1M0SA

Northeast structural genomics consortium (nesg id ir21)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21
rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
molecule keywords Ribose-5-Phosphate Isomerase A
total genus 72
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m0sA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m0sA01
3OFEA 3O1LA 5T41A 1FS6A 3DHXA 3OBIA 2P9EA 5HJ5A 1Y89A 2LQJA 2RQMA 4GO7X 2QMWA 3KWMA 3BXHA 3CEDA 2QSWA 2PC6A 1CD5A 1FSFA 3ICOA 2J0EA 4OQQA 2LVWA 3EFBA 1FS5A 2DT9A 1U8SA 2RE1A 3NZEA 1FRZA 2F1FA 3E7FA 3E15A 1PSDA 2FGCA 3DC2A 3ENVA 2KO1A 1DEAA 3IXQA 4M8LA 3LHIA 4L4ZA 2QMXA 1Y7PA 3BXEA 1UJ6A 2OKGA 2I9SA 4TM8A 3DHWC 4GO5X 4L50A 3IBWA 1ZPVA 3TX2A 2J0WA 3AB4B 4OQPA 3EB9A 3UW1A 2DTJA 5IT0A 2RI1A 2WU1A 1KS2A 3K5PA 2J0XA 1HOTA 5JJBA 4GO1A 5IS2A 5IT4A 3LUYA 3BXFA 1O8BA 3CSSA 3AAWB 4R7TA 3L7OA 2BKVA 4PWUA 1UJ4A 1YBAA 1VL1A 1HORA 3BXGA 4L4YA 3MAHA 3OFFA 2ZHOA 3S1TA 3MTJA 3ENQA 3TUZC 1JT9A 4L5JA 4LUBA 4NMLA 4L51A 2H9ZA 4TM7A 2PA3A 1UJ5A 4X84A 3LOUA 1SC6A 3MWBA 4IO1A 2R5FA 3NWPA 2JHEA 2BKXA 3CH7A 1RWUA 2W48A 5FIIA 3N0VA 3HHEA 2O0MA 4R9NA 3TUJC 3TUIC 3OFHA 2P9CA 3LWDA 3P96A 3W7BA 3HN6A 1LK5A 1LKZA 3ENWA 3AB2B 1FQOA 3KV1A 2MDAA 1NE7A 4L5IA 2F8MA 3NRBA 3U7JA 2CDQA 2P9GA 2JOQA 2GNPA 2QRRA 2RI0A 2RQKA 1PBTA 1XTZA 3OC6A 3OFGA 1YGYA 1M0SA 4GMKA 3DDNA 1LK7A 2NYIA
chains in the Genus database with same CATH superfamily
5IDWA 4TU9A 2ZYAA 2E7VA 3B1WA 2DPYA 4RL1A 1U6JA 1USIA 2JGNA 4F4WA 3L8GA 2F55A 3WOVA 1U7XA 3ADCA 4NBSA 4WKNA 1PDOA 3AJAA 4A8YA 2GKGA 1QYDA 3AR4A 2GEJA 3FSIA 2O7QA 2VDWA 1BZYA 1LBQA 1U1MA 4IUDS 3DOKA 2J0WA 3W5ZA 4O2LA 4Z99A 3D1LA 5KVQA 2WSYB 3MRTA 2PI4A 3T3MB 2OV8A 1OT3A 3K0AA 1UXIA 4N5LA 1XRRA 1ZZNA 2I7TA 5BOSA 4AJKA 4C6RA 4WASA 2WONA 1QIIA 1OGYA 4X62B 4QYZJ 3QWAA 2MKKA 2QX7A 3QY9A 3FX2A 5KNDD 4JBGA 2GHWA 3BMOA 1U26A 3MW8A 2GAGC 4CLOB 5FOTA 5DTJA 3HKBA 3ZQ6A 3VBCA 1ECPA 3HKDB 1M10A 4K1LA 5KDOA 1GGMA 2CNKA 1YRYE 5TMEA 2ECQA 3BD8A 5IYZF 5TX7A 5KFOA 3BE6A 1PC4A 4CMJA 2BR4A 2FYTA 5EMJA 2FHJD 1AN0A 4D5EA 4ZQFA 2IT1A 1L5MA 3BKWA 4CG2A 3AM1A 1A2BA 2M3DA 4B4WA 2XMGA 1HZJA 3NV9A 1KARA 2AOUB 1GUZA 1X74A 4JSYA 1EIWA 1I3OA 2VP6A 4TQSA 4O4LB 3H04A 2YVKA 4LJ7A 3HXMA 1CS4C 3DHWC 5E3PA 2EYQA 5FOSA 4FGUA 1Z34A 3ZLJA 2GBFA 4IDAA 3QKWA 1FP6A 2PRKA 3MD0A 4F7DA 3P4XA 2H1OA 2D5IA 4PF1A 3ZWOA 5ECWA 4B32A 5H81A 5PGMA 4WLOA 2JLCA 2Y8EA 2CQGA 3CRQA 1U0BB 5G40A 1D2CA 1RYSA 2XT6A 1R9GA 1XJ0A 4DCGA 4CQLA 3LWBA 1J5PA 2C9CA 4DDHA 4F2DA 1XNRJ 4XB6B 4TSKA 3K0AB 1MO2A 2VIHA 1SUFA 5AW7A 2R6JA 3UK2A 1SY7A 4WYWA 2PRZA 2HWTA 2OP0A 1NG1A 1FRVA 3HDVA 3VPDA 2HT6A 1E2FA 4ZHQA 4KPEC 4DPMA 3UFCX 4B6EA 2I3GA 3TOVA 3PWZA 2FSIA 3W8PA 3K8ZA 4IDBA 5ALIA 1L4LA 3IQHX 4X2BA 2CLMB 1PCXA 2AG0A 2E5IA 1BW9A 3EMVA 1AQ6A 5REQA 5CYMB 2WTEA 2MKSA 2JFUA 1U4NA 1JIJA 2SKEA 4P6QA 4RTLA 1A88A 3UJ9A 1GFWA 5E8JA 1GCAA 4AS1A 1QK3A 3HADA 2GUGA 3HFJA 3NETA 3ZNUA 4FIDA 2YIDA 2EL9A 1OE0A 3Q6MA 4HD8A 1RXUA 3T7RA 5C1OA 4W7HA 3GIIA 1SXHA 3FMWA 4NI5A 2C95A 4PW0A 1VLHA 4EP1A 1SU6A 4BFLA 1FPMA 4RH1A 3IEXA 2HFNA 4IQ0A 1SELA 2WT8A 2H00A 4BE7B 5HF5A 1UOQA 6AT1B 4O1HA 3BSOA 2HUPA 2GJ4A 3OFKA 3P3DA 4JXXA 3WWPA 3PHIA 3W2VB 1AK2A 3DMFA 4I9GA 3T1VA 2PKCA 3K8WA 3QT7A 1QIFA 1IU9A 5LA6A 1E2QA 3BHIA 1T0JB 2FPIA 5CDTA 4LFAB 3QTTA 1X5TA 3M4ZA 2FJWA 3PM9A 2OXFA 2X58A 2QN9A 1JA9A 3IAS1 5LBUA 1D8AA 1PI3A 1VJ1A 2KJWA 1P6TA 2OGWA 4MITA 5IYZA 4DUPA 5E6UB 3SDEA 1ADCA 4UOGA 1WA5A 4YR9A 2JLZA 4GEGA 3L3BA 2Z5GA 5EUCA 3LDFA 3MCVA 3R7DA 2WMOB 4J4TA 5P8WA 4YMVA 3R5KA 4TYNA 1KI9A 4BEJA 4KIFA 1DTTB 2J6BA 4DN9A 4E1VA 1YS6A 1JDBB 2VNHA 1T5HX 1DWUA 1HWYA 1JBQA 2VHVA 5JNWA 4OJKA 1CZLA 3M6IA 4WZ6A 3BGRA 4UW2A 3VKGA 4BLUA 4MUYA 7AT1A 2XNHA 4P81A 4N8OA 2C77A 1LSOA 4GP6A 4MK9A 1QSGA 2Q3MA 4BVFA 3FKSA 3FNQA 1S48A 5IT9A 3OP1A 2PKWA 4LRXA 3FPHA 1JEOA 3VNUA 3I23A 1GEHA 1IBRA 2PWZA 4E5VA 5IV4A 3GJSB 1N1DA 1H1TA 3D9QX 4G1FA 1J2RA 3MUEA 1SG9A 2RK6A 2XUPA 3U02A 4GP7A 4KO3S 3MJTA 2JGLA 2FQQA 2I2CA 3HZGA 3KQNA 2R44A 4TT3D 3D8BA 2C3UA 2W83A 1Z1ZA 5JALA 3UD3P 2XAAA 5BRJA 4IZOA 1MIHA 2B4RO 4EW1A 4RW0A 3NDBB 3SLGA 1A7GE 2DR7A 1I51A 4JI6B 3NTOA 4KGKA 5EJIA 4KBYA 2EWWA 1JLLA 2I8EA 1XERA 5C8YF 4QO7A 2DCLA 4C43A 1A8UA 1QHGA 1Q78A 5HIKA 2B8NA 3LUBA 1JHDA 3HV2A 2X2FA 5D3GA 4FEAA 4HNHA 3ZVLA 5MGBA 2XAUA 1WC1A 5BW8A 4NA3A 5HMYA 2WF7A 2CPDA 4Y2TA 3TXYA 1R0AA 2WAXA 3TA0A 3N1UA 5LKAA 4LJYA 1CUWA 2P4SA 2WM9B 4V2IA 4Z86A 2AXEA 3A4IA 2AJ0A 3KHHA 2IJFA 2CNLA 5EA2A 3DLCA 2DHSA 5EMKA 4K0KF 3ZW9A 2LD4A 3V81B 1M1YE 1P5ZB 4PYQA 4H7HA 5LOQA 1ZUHA 2P4UA 3C2QA 2WVGA 1E0AA 4V38A 4LQ3A 3WRWA 1F8UA 3HHKA 3AVXA 4NLPA 3WKCA 3V81A 1RWMB 3ETMA 4NLXA 4BNKA 1MJHA 5EE9A 3ZQ4A 1T0BA 2IPOB 2H16A 1NNI1 4HHJA 4NH4A 3JTEA 5E3RA 2GHRA 3KQWA 3TVZA 3IJ5A 5F7XA 3OPYB 3LS2A 4PZ0A 1G8HA 1J8QA 5EMHA 4YAWA 5FLEX 5DYTA 4C4TA 4QNRA 1N7IA 4JJEA 4YFVA 3KWMA 4TWAA 5JCZA 1T10A 1KEZA 3CVVA 4X66B 3UCEA 3R9XA 3E2MA 3B60A 1NMQA 4X1KB 1CQIA 3QLUC 2Q1UA 4M8LA 3V6MA 3RSHA 3GLGB 4JSRA 1E7YA 4OI0A 3NAMA 1U2SA 2N4CA 3TFWA 4PO9A 4JAVC 3C6UA 1E9DA 3T3OA 4F9EA 1YZTA 1FESA 4UKDA 2VDNB 3MEKA 2C54A 4M7RA 3Q7PA 2BKVA 3ADAC 3TEGA 2ISSD 4DI6A 1KK2A 2IBSA 1G8KA 5FX2A 3HPRA 2H4WB 1WSAA 3TX0A 2JFYA 4X8HA 3S2SA 4UM8B 1RAFB 1YH3A 5K8MA 2QYTA 2I67A 2A5LA 1E8MA 4UU7A 4BJ6A 1PUIA 2QUBA 2AMYA 1VL6A 1JNZB 3KU4A 2GKSA 1M2HA 4QDOA 3MTIA 4J4BA 3MWLA 3EJ6A 3G7SA 2FMFA 2AZDA 1CPYA 1JMVA 1RRMA 1S01A 4EUEA 2VH2A 2YQ1A 1OUMA 1I3KA 3BC1A 3VO9A 2WJZB 4ENWA 3ONWA 5JS8A 2WKPA 4CMBA 3V46A 4XGKA 2QEQA 3L8EA 4K40A 3G96A 1DIHA 3EDCA 2UVUA 3UN1A 4YDDB 3DR5A 4I9HA 4F46A 2V8PA 4MVWA 2E89A 1C7RA 5DGCA 1YONA 4UDYX 3FFBA 1FNMA 3GIKA 1Z18A 3JATB 4MW2A 4ZIVA 4NV1A 3AP1A 2FD2A 2MMCA 2D5CA 4AY3A 2M70A 1O6ZA 4UHDA 2ZI7A 1YI1A 1E32A 1T94A 5T3YA 4Z3OA 3LLVA 3A1YG 5FWYB 1RPTA 4OLBA 5I9BA 3OEEA 2EAUA 2ZUVA 1NDCA 3TRHA 3HCEA 1YJVA 3OC0A 2QL9A 2G4BA 1V6HA 3GFZA 2Q28A 3KYDB 2QAGB 3WLHA 1XLTA 4Z8XA 3UJPA 1XZJA 4N7RA 4P35A 1FL9A 3ZDDA 1R4NA 1JX6A 3BE8A 2XE6A 4FSHA 4ZC8A 3HWRA 3ZH2A 4BNGA 4NCBA 1R4AA 3NOVA 3OLBA 5DS7A 3UAXA 2GBPA 4JV5B 3Q83A 5FOUA 4HB4A 3D54A 4DG1B 4RY0A 3L4EA 1T6BY 2QSUA 2B5VA 3CEAA 1QO0A 1F2GA 2BRUA 4N7BA 1YZ7A 4IDFA 2PJDA 4O08A 1Z7WA 1NQXA 2WM8A 2QQ5A 3LA0A 1Y6QA 4M49A 1XPUA 4LF4B 3FPBA 4JGGA 3ZX5A 1S57A 3VXKA 3NTUA 1N4AA 1THZA 1EUCA 1EX1A 1Y8AA 1MFPA 4YYZA 2MYTA 5ICEA 1ZGHA 3CULA 2EBWA 3FETA 3B9QA 3BXGA 1XTJA 4FYWA 1XWFA 1YWGO 3WHKA 4V0SA 4YT4A 5ER6A 4DPYA 3ITKA 3DKDA 1K8QA 1Z4MA 3ROZA 3FR8A 4EY8A 3HJTA 2GJKA 1UBOS 5CM8B 3LGAA 2WF5A 2XUKA 1JUDA 1OI2A 3UYKA 3OTCA 5C5DA 1WG1A 3HNRA 4JIMA 3V9AA 4WFXA 3OC6A 5BQ5A 9MHTA 4LYJA 5JVGQ 4N6GA 4OM7A 3JVUA 2WBLC 3G2JA 1UTAA 4B4DA 1Q1BA 2OSBA 4HB2A 2PT9A 4M9QA 4JYCA 4PINA 2F9FA 1TKAA 4MKIA 3UAZA 5K0CA 1E2BA 1A2OA 4OYLA 5DO2A 4BLSA 2K7KA 1N9GB 1UAYA 1HDXA 3RLFA 2DTXA 1YJ5A 1D9DA 3O82A 3NGMA 2PT7A 2ZJFA 1CQJB 1MROB 3P2KA 4DBLE 5FUVA 5BYAA 4YV0A 3FBWA 1RTIA 3ESZA 4J0CA 4RCZA 4KIJA 1BA2A 4CF6A 3F3SA 3BMOB 2EZ8A 3KKKA 5JXHA 2DBRA 3ENNA 2BJEA 3N8IA 2ZUSA 1QKJA 5ED0A 2VOEA 2F4NA 2YZNA 5AMXA 2BKUA 2EOAA 1J7JA 2YWJA 4JASB 2CWKA 3WO1A 5AW5A 2HMTA 2GO9A 2YY5A 3ZWDA 2OBXA 1WABA 5G3ZA 5LB4A 1HHTP 3AIIA 1UMDB 3QSIA 4KNWA 2BGGA 2FVPA 1FVXA 2G2ZA 4WLNA 1JYFA 1LDBA 2V7WA 1JAYA 4Q7EA 4UBJA 3GFPA 5J1PA 4BNJA 3WMWA 1K7CA 3M05A 2CJQA 2QG9A 3QSYB 1JF8A 3AG5A 3GXOA 5ETTA 4OM8A 2CHQA 1YIDA 3U80A 4JVLA 3I5XA 5E0KB 2HSZA 3ND7A 2HTFA 2UXBB 2H07A 1C9EA 4OJGA 3NWJA 3P8ZA 4Z9XA 3TRFA 2BH2A 1CUZA 3REFA 4S1NA 1GQYA 3UAWA 3EJWA 10MHA 1H5NA 1VLOA 1G59A 3M89A 1KAEA 3ANYB 2FSUA 5M29A 3WMXA 4PLZA 1JEQB 4EG3A 3LUDA 4MV7A 4QYIA 2QO3A 1KOJA 1S9GB 4ZVVA 2J9GA 2XNKA 2ETVA 1G16A 3T1OA 2GPSA 2DPJA 5BYBA 2Z4SA 5DGDA 5LZ7A 4K4ZA 3HA7A 4O2AA 3TLGA 4Y0FA 4MAAA 3BGVA 1C1BB 3HU1A 5A3SA 1JVSA 1JMYA 4I2NA 4KN8A 1P2BA 4O4HA 1KHHA 4CQMA 1KJNA 3MCMA 1TKZB 4PCQA 2R2UA 1XZNA 3WGIA 1DADA 1E7WA 3MC1A 1NZDA 2WLTA 1NOKA 1SKWA 1CERA 1FE0A 5GJBA 4F3OA 4H54A 3DZ8A 1B0ZA 4CODB 1C8LA 2OTLS 3I5CA 3NGLA 3I8XA 4E2YA 3WSVA 4KV8A 2BTOA 5IAEA 2C8KA 4NFHA 2GO1A 2XR1A 1ZAWA 2D1QA 4U8GA 2IXTA 1RYNA 2WTAA 4IWXA 2P0YA 3L77A 3GHHA 3Q7RA 4FPIA 3DF7A 2RHRA 1NX9A 2QPTA 5FNVA 2FN4A 3RIXA 5GOTA 4KE7A 4C6TA 2N82B 2JLWA 4C8LA 5A5DA 1NUUA 4X65F 2QNRA 2RGXA 1VHJA 4HH1A 1I6KA 1HA3A 2GEVA 4Z9FA 2HWKA 2SKDA 5CEFA 4V19X 4QLAA 4TLCA 4ZVUA 1J21A 2WWWA 3QG5A 1L5NA 3H0EA 4Q3NA 1I6LA 2DNQA 5K7SA 3UMSA 4Q7KA 1TL3B 1C1YA 4X1KA 3D1VA 3GJTB 3QBCA 3I6ZA 2IE0A 4J75A 2ZTLA 3GP9A 1KAOA 2CHEA 2BJ3A 1VQMS 4RVOA 4EKGA 2C2EA 5BR7A 5K8VA 3HB9A 4DJTA 5AW1A 3GH1A 1HFEL 1JLQB 2NGRA 4RK1A 3SS9X 2PH7A 3JARA 3LA6A 4UY8T 3T06B 4DR3J 4CRJA 1Q7LB 4DPWA 4B3CA 2HWXA 5EFOA 2MHEA 4DDKA 3UMVA 3UR3C 1I2ZA 4WK3A 4OZ0A 4CF3A 3EDQA 3BO4A 2C3YA 5H9EJ 4DRXB 4JYAJ 3R6WA 3ZI7A 1WJ9A 3H4BA 2INGX 4KQZA 3T9BA 3TRKA 4RH3A 1JA1A 2P2DA 2ZJ6A 4HX5A 1P2DA 4FQ5A 3ZPXA 3KUHA 2ZI3A 3ZY2A 3ZZPA 4PICA 3CW9A 1FHTA 3EAGA 4Q0MA 5JJ5A 2FPHX 5IM0A 3R1LA 1MRNA 2J5AA 2CFSA 2KXNB 1O6GA 4UASA 3E84A 5IH7A 1Z29A 2E1PA 4G0VA 3F9RA 1A7JA 1MMLA 3Q72A 3FKJA 5JISA 4KVZA 4B3RF 4GO1A 1B2RA 2J87A 4H18A 1P5JA 4YMUA 1A1VA 1JNRB 5EKUA 3PV0A 2TECE 1EA5A 4HLDA 5EIHA 3NAGA 3VZPA 4F9TA 1YCHA 3H1FA 2AVNA 3MIZA 2PGAA 4TMYA 4D45A 4QIVA 4UUAA 4P2BA 3S99A 4YMTA 1MTZA 1I51B 1S0UA 1HEIA 3UKJA 3IESA 3LP6A 3AB2B 3W64A 2WOMA 4R0EA 2PTHA 4JJ7A 2WK4A 4XVCA 4FJ0A 3MJ4A 2FJAB 5CCBA 4NOLA 1ZI6A 3N74A 4JDPA 4FS3A 5A3JA 1K08A 3KPVA 4KSCA 2W8BB 3R4VA 3PUZA 4CV1A 1S1WB 3HBAA 3I4HX 3CEDA 5I9MA 5BUZA 4ITVA 3K5NA 3DMDA 5CURA 3TL6A 1GTSA 2IM1A 1PFYA 4DMUB 2C2NA 6ADHA 4LFBB 3X2EA 3HK2A 1PQYA 2AG5A 4RHYA 5ETLA 2DECA 4DM3A 3GR1A 1M1GA 1E2HA 1U5CA 3AZOA 1JKMA 2XBLA 4ZTZB 1G1AA 4GI3A 5KG6A 1QRSA 5LUBA 4W63A 1L6IA 2ZSDA 3DAYA 1C3OB 3DGEC 5IU6A 4B8YA 1I0IA 1A9YA 3R3WA 3KDPA 3R9KA 3DNCA 1RWNA 1L4BA 2XHEA 1E1RA 2BHTA 5JJCA 4NYJR 3DM2A 3EW9A 2PE5A 5JZVA 2QN1A 2WJWA 2HJWA 1E1LA 2W2LA 3W8GA 2VCEA 3BQ1A 3ADDA 4LMAA 1E1YA 4LYYA 3US5A 4NBNA 2H1SA 1OH7A 2M5YA 1QHEA 3EBPA 2A59A 4C21A 4IS2A 1BN7A 3V4VB 3NCHA 1O5OA 4BKQA 4NHOA 4AQYJ 1Q22A 3BK7A 4GNRA 4KODA 4RC9A 4LXXA 2P27A 1K1SA 4OV6A 2H2GA 1DQPA 3A9WA 4H1TA 4ELUA 4J0QA 2CDBA 2NCKL 3PXUA 2WHYA 2FPKA 1NDHA 1FPQA 2QMXA 2CIMA 4FFDA 1NJ2A 3RUAA 2IJGX 1DTTA 4AKSA 1QH0A 4ANFA 5C25A 4XOIA 1HWJA 5CDSA 1ZA1A 3B1YA 4F4FA 1JKXA 1DC8A 1CDDA 1CFZA 1GZ3A 2WRZA 2AJ8A 2Y0DA 4G01B 4ZOLF 2OAP1 2EKNA 2JCGA 2CVEA 4YFYA 1U49A 1CSJA 2HSEA 2X8JB 5BNIA 1ZH5A 3HJRA 2VJOA 1G21E 3FNFA 3WYCA 1GN9A 3PENA 4G5OA 2XLBA 4MPDA 4WJKB 4UM5A 1RXSA 1S6PB 3NCPA 3A2NA 3IXMA 3BS9A 1JTFA 4YRRA 1XDGA 3W8FA 1HMYA 3QUBA 2QXTA 2QY9A 3USES 1SXIA 1YIOA 2CQPA 1S4MA 3GFOA 3BH7B 3NLLA 1OY1A 4PVDA 3F6CA 2VXCA 4DV7F 2PQ2A 2PYDA 2BEFA 3AMVA 5HJ5A 2IA5A 1YVRA 2CV2A 2L42A 1ZCBA 3TW4A 2ERXA 5AUQA 3ZK8A 1JR2A 4NPOA 4YRLA 1UFQA 3V5RA 1K7SN 2WFLA 4J7XA 3FTPA 5B3KA 1YJRA 2GS8A 5IBPA 1X8KA 1ZP6A 2B0JA 2IHUA 4B9AA 3V8PA 3GLIA 3GRCA 1F7VA 3T54A 2P79A 1U81A 2BUBA 4O3PA 3QFWA 3TINA 4RMJA 2ZE2B 3RSGA 5CDFE 2YFKA 3AHGA 2O5EA 1UBMS 3AY0A 3A3PA 2R87A 2GEBA 5JJLA 5E3JA 4UNRA 3EMDA 3UWDA 3G17A 3K6SA 3NWPA 1UQTA 5BORA 7GPBA 4OHYA 4U00A 1ULHA 1SPBS 2IYVA 2KQUA 5HW0A 3ETDA 3KL4A 3AFGA 3T1YJ 1IG0A 5E33A 4S0ZA 3KVVA 2YZMA 5JBNA 3CTMA 1VCTA 3VGPA 1VQ8S 2XGGA 4YDHB 5L46A 3FTNA 3PS9A 2FG7C 1I5RA 1N52B 3DRPB 4D92A 3FCXA 3T0GA 2OLWA 2QMEA 2IOYA 4KQHA 3NVKI 3BGWA 2BVZA 3EGCA 3W9HA 3KB8A 2HNAA 2NZWA 2OGUA 1E5LA 1E3QA 2XTMA 1GPLA 2JEOA 3QVMA 5CYFA 5BN4B 4DV4F 2GMJA 4U7FA 3P97A 1A8IA 1G4UR 3TX2A 4LOAA 1T3SA 2C0PA 2GNAA 4JI0J 1LV5A 2GPWA 4JI5F 4R8SA 2YJ5A 2QK4A 1Y98A 3EX7B 3SSMA 3NHMA 3HDSA 2CDAA 1GEEA 3KKNA 3BIWA 1IG3A 5BT8A 3ASZA 3WRYC 1HT2E 5IKMA 1GCUA 2PMWB 5FLXU 4I69A 4LKOA 5JCXA 4JT2A 2W22A 3H5OA 1ATIA 2C61A 2OFWA 4NTZA 3UJ3X 5GVRA 4MYTA 4HH0A 3U3JA 1IXYA 3QENA 2PQ0A 3AF0A 3G1WA 4HFJA 5D5PA 1F8GA 4DCNA 1D04A 4LF9B 4HYEA 3L82B 4HLBA 2RI6A 4ZJQA 3SYRA 1A04A 5AKKA 4XQGA 4GGOA 1REVA 3WHIA 4M8IA 4MS3A 2C96A 3DXZA 1Y3JA 2GEKA 4QYXA 3HDYA 4DCCA 2IDMA 3D1QA 1CVIA 4HSEA 1E6VA 2EKZA 4KI7A 2O01C 2N3LA 1NBHA 4KR7A 2IYGA 1YQTA 3LW7A 2BUNA 1CUYA 2Q6TA 2GSDA 3D68A 1SUQA 3FWYA 1RTHA 2YW2A 2GYWA 3JALB 1FP7A 1DBQA 4NCIA 2G7MC 3N2EA 4NYJQ 1R74A 4AZSA 2VHEA 3GT3A 1WSVA 1XQ6A 4QBGB 2DGOA 4AVYA 4M53A 3E05A 3TLJA 2YNFA 1I4TD 4DR2B 3K2YA 1F4VA 2GF0A 1ENZA 4OHOA 3M9NB 1RJJA 4GGPA 4LIRA 1VI6A 1QH1A 4DU7A 2R8OA 4DWJA 2D3UA 1KRHA 2ZWOA 5DRTA 4XCVA 3NONA 3W5HA 4QGSA 5KNCD 2AP6A 2J7WA 3NGTA 3GU3A 3E5RA 2BBTA 2HU8A 4WUVA 1QAOA 1T0UA 4O1IA 4U4AA 3T7KA 5EJEA 3BZUA 5KKCA 5DX1A 1FRIA 5GAGU 1WMAA 2FIUA 3KJFB 3CCQS 1F8XA 2QJTA 1FIUA 3N7TA 5ELXA 3DQZA 3DLIA 4BAGA 2NV0A 5GM1A 3KD3A 3MF4A 3OW2R 5AVOA 1IY0A 1Y1SA 3PTLA 4ZK7M 4ZCLA 2IVZA 3Q8SB 4ML3A 5AM3A 4NLTA 2C5AA 1QV6A 2ICAA 3WSWA 3RRHA 1SNYA 5HLFA 2AG6A 2AN1A 7FDRA 4HJXA 2Q5EA 2JLEA 4LMZA 2GVZA 5KJCA 1UVIA 2G9UA 5JZMA 3ET5A 2XQJA 2ODBA 1UBHS 3G6KA 4L85A 2OOKA 3JQJA 3UHPA 1S2MA 2BF4A 4G1QA 5LDGA 3SBMA 2GVDC 2W2MA 3IAFA 4IVNA 1OYOA 3ZHCA 4WLVA 2H4WA 2ID9A 4EJ2A 4TZKA 4B9MA 2FVXA 4RHEA 2IXFA 5K51A 1NULA 4IX9A 3RPEA 2Y1LA 3WC0A 3FGZA 3ZE1B 4FHCA 2EI5A 1FKOB 3NHFA 3NX4A 4ZZIA 4IJWA 3M2RB 2MU1A 2QG9B 4KHRA 1T34A 1MA0A 2RRBA 2VJVA 1R7RA 4CG1A 2E29A 2VC1A 5AI6A 5GJVC 4QC2A 2DPMA 3ZE8A 1M0SA 1NRWA 3BL6A 1RHMA 1NLYA 1ZOTA 3MAGA 2RNEA 1CWUA 3AILA 1OAOC 4NJMB 2J7KA 4OQJA 3OFNA 2DOKA 4QUKA 1WC6A 2FEPA 4MMZB 1XEFA 2C83A 1SV5A 5H02A 2H5LA 4IZIA 5TS2A 2XEDA 3ORHA 2AJDA 5K5MA 5FUQA 5LP1A 1TIBA 1CEEA 3RFFA 2Q8PA 2RAVA 3CLKA 1HOTA 4F67A 2J3QA 1H85A 3H9UA 5CMLA 5KNCA 3BYRA 1U7PA 2PGDA 3MEQA 1J8YF 2ZK7A 4FFNA 3M1YA 1QP4A 1RXIA 4HDKA 3U3XA 2PGXA 1NDUA 4D97A 1A9QA 5HTOA 3L0BA 2OTJS 4GVXA 1LPPA 5EWEA 4LZZA 1J8MF 4QWAA 3EYZA 5F9FA 3BXZA 2OGSA 2HA4A 2AC7A 2QYGA 3VGVA 4LV5B 3T4EA 3H18A 2H1YA 3NEPX 2HH9A 3QPVA 3G8QA 3PCTA 3OHAA 1NR7A 4UHKA 2QBYA 4GECA 1UBNA 1T13A 3VHXA 1ZZFA 2Z8YM 1CR6A 1QP7A 2HA6A 1QHYA 3Q8QB 4ZQEA 2FUKA 3O90A 3LUJA 1QZTA 2BM8A 1F6DA 1CBKA 1YJAA 4QATA 1C0EA 1RADB 3BRWD 1KK3A 2SXLA 3FDSA 2P6PA 4GKVA 2VIIA 3RVLA 5K2OA 1YR1A 3VYVA 2BHSA 2RH3A 2CL6X 3M32B 3R7BB 1XE3A 2P9YA 1N0WA 2AJ2A 3BXEA 5JROA 1JNYA 4HNRA 4GFDA 4MUFA 2IX3A 3OQJA 1OXVA 1G20B 3KOWA 4BC7A 4HYTA 2IC3B 4M95A 4MICA 5LFAA 1DXHA 4MAFA 4DQLA 3QLTA 4IDGA 4OYZA 1QX3A 4L0QA 5CXUA 4E5YA 3LOPA 5JD3A 5AJHA 1KIMA 4D96A 1YIJS 1BRTA 1B7FA 2H48A 2PWBA 3C7TA 3SIXA 4LJAA 3SI7A 4B9NA 3MCWA 2OL4A 1L3CA 3QY0A 2W37A 2W2KB 2KKHA 3M4YA 4WHMA 4J07A 2JFKA 5B0GA 2AN3A 3H05A 4QVGA 2W2PP 4XASA 4USKA 2RQKA 4DV5F 1G1XA 5M7EA 5DHRA 1YASA 1CUXA 4URGA 3GEIA 5ECDA 2POCA 3MMXA 4OYPA 4BV2A 2AHOB 3U49A 4FBTA 2MKJA 3DZCA 3R7AA 3L06A 4R9RA 1S3FA 4W5HA 1W7WA 6GPBA 2ZH1A 1GXSB 3I0RB 4N0MA 2P6MA 1EVLA 5D0HA 5C8XA 4C05A 1AC5A 1OLOA 2EVZA 2JAUA 3C1OA 3ZU4A 4QJBA 3FVYA 1X86B 1XTUA 3OZCA 2IKSA 3PU6A 2IYYA 2PMBA 1N8KA 1UJBA 3LDGA 3BEGB 1UADA 1EAYC 3ZXYA 5C53B 3UEOA 4L72A 5H80A 3DO5A 5KSWB 2H06A 2P2YA 2QB5A 4D25A 3KNZA 1GZDA 4M98A 1TF5A 5FYQA 4MR8B 2H4YB 1RWUA 3OLAA 4FOTA 1BJKA 5FUMA 1TO2E 3D7NA 5H9VA 5DF1A 4D9MA 2OYRA 2IZZA 1QMGA 3K70B 3UOAB 5FD8A 4MUHA 1Q1GA 1ZPWX 2JJ2D 5K0BA 4ZDKA 2ZP1A 1U9CA 1C7FA 3TANA 3UC9A 1FW8A 5JSHA 2HBYA 1OH5A 5ELLA 3S68A 3MTKA 4DLBA 2R2TA 1Z0AA 5IF3A 4MJKA 1GAOA 2XLJA 1EFRA 4M9SA 2IGTA 4B3MB 4B5LA 1KQFB 4DSAA 1AW0A 4B8ZA 4UUOA 5FHQA 3VQTA 2CDRB 1ORRA 1E1KA 3BHJA 4UTPA 3AP3A 1S6PA 1REQB 5DDQC 1G3UA 1YI2S 1VS3A 1NFRA 3ONNA 1AUOA 4MULA 4BKMA 4BLPA 3ZI4A 3VR2D 5LM3A 1ECJA 1WC3A 3OECA 4CWBA 3CJSA 2QL7A 1YE5A 3E22A 1JXQA 5LIRA 3TQ1A 2V4QA 1NW5A 4GLOA 5K0NA 3AJ2A 2ZROA 3L6RA 3HI6A 2ERRA 4L7VA 3Q6IA 3N07A 2RMLA 3O1JC 4Z54A 4GWKA 1D5WA 3NFRA 3PQEA 4PPGA 1XFDA 1FYFA 2I76A 3COVA 3EDMA 8RUCA 1KJ8A 4G63A 4IH6A 3ET6B 4Y2UA 2BN4A 3KYCA 1TYEB 4TKZA 1WP9A 5B08A 3K70D 2Z57A 2VPQA 2VNKA 4AKGA 3CKYA 4TOIA 2BGJA 4FBGA 1X70A 1LPBB 4P3YA 2K2PA 4G5HA 4KC0A 3VKVA 5A0TA 3RK1A 3QWPA 1RAJA 1IUPA 4V0KA 1P17A 3K32A 3PEWA 4DZ6A 2UYYA 1E6YB 3TOZA 2RILA 4RPLA 4A6XA 4ED1A 2FU5C 1XMQB 3L6CA 3GIJA 4HRAA 4D3XA 1LXJA 3VVBA 3EB9A 1O58A 3KKMA 5J3JA 3B7WA 3PJ9A 2QN6B 2YIVX 3B38A 4W5NA 2QTAA 2RHCA 2JBAA 2UZIR 3L7UA 1Q1EA 2GVZC 2W9AA 4FHFA 1E0SA 1N6IA 4D4GA 4HOYA 1PX0A 4ALIA 2O1WA 4KVAA 5K4GA 4ETNA 3DL4A 4EAAA 1CQZA 1HW8A 3N86A 3U7QB 3DEJA 2HA0A 1FK9B 1D0SA 4RTJA 2O8EA 1XNGA 1G291 3N01A 1DOHA 3TTWA 5LQMA 4WGGA 2BSQA 3M3PA 1TRHA 2CLIB 3EXIA 1Z75A 2FP3A 3WLMA 3WLJA 4F2RA 1BE0A 2DWQA 1CRQA 3PLRA 1CF9A 2W6NA 2DFNA 1W36D 4ZTBA 3O3LA 4IO9Q 3JQQA 2HMIB 3GILA 3AUUA 1E59A 1VK3A 2Q2OA 1ONBA 4Y1RA 4ANDA 1RPZA 2FRVA 3TEFA 2XQIA 2P2ZA 4B3OA 1U0TA 4MP8A 2OPSA 4FGSA 2Z56A 1SIZA 3P9QA 4JZKA 4FPXA 4JI2B 1KZYC 2QP3A 2ZANA 4GXQA 3DLGB 1MVNA 3QU7A 3IWNC 3DCJA 1YHQS 3KLIA 4DLUA 2UZ1A 1ULBA 3RYLA 3PE6A 5IKEA 1Z5VA 1XVLA 5DCWA 5ARBA 4KX3A 3UTDA 2QX0A 1KYYA 4HS9A 2XOKA 2HQSA 4IMPA 3K8VA 4LC0A 3OKCA 4QR0A 2Z8ZA 1X7YB 2KDOA 4UTXA 2WP8J 3KJNA 1HHSA 2HHVA 1XR6A 4ED0A 3EHDA 1UXJA 4Y6QA 3QVWA 2ZYUX 2XBMA 2EVWX 4ECZA 4P8RA 4C7JA 1NCLA 5GADI 1H4SA 1H74A 4JROA 1DDGA 1NC3A 2OJ3A 3C16B 3JSYA 3J81U 4MVJA 1X4BA 2SCUB 3K0BA 3OTIA 4EPVA 1RXWA 1Z2CA 3AKZA 1QE3A 1PFQA 4U3JA 4DLLA 2IYUA 3BQ2A 4Y9SA 3GSDA 4HI0E 3SIPB 3NPAA 1USKA 2MTBA 1Y9DA 4R5PA 1Y5MA 2WHPB 1FU7A 2RD2A 2DPXA 1VGQA 1T3ZA 2XB4A 3W9YA 4EJFA 3M2UB 2JIDA 1JG3A 3FPJA 1WG5A 2V4JA 2Q1SA 2V7TA 4UOCA 4KFCA 1B8UA 3SEAA 5C80A 1KYVA 2QP4A 2NUHA 3H9EO 5HL7Q 1FP2A 5KQMA 3VR3A 2PZAA 1NTRA 4QJVA 5GP1A 2BJ8A 5JVDF 1O0BA 3TLMA 2DCUB 2CWDA 3I09A 1HQEB 3VGTA 1U6KA 2JLYA 2H2HA 4RHCA 2QYOA 4YMGA 4ECSA 3CF0A 4BTLA 1QVFR 2B25A 2XWSA 3MD3A 2JHAA 1OLSB 3MGJA 4P82A 2NADA 4D0GA 3RREA 1DJ0A 3W2GA 5CAEB 1W5FA 1J1UA 3KAJA 1K0VA 3G0GA 3IURA 1P0CA 2VSOA 1JE0A 1NV8A 5J63A 4K4WA 5JCJD 2Q4BA 1N5TA 2VB6A 1NVEA 1FQWA 4RM2A 1WUJS 4YAEA 1T25A 2FZVA 3RSZA 3MGCA 2DNHA 4LJ8A 4Y0AA 1IHYA 1WX1A 2QX8A 2WU4A 2BEJA 4YVFA 5A6SA 1DUSA 1DAGA 3V34A 2WIJA 3VR3D 1S76D 2PUAA 4BLTA 1B1CA 2IY7A 2AHRA 2VL1A 5HKAA 1HYQA 3MILA 1NHGA 1YB5A 1O95C 2R3SA 3ABIA 3L7LA 5CA1F 3ME5A 2NQ2C 5AVXA 3MM8B 4UJ5A 3E7XA 1L5OA 2K6GA 1TEZA 4Z37A 1KVKA 3NI2A 4JEHA 1LSSA 4OH7A 3KC2A 2ZUBA 5FJIA 2APOA 5A8WB 4L78A 1J9GA 1P8JA 6LDHA 2GN4A 1E4YA 1LPSA 4M0KA 4TXLA 3R3VA 3KOMA 2HS0A 5GVSA 4QBIA 4TMVA 1N6QA 2KM1A 5LZ4A 2KU7A 1DKQA 2HGMA 2EF0A 3IVAA 3MECA 1NU8A 2HREA 3F4KA 3LKVA 3B3QA 3UICA 5H16A 3DHEA 4V0RA 1OWLA 4U6QA 4L08A 4BN4A 3IH5A 1AE1A 4Z9YA 2QM7A 1KZ6A 1U47A 4ZFNA 4KO1S 3CLHA 4LY6A 1LQTA 4ZP7A 2GM9A 3QX3A 2V58A 2Z6UA 2A9FA 4KHPB 1RYYA 1H9BA 3HL0A 1FFSA 4BXOA 2R6DA 4QPTA 1NVKA 4RZ3A 5HQ3A 1VECA 3DCYA 4WKYA 5ALJA 3PZBA 4WCVA 4D8XA 1CHNA 2O14A 2IHTA 1XR7A 4W1PA 4BJ3A 3MYRA 1DHTA 2YFQA 4MVJP 3GA0A 3LK6A 5AJWA 4OV1A 4RX6A 1T9XA 1PGQA 1VB3A 3REGA 2ZBQA 5BSVA 2J5RA 4ZYVA 1HL3A 3O6QA 2J3EA 5HDBB 1Z4OA 1KVSA 5HSPA 2FPGB 3NRBA 4JYPA 3OTOJ 4KT0C 1U0JA 3OJLA 1OWPA 4RJJA 1U98A 2FSPA 5H9FJ 4WZAB 3W34A 2HPHA 4X93A 1EFAA 5JDCC 3GEMA 2RAFA 3BGUA 1SBNE 3KLPX 5IDQA 4PXSA 3ADKA 5LMUF 1NF2A 4RLEA 5ANRB 2ZS8A 1II0A 1E7QA 4MQ6A 3TN7A 3LHFA 4DCPA 4B2YA 1NXIA 4FMDB 4CMKA 1NOIA 4NPHA 4HWPA 2ATCA 1Q16B 2O1EA 3VVMA 3C6QA 4XRRA 4IOJA 5I3QA 1XZBA 2Q1XA 4J90A 5J2QA 2KFZA 1XZ8A 4E3ZA 2V4MA 3RRNA 4HKQA 1A4UA 1FVSA 3CO5A 5HOEA 3G68A 3SC3A 1E2LA 4TM7A 9RUBA 1UJ5A 5IEJA 3BBLA 2Y1IA 1TUGB 1NVAA 2WVEA 3ZHVA 2IVFB 3IQGX 3D0IE 3MB5A 1H9AA 1C3LA 1XVVA 1J39A 2AT1B 2WQZA 4OEHA 3GVIA 3KJVB 3IAM9 1YXMA 5IC5A 4RVGA 4QU9A 1EX7A 3VC1A 2Z8QA 3AOCA 3KVOA 2P6TA 3S70A 4O0MA 2W5UA 2B4UA 1ADBA 4K26A 5DX0A 1ZHOA 1PJ6A 1FRMA 2A33A 2DBYA 5EEGA 2KO1A 3F7OA 4PGGA 2EDCA 4GSLA 1FDTA 3QJYA 1IVZA 4KLCA 5IM4A 3VTFA 1U3CA 3LL7A 3D2AA 4QQRA 3UW1A 2PQMA 3KT8A 1Y4UA 4X62F 4YJ2B 2A1BA 2SICE 3O8QA 1E5XA 4RD1A 5HKOA 1B8NA 1GDHA 2PCLA 2O3RA 4M9RA 3MEGA 5KFSA 2B8PA 3FCAA 1WVMA 4DPUA 2IUEA 4MZXA 4LF8J 4PR3A 2XUIA 3ZDCA 1TJ5A 5KFVA 3GDHA 5CFOA 3PG5A 4CT4B 1TAUA 3DBLB 2GNPA 3DE0X 4PG5A 2G1DA 4LG1A 5AHWA 3W6PA 2QN8A 2NSJA 3R5SA 3INGA 4BLGA 1TM5E 3KO8A 2QD4A 2IVMA 1RE0A 2RHLA 1D1QA 3VYSB 2B5WA 2VRCD 3TNDA 1Z28A 2CVZA 2CHUA 3P2MA 5F1PA 3ENVA 1JU3A 5BT9A 3IKTA 3TE7A 1FBNA 4X4RA 2VBZA 3CA8A 3DE4X 4MQUA 5FDLB 2HAFA 3DPUA 2WY2D 3Q2KA 1UOPA 2ZG6A 3CT4A 4U7CA 4C11A 3ILLA 1QPGA 1O95A 3W5BA 4HGOA 3T6JA 1JR3A 2CF6A 1WXXA 5E2AA 5KEIA 5FV7A 3B4DA 2ZETA 3FEXB 3EC1A 1RC0A 4FR5A 1NYTA 4JVSB 4B3SB 3O5TB 3PEYA 1AKNA 3QZUA 2GPNA 4GF5A 3RHFA 1V48A 1YMUA 3UB2A 3CN7A 3KQSA 3BB3A 1P19A 2CZ9A 4EUSA 4OX9Y 5HS4A 1LK7A 1TMKA 2ZRFA 3ZCUA 4EFMA 3KZVA 2ZCVA 3DYAB 2GM4A 2O3DA 4C1NA 4ZEXA 4OQZA 2IM0A 2MZJA 3QH4A 1Z13A 1M34A 3UXMA 5IM5A 4ZVOB 5K8PA 2HVEA 1X8JA 1AZSC 1EUZA 2DXEA 4YJFA 3CPWR 2B5JA 3TAPA 2CLDX 3T4UA 2WYIA 3OT1A 4UHHA 3H1GA 4ALZA 3IULA 1H05A 2Q6VA 2DFPA 5F77A 1OA0A 1ENOA 4YRQA 4K2XA 1DBDA 4AO8A 1QDUB 2ZJ0A 4N0EA 5L4SA 1RAFA 4HUJA 5FADA 2REXB 1USUA 3T3NA 3DKVA 2PL5A 3IAXA 4N54A 4DFMA 4DNQA 3HFRA 2CXRA 4QOFA 3TIFA 3HP4A 3R5GA 1C0KA 3V7FA 5T6BA 2PUGA 4NCGB 1QC5A 2L08A 2MGZA 2I7DA 2ZB3A 4WRRA 2DGWA 3ZI0A 2CUNA 3NHPA 2GGPA 2LU1A 5LYJB 1X1CA 4G0PA 2OEMA 2G9ZA 5HP1A 2GXUA 4DBVO 3BRWA 3QOYA 3UCXA 2BE9B 2QFJA 3VX4A 1RJFA 1ZL2A 3CJ4A 2O8BA 3D64A 1K88A 1JDZA 1G98A 3UAOA 1Z0DA 1L1EA 4DA7A 4EG6A 2OG1A 3G5UA 5LN1A 4AKHA 2MEWA 1OPZA 1X6VA 3UWKA 2X5XA 2BFAA 5HZKA 1Q2UA 1XZCA 1HBMB 3IFSA 2VH7A 4PTLA 3RRBA 2A35A 4B48A 3P9PA 3PSHA 1D2MA 1J27A 3A1VA 4C5CA 5FTLA 4JBWA 4R68A 5CDUA 1MBZA 3CLRC 5FQNA 1KYZA 1TZMA 1OZ0A 3WDSA 5KG7A 1NJ6A 3CUUA 4LDPA 2ATIA 4UDNA 3OFHA 4LRFA 1DEKA 1FMJA 1NYLA 1OAKA 2VDHA 2L17A 1NQWA 3FZBA 2NU8B 4QBHA 4FWIB 3NTRA 3LLSA 4LR7A 1GEGA 3SCJE 2NO1A 3RFUA 2XYHA 1M1XB 4Q1AA 2F1RA 4HT3B 4B3IA 4QRIA 4WJBA 2WOJA 1JQJC 2BACA 3GPIA 5JADA 1BWSA 1TU0A 3J81A 4G26A 4TKVA 4HEHA 1ZAYA 5DEOA 4C01A 1CTQA 4IPTA 1KOHA 2Q1WA 1V9OA 2P2SA 1HI0P 5F2OA 4DFPA 3DDIA 3WISA 3L09A 2CFIA 2HPZA 2VK2A 4AX4A 4GIBA 3PGXA 1VC6A 3TTYA 4RJIA 4RLHA 2R8EA 3ZWAA 3RYFB 2EBUA 1I5OA 4YHHJ 3INNA 2ZDOA 5CNKA 3IRVA 2IH2A 4K4SA 3M6LA 1RFGE 1RU3A 3ASYA 2JGKA 4KGVB 5TMPA 1K63A 5A76A 3WIOA 4YY3J 2J85A 4LOJA 1AA1B 1QQ7A 3QUQA 1DBIA 4HAZA 3PDWA 4DG9A 2K8GA 1RT2A 1VQ1A 5AVKA 3RCBA 4W9NC 3AOAA 2XB6A 2J30A 3OJUA 1NPKA 4F56A 2YYZA 3WL7A 1TP7A 3QHQA 4QBKA 4RBUA 1H0HB 3FNHA 3LX4A 5EIAA 5DN9A 1ZKMA 4PXAA 4OXQA 3AOEC 4PN3A 2QSWA 2HO4A 3EZ6A 1XQIA 1ZIPA 4WL0A 4GMHA 2KM8B 7REQA 4OFWA 3PX3A 1QB7A 1MRZA 3DOMB 4XCQA 2UV8A 1KJZA 3OZTA 4EW3A 3EEIA 4R2LA 1IUKA 5AD1A 4CG3A 1HYGA 1ZAVA 1U0SY 1M2NA 1NBIA 2CFXA 4NC9A 1XR5A 2XH8A 1N25A 1OJLA 2GJAA 2JWNA 1QGZA 4EO8A 1PT9A 2ZI5A 4MIBA 5A5FA 4S04A 2X5JO 2CJWA 2VK4A 1DAIA 4DVJA 4BKUA 5CXTA 1GR0A 3NP5A 1ZSNA 4BO1A 4PCLA 2Y0EA 2EC5A 5A0YA 4DR1B 4AQYB 3IRUA 2WA2A 4K8OA 5G0UA 4B3SF 1U48A 3CD6S 4OVKA 3GYBA 1N5YA 4UZEA 2HK2A 3KWJA 1XTIA 1F9EB 2I22A 1WMSA 4Q1EA 1OZGA 2J33A 4KE6A 4P9SA 3OBIA 4Z0TA 1PIWA 1W35A 3GB0A 3W04A 1YQDA 2I8LA 3KLNA 4YAJA 3QGPA 1SVNA 1QRUA 1AXGA 3FPKA 1P3DA 2FWBA 1V11B 3SQDA 4ZP9A 3CVWA 3M4NA 4DY6A 4I08A 5K8TA 2XZTA 2HDNB 2EKDA 4GPAA 1K9VF 1R8JA 3QGGA 4DHWA 3NDRA 4ED4A 1V39A 3P0FA 2DH5A 3T0IA 4C08A 1Y6RA 2L18A 5F8HA 3VR5H 3PR2B 3ZZOA 3SNKA 4IM7A 1GQQA 4OLJA 3OD2A 1T8EA 2PBZA 4DCOB 4PHTA 1Z7BA 4AUKA 3W3SA 1BX1A 3GFVA 3Q41A 1D4OA 2EZUA 4IIUA 3PVCA 5SZKB 4P5EA 4ZVFA 1O03A 1B6RA 4OHRA 4WNAA 4XAQA 1JQLB 1Z4NA 4YI3A 2CPFA 2WZCA 2FSSA 4GBJA 3EPJA 3PC4A 1NVVR 4OAOA 3PICA 3C14A 5BSRA 5F21A 4EIWA 2CSXA 3ZLTA 1DV2A 1GU7A 2XUJA 3VDRA 1VMBA 4F4XA 1PYOA 2XCRB 5SY9A 1S77D 2FY1A 3MFYA 3LKDA 3LXRA 3JTOA 1NP6A 2N46A 3OZGA 2VF5X 3I58A 4KE9A 2PX4A 5EWJB 3E8OA 3KFVA 3GLSA 1S3GA 5AXKA 4QPNA 2U1AA 4USMA 1DWPA 4LF8F 1NMEA 2YN2A 1ZUWA 1T6YA 5JZ9A 2UZ3A 2XOKD 2J3HA 2O6HA 5DETA 4PGHA 4L3KA 2PKYX 1IBCB 4KLZA 4NLOA 2C82A 1NURA 1CB7A 4IIJA 2XLKA 2XNJA 2MDAA 1TFYA 4WZBA 3ROQA 1KXJA 1KZHA 2C84A 3DDUA 3IEIA 1DAHA 4REOA 3UOGA 4P74A 1VGRA 4P10A 3OUZA 2BLLA 3MJSA 3ZXWA 1QGAA 1YTUA 4EBBA 2V98A 1E9AA 4NBWA 3HLYA 5BSMA 5DNDA 3A36A 3DB1A 2KG1A 4BP8A 4L15A 5CLLA 2CV0A 1FKAF 1EK5A 1Y4SA 2QMHA 1PJ8A 2VPZB 2YNMD 2Z5LA 3FYDA 4AW9A 2WPDD 1GLNA 1CP3A 2I6UA 1ZXBA 3PQ5A 4MUAA 1Y4ZB 1VYHA 4BQPA 4EMDA 1HNXJ 3VAKA 1CUGA 3DEIA 2B43A 2GWHA 3DTVD 4OSEA 1KMIY 4ECUA 3W5JA 5JXWA 3TLKA 1MWYA 3K1AA 3G8SA 4EY4A 1ZEMA 2BTQA 1IONA 3TTTA 1Q53A 3KG4A 1T2NA 2JLQA 3SYNA 1GZ4A 1Y3DE 3WQHA 1ZQ1A 4LJMA 3CNQS 3AERB 4PQFA 3BL5A 3VJMA 1JG1A 3OE7D 3RVRA 2C4VA 4BX2A 4F25A 4YUYA 2Q21A 1HOXA 3QLHA 5KT3A 3M70A 1TVEA 1Y3IA 2H9YA 5JDCA 3SM9A 4IIYA 3DOKB 2VP3A 3NP7A 3BWVA 3CX4A 1EKXA 1PHRA 2EERA 3D0OA 3URKA 1JJAA 1MEEA 3V4LA 4QU0A 2H2DA 3LT2A 1R27B 4BWJA 3KCNA 2J6UA 1HNIB 2OZEA 4URSA 1ZRNA 5EUQB 4LTDA 3ZD7A 4DYVA 4DSJA 1VDZA 3QPDA 3I9LA 3PT9A 4FOPA 2LCFA 4D3GA 5BNTA 5K0SA 4MAKA 3NHYA 2AVDA 4F6LA 1FVHA 2EW8A 2ONYA 4OQNA 3PD0A 3CZRA 1CCWA 4P38A 1T1GA 4RZXA 3COWA 3DDOA 5FLXA 2VN8A 4KMMA 2NZ8A 2ZBEA 1N48A 5MF6A 4JL6A 4KAXA 4BFWA 3ZWBA 1P9OA 1HG1A 4DLAA 1SH0A 1W5SA 6PFKA 2W42A 1TGYA 2G9RA 3PNKA 4CTOA 3PY8A 3DEZA 1YR7A 4KWCA 3WWZA 3G49A 2CPEA 4OHWA 2VFTA 4K1XA 3SXPA 3K5WA 1E1QD 4Q1VA 3AZPA 1PLJA 4F84A 1OO0B 1EJ7L 3VUEA 3II6X 5I5GA 2YNMA 1UA1A 5EXDA 2PN6A 3NBQA 1YB6A 2PFSA 2ZIGA 2OQVA 5GMDA 4J9OA 4LV8B 2QSZA 3OURA 4B6PA 4KYTA 4Q34A 4O8ZA 2LVBA 2OWDA 4HWKA 2GZMA 4JUIA 2FLVA 4XB1A 1H6BA 1DX9A 2PFKA 1BMFD 5MFZA 3WSTA 3HP7A 4EG0A 3OF5A 3D3QA 3ODPA 2WWGA 2FPGA 2W7OA 2XO7A 1DBSA 2H7VA 4P2XA 1N57A 2QGZA 1FRJA 4NRUA 1TZKA 2F43A 1CB0A 2X77A 3MWBA 2H0RA 3VU3A 3GN2A 3JD1A 1MC4A 5F35A 3HR8A 4TS3A 1MT3A 5TIIA 3QQ5A 5JRDS 3DBHA 3DFFA 4ZV9A 1JQ3A 4M1WA 4QZVA 2WMDA 4FHDA 2VOJA 3OSNA 2CCGA 2JLAA 4TL7A 1R5OA 1QIGA 5D78A 3I83A 4DLKA 4DLPA 4Q19A 4BFXA 3DXYA 3NNHA 1T6ZA 2XGSA 5L45A 4YAIA 3QWBA 2RF2A 4LKRA 1BCSA 4CTJA 4BEWA 2J48A 1V7PC 2E55A 4BNNA 5EJ8A 3UATA 3FN4A 3WNVA 4B35A 4U5XA 3ZTWA 2O20A 4D9BA 2HR1A 1NDQA 1XEWY 2ORYA 2FE1A 6FD1A 5BR1A 4USJC 4CF5A 2O4UX 2HA7A 1CUUA 1GIAA 1FO1A 3TI0A 2XCOA 4YCDA 2JAPA 4INAA 2Z58A 1NX6A 2WB1D 5BR8B 1S6UA 3EPLA 1L1FA 3T5JA 4DCOA 2RGNA 2J9CA 3T4PA 1B1AA 1W76A 5JS6A 4BO9A 1GN8A 2WJYA 2B21A 4I68A 4BX0A 1D9FA 3W9JA 1X5SA 3PEUA 5AUNB 4UNPA 4PHHA 1ZNZA 2H4XA 3ENAA 3JAWB 5ETQA 1JN0A 1PGNA 1PR5A 3KNGA 3LYHA 4YAGA 2JAOA 2RSLA 3B48A 3JASA 2WUGA 2EZTA 2W2OP 4O0LA 5K6TA 3ROEA 2MQQA 4DGQA 3L93A 4N5SA 4WCFB 1WR8A 3I76A 2F4VF 2W4QA 3C6XA 4MQFA 3N0RA 2XHCA 3VPXA 3IJEB 4BQSA 1DO0A 1M9NA 4UREA 4N0PA 4GPD1 4PHCA 1Z2EA 3UCZP 3OZDA 4UXIA 2YN4A 4DC9A 4AFNA 2PEHA 1ODJA 1LZKA 4MK8A 3D0RA 2RVJA 3GLUA 1BXZA 4EQZA 5K8NA 1CULA 2QAGA 1NN3A 3ND8A 3EF3A 4GMFA 2HLNA 1U8UA 4C97A 2QTGA 2CL7X 2DBBA 2NXJA 4L3WA 4DMLA 4BTEA 3GWCA 3ZNQA 4LISA 3M6WA 2KL8A 2I62A 1VSBA 4CKBA 1SUEA 3KHGA 1X13A 4XRGA 3UV6A 3SM3A 4TN5A 4NLQA 2C5BA 5FUYA 3TNJA 3W7BA 4MXDA 2DT5A 2VTBA 2EW1A 3ER8A 1U94A 3U62A 3KMQA 4EYOA 3C43A 3IIIA 3RB4A 4I6YA 4QTUB 4ZOEA 5DOZA 3WMEA 1REGX 2NXNA 3V97A 4ER5A 1VRTB 2YWEA 4EGFA 4CUZA 4KRYA 2NYUA 2GA9A 1WMEA 3CONA 5BURA 4NFYA 3MPUB 4JI7F 3KE9A 1WZ2A 2UVVA 1MKYA 5KFKA 1RABA 5CG1A 1W8DA 1XUOA 4O3FA 2YHSA 3SLKA 4FEGA 3M5DA 4GE3A 2P4EA 1BEEA 5FTJA 4RVFA 5SY6A 3D3BJ 4AXIA 3V55A 4D4JA 1R6VA 4J9QA 1XMOJ 4DADA 3KUGA 2OUKA 4P58A 5BW4A 5KSYA 1DAXA 4FYXB 1HORA 4ND2A 3N5BA 3TZ6A 2Z4TA 5DRKA 5JMPA 3T5HA 1SB6A 1QZXA 4MQMA 1WW3A 3RAEC 5DGHA 2A6OA 4FFVA 3HUEA 3V00A 3F74A 2FK8A 2X9VA 4X64J 1DEXA 4TRMA 4BQIA 2GZHA 1YB2A 1OTYA 3CJKA 1NLFA 3RUIA 3PC6A 4ZVTA 2W2NP 2AJ4A 1CR0A 3IKVA 2HIQA 2FEKA 2JGEA 4R1NA 5CYOA 2FMUA 1Z8DA 1XEAA 5HI7A 3HCPA 3ZTRA 5JCPA 1IRXA 2WJVA 3VO1A 4GZLA 3LLUA 5DHQA 2EWMA 2XLIA 3M9WA 4WZZA 5JSZB 4AI6A 1T9TA 4ZPTR 2QGNA 1YJ8A 3DFMA 2PRYA 4R8UB 1BOOA 2HVZA 4L9SA 3BKUA 3NU1A 4TQRA 2EIXA 2C1EA 1RXYA 3ZHYA 5GIPE 4MJ3A 2VTBB 3CFYA 3WL8A 3VZDA 4JLKA 2O8EB 4I5FA 2F7SA 5AXAA 1I6WA 1TQ2A 2HBZB 2DNPA 5JXGA 4EF5A 1V1MA 3SK0A 3G02A 5FI3A 4ODIA 2BW7A 1NZFA 3LH5A 5BVGA 1Z0FA 1RYHA 4YB5A 3V2GA 2B1QA 3S01A 1FQJA 2G1HA 3QX7A 4JU8A 3G2KA 4DSUA 5HE9A 5I4CA 2DBQA 3N8HA 2AHOA 1EGMB 1F3FA 1IDOA 1YR8A 1JJVA 5G0WA 5CLHA 1KDZA 3O3OB 4GWGA 1BUXA 2R96A 2XF2A 3H5VA 4KHMA 3OY7A 3BULA 3QBJA 2GC8A 4YEDA 4FQ8A 2W2KA 1DT3A 4OX9B 4JHXA 3OZEA 1OR8A 1N5JA 4B74A 1XCPA 3EOZA 1WP4A 3RASA 1SOVA 4FGJA 1OXMA 4X60A 3JD2A 1HR0F 1UFKA 1IKYB 1HBOA 3S8SA 2K1RB 2P69A 1CFJA 3RSLA 4BKOA 3R7LA 2IDEA 3QXGA 2ZJYA 1BH6A 2WFAA 4OHBA 2G1AA 4AJ9A 3IBFB 4JR0A 5AOAA 1RQ7A 2MSDB 4V1CB 4LV6A 1QDUA 3FM9A 4DNPA 1QNFA 3LXXA 4G8BA 1P91A 3F9IA 3C15C 4F2GA 3QVJA 1P7VA 2CXXA 3GDOA 2QUJA 5T57A 9ABPA 5JYBA 1G2EA 1RT4A 3AFHA 5EJ2A 3CUSA 1QIDA 3QMMA 2XOXA 2DGVA 3QAUA 4A1FA 2CKDA 2WJIA 2VODA 2VJMA 3OZWA 3L8MA 4JJAA 1KD1T 1GRRA 1OILA 4YY3F 2WFLB 5ETNA 1R89A 1MOSA 3T95A 5A9SB 5LBIA 4JX8A 3I2JA 3EVBA 3OQ6A 3GLFB 1VQYA 1T4DA 1X4GA 1XXLA 3ZXSA 2AE2A 3RC3A 3ON5A 4F3KA 3STUA 2YHAA 1NHUA 2IOFK 2HW8A 2EJVA 4F4CA 2FGCA 2XUAA 1VQ7S 1FRXA 3UNYA 1H8HA 2PCJA 3P5BP 4PPDA 5DBIA 1UXGA 2JFBA 2J8AA 2Y6VA 5EHQA 2Z43A 3NAZA 1CJUB 4S0MA 5AM4A 2X8WA 3FMPB 4MK7A 2X6QA 3PG9A 3IPYA 3A1DA 5DKFA 5ADUS 6ABPA 3FOBA 2XIJA 4LCBA 1WF2A 2Y1DA 2NUAA 4DIUA 1X39A 1C0PA 2OM6A 1MABA 4UEJA 2VSNA 5IWAB 3PUIA 2E9ZA 2HRCA 4JI3F 2F3TA 1UPXA 3SXUA 2N9UA 4MGZR 1JE1A 1PG5B 1CUSA 4CM4B 3THOA 1E6WA 1S1MA 2QT9A 3WA7A 2QTVB 3V2UC 1SHUX 4G36A 5BV8A 1S96A 1YGPA 2Z04A 3DRRA 4Z4EA 5DMXA 4NCKA 4WW0A 2CHGA 2Q49A 1XPOA 5CG2A 4NXNJ 2FFRA 4ZARA 1WE2A 2HWIA 1AK1A 1BXGB 4Y2QA 3QXCA 2FP4A 3BWCA 1RHQA 3D0HE 1B3TA 2H5JB 2OB2A 1OZHA 5DTIA 2NUTB 1RTJA 2RKBA 2OWEA 4UFNA 1JJ7A 2LV8A 3PQ8A 2XWBF 3LPLA 2RGGA 4EG8A 2F8EX 4OK3A 4P4GA 5HDQA 3L9ZA 1J22A 1XNHA 2O5VA 1SCNE 5CHYA 3WIBA 5A3RA 1SUIA 3B8EA 2XSZA 4BLRA 3MINA 3I52A 4H2DA 4KWIA 3T38A 1RCFA 3FIJA 4E5MA 3WLLA 2H92A 1BS2A 4C7XA 5F33A 1XMOF 5DM70 1SK9A 2ISCA 3NM4A 1Z8HA 3HCOA 5JFTA 4RF4A 2XUDA 3DZHA 2NU9B 2XITA 4B7UA 4P75A 1RT5B 2FZ4A 1BHQ1 2HDHA 2G0TA 3HSGA 5LBTA 5EY5B 4DA8A 1K3FA 5E41A 5AI9A 3GMTA 3P5SA 3AHCA 1RZRD 4Z0HO 4JQYA 3RFCA 2HL6A 2Q3HA 4IRKA 3O84A 5CIWA 4AMUA 3HMKA 4X65B 2EKQA 3D7KA 1T1IA 3HJCA 5K2MA 3GJRB 3IUYA 2BYCA 1QVGR 2WUWE 3T35A 3RRGA 3JYOA 1YQXA 3IBYA 4B71A 3E1SA 2CJKA 2GN2A 3G0DA 4FFSA 2NNLD 4DHEA 3U1TA 2R7MA 2ZUGA 4KO4S 2KXFA 5DNAA 5HF8A 1YDHA 4OHXA 4H1UA 1NNDA 2PY6A 3HCRA 3ZVNA 2C99A 4D43A 4LW8A 2V9KA 2I4MA 1R1DA 2IA0A 4PC3A 2AGOA 1E1RD 4WZBE 2PU7A 3VH1A 3H3JA 3HP6A 1XF9A 2G0CA 1LQ2A 3H17A 5C7PA 3AIOA 1N6NA 2J0UB 5HXAA 1TYCA 1VQKS 1KZ9A 4XJTA 3I0SB 3AETB 5HVFA 1RTTA 5JYEA 4J2TA 1UBFA 2JL9A 1NJ1A 3FWHA 3HU3A 3S28A 2H1WA 3FLMA 2E5LJ 1MU2B 4UEQA 1O97C 2QA1A 1MX1A 4FF3A 2RAUA 3SJ7A 3U44B 5IPFA 1BKDR 5L8RC 1ZOIA 2JDIA 2IEAA 2DPHA 2R4UA 4WFYA 1VYUA 1VL0A 3SBDA 1DDIA 1HMVA 4L6CA 5C5JA 1JAZA 3GG1A 1AGNA 1GSIA 3KK3B 1I2AA 3KDOA 3OM0A 1B4SA 3B6MA 2R8IA 3R7NA 5DM6Q 2BC9A 4B1FA 1GG5A 4O3OA 4RCYA 5M2QA 4H7EA 2QDKA 4NYIQ 5CCMA 4OY3A 5SYAA 4HEJA 2XA9A 1JP7A 3DOIA 1L9XA 3M2RA 1SBZA 2A88A 4WXWA 5LZ9A 1B4DA 5HANA 3H5LA 4LX8A 4G89A 2VJYA 1RLCL 4M1SA 5KYXB 4PPZA 3DMHA 4JI2J 3PJEA 2DGDA 4PN7A 4PX2A 2W0MA 1QCCA 1GTL1 3MT0A 3L5KA 3QM1A 5FUBA 3ZU3A 4FNGA 5CXXA 4M5HA 2ZH2A 2QJRA 4XTTA 4HDSA 1N2IA 1PR9A 3HVAA 2FRXA 1JR6A 4DV2B 1BVRA 2YL2A 3MWEA 1WM1A 4S1PA 2DFDA 4ME6A 2XA2A 2LEPA 4NMMA 2H0QA 1RT6A 3EUEA 1UW4A 2HFZA 1VHTA 1K7YA 3DRXA 4AJEA 4TVOA 3KSRA 2MJUA 4LTNA 3DAPA 1CUEA 1S1XA 4COOA 3A8KA 2WZ1A 3MR5A 4RPIA 5FWAA 1NXQA 4W92B 4G97A 4BEBA 1IQZA 5AE1A 2C3PA 4UDOA 2O2SA 1FX0A 3SSOA 3K1YA 5JEEA 4LF7F 1XRSB 4BVBA 4MW6A 2ODAA 3J7YI 3QZ7A 1TCBA 4FDMA 4E70A 4O2BA 4U6PA 3IHKA 5HQTA 4RAQA 2JBWA 4WA8A 2QN3A 2RB7A 3N0VA 2GBLC 1MW7A 5F4BA 4GX1A 1DEHA 3N7AA 1RQPA 1OREA 3BKXA 4BNMA 3CPHA 3RJ5A 1B74A 5EXEA 4DKXA 4IH5A 2NM0A 3OLVA 3GEDA 5K3FB 2NV6A 2YINC 1T2DA 2OM2A 5GV8A 4BLOA 1IEXA 4A03A 5CAEA 4PZVA 3NJ4A 5AWFC 1L7OA 3TWZA 4PG8A 1Y37A 2ZXUA 4I1VA 1PP4A 4FBUA 2OCLA 3CNHA 1LWEB 2HGLA 2C97A 3UF0A 3ZWKA 3SF8B 1C1CB 5TVGA 2V68A 1NXOA 5K8JB 5KWSA 1WACA 1VE6A 3Q2TC 4MVCA 2HD4A 3N05A 1G2QA 4X24A 1LEOA 4MQBA 2RHOA 4Y6LA 4RS3A 3ELWA 2JATA 1UKCA 5C2GA 2FW8A 3HXQA 2R60A 4LF8B 4J0DA 2C2KB 1V1RA 3BORA 3RKRA 1KH2A 1IJKA 3HVKA 1Y63A 4R7TA 4LECA 4B02A 4P72A 1XDZA 3B6ZA 3U37A 3EWSA 2IRWA 1U0SA 3A37A 3P71T 1FXSA 3ELDA 3O21A 3DEHA 1F12A 3EOAI 2AFRA 3NANA 4R8UA 4KQ9A 3WWDA 3SIPA 3UA3A 4ES1A 2XY5A 3WNCA 2NQTA 2DXDA 3UT5B 4HXEB 1BC6A 3PL5A 4NVRA 3QIPA 3M1VA 2HA3A 1EFUA 3QPBA 2YKOA 2A3JA 4ITRC 1A7UA 4IUBS 2F64A 4RZHA 3IVXA 4DNXA 1E96A 1T3NA 3GI1A 2ZIUB 3E61A 2E37A 4BO0A 1FVFA 4W5QA 5ALFA 3VC2A 1CEXA 1U24A 5ALNA 2ZUTA 3F7NA 5B2ZA 1ZMXA 4UPDA 3V4ZA 1QAYA 2IYLD 5K6AC 3PE4A 4O23A 3UW3A 2TMDA 1FP1D 7FD1A 1TKBA 2CZCA 1N34J 5A05A 3PQ7A 4QXPA 2DHHA 2E1CA 3PFWO 3T1HJ 3BHMA 1LZLA 3O26A 2NLWA 1V3QE 1BQMB 4YJGB 3BFVA 5DN6D 4DR7B 4DQIA 3MA0A 4MIWA 3PWSA 2RJNA 4CGYA 4LSNA 2P9FA 2D2XA 4DIFA 4P52A 3R6TA 4TQGA 5JH7F 2XCIA 2GFQA 4OHKA 2K2WA 5L4LA 1P74A 2PGCA 4RF3A 3VTKA 5LOVA 3CMES 1E20A 4Q8EA 3H8VA 2BJ9A 1VMIA 1ID1A 4M0CA 2VLBA 3PKJA 3M5PA 3AJ1A 1V26A 2P2LA 3VO8A 3LF0A 1ZUD1 2DJWA 1Z0SA 4R1TA 1YGYA 2HCBA 4I2PA 3M0EA 1FDSA 1G9TA 2V7GA 3DOLA 4FXPA 4N03A 1D4ZA 1TL1A 4EB6A 3GLVA 1IN6A 2XJ4A 2W6ID 2GLTA 2RKIB 2J4FA 3UKOA 4HXGA 4OJ1A 2JLBA 1EDOA 1T29A 4OZNA 2OIHA 4RD4A 3OQVA 4YN3A 1C9DB 1QQ6A 2I66A 3R0ZA 2IE8A 4AQYF 1R8PA 4M8NE 5DM0A 1ORIA 5DM1A 3OZVA 2B0GA 3RTBA 1M6NA 3HDTA 3E4DA 1PJBA 4BP1A 5EZYA 3QO9A 1JXAA 3WK4A 2ZNYA 1VRUA 1VI5A 5E1MA 1GTHA 3H11A 3VGSA 3NM5A 3RV3A 4UVDA 5C7YA 3ICWA 2WSLA 3OZRA 4TXJA 1KYTA 3HFZB 1N5QA 1N3YA 1XVUA 1LWXA 3A1WA 5HP4A 3POTB 1QYXA 1IAVA 2XZDA 2W8LA 1J09A 2CQ1A 1QV9A 3W6UA 4YUVA 3LBYA 1UL1X 1GTG1 1SN7A 1NW4A 1R0AB 2ZEJA 2QTHA 5A4JA 3E5MA 1EETB 4BC0A 1NW3A 4XTCS 3CNLA 5FPHA 2R00C 4D9JA 4BCAA 5EE1A 2DLCX 4ZU3A 3ZWYA 4DLGA 1B0UA 4OHVA 1AB8A 4QU8A 4RIFA 2WBRA 4TYAA 5BVGB 1JXLA 3WQPA 1QC5B 1U2TA 1T9GR 1UOOA 3JU3A 3OKPA 3SCLE 4H16A 1JDNA 5L39A 4FNMA 2QQ0A 3PXGA 1YSCA 1ORHA 2B94A 3I12A 1OSNA 3EPIA 1LX7A 2WAYA 1TK3A 3FRYA 1RAGA 2OD6A 3JD0A 1I7DA 3NNNA 4LJ4A 4Q7QA 3HT0A 4ZHRA 1L6RA 1PUXA 4HB0A 1NRJB 4G4GA 4OFBA 2VWQA 2N75A 2XZOA 2JK0A 5AVJA 2AJLI 2W8ZA 3MUOA 3B5IA 3RU7A 2C7VA 1HT3A 4LOHA 5JSZA 3SQXA 3E5HA 5B4UA 2ZRAA 4QFBA 4HL9A 3I32A 2VUUA 4P33A 1EGQA 2C03A 3C8MA 2Q6KA 4ZVUB 2KI5A 2R751 1HD1A 4C87A 2WZDA 2ZH5A 2HVHA 2JI6A 3EVDA 4UMDA 1MIOA 2EFEB 3CEMA 3W5UA 2BZ0A 2O4CA 5LXTB 2AUNA 1QO0D 3X1XA 1IHPA 4BB6A 3M8QB 2IIVA 4NBLA 4E5SA 4BB5A 2X15A 3HB1A 1U9YA 3DC7A 1U7DA 4GO5X 1E3TA 3CX7A 4LHSA 1HDCA 1XN1A 4MJ7A 3CISA 2EKYA 4IHJF 4QJ3A 4TS1A 3KB1A 1N2SA 1N7HA 4GXTA 1JB1A 2JCBA 5D5QA 2V7QA 3SYZA 3CBQA 4M3NA 5CEEA 5K5EA 2B3DA 2HFSA 3WLFA 3V5NA 1ZRHA 4DV5J 1LTKA 2FFBA 3GGDA 4DAOA 2CQ2A 4PS0A 1OBFO 3OEED 1GSAA 4HGPA 2ANBA 1TA9A 1PYTA 3DAOA 1TKZA 4A8MP 1E0KA 2J6SA 4KWTA 4F4YA 2Z98A 1FI4A 1ODSA 3HE3A 2ODPA 1NT2A 3KHTA 1YULA 5CVVA 4ZCTA 1ZNYA 4OD0A 4RTMA 2QORA 2UVPB 3AKEA 4S12A 4TGLA 5HF9A 1SURA 4H6WA 1U8ZA 1T8SA 3S81A 1LLCA 3LTEA 2I2YA 1E2MA 4XLLA 3DV0A 1OPIA 2CQ4A 1KH1A 3SCIE 3D6HA 3SICE 1MB2A 1S99A 4U6NA 2HZAA 4GVBA 4GLJA 1FP4A 3D4BA 3TDNA 4MJXA 3POTA 5EIFA 3BOSA 3AVUA 4RMGA 4MPRA 2OQ2A 2R6R1 3I4LA 2R7NA 1PJLA 1UKYA 4F2HA 1WMFA 3SFZA 4AJLA 3I6IA 3E3MA 2OO3A 1U8EA 5AK3A 4OX9J 3RBAA 2PNFA 2VXYA 3IBCB 3GT7A 4M0LA 4WY5A 2GAFA 3P9RA 3E01B 3ROXA 2J1LA 1NJFA 1OXSC 3ZC3A 4EVSA 2D0IA 3AEKB 4NYIR 3HA3A 4YMLA 4M9XA 5JAHA 5DMHA 4E5PA 3WGZA 2HHPA 1OAAA 1I4OA 3ORQA 3BYZA 4HRXA 4HYKA 4WCFA 4X6YA 3BSCA 1YFLA 4CL3A 2C9BA 1G5FA 5DLQC 3CCFA 3B9PA 1YK1A 3NBYC 1FJXA 3NJ8A 3IT0A 4CRWB 5TT1A 4U67Q 5BV2P 2NU8A 2JIPA 5LSLA 1FX2A 4BTVA 2NXEA 4FNIA 1L5QA 5EJ4A 3NOCA 3JAWA 2DUJA 3AL0C 2DR2A 1UFLA 5M3BA 4ZPDA 4BV9A 1M1UA 2VKRA 1NUAA 5AW3A 2PJRA 3OICA 1JSRA 4M5DA 4JOUA 2YDYA 5EHIA 5FBRB 3R6GB 3O5AA 5JHHB 3VNQA 3VU0A 3SS8A 4CO0A 4YJHB 2QLJB 3ZIAD 2ZJ1A 3IG1B 2IRXA 1LBHA 1VG0B 3VCDA 1Q6YA 5EMLA 5HVNA 2Z1DA 3UGQA 4TXNA 1NH7A 3EZNA 2I1RA 1DBPA 4KR0B 3R3ZA 4H1VA 2OHOA 1IKVA 4RSHA 5DJ5A 5AKZA 2F9MA 4WESA 1VMAA 2B9WA 1F2HA 3Q8VA 1XDSA 4MVJM 3J80A 1WB6A 1HE4A 1RD4A 4PLTA 2NO0A 3I9JA 1XYVA 3KJIA 1M73E 4K9OA 5GV7A 3I9V9 4HMOA 3NZEA 1OXBB 5FLKA 1FFBA 1Z73A 3LQKA 4XGNA 4JQOA 5JNSA 4KPCA 4RQAA 1LEHA 4YJ3F 3M83A 2W2VA 3QKTA 1R4ZA 4YCAA 1Y5LA 3TTXA 3RHSA 3M82A 4EA9A 2PL9A 2GLXA 2YV4A 2BMBA 1V35A 1TELA 3A4LA 4J29A 4BNDA 5ILGA 3TD9A 4NENA 5AQEA 2HQIA 2E5LF 4ZI3A 2L69A 3EZ5A 3I9NA 1Q81T 2VDKB 3SSAA 4CKBB 4HVLA 1MVOA 4FQ7A 5G0SA 4OL9A 1KAMA 3IAM1 3CZ5A 4I56A 4KRXA 1G6OA 1VLZA 1M1ZA 4EPWA 3PLNA 1Z5OA 4HDGA 3R5FA 4DUGD 1MRSA 1OYDA 2CMHA 1N32J 2ZRNA 1D9ZA 5T4HA 1C9MA 4A8QA 5IFLA 4MCJA 4LZOA 1WCIB 4YS6A 1JLGB 4C7OB 3QNUA 4GICA 3CMMA 3LP2A 1OYVA 5IWAF 3V6DB 3MMCA 2ORVA 3CX8A 4HS4A 3G9ZA 2ZDHA 4QOJA 5A4DA 1G3OA 3VU9A 1WHVA 4NI2A 3HS3A 4ZMBA 1L4HA 2BR5A 3CRMA 1BQXA 3CH4B 1XKQA 2HMSA 3CW8X 2BJWA 1LGYA 4ZEOA 1FYWA 1C4CA 2X41A 3DZFA 4IRUB 4J3NA 3A8IA 1XFAA 4FI3F 2FCAA 1CJUA 4E08A 1EXNA 4M2LA 1VISA 3MM7B 2OMKA 3QRPA 3UDCA 1WBBA 2A18A 4Q5VA 1PJCA 4N18A 2GCOB 3L7MA 4P0PB 1C4AA 5IK2D 1K7XB 3BWEA 4R2IA 5JAUA 1ZD4A 2O5CA 1IN1A 2OO5A 2P2GA 4CQ1A 1S9EB 5AOVA 3HXPA 1R0LA 3H5XA 4D4LA 1WKLA 2R2GA 2P90A 4Q3OA 3E3NA 1FXDA 1HEYA 2ZI4A 3WLAA 4MGKR 3GRZA 1FJGJ 3LNTA 5J1EA 5C5IA 3KUXA 5JQGB 5J40A 2ZWVA 2G28A 1QP0A 4NMXA 4H6PA 3BV8A 4CKYA 1B23P 1PFWA 3KKLA 3GYGA 5C1IA 1Q3KA 1WORA 1TJNA 3F73A 3UFXB 2VNAA 3KR0A 5JI2E 5COBA 1RTDB 4LDZA 5DBEX 1RT4B 2I4OA 1I7QB 3DI6A 3LUGA 3COZA 4EYGA 3J7A1 5CB8A 3FCEA 1SCUA 1TX4B 2HYIC 2QI9C 4RU1A 1N1MA 4BV3A 3QEMB 4U9HS 1E9CA 2GQ0A 1KVJA 1SVKA 3WKAA 4BRUA 3UV3A 2QSYA 3OTOB 3ZY3A 3E23A 1YOBA 1B15A 5J47A 4QVIA 4ILKA 4QXQA 4HATA 3MI7X 1PJ3A 1N6RA 2IYRA 1BWRA 3HI9A 4YMEA 2M6LA 4C3KA 3KKPA 1BHNA 2WHXA 4RJ2A 5DZSA 4UQGA 1UFWA 1FFYA 1NXPA 4PXBA 4X94A 4UTGA 5A2QY 1HDRA 4IIJB 4PRLA 2P78A 4F6RA 2NZJA 2UXCB 4V1Ak 1D2EA 1HBUB 3MAAA 2D8AA 4FDLA 4EITA 1UWBA 3LFHA 4OI2A 2NP6A 2RE8A 4GEKA 2H17A 3UPDA 2EX4A 5CT9A 2JEFA 3DMPA 2Y1RI 2C4NA 4PWUA 2GVNA 3RIHA 4DVGA 3OPMA 3OFFA 3RJMA 1VBXA 3TM5A 4MA0A 5L6MB 5IXJA 2DPGA 3CCMS 4LQ9A 1T4GA 1MG0A 2Y3IA 5LMZA 1GZ5A 5KOXA 4ED6A 1K3TA 2G76A 4F7WA 3M6XA 5AKIA 2ABWA 2OR3A 2GXSA 2DNRA 3N7UA 1P1TA 4TT8A 2D7SA 1C4WA 2XSJB 5IKPA 1ZGBA 1HMPA 5BRNA 1FUUA 3QXXA 2ZGVA 1XRNA 1HK7A 1R0YA 1DAFA 3EDYA 1PIEA 2C2XA 2MSCB 4YMIA 4S05A 5D3GB 4IXTA 2YW9A 2IU0A 2FXIA 1J49A 1KDOA 1GZSA 1KL7A 1FUKA 4RH0A 2RGNC 4J4HA 2YV1A 3FSRA 1EAMA 3FK4A 3O91A 3AQPA 4EI8A 4YLEA 5CH3A 3BDIA 1PT5A 5DZ7A 4P1ZA 1C0TA 1PDVA 2LDIA 2G8LA 3TCNA 2FFJA 2VZLA 3OOJA 2XQCA 1QAXA 4D02A 2B6HA 2NZ2A 2IEZA 4RNNA 4OBXA 2CAJA 5ELMA 4IGKA 2DVMA 2IA6A 1HR0J 4Z2YA 2DHRA 3F1LA 4D2IA 1CY8A 4LBVA 4RVCA 1ZY2A 5BWBA 5PNTA 5L3RA 1FFGA 4NPCA 4HNUA 4JC5A 1Y1PA 4Y6GB 5LQRA 3DWGA 5FO1A 3MLAA 5ICSA 3TBFA 5IAKA 1HZZA 1X2BA 1NMYA 2BEKA 4XSVA 2EFYA 3RC7A 1T9UA 1NJYA 1DL5A 1E4OA 3ZE0B 2IYXA 2FP4B 3B52X 2Q79A 3LRTA 2EZ4A 1OQ3A 4B81A 2IOQA 3C5CA 5LIPA 2NO7A 3G0BA 3NC0C 4B6QA 3QU9A 1MLAA 3E9MA 1DZIA 2F8SA 4L76A 4EY5A 2VF2A 4K9RA 5DHAA 4I5GA 4CM4A 4IFYA 2PT0A 1Y8RA 2W8KA 2FWPA 1XROA 5IFMA 4BPBA 1GDTA 4ZA1A 4D44A 4GPBA 1SG6A 1Y7TA 3D59A 1GTVA 4JR2A 4L57A 5DK4A 3I0NA 3ZHQA 5KOJB 1IQ0A 3H5UA 3KOOA 2W6ZA 2JIQA 2ZIWB 1TM4E 2BANA 3T1YF 3BSFA 4ZVKA 5BN3B 4HYYA 4P7GA 4JIGA 4XIJA 4RFVA 3BCUA 3MMBB 1DKRA 3FR7A 2JA2A 2HADA 2QQFA 4LMPA 4JQSA 5I4BA 1WNEA 1KHWA 3WAGA 5JMNA 3ENKA 2Z09A 3CDWA 1MSWD 3GFYA 1KK1A 4HNAB 4R8RA 3X1YA 5KU1A 1A71A 2QLXA 1JEYB 4ENRA 1FNSA 1JALA 1H4TA 2P9QA 3TOSA 2C2MA 1Q7TA 4DR6F 5TF4A 1H3DA 1IWPB 1EFRD 4J1SA 4TQUS 2OY0A 5G02A 3D6AA 4QGAA 2YJZA 4RVUA 2WFMA 2AEEA 3O8OB 4BDTA 2KFYA 1ST3A 2BANB 1JEEA 3SYMA 4AD6A 3K6KA 4DV3J 2C9MA 2RGCA 3ESQA 3G82B 4HAXA 2CMGA 1NKBA 2ZBCA 4O6VA 1M8KA 2DBZA 4I4IA 4NBKA 1EP2B 3L7DA 4HR2A 4JLOA 2HJ9A 1TKCA 2HWWA 4HWSA 3CO9A 2VHYA 4RUHA 3O7MA 1J6UA 1BN6A 3GG9A 1RYDA 4U3JB 1DAOA 3G6YA 3DVAB 3NMRA 5CD4H 2QAGC 2WSEC 3KJGA 2XZLA 3DE2X 3G7UA 4PSUA 3BGLA 2HJVA 2MIIA 1YJTA 1KBOA 1QH8B 1XMBA 1WF6A 1V11A 4OGWA 5F76A 2RF2B 4CDRA 2E5FA 3FUUA 1UJCA 3FYUC 2FLLA 2HK9A 3CIFA 2C7PA 1OHHD 4M37A 4GI2A 2ZDGA 1ZPVA 3W06A 3E7DA 1YS7A 4Q45A 1LOUA 3ZBUA 4F92B 1AZSB 1VQPS 2RI1A 2FOXA 3VTAA 3LDUA 2B8TA 3MCAA 3D3CJ 3C7CB 2VSQA 2AN4A 2BONA 4HL6A 2HIYA 2YPYA 1CX9B 3AR8A 3DLGA 2VZ9A 4KK4A 1W0CA 4CV3A 2LA4A 3V80A 3VZHA 1JJFA 1FXWA 3JZDA 4R8MA 3QF4B 1HTBA 4LOIA 3PTZA 1SXJC 4N5DA 3T9DA 1NUQA 3WK5A 4N01A 1LDMA 5B1SA 4CMEA 4RSGA 1SL2A 2OC4A 2IC3A 5K8IA 2GPYA 3PRVA 2P8IA 1PNQA 3CUVA 4OJHA 2KLBA 4HP8A 5D0RA 1BCSB 3G1UA 4UVEA 2AYGA 2QFIA 3LCMA 4DSNA 1DIGA 1BD6A 5AK0A 1PK7A 1DOZA 1MOPA 2CJAA 1VLLA 3ZC4A 4MFBA 3R74A 1SJQA 2AZ3A 3EC2A 3GR6A 2NPOA 4RZSA 4LRQA 3VNAA 1F48A 1QFJA 2QA5A 4LDJA 1XLWA 3ZQJA 3BF7A 1W59A 1YAHA 2QRVB 4L50A 4BS2A 1H0HA 2AXNA 1L3TA 2DFTA 5M04A 3A6GA 1PNVA 5L8VA 1C29B 3FD8A 2X8BA 1JYEA 4B46A 5AKEA 5KYUA 3DEAA 4I66A 1SXJB 3I73A 5LVAA 1Q8LA 1HBUA 1HEUA 1WEHA 3VV3A 4I6AA 4DL3A 3NCRA 3NS6A 4HQKA 3GUYA 5B37A 4Z7YA 1I2CA 4ZOSA 3K5OA 3ZFVA 2VNIA 2Q3CA 2Q0SA 2O54A 1TMYA 4WCFC 1E9BA 1JKFA 3GWGA 3CRRA 1O3YA 2J3KA 4I7FA 3LM8A 3P52A 3H0CA 3UJ8A 4UU0A 3QQCD 1AN9A 4GZ3A 1RI2A 1BMQB