1M0SA

Northeast structural genomics consortium (nesg id ir21)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21
rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
molecule keywords Ribose-5-Phosphate Isomerase A
total genus 72
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m0sA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m0sA01
3IBWA 1HORA 4L4YA 2RI0A 5IT4A 3NRBA 2BKVA 3HN6A 2KO1A 1FSFA 2NYIA 3OFGA 2QMXA 5HJ5A 2WU1A 2FGCA 1VL1A 3K5PA 2J0WA 1FRZA 3TX2A 2JOQA 4GMKA 1RWUA 3U7JA 1DEAA 1PSDA 3DC2A 2DT9A 2RQKA 4X84A 2W48A 1KS2A 3HHEA 3MWBA 2J0EA 3BXEA 3NWPA 3UW1A 3DHXA 3BXHA 1U8SA 1Y89A 1YGYA 2O0MA 2JHEA 2ZHOA 3ENVA 5FIIA 1CD5A 1YBAA 3BXFA 3TUJC 1UJ6A 3TUIC 3IXQA 3CEDA 2R5FA 3KV1A 3ENQA 1UJ4A 1O8BA 2QSWA 3OBIA 3N0VA 1FS6A 2CDQA 4OQQA 3AAWB 3TUZC 4PWUA 1FS5A 1JT9A 4M8LA 4IO1A 5IS2A 1FQOA 2MDAA 3CSSA 3OFEA 1HOTA 3E15A 5IT0A 2LVWA 4LUBA 3LUYA 3AB2B 3P96A 3BXGA 1Y7PA 3AB4B 3LOUA 2GNPA 3CH7A 4R7TA 3OFHA 4GO5X 2F8MA 2OKGA 2QMWA 2PC6A 5T41A 3MAHA 2RQMA 3W7BA 2F1FA 4GO7X 2DTJA 1SC6A 3MTJA 1M0SA 3EFBA 3LWDA 4TM8A 2BKXA 2RI1A 1LKZA 3KWMA 1PBTA 4L5IA 4GO1A 2I9SA 3DDNA 1XTZA 4TM7A 4L4ZA 4R9NA 2RE1A 1LK5A 2QRRA 3OC6A 4L51A 2J0XA 3ENWA 1ZPVA 4L5JA 2H9ZA 1LK7A 4OQPA 4L50A 3O1LA 3E7FA 3S1TA 3L7OA 3EB9A 3LHIA 3NZEA 2P9GA 4NMLA 3OFFA 1NE7A 1UJ5A 2P9CA 2P9EA 3ICOA 3DHWC 5JJBA 2PA3A 2LQJA
chains in the Genus database with same CATH superfamily
4L8LA 1KC1A 2NR0A 4KGXA 2WUGA 5BW8A 4DCSA 1G1AA 2YNMC 2JX2A 4FFSA 4CKEB 1PDVA 4UNNA 1H7XA 3IVAA 5ELXA 4JI3B 4RNMA 1WXEA 2JIQA 2ZBUA 4HS4A 3GWCA 4W9MC 4MR7A 4ZPBA 3I6QA 1C9EA 4O3PA 1NKTA 4NH0A 3AM5A 3HFGA 3RROA 4P83A 1Y1LA 1N2CE 4BVGA 3NNSA 1U8XX 1AKTA 1GL3A 3R7DA 2AC4A 2EATA 1UQUA 3MMAB 3REQB 2VSXA 4RLSA 1YT5A 2DPHA 1OIWA 3D0OA 4BNDB 2Z2MA 2JFDA 2YWJA 1PIEA 1HC7A 1ISSA 5LZ5A 4EPYA 3HPRA 3RS7A 5AKLA 4QFCA 4TYMA 4YJHB 4KDRA 1S6UA 3GWGA 3W60A 5EKSA 1UWBA 4BO2A 2IPNA 4UVEA 3E1KA 4PQGA 1XLTA 3DZ8A 3ZU3A 1ZRSA 3H5AA 3MCOA 4P93A 2E7VA 1V5IB 4MW9A 4HTFA 4K6OA 5AW2A 2IP2A 2C9CA 3KALA 2C2ZB 2FETA 5H0IA 2FPGA 3VM6A 3JQFC 4MQEA 2RUSA 4FI3F 4MAFA 2I3BA 3E8SA 3AP2A 1N7HA 2AZTA 4FHDA 1OKKA 3K4HA 3H3XA 1YE8A 1T0BA 3N6LA 4GXQA 1DC6A 4MJXA 2O3SA 3VKGA 4QHYA 2B98A 1NQXA 3H4MA 2M2IA 3MAQA 2ZRCA 1MC5A 1DC4A 1VZ3A 2N47A 2GD6A 2VKQA 1F6TA 1Z5WA 1GPH1 1YJRA 1GPWB 5SZIA 2QP4A 3I2HA 3FYCA 4BKUA 3NP5A 2EF1A 4KQMA 4FNAA 5FUYA 4OQFA 4DCOB 5KMGB 3U7GA 2WE7A 1MC8A 5DGTA 3US5A 1LA2A 2ZM5A 4UY85 1LNSA 2JF0A 5EC8A 3SEFA 2C0QA 1JDVA 1ZOTA 1P9QC 2XNHA 1B14A 2EKNA 4I4TA 2VDIA 3O8OB 4TVKA 1T2DA 3PO5A 1YVUA 3ONVA 3UIEA 1U4OA 2VJBA 3EXCX 1WBJB 3ZDDA 5BR1A 5BNFA 2O1WA 1RHUB 2ZUEA 3F73A 2V65A 2NLWA 4NYJQ 4OX9Y 4UAUA 1SQ5A 1I0LA 2HCTA 3T1TA 2BTQA 2EEZA 1HTBA 2WJYA 5A3JA 1RC1A 1I7QB 1DXYA 4DGSA 3AT1A 3K9GA 4AJ2A 3ZG6A 3SHQA 2G08A 4L6IA 1N6RA 3H7IA 2DWQA 1HQDA 4GQAA 4I9GA 3UOAB 1BXRB 2H7XA 2XQJA 2P6SA 2W7TA 3A4LA 4YRPA 5KU7A 1O6FA 3EXHC 3LGXA 3ZVNA 5DS7A 2ZDGA 2F9FA 4R6WA 2XXAB 3L01A 2E5IA 1RTIB 1QHHB 3BBFA 1N4DA 3BL5A 1RHUA 3N5FA 4N3CA 4GEGA 3BB1A 1SC1A 2I62A 4FHEA 3CDBA 3S2SA 1FFWB 3IL2A 3H99A 4F67A 3TANA 2WHOA 3UM9A 1Z15A 3M0EA 3CCWA 1FF9A 4DF8A 1W75A 3CLRC 4I3GA 4K9LA 4CV0A 4R0MA 2QV7A 3TS1A 4Y0FA 3DBVO 5BPHA 1T5HX 3C3XA 2FVPA 5LZ7A 5EP4A 1T6XA 4G1IA 2D1RA 4YAUA 1BXKA 4JLVA 4EI2A 3RUAA 5A4MS 2BEWB 5HCNA 3HB7A 2JZNA 2FUG9 5GV8A 1JLBB 2ZJZA 3HJVA 4O2AA 2X58A 3TUZC 4X24A 1IPEA 3VHLB 2N46A 3NHSA 3OO0A 4N8OA 2DO0A 2FWJA 3JTPA 2YJGA 2EQAA 1WTFA 2WLTA 3MZIA 3PUVA 2IITA 1Q84A 1ES9A 2IDMA 5GONF 4PLCA 3R7BA 2MHEA 1L9KA 3Q8PB 2PZ8A 4URWR 4P34A 4C89A 3OOYA 3OXLA 4GO7X 2C59A 3UH0A 3R5KA 4H4EA 2ATVA 1OASA 2EGUA 2X0RA 3WYBA 2NG1A 4ZHRA 3L7CA 4TRNA 5AXDA 2OWEA 2IL1A 4NK4A 3CNEA 4HT3B 1D1QA 1VRTB 3GC6A 1OH5A 2NPOA 2ZYUX 3W9UA 4RD1A 2B6AA 2FPGB 3WK6A 3VKFA 4TTJA 1YB7A 2HNKA 4MP3A 5IT9Y 4DUYF 2ZITA 2NV0A 3GRKA 3JWEA 4LXQA 2OM6A 5CRIA 3G59A 2R1VA 4B5KA 1RDFA 1NJWA 2RSLA 4UDNA 5U47A 5FI0B 2PLAA 2G1HA 3OR2A 2HTFA 4ZQGA 1N2ZA 1IHDA 1FKOB 5TE9A 1PC5A 2HG4A 2AH5A 4J1NA 1XMOJ 1E64A 3A6FA 2OESA 4ALIA 4JJGA 4IJ6A 2XB4A 3TEJA 5FA6A 3OQ2A 4PWWA 3KT0A 3IA7A 4FXDA 2UV8A 4QQBA 2ZD1B 4C4XA 1X8KA 2GTHA 5DM2A 2GNPA 3FWZA 5EJEA 4LY3A 1EAMA 2JFYA 4JL8A 3FJYA 2NU7B 4N7MA 5LOQA 3L93A 1YKWA 3MMCB 4W1QA 2W42A 2V67A 1LC0A 3E9MA 4ECTA 4U02A 3WYDA 2VOJA 4DCVA 4RABA 4G9EA 3VAHA 2KVIA 4ENWA 2ZBFA 3PI6A 3FUYA 4RTOA 2Q7XA 4G5OA 1ZK0A 3HLUA 2R6JA 2Q5EA 3ZE9A 1SXJD 2KT3A 2GLTA 1H2AS 5C5IA 4JYMA 3GFRA 3L46A 4KX5A 3WJ2A 2MLZA 1GA4A 4ZZ3A 4R81A 1GNPA 3NDBB 5IH7A 3U7JA 1M1UA 4DNQA 4FIDA 3WLIA 3BTVA 4R7ZA 1N8KA 4B4VA 2OBMA 1NK7A 4IDQA 1SELA 1JPNA 4LBWA 3X1LB 1DJOA 4FWIB 1A9YA 2I3GA 2D0OB 2HXYA 3ST7A 1RWNA 1F9EB 1S89A 2HIHA 1HARA 1FIUA 5EI5A 1Y6GA 1SXGA 3OEYA 1Q17A 4IOLA 4ZJPA 3QE4A 1FC0A 4UNPA 1BKDR 4EELA 3ORHA 2FQQA 3V6KA 1W88A 2E4UA 2QX6A 2VTDA 1ZOPA 5K3FA 1WZUA 1YJVA 4LIPD 1OAOC 2CVOA 4XX1A 3N0TA 1R6XA 1CIJA 3RD5A 2IDJA 4PE5B 2GC8A 5DX8A 1RHKB 1RYZA 1RXEA 3KCNA 4Y0AA 1WNTA 4WLFA 2HMWA 3GZJA 5KQPA 3O3OB 4YALA 1EYZA 1KNZA 1PBNA 5LU9A 1PE0A 2ZJ0A 3O9ZA 2XR1A 2LFVA 3R5CA 2N9UA 1K89A 5KNBH 3R3HA 1GG8A 2P2ZA 2HIQA 1CBKA 2NXJA 8AT1A 3H19A 2EGGA 1YGYA 4YY3J 1IKVB 4ALJA 3QPAA 1U9IC 4RFLA 2Z1MA 2PD3A 3HB1A 4LHXA 5HK8A 3HHNB 4FILA 3NOQA 4PLHA 1XTRA 4DQ0A 4BGUA 2DPLA 5A8RB 5KVAA 4M94A 2YVUA 3EGWA 1X9HA 1UANA 4YRIA 3FWHA 2P41A 1FQWA 1NO8A 3AVVA 5BNWA 3W79A 5JDIC 1YQTA 1T03A 1PS8A 1F2DA 5C42A 3CMQA 2B9EA 3ADPA 1FJCA 5KNBD 3D64A 1T4BA 5FLXU 3L7YA 3JZAA 2I65A 3FCYA 1WQ3A 4IIXA 3ZHCA 3L8MA 1YZKA 1OI7A 3FG9A 3KBBA 2Y3YA 1LOUA 2O7VA 2DLDA 3DXFA 3GXBA 5IAKA 2CCJA 2XXBA 5KINB 5EGYA 1ML4A 3PCOB 5JANA 4H15A 2N0SA 2QNIA 3GP3A 4K9SA 2W9BB 1D6JA 3DCYA 3M5DA 2Z5FA 3GRPA 1CE8A 2VDQB 4RLHA 5FL7A 3THOA 4UTZA 1LW2B 3STXA 1PK8A 4FYXB 5JNVA 1PZMA 2KB2A 1ILEA 3OZFA 3DMTC 1EFRD 5C42B 5REQB 3C6BA 5IBRA 4EYHB 3BSAA 1OVGA 2VQEB 2VWGA 3DE3X 5K99A 4V2UA 1QNFA 3BGRB 1RFGE 1II9A 3DS8A 1E7YA 1RXYA 4KTTE 5I5GA 4CF3A 2F8TA 4EBDA 2BPOA 2V9CA 1GG2A 4C3ZA 4S0XA 3F6PA 1KDVA 1W4CA 5CFNA 2VG5A 3V81B 1T9AA 3KTFA 4GECA 4YJFB 3C8ZA 3OCCA 3DVAA 4U2FA 5DTMA 5GMKa 5KOWA 1Q1NA 2SICE 4QL3A 4Z7JA 4JP3A 1EB0A 3M2UB 1J8DA 2ZRLA 3EZYA 1W30A 3IP1A 2A8YA 1WP9A 4EGAA 3ZVLA 2PJDA 3HZEA 1KC3A 3SHTA 3MTDA 2AFRA 3D6TB 1RWUA 1EFKA 3ZZPA 2E5FA 2ROEA 1KS2A 3IIEA 5CTAA 1ODSA 3GH1A 4OUKX 2WAOA 3RG6A 5F52A 4UF4A 3UFXA 2R66A 4ICIA 1ZW1A 3K9QO 2DGTA 3SSQA 1JKXA 1QLHA 4ZTBA 4P38A 1NBAA 2PVCA 3AQIA 4UUWA 4PQUA 3BQ1A 5IN5A 4IG3A 3WGQA 2VAMA 4OQXA 4RDCA 5EERA 1HHSA 3R6TA 4LBIA 4Y2MA 1GCUA 3RPEA 2F9MA 1Y9JA 1YBTA 3Q85A 1SJ1A 5KYUB 4RAQA 4IO9Q 2DR0A 3TMKA 1EDZA 4FDMA 1TL4A 1SKRA 1ZC4A 1YRTA 3KQOA 2GAFA 3CE8A 4OHBA 1JA9A 3LC0A 1NWHA 4MW1A 1UBSB 1VKRA 1L5UA 3YASA 2QSUA 5BSUA 3I72A 3TSCA 4B9UA 5FWYA 3A3YA 2JC3A 1E2HA 3DW1X 3M30B 3O2NA 1TV6A 2PL9A 4UU0A 1P27B 2PXAA 2FD2A 2P5TB 1HYSB 4CO4A 4F93B 4HEA1 5CT6A 3AUAA 2X13A 3OIUA 2X6RA 3Q7TA 3MYYA 5HSGA 5GZ6A 4LF9B 1NG1A 3S2UA 3RC8A 1GTJ1 3NGLA 4KR6A 5A7GA 4QBIA 3EZXA 2HV8A 1IKXA 2HFZA 3MJRA 2RDJA 2KH9A 1ULSA 3LYHA 5FHQA 1KI4A 3PLAE 2RHDA 2YS6A 3QEJA 4ND8A 4R98A 4RX6A 5FFNA 4LF9J 2E1AA 4MV7A 4RD6A 5D0EA 5B36A 1MOQA 3D4IA 2C2MB 4RJIA 2QAIA 1QZUA 4EYKA 1Z4LA 2ZRAA 5D6NA 4DWWA 5T6MA 3KYJB 2YBDA 5CVEA 5LIPA 4UU7A 3FIUA 3UAZA 2AWNA 1HLWA 1XWLA 5HQJA 3O21A 5KSPA 4OB7A 1HLDA 4WKRA 2VR1A 3OZSA 4L85A 4L51A 5GVSA 1P18A 5C8YA 2RS8A 2JA2A 1DAHA 3DT8A 3WLJA 4J37A 1D2GA 2NW6A 3CB2A 4ENTA 3LBFA 1A0OB 4YONB 2JEFA 2IS6A 2REQA 3NBPA 2Z57A 2YQZA 3GJ6A 1SBCA 3EVNA 5D0RA 4KYIB 1FDRA 3K5LA 2NQTA 2C9OA 1WZCA 1YA8A 1PEKE 3AU8A 2WKWA 3KV3O 3ZU6A 1W1IA 3DE4X 4JLWA 4I56A 2XHEA 3DDIA 3M5CA 2P1RA 1K27A 2XXJA 4ZN6A 4MDFA 1WU8A 4DCJA 4RGBA 3IA2A 2M1ZA 1IR1A 2LQ8A 3VU8A 5THXA 1B6RA 2RONA 2UU9J 4EK9A 5AXLA 4X6UA 4EB0A 4AY6A 2AX0A 5M2UA 4N5HX 4ITSA 2G83A 2ZC4A 5ICMA 1Z7EA 5F73A 2OO5A 4ESVA 3I0RA 2ZWMA 3KPYA 4NLTA 1ROFA 3ROXA 3ZZMA 5ECYA 4P3KA 3KHGA 2I9SA 4A2CA 5MFZA 4K5RA 1ZSYA 5GPBA 4NLUA 1SVWA 1RT3B 2D7SA 3HP4A 1YJ9S 2HS3A 4CLDA 2R1UA 1TI7A 4ILMA 1X4HA 3CF5Q 2JIBA 4EY3A 3UKDA 3QVUA 3U40A 2ZKLA 3GZNB 1FDNA 3RYFB 3QKSB 5HYVA 2UZ4A 5G41A 1Q5VA 1A6LA 2P9YA 5AE3A 3JS9A 4L8GA 2ZHOA 3W3SA 2XNDD 1LCIA 4GIBA 1JKHB 3KM0A 1ISHA 3RWOA 1KO1A 4M6WB 3BRWA 4PG7A 1HW8A 1JMTA 4KFSA 2X2PA 4D4IA 4WNCA 3NXKA 3PUXA 4HVCA 4N76A 1U2CA 2ZGVA 4X62F 3AKYA 3TW4A 4GR9A 2W6MA 2YRXA 1LWCA 5HQLA 2DSTA 1VCIA 5LXTB 4XQ0A 4RNDB 3NI2A 1XRRA 4G89A 1ESDA 3AOAA 1G8AA 3M6IA 2VYQA 3KPVA 5BUSA 3GVIA 5L7WA 2CLOB 1SOWA 1OJ7A 4HNUA 1XWIA 4IPTA 3P8BB 4BU0A 3EWAA 2L0XA 4QPXA 4AN1A 1NNSA 1F6DA 1KFBB 1N9GB 1AK1A 4WA7A 2GZHA 1KWMA 1Z37A 4KBIA 4GEKA 5AVUA 2GN2A 3RS2A 3RIMA 4TKUB 4DYVA 2ZVSA 1R50A 4JSRA 1DEKA 3G9QA 1HNIA 1L5KA 3TBHA 4ZV7A 4H35A 1HPZA 3MW8A 3MCSA 3AOEC 5CYOA 1RTZA 3D1LA 2ACVA 4BXOB 5C7OO 3RW9A 5IASA 1VJDA 1FW6A 2VCEA 3QM1A 5MN4A 3J81A 3DKDA 1TTTA 4WJZA 4S1VA 1WE2A 4FUTA 1WA5A 2O6HA 4R2HA 2NU8A 5HQ3A 4YRFA 1AFJA 2GZ3A 1E92A 3M6FA 2A9KA 4EFMA 4CNBA 2FPRA 1EKRA 2K87A 2DEIA 4M0FA 1SVNA 3MB8A 2K3KA 1H3DA 4RJVA 1XGKA 3H3FA 2PMEA 3RRYA 1G55A 2RHQB 5KNDA 4E5NA 2QIOA 5I7RA 1YJ5A 4RM3A 3WFZA 1GZUA 1RT7A 1S1WA 1OHHD 3UG6A 5IABA 1G7TA 3KUDA 3X44A 5MFPA 1TFUA 2AI3A 2PBRA 1G6OA 3CLTC 1DOAA 1N2EA 2DBRA 3Q3JB 3MHYA 3UDLA 2W2QA 3N6MA 4CCHA 4RGQA 5IM4F 1Y6RA 3GMTA 5EP2A 3A6DA 5IC6B 2Y0EA 1GFIA 2G7MC 1ONBA 3HY6A 3ZJTA 2CVZA 5HVFA 3SZMA 3OQNA 3QH4A 2ZIEA 4FEAA 4JHLA 4UE6A 1IBKB 4LIWA 5HRUA 1ZJWA 1DJPA 3PM9A 1VJ5A 4FW9A 3AA9A 3CH7A 3D3CJ 3HY4A 2G0IA 5KDOA 2B51A 1A5ZA 4EGSA 4NZ9A 1US8A 4BZZA 2IJNA 2QMZA 2P6RA 1JHVA 3ZQ6A 3DDZX 3FPBA 2HGSA 1M1XB 3BPSA 4EKIA 4C3LA 2Y9PB 4QWMA 1ECGA 1H2ZA 1K9MT 3UICA 3RUFA 3PR1A 5J59A 1QJ4A 3PRHA 3WK7A 1K3UB 4LUCA 1JQDA 3DT6A 3GAAA 4LF7J 1DBIA 1E7QA 4G2NA 1XR5A 2R1ZA 3RS0A 1LDEA 5EE0A 3CC2S 4Q39A 4CIDA 5A2GA 3NH9A 3QU9A 3S4YA 4D6PA 5CYJA 1UVKA 2J31A 5DQHA 4EY7A 4BDPA 4OHMA 4RKUC 2H5IB 4ELUA 2WT8A 1B76A 3O2JA 4DXDA 3TZZA 1YB4A 3BSYA 5ED0A 1FDBA 3OF3A 1QQBA 1PAEX 3ZZYA 3A8IA 4PZAA 4E1AA 4NBKA 2GK3A 2C7OA 4IICA 2M7SA 1QF7A 3KHTA 4EVQA 3GBVA 1SKSA 3MF4A 4DE5A 3BJYA 2HXSA 2AOWA 2E3JA 2GM9A 2DITA 1RYEA 2XAAA 4EHLA 3MM7A 4LVNP 1CDZA 4IEEA 3ZTPA 4B9EA 2V6JA 4NCKA 4XGRA 4LKRA 2DNRA 3TQCA 2ZPAA 3ZVKA 5KTMA 1RPZA 3FROA 1QDUB 1M8FA 2C2MA 4FVTA 3LK7A 2WFLA 3LCRA 1KLNA 4G84A 2PH3A 4JJFA 5ER6A 5ELLA 2HFOA 3GHHA 4J4HA 2AJ1A 2IZ7A 2BE2A 1RAEA 3JU3A 1JUDA 2AXPA 1P44A 3OIWA 2DGQA 2HSEB 3DLKB 1SXIA 5NULA 3VV3A 3P9IA 2Q6TA 4Y9UA 5KG0A 4LSNA 4K4SA 4RW8A 1BWEA 3S1AB 4EW6A 1ZRMA 4DC9A 1OVMA 1S02A 1KMNA 2CJWB 4NYZA 5A8WA 3TOVA 3NBYC 2D0DA 4ZK6A 1VMBA 3LYUA 3UBTA 4P33A 4CLKA 5CFZA 5J4HA 3KWJA 2AC2A 4OXRA 4FB4A 3L1UA 1U65A 3VZPA 3KYCA 3T06B 4WBXC 4EUNA 5DO9A 3C1AA 5DGXA 3WK4A 2IS2A 4RGYA 1GT6A 3GGGA 4WKGA 3QTTA 3SQXA 3SS7X 1U7HA 4RLQA 1FVOA 3A9SA 1VYAA 5E4YA 1BMQB 4AE5A 4G63A 4HAOA 2EJBA 1C0TB 3KG4A 4Q4JA 1EM8A 1WB5A 4U7WA 1DAFA 3ZK7A 4MWOA 5CCBA 4EFLA 4Q9DA 1WG5A 3V00A 4OFWA 3AZPA 3PFHA 2IS1A 4W7SA 2QRRA 3U62A 4BQQA 2EU8A 2BVNA 1KEEB 2DBVO 2O2DA 4MYSA 1H6DA 3OT1B 2O7RA 2QJRA 3AHPA 3LUBA 2QV0A 5JH7B 2M3DA 3GJSA 4M8IA 4B0PA 3UDEA 3A6PC 4KXMA 4G85A 4FD2A 3ADAC 2Y0CA 3PWTA 1NBOA 1VQ4S 2H92A 1KI8A 3H6GA 1NTRA 2W4PA 1DLIA 3AW8A 2W5UA 2J07A 1LXCA 5EJ2A 3GIWA 3A4IA 3CDAA 1KI3A 2JRSA 5CXQA 3PJXA 1SKYE 3V4MA 3AR5A 4K6FA 3HKWA 4YQEA 2MLXA 4IO1A 1NATA 2ZB2A 1D0EA 1YITS 1GTRA 2H3EB 2O59A 2IHVA 2VDWA 4A8PA 1CR2A 3IO5A 2YVSA 4GZ5A 4DV2B 5K01A 4TWRA 3U4QA 1MVLA 4LZPA 3PWZA 4QGSA 5K8OA 3ICPA 5IXUA 3J7A1 3AF0A 4M98A 1OXVA 1QD1A 2VN8A 4Z3KA 4K88A 4FNIA 4YRQA 1M72A 4Z1MD 5FI5A 1FLVA 3R3UA 3ZCSA 5BVHB 2W8ZA 2PX4A 3U4CA 4MVCA 2PGCA 4K3UA 2PA3A 1RQ0A 4OMUA 1U1QA 4DPUA 2QRMA 3MM5B 2A92A 4A27A 3VSAA 4YJKA 4PQYA 2C1XA 5JPIA 4F4XA 3V1MA 4ETMA 2AOUB 4B8YA 2WJPA 4CXMA 4ES6A 1OWPA 4HXFB 2CDNA 4ME6A 1D04A 2XMVA 1GXTA 1TM1E 3W8EA 2PXHA 1QH1A 3HA2A 2QK4A 1DX4A 3T3HA 2VG6B 4B3SJ 1O58A 3UB2A 1HD1A 2XD4A 4D7AA 4NCAA 2FLVA 1WL8A 1U2TA 3CR7A 3CH4B 4YRJA 1SJ9A 4JS0A 2V8VA 3GCWP 2UVQA 2YQ3A 2QN2A 1OLXA 1Z82A 1YHYA 1PFKA 4RTNA 1P2UA 2BGWA 4YFYA 4ZYTA 1NOJA 2O2YA 1GPKA 2HDHA 1WW2A 2H54A 4C6RA 3T3OA 1AHIA 2BMWA 2MEWA 1FSFA 4Q7KA 1EBBA 1G41A 1FX0B 2JVJA 2JIZA 3C6ZA 3W1EA 4XQCA 2VP6A 1ENZA 3P45B 1GEHA 4UHFA 2WIJA 2B1RA 1C4WA 3TB6A 4EOGA 4V0MA 3AXMA 3E0XA 3NRCA 2HDOA 4NFHA 4IVPA 3INNA 1SMKA 3OJXA 4XB2A 1ITPA 2AFIA 4JHXA 1HZZC 4F7WA 3GR6A 1EVYA 5KJ6A 4RPGA 2P8SA 2Q21A 1N48A 3EZ5A 4EUKA 4D3YA 2LGJA 2P4QA 1QAJA 2BCEA 2HSJA 2WJ3A 1VRCA 1TA9A 1JXEA 1VDHA 1H93A 1JU3A 1M6EX 3C41J 3Q9NA 4KQ2A 4DMCA 2NLOA 3HXTA 4M5HA 2DKFA 2P90A 3SVLA 5ICEA 2PU7A 3NCRA 3EDQB 3Q3HA 1YR3A 3NBAA 1TECE 2GPNA 3OPMA 2UXBB 1Y37A 1RM5A 2X5KO 3FAKA 5AVKA 1TL1A 2ETXA 4POOA 4GMGA 1T9ZA 1NQUA 3VU9B 2EP7A 3U1BA 2AFHE 3N05A 1W85B 3Q24A 5ICFA 1KZ7B 1C0IA 4XB6B 1Z5UA 3LCJA 1V5FA 4DR7B 3S68A 3EF3A 5DHRA 4GX5A 1POXA 2X9VA 1MWZA 5FYDA 3ABRB 4WW0A 3BQ2A 4P5EA 1J9ZA 3I73A 1KK1A 2XGOA 1DRUA 3E0QA 1H4VB 3Q6MA 5FYQA 5JHGB 3GG1A 4CEIA 1ECJA 4BEVA 4LQ3A 1T1EA 3TKLA 3AH6A 2MOKA 4FCTA 1E7RA 3C4VA 1Q7BA 2HV9A 2CJXB 4RA9B 4X8HA 2IODA 3IQZA 4LOIA 3H42A 1QQ5A 1Z25A 1SIWA 2OXEA 2WINI 1XA4A 4O4IF 5AW4A 4R3UC 1JB9A 4O2BF 2B61A 1HETA 4KHPJ 3G1UA 4RNHA 1AQYA 1GCGA 3DDUA 3R77A 2GN0A 1ZHOA 3MLBA 2BGLA 1Z18A 2O0LA 3HB5X 1FEHA 3OZUA 5BMVB 1H2BA 3KUEA 2ONCA 2M9KA 2JI7A 2V54A 3WLKX 1C1XA 2ZYRA 2ERRA 1GGHA 5TC4A 3UVEA 2ZUBA 1H3FA 4FYIA 4NCGA 1Z3IX 1RTHA 1H98A 4TXSA 1I5OA 4AWBA 1V7QA 1PV1A 2BCJQ 1GK8A 3SYTA 3NHPA 4IIVA 5CVJA 5F8HA 1Z8FA 2P27A 2AZ1A 1X4GA 2UVDA 3TVZA 1WSVA 2GAHC 3OTGA 2PUGA 5F1OA 1FFWA 1ZY2A 2G1AA 1YDHA 4UHCA 3ZJVA 3UWOA 2N3ZA 3PV8A 4AZWA 1J25A 1PIWA 5EJ5A 3SZ3A 4FD3A 5JYBA 2BKLA 1R27A 3VZHA 2C2HA 2XGQA 1UDBA 5E3IA 3DV2A 3UQSA 4OGFA 2FAXA 3QJPA 3DZCA 4M1KA 3QP9A 2Y0DA 1J1UA 2OWDA 3L8YA 4OK5A 2QE6A 4F2RA 4KQEA 1RHJA 4DIUA 3WNVA 4ZLJA 4UZSA 2PBFA 3GA5A 3AT1B 4RMGA 5F8MA 2QT7A 2B43A 1E59A 2VAWA 2JLAA 5BMVA 3MOSA 4DB4A 5TMEA 4ZTUB 4CQLB 4DXHA 2AJBA 4I4TB 1A4IA 4UM8B 2B7BA 4HLCA 2YKOA 4LAFA 3CCRS 1DGQA 3K1AB 2AOTB 3K5IA 1JG4A 3RARA 3D5EA 4UASA 4Y9RA 2CFSA 1SIWB 1SY7A 3TWOA 1U1RA 5AM5A 3DEYX 2V8OA 2VI5A 3KHKA 4B0OA 2X0IA 1TUEA 3L0IB 2CW5A 5CD9A 4ICLA 4FSHA 2H00A 3DU6A 3GUVA 5IAJA 1P1LA 2RBKA 4JGGA 1AZLA 4PY2A 1SCNE 4MVXA 4C2BA 4RSRA 1Q1EA 3BQMB 4FS2A 2HFJA 4U2BA 4ZJUA 3NHRA 3OUUA 5AK4A 2XX3A 1YS9A 1Z56C 5G2OA 4I4NA 4LF8F 1T0PA 2VNHA 5TEVA 3MINA 2P3OA 4HWGA 2OHVA 4AMGA 4OTZA 3TAMA 2IYSA 3TZEA 4OQPA 3C15B 4WLUA 5FWNA 4JJKA 2G2ZA 5DRYA 2CJ9A 2KI2A 3B1ZA 2ZVQX 3ESDA 2VRWA 6REQB 5D0GA 1R0CB 1P2GA 3JZDA 1V8OA 1GPLA 1E6VA 3FBTA 1G291 2QRNA 1OS5A 1FP4B 4LMAA 3UPUA 5HLFA 1DBRA 4E08A 5CH3A 2CQIA 2P77A 3DOKA 1QGAA 1YR7A 1CS4C 2K1RA 2PSEA 4HLQB 1HNZB 5HMXA 4L8YA 1PT8A 2QMUB 4QBUA 4B3OB 4MDYA 1P3Y1 4NBRA 2J30A 2IP1A 2P5UA 3QZUA 2C4UA 3RG8A 1C2PA 4HTAA 3WL6A 2FOIA 4MITA 2ZAMA 3OVMA 4R8LA 3I4LA 3GPBA 3W2EA 2FC8A 3ZR4B 5CFQA 5K8LA 4L27A 2XUHA 2L19A 4HPJB 3CF2A 4E12A 4G09A 2J76E 3NHWA 1TL7C 2HLHA 1FRVA 3GCWA 3FKJA 3AY7A 1PZFA 2GYUA 2H1VA 2IUEA 4PWDB 2AYEA 1WY7A 1N0UA 1K6EA 1GGNA 1DQPA 3TQFA 1WKCA 3OQIA 1NSKL 5IJWA 5ESWA 4R5PA 1FTWA 1HYGA 1JR3D 5ETOA 2HHHJ 2BIFA 1TK8A 3EQ2A 2YQ4A 1BQNB 1MTZA 3DLAA 3NALA 3CTMA 3ZU2A 1J56A 4Y30A 4Y2UA 3PQFA 1KJ8A 1TT7A 1WUHS 4C0OC 1RJWA 1TP7A 3VO9A 4UOFA 1I1HA 3UF0A 4MAAA 1U8ZA 5I4KA 1YTYA 1PQWA 4E2XA 3RT9A 2DUWA 1X8DA 3I9V9 3LP5A 2OXRA 1IOVA 4KSBA 5HS4A 1NASA 3LY8A 4M9CA 1RWNB 5HUHA 4OJKA 1Z2ZA 3BH7B 4JZYA 4A82A 2FWPA 1XI2A 3VR5H 1N5DA 4XYMA 2WJWA 4RH1A 4S05A 3H2IA 1KJWA 4G0YA 4BAGA 5J4VA 1VL6A 1NPTO 2KE5A 1PK7A 1T34A 4MHOA 4PXBA 1E94E 2F43B 3V4SA 2XBPA 3VSDA 3T5PA 2PD1A 4E4RA 2QQFA 4YNBA 4CLTA 3AV0B 4HRXA 2EIHA 1ID8A 1GGKA 3HFZB 1M6NA 2WJGA 5TVKA 2VXCA 5THQA 4X41A 3MMZA 2ZR7A 2CXQA 5FPTA 2Q3DA 1KYZA 5A0FA 3K8WA 1E3TA 4CYMA 3RU0A 2H65A 2UVPA 4NBNA 4AWXA 2C2OA 1IQ0A 2VJKA 3BDEA 1UZAA 2HQ1A 2BJ1A 3DLPX 5A9TA 3TOCA 1QSYA 1VQMS 1A96A 2NVUB 4IIDA 1RTJA 5CPBA 1WCWA 4WY5A 1NZDA 4ANFA 2HHQA 1Z75A 3Q5EA 4BFXA 2FYTA 4JV1A 2KDOA 1W0CA 3I0SB 5J2TB 4BBYA 1CJMA 2EV9A 4M87A 5GAEI 5DLPA 3PZRA 4QVKA 1MKYA 2N3OA 5GADI 1R0WA 5ERXA 1PUJA 2PUEA 2H51A 2J7UA 3VTZA 2XY7A 1ECLA 3KRTA 1F8FA 3BEDA 4C3OB 2YYSA 3CT9A 4GKKF 4FYJA 2CLDX 1RU3A 2P9BA 1CJKC 2NVWA 2VUGA 1GSOA 4HDSA 2VHEA 1DZ5A 2R8XA 1MMDA 2R7WA 1NZJA 4G0MA 3TOXA 1XQXA 1EXMA 2R6R1 2VSYA 2H5LA 4JA2A 1VRTA 3PR3A 3QQCD 2Z5LA 1EAYA 1VB3A 3EVMA 2HU7A 1YRHA 4YK7A 3ROMA 1W9MA 3GRVA 2E21A 1Y3IA 1TAHA 4CCYA 2FB0A 4G56A 2VDLB 1EMDA 2OP5A 2MSSA 2FQXA 2VAXA 4QDJA 3T3PB 2VDPB 3R3XA 4D57A 3H8VA 3HFRA 2B69A 3LT0A 1A9TA 4XSGA 3WDSA 2P69A 4HX5A 4ABTA 2VFRA 4TYAA 1E4EA 1AB5A 2OHDA 2FW8A 3LW7A 2CCKA 1MABB 3HKEA 4NMWA 3H9QA 1Z2EA 2XDAA 3NGXA 3AB3A 1XDDA 5L3SA 4G1MB 1YOVB 2VH5R 1IAQA 3FNEA 4ZVKA 4QOFA 4G07A 2GO9A 1HWLA 2KSQA 3PKJA 4NYIR 5DG9A 1Y5RA 1TQ2A 2YFHA 3FCXA 4G4IA 4WHMA 5F77A 4DMFA 5KZMB 4XWGA 3DGVA 3SC6A 1LSUA 1SG6A 2HRYA 3KK3A 3R7LA 2WJAA 4GDMA 4CIOA 1K2WA 1Y3AA 4MHSA 1C0KA 1UA0A 1NBMD 1TQ4A 1QZZA 4HQOA 1EE1A 1G8GA 3GRUA 1RB0A 4PYAA 4NABA 3QLUA 4URZR 2ZIXB 3NAZA 1GR1A 3QMVA 2E4VA 1P2BA 4ZOEA 1QVZA 5FIIA 5K0LA 1R3NA 1SA0B 5L9XA 4QXAA 3RB4A 3P26A 1M2VB 4XUDA 3OQMA 4KH0B 4CT4B 4N48A 4BNWA 2ACEA 2AEMA 5A6WA 4R8UA 3H4VA 4ZDIA 2BSXA 1K0VA 1VM6A 4C8KA 3JALA 2Z9CA 1H4SA 2G0CA 5ETMA 4CTKA 5IKXA 3DSRA 4CQMB 3BRQA 4ARBA 5FUVA 2CZ4A 2WTEA 4INAA 4PIVA 1TA4A 4XWWA 4ENRA 3WZ2A 4NAVA 4X95A 2FU5C 2FHJD 1IKWB 4DQIA 2R2AA 2XCTB 4DS3A 2GEBA 5IH3A 3P2IA 3HN7A 4DV4J 4K7JA 3CUEF 5ALSA 4FOOA 2AEJA 3I2GA 1YOBA 3AIIA 3V1NA 1DO2A 4MQEB 1WPRA 5HTKA 1KONA 3MCNA 5AVXA 3NT4A 2JLFA 4EPXA 4X4UA 3JYPA 3SEZA 4NECA 4X3OA 1FSZA 4UBNA 1OSCA 2H9AA 3BT7A 5ITHA 2GMWA 4RHFA 2K6GA 2YN4A 2QT1A 2Z09A 5LP6B 4YRNA 3D67A 1D2EA 4ZAYA 1H3NA 4ZK7M 1L3BA 2PANA 3U09A 4H7EA 3UGTA 4QEZA 3HX9A 2AKYA 2V03A 4C8LA 1YZUA 4GZMA 4IS3A 4TKVA 3JASA 5KU1A 2XMTA 3UJPA 3T3NA 1AUOA 3ZY6A 2CMGA 3T19A 3G96A 2DUMA 2BW7A 3IQGX 4EJ6A 5HVHA 2PIAA 3Q98A 2DG2A 5A2QA 3PE3A 4IDNA 2GX6A 3EE3A 3AWDA 1XMIA 2NT3A 4M5IA 1A3CA 2VJLA 4D9JA 1GGEA 1PNVA 3EIWA 1F8GA 2ROPA 3HM9A 1NJ6A 4UMDA 3DMJA 5BRJA 3VX4A 4U7DA 1LNQA 2Y1CA 2FQQB 3R6DA 1RHRA 2IXGA 4ENVA 2CSXA 2YFQA 2GILA 3WNCA 1T91A 4WZAE 2NCKL 4QFMA 3PDNA 1KDZA 1RMYA 4X66J 2ZE7A 4F5ZA 4MVJG 1NJ2A 1CZKA 3UMGA 3TIGA 3AL0C 4BGIA 3QX8A 4RK0A 3ZBPA 4TLQA 2QXUA 2JVKA 1DLOA 4HGPA 3AV3A 3D2LA 5JWRA 3CZPA 3IXQA 3A37A 4XCXA 2NTJA 4N49A 3IRXA 2HK7A 3HI9A 3ZNUA 1ZWKA 4V0RA 2EQ5A 2WVHA 4DADA 4OXKA 2XCLA 2EF0A 1UFQA 1S1CA 4OGLA 2DEUA 2GI4A 4DUYB 4ZRDA 2DQYA 4QG7A 1UXKA 3A2NA 2HNAA 2DH7A 3HU5A 4F21A 1JXVA 4EB8A 4TY8A 1RHRB 2PMBA 5AI6A 2DXEA 5BJRA 2FJPA 5SZJA 5JO0A 3U4DA 2EBHX 5JQGB 1K4YA 1TU3A 4ER3A 3E9NA 4C7QA 4OZJA 3JAWA 2H4YB 3A3KA 3DN9A 3GJTB 1XBTA 2FWBA 4OXYA 1BEUB 4NLYA 4R5PB 3JAWB 3PICA 2G3YA 3K31A 2P67A 3PYEA 3EH2A 3UV3A 4ENSA 9MHTA 1UR5A 3RYIA 3T1HJ 4D6XA 2NYIA 1N36F 3OA2A 1TKCA 3LM8A 4PR0A 2BBEA 2JA1A 4HDKA 5LSRA 2JEZA 1P4HA 2KVQE 3I55S 2IV3A 3G6ES 3OL6A 1PJ3A 4W4TA 4ZFNA 4FGUA 1GY8A 3G2KA 3VTAA 3M8PB 821PA 2PFSA 3LPLA 4UREA 1LF5A 2GQ0A 1RJEA 2C7GA 4YCSA 3X43A 4YRBA 3UENA 4LDQA 4LSWA 1QONA 5BR8J 3UMRA 5HX7A 3K0KA 4YCLA 4KQHA 1DUVG 1XEXB 3Q5GA 2HHXA 1ICIA 3ETLA 3OIVA 4YP7A 1EIWA 2IZ1A 3WWPA 4BC7A 4LHYA 1T8UA 4RDHA 5J5CA 2ZIAA 3H05A 3L49A 2I4MA 2CBZA 1Z5OA 4DXLA 1YVRA 3L07A 3V7YA 1VLLA 5KT3A 4N3NA 3OO1A 2C29D 3IQWA 1S2LA 4NBUA 3LWZA 1NDKA 4TV9A 4OYWA 1THGA 4X20B 3WADA 1P2DA 4D8TA 3KZMA 4EK2A 3ZHOA 2GRUA 4W5JA 2CMFA 1D03A 4TV8B 3ZY4A 4Y2AA 2BABA 4N77A 4QGHA 1SXHA 1U1EA 1JL3A 3IAM1 1JI3A 4WXRA 1YF3A 2OIHA 5CDFE 3UN2A 3IP9A 1MNAA 4DS5A 4X4VA 1P0IA 2YV3A 4E46A 1M1YA 1BVHA 4DUTA 4WWSA 2LKCA 2CDQA 3MI7X 2EC5A 4HACB 4CE6A 5KNLA 4PZYA 2IKSA 5FWDA 5FOXA 3KJEA 3OM8A 4OX7A 1UQTA 5KT7A 5KX5F 5LDDC 1C7FA 5DMXA 3VSBA 5JG7A 2IXDA 3W2FA 2HMYB 4F4YA 1JDUA 3HMQA 3MAHA 2BOVA 5A3QA 1I7LA 2I03A 3A1YG 2RI1A 4Z3OA 1QSGA 2QSJA 3E5NA 5SUHA 1OXKB 2GVNA 2HZAA 4WZBB 1VRQC 2AR0A 5DM6Q 4JCOA 2QL9A 1VL0A 4YP5A 1JVSA 3F0NA 3RANA 1LZLA 1HHTP 2PGDA 1TM4E 3CUUA 2WZBA 3LI2A 3AF6A 3WB9A 1UZHA 1DPGA 1DC5A 3PC3A 4RMHA 1U7XA 4K4WA 5KT2A 2BI4A 2HOQA 5KFAA 1N7GA 4DBVO 4FMDF 3AUFA 2DWUA 4K81B 1OILA 2EG5A 2AG0A 4X6XA 3ZVRA 2EFYA 3BBCA 4BRZA 2ZWVA 4BJ1A 1I0ZA 3E3XA 2B2XA 4F2PA 3O1HB 4RA6A 2ATLA 3K9LA 4IUFA 4V0ME 3A7DA 3E9YA 1G3RA 5KQLA 2WP0A 1Z12A 3DMYA 1IN0A 1FUIA 1Y5NA 1SAYA 4P72A 5EZYA 4QJ3A 3GCGA 2XVXA 3UN3A 1X39A 3IBGA 2BGUA 1CEXA 1U2DA 2O2JA 1XN1A 1UKUA 1K5GA 4XD2A 1X94A 1EP4A 3BB4A 1JHZA 1YR9A 5CLFA 1AQJA 1KYXA 1KKLA 1ZOLA 1M5VC 1W93A 3V97A 3K1TA 1VL2A 3H5XA 3UXEA 3BMOA 3ELBA 4KAAA 2G9OA 4NYMQ 2QL7B 2BUCA 3UW3A 5I9TA 4RFSB 4BE4A 2V4QA 3ILYA 1I7SB 1U5CA 3PI7A 1NP6A 5C1BA 1IWGA 5LR6A 4B6QA 5A0TA 3G0OA 5LYJB 2OV4A 3SCZA 2XZDA 1BQMB 3QVWA 4K4ZA 3DLGA 1L3UA 4JNCA 3UVJB 5JXWA 2VJMA 3JQ8B 3P20A 1RWBA 2XF2A 4F6RA 3HP7A 1RAAB 1NUPA 1I10A 2XRMA 3SFVA 2DC1A 3GV0A 4FGSA 1U9ZA 4DLTA 1BS9A 1MROB 2DD8S 2GVDB 2IBTA 2XCAA 4Y2CA 5FIUA 3R1LA 3A10A 3CH6A 4AWAA 4DR2B 1ZETA 1JKHA 2DY0A 3D7KA 4BRSA 5C7YA 1R5JA 1ZIYA 3WQHA 1M74A 2ZVPX 3T5LA 4GP7A 5EJ7A 1NOIA 2Q9AA 4HSGA 1N1GA 3SQGB 3IAS1 5DZ6A 4Y9DA 1UZDA 2IRWA 2BJ7A 4QYZK 4HBZA 4AG5A 5CYGA 2M88A 3VH2A 3D59A 3CIZA 1E3QA 2D2XA 5A4JA 4WBNF 3AHGA 4Y1EA 4I1UA 1F3VA 4U0JA 4JITA 5IYZF 3JYHA 4I5GA 3IVGA 3UWKA 4CCAA 1BW9B 5I4MA 2LQJA 1ZGAA 2ATEA 2CADA 1GM5A 3B3JA 4MJLA 4DN9A 4L4RA 3LGAA 1F06A 3ANLA 2MKSA 3N01A 1PUXA 2CYBA 2CQBA 3A3PB 1P4GA 2CLLB 2FRDC 1VIVA 1P0FA 4JQZA 1X60A 1JS1X 1FWLA 4QKQA 1E89A 3I9MA 4J9LA 3RVRA 3OLXA 1Y4DE 9RUBA 4G1CA 4FZ5A 1L4HA 3IQFA 2VHJA 4W6ZA 1JTFA 4KAJA 3MTAA 4QQFA 3I5YA 4AS3A 2JIDA 3H59A 1ZRHA 1XRJA 1QMGA 2QAGC 4AN4A 1VCOA 2XVAA 4TT3A 1E79A 4QUHA 3ZWBA 1NQWA 2V7QA 2W2PP 1X92A 3OKAA 3OZEA 4HUJA 4NS1A 3LBIA 5KOHB 3H8YA 5CB4F 3HMKA 3ZWAA 2R2SA 3O93A 3MF5A 4JR0A 4FKXA 5E7MA 3M49A 2D5IA 3GPLA 3P5TL 4F3QA 2XWQA 3AESA 1XCPA 3LH5A 4GKJJ 2RCNA 3OURA 2F1OA 1EFHA 2BKAA 4XW2A 3OLCX 4C88A 3CT6A 3NORA 4JT4A 1GA1A 2F8HA 2UYOA 4LRYA 1KGDA 6GPBA 3ACBA 5LXTA 1XZAA 2CSUA 3HF5A 3ZE7A 4OHOA 4FE3A 1P9LA 4PQEA 1YJTA 1Y3HA 3IAXA 4IHJB 3GGPA 3CCBA 4CHGA 2EW8A 3GQBB 2R6GA 1CC8A 1Z6PA 2G2YA 1CUAA 3OOSA 4AFFA 5IV3A 4DR3J 3L0DA 1FKAF 5AKJA 2DHRA 4CKYA 2CK3A 4Y67A 4CN9A 1VA4A 2VA3A 2BVZA 1X4DA 2HLUA 1NM5C 1U6FA 2AJQA 4L9WA 1JJVA 1UDCA 4MB6A 5FNZA 1SKQA 3KEMA 4F71A 3Q1LA 4IQFA 2QLBA 4RQBA 3PYLA 3QIPB 2ZPUA 3NIBA 3P94A 1FDVA 2VQSA 2QDKA 3OLYA 2V9KA 2QRZA 1JJAA 1NU8A 5JMNA 4FQ8A 3U31A 4ISBA 3ITEA 5CM9C 2PU5A 1A7AA 2QTLA 1CRPA 1IATA 1WSWA 3FNQA 4PNZA 2G0TA 3OTIA 4AZ0A 4GC9A 3ZCXA 1KRXA 4QU7A 3MB5A 1E0KA 3IULA 3CJ0A 4OL0A 4KBGA 4EPWA 3EUNA 5J2UB 4DIDA 4DV4B 2DQZA 1Q0ZA 1ZO8A 1A2OA 3DC2A 2HA5A 1PVOA 5AT1B 3T5TA 1Y89A 3V6DA 3EZ7A 4M1EA 5D5HA 3TLYA 3Q23A 1EFRA 3KWLA 3N9UC 4PCVA 3WK9A 1SO8A 3GLRA 2UXBF 3CVOA 2PTGA 3DLBA 1U3GA 2MWMA 3I5CA 2F4VB 1J1IA 2Y1LA 3IR6A 4DY4A 3R6LB 3LXXA 4LGMA 4RW0A 2BONA 4EF6A 4KQFA 4MKGA 2YWCA 3D66A 3WYAA 1MFPA 5K2OA 2GXUA 4WYLA 1DINA 3JYLA 3ZDEA 3RRBA 1GZVA 5DGDA 4F25A 5KQRA 2D1QA 1JBQA 3VWSA 1U09A 5HS6A 1CIPA 4R40A 1NKCA 3IERA 1ZCJA 3RAJA 2MYNA 3MWLA 3QEKA 5AXCA 4AXXA 1NHKL 3QHPA 2FN3A 4AMYA 4YUYA 1JNYA 2XLCA 5LVAA 4MAKA 1B7YB 4K26A 2FF7A 1B8PA 2P2YA 2Y99A 3DHYA 4LR7A 1O7JA 4LYJA 3DV0B 3QJLA 2IMOA 3PF8A 5JISA 1FZTA 3KLVA 3W5VA 4URHA 5BN4A 4D4MA 2VFAA 4ED6A 3ZWWA 3MM9A 3CDEA 1Q79A 4LJ8A 3UD3P 3LWLA 4NYMR 3F5QA 1QK3A 4YXWD 1EK5A 2J9ZB 4ZEWA 4FSDA 5LXTF 2CVHA 2FXIA 4KWEA 1MA0A 1N6OA 4PXYA 2J32A 1TUVA 3CSKA 1Q1KA 1KE2A 3ZKWA 3ED1A 4KQ9A 3I0NA 3SBOA 4AKSA 3E4CA 2FJ0A 5K0FA 3PUKA 3B54A 1CZRA 1T02A 1S9FA 3Q0IA 2DBZA 1H2EA 1YJNS 4V38A 3MAAB 1UCNA 4YHHF 5ICGA 2AU0A 2WSFC 3AYZB 2REOA 2GFFA 2Z8QA 4C76A 2BDTA 1S97A 4DJ5X 3KJIA 3UMBA 2POKA 4LXTA 3AOEA 3GH3A 4PR6A 1I3KA 1WCIA 2QA5A 1T6ZA 4DV7J 1ZCZA 2OPPB 4ZVRA 1RC0A 3T7JA 3IEKA 1VR6A 4F4KA 2BFCB 3LX4A 4D46A 3DM5A 2B4AA 4ATNA 1EP4B 3LQQA 1HNXF 5FRDA 3C6TA 3KVOA 4XIFA 3K5WA 3IUQA 5BSKA 2GEVA 1YZ3A 4OAOA 1GSHA 2I0FA 4IFYA 2ZG6A 1SU6A 3CUTA 5UKDA 3C6TB 4J6EA 1O0PA 1VKNA 2NSYA 3CURA 4LN1A 4KN9S 5F9FA 5E2BA 5CYQA 1RPTA 3PDJA 3N6NA 1Y8AA 1JDJA 1XNQF 1DKPA 2AQHA 3WJ1A 4IR9A 2BKEA 3G87A 4K40A 1K1SA 4MGIR 2E4ZA 5TPZD 1UFLA 3G2IA 5EXDA 4QU6A 1WCIB 4TVSA 2AXEA 4YVFA 4BTVA 1XHFA 4PRLA 2JFKA 4HLDA 5F3WB 2Z0GA 4UZBA 4DSEA 5HMLA 4DV5F 1E3JA 4ID5B 1PVDA 3RIYA 1K88A 3H11A 4UOCA 1Q0HA 2PL5A 5DDRC 1X1QA 4G41A 3ROKA 4J0IA 1WB9A 4HATA 3ZQUA 2P4EA 4IQGA 2Z4SA 2QENA 3VR0A 3LNCA 4CLSA 1SHLA 2Z1NA 2PKQP 3KJHA 1E1DA 4L4YA 5L1LA 1JQEA 4MV4A 1LFAA 5E4TA 5IN4A 4WP3A 3STTA 2BTOA 3CRVA 3FGNA 3M8WA 4Q1DA 3KLMX 2Q66A 3WKAA 1E9RA 1YJAA 4ZCRA 3NHMA 4ZJOA 2Q07A 4HQKA 4KRXA 4R1QA 2WU8A 4MUNA 3O91A 5HMZA 2I87A 1RD4A 3VAGA 1C0EA 4XH9B 3ZTRA 1WG4A 3EXYA 4BB6A 4Q6WA 5J1TB 2QY6A 4X85A 1K8RA 1ZH2A 2XZLA 3GD7A 1XTIA 4O4LA 4RTRA 3INGA 3KL2A 3SR4A 3L0ZA 2QLLA 2VOEA 5JS8A 4AECA 3RB8A 1PBAA 4OJNA 2FPUA 2EI5A 3NJ8A 4LRXA 1TZCA 2E18A 3CWCA 3ND6A 2XT9A 3A1EA 2WM8A 2KPOA 1MWQA 4KODA 4RBNA 1L3SA 1GQRA 4KQKA 5L39A 4WOCA 3PYFA 3KQNA 2WUEA 2MGZA 2GO1A 5FPSA 1IXSB 1VIMA 4JC4A 2VLIA 1DHTA 4KKXB 4EZBA 4BNZA 3QRQA 4OLFA 2GH1A 3VC3A 4N0MA 2D2EA 1H2TZ 2IXEA 1LV8A 1WBDA 3SU8A 3EPRA 2DNOA 1QFJA 4D3SA 1W94A 2RAPA 1FS5A 2VPQA 5J63A 4CMCA 3ANMA 2D7DA 3KJQB 5DW3A 2NO5A 4RTSA 4PZVA 3TL6A 4B3RB 2EP5A 3DFKA 3LOUA 4G65A 4KO8A 4F72A 3KAJA 1ZNQO 3NB0A 1Q2XA 3MIIA 4R2IA 3KPJA 1BGWA 4F6LA 3PXGA 1FTQA 3MT7A 3S27A 1VE1A 1FTNA 5K8CA 4UD6A 3QVGB 2FZCB 3DLEA 2JGNA 1QVRA 3HADA 2F64A 1Y4AE 1W4RA 1ONPA 1ULZA 2FPIB 3J7TA 2R7MA 3IT0A 3TR0A 2UZ1A 1FJGB 1V41E 2W2OP 4GP9A 1Q0RA 1QUPA 1SBIA 2GZ1A 2VG5B 5A3VA 3WA6A 3LT4A 2ZPTX 3PHBE 2CNKB 3R3JA 4ANEA 1JYEA 5AM3A 1R0BA 3AH8A 4GXNA 5AHKA 1HFJA 2V7WA 4UMVA 4MB0A 3QFCA 2DCUB 1P60A 4E0BA 5ESDA 4C8MA 2W6ID 5JTUA 5BQFA 3I9NA 3JRXA 5AYVA 1OB5A 2Q62A 1CY2A 2H08A 3P2MA 3GEMA 2AKWB 3TUJC 2UYCA 5AE2A 5KWVA 2A6OA 2FZEA 5BP7A 2PA8D 2XVYA 1K06A 2CZQA 2MU1A 1KY5A 4JJZA 5KTTA 2GGPB 4YCDA 2WF9A 4WECA 3JYOA 2FPXA 5LOVA 4G0PA 2H63A 3ZH2A 1GU7A 1N1EA 3WL7A 1OTYA 2E4YA 2OLKA 2Q1UA 3T3IA 2GPWA 1H2HA 1QRDA 2IAJB 2D8MA 2Z8ZA 1O94A 1X74A 1KJIA 1T2VA 1NCLA 3GRYA 1XRQA 4UAVA 2AHRA 3IAUA 2B0GA 1CEQA 5T7LB 2QF7A 1YO6A 1OIVA 3JSMA 3D0RA 5B58C 4A8XA 3HA7A 3MIZA 4JJ7A 2Q3EA 4V19J 2NSBA 5K8IA 1XQYA 1FESA 1IC6A 2FJDB 1CUWA 1VQ8S 3NDRA 4HOYA 3F2IA 1GZSA 2XBUA 1PWHA 1WEYA 4TYYA 4ZITA 3TCNA 1KP6A 3CJ3A 1MZPA 2HA0A 3UT6A 4W63A 2ZD1A 1SL2A 3WL3A 5HZGA 1BXGA 1Z4JA 2H9YA 3F5DA 5CLQA 3C66A 1NXXA 4A23A 3SSSA 1NK8A 3BFKA 3BGWA 4IV8A 4KQXA 2WVEA 2IH4A 5FO0A 3NLLA 3PGJA 2ZRIA 3I6YA 4TKZA 4CO2A 2I54A 2H4ZA 1BHNA 2QM8A 3JARB 3OCUA 1Y8QA 3CMAS 1E0DA 1E66A 1QHGA 1X38A 3VPBA 1LS6A 3TZLA 4OZ0A 1R88A 3R41A 3P6YC 2VHVA 3B6BA 3RYTC 3W6PA 4W5OA 2BI8A 1U04A 4RGVA 3SMVA 3WBFA 1XU7A 5ALOA 4CDIA 1GRVA 2CG8A 2G4LA 3KDOA 4PPDA 1ZVJA 2BJWA 3EW9A 3D31A 4PYDA 1ZLYA 1BUXA 3D1VA 1SCQA 5GZ3A 4A10A 3D8SA 4DC0A 5CVCA 4GMHA 1L4UA 4ZKDA 4M76B 3LP6A 1EX1A 2OORA 4Y3CA 1P7PA 3OV7A 5GIPE 4PGMA 2QSFA 1XJ0A 3KLHB 2QYGA 5DNUA 3UY4A 4B3RJ 3MINB 5B4TA 4EGLA 4FR2A 1R0LA 1GOTA 2HREA 4BS2A 2XCPA 2NP7A 2B4YA 5H4HA 2C2KA 4K9RA 2X3FA 4B87A 3GDGA 1MH9A 4R41A 5FLXA 2JFNA 3OR1B 3TDKA 1G2EA 3G7UA 5A5FA 4AW9A 4RVOA 2GVZA 2NVUA 5GQSA 5E0KB 5FP0A 5DKFA 1RTDA 4X7MA 1AM4D 4LRBA 2A94A 4JUAA 3HO1A 3FRHA 4GHWA 1QZ3A 3KLEA 1TKRA 4ZT5A 3DXXA 2HI0A 3TI0A 5EP1A 1R6DA 4H1VA 4WLOA 4HADA 1H0HB 2ZTUA 3HZHA 1JWBB 4MUYA 5CEFA 4LF5F 3JZMA 3VALA 1DO8A 3BZWA 4U9RA 1M1KT 1O4WA 3Q7PA 4NENA 4DT1B 1BN7A 5BV2P 4F6CA 2ZVDA 3ONEA 3ZZRA 3BULA 3OIGA 1VQKS 4A8WA 1NE2A 2XOKA 3KG2A 5DG8A 3RB3A 2Y9HA 1Y81A 1U0NA 1KEVA 3W5AA 5FTKA 1F2GA 3WKCA 4M4SA 3T61A 1VQ1A 5I48A 3EXFB 3BORA 4PRFA 4OJHA 5DCYA 5EJGA 2J3MA 4DCCA 5FT9A 4LE2A 1Z7GA 2DSNA 4ZOAA 1U4SA 1GG5A 2WWVD 4Z4IA 5HXAA 4O23A 4N0QA 3OL7A 3RFCA 1FFXB 5EHZA 2PUAA 1L4KA 3AI3A 4MO9A 1AXGA 1TJ3A 3SI7A 1KY2A 1QRRA 4NFYA 3JSMB 3KG1A 3KEQA 2RKIB 1RAFA 2QQEA 1PL8A 4LI0A 3EZ9A 4OBBA 3DD5A 3LBNA 4ZKEA 4O4JA 4NEGA 4PBTA 3LWBA 1QHIA 4HZUB 2CD7A 2HHUA 1H9CA 4P2XA 4AO7A 1I30A 4FS3A 3KQYA 4D0LB 4C21A 2DTEA 1ZPWX 2ICAA 2FZGA 3FDZA 2E4AA 3AEXA 1KOHA 1N6PA 1N5QA 4FN5A 2H31A 3M3HA 2WA2A 3UJ9A 3F9CA 5CHCB 2PUVA 3FYUC 5FFFA 2JBAA 4HTJA 5CXSA 3I64A 2VA2A 3UAWA 3ECCA 2CF5A 3O7MA 2FX5A 5KJ1A 3ECSA 1WD7A 2X8JA 4LKOA 2Z6VA 1MJNA 3PFKA 1ZD9A 2X77A 5T3YA 2QXTA 5KTPA 3I2YX 4LE0A 2Y67A 1BA3A 1LV5A 4LR8A 3ZDYB 2DUJA 4XGKA 2QZPA 3K70C 1PFQA 3TLJA 1AC5A 2HHHF 1U90A 1QLWA 2DR2A 3JQRA 5AM2A 3DMDA 1AUVA 2PE5A 1DQNA 4LJSA 4OF4A 4L76A 1FA0A 2FJXA 3ZNPA 3AF4A 1NXPA 1UA1A 2YXPX 3M9XA 3OTOB 3IPXA 2P9EA 1Y4ZB 4GBED 2RI0A 4BBAA 5DT9A 3QVGA 1VXRA 4QASA 2G6TA 5EZ5A 4D97A 1EX7A 3VYSB 4GFDA 4EO8A 5JQGF 1AQUA 2A88A 4EY5A 4PQRA 4H6VA 1B8VA 2QTFA 4A8SA 2I2AA 3PE4A 2HWHA 1VPWA 2GDJA 1FRMA 2Q43A 1H73A 1DMRA 1MOSA 2HW8A 4JV5B 4BKMA 5IUNC 1TL5A 2V0CA 2CXHA 2B35A 3UYKA 3NX4A 2Y0PA 3TRDA 1XD2B 5T5QA 4OYOA 1RT1A 2XWXA 1HE2A 1F0NA 1FERA 2DHXA 4RQAA 1WLSA 9LDTA 3IVXA 1KSGA 1SOUA 3QSIA 3HVAA 1WJ9A 5EWMA 3BDPA 1K5HA 1QYXA 2IDZA 4OZ5A 1U47A 1Z2OX 3FC9A 8RUCA 1KRPA 4ZKAA 2ZOMA 1FJXA 2ODQA 4YHHJ 1YASA 1VC5A 1XBWA 4BNXA 4CLWA 1DTQB 3P4XA 3T5HA 2GNKA 3B6ZA 1F5NA 5LN1A 4NI2B 1ZCAA 1RXUA 1NHWA 4O3QA 3NIWA 1L5MA 4ZP8A 5FLKA 2D62A 1OPIA 5H9EJ 3ZGNA 3A27A 4FYHA 4JLJA 5DYGA 2V5VA 1FSPA 1DHMA 2FCAA 1DXQA 4MWDA 2IEYA 1BC5A 2RG7A 5JATA 3OJOA 4LJAA 4EW2A 3RAXA 4UTGA 3C5EA 2RUGA 2R7OA 1NVTA 5BORA 1XKXA 4U2EA 2QLTA 4OXNA 3T7TA 5DQIA 1ZK2A 2G4CA 3WQSB 3DL7A 2K7ZA 3NBFA 2R47A 2FEAA 4CT8A 2GYVA 1N8NA 4MUGA 2ZQZA 4FYYB 2AQKA 4J0EA 5COQA 1FYFA 2M6KA 2HGZA 1T05B 4DV2J 1H6BA 4C9BA 4RMJA 3Q8WA 1K7XB 4U3JB 3BR8A 4CM5A 2IZZA 2Y4NA 4MYCA 1TTPB 4LSZA 1POWA 2MYFA 1PG0A 1IEQA 3SI8A 3FI0A 2Y0SD 3BV8A 3O8BA 5JARA 1E2IA 3CMMA 4IBOA 1PVVA 1UWAA 1JECA 3ZGYA 4EG0A 3PHCA 4UTOA 4TMZA 1RBZA 3HFVA 4MMZB 1FT8A 3L0YA 2P0EA 4WKOA 4X90A 3ZIAD 2ZWOA 2GHQA 4KSYA 1W2IA 2WVBA 4JQCA 3IM8A 4L15A 3VI4B 5JY6A 3SICE 4HNAA 4EJSC 3OZIA 2QLJB 4MK8A 2R5FA 2WBLC 2G63A 3G2HA 1XQVA 2FVRA 3UMCA 5KT5A 3NEKA 1F5BA 2HIYA 4WASA 3IURA 2QR3A 5JQGA 4LOJA 4W7HA 3EZUA 2Y76A 3TGPA 3GEGA 4DL0C 5JSQA 1QDUA 4QIVA 5CFOA 2QJTA 1JEQB 3IRVA 4QGFA 2QE7D 4XPZA 3HCWA 2ZE6A 3OX1A 3G0IA 3BSCA 2ZE5A 2ASDA 1DDIA 4BV3A 2WEKA 4RELA 1CRWG 5AR1A 3IGVA 3PRBA 3RTVA 5EKDA 3FPCA 1BKYA 3S1TA 4KLAA 2XNQA 5B6PA 1T5LA 4ISCA 3DQQA 3UCGA 4UOZA 5E1OA 3CCLS 4KB5A 2HRZA 4ZV4A 3LO5A 4YWHA 2C94A 3FGVA 5LUAA 2DCMA 3H2SA 5E2AA 1GL6A 4IG3B 2C20A 3V2HA 1FLDA 1ZQ9A 4C8NA 3UOGA 5BSTA 3QEBZ 4KN5A 1ZIXA 4LI3X 3TTTA 3IIIA 1KEWA 1QAXA 1D9XA 2HLPA 2HJRA 3TPZA 1X9MA 4G86A 2QEXS 5B57C 1OWOA 4K87A 1F6BA 3MWEA 2I1WA 2YNHA 3MMBB 2B36A 3KC2A 4E8UA 4HL6A 2AVDA 2IOHA 2H3EA 3IP8A 3N87A 5KC8A 1KVSA 4GVLA 1FXRA 2DTJA 1P0CA 1Y5IB 4KOEC 1B16A 1IUOA 2VPXB 1F7UA 3M2VA 3HVHA 1PJAA 4ZT2A 4TZ6A 2WK4A 1MR3F 3GLKA 2XMSA 2CB9A 4C7VA 3PX2A 1TE2A 4TN1A 2CL5A 2YX1A 1SKYB 2WHYA 1WWHA 3AVYA 4FEYA 2KN4A 4I6JA 2BSQA 1VBYA 1RABB 2FPLA 3ZLBA 1J24A 2Q6IA 3BSWA 3RFXA 3BXEA 5E95A 4I4LA 1O03A 2CY0A 1L5LA 2FRXA 4XSVA 5KCMA 2PMWA 2CMKA 4KDEA 1ZH6A 1R31A 1PL7A 4MCHA 2C4HA 4EY8A 1T3SA 2WILA 1NB2A 2UUWA 5HGXA 1PCXA 1YCDA 1N5OX 2AXQA 1O94D 2DB3A 4JVNA 3HNPA 3OVSA 4BFCA 3RVNA 1WMBA 3I6ZA 3QQPA 4XGIA 1Z28A 4NOHA 3TD2A 2J9EA 1FNDA 4P7GA 2HZCA 2LLZA 4YEAA 1ND6A 1JHQA 3DOFA 3D6FA 4LZAA 1HQYE 4BMVA 1ZTTA 2YKMA 2ADOA 3NTLA 3HGQA 4DNXA 5JFGA 2XULA 3U17A 2DNLA 1N3LA 5CUQA 3F41A 1OROA 4QXRA 4HDOB 3BXPA 4LC9A 4RYDA 4PO9A 5EYPB 1YMVA 4A8KA 3NHJA 4NFLA 4RK7A 4LYAA 3WGUA 1IL0A 1MNEA 4OAPA 2CAJA 2DRDA 1LJLA 1MAAA 4TTRA 3B1FA 5CR9A 3MM6A 5KKCA 1XPOA 5ETPA 1GGMA 3TTVA 4L5YA 4BWVA 4ND8B 3C7DB 3PCRB 4PGFA 5EFZA 5DETA 1MX1A 1JPUA 2BXJA 4TXJA 2GMLA 1OY1A 4CKBA 3IO3A 2PQ0A 1DJNA 2QORA 2M1XA 3AVXA 2EBFX 3CJQA 1NLZA 3K1ZA 1O6GA 2HCRA 2QDXA 4C5CA 3PIIA 1ADCA 4QUJA 1RWXB 2X41A 4WXHA 2NU6A 5IAGA 1QTRA 1AT1A 3CB4A 2QRHA 2CPYA 2HC9A 1ZGJA 1R5BA 3BSNA 3NOGA 3KZ1E 3EDMA 4KUGA 4TOIA 4AL4A 5G0RA 3W4KA 2BBOA 2GS9A 3EGCA 5CURA 1XVVA 1T1GA 1N2IA 1RKVA 2RGXA 3DNMA 1G7CB 3MXTA 1J6UA 4MICA 2M32A 4HUQA 4J0QA 3GUZA 4K7QA 4EG3A 1MRSA 4ZVPB 5JASA 2JVRA 2OCBA 2B99A 4KIAA 4I2VA 3DOOA 2VPYA 1PJ5A 2MMGA 3SQLA 3DXBA 1H1LA 2Y71A 2AYGA 2AGQA 1AS2A 1SBTA 1KTVA 1L5OA 4QDTA 4Q18A 4BBZA 4I1RA 5HP1A 3K57A 5GY7A 4M0LA 4RMIA 2XCQA 4KPUB 3ZOKA 3ND5A 1NMEB 1RJDA 4JKIA 2OD4A 4PAWA 1DVRA 4G24A 3M4ZA 3O8CA 2OUIA 5CXXA 4F7DA 2GXQA 2X86A 3IAFA 3F9IA 1I2AA 2ZCVA 4WL0A 2CNNB 2D1TA 4ZC1A 4DJEC 1J20A 1WTAA 3C7CB 2DR7A 1Q1BA 1V6AA 3BRCA 1QH0A 5LXYA 4MGZR 4Y0NA 4I2QB 4BFWA 5D78A 1UXJA 1O57A 2YZ2A 2EQBA 3DULA 1QHNA 3Q2SC 5K3BA 2OENG 2XMRA 5HK9A 1YZVA 1X9IA 1ETHA 1LBTA 3I3SR 3GFFA 3O4GA 1R6AA 1URPA 1HZZA 5ILQA 1QM5A 5C4MA 1JMVA 1LK7A 4ZPCA 2ODWA 1H0KA 4B4UA 1VMKA 3QNMA 2DECA 1GUZA 2B8JA 5CW2A 2XB9A 4QPTA 3UMMA 1MO5A 4CM9A 1QO0A 3I8SA 4PFJA 2QTVB 1E32A 3MMPA 2LD4A 3DOIA 5KG3A 2GCOA 4Z4EA 1R15A 3MWJA 1FPQA 1AMOA 1DQ8A 2YMQA 1Z3CA 3WV4A 3L4KA 3M1VA 1E2UA 1FRKA 3OA0A 2AOUA 4FTWA 3TECE 4IXTA 2QTWA 3WIEA 4WTOB 4Q37A 2XE4A 1E0JA 2VQDA 3W65A 4BJ6A 2G17A 4KGVA 5KFGA 1TEZA 1Y5LA 2O9JA 3RK4A 2OG2A 5TJ9A 2YIDA 3RJZA 2GBLC 3V2UC 1YLXA 4E7PA 3AMVA 1N0VC 3T0IA 2WIKA 5ALEA 3NCQA 2UYYA 1OR8A 3KVVA 4BO7A 4AYXA 4ROSA 4ECZA 2ODAA 4J94A 3COZA 4ZCPA 2HMAA 1W5SA 1UKVY 5DGCA 4WBFA 4M88A 3RAMA 2A0FA 2PRIA 3JRWA 2B1IA 1EK0A 4E32A 2GAGC 3QFFA 1VK3A 1Z4UA 2Q4TA 3VNUA 1RRPA 1NXSA 4DR7J 4PVDA 4WFZA 4RQUA 3UCUP 2X5OA 4N47A 4ANDA 5REQA 3LUKA 2BUBA 4EG1A 4NXMJ 3C19A 2OLJA 1E8DA 1A9XB 1ZHFA 3OOWA 3AJDA 4ENOA 4X1KB 3ZIAA 4H1TA 2BFEB 2I2BA 5C37A 1F1JA 2GNOA 3K59A 5ALZA 3K0CC 5LJ3Y 3UJDA 5K3SA 2RQ4A 2VCYA 4I55F 2GFQA 2CHGA 3NQ41 2GFIA 4ECYA 2HMUA 2XQGA 4CQNA 3UDCA 2WQ6A 3S1SA 3FE2A 5IMBA 4NCBA 1QLJA 1WB6A 3URMA 3QLHB 1NRJB 2NZJA 3E70C 1TMJA 9ABPA 6LDHA 2B4PA 4AQYF 1XCBA 1R12A 4PAQA 2YOFA 2IYIA 3DNFA 5I3UB 3QVKA 5B0AA 3HWRA 4G1PA 1F0PA 3QFTA 4X64J 4PSCA 3Q3IA 5AT1A 1JPJA 3UCFA 1G64A 1II8A 3LQ1A 3PFGA 5CT8A 2ZOSA 1IOLA 4ACAA 5AXBA 2CYAA 2G8LA 4RE6A 4DC1A 1UK8A 2ROQA 2QD5A 3H8JA 3V4LA 3H1AA 4BGEA 2M8HA 3STYA 8ABPA 1YZTA 2EFJA 4IIEA 2ZETA 5C2CA 1B1AA 1WDKA 4DIOA 3R9XA 4N82A 4O8ZA 4K9KA 4MRAA 2YVLA 3IKMB 1X86B 1ORDA 5DM60 1Y3FE 5TY0A 4O4LB 5L38A 1E6LA 2UVUA 3I4CA 2AUNA 3TQIA 2XWPA 4PZPA 1SPBP 3K4PA 5JVGQ 1Q8IA 1E5QA 1E1RA 5DCWA 4EYOA 1ZESA 3SJBA 3L6BA 4V0SA 4ETXA 1WLYA 4TROA 1EUCA 1AKUA 2OG1A 4QYTA 3DB2A 5TF4A 4F4CA 2PUDA 4G0OA 2REXB 1KLMA 1IJFA 1B42A 4DSFA 5IC4B 3ANSA 1I13A 3RIHA 1I3CA 1NVEA 2EW2A 4JJEA 1XMXA 3L6DA 4L8VA 1TKZA 1RRCA 4ZI7B 1UODA 4C3UA 4QJIA 2QLBB 2JATA 1CLUA 4DV6J 1XD9A 4G1QA 3OE7A 1FD2A 3T1YB 1IZ9A 4RWXA 4DSIA 2IRXA 4F56A 2AR9A 4TLMB 1R4NA 1M6YA 2OPRB 4F9TA 1FHTA 5F0WA 2C5BA 4M53A 1ZJ5A 3I9LA 1YJCA 1OY6A 2ZUAA 1ADBA 2PKQO 4A8TA 3QOYA 2QTWB 3UHJA 2BHNA 2WG2A 3AG6A 3AL2A 1UFKA 2WW4A 4OAQA 3IOEA 3C8HA 4AUNA 5JDCA 3IM9A 2DULA 2AZDA 4L02A 2ZRNA 3PRKE 5DBOA 1YKSA 5IKEA 4EATA 5IRCD 2CBXA 3U9LA 4PTZA 3Q7EA 2UXCB 4JGBA 3A4YA 2N1BA 4ED9A 3IPRA 4R9VA 2VODA 2G9QA 3WA7A 1E2PA 2WT4A 1GN8A 2SCUB 1NNDA 4II7A 3W05A 3SJAA 2X9LA 5COAA 1UFOA 1PZEA 3FSYA 1MBZA 2H4HA 3A9WA 4HDMA 2JEYA 2P5YA 2FUCA 4W5WA 4A8FA 5F8LA 1H2WA 2WSSA 3I04M 2P6TA 3SSMA 4Z4CA 3CY6A 1S3FA 2ZT7A 1T3OA 2GPSA 5EKUA 4G1EB 3KFXA 2HA2A 5MAOA 2BZ0A 3EPIA 2XCSB 3W78A 4ZXFA 1VI6A 1VE9A 1JG2A 1ACMA 5C5CA 2YYAA 5JW6A 3OQ6A 2OQIA 1ORIA 3KV1A 3TSZA 2BF4A 4H1HA 1I5RA 4WE1A 1AX9A 2LMIA 3WGMA 1ACMB 4OO3A 2YKGA 4W1SA 4MKBA 3W8GA 1EX9A 5T8KA 2BEUA 3JY6A 4EEYA 1T25A 2VPZB 3I1JA 2PZAA 3K4QA 3PFBA 3FNNA 4B7XA 2WNSA 3VR4D 5K45A 1G3QA 4QPCA 3T7RA 3IRWP 3KAQA 4D8VA 3SBMA 2XY6A 2YTZA 3A3NB 3GJYA 2VH2A 3T4UA 3V4FA 3SSOA 2P2LA 3S5JA 4GBMA 1MB0A 1I3LA 1DIRA 2Z2YA 5E4JA 4E51A 1TM7E 2ZT8A 2O66A 3QGHA 3WGJA 4FFDA 3VZSA 2XUAA 5C2JB 1NYQA 4JL6A 1OFTA 1TVEA 1IQZA 1GDHA 2VHXA 1RXVA 1WS6A 2ZCJA 1HWJA 5AJZA 2QTCA 2P3SA 2YN0A 1RT9A 3KKOA 3QXJA 1DDOA 2CHFA 2WYUA 4CL8A 2IRYA 1E2NA 4X65F 2DR6A 3FR7A 5D01A 5CA0B 1AQIA 3BHNA 5CITA 1RP5A 3WXBA 5JU6A 2NS1B 3OX3A 4F4IA 1NXTA 1R18A 1A8IA 2JFZA 3AFHA 2ODTX 3A2KA 4KR3A 3S5UA 3W2WA 2F67A 3TG8A 2FN4A 4Z0HO 4QXQA 5ES4B 4E5MA 4XIUA 2RQMA 3F49S 2VG8A 5ALDA 3ABQB 3QQ5A 1Y7TA 1J42A 4O8CA 3M8QA 5IJAA 4QSMA 3RGGA 2P91A 2IYUA 1A8UA 5FF9A 2KZMA 5JJLA 2JAUA 2IE8A 1XKQA 5IHPA 1PDOA 1ZU4A 4UM9B 1NXIA 1KAHA 1T3GA 1SJFA 3G0BA 2RHSB 2F8LA 4A6DA 1QUVA 4JT8A 1EGMB 3DLTA 4QVGA 5B7PA 1TGYA 1BCSA 3JD2A 4CG2A 4FBMA 2WFAA 3PC7A 1PCAA 1T11A 2P0YA 2OHJA 5DP1A 3T7IA 5C1OA 3T9FA 4XM1A 1Z0AA 3EDRA 1WMDA 3MD9A 3NMUF 3PJEA 5CX1A 1ESNA 4DEVA 5ALFA 4UEQA 4RPJA 3R9XB 3J7AC 3C46A 2H7YA 2RILA 3UK0A 2QWXA 3QA3E 4ZVSA 1JFFA 1UBJS 4MIWA 3EBOA 4XIIA 5BNTA 4MWEA 2CYCA 1KXZA 2BGRA 4Q6BA 3U9TA 4ZS6A 1AKQA 1ZS9A 1W7WA 3OT1A 2VT2A 3BSOA 3FFTA 4PZ0A 1XTZA 5G4KA 2P9FA 4U2KA 2YWGA 2HHPA 1RT6A 2CLCX 2WT9A 2VQ3A 3KEFA 1U7OA 4YAGA 1TADA 2HSWA 2F7SA 3TZBA 3L1VA 4G36A 1MOZA 4M3NA 5EIFA 2B5WA 4IDGA 1E6MA 4RTQA 3T15A 3K5PA 1KY3A 4Z7CA 2MQPA 1GVNB 4Q3EA 3UKOA 4HAWA 1EIYB 1VS3A 2BGNA 1WTCA 4OYAA 3CW8X 3S3TA 1CXZA 4KTQA 3BTOA 3GE9A 3EA0A 4XIJA 1TEXA 5K0BA 3Q9SA 3VR6H 3R44A 3D3NA 3HFKA 3EDOA 2QN6B 1QIHA 2ZYVX 3JVEA 1Z0JA 2RAQA 2LYVA 4WFNQ 1K68A 2GPTA 1BWRA 4WZZA 4O3FA 3CNBA 1SHTX 4EA9A 5L8RC 1THTA 1V71A 4A8QA 3K35A 1SVIA 2R96A 3EIHA 1PJ6A 4C04A 4Q3OA 2DZDA 5J2PA 4EEKA 3M3PA 4Y1FA 3SHWA 2BFBB 1IB6A 4TWIA 4DHVA 4QYWA 4YJGB 5A2QY 1I1OA 1SVOA 2VHYA 1MENA 1K63A 4MV6A 5SYAA 1TL1B 1UUFA 4DLPA 5CQGA 4YJHA 4A7PA 3ZJYA 4ECUA 4RKYA 4LZZA 4FLEA 2ADBA 4RKWA 4MUFA 4PFSA 3NDIA 4HLUC 1UZMA 1EVQA 3JQPA 1MJGA 3NOCA 4MWCA 5L3RA 5D4OA 1AMNA 3EW7A 2C95A 1VA5A 3LGHA 5FLYA 3I53A 4MI6A 3QYPA 1J2RA 3TH5A 3L5KA 2VOPA 2Q4DA 5BMVF 2COEA 2W6IA 3PZBA 3AAWB 1QE1A 3BFVA 4DBLC 1XAHA 1N1MA 4ITRC 4E98A 2DHQA 4EGCB 2CWKA 1EHWA 3QNUA 2I8CA 5C34B 1OC4A 4ZZ0A 4BO9A 3KR2A 4D3XA 3LPMA 3QKUA 3AG5A 5ETKA 1IUPA 1XZIA 4M1WA 1XCLA 4LIRA 4HYEA 3LP2A 1U81A 1LS1A 3F4KA 5IMSA 2RDIA 1WDDA 1NJ1A 3RU3A 3TINA 2YFKA 3MCMA 3ABSB 2Q6OA 1QK5A 2QD2A 3RBDA 1FX0A 5CCDA 4NONA 3BO2A 1L5HB 4UHKA 2V50A 1V47A 4UFNA 1K6MA 3AUSA 3A3NA 4D96A 3HUDA 3UXHA 3IHKA 1U0SA 2WUFA 5FD1A 4HDAA 2CJWA 2B37A 3U3DA 3C85A 4PCUA 3WIOA 1L6RA 5HGJA 3G79A 1TZBA 2ZBDA 2Q0HA 2JAHA 5AI5A 5H80A 2X5NA 2GBPA 2IM2A 4CLRA 3GYBA 4DR3F 4P0QB 2YOGA 2WK1A 1P73A 3CW9A 2B3TB 1A77A 1R37A 2QR2A 2B6NA 4U3JA 5F3RA 3OE4A 4JI1F 4HWKA 3K8OE 4I1YA 1U4BA 3UOWA 3W63A 2FP4A 4FDFA 3KFLA 4KI0A 1HMVA 2W58A 1L7OA 4G9BA 1JFSA 5ALVA 4TLBA 3NNCA 5CP8A 2ZH9A 5LQCA 5DTIA 2XF8A 4B32A 3S44A 5L7YA 4S35A 4R05A 2H52A 1DTQA 5IG2A 1HL6A 1Z33A 2INGX 1JAYA 3OHBA 1CKEA 1XL0A 2XOEA 5SY9A 1JKMA 3AFGA 5J43A 4NLVA 2ZIXA 2RD2A 1RTDB 1AKYA 2OOKA 3KQMA 1SIBE 3ZE8A 3JD3A 1J27A 3GXOA 5KVCA 1S48A 2HVIA 4O2BA 3ZI0A 3K2BA 4GM1A 3DOLB 3KTDA 5KFOA 1F2HA 4HC4A 4D9EA 4G23A 4FYYA 2VH7A 2LP4A 3GIIA 4CYUA 5EPEA 5DGHA 2XTNA 4USKA 2MSEB 3ADOA 1K9VF 2PKWA 4DMMA 4JZKA 2WHRA 3VBCA 1SIUA 1UMDB 4OSPA 4PX3A 1GNVA 4YV0A 2IYNA 3OQBA 3OY2A 2CQGA 2CFXA 1PS9A 4JLPA 1HEUA 4BP9A 4NYJR 5HKBA 1NEEA 4JR2A 2A9VA 4AP6A 1R4MA 4R8UB 2BFPA 4PNPA 2YWHA 4HN9A 4H18A 3P19A 3D4BA 1H1LB 5EIEA 1D4AA 2B4OA 3H1BA 2I66A 5ED4A 3AHIA 4XYEA 4XYBA 1AFIA 4URUR 3I37X 3O8QB 1V26A 3WMWA 3CULA 1WEKA 5KFPA 1IJEB 1FL9A 1DARA 2MINA 1P6QA 5IDXA 1W7AA 2Z2ZA 4HNRA 3GD5A 5AWFC 4NMXB 4RIIA 5D00A 5KYKA 2ZAOA 2BGIA 2HYIC 4NMHA 2FPIA 3VH3A 2RQKA 5LNK1 4NX2A 1XV5A 3G2MA 1U7PA 1RZRD 2VP0A 2JSXA 2DQSA 3M4XA 4CI0B 1DJQA 3LU1A 3TRGA 2H4JA 3ET6B 4BYGA 5FULA 3J81Y 1VLMA 4LZLA 5KKAA 4X7BA 4XQEA 5A8KB 4CZ2A 3OUZA 3L84A 1IJFB 4O2AB 3NMRA 3CONA 2IELA 5DHSA 2ODPA 4I8IA 2RGYA 1XIVA 3TKAA 2PGIA 2XJ9A 2O8DB 1CWUA 2P2NA 5HVGA 2HEIA 3BH0A 5H82A 5DASA 1NGSA 2Z6QA 1M5KC 1HE8B 1K5PA 3ZDCA 3N0RA 3P5SA 3K6SA 3IBCB 3SIWA 1HORA 1HNVA 2BKVA 4DIEA 2DQ4A 1SQ6A 3G86A 3VAZA 2AC7A 2WJ4A 5AXAA 4X8OA 5CW1A 1JHPA 1MW7A 1HYBA 5EQJB 2DNYA 4HAXA 2MINB 1M6VA 1NSTA 1H1DA 2QTGA 4TNOA 4S24A 4DPXA 1SQEA 1Y4ZA 2ZYWX 5K6TA 5H9EK 5LJLA 4C4RA 5DQGA 2HMVA 2MKCA 1ICEA 3GA7A 1GNRA 5IZCA 2D74B 2WDPA 3KB6A 4C48A 1D6MA 2DWCA 3QYFA 1FRXA 1AK2A 4GX2A 4H4OA 1Z1ZA 1JSCA 3SZGA 5KTQA 1AG9A 1HLFA 1PLJA 2B56A 1JVNA 4IR1A 4C4ZA 3TW8B 2IFXA 4GOND 1TD1A 3A13A 4I64A 3B9RA 3K6SB 1NDUA 4RWZA 5F78A 4DQUA 3GV8B 3GVPA 1LBHA 2EVZA 5M7EA 4EL0A 4XA8A 5BW4A 5HJYA 3JQJA 1RI2A 2HJVA 3FOCA 2ZRJA 3I6MA 4DMKA 1HKUA 2FVCA 2NO9A 1I3OB 2IHR1 3VOAA 2PK3A 4UE3S 1NPRA 3C0KA 3CJTA 2QUAA 3QE2A 2PMZD 3TQHA 3WK8A 2YC4C 2WUVA 3H8WA 1JLAB 2X8LA 1EFDN 2MHCA 4REMA 1VQ9S 3WGIA 4CYUB 1Z4KA 3EQ7A 4YJ2A 4HAYA 2R3VA 1MTOA 4P9SA 3DLCA 3DPUA 3CJ8A 4ZDWA 2HFSA 5DZSA 3ET5A 3G8BA 2RH8A 1JJBA 1S8NA 3GLGE 3W61A 1D2AA 1F17A 1JT9A 3KHUA 2AS0A 1APBA 4C3KA 5EN1A 4ZPDA 1PV2A 5C7IO 2IYYA 4Z54A 4ZLPA 4J90A 4ZRNA 3BERA 3L18A 3GRCA 2GJ2A 4DKXA 2PFGA 4YQZA 4MROA 4C97A 3WAJA 4C7BA 3OPYA 1J09A 5EN4A 4BCCA 1U2FA 3K20A 3LWDA 4UZFA 4FYWA 4QQRA 3KLHA 3WLHA 3CR8A 4Q9LA 3EZNA 3GRAA 3GLFA 3WSVA