2NYHA

Crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
GMTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPMWSYQLAFTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dioxygenase
publication title Crystal structure of putative Dioxygenase (YP_555069.1) from Burkholderia Xenovorans LB400 at 1.70 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08883 DOPA_dioxygen Dopa 4,5-dioxygenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits DOPA-like domains 2nyhA00
2NYHA 2P8IA 2PEBA
chains in the Genus database with same CATH superfamily
5D8HB 1RWXB 2QG9B 1S79A 1ROFA 5F9NA 2DNOA 3GJSB 3TR5A 2D7SA 1XJWB 5E3QA 2A10A 3H20A 1EKRA 3UPFA 3CCUS 2OPQB 5FDLB 4PG6A 3NLCA 3AA8A 3NNHA 1U7LA 2VZ9A 3U1NA 2G9OA 5F8GA 3S7RA 3GIKA 2FC8A 4LBIA 2R7WA 1UFWA 4DV1J 1O8BA 4D3HA 1IBMJ 4KO0B 4LSLB 1CVJA 4U95A 2R9LA 2WVBA 3SIPB 2R7UA 5IFMA 3TAMB 2NUHA 4J9UE 1CULB 4NLQA 4USMA 3IBFB 3HJFA 2E44A 4UUWA 4U67Q 2QGFB 4LRBA 4LF8F 1D1UA 4KKOB 2KRRA 4RBUA 3J7YU 1A6LA 2CJKA 3GFZA 2ATLA 1RADB 2VQFJ 2IHR1 2ACMA 4ILRA 2OPSA 1UAWA 4B9TA 2VJUA 1WC5A 1OJ4A 4C8MA 2AYGA 4JI0F 2QL7B 4Q2LA 2VDHA 2XHCA 3GIIA 1BY9A 4K4TA 2V8VA 2HHVA 2BW7A 2VL1A 2NXNA 1RTJA 2DJWA 2RUGA 4ZMMA 1OQ3A 2V2VA 1GXUA 2I5JB 4PPZA 4A47A 3D0IE 2AWZA 4BWMA 1BQXA 5C24A 1IJFB 5CYQA 4ZOSA 1S9GB 1J5OB 4AL6A 1SJ1A 2MZRA 1I51B 1RKJA 1FKOB 2DD8S 1ZS6A 2ZKTA 3RRKA 5ETOA 4TNOA 2WB4A 1OQ6A 3NXZA 4ICLB 3G2XA 4W4MA 4TN2A 5D3GA 3BQ0A 3FBCA 1HR0F 3QLHB 4ED1A 3FGVA 1UWAA 2RF2A 4DR2F 2B5JA 1VC0A 3AD8C 1X9SA 4HTJA 9RUBA 3QNWB 3D3CJ 2OLWA 2HHXA 4FP9A 1NXIA 2CJQA 3QRPA 1IJEB 2H54B 2J9DE 4RLEA 2Y1IA 3M05A 1Q8KA 1H2TZ 1X4EA 3KKFA 4AT1B 4TLQA 2CQ1A 2ZBRA 2KVIA 3PO4A 1I1GA 3M8RA 4ED0A 3PRVA 4JV1A 2VG6A 4R25A 2FJDB 4FPIA 4CLFA 1IBLF 2JEJA 4OI4A 5LJ5Y 2XLKA 1BE4A 5K14A 3CDBA 3QJPA 1YLXA 2ZBPA 4C4WA 2FTRA 4DS4A 3VAKA 4J37A 4MYUA 3HT0A 4NLWA 3R7SB 5GAGI 4ECTA 3MECA 2KG0A 5E33A 2POKA 4ZHRA 5HMYA 1HBUA 1S6QA 1Q8IA 2OPSB 3WHIA 2F7VA 4ANDA 3MMAB 3OV7A 1OIAA 2YQ0A 3CJ8A 3FUYA 1FX4A 2WRMA 1PJ5A 1D9FA 3THTA 5F0WA 2FHMA 3E2EA 1RTJB 2FC9A 1NK8A 2LVWA 4QU7A 2NQPA 3FQKA 4TU9A 3LO3A 2COLA 1VGYA 1U26A 5CYQB 1VK8A 2HVHA 1TUVA 3EZUA 2UUCJ 5KG2A 2O67A 3CJQA 2D3UA 3A4TA 3NCPA 1RT4A 4RW9A 2HZVA 1YHQS 5L46A 1VOMA 4LF4J 4DCPB 1JIHA 2YWFA 2CJAA 3F73A 2GMJA 2PA8D 5D3GB 2IJRA 1ZPVA 3KFWX 2FHJA 2R7TA 1YK9A 3BBFA 4EO8A 2DR9A 3BEGB 4UW2A 3MOZA 1KQFB 2B5JB 3IA0A 4MH8A 4IG3A 2XGPA 2APOA 3B8HA 2CXEA 5AE2A 4CYUA 3M9OB 2OSRA 3NS7B 1WHYA 4PR6A 2B4PA 4HT5A 4A8SA 4TY9A 2YNIB 4FF3A 2E9ZA 3RYLA 3ETMA 2V34A 2CPXA 1EETA 2DGTA 5GAEU 3EUNA 2ZH6A 3A3NB 4DUYJ 3RW7A 1T9UA 1KWMA 1PJ6A 8AT1B 1BXNA 2VG6B 1H7XA 4H4KC 5K14B 4U7UD 4JP8A 3V81A 2IVMA 5I3UA 4A8KA 2VBZA 4RKUC 2VG7A 4DV1F 4Z2XA 1IBMF 2RDJA 3PR4A 3M8YA 1R8CA 1FK9A 3J81Y 3MECB 2VPYB 3PJWA 2YVSA 1U49A 4U8VA 4MKYA 4CTAA 1HBUB 1S6QB 3CGIA 3KLFA 2H1YA 1ITPA 4LR9A 1AA1B 1FO1A 1WEXA 3DDIA 2HHUA 2B4OA 2RU3A 3BGOP 3K2YA 1U47A 4EZ9A 2ZH2A 3JQJA 1S0NA 4YS2A 2VQFF 2XY7A 1HWUA 4ZIVA 1YBUA 4DR5J 4TU7A 4H4KA 1CSJA 4NLVA 4JYAJ 2A18A 1EHWA 2CPJA 1BQMA 5HSPA 1CJVA 3CC2S 1UVIA 3OXLA 4NX9A 1RT4B 3EJMA 4MTPA 4RW9B 2FJVA 4CT9A 4KAIA 4NA2A 3I55S 4F4WA 4KFBA 3H90A 1YI2S 2XMUA 3CUNA 3TQ1A 1C0TA 1RT3A 3KLGB 3POTA 4P6QA 1FTCA 1JMTA 2V8HA 2JX2A 2R2SA 1PYOB 4ER8A 3CJ2A 2D9PA 2KZMA 2E29A 4TLRA 4IG3B 1W2BR 2VOPA 2GIQA 2LA4A 3M7VA 1QVFR 4CYUB 4QR2A 1GX5A 3CCLS 3ULHA 2XQCA 1RU2A 3IC1A 1GTEA 1VBXA 3UNGC 2DR6A 5LMUJ 3K5MA 1TKTA 4WXOA 3WIVA 1EETB 5F8JA 2WZ1A 4OHVA 2VFSA 3OL8A 4ZITA 3L9ZA 1K73T 2BJ1A 4E2FB 3BO4A 1FA0A 2HHTA 3EXYA 2YPYA 4DR7J 1JJ4A 3A1YG 4NLPA 3JYTA 3V81B 3P5BP 4G1IA 1D3WA 1U8SA 4URQU 4UOFA 1T9WA 1NB2A 2PSZA 1T0TV 3DOMA 3TA1A 3QGPA 1TV6B 1FK9B 4NA3A 4ZS6A 1MMDA 3JTNA 5LMNJ 3PX4A 3UDCA 2R42A 4CTAB 2KU7A 4OZ2A 1JJ2R 1JLCA 1WKKA 4F04B 1HQ2A 3NS5A 1N5SA 4PQUA 4K2XA 1ZYQA 1S7HA 4FXWA 4PRFA 1X7VA 2RS8A 2VFTA 2EFGA 3EXCX 5L9NA 1Q7LB 1Q16B 3UDLA 5L1LA 4CIOA 1FKAF 2YNHA 5KFMA 3DLLQ 1QD1A 1CJVB 2XTJP 2BM1A 1E6VB 4DPWA 4DI6A 2K3IA 1JK9B 2MLXA 1J27A 2DB1A 1NB7A 1HQUA 2KJVA 5DDRC 4YHHJ 4KFBB 4WTOB 2QYGA 1C0TB 2Y1LB 4MT1A 3R9LA 2UUCF 1IBKJ 2YY3A 4CLPA 2Y1JA 1SQEA 2FGOA 3W2WA 1RB0A 4RPFA 5D6GA 2AD9A 2XNRA 5BXIA 5B0GA 4LF4F 4RNNA 1AFJA 3CJSA 5C42B 3BM7A 1K44A 1UW9A 1U6ZA 4ECRA 1WHXA 4LFBJ 4DR1J 1FNOA 2EK1A 1UW4A 4WYLA 1YGYA 1TKTB 2DNRA 3KDOA 1NKBA 2EK6A 4LF9J 2FHKA 2MZJA 3HSJA 3GPAA 2RUSA 4KHPJ 4ZPCA 1L3KA 1JB0C 4OZ1A 4OI2A 2FIUA 5CH7B 5AJ3J 2OPPA 2P9EA 3UW1A 1D8YA 4EWTA 3NMAA 1LNQA 4LF7J 3OTCA 4QR1A 4DUYF 2HSEB 2XM3A 4HDHA 3N6MA 3DLBA 4YR0A 3DOMB 2FHJD 4WXWA 5A2QY 5L1JA 1N0VC 1ZM4A 1PJ7A 4Q0BA 1JLCB 1FE0A 3OJUA 4CLUA 2QX0A 1WG1A 3NGDA 1TAUA 3IBWA 1T95A 3BQ1A 5KG6A 3VAHA 3MHYA 2XZWA 3R6LB 4O0IA 2GMHA 2WOMA 4ID5A 4WKYA 5L1KA 1FFSB 4LT6A 2G0IA 1S59A 2YNHB 3ZZPA 2QMXA 5KFNA 2LEAA 4ZP8A 2X51A 3PFEA 2ZVSA 5HVHA 1I5OB 3OLAA 5KOWA 3SBMA 2FHOB 1HMVA 1HQUB 4I4BA 4CO2A 2CPIA 3BF4A 2NZ4A 4JYAF 1Q53A 1T05A 1Y4ZB 4NXNJ 4KH1B 2V4RA 1VDHA 2DBBA 4DHVA 1FVSA 2UV8A 1TQLA 5D0RA 2HFSA 1N5TA 2QV6A 1F60B 1XK8A 3KJFB 3U1MA 1BWVA 1PG5B 2XYPB 4C3KA 1RTHA 5HO4A 1OY8A 3QQCD 2RQCA 2X1FA 1CQNA 2HNYA 3R1LA 5KT7A 4P2MA 3SCKE 1NKCA 3Q0AA 1ICEB 2WW8A 2OPPB 2VKZG 1XMBA 2FVRA 1DJ0A 5LMUF 2HFZA 3I31A 2J0SD 4WFNQ 1F1BB 4GKJJ 1VQ9S 3G6YA 3FKBA 4J9VA 2LU2A 1QM9A 2L48A 3G8QA 2HIQA 1RAGB 3LPEA 5IQ6A 1YJNS 2ATCB 3Q83A 1BLUA 1FRKA 4DR7F 4R0EA 1Y0HA 4DG1A 4Q0BB 3D67A 1JJHA 4CO4A 1F9FA 1P9YA 4LREA 1EB0A 2HHHJ 4I67A 1RGVA 1CC8A 2Y3YA 3DKDA 3N9UC 3W8PA 3OSNA 3IM8A 1SVDA 4F0MA 2WOMB 5LMNF 4K4XA 2PIIA 4X4SA 2WVEA 2ZJPQ 3BB5A 4C8YA 2HVZA 2DH7A 4IH7A 1WC6A 1RTIB 4C2MA 3JSRA 6AT1B 4ZCIA 2CDQA 2CQPA 1JWWA 1JJCB 4ZN1A 5A6PA 3DDKA 2IJFA 4J9KA 3BYPA 3T19A 1R3NA 2FD2A 4YUDA 1NCLA 3QYYA 5ETKA 5H9EJ 4WU2A 4YEAA 1HMVB 3W5YA 3ITHA 1N5YA 2BACA 2LXIA 3I4HX 1T05B 3W9JA 2BKNA 1Y3JA 1VC5A 3OD2A 2VD3A 1U24A 3BSAA 3OUYA 4YHHF 3M8ZA 1UJ5A 4GC7A 4F0KA 1NMEB 3TP2A 3IS9A 1DBDA 1IBKF 1U1NA 5B08A 4Y0FA 4F02A 1MN7A 1IWAA 1BUXA 4DPYA 1VK3A 2A1BA 3KJVA 3OTBA 4USVA 1RA6A 2HNYB 2GW8A 3BS9A 1EAYC 3WDOA 2YNGA 1H3DA 4TVAB 5H1SV 1S57A 4LFBF 4DR1F 3CULA 2F4VJ 2HVEA 4H4OA 3QSIA 4USIA 3NBPA 4LF9F 2UXBJ 5LSLA 3G8TA 2FZKB 3D28A 4NYZA 4KHPF 3EVMA 3PRBA 2H5JB 3G8SA 4P2SA 5AJ3F 2EPIA 1U2CA 4L6V3 5K20B 2HQGA 2FVCA 2ILZA 4DG1B 3Q24A 3FDSA 4DL6A 3MEEA 4LF7F 2FB0A 2JLGA 4J9OA 4PCQA 5CA5A 2PMZD 4ES3A 2XLJA 1QE1A 4DR4J 2RSQA 5HL7Q 3GFHA 2ZZTA 3UN5A 1KQGB 3KJQB 2MKYA 1LOUA 4WP3A 4B3OA 3CCQS 2Y8YA 2OHDA 3C3LA 4IFYA 3JSMA 5KFFA 2VIHA 4WZMA 2JFDA 3HP6A 4DXLA 1ZM3A 1RLCL 1HWLA 1C0UA 1KVKA 1V3RA 2WCXA 2YKNA 1WEZA 2IC3A 3ITHB 1N5YB 4IFVB 4QCLA 1KSPA 2HK2A 2KT5A 4WFBQ 3C16A 2MLZA 2E7VA 3K5OA 4MFBA 3FRZA 4QPTA 1FWPA 2KYXA 2WW4A 2HLUA 4TY8B 2PD1A 1WORA 2YWKA 2RJZA 2Y9HA 1UJ6A 3IS9B 1W26A 3HVTB 4NXNF 3KNGA 3KHRA 4N47A 2FQQB 5ETLA 1U0HB 3KJVB 2KFZA 2ALZA 2E1AA 3SV3A 1TELA 3UE2A 3IBCB 3NAIA 5J2MA 1S4FA 1SL1A 4FPRA 1VRQC 5F3TA 4IRKA 1YWXA 2DNQA 3AQPA 2HQ3A 4N41A 1YITS 5HQLA 1QAJA 4H4OB 3NBPB 5JXSA 4NEZA 3D1HA 2JC0A 1TKXA 3D66A 1NRKA 4WFZA 5HATA 1M0SA 4L76A 3NEKA 3UO0A 2R7SA 1VIOA 4DV5J 3W1YC 1RKIA 5KG4A 1FE4A 4F25A 5IM0A 1FWLA 2QE5A 2RHSB 5D4OA 4NCGA 1TMMA 4GKJF 3VGTA 4FN5A 1M1KT 3MI7X 2L41A 2HQCA 3N5BA 3MEEB 1RWKB 5KFXA 2F1FA 4OZ5A 4CO5A 2BV3A 4F2RA 1WI8A 2PMHA 3CCSS 2UUWA 4F2SA 2XEXA 1QE1B 1SJRA 5B0CA 2MGZA 3MZIA 3JQMA 3P49B 1PYSB 2E5IA 4WYWA 3FSXA 3J7A1 1RT6A 1IXKA 2MZ1A 2HHHF 3D6TB 3MMBA 4B3OB 1S6UA 4HHJA 4IFYB 3KJNB 3JSMB 1YZ7A 3J80Y 1ZA1B 4OI3A 1S1XA 3UR3C 2GHPA 1SQGA 3RRHA 2M3DA 4ZLLA 1YJRA 2VC0A 3CCVS 1C0UB 4KTQA 1BHNA 3GYNA 2YKNB 4Y34A 2BQRA 2IC3B 5GADU 3CD0A 5EN1A 3MTKA 3U02A 3C16B 3R5JB 4X4QA 2M8HA 2JWNA 3H7HB 4MFBB 5KFOA 4URSA 1F3VA 1WACA 2M9KA 3M8SA 4LR7A 2C2DA 2HS4A 4NLUA 3S6EA 1CS4A 3SZ2A 4CNZA 2F8EX 4XPCA 4LBHA 4I69A 5CYMA 4ZP7A 3OVBA 1K8AT 5HK4A 2ZH5A 1CJKA 3DU5A 2CWXA 4B9MA 3B4MA 4H54A 4DQIA 5J2MB 1QY7A 3HSZA 4OHZA 2YWWA 2UV8G 1R89A 2UUBJ 4NLDA 5KFJA 4PUOB 4PABA 1RK8A 2BMBA 4OYIA 3D7SB 1WG4A 3D4JA 2ZNYA 1JQGA 2Z2ZA 3DLHA 3HZEA 2JL9A 1TKXB 4OYXA 1AFIA 1KHWA 5GAHU 3QO9A 3WBZA 3QIPB 4Y2MA 3GSDA 2MKIA 1NHUA 1KEKA 9ATCB 4RNFA 3GP9A 3M6UA 3PHTA 1TK0A 5DDOC 3OL6A 2QA2A 2E5JA 5IM0B 2F4VF 4ED8A 4PEOA 3QSYB 5MAOA 2UXBF 3ISZA 2CZ9A 3PYFA 2Z57B 2ZBIA 4QWBA 1N54B 2JJ4D 2J6TA 1JNRB 4DSKA 2AGOA 4B08A 3JB9k 2Y0BB 3LUYA 3KG1A 5E3RA 2LEPA 3G9CA 2MGZB 1WC3A 1IM4A 2RH3A 2FVQA 1NZAA 2AYMA 4MIAA 4WP8A 2R7VA 1LWEA 2WK4A 3WZ0A 3CCMS 2YBVA 4OFZA 5G0RA 2WSFC 3Q8UA 1H7WA 5DDQC 2L9WA 3MMBB 1WSVA 3ET6A 3TUZC 2NS1B 2MQQA 2AJQA 1S1XB 4DR4F 1KS2A 4NCBA 3VGUA 1Y5LB 3PXGa 5KFSA 2DNLA 4DL2A 5EWGA 1NHVA 3EGWB 2O01C 2ZBCA 4QOTA 4J9QA 2V8GA 3CDUA 3PO5A 2HS0A 3NGKA 5JVHQ 3D68A 4EFAC 4Q8FA 5HVGA 1VQNS 5A6WA 2DNKA 4LF2A 3Q86A 3CVKA 2BE2A 4NLXA 4L72B 1BQNA 2ADCA 1CS4B 3T6JA 3LP0A 3KXDA 3CJ3A 3FZBA 1YQHA 4USKA 3AJ1A 5CYMB 3W5ZA 1D8ZA 2CAJA 3AHPA 4K59A 3R7NB 5E3CA 3MMCA 3JTPA 3SMZA 2VFUA 1WDDA 2MPUA 5LOQA 3ZC4A 4C97A 2H48B 1JX4A 3QO9B 4PZVA 3R1HA 3MOJB 1HARA 4EO6A 4K50A 1F2GA 1W2IA 4UY85 4ZCKA 4YB5A 4URGA 4NZ6A 2ZH4A 4ZVEA 4KGKA 3SSSA 2GAHC 2K3KA 3GE9A 1UPMB 3CCTA 1KLNA 3EPIA 5HP1A 2OI2A 2R2RA 3B6BA 3PW5A 3CJKA 2RB7A 1XNRJ 2N3OA 2GQCA 1KRPA 1QLNA 1MWQA 2MY8A 4FVMA 2B9EA 4DV5F 3PYDA 1YG0A 4UZCA 3NY0A 3BN7A 2HQDA 3QGHA 3NMRA 3P6YC 4FKXA 3MM5B 1KVJA 2P2CB 1LWEB 3AH6A 3TWZA 2DGWA 3LP1B 1UP1A 5G0RB 2W01A 2BQUA 1S6OA 3OJSA 3PX0A 2HGLA 3HFVA 2HW3A 4LRAA 5LT5A 3ZTPA 3W64A 1Q8BA 4K2JA 4YR3A 1WI6A 2EW9A 1KD1T 2Z58B 2LXFA 1RSCA 4ITSA 2YTCA 2JLEA 3AXMA 4QYZK 4GVLA 2AU0A 1RDRA 2QRRA 2KXHA 4ELVA 3T5HA 3R27A 3NGTA 4LR8A 1X4CA 3KK1A 2AZ3A 1FCAA 2D74B 1MWZA 2QFJA 1U6BA 3RU0A 3N6LA 3HFZB 2V67A 3GJQB 2DT9A 4RW7A 5KT6A 2FYXA 4FDFA 2UVRA 1WKLA 4GC6A 1KONA 2BE2B 4DQRA 3HKWA 4P2XA 1BQNB 2HLTA 2G1HA 2D3ZA 2DY1A 3LP0B 1NSAA 3D54A 3EZOA 1WTBA 4ED3A 4ETZA 2IRUA 3MR7A 3MR3A 4DUZJ 2LKZA 3LGNA 2BKPA 3NS6A 3P5TL 3MMCB 3MMJA 4BS2A 4GO7X 5D15A 5EGYA 1Q8LA 4HKQA 2VUGA 2BRLA 3Q8SB 5IC6B 3AB2B 4JI8J 3EDRB 5J1NA 3VV2B 1PBUA 1LWFA 4O4GA 5KG7A 4LQ3A 1ZZFA 2DTJA 3I4PA 3CXCR 3BYRA 2AKWB 5CXTA 3CDEA 2UUBF 3SXLA 4A48A 3TX0A 5IXUA 1IUJA 1DLOB 2DR8A 4RU2A 4I6AA 4P7TA 3CJKB 2BJ7A 3CIMA 2JFKA 4OJGA 1B3TA 3DLGA 7FD1A 4M5KA 5GAGU 5LSRA 3AD7C 3TUPA 1N5QA 3D6MB 2DNHA 3D1QA 1ZM9A 2J8SA 2ROEA 2V68A 3E8OA 3CC4S 3TAPA 1JLGB 4UY8T 2VONA 2QZ8A 5ETMA 2CQGA 1X4BA 3O1LA 1D0EA 2RRNA 3KHLA 1NPKA 1SI9A 5KFWA 3D3BJ 1GAOA 2PI5A 2ZHBA 1LW2B 2W7AA 3MUTP 2L3MA 4DX6A 4OJ1A 3FBFA 3ZZRA 1WTFA 2C22A 2NUUG 5IQQA 2LQJA 3SCIE 2ZOMA 2W2NP 3G96A 3QAUA 1VQ5S 1QSLA 4F4YA 3KK1B 4CH7A 4C8LA 1VBYA 2E9RX 1R27B 1R8HA 4YMEA 3TA2A 4P52A 1TKDA 2EKYA 2NZCA 4KIAA 4ZDNA 3DHWC 4RW7B 4NZ0A 4DL3A 5KFAA 2IA6A 1U1LA 2B4UA 2EFOA 4WK3A 4Z7YA 3NNAA 4ZVHA 1JKHA 4QIFA 3H8YA 4OHXA 4P9SA 4A8XA 2GJFA 4J9PA 3Q2SC 3HMJG 4USWA 1U25A 2Z0GA 2BJ3A 2N82B 1FRLA 2HFNA 2VQEJ 1S1UA 3BH7B 2WONB 1A9NB 2HZCA 3OR1A 4Y65A 1ZBTA 4ZVPB 4CDIA 4A8MP 2MKKA 3R2DJ 4NLRA 2HVDA 3BBCA 3S8SA 5KAKA 1Q0NA 4JI2J 2CRLA 1RHMB 1SL0A 5KFQA 3WC0A 3QZ8A 4IKAA 2GO8A 1PBAA 5D4NA 2XS5A 2AJ1A 2CNOB 4OYPA 1LWFB 4O4GB 2XYHB 3D0GE 4OLOA 2P5VA 3JSBA 3CCZA 4K4VA 3PDNA 3HHNB 4ZVSB 2I2YA 1UEUA 2V8DA 2BE7D 3A13A 3U27A 4IR1A 1CJUB 4OV1A 2IBKA 2CQBA 5K8NA 4EZ6A 3G6VA 3I0SA 1P6TA 2BE9B 4NMLA 2F8MA 2NXJA 2EBEA 5DO2A 2C3UA 2W7OA 3PEJA 4JI4F 1XNRF 1VIXA 2OH2A 3KHHA 3C2PA 1R43A 3LPYA 1LEOA 4M1KA 2LYVA 4HDGA 1M5KC 3P8BB 4BBYA 4C8KA 5K8OA 1R8BA 1SPBP 4OJHA 2EXUA 2ZNZA 2HS3A 4KE5A 4E8UA 2IJNA 4DV3J 5IS2A 1TVRA 3H2UB 1CQMA 2VG5A 3QWPA 2CJ9A 3M6XA 2DVIA 4AD6A 4DX8H 4IOAQ 4O3OA 4QPXA 4J90A 5JUMA 3BBBA 3CO0P 3M8WA 2VH7A 3ZZ0A 2HRYA 3DRXA 4DV4J 2PE8A 1I6JA 1RXOB 2LP4A 5IT9Y 3TOQA 1JKHB 2FPHX 4NLSA 2W9CB 4WFXA 1HNWJ 3QZ7A 3OTDA 1S1UB 2WBRA 1FFWB 3OR1B 1FT8A 1Q81T 3P4UB 3MR6A 4NYPA 1S0VA 1S1WA 3CO9A 5HJYA 1L3SA 3BSCA 1PAUB 1DTQA 4R8UA 4FXVA 2ASJA 3KHGA 1B0TA 2QA1A 1IKVA 1Z4UA 2YX4A 4DUTA 1Q82T 4O44A 4MIWA 1B0VA 4DUZF 1UVJA 2BX6A 3LGHA 5DG8A 2GVDA 2YH0A 4OYMA 1S9FA 1U8WA 3VR1A 3MEGA 1HLWA 2ZH7A 1MNEA 3OFGA 3K0JA 1O51A 2M5YA 3CW2C 4QIGA 4JI8F 3W61A 3CF5Q 1V5IB 4QWAA 3KUHA 2W1BA 1UWBA 2QLWA 1YIJS 1NBEB 4QYZJ 1SKWA 1WEYA 2EC0A 3W3SA 3I0SB 1OO0B 2W2OP 3AXKA 4FYXB 1N34J 2I0XA 3H59A 4LFCJ 1F5CA 1LWXA 2XG8A 4ECQA 2UXDJ 1PGZA 2YQ3A 3T5JA 4YB6A 1XR5A 4A8WA 3MCOA 2DNPA 4LUBA 4C6AA 1G7CB 2ZD1A 3QJLA 1RJJA 5HVFA 4M8LA 4UQGA 1T7PA 2J6SA 3HXMA 3TZWA 2GGPA 4O3PA 5CQGA 1YBTA 2H5IB 3DMJA 1X4FA 3PW0A 4XDCA 5GMDA 2EC2A 2LFVA 2Z56B 4WWSA 1TVRB 2ABYA 1FD2A 3CCJS 2VG5B 1SKRA 1NDKA 3S01A 3HD2A 2PT0A 2JHEA 1NJZA 1Q7YT 4OYOA 4FBUA 2KH9A 2W2MP 5B0BA 3AA9A 2JRSA 1XEZA 1APSA 3LTOA 1KFDA 4HYKA 1X5PA 3MFHA 4BLGA 3FSYA 4KR0B 4EBEA 5E7OB 3RGIA 4DDFA 3UN3A 3OT9A 3M6WA 1S5ZA 1VRUA 3RB6A 4FF4A 3MPWA 1S1WB 5A76A 1RT5A 1DAXA 4PG4A 4CO3A 3OHBA 2GJ2A 3QT7A 1DTQB 1F3FA 4R8UB 3FNNA 2VQEF 1IKVB 2CIMA 3DC2A 4O44B 1RHJB 4F67A 2E5LJ 3RAMA 1I94J 1TZ0A 5I3QA 2IAJA 4ZLJA 2GVDB 2AEJA 4DLGA 2HQIA 4JI2F 3MEGB 4R5PA 2RDIA 5KFPA 2AZ1A 2ZDPA 2DXEA 2LQ8A 4TXSA 2ZZNA 2H65B 1K1SA 3O44A 3FC9A 1UWBB 3HO1A 3PIOQ 5D0HA 4K4ZA 1KKHA 2E1CA 4V19X 3TUIC 4DF8A 4LIRA 2PI4A 4DQSA 3EX7B 1KLMA 5KT4A 2V63A 4B17A 1DQ8A 2ZD1B 4LRFA 2ZITA 4L75A 3FRYA 1CULA 2XO7A 5SZTA 3PVXA 1LW0A 3PKYA 2MB0B 3AD9C 2GGPB 2QLBB 4I64A 1J2VA 3DMJB 4OX7A 2BA9A 3HX9A 3VAGA 1HYSA 1X4AA 3OTEA 3PJ9A 5KFTA 1Z2ZA 4FYWB 3MPUB 5F9LA 3NAHA 4WIQA 3TZZA 2DH9A 4NLTA 3MD1A 4O3QA 2GCFA 3K8WA 4K4SA 2B7CB 2FUG9 4QW9A 4DV3F 1UPPA 4DN9A 4K7QA 1ZM2A 4LBPA 1AUSL 1RHRB 4JV5J 3TVKA 3G71S 2VASA 3G86A 4X4PA 1VRUB 2V9WA 1WC0A 1L3UA 1AW0A 2FZCB 4DV4F 3EVOA 2I8EA 3O2IA 2PN6A 4OZ3A 1RT5B 4NL5A 1X5OA 1HNWF 2RQ4A 2JEIA 1OYEA 2ADBA 3RR7A 3EM1A 2HYIB 4DR3J 5K5MA 4GKKJ 4PXBA 4O3RA 1NPPA 2IAJB 2Q1LA 2Q66A 3HHDA 3TYTA 2D69A 3MM8A 4R5PB 4NWBA 4E98A 1J5EJ 3RB4A 1CC7A 1OSCA 4EK2A 4V1Ak 2CPHA 1NH7A 2ZE2A 2OP5A 2OMOA 4UQTA 4IOBA 1WF2A 3R5GA 4QIWD 2HHQA 2KG1A 1NO8A 2ZWOA 3C46A 1AB8A 4DN0A 1SL2A 1FTRA 3QJJA 3OVSA 1B70B 1KLMB 4Y28C 2UZAA 3HM9A 1O6XA 3OL9A 4MKBA 2JC1A 2H4WB 2CZ4A 4GO5X 2C2EA 1CG2A 2F5GA 3I6PA 1LW0B 1N34F 1H2UX 4IRCA 5BYRA 4USHA 2MJNA 4LFCF 3MEDA 4AQYJ 3CJ5A 2UXDF 2IDLA 4FKYA 3R6GB 3FFIA 1HYSB 2I6WA 1SQFA 4RNMA 1IM6A 2DGQA 3MMAA 3T1AA 3IRXA 2B56A 2F65A 4ENOA 2E66A 3P45B 2R2UA 1NJWA 1QDUB 3S1TA 1NAQA 4RBVA 2GNKA 5M2RA 4NI2A 4BWJA 2IYGA 2F8HA 2QO3A 4I6WA 4DFMA 3T5KA 4CM2A 1RWMB 4CLWA 4WPAA 2XC9A 4DL4A 1T03A 4LSZB 2BXJA 3TJ8A 3QRRA 1VJWA 5KFUA 2YXLA 2BANA 1RHUB 2V2ZA 2IY5B 4ZVRB 1S0OA 1RWNB 3HCXA 1T3NA 2A6OA 1JXVA 1AROP 2IRYA 4X4NA 2VV5A 2V4QA 1VQLS 4HEA9 4QYRA 1HKAA 3MAQA 1NK4A 2BM0A 2LQ5A 4UT4A 3PR5B 2KRBA 2C3PA 3FCHA 4IRDA 3IGNA 3SCJE 2CZVC 5B0FA 3QT5A 1NH8A 1ZAWA 3PV8A 3MM8B 3T1YJ 4OJ3A 1YJVA 3CE8A 2ZE2B 2CQ2A 3CNQP 3GONA 2YNIA 2E5LF 1CEZA 1KFSA 3PACA 1I94F 3JAMU 3GV5B 1KNZA 4J9MA 4P75A 4C0BA 4U7CA 4OYBA 4DFKA 3ILIA 1L3TA 2DH8A 2EBGA 2CQ0A 3M4XA 1FKPA 2OD6A 2W7PA 3GQCA 1IR1A 1Q4RA 5KT3A 4QZVB 3TO8A 4DZDA 3M6VA 4Q45A 3NCQA 1EKSA 2AYEA 1FDNA 3FBBA 4IQMA 3GZ7A 2YKAA 3MEDB 2HNDA 5L9XA 2HG4A 4DPUA 1QAYA 4IO9Q 3FFIB 1X9WA 3OHAA 2BQ3A 2NXUA 2BOPA 2P6TA 2AJ0A 4K4WA 2AQ4A 1UVNA 3IRXB 5F3ZA 2VPZB 2JZ5A 2W4DA 4Z7CA 5L38A 5B0EA 2DNGA 2JLFA 3E01B 2BEFA 4NI2B 1NSPA 1NM2A 1AYEA 1NK5A 3EVWA 3UD5A 1HQEA 2W24A 1RACB 2RILA 5BYSA 1N56A 3CJTA 5KFBA 1FWKA 1T03B 4MK7A 2DYAA 5CYJA 1HD1A 3N6NA 1XMOJ 1SCJB 4DPXA 3DLKB 2GC8A 2BANB 1LK5A 3MD3A 3VZHA 2FVSA 1C1BA 1WHWA 1HL6A 5D78A 1RTZA 1T8EA 2HBYB 4CWBA 2CKWA 2QSWA 1U1OA 3H40A 3PW2A 2C1EB 3V4MA 3NWRA 2NR0A 4JV5F 1RBLA 3KLGA 1QAXA 3W9IA 4NE9C 5J2QA 5HQMA 1EARA 2HNZA 2HQFA 1N8RT 1AXQA 3VTIA 2RAQA 2KT3A 2BABA 2ZEJA 3V5RA 3CSKA 5F8MA 4DR3F 8RUCA 1CPZA 2MMYA 2ZHOA 4GKKF 4ZVGA 7FDRA 1NNDA 1ACMB 1RWPB 3M8QA 1U1MA 4HR2A 3K7RA 3PKMA 4C11A 4C9DA 3QGGA 1J5EF 4FXDA 1FKPB 3ENWA 4KB7A 2X7IA 1PSDA 2M7SA 3W7BA 4C48A 2LECA 3IAM9 3TARA 4I2PA 4W92B 1FI4A 5LM7E 1QTMA 4MJKA 3R2CJ 1RISA 2HNDB 2AV5A 1TV6A 1RAHB 4AYBD 3A3OB 3MUMP 3THPA 1VRTA 5DGBA 4B9UA 3PG9A 3VQTA 3BZQA 2QEXS 2MQPA 5KFIA 1YKWA 1FRMA 3N28A 4AQYF 2F40A 1M1HA 1NLKL 1HQEB 4MKAA 1NDLA 2W4PA 4CP5A 2GMLA 3U7JA 4OX9J 2UUTA 1VQKS 1MMNA 3IR6B 4QJVA 4KRWA 3VQSA 2GHVC 2GV1A 3HT3A 4ALZA 1E6VA 4Q43A 4CH1A 1C1BB 1F5AA 2UXCJ 3RRGA 4N76A 4EEYA 1R0BG 1HBOB 4O3NA 3CD6S 3B82A 1HHSA 2KDOA 1Y7PA 1Q5YA 2WVFA 2KXFA 2A6MA 2VODA 2J7WA 1U2RA 1M5OC 5J2QB 1YRXA 2Y8WA 2HNZB 1NUEA 5C42A 5DQHA 2KJWA 1BWEA 2MKHA 5K8PA 2ZH1A 4DU7A 1WHVA 3GU0A 1WSRA 1NK6A 3IXQA 3OVAA 5KFDA 3QFHA 1X4DA 1YRTA 3M8QB 5FJ4A 3A8KA 2XCPA 1TP7A 2OKQA 4C11B 5H9EK 3J81j 3QT6A 1SKSA 3T1YF 1HPZA 1RP5A 2J5AA 3IGVA 5KG1A 3F56A 5HBMA 4I2PB 4C8NA 5DM6Q 2N4CA 3AJDA 4USUA 1LKZA 2M88A 4N8OA 2O1PA 1VRTB 2G0JA 3UDEA 2DRDA 2KKHA 2XY6A 1TMJA 4ZIWA 2XMAA 2XMVA 4MK8A 2WHOA 4DV0J 1PC4A 2KYZA 5K9FA 2E1PA 1TK5A 2V0NA 3RW6A 3U1LA 1ZPWX 2DY9A 1XTZA 1NHKL 2DPIA 2MQOA 1N48A 2DGOA 2DCUB 3NG8A 1DURA 5BR8J 1URNA 3CDAA 2QIFA 4PG8A 4KV8B 3HI9A 4RW4A 3T3FA 4K5SA 2X3DA 1FDAA 3SV4A 2SXLA 1D9DA 4K4UA 3TZXA 1ZH5A 3MCNA 4J9NA 1FDBA 3LH2S 4JBCA 1XMOF 4OYWA 1WD6A 4EBCA 3GCXP 3IFEA 2W8LA 1TU0B 5KFCA 3ZTRA 2FVPA 3NGSA 2JSXA 5KT5A 4RNHA 3GYGA 2QMWA 2MQMA 4M95A 2XSFA 1M5HA 1K0TA 1S77D 2KTQA 1XR6A 5EWEA 5DG7A 2L9NA 3G82A 1IQZA 3CCES 4YR2A 5MLCV 1FRHA 3EZ5A 1HPZB 4WF9Q 4QQBA 5L1IA 2LQBA 3IO1A 3MXHP 5A8RA 4USJC 4XPEA 2ASDA 4HI2A 2G13A 3T6BA 2GIFA 3NKYA 3UD3P 2QMUB 1Q79A 2Q43A 1TUWA 4K0KJ 5HBMB 4WZQA 3FMWA 3GYXB 4A8OA 4HL9A 2OTLS 3M8PB 3UCGA 1MWYA 1DY3A 3MWBA 2PMWA 1RUSA 1R0CB 2HAFA 3THVA 1IKXA 1HHTP 5GADI 3R5AA 2IBOA 2NREA 2LLZA 1EQMA 2GJIA 2OMLA 2OFGX 5A8WA 5CZVA 3M9MB 4KT0C 4CRJA 4PXEA 3I56S 4KGXB 2C2RA 4DSFA 3Q89A 3BSNA 3O8WA 1NU4A 4KC5A 2HGNA 1UVMA 3GG0A 1RTIA 3Q2TC 3IG1B 5LXRA 2AJFE 3QIDA 3SSRA 2MSTA 1FXRA 5HMWA 5DRKA 3TJAA 3KG4A 4DPTA 4RW4B 4TKTA 2QJ3A 3B78A 2B8PA 2IFXA 2KL8A 4OX9F 3W2VB 4DR5F 4DS5A 4Q7AA 2CWKA 1NSKL 2E1MC 5GAHI 4ES2A 2AJ2A 4ZPTR 5CD4A 2A2DA 3PW4A 3O6QA 1TAQA 2FJAB 2GFFA 3MPVA 4B9NA 5ETVA 3Q8RB 2UXCF 2HK3A 5CAAA 2L08A 1W25A 3KLHA 1GT8A 4YFUA 3OXFA 2LEBA 1EZZB 4OX6A 4PXCA 2VBYA 4FZVA 4BC7A 2KVQE 3ILJA 3SSQA 3VAFA 3CB4A 1S0MA 2CDRB 1MMLA 1UZHA 1KQKA 2FY1A 1WUUA 4NMXA 5RUBA 2GQQA 2ERRA 4M5GA 3G82B 3C19A 1CLFA 1M5SA 2MQ8A 5A8RB 4N7TA 3IN5A 3TEGA 3AOCA 4KGMA 3M9NB 1H38A 3C14A 5AXLA 3TRGA 4WE1A 2DGXA 2ZHAA 3MF5A 2RE1A 2DNZA 2RIJA 1IKXB 3MTJA 4RNOA 1FF2A 1M1GA 3OR2B 3ENVA 1X31C 5U47A 4DQPA 1VQ6S 5E2QA 2VA2A 5KFGA 1IBCB 4EYHB 2ZZMA 1GMWA 5A8WB 4AXJA 4K4YA 1KHVA 3DRYA 3DOLB 3KWMA 1B7YB 2W2PP 3HVAA 3VWSA 1N52B 2IDEA 3RAXA 3BJYA 3LP2A 5E3AA 4QWCA 1H73A 1V3ZA 2W2QP 4A46A 1KOHA 2P9GA 2MYFA 3DFEA 1S10A 2CVEA 5HI7A 3DI6A 4YB7A 4W90B 4AFFA 4KH0B 4DV0F 4J9RA 3MCSA 5JJBA 2CQIA 4HI1A 1FJGJ 1IR2A 1TR0A 2K7JA 4RWWA 4B9LA 2MXYA 4OHWA 4U96A 1RA7A 4IFVA 5BR8F 1BMQB 2RU9A 1RYRA 2EWHA 4U8YA 4ANCA 4I1TA 3LA0A 1HFEL 4XDDA 1VFJA 5IWAJ 2J0QD 2KM8C 1U02A 2G2OA 3KLHB 4AL5A 4TY8A 2KZZA 3HVTA 1HI8A 2X1BA 2HWTA 3FCVA 3BO3A 3KYLA 3DXBA 4DX5A 1F6TA 1U0HA 4ZCMA 2LA6A 1T94A 1T02A 3I96A 2DHXA 1X0FA 3G6XA 3EICA 1IKWA 2CYYA 1S6PA 4ZP6A 1M5VC 3MM6A 3ZNUA 2VA3A 3L4BC 3N79A 3CCWA 2V4JA 1T9TA 1YDLA 3R5CA 4X4OA 1RWOB 1W7WA 1RAOA 2U1AA 3C14B 3ZZUA 4WE1B 3L95X 1Y10A 1RT1A 4CNYA 2UUAJ 4TYAA 4P74A 2EFVA 3L7UA 4NRTA 2XS2A 3D1OA 2ASLA 3QFWA 1VHIA 1VQOS 3OBIA 3Q8PB 3SQGA 4K0KF 3RBEA 4DCJB 1HWJA 2FLPA 5KFEA 2C3OA 2IM2A 2BW2A 3D9BA 2LMIA 1UVKA 2V2KA 4B9SA 1QJHA 5EDWA 4P72A 3LP2B 2I9SA 3GILA 3WX8A 4F3MA 4OZNA 3NWGA 3GSIA 4NOHA 3BGFA 3DI6B 4ZP9A 5I3PA 5FIIA 2VJVA 3ICLA 1H98A 2DNMA 1U45A 4BHQA 3J7Z5 4ILLA 2HEKA 2DK2A 1SH2A 5H9FK 4QR0A 4ZJOA 4U6PA 2NSBA 2XI3A 2JEGA 4KQZA 3VAJA 1FRJA 2GS8A 1IKYA 4LF5J 1SUQA 4OZ0A 3R5DA 2V5HG 4NLOA 3V6DA 4XTTA 4O4RA 3HKZD 3H25A 2MZSA 1RWUA 3AOBA 3CT9A 3HFKA 2XS7A 4Y2AA 1Y11A 3ZTQA 2K1RA 3N0VA 3W8GA 3PW7A 2EVZA 5CZXA 4LVNP 3KOAA 4RO0A 4CLLA 4D3GA 2R8HA 3H98A 4OL8A 4OZLA 1BGXT 1WKJA 5KG5A 2UVWA 4X2BA 3LW5C 2ZC4A 4HLBA 2F4FA 3G4SS 5GMKa 1DQ9A 4AUKA 4MMOA 1IKWB 1S6PB 2OUGA 1NKEA 2IM0A 5A8KA 1U48A 2HFUA 3MM6B 4ZPBA 4PUOA 2HPUA 1DFDA 4DCOB 4DV2J 2V4JB 3BV8A 2CQ4A 4CLSA 4DQQA 1XR7A 5DM7Q 1REVA 3VVUA 3BDPA 1RT1B 3QIPA 3DRRA 5THWA 2XO6A 2KM8B 5C24B 3NGUA 1RAFB 2BRKA 1X9MA 1SIWB 1PIEA 4X4UA 2KFYA 1TL4A 4OMFG 3SQGB 5E0OA 1D9AA 5AE3A 5CCMA 3GIMA 3AQOA 1Z2LA 4L3NA 2FLNA 3TI0A 4IO1A 3UQSA 4OI0A 3GFYA 4ZLNA 4P7VA 2L9DA 4NA1A 1VQYA 3M2VA 3E51A 1AZSA 2RF2B 3ZTOA 1NJXA 1YX2A 2JNJA 3MR2A 3M2UA 1Y5IB 2Z2MA 1U1PA 2XYGB 4YN3B 1KN6A 5ETSA 2OO4A 5M2PA 3V2UC 3KDNA 1JLAA 3FEXB 2XBPA 1RQ0A 1F2HA 1TKZA 2DHSA 4ELUA 2KFNA 2RQMA 1TTHB 1HWKA 2HBRB 3DLEA 3K17A 2DISA 3D6HB 4I2QA 1M90T 4F4XA 3GG1A 4P2FA 2XCAA 3WC2A 1VS3A 1IKYB 1OY6A 2I38A 1SUQB 1T11A 5KFVA 3V6DB 1FJGF 1WDTA 1H6KX 1GMWD 2K1RB 1PO6A 1B7FA 4P73A 4RZRA 4NRUA 2MY7A 2QA4G 2RRBA 1HI1A 3J7ZT 1R6VA 1KQSR 3T5LA 1WG5A 4LF1A 4ZHRB 5IWAF 2QLJB 2VHGA 3CMES 1KTVA 4X66J 3Q23A 1R8PA 3BH6B 3OSPA 1S76D 4KPCA 1HBMA 3T9ZA 3TVZA 2GO9A 2QA4S 3MGJA 1XC9A 5A8KB 3HSDA 2M8DB 1F0XA 1UA1A 4BDPA 3LWMA 1OS5A 2KB2A 3IWLA 3JS9A 5KTQA 1REVB 5J1EA 4PWWA 3DRRB 4ZJQA 4OZJA 2JOQA 2DXFA 1UETA 1NK0A 5G4DA 3DHXA 4ECUA 4MKVA 5B09A 3BO2A 4H4MA 2RQKA 3LALA 5D77A 2YQ1A 3RJMB 1GTHA 2UUAF 3BSOA 4X4TA 2N4DA 4O3SA 2A2CA 2ZFHA 5ETPA 4ZVQB 2O66A 3M2VB 3HSGA 1AZSB 4KY3A 3IRWP 3R7BB 1U1RA 3RUBL 5F41A 3MM5A 2M70A 3M2UB 3SYZA 3LP1A 5LXYA 2ZUAA 1VI7A 2R8JA 1U1QA 4QWEA 1RHKB 5IV3A 2GVZA 3ZZZA 2W25A 3DXSX 3KG0A 2EG2A 1JLAB 1UA0A 5KG0A 3KK3A 1OWXA 1TKZB 4EGLA 1H72C 4Q44A 2HWHA 4LJMA 4DOZA 1VHFA 2J8AA 1YJTA 2XMTA 4F7VA 3DLEB 3W65A 4ATNA 3IP0A 4I2QB 1VQ7S 5EX3A 4DL0C 1M5PC 4ECXA 5IZHA 4WBFA 5AXKA 2WB1D 2AX1A 1GNKA 1KOOA 5I3UB 4LSNA 1IQTA 2GAGC 4M5NA 1FESA 4UTGA 4YOEA 4FNHA 4NPOA 3OPKA 1SJ4P 3GJTB 1D09B 2VG7B 1ULRA 4WFAQ 4L74A 2EG1A 2F63A 1NSQA 5LJ3Y 4LF5F 3LAKA 4NXMJ 1KBRA 3A3PB 3KLFB 5C5JA 4ECSA 2GA7A 4C8OA 1SIZA 1HBMB 4YQWA 2V69A 3K57A 3CJ4A 2HRTA 4NASA 2WAQD 5HMXA 1Q1KA 1XMQJ 4TQSA 4F50A 1VQMS 4RJVA 1DRZA 4RUBA 1VQ8S 4NYOA 5EWFA 5C2CA 5J1EB 2B6AA 1QSYA 3MPYA 3IM9A 3MAHA 1MROA 5IC4B 4IUFA 2DCLA 1MG7A 3JAMY 1UFKA 3PCOB 2XMKA 3VCDA 2KHDA 1BQMB 2C2OB 3BN4A 4DV2F 1LV5A 4H4MB 4FYDA 2B4VA 1V9OA 1DLOA 1SH0A 2GX8A 1S1VA 3ZXWA 4KGZB 5I42A 5IT9U 4I6YA 1GMUA 1N32J 5H9FJ 2RT3A 1V6HA 2AGPA 1DZ5A 1RT7A 4X84A 3DU6A 3W66A 4ECWA 5FLXU 4NLYA 4Y2IA 1YZ6A 1S7IA 1RT3B 3P3DA 2AT1B 3POTB 5DZ7A 2GQ2A 2DNNA 1KC8T 1HWIA 4ECVA 2OJ3A 4UOGA 1JLGA 4N8NA 3N5FA 3R3TA 4HHHA 2EFPA 2M0GB 2YWEA 1L5UA 3RBXA 3K5LA 2MKSA 2GVZB 3BQ2A 1FNXH 1GMVA 3I5BA 1LW2A 3AT1B 3HULA 4IDKA 3ENAA 5AE1A 3KK3B 4IH5A 2GHWA 4AXIA 1UMJA 4NLGA 3AJ2A 2CJYB 2O5DA 3H4BA 2H3EB 2Z2LA 1FD8A 4J7CA 1FEEA 3I9ZA 5L8RC 5KFLA 1Q5VA 3MEKA 3FVYA 2M2BA 1SJQA 3DLJA 4OYAA 2DXDA 1KP6A 4A8YA 2BJDA 3JYTB 4Y00A 2R7RA 1RU1A 4RX6A 4LSNB 4QU6A 2VDIA 4XAKA 4C3LA 1YJUA 1UEKA 2DO0A 4PAAA 2BBEA 2DRAA 3SCLE 2N3LA 2LU1A 2B0GA 4HVZA 3IAS9 3D0HE 1U4BA 2BJ9A 2G2ZA 2WONA 2MDAA 4EBDA 4J9SA 3LANA 4PQUB 5CCLA 2QLFB 1URRA 1GEHA 4P71A 4DFJA 1I3OB 1A7GE 5J2NA 3VGSA 1HNZJ 4TU8A 1C2PA 3KUGA 4R0JA 4J5OA 3KUEA 1XNQJ 3TQEA 2E5HA 2C2NA 3FZ2A 4CI0B 3KTQA 1S97A 4X66F 4G1PA 2B6AB 1PILA 1RBAA 3QGIA 4O23A 1MROB 2O3DA 2CNNB 1HNXJ 3HHKA 2OELA 4OI6A 2E7XA 3SI8A 2ROPA 3UCZP 3H0PA 2A0FB 3IWNC 2GZOA 2HGMA 2OFHX 2ZH3A 1RAIB 3JTOA 1S1VB 4DJBA 5I42B 1CJUA 4V19J 2BKOA 1JLQA 3PX6A 4X62J 1RT7B 3O5TB 4N77A 1N36J 2QFIA 4ZPWR 5F8IA 3MM9A 2QL5B 2H51B 1MU2A 3HK2A 1F9HA 2QL9B 3CJ0A 3CEDA 5BJRA 3CD5A 1EJ7L 1V3SA 3W2WB 4JOUA 4UOHA 1NJYA 2MQLA 3E3XA 3PZPA 1VBZA 2OIHA 3KLVA 1YVFA 1PAEX 2HIYA 3DOKA 1CBKA 5IT4A 2CUYA 4RBTA 4Q5VA 2CVIA 1G3OA 4FF1A 4F0HA 3MCMA 3QMQA 3F41A 1U0SA 5HAOA 5B0DA 3MFIA 2RHQB 3VALA 4M5MA 4IDKB 3AAWB 5HMZA 4EU0A 3VHQA 3PNIA 2EFQA 3CD7A 3BPSP 1ZAXA 2HMIA 5T41A 2XGQA 6FD1A 4I56A 3G87A 4KGVB 1LXNA 1G6BA 5GMEA 3BR8A 1OY9A 1SBRA 2Q79A 4MYTA 3Q22A 2C3YA 1F9EB 3V6HA 2W9CA 2OAUA 2DEJA 4ECYA 2X3GA 2OPRA 1WC1A 2NLWA 2A3JA 2Z2YB 4MAKA 1OPIA 1WF0A 3BPDA 1RABB 3CTRA 4ZVTB 2DRBA 1P1TA 4GMKA 1U2FA 4GVBA 3SQOP 3W5XA 2R7OA 1KVIA 5J2NB 2QN6B 4EYIB 2AF6A 4DL5A 2V50A 3A12A 3CDWA 1FXLA 1WC4A 3TNVA 1O0PA 2LDIA 4KPYA 1N88A 3FCWA 4ID5B 4NXMF 4PWUA 4DFPA 2ASYA 4IG0A 5DG9A 1UJ4A 3DN9A 4JI7J 3B4DA 3J7YI 1FEHA 4FF2A 5D4PA 4RW6A 2J0WA 2EEYA 1LFWA 4M5JA 4ED7A 5DETA 4QWDA 3H2LA 1RYSA 1XMQF 3K59A 2CNLB 2BJ8A 4W98A 1RI7A 1P9QC 2ZVIA 2AGQA 1R6YA 3CJRA 2RKIA 1JLFA 4Z37A 3NOCA 1JLQB 3R97A 1HNIA 5T7LA 4DSJA 2FGCA 2CQDA 2J76E 1MSWD 3NCRA 4P10A 3UI3A 1X5SA 5F8HA 2G1DA 3MM9B 2F9DA 3GTYX 1MU2B 2RNEA 1TL1A 5D4LA 3ILOA 2UP1A 1WELA 4M5DA 3DOKB 4ZKAA 2ZH8A 1N32F 8ATCB 2CPDA 4OX8A 2WVDA 4XO0A 5HLFA 2FJEB 4WP9A 1BC6A 1B99A 3BKTA 1QUPA 3C6UA 1RTHB 3RZAA 2MQNA 5DDPC 2PFFB 1OPZA 4PG7A 2X1AA 3RAQA 4WJBA 3OQ2A 3MR5A 1UL3A 5M2UA 3M2RA 2QLXA 3KLEA 5DGAA 2HMIB 2R8GA 2V8PA 2HAIA 3UN2A 2PDAA 3HLUA 2AIRB 2KO1A 1SC6A 3GWCA 2JDJA 2HBZB 4YP3A 3AB4B 2XNQA 1P1LA 2OPRB 2H5EA 1Q78A 3ADAC 1Y00A 5C2GA 4M5IA 2UVVA 1EIYB 5SUHA 3GMGA 5DLGA 3V4IA 3BR9A 3G6ES 4F4AA 3V6JA 4Y6IA 4GVBB 3GIJA 2IMWP 2ZJRQ 2QTWA 2VBXA 1IWGA 1G4CA 4IG0B 4XIUA 3HJVA 1EP4A 2KN4A 4FYVB 1HA1A 3JSYA 1T3OA 1OSDA 4RW6B 2B9WA 1HNZF 2C28A 2DR5A 1WNEA 2ACYA 3DCAA 2VF3A 1IR0A 2IM1A 1MW7A 4JUZA 1XNQF 2HFVA 2P6SA 2GIRA 3I82A 2RVJA 4HTIA 5HQ8A 2AMCB 1EQ0A 2KHCA 3F0NA 2RKIB 1WJ9A 1JLFB 2RMLA 1HNIB 5T7LB 2NYIA 4DSEA 5J1PA 1HNXF 2N7CA 4DX7A 1QSSA 1YJ7A 1S48A 1SC1B 5E3PA 1TL1B 1RBOB 4A8QA 2IPOB 4M5DB 3C66A 2E1RA 3OUYB 3PHEA 4X62F 2HBQB 3ISNC 1N36F 2HZAA 2KT2A 5HLFB 2JVOA 2V6AA 3R8YA 2AW0A 2OEKA 4F36A 4J9LA 3NGRA 3K58A 2MKCA 3A8EA 3BREA 3C6UB 2VFRA 2IVFB 2XWYA 2G0CA 3CMQA 3I5CA 2YNGB 4KSEB 1SJ3P 1RZMA 4CM0A 2MHEA 2CPZA 3LQVA 3M2RB 3KLEB 5D0EA 3H5XA 1MN9A 3DGPA 1WWHA 5KG3A 4OQJA 5EUHA 4MK9A 1NK9A 4OV6A 3L09A 1FX2A 3UVJA 4E0DA 1CJTA 1Y5NB 3D5MA 4F8RA 3GJRB 2DR7A 2P9CA 4CLKA 4N56A 5GAEI 1LQ9A 5KT2A 1LWCA 2BYCA 2XMJA 3V4IB 4WCEQ 3D6FB 3C15A 4HT7A 2DGSA 4A8FA 3EMTA 3RBDA 5JVGQ 4UZBA 1HHQA 1NPRA 1FNMA 4ANEA 4YDDB 2MHNA 4WU3A 2W9BA 1UTAA 4OYZA 4DR6J 1X0PA 3OFFA 2F9JA 3I9V9 1H0HB 1B4SA 2B43A 4I0WA 1OMSA 3UD4P 3H5UA 1EP4B 1T9XA 2AYBA 3QRQA 4X4VA 5AT1B 4M5LA 1S4EA 2VBWA 2CFXA 3TVYA 4DLEA 4OIXA 1UFLA 3KMQA 3BGRA 2D9OA 3TA0A 2LDYA 1R0AA 5HN0A 3BGUA 3RB0A 4USTA 2EKNA 2XMWA 3UWTA 4JI7F 3ETOA 4CCHA 1B0PA 2VC1A 1MLAA 2K2PA 1N4LA 1QAIA 1Y3KA 2JH3A 4KYZA 2QT7A 3VGVA 4A4JA 1SV5A 3UFCX 1EX8A 1GXLA 1P8GA 4ZJLA 2IA0A 3ZFVA 3W63A 4CH0S 3HPOA 4FS2A 3X1LB 4DV7J 2LCWA 3WX4A 3NRBA 3BKFA 3TJ9A 3GV8B 3CMAS 2YWGA 4JI5J 2CQ3A 3CCRS 2RS2A 4YB1P 1C1CA 1JXEA 1DTTA 3OLBA 3FSIA 4LMZA 2V9KA 3I5AA 2NXEA 5D0GA 2U2FA 3PTWA 4ZVUB 3UR0A 5IT0A 4ID8A 2Y0SD 2J7KA 3DGPB 1GX6A 4I68A 1HIYA 1RWVB 4YY3J 3OFHA 2ROGA 3UVJB 1CJTB 1FJCA 2XULA 4F3QA 3EGZA 2R2TA 1TL7A 4IQXA 4TYBA 4Q8EA 4NCGB 1JXLA 1LWCB 1REGX 3M30A 4PXDA 2B51A 3FJ2A 2IM3A 3C15B 4X4RA 4RWXA 4ZPAA 3BGLA 3OFEA 1C4CA 1H74A 3CPWR 4LRDA 3KK2A 5HROA 2XSJA 2W9BB 1RCXB 3J81U 1DQAA 1HW8A 1Q86T 4X64J 2EFNA 2D41A 2N7YA 3LOUA 2VU5A 5KFZA 2XWXA 4B3MJ 2DGVA 1RT6B 2VB6A 2P8IA 1HNVA 2HHPA 2UVUA 5A0YA 3ILLA 1HW9A 3BGRB 4JI3J 3N01A 1VQPS 1XN9A 3EYZA 1X8DA 4YDXA 4C0HA 4FVCA 3QPIA 1R0AB 3I0RA 4ED2A 2LQ9A 3MUVP 4Y3CA 2XHWA 5J2PA 4ZPDA 3QWUA 5F8LA 1S49A 4HACA 2W9AA 2PA3A 3T1HJ 2X1GA 3IMQJ 4PWDA 2MZTA 4NZ7A 1IN0A 2IRXA 1SV5B 3GCWP 1GFWB 2CPEA 1LXJA 3UDVA 3OTOJ 2DO4A 1VLOA 3Q8QB 2YKMA 4X65J 3HHLC 1H2VZ 4Y2CA 1A0OB 1T9VA 3KMSA 3LAMA 2ILYA 2FLOA 2WSCC 1CJKB 1C1CB 1DTTB 2R8IA 5ETNA 2YKQA 2CADA 2CG4A 1PYTA 3EGNA 3TANA 1R7IA 3FEZA 3I87A 2FJWA 5F8NA 5ETQA 5ETRA 2Y1RI 1C4AA 4WK1A 1X60A 5EX0A 3E01A 3M32A 2DHAA 4HH0A 1RLDA 4ED4A 1U09A 4WFYA 5B0AA 4B3TJ 4M5HA 1TL7B 2QSFA 3N4WA 4CLZA 4F4KA 1YJ9S 2OGUA 3HHLA 3NNCA 3DRPA 3DLKA 2FY8A 3M30B 3NP5A 1SC4B 5T14A 2OTJS 4JI4J 3KLIA 1HBNA 2V94A 4JI6J 3KK2B 3QT8A 5HROB 2R4FA 2XSJB 3M1VA 3QAEA 2E7WA 4JI1J 1N6QA 1S9EA 3X3UA 2CJXB 1VBKA 1HNVB 4QW8A 4C8ZA 5A0YB 4ERDA 1JLBA 2MZQA 3ET6B 5DS7A 2YNFA 4DR6F 3I0RB 3HVWA 4U9RA 2Z4PA 3T41A 4C7QA 1NEEA 2B9XA 4IYQA 4ETXA 1KTQA 5J2PB 4QIVA 2YX1A 2ZH9A 4HACB 4CZCA 3AOAA 3QBCA 1U1KA 3ZZYA 2C2ZB 4BCAA 4PWDB 3GIRA 1UCNA 4AL7A 3UNYA 2E5GA 1VISA 3ISND 4RU9A 3Q8YA 4LF6J 3BKUA 2G2YA 1YSJA 4L3KA 2CQHA 2FJBB 1R31A 1RAJA 3HHEA 2YKMB 2AX0A 1ZETA 1N0UA 5KFKA 1LK7A 2XZTB 1S99A 2DGUA 4UF4A 2BZ2A 2PGCA 2NCKL 1WOOA 1ZA2B 3DYAA 4KHRA 4ZVOB 2DPJA 2YX7A 3GR0A 2WTFA 1RT2A 1K47A 3F44A 1X4HA 3ENQA 4ILMA 3W62A 4ZPVR 3C8YA 3TAQA 1VQSA 1VQ4S 4DSLA 1S1TA 2JVRA 4DV7F 4CLTA 2PO4A 1ZTTA 3PYEA 1SH3A 4KHMA 3IWXA 4JI5F 2YKOA 4KJIA 4JV0A 3SFUA 1Y9OA 3M32B 1AT1B 3AODA 5GVQA 2OEJA 2NSCA 1NZ8A 2NPIA 2CA9A 4IR9A 1LFPA 3HHLB 3DRPB 4B3RJ 1FRXA 5HP1B 2WSEC 5HANA 2ZM6J 2IVYA 2Q6BA 4YY3F 1NDCA 6FDRA 3WIUA 3KLIB 1HBNB 3ZZTA 1FHTA 1ZAVA 1HBOA 4UUXA 2FZGB 5A2QU 3M1VB 3CIZA 3HF5A 3PJXA 4Y2KA 1GXTA 3HDSA 3US5A 1FJ7A 2E9TA 2VOOA 1N6QB 1S9EB 2NYHA 2W4CA 4OI1A 4ZLPA 1XBWA 1JLBB 4K8RA 2R7XA 1JLEA 3SEOA 2YNFB 2J9CA 2ZBQA 5KOXA 4PYDA 2ZOFA 4X64F 1HD0A 5CHCB 2CNKB 4U7UK 2RRAA 4DF4A 1XERA 4B3MF 2ZUGA 3SDEA 4JI3F 5C25A 5DJBA 2BOAA 4RUHA 5KFYA 3UCUP 4ZCLA 5ITHA 4RW8A 2YWHA 3MM7A 1XQIA 4CT8A 3PEHA 1T9YA 2WBMA 4ELTA 4L73A 3J7AN 4S0MA 1IVZA 2PC6A 1KR4A 4FBTA 3ONQA 1RTDA 3TZYA 3T1HF 2PEBA 3EDQB 2B8QA 2B7BB 4IH6A 1VC6A 3PYGA 2B3TB 3L7PA 2H4YB 4EMDA 3EE3A 3DYAB 3PFOA 4QIEA 1N33J 3OTOF 3DGVA 3H4DA 1RT2B 3L3CA 3TW0A 2AHOB 4OLPA 3IR5B 3LWLA 2D1CA 4RR5A 3KNAA 3TUJC 4X65F 4PYAA 3VAMA 1TFYA 3H2VE 3K8VA 1S1TB 3EWGA 3MPDA 4I7FA 1WF1A 1VMBA 4HH1A 4C0OC 4PPDA 4K5RA 1PC5A 2HURA 1NJIT 1RWWB 1TFWA 1YTYA 4FS1A 4KV8A 4B3SJ 2HRUA 2WVCA 5BYQA 3PRDA 1WOPA 5K8MA 2BVZA 3DLGB 4B3TF 4PKDB 3MAAA 2JEFA 2J7UA 4DEZA 2QYCA 2MJUA 3TEHB 2EI5A 5IV4A 4BC9A 1XIQA 1SC3B 1PKUA 4G65A 3PY8A 5L39A 1G1XA 3RB3A 4LFAJ 2AEFA 4M94A 1JLEB 2DKOB 4JI6F 1FERA 4CO1A 2MLYA 4C3MA 1R8AA 1Z1ZA 2DNYA 4EUVA 3LGMA 2NPFA 2M4MA 4JI1F 2K7KA 2FLLA 1RAEB 4EI2A 3SDEB 3TX8A 2ZWPA 3FQLA 1SXLA 2ZOGA 5C25B 3GV7B 1B64A 3Q8VA 4PQAA 5FD1A 3SFGA 5DQGA 4GRSA 3OXGA 3HHLD 2FJXA 4RW8B 1WOSA 3DRSA 2UU9J 5JMNA 3MM7B 3FBEA 5AXNA 1N5VA 2K06A 4HHUA 1RHQB 2MSSA 3H42A 4DZ6A 1RTDB 3M8PA 1YJWS 5EHHA 2FDNA 3R5BA 1NDPA 3PM9A 1ZZNA 4LVOP 5FLXY 3RBZA 4DV6J 2R3VA 4RUCA 4LF6F 1O5JA 3JXOA 2IIHA 2W8KA 4FYYB 1QVGR 4G6VB 2ZJQQ 2BR0A 1FJEB 2XZDB 1G2EA 3C6TA 4F3OA 1GQEA 2J9EA 1RAAB 4I7FB 4KBIA 1OYDA 2XY5A 1TUGB 4DMZA 4DSIA 3B54A 4JB8B 1U6FA 5DQIA 3WQPA 2XLIA 2ZKUA 3A8JA 3H5YA 1S12A 1GK8A 4QBUA 5F0UA 2BDPA 3IG1A 2HWIA 1BD6A 4O0NA 5CABA 5KFRA 3OL7A 4DU8A 1GH8A 2YPZA 4AE5A 3W60A 2H9ZA 4F4ZA 3MURP 1K0VA 1FRIA 3DNCA 2J9DA 3W2VA 2ZC3A 1VCTA 4NEYA 4RL1A 3RG6A 3MAAB 3RTVA 3FK4A 3HZGA 4B02A 4LF8J 2BUNA 4WTYA 2XI2A 4G1QA 4B3RF 2CJBA 4J91A 1SJFA 4FNIA 3FMBA 2ZM6F 1S72S 4C98A 2IMOA 3LF0A 3DM2A 2HHWA 2F3JA 5AXMA 4CQ1A 4JI0J 2CQCA 3RR8A 1V5VA 2OD4A 1UZDA 2VPWB 5E5NA 3A8IA 4ES1A 2VPXB 2IYIA 4MIBA 2KXNB 5LL6d 1JNZB 2AJ4A 2BJEA 1TL3A 2VICA 3K5PA 5B7WA 1HI0P 4ZK7M 1VR6A 3ZO7A 3EGVA 4CO0A 3DRSB 4B9VA 2DEIA 4F26A 1PCAA 2OEMA 3ZZOA 5ETTA 1K1QA 4RUAA 4DWIA 1F5BA 2DHHA 2K8GA 3GLJA 1TK8A 4WIIA 3HVRA 1HR0J 1VLYA 3OR2A 3CC7S 1Q95G 4ZVFA 2Z30B 2HHSA 3VF0B 3DDNA 4CLYA 2Z8QA 4DR2J 3AY0A 3C6TB 2B9YA 2MKJA 2C2KB 3ELHA 3VZIA 1FDDA 2M52A 2AEMA 3DOLA 2I1RA 2ALYB 2DHGA 2R8KA 4DL7A 5HJXA 4LIWA 1E6YA 1N33F 2VKRA 4ZN3A 2LXUA 1DHMA 5IOLA 1FVQA 1VYAA 7AT1B 3AFGA 2D3O1 1FFGB 3GB0A 2CPYA 3NL0A 3O3LA 5CD4H 4G3IA 2C42A 2HKEA 3JQKA 1QUVA 1IBLJ 1DARA 2OPQA 5C7PA 5FDLA 2Q6CA 2J6UA 3ZTSA 4UOCA 2KI2A 3P96A 4WKRA 2XMMA 1P27B 4Q2MA 1UVLA 1K9MT 4KO0A 4LSLA 4PG5A 4G1QB 4ED6A 4ED5A 1FXDA 4B3SF 3TAMA 3GFXA 1X4GA 3NOGA 2D3OR 3DM2B 2OSQA 4JV2A 2HVIA 1SKUB 2AP6A 3HD1A 1NK7A 2PFDA 1QTNB 3IR7B 1TL5A 4IOCQ 4KKOA 2Q3PA 3GR1A 3H5SA 4OHYA 3I32A 2MTLA 4N5SA 2C3MA 3K5NA 3L7OA 2CG8A 2VFVA 4LFAF 2PEHA 2MEWA 2DITA 1ZTWA 1TL3B 3J80U 5E41A 4NCAA 2C2MB 5DLFA 3T9NA 3VVTA 1ELOA 3PIPQ 3OW2R 3QATA 3V6KA 2QC3A 2ZDOA 2J0XA 2RD5C 4ZA1A 4ECZA 2DIVA 3BDEA 1SB6A 2RDDA 4M63A 3CWJA 1YRUA 2I5JA 2YH1A 1XWLA 2DIUA 4DPOA 2R7QA 3FEYB 1ZOTA 1S9GA 5KFHA 1J5OA 1RE1B 3K89A 5DZ6A 2V2QA 2XB2D 1VJQA 2UU9F 3ZNJ1 1UEVA 1FKOA 4TQRA 2HFOA 5ADZA 1UKUA 3W9HA 2CPFA 1KDNA 1L3VA 3VAIA 2NXCA 4DBQA 4ICLA 5I4MA 1YBAA 1RCOB 2YKPA 5LSOA 3MDFA 4LRCA 4DV6F 3EPGA 4XK8C 3QLHA 3D2WA 2G4BA 1E6YB 1AUDA 4LQ9A 1X5TA
chains in the Genus database with same CATH topology
2NYHA 2P8IA 2PEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYH A;  2P8I A;  2PEB A; 
#chains in the Genus database with same CATH topology
 5D8H B;  1RWX B;  2QG9 B;  1S79 A;  1ROF A;  5F9N A;  2DNO A;  3GJS B;  3TR5 A;  2D7S A;  1XJW B;  5E3Q A;  2A10 A;  3H20 A;  1EKR A;  3UPF A;  3CCU S;  2OPQ B;  5FDL B;  4PG6 A;  3NLC A;  3AA8 A;  3NNH A;  1U7L A;  2VZ9 A;  3U1N A;  2G9O A;  5F8G A;  3S7R A;  3GIK A;  2FC8 A;  4LBI A;  2R7W A;  1UFW A;  4DV1 J;  1O8B A;  4D3H A;  1IBM J;  4KO0 B;  4LSL B;  1CVJ A;  4U95 A;  2R9L A;  2WVB A;  3SIP B;  2R7U A;  5IFM A;  3TAM B;  2NUH A;  4J9U E;  1CUL B;  4NLQ A;  4USM A;  3IBF B;  3HJF A;  2E44 A;  4UUW A;  4U67 Q;  2QGF B;  4LRB A;  4LF8 F;  1D1U A;  4KKO B;  2KRR A;  4RBU A;  3J7Y U;  1A6L A;  2CJK A;  3GFZ A;  2ATL A;  1RAD B;  2VQF J;  2IHR 1;  2ACM A;  4ILR A;  2OPS A;  1UAW A;  4B9T A;  2VJU A;  1WC5 A;  1OJ4 A;  4C8M A;  2AYG A;  4JI0 F;  2QL7 B;  4Q2L A;  2VDH A;  2XHC A;  3GII A;  1BY9 A;  4K4T A;  2V8V A;  2HHV A;  2BW7 A;  2VL1 A;  2NXN A;  1RTJ A;  2DJW A;  2RUG A;  4ZMM A;  1OQ3 A;  2V2V A;  1GXU A;  2I5J B;  4PPZ A;  4A47 A;  3D0I E;  2AWZ A;  4BWM A;  1BQX A;  5C24 A;  1IJF B;  5CYQ A;  4ZOS A;  1S9G B;  1J5O B;  4AL6 A;  1SJ1 A;  2MZR A;  1I51 B;  1RKJ A;  1FKO B;  2DD8 S;  1ZS6 A;  2ZKT A;  3RRK A;  5ETO A;  4TNO A;  2WB4 A;  1OQ6 A;  3NXZ A;  4ICL B;  3G2X A;  4W4M A;  4TN2 A;  5D3G A;  3BQ0 A;  3FBC A;  1HR0 F;  3QLH B;  4ED1 A;  3FGV A;  1UWA A;  2RF2 A;  4DR2 F;  2B5J A;  1VC0 A;  3AD8 C;  1X9S A;  4HTJ A;  9RUB A;  3QNW B;  3D3C J;  2OLW A;  2HHX A;  4FP9 A;  1NXI A;  2CJQ A;  3QRP A;  1IJE B;  2H54 B;  2J9D E;  4RLE A;  2Y1I A;  3M05 A;  1Q8K A;  1H2T Z;  1X4E A;  3KKF A;  4AT1 B;  4TLQ A;  2CQ1 A;  2ZBR A;  2KVI A;  3PO4 A;  1I1G A;  3M8R A;  4ED0 A;  3PRV A;  4JV1 A;  2VG6 A;  4R25 A;  2FJD B;  4FPI A;  4CLF A;  1IBL F;  2JEJ A;  4OI4 A;  5LJ5 Y;  2XLK A;  1BE4 A;  5K14 A;  3CDB A;  3QJP A;  1YLX A;  2ZBP A;  4C4W A;  2FTR A;  4DS4 A;  3VAK A;  4J37 A;  4MYU A;  3HT0 A;  4NLW A;  3R7S B;  5GAG I;  4ECT A;  3MEC A;  2KG0 A;  5E33 A;  2POK A;  4ZHR A;  5HMY A;  1HBU A;  1S6Q A;  1Q8I A;  2OPS B;  3WHI A;  2F7V A;  4AND A;  3MMA B;  3OV7 A;  1OIA A;  2YQ0 A;  3CJ8 A;  3FUY A;  1FX4 A;  2WRM A;  1PJ5 A;  1D9F A;  3THT A;  5F0W A;  2FHM A;  3E2E A;  1RTJ B;  2FC9 A;  1NK8 A;  2LVW A;  4QU7 A;  2NQP A;  3FQK A;  4TU9 A;  3LO3 A;  2COL A;  1VGY A;  1U26 A;  5CYQ B;  1VK8 A;  2HVH A;  1TUV A;  3EZU A;  2UUC J;  5KG2 A;  2O67 A;  3CJQ A;  2D3U A;  3A4T A;  3NCP A;  1RT4 A;  4RW9 A;  2HZV A;  1YHQ S;  5L46 A;  1VOM A;  4LF4 J;  4DCP B;  1JIH A;  2YWF A;  2CJA A;  3F73 A;  2GMJ A;  2PA8 D;  5D3G B;  2IJR A;  1ZPV A;  3KFW X;  2FHJ A;  2R7T A;  1YK9 A;  3BBF A;  4EO8 A;  2DR9 A;  3BEG B;  4UW2 A;  3MOZ A;  1KQF B;  2B5J B;  3IA0 A;  4MH8 A;  4IG3 A;  2XGP A;  2APO A;  3B8H A;  2CXE A;  5AE2 A;  4CYU A;  3M9O B;  2OSR A;  3NS7 B;  1WHY A;  4PR6 A;  2B4P A;  4HT5 A;  4A8S A;  4TY9 A;  2YNI B;  4FF3 A;  2E9Z A;  3RYL A;  3ETM A;  2V34 A;  2CPX A;  1EET A;  2DGT A;  5GAE U;  3EUN A;  2ZH6 A;  3A3N B;  4DUY J;  3RW7 A;  1T9U A;  1KWM A;  1PJ6 A;  8AT1 B;  1BXN A;  2VG6 B;  1H7X A;  4H4K C;  5K14 B;  4U7U D;  4JP8 A;  3V81 A;  2IVM A;  5I3U A;  4A8K A;  2VBZ A;  4RKU C;  2VG7 A;  4DV1 F;  4Z2X A;  1IBM F;  2RDJ A;  3PR4 A;  3M8Y A;  1R8C A;  1FK9 A;  3J81 Y;  3MEC B;  2VPY B;  3PJW A;  2YVS A;  1U49 A;  4U8V A;  4MKY A;  4CTA A;  1HBU B;  1S6Q B;  3CGI A;  3KLF A;  2H1Y A;  1ITP A;  4LR9 A;  1AA1 B;  1FO1 A;  1WEX A;  3DDI A;  2HHU A;  2B4O A;  2RU3 A;  3BGO P;  3K2Y A;  1U47 A;  4EZ9 A;  2ZH2 A;  3JQJ A;  1S0N A;  4YS2 A;  2VQF F;  2XY7 A;  1HWU A;  4ZIV A;  1YBU A;  4DR5 J;  4TU7 A;  4H4K A;  1CSJ A;  4NLV A;  4JYA J;  2A18 A;  1EHW A;  2CPJ A;  1BQM A;  5HSP A;  1CJV A;  3CC2 S;  1UVI A;  3OXL A;  4NX9 A;  1RT4 B;  3EJM A;  4MTP A;  4RW9 B;  2FJV A;  4CT9 A;  4KAI A;  4NA2 A;  3I55 S;  4F4W A;  4KFB A;  3H90 A;  1YI2 S;  2XMU A;  3CUN A;  3TQ1 A;  1C0T A;  1RT3 A;  3KLG B;  3POT A;  4P6Q A;  1FTC A;  1JMT A;  2V8H A;  2JX2 A;  2R2S A;  1PYO B;  4ER8 A;  3CJ2 A;  2D9P A;  2KZM A;  2E29 A;  4TLR A;  4IG3 B;  1W2B R;  2VOP A;  2GIQ A;  2LA4 A;  3M7V A;  1QVF R;  4CYU B;  4QR2 A;  1GX5 A;  3CCL S;  3ULH A;  2XQC A;  1RU2 A;  3IC1 A;  1GTE A;  1VBX A;  3UNG C;  2DR6 A;  5LMU J;  3K5M A;  1TKT A;  4WXO A;  3WIV A;  1EET B;  5F8J A;  2WZ1 A;  4OHV A;  2VFS A;  3OL8 A;  4ZIT A;  3L9Z A;  1K73 T;  2BJ1 A;  4E2F B;  3BO4 A;  1FA0 A;  2HHT A;  3EXY A;  2YPY A;  4DR7 J;  1JJ4 A;  3A1Y G;  4NLP A;  3JYT A;  3V81 B;  3P5B P;  4G1I A;  1D3W A;  1U8S A;  4URQ U;  4UOF A;  1T9W A;  1NB2 A;  2PSZ A;  1T0T V;  3DOM A;  3TA1 A;  3QGP A;  1TV6 B;  1FK9 B;  4NA3 A;  4ZS6 A;  1MMD A;  3JTN A;  5LMN J;  3PX4 A;  3UDC A;  2R42 A;  4CTA B;  2KU7 A;  4OZ2 A;  1JJ2 R;  1JLC A;  1WKK A;  4F04 B;  1HQ2 A;  3NS5 A;  1N5S A;  4PQU A;  4K2X A;  1ZYQ A;  1S7H A;  4FXW A;  4PRF A;  1X7V A;  2RS8 A;  2VFT A;  2EFG A;  3EXC X;  5L9N A;  1Q7L B;  1Q16 B;  3UDL A;  5L1L A;  4CIO A;  1FKA F;  2YNH A;  5KFM A;  3DLL Q;  1QD1 A;  1CJV B;  2XTJ P;  2BM1 A;  1E6V B;  4DPW A;  4DI6 A;  2K3I A;  1JK9 B;  2MLX A;  1J27 A;  2DB1 A;  1NB7 A;  1HQU A;  2KJV A;  5DDR C;  4YHH J;  4KFB B;  4WTO B;  2QYG A;  1C0T B;  2Y1L B;  4MT1 A;  3R9L A;  2UUC F;  1IBK J;  2YY3 A;  4CLP A;  2Y1J A;  1SQE A;  2FGO A;  3W2W A;  1RB0 A;  4RPF A;  5D6G A;  2AD9 A;  2XNR A;  5BXI A;  5B0G A;  4LF4 F;  4RNN A;  1AFJ A;  3CJS A;  5C42 B;  3BM7 A;  1K44 A;  1UW9 A;  1U6Z A;  4ECR A;  1WHX A;  4LFB J;  4DR1 J;  1FNO A;  2EK1 A;  1UW4 A;  4WYL A;  1YGY A;  1TKT B;  2DNR A;  3KDO A;  1NKB A;  2EK6 A;  4LF9 J;  2FHK A;  2MZJ A;  3HSJ A;  3GPA A;  2RUS A;  4KHP J;  4ZPC A;  1L3K A;  1JB0 C;  4OZ1 A;  4OI2 A;  2FIU A;  5CH7 B;  5AJ3 J;  2OPP A;  2P9E A;  3UW1 A;  1D8Y A;  4EWT A;  3NMA A;  1LNQ A;  4LF7 J;  3OTC A;  4QR1 A;  4DUY F;  2HSE B;  2XM3 A;  4HDH A;  3N6M A;  3DLB A;  4YR0 A;  3DOM B;  2FHJ D;  4WXW A;  5A2Q Y;  5L1J A;  1N0V C;  1ZM4 A;  1PJ7 A;  4Q0B A;  1JLC B;  1FE0 A;  3OJU A;  4CLU A;  2QX0 A;  1WG1 A;  3NGD A;  1TAU A;  3IBW A;  1T95 A;  3BQ1 A;  5KG6 A;  3VAH A;  3MHY A;  2XZW A;  3R6L B;  4O0I A;  2GMH A;  2WOM A;  4ID5 A;  4WKY A;  5L1K A;  1FFS B;  4LT6 A;  2G0I A;  1S59 A;  2YNH B;  3ZZP A;  2QMX A;  5KFN A;  2LEA A;  4ZP8 A;  2X51 A;  3PFE A;  2ZVS A;  5HVH A;  1I5O B;  3OLA A;  5KOW A;  3SBM A;  2FHO B;  1HMV A;  1HQU B;  4I4B A;  4CO2 A;  2CPI A;  3BF4 A;  2NZ4 A;  4JYA F;  1Q53 A;  1T05 A;  1Y4Z B;  4NXN J;  4KH1 B;  2V4R A;  1VDH A;  2DBB A;  4DHV A;  1FVS A;  2UV8 A;  1TQL A;  5D0R A;  2HFS A;  1N5T A;  2QV6 A;  1F60 B;  1XK8 A;  3KJF B;  3U1M A;  1BWV A;  1PG5 B;  2XYP B;  4C3K A;  1RTH A;  5HO4 A;  1OY8 A;  3QQC D;  2RQC A;  2X1F A;  1CQN A;  2HNY A;  3R1L A;  5KT7 A;  4P2M A;  3SCK E;  1NKC A;  3Q0A A;  1ICE B;  2WW8 A;  2OPP B;  2VKZ G;  1XMB A;  2FVR A;  1DJ0 A;  5LMU F;  2HFZ A;  3I31 A;  2J0S D;  4WFN Q;  1F1B B;  4GKJ J;  1VQ9 S;  3G6Y A;  3FKB A;  4J9V A;  2LU2 A;  1QM9 A;  2L48 A;  3G8Q A;  2HIQ A;  1RAG B;  3LPE A;  5IQ6 A;  1YJN S;  2ATC B;  3Q83 A;  1BLU A;  1FRK A;  4DR7 F;  4R0E A;  1Y0H A;  4DG1 A;  4Q0B B;  3D67 A;  1JJH A;  4CO4 A;  1F9F A;  1P9Y A;  4LRE A;  1EB0 A;  2HHH J;  4I67 A;  1RGV A;  1CC8 A;  2Y3Y A;  3DKD A;  3N9U C;  3W8P A;  3OSN A;  3IM8 A;  1SVD A;  4F0M A;  2WOM B;  5LMN F;  4K4X A;  2PII A;  4X4S A;  2WVE A;  2ZJP Q;  3BB5 A;  4C8Y A;  2HVZ A;  2DH7 A;  4IH7 A;  1WC6 A;  1RTI B;  4C2M A;  3JSR A;  6AT1 B;  4ZCI A;  2CDQ A;  2CQP A;  1JWW A;  1JJC B;  4ZN1 A;  5A6P A;  3DDK A;  2IJF A;  4J9K A;  3BYP A;  3T19 A;  1R3N A;  2FD2 A;  4YUD A;  1NCL A;  3QYY A;  5ETK A;  5H9E J;  4WU2 A;  4YEA A;  1HMV B;  3W5Y A;  3ITH A;  1N5Y A;  2BAC A;  2LXI A;  3I4H X;  1T05 B;  3W9J A;  2BKN A;  1Y3J A;  1VC5 A;  3OD2 A;  2VD3 A;  1U24 A;  3BSA A;  3OUY A;  4YHH F;  3M8Z A;  1UJ5 A;  4GC7 A;  4F0K A;  1NME B;  3TP2 A;  3IS9 A;  1DBD A;  1IBK F;  1U1N A;  5B08 A;  4Y0F A;  4F02 A;  1MN7 A;  1IWA A;  1BUX A;  4DPY A;  1VK3 A;  2A1B A;  3KJV A;  3OTB A;  4USV A;  1RA6 A;  2HNY B;  2GW8 A;  3BS9 A;  1EAY C;  3WDO A;  2YNG A;  1H3D A;  4TVA B;  5H1S V;  1S57 A;  4LFB F;  4DR1 F;  3CUL A;  2F4V J;  2HVE A;  4H4O A;  3QSI A;  4USI A;  3NBP A;  4LF9 F;  2UXB J;  5LSL A;  3G8T A;  2FZK B;  3D28 A;  4NYZ A;  4KHP F;  3EVM A;  3PRB A;  2H5J B;  3G8S A;  4P2S A;  5AJ3 F;  2EPI A;  1U2C A;  4L6V 3;  5K20 B;  2HQG A;  2FVC A;  2ILZ A;  4DG1 B;  3Q24 A;  3FDS A;  4DL6 A;  3MEE A;  4LF7 F;  2FB0 A;  2JLG A;  4J9O A;  4PCQ A;  5CA5 A;  2PMZ D;  4ES3 A;  2XLJ A;  1QE1 A;  4DR4 J;  2RSQ A;  5HL7 Q;  3GFH A;  2ZZT A;  3UN5 A;  1KQG B;  3KJQ B;  2MKY A;  1LOU A;  4WP3 A;  4B3O A;  3CCQ S;  2Y8Y A;  2OHD A;  3C3L A;  4IFY A;  3JSM A;  5KFF A;  2VIH A;  4WZM A;  2JFD A;  3HP6 A;  4DXL A;  1ZM3 A;  1RLC L;  1HWL A;  1C0U A;  1KVK A;  1V3R A;  2WCX A;  2YKN A;  1WEZ A;  2IC3 A;  3ITH B;  1N5Y B;  4IFV B;  4QCL A;  1KSP A;  2HK2 A;  2KT5 A;  4WFB Q;  3C16 A;  2MLZ A;  2E7V A;  3K5O A;  4MFB A;  3FRZ A;  4QPT A;  1FWP A;  2KYX A;  2WW4 A;  2HLU A;  4TY8 B;  2PD1 A;  1WOR A;  2YWK A;  2RJZ A;  2Y9H A;  1UJ6 A;  3IS9 B;  1W26 A;  3HVT B;  4NXN F;  3KNG A;  3KHR A;  4N47 A;  2FQQ B;  5ETL A;  1U0H B;  3KJV B;  2KFZ A;  2ALZ A;  2E1A A;  3SV3 A;  1TEL A;  3UE2 A;  3IBC B;  3NAI A;  5J2M A;  1S4F A;  1SL1 A;  4FPR A;  1VRQ C;  5F3T A;  4IRK A;  1YWX A;  2DNQ A;  3AQP A;  2HQ3 A;  4N41 A;  1YIT S;  5HQL A;  1QAJ A;  4H4O B;  3NBP B;  5JXS A;  4NEZ A;  3D1H A;  2JC0 A;  1TKX A;  3D66 A;  1NRK A;  4WFZ A;  5HAT A;  1M0S A;  4L76 A;  3NEK A;  3UO0 A;  2R7S A;  1VIO A;  4DV5 J;  3W1Y C;  1RKI A;  5KG4 A;  1FE4 A;  4F25 A;  5IM0 A;  1FWL A;  2QE5 A;  2RHS B;  5D4O A;  4NCG A;  1TMM A;  4GKJ F;  3VGT A;  4FN5 A;  1M1K T;  3MI7 X;  2L41 A;  2HQC A;  3N5B A;  3MEE B;  1RWK B;  5KFX A;  2F1F A;  4OZ5 A;  4CO5 A;  2BV3 A;  4F2R A;  1WI8 A;  2PMH A;  3CCS S;  2UUW A;  4F2S A;  2XEX A;  1QE1 B;  1SJR A;  5B0C A;  2MGZ A;  3MZI A;  3JQM A;  3P49 B;  1PYS B;  2E5I A;  4WYW A;  3FSX A;  3J7A 1;  1RT6 A;  1IXK A;  2MZ1 A;  2HHH F;  3D6T B;  3MMB A;  4B3O B;  1S6U A;  4HHJ A;  4IFY B;  3KJN B;  3JSM B;  1YZ7 A;  3J80 Y;  1ZA1 B;  4OI3 A;  1S1X A;  3UR3 C;  2GHP A;  1SQG A;  3RRH A;  2M3D A;  4ZLL A;  1YJR A;  2VC0 A;  3CCV S;  1C0U B;  4KTQ A;  1BHN A;  3GYN A;  2YKN B;  4Y34 A;  2BQR A;  2IC3 B;  5GAD U;  3CD0 A;  5EN1 A;  3MTK A;  3U02 A;  3C16 B;  3R5J B;  4X4Q A;  2M8H A;  2JWN A;  3H7H B;  4MFB B;  5KFO A;  4URS A;  1F3V A;  1WAC A;  2M9K A;  3M8S A;  4LR7 A;  2C2D A;  2HS4 A;  4NLU A;  3S6E A;  1CS4 A;  3SZ2 A;  4CNZ A;  2F8E X;  4XPC A;  4LBH A;  4I69 A;  5CYM A;  4ZP7 A;  3OVB A;  1K8A T;  5HK4 A;  2ZH5 A;  1CJK A;  3DU5 A;  2CWX A;  4B9M A;  3B4M A;  4H54 A;  4DQI A;  5J2M B;  1QY7 A;  3HSZ A;  4OHZ A;  2YWW A;  2UV8 G;  1R89 A;  2UUB J;  4NLD A;  5KFJ A;  4PUO B;  4PAB A;  1RK8 A;  2BMB A;  4OYI A;  3D7S B;  1WG4 A;  3D4J A;  2ZNY A;  1JQG A;  2Z2Z A;  3DLH A;  3HZE A;  2JL9 A;  1TKX B;  4OYX A;  1AFI A;  1KHW A;  5GAH U;  3QO9 A;  3WBZ A;  3QIP B;  4Y2M A;  3GSD A;  2MKI A;  1NHU A;  1KEK A;  9ATC B;  4RNF A;  3GP9 A;  3M6U A;  3PHT A;  1TK0 A;  5DDO C;  3OL6 A;  2QA2 A;  2E5J A;  5IM0 B;  2F4V F;  4ED8 A;  4PEO A;  3QSY B;  5MAO A;  2UXB F;  3ISZ A;  2CZ9 A;  3PYF A;  2Z57 B;  2ZBI A;  4QWB A;  1N54 B;  2JJ4 D;  2J6T A;  1JNR B;  4DSK A;  2AGO A;  4B08 A;  3JB9 k;  2Y0B B;  3LUY A;  3KG1 A;  5E3R A;  2LEP A;  3G9C A;  2MGZ B;  1WC3 A;  1IM4 A;  2RH3 A;  2FVQ A;  1NZA A;  2AYM A;  4MIA A;  4WP8 A;  2R7V A;  1LWE A;  2WK4 A;  3WZ0 A;  3CCM S;  2YBV A;  4OFZ A;  5G0R A;  2WSF C;  3Q8U A;  1H7W A;  5DDQ C;  2L9W A;  3MMB B;  1WSV A;  3ET6 A;  3TUZ C;  2NS1 B;  2MQQ A;  2AJQ A;  1S1X B;  4DR4 F;  1KS2 A;  4NCB A;  3VGU A;  1Y5L B;  3PXG a;  5KFS A;  2DNL A;  4DL2 A;  5EWG A;  1NHV A;  3EGW B;  2O01 C;  2ZBC A;  4QOT A;  4J9Q A;  2V8G A;  3CDU A;  3PO5 A;  2HS0 A;  3NGK A;  5JVH Q;  3D68 A;  4EFA C;  4Q8F A;  5HVG A;  1VQN S;  5A6W A;  2DNK A;  4LF2 A;  3Q86 A;  3CVK A;  2BE2 A;  4NLX A;  4L72 B;  1BQN A;  2ADC A;  1CS4 B;  3T6J A;  3LP0 A;  3KXD A;  3CJ3 A;  3FZB A;  1YQH A;  4USK A;  3AJ1 A;  5CYM B;  3W5Z A;  1D8Z A;  2CAJ A;  3AHP A;  4K59 A;  3R7N B;  5E3C A;  3MMC A;  3JTP A;  3SMZ A;  2VFU A;  1WDD A;  2MPU A;  5LOQ A;  3ZC4 A;  4C97 A;  2H48 B;  1JX4 A;  3QO9 B;  4PZV A;  3R1H A;  3MOJ B;  1HAR A;  4EO6 A;  4K50 A;  1F2G A;  1W2I A;  4UY8 5;  4ZCK A;  4YB5 A;  4URG A;  4NZ6 A;  2ZH4 A;  4ZVE A;  4KGK A;  3SSS A;  2GAH C;  2K3K A;  3GE9 A;  1UPM B;  3CCT A;  1KLN A;  3EPI A;  5HP1 A;  2OI2 A;  2R2R A;  3B6B A;  3PW5 A;  3CJK A;  2RB7 A;  1XNR J;  2N3O A;  2GQC A;  1KRP A;  1QLN A;  1MWQ A;  2MY8 A;  4FVM A;  2B9E A;  4DV5 F;  3PYD A;  1YG0 A;  4UZC A;  3NY0 A;  3BN7 A;  2HQD A;  3QGH A;  3NMR A;  3P6Y C;  4FKX A;  3MM5 B;  1KVJ A;  2P2C B;  1LWE B;  3AH6 A;  3TWZ A;  2DGW A;  3LP1 B;  1UP1 A;  5G0R B;  2W01 A;  2BQU A;  1S6O A;  3OJS A;  3PX0 A;  2HGL A;  3HFV A;  2HW3 A;  4LRA A;  5LT5 A;  3ZTP A;  3W64 A;  1Q8B A;  4K2J A;  4YR3 A;  1WI6 A;  2EW9 A;  1KD1 T;  2Z58 B;  2LXF A;  1RSC A;  4ITS A;  2YTC A;  2JLE A;  3AXM A;  4QYZ K;  4GVL A;  2AU0 A;  1RDR A;  2QRR A;  2KXH A;  4ELV A;  3T5H A;  3R27 A;  3NGT A;  4LR8 A;  1X4C A;  3KK1 A;  2AZ3 A;  1FCA A;  2D74 B;  1MWZ A;  2QFJ A;  1U6B A;  3RU0 A;  3N6L A;  3HFZ B;  2V67 A;  3GJQ B;  2DT9 A;  4RW7 A;  5KT6 A;  2FYX A;  4FDF A;  2UVR A;  1WKL A;  4GC6 A;  1KON A;  2BE2 B;  4DQR A;  3HKW A;  4P2X A;  1BQN B;  2HLT A;  2G1H A;  2D3Z A;  2DY1 A;  3LP0 B;  1NSA A;  3D54 A;  3EZO A;  1WTB A;  4ED3 A;  4ETZ A;  2IRU A;  3MR7 A;  3MR3 A;  4DUZ J;  2LKZ A;  3LGN A;  2BKP A;  3NS6 A;  3P5T L;  3MMC B;  3MMJ A;  4BS2 A;  4GO7 X;  5D15 A;  5EGY A;  1Q8L A;  4HKQ A;  2VUG A;  2BRL A;  3Q8S B;  5IC6 B;  3AB2 B;  4JI8 J;  3EDR B;  5J1N A;  3VV2 B;  1PBU A;  1LWF A;  4O4G A;  5KG7 A;  4LQ3 A;  1ZZF A;  2DTJ A;  3I4P A;  3CXC R;  3BYR A;  2AKW B;  5CXT A;  3CDE A;  2UUB F;  3SXL A;  4A48 A;  3TX0 A;  5IXU A;  1IUJ A;  1DLO B;  2DR8 A;  4RU2 A;  4I6A A;  4P7T A;  3CJK B;  2BJ7 A;  3CIM A;  2JFK A;  4OJG A;  1B3T A;  3DLG A;  7FD1 A;  4M5K A;  5GAG U;  5LSR A;  3AD7 C;  3TUP A;  1N5Q A;  3D6M B;  2DNH A;  3D1Q A;  1ZM9 A;  2J8S A;  2ROE A;  2V68 A;  3E8O A;  3CC4 S;  3TAP A;  1JLG B;  4UY8 T;  2VON A;  2QZ8 A;  5ETM A;  2CQG A;  1X4B A;  3O1L A;  1D0E A;  2RRN A;  3KHL A;  1NPK A;  1SI9 A;  5KFW A;  3D3B J;  1GAO A;  2PI5 A;  2ZHB A;  1LW2 B;  2W7A A;  3MUT P;  2L3M A;  4DX6 A;  4OJ1 A;  3FBF A;  3ZZR A;  1WTF A;  2C22 A;  2NUU G;  5IQQ A;  2LQJ A;  3SCI E;  2ZOM A;  2W2N P;  3G96 A;  3QAU A;  1VQ5 S;  1QSL A;  4F4Y A;  3KK1 B;  4CH7 A;  4C8L A;  1VBY A;  2E9R X;  1R27 B;  1R8H A;  4YME A;  3TA2 A;  4P52 A;  1TKD A;  2EKY A;  2NZC A;  4KIA A;  4ZDN A;  3DHW C;  4RW7 B;  4NZ0 A;  4DL3 A;  5KFA A;  2IA6 A;  1U1L A;  2B4U A;  2EFO A;  4WK3 A;  4Z7Y A;  3NNA A;  4ZVH A;  1JKH A;  4QIF A;  3H8Y A;  4OHX A;  4P9S A;  4A8X A;  2GJF A;  4J9P A;  3Q2S C;  3HMJ G;  4USW A;  1U25 A;  2Z0G A;  2BJ3 A;  2N82 B;  1FRL A;  2HFN A;  2VQE J;  1S1U A;  3BH7 B;  2WON B;  1A9N B;  2HZC A;  3OR1 A;  4Y65 A;  1ZBT A;  4ZVP B;  4CDI A;  4A8M P;  2MKK A;  3R2D J;  4NLR A;  2HVD A;  3BBC A;  3S8S A;  5KAK A;  1Q0N A;  4JI2 J;  2CRL A;  1RHM B;  1SL0 A;  5KFQ A;  3WC0 A;  3QZ8 A;  4IKA A;  2GO8 A;  1PBA A;  5D4N A;  2XS5 A;  2AJ1 A;  2CNO B;  4OYP A;  1LWF B;  4O4G B;  2XYH B;  3D0G E;  4OLO A;  2P5V A;  3JSB A;  3CCZ A;  4K4V A;  3PDN A;  3HHN B;  4ZVS B;  2I2Y A;  1UEU A;  2V8D A;  2BE7 D;  3A13 A;  3U27 A;  4IR1 A;  1CJU B;  4OV1 A;  2IBK A;  2CQB A;  5K8N A;  4EZ6 A;  3G6V A;  3I0S A;  1P6T A;  2BE9 B;  4NML A;  2F8M A;  2NXJ A;  2EBE A;  5DO2 A;  2C3U A;  2W7O A;  3PEJ A;  4JI4 F;  1XNR F;  1VIX A;  2OH2 A;  3KHH A;  3C2P A;  1R43 A;  3LPY A;  1LEO A;  4M1K A;  2LYV A;  4HDG A;  1M5K C;  3P8B B;  4BBY A;  4C8K A;  5K8O A;  1R8B A;  1SPB P;  4OJH A;  2EXU A;  2ZNZ A;  2HS3 A;  4KE5 A;  4E8U A;  2IJN A;  4DV3 J;  5IS2 A;  1TVR A;  3H2U B;  1CQM A;  2VG5 A;  3QWP A;  2CJ9 A;  3M6X A;  2DVI A;  4AD6 A;  4DX8 H;  4IOA Q;  4O3O A;  4QPX A;  4J90 A;  5JUM A;  3BBB A;  3CO0 P;  3M8W A;  2VH7 A;  3ZZ0 A;  2HRY A;  3DRX A;  4DV4 J;  2PE8 A;  1I6J A;  1RXO B;  2LP4 A;  5IT9 Y;  3TOQ A;  1JKH B;  2FPH X;  4NLS A;  2W9C B;  4WFX A;  1HNW J;  3QZ7 A;  3OTD A;  1S1U B;  2WBR A;  1FFW B;  3OR1 B;  1FT8 A;  1Q81 T;  3P4U B;  3MR6 A;  4NYP A;  1S0V A;  1S1W A;  3CO9 A;  5HJY A;  1L3S A;  3BSC A;  1PAU B;  1DTQ A;  4R8U A;  4FXV A;  2ASJ A;  3KHG A;  1B0T A;  2QA1 A;  1IKV A;  1Z4U A;  2YX4 A;  4DUT A;  1Q82 T;  4O44 A;  4MIW A;  1B0V A;  4DUZ F;  1UVJ A;  2BX6 A;  3LGH A;  5DG8 A;  2GVD A;  2YH0 A;  4OYM A;  1S9F A;  1U8W A;  3VR1 A;  3MEG A;  1HLW A;  2ZH7 A;  1MNE A;  3OFG A;  3K0J A;  1O51 A;  2M5Y A;  3CW2 C;  4QIG A;  4JI8 F;  3W61 A;  3CF5 Q;  1V5I B;  4QWA A;  3KUH A;  2W1B A;  1UWB A;  2QLW A;  1YIJ S;  1NBE B;  4QYZ J;  1SKW A;  1WEY A;  2EC0 A;  3W3S A;  3I0S B;  1OO0 B;  2W2O P;  3AXK A;  4FYX B;  1N34 J;  2I0X A;  3H59 A;  4LFC J;  1F5C A;  1LWX A;  2XG8 A;  4ECQ A;  2UXD J;  1PGZ A;  2YQ3 A;  3T5J A;  4YB6 A;  1XR5 A;  4A8W A;  3MCO A;  2DNP A;  4LUB A;  4C6A A;  1G7C B;  2ZD1 A;  3QJL A;  1RJJ A;  5HVF A;  4M8L A;  4UQG A;  1T7P A;  2J6S A;  3HXM A;  3TZW A;  2GGP A;  4O3P A;  5CQG A;  1YBT A;  2H5I B;  3DMJ A;  1X4F A;  3PW0 A;  4XDC A;  5GMD A;  2EC2 A;  2LFV A;  2Z56 B;  4WWS A;  1TVR B;  2ABY A;  1FD2 A;  3CCJ S;  2VG5 B;  1SKR A;  1NDK A;  3S01 A;  3HD2 A;  2PT0 A;  2JHE A;  1NJZ A;  1Q7Y T;  4OYO A;  4FBU A;  2KH9 A;  2W2M P;  5B0B A;  3AA9 A;  2JRS A;  1XEZ A;  1APS A;  3LTO A;  1KFD A;  4HYK A;  1X5P A;  3MFH A;  4BLG A;  3FSY A;  4KR0 B;  4EBE A;  5E7O B;  3RGI A;  4DDF A;  3UN3 A;  3OT9 A;  3M6W A;  1S5Z A;  1VRU A;  3RB6 A;  4FF4 A;  3MPW A;  1S1W B;  5A76 A;  1RT5 A;  1DAX A;  4PG4 A;  4CO3 A;  3OHB A;  2GJ2 A;  3QT7 A;  1DTQ B;  1F3F A;  4R8U B;  3FNN A;  2VQE F;  1IKV B;  2CIM A;  3DC2 A;  4O44 B;  1RHJ B;  4F67 A;  2E5L J;  3RAM A;  1I94 J;  1TZ0 A;  5I3Q A;  2IAJ A;  4ZLJ A;  2GVD B;  2AEJ A;  4DLG A;  2HQI A;  4JI2 F;  3MEG B;  4R5P A;  2RDI A;  5KFP A;  2AZ1 A;  2ZDP A;  2DXE A;  2LQ8 A;  4TXS A;  2ZZN A;  2H65 B;  1K1S A;  3O44 A;  3FC9 A;  1UWB B;  3HO1 A;  3PIO Q;  5D0H A;  4K4Z A;  1KKH A;  2E1C A;  4V19 X;  3TUI C;  4DF8 A;  4LIR A;  2PI4 A;  4DQS A;  3EX7 B;  1KLM A;  5KT4 A;  2V63 A;  4B17 A;  1DQ8 A;  2ZD1 B;  4LRF A;  2ZIT A;  4L75 A;  3FRY A;  1CUL A;  2XO7 A;  5SZT A;  3PVX A;  1LW0 A;  3PKY A;  2MB0 B;  3AD9 C;  2GGP B;  2QLB B;  4I64 A;  1J2V A;  3DMJ B;  4OX7 A;  2BA9 A;  3HX9 A;  3VAG A;  1HYS A;  1X4A A;  3OTE A;  3PJ9 A;  5KFT A;  1Z2Z A;  4FYW B;  3MPU B;  5F9L A;  3NAH A;  4WIQ A;  3TZZ A;  2DH9 A;  4NLT A;  3MD1 A;  4O3Q A;  2GCF A;  3K8W A;  4K4S A;  2B7C B;  2FUG 9;  4QW9 A;  4DV3 F;  1UPP A;  4DN9 A;  4K7Q A;  1ZM2 A;  4LBP A;  1AUS L;  1RHR B;  4JV5 J;  3TVK A;  3G71 S;  2VAS A;  3G86 A;  4X4P A;  1VRU B;  2V9W A;  1WC0 A;  1L3U A;  1AW0 A;  2FZC B;  4DV4 F;  3EVO A;  2I8E A;  3O2I A;  2PN6 A;  4OZ3 A;  1RT5 B;  4NL5 A;  1X5O A;  1HNW F;  2RQ4 A;  2JEI A;  1OYE A;  2ADB A;  3RR7 A;  3EM1 A;  2HYI B;  4DR3 J;  5K5M A;  4GKK J;  4PXB A;  4O3R A;  1NPP A;  2IAJ B;  2Q1L A;  2Q66 A;  3HHD A;  3TYT A;  2D69 A;  3MM8 A;  4R5P B;  4NWB A;  4E98 A;  1J5E J;  3RB4 A;  1CC7 A;  1OSC A;  4EK2 A;  4V1A k;  2CPH A;  1NH7 A;  2ZE2 A;  2OP5 A;  2OMO A;  4UQT A;  4IOB A;  1WF2 A;  3R5G A;  4QIW D;  2HHQ A;  2KG1 A;  1NO8 A;  2ZWO A;  3C46 A;  1AB8 A;  4DN0 A;  1SL2 A;  1FTR A;  3QJJ A;  3OVS A;  1B70 B;  1KLM B;  4Y28 C;  2UZA A;  3HM9 A;  1O6X A;  3OL9 A;  4MKB A;  2JC1 A;  2H4W B;  2CZ4 A;  4GO5 X;  2C2E A;  1CG2 A;  2F5G A;  3I6P A;  1LW0 B;  1N34 F;  1H2U X;  4IRC A;  5BYR A;  4USH A;  2MJN A;  4LFC F;  3MED A;  4AQY J;  3CJ5 A;  2UXD F;  2IDL A;  4FKY A;  3R6G B;  3FFI A;  1HYS B;  2I6W A;  1SQF A;  4RNM A;  1IM6 A;  2DGQ A;  3MMA A;  3T1A A;  3IRX A;  2B56 A;  2F65 A;  4ENO A;  2E66 A;  3P45 B;  2R2U A;  1NJW A;  1QDU B;  3S1T A;  1NAQ A;  4RBV A;  2GNK A;  5M2R A;  4NI2 A;  4BWJ A;  2IYG A;  2F8H A;  2QO3 A;  4I6W A;  4DFM A;  3T5K A;  4CM2 A;  1RWM B;  4CLW A;  4WPA A;  2XC9 A;  4DL4 A;  1T03 A;  4LSZ B;  2BXJ A;  3TJ8 A;  3QRR A;  1VJW A;  5KFU A;  2YXL A;  2BAN A;  1RHU B;  2V2Z A;  2IY5 B;  4ZVR B;  1S0O A;  1RWN B;  3HCX A;  1T3N A;  2A6O A;  1JXV A;  1ARO P;  2IRY A;  4X4N A;  2VV5 A;  2V4Q A;  1VQL S;  4HEA 9;  4QYR A;  1HKA A;  3MAQ A;  1NK4 A;  2BM0 A;  2LQ5 A;  4UT4 A;  3PR5 B;  2KRB A;  2C3P A;  3FCH A;  4IRD A;  3IGN A;  3SCJ E;  2CZV C;  5B0F A;  3QT5 A;  1NH8 A;  1ZAW A;  3PV8 A;  3MM8 B;  3T1Y J;  4OJ3 A;  1YJV A;  3CE8 A;  2ZE2 B;  2CQ2 A;  3CNQ P;  3GON A;  2YNI A;  2E5L F;  1CEZ A;  1KFS A;  3PAC A;  1I94 F;  3JAM U;  3GV5 B;  1KNZ A;  4J9M A;  4P75 A;  4C0B A;  4U7C A;  4OYB A;  4DFK A;  3ILI A;  1L3T A;  2DH8 A;  2EBG A;  2CQ0 A;  3M4X A;  1FKP A;  2OD6 A;  2W7P A;  3GQC A;  1IR1 A;  1Q4R A;  5KT3 A;  4QZV B;  3TO8 A;  4DZD A;  3M6V A;  4Q45 A;  3NCQ A;  1EKS A;  2AYE A;  1FDN A;  3FBB A;  4IQM A;  3GZ7 A;  2YKA A;  3MED B;  2HND A;  5L9X A;  2HG4 A;  4DPU A;  1QAY A;  4IO9 Q;  3FFI B;  1X9W A;  3OHA A;  2BQ3 A;  2NXU A;  2BOP A;  2P6T A;  2AJ0 A;  4K4W A;  2AQ4 A;  1UVN A;  3IRX B;  5F3Z A;  2VPZ B;  2JZ5 A;  2W4D A;  4Z7C A;  5L38 A;  5B0E A;  2DNG A;  2JLF A;  3E01 B;  2BEF A;  4NI2 B;  1NSP A;  1NM2 A;  1AYE A;  1NK5 A;  3EVW A;  3UD5 A;  1HQE A;  2W24 A;  1RAC B;  2RIL A;  5BYS A;  1N56 A;  3CJT A;  5KFB A;  1FWK A;  1T03 B;  4MK7 A;  2DYA A;  5CYJ A;  1HD1 A;  3N6N A;  1XMO J;  1SCJ B;  4DPX A;  3DLK B;  2GC8 A;  2BAN B;  1LK5 A;  3MD3 A;  3VZH A;  2FVS A;  1C1B A;  1WHW A;  1HL6 A;  5D78 A;  1RTZ A;  1T8E A;  2HBY B;  4CWB A;  2CKW A;  2QSW A;  1U1O A;  3H40 A;  3PW2 A;  2C1E B;  3V4M A;  3NWR A;  2NR0 A;  4JV5 F;  1RBL A;  3KLG A;  1QAX A;  3W9I A;  4NE9 C;  5J2Q A;  5HQM A;  1EAR A;  2HNZ A;  2HQF A;  1N8R T;  1AXQ A;  3VTI A;  2RAQ A;  2KT3 A;  2BAB A;  2ZEJ A;  3V5R A;  3CSK A;  5F8M A;  4DR3 F;  8RUC A;  1CPZ A;  2MMY A;  2ZHO A;  4GKK F;  4ZVG A;  7FDR A;  1NND A;  1ACM B;  1RWP B;  3M8Q A;  1U1M A;  4HR2 A;  3K7R A;  3PKM A;  4C11 A;  4C9D A;  3QGG A;  1J5E F;  4FXD A;  1FKP B;  3ENW A;  4KB7 A;  2X7I A;  1PSD A;  2M7S A;  3W7B A;  4C48 A;  2LEC A;  3IAM 9;  3TAR A;  4I2P A;  4W92 B;  1FI4 A;  5LM7 E;  1QTM A;  4MJK A;  3R2C J;  1RIS A;  2HND B;  2AV5 A;  1TV6 A;  1RAH B;  4AYB D;  3A3O B;  3MUM P;  3THP A;  1VRT A;  5DGB A;  4B9U A;  3PG9 A;  3VQT A;  3BZQ A;  2QEX S;  2MQP A;  5KFI A;  1YKW A;  1FRM A;  3N28 A;  4AQY F;  2F40 A;  1M1H A;  1NLK L;  1HQE B;  4MKA A;  1NDL A;  2W4P A;  4CP5 A;  2GML A;  3U7J A;  4OX9 J;  2UUT A;  1VQK S;  1MMN A;  3IR6 B;  4QJV A;  4KRW A;  3VQS A;  2GHV C;  2GV1 A;  3HT3 A;  4ALZ A;  1E6V A;  4Q43 A;  4CH1 A;  1C1B B;  1F5A A;  2UXC J;  3RRG A;  4N76 A;  4EEY A;  1R0B G;  1HBO B;  4O3N A;  3CD6 S;  3B82 A;  1HHS A;  2KDO A;  1Y7P A;  1Q5Y A;  2WVF A;  2KXF A;  2A6M A;  2VOD A;  2J7W A;  1U2R A;  1M5O C;  5J2Q B;  1YRX A;  2Y8W A;  2HNZ B;  1NUE A;  5C42 A;  5DQH A;  2KJW A;  1BWE A;  2MKH A;  5K8P A;  2ZH1 A;  4DU7 A;  1WHV A;  3GU0 A;  1WSR A;  1NK6 A;  3IXQ A;  3OVA A;  5KFD A;  3QFH A;  1X4D A;  1YRT A;  3M8Q B;  5FJ4 A;  3A8K A;  2XCP A;  1TP7 A;  2OKQ A;  4C11 B;  5H9E K;  3J81 j;  3QT6 A;  1SKS A;  3T1Y F;  1HPZ A;  1RP5 A;  2J5A A;  3IGV A;  5KG1 A;  3F56 A;  5HBM A;  4I2P B;  4C8N A;  5DM6 Q;  2N4C A;  3AJD A;  4USU A;  1LKZ A;  2M88 A;  4N8O A;  2O1P A;  1VRT B;  2G0J A;  3UDE A;  2DRD A;  2KKH A;  2XY6 A;  1TMJ A;  4ZIW A;  2XMA A;  2XMV A;  4MK8 A;  2WHO A;  4DV0 J;  1PC4 A;  2KYZ A;  5K9F A;  2E1P A;  1TK5 A;  2V0N A;  3RW6 A;  3U1L A;  1ZPW X;  2DY9 A;  1XTZ A;  1NHK L;  2DPI A;  2MQO A;  1N48 A;  2DGO A;  2DCU B;  3NG8 A;  1DUR A;  5BR8 J;  1URN A;  3CDA A;  2QIF A;  4PG8 A;  4KV8 B;  3HI9 A;  4RW4 A;  3T3F A;  4K5S A;  2X3D A;  1FDA A;  3SV4 A;  2SXL A;  1D9D A;  4K4U A;  3TZX A;  1ZH5 A;  3MCN A;  4J9N A;  1FDB A;  3LH2 S;  4JBC A;  1XMO F;  4OYW A;  1WD6 A;  4EBC A;  3GCX P;  3IFE A;  2W8L A;  1TU0 B;  5KFC A;  3ZTR A;  2FVP A;  3NGS A;  2JSX A;  5KT5 A;  4RNH A;  3GYG A;  2QMW A;  2MQM A;  4M95 A;  2XSF A;  1M5H A;  1K0T A;  1S77 D;  2KTQ A;  1XR6 A;  5EWE A;  5DG7 A;  2L9N A;  3G82 A;  1IQZ A;  3CCE S;  4YR2 A;  5MLC V;  1FRH A;  3EZ5 A;  1HPZ B;  4WF9 Q;  4QQB A;  5L1I A;  2LQB A;  3IO1 A;  3MXH P;  5A8R A;  4USJ C;  4XPE A;  2ASD A;  4HI2 A;  2G13 A;  3T6B A;  2GIF A;  3NKY A;  3UD3 P;  2QMU B;  1Q79 A;  2Q43 A;  1TUW A;  4K0K J;  5HBM B;  4WZQ A;  3FMW A;  3GYX B;  4A8O A;  4HL9 A;  2OTL S;  3M8P B;  3UCG A;  1MWY A;  1DY3 A;  3MWB A;  2PMW A;  1RUS A;  1R0C B;  2HAF A;  3THV A;  1IKX A;  1HHT P;  5GAD I;  3R5A A;  2IBO A;  2NRE A;  2LLZ A;  1EQM A;  2GJI A;  2OML A;  2OFG X;  5A8W A;  5CZV A;  3M9M B;  4KT0 C;  4CRJ A;  4PXE A;  3I56 S;  4KGX B;  2C2R A;  4DSF A;  3Q89 A;  3BSN A;  3O8W A;  1NU4 A;  4KC5 A;  2HGN A;  1UVM A;  3GG0 A;  1RTI A;  3Q2T C;  3IG1 B;  5LXR A;  2AJF E;  3QID A;  3SSR A;  2MST A;  1FXR A;  5HMW A;  5DRK A;  3TJA A;  3KG4 A;  4DPT A;  4RW4 B;  4TKT A;  2QJ3 A;  3B78 A;  2B8P A;  2IFX A;  2KL8 A;  4OX9 F;  3W2V B;  4DR5 F;  4DS5 A;  4Q7A A;  2CWK A;  1NSK L;  2E1M C;  5GAH I;  4ES2 A;  2AJ2 A;  4ZPT R;  5CD4 A;  2A2D A;  3PW4 A;  3O6Q A;  1TAQ A;  2FJA B;  2GFF A;  3MPV A;  4B9N A;  5ETV A;  3Q8R B;  2UXC F;  2HK3 A;  5CAA A;  2L08 A;  1W25 A;  3KLH A;  1GT8 A;  4YFU A;  3OXF A;  2LEB A;  1EZZ B;  4OX6 A;  4PXC A;  2VBY A;  4FZV A;  4BC7 A;  2KVQ E;  3ILJ A;  3SSQ A;  3VAF A;  3CB4 A;  1S0M A;  2CDR B;  1MML A;  1UZH A;  1KQK A;  2FY1 A;  1WUU A;  4NMX A;  5RUB A;  2GQQ A;  2ERR A;  4M5G A;  3G82 B;  3C19 A;  1CLF A;  1M5S A;  2MQ8 A;  5A8R B;  4N7T A;  3IN5 A;  3TEG A;  3AOC A;  4KGM A;  3M9N B;  1H38 A;  3C14 A;  5AXL A;  3TRG A;  4WE1 A;  2DGX A;  2ZHA A;  3MF5 A;  2RE1 A;  2DNZ A;  2RIJ A;  1IKX B;  3MTJ A;  4RNO A;  1FF2 A;  1M1G A;  3OR2 B;  3ENV A;  1X31 C;  5U47 A;  4DQP A;  1VQ6 S;  5E2Q A;  2VA2 A;  5KFG A;  1IBC B;  4EYH B;  2ZZM A;  1GMW A;  5A8W B;  4AXJ A;  4K4Y A;  1KHV A;  3DRY A;  3DOL B;  3KWM A;  1B7Y B;  2W2P P;  3HVA A;  3VWS A;  1N52 B;  2IDE A;  3RAX A;  3BJY A;  3LP2 A;  5E3A A;  4QWC A;  1H73 A;  1V3Z A;  2W2Q P;  4A46 A;  1KOH A;  2P9G A;  2MYF A;  3DFE A;  1S10 A;  2CVE A;  5HI7 A;  3DI6 A;  4YB7 A;  4W90 B;  4AFF A;  4KH0 B;  4DV0 F;  4J9R A;  3MCS A;  5JJB A;  2CQI A;  4HI1 A;  1FJG J;  1IR2 A;  1TR0 A;  2K7J A;  4RWW A;  4B9L A;  2MXY A;  4OHW A;  4U96 A;  1RA7 A;  4IFV A;  5BR8 F;  1BMQ B;  2RU9 A;  1RYR A;  2EWH A;  4U8Y A;  4ANC A;  4I1T A;  3LA0 A;  1HFE L;  4XDD A;  1VFJ A;  5IWA J;  2J0Q D;  2KM8 C;  1U02 A;  2G2O A;  3KLH B;  4AL5 A;  4TY8 A;  2KZZ A;  3HVT A;  1HI8 A;  2X1B A;  2HWT A;  3FCV A;  3BO3 A;  3KYL A;  3DXB A;  4DX5 A;  1F6T A;  1U0H A;  4ZCM A;  2LA6 A;  1T94 A;  1T02 A;  3I96 A;  2DHX A;  1X0F A;  3G6X A;  3EIC A;  1IKW A;  2CYY A;  1S6P A;  4ZP6 A;  1M5V C;  3MM6 A;  3ZNU A;  2VA3 A;  3L4B C;  3N79 A;  3CCW A;  2V4J A;  1T9T A;  1YDL A;  3R5C A;  4X4O A;  1RWO B;  1W7W A;  1RAO A;  2U1A A;  3C14 B;  3ZZU A;  4WE1 B;  3L95 X;  1Y10 A;  1RT1 A;  4CNY A;  2UUA J;  4TYA A;  4P74 A;  2EFV A;  3L7U A;  4NRT A;  2XS2 A;  3D1O A;  2ASL A;  3QFW A;  1VHI A;  1VQO S;  3OBI A;  3Q8P B;  3SQG A;  4K0K F;  3RBE A;  4DCJ B;  1HWJ A;  2FLP A;  5KFE A;  2C3O A;  2IM2 A;  2BW2 A;  3D9B A;  2LMI A;  1UVK A;  2V2K A;  4B9S A;  1QJH A;  5EDW A;  4P72 A;  3LP2 B;  2I9S A;  3GIL A;  3WX8 A;  4F3M A;  4OZN A;  3NWG A;  3GSI A;  4NOH A;  3BGF A;  3DI6 B;  4ZP9 A;  5I3P A;  5FII A;  2VJV A;  3ICL A;  1H98 A;  2DNM A;  1U45 A;  4BHQ A;  3J7Z 5;  4ILL A;  2HEK A;  2DK2 A;  1SH2 A;  5H9F K;  4QR0 A;  4ZJO A;  4U6P A;  2NSB A;  2XI3 A;  2JEG A;  4KQZ A;  3VAJ A;  1FRJ A;  2GS8 A;  1IKY A;  4LF5 J;  1SUQ A;  4OZ0 A;  3R5D A;  2V5H G;  4NLO A;  3V6D A;  4XTT A;  4O4R A;  3HKZ D;  3H25 A;  2MZS A;  1RWU A;  3AOB A;  3CT9 A;  3HFK A;  2XS7 A;  4Y2A A;  1Y11 A;  3ZTQ A;  2K1R A;  3N0V A;  3W8G A;  3PW7 A;  2EVZ A;  5CZX A;  4LVN P;  3KOA A;  4RO0 A;  4CLL A;  4D3G A;  2R8H A;  3H98 A;  4OL8 A;  4OZL A;  1BGX T;  1WKJ A;  5KG5 A;  2UVW A;  4X2B A;  3LW5 C;  2ZC4 A;  4HLB A;  2F4F A;  3G4S S;  5GMK a;  1DQ9 A;  4AUK A;  4MMO A;  1IKW B;  1S6P B;  2OUG A;  1NKE A;  2IM0 A;  5A8K A;  1U48 A;  2HFU A;  3MM6 B;  4ZPB A;  4PUO A;  2HPU A;  1DFD A;  4DCO B;  4DV2 J;  2V4J B;  3BV8 A;  2CQ4 A;  4CLS A;  4DQQ A;  1XR7 A;  5DM7 Q;  1REV A;  3VVU A;  3BDP A;  1RT1 B;  3QIP A;  3DRR A;  5THW A;  2XO6 A;  2KM8 B;  5C24 B;  3NGU A;  1RAF B;  2BRK A;  1X9M A;  1SIW B;  1PIE A;  4X4U A;  2KFY A;  1TL4 A;  4OMF G;  3SQG B;  5E0O A;  1D9A A;  5AE3 A;  5CCM A;  3GIM A;  3AQO A;  1Z2L A;  4L3N A;  2FLN A;  3TI0 A;  4IO1 A;  3UQS A;  4OI0 A;  3GFY A;  4ZLN A;  4P7V A;  2L9D A;  4NA1 A;  1VQY A;  3M2V A;  3E51 A;  1AZS A;  2RF2 B;  3ZTO A;  1NJX A;  1YX2 A;  2JNJ A;  3MR2 A;  3M2U A;  1Y5I B;  2Z2M A;  1U1P A;  2XYG B;  4YN3 B;  1KN6 A;  5ETS A;  2OO4 A;  5M2P A;  3V2U C;  3KDN A;  1JLA A;  3FEX B;  2XBP A;  1RQ0 A;  1F2H A;  1TKZ A;  2DHS A;  4ELU A;  2KFN A;  2RQM A;  1TTH B;  1HWK A;  2HBR B;  3DLE A;  3K17 A;  2DIS A;  3D6H B;  4I2Q A;  1M90 T;  4F4X A;  3GG1 A;  4P2F A;  2XCA A;  3WC2 A;  1VS3 A;  1IKY B;  1OY6 A;  2I38 A;  1SUQ B;  1T11 A;  5KFV A;  3V6D B;  1FJG F;  1WDT A;  1H6K X;  1GMW D;  2K1R B;  1PO6 A;  1B7F A;  4P73 A;  4RZR A;  4NRU A;  2MY7 A;  2QA4 G;  2RRB A;  1HI1 A;  3J7Z T;  1R6V A;  1KQS R;  3T5L A;  1WG5 A;  4LF1 A;  4ZHR B;  5IWA F;  2QLJ B;  2VHG A;  3CME S;  1KTV A;  4X66 J;  3Q23 A;  1R8P A;  3BH6 B;  3OSP A;  1S76 D;  4KPC A;  1HBM A;  3T9Z A;  3TVZ A;  2GO9 A;  2QA4 S;  3MGJ A;  1XC9 A;  5A8K B;  3HSD A;  2M8D B;  1F0X A;  1UA1 A;  4BDP A;  3LWM A;  1OS5 A;  2KB2 A;  3IWL A;  3JS9 A;  5KTQ A;  1REV B;  5J1E A;  4PWW A;  3DRR B;  4ZJQ A;  4OZJ A;  2JOQ A;  2DXF A;  1UET A;  1NK0 A;  5G4D A;  3DHX A;  4ECU A;  4MKV A;  5B09 A;  3BO2 A;  4H4M A;  2RQK A;  3LAL A;  5D77 A;  2YQ1 A;  3RJM B;  1GTH A;  2UUA F;  3BSO A;  4X4T A;  2N4D A;  4O3S A;  2A2C A;  2ZFH A;  5ETP A;  4ZVQ B;  2O66 A;  3M2V B;  3HSG A;  1AZS B;  4KY3 A;  3IRW P;  3R7B B;  1U1R A;  3RUB L;  5F41 A;  3MM5 A;  2M70 A;  3M2U B;  3SYZ A;  3LP1 A;  5LXY A;  2ZUA A;  1VI7 A;  2R8J A;  1U1Q A;  4QWE A;  1RHK B;  5IV3 A;  2GVZ A;  3ZZZ A;  2W25 A;  3DXS X;  3KG0 A;  2EG2 A;  1JLA B;  1UA0 A;  5KG0 A;  3KK3 A;  1OWX A;  1TKZ B;  4EGL A;  1H72 C;  4Q44 A;  2HWH A;  4LJM A;  4DOZ A;  1VHF A;  2J8A A;  1YJT A;  2XMT A;  4F7V A;  3DLE B;  3W65 A;  4ATN A;  3IP0 A;  4I2Q B;  1VQ7 S;  5EX3 A;  4DL0 C;  1M5P C;  4ECX A;  5IZH A;  4WBF A;  5AXK A;  2WB1 D;  2AX1 A;  1GNK A;  1KOO A;  5I3U B;  4LSN A;  1IQT A;  2GAG C;  4M5N A;  1FES A;  4UTG A;  4YOE A;  4FNH A;  4NPO A;  3OPK A;  1SJ4 P;  3GJT B;  1D09 B;  2VG7 B;  1ULR A;  4WFA Q;  4L74 A;  2EG1 A;  2F63 A;  1NSQ A;  5LJ3 Y;  4LF5 F;  3LAK A;  4NXM J;  1KBR A;  3A3P B;  3KLF B;  5C5J A;  4ECS A;  2GA7 A;  4C8O A;  1SIZ A;  1HBM B;  4YQW A;  2V69 A;  3K57 A;  3CJ4 A;  2HRT A;  4NAS A;  2WAQ D;  5HMX A;  1Q1K A;  1XMQ J;  4TQS A;  4F50 A;  1VQM S;  4RJV A;  1DRZ A;  4RUB A;  1VQ8 S;  4NYO A;  5EWF A;  5C2C A;  5J1E B;  2B6A A;  1QSY A;  3MPY A;  3IM9 A;  3MAH A;  1MRO A;  5IC4 B;  4IUF A;  2DCL A;  1MG7 A;  3JAM Y;  1UFK A;  3PCO B;  2XMK A;  3VCD A;  2KHD A;  1BQM B;  2C2O B;  3BN4 A;  4DV2 F;  1LV5 A;  4H4M B;  4FYD A;  2B4V A;  1V9O A;  1DLO A;  1SH0 A;  2GX8 A;  1S1V A;  3ZXW A;  4KGZ B;  5I42 A;  5IT9 U;  4I6Y A;  1GMU A;  1N32 J;  5H9F J;  2RT3 A;  1V6H A;  2AGP A;  1DZ5 A;  1RT7 A;  4X84 A;  3DU6 A;  3W66 A;  4ECW A;  5FLX U;  4NLY A;  4Y2I A;  1YZ6 A;  1S7I A;  1RT3 B;  3P3D A;  2AT1 B;  3POT B;  5DZ7 A;  2GQ2 A;  2DNN A;  1KC8 T;  1HWI A;  4ECV A;  2OJ3 A;  4UOG A;  1JLG A;  4N8N A;  3N5F A;  3R3T A;  4HHH A;  2EFP A;  2M0G B;  2YWE A;  1L5U A;  3RBX A;  3K5L A;  2MKS A;  2GVZ B;  3BQ2 A;  1FNX H;  1GMV A;  3I5B A;  1LW2 A;  3AT1 B;  3HUL A;  4IDK A;  3ENA A;  5AE1 A;  3KK3 B;  4IH5 A;  2GHW A;  4AXI A;  1UMJ A;  4NLG A;  3AJ2 A;  2CJY B;  2O5D A;  3H4B A;  2H3E B;  2Z2L A;  1FD8 A;  4J7C A;  1FEE A;  3I9Z A;  5L8R C;  5KFL A;  1Q5V A;  3MEK A;  3FVY A;  2M2B A;  1SJQ A;  3DLJ A;  4OYA A;  2DXD A;  1KP6 A;  4A8Y A;  2BJD A;  3JYT B;  4Y00 A;  2R7R A;  1RU1 A;  4RX6 A;  4LSN B;  4QU6 A;  2VDI A;  4XAK A;  4C3L A;  1YJU A;  1UEK A;  2DO0 A;  4PAA A;  2BBE A;  2DRA A;  3SCL E;  2N3L A;  2LU1 A;  2B0G A;  4HVZ A;  3IAS 9;  3D0H E;  1U4B A;  2BJ9 A;  2G2Z A;  2WON A;  2MDA A;  4EBD A;  4J9S A;  3LAN A;  4PQU B;  5CCL A;  2QLF B;  1URR A;  1GEH A;  4P71 A;  4DFJ A;  1I3O B;  1A7G E;  5J2N A;  3VGS A;  1HNZ J;  4TU8 A;  1C2P A;  3KUG A;  4R0J A;  4J5O A;  3KUE A;  1XNQ J;  3TQE A;  2E5H A;  2C2N A;  3FZ2 A;  4CI0 B;  3KTQ A;  1S97 A;  4X66 F;  4G1P A;  2B6A B;  1PIL A;  1RBA A;  3QGI A;  4O23 A;  1MRO B;  2O3D A;  2CNN B;  1HNX J;  3HHK A;  2OEL A;  4OI6 A;  2E7X A;  3SI8 A;  2ROP A;  3UCZ P;  3H0P A;  2A0F B;  3IWN C;  2GZO A;  2HGM A;  2OFH X;  2ZH3 A;  1RAI B;  3JTO A;  1S1V B;  4DJB A;  5I42 B;  1CJU A;  4V19 J;  2BKO A;  1JLQ A;  3PX6 A;  4X62 J;  1RT7 B;  3O5T B;  4N77 A;  1N36 J;  2QFI A;  4ZPW R;  5F8I A;  3MM9 A;  2QL5 B;  2H51 B;  1MU2 A;  3HK2 A;  1F9H A;  2QL9 B;  3CJ0 A;  3CED A;  5BJR A;  3CD5 A;  1EJ7 L;  1V3S A;  3W2W B;  4JOU A;  4UOH A;  1NJY A;  2MQL A;  3E3X A;  3PZP A;  1VBZ A;  2OIH A;  3KLV A;  1YVF A;  1PAE X;  2HIY A;  3DOK A;  1CBK A;  5IT4 A;  2CUY A;  4RBT A;  4Q5V A;  2CVI A;  1G3O A;  4FF1 A;  4F0H A;  3MCM A;  3QMQ A;  3F41 A;  1U0S A;  5HAO A;  5B0D A;  3MFI A;  2RHQ B;  3VAL A;  4M5M A;  4IDK B;  3AAW B;  5HMZ A;  4EU0 A;  3VHQ A;  3PNI A;  2EFQ A;  3CD7 A;  3BPS P;  1ZAX A;  2HMI A;  5T41 A;  2XGQ A;  6FD1 A;  4I56 A;  3G87 A;  4KGV B;  1LXN A;  1G6B A;  5GME A;  3BR8 A;  1OY9 A;  1SBR A;  2Q79 A;  4MYT A;  3Q22 A;  2C3Y A;  1F9E B;  3V6H A;  2W9C A;  2OAU A;  2DEJ A;  4ECY A;  2X3G A;  2OPR A;  1WC1 A;  2NLW A;  2A3J A;  2Z2Y B;  4MAK A;  1OPI A;  1WF0 A;  3BPD A;  1RAB B;  3CTR A;  4ZVT B;  2DRB A;  1P1T A;  4GMK A;  1U2F A;  4GVB A;  3SQO P;  3W5X A;  2R7O A;  1KVI A;  5J2N B;  2QN6 B;  4EYI B;  2AF6 A;  4DL5 A;  2V50 A;  3A12 A;  3CDW A;  1FXL A;  1WC4 A;  3TNV A;  1O0P A;  2LDI A;  4KPY A;  1N88 A;  3FCW A;  4ID5 B;  4NXM F;  4PWU A;  4DFP A;  2ASY A;  4IG0 A;  5DG9 A;  1UJ4 A;  3DN9 A;  4JI7 J;  3B4D A;  3J7Y I;  1FEH A;  4FF2 A;  5D4P A;  4RW6 A;  2J0W A;  2EEY A;  1LFW A;  4M5J A;  4ED7 A;  5DET A;  4QWD A;  3H2L A;  1RYS A;  1XMQ F;  3K59 A;  2CNL B;  2BJ8 A;  4W98 A;  1RI7 A;  1P9Q C;  2ZVI A;  2AGQ A;  1R6Y A;  3CJR A;  2RKI A;  1JLF A;  4Z37 A;  3NOC A;  1JLQ B;  3R97 A;  1HNI A;  5T7L A;  4DSJ A;  2FGC A;  2CQD A;  2J76 E;  1MSW D;  3NCR A;  4P10 A;  3UI3 A;  1X5S A;  5F8H A;  2G1D A;  3MM9 B;  2F9D A;  3GTY X;  1MU2 B;  2RNE A;  1TL1 A;  5D4L A;  3ILO A;  2UP1 A;  1WEL A;  4M5D A;  3DOK B;  4ZKA A;  2ZH8 A;  1N32 F;  8ATC B;  2CPD A;  4OX8 A;  2WVD A;  4XO0 A;  5HLF A;  2FJE B;  4WP9 A;  1BC6 A;  1B99 A;  3BKT A;  1QUP A;  3C6U A;  1RTH B;  3RZA A;  2MQN A;  5DDP C;  2PFF B;  1OPZ A;  4PG7 A;  2X1A A;  3RAQ A;  4WJB A;  3OQ2 A;  3MR5 A;  1UL3 A;  5M2U A;  3M2R A;  2QLX A;  3KLE A;  5DGA A;  2HMI B;  2R8G A;  2V8P A;  2HAI A;  3UN2 A;  2PDA A;  3HLU A;  2AIR B;  2KO1 A;  1SC6 A;  3GWC A;  2JDJ A;  2HBZ B;  4YP3 A;  3AB4 B;  2XNQ A;  1P1L A;  2OPR B;  2H5E A;  1Q78 A;  3ADA C;  1Y00 A;  5C2G A;  4M5I A;  2UVV A;  1EIY B;  5SUH A;  3GMG A;  5DLG A;  3V4I A;  3BR9 A;  3G6E S;  4F4A A;  3V6J A;  4Y6I A;  4GVB B;  3GIJ A;  2IMW P;  2ZJR Q;  2QTW A;  2VBX A;  1IWG A;  1G4C A;  4IG0 B;  4XIU A;  3HJV A;  1EP4 A;  2KN4 A;  4FYV B;  1HA1 A;  3JSY A;  1T3O A;  1OSD A;  4RW6 B;  2B9W A;  1HNZ F;  2C28 A;  2DR5 A;  1WNE A;  2ACY A;  3DCA A;  2VF3 A;  1IR0 A;  2IM1 A;  1MW7 A;  4JUZ A;  1XNQ F;  2HFV A;  2P6S A;  2GIR A;  3I82 A;  2RVJ A;  4HTI A;  5HQ8 A;  2AMC B;  1EQ0 A;  2KHC A;  3F0N A;  2RKI B;  1WJ9 A;  1JLF B;  2RML A;  1HNI B;  5T7L B;  2NYI A;  4DSE A;  5J1P A;  1HNX F;  2N7C A;  4DX7 A;  1QSS A;  1YJ7 A;  1S48 A;  1SC1 B;  5E3P A;  1TL1 B;  1RBO B;  4A8Q A;  2IPO B;  4M5D B;  3C66 A;  2E1R A;  3OUY B;  3PHE A;  4X62 F;  2HBQ B;  3ISN C;  1N36 F;  2HZA A;  2KT2 A;  5HLF B;  2JVO A;  2V6A A;  3R8Y A;  2AW0 A;  2OEK A;  4F36 A;  4J9L A;  3NGR A;  3K58 A;  2MKC A;  3A8E A;  3BRE A;  3C6U B;  2VFR A;  2IVF B;  2XWY A;  2G0C A;  3CMQ A;  3I5C A;  2YNG B;  4KSE B;  1SJ3 P;  1RZM A;  4CM0 A;  2MHE A;  2CPZ A;  3LQV A;  3M2R B;  3KLE B;  5D0E A;  3H5X A;  1MN9 A;  3DGP A;  1WWH A;  5KG3 A;  4OQJ A;  5EUH A;  4MK9 A;  1NK9 A;  4OV6 A;  3L09 A;  1FX2 A;  3UVJ A;  4E0D A;  1CJT A;  1Y5N B;  3D5M A;  4F8R A;  3GJR B;  2DR7 A;  2P9C A;  4CLK A;  4N56 A;  5GAE I;  1LQ9 A;  5KT2 A;  1LWC A;  2BYC A;  2XMJ A;  3V4I B;  4WCE Q;  3D6F B;  3C15 A;  4HT7 A;  2DGS A;  4A8F A;  3EMT A;  3RBD A;  5JVG Q;  4UZB A;  1HHQ A;  1NPR A;  1FNM A;  4ANE A;  4YDD B;  2MHN A;  4WU3 A;  2W9B A;  1UTA A;  4OYZ A;  4DR6 J;  1X0P A;  3OFF A;  2F9J A;  3I9V 9;  1H0H B;  1B4S A;  2B43 A;  4I0W A;  1OMS A;  3UD4 P;  3H5U A;  1EP4 B;  1T9X A;  2AYB A;  3QRQ A;  4X4V A;  5AT1 B;  4M5L A;  1S4E A;  2VBW A;  2CFX A;  3TVY A;  4DLE A;  4OIX A;  1UFL A;  3KMQ A;  3BGR A;  2D9O A;  3TA0 A;  2LDY A;  1R0A A;  5HN0 A;  3BGU A;  3RB0 A;  4UST A;  2EKN A;  2XMW A;  3UWT A;  4JI7 F;  3ETO A;  4CCH A;  1B0P A;  2VC1 A;  1MLA A;  2K2P A;  1N4L A;  1QAI A;  1Y3K A;  2JH3 A;  4KYZ A;  2QT7 A;  3VGV A;  4A4J A;  1SV5 A;  3UFC X;  1EX8 A;  1GXL A;  1P8G A;  4ZJL A;  2IA0 A;  3ZFV A;  3W63 A;  4CH0 S;  3HPO A;  4FS2 A;  3X1L B;  4DV7 J;  2LCW A;  3WX4 A;  3NRB A;  3BKF A;  3TJ9 A;  3GV8 B;  3CMA S;  2YWG A;  4JI5 J;  2CQ3 A;  3CCR S;  2RS2 A;  4YB1 P;  1C1C A;  1JXE A;  1DTT A;  3OLB A;  3FSI A;  4LMZ A;  2V9K A;  3I5A A;  2NXE A;  5D0G A;  2U2F A;  3PTW A;  4ZVU B;  3UR0 A;  5IT0 A;  4ID8 A;  2Y0S D;  2J7K A;  3DGP B;  1GX6 A;  4I68 A;  1HIY A;  1RWV B;  4YY3 J;  3OFH A;  2ROG A;  3UVJ B;  1CJT B;  1FJC A;  2XUL A;  4F3Q A;  3EGZ A;  2R2T A;  1TL7 A;  4IQX A;  4TYB A;  4Q8E A;  4NCG B;  1JXL A;  1LWC B;  1REG X;  3M30 A;  4PXD A;  2B51 A;  3FJ2 A;  2IM3 A;  3C15 B;  4X4R A;  4RWX A;  4ZPA A;  3BGL A;  3OFE A;  1C4C A;  1H74 A;  3CPW R;  4LRD A;  3KK2 A;  5HRO A;  2XSJ A;  2W9B B;  1RCX B;  3J81 U;  1DQA A;  1HW8 A;  1Q86 T;  4X64 J;  2EFN A;  2D41 A;  2N7Y A;  3LOU A;  2VU5 A;  5KFZ A;  2XWX A;  4B3M J;  2DGV A;  1RT6 B;  2VB6 A;  2P8I A;  1HNV A;  2HHP A;  2UVU A;  5A0Y A;  3ILL A;  1HW9 A;  3BGR B;  4JI3 J;  3N01 A;  1VQP S;  1XN9 A;  3EYZ A;  1X8D A;  4YDX A;  4C0H A;  4FVC A;  3QPI A;  1R0A B;  3I0R A;  4ED2 A;  2LQ9 A;  3MUV P;  4Y3C A;  2XHW A;  5J2P A;  4ZPD A;  3QWU A;  5F8L A;  1S49 A;  4HAC A;  2W9A A;  2PA3 A;  3T1H J;  2X1G A;  3IMQ J;  4PWD A;  2MZT A;  4NZ7 A;  1IN0 A;  2IRX A;  1SV5 B;  3GCW P;  1GFW B;  2CPE A;  1LXJ A;  3UDV A;  3OTO J;  2DO4 A;  1VLO A;  3Q8Q B;  2YKM A;  4X65 J;  3HHL C;  1H2V Z;  4Y2C A;  1A0O B;  1T9V A;  3KMS A;  3LAM A;  2ILY A;  2FLO A;  2WSC C;  1CJK B;  1C1C B;  1DTT B;  2R8I A;  5ETN A;  2YKQ A;  2CAD A;  2CG4 A;  1PYT A;  3EGN A;  3TAN A;  1R7I A;  3FEZ A;  3I87 A;  2FJW A;  5F8N A;  5ETQ A;  5ETR A;  2Y1R I;  1C4A A;  4WK1 A;  1X60 A;  5EX0 A;  3E01 A;  3M32 A;  2DHA A;  4HH0 A;  1RLD A;  4ED4 A;  1U09 A;  4WFY A;  5B0A A;  4B3T J;  4M5H A;  1TL7 B;  2QSF A;  3N4W A;  4CLZ A;  4F4K A;  1YJ9 S;  2OGU A;  3HHL A;  3NNC A;  3DRP A;  3DLK A;  2FY8 A;  3M30 B;  3NP5 A;  1SC4 B;  5T14 A;  2OTJ S;  4JI4 J;  3KLI A;  1HBN A;  2V94 A;  4JI6 J;  3KK2 B;  3QT8 A;  5HRO B;  2R4F A;  2XSJ B;  3M1V A;  3QAE A;  2E7W A;  4JI1 J;  1N6Q A;  1S9E A;  3X3U A;  2CJX B;  1VBK A;  1HNV B;  4QW8 A;  4C8Z A;  5A0Y B;  4ERD A;  1JLB A;  2MZQ A;  3ET6 B;  5DS7 A;  2YNF A;  4DR6 F;  3I0R B;  3HVW A;  4U9R A;  2Z4P A;  3T41 A;  4C7Q A;  1NEE A;  2B9X A;  4IYQ A;  4ETX A;  1KTQ A;  5J2P B;  4QIV A;  2YX1 A;  2ZH9 A;  4HAC B;  4CZC A;  3AOA A;  3QBC A;  1U1K A;  3ZZY A;  2C2Z B;  4BCA A;  4PWD B;  3GIR A;  1UCN A;  4AL7 A;  3UNY A;  2E5G A;  1VIS A;  3ISN D;  4RU9 A;  3Q8Y A;  4LF6 J;  3BKU A;  2G2Y A;  1YSJ A;  4L3K A;  2CQH A;  2FJB B;  1R31 A;  1RAJ A;  3HHE A;  2YKM B;  2AX0 A;  1ZET A;  1N0U A;  5KFK A;  1LK7 A;  2XZT B;  1S99 A;  2DGU A;  4UF4 A;  2BZ2 A;  2PGC A;  2NCK L;  1WOO A;  1ZA2 B;  3DYA A;  4KHR A;  4ZVO B;  2DPJ A;  2YX7 A;  3GR0 A;  2WTF A;  1RT2 A;  1K47 A;  3F44 A;  1X4H A;  3ENQ A;  4ILM A;  3W62 A;  4ZPV R;  3C8Y A;  3TAQ A;  1VQS A;  1VQ4 S;  4DSL A;  1S1T A;  2JVR A;  4DV7 F;  4CLT A;  2PO4 A;  1ZTT A;  3PYE A;  1SH3 A;  4KHM A;  3IWX A;  4JI5 F;  2YKO A;  4KJI A;  4JV0 A;  3SFU A;  1Y9O A;  3M32 B;  1AT1 B;  3AOD A;  5GVQ A;  2OEJ A;  2NSC A;  1NZ8 A;  2NPI A;  2CA9 A;  4IR9 A;  1LFP A;  3HHL B;  3DRP B;  4B3R J;  1FRX A;  5HP1 B;  2WSE C;  5HAN A;  2ZM6 J;  2IVY A;  2Q6B A;  4YY3 F;  1NDC A;  6FDR A;  3WIU A;  3KLI B;  1HBN B;  3ZZT A;  1FHT A;  1ZAV A;  1HBO A;  4UUX A;  2FZG B;  5A2Q U;  3M1V B;  3CIZ A;  3HF5 A;  3PJX A;  4Y2K A;  1GXT A;  3HDS A;  3US5 A;  1FJ7 A;  2E9T A;  2VOO A;  1N6Q B;  1S9E B;  2NYH A;  2W4C A;  4OI1 A;  4ZLP A;  1XBW A;  1JLB B;  4K8R A;  2R7X A;  1JLE A;  3SEO A;  2YNF B;  2J9C A;  2ZBQ A;  5KOX A;  4PYD A;  2ZOF A;  4X64 F;  1HD0 A;  5CHC B;  2CNK B;  4U7U K;  2RRA A;  4DF4 A;  1XER A;  4B3M F;  2ZUG A;  3SDE A;  4JI3 F;  5C25 A;  5DJB A;  2BOA A;  4RUH A;  5KFY A;  3UCU P;  4ZCL A;  5ITH A;  4RW8 A;  2YWH A;  3MM7 A;  1XQI A;  4CT8 A;  3PEH A;  1T9Y A;  2WBM A;  4ELT A;  4L73 A;  3J7A N;  4S0M A;  1IVZ A;  2PC6 A;  1KR4 A;  4FBT A;  3ONQ A;  1RTD A;  3TZY A;  3T1H F;  2PEB A;  3EDQ B;  2B8Q A;  2B7B B;  4IH6 A;  1VC6 A;  3PYG A;  2B3T B;  3L7P A;  2H4Y B;  4EMD A;  3EE3 A;  3DYA B;  3PFO A;  4QIE A;  1N33 J;  3OTO F;  3DGV A;  3H4D A;  1RT2 B;  3L3C A;  3TW0 A;  2AHO B;  4OLP A;  3IR5 B;  3LWL A;  2D1C A;  4RR5 A;  3KNA A;  3TUJ C;  4X65 F;  4PYA A;  3VAM A;  1TFY A;  3H2V E;  3K8V A;  1S1T B;  3EWG A;  3MPD A;  4I7F A;  1WF1 A;  1VMB A;  4HH1 A;  4C0O C;  4PPD A;  4K5R A;  1PC5 A;  2HUR A;  1NJI T;  1RWW B;  1TFW A;  1YTY A;  4FS1 A;  4KV8 A;  4B3S J;  2HRU A;  2WVC A;  5BYQ A;  3PRD A;  1WOP A;  5K8M A;  2BVZ A;  3DLG B;  4B3T F;  4PKD B;  3MAA A;  2JEF A;  2J7U A;  4DEZ A;  2QYC A;  2MJU A;  3TEH B;  2EI5 A;  5IV4 A;  4BC9 A;  1XIQ A;  1SC3 B;  1PKU A;  4G65 A;  3PY8 A;  5L39 A;  1G1X A;  3RB3 A;  4LFA J;  2AEF A;  4M94 A;  1JLE B;  2DKO B;  4JI6 F;  1FER A;  4CO1 A;  2MLY A;  4C3M A;  1R8A A;  1Z1Z A;  2DNY A;  4EUV A;  3LGM A;  2NPF A;  2M4M A;  4JI1 F;  2K7K A;  2FLL A;  1RAE B;  4EI2 A;  3SDE B;  3TX8 A;  2ZWP A;  3FQL A;  1SXL A;  2ZOG A;  5C25 B;  3GV7 B;  1B64 A;  3Q8V A;  4PQA A;  5FD1 A;  3SFG A;  5DQG A;  4GRS A;  3OXG A;  3HHL D;  2FJX A;  4RW8 B;  1WOS A;  3DRS A;  2UU9 J;  5JMN A;  3MM7 B;  3FBE A;  5AXN A;  1N5V A;  2K06 A;  4HHU A;  1RHQ B;  2MSS A;  3H42 A;  4DZ6 A;  1RTD B;  3M8P A;  1YJW S;  5EHH A;  2FDN A;  3R5B A;  1NDP A;  3PM9 A;  1ZZN A;  4LVO P;  5FLX Y;  3RBZ A;  4DV6 J;  2R3V A;  4RUC A;  4LF6 F;  1O5J A;  3JXO A;  2IIH A;  2W8K A;  4FYY B;  1QVG R;  4G6V B;  2ZJQ Q;  2BR0 A;  1FJE B;  2XZD B;  1G2E A;  3C6T A;  4F3O A;  1GQE A;  2J9E A;  1RAA B;  4I7F B;  4KBI A;  1OYD A;  2XY5 A;  1TUG B;  4DMZ A;  4DSI A;  3B54 A;  4JB8 B;  1U6F A;  5DQI A;  3WQP A;  2XLI A;  2ZKU A;  3A8J A;  3H5Y A;  1S12 A;  1GK8 A;  4QBU A;  5F0U A;  2BDP A;  3IG1 A;  2HWI A;  1BD6 A;  4O0N A;  5CAB A;  5KFR A;  3OL7 A;  4DU8 A;  1GH8 A;  2YPZ A;  4AE5 A;  3W60 A;  2H9Z A;  4F4Z A;  3MUR P;  1K0V A;  1FRI A;  3DNC A;  2J9D A;  3W2V A;  2ZC3 A;  1VCT A;  4NEY A;  4RL1 A;  3RG6 A;  3MAA B;  3RTV A;  3FK4 A;  3HZG A;  4B02 A;  4LF8 J;  2BUN A;  4WTY A;  2XI2 A;  4G1Q A;  4B3R F;  2CJB A;  4J91 A;  1SJF A;  4FNI A;  3FMB A;  2ZM6 F;  1S72 S;  4C98 A;  2IMO A;  3LF0 A;  3DM2 A;  2HHW A;  2F3J A;  5AXM A;  4CQ1 A;  4JI0 J;  2CQC A;  3RR8 A;  1V5V A;  2OD4 A;  1UZD A;  2VPW B;  5E5N A;  3A8I A;  4ES1 A;  2VPX B;  2IYI A;  4MIB A;  2KXN B;  5LL6 d;  1JNZ B;  2AJ4 A;  2BJE A;  1TL3 A;  2VIC A;  3K5P A;  5B7W A;  1HI0 P;  4ZK7 M;  1VR6 A;  3ZO7 A;  3EGV A;  4CO0 A;  3DRS B;  4B9V A;  2DEI A;  4F26 A;  1PCA A;  2OEM A;  3ZZO A;  5ETT A;  1K1Q A;  4RUA A;  4DWI A;  1F5B A;  2DHH A;  2K8G A;  3GLJ A;  1TK8 A;  4WII A;  3HVR A;  1HR0 J;  1VLY A;  3OR2 A;  3CC7 S;  1Q95 G;  4ZVF A;  2Z30 B;  2HHS A;  3VF0 B;  3DDN A;  4CLY A;  2Z8Q A;  4DR2 J;  3AY0 A;  3C6T B;  2B9Y A;  2MKJ A;  2C2K B;  3ELH A;  3VZI A;  1FDD A;  2M52 A;  2AEM A;  3DOL A;  2I1R A;  2ALY B;  2DHG A;  2R8K A;  4DL7 A;  5HJX A;  4LIW A;  1E6Y A;  1N33 F;  2VKR A;  4ZN3 A;  2LXU A;  1DHM A;  5IOL A;  1FVQ A;  1VYA A;  7AT1 B;  3AFG A;  2D3O 1;  1FFG B;  3GB0 A;  2CPY A;  3NL0 A;  3O3L A;  5CD4 H;  4G3I A;  2C42 A;  2HKE A;  3JQK A;  1QUV A;  1IBL J;  1DAR A;  2OPQ A;  5C7P A;  5FDL A;  2Q6C A;  2J6U A;  3ZTS A;  4UOC A;  2KI2 A;  3P96 A;  4WKR A;  2XMM A;  1P27 B;  4Q2M A;  1UVL A;  1K9M T;  4KO0 A;  4LSL A;  4PG5 A;  4G1Q B;  4ED6 A;  4ED5 A;  1FXD A;  4B3S F;  3TAM A;  3GFX A;  1X4G A;  3NOG A;  2D3O R;  3DM2 B;  2OSQ A;  4JV2 A;  2HVI A;  1SKU B;  2AP6 A;  3HD1 A;  1NK7 A;  2PFD A;  1QTN B;  3IR7 B;  1TL5 A;  4IOC Q;  4KKO A;  2Q3P A;  3GR1 A;  3H5S A;  4OHY A;  3I32 A;  2MTL A;  4N5S A;  2C3M A;  3K5N A;  3L7O A;  2CG8 A;  2VFV A;  4LFA F;  2PEH A;  2MEW A;  2DIT A;  1ZTW A;  1TL3 B;  3J80 U;  5E41 A;  4NCA A;  2C2M B;  5DLF A;  3T9N A;  3VVT A;  1ELO A;  3PIP Q;  3OW2 R;  3QAT A;  3V6K A;  2QC3 A;  2ZDO A;  2J0X A;  2RD5 C;  4ZA1 A;  4ECZ A;  2DIV A;  3BDE A;  1SB6 A;  2RDD A;  4M63 A;  3CWJ A;  1YRU A;  2I5J A;  2YH1 A;  1XWL A;  2DIU A;  4DPO A;  2R7Q A;  3FEY B;  1ZOT A;  1S9G A;  5KFH A;  1J5O A;  1RE1 B;  3K89 A;  5DZ6 A;  2V2Q A;  2XB2 D;  1VJQ A;  2UU9 F;  3ZNJ 1;  1UEV A;  1FKO A;  4TQR A;  2HFO A;  5ADZ A;  1UKU A;  3W9H A;  2CPF A;  1KDN A;  1L3V A;  3VAI A;  2NXC A;  4DBQ A;  4ICL A;  5I4M A;  1YBA A;  1RCO B;  2YKP A;  5LSO A;  3MDF A;  4LRC A;  4DV6 F;  3EPG A;  4XK8 C;  3QLH A;  3D2W A;  2G4B A;  1E6Y B;  1AUD A;  4LQ9 A;  1X5T A; 
#chains in the Genus database with same CATH homology
 2NYH A;  2P8I A;  2PEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...