1M0SA

Northeast structural genomics consortium (nesg id ir21)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
b'MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-Phosphate Isomerase A
publication title D-RIBOSE-5-PHOSPHATE ISOMERASE, IR21
rcsb
source organism Haemophilus influenzae
molecule tags Isomerase
total genus 72
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m0sA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m0sA01
2O0MA 3OBIA 4TM8A 3DHXA 4LUBA 1FRZA 2WU1A 3OFGA 4PWUA 3S1TA 3UW1A 3O1LA 1XTZA 2QMXA 3L7OA 1FS5A 4OQQA 1UJ4A 1CD5A 1Y89A 2RE1A 1FQOA 3EFBA 3P96A 1SC6A 1Y7PA 2NYIA 5IS2A 1RWUA 2GNPA 2P9EA 2OKGA 3HN6A 2RQMA 3U7JA 3LOUA 1YBAA 3N0VA 3OFFA 2W48A 2QSWA 2JOQA 2P9CA 1O8BA 5IT4A 4L4ZA 4L51A 3E7FA 3K5PA 3MAHA 3KV1A 3BXEA 1KS2A 3OC6A 2QRRA 3KWMA 2KO1A 4R9NA 2F1FA 1PBTA 2CDQA 3MWBA 1LK7A 2PA3A 3LWDA 1UJ5A 4TM7A 3LHIA 2I9SA 4GO7X 1U8SA 3NZEA 4OQPA 3HHEA 3TUZC 2R5FA 2LQJA 2RI1A 3E15A 1LK5A 2F8MA 1DEAA 2BKXA 3TUJC 4L5IA 1ZPVA 2LVWA 1NE7A 3TUIC 1PSDA 4L50A 2J0WA 3NRBA 2J0EA 3BXFA 2JHEA 3DHWC 3ENWA 2RQKA 4X84A 4GMKA 1FS6A 3ENVA 1LKZA 3DDNA 3CSSA 1VL1A 1M0SA 5T41A 5JJBA 2FGCA 2PC6A 5HJ5A 1UJ6A 4R7TA 3NWPA 2QMWA 4L4YA 2MDAA 1HOTA 2P9GA 3CEDA 3DC2A 4M8LA 2BKVA 3OFEA 3IBWA 3EB9A 3AB4B 1HORA 3AAWB 5IT0A 2RI0A 3LUYA 4NMLA 3OFHA 2J0XA 3AB2B 4GO1A 3W7BA 4L5JA 3BXGA 3ICOA 3IXQA 4IO1A 3BXHA 2ZHOA 2DT9A 2H9ZA 1FSFA 3CH7A 3ENQA 5FIIA 1JT9A 3MTJA 3TX2A 2DTJA 4GO5X 1YGYA
chains in the Genus database with same CATH superfamily
1QTMA 1H0SA 2X8AA 1QDUA 3JQDA 1CLUA 4FKBA 2R7KA 2HW3A 3LXXA 3HFSA 4WCFC 3NUZA 2HFSA 2R8KA 2RS8A 3OZUA 4YA6A 2CDRB 1CUEA 1NAHA 4XQ9A 2Y1CA 4QWDA 4YAUA 3J80Y 3GA0A 2HQOA 4YNBA 4YMWA 4GC5A 3COZA 3EPGA 1EFHA 1F5CA 2OKCA 3A6DA 1G64A 4DIMA 3VX3A 3IBCA 5DLQC 1J1ZA 2HFNA 5I6DA 4FYXB 4NSNA 1NR5A 4JBIA 4ZPBA 1KVQA 3ZG6A 2YWCA 5K09A 4E09A 4HTAA 4YJKA 4F4JA 1N54B 1VRVA 2W9CA 4XOIA 1MW8X 4S1WA 2GLXA 1KEZA 2QRUA 3QVTA 4PO1A 3MINB 2CJYB 5K5MA 1UOQA 1GZ5A 3OPYA 3KQMA 3KR1A 5FUWA 2AK2A 3U44B 5MDHA 5HBRA 4H7IA 5K9FA 2RU3A 8MHTA 1IVSA 1UM9B 4B48A 3CSDA 4MUMA 1DJQA 2XTJP 1NJYA 2EW9A 4KXVA 3VC1A 1ZS9A 3V5NA 2Z83A 5TR9A 1FRVA 3CN7A 1XCMA 2OXCA 2J07A 2B25A 2VBFA 4J90A 4JP3A 2ZVJA 3ETOA 2XF2A 1O5JA 1TECE 1DBQA 1OU4A 2GCEA 3LF1A 1DTTA 4I55F 2JJ1A 4QAQA 4ZVOB 2ISQA 4BGVA 3L43A 3DKIA 4BBAA 4Q2LA 4QPTA 4CQJA 1MVNA 2ZVPX 1M5KC 2YJTD 4C22A 4GPEA 2GK6A 3NGXA 1OE0A 1CQZA 3M2PA 5DX1A 3D7RA 2M5YA 2EVZA 1Y3AA 5HTKA 3VPFA 5AICA 4B3SF 1PGOA 3DD5A 1UC9A 1V4BA 2FEOA 1L4LA 4MKIA 1XC7A 4BMDA 3PC8C 4R8KA 1SNYA 3ZXIA 4W99A 1Q0HA 3EWIA 1PG5A 1RISA 4KR0A 2AT1A 3KQQA 5HK4A 1RAFB 1RQGA 1JDNA 3LGSA 1M2OA 5GAEU 3MIZA 2HRQA 2Y0BA 1ST2A 4LJLA 1RKXA 3M83A 1R27A 3PDIA 1C7JA 1CX9B 3T9EA 1AGPA 1IG3A 1O97D 4CDMA 1T9DA 4C1BA 3MFIA 1GEHA 9ATCA 4AT1A 4FB5A 3IQXA 1LWEB 2REBA 4OQNA 3ZBUA 4E5VA 4FMCF 2ZS8A 4BZPA 2LW7A 4HTFA 4US1R 5CEFA 1JECA 4IJMA 3OWHA 1JEAA 3G5LA 5CA1A 4TUYA 2F4VF 4IFYB 4N77A 5KC8A 4FEGA 1SUDA 4QIVA 4RACA 3H5UA 1RZMA 1U2PA 2XNSA 1CUBA 4MVYA 3TA1A 1LFAA 4ZYWA 3FN4A 1A4IA 2G63A 4Q1EA 1JAHA 5U4XA 1X1DA 1UXKA 1G2EA 4BXOA 2HHXA 1YASA 2HJHA 4GMHA 5UKDA 2G1AA 2PZEA 1UK8A 5FFFA 3SCJE 3LMKA 4QDKA 4J9PA 3ZIAD 4LF6F 4RK4A 4QTZA 1WXGA 3P0HA 4GRSA 3U48A 3B6ZA 3FDIA 3G2PA 2WUFA 4DCSA 5BYAA 5DWQA 5FO1A 1FNBA 3IAAA 3R4CA 5CDUA 3THWB 5F9FA 1RA7A 5D7BA 2WEKA 1GAOA 1X7WA 3OEED 1FQJA 2KZMA 1X38A 1KFJB 3LP5A 2BD0A 1CYEA 3QYFA 3MJTA 1QQ7A 4DB4A 4B6OA 5K3DA 4Z4CA 1MNQA 1IBKJ 1V3VA 3I61A 5KOJA 2FX3A 2R47A 2KI5A 2P69A 1F1JA 2YZNA 5D01A 3LQYA 3MMXA 5FBHA 1RU2A 3JZIA 5FBLB 4E12A 1W35A 3QELB 1OSDA 2PYZA 3JASA 2YKOA 2XT9A 1QRAA 4A8JA 1V11A 2CJWB 1N36B 2FOIA 5DSXA 1VLQA 3MEGB 1JILA 3E27A 3M05A 4E3ZA 2UDPA 5JFTA 1XRNA 2CQIA 4XIJA 4HACB 3PICA 3V3TA 4BFZA 3IPCA 3I9V1 3TL6A 1CHDA 4PIVA 2G9RA 1KE1A 5CPFA 2RGUA 1DRZA 1HZZA 4WOJA 3X1YA 2ZJZA 1SFRA 3STVA 4CIDA 1LRKA 2VTEA 2IH4A 4YRFA 3VKVA 2VDNB 4CCWA 5KYKA 3OE4A 3B53X 5FPPA 3WBBA 2RHLA 4MWZA 2V6MA 2UZ1A 3P2JA 4MS4A 5F33A 3VOAA 4MS3B 2ZC4A 1PJ7A 2EJCA 3IA0A 2JIRA 5KVCA 5JZBA 1PQYA 4LC9A 1C1XB 4Z1MD 3D66A 1DOZA 5CM9C 2B51A 4WP8A 1MC5A 4MIWA 2GIRA 2VEDA 1AVTA 2ENWA 2FZGB 3F6RA 2O2DA 3DXSX 4XARA 3POTB 1WF3A 1YOVA 2HDHA 2KS6A 4R1LA 4LVOP 3RS5A 5IC5A 1DXHA 5KFIA 3R8CA 4YMTA 5EC8A 4NLLA 3ZTYA 1XCPA 4X8HA 2DT5A 1P7ZA 4F4HA 4O0LA 2D8AA 1JU9A 3G82A 2AYMA 2IZ5A 1GSIA 3QT7A 1C4XA 3I76A 1AB6A 1KH2A 4WYLA 2V5UA 3T6JA 1AK1A 2ZZMA 2L9DA 2VBYA 3H13A 5EKSA 3KHTA 4U5XA 2X13A 2DQ4A 3ZWNA 4ECAA 4FR0A 5JPIA 1HEIA 2GZRA 2PBRA 4AXBA 4A47A 2CLKB 2YJ6A 1EHIA 4M1OA 3P2MA 3AAWB 1F2DA 2KHDA 4ZA1A 4TV9A 2GFHA 4YGXB 2NLWA 5AJZA 3VR3A 4DLTA 1N78A 1KK0A 1ACMB 4URGA 2ZTLA 4KHPB 2DHDA 4IOJA 1RAIA 4E2FB 3GVIA 1G21E 5DHRA 4D9CA 1UF9A 3LBIA 3LX4A 4C8NA 2IF0A 4HZUB 4JLPA 4PO8A 4MUGA 2XA9A 3WNBA 1CEZA 2XTJA 4PS1A 1SVUA 2PLRA 2P5SA 3V4LA 1XMQB 1NKBA 3UMMA 1D2RA 5KFUA 5EHGA 4P32A 3MT9A 3H4BA 2V1XA 4NI2B 4X6LA 2VUIB 1F5BA 3ILHA 3W9YA 1VQ6S 2HS0A 2A1TR 2BW7A 5HP1B 3VNRA 2AB0A 4OXIA 2D62A 4NNJA 3UXEA 3M8PA 2EFPA 2NVWA 2VHJA 3ZZPA 3E5RA 3D4OA 1SU7A 3CKMA 5KOYA 5JSHA 5F98A 1HKAA 2GNOA 4LDRA 4FUTA 5TQ0A 1NSTA 4ZJUA 5ECGC 3I9V6 4Q00A 3EA5A 1EUZA 3C87A 1C7EA 1ECJA 5SZKB 1VGRA 1JEEA 1VE3A 3KEMA 1CULC 4DCCA 3AILA 1HL3A 2JIPA 4CMHA 1P6UA 4UHHA 4D1YA 4CO1A 2JH9A 2WONB 1PJSA 2I8AA 4KXXA 2OHGA 2Q45A 3VNQA 5JI3E 2H0QA 3CF5Q 1DTWB 2RDDA 2YQ3A 4B4DA 4O2LA 4JYAJ 2WAXA 2Y05A 1J8DA 3QG1A 4YT4A 5L4LA 2AFIA 5DM1A 1R00A 3HHDA 3DO5A 2PA3A 1E2IA 2KXHA 5HP4A 4GP9A 2NO1A 5G0WA 1SKUB 4EZ9A 3U3XA 1SMKA 4R1QA 3BERA 3D8BA 4Q01A 4PZZA 3PQ6A 4CF5A 2RGRA 1W9HA 4EELA 4JOSA 2GAHC 2HRUA 3JQBC 4WE3A 3DU5A 2IWHA 3L7MA 3BMCB 1PNQA 3EQ8A 3C3EA 1TVKA 2R66A 2Z56B 1B00A 1CUUA 1WLYA 5GY7A 4LK3A 1VCMA 2Q5FA 1JA9A 3B9PA 1WC4A 3QKWA 3FOFC 5KYNA 2OCPA 3AZQA 1TUBA 3U3DA 1S2MA 2AG0A 4CDGA 3QE4A 3VPGA 1U1DA 5K0LA 4YN3B 1RBZA 2QLFA 1H2VZ 3RTCA 1M33A 4WOCA 2QVLA 4IMIB 1BUXA 1RXWA 3IV6A 4DR4J 3UJAA 5FTMA 5BW4A 4CLPA 1JWBB 2E4XA 3BH0A 2XQIA 1CE8A 2I3BA 1YA4A 2YJ5A 4DJTA 2DLDA 3P0IA 1L5MA 3G5TA 2FOXA 2FZWA 5KG5A 1NHVA 1SCUB 2NSHA 2WSSD 3PW4A 2VKRA 4K4VA 1V9OA 3BZWA 3BCSA 2ZBIA 3KOOA 1R9JA 2UVQA 1Z2AA 2FUKA 1M66A 4WRRA 2JLGA 1U6ZA 1BWSA 3ELHA 1TYAE 4PX9A 4FOPA 2QSFA 4YO7A 2WYVA 1PZFA 3FXAA 3T7JA 1WSWA 3SC3A 3KSAC 1BO6A 2HHWA 4CTOA 2CLCX 3GLFE 5ELXA 1JJIA 2B7CA 1I6KA 5FLKA 1SXJE 1ZUD1 4X7BA 5KPDA 5GIOE 1YCGA 3NATA 3RS4A 2FA9A 4PG4A 1JXAA 2HI0A 2Y77A 3V4IB 3NCPA 1NSQA 1SGWA 4L9WA 4KAIA 3GXBA 1AMOA 2ZE2A 1VQ4S 1QB7A 2VPPA 1TL3A 2E1RA 4B3RF 2DP4E 2PU7A 3HLUA 1TKZB 2AF3C 4F86A 2DR3A 3TJ8A 1IVYA 4DNQA 2BMDA 4LZOA 4QODA 2VDUE 1SCDA 3S8MA 4W5WA 3OSNA 3NS6A 2A4KA 3OX3A 2PUJA 4LVOA 3CGWA 3G89A 4M37A 4ECZA 3H25A 2N42A 2JCGA 1ZPVA 5KWEA 3UENA 2MZTA 4MR8B 1D2MA 4I1VA 2XIQA 3M5DA 4J4TA 4KSBA 5CM8B 4FC7A 3CEMA 3JYPA 4RPHA 1H69A 4MIEA 4L4YA 2IV7A 3KG2A 1Y4ZB 1QV6A 3WQQA 4YUXA 1KTIA 3RO7A 1WNFA 1XD2B 2FVXA 3GQBB 1YFLA 4CNQA 2OVBA 1VQ1A 1EFRA 2EG1A 421PA 4WBFA 1XRLA 1G4CA 4LTNA 2GVDA 1P33A 3KUXA 3HR8A 1QX3A 4V3BA 2PX8A 1RXOB 4ZVTB 4ES6A 2KFZA 1V6AA 2FFRA 4NLXA 4HSEA 1OWXA 1JXVA 1QZTA 3GNQA 4BVKA 1OO0B 5AI0A 2AG8A 2PV7A 2OG1A 1FRMA 4CM5A 3CPEA 2OHFA 3IDFA 1S6UA 4JJIA 4KL8S 2PE8A 4JXZA 4P4LA 2W9AA 1RT6B 1J0EA 5F78A 4FVTA 4AO8A 1BOOA 1XDDA 3D6JA 4I7FA 3TUPA 3E01A 5FTNA 2ACVA 4QTXA 3TAQA 4MGZR 5FAXA 5G0UA 4LFBF 4F72A 1B16A 4TT8A 3SHTA 2RGWA 1MW7A 3HD1A 1YBFA 2XDAA 3O3MB 1ZETA 1XJWB 2P9BA 3ED5A 1ZRSA 3OW2R 1W2GA 1FD8A 2FPLA 3UN1A 4ID9A 3CCBA 2EVWX 3WYGA 1ZK0A 4DJFC 3OKCA 5I47A 2BW0A 4PXEA 3OQIB 4BO7A 4IDDA 5JXJA 4RJLA 1YR1A 3FKBA 1IBSA 1MU2B 2GN4A 2X1GA 4LHSA 1JDBB 1RYRA 2IUEA 2JAOA 1PR2A 2GN9A 1S9EB 3N3BC 4CETA 1DBPA 2BUCA 3Q12A 2X77A 5G0SA 4DJDC 4C0JA 1E4EB 3BYPA 3MOGA 4RUCA 4A2QA 4CH0S 1NPPA 3JQFA 4X8LA 2ZT5A 4BX9A 3KS9A 3KPWA 4BO5A 2R2GA 4CM3A 3LT5A 2CL0X 1UDAA 2GYVA 3CC2S 1IY2A 4NBWA 1I13A 3RUCA 3GG2A 3IDZA 1JLRA 3QPUA 1J5EB 3JYNA 3FH0A 3WL6A 4CZ2A 5H9WA 2VP2A 5IYZA 4EY5A 2C8VA 2W93A 1WMAA 3K59A 2AJCA 2C98A 5M34A 4I4CA 3RYTC 4AN0A 5KG6A 1SQ5A 4C3MA 3G68A 2I22A 3T5TA 2AFRA 2FZVA 2I8LA 4XIIA 2PMFA 1UVKA 5JMNA 3HY6A 3GRCA 1OA1A 1JG3A 2COUA 3CT6A 1ZS6A 2MYUA 2YV4A 3UMGA 5BN4A 3RRHA 1IHUA 1Y6JA 2EARA 3BICA 1PAEX 5IMBA 1H1TA 3N8NA 4B5KA 3ZHCA 1ZZGA 1O51A 3RJMA 4WU2A 1C7FA 5F23A 3DWEX 4KQGA 1H2RS 2FG7C 4LZLA 3F0TA 3IHKA 3GLIE 4DV5J 1UEIA 5BWMA 4MIBA 1WL8A 4H7FA 4U7UD 4ZVQA 3BD9A 1SXLA 2HURA 1YUMA 3ET6B 4ZYUA 5ALFA 3BKTA 4HB0A 4NZOA 2FQYA 2KMLA 5B7GA 5F7ZA 3MAAA 2ZHBA 3NXSA 1AKWA 3BSOA 2G17A 3K9LA 2G77B 2DKNA 2YH1A 1T2FA 4DPXA 2GN8A 4Y6OA 2D1TA 3G8YA 4L0QA 4CLEA 5KNDA 5A5EA 4XQCA 3FWNA 3TSYA 2O5EA 1YBMA 3LWBA 4FM9A 4UPDA 1HNIB 2BCEA 4D8XA 4GPAA 2IC5A 4OUKX 3HB7A 2F1RA 4KO8A 2RIJA 3OX1A 3CMQA 3DDNA 4HQFA 4B43A 3NG8A 4AKIA 4PYAA 3RFXA 4N18A 4IIGA 2ZQZA 5CXTA 4DHEA 1UP6A 1L3VA 4DSAA 2RG1A 4JR0A 4TTRA 2CQ3A 3QU4A 1Z0JA 1HORA 2BONA 2Z6AA 1JN0A 3O8QB 2D7JA 4C89A 4CLWA 4CQLB 2TSYB 3O75A 2QYGA 1T5TA 2C78A 5KX5B 3GJQB 3PXGa 1OY9A 2FSVC 1KZGB 2ZRMA 1MHTA 1UK6A 5B3JA 5ELLA 1U6IA 4EEKA 2P79A 4ER3A 1YQ9A 3K8ZA 1XDBA 2A1TS 4U7HA 1KYZA 1G98A 1XHFA 1Y1PA 3KYJB 3RUIA 4Q37A 3VAYA 4LF9B 1F2HA 3B85A 4MT1A 4YI3A 1BEEA 1SXIA 1X8DA 3M6XA 3L1UA 3PUHA 3E84A 2Q5IA 4Y0FA 4TXJA 1O5IA 1P0MA 4DS3A 2ILVA 2CADA 4H6VA 3ANXA 1I4EB 2QRVB 1NU8A 2PC6A 2FE1A 3S1AA 1Q20A 2QMWA 2WJVA 1SJ1A 3JTNA 4AKEA 4UOEA 3ZW8A 3KVVA 1DPGA 5DNWA 3WL3A 2CD9A 3HUUA 4MRPA 3GBPA 4PEVA 4WZZA 1N6QA 1KLNA 4PRZA 3IDAA 1MRZA 1MEOA 1XWFA 3BRQA 5IMSA 3LJKA 3B5IA 3G9ZA 4I4TF 1ADFA 4N40A 3UMBA 4ICLB 4O4HB 7REQB 4NS4A 2NYRA 2XZDA 1UL3A 1VBMA 1A7GE 4QUDA 1ILEA 1R0AA 3K0EA 4XGNA 1XNJA 1TF7A 1P5RA 3U7IA 4J9NA 1E6EA 1VM6A 1I94F 5GGYA 3DOOA 1FJ2A 3WL4A 2YPYA 3JS9A 2VHEA 1PL0A 3S99A 1XLUA 1HE4A 3T34A 3WYEA 4QE3A 4ZFNA 3A6JA 7FD1A 1HO3A 2FJWA 4M49A 5F8LA 1RMQA 5CA0A 2FPUA 1EFRD 1WZ2A 4HJRA 1TIKA 1YMQA 2Z3ZA 1YZVA 3BEDA 1KZ9A 1IKXB 1NLFA 1WB5A 5JISA 4NABA 3HJVA 1TL5A 3C1UA 4L78A 1CV2A 2IA6A 4LE1A 2J6TA 3L8GA 4HBGA 1CQIA 3DOEA 5EWMB 3SYMA 4O23A 2VC1A 5HMYA 5K0SA 3CNLA 1J06A 3KK2A 4LRFA 4IQ8A 2IIBA 4RL4A 5FO0A 4TPKA 2VICA 3U40A 3GDFA 2ZPAA 4B44A 1AQNA 4QECA 4K87A 4OM7A 1W4RA 1G66A 2CC2A 1I4DD 4X3OA 1P74A 2Q41A 1UPFA 1ATIA 5AXMA 5TPWA 1T4CB 2ZFUA 6REQA 2BHLA 5MGBA 3PFFA 4ONEA 5DU2A 2GQ0A 2FFAA 1J2JA 4LXQA 4C7KA 3H2LA 4BNMA 2ZSIA 2L41A 4DIOA 2VQFF 1CJMA 3WV4A 4CW7A 1TMGE 3GVXA 4X1YB 4PPGA 1P1JA 1JHAA 2H52A 1T03B 2M9KA 2ASDA 3OFND 4RZUA 1DIAA 4L2IB 1Z3CA 3H5YA 1YJNS 3K4HA 1MPXA 3GG1A 4P1ZA 4FHFA 1VRWA 3I3SR 1BDJA 1FNNA 1AZWA 4N49A 1WV1A 3W9IA 4Z9AA 4N4AA 2HF9A 5KYYB 3QX3A 2RVJA 1Q91A 4PGFA 3LH2S 3AHIA 2HK3A 5BWNA 2QMEA 4W9NC 1MN9A 2L48A 4EA8A 2FQWA 3HKWA 3Q8KA 4NCXA 3FETA 3DJYA 4PC3A 2HYIB 3GPLA 4C7XA 2B4YA 3U7GA 3ZCPA 2X8JA 4ILLA 1JB9A 4S24A 2OEJA 1GG2A 3NNSA 4TYQA 1V8BA 3O74A 1MSWD 2DNPA 4YONB 4MWCA 3SVLA 1NK9A 1JEJA 4UNPA 3TIIA 3KK1A 4IG4A 1BE4A 1V48A 2B4PA 1OFHA 1DJPA 5TLSA 4EPRA 4H31A 1GU7A 2JLWA 1VDHA 2MQQA 4G0WA 1FFGB 2ZZKA 4YUDA 4X2BA 3FB4A 4R2WA 3CO0P 4QVGA 3HA5A 2ID9A 1PKUA 2E9TA 2GCPA 1WTCA 4KE7A 4DY6A 2IOQA 2O48X 4F84A 2J85A 5BORA 3KJVA 4B3MB 4HMOA 5M2PA 3KUCA 3RW6A 2V9PA 3BYRA 1JI3A 4DQXA 2DPMA 4QW8A 2KBEA 3H5IA 4RVDA 5BYBA 1K7YA 3TOSA 3UNYA 3VR6A 2R87A 4OL0A 1CIPA 3EIUA 2WM2A 1GRRA 4ESOA 4JV5J 5EQTA 3CUVA 1GPLA 2D69A 1NLUA 1XALA 4YJ2A 5EJ8A 1I8TA 1LI4A 3V1UA 5HA5A 3T94A 4JITA 1SBCA 2IHVA 2W6ID 2XT6A 2Z0GA 3JPWA 2FPXA 7MDHA 2ZWAA 3M6UA 2FPPB 4NYJR 2M8DB 1D9XA 1GQ2A 2H9IA 5HF9A 4GKAA 3KXLA 2HNYB 5AW4A 2Z5LA 1XMXA 4KTQA 3U1NA 4OHCA 3QYYA 1QH1B 5CFMA 2Y66A 4FFDA 1A9YA 4R2JA 1Q3TA 3H87A 2DF8A 2X14A 1QTNB 3DOIA 5FWDA 4F2HA 2NUBA 2R1ZA 3WMFA 1OGYA 3PFEA 1VQPS 4D02A 5CD4H 4URFA 4L07A 2QXYA 2A35A 2DH8A 3EOZA 3JALB 3HM9A 4NZZA 3AR3A 3EZXA 4IH1A 4MIAA 2VJVA 2ZUVA 4MV9A 4IWNA 1YI0A 3N39C 3PHBE 3ISND 5C42A 1QIDA 4QUKA 1T2NA 2YKPA 3I1FA 1IBMJ 3RUFA 2PI4A 2Q1LA 2FUCA 2Q46A 1T26A 2PXAA 4QHYA 3RRFA 2OXFA 3CPHA 5LWQA 3OTBA 4W82A 1FP1D 4BRSA 1S7GA 4CLHA 3R23A 3JARB 4ITSA 1N2GA 1J7KA 1EUDB 5F9MA 3F47A 4MUHA 3PQDA 4V0ME 4YGYA 3WP0A 3KJGA 1F4LA 3HVKA 4H7PA 2QMYA 4PBTA 2P75A 1L5KA 4O4GA 3QVWA 5J4KA 4WESB 1N6PA 1JLGB 4FFLA 2ON6A 4G1QA 4HNTA 1CUWA 1IN4A 2I6TA 4KE8A 3JAMY 3P4UB 2A9FA 2IW1A 1SUCA 1QZZA 1UJ6A 2ICAA 4K2AA 3QT6A 1KHWA 3LXMA 3OFEA 2I0XA 1WB6A 1KGDA 3C5CA 3WZMA 4USTA 2C31A 3VVTA 2NZXA 3WDSA 5BYSA 3FA2A 4ECYA 5B55A 4OB8A 4A36A 1UZDA 3AFNA 1VBYA 1K06A 1F2TA 4YP9A 3TPZA 1Q1AA 5A8WA 1K9MT 4M87A 3K0SA 1SB6A 3EG9A 2B92A 1W5BA 3FFIB 1NBAA 2BZ0A 3NHLA 1FEHA 5LP1A 3OJSA 3NOOA 3UN3A 3TZHA 2X7HA 4DSZA 1G5FA 1V6CA 3BKUA 1X8LA 3Q8WA 4OXNA 2FPKA 4XWGA 3M9LA 1IKYA 3EHEA 3USES 1HT1E 1M7HA 5K8JB 3PNQA 4MKVA 3N2YA 3PJFA 3G13A 1YD7A 3DWIA 1ZI9A 2JJ8A 4M0KA 5G0TA 1X1EA 4D0GA 2F3UA 3PY8A 2XF8A 3CA8A 2BBEA 4HDKA 2WBLC 2I2WA 4FS2A 3EGWB 1UZMA 1P1LA 1RP1A 1CUXA 5A3RA 1A8PA 1LBEA 3SU8A 4N82A 3LUGA 1FLVA 5K99A 1G19A 1NXPA 3LCVB 5I7EA 3RVPA 4AN1A 5JJBA 1D04A 5IHXA 5LQJA 1OAOA 3DQPA 4LS3A 1SIOA 3LZDA 3E1SA 3N70A 3X1LB 3SCZA 5L38A 1EA7A 5D0EA 1QB8A 3I34X 2JLYA 3OZSA 3J80A 4N8SA 3KHKA 1VIYA 1SH0A 3HKZD 4D45A 2WDZA 4PG7A 5IAOA 4ZS6A 3GLFA 5CURA 1I3NA 2F3TA 3L79A 3T9BA 2VOJA 2C9ZA 2FPSA 2DPJA 2R86A 2J9YB 4WZQA 3UD4P 2HV8A 2H11A 3RVOA 3MR5A 1KZ1A 4RFVA 5E9WA 4ETIA 1T8PA 2WVBA 1QRTA 1ZAVA 3V2GA 3N6MA 1T8EA 2Z6VA 1JHPA 3SFUA 3MOZA 2D4HA 4B09A 3PJXA 4DV7B 4WKYA 1TM4E 4IQ0A 4ZOAA 2JARA 4PRKA 3DRSB 5F3TA 5F76A 3VBEA 3KB8A 5JDCA 5DFAA 4OMUA 1LNQA 3L41A 1PFWA 4FIZA 5EMHA 1T9GR 4BMSA 2B0CA 1TO1E 4R71A 5IKOA 3HHKA 1D8AA 5TF4A 3TXXA 4TMWA 2H1WA 2HFZA 3W62A 4OYYA 3L6UA 1FNXH 2JFPA 1PX0A 1GQSA 4ZYZA 1NB2A 4RMHA 2J6UA 3FTCA 1D2CA 3QPVA 5TRTA 4OX9B 5DYIA 3OO0A 4XOUA 1H2YA 2HKIA 4Q7JB 2C00A 2QN9A 2IEYA 4G8JA 1NJ6A 4RD0A 2IJFA 3S2IA 2BHTA 1WV0A 1OB5A 2DHEA 1DCKA 1B0UA 3ZXUB 4F26A 2HTFA 4ZLPA 2J0SD 3NEAA 2ZIEA 1ADBA 4MV4A 4TWZA 3AKYA 1DVRA 4OP3A 2BZGA 3EC7A 1D2EA 3FGOA 3LKBA 1OFGA 4YRKA 1IBRA 3S5JA 3HBMA 2WHPA 4Q1AA 2AX0A 1MJHA 5DTQA 3O8BA 2KLBA 4L8VA 2I3AA 1KK1A 4GDMA 5TGZA 3R9XB 2PRIA 4TWIA 3SC6A 3TR6A 2HUNA 4I1UA 1YDHA 2VH7A 1LDEA 3ZUPA 1U9YA 1HHTP 3FCVA 3TB6A 4FX5A 5PGMA 4DGSA 2J0WA 1WPGA 1Q44A 3WLPA 3FCXA 3FPGA 3FRZA 1NASA 2H2WA 4IYJA 1PDVA 3IBYA 2AKAB 1YT5A 5TX7A 1KYYA 1KIMA 1USKA 3JQ9C 4OSOA 4O3NA 4I36A 1J4AA 2DISA 1BVHA 1JLEB 3L6DA 3DDUA 1OGIA 4DR2J 4AM8A 1HNWB 2I2BA 3ZDFA 4N5HX 3EXIB 3K5OA 5GMEA 5DHPA 5GJBA 3DLCA 2J3LA 2CYBA 5IXJA 4Y9SA 4D3ZA 3OZCA 5AM0A 4URQU 3KG1A 5SICE 2JX2A 3K9GA 3CZCA 2ZJFA 5G4DA 4V0OA 3R6LB 3NFYA 3NT4A 3FYUB 4AUEA 1BHQ1 2GM9A 3D5TA 2GMWA 3DS8A 5FL7A 1P5JA 5CBPB 4KKOB 2KB2A 1YQHA 2EJUA 3I2FA 3T1YJ 4UQPA 3VA7A 2VDIA 4X3PA 4HQRA 3GR6A 2RJ3A 1KC3A 2CDQA 2TMYA 1SIWB 2CFCA 3RHTA 2ZSFA 3WMEA 4EF4A 5KSYA 1NLKL 1NW4A 5GONF 2OCIA 4QBGB 5AVRA 2OAEA 4OYMA 1UR5A 2NU8B 4DUGD 3NRBA 2DPIA 4QQFA 2MINB 1L3SA 1JMTA 1DG3A 2FC9A 5AJYA 5A6SA 1U2DA 4F2RA 4CMEA 5ALGA 4ILMA 4G0XA 2IS1A 2QQEA 1MV8A 4IGAA 2P9GA 1A1SA 4CM8B 2R7XA 1J25A 4TWJA 2ZJBA 2FW7A 1P7YA 1L4FA 3CRVA 4OYRA 3E6AA 4F92B 4OZ0A 1A5AB 2BMJA 2JEOA 5IKPA 4GZ3A 1E4VA 3R0QA 1J0AA 3DZIA 2LCQA 5JMOA 1N2JA 3AERB 4ZIRB 3EC2A 3ZU6A 2Y0PA 4KWHA 4KXMA 4QNRA 4XWOA 1SI9A 2FI1A 1M8KA 2QDXA 3RKUA 2WQZA 3HMJG 4DL2A 1ABFA 3PX4A 4ZOLF 4WE1A 4JI7F 1S1MA 3L8FA 2OZLB 4JUIA 2X5NA 2MHNA 1X15A 3RC8A 2LYVA 4DCMA 4DQ0A 2H48A 4C8MA 2GCNA 3TTTA 4CDNA 7AT1A 3F4KA 4QDZA 1XA3A 4DR7J 4XFJA 1RQXA 5IKEA 4KVZA 2L2QA 2A0FA 2G40A 5CW1A 4JFRA 4MPJA 5L4SA 1TAQA 2Q5QA 4QQNA 3B20A 1SHTX 4D9JA 3KKLA 3LQ4A 5DLFA 4C7JA 1WSVA 4ZI7B 3S4YA 2RUGA 3HCFA 2RC5A 3L0IB 1N5MA 4WFQA 4XTRA 3ZTQA 4PIPA 5I48A 4BFLA 4X4RA 2WT4A 5B7NA 1CJKC 1FHTA 3QU9A 2UVRA 3SKYA 4CLOB 2PUHA 2XD4A 4ACBA 1CF9A 4HRVA 3DBHA 4R9UC 1Q7TA 2QMXA 4M89A 3KUUA 4HH4A 1JP7A 1RUSA 5BN1A 5A6WA 3L40A 1JSZA 4XLZA 3PJGA 3HHLB 1S5ZA 5CH7B 1OQ3A 1XQYA 3BN3A 4DV4B 3IAS9 3NPMA 3O4FA 1FL9A 2RNEA 3UPUA 1I7LA 2A0KA 4TN1A 4KE5A 1KNXA 4RTQA 4BFSA 3ONFA 4WACA 3BR8A 4RTMA 2EXXA 3KLGA 1L4KA 3PG9A 2G06A 1SCJB 4DV2B 3AFIA 3HPQA 3KT6A 4RIGA 2ZXUA 4JLSA 4YY3B 4N0QA 4R0NA 2G36A 2BVNA 3EQZA 2UUAB 3T41A 1SXJD 4RZ3A 3QKSA 2DNYA 1U0GA 1MOZA 2V8OA 4L02A 3LUCA 3KHSA 4EQZA 1H1DA 4ZAWA 2DGUA 4MW0A 2BI7A 3QLVA 2VG5B 3PK0A 2NZ4A 4BU0A 5AT1B 3CTMA 4J0QA 5KKAA 2BRUC 4JVLA 3KEGA 3IPLA 1FO1A 1JHUA 2HHHB 3M1IA 2YNFB 3SE0A 1P5HA 2EP7A 4TVSA 5FBZA 5JT1A 5FPKA 3ZBTA 1PVOA 2B0GA 2RGDA 2CLFB 4JGBA 2R7SA 5IASA 1A9TA 2YFKA 3SDZA 4PSUA 3GJ6A 4ZPXA 4YMVA 4ROTA 2CA9A 3P8ZA 3CN9A 5JBNA 4Z2YA 4FSDA 4J3NA 1XZKA 4GO7X 1TTPB 3WDLA 4TU7A 1R50A 1C0IA 1I1QB 1RE1B 1WHVA 3MGAA 5KU7A 1HPLA 1RTZA 1F4PA 1RADA 3C8MA 3VNUA 3JRNA 3O8LA 3G8TA 4PGGA 1A2KC 2F9MA 2ACYA 5CAEB 2H3EA 1QO7A 3PR5B 3CRNA 1T6XA 4IV8A 2WTMA 4FBMA 1IZ8A 2QJTA 5K45A 1CRLA 4MRNA 3FPJA 4UREA 1S9GA 2R4UA 4X97A 2QE7D 3NOQA 2BOAA 4HDRA 3F6EX 3ZIAA 2N1MA 5JOQA 3T3DA 3VGJA 3A7DA 3GMIA 4UPEA 3KNGA 3MM6B 3AUFA 4MUXA 3GELA 2PKEA 2X2FA 4DDKA 2CWDA 1E2QA 3N6VA 3OEEA 2QRKA 3ONNA 1X9SA 3MCNA 4TLMB 2XS7A 1MTOA 1YBAA 2PSFA 1T9HA 4QXOA 5MN4A 2ZJRQ 2R6AA 1ZGZA 1T7PA 4X3CA 2ZRPA 1PN3A 4JODA 1E9EA 4QDTA 1QPZA 4NK4A 3X2EA 1NFFA 3RR8A 2C2ZB 4LF7J 4WKOA 1RJEA 1YMUA 4M1MA 3HV0A 4TM7A 2CKDA 1GVNB 3F6CA 5E2AA 1PGNA 3FTPA 2VTBB 1FFEA 1FRJA 3KQPA 3I4CA 4U7PB 3ANTA 2BE9B 3V6DA 1GCGA 4X92A 1N75A 1BCSB 1QAXA 4MEJA 1EVYA 4M8IA 1QYWA 4J7AA 4WXHA 1NNDA 2QN6B 4FXWA 1FEZA 4K9QA 4AZVA 1D3WA 3D2BA 1LQ2A 2C4TA 1FJXA 3V1MA 4D0LB 4V19X 4ND5A 2O06A 1U0NA 3LHDA 4P5DA 1P0PA 1LGYA 1RIIA 1KP9A 3KVOA 1TPZA 2Y9PB 3LP2A 2TMGA 5GMDA 4D9BA 5K0ZA 1E3EA 3AZOA 2UZ0A 1WLSA 3FCAA 4DCNA 1SB8A 4JDUA 1XTPA 2HA4A 4C4XA 2UV8A 1Y1KE 2WD9A 4EG3A 2HJSA 4DC9A 3GFSA 1RHQB 2BGMA 3OI7A 4WL0A 3ZVRA 4E03A 4AYXA 2PSHA 4RH0A 3ZLTA 4BNJA 1T2AA 1P45A 4U9RA 2K6GA 1JXMA 3ZTTA 4N47A 2ECPA 2J9ZB 3RT9A 5EMJA 3TW8B 4N48A 2YRWA 4QPZA 1ULHA 5IM0A 2NSBA 5ITVA 4UTZA 4DLRA 3R8FA 2ZBGA 5DP1A 2PKQO 3K09A 1O87A 1X42A 4ZEVA 2GHQA 4HWOA 1JNYA 1S10A 3US5A 2B8EA 5JXIA 3WKBA 1JYFA 2DMRA 4C1NA 1BEZA 3B7WA 3HYRA 3I2HA 1N5VA 4GBED 1T9TA 1TQ2A 4YUAA 2FLWA 1W30A 4A48A 2W2OP 3WRYC 2GGPA 2PEZA 2BT4A 1HNVB 1RSCA 1K4MA 3CUYA 4Y00A 1T91A 5COBA 5TEWA 3LC1O 2AJ8A 2ZQ5A 3ISJA 2PFGA 3ILVA 1HYGA 2V3VA 3UV7A 5F8IA 2VF3A 1M2WA 5CJJA 3PITA 2AJ1A 3BF8A 2VDMB 2B1QA 5KQLA 1DKUA 2R7MA 4FXPA 2QRRA 3WI7A 4G07A 2ZTUA 2A9JA 1WEKA 3SC2B 1CUJA 2H1OA 1EZ4A 1DC4A 2WF8A 9LDBA 4B3FX 2O8FB 2YHIB 4CYUB 5E3QA 3M4NA 2W9XA 3EGDA 2CNBA 5EOVA 1HMVA 1PI3A 1KYXA 4EYOA 2JNWA 4EH1A 3H18A 2OGZA 2XVAA 2REOA 3WDOA 2PX2A 1YZHA 4ZC1A 3SXJA 1TQ6A 2PUTA 1QGED 1OIAA 3V4MA 2GI4A 3JWGA 2JI9A 3A6HA 2RD5C 1UPPA 4X4NA 2AQIA 1P7PA 1UWBA 3H1EA 4M0PA 4XD7D 4DG1A 2O0MA 2YQ0A 2FK8A 4LUBA 2FW6A 4EVSA 1EAMA 4ZVMA 4BWFB 1XX6A 1V5FA 1GN9A 1U3WA 3SM3A 1K3TA 5U4QA 4UTGA 1JTEA 1HOXA 1UETA 2CJPA 1BA2A 3DEAA 1H6BA 1AZLA 4E5UA 3D8NA 5FR1A 1RRCA 3KHRA 2M6SA 4TMVA 2BGRA 4HAUA 4K4SA 2J1LA 3R7BA 1EBUA 4N3CA 4R5HA 4X41A 3W34A 1QPBA 4V0MA 4I6AA 1FFHA 5L95A 5AVZA 2YW9A 4CNBA 3CRZA 1IEWA 2P0AA 2HHLA 2CYYA 4MVJG 3CURA 1BKSB 4NBNA 5A7GA 4YS6A 1W1UA 3NWBA 2OTJS 1W26A 4YMSA 2V6GA 3DV0A 3R9WA 1OMOA 3I23A 2OCXA 4XWTA 4FYKA 4UT4A 3SZ3A 2QX9A 1QC5B 1DXOA 2DBBA 4KVGA 2CPEA 3UMYA 2IYUA 3W5BA 2PJZA 3THPA 3KLEA 2ZSDA 3AUJB 2PUCA 2G9OA 2XDYA 1K44A 2HGMA 2KT3A 5KFLA 4NJMB 1CULA 1V7CA 4AF7A 1ISIA 1TU0A 4PLZA 3V7FA 3OJWA 4WQMA 3HB1A 3PEJA 3IC1A 3RB3A 1XC9A 1B6GA 1UKEA 1XAIA 4XVCA 2QZ8A 1YGPA 1Z4PX 2BTQA 4KSYA 4BLVA 3GJRA 1S72S 2PMBA 1XRSB 3FLMA 4GFDA 3AOEA 4J37A 2WSSA 4XWWA 2J0EA 4MWTA 5J23A 2MQNA 4DR3J 3H2JA 3R0ZA 1NW7A 1GPMA 1WAMA 4CF3A 4CT9A 3E2EA 2VT3A 3VAJA 2QV6A 3HKCA 4QKQA 4JOCA 4ZCRA 4N39A 1WC1A 3H8WA 4LQDA 2WIKA 5JJLA 3LWMA 2H59A 4J9MA 1LY1A 1ZPWX 4X66F 3NDPA 3C97A 3MJVA 1YIOA 3N8IA 1YACA 1RQPA 4CIYA 3DV9A 4A3SA 2HQFA 5FOXA 3HHPA 1QQTA 4NNPA 1SUWA 1FFWA 1G18A 3CVYA 2D2XA 3QPCA 3LWLA 1MA3A 2VFSA 1ZD3A 2CLLB 1Y48E 2ZSJA 1ZRHA 3QMQA 4F3YA 4DV0F 1QWOA 1Q12A 1LZKA 2I6SA 1XV5A 3N0WA 4E1BA 4K59A 1I4OA 2B4UA 2WC1A 5K3CA 1YS4A 4M0DA 1LW2B 1EVJA 4JI0J 4I08A 4AZ3B 3INTA 2B3TB 4QWBA 5J1SB 5JLAA 2OBNA 3I56S 3JZAA 1HNZF 5KJCA 1CFZA 4XPEA 2W58A 2W2LD 4KE9A 5L7TA 3N6LA 2F63A 1TK5A 5KNBD 2YWWA 1RRGA 5TGTA 2VH5R 3T3PB 4KIUA 1AB8A 2LEBA 1FE4A 4LRSB 2QSZA 4ALJA 3R7LA 4AFNA 5AW1A 2H5IA 3W7BA 4CTAB 3N7AA 3GT7A 1R0RE 4Q45A 2ODTX 2AH5A 2PJRA 1JEQA 4WBNA 1BHO1 1Y6QA 4K4XA 5JUMA 5K6TA 3TE6A 4ON9A 3MT0A 5JXGA 3AMVA 3ZWYA 3H5AA 2W2OA 3R74A 3OT1A 2GS8A 4HVAA 3WLAA 2QIPA 3ET5A 3W1WA 4PZ0A 3QJLA 4JJ6A 3SEZA 1XSEA 4EJMA 2EKDA 3GD5A 2E89A 1ODIA 4L51A 1MFPA 2VYFA 1UBHS 1MJFA 2WHQA 5JNLA 4N41A 4MIKA 3OOHA 3GRPA 4EOGA 3HCCA 1S8AA 3GHHA 4TVAB 1YTYA 4RDHA 4PAOA 2AE2A 1GNKA 3OIDA 3H5WA 1Q4RA 4IIFA 1FDDA 1MH9A 2W9BA 3EUNA 1EKXA 3L7YA 2PRYA 3PNYA 4CCYB 3WWEA 1NTOA 3SOPA 1UP1A 3P45B 4TQGA 3WGMA 3IKVA 3NHJA 4X65B 3WP1B 1X6VA 4Q3OA 2P2DA 2C5LA 3PFKA 3CH7A 1U24A 1XMOJ 3VVBA 2HBZA 1IOVA 4L15A 1Z13A 4JYZA 3MXHP 3E3OA 4XRRA 1NL3A 1E59A 4QOEA 3O0DA 4Q0BB 5DTEA 4RENA 2ZAGA 3F5QA 5DLPA 4EGCB 1HE5A 1NHWA 2HHSA 2DNZA 3VAIA 3P5BP 3B7PA 4PWDB 2EGHA 5FI1B 1NNEA 5CDGA 3CDWA 1PT8A 3HP1A 3NDJA 1ZJWA 3ESZA 3B8EA 2ZJPQ 4AF6A 1TR0A 4P73A 1SA0B 2I9KA 1Q1BA 4AL7A 1VQOS 3VDQA 4TS4A 4KPFC 4DN9A 1L8OA 3ST7A 3RIGA 1B41A 1M0TA 5KYXB 1YRTA 2SCUA 1SURA 3VZCA 1H1LB 1JALA 4I9GA 2OCBA 3V4VB 2HAFA 3QSIA 2P9QA 1E0KA 4NKRA 5FPYA 2I6UA 4KOAA 4IDGA 3WX4A 2W2QP 7ADHA 3P2IA 3AKDA 1L5HA 5SY6A 3IRWP 1R6YA 5TS3A 3U3KA 1OH8A 1N32B 2C7RA 4B8WA 1RZVA 4TN5A 3KLIB 1CR1A 1M1YA 4MDEA 2O2SA 1G2QA 1I6MA 3IUPA 1CEXA 2V0CA 3NHRA 4LBPA 4Q4DA 5F3WB 3T9FA 2P1DA 1DQYA 4DWOA 1JBKA 4L85A 3IBGA 1XXHB 3DU6A 2LXFA 2B5OA 1RVV1 3CNQS 4WASA 2OAUA 5KFZA 4XM1A 2OGUA 5CT9A 4PNPA 4ZPJA 2W8BB 3D8SA 2YINC 1KO4A 5FFMA 4RCYA 2NTNA 4WK1A 5AOVA 3ZDCA 3CF4G 3D2AA 2HGLA 4JQCA 1LPSA 2XMUA 4J0FA 2ZRDA 5FLXU 3P8BB 1VIVA 3G2HA 3GX1A 1ZW6A 4RA9B 2ZKTA 2ZVIA 3H99A 1LWXA 2QR5A 2V97A 3HVUA 3DYAB 4O3OA 2BKLA 3OBBA 1E1NA 2CFRA 3BMOA 2X0DA 4DNFA 4PS0A 5IAEA 2P62A 2D06A 2VSFA 4IDNA 2HK8A 3HSYA 3NTLA 3AR9A 1Y5LB 5IU6A 3RRYA 2F9FA 3PIIA 4NLTA 4H6XA 1KI6A 3CPWR 1RRVA 2ET6A 5FQNA 2AKEA 4LX0A 2VTDA 1IBKF 1G1XA 4JL8A 2HKEA 3BJYA 5JSKA 1H0KA 1IB6A 1B8VA 2QTWA 1VJ0A 1TUEA 4M95A 3H9GA 5JY1A 2RE1A 1TMJA 4CM4B 1AUVA 4L08A 4KXYA 1D2GA 3NRCA 3I30X 4I9FA 3S0JA 3GF4A 4OHFA 3QRRA 4G4SP 1KARA 3UN5A 1VHQA 2XY5A 1R8SA 5BMOA 4GKJB 2G2OA 3CPSA 4TXSA 2FLOA 3C46A 5C7PA 4IH4A 1QU3A 3E03A 2XG8A 2NR0A 1FWPA 1BH2A 2IEDA 3AD7C 5E4TA 4UARA 2B5JB 3HB4X 1NBHA 2Z4TA 1CRWG 3CH5A 3LSYA 1VFPA 4F3TA 2B30A 4M9UA 4I19A 3VNBA 2NUAB 4BVAA 3DP7A 3FRIA 3GFGA 5LD2C 1I5OB 1YSCA 2ZE8A 1JHVA 3K6SA 3ZJYA 4FWIB 3MM8B 3ZVKA 2WAMA 1NPRA 1Z07A 2B21A 1PF7E 1ZUNB 4NXMB 3HABA 2Z30A 3UYKA 2VAVA 1CZUA 3AJRA 1Y4AE 3PKZA 4ZDJA 3T6KA 4A0QA 4TTVA 5F4BA 2W2MA 1WDDA 4GBJA 4Q48A 1NHKL 4I6YA 4HN9A 4QBUA 2FSVA 3CY6A 2XNCA 4ES2A 4XDHA 1XTJA 1BSVA 5FX2A 3OL8A 1OI2A 1ZSYA 2OMEA 1Q84A 1MO6A 2ZSKA 3HU3A 3MWDA 1B8PA 1RT3A 1GPKA 1JFRA 3UHOA 3VOBA 3AA9A 3D1HA 1JXEA 4WTYA 1V35A 1G7CA 4Y2AA 1BE1A 4Q8EA 3CF6R 5JSZA 2J8ZA 4LRXA 1OYDA 2U2FA 1VS3A 4LJAA 1OLUA 5HJ2A 1L1RA 4OI2A 1JJVA 2X1FA 1DHTA 1E7WA 2PH5A 2XB4A 4LTDA 2GJAA 4DLUA 1Y8QA 2YRFA 4D96A 5KHLB 2B98A 2W2XA 5F7XA 2H4YB 4WCEQ 1NI4B 4P7FA 2QW8A 3FRHA 2O8EB 2Z8XA 3MVEA 3RF6A 1JYEA 2CVIA 4RUBA 1JX6A 4ZHQF 1OAAA 5CVDA 2QHXA 3TX2A 2SICE 2Z43A 1VRTA 2WHRA 5EEGA 3DDSA 4MDYA 1JMYA 2C9OA 4ZVSB 2DRAA 4NCGB 1HYHA 3RAJA 5A0TA 1NJSA 3WA6A 4QDUA 3DW3X 1FDWA 2GJIA 4YDXA 1EX9A 2PAAA 5C5EA 1L7DA 2DR2A 2UUBB 1EMDA 2OUGA 4MTPA 2HJGA 2QIFA 4FN4A 5BRJA 5BNZA 1N2HA 1VJGA 1QF6A 2B4OA 5J2NB 4QGHA 2GIQA 1B4SA 3ETNA 5SY9A 2GWRA 2AC4A 4KV9A 2RH3A 4H17A 3P5BA 3JAMA 2BBTA 2R68A 4NRUA 3L2OB 1XNRB 4JEIA 3DHYA 3QBDA 3EXFB 1II8B 3VI3B 2ZNZA 4MR7A 4F56A 2ATEA 3G8AA 4LTMA 5ALIA 3A4LA 4DBZA 3OFNA 3WYBA 1UPUA 2BM9A 1RHMB 1XD8A 1PYGA 1Z7YA 2MDAA 2BBSA 4IIEA 4ERXA 4YB7A 3ZZNA 4DIBA 3RAEC 3P0JA 3EF0A 4RQUA 3BDEA 3FJOA 1YJ5A 2YNIA 2W2QA 5T6MA 3HRIA 2PWBA 4RW4A 4CMAA 1L3BA 4D80A 2WJZB 3SIWA 4JYAF 5IJAA 3OZVA 1N52B 2BW2A 4TRJA 4MCHA 2QLWA 3GEDA 1WUYA 2MSCB 3PJDA 3IS9B 2AN1A 3PR1A 2XUOA 5IS2A 3A58B 3UCGA 1HFWA 1SXGA 2G3YA 4DRXA 1DCMA 1RT5A 4M5DA 2BMAA 3EZNA 4YECA 3GH1A 1TJYA 1PBUA 1YI1A 1QM9A 3OXGA 1T2VA 4EW2A 3GLVA 4D92A 4DZRA 2CVOA 4BDTA 4HQOA 4RXUA 1ZAWA 2CD7A 4JP2A 3ONDA 1C2TA 4NEYA 2A33A 2UZ3A 5D86A 4O2AF 1XEXA 1R1DA 4N7MA 1YR6A 1APBA 2FDXA 2Q99A 2NZ2A 3MF4A 2D0DA 1AMUA 1T1EA 3G2KA 4RZXA 4R7TA 2XWYA 4NV3A 3BWVA 4RTPA 1C0TA 2CFXA 3THXA 2BP7A 4X20A 4COOA 1U4OA 4DR4F 2XC9A 5EXEA 4W1SA 3A31A 1PR6A 1BQMA 5TGDA 1X5TA 2G0AA 1L7PA 1AGXA 5CYGA 1PFQA 1Z6GA 3OTWA 3PVCA 4O2BB 1E7MA 3BRCA 3GP8A 1NRJB 5JW6A 5I01A 4PQUB 1RI2A 4D5GA 2LU2A 3OPKA 3SKXA 4B6RA 1IWBB 2HNKA 4CO2A 2W6IA 4OM8A 1UL1X 2J7WA 2DE0X 2Q8QA 1VZ2A 1PEKE 2PZAA 1ECBA 2FX5A 4EUEA 1EE1A 4P10A 2AG5A 2FXIA 2R42A 4AKGA 3MTAA 4L4SA 3AUYA 4PC1A 3JSMB 2I3GA 1NJWA 1ZGAA 1NLMA 2R7NA 1RBQA 3I9LA 2VFTA 3ZZOA 2DHRA 4E21A 3VKHA 5EA2A 5FHQA 1M2VA 4PUOB 1WW8A 4RZHA 2X9GA 4IZHA 4BS9A 1UMBB 4W5TA 3JZMA 4EDHA 3QX9A 3OUTA 1EIWA 3O2JA 2WAYA 1T0JB 1ZM3A 1ECPA 4TU8A 3DT8A 5TC4A 1F8XA 5AJHA 1JFFA 4AJIA 4OOEA 1KYWA 4JBNA 3U7RA 5KFXA 3ESYA 3TWZA 3NHSA 3BQMB 2QLMA 5HXAA 2AGOA 3EWGA 1VHTA 4ND8B 4GIBA 4ZT7A 4YASA 3HXQA 4O1HA 2BR0A 4DUZF 5BN3B 1F1BA 1XZ8A 5KYVA 2MPUA 1U0HB 1IEQA 2F59A 5E6UB 1M1NB 3L9XA 2FP4B 1GZHB 1W8IA 2H3HA 1DWPA 1PBNA 4L5YA 2WCXA 1PHRA 4GMFA 3V6MA 4RLQA 1M6HA 3QXCA 5EZYA 5HKAA 3IRXA 2JHAA 3LP8A 4HDSB 3ZZ1A 3LD9A 5BR1A 4L9RA 1FSZA 2EK6A 2AE1A 4UUMA 5LQNA 1DC7A 3R76A 4ZAZA 3K2YA 2QM0A 4MRMB 3JR3A 4DTIA 3GN2A 4EHFA 3TQQA 3P4XA 1XPUA 5CIWA 1L4NA 3MTJA 4MR9B 3KXIA 1GZDA 3P9KA 1SZDA 4UBOA 4JI8J 3T3OA 2X22A 2V9WA 3BDVA 3AEQB 1KH1A 1DIRA 3I92A 2DY1A 2IYOA 2GVZB 5BR8J 5FL3A 5EWJB 2BJ7A 3JYHA 4DCPB 2RGGA 1RLOA 3KHUA 1Y1RA 3OP1A 2GDJA 3OZDA 1F2VA 1F2UB 4QL3A 4D42A 4IS2A 1ZSNA 3VV2B 4D25A 1EGVB 1AO0A 1AS3A 3T3MB 2YKAA 2C1XA 3W7AA 1M5OC 5IWAF 1MWZA 1GKYA 3BKXA 1EX7A 1ZOLA 2XTNA 3QPBA 3PP8A 5IT9U 1IAQA 3CVWA 4FUQA 5IEBA 1QK5A 2IBTA 1G8GA 1K9SA 3EVOA 3V8BA 4OHKA 4URSA 3C8HA 2QENA 5IFKA 3ESRA 2DRDA 4K5QA 3FM9A 1YH3A 3V2UC 3VHXB 3E18A 1T29A 2A67A 5BVGA 1I2ZA 2C2MA 1FJCA 1D0VA 3HJTA 3H2ZA 2JD2A 4NK5A 3SIPA 2PSDA 5ICSA 4JDPA 3PFGA 1GGMA 2ZETA 4DSOA 3UF0A 1W5TA 4PGMA 1GEEA 4J75A 2G8LA 4R0JA 4XPIA 1R6UA 3TE7A 2HL6A 1ZH4A 3KG4A 4I5GA 2ZIXB 2FMTA 5CIQA 1PJ2A 2W24A 3GOHA 1LLUA 4KI7A 5B6PA 1ZUHA 5I9LA 4FWTA 4ZJQA 4YRTA 4YRSA 1DQ9A 2B61A 2ES4A 3B5JA 5B58T 1QJCA 2I7DA 4O4JB 2WHXA 3G3EA 1DB3A 4GR4A 4P6VF 1CZNA 3QJGA 4K6MA 4MPTA 5JMWA 5E7MA 3NGTA 4F6LA 4JI3J 2XUFA 2GXAA 4PYDA 1TL1B 1N5SA 1P29A 5HZHA 1B70B 1Z28A 3NI2A 3TYXA 4XQGA 2Q6BA 2Y0EA 1Q14A 4WZMA 3ACDA 4YIKA 2OSBA 3H1PA 1XMVA 1U2CA 1F0NA 4MKHA 3AVWA 1BHSA 4MGYR 1WXDA 4D9MA 5D1NA 1NUUA 4LY6A 3G4SS 4ZC8A 3IDQA 3E5NA 4G1EB 3JQAD 2HJRA 4KH1A 4ZXFA 4F4UA 4KPCA 4MA4A 3MBIA 4PXBA 3VTIA 1K3UB 3M9MB 4Y6SA 2PUEA 2OFPA 2OBXA 3PXAA 2JEYA 1R88A 1SVSA 1QG2A 3V9PA 1KXZA 3REQA 2VHGA 1W2IA 4RUAA 3S6EA 1FRFS 3MRXA 4TL8A 3S44A 2J0SA 2JNJA 5IFMA 3KDSE 4DQVA 3CLSC 1Z36A 1NF3A 5LOQA 4Q12A 3RFTA 3V4SA 2ZUDA 1IAVA 3EIXA 4K1LA 4KO2S 1N4LA 4D46A 3ZTRA 1VB5A 3T9NA 3KYLA 4DR6J 1CQPA 5EZ5A 3EBLA 1E20A 4ENUA 3Q8RB 5KT6A 1T0HB 4FGSA 2Z9CA 4DMZA 4BE9A 4V1CA 1VE9A 3H9UA 4GPD1 4ZJZA 5BT9A 3K15A 4YUZA 3IHTA 1YDFA 3ANMA 3Q5GA 2JAPA 5LMZA 2I7XA 3VKWA 1PLLA 3GMGA 4Q66C 3M3DA 4CO4A 3RH0A 3I04A 2HZBA 1OV6A 2VA3A 2WFMA 3TJRA 2JEJA 1RLCL 1R7IA 2C04A 4N7TA 1G21A 1RXIA 1VJWA 3BJEA 3IIKA 4YWJA 2JBAA 1LBQA 3ETDA 1KSFX 2CNKA 3CCCA 2FR0A 2C2GA 4KWEA 1WW2A 3BBFA 2AKWB 2CXRA 4DLBA 4FMDB 1BN6A 4TT3A 2BSAA 2GKOA 3QNMA 4LVNP 2Z5FA 2MTBA 3LO5A 2J5XA 4QSMA 3HXLA 2JFDA 1GG9A 5HR5A 1I9CA 3E7FA 3ULKA 1K73T 3EAQA 1DAOA 3I1IA 3UO8B 1X7XA 2RKOA 4RM3A 2X5OA 3B3AA 3IVAA 2DCUB 4C97A 2H7VA 5IJZA 2FPOA 3WGIA 4DAEA 1S8OA 2J9RA 2FMIA 1I7QB 1XMSA 1E1YA 4F0HA 2ASYA 3OPVA 3RJTA 2CZ4A 3ZTSA 4OUDB 3A37A 2MTLA 4DUGA 5SZHB 4A8FA 1PWZA 3DR5A 5CYPA 1GPUA 5BQXA 4RL1A 5SY4A 5EKTA 4M0FA 4JKOA 3QNWB 2RRAA 3S2FA 3LGNA 2IT1A 2A5FA 1YUBA 1Y4DE 2H18A 5FWYA 4N5SA 4C8YA 4C11A 4PFQA 1RABA 3W9BA 4DPTA 1DBWA 2RH9B 3BZUA 3GPAA 4C21A 1N5KA 4TLQA 3K0AB 1TA9A 1U7TA 2WJWA 3R5JB 2IWRA 4ZK2A 4U96A 1RJFA 1XQVA 3BEOA 1GL3A 2GB4A 2OPRA 3I1YA 2HT1A 2EX1A 2GEUA 2ONCA 3VZHA 3IP3A 4XB2A 3VTKA 2RH5A 4M9XA 2UXBB 1XZAA 1SBTA 5DHSA 2K3IA 1L8LA 4OJ1A 2W71A 8OHMA 4DL3A 2ZM6B 2O3SA 1DV1A 3PC2A 1QHXA 2V7BA 4RU1A 2J5RA 2OQIA 3OFSA 4D9KA 4XDZA 1ZU5A 2Z6QA 3A9CA 3PRVA 4E2YA 3QEMB 1H2TZ 5GWXA 4RR5A 3LTNC 5BYJA 3DNMA 3IR5B 2KTQA 4CUJA 2P91A 5CD4A 3P9PA 3Q23A 3VMFA 5SYMA 2F1IA 1W8DA 1A9XA 3D2WA 1E3LA 2G25A 3OLCX 5FOTA 2RGNA 8GPBA 2H07A 2EV9A 3LALA 1RFLA 1V3ZA 3V9AA 2AMVA 3TX0A 4OKSA 1VGQA 1TMKA 3I2JA 3KZVA 4HYQA 1X9WA 4UCFA 1WOSA 4PLHA 3T4PA 1FVOA 2OE2A 1U2QA 1YBUA 3LPCA 5H83A 4RJKA 4O4LA 4K4YA 1TM7E 2H65B 3V46A 2Y8YA 3VC2A 4MCJA 4PZPA 1QE1A 4Y1FA 3UT5A 2FWPA 3MUEA 2A5LA 3H0EA 3ZCQA 4F8JA 3MM5B 2HYDA 3ADAC 3UUWA 2BUBA 4FZJA 3LPMA 2F43B 4USKA 4KGVB 3UJDA 5CBKA 1EGMB 3KVRA 4CO5A 3TL2A 4GNKA 5KDDA 2E82A 4DEYA 4QUHA 4JWKA 2JANA 4GMGA 5K3AA 2Z1DA 4DMHA 4AMBA 3RVBA 4OLJA 3TM5A 3FWKA 2IYNA 4WSOA 5D5HA 1I4LD 2IUSA 5L3SA 3DLEA 2VHZA 3IP5A 1SXJA 2OWDA 4BQEA 4GO1A 2J9GA 3RBDA 3NJ8A 3GIKA 2PH7A 4ARZB 4B4KA 3T3EA 4F4YA 3SQGA 1JKJA 1D9AA 2A8YA 1NF8A 3DMJB 1S49A 1BRMA 3G0HA 2ZKLA 4AG3A 4PVCA 3KNAA 2YZ2A 2XMAA 2VS1A 2JA2A 3GN1A 3MRVA 4QR2A 1KIFA 2B7BB 3OQJA 4CNZA 4KFTA 1MC1A 5BW6B 4GM4A 2GN2A 4KFCA 1NWHA 4RD4A 5T67A 1P7WA 4YMGA 4FFBA 3BHJA 5HVFA 1E9RA 3ZHOA 5HZGA 2QQ5A 3QY0A 4LV6A 4UCWA 1CRQA 2NQPA 4NICA 2QZ9A 16PKA 4FNOA 2ZUCA 2J0UB 2XCLA 2JLCA 4YRIA 2XBPA 1WTBA 3T5LA 2NU9B 2F64A 3HVTA 4I55B 2Y4NA 4FHEA 2IMOA 4E0BA 2Q5JA 3QUAA 3GLGB 2IDMA 4EKGA 5BT8A 3NOGA 5HE8A 2YX7A 5DOVA 2HQBA 2BTEA 2FHPA 3E9NA 2Q0XA 3U0VA 2JB9A 3RS7A 2IRWA 4EENA 1QKJA 1TEXA 4B3SB 1SUAA 1D09A 2ZG6A 4S1OA 2QE7A 1MP0A 3AUSA 4RNMA 3C14C 3DAOA 3PUZA 4UPVA 1SG0A 2O2IA 2R3VA 4PBSA 3WLTA 1F9FA 2IM0A 3B2NA 3U0BA 3IS3A 1CC8A 2IXTA 2OGWA 4H27A 2BRUA 3PUJA 2V50A 4KMSA 1M7GA 3DM2B 4IJVA 4LVNA 1JU3A 1YHNA 8ATCB 4XGRA 4ZO8A 4UHJA 2UUCJ 2OESA 1J24A 1X0PA 1JPNA 4CTKA 1GTRA 1R8CA 2AJDA 2QX8A 1O6GA 4DL6A 2A5GA 4WN9B 5JHHB 2Y1JA 4FMCB 1VHJA 4DV3J 1V47A 2IX9A 2ID4A 3RLIA 5DVZA 2MY7A 3JQCA 3QF4B 4O8CA 4YS2A 5HJ5A 2FE4A 1IBMF 3VZQA 2F4VB 4BVHA 3GLUA 3W9JA 1XCOA 1T6BY 3CZMA 1KIAA 3PDUA 4TT3D 4TVOA 1L5LA 1GYPA 1P1CA 2PH3A 3WGJA 5ADUS 1AK9A 3M32B 4K9NA 4KXQA 4IX9A 5AVVA 5JCJA 4F2GA 4ABYA 2DWCA 4YQYA 1Y6ZA 3T12A 1CB0A 1KOHA 4YRNA 2HRZA 1VE1A 3GFHA 2X0RA 2C61A 4DLLA 2QPOA 4PWUA 1DG1G 3UGJA 5AVTA 2OO3A 4XUEA 2VJBA 1GH8A 2PQ2A 2IZ7A 2YOGA 2IBKA 3PL1A 1RRKA 2IHYA 4YCBA 3N4WA 4LF6B 3SHQA 4H4OB 3PF9A 4G2TA 4EO7A 4ZANA 3HO6A 2EFCB 4L75A 5AXKA 2MJLA 3AVUA 1HG1A 3F6SA 2J3EA 3K20A 4ARSA 2ID8A 4HFJA 4HEQA 1PVVA 1AUPA 2ONZA 1BMFD 4NU0A 3N9IA 1RWVB 5L6MB 2OHXA 2E9RX 5C5JA 3CX4A 3A9SA 4KN5A 1O96B 3CXRA 3DL2A 4YAIA 3VALA 3U19A 3I4HX 3VYWA 4K5SA 4ME6A 4KGZB 2NWQA 2J9CA 3O8OA 4NZYA 3BK7A 1O9HA 3TNYA 1UBMS 1IEXA 1UADA 1QH8A 1SH3A 2ATXA 4YV1A 5EXTA 2R00A 3UNGC 1AZSA 1QIEA 1X9IA 3ZGLA 1EKRA 3AEUA 1LU9A 4Z9YA 2COKA 1E2NA 2DPGA 3R5KA 3GLIA 4P6QA 4ZJOA 3ZGXA 4DCUA 2JFFA 5KAPA 1N6OA 5H82A 1ETHA 3BXXA 2JZNA 1SXPA 3CMCO 2GKGA 1NW9B 3B1FA 2V45A 3AWDA 2R44A 4DG5A 3KKEA 3RS2A 1UT5A 2WVDA 3H2SA 3EGIA 1G9SA 5FBQB 4JVSB 5K20A 4BO1A 1PR0A 1KHHA 2CFTA 5CYJA 5LC1A 2Y1LB 4V0QA 2NUTB 5KTTA 3LVFO 1NMYA 3HR4A 5K0JA 1FOEB 2IDZA 2CYAA 4EUSA 4G6ZA 5JSQA 3RS8A 2OFXA 5JCZA 4YAOA 1TFYA 2RKBA 3DEHA 5CCDA 4AX4A 2R4FA 1WCIB 2I33A 4K9DA 3F5FA 3Q3IA 3FSJX 5JTUA 2D0OB 3VH2A 3A36A 1IDN1 1G1MA 4P0QB 3V81B 4IIJF 1ZM2A 4HWSA 5YASA 2R6GA 1TADA 3K0FA 3HDJA 3VHRA 4J91A 2CXEA 2C4NA 5TVGA 2VD3A 2NQ8A 4C4WA 4V0SA 4ZYXA 1FP4A 3A8KA 1BQNB 1V9CA 3R3XA 2HPVA 3E3NA 3SYLA 1SU4A 1OXVA 2I1RA 3V1NA 5F3DA 4EYEA 4AS3A 3IQEA 1OYWA 4YB1P 1HLWA 2NT4A 3QOXA 1P4HA 4XD7A 4Q47A 4IOAQ 2VRBA 5EIAA 4WCFA 4YQFA 2FB0A 2H4WB 5FV4A 2ZP1A 3T0FA 2ZTHA 5ALYA 3GDWA 2B8TA 2VQ3A 2NNLD 2DTDA 2YWHA 3KLVA 3WRYA 3W6PA 4DCJA 4EQ6B 4V02A 3ZH9B 1J9GA 4DLEA 1JHYA 2OSVA 4KYTA 1BQXA 1T3OA 3EXHC 3AVVA 1EARA 4WLFA 4ED8A 1OIVA 1TKXB 3C16B 3DLAA 4DIKA 4YMEA 1RPZA 4OJGA 2QE6A 3E15A 4INZA 3Q8PB 1GTEA 1KRPA 3A6ZA 1SC1B 2XS2A 4F1WA 2PZBA 1B23P 3GJ5A 4XIFA 3VJMA 3NBUA 3D5QA 3H2IA 2GX8A 3T1QA 1HY3A 1UA1A 3QYPA 2PD4A 2HVEA 3DTTA 1OFIA 3HCDA 1S7HA 1S3SA 3Q88A 4J7XA 3DDHA 4JLNA 4CCAA 1NNUA 1ODCA 3QVSA 5CGZA 2DHHA 2RHDA 5I9MA 5K8NA 1EFAA 4DL7A 2OBFA 3IUYA 2ZH8A 2W6JA 2PN1A 3DFKA 4WWSA 2XXBA 5C2CA 4WW0A 4RD1A 2IHBA 4QT4A 4MW9A 1ZH6A 2Z5VA 3CXUA 2QV0A 1NURA 3K5MA 2QN1A 1PEYA 4RTJA 2XHEA 3ZHSA 3SN6A 3OU2A 1QIHA 3BTOA 2BGIA 3PHGA 3DQZA 3LDAA 2WVJA 4UUQA 4J94A 4KSEB 3UGQA 6LDHA 3JQ7B 3V80A 1J70A 1Y7TA 5DQIA 5TQ2A 5I3UA 1F8YA 3PC8A 1E8MA 1VBZA 5J1NA 4DR2F 1ROFA 1FVHA 4LIPD 1RMYA 5LU8A 4EW3A 2DNRA 5DF1A 1SC4B 2YL2A 3TW4A 1C1CB 1W0CA 3LX6A 4Q39A 3PRYA 1EWVA 2QTVA 2FF7A 4Y8VA 2CPZA 2J9FA 1QF7A 1MOSA 1NVWQ 4QOIA 2VHYA 4LYEA 2G4LA 2A1UB 5BQ5A 2CPIA 3PYXA 4GEGA 4RK0A 3T1YF 3IVCA 1X9GA 4XJVA 1QLHA 1KHTA 4Y0VA 2JATA 5ALWA 4I6EA 1DIGA 4RPFA 2O7NA 1I5RA 3CDBA 3UICA 1HEYA 4DPYA 2PRZA 4Z99A 3MHYA 3L46A 4M6WA 2DXFA 2OP0A 3GQVA 2ID7A 1MHPA 1T8RA 3M8WA 5ALNA 1JPUA 2Y76A 2VPQA 4BBPA 5KBYA 2Q7XA 3X1MA 5JD3A 2W4PA 4ALIA 5KFOA 2COEA 1Q79A 1OJLA 4B85A 5K4HA 3WL8A 4FGJA 5CT4A 4EO9A 1N5TA 4NLVA 1Q57A 1Z5UA 3DE5X 4FS1A 5KZMB 2Z2JA 3C3JA 5COAA 2EDAA 1IXYA 1Q0ZA 1F20A 2GJSA 5JCJD 4A46A 3WSWA 4O3FA 3TQTA 3BWMA 1AM4D 5GAHI 5J1EB 2W2LA 1BJRE 2CPJA 1PL8A 3I05A 3VX4A 5KNBA 1LPOA 5AJ3J 3JYQA 3TLCA 2XKKA 4KGDA 3OOJA 1Y9EA 4OYIA 3UDVA 4YJ3A 4PRFA 1E0SA 3L07A 4PQYA 1HTWA 1NOKA 4B83A 1RPJA 2CBXA 4OGWA 3BB3A 1YFKA 4Y6IA 1D2HA 2VK2A 2AF4C 4G5SA 3MWEA 4ZKAA 4M1KA 3ORFA 2IYEA 3KTFA 4DR7F 2ZH9A 2PPLA 1T9GS 2B8NA 5A8KB 4OY3A 3CMES 5KTRA 2G5CA 4QUBA 4YDHB 1R3DA 2IY5B 1B7FA 4WVFA 3R9KA 1F60A 1OWNA 3ZWAA 3HGTA 2CNWD 5FRDA 1U0JA 2F1HA 4YROA 4OFBA 5KTQA 3NGSA 1SCKA 2WP0A 4AKHA 2DCMA 4DA4A 1IR1A 4M54A 5IWCA 2G1UA 5BWLA 3KJFB 4B3RB 5IF9A 1Y42X 5HQ8A 2R7LA 2ETXA 4K9SA 1WUIS 1B42A 3PR2B 4W6QA 5JJ5A 3WLJA 3MD1A 3ZLBA 5FULA 1BXZA 3NHWA 2VU5A 3JYOA 1MO4A 1MGPA 3OLQA 4WZ6A 3TMKA 4U6SA 4C9DA 1P6TA 2XDQA 2B94A 3V1LA 3DXXA 1A96A 1U0RA 4NAVA 4X9XA 3MQFA 3KBOA 3LCRA 3Q2IA 5H70A 3TLGB 1TO6A 1V6SA 1N77A 3CW9A 1PKXA 1AD2A 1FEEA 2Q3BA 5HKOA 1NW6A 4QQRA 3NGLA 4RK6A 3ASZA 2KYRA 1U2RA 2ZLBA 1KJYA 4QULA 2ATCB 5F3ZA 5KJFA 3N0TA 3UXMA 4DI6A 4KR6A 1MEEA 4M3NA 1I01A 1R4MB 5HW0A 3ACCA 2ILYA 3PUKA 2JD0A 4BO2A 1VYHA 3U4MA 1II9A 3JRWA 3O5AA 1NY6A 3HUDA 1DDOA 4ZEOA 3HFKA 1DKQA 4KODA 2GJKA 5KJEA 1B14A 4JD5A 1BC5A 1UWVA 2HDWA 4PHFA 2VHTA 4RX1A 5AI4A 1YF3A 3DGPB 2WYUA 3GUUA 1JEYB 4R8LA 3C41J 4TS1A 5C7IO 4HSGA 1OLSA 2ZR8A 5DK4A 4R01A 4Q7EA 4KAFA 2GTIA 1SAYA 3EPJA 3D6FA 1EVKA 1NXOA 4M5NA 3G9TA 2OT3B 3KM0A 4ZCIA 4LFBB 4DF8A 5REQA 1PJBA 4ALZA 1U1OA 1QFZA 1EDDA 1BW9A 2PGOA 2C9YA 3ZU2A 4EUKA 1GXSB 3UAYA 3VDMA 4YPVA 2VONA 3TEGA 1DI0A 1L4MA 1VK3A 1FDAA 4PXCA 3ZK7A 3G9QA 1RQLA 1DFHA 4BVLA 2C2KB 1VSUA 3K73O 3WJ1A 3IR7B 3QHAA 3UJ6A 4PGHA 2FTRA 4GD3Q 1X77A 2H1YA 1VCIA 2CK3D 4C6AA 3MCZA 3VYUB 3NKLA 1XZGA 2NU7B 2IEBA 1H98A 5DGAA 1H0HA 1JQBA 4UQGA 4YLGA 1MG7A 1SBIA 1VL8A 3IO1A 4YRDA 2MSTA 4DQIA 1SKAA 3ITHB 3M9OB 3U4QA 4YPOA 4IJ5A 1Z2PX 1S76D 3GA7A 4PLPA 2W6JD 4M1SA 2MOKA 3PHTA 2O20A 2DUUA 4R98A 4NOHA 1XJ0A 1YK1A 4ZO9A 4TXLA 3DB2A 4UE2A 3L6BA 4Y2RA 2HSDA 4YEDA 4J0KA 1L4EA 1KMQA 1RAHA 4KEAA 3S1TA 3QUTA 4UUWA 1N1GA 4W4TA 2VWGA 3GRVA 2JG3A 1FBTA 2QLBA 3R9IA 4WIQA 2Z57A 4QVKA 4NLUA 2POQX 5JZVA 5HCIA 1N1MA 3O9VA 4WWHA 1S6YA 3EASA 1PL6A 1DC6A 1UMDB 2YVAA 2GPTA 1ISPA 4LCBA 5LOVF 2GYYA 2HD4A 1LXJA 3U1MA 5LB2A 4O1IA 5AE1A 1RDFA 2QN8A 1K7EB 3DLLQ 3OKFA 2L42A 3W4IA 1AJEA 3ZS9A 3P2OA 2PANA 3JQBA 4DTCA 3PGLA 1NONA 1K47A 1ZUIA 2BEUA 1H22A 2NAFA 2AI1A 1K7CA 2YJ4A 1VI7A 2WZ1A 2PZKA 4OGLA 5HGXA 2Y6VA 4TV8A 1D03A 2QX7A 3RAGA 4EG8A 4UY85 2AHRA 4FHGA 4DOMA 3RVDA 3FROA 2XLKA 1SM4A 5A3QA 4NBKA 3VZPA 1FQKA 3AHFA 1P31A 1WXXA 4P36A 4KX3A 4EEYA 2OFOA 2I1QA 2M1XA 3LAWA 3FB1A 3GIWA 5DV9A 1GQYA 2HZAA 5TMBA 4RIIA 2BACA 3ENNA 2HCTA 2AD5A 3U4DA 1UVNA 3BCRA 2AR9A 9ABPA 2ESRA 3SEFA 2IYZA 1Z73A 1EXNA 4QHSA 3D68A 3PW7A 3L3BA 1HHSA 5A0YB 3AJ8A 4C78A 2XYHA 3OZRA 3GDHA 4Y2PA 3S27A 2ACMA 4A8HA 3P9QA 1ZXLA 4QWCA 1DRVA 4ZD6A 1HBNB 3TUIC 1DKOA 3NO4A 4TQUS 4ER0A 5CCLA 4GYKA 3HXTA 5J43A 5E4FA 2VOEA 4U7FA 1HLFA 2W70A 3ZDZB 4AYWA 3ZD7A 4O29A 2OBBA 2R6ZA 2W2MP 2QMQA 1CLEA 3RSOA 4IIDA 4CG2A 2YXBA 2PX3A 2WPDA 2A0UA 2VF7A 3M2UA 5THKA 2OCGA 3RPEA 1EGAA 5LZ5A 4LR8A 3FOEC 5KQMA 4TZ6A 3D1LA 10MHA 5DHFA 2RT3A 1FSFA 1B1AA 1BU8A 2I80A 5JFOA 4FHCA 3J7AC 3THRA 4I67A 1YB7A 2P6NA 3PNPA 4FIDA 2X4LA 1Q7BA 4HLQB 3VAHA 2NO6A 3FOBA 2QTHA 3DVSX 1FPMA 2HDOA 5ETJA 1VC0A 2CV2A 3B4MA 2C8JA 1OX4B 4HL9A 2B7LA 2X2OA 3IKMB 4NVRA 2QSYA 5KINB 2ALZA 5HBMA 4I4TB 4CM0A 1ABEA 3WHPA 4KQJA 3NZEA 3O1HB 2PIIA 5ALEA 1YRWA 1Z06A 3D7MA 3AVQA 1Y00A 4CIOA 3DXFA 2WG1A 3AHCA 3G8QA 3FKQA 1XU4A 3A1EA 4EFAC 3DO6A 1I94B 2HADA 6AT1A 4BMZA 2QBYA 4FP9A 2RQ4A 1I24A 3U5TA 3VSCA 3TVTA 1FS4A 1UMCB 4Y34A 4P5EA 3EE6A 3SI7A 3DTNA 3A1TA 5J5AA 1ZC4A 4B02A 1ZOTA 2X86A 2Q4EA 1ECCA 1OFVA 1ZQ9A 2OV2A 2UKDA 2FSPA 4AQDA 4EATA 2XE6A 1PTKA 5ETSA 4J0HA 3GGDA 5B36A 4ZKEA 2PQ6A 1CR2A 2PZFA 1Z83A 2BKPA 2F7VA 1LBHA 3F5MA 1LUAA 3C85A 4Y30A 2PQ0A 5ETMA 3AUAA 3K3PA 4S1PA 3BO2A 3V48A 2V7WA 2CF6A 3MEEB 3G5MA 3DRXA 5TSDA 3WICA 4J0IA 1R0BA 4RD3A 3QWFA 3DMDA 3G2JA 4LN1A 2FRDC 5CXXA 4C6TA 4PXAA 2K1RB 3RTVA 3TAMA 4F5DA 3ZH2A 1FUEA 4OAPA 3ZKWB 1VI6A 1KQFB 3ZJ4A 3BORA 4OF4A 3FSIA 3EZ7A 3VPDA 2RHRA 3QVJA 1RT2A 3EDQB 1SHZA 1MNAA 3JU3A 2EIHA 2AV6A 2YPZA 1DNPA 1KMNA 3NCHA 3PE4A 4JJ8A 2VQFB 1Y5RA 3HTXA 1UXGA 1UW9A 1FXUA 1KEVA 1WA5A 5DNAA 1X7VA 4O4IF 4MV8A 3BXZA 1DUSA 3ZD8A 2O5DA 4C2BA 3PQ5A 3OZTA 2ZJ8A 4QZVA 5KJ1A 3BAFA 3KDAA 1S7CA 2QL7B 4FVCA 5KFEA 1DZIA 4DR3F 1JKIA 2E4WA 3TJAA 2XXJA 5K6AC 4LSGA 3T3NA 4CIBA 4R16A 4BEJA 2JEIA 2GAOA 4HNGA 2Z08A 1T3HA 5B57C 3EZYA 4DCOA 3CJTA 3FCWA 1CZHA 4GOOD 2O5VA 1CJUB 3E23A 4NXNJ 3MMBA 1NEEA 3HKBB 2FUNB 2GSDA 1G0NA 5HQJA 3CCLS 1NUQA 3KLFB 1R5BA 2IV3A 4DS5A 2GBIA 3K9FC 2RCYA 4MP8A 4POAA 4MLPA 4HXGA 3FPSA 1TQLA 5LB4A 2LRHA 3H2VE 1Z4KA 4UZEA 4HDMB 3URKA 2OXTA 1UEUA 1ZGHA 3QVGB 1LTQA 5AXDA 5IYZF 1GMVA 4GRDA 3UWDA 5DT9A 1UC4B 3UK1A 5BNTA 4ZP6A 1CBUA 1M75A 1A27A 4WFAQ 3SD7A 3PEVA 2BEFA 3BV8A 3SBMA 1XQWA 2Z0MA 4HN2A 2FDNA 2QTZA 4NG4A 4WKNA 3BH6B 4JI0F 5G53C 3T4XA 3TTWA 2A18A 1V41E 1Q8IA 4IWXA 4Y2SA 1XJ5A 4K9LA 2DFNA 1XTQA 4TL7A 3O6QA 1OXKB 2H2AA 2V69A 2O1XA 2PKRA 3ZQ4A 1B3RA 2JGFA 2IJNA 2FUG9 2CVHA 4OEHA 1QAIA 4NR0A 1DEAA 1E3JA 4QWEA 4X4VA 2QRJA 3E9CA 5CCXA 3DXBA 3TBFA 2YN2A 4YRBA 4DLKA 3I5BA 1RTJB 2R60A 1HBOB 1ICEB 5ESWA 2HXYA 2MU1A 3UBTA 3B1VA 5EIXA 5AJTA 1P75A 1MXHA 2J9EA 2PHZA 5KG2A 3ZWCA 4ZV4A 1CPZA 4RA6A 2HMIA 3UG7A 3EGXB 1YVEI 5JBIA 1FDVA 1V9SA 4HN4B 3TLEA 4NCHA 5A04A 2XMDA 5ILGA 1M5PC 2PVPA 1KI1A 4CR7A 1QYDA 2VKTA 2WF7A 2Z2XA 2ZXFA 3ESBA 1AA1B 1D6NA 3EJ6A 3QEKA 2WY2D 4XGQA 3C8DA 2GZ2A 1JE0A 3L7LA 1TGVA 4X61A 1BG6A 2Y0DA 4WX2B 3NGDA 4F4CA 2XVMA 3VSEA 4NE2A 1QU2A 3ZJUA 3SVZA 1AT1A 4OL9A 2O19A 1KETA 4REQB 3FLAA 1LV8A 4KQIA 3EEQA 1HW8A 1S0MA 2WPDD 3D2CA 2X19A 4R81A 4ZP1A 5I9BA 1TXGA 2Y6UA 1RM0A 3C6UB 3GEEA 3Q8QB 5FEMA 2SHKA 4EY7A 2P2CB 2WAOA 1CUGA 3H83A 3R5DA 5LYJF 4G1VA 4BFYA 5CDYA 1JPVA 3ZCVA 4DA7A 1RKJA 1L7XA 4RH1A 1QHFA 4PQFA 4CKCB 1ZNZA 3DF7A 4IYQA 1HXHA 4HDGA 2RHCA 4JVOA 2Y0CA 1T2CA 4K81B 2P3QA 4KV8B 4ARCA 3B6BA 1WVMA 3K5WA 3EN0A 2HLTA 4YT2A 1TUVA 2DJWA 3LQVA 3E8SA 4C4AA 3ES9A 4JYMA 4UHDA 3N5BA 3WGNA 4PO3X 2OLKA 1H42A 3WL7A 1ZESA 3W2VB 1DDIA 3IUBA 3V4OA 1X1RA 3S7RA 1FK9A 5T4BA 3W2EA 1L7EA 3Q7RA 3EE3A 3I42A 4Q3LA 4QM6A 1G9XA 4E5YA 4C7OB 1VQYA 2OHIA 1S2DA 2QUAA 1EFPA 3G8BA 2WAQD 1I1HA 3O3CA 2ASVA 2NPOA 1QYXA 1NXIA 2IHR1 2CPDA 1K5HA 5JEEA 4R1TA 3DTYA 3WOVA 4ZVGA 5INTA 5ETRA 1FCJA 2BXJA 1DKRA 3F49S 4BN0A 5HROA 1IHOA 1DZ5A 1RWOA 1KI3A 2PDAA 4RDXA 1VLVA 2WNSA 2Z2ZA 1E6KA 5JASA 2QYSA 4EA6A 4ZCLA 4KZPA 1HDOA 1E60A 1HBUA 4GLJA 3EM1A 4AUNA 1MB3A 4Z54A 3V2UA 3JQAA 2FVPA 4PABA 4QUJA 4RBUA 2R2TA 2VPTA 1FYFA 1AS0A 4Q1FA 5D00A 1K6EA 2VDKB 2R84A 4J0EA 1QPGA 2D41A 3M70A 2VDRB 3KWLA 3RR2A 2ZYRA 1KFDA 4DDUA 5L3QB 3PVXA 3C3AA 5EP3A 2PS0A 4O3SA 2IYIA 4H0FA 5JNWA 3H9BA 4JNCA 3LZ6A 4LHWA 3BL8A 4NY1A 4F8EA 2CXQA 5BRAA 2NAPA 4ZV9A 4NESA 2NXJA 5CVEA 2HW8A 1CJVC 1ENPA 4L3WA 1JR2A 1ZO8A 3BZBA 3HWWA 1SEPA 5HGJA 3SS8A 3BSNA 3GP3A 1WETA 1OXTA 2WICA 1PBAA 2IIVA 2QUBA 4D4LA 1A9ZA 3ZBPA 2VDVE 1NDQA 1X1SA 1MR3F 4M8LA 4UVHA 4EECA 1EQ2A 2K2WA 4P0PB 1VQLS 2IEAA 1LJLA 4UE3S 3E35A 2R9VA 4W9NA 1HDGO 2RAPA 2M2BA 3MR2A 2BE2A 4ZQFA 3G0OA 5EQDA 5HN0A 1VDMA 4I9NA 3HSJA 1QSLA 3UK7A 6FDRA 2D3O1 1UC5B 4XYGA 1VIAA 1P1RA 5TXGA 2ZD1A 4JYPA 1FFYA 4UU0A 5EGNA 2YYSA 2DB1A 2LGJA 2VRNA 4IHJF 1U1RA 2X41A 3ZJVA 1S0VA 1JMVA 2M98A 4KLAA 2ROGA 3QMMA 4QPPA 2I9SA 1E6CA 3E5MA 1O5OA 4KTVE 2ZE5A 1ILWA </