2NYHA

Crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
b'GMTFRDTSAIASWHAHVYFDASSRDAAWTLREQIEAHWSGKLQLGRFHERPVGPHPMWSYQLAFTQEQFADLVGWLTLNHGALDIFLHPNTGDALRDHRDAAVWIGHSHELVLSAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dioxygenase
publication title Crystal structure of putative Dioxygenase (YP_555069.1) from Burkholderia Xenovorans LB400 at 1.70 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08883 DOPA_dioxygen Dopa 4,5-dioxygenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits DOPA-like domains 2nyhA00
2P8IA 2PEBA 2NYHA
chains in the Genus database with same CATH superfamily
3R5JB 5A6WA 5KFDA 1UA0A 4U96A 1RA7A 2VICA 3D6HB 3BJYA 3NNHA 2AKWB 3MD3A 2CQDA 4H4MB 1TUGB 3T19A 4YDDB 3KFWX 3SBMA 4DG1A 3EXYA 3SXLA 4BDPA 4I4BA 1GX5A 3PM9A 1Q5VA 1WEYA 1SJQA 4TY9A 3OFEA 3HT3A 3G2XA 1KVIA 3HF5A 1Q86T 2W24A 4NLUA 2HBQB 3GWCA 2R8HA 2K2PA 3C6UB 5B0CA 3TOQA 3QGPA 4DL6A 1FWPA 2DH9A 5BR8F 2DK2A 1F9EB 3QRPA 2ZFHA 4QZVB 3TA1A 5KG1A 3PFOA 1FT8A 3NEKA 4ECWA 3NMAA 1BLUA 1CJKA 1X4GA 3LH2S 3AXKA 5DLFA 1RTHB 4P2FA 2ZH3A 3QGIA 4CTAA 2J9DE 2XSJA 1XBWA 3CCSS 3D68A 2N7CA 5A76A 2UVRA 3BS9A 4FS2A 2MY8A 3TVZA 1RWPB 1WNEA 3A4TA 2WOMB 5CYMA 3OTEA 2FPHX 4F4AA 4ECXA 4B3RF 3PTWA 3CXCR 2MDAA 4P52A 4X62F 1UVJA 3K5MA 4A8FA 5I4MA 1XR6A 1ULRA 1LFPA 1U2CA 3CDAA 3BEGB 4LFCJ 4R8UB 1LXNA 2OEKA 1Y10A 1YKWA 2W2MP 3DCAA 4NLQA 2W7PA 2DY9A 1RADB 1BQMB 3QFHA 2DNYA 2QFJA 4WP8A 1VQ8S 1J5OB 1LFWA 5GAHI 3C6TB 5J2MB 2ZH8A 3OXFA 5DDOC 1QDUB 2F63A 3IBWA 2ATLA 1YK9A 1T94A 4HH1A 3LP1B 4RLEA 2X1FA 1WG5A 1YLXA 3G6YA 4DSIA 1YJNS 1ZOTA 3UD3P 4OJHA 1U24A 2RDIA 2B7BB 2ZZTA 5DDRC 4QQBA 2QMUB 3MI7X 5J2NA 5E3QA 3FFIA 2WB4A 3HULA 3CJ4A 3QO9B 2HURA 1CC7A 3ENAA 1X60A 4LBIA 4HL9A 4O4RA 2HNZB 4NZ7A 5FDLB 1WOSA 1K73T 3GJTB 1C4CA 2V9WA 3B78A 1RHJB 3O3LA 3PRBA 4NXNF 2OP5A 4MAKA 1WTBA 4ZVPB 4E2FB 2AYGA 4Q44A 2IRUA 4MFBA 4ZMMA 3FK4A 5KG4A 2GGPB 2V5HG 4QJVA 4NI2B 4G6VB 3B4DA 2FLPA 4OI1A 1YSJA 2JNJA 2GIFA 5D0GA 1KFDA 1YZ7A 1M5OC 1V3SA 4XIUA 3MEGA 4EGLA 2AU0A 4ED5A 4W92B 2CKWA 4PG4A 4NRTA 4LF7J 2V63A 5KT4A 2KJVA 3AY0A 3MR2A 2CJAA 1XWLA 2Q1LA 4PAAA 4MKVA 4P7TA 1X0PA 1R8PA 2ZH4A 3FSYA 3FSXA 4N8OA 3S6EA 4QPXA 4F02A 4PPZA 1RWWB 2K1RA 4FXWA 4KSEB 4XK8C 4XAKA 5KFLA 4CM0A 3LPYA 3M30A 3IN5A 5CD4A 3AJ1A 2ZZMA 3KHLA 1JLBA 2OKQA 3V81B 3N01A 5DG9A 4HDHA 4B3TF 5CCMA 2X51A 1LK5A 1B0PA 3HJVA 4ZVRB 5AJ3F 1TK8A 2Z4PA 2HSEB 1JJHA 1JK9B 1RWOB 3ZTQA 1FWLA 1Z4UA 4ZN1A 4WE1A 4OYIA 4ZN3A 4ILMA 5F8HA 4XTTA 2ZDOA 4F4XA 4J37A 4NZ0A 4KKOA 3D1OA 4ED8A 3T9ZA 2N4DA 2RILA 1NK4A 2QX0A 4F3QA 4F26A 1WHVA 3MOZA 4GMKA 3AOBA 4LBPA 2BE2B 3KLGA 1K44A 1DTQA 3V6HA 1U1OA 1NB2A 3MPWA 2ZVIA 3HXMA 1HWIA 2B51A 2H51B 1WI6A 2EK1A 4ETXA 4WP3A 2G13A 2FGCA 3U02A 2K7JA 1U1QA 2A0FB 2HVIA 4NLDA 1LW0B 3O1LA 1NCLA 2WTFA 3H40A 1N5SA 4DR1J 2NQPA 3O8WA 4K4SA 2ZBIA 1NJYA 1GMWD 1FE0A 3AOCA 4KE5A 1NH8A 4B08A 4HACA 1U1MA 3LA0A 2Z56B 3EXCX 4F0MA 3O6QA 2YNFA 1XN9A 2P9GA 4P2SA 5A8RA 4EK2A 3VGTA 5B0GA 5C25B 1WJ9A 5HMWA 3A3NB 4ZCKA 4B9TA 3OFGA 1PAUB 3THTA 4LFCF 5LSLA 1TAQA 3NAIA 3MEEA 2W7OA 4USKA 3R7NB 2OTJS 2Z2LA 1KDNA 3CD5A 1QVFR 5M2RA 3SQGB 2YNHB 2I2YA 1HMVB 2MKCA 2NLWA 1VYAA 3GIRA 2VFUA 3H2UB 1BGXT 3IC1A 2OSQA 3MMAB 3MAAA 4C8MA 4DR5J 4DPTA 2ADCA 2PT0A 2LEPA 3DOLB 3TQ1A 2O3DA 2MQOA 2RHSB 4GKJJ 5IXUA 2HGMA 3JAMY 1CEZA 2HZAA 2MJUA 3M8WA 1UVIA 1OSDA 2IA0A 2FLLA 1QLNA 2KJWA 3T5LA 1AZSB 2YQ0A 1SV5A 2DTJA 2FVPA 2DEIA 1TELA 4ZLNA 4PQUA 4RL1A 2AJ0A 3QMQA 1Q8LA 3A3OB 3PYFA 4QW9A 4B9UA 4M5NA 4DL0C 2IMOA 2RQ4A 3D9BA 1LWEB 3MTJA 3CF5Q 1IBCB 4EBDA 2YH1A 3LF0A 4UTGA 6FD1A 4U8VA 4DX7A 3EGVA 1HBOB 2A10A 5CYQA 4CWBA 3EGZA 2V2ZA 3W61A 1VISA 3L7PA 3VAGA 1GMUA 3CDEA 3V6DA 1AROP 2XZDB 4M5GA 1FD8A 1WELA 4RW9B 4DQIA 1N8RT 3UVJA 5ETNA 3I6PA 3KKFA 4TYAA 5G0RA 3BO2A 1PG5B 2BANA 2WW8A 4TLRA 3TAPA 1REVA 1SKUB 4Y65A 2CIMA 1O0PA 2E1MC 3GYXB 4N5SA 3WIUA 1WC1A 2J9DA 2XMVA 1HQEB 2UUAJ 3PFEA 3PHEA 4RW6A 4CM2A 5C2CA 3M2VA 2LDYA 4J9QA 1F3FA 3IG1A 4EO6A 3CT9A 2M3DA 2XULA 3TJ9A 5KFBA 3GIMA 3ITHA 1WEXA 3KWMA 1L5UA 2MB0B 4GKKJ 3HD2A 2H1YA 4LBHA 4C8ZA 4NLOA 3Q86A 4YR0A 3UCUP 3OTOJ 5KFMA 2HMIB 3BDEA 2B56A 4DFPA 1AXQA 1R0BG 2B5JB 4DV2J 2HRYA 2L9WA 3IM8A 4G3IA 4ZHRB 1BQNA 3PZPA 1UVNA 4DUYJ 4Z7CA 3M8QA 1JLQB 2GZOA 2AEMA 1FJGJ 4X4TA 3TUJC 4FBTA 4WXOA 2W9CB 3Q83A 3CJKA 2QFIA 4B3OA 5HQ8A 4YDXA 1RAEB 3O5TB 4JI3F 3NKYA 3HVTB 3U1MA 4F8RA 3OSNA 1FO1A 2QA4G 1PGZA 1UWBA 4J9NA 2XWXA 2DXEA 2XMUA 2RB7A 3VGSA 4MK8A 2E5IA 4RBTA 4C9DA 3BSAA 4AL6A 4C8YA 1A9NB 3CCTA 4OYWA 2QE5A 3T1AA 4Q5VA 3KOAA 2FGOA 1S1WB 4ICLB 4USHA 4PUOA 2J8AA 5KFSA 5LSRA 4ZP9A 5E3RA 4KFBA 2PMWA 3OTDA 2EKYA 2EFOA 3S7RA 1VRQC 2ZH7A 1VC5A 3M8PA 3MMJA 2R8JA 1T9WA 2VKRA 3OR2A 1NPRA 2QYCA 5AE1A 3C16B 2VJVA 2V34A 3W9JA 4K7QA 4GRSA 3MEDB 3NS7B 1IKYA 2R7UA 5FIIA 3WHIA 3W5ZA 2QO3A 5HSPA 3QAEA 2QL9B 4PCQA 2O01C 1VQSA 4DR5F 1RWNB 3B82A 3PG9A 1IJFB 1ZYQA 2CNNB 1HIYA 3LALA 2DNHA 3M6UA 3VAHA 3TARA 1PJ5A 4RWXA 4I67A 1RAFB 1DQAA 5ITHA 3C15A 1VRTA 2YNGA 3GR1A 4OL8A 4FPIA 3M6XA 1S76D 3PY8A 1U09A 5A2QY 4M8LA 2HFVA 2GVDA 4E8UA 3RG6A 3WDOA 2DD8S 3K17A 3PO4A 3OQ2A 4OHXA 5K8NA 4LSLA 4DFMA 1S0VA 1RGVA 3EPIA 4KC5A 3OXLA 5HO4A 1VQMS 4WFNQ 1MWZA 4RW4A 3MMCB 3QRQA 4WTOB 3M6VA 2ZD1B 2F8MA 4DS4A 4LF1A 1Y3JA 2DRBA 2RIJA 3NAHA 1OPZA 2VOOA 3CCUS 3KLIB 2YWKA 1RT1B 4DV7J 5HANA 2OPPA 1U26A 3NGSA 2A2CA 4PYAA 1JJ2R 1X9MA 3UN5A 4PWDB 2FVQA 2DCUB 4DCPB 1U1KA 4J9MA 1Y7PA 2JRSA 3PACA 1HBNB 2ZH9A 4DV6J 1T03A 3CJ0A 3DOKB 2XEXA 2K8GA 2GQCA 2DIVA 1JXVA 4OMFG 4TYBA 5JVGQ 2UUAF 2YKOA 1VBYA 2H5JB 5IT4A 4LJMA 4B3MJ 4DR7J 3KK2B 3A1YG 4CLPA 2UUWA 2DO0A 3HHEA 4K4TA 4NLRA 3D28A 3CE8A 2CG8A 5D0HA 4GKKF 2XI2A 3BSCA 1OJ4A 1GTEA 2VBWA 5DM6Q 3FZBA 2V8PA 4OV1A 1R6VA 3MAHA 1NJZA 4DV2F 5I3QA 2E1AA 2XY6A 3SDEA 5KT7A 1RT7A 1X8DA 1NMEB 4W90B 4DUYF 4HTJA 5I42B 1NK7A 4K2XA 2CQCA 3R7SB 2K7KA 1VJQA 3LQVA 3DRYA 1FJGF 1FA0A 1IQTA 1HNZF 2J7UA 1R7IA 1LWCA 3L9ZA 2Y8WA 2HBZB 2W4PA 1RT4A 1EQ0A 4MK9A 2IAJB 2D1CA 1FJCA 4DLGA 5C5JA 3R97A 1VBZA 1I3OB 3MM5B 1L3TA 3VHQA 3EZOA 4X4OA 2BRLA 3JSMA 2DNNA 3EUNA 4AT1B 3KLFA 2ABYA 1UMJA 3LGNA 4N76A 2KB2A 3TANA 3G96A 2CJKA 1YJ9S 2IM0A 4Y2IA 2EEYA 3AQPA 4CCHA 3T3FA 2UU9J 3DI6A 2QA4S 1RWVB 4Q7AA 4PXDA 1FDNA 3PYDA 2W25A 3DMJB 1IJEB 5J1EB 1S7IA 1UEKA 2MQMA 3K57A 2WVFA 2AQ4A 3ONQA 1L3KA 1V3RA 1C0UB 1SPBP 1UEVA 3ULHA 2Y8YA 5HLFB 3AH6A 5IV4A 3ZZTA 3BKTA 4ES2A 1R0AB 4X4VA 2EFNA 1J27A 3GIKA 1HNIA 5D4NA 1EQMA 3FQLA 2CPZA 2AP6A 3L7OA 1ZTWA 2I0XA 2CQ4A 3HSZA 3UN3A 1KVKA 4N56A 1BUXA 1KEKA 2RUGA 4AL5A 2QSFA 4RPFA 2XO7A 4DN9A 4R0EA 1RT5A 2HGLA 1Y4ZB 1K47A 4X65F 1OYDA 3AHPA 4PYDA 4C3LA 4Y3CA 5DG8A 3KLHB 4U7UK 4GC6A 4DV3J 2EXUA 3TW0A 3UPFA 2J9EA 3SSSA 2D9PA 3K2YA 3TX8A 4F4YA 1NZ8A 3HSJA 2CQHA 2YPZA 3I9ZA 1WOPA 2D3UA 5HL7Q 2RS2A 1JNZB 3GSIA 2NR0A 2CNLB 4X4RA 3ZTSA 4JV5J 5L39A 4QBUA 3FDSA 1HPZA 3KLVA 2EG2A 2HBYB 3GSDA 1ZETA 5HMZA 2YY3A 3BN4A 5L1LA 3K8VA 4M5MA 2DXDA 1CLFA 4ZVSB 1U2RA 4M5IA 3RAXA 4Y34A 4DF8A 3DDIA 1RT3A 2W9BB 1NKEA 1JLGB 4DV7F 3DRRB 1S7HA 2MYFA 3OPKA 4ENOA 3N0VA 2W1BA 4UOGA 4DPYA 2IYGA 1WORA 3VVUA 3IGVA 4DV6F 1NHVA 1X31C 2QC3A 3C66A 1CS4A 2FB0A 2YKMA 3RAQA 1S0NA 2MGZB 3Q8SB 4K4ZA 3HFVA 1FXLA 4CYUB 4AXJA 3E3XA 3ISND 4DR7F 2R42A 5ETPA 1DQ8A 2NZCA 3TZXA 1SJ3P 5C24B 2VIHA 4J9PA 4QYZK 2FDNA 2HS0A 4Z37A 3QPIA 5J2PB 2BM0A 3SMZA 5KFPA 2XSFA 2GV1A 5LMNJ 3FQKA 1X4FA 2F4VJ 1N6QA 3PX6A 3UR3C 3A13A 1LW2A 4N8NA 5CAAA 3ZTRA 2UV8A 2DR8A 3CJTA 4RW8B 2JFKA 3KJVB 1E6VA 4DFKA 1GAOA 5IT0A 4UQGA 3DGVA 3NRBA 4MH8A 4I7FB 2E5JA 2WONB 1N54B 3KUEA 3JSBA 3CJ2A 4I6WA 1U6FA 2IRXA 1FI4A 2FVRA 3I0SA 4ECTA 1ELOA 4WYLA 3AB2B 4I2PB 4IFYB 2ZC4A 1GMVA 2Z30B 2EC0A 4BC7A 2VB6A 2HHWA 2OTLS 3D54A 5L1KA 2UU9F 1U6BA 2MZQA 2W01A 3CO0P 4KHRA 2KFYA 1O51A 4Y00A 5JVHQ 4FF2A 4FYDA 3CC4S 2WW4A 4FVMA 4ZKAA 3IWNC 2H65B 2ZHOA 1DZ5A 5D6GA 4LMZA 3PYEA 1S49A 2MSSA 3ISZA 1JLCA 3DYAA 5LMUF 3KHHA 1ITPA 5LXRA 1SC4B 3V4IB 4UY8T 3SI8A 1TFYA 3BZQA 1IR1A 1TVRA 3RU0A 1X5OA 2MZ1A 4RNMA 4RNHA 3M32B 1G2EA 3NG8A 2ZM6J 1S5ZA 1RCXB 1OPIA 1F0XA 2YKNA 1EZZB 3J81Y 3NXZA 3W7BA 1FF2A 2VH7A 1D9DA 5I3UA 2AYBA 1NEEA 3KUHA 3HP6A 4DV3F 4KIAA 3LW5C 3IRXA 3RAMA 2OPQA 1DBDA 4P73A 3W65A 3LP2B 3IBCB 2HHSA 3M9MB 4KO0B 1B99A 2XM3A 2V2KA 4YP3A 2R4FA 5IQQA 3CDUA 1IUJA 4JV5F 1S9EB 5LSOA 2DPIA 2C2MB 3SQGA 3UD5A 4B9LA 1TL7A 5ETSA 1QSLA 1RABB 2C3YA 4OI4A 2XS5A 1N4LA 3TJAA 4JV2A 3MMAA 2CJ9A 3GIIA 5B0DA 4O44B 2E9ZA 2X1GA 2WSCC 5L1JA 2C2OB 1C1CB 3B6BA 4ED4A 1U1NA 3Q8QB 5F3ZA 2MHNA 4J9KA 2CPXA 2DKOB 2J0SD 4KH1B 4K50A 4K4XA 4ZVUB 2LQ9A 1TL5A 4HVZA 3E01A 2FJDB 2HFZA 2F4FA 2EVZA 2EFGA 5IWAJ 4DG1B 2JH3A 4PQAA 4DQSA 1TTHB 3EICA 2HHVA 4WK3A 1UCNA 2KH9A 3AXMA 1OY9A 1UFKA 4V19X 5F0WA 3CPWR 1FTRA 5DZ6A 1S6UA 1MROB 2MZSA 4X66J 1X4BA 4NCBA 1LWEA 3C14A 3EMTA 2DNLA 2IM2A 3KNGA 4PEOA 2NXJA 1FESA 5A0YA 1X5SA 1B3TA 2PFDA 4ZPCA 2EC2A 1RHQB 1ZS6A 2UUTA 1HYSA 2BJ9A 1JJ4A 3OD2A 1CJKB 1DARA 3K8WA 2B0GA 1VBKA 3TNVA 4I6AA 4J90A 2MKJA 2O5DA 3CC7S 4CTAB 2NPFA 2Z2ZA 2AX1A 4DL4A 1T9XA 4YQWA 2HGNA 4Y2AA 1JB0C 1YJRA 1L3UA 4DV5J 4K8RA 2LDIA 5B7WA 2UVWA 4AQYF 5CYMB 3CULA 3BQ2A 5B08A 3PKYA 2W2PP 1HFEL 3TZYA 5KG7A 2FHOB 2BQUA 3K5LA 4ZPAA 4DQRA 3PJXA 1I94J 1UL3A 1OYEA 1Q8BA 2KKHA 1CPZA 4W98A 3PX0A 2CQ2A 2GAHC 3BGLA 4NLVA 3LUYA 1DQ9A 2APOA 2BW2A 1RAAB 1XJWB 1NAQA 1RT6A 2C1EB 4X4UA 1NPPA 4WZQA 3W8GA 3G4SS 1RWMB 4FF3A 2CWXA 2GO9A 3LGHA 1KBRA 2E66A 3T1HF 3MAQA 1TV6A 2YBVA 5LT5A 2BA9A 3RZAA 3QNWB 4DX8H 3CGIA 2M8DB 2N3OA 3FC9A 1RAGB 2GMHA 4AL7A 1SQGA 4PWWA 3ILJA 3D6TB 2R7QA 3J7ZT 2HZVA 3MM6A 4NMLA 2CZ4A 1YG0A 4YS2A 5BYSA 1RAIB 2ZBQA 2LA6A 2XHWA 1WEZA 4DR2J 4DS5A 4WFAQ 2DYAA 4JI0F 3IS9B 1B7FA 4A8WA 4MKAA 2MZJA 1S97A 2QLWA 4MK7A 3LGMA 2V2VA 2XGPA 2YX7A 1GH8A 4LRAA 3MECA 2NUUG 2VQEJ 4NASA 1VLOA 1KONA 3MEGB 1IXKA 3KJQB 2XLIA 3AD9C 1BQXA 1F6TA 5MAOA 5D0RA 2R2RA 2R9LA 2LXFA 2EFQA 4N77A 1OMSA 1EKSA 2VQFJ 2K1RB 1S9FA 4P2XA 1N36J 5LJ5Y 2ALZA 2MY7A 3PVXA 1JLBB 2DH8A 1NZAA 2HQIA 4QOTA 5KT5A 2CQ1A 2AV5A 3PW7A 2E1PA 1VQ6S 1PC4A 1FNXH 2KT3A 5IWAF 3PX4A 2U1AA 1PBAA 4ZITA 1D9FA 2XZTB 1NDPA 2HWIA 2GNKA 2BBEA 1TL4A 2KN4A 3O44A 2VODA 2JLEA 3GJQB 2V2QA 2V4QA 3W2WA 2QA2A 3TZZA 1XMOJ 1Q79A 3PR5B 4C48A 2MJNA 3KLGB 3Q23A 4ILLA 4Z7YA 4IG0A 4J9SA 2OHDA 5KG2A 2OMLA 3H5XA 5ETRA 2V69A 1DTQB 1FK9B 5D4PA 3KYLA 1ZZNA 1HL6A 4R5PA 1OO0B 3BKFA 3Q0AA 3HVAA 1XNRJ 4FVCA 2YVSA 2DHXA 1T02A 2PMHA 3TR5A 2EKNA 1C0TA 1YJWS 1X5PA 4FYWB 1F5BA 3A12A 4JI8J 1BWVA 4R25A 3PW2A 1FX2A 3US5A 2BJEA 4QR2A 4OZJA 3G8TA 3IAS9 4ILRA 1S1UA 4ZCIA 3NGDA 3TJ8A 3HPOA 4OLPA 2V0NA 4DI6A 3UDCA 3N9UC 3CSKA 2WAQD 1WC5A 2ATCB 3MZIA 2R2UA 2ZH6A 2UXBJ 3D7SB 5B09A 4HACB 1TL1A 3KK2A 5BYRA 3KMSA 4E98A 4WFXA 2GW8A 3G82A 3JS9A 4PG5A 1RAJA 5A8RB 1QTMA 3JQMA 1G3OA 4IG3A 2J9CA 2BR0A 2RMLA 3NCQA 1N32J 2QMXA 5L1IA 3AQOA 2O67A 4H4OA 1NSQA 1FTCA 3QJPA 4NLXA 3BQ0A 1DJ0A 4QU6A 4CH0S 3MEEB 2GQ2A 4NEZA 4P71A 3IRWP 2E29A 2IM1A 4HEA9 1LV5A 5HATA 2M7SA 3QJJA 1H2UX 2JEFA 1S4EA 3HHLB 4L72B 4B9NA 2MXYA 1F5AA 1TKTA 3OR1A 2A6OA 4HKQA 1JKHA 4IH5A 4JI2J 1H98A 4OYOA 4DL5A 3G71S 1IBMJ 3W3SA 4ELVA 1JLAA 2GHPA 2L48A 3FGVA 3MM5A 2HHHJ 3MR6A 2AJ1A 1VQPS 2J0WA 1O5JA 2B4OA 3H5SA 2ZVSA 4RZRA 3HO1A 1SV5B 4DR2F 3DXSX 2Y0BB 2YWHA 4U7UD 4F0KA 2IVMA 2BX6A 1XMBA 2GS8A 2EI5A 2XC9A 3MTKA 5HQMA 1R43A 4LREA 3W5YA 3CDWA 1WKLA 2WRMA 1R8AA 3LWMA 4DV4F 2WVDA 2VQEF 2RH3A 5K8OA 1DRZA 4O0NA 4ZLPA 3GMGA 3ZZOA 3HZGA 1HWJA 2FHJA 2HW3A 5CYQB 2ZKTA 3I4PA 2GMJA 4X4PA 1MN9A 3BO4A 1IBKJ 2PIIA 2DGSA 1M1GA 3MM7A 4TN2A 5HLFA 3V6DB 1S1VA 1WKKA 5AXNA 4NL5A 3MPYA 4JYAJ 2QV6A 5DO2A 2OH2A 3VAKA 4IOBA 1PJ7A 3K7RA 2E5GA 2B43A 3UVJB 2MQQA 1LEOA 4U67Q 2VASA 3VGVA 5G0RB 1DFDA 2YNIA 2BANB 4J9VA 2KZZA 2ZKUA 4DL2A 3DU6A 2BXJA 1REVB 3ZNJ1 4ZP8A 3LWLA 1YQHA 2FHKA 4C7QA 1Q82T 4YHHF 5HN0A 5CHCB 5ETOA 5GAGU 3TYTA 4LF4F 5AXLA 1VHFA 2YWFA 1OS5A 4J91A 3Q8UA 1NK0A 4L6V3 2R8IA 2CPHA 4RW6B 5KFHA 1J2VA 2R7WA 2CPJA 3U1NA 2ZJRQ 4ZVEA 1XMOF 5LM7E 4F50A 2AGPA 2UUCF 2J0XA 3KJFB 2LA4A 1FNMA 1V3ZA 1KS2A 1HR0J 2CVIA 5GMDA 1RI7A 1M90T 1RK8A 2V4JA 3GE9A 1M1HA 2XYGB 4DFJA 3AODA 4OYPA 1FHTA 4CH1A 1XNRF 1UVLA 1BY9A 4YB6A 2R8KA 4X4NA 5D78A 2VBZA 1N52B 1KFSA 1Q8IA 4PABA 3M8QB 4KGZB 1KQGB 2YTCA 3JQJA 4OI2A 2KO1A 4P7VA 4CO0A 1Q8KA 3CJKB 4B3OB 1HNVA 1T3NA 1S57A 4C3MA 1HHSA 2CPYA 2OEMA 1QSYA 1TAUA 1B7YB 4EZ6A 2KZMA 1PKUA 3GG0A 3KK3A 2C28A 5KFJA 5HP1A 1UWBB 2XI3A 5GADI 3CJSA 2MGZA 1HI8A 4F67A 4HT5A 4USJC 1Q7LB 1DTTA 4URQU 2DGUA 5KT3A 1T7PA 3K89A 2IVFB 3JYTA 1UEUA 4C8KA 3L3CA 1SIWB 4PUOB 1S6OA 2MKSA 1N32F 3PO5A 3M8PB 2GX8A 2HS3A 2CPDA 5BR8J 2OEJA 3OR2B 3HVRA 4J9LA 1Y11A 1P1LA 1JX4A 3P6YC 3R2CJ 1OWXA 3GZ7A 3MCMA 4WK1A 1MSWD 1IKYB 1IR0A 2KXHA 2UUBJ 3U7JA 2BDPA 1BE4A 2CJYB 3H4BA 1P9YA 2XMJA 4NEYA 2RRNA 3MCNA 2X3DA 1KHWA 3QZ7A 2HIYA 2QYGA 2FJWA 2DJWA 3H20A 2YX1A 1T9TA 4CZCA 2P2CB 1RA6A 5J1PA 1TP7A 4L73A 2PDAA 2ALYB 5A8WB 5M2UA 1DURA 2HHHF 2J6TA 2NXNA 3T9NA 4B3RJ 3W63A 3C15B 2BMBA 1VRTB 3W66A 1R6YA 1WUUA 5KFKA 4X62J 4WXWA 2GVDB 3M2UA 2OO4A 4NXMJ 2F9JA 4JP8A 3A8IA 5ETTA 2E9TA 5HBMA 2DRDA 2OAUA 4LSLB 1QAYA 2A1BA 1RT2A 2V8VA 4A8KA 4FP9A 2AEFA 4RW4B 4RUHA 4C8OA 1PIEA 1SBRA 5K8MA 4Q0BA 1XMQJ 1IBKF 2VG5A 1UWAA 3MOJB 1OQ3A 4YY3J 1R8CA 1H38A 3T5KA 2Z8QA 3OVSA 1OQ6A 3E51A 4PG7A 4G1QB 2CA9A 3OT9A 2RS8A 5C7PA 3P5TL 2OD6A 4C4WA 1NK6A 1WF1A 4USIA 1ZH5A 2IPOB 3QT8A 1CULA 3ILIA 4OLOA 1KLMB 1B0VA 3RBXA 4NXNJ 2X1BA 1H3DA 3HVWA 3KG0A 1RACB 1KP6A 3QLHA 3KJNB 1VQ5S 1SC1B 5D3GA 4K4UA 4FN5A 1UKUA 2PN6A 3I5CA 2C3PA 5CQGA 1VRUA 1WSVA 2GQQA 2YWEA 4CO1A 4IO9Q 2F8EX 4O3QA 3NY0A 3OLBA 3AA8A 3M8RA 3GG1A 3ETOA 4WZMA 2DNQA 3N6LA 3CWJA 4OX9J 1NK8A 1Y9OA 2LP4A 3VTIA 4LRFA 4PG8A 1WWHA 1S6PA 1BD6A 3SDEB 3HHLC 1RT7B 1LK7A 3QATA 3OTCA 4LSNA 1BHNA 1HNWJ 4B3TJ 3KLEA 2DGXA 4M5JA 3J80Y 5AJ3J 4CLZA 1LWCB 2D3OR 1K1SA 1RT4B 3IA0A 1QE1B 3NGTA 2QLXA 2VBYA 2ZOMA 4EO8A 2HVZA 5IS2A 3R8YA 4J5OA 2JC0A 3JSMB 1EETA 2GFFA 3KLFB 1Q78A 1OIAA 5DDQC 2FY1A 4LF5J 1YRTA 4Q8FA 4A8OA 2R7SA 1MROA 4DU8A 2OIHA 3MMBA 4P74A 4Y2KA 5E41A 3SSRA 2G4BA 5GAEI 4EZ9A 3DI6B 1Q53A 1I6JA 3BN7A 3HHDA 4FYYB 4M5DA 4Z2XA 4QYZJ 3TUPA 2KYZA 1QY7A 2CNOB 3GB0A 3D1QA 2JLFA 2ZWOA 3VAMA 3AT1B 4F0HA 1H2TZ 1GQEA 3GV8B 2UUBF 2DHHA 4V19J 2A6MA 3RB3A 4ZVGA 1RTJA 5GAGI 1GK8A 5F8JA 1HNIB 3FEZA 2XCPA 1NM2A 4EU0A 4FF4A 3CD0A 2ROGA 2P6TA 4W4MA 4IRCA 3GV7B 1ACMB 3H5UA 2C2ZB 4F4ZA 2VJUA 4WKYA 5HJYA 2KU7A 5FD1A 2EWHA 3HJFA 1RT5B 3GQCA 1FRLA 5F3TA 2XMKA 3I5AA 2W9AA 2KTQA 1WF2A 3DRSA 3IMQJ 2FIUA 5B0FA 1TFWA 2KFNA 1FKAF 1UJ6A 3M6WA 3W2VA 4NXMF 3HCXA 1BC6A 3BGOP 4ZK7M 5KFFA 1CJVA 2B6AA 3G8QA 2VZ9A 1Q16B 2F1FA 2E5LJ 1HPZB 3T1YF 1CJTB 1TMJA 1FVSA 5KFXA 3OVBA 4A8MP 1KSPA 4PXEA 2XY5A 2QGFB 1XMQF 5KFTA 1YIJS 3CJRA 2WSEC 1UJ4A 2QZ8A 4YY3F 2NPIA 1TZ0A 3PEHA 5IQ6A 4QIVA 1D9AA 1RU2A 1M5VC 1RT3B 4TU7A 2EFPA 2IMWP 1T0TV 2QJ3A 2AZ3A 5U47A 4J9UE 1VIXA 5C42B 1T05A 2QG9B 1K0TA 3HKZD 1CS4B 4DUZJ 4JI7F 1JXLA 1KQSR 2YKMB 1EJ7L 1XIQA 2D7SA 1ICEB 2I9SA 3OHBA 2I38A 4JI4J 4DSEA 3IS9A 5EDWA 2MEWA 2R8GA 2NREA 2OSRA 4J7CA 2RVJA 2P8IA 3D0HE 2DGTA 5LXYA 5D77A 4C8NA 2NZ4A 3D3CJ 3TEHB 2Y9HA 4JOUA 3DM2A 3QT7A 4KT0C 2VPZB 3CW2C 3PW0A 2AHOB 5F8GA 1S79A 2R7OA 1YI2S 4OX9F 3R27A 2D3ZA 2E9RX 3UO0A 3KHGA 1UP1A 1N6QB 1LW2B 1RHUB 1REGX 3CVKA 2DXFA 3NL0A 2UZAA 3ETMA 2BUNA 1P27B 3G6XA 2LEBA 1Z1ZA 1E6VB 1HNWF 1FFWB 3LAKA 3VAJA 2PI5A 1WC4A 1TL3A 2ZUGA 3OFHA 3CCWA 2RQCA 2DR7A 1N5YB 1F1BB 1FXDA 3HFZB 3THVA 1TUVA 4ECVA 3I0SB 2HVDA 2Z2YB 1RP5A 1H7XA 4G1IA 4U6PA 4LF5F 4EBEA 1EARA 5IOLA 2JDJA 3J81j 9RUBA 4L76A 4WF9Q 5ETLA 1SKWA 2MTLA 4LT6A 2UV8G 5B0BA 2X7IA 3JXOA 1RB0A 2OI2A 4JV1A 3KDNA 3P5BP 1HW8A 1FK9A 2FZGB 3RBDA 2F3JA 2HKEA 5KT2A 2JEGA 4NA1A 1QAJA 2J0QD 1B4SA 1C2PA 2GCFA 1TQLA 2IJFA 2YKAA 2LECA 4QWDA 3TVYA 1FKOB 4AD6A 2HK3A 4D3GA 2MZRA 1JLCB 4FDFA 3DYAB 3R2DJ 2CPEA 2DY1A 4WFZA 2WVEA 3IR6B 1XTZA 4OZ5A 2F65A 1TVRB 4BWMA 1U1RA 4IOCQ 2H5EA 3M8SA 2WCXA 3C19A 2CZ9A 4JI3J 4TKTA 3A8JA 3PYGA 1SJ4P 2FZCB 4ZPTR 3HM9A 2CDRB 4LRDA 2YKNB 3ELHA 1RTDA 1T9UA 5I3UB 1FRIA 3GTYX 4EEYA 1AA1B 3DOMA 1JJCB 2MPUA 2XB2D 2EPIA 3P96A 1M0SA 1GXLA 3QIPB 1SUQB 3IRXB 1UW9A 2OPQB 3KHRA 3C46A 3FKBA 2NXCA 4LRCA 3RW7A 3W64A 2W2NP 5JJBA 4CLSA 1X4HA 2E5LF 2LCWA 2MQ8A 2XNRA 1IKWA 3ZZUA 4DHVA 5AE2A 1FEEA 1TL7B 3QFWA 2HEKA 3FZ2A 3HHLA 4KPCA 2J6UA 2XO6A 4N7TA 2W2QP 1H73A 4DCOB 2ZWPA 2IFXA 2M52A 3D0IE 3VF0B 3RGIA 1R27B 2ZBRA 4H54A 3QRRA 1F60B 1HHTP 1WDDA 2XYPB 3JSRA 2AX0A 1FXRA 3H0PA 3AJ2A 3E01B 1SQEA 4O3OA 5HVGA 2HWHA 4DUZF 1RISA 4KAIA 2AT1B 4F25A 1VC6A 1HWLA 3H4DA 3CB4A 2MZTA 2MKHA 4OI6A 2A2DA 2DVIA 1QM9A 4JI4F 3ENVA 2JVOA 3R5CA 2NYHA 2RQMA 3AB4B 3SCIE 1L3SA 3T41A 4BHQA 3C14B 4IQMA 2KRBA 1MU2B 1S48A 1XERA 2QN6B 3H7HB 2GMLA 2PC6A 4RX6A 5KFIA 5A0YB 3PHTA 2PEHA 1Q7YT 5A6PA 1X4CA 4CLUA 1NU4A 2RDDA 4ZLJA 1HYSB 3NOGA 1MWQA 5J2QA 2VFSA 3D5MA 4K5RA 3L09A 5ETQA 4YR3A 2FUG9 4HH0A 1SKSA 4RR5A 1RJJA 4ZVOB 2CADA 2XCAA 4KHPF 5IT9Y 1V6HA 2HQ3A 4MIBA 2CQ0A 4DF4A 4AE5A 4QYRA 3O2IA 5K8PA 2XGQA 1K1QA 3RTVA 5T41A 4DSJA 4DMZA 3HDSA 2DNZA 1D0EA 2ILYA 2DHAA 3U27A 4UZBA 2YPYA 3OL8A 2GC8A 3BREA 4IYQA 1RLDA 3CCLS 4O23A 3GFXA 2D74B 2QMWA 1KTQA 3RB6A 3IO1A 4CO2A 5K20B 2D41A 3J81U 3NNAA 2AJFE 3PJWA 4QR1A 3T5HA 1BWEA 1IKVA 1FRKA 2HFSA 2Q43A 2EBEA 4I68A 2AEJA 2FLOA 2E7XA 3B54A 1Q4RA 3SV4A 2CQGA 1RT6B 2YKPA 1HHQA 1MNEA 4K4WA 1KWMA 3UWTA 1UETA 4C6AA 2FLNA 2FJXA 3EDRB 2ASDA 1U0HA 4U9RA 2KG0A 3N6MA 2PSZA 1CQMA 2LFVA 3HZEA 2VFRA 3DLGA 3FCHA 1TV6B 3N4WA 1W2BR 4ZA1A 3UE2A 5BXIA 1G7CB 5D0EA 2ZITA 1HNZJ 2OELA 3F0NA 1NRKA 1FNOA 1KLNA 1U1PA 2C2NA 2ZH1A 1B0TA 2QLFB 4ZVQB 5DDPC 2I8EA 4ZCMA 3EYZA 5KFUA 2HK2A 3BBCA 1JQGA 2IA6A 3MM6B 3RR8A 1LWFA 3DNCA 4KQZA 3TAMB 4WU2A 3VVTA 2MSTA 2HAIA 4NLYA 2XQCA 3Q2TC 3J7YU 1P8GA 4LIRA 3R1HA 4OYXA 1UFLA 3I9V9 2DNGA 2NXUA 3H2VE 3RBZA 2G0CA 2UXCF 2R7RA 5DM7Q 1RKJA 4I0WA 1HBUA 3GR0A 2RJZA 3MR5A 4LQ3A 4ZLLA 2R2TA 3MECB 7FD1A 2DGQA 1NSPA 4KJIA 1BXNA 1YJ7A 4C11A 4WKRA 3IFEA 4P2MA 4ES3A 1HQUA 4ANEA 2UVUA 1SH2A 3S01A 3CJ5A 2DR5A 4RKUC 5DQIA 2B3TB 2DBBA 5DLGA 3JTOA 2ZH5A 1FD2A 1YWXA 4PXCA 2HRUA 3OHAA 5KOWA 5HMXA 2HBRB 4QIFA 5A8WA 2ZOFA 3DRPA 8RUCA 3K58A 2VG6A 2HRTA 4DXLA 3SFUA 2CFXA 2RSQA 1VBXA 2AWZA 4FYVB 4X65J 2G9OA 3VAIA 2PFFB 3PDNA 2DITA 1EKRA 1TKXB 2ACYA 1VR6A 2GVZA 4CNYA 4XDCA 1U2FA 3W2WB 4LF6J 5KG5A 1NH7A 4JB8B 2C3UA 1FEHA 4HI2A 2WB1D 3QAUA 2I1RA 4IG0B 1ZM9A 4MTPA 1J5EJ 2I6WA 4WWSA 2HNYA 2IM3A 4R5PB 1UA1A 3KNAA 3WX8A 3UCGA 1RTIA 3OUYA 4M94A 1KVJA 3OSPA 2G1HA 4JUZA 4G1QA 5CABA 2K3KA 2B7CB 3H5YA 4ED1A 1C0TB 3ZZPA 2DB1A 2LU2A 3C8YA 4QIWD 4HLBA 1EIYB 1YJUA 2ZJPQ 2XS7A 3KXDA 3Q8VA 1KLMA 3MUVP 4HTIA 4Y28C 2ZZNA 2VKZG 2VD3A 1U4BA 4OHWA 2LQJA 2VONA 1S1UB 4DR4F 2HWTA 1T9VA 2RKIA 4K0KF 5HAOA 1HWUA 1PAEX 3BBFA 3MPDA 1D8YA 2N82B 2AIRB 3EGWB 3HI9A 4A8QA 1TL1B 4ECQA 3KK1A 1G6BA 2GHVC 4MIAA 3G82B 1RHMB 2XS2A 1SQFA 3CIMA 1U45A 5HQLA 4IG3B 1A0OB 1UPPA 1X9WA 1PBUA 8ATCB 3OW2R 4GVLA 1TUWA 3BYRA 2HZCA 4H4OB 3RB0A 2ZHBA 6AT1B 1QAXA 1SXLA 3UW1A 4QPTA 4WTYA 3TO8A 1Y3KA 1TKDA 1R8BA 4I6YA 1WKJA 2Z2MA 2BE9B 1LKZA 4ETZA 2LVWA 2RDJA 1MMDA 2O1PA 3F44A 2ZOGA 1TU0B 4LF9J 1TKTB 3AD7C 3OR1B 4TY8A 3B4MA 3DKDA 3HMJG 1RDRA 1JKHB 3M4XA 3DLLQ 2RF2A 3MFHA 5AE3A 3N5BA 3EE3A 1FVQA 2LQ8A 1AFJA 1QE1A 1KTVA 1JLAB 4O4GA 3WC2A 3LAMA 3CCVS 1H72C 2F9DA 2B8PA 2AF6A 2CYYA 1YRUA 3R5BA 2RQKA 1NJWA 4DSKA 1N33F 3NWRA 4QCLA 4RNFA 4KGVB 2DNRA 3NLCA 1FDDA 3MD1A 2FC8A 2OPRA 3IM9A 2NSCA 1QAIA 3POTA 2VC0A 1S12A 3H98A 1ZA2B 1SC3B 1LXJA 3BYPA 4URSA 3FBBA 2QT7A 2VPYB 2LXIA 1ZAWA 3S8SA 4WIIA 1EHWA 5DRKA 4OQJA 1RHKB 4J9OA 3PKMA 4CO5A 3MM7B 5LMUJ 4O3PA 1S1VB 1XC9A 1FFSB 1I5OB 2E5HA 2DIUA 4DN0A 2KRRA 4IDKB 4QWCA 4Y0FA 4B9SA 3UCZP 3MXHP 3VR1A 2YNIB 1KNZA 2LQ5A 3OV7A 2GHWA 4PR6A 1WDTA 3GCXP 4HHUA 4Y2MA 4OZ3A 3EM1A 2XMTA 1DAXA 1U25A 2AJ4A 3I82A 4LF8F 2C2KB 2E1CA 4O3SA 4Y6IA 1M5KC 3BH6B 2X1AA 2AGOA 2OFHX 4TVAB 3NNCA 3BV8A 2O66A 4BLGA 4LF6F 2CQBA 3EGNA 1S1XA 3R5GA 4XPEA 2ZEJA 2NYIA 1FRMA 1N5TA 2XMMA 3DRXA 1KN6A 1IKXA 1CJTA 2DNPA 4DEZA 1J5EF 2V4JB 3D0GE 1LWXA 2C3OA 4LR9A 4NLGA 1AW0A 4J9RA 2Q79A 1VDHA 1V5VA 1VJWA 4DV0J 2V8GA 5KFGA 4NLTA 1N0UA 2V50A 9ATCB 2CXEA 4NLSA 4KB7A 1D8ZA 3ZZZA 4UT4A 1M1KT 3M7VA 2HQGA 4E0DA 2GIRA 4RNOA 3QBCA 2R7TA 1CJUA 3FJ2A 3SV3A 4F36A 2EG1A 3UDEA 4ECYA 2JL9A 3OJSA 3J7YI 4XO0A 3DLEB 3NWGA 1HNVB 2W7AA 5JUMA 5C42A 3W5XA 4GVBA 4HHHA 3QIDA 4X4QA 1B70B 1OSCA 4KPYA 2HFNA 3KK3B 1JLFA 1TKZA 1PYOB 5HP1B 2XHCA 2D69A 1SCJB 4UZCA 3BM7A 3NCPA 1N48A 2YWGA 2IC3A 5LJ3Y 2VG7A 5D4OA 1YITS 1EP4A 1DTTB 1SC6A 3GP9A 3A8EA 3HHNB 3JYTB 1VGYA 2CVEA 2ROEA 1YBUA 4RBUA 2MKYA 3MF5A 3LP0A 5KG3A 5CZVA 4KGKA 3G87A 1LQ9A 2IBKA 4UOFA 2OGUA 2JEJA 1R0CB 3OTBA 1HD0A 4HI1A 2F5GA 4CLTA 2XNQA 4BC9A 3R7BB 4DZDA 1VK8A 2RD5C 1D1UA 4LF9F 4H4KA 4ZPVR 2POKA 2CJQA 5KFWA 5IC4B 4L3NA 7FDRA 4UOHA 1U1LA 4RU2A 4ZIWA 4RW7A 4AQYJ 1N5YA 3CCRS 3ZXWA 3ET6B 5FLXY 3HT0A 3K5NA 4UW2A 1S1TA 1ROFA 4V1Ak 1RLCL 4NCGA 2F40A 1UJ5A 3PXGa 3BR9A 1VQOS 3M2UB 3EVWA 2NUHA 2FJEB 1NKCA 4UOCA 3SQOP 2KYXA 3RYLA 4ANCA 1JLEA 2BJ7A 5HBMB 1N5QA 4I2QA 1OY8A 4ZJQA 2QA1A 1RT2B 1X4EA 2XZWA 2EK6A 3D6MB 4JI6J 4DZ6A 2QSWA 3A8KA 1BMQB 1B64A 3PIPQ 1K8AT 3DLKA 3L7UA 1FKOA 4Q0BB 4TU9A 2Q6CA 3JB9k 1FCAA 2VG5B 3T1HJ 2V4RA 3TP2A 4B3SJ 2R3VA 2FHMA 2DEJA 4MKYA 1YDLA 3CMQA 4ED6A 4TQRA 2RU9A 1NHKL 4CO4A 4X4SA 1R89A 3BQ1A 2HFUA 3GV5B 2GO8A 3ADAC 1CULB 1RKIA 4YEAA 3R5DA 3KTQA 1S77D 4KV8A 3JTNA 3RUBL 1HBMB 1Q0NA 1X4DA 1MWYA 5D4LA 3TA2A 2IVYA 3QLHB 1SL2A 1RSCA 4ERDA 2AGQA 4DLEA 5D3GB 3QIPA 1SUQA 3QSYB 4JI0J 1AT1B 1KC8T 2C22A 3PW5A 3SCKE 2BYCA 1VRUB 1DHMA 4LVOP 2B9EA 2DGOA 4QIEA 4ZPWR 2ZJQQ 1E6YA 2BW7A 4LVNP 4ALZA 2CRLA 1IVZA 1DLOA 4KR0B 3P8BB 3I4HX 4XPCA 4C3KA 3E2EA 3L4BC 4CT9A 2BVZA 4DV0F 1U48A 4NYZA 4ER8A 1S6PB 1XEZA 4TQSA 5E0OA 1S6QA 4LSNB 5T7LA 4O3RA 4DL3A 1YRXA 2PD1A 4OV6A 4NE9C 2HYIB 4OX6A 3KLEB 2DGVA 3MCSA 1W26A 3RRGA 4WP9A 3X1LB 4R0JA 1PJ6A 1U0SA 5IM0B 3CIZA 1EETB 5H9FJ 2DT9A 1FFGB 2XG8A 3FMWA 5HMYA 4IR9A 1F5CA 3MMBB 1IBLJ 1K9MT 4LF7F 4ELUA 1MU2A 1V5IB 1S9GA 2CWKA 5C2GA 4M5DB 2M4MA 2BM1A 2G2OA 1KKHA 4MYUA 2MLYA 5KG0A 3C2PA 2Q3PA 1LOUA 1SI9A 2BKPA 1WSRA 3MM9A 3FUYA 5EWGA 2FHJD 1HLWA 1RBOB 2WHOA 4C97A 4ZPBA 4WBFA 5DQGA 4ANDA 6FDRA 1RTJB 1U6ZA 3BKUA 5KFVA 3Q8YA 2OPSB 2OFGX 4KH0B 1M5SA 2LQBA 3MGJA 1R8HA 2OJ3A 2LLZA 2OMOA 1VQNS 3VAFA 2YX4A 2PI4A 5SUHA 1IN0A 4FYXB 1QTNB 5A8KB 3KUGA 4IFVA 3DRSB 2OD4A 4U95A 1G4CA 1PCAA 4A4JA 1HQ2A 3W2VB 3SEOA 1CJVB 3W1YC 1URNA 3VZIA 3K5OA 2HQCA 4HYKA 2FTRA 2B6AB 5L9XA 4ATNA 2DO4A 5HROA 1TK5A 2COLA 2NSBA 4P10A 3M1VA 4JI6F 4F4WA 1H2VZ 3I96A 4YB5A 1UZHA 4JI5J 4B9VA 2BQ3A 2YH0A 5E2QA 2BQRA 2BKOA 2J6SA 1GX6A 1Y5LB 3ILLA 4B3SF 5FJ4A 2QL5B 2V6AA 2L9NA 4DR1F 4CO3A 2ZE2A 1P9QC 2XWYA 4DQPA 3DLBA 2I5JB 5GMKa 2V67A 3UDLA 3N28A 1Y0HA 4WFBQ 2E44A 1T05B 4RU9A 1Q1KA 3DDKA 1NDLA 4DR3J 1CBKA 2HNDA 4M63A 1MMNA 1GEHA 3TAMA 3HHKA 2CJBA 3J80U 4OZ0A 3GFZA 4QU7A 4MMOA 2Z0GA 2JSXA 3VGUA 1WTFA 2FQQB 5GADU 2XLKA 2XY7A 2G2ZA 2CQPA 1VHIA 1Z2LA 1S0OA 2SXLA 3CCZA 1T9YA 4DV4J 1D3WA 2MQNA 4FNIA 4DR6J 2EW9A 3NGRA 3UR0A 2G1DA 5H9EJ 2RAQA 3DM2B 1EX8A 2L41A 4NZ6A 3NBPA 1FKPA 2WBMA 3NS5A 3PEJA 1PC5A 2CDQA 1ZM3A 1N0VC 4GKJF 4F04B 3UNYA 1WD6A 3TUIC 3F73A 5M2PA 5K9FA 1GXTA 4QWBA 4YFUA 3DGPB 4UF4A 1F3VA 1M5HA 4GO5X 1TL3B 4YHHJ 1Y5IB 5F8LA 2ADBA 3CCQS 4LF4J 2IIHA 4ELTA 1W7WA 4TLQA 1N34J 2J7WA 3HX9A 2LU1A 4KYZA 4AXIA 3UNGC 1SL0A 2KM8B 1TKXA 2DHGA 4I56A 3M8ZA 4KBIA 2AD9A 3RR7A 4K2JA 2XYHB 1C1BA 1VQKS 2CUYA 1IWGA 1NJXA 2P6SA 3MUMP 2IY5B 1VK3A 2BRKA 1JXEA 1CQNA 4IUFA 2U2FA 2KHCA 2UUCJ 4B9MA 1IBLF 2J5AA 3SIPB 1VS3A 4LUBA 4LSZB 4O0IA 2N4CA 1RYSA 3RRKA 2IJRA 4ECSA 4OYZA 3VWSA 1ZM2A 1RU1A 2HPUA 2MLZA 4QIGA 3NP5A 3AD8C 1H0HB 8AT1B 3PIOQ 2LMIA 2IDLA 2JFDA 5DETA 1YVFA 3Q8PB 1WHYA 1KD1T 3UN2A 1GMWA 5F41A 1EB0A 3W62A 4ZVTB 2H4WB 4A8YA 3PR4A 2HG4A 1FWKA 3QT6A 2MQLA 4DWIA 3I0RA 4NA2A 2BEFA 3SCLE 4ECRA 2FVCA 4AYBD 1LNQA 3MPVA 3CD6S 1RTDB 5T14A 5K14A 3DOMB 4WYWA 4OHVA 1WHXA 4K4YA 4OYBA 2N7YA 1NLKL 4P9SA 4ZJOA 2DISA 2ZDPA 4CNZA 3TZWA 5ETVA 2RT3A 4C0OC 3OTOF 4OI3A 4CH7A 1NB7A 3FBCA 3HSDA 1W25A 5KFQA 3FBEA 1IKWB 2M70A 3DFEA 1NBEB 1ZAVA 3BSOA 3Q22A 4ED2A 5DZ7A 4JI5F 1ZAXA 4UUWA 2YWWA 4A46A 2P9EA 1UTAA 2RHQB 3P45B 5BJRA 2FJVA 4H4MA 1DY3A 4NX9A 2MKKA 2WVCA 5JMNA 2YQ3A 2L9DA 4FXDA 1N5VA 4OZ1A 5HK4A 4RWWA 4YR2A 4WU3A 1AYEA 3RB4A 3GJSB 4F4KA 4ID8A 4DR3F 1NXIA 2CPIA 4MKBA 3JSYA 1RWKB 3C6UA 1RWUA 1MW7A 2WZ1A 1NO8A 4K59A 2A3JA 4OJ1A 1MLAA 1RUSA 5GVQA 1FJ7A 1RZMA 1W2IA 4RUCA 3HK2A 4PPDA 1UPMB 4DR6F 3J7A1 2KHDA 1RTHA 1X0FA 1WHWA 1ZBTA 2PO4A 5HVHA 4UY85 2QTWA 3CJ8A 3M9NB 5GAEU 2HHTA 2B4UA 4U7CA 2RE1A 4WIQA 3FCVA 2M8HA 2C2RA 2WK4A 4MJKA 5J2QB 3ILOA 2FJAB 4HHJA 2WOMA 4F3OA 5ETMA 4WJBA 3SCJE 1HA1A 4IDKA 4LFBJ 3R5AA 1U47A 3TUZC 4RUBA 3THPA 5EX3A 3SSQA 4ECUA 2CZVC 1YBTA 4HR2A 2BZ2A 5E33A 1YGYA 4URGA 1N34F 4Y2CA 1KOOA 4U8YA 4K4VA 1QSSA 2ROPA 3OJUA 3CCES 4R8UA 1RXOB 1U7LA 2QL7B 3WZ0A 2HQFA 4EYHB 2AJ2A 3QT5A 1BQMA 4USVA 3ZO7A 1YHQS 1J5OA 3D4JA 3C6TA 5J2MA 4X84A 4ZP6A 2ZBPA 2HLTA 4ES1A 3LP1A 5DJBA 1IKVB 1S59A 4CIOA 1XQIA 1IQZA 1NDCA 1SKRA 4KGMA 4LRBA 4KTQA 3BO3A 2W8LA 3QO9A 2AZ1A 2M2BA 2Y0SD 3FCWA 2JOQA 2BACA 4PRFA 1U0HB 2HNZA 4M95A 4HDGA 3U1LA 1KOHA 5FDLA 3LOUA 5F8IA 2ZNYA 3I31A 4FF1A 2H54B 3DLGB 3JTPA 3PRDA 2PE8A 3FEXB 3GLJA 1U49A 3MDFA 4ZDNA 3DLEA 3IBFB 2YKQA 2GGPA 2VU5A 4WPAA 2BOPA 4A8SA 2QEXS 2JX2A 2CJXB 4NI2A 4B3MF 3ISNC 2J76E 3AJDA 2PEBA 1AFIA 1KHVA 2M5YA 3M9OB 4OHYA 3H2LA 1LWFB 2ILZA 1Z2ZA 5EHHA 1S99A 2CPFA 1NK9A 3D67A 1OY6A 3G9CA 3JAMU 3MM8B 2GJ2A 2LKZA 2AYEA 4WFYA 2G0IA 4USMA 2C42A 2UXDJ 3CMAS 5KTQA 1ZTTA 1HBUB 3V4MA 3DN9A 4HT7A 1XR7A 2KT5A 1SIZA 3R1LA 4C11B 3FSIA 3TAQA 3V81A 5KFZA 4OJGA 4CLLA 1HQUB 3HD1A 3SZ2A 4OIXA 3N79A 5MLCV 4FPRA 2IRYA 4YB1P 3MR3A 2Q6BA 3ENWA 3BGRB 1H7WA 4YUDA 3PCOB 5EWEA 2PGCA 5KFYA 3DRPB 1JWWA 3IR5B 4ED7A 3DDNA 3ET6A 2VG6B 4NMXA 3BF4A 1H6KX 4OYAA 3NOCA 5CA5A 1ZA1B 4G65A 5IT9U 2XMWA 3M2RB 5RUBA 2BE2A 4BS2A 1WG4A 4DSLA 2MKIA 5K5MA 2KM8C 2KXNB 2H9ZA 1RAHB 2YXLA 2GVZB 3ZTOA 1VLYA 3GPAA 4K5SA 2DR6A 3H42A 4ZPDA 1RYRA 3TA0A 3UDVA 4IR1A 3NCRA 3VV2B 4PXBA 4ZP7A 2ASLA 1D09B 1S10A 2V8DA 3GONA 4DPWA 5DGAA 2ZC3A 3T1YJ 3I87A 2JHEA 3ENQA 2HNYB 1GXUA 2HHXA 2CQ3A 2LXUA 4QW8A 1LW0A 3QSIA 3KMQA 3DLJA 4NA3A 1Q95G 4MYTA 4B17A 1RTIB 1GT8A 3OUYB 1WACA 3JQKA 4NRUA 1PO6A 1O6XA 3J7Z5 4LFBF 1NSAA 4ID5B 4Q2MA 3FRYA 3GJRB 1APSA 4PG6A 4DPUA 4JI1J 1VCTA 5E3PA 5F8MA 2KVQE 1HBMA 4D3HA 5C25A 5AXMA 3LTOA 4JI7J 2JVRA 2ZUAA 1T3OA 2RKIB 5F0UA 3H25A 3B8HA 2VF3A 2A18A 5F8NA 3G86A 2HVHA 3KK1B 4DCJB 3D1HA 2YNHA 3BPSP 3DU5A 1HMVA 3BSNA 1KQKA 2ASJA 4M5KA 4CLYA 2DRAA 4DSFA 4OZ2A 5SZTA 1VQ7S 3R6GB 2BJ8A 4EUVA 5HJXA 1UFWA 1NUEA 2HAFA 1A7GE 1G1XA 2PA3A 1U8WA 3AA9A 1IR2A 3CTRA 3V2UC 3SYZA 3DOLA 1KRPA 4ECZA 5KG6A 2GIQA 3W9HA 2VFTA 3CC2S 3HHLD 5KAKA 4CLKA 1FX4A 4BCAA 4TY8B 2CAJA 2BJ1A 3NGKA 2KFZA 2W4CA 2RF2B 5CYJA 3LPEA 4C0BA 5DS7A 4JBCA 2MHEA 2VBXA 1AZSA 1RBAA 3BR8A 3F41A 4X64J 1I1GA 2DNOA 4OYMA 4O4GB 3W8PA 3GFHA 5DG7A 3CD7A 3D6FB 1YJVA 3P4UB 2IHR1 5IM0A 4EMDA 3GYNA 2J7KA 2AMCB 1GTHA 4C0HA 5HI7A 4RJVA 3UD4P 1HBOA 3E8OA 3BGUA 2OPRB 2C2EA 1RE1B 2UP1A 1QUPA 5LMNF 3POTB 4TNOA 2UXDF 3WBZA 3QZ8A 4ZJLA 5A2QU 3DLHA 2F4VF 3J7AN 2H3EB 2M9KA 3W9IA 4B02A 2VDIA 4RW9A 3K59A 1GNKA 1QVGR 4DPXA 1Q81T 1QUVA 3TRGA 4CLFA 3M05A 3NGUA 2XSJB 5F9LA 2B8QA 1Y00A 3I56S 5GMEA 3NMRA 1JNRB 2OPSA 1VMBA 5CXTA 5AXKA 2RNEA 2KG1A 4KRWA 4F3MA 2N3LA 3OL9A 1HQEA 2OLWA 4CLWA 2BV3A 1MMLA 1RBLA 1NPKA 2V9KA 1RAOA 1F9HA 3RW6A 1NNDA 1YBAA 1AUDA 5B0AA 2HHUA 1YX2A 1YZ6A 2HLUA 5A8KA 4P6QA 1QJHA 1U02A 3VCDA 3D2WA 3MCOA 1X7VA 2MMYA 2KL8A 5IV3A 4L3KA 1SJ1A 4NPOA 4IO1A 4I64A 1S1XB 1VOMA 2HMIA 2B5JA 3GCWP 2ZHAA 2H4YB 3FVYA 3EWGA 3G6ES 3ZZYA 2ASYA 1IKXB 4ZHRA 2Y1RI 2JWNA 4CQ1A 4P72A 3GFYA 1JLQA 4ZS6A 1V9OA 5J2NB 2W9CA 3FFIB 1SJRA 5KFOA 2ERRA 1NKBA 2HIQA 2DCLA 3CUNA 5BYQA 3MWBA 1HNXJ 4PWUA 1PYSB 4XDDA 2FYXA 1HWKA 2FC9A 3EZUA 3HFKA 3HVTA 2BABA 2ZM6F 4IRDA 4CT8A 3DXBA 3G6VA 5KOXA 2I5JA 1FJEB 3QGHA 4KHMA 3CNQP 1CJUB 2DPJA 4TU8A 3QQCD 1HARA 4EYIB 2Z57B 3LANA 2DNKA 4JI1F 2JZ5A 3RBEA 4IQXA 4MFBB 4GVBB 4OZNA 1S1WA 4ICLA 2E7VA 1T11A 5H9FK 1JLFB 1TKZB 2Y1IA 4X2BA 4DV1J 1L3VA 2CG4A 1FERA 1PILA 4AFFA 4DX6A 5H1SV 2IC3B 2VG7B 5L38A 1VQYA 3L95X 1XR5A 4AUKA 1U8SA 2HHPA 4MIWA 1A6LA 1EP4B 2HS4A 5EWFA 3C16A 5AT1B 1SVDA 3CDBA 2B9XA 3OBIA 5I3PA 3MEDA 3LP0B 4FNHA 5KFAA 5DQHA 4CI0B 4L75A 4UUXA 2XLJA 3QGGA 3Q8RB 2QIFA 1IM6A 2VDHA 2XBPA 1UVKA 2KVIA 3M30B 2L3MA 2V68A 4OX7A 3GU0A 2P5VA 5EX0A 1YTYA 4IOAQ 1S72S 2JC1A 1VIOA 4Q45A 3H90A 4KHPJ 1WC0A 1XNQJ 4OJ3A 2F7VA 2B4VA 3DGPA 3D66A 7AT1B 5G4DA 4Q43A 4WE1B 2L08A 4RW7B 4EI2A 4X64F 1IM4A 4KKOB 2EFVA 2LYVA 3LO3A 4F7VA 5EUHA 4PKDB 4X66F 4NLWA 1S1TB 4N41A 2WSFC 4USTA 1ZPWX 5IZHA 1M5PC 4NCGB 2ZBCA 1Y5NB 2DNMA 3VQSA 3MMCA 2KXFA 2X3GA 3EPGA 3MFIA 4YN3B 5KFNA 2ZD1A 1HI0P 3EZ5A 4TXSA 1T8EA 1JLEB 1VQ9S 1QD1A 3WX4A 4I2QB 4LQ9A 2MQPA 2DR9A 1F2GA 3KLIA 3KDOA 3MUTP 1RT1A 5ETKA 3M8YA 2Y1LB 4EBCA 4NLPA 1TR0A 3DLKB 4PWDA 4Q2LA 5EGYA 3ZC4A 2B9YA 3AFGA 3BDPA 4DV5F 2GJIA 3EX7B 1HBNA 4ZVFA 3DOKA 3AAWB 1UVMA 3PV8A 4IKAA 4NYPA 3OL7A 3TI0A 1I94F 3H59A 3ZTPA 4WCEQ 4KV8B 3UI3A 2W2OP 4LF2A 4S0MA 2YNFB 3IWXA 2LEAA 2Z58B 5CCLA 3T6JA 4RNNA 4FZVA 2WVBA 1VQ4S 2VHGA 2Y1JA 2HHQA 3X3UA 2VL1A 4YB7A 4OI0A 2FVSA 3FBFA 4ITSA 4RUAA 3T6BA 3VALA 2NXEA 2UXCJ 3C3LA 1S4FA 1MG7A 3QYYA 2NS1B 3CMES 5H9EK 2FY8A 3I5BA 4LFAJ 1E6YB 1CSJA 5J1NA 3CCJS 3ICLA 2ZNZA 4A47A 3R9LA 1DLOB 4DX5A 3Q89A 2IYIA 1PYTA 4IH6A 5I42A 3MAAB 1N88A 4QWAA 5CH7B 1PSDA 4ED3A 3TWZA 1NHUA 1WC6A 1HNXF 5LOQA 3Q2SC 4FXVA 2IAJA 3CEDA 1AB8A 3RRHA 4DOZA 4KGXB 1S6QB 1RWXB 4IRKA 1TK0A 4UQTA 3K0JA 3IGNA 2J8SA 5T7LB 5E3CA 4L74A 4USWA 4A8XA 2PA8D 4C98A 1X4AA 3UFCX 2HVEA 2DGWA 3TVKA 3TQEA 2KI2A 4OX8A 4PQUB 2HQDA 5LL6d 4DV1F 5L46A 2KDOA 3P3DA 3DMJA 5J1EA 3H8YA 4M5LA 4F2SA 3OFFA 4Q8EA 2P9CA 4FS1A 2M0GB 5FLXU 1IWAA 4DJBA 1C0UA 2VC1A 4DL7A 4IH7A 2DHSA 3WQPA 2FD2A 4PZVA 1S9GB 5B0EA 4DQQA 4NYOA 4RO0A 3EDQB 1R0AA 4ZVHA 1R31A 2VQFF 3G8SA 3MPUB 1T95A 3UQSA 1RCOB 4C2MA 1N36F 3MM9B 2V8HA 4BWJA 3OVAA 1NK5A 4NWBA 5CZXA 3P49B 2Q66A 5JXSA 2JJ4D 1O8BA 1GFWB 4F2RA 1XNQF 2H48B 4ED0A 1P6TA 2G0JA 4GC7A 3AOAA 3MEKA 5L8RC 1CC8A 1UAWA 3V6JA 3KLHA 2BOAA 4DR4J 1ZPVA 3M2VB 5CD4H 1WG1A 4DPOA 4K0KJ 1FRXA 5L9NA 3DHWC 3IG1B 3F56A 3ZZRA 2FZKB 4IFVB 2HFOA 3ITHB 1RTZA 2BE7D 2CQIA 2QLJB 1WI8A 2R7XA 1ZM4A 2YQ1A 4FKXA 4FKYA 2UVVA 1R3NA 4BBYA 1WF0A 5E3AA 4RBVA 5D15A 3I55S 1P1TA 5E5NA 3DHXA 5HROB 4LR7A 2DH7A 1TMMA 1HKAA 3M1VB 3RJMB 2W9BA 2IBOA 1JLGA 1BQNB 1URRA 5GAHU 3DRRA 1FE4A 4NCAA 3IP0A 1KR4A 4A48A 1SH0A 3FNNA 3IXQA 4JI8F 3T5JA 3V6KA 4MT1A 2IJNA 3CCMS 3MR7A 4CRJA 1FRHA 2ZE2B 4ZOSA 2OUGA 2CNKB 5E7OB 5F9NA 3NS6A 2Y3YA 3BB5A 4NOHA 3N6NA 1HW9A 4CP5A 1HD1A 2K06A 1KQFB 4CYUA 2C2DA 4O3NA 4I1TA 2UXBF 2C3MA 3BPDA 2VA2A 2QRRA 1H74A 3K5PA 2HNDB 5C24A 2VUGA 1N33J 1FRJA 1FDBA 3IWLA 3BH7B 3I32A 4KFBB 5DGBA 1NJIT 5ADZA 5J2PA 4LIWA 1VQLS 4N47A 3CJ3A 3MM8A 3FMBA 2D9OA 2VV5A 3D3BJ 1Q5YA 3N5FA 1VI7A 4LFAF 5THWA 1UW4A 2VPXB 2RRAA 1F2HA 4M5HA 4OFZA 4QWEA 2D3O1 2VA3A 1FDAA 3PJ9A 2R2SA 1WOOA 4RW8A 3W60A 2BJ3A 3KJVA 4DDFA 3NBPB 1FKPB 2M88A 2GJFA 3BGFA 4JI2F 2K3IA 3KG1A 2H5IB 2FJBB 3QWUA 4I7FA 2WONA 3FRZA 3TEGA 1IBMF 3ZNUA 4YOEA 4EFAC 3MURP 4M1KA 4CDIA 2F8HA 3EJMA 1XK8A 2JEIA 3CJQA 3BGRA 3HSGA 4H4KC 2W8KA 2YNGB 2RRBA 1N56A 4I2PA 3PW4A 4IFYA 3R6LB 2WBRA 3BBBA 1SL1A 4FBUA 2E1RA 3HKWA 1NSKL 1F9FA 3WC0A 4DU7A 3IR7B 3M2RA 3EVMA 4LF8J 1MN7A 3S1TA 1AUSL 2PMZD 4P75A 3GYGA 1SJFA 2B9WA 2JLGA 1K0VA 1C1BB 3IAM9 2GAGC 5KT6A 1ZZFA 3QWPA 3DC2A 1SB6A 5IFMA 1C4AA 1HI1A 4LR8A 5KFEA 5EN1A 3OXGA 3V4IA 4C8LA 4JYAF 4ZIVA 1YJTA 1JMTA 2AJQA 1SH3A 2MLXA 2AYMA 2OPPB 3GIJA 3A3PB 2BJDA 2EBGA 3M32A 4DUTA 2NCKL 4OZLA 1NDKA 2QLBB 3VZHA 2G2YA 5IC6B 4ZCLA 2W4DA 3FEYB 4ID5A 2XTJP 2KT2A 3SFGA 1T03B 1X5TA 2AW0A 2GA7A 3ZZ0A 3EVOA 1S0MA 3I0RB 2E7WA 5KFRA 1VC0A 3MHYA 2VFVA 2XMAA 2B4PA 3WIVA 4EWTA 5HVFA 3HLUA 4KY3A 5KFCA 4GO7X 3LP2A 3Q24A 1VFJA 2BKNA 3CO9A 3QJLA 2ACMA 3V5RA 4KO0A 2VOPA 1X9SA 1UZDA 1CG2A 4OHZA 1JIHA 4YMEA 5K14B 3ZFVA 1RHRB 2V94A 4USUA 1S9EA 4G1PA 2IDEA 1HR0F 3VQTA 1WC3A 2RU3A 3OLAA 4QR0A 2R7VA 3R3TA 1EAYC 2ZH2A 4JV0A 2RUSA 3OL6A 3TX0A 3PRVA 3PNIA 1CVJA 3KG4A 1I51B 2VPWB 3GILA 4O44A 1RQ0A 4I69A 5D8HB 1C1CA 4DBQA
chains in the Genus database with same CATH topology
2P8IA 2PEBA 2NYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8I A;  2PEB A;  2NYH A; 
#chains in the Genus database with same CATH topology
 3R5J B;  5A6W A;  5KFD A;  1UA0 A;  4U96 A;  1RA7 A;  2VIC A;  3D6H B;  3BJY A;  3NNH A;  2AKW B;  3MD3 A;  2CQD A;  4H4M B;  1TUG B;  3T19 A;  4YDD B;  3KFW X;  3SBM A;  4DG1 A;  3EXY A;  3SXL A;  4BDP A;  4I4B A;  1GX5 A;  3PM9 A;  1Q5V A;  1WEY A;  1SJQ A;  4TY9 A;  3OFE A;  3HT3 A;  3G2X A;  1KVI A;  3HF5 A;  1Q86 T;  2W24 A;  4NLU A;  2HBQ B;  3GWC A;  2R8H A;  2K2P A;  3C6U B;  5B0C A;  3TOQ A;  3QGP A;  4DL6 A;  1FWP A;  2DH9 A;  5BR8 F;  2DK2 A;  1F9E B;  3QRP A;  2ZFH A;  4QZV B;  3TA1 A;  5KG1 A;  3PFO A;  1FT8 A;  3NEK A;  4ECW A;  3NMA A;  1BLU A;  1CJK A;  1X4G A;  3LH2 S;  3AXK A;  5DLF A;  1RTH B;  4P2F A;  2ZH3 A;  3QGI A;  4CTA A;  2J9D E;  2XSJ A;  1XBW A;  3CCS S;  3D68 A;  2N7C A;  5A76 A;  2UVR A;  3BS9 A;  4FS2 A;  2MY8 A;  3TVZ A;  1RWP B;  1WNE A;  3A4T A;  2WOM B;  5CYM A;  3OTE A;  2FPH X;  4F4A A;  4ECX A;  4B3R F;  3PTW A;  3CXC R;  2MDA A;  4P52 A;  4X62 F;  1UVJ A;  3K5M A;  4A8F A;  5I4M A;  1XR6 A;  1ULR A;  1LFP A;  1U2C A;  3CDA A;  3BEG B;  4LFC J;  4R8U B;  1LXN A;  2OEK A;  1Y10 A;  1YKW A;  2W2M P;  3DCA A;  4NLQ A;  2W7P A;  2DY9 A;  1RAD B;  1BQM B;  3QFH A;  2DNY A;  2QFJ A;  4WP8 A;  1VQ8 S;  1J5O B;  1LFW A;  5GAH I;  3C6T B;  5J2M B;  2ZH8 A;  3OXF A;  5DDO C;  1QDU B;  2F63 A;  3IBW A;  2ATL A;  1YK9 A;  1T94 A;  4HH1 A;  3LP1 B;  4RLE A;  2X1F A;  1WG5 A;  1YLX A;  3G6Y A;  4DSI A;  1YJN S;  1ZOT A;  3UD3 P;  4OJH A;  1U24 A;  2RDI A;  2B7B B;  2ZZT A;  5DDR C;  4QQB A;  2QMU B;  3MI7 X;  5J2N A;  5E3Q A;  3FFI A;  2WB4 A;  3HUL A;  3CJ4 A;  3QO9 B;  2HUR A;  1CC7 A;  3ENA A;  1X60 A;  4LBI A;  4HL9 A;  4O4R A;  2HNZ B;  4NZ7 A;  5FDL B;  1WOS A;  1K73 T;  3GJT B;  1C4C A;  2V9W A;  3B78 A;  1RHJ B;  3O3L A;  3PRB A;  4NXN F;  2OP5 A;  4MAK A;  1WTB A;  4ZVP B;  4E2F B;  2AYG A;  4Q44 A;  2IRU A;  4MFB A;  4ZMM A;  3FK4 A;  5KG4 A;  2GGP B;  2V5H G;  4QJV A;  4NI2 B;  4G6V B;  3B4D A;  2FLP A;  4OI1 A;  1YSJ A;  2JNJ A;  2GIF A;  5D0G A;  1KFD A;  1YZ7 A;  1M5O C;  1V3S A;  4XIU A;  3MEG A;  4EGL A;  2AU0 A;  4ED5 A;  4W92 B;  2CKW A;  4PG4 A;  4NRT A;  4LF7 J;  2V63 A;  5KT4 A;  2KJV A;  3AY0 A;  3MR2 A;  2CJA A;  1XWL A;  2Q1L A;  4PAA A;  4MKV A;  4P7T A;  1X0P A;  1R8P A;  2ZH4 A;  3FSY A;  3FSX A;  4N8O A;  3S6E A;  4QPX A;  4F02 A;  4PPZ A;  1RWW B;  2K1R A;  4FXW A;  4KSE B;  4XK8 C;  4XAK A;  5KFL A;  4CM0 A;  3LPY A;  3M30 A;  3IN5 A;  5CD4 A;  3AJ1 A;  2ZZM A;  3KHL A;  1JLB A;  2OKQ A;  3V81 B;  3N01 A;  5DG9 A;  4HDH A;  4B3T F;  5CCM A;  2X51 A;  1LK5 A;  1B0P A;  3HJV A;  4ZVR B;  5AJ3 F;  1TK8 A;  2Z4P A;  2HSE B;  1JJH A;  1JK9 B;  1RWO B;  3ZTQ A;  1FWL A;  1Z4U A;  4ZN1 A;  4WE1 A;  4OYI A;  4ZN3 A;  4ILM A;  5F8H A;  4XTT A;  2ZDO A;  4F4X A;  4J37 A;  4NZ0 A;  4KKO A;  3D1O A;  4ED8 A;  3T9Z A;  2N4D A;  2RIL A;  1NK4 A;  2QX0 A;  4F3Q A;  4F26 A;  1WHV A;  3MOZ A;  4GMK A;  3AOB A;  4LBP A;  2BE2 B;  3KLG A;  1K44 A;  1DTQ A;  3V6H A;  1U1O A;  1NB2 A;  3MPW A;  2ZVI A;  3HXM A;  1HWI A;  2B51 A;  2H51 B;  1WI6 A;  2EK1 A;  4ETX A;  4WP3 A;  2G13 A;  2FGC A;  3U02 A;  2K7J A;  1U1Q A;  2A0F B;  2HVI A;  4NLD A;  1LW0 B;  3O1L A;  1NCL A;  2WTF A;  3H40 A;  1N5S A;  4DR1 J;  2NQP A;  3O8W A;  4K4S A;  2ZBI A;  1NJY A;  1GMW D;  1FE0 A;  3AOC A;  4KE5 A;  1NH8 A;  4B08 A;  4HAC A;  1U1M A;  3LA0 A;  2Z56 B;  3EXC X;  4F0M A;  3O6Q A;  2YNF A;  1XN9 A;  2P9G A;  4P2S A;  5A8R A;  4EK2 A;  3VGT A;  5B0G A;  5C25 B;  1WJ9 A;  5HMW A;  3A3N B;  4ZCK A;  4B9T A;  3OFG A;  1PAU B;  3THT A;  4LFC F;  5LSL A;  1TAQ A;  3NAI A;  3MEE A;  2W7O A;  4USK A;  3R7N B;  2OTJ S;  2Z2L A;  1KDN A;  3CD5 A;  1QVF R;  5M2R A;  3SQG B;  2YNH B;  2I2Y A;  1HMV B;  2MKC A;  2NLW A;  1VYA A;  3GIR A;  2VFU A;  3H2U B;  1BGX T;  3IC1 A;  2OSQ A;  3MMA B;  3MAA A;  4C8M A;  4DR5 J;  4DPT A;  2ADC A;  2PT0 A;  2LEP A;  3DOL B;  3TQ1 A;  2O3D A;  2MQO A;  2RHS B;  4GKJ J;  5IXU A;  2HGM A;  3JAM Y;  1CEZ A;  2HZA A;  2MJU A;  3M8W A;  1UVI A;  1OSD A;  2IA0 A;  2FLL A;  1QLN A;  2KJW A;  3T5L A;  1AZS B;  2YQ0 A;  1SV5 A;  2DTJ A;  2FVP A;  2DEI A;  1TEL A;  4ZLN A;  4PQU A;  4RL1 A;  2AJ0 A;  3QMQ A;  1Q8L A;  3A3O B;  3PYF A;  4QW9 A;  4B9U A;  4M5N A;  4DL0 C;  2IMO A;  2RQ4 A;  3D9B A;  1LWE B;  3MTJ A;  3CF5 Q;  1IBC B;  4EBD A;  2YH1 A;  3LF0 A;  4UTG A;  6FD1 A;  4U8V A;  4DX7 A;  3EGV A;  1HBO B;  2A10 A;  5CYQ A;  4CWB A;  3EGZ A;  2V2Z A;  3W61 A;  1VIS A;  3L7P A;  3VAG A;  1GMU A;  3CDE A;  3V6D A;  1ARO P;  2XZD B;  4M5G A;  1FD8 A;  1WEL A;  4RW9 B;  4DQI A;  1N8R T;  3UVJ A;  5ETN A;  3I6P A;  3KKF A;  4TYA A;  5G0R A;  3BO2 A;  1PG5 B;  2BAN A;  2WW8 A;  4TLR A;  3TAP A;  1REV A;  1SKU B;  4Y65 A;  2CIM A;  1O0P A;  2E1M C;  3GYX B;  4N5S A;  3WIU A;  1WC1 A;  2J9D A;  2XMV A;  1HQE B;  2UUA J;  3PFE A;  3PHE A;  4RW6 A;  4CM2 A;  5C2C A;  3M2V A;  2LDY A;  4J9Q A;  1F3F A;  3IG1 A;  4EO6 A;  3CT9 A;  2M3D A;  2XUL A;  3TJ9 A;  5KFB A;  3GIM A;  3ITH A;  1WEX A;  3KWM A;  1L5U A;  2MB0 B;  4GKK J;  3HD2 A;  2H1Y A;  4LBH A;  4C8Z A;  4NLO A;  3Q86 A;  4YR0 A;  3UCU P;  3OTO J;  5KFM A;  2HMI B;  3BDE A;  2B56 A;  4DFP A;  1AXQ A;  1R0B G;  2B5J B;  4DV2 J;  2HRY A;  2L9W A;  3IM8 A;  4G3I A;  4ZHR B;  1BQN A;  3PZP A;  1UVN A;  4DUY J;  4Z7C A;  3M8Q A;  1JLQ B;  2GZO A;  2AEM A;  1FJG J;  4X4T A;  3TUJ C;  4FBT A;  4WXO A;  2W9C B;  3Q83 A;  3CJK A;  2QFI A;  4B3O A;  5HQ8 A;  4YDX A;  1RAE B;  3O5T B;  4JI3 F;  3NKY A;  3HVT B;  3U1M A;  4F8R A;  3OSN A;  1FO1 A;  2QA4 G;  1PGZ A;  1UWB A;  4J9N A;  2XWX A;  2DXE A;  2XMU A;  2RB7 A;  3VGS A;  4MK8 A;  2E5I A;  4RBT A;  4C9D A;  3BSA A;  4AL6 A;  4C8Y A;  1A9N B;  3CCT A;  4OYW A;  2QE5 A;  3T1A A;  4Q5V A;  3KOA A;  2FGO A;  1S1W B;  4ICL B;  4USH A;  4PUO A;  2J8A A;  5KFS A;  5LSR A;  4ZP9 A;  5E3R A;  4KFB A;  2PMW A;  3OTD A;  2EKY A;  2EFO A;  3S7R A;  1VRQ C;  2ZH7 A;  1VC5 A;  3M8P A;  3MMJ A;  2R8J A;  1T9W A;  2VKR A;  3OR2 A;  1NPR A;  2QYC A;  5AE1 A;  3C16 B;  2VJV A;  2V34 A;  3W9J A;  4K7Q A;  4GRS A;  3MED B;  3NS7 B;  1IKY A;  2R7U A;  5FII A;  3WHI A;  3W5Z A;  2QO3 A;  5HSP A;  3QAE A;  2QL9 B;  4PCQ A;  2O01 C;  1VQS A;  4DR5 F;  1RWN B;  3B82 A;  3PG9 A;  1IJF B;  1ZYQ A;  2CNN B;  1HIY A;  3LAL A;  2DNH A;  3M6U A;  3VAH A;  3TAR A;  1PJ5 A;  4RWX A;  4I67 A;  1RAF B;  1DQA A;  5ITH A;  3C15 A;  1VRT A;  2YNG A;  3GR1 A;  4OL8 A;  4FPI A;  3M6X A;  1S76 D;  3PY8 A;  1U09 A;  5A2Q Y;  4M8L A;  2HFV A;  2GVD A;  4E8U A;  3RG6 A;  3WDO A;  2DD8 S;  3K17 A;  3PO4 A;  3OQ2 A;  4OHX A;  5K8N A;  4LSL A;  4DFM A;  1S0V A;  1RGV A;  3EPI A;  4KC5 A;  3OXL A;  5HO4 A;  1VQM S;  4WFN Q;  1MWZ A;  4RW4 A;  3MMC B;  3QRQ A;  4WTO B;  3M6V A;  2ZD1 B;  2F8M A;  4DS4 A;  4LF1 A;  1Y3J A;  2DRB A;  2RIJ A;  3NAH A;  1OPZ A;  2VOO A;  3CCU S;  3KLI B;  2YWK A;  1RT1 B;  4DV7 J;  5HAN A;  2OPP A;  1U26 A;  3NGS A;  2A2C A;  4PYA A;  1JJ2 R;  1X9M A;  3UN5 A;  4PWD B;  2FVQ A;  2DCU B;  4DCP B;  1U1K A;  4J9M A;  1Y7P A;  2JRS A;  3PAC A;  1HBN B;  2ZH9 A;  4DV6 J;  1T03 A;  3CJ0 A;  3DOK B;  2XEX A;  2K8G A;  2GQC A;  2DIV A;  1JXV A;  4OMF G;  4TYB A;  5JVG Q;  2UUA F;  2YKO A;  1VBY A;  2H5J B;  5IT4 A;  4LJM A;  4B3M J;  4DR7 J;  3KK2 B;  3A1Y G;  4CLP A;  2UUW A;  2DO0 A;  3HHE A;  4K4T A;  4NLR A;  3D28 A;  3CE8 A;  2CG8 A;  5D0H A;  4GKK F;  2XI2 A;  3BSC A;  1OJ4 A;  1GTE A;  2VBW A;  5DM6 Q;  3FZB A;  2V8P A;  4OV1 A;  1R6V A;  3MAH A;  1NJZ A;  4DV2 F;  5I3Q A;  2E1A A;  2XY6 A;  3SDE A;  5KT7 A;  1RT7 A;  1X8D A;  1NME B;  4W90 B;  4DUY F;  4HTJ A;  5I42 B;  1NK7 A;  4K2X A;  2CQC A;  3R7S B;  2K7K A;  1VJQ A;  3LQV A;  3DRY A;  1FJG F;  1FA0 A;  1IQT A;  1HNZ F;  2J7U A;  1R7I A;  1LWC A;  3L9Z A;  2Y8W A;  2HBZ B;  2W4P A;  1RT4 A;  1EQ0 A;  4MK9 A;  2IAJ B;  2D1C A;  1FJC A;  4DLG A;  5C5J A;  3R97 A;  1VBZ A;  1I3O B;  3MM5 B;  1L3T A;  3VHQ A;  3EZO A;  4X4O A;  2BRL A;  3JSM A;  2DNN A;  3EUN A;  4AT1 B;  3KLF A;  2ABY A;  1UMJ A;  3LGN A;  4N76 A;  2KB2 A;  3TAN A;  3G96 A;  2CJK A;  1YJ9 S;  2IM0 A;  4Y2I A;  2EEY A;  3AQP A;  4CCH A;  3T3F A;  2UU9 J;  3DI6 A;  2QA4 S;  1RWV B;  4Q7A A;  4PXD A;  1FDN A;  3PYD A;  2W25 A;  3DMJ B;  1IJE B;  5J1E B;  1S7I A;  1UEK A;  2MQM A;  3K57 A;  2WVF A;  2AQ4 A;  3ONQ A;  1L3K A;  1V3R A;  1C0U B;  1SPB P;  1UEV A;  3ULH A;  2Y8Y A;  5HLF B;  3AH6 A;  5IV4 A;  3ZZT A;  3BKT A;  4ES2 A;  1R0A B;  4X4V A;  2EFN A;  1J27 A;  3GIK A;  1HNI A;  5D4N A;  1EQM A;  3FQL A;  2CPZ A;  2AP6 A;  3L7O A;  1ZTW A;  2I0X A;  2CQ4 A;  3HSZ A;  3UN3 A;  1KVK A;  4N56 A;  1BUX A;  1KEK A;  2RUG A;  4AL5 A;  2QSF A;  4RPF A;  2XO7 A;  4DN9 A;  4R0E A;  1RT5 A;  2HGL A;  1Y4Z B;  1K47 A;  4X65 F;  1OYD A;  3AHP A;  4PYD A;  4C3L A;  4Y3C A;  5DG8 A;  3KLH B;  4U7U K;  4GC6 A;  4DV3 J;  2EXU A;  3TW0 A;  3UPF A;  2J9E A;  3SSS A;  2D9P A;  3K2Y A;  3TX8 A;  4F4Y A;  1NZ8 A;  3HSJ A;  2CQH A;  2YPZ A;  3I9Z A;  1WOP A;  2D3U A;  5HL7 Q;  2RS2 A;  1JNZ B;  3GSI A;  2NR0 A;  2CNL B;  4X4R A;  3ZTS A;  4JV5 J;  5L39 A;  4QBU A;  3FDS A;  1HPZ A;  3KLV A;  2EG2 A;  2HBY B;  3GSD A;  1ZET A;  5HMZ A;  2YY3 A;  3BN4 A;  5L1L A;  3K8V A;  4M5M A;  2DXD A;  1CLF A;  4ZVS B;  1U2R A;  4M5I A;  3RAX A;  4Y34 A;  4DF8 A;  3DDI A;  1RT3 A;  2W9B B;  1NKE A;  1JLG B;  4DV7 F;  3DRR B;  1S7H A;  2MYF A;  3OPK A;  4ENO A;  3N0V A;  2W1B A;  4UOG A;  4DPY A;  2IYG A;  1WOR A;  3VVU A;  3IGV A;  4DV6 F;  1NHV A;  1X31 C;  2QC3 A;  3C66 A;  1CS4 A;  2FB0 A;  2YKM A;  3RAQ A;  1S0N A;  2MGZ B;  3Q8S B;  4K4Z A;  3HFV A;  1FXL A;  4CYU B;  4AXJ A;  3E3X A;  3ISN D;  4DR7 F;  2R42 A;  5ETP A;  1DQ8 A;  2NZC A;  3TZX A;  1SJ3 P;  5C24 B;  2VIH A;  4J9P A;  4QYZ K;  2FDN A;  2HS0 A;  4Z37 A;  3QPI A;  5J2P B;  2BM0 A;  3SMZ A;  5KFP A;  2XSF A;  2GV1 A;  5LMN J;  3FQK A;  1X4F A;  2F4V J;  1N6Q A;  3PX6 A;  3UR3 C;  3A13 A;  1LW2 A;  4N8N A;  5CAA A;  3ZTR A;  2UV8 A;  2DR8 A;  3CJT A;  4RW8 B;  2JFK A;  3KJV B;  1E6V A;  4DFK A;  1GAO A;  5IT0 A;  4UQG A;  3DGV A;  3NRB A;  4MH8 A;  4I7F B;  2E5J A;  2WON B;  1N54 B;  3KUE A;  3JSB A;  3CJ2 A;  4I6W A;  1U6F A;  2IRX A;  1FI4 A;  2FVR A;  3I0S A;  4ECT A;  1ELO A;  4WYL A;  3AB2 B;  4I2P B;  4IFY B;  2ZC4 A;  1GMV A;  2Z30 B;  2EC0 A;  4BC7 A;  2VB6 A;  2HHW A;  2OTL S;  3D54 A;  5L1K A;  2UU9 F;  1U6B A;  2MZQ A;  2W01 A;  3CO0 P;  4KHR A;  2KFY A;  1O51 A;  4Y00 A;  5JVH Q;  4FF2 A;  4FYD A;  3CC4 S;  2WW4 A;  4FVM A;  4ZKA A;  3IWN C;  2H65 B;  2ZHO A;  1DZ5 A;  5D6G A;  4LMZ A;  3PYE A;  1S49 A;  2MSS A;  3ISZ A;  1JLC A;  3DYA A;  5LMU F;  3KHH A;  1ITP A;  5LXR A;  1SC4 B;  3V4I B;  4UY8 T;  3SI8 A;  1TFY A;  3BZQ A;  1IR1 A;  1TVR A;  3RU0 A;  1X5O A;  2MZ1 A;  4RNM A;  4RNH A;  3M32 B;  1G2E A;  3NG8 A;  2ZM6 J;  1S5Z A;  1RCX B;  1OPI A;  1F0X A;  2YKN A;  1EZZ B;  3J81 Y;  3NXZ A;  3W7B A;  1FF2 A;  2VH7 A;  1D9D A;  5I3U A;  2AYB A;  1NEE A;  3KUH A;  3HP6 A;  4DV3 F;  4KIA A;  3LW5 C;  3IRX A;  3RAM A;  2OPQ A;  1DBD A;  4P73 A;  3W65 A;  3LP2 B;  3IBC B;  2HHS A;  3M9M B;  4KO0 B;  1B99 A;  2XM3 A;  2V2K A;  4YP3 A;  2R4F A;  5IQQ A;  3CDU A;  1IUJ A;  4JV5 F;  1S9E B;  5LSO A;  2DPI A;  2C2M B;  3SQG A;  3UD5 A;  4B9L A;  1TL7 A;  5ETS A;  1QSL A;  1RAB B;  2C3Y A;  4OI4 A;  2XS5 A;  1N4L A;  3TJA A;  4JV2 A;  3MMA A;  2CJ9 A;  3GII A;  5B0D A;  4O44 B;  2E9Z A;  2X1G A;  2WSC C;  5L1J A;  2C2O B;  1C1C B;  3B6B A;  4ED4 A;  1U1N A;  3Q8Q B;  5F3Z A;  2MHN A;  4J9K A;  2CPX A;  2DKO B;  2J0S D;  4KH1 B;  4K50 A;  4K4X A;  4ZVU B;  2LQ9 A;  1TL5 A;  4HVZ A;  3E01 A;  2FJD B;  2HFZ A;  2F4F A;  2EVZ A;  2EFG A;  5IWA J;  4DG1 B;  2JH3 A;  4PQA A;  4DQS A;  1TTH B;  3EIC A;  2HHV A;  4WK3 A;  1UCN A;  2KH9 A;  3AXM A;  1OY9 A;  1UFK A;  4V19 X;  5F0W A;  3CPW R;  1FTR A;  5DZ6 A;  1S6U A;  1MRO B;  2MZS A;  4X66 J;  1X4B A;  4NCB A;  1LWE A;  3C14 A;  3EMT A;  2DNL A;  2IM2 A;  3KNG A;  4PEO A;  2NXJ A;  1FES A;  5A0Y A;  1X5S A;  1B3T A;  2PFD A;  4ZPC A;  2EC2 A;  1RHQ B;  1ZS6 A;  2UUT A;  1HYS A;  2BJ9 A;  1JJ4 A;  3OD2 A;  1CJK B;  1DAR A;  3K8W A;  2B0G A;  1VBK A;  3TNV A;  4I6A A;  4J90 A;  2MKJ A;  2O5D A;  3CC7 S;  4CTA B;  2NPF A;  2Z2Z A;  2AX1 A;  4DL4 A;  1T9X A;  4YQW A;  2HGN A;  4Y2A A;  1JB0 C;  1YJR A;  1L3U A;  4DV5 J;  4K8R A;  2LDI A;  5B7W A;  2UVW A;  4AQY F;  5CYM B;  3CUL A;  3BQ2 A;  5B08 A;  3PKY A;  2W2P P;  1HFE L;  3TZY A;  5KG7 A;  2FHO B;  2BQU A;  3K5L A;  4ZPA A;  4DQR A;  3PJX A;  1I94 J;  1UL3 A;  1OYE A;  1Q8B A;  2KKH A;  1CPZ A;  4W98 A;  3PX0 A;  2CQ2 A;  2GAH C;  3BGL A;  4NLV A;  3LUY A;  1DQ9 A;  2APO A;  2BW2 A;  1RAA B;  1XJW B;  1NAQ A;  1RT6 A;  2C1E B;  4X4U A;  1NPP A;  4WZQ A;  3W8G A;  3G4S S;  1RWM B;  4FF3 A;  2CWX A;  2GO9 A;  3LGH A;  1KBR A;  2E66 A;  3T1H F;  3MAQ A;  1TV6 A;  2YBV A;  5LT5 A;  2BA9 A;  3RZA A;  3QNW B;  4DX8 H;  3CGI A;  2M8D B;  2N3O A;  3FC9 A;  1RAG B;  2GMH A;  4AL7 A;  1SQG A;  4PWW A;  3ILJ A;  3D6T B;  2R7Q A;  3J7Z T;  2HZV A;  3MM6 A;  4NML A;  2CZ4 A;  1YG0 A;  4YS2 A;  5BYS A;  1RAI B;  2ZBQ A;  2LA6 A;  2XHW A;  1WEZ A;  4DR2 J;  4DS5 A;  4WFA Q;  2DYA A;  4JI0 F;  3IS9 B;  1B7F A;  4A8W A;  4MKA A;  2MZJ A;  1S97 A;  2QLW A;  4MK7 A;  3LGM A;  2V2V A;  2XGP A;  2YX7 A;  1GH8 A;  4LRA A;  3MEC A;  2NUU G;  2VQE J;  4NAS A;  1VLO A;  1KON A;  3MEG B;  1IXK A;  3KJQ B;  2XLI A;  3AD9 C;  1BQX A;  1F6T A;  5MAO A;  5D0R A;  2R2R A;  2R9L A;  2LXF A;  2EFQ A;  4N77 A;  1OMS A;  1EKS A;  2VQF J;  2K1R B;  1S9F A;  4P2X A;  1N36 J;  5LJ5 Y;  2ALZ A;  2MY7 A;  3PVX A;  1JLB B;  2DH8 A;  1NZA A;  2HQI A;  4QOT A;  5KT5 A;  2CQ1 A;  2AV5 A;  3PW7 A;  2E1P A;  1VQ6 S;  1PC4 A;  1FNX H;  2KT3 A;  5IWA F;  3PX4 A;  2U1A A;  1PBA A;  4ZIT A;  1D9F A;  2XZT B;  1NDP A;  2HWI A;  2GNK A;  2BBE A;  1TL4 A;  2KN4 A;  3O44 A;  2VOD A;  2JLE A;  3GJQ B;  2V2Q A;  2V4Q A;  3W2W A;  2QA2 A;  3TZZ A;  1XMO J;  1Q79 A;  3PR5 B;  4C48 A;  2MJN A;  3KLG B;  3Q23 A;  4ILL A;  4Z7Y A;  4IG0 A;  4J9S A;  2OHD A;  5KG2 A;  2OML A;  3H5X A;  5ETR A;  2V69 A;  1DTQ B;  1FK9 B;  5D4P A;  3KYL A;  1ZZN A;  1HL6 A;  4R5P A;  1OO0 B;  3BKF A;  3Q0A A;  3HVA A;  1XNR J;  4FVC A;  2YVS A;  2DHX A;  1T02 A;  2PMH A;  3TR5 A;  2EKN A;  1C0T A;  1YJW S;  1X5P A;  4FYW B;  1F5B A;  3A12 A;  4JI8 J;  1BWV A;  4R25 A;  3PW2 A;  1FX2 A;  3US5 A;  2BJE A;  4QR2 A;  4OZJ A;  3G8T A;  3IAS 9;  4ILR A;  1S1U A;  4ZCI A;  3NGD A;  3TJ8 A;  3HPO A;  4OLP A;  2V0N A;  4DI6 A;  3UDC A;  3N9U C;  3CSK A;  2WAQ D;  1WC5 A;  2ATC B;  3MZI A;  2R2U A;  2ZH6 A;  2UXB J;  3D7S B;  5B09 A;  4HAC B;  1TL1 A;  3KK2 A;  5BYR A;  3KMS A;  4E98 A;  4WFX A;  2GW8 A;  3G82 A;  3JS9 A;  4PG5 A;  1RAJ A;  5A8R B;  1QTM A;  3JQM A;  1G3O A;  4IG3 A;  2J9C A;  2BR0 A;  2RML A;  3NCQ A;  1N32 J;  2QMX A;  5L1I A;  3AQO A;  2O67 A;  4H4O A;  1NSQ A;  1FTC A;  3QJP A;  4NLX A;  3BQ0 A;  1DJ0 A;  4QU6 A;  4CH0 S;  3MEE B;  2GQ2 A;  4NEZ A;  4P71 A;  3IRW P;  2E29 A;  2IM1 A;  4HEA 9;  1LV5 A;  5HAT A;  2M7S A;  3QJJ A;  1H2U X;  2JEF A;  1S4E A;  3HHL B;  4L72 B;  4B9N A;  2MXY A;  1F5A A;  1TKT A;  3OR1 A;  2A6O A;  4HKQ A;  1JKH A;  4IH5 A;  4JI2 J;  1H98 A;  4OYO A;  4DL5 A;  3G71 S;  1IBM J;  3W3S A;  4ELV A;  1JLA A;  2GHP A;  2L48 A;  3FGV A;  3MM5 A;  2HHH J;  3MR6 A;  2AJ1 A;  1VQP S;  2J0W A;  1O5J A;  2B4O A;  3H5S A;  2ZVS A;  4RZR A;  3HO1 A;  1SV5 B;  4DR2 F;  3DXS X;  2Y0B B;  2YWH A;  4U7U D;  4F0K A;  2IVM A;  2BX6 A;  1XMB A;  2GS8 A;  2EI5 A;  2XC9 A;  3MTK A;  5HQM A;  1R43 A;  4LRE A;  3W5Y A;  3CDW A;  1WKL A;  2WRM A;  1R8A A;  3LWM A;  4DV4 F;  2WVD A;  2VQE F;  2RH3 A;  5K8O A;  1DRZ A;  4O0N A;  4ZLP A;  3GMG A;  3ZZO A;  3HZG A;  1HWJ A;  2FHJ A;  2HW3 A;  5CYQ B;  2ZKT A;  3I4P A;  2GMJ A;  4X4P A;  1MN9 A;  3BO4 A;  1IBK J;  2PII A;  2DGS A;  1M1G A;  3MM7 A;  4TN2 A;  5HLF A;  3V6D B;  1S1V A;  1WKK A;  5AXN A;  4NL5 A;  3MPY A;  4JYA J;  2QV6 A;  5DO2 A;  2OH2 A;  3VAK A;  4IOB A;  1PJ7 A;  3K7R A;  2E5G A;  2B43 A;  3UVJ B;  2MQQ A;  1LEO A;  4U67 Q;  2VAS A;  3VGV A;  5G0R B;  1DFD A;  2YNI A;  2BAN B;  4J9V A;  2KZZ A;  2ZKU A;  4DL2 A;  3DU6 A;  2BXJ A;  1REV B;  3ZNJ 1;  4ZP8 A;  3LWL A;  1YQH A;  2FHK A;  4C7Q A;  1Q82 T;  4YHH F;  5HN0 A;  5CHC B;  5ETO A;  5GAG U;  3TYT A;  4LF4 F;  5AXL A;  1VHF A;  2YWF A;  1OS5 A;  4J91 A;  3Q8U A;  1NK0 A;  4L6V 3;  2R8I A;  2CPH A;  4RW6 B;  5KFH A;  1J2V A;  2R7W A;  2CPJ A;  3U1N A;  2ZJR Q;  4ZVE A;  1XMO F;  5LM7 E;  4F50 A;  2AGP A;  2UUC F;  2J0X A;  3KJF B;  2LA4 A;  1FNM A;  1V3Z A;  1KS2 A;  1HR0 J;  2CVI A;  5GMD A;  1RI7 A;  1M90 T;  1RK8 A;  2V4J A;  3GE9 A;  1M1H A;  2XYG B;  4DFJ A;  3AOD A;  4OYP A;  1FHT A;  4CH1 A;  1XNR F;  1UVL A;  1BY9 A;  4YB6 A;  2R8K A;  4X4N A;  5D78 A;  2VBZ A;  1N52 B;  1KFS A;  1Q8I A;  4PAB A;  3M8Q B;  4KGZ B;  1KQG B;  2YTC A;  3JQJ A;  4OI2 A;  2KO1 A;  4P7V A;  4CO0 A;  1Q8K A;  3CJK B;  4B3O B;  1HNV A;  1T3N A;  1S57 A;  4C3M A;  1HHS A;  2CPY A;  2OEM A;  1QSY A;  1TAU A;  1B7Y B;  4EZ6 A;  2KZM A;  1PKU A;  3GG0 A;  3KK3 A;  2C28 A;  5KFJ A;  5HP1 A;  1UWB B;  2XI3 A;  5GAD I;  3CJS A;  2MGZ A;  1HI8 A;  4F67 A;  4HT5 A;  4USJ C;  1Q7L B;  1DTT A;  4URQ U;  2DGU A;  5KT3 A;  1T7P A;  3K89 A;  2IVF B;  3JYT A;  1UEU A;  4C8K A;  3L3C A;  1SIW B;  4PUO B;  1S6O A;  2MKS A;  1N32 F;  3PO5 A;  3M8P B;  2GX8 A;  2HS3 A;  2CPD A;  5BR8 J;  2OEJ A;  3OR2 B;  3HVR A;  4J9L A;  1Y11 A;  1P1L A;  1JX4 A;  3P6Y C;  3R2C J;  1OWX A;  3GZ7 A;  3MCM A;  4WK1 A;  1MSW D;  1IKY B;  1IR0 A;  2KXH A;  2UUB J;  3U7J A;  2BDP A;  1BE4 A;  2CJY B;  3H4B A;  1P9Y A;  2XMJ A;  4NEY A;  2RRN A;  3MCN A;  2X3D A;  1KHW A;  3QZ7 A;  2HIY A;  2QYG A;  2FJW A;  2DJW A;  3H20 A;  2YX1 A;  1T9T A;  4CZC A;  2P2C B;  1RA6 A;  5J1P A;  1TP7 A;  4L73 A;  2PDA A;  2ALY B;  5A8W B;  5M2U A;  1DUR A;  2HHH F;  2J6T A;  2NXN A;  3T9N A;  4B3R J;  3W63 A;  3C15 B;  2BMB A;  1VRT B;  3W66 A;  1R6Y A;  1WUU A;  5KFK A;  4X62 J;  4WXW A;  2GVD B;  3M2U A;  2OO4 A;  4NXM J;  2F9J A;  4JP8 A;  3A8I A;  5ETT A;  2E9T A;  5HBM A;  2DRD A;  2OAU A;  4LSL B;  1QAY A;  2A1B A;  1RT2 A;  2V8V A;  4A8K A;  4FP9 A;  2AEF A;  4RW4 B;  4RUH A;  4C8O A;  1PIE A;  1SBR A;  5K8M A;  4Q0B A;  1XMQ J;  1IBK F;  2VG5 A;  1UWA A;  3MOJ B;  1OQ3 A;  4YY3 J;  1R8C A;  1H38 A;  3T5K A;  2Z8Q A;  3OVS A;  1OQ6 A;  3E51 A;  4PG7 A;  4G1Q B;  2CA9 A;  3OT9 A;  2RS8 A;  5C7P A;  3P5T L;  2OD6 A;  4C4W A;  1NK6 A;  1WF1 A;  4USI A;  1ZH5 A;  2IPO B;  3QT8 A;  1CUL A;  3ILI A;  4OLO A;  1KLM B;  1B0V A;  3RBX A;  4NXN J;  2X1B A;  1H3D A;  3HVW A;  3KG0 A;  1RAC B;  1KP6 A;  3QLH A;  3KJN B;  1VQ5 S;  1SC1 B;  5D3G A;  4K4U A;  4FN5 A;  1UKU A;  2PN6 A;  3I5C A;  2C3P A;  5CQG A;  1VRU A;  1WSV A;  2GQQ A;  2YWE A;  4CO1 A;  4IO9 Q;  2F8E X;  4O3Q A;  3NY0 A;  3OLB A;  3AA8 A;  3M8R A;  3GG1 A;  3ETO A;  4WZM A;  2DNQ A;  3N6L A;  3CWJ A;  4OX9 J;  1NK8 A;  1Y9O A;  2LP4 A;  3VTI A;  4LRF A;  4PG8 A;  1WWH A;  1S6P A;  1BD6 A;  3SDE B;  3HHL C;  1RT7 B;  1LK7 A;  3QAT A;  3OTC A;  4LSN A;  1BHN A;  1HNW J;  4B3T J;  3KLE A;  2DGX A;  4M5J A;  3J80 Y;  5AJ3 J;  4CLZ A;  1LWC B;  2D3O R;  1K1S A;  1RT4 B;  3IA0 A;  1QE1 B;  3NGT A;  2QLX A;  2VBY A;  2ZOM A;  4EO8 A;  2HVZ A;  5IS2 A;  3R8Y A;  4J5O A;  2JC0 A;  3JSM B;  1EET A;  2GFF A;  3KLF B;  1Q78 A;  1OIA A;  5DDQ C;  2FY1 A;  4LF5 J;  1YRT A;  4Q8F A;  4A8O A;  2R7S A;  1MRO A;  4DU8 A;  2OIH A;  3MMB A;  4P74 A;  4Y2K A;  5E41 A;  3SSR A;  2G4B A;  5GAE I;  4EZ9 A;  3DI6 B;  1Q53 A;  1I6J A;  3BN7 A;  3HHD A;  4FYY B;  4M5D A;  4Z2X A;  4QYZ J;  3TUP A;  2KYZ A;  1QY7 A;  2CNO B;  3GB0 A;  3D1Q A;  2JLF A;  2ZWO A;  3VAM A;  3AT1 B;  4F0H A;  1H2T Z;  1GQE A;  3GV8 B;  2UUB F;  2DHH A;  4V19 J;  2A6M A;  3RB3 A;  4ZVG A;  1RTJ A;  5GAG I;  1GK8 A;  5F8J A;  1HNI B;  3FEZ A;  2XCP A;  1NM2 A;  4EU0 A;  4FF4 A;  3CD0 A;  2ROG A;  2P6T A;  4W4M A;  4IRC A;  3GV7 B;  1ACM B;  3H5U A;  2C2Z B;  4F4Z A;  2VJU A;  4WKY A;  5HJY A;  2KU7 A;  5FD1 A;  2EWH A;  3HJF A;  1RT5 B;  3GQC A;  1FRL A;  5F3T A;  2XMK A;  3I5A A;  2W9A A;  2KTQ A;  1WF2 A;  3DRS A;  3IMQ J;  2FIU A;  5B0F A;  1TFW A;  2KFN A;  1FKA F;  1UJ6 A;  3M6W A;  3W2V A;  4NXM F;  3HCX A;  1BC6 A;  3BGO P;  4ZK7 M;  5KFF A;  1CJV A;  2B6A A;  3G8Q A;  2VZ9 A;  1Q16 B;  2F1F A;  2E5L J;  1HPZ B;  3T1Y F;  1CJT B;  1TMJ A;  1FVS A;  5KFX A;  3OVB A;  4A8M P;  1KSP A;  4PXE A;  2XY5 A;  2QGF B;  1XMQ F;  5KFT A;  1YIJ S;  3CJR A;  2WSE C;  1UJ4 A;  2QZ8 A;  4YY3 F;  2NPI A;  1TZ0 A;  3PEH A;  5IQ6 A;  4QIV A;  1D9A A;  1RU2 A;  1M5V C;  1RT3 B;  4TU7 A;  2EFP A;  2IMW P;  1T0T V;  2QJ3 A;  2AZ3 A;  5U47 A;  4J9U E;  1VIX A;  5C42 B;  1T05 A;  2QG9 B;  1K0T A;  3HKZ D;  1CS4 B;  4DUZ J;  4JI7 F;  1JXL A;  1KQS R;  2YKM B;  1EJ7 L;  1XIQ A;  2D7S A;  1ICE B;  2I9S A;  3OHB A;  2I38 A;  4JI4 J;  4DSE A;  3IS9 A;  5EDW A;  2MEW A;  2R8G A;  2NRE A;  2OSR A;  4J7C A;  2RVJ A;  2P8I A;  3D0H E;  2DGT A;  5LXY A;  5D77 A;  4C8N A;  2NZ4 A;  3D3C J;  3TEH B;  2Y9H A;  4JOU A;  3DM2 A;  3QT7 A;  4KT0 C;  2VPZ B;  3CW2 C;  3PW0 A;  2AHO B;  5F8G A;  1S79 A;  2R7O A;  1YI2 S;  4OX9 F;  3R27 A;  2D3Z A;  2E9R X;  3UO0 A;  3KHG A;  1UP1 A;  1N6Q B;  1LW2 B;  1RHU B;  1REG X;  3CVK A;  2DXF A;  3NL0 A;  2UZA A;  3ETM A;  2BUN A;  1P27 B;  3G6X A;  2LEB A;  1Z1Z A;  1E6V B;  1HNW F;  1FFW B;  3LAK A;  3VAJ A;  2PI5 A;  1WC4 A;  1TL3 A;  2ZUG A;  3OFH A;  3CCW A;  2RQC A;  2DR7 A;  1N5Y B;  1F1B B;  1FXD A;  3HFZ B;  3THV A;  1TUV A;  4ECV A;  3I0S B;  2HVD A;  2Z2Y B;  1RP5 A;  1H7X A;  4G1I A;  4U6P A;  4LF5 F;  4EBE A;  1EAR A;  5IOL A;  2JDJ A;  3J81 j;  9RUB A;  4L76 A;  4WF9 Q;  5ETL A;  1SKW A;  2MTL A;  4LT6 A;  2UV8 G;  5B0B A;  2X7I A;  3JXO A;  1RB0 A;  2OI2 A;  4JV1 A;  3KDN A;  3P5B P;  1HW8 A;  1FK9 A;  2FZG B;  3RBD A;  2F3J A;  2HKE A;  5KT2 A;  2JEG A;  4NA1 A;  1QAJ A;  2J0Q D;  1B4S A;  1C2P A;  2GCF A;  1TQL A;  2IJF A;  2YKA A;  2LEC A;  4QWD A;  3TVY A;  1FKO B;  4AD6 A;  2HK3 A;  4D3G A;  2MZR A;  1JLC B;  4FDF A;  3DYA B;  3R2D J;  2CPE A;  2DY1 A;  4WFZ A;  2WVE A;  3IR6 B;  1XTZ A;  4OZ5 A;  2F65 A;  1TVR B;  4BWM A;  1U1R A;  4IOC Q;  2H5E A;  3M8S A;  2WCX A;  3C19 A;  2CZ9 A;  4JI3 J;  4TKT A;  3A8J A;  3PYG A;  1SJ4 P;  2FZC B;  4ZPT R;  3HM9 A;  2CDR B;  4LRD A;  2YKN B;  3ELH A;  1RTD A;  1T9U A;  5I3U B;  1FRI A;  3GTY X;  4EEY A;  1AA1 B;  3DOM A;  1JJC B;  2MPU A;  2XB2 D;  2EPI A;  3P96 A;  1M0S A;  1GXL A;  3QIP B;  1SUQ B;  3IRX B;  1UW9 A;  2OPQ B;  3KHR A;  3C46 A;  3FKB A;  2NXC A;  4LRC A;  3RW7 A;  3W64 A;  2W2N P;  5JJB A;  4CLS A;  1X4H A;  2E5L F;  2LCW A;  2MQ8 A;  2XNR A;  1IKW A;  3ZZU A;  4DHV A;  5AE2 A;  1FEE A;  1TL7 B;  3QFW A;  2HEK A;  3FZ2 A;  3HHL A;  4KPC A;  2J6U A;  2XO6 A;  4N7T A;  2W2Q P;  1H73 A;  4DCO B;  2ZWP A;  2IFX A;  2M52 A;  3D0I E;  3VF0 B;  3RGI A;  1R27 B;  2ZBR A;  4H54 A;  3QRR A;  1F60 B;  1HHT P;  1WDD A;  2XYP B;  3JSR A;  2AX0 A;  1FXR A;  3H0P A;  3AJ2 A;  3E01 B;  1SQE A;  4O3O A;  5HVG A;  2HWH A;  4DUZ F;  1RIS A;  4KAI A;  2AT1 B;  4F25 A;  1VC6 A;  1HWL A;  3H4D A;  3CB4 A;  2MZT A;  2MKH A;  4OI6 A;  2A2D A;  2DVI A;  1QM9 A;  4JI4 F;  3ENV A;  2JVO A;  3R5C A;  2NYH A;  2RQM A;  3AB4 B;  3SCI E;  1L3S A;  3T41 A;  4BHQ A;  3C14 B;  4IQM A;  2KRB A;  1MU2 B;  1S48 A;  1XER A;  2QN6 B;  3H7H B;  2GML A;  2PC6 A;  4RX6 A;  5KFI A;  5A0Y B;  3PHT A;  2PEH A;  1Q7Y T;  5A6P A;  1X4C A;  4CLU A;  1NU4 A;  2RDD A;  4ZLJ A;  1HYS B;  3NOG A;  1MWQ A;  5J2Q A;  2VFS A;  3D5M A;  4K5R A;  3L09 A;  5ETQ A;  4YR3 A;  2FUG 9;  4HH0 A;  1SKS A;  4RR5 A;  1RJJ A;  4ZVO B;  2CAD A;  2XCA A;  4KHP F;  5IT9 Y;  1V6H A;  2HQ3 A;  4MIB A;  2CQ0 A;  4DF4 A;  4AE5 A;  4QYR A;  3O2I A;  5K8P A;  2XGQ A;  1K1Q A;  3RTV A;  5T41 A;  4DSJ A;  4DMZ A;  3HDS A;  2DNZ A;  1D0E A;  2ILY A;  2DHA A;  3U27 A;  4UZB A;  2YPY A;  3OL8 A;  2GC8 A;  3BRE A;  4IYQ A;  1RLD A;  3CCL S;  4O23 A;  3GFX A;  2D74 B;  2QMW A;  1KTQ A;  3RB6 A;  3IO1 A;  4CO2 A;  5K20 B;  2D41 A;  3J81 U;  3NNA A;  2AJF E;  3PJW A;  4QR1 A;  3T5H A;  1BWE A;  1IKV A;  1FRK A;  2HFS A;  2Q43 A;  2EBE A;  4I68 A;  2AEJ A;  2FLO A;  2E7X A;  3B54 A;  1Q4R A;  3SV4 A;  2CQG A;  1RT6 B;  2YKP A;  1HHQ A;  1MNE A;  4K4W A;  1KWM A;  3UWT A;  1UET A;  4C6A A;  2FLN A;  2FJX A;  3EDR B;  2ASD A;  1U0H A;  4U9R A;  2KG0 A;  3N6M A;  2PSZ A;  1CQM A;  2LFV A;  3HZE A;  2VFR A;  3DLG A;  3FCH A;  1TV6 B;  3N4W A;  1W2B R;  4ZA1 A;  3UE2 A;  5BXI A;  1G7C B;  5D0E A;  2ZIT A;  1HNZ J;  2OEL A;  3F0N A;  1NRK A;  1FNO A;  1KLN A;  1U1P A;  2C2N A;  2ZH1 A;  1B0T A;  2QLF B;  4ZVQ B;  5DDP C;  2I8E A;  4ZCM A;  3EYZ A;  5KFU A;  2HK2 A;  3BBC A;  1JQG A;  2IA6 A;  3MM6 B;  3RR8 A;  1LWF A;  3DNC A;  4KQZ A;  3TAM B;  4WU2 A;  3VVT A;  2MST A;  2HAI A;  4NLY A;  2XQC A;  3Q2T C;  3J7Y U;  1P8G A;  4LIR A;  3R1H A;  4OYX A;  1UFL A;  3I9V 9;  2DNG A;  2NXU A;  3H2V E;  3RBZ A;  2G0C A;  2UXC F;  2R7R A;  5DM7 Q;  1RKJ A;  4I0W A;  1HBU A;  3GR0 A;  2RJZ A;  3MR5 A;  4LQ3 A;  4ZLL A;  2R2T A;  3MEC B;  7FD1 A;  2DGQ A;  1NSP A;  4KJI A;  1BXN A;  1YJ7 A;  4C11 A;  4WKR A;  3IFE A;  4P2M A;  4ES3 A;  1HQU A;  4ANE A;  2UVU A;  1SH2 A;  3S01 A;  3CJ5 A;  2DR5 A;  4RKU C;  5DQI A;  2B3T B;  2DBB A;  5DLG A;  3JTO A;  2ZH5 A;  1FD2 A;  1YWX A;  4PXC A;  2HRU A;  3OHA A;  5KOW A;  5HMX A;  2HBR B;  4QIF A;  5A8W A;  2ZOF A;  3DRP A;  8RUC A;  3K58 A;  2VG6 A;  2HRT A;  4DXL A;  3SFU A;  2CFX A;  2RSQ A;  1VBX A;  2AWZ A;  4FYV B;  4X65 J;  2G9O A;  3VAI A;  2PFF B;  3PDN A;  2DIT A;  1EKR A;  1TKX B;  2ACY A;  1VR6 A;  2GVZ A;  4CNY A;  4XDC A;  1U2F A;  3W2W B;  4LF6 J;  5KG5 A;  1NH7 A;  4JB8 B;  2C3U A;  1FEH A;  4HI2 A;  2WB1 D;  3QAU A;  2I1R A;  4IG0 B;  1ZM9 A;  4MTP A;  1J5E J;  2I6W A;  4WWS A;  2HNY A;  2IM3 A;  4R5P B;  1UA1 A;  3KNA A;  3WX8 A;  3UCG A;  1RTI A;  3OUY A;  4M94 A;  1KVJ A;  3OSP A;  2G1H A;  4JUZ A;  4G1Q A;  5CAB A;  2K3K A;  2B7C B;  3H5Y A;  4ED1 A;  1C0T B;  3ZZP A;  2DB1 A;  2LU2 A;  3C8Y A;  4QIW D;  4HLB A;  1EIY B;  1YJU A;  2ZJP Q;  2XS7 A;  3KXD A;  3Q8V A;  1KLM A;  3MUV P;  4HTI A;  4Y28 C;  2ZZN A;  2VKZ G;  2VD3 A;  1U4B A;  4OHW A;  2LQJ A;  2VON A;  1S1U B;  4DR4 F;  2HWT A;  1T9V A;  2RKI A;  4K0K F;  5HAO A;  1HWU A;  1PAE X;  3BBF A;  3MPD A;  1D8Y A;  2N82 B;  2AIR B;  3EGW B;  3HI9 A;  4A8Q A;  1TL1 B;  4ECQ A;  3KK1 A;  1G6B A;  2GHV C;  4MIA A;  3G82 B;  1RHM B;  2XS2 A;  1SQF A;  3CIM A;  1U45 A;  5HQL A;  4IG3 B;  1A0O B;  1UPP A;  1X9W A;  1PBU A;  8ATC B;  3OW2 R;  4GVL A;  1TUW A;  3BYR A;  2HZC A;  4H4O B;  3RB0 A;  2ZHB A;  6AT1 B;  1QAX A;  1SXL A;  3UW1 A;  4QPT A;  4WTY A;  3TO8 A;  1Y3K A;  1TKD A;  1R8B A;  4I6Y A;  1WKJ A;  2Z2M A;  2BE9 B;  1LKZ A;  4ETZ A;  2LVW A;  2RDJ A;  1MMD A;  2O1P A;  3F44 A;  2ZOG A;  1TU0 B;  4LF9 J;  1TKT B;  3AD7 C;  3OR1 B;  4TY8 A;  3B4M A;  3DKD A;  3HMJ G;  1RDR A;  1JKH B;  3M4X A;  3DLL Q;  2RF2 A;  3MFH A;  5AE3 A;  3N5B A;  3EE3 A;  1FVQ A;  2LQ8 A;  1AFJ A;  1QE1 A;  1KTV A;  1JLA B;  4O4G A;  3WC2 A;  3LAM A;  3CCV S;  1H72 C;  2F9D A;  2B8P A;  2AF6 A;  2CYY A;  1YRU A;  3R5B A;  2RQK A;  1NJW A;  4DSK A;  1N33 F;  3NWR A;  4QCL A;  4RNF A;  4KGV B;  2DNR A;  3NLC A;  1FDD A;  3MD1 A;  2FC8 A;  2OPR A;  3IM9 A;  2NSC A;  1QAI A;  3POT A;  2VC0 A;  1S12 A;  3H98 A;  1ZA2 B;  1SC3 B;  1LXJ A;  3BYP A;  4URS A;  3FBB A;  2QT7 A;  2VPY B;  2LXI A;  1ZAW A;  3S8S A;  4WII A;  1EHW A;  5DRK A;  4OQJ A;  1RHK B;  4J9O A;  3PKM A;  4CO5 A;  3MM7 B;  5LMU J;  4O3P A;  1S1V B;  1XC9 A;  1FFS B;  1I5O B;  2E5H A;  2DIU A;  4DN0 A;  2KRR A;  4IDK B;  4QWC A;  4Y0F A;  4B9S A;  3UCZ P;  3MXH P;  3VR1 A;  2YNI B;  1KNZ A;  2LQ5 A;  3OV7 A;  2GHW A;  4PR6 A;  1WDT A;  3GCX P;  4HHU A;  4Y2M A;  4OZ3 A;  3EM1 A;  2XMT A;  1DAX A;  1U25 A;  2AJ4 A;  3I82 A;  4LF8 F;  2C2K B;  2E1C A;  4O3S A;  4Y6I A;  1M5K C;  3BH6 B;  2X1A A;  2AGO A;  2OFH X;  4TVA B;  3NNC A;  3BV8 A;  2O66 A;  4BLG A;  4LF6 F;  2CQB A;  3EGN A;  1S1X A;  3R5G A;  4XPE A;  2ZEJ A;  2NYI A;  1FRM A;  1N5T A;  2XMM A;  3DRX A;  1KN6 A;  1IKX A;  1CJT A;  2DNP A;  4DEZ A;  1J5E F;  2V4J B;  3D0G E;  1LWX A;  2C3O A;  4LR9 A;  4NLG A;  1AW0 A;  4J9R A;  2Q79 A;  1VDH A;  1V5V A;  1VJW A;  4DV0 J;  2V8G A;  5KFG A;  4NLT A;  1N0U A;  2V50 A;  9ATC B;  2CXE A;  4NLS A;  4KB7 A;  1D8Z A;  3ZZZ A;  4UT4 A;  1M1K T;  3M7V A;  2HQG A;  4E0D A;  2GIR A;  4RNO A;  3QBC A;  2R7T A;  1CJU A;  3FJ2 A;  3SV3 A;  4F36 A;  2EG1 A;  3UDE A;  4ECY A;  2JL9 A;  3OJS A;  3J7Y I;  4XO0 A;  3DLE B;  3NWG A;  1HNV B;  2W7A A;  5JUM A;  5C42 A;  3W5X A;  4GVB A;  4HHH A;  3QID A;  4X4Q A;  1B70 B;  1OSC A;  4KPY A;  2HFN A;  3KK3 B;  1JLF A;  1TKZ A;  1PYO B;  5HP1 B;  2XHC A;  2D69 A;  1SCJ B;  4UZC A;  3BM7 A;  3NCP A;  1N48 A;  2YWG A;  2IC3 A;  5LJ3 Y;  2VG7 A;  5D4O A;  1YIT S;  1EP4 A;  1DTT B;  1SC6 A;  3GP9 A;  3A8E A;  3HHN B;  3JYT B;  1VGY A;  2CVE A;  2ROE A;  1YBU A;  4RBU A;  2MKY A;  3MF5 A;  3LP0 A;  5KG3 A;  5CZV A;  4KGK A;  3G87 A;  1LQ9 A;  2IBK A;  4UOF A;  2OGU A;  2JEJ A;  1R0C B;  3OTB A;  1HD0 A;  4HI1 A;  2F5G A;  4CLT A;  2XNQ A;  4BC9 A;  3R7B B;  4DZD A;  1VK8 A;  2RD5 C;  1D1U A;  4LF9 F;  4H4K A;  4ZPV R;  2POK A;  2CJQ A;  5KFW A;  5IC4 B;  4L3N A;  7FDR A;  4UOH A;  1U1L A;  4RU2 A;  4ZIW A;  4RW7 A;  4AQY J;  1N5Y A;  3CCR S;  3ZXW A;  3ET6 B;  5FLX Y;  3HT0 A;  3K5N A;  4UW2 A;  1S1T A;  1ROF A;  4V1A k;  1RLC L;  4NCG A;  2F40 A;  1UJ5 A;  3PXG a;  3BR9 A;  1VQO S;  3M2U B;  3EVW A;  2NUH A;  2FJE B;  1NKC A;  4UOC A;  3SQO P;  2KYX A;  3RYL A;  4ANC A;  1JLE A;  2BJ7 A;  5HBM B;  1N5Q A;  4I2Q A;  1OY8 A;  4ZJQ A;  2QA1 A;  1RT2 B;  1X4E A;  2XZW A;  2EK6 A;  3D6M B;  4JI6 J;  4DZ6 A;  2QSW A;  3A8K A;  1BMQ B;  1B64 A;  3PIP Q;  1K8A T;  3DLK A;  3L7U A;  1FKO A;  4Q0B B;  4TU9 A;  2Q6C A;  3JB9 k;  1FCA A;  2VG5 B;  3T1H J;  2V4R A;  3TP2 A;  4B3S J;  2R3V A;  2FHM A;  2DEJ A;  4MKY A;  1YDL A;  3CMQ A;  4ED6 A;  4TQR A;  2RU9 A;  1NHK L;  4CO4 A;  4X4S A;  1R89 A;  3BQ1 A;  2HFU A;  3GV5 B;  2GO8 A;  3ADA C;  1CUL B;  1RKI A;  4YEA A;  3R5D A;  3KTQ A;  1S77 D;  4KV8 A;  3JTN A;  3RUB L;  1HBM B;  1Q0N A;  1X4D A;  1MWY A;  5D4L A;  3TA2 A;  2IVY A;  3QLH B;  1SL2 A;  1RSC A;  4ERD A;  2AGQ A;  4DLE A;  5D3G B;  3QIP A;  1SUQ A;  3QSY B;  4JI0 J;  1AT1 B;  1KC8 T;  2C22 A;  3PW5 A;  3SCK E;  2BYC A;  1VRU B;  1DHM A;  4LVO P;  2B9E A;  2DGO A;  4QIE A;  4ZPW R;  2ZJQ Q;  1E6Y A;  2BW7 A;  4LVN P;  4ALZ A;  2CRL A;  1IVZ A;  1DLO A;  4KR0 B;  3P8B B;  3I4H X;  4XPC A;  4C3K A;  3E2E A;  3L4B C;  4CT9 A;  2BVZ A;  4DV0 F;  1U48 A;  4NYZ A;  4ER8 A;  1S6P B;  1XEZ A;  4TQS A;  5E0O A;  1S6Q A;  4LSN B;  5T7L A;  4O3R A;  4DL3 A;  1YRX A;  2PD1 A;  4OV6 A;  4NE9 C;  2HYI B;  4OX6 A;  3KLE B;  2DGV A;  3MCS A;  1W26 A;  3RRG A;  4WP9 A;  3X1L B;  4R0J A;  1PJ6 A;  1U0S A;  5IM0 B;  3CIZ A;  1EET B;  5H9F J;  2DT9 A;  1FFG B;  2XG8 A;  3FMW A;  5HMY A;  4IR9 A;  1F5C A;  3MMB B;  1IBL J;  1K9M T;  4LF7 F;  4ELU A;  1MU2 A;  1V5I B;  1S9G A;  2CWK A;  5C2G A;  4M5D B;  2M4M A;  2BM1 A;  2G2O A;  1KKH A;  4MYU A;  2MLY A;  5KG0 A;  3C2P A;  2Q3P A;  1LOU A;  1SI9 A;  2BKP A;  1WSR A;  3MM9 A;  3FUY A;  5EWG A;  2FHJ D;  1HLW A;  1RBO B;  2WHO A;  4C97 A;  4ZPB A;  4WBF A;  5DQG A;  4AND A;  6FDR A;  1RTJ B;  1U6Z A;  3BKU A;  5KFV A;  3Q8Y A;  2OPS B;  2OFG X;  4KH0 B;  1M5S A;  2LQB A;  3MGJ A;  1R8H A;  2OJ3 A;  2LLZ A;  2OMO A;  1VQN S;  3VAF A;  2YX4 A;  2PI4 A;  5SUH A;  1IN0 A;  4FYX B;  1QTN B;  5A8K B;  3KUG A;  4IFV A;  3DRS B;  2OD4 A;  4U95 A;  1G4C A;  1PCA A;  4A4J A;  1HQ2 A;  3W2V B;  3SEO A;  1CJV B;  3W1Y C;  1URN A;  3VZI A;  3K5O A;  2HQC A;  4HYK A;  2FTR A;  2B6A B;  5L9X A;  4ATN A;  2DO4 A;  5HRO A;  1TK5 A;  2COL A;  2NSB A;  4P10 A;  3M1V A;  4JI6 F;  4F4W A;  1H2V Z;  3I96 A;  4YB5 A;  1UZH A;  4JI5 J;  4B9V A;  2BQ3 A;  2YH0 A;  5E2Q A;  2BQR A;  2BKO A;  2J6S A;  1GX6 A;  1Y5L B;  3ILL A;  4B3S F;  5FJ4 A;  2QL5 B;  2V6A A;  2L9N A;  4DR1 F;  4CO3 A;  2ZE2 A;  1P9Q C;  2XWY A;  4DQP A;  3DLB A;  2I5J B;  5GMK a;  2V67 A;  3UDL A;  3N28 A;  1Y0H A;  4WFB Q;  2E44 A;  1T05 B;  4RU9 A;  1Q1K A;  3DDK A;  1NDL A;  4DR3 J;  1CBK A;  2HND A;  4M63 A;  1MMN A;  1GEH A;  3TAM A;  3HHK A;  2CJB A;  3J80 U;  4OZ0 A;  3GFZ A;  4QU7 A;  4MMO A;  2Z0G A;  2JSX A;  3VGU A;  1WTF A;  2FQQ B;  5GAD U;  2XLK A;  2XY7 A;  2G2Z A;  2CQP A;  1VHI A;  1Z2L A;  1S0O A;  2SXL A;  3CCZ A;  1T9Y A;  4DV4 J;  1D3W A;  2MQN A;  4FNI A;  4DR6 J;  2EW9 A;  3NGR A;  3UR0 A;  2G1D A;  5H9E J;  2RAQ A;  3DM2 B;  1EX8 A;  2L41 A;  4NZ6 A;  3NBP A;  1FKP A;  2WBM A;  3NS5 A;  3PEJ A;  1PC5 A;  2CDQ A;  1ZM3 A;  1N0V C;  4GKJ F;  4F04 B;  3UNY A;  1WD6 A;  3TUI C;  3F73 A;  5M2P A;  5K9F A;  1GXT A;  4QWB A;  4YFU A;  3DGP B;  4UF4 A;  1F3V A;  1M5H A;  4GO5 X;  1TL3 B;  4YHH J;  1Y5I B;  5F8L A;  2ADB A;  3CCQ S;  4LF4 J;  2IIH A;  4ELT A;  1W7W A;  4TLQ A;  1N34 J;  2J7W A;  3HX9 A;  2LU1 A;  4KYZ A;  4AXI A;  3UNG C;  1SL0 A;  2KM8 B;  1TKX A;  2DHG A;  4I56 A;  3M8Z A;  4KBI A;  2AD9 A;  3RR7 A;  4K2J A;  2XYH B;  1C1B A;  1VQK S;  2CUY A;  1IWG A;  1NJX A;  2P6S A;  3MUM P;  2IY5 B;  1VK3 A;  2BRK A;  1JXE A;  1CQN A;  4IUF A;  2U2F A;  2KHC A;  2UUC J;  4B9M A;  1IBL F;  2J5A A;  3SIP B;  1VS3 A;  4LUB A;  4LSZ B;  4O0I A;  2N4C A;  1RYS A;  3RRK A;  2IJR A;  4ECS A;  4OYZ A;  3VWS A;  1ZM2 A;  1RU1 A;  2HPU A;  2MLZ A;  4QIG A;  3NP5 A;  3AD8 C;  1H0H B;  8AT1 B;  3PIO Q;  2LMI A;  2IDL A;  2JFD A;  5DET A;  1YVF A;  3Q8P B;  1WHY A;  1KD1 T;  3UN2 A;  1GMW A;  5F41 A;  1EB0 A;  3W62 A;  4ZVT B;  2H4W B;  4A8Y A;  3PR4 A;  2HG4 A;  1FWK A;  3QT6 A;  2MQL A;  4DWI A;  3I0R A;  4NA2 A;  2BEF A;  3SCL E;  4ECR A;  2FVC A;  4AYB D;  1LNQ A;  3MPV A;  3CD6 S;  1RTD B;  5T14 A;  5K14 A;  3DOM B;  4WYW A;  4OHV A;  1WHX A;  4K4Y A;  4OYB A;  2N7Y A;  1NLK L;  4P9S A;  4ZJO A;  2DIS A;  2ZDP A;  4CNZ A;  3TZW A;  5ETV A;  2RT3 A;  4C0O C;  3OTO F;  4OI3 A;  4CH7 A;  1NB7 A;  3FBC A;  3HSD A;  1W25 A;  5KFQ A;  3FBE A;  1IKW B;  2M70 A;  3DFE A;  1NBE B;  1ZAV A;  3BSO A;  3Q22 A;  4ED2 A;  5DZ7 A;  4JI5 F;  1ZAX A;  4UUW A;  2YWW A;  4A46 A;  2P9E A;  1UTA A;  2RHQ B;  3P45 B;  5BJR A;  2FJV A;  4H4M A;  1DY3 A;  4NX9 A;  2MKK A;  2WVC A;  5JMN A;  2YQ3 A;  2L9D A;  4FXD A;  1N5V A;  4OZ1 A;  5HK4 A;  4RWW A;  4YR2 A;  4WU3 A;  1AYE A;  3RB4 A;  3GJS B;  4F4K A;  4ID8 A;  4DR3 F;  1NXI A;  2CPI A;  4MKB A;  3JSY A;  1RWK B;  3C6U A;  1RWU A;  1MW7 A;  2WZ1 A;  1NO8 A;  4K59 A;  2A3J A;  4OJ1 A;  1MLA A;  1RUS A;  5GVQ A;  1FJ7 A;  1RZM A;  1W2I A;  4RUC A;  3HK2 A;  4PPD A;  1UPM B;  4DR6 F;  3J7A 1;  2KHD A;  1RTH A;  1X0F A;  1WHW A;  1ZBT A;  2PO4 A;  5HVH A;  4UY8 5;  2QTW A;  3CJ8 A;  3M9N B;  5GAE U;  2HHT A;  2B4U A;  4U7C A;  2RE1 A;  4WIQ A;  3FCV A;  2M8H A;  2C2R A;  2WK4 A;  4MJK A;  5J2Q B;  3ILO A;  2FJA B;  4HHJ A;  2WOM A;  4F3O A;  5ETM A;  4WJB A;  3SCJ E;  1HA1 A;  4IDK A;  4LFB J;  3R5A A;  1U47 A;  3TUZ C;  4RUB A;  3THP A;  5EX3 A;  3SSQ A;  4ECU A;  2CZV C;  1YBT A;  4HR2 A;  2BZ2 A;  5E33 A;  1YGY A;  4URG A;  1N34 F;  4Y2C A;  1KOO A;  4U8Y A;  4K4V A;  1QSS A;  2ROP A;  3OJU A;  3CCE S;  4R8U A;  1RXO B;  1U7L A;  2QL7 B;  3WZ0 A;  2HQF A;  4EYH B;  2AJ2 A;  3QT5 A;  1BQM A;  4USV A;  3ZO7 A;  1YHQ S;  1J5O A;  3D4J A;  3C6T A;  5J2M A;  4X84 A;  4ZP6 A;  2ZBP A;  2HLT A;  4ES1 A;  3LP1 A;  5DJB A;  1IKV B;  1S59 A;  4CIO A;  1XQI A;  1IQZ A;  1NDC A;  1SKR A;  4KGM A;  4LRB A;  4KTQ A;  3BO3 A;  2W8L A;  3QO9 A;  2AZ1 A;  2M2B A;  2Y0S D;  3FCW A;  2JOQ A;  2BAC A;  4PRF A;  1U0H B;  2HNZ A;  4M95 A;  4HDG A;  3U1L A;  1KOH A;  5FDL A;  3LOU A;  5F8I A;  2ZNY A;  3I31 A;  4FF1 A;  2H54 B;  3DLG B;  3JTP A;  3PRD A;  2PE8 A;  3FEX B;  3GLJ A;  1U49 A;  3MDF A;  4ZDN A;  3DLE A;  3IBF B;  2YKQ A;  2GGP A;  2VU5 A;  4WPA A;  2BOP A;  4A8S A;  2QEX S;  2JX2 A;  2CJX B;  4NI2 A;  4B3M F;  3ISN C;  2J76 E;  3AJD A;  2PEB A;  1AFI A;  1KHV A;  2M5Y A;  3M9O B;  4OHY A;  3H2L A;  1LWF B;  2ILZ A;  1Z2Z A;  5EHH A;  1S99 A;  2CPF A;  1NK9 A;  3D67 A;  1OY6 A;  3G9C A;  3JAM U;  3MM8 B;  2GJ2 A;  2LKZ A;  2AYE A;  4WFY A;  2G0I A;  4USM A;  2C42 A;  2UXD J;  3CMA S;  5KTQ A;  1ZTT A;  1HBU B;  3V4M A;  3DN9 A;  4HT7 A;  1XR7 A;  2KT5 A;  1SIZ A;  3R1L A;  4C11 B;  3FSI A;  3TAQ A;  3V81 A;  5KFZ A;  4OJG A;  4CLL A;  1HQU B;  3HD1 A;  3SZ2 A;  4OIX A;  3N79 A;  5MLC V;  4FPR A;  2IRY A;  4YB1 P;  3MR3 A;  2Q6B A;  3ENW A;  3BGR B;  1H7W A;  4YUD A;  3PCO B;  5EWE A;  2PGC A;  5KFY A;  3DRP B;  1JWW A;  3IR5 B;  4ED7 A;  3DDN A;  3ET6 A;  2VG6 B;  4NMX A;  3BF4 A;  1H6K X;  4OYA A;  3NOC A;  5CA5 A;  1ZA1 B;  4G65 A;  5IT9 U;  2XMW A;  3M2R B;  5RUB A;  2BE2 A;  4BS2 A;  1WG4 A;  4DSL A;  2MKI A;  5K5M A;  2KM8 C;  2KXN B;  2H9Z A;  1RAH B;  2YXL A;  2GVZ B;  3ZTO A;  1VLY A;  3GPA A;  4K5S A;  2DR6 A;  3H42 A;  4ZPD A;  1RYR A;  3TA0 A;  3UDV A;  4IR1 A;  3NCR A;  3VV2 B;  4PXB A;  4ZP7 A;  2ASL A;  1D09 B;  1S10 A;  2V8D A;  3GON A;  4DPW A;  5DGA A;  2ZC3 A;  3T1Y J;  3I87 A;  2JHE A;  3ENQ A;  2HNY B;  1GXU A;  2HHX A;  2CQ3 A;  2LXU A;  4QW8 A;  1LW0 A;  3QSI A;  3KMQ A;  3DLJ A;  4NA3 A;  1Q95 G;  4MYT A;  4B17 A;  1RTI B;  1GT8 A;  3OUY B;  1WAC A;  3JQK A;  4NRU A;  1PO6 A;  1O6X A;  3J7Z 5;  4LFB F;  1NSA A;  4ID5 B;  4Q2M A;  3FRY A;  3GJR B;  1APS A;  4PG6 A;  4DPU A;  4JI1 J;  1VCT A;  5E3P A;  5F8M A;  2KVQ E;  1HBM A;  4D3H A;  5C25 A;  5AXM A;  3LTO A;  4JI7 J;  2JVR A;  2ZUA A;  1T3O A;  2RKI B;  5F0U A;  3H25 A;  3B8H A;  2VF3 A;  2A18 A;  5F8N A;  3G86 A;  2HVH A;  3KK1 B;  4DCJ B;  3D1H A;  2YNH A;  3BPS P;  3DU5 A;  1HMV A;  3BSN A;  1KQK A;  2ASJ A;  4M5K A;  4CLY A;  2DRA A;  4DSF A;  4OZ2 A;  5SZT A;  1VQ7 S;  3R6G B;  2BJ8 A;  4EUV A;  5HJX A;  1UFW A;  1NUE A;  2HAF A;  1A7G E;  1G1X A;  2PA3 A;  1U8W A;  3AA9 A;  1IR2 A;  3CTR A;  3V2U C;  3SYZ A;  3DOL A;  1KRP A;  4ECZ A;  5KG6 A;  2GIQ A;  3W9H A;  2VFT A;  3CC2 S;  3HHL D;  5KAK A;  4CLK A;  1FX4 A;  4BCA A;  4TY8 B;  2CAJ A;  2BJ1 A;  3NGK A;  2KFZ A;  2W4C A;  2RF2 B;  5CYJ A;  3LPE A;  4C0B A;  5DS7 A;  4JBC A;  2MHE A;  2VBX A;  1AZS A;  1RBA A;  3BR8 A;  3F41 A;  4X64 J;  1I1G A;  2DNO A;  4OYM A;  4O4G B;  3W8P A;  3GFH A;  5DG7 A;  3CD7 A;  3D6F B;  1YJV A;  3P4U B;  2IHR 1;  5IM0 A;  4EMD A;  3GYN A;  2J7K A;  2AMC B;  1GTH A;  4C0H A;  5HI7 A;  4RJV A;  3UD4 P;  1HBO A;  3E8O A;  3BGU A;  2OPR B;  2C2E A;  1RE1 B;  2UP1 A;  1QUP A;  5LMN F;  3POT B;  4TNO A;  2UXD F;  3WBZ A;  3QZ8 A;  4ZJL A;  5A2Q U;  3DLH A;  2F4V F;  3J7A N;  2H3E B;  2M9K A;  3W9I A;  4B02 A;  2VDI A;  4RW9 A;  3K59 A;  1GNK A;  1QVG R;  4DPX A;  1Q81 T;  1QUV A;  3TRG A;  4CLF A;  3M05 A;  3NGU A;  2XSJ B;  5F9L A;  2B8Q A;  1Y00 A;  3I56 S;  5GME A;  3NMR A;  1JNR B;  2OPS A;  1VMB A;  5CXT A;  5AXK A;  2RNE A;  2KG1 A;  4KRW A;  4F3M A;  2N3L A;  3OL9 A;  1HQE A;  2OLW A;  4CLW A;  2BV3 A;  1MML A;  1RBL A;  1NPK A;  2V9K A;  1RAO A;  1F9H A;  3RW6 A;  1NND A;  1YBA A;  1AUD A;  5B0A A;  2HHU A;  1YX2 A;  1YZ6 A;  2HLU A;  5A8K A;  4P6Q A;  1QJH A;  1U02 A;  3VCD A;  3D2W A;  3MCO A;  1X7V A;  2MMY A;  2KL8 A;  5IV3 A;  4L3K A;  1SJ1 A;  4NPO A;  4IO1 A;  4I64 A;  1S1X B;  1VOM A;  2HMI A;  2B5J A;  3GCW P;  2ZHA A;  2H4Y B;  3FVY A;  3EWG A;  3G6E S;  3ZZY A;  2ASY A;  1IKX B;  4ZHR A;  2Y1R I;  2JWN A;  4CQ1 A;  4P72 A;  3GFY A;  1JLQ A;  4ZS6 A;  1V9O A;  5J2N B;  2W9C A;  3FFI B;  1SJR A;  5KFO A;  2ERR A;  1NKB A;  2HIQ A;  2DCL A;  3CUN A;  5BYQ A;  3MWB A;  1HNX J;  4PWU A;  1PYS B;  4XDD A;  2FYX A;  1HWK A;  2FC9 A;  3EZU A;  3HFK A;  3HVT A;  2BAB A;  2ZM6 F;  4IRD A;  4CT8 A;  3DXB A;  3G6V A;  5KOX A;  2I5J A;  1FJE B;  3QGH A;  4KHM A;  3CNQ P;  1CJU B;  2DPJ A;  4TU8 A;  3QQC D;  1HAR A;  4EYI B;  2Z57 B;  3LAN A;  2DNK A;  4JI1 F;  2JZ5 A;  3RBE A;  4IQX A;  4MFB B;  4GVB B;  4OZN A;  1S1W A;  4ICL A;  2E7V A;  1T11 A;  5H9F K;  1JLF B;  1TKZ B;  2Y1I A;  4X2B A;  4DV1 J;  1L3V A;  2CG4 A;  1FER A;  1PIL A;  4AFF A;  4DX6 A;  5H1S V;  2IC3 B;  2VG7 B;  5L38 A;  1VQY A;  3L95 X;  1XR5 A;  4AUK A;  1U8S A;  2HHP A;  4MIW A;  1A6L A;  1EP4 B;  2HS4 A;  5EWF A;  3C16 A;  5AT1 B;  1SVD A;  3CDB A;  2B9X A;  3OBI A;  5I3P A;  3MED A;  3LP0 B;  4FNH A;  5KFA A;  5DQH A;  4CI0 B;  4L75 A;  4UUX A;  2XLJ A;  3QGG A;  3Q8R B;  2QIF A;  1IM6 A;  2VDH A;  2XBP A;  1UVK A;  2KVI A;  3M30 B;  2L3M A;  2V68 A;  4OX7 A;  3GU0 A;  2P5V A;  5EX0 A;  1YTY A;  4IOA Q;  1S72 S;  2JC1 A;  1VIO A;  4Q45 A;  3H90 A;  4KHP J;  1WC0 A;  1XNQ J;  4OJ3 A;  2F7V A;  2B4V A;  3DGP A;  3D66 A;  7AT1 B;  5G4D A;  4Q43 A;  4WE1 B;  2L08 A;  4RW7 B;  4EI2 A;  4X64 F;  1IM4 A;  4KKO B;  2EFV A;  2LYV A;  3LO3 A;  4F7V A;  5EUH A;  4PKD B;  4X66 F;  4NLW A;  1S1T B;  4N41 A;  2WSF C;  4UST A;  1ZPW X;  5IZH A;  1M5P C;  4NCG B;  2ZBC A;  1Y5N B;  2DNM A;  3VQS A;  3MMC A;  2KXF A;  2X3G A;  3EPG A;  3MFI A;  4YN3 B;  5KFN A;  2ZD1 A;  1HI0 P;  3EZ5 A;  4TXS A;  1T8E A;  1JLE B;  1VQ9 S;  1QD1 A;  3WX4 A;  4I2Q B;  4LQ9 A;  2MQP A;  2DR9 A;  1F2G A;  3KLI A;  3KDO A;  3MUT P;  1RT1 A;  5ETK A;  3M8Y A;  2Y1L B;  4EBC A;  4NLP A;  1TR0 A;  3DLK B;  4PWD A;  4Q2L A;  5EGY A;  3ZC4 A;  2B9Y A;  3AFG A;  3BDP A;  4DV5 F;  2GJI A;  3EX7 B;  1HBN A;  4ZVF A;  3DOK A;  3AAW B;  1UVM A;  3PV8 A;  4IKA A;  4NYP A;  3OL7 A;  3TI0 A;  1I94 F;  3H59 A;  3ZTP A;  4WCE Q;  4KV8 B;  3UI3 A;  2W2O P;  4LF2 A;  4S0M A;  2YNF B;  3IWX A;  2LEA A;  2Z58 B;  5CCL A;  3T6J A;  4RNN A;  4FZV A;  2WVB A;  1VQ4 S;  2VHG A;  2Y1J A;  2HHQ A;  3X3U A;  2VL1 A;  4YB7 A;  4OI0 A;  2FVS A;  3FBF A;  4ITS A;  4RUA A;  3T6B A;  3VAL A;  2NXE A;  2UXC J;  3C3L A;  1S4F A;  1MG7 A;  3QYY A;  2NS1 B;  3CME S;  5H9E K;  2FY8 A;  3I5B A;  4LFA J;  1E6Y B;  1CSJ A;  5J1N A;  3CCJ S;  3ICL A;  2ZNZ A;  4A47 A;  3R9L A;  1DLO B;  4DX5 A;  3Q89 A;  2IYI A;  1PYT A;  4IH6 A;  5I42 A;  3MAA B;  1N88 A;  4QWA A;  5CH7 B;  1PSD A;  4ED3 A;  3TWZ A;  1NHU A;  1WC6 A;  1HNX F;  5LOQ A;  3Q2S C;  4FXV A;  2IAJ A;  3CED A;  1AB8 A;  3RRH A;  4DOZ A;  4KGX B;  1S6Q B;  1RWX B;  4IRK A;  1TK0 A;  4UQT A;  3K0J A;  3IGN A;  2J8S A;  5T7L B;  5E3C A;  4L74 A;  4USW A;  4A8X A;  2PA8 D;  4C98 A;  1X4A A;  3UFC X;  2HVE A;  2DGW A;  3TVK A;  3TQE A;  2KI2 A;  4OX8 A;  4PQU B;  2HQD A;  5LL6 d;  4DV1 F;  5L46 A;  2KDO A;  3P3D A;  3DMJ A;  5J1E A;  3H8Y A;  4M5L A;  4F2S A;  3OFF A;  4Q8E A;  2P9C A;  4FS1 A;  2M0G B;  5FLX U;  1IWA A;  4DJB A;  1C0U A;  2VC1 A;  4DL7 A;  4IH7 A;  2DHS A;  3WQP A;  2FD2 A;  4PZV A;  1S9G B;  5B0E A;  4DQQ A;  4NYO A;  4RO0 A;  3EDQ B;  1R0A A;  4ZVH A;  1R31 A;  2VQF F;  3G8S A;  3MPU B;  1T95 A;  3UQS A;  1RCO B;  4C2M A;  1N36 F;  3MM9 B;  2V8H A;  4BWJ A;  3OVA A;  1NK5 A;  4NWB A;  5CZX A;  3P49 B;  2Q66 A;  5JXS A;  2JJ4 D;  1O8B A;  1GFW B;  4F2R A;  1XNQ F;  2H48 B;  4ED0 A;  1P6T A;  2G0J A;  4GC7 A;  3AOA A;  3MEK A;  5L8R C;  1CC8 A;  1UAW A;  3V6J A;  3KLH A;  2BOA A;  4DR4 J;  1ZPV A;  3M2V B;  5CD4 H;  1WG1 A;  4DPO A;  4K0K J;  1FRX A;  5L9N A;  3DHW C;  3IG1 B;  3F56 A;  3ZZR A;  2FZK B;  4IFV B;  2HFO A;  3ITH B;  1RTZ A;  2BE7 D;  2CQI A;  2QLJ B;  1WI8 A;  2R7X A;  1ZM4 A;  2YQ1 A;  4FKX A;  4FKY A;  2UVV A;  1R3N A;  4BBY A;  1WF0 A;  5E3A A;  4RBV A;  5D15 A;  3I55 S;  1P1T A;  5E5N A;  3DHX A;  5HRO B;  4LR7 A;  2DH7 A;  1TMM A;  1HKA A;  3M1V B;  3RJM B;  2W9B A;  2IBO A;  1JLG A;  1BQN B;  1URR A;  5GAH U;  3DRR A;  1FE4 A;  4NCA A;  3IP0 A;  1KR4 A;  4A48 A;  1SH0 A;  3FNN A;  3IXQ A;  4JI8 F;  3T5J A;  3V6K A;  4MT1 A;  2IJN A;  3CCM S;  3MR7 A;  4CRJ A;  1FRH A;  2ZE2 B;  4ZOS A;  2OUG A;  2CNK B;  5E7O B;  5F9N A;  3NS6 A;  2Y3Y A;  3BB5 A;  4NOH A;  3N6N A;  1HW9 A;  4CP5 A;  1HD1 A;  2K06 A;  1KQF B;  4CYU A;  2C2D A;  4O3N A;  4I1T A;  2UXB F;  2C3M A;  3BPD A;  2VA2 A;  2QRR A;  1H74 A;  3K5P A;  2HND B;  5C24 A;  2VUG A;  1N33 J;  1FRJ A;  1FDB A;  3IWL A;  3BH7 B;  3I32 A;  4KFB B;  5DGB A;  1NJI T;  5ADZ A;  5J2P A;  4LIW A;  1VQL S;  4N47 A;  3CJ3 A;  3MM8 A;  3FMB A;  2D9O A;  2VV5 A;  3D3B J;  1Q5Y A;  3N5F A;  1VI7 A;  4LFA F;  5THW A;  1UW4 A;  2VPX B;  2RRA A;  1F2H A;  4M5H A;  4OFZ A;  4QWE A;  2D3O 1;  2VA3 A;  1FDA A;  3PJ9 A;  2R2S A;  1WOO A;  4RW8 A;  3W60 A;  2BJ3 A;  3KJV A;  4DDF A;  3NBP B;  1FKP B;  2M88 A;  2GJF A;  3BGF A;  4JI2 F;  2K3I A;  3KG1 A;  2H5I B;  2FJB B;  3QWU A;  4I7F A;  2WON A;  3FRZ A;  3TEG A;  1IBM F;  3ZNU A;  4YOE A;  4EFA C;  3MUR P;  4M1K A;  4CDI A;  2F8H A;  3EJM A;  1XK8 A;  2JEI A;  3CJQ A;  3BGR A;  3HSG A;  4H4K C;  2W8K A;  2YNG B;  2RRB A;  1N56 A;  4I2P A;  3PW4 A;  4IFY A;  3R6L B;  2WBR A;  3BBB A;  1SL1 A;  4FBU A;  2E1R A;  3HKW A;  1NSK L;  1F9F A;  3WC0 A;  4DU7 A;  3IR7 B;  3M2R A;  3EVM A;  4LF8 J;  1MN7 A;  3S1T A;  1AUS L;  2PMZ D;  4P75 A;  3GYG A;  1SJF A;  2B9W A;  2JLG A;  1K0V A;  1C1B B;  3IAM 9;  2GAG C;  5KT6 A;  1ZZF A;  3QWP A;  3DC2 A;  1SB6 A;  5IFM A;  1C4A A;  1HI1 A;  4LR8 A;  5KFE A;  5EN1 A;  3OXG A;  3V4I A;  4C8L A;  4JYA F;  4ZIV A;  1YJT A;  1JMT A;  2AJQ A;  1SH3 A;  2MLX A;  2AYM A;  2OPP B;  3GIJ A;  3A3P B;  2BJD A;  2EBG A;  3M32 A;  4DUT A;  2NCK L;  4OZL A;  1NDK A;  2QLB B;  3VZH A;  2G2Y A;  5IC6 B;  4ZCL A;  2W4D A;  3FEY B;  4ID5 A;  2XTJ P;  2KT2 A;  3SFG A;  1T03 B;  1X5T A;  2AW0 A;  2GA7 A;  3ZZ0 A;  3EVO A;  1S0M A;  3I0R B;  2E7W A;  5KFR A;  1VC0 A;  3MHY A;  2VFV A;  2XMA A;  2B4P A;  3WIV A;  4EWT A;  5HVF A;  3HLU A;  4KY3 A;  5KFC A;  4GO7 X;  3LP2 A;  3Q24 A;  1VFJ A;  2BKN A;  3CO9 A;  3QJL A;  2ACM A;  3V5R A;  4KO0 A;  2VOP A;  1X9S A;  1UZD A;  1CG2 A;  4OHZ A;  1JIH A;  4YME A;  5K14 B;  3ZFV A;  1RHR B;  2V94 A;  4USU A;  1S9E A;  4G1P A;  2IDE A;  1HR0 F;  3VQT A;  1WC3 A;  2RU3 A;  3OLA A;  4QR0 A;  2R7V A;  3R3T A;  1EAY C;  2ZH2 A;  4JV0 A;  2RUS A;  3OL6 A;  3TX0 A;  3PRV A;  3PNI A;  1CVJ A;  3KG4 A;  1I51 B;  2VPW B;  3GIL A;  4O44 A;  1RQ0 A;  4I69 A;  5D8H B;  1C1C A;  4DBQ A; 
#chains in the Genus database with same CATH homology
 2P8I A;  2PEB A;  2NYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...