3UVJB

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVCDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYSLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanylate cyclase soluble subunit alpha-3
publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 54
structure length 196
sequence length 196
chains with identical sequence D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjB00
4CLZA 1CS4B 4WP3A 4CLWA 5D0GA 1AZSB 1YBTA 4WP8A 1AB8A 1CJTA 5D0RA 3ET6A 1YK9A 3UVJB 5D0HA 4CLLA 1WC1A 1CJKB 5D15A 4OYZA 1U0HB 4OYWA 4CLKA 2QV6A 4USUA 4CLPA 2BW7A 4WPAA 3C16A 3C15A 4WP9A 4OYBA 2GVZA 4P2FA 1Y10A 2WZ1A 4CLUA 3ET6B 4P2MA 2GVDA 5IV3A 1Y11A 4USWA 4NI2A 1CULA 1CJUB 4OZ3A 3G82A 3C14A 3R5GA 4CLYA 4OYMA 1TL7A 4USVA 3MAAA 4CLSA 3C16B 3C15B 1CJVA 2GVZB 1CS4A 4OYXA 1CJTB 4OYPA 4OYOA 1WC3A 4OYIA 2W01A 1AZSA 4P2XA 4CM2A 1WC0A 2GVDB 4CM0A 4USTA 4OYAA 3MR7A 3UVJA 1FX4A 1WC6A 5IV4A 4NI2B 4CLTA 1CJKA 1CULB 1U0HA 3G82B 3C14B 4CLFA 1FX2A 4OZ2A 1TL7B 1YBUA 3MAAB 5D0EA 1WC4A 1CJVB 1WC5A 1CJUA
chains in the Genus database with same CATH superfamily
3PV8A 4TQSA 2RILA 5AE1A 3P4UB 2B6AB 4DQPA 1LW0A 3M8ZA 1KTQA 4J9OA 3RAXA 3MURP 2GZOA 4OZ0A 4LFCJ 4UTGA 5EWGA 5L1LA 4LVOP 4HDHA 2PA3A 4MFBA 4NLXA 4X66J 1U7LA 1IKVA 1WF1A 3F41A 3CCJS 4CNYA 2BJ9A 1Y3JA 2KVIA 3S7RA 2HVHA 1N8RT 4KGMA 3BGRA 1N34F 2HHXA 1BQNB 3PO4A 1SC4B 2M2BA 1S1TA 5A8RB 2E1MC 3WHIA 5ADZA 3TAMA 4F7VA 3K58A 5D3GA 3H4DA 2MQQA 1L3KA 4LQ9A 3DYAA 2LU2A 2QYCA 3QNWB 3MR7A 1K0VA 4ANDA 1YSJA 5BJRA 1LWCB 4OV6A 4GVBB 1N88A 1VJWA 3N6LA 5SZTA 2QSWA 3QT7A 2G2YA 1X9WA 4IFVB 3KWMA 5E3RA 4O3NA 3BN4A 4TLRA 5HATA 3C6UA 2VPYB 2J6SA 1HWKA 4NLYA 5ETMA 2PEBA 3AXKA 1LEOA 4Y2KA 3CCRS 4TVAB 2W8KA 1U1PA 1XIQA 2H4WB 2ZKUA 1S59A 4X4VA 4FNIA 4N56A 2YH1A 2VDIA 4KC5A 1NPKA 3HHEA 1SI9A 1NK5A 4OZ5A 1FVQA 3Q8RB 1Y11A 2I38A 2YKNA 3I82A 4M5GA 2CJYB 3RBEA 3N79A 2BJ7A 4C98A 3CDEA 3TX0A 5F0WA 1T95A 3PW4A 4M5KA 2N7CA 2ROGA 2CWKA 3H25A 4KY3A 3UO0A 1KN6A 4DSKA 4DX6A 1YRUA 1LQ9A 1R3NA 2M8DB 3LUYA 2EC2A 1ZPVA 3TEGA 2HHHF 2HQ3A 1X0FA 4W98A 1IM6A 1NPPA 3OSPA 2MGZA 3AOBA 4FXVA 1QUPA 2FHMA 2V9KA 4IDKA 1C1BA 2Z2LA 3DGVA 1VHFA 1VC0A 5LT5A 3QRQA 1MN7A 4KH1B 4OJGA 3RAQA 3PDNA 1JX4A 7FD1A 3VGUA 3NGUA 2ZNYA 3CDUA 1XC9A 3HULA 1IBLJ 1FE4A 4JI6F 5T7LA 1FKAF 1BE4A 2RQMA 1Y9OA 5H9FK 2RU9A 3RAMA 4C3MA 2IBKA 1GNKA 2HMIA 1H2VZ 1I51B 2NXJA 3DRRB 2VUGA 4A47A 4IH7A 3M6UA 1T03B 4KHPF 1XNRJ 1RHKB 3VGSA 3K2YA 3GFYA 2G1DA 3SI8A 1AXQA 3TP2A 4NYOA 1PBAA 4UQTA 4P10A 1T8EA 1CJUA 3DOLA 4P74A 2G0CA 2ROPA 3VZIA 1N6QA 1ROFA 3T19A 1KP6A 4EGLA 4OIXA 1H7XA 4BDPA 5GAEU 2E1RA 4KGXB 4PXBA 1MMLA 3GCXP 3FQKA 2CQ3A 3T3FA 4EZ6A 3MEDB 5D77A 4PAAA 2H1YA 3HP6A 3BQ1A 4ETXA 1KOOA 4L3KA 4RX6A 3FK4A 2MHEA 1H72C 1UJ4A 2X1GA 3LAMA 4KBIA 1TKXB 5KFCA 3BR9A 2LQ8A 3JTPA 3KYLA 3CCSS 5M2PA 1NMEB 5ETKA 1WACA 1UVMA 4J9KA 1WEXA 5F9NA 1LWEB 3KJVB 1SVDA 2F1FA 1VRUA 4LBHA 1LFPA 1FDBA 3R8YA 4RNMA 4B9SA 4YS2A 1ZZFA 1E6VA 4O3SA 3EWGA 4XPEA 1LKZA 3M8PA 4TU8A 1C1CA 1CVJA 1ZZNA 3HVAA 2C3UA 1PIEA 3ZZTA 5E7OB 4M95A 3GIJA 3TAPA 2HIQA 1YK9A 5CYQA 1YJUA 3KLHB 1N32F 1RB0A 3Q22A 2Y1IA 1GTHA 2XY5A 1VCTA 1UVIA 4P72A 5IXUA 2B7BB 2DCLA 2EBEA 4I6YA 2KHCA 2W1BA 1URNA 4Z7YA 2WW4A 2IM1A 2LCWA 3MOZA 3OVAA 2CDRB 2DHAA 2I5JB 3DLEA 4TN2A 5F3ZA 2PI5A 3M2VA 3HF5A 3TWZA 4PG8A 3BREA 3R7SB 1KBRA 3ISZA 3L9ZA 4EBDA 4WFZA 3MMCA 4X2BA 1X7VA 2F8MA 4QU6A 4I68A 4QBUA 2VFVA 4LF8J 4DL4A 2ASJA 4PZVA 3H2LA 3KDOA 1NU4A 1FWKA 1IKXB 4KH0B 1T0TV 3W61A 2UUTA 4YB1P 4WYWA 4NLDA 4QYZJ 1XMOF 2DY9A 1KHWA 4B9TA 1RTJB 3EDQB 1WKKA 1A9NB 4DSJA 3BZQA 2KT2A 2CPJA 1U8WA 3ZZYA 2Y8YA 2CQGA 2DB1A 1Q7LB 2UU9J 4TKTA 3Q8PB 1HIYA 1ZBTA 2E44A 3PJWA 1PYSB 2NSBA 2RAQA 3AFGA 2O01C 2D3O1 2GIFA 4OLOA 1VQOS 3BO4A 3HXMA 4C0OC 1EQ0A 1CC8A 3MEEA 1U24A 2E1AA 1EP4A 5KFPA 1EX8A 1N36J 3FRYA 2LQ9A 4O4GB 5F41A 3MMJA 3D68A 5DJBA 3MFIA 2DGOA 3CCVS 2J7KA 4DPTA 2YNIB 2F40A 1FJ7A 1CS4B 5E0OA 5IQQA 2LA4A 3QT5A 4ECXA 4LRFA 3UWTA 1VBZA 3D6FB 3OR1A 5HLFB 3LP2A 1QSSA 4B17A 3CJKA 4KR0B 3SV3A 1QLNA 4I64A 4CLPA 3P5BP 2GIRA 3LANA 3C15A 1SIWB 3SCJE 3M05A 5CYMB 2BZ2A 4TYAA 4XO0A 1JJHA 4A8XA 3GSIA 1X5TA 4RZRA 2C2OB 1S49A 3KLFA 3NGKA 2WCXA 4K2JA 4GO5X 5I3UA 3AD7C 4LF5F 2G4BA 4DR5J 1S9EB 4DZ6A 3SV4A 3NAIA 2UV8A 2M9KA 1S10A 5LL6d 1Q82T 4IH5A 1JLBB 3U1LA 5FLXU 4QWEA 3JSYA 2HYIB 4B3OA 2X7IA 2BX6A 2OO4A 3A12A 4LF9F 1ZM4A 2E66A 3LGMA 3LP1A 1YBTA 3UR3C 3VAKA 2E29A 2KJVA 3NGTA 2YX4A 4ES1A 2BE2A 2IAJA 4CQ1A 1CQNA 4ID8A 3GFHA 1VOMA 1JLQA 3UDLA 1KHVA 4I6WA 2W4PA 4M94A 3CVKA 5RUBA 4U96A 2ZD1A 1XEZA 4HYKA 3ET6B 3W62A 1RWNB 4UT4A 3GIIA 3KLEA 2GQCA 1U1RA 3BGUA 1X9SA 5HROB 2Q6BA 3NWRA 5KFGA 2RNEA 3RG6A 4U7CA 1EETA 2XS5A 2ASYA 3MR5A 5EGYA 4DV3J 3N28A 3RJMB 2W01A 4L6V3 2B4PA 1UFLA 1GT8A 5B0BA 1IJEB 1WHVA 4OJHA 1JJCB 5M2RA 2MJNA 1VLOA 4HVZA 4AYBD 3KK2A 3BH6B 2BOAA 4KFBA 1RWVB 3MTKA 3W8GA 4PPDA 4DQRA 1VQLS 1X4DA 3PIOQ 2YBVA 1NHKL 3W1YC 4ED0A 2GJ2A 3C46A 5DZ6A 1FXRA 3CJ4A 4DV7J 1HR0J 4RU2A 3ZC4A 2OLWA 3HFVA 2HFSA 2RS2A 3L7UA 1NJZA 1XK8A 6FD1A 4GO7X 3IM9A 2UUBF 4UQGA 3H90A 2D3OR 3MM8A 2XMWA 1UJ6A 4M1KA 2XC9A 3SZ2A 5AJ3J 1RHMB 3QIPB 3IS9B 3CJ5A 3HK2A 3CIMA 2XYGB 2JL9A 5JMNA 2VIHA 5HVGA 2QMWA 2HKEA 2H5JB 4IG0A 3W9HA 4C9DA 2ZM6F 2N4CA 4PXDA 3ISND 2OD6A 2X3GA 2OSQA 4ECTA 4ZVRB 1REGX 2Z2MA 4CM2A 2MKJA 1R0AA 2VONA 3ZZZA 2XEXA 1HBUB 4B9MA 2FC8A 2HNZA 3B54A 2VG6B 2RHSB 4OX6A 3J80Y 3G87A 4J9VA 4W92B 1YHQS 5CH7B 2LMIA 4LRDA 1FK9A 5HMYA 5BR8F 3A3NB 3B78A 3MOJB 1RU1A 2V69A 2FLPA 3GFXA 1NKBA 2XMJA 4QCLA 3O6QA 1N5TA 2MZRA 2RE1A 2AYMA 4RNHA 4RW7A 4PWDA 4KGKA 3GYNA 3PYFA 1Q7YT 4LF4F 4DFKA 3UN2A 4O4RA 5KFXA 1M1GA 4Y65A 4P2MA 3Q86A 4AE5A 1FFWB 4IOBA 3ELHA 4PRFA 2IVFB 2XNRA 3C14A 2RQ4A 5DGAA 2HIYA 2JEGA 5JVHQ 2XYPB 1MU2B 3PR5B 3FKBA 3P5TL 1VQ6S 3ITHB 1I1GA 4R8UA 1EKSA 2CG4A 3TOQA 1WD6A 1S0OA 3PR4A 2XO6A 4JOUA 3Q8QB 1X4AA 5C42A 1EAYC 2YQ0A 1HBNA 3FEYB 4DV6F 5IV4A 3TARA 4I2QB 1T9WA 3VV2B 5L9XA 5KG3A 1TKDA 2OUGA 2UXDJ 4RNFA 3EZOA 2RF2A 2FJWA 2YWKA 4JI7J 1NUEA 3DM2B 2O67A 1HQ2A 4NLVA 3M8QA 1IBKF 1X0PA 1XERA 3KK1A 2GA7A 2KXHA 2QJ3A 4ZPDA 4AL5A 1OIAA 4DV5F 1U09A 1Z4UA 2MLXA 3R97A 3PRVA 3P49B 2V5HG 1FI4A 4DV0F 1MNEA 2E5JA 5AE2A 3FQLA 3J7AN 4DFJA 4AT1B 4OZJA 4FS2A 1ZTWA 1VRQC 5E2QA 3OUYB 4LFAF 2KO1A 4DBQA 1FTRA 2AF6A 2LECA 3KHLA 5IZHA 3V5RA 2E5IA 4QWBA 4JI8F 4E8UA 4YFUA 4O3RA 4EEYA 2CJAA 2YWHA 5LMUF 2UUAJ 4ZVQB 2OEJA 3TJ8A 1EZZB 1TAUA 1VDHA 1Q4RA 1SKUB 5EDWA 1IJFB 2VKZG 1WWHA 3IAM9 2GAHC 1DTQB 2MLYA 3R27A 1UJ5A 1S1WB 1Q78A 1FFSB 4A8SA 1TU0B 4RBUA 2EW9A 1UFKA 1YJ7A 3GJTB 2OPPB 2DXEA 3RB3A 4C8YA 3E01A 1RT4A 1C0UA 3UE2A 3BSCA 5AXLA 1LOUA 2BJ8A 4Q2LA 2YXLA 1HYSA 1B99A 1QJHA 3UQSA 1T05A 2ILYA 4CTAA 4NXNF 2Q43A 5KG2A 2RDDA 3QRRA 4RW8B 5DGBA 4NI2B 5FDLA 3HVWA 3SCKE 4DV1J 4CDIA 5A8WA 4ZIVA 5HMWA 1R8AA 2B4VA 2DGSA 5ETRA 1YJ9S 1AFJA 4I67A 1FEHA 2J9DA 4X65F 3PO5A 3SEOA 2FJBB 3GILA 4LF7F 1FWLA 4USMA 3CMAS 5JVGQ 5DQGA 3PVXA 4ZVPB 3JQJA 2LP4A 2HHUA 2L9NA 2IM0A 3TA1A 1UTAA 2Q6CA 1JB0C 3AJ2A 3RB0A 1RLDA 4UW2A 1HFEL 2C3MA 4K0KJ 2F8HA 1HL6A 5ETVA 1XR6A 4MAKA 4K7QA 2R7SA 2V63A 1REVB 3CJ0A 2F9DA 4TNOA 2XZDB 1PO6A 3KJFB 4PWWA 3HKWA 2AEJA 5E3PA 4OHWA 4DLEA 1XBWA 4DS4A 3TQEA 2FC9A 3D3CJ 3CMQA 4ZP8A 3TUPA 1R8HA 2E5GA 4NA1A 4PG5A 1OMSA 2VG5B 2OI2A 4ZITA 1TKZA 2VOOA 4IUFA 3CC7S 2CPZA 4QW9A 2HS3A 2HFUA 2XULA 1N54B 1JLEA 2VU5A 4PWUA 5E3CA 1N52B 3DGPB 3VVUA 3GZ7A 3NCPA 1KQKA 3H20A 3RR7A 4ECVA 4U8YA 4F4YA 1ZPWX 4P2FA 3LALA 5HANA 4FYWB 3MXHP 3CD7A 5H9EJ 2ZOMA 4CO2A 5DO2A 1RBAA 1U1KA 2C1EB 1RE1B 1TKTB 3LP0A 4YY3J 3SQGB 4DSLA 4HI2A 2VBXA 2RB7A 1WJ9A 4LQ3A 1UAWA 2KRRA 2GMJA 2M52A 3D5MA 1UEVA 5MLCV 3R7BB 4OYIA 3OPKA 1SL0A 3J7A1 4Z7CA 3A3OB 1VJQA 5I3QA 4ZVOB 2J0WA 3UVJA 4KO0B 3V4IB 1J27A 2LFVA 2XI2A 2FZCB 3M32A 1QSLA 2HHPA 4B3SJ 1HHSA 1RU2A 3PW0A 1HQEB 4WP3A 2QX0A 8ATCB 3OXFA 4QIGA 3GJQB 4LSZB 2GFFA 1RWUA 4NX9A 1IBCB 2V4RA 3RZAA 1YITS 2ZZTA 2XB2D 4D3HA 4RWXA 2GHVC 4NLRA 1RWXB 4RJVA 4F4ZA 5C25B 3G6YA 1RWKB 2QIFA 3M6XA 2AU0A 1RHJB 4BS2A 1ZTTA 2RUSA 2V6AA 2EFPA 2DRDA 3BO3A 4M5MA 5A0YA 1O0PA 1VS3A 5K8PA 1T9XA 2FUG9 3UFCX 3MM9A 4USVA 1KTVA 3V2UC 4OYPA 4LF6J 2PFDA 2DR6A 3R5CA 5GAHI 4AL6A 1U25A 2W24A 4ZVFA 3J7YU 3CB4A 4G6VB 2ZH8A 3T1AA 4CLTA 1V3SA 1CJKA 4Q2MA 5IWAJ 3KDNA 2X51A 4FPIA 4ZJLA 2DNMA 3IBFB 3EVWA 3WIUA 2KM8B 1KLMA 2RHQB 3QO9B 1FHTA 3PYDA 2YKMB 1KQSR 4USIA 1UPMB 2DISA 4DWIA 3FMWA 3DLGB 3SQOP 1QE1B 3VGVA 4TU9A 3TAMB 2XS2A 4QR0A 1XN9A 2W9BA 4WIQA 3LAKA 4RL1A 1KVIA 3RW6A 4MIBA 1RT7A 4CT8A 3KUGA 3CCMS 3ONQA 4WK1A 2BQUA 2X3DA 1AW0A 2MKHA 2OHDA 1HPZA 4ATNA 1DY3A 4DV2J 4WZMA 1NPRA 3CULA 5KG6A 2HBRB 4C0HA 2YKOA 2K3KA 2FHJA 1AZSA 3ILOA 2HNDA 5KFYA 4NXMF 3Q8UA 3D4JA 2B56A 5KFBA 3MWBA 5D0EA 4ZHRB 2WVCA 4ZLNA 1TUVA 2WTFA 2HS0A 2YKNB 1G4CA 1NZAA 5BYSA 4F04B 1F6TA 3ZNJ1 2DR9A 3OLBA 2K06A 3K5NA 3WQPA 2RRBA 1F5CA 1IWGA 2M8HA 1O6XA 3VAJA 3CJ8A 4YR2A 1NCLA 1HMVA 1FDDA 2JVRA 2XBPA 1N0UA 2VQFJ 1YZ7A 3MHYA 3G6VA 1AUDA 1L3UA 4RUBA 5E5NA 4P52A 2CYYA 2IFXA 3MCNA 4MJKA 4F25A 2QA4G 2J9CA 2R7TA 1S48A 5KT3A 4MTPA 2E7WA 1RHRB 1TK5A 1UVKA 2V94A 5J1PA 1RLCL 2MDAA 2DIVA 4ALZA 1Z1ZA 3IRXA 2GGPB 2CA9A 2FHJD 1EB0A 2P6SA 2EBGA 1JLFB 3T5HA 1U1LA 3EVOA 3I4HX 4WTYA 1M90T 2JFKA 2CG8A 3R3TA 2KM8C 3OR2A 4A8WA 3MPUB 4PG4A 3R5AA 5T7LB 4LFCF 2BMBA 3MAHA 3R5JB 2MSSA 5J1EA 3ENVA 2MZQA 4X66F 2D3ZA 1RT1A 4ZVGA 1HWLA 3GFZA 2HFZA 3R6LB 1RQ0A 4ETZA 4XIUA 4DLGA 3DOMB 2LDIA 2B9XA 1DTTB 3GPAA 2CQBA 3MEGA 4V19J 3MR2A 5D4OA 3QJJA 1Z2ZA 1CJUB 3DOLB 2QG9B 4RLEA 5F8LA 3QAEA 3LGNA 3KG0A 1CJVA 2CQPA 3L95X 5HMZA 1WC3A 2QLXA 2BVZA 3HJFA 3NGRA 3F73A 4DR7J 1TK0A 5DQHA 4F26A 1FDAA 1RZMA 3NBPB 4IG3A 1HNIB 3LQVA 2KG1A 1S79A 3SMZA 5A2QY 1VQYA 3QWPA 2BDPA 1AT1B 4F3OA 1YBAA 2W2PP 2YX1A 3BGOP 2BJDA 4RBTA 1VK8A 1ZOTA 1U0SA 2H65B 4QQBA 3PHEA 2DNLA 4QIVA 4K8RA 1Q0NA 1JLAA 4USJC 1VC6A 1RAIB 5L1KA 3D67A 3KXDA 2ZOGA 5KG1A 5K20B 4C0BA 4LR7A 2Z30B 4Y00A 3ENAA 1UVNA 3GG0A 1HBOA 2PGCA 3BH7B 3QGPA 5L1IA 3J81U 4ZPVR 1IKYA 4FF3A 4IOAQ 3GWCA 3H40A 5ETOA 5DLGA 1FX4A 4CO5A 2R2UA 4N7TA 4OJ1A 3W2VA 1YBUA 3B8HA 3EMTA 3H98A 2LLZA 2PIIA 1VIOA 3RRKA 3KHHA 3PFOA 1N33J 1Q8IA 2QO3A 4LRCA 1XNQJ 3S6EA 2IJNA 1RWMB 1RABB 2EK6A 2J8SA 2Z0GA 2VH7A 1FT8A 2ZH5A 3FBBA 3GR1A 3D7SB 3R1HA 3K17A 3DHXA 4OJ3A 3IWLA 1SCJB 3N9UC 2RKIA 4R5PB 3H4BA 3MMCB 1IBLF 1TVRB 1IVZA 5JUMA 1WDTA 4X4RA 2WSEC 2CPXA 1YJTA 1X4CA 2ZJRQ 2DGUA 3KLIB 4ZVHA 2MQMA 5LSLA 4QWAA 3TNVA 3PTWA 3DI6A 3M7VA 3UPFA 1XNRF 3GCWP 2NUHA 2KJWA 2E5LJ 4NLSA 3I0SB 1T3OA 1WC6A 3L7OA 3QZ8A 1U0HA 3BM7A 1NDLA 5J2PA 1S9FA 4X4UA 2ZH1A 2I8EA 2NR0A 3D0HE 3KNAA 2VFRA 3KFWX 3HDSA 1HKAA 2CZVC 2DNHA 4ZVEA 2K1RB 4NLQA 2XCPA 4WU2A 4LFBJ 2V4JA 4CT9A 3R6GB 2ZBPA 3MM5B 2XSJA 3CCLS 3CCWA 3ZZRA 1XMBA 2HQIA 4M63A 1ZS6A 2ALYB 3HFKA 3M9OB 2V50A 3E2EA 2JLGA 2DH7A 4LR9A 5L46A 2ZZNA 5GAGU 1FKOB 1WTBA 4OZ3A 1KFDA 2O5DA 2LU1A 4ED2A 2QEXS 5KG7A 2VFTA 2BEFA 1YZ6A 2ASDA 2W25A 1DJ0A 3LP2B 3GTYX 1Q8LA 1S6QA 4NMLA 1URRA 4AL7A 2FJVA 3FSIA 4C8MA 4ID5A 2UVVA 3UCGA 5I42A 4C48A 2H9ZA 3ZTSA 4ILMA 3IG1A 2C2DA 3ETOA 4A8KA 3DXBA 4FVCA 2GQ2A 4URSA 5DETA 3K7RA 1TUGB 1PGZA 4TY8A 1HBMA 5HAOA 4NLOA 3X1LB 3U7JA 2BANA 4B9UA 1GH8A 5KT5A 1YKWA 1QDUB 2RDJA 4USUA 1S1XA 2IA6A 5B0FA 2ABYA 3OW2R 5GMDA 2HLUA 4ES2A 1MN9A 4B3TJ 4E0DA 3IC1A 2OFHX 4NLWA 3J7Z5 1R8CA 3D1OA 3QLHA 1VRTB 5C24B 4DUZJ 4OYMA 3JYTA 2B9YA 4HH0A 1Q8BA 1OY6A 8AT1B 2X1FA 3F44A 4WKRA 4WXOA 1RAGB 1WUUA 2K8GA 1HNXJ 3ICLA 1ZAXA 3KK3A 3PACA 3JSMB 4ZVUB 1S6PB 5DDPC 3MPDA 2AJ4A 1QTMA 2CQ2A 4KPCA 3O2IA 2M3DA 4MMOA 3TAQA 4ANCA 4LF8F 3QT6A 2PT0A 4JI4J 4ELTA 4ZP6A 4NZ0A 2ZD1B 4NLGA 4N5SA 1AA1B 2Y0SD 2HVIA 4B08A 1LK5A 2QYGA 3GIRA 1HW8A 1SXLA 2KH9A 3QFWA 1VQSA 4ZPWR 5AXNA 3T6JA 3HHLB 2C3PA 2OPSA 2D9OA 3D0IE 4PYDA 3VQTA 2AP6A 3D1QA 5DG9A 1JLGA 4DG1A 2UU9F 3BSNA 4JI5J 4HTIA 1P27B 3BBFA 5DM6Q 2XLKA 2DY1A 3C6TB 3WDOA 1J5OA 4RBVA 2YNFA 1RYSA 1TMMA 3MR6A 2HS4A 2GVZB 2QC3A 4DOZA 5IM0B 3CCUS 1IUJA 4HTJA 4G1IA 2B6AA 3NAHA 2MY8A 5KFFA 2NPIA 2IVYA 1N36F 1MWYA 3I5AA 1FA0A 4PPZA 4OLPA 3HSGA 1NSAA 2I9SA 1EARA 3KKFA 3IRWP 5J2NB 3VZHA 2JLEA 3PW5A 2P6TA 4ZP7A 2KFYA 1DAXA 4QYZK 1SH2A 2BXJA 2ZBIA 3QMQA 2W2QP 2YNHB 3MD3A 2B4UA 4MK9A 2VQEJ 5D15A 2RD5C 2QT7A 2V2KA 3QZ7A 2VASA 2WSFC 3LPEA 4CLKA 3RRHA 3MUMP 3IO1A 2DHHA 4DS5A 3R2DJ 4X84A 2UVWA 1MMNA 4EUVA 2UZAA 3PW7A 4QWCA 3UCZP 3N5FA 1F0XA 1T9VA 1RTHB 3EGZA 1P9QC 3VALA 2YVSA 1U2FA 3OL9A 5GVQA 1TL3B 3MUVP 2MKCA 1LWCA 1RT5B 4GVBA 2I6WA 2W7OA 3I31A 3PXGa 2OELA 4IRKA 2BW2A 3FFIB 4IFVA 4WFYA 5J2MB 2JRSA 3FZBA 2HRYA 1XJWB 2PSZA 3MF5A 4P75A 2R7WA 3LPYA 3NNHA 3OD2A 3SIPB 1HNZJ 2B9EA 2ZDOA 1PSDA 3PNIA 4EO8A 2DO0A 2D3UA 4AD6A 2FQQB 2DR8A 2IJRA 2KYZA 3MR3A 1Y5NB 3B6BA 4HACB 4K59A 3ZFVA 1RSCA 4CYUA 3OL7A 1S76D 4ZN3A 4LSNB 3KMQA 3FCHA 2ZE2B 1SKWA 5CQGA 4FF1A 3L3CA 1BUXA 1S9GA 1VC5A 2JX2A 2CJXB 3QFHA 2Z56B 4Y34A 4J9PA 4WYLA 1RT2B 4E2FB 5B0EA 3MCOA 5D8HB 2G2ZA 4DV3F 1RT3B 1R0CB 2ZJPQ 4PR6A 2E9ZA 3BKUA 3K8WA 4OV1A 4Q8EA 1FRJA 2C3OA 2DPIA 5BXIA 1DLOB 2DHGA 3CCQS 3T5JA 2AJQA 1CLFA 1WTFA 2J76E 1R7IA 2OEMA 4LSLB 3T1YJ 4DV7F 1HR0F 3OVBA 1RHUB 2AKWB 1AB8A 3Q8VA 4ZPTR 1BQMA 2HQFA 4PXCA 3E51A 4MYTA 3MUTP 1HI0P 2WVBA 2VKRA 5AJ3F 3FJ2A 5KOWA 2EKNA 2WBRA 3UCUP 5F3TA 4C7QA 3CJTA 1UWBB 2JEJA 3DRRA 2CQHA 3BJYA 3U02A 1T03A 4PUOB 5F8GA 1HWUA 3OT9A 3LWLA 5KFLA 3SYZA 3FGVA 2R7UA 2MQLA 4ZCIA 3TW0A 2QLFB 2AEFA 4YHHJ 3AA8A 1YX2A 3HHKA 5U47A 4BHQA 2MKYA 4NZ7A 1SL1A 4BWMA 1UW9A 4F4KA 2YY3A 3B82A 3W5XA 2CIMA 4IFYB 3CIZA 3R7NB 1IR2A 1NK6A 4ZJQA 2LXFA 4QJVA 2QA4S 2UXBJ 2A6MA 4QWDA 4X4NA 1UVJA 1UA1A 2NYIA 3MEDA 5DG8A 2KN4A 3CJ3A 2DNYA 4ANEA 2MYFA 5B0DA 3MM6B 2G0JA 4YR0A 1J5EJ 3KG1A 5F9LA 2VD3A 3SSSA 1NJYA 1TKXA 1VI7A 1O51A 2JOQA 4C97A 2CJBA 2VG7B 1MLAA 1NJIT 3CJQA 1LWEA 1T05B 1NK4A 2GO8A 4CTAB 2Y3YA 2CKWA 1GFWB 1I5OB 2ZWOA 5EN1A 2DGVA 5FDLB 5F8HA 3IGVA 3AODA 2LEAA 1X4FA 3DRSB 1SJFA 2KXFA 4JI1J 1MROB 1B0VA 1MG7A 5CAAA 4ECUA 2AZ1A 2DGWA 2QLBB 1WG1A 4H4OB 4OYAA 2WBMA 3KLHA 3FRZA 2GS8A 2J6TA 4Q0BB 5HJYA 3S8SA 2UXDF 2HZAA 4LF5J 3IMQJ 1UZHA 2FYXA 2NCKL 4JBCA 3DN9A 2BKNA 2YNGB 3PG9A 1GTEA 4JI7F 3AQPA 4EO6A 4ZPBA 1FESA 2R7XA 3R2CJ 1T9YA 2MQ8A 2EG2A 4ZCLA 1AFIA 1I6JA 5KG5A 5B08A 4FF4A 2WSCC 2BW7A 2G2OA 1SB6A 2I5JA 1HI8A 2C2MB 2AGOA 5CZVA 3M1VB 2A6OA 5BYQA 4YMEA 3W63A 4DFMA 4ZA1A 2IM3A 5IT0A 2DK2A 4FBUA 3DLBA 2J0SD 4KKOB 2OAUA 5KT4A 1D09B 4CZCA 3PEJA 4OYXA 2IVMA 3DOKB 1M1KT 1NHVA 3J80U 2EKYA 4EBCA 1PYOB 5KG0A 6AT1B 1WELA 1RTJA 2JHEA 2RJZA 4HL9A 2UUAF 2IIHA 4CCHA 3MM7B 2DNGA 1WDDA 5D0GA 3QT8A 3UN5A 1SKRA 3FCWA 2IDLA 4P71A 4NYZA 3QQCD 1JNZB 4CH1A 3W65A 1RA7A 1SPBP 2GX8A 4J7CA 3MAQA 1QAXA 4I0WA 4JYAJ 1VBXA 3NP5A 1VQ5S 3CDAA 5KFDA 3AOAA 3T1HJ 4HT5A 1RWPB 2VPZB 3ZZUA 4KSEB 2OGUA 1N5YA 2AYEA 1NO8A 3JAMY 4K4YA 3H7HB 5LJ5Y 4O4GA 3DMJB 4U6PA 2J7WA 4DF8A 4YDDB 4AFFA 2YNIA 2KFZA 4V19X 1CS4A 2UV8G 3CF5Q 1K9MT 4WK3A 5HL7Q 3H2UB 3D54A 1FJGJ 2VJVA 4ELUA 1Y00A 2WRMA 5HLFA 3I5CA 4WCEQ 3HCXA 3ILJA 2OH2A 1S4FA 4DV1F 1N56A 3NMRA 4URQU 3TUZC 2N3LA 1YLXA 5CYMA 2MKSA 1CJTA 2CZ4A 3I0RB 2IRYA 4UOFA 3PX4A 1NEEA 4PABA 3MPWA 1S4EA 2DH8A 3CUNA 3W7BA 1RHQB 1X5PA 2CPIA 2RDIA 5IOLA 1JLCB 4O23A 3D6MB 1S0MA 1S9EA 1WKJA 2RH3A 1RAHB 4AUKA 2R2RA 2K2PA 1N5SA 4Y2AA 3V81B 4K0KF 1JLBA 4BC9A 3NGDA 1KLMB 4HKQA 4LMZA 5I4MA 2ALZA 3M2UB 4EBEA 2YWEA 1TQLA 2FVRA 5EHHA 3FSYA 2XY6A 1Q1KA 3QSYB 2DNZA 1QD1A 3F56A 2NXEA 3CC4S 4FP9A 4FYDA 1OYEA 4EYIB 2LQBA 4LREA 3K0JA 3TVKA 4JP8A 4G1QB 2YQ3A 1H7WA 1IKWB 4V1Ak 2GNKA 2F4VJ 2CVEA 4NPOA 4M5DB 2B7CB 1WG5A 4IRDA 3ET6A 4DPOA 4DU7A 2HEKA 4CLLA 3A13A 4IRCA 5HP1B 4OHVA 3OFFA 5I3PA 5HROA 2QRRA 1R0BG 5K14B 2KRBA 1HD0A 4K4VA 1VISA 3L09A 4CWBA 1D1UA 3QATA 2HHSA 2CQ0A 4FBTA 2MB0B 4YY3F 2AIRB 4JV5J 3D28A 3V6HA 1F9HA 4M5NA 4KAIA 3GV8B 1YQHA 1NJXA 2DVIA 1UETA 4K4UA 1JJ2R 1S1VB 3IA0A 3DHWC 2HFOA 3BR8A 4R0EA 2Y9HA 2JLFA 2PA8D 4ZDNA 3ENWA 1D3WA 5KOXA 4EWTA 5GADI 1S7HA 5KFWA 3DDNA 3Q89A 4LFAJ 4F2SA 4OI0A 4S0MA 3GV5B 3QIPA 2PD1A 3IS9A 3CGIA 3NG8A 5LOQA 1YI2S 1U48A 2EK1A 4X64J 2Z4PA 1S72S 1VMBA 3AAWB 3TJAA 2CPDA 1FKPB 4KTQA 4GKJF 3U27A 4X4TA 4MK8A 5E41A 2F9JA 3I55S 3HFZB 4B3MJ 5A8KB 2WONA 4NRUA 1F3FA 2XG8A 1LXNA 4OYBA 3IP0A 1RAEB 1TAQA 3PEHA 5H9EK 2ZBCA 4LJMA 2M0GB 3UD5A 1HBUA 1VLYA 2MSTA 4USWA 3EPIA 4MIWA 5K8NA 2IBOA 2HNYB 1U49A 1GMWA 3FC9A 4W4MA 7AT1B 3OR2B 4LF6F 4LF1A 3SDEB 2JSXA 4Q7AA 4K4XA 2O66A 2GHPA 2IYGA 4DZDA 1XR5A 3IR6B 5KFZA 2AGQA 1UZDA 1H98A 5IWAF 3Q2TC 3IFEA 1CULB 3ILIA 1T9TA 2I2YA 4H4MB 4ECRA 4ELVA 3N6NA 1X9MA 4LRAA 1RP5A 3LW5C 2M88A 3CMES 4B9VA 1D9AA 1Q86T 1GQEA 4U67Q 4RW4B 1UW4A 1RDRA 2VPXB 2XGPA 1SV5B 4N77A 3EICA 1SUQB 2EXUA 3NNCA 1PAUB 1RTIB 1T7PA 5D78A 5IT4A 4TQRA 5IQ6A 2V2VA 1JKHB 1UEKA 2CJQA 4TYBA 2XHWA 3M30B 1NHUA 1Q5VA 2DNPA 4X4QA 2ZNZA 1KR4A 4IQXA 4OMFG 4DV2F 1IBMJ 5HVFA 4HI1A 2B5JB 4I2QA 4P9SA 1EHWA 3KG4A 4J9MA 5LXYA 4F67A 1X4GA 1GAOA 1WNEA 1HNVB 1N4LA 1TL1B 1G2EA 4LBIA 1GMWD 4ZOSA 1RCXB 1WSVA 3FEXB 4R0JA 4DPYA 4ED8A 2PDAA 2AHOB 3WX4A 3WX8A 5C2GA 1YJRA 3I9V9 4JB8B 2DNKA 3I9ZA 3EZ5A 1FD8A 2HGNA 3HVTB 3MAAB 2M4MA 2Y8WA 4F3MA 2BUNA 2DKOB 4ZLPA 4DUYJ 2YKPA 1FO1A 4OHZA 1Q81T 2E1CA 2D9PA 3I56S 2BYCA 1VHIA 4Q5VA 1J2VA 4NLUA 2PC6A 4Z2XA 1W25A 2DTJA 5C2CA 4ZIWA 3OUYA 1RGVA 2ZH2A 1S7IA 3DFEA 2B0GA 4HR2A 4PQUB 3UNGC 2RQCA 2VQFF 2LEBA 4M5LA 3SSRA 1U1MA 5L1JA 3RW7A 3SCLE 4UZBA 4FN5A 2WW8A 1YJWS 1S0NA 4K5RA 4JI2J 5E3AA 1B3TA 4ZPAA 1V6HA 2P9CA 1B0TA 3Q24A 2GIQA 2VJUA 1LWFA 5G4DA 3DCAA 5T41A 4J9QA 1PCAA 2CQ4A 4OX7A 2JC0A 4C8ZA 1SL2A 2XTJP 3OBIA 3N01A 2DYAA 1DTQA 4A8MP 1AUSL 3HT0A 3N4WA 2A0FB 2UP1A 3MMBA 2HHTA 2WVDA 1S1WA 3SCIE 2BM0A 2GMLA 3AJDA 5KFIA 3UDVA 4L74A 4DCOB 4DR3J 1NK0A 2OPPA 5KT6A 1H6KX 4YP3A 4DL5A 1U02A 4N76A 5J2QB 3JS9A 3THPA 4LBPA 1G1XA 2ERRA 1MSWD 2IRUA 3H8YA 4UY85 2FY8A 2HG4A 3SSQA 4I1TA 2DR5A 2W7AA 4NI2A 4DSIA 2LA6A 1UEUA 4WKYA 1CSJA 3C16B 2Y1JA 3DC2A 4DSFA 2AYBA 2H48B 1RAOA 4DR7F 1B64A 5D4PA 1NSKL 1M5PC 3DLJA 2LQ5A 1U4BA 1KEKA 3Q0AA 1MMDA 3T9ZA 1DFDA 4PCQA 1RTDB 4JI0J 1H2TZ 2H54B 2UUWA 1LW2B 4I7FB 4L76A 1SJQA 4EFAC 3MCSA 2BKOA 1PC5A 5D6GA 1GX6A 3BV8A 3NEKA 4RNOA 1S6OA 3HMJG 1DZ5A 3KLGB 4ZS6A 2ZFHA 3NRBA 2CXEA 3PKYA 1REVA 4WP9A 1FRLA 3BQ2A 1QAJA 2BJ1A 2XMKA 3T41A 2P9EA 4U95A 5KT2A 1FXDA 3FUYA 4F2RA 2FJDB 2QLWA 1TUWA 4RW9B 4CLSA 2VG5A 3RYLA 3KOAA 1WG4A 1TMJA 2AW0A 2BANB 2GO9A 2ZH9A 1RISA 1KQGB 4FKYA 4DQQA 1VYAA 4RW6B 2XLJA 1S6UA 1QSYA 2HWIA 3V6KA 2YWFA 3DLKB 2CNKB 4QR2A 9RUBA 4Y3CA 4HEA9 4CLZA 3QSIA 4CLWA 3OFHA 4MIAA 3R9LA 1GX5A 4ZKAA 5B09A 1N33F 5KFUA 2P8IA 5AT1B 1NSQA 3QLHB 1XNQF 4DMZA 3W5YA 1BXNA 3RRGA 4QPXA 1TKTA 3CPWR 3SQGA 1C4AA 5DRKA 4RUCA 1WHYA 4DX8H 2B3TB 3GIMA 4DR4J 2YWGA 1JXEA 3KK3B 5LSOA 1PJ7A 2E7XA 1HLWA 1NZ8A 2C28A 4GKKJ 4NA2A 4D3GA 2HWHA 2WHOA 2YWWA 1S1UB 1BY9A 2BM1A 3N6MA 2MY7A 3EGVA 4KO0A 3V4IA 4CO3A 2BABA 1G3OA 2DNNA 2B43A 3OXLA 1K8AT 2MXYA 8RUCA 4M5JA 2C2ZB 3FBEA 3TUIC 1HQEA 3VF0B 2NSCA 5KT7A 3T5KA 1PILA 2W8LA 5A2QU 4GMKA 5KFRA 2FD2A 4DPWA 2W2OP 1VQ8S 3V6DB 2OPQB 4H4KC 1C0TB 4WBFA 2E5LF 2BBEA 3PX0A 1OY8A 1T9UA 2AZ3A 4XAKA 4XDCA 1FNOA 3NY0A 4O44B 5HK4A 4C8KA 4LVNP 4C6AA 1KC8T 1RBLA 2HRTA 3OV7A 4DUTA 5C25A 4WFBQ 2MZSA 2W9AA 1BHNA 2Z8QA 4LFBF 2FLLA 1JIHA 3IBWA 4XTTA 3NL0A 1RACB 2DXFA 2FLOA 5GAEI 2IPOB 2VDHA 4UUWA 5CD4A 4KIAA 5AE3A 3H42A 1ZM2A 3O44A 3GYGA 3ADAC 3OHBA 1RAJA 1HNWJ 2BA9A 1IR0A 2DITA 3CD0A 2A2CA 3CO0P 2KVQE 1GEHA 3ZZ0A 3A8KA 2G0IA 1L3SA 2M7SA 3K89A 4X62J 3P8BB 4NCGA 4F3QA 3QO9A 2KT3A 5CABA 3THTA 2YKMA 1Y0HA 5KFVA 3K8VA 3DDKA 3DLGA 2BV3A 3MMAB 4MKAA 1QE1A 2DD8S 4O3OA 2W7PA 3CT9A 3P96A 2D7SA 1Q95G 3C3LA 3TVZA 5CZXA 5IS2A 4WP8A 2W9CB 2IA0A 3M9MB 4KV8A 4K4WA 2OMOA 4C2MA 3JTOA 3EXYA 1D0EA 4MH8A 6FDRA 1UL3A 4QZVB 4LIRA 1SC3B 2Z2YB 2DGTA 3J7ZT 4CO1A 4B3TF 2EPIA 1M5SA 4NEYA 2XCAA 4F50A 3G86A 3UR0A 2FHKA 3HJVA 5ETQA 3SFGA 2HAFA 4DUZF 2GV1A 1FRMA 1ZM3A 2VBWA 3FEZA 3HKZD 1OPZA 2R9LA 2YKQA 1E6YB 3OFEA 4ZHRA 2AEMA 3RB4A 1TV6B 3HM9A 1HNXF 1DURA 2CFXA 2CUYA 3UNYA 3CCTA 2J8AA 4N8OA 4KJIA 2EFGA 2XMUA 2YTCA 4CYUB 2R8HA 2CPEA 3EDRB 1W26A 4JI4F 3G82B 3BF4A 3HX9A 1TL7B 3WBZA 3D3BJ 5KFOA 2JEFA 1S9GB 2GW8A 1P1TA 2LKZA 2WK4A 3AJ1A 2B8QA 1N5QA 1KLNA 5KG4A 4B02A 1D8YA 4YR3A 2ZVIA 3W2WB 2JNJA 4YDXA 4QPTA 2VV5A 1VQPS 1F1BB 4ZJOA 4DL3A 3PZPA 3ZTRA 2AJ0A 4A4JA 2JDJA 3M2RB 4JI5F 3AB4B 3RUBL 4ENOA 3P45B 3FNNA 5HMXA 2MZJA 2WOMB 3CDWA 1DARA 4JI3J 2V8DA 2GGPA 3LA0A 4F4AA 3ZTOA 4BBYA 2AWZA 3KLVA 3DRXA 2IC3B 1LK7A 2X1BA 3RU0A 1JLFA 3CEDA 4ICLB 2XS7A 2WVFA 1OJ4A 1BQMB 2C3YA 2ZKTA 3MEKA 3TA2A 5G0RB 4K4SA 4DR1J 3ZNUA 3PM9A 3KMSA 4C11B 1RTZA 3D6TB 3M9NB 1ULRA 2IM2A 3NXZA 4USHA 2OKQA 3MCMA 1JWWA 1F2HA 4I56A 2MKIA 1HHQA 2QZ8A 4WZQA 1NXIA 2FDNA 3DOMA 2MKKA 5HSPA 1DTTA 5D0HA 2CJ9A 2VQEF 3J81j 1X4HA 1ZH5A 2VHGA 2QL5B 3OFGA 2D41A 3MDFA 2G1HA 2DBBA 1I94J 3VAFA 2ZC3A 4WE1B 2J6UA 4N41A 3POTB 2QSFA 4Q45A 2J9DE 4CRJA 5B0CA 3BYRA 3MI7X 3MD1A 3HO1A 2HQDA 3TA0A 3D1HA 3ZZOA 3NBPA 1KNZA 4WXWA 1HNIA 1NK7A 1GMUA 1N48A 3C2PA 7FDRA 4OI4A 1SKSA 4AQYJ 1UWAA 2V9WA 1JJ4A 3H5YA 3DRPB 3HHDA 2XZTB 2ZITA 4RKUC 3W9IA 4WU3A 2GVDB 3R5DA 4A8FA 2XNQA 3I6PA 4ZN1A 1JXVA 4YOEA 4DL0C 4L3NA 4UOCA 2UUCJ 4AXJA 4U7UK 4RO0A 4OZ2A 3ZTPA 1HNZF 2B9WA 4NEZA 2CRLA 4NLTA 5DZ7A 5HBMB 4ZCKA 3TVYA 1Q5YA 1BQXA 2VICA 1QUVA 3VR1A 3G4SS 1HQUB 3O5TB 4PKDB 2GAGC 4QIFA 3R1LA 1H2UX 3PKMA 3NS6A 4K50A 5LSRA 4C3KA 1LW0B 4J9UE 3OTBA 4NLPA 3PW2A 3MGJA 2XO7A 1U2CA 2AX1A 3WC0A 1SH0A 1S57A 2HVDA 4ZP9A 4EI2A 3D6HB 2QE5A 2XM3A 5AXKA 2IY5B 2HWTA 4FZVA 3PRBA 1OSDA 5KAKA 1GXUA 4MFBB 1YRXA 3CCZA 1IKVB 4FYYB 4ILRA 2FJXA 1CC7A 4HHJA 5T14A 3I5BA 4EK2A 3BGRB 5L38A 1B7FA 5KFSA 1HW9A 2BACA 1S1TB 5GMKa 3QJLA 1QVFR 1OO0B 1QAIA 2GJIA 1Q53A 3BQ0A 1T11A 3T1YF 2IYIA 5D3GB 3TJ9A 4W90B 2KG0A 4EZ9A 4G3IA 1S5ZA 3DYAB 2AYGA 3GJSB 2R3VA 3LGHA 4R5PA 1Y5IB 1UPPA 2AJ2A 1TVRA 2HFVA 1RADB 3Q8YA 3LF0A 3H2VE 3KLIA 3N0VA 5B7WA 1ZA2B 5IT9Y 1NKCA 4EMDA 3HHNB 2CADA 1V5VA 2A3JA 2C2KB 2XWXA 4RPFA 3C6UB 1O8BA 2KB2A 3L4BC 4NCBA 1BD6A 3I0SA 1R8BA 2HPUA 5C7PA 4YHHF 3BBCA 4FNHA 1D9FA 4Q8FA 1RWWB 1FNXH 3M8WA 1UKUA 4J91A 4CNZA 3T5LA 2K1RA 3L7PA 4RUHA 2J7UA 1FRKA 1U2RA 4KYZA 3CD5A 2UXBF 2OIHA 2FPHX 4FDFA 2ZH6A 1APSA 3MM5A 2NYHA 4J9NA 1N5YB 4RUAA 3TQ1A 3PX6A 3AD9C 3PY8A 2HZCA 2E9TA 1J5EF 1B70B 2Z57B 4KQZA 4OQJA 1FKOA 1X60A 4DL2A 3HSDA 1L3VA 5KFAA 2F63A 4DR6J 2BJ3A 1EJ7L 1KFSA 4JV1A 2QA1A 3H5UA 2FB0A 2LXUA 3MZIA 2VPWB 2ZHOA 4J9LA 2KZMA 3TEHB 2MGZB 1N0VC 3JB9k 2XHCA 4OI1A 4WF9Q 2IJFA 1K1QA 5FIIA 4YEAA 2L48A 4JI1F 3FVYA 2R8IA 2JZ5A 5DDQC 3H0PA 1W2IA 3AQOA 4IDKB 1C1BB 4C8NA 5DQIA 4E98A 3NOCA 2CNNB 2DH9A 4WJBA 1T94A 1CJTB 5AXMA 1C2PA 4DI6A 2PEHA 3DNCA 2KZZA 4ZCMA 4Q43A 2MMYA 3GB0A 5IFMA 5HI7A 2EWHA 1UMJA 5CYJA 3JSRA 2CJKA 3HPOA 1NRKA 2C22A 2POKA 2KKHA 4NCAA 4DPUA 2QA2A 2XMTA 2HMIB 3VAHA 1ZAWA 4DXLA 4MK7A 2MQPA 2HGLA 5FD1A 3AOCA 5IC4B 2H5EA 3G8TA 1L3TA 1KRPA 1B0PA 3RBDA 1BGXT 1JXLA 2NQPA 4F36A 1VRTA 5C24A 1NDKA 3QPIA 4K4TA 4DCPB 4NL5A 1R6YA 2B4OA 3BS9A 1N5VA 1KS2A 1N6QB 1BWVA 2QL9B 3Q83A 2JFDA 3QGGA 3JSMA 1SH3A 1OQ3A 1S6PA 3BKTA 2BJEA 2OPRA 2CNOB 1WI6A 3DKDA 2E1PA 3KJNB 3OTOJ 1RI7A 1M5VC 5GAHU 1RKJA 1KKHA 4DV4J 1XMQJ 3C66A 3GLJA 1YWXA 1F5BA 3HHLA 3CO9A 4O0IA 3MPVA 1B4SA 2D1CA 2HVEA 3DU6A 4NZ6A 1OSCA 2AMCB 3IWXA 1SJ3P 1PG5B 2J0XA 2HW3A 2RU3A 2BRLA 2KHDA 3B4DA 2MPUA 5ETLA 1VRUB 1WF2A 1F3VA 3H5SA 2J5AA 5E3QA 1UP1A 1GMVA 4JYAF 1FTCA 1E6VB 3C6TA 1A0OB 4OHXA 3T1HF 2UXCJ 1WI8A 1MWZA 5JJBA 3M8PB 1IM4A 1PBUA 1C1CB 2HFNA 4J5OA 1SIZA 2GVZA 5IM0A 1H38A 1SC1B 3M6VA 1UFWA 2DRAA 3IAS9 3UI3A 5CYQB 4Y0FA 2R8KA 1FVSA 5F8NA 3THVA 3PJXA 2PMHA 1KD1T 3QBCA 4GC7A 4ECZA 2BOPA 4XDDA 2V34A 4ITSA 1P8GA 2L08A 3RGIA 1JMTA 3ULHA 3RR8A 4DPXA 2ZWPA 1RT6A 3PYEA 1IWAA 4DF4A 1FJGF 2LEPA 4OL8A 2B8PA 2A10A 5J2NA 2NZ4A 2WVEA 2YNHA 2C42A 2WONB 1KQFB 4MKVA 3QGHA 1KSPA 5C5JA 2LVWA 3DLEB 3M2VB 2PN6A 9ATCB 3HHLD 4FPRA 3N5BA 2G9OA 2EFOA 2ZC4A 3W5ZA 5LMNJ 1IR1A 4YB6A 4B3RJ 1IQTA 2BR0A 1RTHA 3QJPA 4N47A 3CTRA 3UDEA 1FJEB 4Q44A 4YQWA 1TL3A 1TK8A 4F8RA 4OX9J 1RT5A 2B51A 2XQCA 2DHXA 4DR2J 3FFIA 2CQIA 1VQ7S 5J2MA 1H3DA 3EE3A 4TY9A 3PYGA 4IR9A 1S12A 3OTEA 5ITHA 2COLA 1V5IB 4UOHA 5HQ8A 2PE8A 3JXOA 3LH2S 2XMMA 3CJSA 3GG1A 2GQQA 5B0AA 1LV5A 2HSEB 3MECA 3HI9A 2NS1B 1XWLA 3M6WA 4DN9A 1G6BA 4YB7A 1GXLA 2AJ1A 4MT1A 2IDEA 4HDGA 1RUSA 1G7CB 2R7QA 4HACA 1ZAVA 2N82B 2DR7A 3QIDA 2KXNB 4QIEA 2ZHBA 2MJUA 3ETMA 2CPYA 4LSNA 2F4VF 2ZE2A 4QOTA 3MEEB 3GJRB 5SUHA 2MZTA 1EP4B 2VFUA 4A8OA 1TFWA 2NUUG 1F2GA 3K57A 4J9RA 4OI3A 5DM7Q 1RT2A 4KB7A 3NNAA 2DO4A 3JAMU 3E3XA 1FFGB 1RT3A 3CWJA 2E5HA 2FIUA 1WOSA 1VK3A 3G6ES 4CLUA 2QFIA 2BKPA 3UW1A 3OR1B 1FE0A 1DLOA 4I6AA 4JV5F 2WAQD 3CJKB 3WZ0A 4HHHA 1N34J 4GVLA 2EI5A 2NLWA 1S0VA 4PYAA 3AXMA 1CBKA 1KWMA 2VODA 3C15B 4LSLA 4NASA 2ASLA 1DQAA 2MHNA 2NPFA 2F5GA 3BBBA 3K5OA 3VAIA 3BDEA 2FGOA 2RRAA 3KLFB 1M0SA 2VC0A 3D9BA 2EFQA 2N4DA 1X5SA 4DEZA 5EX0A 2QGFB 5I3UB 4ZK7M 3JQMA 1HD1A 1UWBA 4X64F 2OTLS 5M2UA 1UA0A 5EWEA 3CD6S 4U9RA 2DEJA 1K73T 1XR7A 4PUOA 3FDSA 4B3MF 1HARA 4B3OB 4LF2A 1YGYA 1QTNB 5CA5A 2W4CA 1OPIA 3BSOA 5A6PA 3HZGA 3W60A 3LP1B 2AJFE 1X8DA 2VL1A 1YJNS 1LWFB 3OL6A 2ADBA 3VAMA 3ILLA 1PJ6A 2BE2B 2IAJB 4IFYA 2QL7B 2V2ZA 4I2PA 4JV2A 4ECSA 3T9NA 5H9FJ 4ED1A 1JLQB 4CI0B 3KUEA 3MMBB 1SJ4P 2J0QD 2APOA 3M8SA 1YVFA 2GC8A 2N3OA 3G71S 3MM6A 3G96A 3KLEB 1S99A 3OTDA 1X31C 4U8VA 3J7YI 3G8SA 3NMAA 5GMEA 2VG7A 2MQNA 1O5JA 1EETB 5L39A 1P9YA 4QR1A 1OQ6A 2HHHJ 3GYXB 3HT3A 2V68A 1V9OA 4YUDA 1QY7A 3V4MA 4IR1A 2KYXA 2AD9A 2DNOA 3KK2B 3W8PA 2P9GA 4KFBB 3DRSA 1AROP 5KFNA 1MROA 1YIJS 2MZ1A 1CEZA 3K59A 2E9RX 4X4SA 5CCMA 1WOOA 3BKFA 5JXSA 3GU0A 1T02A 1KVKA 3BYPA 4H4OA 3CCES 4WFAQ 1JNRB 2OSRA 1IBMF 2BRKA 1X4BA 4Q0BA 3MM8B 4JI6J 3JQKA 2RVJA 4JV0A 4C4WA 3VAGA 3TI0A 3QWUA 2XGQA 1KOHA 2YNGA 4OI2A 4TLQA 1A7GE 3W3SA 2D74B 4KHPJ 1TELA 3RBXA 4MKYA 3OXGA 4IG0B 2WB1D 4NYPA 3ENQA 1BQNA 1UCNA 3BPSP 4TXSA 2PI4A 3BPDA 5A8RA 4RR5A 2XMVA 4DUYF 4ED3A 1R0AB 3M1VA 5D0RA 1EKRA 4Y28C 1S97A 3C19A 3RBZA 5CD4H 2HNZB 3IXQA 2Q66A 1EQMA 2GHWA 4KKOA 2JWNA 4Y2IA 1FK9B 3FSXA 5DDOC 4DR5F 2YPZA 3DOKA 2XZWA 3DLHA 4NOHA 2RMLA 3TRGA 1KVJA 1FRHA 2QN6B 4X4PA 4RW7B 4PWDB 1F9EB 3GMGA 4NE9C 2VFSA 4JI2F 2L9WA 2VOPA 3MM7A 4C8LA 2FVQA 3O1LA 1IN0A 2DHSA 2MLZA 3GQCA 1BLUA 3NKYA 5ETTA 4A48A 3ISNC 3C14B 4L72B 3EZUA 2LDYA 2BQRA 4IKAA 1TL5A 3IM8A 3WIVA 5A6WA 3HHLC 2KL8A 4DL7A 2JC1A 3K5MA 5B0GA 4R8UB 4FXWA 1OWXA 5F0UA 5K9FA 5KFKA 1WKLA 4DR3F 1RYRA 2BE9B 5C42B 1Q16B 1HBNB 5EUHA 2SXLA 2CAJA 1N32J 3DMJA 3OHAA 2ZOFA 4IH6A 2PMWA 1VFJA 1LXJA 2RF2B 3TO8A 4UY8T 4LR8A 2WZ1A 1NH8A 4GKJJ 2U2FA 4OFZA 5ETPA 3M8QB 4H54A 2W4DA 1RXOB 3KK1B 1V3RA 3NLCA 2V8HA 3VGTA 1K47A 4I69A 1I3OB 3H59A 4ZVSB 4ILLA 1WC0A 2ZDPA 3I0RA 4P73A 1NNDA 1SC6A 5KFMA 2L9DA 3EX7B 3QYYA 2EFNA 1R89A 1VBKA 4JI0F 4HHUA 4C3LA 1JLCA 1WC5A 1NM2A 1NB2A 2CPHA 4ZMMA 1FDNA 1ZETA 1U1NA 4URGA 3O8WA 1FCAA 2Q79A 3B4MA 5FLXY 1ZYQA 3FMBA 3KJQB 4HT7A 3E8OA 4BLGA 2K7JA 1XMOJ 4CO0A 2R7RA 2DIUA 3V81A 2FLNA 3IN5A 2V8PA 4ZLLA 3VVTA 5L9NA 1RJJA 1SQGA 3A8IA 4NCGB 1BWEA 3M2UA 3NS7B 4RNNA 2DT9A 2RUGA 3FBFA 2VZ9A 1IQZA 2DGQA 2GMHA 2HBZB 3EVMA 2DRBA 2DGXA 2P2CB 1NKEA 5HJXA 2CWXA 3D2WA 2AT1B 4BC7A 2FZGB 1C4CA 4IO9Q 3P3DA 2H5IB 4KRWA 4G1QA 1TZ0A 2F3JA 4KV8B 3KUHA 3G2XA 4OX8A 1IKWA 3NOGA 2HURA 4M5DA 3AHPA 1NLKL 2XSFA 3EUNA 5HP1A 4MYUA 3E01B 1PAEX 1RT4B 1VQKS 1C0UB 1PYTA 1Y3KA 5KFJA 4P6QA 2VB6A 5K14A 1TFYA 2KDOA 1HYSB 1QM9A 3GSDA 2ZJQQ 1FD2A 3KJVA 2V8VA 2NXCA 1FNMA 1H73A 2KI2A 4OYZA 3EPGA 3GV7B 4F0MA 5A8WB 1ZA1B 4DR4F 2KU7A 1BMQB 2ADCA 5HVHA 2C2EA 2LXIA 4F0KA 4Y2MA 1S1VA 3R5BA 4DJBA 4Z37A 4GKKF 5F8JA 3W66A 4CIOA 2XWYA 1KDNA 2C2RA 2JEIA 4ZVTB 4F4WA 1M1HA 2EEYA 2V8GA 4CLYA 2DNRA 5EWFA 1QVGR 5D4NA 4F02A 1WOPA 2PO4A 2EFVA 4OYOA 3SXLA 4RU9A 5DLFA 1Y7PA 1M5KC 4P2XA 2OFGX 1FKPA 2QMUB 4J90A 5J1NA 5F8IA 2HLTA 4DHVA 5ETNA 3DXSX 3LOUA 2IMOA 5A8KA 3HD1A 2HHQA 3Q23A 4LF9J 4DQSA 3AY0A 3IR5B 2LYVA 1UVLA 3A4TA 2P5VA 2F4FA 4K2XA 4M5HA 4AXIA 3H5XA 2D69A 3M4XA 2HNYA 1ITPA 3QRPA 3ZXWA 3CXCR 1TKZB 3G6XA 2VBYA 3BGFA 2V2QA 1OYDA 1HNWF 3SDEA 1Y5LB 2XMAA 2H4YB 1JLEB 2MEWA 3EM1A 4I4BA 3QAUA 1IKXA 4UF4A 4A46A 2O3DA 5GAGI 1OS5A 1CULA 3GR0A 4H4MA 2FZKB 4X62F 5FJ4A 2R2TA 2Y1LB 2FTRA 3F0NA 2RT3A 4RW4A 2OP5A 4EU0A 4PG7A 1X5OA 3LP0B 1SV5A 4FVMA 4HH1A 1LWXA 1SUQA 1QAYA 1RTIA 4FYXB 4HLBA 2H51B 1JKHA 1RAAB 3K5PA 4L73A 3M30A 5BYRA 3UVJB 2QMXA 4R25A 3G9CA 1FWPA 4NA3A 3M32B 4P2SA 3UD3P 2UUBJ 4OYWA 2B5JA 4ES3A 2JVOA 5HQLA 2HRUA 1WEYA 1HHTP 2DPJA 1HNVA 2F7VA 2GCFA 1TL1A 5DDRC 4ECWA 1SJRA 1HI1A 2Q3PA 5HQMA 3UN3A 4MKBA 3UDCA 4DQIA 1K0TA 4ER8A 3D66A 1F9FA 3O3LA 4YB5A 1YRTA 2ZM6J 3HVTA 3MAAA 3OVSA 4M5IA 1WF0A 1RK8A 4EYHB 2VA2A 2AV5A 1DQ8A 2Y1RI 2LQJA 1YDLA 2CZ9A 4ERDA 3BSAA 4NWBA 1F60B 5A0YB 2HBQB 5LXRA 4CP5A 1K44A 3MM9B 2BQ3A 4U7UD 1WC4A 2CQDA 5D4LA 2J9EA 3TYTA 1U1OA 2V67A 1F5AA 4O3PA 3W64A 4PQUA 2R42A 4LT6A 5BR8J 1U45A 2CNLB 2HBYB 1U6BA 2CQCA 2RRNA 2YPYA 1CJKB 4OZNA 2NXNA 2AGPA 2HAIA 5CCLA 3TR5A 1PKUA 3S1TA 4KPYA 3AT1B 1HWJA 4LF4J 4LRBA 4G65A 1R43A 1YTYA 1FRIA 3Q8SB 3IWNC 3TANA 3TUJC 5IV3A 4JI3F 2I1RA 2EVZA 3OTCA 1X4EA 2W9BB 4M8LA 3R5GA 1NDCA 1NJWA 3VHQA 4OHYA 1RT7B 4CH7A 1U6ZA 3BEGB 2QTWA 1R31A 3HZEA 4DR1F 4XK8C 2YKAA 1Q8KA 1U26A 2CVIA 4USTA 4NRTA 3GONA 2DJWA 5K5MA 1HPZB 4DV6J 4J37A 2MQOA 1FX2A 2ZHAA 3DLLQ 5J2QA 2DEIA 3GIKA 2JH3A 3SBMA 2Y0BB 1TTHB 1V3ZA 2OD4A 1AZSB 2HNDB 1RAFB 1PC4A 3NCQA 4F4XA 2QLJB 1RKIA 3CW2C 1FXLA 1IBKJ 4P7VA 2R7VA 1I94F 3BDPA 4LUBA 3AB2B 1M5OC 3C16A 4FS1A 1YJVA 4H4KA 4DV5J 1VR6A 2I0XA 1WSRA 2U1AA 2IMWP 4OZLA 2CDQA 2O1PA 4DV0J 4BCAA 4AQYF 3VTIA 1RTDA 4ED6A 4B3SF 2CQ1A 1Y4ZB 2K3IA 3IR7B 3EYZA 1NK8A 1LW2A 4I7FA 1HMVB 2YX7A 2L41A 2NREA 4IO1A 3BN7A 2UUCF 4JI8J 1NB7A 4LIWA 4DU8A 3KLGA 1L5UA 2UVUA 2IHR1 2ZUGA 4G1PA 5KTQA 5KFQA 3HVRA 1P1LA 1BC6A 3KHRA 4A8YA 2F65A 5LMUJ 2Q1LA 3V6JA 1NAQA 2RQKA 2KTQA 1U6FA 3IRXB 1VQ4S 1VGYA 2XLIA 4RW9A 3KHGA 3A1YG 4N8NA 2ACMA 3QGIA 3DDIA 2VG6A 2E7VA 4UUXA 3D0GE 5KFEA 4ED5A 2YQ1A 3HSZA 4Y6IA 3M8YA 1VQ9S 4WWSA 3MFHA 4RW6A 2JJ4D 4KE5A 1H74A 5J1EB 1DQ9A 1SJ1A 4FF2A 5DS7A 3DLKA 1RT1B 2PFFB 2ACYA 4IQMA 3ZZPA 2X1AA 2HHWA 2ROEA 3S01A 4UZCA 2ZZMA 1FEEA 4GRSA 3RTVA 4USKA 3A3PB 3OL8A 4DSEA 2NZCA 3MEGB 2RIJA 3ZO7A 4O0NA 1GXTA 2G13A 4NXNJ 4GC6A 1SQEA 2R4FA 1A6LA 4TU7A 4KHMA 2FGCA 1T3NA 1D8ZA 1CJVB 3I32A 5DG7A 4QYRA 1W2BR 1MU2A 2OPRB 1TR0A 3ITHA 3K5LA 3WC2A 1S1UA 4ECQA 4X65J 4IG3B 5CXTA 1TL4A 2WB4A 2MTLA 4LF7J 4OI6A 2R2SA 5CHCB 1Y10A 1NK9A 1XQIA 2NXUA 3V6DA 3EGNA 5L8RC 2OPQA 1C0TA 5ETSA 1KONA 3HLUA 4ED4A 2Z2ZA 4O44A 4IYQA 3DM2A 1FRXA 2DXDA 1HWIA 1JLAB 2KFNA 2OTJS 1OY9A 1FJCA 3VCDA 3TZWA 2DCUB 2FVCA 3PCOB 4B9NA 2HHVA 1EIYB 1WEZA 4WTOB 1S77D 1NSPA 1CQMA 4XPCA 5E33A 1MW7A 1U47A 1HBOB 5LJ3Y 3OSNA 1R6VA 3HSJA 4DX7A 1AYEA 1IKYB 1TP7A 3OJUA 3AD8C 3CDBA 1LNQA 1HA1A 2R7OA 4B9LA 1RCOB 1VQNS 4Y2CA 3JSBA 3IGNA 2ZH4A 4IOCQ 4DR6F 1RT6B 3W2VB 4PG6A 2XYHB 3FBCA 5A76A 5LM7E 1RA6A 1MWQA 4J9SA 2HGMA 3T6BA 4FYVB 2N7YA 3LTOA 2R8JA 4PXEA 5KFTA 3GE9A 4O3QA 3MMAA 1NH7A 3HD2A 1XTZA 2W2NP 2HK3A 4FKXA 3LWMA 1M5HA 2ILZA 2RKIB 2OJ3A 4YN3B 2W9CA 2EG1A 4QU7A 2FVPA 3FCVA 4JUZA 1VIXA 4K4ZA 1ELOA 3EGWB 5GADU 1R27B 3OLAA 1JK9B 4KT0C 3DRYA 3BB5A 3TZZA 3P6YC 2ATLA 5HO4A 3DI6B 1ICEB 3KNGA 3A8JA 3NWGA 2VBZA 2FJEB 3MPYA 2RS8A 2R8GA 5IT9U 2HK2A 1JQGA 4KHRA 3X3UA 3CJRA 5HN0A 1U0HB 2A1BA 1FERA 3JTNA 5J2PB 2QV6A 1DRZA 4RW8A 3MECB 2ZH7A 4WPAA 2OEKA 1E6YA 2L3MA 1TV6A 4KGZB 3OJSA 2XY7A 2CPFA 2ZH3A 4QW8A 2V4JB 1NBEB 5F8MA 2XI3A 2KT5A 2Z58B 3G82A 2XSJB 3BGLA 3I87A 3OTOF 1TL7A 5IC6B 2HVZA 4DFPA 3Q2SC 3A8EA 2K7KA 4DV4F 1YG0A 4RWWA 1XMQF 2M70A 1WHXA 4WIIA 2ZUAA 1D9DA 1K1SA 3W2WA 1GK8A 3MTJA 3OQ2A 3BO2A 2VF3A 3M2RA 2HQGA 2V0NA 1VQMS 2FJAB 1WHWA 1S6QB 2EC0A 2WOMA 5MAOA 2VC1A 2YH0A 3NS5A 2ZVSA 2GJFA 4ID5B 3UD4P 1Z2LA 1WC1A 5I42B 2UVRA 2UXCF 1RWOB 4F0HA 2HQCA 4KGVB 3IG1B 4DL6A 2IC3A 3TZYA 5K8MA 4A8QA 3EXCX 4ICLA 1IXKA 2OMLA 4TY8B 4DCJB 1HBMB 5G0RA 4ZLJA 2DNQA 3EJMA 2ZBQA 4K5SA 4ZPCA 4C11A 2FHOB 2V4QA 5KFHA 1Q79A 3VQSA 1S1XB 3DGPA 2FVSA 3PJ9A 3US5A 3U1NA 3DU5A 4CM0A 1P6TA 1SBRA 2RSQA 5THWA 4NXMJ 2PMZD 2QFJA 5EX3A 3CNQP 1CG2A 3KTQA 2A2DA 3SFUA 1RBOB 4CLFA 1U1QA 3JYTB 4FXDA 4DN0A 4WE1A 3VWSA 3CC2S 4WFXA 3POTA 4QIWD 5LMNF 2AQ4A 2FY1A 3AA9A 4I2PB 2BE7D 4CO4A 4B3RF 3FZ2A 3CSKA 4WFNQ 3TX8A 2ATCB 3CE8A 1ACMB 4UOGA 3NGSA 3U1MA 4OX9F 3PHTA 3ZTQA 2C2NA 1DBDA 2VA3A 3RB6A 1PJ5A 2H3EB 3CJ2A 1FF2A 4CH0S 4DR2F 3DRPA 2M5YA 3I4PA 3G8QA 3C8YA 3LO3A 2ZEJA 3AH6A 1NDPA 2GVDA 3IBCB 1SQFA 3W9JA 5K8OA 2IRXA 4PEOA 4BWJA 1W7WA 1CPZA 2OPSB 4ECYA 4PQAA 3I96A 2HZVA 1JLGB 4C8OA 4DG1B 5HBMA 3M8RA 1DHMA 2W2MP 1H0HB 4P7TA 3PFEA 1U8SA 5H1SV 4X4OA 1HQUA 3TZXA 2AX0A 2F8EX 4L75A 1ZM9A 3J81Y 1VBYA 1B7YB 3NCRA 1J5OB 1WORA 4DX5A 2YNFB 3PIPQ 2ZBRA 1LFWA 3GP9A 4NMXA 4ED7A 2A18A 4OZ1A 1R8PA 4DDFA 3PRDA
chains in the Genus database with same CATH topology
4CLZA 1CS4B 4WP3A 4CLWA 5D0GA 1AZSB 1YBTA 4WP8A 1AB8A 1CJTA 5D0RA 3ET6A 1YK9A 3UVJB 5D0HA 4CLLA 1WC1A 1CJKB 5D15A 4OYZA 1U0HB 4OYWA 4CLKA 2QV6A 4USUA 4CLPA 2BW7A 4WPAA 3C16A 3C15A 4WP9A 4OYBA 2GVZA 4P2FA 1Y10A 2WZ1A 4CLUA 3ET6B 4P2MA 2GVDA 5IV3A 1Y11A 4USWA 4NI2A 1CULA 1CJUB 4OZ3A 3G82A 3C14A 3R5GA 4CLYA 4OYMA 1TL7A 4USVA 3MAAA 4CLSA 3C16B 3C15B 1CJVA 2GVZB 1CS4A 4OYXA 1CJTB 4OYPA 4OYOA 1WC3A 4OYIA 2W01A 1AZSA 4P2XA 4CM2A 1WC0A 2GVDB 4CM0A 4USTA 4OYAA 3MR7A 3UVJA 1FX4A 1WC6A 5IV4A 4NI2B 4CLTA 1CJKA 1CULB 1U0HA 3G82B 3C14B 4CLFA 1FX2A 4OZ2A 1TL7B 1YBUA 3MAAB 5D0EA 1WC4A 1CJVB 1WC5A 1CJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLZ A;  1CS4 B;  4WP3 A;  4CLW A;  5D0G A;  1AZS B;  1YBT A;  4WP8 A;  1AB8 A;  1CJT A;  5D0R A;  3ET6 A;  1YK9 A;  3UVJ B;  5D0H A;  4CLL A;  1WC1 A;  1CJK B;  5D15 A;  4OYZ A;  1U0H B;  4OYW A;  4CLK A;  2QV6 A;  4USU A;  4CLP A;  2BW7 A;  4WPA A;  3C16 A;  3C15 A;  4WP9 A;  4OYB A;  2GVZ A;  4P2F A;  1Y10 A;  2WZ1 A;  4CLU A;  3ET6 B;  4P2M A;  2GVD A;  5IV3 A;  1Y11 A;  4USW A;  4NI2 A;  1CUL A;  1CJU B;  4OZ3 A;  3G82 A;  3C14 A;  3R5G A;  4CLY A;  4OYM A;  1TL7 A;  4USV A;  3MAA A;  4CLS A;  3C16 B;  3C15 B;  1CJV A;  2GVZ B;  1CS4 A;  4OYX A;  1CJT B;  4OYP A;  4OYO A;  1WC3 A;  4OYI A;  2W01 A;  1AZS A;  4P2X A;  4CM2 A;  1WC0 A;  2GVD B;  4CM0 A;  4UST A;  4OYA A;  3MR7 A;  3UVJ A;  1FX4 A;  1WC6 A;  5IV4 A;  4NI2 B;  4CLT A;  1CJK A;  1CUL B;  1U0H A;  3G82 B;  3C14 B;  4CLF A;  1FX2 A;  4OZ2 A;  1TL7 B;  1YBU A;  3MAA B;  5D0E A;  1WC4 A;  1CJV B;  1WC5 A;  1CJU A; 
#chains in the Genus database with same CATH topology
 3PV8 A;  4TQS A;  2RIL A;  5AE1 A;  3P4U B;  2B6A B;  4DQP A;  1LW0 A;  3M8Z A;  1KTQ A;  4J9O A;  3RAX A;  3MUR P;  2GZO A;  4OZ0 A;  4LFC J;  4UTG A;  5EWG A;  5L1L A;  4LVO P;  4HDH A;  2PA3 A;  4MFB A;  4NLX A;  4X66 J;  1U7L A;  1IKV A;  1WF1 A;  3F41 A;  3CCJ S;  4CNY A;  2BJ9 A;  1Y3J A;  2KVI A;  3S7R A;  2HVH A;  1N8R T;  4KGM A;  3BGR A;  1N34 F;  2HHX A;  1BQN B;  3PO4 A;  1SC4 B;  2M2B A;  1S1T A;  5A8R B;  2E1M C;  3WHI A;  5ADZ A;  3TAM A;  4F7V A;  3K58 A;  5D3G A;  3H4D A;  2MQQ A;  1L3K A;  4LQ9 A;  3DYA A;  2LU2 A;  2QYC A;  3QNW B;  3MR7 A;  1K0V A;  4AND A;  1YSJ A;  5BJR A;  1LWC B;  4OV6 A;  4GVB B;  1N88 A;  1VJW A;  3N6L A;  5SZT A;  2QSW A;  3QT7 A;  2G2Y A;  1X9W A;  4IFV B;  3KWM A;  5E3R A;  4O3N A;  3BN4 A;  4TLR A;  5HAT A;  3C6U A;  2VPY B;  2J6S A;  1HWK A;  4NLY A;  5ETM A;  2PEB A;  3AXK A;  1LEO A;  4Y2K A;  3CCR S;  4TVA B;  2W8K A;  1U1P A;  1XIQ A;  2H4W B;  2ZKU A;  1S59 A;  4X4V A;  4FNI A;  4N56 A;  2YH1 A;  2VDI A;  4KC5 A;  1NPK A;  3HHE A;  1SI9 A;  1NK5 A;  4OZ5 A;  1FVQ A;  3Q8R B;  1Y11 A;  2I38 A;  2YKN A;  3I82 A;  4M5G A;  2CJY B;  3RBE A;  3N79 A;  2BJ7 A;  4C98 A;  3CDE A;  3TX0 A;  5F0W A;  1T95 A;  3PW4 A;  4M5K A;  2N7C A;  2ROG A;  2CWK A;  3H25 A;  4KY3 A;  3UO0 A;  1KN6 A;  4DSK A;  4DX6 A;  1YRU A;  1LQ9 A;  1R3N A;  2M8D B;  3LUY A;  2EC2 A;  1ZPV A;  3TEG A;  2HHH F;  2HQ3 A;  1X0F A;  4W98 A;  1IM6 A;  1NPP A;  3OSP A;  2MGZ A;  3AOB A;  4FXV A;  1QUP A;  2FHM A;  2V9K A;  4IDK A;  1C1B A;  2Z2L A;  3DGV A;  1VHF A;  1VC0 A;  5LT5 A;  3QRQ A;  1MN7 A;  4KH1 B;  4OJG A;  3RAQ A;  3PDN A;  1JX4 A;  7FD1 A;  3VGU A;  3NGU A;  2ZNY A;  3CDU A;  1XC9 A;  3HUL A;  1IBL J;  1FE4 A;  4JI6 F;  5T7L A;  1FKA F;  1BE4 A;  2RQM A;  1Y9O A;  5H9F K;  2RU9 A;  3RAM A;  4C3M A;  2IBK A;  1GNK A;  2HMI A;  1H2V Z;  1I51 B;  2NXJ A;  3DRR B;  2VUG A;  4A47 A;  4IH7 A;  3M6U A;  1T03 B;  4KHP F;  1XNR J;  1RHK B;  3VGS A;  3K2Y A;  3GFY A;  2G1D A;  3SI8 A;  1AXQ A;  3TP2 A;  4NYO A;  1PBA A;  4UQT A;  4P10 A;  1T8E A;  1CJU A;  3DOL A;  4P74 A;  2G0C A;  2ROP A;  3VZI A;  1N6Q A;  1ROF A;  3T19 A;  1KP6 A;  4EGL A;  4OIX A;  1H7X A;  4BDP A;  5GAE U;  2E1R A;  4KGX B;  4PXB A;  1MML A;  3GCX P;  3FQK A;  2CQ3 A;  3T3F A;  4EZ6 A;  3MED B;  5D77 A;  4PAA A;  2H1Y A;  3HP6 A;  3BQ1 A;  4ETX A;  1KOO A;  4L3K A;  4RX6 A;  3FK4 A;  2MHE A;  1H72 C;  1UJ4 A;  2X1G A;  3LAM A;  4KBI A;  1TKX B;  5KFC A;  3BR9 A;  2LQ8 A;  3JTP A;  3KYL A;  3CCS S;  5M2P A;  1NME B;  5ETK A;  1WAC A;  1UVM A;  4J9K A;  1WEX A;  5F9N A;  1LWE B;  3KJV B;  1SVD A;  2F1F A;  1VRU A;  4LBH A;  1LFP A;  1FDB A;  3R8Y A;  4RNM A;  4B9S A;  4YS2 A;  1ZZF A;  1E6V A;  4O3S A;  3EWG A;  4XPE A;  1LKZ A;  3M8P A;  4TU8 A;  1C1C A;  1CVJ A;  1ZZN A;  3HVA A;  2C3U A;  1PIE A;  3ZZT A;  5E7O B;  4M95 A;  3GIJ A;  3TAP A;  2HIQ A;  1YK9 A;  5CYQ A;  1YJU A;  3KLH B;  1N32 F;  1RB0 A;  3Q22 A;  2Y1I A;  1GTH A;  2XY5 A;  1VCT A;  1UVI A;  4P72 A;  5IXU A;  2B7B B;  2DCL A;  2EBE A;  4I6Y A;  2KHC A;  2W1B A;  1URN A;  4Z7Y A;  2WW4 A;  2IM1 A;  2LCW A;  3MOZ A;  3OVA A;  2CDR B;  2DHA A;  2I5J B;  3DLE A;  4TN2 A;  5F3Z A;  2PI5 A;  3M2V A;  3HF5 A;  3TWZ A;  4PG8 A;  3BRE A;  3R7S B;  1KBR A;  3ISZ A;  3L9Z A;  4EBD A;  4WFZ A;  3MMC A;  4X2B A;  1X7V A;  2F8M A;  4QU6 A;  4I68 A;  4QBU A;  2VFV A;  4LF8 J;  4DL4 A;  2ASJ A;  4PZV A;  3H2L A;  3KDO A;  1NU4 A;  1FWK A;  1IKX B;  4KH0 B;  1T0T V;  3W61 A;  2UUT A;  4YB1 P;  4WYW A;  4NLD A;  4QYZ J;  1XMO F;  2DY9 A;  1KHW A;  4B9T A;  1RTJ B;  3EDQ B;  1WKK A;  1A9N B;  4DSJ A;  3BZQ A;  2KT2 A;  2CPJ A;  1U8W A;  3ZZY A;  2Y8Y A;  2CQG A;  2DB1 A;  1Q7L B;  2UU9 J;  4TKT A;  3Q8P B;  1HIY A;  1ZBT A;  2E44 A;  3PJW A;  1PYS B;  2NSB A;  2RAQ A;  3AFG A;  2O01 C;  2D3O 1;  2GIF A;  4OLO A;  1VQO S;  3BO4 A;  3HXM A;  4C0O C;  1EQ0 A;  1CC8 A;  3MEE A;  1U24 A;  2E1A A;  1EP4 A;  5KFP A;  1EX8 A;  1N36 J;  3FRY A;  2LQ9 A;  4O4G B;  5F41 A;  3MMJ A;  3D68 A;  5DJB A;  3MFI A;  2DGO A;  3CCV S;  2J7K A;  4DPT A;  2YNI B;  2F40 A;  1FJ7 A;  1CS4 B;  5E0O A;  5IQQ A;  2LA4 A;  3QT5 A;  4ECX A;  4LRF A;  3UWT A;  1VBZ A;  3D6F B;  3OR1 A;  5HLF B;  3LP2 A;  1QSS A;  4B17 A;  3CJK A;  4KR0 B;  3SV3 A;  1QLN A;  4I64 A;  4CLP A;  3P5B P;  2GIR A;  3LAN A;  3C15 A;  1SIW B;  3SCJ E;  3M05 A;  5CYM B;  2BZ2 A;  4TYA A;  4XO0 A;  1JJH A;  4A8X A;  3GSI A;  1X5T A;  4RZR A;  2C2O B;  1S49 A;  3KLF A;  3NGK A;  2WCX A;  4K2J A;  4GO5 X;  5I3U A;  3AD7 C;  4LF5 F;  2G4B A;  4DR5 J;  1S9E B;  4DZ6 A;  3SV4 A;  3NAI A;  2UV8 A;  2M9K A;  1S10 A;  5LL6 d;  1Q82 T;  4IH5 A;  1JLB B;  3U1L A;  5FLX U;  4QWE A;  3JSY A;  2HYI B;  4B3O A;  2X7I A;  2BX6 A;  2OO4 A;  3A12 A;  4LF9 F;  1ZM4 A;  2E66 A;  3LGM A;  3LP1 A;  1YBT A;  3UR3 C;  3VAK A;  2E29 A;  2KJV A;  3NGT A;  2YX4 A;  4ES1 A;  2BE2 A;  2IAJ A;  4CQ1 A;  1CQN A;  4ID8 A;  3GFH A;  1VOM A;  1JLQ A;  3UDL A;  1KHV A;  4I6W A;  2W4P A;  4M94 A;  3CVK A;  5RUB A;  4U96 A;  2ZD1 A;  1XEZ A;  4HYK A;  3ET6 B;  3W62 A;  1RWN B;  4UT4 A;  3GII A;  3KLE A;  2GQC A;  1U1R A;  3BGU A;  1X9S A;  5HRO B;  2Q6B A;  3NWR A;  5KFG A;  2RNE A;  3RG6 A;  4U7C A;  1EET A;  2XS5 A;  2ASY A;  3MR5 A;  5EGY A;  4DV3 J;  3N28 A;  3RJM B;  2W01 A;  4L6V 3;  2B4P A;  1UFL A;  1GT8 A;  5B0B A;  1IJE B;  1WHV A;  4OJH A;  1JJC B;  5M2R A;  2MJN A;  1VLO A;  4HVZ A;  4AYB D;  3KK2 A;  3BH6 B;  2BOA A;  4KFB A;  1RWV B;  3MTK A;  3W8G A;  4PPD A;  4DQR A;  1VQL S;  1X4D A;  3PIO Q;  2YBV A;  1NHK L;  3W1Y C;  4ED0 A;  2GJ2 A;  3C46 A;  5DZ6 A;  1FXR A;  3CJ4 A;  4DV7 J;  1HR0 J;  4RU2 A;  3ZC4 A;  2OLW A;  3HFV A;  2HFS A;  2RS2 A;  3L7U A;  1NJZ A;  1XK8 A;  6FD1 A;  4GO7 X;  3IM9 A;  2UUB F;  4UQG A;  3H90 A;  2D3O R;  3MM8 A;  2XMW A;  1UJ6 A;  4M1K A;  2XC9 A;  3SZ2 A;  5AJ3 J;  1RHM B;  3QIP B;  3IS9 B;  3CJ5 A;  3HK2 A;  3CIM A;  2XYG B;  2JL9 A;  5JMN A;  2VIH A;  5HVG A;  2QMW A;  2HKE A;  2H5J B;  4IG0 A;  3W9H A;  4C9D A;  2ZM6 F;  2N4C A;  4PXD A;  3ISN D;  2OD6 A;  2X3G A;  2OSQ A;  4ECT A;  4ZVR B;  1REG X;  2Z2M A;  4CM2 A;  2MKJ A;  1R0A A;  2VON A;  3ZZZ A;  2XEX A;  1HBU B;  4B9M A;  2FC8 A;  2HNZ A;  3B54 A;  2VG6 B;  2RHS B;  4OX6 A;  3J80 Y;  3G87 A;  4J9V A;  4W92 B;  1YHQ S;  5CH7 B;  2LMI A;  4LRD A;  1FK9 A;  5HMY A;  5BR8 F;  3A3N B;  3B78 A;  3MOJ B;  1RU1 A;  2V69 A;  2FLP A;  3GFX A;  1NKB A;  2XMJ A;  4QCL A;  3O6Q A;  1N5T A;  2MZR A;  2RE1 A;  2AYM A;  4RNH A;  4RW7 A;  4PWD A;  4KGK A;  3GYN A;  3PYF A;  1Q7Y T;  4LF4 F;  4DFK A;  3UN2 A;  4O4R A;  5KFX A;  1M1G A;  4Y65 A;  4P2M A;  3Q86 A;  4AE5 A;  1FFW B;  4IOB A;  3ELH A;  4PRF A;  2IVF B;  2XNR A;  3C14 A;  2RQ4 A;  5DGA A;  2HIY A;  2JEG A;  5JVH Q;  2XYP B;  1MU2 B;  3PR5 B;  3FKB A;  3P5T L;  1VQ6 S;  3ITH B;  1I1G A;  4R8U A;  1EKS A;  2CG4 A;  3TOQ A;  1WD6 A;  1S0O A;  3PR4 A;  2XO6 A;  4JOU A;  3Q8Q B;  1X4A A;  5C42 A;  1EAY C;  2YQ0 A;  1HBN A;  3FEY B;  4DV6 F;  5IV4 A;  3TAR A;  4I2Q B;  1T9W A;  3VV2 B;  5L9X A;  5KG3 A;  1TKD A;  2OUG A;  2UXD J;  4RNF A;  3EZO A;  2RF2 A;  2FJW A;  2YWK A;  4JI7 J;  1NUE A;  3DM2 B;  2O67 A;  1HQ2 A;  4NLV A;  3M8Q A;  1IBK F;  1X0P A;  1XER A;  3KK1 A;  2GA7 A;  2KXH A;  2QJ3 A;  4ZPD A;  4AL5 A;  1OIA A;  4DV5 F;  1U09 A;  1Z4U A;  2MLX A;  3R97 A;  3PRV A;  3P49 B;  2V5H G;  1FI4 A;  4DV0 F;  1MNE A;  2E5J A;  5AE2 A;  3FQL A;  3J7A N;  4DFJ A;  4AT1 B;  4OZJ A;  4FS2 A;  1ZTW A;  1VRQ C;  5E2Q A;  3OUY B;  4LFA F;  2KO1 A;  4DBQ A;  1FTR A;  2AF6 A;  2LEC A;  3KHL A;  5IZH A;  3V5R A;  2E5I A;  4QWB A;  4JI8 F;  4E8U A;  4YFU A;  4O3R A;  4EEY A;  2CJA A;  2YWH A;  5LMU F;  2UUA J;  4ZVQ B;  2OEJ A;  3TJ8 A;  1EZZ B;  1TAU A;  1VDH A;  1Q4R A;  1SKU B;  5EDW A;  1IJF B;  2VKZ G;  1WWH A;  3IAM 9;  2GAH C;  1DTQ B;  2MLY A;  3R27 A;  1UJ5 A;  1S1W B;  1Q78 A;  1FFS B;  4A8S A;  1TU0 B;  4RBU A;  2EW9 A;  1UFK A;  1YJ7 A;  3GJT B;  2OPP B;  2DXE A;  3RB3 A;  4C8Y A;  3E01 A;  1RT4 A;  1C0U A;  3UE2 A;  3BSC A;  5AXL A;  1LOU A;  2BJ8 A;  4Q2L A;  2YXL A;  1HYS A;  1B99 A;  1QJH A;  3UQS A;  1T05 A;  2ILY A;  4CTA A;  4NXN F;  2Q43 A;  5KG2 A;  2RDD A;  3QRR A;  4RW8 B;  5DGB A;  4NI2 B;  5FDL A;  3HVW A;  3SCK E;  4DV1 J;  4CDI A;  5A8W A;  4ZIV A;  5HMW A;  1R8A A;  2B4V A;  2DGS A;  5ETR A;  1YJ9 S;  1AFJ A;  4I67 A;  1FEH A;  2J9D A;  4X65 F;  3PO5 A;  3SEO A;  2FJB B;  3GIL A;  4LF7 F;  1FWL A;  4USM A;  3CMA S;  5JVG Q;  5DQG A;  3PVX A;  4ZVP B;  3JQJ A;  2LP4 A;  2HHU A;  2L9N A;  2IM0 A;  3TA1 A;  1UTA A;  2Q6C A;  1JB0 C;  3AJ2 A;  3RB0 A;  1RLD A;  4UW2 A;  1HFE L;  2C3M A;  4K0K J;  2F8H A;  1HL6 A;  5ETV A;  1XR6 A;  4MAK A;  4K7Q A;  2R7S A;  2V63 A;  1REV B;  3CJ0 A;  2F9D A;  4TNO A;  2XZD B;  1PO6 A;  3KJF B;  4PWW A;  3HKW A;  2AEJ A;  5E3P A;  4OHW A;  4DLE A;  1XBW A;  4DS4 A;  3TQE A;  2FC9 A;  3D3C J;  3CMQ A;  4ZP8 A;  3TUP A;  1R8H A;  2E5G A;  4NA1 A;  4PG5 A;  1OMS A;  2VG5 B;  2OI2 A;  4ZIT A;  1TKZ A;  2VOO A;  4IUF A;  3CC7 S;  2CPZ A;  4QW9 A;  2HS3 A;  2HFU A;  2XUL A;  1N54 B;  1JLE A;  2VU5 A;  4PWU A;  5E3C A;  1N52 B;  3DGP B;  3VVU A;  3GZ7 A;  3NCP A;  1KQK A;  3H20 A;  3RR7 A;  4ECV A;  4U8Y A;  4F4Y A;  1ZPW X;  4P2F A;  3LAL A;  5HAN A;  4FYW B;  3MXH P;  3CD7 A;  5H9E J;  2ZOM A;  4CO2 A;  5DO2 A;  1RBA A;  1U1K A;  2C1E B;  1RE1 B;  1TKT B;  3LP0 A;  4YY3 J;  3SQG B;  4DSL A;  4HI2 A;  2VBX A;  2RB7 A;  1WJ9 A;  4LQ3 A;  1UAW A;  2KRR A;  2GMJ A;  2M52 A;  3D5M A;  1UEV A;  5MLC V;  3R7B B;  4OYI A;  3OPK A;  1SL0 A;  3J7A 1;  4Z7C A;  3A3O B;  1VJQ A;  5I3Q A;  4ZVO B;  2J0W A;  3UVJ A;  4KO0 B;  3V4I B;  1J27 A;  2LFV A;  2XI2 A;  2FZC B;  3M32 A;  1QSL A;  2HHP A;  4B3S J;  1HHS A;  1RU2 A;  3PW0 A;  1HQE B;  4WP3 A;  2QX0 A;  8ATC B;  3OXF A;  4QIG A;  3GJQ B;  4LSZ B;  2GFF A;  1RWU A;  4NX9 A;  1IBC B;  2V4R A;  3RZA A;  1YIT S;  2ZZT A;  2XB2 D;  4D3H A;  4RWX A;  2GHV C;  4NLR A;  1RWX B;  4RJV A;  4F4Z A;  5C25 B;  3G6Y A;  1RWK B;  2QIF A;  3M6X A;  2AU0 A;  1RHJ B;  4BS2 A;  1ZTT A;  2RUS A;  2V6A A;  2EFP A;  2DRD A;  3BO3 A;  4M5M A;  5A0Y A;  1O0P A;  1VS3 A;  5K8P A;  1T9X A;  2FUG 9;  3UFC X;  3MM9 A;  4USV A;  1KTV A;  3V2U C;  4OYP A;  4LF6 J;  2PFD A;  2DR6 A;  3R5C A;  5GAH I;  4AL6 A;  1U25 A;  2W24 A;  4ZVF A;  3J7Y U;  3CB4 A;  4G6V B;  2ZH8 A;  3T1A A;  4CLT A;  1V3S A;  1CJK A;  4Q2M A;  5IWA J;  3KDN A;  2X51 A;  4FPI A;  4ZJL A;  2DNM A;  3IBF B;  3EVW A;  3WIU A;  2KM8 B;  1KLM A;  2RHQ B;  3QO9 B;  1FHT A;  3PYD A;  2YKM B;  1KQS R;  4USI A;  1UPM B;  2DIS A;  4DWI A;  3FMW A;  3DLG B;  3SQO P;  1QE1 B;  3VGV A;  4TU9 A;  3TAM B;  2XS2 A;  4QR0 A;  1XN9 A;  2W9B A;  4WIQ A;  3LAK A;  4RL1 A;  1KVI A;  3RW6 A;  4MIB A;  1RT7 A;  4CT8 A;  3KUG A;  3CCM S;  3ONQ A;  4WK1 A;  2BQU A;  2X3D A;  1AW0 A;  2MKH A;  2OHD A;  1HPZ A;  4ATN A;  1DY3 A;  4DV2 J;  4WZM A;  1NPR A;  3CUL A;  5KG6 A;  2HBR B;  4C0H A;  2YKO A;  2K3K A;  2FHJ A;  1AZS A;  3ILO A;  2HND A;  5KFY A;  4NXM F;  3Q8U A;  3D4J A;  2B56 A;  5KFB A;  3MWB A;  5D0E A;  4ZHR B;  2WVC A;  4ZLN A;  1TUV A;  2WTF A;  2HS0 A;  2YKN B;  1G4C A;  1NZA A;  5BYS A;  4F04 B;  1F6T A;  3ZNJ 1;  2DR9 A;  3OLB A;  2K06 A;  3K5N A;  3WQP A;  2RRB A;  1F5C A;  1IWG A;  2M8H A;  1O6X A;  3VAJ A;  3CJ8 A;  4YR2 A;  1NCL A;  1HMV A;  1FDD A;  2JVR A;  2XBP A;  1N0U A;  2VQF J;  1YZ7 A;  3MHY A;  3G6V A;  1AUD A;  1L3U A;  4RUB A;  5E5N A;  4P52 A;  2CYY A;  2IFX A;  3MCN A;  4MJK A;  4F25 A;  2QA4 G;  2J9C A;  2R7T A;  1S48 A;  5KT3 A;  4MTP A;  2E7W A;  1RHR B;  1TK5 A;  1UVK A;  2V94 A;  5J1P A;  1RLC L;  2MDA A;  2DIV A;  4ALZ A;  1Z1Z A;  3IRX A;  2GGP B;  2CA9 A;  2FHJ D;  1EB0 A;  2P6S A;  2EBG A;  1JLF B;  3T5H A;  1U1L A;  3EVO A;  3I4H X;  4WTY A;  1M90 T;  2JFK A;  2CG8 A;  3R3T A;  2KM8 C;  3OR2 A;  4A8W A;  3MPU B;  4PG4 A;  3R5A A;  5T7L B;  4LFC F;  2BMB A;  3MAH A;  3R5J B;  2MSS A;  5J1E A;  3ENV A;  2MZQ A;  4X66 F;  2D3Z A;  1RT1 A;  4ZVG A;  1HWL A;  3GFZ A;  2HFZ A;  3R6L B;  1RQ0 A;  4ETZ A;  4XIU A;  4DLG A;  3DOM B;  2LDI A;  2B9X A;  1DTT B;  3GPA A;  2CQB A;  3MEG A;  4V19 J;  3MR2 A;  5D4O A;  3QJJ A;  1Z2Z A;  1CJU B;  3DOL B;  2QG9 B;  4RLE A;  5F8L A;  3QAE A;  3LGN A;  3KG0 A;  1CJV A;  2CQP A;  3L95 X;  5HMZ A;  1WC3 A;  2QLX A;  2BVZ A;  3HJF A;  3NGR A;  3F73 A;  4DR7 J;  1TK0 A;  5DQH A;  4F26 A;  1FDA A;  1RZM A;  3NBP B;  4IG3 A;  1HNI B;  3LQV A;  2KG1 A;  1S79 A;  3SMZ A;  5A2Q Y;  1VQY A;  3QWP A;  2BDP A;  1AT1 B;  4F3O A;  1YBA A;  2W2P P;  2YX1 A;  3BGO P;  2BJD A;  4RBT A;  1VK8 A;  1ZOT A;  1U0S A;  2H65 B;  4QQB A;  3PHE A;  2DNL A;  4QIV A;  4K8R A;  1Q0N A;  1JLA A;  4USJ C;  1VC6 A;  1RAI B;  5L1K A;  3D67 A;  3KXD A;  2ZOG A;  5KG1 A;  5K20 B;  4C0B A;  4LR7 A;  2Z30 B;  4Y00 A;  3ENA A;  1UVN A;  3GG0 A;  1HBO A;  2PGC A;  3BH7 B;  3QGP A;  5L1I A;  3J81 U;  4ZPV R;  1IKY A;  4FF3 A;  4IOA Q;  3GWC A;  3H40 A;  5ETO A;  5DLG A;  1FX4 A;  4CO5 A;  2R2U A;  4N7T A;  4OJ1 A;  3W2V A;  1YBU A;  3B8H A;  3EMT A;  3H98 A;  2LLZ A;  2PII A;  1VIO A;  3RRK A;  3KHH A;  3PFO A;  1N33 J;  1Q8I A;  2QO3 A;  4LRC A;  1XNQ J;  3S6E A;  2IJN A;  1RWM B;  1RAB B;  2EK6 A;  2J8S A;  2Z0G A;  2VH7 A;  1FT8 A;  2ZH5 A;  3FBB A;  3GR1 A;  3D7S B;  3R1H A;  3K17 A;  3DHX A;  4OJ3 A;  3IWL A;  1SCJ B;  3N9U C;  2RKI A;  4R5P B;  3H4B A;  3MMC B;  1IBL F;  1TVR B;  1IVZ A;  5JUM A;  1WDT A;  4X4R A;  2WSE C;  2CPX A;  1YJT A;  1X4C A;  2ZJR Q;  2DGU A;  3KLI B;  4ZVH A;  2MQM A;  5LSL A;  4QWA A;  3TNV A;  3PTW A;  3DI6 A;  3M7V A;  3UPF A;  1XNR F;  3GCW P;  2NUH A;  2KJW A;  2E5L J;  4NLS A;  3I0S B;  1T3O A;  1WC6 A;  3L7O A;  3QZ8 A;  1U0H A;  3BM7 A;  1NDL A;  5J2P A;  1S9F A;  4X4U A;  2ZH1 A;  2I8E A;  2NR0 A;  3D0H E;  3KNA A;  2VFR A;  3KFW X;  3HDS A;  1HKA A;  2CZV C;  2DNH A;  4ZVE A;  2K1R B;  4NLQ A;  2XCP A;  4WU2 A;  4LFB J;  2V4J A;  4CT9 A;  3R6G B;  2ZBP A;  3MM5 B;  2XSJ A;  3CCL S;  3CCW A;  3ZZR A;  1XMB A;  2HQI A;  4M63 A;  1ZS6 A;  2ALY B;  3HFK A;  3M9O B;  2V50 A;  3E2E A;  2JLG A;  2DH7 A;  4LR9 A;  5L46 A;  2ZZN A;  5GAG U;  1FKO B;  1WTB A;  4OZ3 A;  1KFD A;  2O5D A;  2LU1 A;  4ED2 A;  2QEX S;  5KG7 A;  2VFT A;  2BEF A;  1YZ6 A;  2ASD A;  2W25 A;  1DJ0 A;  3LP2 B;  3GTY X;  1Q8L A;  1S6Q A;  4NML A;  1URR A;  4AL7 A;  2FJV A;  3FSI A;  4C8M A;  4ID5 A;  2UVV A;  3UCG A;  5I42 A;  4C48 A;  2H9Z A;  3ZTS A;  4ILM A;  3IG1 A;  2C2D A;  3ETO A;  4A8K A;  3DXB A;  4FVC A;  2GQ2 A;  4URS A;  5DET A;  3K7R A;  1TUG B;  1PGZ A;  4TY8 A;  1HBM A;  5HAO A;  4NLO A;  3X1L B;  3U7J A;  2BAN A;  4B9U A;  1GH8 A;  5KT5 A;  1YKW A;  1QDU B;  2RDJ A;  4USU A;  1S1X A;  2IA6 A;  5B0F A;  2ABY A;  3OW2 R;  5GMD A;  2HLU A;  4ES2 A;  1MN9 A;  4B3T J;  4E0D A;  3IC1 A;  2OFH X;  4NLW A;  3J7Z 5;  1R8C A;  3D1O A;  3QLH A;  1VRT B;  5C24 B;  4DUZ J;  4OYM A;  3JYT A;  2B9Y A;  4HH0 A;  1Q8B A;  1OY6 A;  8AT1 B;  2X1F A;  3F44 A;  4WKR A;  4WXO A;  1RAG B;  1WUU A;  2K8G A;  1HNX J;  3ICL A;  1ZAX A;  3KK3 A;  3PAC A;  3JSM B;  4ZVU B;  1S6P B;  5DDP C;  3MPD A;  2AJ4 A;  1QTM A;  2CQ2 A;  4KPC A;  3O2I A;  2M3D A;  4MMO A;  3TAQ A;  4ANC A;  4LF8 F;  3QT6 A;  2PT0 A;  4JI4 J;  4ELT A;  4ZP6 A;  4NZ0 A;  2ZD1 B;  4NLG A;  4N5S A;  1AA1 B;  2Y0S D;  2HVI A;  4B08 A;  1LK5 A;  2QYG A;  3GIR A;  1HW8 A;  1SXL A;  2KH9 A;  3QFW A;  1VQS A;  4ZPW R;  5AXN A;  3T6J A;  3HHL B;  2C3P A;  2OPS A;  2D9O A;  3D0I E;  4PYD A;  3VQT A;  2AP6 A;  3D1Q A;  5DG9 A;  1JLG A;  4DG1 A;  2UU9 F;  3BSN A;  4JI5 J;  4HTI A;  1P27 B;  3BBF A;  5DM6 Q;  2XLK A;  2DY1 A;  3C6T B;  3WDO A;  1J5O A;  4RBV A;  2YNF A;  1RYS A;  1TMM A;  3MR6 A;  2HS4 A;  2GVZ B;  2QC3 A;  4DOZ A;  5IM0 B;  3CCU S;  1IUJ A;  4HTJ A;  4G1I A;  2B6A A;  3NAH A;  2MY8 A;  5KFF A;  2NPI A;  2IVY A;  1N36 F;  1MWY A;  3I5A A;  1FA0 A;  4PPZ A;  4OLP A;  3HSG A;  1NSA A;  2I9S A;  1EAR A;  3KKF A;  3IRW P;  5J2N B;  3VZH A;  2JLE A;  3PW5 A;  2P6T A;  4ZP7 A;  2KFY A;  1DAX A;  4QYZ K;  1SH2 A;  2BXJ A;  2ZBI A;  3QMQ A;  2W2Q P;  2YNH B;  3MD3 A;  2B4U A;  4MK9 A;  2VQE J;  5D15 A;  2RD5 C;  2QT7 A;  2V2K A;  3QZ7 A;  2VAS A;  2WSF C;  3LPE A;  4CLK A;  3RRH A;  3MUM P;  3IO1 A;  2DHH A;  4DS5 A;  3R2D J;  4X84 A;  2UVW A;  1MMN A;  4EUV A;  2UZA A;  3PW7 A;  4QWC A;  3UCZ P;  3N5F A;  1F0X A;  1T9V A;  1RTH B;  3EGZ A;  1P9Q C;  3VAL A;  2YVS A;  1U2F A;  3OL9 A;  5GVQ A;  1TL3 B;  3MUV P;  2MKC A;  1LWC A;  1RT5 B;  4GVB A;  2I6W A;  2W7O A;  3I31 A;  3PXG a;  2OEL A;  4IRK A;  2BW2 A;  3FFI B;  4IFV A;  4WFY A;  5J2M B;  2JRS A;  3FZB A;  2HRY A;  1XJW B;  2PSZ A;  3MF5 A;  4P75 A;  2R7W A;  3LPY A;  3NNH A;  3OD2 A;  3SIP B;  1HNZ J;  2B9E A;  2ZDO A;  1PSD A;  3PNI A;  4EO8 A;  2DO0 A;  2D3U A;  4AD6 A;  2FQQ B;  2DR8 A;  2IJR A;  2KYZ A;  3MR3 A;  1Y5N B;  3B6B A;  4HAC B;  4K59 A;  3ZFV A;  1RSC A;  4CYU A;  3OL7 A;  1S76 D;  4ZN3 A;  4LSN B;  3KMQ A;  3FCH A;  2ZE2 B;  1SKW A;  5CQG A;  4FF1 A;  3L3C A;  1BUX A;  1S9G A;  1VC5 A;  2JX2 A;  2CJX B;  3QFH A;  2Z56 B;  4Y34 A;  4J9P A;  4WYL A;  1RT2 B;  4E2F B;  5B0E A;  3MCO A;  5D8H B;  2G2Z A;  4DV3 F;  1RT3 B;  1R0C B;  2ZJP Q;  4PR6 A;  2E9Z A;  3BKU A;  3K8W A;  4OV1 A;  4Q8E A;  1FRJ A;  2C3O A;  2DPI A;  5BXI A;  1DLO B;  2DHG A;  3CCQ S;  3T5J A;  2AJQ A;  1CLF A;  1WTF A;  2J76 E;  1R7I A;  2OEM A;  4LSL B;  3T1Y J;  4DV7 F;  1HR0 F;  3OVB A;  1RHU B;  2AKW B;  1AB8 A;  3Q8V A;  4ZPT R;  1BQM A;  2HQF A;  4PXC A;  3E51 A;  4MYT A;  3MUT P;  1HI0 P;  2WVB A;  2VKR A;  5AJ3 F;  3FJ2 A;  5KOW A;  2EKN A;  2WBR A;  3UCU P;  5F3T A;  4C7Q A;  3CJT A;  1UWB B;  2JEJ A;  3DRR A;  2CQH A;  3BJY A;  3U02 A;  1T03 A;  4PUO B;  5F8G A;  1HWU A;  3OT9 A;  3LWL A;  5KFL A;  3SYZ A;  3FGV A;  2R7U A;  2MQL A;  4ZCI A;  3TW0 A;  2QLF B;  2AEF A;  4YHH J;  3AA8 A;  1YX2 A;  3HHK A;  5U47 A;  4BHQ A;  2MKY A;  4NZ7 A;  1SL1 A;  4BWM A;  1UW9 A;  4F4K A;  2YY3 A;  3B82 A;  3W5X A;  2CIM A;  4IFY B;  3CIZ A;  3R7N B;  1IR2 A;  1NK6 A;  4ZJQ A;  2LXF A;  4QJV A;  2QA4 S;  2UXB J;  2A6M A;  4QWD A;  4X4N A;  1UVJ A;  1UA1 A;  2NYI A;  3MED A;  5DG8 A;  2KN4 A;  3CJ3 A;  2DNY A;  4ANE A;  2MYF A;  5B0D A;  3MM6 B;  2G0J A;  4YR0 A;  1J5E J;  3KG1 A;  5F9L A;  2VD3 A;  3SSS A;  1NJY A;  1TKX A;  1VI7 A;  1O51 A;  2JOQ A;  4C97 A;  2CJB A;  2VG7 B;  1MLA A;  1NJI T;  3CJQ A;  1LWE A;  1T05 B;  1NK4 A;  2GO8 A;  4CTA B;  2Y3Y A;  2CKW A;  1GFW B;  1I5O B;  2ZWO A;  5EN1 A;  2DGV A;  5FDL B;  5F8H A;  3IGV A;  3AOD A;  2LEA A;  1X4F A;  3DRS B;  1SJF A;  2KXF A;  4JI1 J;  1MRO B;  1B0V A;  1MG7 A;  5CAA A;  4ECU A;  2AZ1 A;  2DGW A;  2QLB B;  1WG1 A;  4H4O B;  4OYA A;  2WBM A;  3KLH A;  3FRZ A;  2GS8 A;  2J6T A;  4Q0B B;  5HJY A;  3S8S A;  2UXD F;  2HZA A;  4LF5 J;  3IMQ J;  1UZH A;  2FYX A;  2NCK L;  4JBC A;  3DN9 A;  2BKN A;  2YNG B;  3PG9 A;  1GTE A;  4JI7 F;  3AQP A;  4EO6 A;  4ZPB A;  1FES A;  2R7X A;  3R2C J;  1T9Y A;  2MQ8 A;  2EG2 A;  4ZCL A;  1AFI A;  1I6J A;  5KG5 A;  5B08 A;  4FF4 A;  2WSC C;  2BW7 A;  2G2O A;  1SB6 A;  2I5J A;  1HI8 A;  2C2M B;  2AGO A;  5CZV A;  3M1V B;  2A6O A;  5BYQ A;  4YME A;  3W63 A;  4DFM A;  4ZA1 A;  2IM3 A;  5IT0 A;  2DK2 A;  4FBU A;  3DLB A;  2J0S D;  4KKO B;  2OAU A;  5KT4 A;  1D09 B;  4CZC A;  3PEJ A;  4OYX A;  2IVM A;  3DOK B;  1M1K T;  1NHV A;  3J80 U;  2EKY A;  4EBC A;  1PYO B;  5KG0 A;  6AT1 B;  1WEL A;  1RTJ A;  2JHE A;  2RJZ A;  4HL9 A;  2UUA F;  2IIH A;  4CCH A;  3MM7 B;  2DNG A;  1WDD A;  5D0G A;  3QT8 A;  3UN5 A;  1SKR A;  3FCW A;  2IDL A;  4P71 A;  4NYZ A;  3QQC D;  1JNZ B;  4CH1 A;  3W65 A;  1RA7 A;  1SPB P;  2GX8 A;  4J7C A;  3MAQ A;  1QAX A;  4I0W A;  4JYA J;  1VBX A;  3NP5 A;  1VQ5 S;  3CDA A;  5KFD A;  3AOA A;  3T1H J;  4HT5 A;  1RWP B;  2VPZ B;  3ZZU A;  4KSE B;  2OGU A;  1N5Y A;  2AYE A;  1NO8 A;  3JAM Y;  4K4Y A;  3H7H B;  5LJ5 Y;  4O4G A;  3DMJ B;  4U6P A;  2J7W A;  4DF8 A;  4YDD B;  4AFF A;  2YNI A;  2KFZ A;  4V19 X;  1CS4 A;  2UV8 G;  3CF5 Q;  1K9M T;  4WK3 A;  5HL7 Q;  3H2U B;  3D54 A;  1FJG J;  2VJV A;  4ELU A;  1Y00 A;  2WRM A;  5HLF A;  3I5C A;  4WCE Q;  3HCX A;  3ILJ A;  2OH2 A;  1S4F A;  4DV1 F;  1N56 A;  3NMR A;  4URQ U;  3TUZ C;  2N3L A;  1YLX A;  5CYM A;  2MKS A;  1CJT A;  2CZ4 A;  3I0R B;  2IRY A;  4UOF A;  3PX4 A;  1NEE A;  4PAB A;  3MPW A;  1S4E A;  2DH8 A;  3CUN A;  3W7B A;  1RHQ B;  1X5P A;  2CPI A;  2RDI A;  5IOL A;  1JLC B;  4O23 A;  3D6M B;  1S0M A;  1S9E A;  1WKJ A;  2RH3 A;  1RAH B;  4AUK A;  2R2R A;  2K2P A;  1N5S A;  4Y2A A;  3V81 B;  4K0K F;  1JLB A;  4BC9 A;  3NGD A;  1KLM B;  4HKQ A;  4LMZ A;  5I4M A;  2ALZ A;  3M2U B;  4EBE A;  2YWE A;  1TQL A;  2FVR A;  5EHH A;  3FSY A;  2XY6 A;  1Q1K A;  3QSY B;  2DNZ A;  1QD1 A;  3F56 A;  2NXE A;  3CC4 S;  4FP9 A;  4FYD A;  1OYE A;  4EYI B;  2LQB A;  4LRE A;  3K0J A;  3TVK A;  4JP8 A;  4G1Q B;  2YQ3 A;  1H7W A;  1IKW B;  4V1A k;  2GNK A;  2F4V J;  2CVE A;  4NPO A;  4M5D B;  2B7C B;  1WG5 A;  4IRD A;  3ET6 A;  4DPO A;  4DU7 A;  2HEK A;  4CLL A;  3A13 A;  4IRC A;  5HP1 B;  4OHV A;  3OFF A;  5I3P A;  5HRO A;  2QRR A;  1R0B G;  5K14 B;  2KRB A;  1HD0 A;  4K4V A;  1VIS A;  3L09 A;  4CWB A;  1D1U A;  3QAT A;  2HHS A;  2CQ0 A;  4FBT A;  2MB0 B;  4YY3 F;  2AIR B;  4JV5 J;  3D28 A;  3V6H A;  1F9H A;  4M5N A;  4KAI A;  3GV8 B;  1YQH A;  1NJX A;  2DVI A;  1UET A;  4K4U A;  1JJ2 R;  1S1V B;  3IA0 A;  3DHW C;  2HFO A;  3BR8 A;  4R0E A;  2Y9H A;  2JLF A;  2PA8 D;  4ZDN A;  3ENW A;  1D3W A;  5KOX A;  4EWT A;  5GAD I;  1S7H A;  5KFW A;  3DDN A;  3Q89 A;  4LFA J;  4F2S A;  4OI0 A;  4S0M A;  3GV5 B;  3QIP A;  2PD1 A;  3IS9 A;  3CGI A;  3NG8 A;  5LOQ A;  1YI2 S;  1U48 A;  2EK1 A;  4X64 J;  2Z4P A;  1S72 S;  1VMB A;  3AAW B;  3TJA A;  2CPD A;  1FKP B;  4KTQ A;  4GKJ F;  3U27 A;  4X4T A;  4MK8 A;  5E41 A;  2F9J A;  3I55 S;  3HFZ B;  4B3M J;  5A8K B;  2WON A;  4NRU A;  1F3F A;  2XG8 A;  1LXN A;  4OYB A;  3IP0 A;  1RAE B;  1TAQ A;  3PEH A;  5H9E K;  2ZBC A;  4LJM A;  2M0G B;  3UD5 A;  1HBU A;  1VLY A;  2MST A;  4USW A;  3EPI A;  4MIW A;  5K8N A;  2IBO A;  2HNY B;  1U49 A;  1GMW A;  3FC9 A;  4W4M A;  7AT1 B;  3OR2 B;  4LF6 F;  4LF1 A;  3SDE B;  2JSX A;  4Q7A A;  4K4X A;  2O66 A;  2GHP A;  2IYG A;  4DZD A;  1XR5 A;  3IR6 B;  5KFZ A;  2AGQ A;  1UZD A;  1H98 A;  5IWA F;  3Q2T C;  3IFE A;  1CUL B;  3ILI A;  1T9T A;  2I2Y A;  4H4M B;  4ECR A;  4ELV A;  3N6N A;  1X9M A;  4LRA A;  1RP5 A;  3LW5 C;  2M88 A;  3CME S;  4B9V A;  1D9A A;  1Q86 T;  1GQE A;  4U67 Q;  4RW4 B;  1UW4 A;  1RDR A;  2VPX B;  2XGP A;  1SV5 B;  4N77 A;  3EIC A;  1SUQ B;  2EXU A;  3NNC A;  1PAU B;  1RTI B;  1T7P A;  5D78 A;  5IT4 A;  4TQR A;  5IQ6 A;  2V2V A;  1JKH B;  1UEK A;  2CJQ A;  4TYB A;  2XHW A;  3M30 B;  1NHU A;  1Q5V A;  2DNP A;  4X4Q A;  2ZNZ A;  1KR4 A;  4IQX A;  4OMF G;  4DV2 F;  1IBM J;  5HVF A;  4HI1 A;  2B5J B;  4I2Q A;  4P9S A;  1EHW A;  3KG4 A;  4J9M A;  5LXY A;  4F67 A;  1X4G A;  1GAO A;  1WNE A;  1HNV B;  1N4L A;  1TL1 B;  1G2E A;  4LBI A;  1GMW D;  4ZOS A;  1RCX B;  1WSV A;  3FEX B;  4R0J A;  4DPY A;  4ED8 A;  2PDA A;  2AHO B;  3WX4 A;  3WX8 A;  5C2G A;  1YJR A;  3I9V 9;  4JB8 B;  2DNK A;  3I9Z A;  3EZ5 A;  1FD8 A;  2HGN A;  3HVT B;  3MAA B;  2M4M A;  2Y8W A;  4F3M A;  2BUN A;  2DKO B;  4ZLP A;  4DUY J;  2YKP A;  1FO1 A;  4OHZ A;  1Q81 T;  2E1C A;  2D9P A;  3I56 S;  2BYC A;  1VHI A;  4Q5V A;  1J2V A;  4NLU A;  2PC6 A;  4Z2X A;  1W25 A;  2DTJ A;  5C2C A;  4ZIW A;  3OUY A;  1RGV A;  2ZH2 A;  1S7I A;  3DFE A;  2B0G A;  4HR2 A;  4PQU B;  3UNG C;  2RQC A;  2VQF F;  2LEB A;  4M5L A;  3SSR A;  1U1M A;  5L1J A;  3RW7 A;  3SCL E;  4UZB A;  4FN5 A;  2WW8 A;  1YJW S;  1S0N A;  4K5R A;  4JI2 J;  5E3A A;  1B3T A;  4ZPA A;  1V6H A;  2P9C A;  1B0T A;  3Q24 A;  2GIQ A;  2VJU A;  1LWF A;  5G4D A;  3DCA A;  5T41 A;  4J9Q A;  1PCA A;  2CQ4 A;  4OX7 A;  2JC0 A;  4C8Z A;  1SL2 A;  2XTJ P;  3OBI A;  3N01 A;  2DYA A;  1DTQ A;  4A8M P;  1AUS L;  3HT0 A;  3N4W A;  2A0F B;  2UP1 A;  3MMB A;  2HHT A;  2WVD A;  1S1W A;  3SCI E;  2BM0 A;  2GML A;  3AJD A;  5KFI A;  3UDV A;  4L74 A;  4DCO B;  4DR3 J;  1NK0 A;  2OPP A;  5KT6 A;  1H6K X;  4YP3 A;  4DL5 A;  1U02 A;  4N76 A;  5J2Q B;  3JS9 A;  3THP A;  4LBP A;  1G1X A;  2ERR A;  1MSW D;  2IRU A;  3H8Y A;  4UY8 5;  2FY8 A;  2HG4 A;  3SSQ A;  4I1T A;  2DR5 A;  2W7A A;  4NI2 A;  4DSI A;  2LA6 A;  1UEU A;  4WKY A;  1CSJ A;  3C16 B;  2Y1J A;  3DC2 A;  4DSF A;  2AYB A;  2H48 B;  1RAO A;  4DR7 F;  1B64 A;  5D4P A;  1NSK L;  1M5P C;  3DLJ A;  2LQ5 A;  1U4B A;  1KEK A;  3Q0A A;  1MMD A;  3T9Z A;  1DFD A;  4PCQ A;  1RTD B;  4JI0 J;  1H2T Z;  2H54 B;  2UUW A;  1LW2 B;  4I7F B;  4L76 A;  1SJQ A;  4EFA C;  3MCS A;  2BKO A;  1PC5 A;  5D6G A;  1GX6 A;  3BV8 A;  3NEK A;  4RNO A;  1S6O A;  3HMJ G;  1DZ5 A;  3KLG B;  4ZS6 A;  2ZFH A;  3NRB A;  2CXE A;  3PKY A;  1REV A;  4WP9 A;  1FRL A;  3BQ2 A;  1QAJ A;  2BJ1 A;  2XMK A;  3T41 A;  2P9E A;  4U95 A;  5KT2 A;  1FXD A;  3FUY A;  4F2R A;  2FJD B;  2QLW A;  1TUW A;  4RW9 B;  4CLS A;  2VG5 A;  3RYL A;  3KOA A;  1WG4 A;  1TMJ A;  2AW0 A;  2BAN B;  2GO9 A;  2ZH9 A;  1RIS A;  1KQG B;  4FKY A;  4DQQ A;  1VYA A;  4RW6 B;  2XLJ A;  1S6U A;  1QSY A;  2HWI A;  3V6K A;  2YWF A;  3DLK B;  2CNK B;  4QR2 A;  9RUB A;  4Y3C A;  4HEA 9;  4CLZ A;  3QSI A;  4CLW A;  3OFH A;  4MIA A;  3R9L A;  1GX5 A;  4ZKA A;  5B09 A;  1N33 F;  5KFU A;  2P8I A;  5AT1 B;  1NSQ A;  3QLH B;  1XNQ F;  4DMZ A;  3W5Y A;  1BXN A;  3RRG A;  4QPX A;  1TKT A;  3CPW R;  3SQG A;  1C4A A;  5DRK A;  4RUC A;  1WHY A;  4DX8 H;  2B3T B;  3GIM A;  4DR4 J;  2YWG A;  1JXE A;  3KK3 B;  5LSO A;  1PJ7 A;  2E7X A;  1HLW A;  1NZ8 A;  2C28 A;  4GKK J;  4NA2 A;  4D3G A;  2HWH A;  2WHO A;  2YWW A;  1S1U B;  1BY9 A;  2BM1 A;  3N6M A;  2MY7 A;  3EGV A;  4KO0 A;  3V4I A;  4CO3 A;  2BAB A;  1G3O A;  2DNN A;  2B43 A;  3OXL A;  1K8A T;  2MXY A;  8RUC A;  4M5J A;  2C2Z B;  3FBE A;  3TUI C;  1HQE A;  3VF0 B;  2NSC A;  5KT7 A;  3T5K A;  1PIL A;  2W8L A;  5A2Q U;  4GMK A;  5KFR A;  2FD2 A;  4DPW A;  2W2O P;  1VQ8 S;  3V6D B;  2OPQ B;  4H4K C;  1C0T B;  4WBF A;  2E5L F;  2BBE A;  3PX0 A;  1OY8 A;  1T9U A;  2AZ3 A;  4XAK A;  4XDC A;  1FNO A;  3NY0 A;  4O44 B;  5HK4 A;  4C8K A;  4LVN P;  4C6A A;  1KC8 T;  1RBL A;  2HRT A;  3OV7 A;  4DUT A;  5C25 A;  4WFB Q;  2MZS A;  2W9A A;  1BHN A;  2Z8Q A;  4LFB F;  2FLL A;  1JIH A;  3IBW A;  4XTT A;  3NL0 A;  1RAC B;  2DXF A;  2FLO A;  5GAE I;  2IPO B;  2VDH A;  4UUW A;  5CD4 A;  4KIA A;  5AE3 A;  3H42 A;  1ZM2 A;  3O44 A;  3GYG A;  3ADA C;  3OHB A;  1RAJ A;  1HNW J;  2BA9 A;  1IR0 A;  2DIT A;  3CD0 A;  2A2C A;  3CO0 P;  2KVQ E;  1GEH A;  3ZZ0 A;  3A8K A;  2G0I A;  1L3S A;  2M7S A;  3K89 A;  4X62 J;  3P8B B;  4NCG A;  4F3Q A;  3QO9 A;  2KT3 A;  5CAB A;  3THT A;  2YKM A;  1Y0H A;  5KFV A;  3K8V A;  3DDK A;  3DLG A;  2BV3 A;  3MMA B;  4MKA A;  1QE1 A;  2DD8 S;  4O3O A;  2W7P A;  3CT9 A;  3P96 A;  2D7S A;  1Q95 G;  3C3L A;  3TVZ A;  5CZX A;  5IS2 A;  4WP8 A;  2W9C B;  2IA0 A;  3M9M B;  4KV8 A;  4K4W A;  2OMO A;  4C2M A;  3JTO A;  3EXY A;  1D0E A;  4MH8 A;  6FDR A;  1UL3 A;  4QZV B;  4LIR A;  1SC3 B;  2Z2Y B;  2DGT A;  3J7Z T;  4CO1 A;  4B3T F;  2EPI A;  1M5S A;  4NEY A;  2XCA A;  4F50 A;  3G86 A;  3UR0 A;  2FHK A;  3HJV A;  5ETQ A;  3SFG A;  2HAF A;  4DUZ F;  2GV1 A;  1FRM A;  1ZM3 A;  2VBW A;  3FEZ A;  3HKZ D;  1OPZ A;  2R9L A;  2YKQ A;  1E6Y B;  3OFE A;  4ZHR A;  2AEM A;  3RB4 A;  1TV6 B;  3HM9 A;  1HNX F;  1DUR A;  2CFX A;  2CUY A;  3UNY A;  3CCT A;  2J8A A;  4N8O A;  4KJI A;  2EFG A;  2XMU A;  2YTC A;  4CYU B;  2R8H A;  2CPE A;  3EDR B;  1W26 A;  4JI4 F;  3G82 B;  3BF4 A;  3HX9 A;  1TL7 B;  3WBZ A;  3D3B J;  5KFO A;  2JEF A;  1S9G B;  2GW8 A;  1P1T A;  2LKZ A;  2WK4 A;  3AJ1 A;  2B8Q A;  1N5Q A;  1KLN A;  5KG4 A;  4B02 A;  1D8Y A;  4YR3 A;  2ZVI A;  3W2W B;  2JNJ A;  4YDX A;  4QPT A;  2VV5 A;  1VQP S;  1F1B B;  4ZJO A;  4DL3 A;  3PZP A;  3ZTR A;  2AJ0 A;  4A4J A;  2JDJ A;  3M2R B;  4JI5 F;  3AB4 B;  3RUB L;  4ENO A;  3P45 B;  3FNN A;  5HMX A;  2MZJ A;  2WOM B;  3CDW A;  1DAR A;  4JI3 J;  2V8D A;  2GGP A;  3LA0 A;  4F4A A;  3ZTO A;  4BBY A;  2AWZ A;  3KLV A;  3DRX A;  2IC3 B;  1LK7 A;  2X1B A;  3RU0 A;  1JLF A;  3CED A;  4ICL B;  2XS7 A;  2WVF A;  1OJ4 A;  1BQM B;  2C3Y A;  2ZKT A;  3MEK A;  3TA2 A;  5G0R B;  4K4S A;  4DR1 J;  3ZNU A;  3PM9 A;  3KMS A;  4C11 B;  1RTZ A;  3D6T B;  3M9N B;  1ULR A;  2IM2 A;  3NXZ A;  4USH A;  2OKQ A;  3MCM A;  1JWW A;  1F2H A;  4I56 A;  2MKI A;  1HHQ A;  2QZ8 A;  4WZQ A;  1NXI A;  2FDN A;  3DOM A;  2MKK A;  5HSP A;  1DTT A;  5D0H A;  2CJ9 A;  2VQE F;  3J81 j;  1X4H A;  1ZH5 A;  2VHG A;  2QL5 B;  3OFG A;  2D41 A;  3MDF A;  2G1H A;  2DBB A;  1I94 J;  3VAF A;  2ZC3 A;  4WE1 B;  2J6U A;  4N41 A;  3POT B;  2QSF A;  4Q45 A;  2J9D E;  4CRJ A;  5B0C A;  3BYR A;  3MI7 X;  3MD1 A;  3HO1 A;  2HQD A;  3TA0 A;  3D1H A;  3ZZO A;  3NBP A;  1KNZ A;  4WXW A;  1HNI A;  1NK7 A;  1GMU A;  1N48 A;  3C2P A;  7FDR A;  4OI4 A;  1SKS A;  4AQY J;  1UWA A;  2V9W A;  1JJ4 A;  3H5Y A;  3DRP B;  3HHD A;  2XZT B;  2ZIT A;  4RKU C;  3W9I A;  4WU3 A;  2GVD B;  3R5D A;  4A8F A;  2XNQ A;  3I6P A;  4ZN1 A;  1JXV A;  4YOE A;  4DL0 C;  4L3N A;  4UOC A;  2UUC J;  4AXJ A;  4U7U K;  4RO0 A;  4OZ2 A;  3ZTP A;  1HNZ F;  2B9W A;  4NEZ A;  2CRL A;  4NLT A;  5DZ7 A;  5HBM B;  4ZCK A;  3TVY A;  1Q5Y A;  1BQX A;  2VIC A;  1QUV A;  3VR1 A;  3G4S S;  1HQU B;  3O5T B;  4PKD B;  2GAG C;  4QIF A;  3R1L A;  1H2U X;  3PKM A;  3NS6 A;  4K50 A;  5LSR A;  4C3K A;  1LW0 B;  4J9U E;  3OTB A;  4NLP A;  3PW2 A;  3MGJ A;  2XO7 A;  1U2C A;  2AX1 A;  3WC0 A;  1SH0 A;  1S57 A;  2HVD A;  4ZP9 A;  4EI2 A;  3D6H B;  2QE5 A;  2XM3 A;  5AXK A;  2IY5 B;  2HWT A;  4FZV A;  3PRB A;  1OSD A;  5KAK A;  1GXU A;  4MFB B;  1YRX A;  3CCZ A;  1IKV B;  4FYY B;  4ILR A;  2FJX A;  1CC7 A;  4HHJ A;  5T14 A;  3I5B A;  4EK2 A;  3BGR B;  5L38 A;  1B7F A;  5KFS A;  1HW9 A;  2BAC A;  1S1T B;  5GMK a;  3QJL A;  1QVF R;  1OO0 B;  1QAI A;  2GJI A;  1Q53 A;  3BQ0 A;  1T11 A;  3T1Y F;  2IYI A;  5D3G B;  3TJ9 A;  4W90 B;  2KG0 A;  4EZ9 A;  4G3I A;  1S5Z A;  3DYA B;  2AYG A;  3GJS B;  2R3V A;  3LGH A;  4R5P A;  1Y5I B;  1UPP A;  2AJ2 A;  1TVR A;  2HFV A;  1RAD B;  3Q8Y A;  3LF0 A;  3H2V E;  3KLI A;  3N0V A;  5B7W A;  1ZA2 B;  5IT9 Y;  1NKC A;  4EMD A;  3HHN B;  2CAD A;  1V5V A;  2A3J A;  2C2K B;  2XWX A;  4RPF A;  3C6U B;  1O8B A;  2KB2 A;  3L4B C;  4NCB A;  1BD6 A;  3I0S A;  1R8B A;  2HPU A;  5C7P A;  4YHH F;  3BBC A;  4FNH A;  1D9F A;  4Q8F A;  1RWW B;  1FNX H;  3M8W A;  1UKU A;  4J91 A;  4CNZ A;  3T5L A;  2K1R A;  3L7P A;  4RUH A;  2J7U A;  1FRK A;  1U2R A;  4KYZ A;  3CD5 A;  2UXB F;  2OIH A;  2FPH X;  4FDF A;  2ZH6 A;  1APS A;  3MM5 A;  2NYH A;  4J9N A;  1N5Y B;  4RUA A;  3TQ1 A;  3PX6 A;  3AD9 C;  3PY8 A;  2HZC A;  2E9T A;  1J5E F;  1B70 B;  2Z57 B;  4KQZ A;  4OQJ A;  1FKO A;  1X60 A;  4DL2 A;  3HSD A;  1L3V A;  5KFA A;  2F63 A;  4DR6 J;  2BJ3 A;  1EJ7 L;  1KFS A;  4JV1 A;  2QA1 A;  3H5U A;  2FB0 A;  2LXU A;  3MZI A;  2VPW B;  2ZHO A;  4J9L A;  2KZM A;  3TEH B;  2MGZ B;  1N0V C;  3JB9 k;  2XHC A;  4OI1 A;  4WF9 Q;  2IJF A;  1K1Q A;  5FII A;  4YEA A;  2L48 A;  4JI1 F;  3FVY A;  2R8I A;  2JZ5 A;  5DDQ C;  3H0P A;  1W2I A;  3AQO A;  4IDK B;  1C1B B;  4C8N A;  5DQI A;  4E98 A;  3NOC A;  2CNN B;  2DH9 A;  4WJB A;  1T94 A;  1CJT B;  5AXM A;  1C2P A;  4DI6 A;  2PEH A;  3DNC A;  2KZZ A;  4ZCM A;  4Q43 A;  2MMY A;  3GB0 A;  5IFM A;  5HI7 A;  2EWH A;  1UMJ A;  5CYJ A;  3JSR A;  2CJK A;  3HPO A;  1NRK A;  2C22 A;  2POK A;  2KKH A;  4NCA A;  4DPU A;  2QA2 A;  2XMT A;  2HMI B;  3VAH A;  1ZAW A;  4DXL A;  4MK7 A;  2MQP A;  2HGL A;  5FD1 A;  3AOC A;  5IC4 B;  2H5E A;  3G8T A;  1L3T A;  1KRP A;  1B0P A;  3RBD A;  1BGX T;  1JXL A;  2NQP A;  4F36 A;  1VRT A;  5C24 A;  1NDK A;  3QPI A;  4K4T A;  4DCP B;  4NL5 A;  1R6Y A;  2B4O A;  3BS9 A;  1N5V A;  1KS2 A;  1N6Q B;  1BWV A;  2QL9 B;  3Q83 A;  2JFD A;  3QGG A;  3JSM A;  1SH3 A;  1OQ3 A;  1S6P A;  3BKT A;  2BJE A;  2OPR A;  2CNO B;  1WI6 A;  3DKD A;  2E1P A;  3KJN B;  3OTO J;  1RI7 A;  1M5V C;  5GAH U;  1RKJ A;  1KKH A;  4DV4 J;  1XMQ J;  3C66 A;  3GLJ A;  1YWX A;  1F5B A;  3HHL A;  3CO9 A;  4O0I A;  3MPV A;  1B4S A;  2D1C A;  2HVE A;  3DU6 A;  4NZ6 A;  1OSC A;  2AMC B;  3IWX A;  1SJ3 P;  1PG5 B;  2J0X A;  2HW3 A;  2RU3 A;  2BRL A;  2KHD A;  3B4D A;  2MPU A;  5ETL A;  1VRU B;  1WF2 A;  1F3V A;  3H5S A;  2J5A A;  5E3Q A;  1UP1 A;  1GMV A;  4JYA F;  1FTC A;  1E6V B;  3C6T A;  1A0O B;  4OHX A;  3T1H F;  2UXC J;  1WI8 A;  1MWZ A;  5JJB A;  3M8P B;  1IM4 A;  1PBU A;  1C1C B;  2HFN A;  4J5O A;  1SIZ A;  2GVZ A;  5IM0 A;  1H38 A;  1SC1 B;  3M6V A;  1UFW A;  2DRA A;  3IAS 9;  3UI3 A;  5CYQ B;  4Y0F A;  2R8K A;  1FVS A;  5F8N A;  3THV A;  3PJX A;  2PMH A;  1KD1 T;  3QBC A;  4GC7 A;  4ECZ A;  2BOP A;  4XDD A;  2V34 A;  4ITS A;  1P8G A;  2L08 A;  3RGI A;  1JMT A;  3ULH A;  3RR8 A;  4DPX A;  2ZWP A;  1RT6 A;  3PYE A;  1IWA A;  4DF4 A;  1FJG F;  2LEP A;  4OL8 A;  2B8P A;  2A10 A;  5J2N A;  2NZ4 A;  2WVE A;  2YNH A;  2C42 A;  2WON B;  1KQF B;  4MKV A;  3QGH A;  1KSP A;  5C5J A;  2LVW A;  3DLE B;  3M2V B;  2PN6 A;  9ATC B;  3HHL D;  4FPR A;  3N5B A;  2G9O A;  2EFO A;  2ZC4 A;  3W5Z A;  5LMN J;  1IR1 A;  4YB6 A;  4B3R J;  1IQT A;  2BR0 A;  1RTH A;  3QJP A;  4N47 A;  3CTR A;  3UDE A;  1FJE B;  4Q44 A;  4YQW A;  1TL3 A;  1TK8 A;  4F8R A;  4OX9 J;  1RT5 A;  2B51 A;  2XQC A;  2DHX A;  4DR2 J;  3FFI A;  2CQI A;  1VQ7 S;  5J2M A;  1H3D A;  3EE3 A;  4TY9 A;  3PYG A;  4IR9 A;  1S12 A;  3OTE A;  5ITH A;  2COL A;  1V5I B;  4UOH A;  5HQ8 A;  2PE8 A;  3JXO A;  3LH2 S;  2XMM A;  3CJS A;  3GG1 A;  2GQQ A;  5B0A A;  1LV5 A;  2HSE B;  3MEC A;  3HI9 A;  2NS1 B;  1XWL A;  3M6W A;  4DN9 A;  1G6B A;  4YB7 A;  1GXL A;  2AJ1 A;  4MT1 A;  2IDE A;  4HDG A;  1RUS A;  1G7C B;  2R7Q A;  4HAC A;  1ZAV A;  2N82 B;  2DR7 A;  3QID A;  2KXN B;  4QIE A;  2ZHB A;  2MJU A;  3ETM A;  2CPY A;  4LSN A;  2F4V F;  2ZE2 A;  4QOT A;  3MEE B;  3GJR B;  5SUH A;  2MZT A;  1EP4 B;  2VFU A;  4A8O A;  1TFW A;  2NUU G;  1F2G A;  3K57 A;  4J9R A;  4OI3 A;  5DM7 Q;  1RT2 A;  4KB7 A;  3NNA A;  2DO4 A;  3JAM U;  3E3X A;  1FFG B;  1RT3 A;  3CWJ A;  2E5H A;  2FIU A;  1WOS A;  1VK3 A;  3G6E S;  4CLU A;  2QFI A;  2BKP A;  3UW1 A;  3OR1 B;  1FE0 A;  1DLO A;  4I6A A;  4JV5 F;  2WAQ D;  3CJK B;  3WZ0 A;  4HHH A;  1N34 J;  4GVL A;  2EI5 A;  2NLW A;  1S0V A;  4PYA A;  3AXM A;  1CBK A;  1KWM A;  2VOD A;  3C15 B;  4LSL A;  4NAS A;  2ASL A;  1DQA A;  2MHN A;  2NPF A;  2F5G A;  3BBB A;  3K5O A;  3VAI A;  3BDE A;  2FGO A;  2RRA A;  3KLF B;  1M0S A;  2VC0 A;  3D9B A;  2EFQ A;  2N4D A;  1X5S A;  4DEZ A;  5EX0 A;  2QGF B;  5I3U B;  4ZK7 M;  3JQM A;  1HD1 A;  1UWB A;  4X64 F;  2OTL S;  5M2U A;  1UA0 A;  5EWE A;  3CD6 S;  4U9R A;  2DEJ A;  1K73 T;  1XR7 A;  4PUO A;  3FDS A;  4B3M F;  1HAR A;  4B3O B;  4LF2 A;  1YGY A;  1QTN B;  5CA5 A;  2W4C A;  1OPI A;  3BSO A;  5A6P A;  3HZG A;  3W60 A;  3LP1 B;  2AJF E;  1X8D A;  2VL1 A;  1YJN S;  1LWF B;  3OL6 A;  2ADB A;  3VAM A;  3ILL A;  1PJ6 A;  2BE2 B;  2IAJ B;  4IFY A;  2QL7 B;  2V2Z A;  4I2P A;  4JV2 A;  4ECS A;  3T9N A;  5H9F J;  4ED1 A;  1JLQ B;  4CI0 B;  3KUE A;  3MMB B;  1SJ4 P;  2J0Q D;  2APO A;  3M8S A;  1YVF A;  2GC8 A;  2N3O A;  3G71 S;  3MM6 A;  3G96 A;  3KLE B;  1S99 A;  3OTD A;  1X31 C;  4U8V A;  3J7Y I;  3G8S A;  3NMA A;  5GME A;  2VG7 A;  2MQN A;  1O5J A;  1EET B;  5L39 A;  1P9Y A;  4QR1 A;  1OQ6 A;  2HHH J;  3GYX B;  3HT3 A;  2V68 A;  1V9O A;  4YUD A;  1QY7 A;  3V4M A;  4IR1 A;  2KYX A;  2AD9 A;  2DNO A;  3KK2 B;  3W8P A;  2P9G A;  4KFB B;  3DRS A;  1ARO P;  5KFN A;  1MRO A;  1YIJ S;  2MZ1 A;  1CEZ A;  3K59 A;  2E9R X;  4X4S A;  5CCM A;  1WOO A;  3BKF A;  5JXS A;  3GU0 A;  1T02 A;  1KVK A;  3BYP A;  4H4O A;  3CCE S;  4WFA Q;  1JNR B;  2OSR A;  1IBM F;  2BRK A;  1X4B A;  4Q0B A;  3MM8 B;  4JI6 J;  3JQK A;  2RVJ A;  4JV0 A;  4C4W A;  3VAG A;  3TI0 A;  3QWU A;  2XGQ A;  1KOH A;  2YNG A;  4OI2 A;  4TLQ A;  1A7G E;  3W3S A;  2D74 B;  4KHP J;  1TEL A;  3RBX A;  4MKY A;  3OXG A;  4IG0 B;  2WB1 D;  4NYP A;  3ENQ A;  1BQN A;  1UCN A;  3BPS P;  4TXS A;  2PI4 A;  3BPD A;  5A8R A;  4RR5 A;  2XMV A;  4DUY F;  4ED3 A;  1R0A B;  3M1V A;  5D0R A;  1EKR A;  4Y28 C;  1S97 A;  3C19 A;  3RBZ A;  5CD4 H;  2HNZ B;  3IXQ A;  2Q66 A;  1EQM A;  2GHW A;  4KKO A;  2JWN A;  4Y2I A;  1FK9 B;  3FSX A;  5DDO C;  4DR5 F;  2YPZ A;  3DOK A;  2XZW A;  3DLH A;  4NOH A;  2RML A;  3TRG A;  1KVJ A;  1FRH A;  2QN6 B;  4X4P A;  4RW7 B;  4PWD B;  1F9E B;  3GMG A;  4NE9 C;  2VFS A;  4JI2 F;  2L9W A;  2VOP A;  3MM7 A;  4C8L A;  2FVQ A;  3O1L A;  1IN0 A;  2DHS A;  2MLZ A;  3GQC A;  1BLU A;  3NKY A;  5ETT A;  4A48 A;  3ISN C;  3C14 B;  4L72 B;  3EZU A;  2LDY A;  2BQR A;  4IKA A;  1TL5 A;  3IM8 A;  3WIV A;  5A6W A;  3HHL C;  2KL8 A;  4DL7 A;  2JC1 A;  3K5M A;  5B0G A;  4R8U B;  4FXW A;  1OWX A;  5F0U A;  5K9F A;  5KFK A;  1WKL A;  4DR3 F;  1RYR A;  2BE9 B;  5C42 B;  1Q16 B;  1HBN B;  5EUH A;  2SXL A;  2CAJ A;  1N32 J;  3DMJ A;  3OHA A;  2ZOF A;  4IH6 A;  2PMW A;  1VFJ A;  1LXJ A;  2RF2 B;  3TO8 A;  4UY8 T;  4LR8 A;  2WZ1 A;  1NH8 A;  4GKJ J;  2U2F A;  4OFZ A;  5ETP A;  3M8Q B;  4H54 A;  2W4D A;  1RXO B;  3KK1 B;  1V3R A;  3NLC A;  2V8H A;  3VGT A;  1K47 A;  4I69 A;  1I3O B;  3H59 A;  4ZVS B;  4ILL A;  1WC0 A;  2ZDP A;  3I0R A;  4P73 A;  1NND A;  1SC6 A;  5KFM A;  2L9D A;  3EX7 B;  3QYY A;  2EFN A;  1R89 A;  1VBK A;  4JI0 F;  4HHU A;  4C3L A;  1JLC A;  1WC5 A;  1NM2 A;  1NB2 A;  2CPH A;  4ZMM A;  1FDN A;  1ZET A;  1U1N A;  4URG A;  3O8W A;  1FCA A;  2Q79 A;  3B4M A;  5FLX Y;  1ZYQ A;  3FMB A;  3KJQ B;  4HT7 A;  3E8O A;  4BLG A;  2K7J A;  1XMO J;  4CO0 A;  2R7R A;  2DIU A;  3V81 A;  2FLN A;  3IN5 A;  2V8P A;  4ZLL A;  3VVT A;  5L9N A;  1RJJ A;  1SQG A;  3A8I A;  4NCG B;  1BWE A;  3M2U A;  3NS7 B;  4RNN A;  2DT9 A;  2RUG A;  3FBF A;  2VZ9 A;  1IQZ A;  2DGQ A;  2GMH A;  2HBZ B;  3EVM A;  2DRB A;  2DGX A;  2P2C B;  1NKE A;  5HJX A;  2CWX A;  3D2W A;  2AT1 B;  4BC7 A;  2FZG B;  1C4C A;  4IO9 Q;  3P3D A;  2H5I B;  4KRW A;  4G1Q A;  1TZ0 A;  2F3J A;  4KV8 B;  3KUH A;  3G2X A;  4OX8 A;  1IKW A;  3NOG A;  2HUR A;  4M5D A;  3AHP A;  1NLK L;  2XSF A;  3EUN A;  5HP1 A;  4MYU A;  3E01 B;  1PAE X;  1RT4 B;  1VQK S;  1C0U B;  1PYT A;  1Y3K A;  5KFJ A;  4P6Q A;  2VB6 A;  5K14 A;  1TFY A;  2KDO A;  1HYS B;  1QM9 A;  3GSD A;  2ZJQ Q;  1FD2 A;  3KJV A;  2V8V A;  2NXC A;  1FNM A;  1H73 A;  2KI2 A;  4OYZ A;  3EPG A;  3GV7 B;  4F0M A;  5A8W B;  1ZA1 B;  4DR4 F;  2KU7 A;  1BMQ B;  2ADC A;  5HVH A;  2C2E A;  2LXI A;  4F0K A;  4Y2M A;  1S1V A;  3R5B A;  4DJB A;  4Z37 A;  4GKK F;  5F8J A;  3W66 A;  4CIO A;  2XWY A;  1KDN A;  2C2R A;  2JEI A;  4ZVT B;  4F4W A;  1M1H A;  2EEY A;  2V8G A;  4CLY A;  2DNR A;  5EWF A;  1QVG R;  5D4N A;  4F02 A;  1WOP A;  2PO4 A;  2EFV A;  4OYO A;  3SXL A;  4RU9 A;  5DLF A;  1Y7P A;  1M5K C;  4P2X A;  2OFG X;  1FKP A;  2QMU B;  4J90 A;  5J1N A;  5F8I A;  2HLT A;  4DHV A;  5ETN A;  3DXS X;  3LOU A;  2IMO A;  5A8K A;  3HD1 A;  2HHQ A;  3Q23 A;  4LF9 J;  4DQS A;  3AY0 A;  3IR5 B;  2LYV A;  1UVL A;  3A4T A;  2P5V A;  2F4F A;  4K2X A;  4M5H A;  4AXI A;  3H5X A;  2D69 A;  3M4X A;  2HNY A;  1ITP A;  3QRP A;  3ZXW A;  3CXC R;  1TKZ B;  3G6X A;  2VBY A;  3BGF A;  2V2Q A;  1OYD A;  1HNW F;  3SDE A;  1Y5L B;  2XMA A;  2H4Y B;  1JLE B;  2MEW A;  3EM1 A;  4I4B A;  3QAU A;  1IKX A;  4UF4 A;  4A46 A;  2O3D A;  5GAG I;  1OS5 A;  1CUL A;  3GR0 A;  4H4M A;  2FZK B;  4X62 F;  5FJ4 A;  2R2T A;  2Y1L B;  2FTR A;  3F0N A;  2RT3 A;  4RW4 A;  2OP5 A;  4EU0 A;  4PG7 A;  1X5O A;  3LP0 B;  1SV5 A;  4FVM A;  4HH1 A;  1LWX A;  1SUQ A;  1QAY A;  1RTI A;  4FYX B;  4HLB A;  2H51 B;  1JKH A;  1RAA B;  3K5P A;  4L73 A;  3M30 A;  5BYR A;  3UVJ B;  2QMX A;  4R25 A;  3G9C A;  1FWP A;  4NA3 A;  3M32 B;  4P2S A;  3UD3 P;  2UUB J;  4OYW A;  2B5J A;  4ES3 A;  2JVO A;  5HQL A;  2HRU A;  1WEY A;  1HHT P;  2DPJ A;  1HNV A;  2F7V A;  2GCF A;  1TL1 A;  5DDR C;  4ECW A;  1SJR A;  1HI1 A;  2Q3P A;  5HQM A;  3UN3 A;  4MKB A;  3UDC A;  4DQI A;  1K0T A;  4ER8 A;  3D66 A;  1F9F A;  3O3L A;  4YB5 A;  1YRT A;  2ZM6 J;  3HVT A;  3MAA A;  3OVS A;  4M5I A;  1WF0 A;  1RK8 A;  4EYH B;  2VA2 A;  2AV5 A;  1DQ8 A;  2Y1R I;  2LQJ A;  1YDL A;  2CZ9 A;  4ERD A;  3BSA A;  4NWB A;  1F60 B;  5A0Y B;  2HBQ B;  5LXR A;  4CP5 A;  1K44 A;  3MM9 B;  2BQ3 A;  4U7U D;  1WC4 A;  2CQD A;  5D4L A;  2J9E A;  3TYT A;  1U1O A;  2V67 A;  1F5A A;  4O3P A;  3W64 A;  4PQU A;  2R42 A;  4LT6 A;  5BR8 J;  1U45 A;  2CNL B;  2HBY B;  1U6B A;  2CQC A;  2RRN A;  2YPY A;  1CJK B;  4OZN A;  2NXN A;  2AGP A;  2HAI A;  5CCL A;  3TR5 A;  1PKU A;  3S1T A;  4KPY A;  3AT1 B;  1HWJ A;  4LF4 J;  4LRB A;  4G65 A;  1R43 A;  1YTY A;  1FRI A;  3Q8S B;  3IWN C;  3TAN A;  3TUJ C;  5IV3 A;  4JI3 F;  2I1R A;  2EVZ A;  3OTC A;  1X4E A;  2W9B B;  4M8L A;  3R5G A;  1NDC A;  1NJW A;  3VHQ A;  4OHY A;  1RT7 B;  4CH7 A;  1U6Z A;  3BEG B;  2QTW A;  1R31 A;  3HZE A;  4DR1 F;  4XK8 C;  2YKA A;  1Q8K A;  1U26 A;  2CVI A;  4UST A;  4NRT A;  3GON A;  2DJW A;  5K5M A;  1HPZ B;  4DV6 J;  4J37 A;  2MQO A;  1FX2 A;  2ZHA A;  3DLL Q;  5J2Q A;  2DEI A;  3GIK A;  2JH3 A;  3SBM A;  2Y0B B;  1TTH B;  1V3Z A;  2OD4 A;  1AZS B;  2HND B;  1RAF B;  1PC4 A;  3NCQ A;  4F4X A;  2QLJ B;  1RKI A;  3CW2 C;  1FXL A;  1IBK J;  4P7V A;  2R7V A;  1I94 F;  3BDP A;  4LUB A;  3AB2 B;  1M5O C;  3C16 A;  4FS1 A;  1YJV A;  4H4K A;  4DV5 J;  1VR6 A;  2I0X A;  1WSR A;  2U1A A;  2IMW P;  4OZL A;  2CDQ A;  2O1P A;  4DV0 J;  4BCA A;  4AQY F;  3VTI A;  1RTD A;  4ED6 A;  4B3S F;  2CQ1 A;  1Y4Z B;  2K3I A;  3IR7 B;  3EYZ A;  1NK8 A;  1LW2 A;  4I7F A;  1HMV B;  2YX7 A;  2L41 A;  2NRE A;  4IO1 A;  3BN7 A;  2UUC F;  4JI8 J;  1NB7 A;  4LIW A;  4DU8 A;  3KLG A;  1L5U A;  2UVU A;  2IHR 1;  2ZUG A;  4G1P A;  5KTQ A;  5KFQ A;  3HVR A;  1P1L A;  1BC6 A;  3KHR A;  4A8Y A;  2F65 A;  5LMU J;  2Q1L A;  3V6J A;  1NAQ A;  2RQK A;  2KTQ A;  1U6F A;  3IRX B;  1VQ4 S;  1VGY A;  2XLI A;  4RW9 A;  3KHG A;  3A1Y G;  4N8N A;  2ACM A;  3QGI A;  3DDI A;  2VG6 A;  2E7V A;  4UUX A;  3D0G E;  5KFE A;  4ED5 A;  2YQ1 A;  3HSZ A;  4Y6I A;  3M8Y A;  1VQ9 S;  4WWS A;  3MFH A;  4RW6 A;  2JJ4 D;  4KE5 A;  1H74 A;  5J1E B;  1DQ9 A;  1SJ1 A;  4FF2 A;  5DS7 A;  3DLK A;  1RT1 B;  2PFF B;  2ACY A;  4IQM A;  3ZZP A;  2X1A A;  2HHW A;  2ROE A;  3S01 A;  4UZC A;  2ZZM A;  1FEE A;  4GRS A;  3RTV A;  4USK A;  3A3P B;  3OL8 A;  4DSE A;  2NZC A;  3MEG B;  2RIJ A;  3ZO7 A;  4O0N A;  1GXT A;  2G13 A;  4NXN J;  4GC6 A;  1SQE A;  2R4F A;  1A6L A;  4TU7 A;  4KHM A;  2FGC A;  1T3N A;  1D8Z A;  1CJV B;  3I32 A;  5DG7 A;  4QYR A;  1W2B R;  1MU2 A;  2OPR B;  1TR0 A;  3ITH A;  3K5L A;  3WC2 A;  1S1U A;  4ECQ A;  4X65 J;  4IG3 B;  5CXT A;  1TL4 A;  2WB4 A;  2MTL A;  4LF7 J;  4OI6 A;  2R2S A;  5CHC B;  1Y10 A;  1NK9 A;  1XQI A;  2NXU A;  3V6D A;  3EGN A;  5L8R C;  2OPQ A;  1C0T A;  5ETS A;  1KON A;  3HLU A;  4ED4 A;  2Z2Z A;  4O44 A;  4IYQ A;  3DM2 A;  1FRX A;  2DXD A;  1HWI A;  1JLA B;  2KFN A;  2OTJ S;  1OY9 A;  1FJC A;  3VCD A;  3TZW A;  2DCU B;  2FVC A;  3PCO B;  4B9N A;  2HHV A;  1EIY B;  1WEZ A;  4WTO B;  1S77 D;  1NSP A;  1CQM A;  4XPC A;  5E33 A;  1MW7 A;  1U47 A;  1HBO B;  5LJ3 Y;  3OSN A;  1R6V A;  3HSJ A;  4DX7 A;  1AYE A;  1IKY B;  1TP7 A;  3OJU A;  3AD8 C;  3CDB A;  1LNQ A;  1HA1 A;  2R7O A;  4B9L A;  1RCO B;  1VQN S;  4Y2C A;  3JSB A;  3IGN A;  2ZH4 A;  4IOC Q;  4DR6 F;  1RT6 B;  3W2V B;  4PG6 A;  2XYH B;  3FBC A;  5A76 A;  5LM7 E;  1RA6 A;  1MWQ A;  4J9S A;  2HGM A;  3T6B A;  4FYV B;  2N7Y A;  3LTO A;  2R8J A;  4PXE A;  5KFT A;  3GE9 A;  4O3Q A;  3MMA A;  1NH7 A;  3HD2 A;  1XTZ A;  2W2N P;  2HK3 A;  4FKX A;  3LWM A;  1M5H A;  2ILZ A;  2RKI B;  2OJ3 A;  4YN3 B;  2W9C A;  2EG1 A;  4QU7 A;  2FVP A;  3FCV A;  4JUZ A;  1VIX A;  4K4Z A;  1ELO A;  3EGW B;  5GAD U;  1R27 B;  3OLA A;  1JK9 B;  4KT0 C;  3DRY A;  3BB5 A;  3TZZ A;  3P6Y C;  2ATL A;  5HO4 A;  3DI6 B;  1ICE B;  3KNG A;  3A8J A;  3NWG A;  2VBZ A;  2FJE B;  3MPY A;  2RS8 A;  2R8G A;  5IT9 U;  2HK2 A;  1JQG A;  4KHR A;  3X3U A;  3CJR A;  5HN0 A;  1U0H B;  2A1B A;  1FER A;  3JTN A;  5J2P B;  2QV6 A;  1DRZ A;  4RW8 A;  3MEC B;  2ZH7 A;  4WPA A;  2OEK A;  1E6Y A;  2L3M A;  1TV6 A;  4KGZ B;  3OJS A;  2XY7 A;  2CPF A;  2ZH3 A;  4QW8 A;  2V4J B;  1NBE B;  5F8M A;  2XI3 A;  2KT5 A;  2Z58 B;  3G82 A;  2XSJ B;  3BGL A;  3I87 A;  3OTO F;  1TL7 A;  5IC6 B;  2HVZ A;  4DFP A;  3Q2S C;  3A8E A;  2K7K A;  4DV4 F;  1YG0 A;  4RWW A;  1XMQ F;  2M70 A;  1WHX A;  4WII A;  2ZUA A;  1D9D A;  1K1S A;  3W2W A;  1GK8 A;  3MTJ A;  3OQ2 A;  3BO2 A;  2VF3 A;  3M2R A;  2HQG A;  2V0N A;  1VQM S;  2FJA B;  1WHW A;  1S6Q B;  2EC0 A;  2WOM A;  5MAO A;  2VC1 A;  2YH0 A;  3NS5 A;  2ZVS A;  2GJF A;  4ID5 B;  3UD4 P;  1Z2L A;  1WC1 A;  5I42 B;  2UVR A;  2UXC F;  1RWO B;  4F0H A;  2HQC A;  4KGV B;  3IG1 B;  4DL6 A;  2IC3 A;  3TZY A;  5K8M A;  4A8Q A;  3EXC X;  4ICL A;  1IXK A;  2OML A;  4TY8 B;  4DCJ B;  1HBM B;  5G0R A;  4ZLJ A;  2DNQ A;  3EJM A;  2ZBQ A;  4K5S A;  4ZPC A;  4C11 A;  2FHO B;  2V4Q A;  5KFH A;  1Q79 A;  3VQS A;  1S1X B;  3DGP A;  2FVS A;  3PJ9 A;  3US5 A;  3U1N A;  3DU5 A;  4CM0 A;  1P6T A;  1SBR A;  2RSQ A;  5THW A;  4NXM J;  2PMZ D;  2QFJ A;  5EX3 A;  3CNQ P;  1CG2 A;  3KTQ A;  2A2D A;  3SFU A;  1RBO B;  4CLF A;  1U1Q A;  3JYT B;  4FXD A;  4DN0 A;  4WE1 A;  3VWS A;  3CC2 S;  4WFX A;  3POT A;  4QIW D;  5LMN F;  2AQ4 A;  2FY1 A;  3AA9 A;  4I2P B;  2BE7 D;  4CO4 A;  4B3R F;  3FZ2 A;  3CSK A;  4WFN Q;  3TX8 A;  2ATC B;  3CE8 A;  1ACM B;  4UOG A;  3NGS A;  3U1M A;  4OX9 F;  3PHT A;  3ZTQ A;  2C2N A;  1DBD A;  2VA3 A;  3RB6 A;  1PJ5 A;  2H3E B;  3CJ2 A;  1FF2 A;  4CH0 S;  4DR2 F;  3DRP A;  2M5Y A;  3I4P A;  3G8Q A;  3C8Y A;  3LO3 A;  2ZEJ A;  3AH6 A;  1NDP A;  2GVD A;  3IBC B;  1SQF A;  3W9J A;  5K8O A;  2IRX A;  4PEO A;  4BWJ A;  1W7W A;  1CPZ A;  2OPS B;  4ECY A;  4PQA A;  3I96 A;  2HZV A;  1JLG B;  4C8O A;  4DG1 B;  5HBM A;  3M8R A;  1DHM A;  2W2M P;  1H0H B;  4P7T A;  3PFE A;  1U8S A;  5H1S V;  4X4O A;  1HQU A;  3TZX A;  2AX0 A;  2F8E X;  4L75 A;  1ZM9 A;  3J81 Y;  1VBY A;  1B7Y B;  3NCR A;  1J5O B;  1WOR A;  4DX5 A;  2YNF B;  3PIP Q;  2ZBR A;  1LFW A;  3GP9 A;  4NMX A;  4ED7 A;  2A18 A;  4OZ1 A;  1R8P A;  4DDF A;  3PRD A; 
#chains in the Genus database with same CATH homology
 4CLZ A;  1CS4 B;  4WP3 A;  4CLW A;  5D0G A;  1AZS B;  1YBT A;  4WP8 A;  1AB8 A;  1CJT A;  5D0R A;  3ET6 A;  1YK9 A;  3UVJ B;  5D0H A;  4CLL A;  1WC1 A;  1CJK B;  5D15 A;  4OYZ A;  1U0H B;  4OYW A;  4CLK A;  2QV6 A;  4USU A;  4CLP A;  2BW7 A;  4WPA A;  3C16 A;  3C15 A;  4WP9 A;  4OYB A;  2GVZ A;  4P2F A;  1Y10 A;  2WZ1 A;  4CLU A;  3ET6 B;  4P2M A;  2GVD A;  5IV3 A;  1Y11 A;  4USW A;  4NI2 A;  1CUL A;  1CJU B;  4OZ3 A;  3G82 A;  3C14 A;  3R5G A;  4CLY A;  4OYM A;  1TL7 A;  4USV A;  3MAA A;  4CLS A;  3C16 B;  3C15 B;  1CJV A;  2GVZ B;  1CS4 A;  4OYX A;  1CJT B;  4OYP A;  4OYO A;  1WC3 A;  4OYI A;  2W01 A;  1AZS A;  4P2X A;  4CM2 A;  1WC0 A;  2GVD B;  4CM0 A;  4UST A;  4OYA A;  3MR7 A;  3UVJ A;  1FX4 A;  1WC6 A;  5IV4 A;  4NI2 B;  4CLT A;  1CJK A;  1CUL B;  1U0H A;  3G82 B;  3C14 B;  4CLF A;  1FX2 A;  4OZ2 A;  1TL7 B;  1YBU A;  3MAA B;  5D0E A;  1WC4 A;  1CJV B;  1WC5 A;  1CJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...