4RWXA 5GAGI 2W7OA 1VQ4S 4WCEQ 3AD8C 1M0SA 4WIIA 1HWKA 2XMKA 3PTWA 3PYEA 4UUXA 4CH0S 4JI8J 2GIQA 3GCWP 2XYPB 2PE8A 2DRDA 2CRLA 4CO2A 2JWNA 3DU5A 3OL9A 2WBRA 3CDAA 5DDRC 2FVPA 4NXMJ 3X3UA 4DXLA 3BO2A 2XMAA 3TARA 3M7VA 2Z30B 4ETXA 1N0VC 3PY8A 2IIHA 4KAIA 2R2UA 2GJIA 1QSSA 3RW6A 4H4MB 1HMVA 2AQ4A 2YKNB 4B3SJ 1N36F 5DLFA 1HFEL 1WF0A 2CPJA 4OIXA 5T41A 4K4SA 1SH2A 2HBYB 2X1GA 2HLUA 2HGLA 2QIFA 3V4IB 1H2TZ 1N88A 4C9DA 1RT7B 2CPDA 3ISND 4LSNB 2GJFA 3GV5B 3MMAA 2Z57B 1U1KA 3JQKA 3KWMA 1H2UX 4RKUC 1TAUA 2MZTA 2A0FB 2BV3A 4PR6A 3HULA 4R5PA 4H4OA 1S0OA 2HNYB 5LSLA 4USWA 1HPZA 4H4MA 3EXYA 2DPJA 1JJHA 5CD4A 3M8RA 5J2PA 1WOPA 2B56A 4WKRA 4L6V3 1HNWJ 2KB2A 2EC2A 1JLEB 2PEBA 4OHXA 3UN5A 1SKWA 5J1EB 4B9NA 2WVFA 3LP1A 2AIRB 1GEHA 5DJBA 1JNRB 1HBNB 4TXSA 3CCSS 2MZJA 3M8PA 3K57A 2QN6B 2FHKA 5I4MA 3NP5A 4OZ1A 2C2NA 2ZJQQ 4A8QA 2E5IA 1F9FA 2L9NA 1UL3A 5KG2A 4QIEA 2FJWA 1GMWD 2LA6A 2V4JB 1RWPB 4QIWD 3PW5A 4DR6F 3JS9A 4O3PA 1FHTA 2YWFA 2UUAF 2C3MA 3ZZPA 1Y7PA 1R7IA 3KLHB 1S6QB 3GR1A 5KFFA 4LSLB 1FDAA 4GVBA 1YJRA 1Q78A 2VPYB 1JQGA 2NPIA 3D28A 4RUBA 4ZVRB 5IV4A 4ECUA 4DS4A 1U6FA 3GLJA 3IC1A 1YZ7A 4I6YA 3T1HF 3RRGA 2PMWA 1TKXA 5EN1A 4WP3A 4DX8H 5DDQC 1IKWA 3N28A 1X5OA 2DIVA 3IM9A 4LBPA 2VC1A 4O3SA 1RAOA 4LFBJ 2ZKTA 5J2MB 1WG4A 1U1OA 2YKMA 4Q7AA 2NR0A 2ZH9A 1UETA 1IBKJ 1S6PA 2F8MA 3HSZA 5L46A 2KH9A 2GMJA 1F6TA 2UUAJ 4U95A 5KFGA 1CPZA 1M5OC 5L1LA 4PZVA 4NMXA 4HYKA 2AGQA 5KFNA 3N01A 4DX5A 2CWKA 3EE3A 2NXNA 3ZXWA 2BW2A 2QFJA 1KHWA 5K14A 4DV5F 2K3IA 3TI0A 1TK5A 1VC5A 1C1CB 3P6YC 1NK4A 2CJXB 1F9EB 2RKIA 4P73A 5DRKA 5E5NA 2VQEJ 1FDBA 3MEDB 3TVZA 2QA4S 1S4EA 2HFUA 3C8YA 2E1AA 3OXLA 4PXBA 5KFSA 2VICA 2AJQA 5CYQA 5C25B 1LOUA 5F9LA 2QE5A 3NEKA 4WJBA 4DL5A 3MR3A 4IRKA 1RADB 2OTJS 3L3CA 1U02A 3PM9A 3KG4A 4AQYJ 4ZP9A 5E33A 3GJRB 5SZTA 3BJYA 4DEZA 3I0SB 4ILRA 2GCFA 1U47A 3T5HA 3NGSA 3QIPA 1CULA 1VHFA 3EVWA 4IFYB 1IKVA 1L3SA 4JV2A 3MM5B 4USHA 5LOQA 3C46A 1JLEA 1FT8A 5H9FJ 1VMBA 2FC9A 1BQNA 3C15A 4F4AA 5CABA 4WZMA 3Q22A 1HQEA 1TL7B 3PXGa 8AT1B 1YKWA 1CS4A 4Y00A 2AGPA 1UW4A 2DBBA 1JJ2R 4LBIA 3L4BC 4NL5A 3U7JA 5MAOA 3UD3P 3C16B 1KQFB 3A12A 3DU6A 4MFBA 2G13A 2YQ1A 3QMQA 4XAKA 3U1LA 4X4OA 3BO4A 4EZ6A 3KK1A 1NMEB 1G3OA 3GYGA 4W92B 1SKRA 1NAQA 2VC0A 3AA9A 4PWUA 1HYSB 5DLGA 2DD8S 1VQMS 3OFFA 2E5HA 2YWEA 2ZBCA 3WZ0A 4AUKA 4F3QA 3CCTA 1WTFA 2LXUA 3NS7B 2CPZA 5HMWA 3E8OA 4WE1A 5F0UA 2OPQA 5A8RB 1GXTA 1B4SA 2R7XA 4X4UA 3I4PA 4ZLPA 1RT1B 4OHWA 1XEZA 5ETSA 4K0KJ 3Q24A 1S1UB 2LXIA 5LMNF 2OIHA 3H5SA 3KUGA 3AJ1A 4PXDA 2IDLA 1NSAA 1UP1A 4EEYA 1M1KT 3QRRA 1IKXA 2B0GA 3CCLS 2C2RA 3NG8A 4M5MA 3TOQA 4AYBD 4BHQA 4JV0A 1U4BA 1MWQA 4FZVA 5GADU 5JXSA 1WKKA 4IQXA 4N41A 2UXDF 4FXDA 3CJ0A 4ELTA 4KHPJ 4IOCQ 1YJTA 4A8WA 3CJ4A 4Y2KA 5IZHA 3MPYA 5F8IA 3ZZUA 3KLHA 1FJGJ 2V8VA 1FERA 5KT5A 2N7CA 1HD0A 4RW7B 3K5MA 1HHTP 2MJNA 4MKBA 4DV3F 1G6BA 3TA1A 1N36J 4PCQA 1NH8A 1JNZB 1OSDA 1PCAA 2DO0A 1S1VA 1H3DA 3LP0A 3KMQA 4JI0F 3TVYA 2E9RX 2UXBJ 2MSTA 1NDPA 3CEDA 3VQSA 4IH5A 2CPHA 2H4WB 2HG4A 5HI7A 4MIBA 2ASYA 2C2ZB 4DMZA 5BR8J 2JNJA 1RYSA 3NAHA 4OZ0A 2PN6A 2VIHA 1N0UA 3AJDA 2WVDA 1IR1A 2GA7A 4C0HA 4CTAA 4KIAA 3RB6A 2ZZNA 5D4OA 1E6VA 3HSDA 4PYAA 3CCJS 2IM3A 4M63A 3TA0A 1RU1A 1YJUA 2GQCA 5B0AA 1HW9A 4JUZA 2G0IA 2Y0SD 2XYGB 3GFXA 3L95X 4IDKA 3WIVA 4ATNA 2E9ZA 4NI2B 4ILMA 3PV8A 3AOAA 4OJ1A 2ZHOA 5D4NA 4DDFA 3DOLA 1JWWA 2QV6A 3NNCA 2KN4A 3LPYA 1R27B 5L1KA 3MM6A 3UVJA 1S9EB 3G8QA 3LP1B 2A6MA 5HROA 4JV5F 4DQPA 4OV6A 3DRRA 5E3QA 2R7SA 3JSYA 2HHSA 1S12A 1O5JA 1T3OA 1QE1A 1B0VA 2ERRA 2R7RA 2F7VA 4PRFA 4MIAA 3J7YU 3OLBA 2JLFA 2VF3A 3KLIB 2ALZA 1XTZA 2MKYA 1U48A 1Q5VA 5IWAF 1MROA 1U6BA 2WSCC 4YP3A 1ZBTA 4MKAA 2BQUA 3AAWB 2AW0A 3OJSA 3N6MA 1WORA 4C2MA 5C2GA 3Q8PB 2HHUA 1NB7A 2XGPA 4KJIA 2C1EB 2NYIA 2KXNB 3IBCB 3CO9A 1LW0B 1R3NA 3I87A 2BYCA 3BGOP 3E01B 2YKNA 4NLQA 3QT5A 3WIUA 3BKFA 4EBEA 2XY5A 4NLXA 5D4PA 3RBDA 3VV2B 5D0EA 4L74A 2PD1A 4DL3A 2OPPA 4NMLA 3ZFVA 1YJNS 4IO9Q 2IBKA 2X3DA 2IYGA 2CUYA 3MCOA 5LM7E 1D0EA 1R0CB 3QQCD 4C8MA 1FRXA 3LALA 3QAEA 3SIPB 2EC0A 1PC4A 3MECB 1ZM2A 1F60B 3VCDA 1MLAA 5F8MA 3I82A 3M30A 4ZA1A 3BR8A 4DL7A 1J5EF 3M2RB 3J81U 3RBEA 3TRGA 1AB8A 4MMOA 3LWMA 4IG0B 3TUIC 1NEEA 3KJVA 3V6KA 1NPRA 1LXJA 2CQ3A 5HMYA 2YKAA 1X5PA 3H59A 2DNNA 4UF4A 5E7OB 2PMZD 2LYVA 2RKIB 1ACMB 3MTKA 2C3OA 1IR0A 1RWNB 4RL1A 3BDPA 4GKJF 1F2GA 1G4CA 1TKZA 1OS5A 2CZ4A 2WVEA 2KVIA 3HHLD 4QU7A 2JH3A 2V94A 2BJ9A 3IBFB 1NDKA 2BE9B 2VU5A 3W2VB 2ROPA 5KT2A 3GIKA 3MPUB 2EFVA 2W9CB 1RLCL 3EUNA 3FC9A 9ATCB 4RUAA 1RWOB 1VBXA 2ROGA 3CTRA 2EG1A 2E44A 1M1GA 3OFEA 2RT3A 3HT0A 2J9DA 3ZNUA 4B3MF 4GKKJ 2BM1A 1BXNA 2BOAA 2OSQA 3F56A 2YNIA 3UCZP 1LK5A 2DGXA 3GQCA 3NOGA 4NX9A 3CJKA 3BM7A 2GHWA 3BSOA 3D6MB 5HVGA 2IC3B 2OEJA 4WYWA 1I51B 3DDKA 4UW2A 4F2SA 4EI2A 2RE1A 2I6WA 2DYAA 3OFHA 4CH1A 3QPIA 3ZTRA 2GO9A 3CULA 1VIOA 4J90A 3VALA 1PILA 2VBXA 1Z4UA 2LQ9A 2CWXA 4IDKB 4ITSA 4HLBA 3T19A 3FBFA 2E1CA 7FD1A 3TYTA 3JSMA 1H74A 4B9UA 2LXFA 2DXEA 3QLHB 4HHUA 4QR2A 1KOHA 4LVNP 1XMBA 4KFBB 2VFRA 4B3MJ 5RUBA 3EYZA 3ETMA 2J5AA 3FCWA 3HZEA 1WSVA 3OSNA 3BEGB 3MCNA 4AXJA 2BQ3A 1VQ8S 1EZZB 4MYTA 1AUSL 4M8LA 2FIUA 4TN2A 5K9FA 1D9DA 4RW8B 1T9TA 3VQTA 2FVQA 2WOMA 3V2UC 5DQHA 1X4DA 2NSCA 3D6HB 3ONQA 4WXWA 3MEGA 3TAMA 4AL7A 4DR4J 3M8QA 2BMBA 5F3ZA 5HLFA 4WK1A 2NZ4A 5C7PA 1XK8A 4MIWA 2L41A 1FRLA 3EJMA 4ANDA 1FJGF 1U49A 2QT7A 2LDIA 5C25A 1GMUA 3HHDA 5FIIA 5D15A 5HSPA 4YQWA 1PJ7A 5H9EJ 1RHQB 4LF8F 4OZ3A 1D1UA 1BWEA 4KH1B 3MM7A 2LLZA 4OX9J 4QU6A 1RISA 2IJRA 2LQJA 1ZTTA 3R3TA 1CSJA 4BS2A 5F8GA 3AB4B 3CMAS 4C3KA 3TZXA 4I1TA 2W9BB 4KV8B 4A8FA 1NZAA 1CJTB 4DX6A 3KLEB 1TU0B 1R89A 4YHHF 1KKHA 1TMMA 1OY9A 5EDWA 2N82B 2MKIA 4CLPA 2I2YA 2C2EA 2WONA 5D3GA 1VISA 3K8VA 4GVBB 5HATA 2BBEA 3MD1A 3PR4A 3IXQA 4FXWA 4NLTA 2MQLA 1K1QA 4QJVA 2ZH1A 1TL7A 2R8KA 2PFFB 2J9CA 3UN3A 1F2HA 3PHTA 1YJ9S 4Q5VA 2K7KA 2YNGA 1YBUA 2QL5B 2ZDOA 2QA4G 2ZKUA 3LGHA 4ZMMA 1TKDA 1H7WA 2CADA 2F8HA 3VGSA 1FEHA 1ZAXA 1WJ9A 4DR1F 5JMNA 1RTZA 1S10A 1V6HA 1SV5B 5CCLA 1X4GA 2XLIA 5GMKa 4AQYF 2OTLS 3BBCA 5DG7A 1OPIA 1S0VA 4J9QA 2UVWA 3QSYB 3IRXB 3TZWA 4OYPA 2YXLA 5J1NA 5HK4A 4K2XA 1KVKA 2ILYA 1RT1A 4KGVB 1FNXH 1RHRB 2CQPA 3M32B 2J76E 1UJ6A 4HTIA 1RBAA 2V68A 4XDCA 3W2WB 1IWGA 1VRUA 4KR0B 1U24A 2Y0BB 1FD2A 3HLUA 3R6GB 4E8UA 4ED4A 3KK2A 2NQPA 3T1AA 4B9VA 2RU9A 5KAKA 2H5JB 3HK2A 5E3PA 5AJ3F 1VQ9S 1HWLA 2Z2YB 3M2UB 3CT9A 4FPRA 2R8IA 2RB7A 3OUYA 3HVAA 3HVWA 4O3NA 3V6HA 4Q45A 1QD1A 4P9SA 2UU9F 1QAIA 4P6QA 1M5SA 2GC8A 2DR5A 2K06A 2HPUA 3H40A 4ENOA 2OUGA 2YNFB 1UPMB 3C6TA 1CVJA 4OZLA 2FYXA 1S1WA 4DPTA 3DGVA 3NMAA 4W90B 1O0PA 4CI0B 4EMDA 2R9LA 2UUCJ 4NEYA 1UCNA 2H65B 1DLOA 5KFXA 3ULHA 1CLFA 3KJFB 1FDNA 2L9DA 2P6SA 4GO5X 4X84A 4EUVA 5DQIA 1TVRB 2V9KA 4LRBA 4QWAA 4DUZJ 4KRWA 1S6QA 3RB0A 4G1IA 4KY3A 1AFJA 4FVMA 1NSPA 3H25A 2BX6A 4O0IA 5B0GA 2J6TA 5HROB 2DVIA 2AWZA 4ES3A 3WC0A 2P9GA 4I4BA 3IM8A 1VQSA 4J9LA 3OR2A 3IFEA 4G1PA 3T1HJ 4USVA 3MCMA 3MUVP 4P71A 4ZVGA 2IA0A 2LEAA 1URRA 4LF2A 3BO3A 4C8NA 3LO3A 2IRYA 5IQ6A 2XBPA 4FBTA 1JLCA 4ID5B 1MNEA 2VODA 4QWBA 4ED8A 2EK1A 4PQUB 3NMRA 2MSSA 1ZM4A 2G9OA 2XWXA 1U25A 1MMDA 3NBPA 4CRJA 5GAEU 3GG1A 2D3O1 5A76A 3QRPA 1SUQA 4I69A 2VG6B 1RTHB 3JTPA 4LFAF 1VQ6S 3BGUA 3AA8A 2GQ2A 1RLDA 1RBOB 2H5EA 3PRVA 5KFRA 5EWGA 4ZS6A 2HFOA 4Z7CA 1U1LA 4ANEA 3PO5A 2WONB 1QY7A 3N5BA 2I9SA 3CUNA 3CDWA 1ZH5A 2GVDA 3LGMA 4ECTA 3OW2R 1X5TA 2WAQD 3HHLC 1NJXA 1K47A 2VDIA 4OJHA 2MZRA 4RUCA 3J7AN 1KD1T 5GAEI 1FFSB 4WP8A 3F73A 4CLZA 2HQ3A 2X1FA 4C4WA 3QO9B 2VPWB 2A18A 2OI2A 1RTHA 2CIMA 4KSEB 5EUHA 2HNYA 2KU7A 5ETKA 3KXDA 3SEOA 3W61A 4N56A 3JSMB 1KFDA 2YH0A 2XG8A 5EX0A 2QO3A 4MH8A 7FDRA 2HRUA 3GPAA 2XZWA 1HR0F 1FE4A 2E5GA 3MECA 3TNVA 4K4UA 4PAAA 4ECSA 3IR7B 2DNOA 1A0OB 2F5GA 3R5JB 1HBNA 5CH7B 4C3LA 1HBOA 1Y5NB 2V34A 2CNLB 2AZ3A 2ZJRQ 2ACMA 4R0JA 2XO6A 2F63A 2BJ3A 1KP6A 3NWRA 2DY9A 4DSJA 1RE1B 1C2PA 1SC6A 2HMIA 3QSIA 4X4VA 1T7PA 4PG6A 1N52B 1WTBA 2UXCJ 2HHVA 1XJWB 3HXMA 1FDDA 4LT6A 2QRRA 1JXVA 1X4HA 2KL8A 4M95A 3QFHA 1R0AB 3R9LA 2MXYA 3RRKA 1RTIB 2W01A 3TWZA 2MKSA 2XMVA 1JLQA 2QYCA 2ZDPA 1PYSB 2QZ8A 3D7SB 2OPRB 2MZQA 1PYTA 1XQIA 2A3JA 3K89A 4GO7X 5B0FA 3J81j 4BDPA 2EWHA 1JMTA 4U67Q 2L08A 1QE1B 1DURA 4C7QA 2I38A 1WKJA 4DBQA 2BE7D 5KTQA 4NLDA 2Z2MA 3MFHA 2Q43A 3C2PA 1GQEA 3FCVA 2XC9A 4K2JA 5KOWA 4B3TJ 4QPTA 4ECYA 1SJ3P 2G2OA 4F7VA 4ED3A 4V19J 4X4PA 1FA0A 5IT4A 3MGJA 2GS8A 2IRUA 1JIHA 2ZNYA 3RBXA 1DTTA 5L8RC 3J81Y 1S7HA 4BLGA 1TK8A 2COLA 3KLIA 2XZDB 4V19X 1SCJB 2ASJA 2B8QA 2HZVA 5BYRA 2ZC3A 5ETPA 2FJAB 2CJKA 4YS2A 2XHCA 2W4DA 3R5BA 2DCLA 3C15B 2K7JA 1IJEB 1SH3A 1H72C 5KFLA 1J2VA 1NK9A 3ZZTA 3NS6A 1VGYA 3CJ5A 3C66A 2GFFA 2RIJA 3MEGB 4ZVEA 2ZWPA 2HLTA 3IAM9 3TAMB 3TQEA 3ET6A 2R2RA 2W2MP 4IO1A 2MQQA 3PEJA 2HS3A 2F1FA 3RTVA 3LOUA 3D3CJ 4LF7J 4DR4F 2DR9A 3ZZZA 1S6UA 2QFIA 1KLMB 4P2XA 2UU9J 2QMXA 2ZITA 4W4MA 3ZTSA 5DDPC 1WNEA 4ZKAA 2MGZB 4KFBA 4FBUA 1BWVA 4ZLJA 3PKMA 2MB0B 1F5CA 2EPIA 3A3PB 5LT5A 4CH7A 2ASDA 1G1XA 2DNYA 5KG3A 4MTPA 2MZSA 1UVMA 3M6WA 2MKHA 1IKWB 1RABB 1N33J 4JI3J 3W5XA 3K2YA 3TJ8A 3ELHA 2EFGA 4B02A 3DCAA 4LF5J 2M3DA 5D0HA 1X4CA 4CLWA 1I6JA 1WACA 1YZ6A 3QFWA 1FXLA 2CZ9A 3BPSP 4A48A 3M2VA 5IM0B 1WHWA 3Q8YA 4M5KA 2RQCA 2R7OA 5FDLB 5KT3A 2CDQA 1WELA 2DNHA 2G2ZA 4E0DA 4JI4J 2CQGA 4I64A 4ZP6A 4GC7A 1ZTWA 1N8RT 3R7BB 1XR6A 4P52A 2FHOB 2RF2B 4WFYA 4ECVA 4USUA 3EZUA 1QAXA 1QTMA 1HNIA 3EM1A 3BH7B 3EICA 4ALZA 3KHHA 5DQGA 4J9SA 2R7QA 1YX2A 4NCGB 4KKOB 2I1RA 2HBQB 2HNZA 1B7YB 4XIUA 3NKYA 3RAXA 5H9FK 1PAUB 1NDCA 5HN0A 2P6TA 4O3QA 3W7BA 1MMLA 4X4TA 1BLUA 3DHWC 2G0CA 2ZBQA 4AL5A 1RT4A 3NRBA 5M2RA 3O44A 4HDHA 2B9EA 3ITHA 1NXIA 4F3OA 1BQXA 5KFOA 3M2VB 3QIPB 3ZTPA 4Y2CA 1YK9A 1OYEA 4WP9A 5I3UA 1VC0A 2OPSA 2DHHA 3M8QB 1WDTA 1N54B 2W8KA 2IVMA 2JVRA 5DZ7A 1R8HA 4OI2A 3KKFA 1TZ0A 5IT9Y 1RTDB 3EDRB 3D4JA 4JI6F 1LW2B 2XWYA 1D9AA 3EGNA 4RW4B 2OGUA 5AXLA 5CZXA 1WC3A 2QYGA 2UUTA 4ZK7M 4EBCA 2KXHA 3W2WA 4MAKA 5LSRA 4BWMA 4PEOA 2CQHA 3NCRA 1Y3KA 1BY9A 3AB2B 3JQMA 2Q6CA 1RCOB 1NLKL 3MAHA 4KPYA 2M88A 2LEBA 1LWEA 2JL9A 3I5CA 2JDJA 4FF1A 3M05A 2CPEA 1HYSA 1CJTA 4IQMA 1JX4A 2KG0A 1HKAA 4K4WA 1RT7A 1UFWA 4LSNA 4Q44A 4IG3A 3DLBA 5J2QB 2J7KA 1VBZA 1IXKA 3P4UB 3I55S 2GMLA 3ZZOA 3RB4A 4F04B 1AYEA 1RT4B 2HEKA 2PGCA 4OI4A 4RW9B 2R7UA 1S1UA 1SC3B 2XSFA 3H90A 1BD6A 4Z2XA 2RUSA 3QJPA 2ZVIA 3A8EA 4ZVUB 2M7SA 4ZCLA 3BSAA 1Y0HA 2D1CA 5LL6d 3TZZA 4IUFA 3EX7B 2RRAA 2E1MC 2EG2A 2V2VA 3G82A 4I2QA 2IBOA 4E2FB 2E5LJ 4RW6A 2A2CA 2BE2A 2DNZA 1HL6A 1X0FA 4K4ZA 3CJ2A 3MWBA 1CQMA 4N47A 3DRSB 4DQRA 5DO2A 4ZVSB 4FYXB 3UDLA 1T95A 4F3MA 3TR5A 4LF4F 4JV5J 4MYUA 2C3YA 1EARA 3CSKA 5G4DA 1LWFB 1FRMA 2AV5A 3CO0P 3DM2A 3BH6B 4C3MA 3HPOA 2R2TA 4LFCJ 4K50A 4U8VA 2MQOA 2HHWA 4JI5F 4DX7A 3I4HX 1KTQA 3GTYX 2ZM6F 4K4YA 1HMVB 4CM2A 2AD9A 3LTOA 2GHVC 2DGQA 3OTOF 3HHNB 3CD5A 2WB4A 3IS9B 2HWIA 1FX4A 4LRCA 2CYYA 2NLWA 4NYZA 3H5YA 2VKRA 1UVJA 4FYYB 3BGFA 1ZM3A 2KKHA 5KOXA 1HI0P 1IQTA 2IM2A 2UV8A 4DR3F 2YNHB 1N5SA 3LP2B 4ZJOA 1KQKA 4PG5A 4BBYA 1YWXA 1HQUA 4H4KA 1T03A 3IR5B 1X4EA 3A8KA 1M5PC 4Q8EA 5IQQA 1NCLA 1Q8LA 3LAKA 3W5ZA 3CD0A 3KLFA 4F4YA 3SYZA 1UMJA 3N4WA 1RDRA 4FYWB 2QTWA 4ZLLA 5K20B 2IPOB 3T5LA 1S1XA 4OYWA 1LWFA 4D3HA 5A0YB 4PPZA 4ES2A 3OVAA 4F26A 2V8GA 3T9NA 4DR7J 1FNMA 1KQSR 2VB6A 1B3TA 2J0SD 3H7HB 4RNMA 3FCHA 3AXKA 1T9VA 4DV6J 1W26A 5A8WA 1G7CB 4DCJB 2BUNA 1UWAA 2PA3A 3MUTP 3FKBA 1LNQA 1X9MA 1I1GA 4B3OA 1RQ0A 1A6LA 1HPZB 3MURP 1S97A 2XS2A 2XS5A 1PYOB 3DXBA 4I67A 2HZCA 3DDNA 3UDEA 3PYGA 3R5GA 5BYSA 4FP9A 3FFIA 1MW7A 1U2CA 3GIRA 1LXNA 2JX2A 4HR2A 2MLXA 1N6QA 2H9ZA 2DXDA 3LW5C 3M8PB 3I5AA 2V67A 1FD8A 1SBRA 3ZTOA 2WOMB 3HFKA 1FXDA 4OX7A 2MPUA 1C1BB 1XR5A 3JSRA 2WW8A 4A46A 3OSPA 3CIMA 3OL7A 4DV1F 2LCWA 3QATA 2BKPA 3HKWA 2D9PA 2RRBA 2OH2A 1KDNA 4QZVB 1F0XA 4U6PA 3QJLA 1N48A 1EJ7L 4JI4F 4UZBA 2V63A 2KFZA 2BM0A 2EBEA 2X7IA 1X9WA 1F9HA 3PIPQ 2OFHX 3GV8B 4ED2A 4F8RA 1JLQB 2BJ7A 4EFAC 3H42A 1E6YB 2Q1LA 2XS7A 1PJ6A 2HS0A 2CNOB 2NXJA 4DR3J 5HJXA 3TUPA 3S6EA 3T6JA 4MFBB 1IKXB 2JJ4D 3N9UC 5F9NA 4RNNA 3F44A 2YTCA 4X4RA 3CJKB 1Y5LB 3HDSA 3R97A 3BV8A 4DV7F 4QCLA 3TJAA 5AXMA 3TANA 2F3JA 1X60A 3VVUA 4A8OA 4J9KA 3E2EA 1TL1A 3SMZA 1H0HB 3G8SA 1LV5A 2F4FA 4FF3A 1N33F 1FCAA 1KEKA 2KFNA 2IMOA 4OZ2A 3JAMU 2KT3A 2ZOGA 6FDRA 1PAEX 2FTRA 2V5HG 3RAMA 3MR2A 3VAKA 3T1YF 4TNOA 3CMES 3G9CA 3HJFA 5KFPA 3WC2A 3LPEA 2QA2A 3A8JA 4DQIA 1SJFA 3VZIA 1YRUA 5BYQA 3OLAA 1XNQF 4ED6A 3B4MA 1C4CA 4Q0BB 3IG1A 4O0NA 1DTQB 1HWUA 1S9GA 2KRBA 3DYAB 1HQEB 2YPYA 1F3VA 3EMTA 3X1LB 2W2QP 3SXLA 4DQQA 2CKWA 4DL2A 1RT6B 4Y0FA 5DM7Q 2AYBA 3D1OA 2IVFB 1N5YA 4OZJA 1VQNS 1RKJA 3GSDA 1FKPA 1FF2A 4PWWA 4J9PA 5ETOA 3I0SA 3PJ9A 3LP0B 1HWJA 2QGFB 3MOZA 3SQOP 4CYUA 3SQGA 4QYZK 4NLUA 2HHPA 3CPWR 1HBUB 3FQKA 1IKYB 2YVSA 3BDEA 2FDNA 1CG2A 4A8KA 1NO8A 4CTAB 4OYXA 2V2ZA 3CCQS 1XMQJ 5KG1A 1D8YA 2VL1A 1JKHA 1CJUB 5HLFB 2WCXA 1U1PA 3CC7S 2AJFE 1IJFB 5D4LA 5HMZA 4FF2A 2QA1A 1QVFR 5HBMB 1FVQA 4AD6A 3UCGA 1MROB 2KM8B 1AZSB 1C0UA 2ZHAA 3LQVA 3RG6A 2RS2A 5M2PA 3OHAA 1N32F 4Y6IA 4DJBA 3QWPA 3D0HE 1T94A 3IO1A 1RBLA 1DQ9A 2WW4A 3LANA 4KBIA 4CNYA 4DUTA 1YBAA 2B4UA 2U2FA 3BS9A 3PRDA 4KGMA 2YY3A 4M5DA 1FE0A 4U9RA 4R5PB 5HO4A 2MTLA 3BSNA 3PIOQ 2OELA 3KLGA 5AE1A 4USTA 4QOTA 1AXQA 3C14B 2O67A 2P2CB 3O8WA 1REVB 4Y28C 2XMWA 3AOBA 2R3VA 2RDJA 1KFSA 2CVIA 5F8NA 1YQHA 2KRRA 4JBCA 1KN6A 3B54A 4XDDA 1WUUA 3SCLE 5C2CA 4OHYA 2GJ2A 2VFSA 1TL1B 2X3GA 1FFGB 3L7UA 3KHGA 2HVHA 4KE5A 3UD5A 2K1RB 2PMHA 5HQMA 2R42A 3MM8A 1F1BB 3EWGA 4DF4A 1VJWA 2RJZA 2VZ9A 3DLLQ 1FESA 3CWJA 3P3DA 3QGIA 3VWSA 2OAUA 3UQSA 3IRWP 4DLEA 1HA1A 2IRXA 4MKVA 4ZCKA 2FVRA 1RHMB 4IG3B 2IMWP 2WVCA 4AE5A 2FLNA 2HVEA 1FFWB 2QL9B 3A13A 4J7CA 4CLSA 4HT5A 1Y9OA 2X51A 5IOLA 4DL0C 1JLGB 2M9KA 3PEHA 4LF7F 1MU2B 1S49A 2O66A 2V4RA 2IM1A 4NCAA 3O3LA 2VA2A 1S48A 3ILIA 3AH6A 4JI8F 5CA5A 5L38A 3M9MB 1T05B 4GKKF 1OWXA 3DLGA 3T6BA 4Z7YA 3MOJB 2K3KA 3AXMA 4X4QA 4ZVQB 3FNNA 5JVGQ 1GT8A 3FZBA 1VHIA 1OJ4A 1RA7A 2EK6A 4RPFA 3HVRA 2A10A 1SQEA 1NK0A 1S0MA 2OD4A 4G6VB 1YIJS 1Z2ZA 2VFUA 3FMBA 4G1QB 4GMKA 4DFPA 3CCWA 5A2QY 3PFEA 3EVOA 5KFBA 3R5AA 2LFVA 2IC3A 3AODA 2RRNA 3PVXA 2DGWA 1D3WA 3UW1A 3NS5A 4UQGA 4DSLA 4LQ3A 3ADAC 1S1WB 3IBWA 4DS5A 3EDQB 4TY9A 5F8HA 3JAMY 4JI1F 4KTQA 3J7YI 2AX0A 1FXRA 4JI7J 1APSA 2DHXA 4TY8B 4NEZA 4FVCA 4H4OB 4EYIB 2BW7A 1Q8IA 2LA4A 3G6VA 2F8EX 3CCES 1RWVB 2HKEA 1Q79A 3A1YG 4WFBQ 5C24A 4WTOB 4FNIA 3Q8VA 1VC6A 3AQPA 4R25A 2CNKB 4USKA 2D3ZA 2POKA 2IM0A 4NASA 3K0JA 2R2SA 2DGSA 2DPIA 2L9WA 2XHWA 1DHMA 3DMJB 3ITHB 3D5MA 2W1BA 4KHRA 3W5YA 2DB1A 4TU8A 4DV3J 4EBDA 4LFBF 4U7UD 2MHNA 3ZO7A 1S57A 2BQRA 4WZQA 3R8YA 3EPIA 5HP1A 4TQRA 2NS1B 4YN3B 4RZRA 1IBLJ 4N8NA 1H2VZ 3PNIA 4JYAF 2DGVA 4LF1A 2JSXA 2YWKA 4YHHJ 1HLWA 1GXUA 1WI8A 5K8NA 1S1TA 3SSRA 4F4XA 2GIRA 1PGZA 1C0TA 4DHVA 3KK3A 2HQCA 3I9ZA 1BGXT 3GU0A 3L7PA 4FNHA 2N4DA 2EVZA 3OL8A 4QWEA 2ZNZA 3WDOA 4ED0A 3J80U 3BF4A 2FHJA 4NOHA 2VQEF 1D8ZA 1SB6A 4FS2A 4DL6A 3ILJA 3HO1A 1X4AA 3R1LA 2KTQA 2Z4PA 4B17A 4F0KA 2VASA 1X31C 3IGNA 4ZPCA 5M2UA 4J9NA 3R27A 5J2MA 2UXCF 3MEEA 3G6ES 2JFKA 3M8ZA 2RQ4A 3GYNA 1RHUB 1WEXA 2K8GA 1KR4A 1N5TA 3PACA 3RR8A 4KQZA 3S1TA 4PXCA 4NA2A 4WPAA 1N5QA 1RHKB 1R31A 3KLEA 4P75A 4DUYF 1S6OA 2Y1RI 2ZD1B 4AL6A 5CXTA 3GB0A 4EZ9A 3FSIA 1KBRA 1IBKF 3IS9A 4NZ7A 5BJRA 3CXCR 1T11A 3A3NB 1BMQB 2AF6A 2YWGA 3P45B 4DPXA 3SI8A 4DPOA 4FDFA 1T02A 2YX4A 1IQZA 1EKRA 1J5OA 4LR9A 5CCMA 2GAHC 1UEKA 4YB5A 4UOFA 3N0VA 2HWHA 4ZP7A 3Q83A 1HBMA 4KB7A 3UDCA 5DG8A 2ZUGA 3NGTA 3H4BA 2DEJA 2FB0A 3DOMA 3SV3A 4K5SA 1WG5A 1FRIA 1U0HA 3G71S 4DQSA 3UPFA 3H8YA 2JEGA 3LF0A 4K5RA 3K5PA 3VAGA 2M8DB 3HM9A 2Y8YA 5DZ6A 4P2MA 2AYEA 3DDIA 4Y3CA 1L3VA 4Y65A 2PT0A 2W24A 3PHEA 3RBZA 4LF6F 1UVNA 5T7LB 3KJNB 3P5BP 2V9WA 3O6QA 4EGLA 4YMEA 3D0IE 3TAQA 2G1DA 1DQAA 1EB0A 1TKTB 2W4PA 2DTJA 2YKOA 4LFAJ 3M6VA 3TZYA 2DR7A 3SDEA 1FRJA 2BJEA 6FD1A 1UTAA 4IR9A 3H2UB 4QW8A 3CJ8A 2MLYA 1OY6A 1IR2A 2FUG9 4YY3F 1TUVA 4I7FA 2DEIA 3TUZC 3RR7A 2HFSA 2QL7B 1VRTA 3P96A 1RT5B 2D3OR 1WC5A 4RW6B 4W98A 3R6LB 4OI6A 1KTVA 2BABA 3HVTB 1NRKA 4KGZB 4ECXA 3GJTB 1LK7A 1TV6A 4U8YA 4K59A 1YJ7A 2DH9A 2HZAA 2OPQB 1VS3A 1S59A 4HHJA 5HVFA 3DM2B 4PPDA 4ZPTR 2W9CA 1FI4A 1HBOB 4ZVHA 2HS4A 1I94F 3PX6A 4JI2J 2P5VA 9RUBA 2HK2A 4YB6A 1SV5A 3FMWA 5LJ5Y 4X65F 5DM6Q 1HNIB 3OTEA 5KT4A 4DFKA 2Y1IA 2FJVA 4A4JA 4QIGA 4DFJA 5ETMA 3IMQJ 4B3TF 3O5TB 2HVIA 1MWYA 2MQMA 1V5VA 2XMJA 2Q66A 1KOOA 1WF2A 1HNZF 3GJQB 2FZCB 2HVDA 3CF5Q 1GNKA 1HWIA 2LQBA 3MD3A 1Q0NA 2ACYA 3QT8A 5KFUA 3MUMP 5THWA 1XR7A 1TL4A 3B4DA 3LP2A 3BN7A 4RO0A 4XTTA 3UFCX 4ED1A 1JLFB 3KYLA 1VRTB 1L3TA 1H73A 3AQOA 1R6YA 3FVYA 3KG0A 2UV8G 4ID8A 2CQIA 4CLLA 1VJQA 4N5SA 2XULA 2W9AA 2CQ4A 1T3NA 2J7WA 2OPSB 5AE2A 3I56S 3UWTA 1IVZA 4BC7A 2MY7A 1VRQC 3MEEB 2QLFB 4R8UB 3H4DA 4JV1A 3HFZB 3S01A 3W1YC 3UN2A 4OZ5A 1CS4B 2IFXA 5F41A 3K5NA 3M32A 4PUOB 2YX1A 4WU3A 1HQ2A 2AP6A 2GHPA 1JJCB 3NBPB 2Z2LA 2IJFA 3AHPA 1UWBB 2VG5B 3PKYA 3FBCA 3VF0B 1NKEA 4KKOA 1P9YA 4M94A 3IWNC 4C97A 3CW2C 4PKDB 4DN0A 4YEAA 1EQ0A 4MJKA 2D74B 3R5CA 3FFIB 4PG7A 3WQPA 3D3BJ 1HW8A 3MM7B 2MHEA 3CDBA 3RZAA 1XMQF 3K58A 4DSKA 2CG4A 4UY85 5E41A 1RGVA 1YBTA 2ROEA 4X64F 2ZE2B 4K4TA 1K1SA 4ZPVR 2HGNA 4HACA 1RTJA 2HSEB 5D0GA 3N6LA 2KHCA 4P7VA 3UI3A 1C1CA 4OV1A 4PABA 4ZVTB 1XC9A 2HQGA 2YX7A 5HQ8A 2FQQB 5HBMA 3MM6B 3UVJB 3IWXA 1N32J 5A6PA 1TFWA 3DRSA 4OHZA 4I0WA 2FPHX 2YBVA 1TK0A 1XNRJ 1AUDA 3N6NA 4X62J 4ZHRA 1RUSA 3FEZA 3GSIA 5GVQA 2XSJA 1S99A 4DPWA 1U26A 2GVZB 2QG9B 2V0NA 4PG8A 4OI1A 4BC9A 5KG7A 2V4QA 3G6XA 1OIAA 4WK3A 3PW4A 1WEZA 4IG0A 3KJVB 3QJJA 2GV1A 2MMYA 3EVMA 2JZ5A 3VAIA 1Z2LA 3L7OA 2LKZA 3MM5A 1KVIA 1FJCA 5ETLA 5I42B 2CJBA 1Y10A 5IT9U 1O8BA 3MI7X 2FC8A 3DHXA 1T0TV 1D09B 2V8PA 2DGTA 4IRCA 1EKSA 1YRTA 1JLCB 4ID5A 5J2NA 2PI5A 5C42B 2AJ0A 5KG6A 1QSLA 1LWCA 1FKOB 1RI7A 4O23A 3UR0A 4DG1B 2P9CA 4OYMA 4Q2MA 2EKNA 4KPCA 2NCKL 3OV7A 3P49B 4TY8A 3RAQA 4YFUA 4LUBA 3M8YA 1EP4A 1TUGB 2MYFA 4X62F 3CJQA 1RAJA 5HANA 3AY0A 2ADCA 2EFOA 4ERDA 2C28A 3QZ7A 1R8CA 2WZ1A 4CIOA 2Q79A 3KUHA 4C48A 1IM6A 2W7AA 2CQ2A 3D2WA 2FHJD 1EQMA 1Q81T 1X0PA 2UZAA 3G2XA 3HF5A 3KHRA 1NSKL 3QYYA 4IH6A 4USJC 2VDHA 1KWMA 2CJ9A 5HL7Q 2XM3A 3GIIA 1SL0A 5HVHA 3TX8A 1QDUB 2JVOA 2XY7A 2JOQA 3CDUA 5KFDA 3A3OB 3ILLA 1R43A 1YITS 2QC3A 1EP4B 3BPDA 2RQMA 1KSPA 5CYJA 2ZUAA 4QWCA 2HRYA 4LF4J 3O1LA 2RVJA 3T9ZA 1MU2A 2J9DE 4LF5F 2B51A 1LWCB 5D3GB 3KNGA 1HIYA 2CPXA 4DV2J 5ETVA 2M70A 1K0VA 3W2VA 3G86A 2ZHBA 3NCQA 3MZIA 5U47A 5EWFA 2Y9HA 3KUEA 3Q0AA 2YKPA 2GGPA 4L75A 2B4VA 1B70B 1H7XA 1RTJB 4FKXA 2DK2A 1V3SA 4NZ6A 4O3OA 1RAGB 1L3UA 2AT1B 3D0GE 3EZ5A 3M9OB 1EX8A 3FRYA 2Y8WA 3MEDA 3SSQA 1AZSA 1CQNA 3PG9A 3VGUA 1BQMB 2JLGA 1IBLF 4C8OA 4DZ6A 2NYHA 4ECWA 2HHQA 3K59A 2DIUA 1MN7A 4WFZA 1HHSA 1IM4A 4ZCIA 3IAS9 3CCVS 4YDXA 3DN9A 2XMMA 4Q43A 4NI2A 3V4MA 1TMJA 5E3CA 2EKYA 4NLSA 2HQFA 2ZFHA 1YDLA 3AJ2A 3JTNA 2DKOB 5L9XA 5J2PB 1PBUA 4M5IA 3G4SS 3VTIA 1RJJA 1UFLA 1SL1A 3GP9A 3IG1B 3OQ2A 4K4VA 3EGWB 5IC6B 2RU3A 1VCTA 5D8HB 1L3KA 3DMJA 2OMLA 2LDYA 2E7WA 1HI1A 2RQKA 3PJXA 4WKYA 1C1BA 3ISNC 2HYIB 2ZD1A 4L72B 5AT1B 4AXIA 3G6YA 1UPPA 3UD4P 2JEJA 1DLOB 2VH7A 4DWIA 4HH1A 4LF8J 4GVLA 1T9UA 4DUYJ 2EEYA 4LR7A 4V1Ak 1GMWA 1NSQA 1S6PB 3UDVA 3U27A 4TU7A 4A8SA 4F67A 4MT1A 5HP1B 1CJVA 1NK5A 4DR6J 4O4RA 2IY5B 1VK3A 3B8HA 5L9NA 2CG8A 2QSFA 2ZM6J 3PZPA 3GFHA 4TKTA 1Q1KA 1UEVA 2NXEA 2HNDA 2LEPA 4JI7F 2NUHA 4WFXA 1N34J 3C3LA 1B64A 3CD7A 4K8RA 2NPFA 1Z1ZA 4WFAQ 1Y4ZB 3CD6S 1YJVA 4HDGA 2ZZMA 3N79A 3OBIA 4F36A 3J7ZT 5E3AA 3MMBB 2L3MA 1UW9A 2EBGA 2HGMA 4LF9J 3JTOA 2JRSA 1TL3B 2R4FA 2X1BA 4M5NA 5L39A 1Q7YT 3GYXB 4ED7A 1S7IA 8RUCA 4QYZJ 2HHTA 2EI5A 3TO8A 1FX2A 3MXHP 1KRPA 1HBUA 5LSOA 1RHJB 1LW2A 3NAIA 3M2RA 1T8EA 2KO1A 2OPRA 3QGPA 4KT0C 1HNXJ 1KHVA 4DSEA 2DHAA 4I7FB 1WC0A 1Y3JA 4ZITA 1TP7A 4XO0A 2H1YA 1BUXA 2HWTA 2BACA 4CO4A 3DNCA 4C8KA 4MK8A 2NXUA 2FJXA 1YI2S 3OTDA 1M90T 5IFMA 2F4VF 1WOOA 3OXFA 4C98A 2OKQA 2GZOA 1J5OB 4C8LA 4TLRA 2XMTA 2LQ8A 3OR1B 4OLOA 1PKUA 5IV3A 2BANB 5KFMA 1QTNB 2XSJB 3FQLA 1DAXA 2A2DA 3LH2S 4Y2AA 3EZOA 4YY3J 4OX8A 3NWGA 1ZETA 2FGOA 1YVFA 2B7CB 3HI9A 2AYMA 3WHIA 5JUMA 4RNHA 2RS8A 4IFVB 2VQFJ 2F65A 3AT1B 4CT9A 4RLEA 4U7CA 2XYHB 3HD2A 3MMCA 3NCPA 4ECZA 2A6OA 2I5JA 3W66A 3SCIE 3MPVA 1PBAA 4J9MA 4QIVA 4GRSA 2JEIA 1HBMB 1GK8A 1IWAA 1U2FA 3M6UA 3SDEB 2XNRA 4ED5A 3TAPA 3MHYA 1SJ4P 2QMUB 3C6TB 2DXFA 2V8DA 4LMZA 3OR1A 2IAJA 4CLTA 2UXDJ 2K1RA 2LMIA 3MPWA 5DETA 1T05A 1PG5B 3DI6A 3KOAA 2KVQE 1RA6A 1AA1B 2QJ3A 1ULRA 4USIA 5IWAJ 1HNVA 2L48A 1CULB 3DRYA 1NB2A 3KG1A 4IFYA 4CP5A 3HSJA 4ZN3A 4XPCA 2VHGA 5F8JA 4M1KA 3CIZA 1Q4RA 4G1QA 3EXCX 1GMVA 1FRKA 4RBTA 2H51B 4UUWA 2KDOA 4QYRA 4DV4F 1EAYC 2KZZA 3CCUS 4DR2F 4M5DB 3FUYA 2FY1A 2ZBIA 4QBUA 4CO3A 1JLBB 3TP2A 5F8LA 2B6AB 2MKKA 2PI4A 2HW3A 2PSZA 1J27A 3H5UA 4XPEA 2XCPA 3MFIA 2M4MA 3QO9A 1RB0A 2LVWA 3I6PA 2PO4A 3RYLA 1RT2B 2XGQA 1ZS6A 2DISA 1VFJA 2XO7A 1HNXF 3HD1A 3UNGC 4UY8T 1WI6A 2X1AA 3NOCA 2RAQA 4OYAA 5KFWA 2PEHA 5B0CA 1UJ5A 1S0NA 3Q2TC 2G4BA 1CC7A 4DV5J 5A0YA 2O3DA 3G87A 1U1RA 3IA0A 3DI6B 4DCOB 2C2MB 2ADBA 1MWZA 1UJ4A 3KTQA 1U09A 2J6SA 1RAEB 2XY6A 4CQ1A 2ZJPQ 2CQBA 2C2DA 3W9JA 1UZDA 1V3RA 3PCOB 4H54A 1XN9A 1S5ZA 2HNZB 2NXCA 1CC8A 4NPOA 4K4XA 2UUCF 2RMLA 3KHLA 3PRBA 1ZA1B 5B0EA 1TELA 2B4PA 2RHSB 3SCJE 3MAAA 2IJNA 3NXZA 1VDHA 5KFCA 1UVKA 3BN4A 4LREA 3E51A 2LECA 4JI1J 4IR1A 5AE3A 3DXSX 4OYBA 4C11A 1OQ6A 2LQ5A 2QEXS 1SI9A 3QGHA 2ZH8A 1T9XA 2VBZA 4C8ZA 2DITA 2MGZA 5GMEA 1P9QC 2Z58B 3OTBA 4O44A 3SQGB 1RT5A 4K7QA 4AFFA 1R8BA 3U1MA 4F2RA 1J5EJ 1D9FA 3D9BA 2DRBA 5B09A 4NLRA 4RJVA 5J2NB 3VAHA 3TQ1A 2DO4A 2AYGA 2GIFA 1E6YA 1Q95G 2D69A 3ETOA 1JJ4A 1UVIA 4PQUA 1WDDA 3DGPB 3PW0A 1S1TB 3HCXA 1R0AA 3MR7A 4X2BA 2IHR1 1T9WA 2W4CA 3HZGA 1SJRA 5IC4B 5GAHI 3FRZA 1NDLA 1UAWA 1KNZA 3MCSA 4IH7A 3H5XA 4ZPBA 2CVEA 4CLYA 1CJKB 2WHOA 3DOKA 3IWLA 2JHEA 3QLHA 3DLEB 3FSXA 3VVTA 4Y34A 1NKBA 3GZ7A 1NPPA 1FTCA 1XMOF 4P2FA 3LUYA 4OJGA 3M30B 2KG1A 4DV1J 3HHEA 2CJYB 2NZCA 1Q5YA 3JB9k 5DDOC 4B3RJ 3H2LA 3OFGA 2FVCA 4GC6A 4UZCA 3MMJA 5KG0A 5EGYA 1V5IB 1FKPB 5GAHU 2MDAA 3D6FB 3ZZYA 4X4NA 4O44B 3GCXP 1MG7A 3KLVA 2FGCA 3K7RA 1U1QA 2B9XA 2M52A 4WWSA 2HFVA 3HX9A 1RWMB 2KZMA 3THTA 4LIRA 2MLZA 3A8IA 1IBMF 1AT1B 3Q86A 3W63A 4DOZA 5H9EK 4LIWA 2PDAA 3HHLA 3MPDA 3GILA 2VUGA 1S9EA 1S4FA 5SUHA 1W2BR 1EETA 4F02A 4B9MA 2ASLA 1NK6A 4HHHA 1W7WA 1JK9B 2OHDA 2BEFA 5KFHA 2J9EA 2Y1JA 5KFIA 2VV5A 3CE8A 3DKDA 1ZPVA 5KG5A 3J7Z5 3T1YJ 3NNAA 3BGRB 1UEUA 2YQ3A 3FZ2A 3IR6B 1DJ0A 1XERA 1QSYA 1K44A 2I0XA 1LFPA 1S77D 2LU2A 4L76A 1IKYA 1S9FA 4QPXA 2FY8A 2VBWA 2DNMA 5T7LA 3SBMA 1H6KX 1F5BA 4CYUB 3GWCA 3OHBA 4UOGA 4DG1A 1OSCA 4P2SA 2ZH4A 3HT3A 2SXLA 3KK3B 2R8HA 4NXNJ 4ILLA 1Y00A 1OY8A 1NHKL 1XBWA 4I2PB 3JYTB 2CQ1A 3I96A 1YSJA
chains in the Genus database with same CATH topology
2P8IA 2NYHA 2PEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8I A;  2NYH A;  2PEB A; 
#chains in the Genus database with same CATH topology
 5I3U B;  1GX5 A;  1WG1 A;  2QX0 A;  2B3T B;  4P10 A;  1VLY A;  1Q86 T;  4YDD B;  4NA3 A;  4YUD A;  4LJM A;  2CJQ A;  2OPP B;  1X9S A;  4CDI A;  4DR5 F;  1JLA B;  3POT A;  1ELO A;  3DC2 A;  1BC6 A;  2E66 A;  1ARO P;  2GGP B;  5KFY A;  4F4Z A;  3BR9 A;  4A47 A;  3A4T A;  1HD1 A;  2RDD A;  2P8I A;  3M8S A;  3LGN A;  1R8P A;  1LWX A;  4Y2M A;  4TLQ A;  3RU0 A;  2GMH A;  2OO4 A;  3GE9 A;  1SPB P;  3JYT A;  5T14 A;  3EPG A;  1H98 A;  1QUP A;  3LWL A;  1HNV B;  2W9B A;  2EXU A;  2J6U A;  1XIQ A;  2C2K B;  3DRP A;  3GIM A;  3VHQ A;  2G0J A;  3G82 B;  4N7T A;  3S7R A;  4YR0 A;  4ZPA A;  4DF8 A;  2XTJ P;  2E1R A;  2BJ1 A;  3FBE A;  3Q8S B;  2ZH7 A;  1VOM A;  2OSR A;  2AEF A;  2YKM B;  2Z8Q A;  3D68 A;  4Y2I A;  3SFG A;  1IBM J;  2CNN B;  2C42 A;  4NE9 C;  3D6T B;  4I6A A;  3PO4 A;  4KO0 A;  1DFD A;  4OX6 A;  3BKT A;  3QT7 A;  1RP5 A;  5CQG A;  5I3P A;  5EX3 A;  5JJB A;  3D1Q A;  4EWT A;  2FZK B;  5FLX U;  4ECQ A;  2WB1 D;  2KXF A;  2DNL A;  5DGA A;  1MSW D;  1NM2 A;  4KHM A;  5FD1 A;  3CJR A;  1C4A A;  4U96 A;  4J9V A;  4M5G A;  4NCB A;  1DRZ A;  4KHP F;  2QSW A;  5GMD A;  2ATL A;  4FYD A;  1M5K C;  4CO0 A;  3OJU A;  3RRH A;  1H38 A;  1FWK A;  1ZPW X;  3Q8U A;  1AW0 A;  2KT2 A;  1F3F A;  1FK9 B;  2F9D A;  4M5L A;  4RW9 A;  2ZC4 A;  1TQL A;  3D67 A;  1JB0 C;  3OXG A;  1U7L A;  3UO0 A;  3QWU A;  1S72 S;  3CGI A;  2WSF C;  3QNW B;  4DLG A;  2AMC B;  5B0D A;  3FBB A;  2HIY A;  2J7U A;  2I5J B;  2HIQ A;  2Y3Y A;  4A8M P;  1YGY A;  3P5T L;  1M1H A;  3I0R B;  4BWJ A;  1QLN A;  2FLO A;  2ZBP A;  3JQJ A;  1WC4 A;  4OYI A;  3H0P A;  1VQ5 S;  1RWX B;  2YWW A;  2QLW A;  1VRU B;  2QLB B;  3W62 A;  1G2E A;  3C6U B;  2JC0 A;  3V6D A;  2HK3 A;  2ZBR A;  5DGB A;  3OTO J;  2GVZ A;  3Q8Q B;  3V81 B;  5EWE A;  3WBZ A;  2CQ0 A;  4QIF A;  2Y1L B;  2DY1 A;  3T5J A;  2JEF A;  3BSC A;  5FLX Y;  3D66 A;  3CC4 S;  5A8W B;  1IKV B;  1PSD A;  2D7S A;  4NWB A;  2CAJ A;  4QW9 A;  4NYO A;  4NCG A;  1S76 D;  4C8Y A;  2J8S A;  2VFT A;  5J2Q A;  1W2I A;  1O6X A;  1R0B G;  2GVD B;  4R0E A;  2W2N P;  1U8W A;  1VIX A;  2N4C A;  2FJE B;  5ETN A;  3W8G A;  1N6Q B;  1P6T A;  2ILZ A;  4OYO A;  5IT0 A;  4PWD B;  2DNG A;  1TAQ A;  1KQG B;  3PR5 B;  3L9Z A;  2CFX A;  4TQS A;  3GIJ A;  2DR8 A;  2BAN A;  3BQ2 A;  1V9O A;  1YJW S;  4LF6 J;  4YOE A;  1T03 B;  4HVZ A;  1GTH A;  2B43 A;  2RHQ B;  1R6V A;  2OFG X;  3M8W A;  5KFV A;  3VZH A;  1RXO B;  4DI6 A;  1HNZ J;  1B0P A;  2KHD A;  1U2R A;  5K14 B;  3TX0 A;  2BRK A;  3BKU A;  3OUY B;  4ICL B;  1QAJ A;  2KT5 A;  1NH7 A;  1RSC A;  4HI1 A;  2VON A;  3CDE A;  1FRH A;  4IOB A;  2BRL A;  5AXN A;  2XI2 A;  1SKU B;  4JI5 J;  4DV0 J;  2XLJ A;  4RU9 A;  1DZ5 A;  4LRF A;  1IUJ A;  1DAR A;  2MKJ A;  3R1H A;  2UUB F;  1ICE B;  4KO0 B;  2C2O B;  2RH3 A;  3THV A;  3NNH A;  1QM9 A;  2CXE A;  2DHG A;  2VG6 A;  3DLG B;  3ENQ A;  4B08 A;  1WHY A;  5IXU A;  5KFE A;  3ICL A;  4UOC A;  1HHQ A;  5MLC V;  4YR2 A;  3RUB L;  3VR1 A;  4KH0 B;  1VBK A;  4J9R A;  1ROF A;  4ZJQ A;  5KT7 A;  5A6W A;  3HFV A;  2E7X A;  1K8A T;  3CB4 A;  1IBC B;  1OYD A;  3SSS A;  4DPY A;  4JYA J;  1KVJ A;  4G3I A;  1I94 J;  1NK8 A;  1BHN A;  3QZ8 A;  2UVR A;  2P9E A;  2HHH J;  2N3O A;  1NKC A;  3VAF A;  2KJV A;  1ZYQ A;  3K5L A;  1P1L A;  1SQG A;  2OMO A;  4PYD A;  2HQD A;  4QR0 A;  3PW7 A;  2UVV A;  1K0T A;  4HAC B;  4HL9 A;  2O01 C;  1U6Z A;  2DJW A;  4CWB A;  3TEG A;  5J1P A;  4TU9 A;  3KLF B;  1NU4 A;  3R2D J;  1ZOT A;  3BQ0 A;  4B9S A;  4LQ9 A;  4ETZ A;  1ZM9 A;  5K8O A;  2CQC A;  1RYR A;  2MEW A;  2J0X A;  4DV6 F;  1WD6 A;  2YPZ A;  5ETR A;  4WYL A;  3M4X A;  3M2U A;  3GG0 A;  4X64 J;  2AU0 A;  1RAC B;  2LP4 A;  2KM8 C;  2HFZ A;  5KFK A;  4JI0 J;  2UVU A;  2CJA A;  1JLF A;  3FSY A;  2ZZT A;  4JP8 A;  4O4G B;  4CCH A;  4EYH B;  2RF2 A;  3Q2S C;  1N5Y B;  4LFC F;  1FEE A;  5FJ4 A;  5CYM A;  4OHV A;  4L3N A;  3ILO A;  2DR6 A;  1CJK A;  1WC1 A;  1UA1 A;  4CLF A;  4ER8 A;  2DRA A;  1O51 A;  2YNI B;  1XNR F;  5JVH Q;  4KGK A;  4J9U E;  3E3X A;  4WE1 B;  1X4F A;  5D78 A;  4ZJL A;  4C0B A;  4L3K A;  4R8U A;  2DT9 A;  2XB2 D;  3K8W A;  3ISZ A;  1Q8K A;  5C42 A;  1SXL A;  4ELV A;  2VPX B;  3MDF A;  3PFO A;  1Q53 A;  4LRD A;  1RTI A;  2B5J B;  3CMQ A;  3ENW A;  2HAI A;  4URS A;  4E98 A;  1YTY A;  1UA0 A;  2RNE A;  5ETQ A;  1VQ7 S;  1SH0 A;  4WIQ A;  4OFZ A;  1VK8 A;  1NHV A;  1LWE B;  1WHX A;  3HKZ D;  4RUH A;  1L5U A;  3OVB A;  1RAA B;  4WTY A;  2BZ2 A;  4YB7 A;  3F41 A;  3ZZR A;  1M5H A;  1YLX A;  3CCM S;  3DOK B;  1VQO S;  5HJY A;  3V5R A;  4WU2 A;  5K8M A;  1BE4 A;  1RU2 A;  1SKS A;  4TVA B;  3DLK A;  1IN0 A;  1SC4 B;  2B7B B;  3OL6 A;  5L1I A;  4PWD A;  1UKU A;  3PYF A;  3P8B B;  2MKC A;  4YB1 P;  4JOU A;  4DSF A;  3UE2 A;  3SV4 A;  1RAI B;  4UTG A;  3M1V A;  1NBE B;  2EFN A;  3OPK A;  1ITP A;  3PX4 A;  4CNZ A;  5L1J A;  4K0K F;  2BE2 B;  2QLX A;  3I31 A;  1M5V C;  4OMF G;  1RWK B;  3UNY A;  4OI0 A;  4DZD A;  4RU2 A;  1XWL A;  4JI6 J;  4DCP B;  3DFE A;  1F5A A;  2AZ1 A;  2VA3 A;  4WXO A;  3BQ1 A;  2HFN A;  5KFT A;  3NL0 A;  5A8R A;  2CA9 A;  2V69 A;  3OD2 A;  4CM0 A;  4ZHR B;  2KI2 A;  4ANC A;  2H3E B;  4TYB A;  1RWW B;  2ZWO A;  1SQF A;  5D77 A;  5F0W A;  2V6A A;  3U1N A;  4X4S A;  2R8J A;  4F4W A;  3FDS A;  3ENV A;  2BVZ A;  1TKX B;  4FPI A;  3DGP A;  2HVZ A;  1U0H B;  2IVY A;  1JKH B;  3QBC A;  1UWB A;  2W2O P;  2OJ3 A;  5I42 A;  5A8K B;  4RBV A;  1RT2 A;  5G0R A;  5LXY A;  4X65 J;  1K9M T;  5I3Q A;  4ELU A;  2B8P A;  3DLK B;  2JFD A;  3AD7 C;  4IKA A;  3ZC4 A;  4C6A A;  2W7P A;  4J9O A;  4F25 A;  2UXB F;  4MKY A;  1SJQ A;  1TV6 B;  2FHM A;  3HJV A;  3CNQ P;  5K5M A;  4XK8 C;  4DU8 A;  1N34 F;  3HMJ G;  1V3Z A;  4UQT A;  4URQ U;  3SFU A;  4A8Y A;  1MN9 A;  3AFG A;  2J0W A;  1N4L A;  1NJI T;  2AEM A;  2R7W A;  2M5Y A;  3KFW X;  1JLG A;  2M0G B;  2DCU B;  4KV8 A;  3WX8 A;  1WEY A;  2QLJ B;  2K2P A;  4FF4 A;  1CJU A;  3C14 A;  2ZVS A;  3AD9 C;  3MTJ A;  2VG5 A;  2WBM A;  4NLY A;  3DLJ A;  5D0R A;  1S1X B;  1ZAV A;  2AKW B;  2XZT B;  3TEH B;  3D54 A;  1AFI A;  1GTE A;  5HQL A;  3FEX B;  4WF9 Q;  3CJ3 A;  3GJS B;  3H2V E;  2OD6 A;  5CYQ B;  1TFY A;  2ZE2 A;  2YNG B;  2Q3P A;  2ZH6 A;  3CC2 S;  4S0M A;  4P72 A;  3M9N B;  2HRT A;  3E01 A;  1JXL A;  3MF5 A;  5LMN J;  5E2Q A;  1Q16 B;  2N3L A;  3O2I A;  3VGT A;  1GXL A;  3GMG A;  3BYP A;  4FS1 A;  3SCK E;  3MMB A;  4JB8 B;  2WTF A;  4ZPD A;  4NXN F;  4F4K A;  1FKA F;  2VD3 A;  4ECR A;  4J37 A;  2MQ8 A;  3UR3 C;  1RT3 A;  2ABY A;  4BCA A;  3G8T A;  4NLG A;  3KJQ B;  2E9T A;  4LSL A;  3W60 A;  2U1A A;  4ZN1 A;  2MQP A;  2IA6 A;  2BJD A;  2XI3 A;  3BYR A;  3US5 A;  1XNQ J;  4AT1 B;  4DV4 J;  1JLA A;  1OMS A;  4FN5 A;  1DY3 A;  1HI8 A;  4PXE A;  3ZZ0 A;  4DFM A;  4OYZ A;  1SL2 A;  2PFD A;  1JLB A;  3NGU A;  2R8G A;  2Z56 B;  2YKQ A;  3MM9 A;  3NGR A;  2J8A A;  2H54 B;  3BGR A;  4LRA A;  1VBY A;  3K5O A;  2VQF F;  2FZG B;  1NZ8 A;  2VG7 B;  1DTT B;  2EFP A;  2B9W A;  3GV7 B;  4JI3 F;  1SC1 B;  1U45 A;  1KS2 A;  1SIZ A;  3RW7 A;  2VOP A;  1X7V A;  1ZZF A;  2ZOF A;  2EFQ A;  3MEK A;  3Q89 A;  1WC6 A;  2ATC B;  4NRT A;  5C24 B;  2G2Y A;  2RD5 C;  2YWH A;  2XQC A;  1Q8B A;  2C3U A;  2AJ4 A;  5J1E A;  1TKT A;  2F40 A;  4FXV A;  4OL8 A;  1B0T A;  1OQ3 A;  3W8P A;  3WX4 A;  4EO8 A;  1PIE A;  3H98 A;  4ZCM A;  3T41 A;  3POT B;  1OO0 B;  1SIW B;  2MQN A;  5B08 A;  1HR0 J;  2FVS A;  4PUO A;  4DV2 F;  4RWW A;  1A9N B;  4EK2 A;  3W9I A;  4OJ3 A;  4ZOS A;  4N76 A;  5KT6 A;  8ATC B;  3VGV A;  1NND A;  2DNR A;  5A8K A;  2PII A;  1B7F A;  3I0R A;  4I68 A;  1Q7L B;  2GX8 A;  1HAR A;  3OTC A;  2UP1 A;  4MK9 A;  5LXR A;  2DNP A;  2GAG C;  2DHS A;  2WK4 A;  2WVB A;  4UT4 A;  2APO A;  3UCU P;  3OVS A;  2GO8 A;  2ZH2 A;  3ZTQ A;  2Z0G A;  4LR8 A;  5K8P A;  1YHQ S;  4DR2 J;  4B3S F;  4F0M A;  4ES1 A;  2O5D A;  4IYQ A;  2HHX A;  4HH0 A;  1QJH A;  5B7W A;  3KDO A;  1Y5I B;  5CYM B;  1LW0 A;  3T5K A;  2E29 A;  4LVO P;  2KFY A;  3TJ9 A;  3KDN A;  3IRX A;  4ZVO B;  2XCA A;  2ZEJ A;  1RTD A;  4UOH A;  2Q6B A;  2RIL A;  3OT9 A;  3S8S A;  1HNW F;  1X5S A;  2V8H A;  5ADZ A;  5F3T A;  1FWL A;  3Q8R B;  1VLO A;  4RR5 A;  3RJM B;  1U1M A;  4EO6 A;  1W25 A;  3C16 A;  5C5J A;  1MMN A;  3KK2 B;  4F50 A;  4LF9 F;  2A1B A;  2WRM A;  4I2Q B;  3PJW A;  3TVK A;  3MM8 B;  1FK9 A;  2M2B A;  2W2P P;  1B99 A;  3ZNJ 1;  3W65 A;  1SVD A;  5BXI A;  3SZ2 A;  1KLN A;  4IRD A;  4NYP A;  1TL3 A;  2HBR B;  3FK4 A;  3MR5 A;  3IP0 A;  3GR0 A;  4N8O A;  1RT3 B;  4QR1 A;  3L09 A;  5DS7 A;  2H4Y B;  5D6G A;  4ZP8 A;  2E5J A;  2DGU A;  2BKN A;  4N77 A;  1VQL S;  1X4B A;  4DL4 A;  3EGV A;  2IYI A;  4L73 A;  1LKZ A;  4PG4 A;  2J0Q D;  2HHH F;  4P74 A;  3HHK A;  3DOM B;  1BQM A;  2DGO A;  3I9V 9;  3RGI A;  5AJ3 J;  3OR2 B;  4ZVP B;  3MM9 B;  1Q82 T;  4WFN Q;  4QWD A;  2HBZ B;  1UVL A;  1FO1 A;  2F4V J;  3PDN A;  3FJ2 A;  2BDP A;  2HMI B;  2CPY A;  2LU1 A;  1K73 T;  2MZ1 A;  2VJU A;  1KLM A;  2E5L F;  1C0U B;  2OEK A;  3DRP B;  2BXJ A;  2NRE A;  4ZIW A;  2YNH A;  5LMU F;  4URG A;  2UUB J;  4IOA Q;  2AGO A;  3DRX A;  1FWP A;  2BKO A;  2VBY A;  3T3F A;  1T9Y A;  1YG0 A;  2R7T A;  3BBB A;  2D9O A;  3IGV A;  4RW8 A;  2ZH5 A;  3VAM A;  2NUU G;  1S1V B;  3F0N A;  4U7U K;  3U02 A;  1TR0 A;  1ZA2 B;  3KLG B;  1RAF B;  2GW8 A;  1KC8 T;  1PJ5 A;  1RCX B;  2BJ8 A;  4DU7 A;  4DV7 J;  4X66 J;  2KJW A;  3D1H A;  7AT1 B;  3I5B A;  3MAQ A;  3QAU A;  3M6X A;  2V4J A;  3NGK A;  4Q8F A;  4B3O B;  4I56 A;  5GAD I;  4HI2 A;  1ZZN A;  2MY8 A;  2RUG A;  2N7Y A;  5FDL A;  4OLP A;  1VQP S;  2UUW A;  1P1T A;  2EW9 A;  2OP5 A;  3W9H A;  2ZOM A;  5CZV A;  1WKL A;  3B6B A;  2KYX A;  1QAY A;  2VPZ B;  3MAA B;  4KYZ A;  2FJB B;  4Z37 A;  2RSQ A;  2FLP A;  1OPZ A;  2O1P A;  1QVG R;  1WWH A;  3KK1 B;  4OI3 A;  1EET B;  1LEO A;  1CEZ A;  4RBU A;  1VQY A;  3CJT A;  1SJ1 A;  2W25 A;  5LJ3 Y;  3TW0 A;  4NXM F;  3CCR S;  4OZN A;  1X8D A;  4ZLN A;  4B9L A;  1FNO A;  1YRX A;  1RK8 A;  2AJ2 A;  4G65 A;  1GX6 A;  2VJV A;  3R5D A;  4FKY A;  4GKJ J;  1ZAW A;  2IDE A;  3HP6 A;  1R8A A;  2E7V A;  4DR1 J;  1DTQ A;  2RDI A;  3HVT A;  2BR0 A;  4F0H A;  5E0O A;  4HT7 A;  1NPK A;  3BZQ A;  5DG9 A;  2OEM A;  4FYV B;  2W8L A;  2DH8 A;  1N5V A;  3MMA B;  4DR7 F;  4PQA A;  1C0T B;  3LA0 A;  4I6W A;  4I2P A;  1FJE B;  4EU0 A;  1WF1 A;  2AEJ A;  1VR6 A;  4D3G A;  4YR3 A;  3R7S B;  4DV0 F;  1NJY A;  1NJW A;  2KYZ A;  2HUR A;  4RX6 A;  3AOC A;  3HSG A;  1RAH B;  1WSR A;  2NSB A;  3DLE A;  3IN5 A;  4QQB A;  2AX1 A;  4USM A;  3JXO A;  2CQD A;  1TTH B;  1P27 B;  2CDR B;  2FJD B;  2VKZ G;  1P8G A;  4RW7 A;  1FVS A;  2V2Q A;  4RW4 A;  4DPU A;  4O4G A;  3PX0 A;  1RWU A;  1JXE A;  1S79 A;  3THP A;  1UZH A;  2HQI A;  2XEX A;  4WBF A;  4CT8 A;  6AT1 B;  3K17 A;  2B5J A;  4HTJ A;  4NZ0 A;  2D3U A;  3RB3 A;  3ET6 B;  2VG7 A;  2Z2Z A;  3R2C J;  3GFY A;  1XMO J;  4IFV A;  1A7G E;  1WHV A;  1CBK A;  1NUE A;  2MJU A;  2VFV A;  4RNO A;  1RKI A;  2I8E A;  2C22 A;  3I32 A;  4X66 F;  3BBF A;  4DR5 J;  1NK7 A;  1CJV B;  3MR6 A;  1DBD A;  2IAJ B;  3QRQ A;  1BQN B;  1S9G B;  2GQQ A;  3DYA A;  4M5J A;  4DUZ F;  2BOP A;  1LQ9 A;  5H1S V;  3CVK A;  3CJS A;  3DRR B;  5HAO A;  1GH8 A;  4KC5 A;  4JI2 F;  2JLE A;  4NA1 A;  4O3R A;  4A8X A;  5B0B A;  3M1V B;  1U8S A;  4HEA 9;  4P7T A;  4HKQ A;  2CZV C;  1Y11 A;  2YQ0 A;  1EHW A;  3J7A 1;  4KGX B;  3V4I A;  3R7N B;  4NLO A;  4LBH A;  1PO6 A;  2OLW A;  2XMU A;  2XLK A;  2B6A A;  2B9Y A;  3N5F A;  2F9J A;  3C6U A;  3V6D B;  2PA8 D;  1TL5 A;  4C0O C;  4Q2L A;  3KMS A;  3VAJ A;  5ETT A;  2R7V A;  1FKO A;  3EGZ A;  1EIY B;  2CPI A;  5A2Q U;  5BR8 F;  4B9T A;  3NY0 A;  3DOL B;  5CD4 H;  4B3R F;  1GAO A;  3W64 A;  2VOO A;  4CO1 A;  2GNK A;  1UFK A;  2AJ1 A;  3H20 A;  2AHO B;  2V50 A;  3J80 Y;  3W3S A;  2ZH3 A;  4MK7 A;  4LSZ B;  3G96 A;  4NRU A;  3ENA A;  4CZC A;  1PC5 A;  5CHC B;  4ZPW R;  2D41 A;  1U0S A;  1GFW B;  3JSB A;  1NJZ A;  1E6V B;  4H4K C;  3TA2 A;  5KG4 A;  5AXK A;  1URN A;  1HQU B;  3QGG A;  1KON A;  1QUV A;  5G0R B;  4C11 B;  5CAA A;  2H5I B;  1LFW A;  3B82 A;  2H48 B;  3PYD A;  3QT6 A;  5IM0 A;  1FTR A;  2ALY B;  3CCZ A;  5KFA A;  2WSE C;  3KNA A;  3V6J A;  1N56 A;  3MMC B;  1REG X;  3BGL A;  2E1P A;  4TYA A;  4NLP A;  1REV A;  3TUJ C;  2V2K A;  3LAM A;  3HHL B;  1VQK S;  2C3P A;  2JC1 A;  1U1N A;  3BB5 A;  4DN9 A;  1WOS A;  4RNF A;  2HND B;  3NGD A;  3C19 A;  2DH7 A;  2FLL A;  2DNK A;  1NHU A;  4CO5 A;  4CLU A;  3PW2 A;  1FJ7 A;  5KFQ A;  1DQ8 A;  2B4O A;  2PC6 A;  3GON A;  1SUQ B;  4NLV A;  3Q23 A;  4OQJ A;  4DSI A;  5E3R A;  4Q0B A;  2G1H A;  5KFZ A;  1TUW A;  4J91 A;  1VYA A;  5GAG U;  1I5O B;  3DLH A;  3FGV A;  3GFZ A;  1TVR A;  5IS2 A;  4OX9 F;  2DNQ A;  4ZIV A;  4NLW A;  4M5H A;  5LMU J;  2YH1 A;  3B78 A;  2CPF A;  4ZDN A;  4ICL A;  2HAF A;  1RZM A;  5ITH A;  2XNQ A;  3BRE A;  1I3O B;  1TKZ B;  2BA9 A;  5HMX A;  5KFJ A;  3NLC A;  2FD2 A;  5EHH A;  1VI7 A;  3V81 A;  1RT6 A;  3QID A;  2M8H A;  4J5O A;  2YNF A;  2QMW A;  4ZVF A;  4CLK A;  3FEY B;  4RWX A;  5GAG I;  2W7O A;  1VQ4 S;  4WCE Q;  3AD8 C;  1M0S A;  4WII A;  1HWK A;  2XMK A;  3PTW A;  3PYE A;  4UUX A;  4CH0 S;  4JI8 J;  2GIQ A;  3GCW P;  2XYP B;  2PE8 A;  2DRD A;  2CRL A;  4CO2 A;  2JWN A;  3DU5 A;  3OL9 A;  2WBR A;  3CDA A;  5DDR C;  2FVP A;  4NXM J;  3X3U A;  4DXL A;  3BO2 A;  2XMA A;  3TAR A;  3M7V A;  2Z30 B;  4ETX A;  1N0V C;  3PY8 A;  2IIH A;  4KAI A;  2R2U A;  2GJI A;  1QSS A;  3RW6 A;  4H4M B;  1HMV A;  2AQ4 A;  2YKN B;  4B3S J;  1N36 F;  5DLF A;  1HFE L;  1WF0 A;  2CPJ A;  4OIX A;  5T41 A;  4K4S A;  1SH2 A;  2HBY B;  2X1G A;  2HLU A;  2HGL A;  2QIF A;  3V4I B;  1H2T Z;  1N88 A;  4C9D A;  1RT7 B;  2CPD A;  3ISN D;  4LSN B;  2GJF A;  3GV5 B;  3MMA A;  2Z57 B;  1U1K A;  3JQK A;  3KWM A;  1H2U X;  4RKU C;  1TAU A;  2MZT A;  2A0F B;  2BV3 A;  4PR6 A;  3HUL A;  4R5P A;  4H4O A;  1S0O A;  2HNY B;  5LSL A;  4USW A;  1HPZ A;  4H4M A;  3EXY A;  2DPJ A;  1JJH A;  5CD4 A;  3M8R A;  5J2P A;  1WOP A;  2B56 A;  4WKR A;  4L6V 3;  1HNW J;  2KB2 A;  2EC2 A;  1JLE B;  2PEB A;  4OHX A;  3UN5 A;  1SKW A;  5J1E B;  4B9N A;  2WVF A;  3LP1 A;  2AIR B;  1GEH A;  5DJB A;  1JNR B;  1HBN B;  4TXS A;  3CCS S;  2MZJ A;  3M8P A;  3K57 A;  2QN6 B;  2FHK A;  5I4M A;  3NP5 A;  4OZ1 A;  2C2N A;  2ZJQ Q;  4A8Q A;  2E5I A;  1F9F A;  2L9N A;  1UL3 A;  5KG2 A;  4QIE A;  2FJW A;  1GMW D;  2LA6 A;  2V4J B;  1RWP B;  4QIW D;  3PW5 A;  4DR6 F;  3JS9 A;  4O3P A;  1FHT A;  2YWF A;  2UUA F;  2C3M A;  3ZZP A;  1Y7P A;  1R7I A;  3KLH B;  1S6Q B;  3GR1 A;  5KFF A;  4LSL B;  1FDA A;  4GVB A;  1YJR A;  1Q78 A;  2VPY B;  1JQG A;  2NPI A;  3D28 A;  4RUB A;  4ZVR B;  5IV4 A;  4ECU A;  4DS4 A;  1U6F A;  3GLJ A;  3IC1 A;  1YZ7 A;  4I6Y A;  3T1H F;  3RRG A;  2PMW A;  1TKX A;  5EN1 A;  4WP3 A;  4DX8 H;  5DDQ C;  1IKW A;  3N28 A;  1X5O A;  2DIV A;  3IM9 A;  4LBP A;  2VC1 A;  4O3S A;  1RAO A;  4LFB J;  2ZKT A;  5J2M B;  1WG4 A;  1U1O A;  2YKM A;  4Q7A A;  2NR0 A;  2ZH9 A;  1UET A;  1IBK J;  1S6P A;  2F8M A;  3HSZ A;  5L46 A;  2KH9 A;  2GMJ A;  1F6T A;  2UUA J;  4U95 A;  5KFG A;  1CPZ A;  1M5O C;  5L1L A;  4PZV A;  4NMX A;  4HYK A;  2AGQ A;  5KFN A;  3N01 A;  4DX5 A;  2CWK A;  3EE3 A;  2NXN A;  3ZXW A;  2BW2 A;  2QFJ A;  1KHW A;  5K14 A;  4DV5 F;  2K3I A;  3TI0 A;  1TK5 A;  1VC5 A;  1C1C B;  3P6Y C;  1NK4 A;  2CJX B;  1F9E B;  2RKI A;  4P73 A;  5DRK A;  5E5N A;  2VQE J;  1FDB A;  3MED B;  3TVZ A;  2QA4 S;  1S4E A;  2HFU A;  3C8Y A;  2E1A A;  3OXL A;  4PXB A;  5KFS A;  2VIC A;  2AJQ A;  5CYQ A;  5C25 B;  1LOU A;  5F9L A;  2QE5 A;  3NEK A;  4WJB A;  4DL5 A;  3MR3 A;  4IRK A;  1RAD B;  2OTJ S;  3L3C A;  1U02 A;  3PM9 A;  3KG4 A;  4AQY J;  4ZP9 A;  5E33 A;  3GJR B;  5SZT A;  3BJY A;  4DEZ A;  3I0S B;  4ILR A;  2GCF A;  1U47 A;  3T5H A;  3NGS A;  3QIP A;  1CUL A;  1VHF A;  3EVW A;  4IFY B;  1IKV A;  1L3S A;  4JV2 A;  3MM5 B;  4USH A;  5LOQ A;  3C46 A;  1JLE A;  1FT8 A;  5H9F J;  1VMB A;  2FC9 A;  1BQN A;  3C15 A;  4F4A A;  5CAB A;  4WZM A;  3Q22 A;  1HQE A;  1TL7 B;  3PXG a;  8AT1 B;  1YKW A;  1CS4 A;  4Y00 A;  2AGP A;  1UW4 A;  2DBB A;  1JJ2 R;  4LBI A;  3L4B C;  4NL5 A;  3U7J A;  5MAO A;  3UD3 P;  3C16 B;  1KQF B;  3A12 A;  3DU6 A;  4MFB A;  2G13 A;  2YQ1 A;  3QMQ A;  4XAK A;  3U1L A;  4X4O A;  3BO4 A;  4EZ6 A;  3KK1 A;  1NME B;  1G3O A;  3GYG A;  4W92 B;  1SKR A;  1NAQ A;  2VC0 A;  3AA9 A;  4PWU A;  1HYS B;  5DLG A;  2DD8 S;  1VQM S;  3OFF A;  2E5H A;  2YWE A;  2ZBC A;  3WZ0 A;  4AUK A;  4F3Q A;  3CCT A;  1WTF A;  2LXU A;  3NS7 B;  2CPZ A;  5HMW A;  3E8O A;  4WE1 A;  5F0U A;  2OPQ A;  5A8R B;  1GXT A;  1B4S A;  2R7X A;  4X4U A;  3I4P A;  4ZLP A;  1RT1 B;  4OHW A;  1XEZ A;  5ETS A;  4K0K J;  3Q24 A;  1S1U B;  2LXI A;  5LMN F;  2OIH A;  3H5S A;  3KUG A;  3AJ1 A;  4PXD A;  2IDL A;  1NSA A;  1UP1 A;  4EEY A;  1M1K T;  3QRR A;  1IKX A;  2B0G A;  3CCL S;  2C2R A;  3NG8 A;  4M5M A;  3TOQ A;  4AYB D;  4BHQ A;  4JV0 A;  1U4B A;  1MWQ A;  4FZV A;  5GAD U;  5JXS A;  1WKK A;  4IQX A;  4N41 A;  2UXD F;  4FXD A;  3CJ0 A;  4ELT A;  4KHP J;  4IOC Q;  1YJT A;  4A8W A;  3CJ4 A;  4Y2K A;  5IZH A;  3MPY A;  5F8I A;  3ZZU A;  3KLH A;  1FJG J;  2V8V A;  1FER A;  5KT5 A;  2N7C A;  1HD0 A;  4RW7 B;  3K5M A;  1HHT P;  2MJN A;  4MKB A;  4DV3 F;  1G6B A;  3TA1 A;  1N36 J;  4PCQ A;  1NH8 A;  1JNZ B;  1OSD A;  1PCA A;  2DO0 A;  1S1V A;  1H3D A;  3LP0 A;  3KMQ A;  4JI0 F;  3TVY A;  2E9R X;  2UXB J;  2MST A;  1NDP A;  3CED A;  3VQS A;  4IH5 A;  2CPH A;  2H4W B;  2HG4 A;  5HI7 A;  4MIB A;  2ASY A;  2C2Z B;  4DMZ A;  5BR8 J;  2JNJ A;  1RYS A;  3NAH A;  4OZ0 A;  2PN6 A;  2VIH A;  1N0U A;  3AJD A;  2WVD A;  1IR1 A;  2GA7 A;  4C0H A;  4CTA A;  4KIA A;  3RB6 A;  2ZZN A;  5D4O A;  1E6V A;  3HSD A;  4PYA A;  3CCJ S;  2IM3 A;  4M63 A;  3TA0 A;  1RU1 A;  1YJU A;  2GQC A;  5B0A A;  1HW9 A;  4JUZ A;  2G0I A;  2Y0S D;  2XYG B;  3GFX A;  3L95 X;  4IDK A;  3WIV A;  4ATN A;  2E9Z A;  4NI2 B;  4ILM A;  3PV8 A;  3AOA A;  4OJ1 A;  2ZHO A;  5D4N A;  4DDF A;  3DOL A;  1JWW A;  2QV6 A;  3NNC A;  2KN4 A;  3LPY A;  1R27 B;  5L1K A;  3MM6 A;  3UVJ A;  1S9E B;  3G8Q A;  3LP1 B;  2A6M A;  5HRO A;  4JV5 F;  4DQP A;  4OV6 A;  3DRR A;  5E3Q A;  2R7S A;  3JSY A;  2HHS A;  1S12 A;  1O5J A;  1T3O A;  1QE1 A;  1B0V A;  2ERR A;  2R7R A;  2F7V A;  4PRF A;  4MIA A;  3J7Y U;  3OLB A;  2JLF A;  2VF3 A;  3KLI B;  2ALZ A;  1XTZ A;  2MKY A;  1U48 A;  1Q5V A;  5IWA F;  1MRO A;  1U6B A;  2WSC C;  4YP3 A;  1ZBT A;  4MKA A;  2BQU A;  3AAW B;  2AW0 A;  3OJS A;  3N6M A;  1WOR A;  4C2M A;  5C2G A;  3Q8P B;  2HHU A;  1NB7 A;  2XGP A;  4KJI A;  2C1E B;  2NYI A;  2KXN B;  3IBC B;  3CO9 A;  1LW0 B;  1R3N A;  3I87 A;  2BYC A;  3BGO P;  3E01 B;  2YKN A;  4NLQ A;  3QT5 A;  3WIU A;  3BKF A;  4EBE A;  2XY5 A;  4NLX A;  5D4P A;  3RBD A;  3VV2 B;  5D0E A;  4L74 A;  2PD1 A;  4DL3 A;  2OPP A;  4NML A;  3ZFV A;  1YJN S;  4IO9 Q;  2IBK A;  2X3D A;  2IYG A;  2CUY A;  3MCO A;  5LM7 E;  1D0E A;  1R0C B;  3QQC D;  4C8M A;  1FRX A;  3LAL A;  3QAE A;  3SIP B;  2EC0 A;  1PC4 A;  3MEC B;  1ZM2 A;  1F60 B;  3VCD A;  1MLA A;  5F8M A;  3I82 A;  3M30 A;  4ZA1 A;  3BR8 A;  4DL7 A;  1J5E F;  3M2R B;  3J81 U;  3RBE A;  3TRG A;  1AB8 A;  4MMO A;  3LWM A;  4IG0 B;  3TUI C;  1NEE A;  3KJV A;  3V6K A;  1NPR A;  1LXJ A;  2CQ3 A;  5HMY A;  2YKA A;  1X5P A;  3H59 A;  2DNN A;  4UF4 A;  5E7O B;  2PMZ D;  2LYV A;  2RKI B;  1ACM B;  3MTK A;  2C3O A;  1IR0 A;  1RWN B;  4RL1 A;  3BDP A;  4GKJ F;  1F2G A;  1G4C A;  1TKZ A;  1OS5 A;  2CZ4 A;  2WVE A;  2KVI A;  3HHL D;  4QU7 A;  2JH3 A;  2V94 A;  2BJ9 A;  3IBF B;  1NDK A;  2BE9 B;  2VU5 A;  3W2V B;  2ROP A;  5KT2 A;  3GIK A;  3MPU B;  2EFV A;  2W9C B;  1RLC L;  3EUN A;  3FC9 A;  9ATC B;  4RUA A;  1RWO B;  1VBX A;  2ROG A;  3CTR A;  2EG1 A;  2E44 A;  1M1G A;  3OFE A;  2RT3 A;  3HT0 A;  2J9D A;  3ZNU A;  4B3M F;  4GKK J;  2BM1 A;  1BXN A;  2BOA A;  2OSQ A;  3F56 A;  2YNI A;  3UCZ P;  1LK5 A;  2DGX A;  3GQC A;  3NOG A;  4NX9 A;  3CJK A;  3BM7 A;  2GHW A;  3BSO A;  3D6M B;  5HVG A;  2IC3 B;  2OEJ A;  4WYW A;  1I51 B;  3DDK A;  4UW2 A;  4F2S A;  4EI2 A;  2RE1 A;  2I6W A;  2DYA A;  3OFH A;  4CH1 A;  3QPI A;  3ZTR A;  2GO9 A;  3CUL A;  1VIO A;  4J90 A;  3VAL A;  1PIL A;  2VBX A;  1Z4U A;  2LQ9 A;  2CWX A;  4IDK B;  4ITS A;  4HLB A;  3T19 A;  3FBF A;  2E1C A;  7FD1 A;  3TYT A;  3JSM A;  1H74 A;  4B9U A;  2LXF A;  2DXE A;  3QLH B;  4HHU A;  4QR2 A;  1KOH A;  4LVN P;  1XMB A;  4KFB B;  2VFR A;  4B3M J;  5RUB A;  3EYZ A;  3ETM A;  2J5A A;  3FCW A;  3HZE A;  1WSV A;  3OSN A;  3BEG B;  3MCN A;  4AXJ A;  2BQ3 A;  1VQ8 S;  1EZZ B;  4MYT A;  1AUS L;  4M8L A;  2FIU A;  4TN2 A;  5K9F A;  1D9D A;  4RW8 B;  1T9T A;  3VQT A;  2FVQ A;  2WOM A;  3V2U C;  5DQH A;  1X4D A;  2NSC A;  3D6H B;  3ONQ A;  4WXW A;  3MEG A;  3TAM A;  4AL7 A;  4DR4 J;  3M8Q A;  2BMB A;  5F3Z A;  5HLF A;  4WK1 A;  2NZ4 A;  5C7P A;  1XK8 A;  4MIW A;  2L41 A;  1FRL A;  3EJM A;  4AND A;  1FJG F;  1U49 A;  2QT7 A;  2LDI A;  5C25 A;  1GMU A;  3HHD A;  5FII A;  5D15 A;  5HSP A;  4YQW A;  1PJ7 A;  5H9E J;  1RHQ B;  4LF8 F;  4OZ3 A;  1D1U A;  1BWE A;  4KH1 B;  3MM7 A;  2LLZ A;  4OX9 J;  4QU6 A;  1RIS A;  2IJR A;  2LQJ A;  1ZTT A;  3R3T A;  1CSJ A;  4BS2 A;  5F8G A;  3AB4 B;  3CMA S;  4C3K A;  3TZX A;  4I1T A;  2W9B B;  4KV8 B;  4A8F A;  1NZA A;  1CJT B;  4DX6 A;  3KLE B;  1TU0 B;  1R89 A;  4YHH F;  1KKH A;  1TMM A;  1OY9 A;  5EDW A;  2N82 B;  2MKI A;  4CLP A;  2I2Y A;  2C2E A;  2WON A;  5D3G A;  1VIS A;  3K8V A;  4GVB B;  5HAT A;  2BBE A;  3MD1 A;  3PR4 A;  3IXQ A;  4FXW A;  4NLT A;  2MQL A;  1K1Q A;  4QJV A;  2ZH1 A;  1TL7 A;  2R8K A;  2PFF B;  2J9C A;  3UN3 A;  1F2H A;  3PHT A;  1YJ9 S;  4Q5V A;  2K7K A;  2YNG A;  1YBU A;  2QL5 B;  2ZDO A;  2QA4 G;  2ZKU A;  3LGH A;  4ZMM A;  1TKD A;  1H7W A;  2CAD A;  2F8H A;  3VGS A;  1FEH A;  1ZAX A;  1WJ9 A;  4DR1 F;  5JMN A;  1RTZ A;  1S10 A;  1V6H A;  1SV5 B;  5CCL A;  1X4G A;  2XLI A;  5GMK a;  4AQY F;  2OTL S;  3BBC A;  5DG7 A;  1OPI A;  1S0V A;  4J9Q A;  2UVW A;  3QSY B;  3IRX B;  3TZW A;  4OYP A;  2YXL A;  5J1N A;  5HK4 A;  4K2X A;  1KVK A;  2ILY A;  1RT1 A;  4KGV B;  1FNX H;  1RHR B;  2CQP A;  3M32 B;  2J76 E;  1UJ6 A;  4HTI A;  1RBA A;  2V68 A;  4XDC A;  3W2W B;  1IWG A;  1VRU A;  4KR0 B;  1U24 A;  2Y0B B;  1FD2 A;  3HLU A;  3R6G B;  4E8U A;  4ED4 A;  3KK2 A;  2NQP A;  3T1A A;  4B9V A;  2RU9 A;  5KAK A;  2H5J B;  3HK2 A;  5E3P A;  5AJ3 F;  1VQ9 S;  1HWL A;  2Z2Y B;  3M2U B;  3CT9 A;  4FPR A;  2R8I A;  2RB7 A;  3OUY A;  3HVA A;  3HVW A;  4O3N A;  3V6H A;  4Q45 A;  1QD1 A;  4P9S A;  2UU9 F;  1QAI A;  4P6Q A;  1M5S A;  2GC8 A;  2DR5 A;  2K06 A;  2HPU A;  3H40 A;  4ENO A;  2OUG A;  2YNF B;  1UPM B;  3C6T A;  1CVJ A;  4OZL A;  2FYX A;  1S1W A;  4DPT A;  3DGV A;  3NMA A;  4W90 B;  1O0P A;  4CI0 B;  4EMD A;  2R9L A;  2UUC J;  4NEY A;  1UCN A;  2H65 B;  1DLO A;  5KFX A;  3ULH A;  1CLF A;  3KJF B;  1FDN A;  2L9D A;  2P6S A;  4GO5 X;  4X84 A;  4EUV A;  5DQI A;  1TVR B;  2V9K A;  4LRB A;  4QWA A;  4DUZ J;  4KRW A;  1S6Q A;  3RB0 A;  4G1I A;  4KY3 A;  1AFJ A;  4FVM A;  1NSP A;  3H25 A;  2BX6 A;  4O0I A;  5B0G A;  2J6T A;  5HRO B;  2DVI A;  2AWZ A;  4ES3 A;  3WC0 A;  2P9G A;  4I4B A;  3IM8 A;  1VQS A;  4J9L A;  3OR2 A;  3IFE A;  4G1P A;  3T1H J;  4USV A;  3MCM A;  3MUV P;  4P71 A;  4ZVG A;  2IA0 A;  2LEA A;  1URR A;  4LF2 A;  3BO3 A;  4C8N A;  3LO3 A;  2IRY A;  5IQ6 A;  2XBP A;  4FBT A;  1JLC A;  4ID5 B;  1MNE A;  2VOD A;  4QWB A;  4ED8 A;  2EK1 A;  4PQU B;  3NMR A;  2MSS A;  1ZM4 A;  2G9O A;  2XWX A;  1U25 A;  1MMD A;  3NBP A;  4CRJ A;  5GAE U;  3GG1 A;  2D3O 1;  5A76 A;  3QRP A;  1SUQ A;  4I69 A;  2VG6 B;  1RTH B;  3JTP A;  4LFA F;  1VQ6 S;  3BGU A;  3AA8 A;  2GQ2 A;  1RLD A;  1RBO B;  2H5E A;  3PRV A;  5KFR A;  5EWG A;  4ZS6 A;  2HFO A;  4Z7C A;  1U1L A;  4ANE A;  3PO5 A;  2WON B;  1QY7 A;  3N5B A;  2I9S A;  3CUN A;  3CDW A;  1ZH5 A;  2GVD A;  3LGM A;  4ECT A;  3OW2 R;  1X5T A;  2WAQ D;  3HHL C;  1NJX A;  1K47 A;  2VDI A;  4OJH A;  2MZR A;  4RUC A;  3J7A N;  1KD1 T;  5GAE I;  1FFS B;  4WP8 A;  3F73 A;  4CLZ A;  2HQ3 A;  2X1F A;  4C4W A;  3QO9 B;  2VPW B;  2A18 A;  2OI2 A;  1RTH A;  2CIM A;  4KSE B;  5EUH A;  2HNY A;  2KU7 A;  5ETK A;  3KXD A;  3SEO A;  3W61 A;  4N56 A;  3JSM B;  1KFD A;  2YH0 A;  2XG8 A;  5EX0 A;  2QO3 A;  4MH8 A;  7FDR A;  2HRU A;  3GPA A;  2XZW A;  1HR0 F;  1FE4 A;  2E5G A;  3MEC A;  3TNV A;  4K4U A;  4PAA A;  4ECS A;  3IR7 B;  2DNO A;  1A0O B;  2F5G A;  3R5J B;  1HBN A;  5CH7 B;  4C3L A;  1HBO A;  1Y5N B;  2V34 A;  2CNL B;  2AZ3 A;  2ZJR Q;  2ACM A;  4R0J A;  2XO6 A;  2F63 A;  2BJ3 A;  1KP6 A;  3NWR A;  2DY9 A;  4DSJ A;  1RE1 B;  1C2P A;  1SC6 A;  2HMI A;  3QSI A;  4X4V A;  1T7P A;  4PG6 A;  1N52 B;  1WTB A;  2UXC J;  2HHV A;  1XJW B;  3HXM A;  1FDD A;  4LT6 A;  2QRR A;  1JXV A;  1X4H A;  2KL8 A;  4M95 A;  3QFH A;  1R0A B;  3R9L A;  2MXY A;  3RRK A;  1RTI B;  2W01 A;  3TWZ A;  2MKS A;  2XMV A;  1JLQ A;  2QYC A;  2ZDP A;  1PYS B;  2QZ8 A;  3D7S B;  2OPR B;  2MZQ A;  1PYT A;  1XQI A;  2A3J A;  3K89 A;  4GO7 X;  5B0F A;  3J81 j;  4BDP A;  2EWH A;  1JMT A;  4U67 Q;  2L08 A;  1QE1 B;  1DUR A;  4C7Q A;  2I38 A;  1WKJ A;  4DBQ A;  2BE7 D;  5KTQ A;  4NLD A;  2Z2M A;  3MFH A;  2Q43 A;  3C2P A;  1GQE A;  3FCV A;  2XC9 A;  4K2J A;  5KOW A;  4B3T J;  4QPT A;  4ECY A;  1SJ3 P;  2G2O A;  4F7V A;  4ED3 A;  4V19 J;  4X4P A;  1FA0 A;  5IT4 A;  3MGJ A;  2GS8 A;  2IRU A;  1JIH A;  2ZNY A;  3RBX A;  1DTT A;  5L8R C;  3J81 Y;  1S7H A;  4BLG A;  1TK8 A;  2COL A;  3KLI A;  2XZD B;  4V19 X;  1SCJ B;  2ASJ A;  2B8Q A;  2HZV A;  5BYR A;  2ZC3 A;  5ETP A;  2FJA B;  2CJK A;  4YS2 A;  2XHC A;  2W4D A;  3R5B A;  2DCL A;  3C15 B;  2K7J A;  1IJE B;  1SH3 A;  1H72 C;  5KFL A;  1J2V A;  1NK9 A;  3ZZT A;  3NS6 A;  1VGY A;  3CJ5 A;  3C66 A;  2GFF A;  2RIJ A;  3MEG B;  4ZVE A;  2ZWP A;  2HLT A;  3IAM 9;  3TAM B;  3TQE A;  3ET6 A;  2R2R A;  2W2M P;  4IO1 A;  2MQQ A;  3PEJ A;  2HS3 A;  2F1F A;  3RTV A;  3LOU A;  3D3C J;  4LF7 J;  4DR4 F;  2DR9 A;  3ZZZ A;  1S6U A;  2QFI A;  1KLM B;  4P2X A;  2UU9 J;  2QMX A;  2ZIT A;  4W4M A;  3ZTS A;  5DDP C;  1WNE A;  4ZKA A;  2MGZ B;  4KFB A;  4FBU A;  1BWV A;  4ZLJ A;  3PKM A;  2MB0 B;  1F5C A;  2EPI A;  3A3P B;  5LT5 A;  4CH7 A;  2ASD A;  1G1X A;  2DNY A;  5KG3 A;  4MTP A;  2MZS A;  1UVM A;  3M6W A;  2MKH A;  1IKW B;  1RAB B;  1N33 J;  4JI3 J;  3W5X A;  3K2Y A;  3TJ8 A;  3ELH A;  2EFG A;  4B02 A;  3DCA A;  4LF5 J;  2M3D A;  5D0H A;  1X4C A;  4CLW A;  1I6J A;  1WAC A;  1YZ6 A;  3QFW A;  1FXL A;  2CZ9 A;  3BPS P;  4A48 A;  3M2V A;  5IM0 B;  1WHW A;  3Q8Y A;  4M5K A;  2RQC A;  2R7O A;  5FDL B;  5KT3 A;  2CDQ A;  1WEL A;  2DNH A;  2G2Z A;  4E0D A;  4JI4 J;  2CQG A;  4I64 A;  4ZP6 A;  4GC7 A;  1ZTW A;  1N8R T;  3R7B B;  1XR6 A;  4P52 A;  2FHO B;  2RF2 B;  4WFY A;  4ECV A;  4USU A;  3EZU A;  1QAX A;  1QTM A;  1HNI A;  3EM1 A;  3BH7 B;  3EIC A;  4ALZ A;  3KHH A;  5DQG A;  4J9S A;  2R7Q A;  1YX2 A;  4NCG B;  4KKO B;  2I1R A;  2HBQ B;  2HNZ A;  1B7Y B;  4XIU A;  3NKY A;  3RAX A;  5H9F K;  1PAU B;  1NDC A;  5HN0 A;  2P6T A;  4O3Q A;  3W7B A;  1MML A;  4X4T A;  1BLU A;  3DHW C;  2G0C A;  2ZBQ A;  4AL5 A;  1RT4 A;  3NRB A;  5M2R A;  3O44 A;  4HDH A;  2B9E A;  3ITH A;  1NXI A;  4F3O A;  1BQX A;  5KFO A;  3M2V B;  3QIP B;  3ZTP A;  4Y2C A;  1YK9 A;  1OYE A;  4WP9 A;  5I3U A;  1VC0 A;  2OPS A;  2DHH A;  3M8Q B;  1WDT A;  1N54 B;  2W8K A;  2IVM A;  2JVR A;  5DZ7 A;  1R8H A;  4OI2 A;  3KKF A;  1TZ0 A;  5IT9 Y;  1RTD B;  3EDR B;  3D4J A;  4JI6 F;  1LW2 B;  2XWY A;  1D9A A;  3EGN A;  4RW4 B;  2OGU A;  5AXL A;  5CZX A;  1WC3 A;  2QYG A;  2UUT A;  4ZK7 M;  4EBC A;  2KXH A;  3W2W A;  4MAK A;  5LSR A;  4BWM A;  4PEO A;  2CQH A;  3NCR A;  1Y3K A;  1BY9 A;  3AB2 B;  3JQM A;  2Q6C A;  1RCO B;  1NLK L;  3MAH A;  4KPY A;  2M88 A;  2LEB A;  1LWE A;  2JL9 A;  3I5C A;  2JDJ A;  4FF1 A;  3M05 A;  2CPE A;  1HYS A;  1CJT A;  4IQM A;  1JX4 A;  2KG0 A;  1HKA A;  4K4W A;  1RT7 A;  1UFW A;  4LSN A;  4Q44 A;  4IG3 A;  3DLB A;  5J2Q B;  2J7K A;  1VBZ A;  1IXK A;  3P4U B;  3I55 S;  2GML A;  3ZZO A;  3RB4 A;  4F04 B;  1AYE A;  1RT4 B;  2HEK A;  2PGC A;  4OI4 A;  4RW9 B;  2R7U A;  1S1U A;  1SC3 B;  2XSF A;  3H90 A;  1BD6 A;  4Z2X A;  2RUS A;  3QJP A;  2ZVI A;  3A8E A;  4ZVU B;  2M7S A;  4ZCL A;  3BSA A;  1Y0H A;  2D1C A;  5LL6 d;  3TZZ A;  4IUF A;  3EX7 B;  2RRA A;  2E1M C;  2EG2 A;  2V2V A;  3G82 A;  4I2Q A;  2IBO A;  4E2F B;  2E5L J;  4RW6 A;  2A2C A;  2BE2 A;  2DNZ A;  1HL6 A;  1X0F A;  4K4Z A;  3CJ2 A;  3MWB A;  1CQM A;  4N47 A;  3DRS B;  4DQR A;  5DO2 A;  4ZVS B;  4FYX B;  3UDL A;  1T95 A;  4F3M A;  3TR5 A;  4LF4 F;  4JV5 J;  4MYU A;  2C3Y A;  1EAR A;  3CSK A;  5G4D A;  1LWF B;  1FRM A;  2AV5 A;  3CO0 P;  3DM2 A;  3BH6 B;  4C3M A;  3HPO A;  2R2T A;  4LFC J;  4K50 A;  4U8V A;  2MQO A;  2HHW A;  4JI5 F;  4DX7 A;  3I4H X;  1KTQ A;  3GTY X;  2ZM6 F;  4K4Y A;  1HMV B;  4CM2 A;  2AD9 A;  3LTO A;  2GHV C;  2DGQ A;  3OTO F;  3HHN B;  3CD5 A;  2WB4 A;  3IS9 B;  2HWI A;  1FX4 A;  4LRC A;  2CYY A;  2NLW A;  4NYZ A;  3H5Y A;  2VKR A;  1UVJ A;  4FYY B;  3BGF A;  1ZM3 A;  2KKH A;  5KOX A;  1HI0 P;  1IQT A;  2IM2 A;  2UV8 A;  4DR3 F;  2YNH B;  1N5S A;  3LP2 B;  4ZJO A;  1KQK A;  4PG5 A;  4BBY A;  1YWX A;  1HQU A;  4H4K A;  1T03 A;  3IR5 B;  1X4E A;  3A8K A;  1M5P C;  4Q8E A;  5IQQ A;  1NCL A;  1Q8L A;  3LAK A;  3W5Z A;  3CD0 A;  3KLF A;  4F4Y A;  3SYZ A;  1UMJ A;  3N4W A;  1RDR A;  4FYW B;  2QTW A;  4ZLL A;  5K20 B;  2IPO B;  3T5L A;  1S1X A;  4OYW A;  1LWF A;  4D3H A;  5A0Y B;  4PPZ A;  4ES2 A;  3OVA A;  4F26 A;  2V8G A;  3T9N A;  4DR7 J;  1FNM A;  1KQS R;  2VB6 A;  1B3T A;  2J0S D;  3H7H B;  4RNM A;  3FCH A;  3AXK A;  1T9V A;  4DV6 J;  1W26 A;  5A8W A;  1G7C B;  4DCJ B;  2BUN A;  1UWA A;  2PA3 A;  3MUT P;  3FKB A;  1LNQ A;  1X9M A;  1I1G A;  4B3O A;  1RQ0 A;  1A6L A;  1HPZ B;  3MUR P;  1S97 A;  2XS2 A;  2XS5 A;  1PYO B;  3DXB A;  4I67 A;  2HZC A;  3DDN A;  3UDE A;  3PYG A;  3R5G A;  5BYS A;  4FP9 A;  3FFI A;  1MW7 A;  1U2C A;  3GIR A;  1LXN A;  2JX2 A;  4HR2 A;  2MLX A;  1N6Q A;  2H9Z A;  2DXD A;  3LW5 C;  3M8P B;  3I5A A;  2V67 A;  1FD8 A;  1SBR A;  3ZTO A;  2WOM B;  3HFK A;  1FXD A;  4OX7 A;  2MPU A;  1C1B B;  1XR5 A;  3JSR A;  2WW8 A;  4A46 A;  3OSP A;  3CIM A;  3OL7 A;  4DV1 F;  2LCW A;  3QAT A;  2BKP A;  3HKW A;  2D9P A;  2RRB A;  2OH2 A;  1KDN A;  4QZV B;  1F0X A;  4U6P A;  3QJL A;  1N48 A;  1EJ7 L;  4JI4 F;  4UZB A;  2V63 A;  2KFZ A;  2BM0 A;  2EBE A;  2X7I A;  1X9W A;  1F9H A;  3PIP Q;  2OFH X;  3GV8 B;  4ED2 A;  4F8R A;  1JLQ B;  2BJ7 A;  4EFA C;  3H42 A;  1E6Y B;  2Q1L A;  2XS7 A;  1PJ6 A;  2HS0 A;  2CNO B;  2NXJ A;  4DR3 J;  5HJX A;  3TUP A;  3S6E A;  3T6J A;  4MFB B;  1IKX B;  2JJ4 D;  3N9U C;  5F9N A;  4RNN A;  3F44 A;  2YTC A;  4X4R A;  3CJK B;  1Y5L B;  3HDS A;  3R97 A;  3BV8 A;  4DV7 F;  4QCL A;  3TJA A;  5AXM A;  3TAN A;  2F3J A;  1X60 A;  3VVU A;  4A8O A;  4J9K A;  3E2E A;  1TL1 A;  3SMZ A;  1H0H B;  3G8S A;  1LV5 A;  2F4F A;  4FF3 A;  1N33 F;  1FCA A;  1KEK A;  2KFN A;  2IMO A;  4OZ2 A;  3JAM U;  2KT3 A;  2ZOG A;  6FDR A;  1PAE X;  2FTR A;  2V5H G;  3RAM A;  3MR2 A;  3VAK A;  3T1Y F;  4TNO A;  3CME S;  3G9C A;  3HJF A;  5KFP A;  3WC2 A;  3LPE A;  2QA2 A;  3A8J A;  4DQI A;  1SJF A;  3VZI A;  1YRU A;  5BYQ A;  3OLA A;  1XNQ F;  4ED6 A;  3B4M A;  1C4C A;  4Q0B B;  3IG1 A;  4O0N A;  1DTQ B;  1HWU A;  1S9G A;  2KRB A;  3DYA B;  1HQE B;  2YPY A;  1F3V A;  3EMT A;  3X1L B;  2W2Q P;  3SXL A;  4DQQ A;  2CKW A;  4DL2 A;  1RT6 B;  4Y0F A;  5DM7 Q;  2AYB A;  3D1O A;  2IVF B;  1N5Y A;  4OZJ A;  1VQN S;  1RKJ A;  3GSD A;  1FKP A;  1FF2 A;  4PWW A;  4J9P A;  5ETO A;  3I0S A;  3PJ9 A;  3LP0 B;  1HWJ A;  2QGF B;  3MOZ A;  3SQO P;  4CYU A;  3SQG A;  4QYZ K;  4NLU A;  2HHP A;  3CPW R;  1HBU B;  3FQK A;  1IKY B;  2YVS A;  3BDE A;  2FDN A;  1CG2 A;  4A8K A;  1NO8 A;  4CTA B;  4OYX A;  2V2Z A;  3CCQ S;  1XMQ J;  5KG1 A;  1D8Y A;  2VL1 A;  1JKH A;  1CJU B;  5HLF B;  2WCX A;  1U1P A;  3CC7 S;  2AJF E;  1IJF B;  5D4L A;  5HMZ A;  4FF2 A;  2QA1 A;  1QVF R;  5HBM B;  1FVQ A;  4AD6 A;  3UCG A;  1MRO B;  2KM8 B;  1AZS B;  1C0U A;  2ZHA A;  3LQV A;  3RG6 A;  2RS2 A;  5M2P A;  3OHA A;  1N32 F;  4Y6I A;  4DJB A;  3QWP A;  3D0H E;  1T94 A;  3IO1 A;  1RBL A;  1DQ9 A;  2WW4 A;  3LAN A;  4KBI A;  4CNY A;  4DUT A;  1YBA A;  2B4U A;  2U2F A;  3BS9 A;  3PRD A;  4KGM A;  2YY3 A;  4M5D A;  1FE0 A;  4U9R A;  4R5P B;  5HO4 A;  2MTL A;  3BSN A;  3PIO Q;  2OEL A;  3KLG A;  5AE1 A;  4UST A;  4QOT A;  1AXQ A;  3C14 B;  2O67 A;  2P2C B;  3O8W A;  1REV B;  4Y28 C;  2XMW A;  3AOB A;  2R3V A;  2RDJ A;  1KFS A;  2CVI A;  5F8N A;  1YQH A;  2KRR A;  4JBC A;  1KN6 A;  3B54 A;  4XDD A;  1WUU A;  3SCL E;  5C2C A;  4OHY A;  2GJ2 A;  2VFS A;  1TL1 B;  2X3G A;  1FFG B;  3L7U A;  3KHG A;  2HVH A;  4KE5 A;  3UD5 A;  2K1R B;  2PMH A;  5HQM A;  2R42 A;  3MM8 A;  1F1B B;  3EWG A;  4DF4 A;  1VJW A;  2RJZ A;  2VZ9 A;  3DLL Q;  1FES A;  3CWJ A;  3P3D A;  3QGI A;  3VWS A;  2OAU A;  3UQS A;  3IRW P;  4DLE A;  1HA1 A;  2IRX A;  4MKV A;  4ZCK A;  2FVR A;  1RHM B;  4IG3 B;  2IMW P;  2WVC A;  4AE5 A;  2FLN A;  2HVE A;  1FFW B;  2QL9 B;  3A13 A;  4J7C A;  4CLS A;  4HT5 A;  1Y9O A;  2X51 A;  5IOL A;  4DL0 C;  1JLG B;  2M9K A;  3PEH A;  4LF7 F;  1MU2 B;  1S49 A;  2O66 A;  2V4R A;  2IM1 A;  4NCA A;  3O3L A;  2VA2 A;  1S48 A;  3ILI A;  3AH6 A;  4JI8 F;  5CA5 A;  5L38 A;  3M9M B;  1T05 B;  4GKK F;  1OWX A;  3DLG A;  3T6B A;  4Z7Y A;  3MOJ B;  2K3K A;  3AXM A;  4X4Q A;  4ZVQ B;  3FNN A;  5JVG Q;  1GT8 A;  3FZB A;  1VHI A;  1OJ4 A;  1RA7 A;  2EK6 A;  4RPF A;  3HVR A;  2A10 A;  1SQE A;  1NK0 A;  1S0M A;  2OD4 A;  4G6V B;  1YIJ S;  1Z2Z A;  2VFU A;  3FMB A;  4G1Q B;  4GMK A;  4DFP A;  3CCW A;  5A2Q Y;  3PFE A;  3EVO A;  5KFB A;  3R5A A;  2LFV A;  2IC3 A;  3AOD A;  2RRN A;  3PVX A;  2DGW A;  1D3W A;  3UW1 A;  3NS5 A;  4UQG A;  4DSL A;  4LQ3 A;  3ADA C;  1S1W B;  3IBW A;  4DS5 A;  3EDQ B;  4TY9 A;  5F8H A;  3JAM Y;  4JI1 F;  4KTQ A;  3J7Y I;  2AX0 A;  1FXR A;  4JI7 J;  1APS A;  2DHX A;  4TY8 B;  4NEZ A;  4FVC A;  4H4O B;  4EYI B;  2BW7 A;  1Q8I A;  2LA4 A;  3G6V A;  2F8E X;  3CCE S;  1RWV B;  2HKE A;  1Q79 A;  3A1Y G;  4WFB Q;  5C24 A;  4WTO B;  4FNI A;  3Q8V A;  1VC6 A;  3AQP A;  4R25 A;  2CNK B;  4USK A;  2D3Z A;  2POK A;  2IM0 A;  4NAS A;  3K0J A;  2R2S A;  2DGS A;  2DPI A;  2L9W A;  2XHW A;  1DHM A;  3DMJ B;  3ITH B;  3D5M A;  2W1B A;  4KHR A;  3W5Y A;  2DB1 A;  4TU8 A;  4DV3 J;  4EBD A;  4LFB F;  4U7U D;  2MHN A;  3ZO7 A;  1S57 A;  2BQR A;  4WZQ A;  3R8Y A;  3EPI A;  5HP1 A;  4TQR A;  2NS1 B;  4YN3 B;  4RZR A;  1IBL J;  4N8N A;  1H2V Z;  3PNI A;  4JYA F;  2DGV A;  4LF1 A;  2JSX A;  2YWK A;  4YHH J;  1HLW A;  1GXU A;  1WI8 A;  5K8N A;  1S1T A;  3SSR A;  4F4X A;  2GIR A;  1PGZ A;  1C0T A;  4DHV A;  3KK3 A;  2HQC A;  3I9Z A;  1BGX T;  3GU0 A;  3L7P A;  4FNH A;  2N4D A;  2EVZ A;  3OL8 A;  4QWE A;  2ZNZ A;  3WDO A;  4ED0 A;  3J80 U;  3BF4 A;  2FHJ A;  4NOH A;  2VQE F;  1D8Z A;  1SB6 A;  4FS2 A;  4DL6 A;  3ILJ A;  3HO1 A;  1X4A A;  3R1L A;  2KTQ A;  2Z4P A;  4B17 A;  4F0K A;  2VAS A;  1X31 C;  3IGN A;  4ZPC A;  5M2U A;  4J9N A;  3R27 A;  5J2M A;  2UXC F;  3MEE A;  3G6E S;  2JFK A;  3M8Z A;  2RQ4 A;  3GYN A;  1RHU B;  1WEX A;  2K8G A;  1KR4 A;  1N5T A;  3PAC A;  3RR8 A;  4KQZ A;  3S1T A;  4PXC A;  4NA2 A;  4WPA A;  1N5Q A;  1RHK B;  1R31 A;  3KLE A;  4P75 A;  4DUY F;  1S6O A;  2Y1R I;  2ZD1 B;  4AL6 A;  5CXT A;  3GB0 A;  4EZ9 A;  3FSI A;  1KBR A;  1IBK F;  3IS9 A;  4NZ7 A;  5BJR A;  3CXC R;  1T11 A;  3A3N B;  1BMQ B;  2AF6 A;  2YWG A;  3P45 B;  4DPX A;  3SI8 A;  4DPO A;  4FDF A;  1T02 A;  2YX4 A;  1IQZ A;  1EKR A;  1J5O A;  4LR9 A;  5CCM A;  2GAH C;  1UEK A;  4YB5 A;  4UOF A;  3N0V A;  2HWH A;  4ZP7 A;  3Q83 A;  1HBM A;  4KB7 A;  3UDC A;  5DG8 A;  2ZUG A;  3NGT A;  3H4B A;  2DEJ A;  2FB0 A;  3DOM A;  3SV3 A;  4K5S A;  1WG5 A;  1FRI A;  1U0H A;  3G71 S;  4DQS A;  3UPF A;  3H8Y A;  2JEG A;  3LF0 A;  4K5R A;  3K5P A;  3VAG A;  2M8D B;  3HM9 A;  2Y8Y A;  5DZ6 A;  4P2M A;  2AYE A;  3DDI A;  4Y3C A;  1L3V A;  4Y65 A;  2PT0 A;  2W24 A;  3PHE A;  3RBZ A;  4LF6 F;  1UVN A;  5T7L B;  3KJN B;  3P5B P;  2V9W A;  3O6Q A;  4EGL A;  4YME A;  3D0I E;  3TAQ A;  2G1D A;  1DQA A;  1EB0 A;  1TKT B;  2W4P A;  2DTJ A;  2YKO A;  4LFA J;  3M6V A;  3TZY A;  2DR7 A;  3SDE A;  1FRJ A;  2BJE A;  6FD1 A;  1UTA A;  4IR9 A;  3H2U B;  4QW8 A;  3CJ8 A;  2MLY A;  1OY6 A;  1IR2 A;  2FUG 9;  4YY3 F;  1TUV A;  4I7F A;  2DEI A;  3TUZ C;  3RR7 A;  2HFS A;  2QL7 B;  1VRT A;  3P96 A;  1RT5 B;  2D3O R;  1WC5 A;  4RW6 B;  4W98 A;  3R6L B;  4OI6 A;  1KTV A;  2BAB A;  3HVT B;  1NRK A;  4KGZ B;  4ECX A;  3GJT B;  1LK7 A;  1TV6 A;  4U8Y A;  4K59 A;  1YJ7 A;  2DH9 A;  2HZA A;  2OPQ B;  1VS3 A;  1S59 A;  4HHJ A;  5HVF A;  3DM2 B;  4PPD A;  4ZPT R;  2W9C A;  1FI4 A;  1HBO B;  4ZVH A;  2HS4 A;  1I94 F;  3PX6 A;  4JI2 J;  2P5V A;  9RUB A;  2HK2 A;  4YB6 A;  1SV5 A;  3FMW A;  5LJ5 Y;  4X65 F;  5DM6 Q;  1HNI B;  3OTE A;  5KT4 A;  4DFK A;  2Y1I A;  2FJV A;  4A4J A;  4QIG A;  4DFJ A;  5ETM A;  3IMQ J;  4B3T F;  3O5T B;  2HVI A;  1MWY A;  2MQM A;  1V5V A;  2XMJ A;  2Q66 A;  1KOO A;  1WF2 A;  1HNZ F;  3GJQ B;  2FZC B;  2HVD A;  3CF5 Q;  1GNK A;  1HWI A;  2LQB A;  3MD3 A;  1Q0N A;  2ACY A;  3QT8 A;  5KFU A;  3MUM P;  5THW A;  1XR7 A;  1TL4 A;  3B4D A;  3LP2 A;  3BN7 A;  4RO0 A;  4XTT A;  3UFC X;  4ED1 A;  1JLF B;  3KYL A;  1VRT B;  1L3T A;  1H73 A;  3AQO A;  1R6Y A;  3FVY A;  3KG0 A;  2UV8 G;  4ID8 A;  2CQI A;  4CLL A;  1VJQ A;  4N5S A;  2XUL A;  2W9A A;  2CQ4 A;  1T3N A;  2J7W A;  2OPS B;  5AE2 A;  3I56 S;  3UWT A;  1IVZ A;  4BC7 A;  2MY7 A;  1VRQ C;  3MEE B;  2QLF B;  4R8U B;  3H4D A;  4JV1 A;  3HFZ B;  3S01 A;  3W1Y C;  3UN2 A;  4OZ5 A;  1CS4 B;  2IFX A;  5F41 A;  3K5N A;  3M32 A;  4PUO B;  2YX1 A;  4WU3 A;  1HQ2 A;  2AP6 A;  2GHP A;  1JJC B;  3NBP B;  2Z2L A;  2IJF A;  3AHP A;  1UWB B;  2VG5 B;  3PKY A;  3FBC A;  3VF0 B;  1NKE A;  4KKO A;  1P9Y A;  4M94 A;  3IWN C;  4C97 A;  3CW2 C;  4PKD B;  4DN0 A;  4YEA A;  1EQ0 A;  4MJK A;  2D74 B;  3R5C A;  3FFI B;  4PG7 A;  3WQP A;  3D3B J;  1HW8 A;  3MM7 B;  2MHE A;  3CDB A;  3RZA A;  1XMQ F;  3K58 A;  4DSK A;  2CG4 A;  4UY8 5;  5E41 A;  1RGV A;  1YBT A;  2ROE A;  4X64 F;  2ZE2 B;  4K4T A;  1K1S A;  4ZPV R;  2HGN A;  4HAC A;  1RTJ A;  2HSE B;  5D0G A;  3N6L A;  2KHC A;  4P7V A;  3UI3 A;  1C1C A;  4OV1 A;  4PAB A;  4ZVT B;  1XC9 A;  2HQG A;  2YX7 A;  5HQ8 A;  2FQQ B;  5HBM A;  3MM6 B;  3UVJ B;  3IWX A;  1N32 J;  5A6P A;  1TFW A;  3DRS A;  4OHZ A;  4I0W A;  2FPH X;  2YBV A;  1TK0 A;  1XNR J;  1AUD A;  3N6N A;  4X62 J;  4ZHR A;  1RUS A;  3FEZ A;  3GSI A;  5GVQ A;  2XSJ A;  1S99 A;  4DPW A;  1U26 A;  2GVZ B;  2QG9 B;  2V0N A;  4PG8 A;  4OI1 A;  4BC9 A;  5KG7 A;  2V4Q A;  3G6X A;  1OIA A;  4WK3 A;  3PW4 A;  1WEZ A;  4IG0 A;  3KJV B;  3QJJ A;  2GV1 A;  2MMY A;  3EVM A;  2JZ5 A;  3VAI A;  1Z2L A;  3L7O A;  2LKZ A;  3MM5 A;  1KVI A;  1FJC A;  5ETL A;  5I42 B;  2CJB A;  1Y10 A;  5IT9 U;  1O8B A;  3MI7 X;  2FC8 A;  3DHX A;  1T0T V;  1D09 B;  2V8P A;  2DGT A;  4IRC A;  1EKS A;  1YRT A;  1JLC B;  4ID5 A;  5J2N A;  2PI5 A;  5C42 B;  2AJ0 A;  5KG6 A;  1QSL A;  1LWC A;  1FKO B;  1RI7 A;  4O23 A;  3UR0 A;  4DG1 B;  2P9C A;  4OYM A;  4Q2M A;  2EKN A;  4KPC A;  2NCK L;  3OV7 A;  3P49 B;  4TY8 A;  3RAQ A;  4YFU A;  4LUB A;  3M8Y A;  1EP4 A;  1TUG B;  2MYF A;  4X62 F;  3CJQ A;  1RAJ A;  5HAN A;  3AY0 A;  2ADC A;  2EFO A;  4ERD A;  2C28 A;  3QZ7 A;  1R8C A;  2WZ1 A;  4CIO A;  2Q79 A;  3KUH A;  4C48 A;  1IM6 A;  2W7A A;  2CQ2 A;  3D2W A;  2FHJ D;  1EQM A;  1Q81 T;  1X0P A;  2UZA A;  3G2X A;  3HF5 A;  3KHR A;  1NSK L;  3QYY A;  4IH6 A;  4USJ C;  2VDH A;  1KWM A;  2CJ9 A;  5HL7 Q;  2XM3 A;  3GII A;  1SL0 A;  5HVH A;  3TX8 A;  1QDU B;  2JVO A;  2XY7 A;  2JOQ A;  3CDU A;  5KFD A;  3A3O B;  3ILL A;  1R43 A;  1YIT S;  2QC3 A;  1EP4 B;  3BPD A;  2RQM A;  1KSP A;  5CYJ A;  2ZUA A;  4QWC A;  2HRY A;  4LF4 J;  3O1L A;  2RVJ A;  3T9Z A;  1MU2 A;  2J9D E;  4LF5 F;  2B51 A;  1LWC B;  5D3G B;  3KNG A;  1HIY A;  2CPX A;  4DV2 J;  5ETV A;  2M70 A;  1K0V A;  3W2V A;  3G86 A;  2ZHB A;  3NCQ A;  3MZI A;  5U47 A;  5EWF A;  2Y9H A;  3KUE A;  3Q0A A;  2YKP A;  2GGP A;  4L75 A;  2B4V A;  1B70 B;  1H7X A;  1RTJ B;  4FKX A;  2DK2 A;  1V3S A;  4NZ6 A;  4O3O A;  1RAG B;  1L3U A;  2AT1 B;  3D0G E;  3EZ5 A;  3M9O B;  1EX8 A;  3FRY A;  2Y8W A;  3MED A;  3SSQ A;  1AZS A;  1CQN A;  3PG9 A;  3VGU A;  1BQM B;  2JLG A;  1IBL F;  4C8O A;  4DZ6 A;  2NYH A;  4ECW A;  2HHQ A;  3K59 A;  2DIU A;  1MN7 A;  4WFZ A;  1HHS A;  1IM4 A;  4ZCI A;  3IAS 9;  3CCV S;  4YDX A;  3DN9 A;  2XMM A;  4Q43 A;  4NI2 A;  3V4M A;  1TMJ A;  5E3C A;  2EKY A;  4NLS A;  2HQF A;  2ZFH A;  1YDL A;  3AJ2 A;  3JTN A;  2DKO B;  5L9X A;  5J2P B;  1PBU A;  4M5I A;  3G4S S;  3VTI A;  1RJJ A;  1UFL A;  1SL1 A;  3GP9 A;  3IG1 B;  3OQ2 A;  4K4V A;  3EGW B;  5IC6 B;  2RU3 A;  1VCT A;  5D8H B;  1L3K A;  3DMJ A;  2OML A;  2LDY A;  2E7W A;  1HI1 A;  2RQK A;  3PJX A;  4WKY A;  1C1B A;  3ISN C;  2HYI B;  2ZD1 A;  4L72 B;  5AT1 B;  4AXI A;  3G6Y A;  1UPP A;  3UD4 P;  2JEJ A;  1DLO B;  2VH7 A;  4DWI A;  4HH1 A;  4LF8 J;  4GVL A;  1T9U A;  4DUY J;  2EEY A;  4LR7 A;  4V1A k;  1GMW A;  1NSQ A;  1S6P B;  3UDV A;  3U27 A;  4TU7 A;  4A8S A;  4F67 A;  4MT1 A;  5HP1 B;  1CJV A;  1NK5 A;  4DR6 J;  4O4R A;  2IY5 B;  1VK3 A;  3B8H A;  5L9N A;  2CG8 A;  2QSF A;  2ZM6 J;  3PZP A;  3GFH A;  4TKT A;  1Q1K A;  1UEV A;  2NXE A;  2HND A;  2LEP A;  4JI7 F;  2NUH A;  4WFX A;  1N34 J;  3C3L A;  1B64 A;  3CD7 A;  4K8R A;  2NPF A;  1Z1Z A;  4WFA Q;  1Y4Z B;  3CD6 S;  1YJV A;  4HDG A;  2ZZM A;  3N79 A;  3OBI A;  4F36 A;  3J7Z T;  5E3A A;  3MMB B;  2L3M A;  1UW9 A;  2EBG A;  2HGM A;  4LF9 J;  3JTO A;  2JRS A;  1TL3 B;  2R4F A;  2X1B A;  4M5N A;  5L39 A;  1Q7Y T;  3GYX B;  4ED7 A;  1S7I A;  8RUC A;  4QYZ J;  2HHT A;  2EI5 A;  3TO8 A;  1FX2 A;  3MXH P;  1KRP A;  1HBU A;  5LSO A;  1RHJ B;  1LW2 A;  3NAI A;  3M2R A;  1T8E A;  2KO1 A;  2OPR A;  3QGP A;  4KT0 C;  1HNX J;  1KHV A;  4DSE A;  2DHA A;  4I7F B;  1WC0 A;  1Y3J A;  4ZIT A;  1TP7 A;  4XO0 A;  2H1Y A;  1BUX A;  2HWT A;  2BAC A;  4CO4 A;  3DNC A;  4C8K A;  4MK8 A;  2NXU A;  2FJX A;  1YI2 S;  3OTD A;  1M90 T;  5IFM A;  2F4V F;  1WOO A;  3OXF A;  4C98 A;  2OKQ A;  2GZO A;  1J5O B;  4C8L A;  4TLR A;  2XMT A;  2LQ8 A;  3OR1 B;  4OLO A;  1PKU A;  5IV3 A;  2BAN B;  5KFM A;  1QTN B;  2XSJ B;  3FQL A;  1DAX A;  2A2D A;  3LH2 S;  4Y2A A;  3EZO A;  4YY3 J;  4OX8 A;  3NWG A;  1ZET A;  2FGO A;  1YVF A;  2B7C B;  3HI9 A;  2AYM A;  3WHI A;  5JUM A;  4RNH A;  2RS8 A;  4IFV B;  2VQF J;  2F65 A;  3AT1 B;  4CT9 A;  4RLE A;  4U7C A;  2XYH B;  3HD2 A;  3MMC A;  3NCP A;  4ECZ A;  2A6O A;  2I5J A;  3W66 A;  3SCI E;  3MPV A;  1PBA A;  4J9M A;  4QIV A;  4GRS A;  2JEI A;  1HBM B;  1GK8 A;  1IWA A;  1U2F A;  3M6U A;  3SDE B;  2XNR A;  4ED5 A;  3TAP A;  3MHY A;  1SJ4 P;  2QMU B;  3C6T B;  2DXF A;  2V8D A;  4LMZ A;  3OR1 A;  2IAJ A;  4CLT A;  2UXD J;  2K1R A;  2LMI A;  3MPW A;  5DET A;  1T05 A;  1PG5 B;  3DI6 A;  3KOA A;  2KVQ E;  1RA6 A;  1AA1 B;  2QJ3 A;  1ULR A;  4USI A;  5IWA J;  1HNV A;  2L48 A;  1CUL B;  3DRY A;  1NB2 A;  3KG1 A;  4IFY A;  4CP5 A;  3HSJ A;  4ZN3 A;  4XPC A;  2VHG A;  5F8J A;  4M1K A;  3CIZ A;  1Q4R A;  4G1Q A;  3EXC X;  1GMV A;  1FRK A;  4RBT A;  2H51 B;  4UUW A;  2KDO A;  4QYR A;  4DV4 F;  1EAY C;  2KZZ A;  3CCU S;  4DR2 F;  4M5D B;  3FUY A;  2FY1 A;  2ZBI A;  4QBU A;  4CO3 A;  1JLB B;  3TP2 A;  5F8L A;  2B6A B;  2MKK A;  2PI4 A;  2HW3 A;  2PSZ A;  1J27 A;  3H5U A;  4XPE A;  2XCP A;  3MFI A;  2M4M A;  3QO9 A;  1RB0 A;  2LVW A;  3I6P A;  2PO4 A;  3RYL A;  1RT2 B;  2XGQ A;  1ZS6 A;  2DIS A;  1VFJ A;  2XO7 A;  1HNX F;  3HD1 A;  3UNG C;  4UY8 T;  1WI6 A;  2X1A A;  3NOC A;  2RAQ A;  4OYA A;  5KFW A;  2PEH A;  5B0C A;  1UJ5 A;  1S0N A;  3Q2T C;  2G4B A;  1CC7 A;  4DV5 J;  5A0Y A;  2O3D A;  3G87 A;  1U1R A;  3IA0 A;  3DI6 B;  4DCO B;  2C2M B;  2ADB A;  1MWZ A;  1UJ4 A;  3KTQ A;  1U09 A;  2J6S A;  1RAE B;  2XY6 A;  4CQ1 A;  2ZJP Q;  2CQB A;  2C2D A;  3W9J A;  1UZD A;  1V3R A;  3PCO B;  4H54 A;  1XN9 A;  1S5Z A;  2HNZ B;  2NXC A;  1CC8 A;  4NPO A;  4K4X A;  2UUC F;  2RML A;  3KHL A;  3PRB A;  1ZA1 B;  5B0E A;  1TEL A;  2B4P A;  2RHS B;  3SCJ E;  3MAA A;  2IJN A;  3NXZ A;  1VDH A;  5KFC A;  1UVK A;  3BN4 A;  4LRE A;  3E51 A;  2LEC A;  4JI1 J;  4IR1 A;  5AE3 A;  3DXS X;  4OYB A;  4C11 A;  1OQ6 A;  2LQ5 A;  2QEX S;  1SI9 A;  3QGH A;  2ZH8 A;  1T9X A;  2VBZ A;  4C8Z A;  2DIT A;  2MGZ A;  5GME A;  1P9Q C;  2Z58 B;  3OTB A;  4O44 A;  3SQG B;  1RT5 A;  4K7Q A;  4AFF A;  1R8B A;  3U1M A;  4F2R A;  1J5E J;  1D9F A;  3D9B A;  2DRB A;  5B09 A;  4NLR A;  4RJV A;  5J2N B;  3VAH A;  3TQ1 A;  2DO4 A;  2AYG A;  2GIF A;  1E6Y A;  1Q95 G;  2D69 A;  3ETO A;  1JJ4 A;  1UVI A;  4PQU A;  1WDD A;  3DGP B;  3PW0 A;  1S1T B;  3HCX A;  1R0A A;  3MR7 A;  4X2B A;  2IHR 1;  1T9W A;  2W4C A;  3HZG A;  1SJR A;  5IC4 B;  5GAH I;  3FRZ A;  1NDL A;  1UAW A;  1KNZ A;  3MCS A;  4IH7 A;  3H5X A;  4ZPB A;  2CVE A;  4CLY A;  1CJK B;  2WHO A;  3DOK A;  3IWL A;  2JHE A;  3QLH A;  3DLE B;  3FSX A;  3VVT A;  4Y34 A;  1NKB A;  3GZ7 A;  1NPP A;  1FTC A;  1XMO F;  4P2F A;  3LUY A;  4OJG A;  3M30 B;  2KG1 A;  4DV1 J;  3HHE A;  2CJY B;  2NZC A;  1Q5Y A;  3JB9 k;  5DDO C;  4B3R J;  3H2L A;  3OFG A;  2FVC A;  4GC6 A;  4UZC A;  3MMJ A;  5KG0 A;  5EGY A;  1V5I B;  1FKP B;  5GAH U;  2MDA A;  3D6F B;  3ZZY A;  4X4N A;  4O44 B;  3GCX P;  1MG7 A;  3KLV A;  2FGC A;  3K7R A;  1U1Q A;  2B9X A;  2M52 A;  4WWS A;  2HFV A;  3HX9 A;  1RWM B;  2KZM A;  3THT A;  4LIR A;  2MLZ A;  3A8I A;  1IBM F;  1AT1 B;  3Q86 A;  3W63 A;  4DOZ A;  5H9E K;  4LIW A;  2PDA A;  3HHL A;  3MPD A;  3GIL A;  2VUG A;  1S9E A;  1S4F A;  5SUH A;  1W2B R;  1EET A;  4F02 A;  4B9M A;  2ASL A;  1NK6 A;  4HHH A;  1W7W A;  1JK9 B;  2OHD A;  2BEF A;  5KFH A;  2J9E A;  2Y1J A;  5KFI A;  2VV5 A;  3CE8 A;  3DKD A;  1ZPV A;  5KG5 A;  3J7Z 5;  3T1Y J;  3NNA A;  3BGR B;  1UEU A;  2YQ3 A;  3FZ2 A;  3IR6 B;  1DJ0 A;  1XER A;  1QSY A;  1K44 A;  2I0X A;  1LFP A;  1S77 D;  2LU2 A;  4L76 A;  1IKY A;  1S9F A;  4QPX A;  2FY8 A;  2VBW A;  2DNM A;  5T7L A;  3SBM A;  1H6K X;  1F5B A;  4CYU B;  3GWC A;  3OHB A;  4UOG A;  4DG1 A;  1OSC A;  4P2S A;  2ZH4 A;  3HT3 A;  2SXL A;  3KK3 B;  2R8H A;  4NXN J;  4ILL A;  1Y00 A;  1OY8 A;  1NHK L;  1XBW A;  4I2P B;  3JYT B;  2CQ1 A;  3I96 A;  1YSJ A; 
#chains in the Genus database with same CATH homology
 2P8I A;  2NYH A;  2PEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...