3UVJB

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVCDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYSLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Guanylate cyclase soluble subunit alpha-3
publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 196
sequence length 196
chains with identical sequence D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjB00
4CLTA 1CULA 5D0EA 2GVDA 3C14A 1WC5A 4OZ2A 1YBUA 1WC6A 4P2FA 1CJTB 5D15A 1FX2A 4NI2B 1TL7B 4WP8A 3MAAB 1CS4A 4OYAA 5D0RA 4OYMA 3MAAA 3MR7A 1AB8A 5IV4A 1YBTA 2GVZB 1WC4A 2W01A 2GVZA 4CLPA 2BW7A 4WPAA 1AZSB 4OYZA 5IV3A 1CJTA 4CLWA 4WP9A 2WZ1A 4NI2A 1TL7A 4USTA 1CJKB 4CLFA 4OYOA 4OYPA 3ET6B 4CM2A 1U0HB 4USWA 5D0HA 4CLUA 4OZ3A 1WC1A 4P2XA 1CJVB 3C16B 4CLKA 3G82B 1CJUB 1AZSA 1CJVA 1Y10A 3C16A 4CLYA 4OYWA 1Y11A 3R5GA 1YK9A 3C14B 2QV6A 3UVJB 1CJKA 4CLZA 4USUA 3UVJA 4P2MA 4OYIA 4CLLA 4WP3A 4CM0A 5D0GA 4USVA 4CLSA 1FX4A 1CS4B 3ET6A 3C15B 1U0HA 3C15A 4OYBA 1WC0A 1WC3A 4OYXA 1CULB 3G82A 1CJUA 2GVDB
chains in the Genus database with same CATH superfamily
1TK0A 2RU9A 3DLBA 4QYRA 3C14A 2CYYA 4PXEA 1JNRB 4OI6A 5J1EA 5HROB 3RU0A 1YJUA 2GMHA 1PKUA 2XYHB 3D0IE 3BN4A 4LFBJ 1DFDA 2VFTA 2Q43A 4BWJA 1FVSA 4K4XA 1BE4A 2JH3A 4NYPA 1U6BA 3MMBA 3I31A 2KZMA 2E1RA 4JYAF 1D0EA 3M8ZA 1HNXJ 2IVYA 3I4HX 1G4CA 2P9CA 2KFZA 2MHNA 4H54A 4KKOA 3J81j 3BBBA 3DKDA 4WIIA 3R7BB 1YX2A 3MUTP 4C4WA 2ZH4A 2ZBRA 1WG4A 5CYMA 1RACB 3TUZC 4MMOA 2OO4A 5KFQA 3C14B 3QAUA 4OZLA 5J1EB 2W4DA 2IIHA 3NMAA 2HFVA 2J9CA 1FX4A 2FC8A 5B0GA 2F4VJ 4GKJJ 3DM2A 4TLQA 4NLQA 5GVQA 2NXNA 3GIKA 4FS2A 2KH9A 1XNRJ 1X0PA 3LPEA 2W2PP 5E3AA 4DZ6A 1P1LA 2KN4A 1KEKA 4RW6A 1R3NA 4J37A 4PEOA 1S1XA 4A8XA 3OSPA 5LMNF 3VZHA 3MR7A 3AJ2A 4KKOB 2O1PA 1QM9A 8AT1B 3K5PA 3PXGa 3R2CJ 1R31A 2FZKB 4XK8C 2GVZA 3BDEA 4UOHA 5AXLA 1G6BA 5GADI 1UZDA 1QAXA 4EYHB 3VAGA 4JYAJ 1V9OA 3CJ2A 4ZLJA 3EGNA 5DS7A 1VR6A 3NBPA 4K5SA 3CUNA 4B9VA 2XYPB 4TVAB 2Y1JA 4X4RA 3DM2B 3PIOQ 2X1BA 3KOAA 2AZ3A 3M8QA 2Z8QA 5HMXA 1JJHA 3PJWA 4X4OA 4KO0A 1AXQA 2D3ZA 4RW6B 2KFYA 1PC5A 4R5PA 4K59A 2FQQB 3VAHA 4NCGA 1T7PA 2HBYB 3IG1B 2O5DA 2WOMA 5E3RA 2QEXS 5KOXA 2ZC3A 2H5IB 3F73A 2OGUA 3M9NB 3C2PA 1RBLA 4IH6A 1S9EA 2L48A 4QWAA 3RRGA 5H9EJ 3MAHA 5D78A 3MEEB 4QCLA 3QT6A 1T8EA 2YNIA 3NBPB 1KOHA 1CG2A 5E2QA 4P72A 1PBAA 1U47A 2FLNA 3M8QB 4OV1A 3OR2A 2AEJA 1U49A 4O3RA 2AGQA 4EGLA 1QVGR 1XQIA 1SJFA 4KO0B 3BEGB 4EI2A 4EU0A 4R5PB 2KHCA 1HNWF 3HLUA 3M8RA 5A76A 2C28A 4NCGB 2JLFA 2POKA 2H48B 3K5OA 2CQHA 2WOMB 2MLYA 4ANEA 5ETSA 3RBDA 4C11A 4WWSA 4MTPA 1R6VA 1S99A 3TUJC 4USUA 2O01C 2XS7A 1M5SA 1RHUB 3RTVA 1S9EB 3K8WA 3IWNC 3QJLA 3B6BA 1L3TA 1RA7A 4ECYA 2BDPA 2X1GA 3I6PA 2RE1A 2BJEA 4CO4A 2YNIB 2ZH8A 2CDQA 2DO0A 3A3PB 2OAUA 2K06A 3CD7A 5AJ3F 5GMDA 4R8UB 4OLOA 2X3DA 2A1BA 3OR2B 3M2VA 2YNGB 2W24A 1H72C 3UN5A 2DPIA 3V2UC 2I1RA 4NLXA 4Y3CA 2B4OA 5HP1A 4O3QA 2DGWA 2HAFA 1A0OB 3H5UA 4IQXA 1RWOB 4C11B 3VTIA 3KMSA 1OY8A 1YSJA 2R2RA 3IN5A 2XMWA 2QE5A 2NXJA 2GC8A 2L3MA 2CKWA 1HNWJ 4MH8A 2QGFB 2DRBA 3RBZA 3GLJA 5HBMA 3M2VB 4EBEA 1TL3A 2D3UA 1OYDA 3IGNA 4KTQA 1YJ9S 4Z2XA 2EKNA 4MYUA 4N5SA 2D3O1 3QLHA 2V8PA 2XMVA 2DCLA 4DOZA 2XQCA 4G1PA 1HR0F 4ID5A 2RHQB 4X65F 2GIQA 2DEJA 1CLFA 4ES3A 2BABA 5CA5A 1SPBP 1FE4A 1SL2A 4F25A 2IC3B 3QPIA 2AF6A 3NCPA 2ZKUA 1XR7A 3CDBA 4RU9A 3ZNUA 4LF4F 5HBMB 4NZ6A 5KFYA 4FBTA 3JXOA 4RBTA 2FHJD 2HEKA 1X4AA 3P8BB 1UJ6A 1RKIA 2X7IA 1EKSA 3PFOA 2ZWPA 3QLHB 4JI8J 3WC2A 4CO3A 1SJ4P 4QYZK 4ID5B 4RNHA 1FFGB 1WOOA 3M6WA 1NKEA 1BQNB 3CSKA 4ZIWA 3C15A 4Y00A 3JTPA 4F3QA 2DXEA 2RMLA 4Y28C 3C66A 4FYVB 1VDHA 2MTLA 2W7OA 1HQUA 3O6QA 3POTA 3ILOA 3QRQA 1OQ3A 2GZOA 2J6TA 2L9WA 4WFNQ 1FDDA 3SDEA 4YDXA 2C2NA 1HR0J 2KXNB 4BC7A 5J2NA 2IVMA 3DLJA 4OZNA 4DR3F 3FZ2A 2MY7A 1SH0A 2RQKA 2PC6A 2OPQA 3CJ8A 5A2QY 3O2IA 4PXCA 3NWGA 1HBOB 1D3WA 2M9KA 3KDNA 2XGQA 4A8WA 4NXMJ 2JSXA 3C6UA 3JTOA 2KM8C 4LF4J 4O3PA 2NYIA 5B0BA 3GCWP 1VRUA 1S49A 4URQU 5D4OA 3DRPA 3PJ9A 3BZQA 2QT7A 1TP7A 3POTB 2DR5A 1UAWA 4F2SA 3IAS9 3CJ3A 3AY0A 3SDEB 5J2NB 3LWMA 4WU2A 2J6SA 1IKXA 1QE1A 3PX6A 4I4BA 2M7SA 2B56A 3FBEA 2XI3A 1J2VA 4FXDA 5EN1A 3L09A 3HSZA 1NB2A 1HLWA 3EVOA 3C6UB 5LSOA 3QSIA 1RT5A 2MJNA 2HRTA 4Y0FA 1BGXT 1VRUB 2Z57B 1RAHB 1VBZA 3DRPB 4B9MA 1MU2A 4LUBA 4DR3J 3W9IA 2MB0B 3IR7B 1B99A 3T6JA 4B9TA 4X4QA 4OLPA 3IRXB 4QIGA 1G1XA 1KFDA 3H7HB 4NX9A 4ZJQA 3DDNA 2HFNA 1R8PA 3V6JA 1IKXB 3PG9A 3T1HF 2F7VA 1QE1B 4ZLLA 2AGPA 5B09A 1M5OC 3W7BA 2AJ1A 3AQPA 4DPXA 5KFKA 3VGVA 3W2WA 3M8YA 2W2QP 2FB0A 2X51A 2EFQA 1ITPA 4DQPA 5IQQA 3MR5A 2B6AA 2ZUGA 1VQ6S 2B9WA 1CJUA 4FN5A 1WC5A 2BQRA 2QA1A 2V2VA 3V81A 4J9NA 2DEIA 3G6XA 2XWXA 2VD3A 2FD2A 2XWYA 3LGMA 3HHLC 1K0VA 1K44A 1UVIA 2I8EA 2A0FB 3IAM9 4C48A 1N32F 4OQJA 4JI7F 1HFEL 1VJWA 1JX4A 1TL1A 1NK6A 1C1BA 3Q83A 4HHHA 2LU1A 2MKIA 1VQYA 3I0SA 5GAGU 3BO2A 4HVZA 4F0MA 2UU9F 2GQQA 3FCWA 1RTJB 3Q8RB 1AYEA 2RB7A 2B6AB 3OTDA 3RG6A 5D3GB 1N36J 1CJUB 3TJAA 4CLYA 2AIRB 1BUXA 1U45A 2N7CA 1RWKB 3V81B 4OX9F 3T1HJ 1H0HB 2VQFF 3SV4A 1X5OA 3EYZA 4MKYA 3CB4A 4RNFA 4EYIB 2XY7A 4K5RA 2ZJQQ 3CF5Q 3EWGA 2V4QA 3SZ2A 1VOMA 3OT9A 4ZLPA 1TL1B 1C1BB 3H40A 2G4BA 1IR2A 3NMRA 1SBRA 3I0SB 3HVWA 5D0RA 4BCAA 2XY6A 3RAQA 3Q89A 1Z1ZA 1VRTA 1RCOB 5LT5A 2VA2A 1FNXH 4OX6A 2DH9A 3TVZA 2CNNB 1KWMA 2RSQA 3UQSA 1N32J 1CJTA 1IBCB 3TZZA 1XMBA 4NI2A 1O5JA 1S1WB 1J27A 4PKDB 2Q66A 2Z0GA 3NS6A 2IM0A 4NLVA 2UU9J 1N4LA 3G2XA 5C25B 2HKEA 3KDOA 3UDCA 2BJ8A 4RUBA 1IJEB 5A8RA 2VC0A 2RS8A 1RTDA 1V5IB 4ZPTR 1HWKA 1SC4B 2L9NA 3VGSA 5C24A 1VRTB 5KG3A 4HDGA 3RW7A 4RUCA 3TX0A 1YBUA 1CJTB 4NI2B 1SC6A 3TQ1A 2LQBA 2EFOA 2CQIA 4WFZA 3NG8A 4Y2MA 3MDFA 2OUGA 1M5HA 4IFVA 4FZVA 4CQ1A 3CCRS 3R5BA 2G2ZA 1FVQA 4PYAA 2ZZNA 2OEKA 1WHXA 2FVCA 4F4ZA 3OTOF 2Q1LA 5A8RB 2RF2A 5CXTA 3FDSA 3QBCA 1RTDB 4FXVA 2X1AA 1WF1A 1GX6A 3K0JA 4IH5A 5KT7A 5C24B 4AQYF 3HZEA 5RUBA 4OX7A 2M8HA 2ASDA 5T41A 4LRDA 3A8IA 3VAIA 5BYQA 1JB0C 2P5VA 3RBXA 4DL2A 3CD6S 2QLFB 3DMJA 4ER8A 4H4OB 2XZDB 2GHWA 1Z2ZA 2J6UA 2UVWA 4O4GA 3I5BA 1X31C 5GAGI 4ZVGA 4IG3A 4DFKA 1XIQA 5KAKA 1RAIB 3QWPA 1H73A 1Q79A 1NH7A 1JXLA 2MPUA 1KD1T 3PX0A 3GSDA 1U2CA 1Q82T 3N01A 4QPTA 2YPZA 5DG7A 2RF2B 2AEFA 2ZD1A 2CDRB 3LGHA 1Q1KA 2KVIA 1P27B 2B7BB 3CD5A 4KV8A 5DDPC 2BJDA 3NGTA 2XZWA 4LF9F 2EC0A 3ENVA 3KUEA 5ITHA 1KS2A 2Z4PA 2CJQA 1FRLA 2IYIA 3DMJB 3OTOJ 3DRRB 5ETOA 4TY8A 3HHEA 4OZ3A 4O4GB 1JLQA 1WWHA 4IG3B 3OR1B 1OPIA 2MYFA 2RU3A 2BVZA 4AQYJ 4M5LA 3P3DA 3CJQA 3FRYA 3KTQA 4L6V3 4X4SA 3W5XA 2FY8A 2HWTA 2ZD1B 2X3GA 2F9JA 4QWDA 4RW7A 4FVCA 2GVDA 2AZ1A 4KV8B 1FNMA 4WXOA 4ETZA 2FVRA 5KFRA 5DDQC 2BJ9A 4D3HA 4KY3A 2NUUG 2FVSA 1S79A 1K1QA 3VR1A 4XO0A 2KU7A 1MW7A 1T9UA 1UJ5A 2OI2A 2B3TB 2M2BA 1RYRA 4TY8B 1RI7A 1NXIA 1JLQB 1VK8A 2GNKA 4WP9A 2N4DA 1UETA 1PJ6A 3W60A 3SV3A 1U1LA 1PGZA 2CVEA 2J7UA 4JI5J 4A8FA 3GB0A 3C6TA 3CCZA 2B4UA 3MR3A 1ZPWX 5L1KA 4RW7B 5AXMA 5LJ3Y 6FD1A 1UW9A 4K4WA 4FF2A 3T19A 4KPCA 4XIUA 5HATA 4WP3A 3PZPA 4J7CA 4IR1A 4HHJA 4DCJB 2QJ3A 4IFYA 5EX3A 2VG6A 2XNRA 2CUYA 3HZGA 2Z2ZA 3RUBL 4K4VA 5E33A 3JYTA 3DRYA 4MK7A 4WP8A 3OXGA 3ZO7A 1KQKA 1KQFB 1VIOA 3BH7B 3HSJA 3C6TB 3MECA 9ATCB 5E41A 4A8MP 4KHRA 2YX4A 1RT3B 1VFJA 1SC1B 3G8SA 3HD1A 1XWLA 4B3TF 2LXIA 2QN6B 2BV3A 4Y6IA 3I56S 4K4ZA 3W5ZA 2ERRA 1UVLA 1SJRA 2EBGA 4IFYB 1YBAA 2Q79A 2ADBA 1TL5A 4NRTA 3PX4A 3CCQS 4ECVA 2GAGC 2GO8A 1Y11A 2HQCA 4FF4A 1OYEA 2MKSA 5K8NA 3JYTB 1U6FA 2BUNA 5A6WA 3H5XA 3UR3C 4ZPAA 1QSYA 1TFWA 3P45B 4P9SA 3DOMA 1RDRA 3ILJA 1NEEA 1RP5A 4NWBA 2H5EA 2I2YA 1URRA 5B0FA 1DTTB 2ZH3A 1JLEB 2LP4A 1OS5A 2HHPA 1UCNA 3UNGC 2FJXA 2I6WA 1KQSR 1F9HA 1FEHA 2XSJA 3QATA 3DLLQ 3OXFA 5GAEI 4YY3J 3KLVA 3N5BA 3JSMB 4RNOA 2ACYA 3PRDA 3D66A 3CJKB 2MXYA 1EETA 2D9OA 2GQ2A 2IRXA 1CQMA 3F41A 2ZJRQ 4B3TJ 2ZKTA 3QT8A 2E29A 5JJBA 1M5VC 2G0IA 1FK9A 4MKVA 3KLIB 5IQ6A 2G13A 4E98A 3W65A 3GFHA 3I4PA 3M8WA 5DLFA 2FHJA 2DY1A 3GIIA 1HNZF 2WCXA 4AL6A 1WOPA 5KFBA 3OLAA 2XSJB 1WC3A 4IRKA 1U09A 2R42A 4QQBA 4IO1A 5CH7B 1O0PA 2HVHA 1HWIA 3ZFVA 4OZ0A 3CJ4A 2P9GA 5E3CA 1RAJA 1EETB 2HPUA 3FSXA 1EQMA 2HMIA 2P9EA 3R7SB 5EWFA 1WC4A 1DARA 2CPFA 3OUYA 5C7PA 1FK9B 3MFHA 1RT2A 2RDDA 1GTHA 3U7JA 4NZ0A 3TWZA 4OYPA 3L95X 1WKLA 3LTOA 1TL4A 3DC2A 3H20A 3TW0A 1R0CB 2F8EX 1KSPA 3UE2A 3MM8B 1IWGA 1X4GA 2AW0A 1NDLA 1IUJA 2OPRA 3UCGA 4CNZA 1NDKA 2DGTA 2J0QD 1OY9A 4ED4A 5D0GA 2N3OA 4NXNF 3AXMA 3PCOB 2V34A 4HL9A 5ETVA 2HMIB 4P10A 3VQTA 5ETLA 4BHQA 2GJIA 2EEYA 2MQLA 1YDLA 4LR8A 1SKUB 4JV1A 4ES1A 2KT5A 1AA1B 2NUHA 5I3PA 1RU1A 1XJWB 1BXNA 2UUCF 4Q2MA 2AU0A 4FPRA 4CNYA 2VICA 1FTRA 1NHVA 2DKOB 3SIPB 4UZBA 3TNVA 2DH8A 3PHTA 2HIYA 2OPRB 4QW9A 4N7TA 2ZM6J 4X4PA 3BR8A 3DYAB 3EMTA 2LECA 2H51B 1OSDA 1KRPA 4TU9A 5H1SV 2H4YB 5ADZA 3CCTA 5C42A 1RAOA 1G3OA 4XDDA 4PG4A 5IOLA 1ELOA 3C16B 4WJBA 5BXIA 1RCXB 1SI9A 1JKHA 2EK6A 2W7PA 2G0JA 2K2PA 1TKXB 2LEPA 3MFIA 2KTQA 1HBNA 4NXNJ 2HHVA 4WKRA 3CIZA 3BQ2A 1B7YB 2ZVSA 3EX7B 1F1BB 1TKZA 3KXDA 1S6UA 1WC6A 4M5MA 1Z4UA 4GVBA 2JJ4D 4LVNP 2ZBCA 3GJQB 2LLZA 4M63A 2NPFA 4O3NA 2APOA 3DN9A 3H90A 2V5HG 2UUCJ 5C42B 4WZQA 2KZZA 1KLMA 2EVZA 4ZCKA 1JKHB 5AE3A 2VJUA 1VLYA 3D68A 1TL7A 3VZIA 1QTMA 1KTVA 2P6TA 4A8QA 1VQ5S 1F3VA 4QR0A 1S6QA 3JS9A 2DRAA 1TUWA 1EAYC 2FJWA 4R0JA 2HGLA 4KRWA 4ZVQB 4RL1A 4FNHA 4V19J 1O51A 2A6OA 5K14B 4CLZA 3GU0A 1U8SA 1TKZB 5B7WA 1R8BA 4ZK7M 4LF5J 2JC0A 4GVBB 3KYLA 4JV0A 2YWKA 1HI1A 3HHNB 1U1KA 1KVIA 3W5YA 3SXLA 3K5NA 1ZM9A 3D3CJ 1L3VA 2KT2A 5CZXA 5KFUA 4MKBA 1U7LA 4BC9A 4DFPA 2DHXA 3KLEB 4MIWA 4O44B 3ZZPA 5I3UA 1W7WA 2PFFB 4I1TA 1TL7B 2RRAA 1Y9OA 3FBFA 1N8RT 1SXLA 3MURP 1JNZB 3MR6A 1S6QB 2FDNA 4ED1A 4GC7A 1AUSL 5F8JA 1DQAA 3AA9A 3NNCA 2DGQA 3M7VA 2OD4A 2WBMA 4DFJA 4H4KA 2H1YA 4GRSA 3CULA 1Q8BA 4J91A 4Q5VA 1RAGB 1SKSA 1SC3B 2PGCA 1X4DA 2Z2MA 4UF4A 4CLUA 1XERA 5KFNA 5EDWA 1T9VA 2XLJA 3QGPA 4ZHRA 1YI2S 2F8HA 4DS4A 2HQIA 5DDOC 3ZTSA 3LP1A 4C8LA 2SXLA 5I3UB 3B78A 1IWAA 2HIQA 4JI6F 1FCAA 2M70A 1PYOB 4F0HA 5LSLA 2PIIA 4NLTA 2DHGA 1U6ZA 4DV5J 4ZVOB 3HT0A 4OI2A 4MFBA 3CD0A 3IWXA 1RWVB 1YIJS 1FKOA 5A8WA 3QQCD 2VH7A 1AUDA 3UDVA 2FPHX 3TZXA 2J5AA 2L41A 4J9QA 1S72S 2M0GB 3SYZA 4DBQA 3MCOA 4FF1A 4NLOA 1I3OB 2HG4A 1VHFA 3LF0A 3TQEA 4ZHRB 1EKRA 3A3OB 5H9FJ 1WI8A 2Z56B 2YNHA 3LP1B 3RRKA 3PYDA 2DHAA 2V9KA 1TFYA 3KLFA 3EZOA 1WHWA 1UTAA 4X4VA 3PVXA 3BYRA 3ENQA 4KYZA 5LMUJ 2E5LF 2G1HA 5ETPA 3QYYA 3KG4A 2IJNA 1S6PB 2G0CA 3SCJE 1RKJA 4MFBB 1K9MT 4LF1A 4Q7AA 2MZJA 1FKOB 1FWKA 2DIVA 4RW8A 1HW8A 2BW2A 2WW4A 3PW4A 4PG8A 4C2MA 4PWDA 1U0SA 4DQSA 4Y2IA 2KRRA 1WUUA 4DX5A 3G8TA 2YNHB 1VGYA 1DQ8A 5HVHA 1RK8A 3AOAA 4ZN1A 1NHUA 1ROFA 1RISA 4CO1A 4QU6A 3KLFB 2IMWP 4NMXA 4J9UE 2IPOB 2HHQA 1YGYA 2OLWA 4AL5A 1IBKF 1BMQB 3WHIA 2RH3A 4DPTA 1FF2A 4HI2A 4RWWA 4I56A 2YY3A 1LWCA 1N52B 4RW8B 3M2RA 5KFZA 3TVYA 4DHVA 5CABA 1AZSA 2JFDA 3GIRA 3L4BC 4NASA 3HM9A 4B3OA 2R7SA 4Y2CA 3OFGA 1EB0A 3HHKA 3RR8A 2MJUA 3QT7A 5KFPA 2C42A 4B17A 2NXCA 5DRKA 3U1LA 1N5YA 1SKWA 1JK9B 3BSOA 2CFXA 2IFXA 2VV5A 3R5JB 5HMWA 5J1PA 1CVJA 4A4JA 5IV4A 1WEZA 1LWCB 3UN2A 3DU5A 3M2RB 3N5FA 3Q8SB 4ZVHA 2DR6A 4UW2A 4MK8A 3A13A 1MMNA 5J2PA 4ANCA 1AZSB 4BLGA 1RZMA 3UDLA 2LA4A 1VBKA 4USTA 1RWPB 2HNDB 3M6UA 1NU4A 2GJFA 1IBKJ 1IKWA 1UKUA 2AHOB 1T9WA 4B3OB 4TLRA 3SFUA 2BZ2A 3BS9A 1UJ4A 3ISND 4KC5A 1VQSA 4QR2A 4DWIA 3M6XA 5LL6d 2J9EA 1H2VZ 4CWBA 2CQ1A 5KG6A 2ATCB 1FD8A 2WW8A 1MMDA 2DHSA 2V94A 4I2QA 5I3QA 1MMLA 4DR2J 3BKUA 4LF2A 2FTRA 4ZPBA 1G7CB 4QIFA 1WTFA 3CJ0A 4PPDA 1MSWD 5J2PB 5LJ5Y 3BKTA 3J7A1 2RDIA 2JFKA 3P5TL 3KLHA 3FMBA 1LWXA 2AWZA 2R8KA 4NA2A 1T11A 1FDAA 3Q86A 3K89A 4ECRA 1WHVA 3OFEA 3B4DA 4OV6A 2MQNA 5F8NA 1W2BR 5FJ4A 1S59A 2CNOB 3WDOA 2C2EA 5HL7Q 2HHSA 2WZ1A 2YWFA 4DPUA 3D1OA 2YWEA 3OHBA 4IYQA 1S4EA 2LCWA 2DCUB 1K1SA 2ASYA 1JJCB 4DX7A 3TAPA 1HD0A 4P2SA 4DR7F 2M5YA 4I2QB 5IWAF 1FO1A 3NNHA 3KMQA 2RUGA 3JAMU 1M90T 1U1NA 4M94A 1LK5A 3EXYA 4F4KA 4E8UA 1MWYA 3KLHB 4I6WA 3ZTOA 4C0BA 4ZVSB 3QAEA 4QIVA 3T9ZA 1C2PA 1WKKA 2P6SA 1QVFR 1JXEA 1D8YA 2UZAA 2ZBIA 1HQ2A 3W9HA 4DR4F 4RW4A 1X4BA 2XMAA 1FDNA 1H2TZ 3KLGA 1IR0A 4NEZA 3T1AA 4DQIA 4XPEA 4FYYB 1YQHA 3I87A 3TEHB 3DDKA 3OV7A 1XMQJ 3O5TB 3I32A 5ETKA 1F0XA 3PW2A 3AJ1A 4X4TA 4ZN3A 1SCJB 3AD7C 5KFXA 2DNZA 1VBXA 1VK3A 3G9CA 2OEJA 1NDPA 3MF5A 4YR3A 2NSBA 4P2XA 1CJVB 1UMJA 2PDAA 4U7UD 1K0TA 4K4TA 3SQGB 4NLPA 4KH1B 1JLCB 2JRSA 4JP8A 1S1UA 1HMVA 2Y0SD 1YZ7A 1IBMF 2KRBA 2BRLA 2CQCA 2HZVA 5C2GA 3L9ZA 4C8ZA 4DG1A 3KLGB 4ZITA 4LF6F 4J9VA 2R8GA 3J7AN 5HVFA 1S1TA 5L1IA 3G87A 2MQQA 4EMDA 2U2FA 4ZPVR 2XEXA 4USHA 3WX4A 2C2RA 2ZOMA 5D6GA 4OHVA 1NPKA 2MDAA 1F3FA 2QLJB 2JOQA 3W8PA 4DR4J 1NCLA 5GAHI 3NS7B 1R0BG 4C8KA 3T5HA 3HDSA 2QMWA 4DPWA 1S1UB 2OMOA 2CPDA 2ZNYA 2IDEA 1S4FA 3HK2A 2QZ8A 2UXCF 2V63A 4ECSA 2VPYB 1N56A 4LF8J 2QL5B 2H65B 4RNMA 1X8DA 3N4WA 1S1TB 2GIFA 4F02A 4CTAA 5JXSA 3HD2A 4HH0A 1Q7YT 2V50A 1NBEB 3CMES 4K4SA 5J1NA 5KG7A 5DQHA 3HI9A 3CCLS 1IBMJ 3NCRA 1KHVA 1HKAA 2B8QA 4LF6J 4ZVPB 1VI7A 3SMZA 3FEXB 1KHWA 3JSRA 3IR5B 3DRSA 4U6PA 5F3TA 3SQOP 3V6KA 2Z30B 1D9FA 2E5IA 2V2ZA 2FGCA 1SV5A 1FD2A 4F4AA 1ZM2A 3MI7X 4PUOA 3FKBA 5J2QA 3H4DA 4WK3A 3CJ5A 1Y0HA 2KXHA 3D54A 2DNYA 5L9NA 4RWXA 4YR0A 4XDCA 3OL6A 2F63A 5KG4A 4CTAB 4JI2F 3CPWR 4B9UA 4UOFA 2VPZB 4DU7A 1L3KA 1UFWA 4J9MA 2YTCA 3LPYA 2MKYA 4F67A 3IRWP 1NB7A 3D6MB 1LKZA 2FVQA 1IQTA 2IA0A 4OJ3A 4F3MA 4DR1F 1B0TA 1U4BA 1SJQA 3I55S 4MJKA 4OHXA 4DL4A 3M30A 4PG5A 1S0VA 3D28A 2NYHA 5A6PA 4LF7J 4I0WA 1LW0B 3R7NB 1SV5B 1WTBA 2G1DA 2ZBQA 4PUOB 4A48A 2EG2A 2GIRA 3TVKA 3ZTPA 2VG7A 1JIHA 1WSVA 4X2BA 1YRXA 3AOCA 3P4UB 1LXNA 1R8AA 3MM9A 3NS5A 4WYWA 1NJYA 4I6YA 1TUGB 2HBQB 2KVQE 5T7LA 4LMZA 3CJRA 4USJC 4J90A 3JQKA 3G4SS 3TJ8A 2NCKL 2MMYA 3W61A 3M30B 1N88A 2NZCA 3M9OB 3DCAA 5C2CA 3UNYA 2PA3A 2LEAA 5GADU 1R43A 2CADA 1Q81T 1X4CA 3EXCX 3WX8A 1Y00A 3BYPA 4NOHA 3GV8B 2VG7B 2IHR1 1TELA 5CYQB 1A6LA 3MM9B 1HQEA 1S0NA 1PSDA 4FVMA 2KHDA 4DN0A 2PA8D 2YXLA 1VIXA 5T7LB 3ILLA 4DSKA 1NSKL 2FLLA 2DXFA 1EIYB 2WVBA 4EK2A 1X4FA 3PKYA 4AUKA 1X0FA 5M2RA 1GX5A 5HROA 2CNKB 3NY0A 2P8IA 2E1CA 3ZZTA 3ELHA 2BXJA 2K8GA 4G1QA 2R8JA 4JBCA 2VG5A 1FA0A 4DL7A 2R8HA 1H6KX 1M0SA 4U7UK 2F5GA 1S0OA 3BBFA 1HQEB 4W92B 4ED7A 3M8PA 1LW2A 3PRBA 3EPGA 4C0HA 2XZTB 4LQ9A 3I5CA 4EO6A 1TZ0A 4M8LA 4Q44A 4OFZA 4JV5J 2WVCA 2BQUA 5CCLA 3H8YA 1S7IA 4HEA9 1HARA 2AQ4A 4YUDA 2VFRA 2HK3A 2E1MC 4G1QB 3FCHA 2AKWB 3OFHA 3FGVA 2HVDA 2VG5B 1NO8A 7AT1B 2V2KA 4A47A 4WFAQ 3PIPQ 4ZMMA 1AROP 3Q8QB 3PEJA 4KBIA 1A7GE 3EPIA 2VBZA 3ITHB 5IZHA 4JI1J 2WTFA 2WHOA 2LDYA 4IOAQ 3M9MB 3M8PB 1LW2B 3MPUB 4AT1B 3TYTA 4N56A 3BJYA 1UL3A 5IM0A 3KK2A 3JTNA 1VQOS 3HSGA 5FD1A 2AT1B 5GMEA 4KQZA 3AOBA 3K5LA 2AX0A 1HL6A 4F7VA 1TK8A 2L08A 3E51A 2HNZB 3EUNA 3CCWA 1FFSB 3HVTB 2HVEA 2XMUA 4L74A 3CC2S 5THWA 1U1RA 3MM6B 5AT1B 5KG5A 4DV3F 5IT0A 3BGOP 2R2SA 2W1BA 3T3FA 2DISA 3R5DA 1PO6A 2R7UA 1GQEA 3Q2SC 1T3NA 1K8AT 3FMWA 2FLOA 3FZBA 1YKWA 5CD4H 3U02A 5FDLA 2QFIA 3A12A 3HMJG 2MY8A 4U67Q 5IM0B 3KK2B 3IG1A 3MMAA 4OIXA 3DHWC 3HFZB 3VAKA 1KFSA 4DV4F 3MAAB 1FERA 3NGSA 3FQKA 1R0AA 3W8GA 3BGFA 3R6LB 4LSLA 2CG8A 2J76E 1VQKS 3MEEA 3RGIA 3CCES 4Z37A 4LRBA 3IC1A 1AW0A 1V3SA 3PHEA 5M2PA 4M5IA 3V5RA 5KFHA 3R6GB 3D6TB 3SI8A 3R3TA 4Q45A 4DUZF 2XG8A 5HSPA 3LA0A 2OTLS 1Q78A 3MM7A 2BOPA 4B3RJ 4TQSA 2EW9A 2FY1A 4E2FB 2UUAF 1C0TA 5FDLB 1FFWB 2B51A 3AJDA 3GMGA 3N79A 4DV3J 2OP5A 3MMAB 2D3OR 2N4CA 4YOEA 1VC5A 2YKAA 1R0AB 1R8HA 2FJBB 1GFWB 4LSLB 4QWCA 3VAFA 2HRYA 3D7SB 3EM1A 2KFNA 5BR8F 4R8UA 3DNCA 4Y2AA 2UVUA 4ZS6A 4DJBA 2YNGA 4K2XA 1XN9A 4DV4J 3H0PA 4XPCA 3MM7B 2H5JB 4I67A 2DT9A 4BBYA 3TOQA 1C0TB 4C8MA 4KPYA 2VFVA 4ECWA 2XGPA 4N77A 4YHHJ 2J7KA 3BO3A 2CQDA 2D41A 1TU0B 1EP4A 4HTJA 1S9FA 4DUZJ 4X62J 4J9OA 5F8GA 4L72B 2K3IA 4ZVRB 2UUAJ 2I9SA 3D6FB 4UOGA 1GMUA 3FK4A 2KG0A 2J0SD 4HI1A 3HULA 1J5EJ 1HD1A 2D1CA 4DV0J 2LQ8A 1RHQB 4K50A 1XTZA 3KJNB 1U1QA 1Q4RA 2CJAA 1UVJA 3TZWA 4CLTA 1TQLA 4DLGA 2WB1D 5EWEA 1O6XA 4WIQA 4PQUB 1CQNA 2MHEA 4P52A 3J7YU 1LWEA 4ZCIA 1PAEX 3M4XA 2HK2A 4IOBA 2H54B 1CS4A 4OJHA 2V9WA 1EP4B 1M1HA 5BR8J 3MPVA 3D4JA 4R0EA 1XMOJ 1LFWA 4OZJA 5EUHA 3QRPA 4JI8F 1F5CA 2IC3A 4CZCA 4AYBD 3J7ZT 3CGIA 1GK8A 1TR0A 2PT0A 1PC4A 1YTYA 3DLEB 1Q8KA 2E5HA 3MEDA 2ACMA 1FDBA 2NS1B 3IFEA 3FQLA 2AGOA 3QGGA 4Q8FA 1XBWA 2VB6A 3UW1A 1LWEB 2GHVC 2R3VA 1CS4B 2CRLA 3ETMA 3MGJA 3GJRB 3MEGA 1BQNA 2GMLA 2LQ5A 1S10A 1HWLA 1RWXB 4HYKA 4NXMF 4IDKA 1NHKL 2OTJS 2HHXA 4YS2A 1FXDA 4D3GA 2ZH9A 1FT8A 4FP9A 2AMCB 3K5MA 2V0NA 1EJ7L 1K47A 4JI3F 3MEDB 1YG0A 1CC8A 4OMFG 3D0HE 4ECTA 2UUBF 2RRNA 3GTYX 1HBOA 4QYZJ 3VCDA 1WJ9A 1Y3KA 3HSDA 4GKKJ 1HWJA 3G8QA 2J9DE 2PSZA 3MUMP 4KIAA 1W26A 4AE5A 4A8OA 1U25A 3MEGB 3M1VA 4EEYA 2PE8A 4B9LA 1VCTA 3QO9A 2O67A 4DCOB 4F8RA 1HI8A 4OYIA 4ZJOA 1YITS 4IDKB 3H42A 4HHUA 2JZ5A 3K59A 1U1OA 1SQGA 4YB5A 1S5ZA 4U8VA 4ID8A 4OYBA 4V19X 1GXLA 1R8CA 2VOOA 3A1YG 5IC6B 2ROPA 3CJTA 1HHTP 5KFSA 5DQIA 2WAQD 4ANDA 3UN3A 2ZOGA 4YB7A 3MWBA 6FDRA 1TMMA 5E7OB 4W90B 1WNEA 3D6HB 3HCXA 2VHGA 5F8HA 3TEGA 3QRRA 2YKQA 4URGA 2R4FA 4MIAA 2EG1A 3V4IA 2HLTA 3NWRA 2ZH6A 3OJUA 5CQGA 3AAWB 3M1VB 1SQFA 5BYSA 3BH6B 3QO9B 1NK0A 2ZC4A 2FHKA 5KFAA 1OWXA 4JI3J 2OKQA 2VF3A 2JHEA 4N47A 1FEEA 2UUBJ 3BPSP 3PEHA 2LQ9A 4KFBA 1TVRA 1Y5LB 5KFFA 1ZH5A 3IRXA 3QJPA 4O3OA 1NZAA 4WYLA 3A4TA 3J7YI 2Y1RI 2E7XA 2ABYA 2W25A 1KBRA 4WE1A 4NRUA 1KC8T 5KFVA 2GCFA 2VZ9A 4HT7A 2LXUA 1UPMB 2QG9B 2HNYA 1Y5IB 4ES2A 1HBMA 2EFNA 4URSA 4JV2A 5KFWA 3V4IB 3AH6A 1JLBA 1ZM4A 4KGZB 5A8KA 3O3LA 3H2UB 2XHWA 2FC9A 3BF4A 1E6VA 4IUFA 4NPOA 3FEYB 1VQ8S 3NCQA 2WBRA 1FKPB 4KFBB 2K3KA 2AYGA 1TVRB 4ATNA 2J7WA 2HBZB 1Q8IA 2YVSA 4B3MF 1N36F 2XULA 4ZVTB 2VONA 4EZ6A 3GIJA 5DG8A 3CC7S 1UEKA 4FXWA 3H59A 4TYAA 3PDNA 4LFAF 3DXBA 4ECXA 3Q22A 4WE1B 5KFOA 2QRRA 2BKPA 1S77D 3BGLA 3GV5B 5ETTA 1M5KC 2Z2LA 2O3DA 4ZIVA 3IA0A 1RTJA 2HNYB 2CIMA 1HBMB 5D3GA 1JLBB 5A8KB 1NNDA 2KXFA 4YN3B 3RJMB 4WTYA 3VV2B 4RW9A 1RE1B 4ZVUB 1E6VB 2LYVA 2KJWA 4F4YA 4OHWA 4S0MA 3OVSA 2R7OA 1T03A 2WVFA 2F9DA 2XNQA 5HVGA 1NK4A 4DR5F 2EFVA 2A3JA 2E9ZA 4X4UA 4Y34A 1QDUB 5C5JA 3MPWA 1VQPS 2UV8G 3ICLA 3CC4S 2EK1A 5DGAA 2IA6A 1EQ0A 2JDJA 1D8ZA 3PM9A 2X1FA 4P75A 1T9XA 3QFHA 2DNGA 4B3MJ 2M88A 3W62A 4LREA 2CVIA 4LBIA 2RRBA 4RW9B 4RZRA 2MSSA 2EBEA 3LOUA 4LFAJ 4TYBA 3C19A 4J9RA 5KT4A 1S1WA 3FFIA 2YWWA 5DO2A 3G96A 5K9FA 3MMCA 2Y1IA 3PR5B 1T03B 5L8RC 5C25A 2FHMA 1NRKA 3KHRA 5FLXY 3UWTA 4CLLA 3Q24A 2JEGA 5HQLA 1RXOB 2OPSA 5KG2A 4NLGA 3LGNA 2DIUA 2B4PA 4G3IA 4KT0C 4DI6A 1UVNA 5D4NA 1D9DA 4ERDA 2QIFA 4P7TA 2LXFA 4N41A 3Q8UA 2U1AA 3TP2A 4RBVA 4FNIA 2YQ1A 2F40A 4EUVA 2QL9B 4DR5J 2V4JB 2W8LA 5ETRA 3OHAA 4ECUA 1Q5YA 4M5GA 1M1KT 1GMVA 2V8HA 2HLUA 3T1YF 2YKPA 3GJSB 2WSEC 3FFIB 2LDIA 3MMCB 5KFDA 4PABA 3IBFB 2HGMA 2RIJA 2LQJA 3CCJS 1MWZA 2NPIA 2MEWA 2NXEA 3R1HA 2YX1A 3ZZUA 1Y4ZB 2C1EB 2YBVA 1FJGF 1BQXA 2CJYB 1DLOA 2OPSB 4CT8A 2WRMA 4IQMA 1P6TA 3M2UB 2HS4A 2ZH5A 1MNEA 1BY9A 3OPKA 1WG5A 2GV1A 1QD1A 2JEIA 5MAOA 1ZTWA 1Z2LA 3LAKA 4RJVA 3I82A 2OEMA 4H4OA 5D0EA 2VPWB 5SUHA 2E7VA 1XK8A 2MZTA 2QA4S 5KT5A 2HVIA 3D67A 1PILA 3K8VA 3Q8PB 4UQTA 4OX8A 3CMQA 5HJYA 1DLOB 2ADCA 1L3UA 5IS2A 1WELA 4LQ3A 2WSCC 4ZVEA 3OXLA 2CQPA 3GSIA 3T1YJ 3AT1B 1FRHA 1CSJA 1UWBA 2Y8YA 1IKYB 4DFMA 4OL8A 4C98A 3CDWA 2UXBF 2HHHF 3F0NA 4IRCA 3HJFA 1FJGJ 4YB1P 1LEOA 3DRRA 2HW3A 4OI4A 3UFCX 2YQ0A 1RTIA 2ILZA 3GPAA 3OR1A 1YK9A 1Q16B 4Q43A 2M3DA 5DGBA 1HI0P 2ZVIA 2E7WA 2D74B 2FJEB 2PN6A 2E66A 3AD8C 1CULB 4WTOB 1QSSA 2DR7A 3W3SA 3GR1A 3HHLD 2R2UA 1UWBB 3EGVA 4X4NA 4JI5F 4USIA 1UEUA 2BM0A 2YWGA 2KKHA 1HA1A 3P6YC 1U02A 4GC6A 1AB8A 2V2QA 2YKMA 3AHPA 3MCMA 1HNIB 1RTIB 4OYZA 1V6HA 2VC1A 1NSPA 2QYCA 2MQMA 3UD3P 1IQZA 3KJFB 3IM8A 3SSRA 5GAEU 4KB7A 2FJAB 3KKFA 2WB4A 4A8YA 2E9TA 2HQDA 2ZWOA 5K8OA 4O4RA 4CO0A 1T0TV 2RNEA 2UXBJ 4TXSA 2HHHJ 4DF8A 3CJSA 3IS9A 4P6QA 3CCSS 2E1PA 3J80Y 3MCSA 3SCLE 3CCUS 3THTA 3UVJB 3GJTB 2QLWA 2FLPA 1FRKA 2QMUB 2BYCA 3VHQA 1QUVA 2GO9A 4ZVFA 2YKMB 4FF3A 3H2LA 3DLGA 3FCVA 3OVAA 3VVTA 4EO8A 4DQRA 3J81Y 4K0KJ 2V8DA 1PJ7A 2IRUA 2QA2A 1P9YA 3MMBB 5J2MA 4MIBA 1U48A 2VFSA 1NK7A 1B7FA 3IS9B 2OD6A 3RB4A 1TAQA 2ASLA 5IT9Y 3GP9A 2JVRA 4Q2LA 1RT3A 2CJXB 4OYOA 1JJ2R 4USMA 2DNHA 2VFUA 4DSJA 5CYMB 1SL0A 3V6HA 3DFEA 2ILYA 1RAFB 3LWLA 2W2OP 2ZH7A 4YDDB 3DLGB 3NNAA 2V8VA 4C3LA 3IO1A 4DUTA 1DY3A 3BDPA 4Q8EA 5L9XA 1D1UA 4YY3F 4YP3A 4C3KA 1IJFB 1MN9A 4LRFA 5J2MB 3KK1A 3PW7A 4FKXA 1X5TA 1UFLA 4CIOA 2DNOA 1DTTA 4P74A 1RUSA 1JLEA 4F04B 1S1XB 1V3RA 1S0MA 1WSRA 3LP0A 3D0GE 2R7QA 1VQMS 1UFKA 3NOCA 5A0YA 1GAOA 3TX8A 2L9DA 2GVZB 4MK9A 4NZ7A 3UR0A 1N0UA 2WVDA 2IRYA 1H2UX 2CWXA 2HSEB 3CNQP 4OZ5A 3JSMA 1KN6A 3CDEA 5CD4A 4B3SF 2V69A 3L7UA 2XB2D 2NREA 2FJVA 3CJKA 3JQMA 2B5JA 1N54B 3K57A 5H9EK 5LMNJ 1U8WA 3R5CA 2W8KA 2RQ4A 1ZZFA 1RT1A 1RHMB 2OELA 3KK1B 2MKHA 4QR1A 2RS2A 3KLIA 5F0WA 1FXLA 2BOAA 1BQMA 1JXVA 1MN7A 3CDUA 2XBPA 2IM2A 2EWHA 5HJXA 2W2MP 3LP0B 1L5UA 1RAEB 5A0YB 2PO4A 2XMKA 3EZ5A 2OFGX 3SSQA 3WIUA 5DJBA 3BKFA 2ZDPA 1UA0A 1FX2A 2XO7A 4IG0A 2HWHA 1LK7A 2AJ2A 2B5JB 3K7RA 4CP5A 4NEYA 2W9CA 1NLKL 2FZCB 2LVWA 2RVJA 1B0PA 2Z58B 1WF2A 1RT1B 5IXUA 1QAJA 4Y2KA 1BD6A 2IDLA 2B9XA 5F9NA 4YEAA 3KHHA 4HLBA 3KHGA 1BQMB 2ATLA 2QTWA 4NA1A 5FIIA 2QC3A 3QJJA 3TA1A 4B3SJ 1KNZA 3WBZA 5DZ7A 4G1IA 2QMXA 3MM8A 3EE3A 3ZZRA 4F2RA 4C6AA 2QV6A 3OSNA 2C2ZB 3CDAA 2I0XA 1ZM3A 3RYLA 4M5JA 2ZH2A 3NAIA 4IG0B 4DEZA 4N8NA 7FD1A 3PO4A 3ENWA 1XEZA 4G6VB 2GGPA 1CEZA 2W9CB 1VBYA 3NGKA 2XCAA 1F2GA 3GYNA 5E3QA 4JUZA 3SCKE 2ZM6F 2DR8A 3OL9A 1RWUA 2BKNA 3R9LA 3BQ0A 5HQMA 1DTQA 4KH0B 1OQ6A 3VAJA 4LFCF 5HP1B 1XC9A 3PJXA 4OI3A 2PMZD 1NSAA 2WVEA 4O23A 1OO0B 2N7YA 3SFGA 5AJ3J 3N6NA 4C9DA 1F2HA 2DNLA 3DYAA 1Y3JA 3GR0A 3CE8A 5F3ZA 1BHNA 4C8OA 2GGPB 1N5TA 3THPA 3PRVA 1Y10A 3C16A 1TAUA 4A8SA 2DPJA 3BREA 4P7VA 4LIWA 4PCQA 3OVBA 1TL3B 1VJQA 5E5NA 1DTQB 1TKXA 2VJVA 2RILA 4DQQA 5G0RA 2MKKA 3Q23A 5IC4B 2BJ7A 2M52A 3BSNA 3GONA 4LRCA 1KLNA 3OW2R 4UUWA 3J7Z5 2V8GA 1HPZA 4X84A 3AQOA 2XS5A 4H4KC 2W4CA 1DZ5A 2YX7A 4LFCJ 5CAAA 5JMNA 4WBFA 5DQGA 1NJIT 2KDOA 5HMYA 2Z2YB 2B0GA 4LF5F 4X65J 3OD2A 2IBKA 3BB5A 1BC6A 1I94F 3I5AA 1S48A 5D0HA 5G0RB 6AT1B 2DGUA 4I7FA 3A3NB 3CXCR 3U1NA 4QU7A 3T41A 3DLHA 2CWKA 1ULRA 4O3SA 1KDNA 5K14A 3MM5A 1IM4A 3G6YA 4DXLA 2XMJA 3EICA 3VGTA 1SIWB 1HPZB 3C15B 1RBOB 2QLBB 3VGUA 1FNOA 4DSIA 1HQUB 3HVAA 3AA8A 3X1LB 2CJKA 1WEXA 3AFGA 3KLEA 1NJXA 3EGZA 4O44A 3GCXP 5DLGA 2GQCA 5D77A 4ZP9A 2HHWA 3QFWA 3ZC4A 4RR5A 3OTCA 2VOPA 2OPQB 3W2VA 4I7FB 2J0WA 2K7KA 5I4MA 5L46A 3CVKA 3KJQB 3NP5A 2ALYB 2COLA 3MM5B 5LXRA 2IJFA 3FEZA 3FSIA 3OLBA 2GW8A 3ZZYA 4DV5F 4IH7A 2CPEA 2JX2A 1I94J 3S7RA 4DMZA 1OIAA 2XI2A 1PBUA 4RUHA 4ED5A 4IRDA 2I38A 2R7VA 3JQJA 2V6AA 4UY8T 5F9LA 2A10A 2IY5B 3X3UA 2UV8A 4LSNA 4DU8A 4DV1F 1WC0A 3HFKA 5KFJA 3W2VB 3G6VA 4I2PA 1B70B 4USKA 3N0VA 1B0VA 3KWMA 2MSTA 1RT7A 1DQ9A 3HVRA 4OYMA 1VISA 4WKYA 1NH8A 5F41A 5AE1A 1E6YA 2DK2A 1RT5B 3PO5A 5LMUF 2MQPA 1MG7A 2ZEJA 1TTHB 4GMKA 2W01A 4YFUA 1MU2B 3OTEA 5IT4A 1RT4A 3EJMA 2AJQA 3LO3A 4GO7X 2XO6A 4CRJA 1NMEB 1FI4A 1YRTA 4ZPDA 4BDPA 1VQLS 4CM2A 4LSNB 3BR9A 4QIWD 3F44A 2QA4G 3GWCA 2RAQA 1P9QC 2H3EB 3H5YA 3TR5A 3N6MA 4I2PB 1MWQA 1S6PA 3W2WB 4CM0A 8RUCA 1RT7B 2FGOA 5LM7E 1B64A 2VBXA 4J5OA 1E6YB 2CPHA 5KFTA 5BJRA 4O0IA 2J8SA 4MKAA 2R7XA 4DV1J 4J9SA 1RBAA 3OL7A 4QWEA 1RT4B 4ILLA 1JLGA 5LOQA 3TO8A 1RTHA 2XY5A 4FPIA 5E3PA 2MZ1A 3B8HA 4G65A 7FDRA 5ETQA 3QGIA 1SUQA 1VMBA 3IMQJ 4WZMA 2KM8B 3N28A 5SZTA 5U47A 2C2KB 4CLFA 2KG1A 1KQGB 5M2UA 5EGYA 4DV2F 1FKAF 4GVLA 4FYWB 4ZPCA 4PYDA 3ONQA 3IGVA 2IAJA 1ZYQA 4U96A 3N6LA 4JI7J 2D9PA 3MD3A 2BE9B 2C22A 3W64A 3BPDA 1RLDA 1M1GA 3EDRB 3RAMA 4P2MA 1LNQA 2VUGA 1JLGB 2ZOFA 5KFMA 4ZP6A 4ENOA 3VQSA 1RTHB 4OJ1A 3TARA 4M1KA 2BQ3A 3MD1A 5F8LA 1SUQB 2AJFE 3DGVA 5G4DA 3D1QA 1HHSA 3LALA 4KHPF 1FTCA 5D4LA 4DSFA 1V5VA 1AFIA 4ILMA 3DXSX 3DI6A 4HACA 1X9WA 4DL5A 4OX9J 2VQFJ 3AD9C 4NYZA 1F9EB 1N33F 5E0OA 2WK4A 4KE5A 2Y3YA 5B0DA 2VA3A 5B0EA 3GZ7A 2D69A 3UI3A 2LFVA 2DD8S 1GNKA 2IAJB 5L1JA 3HHLA 1RYSA 1RT6A 2CQ0A 1C1CA 2DY9A 1JQGA 2YH1A 1F60B 1WD6A 3U27A 2HNDA 4FDFA 1WACA 2UP1A 1DHMA 4DR2F 1PIEA 1D9AA 2B4VA 2F8MA 1RWMB 4U7CA 4DV2J 3TAQA 4B02A 4JOUA 4OYWA 2ZDOA 3L7PA 2JEFA 2HAIA 2A2CA 3DI6B 4HACB 4XTTA 5CZVA 1VQ4S 4ZCMA 1SL1A 2VU5A 3CW2C 4DV6F 3HT3A 3Q2TC 1BWVA 1X5PA 4QIEA 3HHLB 3CIMA 1RT6B 3VAMA 4ELVA 4ZKAA 4KHPJ 1C1CB 2LA6A 1X60A 4DX8H 2A2DA 2E1AA 3HX9A 4IFVB 4O0NA 3P49B 4CT9A 2B8PA 1N33J 1FXRA 4PRFA 2PI4A 1U1PA 4I68A 2VODA 1VS3A 3V4MA 4AL7A 3OQ2A 5GAHU 2DVIA 2C2DA 3K2YA 2CJ9A 3HJVA 1PAUB 2KL8A 1Q86T 3P5BP 5AXNA 1VLOA 2H4WB 3DDIA 3QZ7A 4LVOP 2IYGA 1FESA 3US5A 5HMZA 3RZAA 4CLSA 1YJTA 5L38A 2BR0A 3KJVA 1ZOTA 2N3LA 4UQGA 3UPFA 5JVGQ 3QT5A 1XMQF 5K8MA 4RX6A 3ETOA 1F5AA 1HWUA 4DV6J 2W7AA 1WORA 2V68A 2DR9A 2MZQA 5D8HB 2QL7B 5LXYA 2VKZG 2W2NP 2EPIA 2DGOA 2EFPA 1GEHA 3M6VA 1EZZB 3THVA 4IO9Q 2ZUAA 1HNVA 4CI0B 2E9RX 1NK5A 1HW9A 3NGRA 2HFOA 2R2TA 1H7XA 2ZE2A 1FRJA 4MAKA 4NMLA 5D4PA 2BX6A 1WDDA 3KJVB 1VQ9S 2EKYA 1S7HA 5EX0A 2BBEA 1N5SA 1T05A 2IM1A 1CJVA 5HANA 3FJ2A 3SQGA 2HRUA 3NLCA 2DH7A 2BE7D 1JLCA 4F50A 1R27B 2BMBA 3RB6A 3Q0AA 3GIMA 4EWTA 4LF9J 1OJ4A 2ZJPQ 4M5KA 3HXMA 1C4CA 4KR0B 1NK8A 3NAHA 2OFHX 2GVDB 4I6AA 2VBWA 3MHYA 2RQCA 3O1LA 3Q8VA 2F1FA 4OZ2A 2N82B 2O66A 1XR6A 1HNVB 3ILIA 2MLXA 4U95A 2ZE2B 4LF8F 4M5NA 1TKTA 5KG1A 4C8YA 3D9BA 2ROEA 4NCAA 2CPJA 5DM6Q 1URNA 3TA2A 2YKNA 3NRBA 1T05B 3VALA 5IV3A 4RU2A 2LEBA 2VPXB 1YJWS 4WFYA 1U2FA 1EX8A 4HTIA 3LAMA 3EVWA 2V4RA 1ZAWA 3G6ES 3PTWA 4NLWA 4U8YA 4WF9Q 2DNKA 4PAAA 4LBHA 3IR6B 4TU7A 3GFZA 4RBUA 1KVJA 2VG6B 1NPRA 4N76A 1KONA 4BWMA 1TKTB 1FJEB 4WFBQ 3MOZA 1RLCL 1RTZA 3ZTRA 2YKNB 2DYAA 2DBBA 4QW8A 2UVRA 2B7CB 3WC0A 4DZDA 5DETA 2NZ4A 1ZAVA 1QTNB 2CQ2A 3DLKA 2NSCA 3DGPA 3MUVP 4FBUA 1ZAXA 1RJJA 1GXTA 3QNWB 2DNRA 4ELUA 3MECB 1YBTA 2OHDA 4AXJA 2ZITA 4L3KA 4UTGA 2KJVA 1X4HA 3MPYA 1GTEA 3W63A 4LF7F 1UVKA 2KYZA 1AT1B 5HAOA 3ZTQA 1N34F 3ISZA 3M32A 1N5QA 2I5JA 2QX0A 3D5MA 3UDEA 1B3TA 4WU3A 5KFGA 3HO1A 4OJGA 1UP1A 3TJ9A 3AXKA 3F56A 5KFCA 2DNPA 3N9UC 3DOMB 1LW0A 1NKBA 1IN0A 3DLKB 3DGPB 3FNNA 2CQ4A 3OTBA 4HT5A 1YJNS 4YQWA 4FS1A 2A18A 1K73T 4ZA1A 2FZGB 3SSSA 4DL6A 4DLEA 3CWJA 4ZP7A 4ELTA 3FUYA 5B0CA 2ZH1A 2BKOA 2VASA 2P2CB 3M32B 1R89A 5EWGA 4NLRA 4EBDA 1WF0A 2I5JB 3NL0A 1PJ5A 2RUSA 1DJ0A 3CT9A 3BQ1A 3B82A 5HI7A 1GMWD 1RGVA 4TN2A 3ZZOA 1N34J 1ZA1B 4ZP8A 3VF0B 2AV5A 2HYIB 2KYXA 3S1TA 3Q8YA 1FHTA 1DRZA 1KKHA 2WSFC 2KB2A 5KG0A 2ZFHA 1Y5NB 5CYQA 1A9NB 2E44A 3R2DJ 3TAMA 2CPZA 4HH1A 1G2EA 2C3YA 3MOJB 5HK4A 4NLDA 3PYGA 3QWUA 2ZHBA 2R8IA 1VQ7S 4K8RA 2LKZA 3QGHA 4ED8A 4DR6F 2OJ3A 4IOCQ 1GT8A 4NA3A 3BGRA 2HZAA 1VC0A 1FRMA 1HNZJ 4P71A 2C2OB 4ZCLA 3O44A 1IR1A 3OUYB 1RT2B 5B0AA 5K8PA 4FYXB 4ZPWR 1J5OA 2XSFA 4JV5F 1LV5A 4DSEA 4TKTA 2XMMA 1PG5B 1HBUA 4PWWA 5K5MA 3JSBA 3LUYA 2JC1A 2GJ2A 3H2VE 3QSYB 1IXKA 1KOOA 3TUPA 5GMKa 3TAMB 2J8AA 2PEHA 3R5AA 1VQNS 1IVZA 2E5JA 4QWBA 2WONA 1SVDA 1YHQS 4LRAA 2E5GA 4JI1F 2AYEA 4USVA 2JNJA 2YQ3A 3UCUP 4K7QA 5DDRC 4H4MA 1I1GA 1MROA 2VBYA 3BGRB 4LJMA 4XAKA 3RB3A 5DM7Q 1WEYA 1F9FA 2VQEF 2MZRA 1U1MA 1J5OB 3U1MA 5ETNA 1TV6A 3HPOA 1WHYA 5KT2A 2OH2A 1JMTA 4C3MA 3V6DA 1JLFA 4RNNA 1HBUB 1H74A 5HLFA 3ITHA 3GFYA 3M05A 1UVMA 4DR6J 1Q53A 3R97A 4PWUA 4P73A 1FRIA 3IP0A 1B4SA 2J0XA 3FC9A 3C3LA 2WONB 2CQ3A 4Q0BA 2HNZA 1H98A 4DN9A 2CPIA 1NUEA 3HVTA 2MKCA 2CAJA 2M8DB 4PG7A 1D09B 1AFJA 4H4MB 4Z7YA 1MROB 5AXKA 3MM6A 3WQPA 1GH8A 3C46A 2QYGA 3BV8A 1CJKA 4B9SA 5DZ6A 1TV6B 1VYAA 4X64F 3V6DB 1JLFB 3ET6A 1ZBTA 5HLFB 1HBNB 3HKZD 3T5LA 4DS5A 5CCMA 5KOWA 2CQGA 3EZUA 3FRZA 4M5DA 1ZA2B 2B9EA 1S9GA 3ZZ0A 2C2MB 3QIPA 3PR4A 2VQEJ 1YLXA 2XLKA 2JLGA 4Q0BB 2RD5C 2YNFA 3MAAA 4B3RF 3LQVA 3I9V9 2DRDA 4RO0A 2QFJA 1S1VA 4ILRA 1NJWA 1KLMB 4BS2A 3NGDA 1UW4A 1UA1A 2HS3A 4I64A 4ECZA 4CDIA 3SCIE 4KAIA 1CJKB 2GMJA 2HQ3A 3CCVS 3KNAA 2HQFA 1YWXA 3OBIA 3ADAC 4EBCA 5L1LA 2JEJA 3OL8A 2ZBPA 3ET6B 5KFLA 1NK9A 3RBEA 1VC6A 2DNMA 4CLKA 4FYDA 5AE2A 2HFZA 3ISNC 2PD1A 4M5DB 1FJ7A 3KNGA 1S9GB 2NLWA 1QJHA 2GFFA 2K7JA 3QIPB 1REVA 1R6YA 3MAQA 4KGMA 2YNFB 4X64J 2F65A 3S6EA 1S1VB 2AX1A 2GA7A 1NAQA 4L73A 2HURA 2QO3A 3RRHA 3DOLA 4CO5A 4YHHF 2FYXA 2IM3A 4B08A 2ZHOA 4NYOA 4UT4A 1PCAA 5KT3A 1HHQA 3QIDA 4J9KA 4X62F 2HFUA 1JLAA 1ZPVA 3BN7A 1DURA 3NGUA 4J9PA 1NZ8A 3OFFA 2XC9A 1JWWA 1M5PC 4NLYA 1FRXA 5DG9A 2J9DA 1KTQA 3IM9A 2DB1A 3CEDA 1ACMB 2GAHC 5CHCB 1T95A 1J5EF 2C3MA 1REVB 3TA0A 4UY85 3H25A 3GYGA 4DV0F 2AJ4A 4YR2A 4LBPA 2CZ4A 4C8NA 3TRGA 1RWNB 3K58A 4TU8A 2BANA 2DHHA 2Y8WA 2ZNZA 5H9FK 3DOLB 3FBBA 4ZJLA 1PYSB 2RKIA 3UCZP 1Q0NA 2GHPA 3MMJA 1ZZNA 3KHLA 2PMHA 1V3ZA 2K1RA 1XMOF 4DF4A 3GFXA 4AFFA 1JLAB 4UOCA 2IJRA 3G82A 2HQGA 3ZNJ1 2ASJA 1S76D 3KUHA 3BM7A 3AODA 4KGXB 2DNQA 2BA9A 2YH0A 3KUGA 2R7WA 4PQUA 5A8WB 4TY9A 4ZDNA 3GQCA 3A8EA 4X66F 3CO9A 3MEKA 2C3OA 3GG1A 3PYEA 2H9ZA 4JI6J 2EI5A 1O8BA 5KFIA 4OHZA 1RHRB 1FWPA 3BGUA 2FUG9 2LU2A 4TNOA 3H98A 2NQPA 1Q95G 4F26A 4J9LA 2BANB 3QZ8A 1WKJA 5KT6A 3HFVA 4DL0C 2YKOA 2MKJA 2RKIB 1MLAA 5LSRA 3LANA 1KR4A 1NDCA 1WG1A 3IBWA 3R8YA 1QAYA 2K1RB 1REGX 3DLEA 2G2YA 3NEKA 1QUPA 2JL9A 3G82B 2XHCA 3UD5A 3G71S 1SJ1A 3PW5A 1YZ6A 3DOKA 2XYGB 4MT1A 2HVZA 4WFXA 2ZZTA 4DDFA 4IR9A 1EHWA 3KFWX 4UZCA 3T9NA 1Q7LB 2W4PA 1Q5VA 2CNLB 3CCMS 4OYXA 4PWDB 2BRKA 2E5LJ 2HFSA 2DITA 2NR0A 3L7OA 3MTKA 4GKKF 1H7WA 2RJZA 3IWLA 1DAXA 4A8KA 3R27A 4MYTA 4L75A 2F4FA 4ETXA 4X66J 3PNIA 4PPZA 1P1TA 4ED3A 1QAIA 5T14A 2R7TA 4OHYA 1RWWB 5A2QU 3DOKB 4K2JA 1UWAA 4LIRA 2DTJA 2B9YA 5KFEA 3UD4P 2AP6A 3RR7A 4L76A 4E0DA 3JB9k 4NCBA 1JJ4A 3R1LA 3QMQA 1I5OB 1N5VA 1X5SA 1TUVA 2Q6BA 1WC1A 1IM6A 1UEVA 3BO4A 1GXUA 2BEFA 2C3UA 1I6JA 1WOSA 3I96A 3IBCB 3WIVA 2JLEA 2AYBA 4A46A 4ED6A 1NSQA 4DL3A 3CO0P 2VKRA 1U0HA 1VRQC 3AB4B 3S8SA 1IKVA 3E3XA 2OSRA 1HIYA 4PQAA 1N5YB 3LP2A 3GV7B 3PV8A 2QSWA 2CQBA 2PMWA 3FBCA 2HBRB 2HHUA 1C0UA 1S6OA 5JVHQ 3W9JA 2BM1A 3ULHA 3D3BJ 2CPYA 3H5SA 4KHMA 4V1Ak 4ZLNA 1OY6A 3EGWB 1CBKA 4CLPA 3FVYA 1X4EA 4ED0A 5I42A 4CLWA 3BBCA 1ZETA 1I51B 3L3CA 1OMSA 2CJBA 4YB6A 1IKWB 4PR6A 1BLUA 3MTJA 2FJDB 1RB0A 3NXZA 3DRXA 4I69A 1TMJA 1FE0A 1KP6A 1U0HB 4USWA 2GS8A 4WCEQ 1F5BA 1NM2A 1IKVB 2EFGA 1YJVA 3EDQB 5HN0A 3LP2B 2FIUA 1UZHA 2Q3PA 3T5JA 1C0UB 1ZTTA 4LT6A 9RUBA 3ZXWA 2KO1A 4N8OA 2Y1LB 2CG4A 3FSYA 2KI2A 2BE2A 4DPYA 3KG1A 5I42B 1QLNA 5D15A 4F36A 4KJIA 3JSYA 2LMIA 5BYRA 1KVKA 4JI0F 3NKYA 3P96A 2KT3A 1TK5A 4W98A 2W9BA 1FKPA 3I0RA 2G2OA 3CTRA 3PFEA 4WK1A 4KGKA 1Q8LA 4CH7A 1RHKB 3LH2S 2MGZA 3O8WA 2F3JA 1ZS6A 1QY7A 3KK3A 3OJSA 1LWFA 4AXIA 3B54A 1N0VC 3S01A 3GE9A 1WDTA 2RDJA 2BE2B 1FWLA 4B9NA 2VDIA 4RUAA 2VIHA 1Y7PA 3PW0A 3A8JA 4ICLA 1S12A 1C4AA 1LOUA 3ENAA 2BJ3A 1PYTA 2XM3A 1T9YA 4QBUA 5MLCV 2UUTA 1X7VA 2HGNA 4NLUA 2PI5A 2W9BB 4DR7J 3I0RB 4QJVA 5IWAJ 2CPXA 3GYXB 4FKYA 2Y9HA 2UVVA 3HP6A 4QPXA 4NL5A 3ZZZA 2MGZB 3KG0A 5FLXU 2QSFA 1SQEA 4F3OA 4RW4B 2XLIA 4DSLA 1F6TA 2XS2A 3H4BA 3K17A 3KK3B 3PY8A 3B4MA 1LWFB 3IXQA 3W66A 4JI0J 2R7RA 4QOTA 3D1HA 4F4XA 4DUYF 1R7IA 3RB0A 2IBOA 2DGXA 3MXHP 1QSLA 3JAMY 1OPZA 3T5KA 4ICLB 4OI1A 3AB2B 4Z7CA 2VDHA 1T9TA 4EZ9A 3EVMA 3HKWA 3PACA 3MR2A 5HO4A 3T6BA 2DJWA 3G86A 4CO2A 1NJZA 3LW5C 4Y65A 4YMEA 2FVPA 2DGVA 2AD9A 2UXDF 1GMWA 1HMVB 2IMOA 2HWIA 2AYMA 2OIHA 4PG6A 1T3OA 4K4YA 1T02A 2B43A 4DG1B 4NE9C 1XR5A 2DNNA 3M8SA 2CZVC 5IFMA 2Y0BB 2M4MA 4RKUC 1RHJB 1FJCA 4U9RA 5F0UA 4DV7F 4OZ1A 5K20B 4P2FA 1SH3A 2OSQA 4PXBA 2BJ1A 1XNQF 2EXUA 4DPOA 4OYAA 2V4JA 1HYSA 4ITSA 2CXEA 3MZIA 1LFPA 3W1YC 4ED2A 4F4WA 4PZVA 3E2EA 3DHXA 3MCNA 4C7QA 5JUMA 1SH2A 4AD6A 3DU6A 3SBMA 1H38A 2ALZA 4M95A 4DUYJ 1NPPA 2AEMA 2UUWA 1NKCA 2HS0A 2RT3A 2CA9A 2D7SA 1T94A 1YVFA 3C8YA 1OSCA 3MPDA 1S97A 1RU2A 4QZVB 2W9AA 2DO4A 5KTQA 3M2UA 3I9ZA 1CPZA 3TANA 3A8KA 4RPFA 3R5GA 4OI0A 2GX8A 2UXDJ 1W2IA 4IKAA 2G9OA 1SJ3P 4KSEB 1HYSB 1ICEB 5B08A 3D2WA 2EC2A 2YPYA 2UXCJ 4PXDA 1UPPA 3UO0A 4HKQA 3PKMA 1U2RA 4GO5X 2MQ8A 5CYJA 4R25A 4CYUA 2ROGA 2OPPA 3DRSB 2XTJP 4ECQA 4DV7J 3E01A 3RAXA 3TZYA 4DCPB 3CMAS 2R9LA 2HZCA 4UUXA 1EARA 4JB8B 2V67A 1XNQJ 3VVUA 5J2QB 5F8IA 2ZHAA 1RA6A 1SKRA 1LXJA 1N48A 1X9SA 4C97A 1RAAB 3HF5A 4WPAA 1VHIA 3BSAA 4M5HA 1RSCA 4WXWA 5EHHA 1WI6A 4DX6A 2VL1A 2JVOA 2RQMA 1IKYA 2XCPA 1YRUA 2DXDA 2DGSA 2C3PA 2XMTA 4LR7A 3PYFA 4K4UA 4LSZB 1SIZA 1N6QA 4LR9A 1IBLF 1YJRA 1H3DA 2HHTA 1SB6A 8ATCB 4JI4F 4CYUB 2AJ0A 2OPPB 1P8GA 1U26A 1L3SA 3E01B 4RLEA 4JI2J 2ZZMA 4W4MA 1S57A 2MLZA 3E8OA 2OMLA 2PFDA 4CH1A 1CULA 3SEOA 3J80U 4DR1J 4ZOSA 4LFBF 3WZ0A 3BSCA 2MZSA 1APSA 1RADB 1W25A 3GILA 2NXUA 5ETMA 1X9MA 1BWEA 2MQOA 4TQRA 1DBDA 1HNXF 4KGVB 1U24A 2A6MA 1TKDA 1N6QB 2BW7A 2Q6CA 1HNIA 4HR2A 1CC7A 2IVFB 3VWSA 3TUIC 3GG0A 3J81U 4NLSA 4ALZA 4F0KA 3RW6A 2BACA 4HDHA 2QLXA 4CCHA 4CH0S 3NOGA 4L3NA 5L39A 1YJ7A 1RABB 5IT9U 3UVJA 3TI0A 1IBLJ 2CZ9A 4EFAC 4K0KF 4JI4J 1LQ9A 2F4VF 4GKJF 5HQ8A 2PEBA 2JWNA 2YWHA 3HHDA 4C0OC 1XNRF 2RHSB 2FHOB 5F8MA 1RQ0A
chains in the Genus database with same CATH topology
4CLTA 1CULA 5D0EA 2GVDA 3C14A 1WC5A 4OZ2A 1YBUA 1WC6A 4P2FA 1CJTB 5D15A 1FX2A 4NI2B 1TL7B 4WP8A 3MAAB 1CS4A 4OYAA 5D0RA 4OYMA 3MAAA 3MR7A 1AB8A 5IV4A 1YBTA 2GVZB 1WC4A 2W01A 2GVZA 4CLPA 2BW7A 4WPAA 1AZSB 4OYZA 5IV3A 1CJTA 4CLWA 4WP9A 2WZ1A 4NI2A 1TL7A 4USTA 1CJKB 4CLFA 4OYOA 4OYPA 3ET6B 4CM2A 1U0HB 4USWA 5D0HA 4CLUA 4OZ3A 1WC1A 4P2XA 1CJVB 3C16B 4CLKA 3G82B 1CJUB 1AZSA 1CJVA 1Y10A 3C16A 4CLYA 4OYWA 1Y11A 3R5GA 1YK9A 3C14B 2QV6A 3UVJB 1CJKA 4CLZA 4USUA 3UVJA 4P2MA 4OYIA 4CLLA 4WP3A 4CM0A 5D0GA 4USVA 4CLSA 1FX4A 1CS4B 3ET6A 3C15B 1U0HA 3C15A 4OYBA 1WC0A 1WC3A 4OYXA 1CULB 3G82A 1CJUA 2GVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLT A;  1CUL A;  5D0E A;  2GVD A;  3C14 A;  1WC5 A;  4OZ2 A;  1YBU A;  1WC6 A;  4P2F A;  1CJT B;  5D15 A;  1FX2 A;  4NI2 B;  1TL7 B;  4WP8 A;  3MAA B;  1CS4 A;  4OYA A;  5D0R A;  4OYM A;  3MAA A;  3MR7 A;  1AB8 A;  5IV4 A;  1YBT A;  2GVZ B;  1WC4 A;  2W01 A;  2GVZ A;  4CLP A;  2BW7 A;  4WPA A;  1AZS B;  4OYZ A;  5IV3 A;  1CJT A;  4CLW A;  4WP9 A;  2WZ1 A;  4NI2 A;  1TL7 A;  4UST A;  1CJK B;  4CLF A;  4OYO A;  4OYP A;  3ET6 B;  4CM2 A;  1U0H B;  4USW A;  5D0H A;  4CLU A;  4OZ3 A;  1WC1 A;  4P2X A;  1CJV B;  3C16 B;  4CLK A;  3G82 B;  1CJU B;  1AZS A;  1CJV A;  1Y10 A;  3C16 A;  4CLY A;  4OYW A;  1Y11 A;  3R5G A;  1YK9 A;  3C14 B;  2QV6 A;  3UVJ B;  1CJK A;  4CLZ A;  4USU A;  3UVJ A;  4P2M A;  4OYI A;  4CLL A;  4WP3 A;  4CM0 A;  5D0G A;  4USV A;  4CLS A;  1FX4 A;  1CS4 B;  3ET6 A;  3C15 B;  1U0H A;  3C15 A;  4OYB A;  1WC0 A;  1WC3 A;  4OYX A;  1CUL B;  3G82 A;  1CJU A;  2GVD B; 
#chains in the Genus database with same CATH topology
 1TK0 A;  2RU9 A;  3DLB A;  4QYR A;  3C14 A;  2CYY A;  4PXE A;  1JNR B;  4OI6 A;  5J1E A;  5HRO B;  3RU0 A;  1YJU A;  2GMH A;  1PKU A;  2XYH B;  3D0I E;  3BN4 A;  4LFB J;  1DFD A;  2VFT A;  2Q43 A;  4BWJ A;  1FVS A;  4K4X A;  1BE4 A;  2JH3 A;  4NYP A;  1U6B A;  3MMB A;  3I31 A;  2KZM A;  2E1R A;  4JYA F;  1D0E A;  3M8Z A;  1HNX J;  2IVY A;  3I4H X;  1G4C A;  2P9C A;  2KFZ A;  2MHN A;  4H54 A;  4KKO A;  3J81 j;  3BBB A;  3DKD A;  4WII A;  3R7B B;  1YX2 A;  3MUT P;  4C4W A;  2ZH4 A;  2ZBR A;  1WG4 A;  5CYM A;  1RAC B;  3TUZ C;  4MMO A;  2OO4 A;  5KFQ A;  3C14 B;  3QAU A;  4OZL A;  5J1E B;  2W4D A;  2IIH A;  3NMA A;  2HFV A;  2J9C A;  1FX4 A;  2FC8 A;  5B0G A;  2F4V J;  4GKJ J;  3DM2 A;  4TLQ A;  4NLQ A;  5GVQ A;  2NXN A;  3GIK A;  4FS2 A;  2KH9 A;  1XNR J;  1X0P A;  3LPE A;  2W2P P;  5E3A A;  4DZ6 A;  1P1L A;  2KN4 A;  1KEK A;  4RW6 A;  1R3N A;  4J37 A;  4PEO A;  1S1X A;  4A8X A;  3OSP A;  5LMN F;  3VZH A;  3MR7 A;  3AJ2 A;  4KKO B;  2O1P A;  1QM9 A;  8AT1 B;  3K5P A;  3PXG a;  3R2C J;  1R31 A;  2FZK B;  4XK8 C;  2GVZ A;  3BDE A;  4UOH A;  5AXL A;  1G6B A;  5GAD I;  1UZD A;  1QAX A;  4EYH B;  3VAG A;  4JYA J;  1V9O A;  3CJ2 A;  4ZLJ A;  3EGN A;  5DS7 A;  1VR6 A;  3NBP A;  4K5S A;  3CUN A;  4B9V A;  2XYP B;  4TVA B;  2Y1J A;  4X4R A;  3DM2 B;  3PIO Q;  2X1B A;  3KOA A;  2AZ3 A;  3M8Q A;  2Z8Q A;  5HMX A;  1JJH A;  3PJW A;  4X4O A;  4KO0 A;  1AXQ A;  2D3Z A;  4RW6 B;  2KFY A;  1PC5 A;  4R5P A;  4K59 A;  2FQQ B;  3VAH A;  4NCG A;  1T7P A;  2HBY B;  3IG1 B;  2O5D A;  2WOM A;  5E3R A;  2QEX S;  5KOX A;  2ZC3 A;  2H5I B;  3F73 A;  2OGU A;  3M9N B;  3C2P A;  1RBL A;  4IH6 A;  1S9E A;  2L48 A;  4QWA A;  3RRG A;  5H9E J;  3MAH A;  5D78 A;  3MEE B;  4QCL A;  3QT6 A;  1T8E A;  2YNI A;  3NBP B;  1KOH A;  1CG2 A;  5E2Q A;  4P72 A;  1PBA A;  1U47 A;  2FLN A;  3M8Q B;  4OV1 A;  3OR2 A;  2AEJ A;  1U49 A;  4O3R A;  2AGQ A;  4EGL A;  1QVG R;  1XQI A;  1SJF A;  4KO0 B;  3BEG B;  4EI2 A;  4EU0 A;  4R5P B;  2KHC A;  1HNW F;  3HLU A;  3M8R A;  5A76 A;  2C28 A;  4NCG B;  2JLF A;  2POK A;  2H48 B;  3K5O A;  2CQH A;  2WOM B;  2MLY A;  4ANE A;  5ETS A;  3RBD A;  4C11 A;  4WWS A;  4MTP A;  1R6V A;  1S99 A;  3TUJ C;  4USU A;  2O01 C;  2XS7 A;  1M5S A;  1RHU B;  3RTV A;  1S9E B;  3K8W A;  3IWN C;  3QJL A;  3B6B A;  1L3T A;  1RA7 A;  4ECY A;  2BDP A;  2X1G A;  3I6P A;  2RE1 A;  2BJE A;  4CO4 A;  2YNI B;  2ZH8 A;  2CDQ A;  2DO0 A;  3A3P B;  2OAU A;  2K06 A;  3CD7 A;  5AJ3 F;  5GMD A;  4R8U B;  4OLO A;  2X3D A;  2A1B A;  3OR2 B;  3M2V A;  2YNG B;  2W24 A;  1H72 C;  3UN5 A;  2DPI A;  3V2U C;  2I1R A;  4NLX A;  4Y3C A;  2B4O A;  5HP1 A;  4O3Q A;  2DGW A;  2HAF A;  1A0O B;  3H5U A;  4IQX A;  1RWO B;  4C11 B;  3VTI A;  3KMS A;  1OY8 A;  1YSJ A;  2R2R A;  3IN5 A;  2XMW A;  2QE5 A;  2NXJ A;  2GC8 A;  2L3M A;  2CKW A;  1HNW J;  4MH8 A;  2QGF B;  2DRB A;  3RBZ A;  3GLJ A;  5HBM A;  3M2V B;  4EBE A;  1TL3 A;  2D3U A;  1OYD A;  3IGN A;  4KTQ A;  1YJ9 S;  4Z2X A;  2EKN A;  4MYU A;  4N5S A;  2D3O 1;  3QLH A;  2V8P A;  2XMV A;  2DCL A;  4DOZ A;  2XQC A;  4G1P A;  1HR0 F;  4ID5 A;  2RHQ B;  4X65 F;  2GIQ A;  2DEJ A;  1CLF A;  4ES3 A;  2BAB A;  5CA5 A;  1SPB P;  1FE4 A;  1SL2 A;  4F25 A;  2IC3 B;  3QPI A;  2AF6 A;  3NCP A;  2ZKU A;  1XR7 A;  3CDB A;  4RU9 A;  3ZNU A;  4LF4 F;  5HBM B;  4NZ6 A;  5KFY A;  4FBT A;  3JXO A;  4RBT A;  2FHJ D;  2HEK A;  1X4A A;  3P8B B;  1UJ6 A;  1RKI A;  2X7I A;  1EKS A;  3PFO A;  2ZWP A;  3QLH B;  4JI8 J;  3WC2 A;  4CO3 A;  1SJ4 P;  4QYZ K;  4ID5 B;  4RNH A;  1FFG B;  1WOO A;  3M6W A;  1NKE A;  1BQN B;  3CSK A;  4ZIW A;  3C15 A;  4Y00 A;  3JTP A;  4F3Q A;  2DXE A;  2RML A;  4Y28 C;  3C66 A;  4FYV B;  1VDH A;  2MTL A;  2W7O A;  1HQU A;  3O6Q A;  3POT A;  3ILO A;  3QRQ A;  1OQ3 A;  2GZO A;  2J6T A;  2L9W A;  4WFN Q;  1FDD A;  3SDE A;  4YDX A;  2C2N A;  1HR0 J;  2KXN B;  4BC7 A;  5J2N A;  2IVM A;  3DLJ A;  4OZN A;  4DR3 F;  3FZ2 A;  2MY7 A;  1SH0 A;  2RQK A;  2PC6 A;  2OPQ A;  3CJ8 A;  5A2Q Y;  3O2I A;  4PXC A;  3NWG A;  1HBO B;  1D3W A;  2M9K A;  3KDN A;  2XGQ A;  4A8W A;  4NXM J;  2JSX A;  3C6U A;  3JTO A;  2KM8 C;  4LF4 J;  4O3P A;  2NYI A;  5B0B A;  3GCW P;  1VRU A;  1S49 A;  4URQ U;  5D4O A;  3DRP A;  3PJ9 A;  3BZQ A;  2QT7 A;  1TP7 A;  3POT B;  2DR5 A;  1UAW A;  4F2S A;  3IAS 9;  3CJ3 A;  3AY0 A;  3SDE B;  5J2N B;  3LWM A;  4WU2 A;  2J6S A;  1IKX A;  1QE1 A;  3PX6 A;  4I4B A;  2M7S A;  2B56 A;  3FBE A;  2XI3 A;  1J2V A;  4FXD A;  5EN1 A;  3L09 A;  3HSZ A;  1NB2 A;  1HLW A;  3EVO A;  3C6U B;  5LSO A;  3QSI A;  1RT5 A;  2MJN A;  2HRT A;  4Y0F A;  1BGX T;  1VRU B;  2Z57 B;  1RAH B;  1VBZ A;  3DRP B;  4B9M A;  1MU2 A;  4LUB A;  4DR3 J;  3W9I A;  2MB0 B;  3IR7 B;  1B99 A;  3T6J A;  4B9T A;  4X4Q A;  4OLP A;  3IRX B;  4QIG A;  1G1X A;  1KFD A;  3H7H B;  4NX9 A;  4ZJQ A;  3DDN A;  2HFN A;  1R8P A;  3V6J A;  1IKX B;  3PG9 A;  3T1H F;  2F7V A;  1QE1 B;  4ZLL A;  2AGP A;  5B09 A;  1M5O C;  3W7B A;  2AJ1 A;  3AQP A;  4DPX A;  5KFK A;  3VGV A;  3W2W A;  3M8Y A;  2W2Q P;  2FB0 A;  2X51 A;  2EFQ A;  1ITP A;  4DQP A;  5IQQ A;  3MR5 A;  2B6A A;  2ZUG A;  1VQ6 S;  2B9W A;  1CJU A;  4FN5 A;  1WC5 A;  2BQR A;  2QA1 A;  2V2V A;  3V81 A;  4J9N A;  2DEI A;  3G6X A;  2XWX A;  2VD3 A;  2FD2 A;  2XWY A;  3LGM A;  3HHL C;  1K0V A;  1K44 A;  1UVI A;  2I8E A;  2A0F B;  3IAM 9;  4C48 A;  1N32 F;  4OQJ A;  4JI7 F;  1HFE L;  1VJW A;  1JX4 A;  1TL1 A;  1NK6 A;  1C1B A;  3Q83 A;  4HHH A;  2LU1 A;  2MKI A;  1VQY A;  3I0S A;  5GAG U;  3BO2 A;  4HVZ A;  4F0M A;  2UU9 F;  2GQQ A;  3FCW A;  1RTJ B;  3Q8R B;  1AYE A;  2RB7 A;  2B6A B;  3OTD A;  3RG6 A;  5D3G B;  1N36 J;  1CJU B;  3TJA A;  4CLY A;  2AIR B;  1BUX A;  1U45 A;  2N7C A;  1RWK B;  3V81 B;  4OX9 F;  3T1H J;  1H0H B;  2VQF F;  3SV4 A;  1X5O A;  3EYZ A;  4MKY A;  3CB4 A;  4RNF A;  4EYI B;  2XY7 A;  4K5R A;  2ZJQ Q;  3CF5 Q;  3EWG A;  2V4Q A;  3SZ2 A;  1VOM A;  3OT9 A;  4ZLP A;  1TL1 B;  1C1B B;  3H40 A;  2G4B A;  1IR2 A;  3NMR A;  1SBR A;  3I0S B;  3HVW A;  5D0R A;  4BCA A;  2XY6 A;  3RAQ A;  3Q89 A;  1Z1Z A;  1VRT A;  1RCO B;  5LT5 A;  2VA2 A;  1FNX H;  4OX6 A;  2DH9 A;  3TVZ A;  2CNN B;  1KWM A;  2RSQ A;  3UQS A;  1N32 J;  1CJT A;  1IBC B;  3TZZ A;  1XMB A;  4NI2 A;  1O5J A;  1S1W B;  1J27 A;  4PKD B;  2Q66 A;  2Z0G A;  3NS6 A;  2IM0 A;  4NLV A;  2UU9 J;  1N4L A;  3G2X A;  5C25 B;  2HKE A;  3KDO A;  3UDC A;  2BJ8 A;  4RUB A;  1IJE B;  5A8R A;  2VC0 A;  2RS8 A;  1RTD A;  1V5I B;  4ZPT R;  1HWK A;  1SC4 B;  2L9N A;  3VGS A;  5C24 A;  1VRT B;  5KG3 A;  4HDG A;  3RW7 A;  4RUC A;  3TX0 A;  1YBU A;  1CJT B;  4NI2 B;  1SC6 A;  3TQ1 A;  2LQB A;  2EFO A;  2CQI A;  4WFZ A;  3NG8 A;  4Y2M A;  3MDF A;  2OUG A;  1M5H A;  4IFV A;  4FZV A;  4CQ1 A;  3CCR S;  3R5B A;  2G2Z A;  1FVQ A;  4PYA A;  2ZZN A;  2OEK A;  1WHX A;  2FVC A;  4F4Z A;  3OTO F;  2Q1L A;  5A8R B;  2RF2 A;  5CXT A;  3FDS A;  3QBC A;  1RTD B;  4FXV A;  2X1A A;  1WF1 A;  1GX6 A;  3K0J A;  4IH5 A;  5KT7 A;  5C24 B;  4AQY F;  3HZE A;  5RUB A;  4OX7 A;  2M8H A;  2ASD A;  5T41 A;  4LRD A;  3A8I A;  3VAI A;  5BYQ A;  1JB0 C;  2P5V A;  3RBX A;  4DL2 A;  3CD6 S;  2QLF B;  3DMJ A;  4ER8 A;  4H4O B;  2XZD B;  2GHW A;  1Z2Z A;  2J6U A;  2UVW A;  4O4G A;  3I5B A;  1X31 C;  5GAG I;  4ZVG A;  4IG3 A;  4DFK A;  1XIQ A;  5KAK A;  1RAI B;  3QWP A;  1H73 A;  1Q79 A;  1NH7 A;  1JXL A;  2MPU A;  1KD1 T;  3PX0 A;  3GSD A;  1U2C A;  1Q82 T;  3N01 A;  4QPT A;  2YPZ A;  5DG7 A;  2RF2 B;  2AEF A;  2ZD1 A;  2CDR B;  3LGH A;  1Q1K A;  2KVI A;  1P27 B;  2B7B B;  3CD5 A;  4KV8 A;  5DDP C;  2BJD A;  3NGT A;  2XZW A;  4LF9 F;  2EC0 A;  3ENV A;  3KUE A;  5ITH A;  1KS2 A;  2Z4P A;  2CJQ A;  1FRL A;  2IYI A;  3DMJ B;  3OTO J;  3DRR B;  5ETO A;  4TY8 A;  3HHE A;  4OZ3 A;  4O4G B;  1JLQ A;  1WWH A;  4IG3 B;  3OR1 B;  1OPI A;  2MYF A;  2RU3 A;  2BVZ A;  4AQY J;  4M5L A;  3P3D A;  3CJQ A;  3FRY A;  3KTQ A;  4L6V 3;  4X4S A;  3W5X A;  2FY8 A;  2HWT A;  2ZD1 B;  2X3G A;  2F9J A;  4QWD A;  4RW7 A;  4FVC A;  2GVD A;  2AZ1 A;  4KV8 B;  1FNM A;  4WXO A;  4ETZ A;  2FVR A;  5KFR A;  5DDQ C;  2BJ9 A;  4D3H A;  4KY3 A;  2NUU G;  2FVS A;  1S79 A;  1K1Q A;  3VR1 A;  4XO0 A;  2KU7 A;  1MW7 A;  1T9U A;  1UJ5 A;  2OI2 A;  2B3T B;  2M2B A;  1RYR A;  4TY8 B;  1RI7 A;  1NXI A;  1JLQ B;  1VK8 A;  2GNK A;  4WP9 A;  2N4D A;  1UET A;  1PJ6 A;  3W60 A;  3SV3 A;  1U1L A;  1PGZ A;  2CVE A;  2J7U A;  4JI5 J;  4A8F A;  3GB0 A;  3C6T A;  3CCZ A;  2B4U A;  3MR3 A;  1ZPW X;  5L1K A;  4RW7 B;  5AXM A;  5LJ3 Y;  6FD1 A;  1UW9 A;  4K4W A;  4FF2 A;  3T19 A;  4KPC A;  4XIU A;  5HAT A;  4WP3 A;  3PZP A;  4J7C A;  4IR1 A;  4HHJ A;  4DCJ B;  2QJ3 A;  4IFY A;  5EX3 A;  2VG6 A;  2XNR A;  2CUY A;  3HZG A;  2Z2Z A;  3RUB L;  4K4V A;  5E33 A;  3JYT A;  3DRY A;  4MK7 A;  4WP8 A;  3OXG A;  3ZO7 A;  1KQK A;  1KQF B;  1VIO A;  3BH7 B;  3HSJ A;  3C6T B;  3MEC A;  9ATC B;  5E41 A;  4A8M P;  4KHR A;  2YX4 A;  1RT3 B;  1VFJ A;  1SC1 B;  3G8S A;  3HD1 A;  1XWL A;  4B3T F;  2LXI A;  2QN6 B;  2BV3 A;  4Y6I A;  3I56 S;  4K4Z A;  3W5Z A;  2ERR A;  1UVL A;  1SJR A;  2EBG A;  4IFY B;  1YBA A;  2Q79 A;  2ADB A;  1TL5 A;  4NRT A;  3PX4 A;  3CCQ S;  4ECV A;  2GAG C;  2GO8 A;  1Y11 A;  2HQC A;  4FF4 A;  1OYE A;  2MKS A;  5K8N A;  3JYT B;  1U6F A;  2BUN A;  5A6W A;  3H5X A;  3UR3 C;  4ZPA A;  1QSY A;  1TFW A;  3P45 B;  4P9S A;  3DOM A;  1RDR A;  3ILJ A;  1NEE A;  1RP5 A;  4NWB A;  2H5E A;  2I2Y A;  1URR A;  5B0F A;  1DTT B;  2ZH3 A;  1JLE B;  2LP4 A;  1OS5 A;  2HHP A;  1UCN A;  3UNG C;  2FJX A;  2I6W A;  1KQS R;  1F9H A;  1FEH A;  2XSJ A;  3QAT A;  3DLL Q;  3OXF A;  5GAE I;  4YY3 J;  3KLV A;  3N5B A;  3JSM B;  4RNO A;  2ACY A;  3PRD A;  3D66 A;  3CJK B;  2MXY A;  1EET A;  2D9O A;  2GQ2 A;  2IRX A;  1CQM A;  3F41 A;  2ZJR Q;  4B3T J;  2ZKT A;  3QT8 A;  2E29 A;  5JJB A;  1M5V C;  2G0I A;  1FK9 A;  4MKV A;  3KLI B;  5IQ6 A;  2G13 A;  4E98 A;  3W65 A;  3GFH A;  3I4P A;  3M8W A;  5DLF A;  2FHJ A;  2DY1 A;  3GII A;  1HNZ F;  2WCX A;  4AL6 A;  1WOP A;  5KFB A;  3OLA A;  2XSJ B;  1WC3 A;  4IRK A;  1U09 A;  2R42 A;  4QQB A;  4IO1 A;  5CH7 B;  1O0P A;  2HVH A;  1HWI A;  3ZFV A;  4OZ0 A;  3CJ4 A;  2P9G A;  5E3C A;  1RAJ A;  1EET B;  2HPU A;  3FSX A;  1EQM A;  2HMI A;  2P9E A;  3R7S B;  5EWF A;  1WC4 A;  1DAR A;  2CPF A;  3OUY A;  5C7P A;  1FK9 B;  3MFH A;  1RT2 A;  2RDD A;  1GTH A;  3U7J A;  4NZ0 A;  3TWZ A;  4OYP A;  3L95 X;  1WKL A;  3LTO A;  1TL4 A;  3DC2 A;  3H20 A;  3TW0 A;  1R0C B;  2F8E X;  1KSP A;  3UE2 A;  3MM8 B;  1IWG A;  1X4G A;  2AW0 A;  1NDL A;  1IUJ A;  2OPR A;  3UCG A;  4CNZ A;  1NDK A;  2DGT A;  2J0Q D;  1OY9 A;  4ED4 A;  5D0G A;  2N3O A;  4NXN F;  3AXM A;  3PCO B;  2V34 A;  4HL9 A;  5ETV A;  2HMI B;  4P10 A;  3VQT A;  5ETL A;  4BHQ A;  2GJI A;  2EEY A;  2MQL A;  1YDL A;  4LR8 A;  1SKU B;  4JV1 A;  4ES1 A;  2KT5 A;  1AA1 B;  2NUH A;  5I3P A;  1RU1 A;  1XJW B;  1BXN A;  2UUC F;  4Q2M A;  2AU0 A;  4FPR A;  4CNY A;  2VIC A;  1FTR A;  1NHV A;  2DKO B;  3SIP B;  4UZB A;  3TNV A;  2DH8 A;  3PHT A;  2HIY A;  2OPR B;  4QW9 A;  4N7T A;  2ZM6 J;  4X4P A;  3BR8 A;  3DYA B;  3EMT A;  2LEC A;  2H51 B;  1OSD A;  1KRP A;  4TU9 A;  5H1S V;  2H4Y B;  5ADZ A;  3CCT A;  5C42 A;  1RAO A;  1G3O A;  4XDD A;  4PG4 A;  5IOL A;  1ELO A;  3C16 B;  4WJB A;  5BXI A;  1RCX B;  1SI9 A;  1JKH A;  2EK6 A;  2W7P A;  2G0J A;  2K2P A;  1TKX B;  2LEP A;  3MFI A;  2KTQ A;  1HBN A;  4NXN J;  2HHV A;  4WKR A;  3CIZ A;  3BQ2 A;  1B7Y B;  2ZVS A;  3EX7 B;  1F1B B;  1TKZ A;  3KXD A;  1S6U A;  1WC6 A;  4M5M A;  1Z4U A;  4GVB A;  2JJ4 D;  4LVN P;  2ZBC A;  3GJQ B;  2LLZ A;  4M63 A;  2NPF A;  4O3N A;  2APO A;  3DN9 A;  3H90 A;  2V5H G;  2UUC J;  5C42 B;  4WZQ A;  2KZZ A;  1KLM A;  2EVZ A;  4ZCK A;  1JKH B;  5AE3 A;  2VJU A;  1VLY A;  3D68 A;  1TL7 A;  3VZI A;  1QTM A;  1KTV A;  2P6T A;  4A8Q A;  1VQ5 S;  1F3V A;  4QR0 A;  1S6Q A;  3JS9 A;  2DRA A;  1TUW A;  1EAY C;  2FJW A;  4R0J A;  2HGL A;  4KRW A;  4ZVQ B;  4RL1 A;  4FNH A;  4V19 J;  1O51 A;  2A6O A;  5K14 B;  4CLZ A;  3GU0 A;  1U8S A;  1TKZ B;  5B7W A;  1R8B A;  4ZK7 M;  4LF5 J;  2JC0 A;  4GVB B;  3KYL A;  4JV0 A;  2YWK A;  1HI1 A;  3HHN B;  1U1K A;  1KVI A;  3W5Y A;  3SXL A;  3K5N A;  1ZM9 A;  3D3C J;  1L3V A;  2KT2 A;  5CZX A;  5KFU A;  4MKB A;  1U7L A;  4BC9 A;  4DFP A;  2DHX A;  3KLE B;  4MIW A;  4O44 B;  3ZZP A;  5I3U A;  1W7W A;  2PFF B;  4I1T A;  1TL7 B;  2RRA A;  1Y9O A;  3FBF A;  1N8R T;  1SXL A;  3MUR P;  1JNZ B;  3MR6 A;  1S6Q B;  2FDN A;  4ED1 A;  4GC7 A;  1AUS L;  5F8J A;  1DQA A;  3AA9 A;  3NNC A;  2DGQ A;  3M7V A;  2OD4 A;  2WBM A;  4DFJ A;  4H4K A;  2H1Y A;  4GRS A;  3CUL A;  1Q8B A;  4J91 A;  4Q5V A;  1RAG B;  1SKS A;  1SC3 B;  2PGC A;  1X4D A;  2Z2M A;  4UF4 A;  4CLU A;  1XER A;  5KFN A;  5EDW A;  1T9V A;  2XLJ A;  3QGP A;  4ZHR A;  1YI2 S;  2F8H A;  4DS4 A;  2HQI A;  5DDO C;  3ZTS A;  3LP1 A;  4C8L A;  2SXL A;  5I3U B;  3B78 A;  1IWA A;  2HIQ A;  4JI6 F;  1FCA A;  2M70 A;  1PYO B;  4F0H A;  5LSL A;  2PII A;  4NLT A;  2DHG A;  1U6Z A;  4DV5 J;  4ZVO B;  3HT0 A;  4OI2 A;  4MFB A;  3CD0 A;  3IWX A;  1RWV B;  1YIJ S;  1FKO A;  5A8W A;  3QQC D;  2VH7 A;  1AUD A;  3UDV A;  2FPH X;  3TZX A;  2J5A A;  2L41 A;  4J9Q A;  1S72 S;  2M0G B;  3SYZ A;  4DBQ A;  3MCO A;  4FF1 A;  4NLO A;  1I3O B;  2HG4 A;  1VHF A;  3LF0 A;  3TQE A;  4ZHR B;  1EKR A;  3A3O B;  5H9F J;  1WI8 A;  2Z56 B;  2YNH A;  3LP1 B;  3RRK A;  3PYD A;  2DHA A;  2V9K A;  1TFY A;  3KLF A;  3EZO A;  1WHW A;  1UTA A;  4X4V A;  3PVX A;  3BYR A;  3ENQ A;  4KYZ A;  5LMU J;  2E5L F;  2G1H A;  5ETP A;  3QYY A;  3KG4 A;  2IJN A;  1S6P B;  2G0C A;  3SCJ E;  1RKJ A;  4MFB B;  1K9M T;  4LF1 A;  4Q7A A;  2MZJ A;  1FKO B;  1FWK A;  2DIV A;  4RW8 A;  1HW8 A;  2BW2 A;  2WW4 A;  3PW4 A;  4PG8 A;  4C2M A;  4PWD A;  1U0S A;  4DQS A;  4Y2I A;  2KRR A;  1WUU A;  4DX5 A;  3G8T A;  2YNH B;  1VGY A;  1DQ8 A;  5HVH A;  1RK8 A;  3AOA A;  4ZN1 A;  1NHU A;  1ROF A;  1RIS A;  4CO1 A;  4QU6 A;  3KLF B;  2IMW P;  4NMX A;  4J9U E;  2IPO B;  2HHQ A;  1YGY A;  2OLW A;  4AL5 A;  1IBK F;  1BMQ B;  3WHI A;  2RH3 A;  4DPT A;  1FF2 A;  4HI2 A;  4RWW A;  4I56 A;  2YY3 A;  1LWC A;  1N52 B;  4RW8 B;  3M2R A;  5KFZ A;  3TVY A;  4DHV A;  5CAB A;  1AZS A;  2JFD A;  3GIR A;  3L4B C;  4NAS A;  3HM9 A;  4B3O A;  2R7S A;  4Y2C A;  3OFG A;  1EB0 A;  3HHK A;  3RR8 A;  2MJU A;  3QT7 A;  5KFP A;  2C42 A;  4B17 A;  2NXC A;  5DRK A;  3U1L A;  1N5Y A;  1SKW A;  1JK9 B;  3BSO A;  2CFX A;  2IFX A;  2VV5 A;  3R5J B;  5HMW A;  5J1P A;  1CVJ A;  4A4J A;  5IV4 A;  1WEZ A;  1LWC B;  3UN2 A;  3DU5 A;  3M2R B;  3N5F A;  3Q8S B;  4ZVH A;  2DR6 A;  4UW2 A;  4MK8 A;  3A13 A;  1MMN A;  5J2P A;  4ANC A;  1AZS B;  4BLG A;  1RZM A;  3UDL A;  2LA4 A;  1VBK A;  4UST A;  1RWP B;  2HND B;  3M6U A;  1NU4 A;  2GJF A;  1IBK J;  1IKW A;  1UKU A;  2AHO B;  1T9W A;  4B3O B;  4TLR A;  3SFU A;  2BZ2 A;  3BS9 A;  1UJ4 A;  3ISN D;  4KC5 A;  1VQS A;  4QR2 A;  4DWI A;  3M6X A;  5LL6 d;  2J9E A;  1H2V Z;  4CWB A;  2CQ1 A;  5KG6 A;  2ATC B;  1FD8 A;  2WW8 A;  1MMD A;  2DHS A;  2V94 A;  4I2Q A;  5I3Q A;  1MML A;  4DR2 J;  3BKU A;  4LF2 A;  2FTR A;  4ZPB A;  1G7C B;  4QIF A;  1WTF A;  3CJ0 A;  4PPD A;  1MSW D;  5J2P B;  5LJ5 Y;  3BKT A;  3J7A 1;  2RDI A;  2JFK A;  3P5T L;  3KLH A;  3FMB A;  1LWX A;  2AWZ A;  2R8K A;  4NA2 A;  1T11 A;  1FDA A;  3Q86 A;  3K89 A;  4ECR A;  1WHV A;  3OFE A;  3B4D A;  4OV6 A;  2MQN A;  5F8N A;  1W2B R;  5FJ4 A;  1S59 A;  2CNO B;  3WDO A;  2C2E A;  5HL7 Q;  2HHS A;  2WZ1 A;  2YWF A;  4DPU A;  3D1O A;  2YWE A;  3OHB A;  4IYQ A;  1S4E A;  2LCW A;  2DCU B;  1K1S A;  2ASY A;  1JJC B;  4DX7 A;  3TAP A;  1HD0 A;  4P2S A;  4DR7 F;  2M5Y A;  4I2Q B;  5IWA F;  1FO1 A;  3NNH A;  3KMQ A;  2RUG A;  3JAM U;  1M90 T;  1U1N A;  4M94 A;  1LK5 A;  3EXY A;  4F4K A;  4E8U A;  1MWY A;  3KLH B;  4I6W A;  3ZTO A;  4C0B A;  4ZVS B;  3QAE A;  4QIV A;  3T9Z A;  1C2P A;  1WKK A;  2P6S A;  1QVF R;  1JXE A;  1D8Y A;  2UZA A;  2ZBI A;  1HQ2 A;  3W9H A;  4DR4 F;  4RW4 A;  1X4B A;  2XMA A;  1FDN A;  1H2T Z;  3KLG A;  1IR0 A;  4NEZ A;  3T1A A;  4DQI A;  4XPE A;  4FYY B;  1YQH A;  3I87 A;  3TEH B;  3DDK A;  3OV7 A;  1XMQ J;  3O5T B;  3I32 A;  5ETK A;  1F0X A;  3PW2 A;  3AJ1 A;  4X4T A;  4ZN3 A;  1SCJ B;  3AD7 C;  5KFX A;  2DNZ A;  1VBX A;  1VK3 A;  3G9C A;  2OEJ A;  1NDP A;  3MF5 A;  4YR3 A;  2NSB A;  4P2X A;  1CJV B;  1UMJ A;  2PDA A;  4U7U D;  1K0T A;  4K4T A;  3SQG B;  4NLP A;  4KH1 B;  1JLC B;  2JRS A;  4JP8 A;  1S1U A;  1HMV A;  2Y0S D;  1YZ7 A;  1IBM F;  2KRB A;  2BRL A;  2CQC A;  2HZV A;  5C2G A;  3L9Z A;  4C8Z A;  4DG1 A;  3KLG B;  4ZIT A;  4LF6 F;  4J9V A;  2R8G A;  3J7A N;  5HVF A;  1S1T A;  5L1I A;  3G87 A;  2MQQ A;  4EMD A;  2U2F A;  4ZPV R;  2XEX A;  4USH A;  3WX4 A;  2C2R A;  2ZOM A;  5D6G A;  4OHV A;  1NPK A;  2MDA A;  1F3F A;  2QLJ B;  2JOQ A;  3W8P A;  4DR4 J;  1NCL A;  5GAH I;  3NS7 B;  1R0B G;  4C8K A;  3T5H A;  3HDS A;  2QMW A;  4DPW A;  1S1U B;  2OMO A;  2CPD A;  2ZNY A;  2IDE A;  1S4F A;  3HK2 A;  2QZ8 A;  2UXC F;  2V63 A;  4ECS A;  2VPY B;  1N56 A;  4LF8 J;  2QL5 B;  2H65 B;  4RNM A;  1X8D A;  3N4W A;  1S1T B;  2GIF A;  4F02 A;  4CTA A;  5JXS A;  3HD2 A;  4HH0 A;  1Q7Y T;  2V50 A;  1NBE B;  3CME S;  4K4S A;  5J1N A;  5KG7 A;  5DQH A;  3HI9 A;  3CCL S;  1IBM J;  3NCR A;  1KHV A;  1HKA A;  2B8Q A;  4LF6 J;  4ZVP B;  1VI7 A;  3SMZ A;  3FEX B;  1KHW A;  3JSR A;  3IR5 B;  3DRS A;  4U6P A;  5F3T A;  3SQO P;  3V6K A;  2Z30 B;  1D9F A;  2E5I A;  2V2Z A;  2FGC A;  1SV5 A;  1FD2 A;  4F4A A;  1ZM2 A;  3MI7 X;  4PUO A;  3FKB A;  5J2Q A;  3H4D A;  4WK3 A;  3CJ5 A;  1Y0H A;  2KXH A;  3D54 A;  2DNY A;  5L9N A;  4RWX A;  4YR0 A;  4XDC A;  3OL6 A;  2F63 A;  5KG4 A;  4CTA B;  4JI2 F;  3CPW R;  4B9U A;  4UOF A;  2VPZ B;  4DU7 A;  1L3K A;  1UFW A;  4J9M A;  2YTC A;  3LPY A;  2MKY A;  4F67 A;  3IRW P;  1NB7 A;  3D6M B;  1LKZ A;  2FVQ A;  1IQT A;  2IA0 A;  4OJ3 A;  4F3M A;  4DR1 F;  1B0T A;  1U4B A;  1SJQ A;  3I55 S;  4MJK A;  4OHX A;  4DL4 A;  3M30 A;  4PG5 A;  1S0V A;  3D28 A;  2NYH A;  5A6P A;  4LF7 J;  4I0W A;  1LW0 B;  3R7N B;  1SV5 B;  1WTB A;  2G1D A;  2ZBQ A;  4PUO B;  4A48 A;  2EG2 A;  2GIR A;  3TVK A;  3ZTP A;  2VG7 A;  1JIH A;  1WSV A;  4X2B A;  1YRX A;  3AOC A;  3P4U B;  1LXN A;  1R8A A;  3MM9 A;  3NS5 A;  4WYW A;  1NJY A;  4I6Y A;  1TUG B;  2HBQ B;  2KVQ E;  5T7L A;  4LMZ A;  3CJR A;  4USJ C;  4J90 A;  3JQK A;  3G4S S;  3TJ8 A;  2NCK L;  2MMY A;  3W61 A;  3M30 B;  1N88 A;  2NZC A;  3M9O B;  3DCA A;  5C2C A;  3UNY A;  2PA3 A;  2LEA A;  5GAD U;  1R43 A;  2CAD A;  1Q81 T;  1X4C A;  3EXC X;  3WX8 A;  1Y00 A;  3BYP A;  4NOH A;  3GV8 B;  2VG7 B;  2IHR 1;  1TEL A;  5CYQ B;  1A6L A;  3MM9 B;  1HQE A;  1S0N A;  1PSD A;  4FVM A;  2KHD A;  4DN0 A;  2PA8 D;  2YXL A;  1VIX A;  5T7L B;  3ILL A;  4DSK A;  1NSK L;  2FLL A;  2DXF A;  1EIY B;  2WVB A;  4EK2 A;  1X4F A;  3PKY A;  4AUK A;  1X0F A;  5M2R A;  1GX5 A;  5HRO A;  2CNK B;  3NY0 A;  2P8I A;  2E1C A;  3ZZT A;  3ELH A;  2BXJ A;  2K8G A;  4G1Q A;  2R8J A;  4JBC A;  2VG5 A;  1FA0 A;  4DL7 A;  2R8H A;  1H6K X;  1M0S A;  4U7U K;  2F5G A;  1S0O A;  3BBF A;  1HQE B;  4W92 B;  4ED7 A;  3M8P A;  1LW2 A;  3PRB A;  3EPG A;  4C0H A;  2XZT B;  4LQ9 A;  3I5C A;  4EO6 A;  1TZ0 A;  4M8L A;  4Q44 A;  4OFZ A;  4JV5 J;  2WVC A;  2BQU A;  5CCL A;  3H8Y A;  1S7I A;  4HEA 9;  1HAR A;  2AQ4 A;  4YUD A;  2VFR A;  2HK3 A;  2E1M C;  4G1Q B;  3FCH A;  2AKW B;  3OFH A;  3FGV A;  2HVD A;  2VG5 B;  1NO8 A;  7AT1 B;  2V2K A;  4A47 A;  4WFA Q;  3PIP Q;  4ZMM A;  1ARO P;  3Q8Q B;  3PEJ A;  4KBI A;  1A7G E;  3EPI A;  2VBZ A;  3ITH B;  5IZH A;  4JI1 J;  2WTF A;  2WHO A;  2LDY A;  4IOA Q;  3M9M B;  3M8P B;  1LW2 B;  3MPU B;  4AT1 B;  3TYT A;  4N56 A;  3BJY A;  1UL3 A;  5IM0 A;  3KK2 A;  3JTN A;  1VQO S;  3HSG A;  5FD1 A;  2AT1 B;  5GME A;  4KQZ A;  3AOB A;  3K5L A;  2AX0 A;  1HL6 A;  4F7V A;  1TK8 A;  2L08 A;  3E51 A;  2HNZ B;  3EUN A;  3CCW A;  1FFS B;  3HVT B;  2HVE A;  2XMU A;  4L74 A;  3CC2 S;  5THW A;  1U1R A;  3MM6 B;  5AT1 B;  5KG5 A;  4DV3 F;  5IT0 A;  3BGO P;  2R2S A;  2W1B A;  3T3F A;  2DIS A;  3R5D A;  1PO6 A;  2R7U A;  1GQE A;  3Q2S C;  1T3N A;  1K8A T;  3FMW A;  2FLO A;  3FZB A;  1YKW A;  5CD4 H;  3U02 A;  5FDL A;  2QFI A;  3A12 A;  3HMJ G;  2MY8 A;  4U67 Q;  5IM0 B;  3KK2 B;  3IG1 A;  3MMA A;  4OIX A;  3DHW C;  3HFZ B;  3VAK A;  1KFS A;  4DV4 F;  3MAA B;  1FER A;  3NGS A;  3FQK A;  1R0A A;  3W8G A;  3BGF A;  3R6L B;  4LSL A;  2CG8 A;  2J76 E;  1VQK S;  3MEE A;  3RGI A;  3CCE S;  4Z37 A;  4LRB A;  3IC1 A;  1AW0 A;  1V3S A;  3PHE A;  5M2P A;  4M5I A;  3V5R A;  5KFH A;  3R6G B;  3D6T B;  3SI8 A;  3R3T A;  4Q45 A;  4DUZ F;  2XG8 A;  5HSP A;  3LA0 A;  2OTL S;  1Q78 A;  3MM7 A;  2BOP A;  4B3R J;  4TQS A;  2EW9 A;  2FY1 A;  4E2F B;  2UUA F;  1C0T A;  5FDL B;  1FFW B;  2B51 A;  3AJD A;  3GMG A;  3N79 A;  4DV3 J;  2OP5 A;  3MMA B;  2D3O R;  2N4C A;  4YOE A;  1VC5 A;  2YKA A;  1R0A B;  1R8H A;  2FJB B;  1GFW B;  4LSL B;  4QWC A;  3VAF A;  2HRY A;  3D7S B;  3EM1 A;  2KFN A;  5BR8 F;  4R8U A;  3DNC A;  4Y2A A;  2UVU A;  4ZS6 A;  4DJB A;  2YNG A;  4K2X A;  1XN9 A;  4DV4 J;  3H0P A;  4XPC A;  3MM7 B;  2H5J B;  4I67 A;  2DT9 A;  4BBY A;  3TOQ A;  1C0T B;  4C8M A;  4KPY A;  2VFV A;  4ECW A;  2XGP A;  4N77 A;  4YHH J;  2J7K A;  3BO3 A;  2CQD A;  2D41 A;  1TU0 B;  1EP4 A;  4HTJ A;  1S9F A;  4DUZ J;  4X62 J;  4J9O A;  5F8G A;  4L72 B;  2K3I A;  4ZVR B;  2UUA J;  2I9S A;  3D6F B;  4UOG A;  1GMU A;  3FK4 A;  2KG0 A;  2J0S D;  4HI1 A;  3HUL A;  1J5E J;  1HD1 A;  2D1C A;  4DV0 J;  2LQ8 A;  1RHQ B;  4K50 A;  1XTZ A;  3KJN B;  1U1Q A;  1Q4R A;  2CJA A;  1UVJ A;  3TZW A;  4CLT A;  1TQL A;  4DLG A;  2WB1 D;  5EWE A;  1O6X A;  4WIQ A;  4PQU B;  1CQN A;  2MHE A;  4P52 A;  3J7Y U;  1LWE A;  4ZCI A;  1PAE X;  3M4X A;  2HK2 A;  4IOB A;  2H54 B;  1CS4 A;  4OJH A;  2V9W A;  1EP4 B;  1M1H A;  5BR8 J;  3MPV A;  3D4J A;  4R0E A;  1XMO J;  1LFW A;  4OZJ A;  5EUH A;  3QRP A;  4JI8 F;  1F5C A;  2IC3 A;  4CZC A;  4AYB D;  3J7Z T;  3CGI A;  1GK8 A;  1TR0 A;  2PT0 A;  1PC4 A;  1YTY A;  3DLE B;  1Q8K A;  2E5H A;  3MED A;  2ACM A;  1FDB A;  2NS1 B;  3IFE A;  3FQL A;  2AGO A;  3QGG A;  4Q8F A;  1XBW A;  2VB6 A;  3UW1 A;  1LWE B;  2GHV C;  2R3V A;  1CS4 B;  2CRL A;  3ETM A;  3MGJ A;  3GJR B;  3MEG A;  1BQN A;  2GML A;  2LQ5 A;  1S10 A;  1HWL A;  1RWX B;  4HYK A;  4NXM F;  4IDK A;  1NHK L;  2OTJ S;  2HHX A;  4YS2 A;  1FXD A;  4D3G A;  2ZH9 A;  1FT8 A;  4FP9 A;  2AMC B;  3K5M A;  2V0N A;  1EJ7 L;  1K47 A;  4JI3 F;  3MED B;  1YG0 A;  1CC8 A;  4OMF G;  3D0H E;  4ECT A;  2UUB F;  2RRN A;  3GTY X;  1HBO A;  4QYZ J;  3VCD A;  1WJ9 A;  1Y3K A;  3HSD A;  4GKK J;  1HWJ A;  3G8Q A;  2J9D E;  2PSZ A;  3MUM P;  4KIA A;  1W26 A;  4AE5 A;  4A8O A;  1U25 A;  3MEG B;  3M1V A;  4EEY A;  2PE8 A;  4B9L A;  1VCT A;  3QO9 A;  2O67 A;  4DCO B;  4F8R A;  1HI8 A;  4OYI A;  4ZJO A;  1YIT S;  4IDK B;  3H42 A;  4HHU A;  2JZ5 A;  3K59 A;  1U1O A;  1SQG A;  4YB5 A;  1S5Z A;  4U8V A;  4ID8 A;  4OYB A;  4V19 X;  1GXL A;  1R8C A;  2VOO A;  3A1Y G;  5IC6 B;  2ROP A;  3CJT A;  1HHT P;  5KFS A;  5DQI A;  2WAQ D;  4AND A;  3UN3 A;  2ZOG A;  4YB7 A;  3MWB A;  6FDR A;  1TMM A;  5E7O B;  4W90 B;  1WNE A;  3D6H B;  3HCX A;  2VHG A;  5F8H A;  3TEG A;  3QRR A;  2YKQ A;  4URG A;  2R4F A;  4MIA A;  2EG1 A;  3V4I A;  2HLT A;  3NWR A;  2ZH6 A;  3OJU A;  5CQG A;  3AAW B;  3M1V B;  1SQF A;  5BYS A;  3BH6 B;  3QO9 B;  1NK0 A;  2ZC4 A;  2FHK A;  5KFA A;  1OWX A;  4JI3 J;  2OKQ A;  2VF3 A;  2JHE A;  4N47 A;  1FEE A;  2UUB J;  3BPS P;  3PEH A;  2LQ9 A;  4KFB A;  1TVR A;  1Y5L B;  5KFF A;  1ZH5 A;  3IRX A;  3QJP A;  4O3O A;  1NZA A;  4WYL A;  3A4T A;  3J7Y I;  2Y1R I;  2E7X A;  2ABY A;  2W25 A;  1KBR A;  4WE1 A;  4NRU A;  1KC8 T;  5KFV A;  2GCF A;  2VZ9 A;  4HT7 A;  2LXU A;  1UPM B;  2QG9 B;  2HNY A;  1Y5I B;  4ES2 A;  1HBM A;  2EFN A;  4URS A;  4JV2 A;  5KFW A;  3V4I B;  3AH6 A;  1JLB A;  1ZM4 A;  4KGZ B;  5A8K A;  3O3L A;  3H2U B;  2XHW A;  2FC9 A;  3BF4 A;  1E6V A;  4IUF A;  4NPO A;  3FEY B;  1VQ8 S;  3NCQ A;  2WBR A;  1FKP B;  4KFB B;  2K3K A;  2AYG A;  1TVR B;  4ATN A;  2J7W A;  2HBZ B;  1Q8I A;  2YVS A;  4B3M F;  1N36 F;  2XUL A;  4ZVT B;  2VON A;  4EZ6 A;  3GIJ A;  5DG8 A;  3CC7 S;  1UEK A;  4FXW A;  3H59 A;  4TYA A;  3PDN A;  4LFA F;  3DXB A;  4ECX A;  3Q22 A;  4WE1 B;  5KFO A;  2QRR A;  2BKP A;  1S77 D;  3BGL A;  3GV5 B;  5ETT A;  1M5K C;  2Z2L A;  2O3D A;  4ZIV A;  3IA0 A;  1RTJ A;  2HNY B;  2CIM A;  1HBM B;  5D3G A;  1JLB B;  5A8K B;  1NND A;  2KXF A;  4YN3 B;  3RJM B;  4WTY A;  3VV2 B;  4RW9 A;  1RE1 B;  4ZVU B;  1E6V B;  2LYV A;  2KJW A;  4F4Y A;  4OHW A;  4S0M A;  3OVS A;  2R7O A;  1T03 A;  2WVF A;  2F9D A;  2XNQ A;  5HVG A;  1NK4 A;  4DR5 F;  2EFV A;  2A3J A;  2E9Z A;  4X4U A;  4Y34 A;  1QDU B;  5C5J A;  3MPW A;  1VQP S;  2UV8 G;  3ICL A;  3CC4 S;  2EK1 A;  5DGA A;  2IA6 A;  1EQ0 A;  2JDJ A;  1D8Z A;  3PM9 A;  2X1F A;  4P75 A;  1T9X A;  3QFH A;  2DNG A;  4B3M J;  2M88 A;  3W62 A;  4LRE A;  2CVI A;  4LBI A;  2RRB A;  4RW9 B;  4RZR A;  2MSS A;  2EBE A;  3LOU A;  4LFA J;  4TYB A;  3C19 A;  4J9R A;  5KT4 A;  1S1W A;  3FFI A;  2YWW A;  5DO2 A;  3G96 A;  5K9F A;  3MMC A;  2Y1I A;  3PR5 B;  1T03 B;  5L8R C;  5C25 A;  2FHM A;  1NRK A;  3KHR A;  5FLX Y;  3UWT A;  4CLL A;  3Q24 A;  2JEG A;  5HQL A;  1RXO B;  2OPS A;  5KG2 A;  4NLG A;  3LGN A;  2DIU A;  2B4P A;  4G3I A;  4KT0 C;  4DI6 A;  1UVN A;  5D4N A;  1D9D A;  4ERD A;  2QIF A;  4P7T A;  2LXF A;  4N41 A;  3Q8U A;  2U1A A;  3TP2 A;  4RBV A;  4FNI A;  2YQ1 A;  2F40 A;  4EUV A;  2QL9 B;  4DR5 J;  2V4J B;  2W8L A;  5ETR A;  3OHA A;  4ECU A;  1Q5Y A;  4M5G A;  1M1K T;  1GMV A;  2V8H A;  2HLU A;  3T1Y F;  2YKP A;  3GJS B;  2WSE C;  3FFI B;  2LDI A;  3MMC B;  5KFD A;  4PAB A;  3IBF B;  2HGM A;  2RIJ A;  2LQJ A;  3CCJ S;  1MWZ A;  2NPI A;  2MEW A;  2NXE A;  3R1H A;  2YX1 A;  3ZZU A;  1Y4Z B;  2C1E B;  2YBV A;  1FJG F;  1BQX A;  2CJY B;  1DLO A;  2OPS B;  4CT8 A;  2WRM A;  4IQM A;  1P6T A;  3M2U B;  2HS4 A;  2ZH5 A;  1MNE A;  1BY9 A;  3OPK A;  1WG5 A;  2GV1 A;  1QD1 A;  2JEI A;  5MAO A;  1ZTW A;  1Z2L A;  3LAK A;  4RJV A;  3I82 A;  2OEM A;  4H4O A;  5D0E A;  2VPW B;  5SUH A;  2E7V A;  1XK8 A;  2MZT A;  2QA4 S;  5KT5 A;  2HVI A;  3D67 A;  1PIL A;  3K8V A;  3Q8P B;  4UQT A;  4OX8 A;  3CMQ A;  5HJY A;  1DLO B;  2ADC A;  1L3U A;  5IS2 A;  1WEL A;  4LQ3 A;  2WSC C;  4ZVE A;  3OXL A;  2CQP A;  3GSI A;  3T1Y J;  3AT1 B;  1FRH A;  1CSJ A;  1UWB A;  2Y8Y A;  1IKY B;  4DFM A;  4OL8 A;  4C98 A;  3CDW A;  2UXB F;  2HHH F;  3F0N A;  4IRC A;  3HJF A;  1FJG J;  4YB1 P;  1LEO A;  3DRR A;  2HW3 A;  4OI4 A;  3UFC X;  2YQ0 A;  1RTI A;  2ILZ A;  3GPA A;  3OR1 A;  1YK9 A;  1Q16 B;  4Q43 A;  2M3D A;  5DGB A;  1HI0 P;  2ZVI A;  2E7W A;  2D74 B;  2FJE B;  2PN6 A;  2E66 A;  3AD8 C;  1CUL B;  4WTO B;  1QSS A;  2DR7 A;  3W3S A;  3GR1 A;  3HHL D;  2R2U A;  1UWB B;  3EGV A;  4X4N A;  4JI5 F;  4USI A;  1UEU A;  2BM0 A;  2YWG A;  2KKH A;  1HA1 A;  3P6Y C;  1U02 A;  4GC6 A;  1AB8 A;  2V2Q A;  2YKM A;  3AHP A;  3MCM A;  1HNI B;  1RTI B;  4OYZ A;  1V6H A;  2VC1 A;  1NSP A;  2QYC A;  2MQM A;  3UD3 P;  1IQZ A;  3KJF B;  3IM8 A;  3SSR A;  5GAE U;  4KB7 A;  2FJA B;  3KKF A;  2WB4 A;  4A8Y A;  2E9T A;  2HQD A;  2ZWO A;  5K8O A;  4O4R A;  4CO0 A;  1T0T V;  2RNE A;  2UXB J;  4TXS A;  2HHH J;  4DF8 A;  3CJS A;  3IS9 A;  4P6Q A;  3CCS S;  2E1P A;  3J80 Y;  3MCS A;  3SCL E;  3CCU S;  3THT A;  3UVJ B;  3GJT B;  2QLW A;  2FLP A;  1FRK A;  2QMU B;  2BYC A;  3VHQ A;  1QUV A;  2GO9 A;  4ZVF A;  2YKM B;  4FF3 A;  3H2L A;  3DLG A;  3FCV A;  3OVA A;  3VVT A;  4EO8 A;  4DQR A;  3J81 Y;  4K0K J;  2V8D A;  1PJ7 A;  2IRU A;  2QA2 A;  1P9Y A;  3MMB B;  5J2M A;  4MIB A;  1U48 A;  2VFS A;  1NK7 A;  1B7F A;  3IS9 B;  2OD6 A;  3RB4 A;  1TAQ A;  2ASL A;  5IT9 Y;  3GP9 A;  2JVR A;  4Q2L A;  1RT3 A;  2CJX B;  4OYO A;  1JJ2 R;  4USM A;  2DNH A;  2VFU A;  4DSJ A;  5CYM B;  1SL0 A;  3V6H A;  3DFE A;  2ILY A;  1RAF B;  3LWL A;  2W2O P;  2ZH7 A;  4YDD B;  3DLG B;  3NNA A;  2V8V A;  4C3L A;  3IO1 A;  4DUT A;  1DY3 A;  3BDP A;  4Q8E A;  5L9X A;  1D1U A;  4YY3 F;  4YP3 A;  4C3K A;  1IJF B;  1MN9 A;  4LRF A;  5J2M B;  3KK1 A;  3PW7 A;  4FKX A;  1X5T A;  1UFL A;  4CIO A;  2DNO A;  1DTT A;  4P74 A;  1RUS A;  1JLE A;  4F04 B;  1S1X B;  1V3R A;  1S0M A;  1WSR A;  3LP0 A;  3D0G E;  2R7Q A;  1VQM S;  1UFK A;  3NOC A;  5A0Y A;  1GAO A;  3TX8 A;  2L9D A;  2GVZ B;  4MK9 A;  4NZ7 A;  3UR0 A;  1N0U A;  2WVD A;  2IRY A;  1H2U X;  2CWX A;  2HSE B;  3CNQ P;  4OZ5 A;  3JSM A;  1KN6 A;  3CDE A;  5CD4 A;  4B3S F;  2V69 A;  3L7U A;  2XB2 D;  2NRE A;  2FJV A;  3CJK A;  3JQM A;  2B5J A;  1N54 B;  3K57 A;  5H9E K;  5LMN J;  1U8W A;  3R5C A;  2W8K A;  2RQ4 A;  1ZZF A;  1RT1 A;  1RHM B;  2OEL A;  3KK1 B;  2MKH A;  4QR1 A;  2RS2 A;  3KLI A;  5F0W A;  1FXL A;  2BOA A;  1BQM A;  1JXV A;  1MN7 A;  3CDU A;  2XBP A;  2IM2 A;  2EWH A;  5HJX A;  2W2M P;  3LP0 B;  1L5U A;  1RAE B;  5A0Y B;  2PO4 A;  2XMK A;  3EZ5 A;  2OFG X;  3SSQ A;  3WIU A;  5DJB A;  3BKF A;  2ZDP A;  1UA0 A;  1FX2 A;  2XO7 A;  4IG0 A;  2HWH A;  1LK7 A;  2AJ2 A;  2B5J B;  3K7R A;  4CP5 A;  4NEY A;  2W9C A;  1NLK L;  2FZC B;  2LVW A;  2RVJ A;  1B0P A;  2Z58 B;  1WF2 A;  1RT1 B;  5IXU A;  1QAJ A;  4Y2K A;  1BD6 A;  2IDL A;  2B9X A;  5F9N A;  4YEA A;  3KHH A;  4HLB A;  3KHG A;  1BQM B;  2ATL A;  2QTW A;  4NA1 A;  5FII A;  2QC3 A;  3QJJ A;  3TA1 A;  4B3S J;  1KNZ A;  3WBZ A;  5DZ7 A;  4G1I A;  2QMX A;  3MM8 A;  3EE3 A;  3ZZR A;  4F2R A;  4C6A A;  2QV6 A;  3OSN A;  2C2Z B;  3CDA A;  2I0X A;  1ZM3 A;  3RYL A;  4M5J A;  2ZH2 A;  3NAI A;  4IG0 B;  4DEZ A;  4N8N A;  7FD1 A;  3PO4 A;  3ENW A;  1XEZ A;  4G6V B;  2GGP A;  1CEZ A;  2W9C B;  1VBY A;  3NGK A;  2XCA A;  1F2G A;  3GYN A;  5E3Q A;  4JUZ A;  3SCK E;  2ZM6 F;  2DR8 A;  3OL9 A;  1RWU A;  2BKN A;  3R9L A;  3BQ0 A;  5HQM A;  1DTQ A;  4KH0 B;  1OQ6 A;  3VAJ A;  4LFC F;  5HP1 B;  1XC9 A;  3PJX A;  4OI3 A;  2PMZ D;  1NSA A;  2WVE A;  4O23 A;  1OO0 B;  2N7Y A;  3SFG A;  5AJ3 J;  3N6N A;  4C9D A;  1F2H A;  2DNL A;  3DYA A;  1Y3J A;  3GR0 A;  3CE8 A;  5F3Z A;  1BHN A;  4C8O A;  2GGP B;  1N5T A;  3THP A;  3PRV A;  1Y10 A;  3C16 A;  1TAU A;  4A8S A;  2DPJ A;  3BRE A;  4P7V A;  4LIW A;  4PCQ A;  3OVB A;  1TL3 B;  1VJQ A;  5E5N A;  1DTQ B;  1TKX A;  2VJV A;  2RIL A;  4DQQ A;  5G0R A;  2MKK A;  3Q23 A;  5IC4 B;  2BJ7 A;  2M52 A;  3BSN A;  3GON A;  4LRC A;  1KLN A;  3OW2 R;  4UUW A;  3J7Z 5;  2V8G A;  1HPZ A;  4X84 A;  3AQO A;  2XS5 A;  4H4K C;  2W4C A;  1DZ5 A;  2YX7 A;  4LFC J;  5CAA A;  5JMN A;  4WBF A;  5DQG A;  1NJI T;  2KDO A;  5HMY A;  2Z2Y B;  2B0G A;  4LF5 F;  4X65 J;  3OD2 A;  2IBK A;  3BB5 A;  1BC6 A;  1I94 F;  3I5A A;  1S48 A;  5D0H A;  5G0R B;  6AT1 B;  2DGU A;  4I7F A;  3A3N B;  3CXC R;  3U1N A;  4QU7 A;  3T41 A;  3DLH A;  2CWK A;  1ULR A;  4O3S A;  1KDN A;  5K14 A;  3MM5 A;  1IM4 A;  3G6Y A;  4DXL A;  2XMJ A;  3EIC A;  3VGT A;  1SIW B;  1HPZ B;  3C15 B;  1RBO B;  2QLB B;  3VGU A;  1FNO A;  4DSI A;  1HQU B;  3HVA A;  3AA8 A;  3X1L B;  2CJK A;  1WEX A;  3AFG A;  3KLE A;  1NJX A;  3EGZ A;  4O44 A;  3GCX P;  5DLG A;  2GQC A;  5D77 A;  4ZP9 A;  2HHW A;  3QFW A;  3ZC4 A;  4RR5 A;  3OTC A;  2VOP A;  2OPQ B;  3W2V A;  4I7F B;  2J0W A;  2K7K A;  5I4M A;  5L46 A;  3CVK A;  3KJQ B;  3NP5 A;  2ALY B;  2COL A;  3MM5 B;  5LXR A;  2IJF A;  3FEZ A;  3FSI A;  3OLB A;  2GW8 A;  3ZZY A;  4DV5 F;  4IH7 A;  2CPE A;  2JX2 A;  1I94 J;  3S7R A;  4DMZ A;  1OIA A;  2XI2 A;  1PBU A;  4RUH A;  4ED5 A;  4IRD A;  2I38 A;  2R7V A;  3JQJ A;  2V6A A;  4UY8 T;  5F9L A;  2A10 A;  2IY5 B;  3X3U A;  2UV8 A;  4LSN A;  4DU8 A;  4DV1 F;  1WC0 A;  3HFK A;  5KFJ A;  3W2V B;  3G6V A;  4I2P A;  1B70 B;  4USK A;  3N0V A;  1B0V A;  3KWM A;  2MST A;  1RT7 A;  1DQ9 A;  3HVR A;  4OYM A;  1VIS A;  4WKY A;  1NH8 A;  5F41 A;  5AE1 A;  1E6Y A;  2DK2 A;  1RT5 B;  3PO5 A;  5LMU F;  2MQP A;  1MG7 A;  2ZEJ A;  1TTH B;  4GMK A;  2W01 A;  4YFU A;  1MU2 B;  3OTE A;  5IT4 A;  1RT4 A;  3EJM A;  2AJQ A;  3LO3 A;  4GO7 X;  2XO6 A;  4CRJ A;  1NME B;  1FI4 A;  1YRT A;  4ZPD A;  4BDP A;  1VQL S;  4CM2 A;  4LSN B;  3BR9 A;  4QIW D;  3F44 A;  2QA4 G;  3GWC A;  2RAQ A;  1P9Q C;  2H3E B;  3H5Y A;  3TR5 A;  3N6M A;  4I2P B;  1MWQ A;  1S6P A;  3W2W B;  4CM0 A;  8RUC A;  1RT7 B;  2FGO A;  5LM7 E;  1B64 A;  2VBX A;  4J5O A;  1E6Y B;  2CPH A;  5KFT A;  5BJR A;  4O0I A;  2J8S A;  4MKA A;  2R7X A;  4DV1 J;  4J9S A;  1RBA A;  3OL7 A;  4QWE A;  1RT4 B;  4ILL A;  1JLG A;  5LOQ A;  3TO8 A;  1RTH A;  2XY5 A;  4FPI A;  5E3P A;  2MZ1 A;  3B8H A;  4G65 A;  7FDR A;  5ETQ A;  3QGI A;  1SUQ A;  1VMB A;  3IMQ J;  4WZM A;  2KM8 B;  3N28 A;  5SZT A;  5U47 A;  2C2K B;  4CLF A;  2KG1 A;  1KQG B;  5M2U A;  5EGY A;  4DV2 F;  1FKA F;  4GVL A;  4FYW B;  4ZPC A;  4PYD A;  3ONQ A;  3IGV A;  2IAJ A;  1ZYQ A;  4U96 A;  3N6L A;  4JI7 J;  2D9P A;  3MD3 A;  2BE9 B;  2C22 A;  3W64 A;  3BPD A;  1RLD A;  1M1G A;  3EDR B;  3RAM A;  4P2M A;  1LNQ A;  2VUG A;  1JLG B;  2ZOF A;  5KFM A;  4ZP6 A;  4ENO A;  3VQS A;  1RTH B;  4OJ1 A;  3TAR A;  4M1K A;  2BQ3 A;  3MD1 A;  5F8L A;  1SUQ B;  2AJF E;  3DGV A;  5G4D A;  3D1Q A;  1HHS A;  3LAL A;  4KHP F;  1FTC A;  5D4L A;  4DSF A;  1V5V A;  1AFI A;  4ILM A;  3DXS X;  3DI6 A;  4HAC A;  1X9W A;  4DL5 A;  4OX9 J;  2VQF J;  3AD9 C;  4NYZ A;  1F9E B;  1N33 F;  5E0O A;  2WK4 A;  4KE5 A;  2Y3Y A;  5B0D A;  2VA3 A;  5B0E A;  3GZ7 A;  2D69 A;  3UI3 A;  2LFV A;  2DD8 S;  1GNK A;  2IAJ B;  5L1J A;  3HHL A;  1RYS A;  1RT6 A;  2CQ0 A;  1C1C A;  2DY9 A;  1JQG A;  2YH1 A;  1F60 B;  1WD6 A;  3U27 A;  2HND A;  4FDF A;  1WAC A;  2UP1 A;  1DHM A;  4DR2 F;  1PIE A;  1D9A A;  2B4V A;  2F8M A;  1RWM B;  4U7C A;  4DV2 J;  3TAQ A;  4B02 A;  4JOU A;  4OYW A;  2ZDO A;  3L7P A;  2JEF A;  2HAI A;  2A2C A;  3DI6 B;  4HAC B;  4XTT A;  5CZV A;  1VQ4 S;  4ZCM A;  1SL1 A;  2VU5 A;  3CW2 C;  4DV6 F;  3HT3 A;  3Q2T C;  1BWV A;  1X5P A;  4QIE A;  3HHL B;  3CIM A;  1RT6 B;  3VAM A;  4ELV A;  4ZKA A;  4KHP J;  1C1C B;  2LA6 A;  1X60 A;  4DX8 H;  2A2D A;  2E1A A;  3HX9 A;  4IFV B;  4O0N A;  3P49 B;  4CT9 A;  2B8P A;  1N33 J;  1FXR A;  4PRF A;  2PI4 A;  1U1P A;  4I68 A;  2VOD A;  1VS3 A;  3V4M A;  4AL7 A;  3OQ2 A;  5GAH U;  2DVI A;  2C2D A;  3K2Y A;  2CJ9 A;  3HJV A;  1PAU B;  2KL8 A;  1Q86 T;  3P5B P;  5AXN A;  1VLO A;  2H4W B;  3DDI A;  3QZ7 A;  4LVO P;  2IYG A;  1FES A;  3US5 A;  5HMZ A;  3RZA A;  4CLS A;  1YJT A;  5L38 A;  2BR0 A;  3KJV A;  1ZOT A;  2N3L A;  4UQG A;  3UPF A;  5JVG Q;  3QT5 A;  1XMQ F;  5K8M A;  4RX6 A;  3ETO A;  1F5A A;  1HWU A;  4DV6 J;  2W7A A;  1WOR A;  2V68 A;  2DR9 A;  2MZQ A;  5D8H B;  2QL7 B;  5LXY A;  2VKZ G;  2W2N P;  2EPI A;  2DGO A;  2EFP A;  1GEH A;  3M6V A;  1EZZ B;  3THV A;  4IO9 Q;  2ZUA A;  1HNV A;  4CI0 B;  2E9R X;  1NK5 A;  1HW9 A;  3NGR A;  2HFO A;  2R2T A;  1H7X A;  2ZE2 A;  1FRJ A;  4MAK A;  4NML A;  5D4P A;  2BX6 A;  1WDD A;  3KJV B;  1VQ9 S;  2EKY A;  1S7H A;  5EX0 A;  2BBE A;  1N5S A;  1T05 A;  2IM1 A;  1CJV A;  5HAN A;  3FJ2 A;  3SQG A;  2HRU A;  3NLC A;  2DH7 A;  2BE7 D;  1JLC A;  4F50 A;  1R27 B;  2BMB A;  3RB6 A;  3Q0A A;  3GIM A;  4EWT A;  4LF9 J;  1OJ4 A;  2ZJP Q;  4M5K A;  3HXM A;  1C4C A;  4KR0 B;  1NK8 A;  3NAH A;  2OFH X;  2GVD B;  4I6A A;  2VBW A;  3MHY A;  2RQC A;  3O1L A;  3Q8V A;  2F1F A;  4OZ2 A;  2N82 B;  2O66 A;  1XR6 A;  1HNV B;  3ILI A;  2MLX A;  4U95 A;  2ZE2 B;  4LF8 F;  4M5N A;  1TKT A;  5KG1 A;  4C8Y A;  3D9B A;  2ROE A;  4NCA A;  2CPJ A;  5DM6 Q;  1URN A;  3TA2 A;  2YKN A;  3NRB A;  1T05 B;  3VAL A;  5IV3 A;  4RU2 A;  2LEB A;  2VPX B;  1YJW S;  4WFY A;  1U2F A;  1EX8 A;  4HTI A;  3LAM A;  3EVW A;  2V4R A;  1ZAW A;  3G6E S;  3PTW A;  4NLW A;  4U8Y A;  4WF9 Q;  2DNK A;  4PAA A;  4LBH A;  3IR6 B;  4TU7 A;  3GFZ A;  4RBU A;  1KVJ A;  2VG6 B;  1NPR A;  4N76 A;  1KON A;  4BWM A;  1TKT B;  1FJE B;  4WFB Q;  3MOZ A;  1RLC L;  1RTZ A;  3ZTR A;  2YKN B;  2DYA A;  2DBB A;  4QW8 A;  2UVR A;  2B7C B;  3WC0 A;  4DZD A;  5DET A;  2NZ4 A;  1ZAV A;  1QTN B;  2CQ2 A;  3DLK A;  2NSC A;  3DGP A;  3MUV P;  4FBU A;  1ZAX A;  1RJJ A;  1GXT A;  3QNW B;  2DNR A;  4ELU A;  3MEC B;  1YBT A;  2OHD A;  4AXJ A;  2ZIT A;  4L3K A;  4UTG A;  2KJV A;  1X4H A;  3MPY A;  1GTE A;  3W63 A;  4LF7 F;  1UVK A;  2KYZ A;  1AT1 B;  5HAO A;  3ZTQ A;  1N34 F;  3ISZ A;  3M32 A;  1N5Q A;  2I5J A;  2QX0 A;  3D5M A;  3UDE A;  1B3T A;  4WU3 A;  5KFG A;  3HO1 A;  4OJG A;  1UP1 A;  3TJ9 A;  3AXK A;  3F56 A;  5KFC A;  2DNP A;  3N9U C;  3DOM B;  1LW0 A;  1NKB A;  1IN0 A;  3DLK B;  3DGP B;  3FNN A;  2CQ4 A;  3OTB A;  4HT5 A;  1YJN S;  4YQW A;  4FS1 A;  2A18 A;  1K73 T;  4ZA1 A;  2FZG B;  3SSS A;  4DL6 A;  4DLE A;  3CWJ A;  4ZP7 A;  4ELT A;  3FUY A;  5B0C A;  2ZH1 A;  2BKO A;  2VAS A;  2P2C B;  3M32 B;  1R89 A;  5EWG A;  4NLR A;  4EBD A;  1WF0 A;  2I5J B;  3NL0 A;  1PJ5 A;  2RUS A;  1DJ0 A;  3CT9 A;  3BQ1 A;  3B82 A;  5HI7 A;  1GMW D;  1RGV A;  4TN2 A;  3ZZO A;  1N34 J;  1ZA1 B;  4ZP8 A;  3VF0 B;  2AV5 A;  2HYI B;  2KYX A;  3S1T A;  3Q8Y A;  1FHT A;  1DRZ A;  1KKH A;  2WSF C;  2KB2 A;  5KG0 A;  2ZFH A;  1Y5N B;  5CYQ A;  1A9N B;  2E44 A;  3R2D J;  3TAM A;  2CPZ A;  4HH1 A;  1G2E A;  2C3Y A;  3MOJ B;  5HK4 A;  4NLD A;  3PYG A;  3QWU A;  2ZHB A;  2R8I A;  1VQ7 S;  4K8R A;  2LKZ A;  3QGH A;  4ED8 A;  4DR6 F;  2OJ3 A;  4IOC Q;  1GT8 A;  4NA3 A;  3BGR A;  2HZA A;  1VC0 A;  1FRM A;  1HNZ J;  4P71 A;  2C2O B;  4ZCL A;  3O44 A;  1IR1 A;  3OUY B;  1RT2 B;  5B0A A;  5K8P A;  4FYX B;  4ZPW R;  1J5O A;  2XSF A;  4JV5 F;  1LV5 A;  4DSE A;  4TKT A;  2XMM A;  1PG5 B;  1HBU A;  4PWW A;  5K5M A;  3JSB A;  3LUY A;  2JC1 A;  2GJ2 A;  3H2V E;  3QSY B;  1IXK A;  1KOO A;  3TUP A;  5GMK a;  3TAM B;  2J8A A;  2PEH A;  3R5A A;  1VQN S;  1IVZ A;  2E5J A;  4QWB A;  2WON A;  1SVD A;  1YHQ S;  4LRA A;  2E5G A;  4JI1 F;  2AYE A;  4USV A;  2JNJ A;  2YQ3 A;  3UCU P;  4K7Q A;  5DDR C;  4H4M A;  1I1G A;  1MRO A;  2VBY A;  3BGR B;  4LJM A;  4XAK A;  3RB3 A;  5DM7 Q;  1WEY A;  1F9F A;  2VQE F;  2MZR A;  1U1M A;  1J5O B;  3U1M A;  5ETN A;  1TV6 A;  3HPO A;  1WHY A;  5KT2 A;  2OH2 A;  1JMT A;  4C3M A;  3V6D A;  1JLF A;  4RNN A;  1HBU B;  1H74 A;  5HLF A;  3ITH A;  3GFY A;  3M05 A;  1UVM A;  4DR6 J;  1Q53 A;  3R97 A;  4PWU A;  4P73 A;  1FRI A;  3IP0 A;  1B4S A;  2J0X A;  3FC9 A;  3C3L A;  2WON B;  2CQ3 A;  4Q0B A;  2HNZ A;  1H98 A;  4DN9 A;  2CPI A;  1NUE A;  3HVT A;  2MKC A;  2CAJ A;  2M8D B;  4PG7 A;  1D09 B;  1AFJ A;  4H4M B;  4Z7Y A;  1MRO B;  5AXK A;  3MM6 A;  3WQP A;  1GH8 A;  3C46 A;  2QYG A;  3BV8 A;  1CJK A;  4B9S A;  5DZ6 A;  1TV6 B;  1VYA A;  4X64 F;  3V6D B;  1JLF B;  3ET6 A;  1ZBT A;  5HLF B;  1HBN B;  3HKZ D;  3T5L A;  4DS5 A;  5CCM A;  5KOW A;  2CQG A;  3EZU A;  3FRZ A;  4M5D A;  1ZA2 B;  2B9E A;  1S9G A;  3ZZ0 A;  2C2M B;  3QIP A;  3PR4 A;  2VQE J;  1YLX A;  2XLK A;  2JLG A;  4Q0B B;  2RD5 C;  2YNF A;  3MAA A;  4B3R F;  3LQV A;  3I9V 9;  2DRD A;  4RO0 A;  2QFJ A;  1S1V A;  4ILR A;  1NJW A;  1KLM B;  4BS2 A;  3NGD A;  1UW4 A;  1UA1 A;  2HS3 A;  4I64 A;  4ECZ A;  4CDI A;  3SCI E;  4KAI A;  1CJK B;  2GMJ A;  2HQ3 A;  3CCV S;  3KNA A;  2HQF A;  1YWX A;  3OBI A;  3ADA C;  4EBC A;  5L1L A;  2JEJ A;  3OL8 A;  2ZBP A;  3ET6 B;  5KFL A;  1NK9 A;  3RBE A;  1VC6 A;  2DNM A;  4CLK A;  4FYD A;  5AE2 A;  2HFZ A;  3ISN C;  2PD1 A;  4M5D B;  1FJ7 A;  3KNG A;  1S9G B;  2NLW A;  1QJH A;  2GFF A;  2K7J A;  3QIP B;  1REV A;  1R6Y A;  3MAQ A;  4KGM A;  2YNF B;  4X64 J;  2F65 A;  3S6E A;  1S1V B;  2AX1 A;  2GA7 A;  1NAQ A;  4L73 A;  2HUR A;  2QO3 A;  3RRH A;  3DOL A;  4CO5 A;  4YHH F;  2FYX A;  2IM3 A;  4B08 A;  2ZHO A;  4NYO A;  4UT4 A;  1PCA A;  5KT3 A;  1HHQ A;  3QID A;  4J9K A;  4X62 F;  2HFU A;  1JLA A;  1ZPV A;  3BN7 A;  1DUR A;  3NGU A;  4J9P A;  1NZ8 A;  3OFF A;  2XC9 A;  1JWW A;  1M5P C;  4NLY A;  1FRX A;  5DG9 A;  2J9D A;  1KTQ A;  3IM9 A;  2DB1 A;  3CED A;  1ACM B;  2GAH C;  5CHC B;  1T95 A;  1J5E F;  2C3M A;  1REV B;  3TA0 A;  4UY8 5;  3H25 A;  3GYG A;  4DV0 F;  2AJ4 A;  4YR2 A;  4LBP A;  2CZ4 A;  4C8N A;  3TRG A;  1RWN B;  3K58 A;  4TU8 A;  2BAN A;  2DHH A;  2Y8W A;  2ZNZ A;  5H9F K;  3DOL B;  3FBB A;  4ZJL A;  1PYS B;  2RKI A;  3UCZ P;  1Q0N A;  2GHP A;  3MMJ A;  1ZZN A;  3KHL A;  2PMH A;  1V3Z A;  2K1R A;  1XMO F;  4DF4 A;  3GFX A;  4AFF A;  1JLA B;  4UOC A;  2IJR A;  3G82 A;  2HQG A;  3ZNJ 1;  2ASJ A;  1S76 D;  3KUH A;  3BM7 A;  3AOD A;  4KGX B;  2DNQ A;  2BA9 A;  2YH0 A;  3KUG A;  2R7W A;  4PQU A;  5A8W B;  4TY9 A;  4ZDN A;  3GQC A;  3A8E A;  4X66 F;  3CO9 A;  3MEK A;  2C3O A;  3GG1 A;  3PYE A;  2H9Z A;  4JI6 J;  2EI5 A;  1O8B A;  5KFI A;  4OHZ A;  1RHR B;  1FWP A;  3BGU A;  2FUG 9;  2LU2 A;  4TNO A;  3H98 A;  2NQP A;  1Q95 G;  4F26 A;  4J9L A;  2BAN B;  3QZ8 A;  1WKJ A;  5KT6 A;  3HFV A;  4DL0 C;  2YKO A;  2MKJ A;  2RKI B;  1MLA A;  5LSR A;  3LAN A;  1KR4 A;  1NDC A;  1WG1 A;  3IBW A;  3R8Y A;  1QAY A;  2K1R B;  1REG X;  3DLE A;  2G2Y A;  3NEK A;  1QUP A;  2JL9 A;  3G82 B;  2XHC A;  3UD5 A;  3G71 S;  1SJ1 A;  3PW5 A;  1YZ6 A;  3DOK A;  2XYG B;  4MT1 A;  2HVZ A;  4WFX A;  2ZZT A;  4DDF A;  4IR9 A;  1EHW A;  3KFW X;  4UZC A;  3T9N A;  1Q7L B;  2W4P A;  1Q5V A;  2CNL B;  3CCM S;  4OYX A;  4PWD B;  2BRK A;  2E5L J;  2HFS A;  2DIT A;  2NR0 A;  3L7O A;  3MTK A;  4GKK F;  1H7W A;  2RJZ A;  3IWL A;  1DAX A;  4A8K A;  3R27 A;  4MYT A;  4L75 A;  2F4F A;  4ETX A;  4X66 J;  3PNI A;  4PPZ A;  1P1T A;  4ED3 A;  1QAI A;  5T14 A;  2R7T A;  4OHY A;  1RWW B;  5A2Q U;  3DOK B;  4K2J A;  1UWA A;  4LIR A;  2DTJ A;  2B9Y A;  5KFE A;  3UD4 P;  2AP6 A;  3RR7 A;  4L76 A;  4E0D A;  3JB9 k;  4NCB A;  1JJ4 A;  3R1L A;  3QMQ A;  1I5O B;  1N5V A;  1X5S A;  1TUV A;  2Q6B A;  1WC1 A;  1IM6 A;  1UEV A;  3BO4 A;  1GXU A;  2BEF A;  2C3U A;  1I6J A;  1WOS A;  3I96 A;  3IBC B;  3WIV A;  2JLE A;  2AYB A;  4A46 A;  4ED6 A;  1NSQ A;  4DL3 A;  3CO0 P;  2VKR A;  1U0H A;  1VRQ C;  3AB4 B;  3S8S A;  1IKV A;  3E3X A;  2OSR A;  1HIY A;  4PQA A;  1N5Y B;  3LP2 A;  3GV7 B;  3PV8 A;  2QSW A;  2CQB A;  2PMW A;  3FBC A;  2HBR B;  2HHU A;  1C0U A;  1S6O A;  5JVH Q;  3W9J A;  2BM1 A;  3ULH A;  3D3B J;  2CPY A;  3H5S A;  4KHM A;  4V1A k;  4ZLN A;  1OY6 A;  3EGW B;  1CBK A;  4CLP A;  3FVY A;  1X4E A;  4ED0 A;  5I42 A;  4CLW A;  3BBC A;  1ZET A;  1I51 B;  3L3C A;  1OMS A;  2CJB A;  4YB6 A;  1IKW B;  4PR6 A;  1BLU A;  3MTJ A;  2FJD B;  1RB0 A;  3NXZ A;  3DRX A;  4I69 A;  1TMJ A;  1FE0 A;  1KP6 A;  1U0H B;  4USW A;  2GS8 A;  4WCE Q;  1F5B A;  1NM2 A;  1IKV B;  2EFG A;  1YJV A;  3EDQ B;  5HN0 A;  3LP2 B;  2FIU A;  1UZH A;  2Q3P A;  3T5J A;  1C0U B;  1ZTT A;  4LT6 A;  9RUB A;  3ZXW A;  2KO1 A;  4N8O A;  2Y1L B;  2CG4 A;  3FSY A;  2KI2 A;  2BE2 A;  4DPY A;  3KG1 A;  5I42 B;  1QLN A;  5D15 A;  4F36 A;  4KJI A;  3JSY A;  2LMI A;  5BYR A;  1KVK A;  4JI0 F;  3NKY A;  3P96 A;  2KT3 A;  1TK5 A;  4W98 A;  2W9B A;  1FKP A;  3I0R A;  2G2O A;  3CTR A;  3PFE A;  4WK1 A;  4KGK A;  1Q8L A;  4CH7 A;  1RHK B;  3LH2 S;  2MGZ A;  3O8W A;  2F3J A;  1ZS6 A;  1QY7 A;  3KK3 A;  3OJS A;  1LWF A;  4AXI A;  3B54 A;  1N0V C;  3S01 A;  3GE9 A;  1WDT A;  2RDJ A;  2BE2 B;  1FWL A;  4B9N A;  2VDI A;  4RUA A;  2VIH A;  1Y7P A;  3PW0 A;  3A8J A;  4ICL A;  1S12 A;  1C4A A;  1LOU A;  3ENA A;  2BJ3 A;  1PYT A;  2XM3 A;  1T9Y A;  4QBU A;  5MLC V;  2UUT A;  1X7V A;  2HGN A;  4NLU A;  2PI5 A;  2W9B B;  4DR7 J;  3I0R B;  4QJV A;  5IWA J;  2CPX A;  3GYX B;  4FKY A;  2Y9H A;  2UVV A;  3HP6 A;  4QPX A;  4NL5 A;  3ZZZ A;  2MGZ B;  3KG0 A;  5FLX U;  2QSF A;  1SQE A;  4F3O A;  4RW4 B;  2XLI A;  4DSL A;  1F6T A;  2XS2 A;  3H4B A;  3K17 A;  3KK3 B;  3PY8 A;  3B4M A;  1LWF B;  3IXQ A;  3W66 A;  4JI0 J;  2R7R A;  4QOT A;  3D1H A;  4F4X A;  4DUY F;  1R7I A;  3RB0 A;  2IBO A;  2DGX A;  3MXH P;  1QSL A;  3JAM Y;  1OPZ A;  3T5K A;  4ICL B;  4OI1 A;  3AB2 B;  4Z7C A;  2VDH A;  1T9T A;  4EZ9 A;  3EVM A;  3HKW A;  3PAC A;  3MR2 A;  5HO4 A;  3T6B A;  2DJW A;  3G86 A;  4CO2 A;  1NJZ A;  3LW5 C;  4Y65 A;  4YME A;  2FVP A;  2DGV A;  2AD9 A;  2UXD F;  1GMW A;  1HMV B;  2IMO A;  2HWI A;  2AYM A;  2OIH A;  4PG6 A;  1T3O A;  4K4Y A;  1T02 A;  2B43 A;  4DG1 B;  4NE9 C;  1XR5 A;  2DNN A;  3M8S A;  2CZV C;  5IFM A;  2Y0B B;  2M4M A;  4RKU C;  1RHJ B;  1FJC A;  4U9R A;  5F0U A;  4DV7 F;  4OZ1 A;  5K20 B;  4P2F A;  1SH3 A;  2OSQ A;  4PXB A;  2BJ1 A;  1XNQ F;  2EXU A;  4DPO A;  4OYA A;  2V4J A;  1HYS A;  4ITS A;  2CXE A;  3MZI A;  1LFP A;  3W1Y C;  4ED2 A;  4F4W A;  4PZV A;  3E2E A;  3DHX A;  3MCN A;  4C7Q A;  5JUM A;  1SH2 A;  4AD6 A;  3DU6 A;  3SBM A;  1H38 A;  2ALZ A;  4M95 A;  4DUY J;  1NPP A;  2AEM A;  2UUW A;  1NKC A;  2HS0 A;  2RT3 A;  2CA9 A;  2D7S A;  1T94 A;  1YVF A;  3C8Y A;  1OSC A;  3MPD A;  1S97 A;  1RU2 A;  4QZV B;  2W9A A;  2DO4 A;  5KTQ A;  3M2U A;  3I9Z A;  1CPZ A;  3TAN A;  3A8K A;  4RPF A;  3R5G A;  4OI0 A;  2GX8 A;  2UXD J;  1W2I A;  4IKA A;  2G9O A;  1SJ3 P;  4KSE B;  1HYS B;  1ICE B;  5B08 A;  3D2W A;  2EC2 A;  2YPY A;  2UXC J;  4PXD A;  1UPP A;  3UO0 A;  4HKQ A;  3PKM A;  1U2R A;  4GO5 X;  2MQ8 A;  5CYJ A;  4R25 A;  4CYU A;  2ROG A;  2OPP A;  3DRS B;  2XTJ P;  4ECQ A;  4DV7 J;  3E01 A;  3RAX A;  3TZY A;  4DCP B;  3CMA S;  2R9L A;  2HZC A;  4UUX A;  1EAR A;  4JB8 B;  2V67 A;  1XNQ J;  3VVU A;  5J2Q B;  5F8I A;  2ZHA A;  1RA6 A;  1SKR A;  1LXJ A;  1N48 A;  1X9S A;  4C97 A;  1RAA B;  3HF5 A;  4WPA A;  1VHI A;  3BSA A;  4M5H A;  1RSC A;  4WXW A;  5EHH A;  1WI6 A;  4DX6 A;  2VL1 A;  2JVO A;  2RQM A;  1IKY A;  2XCP A;  1YRU A;  2DXD A;  2DGS A;  2C3P A;  2XMT A;  4LR7 A;  3PYF A;  4K4U A;  4LSZ B;  1SIZ A;  1N6Q A;  4LR9 A;  1IBL F;  1YJR A;  1H3D A;  2HHT A;  1SB6 A;  8ATC B;  4JI4 F;  4CYU B;  2AJ0 A;  2OPP B;  1P8G A;  1U26 A;  1L3S A;  3E01 B;  4RLE A;  4JI2 J;  2ZZM A;  4W4M A;  1S57 A;  2MLZ A;  3E8O A;  2OML A;  2PFD A;  4CH1 A;  1CUL A;  3SEO A;  3J80 U;  4DR1 J;  4ZOS A;  4LFB F;  3WZ0 A;  3BSC A;  2MZS A;  1APS A;  1RAD B;  1W25 A;  3GIL A;  2NXU A;  5ETM A;  1X9M A;  1BWE A;  2MQO A;  4TQR A;  1DBD A;  1HNX F;  4KGV B;  1U24 A;  2A6M A;  1TKD A;  1N6Q B;  2BW7 A;  2Q6C A;  1HNI A;  4HR2 A;  1CC7 A;  2IVF B;  3VWS A;  3TUI C;  3GG0 A;  3J81 U;  4NLS A;  4ALZ A;  4F0K A;  3RW6 A;  2BAC A;  4HDH A;  2QLX A;  4CCH A;  4CH0 S;  3NOG A;  4L3N A;  5L39 A;  1YJ7 A;  1RAB B;  5IT9 U;  3UVJ A;  3TI0 A;  1IBL J;  2CZ9 A;  4EFA C;  4K0K F;  4JI4 J;  1LQ9 A;  2F4V F;  4GKJ F;  5HQ8 A;  2PEB A;  2JWN A;  2YWH A;  3HHD A;  4C0O C;  1XNR F;  2RHS B;  2FHO B;  5F8M A;  1RQ0 A; 
#chains in the Genus database with same CATH homology
 4CLT A;  1CUL A;  5D0E A;  2GVD A;  3C14 A;  1WC5 A;  4OZ2 A;  1YBU A;  1WC6 A;  4P2F A;  1CJT B;  5D15 A;  1FX2 A;  4NI2 B;  1TL7 B;  4WP8 A;  3MAA B;  1CS4 A;  4OYA A;  5D0R A;  4OYM A;  3MAA A;  3MR7 A;  1AB8 A;  5IV4 A;  1YBT A;  2GVZ B;  1WC4 A;  2W01 A;  2GVZ A;  4CLP A;  2BW7 A;  4WPA A;  1AZS B;  4OYZ A;  5IV3 A;  1CJT A;  4CLW A;  4WP9 A;  2WZ1 A;  4NI2 A;  1TL7 A;  4UST A;  1CJK B;  4CLF A;  4OYO A;  4OYP A;  3ET6 B;  4CM2 A;  1U0H B;  4USW A;  5D0H A;  4CLU A;  4OZ3 A;  1WC1 A;  4P2X A;  1CJV B;  3C16 B;  4CLK A;  3G82 B;  1CJU B;  1AZS A;  1CJV A;  1Y10 A;  3C16 A;  4CLY A;  4OYW A;  1Y11 A;  3R5G A;  1YK9 A;  3C14 B;  2QV6 A;  3UVJ B;  1CJK A;  4CLZ A;  4USU A;  3UVJ A;  4P2M A;  4OYI A;  4CLL A;  4WP3 A;  4CM0 A;  5D0G A;  4USV A;  4CLS A;  1FX4 A;  1CS4 B;  3ET6 A;  3C15 B;  1U0H A;  3C15 A;  4OYB A;  1WC0 A;  1WC3 A;  4OYX A;  1CUL B;  3G82 A;  1CJU A;  2GVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...