1M0SA

Northeast structural genomics consortium (nesg id ir21)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribose-5-Phosphate Isomerase A
publication title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21
rcsb
source organism Haemophilus influenzae
total genus 72
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m0sA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m0sA01
3TUJC 3ENQA 3BXGA 2J0WA 1U8SA 2P9EA 1FQOA 1LKZA 3IXQA 2LVWA 3OC6A 3NZEA 4L4ZA 3TX2A 2PC6A 1NE7A 4GO1A 3BXFA 1PSDA 4IO1A 2I9SA 2LQJA 3TUZC 3E7FA 3OBIA 2NYIA 1HORA 1SC6A 3LHIA 3NWPA 2R5FA 3BXHA 3DHXA 2BKVA 5HJ5A 3MTJA 3E15A 3O1LA 2J0EA 2O0MA 3CSSA 2JOQA 3MAHA 2DTJA 4OQQA 3HN6A 3LWDA 3L7OA 1YGYA 4X84A 3AB2B 3TUIC 1CD5A 1UJ4A 4OQPA 1ZPVA 1HOTA 2CDQA 3N0VA 1RWUA 3LUYA 4PWUA 2RQKA 4L5JA 2F8MA 2BKXA 1VL1A 1DEAA 2JHEA 2OKGA 3KWMA 3K5PA 4LUBA 2GNPA 3OFGA 2H9ZA 5JJBA 1FSFA 2F1FA 3LOUA 4R9NA 2RI0A 3OFEA 1LK5A 4L4YA 4M8LA 3OFHA 3ENWA 2QMWA 4L5IA 5FIIA 3DHWC 2QSWA 1Y7PA 4GO5X 3ENVA 2WU1A 3ICOA 1FS6A 1UJ6A 1LK7A 5IS2A 4NMLA 1FRZA 3AAWB 4R7TA 2FGCA 4TM8A 3S1TA 1YBAA 2DT9A 3U7JA 3BXEA 2RE1A 2QRRA 2RQMA 3KV1A 3AB4B 1Y89A 3CH7A 1M0SA 2MDAA 4GMKA 1FS5A 3NRBA 2KO1A 4GO7X 5IT4A 3DDNA 4L50A 2P9CA 3CEDA 4TM7A 1XTZA 2PA3A 3IBWA 5T41A 2RI1A 1O8BA 2J0XA 3UW1A 1PBTA 2ZHOA 3HHEA 3OFFA 1JT9A 2QMXA 3EB9A 1UJ5A 3W7BA 4L51A 2P9GA 2W48A 1KS2A 3P96A 3MWBA 3DC2A 5IT0A 3EFBA
chains in the Genus database with same CATH superfamily
4U2KA 1NR7A 2R6DA 5B7QA 1JHPA 4LE1A 4CL3A 3HA7A 4H4CA 2PUCA 4KAJA 3K8QA 3OHBA 2YNHB 5J5CA 1PT9A 4RW7B 4GQIA 1JEDA 2FJBB 4BV8A 5KKAA 3U9TA 3TLMA 1AH2A 3UH0A 1IR2A 3KZVA 5CEFA 1O6FA 3PBKA 5IBCA 2G1KA 5E7QA 1E1KA 1MN9A 5EHQA 1SBCA 3TLXA 1EM6A 4M1WA 1XA3A 1W5BA 5CD4A 4NAUA 1H4VB 5DNAA 3R5GA 5ISMA 4X94A 1DKUA 4LV5B 3UMCA 2GQ2A 4TSFD 4IICA 5HAOA 4G0QA 2V7QD 3DMNA 2VBCA 4F97A 5EJGA 3KELA 1G5RA 1UMKA 3GLHE 5JFTA 4NLWA 4NBNA 4B82A 2YNIB 3H40A 3B8EA 3HP1A 3C5HA 4MEAA 3RRNA 3W9SA 5EESA 3BDAA 5JARA 3L84A 1S7IA 1RBYA 4J7AA 1REVA 3FBEA 3EZFA 5C35A 4QU6A 3K0FB 1PDWA 3IA2A 2VF5X 1IEVA 4OHPA 4L8LA 1N8RT 1NHVA 2Q49A 5LT5A 2VHYA 3ABQB 4C05A 3W3AH 4UBNA 3F78A 1KQKA 2A7XA 2X7XA 4R3WA 3DMYA 3TVZA 4H0CA 1U81A 4OHUA 1T5BA 6REQA 2PMFA 4PUOA 4H4KC 4UMFA 4HZIA 3UUGA 2X0FA 3JYTA 4BOYA 2WWYA 1DXOA 3FCUB 3AM1A 1K89A 4EDHA 3TX0A 3O91A 1ZVKA 4CETA 4AX4A 4QWWA 3TFWA 2Y67A 4IIEA 2PSEA 2Z8YM 3H25A 2H31A 1KOHA 4NJOA 3BIXA 2C2HA 4Z7NB 2OP1A 1YZGA 1T1IA 1LX7A 4Y1RA 1Z17A 1E9AA 4CCYA 2RE1A 2MYTA 3BIFA 2BFWA 3QLUC 3VUEA 1HL3A 4LW8A 3T9EA 2BBTA 4WFJA 4ER8A 5KFHA 3SKYA 4AK9A 2YYAA 4EPYA 2IZOA 1TECE 2HO5A 1LC3A 2NUHA 2P40A 4LV8B 1QSSA 2FYXA 1FP4A 5E2BA 2WAXA 5HF6A 4H1TA 4D4HA 5IEBA 1AS3A 1XFAA 1R3UA 3DKKA 2ZSKA 3KXLA 1L5HA 3GPLA 1UEXC 2IEDA 4ZHRB 2R1ZA 1VMBA 2BACA 1KJJA 5JFOA 2SCUA 2Z4SA 1GL3A 2CL6X 1DGQA 4MH8A 4M9UA 4XDZA 1S01A 2HBRA 1UT6A 3M6MD 3KMQA 3IQHX 1EE1A 4E5SA 1TUBA 1BYIA 1P91A 4URGA 4TV8B 5JCZA 2EQ5A 1FUUA 4EHDA 4OZ1A 1BAPA 2Q99A 3NCPA 2R8XA 4D4LA 3GFXA 2FSFA 4C2BA 4H17A 4CM7A 2M1ZA 4XQCA 1SXHA 3MTQA 1PQUA 4JVLA 1PT7A 4KXXA 4B3OB 1JQBA 1ULRA 2LECA 5HVHA 1A7GE 1H9CA 3W5BA 4RNDB 3KKPA 4J29A 3HEBA 4RPFA 3ND7A 3Q2OA 4M5GA 2X8JA 3OZXA 1CY8A 2DFKB 5C31A 4H27A 5FLEX 1N32F 2CLMB 3HBMA 2HHHF 3RFXA 2GSWA 2F1OA 3DF7A 3T3PB 3IJPA 1N1EA 1J07A 2XMZA 4KDCA 4BNYA 2P4SA 1JPNA 4O1IA 4V0ME 1O95D 4OKNA 4Q16A 4WK6A 2BDPA 2PH7A 4RVGA 1ZPWX 2DGTA 4Z51A 3R3WA 2AN4A 3EIHA 1BHSA 3I04A 4ZPBA 1JJBA 1XMQF 3GQVA 3ON5A 3BRWD 1N5VA 2L0XA 5D4OA 2H06A 4AXXA 1PWZA 2ZANA 3ODPA 4UZCA 4F4XA 2KI2A 3CNQP 4A82A 1IUKA 1SAYA 2W2TA 3EOBI 4WQMA 3IOEA 2AUTA 5EYPB 3F4KA 4OI3A 4X4RA 3H13A 3R7AA 2MHCA 3EIFA 4DIUA 2R4QA 1BWEA 5BSFA 1N78A 5AUNB 4X66B 2ZBQA 4DV5B 3K73O 4HY3A 1VLMA 4C0KA 4D9KA 4FF1A 4ZI7A 1B74A 3HSYA 3M5DA 2NR0A 4M8IA 5TPZA 5IT0A 4FONA 4ZKEA 2GAOA 3M2UB 4BE9A 3EG9B 3F9RA 2C3PA 2LEPA 4B4VA 3HPQA 3JPYA 3MMCB 3T0FA 4D4KA 4CLKA 2XXBA 2FPXA 2QJFA 4IH1A 3AI2A 3H1FA 5B6JA 4WTYA 3IULA 1VKHA 2PWBA 3JRWA 3RREA 5EMHA 2C2BA 3O0DA 3H9EO 3DMJA 2W9BB 3EUAA 3X1KA 1C8KA 4F6RB 1E5LA 5ECWA 3S5UA 4B02A 3K1ZA 4DMLA 1T5IA 1TM2A 3HDTA 3IIEA 2VP4A 3RT9A 4G8CA 2AGPA 3EDRA 4JFAA 4TYMA 3EXHA 5B1YA 4QDTA 1T4DA 4TMFA 4EL5A 3EPKA 2C4TA 1U94A 3PSHA 3AI1A 5F1PA 2HS3A 5GMEA 4RW9B 4YMVA 2CNLB 4HQ0A 3LH5A 1IJKA 1GX6A 4OYLA 2GEDA 2DUJA 1G291 3RAMA 2XV1A 4KQIA 1U90A 3TW6A 4HDRA 1QO0A 3TAQA 2NCKL 1ZRMA 3SQNA 4NFHA 3HH8A 1FQWA 2R8KA 3NHRA 4ENRA 5DYGA 2QTWA 3OQVA 5K14A 5K0LA 4YJFA 1H2RS 1VMKA 2QAJA 5JZSA 2NYVA 3PE6A 2LDIA 3IIJA 1E77A 1ZH5A 1HPZB 2HLUA 3MCTA 2HPVA 1RWPA 4LYDA 1P39A 1QSGA 2YY7A 2PX5A 1YGPA 4YMHA 4GX5A 2DCUA 3DZKA 1GR0A 4Q3NA 2R7NA 2QQGA 2XZDA 2G9UA 1XXHA 4PNZA 1N1MA 3AIOA 2OV1A 4LOHA 3RS8A 4DDKA 4UAUA 1K73T 4Y2IA 1N7GA 3LKZA 1OX6A 3BBCA 2I91A 4JOSA 2XLJA 3PQ6A 5K20A 2M0GB 1GT6A 2I2WA 4TS3A 1LBSA 2LFVA 4CP5A 2CJXA 5EG5A 1JL3A 2GCOA 3WK9A 5LXTF 3FSJX 4KH1A 4JYAB 4TPKA 1XMBA 2HAFA 3ESZA 3ZS8A 1CUBA 2GOYA 3K15A 2HMAA 1BA3A 2IPOA 4HJXA 3NHFA 4YAFA 3GXOA 3I0SB 3KEOA 2QVXX 3PWSA 3Q7RA 2CAJA 1NUSA 2VONA 1PHPA 4ZAYA 2Z6QA 3GJSA 3RB8A 4TLCA 1ZGCA 3I52A 1D2HA 1A1SA 5F33A 3UA4A 1JMKC 5ITZA 1E6WA 2J7PD 3PD0A 4IXMA 1QRTA 3UWTA 3SSAA 4N77A 4ZGBA 4GLOA 1W1WA 3PJ9A 2PMHA 5KNBA 3SHFA 2HEIA 2IZZA 4AG6A 2ZSBA 3QKRA 1SKSA 2IXDA 3GJ7A 3ACDA 5JV5A 4IIJA 1DZ3A 2ALZA 4WY8A 3QIDA 4IQMA 3GJQA 1MROB 1TDJA 4YAKA 3AODA 3ZH2A 3H11B 1I1GA 3BEGB 3VYVA 3ONQA 3HSSA 4ED6A 4S24A 2OBYA 4NABA 1Z5ZA 5EGSA 2DPJA 4DHVA 1OFVA 4LJYA 3CT9A 1DAEA 3UYKA 3AUKA 1SVNA 5JRZA 4X45A 4HYQA 2VK8A 1NLMA 4P4UA 2REOA 2AJBA 2V7XA 3T54A 1NQVA 1AUXA 4KE8A 4PTLA 2ZNYA 1WUTA 2JFFA 5DH9A 4CN9A 1P0CA 2WOOA 3ESRA 2IAJB 3G2XA 2YN0A 1WDTA 4X84A 3E6AA 3RTBA 1ZX1A 1QHHA 5AVTA 1VZ3A 3MEDA 4BKPA 1DMRA 5LD2C 3SNKA 3RGGA 1JHOA 1ZI9A 3OEEA 5C3UA 4GLBA 2CMFA 2CDRB 3SR4A 2C5SA 5EQTA 4UW9A 1R37A 4IUYA 1L1FA 2RAUA 1IOZA 2C98A 1IBMF 4S04A 3VAAA 1FXUA 2PBZA 1HEYA 5JZBA 3CH6A 1XVTA 5HSPA 1A9NB 1PWYE 2HMWA 1XRNA 4LRYA 2Q1YA 2HRBA 2QRHA 3T4EA 2XYGA 1XP5A 4IDAA 2R87A 5BNZA 1XE3A 4MV4A 3V8MA 3FCSB 2V4QA 2VODA 1EA5A 2I4MA 2BJVA 4CTAA 3B9RA 2Z2IA 1VIMA 4AICA 5K6TA 1NP3A 3ND9A 3UHPA 4LFAJ 3CF6R 2VZ8A 3TE7A 2AWNA 3BUSA 3BSCA 5I7OA 4ZVLA 2QTVA 1KNZA 4C4WA 4WE3A 2QGNA 1O9BA 2QLBB 5I9TA 4OZLA 4P1ZA 5CCDA 3GNTA 1N88A 5FA6A 4U7UK 4UUMA 2G0JA 1PLLA 1LWXA 3QYJA 3LSTA 4A6PA 3OSPA 5LLDA 1V5FA 3ICCA 5F3WB 1CETA 1MF7A 1Z0FA 4Q4CA 4Z5XA 3DJFA 4N3GA 3HN2A 1SCDA 5JVDA 1HDIA 1Q21A 3ZXUB 4NA3A 2A2ZA 2YKMB 1NPTO 1TK0A 3BGWA 4TL9A 2JEYA 1GGVA 3O8OA 3AOEC 5DDPC 2CT8A 2DVMA 1S0UA 3OJXA 4BVEA 5IJ0B 3HY4A 5CCMA 2BEKA 4I08A 4LXGA 1XF9A 4DQQA 3LP2A 5HIKA 1WU7A 3U4QB 4ZK7M 2F4VJ 3JVEA 1P1RA 1A96A 1U2GC 2HVIA 1U8SA 4DJEC 3MT7A 3IEMA 3BB1A 4EU0A 1JPUA 3G8QA 3FVWA 1ECGA 4U5XA 3S68A 5BQOA 5AM2A 1JJIA 3H2GA 5DLGA 1N5QA 4CWAA 3KHGA 2UYCA 2XC9A 4N5SA 4OQEA 5ETVA 5G4KB 2XTAA 1RA7A 2C8JA 2WM9B 4RBTA 5AJHA 5MLCV 2WHXA 4RAQA 4EB6A 4M1YA 3OFKA 2HXGA 4LFCJ 4I4LA 4CM1A 3TVKA 1S2MA 1IOWA 4Z1MA 4GR5A 3Q8UA 1GQYA 4PFSA 1JLQA 4DNQA 1DXQA 4OLFA 4D44A 2AVDA 2GYVA 3Q83A 3D6JA 2RHTA 2MZQA 1QANA 1ZL0A 1IKXB 5F5LA 3EPJA 3AD7C 1X4GA 4EI7A 1VLOA 5AMXA 3DLEA 4TLQA 3TDKA 4W6ZA 3EZUA 4EY8A 5FAXA 3LA0A 1J1UA 2VDWB 5F4ZA 2ZUSA 2HFZA 3DD5A 4E98A 2DHSA 3G2LA 2DRIA 3R9IA 2R0QC 2ZVPX 4J2TA 4DQ0A 3RAEC 3K0HA 3BTUA 4DM7A 3OTIA 4MUXA 4FSHA 4CO2A 3UJ8A 2CXNA 4U2FA 2C22A 1Y1PA 4G5OA 3KSBC 1AQLA 1T02A 3G02A 4IQGA 3M2VB 1RTJB 3O6QA 1I3OA 1MQAA 4OHFA 1JLBB 4C08A 5CFMA 2I62A 2HRDA 1L5YA 4BIMA 3T6KA 2B6NA 1KHVA 5KVQA 5TARA 3BBLA 1KZHA 1EAYA 1EVKA 2DWQA 2DR9A 3WNVA 1DTTA 4GYJA 1DRKA 4NH0A 1CYEA 5A6PA 2M8HA 2Q3PA 2EGHA 1RACB 3RH0A 5HUHA 3OF3A 1GSIA 3E22A 4MLPA 4F3TA 1XMOJ 2EC2A 2WWIA 1FQJA 4QVKA 3HRKA 4EGCB 5I9NA 1RZRD 1OAOA 1M6YA 3AIIA 1DJOA 2QRRA 3SYRA 4TKMA 4ZVPA 1H5UA 2OEPA 3S1AA 4EW1A 3MCZA 4IFEA 1L8QA 2QI9F 1X0VA 2OK7A 1GCUA 2CQ2A 5FUVA 1F5BA 3T99A 1ZKMA 1ENZA 3WKDA 1F0XA 3BMXA 1MPXA 3DZBA 4R2JA 2WRZA 3DOEA 4X85A 3VHRA 1U7LA 1LSJA 3HVJA 1MMLA 4JBCA 3A04A 3WLHA 1J2JA 2CLSA 3HJVA 4J7UA 3L0SA 1NBIA 3N8GA 1NXVA 1GPH1 2NP7A 3OZRA 2GGPB 2FP3A 2FSSA 3GIKA 4YRZA 4FYIA 2X4LA 2UVWA 2XTMA 4C2UA 3HJFA 1GCIA 4JDUA 5LYJB 1S2DA 3CCUS 2XULA 3DTVB 5KOIA 3W6UA 2IHNA 1RWNB 2VN8A 4O4IF 2YTCA 2WHOA 1WZ2A 5A1JA 2IU4A 2EEPA 3OQ1A 4AG5A 4I4IA 1FDNA 5LMZA 1GNRA 1SVIA 2X9QA 4UFNA 1CV2A 3TVYA 2XNDD 2OAEA 5BSMA 1ANKA 3M83A 5TGDA 1YZ7A 2VQFF 4OHOA 4B43A 3E61A 2GFQA 2E5LF 4KXVA 4EYEA 3FA2A 4GKBA 4LJ6A 2I7DA 3SD7A 1JSXA 4RGVA 3V6DA 4DUZB 4ARZA 2JCGA 4DL2A 4WWHA 2ECPA 3TOVA 4PYAA 3KWFA 1FFGA 1GTMA 5AXBA 4BFWA 1U99A 1H8HD 2DKFA 4HR2A 1C30A 2G1DA 4NI2A 2PMWB 5JYCA 2VOJA 4ARVA 3P9CA 4UKDA 1VGRA 1VG1A 4TMTA 1GGHA 1LU9A 3H0PA 4TWAA 1N5IA 2FRVA 4RORA 1TZJA 1ZXXA 1NTRA 3FX2A 2XMWA 1U28A 1AFIA 2PXAA 2Y1WA 2Z2YA 3A6FA 4HV4A 3BH0A 3DBRA 1DBQA 4EJSC 1FTYA 2DAPA 1O6GA 1O97D 4ENOA 3EIXA 1DAMA 1KR4A 1TELA 3UAWA 1YUBA 3VRHA 1WDKA 3I42A 1HGXA 2OOSA 1WB6A 4XDGA 5CNMA 2D1SA 3LX5A 2C61A 3DMTC 4ROTA 2Q5EA 3KU4A 2ZREA 3EICA 1N7JA 1EFDN 3VPCA 5EN4A 1M72A 4DR4B 1MTZA 4WNYA 4HL9A 4JCCA 3MXHP 2FGCA 1MO3A 1P7VA 3BIOA 4V02A 2TSYB 2WIAA 3GLIE 4WNAA 4DUTA 2Q3JA 2ZTHA 3JQAB 4IHJB 4N56A 3GA7A 4ICLB 4MRRA 4UD6A 1R0KA 5HJ2A 3VNRA 2VA2A 2R48A 3KLBA 3SQXA 4CWBA 1X86B 1VBMA 1FYDA 3BXGA 4JLUA 3DNFA 2O5DA 4PG5A 3P32A 3VYSB 1F5SA 1I9CA 4R9SA 3HE3A 4I8IA 2BC9A 4KR3A 2IGBA 4NXMJ 4CRWB 2ANCA 3M2PA 1R0YA 3I39X 4L0DA 4DR1J 2BGGA 4UU1A 5LZ4A 4CM3A 3CINA 2FSIA 2K7KA 4LJMA 1Z47A 1PQ4A 3L8EA 4MP8A 3N3AC 1A6LA 3BGVA 1R0CA 4FHDA 1XLVA 1TVMA 2JOQA 5E41A 5E6RB 1KPIA 1GKYA 4NLVA 3QXXA 3TJ8A 3LCUA 4RS3A 2FE4A 5AI0A 1KY3A 2G7ZA 3MTIA 4PZ9A 1HMYA 1M2NA 3GV8B 4HH0A 3GFYA 2H1YA 1DKQA 3DVAB 5D4PA 2ZC4A 2BZ2A 4LF8B 2OG1A 5DHTA 2R3SA 4DG9A 4JI1B 2GRUA 4LSLB 2DBVO 2D1QA 4DIEA 3K09A 1KEUA 2O1PA 1HKHA 3ZIUA 2AI2A 5JE8A 1UVMA 1E2IA 5KNDH 3QPBA 4EM6A 5KOWA 3LY7A 1SVDA 2IY9A 2P69A 1GH8A 1P9WA 4EY5A 3I5UA 2YJ5A 4FCWA 2B34A 3R5AA 3PACA 3PR4A 3HNRA 1T9AA 3C85A 5M2UA 4DV0J 3QIPA 2WKQA 5I42B 3VOBA 1I5RA 1YMQA 5TPWA 3UE2A 3PDNA 4I9HA 3QGMA 3EC7A 3BKUA 5J47A 2FSPA 2DNNA 2GCEA 4HT7A 4P86A 4FW8A 5K8TA 3A4LA 4XGNA 5AH0A 1PZMA 4P3OA 5D00A 4ANFA 3MMAB 3O3OB 2B8WA 4PWYA 2P79A 3C7KA 1I6LA 3KCNA 2M6RA 5BN1A 1NYRA 1C50A 1PZEA 1HLGA 3TL2A 4PQUA 4DCNA 4HQ6A 4ZA2A 1Z7BA 2QENA 2XYPA 1XFDA 3ROPA 2FZGB 3RARA 2KT5A 2RJOA 3D1HA 2Z9DA 4PLGA 3WHPA 1DBVO 4BAGA 3GY0A 4KK4A 3F6PA 1JH8A 2FSVC 4YXWD 4V3CA 5J2TF 5EZYB 2IPMA 1ICIA 2WIJA 1XJCA 4U8YA 4ZCMA 1SI9A 2J3IA 2ZDQA 3JCZA 1JECA 3R6TA 4KG7A 3A6ZA 4BLRA 3WB9A 4BLOA 3IDQA 2ECQA 5NULA 1P7ZA 1W4BA 2PKXA 4EA8A 4BNHA 3HV2A 3G0BA 4KY3A 2OPSB 4LRTB 4DQPA 5AW9A 3BWEA 1YHYA 3JQ7A 5RUBA 3SQLA 5U47A 3ECSA 1G20A 4BN0A 3P94A 4DBLE 1PUJA 2GZHA 2DMRA 1FP7A 3PXUA 2XVMA 1BUXA 3HHDA 5HPYB 1VJ0A 4B4DA 1M1NB 3NC0C 3UC9A 1PJ2A 4ZJYA 1LVUA 1SKRA 5TJHA 4M8LA 5JS8A 3VZHA 4JXKA 3KYDA 5K8OA 3PM9A 3JQ6A 3WGVA 4ZDKA 3MD3A 1Z18A 3IPLA 1G3UA 4IO0A 1CQPA 4CKBB 1I4DD 1RWKB 2PXXA 3JRXA 4HZUB 4NBRA 1VFNA 2PN6A 1QZTA 2BM0A 2HJ9A 4OLAA 5E6UA 3EF3A 4W98A 1UT5A 4F45A 1ND5A 3D3NA 4PHTA 1UVLA 4YY3B 3GRVA 1W7AA 1Y5NA 3T5DA 4ZLJA 4TVBA 1I2MA 3FOEC 3UPTA 3RODA 1C0PA 2JJ8A 2WFLA 3A3PA 4HNVA 1PJBA 2R8ZA 3O4JA 2OCIA 3MFHA 4ZO6A 1S1XA 5K3DA 1N6QB 4DFJA 4X3OA 4P2SA 2VKRA 1N5JA 2IYEA 2JGRA 1XEFA 2HSJA 3MG9A 1T3HA 3WJAA 1SC4A 3MHTA 1NP7A 4UATA 1N57A 5D5HA 3MFYA 9ATCB 3WYCA 1ESNA 5DIFA 3RRYA 1ZK0A 1NX6A 1NBEB 2RFLA 2FN4A 2PX8A 4AMGA 4GMGA 1DC6A 2UZIR 1P75A 3AW8A 2QL9A 3C24A 3E1GA 3A6JA 1DINA 2G88A 4LSNB 4MKZA 2GCNA 4HFJA 1EX1A 3UCGA 3Q7IA 3DXZA 1WPQA 4O0MA 3ZZMA 1NPYA 3R0IA 2BFNA 3WL5A 4L4UA 2M5YA 3NL0A 1OC2A 1Q20A 3OFVA 2FEPA 2GZSA 3RB6A 1G7RA 3CRQA 5KFRA 4Y0FA 4TXJA 5CYJA 3U4IA 2XEXA 3LBAA 1T03A 1RXVA 1RYFA 1VJQA 4NLXA 1D8ZA 5MAOA 1QOQB 2LEAA 1P31A 3GV5B 1J97A 4GO1A 5D01A 1K66A 3IBTA 3OEHD 2GAFA 3EPPA 2BCEA 1GAXA 2HU5A 1VQPS 2VG6A 5AKXA 1NN5A 1HEIA 3DCIA 3TW8B 4L7QA 3GFVA 1D09A 4P52A 1WG5A 3ZEIA 3PFIA 2C7VA 3GK3A 4S1NA 1C8LA 3ZDXB 3PWTA 2ASLA 5CFPA 4FDVA 1C7FA 5EPEA 4LGCA 3A9CA 2Z2KA 3OJFA 1NB2A 3MC1A 3WB2A 4OL9A 3OR1B 3IAM9 4ZZIA 5L1JA 2KX7A 4J0KA 4C8ZA 1AB6A 4QUHA 1RPAA 5EMNA 3KPVA 3C5CA 1LS6A 1XWWA 4KYUA 4BDPA 3GILA 4KI0A 4CIXA 1V9SA 4X71A 5IX8A 3RJZA 2QN3A 2OBMA 2WCXA 3FPBA 2FETA 1C4WA 1HNZB 2WUVA 4FYYA 3F5FA 2FVYA 3B4DA 1KP6A 4HWSA 4I6WA 3RYFB 3ZZUA 1EK5A 2XIQA 4KXUA 2Q0QA 4UDNA 5DM6Q 4EBDA 3CUTA 1E1YA 2R7SA 4P83A 3UN2A 1YI1A 1B00A 2HFKA 1XJWA 5C42A 1ISRA 1T9HA 3FSGA 3MFQA 3X1XA 2VKQA 2W6PA 4N6NA 2E4YA 4EKIA 4D3GA 3UANA 3HR8A 2HA5A 3O38A 3BE4A 3RUAA 4RUHA 4IM7A 1NEEA 3IC5A 3DPIA 5ALMA 2FB0A 1S1UA 1SGWA 4ZVRA 2Q5IA 1RPJA 4ALZA 4H1UA 3E9YA 5L45A 3ZV6A 4K3UA 4UPVA 4DFDA 1O1YA 5LA6F 4LF4J 3ND6A 4DVGA 1EH5A 2NUPA 4EYSA 3K6JA 3FZNA 1HE4A 1BWPA 2JAWA 3GZJA 4ZV9A 3HI6A 1Y8AA 2OC9A 2GD1O 4ED9A 3LDFA 3CMMA 1IKVA 3BJMA 4TMXA 4GM0A 2XZLA 1HI1A 5HBMB 4FW9A 5HW0A 1SQ5A 3KHSA 4KFTA 4E5VA 4B47A 1UMBA 4NHOA 3IG1B 5HCNA 3FIJA 2EAUA 4DLRA 3EMTA 1BC5A 3ZX5A 4GNRA 3K0KA 3E9DA 3RU7A 4A8QA 4HZGA 1NJFA 4JC5A 1XXLA 1P2BA 2OCGA 4LSZB 4ZT5A 5B7PA 1XNQB 4HATA 4A91A 3DOLA 4M99A 1YJ7A 2OL4A 5SYAA 2RHSB 1Z2AA 5BN3A 4Y2TA 3BB4A 4ECRA 3REOA 1VE5A 5MN4A 2KFNA 3AUXA 3UCXA 1WM1A 2BP7A 4FYDA 1N7HA 1VSTA 3ID6C 4J0CA 1PX0A 3ADKA 1AOXA 1L7AA 2MTLA 2MKSA 4XGRA 4UBJA 5CVEA 4QPNA 2POQX 2JZOA 3V7NA 3WWZA 1RADB 3KD3A 5C7PA 3KIPA 3OM8A 3QYPA 4OU4A 2DNZA 2A1TR 5ECGC 1GZ4A 1MXHA 3DBHA 2CPEA 5DNEA 4X62J 4EPWA 1YT5A 2B4OA 2GN8A 2QHXA 2EQAA 5DGAA 1PJRA 4AYWA 3HVAA 4AY6A 1I7QB 3VR2A 1HWLA 2ES4A 2PNFA 3MWLA 1PFGA 2J4DA 4HN9A 5BNIA 1EX6A 5ALNA 2QX0A 1G3RA 4MARA 2O1WA 1IONA 1B0VA 4WX2B 1OWNA 5J1EA 3L8CA 3OY7A 3GPAA 4YMUA 2CF5A 1DRJA 4IBOA 1J25A 1RT3A 4MIWA 2P77A 2R5FA 1UQUA 3PPWA 3I9MA 1Q7BA 1TGVA 3ABSB 1MUUA 4LPSA 1TQDA 1R8BA 3WLEA 4YQZA 3SIPB 3UV7A 4YRNA 4MP3A 4P54A 3ESAA 2QX4A 1ICEB 2OM6A 3OJSA 1DKMA 3BH6A 5A8KA 4Q3OA 3FCOA 1QGUB 1H5QA 4G3XA 4EMSA 1HD1A 1S9DA 3OE7D 4EA7A 1P2FA 1MB9A 1EETA 2CQGA 2OPPA 4X61A 3JTOA 3TDNA 2EP7A 1UMJA 3B51X 4XA8A 2VDLB 3CLSD 1I0LA 3H4MA 2D1CA 2VR1A 3K3PA 4U7CA 5FWAA 1Y3KA 1SQGA 4ER7A 5ARBA 2H4WB 3U0VA 4WTOB 3I92A 2FR8C 2XQKA 1F0YA 2ZBGA 2ATCB 3U0BA 4ZPJA 5JCOC 2QNIA 1GU0A 4CV2A 3W3AA 3TPCA 2ZWVA 4P4SA 2H1IA 3L5KA 2MSKA 4F9GA 1LBEA 1QVRA 1UBFA 3ND8A 5JTUA 2A3NA 4Y8VA 1YRBA 4FYHA 1CBKA 1OH5A 3CNEA 5BMOA 2HDOA 3VDNB 2HQ3A 1OU4A 4BMPB 3R6GB 2IEYA 2CADA 5EQFA 2PJZA 2G28A 1KR2A 1V8PA 2VG5A 1CY4A 5DWDA 3WB0A 3OZCA 3A9RA 1SPBS 3L43A 1FFXB 4EKYA 1J0EA 2ZD1B 4HFRA 3RBDA 3O3NB 1UANA 3KHUA 4H08A 4A7PA 2WE7A 2KG0A 4CIDA 3H42A 2CVZA 4G1UC 1O89A 4R1OA 3MGGA 1K68A 3NU1A 3QE3A 3VAJA 5IT4A 4ER3A 1R9NA 2JVJA 4YJ2B 1Z62A 4Z4FA 1QR2A 1UKVY 2VJAA 4XEHA 4QSMA 5HILA 1KFKB 2C1XA 4KAAA 1JSZA 1X1BA 4FWBA 4OV6A 4WBFA 4LI3X 4JC4A 3JD2A 1E2JA 5IK2A 2VWHA 3BSFA 3OKFA 4ZDJA 3N0WA 2RKIA 1ZRSA 1DIHA 1YQEA 2XEDA 4DQUA 1O5OA 3D1QA 3UJHA 1JBQA 4R1UA 1M0WA 1UJMA 2EW8A 5DG8A 1BWQA 1BWRA 1PZNA 1P1HA 3WGLA 3DLLQ 2AZ4A 4IX9A 1VL2A 5CA0A 3RSOA 1QIFA 3EZ9A 3K72B 1DAKA 2CYYA 1PILA 4FGUA 3CO0P 2IHUA 1PE0A 3IJEB 1Z4OA 3J80A 4IY1A 3D3CJ 1YDFA 3E2EA 5J43A 1X1DA 1KLNA 1GD1O 3U9LA 5EI5A 1SUDA 3TZ6A 2WU3A 1VCTA 2OCYC 1F5NA 3VQTA 1HI9A 4EO8A 1JR4A 3VX4A 2L69A 4IRUB 5DDRC 1DELA 1RBMA 4FNOA 5INTA 1E3JA 1CUAA 3FPHA 2CFOA 1Z6XA 1MDFA 4CYMA 5L3QA 2FPSA 3M49A 4CDIA 5HO4A 1WSRA 1XG5A 1U0HC 3KQPA 3MPWA 2C0CA 3W2IA 2QG6A 2GM9A 3F6EX 3CLTC 3QAUA 1PWHA 1M0TA 1YQGA 4WJBA 5JASA 4NCGA 1I24A 4KPUB 2ZYGA 4EG1A 3O82A 1TCVA 5KBYA 4LAFA 2OMLA 5EWLB 1YRLA 1GMUA 3POTB 4A2CA 1M1UA 2J5AA 3ZVMA 3PU6A 2GLUA 2IJFA 3H2HA 2PWAA 2P2CB 4WKRA 1RXSA 3T9DA 2W58A 3L8ZA 2E9ZA 3CLKA 3AF1A 2HBYB 2OG2A 2I4RA 1GARA 3M6AA 5ALLA 4MW0A 3SNHA 4EENA 3URKA 2CDBA 5SYNA 4YRQA 3HBFA 3PI6A 1JKIA 3GFZA 1XA4A 5B30A 1PNQA 4H7DA 2W6ID 4NLRA 4RH1A 3ZDZB 3N2GA 3DXFA 2LCIA 1O9HA 3Q4GA 4L73A 6NULA 1TKTB 1JPVA 2BEUB 3C5VA 1DAOA 4QUDA 5LMNF 1E9EA 2VXYA 4IYRA 3OFNA 1XWIA 4DC1A 4GP9A 5MF6A 2XCUA 1EKXA 4PIPA 2RAFA 3BVPA 3ZNNA 5HLFA 3P71T 4WT7A 3FOAA 5DULA 4BHQA 1Y1LA 2ORED 2WMNB 3HRHA 5JLJA 3VNVA 1BMQA 5B12A 3TTUA 2EJUA 1CRWG 3EGWB 2XRYA 2HD4A 3EAQA 4KGMA 3QLJA 4W7HA 2A5LA 4DNXA 2FB9A 3L7JA 3I56S 3PQCA 1HETA 4RX1A 1N6HA 3EFOA 4L75A 3AVWA 3H2LA 4PWDB 4MMOA 2GO7A 2OD6A 4GD3Q 2IA0A 4HSGA 3MTGA 2GHWA 2J3QA 5JMTA 4ZVQA 1ACJA 3KJVB 1XXHE 4MPRA 5H3LA 3PQDA 4LTNA 2DM6A 1X80A 4KXNA 2F8HA 1Y3DE 1ESCA 4AX8A 1Y5IA 1Q8BA 5L4LA 4FYKA 2D7JA 4CIVA 3KDNA 3IOCA 4M1QA 3CSDA 3BHNA 2DNQA 3QPIA 2C29D 2K5UA 3ROQA 3C70A 5IN5A 2QLJA 5IP5A 1C0IA 2ZH4A 2PY6A 2VSYA 3MTAA 4ZVTA 4N5NA 3FKSD 2WFMA 1UXKA 2UZ1B 2ZUGA 2OHVA 5D84A 1LNZA 5LQAA 3M2RB 1H72C 5MGBA 2EZTA 3IQXA 1DIBA 3P2IA 3CY6A 4C3KA 2KM8B 3I0RA 3IRUA 4AMBA 2NO4A 5C4GB 5I5EA 3DE0X 3H99A 4QHYA 4QJ4A 3ZXWA 1ZTWA 3BHIA 1SHTX 3UB3A 5CYQA 4ANDA 3AHGA 4DLPA 1U8CB 2PR7A 4ZFNA 1L4NA 5BR8B 1CRLA 3LF1A 2CNBA 3V97A 2XUQA 2QGFA 1RRFA 3Q3CA 4QU8A 4PCLA 2RHDA 1ZJZA 3WGTA 4UXHA 4MIOA 1KRHA 4HT3B 1MSWD 1E3TA 4CLYA 2D9OA 4IGFA 4CHGA 1ZR2A 5TEVA 5K01A 5BQFA 3W8FA 3GJYA 3C5WP 1OX4A 1DQNA 2B7CB 3K0CA 4I1SA 1QF6A 1PEDA 3A58B 2YWHA 3NWOA 3CF5Q 3PEEA 4LMBA 2WQ6A 2G9OA 4FFPA 1X1AA 4E07A 2ADBA 3AFNA 1B8OA 1BVYF 1ZJJA 4U6QA 1B64A 2WHRA 1W2IA 1X7ZB 3LUCA 4DLZA 2DY9A 2QVBA 2JW5A 2XDWA 3CCQS 4F2RA 3KE9A 1WNFA 1SKBA 2XH8A 4WFNQ 2O1EA 4RJKA 3GMSA 2OZKA 3R20A 3PZPA 4DN0A 4ETMA 4LFBJ 1Q95A 2JLBA 2YHIA 3WTCA 3L7BA 3A8TA 2GPWA 2I8AA 2PLFA 5DXAA 2GJAA 4KQ6A 1UBMS 4C5BA 4NXNJ 5AXKA 3HBNA 4KCGA 1CR6A 3H86A 3FRHA 2D3ZA 1TVRB 4FZ5A 1DXYA 5KEIA 4KR6A 3AHDA 1Q8KA 3F2IA 3CLRC 4JNCA 1BJRE 4ZO9A 4IOJA 2C2EA 2ZR7A 1FXSA 1GFWB 2HDNB 4AWAA 1FRLA 1KP3A 1TVCA 1V9OA 1C14A 5DNDA 3D02A 1JB0C 1NYQA 3IUMA 1Y9JA 2XZTA 2D7CA 3J81k 4GKKB 4IIFA 3UMGA 4CG1A 1RLMA 1D8AA 3D3BJ 1PG5A 2YN4A 4MHSA 1W7WA 5JZ9A 4JEHA 1YBMA 4O3FA 4B3RJ 4KEAA 3IKLA 3HXOA 3K5MA 5BSVA 3FOCA 1UPPA 3H97A 2PRKA 4MVYA 4TSKA 4YJDA 1M0EA 2E4WA 4BYMA 4X8HA 4AZ3A 3F6YA 2N3ZA 3Q8YA 2GPYA 1I4WA 3E27A 4DCOA 1PS9A 3V4IB 4Q19A 4OI1A 1FTGA 1I94F 4Y28C 3DRPB 1PEYA 4F2SA 3O8CA 4UT4A 3BRQA 3WWEA 4FDAA 4PICA 4NE9C 3SCIE 1YQTA 3NOCA 2RGWA 3DD1A 4EATA 1SUPA 3E5MA 4MROA 4IKOA 4HLDA 4E7OA 5CB4B 1IH8A 2I67A 1E2UA 1H0HB 4DVJA 4I3FA 3LAMA 1J0CA 4DQVA 1WXXA 2ZYTX 3IVCA 3A31A 3F9CA 2YKAA 3ZV5A 4A0FA 3I73A 2D7DA 5KU7A 1YQUA 3JX9A 4PAAA 3DMDA 4B3MJ 5JXHA 1L4FA 3NNDA 1LFDB 3QTTA 4FINA 1R5OA 3OTOJ 3MGKA 4GPD1 4IMJB 3GJXC 4OX8A 3WR5A 2K6GA 1JWLA 4EB3A 3V4LA 3KB8A 2WHYA 1QH1A 2MY7A 3R0XA 2Q7OE 1R18A 1T3ZA 1WL8A 2JGLA 3FWKA 1L5WA 3BSSA 3QRWA 1VTKA 3D6NB 4E3WA 1AQ6A 4Q4LA 5DTIA 3D81A 2IWRA 5CPFA 5IZHA 3KJHA 1P8AA 4LZPA 4DAEA 3N9IA 1UBEA 1UKYA 1LWCA 2P9BA 1TCCA 1BMDA 1FFHA 4QYMA 3KYIB 5LU9A 2SKCA 4ZQEA 4Y18A 3QU9A 4WK3A 2C94A 1P72A 2OP0A 3H4IA 1WF1A 1SOAA 2DHEA 2JGEA 3K5IA 5DNUA 4ETIA 4RC9A 3RS2A 1VBFA 4GRSA 3CVJA 2JATA 1M7GA 1Q14A 3VKHA 5JCJA 2MZRA 3ZH9B 4HLCA 2GHRA 1GDTA 2PZ8A 2VV5A 3CVVA 1VPWA 4Y65A 2KT2A 3GLFA 4X93A 4TX1A 4OK5A 3X3UA 3DMPA 2OGSA 1W4ZA 4WA8A 3C15B 1O94A 3QZ7A 4UUOA 2X0KA 3M8PB 1VQ4S 5J23A 5DM7Q 1RAHA 4B9MA 4MYRA 3TRKA 4KV8A 1SCUB 3KQSA 2P67A 3CD6S 3NGKA 2C04A 3BFKA 5GZ3A 1LWEA 3CYFA 2HSDA 5ALJA 2I3AA 2ZJ4A 3VPSA 4CVNA 4QR0A 3EWSA 2UXDB 1OLUB 3AILA 2Q2QA 3GVHA 2CHGA 3OZDA 8ATCA 5BMVB 3ICEA 1ONPA 4M9XA 1A4RA 5KIAA 3PFBA 4YQWA 3ORSA 3ILVA 4YP9A 3UAXA 3MW8A 2YNFA 5K8MA 4LF5F 4M1EA 3IC1A 2LDXA 1N34J 1FWKA 2VC0A 2MINB 1KIMA 4HYEA 4G81A 4E2FB 1A5BB 3OKPA 4MOWA 3GPDG 4DR5J 4B4OA 4M5DA 3BXOA 1OVGA 3JZDA 3PFKA 2LCQA 4ZV4A 1NF9A 2V7TA 2E1CA 5HK4A 4YX9A 1N3YA 4C8OA 1NUEA 4MAMA 4OK6A 3ZEAA 4A27A 1VG9B 4PZZA 4E1VA 1XTJA 4UVDA 1BIFA 4HAXA 2YV4A 2ZXEA 4CKZA 1KI9A 3DV0B 2XMAA 3W64A 2ZB8A 1Z22A 3G0DA 4OYIA 2JD1A 4B1FA 3TBHA 3ISND 5ALUA 1TLFA 4BE4A 1X7GA 2ZI3A 3GJ6A 3ZGNA 1K1EA 3HR4A 4PFKA 2PGAA 1THTA 4C11B 3ABRB 5G0RA 4ZRMA 3ZCQA 1OA1A 2ZAIA 1JMVA 4ZO7A 1XVVA 3RIXA 4A6EA 1RAEA 1EWVA 1HR0B 2CNKA 4P7FA 5AW2A 4FWIB 3EZ5A 2QWXA 3CM0A 3LRTA 3OZBA 1NO8A 2RI0A 4F92B 2QVLA 1RP7A 3Q3EA 5EPOA 1YS9A 1KJIA 1MENA 2O52A 1K7EB 1YZYA 3IR6A 4M55A 1CZKA 1U9JA 4HDGA 4TRJA 3QWIA 3X1MA 2V03A 1RU1A 4AAYA 4RV4A 3BJRA 3IQIX 5DO9A 2Y1LA 2XMSA 5JJCA 1JHUA 1B0AA 2GYYA 2WU8A 2CXXA 5FI0B 4DCPA 4DR3B 4LRCA 3OI7A 3IFEA 1T05A 1RA6A 1L1RA 3IEKA 2CMDA 3DOJA 1V6AA 4JGIA 3DZGA 5DI3B 3KXKA 3FNBA 3UWSA 4DXLA 1WTAA 2O7RA 1ZN7A 3P9RA 4BMOB 1H0SA 3C3BA 1RTZA 1GVHA 2AW3A 4RY9A 2RT3A 2VHZA 1R0BA 2PBLA 4NH4A 3OCVA 1U4NA 4I1YA 3LMKA 3KQUA 1GGMA 2I1LA 1VYTA 1YJQA 4H7HA 1ID8A 4RU2A 4CMAA 5T57A 3Q0AA 5CA1A 4E6EA 4NCBA 4FIZA 1E59A 1KSHA 5A1TA 2ZTVA 4RZUA 1TVKA 2OV6A 3SJ7A 2B3DA 4FYVB 4S35A 1B0PA 4D79A 5KVCA 4JDPA 1YR7A 3EA4A 2LKCA 1HX7A 2O2EA 3OQ6A 1IHDA 5K51A 2A9PA 4RLQA 1QHFA 2ZI9A 1GXLA 2GZ3A 2YS7A 5CDHA 3QWPA 3K35A 4CLRA 2QR5A 2BRKA 1RZMA 3BFJA 3DLGA 2CWKA 1VHIA 4ESEA 2AXPA 3IQDB 4FEEA 3KLGB 2RUSA 3VO2A 4AYBD 4ZXFA 3KQTA 4CMBA 1N0WA 4OQNA 3FCCA 4ZYYA 3OCWA 1RHUA 1WCXA 1IYZA 4OJNA 4B9NA 1T8TA 4AF6A 3ASYA 4FSXA 3E58A 1KOOA 2PUWA 1GZDA 3AEKA 4A0QA 1WBJB 3N7TA 2DJIA 4J9PA 2DGWA 3ZJYA 4TYPA 1VE9A 4NFSA 1T3TA 3Q1KA 1MX3A 1RWWB 1P2SA 4D02A 3SLRA 2ZJ2A 4NY1A 1OJ4A 3PJXA 4YHHJ 2YIDA 3VC7A 3HKCA 1R88A 3PPIA 3EJ6A 3A2KA 3ICQB 4D4GA 3FOZA 4D42A 3RRZA 1KO8A 4QWEA 2XMPA 3E05A 2ATXA 3G3EA 1DQSA 5I7EA 3HK2A 4ZJZA 3AAWB 3KTQA 1DZIA 1JNXX 4NOHA 4ZVSB 4D92A 5C53B 2D5AA 3KEGA 2O8FB 2VF7A 3QKSA 2B5JB 3GEDA 3JQEA 1USUA 1XTSA 5JTTA 2HWWA 5C24A 2G6TA 2AMJA 4ZQBA 1TYDE 2DGDA 3V33A 2OFPA 1AC5A 4GYWA 1IBKB 3AR8A 2EFGA 2Y0SD 4UARA 4CR8A 1SC9A 4LX8A 4G07A 3FYUA 1VMDA 1UWBA 3PKMA 5G4DA 1IY8A 4BLQA 4TKUA 3WA7A 2XA2A 2OGUA 3AJ9A 4EHJA 1QG6A 1AZSC 4BX8A 3IDSA 4OZJA 3ZTYA 3FKQA 2ROEA 4R84A 1MAWA 2MQNA 4AIRA 3OCCA 1FY2A 4DSFA 4Y2GA 5AJVB 4Y9UA 5BYBA 2INGX 5JAUA 1QNLA 3UWMA 1YR8A 1RM3A 1ZD5A 2JJ2D 3GVPA 1G64A 3BGRA 5DP2A 4BBAA 4C14A 2HW3A 1E2KA 2VBFA 1UODA 2DFNA 4ES2A 1Y1QA 4LNUB 1IBCB 3OPQA 3LLCA 1EYZA 2XSZA 3UB4A 1Q16B 5EUCA 1OY8A 1MG0A 4HPJB 4MR7A 2HFUA 4U5QA 3RYIA 2IYLD 1R8XA 2F67A 1D8YA 1THGA 1UT8A 4F8JA 1G8FA 3IIKA 2CQ4A 1SIZA 4UUQA 3ZU2A 3THSA 1H6BA 6FDRA 4Q7LA 5JD3A 2W93A 5EXSA 4ID9A 4YDDB 1O6BA 2H4HA 1ZUNB 4L3KA 1MVNA 4NS1A 3H2ZA 2EJVA 3R3HA 3NM5A 2JRSA 4RNFA 2JGDA 4BNLA 4CNYA 3PW0A 1BQMA 3IP5A 1W93A 1AQNA 1LDMA 4B9EA 5CMLA 4I4TF 1FFEA 2DPGA 3IR5A 2LQBA 4HXFB 3OBBA 1B14A 3CKYA 3KKOA 4HWPA 2MSDB 2HADA 4NBSA 2KB0A 3ZDRA 4QYWA 4FDMA 3FNFA 3WP0A 4TYBA 3RUFA 1TC2A 3FMOB 5KWIA 2WK4A 3NG8A 1JXVA 4JJZA 1KC3A 3AGQA 2QP9X 2VP2A 3FNQA 3QFHA 2PX4A 4JZYA 2ZWAA 3EVBA 1VSBA 1B0UA 1MJHA 2XUFA 5DWQA 3EHDA 3MEGA 2CQIA 4D6XA 4JMLA 5AM0A 2B78A 4BUCA 2B1RA 1Z33A 4B3TB 1RHMB 3BH7A 4O63O 1YA4A 2KPOA 3R5DA 5D0EA 3QGPA 1N8TA 3WIUA 3Q8WA 1U2FA 4IFVA 2ZYHA 2FF7A 2RGAA 2LQ8A 4RBUA 1V41E 3EOZA 2FJAB 2FEWB 2VHUA 2HTFA 3QEAZ 1YLXA 1U47A 1Q0HA 1IN7A 4TKZA 1OZFA 2JGMA 3SV3A 4XH9B 4ECAA 2WA1A 2B20A 3EQ7A 2BGLA 5B7WA 1JIVA 3WHIA 4B08A 3OV7A 4BO9A 4JVMA 1WHTA 2AYZA 3O26A 1XTUA 3KP1A 1TM7E 4IVRA 4BAUA 2OHHA 1LI5A 2A9QA 1E1DA 4F3NA 1TCBA 4YQEA 2VUSA 1WXEA 5CYMA 2A33A 2QMUB 1YCDA 2GPNA 2XCRB 5H7XA 2C4VA 3UFCX 3T1HF 3RR7A 4YAUA 4BVFA 1DRZA 4TSFA 3Q9NA 4N5IX 3MLAA 4F3KA 4ZK6A 5J59A 1YWXA 4HHJA 5L7TA 5DTQA 2ZIUB 1S99A 1NI4B 2XYVA 2H2WA 3GNQA 1YB1A 1IKYA 2CLOB 3D3KA 3MN1A 3QVOA 3IO1A 1EFUA 5B4UA 3DTVD 1XZLA 5ENDA 2J9ZB 5E8RA 5JS2A 3ZY6A 4DN6A 4P80A 2Q3FA 2DRAA 2ADMA 3A9TA 2XE4A 1WXGA 2ZB4A 2QRVB 4MICA 1TZMA 2C7RA 4R01A 1JJ2R 2Y71A 3J7A1 5KFIA 4LXIA 1E96A 2NU9B 1K5GA 1LQ2A 4HFNA 4C6TA 4UEKA 3W6OA 1UCFA 4MI1A 5K5MA 1LBIA 1W1UA 3TFQA 5TGTA 5LMUB 1B6TA 2G2OA 3BDPA 3UC5A 1CIPA 1XD8A 1TVEA 2G1PA 1CR0A 3BQ0A 4ZT3A 4WFAQ 4EHNA 3R5JB 2EFYA 3RO7A 3WMGA 10MHA 4A8XA 4QYRA 1HI0P 4KIJA 2WZCA 3QPCA 3DE4X 5CURA 2WG0A 4MS1A 1QIHA 2ZULA 2DHXA 3PB3A 3F4LA 2JLVA 2DGVA 1IFXA 2RG7A 4M38A 4X1YB 4B3FX 3I2FA 1IVZA 2DBRA 2PZGA 1NK4A 2P35A 5ERGB 2P6UA 1B76A 4P3PA 3NP9A 5CVDA 3L6DA 4BVLA 4UVHA 5J2UA 3I2YX 1NKTA 3ZGXA 3WKCA 2QLFB 2BFOA 2B7BA 5SZKB 3D1VA 2NUUG 4IOCQ 3ZXIA 1S8FA 3GUUA 3QQ5A 1RAGB 2VF3A 2YS6A 3DT9A 5EUQB 2PSFA 1T10A 1KSGA 1COWA 1U8XX 3KOMA 3FE2A 1EQUA 3PF8A 1EB8A 1UM9B 3JQAD 3JWHA 1T9KA 2XO7A 1A9SA 3FZQA 3LQRA 3AW9A 2QMOA 2C3UA 4YT2A 3W9IA 4ZDIA 5F98A 1RAFA 3PD1A 3M30A 3IHLA 3DF9A 3BYRA 5BVGA 3FBFA 1ZZFA 3D0OA 2R86A 4TVKA 4J9OA 3RTEA 4QAQA 1XWFA 4YPOA 5ESDA 3E7FA 4NLOA 3NI2A 4PINA 5KNCA 2IW3A 3DO5A 2PWPA 1QUFA 1P4SA 4FFOA 2CJKA 4ZN3A 3SQGB 1FJGJ 3BO3A 4WW0A 1MG5A 1X4BA 1K7YA 4GE3A 3MECB 3P26A 5CLLA 3CCTA 3OX1A 4HH1A 4DV1F 4URZR 4CO5A 4LXUA 2QR3A 1IKWB 3FYDA 4NZPA 2FZCB 2I80A 2EHJA 4EQ6A 2CB0A 4B3BA 1S77D 4NEZA 3PO5A 2HMIA 2JFWA 2HURA 2OLEA 4R6WA 2VJOA 4C0HA 1IWGA 4R1SA 3IS9B 4PPFA 1SA0A 2Q4RA 4ZXPA 2GM3A 2WQZA 3L93A 3OURA 3WOVA 5G0WA 4UE2A 1KBOA 4GMKA 2MU1A 2ZTMA 5B08A 3BN7A 4KO1S 5EXEA 1SB9A 3GLQA 3ZGOA 2GQQA 3QJPA 3U5ZB 5FWXA 5C81A 6ADHA 1YB6A 5F8IA 5ETJA 2VYNA 2BMFA 4RMJA 1LF0A 2EG2A 5ALEA 4HQLA 1H3NA 3K8VA 3NHBA 1UBLS 4ELUA 1L4KA 2R7VA 4H4MB 1RP1A 4C4RA 1XC9A 4RIHA 1OIXA 5ULLA 2ODEA 3MAJA 2GJ9A 4TL7A 5CM2Z 3GD7A 1AK9A 3ZHVA 3ET6B 3MF4A 1VXOA 3WQPA 3FRIA 1X92A 3KOYA 3RRKA 3B6IA 3PC8A 4RHYA 1X74A 4AN4A 4HGPA 4DLSA 5KMGB 4A8JA 1ABEA 1H98A 4R2KA 4DL6A 4C1BA 1D7AA 3SYTA 2JEIA 4KJXA 1XNRF 4AJNA 3WYGA 4QDKA 3TLYA 4AQYF 1AW0A 1KHTA 1U48A 3PSAA 2TMKA 1DNPA 4Q6WA 3M8WA 1MJFA 5EWJA 2W25A 5HM6A 3ZQ6A 4EG0A 1OAAA 4PZVA 4BCBA 3RKRA 4ZP9A 4BASA 1ZGJA 2VRBA 1U1NA 3JSMB 1LV7A 1TL3A 1X9SA 4P31A 4WGFA 1NUQA 1U1CA 2VB6A 2ZPAA 2MB0B 3VTAA 1HLFA 2H11A 4V24A 4HAIA 4ENWA 4X7MA 1G9XA 2NZ4A 3NHMA 1RE1B 3KFVA 4F2GA 1AT1A 2VUUA 3I6PA 5DHAA 1R3DA 1X70A 4KO4S 2A4KA 4J0IA 4NZOA 2WOMB 2ZS7A 3TR0A 1D0IA 4OQJA 4Q7QA 3EGXB 4FFNA 1HNWB 4QOEA 4Y2RA 1PN3A 3QXJA 1NWCA 3ULHA 1YZTA 7AT1A 1XRPA 1PO6A 4NYIQ 3AFOA 3P4XA 2IV3A 3QRQA 4EJ2A 3PDHA 5CP8A 1VHTA 1Z73A 3WFZA 5DQHA 1MVLA 4Z99A 2K06A 2YX7A 4V3BA 2BRLA 1EFHA 1TUGB 3C74A 3N8DA 3CVUA 4X4NA 2PL9A 4NLUA 4DPUA 8GPBA 1HT1E 1OH8A 2HSZA 1WY5A 1QQ7A 2EL7A 3WLPA 3E9NA 3DONA 4P3YA 2G7MC 1TU0B 2Z8ZA 5D8HB 1M8PA 5ALOA 4EGFA 3EYAA 4NCKA 1P7PA 3UPFA 1X94A 5CXSA 3ANXA 4JI8F 3NV9A 3F3SA 4CM5A 3HLUA 4UCFA 1S2NA 5CNJA 2VNJA 4JQZA 4MKXA 3CE8A 3FNHA 2JEGA 3I9OA 5GIPE 2IHBA 1PGPA 1AO3A 2CDCA 2XWPA 3LL7A 2V6BA 4U7HA 3EZNA 1T0HB 1TXGA 4TN1A 2BE2B 4IR7A 2W4DA 3E01A 1U7HA 4CUZA 4BZQA 1NVMB 2QUKA 3KG0A 4IMPA 1IWPB 1M2EA 5E7MA 5J2PB 1YO6A 2V4UA 1VHDA 4Q1EA 2O2GA 4V1Ak 4RHXA 3SE7A 4QGFA 2QTHA 5JALA 4CLDA 1V4NA 2QG9A 1OW3B 2DQ4A 2E1MC 2QIFA 1E79D 1FDWA 3PS9A 4AS1A 1LLQA 3UT5B 2KZMA 2J7UA 4QW9A 4B8ZA 4J4HA 2BKNA 3OIGA 4UOEA 4F72A 4B6JA 1DHMA 4KXFB 4KO3S 1RT6A 1RBOB 4N7RA 3BERA 5CUQA 4DARA 1JHYA 1MMDA 2GA7A 3CCSS 4XUDA 1PL7A 1Z0SA 3G86A 1ZEMA 2OCLA 4Y2HA 4KV7A 4G2TA 2VKTA 4QWAA 3J7AC 5CHYA 4C4AA 1UJ4A 4UBOA 3PX3A 5CYPA 8MHTA 1JFFA 4W5HA 3I9JA 3G6ES 3RKUA 3CUVA 5FNVF 3WQRA 3JQ9C 4JUCA 2QL5B 3A14A 2C2MA 3JATB 5HG0A 3WMRA 5BYKA 4U95A 2ACKA 3I1JA 3CCFA 4EUFA 3MS4A 3FDZB 5A2QY 4C78A 4WPGA 4NEGA 1SO8A 4FYXA 5K3CA 4M0LA 5G4LA 1GKLA 1LWNA 3MR3A 4YRKA 4HTIA 2W6JA 1LFPA 5AK3A 4MRAA 3NGUA 1F8FA 2HHPA 4CL2A 3D9BA 2P6PA 2Z2JA 4NF2A 4N40A 2WTAA 4I1IA 3P1JA 2GARA 4I3HA 3KPYA 4HPWA 1YDEA 1XBTA 1MO6A 1TL7C 1KWKA 1P62B 2WHPA 4URHA 1VBZA 1YC2A 4E2YA 4AFNA 2OFHX 5A7FA 5FTLA 5FXMA 4R0MA 1E8MA 1SM4A 4MUYA 4U6NA 4EMBA 1W44A 3T8YA 2AG5A 3OZFA 3R3TA 1X3LA 3UBTA 521PA 1XTBA 1OHHD 2PYZA 4P98A 4NPCA 4K0RA 3VR6A 2ERXA 4QM7A 1P5RA 3NCRA 4IH4A 4G84A 2GASA 2FLPA 3IAS1 4RX6A 4HNUA 1P74A 4XEUA 1KEZA 3MPUA 3JSXA 2HA7A 3BCSA 5EZQA 4Q3BA 2FU5C 2O2IA 1QJCA 4JLJA 2XQFA 5BXYA 3M1VA 4HPXB 4REQA 1AN9A 4EYOA 1XMXA 2FJPA 2I1QA 3ZI0A 3O84A 3ZU3A 4ZGWA 5IUKC 5AWFC 3W3SA 4JV1A 1FX1A 2ZZKA 3CEDA 1OXUA 5KYYA 1UPMB 4IHKA 4CT8A 1F6DA 2IRWA 3RYCA 3MSCA 4FOPA 5IC6B 1E3DA 3O5AA 2AFHB 3G49A 3IKTA 2PFDA 4P0QB 2ZI4A 3BJIC 2UUAJ 2XWSA 5FHQA 1NJ2A 4D41A 3ONNA 1ULHA 2VOEA 3INGA 4JCOA 4EG3A 4TLBA 1UK9A 5BYQA 4KU4A 3BGOS 1W19A 3W5CA 3R3XA 3ILJA 4MS4A 4Y7CA 1R27B 3HVWA 1SUQA 3WAGA 4GM4A 4EMTA 4MJ7A 1EGVB 5EOVA 5JS6A 4TS1A 1KEEA 4ICIA 2MSLA 4BNJA 3A1CA 1F3VA 3KWMA 4D6YA 3DFZA 3IPRA 2MMYA 2CIMA 3ZZRA 2Y27A 1F60B 3AZOA 3BZBA 3WDSA 4XWWA 4XGKA 3K9QO 2EEYA 3AQOA 2K1RA 5ETNA 3KKQA 5LPNA 2EX4A 3I76A 2V4MA 3V1TC 3ORFA 1XYGA 4MULA 4WRRA 4PZDA 4IJUA 1GG2A 4HADA 3BRSA 2P6MA 2DKOB 1ENYA 1QRRA 3C7TA 4OP1A 5J63A 3IILA 4HEQA 4WKOA 2D54A 1KWMA 4ZQHA 2XCQA 2ZWMA 4I68A 3L1UA 4DYVA 1X38A 1Y6FA 2CVIA 3PGJA 1F2VA 4DU8A 4O2AA 5BSRA 4CEHA 1OPIA 1YU6A 3M89A 3DEZA 4G0MA 4X20A 3WYBA 1GPNA 2ORVA 3EGZA 4CKCB 4EZ9A 1UOQA 3KQOA 1MO4A 3L79A 2N3OA 1D07A 5H68A 3UJCA 4HAVA 4BUJA 3FVTA 4XDCA 2G82A 2WF8A 4DOZA 3W1VA 4IMIB 1IZ9A 4Z0NA 3TARA 1JJFA 2OYCA 4HAZA 3C1OA 3Q5GA 2JJYA 2X0IA 2FJUA 3TBKA 5D6GA 3FVRA 2ZIXB 2O14A 1Y11A 1Q44A 4L72B 1V96A 2ZK7A 1SBYA 3MD1A 4DA4A 2IGTA 4A8YA 2PEZA 3LPNA 4MKYA 1IJFA 1H4SA 1QV6A 1YDGA 3QJJA 4BBPA 5LWHA 3SZRA 3OQMA 4N0EA 4AROA 4DS3A 1QK4A 3DHWC 2IM2A 4NU6A 2BFDB 4K4TA 1U5BA 4CO4A 3BWXA 3UN1A 4X64F 3QKUA 2PUJA 2O3TA 2GEUA 4HNGA 3NFRA 4HLUA 4LVNA 2AVNA 2C2NA 3MGBA 3G68A 1ZM7A 2ODBA 1LXNA 1JV2B 4IH9A 1X5SA 4F04B 4JI5F 2FUG6 1F2UA 2PX2A 3ZWKA 2IXBA 4GE0A 4KJIA 1A3CA 1LPSA 4K5RA 1JIJA 2EW1A 3ANLA 5CZVA 3RS5A 1RZRA 3TZBA 5K8VA 3PNMA 4FKBA 2P8SA 2RH8A 1JNZB 3C2PA 3I5MA 2G06A 1SIWA 4QDOA 3FDJA 4Z54A 5FLYA 3VAHA 4FNAA 2I8CA 3ROKA 2AD1A 3R6WA 1T4BA 3K9WA 4LF7B 3TOXA 5EA2A 1F8UA 3LVBA 4CYUB 1FLVA 4F96A 5CNKA 1R0SA 2AYBA 3R5TA 4HDMB 3EDCA 1E6CA 3MHPA 4WU3A 1AO0A 3DZ8A 3WO0A 1JYFA 3UJ7A 3WY9A 1VA4A 3Q9UA 3VYRB 3D4NA 5HS6A 2OLJA 2P3OA 1JSCA 4FC6A 5AHKA 4WNCA 4Q4HB 1KDOA 3OLYA 4PLWA 2IHVA 2JFNA 1JJVA 2OPQB 3CTRA 4RY8A 2LD4A 1Z34A 5AVRA 3FZBA 2JDJA 1VG8A 3LLVA 2D74A 2RHOA 4N12A 2UUBF 4OLOA 1VIYA 1NG9A 3FRZA 1V8FA 1IBRA 4F60A 4IVNA 1S79A 1SQ0A 4QOIA 5GONF 1V5WA 3IV7A 2CNDA 1VP3A 4BNDA 3IXQA 5EWFA 3MRTA 3R3ZA 1F7VA 2XNDA 4NFYA 3EUFA 1ODLA 1BX3A 4LNAA 5TB5A 1E2QA 2H65B 4YJKA 2C2ZA 2OFXA 1YK9A 2GJ2A 4MGZR 3TR5A 5L46A 2QKYA 5BRNA 3OLAA 3TAUA 4YXFA 4R8LA 4BAZA 3CR7A 2E1RA 3U9SA 3U1LA 4DV4F 8AT1B 4ZEOA 5FPSA 3HYTA 5CJ2A 3PENA 2XCTB 4ML3A 5G02A 1Q53A 3FI0A 4K4XA 2X8WA 3U7QB 2GEKA 3LJKA 3EXIB 4RABA 1INLA 4AO6A 4M1KA 3RVRA 2ACWA 4HAUA 3GJTA 4MQFA 4UU0A 3DV9A 3PIOQ 2R8GA 3BMNB 4K6HA 1L4HA 3H2SA 1Y6GA 3D8SA 3T7DA 1MU2A 4MRVA 5G0UA 2F1RA 4YP7A 5JDIA 4B80A 4Q6BA 3CXUA 3GLFE 2BABA 1TQ6A 1SL0A 4O4LF 1GTJ1 2EX1A 1THMA 1DCKA 4W8HA 2H48A 3K4PA 3LX4A 4B3XA 3O4RA 1TK2A 3TN7A 5ERYA 2B9WA 2I2AA 4PFJA 3ZNQA 2U1AA 2I6SA 2YQ5A 2M6KA 5AJXA 4MR9A 1NF3A 1OFUA 2BD0A 1REQB 3LWDA 4N8DA 4E70A 5AIAA 3B1YA 4AKHA 1DEHA 3C14C 4EBEA 3DCNA 2F8SA 2YVKA 1GLGA 3HU2A 1QE0A 3MM4A 4PSUA 3CD5A 2PRIA 4DL7A 1X8JA 3WZMA 1I80A 4K28A 3PPVA 1SOVA 3DGPA 3D2CA 2A5DA 5B7NA 2VJKA 1VIXA 1KH3A 4U02A 1CRQA 3EEYA 1CUVA 1W5SA 2FLKA 1A8IA 1ACMA 1KH2A 3NO4A 1V16A 4DUYJ 1PQYA 5C8DA 2WSBA 2H8KA 1IG0A 3VVBA 1GA6A 3M1YA 4A8SA 4PYKA 2H63A 1SC3B 1X8KA 2A9JA 1P9RA 3CN9A 1H7XA 2W9XA 3ECAA 1TQ8A 5B0GA 2EFQA 2BMWA 2H1SA 4K8RA 2CXUA 1VMIA 2BDTA 1ISIA 3QBEA 3WWCA 4HDSA 1KYYA 1GA1A 2VJMA 2RH9B 3OPKA 2RGUA 5GMKa 1CD5A 1BCRA 4Y34A 4EPTA 1PR0A 4HFMA 4GL2A 5LNK1 4DKJA 3TRJA 2YY3A 3BBPA 4ELVA 1GX5A 4E1AA 2GFHA 1SJFA 2FX3A 1L4EA 4MZDA 2NO0A 3I4PA 4K9KA 2O07A 4KB7A 1JQ5A 5HE9A 5L3ZA 5TMEA 1ST2A 3FDFA 5CK5A 3ZGZA 3IERA 3RRGA 3R24A 1Q7CA 2NIPA 2D0PB 3DHVA 1CUSA 1K27A 3CJ4A 3L8MA 4NYJQ 2O8CB 1M0SA 2YFQA 3H16A 5KINB 1M2GA 5AT1B 4FNGA 1EBUA 1P73A 1KFSA 1BU5A 2PDAA 3NEPX 3KPUA 3D0HE 3PQ8A 1E6KA 3AEUA 4TS9A 1OASA 4ERDA 2B9XA 1B8NA 2LIVA 2Z6VA 1MDBA 4W6QA 1IOVA 1IXKA 3ROMA 5JECA 4MO2A 4NQRA 3BJYA 2YWWA 1QKJA 1YVFA 1GV0A 3ZNPA 1M5OC 3MTJA 2BUNA 3UAZA 3CPJB 4AULA 4UEQA 4IZHA 5EWEA 3VV2A 5D3KA 2DY0A 1TTTA 2X19A 4RUCA 2HKEA 2X40A 5EC8A 3H5WA 3TIGA 2LU1A 4D0GA 2BFFA 1HL7A 1K3TA 2B0JA 4MV6A 2P2SA 1XRQA 2XG8A 2UVPA 1L3CA 5DPMA 3LQQA 4QQFA 1Q19A 1PL8A 1F51E 4XXHA 3TMYA 1AKUA 1T6ZA 4MW5A 3I82A 4IKAA 3HB9A 5EJFA 2OFFA 5FKJA 2UP1A 1CKEA 3HBLA 3NCTA 3QI2A 2XWYA 3G96A 2OPBA 4KAFA 3MPDA 2B25A 4X3CA 2Q50A 1A0OB 5KOJA 4DADA 2C4MA 1UP4A 2HHHB 3DV2A 1JKJA 1RI3A 1DT3A 4X0EA 3FPAA 1UUFA 3MAGA 1C4XA 4QCLA 3BREA 4EGLA 2DGXA 5EE9A 4AWXA 3OFJA 4GHWA 2JJ1A 3DWIA 4G0NA 3L06A 5HKKD 2NYHA 5AESA 5JI2E 3KSUA 2GZDA 4AUMA 4BECA 1KDRA 3ZI4A 4A6DA 4RXUA 3PFFA 4X65J 4RDXA 4N76A 5T6BA 3FLMA 5D5QA 4MTLA 2Q7XA 2XUAA 5J5VA 2WJIA 3CR8A 5COBA 1EGMB 3ZXXA 3RM3A 2MWMA 3OIUA 5KQGA 1R6TA 3MM9B 3NDBB 1HG1A 4B2IA 1O0BA 4A6XA 3DLPX 2CSXA 1IWBB 4DAOA 4ODIA 3AD8C 2I3GA 3OSZA 4N9QA 1Q95G 1A27A 1N2CB 3OZAA 1KI6A 1ADFA 3TEHB 4R69A 5JPCA 5DT2A 3NGRA 5I9IA 4I1PA 3F7TA 5CJPA 2VPXA 5B53A 1JFLA 1CJVC 1CY7A 4F7VA 4HNTA 2GEBA 3MUNA 4RFSA 4R8MA 4QDUA 1M34A 3MMBB 1RYYA 3H3XA 4JY7A 1W59A 4O3MA 2HA0A 4XWKA 2PSZA 4RA9B 4DX7A 1DPGA 3GC6A 4A1FA 3EQ2A 4XD2A 3CNOA 4WL0A 3O8WA 1LSOA 2PKRA 8ADHA 3O03A 2C5LA 1OZHA 4E3ZA 1FW8A 1XMJA 4JT4A 2QN6B 1RKUA 3E5RA 5L9NA 1SCIA 3EZ6A 2AP6A 1R4NA 2Q43A 4N3AA 4GXQA 4F2DA 1D7OA 3UNYA 1JVSA 2OORC 2EBUA 2R60A 3OD2A 1FDUA 3JQFC 3ZU5A 1IM5A 2WSMA 1HQEA 2DPIA 2WM3A 4AY2A 4JSYA 1TFWA 2IMOA 4J3NA 3I37X 3OT5A 3N6RA 4F46A 3WDOA 4HXYA 4X4OA 5GADI 3CGWA 1S6YA 1UBUS 3T3NA 1WC1A 4HUTA 1T36B 2R79A 2K2QB 1XDGA 5A6SA 3PW2A 5CVUA 3DCJA 4ZVUA 2OXFA 1R0RE 3X1YA 1QLJA 1M1ZA 3DDZX 1UEKA 3KLHB 3ZE9A 3HG7A 4PABA 4IMRA 3L5OA 3JQQA 1EX8A 4UNPA 1Y4AE 2SNIE 3ETDA 2QTFA 4DMKA 4ND1A 2ZBDA 5FUQA 1E0SA 1IOLA 3H1PA 1N75A 1OB2A 4ZOAA 5G3ZA 2FHSA 4F91B 2VAMA 3PHLA 4QFCA 2ETVA 5IT9A 2HWTA 4L4XA 3UG7A 3KSDO 2FQ1A 3BSYA 5IT5A 4Y2JA 4O08A 1NRKA 1GTL1 1YQ9A 2AYMA 1SBHA 2Q5QA 4BMZA 3ZDQA 5F73A 4U2BA 3ASZA 4GO5X 3UD5A 4C8YA 3UD3P 2N46A 2I38A 1R8YA 3MPOA 4XPIA 4BGVA 1P1TA 1WEHA 1WUYA 3ORYA 3I6MA 1CQXA 4LVNP 1XD2B 2BHNA 3G2KA 3FK4A 2ZYUX 4ADSG 3CMAS 2ZKIA 1AS2A 4CODB 3LYAA 5ABPA 5LXTB 3ZHZA 4MYCA 4PTYA 2DBBA 1FXRA 4HDNB 1E7RA 2JCSA 2OV8A 5KC8A 4LI0A 4Q1AA 4D82A 4MVXA 4FXVA 4LNHA 2JI7A 2REQA 4XTTA 2AF4C 1PR6A 4P81A 4M1ZA 2W7OA 1USGA 4NA2A 4B75A 4D56A 3P45B 2IXFA 1R89A 3DC7A 1X1EA 4IGEA 1UTAA 2J6UA 4OYXA 1P3Y1 1Q0PA 4R2WA 2YINC 5AKZA 5HE8A 2I3ZA 5BWOA 4OK3A 4UNSA 3SLGA 3IDOA 2WSSA 1DY3A 3KG1A 1Y5MA 5IV3A 2FR1A 2RJNA 2VBIA 3R6LA 5F3ZA 2ZIGA 1JQGA 5AVQA 1U0LA 7YASA 5C80A 3LGNA 3PDIA 4DSNA 1IAQA 3GRZA 3CXRA 1NBOA 3DOOA 2YXBA 3JYOA 1XZ8A 3OLQA 3ZGYA 1K97A 2RBEA 2NSCA 4ARUA 1JH9A 2AKWB 4WN9A 2HWUA 5C8YB 1NBHA 3W8GA 1JRLA 8RUCA 5DGDA 2F3UA 2VG7B 4M95A 1L8OA 2F3PA 3H4TA 5F0UA 3EEQA 1K8ZB 5LP6A 3DZJA 3BXPA 3C3JA 4LRUA 5CLFA 2ZRHA 3C4QA 4M76B 3GGSA 4P34A 1DJ0A 4L16A 1TJ5A 2YWRA 3B7WA 2EWVA 4WYWA 2QO3A 3OESA 4AM8A 1QLHA 1M5HA 2BCJQ 2V6IA 1E2BA 4UHBA 3UVJA 4DLVA 4DBVO 2ZH2A 2RGRA 3B8HA 1YJAA 2UUPA 3A2MA 4RUBA 7FDRA 1GFIA 1CR4A 1GZUA 1XVIA 4EZIA 5MDHA 2NMVA 2NV2B 5BQ5A 4U7FA 2V2ZA 1KO7A 2NOAA 4P5PA 3GJRA 1S6UA 3GG1A 4UM7A 2R1TB 5TMPA 4ZOLA 4MVJF 3WKEA 4J9SA 5EMKA 1T0UA 2OSBA 1M6NA 2E5FA 3QEJA 2RRAA 3PJFA 4UY8T 2Q9AA 1E1QD 5CH7B 3RJMA 1CUEA 4CUKA 1VQ7S 2A1UA 2VDMB 2H18A 3LA8A 5K05A 1WZIA 3I31A 1NLFA 3GZNA 3EVTA 1O9GA 2HZBA 3UZUA 2NQPA 2WDZA 4UHHA 4ED2A 5BV1A 1M2OA 5JH7A 2V1XA 2VDRB 3ORHA 3TNJA 1M2JA 4R6XA 2OMKA 1M1GA 1DUSA 4KE5A 1LDYA 4RVDA 2O8EB 4RD0A 5BRAA 1RWMA 5EINA 3A3NA 2AR0A 4BMDA 3CNLA 5ALSA 5A4DA 3JWEA 4ID5A 5DDQC 2CLDX 2MTBA 4E94A 1KS9A 2UXBB 2PD4A 4MKAA 2YCLA 1X4EA 4E46A 3MM7A 1F4LA 1R0BG 1RI4A 1SN7A 4F4DA 2PA8D 3P27A 1ZCJA 3TSOA 2VHVA 4URXR 4YMLA 1CY1A 4DWWA 821PA 2G1AA 2IXTA 1GGJA 2RGGA 3VGUA 3TJMA 4EAQA 5A3QA 5E3AA 3G9XA 3C6TB 1T6BY 3LAWA 1EXVA 3R1LA 3KZCA 6GPBA 4NZ6A 3SSNA 4EG4A 3WL7A 3T4PA 4GI1A 5GZ1A 3OIYA 1YIOA 3DLKA 4FMDB 3DM9B 1OE0A 2VXOA 4GLLA 4V1CB 3A3OA 3K5LA 3M9LA 1EKRA 2PQ0A 1WWKA 3T5HA 4JR0A 2ZZNA 4ZN1A 5ARDA 1UQTA 3GP8A 1W48A 4WKPA 4LTDA 1W26A 1K5HA 1WQ4A 4OEHA 1Y3BE 4UTOA 4PZPA 3D4IA 3RB3A 4KVFA 3T12A 2L17A 1U2SA 3S2SA 2FWBA 2EARA 3ICPA 2B5WA 3GHHA 1IIRA 8OHMA 1QD1A 1WOMA 4G0PA 4U8GA 4BMCA 2X41A 5F64A 3MXOA 2K3KA 3L1HA 3VVUA 3D6MB 1FDDA 4XM1A 1S02A 1YR9A 2OXIA 1OY1A 3FFIA 4QT4A 4RZHA 3AWDA 1NBAA 2G0TA 5I7SA 3CUKA 2PAFA 2A0WA 3HKZD 2L42A 5JO9A 4E32A 1D8TA 2HIHA 5IANA 1CDOA 3GLUA 1ZESA 1VJDA 2QMXA 2WNHA 3HL0A 4KODA 1PYOB 3N70A 1OBHA 4K3VA 1H2AS 1SVSA 3DBLA 1P29A 4Z9FA 4I5EA 3Q0EA 4F06A 4HEA6 2JBAB 4V2UA 2U2FA 2BMBA 4GXNA 2P0EA 3WMFA 3Q8KA 3B52X 2PMEA 5EJ4A 2GILA 3D3WB 1ZDMA 4C0XA 4A8TA 1MRSA 2H7CA 1BDIA 4RJJA 3H2KA 2CZ9A 4QBUA 3L7LA 2AKEA 2PBRA 4WWSA 3OWHA 2RGEA 4TYQA 3N3BC 1JQ3A 3M4JA 2GAAA 2XHWA 1TEZA 1JSLA 4QA9A 2WJ4A 3LCJA 3AH8A 4HI1A 4TUYB 1OYOA 1RKBA 3EJMA 3CO5A 4MTCA 4XJTA 4LCBA 3C3DA 3Q7SA 4KLNA 4B5LA 4G1MB 3T7KA 1RLUA 4H1VA 1AQJA 1P9OA 4MWOA 1UVIA 1FFSA 5BJRA 5BSUA 3T4XA 2NVWA 1Z0DA 3OVSA 5B1HA 5CT4A 3MAAC 2W6IA 2E9TA 2QT9A 5LL6d 2IZ6A 2JLYA 1RXUA 2XGQA 1U2DA 3OT1B 4S1PA 2A58A 4NPHA 4MKVA 3DDCA 5HBGA 3C4VA 1BGXT 1VHJA 2Y8WA 2H3EB 3FUXA 1BY9A 1H1LA 5GMDA 3Q6MA 4C89A 3CDWA 4DR6B 4N7JA 4H54A 1JHVA 2GA9A 3DAGA 2CPJA 3M7IA 3AXTA 3DI6B 2E1AA 3VC2A 3W1WA 4KMOA 3LU1A 3QNWA 2X8LA 3ENWA 2V96A 3LVFO 3AJ8A 3MWDA 5EPUA 3IFSA 5JWHA 4D9NA 2WONB 4ZK2A 1X4HA 2RRBA 5AVYA 2JEFA 4D26A 4RZSA 3T1VA 2X1BA 1Z0KA 2FFAA 5FWNA 2RHQB 1H2ZA 3MJEA 4D4MA 3M6VA 2ZE8A 1UJ2A 3KV1A 4MA4A 2CSUA 3D8TA 2CLHB 1HNZJ 1NQUA 4GO7X 2VQFB 1SD5A 5EXDA 3S8EA 3AHCA 2E5LB 3F3MA 2L2QA 2ST1A 3IPAA 2HHXA 3AM5A 4KUEA 5HKOA 4KXMA 4RD1A 2P78A 3HA5A 2VJLA 1TTHB 3EY9A 2J3KA 1X1CA 3HXMA 2Q4EA 3OVBA 2HH9A 4I56A 1UETA 1QZ3A 1N56A 2OTLS 4JHLA 1LEOA 2C9YA 3E03A 3K70D 5IAGA 1GQFA 1MLDA 1NVFA 1FDVA 1RXOB 2Z3VA 3ZQJA 3FKSA 3F41A 4F3QA 3M4NA 3OHPA 4BP8A 1NJGA 2YNHA 3H1EA 4JB2A 1V1MB 1B0ZA 5KNDA 3FSXA 4GF5A 4RW7A 2D3TA 2X1MA 6LDHA 1JEJA 3REQB 4BWJA 3HVTB 3ELYA 1Y6QA 3HUTA 4K6MA 3N58A 4FILA 5H70A 3Q89A 4L2IB 4RESA 4PXSA 3ISJA 4F3YA 1KJNA 1T9XA 2PM8A 1LK7A 1G9TA 4BFCA 2VIIA 3JASA 3R4VA 4G3IA 2QBYB 1JKMA 3P0FA 4JKOA 4RZ2A 1QG4A 1RRVA 1XT6A 4A8WA 3N7AA 1IXYA 1HA3A 3B7GA 3OUUA 1UAWA 2FC9A 3AVPA 1Q0TA 3CCWA 4N8EA 3ITHA 2HSEB 3UG6A 2FLOA 4BNVA 1FERA 2O2DA 1ISSA 1KVJA 3N86A 3H3FA 2LA4A 2YNIA 1DO0A 5M3BA 1PVVA 2BAGA 3W66A 1G20E 3MEKA 3ODGA 5L7YA 2ISSD 4Z4HA 3M9OB 3K0FA 3H0KA 5KJCA 3S99A 2PT9A 4HI2A 2NP6A 3V48A 3CF2A 1Q5YA 1S12A 2ACEA 3CUWA 3LPEA 4DF4A 4RJVA 1KZYC 4OXYA 5AYVA 1Y7LA 2G5PA 4PZLA 4UDYX 4OQYA 3SCZA 4XYLA 3JS9A 2HJGA 5B1DA 2HPZA 2XWJI 3NDRA 1XDZA 1YMUA 3T9CA 5FDFA 3FUYA 3OFSA 1WVMA 3AL2A 3BXEA 3O4GA 3LIPA 2IP1A 4EAAA 2CFIA 4YCJA 3UJPA 4XYGA 1PI3A 1RCUA 1RTHB 1VBNA 1IN6A 5IXUA 4NU5A 3U7FB 4C8LA 4ECYA 2ZCJA 4G89A 1YJ5A 4FOTA 3C16C 4OM7A 5HK8A 4QIWD 1W1IA 2GMLA 3QBTA 2AFIB 4QO7A 3KEMA 3K70B 4S0ZA 3FOBA 5EXXA 4LJSA 1HW8A 4K2AA 4HDHA 1SXJC 4DIOA 4I6JA 2Y1IA 1AGPA 4UM8B 3B3QA 5DTRA 1RHKB 3KUKA 3UAGA 5JBNA 3JQGB 4FNHA 1QFMA 1TP7A 2AXEA 2PJRA 1PYGA 2HWHA 1LRJA 3GLRA 2W6OA 3NGLA 5F51A 4BO1A 2VT6A 5JXJA 1UWKA 4L08A 4ZHRA 4Y2MA 1BA2A 3IOBA 3LQYA 1MB2A 2BKPA 4D9JA 2V2QA 3FDXA 1VRUB 1NJXA 1CJKC 2DNGA 2XD9A 3PJDA 2OSQA 4GEKA 4NYMQ 5FIUA 5G1NA 2QV0A 3TQFA 4JH0A 3MM5B 4L9RA 4WBNF 1VKRA 4TV8A 1S8NA 2V7QA 2ZRFA 3MTKA 1NVBA 1L5GB 3AHIA 3CTMA 2C2DA 2OM2A 1W75A 5B0EA 1W2WB 4QJBA 3O3MB 1U2RA 3BWCA 4TN5A 1QAIA 1RBZA 4M1TA 2BGJA 4B3OA 2F64A 2NTNA 4WFKA 3VZPA 1Y1TA 3MWFA 3BK1A 1M8FA 1Z08A 3W8NA 1LPOA 5CNIA 3GJ3A 2GAJA 4DT1B 5ICFA 3LYLA 3ISVA 1SUEA 3VMMA 4HVZA 5BWMA 2C7GA 1O5IA 4ESOA 1OH6A 2A35A 4JJEA 4J9VA 4J91A 3O2IA 4PYNA 4LY0A 4HVCA 3DHYA 2XR1A 4C7XA 1MRNA 1WMSA 1A9OA 3RHZA 4ZYXA 3EVAA 3IO3A 5HQJA 4K7JA 1FESA 2W2QP 3JQRA 3NAGA 3LUFA 5D0HA 2NZVG 4WVFA 3IMQJ 1OBFO 2OP5A 2GVDC 3RHFA 5G3YA 3DYAB 5CCBA 2X1AA 4H0NA 4OSOA 4K9SA 3TJAA 3D31A 4QHTA 4F5EA 2EVWX 4DXHA 1WF6A 2OAP1 1NVKA 3VAMA 5EYPA 4X7PA 3NTRA 4O02B 3NBPA 1GG8A 2HR1A 3KOWA 4ZOCA 1XZBA 1JTVA 2I9PA 3A6KA 4RSHA 3RAGA 4H0FA 2HFNA 1T11A 2CD9A 4UPEA 3HB1A 1I7DA 2IS4A 1P27B 4J90A 2V5HG 1QYWA 1ZIPA 1A7AA 2UVRA 3HO6A 3LY9A 1B6SA 1VYVA 2EJCA 3M2UA 4HQNA 4TYNA 4EWLA 2FF5A 2R97A 3EG9A 4DANA 5A4KA 4KTTE 1NXPA 1EDZA 3MMCA 1P9NA 2C1ZA 3ZW9A 2VBXA 3V1LA 2OUGA 2WYIA 2BDUA 2V8VA 3HM2A 1TM4E 1M6VB 4H7KA 2B61A 3LGMA 3IDAA 2JZ5A 3SZ2A 1YRQA 5KQSA 1B8UA 3TIXB 4USJC 3KWLA 2W9BA 3CURA 3K9GA 4GI3A 4YAIA 1VG0B 1SJQA 3LE8A 4JC8A 4MGIR 3ZLTA 5JC1A 1ULTA 4PPGA 3HYLA 1AFJA 1I2CA 3G2PA 3IUJA 1Z4NA 4EYHB 4LXTA 1RT2A 3NHYA 4RW9A 4YREA 2F3QA 4JLMA 3SBEA 1B8PA 4WCFC 4W9MC 3VR5D 1TYCA 1IZYA 4AW9A 5ALGA 1A8PA 3F9IA 2ODQA 5CTAA 1M76A 1VHQA 1G1XA 1QAMA 5IJAA 1JQAA 1QJ4A 2X86A 2X76A 1E2EA 5HMMA 1XR5A 1DQRA 3TW0A 2ZSIA 3V2UC 3ISZA 1O95A 4E5NA 1M6EX 5J2NB 4KX5A 4QQ8A 2DY1A 1E4OA 3O94A 1YTUA 1Y4SA 4YJ3A 2LXNA 3COYA 3RVSA 4L5JA 1KTIA 1JBEA 3P2OA 4YOEA 3BRWA 3CC8A 3AGPA 6Q21A 2MGZB 2I0XA 1UBSB 2ZYAA 1AUDA 1L7VC 3ILXA 3EDQA 4M36A 1YK1A 4ND4A 1SIOA 4HGOA 2QSWA 4A9AA 1ZD1A 2VTBB 2ZIFA 4B8WA 1P3DA 2K2PA 1KAGA 2W98A 2IZ5A 4CCSA 5HSGA 2H5JB 4NMLA 3IP3A 3U31A 2SHKA 1YZNA 1KSJA 5JWRA 5EIAA 1NQXA 1SQSA 4RF2A 3HDQA 1WDWB 1C0TB 2GSDA 4F2HA 4QREA 3RTAA 4LRWA 1DS6A 2D5LA 3OQIB 5E4TA 3CPHA 1IUOA 1ZO8A 2WSYB 2RK4A 2DR6A 1USIA 2J1LA 4PO9A 3GT7A 2NXNA 2JAUA 3VTFA 3PJGA 4YWHA 4MKGA 1QHYA 3QVMA 5HI7A 3QIVA