1M0SA

Northeast structural genomics consortium (nesg id ir21)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-Phosphate Isomerase A
publication title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21
rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
total genus 72
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m0sA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m0sA01
5IT0A 1LKZA 3ICOA 4GO5X 1M0SA 3KV1A 3MAHA 3BXFA 1U8SA 2W48A 1CD5A 3O1LA 3MWBA 3OC6A 2P9GA 1JT9A 3BXGA 3HN6A 2J0EA 5HJ5A 3TUIC 1FSFA 3UW1A 3E15A 1O8BA 2QMWA 3TUJC 1FS6A 3IBWA 3LWDA 2RE1A 4TM8A 3OFHA 4OQPA 3AB2B 4TM7A 2FGCA 3BXHA 4L5JA 2RQKA 3LHIA 2WU1A 3IXQA 5IT4A 2OKGA 3NRBA 2PC6A 2JOQA 1XTZA 2QSWA 4L4YA 3MTJA 3EB9A 4OQQA 2O0MA 3ENWA 4PWUA 3DHWC 1NE7A 2F8MA 4GO7X 3U7JA 3DC2A 1SC6A 1PBTA 2MDAA 2F1FA 3DHXA 2BKXA 3BXEA 2RI1A 4GMKA 1FS5A 2NYIA 4L4ZA 1LK5A 2RQMA 2GNPA 3CSSA 1LK7A 3ENVA 3HHEA 3DDNA 4L5IA 3NZEA 3CEDA 2ZHOA 4X84A 2BKVA 5FIIA 2J0WA 1UJ4A 5IS2A 2KO1A 2DT9A 2I9SA 3E7FA 3NWPA 1YGYA 2QMXA 1UJ5A 4LUBA 3S1TA 3LUYA 1UJ6A 4L51A 4IO1A 1HOTA 3AAWB 3P96A 1VL1A 3ENQA 3OFGA 1Y89A 2P9CA 2H9ZA 4L50A 2QRRA 1FRZA 4GO1A 2PA3A 3KWMA 2JHEA 3L7OA 1Y7PA 5T41A 3OFFA 3K5PA 3LOUA 1KS2A 4R7TA 3EFBA 2P9EA 1HORA 3AB4B 3CH7A 1PSDA 3TUZC 2RI0A 3N0VA 2DTJA 1DEAA 1ZPVA 4M8LA 2R5FA 3W7BA 2J0XA 3OBIA 4R9NA 2CDQA 2LQJA 3OFEA 1YBAA 2LVWA 3TX2A 4NMLA 5JJBA 1FQOA 1RWUA
chains in the Genus database with same CATH superfamily
3KYJB 5UKDA 4GR5A 4BZXA 4ES3A 4OI0A 1VPTA 2A5YB 4G37A 4UZSA 2A1TS 1EPUA 2XT0A 3KJNA 2V03A 1Z8DA 5K05A 2G1KA 1PFGA 2IEBA 4FI3F 3GLJA 1I7PA 5CA1F 1KO4A 1U09A 1Y5NB 1KHHA 5KYXA 2VNSA 4R9UC 3KKLA 4OIFA 1UKZA 1JJ7A 4CGYA 2NU9B 4NOJA 5K3AA 3PW0A 1C7QA 3JQGB 1FFSA 4LSLB 3PVSA 3R0IA 2APOA 2IC3A 3CX3A 5J2NA 3R5DA 1UPXA 1HH4A 3QF4B 2X7XA 4D0LB 2ID9A 2JVKA 2BTEA 2UUBB 4DHEA 3W9BA 4OREX 1TVRA 2ZM6B 2VOEA 3PLAE 4LSMA 2IX9A 5DG7A 4DJ5X 1LTHR 5A6PA 4I2PA 1XHEA 3GDGA 4BLGA 1JLAB 2JA2A 3TMYA 3DXYA 4DIEA 2YDXA 3WR5A 4QXOA 3CEHA 1KS9A 2VSNA 5FX2A 3VR5D 1H2UX 4E8UA 3EG9A 3ZHOA 4ZMMA 4ACBA 5KT7A 5E2IA 3WGIA 4BQFA 1ZZEA 3QNWA 3ZX4A 2PT5A 1T4DA 3LUDA 3D2CA 1Y3FE 4E4TA 2VONA 2E1RA 4QELA 1ZLYA 2PYDA 3TARA 1FZQA 3L1JA 1HEIA 4DEYA 3WZMA 4DMFA 1KVSA 1A8PA 3H8JA 4RL4A 1FX1A 3MWYW 4NR0A 4C76A 3RKSA 4ETNA 3NWOA 2F3PA 4D8XA 4ZEWA 1X42A 4HAYA 4E03A 4DV2B 2R1UA 4NI2A 3ULHA 2DOKA 4KFUA 1MZVA 2LKCA 1VKOA 3BGWA 1YJXA 2H9YA 3OQMA 5B6JA 2MOKA 5H5JA 1WUTA 4CLOB 1HNWJ 3PNPA 4GPD1 4KWEA 1HW8A 2FMTA 2E5GA 1MVLA 2WHEA 1WCV1 2RU3A 5EE3A 1PD0A 1Z4IA 1X9MA 1SXLA 2AMFA 2P4HX 2A0KA 2P0EA 2YXEA 3OZDA 4P7JA 1VMIA 4ND4A 3AZPA 3COPA 4AMYA 1EHCA 1KP6A 2P3OA 1P39A 4M8IA 3ZCQA 4WCEQ 2PTHA 1ZNYA 4KO8A 1FE0A 1D1TA 4GVXA 5KJCA 2X41A 4LOHA 4NRTA 4A15A 2XAAA 1G3RA 3RJTA 4A47A 1OXXK 3ZWCA 1JJ4A 4ROSA 1Z2OX 3GG1A 1BQ4A 4QWBA 5JWOA 3EB9A 3KKNA 1Z75A 2VNAA 1OBCA 3SK0A 4LF6J 2DNRA 3ANNA 1REQA 2XQCA 4DJBA 3OLQA 1ZY2A 4MUBA 2VG6A 5IF3A 2GM9A 2XKJE 5GADI 2IHBA 4V19J 3S4YA 2MSSA 2AYGA 1A9XB 3AH8A 4FMDF 1XV5A 4N3NA 1XMBA 3A6PC 4JLPA 2P9BA 1SUIA 4IDOA 2QN2A 3UK7A 4L75A 1H9AA 3UWDA 3TX8A 1QIEA 2IDJA 3QMPA 2WAQD 2EP5A 1DIGA 1Z25A 2YPYA 2NZ2A 5CPBA 5HEKA 1AHIA 1P5FA 2LDIA 2JCXA 4L16A 3STHA 1VE9A 3T3GA 2GNKA 4YVFA 1EIYB 1C0TB 4L7VA 1DTWA 1S1WA 1Y6FA 3LPDA 4LBPA 1JTVA 3MMJA 2XYHB 4I1IA 4CQMB 1W9MA 1I2DA 4X1IB 2J6HA 1ECFA 5AICA 4TYYA 4Y67A 3R8YA 4EKIA 1FJ7A 5LD2B 2NYVA 4TY9A 2NYRA 3FVRA 4GM0A 1P18A 1RQNA 1HO3A 3IESA 3AVPA 1GLVA 2XOXA 4O4HA 5T3UA 1AOXA 1W19A 1TB4A 2ZE2A 3ZGXA 1ECGA 4LT6A 2Y1LA 2Y1KA 3WC0A 3PXDA 4PAMA 4ZVUA 1YBFA 4X4UA 4HO1X 3FRHA 4MA5A 4R0JA 3DE4X 3UUGA 2ATXA 3B6BA 4XGIA 2G4LA 3X3UA 1RISA 5KYYA 5EHXA 3HX9A 1MT3A 2ODTX 2WJAA 2UDPA 3IA2A 4TT3A 4ZDJA 5TMPA 1U3CA 4DOMA 3E8MA 3AKZA 2CHQA 1H5NA 3HSZA 2DGVA 3GPBA 2CNWD 2PUEA 2LVWA 1T1GA 4YI3A 1VLMA 4DRXA 2EKQA 4B0PA 3EFEA 2VHZA 5KG7A 3UJ9A 4PW0A 5CT6A 2H1YA 4KOEC 1GGEA 3BGFA 4LF4B 4I50F 2PT9A 1D1QA 3IB6A 1Z35A 5HXAA 4LF8J 1HNXF 1U0GA 2FZLA 4F84A 3U4QA 3K9LA 3BFPA 1L4YA 2EC2A 5E41A 3DOMB 3O91A 3SI7A 1GU0A 3GG0A 2I03A 1SU7A 3MQ4A 2CG4A 1O1YA 4WXHA 1PYSB 1V41E 3PXBA 1H74A 3U31A 5LXYA 3FLMA 1D6NA 2XQKA 4PLPA 3LF2A 4MW7A 4OQEA 2VK1A 2PO5A 1JJBA 4RK7A 4YAJA 3BA1A 2EP7A 2MKIA 3O2SB 4Y6GB 4R31A 1J5EJ 5IBCA 1RW4A 3HCOA 3DRSB 5AK6A 4OEHA 3IIJA 5E8RA 2GHRA 4WIQA 3PA8A 3OL8A 4C2AA 4HH0A 3Q8XB 4R16A 2D0DA 2O3UA 1G98A 4TYNA 3MR5A 1VE6A 1UAWA 4ZVPB 1XRRA 4WCFC 3HLYA 3RUHA 4ARAA 1Y6GA 4UHFA 4CV3A 5HIAA 1FFGA 3TTUA 4YAGA 2QPTA 1VIMA 3KSBC 4FNHA 2SCUB 2MKYA 2FQ1A 4RTOA 1N9GA 3IDSA 1V8BA 1VBYA 3EF0A 2DUJA 1FFXB 3BWXA 1IAVA 2XDQB 1ZP6A 1CDDA 3FTPA 1ENPA 4FCTA 2XLKA 1XZGA 1F4VA 3NBYC 2G0NA 2VFVA 2FVQA 4JKYA 5SYNA 5CYOA 3IR7B 1D8TA 2G9VA 2I80A 1E2DA 1R89A 1JKFA 2FMIA 2JLXA 1VIXA 1JWWA 1F0PA 1L5MA 2WKQA 2DWCA 4U7CA 3QY9A 2W6MA 3TEFA 1AC5A 1EA5A 5G3ZA 2ZXUA 5JAOA 1QHSA 2DNPA 3GJQA 5IHPA 2OM2A 2PU7A 3BB1A 2AX3A 4KGMA 4DCCA 3MWDB 4BNXA 1IXZA 1G20E 4PNEA 4I9FA 2W2QA 4M1OA 4R9NA 3KHSA 3GPAA 2O52A 3PQDA 5H9WA 3HBAA 5CHCB 3ELBA 1F6TA 1D8YA 1QH1B 2O5CA 1G41A 3NH6A 4ZVRA 1JB9A 3O1LA 4LRBA 1AO0A 3AY6A 1RWXB 4HDRA 4DUZJ 4UQTA 2GHWA 3I62A 2W2OP 2ROQA 2WDZA 5FUYA 5JISA 3M8WA 4U2CA 2R84A 2OGUA 1AXEA 4YUXA 3PLNA 3KXPA 1GNVA 3WL3A 1GNQA 3K0AA 2IEZA 2J3QA 1MJ5A 2YBVA 5HRCA 1U81A 2I6FA 2HSGA 4LWOA 2QP4A 4L8GA 3HVHA 1RE1B 4ED7A 1R27B 4X6LA 3MGKA 5ED0A 1YJVA 4IQ0A 2UUPA 3GFZA 2BKVA 5EZQA 5LZ7A 3BH6A 2O8EA 1ZJ5A 3MJHA 1IBCB 2ZIXA 4BO4A 1EVIA 1G3IA 1GPJA 2Q41A 3EGNA 4DLWA 1W85A 3MQFA 1TKXA 1X1RA 1LWNA 1USVA 1PQ4A 2JFNA 3CUNA 3NVKI 3AVUA 4UCFA 4YCCA 3WLFA 1ZFNA 1G5QA 1AQ6A 3B5EA 5C42B 3JVIA 2B21A 3BGRB 4IMRA 2HCTA 3KG0A 2HVIA 1XZJA 2BTOA 2WOMB 3CSDA 2MZRA 2HO5A 3A11A 3BGOP 4A8QA 4K1XA 1C2TA 1M90T 4IKAA 4I7FA 4LV6A 1UFWA 3QLVC 2BISA 3BF4A 1SOAA 4WN9A 4BP8A 4J1NA 4PZLA 4ER8A 5BV7A 2NMVA 2WWWA 1GAJA 1WNEA 3VSBA 4RD4A 1RLUA 2E2WA 4DA8A 2I38A 3UWMA 3KJGA 2CXSA 4JNKA 1KJNA 1LBHA 4FDLA 1RRPA 4R01A 1NONA 3RTAA 2AD9A 1EVZA 3T5PA 3C6UB 4Q16A 1UK9A 2HGSA 2WJZB 1QHEA 4C5BA 2HYIC 2XUAA 2O01C 2WZ1A 4BMYA 3AA9A 1C3OB 5K3OA 3EPLA 3SBEA 2ZJFA 4OLHA 2RHMA 5KNCD 4JI0F 2J67A 1WF6A 5H9EK 4JLNA 1JHRA 4DX7A 1W36C 3PJ9A 5F7XA 2BJVA 2HWXA 1JPUA 1ZOPA 1P3DA 2JD2A 3FYUC 3KT6A 4D0NA 4Z4EA 2F55A 2BJHA 1A8SA 2GKOA 5SICE 5ALJA 2UXBF 1HBOB 1FP7A 1WXWA 3CVUA 3QYAA 4NBLA 4N0EA 3GK3A 4ND5A 2I4LA 4N18A 2FPKA 3OT5A 4UARA 4IYRA 2X1AA 3E81A 2AEFA 3R5GA 3TA2A 1R18A 4OZ5A 1J8VA 1DJ0A 5JSZB 3KSZO 3WNCA 4P2GA 4YH1A 4S2UA 4ND8A 3OU6A 3JWHA 1L3SA 2W4DA 4FKXA 1Y4AE 4PAOA 1VCTA 3FJYA 4QTXA 1ZG3A 2G6TA 2WLTA 4B3BA 3DMJB 2JFWA 1X70A 3Q8MA 2C8VA 4ZZ2A 5CDGA 1H0SA 4DGSA 1WXQA 1PR2A 5FOSA 5DDPC 2WTAA 3RFCA 2QNRA 3ESBA 2RK3A 5I9IA 2XUDA 1CRPA 4GP6A 3GJ8A 3VYSB 1QJCA 2LXUA 4MVJD 2ZJ4A 3ACBA 1VLQA 1IBLF 1CUHA 4GG1A 3LOUA 3IOMA 4DF8A 4PUOB 1W8DA 3TD2A 1ZH0A 2UVQA 3W7BA 2RCNA 1G66A 1OPIA 5IT9A 1AURA 4CEJB 2VZ9A 3BHMA 1OWNA 3URKA 2CFOA 3PRVA 1DWQA 3IEVA 5A8RA 1N6IA 4BKRA 2CFIA 4GF5A 3A58B 2YWJA 2XI4A 3PY8A 4Q00A 2XOKA 3JSMA 5A4AA 2KKHA 3F9IA 2IUSA 1P6XA 1ONSA 2BYCA 3W5DA 1XR7A 4W5NA 3OHAA 1G8AA 2MYTA 5G02A 1HR0F 2VQFF 1SVNA 5AJ3J 5LZ9A 4LDNA 3GUCA 1U1PA 1CIVA 4YHHF 3L77A 3X2SA 1VCNA 3RW6A 1VZ3A 4NCHA 3DLIA 5E0OA 3KQTA 2OV8A 5IC4A 4F12A 4QOFA 1JG2A 1WDLA 5JAQA 1N6QA 4UPVA 3A06A 3OR1B 1I9GA 2IYGA 2BMJA 5KOWA 1XWFA 1ISPA 3EIOA 2BXJA 1EFHA 1YHQS 1LPAB 2FZGA 5GP1A 2FWRA 2HHWA 4Y6QA 2FVRA 5AR1A 4EHBA 4LRDA 4ZVQA 1HYEA 2JJ1D 3ZY2A 4Q9IA 5CA0B 5TV2A 2OHFA 2YBDA 4KV7A 2WWHA 2HDHA 4PS0A 3NV9A 2OPQB 1VBNA 3FJ2A 5I3UB 4GPBA 4RZ2A 4CMIB 3BAFA 4JB8B 1KH1A 3TUJC 2REQB 1PT5A 4R5MA 3HCXA 4MI9A 1EGQA 1JN0A 3CNQP 2KM8C 2ZEJA 1N7JA 3TW4A 3IQDB 2XO7A 3PEHA 2PX8A 3LP8A 1APSA 1GP2A 1N33J 2PRZA 1UOEA 2CUZA 1OI7A 4HNAA 4J0KA 4W4MA 4OOFA 5AW9A 3QOWA 3U1LA 2BUBA 2FN4A 4RNMA 4OXIA 2VUGA 4HNHA 4EI9A 4B7ZA 1ZKMA 3N79A 2OV3A 4J9KA 3DOJA 2PJRA 3KRTA 4RKQA 4ZOLB 4UCWA 4LQ9A 3C8DA 4UXIA 1NPTO 2Z4PA 2NUTA 2GN6A 4J07A 3KJEA 1EX1A 1XVVA 1S6UA 1TQ2A 5E33A 4QAQA 1XRMA 4AXXA 4KR6A 4PKDB 4DR4F 2DWUA 3THWB 2R1VB 3BN3A 4AUEA 1Y6JA 2FWBA 1RTZA 5HMWA 1DAMA 2ZKIA 3EDYA 3PZRA 3VNSA 5EERA 2ZZTA 3T4EA 1AB8A 5DIFA 4ZCPA 1JIJA 1KVKA 4E94A 4ND6A 3DE3X 2OFOA 4L8VA 4QM7A 2GZHA 2YKPA 2XZPA 1DRVA 3GT0A 5F73A 4Q3BA 2WJYA 1BY9A 1LWFA 1ZTWA 4JYZA 2OZLB 4MVJF 2IVMA 3JRXA 2J59A 4Y2CA 3ZQ6A 1E2NA 2FC9A 1UA1A 4KYVA 3ZHVA 2R7QA 1LF5A 3M82A 2R48A 3CPJB 2D3UA 4UHEA 5BVGA 3A3PB 3E7XA 3C3XA 2XCSB 1K6XA 2ERRA 4LVUA 4KGVA 1WTAA 2YQ3A 5K3CA 5CT5A 4CTJA 1W2BR 3MJRA 1QXSA 1RTDA 1S4EA 3EQ7A 5KT3A 3GLVA 2IRXA 4EY8A 4FT2A 4NZZA 1M72A 5C5EA 3NRJA 2Z0MA 3CE6A 4LR7A 4DPWA 1SPXA 1T5DX 4QU5A 1TM7E 4WE3A 4LDAA 2HJ9A 3AHPA 3O3NB 3AFNA 4KW7A 3CCSS 5AUPB 5KVQA 4Z3DA 2XZLA 1NJXA 1M0SA 1OY6A 2QA1A 3UCGA 4UE3S 3GUHA 3H7HB 4OXRA 4FFLA 1QHIA 2Z2IA 4FF1A 4N39A 1LSSA 2X86A 1KN6A 3BPDA 3VYVA 2CYCA 2QOEA 4NAHA 1VLLA 1W46A 4ENPA 1F1BB 1UBEA 2V3VA 1XEXA 3FPSA 2XXBA 3PXAA 1PL8A 3NUQA 4TRRA 2FUG6 2O06A 3W3SA 1E9VA 1VHIA 1JR4A 1J9EA 1I0ZA 5HUHA 3E2IA 3LSYA 4E5DA 2QWXA 3CVKA 4NA3A 2GM4A 2CV1A 1ZBTA 5A04A 1ZA1A 2MQ8A 1M33A 4CM8A 4ENTA 4EFAC 3GRZA 1LS6A 3WDOA 2G1DA 3DAYA 2R85A 3UCUP 1M1NB 1QKJA 4DCOA 4RHUA 2DUMA 2A7QA 1HBNB 3KLOA 2HFNA 4QQRA 2XRZA 1EESA 1ZH6A 2JFVA 1K66A 3NATA 4NZOA 3GJYA 4EUVA 2V4JA 4NCGA 4KH0B 3MS2A 2Y1IA 4OYBA 3GNLA 4GLFA 1ZN8A 4RW6A 4ZP8A 2I99A 4CCSA 1G4UR 4W5WA 1P0FA 4RNFA 2R6JA 2FLNA 4HAXA 2RC5A 3FCEA 3S44A 5TQ2A 2OHIA 2C9BA 3EUFA 3SQMA 4UW2A 2YQ4A 3EFHA 4K6OA 1OFIA 3DWFA 3K0KA 1K6IA 2PSDA 3GYBA 1YIOA 5FFMA 3QYPA 3DOKA 1Z56C 1LBQA 1SC6A 3RE1A 1E9EA 4W1PA 1IJEB 2Y0CA 3AKDA 1L4LA 2HA3A 2EX4A 4DSIA 4LYAA 2KI2A 4YJHA 1ADJA 1CQXA 3O4GA 1DBWA 1OYEA 5D3MB 4ODIA 1NJFA 2LYVA 2EJUA 2ZR9A 4RGYA 3R7DA 4JEIA 2V4RA 2EL9A 4LQ4A 1A9YA 2B94A 4P7TA 4LZPA 1NC3A 1CLEA 4WVLA 3OJFA 2WD7B 4OX9F 3ZV4A 1NKCA 2OSRA 2GA7A 1HX7A 4KTVE 3CVWA 5TQ0A 4ZXFA 2VBIA 1QQTA 3TLGA 4F38A 2OSBA 3E1GA 2VPWB 2PUCA 4KYIB 4CCWA 3TW6A 1BA3A 1J23A 2X15A 3LCCA 4XTCS 5FD1A 3KUEA 4R3NA 2YHUA 1ZTTA 1SZCA 3D0RA 1FVSA 5A6SA 2ZNYA 4FJ2A 5HJYA 2WZDA 5KOJA 2RE1A 4P80A 1M34E 4U2FA 1T9CA 1TKRA 1VMAA 3IPRA 2CB9A 1KJIA 3TRJA 3IH5A 3U81A 1PGNA 2OXCA 4NCKA 2JGJA 3OM0A 5IWCA 1CUCA 5FWXB 3T3IA 4G5HA 3IL2A 2J9FB 4I55F 3FPFA 1CWUA 3N2EA 4DQPA 1L4FA 1Y3AA 1DNPA 1JFSA 3FPCA 2WWGA 3MS4A 2QRQA 3UB4A 1E9FA 2J0QD 2KO1A 2UU9B 1WDKA 3F5DA 1WZ2A 1TL7A 5FLXU 3BKXA 2CLLB 5IBRA 2QLFB 2J5XA 1FUEA 1SIWA 4E2YA 2BEUA 4QXQA 2VB6A 4RKRA 1KOFA 1T2FA 3N2YA 2HSJA 5C46F 5LBTA 5TC4A 4DT1B 4JBLA 5SZTA 4NJEA 5CDTA 5DZ6A 4IQ8A 4NCJA 3G5LA 4H7JA 3IPYA 2ZB4A 1NVXQ 1S9GA 5DNCA 2A0FB 1QIKA 3GIKA 2WD8A 3KOMA 1FUIA 3HEBA 3T1HF 3GJSA 3DBLB 3IAS1 2H4XA 2BP7A 3VR4A 4S2EA 3GFSA 2EXUA 2IYTA 4PLHA 2WILA 4DRYA 4LXTA 5AM5A 3K17A 1YKFA 2HR1A 3G8DA 3S27A 4N3CA 4CG0A 2I34A 4CKBB 2VATA 4BGEA 5TMBA 3BFKA 4WNAA 4DTIA 4UU0A 5DWQA 1KOOA 3AEQA 2ZRFA 4LAFA 2B20A 1M2JA 3GUYA 3RCBA 2G0IA 1RBMA 3R3JA 4TSRA 4X6XA 1JHAA 4ZMSA 2QLXA 4XYMA 2XD9A 2HTFA 2YW2A 3BGVA 3TLAA 4FFMA 4HYTA 1Z88A 2GMWA 1SUQA 4PFSA 4JZKA 4FPXA 2F7SA 1JFFB 3L95X 1OC2A 1MROA 4BFTA 3JQCA 2XYQA 4U3JA 2NVOA 2VIHA 3JATA 4NMXA 1FYVA 3HA2A 4LFCF 1NE2A 2DTJA 3TNFA 2Z4TA 1WJGA 4G9EA 5D1NA 2CLMB 4UZCA 5JYCA 2ODNA 5FOVA 1XHLA 4CIOA 4XXHA 1J42A 3VH3A 1P8AA 2GPWA 2HA0A 1KDVA 1L5HB 3S99A 3IDOA 6AT1B 4KR3A 3T5TA 3QFFA 4AQYJ 1C8BA 4O3OA 4MUEA 2L48A 4F3YA 4F4ZA 3LF1A 2PJUA 4BBYA 2J9CA 1XZCA 3HDJA 3AHCA 1P9NA 3PITA 2PVCA 3DNPA 4OL0A 4YB6A 5JMTA 4OBBA 3VSAA 1GYRA 2ODWA 1R0SA 3AR4A 1DUSA 2BDEA 3BUSA 4LHXA 3ST7A 4DUGA 3D7KA 3D31A 5GQSA 1OGJA 2DPIA 3NO4A 1LFDB 4L9AA 2ETVA 5DYTA 1QE1B 2VDRB 1C9DB 3PGMA 2GPTA 1P73A 1UT8A 2VTVA 1NTOA 1RAGB 3GRFA 3RVNA 4MAFA 3ET4A 4P7BA 3QAUA 4XB6B 4ED1A 3NHMA 3TWZA 1GTEA 5JC1A 1QAYA 4B79A 5KQLA 2DXDA 3TNYA 2C5FA 2Q6BA 4ECEA 4OJQA 2BGMA 1KY5A 2PX2A 4FWTA 1G8JA 1HFWA 4PYNA 2KVQE 4JX9A 3R5BA 2IPOB 2FN7A 4D3SA 2IELA 3CWQA 5IMSA 3TEJA 2FUNB 3FCCA 2J5KA 2VSOA 2YJTD 4OVKA 4MT1A 3N5BA 4ADSG 2QG9A 3VC3A 4DXAA 1N5VA 5DTEA 3DCJA 1FLDA 1I2ZA 3OOHA 1QH8B 5F41A 1E6KA 3FOAA 4UBMA 1ZEMA 3K0SA 4B83A 1BW9B 3DAGA 3TQSA 1U6BA 5K8JB 2ZT6A 4WMLA 1P5RA 2QEQA 5EKUA 4CZ2A 3QIPA 2GESA 1LFAA 3GCDA 2FG5A 4R0MA 4NFLA 4CXMA 1PWHA 5CR9A 3O6VA 1QR2A 3R7WB 4JLAA 2Q8NA 5AKZA 1C30A 3CW9A 4HLDA 4BMVA 4BCBA 4LTDA 1C1CA 3KJFA 4X66B 1S2IA 4OHPA 4Y2QA 2CHUA 2ZIZA 3FNBA 2Y76A 5JZOA 2NW6A 1YJ8A 2XTMA 4QNNA 1BU5A 5MHTA 3O8NA 5L1LA 3E5MA 2EFGA 5HM8A 4TZ6A 4MZDA 3AOBA 3UT0A 2QMUB 2E9SA 3JTNA 1SOUA 2WG1A 3MJDA 2PSJA 4KK4A 5KTSA 1W9HA 3FN4A 2MKJA 1CERA 1M73E 5DCUA 2HSEA 1QGUB 3CBQA 4AKTA 3U3DA 2FLPA 4CE6A 3SHTA 5DKFA 1NQWA 2WKRA 1H3EA 1A2BA 1ETUA 1D2RA 3IC1A 3KLBA 2QYCA 2GBPA 4LVNP 2QT0A 2V7UA 3J81U 1V3SA 1MN7A 4PYDA 1OQ3A 3U3ZA 5KVCA 8LDHA 3NCQA 3MAAA 2ECFA 3H97A 2DXFA 3JQJA 3FB4A 2FEPA 3JZAA 2MHCA 2C2NA 1TL5A 4JOSA 4R5PB 3ZD7A 4C11B 3KFWX 2V69A 5DN9A 4GH5A 4YC7A 2GN1A 4J0EA 2IA0A 3JTPA 3DBIA 4DR2J 3LECA 3E7WA 4B45A 3U4AA 4LUCA 1AUOA 2PJZA 2ZAYA 1H2RS 5DH9A 3VGSA 1VLOA 1UOOA 5LQKA 4ZVOB 2AQ8A 1CE8B 1Q0HA 2C58A 2C3UA 3SSNA 3OCYA 2I6TA 3G9CA 2P7HA 4JKIA 1E3WB 2H1SA 1N5YA 2X14A 3M9WA 1CVLA 3U4GA 3EVBA 2UXDF 4LK3A 1TT5A 4BRSA 3FKSD 3X1DA 3NUZA 4H3SA 1UK7A 4O3FA 5D6OA 2A2DA 1WXHA 2I29A 2ZTHA 3LGSA 1C0LA 2NU8B 3KUDA 2QTNA 2OXEA 3LUKA 4RK6A 1UXHA 3FRZA 3G8YA 2Q1UA 1ORTA 3ZTQA 3E8XA 1GPYA 4OO3A 4RVNA 3Q6MA 2VDHA 2VAPA 3R44A 3PHLA 2OBXA 5EXEA 4MYHA 2AZ1A 4K87A 1FS4A 5DHTA 1GUDA 2PX5A 1IZ7A 1ICEA 1RT5A 1TL3A 2HHLA 3X1MA 3VU3A 3RJ9A 5LNK1 4OJKA 1IEWA 4LSZA 1HYBA 1EP4A 4NCIA 3MM9B 4NBRA 5CH5A 5CNJA 3GDFA 3TL2A 1JWAB 1HNWB 3MT7A 1JSLA 2PKQP 1NKSA 1ONPA 1F3VA 5E3QA 4MXDA 2WD9A 5BN4B 1JHXA 5U4QA 2HWIA 4YA6A 1ODIA 3SZGA 1M9NA 3P0IA 2XNDA 4MVJI 3C45A 1KR4A 5E7OB 1VG9B 4MKVA 2L41A 3QVKA 2EW1A 4CCAA 3TAUA 4B9TA 3N0WA 2UZAA 1MO2A 3IKTA 1HEUA 1EETA 4ZJUA 1YL5A 4ZANA 4AJ4A 2EWWA 2ZH1A 2W4IA 1E4EB 2JI4A 3P5BA 5JIBA 3HKBA 3UKOA 4B5LA 4LF6B 5EIEA 4FWIB 4IRMA 3H2UB 1ZMBA 2OWDA 2HJVA 1D7AA 4G1PA 3NGRA 2A35A 3C4VA 2OD6A 4DPLA 2CNNA 3PWTA 4DXHA 1JLBA 1T0UA 1H6AA 2Q8QA 2AJ1A 1ZS6A 1EM8A 2ZJ1A 3MHYA 1DQ8A 1Y4ZB 3VR6D 1NBIA 3MCMA 1CJTC 1E4OA 1UZAA 1UINA 4OQMA 2UVPB 1LQTA 4PX2A 2GPBA 1NNI1 1ECBA 1KFEB 3M6FA 4LRXA 2GTPA 3IAS6 3PNBA 1ZR4A 1U1RA 3STTA 4DDWA 5AHXA 4XUEA 2RHWA 3A05A 3M5WA 3WB2A 1X86B 5BW5A 2I55A 4JV2A 3PD7A 2AS0A 1QUPA 3FSGA 1WORA 5L53A 2YH1A 1SVSA 5LIRA 3R6LB 1UZMA 4M3NA 1I6MA 3BULA 1PFKA 3VO1A 2GHTA 3BJIC 3DDWA 3GJTB 4J0JA 1OHHD 1WMAA 4HB0A 4V1CB 2P0YA 3OJEA 4FEAA 2GK7A 2XA9A 3MIIA 3AT1A 2LDYA 1XD2B 4EENA 3UD3P 1QTMA 3QPVA 2JLVA 3C98A 1NJ5A 4WIAA 3TP2A 5AFSA 4W92B 1JTFA 3W3AA 1CEZA 1RRFA 4DV4J 8ABPA 3W65A 1HMPA 1MMFB 1TK2A 1M7GA 2DBYA 4O3MA 2W6JA 1PT6A 2H5IB 4NE9A 5KQPA 2RHHA 1PZFA 1KARA 4QGBA 3TR0A 2JH9A 2V7VA 3KK3B 3LYUA 3H2GA 2DBVO 4F11A 4ZQGA 3TIXB 3KSDO 5K8TA 4BO7A 1RXEA 3BMCB 1EH5A 3OZSA 2GNAA 1IZZA 1CVJA 2G77B 4F91B 2FPUA 4MHTA 3SIPA 3PW7A 5KCZA 3V6DB 3LT4A 1SRQA 5G0VA 2CGEA 1X8KA 2ZZKA 4NDZA 4WKNA 1DAKA 2VZ0A 1U6KA 1BRTA 4LF8B 2HHJA 2BHSA 4GEGA 3OD1A 2NZ4A 1JEYA 4KIUA 5ED4A 1YRXA 5EZ6B 3AUUA 2YN4A 2CPEA 1AZWA 2WV9A 3W05A 1KQKA 5A8WA 4MDHA 3FW1A 2Q9CA 3V8NA 2MJNA 2PG3A 2NUUG 3UVEA 1NK5A 1UOQA 4CLXA 3WMXA 4OFZA 1Z4QA 3NAHA 2W0SA 3I34X 1SCBA 3JXEA 4MITA 2W8KA 1J5EB 1P60A 3M3PA 3OFVA 1VKJA 3FZEA 3TNVA 4FD2A 1FJGB 2CNDA 3QMWA 4DL6A 1VI5A 4WBFA 4YV1A 4RWZA 3KOAA 4F3MA 4RIHA 3B48A 4ZEXA 1U8TA 3WZ0A 1C1DA 1VHLA 3IV7A 1V6AA 1EGVB 1YJUA 3NPAA 3RUIA 2I65A 2CW5A 3ZIAA 1P2VA 4QOSA 1Y3KA 1TJNA 1VR6A 5DJBA 2XMJA 2ZRIA 4RZXA 2KBFA 1Q95G 4WJBA 4Y0NA 2VEDA 5GGYA 2YXDA 4JI6F 1Z16A 2MY8A 3GN2A 3UD4P 3X44A 5H81A 5D51S 2Y71A 4AMVA 2W6IA 1EQUA 4NK5A 5IEBA 5KT6A 3C19A 3HU5A 4NXNF 1NXSA 2JZNA 3QA9A 1SOVA 2K7JA 2BUAA 1SVWA 1UBHS 3QQCD 4M9ZA 1H2BA 4GKBA 2GK3A 2C9OA 2R8PA 3S7ZA 4FWBA 3TCXB 4J90A 3VAKA 1MQAA 4WLOA 1GFZA 1DC7A 4XD7A 2X2EA 3G0BA 4D4IA 2BBSA 1N75A 1A9TA 1W8IA 3D1HA 2W2PA 2R1TA 3E9YA 3A7EA 5J2UA 3FH0A 3FA2A 1ES9A 2C2HA 2PRIA 2PWZA 4NESA 4IFVA 3AYZB 1QRSA 5MFPA 2E9RX 4DUZB 2K06A 4V0OA 5D01A 5E3JA 3OLCX 2ACEA 3FDZB 1WCXA 1BZYA 1B8OA 4NPCA 4P93A 4G6VB 1F60A 3GJ0A 4AT1B 1H9CA 3C5CA 3MFQA 4ANEA 1ULAA 3HK2A 1FRMA 4LK2A 3EUEA 5ELLA 2CZ4A 2WYOA 4DL4A 5A1JA 1RWWB 2GVDA 4UEOA 4RQAA 4DSUA 1RP5A 5L9XA 2XVXA 1AS2A 1G1XA 2EEZA 3DYAA 3HBMA 1Q57A 1ZQ1A 4MTPA 3QEOA 4O1IA 5D4PA 4FQ8A 4DNPA 4NWIA 4W9MC 1PR3A 1Q8IA 4E09A 2D2FA 4J9RA 4XQGA 3THVA 1IFXA 3QLUC 4GRDA 4ZQCB 3D28A 1BQNB 4EKNB 5U4XA 4CZCA 4ZRNA 3FNRA 4IIFA 4RDHA 1Y37A 3FRJA 1G2IA 1N3BA 3SJBA 3G13A 5LOVF 4BVBA 3F97A 1N2CA 4WBNF 3DMPA 2X1GA 2Z3ZA 1WB5A 1PS0A 2EFVA 2WP0A 1ZMXA 2WU4A 1LRKA 3ON5A 4N47A 1W88A 5DEOA 1OH7A 3HEAA 1B8PA 4KDFA 2WBRA 2P5VA 1DAPA 5JO9A 1U0NA 1NOKA 2FPGB 1C4KA 4QUBA 4B6SA 4BHTA 4KMSA 4R8SA 5LSLA 3EZ5A 1U2QA 2DULA 1QIHA 1U2SA 3ROKA 3ILJA 5GIPE 4U8GA 3C1TA 3IO3A 5T64A 4HXFB 4ZTBA 4Y6RA 1YZHA 3O03A 3TMAA 3GR1A 1PKUA 4J0DA 1GTRA 1NM2A 1R9MA 2FOIA 2WIDA 4E6PA 4C78A 4MYTA 1SXQA 5EDWA 1XEFA 2ZCJA 4K9NA 2DYAA 1M2EA 1SHUX 5J1PA 2Q9AA 1TAGA 5IT4A 5LNK6 2HWTA 1N5LA 2ZSBA 1VK3A 3M8YA 2E49A 2V0CA 4NEQA 3QPBA 3S2SA 4UAJA 2FSIA 1K2VN 1FDIA 2YJ6A 2IXDA 1FTGA 5K0JA 1RA7A 3W5BA 2YL2A 4DDHA 3RRXA 1V6HA 1IIBA 2OXIA 3DUFB 4QPNA 3LUPA 2A4KA 2HKEA 3O95A 1L7NA 1E6VB 1ZGBA 3O74A 1A72A 2PPLA 1P62B 1T9GS 2Z30A 1DX6A 2MZJA 1NJ1A 4JT4A 2Z0GA 2J3MA 2PEBA 5DISB 4GI7A 5C1BA 4P10A 1E1MA 5FHRA 1SKRA 1ODSA 2ADMA 5HQ3B 3KAJA 1TMMA 4LMAA 1PBAA 5K8MA 1BXRA 3LP0B 3PUZA 3I2YX 2VBGA 3CZCA 2GMLA 2IY5B 1W5FA 3O8BA 3SQNA 3EZFA 3KYCA 1GZ4A 2H29A 3MILA 2HZAA 4YROA 1JJAA 2VTKA 3ZEAA 4BAUA 4LXGA 3I04M 3ZCRA 4FEEA 3VVLA 2QQEA 3LRXA 5FPKA 3PFWO 4KO3S 1Q7TA 1VJWA 1EKSA 3DTNA 3P9YA 5SY4A 2VLIA 4C8KA 1VGQA 3F96A 2FSHA 1B8VA 2CMKA 3ZD8A 2O67A 1QGZA 3GCXA 1CSEE 4EI8A 3PXCX 3MFIA 2OORA 1YVEI 4C5CA 2B7CB 2GCPA 3PDJA 1WMBA 3DBVO 1BXKA 4HTFB 4QG3A 2MJUA 4JI4J 1D9DA 2AKAB 3ZHUA 4E7PA 1OYDA 3HPRA 1HA3A 4CJXA 2EKLA 3IVRA 3KUUA 221PA 1N3LA 4M0KA 3OFFA 3N76A 4JVOA 3A36A 5E3RA 1N92A 5FPYA 2YQ1A 2QXUA 4EG7A 1GOTA 4K9OA 1J1UA 2FRVA 3U9SA 3FUUA 5B36A 4F1KA 1ISFA 4RKWA 3BEDA 2HVDA 1G7CA 1RZRD 3IAAA 5K3FB 3SZRA 4I81A 1CULA 3WLSA 1U2TA 2XGOA 3DM5A 3ERCA 2UAGA 1E63A 1U8FO 4PLTA 4MMXB 2XC9A 1GUYA 2JAXA 2VSXA 5FWYA 4BNIA 3T1YJ 5CFRA 3MXOA 4Q3LA 4PYAA 2VF2A 4BJ6A 2HIAA 3JTOA 5KCMA 3WWOA 4L7QA 4I8XA 1GVNB 3H4TA 5C3UA 2CJBA 1H72C 5IZHA 1DWPA 5FDLB 3CJKB 1YK9A 4NP6A 4R3WA 4GWGA 4WXOA 1TECE 3W2IA 5TY0A 2WIJA 1LS1A 2O3SA 4H60A 3PKYA 2OXRA 1VPLA 3VPHA 3VSCA 1N33B 3KTDA 3K70B 4M5IA 2A92A 3QIVA 3GQCA 3TOVA 3GONA 2JZOA 2JAPA 4MSUA 5EWLA 4EPVA 2VT2A 1ZRMA 3DONA 4YRKA 3QLTA 5BNTA 3NBFA 1XTPA 4KBYA 1I5OB 2VFRA 1W0JD 2ZRNA 4JI8B 1OY8A 4YT2A 4JP5A 1DC5A 2B34A 3IOBA 1I24A 5ETJA 1OKKA 4ZU1X 1M6NA 4Z1OA 1JAZA 2VXOA 2VHVA 1JU4A 3WKEA 5BPFA 4EY4A 2YYZA 5HMXA 2IW1A 5J2PB 1QFJA 2QRNA 3WYNA 2PFGA 3PCRB 5AXKA 2RDJA 4JQSA 1AF4A 3A12A 1F0XA 1EFCA 1NI5A 4AP5A 4BDPA 1C0UA 2RGUA 1U7LA 3IP5A 2JIPA 5A9TA 2O6LA 4R41A 4XOIA 2X40A 3C6MA 3THXB 2COKA 1WPQA 3TZZA 1QTQA 4M9RA 3FCUB 4OQFA 4CTAA 2AFIE 5C9ZA 3DEIA 3JD4A 5JYDA 1O3YA 3BQ9A 1ACLA 3U1VA 1SH2A 2DKNA 4TXHA 1YIAA 5EP2A 3FZ2A 4WDRA 3EQZA 1CNFA 3PKMA 2V74B 2RU9A 4ONEA 5B3JC 5KYKA 4KRFA 1YIJS 4NZYA 1TKTB 1XELA 1U8ZA 2FN9A 2FV8A 1AZSC 1N6OA 1PJ3A 3SC6A 2FIUA 1TL4A 4M53A 2BSXA 4WZBA 1YI1A 4QRHA 3SEAA 1QO0A 2PFFB 2WU1A 5G0RA 3HKEB 3K1ZA 3STXA 2AR0A 3SJCA 5E6UA 4NU8X 4OJ3A 1WPXA 1T1IA 4CYUB 1C9KA 3VC7A 4O4JA 4K6KA 3JQAB 4RVSA 3WJ1A 4OHMA 1VQKS 2DECA 2Y2UA 1Z5UA 4DA4A 2P4QA 2MLZA 1T9HA 4F2HA 4Q43A 2G4VA 4LW8A 4EW3A 3DCIA 3V6KA 2BR4A 1DURA 2R60A 5BPHA 4RA9A 3FAZA 3FVYA 3AXKA 3WDKA 3SQOP 1DHTA 3WTCA 2BCJQ 4ZICA 2ZI4A 2CMHA 4R71A 1NJWA 4D9NA 4MPTA 1M2OB 3ZZZA 2NM0A 3BXFA 3TRIA 5AOVA 1LQ2A 3L8HA 4JAVC 1KO8A 2GZ3A 4XKJA 4OHRA 1L3CA 3CU5A 1L5RA 1GGFA 3PEWA 1QDUA 3UQYS 1PHRA 1IY1A 5KG2A 3FQKA 1MNQA 4Y7CA 4HDKA 4RW0A 5KUTA 5D4LA 5D77A 3O83A 4MKZA 3GD7A 1JQAA 3LV8A 4PPNA 4LXHA 3KHUA 3NXZA 1TC1A 1E3IA 1Z4MA 3KOUA 2QLLA 2XMRA 1WXGA 5C81A 5F21A 4Z8XA 2EIHA 3A9UA 4E30A 1FEHA 1GYPA 1VHDA 4N5LA 3Q2IA 5IFKA 4X8OA 1O0SA 2HU8A 2F4VF 4JWTA 4LRFA 1SIZA 4CPDA 5AXDA 4OQXA 5LA6A 1OSNA 3K1JA 4O33A 5CXQA 1OT3A 2JH3A 3M32A 2ASYA 2FTRA 3T7AA 3HE3A 2BKNA 1TTHA 4H1UA 2JFBA 3FI0A 1DCTA 4PXEA 4D0SA 1M10A 3KLGA 4IILA 4P52A 4B40A 3O8CA 4REOA 1E2IA 5IV3A 2X9VA 1E96A 1OXKB 2IHR1 4YAEA 3HU1A 4TVAB 1GG9A 3FI9A 2OD9A 5JSFA 3GJRA 3QJ5A 2OB2A 2K2PA 3DFKA 3NHPA 4B3XA 3BEOA 1CDOA 4XVHA 2YDYA 5JARA 1SCJA 1Z8NA 4ZZ0A 3C8MA 621PA 4NAUA 5B0AA 1SJRA 1RWVA 3ICQB 1VDHA 5JFGA 3TZ6A 1PV1A 3AEKB 4KXVA 1N9ZA 4PRFA 4X65J 2EJVA 2RGBA 2QTZA 3HFVA 3O31A 1IYZA 1YVRA 2IV7A 2AP6A 1XRPA 3IURA 4BCDA 2LNDA 3QKSA 4HKQA 4HKTA 4C4AA 2E4ZA 1Y42X 3MMBB 4GDMA 4Q02A 4NE9C 3C24A 2CPZA 1XQ1A 4RTKA 4BBPA 4PRKA 2BR5A 1NXWA 3UPFA 3QT7A 4F7WA 4EGLA 1J2YA 3BR9A 4YCSA 3PBKA 2XNSA 2HMVA 4K4YA 3LBAA 2O3JA 2Z43A 3RNLA 1O94A 1TPZA 5KOHB 5JQGB 4OJNA 4R9VA 4MR8A 1J21A 1OD6A 1VCOA 1B0TA 3BOSA 4ZO6A 2Q0SA 1XDDA 4RD6A 2MQNA 3H9QA 1SUCA 1X4FA 2F8SA 1XKTA 3NEKA 1U1IA 1M6VA 3LGNA 4AM8A 1VXRA 3N6XA 4TM7A 2PUJA 4DMLA 3RJMB 1SA0B 1K0FA 1XA4A 3GI1A 3CC7S 3OCZA 3JQBC 5ERGB 3BO2A 2JEJA 3QEMB 2CXUA 2IC5A 5C51B 4QU9A 1LK0A 3FUVA 2FPOA 1HLGA 1OFGA 1RABA 2VDUE 4TKTA 1QHGA 1XNGA 5F3TA 2QJTA 1DRKA 1URNA 1ZN7A 1DKOA 3UHPA 3A4LA 3ITHB 4Q12A 4RMGA 2RHDA 1QYRA 4TT8A 3M6VA 4C7BA 3BZQA 2AFIB 3ZC3A 1ORVA 3RGGA 1A88A 3GLRA 2CG8A 4B82A 1HNZF 3H6KA 4BYGA 1KK1A 4KJIA 4MKRA 1RRKA 4MVJP 3KPUA 1TT7A 4NXMF 3I2GA 3Q1LA 2AN9A 3E2PA 2II6A 3PIDA 5IUJC 5CYMB 2I4RA 1J8YF 5BMVB 4DJDC 3FTEA 4I0WA 3AH6A 2PZMA 4D3XA 1L4GA 4MIAA 3K7EA 4S05A 3K05A 2C2MB 3SS8A 1ACJA 3RREA 2WJVA 2KM1A 3SDEB 3ENWA 5IYZF 4K2JA 2V7QA 2YFKA 3CPWR 1UMDA 1YB7A 3IA7A 2Q07A 4NSNA 3CVXA 4PZVA 1N8RT 3DW3X 1T2NA 2CEAA 1S79A 3LM8A 1D1SA 4FM9A 4S35A 3O21A 1L8XA 3GZ7A 4P92A 2NV0A 4CNBA 2X0FA 1FE8A 2FRDA 1S96A 4AQYB 1GFWB 4QR2A 5B7NA 3HWWA 4BHQA 4DFKA 5F4ZA 3ESDA 3V1NA 2BJ9A 4RM3A 1WKLA 2QY9A 3WHLA 3AFGA 1NFRA 1YOVB 3DTVB 3L0BA 4NG5A 3HBNA 2D8AA 2JGKA 3FRIA 4M38A 1O6CA 2YUTA 1UJNA 3PDIA 1M2FA 1R0WA 4WXYB 1ZVQA 1JX4A 5D15A 5EX0A 1H2HA 4WASA 1FKOA 1I3CA 2R6AA 5EZYF 4I3GA 4E08A 1RWMB 1EVYA 3C70A 3TNJA 2F3SA 3RIGA 1H22A 1V95A 1ZNZA 1Z4UA 2VBYA 4PY2A 3OURA 3V6MA 3R3SA 1YE3A 2NZUG 4AKGA 3LYAA 4H16A 1JA1A 3MT8A 2VS1A 1JH8A 4UEKA 5CD9A 1LWCA 2YFQA 2GVDC 1QSGA 4X0EA 2ZE7A 1XCGB 1WXFA 3OM9A 4YRTA 5KWSA 2H2AA 5D3KA 4F8RA 3UPUA 2PUWA 2XMQA 4IO1A 2X5XA 4YI5A 1I30A 4ERDA 5DE3A 3AXMA 2W8BA 2AEEA 5AW5A 3UMSA 3IG1A 2XOEA 4MWSA 1X1SA 4QHSA 4AL7A 1WKKA 1DZ3A 4LVOA 1P4JA 5F1KA 4YRLA 4F2PA 1CY7A 2MSCB 1NF8A 4LY0A 4LRAA 3BBPA 5KX5F 2VWQA 1NOJA 2IVZA 1QZTA 5AOAA 5GM2A 4J6EA 3ZU6A 3EPPA 4GXQA 2GVZB 4B84A 3K89A 3P2EA 4IDDA 1CBKA 3FUWA 3JVDA 1CG6A 1GJRA 1UXKA 2Y3YA 3GLHA 3GEHA 1T5IA 4GKJF 2Q79A 3RVLA 1QB7A 1UA0A 1DTTA 2VPYA 2OSQA 1N2EA 1QFSA 3P5TL 2VN8A 2WAAA 5DM4A 1S9HA 2SBTA 3RUCA 3L79A 4DR5F 1II0A 1K8AT 1RI2A 3RG2A 4GVBA 1Y5LB 2PS1A 1CS4B 4Z6KA 2HF7A 4YUDA 4LRYA 3ULKA 3ILVA 3PO4A 2IBTA 4KFCA 4X94A 1YMVA 4GGPA 4PANA 3G02A 4LF5J 2R66A 2R65A 3FUCA 3VYWA 4G0NA 2HBZB 1YQWA 3SLRA 1JAHA 3BD8A 3WYGA 3SSQA 3REOA 5JCJA 5B0GA 2OEJA 4JT8A 1BHSA 3RS3A 2HQGA 3PVXA 2VAXA 4H6WA 2KL8A 3ITKA 1AA1B 4BLQA 3MCZA 1VQSA 5HLFB 4TKUA 1NLYA 1T3SA 4JI3B 4YXWD 3DI6A 3I6IA 1Z5OA 3CNNA 5CMLA 2ZT5A 5FO1A 3SJUA 1QQ5A 3PEFA 1LW6E 1S8NA 3IXQA 2QN3A 3OVAA 2EZ4A 2KXHA 1Z6TA 2HHHJ 1NRIA 3BDIA 1GGKA 3U7QB 3UAXA 2OIHA 4IRDA 1GDHA 3R9XA 1YBMA 1LA2A 3JD2A 3QUCA 3ZZPA 4R68A 2NO0A 4WLNA 5ITHA 3CCQS 2QKYA 3R8FA 3LDFA 2L19A 3ENVA 3G2MA 3ZWOA 4DR2B 7FDRA 4MIEA 4OGGA 1GGMA 1U8WA 1Q0LA 3A32A 2J0UB 1E79A 3L7YA 1NBME 2PX0A 1NVMB 4IJWA 1FMJA 1MAUA 4XQCA 3DWGA 3EVAA 4JI7J 2QLMA 4DSOA 5K8PA 3HDGA 2IAJB 1UP4A 3DKDA 1YFKA 4RFLA 2FVPA 1H2ZA 2GSDA 1CRWG 3E5HA 3AD7C 2HT6A 4B09A 5EP4A 2W9AA 4IIJB 4YMVA 1XDWA 3QQ5A 2CQ0A 2QDXA 1Q3HA 2ACYA 3EQ6A 4ZTUB 3EOZA 4D97A 4PCAA 3TNLA 2XCOA 5H82A 4F67A 2QL7B 4R51A 4EZ6A 2XQVA 3BH0A 1ZWLA 5CXXA 4WGFA 5G53C 3IUEA 1S10A 3UMGA 5IM4A 5I4CA 3F4LA 4YYEA 5FQOA 3HADA 4KLCA 4CLWA 4G6ZA 3MECA 4B4DA 2Y1GA 2OLEA 3PPWA 3U44B 1XHFA 3OIFA 4J7UA 4PXBA 4O4IA 2X42A 3K9WA 2DTDA 3CLSD 2I7CA 2FE1A 3Q85A 3EUNA 2CQDA 2O0KA 1JZQA 4DE5A 5DRYA 4EG4A 1MAAA 2YXPX 5AJXA 4XWYA 3FFIA 1S8FA 2VTBB 3R7NB 4ECZA 2XEDA 1X5TA 2ZUDA 5E3AA 1M67A 2GEBA 1Q2UA 3PYXA 1UEIA 4HI1A 3K2EA 3GH3A 2G63A 1IATA 3ZGVA 2CZGA 5M2RA 3RQIA 3NCPA 3ZZOA 4IR7A 4EA6A 2PGNA 3TUIC 2NXCA 1FVFA 4OA8A 4HNGA 2QN8A 2PJDA 3GFPA 2OZKA 3PHJA 1NI3A 4EGFA 4F2SA 5HUQA 4EG8A 2XYPB 1ISJA 5H7XA 5AK4A 3S55A 3ILYA 4OLJA 5I8ZA 1Q7RA 2DHDA 2YWDA 1H6CA 2WSFC 1GGJA 4JBYA 2WJJA 1RPAA 3IUSA 5JZVA 3VJLA 2ZHOA 1CR1A 2CFTA 3WLLA 4MI3A 1DC4A 4ED0A 1LWEA 4ECUA 4XWGA 3R8CA 3I9OA 4Y2VA 4DFDA 1HG1A 2CE7A 4IJ5A 2G04A 1T3NA 3AM5A 1DC3A 2D1FA 5JAHA 1MC1A 3QUSA 1NB2A 1MEOA 4ZMBA 5F12A 2Y9PB 5EWMB 1NSKL 1HDGO 5B2FA 3TI0A 3AF6A 3MTDA 3LOPA 2YHIA 2OUKA 1R0BA 4J43A 2FMKA 2AKEA 1SIUA 1QVAA 3I37X 3MJVA 2HS4A 2JD0A 5KSYA 4ARBA 2ZM5A 3PUXA 1GPLA 1K5HA 3TIIA 3L8EA 4DV4B 3KBBA 1ZEJA 1E18A 3ZQJA 5I45A 2RIJA 2H5JA 2EK1A 2P1RA 3JCZA 3K0BA 3OTBA 1JBKA 1K6MA 2I76A 4R1OA 4COKA 4RLFA 1UBLS 1WXDA 3VQTA 2VPQA 3HSKA 2N4DA 4YUYA 1ZJZA 4HB2A 2FR1A 2P77A 3B53X 1JE1A 4DG8A 2B9EA 4HAOA 1V7ZA 2HCRA 4REMA 4B3RF 5IC6A 5JVDF 2PGAA 4AZ3A 4CBVA 1ENZA 16PKA 2CNKA 3P9IA 4TL6A 1VL1A 3AEYA 4TTSA 4GR9A 4L6AA 4MOWA 2MMYA 4AICA 4MK9A 4EHDA 1G5IA 1FTYA 2I3GA 3PV8A 4KSYA 2ZBQA 5FI3A 5ALYA 3INNA 4LI0A 5IJ0A 3TE7A 3ZI4A 3NB0A 5TJ9A 2AQ4A 4DWIA 1LU9A 1XPJA 2I9PA 3UNYA 2Q6LA 3VNBA 3EEYA 3E3LA 2VDMB 1NY6A 2RS8A 5LJLA 2YNMD 4DCUA 2OPHA 1JQBA 1OB2A 2H7XA 5JDCA 4FOSA 3UJBA 1Y63A 1GL3A 3TCNA 3C3DA 3LL4A 1P1HA 3NHYA 2WSSA 1DBIA 1RT3B 3AF5A 3W9IA 3ZTOA 1QQBA 2J46A 3JR3A 1S6PB 1EHWA 1M2VB 2DQ4A 3QMQA 3KHHA 1KNXA 4YJ3A 5CD4A 4HFRA 1I2MA 4B3DA 1Z38A 3V80A 4HQKA 2B8EA 3UYKA 3CUKA 3ILIA 4OTZA 5F8HA 4U00A 3IE0A 4HUQA 2A84A 3FVVA 1E6EA 1QQAA 4PXYA 3Q3VA 2OG2A 3RC3A 5LSRA 3DEAA 3IUYA 5JJIA 2QMEA 2FWMX 3WLAA 1NULA 3GLIB 3ETCA 1FXLA 3ZNUA 1DBPA 4DCJB 1NK0A 5DLQC 3D1OA 5AXBA 2E1CA 1SV5B 1HQUB 4WEQA 5J63A 3A9TA 4XPIB 4LZJA 1EUCB 4FFWA 3KKEA 3U3KA 4YR2A 2ZYTX 2C1XA 4AKHA 1CS0A 4RZSA 4ZA2A 3LVBA 2N3ZA 4N54A 3LFTA 3K4PA 3ASVA 4AY4A 2ZITA 4WX2B 2BE9A 1U3UA 3TB6A 2WHOA 3REFA 2ZE8A 2ZIEA 5KT5A 4H6VA 5LC1A 4TU8A 4NNOA 4BP1A 3F1KA 2I4NA 1KEEB 2IYAA 1L4KA 4YCJA 1S99A 2HEKA 3K9GA 1B2RA 4CIAA 1YIDA 1E9SA 5C0OE 1GUZA 2C0PA 4OMDA 1SUAA 1U49A 3HZRA 4AXIA 3AFHA 2J0SD 1I2CA 3AB4B 3H11B 1JDBB 4URXR 2IYRA 3BDVA 1FD2A 1JE0A 2WIFA 2DNKA 2G9RA 3I39X 1MB9A 1QVGR 1X8JA 3HXPA 2BEWA 1U0RA 2OYSA 3DZDA 4B3SJ 1VHJA 1PWXA 3LW7A 3OZEA 1K1QA 2W7AA 5SZKB 1OGIA 2F63A 2CPFA 1R4NA 4RD0A 1M83A 3GGGA 5LQCA 2FHKA 1FP4A 1LI4A 2EBGA 2G82A 4PVCA 2NXJA 1WETA 4F9TA 5DSXA 2XB6A 4HT5A 4D4KA 2H1LA 3H83A 3MGGA 1YDEA 1PNQA 1HNNA 1GAXA 1Z4PX 5EE9A 5ESDA 2HZVA 1ZK2A 2QSJA 4GHWA 1C8VB 2E5LJ 3NOGA 4YAWA 1O94C 3RBZA 4Q9NA 3DLEB 5E3PA 2W70A 1THMA 3V32A 5BWMA 3VVBA 5AKIA 1E7WA 3KV3O 2CLFB 2VRWA 4AB1A 2RDIA 4BY9E 1HHQA 1VLJA 2RH4A 5G0WA 1JKJB 3MPWA 3R4VA 1OWPA 3T1QA 1SZJG 5J4KA 2OFGX 4UQPA 1XOIA 3C2QA 4GOMD 3PGA1 2Z2LA 1IVYA 2QD1A 4IM7A 1BX3A 1O9GA 1K75A 2C0CA 1PNOA 4JGIA 1NPRA 1P8JA 1XYVA 4BZQA 4TS3A 5HFNA 3BMQB 2R8KA 4TTPA 5L4LA 1SXHA 2FW6A 2E9ZA 4IINA 1RTHB 2RHRA 3SQGB 2BFMA 1TYEB 2Y66A 2YHBA 4QLOA 4KN5A 4IIXA 2OECA 1W35A 4Z7JA 4K8OA 1FT8A 3U6KA 1HDZA 2BFDA 1RPTA 2O54A 3G9TA 4Y2TA 1QLJA 4QDZA 1C1HA 2G8NA 2ZYDA 2XTJP 2F1FA 2X5NA 4IG9A 3O7WA 5DULA 2FPIA 4AS3A 1CRLA 2ZB8A 4LOAA 4YMUA 3D6VA 1UDXA 2HWHA 1FNSA 4DSLA 3W8PA 3HBFA 5T14A 4AMZA 4NV0A 1M1HA 1U4OA 1FTRA 4HWSA 2JG3A 3RG6A 5KOXA 4MUHA 4TN1A 4IXMA 4RSHA 3OY2A 5BV0A 3DMNA 3DPUA 3DLGA 1PYOA 2FVYA 4TOIA 1U0FA 4YIKA 3MPUA 2J3DA 4AYXA 1I1HA 5M5BA 3HJTA 5EP3A 3ZV7A 1BXNA 3VKVA 3THRA 2ALJA 3L7DA 2V0GA 1RACB 3A2LA 3NHUA 4LIPD 5E38A 2C95A 2P6PA 3OAAD 3MM5B 2ZUEA 1XAJA 1IN7A 4BPBA 4PC6A 5JC8A 1XT6A 1GXUA 2GJKA 3JALA 5IAOA 2YIVX 3QRPA 3Q7EA 2FRDC 1TW3A 5D6NA 3PDWA 4N41A 4BNGA 4B9LA 4GO7X 1P17A 4B2PA 8ATCB 4ZP6A 5TNXA 2VNKA 1C0IA 1LLDA 2IM1A 3WBZA 4WLVA 2RJ3A 3G49A 4EMSA 4C7QA 1W76A 4TRJA 1NKTA 5AD1A 5ALOA 3C43A 1AG9A 4AL5A 3MUNA 4EJFA 3TD9A 4EZIA 1DRUA 3FPKA 3SXPA 1Q17A 2WMYA 4U39A 3CKYA 3D5MA 3PRDA 4KODA 3ZH9B 4NA2A 1T4CA 3GXBA 2TRSB 4BO9A 4E07A 2PKYX 1FU7A 4DADA 3TRGA 4C6HA 5BY2A 4JOQA 2CDNA 5BMOA 4U8YA 2CHGA 3PSHA 2Q9UA 2ZH6A 4IFTA 4RVCA 4ED5A 1SVLA 1KF0A 3KUHA 3R7SB 2IX3A 1Y81A 3A6LA 3H0PA 1Y1SA 3DR5A 4S12A 5GONA 2TS1A 2Y0BB 3IEMA 3EQ2A 2Y27A 4DR6F 1WXIA 2GO8A 2EG5A 4JI4B 1H4SA 5EJ5A 3WL8A 2OI2A 3QQPA 5DYGA 4OLAA 1NI4A 1RXCA 3MOJB 3ND7A 4O3NA 2B4OA 2VJOA 5KKCA 2EARA 4CQMD 5AJWA 5D5PA 1R1DA 1NKBA 4XCXA 3N8HA 4QOJA 3QZ7A 1UVIA 2VG7A 3OWOA 3AG5A 4FS8A 4HWKA 1ZZGA 1NN3A 5CVTA 2UUBF 3AETB 4QBIA 4LYYA 4Y9TA 2ZM6F 5IPFA 2FPXA 1XQXA 5TMDA 1QDEA 1WVMA 2X3UA 3IIMA 4CM4B 4LE1A 1E6UA 4LNHA 3VHLB 4BO6A 1NQAO 3O5AA 5CBKA 1Y7HA 4PAAA 2B2CA 3VKUA 3MWEA 1ZCAA 2EKNA 5ETNA 5MGNA 4ZT3A 3M1YA 4FEGA 4GXRA 1DHMA 2OC9A 4BN4A 3GGOA 3NKFA 1FUYB 4JQCA 4DBZA 1NH8A 3OFEA 4JROA 4I1VA 3P9KA 4CDIA 4FFDA 3OV7A 5FUMA 3TAMB 2VDKB 1ZGZA 1OFHA 4MCJA 4QTUB 1HMVB 1T0IA 3EUAA 2GS8A 4KV8B 1WSWA 2AQHA 1YV9A 2O7VA 1PWYE 5BVHA 1LVGA 3H5AA 1IK4A 4M6WA 5JVHQ 4H4OA 4DV2F 4OQYA 1R43A 1CUJA 3N07A 5HSGA 3DBOB 1QD1A 3RQSA 3VKFA 1G5PA 3JSXA 3QVSA 1GNPA 3VPXA 4CMBA 1GQRA 5E6RB 1NP6A 1TVEA 4I2QB 4F45A 3OTGA 3QWAA 4BS9A 5AXMA 2JGRA 1GTMA 3D6TB 2UV8A 2QR2A 1B76A 1IBKJ 1MX9A 4S3MA 1XZDA 2A5GA 4WXRA 1J22A 1KAQA 5F5NA 3CE8A 4K4WA 2J6SA 1NVBA 3OCJA 1IY0A 2N82B 1XC9A 5HMZA 1MU2A 4Q4HA 1HZJA 3DR3A 5BXYA 1N78A 1TAQA 2JARA 1RT2A 3K0FB 2XITA 1WELA 2UVDA 1HNVA 1WD6A 3BF7A 1WUIS 4Y8VA 4B7AA 3CF5Q 1WDWB 1KYTA 4M22A 2IL1A 3SLKA 3OLWA 5I5GA 1U4SA 2FHJD 5TPWB 3UK1A 3LNTA 2WAMA 1SG6A 5EL0A 4FVCA 1IKWB 1U9YA 5F9FA 1IEQA 3TTTA 3D59A 5AW8A 3FBEA 4ZOQI 4ER5A 2Q5LA 2DCUB 1B6SA 2OUGA 3PTLA 4ISCA 3T9AA 2GXAA 5B64A 4QYSA 3TSCA 3GV7B 3KCNA 4YB1P 3ZWMA 5AVYA 1HBUB 3SHWA 3RVDA 4JCCA 4DJAA 1X7XB 3F1LA 2JC0A 3C2PA 1KBOA 3IVGA 5J1SB 3W8FA 4L74A 1U0LA 4J03A 3UJ3X 3MB8A 2W01A 3KJVB 4HEQA 2DB3A 2ZUTA 4TMWA 4GP7A 3HNOA 4EQ6B 3ILOA 3AZQA 3RROA 4QGFA 2DR5A 4L2IB 4IMIB 1SFRA 2XXAA 3EGCA 4TQAA 5JASA 3WKBA 3W4IA 2IBOA 3O75A 3RKRA 2R7UA 1QM9A 4QYIA 3RRGA 3TTSA 1V5IA 5KVAA 1P9QC 2G36A 4KOAA 1LQUA 5CK4A 3DRPA 4KIWA 2QRLA 3J7YI 1U90A 3K09A 3ROXA 1KTQA 3RIEA 5J4YA 1YLXA 3UB3A 3K8ZA 4RY0A 3SXUA 4OV1A 3RC1A 4KLRA 1N52B 3JAMU 4NEYA 2DHGA 2FB0A 1KR5A 3EXIA 4I5DA 1W4AA 1NVUQ 2R6ZA 3KHLA 1YB1A 1JL3A 4ZVSB 1IN4A 3CCBA 4V39A 1D2CA 1Y98A 4NVRA 3O1IC 5CCLA 3SKVA 1RB0A 3IR5B 2VK8A 1GPBA 3CMES 4IW3B 4XSGA 2J5AA 4RTNA 2XLCA 3BL6A 3PA6A 2VPZA 3QOXA 4KVGA 2J7PD 1C4XA 3PU6A 2H9IA 5JFTA 4XASA 1PJZA 3BWEA 1RTJB 2JBHA 3TZLA 1SQGA 5HZKA 3MT0A 2YXBA 3GMGA 2B0JA 5DGHA 1NJ2A 3W1EA 3MQ2A 2J33A 4DSNA 2J4CA 5GIOE 1SL0A 3TDNA 3H2BA 4OFXA 4L78A 1Q1ZA 4BBAA 3KZKA 2CZCA 1HQKA 3W5XA 1J2VA 1J7KA 3QE4A 4K5QA 4LJ8A 5LBUA 1T4BA 3ADDA 1ZA2A 1RKUA 3K5NA 1HBMB 2ZQ5A 2ATIA 2ERXA 3PJGA 1N34J 1LDNA 5M29A 1TF7A 4H4DA 4C1NA 5ITZA 5JU6A 1VP3A 3P9NA 3LAKA 2FWJA 1BXGB 1L9XA 2V6AA 3GLTA 2R4TA 3DFFA 5KO2A 1WTCA 1NQXA 1C0KA 1ILWA 2BSQA 1DXYA 5LOQA 3KG4A 3D2LA 4C30A 3DHWC 2XJ9A 4QOIA 2IYIA 5AI4A 2XTZA 1VL0A 2AI2A 2VF4X 1TFUA 2B61A 3K31A 3EPIA 4IJ6A 1O95A 3R20A 3W5HA 3EDMA 3KP1A 1WC3A 1HYSA 1RI1A 4EG1A 3DZKA 1VRUB 4YFYA 3Q7IA 5FAKA 3CEAA 1IQZA 2ZTMA 3ETDA 4XZ3A 4X92A 4EWTA 2C1ZA 1KC3A 1GZVA 1EFKA 2HLDA 5CFNA 1SHJA 4INAA 3WMGA 2GA9A 2HMIA 3AD9C 3LKDA 3ZWKA 1ZJJA 2YMMA 3WNQA 1A0OA 3B4MA 4NLXA 3MLEA 2QVZX 1GNLA 4E15A 3SZUA 2B8QA 4GSLA 4X65B 3WXBA 2GKSA 4DBLE 4BOYA 3ACDA 1GXSA 4Q6BA 4EYIB 3L7IA 3VHRA 1E6YB 2YOFA 1DRZA 1GPKA 2FQYA 2CQGA 3SI8A 3GB9A 3RVMA 3L0OA 2LLZA 1CD5A 4QFBA 2VNJA 4C8LA 2HA4A 1RM0A 1ZN9A 1N0HA 3UGTA 2ZHAA 1WY7A 2QYGA 4OXYA 1SUEA 3VC2A 2ZJZA 5HR5A 1RJFA 1NYLA 2DY1A 2BHRA 3ANLA 3ANYB 3RVRA 2XNQA 3ABIA 5B0DA 4EFDA 1NK8A 5MGBA 4DLKA 1Z0IA 2R8BA 1G64A 1FJ2A 2A57A 4P36A 1GCGA 2PIDA 2JBAB 3FMOB 2WT8A 3I8XA 1JUDA 5ALPA 1PFQA 2FP4A 1XTQA 2PN6A 5DLGA 3KLMX 4PAGA 1NW7A 3C4QA 1Y1KE 4TV9B 4IVPA 2R3VA 4CVNA 2QGFB 3A9CA 2XMGA 2KRBA 2FSSA 3MYYA 5CDFA 5JI2E 5FA5A 4IQXA 3W06A 3WJ7A 2P78A 3QT6A 3LCRA 4KMMA 8MHTA 4J0QA 5JDCC 3BQ0A 4OD0A 1HL6A 3ZVMA 4X4TA 4ASUA 3TKYA 4Q2MA 1VKNA 1TL7C 1RHKB 1MB4A 2ZH2A 5GJCA 3JTEA 2NU6B 1TUGA 3BH7B 1VJTA 2ST1A 2FNAA 1S48A 4O2AA 4YY3J 4H7KA 2O2EA 2JFPA 2BE7A 3CZRA 3OT1A 1FFAA 4R84A 3OE5A 2C2XA 4NBVA 3NXKA 3AI3A 3KT8A 1VQ4S 3LUAA 1NK6A 3UOAB 3FX2A 3HS3A 4AP6A 1YGPA 1JLGB 3F5SA 2AC4A 4QUEA 3VH2A 4N65A 4TTVA 1OZFA 3IODA 4Y2JA 3V4SA 5T4BA 4DN0A 3OP4A 2GARA 3PICA 4BGVA 2GZMA 1QVVA 2MTLA 3CW8X 2EDCA 4XPZA 2AL7A 1SC4B 2HRZA 1FFWB 4TN2A 3TINA 5JMOA 1G9TA 5DLPA 1WHVA 3DAHA 2H54A 2Q45A 4MRNA 2GBFA 1AY0A 4DMRA 3DBRB 2GAFA 4A6PA 5CCEA 1TYDE 1HETA 1Z37A 2JAOA 1BCRA 1C4WA 2Q5FA 4LI3X 4AG6A 1IN8A 4WLUA 3R8XA 1NDHA 2JAWA 4IQMA 3FHJA 5E4YA 3ENKA 4OOEA 3BBLA 1MAHA 2N0SA 2EZUA 5HO4A 5C31A 2JJ2A 4NV3A 4BMXA 3NIFB 1Y3HA 2AYBA 1M7BA 4QHTA 2AD1A 2CMFA 3CCCA 4LFAJ 1IHDA 2L9DA 1VQ1A 3R5HA 2R4FA 5KNBH 3RSCA 4ALNA 1PG0A 2XZWA 2BHNA 4ACAA 1AGRA 4DZ6A 1F2TB 4CUKA 3T94A 1V5WA 4PQUA 4C8MA 4ZCTA 3P52A 4MICA 1UT5A 3C7KA 3B3AA 2H4YA 4JSRA 5BW6B 4IDQA 4DA0A 3HY3A 4P4GA 1A7GE 3EE3A 4L72B 5C7IO 2X1FA 2HJRA 5ETKA 1XB2A 2KJWA 3EGEA 3EGDB 4CLZA 4GO1A 2IEIA 3CJSA 2XGQA 5FPSA 4N0PA 1R66A 3LLVA 1NJ8A 1TFWA 5K14B 3HYSA 1V3RA 4NLPA 5CYQB 2B92A 4EKYA 1ZK0A 3GFBA 2P40A 4WA7A 1HK7A 3M8SA 4AJOA 2WJIA 5IKEA 3NBPB 3HR8A 3UG7A 2JAUA 2C2OA 1WX1A 3D0GE 1ZL2A 1PC4A 3KQYA 2AEJA 3ORRA 3VR1A 4HB4A 2Y4NA 3QYFA 5CX1A 2AZDA 3PFEA 4EY7A 2ZVJA 3I1JA 4QULA 2XSJB 4MVCA 2A2CA 1FL9A 5DZSA 4OF4A 4DX8H 1GPWB 4LCJA 2ZBFA 2PV7A 2GDJA 1AA9A 5EMMA 4A5OA 1DAGA 3V2GA 3ET6A 1IMOA 4K9RA 3I82A 1JIQA 3ECAA 4RTRA 2B1QA 3H2KA 2WAYA 1A2OA 1GZ5A 2W9CA 2GIQA 3HCDA 1W87A 3QU5A 4G9BA 2QX9A 3KNAA 3DDZX 2IBSA 1L7PA 3IRXA 3S2YA 2Y93A 4WINA 2WR8A 2C5LA 2P62A 4UUBA 3B82A 2UP1A 4BV2A 4BAZA 5T41A 2JH8A 3R24A 3CC2S 5J2MA 2PLWA 5JG7A 5CM2Z 4G1IA 2CVOA 1UMBA 2BWJA 3I2JA 2VA2A 4YP3A 1S12A 3DRYA 3PC3A 1PHPA 2GJIA 4FBLA 4EHHA 4MKIA 1VKHA 1W73A 3F7NA 3F44A 1XTIA 2TYSB 2HK2A 2BKUA 3B13B 2OCXA 821PA 3R74A 4TWIA 3ZWBA 2BZGA 1D2HA 2ORWA 2M88A 1DQPA 5KWVA 3M6WA 4R1MA 2IPAB 2ZYUX 1WCYA 4X1KB 1Q78A 4BE7B 3K71B 2P9FA 1ULHA 2CHVA 1SZDA 3MN1A 5FL3A 2VHWA 4YJ2B 4K7JA 1DDOA 4N56A 2BD0A 3OE7D 1AW0A 3TMKA 2DK2A 2JHPA 1FNOA 2R8HA 2MSWA 2OP1A 4GNRA 1ITZA 2OQIA 1KI9A 4F0HA 5CDHA 1W1WA 2QAJA 2HHHB 2VFUA 2KTQA 1Q0PA 1J99A 3AUJB 2XCPA 3KZOA 1ETHA 2C7GA 3EE6A 3TZHA 4OLOA 2X1BA 2HF9A 3RFXA 1ARZA 3OQJA 3QVLA 1DSSG 1JFTA 3EEIA 2PUTA 1KFBB 3H19A 1NU8A 4PG4A 3T5BA 2CJWA 1NLUA 5BUZA 4JI7B 4Q0BB 1WOPA 2HBYA 4ZARA 3MAAC 4EFLA 1TL1B 3C87A 1XTBA 1KDNA 2X5KO 2KMLA 4D9BA 4NBWA 1IWGA 5DM6Q 4ZKAA 4RVFA 1I8TA 2E6UX 1RAFB 1CB7A 4C6SA 4BNDB 3I9FA 3A1SA 3R6GB 4J9SA 2ZBPA 4KVZA 1JEQB 2EWMA 2C4NA 4KSCA 5EAIA 1GNKA 2OPPB 1S1UA 2GD0A 1WKJA 2W6NA 4OX9Y 3KDOA 2GVNA 3K35A 4IKEA 1COWA 3SKYA 3K0CA 3W04A 1JDSA 3CXRA 3RUPA 1GNSA 1KQFB 3NAZA 1RHQB 1QCYA 4A46A 5DX1A 4KACA 4Y65A 4MR9B 1DAOA 2F9FA 4QRDA 1CQZA 4KIAA 1UZLA 3IDZA 4KPUB 3KB1A 4IIBA 4JP3A 1SVDA 1M1YE 3FMIA 2BQ3A 3V8RA 3GIWA 2XWXA 2WC1A 3HVJA 2JJ8A 1VL2A 5GTDA 1RPNA 4PZEA 5K0ZA 1I3KA 3WP0A 1KZYC 4WADA 4UTPA 4FR5A 2IE0A 2B4QA 2C4KA 4B73A 1O97D 3RIYA 3JYOA 2GI4A 3W2WB 2IYFA 1MG0A 4E0BA 1U2FA 4LHZA 4ZJZA 2ZWOA 1YJCA 1L7MA 1MWQA 4F04B 3GP5A 1BNCA 1PR1A 4PG8A 3VZIA 1VLHA 4PC3A 4WESA 4C4WA 2JLUA 4DS5A 1VQ7S 2IOYA 3FCAA 1T8RA 2FLKA 3TG2A 3B5IA 3HVKA 3BQ1A 1IUJA 3RK1A 3VMMA 5P21A 1CZRA 2RH3A 3FGOA 3H84A 2WJPA 3CF0A 4G25A 1Q7EA 1REVA 2HQSA 5IOLA 4K4VA 4MROA 2FXVA 2VAWA 5CH7B 3OMLA 1GDTA 4RA6B 9ATCA 4EVRA 3VO8A 4JS0A 3D3JA 3Q8WA 3RTVA 3L8FA 3HGQA 3GJZA 2NQ2C 1NMSA 3HT3A 2N7YA 3E22B 4K59A 1VCHA 1CUSA 3D4LA 3DOCA 3TLBA 4DG1B 4YEDA 1ULTA 5FR1A 1EFRA 4B3CA 4A8KA 3K2YA 3C7DB 1GIAA 5JWRA 2HLPA 3LQ2A 3NC0C 1KVQA 3IVCA 4GE0A 3PT5A 4OHKA 3QLHA 1E1RA 4Q8FA 4B4UA 3WGTA 3VNVA 1W5TA 1VGRA 1XERA 1NBMD 3ASZA 3VR2A 2OCPA 1JNRB 1TMGE 2GTIA 3WWDA 4HLCA 3COJA 2FE4A 2VYVA 1Q3KA 2G71A 2ZXFA 1RHJA 4WOPA 3ZTRA 4FYVA 2J87A 4FEYA 3A3NA 4EA7A 2X0IA 5AVVA 3IEPA 2XADA 2B6HA 5CXTA 1LWOA 2W9XA 3NHSA 3QKIA 1PTKA 4K40A 3UPTA 1MV5A 3MM8A 4PPZA 2Q4TA 4UHKA 1QRDA 1IH8A 5LLSA 4MQLA 2JEFA 1OX4A 1K6EA 2QJOA 2FMUA 8GPBA 5T6BA 5C24A 2HMYB 3OF3A 4B80A 2F1JA 1CU1A 2O7NA 1FVQA 2A9JA 2OJ3A 2JCSA 4KGZB 1SCUB 4E5PA 1V7PC 2J9DE 3D1VA 2NVUA 3DXFA 5TB5A 4AF8A 2RFLA 4JU8A 3D43A 3SIRA 3T6KA 1JDUA 4QGAA 2EP8A 1DTQB 1C7FA 2HRUA 1F8YA 2WUGA 4EMUA 2GGSA 1WHSA 3JX9A 5DQGA 1Z36A 3OPNA 2YPZA 2BRUA 1XPOA 1SUBA 1LJ8A 2ATCA 5KVSA 2BOVA 4PVDA 4MWBA 1WOMA 1BHJA 5F5XA 1Y82A 2HS3A 5K5EA 3ETGA 1KIMA 3ZZNA 1XU7A 3KJXA 1PE0A 1CQIA 4O4LB 4BNJA 3NZEA 4PAQA 3T06B 1ZJYA 1ZINA 3M2UB 3IBCA 1KRWA 2F1HA 3HWSA 4TGLA 4IG3B 1RC0A 1N5IA 1BGVA 1JFVA 2VC1A 1SCKA 1YULA 3G2JA 4O2BF 3EFOA 3TGPA 5FH9A 1KS2A 3EFBA 4ZC8A 1U31A 4XR9A 4RM2A 5AVUA 1CB0A 2D7CA 2XBPA 1XZEA 4OYPA 4WD3A 4CKEB 2VKQA 1F5BA 4L8FA 3THYA 2BKLA 3B2NA 5DXJA 5KFKA 2JIBA 2GC8A 3BXGA 3JD0A 3MZIA 3EA4A 1U94A 2BRLA 3A4MA 3NPMA 1GQ2A 3N0TA 4QU7A 1MN6A 4MYDA 4QSHA 3GUUA 4CCHA 1C9YA 3LP2B 1V4BA 4ZU3A 2C2ZB 4IOJA 2DGXA 4J91A 1PBTA 2BI4A 1DKMA 3LHDA 1JXEA 4QQFA 3AKCA 4I3FA 3K59A 4P3XA 1RBZA 2M70A 2Q4RA 4ZPVR 4YRDA 1HW9A 1B0VA 2PXAA 3ZY5A 3J81k 4KSBA 1ZPWX 3PJFA 4KQHA 4Y2RA 1TEZA 2QBYB 2WSYB 4KQ9A 3LKBA 2VJBA 4ILEA 2ZFHA 4FSXA 2WJHA 3A6FA 4LZAA 3O94A 3D6HB 4Z3OA 3RYFB 1T26A 1RBLA 4YP6A 3IQFA 3I2FA 3NNSA 4DNFA 2DPLA 1M1YB 2Q5OA 2IS4A 1IUKA 1JR6A 4XR4A 1XZNA 3QBCA 3HEMA 3VHXA 1O95C 2VQEF 3TK1A 3K0EA 1FFEA 2HF8A 1VPEA 3HSJA 2ALYB 3TZBA 3FROA 2FGCA 2WKWA 3A13A 1U1GA 2B7BA 3TSYA 5KNDH 5ULLA 4M1MA 3MC1A 4RELA 2JOQA 1WR8A 1T8TA 4J0GA 2P5YA 1SULA 2PUVA 3LPMA 3QFRA 1DBSA 2QPAA 1LJUA 2JFGA 1HFEL 1RTKA 4BFVA 4DPKA 2W9BA 4B3SB 3JQFA 3BBBA 5FA6A 2E87A 3EBOA 5HFAA 4RJTA 1KTIA 1IM2A 2ZIGA 2XSFA 2GIFA 1I7NA 5KYUA 1X14A 4TS4A 4UDXX 2FC8A 5IC5A 3Q87B 1B64A 4WP3A 3NDRA 3KK1B 2ZC4A 3K94A 3DC7A 3O8OA 5JAIA 2MEWA 4Z9AA 2E5LB 5IDWA 5A4DA 5I48A 2D3TA 4RFVA 1RQGA 2GOYA 3DL2A 4EG0A 5LYJA 4LOJA 2HPUA 3U13A 3FIUA 4CLRA 2M0GB 3NKVA 4UBJA 1H2EA 3HN6A 1FEZA 4QT0A 2E0IA 2ZB3A 5KFEA 5D4OA 2ZI6A 4KO2S 2E44A 2ZWMA 4M5MA 4Y98A 1QZXA 2QLBB 4OK6A 3ZK7A 2FW0A 3FOWA 4BB0A 2MPUA 4EPTA 4DL7A 1XLVA 3WFZA 4KKXB 4XFDA 2JAQA 2VPXB 1RADA 1HIYA 2JLCA 3VR5H 1XN1A 4D9GA 1U6JA 1OZAA 3WKCA 2V6BA 3Q2TC 3VZQA 4DL0C 2AX4A 3L9WA 1NN5A 3RFTA 1NG9A 2VCYA 2I0XA 5F9HA 2PYIA 2M8DB 4YMIA 3AFIA 1RZUA 3FVQA 2C3MA 5EC8A 4MDEA 4M5JA 3M89A 5L9NA 3VALA 1K4MA 1FK9B 3RW7A 1W47A 5J2TB 3EW7A 2VJLA 2W22A 2B4YA 4IR9A 4EF5A 1ZUNB 2PH1A 1YQUA 2P68A 1X7YB 3OX2A 2XNRA 4CO3A 4MV5A 2C2KB 1TMJA 3BDPA 3G71S 2QLWA 5AHOA 4CDGA 4O0MA 2C7OA 2Q8PA 4G5QA 4BPRA 1F2GA 4EB0A 2YFHA 2L69A 2VP0A 3DV0B 4N9QA 3TL6A 1GYQA 5JUMA 2F43A 2QY6A 2H8GA 5J2QB 3JWIA 2Q2VA 3W9YA 1W29A 1H2FA 5NULA 1NWHA 5L95A 4BEBA 1IWAA 2PKWA 2RJZA 2O8BA 3RBVA 3QFWA 4GSYA 1X94A 2XD4A 5AM3A 3TVTA 1Q2XA 3GRPA 1U5BB 3PQCA 1NBEB 1T1SA 4X66F 2FYTA 3PNOA 2AHOB 4QZVB 3AONB 5DNAA 1OAAA 1ZD8A 3L9XA 2JS7A 2JVIA 4OAOA 3E3MA 3PI7A 2OMEA 3UAOA 5IAAA 2KG0A 3O8QB 2AIRA 1PK9A 1HI8A 4HL6A 2B4UA 1CZLA 4PZPA 1ZVKA 1E7QA 1IKVA 3LWBA 4ABYA 3ZLUA 3NOCA 3CMMA 3TZEA 2NN3C 2O2CA 1E3SA 1KNZA 2W1BA 2IZZA 4C3UA 3PQEA 5EE0A 2EF0A 2X0DA 3VI3B 2WFLA 4RW4A 3GAZA 4GOOD 1M75A 2R7XA 4KFSA 3ZGOA 3GOQA 4I2NA 4YK7A 3BRSA 2JIMA 2A8YA 1F9FA 3VVTA 3CSSA 1EAMA 1TUBA 2A0XA 3NGKA 1PQUA 1G7TA 3I6PA 1QMPA 3DLPX 3C1UA 3ZKWA 1KTVA 2C04A 3GLIE 1AHNA 4YP7A 4C3VA 3ZV3A 2IKSA 2VTEA 3DVLA 3LNCA 3THSA 3A14A 4YN3B 3WGKA 2MSTA 5K5MA 3WIBA 4XDDA 3R5XA 2FPPA 2MJLA 3NL0A 1U48A 2OORC 4FYPA 2I33A 3CCLS 3NAGA 4DARA 5AVQA 4EO9A 1MDBA 3RYIA 1SBNE 1SC9A 1Q77A 3LW8A 3RF6A 3G0OA 3L9ZA 3F3YA 3UMYA 2P3QA 1HTTA 5ETRA 2KZZA 1Y4SA 3C1AA 1X15A 2YS7A 3TQFA 2JI7A 4GKKJ 3ESCA 3QXSA 2M1ZA 4HVLA 1YJWS 1U1DA 5JT1A 2I1QA 3FBGA 1NB7A 5D87A 1WPRA 3G3EA 3PX0A 1B1CA 2HBRA 2AZTA 1DQYA 1UDRA 1CULC 1E2KA 2GZSA 1T5SA 3EWIA 3O7MA 4BNWA 2A86A 2ZNZA 1BD3A 2QHXA 5EXXA 2YJ5A 4YDQA 1AZTA 1LNQA 5HYVA 2J76E 2H18A 3M1LA 3OIDA 4J7AA 4R8VA 4GBMA 4KO4S 1QG0A 2W42A 1VBZA 4I9GA 4OHWA 4PXDA 1G0NA 4R6WA 1KFDA 1MX5A 2W24A 3WC2A 4Q3OA 1TZCA 4LE0A 1FTCA 2QX7A 3HYTA 1T9KA 2QE7A 1P2GA 1HNWF 3S0JA 3KEMA 2V1UA 5KZMB 1GZHB 5FUWA 1CDZA 4LHWA 1P6TA 1GGVA 4P71A 1IBKB 5GOTA 1VSTA 4J29A 2ANCA 2G5GX 5D4NA 4GC5A 1OV4A 3OD2A 4LRSB 3W5VA 3ECSA 1FRJA 2MKCA 6REQB 2J8ZA 2SICE 2YV2A 1ESMA 3F6RA 2DCMA 3M8RA 1RT1B 2YH2A 5H16A 1O8CA 5KOYA 4R7GA 4EKEA 1UKAA 5EEGA 2R8OA 4JUCA 3MEGB 1T11A 1NT2A 4LF6F 4TRNA 5CXUA 1XDSA 1N5JA 3EZLA 1EE2A 4JP2A 2Y05A 2LFVA 4X64J 5G1PA 2FGOA 1H6DA 1JAXA 4JV5J 2HW3A 4HK4A 1RK8A 2AJ8A 1JMVA 2A2ZA 4HQRA 1CETA 3LZ6A 4FYKA 4FN4A 2H4FA 4NLLA 1B74A 2O3QA 2ZYGA 4MMZB 2XZTB 3AD8C 4QIGA 2JGDA 7AT1B 4ALKA 3LIPA 2CF5