3UVJB

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVCDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYSLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Guanylate cyclase soluble subunit alpha-3
total genus 54
structure length 196
sequence length 196
chains with identical sequence D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjB00
3MAAA 5D0RA 3MAAB 4OYPA 1FX2A 2GVDA 3C15B 3R5GA 1CJVA 1TL7B 5D0HA 4WP3A 4WPAA 4CLTA 3UVJA 1CS4B 4P2XA 4CLKA 4OYIA 2WZ1A 4OYOA 4CLUA 4OYBA 3G82B 1CJTB 1WC5A 1WC0A 1AZSB 1YBTA 3C14A 3C16A 1TL7A 4CLPA 1CJVB 1YK9A 2GVDB 2GVZB 1FX4A 1CULB 4NI2A 1AB8A 4USUA 4OYAA 4USWA 1YBUA 1CJKA 1CJKB 4OYZA 1U0HA 1WC1A 1Y11A 3UVJB 2GVZA 1CULA 4NI2B 2W01A 2BW7A 4P2MA 3ET6A 4CM2A 3G82A 5D0GA 1AZSA 3C14B 3C16B 4OYWA 1Y10A 5IV4A 4OZ2A 4OZ3A 3C15A 1CJUB 4CLWA 4WP8A 4CLLA 3MR7A 4USVA 4OYXA 4CLYA 4CM0A 4WP9A 1CJUA 5D0EA 4CLZA 1WC3A 5IV3A 2QV6A 1WC6A 5D15A 3ET6B 1CS4A 1U0HB 4CLSA 1CJTA 4USTA 4CLFA 1WC4A 4OYMA 4P2FA
chains in the Genus database with same CATH superfamily
3O44A 2A0FB 2X1GA 1FA0A 1X60A 2IAJA 2O67A 2QLJB 2HHWA 3NMAA 1I5OB 4F4YA 1OQ3A 1GFWB 2BJ1A 2W7PA 2GGPA 2ZKTA 4ZPVR 3CE8A 3DRPA 3GONA 4A8XA 1U24A 2CJ9A 5EX0A 2DEJA 4OX9F 5DQIA 2YY3A 5E3AA 2G4BA 2MZJA 4B3TF 1U1PA 2WAQD 1RT5B 1WWHA 2R8KA 3S6EA 4IQXA 4KHRA 2LMIA 2YWFA 2OPQB 4JP8A 1XWLA 2ZE2B 3QIPA 3EJMA 4N41A 3JXOA 4HDGA 3UN3A 1B0TA 1VOMA 1NSPA 1WEZA 1MWYA 2GFFA 2PGCA 3CJ8A 3OTBA 2R2RA 3JTOA 2BJ9A 3VAHA 1YRXA 3PRDA 2B6AB 4QYZK 3ISND 4X65F 4NLXA 4O44A 2B7CB 2DNRA 4JI3F 4DMZA 4QQBA 1F5CA 1R3NA 1RKIA 2V2VA 3I5AA 4NMLA 3W8GA 4DV2F 5CCMA 1VJQA 1S7IA 1YBTA 3SI8A 2H54B 3ITHA 1HWKA 2XZTB 1Z2LA 3QAUA 2BJDA 3WC2A 2NZCA 4N8OA 3RB4A 3TP2A 4O3RA 2MJUA 2YNIB 3JSMA 3BDEA 4FXVA 3H98A 3K5OA 2ROGA 4HVZA 2OTJS 3VGSA 2NXCA 3IC1A 2HNZB 1XN9A 2CQCA 5HMXA 2M4MA 2QA4G 4OYZA 1L3KA 1VQ7S 1HHQA 1RI7A 2EFNA 2MJNA 3MTJA 5IQQA 1OS5A 4M5JA 2XMAA 1Y11A 2OEJA 1U1KA 5FJ4A 4GKJF 2DGUA 1EB0A 3KLFA 3GCXP 2AJQA 4HTIA 2XYPB 4X62F 1PYSB 1R6VA 2B5JB 2CYYA 5IOLA 3SFUA 4C3MA 1YI2S 1SKRA 3NOGA 4NXMJ 5J2QB 3AOBA 2BRLA 5BYQA 3BPSP 2HBRB 2RIJA 2NQPA 1S9GA 4X4VA 3WX8A 1RT6A 4B3OA 1REVB 5HQ8A 1JXVA 3B78A 1BQXA 1UA1A 3LANA 1KDNA 3W5ZA 5ETPA 3IG1B 2FQQB 3RAXA 1TL3B 5CD4H 4ECVA 1RHKB 3H40A 4JV1A 1H2TZ 2GO8A 3QFHA 4BC9A 3CCSS 4GKKF 1ULRA 3DLLQ 2L41A 2BW2A 4JI7F 3A3PB 4RU9A 3VHQA 2GJIA 1XR6A 2C3MA 1RAGB 2FJEB 2R8HA 3M8WA 3QT7A 3MR7A 4LF5J 1KP6A 2IJFA 1Q16B 2F4VJ 2PE8A 1G3OA 3ENVA 1L3UA 2WONA 2DBBA 2D69A 4DV0F 3LGMA 1S6QB 3AQPA 3M8QA 2UVVA 2QMXA 3UNYA 4K2JA 3VAFA 4I2PA 2NXNA 5F8HA 3OLAA 4CDIA 2YWKA 4KO0B 4X4PA 3KLFB 2MMYA 1ZM9A 2MKSA 2YH0A 1RP5A 4LR7A 1XC9A 4ZJQA 2R4FA 3NS5A 5K8OA 4ID5A 1NJWA 1Q5VA 5FDLB 3I0SB 3U02A 3H90A 4DL4A 4DF4A 1YJTA 3WX4A 3CJ5A 3OVSA 2XO7A 5IC4B 1WI6A 4A8KA 2VZ9A 2AGOA 1TFWA 2V67A 2HRUA 2ZOFA 1LWCB 3FQKA 4HT5A 3OD2A 4DX5A 1VHFA 3GIKA 2NZ4A 2HSEB 3DNCA 4DPYA 2FY8A 1VI7A 3OXFA 5C25B 5DM6Q 3CCMS 1URRA 5B0FA 1ZTWA 2AGQA 4NXMF 4Q0BA 2IRUA 2MGZB 2KZZA 4OX7A 1W2IA 1YRUA 1IVZA 3D1QA 3B4DA 1Q81T 2U1AA 4TYBA 1BD6A 3I55S 1HR0J 2HNDA 4JI4F 1R0BG 2B8PA 4KPYA 2RF2B 1HBOB 2NXJA 1WC4A 3ILIA 3OXGA 4E8UA 3S7RA 3VAGA 5EUHA 4AT1B 2XI3A 1R8BA 4NZ0A 4RKUC 1SKUB 1NJIT 1M90T 4DN0A 1SVDA 3MAAB 5DLGA 2HBZB 1EZZB 1IWGA 3ZTRA 5I4MA 3NGTA 4TY8A 4PG6A 4WFBQ 2G1DA 4ZHRB 2H48B 4UF4A 4J9KA 3B8HA 3CCVS 4J9RA 2ZBPA 1LW2A 3CVKA 1JLFB 1EARA 2CVEA 2VU5A 3HT0A 2AQ4A 4J9OA 1KTVA 2XY6A 1Q53A 3TZXA 2BM1A 3TX0A 2VBZA 4DR7F 2COLA 2GQCA 3QO9B 3UVJA 1TL3A 2XHCA 3LTOA 3OHBA 2QLBB 2NUUG 2LXUA 3DRSB 1SXLA 2PA8D 2E5HA 3CJSA 1DTTB 3OTCA 3SQOP 3UDEA 2WVBA 3VTIA 1U45A 1ZAXA 4ED6A 2IMOA 3R2DJ 3RUBL 3MD3A 2FLNA 3H42A 1WC5A 4MIWA 5CAAA 5HATA 1S59A 5K8MA 4K4XA 3C14A 3NOCA 4LF2A 3JTNA 1TL1A 3LP0B 2CNNB 4OI2A 1L3TA 3RRHA 4FBTA 2A6OA 1JNRB 4LF6J 2RNEA 3OW2R 3G71S 2NCKL 4J9UE 1GX6A 1XJWB 4WJBA 1LWFA 1IKXA 2IDLA 3J81j 1WDTA 5ETNA 2UUAF 4NI2A 5KAKA 2M0GB 3ZZOA 3ZTQA 3HKZD 4ECQA 5KFSA 1NPKA 1UZDA 1K1SA 3CT9A 3FBEA 3HSZA 2Y1JA 1H73A 4HLBA 1CJKA 4G1PA 1NKEA 2EPIA 3J81U 4J90A 1KHWA 2C2RA 3CDBA 4MKYA 2Q6CA 1AYEA 1AROP 2AYMA 4P75A 3C66A 5T14A 1KLMA 3MCOA 4AFFA 1U6ZA 2DIUA 2CADA 4DSLA 1EP4A 1T95A 2RS8A 1TAQA 3C19A 4RL1A 2Y3YA 1NLKL 1VQ5S 5J1EB 3GJSB 1WUUA 2J0QD 2WOMA 1RHUB 1RYRA 3KNAA 2GX8A 2GIQA 3L7OA 1Y7PA 4GVBB 4K4UA 2EK6A 1F0XA 2HBQB 2HFUA 5F3TA 4W92B 2MHEA 4ZLJA 1CJUB 3KKFA 4YP3A 4QIVA 4DF8A 3KDNA 1LV5A 4JI2J 3PW7A 3PJXA 4P7TA 2A6MA 1ZM2A 3SSRA 5F8NA 4UOFA 5DZ7A 4K8RA 1HNIA 4PEOA 1F9HA 1NRKA 4ZA1A 3T1AA 2FDNA 1Q5YA 3A4TA 2K3KA 2G0IA 3T6JA 3UR3C 3OUYA 2XTJP 4ER8A 2C2OB 1UP1A 2XB2D 4N56A 4DU7A 3K5LA 1UWBA 3BKUA 4PR6A 4I64A 2CPJA 2C3YA 3A8EA 1S1UA 3M9MB 5CZVA 3I96A 1N6QB 2VFRA 1RTHB 1NSQA 3KLEA 3L9ZA 4CIOA 4KC5A 2HW3A 1TV6B 5IZHA 4QCLA 3DLEB 1YX2A 3EXYA 5FLXY 3BV8A 4Z7CA 2JVRA 3HHEA 1WC3A 3PW2A 1VQ9S 5KFWA 4RU2A 2DHHA 2QV6A 4L72B 3VZHA 3ET6B 3OV7A 4ZPCA 2OPPB 4X4TA 2UXBJ 1DLOB 4LFAF 2IDEA 4C11A 5EWFA 5L9XA 2H9ZA 1LW0B 3HJVA 2XSJA 2D9PA 4UY85 1YRTA 5M2PA 3GG1A 5HI7A 2VFUA 3T9NA 3RRGA 1O5JA 3LGHA 4NWBA 1S4EA 3MMCA 3GIIA 1D1UA 3O3LA 3OL7A 2YNFB 1B7FA 2ZH3A 3HFVA 5T7LB 2XM3A 1K1QA 3C6TB 1MNEA 5C24B 2ZH1A 3Q22A 2ADCA 1RT7A 4N8NA 4IFYB 2XYGB 5MAOA 5DDPC 2PN6A 3K17A 4H4KA 2GVDA 1J5OA 2Y8WA 5CZXA 3TVKA 1RABB 1RTIA 1ZH5A 4F0KA 3RZAA 4X4SA 1WKKA 2XMVA 1GX5A 1ACMB 3ZXWA 3D2WA 4FYXB 4X66F 3J80Y 3MFHA 3TI0A 3UN5A 5HP1B 4B9TA 1AFIA 3I5CA 2IA0A 3N5FA 4QR2A 1FK9A 1TVRB 1PC4A 2B9XA 2HEKA 2E5GA 2L9NA 4P2SA 2N3LA 2I5JA 2MTLA 4Q7AA 2G2YA 1YJNS 1QTMA 1SJRA 1RT1B 3KNGA 3X3UA 4F4XA 4OX6A 3ENWA 1Q8LA 3MD1A 4MYTA 2WB4A 4PG7A 3GILA 2DHXA 3ZFVA 5IC6B 3TW0A 4GMKA 4NCGA 3DU5A 2MXYA 1ITPA 2AU0A 5AJ3J 4QPTA 1HBNA 2HGMA 5GMEA 2XZDB 3KWMA 4DUYF 1FD2A 5B08A 5JMNA 3UD3P 2IM0A 1HL6A 5KG3A 5IT9Y 1JLQA 1VC6A 3Q8SB 4DX7A 8RUCA 1QDUB 2JZ5A 4PPZA 4USUA 5I3PA 1KLNA 4Q8FA 3W7BA 1YBUA 3G6VA 5DGAA 1EAYC 2M52A 4NLVA 3TOQA 4X4RA 4Q5VA 4UOHA 1A9NB 1NMEB 1UAWA 2ZBQA 2FHKA 1IJFB 2HRTA 4LVNP 4MK7A 2F1FA 2E5IA 2QX0A 3CJKA 2ZZNA 3FMBA 3MM9A 4YMEA 4KPCA 3KK3B 2NLWA 3W60A 4OI4A 3LP2B 3OR2B 3QZ7A 3GWCA 4LF6F 1UTAA 3A8KA 4DR4F 4U9RA 1FVSA 2EFPA 2L9WA 4Q2MA 3GFHA 1VIXA 2BV3A 3GLJA 4CYUA 3T1YF 1WOPA 3FFIB 1Y10A 2AP6A 2HHUA 4C3KA 4ATNA 3HXMA 2NXUA 2AYEA 3Q8PB 4KTQA 4IR9A 1EKSA 1S5ZA 2CQ4A 2LDYA 3I87A 1P8GA 4EK2A 4A8SA 2BR0A 1ICEB 4ES3A 5F8IA 3QSYB 4ZCMA 4DEZA 1BQMA 4HHUA 3I0RB 2DPIA 1TUWA 1J5EJ 1S12A 2JFKA 1N33J 1FFGB 2DB1A 2FY1A 2HVZA 2JWNA 1RADB 1VRTB 3ISNC 5GAEU 3UCUP 1CG2A 1YQHA 1M5OC 2OPSA 1SJFA 2DNPA 2UUWA 2YKPA 1S6PB 3FKBA 4LREA 1DQ9A 3DLKA 3F0NA 4K5RA 3KLIB 3KG1A 4DUYJ 1RWUA 4JYAF 3OTEA 3DDKA 1PAUB 1EKRA 5GMDA 2IJRA 3FSYA 3NGUA 1U8WA 3DOMA 3CDUA 3OTDA 4AL6A 3GFYA 2KTQA 2DR8A 1KQFB 2ZWPA 2M7SA 1KQSR 4HYKA 4J91A 2C2NA 3KLHB 1MROB 4DUZJ 4DS5A 5U47A 5D3GA 1H7XA 2HIQA 4WYLA 3MMBA 2I2YA 2CAJA 2J0SD 1S76D 1KFSA 1LWEB 1ZM4A 3MWBA 3UFCX 1S7HA 2VFSA 3D1OA 2NPIA 3M6UA 2FHOB 1FEEA 3OL9A 3QJJA 3QWUA 2OMOA 2YPZA 4ITSA 1PAEX 5KFJA 1NK8A 4KGVB 3EZOA 2CIMA 4RWXA 2HQCA 4IDKB 4J9VA 3MCSA 3JAMY 2E7WA 4K7QA 1RU1A 1HYSA 2DGWA 2A2CA 4PZVA 5D77A 1PILA 4CI0B 4DL7A 4ZLLA 3CC7S 2LCWA 2M8HA 2EG1A 3D1HA 4ZVHA 2C42A 2V63A 3AAWB 3E51A 2R8GA 4OHZA 1FXDA 4B9LA 4H4MA 4QWBA 5J2PB 2RE1A 4ETZA 2BJEA 3RU0A 4LUBA 2GC8A 2VIHA 2IPOB 5E0OA 2ZWOA 7AT1B 5AXKA 2X3GA 3C6UB 2YKMA 2EFVA 2B5JA 1D09B 3BKFA 1T9UA 1P1TA 3LP1A 3PYEA 1NZAA 2UVUA 3F56A 4WKRA 1FESA 4A4JA 2AHOB 2FZKB 1EETB 5K9FA 5H9FJ 1RTDA 1RTIB 4ZKAA 4I6YA 2Z4PA 3F73A 5HLFB 3CJQA 1JJ4A 2VPZB 4IFVB 2C2KB 1N0VC 3G8SA 4R8UB 1C4CA 2WBRA 3C6TA 1JJHA 3OL6A 4IOAQ 4OL8A 1OPZA 1F9EB 4HDHA 4DR3J 1FX4A 1T7PA 2JJ4D 5I42B 4QWDA 1VQNS 2HHXA 3IMQJ 3OR1A 4URQU 1Q82T 2BJ8A 2FZGB 1S9EB 4PWDB 2IVFB 3RBEA 3P6YC 2P9GA 1T9XA 3BGRA 2R7QA 3DC2A 4YOEA 2XSJB 1LW0A 1OQ6A 2YX7A 1KBRA 4ZDNA 3UDVA 3D6MB 2RKIB 2XG8A 2WRMA 2UUTA 1R0AA 2W01A 2O5DA 3D3BJ 5ETRA 1GXUA 4BLGA 1RHJB 1MWQA 2CG8A 1ZA1B 2RAQA 3ET6A 3SXLA 4CM2A 2ZH6A 5KFVA 4YB1P 2ZJQQ 3FJ2A 4ZN3A 1M5SA 3TUZC 2HLUA 1G4CA 3FRYA 5IFMA 4KKOA 2QYCA 2OEMA 3CJ2A 1XBWA 2VOPA 2RSQA 2F63A 2H51B 3FBBA 4OZ3A 4A8YA 5KG4A 4FVMA 2GGPB 2W2MP 1N4LA 4LR8A 4JI7J 4LF8F 4NLGA 1TKZA 3M30A 4ILRA 4CLWA 3OHAA 2IMWP 1SQFA 3CTRA 4TLRA 4OMFG 3K0JA 1HARA 1HPZA 3D0GE 5F9NA 4PRFA 3PACA 2ZH4A 3RBXA 4IO9Q 2WSEC 4DS4A 1PGZA 1OY9A 2FVPA 2H4YB 4QW8A 4DV4F 1S48A 2RT3A 4DV0J 3C3LA 1O8BA 2WSFC 5SZTA 2XSFA 4EEYA 3RW6A 3BEGB 5CABA 3I0RA 2KJVA 3UPFA 4FF1A 3P3DA 2QJ3A 3GSIA 2DGQA 2JLGA 2DR7A 4G1QA 3TA1A 1KSPA 1DAXA 1RB0A 1REGX 4C6AA 1U1MA 5F0UA 1H2UX 4KFBA 2QZ8A 2IM2A 5I3UA 4GVBA 1WKJA 2HNZA 2F8EX 4RW4B 1MU2B 2JHEA 3NNHA 2IM1A 1XMOJ 1TUGB 1K47A 3A3NB 2VG6A 2K1RB 4ZP6A 3CPWR 4RPFA 4K4SA 2KRBA 3QATA 1R8CA 4RX6A 1MMDA 4IG3B 4C0HA 1JB0C 1U1LA 3BGUA 1F2GA 4KGKA 4Y00A 1PG5B 1N56A 3ZZZA 1ZYQA 1RWMB 2VD3A 4L6V3 4N77A 3H2LA 4O23A 4B02A 3V4IA 3RR8A 4KR0B 3QRQA 4XTTA 2LKZA 3EVWA 2ZOMA 3TZZA 4CLFA 3ICLA 3CIMA 3BR9A 4L3NA 6AT1B 5M2RA 2ZE2A 3N0VA 3PRBA 1GTEA 2MQMA 3M2UA 2HHHJ 1UMJA 3KMSA 2C3PA 2R7XA 3G9CA 3BSAA 5CYJA 1RAAB 4DPUA 1QM9A 5ITHA 3VAIA 5C42B 4EI2A 4DV4J 2E29A 3DRPB 3R5GA 2MSTA 2H5IB 5A76A 1FJGJ 4TLQA 2GIRA 1RWPB 4QBUA 4LQ9A 3KFWX 2RB7A 5D6GA 3G4SS 2IC3A 2GQ2A 1SV5A 4ZVGA 2OSRA 4E2FB 1TELA 3CCRS 1NK6A 2YX4A 2PSZA 1B4SA 3HHLB 4HI1A 2BRKA 5ETOA 3HM9A 4YFUA 1KEKA 3LGNA 3TNVA 1YIJS 4JV5J 1Q0NA 2DHAA 3FCHA 3G82B 2E7XA 4Q44A 1HNZF 4Y2AA 2XGQA 3IRXB 2AD9A 3ILJA 4TXSA 3Q2SC 2LQ8A 2YQ3A 4ZVOB 1TKTA 1F9FA 5E3PA 4K50A 2B51A 3HVTB 1VRUB 1M5HA 3KUGA 4IKAA 5EDWA 5H1SV 2MZRA 3IO1A 2VFVA 3Q89A 1VJWA 1QAXA 1WHWA 2J0XA 4WU3A 1YK9A 4X66J 2ZHOA 5GAEI 3KK1A 4IG0B 5L1IA 4C4WA 2RF2A 1C1CB 4EWTA 4JI1F 5HMWA 2NS1B 3DGPB 3DGPA 2CQGA 1VHIA 3DYAB 3PFOA 4F2RA 2VUGA 1HWUA 2MKHA 3VGTA 3LF0A 2DGTA 3GV7B 1CQNA 1R0CB 4O0NA 2EI5A 1R89A 2Y0BB 1WHVA 3O2IA 4W98A 1SC3B 3PJWA 4ZVQB 1A7GE 3K89A 3BSCA 4OQJA 1S0NA 2VBWA 1IBLF 1TFYA 2LA4A 2N3OA 2YWEA 5D0GA 5AJ3F 1QSYA 3MF5A 3TARA 5A8RA 2O66A 5KFKA 4PQAA 2Q6BA 1NB7A 1HW9A 3CJ4A 5HROB 3CDEA 2B3TB 2KM8B 1N6QA 9ATCB 1FWKA 4A8MP 3OPKA 3VZIA 5DQHA 4I68A 1RA7A 1C0UB 3ZTOA 3VV2B 3JTPA 2XS2A 2ZHAA 1SV5B 2XLJA 3G8QA 3M8PA 2DRDA 1Z2ZA 2BKPA 1RQ0A 2H65B 5HQLA 3MURP 1IM4A 1X8DA 4WFXA 2Z56B 1TKTB 3KHGA 2CPIA 1BUXA 1LK7A 1S99A 3Q8UA 4Y2KA 3RGIA 3V81A 4FF4A 2HHQA 1MSWD 5KFIA 4P7VA 3N6MA 5KFUA 1NKBA 1XMQJ 4EO6A 2J0WA 4LFBF 3A8IA 1ZA2B 4F25A 3M7VA 4DPXA 3UQSA 3ZZYA 4J9NA 3BGFA 2B9EA 3EGNA 1Y3JA 2AT1B 2DXEA 2HGLA 2WOMB 5A8KA 2ILYA 4AL7A 2RRAA 5D0EA 4CLZA 2QN6B 1URNA 2E5LJ 1RT6B 4B3OB 4TU8A 2XLKA 3M6XA 3OL8A 3GV8B 1FDDA 3RYLA 4XO0A 5KFBA 4OLPA 3RW7A 3GYGA 3U1MA 2ABYA 4C8ZA 4NLUA 1FKOA 1IBMF 4ELVA 3ISZA 5C42A 2KU7A 3AOAA 1Y5NB 3A8JA 4DPWA 4ZN1A 1H2VZ 2PEHA 1FRKA 1HWJA 3PHEA 2JOQA 2ZH2A 2HGNA 2G1HA 1FRMA 3WIUA 4ILLA 3CCLS 4QYRA 1CJTA 6FDRA 2RU9A 4DR6F 1MU2A 1WOOA 1F1BB 2KRRA 4B08A 4OYMA 5I3UB 1WACA 2HAFA 4F3OA 3QGIA 2PC6A 1N88A 2H1YA 4PYDA 4QIFA 5D0RA 3UD5A 3MCMA 1CSJA 1PKUA 4F50A 3HSGA 2G9OA 1S10A 2ASDA 3BQ0A 1B7YB 2VICA 1Q8KA 2GQQA 4H54A 4OI1A 2LFVA 2ZDOA 3NGRA 2VC1A 4OJ1A 5LMNF 5AXNA 1RTJB 2BZ2A 3PV8A 3FSIA 3IS9A 2Q79A 3PZPA 2VJVA 4WP3A 4N76A 2DY9A 3AJ2A 2J76E 4ZVEA 2BBEA 3NRBA 3AD7C 2GNKA 2W2QP 4DBQA 4K2XA 2BMBA 2QSWA 3QAEA 4RNOA 5GAHU 2KFYA 3MEGB 3TWZA 2R2TA 1RAHB 1YJ7A 3NLCA 4M5DA 2D1CA 3J7Z5 3H5YA 4PWUA 2LP4A 1QAYA 2YNGA 1JNZB 3LAKA 4Z2XA 1BMQB 4NYOA 2H4WB 2QRRA 3E8OA 2VC0A 4HHHA 4NX9A 4P71A 5D4OA 4NL5A 2R8IA 4CYUB 2ZD1B 5IM0B 3D0IE 3H25A 3UE2A 3OFGA 4ED7A 3R7NB 5LOQA 5CD4A 4ZLPA 1B64A 4YY3J 1CJVB 2VBYA 3HVWA 3QIDA 4AUKA 2WTFA 4GO7X 3H4BA 2RKIA 1M5PC 2BE2B 3LPYA 1Q7LB 1VIOA 2QIFA 2DO4A 5HBMA 4CTAA 5BR8F 3KK3A 2E1CA 1TKZB 3M30B 4OX8A 3W64A 2U2FA 3IFEA 3KJVB 4NZ6A 4K4VA 1S9EA 3M6VA 1FE4A 5THWA 4GRSA 3IN5A 2L3MA 4CCHA 1RE1B 3ELHA 4ECXA 1H38A 1VK3A 5F8MA 1T05A 4OI6A 1D9DA 5C7PA 1RSCA 2R42A 3OFFA 4DCOB 1FKAF 4KIAA 3SYZA 3P49B 2DH7A 4B3SJ 2DGSA 2LQBA 2FLPA 3P5TL 4OYWA 1GTHA 4DV1F 2E1PA 2FLLA 1WNEA 4ECUA 4PCQA 4WZQA 1NNDA 4DSFA 2AYBA 4C8KA 4P9SA 3QGPA 4PXBA 4Y6IA 3VVTA 4DR3F 4KO0A 2RS2A 2F8HA 4PWDA 2MQOA 1MN7A 2QTWA 2W9CB 1IQTA 2YKMB 4IYQA 3DRRB 3HD1A 4FZVA 4DCJB 1MN9A 4UZBA 2JSXA 4F3QA 2YTCA 3FC9A 1KN6A 3BGLA 1AXQA 2QLFB 1JLCB 3CD7A 3NXZA 4M1KA 3KG0A 3DMJB 2VKZG 4RW8B 2ZC3A 4R0JA 2LQ9A 4XPCA 2YNHB 4RW7A 3ZZ0A 1X9MA 4DSIA 1KD1T 1U1RA 2C2MB 2Q66A 4YHHF 4I69A 2V4RA 1N36F 1N34J 3S8SA 5KFCA 2ZH7A 4UOCA 3I82A 3JS9A 1I3OB 4DU8A 4RJVA 4EBDA 4QU6A 1E6YB 2OMLA 1HKAA 2QLWA 1XEZA 2DHSA 2DRBA 2PMZD 2QYGA 5GADU 4DL2A 5B0DA 4NYZA 4DWIA 5J2PA 2LQJA 2Y0SD 2YXLA 3DOLB 1GEHA 2ROEA 1WC6A 2AJ1A 5JXSA 3R5BA 2PI5A 1HMVB 4DFJA 3NMRA 4B3RJ 3NAHA 1S57A 3MMBB 5JUMA 4WK1A 3CJRA 4LF4J 2OGUA 2DKOB 2ZHBA 3GE9A 1R6YA 1FFSB 3GIRA 5C2GA 4J9MA 1FRLA 1SJ1A 4MTPA 4PXCA 3MM5B 3QLHA 4USTA 3QGHA 1WTFA 3PEJA 4F67A 3ILOA 3EICA 3N01A 4M5GA 5A0YA 4EYIB 2E5LF 2NR0A 1S6OA 1JX4A 4F26A 3T3FA 2LU1A 1FTCA 2C2ZB 2CQDA 4OI0A 1V5VA 5L1JA 2HBYB 4HACB 2QL7B 2UV8G 3IAM9 4LF7F 2GCFA 2L08A 3OXLA 3TR5A 1TZ0A 3IXQA 5CYMA 2FHJA 1VC0A 2UVWA 1CJVA 3CMES 2V2QA 5D0HA 4LF9J 2SXLA 4M5IA 4DQRA 2V9WA 2F9JA 2XZWA 4CWBA 1JK9B 2E1AA 3HI9A 4V1Ak 3TUJC 2OP5A 4FS1A 1N34F 4KRWA 4M95A 4ILMA 1E6VA 1FJEB 4ZJLA 1TQLA 1XR5A 4DR2F 3WC0A 4QYZJ 3MEGA 1WG5A 1SIZA 3MPWA 4QW9A 3HVRA 3E3XA 4ZVUB 2MZQA 3MM6B 1XQIA 4TKTA 4ZVFA 2ZEJA 3MEEA 5LMNJ 2VODA 4GVLA 3MPDA 1VQPS 7FDRA 1OY6A 5HANA 3W3SA 2OPSB 2KG0A 1TK8A 2XS5A 2F5GA 3GR1A 1EP4B 4P6QA 3NG8A 1TAUA 2VQFF 1NU4A 2XNRA 1EHWA 2EC2A 4OV1A 2BE7D 4DI6A 2GJ2A 2V8GA 1TMMA 4ZPBA 3KUHA 1VRQC 2FZCB 2AKWB 1R8PA 3MUVP 4ENOA 1U0HA 2C1EB 1KQKA 3SMZA 4YB7A 1S0OA 4LF5F 3D6TB 1JLQB 3QMQA 4QJVA 4NI2B 4ECYA 3AQOA 4NCBA 4I4BA 1XNRF 2BOAA 2LVWA 4BS2A 1QUVA 4FXWA 4LF7J 4ETXA 4F8RA 5G0RB 5L38A 1GNKA 3D0HE 3VAMA 5KT3A 3ZTSA 2BQUA 2ZBIA 3C14B 3G87A 5J2MB 2W2PP 4PQUA 2W7AA 2W8KA 3OQ2A 4TQSA 3GIJA 3HD2A 1YJVA 2H5EA 2MEWA 4HACA 1S49A 2DNLA 2R7WA 3TJ9A 4NEYA 5KFZA 3DLHA 3OVAA 3C15A 2CQ0A 3CJ0A 3MOJB 1RWKB 3FBFA 1DTTA 3KMQA 3IAS9 4DHVA 3SZ2A 3ADAC 3MPYA 3R6LB 1VCTA 2DPJA 4F0MA 3MUMP 1LFWA 3EGVA 4R8UA 4J5OA 1FK9B 5E3CA 3QO9A 4F3MA 2GV1A 4FKXA 3GR0A 2HIYA 4L76A 5B0GA 2D7SA 3LPEA 5KFHA 1FEHA 2MZTA 4CT9A 1BE4A 4A8WA 1H7WA 2HVHA 3HT3A 2NSBA 1TP7A 4CLYA 5L46A 1R8AA 2V2ZA 2V4JA 2XCAA 4CRJA 3UNGC 4YR0A 1NZ8A 4R5PB 4EGLA 3J7ZT 2VQFJ 4CQ1A 2YKNB 1JLCA 1V9OA 3W9IA 1RBAA 1JQGA 3E01A 4KQZA 1NO8A 1IKWB 3C6UA 3F44A 1RTZA 1RT1A 5RUBA 1U1NA 5EX3A 2OH2A 2P2CB 1GMWD 3DRRA 2YNFA 4PWWA 5ETMA 4URGA 4X4NA 5L39A 2C28A 4DDFA 5IV3A 2PMWA 4FS2A 1QE1B 2GW8A 4FN5A 5D15A 3MR2A 3H2VE 1R31A 4V19X 1Y4ZB 4C8YA 1CS4A 1V3RA 2HFVA 2G0CA 3UDLA 2YNHA 4RW7B 3ZC4A 5IT0A 2HS0A 4FF2A 2F3JA 2E1RA 4PABA 2J7UA 5DDOC 1SL2A 3D28A 3T19A 2LA6A 1RWNB 2ZKUA 1Q78A 2D3UA 1O51A 3NGKA 4IFYA 4NA3A 4UTGA 2LQ5A 3BO4A 4XAKA 1KOHA 2HVDA 3CO0P 3LOUA 4U96A 3CIZA 2CQIA 2EWHA 2KDOA 1XMQF 2D3O1 1VC5A 2DHGA 1LXNA 4OJGA 3SQGB 3KHRA 4OI3A 3DYAA 3R6GB 2D3ZA 5F8JA 4YDXA 3ONQA 2UU9F 2QL9B 3AXKA 4B9SA 3M2VA 3W61A 4CTAB 2XMKA 2UZAA 4HL9A 2DO0A 1FJGF 1IKVA 2M88A 3MECA 3BYRA 3NAIA 3R5CA 2RQCA 2W9AA 2Z8QA 3OSNA 2DTJA 1VQ6S 1RBOB 2KI2A 3T41A 1N5SA 1U02A 1RT3A 4NE9C 2I6WA 4DV3F 1QLNA 4Y3CA 4I6WA 1T03A 4LF1A 1FXLA 2XWYA 1PCAA 1FTRA 2PD1A 4P2XA 5AE2A 3FK4A 3CCZA 2CFXA 3IM9A 4RW9B 3GSDA 4MKBA 5FLXU 4LMZA 4JUZA 3M2RB 5AXMA 4ECWA 3IBFB 2K7JA 2CNLB 3R7BB 3ZNUA 1KC8T 5KFLA 2LXIA 3KLIA 2MYFA 2MLYA 1UVJA 1D9FA 3IG1A 1XERA 2RDDA 3IGVA 4ZMMA 4ERDA 1X0PA 3HHLA 4DZ6A 4F2SA 1KONA 2NYHA 1QD1A 5EGYA 1IBCB 1NKCA 3IBWA 3HSJA 1UJ6A 4WYWA 1RAOA 2UUCJ 1G1XA 5J2QA 2W4PA 3PCOB 1U0SA 4M5HA 5HVHA 3MEEB 1KLMB 4ZCIA 2ZDPA 3IR6B 1RHQB 3KLVA 4DR2J 4XK8C 5CXTA 2IJNA 4USWA 1VYAA 1FDBA 1WD6A 1TL4A 3PEHA 3RAMA 3L7PA 1CJKB 3TANA 2LU2A 2E5JA 1E6VB 4ES1A 4TY9A 1YG0A 2QL5B 2XWXA 3K8WA 3M2UB 2CJXB 2PEBA 2VH7A 4JI5F 3R2CJ 4K0KF 1DY3A 2J8AA 2BQ3A 4FDFA 5JVHQ 1DURA 1LK5A 2KXHA 4ZK7M 4KY3A 3I5BA 4PG8A 2MKKA 3MEKA 3L95X 1C2PA 3PY8A 3V6KA 2JFDA 1CVJA 4DR4J 1RTJA 1YKWA 2QGFB 2ZVIA 4MK9A 4NLTA 4UW2A 3HX9A 4WFZA 4CO0A 2HMIB 2F4VF 2V8DA 1Y5IB 3GB0A 2BVZA 3I6PA 4YY3F 2IRXA 4MAKA 4KH1B 2W8LA 3MR6A 3EGWB 2K1RA 1BHNA 3BN7A 4QWEA 1NB2A 1HBUB 1FHTA 2HKEA 3Q0AA 3Q8YA 3V6HA 1QUPA 1SKWA 3BF4A 4KAIA 1U26A 5A8KB 3MCNA 3LWLA 3AA8A 1TKDA 3T1HJ 3DOKB 4O3OA 3M8YA 5KFMA 2MZ1A 4NCAA 4NA2A 3H20A 2X1BA 2K06A 2LEPA 1TUVA 3I31A 4ZCLA 1SQEA 4WFNQ 3MM8A 2V68A 2APOA 3LA0A 1XIQA 1HLWA 1RWOB 4NLDA 1JLFA 2MKYA 4QIEA 4WXOA 4KYZA 3V2UC 5F9LA 3R1HA 2NREA 2GAHC 2MLZA 2IRYA 3PIPQ 5CQGA 4LFBJ 2AEMA 1B3TA 1RLCL 4RNFA 4QWCA 3H8YA 2FHMA 4J7CA 1W26A 4WF9Q 4O3QA 4YB6A 4DZDA 5KG1A 4EZ9A 4ED5A 3CC4S 1E6YA 3CCES 2C2EA 1HPZB 1FI4A 3CO9A 4L74A 1SJQA 4LSLB 5GAGU 1ZPWX 3NCQA 2MB0B 2BYCA 2E66A 1HWLA 1FCAA 4RW6B 1NK7A 4K4ZA 2I8EA 2KT2A 4OFZA 3FQLA 1UJ5A 3IGNA 1S1XB 5HN0A 2WHOA 4KH0B 3KK2A 4ZHRA 1DBDA 4K5SA 4P72A 3DMJA 3BGOP 2FJDB 5E5NA 5LM7E 3ZZUA 4NASA 2HYIB 1QY7A 1M5KC 2IVYA 5HSPA 2VKRA 3CD0A 3MMAA 3EXCX 4C7QA 3GPAA 5GMKa 1WSRA 3QBCA 4D3HA 4JB8B 3AH6A 3NCRA 4A46A 2BOPA 2MZSA 1FO1A 2JEFA 1HYSB 1WEYA 2Y8YA 3T5JA 2DNHA 4TVAB 1HHSA 2J5AA 3BREA 3T5HA 4GKJJ 4C8NA 2D9OA 3VALA 3OR1B 3WBZA 2IM3A 3N79A 5IWAJ 2FC9A 2OHDA 4DR5J 1S0MA 1Q7YT 2MKCA 1B99A 1ZOTA 5A8WA 5KT6A 3THPA 3ENQA 2J9EA 1ELOA 2G2OA 3PHTA 1VRUA 1LOUA 2RUGA 1DQAA 1N5YA 1T05B 4RUBA 4YDDB 1B70B 4FNHA 1RHRB 4CLTA 3Q8RB 3IRXA 1RTDB 2HK3A 4JI8F 2DNGA 1DQ8A 2PO4A 3HULA 1VBXA 3GV5B 5BYRA 2JDJA 4CLUA 3RTVA 2CJKA 2J6SA 4OYBA 2HNYB 3PX6A 2ASJA 3H7HB 4O3PA 2OI2A 2KXNB 3M9NB 2MQQA 2J7WA 3QRRA 2BJ3A 4DV3J 4NOHA 2HQFA 2GIFA 1IKWA 2WONB 2BKOA 1A0OB 4YEAA 1V3SA 2HG4A 2V8HA 4H4MB 3TX8A 5M2UA 3ULHA 3NGDA 3TAPA 1NPPA 4R5PA 4N5SA 2QMUB 1M0SA 1IR0A 1FRIA 1KR4A 4K4YA 2KJWA 1ZBTA 2R7SA 2AJ4A 3CSKA 4OYAA 3IM8A 3J7AN 2UXCF 1EIYB 2HPUA 2B4UA 4KBIA 2XULA 1BQNA 1WI8A 2E44A 5BYSA 2M2BA 2EFQA 2NXEA 4FYWB 2YNIA 3AJDA 2KH9A 1SI9A 5F41A 2BW7A 4G65A 4LSZB 2QSFA 4IR1A 4JI2F 3EDRB 1VS3A 3PKMA 5CHCB 4KHPJ 4PYAA 3MZIA 2VG5B 3C16B 1RCOB 5KFTA 2HMIA 3ENAA 4NLYA 4ZPDA 4PQUB 2JRSA 4LRCA 4PUOB 4IOBA 3FZ2A 4ALZA 2BDPA 2NUHA 4ZIVA 2ROPA 4JI5J 4X4OA 1GMUA 2JH3A 2YKQA 2Z2YB 5DO2A 5KFNA 1OMSA 1X4CA 2JEIA 2RQKA 5DJBA 2VPYB 1D3WA 1LWFB 2EFGA 5B0CA 2EC0A 3W8PA 4NRUA 2IYIA 2QA1A 4PG5A 4DUZF 2EVZA 4F4WA 4JI3J 1GH8A 3VAKA 1SPBP 2OD4A 2V4QA 5A2QY 4USVA 4J9QA 4DV2J 1FF2A 1P9QC 2CA9A 1FKOB 1AUDA 5D8HB 1YJWS 1RHMB 4OZNA 4UUWA 4DR7J 3OJUA 1HHTP 3W66A 4LFAJ 3TAMA 4ZS6A 4IRCA 2XY7A 3ZZTA 2VG6B 2AW0A 3MAHA 2V8PA 1UPMB 1VR6A 1JIHA 2AZ3A 3DRSA 3W1YC 3L4BC 3J7YU 1RKJA 3T1HF 1WF0A 4RW4A 2HVEA 1U2RA 3SIPB 5CYQA 1LEOA 5HJXA 3AOCA 2QO3A 1BQMB 1S1TB 1RT5A 3H5UA 3K5PA 3J81Y 4MIAA 3HO1A 2WBMA 4CO1A 2KN4A 4WCEQ 8ATCB 1UVLA 1UW9A 1Y0HA 4B3RF 2MPUA 1XNQJ 1NDCA 3V81B 3G6ES 4JV2A 2RH3A 3MEDB 4IH5A 2XGPA 4AYBD 5B0AA 1ZPVA 2OPRB 1SUQB 2IA6A 4AD6A 5KG6A 5DDQC 3H59A 3UO0A 5KG7A 1UPPA 4Y2IA 2ZH5A 3LP2A 1GAOA 3OR2A 2KHCA 1S1VA 2YQ0A 1N52B 1WDDA 3TEHB 4F36A 5KT5A 1VDHA 1FRJA 2YVSA 3BSOA 4DPTA 1U48A 2V9KA 1I94J 4B9NA 2DR6A 2QMWA 2NSCA 3FBCA 5KFRA 1IN0A 2XMJA 1L3VA 2ZNZA 2FGCA 1FX2A 3D66A 4NA1A 2XCPA 2DNYA 4DQPA 1X5OA 1YJUA 4DFPA 4DFMA 2AEFA 2B4OA 2CDRB 2KHDA 2LEAA 3IA0A 1SC6A 4AE5A 4NXNJ 3PW5A 1Q79A 3DI6A 2VFTA 3R9LA 5IS2A 2CWKA 2D3OR 1RCXB 2VG7A 4AL5A 1M1GA 2DK2A 1DHMA 1GXTA 2PT0A 5FDLA 4TQRA 2RHSB 2QFJA 3UDCA 1CS4B 4KB7A 1PBUA 2J6TA 3FEYB 1HQ2A 5CA5A 1XR7A 1OJ4A 4NLQA 4QOTA 1YVFA 5F3ZA 4KV8A 1PJ6A 4L3KA 3BN4A 3LP1B 4OYOA 3HJFA 1FE0A 4OZ5A 3SBMA 4UQTA 4I2PB 3MAQA 2P8IA 4WTOB 3NGSA 3MR3A 2UXDJ 1NK4A 4WIQA 5JVGQ 5K14B 2G13A 2C22A 3E01B 3P4UB 1SJ4P 1R7IA 3GFXA 1RT4A 4B3TJ 5HQMA 4LJMA 5HMYA 3C2PA 1SB6A 4X64F 3O5TB 3JSBA 3VF0B 2W2OP 2IFXA 3D6FB 1SH3A 2B43A 2F4FA 4FYDA 4M5MA 1HNWF 5KT2A 3CULA 2Z30B 3NWGA 5HL7Q 3RR7A 4DCPB 1S1WA 4QR1A 5DG9A 1LNQA 5BJRA 3HHLC 2DRAA 2ZJPQ 3IWLA 2VOOA 2OTLS 1F5BA 3GCWP 5LSOA 2XY5A 1YITS 4E0DA 2R7UA 2IC3B 1X5TA 2K8GA 2VA3A 3TVYA 5KFXA 4XDCA 3W62A 5H9EK 3PNIA 2HNYA 4USJC 3JQKA 2JEJA 5AE3A 4DLEA 3EWGA 2ZBRA 4G1IA 1U49A 2EEYA 2UXCJ 2FTRA 1N5VA 2XC9A 3TQ1A 4BWMA 2RUSA 2ZFHA 5KFEA 3KLHA 1FDNA 5KFOA 4I2QA 2O3DA 1SC4B 2WSCC 3TUIC 3O8WA 3TVZA 2BQRA 2DT9A 4QIGA 4RZRA 1LXJA 1NPRA 3DOMB 1RDRA 3DLEA 1YWXA 3OBIA 4LSNA 4X62J 1Q8IA 1G6BA 4USIA 4U6PA 4RWWA 2FGOA 3HZEA 4WK3A 1S0VA 4X2BA 1UVKA 3CGIA 2PMHA 5HO4A 1U09A 3IWNC 3UR0A 1FERA 3WHIA 1YTYA 5KOWA 2JC1A 2P9CA 3B4MA 3CCTA 2LLZA 4ZVPB 3W5XA 1MWZA 4DR1F 5E2QA 1NXIA 2C3UA 3DN9A 3M1VA 1SKSA 2RQMA 3MMAB 1X5SA 3EYZA 2FJBB 4KHMA 2FPHX 2FYXA 4ZOSA 3EVOA 2OD6A 3DM2B 4F02A 1NDPA 1DARA 3QQCD 4C8LA 4ZCKA 3R97A 3PW0A 2GS8A 1NSAA 2CJAA 2KB2A 3KUEA 4L75A 3SCIE 3Q2TC 4ZPAA 1SQGA 2JX2A 1WG1A 1S6PA 2IHR1 3CMQA 4MH8A 4LSLA 2IBOA 3JB9k 5KFGA 1HNVB 1NHVA 1T9VA 2A1BA 3VR1A 1UJ4A 4WIIA 3EMTA 5KT4A 3MXHP 3ETMA 1Q1KA 3K2YA 4OV6A 1U1OA 1HD0A 1UFWA 1IXKA 3MM7B 2UVRA 3VAJA 5C2CA 4DSEA 3HK2A 4JV5F 4E98A 3P45B 4I6AA 2CZ4A 4F7VA 3I32A 1W25A 2R9LA 1QVFR 5ETSA 2I1RA 1JKHA 3TRGA 2VQEJ 1XNQF 1B0PA 2AIRB 3BPDA 4HEA9 3EX7B 2UXBF 3CD5A 2BANA 3PRVA 1IJEB 4I2QB 1X4HA 3Q23A 4FF3A 4ZP7A 4C9DA 2HS3A 1RT3B 2B9YA 2FVQA 3VQTA 1CEZA 1CLFA 1S6UA 4OLOA 1RISA 1R0AB 1HI1A 3DGVA 4WXWA 4M94A 2VV5A 3MM9B 4JI1J 2K7KA 1KOOA 1I94F 2B8QA 2HHSA 3M6WA 3MM7A 4Y2MA 1T3OA 4DOZA 1HFEL 1MMNA 4CH1A 1TL5A 2ZH9A 3GJRB 1HWIA 4C0OC 2CQ3A 1T9YA 1WOSA 4K4TA 3FGVA 1IKYA 3JYTB 3J80U 3HP6A 3BQ2A 4EU0A 2XMUA 4IFVA 1HBNB 2YH1A 2W9BA 1HQUB 2HQ3A 1RWVB 1PYTA 4LRFA 4OHYA 1EETA 1HW8A 3PM9A 2GVDB 5ETVA 1J5OB 5ETTA 1QE1A 1CULB 1T02A 4JYAJ 3L7UA 4Z7YA 4JI0J 1RT4B 1C1BB 2CWXA 2HFOA 4NLSA 4EMDA 1P1LA 4ID8A 5HVGA 2CPZA 3UN2A 2KVIA 3JSRA 4I67A 4NYPA 4BWJA 1WC1A 3CJ3A 1QJHA 4Y2CA 1V6HA 1VLOA 2XO6A 5DM7Q 2BA9A 2DCLA 2AMCB 2O01C 3AA9A 1K9MT 3KOAA 3AHPA 3NNAA 5KFAA 5LJ5Y 2MQPA 3THVA 1X4AA 1FNMA 3B6BA 1AT1B 2FUG9 2XQCA 4QIWD 1AZSA 2YKAA 5A8RB 3DLGA 3PJ9A 1UFLA 4WU2A 4ANDA 2K3IA 1IUJA 5AXLA 4I7FA 1O0PA 3CCUS 1RLDA 4O4RA 3SCKE 5GAHI 2V94A 3O1LA 4I1TA 4IDKA 4DQSA 1GMVA 1UA0A 2Q3PA 3U7JA 3I0SA 2F65A 2H3EB 3NP5A 4FVCA 5C5JA 4DLGA 5LJ3Y 4DG1A 2CRLA 1SH2A 2XBPA 1SH0A 2FHJD 3ZTPA 3DU6A 4QZVB 4RUHA 2XLIA 3MECB 1FD8A 2CPEA 1S1UB 4J37A 1IBMJ 4O3SA 3W2VA 1YJRA 2AJ0A 3CWJA 5HBMB 3OVBA 1LWEA 4ECZA 3BBFA 4QU7A 3NKYA 2NYIA 5K20B 2R7TA 5J2MA 5B09A 5D3GB 4X4UA 2OPPA 4ZPWR 2RRBA 3M8QB 4TN2A 1RA6A 4KGMA 1NAQA 2V8VA 1DTQA 1TMJA 1SUQA 1ZM3A 3LW5C 4USKA 5KG5A 3G8TA 1HNIB 4GO5X 4B9UA 1HQEA 1UL3A 4NEZA 1N54B 4ZVSB 5BXIA 3PVXA 3CCJS 1FRXA 1L3SA 4FBUA 2ZZMA 1U2FA 2IBKA 4MK8A 4ZP9A 5F0WA 1CJUA 3QWPA 4FPRA 4I0WA 4P73A 4PG4A 3VGUA 1RK8A 2C2DA 4GKKJ 4DL3A 2ILZA 2CJBA 5ETQA 1NHKL 1WF1A 1NH8A 3WIVA 3M9OB 2OLWA 2W25A 3JQJA 4UZCA 2HHTA 4NLPA 4CH7A 4DJBA 4U7CA 3TUPA 2Q43A 3TAQA 3K5MA 5KG2A 4U8VA 1S9GB 2HZCA 3T1YJ 3TAMB 3WQPA 2HQDA 2A3JA 2RVJA 2ATLA 2KT5A 3WDOA 4KT0C 3S01A 3TEGA 1X7VA 4QPXA 1UWAA 1VQSA 3CCWA 3B82A 2WVDA 1C1BA 4X4QA 4KV8B 1IWAA 1R27B 1VQYA 4UOGA 3J7YI 3LALA 3GFZA 1JWWA 1N5QA 4OJ3A 2L48A 2ADBA 4DUTA 1O6XA 1HQUA 5IWAF 4DR5F 1X4EA 4B17A 2MDAA 1VBYA 2EBEA 2YPYA 2P5VA 3DFEA 2MSSA 3JSMB 2ZUAA 1RT2B 5J2NB 2P6TA 1IQZA 1HNZJ 4OX9J 1VISA 2MKIA 1J2VA 3DXSX 1BLUA 4HT7A 2KG1A 5J1PA 3M32B 3FMWA 4CO5A 1N0UA 4MMOA 5E3RA 2RDJA 4FKYA 2JNJA 4PUOA 4ECSA 2ALYB 1UFKA 3AODA 1Z1ZA 1L5UA 3CJKB 2OUGA 4IG3A 5DG8A 4ED8A 3CXCR 5G4DA 4JI4J 3IBCB 1FKPB 1RWWB 3BZQA 3HF5A 1S1VB 1TR0A 3W9JA 2X51A 3DDIA 2MKJA 4YR2A 1JLGA 1UEKA 4O4GA 2KM8C 3HHLD 4HHJA 2ZNYA 1IKXB 1RAEB 1ZAWA 7FD1A 1OWXA 3KLGB 5J2NA 3FZBA 4B3SF 2DH8A 4KFBB 3U1NA 2VASA 2K2PA 3DDNA 3LAMA 1EX8A 3IR5B 1TL1B 3LP0A 2JLFA 2QT7A 4ANCA 1RAIB 2VB6A 1LW2B 4CLPA 3RB0A 1P9YA 3D5MA 4BDPA 1JMTA 2V5HG 5LXRA 2VJUA 1VMBA 3RAQA 4TY8B 2N4CA 1T3NA 1PSDA 3DOLA 2Z0GA 3W9HA 1GT8A 2KT3A 2Y9HA 2GA7A 2EKNA 2BJ7A 4M5KA 5A6WA 3AD8C 1N48A 1HNVA 1D8ZA 5DDRC 1X9SA 1FFWB 2V2KA 2GVZA 3AT1B 1JLBB 2XHWA 4J9PA 5LSLA 4P2MA 1UZHA 1F6TA 2X7IA 3AB2B 4KHPF 2KVQE 2PIIA 2HK2A 1N32J 1G2EA 2HURA 2DYAA 2Y1IA 1K0VA 2HWHA 2OIHA 4ELTA 5EHHA 5L1KA 5D4NA 1T8EA 3HCXA 3Q86A 3N9UC 4DPOA 3JAMU 1N5YB 3EGZA 2VDHA 1WG4A 1LWCA 3G96A 1TK5A 2GO9A 3TJAA 3OLBA 4OZ2A 2CNOB 1K73T 1OSCA 2KO1A 3Q24A 2CUYA 4OJHA 3UI3A 3PXGa 1FWLA 3W5YA 2XI2A 2HZVA 3CW2C 4DN9A 3ILLA 3PR4A 3G6XA 2WW4A 3U1LA 4NMXA 2CG4A 4A8QA 2HNDB 1HI8A 1C0TB 3H5SA 3HLUA 3DCAA 4A8OA 1C1CA 3W2VB 5KTQA 2IVMA 4IG0A 9RUBA 3N6NA 4LF4F 2D74B 2N7CA 4ED4A 5A2QU 1WJ9A 2ZM6F 1NEEA 2ASYA 2RHQB 1F3VA 1NDKA 1QTNB 5E33A 1NK0A 3D68A 3MM5A 3QLHB 5JJBA 2YWWA 5K8PA 2IYGA 4CH0S 2LEBA 3PW4A 1AA1B 1WHYA 4LRDA 4I7FB 5HLFA 1XMBA 1VQOS 1J5EF 1TV6A 2DGVA 5D4PA 2CPYA 3QGGA 1S72S 4MKAA 2PFFB 2ALZA 2BM0A 2DGOA 2B9WA 2BE2A 1CQMA 2OELA 2WCXA 3BR8A 1S6QA 3N28A 4WFYA 2CQ1A 2CPHA 2G2ZA 3DXBA 2QA4S 1NM2A 3R27A 2EW9A 3NNCA 1SC1B 1TKXB 3AJ1A 4ECRA 2HVIA 4DSKA 5L1LA 4C3LA 3T6BA 4K4WA 2UUBJ 4IQMA 3KJNB 1YBAA 3W2WA 4K59A 2DNOA 4P2FA 2V34A 1OSDA 1OYDA 3FEXB 1SCJB 4LRBA 3SDEB 2PA3A 3QRPA 2ACMA 3GU0A 3HHDA 3Q83A 1WEXA 2R7RA 4HKQA 1FJ7A 3CJTA 1NJXA 3QJPA 5B7WA 1IKYB 3JYTA 1IR1A 2BUNA 5A8WB 4HTJA 5EWEA 1MW7A 1UETA 2E9TA 2IIHA 5GVQA 3THTA 2XYHB 3IS9B 3P8BB 2GHPA 1XTZA 2PDAA 1U1QA 4DQQA 2YKOA 5KFQA 3N5BA 3HDSA 1YZ6A 1W7WA 2G0JA 2Q1LA 2W7OA 3VQSA 2DEIA 2CJYB 3PG9A 1FNXH 3IP0A 2R8JA 2R7OA 2DNNA 4P52A 4N7TA 2N7YA 4FNIA 1KNZA 3OFEA 3Q8QB 3OJSA 4H4KC 5IQ6A 2RU3A 4TU9A 4DL5A 2BKNA 4MFBB 5T41A 2UXDF 1HD1A 2YBVA 3MUTP 2OAUA 1CJTB 1YZ7A 1X4GA 4WE1B 4LVOP 4XIUA 4B3MJ 1WC0A 3K5NA 4DQIA 1WELA 2DY1A 3N6LA 1OO0B 4CZCA 1F5AA 2GMHA 3MFIA 3KK2B 3ITHB 3MDFA 4DL0C 2ZH8A 1Y5LB 2CNKB 4AQYF 1LFPA 2CJQA 4IO1A 3BDPA 3VGVA 3ETOA 1HNWJ 5ETLA 1JLBA 1RBLA 3CB4A 1V5IB 2JL9A 1AB8A 4FYYB 2WB1D 3BM7A 4KGXB 2EKYA 4RBVA 5E41A 1SJ3P 4LIRA 1H98A 1VK8A 1VRTA 2ZITA 2J7KA 3F41A 4EFAC 2UUBF 4IH7A 3MR5A 3G86A 2CZ9A 2HHHF 3D9BA 2W24A 4C97A 3RBDA 4L73A 1FRHA 3AXMA 3UVJB 2HFZA 4QWAA 2VBXA 2MQNA 3BH6B 3EE3A 1VBZA 1M5VC 3EVMA 1KWMA 2HHVA 3RBZA 3QYYA 1GK8A 1R8HA 1X4DA 4RBTA 1U2CA 3FFIA 3MPVA 1YDLA 3GP9A 4WE1A 5HMZA 3KLGA 2J8SA 2JVOA 1VQ8S 3TQEA 4DV7F 4DX8H 2QA2A 1N8RT 1HBUA 4DFKA 1OIAA 2HQIA 4OHXA 4V19J 4HH0A 2HQGA 1V3ZA 3DRYA 4JI0F 1WORA 4CP5A 2VHGA 4JV0A 3HFZB 3HVAA 3N4WA 1S9FA 3ZZPA 2DR5A 3BGRB 5SUHA 2FJAB 1N32F 3A1YG 3LQVA 2CPFA 5I42A 2FVCA 3BBBA 3M32A 4YN3B 2IY5B 5C25A 3VWSA 3OTOJ 3QJLA 2Z2MA 5IXUA 3D7SB 1X9WA 4IUFA 2XMWA 3MOZA 4AQYJ 4OIXA 5B0EA 1JJCB 1WKLA 4U95A 4LF8J 2X3DA 4RBUA 4EYHB 1NBEB 2F9DA 3GZ7A 4CM0A 5J1NA 3G6YA 1QAIA 2AYGA 4AXIA 3EPIA 1PC5A 2FD2A 2I9SA 4A8FA 5L9NA 1X4FA 3HFKA 2M3DA 3AFGA 5DZ6A 3S1TA 1NSKL 1HI0P 4C98A 3AB4B 3D3CJ 4BHQA 3LWMA 3PKYA 3LH2S 4TYAA 5HVFA 2GMJA 3KK1B 3R8YA 3CMAS 1F3FA 1JLAA 3I9ZA 4MJKA 2DXDA 3BB5A 4PXEA 4F04B 1NJYA 3NBPA 1JXLA 2PI4A 4FP9A 4JI6F 1ROFA 1S4FA 1HNXJ 3SDEA 2V4JB 3C8YA 2E9ZA 5FD1A 1SL0A 1SIWB 1T9TA 1RYSA 3M2RA 1XMOF 1KVKA 2N4DA 2XEXA 3W2WB 1MG7A 1K0TA 3HSDA 4PPDA 3BH7B 2KKHA 2ZVSA 3ZO7A 3T5LA 2VQEF 2X1AA 1F60B 1NK9A 4NLOA 4RLEA 1RT7B 1Q86T 4NPOA 1ZZNA 1TKXA 1X0FA 1HQEB 3CD6S 3RB6A 3AD9C 3M8PB 2AX1A 1I1GA 2Z58B 5K14A 4CNZA 3C15B 1QSSA 1D8YA 4Z37A 4PKDB 4X84A 1FWPA 1C0UA 3FNNA 4YR3A 3A3OB 2B0GA 2HS4A 4P74A 3M2VB 1APSA 3TJ8A 4WPAA 5HROA 1HBMA 2KYXA 2I38A 4LIWA 1Y00A 4OYIA 4PAAA 5G0RA 3JSYA 3SQGA 1TU0B 2OFGX 3GG0A 3L3CA 1DRZA 3EZUA 2KZMA 3FRZA 2AEJA 3A13A 4CO2A 1MLAA 4HH1A 4ZVTB 1KFDA 1OPIA 2OEKA 3IRWP 2HRYA 2FLOA 2C3OA 3A12A 4WKYA 3V4IB 3LO3A 3FCVA 4QR0A 4U8YA 3KLEB 3QT8A 3BYPA 4YB5A 5LXYA 5K8NA 4ZITA 2EXUA 1TL7A 3R5JB 4DSJA 3POTB 1HA1A 3TO8A 1QAJA 1GMWA 2FC8A 2VPXB 2W4CA 1N36J 1C0TA 3FUYA 3TA2A 4O44B 2MY7A 3MPUB 2GVZB 2WVCA 3CNQP 3KDOA 4XDDA 4ED1A 3GYXB 2R2UA 3L09A 1FT8A 4HR2A 1ZZFA 1RUSA 3X1LB 3QIPB 3HHKA 4MYUA 4H4OB 3NCPA 2OPRA 4AXJA 5DETA 3MM6A 4CNYA 4B3MF 2YKNA 5IT9U 2VL1A 3EM1A 4DXLA 1CULA 4MKVA 4UT4A 1P6TA 3QT5A 2MHNA 2B4PA 2HFSA 4ICLA 4JBCA 4C2MA 4ED0A 3SCLE 3UCZP 3GTYX 2W9BB 4ANEA 3G82A 1S1TA 2CPDA 2EK1A 4RW6A 1RU2A 3KYLA 1GQEA 1NHUA 2DITA 3M05A 3OSPA 5ADZA 2F8MA 5KFFA 5DGBA 5MLCV 1U7LA 3EZ5A 2VPWB 4NRTA 5CYMB 4OHVA 2MY8A 3M8ZA 3PX0A 1UEVA 5LL6d 4YS2A 1RZMA 2DGXA 3GIMA 3UWTA 1NH7A 4RR5A 3DHWC 2WK4A 4U7UD 3KHHA 4CLLA 2V50A 1SBRA 1Y9OA 3BO3A 4F4ZA 3TZYA 4D3GA 4NLRA 3CEDA 3H5XA 5A0YB 3MM8B 2FVRA 3BS9A 3FDSA 2ZUGA 4CO4A 1S79A 1UEUA 4LF9F 3MI7X 3OFHA 3NY0A 2A10A 3DOKA 5DQGA 2PFDA 4RO0A 4MFBA 4O4GB 1P27B 1JLGB 3P96A 2BANB 3BO2A 1UVMA 3QFWA 1FXRA 2P9EA 2FVSA 2CDQA 1FKPA 3I9V9 3HKWA 2XMTA 3MHYA 4G6VB 1UVIA 4O0IA 1R43A 2AWZA 4OHWA 5GAGI 1JXEA 3R3TA 3HHNB 4HI2A 4RNMA 4WZMA 3JQMA 1FDAA 2JC0A 3BBCA 8AT1B 2BABA 2I5JB 1JLEB 3OTOF 3PIOQ 3SFGA 5DS7A 1Q8BA 3RJMB 4A48A 5F8LA 2M70A 3PYFA 1RT2A 3SCJE 5HP1A 3M8RA 4EUVA 4ZP8A 5A6PA 1U25A 3U27A 1VBKA 2ZM6J 1U47A 4DV5J 3R1LA 4CLSA 3K7RA 2EG2A 1J27A 4DX6A 4ICLB 4JI8J 3MMJA 2OSQA 2GHWA 3MTKA 4RW8A 4Y34A 5K5MA 2X1FA 2V69A 3KJQB 3DRXA 2VDIA 1RGVA 3DLJA 1DJ0A 4WTYA 2Z2LA 2L9DA 3MAAA 4BBYA 3VVUA 3M1VB 3PDNA 3P5BP 1DTQB 2R2SA 2MQLA 4IH6A 2J9DE 2W9CA 4G3IA 2JLEA 3W63A 4ZIWA 4EZ6A 3C46A 3QZ8A 4EBEA 3POTA 1BXNA 2E7VA 5LMUF 2MGZA 2KFNA 4YHHJ 4LQ3A 1B0VA 2GZOA 1IBKJ 1K8AT 1VFJA 2CZVC 3FEZA 5KFPA 4WFAQ 4LR9A 3GJQB 4RW9A 2KL8A 3GMGA 1EJ7L 2BE9B 2HZAA 2W2NP 2W1BA 1G7CB 3LUYA 3SSQA 5AE1A 4KKOB 2WZ1A 2BXJA 3ZZRA 5F8GA 3V6JA 4YQWA 4IRDA 1T03B 4F4AA 1X4BA 3UW1A 4Y28C 1GXLA 3I4PA 4I56A 3HZGA 2RJZA 1RTHA 2RQ4A 1YGYA 2V0NA 1AZSB 1IKVB 2O1PA 2WW8A 3I56S 1HMVA 1LWXA 4R25A 2J6UA 1KVJA 1T94A 1KRPA 1NJZA 2OO4A 2UP1A 2DVIA 4X64J 4ZPTR 4UY8T 1BC6A 3NS6A 1UW4A 1CC7A 4DV5F 4C8MA 2POKA 2WVEA 3BKTA 3PTWA 2F7VA 4LBHA 3SEOA 3NS7B 3OUYB 2UUAJ 3KG4A 4B9VA 2RDIA 1Y3KA 2OKQA 3GJTB 1C4AA 4RNHA 3K59A 2VONA 3G2XA 1VLYA 1RJJA 4NZ7A 4WWSA 5AT1B 4BC7A 3CCQS 2ZBCA 3HPOA 1KQGB 4Q0BB 4C48A 3W65A 4GC7A 1VQLS 1ZS6A 3DLGB 3EUNA 5H9FK 5D4LA 2YWHA 3CDWA 3US5A 4Y0FA 2I0XA 3CUNA 2DNZA 4B9MA 2QEXS 4USHA 2VA2A 2P6SA 3PYGA 3V6DB 1TTHB 3Q8VA 5J1EA 1KTQA 4M5LA 1ZTTA 2UV8A 1AFJA 2OJ3A 4U67Q 2EBGA 2FIUA 1JLEA 1WF2A 2BX6A 5IV4A 1YLXA 4TNOA 1YJ9S 5DRKA 4Q43A 3O6QA 2Y1LB 4UUXA 1H6KX 1DZ5A 4ZVRB 1CBKA 4ED3A 3RB3A 4FPIA 2JEGA 2HWTA 4WP8A 3HMJG 1H0HB 4JOUA 2R7VA 4Q45A 4FYVB 5E7OB 4OZ1A 4FXDA 1KKHA 2DNKA 5EN1A 2LXFA 3EDQB 5E3QA 2MLXA 4DV1J 2A2DA 3T9ZA 1M1HA 3DI6B 4C8OA 3V5RA 2DNQA 3CDAA 2ACYA 2DIVA 1HIYA 1PYOB 2KYZA 5D78A 4C0BA 1PO6A 1AW0A 2A18A 3TYTA 3UD4P 4A47A 3GYNA 1FJCA 2BACA 1U6FA 4O3NA 1S97A 3QSIA 1SL1A 2M8DB 1OYEA 4URSA 2BEFA 4ECTA 2RD5C 5HJYA 3H4DA 3V4MA 2Y1RI 4ELUA 4DR1J 4LFCF 2CQ2A 2B56A 1X31C 4YUDA 3KJVA 4DV7J 1X5PA 3DKDA 4KGZB 2B6AA 3T5KA 1U6BA 2ZOGA 1UCNA 4Q2LA 3KXDA 3IR7B 3DHXA 3FCWA 2J9DA 2MQ8A 1MROA 2DH9A 1WTBA 3OT9A 1XNRJ 4NXNF 3VCDA 2ZD1A 5LT5A 2OPQA 5IM0A 1RAFB 4KJIA 2VF3A 5L8RC 1I6JA 2KFZA 3SV4A 5DG7A 2ATCB 2CPXA 3TZWA 1U4BA 1LQ9A 4M8LA 1OY8A 2YNGB 4NLWA 6FD1A 2AV5A 1QVGR 1JKHB 4W90B 1AUSL 4M5DB 1BGXT 2HWIA 5EWGA 1CC8A 4PXDA 3M4XA 1UVNA 3J7A1 3PYDA 2FJXA 2M9KA 2ZJRQ 2DJWA 3DM2A 5CYQB 4OZJA 3DLKB 4H4OA 2W4DA 3NEKA 3E2EA 2IAJB 2QLXA 4OYPA 3RRKA 4K0KJ 1ZAVA 3K57A 3BSNA 2RRNA 2HLTA 3NWRA 2AJFE 1TVRA 1HBOA 3KTQA 4DV6J 1N5TA 4X65J 3V6DA 2CQPA 3AY0A 1Q4RA 2B7BB 4KE5A 2GAGC 2HHPA 3D6HB 4S0MA 5CH7B 5HAOA 4RUAA 1TL7B 1U8SA 4ED2A 4CT8A 2QFIA 2M5YA 4JI6J 4TU7A 5KT7A 2ZZTA 4CLKA 2FJWA 2QG9B 2RILA 3TA0A 3GQCA 4USMA 2F40A 3NL0A 5ETKA 3FSXA 1YSJA 5H9EJ 3H0PA 4ES2A 4M5NA 4OZLA 1H74A 2B4VA 2GMLA 4ID5B 1KHVA 5LSRA 4LRAA 2J9CA 2DCUB 3BQ1A 1NDLA 1Q95G 1HBMB 4RNNA 1WSVA 5IT4A 4J9LA 2LDIA 3D4JA 1BWEA 1WHXA 4M63A 2VG5A 3C16A 5LMUJ 2AZ1A 2WVFA 1DFDA 3SSSA 2YWGA 1DLOA 5KG0A 1IBKF 4UQGA 2QC3A 2GJFA 2CXEA 4DG1B 4LSNB 1FNOA 3B54A 3IWXA 2DR9A 1S77D 1T0TV 1VQ4S 4F4KA 4LT6A 1S1WB 1BQNB 2HFNA 3R5AA 4R0EA 1BY9A 2LYVA 3PR5B 4EBCA 4P10A 2FJVA 2UU9J 1F2HA 3BJYA 4ZJOA 2CQHA 3FVYA 4NCGB 2DISA 4LBIA 3ZNJ1 1IBLJ 1LKZA 4OZ0A 5HK4A 4DV6F 5DLFA 4DL6A 1KVIA 1I51B 1UWBB 2XNQA 1PIEA 3NBPB 4EO8A 1T11A 3D54A 1IR2A 1RACB 1VQMS 1VQKS 1REVA 2KXFA 1W2BR 1QSLA 3H2UB 2RMLA 3PFEA 3CC2S 1K44A 2NPFA 5KOXA 1NK5A 2DXFA 1RXOB 1IM6A 1H3DA 2FB0A 4J9SA 4IOCQ 3PX4A 2DNMA 1KS2A 3DLBA 5BR8J 3R7SB 2XS7A 3PO5A 2XMMA 1JJ2R 2OFHX 1NUEA 4IRKA 1CPZA 5KFDA 2D41A 2Z57B 3PO4A 2EFOA 2CKWA 4F0HA 3EPGA 5CCLA 3KJFB 1N33F 1UKUA 1FVQA 2CQBA 4XPEA 1YHQS 3QT6A 2E1MC 2V6AA 2R3VA 4Q8EA 2YQ1A 4KSEB 5C24A 3MGJA 1JLAB 1PBAA 2ZC4A 4OYXA 2UUCF 1RWXB 1BWVA 3K8VA 2CVIA 4LBPA 5T7LA 1ZETA 2E9RX 2QE5A 1EQ0A 3MMCB 4N47A 4RUCA 2N82B 2ASLA 2AJ2A 3WZ0A 1NCLA 1HR0F 1RAJA 1T9WA 4WP9A 3K58A 4GC6A 1PJ7A 3UCGA 4C11B 5I3QA 3D67A 1XK8A 2GHVC 4U7UK 2H5JB 3RG6A 2DD8S 3M8SA 3SV3A 2VG7B 1D0EA 4CO3A 3QNWB 2HAIA 3HVTA 1TK0A 3MEDA 3QPIA 1H72C 5FIIA 1EQMA 1HNXF 2AF6A 1PJ5A 1U0HB 3I4HX 4G1QB 4Y65A 4BCAA 5GADI 2ERRA 5B0BA 4LFCJ 4ZLNA 4MT1A 1S1XA 4DR6J 2AGPA 3CF5Q 1MMLA 1Z4UA 2YX1A 1M1KT 3R5DA 4WBFA 2AX0A 3KHLA 4MIBA 4W4MA 5KFYA 1VGYA 1A6LA 2LECA 1D9AA 2Z2ZA
chains in the Genus database with same CATH topology
3MAAA 5D0RA 3MAAB 4OYPA 1FX2A 2GVDA 3C15B 3R5GA 1CJVA 1TL7B 5D0HA 4WP3A 4WPAA 4CLTA 3UVJA 1CS4B 4P2XA 4CLKA 4OYIA 2WZ1A 4OYOA 4CLUA 4OYBA 3G82B 1CJTB 1WC5A 1WC0A 1AZSB 1YBTA 3C14A 3C16A 1TL7A 4CLPA 1CJVB 1YK9A 2GVDB 2GVZB 1FX4A 1CULB 4NI2A 1AB8A 4USUA 4OYAA 4USWA 1YBUA 1CJKA 1CJKB 4OYZA 1U0HA 1WC1A 1Y11A 3UVJB 2GVZA 1CULA 4NI2B 2W01A 2BW7A 4P2MA 3ET6A 4CM2A 3G82A 5D0GA 1AZSA 3C14B 3C16B 4OYWA 1Y10A 5IV4A 4OZ2A 4OZ3A 3C15A 1CJUB 4CLWA 4WP8A 4CLLA 3MR7A 4USVA 4OYXA 4CLYA 4CM0A 4WP9A 1CJUA 5D0EA 4CLZA 1WC3A 5IV3A 2QV6A 1WC6A 5D15A 3ET6B 1CS4A 1U0HB 4CLSA 1CJTA 4USTA 4CLFA 1WC4A 4OYMA 4P2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAA A;  5D0R A;  3MAA B;  4OYP A;  1FX2 A;  2GVD A;  3C15 B;  3R5G A;  1CJV A;  1TL7 B;  5D0H A;  4WP3 A;  4WPA A;  4CLT A;  3UVJ A;  1CS4 B;  4P2X A;  4CLK A;  4OYI A;  2WZ1 A;  4OYO A;  4CLU A;  4OYB A;  3G82 B;  1CJT B;  1WC5 A;  1WC0 A;  1AZS B;  1YBT A;  3C14 A;  3C16 A;  1TL7 A;  4CLP A;  1CJV B;  1YK9 A;  2GVD B;  2GVZ B;  1FX4 A;  1CUL B;  4NI2 A;  1AB8 A;  4USU A;  4OYA A;  4USW A;  1YBU A;  1CJK A;  1CJK B;  4OYZ A;  1U0H A;  1WC1 A;  1Y11 A;  3UVJ B;  2GVZ A;  1CUL A;  4NI2 B;  2W01 A;  2BW7 A;  4P2M A;  3ET6 A;  4CM2 A;  3G82 A;  5D0G A;  1AZS A;  3C14 B;  3C16 B;  4OYW A;  1Y10 A;  5IV4 A;  4OZ2 A;  4OZ3 A;  3C15 A;  1CJU B;  4CLW A;  4WP8 A;  4CLL A;  3MR7 A;  4USV A;  4OYX A;  4CLY A;  4CM0 A;  4WP9 A;  1CJU A;  5D0E A;  4CLZ A;  1WC3 A;  5IV3 A;  2QV6 A;  1WC6 A;  5D15 A;  3ET6 B;  1CS4 A;  1U0H B;  4CLS A;  1CJT A;  4UST A;  4CLF A;  1WC4 A;  4OYM A;  4P2F A; 
#chains in the Genus database with same CATH topology
 3O44 A;  2A0F B;  2X1G A;  1FA0 A;  1X60 A;  2IAJ A;  2O67 A;  2QLJ B;  2HHW A;  3NMA A;  1I5O B;  4F4Y A;  1OQ3 A;  1GFW B;  2BJ1 A;  2W7P A;  2GGP A;  2ZKT A;  4ZPV R;  3CE8 A;  3DRP A;  3GON A;  4A8X A;  1U24 A;  2CJ9 A;  5EX0 A;  2DEJ A;  4OX9 F;  5DQI A;  2YY3 A;  5E3A A;  2G4B A;  2MZJ A;  4B3T F;  1U1P A;  2WAQ D;  1RT5 B;  1WWH A;  2R8K A;  3S6E A;  4IQX A;  4KHR A;  2LMI A;  2YWF A;  2OPQ B;  4JP8 A;  1XWL A;  2ZE2 B;  3QIP A;  3EJM A;  4N41 A;  3JXO A;  4HDG A;  3UN3 A;  1B0T A;  1VOM A;  1NSP A;  1WEZ A;  1MWY A;  2GFF A;  2PGC A;  3CJ8 A;  3OTB A;  2R2R A;  3JTO A;  2BJ9 A;  3VAH A;  1YRX A;  3PRD A;  2B6A B;  4QYZ K;  3ISN D;  4X65 F;  4NLX A;  4O44 A;  2B7C B;  2DNR A;  4JI3 F;  4DMZ A;  4QQB A;  1F5C A;  1R3N A;  1RKI A;  2V2V A;  3I5A A;  4NML A;  3W8G A;  4DV2 F;  5CCM A;  1VJQ A;  1S7I A;  1YBT A;  3SI8 A;  2H54 B;  3ITH A;  1HWK A;  2XZT B;  1Z2L A;  3QAU A;  2BJD A;  3WC2 A;  2NZC A;  4N8O A;  3RB4 A;  3TP2 A;  4O3R A;  2MJU A;  2YNI B;  3JSM A;  3BDE A;  4FXV A;  3H98 A;  3K5O A;  2ROG A;  4HVZ A;  2OTJ S;  3VGS A;  2NXC A;  3IC1 A;  2HNZ B;  1XN9 A;  2CQC A;  5HMX A;  2M4M A;  2QA4 G;  4OYZ A;  1L3K A;  1VQ7 S;  1HHQ A;  1RI7 A;  2EFN A;  2MJN A;  3MTJ A;  5IQQ A;  1OS5 A;  4M5J A;  2XMA A;  1Y11 A;  2OEJ A;  1U1K A;  5FJ4 A;  4GKJ F;  2DGU A;  1EB0 A;  3KLF A;  3GCX P;  2AJQ A;  4HTI A;  2XYP B;  4X62 F;  1PYS B;  1R6V A;  2B5J B;  2CYY A;  5IOL A;  3SFU A;  4C3M A;  1YI2 S;  1SKR A;  3NOG A;  4NXM J;  5J2Q B;  3AOB A;  2BRL A;  5BYQ A;  3BPS P;  2HBR B;  2RIJ A;  2NQP A;  1S9G A;  4X4V A;  3WX8 A;  1RT6 A;  4B3O A;  1REV B;  5HQ8 A;  1JXV A;  3B78 A;  1BQX A;  1UA1 A;  3LAN A;  1KDN A;  3W5Z A;  5ETP A;  3IG1 B;  2FQQ B;  3RAX A;  1TL3 B;  5CD4 H;  4ECV A;  1RHK B;  3H40 A;  4JV1 A;  1H2T Z;  2GO8 A;  3QFH A;  4BC9 A;  3CCS S;  4GKK F;  1ULR A;  3DLL Q;  2L41 A;  2BW2 A;  4JI7 F;  3A3P B;  4RU9 A;  3VHQ A;  2GJI A;  1XR6 A;  2C3M A;  1RAG B;  2FJE B;  2R8H A;  3M8W A;  3QT7 A;  3MR7 A;  4LF5 J;  1KP6 A;  2IJF A;  1Q16 B;  2F4V J;  2PE8 A;  1G3O A;  3ENV A;  1L3U A;  2WON A;  2DBB A;  2D69 A;  4DV0 F;  3LGM A;  1S6Q B;  3AQP A;  3M8Q A;  2UVV A;  2QMX A;  3UNY A;  4K2J A;  3VAF A;  4I2P A;  2NXN A;  5F8H A;  3OLA A;  4CDI A;  2YWK A;  4KO0 B;  4X4P A;  3KLF B;  2MMY A;  1ZM9 A;  2MKS A;  2YH0 A;  1RP5 A;  4LR7 A;  1XC9 A;  4ZJQ A;  2R4F A;  3NS5 A;  5K8O A;  4ID5 A;  1NJW A;  1Q5V A;  5FDL B;  3I0S B;  3U02 A;  3H90 A;  4DL4 A;  4DF4 A;  1YJT A;  3WX4 A;  3CJ5 A;  3OVS A;  2XO7 A;  5IC4 B;  1WI6 A;  4A8K A;  2VZ9 A;  2AGO A;  1TFW A;  2V67 A;  2HRU A;  2ZOF A;  1LWC B;  3FQK A;  4HT5 A;  3OD2 A;  4DX5 A;  1VHF A;  3GIK A;  2NZ4 A;  2HSE B;  3DNC A;  4DPY A;  2FY8 A;  1VI7 A;  3OXF A;  5C25 B;  5DM6 Q;  3CCM S;  1URR A;  5B0F A;  1ZTW A;  2AGQ A;  4NXM F;  4Q0B A;  2IRU A;  2MGZ B;  2KZZ A;  4OX7 A;  1W2I A;  1YRU A;  1IVZ A;  3D1Q A;  3B4D A;  1Q81 T;  2U1A A;  4TYB A;  1BD6 A;  3I55 S;  1HR0 J;  2HND A;  4JI4 F;  1R0B G;  2B8P A;  4KPY A;  2RF2 B;  1HBO B;  2NXJ A;  1WC4 A;  3ILI A;  3OXG A;  4E8U A;  3S7R A;  3VAG A;  5EUH A;  4AT1 B;  2XI3 A;  1R8B A;  4NZ0 A;  4RKU C;  1SKU B;  1NJI T;  1M90 T;  4DN0 A;  1SVD A;  3MAA B;  5DLG A;  2HBZ B;  1EZZ B;  1IWG A;  3ZTR A;  5I4M A;  3NGT A;  4TY8 A;  4PG6 A;  4WFB Q;  2G1D A;  4ZHR B;  2H48 B;  4UF4 A;  4J9K A;  3B8H A;  3CCV S;  4J9R A;  2ZBP A;  1LW2 A;  3CVK A;  1JLF B;  1EAR A;  2CVE A;  2VU5 A;  3HT0 A;  2AQ4 A;  4J9O A;  1KTV A;  2XY6 A;  1Q53 A;  3TZX A;  2BM1 A;  3TX0 A;  2VBZ A;  4DR7 F;  2COL A;  2GQC A;  3QO9 B;  3UVJ A;  1TL3 A;  2XHC A;  3LTO A;  3OHB A;  2QLB B;  2NUU G;  2LXU A;  3DRS B;  1SXL A;  2PA8 D;  2E5H A;  3CJS A;  1DTT B;  3OTC A;  3SQO P;  3UDE A;  2WVB A;  3VTI A;  1U45 A;  1ZAX A;  4ED6 A;  2IMO A;  3R2D J;  3RUB L;  3MD3 A;  2FLN A;  3H42 A;  1WC5 A;  4MIW A;  5CAA A;  5HAT A;  1S59 A;  5K8M A;  4K4X A;  3C14 A;  3NOC A;  4LF2 A;  3JTN A;  1TL1 A;  3LP0 B;  2CNN B;  4OI2 A;  1L3T A;  3RRH A;  4FBT A;  2A6O A;  1JNR B;  4LF6 J;  2RNE A;  3OW2 R;  3G71 S;  2NCK L;  4J9U E;  1GX6 A;  1XJW B;  4WJB A;  1LWF A;  1IKX A;  2IDL A;  3J81 j;  1WDT A;  5ETN A;  2UUA F;  4NI2 A;  5KAK A;  2M0G B;  3ZZO A;  3ZTQ A;  3HKZ D;  4ECQ A;  5KFS A;  1NPK A;  1UZD A;  1K1S A;  3CT9 A;  3FBE A;  3HSZ A;  2Y1J A;  1H73 A;  4HLB A;  1CJK A;  4G1P A;  1NKE A;  2EPI A;  3J81 U;  4J90 A;  1KHW A;  2C2R A;  3CDB A;  4MKY A;  2Q6C A;  1AYE A;  1ARO P;  2AYM A;  4P75 A;  3C66 A;  5T14 A;  1KLM A;  3MCO A;  4AFF A;  1U6Z A;  2DIU A;  2CAD A;  4DSL A;  1EP4 A;  1T95 A;  2RS8 A;  1TAQ A;  3C19 A;  4RL1 A;  2Y3Y A;  1NLK L;  1VQ5 S;  5J1E B;  3GJS B;  1WUU A;  2J0Q D;  2WOM A;  1RHU B;  1RYR A;  3KNA A;  2GX8 A;  2GIQ A;  3L7O A;  1Y7P A;  4GVB B;  4K4U A;  2EK6 A;  1F0X A;  2HBQ B;  2HFU A;  5F3T A;  4W92 B;  2MHE A;  4ZLJ A;  1CJU B;  3KKF A;  4YP3 A;  4QIV A;  4DF8 A;  3KDN A;  1LV5 A;  4JI2 J;  3PW7 A;  3PJX A;  4P7T A;  2A6M A;  1ZM2 A;  3SSR A;  5F8N A;  4UOF A;  5DZ7 A;  4K8R A;  1HNI A;  4PEO A;  1F9H A;  1NRK A;  4ZA1 A;  3T1A A;  2FDN A;  1Q5Y A;  3A4T A;  2K3K A;  2G0I A;  3T6J A;  3UR3 C;  3OUY A;  2XTJ P;  4ER8 A;  2C2O B;  1UP1 A;  2XB2 D;  4N56 A;  4DU7 A;  3K5L A;  1UWB A;  3BKU A;  4PR6 A;  4I64 A;  2CPJ A;  2C3Y A;  3A8E A;  1S1U A;  3M9M B;  5CZV A;  3I96 A;  1N6Q B;  2VFR A;  1RTH B;  1NSQ A;  3KLE A;  3L9Z A;  4CIO A;  4KC5 A;  2HW3 A;  1TV6 B;  5IZH A;  4QCL A;  3DLE B;  1YX2 A;  3EXY A;  5FLX Y;  3BV8 A;  4Z7C A;  2JVR A;  3HHE A;  1WC3 A;  3PW2 A;  1VQ9 S;  5KFW A;  4RU2 A;  2DHH A;  2QV6 A;  4L72 B;  3VZH A;  3ET6 B;  3OV7 A;  4ZPC A;  2OPP B;  4X4T A;  2UXB J;  1DLO B;  4LFA F;  2IDE A;  4C11 A;  5EWF A;  5L9X A;  2H9Z A;  1LW0 B;  3HJV A;  2XSJ A;  2D9P A;  4UY8 5;  1YRT A;  5M2P A;  3GG1 A;  5HI7 A;  2VFU A;  3T9N A;  3RRG A;  1O5J A;  3LGH A;  4NWB A;  1S4E A;  3MMC A;  3GII A;  1D1U A;  3O3L A;  3OL7 A;  2YNF B;  1B7F A;  2ZH3 A;  3HFV A;  5T7L B;  2XM3 A;  1K1Q A;  3C6T B;  1MNE A;  5C24 B;  2ZH1 A;  3Q22 A;  2ADC A;  1RT7 A;  4N8N A;  4IFY B;  2XYG B;  5MAO A;  5DDP C;  2PN6 A;  3K17 A;  4H4K A;  2GVD A;  1J5O A;  2Y8W A;  5CZX A;  3TVK A;  1RAB B;  1RTI A;  1ZH5 A;  4F0K A;  3RZA A;  4X4S A;  1WKK A;  2XMV A;  1GX5 A;  1ACM B;  3ZXW A;  3D2W A;  4FYX B;  4X66 F;  3J80 Y;  3MFH A;  3TI0 A;  3UN5 A;  5HP1 B;  4B9T A;  1AFI A;  3I5C A;  2IA0 A;  3N5F A;  4QR2 A;  1FK9 A;  1TVR B;  1PC4 A;  2B9X A;  2HEK A;  2E5G A;  2L9N A;  4P2S A;  2N3L A;  2I5J A;  2MTL A;  4Q7A A;  2G2Y A;  1YJN S;  1QTM A;  1SJR A;  1RT1 B;  3KNG A;  3X3U A;  4F4X A;  4OX6 A;  3ENW A;  1Q8L A;  3MD1 A;  4MYT A;  2WB4 A;  4PG7 A;  3GIL A;  2DHX A;  3ZFV A;  5IC6 B;  3TW0 A;  4GMK A;  4NCG A;  3DU5 A;  2MXY A;  1ITP A;  2AU0 A;  5AJ3 J;  4QPT A;  1HBN A;  2HGM A;  5GME A;  2XZD B;  3KWM A;  4DUY F;  1FD2 A;  5B08 A;  5JMN A;  3UD3 P;  2IM0 A;  1HL6 A;  5KG3 A;  5IT9 Y;  1JLQ A;  1VC6 A;  3Q8S B;  4DX7 A;  8RUC A;  1QDU B;  2JZ5 A;  4PPZ A;  4USU A;  5I3P A;  1KLN A;  4Q8F A;  3W7B A;  1YBU A;  3G6V A;  5DGA A;  1EAY C;  2M52 A;  4NLV A;  3TOQ A;  4X4R A;  4Q5V A;  4UOH A;  1A9N B;  1NME B;  1UAW A;  2ZBQ A;  2FHK A;  1IJF B;  2HRT A;  4LVN P;  4MK7 A;  2F1F A;  2E5I A;  2QX0 A;  3CJK A;  2ZZN A;  3FMB A;  3MM9 A;  4YME A;  4KPC A;  3KK3 B;  2NLW A;  3W60 A;  4OI4 A;  3LP2 B;  3OR2 B;  3QZ7 A;  3GWC A;  4LF6 F;  1UTA A;  3A8K A;  4DR4 F;  4U9R A;  1FVS A;  2EFP A;  2L9W A;  4Q2M A;  3GFH A;  1VIX A;  2BV3 A;  3GLJ A;  4CYU A;  3T1Y F;  1WOP A;  3FFI B;  1Y10 A;  2AP6 A;  2HHU A;  4C3K A;  4ATN A;  3HXM A;  2NXU A;  2AYE A;  3Q8P B;  4KTQ A;  4IR9 A;  1EKS A;  1S5Z A;  2CQ4 A;  2LDY A;  3I87 A;  1P8G A;  4EK2 A;  4A8S A;  2BR0 A;  1ICE B;  4ES3 A;  5F8I A;  3QSY B;  4ZCM A;  4DEZ A;  1BQM A;  4HHU A;  3I0R B;  2DPI A;  1TUW A;  1J5E J;  1S12 A;  2JFK A;  1N33 J;  1FFG B;  2DB1 A;  2FY1 A;  2HVZ A;  2JWN A;  1RAD B;  1VRT B;  3ISN C;  5GAE U;  3UCU P;  1CG2 A;  1YQH A;  1M5O C;  2OPS A;  1SJF A;  2DNP A;  2UUW A;  2YKP A;  1S6P B;  3FKB A;  4LRE A;  1DQ9 A;  3DLK A;  3F0N A;  4K5R A;  3KLI B;  3KG1 A;  4DUY J;  1RWU A;  4JYA F;  3OTE A;  3DDK A;  1PAU B;  1EKR A;  5GMD A;  2IJR A;  3FSY A;  3NGU A;  1U8W A;  3DOM A;  3CDU A;  3OTD A;  4AL6 A;  3GFY A;  2KTQ A;  2DR8 A;  1KQF B;  2ZWP A;  2M7S A;  1KQS R;  4HYK A;  4J91 A;  2C2N A;  3KLH B;  1MRO B;  4DUZ J;  4DS5 A;  5U47 A;  5D3G A;  1H7X A;  2HIQ A;  4WYL A;  3MMB A;  2I2Y A;  2CAJ A;  2J0S D;  1S76 D;  1KFS A;  1LWE B;  1ZM4 A;  3MWB A;  3UFC X;  1S7H A;  2VFS A;  3D1O A;  2NPI A;  3M6U A;  2FHO B;  1FEE A;  3OL9 A;  3QJJ A;  3QWU A;  2OMO A;  2YPZ A;  4ITS A;  1PAE X;  5KFJ A;  1NK8 A;  4KGV B;  3EZO A;  2CIM A;  4RWX A;  2HQC A;  4IDK B;  4J9V A;  3MCS A;  3JAM Y;  2E7W A;  4K7Q A;  1RU1 A;  1HYS A;  2DGW A;  2A2C A;  4PZV A;  5D77 A;  1PIL A;  4CI0 B;  4DL7 A;  4ZLL A;  3CC7 S;  2LCW A;  2M8H A;  2EG1 A;  3D1H A;  4ZVH A;  2C42 A;  2V63 A;  3AAW B;  3E51 A;  2R8G A;  4OHZ A;  1FXD A;  4B9L A;  4H4M A;  4QWB A;  5J2P B;  2RE1 A;  4ETZ A;  2BJE A;  3RU0 A;  4LUB A;  2GC8 A;  2VIH A;  2IPO B;  5E0O A;  2ZWO A;  7AT1 B;  5AXK A;  2X3G A;  3C6U B;  2YKM A;  2EFV A;  2B5J A;  1D09 B;  3BKF A;  1T9U A;  1P1T A;  3LP1 A;  3PYE A;  1NZA A;  2UVU A;  3F56 A;  4WKR A;  1FES A;  4A4J A;  2AHO B;  2FZK B;  1EET B;  5K9F A;  5H9F J;  1RTD A;  1RTI B;  4ZKA A;  4I6Y A;  2Z4P A;  3F73 A;  5HLF B;  3CJQ A;  1JJ4 A;  2VPZ B;  4IFV B;  2C2K B;  1N0V C;  3G8S A;  4R8U B;  1C4C A;  2WBR A;  3C6T A;  1JJH A;  3OL6 A;  4IOA Q;  4OL8 A;  1OPZ A;  1F9E B;  4HDH A;  4DR3 J;  1FX4 A;  1T7P A;  2JJ4 D;  5I42 B;  4QWD A;  1VQN S;  2HHX A;  3IMQ J;  3OR1 A;  4URQ U;  1Q82 T;  2BJ8 A;  2FZG B;  1S9E B;  4PWD B;  2IVF B;  3RBE A;  3P6Y C;  2P9G A;  1T9X A;  3BGR A;  2R7Q A;  3DC2 A;  4YOE A;  2XSJ B;  1LW0 A;  1OQ6 A;  2YX7 A;  1KBR A;  4ZDN A;  3UDV A;  3D6M B;  2RKI B;  2XG8 A;  2WRM A;  2UUT A;  1R0A A;  2W01 A;  2O5D A;  3D3B J;  5ETR A;  1GXU A;  4BLG A;  1RHJ B;  1MWQ A;  2CG8 A;  1ZA1 B;  2RAQ A;  3ET6 A;  3SXL A;  4CM2 A;  2ZH6 A;  5KFV A;  4YB1 P;  2ZJQ Q;  3FJ2 A;  4ZN3 A;  1M5S A;  3TUZ C;  2HLU A;  1G4C A;  3FRY A;  5IFM A;  4KKO A;  2QYC A;  2OEM A;  3CJ2 A;  1XBW A;  2VOP A;  2RSQ A;  2F63 A;  2H51 B;  3FBB A;  4OZ3 A;  4A8Y A;  5KG4 A;  4FVM A;  2GGP B;  2W2M P;  1N4L A;  4LR8 A;  4JI7 J;  4LF8 F;  4NLG A;  1TKZ A;  3M30 A;  4ILR A;  4CLW A;  3OHA A;  2IMW P;  1SQF A;  3CTR A;  4TLR A;  4OMF G;  3K0J A;  1HAR A;  1HPZ A;  3D0G E;  5F9N A;  4PRF A;  3PAC A;  2ZH4 A;  3RBX A;  4IO9 Q;  2WSE C;  4DS4 A;  1PGZ A;  1OY9 A;  2FVP A;  2H4Y B;  4QW8 A;  4DV4 F;  1S48 A;  2RT3 A;  4DV0 J;  3C3L A;  1O8B A;  2WSF C;  5SZT A;  2XSF A;  4EEY A;  3RW6 A;  3BEG B;  5CAB A;  3I0R A;  2KJV A;  3UPF A;  4FF1 A;  3P3D A;  2QJ3 A;  3GSI A;  2DGQ A;  2JLG A;  2DR7 A;  4G1Q A;  3TA1 A;  1KSP A;  1DAX A;  1RB0 A;  1REG X;  4C6A A;  1U1M A;  5F0U A;  1H2U X;  4KFB A;  2QZ8 A;  2IM2 A;  5I3U A;  4GVB A;  1WKJ A;  2HNZ A;  2F8E X;  4RW4 B;  1MU2 B;  2JHE A;  3NNH A;  2IM1 A;  1XMO J;  1TUG B;  1K47 A;  3A3N B;  2VG6 A;  2K1R B;  4ZP6 A;  3CPW R;  4RPF A;  4K4S A;  2KRB A;  3QAT A;  1R8C A;  4RX6 A;  1MMD A;  4IG3 B;  4C0H A;  1JB0 C;  1U1L A;  3BGU A;  1F2G A;  4KGK A;  4Y00 A;  1PG5 B;  1N56 A;  3ZZZ A;  1ZYQ A;  1RWM B;  2VD3 A;  4L6V 3;  4N77 A;  3H2L A;  4O23 A;  4B02 A;  3V4I A;  3RR8 A;  4KR0 B;  3QRQ A;  4XTT A;  2LKZ A;  3EVW A;  2ZOM A;  3TZZ A;  4CLF A;  3ICL A;  3CIM A;  3BR9 A;  4L3N A;  6AT1 B;  5M2R A;  2ZE2 A;  3N0V A;  3PRB A;  1GTE A;  2MQM A;  3M2U A;  2HHH J;  1UMJ A;  3KMS A;  2C3P A;  2R7X A;  3G9C A;  3BSA A;  5CYJ A;  1RAA B;  4DPU A;  1QM9 A;  5ITH A;  3VAI A;  5C42 B;  4EI2 A;  4DV4 J;  2E29 A;  3DRP B;  3R5G A;  2MST A;  2H5I B;  5A76 A;  1FJG J;  4TLQ A;  2GIR A;  1RWP B;  4QBU A;  4LQ9 A;  3KFW X;  2RB7 A;  5D6G A;  3G4S S;  2IC3 A;  2GQ2 A;  1SV5 A;  4ZVG A;  2OSR A;  4E2F B;  1TEL A;  3CCR S;  1NK6 A;  2YX4 A;  2PSZ A;  1B4S A;  3HHL B;  4HI1 A;  2BRK A;  5ETO A;  3HM9 A;  4YFU A;  1KEK A;  3LGN A;  3TNV A;  1YIJ S;  4JV5 J;  1Q0N A;  2DHA A;  3FCH A;  3G82 B;  2E7X A;  4Q44 A;  1HNZ F;  4Y2A A;  2XGQ A;  3IRX B;  2AD9 A;  3ILJ A;  4TXS A;  3Q2S C;  2LQ8 A;  2YQ3 A;  4ZVO B;  1TKT A;  1F9F A;  5E3P A;  4K50 A;  2B51 A;  3HVT B;  1VRU B;  1M5H A;  3KUG A;  4IKA A;  5EDW A;  5H1S V;  2MZR A;  3IO1 A;  2VFV A;  3Q89 A;  1VJW A;  1QAX A;  1WHW A;  2J0X A;  4WU3 A;  1YK9 A;  4X66 J;  2ZHO A;  5GAE I;  3KK1 A;  4IG0 B;  5L1I A;  4C4W A;  2RF2 A;  1C1C B;  4EWT A;  4JI1 F;  5HMW A;  2NS1 B;  3DGP B;  3DGP A;  2CQG A;  1VHI A;  3DYA B;  3PFO A;  4F2R A;  2VUG A;  1HWU A;  2MKH A;  3VGT A;  3LF0 A;  2DGT A;  3GV7 B;  1CQN A;  1R0C B;  4O0N A;  2EI5 A;  1R89 A;  2Y0B B;  1WHV A;  3O2I A;  4W98 A;  1SC3 B;  3PJW A;  4ZVQ B;  1A7G E;  3K89 A;  3BSC A;  4OQJ A;  1S0N A;  2VBW A;  1IBL F;  1TFY A;  2LA4 A;  2N3O A;  2YWE A;  5D0G A;  5AJ3 F;  1QSY A;  3MF5 A;  3TAR A;  5A8R A;  2O66 A;  5KFK A;  4PQA A;  2Q6B A;  1NB7 A;  1HW9 A;  3CJ4 A;  5HRO B;  3CDE A;  2B3T B;  2KM8 B;  1N6Q A;  9ATC B;  1FWK A;  4A8M P;  3OPK A;  3VZI A;  5DQH A;  4I68 A;  1RA7 A;  1C0U B;  3ZTO A;  3VV2 B;  3JTP A;  2XS2 A;  2ZHA A;  1SV5 B;  2XLJ A;  3G8Q A;  3M8P A;  2DRD A;  1Z2Z A;  2BKP A;  1RQ0 A;  2H65 B;  5HQL A;  3MUR P;  1IM4 A;  1X8D A;  4WFX A;  2Z56 B;  1TKT B;  3KHG A;  2CPI A;  1BUX A;  1LK7 A;  1S99 A;  3Q8U A;  4Y2K A;  3RGI A;  3V81 A;  4FF4 A;  2HHQ A;  1MSW D;  5KFI A;  4P7V A;  3N6M A;  5KFU A;  1NKB A;  1XMQ J;  4EO6 A;  2J0W A;  4LFB F;  3A8I A;  1ZA2 B;  4F25 A;  3M7V A;  4DPX A;  3UQS A;  3ZZY A;  4J9N A;  3BGF A;  2B9E A;  3EGN A;  1Y3J A;  2AT1 B;  2DXE A;  2HGL A;  2WOM B;  5A8K A;  2ILY A;  4AL7 A;  2RRA A;  5D0E A;  4CLZ A;  2QN6 B;  1URN A;  2E5L J;  1RT6 B;  4B3O B;  4TU8 A;  2XLK A;  3M6X A;  3OL8 A;  3GV8 B;  1FDD A;  3RYL A;  4XO0 A;  5KFB A;  4OLP A;  3RW7 A;  3GYG A;  3U1M A;  2ABY A;  4C8Z A;  4NLU A;  1FKO A;  1IBM F;  4ELV A;  3ISZ A;  5C42 A;  2KU7 A;  3AOA A;  1Y5N B;  3A8J A;  4DPW A;  4ZN1 A;  1H2V Z;  2PEH A;  1FRK A;  1HWJ A;  3PHE A;  2JOQ A;  2ZH2 A;  2HGN A;  2G1H A;  1FRM A;  3WIU A;  4ILL A;  3CCL S;  4QYR A;  1CJT A;  6FDR A;  2RU9 A;  4DR6 F;  1MU2 A;  1WOO A;  1F1B B;  2KRR A;  4B08 A;  4OYM A;  5I3U B;  1WAC A;  2HAF A;  4F3O A;  3QGI A;  2PC6 A;  1N88 A;  2H1Y A;  4PYD A;  4QIF A;  5D0R A;  3UD5 A;  3MCM A;  1CSJ A;  1PKU A;  4F50 A;  3HSG A;  2G9O A;  1S10 A;  2ASD A;  3BQ0 A;  1B7Y B;  2VIC A;  1Q8K A;  2GQQ A;  4H54 A;  4OI1 A;  2LFV A;  2ZDO A;  3NGR A;  2VC1 A;  4OJ1 A;  5LMN F;  5AXN A;  1RTJ B;  2BZ2 A;  3PV8 A;  3FSI A;  3IS9 A;  2Q79 A;  3PZP A;  2VJV A;  4WP3 A;  4N76 A;  2DY9 A;  3AJ2 A;  2J76 E;  4ZVE A;  2BBE A;  3NRB A;  3AD7 C;  2GNK A;  2W2Q P;  4DBQ A;  4K2X A;  2BMB A;  2QSW A;  3QAE A;  4RNO A;  5GAH U;  2KFY A;  3MEG B;  3TWZ A;  2R2T A;  1RAH B;  1YJ7 A;  3NLC A;  4M5D A;  2D1C A;  3J7Z 5;  3H5Y A;  4PWU A;  2LP4 A;  1QAY A;  2YNG A;  1JNZ B;  3LAK A;  4Z2X A;  1BMQ B;  4NYO A;  2H4W B;  2QRR A;  3E8O A;  2VC0 A;  4HHH A;  4NX9 A;  4P71 A;  5D4O A;  4NL5 A;  2R8I A;  4CYU B;  2ZD1 B;  5IM0 B;  3D0I E;  3H25 A;  3UE2 A;  3OFG A;  4ED7 A;  3R7N B;  5LOQ A;  5CD4 A;  4ZLP A;  1B64 A;  4YY3 J;  1CJV B;  2VBY A;  3HVW A;  3QID A;  4AUK A;  2WTF A;  4GO7 X;  3H4B A;  2RKI A;  1M5P C;  2BE2 B;  3LPY A;  1Q7L B;  1VIO A;  2QIF A;  2DO4 A;  5HBM A;  4CTA A;  5BR8 F;  3KK3 A;  2E1C A;  1TKZ B;  3M30 B;  4OX8 A;  3W64 A;  2U2F A;  3IFE A;  3KJV B;  4NZ6 A;  4K4V A;  1S9E A;  3M6V A;  1FE4 A;  5THW A;  4GRS A;  3IN5 A;  2L3M A;  4CCH A;  1RE1 B;  3ELH A;  4ECX A;  1H38 A;  1VK3 A;  5F8M A;  1T05 A;  4OI6 A;  1D9D A;  5C7P A;  1RSC A;  2R42 A;  3OFF A;  4DCO B;  1FKA F;  4KIA A;  3SYZ A;  3P49 B;  2DH7 A;  4B3S J;  2DGS A;  2LQB A;  2FLP A;  3P5T L;  4OYW A;  1GTH A;  4DV1 F;  2E1P A;  2FLL A;  1WNE A;  4ECU A;  4PCQ A;  4WZQ A;  1NND A;  4DSF A;  2AYB A;  4C8K A;  4P9S A;  3QGP A;  4PXB A;  4Y6I A;  3VVT A;  4DR3 F;  4KO0 A;  2RS2 A;  2F8H A;  4PWD A;  2MQO A;  1MN7 A;  2QTW A;  2W9C B;  1IQT A;  2YKM B;  4IYQ A;  3DRR B;  3HD1 A;  4FZV A;  4DCJ B;  1MN9 A;  4UZB A;  2JSX A;  4F3Q A;  2YTC A;  3FC9 A;  1KN6 A;  3BGL A;  1AXQ A;  2QLF B;  1JLC B;  3CD7 A;  3NXZ A;  4M1K A;  3KG0 A;  3DMJ B;  2VKZ G;  4RW8 B;  2ZC3 A;  4R0J A;  2LQ9 A;  4XPC A;  2YNH B;  4RW7 A;  3ZZ0 A;  1X9M A;  4DSI A;  1KD1 T;  1U1R A;  2C2M B;  2Q66 A;  4YHH F;  4I69 A;  2V4R A;  1N36 F;  1N34 J;  3S8S A;  5KFC A;  2ZH7 A;  4UOC A;  3I82 A;  3JS9 A;  1I3O B;  4DU8 A;  4RJV A;  4EBD A;  4QU6 A;  1E6Y B;  2OML A;  1HKA A;  2QLW A;  1XEZ A;  2DHS A;  2DRB A;  2PMZ D;  2QYG A;  5GAD U;  4DL2 A;  5B0D A;  4NYZ A;  4DWI A;  5J2P A;  2LQJ A;  2Y0S D;  2YXL A;  3DOL B;  1GEH A;  2ROE A;  1WC6 A;  2AJ1 A;  5JXS A;  3R5B A;  2PI5 A;  1HMV B;  4DFJ A;  3NMR A;  4B3R J;  3NAH A;  1S57 A;  3MMB B;  5JUM A;  4WK1 A;  3CJR A;  4LF4 J;  2OGU A;  2DKO B;  2ZHB A;  3GE9 A;  1R6Y A;  1FFS B;  3GIR A;  5C2G A;  4J9M A;  1FRL A;  1SJ1 A;  4MTP A;  4PXC A;  3MM5 B;  3QLH A;  4UST A;  3QGH A;  1WTF A;  3PEJ A;  4F67 A;  3ILO A;  3EIC A;  3N01 A;  4M5G A;  5A0Y A;  4EYI B;  2E5L F;  2NR0 A;  1S6O A;  1JX4 A;  4F26 A;  3T3F A;  2LU1 A;  1FTC A;  2C2Z B;  2CQD A;  4OI0 A;  1V5V A;  5L1J A;  2HBY B;  4HAC B;  2QL7 B;  2UV8 G;  3IAM 9;  4LF7 F;  2GCF A;  2L08 A;  3OXL A;  3TR5 A;  1TZ0 A;  3IXQ A;  5CYM A;  2FHJ A;  1VC0 A;  2UVW A;  1CJV A;  3CME S;  2V2Q A;  5D0H A;  4LF9 J;  2SXL A;  4M5I A;  4DQR A;  2V9W A;  2F9J A;  2XZW A;  4CWB A;  1JK9 B;  2E1A A;  3HI9 A;  4V1A k;  3TUJ C;  2OP5 A;  4FS1 A;  1N34 F;  4KRW A;  4M95 A;  4ILM A;  1E6V A;  1FJE B;  4ZJL A;  1TQL A;  1XR5 A;  4DR2 F;  3WC0 A;  4QYZ J;  3MEG A;  1WG5 A;  1SIZ A;  3MPW A;  4QW9 A;  3HVR A;  3E3X A;  4ZVU B;  2MZQ A;  3MM6 B;  1XQI A;  4TKT A;  4ZVF A;  2ZEJ A;  3MEE A;  5LMN J;  2VOD A;  4GVL A;  3MPD A;  1VQP S;  7FDR A;  1OY6 A;  5HAN A;  3W3S A;  2OPS B;  2KG0 A;  1TK8 A;  2XS5 A;  2F5G A;  3GR1 A;  1EP4 B;  4P6Q A;  3NG8 A;  1TAU A;  2VQF F;  1NU4 A;  2XNR A;  1EHW A;  2EC2 A;  4OV1 A;  2BE7 D;  4DI6 A;  2GJ2 A;  2V8G A;  1TMM A;  4ZPB A;  3KUH A;  1VRQ C;  2FZC B;  2AKW B;  1R8P A;  3MUV P;  4ENO A;  1U0H A;  2C1E B;  1KQK A;  3SMZ A;  4YB7 A;  1S0O A;  4LF5 F;  3D6T B;  1JLQ B;  3QMQ A;  4QJV A;  4NI2 B;  4ECY A;  3AQO A;  4NCB A;  4I4B A;  1XNR F;  2BOA A;  2LVW A;  4BS2 A;  1QUV A;  4FXW A;  4LF7 J;  4ETX A;  4F8R A;  5G0R B;  5L38 A;  1GNK A;  3D0H E;  3VAM A;  5KT3 A;  3ZTS A;  2BQU A;  2ZBI A;  3C14 B;  3G87 A;  5J2M B;  2W2P P;  4PQU A;  2W7A A;  2W8K A;  3OQ2 A;  4TQS A;  3GIJ A;  3HD2 A;  1YJV A;  2H5E A;  2MEW A;  4HAC A;  1S49 A;  2DNL A;  2R7W A;  3TJ9 A;  4NEY A;  5KFZ A;  3DLH A;  3OVA A;  3C15 A;  2CQ0 A;  3CJ0 A;  3MOJ B;  1RWK B;  3FBF A;  1DTT A;  3KMQ A;  3IAS 9;  4DHV A;  3SZ2 A;  3ADA C;  3MPY A;  3R6L B;  1VCT A;  2DPJ A;  4F0M A;  3MUM P;  1LFW A;  3EGV A;  4R8U A;  4J5O A;  1FK9 B;  5E3C A;  3QO9 A;  4F3M A;  2GV1 A;  4FKX A;  3GR0 A;  2HIY A;  4L76 A;  5B0G A;  2D7S A;  3LPE A;  5KFH A;  1FEH A;  2MZT A;  4CT9 A;  1BE4 A;  4A8W A;  1H7W A;  2HVH A;  3HT3 A;  2NSB A;  1TP7 A;  4CLY A;  5L46 A;  1R8A A;  2V2Z A;  2V4J A;  2XCA A;  4CRJ A;  3UNG C;  4YR0 A;  1NZ8 A;  4R5P B;  4EGL A;  3J7Z T;  2VQF J;  4CQ1 A;  2YKN B;  1JLC A;  1V9O A;  3W9I A;  1RBA A;  1JQG A;  3E01 A;  4KQZ A;  1NO8 A;  1IKW B;  3C6U A;  3F44 A;  1RTZ A;  1RT1 A;  5RUB A;  1U1N A;  5EX3 A;  2OH2 A;  2P2C B;  1GMW D;  3DRR A;  2YNF A;  4PWW A;  5ETM A;  4URG A;  4X4N A;  5L39 A;  2C28 A;  4DDF A;  5IV3 A;  2PMW A;  4FS2 A;  1QE1 B;  2GW8 A;  4FN5 A;  5D15 A;  3MR2 A;  3H2V E;  1R31 A;  4V19 X;  1Y4Z B;  4C8Y A;  1CS4 A;  1V3R A;  2HFV A;  2G0C A;  3UDL A;  2YNH A;  4RW7 B;  3ZC4 A;  5IT0 A;  2HS0 A;  4FF2 A;  2F3J A;  2E1R A;  4PAB A;  2J7U A;  5DDO C;  1SL2 A;  3D28 A;  3T19 A;  2LA6 A;  1RWN B;  2ZKU A;  1Q78 A;  2D3U A;  1O51 A;  3NGK A;  4IFY A;  4NA3 A;  4UTG A;  2LQ5 A;  3BO4 A;  4XAK A;  1KOH A;  2HVD A;  3CO0 P;  3LOU A;  4U96 A;  3CIZ A;  2CQI A;  2EWH A;  2KDO A;  1XMQ F;  2D3O 1;  1VC5 A;  2DHG A;  1LXN A;  4OJG A;  3SQG B;  3KHR A;  4OI3 A;  3DYA A;  3R6G B;  2D3Z A;  5F8J A;  4YDX A;  3ONQ A;  2UU9 F;  2QL9 B;  3AXK A;  4B9S A;  3M2V A;  3W61 A;  4CTA B;  2XMK A;  2UZA A;  4HL9 A;  2DO0 A;  1FJG F;  1IKV A;  2M88 A;  3MEC A;  3BYR A;  3NAI A;  3R5C A;  2RQC A;  2W9A A;  2Z8Q A;  3OSN A;  2DTJ A;  1VQ6 S;  1RBO B;  2KI2 A;  3T41 A;  1N5S A;  1U02 A;  1RT3 A;  4NE9 C;  2I6W A;  4DV3 F;  1QLN A;  4Y3C A;  4I6W A;  1T03 A;  4LF1 A;  1FXL A;  2XWY A;  1PCA A;  1FTR A;  2PD1 A;  4P2X A;  5AE2 A;  3FK4 A;  3CCZ A;  2CFX A;  3IM9 A;  4RW9 B;  3GSD A;  4MKB A;  5FLX U;  4LMZ A;  4JUZ A;  3M2R B;  5AXM A;  4ECW A;  3IBF B;  2K7J A;  2CNL B;  3R7B B;  3ZNU A;  1KC8 T;  5KFL A;  2LXI A;  3KLI A;  2MYF A;  2MLY A;  1UVJ A;  1D9F A;  3IG1 A;  1XER A;  2RDD A;  3IGV A;  4ZMM A;  4ERD A;  1X0P A;  3HHL A;  4DZ6 A;  4F2S A;  1KON A;  2NYH A;  1QD1 A;  5EGY A;  1IBC B;  1NKC A;  3IBW A;  3HSJ A;  1UJ6 A;  4WYW A;  1RAO A;  2UUC J;  1G1X A;  5J2Q A;  2W4P A;  3PCO B;  1U0S A;  4M5H A;  5HVH A;  3MEE B;  1KLM B;  4ZCI A;  2ZDP A;  3IR6 B;  1RHQ B;  3KLV A;  4DR2 J;  4XK8 C;  5CXT A;  2IJN A;  4USW A;  1VYA A;  1FDB A;  1WD6 A;  1TL4 A;  3PEH A;  3RAM A;  3L7P A;  1CJK B;  3TAN A;  2LU2 A;  2E5J A;  1E6V B;  4ES1 A;  4TY9 A;  1YG0 A;  2QL5 B;  2XWX A;  3K8W A;  3M2U B;  2CJX B;  2PEB A;  2VH7 A;  4JI5 F;  3R2C J;  4K0K F;  1DY3 A;  2J8A A;  2BQ3 A;  4FDF A;  5JVH Q;  1DUR A;  1LK5 A;  2KXH A;  4ZK7 M;  4KY3 A;  3I5B A;  4PG8 A;  2MKK A;  3MEK A;  3L95 X;  1C2P A;  3PY8 A;  3V6K A;  2JFD A;  1CVJ A;  4DR4 J;  1RTJ A;  1YKW A;  2QGF B;  2ZVI A;  4MK9 A;  4NLT A;  4UW2 A;  3HX9 A;  4WFZ A;  4CO0 A;  2HMI B;  2F4V F;  2V8D A;  1Y5I B;  3GB0 A;  2BVZ A;  3I6P A;  4YY3 F;  2IRX A;  4MAK A;  4KH1 B;  2W8L A;  3MR6 A;  3EGW B;  2K1R A;  1BHN A;  3BN7 A;  4QWE A;  1NB2 A;  1HBU B;  1FHT A;  2HKE A;  3Q0A A;  3Q8Y A;  3V6H A;  1QUP A;  1SKW A;  3BF4 A;  4KAI A;  1U26 A;  5A8K B;  3MCN A;  3LWL A;  3AA8 A;  1TKD A;  3T1H J;  3DOK B;  4O3O A;  3M8Y A;  5KFM A;  2MZ1 A;  4NCA A;  4NA2 A;  3H20 A;  2X1B A;  2K06 A;  2LEP A;  1TUV A;  3I31 A;  4ZCL A;  1SQE A;  4WFN Q;  3MM8 A;  2V68 A;  2APO A;  3LA0 A;  1XIQ A;  1HLW A;  1RWO B;  4NLD A;  1JLF A;  2MKY A;  4QIE A;  4WXO A;  4KYZ A;  3V2U C;  5F9L A;  3R1H A;  2NRE A;  2GAH C;  2MLZ A;  2IRY A;  3PIP Q;  5CQG A;  4LFB J;  2AEM A;  1B3T A;  1RLC L;  4RNF A;  4QWC A;  3H8Y A;  2FHM A;  4J7C A;  1W26 A;  4WF9 Q;  4O3Q A;  4YB6 A;  4DZD A;  5KG1 A;  4EZ9 A;  4ED5 A;  3CC4 S;  1E6Y A;  3CCE S;  2C2E A;  1HPZ B;  1FI4 A;  3CO9 A;  4L74 A;  1SJQ A;  4LSL B;  5GAG U;  1ZPW X;  3NCQ A;  2MB0 B;  2BYC A;  2E66 A;  1HWL A;  1FCA A;  4RW6 B;  1NK7 A;  4K4Z A;  2I8E A;  2KT2 A;  4OFZ A;  3FQL A;  1UJ5 A;  3IGN A;  1S1X B;  5HN0 A;  2WHO A;  4KH0 B;  3KK2 A;  4ZHR A;  1DBD A;  4K5S A;  4P72 A;  3DMJ A;  3BGO P;  2FJD B;  5E5N A;  5LM7 E;  3ZZU A;  4NAS A;  2HYI B;  1QY7 A;  1M5K C;  2IVY A;  5HSP A;  2VKR A;  3CD0 A;  3MMA A;  3EXC X;  4C7Q A;  3GPA A;  5GMK a;  1WSR A;  3QBC A;  4D3H A;  4JB8 B;  3AH6 A;  3NCR A;  4A46 A;  2BOP A;  2MZS A;  1FO1 A;  2JEF A;  1HYS B;  1WEY A;  2Y8Y A;  3T5J A;  2DNH A;  4TVA B;  1HHS A;  2J5A A;  3BRE A;  3T5H A;  4GKJ J;  4C8N A;  2D9O A;  3VAL A;  3OR1 B;  3WBZ A;  2IM3 A;  3N79 A;  5IWA J;  2FC9 A;  2OHD A;  4DR5 J;  1S0M A;  1Q7Y T;  2MKC A;  1B99 A;  1ZOT A;  5A8W A;  5KT6 A;  3THP A;  3ENQ A;  2J9E A;  1ELO A;  2G2O A;  3PHT A;  1VRU A;  1LOU A;  2RUG A;  1DQA A;  1N5Y A;  1T05 B;  4RUB A;  4YDD B;  1B70 B;  4FNH A;  1RHR B;  4CLT A;  3Q8R B;  3IRX A;  1RTD B;  2HK3 A;  4JI8 F;  2DNG A;  1DQ8 A;  2PO4 A;  3HUL A;  1VBX A;  3GV5 B;  5BYR A;  2JDJ A;  4CLU A;  3RTV A;  2CJK A;  2J6S A;  4OYB A;  2HNY B;  3PX6 A;  2ASJ A;  3H7H B;  4O3P A;  2OI2 A;  2KXN B;  3M9N B;  2MQQ A;  2J7W A;  3QRR A;  2BJ3 A;  4DV3 J;  4NOH A;  2HQF A;  2GIF A;  1IKW A;  2WON B;  2BKO A;  1A0O B;  4YEA A;  1V3S A;  2HG4 A;  2V8H A;  4H4M B;  3TX8 A;  5M2U A;  3ULH A;  3NGD A;  3TAP A;  1NPP A;  4R5P A;  4N5S A;  2QMU B;  1M0S A;  1IR0 A;  1FRI A;  1KR4 A;  4K4Y A;  2KJW A;  1ZBT A;  2R7S A;  2AJ4 A;  3CSK A;  4OYA A;  3IM8 A;  3J7A N;  2UXC F;  1EIY B;  2HPU A;  2B4U A;  4KBI A;  2XUL A;  1BQN A;  1WI8 A;  2E44 A;  5BYS A;  2M2B A;  2EFQ A;  2NXE A;  4FYW B;  2YNI A;  3AJD A;  2KH9 A;  1SI9 A;  5F41 A;  2BW7 A;  4G65 A;  4LSZ B;  2QSF A;  4IR1 A;  4JI2 F;  3EDR B;  1VS3 A;  3PKM A;  5CHC B;  4KHP J;  4PYA A;  3MZI A;  2VG5 B;  3C16 B;  1RCO B;  5KFT A;  2HMI A;  3ENA A;  4NLY A;  4ZPD A;  4PQU B;  2JRS A;  4LRC A;  4PUO B;  4IOB A;  3FZ2 A;  4ALZ A;  2BDP A;  2NUH A;  4ZIV A;  2ROP A;  4JI5 J;  4X4O A;  1GMU A;  2JH3 A;  2YKQ A;  2Z2Y B;  5DO2 A;  5KFN A;  1OMS A;  1X4C A;  2JEI A;  2RQK A;  5DJB A;  2VPY B;  1D3W A;  1LWF B;  2EFG A;  5B0C A;  2EC0 A;  3W8P A;  4NRU A;  2IYI A;  2QA1 A;  4PG5 A;  4DUZ F;  2EVZ A;  4F4W A;  4JI3 J;  1GH8 A;  3VAK A;  1SPB P;  2OD4 A;  2V4Q A;  5A2Q Y;  4USV A;  4J9Q A;  4DV2 J;  1FF2 A;  1P9Q C;  2CA9 A;  1FKO B;  1AUD A;  5D8H B;  1YJW S;  1RHM B;  4OZN A;  4UUW A;  4DR7 J;  3OJU A;  1HHT P;  3W66 A;  4LFA J;  3TAM A;  4ZS6 A;  4IRC A;  2XY7 A;  3ZZT A;  2VG6 B;  2AW0 A;  3MAH A;  2V8P A;  1UPM B;  1VR6 A;  1JIH A;  2AZ3 A;  3DRS A;  3W1Y C;  3L4B C;  3J7Y U;  1RKJ A;  3T1H F;  1WF0 A;  4RW4 A;  2HVE A;  1U2R A;  3SIP B;  5CYQ A;  1LEO A;  5HJX A;  3AOC A;  2QO3 A;  1BQM B;  1S1T B;  1RT5 A;  3H5U A;  3K5P A;  3J81 Y;  4MIA A;  3HO1 A;  2WBM A;  4CO1 A;  2KN4 A;  4WCE Q;  8ATC B;  1UVL A;  1UW9 A;  1Y0H A;  4B3R F;  2MPU A;  1XNQ J;  1NDC A;  3V81 B;  3G6E S;  4JV2 A;  2RH3 A;  3MED B;  4IH5 A;  2XGP A;  4AYB D;  5B0A A;  1ZPV A;  2OPR B;  1SUQ B;  2IA6 A;  4AD6 A;  5KG6 A;  5DDQ C;  3H59 A;  3UO0 A;  5KG7 A;  1UPP A;  4Y2I A;  2ZH5 A;  3LP2 A;  1GAO A;  3OR2 A;  2KHC A;  1S1V A;  2YQ0 A;  1N52 B;  1WDD A;  3TEH B;  4F36 A;  5KT5 A;  1VDH A;  1FRJ A;  2YVS A;  3BSO A;  4DPT A;  1U48 A;  2V9K A;  1I94 J;  4B9N A;  2DR6 A;  2QMW A;  2NSC A;  3FBC A;  5KFR A;  1IN0 A;  2XMJ A;  1L3V A;  2ZNZ A;  2FGC A;  1FX2 A;  3D66 A;  4NA1 A;  2XCP A;  2DNY A;  4DQP A;  1X5O A;  1YJU A;  4DFP A;  4DFM A;  2AEF A;  2B4O A;  2CDR B;  2KHD A;  2LEA A;  3IA0 A;  1SC6 A;  4AE5 A;  4NXN J;  3PW5 A;  1Q79 A;  3DI6 A;  2VFT A;  3R9L A;  5IS2 A;  2CWK A;  2D3O R;  1RCX B;  2VG7 A;  4AL5 A;  1M1G A;  2DK2 A;  1DHM A;  1GXT A;  2PT0 A;  5FDL A;  4TQR A;  2RHS B;  2QFJ A;  3UDC A;  1CS4 B;  4KB7 A;  1PBU A;  2J6T A;  3FEY B;  1HQ2 A;  5CA5 A;  1XR7 A;  1OJ4 A;  4NLQ A;  4QOT A;  1YVF A;  5F3Z A;  4KV8 A;  1PJ6 A;  4L3K A;  3BN4 A;  3LP1 B;  4OYO A;  3HJF A;  1FE0 A;  4OZ5 A;  3SBM A;  4UQT A;  4I2P B;  3MAQ A;  2P8I A;  4WTO B;  3NGS A;  3MR3 A;  2UXD J;  1NK4 A;  4WIQ A;  5JVG Q;  5K14 B;  2G13 A;  2C22 A;  3E01 B;  3P4U B;  1SJ4 P;  1R7I A;  3GFX A;  1RT4 A;  4B3T J;  5HQM A;  4LJM A;  5HMY A;  3C2P A;  1SB6 A;  4X64 F;  3O5T B;  3JSB A;  3VF0 B;  2W2O P;  2IFX A;  3D6F B;  1SH3 A;  2B43 A;  2F4F A;  4FYD A;  4M5M A;  1HNW F;  5KT2 A;  3CUL A;  2Z30 B;  3NWG A;  5HL7 Q;  3RR7 A;  4DCP B;  1S1W A;  4QR1 A;  5DG9 A;  1LNQ A;  5BJR A;  3HHL C;  2DRA A;  2ZJP Q;  3IWL A;  2VOO A;  2OTL S;  1F5B A;  3GCW P;  5LSO A;  2XY5 A;  1YIT S;  4E0D A;  2R7U A;  2IC3 B;  1X5T A;  2K8G A;  2VA3 A;  3TVY A;  5KFX A;  4XDC A;  3W62 A;  5H9E K;  3PNI A;  2HNY A;  4USJ C;  3JQK A;  2JEJ A;  5AE3 A;  4DLE A;  3EWG A;  2ZBR A;  4G1I A;  1U49 A;  2EEY A;  2UXC J;  2FTR A;  1N5V A;  2XC9 A;  3TQ1 A;  4BWM A;  2RUS A;  2ZFH A;  5KFE A;  3KLH A;  1FDN A;  5KFO A;  4I2Q A;  2O3D A;  1SC4 B;  2WSC C;  3TUI C;  3O8W A;  3TVZ A;  2BQR A;  2DT9 A;  4QIG A;  4RZR A;  1LXJ A;  1NPR A;  3DOM B;  1RDR A;  3DLE A;  1YWX A;  3OBI A;  4LSN A;  4X62 J;  1Q8I A;  1G6B A;  4USI A;  4U6P A;  4RWW A;  2FGO A;  3HZE A;  4WK3 A;  1S0V A;  4X2B A;  1UVK A;  3CGI A;  2PMH A;  5HO4 A;  1U09 A;  3IWN C;  3UR0 A;  1FER A;  3WHI A;  1YTY A;  5KOW A;  2JC1 A;  2P9C A;  3B4M A;  3CCT A;  2LLZ A;  4ZVP B;  3W5X A;  1MWZ A;  4DR1 F;  5E2Q A;  1NXI A;  2C3U A;  3DN9 A;  3M1V A;  1SKS A;  2RQM A;  3MMA B;  1X5S A;  3EYZ A;  2FJB B;  4KHM A;  2FPH X;  2FYX A;  4ZOS A;  3EVO A;  2OD6 A;  3DM2 B;  4F02 A;  1NDP A;  1DAR A;  3QQC D;  4C8L A;  4ZCK A;  3R97 A;  3PW0 A;  2GS8 A;  1NSA A;  2CJA A;  2KB2 A;  3KUE A;  4L75 A;  3SCI E;  3Q2T C;  4ZPA A;  1SQG A;  2JX2 A;  1WG1 A;  1S6P A;  2IHR 1;  3CMQ A;  4MH8 A;  4LSL A;  2IBO A;  3JB9 k;  5KFG A;  1HNV B;  1NHV A;  1T9V A;  2A1B A;  3VR1 A;  1UJ4 A;  4WII A;  3EMT A;  5KT4 A;  3MXH P;  3ETM A;  1Q1K A;  3K2Y A;  4OV6 A;  1U1O A;  1HD0 A;  1UFW A;  1IXK A;  3MM7 B;  2UVR A;  3VAJ A;  5C2C A;  4DSE A;  3HK2 A;  4JV5 F;  4E98 A;  3P45 B;  4I6A A;  2CZ4 A;  4F7V A;  3I32 A;  1W25 A;  2R9L A;  1QVF R;  5ETS A;  2I1R A;  1JKH A;  3TRG A;  2VQE J;  1XNQ F;  1B0P A;  2AIR B;  3BPD A;  4HEA 9;  3EX7 B;  2UXB F;  3CD5 A;  2BAN A;  3PRV A;  1IJE B;  4I2Q B;  1X4H A;  3Q23 A;  4FF3 A;  4ZP7 A;  4C9D A;  2HS3 A;  1RT3 B;  2B9Y A;  2FVQ A;  3VQT A;  1CEZ A;  1CLF A;  1S6U A;  4OLO A;  1RIS A;  1R0A B;  1HI1 A;  3DGV A;  4WXW A;  4M94 A;  2VV5 A;  3MM9 B;  4JI1 J;  2K7K A;  1KOO A;  1I94 F;  2B8Q A;  2HHS A;  3M6W A;  3MM7 A;  4Y2M A;  1T3O A;  4DOZ A;  1HFE L;  1MMN A;  4CH1 A;  1TL5 A;  2ZH9 A;  3GJR B;  1HWI A;  4C0O C;  2CQ3 A;  1T9Y A;  1WOS A;  4K4T A;  3FGV A;  1IKY A;  3JYT B;  3J80 U;  3HP6 A;  3BQ2 A;  4EU0 A;  2XMU A;  4IFV A;  1HBN B;  2YH1 A;  2W9B A;  1HQU B;  2HQ3 A;  1RWV B;  1PYT A;  4LRF A;  4OHY A;  1EET A;  1HW8 A;  3PM9 A;  2GVD B;  5ETV A;  1J5O B;  5ETT A;  1QE1 A;  1CUL B;  1T02 A;  4JYA J;  3L7U A;  4Z7Y A;  4JI0 J;  1RT4 B;  1C1B B;  2CWX A;  2HFO A;  4NLS A;  4EMD A;  1P1L A;  4ID8 A;  5HVG A;  2CPZ A;  3UN2 A;  2KVI A;  3JSR A;  4I67 A;  4NYP A;  4BWJ A;  1WC1 A;  3CJ3 A;  1QJH A;  4Y2C A;  1V6H A;  1VLO A;  2XO6 A;  5DM7 Q;  2BA9 A;  2DCL A;  2AMC B;  2O01 C;  3AA9 A;  1K9M T;  3KOA A;  3AHP A;  3NNA A;  5KFA A;  5LJ5 Y;  2MQP A;  3THV A;  1X4A A;  1FNM A;  3B6B A;  1AT1 B;  2FUG 9;  2XQC A;  4QIW D;  1AZS A;  2YKA A;  5A8R B;  3DLG A;  3PJ9 A;  1UFL A;  4WU2 A;  4AND A;  2K3I A;  1IUJ A;  5AXL A;  4I7F A;  1O0P A;  3CCU S;  1RLD A;  4O4R A;  3SCK E;  5GAH I;  2V94 A;  3O1L A;  4I1T A;  4IDK A;  4DQS A;  1GMV A;  1UA0 A;  2Q3P A;  3U7J A;  3I0S A;  2F65 A;  2H3E B;  3NP5 A;  4FVC A;  5C5J A;  4DLG A;  5LJ3 Y;  4DG1 A;  2CRL A;  1SH2 A;  2XBP A;  1SH0 A;  2FHJ D;  3ZTP A;  3DU6 A;  4QZV B;  4RUH A;  2XLI A;  3MEC B;  1FD8 A;  2CPE A;  1S1U B;  4J37 A;  1IBM J;  4O3S A;  3W2V A;  1YJR A;  2AJ0 A;  3CWJ A;  5HBM B;  3OVB A;  1LWE A;  4ECZ A;  3BBF A;  4QU7 A;  3NKY A;  2NYI A;  5K20 B;  2R7T A;  5J2M A;  5B09 A;  5D3G B;  4X4U A;  2OPP A;  4ZPW R;  2RRB A;  3M8Q B;  4TN2 A;  1RA6 A;  4KGM A;  1NAQ A;  2V8V A;  1DTQ A;  1TMJ A;  1SUQ A;  1ZM3 A;  3LW5 C;  4USK A;  5KG5 A;  3G8T A;  1HNI B;  4GO5 X;  4B9U A;  1HQE A;  1UL3 A;  4NEZ A;  1N54 B;  4ZVS B;  5BXI A;  3PVX A;  3CCJ S;  1FRX A;  1L3S A;  4FBU A;  2ZZM A;  1U2F A;  2IBK A;  4MK8 A;  4ZP9 A;  5F0W A;  1CJU A;  3QWP A;  4FPR A;  4I0W A;  4P73 A;  4PG4 A;  3VGU A;  1RK8 A;  2C2D A;  4GKK J;  4DL3 A;  2ILZ A;  2CJB A;  5ETQ A;  1NHK L;  1WF1 A;  1NH8 A;  3WIV A;  3M9O B;  2OLW A;  2W25 A;  3JQJ A;  4UZC A;  2HHT A;  4NLP A;  4CH7 A;  4DJB A;  4U7C A;  3TUP A;  2Q43 A;  3TAQ A;  3K5M A;  5KG2 A;  4U8V A;  1S9G B;  2HZC A;  3T1Y J;  3TAM B;  3WQP A;  2HQD A;  2A3J A;  2RVJ A;  2ATL A;  2KT5 A;  3WDO A;  4KT0 C;  3S01 A;  3TEG A;  1X7V A;  4QPX A;  1UWA A;  1VQS A;  3CCW A;  3B82 A;  2WVD A;  1C1B A;  4X4Q A;  4KV8 B;  1IWA A;  1R27 B;  1VQY A;  4UOG A;  3J7Y I;  3LAL A;  3GFZ A;  1JWW A;  1N5Q A;  4OJ3 A;  2L48 A;  2ADB A;  4DUT A;  1O6X A;  1HQU A;  5IWA F;  4DR5 F;  1X4E A;  4B17 A;  2MDA A;  1VBY A;  2EBE A;  2YPY A;  2P5V A;  3DFE A;  2MSS A;  3JSM B;  2ZUA A;  1RT2 B;  5J2N B;  2P6T A;  1IQZ A;  1HNZ J;  4OX9 J;  1VIS A;  2MKI A;  1J2V A;  3DXS X;  1BLU A;  4HT7 A;  2KG1 A;  5J1P A;  3M32 B;  3FMW A;  4CO5 A;  1N0U A;  4MMO A;  5E3R A;  2RDJ A;  4FKY A;  2JNJ A;  4PUO A;  4ECS A;  2ALY B;  1UFK A;  3AOD A;  1Z1Z A;  1L5U A;  3CJK B;  2OUG A;  4IG3 A;  5DG8 A;  4ED8 A;  3CXC R;  5G4D A;  4JI4 J;  3IBC B;  1FKP B;  1RWW B;  3BZQ A;  3HF5 A;  1S1V B;  1TR0 A;  3W9J A;  2X51 A;  3DDI A;  2MKJ A;  4YR2 A;  1JLG A;  1UEK A;  4O4G A;  2KM8 C;  3HHL D;  4HHJ A;  2ZNY A;  1IKX B;  1RAE B;  1ZAW A;  7FD1 A;  1OWX A;  3KLG B;  5J2N A;  3FZB A;  4B3S F;  2DH8 A;  4KFB B;  3U1N A;  2VAS A;  2K2P A;  3DDN A;  3LAM A;  1EX8 A;  3IR5 B;  1TL1 B;  3LP0 A;  2JLF A;  2QT7 A;  4ANC A;  1RAI B;  2VB6 A;  1LW2 B;  4CLP A;  3RB0 A;  1P9Y A;  3D5M A;  4BDP A;  1JMT A;  2V5H G;  5LXR A;  2VJU A;  1VMB A;  3RAQ A;  4TY8 B;  2N4C A;  1T3N A;  1PSD A;  3DOL A;  2Z0G A;  3W9H A;  1GT8 A;  2KT3 A;  2Y9H A;  2GA7 A;  2EKN A;  2BJ7 A;  4M5K A;  5A6W A;  3AD8 C;  1N48 A;  1HNV A;  1D8Z A;  5DDR C;  1X9S A;  1FFW B;  2V2K A;  2GVZ A;  3AT1 B;  1JLB B;  2XHW A;  4J9P A;  5LSL A;  4P2M A;  1UZH A;  1F6T A;  2X7I A;  3AB2 B;  4KHP F;  2KVQ E;  2PII A;  2HK2 A;  1N32 J;  1G2E A;  2HUR A;  2DYA A;  2Y1I A;  1K0V A;  2HWH A;  2OIH A;  4ELT A;  5EHH A;  5L1K A;  5D4N A;  1T8E A;  3HCX A;  3Q86 A;  3N9U C;  4DPO A;  3JAM U;  1N5Y B;  3EGZ A;  2VDH A;  1WG4 A;  1LWC A;  3G96 A;  1TK5 A;  2GO9 A;  3TJA A;  3OLB A;  4OZ2 A;  2CNO B;  1K73 T;  1OSC A;  2KO1 A;  3Q24 A;  2CUY A;  4OJH A;  3UI3 A;  3PXG a;  1FWL A;  3W5Y A;  2XI2 A;  2HZV A;  3CW2 C;  4DN9 A;  3ILL A;  3PR4 A;  3G6X A;  2WW4 A;  3U1L A;  4NMX A;  2CG4 A;  4A8Q A;  2HND B;  1HI8 A;  1C0T B;  3H5S A;  3HLU A;  3DCA A;  4A8O A;  1C1C A;  3W2V B;  5KTQ A;  2IVM A;  4IG0 A;  9RUB A;  3N6N A;  4LF4 F;  2D74 B;  2N7C A;  4ED4 A;  5A2Q U;  1WJ9 A;  2ZM6 F;  1NEE A;  2ASY A;  2RHQ B;  1F3V A;  1NDK A;  1QTN B;  5E33 A;  1NK0 A;  3D68 A;  3MM5 A;  3QLH B;  5JJB A;  2YWW A;  5K8P A;  2IYG A;  4CH0 S;  2LEB A;  3PW4 A;  1AA1 B;  1WHY A;  4LRD A;  4I7F B;  5HLF A;  1XMB A;  1VQO S;  1J5E F;  1TV6 A;  2DGV A;  5D4P A;  2CPY A;  3QGG A;  1S72 S;  4MKA A;  2PFF B;  2ALZ A;  2BM0 A;  2DGO A;  2B9W A;  2BE2 A;  1CQM A;  2OEL A;  2WCX A;  3BR8 A;  1S6Q A;  3N28 A;  4WFY A;  2CQ1 A;  2CPH A;  2G2Z A;  3DXB A;  2QA4 S;  1NM2 A;  3R27 A;  2EW9 A;  3NNC A;  1SC1 B;  1TKX B;  3AJ1 A;  4ECR A;  2HVI A;  4DSK A;  5L1L A;  4C3L A;  3T6B A;  4K4W A;  2UUB J;  4IQM A;  3KJN B;  1YBA A;  3W2W A;  4K59 A;  2DNO A;  4P2F A;  2V34 A;  1OSD A;  1OYD A;  3FEX B;  1SCJ B;  4LRB A;  3SDE B;  2PA3 A;  3QRP A;  2ACM A;  3GU0 A;  3HHD A;  3Q83 A;  1WEX A;  2R7R A;  4HKQ A;  1FJ7 A;  3CJT A;  1NJX A;  3QJP A;  5B7W A;  1IKY B;  3JYT A;  1IR1 A;  2BUN A;  5A8W B;  4HTJ A;  5EWE A;  1MW7 A;  1UET A;  2E9T A;  2IIH A;  5GVQ A;  3THT A;  2XYH B;  3IS9 B;  3P8B B;  2GHP A;  1XTZ A;  2PDA A;  1U1Q A;  4DQQ A;  2YKO A;  5KFQ A;  3N5B A;  3HDS A;  1YZ6 A;  1W7W A;  2G0J A;  2Q1L A;  2W7O A;  3VQS A;  2DEI A;  2CJY B;  3PG9 A;  1FNX H;  3IP0 A;  2R8J A;  2R7O A;  2DNN A;  4P52 A;  4N7T A;  2N7Y A;  4FNI A;  1KNZ A;  3OFE A;  3Q8Q B;  3OJS A;  4H4K C;  5IQ6 A;  2RU3 A;  4TU9 A;  4DL5 A;  2BKN A;  4MFB B;  5T41 A;  2UXD F;  1HD1 A;  2YBV A;  3MUT P;  2OAU A;  1CJT B;  1YZ7 A;  1X4G A;  4WE1 B;  4LVO P;  4XIU A;  4B3M J;  1WC0 A;  3K5N A;  4DQI A;  1WEL A;  2DY1 A;  3N6L A;  1OO0 B;  4CZC A;  1F5A A;  2GMH A;  3MFI A;  3KK2 B;  3ITH B;  3MDF A;  4DL0 C;  2ZH8 A;  1Y5L B;  2CNK B;  4AQY F;  1LFP A;  2CJQ A;  4IO1 A;  3BDP A;  3VGV A;  3ETO A;  1HNW J;  5ETL A;  1JLB A;  1RBL A;  3CB4 A;  1V5I B;  2JL9 A;  1AB8 A;  4FYY B;  2WB1 D;  3BM7 A;  4KGX B;  2EKY A;  4RBV A;  5E41 A;  1SJ3 P;  4LIR A;  1H98 A;  1VK8 A;  1VRT A;  2ZIT A;  2J7K A;  3F41 A;  4EFA C;  2UUB F;  4IH7 A;  3MR5 A;  3G86 A;  2CZ9 A;  2HHH F;  3D9B A;  2W24 A;  4C97 A;  3RBD A;  4L73 A;  1FRH A;  3AXM A;  3UVJ B;  2HFZ A;  4QWA A;  2VBX A;  2MQN A;  3BH6 B;  3EE3 A;  1VBZ A;  1M5V C;  3EVM A;  1KWM A;  2HHV A;  3RBZ A;  3QYY A;  1GK8 A;  1R8H A;  1X4D A;  4RBT A;  1U2C A;  3FFI A;  3MPV A;  1YDL A;  3GP9 A;  4WE1 A;  5HMZ A;  3KLG A;  2J8S A;  2JVO A;  1VQ8 S;  3TQE A;  4DV7 F;  4DX8 H;  2QA2 A;  1N8R T;  1HBU A;  4DFK A;  1OIA A;  2HQI A;  4OHX A;  4V19 J;  4HH0 A;  2HQG A;  1V3Z A;  3DRY A;  4JI0 F;  1WOR A;  4CP5 A;  2VHG A;  4JV0 A;  3HFZ B;  3HVA A;  3N4W A;  1S9F A;  3ZZP A;  2DR5 A;  3BGR B;  5SUH A;  2FJA B;  1N32 F;  3A1Y G;  3LQV A;  2CPF A;  5I42 A;  2FVC A;  3BBB A;  3M32 A;  4YN3 B;  2IY5 B;  5C25 A;  3VWS A;  3OTO J;  3QJL A;  2Z2M A;  5IXU A;  3D7S B;  1X9W A;  4IUF A;  2XMW A;  3MOZ A;  4AQY J;  4OIX A;  5B0E A;  1JJC B;  1WKL A;  4U95 A;  4LF8 J;  2X3D A;  4RBU A;  4EYH B;  1NBE B;  2F9D A;  3GZ7 A;  4CM0 A;  5J1N A;  3G6Y A;  1QAI A;  2AYG A;  4AXI A;  3EPI A;  1PC5 A;  2FD2 A;  2I9S A;  4A8F A;  5L9N A;  1X4F A;  3HFK A;  2M3D A;  3AFG A;  5DZ6 A;  3S1T A;  1NSK L;  1HI0 P;  4C98 A;  3AB4 B;  3D3C J;  4BHQ A;  3LWM A;  3PKY A;  3LH2 S;  4TYA A;  5HVF A;  2GMJ A;  3KK1 B;  3R8Y A;  3CMA S;  1F3F A;  1JLA A;  3I9Z A;  4MJK A;  2DXD A;  3BB5 A;  4PXE A;  4F04 B;  1NJY A;  3NBP A;  1JXL A;  2PI4 A;  4FP9 A;  4JI6 F;  1ROF A;  1S4F A;  1HNX J;  3SDE A;  2V4J B;  3C8Y A;  2E9Z A;  5FD1 A;  1SL0 A;  1SIW B;  1T9T A;  1RYS A;  3M2R A;  1XMO F;  1KVK A;  2N4D A;  2XEX A;  3W2W B;  1MG7 A;  1K0T A;  3HSD A;  4PPD A;  3BH7 B;  2KKH A;  2ZVS A;  3ZO7 A;  3T5L A;  2VQE F;  2X1A A;  1F60 B;  1NK9 A;  4NLO A;  4RLE A;  1RT7 B;  1Q86 T;  4NPO A;  1ZZN A;  1TKX A;  1X0F A;  1HQE B;  3CD6 S;  3RB6 A;  3AD9 C;  3M8P B;  2AX1 A;  1I1G A;  2Z58 B;  5K14 A;  4CNZ A;  3C15 B;  1QSS A;  1D8Y A;  4Z37 A;  4PKD B;  4X84 A;  1FWP A;  1C0U A;  3FNN A;  4YR3 A;  3A3O B;  2B0G A;  2HS4 A;  4P74 A;  3M2V B;  1APS A;  3TJ8 A;  4WPA A;  5HRO A;  1HBM A;  2KYX A;  2I38 A;  4LIW A;  1Y00 A;  4OYI A;  4PAA A;  5G0R A;  3JSY A;  3SQG A;  1TU0 B;  2OFG X;  3GG0 A;  3L3C A;  1DRZ A;  3EZU A;  2KZM A;  3FRZ A;  2AEJ A;  3A13 A;  4CO2 A;  1MLA A;  4HH1 A;  4ZVT B;  1KFD A;  1OPI A;  2OEK A;  3IRW P;  2HRY A;  2FLO A;  2C3O A;  3A12 A;  4WKY A;  3V4I B;  3LO3 A;  3FCV A;  4QR0 A;  4U8Y A;  3KLE B;  3QT8 A;  3BYP A;  4YB5 A;  5LXY A;  5K8N A;  4ZIT A;  2EXU A;  1TL7 A;  3R5J B;  4DSJ A;  3POT B;  1HA1 A;  3TO8 A;  1QAJ A;  1GMW A;  2FC8 A;  2VPX B;  2W4C A;  1N36 J;  1C0T A;  3FUY A;  3TA2 A;  4O44 B;  2MY7 A;  3MPU B;  2GVZ B;  2WVC A;  3CNQ P;  3KDO A;  4XDD A;  4ED1 A;  3GYX B;  2R2U A;  3L09 A;  1FT8 A;  4HR2 A;  1ZZF A;  1RUS A;  3X1L B;  3QIP B;  3HHK A;  4MYU A;  4H4O B;  3NCP A;  2OPR A;  4AXJ A;  5DET A;  3MM6 A;  4CNY A;  4B3M F;  2YKN A;  5IT9 U;  2VL1 A;  3EM1 A;  4DXL A;  1CUL A;  4MKV A;  4UT4 A;  1P6T A;  3QT5 A;  2MHN A;  2B4P A;  2HFS A;  4ICL A;  4JBC A;  4C2M A;  4ED0 A;  3SCL E;  3UCZ P;  3GTY X;  2W9B B;  4ANE A;  3G82 A;  1S1T A;  2CPD A;  2EK1 A;  4RW6 A;  1RU2 A;  3KYL A;  1GQE A;  1NHU A;  2DIT A;  3M05 A;  3OSP A;  5ADZ A;  2F8M A;  5KFF A;  5DGB A;  5MLC V;  1U7L A;  3EZ5 A;  2VPW B;  4NRT A;  5CYM B;  4OHV A;  2MY8 A;  3M8Z A;  3PX0 A;  1UEV A;  5LL6 d;  4YS2 A;  1RZM A;  2DGX A;  3GIM A;  3UWT A;  1NH7 A;  4RR5 A;  3DHW C;  2WK4 A;  4U7U D;  3KHH A;  4CLL A;  2V50 A;  1SBR A;  1Y9O A;  3BO3 A;  4F4Z A;  3TZY A;  4D3G A;  4NLR A;  3CED A;  3H5X A;  5A0Y B;  3MM8 B;  2FVR A;  3BS9 A;  3FDS A;  2ZUG A;  4CO4 A;  1S79 A;  1UEU A;  4LF9 F;  3MI7 X;  3OFH A;  3NY0 A;  2A10 A;  3DOK A;  5DQG A;  2PFD A;  4RO0 A;  4MFB A;  4O4G B;  1P27 B;  1JLG B;  3P96 A;  2BAN B;  3BO2 A;  1UVM A;  3QFW A;  1FXR A;  2P9E A;  2FVS A;  2CDQ A;  1FKP A;  3I9V 9;  3HKW A;  2XMT A;  3MHY A;  4G6V B;  1UVI A;  4O0I A;  1R43 A;  2AWZ A;  4OHW A;  5GAG I;  1JXE A;  3R3T A;  3HHN B;  4HI2 A;  4RNM A;  4WZM A;  3JQM A;  1FDA A;  2JC0 A;  3BBC A;  8AT1 B;  2BAB A;  2I5J B;  1JLE B;  3OTO F;  3PIO Q;  3SFG A;  5DS7 A;  1Q8B A;  3RJM B;  4A48 A;  5F8L A;  2M70 A;  3PYF A;  1RT2 A;  3SCJ E;  5HP1 A;  3M8R A;  4EUV A;  4ZP8 A;  5A6P A;  1U25 A;  3U27 A;  1VBK A;  2ZM6 J;  1U47 A;  4DV5 J;  3R1L A;  4CLS A;  3K7R A;  2EG2 A;  1J27 A;  4DX6 A;  4ICL B;  4JI8 J;  3MMJ A;  2OSQ A;  2GHW A;  3MTK A;  4RW8 A;  4Y34 A;  5K5M A;  2X1F A;  2V69 A;  3KJQ B;  3DRX A;  2VDI A;  1RGV A;  3DLJ A;  1DJ0 A;  4WTY A;  2Z2L A;  2L9D A;  3MAA A;  4BBY A;  3VVU A;  3M1V B;  3PDN A;  3P5B P;  1DTQ B;  2R2S A;  2MQL A;  4IH6 A;  2J9D E;  2W9C A;  4G3I A;  2JLE A;  3W63 A;  4ZIW A;  4EZ6 A;  3C46 A;  3QZ8 A;  4EBE A;  3POT A;  1BXN A;  2E7V A;  5LMU F;  2MGZ A;  2KFN A;  4YHH J;  4LQ3 A;  1B0V A;  2GZO A;  1IBK J;  1K8A T;  1VFJ A;  2CZV C;  3FEZ A;  5KFP A;  4WFA Q;  4LR9 A;  3GJQ B;  4RW9 A;  2KL8 A;  3GMG A;  1EJ7 L;  2BE9 B;  2HZA A;  2W2N P;  2W1B A;  1G7C B;  3LUY A;  3SSQ A;  5AE1 A;  4KKO B;  2WZ1 A;  2BXJ A;  3ZZR A;  5F8G A;  3V6J A;  4YQW A;  4IRD A;  1T03 B;  4F4A A;  1X4B A;  3UW1 A;  4Y28 C;  1GXL A;  3I4P A;  4I56 A;  3HZG A;  2RJZ A;  1RTH A;  2RQ4 A;  1YGY A;  2V0N A;  1AZS B;  1IKV B;  2O1P A;  2WW8 A;  3I56 S;  1HMV A;  1LWX A;  4R25 A;  2J6U A;  1KVJ A;  1T94 A;  1KRP A;  1NJZ A;  2OO4 A;  2UP1 A;  2DVI A;  4X64 J;  4ZPT R;  4UY8 T;  1BC6 A;  3NS6 A;  1UW4 A;  1CC7 A;  4DV5 F;  4C8M A;  2POK A;  2WVE A;  3BKT A;  3PTW A;  2F7V A;  4LBH A;  3SEO A;  3NS7 B;  3OUY B;  2UUA J;  3KG4 A;  4B9V A;  2RDI A;  1Y3K A;  2OKQ A;  3GJT B;  1C4A A;  4RNH A;  3K59 A;  2VON A;  3G2X A;  1VLY A;  1RJJ A;  4NZ7 A;  4WWS A;  5AT1 B;  4BC7 A;  3CCQ S;  2ZBC A;  3HPO A;  1KQG B;  4Q0B B;  4C48 A;  3W65 A;  4GC7 A;  1VQL S;  1ZS6 A;  3DLG B;  3EUN A;  5H9F K;  5D4L A;  2YWH A;  3CDW A;  3US5 A;  4Y0F A;  2I0X A;  3CUN A;  2DNZ A;  4B9M A;  2QEX S;  4USH A;  2VA2 A;  2P6S A;  3PYG A;  3V6D B;  1TTH B;  3Q8V A;  5J1E A;  1KTQ A;  4M5L A;  1ZTT A;  2UV8 A;  1AFJ A;  2OJ3 A;  4U67 Q;  2EBG A;  2FIU A;  1JLE A;  1WF2 A;  2BX6 A;  5IV4 A;  1YLX A;  4TNO A;  1YJ9 S;  5DRK A;  4Q43 A;  3O6Q A;  2Y1L B;  4UUX A;  1H6K X;  1DZ5 A;  4ZVR B;  1CBK A;  4ED3 A;  3RB3 A;  4FPI A;  2JEG A;  2HWT A;  4WP8 A;  3HMJ G;  1H0H B;  4JOU A;  2R7V A;  4Q45 A;  4FYV B;  5E7O B;  4OZ1 A;  4FXD A;  1KKH A;  2DNK A;  5EN1 A;  2LXF A;  3EDQ B;  5E3Q A;  2MLX A;  4DV1 J;  2A2D A;  3T9Z A;  1M1H A;  3DI6 B;  4C8O A;  3V5R A;  2DNQ A;  3CDA A;  2ACY A;  2DIV A;  1HIY A;  1PYO B;  2KYZ A;  5D78 A;  4C0B A;  1PO6 A;  1AW0 A;  2A18 A;  3TYT A;  3UD4 P;  4A47 A;  3GYN A;  1FJC A;  2BAC A;  1U6F A;  4O3N A;  1S97 A;  3QSI A;  1SL1 A;  2M8D B;  1OYE A;  4URS A;  2BEF A;  4ECT A;  2RD5 C;  5HJY A;  3H4D A;  3V4M A;  2Y1R I;  4ELU A;  4DR1 J;  4LFC F;  2CQ2 A;  2B56 A;  1X31 C;  4YUD A;  3KJV A;  4DV7 J;  1X5P A;  3DKD A;  4KGZ B;  2B6A A;  3T5K A;  1U6B A;  2ZOG A;  1UCN A;  4Q2L A;  3KXD A;  3IR7 B;  3DHX A;  3FCW A;  2J9D A;  2MQ8 A;  1MRO A;  2DH9 A;  1WTB A;  3OT9 A;  1XNR J;  4NXN F;  3VCD A;  2ZD1 A;  5LT5 A;  2OPQ A;  5IM0 A;  1RAF B;  4KJI A;  2VF3 A;  5L8R C;  1I6J A;  2KFZ A;  3SV4 A;  5DG7 A;  2ATC B;  2CPX A;  3TZW A;  1U4B A;  1LQ9 A;  4M8L A;  1OY8 A;  2YNG B;  4NLW A;  6FD1 A;  2AV5 A;  1QVG R;  1JKH B;  4W90 B;  1AUS L;  4M5D B;  1BGX T;  2HWI A;  5EWG A;  1CC8 A;  4PXD A;  3M4X A;  1UVN A;  3J7A 1;  3PYD A;  2FJX A;  2M9K A;  2ZJR Q;  2DJW A;  3DM2 A;  5CYQ B;  4OZJ A;  3DLK B;  4H4O A;  2W4D A;  3NEK A;  3E2E A;  2IAJ B;  2QLX A;  4OYP A;  3RRK A;  4K0K J;  1ZAV A;  3K57 A;  3BSN A;  2RRN A;  2HLT A;  3NWR A;  2AJF E;  1TVR A;  1HBO A;  3KTQ A;  4DV6 J;  1N5T A;  4X65 J;  3V6D A;  2CQP A;  3AY0 A;  1Q4R A;  2B7B B;  4KE5 A;  2GAG C;  2HHP A;  3D6H B;  4S0M A;  5CH7 B;  5HAO A;  4RUA A;  1TL7 B;  1U8S A;  4ED2 A;  4CT8 A;  2QFI A;  2M5Y A;  4JI6 J;  4TU7 A;  5KT7 A;  2ZZT A;  4CLK A;  2FJW A;  2QG9 B;  2RIL A;  3TA0 A;  3GQC A;  4USM A;  2F40 A;  3NL0 A;  5ETK A;  3FSX A;  1YSJ A;  5H9E J;  3H0P A;  4ES2 A;  4M5N A;  4OZL A;  1H74 A;  2B4V A;  2GML A;  4ID5 B;  1KHV A;  5LSR A;  4LRA A;  2J9C A;  2DCU B;  3BQ1 A;  1NDL A;  1Q95 G;  1HBM B;  4RNN A;  1WSV A;  5IT4 A;  4J9L A;  2LDI A;  3D4J A;  1BWE A;  1WHX A;  4M63 A;  2VG5 A;  3C16 A;  5LMU J;  2AZ1 A;  2WVF A;  1DFD A;  3SSS A;  2YWG A;  1DLO A;  5KG0 A;  1IBK F;  4UQG A;  2QC3 A;  2GJF A;  2CXE A;  4DG1 B;  4LSN B;  1FNO A;  3B54 A;  3IWX A;  2DR9 A;  1S77 D;  1T0T V;  1VQ4 S;  4F4K A;  4LT6 A;  1S1W B;  1BQN B;  2HFN A;  3R5A A;  4R0E A;  1BY9 A;  2LYV A;  3PR5 B;  4EBC A;  4P10 A;  2FJV A;  2UU9 J;  1F2H A;  3BJY A;  4ZJO A;  2CQH A;  3FVY A;  4NCG B;  2DIS A;  4LBI A;  3ZNJ 1;  1IBL J;  1LKZ A;  4OZ0 A;  5HK4 A;  4DV6 F;  5DLF A;  4DL6 A;  1KVI A;  1I51 B;  1UWB B;  2XNQ A;  1PIE A;  3NBP B;  4EO8 A;  1T11 A;  3D54 A;  1IR2 A;  1RAC B;  1VQM S;  1VQK S;  1REV A;  2KXF A;  1W2B R;  1QSL A;  3H2U B;  2RML A;  3PFE A;  3CC2 S;  1K44 A;  2NPF A;  5KOX A;  1NK5 A;  2DXF A;  1RXO B;  1IM6 A;  1H3D A;  2FB0 A;  4J9S A;  4IOC Q;  3PX4 A;  2DNM A;  1KS2 A;  3DLB A;  5BR8 J;  3R7S B;  2XS7 A;  3PO5 A;  2XMM A;  1JJ2 R;  2OFH X;  1NUE A;  4IRK A;  1CPZ A;  5KFD A;  2D41 A;  2Z57 B;  3PO4 A;  2EFO A;  2CKW A;  4F0H A;  3EPG A;  5CCL A;  3KJF B;  1N33 F;  1UKU A;  1FVQ A;  2CQB A;  4XPE A;  1YHQ S;  3QT6 A;  2E1M C;  2V6A A;  2R3V A;  4Q8E A;  2YQ1 A;  4KSE B;  5C24 A;  3MGJ A;  1JLA B;  1PBA A;  2ZC4 A;  4OYX A;  2UUC F;  1RWX B;  1BWV A;  3K8V A;  2CVI A;  4LBP A;  5T7L A;  1ZET A;  2E9R X;  2QE5 A;  1EQ0 A;  3MMC B;  4N47 A;  4RUC A;  2N82 B;  2ASL A;  2AJ2 A;  3WZ0 A;  1NCL A;  1HR0 F;  1RAJ A;  1T9W A;  4WP9 A;  3K58 A;  4GC6 A;  1PJ7 A;  3UCG A;  4C11 B;  5I3Q A;  3D67 A;  1XK8 A;  2GHV C;  4U7U K;  2H5J B;  3RG6 A;  2DD8 S;  3M8S A;  3SV3 A;  2VG7 B;  1D0E A;  4CO3 A;  3QNW B;  2HAI A;  3HVT A;  1TK0 A;  3MED A;  3QPI A;  1H72 C;  5FII A;  1EQM A;  1HNX F;  2AF6 A;  1PJ5 A;  1U0H B;  3I4H X;  4G1Q B;  4Y65 A;  4BCA A;  5GAD I;  2ERR A;  5B0B A;  4LFC J;  4ZLN A;  4MT1 A;  1S1X A;  4DR6 J;  2AGP A;  3CF5 Q;  1MML A;  1Z4U A;  2YX1 A;  1M1K T;  3R5D A;  4WBF A;  2AX0 A;  3KHL A;  4MIB A;  4W4M A;  5KFY A;  1VGY A;  1A6L A;  2LEC A;  1D9A A;  2Z2Z A; 
#chains in the Genus database with same CATH homology
 3MAA A;  5D0R A;  3MAA B;  4OYP A;  1FX2 A;  2GVD A;  3C15 B;  3R5G A;  1CJV A;  1TL7 B;  5D0H A;  4WP3 A;  4WPA A;  4CLT A;  3UVJ A;  1CS4 B;  4P2X A;  4CLK A;  4OYI A;  2WZ1 A;  4OYO A;  4CLU A;  4OYB A;  3G82 B;  1CJT B;  1WC5 A;  1WC0 A;  1AZS B;  1YBT A;  3C14 A;  3C16 A;  1TL7 A;  4CLP A;  1CJV B;  1YK9 A;  2GVD B;  2GVZ B;  1FX4 A;  1CUL B;  4NI2 A;  1AB8 A;  4USU A;  4OYA A;  4USW A;  1YBU A;  1CJK A;  1CJK B;  4OYZ A;  1U0H A;  1WC1 A;  1Y11 A;  3UVJ B;  2GVZ A;  1CUL A;  4NI2 B;  2W01 A;  2BW7 A;  4P2M A;  3ET6 A;  4CM2 A;  3G82 A;  5D0G A;  1AZS A;  3C14 B;  3C16 B;  4OYW A;  1Y10 A;  5IV4 A;  4OZ2 A;  4OZ3 A;  3C15 A;  1CJU B;  4CLW A;  4WP8 A;  4CLL A;  3MR7 A;  4USV A;  4OYX A;  4CLY A;  4CM0 A;  4WP9 A;  1CJU A;  5D0E A;  4CLZ A;  1WC3 A;  5IV3 A;  2QV6 A;  1WC6 A;  5D15 A;  3ET6 B;  1CS4 A;  1U0H B;  4CLS A;  1CJT A;  4UST A;  4CLF A;  1WC4 A;  4OYM A;  4P2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...