1M0SA

Northeast structural genomics consortium (nesg id ir21)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21
rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
molecule keywords Ribose-5-Phosphate Isomerase A
total genus 72
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m0sA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m0sA01
2RE1A 1FS5A 3IBWA 3OFFA 2P9EA 4X84A 2PC6A 3CH7A 4GO1A 3W7BA 2I9SA 1FS6A 1O8BA 1HOTA 3OFEA 2H9ZA 2ZHOA 3K5PA 5T41A 1LK7A 4L4ZA 3KWMA 3BXHA 4LUBA 5IT0A 2RI1A 4L51A 5IS2A 1LKZA 2J0WA 3S1TA 1DEAA 1KS2A 1M0SA 2F1FA 3BXEA 3ENWA 3EB9A 1NE7A 3NZEA 4PWUA 3OBIA 1LK5A 3HN6A 2RI0A 2GNPA 4IO1A 3MTJA 2DTJA 1PBTA 3BXFA 2RQMA 3NWPA 2CDQA 5HJ5A 2W48A 2KO1A 3HHEA 3E7FA 1ZPVA 1JT9A 3OFHA 1Y89A 2F8MA 1UJ5A 1UJ6A 3KV1A 1VL1A 2QMXA 1FSFA 2J0XA 3AB4B 3OC6A 3L7OA 3N0VA 3EFBA 2OKGA 1XTZA 3AAWB 4TM7A 3O1LA 3DC2A 2BKXA 2P9CA 3TX2A 2QSWA 3ENQA 2QMWA 3ENVA 3IXQA 5IT4A 3TUIC 1YBAA 3LWDA 1FRZA 2P9GA 3MAHA 1CD5A 2NYIA 3DHWC 4GO5X 3U7JA 3CEDA 4OQQA 2FGCA 3DHXA 4M8LA 3TUZC 3OFGA 1Y7PA 1PSDA 2LVWA 2WU1A 2LQJA 4OQPA 4GMKA 2O0MA 1FQOA 3ICOA 2DT9A 2R5FA 3TUJC 3LOUA 3P96A 3LHIA 3MWBA 2RQKA 4R9NA 2BKVA 4GO7X 4TM8A 1HORA 2J0EA 4NMLA 4L4YA 5FIIA 3AB2B 1SC6A 1YGYA 3E15A 3UW1A 2JOQA 5JJBA 3BXGA 3LUYA 2JHEA 3CSSA 3DDNA 1UJ4A 4L5IA 1U8SA 4L50A 1RWUA 2PA3A 3NRBA 2QRRA 4R7TA 2MDAA 4L5JA
chains in the Genus database with same CATH superfamily
1KQGA 4FDMA 1YMQA 3DLPX 4HV4A 4C0OC 4ERXA 2ZSJA 3I2YX 3QELA 4DR6F 3FJ1A 3LE8A 1X2EA 2L3MA 2AOTB 3EIFA 2YKNB 4HNHA 5J4HA 3IBFA 4RADA 3AJ2A 5LQMA 4YR9A 4BC0A 4PYOA 1J24A 3GFYA 4ZVLA 1UF9A 4KXUA 2HLTA 3E0XA 4DCUA 2PBLA 3GUUA 3JS9A 1T8EA 1AOXA 3LPDA 2PNFA 1IYZA 2PQMA 4V0QA 3VHQA 4YHBA 3HJTA 3VR5H 2IYRA 1KMHA 3TQHA 4NFSA 2HCTA 2PXAA 3JAWA 4MYRA 1DFDA 4BNVA 5F3ZA 1Q3KA 5LZ4A 1LLCA 1EUDA 5FULA 2GRJA 3VSAA 2XO6A 2NUAA 1E20A 4R0MA 1SKBA 3RB8A 2R8BA 4CEJB 4DV2B 3QEJA 1M0TA 2HWHA 3B1FA 2IHVA 3QO9A 1R27A 2GA9A 1OBFO 4DFJA 4WNAA 2R7UA 3OZWA 4DU7A 3SU8A 5TE9A 4DJJA 1Q2UA 4GHWA 4POOA 4K4TA 3HN2A 1H5UA 1EVZA 3GIMA 3UUEA 3MUFA 3I62A 3PJXA 3GLJA 2OC9A 1RWWA 1JYEA 3I5CA 2W6JA 1QRTA 3WK7A 3AU9A 1FBTA 4B3SJ 3FCOA 2MINB 3VVLA 4NHEA 2XVZA 3I9LA 2MMYA 4P82A 2Z2ZA 2B8NA 2MKJA 1XTQA 4G0ZA 3M6AA 1M0WA 2OM6A 3O91A 2E1RA 2PZAA 3NBZC 4MJKA 4RHEA 2J09A 5K9ZA 1G8SA 1Y9ZA 5B57C 4OZLA 1A9XB 5E7MA 5SY4A 5CGZA 2DR2A 2ZKIA 4DLGA 1Y9JA 5T3UA 5GAEI 1Z35A 5I9SA 5A2QA 3GNLA 2ZTHA 1AXQA 4Q4LA 3VZHA 2FPUA 3SS7X 3VRHA 4TTIA 3KXDA 1HK7A 2N3ZA 1W52X 1IJFA 5HA5A 1T5DX 1EX9A 1PLKA 1JAYA 4ZEOA 4BQIA 3F6RA 3JWPA 2F67A 4DUZB 1VIYA 3WGUA 3ZZ1A 1YAJA 1E58A 3NO4A 3DD5A 4NZOA 5KTMA 1MSWD 3P9RA 5EIHA 3FA2A 1PKUA 1ZXBA 1WBDA 3C14C 3AHJA 8ADHA 3TLZA 3U81A 2VYVD 3S1TA 4ZMMA 3RBXA 4RLHA 4ERDA 4XM2A 4MAFA 3NYQA 1K9MT 2AK2A 2J6TA 2A7XA 3QMVA 2DBZA 1IBMF 2VC0A 1X8DA 4D3HA 1VC5A 3MCWA 1RC8A 5KT3A 3OJOA 1UP4A 4G63A 1LRJA 2UXBJ 4Y67A 3D3JA 1O94C 3VH4A 3BFPA 1QY7A 1XNRB 1PQWA 4USHA 1QIJA 4LI0A 4WXMA 4TRNA 1L1FA 4PHHA 3CRZA 4CGYA 3CEHA 4HTIA 3DO6A 4DV1B 1ODTC 3JYPA 3E82A 4R1TA 4UEOA 1RJWA 3OTWA 1L1RA 4GOMD 1Y7HA 3V33A 3KTQA 3DBRA 1F5BA 2WJIA 4AM8A 1ZN2A 2VL7A 3L6DA 2REOA 4TZ6A 1K68A 1FS5A 4EAAA 3EZ7A 3UDLA 2OZPA 1DURA 1L9KA 3NP5A 3VDXA 4E21A 1WF3A 4LCJA 3GLTA 1CS4A 1NLZA 4OFWA 3OM8A 3N8IA 3HP4A 4EECA 1ZD8A 3L6RA 5IKPA 1Y1QA 3CWJA 2XNDA 4CNBA 3VAAA 3WK4A 4JV5B 2RHSB 1SVOA 1VRCA 5LBIA 2GDJA 1NF8A 3L95X 4QYRA 3DS8A 3D2LA 4JJFA 4OIFA 3HXQA 4PLTA 5KFPA 1Q78A 1C0PA 3AETA 3EG9B 1ECGA 3IS9A 3C6KA 3SWWA 3NX4A 3DJFA 1ZA1A 4WJBA 4CV3A 1PR9A 3ZZMA 3ASVA 4QPPA 3BTSA 2XKKA 4HNUA 3DQQA 4RVGA 3VR5A 1XEXA 3ZBQA 1MGPA 4PQRA 1NDPA 3NWRA 1FRQA 4M83A 3MTBA 2XMQA 3CX7A 1IBLJ 4QSMA 2MYFA 3RIMA 1IZYA 3WGGA 5JXGA 4ZVPB 1XP5A 4DIEA 2R6AA 2PC6A 5D3KA 3LV8A 1GT8A 4M5JA 3M9MB 1W2WB 1ZA2A 1M73E 1QQTA 4GUAA 1C0TA 3B9PA 2OVFA 4NBKA 4KLRA 3H5WA 3BGOP 3ESRA 4GI1A 4Y2AA 3G2QA 3UNGC 1WHVA 4TS1A 1C0EA 1SJ9A 2O23A 8ATCB 3WZ2A 5B0EA 4BO1A 3T7KA 4OJGA 3FKQA 3QU9A 2DETA 1XPOA 1KP3A 2B1GA 3BYRA 2OO4A 3B1VA 3NKFA 2V6FA 4XB6B 2DCUA 2CCKA 3DMRA 1FNDA 1F1BB 4BX2A 2DHHA 1G5TA 2GPWA 5FAKA 2C97A 1S2GA 4TL9A 4GLFA 2ZH6A 5TNXA 3DJYA 2D9OA 2IDMA 2QTTA 5A0YB 3E9ZA 2JH3A 1CC7A 4WNAB 3UQSA 5KTNA 1M9NA 2JIQA 3BKFA 4IJKA 4P2XA 8MHTA 3RS5A 4KHRA 4IDAA 5KT4A 3QOXA 2EK6A 1CJMA 4UMVA 2Y68A 5SZIA 5FAXA 1DO2A 1TZ2A 3TEGA 4EY6A 4NXNJ 3QJJA 1M3SA 4MGZR 1EVEA 2MKKA 9LDBA 5C3UA 6AT1A 5AMXA 1RYEA 1TM2A 3UJ6A 5H8WA 4CM8B 4JASB 5DI3B 5ELMA 4EPYA 2CJPA 5DSXA 4KODA 3HSKA 1QZZA 3PHHA 3WGLA 3NHAA 4RMIA 3BD6A 2B3TB 2P5SA 3UAZA 1NLFA 1VBMA 5TARA 1H2BA 3CGGA 2KBFA 4OX6A 4RTLA 3BMNB 1GG2A 4MUEA 1KC8T 1TMYA 1TFRA 2EFHB 4H3KB 4BZWA 3U3XA 4KYUA 1K0VA 1MAVA 4O4JB 1QUVA 5DT9A 2JFPA 3B5JA 5TSDA 5EP1A 2PX5A 3B6JA 4PGHA 1UUFA 5F8JA 3PLAE 2R2SA 2PWPA 1A1VA 3FWHA 4BEWA 2K2PA 3RTAA 5DNUA 5IM5A 2A3JA 3X2SA 1IR1A 1D1PA 3FWNA 2BBEA 1Z2OX 1NSPA 1W26A 2E1MC 3KQPA 1I3LA 5I47A 5AXKA 4M99A 1CNFA 1N3BA 4UUPA 3L6OO 2OMKA 1UMDB 4EK2A 3D8SA 5LZ8A 3GWZA 3GIKA 2CJBA 1BJTA 3GJZA 4JNKA 4FBLA 1YD7A 3PRVA 1E6UA 1ZUWA 2W22A 4DJDC 2GN8A 3UB3A 1X8LA 1DNPA 2QYTA 2FFAA 3NGMA 1CG2A 1MJGA 2GJSA 3H2HA 1Q84A 1TAGA 3RW9A 2KVIA 4G56A 3VAMA 3SJ7A 3R7DA 2YV2A 1H0RA 5IAJA 2FN9A 1UPMB 5HS6A 3Q6NA 4MKGA 3DB1A 2B9VA 3GW8A 1SJFA 1HLGA 3IGVA 2I3AA 1PNQA 3C3PA 1CNEA 4QVIA 4AT1B 4O3RA 1TTHB 2Q9UA 2VPZB 5ALJA 2B5OA 2Q6KA 3ERCA 5L9NA 3D3WA 2GNKA 1N2CA 4K9OA 1XR7A 1QMPA 1I51B 2C2KA 3NOXA 4XUCA 4KBFA 3GLKA 1WORA 2E82A 4HQRA 3ENNA 4IV0A 5CW2A 2BE7A 1UEIA 1EARA 4OL0A 4WKNA 3ZWYA 3HSYA 2GO8A 2FPKA 5AUOB 4O3PA 3HYLA 4QXRA 3DDIA 3NM4A 3I09A 1JKFA 3JAKA 3FYHA 4BNMA 3OM1A 1LI7A 1O95C 3S99A 3KYJB 1NJ1A 4N6NA 4J2TA 2AYGA 1G8GA 1G3OA 4B3IA 1JQEA 5FRDA 1RTZA 1S49A 2QM0A 2CRLA 1KA9H 3ZGYA 5EIAA 3TAHA 2BM9A 3SZ2A 4Y9UA 3RYCB 5I7UA 2IA0A 3ER6A 1RHUA 3DL0A 4MQLA 2FUG6 4XPCA 3Q2TC 3PTAA 2F4VJ 4BEBA 1YR2A 1CR1A 2XI2A 2IHKA 4Q9KA 5A6VA 1PR6A 2OTCA 2AJLI 3GYBA 4HNRA 5LMCA 1P6TA 5HIIA 1KI4A 1P62B 1R0XA 3GLHE 2VSYA 3ZJTA 3QPAA 5BMVA 3BZWA 5LM3A 4ZCSA 1W6RA 3SE0A 1PJ5A 2CG4A 4GWLA 3GFHA 4NF2A 3H4IA 1TL7A 3NP7A 1PT8A 4MYTA 3RFTA 4IIGA 3TIFA 1N2IA 4N5SA 3MEGB 2QMUA 5U4XA 2IPNA 3NPAA 2KI5A 4A0RA 3KHSA 4BYMA 1NJ5A 3WL3A 1RACA 1B6GA 4KJXA 4KWHA 1NXTA 2IPOA 3MK31 1AKWA 3WVNA 1NR7A 4M0MA 4CLYA 2GB4A 3IRXB 1OYOA 2PYZA 3NMUF 3QUQA 3HKCB 1KQFA 3CX8A 1X5SA 4BBPA 4Y1EA 4F0MA 3SQOP 3ZQUA 1U8WA 5TEWA 4EG8A 1KI8A 5HXAA 2YY6A 3A4NA 1SVSA 1W1WA 4K88A 5J2QA 2GK4A 4NCHA 3AJ1A 5BQXA 4DR1F 3CJKA 1OX4A 4RHUA 2V8GA 4URSA 2I22A 2GM4A 1ZIDA 4X92A 2A84A 5F78A 2LD4A 1IY0A 2EFVA 4J49A 4XDHA 1F14A 5G0UA 2AYZA 2LR0A 5L8RC 5IXYA 1PKXA 3U1BA 4HGPA 3GH1A 2G2OA 1L7VC 1TKXA 4YDDB 5BR1A 1UDXA 2HSZA 4QZVA 1RT4B 3H11B 4ICLA 5I7AA 1BN6A 2WP0A 3QE2A 1JQJC 4M1SA 5HQMA 5ALEA 1RBQA 2VWPA 1BCRB 3NV7A 3QEMB 4CQLB 1T25A 2PR2A 1PQ4A 4OHBA 4DJBA 3ZOZA 2HIQA 2A92A 1WCIB 3RC3A 1FCAA 2HF2A 1XPJA 4F7WA 4MV9A 5A3RA 1PD0A 2DNZA 1G21A 1URNA 4EARA 4IMRA 1RTDB 4DAEA 1HBMB 2AX1A 4EELA 1N6LA 1L7AA 1E6VB 2V4JB 5DETA 1XGKA 4ENQA 2FEXA 4B3HA 4DFDA 4NLRA 3ZZUA 2QU7A 2YNGA 4IUBS 1N1EA 1O8BA 1ZCZA 4GKAA 2CDRA 3EMBA 2V0NA 2JGIA 4M8NE 1WZCA 1FO1A 4DSJA 3JQBA 3THXA 4KV8A 4ZALA 4KUHA 2DLDA 5KG3A 1PHRA 3CD0A 1Z33A 4PC7A 2H7VA 4J90A 1RBAA 1QCYA 4NXMJ 4FYVB 3LC2O 3W64A 1N5OX 2BA9A 4NBUA 2N4DA 5TQ2B 1VIDA 2FRXA 4XYEA 1SU4A 2HT1A 1Y1LA 3QVTA 4CDNA 2BCJQ 4J0GA 4R2LA 3OMXA 4PY2A 1Q5PA 1LXJA 2VSOA 1ZWKA 3NALA 2FX5A 1ADBA 2ZYHA 3Q8QB 1UKAA 1GGVA 3NOGA 2IZOA 4JLAA 1P9YA 2R4FA 2CZ9A 3OIVA 4RBUA 2ZUBA 2QSFA 1GA4A 1WG8A 2R6ZA 2XXJA 1U0RA 2C2RA 4NA1A 4JUZA 2FHOB 4Q1FA 3OPVA 3IQGX 1JVNA 3CUTA 3P4UB 5DLFA 1B14A 4EG0A 2FGJA 3EGEA 4LZJA 3UV7A 4OHUA 4ZLLA 4ZP9A 2C1EB 5KPJA 3FNNA 5E5NA 3JSYA 5T41A 1GNTA 5HFNA 3EC7A 1M0SA 3R3SA 2QNRA 1PC5A 2NSHA 2GXSA 3W1EA 1U8XX 4GT1A 3WLTA 1FDVA 1YJ9S 3TI9A 3K89A 4LQDA 2MSTA 5HUQA 2V4ZA 4PV7A 3H1BA 5JWOA 1WZ2A 1JLAB 4OI0A 4RA9B 1JJ4A 4BTVA 5ULLA 3A8TA 4ZYYA 5JI2E 3S40A 4WE1B 2XDWA 5FTLA 1F0XA 3CT9A 2VT7A 2N1BA 3TBHA 3NEKA 4ARCA 5EHQA 3L6UA 2UXCJ 1DHRA 4M0DA 3ZLVA 5K0BA 4H16A 4QOEA 1Y5NB 2P9TA 3PPIA 1NG1A 2VDHA 1NVFA 4LDQA 1L1QA 3Q5DA 3ZTOA 4TZTA 1QZTA 2P41A 2ES4A 2B61A 5BXYA 2C54A 2CADA 3K7EA 1YR9A 3LQ1A 4AZVA 4JB0A 4RMJA 5A05A 4FF2A 1JU9A 4QR1A 1NK6A 3FPLA 3PD1A 4Q4CA 5BPHA 3L41A 1PILA 4FLMA 1WJ9A 4Y6GB 3F47A 2IEDA 4X71A 5GADI 3SM9A 4BU1A 1E9FA 5K3FB 4XFKA 2RS8A 3P26A 2Z58B 1C8BA 3K96A 3H6KA 2YV1A 2R1TB 2HQCA 3WYDA 3LX8A 4FINA 3QI7A 1R15A 3MCMA 4L22A 1R50A 2C4MA 1I2AA 3LP0A 4HYQA 5F76A 4RPLA 1G2OA 2DBBA 3DE1X 1ZJYA 1NZ8A 1DX4A 5K8CA 1IXKA 1SKYE 3KQNA 2QXUA 4FEAA 1YQHA 2VJQA 5AW6A 3ZDEA 3ORYA 3WX8A 1D04A 3L40A 4MEJA 5CHCB 1SXHA 1NW8A 4BFUA 5F1OA 1S1UA 3B89A 4WSOA 1Z5WA 5HK8A 1U98A 3IAM1 1QF7A 2VOEA 4FKBA 5IKMA 2CJKA 3AHIA 4G5SA 4RELA 3WAJA 4PTZA 1U80A 4LG1A 4JUCA 5DK6A 3F6PA 4G5YA 3DOLB 3GEHA 3AR5A 2CPZA 1ZZFA 2RBGA 2OYSA 1SXGA 4YK7A 2YMQA 1LQ9A 3GV0A 3LZ6A 3Q0TA 4Z8XA 4K9QA 1W0KA 3TXXA 4LXGA 3A6GA 2QR3A 3BE8A 3UK2A 4JKIA 3BL6A 2NG1A 4ILEA 1CS0B 3QA3E 4YQWA 3G6ES 2PSFA 1KDTA 1BIFA 1R5NA 2MOKA 1BS2A 1Q19A 4JCOA 3LPYA 4XIYA 2ZIEA 1FVOA 2ZITA 2Y9PB 1M5SA 5AHWA 3QNUA 4NU0A 4PUOA 1MG7A 3GIWA 4CQJA 4H60A 3GZJA 1SK9A 2ATVA 1P6XA 2QF7A 1RI2A 3PX3A 5KQMA 3IAUA 1XWLA 2E9ZA 3ZW8A 2E48A 2DXFA 1YF3A 3W5BA 4Z86A 4DVJA 4BNTA 3U6BA 3EARA 3N87A 4YLGA 1XD2A 3BX1A 1ADGA 1UWAA 2OKQA 2PRZA 3I6MA 3OXGA 3NHLA 2JARA 2H4ZA 1KK3A 3PKMA 2J7UA 4GI2A 4KV7A 4IDCA 4C2UA 3E3XA 2HZBA 4D97A 4CG1A 1TDJA 1X42A 1T1JA 5ED4A 1M5OC 3GL9A 3NLCA 1KDPA 2AYXA 1HWKA 4GZLA 3U3DA 1NNDA 1T9BA 4MP3A 1ZSNA 2V8VA 2EZ4A 2QVLA 2WG2A 2BUAA 1UCNA 3UAWA 1X1TA 4DLTA 5I3QA 1JDTA 4RGBA 5GM2A 5HKBA 4NASA 3QT7A 3HJCA 5IJXA 1SUWA 1D6JA 2IFXA 2KB2A 3O3LA 3K5IA 1JHDA 5A5GA 5ETPA 4LOKA 1RRGA 1QSGA 1NVVR 2BFCB 3ZKAA 2EGHA 3L0CA 3WIDA 2XXAA 1B8NA 5DU2A 1KSFX 2NU9B 3KLHA 3SBXA 3HZRA 4AZ0A 3ZV6A 1R8QA 3DC2A 4V0OA 3SCLE 3D31A 4WA8A 4RK5A 2J8SA 1IXSB 3ZIAD 1C1YA 3SKXA 4GOXA 3LMKA 4G25A 3ZHSA 5TVGA 2FPGA 1RWKA 4ZCLA 4TWIA 1ODCA 4ECQA 1GN8A 3TW0A 3O95A 5L51A 4AKSA 3GD5A 3JW8A 3Q8KA 2YKQA 2ZETA 3H0PA 2FPWA 4JYPA 2GJ4A 1JG1A 2HNKA 2VHWA 4OK5A 5E8RA 4EG5A 2K1RB 5EUMA 1C1BA 3N9IA 1KJIA 1ZRHA 5C1IA 4PQUB 5JISA 1AKTA 4EHFA 1C4OA 1JU3A 4YN3A 3AOEA 2R85A 1LV7A 1VRWA 1RMQA 3CLRD 4IXMA 3SMVA 4PBRA 4UUAA 4CNQA 4Q37A 3ZPXA 1H2HA 3SC3A 1PW5A 3OPXA 1E3LA 3DZFA 2R87A 1KMIY 4RJJA 5FDLA 3A6ZA 3AHHA 2I1WA 2L0XA 4IHAA 3Q11A 1YZHA 2AFHE 1X2BA 4DFPA 1JKJB 3FYCA 1XRQA 1YOVB 5CX4A 3RC9A 2IM1A 3RAEC 3OICA 3IBCB 3WDOA 4MV7A 3ZJYA 4MKRA 3UK1A 4ZU1X 3I0MA 1DADA 4X65J 4I2PB 2L82A 1OI4A 1L8XA 3R0VA 1FESA 2JZ5A 3GPAA 3EX7C 3TVDA 4KQJA 3KNGA 5CDYA 1HLDA 2UYHA 5EHHA 2YUTA 1VG1A 1FEEA 1YC5A 3MCTA 3TE7A 3PNYA 2D0IA 3E3NA 3E1KA 2FUG1 5DLQC 4USJC 1VDMA 4YAKA 5DN6D 4IDOA 4PLPA 4K8RB 4IJQA 3TIXB 5JR3A 1ZNZA 3WWDA 2BZSA 2I7TA 5G41A 4LF5J 2CMKA 3K6SA 1WSRA 1KY3A 1NXWA 4EKIA 2JGRA 1NUSA 3KKEA 2IEAA 4WJKB 4DGQA 1AROP 1U9IC 3GT0A 3N01A 2PV7A 4L02A 3G8TA 2YJZA 1KLMB 3UH0A 3M2PA 3T06B 4E51A 2IUEA 2Q0HA 5B4TA 1EK5A 2HIGA 2ZTLA 1X4DA 4OLAA 5E41A 1T3GA 5D85A 4B3BA 1RT7B 4DMLA 5BV8A 3BREA 2DH9A 3ZHZA 2NZJA 4UMDA 1TCCA 1CEXA 1TC1A 5DLPA 2NSYA 4QXMA 3ETMA 2DNRA 3PE3A 3DL4A 3KT6A 2AI1A 4KYZA 3QKRB 4LY0A 3WDKA 3FPJA 4F21A 5B5SA 3A9VA 1E1DA 2CJWB 3ICWA 3VKGA 3PD0A 3OSPA 4FVCA 4AMBA 4CO5A 2Q3MA 1NKEA 3TJZA 2EYUA 2DVMA 4YUYA 1XLVA 3CH7A 4W5WA 2YVUA 1XQVA 2CFCA 1N5KA 2NREA 4CL2A 2YX1A 2GN0A 2QORA 1W25A 4ODIA 2G5CA 4AYWA 4IR9A 1E3DA 1X77A 1JXVA 4ZT3A 1GYPA 3COPA 3C45A 5E9QA 3IP6A 1I7SB 1PJAA 4P33A 2JGAA 2VQFJ 3HZGA 1GSAA 3BCUA 4C0AC 2PJDA 2VP3A 3SCKE 3LT4A 1FVHA 1KH2A 2O8CB 3PR2B 1FQKA 5CA1F 2QV0A 2PGDA 3D64A 2RF2B 2DD8S 4Q7LA 4B76A 3O74A 3ZGZA 1EZZA 5DDIP 2HWYA 3MMZA 3RVSA 4TL6A 1WD5A 2OLJA 4WKPA 2C0QA 1ORHA 1GUYA 2B94A 1FXWA 1QCDA 1J2TA 1W5TA 1EMDA 4MKXA 2RMLA 3A2MA 2IYYA 2ZKLA 2KZZA 3K0AB 2O8DA 1D2AA 5DDOC 1SZCA 1ZLXA 5K0CA 1HT1E 2IM3A 2D1TA 5F9FA 3WYBA 3UQYS 2HHPA 3GB0A 4KEAA 4MR9A 4DFKA 4JELA 1JQLB 1TT5B 1V6HA 3L4JA 2JI9A 1Z88A 1ETHA 3EZ9A 2DUWA 1NHGA 3EZ5A 4B7AA 3GRYA 1C9EA 4DA9A 2DGDA 3MJHA 1I2DA 5AM2A 1E1CA 3SHOA 2VF8A 1V35A 4O5AA 2AIRA 1ZGHA 2XG8A 3LQ2A 1N6PA 2JD2A 2CV1A 1OI7A 5EMJA 3R5KA 2CUKA 2XWPA 2BJDA 2CLCX 3VYWA 2GARA 3PYGA 1XG5A 3K0SA 4LIPD 3WRVA 3W3AH 1L7PA 3OF3A 3O8QB 1QK3A 3AG6A 3PFIA 1YA4A 1JLBB 3R1IA 5J43A 3ZWPA 2PRIA 4PTYA 4OJNA 3RW7A 1VC2A 2CQGA 4I1UA 3OJFA 2DRDA 3QENA 2CL7X 3WJ7A 3N5KA 4QFDA 1M34E 4LGMA 3LXXA 2WLTA 3BWXA 4PZDA 1VPVA 2HA6A 1V95A 1CETA 3JD3A 1GNLA 3R7SB 1MROB 4ED2A 2C2GA 3REQA 2WTUA 2R7OA 3HXTA 2X6RA 3KFXA 2VSXA 5ITWA 4NBTA 1ZWLA 1S1XA 1VRQC 3TNFA 4RANA 5EIOA 4Q02A 3SHTA 3N1UA 1J6UA 2D2FA 3RSLA 1XJ5A 2FRDA 5DGXA 5A4AA 1DRVA 1V39A 4PLYA 3ORQA 5I4CA 4ESHA 2B30A 1ZCFA 3QXSA 4OXQA 2JFVA 4O44A 2VDWA 3IP0A 3IPRA 1U2SA 2N9UA 3FOEC 1C1HA 2F00A 2VK4A 1U1NA 3OLYA 1QQ5A 5FYDA 1XEFA 2WTFA 4EJ6A 3UCGA 3TFOA 3KLOA 4NE9A 1S8OA 4AD8A 1S0VA 1IM6A 1RAAA 2IZ0A 1DRWA 4ELTA 3TQFA 3NRBA 4YT2A 3CLKA 2OPRB 4NCKA 2FIUA 4NWBA 1FDOA 4ARSA 3QIPB 4NPOA 4O4RA 1IKYA 1EX7A 1RWXA 4KE6A 2ZKTA 2O1PA 3U3MA 2A30A 1TUIA 1YS6A 2CNOA 3D8HA 4EPXA 4CO1A 1IN8A 4DUPA 4UVGA 2NAFA 3ICQB 4ZITA 4UU7A 2JDJA 5B1IA 5K3CA 3L0IB 5B7WA 1RJ9B 1CULA 3H7IA 3ETEA 3DLIA 2A2CA 4QUDA 3MFYA 5DCWA 2VHJA 4DANA 3VO2A 4OG2A 2QJOA 5BOSA 1ULBA 2KW5A 1ZI9A 4L9WA 2XZDB 2XB9A 3EMVA 2HMWA 1JWLA 5AOCA 3K30A 2Y71A 3BS4A 2BMAA 1JR4A 3JQ9A 1Y8RA 4WK1A 1WG4A 4C4AA 3QLTA 2DKOB 2ZT7A 4QYSA 1IDOA 4OREX 2QRGA 1K8QA 4FILA 4ZOLF 3M70A 3TH5A 3GP8A 1SH3A 4HDCA 4RIFA 5CA0A 4J0HA 4MQMA 4HGOA 4EO4A 1XOIA 2VUUA 3EPRA 1I6JA 2CUZA 1YRWA 5J4VA 3VZRA 4ZA1A 1RLDA 1FPMA 3DFUA 2QDXA 1ZHHA 3NBPB 4DUGD 2JLVA 1EGVB 5GONB 2HYIB 2SCUA 1I5OA 3EEQA 1P91A 4PHFA 3TCNA 3AHDA 3IKMB 2RJ3A 5A4MS 3GXOA 4KL8S 3D66A 2WRZA 3I5XA 1NW5A 3GRVA 4CYMA 5DBGA 1YOBA 5ICGA 3HU5A 5AW5A 4HN2A 1ZW6A 2Q99A 1JEAA 3EZ2A 1PR5A 3MECA 1J09A 2FFQA 4GNRA 1CDEA 2NQ8A 5T3YA 3UXMA 3AVOA 3ESYA 4DV6F 5TJ9A 3FTNA 4TV9A 3WSTA 3EIOA 4R69A 4N5NA 2BRUA 4DWJA 1JLLB 3O8RA 2XULA 4DYDA 3PYDA 2OHXA 4HQ0A 1A0OB 3X1DA 1GNPA 4YO7A 2XF2A 4J1SA 1IBKB 4WX2B 4RTRA 3OURA 2X1GA 3ND7A 1QF6A 1JJ7A 1V43A 3HDGA 3KKNA 1HEYA 4M98A 2H52A 2QJWA 1U1GA 1RKBA 4G0PA 2X9GA 4M1MA 5L1LA 4EIWA 3ICLA 5ENVA 3ZE2B 4X4PA 3H20A 2AXQA 1VECA 3JWIA 1SHZA 3PHBE 3C16A 3U48A 3QIVA 3OX4A 4F5DA 4BJ5A 3K8OE 3M0EA 1CUSA 1Z36A 2YV4A 2E49A 5HW0A 1WQ3A 5CCEA 4K26A 1S9EB 2ZFHA 3NAMA 5ARDA 1HD0A 2P5UA 4JITA 1N32B 5FLEX 5IMBA 5DG8A 1IBCB 3ZK9A 1S48A 3D6MA 2MR6A 1YCGA 3G86A 1IM4A 2HIMA 5KPDA 3B4DA 2JASA 1IN4A 4ZN1A 4G1FA 4F1WA 3AERB 3E2MA 3GD7A 3SF8B 4LZPA 4PR3A 2EL9A 1ZMXA 1IATA 2MB0B 1NTOA 4R68A 3W79A 2DBVO 3EVOA 2VA8A 4ZJQA 3VNSA 2D3UA 1WC0A 4MQFA 3H18A 5A1TA 1N6QA 4WL0A 3VZSA 4FLFA 5AK0A 5JROA 3OAAD 4B6EA 2A58A 1GZ5A 3ZXYA 2P27A 4JQZA 3ADCA 1QU2A 3HFZB 2RAUA 3FCEA 4H31A 2PMZD 1L5NA 3UOGA 4C5AA 2E4XA 5IOLA 1SCDA 2WJAA 3BCHA 4LYFA 3GFTA 1V3SA 1Z83A 4XX0A 1DFHA 4MKZA 1GAXA 4WN9A 4UHDA 2HUPA 3UWSA 3NR2A 1KEUA 4YUXA 5HRAA 4Z9YA 3RK1A 2MPUA 2LDBA 4ND7A 1GPJA 3C5CA 3F7MA 1RAHB 4RJIA 3ZD9A 3QUCA 3PQ6A 3QSYB 3PJRA 1ND5A 4I6JA 4G81A 1NKBA 3IXMA 1K66A 3UK0A 5L3QA 2HTFA 4DG9A 1RWOA 2N75A 3GVIA 4UOEA 1VQ6S 3H04A 5GJBA 4MVYA 3SR0A 4QTZA 2FZVA 3OVBA 1Z0ZA 1JWAB 1IJEA 3WMWA 1WCWA 1S1TA 1OC2A 1V96A 2O0JA 4U7DA 2QRNA 4LSZB 3I83A 1FFHA 4V1CB 2E7VA 2E4VA 2WJ4A 1OWXA 3U7EB 1H98A 3ZCQA 4ZLNA 1QFMA 1F9EA 4NLVA 4F2HA 3I6ZA 1PZGA 2YKPA 2GN6A 4J0IA 3OEED 4K05A 5EFOA 5LZ9A 1KDRA 3PDUA 2O1EA 4GWKA 2ZANA 1O89A 3K0HA 3AL3A 3F5DA 1WC1A 4WOPA 1CQIB 2VV5A 1QHSA 2A1TR 1DEAA 2FOXA 2ODPA 4C30A 3ZV3A 1TK9A 3C3JA 2H5IB 4C3LA 2UVDA 4FOLA 3LP1A 3Q86A 4RF4A 3JD4A 4F93B 2VPWB 4EYSA 3B51X 3OA2A 4CYUA 4YAEA 4C3KA 1L4HA 4H2DA 4OX7A 1Z4LA 3AR8A 3M8WA 1E2GA 2JEGA 1YI2S 1W19A 1DJLA 2LXFA 1OLUA 4Q0MA 3ESBA 1I33A 5LKAA 3PXAA 4K4ZA 1U1OA 4D82A 3U7JA 3GBPA 4OQLA 1C1XA 3PR5B 3IR7A 3R5GA 5DQGA 3B5EA 4ID5A 4PGGA 1DC5A 3V6KA 3DEYX 3LHSA 2UU9J 2GGSA 4G1EB 1ILWA 1I6MA 4QDKA 2D3TA 3EZXA 4Z3DA 3EW9A 1OXKB 1ZGZA 3KQQA 1PYOA 3JTEA 4WDQA 4XCXA 4L5BA 2CUYA 4WFAQ 2OBYA 2HF7A 4MHOA 4GPAA 1R4MA 3OT5A 3ZU6A 3OX2A 5JWRA 1BROA 3NDIA 1XC9A 1BX1A 2DY0A 5GGXA 4Z54A 4X85A 3D8TA 5FLKA 4RUHA 2PIAA 4MS4A 1N25A 3D3CJ 1NJSA 3Q7TA 1M1ZA 1L7EA 4EI2A 1FPQA 3DKKA 3LF1A 2FYXA 4ZRMA 1EESA 4D42A 1WNEA 3K72B 3PPYA 1N56A 1EDEA 1RMYA 1E6KA 1AB5A 2QENA 1RSCA 2CE7A 1KOGA 4USWA 2C99A 2ZBQA 1U90A 3ENZA 3ULKA 5KSYA 1J06A 2DNNA 2VHGA 1PO7A 1GDTA 5D7BA 1PGNA 2FHKA 1XJQA 4JI2F 2XCSB 5DOZA 4ZAZA 4Z4QA 1Y5MA 4FYWB 4F12A 4C3MA 2DLNA 1GL6A 5AHRA 1WB6A 3LFTA 3MJRA 4UCFA 1MG5A 3Q10A 4LQ3A 3GK3A 3ZU3A 5HMXA 3G9CA 4NG5A 1ZSVA 5D3MA 2GRAA 4IG9A 5LMUJ 3PE4A 4M49A 1VCNA 4UHJA 4Y2UA 4DF8A 3VVUA 1DIAA 3CNEA 2VUSA 2DUNA 2V68A 3VJKA 4KLZA 2IVYA 1QP7A 1WR8A 1VRTA 1M6WA 2ZRPA 4CP5A 2H51B 1T2AA 4YB6A 2BLNA 9LDTA 4AXXA 1H2ZA 2G8NA 3ZNJ1 1RHJA 3BCRA 3BKTA 3PHCA 3QPCA 5EWFA 5K20A 1RJFA 4KVFA 4G9GA 1J9EA 3A12A 3WBKA 1L2TA 2H7YA 4XIJA 2VJVA 5KSOA 2QTCA 3HSZA 2A0FB 4RZXA 1I94B 1HI8A 1WQ4A 2FPPA 3QJ5A 2IOFA 1EX8A 2HYIC 2ID9A 1S1WB 1PU2A 1YRUA 1LFDB 2A9KA 5U9CA 5AVTA 1WC6A 1XD8A 5HBRA 3INRA 1Q1NA 1TQ4A 3DOHA 2KTQA 1DRKA 4Y0NA 4YJFB 3KWFA 4ZMBA 5HQLA 2XRZA 1KZ4A 3MZIA 1PFYA 5DDQC 1P27B 4AYBD 1P1KA 2GEKA 1WSAA 3NHFA 1V9CA 1OLSA 1VKZA 1OQ3A 4DV4J 2EIHA 2H1IA 3DEZA 3B2NA 4IDNA 4BHTA 3H9CA 1EEHA 2DYAA 1V5EA 2J3QA 4PWZA 2Q4EA 3U7FB 3DBLA 1I3KA 1O5OA 3OCYA 5CA0F 1QFSA 4X93A 3KQTA 5HI7A 1XN1A 3ITEA 4B40A 1JLGB 3UAXA 1QGDA 4PZCA 5CLHA 3U80A 1FP6A 4RAOA 2GETA 5CH3A 4B74A 5BYQA 3NNNA 4IL5A 2AFIA 2UU9F 4AG3A 3R4VA 3K4HA 1SK8A 4B71A 4E7PA 1T0UA 2PA0A 4I9FA 3DGPB 1ZISA 2VXCA 3DGEC 4NONA 3NG1A 4JV1A 4LREA 5CLGA 4DAOA 2GXQA 3W3AD 3L7UA 2BJ1A 4OV6A 5F7ZA 3F73A 4I0WB 2OFGX 3WQBA 1YFLA 2F4VB 2QNIA 1P5FA 1VCOA 1JU4A 4ERNA 4FFWA 3KDPA 4I4TF 4MJ3A 3D0GE 2QUKA 4RYDA 1RFLA 4DSIA 1DJ0A 4JR2A 1D9XA 3DZGA 4HO1X 1NL3A 3L9XA 4PYAA 1SQEA 5IKOA 1L3KA 2PUJA 4P32A 3D2WA 4LHEA 1HTBA 4Q01A 1TKZA 1Q7BA 2ZK7A 4Q9LA 3NS6A 1JIVA 3EVGA 1OR8A 4CM1A 1ZIXA 2KKHA 5BNIA 1YVPA 1EFPB 4AZTA 4JBGA 3ENWA 1XTRA 4B3XA 2PRJA 3FWKA 1LW2B 1T6XA 4C05A 1AV6A 1Y80A 2XTJA 4GKKJ 4AQYB 3NT2A 1H85A 2JVRA 1AGNA 4K6KA 1DMRA 1HPZB 1Y9OA 1QTQA 3BN3A 3MSCA 1LWEB 5K3BA 3I53A 3AAWB 1LEOA 4RWZA 1RRKA 3CCBA 4O3NA 3HLUA 2P6MA 2WVBA 5DM60 1Z2DA 1HFEL 3DHNA 4LUCA 1DCKA 1G3QA 1H6BA 1C3VA 4BBYA 1NHWA 2JI6A 4YJ3B 2Y2VA 1U1EA 2PUDA 4U8VA 4TXJA 4YCJA 2C78A 5IYZF 2HK8A 1N2SA 3QQCD 2BTQA 1F48A 3C6MA 4MX8A 3F3SA 2DXDA 3HFJA 3BT7A 4WXOA 2W2MP 4CO3A 1D7AA 1J0BA 3HRHA 1YL5A 2OHGA 1DDOA 2HEGA 3LRTA 2GCIA 2GVZA 4BX8A 4GC7A 1XMBA 2EWWA 2GF0A 1RAIB 4JVSB 3UA3A 3R6DA 2JVJA 4RY2A 1MVNA 1C3EA 2X40A 2QVXX 3CBGA 4OMDA 2HWKA 4LJRA 3CCQS 1IL0A 1D9FA 3LK6A 4F3YA 3BHMA 5EWMB 2P6UA 2FN4A 3UT5A 4PANA 1D0VA 3MPOA 3R09A 1J8QA 5KSZA 1GGFA 2ASYA 3MWGA 1OJ4A 3B13B 5KYNA 3IWXA 1IVYA 3I61A 1WEYA 3DOOA 2KM1A 4FFBB 3S1AB 2AG6A 2HS0A 3AHEA 5GMEA 1JPNA 4ENRA 3ENVA 1NSFA 1RZRD 2ZWMA 5ERGB 3UMSA 4U7UK 2BMFA 1YTLA 4K40A 4BAUA 1MH1A 4HADA 3OPMA 4ECZA 3NBQA 1FF9A 3K20A 3TAMA 4R8MA 4GP7A 4UQLA 1II8B 4RS3A 1OZGA 3A9WA 5DBFA 2CMHA 4J29A 4IS2A 1AF7A 5GJCA 2GBPA 5AVXA 3UPDA 5HM8A 1XTJA 2AQ4A 3CVUA 2C42A 3UR3C 4BL5A 4IICA 4G1MB 3G6VA 4N8OA 3JZMA 4E31A 5GM1A 2PU5A 2BKAA 4K9SA 3RC8A 5HZHA 3H5VA 5DEIA 5G0RA 4QICA 3FTFA 1M8PA 3DEJA 2NN3C 2PS3A 2ZI3A 1Y0BA 2PANA 2XMDA 4NXMB 1WMEA 3U1LA 2H3EA 1TK2A 4Z2AA 4OAPA 4U5XA 1BOOA 3P2MA 1E3IA 1VPTA 3H87A 2VG6A 1A8HA 4Y3CA 5D0RA 3BBLA 2V7TA 3AINA 3ZN2A 1IKXB 3IQDB 2E1PA 2BKEA 3CJ0A 3LW8A 3GDOA 2YHUA 4FE4A 1TKAA 4PFKA 2CT8A 4ENUA 4B44A 5CFMA 3ZY2A 5FT9A 2XODA 4DBQA 1S7CA 3JY6A 4OGWA 1YJBA 3BWBA 2VQEJ 2FG7C 4OX9Y 4HDKB 4IDBA 1S6UA 1RAJA 2W24A 5D78A 5E9AA 4AUNA 4BNDA 3K3PA 1DOHA 1FMLA 4DNPA 2WINI 1W581 3AT1A 4G8DA 1O7JA 1KGDA 1H23A 4RDHA 3QH4A 5EXPA 2FPLA 3VGSA 1UPUA 2KE5A 1MFZA 3MFHA 3E3MA 2NZ8A 2A5JA 3TN7A 5IVHA 1QVWA 4KX5A 4L8VA 1D9ZA 1DHMA 1I3CA 1N0VC 1GCUA 3HKBA 1D2RA 1FNCA 3NEJA 4UM7A 4M8KA 1COWA 3MM6A 3DXXA 1ABEA 2HPUA 4HCJA 2HJHA 3L1KA 4EY4A 1OI2A 3AR6A 4O33A 4OFBA 1UP1A 5ER6A 3UV3A 3PUZA 2ZU6A 3TDNA 4I5DA 3N2IA 4L78A 3VBEA 3U17A 4FLEA 4HUJA 3LX4A 4DJEC 2R8HA 3V6HA 4DV2J 4IFIA 2HHUA 1Y4UA 2BH2A 2IKQA 1R8BA 4HEA6 1NXSA 4XTRA 2QY9A 4CMIA 4DN0A 1GWNA 5TPWA 3NHKA 1CPYA 4UTVA 3Q7PA 3MT9A 2BFBB 2Y93A 2BY4A 2P6PA 4ZHSA 5D4NA 1E66A 3KUDA 2PKYX 1GAJA 4R5PB 1QGUA 3PW0A 2HGMA 5JPDA 4JNCA 2F43A 2DFDA 3K1TA 3RVBA 4BXOB 2J6SA 3N7TA 5ALQA 5GOTA 2HA7A 4GRIA 5LQDA 3IH5A 1XMOF 1WG5A 4B3SB 3N2LA 3FMGA 1NJ6A 4KVAA 1P39A 4G6VB 1XAGA 2JLAA 1A2QA 2PVPA 5DX1A 2EK1A 1CEYA 3KG0A 5C37A 3IXLA 4PWDB 3AR9A 4G0YA 3H1FA 1S6QB 4B34A 5KYXB 5EMLA 3ZJUA 3V81B 5SUHA 3S6JA 3TNLA 4YPOA 5M04A 3RF7A 3H1AA 1OLXB 3KWLA 3V4SA 4OJ3A 4U9UA 3PYFA 2P67A 2W2OP 2A14A 4BDSA 5TMPA 3VR1A 3QKWA 4CCSA 4RLQA 1PQPA 5TGTA 2DNLA 1HI9A 1TD9A 1R0AA 4QRHA 5CB6A 4B4DA 2LIVA 5CABA 4KQIA 1H2XA 1BA2A 3DTTA 5LSLA 4RZ3A 3K9GA 5ER9A 1RP5A 4O63O 4B9LA 4DOZA 5HQ3A 4QBIA 2QIFA 3D4IA 3GRRA 5EWLA 5K8LA 4Y9TA 1DG3A 1GL7A 5F77A 2AF6A 1IU9A 1U31A 4N41A 2RUGA 1NI5A 4M5HA 1UMBA 2GGPA 1OC4A 3CW9A 3LQKA 1UPFA 4TTQA 1Z7EA 3WNBA 5L1KA 3JZDA 1CDOA 1NMXA 4MV6A 2XMWA 3JAMA 3PHEA 3T0IA 5KJ6A 5L1JA 4HB3A 2B4YA 2J0WA 1GXSB 3WTCA 5DM7Q 1LPPA 2X8JA 4BGIA 4DV1J 4O3OA 1YBMA 1BQMB 2CYBA 2XZLA 2H2HA 3PS9A 3OT4A 3ZDDA 3I73A 1E0KA 3DYAB 2O2IA 2BM0A 1WXEA 3DTVA 2VF4X 2VIIA 4X97A 1H4QA 1E3TA 5J2TF 5F23A 4GMDA 5LPNA 4ZICA 4HVAA 5JNLA 3E4DA 4IGAA 2J9GA 2R47A 2BMWA 3UQZA 4BB9A 4DBLC 3M8RA 3WNVA 4D44A 1I2ZA 1X19A 2YMPA 4ZS6A 1Z56C 3ADBA 3OX1A 4WTOA 5IAOA 1AHIA 4D26A 1J1UA 1RP1A 3MJCA 2WSIA 3NTOA 3A0RB 4O4IA 4GC6A 4CIYA 4P0TA 3IP8A 4Q16A 2Z2KA 1E1RA 3EDRB 4INPA 3LP8A 3K16A 1N0HA 3GVHA 1KAEA 1T9WA 2ZI6A 2C00A 3MM9A 3QTLA 3GCXP 2MQPA 5D77A 4EENA 1M5VC 4J2OA 5FPTA 5AQ1A 5JZSA 5EJMA 4A1OA 4IEFB 1B7FA 3P27A 5EXDA 2C4NA 3SEOA 2FY8A 5EGYA 3RM3A 2N7CA 1ODSA 2IV3A 3IR5B 2HD4A 2EQAA 1OXTA 1FNOA 3NJRA 2KSQA 3SIPB 4PFJA 4DM3A 5H81A 4ZHQA 4URGA 1W9MA 3DN9A 2BE2A 2B0CA 1Z13A 4IKEA 1H6AA 5FUVA 3G8BA 5ADHA 4E3WA 1CLFA 1TD1A 4CW7A 1L4FA 2JFQA 4ZPTR 1LFWA 5LB4A 3IVAA 3EGNA 1PEDA 1E2MA 1NBMA 1CUGA 4MGEA 2I55A 1MQ9A 5CLJA 4JJIA 2KZMA 4PZEA 5JCPA 1BC6A 1Q50A 4FWIB 2QY6A 1BDIA 3BGFA 5KUTA 4K03A 4ANEA 3T0GA 2XI3A 2D7CA 4QGSA 4PSUA 2WVHA 3JYTA 2UP1A 4FMDF 3OP4A 3OLXA 1XQ9A 3PE6A 3P0HA 2WYHA 2O8BA 3VGPA 3RSHA 3RWOA 4C78A 3RAPR 1QE5A 3IV6A 4O3SA 1PFWA 5AW9A 1W36D 5JVDB 5SV2A 4PRKA 1BS1A 3JQQA 2QYGA 3PNIA 5HDBB 2FYTA 3AUXA 2OHDA 3EWIA 2GBCA 4BQRA 4EF5A 1R6BX 4ZCKA 1VQKS 2KLBA 2IHUA 3AW8A 1LS6A 4R54A 5BW6B 3M2UA 2Q9BA 2PI4A 2WHEA 5ALVA 1UVJA 4I5FA 2PMWA 2AJ2A 4Y0FA 5J2MA 3MXHP 1C14A 4PFSA 1WOYA 2IV2X 4B87A 2PZMA 1JN0A 5A7HA 3FFXA 1Z0IA 3DVAA 1OCEA 4MKHA 1DMSA 3OLAA 2VPYB 4BLQA 2D2VA 1T26A 3IPAA 4DV1F 2GVDB 2P62A 1GZ3A 2FE4A 3VR3D 4CNZA 5IZ4A 1YIOA 1RWUA 1USVA 2EKZA 3FWYA 3IESA 3USES 2J0UA 1JFRA 4DSUA 5DCLA 3GP5A 4CNYA 1UXOA 4UFPA 2PXXA 4OXIA 4D8XA 1UP6A 1NRKA 2EFCB 1P74A 1P80A 5IS2A 3GFBA 3U7QA 1O96A 4BVAA 4F4ZA 1NQOA 2PMKA 1UETA 3NCTA 3MINA 4G9EA 3RTDA 4IQ4A 1BU8A 5JSFA 2UKDA 3OQBA 3SYZA 3GJRB 1FKAF 3B78A 4X7PA 3IS3A 4BNLA 4NLLA 3KAPA 3U7RA 1QO7A 2YCLA 4B9SA 3GLFE 4E32A 3DLKA 2H2IA 5A71A 2LKCA 1GYQA 2IBKA 3ZDBA 1R8PA 1HFJA 3DE5X 2PYIA 4RXUA 2BBTA 4JI6J 3DNMA 5AOVA 1PR2A 3ZNUA 3BGRB 3T9FA 1PZMA 3M6FA 1QOQB 3C74A 4L6CA 4Y6IA 3JWHA 4CKEA 5GAGI 3CSSA 1FJGF 3GELA 5KFYA 5D1NA 3KQLA 1V11B 2AR0A 1BMDA 2QSJA 2XMTA 2X1LA 3VYVA 1WACA 2OELA 3LUHA 2FLVA 3IUSA 5FHQA 5ALWA 3V8RA 2A6MA 4MV3A 1Y37A 4E33A 2FDCA 2W11A 2PT6A 1CQJA 4MGIR 1VSVA 3H65A 4UMFA 1FJCA 1NJWA 5KFBA 2HVZA 2H5JA 1UW4A 3OJEA 3PDHA 3WWZA 1EE2A 1R16A 2W7OA 1CBUA 3K6KA 1YQ9A 5LMZA 3AZQA 1GILA 1XTZA 2BGTA 2GAHC 3ML1A 2M6SA 4ZEXA 2XVYA 1T3ZA 2IZ7A 3PHIA 4LJKA 4W9NC 2JBWA 3B85A 2E4UA 4FNAA 3N2NA 4GX5A 4ZXFA 4X94A 3MILA 4MH0R 1G291 3I0SA 3HY6A 4DCJB 1ZCJA 1G1AA 3KK2A 3CF4G 5DB4A 3D28A 4ON9A 4WZAB 2XYGA 3H2ZA 4CLSA 3QVXA 2IXAA 3KKLA 5EKXA 1EXDA 1CZHA 2Z98A 1ZOPA 1R3UA 5L46A 3FEYB 4Q15A 3EQ7A 3H5UA 3M8KA 2ZTSA 2WG0A 2Q1WA 1CSJA 4OU4A 1XZAA 3F1KA 5J2UB 1T3TA 3OI7A 4MV4A 1J22A 3WZ0A 2Q2QA 2MGZB 1OO0B 4DIUA 1D2GA 4ZVMA 1RM5A 1JRLA 2YINC 7ABPA 1AKVA 4V3CA 3GGPA 4KKVA 3CEJA 4K9RA 2AI3A 5KDDA 2G4VA 2FPMA 1F3LA 4REMA 1JHXA 4DV7F 2GZSA 4PSDA 1P1LA 4WK0B 4BWVA 4LCBA 1V3RA 2QBYA 3VPBA 3FBFA 4CO2A 1BXGB 3N58A 1FYEA 2MZQA 2ZR0A 2EXXA 2ILTA 2C5BA 4BO5A 3O2QB 3FLAA 2O20A 4QG7A 3VR2D 5JQGF 1DI0A 1XFAA 3TBFA 4LBHA 1T9XA 4L8WB 3L7AA 2D59A 1QC5B 2G76A 1N4AA 2XGSA 1CDZA 4URXR 4YHHJ 4M5DB 1JWWA 2ZYIA 2E1CA 2ZVJA 2WHXA 1FY2A 4M0EA 4EX6A 1N6OA 2VS1A 2R4QA 4Z9AA 2AF4C 1FYDA 3FMBA 2GLTA 1K1QA 4D25A 1F6DA 1X0VA 4AJ4A 3IGFA 4AZWA 3WFZA 4KR7A 4E22A 4CM3A 1EH5A 1TQ2A 2WAQD 4S04A 5A02A 4Y6QA 2BEVB 1N36B 1ZO8A 3KK3B 2DY1A 1EIYB 4S0MA 2ST1A 4FKXA 5KX5A 1M5RA 5F8NA 4AXJA 1SVWA 1JR6A 2ZNZA 3T9NA 1K6MA 3W6NA 1Z4PX 4UY8T 1UWBB 2F17A 5CTJA 3W78A 3D4BA 3EXAA 5L9XA 5ETKA 2FJAB 4YAWA 3EUFA 2YXLA 1FUYB 4P7VA 3BQ1A 3VU3A 4FHEA 4NYMR 3TXYA 1DTSA 2IRYA 2R48A 1XMJA 3HJHA 2B37A 4A8JC 1TZMA 3IJRA 1FXDA 2W4PA 2IYAA 1AD2A 4X4QA 3JXEA 3PIPQ 2HJRA 1BEZA 2GR9A 2ECFA 3CLRC 2HRCA 2AJ1A 2BBOA 1RWQA 2O3RA 2X51A 1D8YA 1N5SA 1A69A 4NYPA 1HQUB 4MW6A 5J59A 4KH0B 2HQRA 3D7KA 1QVZA 2RRNA 5P21A 4BO9A 1E5LA 1GQEA 1VMBA 3Q0AA 2RQ4A 4LK3A 3ZHTA 5C25B 3NHZA 2DJWA 2QD1A 4DV7B 2WBLC 9ATCB 3CZAA 2F2TA 2WOJA 1U4NA 1ZD5A 1H66A 2PX0A 3G49A 1PYDA 3TKYA 5KFNA 1YDGA 3KHRA 2JBAB 4C9DA 3AF6A 4F4JA 2CV2A 3L7OA 2WVEA 3AILA 4MTPA 3N2KA 1IKVA 1YHZA 1NASA 5A6PA 4AI6A 4YXFA 1YJXA 1R5JA 3H8SA 5ETTA 1GG8A 5HCIA 1YKGA 3NWBA 5FD8A 2VDKB 5HK9A 1R2QA 2A6OA 3N79A 4HNAA 1FNNA 1WB5A 4XSGA 2Z56A 4MS1A 3AB2B 3BJMA 3OHBA 3PTWA 4DSLA 1V16B 2XS2A 1Z4IA 1LPAB 2V6GA 5EKTA 4Y2PA 1J2JA 4GGPA 3AHPA 1TZ0A 5B58T 1VB3A 4GDFA 4DR7F 5ITZB 2OESA 1I3OA 3KWMA 4ZDJA 1BE1A 3EIHA 4EJSC 3DCYA 2W6ID 4YP7A 1W30A 2YJ3A 3D7RA 5F98A 3BXFA 1RR6A 3VFDA 2Y3YA 3UGJA 3NBUA 4M1KA 4YRZA 3KVYA 4PLFA 1NPYA 4FVTA 1E2KA 2I1QA 1S3FA 2OZKA 1QFXA 4IF4A 5KFRA 3CR8A 3Q1LA 4Q9AA 2HFOA 3QVGB 1JUDA 1R0CA 2CQBA 4HMOA 4XUGB 4LDAA 3RRKA 4HAIA 2V63A 2PZLA 1YSCA 4CUKA 3CDWA 4ND4A 2HQ1A 1ISGA 3D4JA 1EA7A 3E53A 2KHZA 3FGNA 5ILGA 3R5XA 2AXNA 1OS5A 4IYRA 1WMDA 3Q8LA 1BD3A 2GJKA 2BFFB 1R1DA 3G9TA 3FBBA 4ZDWA 4ZCPA 2ZTVA 1X7ZB 4INOA 1ZDMA 2HUNA 1P0IA 5B0DA 2I7VA 3LX5A 1A72A 2W93A 3M33A 3GJ4A 4NJMB 3W9UA 1E5DA 4CTMA 4ZTBA 3ZE9A 5I9IA 1ZZEA 3S2FA 3Q83A 2Q3EA 3KB6A 4U8HA 5C8YA 1MF7A 3GZNA 4YNBA 2HF8A 1TA4A 2Z4SA 3RSSA 4INZA 3FVWA 1VE6A 3GA5A 2R0QC 1FRNA 4XGQA 4G4SP 1SUDA 3KO8A 1X0PA 2WI8A 1ISRA 3C7DB 4W1PA 1NSKL 2ODQA 3NJ4A 3S5UA 2ZJ2A 3FH0A 1LXCA 4EBFA 1N6HA 2QLJB 5JOQA 1OBCA 3T9ZA 1GTSA 1UT8A 4QREA 3QVWA 3GLIE 4W4TA 2IF0A 2ZE8A 4OUKX 3EUEA 5IW8A 3C3MA 4ZPXA 4CI9A 4MFBA 4Q48A 3CMMA 1WHTA 2WF7A 4L3KA 5HG0A 5C81A 2CLDX 2IYXA 2PUFA 1V1RB 4NDZA 4Q0BA 1T0BA 3E01B 1YHQS 1RAFA 2QYOA 4KIGA 1SB9A 2B2NA 1UZMA 2ET6A 1D2MA 1KWGA 1VRUB 4P7JA 4RENA 2ZB8A 4XZ3A 4J4HA 2HAEA 4C6AA 4MRMB 2GPYA 1UMCB 1FRFS 4I2NA 4HNVA 3I1YA 4JX9A 3WGVA 1EXNA 2RGYA 3KOUA 4RH3A 5FJ4A 4DV3J 4O0NA 1SUFA 1AO0A 1RXUA 2XNJA 3J81Y 4OI6A 1QIEA 2Q3DA 5KVSA 2I8LA 1G7RA 3PXXA 3R77A 1XKXA 1NURA 5IT5A 1D3WA 2P77A 4ZOCA 3WBFA 1M1XB 1FJXA 2D13A 2Z4TA 1NH7A 1LW0B 3EC2A 2EJWA 2B20A 3OZ7A 3RQSA 1YRBA 3IVMA 3FK4A 4ND2A 4RD4A 2V55B 2WHQA 3M6XA 3F9IA 4L5AA 1F0NA 2C2HA 4I4IA 2ZUGA 2W0SA 3H25A 4LRDA 4W5OA 4B9UA 4EG7A 4LY6A 1R0BG 2AS0A 1HR0B 4EJSA 4XD7D 2U1AA 2PIDA 1DX6A 1IHUA 4FMDB 3PQ2A 2HL6A 2ZJAA 3DFMA 1IRXA 3AVYA 2CAJA 3N8NA 5KOHB 4M89A 3RTCA 4CLZA 4YP9A 5BYJA 2NADA 5E7JA 1GDHA 3I8XA 2VZ0A 4Y2CA 3EISA 5SZTA 3ICPA 4C8ZA 1X7GA 1B1AA 1KH1A 3BXOA 2AW0A 1G7CA 2BFDA 2VDNB 3TARA 3DRSB 2RHOA 2MZJA 2IHR1 3D0OA 1Q7EA 5KQPA 3G3EA 1VIOA 3N6LA 2EQ5A 4GKJB 1D2EA 3GX1A 1N0IA 2JI4A 1I2BA 2XUKA 1HW8A 1XK8A 3C6UA 2QM3A 1X3LA 1SCAA 3WRXC 3GE9A 1VL1A 3L0PA 2FZWA 1CXZA 3LLUA 2GZ1A 5A8KA 3QHQA 1IKWA 5INTA 1M5PC 4MYSA 4EGCB 1QFYA 1ZC3A 1MLDA 5KFJA 1JA0A 1NVTA 3BH7A 3R8FA 1U1KA 5KINB 1JQ3A 1SCNE 3KCQA 4CFSA 3I5BA 5A03A 2JFBA 2AC4A 1G8MA 3DLCA 1US8A 3BDAA 3PP8A 2UU9B 3QP9A 1UK8A 3N3BC 1SJQA 9RUBA 3IMKA 4DHVA 3CE6A 4EG6A 1HL7A 3LGAA 2BQ3A 4Q9IA 2EFYA 1DARA 1W34A 1QG0A 2PMEA 4F0KA 5MFPA 1ZPWX 2XB4A 4NCGA 5DM0A 2ZH1A 1WKVA 2A8YA 4ZAGA 2YZ2A 3FUXA 1LU9A 4YMUA 2QX0A 1HFWA 3RVJA 3BH6A 4FI3C 1MKYA 2BEWB 4QFCA 4KQ2A 1KSJA 3GR0A 2VC1A 5HRCA 3I5MA 1EM8B 2YJ6A 3V2UA 4TVSA 3M1LA 3NWPA 2XSFA 4QELA 2NTJA 4Q6WA 5JADA 1LVHA 1XVUA 4PYMA 1OUMA 4BP8A 3O4HA 1KQPA 1VQSA 3R3YA 3CCRS 5CT9A 2LEBA 4LXIA 2HNZA 3ETOA 1Z63A 2H63A 4QUKA 3EXIB 3CM0A 4ZI5A 2YUIA 3V1NA 3EVBA 4EBBA 4TXLA 1BQEA 2VB6A 3W8GA 3I8OA 2AN4A 2GBLC 3RU0A 1BCSB 1KE1A 2WM3A 1YS1X 2CVQA 4QUHA 1QK5A 4OYIA 2W7PA 1GL3A 1GCIA 2G3YA 1C7IA 4IFVB 3FPHA 3WLHA 3KP1A 1KI6A 1KP2A 4UU8A 1ZRSA 5HE8A 1DX9A 2UUCB 2IUUA 1GPAA 5IBQA 4Z9XA 5KFAA 2FY1A 1GMUA 4UTPA 3IUMA 3L7JA 3F90A 2G13A 2YY5A 1ZCBA 2DPHA 2IIBA 2GJ8A 4P74A 1PNTA 1PAEX 2DPYA 3SSQA 3VAKA 4M6WB 4AQYF 3BA6A 3AFGA 1XLWA 4YRTA 2JAQA 1XCBA 3ESZA 3FNQA 4KFCA 3LECA 3LX6A 3VO9A 1CUHA 3SNKA 1DXQA 2HM7A 3L7MA 4RUAA 1VG8A 3OR2A 2VP6A 5FBWB 3ILJA 2IVFB 5B1HA 2YV3A 3UC9A 1N3LA 1KJ8A 5IPFA 3DBHB 1KNQA 4DV5B 1XI2A 2ZRAA 4DL6A 2EC5A 1YE5A 2Z1MA 1F5NA 2DQZA 4JV2A 3WWPA 1YVUA 5EEGA 2LNDA 1XAJA 4DS4A 3N0RA 2Z9BA 3DOUA 2FAXA 3EVDA 2J30A 3OOYA 4P38A 1I32A 3JS5A 4QNNA 1M7GA 4MS3B 3KJVA 3WJ2A 2HLHA 1Z82A 1X9WA 1OTHA 5DT2A 3VOSA 3W8EA 4DR7B 3SVLA 1J8VA 3D6FA 4C4XA 1P2TA 2H4XA 2PGLA 2PD3A 4UXIA 4J3NA 5GV7A 2N46A 4QUGA 3P9PA 1HNWB 1GNKA 5JU6A 2UVWA 1FFAA 3AP1A 4CMGA 2IMOA 1CUZA 1C1DA 1L0BA 4H4KA 4WBNB 4B3RJ 3T1TA 2PIIA 4MI6A 2KVQE 2FQQA 2C2WA 3SV3A 3RBAA 2P7HA 5CD4A 4FHZA 4HC4A 4QFMA 2RHJA 2QN7A 5JDCA 2ZLBA 4KSBA 3NDJA 3FE2A 4DM7A 2DRBA 4GP6A 5IK2A 1KEEB 2R7RA 1RVDA 4P4SA 4C7OA 1S1VB 2ZJOA 2VCEA 1T2FA 3H4VA 2GCEA 2XQGA 4GO5X 3DTYA 4ZVKA 4GECA 1NRJB 4I2QA 5I7HA 2H57A 1DBIA 2VBFA 5JANA 5ETNA 5KFHA 3LLVA 2ZYUX 3UJ3X 3CUKA 3CJTA 3GARA 1B0VA 4EU0A 2QE7D 4GI7A 1DEXA 4I8IA 1HG1A 1YQDA 3U2QA 3KNAA 4GDMA 3AR4A 1E4OA 3NIDB 5F2EA 1OXUA 4X84A 3ZWMA 1XDUA 3P0IA 3FEXB 4RCYA 3P5SA 1XIVA 3GV7B 4DQLA 1ZYUA 3GH3A 1D2NA 3CUVA 2IPLA 3EF1A 1G4CA 3P2JA 3W4KA 3W8RA 4ZFNA 4PR0A 3E58A 2G0TA 3UM9A 1QH0A 4Z4HA 2QLWA 3GBVA 2WY2D 3GFGA 3WTBA 4KGVA 2BYTA 4OATA 1T2EA 3I5YA 5J47A 5I8PA 2XNHA 2I6TA 1ZTWA 1T2UA 1DRJA 2XEXA 3RBDA 3GI1A 3A6LA 4D9IA 1T4MA 2YY7A 1YJQA 1V8FA 1N48A 1G8FA 3C16C 3E3AA 1WEHA 3FVQA 1L3TA 3PWSA 3NONA 2JJ4D 3MWYW 5FBKA 4TROA 1S99A 5DNWA 2EKQA 4QTXA 4W5HA 2B5VA 3QJLA 2HU2A 4FGZA 4P4GA 2Y27A 4Z7QB 3TKAA 1C9DB 3R5SA 4ALIA 1AW0A 3AJAA 4U3JB 3JVDA 1D5WA 4GC5A 1B99A 1UBGA 5EJ7A 3HGQA 4H7DA 1JB0C 3NYIA 5DTJA 3LPNA 2GFHA 4TYMA 4M86A 5KTSA 4BMNA 3CLTC 4F06A 2J7WA 1R9MA 1JR3D 1QBGA 2DNPA 3RQIA 3ZK8A 1EVYA 3D8BA 1N2XA 5KYUB 1QAOA 1S6PB 2H2FA 1QAJA 4WZQA 4M0LA 4IGIA 1B0PA 3ZYCA 4N5IX 4CDMA 5D5HA 5ETSA 2QSYA 3K5LA 4BAZA 2DWOA 4DT1B 4QXAA 4XQEA 5JLAA 2BHLA 4KUEA 5CUQA 3RH0A 4UCWA 5KTOA 1XCGB 2Z8QA 3FCHA 1RAOA 4EL5A 4FIDA 1IZZA 2MCFA 2HC9A 4K2HA 2OK7A 2OV8A 4ALZA 3FBEA 4LYGA 5IVDA 5HJ7A 5KCZA 1HHTP 1Z0SA 2PS0A 3BGIA 5G0SA 3DVSX 4PXDA 4MMXB 4Q4JA 5FP0A 2EARA 1GCOA 3LY7A 4KFBA 2JVOA 4XQ0A 1E5XA 3CEAA 4QYZJ 4QPTA 4URUR 1FLDA 5FBLB 3UFXA 4TVAB 1U8YA 4QDOA 2H1SA 2ZC4A 1UPAA 4YMVA 4LE1A 3SFZA 2KJVA 1K92A 5KTPA 1RYDA 3FSEA 2O3QA 1M1GA 1LH0A 5FFFA 2AEMA 1GNRA 3ORRA 4NK5A 3FG9A 1JLSA 2OFFA 5TR9A 3NUGA 1F60B 1QTRA 2F9LA 1OGJA 4YMGA 3EZNA 1EIZA 3L7IA 1DBDA 3Q9NA 3I4HX 1TK5A 3N2ZB 3DOEA 3X44A 1EBUA 4GOOD 2AE1A 3O44A 3B54A 4YLEA 1P2UA 1VL2A 3I92A 1ZKMA 2EC2A 2JCVA 5DISB 2D2XA 3PZBA 2O2GA 1FRKA 1EFKA 1GZVA 1GRQA 4Y1FA 4Y2HA 4XWOA 5CB8A 1ZD1A 2GASA 2J48A 4R0NA 2YMLA 4GYWA 3QXXA 4QPDA 1D8AA 2DR6A 1PV2A 2XX3A 2VT6A 3QVOA 2ID8A 1YRLA 2BIFA 5HTOA 4HWPA 5KG2A 4GIBA 2BEKA 2YC2C 4DUTA 3B3JA 4DWVA 2C2DA 1BO6A 1LV8A 5JBQA 4YQZA 4DS5A 4CIOA 3R3HA 2CBZA 1S77D 4CMHA 3VR0A 2BOVA 5TVKA 3TNYA 4BNUA 2AN3A 2E7ZA 3W5DA 2FHJA 5G53C 5EQJB 3G2HA 5B2EA 4Z0TA 3A1WA 3GY0A 3PT9A 3S1SA 4OD0A 5CITA 4ZJOA 1F2TB 2OFWA 2AV6A 4UASA 1SD2A 1FFEA 3A1TA 4ONEA 1EPUA 2EP8A 1O51A 2C29D 1Q16A 4LRUA 3B4MA 3SPXA 4P98A 3KKMA 1N9KA 2IYLD 3WLRA 3BWMA 4WXWA 1QAYA 2JEYA 5DFAA 4W1RA 2FUNB 3OOEA 1M1NB 3OD2A 3V4RA 4MSUA 4GM0A 5AIBA 3WL4A 3HDYA 3UA4A 5CA1A 4KE9A 3GLHB 1K5PA 4EX7A 4L6AA 5K0NA 1JLFA 5JNTA 1NU6A 4C20A 3CD6S 2Q43A 4Q1EA 2WIBA 3OV7A 1VP3A 5DPMA 2HQIA 3KJQA 4I08A 1D8TA 3GLUA 1T5LA 4ML3A 2BACA 1T1IA 2BF7A 1NN1A 4YP1A 3K1YA 3AUTA 3PX7A 4EB3A 2DNGA 2Z8YA 5ELXA 1S3IA 3I2HA 3QNWA 3MWDB 1XXHA 1GPDG 2YH1A 1KDNA 3EFHA 3T3IA 3GAAA 4KPUB 4EW3A 1U7HA 2ZR7A 4WK6A 4PQEA 2DNQA 2DCMA 1BWSA 2WSBA 3FNIA 4D0RA 2XVAA 4MZXA 3HBFA 5C7YA 5CYOA 2J0XA 3G9XA 1E3QA 5EPOA 1ODLA 4X00A 2P40A 1ONPA 4AMYA 4BMSA 1D09B 2GTHA 4HFRA 2YWBA 4ER0A 1FRHA 1WDMA 1N8NA 16PKA 2PH3A 4RL1A 4B3GA 1SBTA 3THWB 3CEDA 4RR5A 1UDBA 3EGDB 3BEDA 1T9GS 4IDGA 3G4SS 2CL5A 3ICEA 2NXJA 1QZXA 2VUGA 2YOHA 1OX5A 1MWYA 3VPFA 4E1AA 4JH0A 1IBLB 5ILQA 4M0CA 2GEUA 4AVYA 2EYQA 2AWOA 2GD0A 4QD3A 3M7IA 3HMKA 5G4KA 1VSUA 4P71A 4Z99A 1TCAA 2K8GA 1JNRB 4JQCA 1U5BB 1RI5A 2MMCA 3V5RA 5ENDA 3NNAA 2FGOA 1U0BB 3COZA 3MCOA 4W7HA 4D6XA 1TUBA 3RADC 2W8ZA 2EFQA 3S2GA 4JJAA 3F0TA 4RK0A 1OAKA 2KL8A 3H1TA 1PWEA 1Q17A 5JSUA 2QL7B 5CJPA 3T3FA 1G8HA 4M76B 1DGQA 5JAZA 1JSXA 3BZBA 3FRIA 5BUCA 3DO8A 3DLGA 4XLTA 3SSMA 4KGXA 5EZYB 2HRUA 1QJ4A 1IAVA 4CG0A 5E6SB 4TL8A 3CB2A 1SC1A 6FD1A 4JCCA 2BKVA 1GFWB 2CVFA 1O97C 5FPQA 2O2XA 2Q1LA 3F9RA 1TUVA 3C15A 7FD1A 3BILA 3AR3A 3ED5A 3I01A 1BKDR 5SY6A 1B42A 5IYZA 3DZCA 2CLLB 3L92A 1Z17A 2XMSA 3A8IA 1C4KA 4CUJA 1PFUA 1JQ5A 4ASUA 3G7NA 4YDQA 3IP9A 1DTWB 4S0XA 1QF9A 4QPZA 2CLIB 2J41A 2NVUB 5FEUA 1NT2A 1W8IA 2AWZA 1B43A 3JSMB 4BATA 5EP3A 3NVDA 3GWGA 1TTPB 4BCAA 1AKQA 3RWBA 3W2TA 1X1CA 2GHIA 2JB9A 1CZRA 1X9GA 1G6BA 2CPJA 5DTRA 2R5WA 4GPEA 3NAIA 1CJUB 5EI5A 4CLRA 1HURA 3MELA 1RYBA 1VIAA 5ICCA 1YJVA 2IP1A 4BX3A 2JCBA 4KP7A 4HLQB 2FZ4A 2J9RA 1BWRA 3QRRA 1EUZA 1RADA 2YR0A 3MGJA 3G2MA 5M2RA 2R2UA 3ZHCA 4CZCA 4E4RA 3BR9A 3DHWC 4OXXA 2QYHA 4HLNA 2ZVSA 3DM5A 2HA2A 1XVTA 4OX9J 1SNYA 3KKKA 4A8JA 2XYQA 1GZHB 3N6MA 5GJWC 5EJIA 3RV4A 3VKVA 2R86A 3NB0A 3HM2A 4JLVA 1WTFA 5L4SA 2VNSA 1RYFA 2C9BA 2DSTA 4OHKA 1ZM7A 4NQZA 1K8YB 1G5HA 1C0IA 4W5QA 1JB9A 3QT8A 3P6YC 1N2OA 2HSEA 4MKYA 4AL7A 2K6GA 1OILA 4RW9A 1P1JA 1UQRA 2IYQA 3CJ8A 1X80A 4BGEA 2NU6B 4YUVA 1UDCA 4DMRA 3W63A 4PLVA 1RRFA 2H31A 5LWHA 4UARA 4X41A 1ZGBA 1XELA 2Y77A 3FPCA 3ADOA 4WXYB 3A8JA 1EGHA 4JDUA 3TRJA 5HF5A 2DB1A 2WHPB 1UXGA 5LC1A 2AFHA 2XIJA 1BVYF 4ZCIA 1UVMA 5F3DA 1NUPA 1T6ZA 2XWJI 1E79D 4OHRA 1N7HA 3GMIA 4R7ZA 1Z08A 5K14B 2LU1A 3RYHA 2FOLA 3W5JA 4IQ8A 3V7FA 2JLRA 4G86A 3BH0A 3CMES 3OU7A 2EJCA 4DWWA 4CCYB 1ULUA 2NYHA 4V0KA 2WJZB 2PGCA 3MYRA 1TC2A 4YTEA 1NK0A 1GIAA 1WXDA 3DFIA 1QCCA 2QUIA 4E88A 3SXPA 2YPZA 2EV9A 1ZS9A 5B0BA 4BN0A 3OOSA 4F9TA 3HUUA 3MFIA 3I6BA 4K4YA 4TMTA 4C8MA 1DT3A 3F44A 2QJTA 2VHQA 3DDUA 4USMA 3B2EA 3QTBA 3ZZNA 1CC1S 5IC4B 3K7RA 3W2EA 1K4MA 4OGFA 1Y0HA 4L15A 3N5CA 4AW9A 1TV6B 3HWSA 5ALTA 4WHMA 3D5QA 2XT0A 4KQKA 3EF0A 3R4CA 1UZHA 3T1HB 4M63A 3MHYA 3KK0A 1ECPA 1BOFA 1A4XA 2XEDA 4R1SA 3IIJA 5KT6A 3TO5A 1W76A 1LWFB 4UE6A 3JRXA 3VR4A 5KT7A 4O2LA 4DKXA 1S6OA 1ACMB 4TTRA 5LXTF 5M2PA 2ORIA 3FQKA 2A0YA 3M32A 4UHHA 1BWPA 4EUEA 2P6OA 3L79A 3QLHA 4QOTA 3L4EA 1XZFA 1JDJA 2FGKA 2QZPA 4A5OA 4YLYA 2QG4A 2WZCA 4L16A 3Q24A 3Q5GA 1UAYA 1DPFA 3QAEA 2W4IA 1BQNB 1L5LA 3RVNA 2DQSA 2I6UA 3IA0A 4RIHA 3ECCA 3VGVA 2A0XA 1KQNA 4A8TA 5JMOA 2ALJA 1RT6A 1FFGB 2J85A 4F3KA 4EO7A 4WFXA 1T6BY 3VMMA 2JC0A 3FPKA 1RU3A 1OYEA 3SSOA 3OU6A 1EWKA 1PS8A 4TS9A 2EW9A 1O5IA 4R8VA 5L1IA 1NU4A 3F2VA 4EG4A 4DQXA 1T9GR 1R6DA 1TJYA 5C5IA 5K0ZA 1WHWA 2DKNA 3T99A 1OSDA 4KH1A 7AT1A 5KHOC 1GFWA 1TO1E 5F2OA 1W1UA 5I9NA 2OILA 2QG9B 1XNJA 1SBNE 1BGXT 2GO1A 4XGNA 4KI7A 1BVHA 4JOQA 3KEMA 5LU9A 3PUWA 4KPCA 3F5FA 4QYTA 5FOWA 4R2XA 3VNAA 1OVGA 1KAMA 5C4MA 5GAJA 2FN7A 1P4SA 1L7XA 4WFQA 3IEUA 1XO1A 1JXOA 4UNRA 2HDOA 2EDAA 3C3AA 2I71A 3BSOA 1Y8AA 1KR4A 1P44A 3DMPA 3MC1A 4JHXA 5FQNA 1VJTA 5JD6A 4BMVA 4BJHB 1S7IA 2BZ1A 4HSEA 2E7XA 3RASA 5JS1A 2WD7B 1JQBA 2RH5A 4B8YA 1HD1A 3OPQA 1K8ZB 3VPHA 3U40A 2DITA 3R97A 1WLSA 2FWAA 1XMQB 1F5AA 1SY7A 1WCV1 1KAGA 3I6YA 2QX7A 1P1BA 1HT0A 3P9NA 4HRVA 3GPLA 4IVRA 3P2YA 4HLUA 3QAUA 5EESA 2CDAA 4W1QA 4LF4F 3I12A 4UREA 4LZNA 3OTBA 5IWAB 2X6QA 3THWA 1Q79A 2RH9B 2ILYA 1ZTTA 2GD2A 5HGJA 3FPAA 1E2EA 1N34F 1S97A 2PSDA 1CJKC 3OSUA 2YJ5A 3FF4A 4A2CA 2NU7A 3JV7A 3QYPA 1F06A 3T1VA 2H2GA 3H16A 5CVVA 3IE1A 1PJ7A 1LI4A 4YJHA 4OJQA 1U0JA 2R79A 2FSUA 1KC1A 1FNSA 5IN4A 3QIDA 3EH1A 4YJ2F 2GM9A 4G5OA 4PNHA 4L5CA 1EJ6A 3PXDA 2UUBJ 4QX6A 1CUJA 2P78A 1UJMA 4IFBA 4CLUA 2JLZA 3NFYA 1RM0A 1VHFA 3Q12A 4BNIA 1SCJB 1HDOA 2JCSA 2I6FA 2L69A 5JFOA 3C3CA 4GL4A 1JJ2R 3EBPA 4WIQA 3SMZA 3OTIA 1K6XA 2YIMA 3B3FA 2PDAA 5JH7F 3KDAA 5K09A 4FKMA 3BJZA 2FG5A 1M90T 4ZVSB 4CLOA 3KJHA 4MT1A 4MR8A 1WPQA 3NGLA 3DPUA 5E3IA 3C3XA 1KYTA 2ZATA 4KBIA 4PX5A 4N6GA 4WKOA 1PVOA 4HGYA 1HDRA 3UW1A 1LSOA 1Y3HA 2PL5A 3M30A 5EJ2A 3L04A 3HB0A 5PGMA 4EA8A 1WB4A 1Z6XA 4RVNA 5K3AA 1ZM3A 4YUDA 2QVCA 3SC4A 4DG1A 3GLQA 3TZLA 3H9QA 4CMAA 2FLNA 2Z9CA 5EQDA 3DW3X 3PEHA 1EK2A 2R1VB 3R20A 3TEJA 3AEUA 4ES3A 3PTZA 3J7AN 1WEZA 3ANMA 2VDQB 2O6LA 3ROTA 3RVPA 4OFZA 1RPJA 3ID6C 1REQB 3ROXA 3COWA 1JEDA 4FU0A 4DC9A 2ORYA 5KYWB 5J2UF 2XSJA 3AEUB 5CYJA 1OX6A 3PRKE 1SVLA 1AXRA 5HCUA 2OYRA 1APSA 1Q57A 2DGUA 1VRVA 4IDHA 3O0TA 5E6RB 5D4LA 1WPXA 1YS9A 3I2IA 3IP7A 5FOXA 4CM4B 2XYHA 1XTBA 3K0BA 4BKUA 5EQTA 3SSAA 4UFOA 3N2GB 1TMKA 3QVSA 4L7QA 1PJ2A 4UBLA 3ME5A 1S7GA 3ND8A 2BW0A 3RVRA 3NS7B 4ZVSA 3FMWA 3OW2R 4IO9Q 3MR7A 2ZI4A 4MPPA 3VHRA 2A5FA 3ZQ6A 5AXLA 1ENYA 5DG9A 4XB2A 3ZVNA 3BCSA 2Q4OA 1EX1A 5KYYB 2HHVA 2I33A 1AQUA 1ZH0A 3IT3A 2IYWA 1Y98A 2D54A 2LA4A 1PZHA 1RHMB 2VNKA 4DCVA 4U8YA 3GYXB 2Q0XA 1MA0A 2NUTA 1NIPA 2IYNA 4JYZA 3NGKA 4YMEA 3H59A 2A10A 2XJ4A 4Q3NA 5CAAA 2FC8A 1QH9A 3IAEA 3KTOA 1KY4A 2XGOA 2HHHB 4HVCA 2HLUA 5HJ2A 1RU1A 3D0QA 4Q5VA 3JARA 4LW8A 4HL6A 3TOCA 4NICA 2HCRA 4DUZJ 1XTIA 1CUAA 2R6CA 4X20A 5CDHA 4W9MC 3DRRA 3MR3A 1TW2A 4UFNA 3M3DA 3KJEA 3TUIC 4Q4HB 3LWDA 1HDYA 2Q49A 4LMPA 4KUGA 1TKDA 3FWZA 2PMBA 5CMLA 4EHHA 4XPZA 1QK4A 1RBOB 2QRPA 1WZIA 4KTTE 3H0CA 1RWMB 1ZAKA 1S10A 3MOZA 4OO3A 3FPBA 2EBFX 3ZX4A 2P5TB 4C8OA 1EGMB 5I45A 2OOKA 1BE0A 1XRMA 1V5WA 1UJ4A 2XQIA 4OHCA 2DBQA 1C1CB 5EOVA 2VYNA 4LSNB 2UUAF 3DI6B 4C3ZA 1T9YA 2R2AA 2WM8A 3M8QA 3V7WA 5E9WA 4WZ6A 2EKNA 4DWIA 1DTEA 4S35A 5I9MA 1M66A 1TVEA 3T95A 3EGIA 5HVHA 2XMVA 3FFAA 3CC2S 2B5JB 1F0KA 4URYR 5CEFA 3S2ZA 2MSEB 4J6EA 4MQ5A 3CVXA 2Q6TA 4CKZA 1HLFA 1FFSA 3W65A 3R9XA 4XPIA 1RM3A 2XOEA 4KGKA 4G37A 1N2JA 4NHOA 5ARCA 1YKFA 3OE4A 1RI7A 1FD8A 4YCLA 3QF4A 3W2HA 4V1CI 3SLKA 1ORWA 4EM6A 3CCWA 1SKYB 5LD2C 2I6QA 5E3AA 3FKSA 3T5LA 4L5YA 1OFIA 3A3NB 3CXUA 4E13A 5DV9A 1Q7RA 3AJ9A 2ZRIA 1JSRA 1E2JA 1ZXLA 2X5JO 3C97A 3IIKA 1OH5A 1WEXA 1K2WA 3VC7A 2IRUA 3UMMA 1T9CA 2NUBA 1A95A 3HWX1 5CNJA 1EUCB 1EFTA 2EJBA 3VTAA 4ECXA 1GT6A 4NESA 4TU8A 4LF6B 1SRQA 4CVNA 1Z7GA 2HW8A 5THQA 1SXLA 4LRAA 5F9MA 3GMGA 2YWWA 1CWUA 3WIUA 3OQOA 1V2GA 1EFVB 3Q89A 1FFGA 4B3OB 4EKYA 1QVVA 3V97A 1TM5E 1UWCA 3NHJA 2XE4A 3VHXB 4QTYA 4RNFA 3WNZA 4FGKA 4KXXA 1VKRA 2CZQA 4KMOA 4U00A 3RYFB 1G4HA 3PW2A 2CYCA 1Q1EA 2H8GA 5T4HA 5EWEA 2FU5C 5ES4B 2NPIA 1UDRA 5TS2A 3H4DA 4MIEA 2RU9A 4U2FA 3WLNA 1J99A 3HH8A 2N47A 3ZBPA 4GYKA 5L9AA 1OHHD 4EGSA 5F33A 2HFSA 1KJJA 2XUGA 1HBNB 1A82A 2NUHA 2MHCA 1MBZA 3KKOA 4H3SA 4CF4A 4YWHA 2VJCA 2DPGA 4LJYA 1O9BA 5HROA 1L6IA 3KYLA 5TXGA 3FFIA 1G42A 4HATA 1D9DA 1XMOB 1PDVA 4C7QA 1SWWA 4DR4F 5LA6F 3MPUB 1TK8A 4JUBA 3JQBC 1RW4A 1JFFB 1U8TA 3V55A 2D4HA 3ZXIA 1EKXA 1A3CA 1HNZJ 4UUOA 3PNQA 4ZI7A 2ZD1A 5G3YA 3OEYA 1EDOA 3QZUA 3B1KA 5DZ7A 4HT3B 2ZM6F 1L4UA 4C0JA 4G1QA 1U9JA 4FJ1A 3RROA 3HKZD 4Q7JB 3KT0A 2YNMD 4GBGA 4ND5A 2X4DA 5JO9A 4EBEA 3VVMA 2LXIA 3KZXA 2QI9C 3O38A 2JD0A 4W9RA 1Z25A 2OQ2A 3AX6A 1O77A 4XWYA 3PG9A 3G68A 4RULA 3R2CJ 3KTAA 2DEIA 2V65A 2P2DA 3OWXA 1T36A 3WLAA 1PWXA 4J16C 4LF9B 4O4HA 4F8RA 4QJBA 4QDJA 1A1SA 1SVNA 2WHPA 3OTQA 2PO4A 5CTAA 4C2AA 3CZCA 3SYNA 3IUQA 1U0GA 3MMJA 4ZVQA 1OXMA 5EZ6B 4M6WA 3UMBA 4HOYA 4YASA 2JRSA 4BQFA 1ND6A 1OJLA 5T14A 3C0KA 4ESEA 4ZIWA 4FIZA 2XCAA 6YASA 1KKMA 5FWXA 2VHYA 3MPUA 1DY3A 2HAFA 4J8PA 2J3IA 2E5JA 4U7CA 1KE2A 1GXLA 1HDIA 2XGPA 3I28A 4MB6A 4MW4A 2QLXA 3OEEA 1AN0A 3BJRA 4E5DA 4PU0A 5HROB 2HQ3A 1RA7A 2GM3A 3ZS8A 4P4LA 2Z8ZA 4ISBA 1UPBA 4NZ6A 2R6JA 3QSIA 2SKDA 4OYPA 1QVRA 4QJ4A 1U9CA 3G6YA 2R8OA 5D1HA 3R0JA 4R9SA 5JAHA 2ERCA 3HRIA 3C3YA 4N6OA 4RK4A 3TLMA 2WWGA 4DEVA 3DZKA 4RSHA 1DB3A 1N34B 3CMCO 1L5YA 2C20A 4E4YA 3HY4A 2V0CA 4YXWA 1V2HE 1LW7A 3USCS 4XD7A 4Y1RA 4HVLA 4IFYB 4IHQA 3T1NA 3HHLC 3WC2A 1LLFA 5BSUA 3WRXA 1RT3B 3FDIA 4IH7A 1H5QA 2QN8A 4RWEA 2BYCA 2P0EA 5I4BA 3PD7A 4PO3X 5REQB 2E44A