2NYHA

Crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
GMTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPMWSYQLAFTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative dioxygenase
publication title Crystal structure of putative Dioxygenase (YP_555069.1) from Burkholderia Xenovorans LB400 at 1.70 A resolution
rcsb
source organism Burkholderia xenovorans
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08883 DOPA_dioxygen Dopa 4,5-dioxygenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits DOPA-like domains 2nyhA00
2NYHA 2PEBA 2P8IA
chains in the Genus database with same CATH superfamily
2G2OA 1Q8LA 3VAFA 1HFEL 4OX6A 1N6QB 3AOAA 3W2VB 2O1PA 3BN7A 4GC6A 5F3TA 4LFAF 4H4OB 3I4PA 5CQGA 1N36F 3QT6A 1TKTA 4TY9A 4XAKA 3LP1B 3SDEA 3JQMA 4CTAA 1SPBP 5A2QY 1WC5A 3OFHA 1B99A 4JOUA 1VHFA 2FHJD 2GJFA 4NCGA 2VDHA 1QE1A 4CM0A 1LWCB 4U7UK 3W5YA 1UVNA 1AW0A 1FCAA 4H4MA 2MKKA 2IDEA 1RWKB 1HQ2A 2FGOA 4ZMMA 1U45A 3ENVA 4DX8H 3RRGA 3J7AN 4LSLA 3DLLQ 4ED2A 1OY8A 2ZUGA 5ETOA 3MAAB 2CNLB 3BSCA 5KT6A 3DU5A 3CJKA 4F2SA 1NPRA 4OFZA 5L1JA 1FDDA 1X5OA 2HS0A 1X5PA 1RAIB 3OFFA 2HLTA 1V5IB 2YNIA 3TZYA 3PKMA 5KG6A 1LEOA 4KGMA 4ANCA 5DG7A 2CPHA 4PWUA 1TP7A 1O6XA 3VZIA 2W9CB 3OSNA 1T7PA 2LEAA 1FK9A 5KFAA 1PGZA 2E44A 1QAJA 5KG5A 2DCLA 3BEGB 5E2QA 2J0SD 4X4RA 3BS9A 3CD0A 3N0VA 2CKWA 2LXIA 1O0PA 4K7QA 2YWFA 2KVQE 1X4AA 4JV0A 1KDNA 4DQIA 4URSA 4YDXA 4EO6A 3LTOA 4AQYJ 1VS3A 5J2QB 5E7OB 1KTVA 3A8EA 3UO0A 3PYFA 1A6LA 2MHEA 2V8VA 5IM0A 1WEZA 2B8QA 2VBXA 1X9SA 1N52B 4LFBJ 5GAGI 1CJUB 4CLTA 1JJHA 4KV8A 4D3HA 1HD1A 3CCRS 2QMUB 3O44A 3E51A 5JVGQ 3EXYA 4DCJB 3QGHA 3EPGA 4R8UB 5AT1B 2HGLA 2RQMA 4Y65A 2F9DA 2CQDA 3HF5A 3A8IA 1HKAA 4DXLA 4FVCA 3PDNA 4CH0S 1Q7LB 4OJHA 2XLIA 2W4DA 4G1PA 4OMFG 2FHOB 2GAHC 4P2XA 3HFKA 5F3ZA 3CSKA 2IVYA 2K2PA 2RS2A 3ZZUA 3D1HA 4HI1A 2CYYA 4CO0A 1WKJA 3I5AA 3CNQP 3QGGA 4F4ZA 2UXDF 4PG8A 1RSCA 2NZ4A 1YRXA 1MWYA 3EMTA 4QJVA 1Z4UA 3M9OB 3MEDA 4YR2A 2VA2A 4F4YA 5J2PB 3HULA 2YKQA 1VQSA 5LJ3Y 1Q78A 4KE5A 1HL6A 1NLKL 4XDDA 3BR8A 4RW7B 3GIMA 3I9ZA 1S1VA 2DH8A 2C28A 1K0VA 4PWDB 3H20A 4LSZB 3G6XA 3MM9A 4XIUA 1OQ6A 2GA7A 1S1XB 3C6TB 4LFCF 1NSQA 1AT1B 1ZZFA 3KLEA 4LVOP 3DM2A 2BJEA 5IOLA 2RAQA 4OZ5A 4R5PB 4AL7A 2YKMB 1WELA 1RTDB 1F3FA 1RB0A 4QPTA 1IBKF 3FKBA 5IT0A 2DGXA 2HGMA 3KUHA 2RSQA 4RJVA 2IMOA 4F02A 2DPIA 1XNQJ 3PTWA 1LW2A 2VJVA 2RDDA 3CMAS 2PMWA 2FJBB 4FNIA 4KSEB 1YJTA 1KVKA 3MR3A 3RRHA 4KR0B 3QGIA 4RNMA 5LMUJ 3IN5A 3BM7A 5HQLA 4J9MA 1Y3KA 1TV6B 5LMNJ 1JXVA 3AT1B 5JJBA 4ZPWR 2MZ1A 2GO8A 1Z2ZA 2V8GA 1M1HA 4CCHA 1RAHB 2H3EB 5HVFA 3P45B 4XTTA 2A6OA 1URRA 1YTYA 2KYXA 2LQ5A 2FB0A 4IOAQ 2XLJA 3HK2A 1TZ0A 2OPSB 4Q45A 3AA9A 5LXYA 3I32A 5IQQA 2Q1LA 2G0JA 3QWPA 4P10A 2UUBF 3EDRB 5DJBA 2V8PA 3AHPA 3BQ1A 5GMEA 2W1BA 3R6GB 1PJ6A 4V19X 1LK5A 5A8WA 2G13A 1MU2B 3GFHA 4DHVA 1CULB 4J37A 4JI5F 4OLOA 2AHOB 4ED4A 4RW4A 3DMJA 4YP3A 3W7BA 3TZWA 1D1UA 3QRRA 4W92B 4F4WA 4PG6A 3PW5A 2CPEA 3IS9A 2XY7A 2N4DA 4P2FA 4LUBA 2YQ0A 1IR2A 4L3KA 5EWGA 3AODA 2GS8A 1ROFA 2AJQA 5HLFB 2XYPB 4FF1A 2EFPA 1NH8A 3HFZB 4U8VA 4AL5A 4JI3F 1XMBA 4ED5A 5DQIA 3PJXA 1YG0A 1U7LA 1ZM3A 1L3KA 4B3SJ 1VK3A 4DV5J 1FHTA 3KHRA 5KT4A 1F9FA 3K17A 4ZP8A 3EZUA 3S6EA 1WKKA 3FMBA 2PSZA 1Q8BA 4QQBA 2NSCA 4DDFA 3GSDA 4C8OA 1E6VA 3CCUS 5E3CA 1OO0B 2OD6A 2PFDA 3PFOA 2WRMA 3BSAA 2HIYA 4BHQA 3C19A 2AYGA 2BZ2A 3W66A 3RB0A 3C16A 2DR8A 1RHUB 4O3SA 1T05B 1IVZA 3N4WA 5BYSA 3W8PA 2DIVA 4XPEA 2BQ3A 2XCPA 4WXWA 1YWXA 4RW9A 2RU9A 2EW9A 1I5OB 5I3QA 8RUCA 5IS2A 2J5AA 4YB6A 3MM6B 4WFBQ 1SUQA 2XMAA 1FWPA 3TJ9A 4FYWB 3FEZA 3RB3A 4LRBA 4RW6A 2M4MA 2ZBIA 4MT1A 1KN6A 1RTIB 2BX6A 1FX2A 1UAWA 1RK8A 3CGIA 2W2QP 3V6HA 1IKXA 2GZOA 3MEKA 1DQ8A 2BJDA 1TR0A 3OL8A 1J5EF 3CDWA 1S6PA 1NHUA 5KG4A 2ZDOA 1RWMB 2HHUA 3CJ3A 3VTIA 4K59A 1B3TA 5ETNA 1N48A 4USVA 5FLXU 5MAOA 4ZIWA 1FKOB 3AQPA 4DR5J 4F3MA 1K1QA 2OO4A 2J0XA 1RAAB 4ZVQB 1CBKA 4NL5A 1LV5A 3D66A 4GVLA 4YN3B 5KFYA 1RTJA 5F0WA 1LWFA 3KXDA 4ZPAA 2HFSA 3PRDA 4E98A 1HMVA 1WSRA 3I0RB 4X4SA 3QT8A 2B6AA 3CJ8A 4DUTA 1CC8A 1X31C 4N7TA 4J9LA 2GJ2A 4UY8T 2MY8A 1BXNA 3ZXWA 5J1EA 2MB0B 1IKVA 1NSAA 4ZVPB 2HURA 4AUKA 3BH7B 2XYHB 4ECVA 4NA1A 4JV2A 4KGZB 3UD5A 3I82A 3OV7A 4Y2KA 1TUGB 3KLFB 2CWXA 1CJTB 2NS1B 2B4VA 2NPFA 2VH7A 4OJGA 3L9ZA 4MK7A 2PMHA 2VG5A 4BWJA 2JSXA 2B4OA 3GU0A 2RUGA 4IRKA 4DV1F 1XNRF 4F2RA 4ILLA 1RT6A 3M30B 4ZJLA 1HWUA 3R6LB 2V4QA 3QZ8A 1DY3A 5H9EJ 3QFWA 5HP1B 2R2TA 1EIYB 4EFAC 1UFLA 4PAAA 3DLHA 4UT4A 4C6AA 2CPIA 4JUZA 3W1YC 1RT3B 3OFEA 2NR0A 2ASJA 2EVZA 1ELOA 4GKKJ 1S48A 3C6UB 4DN9A 2IJFA 4CNYA 4XK8C 2CQCA 2H65B 3T9ZA 4K4UA 1X4GA 1NEEA 1S72S 2V68A 2XQCA 2GCFA 5HSPA 1GK8A 3ICLA 5HL7Q 2HBQB 5CCLA 2QA1A 4RO0A 1GFWB 5KOXA 1IQTA 5H9FJ 3FFIB 3MXHP 4DV2J 2ATLA 4WIIA 3QLHA 2EFGA 2OSQA 2M52A 3DLGA 3Q83A 3HSGA 2HVZA 4DV0F 4UUWA 3PW2A 1RT1A 4LQ3A 3MMAB 4Y2MA 2UUCJ 3GB0A 4ECTA 1U4BA 2IRXA 2ZH1A 2DKOB 2DNLA 5G0RA 1HQEA 2HFUA 1OY6A 1I3OB 5A8KA 3C2PA 2JOQA 1HI0P 3R2CJ 2R3VA 1SBRA 3TA2A 3PV8A 2HEKA 2HHXA 1XEZA 3SCJE 3V4IA 4QYRA 1S77D 2XWYA 4NCBA 2V63A 3VAKA 4PEOA 2XNRA 1REVA 2DPJA 4C8YA 3HDSA 1XMOF 2X1GA 2HZVA 4IG0A 2RQ4A 3T6BA 2DJWA 2ZOFA 2KTQA 3EUNA 4F50A 1KOOA 3IWNC 3DOKB 4RU9A 2HK2A 1VMBA 1WSVA 2ZNZA 4YY3J 5KFXA 4LBIA 1RYSA 1OYDA 4DFJA 2VG7A 4J9OA 1SH2A 1KVIA 3T3FA 2DGWA 1N33F 2FHMA 2IPOB 4HVZA 2J9DE 1Q7YT 3K2YA 3UR0A 5K8MA 4ZCKA 4F36A 3QAEA 1GMVA 3M2UA 1BWVA 2P8IA 3N5FA 2MKYA 4FYVB 2EC2A 4WPAA 4J9VA 3PM9A 4BLGA 2B5JB 3PYGA 2A3JA 2CNOB 4KKOA 3ZFVA 2O5DA 1YGYA 5B0EA 2DISA 1FDAA 1Q1KA 3U1LA 3PO4A 2C3YA 3VVUA 2L9NA 2QFIA 1WHWA 3PKYA 2X7IA 3ITHA 3ZTRA 4DL6A 3UVJB 2RQKA 3R97A 2HHVA 3M8PA 3BF4A 3ILOA 3KNAA 1L5UA 2OLWA 4E2FB 3R2DJ 3JSMA 3MI7X 5D78A 3M8ZA 2VOOA 2C42A 2A2DA 2MMYA 5K8OA 1VIOA 2HHWA 3Q8UA 2E5LF 3QMQA 2M8DB 5KFFA 2I38A 1EHWA 1JIHA 2AGOA 1SQGA 3CO9A 3PYDA 4F8RA 3H4BA 3RRKA 3CPWR 2F65A 1PO6A 2J76E 1Q8KA 1U0HA 1R27B 2EEYA 6AT1B 5F9NA 1TAUA 4ELTA 3HVTB 4JI8F 4GO7X 2IAJB 1S9EA 3HXMA 2QA2A 3QIPB 5GAHU 1BQXA 3PHEA 1F2HA 2MQMA 5LJ5Y 3I87A 1ZBTA 2FJWA 4JI2F 1EX8A 5DLFA 1RBAA 4IFYB 3ETMA 1EP4B 2EBGA 2I8EA 5BYRA 1QSSA 4G6VB 2BW7A 2JH3A 4C3KA 4OX9J 2L3MA 1UW9A 2XWXA 1AUDA 1X8DA 1UVIA 1KQGB 4P73A 1BQNB 1FWKA 3PIOQ 2SXLA 2BKOA 2WONB 1TKZB 2BOAA 4RWWA 2DNKA 3R8YA 2WVDA 5IT9Y 3MMBB 5CYMB 1HBMB 2L9DA 4CNZA 4O23A 3MOJB 1X4CA 1JKHB 5LT5A 3QSYB 1RT7A 2A10A 2XEXA 1VRUB 2Q66A 1HR0F 1JLQA 2B51A 4DSEA 2DNOA 1CVJA 4KPCA 3MAQA 2BJ1A 1Y9OA 3JB9k 2UUWA 3P5TL 4DF8A 3PO5A 1JLEB 1E6YB 1VGYA 2YKAA 4HTJA 2GIRA 2JRSA 5JXSA 1AYEA 3DRRA 4A46A 3G6YA 3AY0A 2L08A 3CCMS 3HSDA 3T1YJ 1TK0A 3B4DA 2B9EA 4ZP9A 3KTQA 4ZHRA 1HQUB 2HWTA 2QLWA 3BPSP 4RBUA 3P96A 2ZHOA 2CADA 1XR5A 2AEFA 5AXKA 3BR9A 1IBMF 2C22A 2HQIA 3DRSB 1RT2B 3IRXB 4EO8A 3LP0A 2EFVA 5EX3A 4ETZA 1PYTA 2VL1A 4J9KA 2XSJA 3CEDA 5CCMA 2X1FA 1SXLA 4O4GB 1U1RA 4ZKAA 2KXHA 1NSPA 5I3UA 2P9CA 2KDOA 3RUBL 5B0BA 4NLPA 2W4PA 4M5GA 4DS4A 4J90A 1M1KT 1EETA 4P2SA 2ZE2A 3UNYA 2YNGB 1RUSA 3I9V9 1KC8T 2F4VJ 4EWTA 1JLFB 3BGRB 2UXCF 4F0MA 1N6QA 2CJ9A 4LF4F 1RJJA 3W2VA 2JLGA 4OI1A 4QIEA 2FLNA 2IVMA 1BHNA 1C4AA 4H4OA 4DN0A 2VFVA 5C7PA 3LP1A 1XIQA 1PC5A 2DT9A 4TKTA 3V5RA 4X4PA 1H7XA 2DGUA 1PILA 1N8RT 1SH3A 3FDSA 2IA6A 4ZPCA 2DTJA 3IBCB 4NXNF 2PO4A 3PCOB 5DQGA 1P9QC 1LWCA 1S9GB 1WF2A 2YPYA 3S01A 2AIRB 5IV4A 3QZ7A 3TR5A 3FC9A 3MR2A 3U1MA 2R7WA 3NWGA 4PCQA 2KB2A 3K89A 2Q3PA 3CCTA 3FSXA 1N5YB 2ATCB 2C3MA 1YVFA 3MAAA 2DCUB 2HKEA 4LFAJ 1FRMA 3CD5A 1QM9A 4HLBA 1N36J 2AX1A 1J5OB 4YHHF 1UZDA 4DQQA 1KKHA 3RR7A 1RWPB 1T94A 2VF3A 4DL4A 3MUVP 2JJ4D 1NB2A 1Q0NA 2ZFHA 2E7VA 2HVEA 5KT3A 4IUFA 4NLSA 3ULHA 2W9CA 1F1BB 1RAOA 2BW2A 5C25B 2ZHBA 5M2PA 1N34F 2CNKB 4FYDA 1U1QA 2ZC4A 1CS4B 5C24B 2XS7A 3UWTA 4CTAB 1U1KA 2CQBA 3GV8B 1SI9A 4RNOA 1BC6A 2N7YA 3VAIA 5KT5A 5J2QA 4TXSA 1RGVA 4PUOB 2I0XA 4E8UA 2UUAF 1TFYA 2HHPA 2R7XA 1UCNA 3RR8A 1ZM4A 4U67Q 2WSEC 2F7VA 4KB7A 5AJ3F 2CZVC 5CHCB 3FCHA 1YQHA 1CJUA 1F3VA 4WK3A 4DR1F 5IWAJ 4LSLB 5D6GA 3TOQA 1WG1A 1KLMB 4R8UA 4Y3CA 4LVNP 2GNKA 3A8JA 4DZ6A 2Z2MA 2J8AA 2CQ2A 2K1RB 4QR2A 1U2CA 3CDAA 3QPIA 3AJDA 5B0DA 4XO0A 2XS2A 4DPTA 3OFGA 2BKPA 2KZZA 1WC4A 3I31A 2NYIA 3KNGA 4CLUA 1JLCB 1B0VA 4DX6A 1TMMA 3TEGA 2VQEJ 2DXEA 2OPRB 3B6BA 3MM7B 1YZ7A 3EPIA 2W4CA 3NGTA 2V8HA 2VPWB 2V2VA 2HNDB 1C0TA 5B08A 2D3O1 1C0UB 3H4DA 3MOZA 4WTYA 2XTJP 3D68A 4TU7A 4MYTA 1KHVA 1VHIA 5J2PA 3H25A 1BE4A 4MIWA 2COLA 1EKRA 1K8AT 1OWXA 2R4FA 3D9BA 5F8GA 4ETXA 4RW7A 4PWDA 1JQGA 1RAEB 4DSLA 2ZEJA 1WACA 1S1XA 3C6TA 5DETA 4ED7A 4EBDA 3M8YA 4AYBD 1WEXA 5IC4B 4QU7A 3GZ7A 4R5PA 2MZJA 2YKMA 1RTDA 4HL9A 2UXDJ 5KG1A 4CLWA 4D3GA 2VFRA 1ZOTA 3T9NA 2DR6A 1VQ8S 2EFQA 3R7NB 3P49B 3SFGA 1RU2A 3TX8A 2LEBA 3NCPA 3T1HJ 3H5UA 5MLCV 2UVUA 3RAQA 3R1HA 2IY5B 2PEBA 1S0OA 3H2UB 1OSDA 4L75A 1MG7A 3G71S 2I5JB 2G0IA 3M9NB 4CDIA 4ZPTR 2BE2B 2J7KA 1FJGF 4OYXA 4TYBA 4LFCJ 1AFIA 3H98A 1UZHA 3M8QA 5EWFA 4ZVOB 3P8BB 1T9XA 2EK6A 2A6MA 1IBKJ 3H5SA 2HQCA 3B8HA 2GIQA 4LF7F 1N5VA 3F0NA 1AROP 3W9IA 3NNHA 3CJ2A 2GMLA 1ITPA 3LF0A 3M2RB 3N5BA 3QAUA 1VBZA 4C9DA 2ZH4A 4CM2A 5T14A 2HFZA 5GAEU 2CQGA 5L9XA 2MDAA 1KFSA 1Q5VA 2XMUA 2OPSA 1CSJA 2VHGA 1R8PA 4Q5VA 2Q6CA 4R0JA 1NUEA 4LR7A 1YKWA 2DVIA 1VJWA 3PNIA 4F4XA 1NHVA 4N8NA 4ZVGA 1F0XA 1U1OA 1WI8A 1D9FA 1D8YA 4GVBB 4ID5B 4ICLA 2AWZA 4NZ6A 2WVFA 1MU2A 3OR1B 4K4VA 1CULA 5DG8A 2F3JA 3RB4A 2EG2A 3GFYA 2XCAA 3VAJA 4IRDA 3OVSA 2BYCA 5B09A 4P7TA 5KG3A 2V4RA 5FD1A 4JBCA 3PIPQ 5C42A 3ETOA 7FDRA 3ZZZA 1X60A 3UN5A 2DNRA 3I56S 5HLFA 4ECRA 4C11B 4MTPA 3NWRA 3MEGB 4AL6A 3T5LA 3GMGA 4DCPB 3GG0A 2HHHF 1FT8A 3KDOA 5B0AA 2KVIA 1RWNB 3KJVB 3O6QA 5E3RA 3JAMY 3PHTA 5KT7A 2OMOA 1HNWF 4QWCA 3GLJA 1XERA 4LF6F 3G82B 3AJ1A 4NPOA 3MZIA 2KM8B 3EVWA 4PG4A 4IOBA 3W3SA 5GAEI 1GMUA 4X64F 1T05A 4JI7F 2VG6B 2Q6BA 5DS7A 1WC6A 1YBAA 2AQ4A 4JI3J 3NOCA 4TU8A 2HBRB 2IYGA 3T1AA 2VPYB 1Z2LA 3CJ5A 3SQOP 4DMZA 3MM6A 3IWXA 3PJ9A 4UW2A 1V6HA 3SQGB 3GFXA 2XULA 1RTIA 1GTEA 3N79A 2LA4A 2BJ9A 3OXGA 4DQSA 1SL2A 2HW3A 2BXJA 4DR3J 3KUGA 1R7IA 3J7A1 4C48A 3FJ2A 2GGPB 5GVQA 4USTA 2EPIA 4WF9Q 3RG6A 3G8TA 2MKIA 4M5IA 4DG1B 5A0YB 1RBLA 5J2NB 2HIQA 5AE1A 5D0RA 3R27A 2E5JA 2OD4A 3KJFB 1SJ4P 3KDNA 4CLFA 2KI2A 4HDGA 5I3PA 3WDOA 5IC6B 5LSOA 3TP2A 2E9ZA 1H7WA 3PVXA 2H9ZA 3G4SS 2NXNA 3NEKA 3BPDA 4NCAA 1HHTP 1F9HA 2RHQB 5GADI 1FRJA 1HWLA 1HWJA 3A3NB 2LVWA 2DRDA 3OTEA 2UVWA 4QW9A 3QATA 3I0RA 1RLDA 4DL0C 1U6ZA 2X1AA 3OXLA 1ZTWA 2LA6A 4Q8FA 2ZH8A 2G4BA 1TL7B 1T9TA 4YQWA 3TA1A 1OJ4A 2EBEA 1FX4A 1W26A 4MJKA 4Y6IA 3ENAA 3UFCX 4H54A 3IXQA 4J9UE 2ZM6J 5E3PA 2KFZA 4P7VA 2D9PA 1RT4B 1U0SA 3KHGA 3KLFA 4UZBA 1CJTA 1HBOB 1YJWS 3MPYA 1GXLA 1HI8A 1AZSB 4ZPVR 1DQAA 5CAAA 1RI7A 2Y0BB 4XPCA 3NCRA 3M30A 4JI0F 3NGKA 1GMWA 2R7OA 1SH0A 4DUYF 5HP1A 1SJ3P 3R3TA 3CCWA 1WF1A 3QO9B 2O67A 1RT3A 2JNJA 3LA0A 3HZEA 1DQ9A 4OQJA 3C6UA 1KR4A 4DR2F 3SYZA 4RL1A 1Y0HA 1VQ4S 1NMEB 1Y7PA 2FPHX 4IKAA 3UN2A 3HLUA 2G2ZA 4ID8A 3LW5C 4PXEA 1RWUA 4B9LA 1VK8A 3O3LA 3G86A 4WYLA 4DV1J 1ZAVA 3FFIA 4RBTA 3J7YU 4F67A 1Q5YA 4RNNA 4PG5A 2F8MA 1JJCB 1ACMB 3MMAA 3HJVA 2YVSA 2R7VA 1XR7A 1S6UA 2FYXA 2VASA 3JQJA 3M6UA 3P4UB 3CC2S 2XMJA 4B9MA 4QIVA 2P9EA 5BR8J 3UD4P 2AGPA 3I6PA 1NXIA 5E33A 4ZITA 1WOPA 2AKWB 5KAKA 2DK2A 4DL2A 2ZZTA 4B9UA 4MKBA 2XB2D 4CRJA 4IFVB 2YWEA 3Q8YA 4RUCA 2WSCC 2XLKA 4WZMA 1RZMA 1ZS6A 2EG1A 1TU0B 3TW0A 2FIUA 2RHSB 2YWKA 1XWLA 3DOKA 2CJXB 3VALA 2XY5A 2JL9A 2R7SA 2G1HA 1RQ0A 3E01B 3HPOA 3OJSA 1WOOA 3HT3A 1L3TA 1N5TA 4ES2A 3ONQA 2HZCA 1HBNB 1V3SA 4S0MA 1R0BG 4RNHA 1J27A 4CI0B 1FRXA 2JFKA 2CJAA 4DU8A 5CD4H 4GMKA 3HSJA 2MQPA 5GMDA 1HW8A 4Y34A 1RT1B 1UFWA 2B5JA 2DNPA 4LBHA 4USHA 3KLGB 2HBYB 5F0UA 2QJ3A 2JLEA 1R31A 2OIHA 5FJ4A 2MGZB 1NKCA 3OR2B 3EDQB 2AEJA 1HQEB 4LRCA 3G8SA 3MPDA 2BABA 2D9OA 2PI4A 4GO5X 3BV8A 3D2WA 5E3AA 4MIBA 2J0QD 3B54A 4QZVB 2IBOA 2KXFA 5ETVA 1U09A 4ENOA 1VQ9S 1WTFA 3JQKA 2FUG9 1OIAA 3UVJA 2PEHA 5DDPC 3TVKA 3PR5B 1Y00A 5DG9A 1TL3B 4X66F 3M32B 2F9JA 1XN9A 1YJRA 2L9WA 4ZCMA 4CLSA 2ILZA 2XSFA 3NBPA 4RLEA 4B3MJ 3T41A 2ZH2A 1JXEA 3CJRA 4TLQA 1S4FA 3JTOA 1VQNS 3GJTB 4KQZA 2CPDA 2R8IA 3MHYA 1AB8A 2LXFA 5F8LA 2YQ3A 1R6VA 3P3DA 4QIGA 3BO3A 1VQPS 1HNZJ 3FK4A 3GJRB 3KLVA 2LFVA 4GKJF 3T6JA 3HVTA 1K9MT 3HHEA 2IAJA 2A0FB 3QIPA 1X4DA 4NYZA 3VHQA 4K4WA 4ILMA 4UUXA 2YWGA 1L3VA 2XZDB 1TFWA 4I7FB 2AMCB 1NDCA 3UR3C 5KFGA 2QA4G 2H4YB 3HCXA 5HVGA 2OPPB 3SCKE 4IFYA 3MPVA 3S1TA 1EP4A 3X1LB 3NCQA 2E5LJ 4ECZA 2IIHA 3DHWC 3ITHB 4AXIA 2AV5A 4UY85 4C8LA 1R89A 5D3GB 3NGUA 3Q0AA 3M8WA 3EICA 4P71A 4ED6A 1BQNA 5T7LB 2CNNB 4NEZA 2C3UA 2BM0A 2DEIA 2WONA 1TKZA 2WOMB 2Z8QA 3MAHA 4LF9F 4DR7J 3ILLA 4M1KA 4LF5J 4C0HA 2AJ1A 1TMJA 2VPXB 3MMBA 2FVPA 5CYMA 1I6JA 1HBMA 5KG0A 1SC1B 2QYGA 3W62A 1S59A 1JKHA 4F4KA 4KFBB 1VRUA 2V2ZA 4OYBA 3H0PA 4QBUA 3SSSA 5D0HA 4RX6A 5DZ7A 1VR6A 2ZUAA 2FJAB 1WHYA 2B56A 1JLEA 1E6YA 2BJ3A 1JLAB 3MDFA 1RP5A 1MROB 1KQKA 4DV6F 4LREA 1EQMA 1SL0A 3BN4A 2M88A 4KRWA 1HQUA 1D09B 1H0HB 3AQOA 1PG5B 4ZP7A 3W64A 3TARA 1H72C 1UTAA 4WIQA 2XYGB 5HBMB 1XK8A 1N32F 3RW7A 2GMHA 2MQLA 3DRSA 1M5PC 1RT2A 3IRXA 2J8SA 1RWWB 1HHQA 3BQ2A 7AT1B 2NLWA 2A18A 5BJRA 4AQYF 4O4GA 3THVA 3R5GA 3BJYA 4OV6A 2LCWA 3KUEA 1QSYA 2IRYA 4ED1A 4NLXA 1X9MA 4YUDA 1Y4ZB 3DGVA 3MUTP 2BRLA 4DCOB 2NQPA 3GP9A 2YNGA 2ACYA 5KFKA 4QYZK 2W2MP 3DN9A 2R8KA 4UQTA 1JLFA 3BGRA 1UL3A 3ZTPA 3KK1B 3TA0A 2F5GA 4K4TA 1NK0A 3O5TB 2W25A 4NMXA 2MHNA 4J5OA 4LR8A 1IBMJ 2ERRA 2IDLA 1SC3B 1V9OA 3E3XA 2C2KB 3CCQS 1T02A 2AF6A 5ETTA 1JNRB 3JYTB 2ACMA 2RH3A 1S9GA 2GMJA 1U1LA 1WC3A 2Z4PA 3D0IE 1Q16B 2FVSA 5KFUA 2WCXA 2YBVA 3KHLA 1VRTB 1X4BA 1W2BR 4X4OA 4CO5A 3OHBA 1UVJA 4KHPJ 2RF2B 1N5YA 1F5BA 1NDPA 5CZXA 3DOLB 5JVHQ 3DLJA 2AJFE 4WZQA 4BBYA 4YFUA 4LSNB 3W2WB 3J81U 1J5OA 2F63A 4PPZA 2DGSA 4N76A 2VFSA 2CQ1A 4Q8EA 2Y1RI 3JXOA 5LL6d 2RRBA 4USKA 2HG4A 2HFNA 1TK8A 1WJ9A 4WYWA 4K5SA 2FC9A 5EDWA 1W2IA 1U24A 3M05A 2LDYA 5C25A 4Q43A 2XZWA 1S6QB 1MW7A 1WEYA 4O3RA 1CS4A 3A8KA 1VBKA 2M5YA 3OLBA 1FVQA 5C24A 3UCUP 3CJ0A 1N5QA 1HYSB 3LAKA 1T95A 4QU6A 2H51B 1G4CA 3TAMB 4PQUB 2E9RX 2E5HA 2NXJA 4PUOA 2CDRB 2PE8A 7FD1A 1MWZA 4X62J 5KFNA 1XNQF 3FQLA 1BWEA 1NHKL 1NK8A 2MJNA 2GX8A 2KRRA 2M3DA 1S0NA 2XMMA 3VQTA 3CW2C 2ALYB 1F60B 4H4KA 4K4XA 2BDPA 3A13A 5F8IA 2K7JA 3BBBA 4I67A 2E1PA 4LF1A 4K4SA 1N34J 4M5LA 3MURP 1YI2S 1KLMA 5BXIA 1R0AB 5CA5A 5ETLA 5EWEA 5LMUF 2K1RA 1R8CA 2EI5A 2E1MC 1Q95G 3AD8C 1QSLA 2KRBA 1TVRA 1GXTA 3VAHA 2D3UA 3CJQA 1UKUA 3W5ZA 4YB1P 3PACA 3TRGA 4WCEQ 5AE2A 5CYQB 1NB7A 3FBBA 4K2JA 4DSKA 1JLCA 2UUAJ 2VUGA 2XG8A 3B4MA 4KHMA 5KOWA 1RWOB 3A3PB 3BO2A 3C15B 4ELUA 1WDTA 3OL9A 4CIOA 2OPRA 3MM7A 4DR1J 3I5CA 3QWUA 4IO1A 4A8XA 3GE9A 5ETQA 3US5A 4KGVB 5CYJA 2N4CA 1GMWD 3OLAA 5DO2A 5CZVA 4ZLPA 3ILIA 4MIAA 2HNDA 4EI2A 2MLZA 1HARA 2CDQA 3DGPB 1VOMA 2FZKB 4ZK7M 3GYNA 1C0UA 4WXOA 4Q2MA 1UA1A 1GEHA 4Y0FA 1IXKA 3A4TA 1FEEA 2JVRA 3FBFA 1U1PA 2OUGA 4FN5A 4HH0A 3DXBA 3W5XA 5IXUA 4IH5A 2W7AA 3OW2R 2Q43A 3VCDA 2IM1A 4YEAA 3LGMA 2M7SA 2CJKA 2CG4A 4DUZF 1S6OA 5KFDA 2WB1D 1Y3JA 1KEKA 3GR0A 4MKAA 1VI7A 2X1BA 4U8YA 5FLXY 2IC3B 2DR5A 4C4WA 1H3DA 2I1RA 3KYLA 4J91A 1B0PA 3PFEA 2NPIA 4WP3A 1HNXJ 2VJUA 1LFWA 4B3SF 5I4MA 2VQFF 3WQPA 2ZITA 2QEXS 2KJWA 4M5MA 2I6WA 2AU0A 2J9DA 2OHDA 1TUWA 4MK9A 1RABB 1R3NA 1RLCL 3CIZA 3THPA 4F0KA 4FF2A 1H2TZ 2HNZB 4DV3J 3K5NA 2I5JA 2XHWA 3TUJC 1MLAA 1HBUB 2JWNA 1T9YA 2BE2A 3NS7B 1C0TB 3MM5B 1UVKA 2VONA 2LU1A 2RQCA 3MCOA 3ZO7A 3GQCA 2AW0A 2PA8D 2R7UA 3WHIA 4B3TJ 3GCXP 3NGDA 1CC7A 1WD6A 5E3QA 4H4KC 3C8YA 3M2RA 4ZLNA 4O0NA 1YK9A 4ZVHA 2R7RA 4C97A 1KS2A 3UW1A 3LWMA 3QFHA 3TJAA 3DRYA 2HHTA 4ECUA 1AUSL 2KL8A 5KG7A 1U47A 3CC7S 2NREA 2QN6B 1VBXA 1SIWB 2ZDPA 3MMCA 4DS5A 4B08A 5KFSA 3MFHA 3FUYA 4NA2A 1PSDA 4GVBA 4ID5A 3MR7A 4OI0A 2KHCA 2GIFA 3OR1A 4M5HA 4UTGA 2V2QA 2Y8WA 1TKXB 1IWGA 3SCIE 1XBWA 2ADBA 4MK8A 4FKXA 3E8OA 2LDIA 2W8LA 1UW4A 4LR9A 4DR5F 3HX9A 1TAQA 1EQ0A 2FJDB 4FNHA 3FBCA 4PG7A 5SZTA 3M8QB 4DR4J 2RD5C 4C11A 3MEGA 3TQ1A 3WX4A 2E66A 4ANEA 3KK3B 2HBZB 2Z56B 4KH1B 2H4WB 2QIFA 1IJEB 2ROGA 4LF8J 1SKRA 3KJVA 2WSFC 1DHMA 4NXMJ 1T8EA 2MEWA 2OAUA 3CMQA 3AXMA 1S0MA 3DDIA 4OHVA 2CRLA 3NS6A 3UDVA 1NAQA 3BH6B 3OQ2A 3R5DA 3G82A 3D1OA 3HSZA 2F4FA 1WI6A 1YBTA 4KY3A 1OY9A 2HAIA 2PN6A 4DL3A 5KFTA 2AJ4A 1VC0A 1FRIA 1EARA 3CIMA 1MWQA 3MPUB 1IJFB 3RAMA 2QLFB 3EXCX 1O51A 3QNWB 1C1BB 4R0EA 3DC2A 3H59A 2KT3A 3PY8A 1S1WB 3B78A 2VG6A 4AT1B 1FO1A 3AFGA 2K06A 1NJIT 3HVWA 2WK4A 2BKNA 4ICLB 4ZVFA 4NLYA 1OYEA 3IGNA 4WU2A 2OEKA 1JX4A 3KG4A 4B3OB 4ES3A 2CPFA 3M7VA 2YX1A 4YDDB 5C42B 4LF6J 1UVLA 3L7OA 1AA1B 3SQGA 2IVFB 3R5CA 4B9NA 2OSRA 4C8NA 1ZM2A 2BA9A 5HJYA 1PJ5A 4F0HA 1DLOB 1EB0A 2GGPA 1G2EA 2LQJA 4PKDB 3KJNB 4IRCA 3CJSA 3DLKB 5LM7E 4OYZA 1ZA2B 9ATCB 1RA7A 3K5LA 4NRTA 4IQXA 4DG1A 5A0YA 3LALA 5J2NA 3LGNA 1MMLA 3BGLA 5H9FK 4K4YA 2FTRA 4KGKA 3ZTOA 2ZBCA 4EK2A 4DV2F 3MEEB 4HT5A 3CCES 4A47A 1WNEA 2EK1A 3CVKA 4URGA 1NJZA 1SCJB 2UUCF 2HNYB 2IMWP 1M90T 4ZLJA 4K5RA 3D0HE 3QT7A 2R2UA 4OX8A 2XC9A 1NBEB 4IO9Q 3TVZA 5DM7Q 5THWA 3RBZA 2YX4A 1PAUB 3NMAA 4WFYA 4HH1A 2OGUA 2WAQD 3BGOP 3UN3A 4F3QA 3TWZA 4FS2A 1YJVA 1YIJS 3K57A 3H8YA 4USWA 3EGZA 3BZQA 1TL7A 2XS5A 4KO0B 3M1VA 2RIJA 3TVYA 1YZ6A 3K5OA 3LANA 2V4JB 4TY8B 1WHXA 3ZTQA 1MN9A 1IKWA 3ZZPA 2ZZMA 2N3LA 2M0GB 3EE3A 2MQNA 3IO1A 4CO3A 4EU0A 3D6HB 3IP0A 4Q0BB 1N54B 3AH6A 1YLXA 1RT4A 1SQEA 2F8HA 2Y1LB 2AD9A 1B7FA 3WBZA 1HBOA 2W8KA 3PX0A 1JB0C 4HKQA 3UI3A 1W25A 1AZSA 1RAGB 1JNZB 4X4TA 2GC8A 2DHGA 1Q81T 2AJ0A 2XZTB 4BC7A 2VC0A 1LNQA 2IM3A 5SUHA 4JI1J 3MM8B 3V81B 2KM8C 2UUTA 2MPUA 1KOHA 1VISA 3H2LA 2DITA 3QO9A 3EWGA 4KC5A 2X3GA 4EBEA 2LQBA 2KN4A 2IRUA 2FJVA 2MTLA 5DDOC 2DD8S 5I42B 3TYTA 2K7KA 2GO9A 2Y1JA 3GSIA 3TUZC 4DX5A 1QVGR 4WFXA 3U1NA 1IKYB 5KTQA 2GQ2A 2N3OA 2E5GA 2RE1A 4RBVA 1NRKA 3SIPB 2AJ2A 2GVDB 3TJ8A 5HMZA 4BDPA 4IDKB 3JSYA 4JI0J 1OMSA 3ISND 4MFBB 2V69A 4USJC 3W9JA 4DUYJ 1ZPWX 5DGAA 1WWHA 4O3QA 5L46A 1NK4A 1M1GA 3MF5A 1SV5A 4DL5A 2J9CA 5CH7B 5RUBA 3FQKA 2R7QA 1PBAA 3HI9A 3FSIA 4K0KJ 4DR2J 4NLWA 2E1AA 1RHMB 3NAIA 3IFEA 2QL9B 1S1TB 1Y5IB 2E1CA 1R6YA 2KH9A 3OVAA 2QL5B 3BSOA 2HK3A 5KG2A 3L7UA 1JJ2R 1HA1A 2EFOA 2QC3A 3GCWP 2BE9B 4IFVA 4NLRA 9RUBA 5C2CA 1OPZA 1X7VA 4ECQA 3FCVA 2R7TA 4I6WA 2P2CB 1ZETA 1Q82T 2CQPA 4OX9F 2J6SA 4DQRA 2QE5A 4QW8A 1JMTA 3E01A 4X65J 5C2GA 4F4AA 3BDEA 4Q7AA 3WX8A 4DV4F 3KWMA 3V6DB 1HBNA 2FJXA 1TK5A 5M2UA 2VA3A 4CLLA 3P6YC 1VQ7S 2UV8A 3DDKA 3NGSA 3G6VA 3KLGA 2YNHA 2W01A 2MGZA 3QRQA 3OR2A 3HHLD 1RU1A 5ETMA 3VV2B 3M8SA 5K14B 2K3IA 1DFDA 2DGQA 3D6FB 4A8FA 2OMLA 4L72B 4JI4J 1X5TA 1K44A 1GNKA 4A4JA 2DH7A 2LEPA 2CWKA 4JYAJ 3EVOA 4A48A 3DNCA 2PDAA 4C0OC 2R8JA 1TL3A 3R1LA 3M32A 3OJUA 3MTKA 2JC0A 4C8ZA 1C1CB 3F56A 3UDEA 5F8HA 2GQQA 1BGXT 2J7UA 5U47A 4M5JA 1IBLJ 2KZMA 4OZ2A 3A3OB 3D28A 5KFHA 4Y00A 2D1CA 1RADB 5EN1A 4ZA1A 1S12A 3QIDA 2DYAA 2JEFA 2ZH5A 1ZH5A 2MKSA 4P72A 3G6ES 1SB6A 2MJUA 1DJ0A 3DI6B 5AXLA 5IQ6A 5HJXA 4L73A 2QZ8A 3MUMP 4I7FA 3WZ0A 1RT5B 2N82B 2DHHA 5KFEA 2YPZA 2OPPA 1NSKL 1ZZNA 5LSLA 4J9RA 1DBDA 4A8OA 2WHOA 2ZWPA 2I2YA 1LK7A 2F40A 3HT0A 4OL8A 1WG4A 1PKUA 3KLIA 4YB7A 2UXBJ 4P75A 2U2FA 3VGSA 5D3GA 5B0GA 4I6AA 2GHWA 5JMNA 2QSFA 1HI1A 1KVJA 5T7LA 2OI2A 4KJIA 4GKJJ 1U48A 4NWBA 2LKZA 4WP8A 2WOMA 4W98A 3NBPB 4ZCLA 1RTZA 4JB8B 2VOPA 1P9YA 4DPXA 4EUVA 4KFBA 1MMDA 3K8WA 2K8GA 1H73A 5D8HB 3CB4A 3LAMA 2BUNA 4TVAB 1S7HA 2OEMA 5GAGU 2L48A 1JLAA 3POTB 1LW0B 1MROA 3PW7A 3PG9A 3S8SA 3IG1B 2RJZA 1U1MA 3R7BB 1UEKA 2O3DA 1XJWB 2XI3A 3BQ0A 4LF9J 2FVQA 3Q8QB 1Q4RA 1DARA 5HBMA 4DV7J 5DZ6A 5ETRA 2KJVA 1URNA 2AZ3A 1RKIA 5DGBA 2CUYA 2YY3A 2V9KA 4JV5J 1SKSA 4I69A 1X0PA 2FZGB 3CMES 4R25A 4LMZA 3VAGA 2JHEA 2C2OB 5HVHA 2ZD1B 3Q24A 4N77A 3BO4A 1WORA 3U27A 5E0OA 3IR5B 4DV6J 4G3IA 4ZVRB 1T3NA 4OHYA 4CZCA 3Q89A 5IWAF 6FD1A 1RBOB 2HRUA 3KK1A 3HVRA 3BBFA 3FCWA 1PIEA 1N32J 1S49A 4M5KA 1VFJA 3KMSA 1FNOA 4KT0C 4A8SA 3JYTA 1T3OA 2UVVA 2FLLA 3FEXB 1BQMA 3FRZA 2YWHA 1VLYA 1UMJA 2KG0A 1FD8A 3SCLE 1O8BA 4ED0A 2D3ZA 2ZH6A 3NY0A 1VRTA 1VC5A 3KG0A 2YH1A 2VQEF 3G9CA 4NRUA 4P9SA 1HNVB 2RF2A 1UFKA 4CLZA 1R43A 2VKZG 5GAHI 4QYZJ 3DOLA 1XQIA 1FE4A 2X3DA 4J9PA 1IR1A 1RAJA 3T5KA 3PXGa 2VV5A 3G8QA 1SJ1A 4LSNA 3UCGA 3W2WA 5KFPA 1S4EA 2FGCA 3CDBA 4K8RA 4X2BA 4DWIA 3DHXA 2D41A 4N47A 2OELA 3B82A 4B3RJ 4YR0A 3H2VE 3QJLA 2VKRA 2LQ9A 2Z0GA 3BKUA 2Y0SD 4USMA 4Z7CA 2ZVSA 4DFPA 3AOCA 4O3OA 1S6QA 1BMQB 1MSWD 1RKJA 4RZRA 4CYUA 3DCAA 4IG3B 1ZPVA 2HLUA 1HYSA 3MTJA 3M8RA 4TYAA 2OPQB 3GYXB 3TAMA 1SC4B 2ABYA 4RUBA 2L41A 1K1SA 4PQUA 2DO4A 2D69A 4ZDNA 1FTRA 2KHDA 1NO8A 4OHXA 2ASDA 4LRAA 2YX7A 3T1HF 1FXRA 2RNEA 3DFEA 3SI8A 1JLGB 4FYXB 3MR5A 1RHKB 3SV3A 1IN0A 1R0AA 1YSJA 4ZPDA 1RCXB 2DY1A 1U6BA 4BCAA 2CJBA 1WC1A 1G3OA 2XMTA 4M63A 2YKNA 2CQ3A 4ZP6A 3HFVA 5J1PA 3SMZA 3N28A 1FTCA 4RW8A 5CYQA 2WVBA 4FXVA 2P6SA 1M5SA 4J7CA 3OTOF 1FERA 3D1QA 4QCLA 4ZVEA 4CO2A 3OUYB 1UETA 4OI6A 3W9HA 3ZNJ1 4FDFA 3C15A 4P2MA 2BMBA 3CDEA 5EUHA 1NJYA 4DF4A 1NKEA 2D74B 3NS5A 4WWSA 1TL1A 4MYUA 2B9XA 4EGLA 3E2EA 1VQMS 3DGPA 2GVZB 3M6XA 4ANDA 1SQFA 4UOGA 2VZ9A 3FRYA 2U1AA 2KU7A 2BQUA 1N0UA 4CT8A 3UPFA 2IJNA 3SEOA 2HWHA 2KYZA 5AXMA 1T9UA 4PWWA 1LOUA 3PW4A 4W4MA 3S7RA 5HI7A 1VJQA 1FFWB 3FBEA 1VIXA 2JDJA 1RACB 2R42A 1FRKA 2Z2YB 1QAIA 3OTBA 3QGPA 5CD4A 3C46A 3G2XA 2CFXA 4HDHA 3RYLA 4IH7A 5J2MB 4MKVA 4EZ9A 3GONA 3W61A 1TVRB 1M5OC 3QT5A 3MWBA 4K50A 3PW0A 1JWWA 2IC3A 1FVSA 3EM1A 4Y2CA 2Z2LA 4PRFA 1NU4A 1VQ6S 5AXNA 2MQ8A 4OYWA 1LWEB 2OTJS 1VBYA 1NPKA 4M8LA 4MH8A 3JTNA 3LH2S 3RB6A 3HHLB 3HKZD 2HNZA 5A2QU 3K7RA 4N56A 1NJWA 2RUSA 1TL4A 4O4RA 1Q86T 4FXWA 4E0DA 1FFSB 4IR9A 1YJ9S 1F9EB 4L76A 1HBUA 1S0VA 1M5VC 2B0GA 4ERDA 1DAXA 2MZTA 4HHJA 2XI2A 3ENWA 3PEJA 4DUZJ 3MM5A 2R2RA 4ZN1A 3BDPA 1VCTA 1D9DA 2W2NP 2JZ5A 4FF4A 4ZN3A 2MZQA 1YBUA 4M5DA 3MGJA 1ZTTA 2DY9A 1S99A 2V2KA 1GX6A 2DO0A 3TAPA 3HM9A 2V50A 2VQFJ 4A8WA 4DZDA 4OYAA 3T5HA 2IM2A 5KFZA 3EJMA 4FS1A 3OTCA 3OBIA 4NE9C 3BKFA 4EBCA 4F25A 2QA4S 2HZAA 4I56A 4OYPA 1UWAA 4DR3F 1JLBB 1SL1A 1I94F 4WU3A 2BQRA 4HYKA 1QY7A 2A1BA 3HKWA 3O2IA 4QIWD 4ER8A 4U7CA 5AE3A 1TKXA 1KTQA 4O44B 2M9KA 3DOMB 3GJSB 1IWAA 2XGPA 1RTHB 4NEYA 4WFAQ 4QWDA 4FP9A 4ES1A 2AYBA 4NI2B 2FD2A 1RHQB 2QMWA 4FBUA 2LU2A 1YRTA 4LIRA 4OLPA 3HHNB 1C4CA 3HHDA 4DR6F 1X5SA 3KK3A 4U9RA 5LOQA 2DEJA 1L3UA 4X84A 2CJQA 4NYOA 1XMQF 2R2SA 1HWIA 4OI2A 4X4UA 1RHJB 3U02A 5ITHA 2OTLS 3I55S 4KAIA 2DNGA 3CO0P 3D6TB 4LJMA 3AD9C 1VQKS 3OVBA 2J9EA 2DHAA 4CH7A 2QYCA 4B17A 2HMIB 3NAHA 1IR0A 1MNEA 1VLOA 5CABA 5KFRA 1YITS 3DYAB 1H2VZ 4KYZA 4QOTA 4ZVUB 2ZM6F 3M9MB 3DRPB 2WVCA 3MMCB 1C1BA 1S1WA 4CH1A 3VGUA 3ZZYA 1FNXH 1ZYQA 2XNQA 2OP5A 4TNOA 3W8GA 4PYDA 4B3OA 4NLVA 1OSCA 3F44A 4DBQA 2DR9A 3ZTSA 5HQMA 4YOEA 1NZAA 1UEUA 4OIXA 2BJ7A 2ASLA 1PAEX 2UUBJ 1DLOA 3R5AA 4IOCQ 2H5JB 3DLKA 1CEZA 1U1NA 1HPZB 2DIUA 2HPUA 1YJNS 1X4HA 5KFOA 5CXTA 1T03B 4L6V3 1HWKA 1S10A 4JI5J 3DLBA 2C2ZB 3KLHB 1NK6A 3RAXA 3BGUA 5HAOA 3MEEA 1R0CB 3FMWA 2WBRA 1QTMA 1N88A 4U7UD 1RWXB 2AYEA 5HROB 4CO1A 1T11A 3KG1A 1DURA 2HNYA 3I4HX 1I1GA 4M5NA 2DNMA 1Y5LB 3C14B 2CJYB 2H48B 2WW8A 1KFDA 3N6MA 4OZJA 3KK2B 5BR8F 4B9VA 2OEJA 3TUIC 3K8VA 3R9LA 3NXZA 4UZCA 4FKYA 1Q79A 1JJ4A 2AZ1A 4ZIVA 2DRBA 2ZKUA 2YXLA 2HQDA 1S57A 4U95A 4C98A 4KO0A 2CQ0A 2MQOA 2WBMA 3IBFB 4DSFA 2V4JA 4TY8A 2C2NA 2MKHA 1QLNA 1FKPB 3TZXA 3FEYB 5DM6Q 3UCZP 3W65A 3GIIA 4QWAA 4Q0BA 1TELA 3RTVA 1RA6A 4USUA 3EX7B 4RUHA 2NCKL 1V3RA 4PZVA 3LP2B 1MN7A 3AJ2A 2M70A 5ADZA 3OL7A 3NLCA 4I0WA 4ECSA 4XDCA 1SJQA 2B8PA 1APSA 4RPFA 4RU2A 2DGTA 5GMKa 4AE5A 2HYIB 1NK7A 2M2BA 4TQSA 2PT0A 2YNFA 3MM8A 3V81A 4AFFA 5FDLB 5C5JA 3V2UC 1UP1A 2F1FA 3UDLA 5D4OA 2B7CB 5HQ8A 1FRLA 1ZAWA 1Z1ZA 3I0SB 5KFWA 3V6KA 3MD1A 5A6PA 3J7ZT 2P6TA 5I42A 3FVYA 1K47A 1Y5NB 1PJ7A 2QX0A 3FZ2A 1J5EJ 4B9TA 3Q8SB 1IQZA 4ELVA 1IKYA 1TKDA 4Z7YA 4HHHA 3EYZA 4NZ0A 1QVFR 3M1VB 3IRWP 2GVDA 4HTIA 5B0FA 4IDKA 4OX7A 3H42A 4MFBA 1IKWB 1SIZA 3L3CA 2RDJA 4X4QA 4B3MF 4WE1B 2FC8A 2BV3A 4NLDA 4OZ1A 1FNMA 3ZZ0A 4OZ3A 2DH9A 2ZNYA 5FIIA 4CLYA 1FEHA 1PC4A 3PZPA 2WVEA 2V8DA 1YX2A 3RZAA 1HNIB 2WB4A 3LO3A 1G6BA 1HNZF 1FF2A 1FWLA 4OHWA 2UV8G 2VBZA 2J7WA 4HACB 1S1TA 3D54A 2XMWA 3GFZA 1KQFB 1L3SA 3M2VB 3GG1A 2IJRA 3JSBA 2IM0A 4A8YA 4KIAA 2C2EA 3K5PA 3GIJA 4ALZA 2CPZA 3MECB 4ZJOA 4WFNQ 3I5BA 1VQ5S 4CWBA 2HHSA 1FXDA 2OJ3A 4WBFA 4FVMA 4C0BA 4V19J 4IQMA 1BLUA 5A8RB 3N6NA 2PD1A 3JSRA 3MCNA 3V6DA 3VAMA 4OJ3A 1XNRJ 2C2DA 4DR7F 1DTTB 4LF5F 1FI4A 2R8HA 1I51B 4ZVTB 2ZJQQ 2Y9HA 3WC2A 2X51A 1U8WA 3O8WA 3NNCA 2H1YA 4I6YA 3GPAA 5DDQC 4ZVSB 1CJVB 5K8PA 2OKQA 1SV5B 1K73T 1QD1A 5K14A 2MKJA 4A8QA 2HRYA 2KKHA 3PX6A 3VR1A 2HAFA 2K3KA 3EVMA 2HGNA 3AXKA 4TU9A 2V5HG 3NKYA 1RISA 2EWHA 4NLQA 4JI6F 1LKZA 3J81Y 1UWBB 4DV4J 3MCMA 4DPUA 1C1CA 1SVDA 1AFJA 4OYIA 2MXYA 2CQIA 2VU5A 2FLOA 4Q44A 1QTNB 3MR6A 3Q8PB 2WZ1A 3ZNUA 4DV0J 3GILA 3QBCA 3M6WA 2QSWA 2DB1A 3HVAA 2CIMA 3FZBA 2CZ4A 1DRZA 3TQEA 2DR7A 2LLZA 1XC9A 4OYMA 1DTQB 3DU6A 4OI4A 2UU9F 3WIUA 2FZCB 3GIRA 3QYYA 2CQ4A 3DI6A 2UZAA 2ALZA 2B7BB 1H38A 4F26A 2J6UA 1RT5A 2MSSA 1U2FA 2VPZB 1ICEB 1T9VA 3D3CJ 2YNHB 2ROEA 2AYMA 1FFGB 3NG8A 1XMOJ 2H5IB 4CO4A 5B0CA 2QG9B 3D5MA 3IAS9 1IBCB 2IYIA 3J7YI 1NNDA 2FJEB 3U7JA 4RKUC 4HEA9 4EMDA 3H40A 5L1IA 1WTBA 1S1UB 4UOHA 3Q2SC 4DPWA 1HHSA 2Y8YA 2KFNA 4I2QB 2RT3A 1N33J 1CLFA 3KHHA 4CLKA 2NXEA 1EAYC 2BM1A 1N5SA 5KFMA 1FKAF 1UJ5A 1ZA1B 2BANA 1KNZA 3PR4A 2HFOA 3GJQB 4LT6A 2QLBB 4KHPF 2RS8A 2AEMA 2HFVA 1U25A 4DLEA 4DFMA 2XO6A 2ZOGA 3IBWA 3VGTA 2ZZNA 5DQHA 2ZH3A 1EKSA 1B7YB 3F41A 4I4BA 1S5ZA 5D15A 1V5VA 3Q23A 2LMIA 5K8NA 1QAYA 3SSQA 4I2PB 3ET6B 3POTA 1LW0A 5IT4A 3LOUA 2HQFA 3IG1A 1HIYA 4HI2A 1FJEB 2YKPA 4OZLA 3CULA 2DNNA 3DLEB 3IM9A 2QTWA 2WW4A 4F3OA 2P5VA 1CJKB 2QFJA 2YWWA 3L4BC 5K9FA 1XTZA 2MLYA 2VIHA 4ILRA 1FRHA 3VWSA 3D6MB 1A7GE 4ECXA 1FDNA 2R9LA 3KLIB 2XHCA 3HMJG 2KT5A 3HZGA 2FHKA 4EYHB 3H5YA 2RKIB 4OHZA 4LRDA 4U6PA 3QJJA 4G1QB 5BYQA 1CG2A 3CE8A 4KBIA 4JI8J 2ZD1A 4X62F 1TTHB 3IR7B 1WHVA 3LPEA 5ETSA 3KFWX 1CPZA 3I96A 2W9BB 2E1RA 5D4LA 4G65A 4J9SA 3IA0A 4QPXA 2CPYA 4DQPA 2CG8A 2MLXA 1FA0A 2ZBPA 1VQYA 3FGVA 4GC7A 4JI2J 5EX0A 3QQCD 4KGXB 2J0WA 2O66A 4RWXA 2H54B 2PC6A 3NRBA 2ZBRA 1TKTB 1SJRA 3SDEB 4YMEA 2DHXA 3SZ2A 1T0TV 2NZCA 2BOPA 2RB7A 4YB5A 3RGIA 1NK9A 3KKFA 2XBPA 3Q8VA 4NCGB 4WTOB 1QE1B 4L74A 2HQ3A 5A6WA 4MMOA 3PRBA 4WFZA 5A76A 2DGVA 3D0GE 3RBXA 4ATNA 4H4MB 2CA9A 2ZJPQ 4DFKA 3WIVA 1YJ7A 2DBBA 1KSPA 1HNVA 3OHAA 1M5KC 3BYPA 3CJTA 5KFVA 2PMZD 3N6LA 3TANA 3GV7B 1N56A 3PX4A 3LGHA 2MZRA 3GWCA 3Q2TC 2LQ8A 2ZH9A 1HR0J 3CJKB 2N7CA 2YNIB 1F5AA 5G4DA 4V1Ak 1KP6A 4O0IA 1VDHA 3EGWB 2HSEB 4LFBF 1BUXA 1FD2A 1FK9B 2W2PP 4BWMA 1BD6A 2HVHA 4UQGA 1RHRB 1D0EA 5L8RC 2Q79A 4Y2IA 4DX7A 2RDIA 3CCLS 4IG3A 1Q53A 2OPQA 5L9NA 2LXUA 1NH7A 3CC4S 1SKWA 2NXCA 2FQQB 3GR1A 1X4FA 4CLPA 4UOFA 1W7WA 2YQ1A 1H74A 1BQMB 2KO1A 4MAKA 1VYAA 3R5JB 1HNXF 5IM0B 1UEVA 2ZHAA 1GX5A 3LWLA 1JLGA 4KV8B 4NLTA 4NOHA 3OT9A 2UXCJ 4DV3F 4N8OA 3JTPA 4PQAA 4LF4J 4LBPA 2MSTA 1D8ZA 4WJBA 3A12A 2IA0A 3TX0A 4NLOA 3VZHA 1TL5A 3R7SB 1NCLA 1NJXA 3CJ4A 4B9SA 2FVCA 5KFIA 2APOA 2LYVA 4HR2A 5D4NA 3F73A 4HHUA 2UP1A 3V6JA 4CQ1A 2KG1A 2F8EX 1WOSA 5IT9U 4NXNJ 2HS4A 4QWEA 4B3TF 4ECYA 1LWXA 3UNGC 3OUYA 1GQEA 1P8GA 2FY8A 4NA3A 2RRAA 2HVDA 4DSIA 2GW8A 2D7SA 3QJPA 4CYUB 3GTYX 4EYIB 2MKCA 3LPYA 2B4UA 2OFGX 4EEYA 4P6QA 2R8GA 2GVZA 3OL6A 2CQHA 3MMJA 4YHHJ 3NNAA 2ZBQA 2Z57B 1TV6A 3ZZRA 4ED8A 4JV1A 1U6FA 2JEJA 3MEDB 2CXEA 2H5EA 3G96A 4HT7A 3QSIA 8ATCB 4WKRA 3LQVA 5B7WA 3SV4A 1JXLA 3W60A 3OTOJ 4CT9A 2CVIA 2ZC3A 2ZVIA 3OD2A 1O5JA 5K5MA 4W90B 4AXJA 4N5SA 1A0OB 2KT2A 1S1VB 3NMRA 2DGOA 4DEZA 3MM9B 3AB4B 1FDBA 2VICA 5J2MA 1HD0A 5LMNF 3KLEB 3DM2B 4DR4F 2YKNB 1IM4A 4C3MA 5F8NA 3HJFA 2V34A 1VQLS 1F5CA 4RW8B 4EZ6A 5HANA 2PIIA 1TUVA 3WC0A 1PYOB 1B0TA 4USIA 4LF8F 1LWEA 1QDUB 1KLNA 4KTQA 4NXMF 1LW2B 4K4ZA 5AJ3J 4DOZA 3HD1A 2W24A 4M94A 3HHLA 3M6VA 4ECWA 4NMLA 2QO3A 2E5IA 3BSNA 1TL1B 4TLRA 1NM2A 2MYFA 3IR6B 1KONA 5IV3A 2IFXA 1U8SA 2PA3A 5T41A 3RBEA 2GHVC 5H1SV 2MZSA 3NL0A 2ZKTA 1Q8IA 1KD1T 3HD2A 5DLGA 2A2CA 4DU7A 2C3PA 2HHQA 4ZCIA 2FDNA 2DNQA 2GQCA 1U02A 2Z2ZA 1S79A 3CCZA 4KPYA 3OSPA 3HHKA 2V6AA 2E29A 1LXJA 2Z30B 4C7QA 2VFTA 3ISZA 3L95X 1SJFA 1B64A 1KRPA 2O01C 2V0NA 3AAWB 3MCSA 3TUPA 4FPIA 3BKTA 1GTHA 2MY7A 2VBYA 3K0JA 5GADU 1P1TA 4A8MP 2B43A 1RYRA 3SBMA 2QL7B 5HMXA 1JLBA 4ITSA 1M0SA 3ISNC 4DV5F 1OQ3A 2JVOA 4URQU 5A8WB 2VD3A 4IYQA 5L39A 4KH0B 2E7WA 1NDLA 3IGVA 4L3NA 4PXDA 1SC6A 3GIKA 4O44A 4RW4B 3DMJB 3DOMA 2LECA 1F2GA 2B9YA 3MD3A 2UVRA 2YH0A 1RTHA 3ZZOA 1H6KX 2NXUA 2ADCA 1FJCA 3IS9B 4NI2A 4NYPA 3TZZA 4K2XA 2GFFA 2DNHA 1RCOB 2HS3A 4PYAA 4M5DB 3W63A 2JEGA 5D0EA 1J2VA 3G87A 2Y3YA 1U26A 3P5BP 3ZC4A 1LXNA 4RUAA 1I94J 3PYEA 3BREA 3UQSA 4WP9A 3TEHB 5HMWA 5F41A 2IBKA 2PFFB 5K20B 2C1EB 4PXCA 4NLGA 1GT8A 2HMIA 1KBRA 1E6VB 1WG5A 6FDRA 3LUYA 5HMYA 1FJ7A 1M5HA 1FKOA 1VRQC 2BVZA 3DYAA 5DDRC 2G9OA 1FJGJ 1UA0A 1JK9B 2FHJA 2Z58B 2C2RA 3DRPA 1IUJA 3C16B 5HO4A 4OV1A 3TO8A 1NZ8A 4F04B 3VGVA 1UPPA 5KFCA 4DR6J 5DRKA 2CZ9A 4LF7J 3HHLC 2QT7A 2W9AA 2V94A 4UF4A 4RW9B 3K5MA 3VF0B 1XMQJ 1S9FA 4GRSA 2XM3A 3OPKA 1X9WA 1GH8A 4LF2A 5KFLA 1RWVB 4G1IA 4JI1F 1SUQB 1C2PA 2BBEA 2ZWOA 2HQGA 4CP5A 5L38A 4FZVA 1HLWA 4RW6B 4U96A 3L09A 2V9WA 1H98A 3Q86A 2RU3A 3CTRA 2JX2A 4P52A 1IKXB 3ELHA 1IM6A 2AGQA 1NDKA 2AT1B 2QMXA 1HPZA 1QUPA 5IZHA 1H2UX 1T03A 5L1LA 3UE2A 1S6PB 1UVMA 2GV1A 1PYSB 2IHR1 4TN2A 3CCVS 3KLHA 3CDUA 5D77A 2YTCA 1GXUA 1RAFB 3V4MA 3NGRA 4FYYB 3OTDA 3OXFA 4NLUA 3NP5A 4QWBA 1ZAXA 5HROA 2VBWA 2JFDA 2ILYA 2POKA 2XMKA 2JEIA 3AD7C 3CXCR 1YHQS 4C3LA 3C14A 3PJWA 2HHHJ 2EFNA 2QLXA 1RTJB 4K0KF 3KK2A 2XGQA 4QR1A 2CPXA 1OS5A 3CT9A 1LWFB 4J9NA 3J80Y 1HMVB 1HNWJ 1U2RA 5H9EK 5L1KA 1TQLA 2B6AB 2DHSA 4X4NA 4N41A 1KQSR 3UD3P 5J1EB 1IKVB 2BE7D 2DRAA 1FKPA 3SSRA 4Q2LA 2G0CA 1G7CB 4GKKF 3ENQA 1QJHA 3PEHA 3D4JA 4Y28C 1YJUA 4X64J 2DNYA 4JI7J 2VC1A 3MFIA 3VVTA 3LP2A 3J81j 2FLPA 4X65F 3MPWA 1QAXA 2QLJB 2VG5B 3DXSX 4DPYA 3C66A 3GYGA 4PPDA 2CPJA 1K0TA 1R8AA 1RT6B 1S76D 2B3TB 4I68A 1D3WA 4C2MA 2EKYA 1FE0A 2EXUA 2AP6A 3A1YG 5FDLA 3H5XA 4JP8A 4OZ0A 2PGCA 3HO1A 2RVJA 2ROPA 4PR6A 3RJMB 2JC1A 4F7VA 3TNVA 3ADAC 1BY9A 3I0SA 4JI4F 1V3ZA 5M2RA 3C3LA 1N0VC 4IR1A 4JYAF 1KHWA 4A8KA 1QUVA 3NOGA 1LFPA 5IFMA 3DRXA 2LP4A 2BRKA 3IM8A 2VB6A 4I64A 2QV6A 5EHHA 3EZ5A 3H7HB 3ILJA 3EGVA 2PI5A 1VC6A 3H90A 2XMVA 5KFJA 2KFYA 4NX9A 3QLHB 1IBLF 3DLGB 4WE1A 3SXLA 1G1XA 1UJ6A 2P9GA 2FY1A 1S97A 3JAMU 5G0RB 1WUUA 5ETPA 4BC9A 4YY3F 1HNIA 3AOBA 5A8KB 3GV5B 3BGFA 1HW9A 3DKDA 2E7XA 4HACA 1P1LA 4FF3A 5LSRA 1WF0A 3D7SB 2GHPA 4FBTA 3BYRA 2G2YA 1P27B 1XR6A 1MMNA 2YNFB 4NZ7A 2EKNA 1YRUA 3M2VA 2YKOA 3V4IB 2E9TA 5F9LA 2NSBA 4DL7A 3MECA 1REVB 2XY6A 4DLGA 3TAQA 1X4EA 2B4PA 4IG0B 4ZPBA 2JLFA 2AX0A 3IMQJ 1OPIA 2VODA 2UXBF 2W7PA 3AA8A 4J9QA 2C2MB 2CVEA 5A8RA 3K58A 3T5JA 3N9UC 2KXNB 2J6TA 2VG7B 4OYOA 3TI0A 1F6TA 1UPMB 4P74A 4OJ1A 1DTTA 4B02A 8AT1B 2C3OA 2NUHA 1KWMA 1WC0A 1EZZB 2BR0A 4Y2AA 2Y1IA 1EJ7L 3IC1A 1VQOS 3M2UB 3CUNA 3IAM9 5LXRA 2BJ8A 2HVIA 1CJVA 2GJIA 4BS2A 1DZ5A 2XO7A 2BACA 4LQ9A 4KKOB 2RILA 1ULRA 1A9NB 2G1DA 3JS9A 3X3UA 1RE1B 3RU0A 1CQMA 3KJQB 1YDLA 1UJ4A 1P6TA 3L7PA 4ZLLA 3HP6A 1R8BA 4PABA 4NASA 4DPOA 4QR0A 3CF5Q 1UWBA 1RXOB 1Y11A 3M8PB 5HN0A 4ZS6A 5KFQA 5D4PA 2M8HA 1REGX 3D3BJ 4QIFA 4DV7F 2I9SA 3JSMB 4OI3A 3O1LA 4YR3A 4JV5F 2RRNA 1N4LA 4UOCA 4OZNA 4Z2XA 5F8MA 1DTQA 1U49A 2NUUG 1U0HB 3CD7A 2GAGC 3CCJS 1FESA 2ZOMA 2QRRA 3K59A 4FXDA 1S9EB 3AB2B 3RBDA 4JI6J 4YS2A 1NK5A 2HRTA 1R8HA 1AXQA 4ZJQA 2BEFA 5EGYA 3EGNA 5D0GA 4LIWA 1NKBA 5J1NA 2OFHX 2DXDA 4WK1A 4KHRA 3UDCA 1X0FA 1GAOA 3CCSS 1T9WA 3IWLA 3THTA 1S1UA 4X4VA 3Q22A 5ETKA 3T1YF 4TQRA 4DJBA 4Z37A 4FPRA 4I2QA 2FVRA 2UU9J 2NYHA 3DDNA 2EC0A 1RDRA 2OH2A 1B70B 1B4SA 1Y10A 2W2OP 4AD6A 4PXBA 4DSJA 4RNFA 3SFUA 1RT7B 3KOAA 3J80U 4C8KA 2CAJA 3FNNA 4LRFA 4IH6A 4M95A 1PBUA 2HWIA 1JLQB 1NPPA 2B9WA 2DNZA 1CQNA 3FSYA 4I2PA 3ET6A 4ED3A 2VDIA 1ZM9A 4RR5A 3DRRB 1WDDA 4B3RF 3BB5A 4WKYA 2ASYA 1SKUB 4X66J 1PCAA 3KMQA 3DLEA 4C8MA 4ZHRB 2F4VF 3PRVA 2QGFB 5HK4A 2V67A 1CJKA 5F8JA 3BBCA 3R5BA 5KT2A 3J7Z5 1D9AA 5KFBA 2ZJRQ 2VFUA 4O3NA 2MQQA 4ZOSA 3LP0B 1FXLA 3QRPA 4O3PA 2WTFA 4DI6A 2XSJB 3CWJA 2RKIA 4I1TA 3T19A 1S7IA 5E41A 5JUMA 1LQ9A 4G1QA 3EZOA 5I3UB 5E5NA 2ZH7A 2RMLA 2DXFA 4MKYA 2D3OR 3Q8RB 2BANB 2W7OA 5HATA 2W9BA 1EETB 2ZE2B 3N01A 3CD6S 3VQSA 3M4XA 3RW6A 3D67A 3ZZTA 1WKLA
chains in the Genus database with same CATH topology
2NYHA 2PEBA 2P8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYH A;  2PEB A;  2P8I A; 
#chains in the Genus database with same CATH topology
 2G2O A;  1Q8L A;  3VAF A;  1HFE L;  4OX6 A;  1N6Q B;  3AOA A;  3W2V B;  2O1P A;  3BN7 A;  4GC6 A;  5F3T A;  4LFA F;  4H4O B;  3I4P A;  5CQG A;  1N36 F;  3QT6 A;  1TKT A;  4TY9 A;  4XAK A;  3LP1 B;  3SDE A;  3JQM A;  4CTA A;  1SPB P;  5A2Q Y;  1WC5 A;  3OFH A;  1B99 A;  4JOU A;  1VHF A;  2FHJ D;  2GJF A;  4NCG A;  2VDH A;  1QE1 A;  4CM0 A;  1LWC B;  4U7U K;  3W5Y A;  1UVN A;  1AW0 A;  1FCA A;  4H4M A;  2MKK A;  2IDE A;  1RWK B;  1HQ2 A;  2FGO A;  4ZMM A;  1U45 A;  3ENV A;  4DX8 H;  3RRG A;  3J7A N;  4LSL A;  3DLL Q;  4ED2 A;  1OY8 A;  2ZUG A;  5ETO A;  3MAA B;  2CNL B;  3BSC A;  5KT6 A;  3DU5 A;  3CJK A;  4F2S A;  1NPR A;  4OFZ A;  5L1J A;  1FDD A;  1X5O A;  2HS0 A;  1X5P A;  1RAI B;  3OFF A;  2HLT A;  1V5I B;  2YNI A;  3TZY A;  3PKM A;  5KG6 A;  1LEO A;  4KGM A;  4ANC A;  5DG7 A;  2CPH A;  4PWU A;  1TP7 A;  1O6X A;  3VZI A;  2W9C B;  3OSN A;  1T7P A;  2LEA A;  1FK9 A;  5KFA A;  1PGZ A;  2E44 A;  1QAJ A;  5KG5 A;  2DCL A;  3BEG B;  5E2Q A;  2J0S D;  4X4R A;  3BS9 A;  3CD0 A;  3N0V A;  2CKW A;  2LXI A;  1O0P A;  4K7Q A;  2YWF A;  2KVQ E;  1X4A A;  4JV0 A;  1KDN A;  4DQI A;  4URS A;  4YDX A;  4EO6 A;  3LTO A;  4AQY J;  1VS3 A;  5J2Q B;  5E7O B;  1KTV A;  3A8E A;  3UO0 A;  3PYF A;  1A6L A;  2MHE A;  2V8V A;  5IM0 A;  1WEZ A;  2B8Q A;  2VBX A;  1X9S A;  1N52 B;  4LFB J;  5GAG I;  1CJU B;  4CLT A;  1JJH A;  4KV8 A;  4D3H A;  1HD1 A;  3CCR S;  2QMU B;  3O44 A;  3E51 A;  5JVG Q;  3EXY A;  4DCJ B;  3QGH A;  3EPG A;  4R8U B;  5AT1 B;  2HGL A;  2RQM A;  4Y65 A;  2F9D A;  2CQD A;  3HF5 A;  3A8I A;  1HKA A;  4DXL A;  4FVC A;  3PDN A;  4CH0 S;  1Q7L B;  4OJH A;  2XLI A;  2W4D A;  4G1P A;  4OMF G;  2FHO B;  2GAH C;  4P2X A;  3HFK A;  5F3Z A;  3CSK A;  2IVY A;  2K2P A;  2RS2 A;  3ZZU A;  3D1H A;  4HI1 A;  2CYY A;  4CO0 A;  1WKJ A;  3I5A A;  3CNQ P;  3QGG A;  4F4Z A;  2UXD F;  4PG8 A;  1RSC A;  2NZ4 A;  1YRX A;  1MWY A;  3EMT A;  4QJV A;  1Z4U A;  3M9O B;  3MED A;  4YR2 A;  2VA2 A;  4F4Y A;  5J2P B;  3HUL A;  2YKQ A;  1VQS A;  5LJ3 Y;  1Q78 A;  4KE5 A;  1HL6 A;  1NLK L;  4XDD A;  3BR8 A;  4RW7 B;  3GIM A;  3I9Z A;  1S1V A;  2DH8 A;  2C28 A;  1K0V A;  4PWD B;  3H20 A;  4LSZ B;  3G6X A;  3MM9 A;  4XIU A;  1OQ6 A;  2GA7 A;  1S1X B;  3C6T B;  4LFC F;  1NSQ A;  1AT1 B;  1ZZF A;  3KLE A;  4LVO P;  3DM2 A;  2BJE A;  5IOL A;  2RAQ A;  4OZ5 A;  4R5P B;  4AL7 A;  2YKM B;  1WEL A;  1RTD B;  1F3F A;  1RB0 A;  4QPT A;  1IBK F;  3FKB A;  5IT0 A;  2DGX A;  2HGM A;  3KUH A;  2RSQ A;  4RJV A;  2IMO A;  4F02 A;  2DPI A;  1XNQ J;  3PTW A;  1LW2 A;  2VJV A;  2RDD A;  3CMA S;  2PMW A;  2FJB B;  4FNI A;  4KSE B;  1YJT A;  1KVK A;  3MR3 A;  3RRH A;  4KR0 B;  3QGI A;  4RNM A;  5LMU J;  3IN5 A;  3BM7 A;  5HQL A;  4J9M A;  1Y3K A;  1TV6 B;  5LMN J;  1JXV A;  3AT1 B;  5JJB A;  4ZPW R;  2MZ1 A;  2GO8 A;  1Z2Z A;  2V8G A;  1M1H A;  4CCH A;  1RAH B;  2H3E B;  5HVF A;  3P45 B;  4XTT A;  2A6O A;  1URR A;  1YTY A;  2KYX A;  2LQ5 A;  2FB0 A;  4IOA Q;  2XLJ A;  3HK2 A;  1TZ0 A;  2OPS B;  4Q45 A;  3AA9 A;  5LXY A;  3I32 A;  5IQQ A;  2Q1L A;  2G0J A;  3QWP A;  4P10 A;  2UUB F;  3EDR B;  5DJB A;  2V8P A;  3AHP A;  3BQ1 A;  5GME A;  2W1B A;  3R6G B;  1PJ6 A;  4V19 X;  1LK5 A;  5A8W A;  2G13 A;  1MU2 B;  3GFH A;  4DHV A;  1CUL B;  4J37 A;  4JI5 F;  4OLO A;  2AHO B;  4ED4 A;  4RW4 A;  3DMJ A;  4YP3 A;  3W7B A;  3TZW A;  1D1U A;  3QRR A;  4W92 B;  4F4W A;  4PG6 A;  3PW5 A;  2CPE A;  3IS9 A;  2XY7 A;  2N4D A;  4P2F A;  4LUB A;  2YQ0 A;  1IR2 A;  4L3K A;  5EWG A;  3AOD A;  2GS8 A;  1ROF A;  2AJQ A;  5HLF B;  2XYP B;  4FF1 A;  2EFP A;  1NH8 A;  3HFZ B;  4U8V A;  4AL5 A;  4JI3 F;  1XMB A;  4ED5 A;  5DQI A;  3PJX A;  1YG0 A;  1U7L A;  1ZM3 A;  1L3K A;  4B3S J;  1VK3 A;  4DV5 J;  1FHT A;  3KHR A;  5KT4 A;  1F9F A;  3K17 A;  4ZP8 A;  3EZU A;  3S6E A;  1WKK A;  3FMB A;  2PSZ A;  1Q8B A;  4QQB A;  2NSC A;  4DDF A;  3GSD A;  4C8O A;  1E6V A;  3CCU S;  5E3C A;  1OO0 B;  2OD6 A;  2PFD A;  3PFO A;  2WRM A;  3BSA A;  2HIY A;  4BHQ A;  3C19 A;  2AYG A;  2BZ2 A;  3W66 A;  3RB0 A;  3C16 A;  2DR8 A;  1RHU B;  4O3S A;  1T05 B;  1IVZ A;  3N4W A;  5BYS A;  3W8P A;  2DIV A;  4XPE A;  2BQ3 A;  2XCP A;  4WXW A;  1YWX A;  4RW9 A;  2RU9 A;  2EW9 A;  1I5O B;  5I3Q A;  8RUC A;  5IS2 A;  2J5A A;  4YB6 A;  3MM6 B;  4WFB Q;  1SUQ A;  2XMA A;  1FWP A;  3TJ9 A;  4FYW B;  3FEZ A;  3RB3 A;  4LRB A;  4RW6 A;  2M4M A;  2ZBI A;  4MT1 A;  1KN6 A;  1RTI B;  2BX6 A;  1FX2 A;  1UAW A;  1RK8 A;  3CGI A;  2W2Q P;  3V6H A;  1IKX A;  2GZO A;  3MEK A;  1DQ8 A;  2BJD A;  1TR0 A;  3OL8 A;  1J5E F;  3CDW A;  1S6P A;  1NHU A;  5KG4 A;  2ZDO A;  1RWM B;  2HHU A;  3CJ3 A;  3VTI A;  4K59 A;  1B3T A;  5ETN A;  1N48 A;  4USV A;  5FLX U;  5MAO A;  4ZIW A;  1FKO B;  3AQP A;  4DR5 J;  4F3M A;  1K1Q A;  2OO4 A;  2J0X A;  1RAA B;  4ZVQ B;  1CBK A;  4NL5 A;  1LV5 A;  3D66 A;  4GVL A;  4YN3 B;  5KFY A;  1RTJ A;  5F0W A;  1LWF A;  3KXD A;  4ZPA A;  2HFS A;  3PRD A;  4E98 A;  1HMV A;  1WSR A;  3I0R B;  4X4S A;  3QT8 A;  2B6A A;  3CJ8 A;  4DUT A;  1CC8 A;  1X31 C;  4N7T A;  4J9L A;  2GJ2 A;  4UY8 T;  2MY8 A;  1BXN A;  3ZXW A;  5J1E A;  2MB0 B;  1IKV A;  1NSA A;  4ZVP B;  2HUR A;  4AUK A;  3BH7 B;  2XYH B;  4ECV A;  4NA1 A;  4JV2 A;  4KGZ B;  3UD5 A;  3I82 A;  3OV7 A;  4Y2K A;  1TUG B;  3KLF B;  2CWX A;  1CJT B;  2NS1 B;  2B4V A;  2NPF A;  2VH7 A;  4OJG A;  3L9Z A;  4MK7 A;  2PMH A;  2VG5 A;  4BWJ A;  2JSX A;  2B4O A;  3GU0 A;  2RUG A;  4IRK A;  4DV1 F;  1XNR F;  4F2R A;  4ILL A;  1RT6 A;  3M30 B;  4ZJL A;  1HWU A;  3R6L B;  2V4Q A;  3QZ8 A;  1DY3 A;  5H9E J;  3QFW A;  5HP1 B;  2R2T A;  1EIY B;  4EFA C;  1UFL A;  4PAA A;  3DLH A;  4UT4 A;  4C6A A;  2CPI A;  4JUZ A;  3W1Y C;  1RT3 B;  3OFE A;  2NR0 A;  2ASJ A;  2EVZ A;  1ELO A;  4GKK J;  1S48 A;  3C6U B;  4DN9 A;  2IJF A;  4CNY A;  4XK8 C;  2CQC A;  2H65 B;  3T9Z A;  4K4U A;  1X4G A;  1NEE A;  1S72 S;  2V68 A;  2XQC A;  2GCF A;  5HSP A;  1GK8 A;  3ICL A;  5HL7 Q;  2HBQ B;  5CCL A;  2QA1 A;  4RO0 A;  1GFW B;  5KOX A;  1IQT A;  5H9F J;  3FFI B;  3MXH P;  4DV2 J;  2ATL A;  4WII A;  3QLH A;  2EFG A;  2OSQ A;  2M52 A;  3DLG A;  3Q83 A;  3HSG A;  2HVZ A;  4DV0 F;  4UUW A;  3PW2 A;  1RT1 A;  4LQ3 A;  3MMA B;  4Y2M A;  2UUC J;  3GB0 A;  4ECT A;  1U4B A;  2IRX A;  2ZH1 A;  2DKO B;  2DNL A;  5G0R A;  1HQE A;  2HFU A;  1OY6 A;  1I3O B;  5A8K A;  3C2P A;  2JOQ A;  1HI0 P;  3R2C J;  2R3V A;  1SBR A;  3TA2 A;  3PV8 A;  2HEK A;  2HHX A;  1XEZ A;  3SCJ E;  3V4I A;  4QYR A;  1S77 D;  2XWY A;  4NCB A;  2V63 A;  3VAK A;  4PEO A;  2XNR A;  1REV A;  2DPJ A;  4C8Y A;  3HDS A;  1XMO F;  2X1G A;  2HZV A;  4IG0 A;  2RQ4 A;  3T6B A;  2DJW A;  2ZOF A;  2KTQ A;  3EUN A;  4F50 A;  1KOO A;  3IWN C;  3DOK B;  4RU9 A;  2HK2 A;  1VMB A;  1WSV A;  2ZNZ A;  4YY3 J;  5KFX A;  4LBI A;  1RYS A;  1OYD A;  4DFJ A;  2VG7 A;  4J9O A;  1SH2 A;  1KVI A;  3T3F A;  2DGW A;  1N33 F;  2FHM A;  2IPO B;  4HVZ A;  2J9D E;  1Q7Y T;  3K2Y A;  3UR0 A;  5K8M A;  4ZCK A;  4F36 A;  3QAE A;  1GMV A;  3M2U A;  1BWV A;  2P8I A;  3N5F A;  2MKY A;  4FYV B;  2EC2 A;  4WPA A;  4J9V A;  3PM9 A;  4BLG A;  2B5J B;  3PYG A;  2A3J A;  2CNO B;  4KKO A;  3ZFV A;  2O5D A;  1YGY A;  5B0E A;  2DIS A;  1FDA A;  1Q1K A;  3U1L A;  3PO4 A;  2C3Y A;  3VVU A;  2L9N A;  2QFI A;  1WHW A;  3PKY A;  2X7I A;  3ITH A;  3ZTR A;  4DL6 A;  3UVJ B;  2RQK A;  3R97 A;  2HHV A;  3M8P A;  3BF4 A;  3ILO A;  3KNA A;  1L5U A;  2OLW A;  4E2F B;  3R2D J;  3JSM A;  3MI7 X;  5D78 A;  3M8Z A;  2VOO A;  2C42 A;  2A2D A;  2MMY A;  5K8O A;  1VIO A;  2HHW A;  3Q8U A;  2E5L F;  3QMQ A;  2M8D B;  5KFF A;  2I38 A;  1EHW A;  1JIH A;  2AGO A;  1SQG A;  3CO9 A;  3PYD A;  4F8R A;  3H4B A;  3RRK A;  3CPW R;  2F65 A;  1PO6 A;  2J76 E;  1Q8K A;  1U0H A;  1R27 B;  2EEY A;  6AT1 B;  5F9N A;  1TAU A;  4ELT A;  3HVT B;  4JI8 F;  4GO7 X;  2IAJ B;  1S9E A;  3HXM A;  2QA2 A;  3QIP B;  5GAH U;  1BQX A;  3PHE A;  1F2H A;  2MQM A;  5LJ5 Y;  3I87 A;  1ZBT A;  2FJW A;  4JI2 F;  1EX8 A;  5DLF A;  1RBA A;  4IFY B;  3ETM A;  1EP4 B;  2EBG A;  2I8E A;  5BYR A;  1QSS A;  4G6V B;  2BW7 A;  2JH3 A;  4C3K A;  4OX9 J;  2L3M A;  1UW9 A;  2XWX A;  1AUD A;  1X8D A;  1UVI A;  1KQG B;  4P73 A;  1BQN B;  1FWK A;  3PIO Q;  2SXL A;  2BKO A;  2WON B;  1TKZ B;  2BOA A;  4RWW A;  2DNK A;  3R8Y A;  2WVD A;  5IT9 Y;  3MMB B;  5CYM B;  1HBM B;  2L9D A;  4CNZ A;  4O23 A;  3MOJ B;  1X4C A;  1JKH B;  5LT5 A;  3QSY B;  1RT7 A;  2A10 A;  2XEX A;  1VRU B;  2Q66 A;  1HR0 F;  1JLQ A;  2B51 A;  4DSE A;  2DNO A;  1CVJ A;  4KPC A;  3MAQ A;  2BJ1 A;  1Y9O A;  3JB9 k;  2UUW A;  3P5T L;  4DF8 A;  3PO5 A;  1JLE B;  1E6Y B;  1VGY A;  2YKA A;  4HTJ A;  2GIR A;  2JRS A;  5JXS A;  1AYE A;  3DRR A;  4A46 A;  3G6Y A;  3AY0 A;  2L08 A;  3CCM S;  3HSD A;  3T1Y J;  1TK0 A;  3B4D A;  2B9E A;  4ZP9 A;  3KTQ A;  4ZHR A;  1HQU B;  2HWT A;  2QLW A;  3BPS P;  4RBU A;  3P96 A;  2ZHO A;  2CAD A;  1XR5 A;  2AEF A;  5AXK A;  3BR9 A;  1IBM F;  2C22 A;  2HQI A;  3DRS B;  1RT2 B;  3IRX B;  4EO8 A;  3LP0 A;  2EFV A;  5EX3 A;  4ETZ A;  1PYT A;  2VL1 A;  4J9K A;  2XSJ A;  3CED A;  5CCM A;  2X1F A;  1SXL A;  4O4G B;  1U1R A;  4ZKA A;  2KXH A;  1NSP A;  5I3U A;  2P9C A;  2KDO A;  3RUB L;  5B0B A;  4NLP A;  2W4P A;  4M5G A;  4DS4 A;  4J90 A;  1M1K T;  1EET A;  4P2S A;  2ZE2 A;  3UNY A;  2YNG B;  1RUS A;  3I9V 9;  1KC8 T;  2F4V J;  4EWT A;  1JLF B;  3BGR B;  2UXC F;  4F0M A;  1N6Q A;  2CJ9 A;  4LF4 F;  1RJJ A;  3W2V A;  2JLG A;  4OI1 A;  4QIE A;  2FLN A;  2IVM A;  1BHN A;  1C4A A;  4H4O A;  4DN0 A;  2VFV A;  5C7P A;  3LP1 A;  1XIQ A;  1PC5 A;  2DT9 A;  4TKT A;  3V5R A;  4X4P A;  1H7X A;  2DGU A;  1PIL A;  1N8R T;  1SH3 A;  3FDS A;  2IA6 A;  4ZPC A;  2DTJ A;  3IBC B;  4NXN F;  2PO4 A;  3PCO B;  5DQG A;  1P9Q C;  1LWC A;  1S9G B;  1WF2 A;  2YPY A;  3S01 A;  2AIR B;  5IV4 A;  3QZ7 A;  3TR5 A;  3FC9 A;  3MR2 A;  3U1M A;  2R7W A;  3NWG A;  4PCQ A;  2KB2 A;  3K89 A;  2Q3P A;  3CCT A;  3FSX A;  1N5Y B;  2ATC B;  2C3M A;  1YVF A;  3MAA A;  2DCU B;  2HKE A;  4LFA J;  1FRM A;  3CD5 A;  1QM9 A;  4HLB A;  1N36 J;  2AX1 A;  1J5O B;  4YHH F;  1UZD A;  4DQQ A;  1KKH A;  3RR7 A;  1RWP B;  1T94 A;  2VF3 A;  4DL4 A;  3MUV P;  2JJ4 D;  1NB2 A;  1Q0N A;  2ZFH A;  2E7V A;  2HVE A;  5KT3 A;  4IUF A;  4NLS A;  3ULH A;  2W9C A;  1F1B B;  1RAO A;  2BW2 A;  5C25 B;  2ZHB A;  5M2P A;  1N34 F;  2CNK B;  4FYD A;  1U1Q A;  2ZC4 A;  1CS4 B;  5C24 B;  2XS7 A;  3UWT A;  4CTA B;  1U1K A;  2CQB A;  3GV8 B;  1SI9 A;  4RNO A;  1BC6 A;  2N7Y A;  3VAI A;  5KT5 A;  5J2Q A;  4TXS A;  1RGV A;  4PUO B;  2I0X A;  4E8U A;  2UUA F;  1TFY A;  2HHP A;  2R7X A;  1UCN A;  3RR8 A;  1ZM4 A;  4U67 Q;  2WSE C;  2F7V A;  4KB7 A;  5AJ3 F;  2CZV C;  5CHC B;  3FCH A;  1YQH A;  1CJU A;  1F3V A;  4WK3 A;  4DR1 F;  5IWA J;  4LSL B;  5D6G A;  3TOQ A;  1WG1 A;  1KLM B;  4R8U A;  4Y3C A;  4LVN P;  2GNK A;  3A8J A;  4DZ6 A;  2Z2M A;  2J8A A;  2CQ2 A;  2K1R B;  4QR2 A;  1U2C A;  3CDA A;  3QPI A;  3AJD A;  5B0D A;  4XO0 A;  2XS2 A;  4DPT A;  3OFG A;  2BKP A;  2KZZ A;  1WC4 A;  3I31 A;  2NYI A;  3KNG A;  4CLU A;  1JLC B;  1B0V A;  4DX6 A;  1TMM A;  3TEG A;  2VQE J;  2DXE A;  2OPR B;  3B6B A;  3MM7 B;  1YZ7 A;  3EPI A;  2W4C A;  3NGT A;  2V8H A;  2VPW B;  2V2V A;  2HND B;  1C0T A;  5B08 A;  2D3O 1;  1C0U B;  3H4D A;  3MOZ A;  4WTY A;  2XTJ P;  3D68 A;  4TU7 A;  4MYT A;  1KHV A;  1VHI A;  5J2P A;  3H25 A;  1BE4 A;  4MIW A;  2COL A;  1EKR A;  1K8A T;  1OWX A;  2R4F A;  3D9B A;  5F8G A;  4ETX A;  4RW7 A;  4PWD A;  1JQG A;  1RAE B;  4DSL A;  2ZEJ A;  1WAC A;  1S1X A;  3C6T A;  5DET A;  4ED7 A;  4EBD A;  3M8Y A;  4AYB D;  1WEX A;  5IC4 B;  4QU7 A;  3GZ7 A;  4R5P A;  2MZJ A;  2YKM A;  1RTD A;  4HL9 A;  2UXD J;  5KG1 A;  4CLW A;  4D3G A;  2VFR A;  1ZOT A;  3T9N A;  2DR6 A;  1VQ8 S;  2EFQ A;  3R7N B;  3P49 B;  3SFG A;  1RU2 A;  3TX8 A;  2LEB A;  3NCP A;  3T1H J;  3H5U A;  5MLC V;  2UVU A;  3RAQ A;  3R1H A;  2IY5 B;  2PEB A;  1S0O A;  3H2U B;  1OSD A;  4L75 A;  1MG7 A;  3G71 S;  2I5J B;  2G0I A;  3M9N B;  4CDI A;  4ZPT R;  2BE2 B;  2J7K A;  1FJG F;  4OYX A;  4TYB A;  4LFC J;  1AFI A;  3H98 A;  1UZH A;  3M8Q A;  5EWF A;  4ZVO B;  3P8B B;  1T9X A;  2EK6 A;  2A6M A;  1IBK J;  3H5S A;  2HQC A;  3B8H A;  2GIQ A;  4LF7 F;  1N5V A;  3F0N A;  1ARO P;  3W9I A;  3NNH A;  3CJ2 A;  2GML A;  1ITP A;  3LF0 A;  3M2R B;  3N5B A;  3QAU A;  1VBZ A;  4C9D A;  2ZH4 A;  4CM2 A;  5T14 A;  2HFZ A;  5GAE U;  2CQG A;  5L9X A;  2MDA A;  1KFS A;  1Q5V A;  2XMU A;  2OPS A;  1CSJ A;  2VHG A;  1R8P A;  4Q5V A;  2Q6C A;  4R0J A;  1NUE A;  4LR7 A;  1YKW A;  2DVI A;  1VJW A;  3PNI A;  4F4X A;  1NHV A;  4N8N A;  4ZVG A;  1F0X A;  1U1O A;  1WI8 A;  1D9F A;  1D8Y A;  4GVB B;  4ID5 B;  4ICL A;  2AWZ A;  4NZ6 A;  2WVF A;  1MU2 A;  3OR1 B;  4K4V A;  1CUL A;  5DG8 A;  2F3J A;  3RB4 A;  2EG2 A;  3GFY A;  2XCA A;  3VAJ A;  4IRD A;  3OVS A;  2BYC A;  5B09 A;  4P7T A;  5KG3 A;  2V4R A;  5FD1 A;  4JBC A;  3PIP Q;  5C42 A;  3ETO A;  7FDR A;  3ZZZ A;  1X60 A;  3UN5 A;  2DNR A;  3I56 S;  5HLF A;  4ECR A;  4C11 B;  4MTP A;  3NWR A;  3MEG B;  4AL6 A;  3T5L A;  3GMG A;  4DCP B;  3GG0 A;  2HHH F;  1FT8 A;  3KDO A;  5B0A A;  2KVI A;  1RWN B;  3KJV B;  3O6Q A;  5E3R A;  3JAM Y;  3PHT A;  5KT7 A;  2OMO A;  1HNW F;  4QWC A;  3GLJ A;  1XER A;  4LF6 F;  3G82 B;  3AJ1 A;  4NPO A;  3MZI A;  2KM8 B;  3EVW A;  4PG4 A;  4IOB A;  3W3S A;  5GAE I;  1GMU A;  4X64 F;  1T05 A;  4JI7 F;  2VG6 B;  2Q6B A;  5DS7 A;  1WC6 A;  1YBA A;  2AQ4 A;  4JI3 J;  3NOC A;  4TU8 A;  2HBR B;  2IYG A;  3T1A A;  2VPY B;  1Z2L A;  3CJ5 A;  3SQO P;  4DMZ A;  3MM6 A;  3IWX A;  3PJ9 A;  4UW2 A;  1V6H A;  3SQG B;  3GFX A;  2XUL A;  1RTI A;  1GTE A;  3N79 A;  2LA4 A;  2BJ9 A;  3OXG A;  4DQS A;  1SL2 A;  2HW3 A;  2BXJ A;  4DR3 J;  3KUG A;  1R7I A;  3J7A 1;  4C48 A;  3FJ2 A;  2GGP B;  5GVQ A;  4UST A;  2EPI A;  4WF9 Q;  3RG6 A;  3G8T A;  2MKI A;  4M5I A;  4DG1 B;  5A0Y B;  1RBL A;  5J2N B;  2HIQ A;  5AE1 A;  5D0R A;  3R27 A;  2E5J A;  2OD4 A;  3KJF B;  1SJ4 P;  3KDN A;  4CLF A;  2KI2 A;  4HDG A;  5I3P A;  3WDO A;  5IC6 B;  5LSO A;  3TP2 A;  2E9Z A;  1H7W A;  3PVX A;  2H9Z A;  3G4S S;  2NXN A;  3NEK A;  3BPD A;  4NCA A;  1HHT P;  1F9H A;  2RHQ B;  5GAD I;  1FRJ A;  1HWL A;  1HWJ A;  3A3N B;  2LVW A;  2DRD A;  3OTE A;  2UVW A;  4QW9 A;  3QAT A;  3I0R A;  1RLD A;  4DL0 C;  1U6Z A;  2X1A A;  3OXL A;  1ZTW A;  2LA6 A;  4Q8F A;  2ZH8 A;  2G4B A;  1TL7 B;  1T9T A;  4YQW A;  3TA1 A;  1OJ4 A;  2EBE A;  1FX4 A;  1W26 A;  4MJK A;  4Y6I A;  3ENA A;  3UFC X;  4H54 A;  3IXQ A;  4J9U E;  2ZM6 J;  5E3P A;  2KFZ A;  4P7V A;  2D9P A;  1RT4 B;  1U0S A;  3KHG A;  3KLF A;  4UZB A;  1CJT A;  1HBO B;  1YJW S;  3MPY A;  1GXL A;  1HI8 A;  1AZS B;  4ZPV R;  1DQA A;  5CAA A;  1RI7 A;  2Y0B B;  4XPC A;  3NCR A;  3M30 A;  4JI0 F;  3NGK A;  1GMW A;  2R7O A;  1SH0 A;  4DUY F;  5HP1 A;  1SJ3 P;  3R3T A;  3CCW A;  1WF1 A;  3QO9 B;  2O67 A;  1RT3 A;  2JNJ A;  3LA0 A;  3HZE A;  1DQ9 A;  4OQJ A;  3C6U A;  1KR4 A;  4DR2 F;  3SYZ A;  4RL1 A;  1Y0H A;  1VQ4 S;  1NME B;  1Y7P A;  2FPH X;  4IKA A;  3UN2 A;  3HLU A;  2G2Z A;  4ID8 A;  3LW5 C;  4PXE A;  1RWU A;  4B9L A;  1VK8 A;  3O3L A;  3G86 A;  4WYL A;  4DV1 J;  1ZAV A;  3FFI A;  4RBT A;  3J7Y U;  4F67 A;  1Q5Y A;  4RNN A;  4PG5 A;  2F8M A;  1JJC B;  1ACM B;  3MMA A;  3HJV A;  2YVS A;  2R7V A;  1XR7 A;  1S6U A;  2FYX A;  2VAS A;  3JQJ A;  3M6U A;  3P4U B;  3CC2 S;  2XMJ A;  4B9M A;  4QIV A;  2P9E A;  5BR8 J;  3UD4 P;  2AGP A;  3I6P A;  1NXI A;  5E33 A;  4ZIT A;  1WOP A;  2AKW B;  5KAK A;  2DK2 A;  4DL2 A;  2ZZT A;  4B9U A;  4MKB A;  2XB2 D;  4CRJ A;  4IFV B;  2YWE A;  3Q8Y A;  4RUC A;  2WSC C;  2XLK A;  4WZM A;  1RZM A;  1ZS6 A;  2EG1 A;  1TU0 B;  3TW0 A;  2FIU A;  2RHS B;  2YWK A;  1XWL A;  3DOK A;  2CJX B;  3VAL A;  2XY5 A;  2JL9 A;  2R7S A;  2G1H A;  1RQ0 A;  3E01 B;  3HPO A;  3OJS A;  1WOO A;  3HT3 A;  1L3T A;  1N5T A;  4ES2 A;  3ONQ A;  2HZC A;  1HBN B;  1V3S A;  4S0M A;  1R0B G;  4RNH A;  1J27 A;  4CI0 B;  1FRX A;  2JFK A;  2CJA A;  4DU8 A;  5CD4 H;  4GMK A;  3HSJ A;  2MQP A;  5GMD A;  1HW8 A;  4Y34 A;  1RT1 B;  1UFW A;  2B5J A;  2DNP A;  4LBH A;  4USH A;  3KLG B;  2HBY B;  5F0U A;  2QJ3 A;  2JLE A;  1R31 A;  2OIH A;  5FJ4 A;  2MGZ B;  1NKC A;  3OR2 B;  3EDQ B;  2AEJ A;  1HQE B;  4LRC A;  3G8S A;  3MPD A;  2BAB A;  2D9O A;  2PI4 A;  4GO5 X;  3BV8 A;  3D2W A;  5E3A A;  4MIB A;  2J0Q D;  3B54 A;  4QZV B;  2IBO A;  2KXF A;  5ETV A;  1U09 A;  4ENO A;  1VQ9 S;  1WTF A;  3JQK A;  2FUG 9;  1OIA A;  3UVJ A;  2PEH A;  5DDP C;  3TVK A;  3PR5 B;  1Y00 A;  5DG9 A;  1TL3 B;  4X66 F;  3M32 B;  2F9J A;  1XN9 A;  1YJR A;  2L9W A;  4ZCM A;  4CLS A;  2ILZ A;  2XSF A;  3NBP A;  4RLE A;  4B3M J;  3T41 A;  2ZH2 A;  1JXE A;  3CJR A;  4TLQ A;  1S4F A;  3JTO A;  1VQN S;  3GJT B;  4KQZ A;  2CPD A;  2R8I A;  3MHY A;  1AB8 A;  2LXF A;  5F8L A;  2YQ3 A;  1R6V A;  3P3D A;  4QIG A;  3BO3 A;  1VQP S;  1HNZ J;  3FK4 A;  3GJR B;  3KLV A;  2LFV A;  4GKJ F;  3T6J A;  3HVT A;  1K9M T;  3HHE A;  2IAJ A;  2A0F B;  3QIP A;  1X4D A;  4NYZ A;  3VHQ A;  4K4W A;  4ILM A;  4UUX A;  2YWG A;  1L3V A;  2XZD B;  1TFW A;  4I7F B;  2AMC B;  1NDC A;  3UR3 C;  5KFG A;  2QA4 G;  2H4Y B;  3HCX A;  5HVG A;  2OPP B;  3SCK E;  4IFY A;  3MPV A;  3S1T A;  1EP4 A;  3X1L B;  3NCQ A;  2E5L J;  4ECZ A;  2IIH A;  3DHW C;  3ITH B;  4AXI A;  2AV5 A;  4UY8 5;  4C8L A;  1R89 A;  5D3G B;  3NGU A;  3Q0A A;  3M8W A;  3EIC A;  4P71 A;  4ED6 A;  1BQN A;  5T7L B;  2CNN B;  4NEZ A;  2C3U A;  2BM0 A;  2DEI A;  2WON A;  1TKZ A;  2WOM B;  2Z8Q A;  3MAH A;  4LF9 F;  4DR7 J;  3ILL A;  4M1K A;  4LF5 J;  4C0H A;  2AJ1 A;  1TMJ A;  2VPX B;  3MMB A;  2FVP A;  5CYM A;  1I6J A;  1HBM A;  5KG0 A;  1SC1 B;  2QYG A;  3W62 A;  1S59 A;  1JKH A;  4F4K A;  4KFB B;  1VRU A;  2V2Z A;  4OYB A;  3H0P A;  4QBU A;  3SSS A;  5D0H A;  4RX6 A;  5DZ7 A;  1VR6 A;  2ZUA A;  2FJA B;  1WHY A;  2B56 A;  1JLE A;  1E6Y A;  2BJ3 A;  1JLA B;  3MDF A;  1RP5 A;  1MRO B;  1KQK A;  4DV6 F;  4LRE A;  1EQM A;  1SL0 A;  3BN4 A;  2M88 A;  4KRW A;  1HQU A;  1D09 B;  1H0H B;  3AQO A;  1PG5 B;  4ZP7 A;  3W64 A;  3TAR A;  1H72 C;  1UTA A;  4WIQ A;  2XYG B;  5HBM B;  1XK8 A;  1N32 F;  3RW7 A;  2GMH A;  2MQL A;  3DRS A;  1M5P C;  1RT2 A;  3IRX A;  2J8S A;  1RWW B;  1HHQ A;  3BQ2 A;  7AT1 B;  2NLW A;  2A18 A;  5BJR A;  4AQY F;  4O4G A;  3THV A;  3R5G A;  3BJY A;  4OV6 A;  2LCW A;  3KUE A;  1QSY A;  2IRY A;  4ED1 A;  4NLX A;  1X9M A;  4YUD A;  1Y4Z B;  3DGV A;  3MUT P;  2BRL A;  4DCO B;  2NQP A;  3GP9 A;  2YNG A;  2ACY A;  5KFK A;  4QYZ K;  2W2M P;  3DN9 A;  2R8K A;  4UQT A;  1JLF A;  3BGR A;  1UL3 A;  3ZTP A;  3KK1 B;  3TA0 A;  2F5G A;  4K4T A;  1NK0 A;  3O5T B;  2W25 A;  4NMX A;  2MHN A;  4J5O A;  4LR8 A;  1IBM J;  2ERR A;  2IDL A;  1SC3 B;  1V9O A;  3E3X A;  2C2K B;  3CCQ S;  1T02 A;  2AF6 A;  5ETT A;  1JNR B;  3JYT B;  2ACM A;  2RH3 A;  1S9G A;  2GMJ A;  1U1L A;  1WC3 A;  2Z4P A;  3D0I E;  1Q16 B;  2FVS A;  5KFU A;  2WCX A;  2YBV A;  3KHL A;  1VRT B;  1X4B A;  1W2B R;  4X4O A;  4CO5 A;  3OHB A;  1UVJ A;  4KHP J;  2RF2 B;  1N5Y A;  1F5B A;  1NDP A;  5CZX A;  3DOL B;  5JVH Q;  3DLJ A;  2AJF E;  4WZQ A;  4BBY A;  4YFU A;  4LSN B;  3W2W B;  3J81 U;  1J5O A;  2F63 A;  4PPZ A;  2DGS A;  4N76 A;  2VFS A;  2CQ1 A;  4Q8E A;  2Y1R I;  3JXO A;  5LL6 d;  2RRB A;  4USK A;  2HG4 A;  2HFN A;  1TK8 A;  1WJ9 A;  4WYW A;  4K5S A;  2FC9 A;  5EDW A;  1W2I A;  1U24 A;  3M05 A;  2LDY A;  5C25 A;  4Q43 A;  2XZW A;  1S6Q B;  1MW7 A;  1WEY A;  4O3R A;  1CS4 A;  3A8K A;  1VBK A;  2M5Y A;  3OLB A;  1FVQ A;  5C24 A;  3UCU P;  3CJ0 A;  1N5Q A;  1HYS B;  3LAK A;  1T95 A;  4QU6 A;  2H51 B;  1G4C A;  3TAM B;  4PQU B;  2E9R X;  2E5H A;  2NXJ A;  4PUO A;  2CDR B;  2PE8 A;  7FD1 A;  1MWZ A;  4X62 J;  5KFN A;  1XNQ F;  3FQL A;  1BWE A;  1NHK L;  1NK8 A;  2MJN A;  2GX8 A;  2KRR A;  2M3D A;  1S0N A;  2XMM A;  3VQT A;  3CW2 C;  2ALY B;  1F60 B;  4H4K A;  4K4X A;  2BDP A;  3A13 A;  5F8I A;  2K7J A;  3BBB A;  4I67 A;  2E1P A;  4LF1 A;  4K4S A;  1N34 J;  4M5L A;  3MUR P;  1YI2 S;  1KLM A;  5BXI A;  1R0A B;  5CA5 A;  5ETL A;  5EWE A;  5LMU F;  2K1R A;  1R8C A;  2EI5 A;  2E1M C;  1Q95 G;  3AD8 C;  1QSL A;  2KRB A;  1TVR A;  1GXT A;  3VAH A;  2D3U A;  3CJQ A;  1UKU A;  3W5Z A;  4YB1 P;  3PAC A;  3TRG A;  4WCE Q;  5AE2 A;  5CYQ B;  1NB7 A;  3FBB A;  4K2J A;  4DSK A;  1JLC A;  2UUA J;  2VUG A;  2XG8 A;  3B4M A;  4KHM A;  5KOW A;  1RWO B;  3A3P B;  3BO2 A;  3C15 B;  4ELU A;  1WDT A;  3OL9 A;  4CIO A;  2OPR A;  3MM7 A;  4DR1 J;  3I5C A;  3QWU A;  4IO1 A;  4A8X A;  3GE9 A;  5ETQ A;  3US5 A;  4KGV B;  5CYJ A;  2N4C A;  1GMW D;  3OLA A;  5DO2 A;  5CZV A;  4ZLP A;  3ILI A;  4MIA A;  2HND A;  4EI2 A;  2MLZ A;  1HAR A;  2CDQ A;  3DGP B;  1VOM A;  2FZK B;  4ZK7 M;  3GYN A;  1C0U A;  4WXO A;  4Q2M A;  1UA1 A;  1GEH A;  4Y0F A;  1IXK A;  3A4T A;  1FEE A;  2JVR A;  3FBF A;  1U1P A;  2OUG A;  4FN5 A;  4HH0 A;  3DXB A;  3W5X A;  5IXU A;  4IH5 A;  2W7A A;  3OW2 R;  2Q43 A;  3VCD A;  2IM1 A;  4YEA A;  3LGM A;  2M7S A;  2CJK A;  2CG4 A;  4DUZ F;  1S6O A;  5KFD A;  2WB1 D;  1Y3J A;  1KEK A;  3GR0 A;  4MKA A;  1VI7 A;  2X1B A;  4U8Y A;  5FLX Y;  2IC3 B;  2DR5 A;  4C4W A;  1H3D A;  2I1R A;  3KYL A;  4J91 A;  1B0P A;  3PFE A;  2NPI A;  4WP3 A;  1HNX J;  2VJU A;  1LFW A;  4B3S F;  5I4M A;  2VQF F;  3WQP A;  2ZIT A;  2QEX S;  2KJW A;  4M5M A;  2I6W A;  2AU0 A;  2J9D A;  2OHD A;  1TUW A;  4MK9 A;  1RAB B;  1R3N A;  1RLC L;  3CIZ A;  3THP A;  4F0K A;  4FF2 A;  1H2T Z;  2HNZ B;  4DV3 J;  3K5N A;  2I5J A;  2XHW A;  3TUJ C;  1MLA A;  1HBU B;  2JWN A;  1T9Y A;  2BE2 A;  3NS7 B;  1C0T B;  3MM5 B;  1UVK A;  2VON A;  2LU1 A;  2RQC A;  3MCO A;  3ZO7 A;  3GQC A;  2AW0 A;  2PA8 D;  2R7U A;  3WHI A;  4B3T J;  3GCX P;  3NGD A;  1CC7 A;  1WD6 A;  5E3Q A;  4H4K C;  3C8Y A;  3M2R A;  4ZLN A;  4O0N A;  1YK9 A;  4ZVH A;  2R7R A;  4C97 A;  1KS2 A;  3UW1 A;  3LWM A;  3QFH A;  3TJA A;  3DRY A;  2HHT A;  4ECU A;  1AUS L;  2KL8 A;  5KG7 A;  1U47 A;  3CC7 S;  2NRE A;  2QN6 B;  1VBX A;  1SIW B;  2ZDP A;  3MMC A;  4DS5 A;  4B08 A;  5KFS A;  3MFH A;  3FUY A;  4NA2 A;  1PSD A;  4GVB A;  4ID5 A;  3MR7 A;  4OI0 A;  2KHC A;  2GIF A;  3OR1 A;  4M5H A;  4UTG A;  2V2Q A;  2Y8W A;  1TKX B;  1IWG A;  3SCI E;  1XBW A;  2ADB A;  4MK8 A;  4FKX A;  3E8O A;  2LDI A;  2W8L A;  1UW4 A;  4LR9 A;  4DR5 F;  3HX9 A;  1TAQ A;  1EQ0 A;  2FJD B;  4FNH A;  3FBC A;  4PG7 A;  5SZT A;  3M8Q B;  4DR4 J;  2RD5 C;  4C11 A;  3MEG A;  3TQ1 A;  3WX4 A;  2E66 A;  4ANE A;  3KK3 B;  2HBZ B;  2Z56 B;  4KH1 B;  2H4W B;  2QIF A;  1IJE B;  2ROG A;  4LF8 J;  1SKR A;  3KJV A;  2WSF C;  1DHM A;  4NXM J;  1T8E A;  2MEW A;  2OAU A;  3CMQ A;  3AXM A;  1S0M A;  3DDI A;  4OHV A;  2CRL A;  3NS6 A;  3UDV A;  1NAQ A;  3BH6 B;  3OQ2 A;  3R5D A;  3G82 A;  3D1O A;  3HSZ A;  2F4F A;  1WI6 A;  1YBT A;  4KY3 A;  1OY9 A;  2HAI A;  2PN6 A;  4DL3 A;  5KFT A;  2AJ4 A;  1VC0 A;  1FRI A;  1EAR A;  3CIM A;  1MWQ A;  3MPU B;  1IJF B;  3RAM A;  2QLF B;  3EXC X;  1O51 A;  3QNW B;  1C1B B;  4R0E A;  3DC2 A;  3H59 A;  2KT3 A;  3PY8 A;  1S1W B;  3B78 A;  2VG6 A;  4AT1 B;  1FO1 A;  3AFG A;  2K06 A;  1NJI T;  3HVW A;  2WK4 A;  2BKN A;  4ICL B;  4ZVF A;  4NLY A;  1OYE A;  3IGN A;  4WU2 A;  2OEK A;  1JX4 A;  3KG4 A;  4B3O B;  4ES3 A;  2CPF A;  3M7V A;  2YX1 A;  4YDD B;  5C42 B;  4LF6 J;  1UVL A;  3L7O A;  1AA1 B;  3SQG A;  2IVF B;  3R5C A;  4B9N A;  2OSR A;  4C8N A;  1ZM2 A;  2BA9 A;  5HJY A;  1PJ5 A;  4F0H A;  1DLO B;  1EB0 A;  2GGP A;  1G2E A;  2LQJ A;  4PKD B;  3KJN B;  4IRC A;  3CJS A;  3DLK B;  5LM7 E;  4OYZ A;  1ZA2 B;  9ATC B;  1RA7 A;  3K5L A;  4NRT A;  4IQX A;  4DG1 A;  5A0Y A;  3LAL A;  5J2N A;  3LGN A;  1MML A;  3BGL A;  5H9F K;  4K4Y A;  2FTR A;  4KGK A;  3ZTO A;  2ZBC A;  4EK2 A;  4DV2 F;  3MEE B;  4HT5 A;  3CCE S;  4A47 A;  1WNE A;  2EK1 A;  3CVK A;  4URG A;  1NJZ A;  1SCJ B;  2UUC F;  2HNY B;  2IMW P;  1M90 T;  4ZLJ A;  4K5R A;  3D0H E;  3QT7 A;  2R2U A;  4OX8 A;  2XC9 A;  1NBE B;  4IO9 Q;  3TVZ A;  5DM7 Q;  5THW A;  3RBZ A;  2YX4 A;  1PAU B;  3NMA A;  4WFY A;  4HH1 A;  2OGU A;  2WAQ D;  3BGO P;  3UN3 A;  4F3Q A;  3TWZ A;  4FS2 A;  1YJV A;  1YIJ S;  3K57 A;  3H8Y A;  4USW A;  3EGZ A;  3BZQ A;  1TL7 A;  2XS5 A;  4KO0 B;  3M1V A;  2RIJ A;  3TVY A;  1YZ6 A;  3K5O A;  3LAN A;  2V4J B;  4TY8 B;  1WHX A;  3ZTQ A;  1MN9 A;  1IKW A;  3ZZP A;  2ZZM A;  2N3L A;  2M0G B;  3EE3 A;  2MQN A;  3IO1 A;  4CO3 A;  4EU0 A;  3D6H B;  3IP0 A;  4Q0B B;  1N54 B;  3AH6 A;  1YLX A;  1RT4 A;  1SQE A;  2F8H A;  2Y1L B;  2AD9 A;  1B7F A;  3WBZ A;  1HBO A;  2W8K A;  3PX0 A;  1JB0 C;  4HKQ A;  3UI3 A;  1W25 A;  1AZS A;  1RAG B;  1JNZ B;  4X4T A;  2GC8 A;  2DHG A;  1Q81 T;  2AJ0 A;  2XZT B;  4BC7 A;  2VC0 A;  1LNQ A;  2IM3 A;  5SUH A;  4JI1 J;  3MM8 B;  3V81 B;  2KM8 C;  2UUT A;  2MPU A;  1KOH A;  1VIS A;  3H2L A;  2DIT A;  3QO9 A;  3EWG A;  4KC5 A;  2X3G A;  4EBE A;  2LQB A;  2KN4 A;  2IRU A;  2FJV A;  2MTL A;  5DDO C;  2DD8 S;  5I42 B;  3TYT A;  2K7K A;  2GO9 A;  2Y1J A;  3GSI A;  3TUZ C;  4DX5 A;  1QVG R;  4WFX A;  3U1N A;  1IKY B;  5KTQ A;  2GQ2 A;  2N3O A;  2E5G A;  2RE1 A;  4RBV A;  1NRK A;  3SIP B;  2AJ2 A;  2GVD B;  3TJ8 A;  5HMZ A;  4BDP A;  4IDK B;  3JSY A;  4JI0 J;  1OMS A;  3ISN D;  4MFB B;  2V69 A;  4USJ C;  3W9J A;  4DUY J;  1ZPW X;  5DGA A;  1WWH A;  4O3Q A;  5L46 A;  1NK4 A;  1M1G A;  3MF5 A;  1SV5 A;  4DL5 A;  2J9C A;  5CH7 B;  5RUB A;  3FQK A;  2R7Q A;  1PBA A;  3HI9 A;  3FSI A;  4K0K J;  4DR2 J;  4NLW A;  2E1A A;  1RHM B;  3NAI A;  3IFE A;  2QL9 B;  1S1T B;  1Y5I B;  2E1C A;  1R6Y A;  2KH9 A;  3OVA A;  2QL5 B;  3BSO A;  2HK3 A;  5KG2 A;  3L7U A;  1JJ2 R;  1HA1 A;  2EFO A;  2QC3 A;  3GCW P;  2BE9 B;  4IFV A;  4NLR A;  9RUB A;  5C2C A;  1OPZ A;  1X7V A;  4ECQ A;  3FCV A;  2R7T A;  4I6W A;  2P2C B;  1ZET A;  1Q82 T;  2CQP A;  4OX9 F;  2J6S A;  4DQR A;  2QE5 A;  4QW8 A;  1JMT A;  3E01 A;  4X65 J;  5C2G A;  4F4A A;  3BDE A;  4Q7A A;  3WX8 A;  4DV4 F;  3KWM A;  3V6D B;  1HBN A;  2FJX A;  1TK5 A;  5M2U A;  2VA3 A;  4CLL A;  3P6Y C;  1VQ7 S;  2UV8 A;  3DDK A;  3NGS A;  3G6V A;  3KLG A;  2YNH A;  2W01 A;  2MGZ A;  3QRQ A;  3OR2 A;  3HHL D;  1RU1 A;  5ETM A;  3VV2 B;  3M8S A;  5K14 B;  2K3I A;  1DFD A;  2DGQ A;  3D6F B;  4A8F A;  2OML A;  4L72 B;  4JI4 J;  1X5T A;  1K44 A;  1GNK A;  4A4J A;  2DH7 A;  2LEP A;  2CWK A;  4JYA J;  3EVO A;  4A48 A;  3DNC A;  2PDA A;  4C0O C;  2R8J A;  1TL3 A;  3R1L A;  3M32 A;  3OJU A;  3MTK A;  2JC0 A;  4C8Z A;  1C1C B;  3F56 A;  3UDE A;  5F8H A;  2GQQ A;  1BGX T;  2J7U A;  5U47 A;  4M5J A;  1IBL J;  2KZM A;  4OZ2 A;  3A3O B;  3D28 A;  5KFH A;  4Y00 A;  2D1C A;  1RAD B;  5EN1 A;  4ZA1 A;  1S12 A;  3QID A;  2DYA A;  2JEF A;  2ZH5 A;  1ZH5 A;  2MKS A;  4P72 A;  3G6E S;  1SB6 A;  2MJU A;  1DJ0 A;  3DI6 B;  5AXL A;  5IQ6 A;  5HJX A;  4L73 A;  2QZ8 A;  3MUM P;  4I7F A;  3WZ0 A;  1RT5 B;  2N82 B;  2DHH A;  5KFE A;  2YPZ A;  2OPP A;  1NSK L;  1ZZN A;  5LSL A;  4J9R A;  1DBD A;  4A8O A;  2WHO A;  2ZWP A;  2I2Y A;  1LK7 A;  2F40 A;  3HT0 A;  4OL8 A;  1WG4 A;  1PKU A;  3KLI A;  4YB7 A;  2UXB J;  4P75 A;  2U2F A;  3VGS A;  5D3G A;  5B0G A;  4I6A A;  2GHW A;  5JMN A;  2QSF A;  1HI1 A;  1KVJ A;  5T7L A;  2OI2 A;  4KJI A;  4GKJ J;  1U48 A;  4NWB A;  2LKZ A;  4WP8 A;  2WOM A;  4W98 A;  3NBP B;  4ZCL A;  1RTZ A;  4JB8 B;  2VOP A;  1P9Y A;  4DPX A;  4EUV A;  4KFB A;  1MMD A;  3K8W A;  2K8G A;  1H73 A;  5D8H B;  3CB4 A;  3LAM A;  2BUN A;  4TVA B;  1S7H A;  2OEM A;  5GAG U;  2L48 A;  1JLA A;  3POT B;  1LW0 B;  1MRO A;  3PW7 A;  3PG9 A;  3S8S A;  3IG1 B;  2RJZ A;  1U1M A;  3R7B B;  1UEK A;  2O3D A;  1XJW B;  2XI3 A;  3BQ0 A;  4LF9 J;  2FVQ A;  3Q8Q B;  1Q4R A;  1DAR A;  5HBM A;  4DV7 J;  5DZ6 A;  5ETR A;  2KJV A;  1URN A;  2AZ3 A;  1RKI A;  5DGB A;  2CUY A;  2YY3 A;  2V9K A;  4JV5 J;  1SKS A;  4I69 A;  1X0P A;  2FZG B;  3CME S;  4R25 A;  4LMZ A;  3VAG A;  2JHE A;  2C2O B;  5HVH A;  2ZD1 B;  3Q24 A;  4N77 A;  3BO4 A;  1WOR A;  3U27 A;  5E0O A;  3IR5 B;  4DV6 J;  4G3I A;  4ZVR B;  1T3N A;  4OHY A;  4CZC A;  3Q89 A;  5IWA F;  6FD1 A;  1RBO B;  2HRU A;  3KK1 A;  3HVR A;  3BBF A;  3FCW A;  1PIE A;  1N32 J;  1S49 A;  4M5K A;  1VFJ A;  3KMS A;  1FNO A;  4KT0 C;  4A8S A;  3JYT A;  1T3O A;  2UVV A;  2FLL A;  3FEX B;  1BQM A;  3FRZ A;  2YWH A;  1VLY A;  1UMJ A;  2KG0 A;  1FD8 A;  3SCL E;  1O8B A;  4ED0 A;  2D3Z A;  2ZH6 A;  3NY0 A;  1VRT A;  1VC5 A;  3KG0 A;  2YH1 A;  2VQE F;  3G9C A;  4NRU A;  4P9S A;  1HNV B;  2RF2 A;  1UFK A;  4CLZ A;  1R43 A;  2VKZ G;  5GAH I;  4QYZ J;  3DOL A;  1XQI A;  1FE4 A;  2X3D A;  4J9P A;  1IR1 A;  1RAJ A;  3T5K A;  3PXG a;  2VV5 A;  3G8Q A;  1SJ1 A;  4LSN A;  3UCG A;  3W2W A;  5KFP A;  1S4E A;  2FGC A;  3CDB A;  4K8R A;  4X2B A;  4DWI A;  3DHX A;  2D41 A;  4N47 A;  2OEL A;  3B82 A;  4B3R J;  4YR0 A;  3H2V E;  3QJL A;  2VKR A;  2LQ9 A;  2Z0G A;  3BKU A;  2Y0S D;  4USM A;  4Z7C A;  2ZVS A;  4DFP A;  3AOC A;  4O3O A;  1S6Q A;  1BMQ B;  1MSW D;  1RKJ A;  4RZR A;  4CYU A;  3DCA A;  4IG3 B;  1ZPV A;  2HLU A;  1HYS A;  3MTJ A;  3M8R A;  4TYA A;  2OPQ B;  3GYX B;  3TAM A;  1SC4 B;  2ABY A;  4RUB A;  2L41 A;  1K1S A;  4PQU A;  2DO4 A;  2D69 A;  4ZDN A;  1FTR A;  2KHD A;  1NO8 A;  4OHX A;  2ASD A;  4LRA A;  2YX7 A;  3T1H F;  1FXR A;  2RNE A;  3DFE A;  3SI8 A;  1JLG B;  4FYX B;  3MR5 A;  1RHK B;  3SV3 A;  1IN0 A;  1R0A A;  1YSJ A;  4ZPD A;  1RCX B;  2DY1 A;  1U6B A;  4BCA A;  2CJB A;  1WC1 A;  1G3O A;  2XMT A;  4M63 A;  2YKN A;  2CQ3 A;  4ZP6 A;  3HFV A;  5J1P A;  3SMZ A;  3N28 A;  1FTC A;  4RW8 A;  5CYQ A;  2WVB A;  4FXV A;  2P6S A;  1M5S A;  4J7C A;  3OTO F;  1FER A;  3D1Q A;  4QCL A;  4ZVE A;  4CO2 A;  3OUY B;  1UET A;  4OI6 A;  3W9H A;  3ZNJ 1;  4FDF A;  3C15 A;  4P2M A;  2BMB A;  3CDE A;  5EUH A;  1NJY A;  4DF4 A;  1NKE A;  2D74 B;  3NS5 A;  4WWS A;  1TL1 A;  4MYU A;  2B9X A;  4EGL A;  3E2E A;  1VQM S;  3DGP A;  2GVZ B;  3M6X A;  4AND A;  1SQF A;  4UOG A;  2VZ9 A;  3FRY A;  2U1A A;  2KU7 A;  2BQU A;  1N0U A;  4CT8 A;  3UPF A;  2IJN A;  3SEO A;  2HWH A;  2KYZ A;  5AXM A;  1T9U A;  4PWW A;  1LOU A;  3PW4 A;  4W4M A;  3S7R A;  5HI7 A;  1VJQ A;  1FFW B;  3FBE A;  1VIX A;  2JDJ A;  1RAC B;  2R42 A;  1FRK A;  2Z2Y B;  1QAI A;  3OTB A;  3QGP A;  5CD4 A;  3C46 A;  3G2X A;  2CFX A;  4HDH A;  3RYL A;  4IH7 A;  5J2M B;  4MKV A;  4EZ9 A;  3GON A;  3W61 A;  1TVR B;  1M5O C;  3QT5 A;  3MWB A;  4K50 A;  3PW0 A;  1JWW A;  2IC3 A;  1FVS A;  3EM1 A;  4Y2C A;  2Z2L A;  4PRF A;  1NU4 A;  1VQ6 S;  5AXN A;  2MQ8 A;  4OYW A;  1LWE B;  2OTJ S;  1VBY A;  1NPK A;  4M8L A;  4MH8 A;  3JTN A;  3LH2 S;  3RB6 A;  3HHL B;  3HKZ D;  2HNZ A;  5A2Q U;  3K7R A;  4N56 A;  1NJW A;  2RUS A;  1TL4 A;  4O4R A;  1Q86 T;  4FXW A;  4E0D A;  1FFS B;  4IR9 A;  1YJ9 S;  1F9E B;  4L76 A;  1HBU A;  1S0V A;  1M5V C;  2B0G A;  4ERD A;  1DAX A;  2MZT A;  4HHJ A;  2XI2 A;  3ENW A;  3PEJ A;  4DUZ J;  3MM5 A;  2R2R A;  4ZN1 A;  3BDP A;  1VCT A;  1D9D A;  2W2N P;  2JZ5 A;  4FF4 A;  4ZN3 A;  2MZQ A;  1YBU A;  4M5D A;  3MGJ A;  1ZTT A;  2DY9 A;  1S99 A;  2V2K A;  1GX6 A;  2DO0 A;  3TAP A;  3HM9 A;  2V50 A;  2VQF J;  4A8W A;  4DZD A;  4OYA A;  3T5H A;  2IM2 A;  5KFZ A;  3EJM A;  4FS1 A;  3OTC A;  3OBI A;  4NE9 C;  3BKF A;  4EBC A;  4F25 A;  2QA4 S;  2HZA A;  4I56 A;  4OYP A;  1UWA A;  4DR3 F;  1JLB B;  1SL1 A;  1I94 F;  4WU3 A;  2BQR A;  4HYK A;  1QY7 A;  2A1B A;  3HKW A;  3O2I A;  4QIW D;  4ER8 A;  4U7C A;  5AE3 A;  1TKX A;  1KTQ A;  4O44 B;  2M9K A;  3DOM B;  3GJS B;  1IWA A;  2XGP A;  1RTH B;  4NEY A;  4WFA Q;  4QWD A;  4FP9 A;  4ES1 A;  2AYB A;  4NI2 B;  2FD2 A;  1RHQ B;  2QMW A;  4FBU A;  2LU2 A;  1YRT A;  4LIR A;  4OLP A;  3HHN B;  1C4C A;  3HHD A;  4DR6 F;  1X5S A;  3KK3 A;  4U9R A;  5LOQ A;  2DEJ A;  1L3U A;  4X84 A;  2CJQ A;  4NYO A;  1XMQ F;  2R2S A;  1HWI A;  4OI2 A;  4X4U A;  1RHJ B;  3U02 A;  5ITH A;  2OTL S;  3I55 S;  4KAI A;  2DNG A;  3CO0 P;  3D6T B;  4LJM A;  3AD9 C;  1VQK S;  3OVB A;  2J9E A;  2DHA A;  4CH7 A;  2QYC A;  4B17 A;  2HMI B;  3NAH A;  1IR0 A;  1MNE A;  1VLO A;  5CAB A;  5KFR A;  1YIT S;  3DYA B;  1H2V Z;  4KYZ A;  4QOT A;  4ZVU B;  2ZM6 F;  3M9M B;  3DRP B;  2WVC A;  3MMC B;  1C1B A;  1S1W A;  4CH1 A;  3VGU A;  3ZZY A;  1FNX H;  1ZYQ A;  2XNQ A;  2OP5 A;  4TNO A;  3W8G A;  4PYD A;  4B3O A;  4NLV A;  1OSC A;  3F44 A;  4DBQ A;  2DR9 A;  3ZTS A;  5HQM A;  4YOE A;  1NZA A;  1UEU A;  4OIX A;  2BJ7 A;  2ASL A;  1PAE X;  2UUB J;  1DLO A;  3R5A A;  4IOC Q;  2H5J B;  3DLK A;  1CEZ A;  1U1N A;  1HPZ B;  2DIU A;  2HPU A;  1YJN S;  1X4H A;  5KFO A;  5CXT A;  1T03 B;  4L6V 3;  1HWK A;  1S10 A;  4JI5 J;  3DLB A;  2C2Z B;  3KLH B;  1NK6 A;  3RAX A;  3BGU A;  5HAO A;  3MEE A;  1R0C B;  3FMW A;  2WBR A;  1QTM A;  1N88 A;  4U7U D;  1RWX B;  2AYE A;  5HRO B;  4CO1 A;  1T11 A;  3KG1 A;  1DUR A;  2HNY A;  3I4H X;  1I1G A;  4M5N A;  2DNM A;  1Y5L B;  3C14 B;  2CJY B;  2H48 B;  2WW8 A;  1KFD A;  3N6M A;  4OZJ A;  3KK2 B;  5BR8 F;  4B9V A;  2OEJ A;  3TUI C;  3K8V A;  3R9L A;  3NXZ A;  4UZC A;  4FKY A;  1Q79 A;  1JJ4 A;  2AZ1 A;  4ZIV A;  2DRB A;  2ZKU A;  2YXL A;  2HQD A;  1S57 A;  4U95 A;  4C98 A;  4KO0 A;  2CQ0 A;  2MQO A;  2WBM A;  3IBF B;  4DSF A;  2V4J A;  4TY8 A;  2C2N A;  2MKH A;  1QLN A;  1FKP B;  3TZX A;  3FEY B;  5DM6 Q;  3UCZ P;  3W65 A;  3GII A;  4QWA A;  4Q0B A;  1TEL A;  3RTV A;  1RA6 A;  4USU A;  3EX7 B;  4RUH A;  2NCK L;  1V3R A;  4PZV A;  3LP2 B;  1MN7 A;  3AJ2 A;  2M70 A;  5ADZ A;  3OL7 A;  3NLC A;  4I0W A;  4ECS A;  4XDC A;  1SJQ A;  2B8P A;  1APS A;  4RPF A;  4RU2 A;  2DGT A;  5GMK a;  4AE5 A;  2HYI B;  1NK7 A;  2M2B A;  4TQS A;  2PT0 A;  2YNF A;  3MM8 A;  3V81 A;  4AFF A;  5FDL B;  5C5J A;  3V2U C;  1UP1 A;  2F1F A;  3UDL A;  5D4O A;  2B7C B;  5HQ8 A;  1FRL A;  1ZAW A;  1Z1Z A;  3I0S B;  5KFW A;  3V6K A;  3MD1 A;  5A6P A;  3J7Z T;  2P6T A;  5I42 A;  3FVY A;  1K47 A;  1Y5N B;  1PJ7 A;  2QX0 A;  3FZ2 A;  1J5E J;  4B9T A;  3Q8S B;  1IQZ A;  4ELV A;  1IKY A;  1TKD A;  4Z7Y A;  4HHH A;  3EYZ A;  4NZ0 A;  1QVF R;  3M1V B;  3IRW P;  2GVD A;  4HTI A;  5B0F A;  4IDK A;  4OX7 A;  3H42 A;  4MFB A;  1IKW B;  1SIZ A;  3L3C A;  2RDJ A;  4X4Q A;  4B3M F;  4WE1 B;  2FC8 A;  2BV3 A;  4NLD A;  4OZ1 A;  1FNM A;  3ZZ0 A;  4OZ3 A;  2DH9 A;  2ZNY A;  5FII A;  4CLY A;  1FEH A;  1PC4 A;  3PZP A;  2WVE A;  2V8D A;  1YX2 A;  3RZA A;  1HNI B;  2WB4 A;  3LO3 A;  1G6B A;  1HNZ F;  1FF2 A;  1FWL A;  4OHW A;  2UV8 G;  2VBZ A;  2J7W A;  4HAC B;  1S1T A;  3D54 A;  2XMW A;  3GFZ A;  1KQF B;  1L3S A;  3M2V B;  3GG1 A;  2IJR A;  3JSB A;  2IM0 A;  4A8Y A;  4KIA A;  2C2E A;  3K5P A;  3GIJ A;  4ALZ A;  2CPZ A;  3MEC B;  4ZJO A;  4WFN Q;  3I5B A;  1VQ5 S;  4CWB A;  2HHS A;  1FXD A;  2OJ3 A;  4WBF A;  4FVM A;  4C0B A;  4V19 J;  4IQM A;  1BLU A;  5A8R B;  3N6N A;  2PD1 A;  3JSR A;  3MCN A;  3V6D A;  3VAM A;  4OJ3 A;  1XNR J;  2C2D A;  4DR7 F;  1DTT B;  4LF5 F;  1FI4 A;  2R8H A;  1I51 B;  4ZVT B;  2ZJQ Q;  2Y9H A;  3WC2 A;  2X51 A;  1U8W A;  3O8W A;  3NNC A;  2H1Y A;  4I6Y A;  3GPA A;  5DDQ C;  4ZVS B;  1CJV B;  5K8P A;  2OKQ A;  1SV5 B;  1K73 T;  1QD1 A;  5K14 A;  2MKJ A;  4A8Q A;  2HRY A;  2KKH A;  3PX6 A;  3VR1 A;  2HAF A;  2K3K A;  3EVM A;  2HGN A;  3AXK A;  4TU9 A;  2V5H G;  3NKY A;  1RIS A;  2EWH A;  4NLQ A;  4JI6 F;  1LKZ A;  3J81 Y;  1UWB B;  4DV4 J;  3MCM A;  4DPU A;  1C1C A;  1SVD A;  1AFJ A;  4OYI A;  2MXY A;  2CQI A;  2VU5 A;  2FLO A;  4Q44 A;  1QTN B;  3MR6 A;  3Q8P B;  2WZ1 A;  3ZNU A;  4DV0 J;  3GIL A;  3QBC A;  3M6W A;  2QSW A;  2DB1 A;  3HVA A;  2CIM A;  3FZB A;  2CZ4 A;  1DRZ A;  3TQE A;  2DR7 A;  2LLZ A;  1XC9 A;  4OYM A;  1DTQ B;  3DU6 A;  4OI4 A;  2UU9 F;  3WIU A;  2FZC B;  3GIR A;  3QYY A;  2CQ4 A;  3DI6 A;  2UZA A;  2ALZ A;  2B7B B;  1H38 A;  4F26 A;  2J6U A;  1RT5 A;  2MSS A;  1U2F A;  2VPZ B;  1ICE B;  1T9V A;  3D3C J;  2YNH B;  2ROE A;  2AYM A;  1FFG B;  3NG8 A;  1XMO J;  2H5I B;  4CO4 A;  5B0C A;  2QG9 B;  3D5M A;  3IAS 9;  1IBC B;  2IYI A;  3J7Y I;  1NND A;  2FJE B;  3U7J A;  4RKU C;  4HEA 9;  4EMD A;  3H40 A;  5L1I A;  1WTB A;  1S1U B;  4UOH A;  3Q2S C;  4DPW A;  1HHS A;  2Y8Y A;  2KFN A;  4I2Q B;  2RT3 A;  1N33 J;  1CLF A;  3KHH A;  4CLK A;  2NXE A;  1EAY C;  2BM1 A;  1N5S A;  5KFM A;  1FKA F;  1UJ5 A;  1ZA1 B;  2BAN A;  1KNZ A;  3PR4 A;  2HFO A;  3GJQ B;  4LT6 A;  2QLB B;  4KHP F;  2RS8 A;  2AEM A;  2HFV A;  1U25 A;  4DLE A;  4DFM A;  2XO6 A;  2ZOG A;  3IBW A;  3VGT A;  2ZZN A;  5DQH A;  2ZH3 A;  1EKS A;  1B7Y B;  3F41 A;  4I4B A;  1S5Z A;  5D15 A;  1V5V A;  3Q23 A;  2LMI A;  5K8N A;  1QAY A;  3SSQ A;  4I2P B;  3ET6 B;  3POT A;  1LW0 A;  5IT4 A;  3LOU A;  2HQF A;  3IG1 A;  1HIY A;  4HI2 A;  1FJE B;  2YKP A;  4OZL A;  3CUL A;  2DNN A;  3DLE B;  3IM9 A;  2QTW A;  2WW4 A;  4F3O A;  2P5V A;  1CJK B;  2QFJ A;  2YWW A;  3L4B C;  5K9F A;  1XTZ A;  2MLY A;  2VIH A;  4ILR A;  1FRH A;  3VWS A;  3D6M B;  1A7G E;  4ECX A;  1FDN A;  2R9L A;  3KLI B;  2XHC A;  3HMJ G;  2KT5 A;  3HZG A;  2FHK A;  4EYH B;  3H5Y A;  2RKI B;  4OHZ A;  4LRD A;  4U6P A;  3QJJ A;  4G1Q B;  5BYQ A;  1CG2 A;  3CE8 A;  4KBI A;  4JI8 J;  2ZD1 A;  4X62 F;  1TTH B;  3IR7 B;  1WHV A;  3LPE A;  5ETS A;  3KFW X;  1CPZ A;  3I96 A;  2W9B B;  2E1R A;  5D4L A;  4G65 A;  4J9S A;  3IA0 A;  4QPX A;  2CPY A;  4DQP A;  2CG8 A;  2MLX A;  1FA0 A;  2ZBP A;  1VQY A;  3FGV A;  4GC7 A;  4JI2 J;  5EX0 A;  3QQC D;  4KGX B;  2J0W A;  2O66 A;  4RWX A;  2H54 B;  2PC6 A;  3NRB A;  2ZBR A;  1TKT B;  1SJR A;  3SDE B;  4YME A;  2DHX A;  3SZ2 A;  1T0T V;  2NZC A;  2BOP A;  2RB7 A;  4YB5 A;  3RGI A;  1NK9 A;  3KKF A;  2XBP A;  3Q8V A;  4NCG B;  4WTO B;  1QE1 B;  4L74 A;  2HQ3 A;  5A6W A;  4MMO A;  3PRB A;  4WFZ A;  5A76 A;  2DGV A;  3D0G E;  3RBX A;  4ATN A;  4H4M B;  2CA9 A;  2ZJP Q;  4DFK A;  3WIV A;  1YJ7 A;  2DBB A;  1KSP A;  1HNV A;  3OHA A;  1M5K C;  3BYP A;  3CJT A;  5KFV A;  2PMZ D;  3N6L A;  3TAN A;  3GV7 B;  1N56 A;  3PX4 A;  3LGH A;  2MZR A;  3GWC A;  3Q2T C;  2LQ8 A;  2ZH9 A;  1HR0 J;  3CJK B;  2N7C A;  2YNI B;  1F5A A;  5G4D A;  4V1A k;  1KP6 A;  4O0I A;  1VDH A;  3EGW B;  2HSE B;  4LFB F;  1BUX A;  1FD2 A;  1FK9 B;  2W2P P;  4BWM A;  1BD6 A;  2HVH A;  4UQG A;  1RHR B;  1D0E A;  5L8R C;  2Q79 A;  4Y2I A;  4DX7 A;  2RDI A;  3CCL S;  4IG3 A;  1Q53 A;  2OPQ A;  5L9N A;  2LXU A;  1NH7 A;  3CC4 S;  1SKW A;  2NXC A;  2FQQ B;  3GR1 A;  1X4F A;  4CLP A;  4UOF A;  1W7W A;  2YQ1 A;  1H74 A;  1BQM B;  2KO1 A;  4MAK A;  1VYA A;  3R5J B;  1HNX F;  5IM0 B;  1UEV A;  2ZHA A;  1GX5 A;  3LWL A;  1JLG A;  4KV8 B;  4NLT A;  4NOH A;  3OT9 A;  2UXC J;  4DV3 F;  4N8O A;  3JTP A;  4PQA A;  4LF4 J;  4LBP A;  2MST A;  1D8Z A;  4WJB A;  3A12 A;  2IA0 A;  3TX0 A;  4NLO A;  3VZH A;  1TL5 A;  3R7S B;  1NCL A;  1NJX A;  3CJ4 A;  4B9S A;  2FVC A;  5KFI A;  2APO A;  2LYV A;  4HR2 A;  5D4N A;  3F73 A;  4HHU A;  2UP1 A;  3V6J A;  4CQ1 A;  2KG1 A;  2F8E X;  1WOS A;  5IT9 U;  4NXN J;  2HS4 A;  4QWE A;  4B3T F;  4ECY A;  1LWX A;  3UNG C;  3OUY A;  1GQE A;  1P8G A;  2FY8 A;  4NA3 A;  2RRA A;  2HVD A;  4DSI A;  2GW8 A;  2D7S A;  3QJP A;  4CYU B;  3GTY X;  4EYI B;  2MKC A;  3LPY A;  2B4U A;  2OFG X;  4EEY A;  4P6Q A;  2R8G A;  2GVZ A;  3OL6 A;  2CQH A;  3MMJ A;  4YHH J;  3NNA A;  2ZBQ A;  2Z57 B;  1TV6 A;  3ZZR A;  4ED8 A;  4JV1 A;  1U6F A;  2JEJ A;  3MED B;  2CXE A;  2H5E A;  3G96 A;  4HT7 A;  3QSI A;  8ATC B;  4WKR A;  3LQV A;  5B7W A;  3SV4 A;  1JXL A;  3W60 A;  3OTO J;  4CT9 A;  2CVI A;  2ZC3 A;  2ZVI A;  3OD2 A;  1O5J A;  5K5M A;  4W90 B;  4AXJ A;  4N5S A;  1A0O B;  2KT2 A;  1S1V B;  3NMR A;  2DGO A;  4DEZ A;  3MM9 B;  3AB4 B;  1FDB A;  2VIC A;  5J2M A;  1HD0 A;  5LMN F;  3KLE B;  3DM2 B;  4DR4 F;  2YKN B;  1IM4 A;  4C3M A;  5F8N A;  3HJF A;  2V34 A;  1VQL S;  1F5C A;  4RW8 B;  4EZ6 A;  5HAN A;  2PII A;  1TUV A;  3WC0 A;  1PYO B;  1B0T A;  4USI A;  4LF8 F;  1LWE A;  1QDU B;  1KLN A;  4KTQ A;  4NXM F;  1LW2 B;  4K4Z A;  5AJ3 J;  4DOZ A;  3HD1 A;  2W24 A;  4M94 A;  3HHL A;  3M6V A;  4ECW A;  4NML A;  2QO3 A;  2E5I A;  3BSN A;  1TL1 B;  4TLR A;  1NM2 A;  2MYF A;  3IR6 B;  1KON A;  5IV3 A;  2IFX A;  1U8S A;  2PA3 A;  5T41 A;  3RBE A;  2GHV C;  5H1S V;  2MZS A;  3NL0 A;  2ZKT A;  1Q8I A;  1KD1 T;  3HD2 A;  5DLG A;  2A2C A;  4DU7 A;  2C3P A;  2HHQ A;  4ZCI A;  2FDN A;  2DNQ A;  2GQC A;  1U02 A;  2Z2Z A;  1S79 A;  3CCZ A;  4KPY A;  3OSP A;  3HHK A;  2V6A A;  2E29 A;  1LXJ A;  2Z30 B;  4C7Q A;  2VFT A;  3ISZ A;  3L95 X;  1SJF A;  1B64 A;  1KRP A;  2O01 C;  2V0N A;  3AAW B;  3MCS A;  3TUP A;  4FPI A;  3BKT A;  1GTH A;  2MY7 A;  2VBY A;  3K0J A;  5GAD U;  1P1T A;  4A8M P;  2B43 A;  1RYR A;  3SBM A;  2QL7 B;  5HMX A;  1JLB A;  4ITS A;  1M0S A;  3ISN C;  4DV5 F;  1OQ3 A;  2JVO A;  4URQ U;  5A8W B;  2VD3 A;  4IYQ A;  5L39 A;  4KH0 B;  2E7W A;  1NDL A;  3IGV A;  4L3N A;  4PXD A;  1SC6 A;  3GIK A;  4O44 A;  4RW4 B;  3DMJ B;  3DOM A;  2LEC A;  1F2G A;  2B9Y A;  3MD3 A;  2UVR A;  2YH0 A;  1RTH A;  3ZZO A;  1H6K X;  2NXU A;  2ADC A;  1FJC A;  3IS9 B;  4NI2 A;  4NYP A;  3TZZ A;  4K2X A;  2GFF A;  2DNH A;  1RCO B;  2HS3 A;  4PYA A;  4M5D B;  3W63 A;  2JEG A;  5D0E A;  1J2V A;  3G87 A;  2Y3Y A;  1U26 A;  3P5B P;  3ZC4 A;  1LXN A;  4RUA A;  1I94 J;  3PYE A;  3BRE A;  3UQS A;  4WP9 A;  3TEH B;  5HMW A;  5F41 A;  2IBK A;  2PFF B;  5K20 B;  2C1E B;  4PXC A;  4NLG A;  1GT8 A;  2HMI A;  1KBR A;  1E6V B;  1WG5 A;  6FDR A;  3LUY A;  5HMY A;  1FJ7 A;  1M5H A;  1FKO A;  1VRQ C;  2BVZ A;  3DYA A;  5DDR C;  2G9O A;  1FJG J;  1UA0 A;  1JK9 B;  2FHJ A;  2Z58 B;  2C2R A;  3DRP A;  1IUJ A;  3C16 B;  5HO4 A;  4OV1 A;  3TO8 A;  1NZ8 A;  4F04 B;  3VGV A;  1UPP A;  5KFC A;  4DR6 J;  5DRK A;  2CZ9 A;  4LF7 J;  3HHL C;  2QT7 A;  2W9A A;  2V94 A;  4UF4 A;  4RW9 B;  3K5M A;  3VF0 B;  1XMQ J;  1S9F A;  4GRS A;  2XM3 A;  3OPK A;  1X9W A;  1GH8 A;  4LF2 A;  5KFL A;  1RWV B;  4G1I A;  4JI1 F;  1SUQ B;  1C2P A;  2BBE A;  2ZWO A;  2HQG A;  4CP5 A;  5L38 A;  4FZV A;  1HLW A;  4RW6 B;  4U96 A;  3L09 A;  2V9W A;  1H98 A;  3Q86 A;  2RU3 A;  3CTR A;  2JX2 A;  4P52 A;  1IKX B;  3ELH A;  1IM6 A;  2AGQ A;  1NDK A;  2AT1 B;  2QMX A;  1HPZ A;  1QUP A;  5IZH A;  1H2U X;  1T03 A;  5L1L A;  3UE2 A;  1S6P B;  1UVM A;  2GV1 A;  1PYS B;  2IHR 1;  4TN2 A;  3CCV S;  3KLH A;  3CDU A;  5D77 A;  2YTC A;  1GXU A;  1RAF B;  3V4M A;  3NGR A;  4FYY B;  3OTD A;  3OXF A;  4NLU A;  3NP5 A;  4QWB A;  1ZAX A;  5HRO A;  2VBW A;  2JFD A;  2ILY A;  2POK A;  2XMK A;  2JEI A;  3AD7 C;  3CXC R;  1YHQ S;  4C3L A;  3C14 A;  3PJW A;  2HHH J;  2EFN A;  2QLX A;  1RTJ B;  4K0K F;  3KK2 A;  2XGQ A;  4QR1 A;  2CPX A;  1OS5 A;  3CT9 A;  1LWF B;  4J9N A;  3J80 Y;  1HMV B;  1HNW J;  1U2R A;  5H9E K;  5L1K A;  1TQL A;  2B6A B;  2DHS A;  4X4N A;  4N41 A;  1KQS R;  3UD3 P;  5J1E B;  1IKV B;  2BE7 D;  2DRA A;  1FKP A;  3SSR A;  4Q2L A;  2G0C A;  1G7C B;  4GKK F;  3ENQ A;  1QJH A;  3PEH A;  3D4J A;  4Y28 C;  1YJU A;  4X64 J;  2DNY A;  4JI7 J;  2VC1 A;  3MFI A;  3VVT A;  3LP2 A;  3J81 j;  2FLP A;  4X65 F;  3MPW A;  1QAX A;  2QLJ B;  2VG5 B;  3DXS X;  4DPY A;  3C66 A;  3GYG A;  4PPD A;  2CPJ A;  1K0T A;  1R8A A;  1RT6 B;  1S76 D;  2B3T B;  4I68 A;  1D3W A;  4C2M A;  2EKY A;  1FE0 A;  2EXU A;  2AP6 A;  3A1Y G;  5FDL A;  3H5X A;  4JP8 A;  4OZ0 A;  2PGC A;  3HO1 A;  2RVJ A;  2ROP A;  4PR6 A;  3RJM B;  2JC1 A;  4F7V A;  3TNV A;  3ADA C;  1BY9 A;  3I0S A;  4JI4 F;  1V3Z A;  5M2R A;  3C3L A;  1N0V C;  4IR1 A;  4JYA F;  1KHW A;  4A8K A;  1QUV A;  3NOG A;  1LFP A;  5IFM A;  3DRX A;  2LP4 A;  2BRK A;  3IM8 A;  2VB6 A;  4I64 A;  2QV6 A;  5EHH A;  3EZ5 A;  3H7H B;  3ILJ A;  3EGV A;  2PI5 A;  1VC6 A;  3H90 A;  2XMV A;  5KFJ A;  2KFY A;  4NX9 A;  3QLH B;  1IBL F;  3DLG B;  4WE1 A;  3SXL A;  1G1X A;  1UJ6 A;  2P9G A;  2FY1 A;  1S97 A;  3JAM U;  5G0R B;  1WUU A;  5ETP A;  4BC9 A;  4YY3 F;  1HNI A;  3AOB A;  5A8K B;  3GV5 B;  3BGF A;  1HW9 A;  3DKD A;  2E7X A;  4HAC A;  1P1L A;  4FF3 A;  5LSR A;  1WF0 A;  3D7S B;  2GHP A;  4FBT A;  3BYR A;  2G2Y A;  1P27 B;  1XR6 A;  1MMN A;  2YNF B;  4NZ7 A;  2EKN A;  1YRU A;  3M2V A;  2YKO A;  3V4I B;  2E9T A;  5F9L A;  2NSB A;  4DL7 A;  3MEC A;  1REV B;  2XY6 A;  4DLG A;  3TAQ A;  1X4E A;  2B4P A;  4IG0 B;  4ZPB A;  2JLF A;  2AX0 A;  3IMQ J;  1OPI A;  2VOD A;  2UXB F;  2W7P A;  3AA8 A;  4J9Q A;  2C2M B;  2CVE A;  5A8R A;  3K58 A;  3T5J A;  3N9U C;  2KXN B;  2J6T A;  2VG7 B;  4OYO A;  3TI0 A;  1F6T A;  1UPM B;  4P74 A;  4OJ1 A;  1DTT A;  4B02 A;  8AT1 B;  2C3O A;  2NUH A;  1KWM A;  1WC0 A;  1EZZ B;  2BR0 A;  4Y2A A;  2Y1I A;  1EJ7 L;  3IC1 A;  1VQO S;  3M2U B;  3CUN A;  3IAM 9;  5LXR A;  2BJ8 A;  2HVI A;  1CJV A;  2GJI A;  4BS2 A;  1DZ5 A;  2XO7 A;  2BAC A;  4LQ9 A;  4KKO B;  2RIL A;  1ULR A;  1A9N B;  2G1D A;  3JS9 A;  3X3U A;  1RE1 B;  3RU0 A;  1CQM A;  3KJQ B;  1YDL A;  1UJ4 A;  1P6T A;  3L7P A;  4ZLL A;  3HP6 A;  1R8B A;  4PAB A;  4NAS A;  4DPO A;  4QR0 A;  3CF5 Q;  1UWB A;  1RXO B;  1Y11 A;  3M8P B;  5HN0 A;  4ZS6 A;  5KFQ A;  5D4P A;  2M8H A;  1REG X;  3D3B J;  4QIF A;  4DV7 F;  2I9S A;  3JSM B;  4OI3 A;  3O1L A;  4YR3 A;  4JV5 F;  2RRN A;  1N4L A;  4UOC A;  4OZN A;  4Z2X A;  5F8M A;  1DTQ A;  1U49 A;  2NUU G;  1U0H B;  3CD7 A;  2GAG C;  3CCJ S;  1FES A;  2ZOM A;  2QRR A;  3K59 A;  4FXD A;  1S9E B;  3AB2 B;  3RBD A;  4JI6 J;  4YS2 A;  1NK5 A;  2HRT A;  1R8H A;  1AXQ A;  4ZJQ A;  2BEF A;  5EGY A;  3EGN A;  5D0G A;  4LIW A;  1NKB A;  5J1N A;  2OFH X;  2DXD A;  4WK1 A;  4KHR A;  3UDC A;  1X0F A;  1GAO A;  3CCS S;  1T9W A;  3IWL A;  3THT A;  1S1U A;  4X4V A;  3Q22 A;  5ETK A;  3T1Y F;  4TQR A;  4DJB A;  4Z37 A;  4FPR A;  4I2Q A;  2FVR A;  2UU9 J;  2NYH A;  3DDN A;  2EC0 A;  1RDR A;  2OH2 A;  1B70 B;  1B4S A;  1Y10 A;  2W2O P;  4AD6 A;  4PXB A;  4DSJ A;  4RNF A;  3SFU A;  1RT7 B;  3KOA A;  3J80 U;  4C8K A;  2CAJ A;  3FNN A;  4LRF A;  4IH6 A;  4M95 A;  1PBU A;  2HWI A;  1JLQ B;  1NPP A;  2B9W A;  2DNZ A;  1CQN A;  3FSY A;  4I2P A;  3ET6 A;  4ED3 A;  2VDI A;  1ZM9 A;  4RR5 A;  3DRR B;  1WDD A;  4B3R F;  3BB5 A;  4WKY A;  2ASY A;  1SKU B;  4X66 J;  1PCA A;  3KMQ A;  3DLE A;  4C8M A;  4ZHR B;  2F4V F;  3PRV A;  2QGF B;  5HK4 A;  2V67 A;  1CJK A;  5F8J A;  3BBC A;  3R5B A;  5KT2 A;  3J7Z 5;  1D9A A;  5KFB A;  2ZJR Q;  2VFU A;  4O3N A;  2MQQ A;  4ZOS A;  3LP0 B;  1FXL A;  3QRP A;  4O3P A;  2WTF A;  4DI6 A;  2XSJ B;  3CWJ A;  2RKI A;  4I1T A;  3T19 A;  1S7I A;  5E41 A;  5JUM A;  1LQ9 A;  4G1Q A;  3EZO A;  5I3U B;  5E5N A;  2ZH7 A;  2RML A;  2DXF A;  4MKY A;  2D3O R;  3Q8R B;  2BAN B;  2W7O A;  5HAT A;  2W9B A;  1EET B;  2ZE2 B;  3N01 A;  3CD6 S;  3VQS A;  3M4X A;  3RW6 A;  3D67 A;  3ZZT A;  1WKL A; 
#chains in the Genus database with same CATH homology
 2NYH A;  2PEB A;  2P8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...