1M0SA

Northeast structural genomics consortium (nesg id ir21)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21
rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
molecule keywords Ribose-5-Phosphate Isomerase A
total genus 72
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m0sA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m0sA01
2WU1A 3AB4B 3P96A 3AAWB 3EB9A 2P9CA 5FIIA 1FS5A 1HORA 3LHIA 4OQQA 4L50A 1O8BA 1HOTA 1LKZA 3OC6A 1DEAA 2ZHOA 4R7TA 4PWUA 2P9EA 2DT9A 5JJBA 3TUIC 4LUBA 3ENWA 3BXGA 1ZPVA 3DC2A 2JOQA 1YGYA 2GNPA 3LOUA 1NE7A 2F8MA 2F1FA 3BXFA 2PC6A 1PBTA 2KO1A 3N0VA 1UJ4A 3NWPA 4GO7X 4TM8A 2LQJA 3W7BA 3IXQA 3UW1A 3CEDA 2PA3A 3OFEA 1SC6A 3E15A 1RWUA 2R5FA 2J0XA 1VL1A 3MTJA 3LUYA 2CDQA 1KS2A 1LK7A 2BKXA 4TM7A 2DTJA 2RQKA 2RQMA 2RE1A 4X84A 1PSDA 3LWDA 3DHWC 3HHEA 4L5IA 3TX2A 3NRBA 2J0EA 3NZEA 4M8LA 4L51A 3DHXA 1M0SA 1LK5A 3ENQA 3U7JA 3BXHA 3OFGA 3OFHA 1FSFA 1UJ5A 2NYIA 2J0WA 1CD5A 2MDAA 5IT0A 3AB2B 5HJ5A 3ENVA 1JT9A 1XTZA 3OFFA 4IO1A 4L5JA 2RI0A 4R9NA 3DDNA 5IS2A 3KWMA 2FGCA 2QMXA 2OKGA 2LVWA 3IBWA 2I9SA 3TUJC 2H9ZA 2BKVA 4GMKA 2RI1A 2QRRA 3EFBA 2JHEA 3HN6A 2QSWA 5IT4A 3CH7A 4OQPA 2O0MA 3ICOA 3MWBA 4NMLA 3OBIA 1Y7PA 1YBAA 2P9GA 2QMWA 3O1LA 1FRZA 1FS6A 1U8SA 3MAHA 2W48A 3CSSA 1UJ6A 3BXEA 5T41A 3K5PA 3TUZC 1Y89A 4GO1A 4L4YA 3S1TA 3L7OA 4L4ZA 1FQOA 3E7FA 3KV1A 4GO5X
chains in the Genus database with same CATH superfamily
4YRMA 4RY0A 4HAUA 2NSCA 2XB9A 3UM9A 1DRUA 4JUBA 4PZUA 2NQ2C 2PRYA 4JBIA 4WQMA 3DE3X 1YS1X 4AG5A 5GMKa 5SZTA 2Y1IA 4HRXA 1JT2A 4D02A 1G3QA 5HJXA 1ZHOA 1NBEA 3C6KA 3IUEA 2RRNA 2ZIFA 4YRLA 4B7UA 4MDEA 2O8CA 3BRQA 3SDZA 3IUMA 4EHLA 4BVBA 4IYRA 1W0KA 4Y0AA 1REVB 3W8GA 4F45A 4FWBA 1PR4A 4BDSA 3MM9A 5EXTA 3SYNA 4Q21A 2WK1A 5L38A 1U31A 2ALJA 5FORA 4ECEA 3C6TB 1T6NA 4OKSA 4ZOLB 1Z28A 1N2OA 2FVCA 1C14A 3IQDB 3FF4A 5F98A 1X9SA 4FLMA 1TM4E 3KHRA 4LYGA 2B5OA 4AIIA 2UXDJ 3F3MA 2CHEA 1Q1KA 1P61B 4OAQA 3WYFA 3GDOA 1RWOA 1RJJA 2FSVC 2X1HA 2C1ZA 1NLMA 2GB4A 1ZIXA 3O3CA 4LJMA 3I6BA 3O83A 2GJ2A 3H2UB 3DFIA 1UZHA 3LLCA 3KXIA 3KV1A 5B0DA 4ED6A 4QOHA 1VI2A 4GMHA 5F3ZA 3KYBA 1DBPA 4JI3J 1O8BA 5K4HA 4GC7A 1H8EA 4EHBA 3IJ5A 1N6IA 1EDBA 4FYMA 1JHMA 3FPAA 3BA1A 2Y9HA 3KE9A 2E6KA 2BHLA 4J0IA 3FCEA 3C6MA 4CBVA 4NABA 4YK7A 1FFDA 1C4OA 1JXEA 2Y1FA 2ATCB 4ICIA 3DE5X 3O3NB 4BYMA 1MAHA 5CFMA 1WRBA 1RVV1 3EFOA 2A9OA 4OJGA 4IHJB 3VYUB 5KB3A 1R1DA 3PENA 1U8ZA 5K3CA 1RE0A 3HSJA 1P45A 3AFHA 5FPPA 3GPLA 2Z04A 2B2CA 1IONA 2V7QD 3TAHA 1VQ7S 3B85A 4D7AA 1EWKA 2O2GA 2G09A 2PUDA 1VLQA 4I2VA 4H35A 4DUTA 3V4FA 1S76D 5HIAA 2XNDD 4UF4A 5JAOA 5LP6F 2QG9B 4NBSA 2JC0A 2UXCB 3UMFA 1GL6A 3CDAA 1Q2UA 2VL1A 4E13A 1AHHA 4G97A 4UMDA 4YMUA 4RF2A 2ZOMA 4DCJA 1LQ2A 2DRAA 1TT5A 5ECWA 4INJA 3MGJA 1SUEA 4QJVA 5AHWA 5LU8A 6YASA 2MZRA 1UBUS 2VP6A 4PZYA 3QKRB 4OX8A 5CYJA 1JE0A 3PYDA 3KQUA 2YXEA 3CRRA 3IMGA 1K9VF 4U2KA 2QTVA 1M5SA 3B2NA 3AQPA 4EAQA 2OWDA 2WA2A 1XDSA 1Z4MA 3RHSA 3KJVB 4FXDA 4W90B 3JASB 4KKOA 3DMHA 2AMCB 4NAHA 3H3JA 3L6UA 2HQBA 1AS2A 1A7GE 1Z63A 2UU9B 2VJKA 5EWLB 1AGNA 3BSNA 1VXRA 5CP8A 5IVHA 1WUJS 2FLOA 3BDPA 2BSXA 4JP2A 1GYQA 2GBLA 3NQ41 3GU0A 2BFFB 3GP3A 2XO6A 3AEYA 4G23A 2C3PA 2W42A 1S3IA 1KOHA 2HW8A 5HMMA 4XQEA 4ZWNA 4D3HA 1CZLA 2GAIA 5JVHQ 3GJ3A 2XCOA 1E1CA 4Q9HA 4F8YA 4B6OA 1FTRA 5J1SB 4Q0BA 2ZI5A 1W7AA 1ZPVA 1ZD2P 1XZPA 1POWA 1DWUA 1T5BA 3VKWA 1YZTA 4BUJA 3OM9A 3PX4A 3I61A 5J2QA 3VJLA 3CEHA 5EPEA 4HLUC 2K8GA 1RWNA 5DTQA 4D9FA 4EPRA 3F5MA 3C3LA 1NIPA 1WB6A 4XR9A 3C3JA 2B6NA 4UZFA 2Z0MA 4RE6A 4EUKA 1H2EA 1IVNA 4OI4A 5LQMA 2F59A 1VZ3A 3II6X 1ZUNA 1AKWA 5KIAA 4HQ6A 4PGMA 1S9GB 5F1KA 3RU7A 3CPWR 1AF4A 4BLPA 3MWKA 1BGVA 3DYAB 3R2CJ 1P7ZA 4QHSA 2V1UA 3V2HA 2AJ4A 1RHMB 4E2WA 1XEWX 4LQCA 4TLCA 4K7JA 1RYZA 1PW5A 1NJ5A 4ER5A 3ONFA 3UMVA 4LT6A 2AG8A 1E9CA 4PRKA 4YJHB 1TKRA 3G96A 4IRXA 2KFZA 3TBKA 1P9YA 5SZJA 1VYHA 3L8DA 2WHYA 3CIOA 3I9KA 4KDFA 3KSBC 4B81A 3ABZA 1MA3A 2BEVB 2VZ9A 1V1MA 2CMDA 4MQMA 1UXIA 1T1RA 4C04A 1KYZA 5ITWA 3QFRA 4B87A 1T3GA 4N0DA 3GLIA 2Y0BB 3IDAA 2LYVA 2YYAA 1HWYA 2RNEA 3ZZOA 5DM60 5DBIA 2HV9A 2PNJA 2B4TO 3M1YA 2N46A 4AJKA 4DLXA 3I55S 1N8RT 5DHSA 5EKUA 1TRHA 2O2DA 4RVFA 3GDWA 1JDSA 1JH8A 3CJ4A 4P4NA 4HKTA 1S6PA 1BRMA 5JRDS 4KLZA 4RULA 3H6HA 1TMKA 2QVXX 4H4KC 5FNVF 3F98A 3GG9A 1P4RA 4GZ3A 5LMUJ 2QDXA 1T2VA 4AFFA 2YFKA 3ETEA 2ZR8A 3FSJX 1VQKS 1XNQF 2H00A 1I8TA 1U24A 2FQWA 4TT3A 3JQRA 1C7FA 1X7XB 3NMAA 4GPBA 3GCXA 3OTGA 2BFCA 3NPMA 3E48A 4B2LA 2P35A 5IYZB 1RLJA 4JVSB 1XTRA 4MR7B 2H0AA 3QLJA 2GZRA 5CD1A 4X1IB 2WJ3A 1R0LA 4A6EA 1FFSB 4K6CA 2E1RA 3D6VA 1S5ZA 3SIRA 2ZNZA 3DRPB 4DR2B 3GQVA 2JZ5A 1Z68A 3JVIA 1K5PA 1ODSA 1QLJA 2GFQA 2NVUB 2QNIA 1VFJA 5AJZA 1JEYA 1CUFA 2DXFA 2QN2A 3OJCA 4DCVA 5KT6A 2V96A 4DX8H 4WFZA 2YJTD 3QELB 3GP8A 1LBSA 1VRQC 3ZPXA 3U4GA 1W19A 1IOZA 1J0BA 4MDFA 3T7EA 2Z3WA 2PX3A 3PUKA 1G19A 3NS7B 4QIEA 1I94F 1OH7A 5IC4A 4B3MJ 2UDPA 1PBUA 2GN8A 3SSSA 2PPVA 2C00A 2I4OA 1PFUA 5KFQA 1TCCA 2X0RA 4Z51A 5GV8A 5JQGA 1UA0A 4OLHA 4WK6A 1MIHA 3DZDA 3L2OB 5JLAA 3TZCA 3VF0B 4UBJA 2QW1A 2VHJA 2GESA 4CM4A 2KB2A 1QXSA 3WMEA 5LM3A 1WY7A 5AKXA 3Q7IA 3G8SA 4ID8A 1T1SA 4OSOA 2IHJA 3BPDA 4KB5A 3IAS1 3P94A 4XOUA 2DWCA 4XTRA 4JUCA 1E18A 4Z5XA 3DHXA 4UULA 1NVVR 3ZWAA 1KEUA 1IHOA 2OGSA 1Q1ZA 4LECA 1KBRA 3DUWA 7REQB 1MT0A 4NZPA 3OLXA 4KN9S 4P7GA 2F9MA 4K9NA 3GQBB 3EZ2A 3SJ7A 3PJFA 1GUDA 3HJHA 1CPYA 1YUMA 3M2UA 2C0PA 4RA6B 3FCOA 4ID5B 5C7YA 3U62A 3AUFA 2ODNA 1HLPA 1QFYA 2HK2A 5IWCA 5DG8A 1WY5A 4DM4A 1C1XA 2WM9B 2OWEA 1QQ5A 1MW8X 3FRHA 5CZXA 4BWMA 2EEZA 3CWCA 2DWUA 2O0KA 2CXEA 3K0FB 3BK7A 3DOHA 4MJ7A 1PL7A 3BXZA 3SDEA 4Q7QA 3VYSB 1BRTA 4MP8A 1TELA 1K73T 2J4CA 2R6GA 2IP4A 2QX7A 3D7RA 1TKXA 1UJCA 3E1KA 1XAIA 3SCZA 3WO0A 3CO0S 4HB0A 3TZEA 3VU9B 3OKPA 2ZTHA 2BR3A 4TVAB 1P2DA 1XCJA 3UY4A 1QRTA 3GARA 4HG2A 3FGVA 2NYRA 2EWWA 2A0UA 5AK6A 1XLVA 1MTOA 3TAUA 2VJYA 1JIJA 3DFZA 4D3GA 1SXLA 3FTEA 1UZMA 4N5DA 3I5AA 5DCWA 3H0CA 4M5DB 1UKAA 3G6YA 3RIEA 3MZIA 4B3TF 2DNLA 3VNQA 4I2NA 3V33A 5EJ7A 5FV7A 1G2IA 4DWJA 1BXZA 4B82A 1E8MA 3WYNA 4EZ9A 1NKEA 1K0UA 4DR5F 1EVYA 1G21A 3V1UA 2NV0A 4TMFA 3I1YA 2P2DA 2YUIA 3OXLA 1KMNA 2ZIZA 3JVUA 2DNYA 2O4UX 2R8HA 4U02A 2DYAA 4IQMA 2DEIA 2VPWA 1ZGBA 3AV0B 1IDN1 2IM1A 2GA7A 1WHYA 3CCSS 2Y1JA 2I1LA 4YPOA 3OLWA 4YGXB 3V4LA 1A9RA 4X6YA 3ND8A 4H0CA 4B3IA 1TA0A 2OE2A 2AYZA 5KPDA 2UXCF 4Z1MA 3EGXA 3DMYA 2R8RA 1J2RA 4WKYA 3A1SA 3RTEA 1IIBA 5LOVF 3KOXA 3H04A 1EJ6A 2C8KA 4RNDB 1CJVA 5BUQA 2GWRA 4CKXA 2CKMA 4R8SA 3H2LA 2ZUGA 2OZVA 3KTQA 1NJ1A 4X1YA 4KGXA 3M5DA 3EOZA 3J81k 1UEVA 1NW6A 1WCXA 4EBEA 3PRHA 1CJSA 4IYJA 3BIOA 5ETMA 2C2XA 4F92B 2PTGA 2DBZA 5FD1A 3NLCA 3OE7A 1IZ9A 4K4TA 3ZD7A 4HNUA 3T1TA 2OHGA 3T5PA 1YKFA 4N5HX 4PLTA 1Y6JA 4P3YA 1HFJA 2B0CA 5BR8B 1KYYA 1YACA 1UA1A 4W5QA 1YRHA 5A1TA 1FP6A 3A1YG 1N1MA 3ZZTA 3I31A 5L45A 2PC6A 3K73O 1Q83A 5K9ZA 3OE4A 2L9NA 4DCSA 3WHKA 4G81A 2B8JA 2G67A 4Y3CA 1A5SB 3FQKA 2E4ZA 2Q07A 1EUCA 5JWHA 2AKEA 2CF5A 1AS0A 2BFEA 4X24A 3MURP 2PRIA 3UR3C 1SH2A 3U7JA 3BXHA 5COAA 1ZZFA 2JFYA 4KO1S 2BANA 1E8DA 1P33A 5B7PA 2HOQA 1CYDA 5CXUA 1M5PC 1Z4UA 4LA4A 3HSZA 1HK7A 1U2DC 1TMYA 4PRYA 5D5HA 3EZNA 1TUIA 3RFTA 2O8FA 3WI7A 1YRLA 4HT3B 2C83A 1P1HA 2JEGA 3DEYX 4WT7A 3C24A 1PNOA 3BGRA 4Y8VA 2I03A 1E7WA 1J2YA 3D2WA 4ENRA 2RU3A 4ARVA 4EKGA 3COPA 3O9VA 4JELA 1T8UA 1HQKA 1P72A 4OX6A 4Q82A 3C66A 2EP7A 4B3DA 4RLEA 5HG0A 4DNQA 3HABA 1UXGA 1JFFA 3V4RA 4LRBA 4DLZA 5TVGA 2HLUA 3EXHC 3QG1A 2H9AA 2FLLA 3H5LA 5JFTA 1MJNA 2G9RA 3RS8A 3WYBA 3V7FA 4HXEB 2M3DA 4ES6A 1JZTA 4WF9Q 3RYIA 4I8XA 4D80A 1NR7A 5KYGA 1PFQA 4AUKA 4N65A 2BTQA 4MWEA 2VJMA 3K70D 3NYRA 4IKEA 3KMSA 1VSBA 4EW1A 4RK7A 3DEIA 4MROA 1SBIA 1OJ4A 4EBCA 4DT1B 5EN4A 3ZZMA 4L5AA 4L9SA 1IOVA 3OQJA 1M2JA 1BYIA 5GJWC 5BYBA 3OHMA 1H0KA 2YYSA 1D2AA 1IQ0A 4DFJA 1OTYA 1BCSA 2VYFA 5KC9A 1UVKA 2XSZA 2QG4A 4DKXA 3GR0A 1LC3A 1LLDA 2HBYB 2G1KA 4M9RA 2P6TA 4LFAF 1TQHA 2QD5A 3JZDA 3DDSA 2P2LA 1CG2A 1VPVA 4R3WA 1B8OA 1G3IA 3WTCA 3M6UA 1G9TA 2H2IA 4IDNA 4PSAA 1BA3A 4KIAA 2VFTA 4DUZF 2ZB8A 5C4IA 2FK8A 3R1HA 1Y5NB 2G6BA 4I5GA 3B3AA 2SICE 1C1XB 1Z0DA 3L1KA 3K9NA 4C76A 3OMWA 3KHLA 2EW8A 3EC2A 3PNKA 5I45A 3ZWNA 3MJDA 3G5AA 3F2VA 3A4VA 3WYEA 3M82A 2ZDQA 5M29A 2QRZA 3GF4A 4UNIA 1PYSB 3B1FA 2R8XA 4O0MA 2IUUA 2WSYB 5CURA 1BU5A 4CLTA 4DY4A 4LF8J 1A8PA 4DG5A 4HLBA 3JASA 1ZRSA 1VA5A 3L3CA 4YDDB 4FW9A 1BJTA 2ZLBA 5JZOA 1FJCA 2Q3CA 4OHVA 2H16A 3SLRA 1GKLA 2DCLA 2NQPA 3EEBA 1CCWA 1P7VA 3ITKA 2GIRA 4EB0A 2BEWB 1P1KA 4LISA 5B1DA 5C5EA 4Q3AA 4C1NA 4QRIA 3SI7A 1ROFA 1R0ZA 1XMVA 3COYA 1FYWA 3TR5A 2X40A 4PBSA 2FX5A 4K5RA 3MUEA 2E82A 3PHTA 1ZKMA 1T0IA 3CGGA 4OD0A 1AUXA 3VQTA 1S7HA 4QUAA 4F2SA 5ED4A 4MW1A 2XR1A 1F5BA 2BMFA 1CJKA 3UGKA 5FLEX 1XIQA 4JOSA 2AFVA 3Q1KA 3KJEA 3A1WA 5ITSA 2FZCB 3NHBA 2CNLB 4JJGA 2Q5QA 4J0CA 5C7OO 3KR9A 1J8DA 2OVBA 2FUKA 3L1UA 2A0XA 4RCVA 3JYTA 3DAYA 4WOBA 2ZAGA 3OFND 3VI3B 4CMIB 1K9SA 3SXLA 1RYRA 1NASA 3UOAB 4U2FA 2XMPA 5GV7A 3KLIB 2QSYA 1HD0A 3HJAA 3EFOB 3SYMA 3E5MA 3MBOA 2HV8A 2OPSB 2LXNA 3AOBA 4WXOA 4ESOA 1YDHA 4DLLA 2QD4A 3WVNA 1YRQA 2D1TA 1CUGA 3TTXA 1EH5A 4HDHA 2GIFA 3WGHA 5AXNA 2CE2X 4X92A 5AXCA 2COUA 1L5RA 5CHYA 2X8AA 4ZXFA 1L5SA 1XMXA 3PDHA 3QQPA 3W1WA 4JU9A 4TSKA 1Y82A 3ZLVA 3MR2A 1L4LA 3U80A 1MMLA 5CB0A 2PJDA 4AWXA 4W5NA 3ILLA 5F9NA 1NXSA 1KVRA 2RI1A 4C98A 1J9ZA 4F4CA 1YZYA 4CR7A 3KFXA 2AEEA 2HHSA 3LXRA 2YQ3A 3O9ZA 3IOEA 4N3AA 4DCCA 2CDRA 1HI0P 3GLIB 3GLKA 2C2RA 3FPBA 3E5HA 2JAXA 2JDID 3MINA 4ZO9A 4WN3A 1KFKB 3KU1A 1LCIA 5A9SA 1XZJA 2FCAA 4LCJA 3LBYA 4Q6WA 4K88A 4QC2A 4JB8B 5KFKA 5AKLA 2H17A 2ROQA 1QS0A 1OV6A 2XEDA 2XS7A 2Q3FA 5G0VA 2NTVA 4C4XA 1C4KA 4OYMA 1R5NA 2QI9C 4UDNA 5LXTF 4PONA 5LYJF 2GPYA 3U5TA 1MCZA 2VHCA 1HMPA 3R7NA 3VKFA 2Q3DA 3O8OA 1RWMB 5B57C 1P6TA 4FVMA 2FY8A 5K2MA 2HGZA 3RAQA 1S1TB 3DLKB 3NBKA 3IQFA 2O6HA 3N6XA 1RT7B 3T5KA 3TQFA 1ECBA 3TS1A 1RHJA 4PSDA 4CWAA 2EJTA 4FE7A 1QAOA 3BQ1A 1IBSA 1QZZA 3E5NA 5ERGB 1G4AE 3BBCA 1XRNA 1L5NA 4QYSA 3THSA 2TMYA 2AGOA 3BRSA 4MUIA 1ND5A 4TXSA 4OIFA 4PR0A 3G49A 2CZCA 4P08A 3G9TA 3K1JA 1KQGA 5KG4A 1Q86T 1RQGA 2BUBA 2PL1A 2HPAA 4AJEA 1DLOA 2OD2A 1WUIS 2C99A 4W5JA 3CLTC 4FF2A 2B8WA 1L3CA 4ZOCA 1Y1KE 1NE2A 2NLOA 4CQMB 4O6VA 1FJXA 2NU8B 3FBEA 5EIHA 2Q0SA 1E2EA 4ND6A 4FYDA 4KXNA 3KUGA 1D9AA 1SV5B 1M2GA 4G5YA 2M32A 1JK9B 3CCWA 1NVXQ 1Y5NA 1AKYA 3F9RA 3OFVA 4LMZA 1GWNA 3RRJA 1II8B 1I3OA 2ZE8A 5KFGA 3DMTC 1PT9A 4MSUA 4NOJA 2K1RA 1J39A 1JLEB 2Q5IA 3C41J 4IDOA 1OZHA 2B5JB 4WLUA 1AN0A 4K0RA 2BYCA 1SY7A 4DREA 1UPUA 4ENTA 2DR9A 1C9EA 1GT91 3TVYA 4V2UA 4IDHA 3KVOA 4D25A 5BXQC 2FR1A 1FDDA 5DS7A 5EFOA 3LUHA 2A7XA 3H0KA 3AESB 2WWXA 5EWMA 2QRMA 3IPCA 4LOKA 3W78A 1RWPA 2WE7A 1W47A 3VDNB 4QDJA 4LJ6A 3B20A 4IIJF 1PUIA 5KFAA 4WVFA 2P9JA 2HWYA 4DTCA 4U9UA 3L8YA 3GLIE 5CLFA 3PNBA 3AH8A 2HNYA 2OLEA 3BH7A 2XNJA 4I6GA 1PL6A 2ZHBA 3LY7A 4YECA 2AOUB 1MG0A 2W8BA 1RACB 1X8KA 4PNEA 4MW9A 1C9YA 4JB2A 1W73A 3DAPA 2GR9A 3ESYA 4F2WA 5KNBA 3P2MA 1EP9A 3PW5A 3QKWA 4B2YA 3FR8A 1U5BB 1UWBA 1OFTA 5BMVA 2VRCD 2IWRA 5DQHA 4EB6B 1MGOA 4LFBB 1M7HA 2EJCA 4C7XA 3HO8A 4MEJA 5JTUA 1EARA 3DSRA 4C6TB 1M2FA 2YN2A 2YV3A 2PWAA 3ZDXB 1SB8A 1XBWA 4DR7J 3AAWB 5C37A 4BP8A 1UM8A 2W6OA 4U6PA 3NT4A 5BN5B 3ZXSA 3K53A 2QOEA 3NM6B 5ERYA 2ORVA 3EQ2A 4L5YA 3JZIA 3QF7A 1FVQA 4IWXA 3EE6A 3DFEA 1ZRMA 2WSMA 5KNCD 4GKKJ 4C14A 3CM0A 1QP4A 4OYLA 2ZB7A 3IUQA 3GLQA 3P19A 1LTHR 5JMTA 2QVBA 5TT1A 3DF7A 5F9MA 1AT1B 2BZ1A 1NV9A 2VUIB 3E3MA 2BEUA 2FFQA 4KLRA 4OKIA 1XZIA 2Q7DA 3U1LA 1FVHA 3UCGA 2F3PA 2FPWA 3MFHA 1GL9B 2ECOA 5HQMA 3W2HA 4BPBA 3QU9A 2QSZA 5KZMB 4NPAA 3A4NA 3PV0A 4KXWA 4M55A 4AL7A 3AZOA 1UJNA 1JR3D 1S1VA 1SD5A 3IIJA 4RH3A 1FRVA 2HA4A 3FNNA 3VU3A 1QUVA 2ATXA 3SFVA 2CVHA 3PHBE 2HHWA 2JLRA 1KO5A 2VK4A 1JDTA 3D0HE 2PCJA 1AYEA 2MKKA 3BDAA 4K9SA 3Q8PB 1SB9A 2HPVA 2R7SA 3MCZA 1VKJA 3DOMB 4D3ZA 1OH8A 3IC1A 2VUUA 5E3AA 4Y98A 5G0RB 3FEYB 5E3CA 1A8SA 2GBIA 1V5VA 4RMIA 3WTBA 3KEGA 4RU1A 1RKIA 2Q1LA 3HHPA 4G6ZA 1OVGA 1ULZA 3LWDA 4V0MA 4EB3A 1XZNA 4YWJA 1NBAA 5CFOA 3VGSA 2HMIB 3OOYA 1TJ4A 5K6AA 1AK2A 1OF1A 1YQ9A 2B21A 5IAJA 2G76A 3CV3A 1W1IA 3G8BA 2ZUTA 1NL3A 1YI2S 4ED4A 2IMOA 5CM9C 1SPBP 3GEPA 3MIIA 4WBNB 4Z37A 4LXHA 3ONQA 4DV6B 2HVIA 2J3LA 1FMLA 4YY3J 2IU3A 4DNXA 3TQIA 3OAAA 4CMBA 1HORA 2WV9A 1F8UA 2W6ID 3D3KA 2RUSA 2XNQA 4RJLA 4V1Ak 3IR6A 4DFMA 1EK2A 2H29A 3K0CA 3EW9A 1E59A 4X85A 5DCUA 4R54A 3ZVRA 2FMUA 2G80A 2Z2ZA 4LRCA 4IG0A 3HKEB 4Q7KA 5FV4A 3ZLUA 4LC0A 1I2CA 1UC4B 5C8YA 3ZN2A 2GKOA 3KFVA 4A8MP 1BVYF 3P49B 4FPRA 3FWKA 2ZE2B 1WXEA 3I6ZA 3MAQA 2BFWA 4UCQA 3DDHA 3OTBA 1D1UA 3BXPA 3HXOA 5LT5A 4IRDA 1DO0A 3TRHA 4JL8A 4Y6GB 4HYYA 5KQLA 3SC2B 1TM2A 4MK9A 3TO5A 1N36J 3RB4A 1ZSVA 3I3SR 5CYQA 1UOOA 1UF9A 2A6OA 1A88A 5A76A 1OMSA 3G82B 1GZVA 1ZD4A 3MWDA 2O8EA 3AK4A 4MYTA 3ZD9A 5A03A 2FW1A 3E7PA 2ZJAA 3OL8A 1VJCA 3AERA 1P7PA 2HZVA 2GHVC 2B8PA 4WFXA 3OJWA 3QAEA 4BQIA 1QTRA 2C9YA 2C58A 1U8UA 1SQ5A 3D2BA 3PEYA 4CTAB 3KL2A 3KZMA 4JI8F 2C42A 3I6QA 4NYZA 4NLWA 5B1EA 4XB2A 4C0XA 3HLUA 1HWJA 4A2WA 2QL5B 2UUBB 2RKWA 4AY6A 2NX2A 1BWEA 5LXTB 2QRGA 4LQ4A 1PL8A 5CA1B 1FEHA 1LEHA 3OQIB 5JO9A 1MSWD 1HBUB 1C0IA 3RR8A 2K06A 4DSOA 1V1RA 4KREA 1R0CB 1REQA 4MQEA 3EBOA 1KORA 2L42A 3RBEA 2HWTA 2IZ7A 5AI5A 4HLNA 5KNBH 1DS6A 2B25A 2IYEA 2FZVA 3UCUP 2EKLA 4QPCA 2ZB2A 13PKA 3CX7A 1A96A 4PQGA 4YS2A 1HYGA 3WNQA 3C48A 1CDOA 2RJZA 1N6KA 1LNQA 3H9EO 4YYEA 4MUBA 2PV0A 5JSHA 4PSCA 5JDIA 5EG5A 4BP9A 2XWPA 3E2PA 2GYVA 1PD1A 5ALJA 4RKQA 1N6NA 3UE2A 3ZWVA 2EFEB 4ZT4A 1LUAA 4HS4A 1HNWF 4MWTA 1MX5A 2ZRGA 1J2TA 2EV9A 4FWIB 4AS3A 2Q5FA 2DULA 1RU3A 4OOEA 5LJLA 1Y8RA 5G1OA 4L0MA 3FHLA 2XBLA 2JH9A 5CD4H 4J90A 4LV8B 3VPBA 1GSAA 1PFWA 2YNMA 2PBFA 4RK6A 1ZUNB 1VJ0A 3WQRA 2J3EA 1MF7A 3ANLA 3QVVA 2WSCC 4HWOA 2VATA 4Q3NA 3RIHA 5AVVA 4E94A 4GVBA 1KVQA 4HRVA 1X7YB 6PFKA 4HKQA 1I6KA 3G89A 5CW1A 4A3SA 5C1IA 1HNWJ 3DHYA 3PKMA 2IU4A 2C2HA 3TAMB 2GEDA 4E4YA 1AGRA 1RYDA 4FSHA 4URUR 2HSZA 3L4BC 4P75A 4B3OB 1CB0A 1NPDA 4EFMA 2QQ5A 1TKDA 2JRSA 5BSUA 2I9PA 5CYOA 3K70B 5HLFA 1NDCA 4G41A 4MRVA 2ZWIA 3KD3A 1GSHA 3L0SA 3Q3JB 5EKDA 2BA9A 2W2PA 3WL6A 1ES9A 3K5NA 4QLOA 2P0EA 2MDTA 4IO0A 2OH2A 4JI0F 1FXWA 2OQ2A 1CFJA 4A8WA 4K2JA 1JA0A 2EQBA 2FSVA 4KHZA 4BMDA 3OPQA 4H7EA 2JEYA 4DDHA 5EUQB 2X6RA 3TLGB 4U6QA 4J9SA 3D6JA 4O25A 1SQFA 3E8XA 1XRMA 1CJUB 1WMSA 2KM8B 3I9V9 3OCYA 1MB3A 2HHVA 3CJSA 3GFQA 3K16A 3RG2A 3ZBPA 4Y6IA 1VQ8S 1LF5A 2N7YA 1S1CA 1FKAF 4C6HA 2WTEA 4J0FA 4IFEA 2CV0A 4W63A 2HN9A 4YLYA 3O5AA 2Y1RI 3L9ZA 5D3QA 2R97A 1XE3A 4ZVLA 3KIPA 3KZOA 2V34A 3CJ3A 2POCA 3D4OA 4QIFA 1TVEA 3JQ9A 4L0DA 3WL8A 3ON5A 4QPNA 1ZBDA 2WF9A 4A8HA 3E8SA 1S48A 3JAWA 3P96A 3WGMA 3G6VA 4Q3OA 4DDMA 1XCPA 3OC6A 5FYQA 3GDHA 1VHFA 4OGKA 3DAGA 5H9EK 3AKYA 4J9LA 1RSCA 1K7XB 3PYGA 4JLMA 4G4IA 4FBMA 1VPLA 4K3VA 4DILA 4BECA 1PILA 3COZA 2OPPB 3VNRA 1Y3HA 3DGFC 1Z0UA 5CLGA 3LLSA 3HMJG 2PSJA 4P86A 5CJ2A 3BMNB 3SYTA 5FX2A 2ZJ7A 2V8OA 2AD1A 4AXXA 4U00A 3LQQA 2XXBA 1NVMB 3CVOA 3K9HA 3T3OA 5BYSA 1NY5A 1E9SA 4GC6A 2PSZA 1RAIB 2VC0A 3FUTA 1V5GA 2H4WA 3H4BA 3AJ8A 5IT9A 3N5KA 1Z0IA 3OUYA 2VBIA 4EW6A 1DC4A 2O1EA 1M5RA 4HADA 1LDYA 4K03A 2M70A 2VO1A 4AO6A 3H2IA 1ONSA 3VU1A 4OZ5A 1GDDA 4PC7A 5IDQA 4EG3A 3KS9A 3UI3A 4OHFA 3VQSA 4KBIA 2ZH8A 1N2SA 1C4WA 4YQEA 4MJXA 3SPXA 4HX2A 5JWOA 5HAOA 2YKQA 5E9JA 1Z56C 2CDQA 2C5LA 3FFBA 2WJIA 2V8VA 2C1EA 2GJKA 4IILA 3NRBA 2J0EA 1KZ6A 4GIBA 3U49A 3EQZA 4U0JA 1THMA 3TI0A 1JJAA 4O3FA 1Z22A 4ZS6A 2ZWAA 3KLEA 4LFCJ 2IDLA 2DH5A 2LCIA 3UV3A 4URVR 2ILZA 3ZV6A 1EVKA 5L4NA 1EIYB 5DMXA 4OU5A 4BRUA 3LDGA 2CC2A 2BBWA 2XBUA 2N75A 3UMMA 1EHCA 1H6DA 1Y4AE 1T9YA 1TUBB 1RXEA 3O8NA 4EBBA 2UYYA 2Q8QA 4BZXA 5LZ5A 1NU8A 5CB8A 1GMVA 5M04A 2NO9A 4QTZA 1KN6A 3TTWA 2J31A 3PNIA 2SHKA 1IR0A 4AJHA 1B4DA 5CRIA 4XVUA 1ECFA 1I4LD 1LU9A 3UW1A 4H1WA 1WXIA 3OBBA 4OLPA 3LLMA 2V4RA 3WNVA 2PY6A 3OI7A 1Q14A 1WJGA 1VKZA 4KO8A 1J6UA 4X94A 1XPOA 2I6XA 2GD6A 3K6SA 3DV0B 2BKAA 4J1QA 3T19A 2ZE5A 4RA9A 3LCCA 3C4VA 3U1NA 4KRXA 1Z9BA 4ISCA 4PSUA 4WE3A 4R84A 1UODA 4KQJA 5T3UA 2A9QA 3HY3A 2GYUA 3EWIA 2G9ZA 5E2QA 3Q8YA 5FOWA 4XB6B 4MULA 5EGYA 2YRXA 2GCIA 4D4HA 3W8DA 2R7RA 1FF9A 2IFTA 4EIWA 2FC8A 4DC9A 2J5XA 4IDEA 1FDRA 1C4XA 3TQSA 5EL0A 3B6EA 4AQYB 2PUFA 1NLUA 4AZ0B 1E63A 2JFFA 1MX1A 1L3TA 4US0R 5SZIA 2W90A 1PR6A 5E4TA 1GITA 1UEIA 4BBPA 5C42A 3OTOB 2UAGA 4QECA 1UWKA 1SXJC 3AUJB 3PHCA 5A71A 1VYUA 1RDFA 3UWTA 3P2KA 3E3NA 1R9NA 1KMCA 4LXGA 3A3PB 4YREA 2A5FA 4NL5A 4XEHA 2CKDA 2UUBF 1K68A 1GGNA 1SUCA 1ESMA 4B34A 3W2WA 4RXMA 1L1QA 1U99A 3OEYA 2F1RA 2DITA 5JALA 5C1BA 4DPOA 2IOQA 4A4DA 1DUIA 3NPAA 2VG6B 1FRXA 2E5IA 4OYYA 2XSJB 2MYPA 5FFNA 3R8XA 1TIPA 1UR5A 2RHHA 4R1NA 2CCJA 2B8QA 2YTCA 3TZQA 2VQEB 4HVTA 4XM1A 2RK6A 1JHZA 3WA6A 2LFVA 1GQEA 1RM3A 2XLIA 3IDZA 1WHSB 1YKGA 4IQ4A 4F02A 1EGAA 4NMMA 4LF7J 2BGGA 2GEJA 3MM6A 3W61A 3S7RA 1SQ6A 5C25B 4MINA 1MX9A 3FKBA 2OEPA 1V9OA 5KKAA 4OYHA 4CCYB 5CT6A 4F8EA 2H1YA 1VCOA 2XQKA 3L0DA 2XLJA 4DEYA 5SUHA 2QUZA 4LBPA 5D85A 2LV8A 4LRDA 1FP7A 3TTSA 4AYBD 1MV8A 4REQA 2G3YA 3B89A 3LHSA 2ZD1B 1A8IA 2V3CC 4LDPA 5B1HA 4EQ6A 2C2WA 4AVYA 5E2IA 3VAHA 4K59A 2OK8A 1NNEA 4NY1A 2BRKA 4F0JA 4WWSA 4QCLA 3LOQA 4WPGA 1Y5IA 2BXJA 1KOGA 1TUGA 3OSZA 1Z2AA 4V0RA 4EP1A 2XJ4A 1JG2A 4E46A 2VDMB 2GA9A 1PQPA 2PE5A 5LSAA 3UC9A 2XT9A 2BM8A 2H48B 4C2BA 2EFQA 4BRZA 4C4RA 2QL9B 4CEHB 3TE7A 3MJVA 2V7QA 3OQPA 4Z0HO 4DSLA 5GAHU 4QWEA 2OOSA 3TSWA 3H4IA 4EA7A 1RIIA 2XULA 4DXLA 3D5TA 4U8GA 2WONB 1S6QA 2NIPA 5CA5A 3WQHA 2CVQA 2F4VB 1L1EA 3TD6A 3PACA 1FTQA 2BP7A 1XMPA 2EHJA 5JMWA 3VGJA 2O2JA 3CUWA 1NQOA 2A0KA 1JG1A 3F6RA 1J23A 3MCTA 1HBJA 1BXGA 3JRNA 4NE2A 1SZDA 2IV2X 3W04A 1KVIA 3AF0A 3QLTA 1DG1G 4KWCA 1D0VA 3Q4GA 1P60A 3P2EA 1BD3A 3STVA 2GMJA 1LWEB 5JAMA 5JV5A 1WTCA 4URYR 2E4UA 2RHQB 2KDOA 1ENZA 3ABOB 4GPZA 2C2KB 3RYCA 2R9VA 4YJFB 4FXWA 3ISVA 2AK3A 2VYVA 2R6DA 1QZTA 2RJOA 2VRBA 3VC3A 4HB2A 2QP3A 5DETA 3CZQA 3PO4A 2Y0PA 4TXHA 1ANKA 2J33A 2A9PA 1FDNA 1KH2A 3T6BA 2PFDA 4B9UA 3DC7A 3TZXA 1LJ8A 4Y18A 2A57A 4IFYA 2BR5A 1VRCA 4WZQA 3QVJA 3TUIC 4J2TA 2IDZA 4TUYB 3P2JA 4ITSA 1E5TA 4OUDA 2IY5B 3PGLA 4NLSA 1Z3CA 4WUVA 3IODA 1ONNA 1C3OB 4CIOA 4E3ZA 3T06B 4MDYA 1CQWA 2XPCA 3NU1A 1DAKA 1C9KA 3ZTRA 4EGLA 3UAZA 4BNDB 3S70A 2BFDB 3A3NB 1ZJZA 3RB6A 2VJBA 3GJXC 3W63A 1DRJA 2KE5A 5AVOA 2V6GA 1QHFA 2HWIA 1UMDA 2ZSFA 1KU0A 2AHOB 3H05A 4AZWA 5IAGA 1QQAA 4L9RA 2AI1A 4JASB 1CQIB 2D3O1 1GNSA 3CLKA 3T4PA 4RPGA 4RWXA 1CF4A 3RRYA 4ED2A 2QYHA 4LF9B 1WQ4A 4FYVB 3L4SO 4DX6A 3LGSA 2PZGA 3OZGA 3ISTA 2HHJA 1O2DA 2K7JA 2LA4A 1GZDA 1BXGB 2RH5A 2LBPA 5F4BA 2QA1A 1K3UB 4FOTA 3LBIA 1PAUB 5DYIA 2DAPA 4W4MA 1DCFA 5EWEA 2AUTA 4ECTA 3I4CA 5TGTA 1CVIA 1CJBA 2VA2A 4IEIA 3N74A 1KLNA 3NGTA 7REQA 1UBJS 1JXMA 3JQ7B 4WA7A 3T5BA 1ZLYA 2CJQA 5ELMA 2OZEA 4HSEA 4IXWA 2EP5A 3H4TA 2AZXA 2ZH4A 2VK2A 4D0NA 2DTJA 1H1LB 2XI3A 1O51A 4RPHA 5AJWA 3WFZA 3GUHA 1VIDA 2ERYA 2HSWA 5DTJA 4YHBA 5BVGA 1JLSA 1RYFA 2YIMA 3BMOA 2IV7A 4RW7A 1SVSA 3BJEA 3IAM1 1Z5PA 1A82A 2R6AA 3E18A 1QP0A 2QNRA 1RTJA 3CLHA 4OI3A 4R8RA 3Q88A 1W36D 2OSRA 2YKNA 2QQ0A 5SY4A 4IUBS 2DFNA 3WFJA 4O0LA 1IN8A 3KSAC 3R9LA 1Y3JA 2OAGA 4YFUA 2E49A 4ERNA 1EP4A 4U4AA 3P6YC 4EENA 4NCIA 4XASA 3VSEA 1VBZA 2B4UA 4ND8B 2OV3A 3VBEA 2ZJYA 2PYZA 4UMFA 4WXYB 1EUCB 4O2LA 4UDYX 2ZBVA 2FG6C 2WF5A 1DX4A 1G6HA 2J6TA 3BD9A 4B3RF 4ZN3A 4EWLA 3M3DA 4E2FB 3CF6R 3INTA 1DQ9A 4KQ2A 4R31A 2DBQA 1NAQA 1FWKA 3OJFA 1W26A 2E89A 1G5FA 3DVLA 2DFKB 1GSIA 3NOXA 1V16B 2I6GA 1X1EA 3KJHA 1KQOA 1J5OB 2IRXA 3I1FA 4BCCA 2DHGA 1GCIA 1B8NA 1Q5VA 4GLLA 2DG2A 4ER7A 2PX2A 5BWLA 4IH7A 5KFEA 2QT9A 1TT7A 4YI5A 5KT2A 5KTQA 3PUZA 4E03A 1VPEA 2IBMA 3MCUA 1V1JA 2KSQA 2IKQA 1VSQA 1CWUA 4NX2A 5KFNA 2R1TB 2XY4A 4L7VA 1EETA 2RKBA 1SGWA 3HXMA 3OMXA 3UAOA 5IKOA 5JANA 5CCLA 3CMMA 5B6JA 4RM3A 5HK8A 4KSEB 1Z6YA 4YRJA 3Q10A 4DA6A 4DR6J 2ZCJA 2ZS8A 4D98A 4JNCA 4NA3A 2Q3JA 2XH8A 2GNPA 1W2IA 1C3EA 3RC2A 4OVKA 1AH2A 4NNPA 4NSNA 3JQCA 1KJQA 1K8AT 2FW6A 2XYRA 2W00A 1CERA 3LUFA 1MROA 1PSWA 2R1VA 2HU8A 1SHKA 3WG9A 1I5OB 2NCKL 1YK9A 2LKCA 2XQGA 4G5HA 1QAXA 2DGWA 3EAQA 3PHGA 3I0SA 2V97A 1ESZA 4L2IA 4OBBA 1VCTA 1YCGA 5I7UA 2PX8A 4OHYA 4ER3A 3KKNA 2OKGA 5DM6Q 2P6MA 3ASYA 1E98A 2A94A 1Y3AA 1H1TA 3A7DA 2X0JA 3EXG1 3MWBA 3OD1A 3DF9A 3KLHB 3UMCA 5IDXA 2VYND 5A3RA 4DQKA 1VECA 4TV9F 2QVCA 3OWHA 1Q0TA 2FSSA 3B8HA 3AHPA 1RWXB 1W85B 1KK0A 1OZAA 5EZYB 2GOYA 1W0KD 2AX4A 1ZMTA 4CMCA 1HRDA 2BJ8A 1Z17A 1SMKA 2C88A 3CNHA 1GN8A 1POXA 1DZIA 4W92B 2QT1A 1B8VA 3RWMB 4IIUA 4HZUA 1JEQA 3ETMA 1KWGA 2L69A 5EI5A 4NX9A 3DV0A 1ULSA 3AV3A 5FRDA 5CYPA 2AC4A 1Y33E 1K4MA 3ILHA 3NNSA 5C0OE 2CYCA 1IG0A 4ZICA 2SECE 5J2QB 5ABPA 5F4ZA 5K8UA 5FJJA 3AGPA 4ZVFA 2C4HA 1HM5A 1X5SA 5ETQA 4CQ1A 5CXXA 4EGSA 4R9RA 1EJBA 4CO5A 1E1CB 3HM9A 3L6RA 1TMMA 5FTLA 2CHGA 2V2QA 3ITNA 3CRZA 2OCXA 1WOMA 5ALRA 4L7QA 1X9HA 1GG8A 2VKRA 1HNNA 3B52X 4V3CA 1JEAA 3UK6A 2IS1A 3MN1A 2CNKB 3ICLA 5J2MB 4WY2A 5AW4A 3RTGA 1IJKA 3TWOA 4MWBA 5LIRA 4DUYF 3H75A 1GO2A 1VC2A 2CJXB 5EE3A 3ANTA 5IARA 1ZUIA 4JLAA 2A6PA 1PBTA 1R4NA 4L8LA 2IOFA 4ND5A 4X95A 3ZTOA 3TIXB 2DQSA 1XK7A 4MV8A 3N2LA 2YVKA 3L92A 1XVTA 3OQNA 3ZE9A 1VSTA 3T3MB 2VG5A 1KC8T 4D79A 3HCXA 2MZQA 2XBMA 1KQPA 2D8MA 3HD2A 1M2OA 3QX8A 1B99A 3AUKA 3JAKA 4R71A 3IULA 4YJ2B 3DOKB 3ZU6A 1BSVA 1WX1A 5LOQA 4BV2A 1RAIA 3DV9A 4WXEA 2EFHB 3WGVA 2Z8XA 3ZHBA 2IOYA 5AHRA 4J03A 5BRJA 1E0DA 3T4XA 2KMLA 5CEFA 1KYQA 2TS1A 4MW6A 3GJRB 1WEKA 1O9HA 3UNGC 2FD2A 2W6JA 3BG5A 3ROKA 4KQKA 2ZM6B 2N82B 2QRVB 2XF2A 1ETUA 1Z6XA 4RHEA 1SC4A 1YTUA 3WC4A 4YAWA 2V9CA 1FQOA 1ZCJA 5D8DA 1R9JA 3R0IA 1EYZA 1UOEA 1JEYB 5GVRA 5KFRA 1DBVO 3ZQUA 1P19A 2CLOB 1HT1E 4A4JA 2IX9A 5KTPA 3D67A 4XD2A 5ETSA 3OETA 3AR7A 2IYUA 1JHVA 3Q0IA 2G0JA 1ACLA 4DADA 1GFWB 5AM1A 1NJWA 3Q8XB 3IBTA 4UOHA 1PYOA 4G4SO 3N6RA 4N8SA 1MNQA 2R47A 3WLTA 2OXEA 1D2CA 3L8HA 1PJRA 2VSOA 1YS4A 1ACJA 4O2BA 4PIPA 3W65A 4BVKA 4Z6KA 4E0DA 1ADCA 3BZUA 2RILA 2L17A 2QRLA 1L5WA 1OY8A 1IBRA 3ANMA 3OR2B 3STHA 1MO4A 4PU0A 4I4IA 5IKXA 1YR9A 5JCOC 1SCAA 4GL4A 1V3TA 2C4NA 5FOVA 4WNAB 1XF1A 4R8MA 5LMUF 1S6PB 4LQ3A 2FR0A 3GMDA 3ZIAA 1XNQB 3EUNA 1C8BA 1IPHA 4JI5F 1QQBA 3L43A 2IPOB 2BGUA 3UDLA 2DR0A 1ZCZA 2IZ1A 4LHWA 1MAAA 3BKUA 1WWHA 2HD4A 2R2AA 5TEVA 1A0OB 2IV3A 4WUTA 5DM1A 1F3FA 4OV6B 3JWJA 1CS4B 1CSEE 3CVKA 3MAAB 1RT5B 3DBRB 4RKEA 5KOWA 1Z18A 3ZDZB 4OX9J 1DTTA 1E1RD 3SF0A 3UAXA 1WL8A 3R3WA 1TR0A 4ESHA 1ICIA 2HEIA 3L82B 3LC1O 3L0IB 3TL3A 4UBLA 3TLGA 1JHYA 4R8KA 4J0GA 2OTJS 1W49A 2VDJA 4JKOA 2VNAA 1T2EA 1EP2B 4E7OA 4OLAA 1B74A 1WACA 1U3WA 4MP6A 3U7QA 2OGZA 2AJ1A 1J2VA 2WUWE 3EJ6A 1ZL2A 1QV9A 2BZGA 3AGQA 2GFHA 1R0XA 3AU9A 3IOCA 3LQ4A 3GZTB 3M6XA 1RLCL 5CLIA 1KGSA 1N0UA 3RJMB 4BP1A 4UHFA 3P71T 2QZ4A 4HCJA 2J76E 4GXNA 3G2QA 5LQJA 1CY1A 3K09A 3MMBB 2DETA 4X0EA 3QBEA 1JMKC 2WVEA 3OHPA 1CVLA 4TX1A 3O2QB 4R1PA 1ZR2A 4FE3A 1Q1QA 3CC2S 2QTMA 2N3OA 1Z4KA 2F63A 4B7XA 3DUFB 1QF7A 3D3JA 2OYRA 1NK5A 3LVQE 1D4AA 3LSYA 3H19A 1H4VB 3QVUA 4JENA 1SR8A 3MT0A 4EG0A 5JWRA 3ADCA 2ZZTA 3HR8A 3TJZA 1J90A 2HQCA 1Q50A 2ZXEA 1OIXA 2X0DA 4N5NA 1CR2A 4BNVA 4KHMA 2PYDA 1N5KA 1TUEA 3K6KA 3WXBA 3FJ2A 1WG8A 3D9QX 5CYFA 3IEMA 3VO1A 3FCAA 2O05A 3FYTA 2IF0A 2L48A 7ABPA 2CV2A 1AJEA 3HG7A 3HO6A 5DDOC 4LSNB 1AHIA 1SQEA 3RO7A 3V1LA 4Z9YA 3QVOA 1QVZA 3ZO7A 1EWVA 2AT1A 1XJWB 2JLZA 1Z7YA 2QMUB 3T1HJ 3NHJA 1UXHA 4YMWA 4PQAA 2B98A 1QGUA 2PI5A 2PLFA 3JQEA 4KXUA 3O8QA 3K0JA 4HEA6 3FDXA 1BCSB 2FPGB 2C7BA 3Q3VA 3R7LA 1N0VC 3R0VA 2P3QA 4UASA 5CG2A 4HNGA 2IZZA 1T4CA 2QM0A 3VAMA 5HP1B 5DBHX 2BZ0A 5JYEA 2AGVA 4J16A 1G3UA 2PMHA 4ZI3A 2NZVG 2OAQ1 3J7AN 2Z2IA 5D5QA 3S2IA 4BLRA 2PIAA 4KAJA 1YBMA 5LJ3Y 5FOUA 1ZK2A 2YYZA 5I6DA 2HQDA 3RS7A 1ZVVA 3AYZB 8OHMA 3D8UA 4KFSA 4ERXA 2J5QA 3GMGA 2DGTA 4BWYA 4LBIA 5EZ6B 2IXEA 3MMNA 2M9MA 3WGKA 3MBKA 4MAMA 4R9NA 1UBEA 1YX2A 2AJFE 2ALZA 1TM3E 3AUXA 3NAGA 4ZC8A 2PEYA 3LCJA 2C2YA 4BFTA 2R6ZA 4RKRA 5T6BA 3RLFA 5IWAF 1TL7B 3IVXA 1PR3A 2FMIA 2Y0EA 3D2CA 4URWR 2OXIA 3GR1A 2KB0A 2I3ZA 1T4DA 1V7QA 5ADWA 4EHKA 1X80B 3UQSA 5BNIA 4ITVA 2YNIB 1L7MA 3TPZA 4YUZA 2HJRA 2B83A 1QYWA 4UHBA 3JR7A 3KCQA 4PPYA 4QDOA 4BN4A 4CL8A 5MFZA 3B2EA 3BSYA 2VF8A 3E7DA 4ZN6A 1VKHA 4RQAA 1KVTA 2YX1A 4M63A 1RAAA 3TL2A 4OBEA 3QSYA 3WDLA 5B4UA 3BILA 4KX3A 2P27A 2IYLD 2RKIA 1XTSA 4CNZA 1ZM2A 4MI3A 3JYNA 5DGCA 3TFWA 4B80A 2BSQA 3EPJA 3DLCA 2J7KA 4JQSA 2BW7A 3J7YU 2R6FA 3OOJA 4IG0B 1N57A 1NC3A 2X2OA 3Q8VA 2GHTA 2XYHB 1U0SY 5F1YA 3L8ZA 5BMVF 1FJ7A 1B0VA 5AK4A 2QM7A 4YCBA 3D3NA 4WI1A 4CDNA 2IVFA 2FZGA 1EJ7L 1C9JA 2X5NA 5AR1A 1M2KA 3WLOA 1L4UA 4CDRA 2MYUA 2YBVA 1MU0A 1PJ4A 1J2JA 4K46A 1EXNA 4LHSA 4CWBA 2NM0A 1CP3A 3ZUPA 1WB9A 2XQFA 4DMGA 3CZ4A 2WICA 3FZNA 5BN3B 1YVPA 2ZIXA 3IESA 2DUJA 3UBMA 2R00A 2BGTA 3A9RA 3IBFA 2OBYA 2EBEA 4RIIA 4B71A 3TAQA 2FOIA 3SNHA 1ZJ5A 3Q2IA 4YRKA 1XXHB 3DT8A 1UBNA 5A5GA 4FQ7A 1ABBA 5JC8A 1UFOA 2DGDA 5D00A 1Q7LB 5KFHA 3WYDA 4EFAC 2UUAJ 4O4JB 5I3ZA 1KDYA 1Y42X 1X9WA 3VR4A 2FEMA 3FF1A 4M9XA 3MWJA 2ZZMA 1YZ7A 2VJUA 2CHVA 3Q8KA 3ROZA 2LIPA 1YJCA 3DMJA 2IU0A 3R7AA 4YFYA 2A84A 3WGYA 1T9UA 4NNOA 6Q21A 3ZNOA 4JODA 3JQAB 2AN5A 3GGJA 1T1GA 4GO1A 5B08A 4YP0A 1C7IA 5CUQA 5L4LA 1ISFA 2AGPA 821PA 2IELA 2H2WA 4X4NA 1QRAA 3WYAA 4YR3A 5K0JA 4CPDA 3MPOA 1RGVA 2QENA 5ENZA 3KP1A 3T3FA 4LVOA 1U7LA 5CDSA 4CV3A 2JCSA 5CA1F 3BK1A 3ZXUB 2F3QA 2CBXA 4BJ3A 1KEPA 3C6UA 3OUUA 3Q86A 4FHFA 2A3NA 3HN7A 3AEXA 3DDKA 3SQWA 1JKJA 3A1TA 1I1NA 1BUXA 2LQ9A 4IS3A 1ULUA 3BMXA 4ENUA 3JQAA 4QAJA 3VZIA 2GZ1A 4E2ZA 2O50A 2DNPA 3EOAI 1MWQA 1HOXA 2LVBA 4L15A 4EUNA 2FUG6 3VHLB 2XCLA 4LF4B 5DULA 4IFBA 4NEGA 2QTAA 4FDFA 4JD5A 5ALXA 3LA8A 4K50A 4USTA 2GZ3A 5IZCC 3QNWB 4BO2A 5FTNA 1EFPA 2G4CA 1J49A 1U8TA 1I7LA 2GAOA 2AQIA 1AK9A 4KFBA 3TLXA 1N1GA 2LXIA 4KRGA 3DQZA 1VCIA 5KYWB 1IRXA 1I3KA 4CCHA 2B0JA 5FI5A 1HH4A 5JATA 2OO7A 4BNIA 4QDUA 1ZISA 3EXEB 4H7KA 3GJSA 5C53B 4MVXA 3C7TA 3FSGA 2EBFX 3V6DB 3DKIA 3M4JA 1W2BR 1GPWB 1G7CB 4UZCA 2Q5EA 1A7KA 1X2EA 2R6HA 1S57A 3S1LA 2FWMX 4B4DA 3M2RB 5JBQA 2JPDA 4R2WA 4HMOA 1DARA 1DKMA 3X3UA 1P0PA 3BGIA 1L5UA 3CLRC 4X00A 5AM4A 2CZQA 1D6SA 1GMUA 4YHHB 2JAUA 1AXRA 1FKOA 3Q0TA 4DLEA 4IOCQ 2AQKA 4PKDB 3I6PA 2A1IA 1LY1A 2DHHA 5I42A 1VRTB 4DJ5X 1QIFA 4BC7A 1F4VA 4QIVA 2WU0A 1PW7A 1TKTB 1L5FA 3OKAA 3SCKE 2G07A 2QEQA 1R43A 2QLFA 2K87A 2GFFA 1KAHA 4JEIA 5BW6B 1O57A 5JG7A 1JLLB 3B5IA 2XZDB 1Z26A 1YFJA 2Q21A 1FNDA 1JQEA 1XU7A 5AMXA 4Y9RA 3DLGA 4NENB 4X7MA 1XD9A 1Y8CA 2ACKA 3HVTA 5L3SA 1OYVA 1KHHA 4MUJA 2KRBA 4O59O 1ZSYA 3RWBA 3UAGA 2BEFA 4JQZA 1MX3A 1JDUA 2ZVSA 4F1WA 3MERA 3CRW1 2JKVA 1S1XB 4BLWA 1BE4A 2FPOA 4QQKA 5CNJA 3DWIA 3KJFB 4ENPA 2P4HX 5DVZA 3EIHA 4FDTA 2XQCA 4OLOA 3M6AA 5T4FA 5D3GB 2TSYB 4DQRA 3O3LA 5TPZA 2EFDB 1WDDA 1R5OA 1BHSA 4EPTA 1ZM9A 1ISRA 4NNJA 4CIBA 1BU8A 3W2VB 2GHIA 3OPKA 1ITZA 1PJ8A 1CG6A 5ENVA 2KHZA 1OPRA 3FPHA 4JROA 5I9SA 2LGJA 4IMRA 5TB5A 4CM9D 1WKBA 1GAJA 1AV7A 1Y3FE 4IP0A 5CIQA 3U3XA 1SUWA 5KPJA 1FXUA 1JEDA 2FE4A 3WLKX 4AMVA 1AA9A 1XSEA 4BNHA 1HTWA 4ZOEA 3R0JA 1K0TA 1V95A 4AI6A 2Z5FA 4PM4A 4U95A 5DM7Q 5JUWA 4X4RA 1P3JA 2PL9A 2EGUA 2F65A 5A02A 1BKDR 2OZLA 3OT1B 5TPWB 2J4DA 4ZEOA 1WORA 3LMKA 1EFTA 1KDPA 4ASUD 2XCTB 1UVIA 3K4QA 3ZHUA 1JR6A 4GYYA 1VIXA 4DRXA 4ZPXA 2WKWA 3CULA 1QGUB 3BJZA 3T41A 1SL0A 4TZKA 5IJXA 1FJHA 1AGXA 4I3HA 4FYKA 3W5XA 4UOZA 4BJ1A 3MW8A 3Q12A 2NTJA 1JDJA 3AUAA 1K8QA 4C4TA 2QTRA 2Q99A 4AKSA 4RIFA 2UUAF 4FGSA 5JPCA 5TT0A 3B9BA 2YY3A 1TTTA 1KVKA 1E2LA 3M7VA 4C1BA 2G9NA 1G8FA 3GROA 4G0WA 5DKFA 2XWSA 2YBDA 4ZLNA 3P0FA 4F12A 3JWPA 3T3HA 1TEHA 3FWYA 3FI0A 4UZBA 3QYFA 4DQQA 1YQEA 3WIUA 3CTPA 4I55F 1ND6A 4BIMA 5KHOC 1UAWA 2V7UA 1FP4A 4FT4A 1X2BA 2WIJA 1WD7A 2GZDA 4FSDA 5FUBA 2AJ0A 2OXRA 4QAQA 1Z73A 3U09A 3ADPA 4LRUA 1IU9A 2P9TA 1HR0B 2ZJ4A 4RVGA 3MFQA 1DJQA 2E18A 1N5YA 2NO0A 4FYPA 3HBFA 4GWLA 2GLUA 1EFLA 4FHGA 1L5LA 4XYLA 1ODKA 4PO9A 1UP1A 2BE7A 2I34A 4Z3DA 4ZDKA 1K6MA 1VPDA 4CT0A 5A7GA 2PD4A 2A88A 1BHO1 1QFMA 4K4YA 2NADA 3AJEA 3HF5A 3N58A 1VSUA 5F21A 3C1UA 4CKYA 1ZD5A 2CQ1A 2CFRA 4DJAA 1FWLA 1VFNA 2IUEA 3RS2A 4CKWA 3A3OB 3O6VA 3IAEA 2XVZA 4FMCB 5CGZA 4ER8A 2E7ZA 3JQBA 2V3WA 4FYXA 4CLHA 1N2BA 2RARA 3R6GB 1TU4A 3BR9A 3KJQB 1D8ZA 2JGRA 3HBMA 2DY1A 2AZMA 3WLIA 5ETTA 1UKBA 3QE3A 3KPWA 3AQ4A 4U2EA 3DOKA 3AVPA 1L5KA 4B3JA 3KOZA 2MKIA 3KZ1E 3SVLA 4JBLA 4ED1A 1MW7A 4OQZA 4FBGA 5EMMA 5EEGA 3IXMA 3SEZA 4RW7B 5LQUA 4F97A 5CR9A 1R6DA 3L9XA 1T25A 2WT8A 5EWFA 4WK2B 4QIWD 4IIFA 3LC0A 2OO3A 3T1YJ 4RNMA 4NK4A 4KE8A 2JGNA 1L3IA 5EHHA 1JJHA 2H5JB 2RE8A 4YB7A 3RT7A 1WVIA 2KKHA 2QRJA 5AKGA 4RTOA 1NP7A 3ZUGA 1PGZA 2CLIB 2OUGA 4D6PA 2WM8A 2K3KA 4V24A 1JJ7A 4HYKA 4QARA 2WV7A 4UDOA 1DJMA 4CCWA 2GASA 4P0TA 4CLUA 3DWEX 5LMCA 1YT5A 3R2JA 3SDBA 2PGXA 1BW9B 1W8IA 3J7Z5 5IPFA 1NVWQ 3PD0A 2QMHA 4PWYA 3OL7A 3CSSA 1O54A 1M1YE 5JCPA 1RWWA 1F4LA 1O94A 2CNOA 5B3JC 2C92A 5FIIA 5CXQA 2FUG9 3MGCA 4TTAA 1JDBC 5HJEA 2DHXA 2EATA 3FWZA 3D1OA 2EAUA 4OHCA 1SG6A 1SBNE 1CY2A 4PPDA 3R4CA 3RKSA 3LF2A 4HX9A 4NCNA 2V8PA 3GA7A 2AJLI 5AQ1A 3MCSA 2L9DA 3GN2A 1FMCA 3G5LA 3EUWA 5F5LA 3D6FB 4OZ1A 2KM8C 2D1FA 3BYRA 1PJBA 3B6ZA 3PGVA 4XEUA 4JLVA 2IDEA 3J7YI 4PZPA 1PEKE 4WNYA 5F5XA 3ABRB 4FF3A 4TRMA 3BMCA 5H68A 4Q45A 1J9GA 5GQSA 3CLSD 5BW4A 3OSPA 3H5RA 4RZRA 4ZAYA 1Z29A 2XSFA 2FP4A 3DEAA 4GSYA 1IM6A 4WCFC 4XIJA 1WXWA 3TIVA 1YFLA 2KL8A 1G0NA 1Z4NA 1IY9A 4ZQBA 2CKWA 1LGYA 1LVHA 3PR1A 1JLBB 4LTNA 4C3ZA 1JIUA 3FETA 1RHRA 2D3ZA 2GJAA 1PHPA 2F9JA 4JUIA 3I76A 1I51A 5J2UB 5CK5A 2PVPA 3DXZA 3WYCA 2NACA 4YJFA 4G4GA 2QTHA 4NE9A 4WP8A 2V45A 2CVIA 4XQCA 2ZTMA 3SFTA 1N5MA 4NLGA 3D1HA 4YQZA 3ZE6A 4MV4A 4EA6A 5IUNC 2G0TA 4AJ2A 4ZQGA 1RXYA 2CEAA 1M72A 3H42A 5KVAA 2LQJA 3QW2A 4QD3A 2A0YA 3WISA 1M6HA 1OTHA 1NMEB 2ZSJA 4COOA 4R9SA 3RG8A 3I9MA 2QLBB 2R86A 4LJ7A 5DISB 2RD2A 1Q7RA 5E5NA 2IYYA 2OT3B 3KHHA 4AULA 2QTCA 5KREA 4TXJA 2WTAA 1JQBA 2VDHA 3KYIB 2ZBGA 3RHZA 3L7IA 4HV4A 4ZOBA 3VSBA 4XUGB 3NXZA 1EB9A 3W4KA 1XQVA 2B3TA 1VDHA 3W60A 5D7NA 1V3ZA 3W3SA 3W2GA 1EWRA 1STOA 2I9KA 2XIJA 1GCUA 3PXXA 3DE1X 3TLKA 4BBYA 1RHQB 4OQJA 1KJZA 3GYXB 2O3DA 1RAOA 4E5UA 4GO7X 4LIRA 3CZCA 1X4HA 4D97A 3R23A 4G01B 2QLWA 1RWUA 3O38A 2NYVA 2QGFA 2DH7A 1OAAA 4HUQB 2C04A 1U0OC 3UC5A 2E4VA 3B1XA 2V54A 4KO2S 4UTGA 1U7PA 4RTPA 1XZEA 1UPCA 3M2VA 2DNHA 4BE4A 3REOA 4BU0A 1NKTA 1H9BA 2QX4A 2AP6A 1QLNA 4DL7A 5KG2A 2W2TA 4NDZA 4L3VA 4N03A 4OXKA 4LRXA 1QYIA 5FWAA 5CEJA 1BNCA 5G1PA 1KSHA 1A2KC 4JV5B 4YY3F 1V48A 3TQOA 3QITA 2AUNA 4F7DA 3R7SB 4YRGA 2JW5A 3D2LA 3HSDA 1P6QA 1UMCA 3K59A 1YZVA 3EA0A 3R24A 1D2GA 2O5EA 1WXDA 1Q1EA 1ZESA 1TZMA 2QLTA 5KWIA 5HM8A 2G9QA 1RT3B 3OJUA 2HVHA 4CV0A 4Y2CA 4HLQB 1UMBB 1BKSB 4FW8A 2CW5A 5CDYA 3FKQA 5C8DA 4KXVA 3ZBTA 4B5LA 1ETHA 2XMQA 3FHJA 2XCIA 5M2QA 4DOMA 2CQ3A 3UAWA 2JH3A 2NV6A 1PT8A 3QNWA 4RHYA 3R5HA 4R68A 5EUMA 1KP3A 5EE1A 2DOKA 4OAPA 4LZLA 3J7TA 3DM2A 4B9LA 1UEJA 2NSYA 2IXFA 1CS4C 2XWBF 2JNJA 4JJAA 2BKPA 3GOHA 4FC7A 4IJUA 1XMQJ 3V5RA 2C4KA 2UZ3A 3JX9A 4YRSA 4J9PA 1WOYA 3O8BA 4S1VA 2WF6A 4DQIA 1UDXA 5EKSA 2EBUA 1QM5A 2UXCJ 1VK3A 3L7AA 3SKYA 1AQ6A 4W1RA 1PN3A 4ZVVA 2ZSDA 1PK7A 4KYZA 4AXJA 3BIFA 1XC9A 4XGIA 4HDOB 4LRFA 3QEKA 4BGVA 2VT2A 4NMWA 3G87A 4C08A 1WOSA 3LWZA 3JZFA 2PR7A 3THOA 1QE0A 5JS8A 4HDSA 1N34F 4DIKA 3Q40A 4NOMA 4NG4A 4JBYA 1OROA 1P9OA 3DMNA 1MW9X 1NVUQ 1MHPA 4DM7A 3TK1A 2IEIA 3AVQA 1JIIA 1D1PA 1VL0A 3D66A 3MCAA 4LHVA 1TYZA 3QE0A 4U3JB 4HDNA 3BO4A 4A5SA 5IAOA 1MXHA 3F3YA 4ZPJA 4D9HA 3DOLB 1B8UA 1S9EA 3ZZ0A 2FMXA 2DKOB 1NRWA 1AB6A 4G2TA 4M1SA 3E01A 1H2UX 1N32F 1G3RA 1UPTA 4HFNA 4EF6A 4JUZA 1L8LA 1J07A 3G2KA 5EWMB 1EG7A 2WM3A 2ZJFA 4MTCA 2FW8A 3OO1A 1TCAA 3MGGA 5KWJA 2HRCA 2J67A 2IMWP 1CZKA 4DPKA 3VOSA 2FLNA 2Q79A 3C14A 3QIPA 4ZP1A 4RK0A 1X1CA 2HEKA 3S8SA 3AFNA 4HYQA 1E4EB 4WAUA 1KI4A 3TJ9A 3VU0A 4PO3X 5K2OA 3MUMP 1FNMA 3IAAA 3GCWP 4FYVA 3HCRA 2NSJA 1PJCA 3P3DA 4NYIR 4O4RA 2FJAB 2ZRNA 2ZTVA 2GEUA 4PHTA 4QW8A 3GLHB 3TEMA 1EVEA 2ODWA 3MWEA 1GNQA 1EHIA 1XZDA 5MHTA 3ESCA 5EIXA 1JYFA 5H4GA 1KNQA 3UHJA 1YC5A 1RBLA 1G2PA 3KQKA 5EUHA 3QGGA 3QVGB 1B23P 1DJOA 1S12A 4TROA 3CMES 4ZT3A 4MO2A 2EKNA 2HWWA 2YJZA 2YV2A 1BWVA 3KBOA 1HEUA 1X9IA 5HDQA 1D9XA 2O1WA 2YICA 1XR3A 1Z5WA 2WSLA 4MR7A 4WZAE 3OZXA 4ZITA 4Q19A 1H5NA 3HU3A 3BULA 3BMCB 1A9SA 3W1YC 2IY9A 4HH0A 4NASA 2FJPA 4GX1A 3ECSA 6AT1B 4NBVA 2BMEA 4HWTA 1SUFA 3H1TA 2WHEA 1OSCA 1QUEA 4CEJB 4KQ6A 4TM7A 3RYFA 2TMKA 2PN6A 3OLZA 3HSGA 1EWYA 3DW3X 2HRRA 2QX6A 3ZJVA 1WDWB 3SR4A 1RWXA 2AXNA 5BRNA 2ZVPX 2IRUA 1T8PA 4CTJA 1HLWA 5IV4A 3FCUB 2D1CA 4EMSA 2BJEA 1KY3A 4OYWA 3JQPA 1HQ2A 1LWCA 4I9NA 2C3OA 2OY0A 3OTOF 1QO0A 2GSWA 2OPHA 1DV1A 3L4KA 5IWAJ 1DTSA 2OHIA 5AW8A 1ONPA 2P9GA 2XI4A 3IG1B 3EQ8A 1BZYA 1Q7EA 4JNKA 2IYWA 4E70A 1QMGA 4TWZA 1MVNA 1P4HA 3I0RB 1M74A 3K2EA 4WIAA 4B6QA 2PJRA 5LQKA 3EWGA 2BP7B 3Q2OA 4E08A 3MM8B 1NBHA 1KZ9A 2ILVA 4MIKA 4MA4A 1HA1A 3PR5B 2XTJA 5BN4A 2ATVA 2A1TR 2K4MA 3PGKA 3PVSA 2OO5A 3U6BA 2CG8A 1A4UA 3K1AB 3NH9A 1U1EA 4J6EA 4GP6A 3DI6A 4LZPA 1T7PA 1BXNA 2UVPA 2WJZB 1U1QA 4C2TA 5K5EA 1CQPA 1WKVA 1GPAA 1QUPA 1B3BA 7YASA 3DGVA 3IBCA 4INAA 4IDAA 4CIDA 1SIUA 5DBFA 1EKRA 4J0KA 2FR8A 3GNLA 3REFA 4QGGA 4TLBA 3K8ZA 2OHOA 1QNLA 4REMA 2NAPA 4RVCA 1IUPA 3UG7A 1KF0A 3ZU3A 4C5CA 2NUTA 2BE9A 4YONB 1I7SB 4V1CI 3CNEA 1HQUB 1UBOS 1WI6A 1QIIA 3ZKWB 2AN1A 2QMWA 2F8LA 3S28A 4D8VA 3EBLA 4Q1VA 2HX1A 2NQTA 3PFIA 4Q00A 3BQNB 2O66A 4NF2A 1AB8A 2RFLA 3PY8A 4LQDA 3FYHA 5GVQA 2DQYA 1ABFA 2FU5C 2WOOA 1KRWA 2FF5A 3QMWA 1Z6PA 1N3LA 1PLJA 2LW7A 2C5HA 3GIKA 3GPCA 3QPVA 1T43A 1NO8A 4JI0J 3EGEA 2Q3MA 4DCMA 1VGVA 1YE3A 1SU4A 4PZVA 1Y0BA 2VF7A 4R0EA 1E32A 4QUHA 1X14A 3T3IA 3RF6A 2Z9DA 1IAQA 3LJKA 3N7AA 4AQYJ 4NATA 4GH5A 5HJ5A 4XWTA 2NPOA 4LW8A 3FI9A 1E5DA 1FRLA 4LF5F 3UKDA 3G2MA 2BSAA 2NUTB 2JHEA 2BW2A 2MKYA 1EIZA 3HN2A 1JJ4A 5IDWA 1M2OB 3HBLA 4UTVA 4IEFB 5YASA 5BYKA 4JI4J 3VAGA 1IHDA 4QBTA 3H4VA 3CG4A 4PPFA 3A6KA 3Q1LA 3RT9A 1Q16A 3QOXA 1ISIA 4QDTA 5K8NA 3KD2A 3QLHB 4M95A 1RHUA 2FSUA 1H1LA 2AUMA 3PS9A 3I62A 4WWHA 2AU0A 5BNFA 2W22A 2Q1YA 2ZRPA 3FN4A 1GUBA 4U8VA 3H42B 4BO4A 5U4XA 1T35A 1K75A 3ANSA 4P35A 1TL1B 2K2QB 1R0WA 4HRYA 2OD6A 4JC8A 3U31A 3U1VA 4DDFA 4IDQA 3WR5A 2NG1A 1BC5A 4HPWA 4GOOD 3BZWA 2ZB3A 4BQNA 4O2BB 2ZSKA 3FUVA 4KV9A 2JI6A 3SAJA 2I33A 5AE1A 4G2NA 1FYVA 2CPHA 2OMOA 4JOBA 2VHYA 3KCNA 4UM7A 2C5GA 1QHSA 5DOVA 4BGIA 1EFRA 4QOSA 1RKXA 1WXXA 3TNLA 4B09A 4RMHA 3TI7A 4TL7A 2OV6A 1NP3A 2OV2A 4YP9A 1HF3A 4Z49A 2HTFA 2GYYA 2APJA 4JXJA 3WNZA 3D0IE 1JQJC 1JVBA 3H5XA 1L8QA 3GYBA 5E2AA 2JK0A 2QLMA 1ZXBA 2QUBA 5AI9A 1UM9A 4L8VA 4F56A 1S7CA 1S59A 4L6AA 3ZW9A 4OM8A 5EESA 3OLBA 4XGQA 5DT2A 4QBHA 4LZOA 2FWBA 4IFTA 1VSVA 2C2OA 4KR2A 2BFPA 4LNUB 4MV3A 3BUSA 4D9CA 2JAOA 3FSIA 3ESRA 4XWWA 1P3Y1 7AT1B 3B82A 3PUYA 1PIEA 2F3UA 4HWSA 3BTUA 1KI9A 1T94A 4URFA 3RSOA 1G66A 5CX4A 2A18A 1XJQA 2BUAA 1Z33A 4NXMF 2Y8YA 4QXRA 3WL7A 4D0SA 4DPUA 1FXSA 3EG9A 3NT2A 4COKA 1U8EA 3GAAA 4DHVA 4DV3F 4GDFA 3RYIB 2V7BA 2VDWA 4FD3A 4IH5A 1UUFA 2UYOA 2ZP1A 5K3FB 4QQRA 1B7GO 4UVEA 2ZI4A 2H9ZA 3PXUA 1V8DA 2PFGA 3EFBA 1AUPA 5KJ1A 3ICQB 3RUCA 1URRA 3MLAA 1FERA 1EFVA 2CHUA 1U8WA 4PVDA 3O26A 3IT0A 3NOQA 5BR8J 1Z7EA 1XB2A 2LECA 2GEKA 2CN1A 1XLWA 1JG7A 1TD1A 1V5EA 1IBMF 1XMOF 2I55A 2CQPA 4QDXA 1HKAA 1UQUA 2HK7A 3TEHB 3JQQA 4GE0A 3WZMA 2ZUBA 3HHLD 1W35A 3JSRA 2E5LJ 3JTPA 3LO3A 1NK8A 4J9KA 1M5UA 1NWHA 4HLCA 1LPOA 2M2BA 4LG1A 7FD1A 4BUCA 3A14A 3C3AA 3C4JA 4RZUA 4P80A 3PRJA 1S97A 5I4IA 3FOEC 1CVRA 1OY1A 3IL2A 1HYSB 2UZ1B 3UKOA 3A8KA 5DNCA 1H74A 4FFDA 1C8VB 2ECKA 2GLTA 5BQOA 2GXAA 2V7GA 3T5HA 3ESZA 3MYYA 5J2PB 5ECDA 4D2IA 4E0BA 4PC3A 5DEIA 4XPIB 3GG1A 3UCZP 1Z38A 2W6ZA 3BM5A 1IBLF 2PM8A 1JHDA 2VNSA 1ODLA 1OSNA 1IUKA 1ZQ9A 3PJGA 3W3AA 3HDQA 1TYBE 1N33B 1O0SA 1U2SA 2BPOA 2P40A 2WFAA 1RKVA 4JEMA 1PS8A 3BFKA 4CMJA 2NR0A 4M6WA 2H0RA 3CKKA 3UOWA 3KJXA 4NDNE 1G5IA 4H6XA 3PU6A 2JIDA 5DYNA 1B43A 4J7XA 2AS0A 3ENNA 5JY6A 3X44A 3KLOA 3IHWA 1MORA 3N0XA 5HSPA 5GJVC 1DO2A 4CCYA 4IRMA 1Z36A 2FF7A 1KQSR 3GO4A 1XZMA 1R8QA 2CA9A 1W2GA 3FZBA 1JKJB 3HCNA 4ALKA 2JBHA 3UN3A 1QVFR 1NQAO 2VODA 1E77A 2NYIA 2CJFA 3I04A 2YS6A 5EC8A 1RXCA 5EPUA 2PIDA 3PUHA 4ENWA 3GYNA 3GIWA 4JSRA 5DPMA 1WNTA 4OP2A 4JQOA 1KSPA 3R5JB 1DC6A 1IQRA 5F23A 2ZIEA 4EEXA 1EB8A 3CCJS 5AJ3F 1YBVA 3F5FA 2QZZA 4RL1A 4CO3A 4Y2SA 2O6LA 5E9WA 4EKIA 4W5TA 4P52A 3S0JA 3DLHA 3A7EA 3OXFA 1SVOA 3LF0A 3QVWA 3M5CA 2HXSA 2W4MA 5L7YA 4QWBA 1UK6A 2M88A 4RR5A 3WP1B 2VDQB 3EXYA 5CA1A 3AOAA 4OXXA 2BEKA 2XGQA 1NBMD 2P2YA 1RI4A 3RFCA 4D5EA 2HK8A 3CXRA 1Z2ZA 3T9EA 1ZHFA 1M8PA 1NW9B 5CB4A 4PGFA 2P8IA 4F5WA 1PFVA 2FHOB 1KDRA 1X6VA 5FOXA 3OTQA 2EK6A 1O5IA 3I9V1 1XQ1A 5KT5A 1FDVA 2GCEA 1OY6A 3ISZA 4B75A 2IKSA 3TZBA 4M21A 5ALQA 4HL9A 2B4VA 3CBQA 5A4MS 2NP7A 3WB2A 1A5TA 1EX6A 2YX7A 1N6OA 4B40A 3TSOA 2XUPA 4DA9A 1SKUB 1YH3A 2HSDA 3F0TA 2AYEA 4BNTA 2Q46A 4QULA 3RIGA 2QYGA 3LL7A 4MWDA 4ECRA 3LFUA 1O95D 3H7AA 2FZGB 2I22A 2HIYA 4RK5A 4IX9A 1IOWA 1KZ7B 2G08A 4UCFA 2X42A 2ENWA 2QB5A 4XARA 1CJMA 4EATA 1RRKA 1WUTA 4FNOA 4QA9A 3BN4A 1YMQA 2D9OA 3K20A 2HF7A 3CJTA 2WUVA 4XWOA 4ZU3A 3ADKA 2EJBA 5FPYA 1E9VA 2PFFB 2G25A 2FPUA 2AD9A 2QD3A 3GZ4A 2G0NA 5BQFA 5GAEI 2HWXA 1FEEA 2VCYA 4ID9A 1TUWA 2XNCA 4RZXA 3PUWA 1OA0A 1X4EA 4AD8A 4MRAA 3GY0A 1NMXA 1JMVA 1LPAB 2IPLA 3ZHOA 3KB8A 4P5DA 4CIVA 1E6WA 3O5TB 4LNAA 3RSHA 2HZCA 2E4XA 2ZTLA 1V1RB 4C01A 4KYUA 4CO1A 4HHHA 1Q91A 4CLZA 4ZVSA 2WKQA 3ZJ4A 1I14A 3O91A 5LFAA 3BWEA 5EY5B 3DTVB 2HRQA 2NVWA 4N82A 5LMNB 3R6LA 4XDHA 3EZ6A 2JLUA 3ODGA 5AD1A 5FI1B 5EHGA 2ANCA 1PKXA 1HI1A 1TEZA 1FMTA 1UDCA 4NXNB 6CHYA 2GD0A 2VUTA 3ZC4A 4H54A 4D8YA 4N77A 2REOA 1YJAA 1WTBA 3R75A 4J7AA 1B8PA 4F2PA 1GG5A 2ZCVA 1XT6A 4IGAA 4LGCA 3TA1A 1SKUA 2W2LD 2C28A 2QMZA 3E01B 4LDAA 4I8DA 4TU9A 2XMBA 3AI1A 4DSIA 2IBTA 4CLOA 1LB1B 2X1GA 2IHZA 4J8PA 4QWMA 2XQVA 2QL9A 1JKHA 1NXXA 4RJTA 1CQXA 3EMBA 3QVKA 2X86A 5HKKA 1A9XB 3OFHA 1AZWA 4K81B 1QDLB 3ROEA 3N0RA 4ZLPA 3TLJA 3GEEA 2EJWA 4JV0A 2BKOA 1UJ2A 1FWPA 2V65A 3CC4S 1C1DB 2ZB4A 2BKVA 2R7XA 3K96A 1L8XA 2D59A 4QNRA 5KX5B 3PC8A 5MGNA 1F5AA 3OWOA 4YP3A 2P77A 2ZH1A 2OZPA 2QP9X 4WK1A 1TI7A 3B36A 5CFZA 2Y99A 5MDHA 3AA8A 2P1DA 4AF8A 1CJKC 1ZETA 2AYBA 1MPTA 2VZ0A 4GP7A 5I7WA 3M1VB 4HZIA 3ZWKA 1Z2NX 2WFMA 1N34J 4LWOA 3OT9A 1BMFD 5AXBA 4HYTA 5KYYB 3FZ2A 3UPDA 3T5CA 4ND7A 1EQUA 3A8TA 1E94E 4I3FA 1BWPA 1GNLA 2W4QA 1Z0AA 4ZXPA 5J9FA 1N2JA 1FVSA 2B78A 2JCGA 4AP6A 3VR4H 2C7VA 5AM0A 5K3FA 4JI6F 3B53X 2XUFA 5F77A 2OAEA 3SDSA 4JI7J 3H1BA 1Y80A 4G0UA 5I7VA 1N5YB 3CY6A 4Q9DA 3RUHA 2C5SA 1W93A 4C6TA 1YDMA 2MQNA 4FMPA 2VT7A 2A6MA 5AK0A 1U8AA 1QV7A 1V5IB 2WUFA 3EMVA 2UXDF 4J91A 1WWKA 3W9YA 3AT1B 1ZMXA 5F2OA 2YWCA 4KE7A 1M6VA 2KJVA 3RPEA 2XGJA 1KIMA 1E69A 4TV9A 3ILJA 3CCUS 4M9SA 5JZ9A 5EZQA 5E4JA 3E0QA 2JA1A 4JLBA 4TXNA 1B14A 4Z54A 4XPEA 4DS5A 1YIAA 1KERA 1YJ8A 5ARBA 4CTNA 4MI1A 2VHGA 3VGPA 2AV6A 3B12A 4NZ9A 1E60A 4JHLA 3LZCA 2C9MA 3ILYA 4F84A 2AB0A 5HQ8A 2WWVD 1QX4A 2CJYB 1RT6A 4QPXA 2B69A 4CMAA 1QWSA 1GTVA 4IIHA 3IFEA 4PRZA 1X1DA 1QVWA 3UH0A 2HNYB 3VTZA 1XEXB 1KBOA 3AY7A 1W5AA 1ZHHA 2QTFA 2X9LA 3DOIA 4GEGA 2WIAA 3PDIA 4H7FA 3SYLA 4IZ6A 4WOJA 4XCQA 4L51A 4F9EA 2NWQA 4ZODA 1W6RA 2VHZA 2GN4A 4E32A 1XQXA 3BBPA 2VUSA 1G8YA 3EXFA 3NAQA 3ETJA 5DZSA 2GCOA 3WLRA 5C1DA 1JNYA 2ZPUA 2GJ9A 5AKIA 1QUFA 3BN3A 3R6GA 3Q3IA 1MA0A 4CT8A 4Y6RA 3GA5A 4ZGBA 3Q9LA 2P2CA 1J42A 4RX1A 5H7XA 1RCOB 1Z6AA 4YP7A 1TL1A 3N2GB 2FW0A 1Z5ZA 1TW3A 4MVWA 1A95A 2EGHA 1QIDA 2JVKA 4H1UA 1U4BA 4RL4A 3R3XA 2AG6A 2PMBA 3IQHX 5B5SA 5EYPB 3OSNA 1SV5A 1A4XA 1VJTA 4OQQA 5JSZB 2VHXA 1R0AB 2NGRA 2P3OA 1YQDA 1Y8AA 4ZZ2A 4JLOA 5I3UB 1N0IA 2I7TA 2ISSD 4RZHA 1VLJA 4D43A 2UZIR 1C30A 1UVMA 1AZSB 4PC1A 3CVXA 2INGX 3O03A 2OEJA 2ID9A 5I5EA 1W2HA 5JDCC 2IHVA 4LVUA 2QP4A 1U8YA 1N2CB 2XG8A 3WNBA 3AYXB 2WZ1A 1SJ3P 3ZU2A 3CF4A 4D41A 3H13A 3SE7A 3EVTA 4K6OA 1U1LA 3AY6A 3R6TA 5BNWA 4FS3A 3TLZA 3H0EA 4F8RA 4DN6A 3ZCUA 4URHA 3KQVA 1RCXB 4F0HA 1VE1A 2WUDA 4O4LB 2Z2MA 1YRYE 3U3JA 5CHEA 3DDNA 3RFXA 2I3AA 4HD8A 4G6VB 1FRFS 4NBNA 4XKJA 3K9BA 2YIVX 2AK2A 3HZEA 3WHIA 3P26A 3IURA 1HR0F 4ND2A 2G7ZA 3OICA 1NQ5A 4YWHA 1ORHA 4B02A 4RYDA 2AFIA 3RHTA 2EBGA 5FNZA 3UDEA 5GONB 2EFPA 2QA5A 4W9MC 2R7AA 1AMOA 3SU8A 3UT6A 1XMQF 2QEXS 4UAUA 4F50A 4LUBA 3FFTA 2IYVA 2IYRA 3ZC3A 5B2EA 2QK4A 3OD5A 5MLCV 2V4JB 2WJYA 4N12A 3WDSA 1VLOA 3HVJA 2XOXA 4UTOA 4IIEA 2KT5A 3OUYB 3PBKA 4X3OA 2GPBA 5TLSA 2XA2A 4Q9KA 2ZBPA 3SFUA 3DRRA 2CNNA 2A1BA 3U60B 3OA2A 3THYB 3K6SB 3IBCB 5ETKA 3O2JA 3TRDA 4E33A 3NL0A 1C0PA 3KDPA 2GGPB 5IT9U 4DCTA 1OU0A 3GCDA 1M0WA 4PANA 1PGQA 3OOSA 3SIXA 3PJEA 4A8YA 1R8SA 1M3SA 4LV5B 4GS5A 4TV8B 2F48A 4RY8A 3P5BA 5ADUS 2D3WA 4JZYA 1ZIPA 2QI9F 3K5PA 3F9CA 2QYTA 2OCBA 3W34A 3T9CA 1VC6A 3N7UA 2BFAA 1GXUA 2R1TA 1HOTA 5AI6A 1PG5B 5JJBA 1DCMA 2PKCA 1TLLA 3KLNA 4JI8J 4WNIA 3ASZA 4NZ6A 3L0CA 2C9DA 3UV7A 4JBHA 1AKUA 1OGJA 2B7CA 4Z9XA 3C8DA 3LP0B 4K9OA 4NCAA 3QKUA 2Q5HA 1UKYA 5CFLA 1L5YA 4MXDA 1C7RA 2ZKTA 3IA0A 1OASA 1PRYA 1DDOA