3UVJB

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVCDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYSLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Guanylate cyclase soluble subunit alpha-3
total genus 54
structure length 196
sequence length 196
chains with identical sequence D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjB00
3MAAB 5IV4A 4OYAA 4CM2A 5IV3A 4WPAA 1FX4A 2W01A 1TL7A 4USTA 4CLYA 4OYMA 2GVZA 3C16A 3C16B 4CM0A 1CJKA 4CLLA 2QV6A 5D0RA 3ET6A 4CLFA 1Y11A 4WP8A 4OYOA 1CJVB 1YBTA 1WC4A 3C14B 1YBUA 1Y10A 4CLTA 4CLKA 3C14A 1CJUB 4CLPA 1CJTA 4OYBA 1AZSA 1CJTB 1WC3A 5D0GA 4USUA 3MR7A 4OYWA 4USVA 5D0HA 3ET6B 4NI2B 5D15A 4P2XA 1U0HA 3C15A 1U0HB 2GVDA 1CJUA 4OYXA 4OYIA 2WZ1A 1WC0A 1CJVA 1WC1A 4OZ2A 4CLSA 3UVJA 4WP9A 2GVDB 4P2FA 3G82A 4CLUA 2GVZB 1AZSB 1CULA 4USWA 4OZ3A 4P2MA 2BW7A 1FX2A 1WC5A 1AB8A 3UVJB 4CLWA 1CJKB 1YK9A 1WC6A 4NI2A 3C15B 4CLZA 4WP3A 3G82B 1TL7B 3MAAA 3R5GA 1CS4A 5D0EA 1CS4B 4OYPA 1CULB 4OYZA
chains in the Genus database with same CATH superfamily
2Z57B 4DR6F 1X4AA 4WE1A 3FQLA 1EHWA 4I68A 4H4MA 1EETB 1IKVB 1L5UA 3TOQA 4M5IA 5HMXA 3KK1A 1L3UA 2BBEA 1F9EB 2B9YA 2GMLA 4KR0B 4Y34A 4AL5A 2ASYA 1FX4A 2M88A 4ZK7M 3CC4S 3HVRA 1OSCA 5KFMA 5HBMA 4B08A 3BDEA 4MFBB 3FK4A 1C2PA 4DL5A 1X4HA 4QOTA 2OKQA 1UL3A 4UQGA 4DV0J 1VBYA 1Y3KA 1Z2LA 3SDEB 2GHVC 4FYWB 2CVIA 3WZ0A 4C8MA 5IC6B 4R8UA 3BJYA 4K4YA 5IZHA 4DS4A 1NUEA 3TUPA 2DNKA 3UN3A 1ZZNA 4IOBA 5G4DA 2UUCJ 1ROFA 4ZVGA 2VHGA 4DR7F 4Y2MA 1A0OB 1UA0A 4USJC 2V2QA 2VBXA 1X7VA 4LREA 2DO4A 4ZN1A 2XM3A 3QZ8A 4DSEA 2JVRA 3H59A 1Y0HA 1SBRA 4DPUA 4RNFA 5L39A 4LMZA 1PYSB 2HVHA 2ACMA 3VWSA 3ZTSA 3JSBA 3ZZOA 4ES3A 2AHOB 3QFHA 2QN6B 2QL5B 2POKA 2IAJB 1PBAA 5T7LA 4LF8J 1MMNA 2NSBA 1TELA 3MM8A 1DTTA 1FERA 1LW2A 3JAMY 4JI4J 1Q7YT 1JLQB 1K1SA 1MWYA 2E9RX 3L7PA 2EG1A 3PIOQ 5KT3A 1C0UA 1X9MA 4AL6A 1HI8A 2CPFA 3IBCB 3W8PA 1FEHA 1M5VC 3LOUA 3Q23A 2AEJA 2W9BA 4TU7A 1RXOB 1WNEA 3HT0A 1FE4A 4TY8B 4F50A 4JI3J 2D7SA 2NXCA 2MKJA 2HFUA 4EUVA 4CDIA 4OFZA 3M9MB 2ZH6A 1U1OA 2E5LF 3CJSA 3H25A 2RKIB 1SH0A 4QIWD 5HQLA 2V2KA 4CNZA 1BGXT 3C15A 1NAQA 1F60B 1TUGB 2J7UA 3OL6A 4ZP8A 3MEDA 1SC1B 2LLZA 3FBEA 2QL9B 5DQHA 3N9UC 3OVAA 4N8OA 2XI3A 4DR2J 1B0VA 2OAUA 3AH6A 4QW8A 3HHLD 1S72S 3UR0A 2VQEJ 1HBOB 1SIWB 3LP0A 1SQGA 1TV6B 2F4FA 3O8WA 5IT0A 1U1LA 3RR8A 4PAAA 2MKSA 4OHZA 3HHEA 3ZNJ1 2UU9J 1OJ4A 4NXNF 1EAYC 3JTNA 4LF8F 2PC6A 3IRXA 4Y0FA 2RQCA 5HJYA 3RBEA 2QA2A 3ISND 1VLOA 2YKQA 1RSCA 4KIAA 1WTFA 2OPSA 2DB1A 3QT7A 2BM0A 2KB2A 4PPDA 5EX0A 2ZBQA 5KFRA 3V81A 3VAJA 3B54A 3MPDA 4WE1B 1JLQA 2OIHA 3FKBA 3MR3A 1RT2B 2CKWA 2I2YA 4ZCKA 5DZ6A 2NPFA 3I4HX 3BV8A 5A8WA 1VK3A 3V4IA 3BGOP 4J90A 4QWBA 4LRBA 2RRBA 3PM9A 1CLFA 2HQIA 4KB7A 2XSJB 1VQOS 3KNGA 2J0QD 5L9NA 3WC0A 4DCOB 4PG4A 1EIYB 2HPUA 1ELOA 3C15B 4NEYA 4WP3A 4P71A 2CZ9A 2ZOMA 2Q79A 4KV8B 2JLGA 4K4WA 2DNLA 2QFIA 1NK0A 1HHTP 4DN0A 4FVCA 3G4SS 2LECA 3QIPB 3PYFA 5D3GA 3UN5A 3GR1A 2Y0SD 3SDEA 2VPWB 4O23A 1ZAXA 4HT5A 3FC9A 2KTQA 2V50A 2Y0BB 1H0HB 2CFXA 3DLJA 5AJ3F 1NSPA 1SC3B 2J8SA 2MHNA 4L6V3 1XN9A 3SSRA 4QPXA 5I42A 2AD9A 1JLAB 3ZTQA 3I0SB 4LFAF 1B70B 3VCDA 4DV7F 1RTJB 2U2FA 3AY0A 3P4UB 3POTA 1NCLA 3BYRA 5DS7A 2XHWA 5T7LB 2QEXS 2W8KA 5KFZA 4U96A 3X1LB 5ETVA 4RW4A 2W7OA 2GVZA 2B0GA 4Y2AA 4WFAQ 2VQEF 4ZVFA 3IS9B 4HH1A 1TKXB 4QJVA 2HRTA 4HH0A 5B0EA 1WTBA 1QTNB 2J76E 2FHMA 5EWFA 3QWUA 1MN9A 4UOFA 3GYGA 2DIVA 2FQQB 1S1XA 2EKNA 3MMBB 3U02A 4L76A 3DOMA 4LBPA 4IQXA 2JOQA 1N33J 2AQ4A 3JXOA 1B0PA 4X65F 1CJVB 1W25A 2KYZA 2V94A 4LF2A 3Q86A 1PYOB 4M5KA 1JJ2R 2FVRA 2KJWA 3DN9A 1NSQA 3K58A 2JLEA 1YRTA 2MLZA 3L7UA 2MSSA 2E44A 4IFVB 3R9LA 4C8YA 1RTIB 1X5TA 2ZEJA 1ZTWA 2W9CA 2XCAA 2WW4A 2OI2A 2VB6A 1HI0P 3BR9A 1N5VA 2XO6A 4KY3A 1H3DA 1TMMA 1G4CA 4O4GA 1HR0J 1EQMA 1BXNA 4ZIWA 5IFMA 3V6DA 3RB4A 3I5AA 2IMOA 1UCNA 1UVNA 1Y00A 3I5CA 5KT5A 2XGQA 2FHKA 3L7OA 3W2VB 3B78A 2VOOA 2JSXA 3CD5A 4RW8B 1UVMA 1FE0A 1GTHA 4DF4A 5HJXA 3IAM9 1BWEA 2AX1A 1JKHB 1NHKL 2QX0A 1NK4A 5KFVA 4K4VA 3K5PA 4NLPA 1V3SA 3H8YA 4F0MA 3EZUA 3QSYB 1R27B 4LIWA 4CT8A 5GVQA 1JLBA 1T9UA 3C6TA 1HWUA 1RT2A 4ENOA 1WC0A 2GW8A 2ZJRQ 1VI7A 4URSA 3HSGA 3OL8A 3MMAB 4B3SJ 4QWDA 3KJQB 4F4WA 2R3VA 4CLSA 2EEYA 4ECYA 3Q8PB 1S0MA 5DGBA 2CQBA 2AX0A 3CJRA 1Y5NB 1WDDA 3P6YC 1FVSA 2NZCA 2QLJB 2B3TB 4EGLA 3TAPA 4DR2F 1FKAF 1C4AA 3ILIA 4TN2A 4NXNJ 3MPVA 2XEXA 4HHHA 3KLHB 2CNNB 3AAWB 3W61A 5J2NA 3DGPA 1LWFB 2DHSA 2HHTA 1C1BA 2IYGA 3MAHA 2BANB 1HW9A 2ZBCA 4ZP9A 4YDXA 3BBFA 1D0EA 2IDEA 1Y7PA 1GQEA 1RA7A 2N7YA 4NZ0A 4ZJQA 5F3ZA 3V4IB 5K8MA 3UO0A 1XNRJ 1M5SA 1IKXA 2WK4A 3MM9A 2FDNA 1FWLA 5L9XA 2ZHAA 3BEGB 2IBOA 2OUGA 3IC1A 3CWJA 2P5VA 2DNRA 4PYDA 1X5OA 4G1QB 1B0TA 2V4QA 4QU6A 4WXOA 4QWAA 2VPZB 2JHEA 4YR0A 1X4BA 1FEEA 4EO6A 2OPSB 2AMCB 2KXNB 1QE1B 5HO4A 3BSAA 1T8EA 2HMIB 4TY9A 2J7KA 2C2NA 2YNIA 3BREA 3CC2S 2FVCA 2Y1JA 1CULB 1FRJA 1JJHA 5E2QA 3MURP 2V2VA 2K3IA 1T9XA 1SJ3P 4OQJA 3M6UA 4I1TA 3P3DA 4NRUA 3PIPQ 1XMQF 2HAFA 3BQ2A 3GYNA 4X4TA 2KRBA 2Y1LB 4DEZA 4JI5J 2G1HA 5K20B 4OZNA 4A8XA 3LP0B 5KFNA 5E3QA 3Q8UA 4RNNA 1VC6A 2WSCC 2C22A 2RAQA 2P8IA 5KG1A 1SJRA 2I0XA 1KONA 2Y3YA 1FO1A 2F3JA 2R7QA 4WIIA 2XG8A 7FD1A 2RKIA 2ZH7A 5HAOA 3EJMA 4DR4F 1AA1B 1R7IA 4I4BA 2HNYA 5E3CA 4R8UB 3PW4A 5EUHA 1X8DA 2KYXA 2E5IA 1F5BA 2K8GA 3HLUA 3E8OA 4TY8A 1OY8A 1PSDA 3P45B 5KG6A 4OZLA 4RW6A 4DU7A 4KE5A 2V9WA 2HNZA 4NA3A 4DV1J 4M94A 3V6KA 3GJSB 4YB5A 2YKNB 3MM8B 1Q0NA 1LW2B 2MQMA 1TAQA 3ZTOA 3OHAA 1RUSA 3KK3B 1M5KC 4Z7CA 1FRHA 2CZVC 2XWYA 1EQ0A 4X4SA 5D4PA 2FGCA 3IG1A 4U9RA 4DV4J 4K5RA 3M6XA 5ETPA 2OMOA 4KGKA 5FLXU 2GGPA 4X65J 5LMUF 1RISA 1WC3A 3TJAA 3TAMA 2IVYA 1O6XA 2GO8A 3PNIA 2I8EA 2VFUA 3OHBA 5DGAA 1YJWS 4FYXB 3VQSA 1DRZA 5LXYA 3CCTA 2G2YA 3M7VA 2IC3A 2DY1A 3GIKA 4FS2A 3UQSA 3AT1B 4DR5J 4X62J 1KN6A 2ZJQQ 1S57A 4CI0B 1RTZA 3HHLB 4DL4A 1HD1A 5D78A 2Z2LA 1N54B 2GVDA 4BWJA 1TL5A 2CA9A 1SH3A 4IG0A 2JH3A 3I9V9 2F9DA 3L4BC 4PYAA 5DLFA 1SL0A 2LMIA 2V5HG 2HGNA 4CO3A 5DG9A 3IRWP 3CF5Q 4X64J 2B8QA 4C8OA 2BJDA 1NDLA 3I96A 3OL9A 4QYZJ 4GO7X 1R0AB 1MG7A 2I9SA 1F5AA 2ZFHA 1YKWA 1U1PA 1N32F 3N5BA 3NWRA 2WVCA 1O0PA 5DO2A 4C2MA 5HN0A 1RU1A 1JXLA 1WC1A 3ILOA 2KL8A 1YRUA 2CJXB 2WW8A 1RWVB 4M5JA 3RRHA 1EP4A 2QFJA 4W4MA 2YKOA 3UVJA 1WACA 2H3EB 3MECA 1BQMA 3KDNA 1WF0A 2V8VA 2MZRA 1RT6A 2W4PA 2ZNYA 3G82A 3HI9A 5RUBA 1YX2A 2GVZB 2G2OA 2QG9B 3CDWA 2H4WB 3DM2A 3MEEB 1KQGB 4OJ3A 4Q7AA 4MK8A 4YHHJ 1HQEB 3JSYA 4RJVA 3KLFA 2I1RA 5HP1A 1XNRF 2KU7A 3NNHA 2ZH2A 2AT1B 4IKAA 4Y6IA 2C2DA 3R5AA 1KTQA 2YWWA 2BX6A 5E5NA 4JI7F 2H5IB 1IBKF 2F8MA 2HS3A 2PIIA 1UW4A 3QGIA 4GKKF 1U45A 1FJEB 2VPYB 3NCRA 3S8SA 1RWNB 1UVKA 2AJ1A 1RB0A 1SH2A 3CTRA 3KJFB 3Q89A 3BDPA 1N5SA 1MWZA 1QUVA 2ZWPA 3G9CA 3QO9B 3A8EA 3CCVS 3QIPA 2ZZNA 4TVAB 3PEHA 2EFQA 2YPYA 2KFNA 2EG2A 3MAAA 5ETQA 4O3OA 1VBXA 1K9MT 4IDKA 5B08A 4NOHA 5KFIA 3NXZA 4KHPF 2CG4A 4P52A 3J81U 2CNLB 2XSFA 1NPPA 3TEHB 4OZ1A 3TZXA 3EYZA 1M90T 2ILYA 5LJ5Y 3OV7A 2OPQB 5E3RA 1S1WA 5AE1A 2QA4S 4U7UD 2E5LJ 4TLQA 3JS9A 2IIHA 4ID8A 3OTEA 2EK6A 3R6LB 4W98A 2GJFA 2MY8A 5DDPC 1C4CA 3TUZC 3G6VA 1CC8A 2XNQA 3KHLA 4ED2A 1LFPA 4E8UA 1U1NA 2UXCF 4P6QA 3E01A 5LSRA 1R3NA 1TKDA 1PG5B 1KLMA 3W7BA 2F8HA 1ZA2B 4NLTA 4X4RA 4ECZA 4CM0A 1Y3JA 3ADAC 4RUCA 1LWCB 3IM9A 1D9AA 3IR5B 5AT1B 2UVVA 1S97A 2HZAA 2MQNA 2SXLA 2IM1A 3PCOB 2XMUA 2YKMB 3Q8VA 3GIJA 1B64A 1QSYA 3E3XA 4EU0A 4ECQA 3PVXA 2FD2A 2K1RB 3R5BA 1UPPA 3MM5B 1H98A 4AQYF 3SQGB 1NLKL 3VQTA 1S7HA 4ZVOB 1IBCB 5F0UA 2GZOA 2M52A 5EX3A 3VZIA 4QIEA 3D28A 4B3RF 5U47A 1E6YB 1P27B 4DN9A 4DV1F 1I1GA 1N0VC 3N01A 3SCKE 1K0VA 2LQ8A 4A47A 2R8KA 2B4OA 3DC2A 2IRXA 1BQMB 1FRXA 3KG1A 2KHDA 2XNRA 4ED7A 3K5OA 3I9ZA 4YP3A 3OVSA 4WFYA 5HVFA 3OQ2A 4KFBB 2UU9F 1NZAA 3QMQA 3J7AN 3T1AA 2WSFC 4A8QA 4LFCJ 1AT1B 3K89A 4OYWA 2KT5A 2BE7D 2DNOA 2H48B 2Q3PA 3LGNA 3PJXA 4KGVB 2L9NA 4BLGA 4RNMA 2W9BB 1SKSA 2N82B 2DCUB 3TJ9A 3GTYX 5B7WA 2HQGA 4KKOA 1TMJA 1S0OA 2RSQA 1NBEB 2YKNA 2HRYA 3GYXB 3H5SA 1J2VA 4P10A 3WIUA 3KHGA 5ETOA 2BQUA 4RLEA 4P2XA 5HQ8A 2C3YA 3MEGB 3HVTA 4DV4F 3QJLA 4J9VA 2AF6A 1S1UA 2DY9A 2V4JB 3CJ0A 2FPHX 3DXBA 1UFWA 3LAMA 5L1JA 2WONB 3NS5A 2NREA 1CJUA 1HNIB 2XS2A 1ZM9A 2VD3A 1C1CB 3DDNA 4OYXA 4DCPB 5F8NA 2D3OR 2HFSA 3OXLA 4AUKA 4QW9A 2DCLA 2MZQA 3NOCA 2RB7A 3RBDA 3UCZP 3DRYA 2F63A 2COLA 2A1BA 3D0HE 2CPZA 1U7LA 2Y1IA 3AQPA 3UFCX 1DHMA 1WDTA 5BXIA 4J9RA 3UN2A 4Q8FA 4JI6J 1KD1T 2ERRA 4UY8T 2ILZA 2R7UA 3FFIB 1VIXA 1HKAA 3SI8A 2E1RA 1YJ7A 1QDUB 5J2PA 1IUJA 1LFWA 2QLFB 1W2IA 5GMEA 5HMYA 3EUNA 3UWTA 4DFMA 4DPOA 3NMAA 3AJDA 3IWXA 1UJ6A 1CULA 3CCUS 2W4DA 1RWUA 1F0XA 3IBWA 2JDJA 2ZBPA 3QBCA 2E5JA 4YHHF 2MGZA 3HT3A 4J9OA 2VG7B 3OW2R 1XEZA 4FNHA 4F02A 2F9JA 3I4PA 4JI7J 1TAUA 5GAEU 2HIYA 4ZS6A 1SKUB 4KJIA 2LXFA 2HRUA 3DLKA 3OR1B 2GNKA 4M5DA 2XYPB 4RO0A 1N48A 3KFWX 1CBKA 1SC6A 2BUNA 1XMOF 2DBBA 3DLEB 3GIIA 4PG6A 1SKRA 3W65A 2ROGA 1VJQA 4ICLA 4DMZA 2AEMA 5H9FJ 5ETNA 5FLXY 2HBYB 2OPRB 1VS3A 3J81Y 3CULA 1QUPA 1JNZB 2X51A 4OV6A 3LQVA 4B9MA 4CM2A 3A3NB 1TQLA 1U49A 3M6WA 2DNHA 1JLGB 2LQBA 3CJ5A 5KT6A 1M1GA 3CCRS 3S7RA 2Z58B 5GADU 2KVQE 2YX7A 3M05A 2GX8A 5KFQA 4B9NA 1SXLA 4M1KA 2EFNA 4RBUA 1FTCA 1NK7A 1U48A 3HK2A 2OMLA 4P7VA 1RAOA 4NYOA 3LWLA 5MLCV 5CXTA 4CO5A 5ETSA 1H74A 5KFXA 5B0FA 4DG1A 4X4QA 2C2KB 1WG4A 3OTOJ 1BUXA 3KK2A 4IRKA 3CD7A 4DUZJ 4HT7A 1DQAA 1VQ4S 4AQYJ 3M32B 3M6VA 4UZBA 2VA3A 3WC2A 3L09A 1NEEA 2MMYA 2GHPA 5B0GA 2UVUA 5A2QY 4EZ9A 3E2EA 1KVJA 3BGUA 1VQ7S 5A2QU 2CZ4A 4HI2A 3T5KA 1XIQA 4IR1A 4NXMJ 2AJQA 1UJ4A 3TP2A 4G3IA 2YNHB 2OPQA 4DV2F 4K4ZA 2VG5B 2IPOB 5KFAA 4RW8A 2HFZA 1ZM2A 3C14B 2Y1RI 2WVDA 1T7PA 1VQSA 1YBUA 2IHR1 2J0XA 4IDKB 1X0FA 1T3NA 3H5XA 3OFGA 2DGOA 4O0IA 1W7WA 3GFXA 5HVGA 5ETTA 2V68A 4MAKA 3SSSA 2DR6A 2OD4A 2C3MA 3LW5C 5IT4A 4MYUA 1XR5A 3HD1A 2RRAA 3RW7A 3H98A 1Z2ZA 3X3UA 1HBMB 1Z4UA 2MPUA 3PR5B 3S01A 4QCLA 1CJTB 1IN0A 3TI0A 1OQ3A 4USUA 4ZPVR 2HHXA 1URNA 3V2UC 3JQMA 4ELVA 5D0HA 4DFPA 4YS2A 3MXHP 5CA5A 3FDSA 3AXMA 5AJ3J 1K44A 3MEEA 3OTOF 4WFNQ 3TX8A 3DLBA 1JKHA 3Q22A 2JEGA 3HSZA 1I5OB 1RT6B 4N47A 1T95A 4WJBA 3EWGA 5IT9U 2XC9A 4YQWA 2DVIA 3TZYA 4UT4A 5B0BA 1Q79A 1S1TB 5I3QA 5KT4A 3JAMU 5J2QB 4LF4J 3PV8A 1EP4B 2IM2A 2M2BA 2HYIB 2QZ8A 1S12A 1WHVA 1F6TA 1HARA 3DHWC 1S4FA 1MMLA 3FCVA 5HI7A 1WWHA 3TEGA 4ETZA 1S77D 2ZH5A 2ALYB 2ADCA 4PQUA 5M2RA 1FFGB 5ETRA 2DH7A 3IA0A 2R7RA 2WB1D 2HFVA 3NNAA 3T9ZA 3H2LA 4KPCA 1BD6A 3DMJA 2N4DA 4WP9A 2GVDB 1YJRA 1HQUA 2CQGA 4P73A 3TNVA 3CC7S 1HWLA 3CMES 2PT0A 3M2RB 4U7UK 2QL7B 1U1MA 1NJXA 3P49B 1TU0B 3ILLA 2HBRB 1GXLA 2HHQA 2EPIA 1RT4A 1GMWD 1P8GA 2QRRA 1FD2A 2DNPA 2R8JA 4P2MA 1N5YB 4B02A 2IA0A 2YNGB 5DZ7A 2GFFA 5FDLA 3PR4A 1NRKA 1M5OC 1RZMA 4OLPA 1RWPB 3CVKA 4OHVA 5AXNA 2KN4A 2XSJA 2UV8G 2K06A 1U6ZA 4N56A 2PSZA 3DLKB 4ZKAA 3IO1A 2DHGA 3DRPB 1F9HA 1GXTA 5CZXA 2XLJA 4EYHB 5J1EA 4LQ3A 1BWVA 3HHLC 4RW4B 3WBZA 3PW0A 1U24A 5A8RB 1UZHA 4ZPWR 4W92B 4QR2A 2B4UA 4U67Q 2ABYA 2MZJA 2P2CB 1ZAWA 3M30A 5IWAJ 2LXUA 3O44A 4W90B 1KKHA 2B4PA 2RNEA 3RB0A 2RMLA 1XNQF 4JI1J 4EEYA 2ZKUA 4ZCIA 1QY7A 1W26A 2GJ2A 5IQQA 2VA2A 1PAUB 3CO0P 2IY5B 3EVOA 1RT7B 5MAOA 4B9SA 4F4YA 4C8ZA 4Y65A 4CO2A 5IQ6A 5KG7A 2GCFA 2DJWA 2JC1A 1SV5A 3QLHB 4ES2A 3AJ2A 2DITA 1NKEA 1PJ5A 4NA2A 2R2UA 4KHRA 1F5CA 1FWPA 3R5CA 2D1CA 2XYGB 4I2PB 3A8IA 1TL3B 3CT9A 1Q8LA 4J5OA 3K5LA 4BCAA 4WYWA 4DV6J 2Z0GA 2W2OP 3KLGB 2RT3A 2EFPA 4M63A 2MQQA 3RAMA 1NXIA 4OI1A 3F73A 2CVEA 4X4OA 3PX4A 1GMVA 3D68A 1HMVA 3QT8A 3RR7A 2R7VA 4NZ6A 1VQNS 1VHIA 4DOZA 1FK9A 5CYQA 3HZEA 5DM6Q 2ZH9A 4C3LA 3MEGA 4YFUA 4OIXA 4FPIA 1GFWB 4C6AA 1YBAA 1FCAA 2B51A 5GAEI 2CNOB 1L3SA 4FF2A 3V81B 3P5TL 5J1PA 1N36J 2MQ8A 3OVBA 2MQOA 1QE1A 3DRSA 4LRAA 5IWAF 3KLEB 2HMIA 3H7HB 2X1GA 2WHOA 3AOAA 3AD9C 1KFSA 4C8NA 3OR2B 4NLWA 3OL7A 2IJNA 3KJVB 3U1NA 3R97A 3V4MA 3IR7B 4DFJA 4KPYA 3HSJA 1J5OA 3UR3C 2G0CA 3MUTP 2IAJA 1XJWB 3KMSA 3MR7A 2KZMA 1HBOA 4FKXA 1TUVA 1N5TA 3VGSA 3MTKA 3UNGC 2X7IA 3MCMA 3DFEA 3A12A 4MMOA 3BPDA 4A8SA 1U8SA 3HULA 2CQ2A 2H54B 3K8WA 4YN3B 5F9NA 4GC6A 3KNAA 4RW9B 1N34J 3C2PA 4LF7F 4JI4F 1UVIA 5GAGI 1KHVA 1WEXA 1U0HB 3FJ2A 2E9ZA 1IWGA 3GFYA 1LQ9A 1DY3A 3QRPA 2V8HA 1UEVA 1CC7A 2E7XA 4ECVA 4P7TA 2FLNA 3TAQA 2HVDA 1KR4A 1FDDA 3N4WA 4C0BA 2C2MB 4I0WA 1C0TA 4KYZA 1NK8A 1S1UB 2V4JA 3CCES 1NNDA 4HLBA 5KFSA 3AB2B 2MGZB 5KFTA 2F1FA 2X3DA 1KWMA 4TLRA 5HBMB 3ZFVA 2BA9A 5K8OA 3P5BP 5A0YA 4LF9J 1VK8A 2P9GA 1S1VB 1YHQS 2YX1A 3GV7B 5A8RA 3M9NB 1WSVA 2G9OA 4NLUA 3W8GA 1V9OA 3PDNA 1NSKL 4I6WA 3FEXB 2RDDA 5J2PB 3QATA 1X5PA 4EBCA 3US5A 3DRPA 1SJ4P 4B3MF 2UUWA 2AYBA 1JIHA 2AJ4A 2E5HA 1WHYA 3H2UB 4F36A 4F0KA 5KFBA 3L9ZA 3ZO7A 1REVA 4TYAA 5A6WA 1S9GB 3GPAA 1ZETA 3CE8A 4YEAA 4ZPTR 4UZCA 2B4VA 5K5MA 2J9DE 4BBYA 6FDRA 1VQ9S 4K50A 5CD4A 3T5LA 1WG5A 1YJUA 1S0VA 2GHWA 1SV5B 2LU2A 3QLHA 2K7KA 1C1CA 3BGLA 3V6DB 2QYCA 2FVSA 2OEKA 2NXUA 2AJ0A 2CWXA 1FNXH 2FJWA 1HNWF 2AYGA 1D3WA 1RHJB 1Y5IB 4I2QB 4P2SA 1KQFB 1IBLJ 3GIRA 4LSLA 3D1HA 2VQFF 2EFOA 4KHMA 3K0JA 2CNKB 5THWA 1UVLA 4Q2MA 4X4UA 3U1MA 4C8LA 4PPZA 2VODA 3PKYA 1YDLA 3N6MA 2KXFA 4DPYA 3D3BJ 4RNOA 4NLGA 2JFDA 1N56A 2E1MC 1NDKA 5EWEA 2O5DA 1NJYA 1D8YA 4PQUB 4H4MB 3BBBA 5DDRC 5LMUJ 2LEPA 2OHDA 4HTJA 1Y4ZB 4IRCA 4Q0BB 4IH6A 5KFHA 1HPZB 1QM9A 2B9EA 4USTA 4BS2A 3BH6B 2JWNA 1I51B 5J2MB 1H2UX 1O8BA 4FBTA 2QMUB 2A6OA 4U95A 2B9WA 3PW7A 2XTJP 1NPRA 4J9LA 3CJ8A 2HNDB 4URGA 3J7A1 1JQGA 1UFKA 4KTQA 4MKAA 2Z2MA 1MNEA 2HEKA 2LQJA 3A1YG 3KDOA 4NMXA 4OZ0A 3MM5A 4CH1A 3PKMA 1HIYA 1JLAA 1G3OA 1L3TA 4GVBA 2DKOB 1WC4A 2QMXA 1FKOB 4N76A 5DM7Q 1T05A 3CEDA 1N36F 2VFVA 2FUG9 3QYYA 1HYSB 1WHXA 1IR1A 2C2OB 3FRZA 3I5BA 5M2PA 2AEFA 2V8GA 3C46A 4OHYA 3BKFA 5J2QA 3NCQA 1U2FA 1DLOA 4ECSA 2NYHA 3PXGa 5HMZA 1S9FA 2NLWA 1LV5A 3NGSA 3C14A 1VQPS 1PGZA 1GMWA 3G87A 3HO1A 1LNQA 3QPIA 4WK1A 4OYBA 2CPXA 3EGNA 4ZIVA 4NEZA 2WBRA 1EKSA 2WVFA 3ULHA 3VZHA 1UVJA 3RBZA 1RHUB 4OI4A 2J0WA 3MF5A 4OX9F 2FC9A 3I31A 3J80Y 5F9LA 2PMZD 2XMVA 1EJ7L 2HQ3A 4DQQA 1HNXJ 2OEMA 2ZBRA 3D3CJ 4U8YA 4Y28C 2AJ2A 1VC5A 3I0SA 4RW7A 4Y3CA 4XDDA 4U8VA 2HNZB 1JWWA 4O3NA 3IAS9 4ANCA 3IWNC 4DV5J 2ZHOA 3OXFA 3T1HF 1RAFB 2M70A 2RF2A 1MWQA 4ID5B 4ZJLA 4DSFA 2PI5A 1HBMA 4IOAQ 2UUCF 3PX6A 2FVQA 4F3QA 4ZLLA 4R0JA 2LFVA 3THPA 2FJVA 4ZITA 5C25A 3AFGA 2XZDB 1SJ1A 3KLIB 3AA8A 4JV5J 3D66A 3EMTA 3O1LA 2BDPA 4PWDB 3SCJE 1GEHA 4OZ2A 3NKYA 4U7CA 1DFDA 2IC3B 4RU2A 4QIFA 4RR5A 3PRBA 2KDOA 2QE5A 3K7RA 3FGVA 4Y2IA 3DLLQ 4Q44A 2HK2A 4LR7A 2B6AB 2P9CA 3T9NA 2ASJA 3CDBA 1LW0A 1ULRA 1FVQA 4C8KA 3LALA 1SQEA 1U2RA 1WSRA 2FHOB 2CDRB 2KT2A 4PXEA 3N6LA 2DPIA 3R1HA 3FBFA 1UEKA 4PXCA 3GJTB 2XGPA 5C42A 2HVZA 4UOGA 5KFWA 2BJ8A 4DSIA 1EX8A 2ASDA 2ATLA 4TQRA 3ENAA 3KLVA 1NKBA 1WEYA 1WUUA 4Q2LA 2KG0A 4J9MA 1S99A 1FI4A 1Q8IA 2YWFA 5K9FA 4JI3F 2RS2A 4F2SA 3RJMB 3CCJS 5F3TA 2KHCA 5A0YB 4FXWA 1VRUB 4DU8A 1UETA 3HKZD 4DI6A 1Q78A 2R8HA 1ZS6A 1FRLA 4BWMA 1MW7A 1RHQB 2H5EA 3P8BB 4C3MA 2NUUG 1RAGB 1DTQB 3CJTA 3HD2A 2YVSA 5K14A 3W2WA 2L08A 2GC8A 3D54A 4OX8A 2E66A 2M8DB 5GMKa 2HHHJ 3HFZB 2P6TA 1IBLF 4IH7A 3MOJB 2HLUA 3T5JA 1V5VA 2BVZA 4OMFG 2BEFA 4R5PB 4CYUA 1Z1ZA 4PG5A 4JI5F 1NMEB 3D0IE 4J9PA 4FYDA 4KAIA 1UWAA 1M0SA 3DGPB 3W1YC 5IV3A 5CCLA 5KFEA 4ALZA 4WPAA 2HBZB 3TAMB 5H9EJ 1HR0F 3M2VB 2QA4G 2F7VA 4CO1A 4C0HA 2YX4A 4LJMA 3PO5A 3F41A 2B5JB 1RKIA 1CSJA 3OTDA 4LSNB 1SB6A 2O3DA 4HDHA 1VQ8S 3T6BA 4NLVA 1OSDA 1TL7A 4FVMA 4CLYA 5K14B 3Q8RB 3IM8A 3KK3A 2YH0A 5HROA 4URQU 1WEZA 4WF9Q 3Q2SC 3UCGA 2EK1A 2NPIA 1XMQJ 2FLLA 3OR2A 1VLYA 4LIRA 2WBMA 3ET6A 1JLBB 1H6KX 4C7QA 2RVJA 2AZ1A 1M1HA 4DFKA 3IMQJ 1EETA 2RDJA 3QAUA 2HW3A 2HG4A 1P6TA 3EDQB 2GAGC 4PUOB 3EM1A 2CRLA 4MT1A 1VR6A 2WOMA 2VZ9A 2L48A 3BO3A 1JLEA 1KNZA 3MCSA 4XPEA 3UNYA 2OELA 1Y10A 2FJDB 4L74A 2J9EA 4FXVA 2AW0A 2O67A 2B6AA 3U1LA 1UA1A 3T41A 2FYXA 2BACA 3SQOP 4WFBQ 4CLPA 3VV2B 1LWFA 2VC0A 2VH7A 4MKYA 3ZZRA 1RT5B 2DT9A 1GXUA 4OX6A 3PY8A 1RT1A 3SQGA 2UV8A 5A8KA 2J6SA 3RUBL 2HWIA 2MKKA 1PAEX 3NBPB 1N52B 3UDCA 1SL1A 1RTHB 2GQQA 4MIBA 2VU5A 3J7Z5 4N77A 1X4DA 4ZPAA 3Q0AA 1IBMF 2I6WA 4LF5F 1HYSA 4X4VA 4DV5F 1BQNA 1TR0A 1HNXF 2QA1A 5HLFB 3ZC4A 4NMLA 2BE9B 3NMRA 4QYRA 4DL7A 1A9NB 2IDLA 1JK9B 1TVRB 3E01B 5HQMA 1T9WA 1KLMB 4DL3A 3TW0A 3RG6A 1YZ6A 4H4KA 1S1TA 4L73A 3SIPB 3V6HA 1HQEA 4OHXA 2DXDA 2RHQB 3KLFB 1TFWA 4F04B 1XERA 2B56A 2XZWA 3EICA 5CABA 2A0FB 3IR6B 3MPYA 1TKZB 1NSAA 1PJ7A 2HSEB 4JV0A 5D8HB 2QC3A 3TVYA 1N32J 1Y5LB 4ECXA 3RBXA 4ECTA 3DDIA 3TUJC 4RUHA 1VBZA 4Q0BA 1W2BR 1M1KT 3VHQA 2XMJA 2CQ4A 4NCGA 3TZZA 3QQCD 4KGXB 3D9BA 2D3ZA 4MK7A 4DQSA 1V6HA 2DGTA 2ZVIA 4NASA 3RRKA 3UDVA 3K17A 3AOCA 3FMBA 2JNJA 3JSRA 4PWUA 1U1KA 3I82A 3DLHA 8RUCA 1QSSA 4XIUA 1VIOA 4WIQA 3G96A 1SKWA 3CCSS 2Y8WA 4LF5J 2OSRA 1TZ0A 1GMUA 4I2QA 3M9OB 1HWIA 3TA2A 4M5HA 1VOMA 2BR0A 1AB8A 3D6TB 1VISA 3B8HA 5CCMA 4LVNP 1OYDA 1HI1A 2VFRA 5KOXA 2CPDA 4JI8F 3FBCA 2YY3A 1WC6A 3RYLA 2E1PA 4DV2J 2YQ3A 2Y9HA 3G82B 2HZVA 3T1YF 3O5TB 4KHPJ 3SZ2A 1SUQA 3DLEA 2XMAA 5C24B 5FIIA 2K2PA 2QO3A 2B8PA 2AYMA 2BKNA 1VYAA 2W24A 3ISZA 4DHVA 1R43A 3GWCA 2AU0A 2CG8A 2QT7A 4K59A 1X5SA 2W2NP 4PUOA 3MAAB 3MR6A 3H2VE 3H5YA 1HQ2A 4CT9A 2MB0B 3RRGA 2C1EB 4O0NA 4FXDA 4DX6A 3CD0A 3EZOA 2FY1A 1T9TA 1XMBA 3O6QA 2Z30B 4DPWA 4I7FB 5CYMB 4A8MP 2CDQA 1H2TZ 3IRXB 2LP4A 4NLYA 1SJQA 1ZPVA 5LSLA 3AXKA 3CIMA 4IG0B 2CQHA 1U4BA 3L95X 4QIVA 3AHPA 3QWPA 1RTIA 3HHLA 4DX7A 1KEKA 3KUEA 4EZ6A 4ZVRB 1RHKB 4KH0B 4MKVA 5BJRA 1F9FA 3SBMA 5HP1B 4B3SF 3R8YA 1MN7A 1JLFA 3HF5A 4WZMA 4A8YA 4XAKA 2XHCA 3ZTRA 4CLFA 3G8SA 1YI2S 2JX2A 1S9EA 2Z8QA 2W4CA 3WHIA 3TWZA 1T0TV 3PRVA 1OO0B 1UJ5A 3PFEA 4LFCF 1YBTA 3M8QA 1URRA 1ZM3A 2QSFA 3MHYA 2J0SD 4PR6A 4UF4A 2C3PA 4HDGA 2AJFE 2FZCB 2RS8A 2Y8YA 4X2BA 1WJ9A 2HWHA 3D7SB 5FD1A 4NX9A 3UE2A 4ANEA 2D3O1 2X1FA 1G1XA 2EC2A 3KHRA 2K3KA 2ALZA 2Z56B 1XTZA 3BPSP 1GK8A 2FHJA 3K5NA 3SFGA 4ZVTB 4WFXA 3TJ8A 2M7SA 2IA6A 3CJQA 2C2ZB 1R8BA 3A13A 2RD5C 1VQ5S 5I42B 3J80U 1ZH5A 5HSPA 3MM7B 1HBNA 3BB5A 1WOSA 3OTCA 4RWWA 3EGZA 4NI2B 4OV1A 1MSWD 1UWBA 2MQLA 2QLBB 2R4FA 4MJKA 3D2WA 1QSLA 1O5JA 2FZGB 5KFCA 3CB4A 1J5EJ 4CCHA 2E1AA 1U0HA 2F8EX 3F44A 4V1Ak 5AXMA 3UD4P 2PO4A 3MEKA 4B17A 3TARA 4ILMA 1K0TA 4LUBA 4A4JA 3IGNA 2HHPA 3JTOA 2BJ7A 5SUHA 4EBEA 4RUAA 1XK8A 3VR1A 2NSCA 1Q1KA 3SMZA 1UTAA 2VPXB 2ZM6J 3W66A 1BY9A 3VAGA 2CQCA 3D67A 4L72B 1S76D 3EE3A 1ITPA 3QSIA 2K1RA 1NH8A 2YWGA 2ZBIA 3G86A 4LSZB 1UWBB 4NLOA 4OI6A 2N3LA 3WX8A 5F8LA 1F3FA 3M8YA 4JI0J 5DDQC 5GAHU 2E7WA 4DV3F 2WSEC 1WKKA 1SL2A 3R2DJ 4HL9A 4PEOA 4KO0A 4UQTA 1YITS 2AGPA 2PFDA 2A6MA 3BKTA 4OL8A 2PA3A 3SCIE 5I4MA 4PXDA 3B6BA 4G6VB 2KI2A 1R8AA 4DLEA 2J9DA 1CEZA 2F5GA 4DV6F 2OEJA 4GO5X 3VAIA 2MZ1A 4OLOA 2HIQA 3ETOA 1UFLA 2WVEA 3BYPA 4J9KA 2RQMA 3SV3A 1RAEB 1NKCA 1KOHA 5H1SV 1IKWB 1AXQA 2FZKB 1D9FA 3FSXA 2MLYA 3GR0A 2N4CA 4USMA 1RWKB 4DX5A 4B3OB 2HHUA 2VDIA 4QZVB 4YOEA 4RBVA 4K4XA 5H9FK 1N8RT 1OYEA 4NA1A 4ZPBA 1KBRA 3PO4A 4IFYA 1ZPWX 4ZHRA 3LH2S 3MMAA 3OUYB 2FB0A 1QTMA 1S79A 1XR7A 4HR2A 4DR5F 4K0KJ 4JI0F 1GAOA 5J1NA 4N5SA 4AYBD 3OLBA 4LR9A 3EPGA 4FDFA 4LRDA 5DJBA 3MAQA 2XLKA 8AT1B 4ZCLA 3TO8A 5I3PA 4LF1A 1NJIT 3IXQA 3DLGB 2NXEA 2Q1LA 4ZVQB 5A76A 1VHFA 1Q95G 4E0DA 4LFBJ 1Q82T 1C1BB 5T41A 2LKZA 3ZZZA 1S7IA 1UP1A 2JJ4D 3LP1B 4DXLA 3M8QB 3PW2A 2YPZA 4FZVA 1YQHA 5D4NA 4XO0A 3BO4A 2ZUAA 5C24A 3W2VA 2KFYA 4HKQA 2YNGA 1LOUA 2RHSB 3ZZ0A 2FGOA 2C2RA 1DBDA 2D3UA 3PRDA 4X66F 1S6QB 2ZE2B 2IVMA 4ITSA 4ZVUB 2V0NA 2DGSA 3CDUA 2HVIA 4L3KA 4CLTA 1RHMB 2BJ1A 3KG4A 4A48A 2W9CB 2CJKA 2IJRA 4ZVSB 1D09B 4NLRA 3W5ZA 4ERDA 1KRPA 4CH7A 4K0KF 2RH3A 1U1RA 3ELHA 4C97A 1ZTTA 5D6GA 4O3RA 2HZCA 5D0GA 3D1OA 3SYZA 2DGQA 3G8QA 1SC4B 3DXSX 3MPWA 1AUDA 4AD6A 1JLCA 4ZLPA 1RBAA 5F8GA 3H42A 2XY6A 4LF4F 1GNKA 1S6UA 1NPKA 4TU8A 3Q8QB 3VVTA 3NNCA 5D15A 2ZH1A 2VBWA 1FJ7A 3TX0A 4FKYA 3GJRB 2G2ZA 1KQSR 4D3HA 2RQKA 5KG3A 2KG1A 1KFDA 3IS9A 1TKXA 2M9KA 3TA1A 2DNMA 4UOHA 2YWHA 1Q7LB 3AOBA 3NRBA 4I6AA 2B7CB 3GB0A 3M32A 3JYTA 2CJBA 2ROEA 3ZTPA 5KG2A 4PG7A 3KTQA 3KK2B 4C4WA 3IFEA 2RRNA 4KGZB 2C28A 2C2EA 4ES1A 2P9EA 4X66J 4NWBA 4CP5A 2R7WA 5LMNJ 2A2CA 2DRBA 1VC0A 3OUYA 2ZM6F 1RE1B 1S6QA 3JB9k 4DR6J 4ILLA 2M0GB 1JNRB 3WQPA 4K2XA 1A6LA 2B5JA 1AROP 4EBDA 2R2RA 3DHXA 3R7SB 2QLXA 2BOPA 4UY85 2BW2A 3M8ZA 3U7JA 3SSQA 4J9NA 2JEJA 4KV8A 4PXBA 3IN5A 4ELTA 1LKZA 3AODA 4FF3A 5I3UB 3MZIA 3QGGA 4RW9A 5C5JA 3DM2B 4U6PA 1GTEA 2GGPB 3G8TA 4F4KA 2OPRA 4K7QA 2XI2A 3RAQA 4YDDB 4J9QA 3C3LA 2BE2B 2BRKA 3RTVA 2UXDJ 2XQCA 1IWAA 1UAWA 1ZAVA 3FQKA 4B9LA 1S5ZA 4WK3A 1P1LA 1J5OB 5BR8F 4ZPDA 3HHNB 3FBBA 1S1VA 3OR1A 1HFEL 2HAIA 1CJKB 2MXYA 4IUFA 2F4VJ 1D9DA 2MJUA 4NLDA 9ATCB 4PKDB 4NI2A 4EYIB 3EZ5A 2W8LA 2UZAA 4DR1F 3MD3A 4J9UE 3R5GA 1WELA 3HFVA 3PYEA 3DRSB 3KLEA 4LF6F 1RP5A 2VC1A 3JTPA 5D3GB 5D0EA 2H1YA 2LQ9A 2DRAA 4Y2CA 1VBKA 3THTA 4B9UA 2WCXA 4WTYA 4RKUC 4XPCA 3CNQP 2I5JB 4X4NA 5D77A 4H54A 5KFUA 1WG1A 4DJBA 1HMVB 3H20A 1H38A 2WRMA 2QTWA 1Q5YA 2DNQA 3N0VA 3KG0A 1R0BG 3OSNA 4IRDA 5ETLA 1ZZFA 3LO3A 3M1VB 4DL0C 1NB7A 1WKJA 3GSDA 3KLGA 3MFIA 4DSLA 3MM6B 4HHJA 1FT8A 8ATCB 1TL4A 4I2PA 3VGTA 1HL6A 1PILA 1R8HA 1TL3A 4F4ZA 2GS8A 2OPPB 4AFFA 1S9EB 3H90A 2VUGA 2C42A 2QV6A 3LP2A 4YY3F 1VQ6S 1QAYA 2U1AA 1IQTA 3R2CJ 1YVFA 1T03A 2CJ9A 2VG7A 4RBTA 1UKUA 2OFGX 1B7YB 3MM7A 2UXCJ 1HBNB 2F4VF 1NHUA 1TK5A 2MYFA 4GMKA 5L38A 1BMQB 1KS2A 4OHWA 3B82A 3MWBA 4IYQA 4QQBA 3D0GE 4KKOB 3EGVA 2PFFB 4X84A 2UUAJ 1SI9A 3UDLA 3JYTB 4B9VA 4QR1A 2YKAA 2CJQA 4I7FA 5CYMA 4ZVEA 5HATA 3FSIA 2B9XA 2W1BA 4XK8C 4EO8A 3PACA 1H2VZ 1GX5A 2N7CA 3W62A 3K59A 5L1LA 1RYSA 1RU2A 2AWZA 4JOUA 4DBQA 4RNHA 2GMHA 1KTVA 1X31C 1AZSA 2DO0A 4OJ1A 5AE2A 3PW5A 3OSPA 4DQIA 4H4OA 2AGOA 2BJEA 2KRRA 1KHWA 5LT5A 4F3MA 4Q43A 1K8AT 1P9YA 2LEAA 2ZH4A 2KM8C 2JEFA 1KDNA 1VFJA 2R2TA 1X60A 4C11A 1SJFA 1N5YA 3HDSA 2CWKA 1X4EA 3M1VA 2UUBF 2JFKA 2JL9A 3ZZTA 4ELUA 3CW2C 2EWHA 2J9CA 4EI2A 1HNVB 4DUZF 1LXJA 3KKFA 4LFAJ 2MKYA 3CIZA 3HVTB 4ETXA 3VALA 2OTLS 3DRXA 1Y9OA 2RUGA 2VICA 4O44A 2F40A 4MFBA 1E6VB 2YXLA 3M8PA 3NY0A 2VBZA 2YKMA 5DETA 2YNIB 4OI0A 4S0MA 2LYVA 4YB1P 4I69A 1LWXA 3BO2A 1TK0A 1Q86T 3WIVA 4PRFA 3SEOA 1LWCA 2WZ1A 3FEZA 1CJVA 3GONA 3R27A 4GC7A 2GQ2A 1SPBP 2V8PA 4LQ9A 1OMSA 2BV3A 2V6AA 1S4EA 2MKHA 2GO9A 1FDBA 2HS0A 4K8RA 2VJUA 1IR2A 2DNYA 4AT1B 2V67A 1FKPA 3MR2A 1FD8A 5AXKA 4PABA 1RT3A 2BE2A 1N6QB 5EHHA 4HVZA 3FNNA 4JP8A 5F8IA 3QAEA 1Q8KA 4YR3A 5G0RB 4DUYF 1YRXA 3THVA 1TFYA 3CSKA 2J8AA 5IM0A 2YTCA 3K57A 1DLOB 3E51A 4O4RA 3BGRB 5IXUA 3WDOA 4QWEA 3G6ES 1HNZF 2DK2A 1WHWA 3GU0A 5JMNA 4K4SA 1MMDA 5GMDA 1WORA 2YH1A 1B4SA 5B0AA 2UXDF 4ZDNA 2EBGA 1R6YA 5KT7A 2HHSA 1QJHA 3LAKA 3QO9A 2XLIA 2VG6B 5BR8J 3HVAA 1WOPA 2OH2A 5C2GA 4ZVHA 4LF6J 4NCBA 2J5AA 4DSJA 4ED1A 4WKYA 4B3MJ 3OFHA 2X3GA 2LEBA 3VF0B 2MKCA 4NRTA 1QD1A 1EARA 5B09A 1S59A 2FJAB 3QGPA 5IM0B 3LP1A 2EFGA 2BABA 1A7GE 1FFWB 4NLQA 2GA7A 1MROA 4OYAA 4UUWA 3SCLE 1WOOA 2LA6A 5EWGA 3KHHA 1ZM4A 2NS1B 2MEWA 2ZDOA 5HANA 3PJWA 2JLFA 3KOAA 3OFFA 1MLAA 2D9OA 2HWTA 3I87A 3ZZYA 1X4FA 5K8PA 5M2UA 2MKIA 1M5HA 3LPYA 2UXBF 1RACB 3ZNUA 2WOMB 1YGYA 4RUBA 4MIWA 3SXLA 4XTTA 2Q43A 4YUDA 1HLWA 5CD4H 2J6UA 4Q45A 3NL0A 3C16A 2EXUA 3MMCA 4WBFA 3ZZPA 1B99A 4QBUA 3GG0A 2P6SA 4LF7J 4CLLA 1VCTA 2QJ3A 2DR9A 4PWWA 1IR0A 2PN6A 2CPEA 3FZBA 3NP5A 5D0RA 3VVUA 3HJFA 3R6GB 2F65A 1MU2B 2B43A 3CJ3A 3K5MA 2DPJA 2HKEA 4KT0C 4WFZA 3D5MA 1HNVA 1TV6A 2HNDA 2VASA 4OI3A 1S10A 1RWXB 2UUAF 5F0WA 2IRUA 4ZLJA 5ITHA 4TQSA 1T02A 4GVLA 4LSNA 5KFGA 4QWCA 4OX9J 4IO9Q 3HPOA 4TU9A 2NCKL 1NZ8A 2OSQA 4ICLB 2R7OA 2Q6CA 5E0OA 4ZOSA 4ZJOA 4FF1A 1HD0A 4IH5A 2VFSA 4YR2A 3JSMB 3NWGA 4I64A 2FY8A 1Q5VA 4KRWA 4RPFA 3VGUA 3LWMA 4P75A 3LPEA 3TZWA 1F2GA 3ITHB 4HTIA 3BQ1A 1T9VA 2ZOFA 3TVKA 1R0AA 3GCXP 2UUBJ 4M5GA 1FHTA 2ACYA 2FC8A 1IVZA 4X64F 2L9DA 4NYPA 5LJ3Y 3ET6B 4Y00A 1YSJA 3POTB 3SV4A 1SIZA 4K5SA 1XBWA 1FRKA 3GILA 3EVMA 2IJFA 1FXLA 1E6VA 1SQFA 3M8PB 4HYKA 1V5IB 3QNWB 5HROB 1V3RA 1UEUA 1YLXA 4EFAC 1G6BA 4ED5A 4UTGA 1VMBA 1LWEB 3HKWA 2BQRA 2FJBB 4B3OA 3R3TA 1H7WA 4JV5F 4FN5A 5CHCB 3KXDA 1PBUA 4GRSA 3M2VA 1L3VA 4C9DA 3BR8A 2ZWOA 2YKPA 1U47A 2ZC4A 5KTQA 1DARA 4DS5A 1HBUB 2H5JB 1LXNA 2W2QP 3DGVA 1LW0B 1JLEB 3PYGA 2NUHA 1CQNA 3VGVA 2NYIA 1HWJA 2D69A 4C3KA 3KWMA 1NH7A 1NK9A 4NZ7A 3Q8SB 4E98A 2BQ3A 4P2FA 5ADZA 4K2JA 1GT8A 1DTQA 2XMMA 2BZ2A 3BN7A 5ETMA 2AYEA 3W2WB 2XO7A 1JX4A 4BDPA 4CTAA 5HVHA 2KKHA 1RWMB 2MDAA 4WTOB 2QLWA 3CCMS 5JVGQ 2VF3A 2VDHA 3NCPA 1VRUA 3M30B 4ILRA 4KC5A 4NL5A 1R8CA 2OGUA 4B9TA 3GE9A 3GQCA 1HA1A 1BLUA 3KUHA 1WC5A 3R7BB 2D9PA 1T03B 1IKVA 2M4MA 4M5MA 1ACMB 3F0NA 3I0RA 5J1EB 2MJNA 6AT1B 3MCOA 1XWLA 3QRQA 4RW7B 2CPYA 2GIRA 3PFOA 3W9JA 3UPFA 3CMAS 1VQMS 2HHWA 3CD6S 6FD1A 4DUYJ 1YG0A 1ZA1B 3LANA 2JRSA 1FRIA 4R5PA 1HNZJ 2OJ3A 3ZXWA 5AXLA 3DCAA 1CQMA 3MEDB 1UMJA 2XZTB 4PWDA 3TUIC 5I3UA 2I5JA 2O01C 3EXYA 3M2UB 4Y2KA 2R7TA 2MLXA 2BXJA 3HVWA 3GMGA 1YJVA 1YZ7A 3Q24A 2G0IA 1BQXA 4ECUA 5C25B 1KVIA 2A10A 3KLIA 3DOLB 3MD1A 2ZVSA 4R0EA 3W3SA 2DEJA 1J27A 2PA8D 4GKJJ 1OIAA 2XMTA 2HVEA 1OQ6A 2OFHX 4J7CA 2W01A 2RF2B 2HHHF 2YBVA 4C48A 4OYMA 3AD8C 5IOLA 2UXBJ 2LXIA 2DNNA 3C16B 3HXMA 3QJPA 1KOOA 3MMCB 1CJKA 2PDAA 3ITHA 3QIDA 1T94A 3R5DA 4CO0A 4RZRA 4N7TA 1DAXA 3OT9A 5HMWA 1DTTB 2RIJA 3ENVA 4WU3A 2CJAA 4DV3J 2ZNZA 2V4RA 3D4JA 2AIRB 3QRRA 2OO4A 5C2CA 4ECRA 5LSOA 1DQ8A 3DU6A 2JEIA 2CUYA 3B4DA 3R7NB 5EN1A 3H0PA 4JB8B 5GADI 4O3QA 1K47A 4F4AA 3ZZUA 3DYAA 4PCQA 5D4LA 2DXEA 3GIMA 4KH1B 3OJUA 2VQFJ 2ZD1B 3CCLS 3FCHA 3Q8YA 3TRGA 5FDLB 3UDEA 4AXIA 3KLHA 2XS5A 2M5YA 4QYZK 3VAHA 2WVBA 1KQKA 2BYCA 1B3TA 2VOPA 2AGQA 3GLJA 1RT4B 2DR7A 5JUMA 3BH7B 1JLFB 4EMDA 3DI6B 1CJTA 2IFXA 3M2RA 4FYYB 3AA9A 3RU0A 4DX8H 2V2ZA 9RUBA 2R7SA 3A4TA 1T9YA 2CADA 1RAAB 2LVWA 2VFTA 3W9HA 4HACA 4GKJF 3W5XA 3TANA 4FBUA 5DQGA 2QMWA 3MOZA 5F8HA 3BGRA 3PTWA 4WXWA 2DR8A 2VBYA 2DEIA 1FF2A 1KVKA 2FIUA 3BKUA 2DISA 3FCWA 2VKZG 5KAKA 2G4BA 1FESA 2GJIA 2D41A 2DHAA 5G0RA 4CZCA 3NGDA 2YNFA 1Q16B 3I55S 3CPWR 4D3GA 5L1KA 5J2MA 7FDRA 3BGFA 1N6QA 4L3NA 4OX7A 2X1BA 4O3PA 3OXGA 1RT3B 1QVFR 3MDFA 2NZ4A 5EGYA 4ZP6A 1S1XB 2MZTA 3FSYA 3MMBA 5E33A 2EFVA 3UCUP 4DR7J 4F2RA 1U0SA 1VQYA 2DGVA 3L3CA 2VJVA 4OYIA 1KP6A 3N6NA 1TTHB 2BJ3A 3CCWA 2E1CA 4CNYA 1QAXA 1OPIA 1RABB 1AFIA 2H51B 1HHSA 2R8GA 2CQ0A 3T6JA 2ADBA 1Q53A 2AKWB 1RTJA 1UZDA 2JC0A 3OPKA 5IS2A 1HWKA 2XS7A 1RK8A 3HFKA 2CYYA 4Z37A 1NDPA 3G71S 3T1YJ 4O44B 1S0NA 3CJKB 3AB4B 4LSLB 4CLUA 3C8YA 1QAJA 3DI6A 5JJBA 1ZBTA 4WCEQ 1PC5A 1RDRA 3I56S 2PGCA 2E5GA 4ZMMA 1T3OA 3EVWA 2KFZA 2DNZA 4USWA 5DG8A 4OZ3A 1VRTA 3LGMA 4A46A 1NDCA 2G1DA 4C11B 2W7PA 2QSWA 2R8IA 3I32A 1HW8A 1LK7A 5KFLA 1JJCB 4FNIA 3S1TA 4F0HA 1Q81T 4JI8J 1O51A 1T11A 4O3SA 5KFFA 4UOCA 1RTDB 3UVJB 2EC0A 1BC6A 5CAAA 5KOWA 3H5UA 3DYAB 3T1HJ 2DHXA 3VTIA 2HGLA 3BSNA 2PE8A 3IG1B 3UD3P 3DLGA 1FJGJ 3GG1A 5KG0A 1QVGR 3BM7A 1M5PC 2M8HA 1KC8T 1CS4A 4TKTA 5LM7E 3EX7B 3V6JA 4DPXA 2VIHA 1I3OB 2V69A 1TVRA 1XR6A 4A8OA 4EK2A 2PMHA 4G1IA 2FTRA 2IRYA 3KJVA 1NK5A 4CTAB 1D1UA 1B7FA 3RZAA 4N41A 3PHTA 4E2FB 3TA0A 2WTFA 4IOCQ 5KFKA 1WI6A 3KYLA 1TP7A 4X4PA 3IGVA 3NBPA 3M8SA 3AD7C 3DOKB 2PEHA 2HFNA 2FLOA 3N79A 1XQIA 4TYBA 4F7VA 3W9IA 2HNYB 5LMNF 1JLGA 3G2XA 3FMWA 4I67A 3GV8B 5LL6d 4ED6A 4Q8EA 4ER8A 2OPPA 1F1BB 1U09A 3CO9A 4C98A 1RAHB 3A8JA 2N3OA 5T14A 4DQPA 2DRDA 4K4UA 2OP5A 2CQ1A 4CQ1A 2RJZA 1IXKA 1PC4A 4DR4J 3OTBA 4MYTA 2DNGA 1OPZA 3LGHA 2KO1A 4HEA9 4KQZA 2UVWA 2OTJS 1FTRA 4OYOA 2W7AA 2A2DA 4JUZA 3LUYA 5L46A 4M5NA 5ETKA 2ZJPQ 2B7BB 2H4YB 1V3ZA 3I0RB 3DRRA 4KO0B 2JZ5A 3J7YU 2DR5A 4RW6B 4MK9A 1U26A 4NCAA 3AJ1A 2V9KA 5E41A 5H9EK 1JXVA 2EVZA 2XMKA 1R8PA 3IP0A 2PEBA 1IJEB 3O2IA 4DF8A 3A3OB 5IT9Y 1UPMB 4M5LA 5C42B 2Q6BA 5KFJA 4DR1J 3CJ4A 2W25A 2AP6A 1IKXB 2EI5A 3MM9B 3QT5A 1FJCA 4F25A 2BKPA 4ZCMA 1QLNA 2MSTA 4JYAJ 3VAKA 4X62F 4HI1A 1VGYA 3BQ0A 3W63A 1FJGF 2GQCA 3M8WA 3CDAA 5BYSA 3NGRA 1YTYA 2ZOGA 3A8KA 4MH8A 2XY7A 1K1QA 3BN4A 2CPIA 1EB0A 3BS9A 4R25A 3QT6A 1VRTB 2LA4A 3IWLA 4JBCA 2FHJD 1U8WA 1H72C 4LT6A 1NU4A 2RUSA 3MTJA 4QIGA 4DUTA 4DV7J 5DRKA 2I38A 2V63A 5BYQA 3ILJA 4GVBB 1FWKA 2DH8A 5KFOA 3I6PA 1RQ0A 3FUYA 1TL1A 1FXRA 2CIMA 4UW2A 4DZ6A 1RYRA 1IBKJ 1ZOTA 4PQAA 5K8NA 1U6FA 4QPTA 1JJ4A 1VRQC 4DPTA 1JB0C 1BHNA 4AE5A 4IR9A 1AYEA 3H4DA 2MHEA 3GCWP 1S1WB 3EXCX 2HFOA 3NS6A 3OJSA 1FRMA 2RILA 1OY9A 4F67A 4DZDA 1AFJA 3ONQA 4IG3B 1G2EA 1N5QA 2GMJA 3MI7X 2Z2ZA 2CXEA 4TXSA 4LR8A 2YQ1A 2CQ3A 4ED4A 3IBFB 1JLCB 2BW7A 4OZ5A 1FX2A 4RU9A 2RU3A 1IBMJ 1JXEA 1NHVA 4DCJB 4FF4A 1U6BA 3PJ9A 1RAJA 4WYLA 5JXSA 3MMJA 5KT2A 3EDRB 2AZ3A 2UVRA 3HX9A 4P74A 1RT7A 3PEJA 3VAFA 1OY6A 4CLWA 4ED3A 2VG6A 1FDAA 4I6YA 1I94F 1T05B 3KJNB 2FVPA 2IM3A 1I6JA 3R1LA 3N5FA 1RCXB 1VJWA 3CJKA 2DTJA 3G6XA 1RJJA 3TQEA 1DZ5A 2IBKA 2HK3A 2XBPA 4V19J 1NB2A 2DH9A 2ASLA 1CS4B 1L3KA 3K8VA 2PMWA 4G65A 4ID5A 1P9QC 1RA6A 3AQOA 1CPZA 3DU5A 2RQ4A 2EBEA 2KVIA 5IV4A 1CG2A 3OFEA 3EPIA 2CQIA 5E3PA 5F8JA 3DNCA 4C0OC 1PO6A 1RTDA 1RI7A 2LQ5A 2BRLA 3OBIA 1FKPB 3W64A 1X9WA 1HPZA 2ZD1A 4A8FA 1D8ZA 4KGMA 1YJTA 4F26A 1NM2A 4UUXA 3RAXA 4ZPCA 4CH0S 2XMWA 2LU1A 4F4XA 3FEYB 1WF1A 2YNFB 3HZGA 3GP9A 3P96A 3V5RA 2YWEA 1J5EF 2BOAA 2L3MA 2EKYA 4I56A 3RGIA 1RWOB 4USHA 3NAIA 2RDIA 2LDIA 3MFHA 2KJVA 1Y11A 2FLPA 4M8LA 3ENQA 1EKRA 4HACB 4QR0A 5KG4A 2PI4A 3S6EA 4WWSA 2NXNA 4YMEA 1R6VA 2KZZA 5JVHQ 3GV5B 1FKOA 1RWWB 2ZE2A 2ZZTA 1H7XA 3T3FA 1U25A 2L9WA 4DL2A 1XMOJ 1RTHA 3MR5A 5KFYA 1IKYA 4K4TA 1S48A 1OWXA 1FFSB 1R31A 2D74B 3DOLA 4FP9A 3QFWA 4ZA1A 2R7XA 4NCGB 4LBIA 1RGVA 1IKWA 3BZQA 3HHKA 2H65B 2YQ0A 2X1AA 2ZH3A 5EDWA 2IM0A 3HHDA 1FNMA 4CO4A 1REVB 2NXJA 3RB6A 1TKTB 3H4BA 1FXDA 1P1TA 3H40A 3MPUB 2DHHA 5CZVA 4ED8A 4USVA 5L1IA 2KH9A 3MECB 2RE1A 1H73A 1IM6A 1N0UA 2ZKTA 2CQPA 3NLCA 1IJFB 3VAMA 4DR3J 4CWBA 2R42A 2ZC3A 2ATCB 1TK8A 4DG1B 4LF9F 4Z2XA 2DIUA 2DXFA 2W2PP 5HLFA 2R2SA 3LA0A 3NGKA 4JV1A 2G13A 1X9SA 2VV5A 4IFYB 3U27A 4ZHRB 5C7PA 1AUSL 3F56A 1G7CB 2DGWA 4OZJA 3FRYA 4P9SA 3MUVP 1C0TB 5A6PA 3CCQS 2A3JA 2CPHA 2GAHC 2Z4PA 3GSIA 3M4XA 3MCNA 3BBCA 2M3DA 5CQGA 3TR5A 1HHQA 1VQLS 3LP2B 1RT5A 2DGUA 4ZP7A 5DQIA 1RT1B 5A8KB 1FK9B 5CYQB 3M2UA 4EWTA 2O66A 3J7ZT 5GAGU 3NGTA 2ZUGA 3R5JB 4MTPA 2W9AA 1RLDA 1XNQJ 3C6UB 2NR0A 3MM6A 1ICEB 2OD6A 3GFZA 3UD5A 4OJGA 4OJHA 1XC9A 2QIFA 1N33F 1NK6A 2EW9A 3ICLA 4N8NA 1X0PA 3CGIA 3NG8A 1S6PB 1R0CB 3D1QA 4NYZA 1FDNA 3C66A 4RL1A 4JI6F 2KT3A 1RLCL 4NE9C 4YB6A 2MY7A 3GFHA 1F2HA 3PHEA 5A8WB 2IVFB 4V19X 3W60A 1AZSB 2R9LA 2MQPA 4H4KC 3DKDA 4P72A 5B0CA 4ZLNA 3HMJG 2FJXA 1YJ9S 4USIA 2IYIA 3FZ2A 4NLXA 5SZTA 4B3TF 4CRJA 4XDCA 3NGUA 1QAIA 4LFBF 1OS5A 2WONA 2OLWA 4DR3F 2ROPA 3HM9A 4WU2A 3A3PB 3DDKA 4JI2J 3UW1A 2BMBA 2UUTA 3NOGA 1C0UB 4DL6A 1UW9A 3TYTA 1X4GA 1I94J 1TL1B 3HJVA 3J7YI 2JVOA 4F8RA 5LOQA 1VDHA 4G1QA 3D6HB 2BKOA 3CXCR 2ZHBA 1SCJB 4CLZA 1KSPA 1TL7B 4NPOA 3GZ7A 1FNOA 3Q83A 4MKBA 3CUNA 4FS1A 2E29A 3FFIA 5KFPA 3CDEA 2W2MP 4IQMA 3KUGA 2BANA 4OYZA 4ANDA 4CIOA 3BSOA 3PX0A 1FA0A 4OI2A 4ECWA 1REGX 4YY3J 1HBUA 1SVDA 5KFDA 1U2CA 4H4OB 4YB7A 1RADB 2XB2D 4CYUB 1U02A 3B4MA 4RX6A 2XCPA 3EGWB 2LCWA 2YWKA 3ISNC 4DWIA 1E6YA 3JQJA 2BJ9A 4AXJA 4FYVB 1DJ0A 4WZQA 4Z7YA 2O1PA 1S49A 2ZH8A 1LEOA 3TVZA 2GV1A 4FPRA 3N28A 1PJ6A 1MU2A 1RBOB 2HQFA 4DDFA 1VQKS 1RAIB 3G6YA 3CMQA 3LTOA 4DV0F 3RW6A 4JV2A 3RB3A 2XYHB 1CVJA 3SFUA 4WP8A 3KK1B 1F3VA 5B0DA 3DRRB 1IQZA 3O3LA 1PCAA 3K2YA 3T19A 4AL7A 1RKJA 5FJ4A 4BC9A 1NO8A 2BM1A 2Q66A 2HLTA 3JSMA 3T5HA 3JQKA 1PKUA 1PYTA 3LF0A 4BHQA 1BE4A 2J7WA 1Q8BA 1SUQB 2MTLA 2HGMA 3HSDA 1YWXA 3M8RA 2ZITA 3WX4A 4LRCA 1S6PA 1DURA 2WB4A 4CLKA 4DQRA 1NJZA 4WKRA 1CJUB 1JMTA 1HNIA 4ED0A 1LWEA 4GKKJ 3UI3A 1N4LA 3OLAA 4O4GB 4F3OA 3C6UA 4RWXA 4NXMF 2CQDA 2LDYA 2QGFB 1Q4RA 4J37A 1PIEA 2HS4A 1X4CA 4G1PA 2CAJA 3D6MB 5BYRA 3PZPA 1YJNS 3J81j 5CYJA 2MZSA 4JYAF 3W5YA 3PYDA 2E7VA 3DOKA 2G0JA 3C19A 3DMJB 3ENWA 2WAQD 2UP1A 1R89A 4PZVA 2DD8S 5F41A 3QJJA 4IFVA 2ZDPA 4A8WA 3OD2A 4LVOP 2HQDA 3CCZA 5HL7Q 4J9SA 5DG7A 1WI8A 3NEKA 1RBLA 5HK4A 4M95A 2DYAA 1HNWJ 1EZZB 4MIAA 1WF2A 2PD1A 2GIFA 4QU7A 2VL1A 4KFBA 2ZZMA 2XWXA 3GJQB 2V8DA 2XY5A 3DOMB 3TQ1A 4PG8A 5GAHI 1AW0A 2NQPA 1KLNA 2H9ZA 1TKZA 4B3RJ 3KMQA 1GH8A 3QZ7A 1MROB 3ETMA 2VKRA 3MGJA 5F8MA 1WKLA 1TKTA 7AT1B 4BC7A 4L75A 5E7OB 1APSA 1ZYQA 5D4OA 3Q2TC 4ZN3A 5CH7B 4A8KA 5J2NB 1YIJS 3NS7B 4HHUA 1K73T 4KBIA 2VONA 1IM4A 5L8RC 2XULA 4DSKA 1RCOB 4ZVPB 4J91A 1IKYB 1GX6A 2J6TA 2A18A 1BQNB 2RU9A 2AV5A 2KXHA 4NLSA 3MUMP 2QYGA 4KSEB 2HHVA 1RHRB 1HQUB 2V34A 3CJ2A 1N88A 4JI2F 2KM8B 2HBQB 3BSCA 4ATNA 2CJYB 2Z2YB 5DLGA 2CPJA 1TUWA 3D6FB 2C3OA 1LK5A 2DGXA 3C6TB 5IC4B 4USKA 2L41A 1N34F 3BF4A 2HQCA 3QGHA 4TNOA 3HP6A 4DLGA 4JI1F 4LBHA 3HCXA 5E3AA 1YK9A 2VG5A 5DDOC 2YNHA 2HURA 4Q5VA 2APOA 4LRFA 3NAHA 2FJEB 2E9TA 2IMWP 1S6OA 2K7JA 4IO1A 5KG5A 5LXRA 1U1QA 4B3TJ 1NJWA 2C3UA 1DQ9A 3PG9A 4IG3A 4M5DB 4OYPA 1S9GA 1WD6A 3FVYA 5AE3A 2GIQA
chains in the Genus database with same CATH topology
3MAAB 5IV4A 4OYAA 4CM2A 5IV3A 4WPAA 1FX4A 2W01A 1TL7A 4USTA 4CLYA 4OYMA 2GVZA 3C16A 3C16B 4CM0A 1CJKA 4CLLA 2QV6A 5D0RA 3ET6A 4CLFA 1Y11A 4WP8A 4OYOA 1CJVB 1YBTA 1WC4A 3C14B 1YBUA 1Y10A 4CLTA 4CLKA 3C14A 1CJUB 4CLPA 1CJTA 4OYBA 1AZSA 1CJTB 1WC3A 5D0GA 4USUA 3MR7A 4OYWA 4USVA 5D0HA 3ET6B 4NI2B 5D15A 4P2XA 1U0HA 3C15A 1U0HB 2GVDA 1CJUA 4OYXA 4OYIA 2WZ1A 1WC0A 1CJVA 1WC1A 4OZ2A 4CLSA 3UVJA 4WP9A 2GVDB 4P2FA 3G82A 4CLUA 2GVZB 1AZSB 1CULA 4USWA 4OZ3A 4P2MA 2BW7A 1FX2A 1WC5A 1AB8A 3UVJB 4CLWA 1CJKB 1YK9A 1WC6A 4NI2A 3C15B 4CLZA 4WP3A 3G82B 1TL7B 3MAAA 3R5GA 1CS4A 5D0EA 1CS4B 4OYPA 1CULB 4OYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAA B;  5IV4 A;  4OYA A;  4CM2 A;  5IV3 A;  4WPA A;  1FX4 A;  2W01 A;  1TL7 A;  4UST A;  4CLY A;  4OYM A;  2GVZ A;  3C16 A;  3C16 B;  4CM0 A;  1CJK A;  4CLL A;  2QV6 A;  5D0R A;  3ET6 A;  4CLF A;  1Y11 A;  4WP8 A;  4OYO A;  1CJV B;  1YBT A;  1WC4 A;  3C14 B;  1YBU A;  1Y10 A;  4CLT A;  4CLK A;  3C14 A;  1CJU B;  4CLP A;  1CJT A;  4OYB A;  1AZS A;  1CJT B;  1WC3 A;  5D0G A;  4USU A;  3MR7 A;  4OYW A;  4USV A;  5D0H A;  3ET6 B;  4NI2 B;  5D15 A;  4P2X A;  1U0H A;  3C15 A;  1U0H B;  2GVD A;  1CJU A;  4OYX A;  4OYI A;  2WZ1 A;  1WC0 A;  1CJV A;  1WC1 A;  4OZ2 A;  4CLS A;  3UVJ A;  4WP9 A;  2GVD B;  4P2F A;  3G82 A;  4CLU A;  2GVZ B;  1AZS B;  1CUL A;  4USW A;  4OZ3 A;  4P2M A;  2BW7 A;  1FX2 A;  1WC5 A;  1AB8 A;  3UVJ B;  4CLW A;  1CJK B;  1YK9 A;  1WC6 A;  4NI2 A;  3C15 B;  4CLZ A;  4WP3 A;  3G82 B;  1TL7 B;  3MAA A;  3R5G A;  1CS4 A;  5D0E A;  1CS4 B;  4OYP A;  1CUL B;  4OYZ A; 
#chains in the Genus database with same CATH topology
 2Z57 B;  4DR6 F;  1X4A A;  4WE1 A;  3FQL A;  1EHW A;  4I68 A;  4H4M A;  1EET B;  1IKV B;  1L5U A;  3TOQ A;  4M5I A;  5HMX A;  3KK1 A;  1L3U A;  2BBE A;  1F9E B;  2B9Y A;  2GML A;  4KR0 B;  4Y34 A;  4AL5 A;  2ASY A;  1FX4 A;  2M88 A;  4ZK7 M;  3CC4 S;  3HVR A;  1OSC A;  5KFM A;  5HBM A;  4B08 A;  3BDE A;  4MFB B;  3FK4 A;  1C2P A;  4DL5 A;  1X4H A;  4QOT A;  2OKQ A;  1UL3 A;  4UQG A;  4DV0 J;  1VBY A;  1Y3K A;  1Z2L A;  3SDE B;  2GHV C;  4FYW B;  2CVI A;  3WZ0 A;  4C8M A;  5IC6 B;  4R8U A;  3BJY A;  4K4Y A;  5IZH A;  4DS4 A;  1NUE A;  3TUP A;  2DNK A;  3UN3 A;  1ZZN A;  4IOB A;  5G4D A;  2UUC J;  1ROF A;  4ZVG A;  2VHG A;  4DR7 F;  4Y2M A;  1A0O B;  1UA0 A;  4USJ C;  2V2Q A;  2VBX A;  1X7V A;  4LRE A;  2DO4 A;  4ZN1 A;  2XM3 A;  3QZ8 A;  4DSE A;  2JVR A;  3H59 A;  1Y0H A;  1SBR A;  4DPU A;  4RNF A;  5L39 A;  4LMZ A;  1PYS B;  2HVH A;  2ACM A;  3VWS A;  3ZTS A;  3JSB A;  3ZZO A;  4ES3 A;  2AHO B;  3QFH A;  2QN6 B;  2QL5 B;  2POK A;  2IAJ B;  1PBA A;  5T7L A;  4LF8 J;  1MMN A;  2NSB A;  1TEL A;  3MM8 A;  1DTT A;  1FER A;  1LW2 A;  3JAM Y;  4JI4 J;  1Q7Y T;  1JLQ B;  1K1S A;  1MWY A;  2E9R X;  3L7P A;  2EG1 A;  3PIO Q;  5KT3 A;  1C0U A;  1X9M A;  4AL6 A;  1HI8 A;  2CPF A;  3IBC B;  3W8P A;  1FEH A;  1M5V C;  3LOU A;  3Q23 A;  2AEJ A;  2W9B A;  4TU7 A;  1RXO B;  1WNE A;  3HT0 A;  1FE4 A;  4TY8 B;  4F50 A;  4JI3 J;  2D7S A;  2NXC A;  2MKJ A;  2HFU A;  4EUV A;  4CDI A;  4OFZ A;  3M9M B;  2ZH6 A;  1U1O A;  2E5L F;  3CJS A;  3H25 A;  2RKI B;  1SH0 A;  4QIW D;  5HQL A;  2V2K A;  4CNZ A;  1BGX T;  3C15 A;  1NAQ A;  1F60 B;  1TUG B;  2J7U A;  3OL6 A;  4ZP8 A;  3MED A;  1SC1 B;  2LLZ A;  3FBE A;  2QL9 B;  5DQH A;  3N9U C;  3OVA A;  4N8O A;  2XI3 A;  4DR2 J;  1B0V A;  2OAU A;  3AH6 A;  4QW8 A;  3HHL D;  1S72 S;  3UR0 A;  2VQE J;  1HBO B;  1SIW B;  3LP0 A;  1SQG A;  1TV6 B;  2F4F A;  3O8W A;  5IT0 A;  1U1L A;  3RR8 A;  4PAA A;  2MKS A;  4OHZ A;  3HHE A;  3ZNJ 1;  2UU9 J;  1OJ4 A;  4NXN F;  1EAY C;  3JTN A;  4LF8 F;  2PC6 A;  3IRX A;  4Y0F A;  2RQC A;  5HJY A;  3RBE A;  2QA2 A;  3ISN D;  1VLO A;  2YKQ A;  1RSC A;  4KIA A;  1WTF A;  2OPS A;  2DB1 A;  3QT7 A;  2BM0 A;  2KB2 A;  4PPD A;  5EX0 A;  2ZBQ A;  5KFR A;  3V81 A;  3VAJ A;  3B54 A;  3MPD A;  4WE1 B;  1JLQ A;  2OIH A;  3FKB A;  3MR3 A;  1RT2 B;  2CKW A;  2I2Y A;  4ZCK A;  5DZ6 A;  2NPF A;  3I4H X;  3BV8 A;  5A8W A;  1VK3 A;  3V4I A;  3BGO P;  4J90 A;  4QWB A;  4LRB A;  2RRB A;  3PM9 A;  1CLF A;  2HQI A;  4KB7 A;  2XSJ B;  1VQO S;  3KNG A;  2J0Q D;  5L9N A;  3WC0 A;  4DCO B;  4PG4 A;  1EIY B;  2HPU A;  1ELO A;  3C15 B;  4NEY A;  4WP3 A;  4P71 A;  2CZ9 A;  2ZOM A;  2Q79 A;  4KV8 B;  2JLG A;  4K4W A;  2DNL A;  2QFI A;  1NK0 A;  1HHT P;  4DN0 A;  4FVC A;  3G4S S;  2LEC A;  3QIP B;  3PYF A;  5D3G A;  3UN5 A;  3GR1 A;  2Y0S D;  3SDE A;  2VPW B;  4O23 A;  1ZAX A;  4HT5 A;  3FC9 A;  2KTQ A;  2V50 A;  2Y0B B;  1H0H B;  2CFX A;  3DLJ A;  5AJ3 F;  1NSP A;  1SC3 B;  2J8S A;  2MHN A;  4L6V 3;  1XN9 A;  3SSR A;  4QPX A;  5I42 A;  2AD9 A;  1JLA B;  3ZTQ A;  3I0S B;  4LFA F;  1B70 B;  3VCD A;  4DV7 F;  1RTJ B;  2U2F A;  3AY0 A;  3P4U B;  3POT A;  1NCL A;  3BYR A;  5DS7 A;  2XHW A;  5T7L B;  2QEX S;  2W8K A;  5KFZ A;  4U96 A;  3X1L B;  5ETV A;  4RW4 A;  2W7O A;  2GVZ A;  2B0G A;  4Y2A A;  4WFA Q;  2VQE F;  4ZVF A;  3IS9 B;  4HH1 A;  1TKX B;  4QJV A;  2HRT A;  4HH0 A;  5B0E A;  1WTB A;  1QTN B;  2J76 E;  2FHM A;  5EWF A;  3QWU A;  1MN9 A;  4UOF A;  3GYG A;  2DIV A;  2FQQ B;  1S1X A;  2EKN A;  3MMB B;  3U02 A;  4L76 A;  3DOM A;  4LBP A;  4IQX A;  2JOQ A;  1N33 J;  2AQ4 A;  3JXO A;  1B0P A;  4X65 F;  1CJV B;  1W25 A;  2KYZ A;  2V94 A;  4LF2 A;  3Q86 A;  1PYO B;  4M5K A;  1JJ2 R;  2FVR A;  2KJW A;  3DN9 A;  1NSQ A;  3K58 A;  2JLE A;  1YRT A;  2MLZ A;  3L7U A;  2MSS A;  2E44 A;  4IFV B;  3R9L A;  4C8Y A;  1RTI B;  1X5T A;  2ZEJ A;  1ZTW A;  2W9C A;  2XCA A;  2WW4 A;  2OI2 A;  2VB6 A;  1HI0 P;  3BR9 A;  1N5V A;  2XO6 A;  4KY3 A;  1H3D A;  1TMM A;  1G4C A;  4O4G A;  1HR0 J;  1EQM A;  1BXN A;  4ZIW A;  5IFM A;  3V6D A;  3RB4 A;  3I5A A;  2IMO A;  1UCN A;  1UVN A;  1Y00 A;  3I5C A;  5KT5 A;  2XGQ A;  2FHK A;  3L7O A;  3W2V B;  3B78 A;  2VOO A;  2JSX A;  3CD5 A;  4RW8 B;  1UVM A;  1FE0 A;  1GTH A;  4DF4 A;  5HJX A;  3IAM 9;  1BWE A;  2AX1 A;  1JKH B;  1NHK L;  2QX0 A;  1NK4 A;  5KFV A;  4K4V A;  3K5P A;  4NLP A;  1V3S A;  3H8Y A;  4F0M A;  3EZU A;  3QSY B;  1R27 B;  4LIW A;  4CT8 A;  5GVQ A;  1JLB A;  1T9U A;  3C6T A;  1HWU A;  1RT2 A;  4ENO A;  1WC0 A;  2GW8 A;  2ZJR Q;  1VI7 A;  4URS A;  3HSG A;  3OL8 A;  3MMA B;  4B3S J;  4QWD A;  3KJQ B;  4F4W A;  2R3V A;  4CLS A;  2EEY A;  4ECY A;  3Q8P B;  1S0M A;  5DGB A;  2CQB A;  2AX0 A;  3CJR A;  1Y5N B;  1WDD A;  3P6Y C;  1FVS A;  2NZC A;  2QLJ B;  2B3T B;  4EGL A;  3TAP A;  4DR2 F;  1FKA F;  1C4A A;  3ILI A;  4TN2 A;  4NXN J;  3MPV A;  2XEX A;  4HHH A;  3KLH B;  2CNN B;  3AAW B;  3W61 A;  5J2N A;  3DGP A;  1LWF B;  2DHS A;  2HHT A;  1C1B A;  2IYG A;  3MAH A;  2BAN B;  1HW9 A;  2ZBC A;  4ZP9 A;  4YDX A;  3BBF A;  1D0E A;  2IDE A;  1Y7P A;  1GQE A;  1RA7 A;  2N7Y A;  4NZ0 A;  4ZJQ A;  5F3Z A;  3V4I B;  5K8M A;  3UO0 A;  1XNR J;  1M5S A;  1IKX A;  2WK4 A;  3MM9 A;  2FDN A;  1FWL A;  5L9X A;  2ZHA A;  3BEG B;  2IBO A;  2OUG A;  3IC1 A;  3CWJ A;  2P5V A;  2DNR A;  4PYD A;  1X5O A;  4G1Q B;  1B0T A;  2V4Q A;  4QU6 A;  4WXO A;  4QWA A;  2VPZ B;  2JHE A;  4YR0 A;  1X4B A;  1FEE A;  4EO6 A;  2OPS B;  2AMC B;  2KXN B;  1QE1 B;  5HO4 A;  3BSA A;  1T8E A;  2HMI B;  4TY9 A;  2J7K A;  2C2N A;  2YNI A;  3BRE A;  3CC2 S;  2FVC A;  2Y1J A;  1CUL B;  1FRJ A;  1JJH A;  5E2Q A;  3MUR P;  2V2V A;  2K3I A;  1T9X A;  1SJ3 P;  4OQJ A;  3M6U A;  4I1T A;  3P3D A;  4NRU A;  3PIP Q;  1XMQ F;  2HAF A;  3BQ2 A;  3GYN A;  4X4T A;  2KRB A;  2Y1L B;  4DEZ A;  4JI5 J;  2G1H A;  5K20 B;  4OZN A;  4A8X A;  3LP0 B;  5KFN A;  5E3Q A;  3Q8U A;  4RNN A;  1VC6 A;  2WSC C;  2C22 A;  2RAQ A;  2P8I A;  5KG1 A;  1SJR A;  2I0X A;  1KON A;  2Y3Y A;  1FO1 A;  2F3J A;  2R7Q A;  4WII A;  2XG8 A;  7FD1 A;  2RKI A;  2ZH7 A;  5HAO A;  3EJM A;  4DR4 F;  1AA1 B;  1R7I A;  4I4B A;  2HNY A;  5E3C A;  4R8U B;  3PW4 A;  5EUH A;  1X8D A;  2KYX A;  2E5I A;  1F5B A;  2K8G A;  3HLU A;  3E8O A;  4TY8 A;  1OY8 A;  1PSD A;  3P45 B;  5KG6 A;  4OZL A;  4RW6 A;  4DU7 A;  4KE5 A;  2V9W A;  2HNZ A;  4NA3 A;  4DV1 J;  4M94 A;  3V6K A;  3GJS B;  4YB5 A;  2YKN B;  3MM8 B;  1Q0N A;  1LW2 B;  2MQM A;  1TAQ A;  3ZTO A;  3OHA A;  1RUS A;  3KK3 B;  1M5K C;  4Z7C A;  1FRH A;  2CZV C;  2XWY A;  1EQ0 A;  4X4S A;  5D4P A;  2FGC A;  3IG1 A;  4U9R A;  4DV4 J;  4K5R A;  3M6X A;  5ETP A;  2OMO A;  4KGK A;  5FLX U;  2GGP A;  4X65 J;  5LMU F;  1RIS A;  1WC3 A;  3TJA A;  3TAM A;  2IVY A;  1O6X A;  2GO8 A;  3PNI A;  2I8E A;  2VFU A;  3OHB A;  5DGA A;  1YJW S;  4FYX B;  3VQS A;  1DRZ A;  5LXY A;  3CCT A;  2G2Y A;  3M7V A;  2IC3 A;  2DY1 A;  3GIK A;  4FS2 A;  3UQS A;  3AT1 B;  4DR5 J;  4X62 J;  1KN6 A;  2ZJQ Q;  1S57 A;  4CI0 B;  1RTZ A;  3HHL B;  4DL4 A;  1HD1 A;  5D78 A;  2Z2L A;  1N54 B;  2GVD A;  4BWJ A;  1TL5 A;  2CA9 A;  1SH3 A;  4IG0 A;  2JH3 A;  3I9V 9;  2F9D A;  3L4B C;  4PYA A;  5DLF A;  1SL0 A;  2LMI A;  2V5H G;  2HGN A;  4CO3 A;  5DG9 A;  3IRW P;  3CF5 Q;  4X64 J;  2B8Q A;  4C8O A;  2BJD A;  1NDL A;  3I96 A;  3OL9 A;  4QYZ J;  4GO7 X;  1R0A B;  1MG7 A;  2I9S A;  1F5A A;  2ZFH A;  1YKW A;  1U1P A;  1N32 F;  3N5B A;  3NWR A;  2WVC A;  1O0P A;  5DO2 A;  4C2M A;  5HN0 A;  1RU1 A;  1JXL A;  1WC1 A;  3ILO A;  2KL8 A;  1YRU A;  2CJX B;  2WW8 A;  1RWV B;  4M5J A;  3RRH A;  1EP4 A;  2QFJ A;  4W4M A;  2YKO A;  3UVJ A;  1WAC A;  2H3E B;  3MEC A;  1BQM A;  3KDN A;  1WF0 A;  2V8V A;  2MZR A;  1RT6 A;  2W4P A;  2ZNY A;  3G82 A;  3HI9 A;  5RUB A;  1YX2 A;  2GVZ B;  2G2O A;  2QG9 B;  3CDW A;  2H4W B;  3DM2 A;  3MEE B;  1KQG B;  4OJ3 A;  4Q7A A;  4MK8 A;  4YHH J;  1HQE B;  3JSY A;  4RJV A;  3KLF A;  2I1R A;  5HP1 A;  1XNR F;  2KU7 A;  3NNH A;  2ZH2 A;  2AT1 B;  4IKA A;  4Y6I A;  2C2D A;  3R5A A;  1KTQ A;  2YWW A;  2BX6 A;  5E5N A;  4JI7 F;  2H5I B;  1IBK F;  2F8M A;  2HS3 A;  2PII A;  1UW4 A;  3QGI A;  4GKK F;  1U45 A;  1FJE B;  2VPY B;  3NCR A;  3S8S A;  1RWN B;  1UVK A;  2AJ1 A;  1RB0 A;  1SH2 A;  3CTR A;  3KJF B;  3Q89 A;  3BDP A;  1N5S A;  1MWZ A;  1QUV A;  2ZWP A;  3G9C A;  3QO9 B;  3A8E A;  3CCV S;  3QIP A;  2ZZN A;  4TVA B;  3PEH A;  2EFQ A;  2YPY A;  2KFN A;  2EG2 A;  3MAA A;  5ETQ A;  4O3O A;  1VBX A;  1K9M T;  4IDK A;  5B08 A;  4NOH A;  5KFI A;  3NXZ A;  4KHP F;  2CG4 A;  4P52 A;  3J81 U;  2CNL B;  2XSF A;  1NPP A;  3TEH B;  4OZ1 A;  3TZX A;  3EYZ A;  1M90 T;  2ILY A;  5LJ5 Y;  3OV7 A;  2OPQ B;  5E3R A;  1S1W A;  5AE1 A;  2QA4 S;  4U7U D;  2E5L J;  4TLQ A;  3JS9 A;  2IIH A;  4ID8 A;  3OTE A;  2EK6 A;  3R6L B;  4W98 A;  2GJF A;  2MY8 A;  5DDP C;  1C4C A;  3TUZ C;  3G6V A;  1CC8 A;  2XNQ A;  3KHL A;  4ED2 A;  1LFP A;  4E8U A;  1U1N A;  2UXC F;  4P6Q A;  3E01 A;  5LSR A;  1R3N A;  1TKD A;  1PG5 B;  1KLM A;  3W7B A;  2F8H A;  1ZA2 B;  4NLT A;  4X4R A;  4ECZ A;  4CM0 A;  1Y3J A;  3ADA C;  4RUC A;  1LWC B;  3IM9 A;  1D9A A;  3IR5 B;  5AT1 B;  2UVV A;  1S97 A;  2HZA A;  2MQN A;  2SXL A;  2IM1 A;  3PCO B;  2XMU A;  2YKM B;  3Q8V A;  3GIJ A;  1B64 A;  1QSY A;  3E3X A;  4EU0 A;  4ECQ A;  3PVX A;  2FD2 A;  2K1R B;  3R5B A;  1UPP A;  3MM5 B;  1H98 A;  4AQY F;  3SQG B;  1NLK L;  3VQT A;  1S7H A;  4ZVO B;  1IBC B;  5F0U A;  2GZO A;  2M52 A;  5EX3 A;  3VZI A;  4QIE A;  3D28 A;  4B3R F;  5U47 A;  1E6Y B;  1P27 B;  4DN9 A;  4DV1 F;  1I1G A;  1N0V C;  3N01 A;  3SCK E;  1K0V A;  2LQ8 A;  4A47 A;  2R8K A;  2B4O A;  3DC2 A;  2IRX A;  1BQM B;  1FRX A;  3KG1 A;  2KHD A;  2XNR A;  4ED7 A;  3K5O A;  3I9Z A;  4YP3 A;  3OVS A;  4WFY A;  5HVF A;  3OQ2 A;  4KFB B;  2UU9 F;  1NZA A;  3QMQ A;  3J7A N;  3T1A A;  2WSF C;  4A8Q A;  4LFC J;  1AT1 B;  3K89 A;  4OYW A;  2KT5 A;  2BE7 D;  2DNO A;  2H48 B;  2Q3P A;  3LGN A;  3PJX A;  4KGV B;  2L9N A;  4BLG A;  4RNM A;  2W9B B;  1SKS A;  2N82 B;  2DCU B;  3TJ9 A;  3GTY X;  5B7W A;  2HQG A;  4KKO A;  1TMJ A;  1S0O A;  2RSQ A;  1NBE B;  2YKN A;  2HRY A;  3GYX B;  3H5S A;  1J2V A;  4P10 A;  3WIU A;  3KHG A;  5ETO A;  2BQU A;  4RLE A;  4P2X A;  5HQ8 A;  2C3Y A;  3MEG B;  3HVT A;  4DV4 F;  3QJL A;  4J9V A;  2AF6 A;  1S1U A;  2DY9 A;  2V4J B;  3CJ0 A;  2FPH X;  3DXB A;  1UFW A;  3LAM A;  5L1J A;  2WON B;  3NS5 A;  2NRE A;  1CJU A;  1HNI B;  2XS2 A;  1ZM9 A;  2VD3 A;  1C1C B;  3DDN A;  4OYX A;  4DCP B;  5F8N A;  2D3O R;  2HFS A;  3OXL A;  4AUK A;  4QW9 A;  2DCL A;  2MZQ A;  3NOC A;  2RB7 A;  3RBD A;  3UCZ P;  3DRY A;  2F63 A;  2COL A;  2A1B A;  3D0H E;  2CPZ A;  1U7L A;  2Y1I A;  3AQP A;  3UFC X;  1DHM A;  1WDT A;  5BXI A;  4J9R A;  3UN2 A;  4Q8F A;  4JI6 J;  1KD1 T;  2ERR A;  4UY8 T;  2ILZ A;  2R7U A;  3FFI B;  1VIX A;  1HKA A;  3SI8 A;  2E1R A;  1YJ7 A;  1QDU B;  5J2P A;  1IUJ A;  1LFW A;  2QLF B;  1W2I A;  5GME A;  5HMY A;  3EUN A;  3UWT A;  4DFM A;  4DPO A;  3NMA A;  3AJD A;  3IWX A;  1UJ6 A;  1CUL A;  3CCU S;  2W4D A;  1RWU A;  1F0X A;  3IBW A;  2JDJ A;  2ZBP A;  3QBC A;  2E5J A;  4YHH F;  2MGZ A;  3HT3 A;  4J9O A;  2VG7 B;  3OW2 R;  1XEZ A;  4FNH A;  4F02 A;  2F9J A;  3I4P A;  4JI7 J;  1TAU A;  5GAE U;  2HIY A;  4ZS6 A;  1SKU B;  4KJI A;  2LXF A;  2HRU A;  3DLK A;  3OR1 B;  2GNK A;  4M5D A;  2XYP B;  4RO0 A;  1N48 A;  3KFW X;  1CBK A;  1SC6 A;  2BUN A;  1XMO F;  2DBB A;  3DLE B;  3GII A;  4PG6 A;  1SKR A;  3W65 A;  2ROG A;  1VJQ A;  4ICL A;  4DMZ A;  2AEM A;  5H9F J;  5ETN A;  5FLX Y;  2HBY B;  2OPR B;  1VS3 A;  3J81 Y;  3CUL A;  1QUP A;  1JNZ B;  2X51 A;  4OV6 A;  3LQV A;  4B9M A;  4CM2 A;  3A3N B;  1TQL A;  1U49 A;  3M6W A;  2DNH A;  1JLG B;  2LQB A;  3CJ5 A;  5KT6 A;  1M1G A;  3CCR S;  3S7R A;  2Z58 B;  5GAD U;  2KVQ E;  2YX7 A;  3M05 A;  2GX8 A;  5KFQ A;  4B9N A;  1SXL A;  4M1K A;  2EFN A;  4RBU A;  1FTC A;  1NK7 A;  1U48 A;  3HK2 A;  2OML A;  4P7V A;  1RAO A;  4NYO A;  3LWL A;  5MLC V;  5CXT A;  4CO5 A;  5ETS A;  1H74 A;  5KFX A;  5B0F A;  4DG1 A;  4X4Q A;  2C2K B;  1WG4 A;  3OTO J;  1BUX A;  3KK2 A;  4IRK A;  3CD7 A;  4DUZ J;  4HT7 A;  1DQA A;  1VQ4 S;  4AQY J;  3M32 B;  3M6V A;  4UZB A;  2VA3 A;  3WC2 A;  3L09 A;  1NEE A;  2MMY A;  2GHP A;  5B0G A;  2UVU A;  5A2Q Y;  4EZ9 A;  3E2E A;  1KVJ A;  3BGU A;  1VQ7 S;  5A2Q U;  2CZ4 A;  4HI2 A;  3T5K A;  1XIQ A;  4IR1 A;  4NXM J;  2AJQ A;  1UJ4 A;  3TP2 A;  4G3I A;  2YNH B;  2OPQ A;  4DV2 F;  4K4Z A;  2VG5 B;  2IPO B;  5KFA A;  4RW8 A;  2HFZ A;  1ZM2 A;  3C14 B;  2Y1R I;  2WVD A;  1T7P A;  1VQS A;  1YBU A;  2IHR 1;  2J0X A;  4IDK B;  1X0F A;  1T3N A;  3H5X A;  3OFG A;  2DGO A;  4O0I A;  1W7W A;  3GFX A;  5HVG A;  5ETT A;  2V68 A;  4MAK A;  3SSS A;  2DR6 A;  2OD4 A;  2C3M A;  3LW5 C;  5IT4 A;  4MYU A;  1XR5 A;  3HD1 A;  2RRA A;  3RW7 A;  3H98 A;  1Z2Z A;  3X3U A;  1HBM B;  1Z4U A;  2MPU A;  3PR5 B;  3S01 A;  4QCL A;  1CJT B;  1IN0 A;  3TI0 A;  1OQ3 A;  4USU A;  4ZPV R;  2HHX A;  1URN A;  3V2U C;  3JQM A;  4ELV A;  5D0H A;  4DFP A;  4YS2 A;  3MXH P;  5CA5 A;  3FDS A;  3AXM A;  5AJ3 J;  1K44 A;  3MEE A;  3OTO F;  4WFN Q;  3TX8 A;  3DLB A;  1JKH A;  3Q22 A;  2JEG A;  3HSZ A;  1I5O B;  1RT6 B;  4N47 A;  1T95 A;  4WJB A;  3EWG A;  5IT9 U;  2XC9 A;  4YQW A;  2DVI A;  3TZY A;  4UT4 A;  5B0B A;  1Q79 A;  1S1T B;  5I3Q A;  5KT4 A;  3JAM U;  5J2Q B;  4LF4 J;  3PV8 A;  1EP4 B;  2IM2 A;  2M2B A;  2HYI B;  2QZ8 A;  1S12 A;  1WHV A;  1F6T A;  1HAR A;  3DHW C;  1S4F A;  1MML A;  3FCV A;  5HI7 A;  1WWH A;  3TEG A;  4ETZ A;  1S77 D;  2ZH5 A;  2ALY B;  2ADC A;  4PQU A;  5M2R A;  1FFG B;  5ETR A;  2DH7 A;  3IA0 A;  2R7R A;  2WB1 D;  2HFV A;  3NNA A;  3T9Z A;  3H2L A;  4KPC A;  1BD6 A;  3DMJ A;  2N4D A;  4WP9 A;  2GVD B;  1YJR A;  1HQU A;  2CQG A;  4P73 A;  3TNV A;  3CC7 S;  1HWL A;  3CME S;  2PT0 A;  3M2R B;  4U7U K;  2QL7 B;  1U1M A;  1NJX A;  3P49 B;  1TU0 B;  3ILL A;  2HBR B;  1GXL A;  2HHQ A;  2EPI A;  1RT4 A;  1GMW D;  1P8G A;  2QRR A;  1FD2 A;  2DNP A;  2R8J A;  4P2M A;  1N5Y B;  4B02 A;  2IA0 A;  2YNG B;  5DZ7 A;  2GFF A;  5FDL A;  3PR4 A;  1NRK A;  1M5O C;  1RZM A;  4OLP A;  1RWP B;  3CVK A;  4OHV A;  5AXN A;  2KN4 A;  2XSJ A;  2UV8 G;  2K06 A;  1U6Z A;  4N56 A;  2PSZ A;  3DLK B;  4ZKA A;  3IO1 A;  2DHG A;  3DRP B;  1F9H A;  1GXT A;  5CZX A;  2XLJ A;  4EYH B;  5J1E A;  4LQ3 A;  1BWV A;  3HHL C;  4RW4 B;  3WBZ A;  3PW0 A;  1U24 A;  5A8R B;  1UZH A;  4ZPW R;  4W92 B;  4QR2 A;  2B4U A;  4U67 Q;  2ABY A;  2MZJ A;  2P2C B;  1ZAW A;  3M30 A;  5IWA J;  2LXU A;  3O44 A;  4W90 B;  1KKH A;  2B4P A;  2RNE A;  3RB0 A;  2RML A;  1XNQ F;  4JI1 J;  4EEY A;  2ZKU A;  4ZCI A;  1QY7 A;  1W26 A;  2GJ2 A;  5IQQ A;  2VA2 A;  1PAU B;  3CO0 P;  2IY5 B;  3EVO A;  1RT7 B;  5MAO A;  4B9S A;  4F4Y A;  4C8Z A;  4Y65 A;  4CO2 A;  5IQ6 A;  5KG7 A;  2GCF A;  2DJW A;  2JC1 A;  1SV5 A;  3QLH B;  4ES2 A;  3AJ2 A;  2DIT A;  1NKE A;  1PJ5 A;  4NA2 A;  2R2U A;  4KHR A;  1F5C A;  1FWP A;  3R5C A;  2D1C A;  2XYG B;  4I2P B;  3A8I A;  1TL3 B;  3CT9 A;  1Q8L A;  4J5O A;  3K5L A;  4BCA A;  4WYW A;  4DV6 J;  2Z0G A;  2W2O P;  3KLG B;  2RT3 A;  2EFP A;  4M63 A;  2MQQ A;  3RAM A;  1NXI A;  4OI1 A;  3F73 A;  2CVE A;  4X4O A;  3PX4 A;  1GMV A;  3D68 A;  1HMV A;  3QT8 A;  3RR7 A;  2R7V A;  4NZ6 A;  1VQN S;  1VHI A;  4DOZ A;  1FK9 A;  5CYQ A;  3HZE A;  5DM6 Q;  2ZH9 A;  4C3L A;  3MEG A;  4YFU A;  4OIX A;  4FPI A;  1GFW B;  4C6A A;  1YBA A;  1FCA A;  2B51 A;  5GAE I;  2CNO B;  1L3S A;  4FF2 A;  3V81 B;  3P5T L;  5J1P A;  1N36 J;  2MQ8 A;  3OVB A;  2MQO A;  1QE1 A;  3DRS A;  4LRA A;  5IWA F;  3KLE B;  2HMI A;  3H7H B;  2X1G A;  2WHO A;  3AOA A;  3AD9 C;  1KFS A;  4C8N A;  3OR2 B;  4NLW A;  3OL7 A;  2IJN A;  3KJV B;  3U1N A;  3R97 A;  3V4M A;  3IR7 B;  4DFJ A;  4KPY A;  3HSJ A;  1J5O A;  3UR3 C;  2G0C A;  3MUT P;  2IAJ A;  1XJW B;  3KMS A;  3MR7 A;  2KZM A;  1HBO A;  4FKX A;  1TUV A;  1N5T A;  3VGS A;  3MTK A;  3UNG C;  2X7I A;  3MCM A;  3DFE A;  3A12 A;  4MMO A;  3BPD A;  4A8S A;  1U8S A;  3HUL A;  2CQ2 A;  2H54 B;  3K8W A;  4YN3 B;  5F9N A;  4GC6 A;  3KNA A;  4RW9 B;  1N34 J;  3C2P A;  4LF7 F;  4JI4 F;  1UVI A;  5GAG I;  1KHV A;  1WEX A;  1U0H B;  3FJ2 A;  2E9Z A;  1IWG A;  3GFY A;  1LQ9 A;  1DY3 A;  3QRP A;  2V8H A;  1UEV A;  1CC7 A;  2E7X A;  4ECV A;  4P7T A;  2FLN A;  3TAQ A;  2HVD A;  1KR4 A;  1FDD A;  3N4W A;  4C0B A;  2C2M B;  4I0W A;  1C0T A;  4KYZ A;  1NK8 A;  1S1U B;  2V4J A;  3CCE S;  1NND A;  4HLB A;  5KFS A;  3AB2 B;  2MGZ B;  5KFT A;  2F1F A;  2X3D A;  1KWM A;  4TLR A;  5HBM B;  3ZFV A;  2BA9 A;  5K8O A;  3P5B P;  5A0Y A;  4LF9 J;  1VK8 A;  2P9G A;  1S1V B;  1YHQ S;  2YX1 A;  3GV7 B;  5A8R A;  3M9N B;  1WSV A;  2G9O A;  4NLU A;  3W8G A;  1V9O A;  3PDN A;  1NSK L;  4I6W A;  3FEX B;  2RDD A;  5J2P B;  3QAT A;  1X5P A;  4EBC A;  3US5 A;  3DRP A;  1SJ4 P;  4B3M F;  2UUW A;  2AYB A;  1JIH A;  2AJ4 A;  2E5H A;  1WHY A;  3H2U B;  4F36 A;  4F0K A;  5KFB A;  3L9Z A;  3ZO7 A;  1REV A;  4TYA A;  5A6W A;  1S9G B;  3GPA A;  1ZET A;  3CE8 A;  4YEA A;  4ZPT R;  4UZC A;  2B4V A;  5K5M A;  2J9D E;  4BBY A;  6FDR A;  1VQ9 S;  4K50 A;  5CD4 A;  3T5L A;  1WG5 A;  1YJU A;  1S0V A;  2GHW A;  1SV5 B;  2LU2 A;  3QLH A;  2K7K A;  1C1C A;  3BGL A;  3V6D B;  2QYC A;  2FVS A;  2OEK A;  2NXU A;  2AJ0 A;  2CWX A;  1FNX H;  2FJW A;  1HNW F;  2AYG A;  1D3W A;  1RHJ B;  1Y5I B;  4I2Q B;  4P2S A;  1KQF B;  1IBL J;  3GIR A;  4LSL A;  3D1H A;  2VQF F;  2EFO A;  4KHM A;  3K0J A;  2CNK B;  5THW A;  1UVL A;  4Q2M A;  4X4U A;  3U1M A;  4C8L A;  4PPZ A;  2VOD A;  3PKY A;  1YDL A;  3N6M A;  2KXF A;  4DPY A;  3D3B J;  4RNO A;  4NLG A;  2JFD A;  1N56 A;  2E1M C;  1NDK A;  5EWE A;  2O5D A;  1NJY A;  1D8Y A;  4PQU B;  4H4M B;  3BBB A;  5DDR C;  5LMU J;  2LEP A;  2OHD A;  4HTJ A;  1Y4Z B;  4IRC A;  4Q0B B;  4IH6 A;  5KFH A;  1HPZ B;  1QM9 A;  2B9E A;  4UST A;  4BS2 A;  3BH6 B;  2JWN A;  1I51 B;  5J2M B;  1H2U X;  1O8B A;  4FBT A;  2QMU B;  2A6O A;  4U95 A;  2B9W A;  3PW7 A;  2XTJ P;  1NPR A;  4J9L A;  3CJ8 A;  2HND B;  4URG A;  3J7A 1;  1JQG A;  1UFK A;  4KTQ A;  4MKA A;  2Z2M A;  1MNE A;  2HEK A;  2LQJ A;  3A1Y G;  3KDO A;  4NMX A;  4OZ0 A;  3MM5 A;  4CH1 A;  3PKM A;  1HIY A;  1JLA A;  1G3O A;  1L3T A;  4GVB A;  2DKO B;  1WC4 A;  2QMX A;  1FKO B;  4N76 A;  5DM7 Q;  1T05 A;  3CED A;  1N36 F;  2VFV A;  2FUG 9;  3QYY A;  1HYS B;  1WHX A;  1IR1 A;  2C2O B;  3FRZ A;  3I5B A;  5M2P A;  2AEF A;  2V8G A;  3C46 A;  4OHY A;  3BKF A;  5J2Q A;  3NCQ A;  1U2F A;  1DLO A;  4ECS A;  2NYH A;  3PXG a;  5HMZ A;  1S9F A;  2NLW A;  1LV5 A;  3NGS A;  3C14 A;  1VQP S;  1PGZ A;  1GMW A;  3G87 A;  3HO1 A;  1LNQ A;  3QPI A;  4WK1 A;  4OYB A;  2CPX A;  3EGN A;  4ZIV A;  4NEZ A;  2WBR A;  1EKS A;  2WVF A;  3ULH A;  3VZH A;  1UVJ A;  3RBZ A;  1RHU B;  4OI4 A;  2J0W A;  3MF5 A;  4OX9 F;  2FC9 A;  3I31 A;  3J80 Y;  5F9L A;  2PMZ D;  2XMV A;  1EJ7 L;  2HQ3 A;  4DQQ A;  1HNX J;  2OEM A;  2ZBR A;  3D3C J;  4U8Y A;  4Y28 C;  2AJ2 A;  1VC5 A;  3I0S A;  4RW7 A;  4Y3C A;  4XDD A;  4U8V A;  2HNZ B;  1JWW A;  4O3N A;  3IAS 9;  4ANC A;  3IWN C;  4DV5 J;  2ZHO A;  3OXF A;  3T1H F;  1RAF B;  2M70 A;  2RF2 A;  1MWQ A;  4ID5 B;  4ZJL A;  4DSF A;  2PI5 A;  1HBM A;  4IOA Q;  2UUC F;  3PX6 A;  2FVQ A;  4F3Q A;  4ZLL A;  4R0J A;  2LFV A;  3THP A;  2FJV A;  4ZIT A;  5C25 A;  3AFG A;  2XZD B;  1SJ1 A;  3KLI B;  3AA8 A;  4JV5 J;  3D66 A;  3EMT A;  3O1L A;  2BDP A;  4PWD B;  3SCJ E;  1GEH A;  4OZ2 A;  3NKY A;  4U7C A;  1DFD A;  2IC3 B;  4RU2 A;  4QIF A;  4RR5 A;  3PRB A;  2KDO A;  2QE5 A;  3K7R A;  3FGV A;  4Y2I A;  3DLL Q;  4Q44 A;  2HK2 A;  4LR7 A;  2B6A B;  2P9C A;  3T9N A;  2ASJ A;  3CDB A;  1LW0 A;  1ULR A;  1FVQ A;  4C8K A;  3LAL A;  1SQE A;  1U2R A;  1WSR A;  2FHO B;  2CDR B;  2KT2 A;  4PXE A;  3N6L A;  2DPI A;  3R1H A;  3FBF A;  1UEK A;  4PXC A;  3GJT B;  2XGP A;  5C42 A;  2HVZ A;  4UOG A;  5KFW A;  2BJ8 A;  4DSI A;  1EX8 A;  2ASD A;  2ATL A;  4TQR A;  3ENA A;  3KLV A;  1NKB A;  1WEY A;  1WUU A;  4Q2L A;  2KG0 A;  4J9M A;  1S99 A;  1FI4 A;  1Q8I A;  2YWF A;  5K9F A;  4JI3 F;  2RS2 A;  4F2S A;  3RJM B;  3CCJ S;  5F3T A;  2KHC A;  5A0Y B;  4FXW A;  1VRU B;  4DU8 A;  1UET A;  3HKZ D;  4DI6 A;  1Q78 A;  2R8H A;  1ZS6 A;  1FRL A;  4BWM A;  1MW7 A;  1RHQ B;  2H5E A;  3P8B B;  4C3M A;  2NUU G;  1RAG B;  1DTQ B;  3CJT A;  3HD2 A;  2YVS A;  5K14 A;  3W2W A;  2L08 A;  2GC8 A;  3D54 A;  4OX8 A;  2E66 A;  2M8D B;  5GMK a;  2HHH J;  3HFZ B;  2P6T A;  1IBL F;  4IH7 A;  3MOJ B;  2HLU A;  3T5J A;  1V5V A;  2BVZ A;  4OMF G;  2BEF A;  4R5P B;  4CYU A;  1Z1Z A;  4PG5 A;  4JI5 F;  1NME B;  3D0I E;  4J9P A;  4FYD A;  4KAI A;  1UWA A;  1M0S A;  3DGP B;  3W1Y C;  5IV3 A;  5CCL A;  5KFE A;  4ALZ A;  4WPA A;  2HBZ B;  3TAM B;  5H9E J;  1HR0 F;  3M2V B;  2QA4 G;  2F7V A;  4CO1 A;  4C0H A;  2YX4 A;  4LJM A;  3PO5 A;  3F41 A;  2B5J B;  1RKI A;  1CSJ A;  3OTD A;  4LSN B;  1SB6 A;  2O3D A;  4HDH A;  1VQ8 S;  3T6B A;  4NLV A;  1OSD A;  1TL7 A;  4FVM A;  4CLY A;  5K14 B;  3Q8R B;  3IM8 A;  3KK3 A;  2YH0 A;  5HRO A;  4URQ U;  1WEZ A;  4WF9 Q;  3Q2S C;  3UCG A;  2EK1 A;  2NPI A;  1XMQ J;  2FLL A;  3OR2 A;  1VLY A;  4LIR A;  2WBM A;  3ET6 A;  1JLB B;  1H6K X;  4C7Q A;  2RVJ A;  2AZ1 A;  1M1H A;  4DFK A;  3IMQ J;  1EET A;  2RDJ A;  3QAU A;  2HW3 A;  2HG4 A;  1P6T A;  3EDQ B;  2GAG C;  4PUO B;  3EM1 A;  2CRL A;  4MT1 A;  1VR6 A;  2WOM A;  2VZ9 A;  2L48 A;  3BO3 A;  1JLE A;  1KNZ A;  3MCS A;  4XPE A;  3UNY A;  2OEL A;  1Y10 A;  2FJD B;  4L74 A;  2J9E A;  4FXV A;  2AW0 A;  2O67 A;  2B6A A;  3U1L A;  1UA1 A;  3T41 A;  2FYX A;  2BAC A;  3SQO P;  4WFB Q;  4CLP A;  3VV2 B;  1LWF A;  2VC0 A;  2VH7 A;  4MKY A;  3ZZR A;  1RT5 B;  2DT9 A;  1GXU A;  4OX6 A;  3PY8 A;  1RT1 A;  3SQG A;  2UV8 A;  5A8K A;  2J6S A;  3RUB L;  2HWI A;  2MKK A;  1PAE X;  3NBP B;  1N52 B;  3UDC A;  1SL1 A;  1RTH B;  2GQQ A;  4MIB A;  2VU5 A;  3J7Z 5;  4N77 A;  1X4D A;  4ZPA A;  3Q0A A;  1IBM F;  2I6W A;  4LF5 F;  1HYS A;  4X4V A;  4DV5 F;  1BQN A;  1TR0 A;  1HNX F;  2QA1 A;  5HLF B;  3ZC4 A;  4NML A;  2BE9 B;  3NMR A;  4QYR A;  4DL7 A;  1A9N B;  2IDL A;  1JK9 B;  1TVR B;  3E01 B;  5HQM A;  1T9W A;  1KLM B;  4DL3 A;  3TW0 A;  3RG6 A;  1YZ6 A;  4H4K A;  1S1T A;  4L73 A;  3SIP B;  3V6H A;  1HQE A;  4OHX A;  2DXD A;  2RHQ B;  3KLF B;  1TFW A;  4F04 B;  1XER A;  2B56 A;  2XZW A;  3EIC A;  5CAB A;  2A0F B;  3IR6 B;  3MPY A;  1TKZ B;  1NSA A;  1PJ7 A;  2HSE B;  4JV0 A;  5D8H B;  2QC3 A;  3TVY A;  1N32 J;  1Y5L B;  4ECX A;  3RBX A;  4ECT A;  3DDI A;  3TUJ C;  4RUH A;  1VBZ A;  4Q0B A;  1W2B R;  1M1K T;  3VHQ A;  2XMJ A;  2CQ4 A;  4NCG A;  3TZZ A;  3QQC D;  4KGX B;  3D9B A;  2D3Z A;  4MK7 A;  4DQS A;  1V6H A;  2DGT A;  2ZVI A;  4NAS A;  3RRK A;  3UDV A;  3K17 A;  3AOC A;  3FMB A;  2JNJ A;  3JSR A;  4PWU A;  1U1K A;  3I82 A;  3DLH A;  8RUC A;  1QSS A;  4XIU A;  1VIO A;  4WIQ A;  3G96 A;  1SKW A;  3CCS S;  2Y8W A;  4LF5 J;  2OSR A;  1TZ0 A;  1GMU A;  4I2Q A;  3M9O B;  1HWI A;  3TA2 A;  4M5H A;  1VOM A;  2BR0 A;  1AB8 A;  3D6T B;  1VIS A;  3B8H A;  5CCM A;  4LVN P;  1OYD A;  1HI1 A;  2VFR A;  5KOX A;  2CPD A;  4JI8 F;  3FBC A;  2YY3 A;  1WC6 A;  3RYL A;  2E1P A;  4DV2 J;  2YQ3 A;  2Y9H A;  3G82 B;  2HZV A;  3T1Y F;  3O5T B;  4KHP J;  3SZ2 A;  1SUQ A;  3DLE A;  2XMA A;  5C24 B;  5FII A;  2K2P A;  2QO3 A;  2B8P A;  2AYM A;  2BKN A;  1VYA A;  2W24 A;  3ISZ A;  4DHV A;  1R43 A;  3GWC A;  2AU0 A;  2CG8 A;  2QT7 A;  4K59 A;  1X5S A;  2W2N P;  4PUO A;  3MAA B;  3MR6 A;  3H2V E;  3H5Y A;  1HQ2 A;  4CT9 A;  2MB0 B;  3RRG A;  2C1E B;  4O0N A;  4FXD A;  4DX6 A;  3CD0 A;  3EZO A;  2FY1 A;  1T9T A;  1XMB A;  3O6Q A;  2Z30 B;  4DPW A;  4I7F B;  5CYM B;  4A8M P;  2CDQ A;  1H2T Z;  3IRX B;  2LP4 A;  4NLY A;  1SJQ A;  1ZPV A;  5LSL A;  3AXK A;  3CIM A;  4IG0 B;  2CQH A;  1U4B A;  3L95 X;  4QIV A;  3AHP A;  3QWP A;  1RTI A;  3HHL A;  4DX7 A;  1KEK A;  3KUE A;  4EZ6 A;  4ZVR B;  1RHK B;  4KH0 B;  4MKV A;  5BJR A;  1F9F A;  3SBM A;  5HP1 B;  4B3S F;  3R8Y A;  1MN7 A;  1JLF A;  3HF5 A;  4WZM A;  4A8Y A;  4XAK A;  2XHC A;  3ZTR A;  4CLF A;  3G8S A;  1YI2 S;  2JX2 A;  1S9E A;  2Z8Q A;  2W4C A;  3WHI A;  3TWZ A;  1T0T V;  3PRV A;  1OO0 B;  1UJ5 A;  3PFE A;  4LFC F;  1YBT A;  3M8Q A;  1URR A;  1ZM3 A;  2QSF A;  3MHY A;  2J0S D;  4PR6 A;  4UF4 A;  2C3P A;  4HDG A;  2AJF E;  2FZC B;  2RS8 A;  2Y8Y A;  4X2B A;  1WJ9 A;  2HWH A;  3D7S B;  5FD1 A;  4NX9 A;  3UE2 A;  4ANE A;  2D3O 1;  2X1F A;  1G1X A;  2EC2 A;  3KHR A;  2K3K A;  2ALZ A;  2Z56 B;  1XTZ A;  3BPS P;  1GK8 A;  2FHJ A;  3K5N A;  3SFG A;  4ZVT B;  4WFX A;  3TJ8 A;  2M7S A;  2IA6 A;  3CJQ A;  2C2Z B;  1R8B A;  3A13 A;  2RD5 C;  1VQ5 S;  5I42 B;  3J80 U;  1ZH5 A;  5HSP A;  3MM7 B;  1HBN A;  3BB5 A;  1WOS A;  3OTC A;  4RWW A;  3EGZ A;  4NI2 B;  4OV1 A;  1MSW D;  1UWB A;  2MQL A;  2QLB B;  2R4F A;  4MJK A;  3D2W A;  1QSL A;  1O5J A;  2FZG B;  5KFC A;  3CB4 A;  1J5E J;  4CCH A;  2E1A A;  1U0H A;  2F8E X;  3F44 A;  4V1A k;  5AXM A;  3UD4 P;  2PO4 A;  3MEK A;  4B17 A;  3TAR A;  4ILM A;  1K0T A;  4LUB A;  4A4J A;  3IGN A;  2HHP A;  3JTO A;  2BJ7 A;  5SUH A;  4EBE A;  4RUA A;  1XK8 A;  3VR1 A;  2NSC A;  1Q1K A;  3SMZ A;  1UTA A;  2VPX B;  2ZM6 J;  3W66 A;  1BY9 A;  3VAG A;  2CQC A;  3D67 A;  4L72 B;  1S76 D;  3EE3 A;  1ITP A;  3QSI A;  2K1R A;  1NH8 A;  2YWG A;  2ZBI A;  3G86 A;  4LSZ B;  1UWB B;  4NLO A;  4OI6 A;  2N3L A;  3WX8 A;  5F8L A;  1F3F A;  3M8Y A;  4JI0 J;  5DDQ C;  5GAH U;  2E7W A;  4DV3 F;  2WSE C;  1WKK A;  1SL2 A;  3R2D J;  4HL9 A;  4PEO A;  4KO0 A;  4UQT A;  1YIT S;  2AGP A;  2PFD A;  2A6M A;  3BKT A;  4OL8 A;  2PA3 A;  3SCI E;  5I4M A;  4PXD A;  3B6B A;  4G6V B;  2KI2 A;  1R8A A;  4DLE A;  2J9D A;  1CEZ A;  2F5G A;  4DV6 F;  2OEJ A;  4GO5 X;  3VAI A;  2MZ1 A;  4OLO A;  2HIQ A;  3ETO A;  1UFL A;  2WVE A;  3BYP A;  4J9K A;  2RQM A;  3SV3 A;  1RAE B;  1NKC A;  1KOH A;  5H1S V;  1IKW B;  1AXQ A;  2FZK B;  1D9F A;  3FSX A;  2MLY A;  3GR0 A;  2N4C A;  4USM A;  1RWK B;  4DX5 A;  4B3O B;  2HHU A;  2VDI A;  4QZV B;  4YOE A;  4RBV A;  4K4X A;  5H9F K;  1N8R T;  1OYE A;  4NA1 A;  4ZPB A;  1KBR A;  3PO4 A;  4IFY A;  1ZPW X;  4ZHR A;  3LH2 S;  3MMA A;  3OUY B;  2FB0 A;  1QTM A;  1S79 A;  1XR7 A;  4HR2 A;  4DR5 F;  4K0K J;  4JI0 F;  1GAO A;  5J1N A;  4N5S A;  4AYB D;  3OLB A;  4LR9 A;  3EPG A;  4FDF A;  4LRD A;  5DJB A;  3MAQ A;  2XLK A;  8AT1 B;  4ZCL A;  3TO8 A;  5I3P A;  4LF1 A;  1NJI T;  3IXQ A;  3DLG B;  2NXE A;  2Q1L A;  4ZVQ B;  5A76 A;  1VHF A;  1Q95 G;  4E0D A;  4LFB J;  1Q82 T;  1C1B B;  5T41 A;  2LKZ A;  3ZZZ A;  1S7I A;  1UP1 A;  2JJ4 D;  3LP1 B;  4DXL A;  3M8Q B;  3PW2 A;  2YPZ A;  4FZV A;  1YQH A;  5D4N A;  4XO0 A;  3BO4 A;  2ZUA A;  5C24 A;  3W2V A;  2KFY A;  4HKQ A;  2YNG A;  1LOU A;  2RHS B;  3ZZ0 A;  2FGO A;  2C2R A;  1DBD A;  2D3U A;  3PRD A;  4X66 F;  1S6Q B;  2ZE2 B;  2IVM A;  4ITS A;  4ZVU B;  2V0N A;  2DGS A;  3CDU A;  2HVI A;  4L3K A;  4CLT A;  1RHM B;  2BJ1 A;  3KG4 A;  4A48 A;  2W9C B;  2CJK A;  2IJR A;  4ZVS B;  1D09 B;  4NLR A;  3W5Z A;  4ERD A;  1KRP A;  4CH7 A;  4K0K F;  2RH3 A;  1U1R A;  3ELH A;  4C97 A;  1ZTT A;  5D6G A;  4O3R A;  2HZC A;  5D0G A;  3D1O A;  3SYZ A;  2DGQ A;  3G8Q A;  1SC4 B;  3DXS X;  3MPW A;  1AUD A;  4AD6 A;  1JLC A;  4ZLP A;  1RBA A;  5F8G A;  3H42 A;  2XY6 A;  4LF4 F;  1GNK A;  1S6U A;  1NPK A;  4TU8 A;  3Q8Q B;  3VVT A;  3NNC A;  5D15 A;  2ZH1 A;  2VBW A;  1FJ7 A;  3TX0 A;  4FKY A;  3GJR B;  2G2Z A;  1KQS R;  4D3H A;  2RQK A;  5KG3 A;  2KG1 A;  1KFD A;  3IS9 A;  1TKX A;  2M9K A;  3TA1 A;  2DNM A;  4UOH A;  2YWH A;  1Q7L B;  3AOB A;  3NRB A;  4I6A A;  2B7C B;  3GB0 A;  3M32 A;  3JYT A;  2CJB A;  2ROE A;  3ZTP A;  5KG2 A;  4PG7 A;  3KTQ A;  3KK2 B;  4C4W A;  3IFE A;  2RRN A;  4KGZ B;  2C28 A;  2C2E A;  4ES1 A;  2P9E A;  4X66 J;  4NWB A;  4CP5 A;  2R7W A;  5LMN J;  2A2C A;  2DRB A;  1VC0 A;  3OUY A;  2ZM6 F;  1RE1 B;  1S6Q A;  3JB9 k;  4DR6 J;  4ILL A;  2M0G B;  1JNR B;  3WQP A;  4K2X A;  1A6L A;  2B5J A;  1ARO P;  4EBD A;  2R2R A;  3DHX A;  3R7S B;  2QLX A;  2BOP A;  4UY8 5;  2BW2 A;  3M8Z A;  3U7J A;  3SSQ A;  4J9N A;  2JEJ A;  4KV8 A;  4PXB A;  3IN5 A;  4ELT A;  1LKZ A;  3AOD A;  4FF3 A;  5I3U B;  3MZI A;  3QGG A;  4RW9 A;  5C5J A;  3DM2 B;  4U6P A;  1GTE A;  2GGP B;  3G8T A;  4F4K A;  2OPR A;  4K7Q A;  2XI2 A;  3RAQ A;  4YDD B;  4J9Q A;  3C3L A;  2BE2 B;  2BRK A;  3RTV A;  2UXD J;  2XQC A;  1IWA A;  1UAW A;  1ZAV A;  3FQK A;  4B9L A;  1S5Z A;  4WK3 A;  1P1L A;  1J5O B;  5BR8 F;  4ZPD A;  3HHN B;  3FBB A;  1S1V A;  3OR1 A;  1HFE L;  2HAI A;  1CJK B;  2MXY A;  4IUF A;  2F4V J;  1D9D A;  2MJU A;  4NLD A;  9ATC B;  4PKD B;  4NI2 A;  4EYI B;  3EZ5 A;  2W8L A;  2UZA A;  4DR1 F;  3MD3 A;  4J9U E;  3R5G A;  1WEL A;  3HFV A;  3PYE A;  3DRS B;  3KLE A;  4LF6 F;  1RP5 A;  2VC1 A;  3JTP A;  5D3G B;  5D0E A;  2H1Y A;  2LQ9 A;  2DRA A;  4Y2C A;  1VBK A;  3THT A;  4B9U A;  2WCX A;  4WTY A;  4RKU C;  4XPC A;  3CNQ P;  2I5J B;  4X4N A;  5D77 A;  4H54 A;  5KFU A;  1WG1 A;  4DJB A;  1HMV B;  3H20 A;  1H38 A;  2WRM A;  2QTW A;  1Q5Y A;  2DNQ A;  3N0V A;  3KG0 A;  1R0B G;  3OSN A;  4IRD A;  5ETL A;  1ZZF A;  3LO3 A;  3M1V B;  4DL0 C;  1NB7 A;  1WKJ A;  3GSD A;  3KLG A;  3MFI A;  4DSL A;  3MM6 B;  4HHJ A;  1FT8 A;  8ATC B;  1TL4 A;  4I2P A;  3VGT A;  1HL6 A;  1PIL A;  1R8H A;  1TL3 A;  4F4Z A;  2GS8 A;  2OPP B;  4AFF A;  1S9E B;  3H90 A;  2VUG A;  2C42 A;  2QV6 A;  3LP2 A;  4YY3 F;  1VQ6 S;  1QAY A;  2U1A A;  1IQT A;  3R2C J;  1YVF A;  1T03 A;  2CJ9 A;  2VG7 A;  4RBT A;  1UKU A;  2OFG X;  1B7Y B;  3MM7 A;  2UXC J;  1HBN B;  2F4V F;  1NHU A;  1TK5 A;  2MYF A;  4GMK A;  5L38 A;  1BMQ B;  1KS2 A;  4OHW A;  3B82 A;  3MWB A;  4IYQ A;  4QQB A;  3D0G E;  4KKO B;  3EGV A;  2PFF B;  4X84 A;  2UUA J;  1SI9 A;  3UDL A;  3JYT B;  4B9V A;  4QR1 A;  2YKA A;  2CJQ A;  4I7F A;  5CYM A;  4ZVE A;  5HAT A;  3FSI A;  2B9X A;  2W1B A;  4XK8 C;  4EO8 A;  3PAC A;  1H2V Z;  1GX5 A;  2N7C A;  3W62 A;  3K59 A;  5L1L A;  1RYS A;  1RU2 A;  2AWZ A;  4JOU A;  4DBQ A;  4RNH A;  2GMH A;  1KTV A;  1X31 C;  1AZS A;  2DO0 A;  4OJ1 A;  5AE2 A;  3PW5 A;  3OSP A;  4DQI A;  4H4O A;  2AGO A;  2BJE A;  2KRR A;  1KHW A;  5LT5 A;  4F3M A;  4Q43 A;  1K8A T;  1P9Y A;  2LEA A;  2ZH4 A;  2KM8 C;  2JEF A;  1KDN A;  1VFJ A;  2R2T A;  1X60 A;  4C11 A;  1SJF A;  1N5Y A;  3HDS A;  2CWK A;  1X4E A;  3M1V A;  2UUB F;  2JFK A;  2JL9 A;  3ZZT A;  4ELU A;  3CW2 C;  2EWH A;  2J9C A;  4EI2 A;  1HNV B;  4DUZ F;  1LXJ A;  3KKF A;  4LFA J;  2MKY A;  3CIZ A;  3HVT B;  4ETX A;  3VAL A;  2OTL S;  3DRX A;  1Y9O A;  2RUG A;  2VIC A;  4O44 A;  2F40 A;  4MFB A;  1E6V B;  2YXL A;  3M8P A;  3NY0 A;  2VBZ A;  2YKM A;  5DET A;  2YNI B;  4OI0 A;  4S0M A;  2LYV A;  4YB1 P;  4I69 A;  1LWX A;  3BO2 A;  1TK0 A;  1Q86 T;  3WIV A;  4PRF A;  3SEO A;  1LWC A;  2WZ1 A;  3FEZ A;  1CJV A;  3GON A;  3R27 A;  4GC7 A;  2GQ2 A;  1SPB P;  2V8P A;  4LQ9 A;  1OMS A;  2BV3 A;  2V6A A;  1S4E A;  2MKH A;  2GO9 A;  1FDB A;  2HS0 A;  4K8R A;  2VJU A;  1IR2 A;  2DNY A;  4AT1 B;  2V67 A;  1FKP A;  3MR2 A;  1FD8 A;  5AXK A;  4PAB A;  1RT3 A;  2BE2 A;  1N6Q B;  5EHH A;  4HVZ A;  3FNN A;  4JP8 A;  5F8I A;  3QAE A;  1Q8K A;  4YR3 A;  5G0R B;  4DUY F;  1YRX A;  3THV A;  1TFY A;  3CSK A;  2J8A A;  5IM0 A;  2YTC A;  3K57 A;  1DLO B;  3E51 A;  4O4R A;  3BGR B;  5IXU A;  3WDO A;  4QWE A;  3G6E S;  1HNZ F;  2DK2 A;  1WHW A;  3GU0 A;  5JMN A;  4K4S A;  1MMD A;  5GMD A;  1WOR A;  2YH1 A;  1B4S A;  5B0A A;  2UXD F;  4ZDN A;  2EBG A;  1R6Y A;  5KT7 A;  2HHS A;  1QJH A;  3LAK A;  3QO9 A;  2XLI A;  2VG6 B;  5BR8 J;  3HVA A;  1WOP A;  2OH2 A;  5C2G A;  4ZVH A;  4LF6 J;  4NCB A;  2J5A A;  4DSJ A;  4ED1 A;  4WKY A;  4B3M J;  3OFH A;  2X3G A;  2LEB A;  3VF0 B;  2MKC A;  4NRT A;  1QD1 A;  1EAR A;  5B09 A;  1S59 A;  2FJA B;  3QGP A;  5IM0 B;  3LP1 A;  2EFG A;  2BAB A;  1A7G E;  1FFW B;  4NLQ A;  2GA7 A;  1MRO A;  4OYA A;  4UUW A;  3SCL E;  1WOO A;  2LA6 A;  5EWG A;  3KHH A;  1ZM4 A;  2NS1 B;  2MEW A;  2ZDO A;  5HAN A;  3PJW A;  2JLF A;  3KOA A;  3OFF A;  1MLA A;  2D9O A;  2HWT A;  3I87 A;  3ZZY A;  1X4F A;  5K8P A;  5M2U A;  2MKI A;  1M5H A;  3LPY A;  2UXB F;  1RAC B;  3ZNU A;  2WOM B;  1YGY A;  4RUB A;  4MIW A;  3SXL A;  4XTT A;  2Q43 A;  4YUD A;  1HLW A;  5CD4 H;  2J6U A;  4Q45 A;  3NL0 A;  3C16 A;  2EXU A;  3MMC A;  4WBF A;  3ZZP A;  1B99 A;  4QBU A;  3GG0 A;  2P6S A;  4LF7 J;  4CLL A;  1VCT A;  2QJ3 A;  2DR9 A;  4PWW A;  1IR0 A;  2PN6 A;  2CPE A;  3FZB A;  3NP5 A;  5D0R A;  3VVU A;  3HJF A;  3R6G B;  2F65 A;  1MU2 B;  2B43 A;  3CJ3 A;  3K5M A;  2DPJ A;  2HKE A;  4KT0 C;  4WFZ A;  3D5M A;  1HNV A;  1TV6 A;  2HND A;  2VAS A;  4OI3 A;  1S10 A;  1RWX B;  2UUA F;  5F0W A;  2IRU A;  4ZLJ A;  5ITH A;  4TQS A;  1T02 A;  4GVL A;  4LSN A;  5KFG A;  4QWC A;  4OX9 J;  4IO9 Q;  3HPO A;  4TU9 A;  2NCK L;  1NZ8 A;  2OSQ A;  4ICL B;  2R7O A;  2Q6C A;  5E0O A;  4ZOS A;  4ZJO A;  4FF1 A;  1HD0 A;  4IH5 A;  2VFS A;  4YR2 A;  3JSM B;  3NWG A;  4I64 A;  2FY8 A;  1Q5V A;  4KRW A;  4RPF A;  3VGU A;  3LWM A;  4P75 A;  3LPE A;  3TZW A;  1F2G A;  3ITH B;  4HTI A;  3BQ1 A;  1T9V A;  2ZOF A;  3TVK A;  1R0A A;  3GCX P;  2UUB J;  4M5G A;  1FHT A;  2ACY A;  2FC8 A;  1IVZ A;  4X64 F;  2L9D A;  4NYP A;  5LJ3 Y;  3ET6 B;  4Y00 A;  1YSJ A;  3POT B;  3SV4 A;  1SIZ A;  4K5S A;  1XBW A;  1FRK A;  3GIL A;  3EVM A;  2IJF A;  1FXL A;  1E6V A;  1SQF A;  3M8P B;  4HYK A;  1V5I B;  3QNW B;  5HRO B;  1V3R A;  1UEU A;  1YLX A;  4EFA C;  1G6B A;  4ED5 A;  4UTG A;  1VMB A;  1LWE B;  3HKW A;  2BQR A;  2FJB B;  4B3O A;  3R3T A;  1H7W A;  4JV5 F;  4FN5 A;  5CHC B;  3KXD A;  1PBU A;  4GRS A;  3M2V A;  1L3V A;  4C9D A;  3BR8 A;  2ZWO A;  2YKP A;  1U47 A;  2ZC4 A;  5KTQ A;  1DAR A;  4DS5 A;  1HBU B;  2H5J B;  1LXN A;  2W2Q P;  3DGV A;  1LW0 B;  1JLE B;  3PYG A;  2NUH A;  1CQN A;  3VGV A;  2NYI A;  1HWJ A;  2D69 A;  4C3K A;  3KWM A;  1NH7 A;  1NK9 A;  4NZ7 A;  3Q8S B;  4E98 A;  2BQ3 A;  4P2F A;  5ADZ A;  4K2J A;  1GT8 A;  1DTQ A;  2XMM A;  2BZ2 A;  3BN7 A;  5ETM A;  2AYE A;  3W2W B;  2XO7 A;  1JX4 A;  4BDP A;  4CTA A;  5HVH A;  2KKH A;  1RWM B;  2MDA A;  4WTO B;  2QLW A;  3CCM S;  5JVG Q;  2VF3 A;  2VDH A;  3NCP A;  1VRU A;  3M30 B;  4ILR A;  4KC5 A;  4NL5 A;  1R8C A;  2OGU A;  4B9T A;  3GE9 A;  3GQC A;  1HA1 A;  1BLU A;  3KUH A;  1WC5 A;  3R7B B;  2D9P A;  1T03 B;  1IKV A;  2M4M A;  4M5M A;  1ACM B;  3F0N A;  3I0R A;  5J1E B;  2MJN A;  6AT1 B;  3MCO A;  1XWL A;  3QRQ A;  4RW7 B;  2CPY A;  2GIR A;  3PFO A;  3W9J A;  3UPF A;  3CMA S;  1VQM S;  2HHW A;  3CD6 S;  6FD1 A;  4DUY J;  1YG0 A;  1ZA1 B;  3LAN A;  2JRS A;  1FRI A;  4R5P A;  1HNZ J;  2OJ3 A;  3ZXW A;  5AXL A;  3DCA A;  1CQM A;  3MED B;  1UMJ A;  2XZT B;  4PWD A;  3TUI C;  5I3U A;  2I5J A;  2O01 C;  3EXY A;  3M2U B;  4Y2K A;  2R7T A;  2MLX A;  2BXJ A;  3HVW A;  3GMG A;  1YJV A;  1YZ7 A;  3Q24 A;  2G0I A;  1BQX A;  4ECU A;  5C25 B;  1KVI A;  2A10 A;  3KLI A;  3DOL B;  3MD1 A;  2ZVS A;  4R0E A;  3W3S A;  2DEJ A;  1J27 A;  2PA8 D;  4GKJ J;  1OIA A;  2XMT A;  2HVE A;  1OQ6 A;  2OFH X;  4J7C A;  2W01 A;  2RF2 B;  2HHH F;  2YBV A;  4C48 A;  4OYM A;  3AD8 C;  5IOL A;  2UXB J;  2LXI A;  2DNN A;  3C16 B;  3HXM A;  3QJP A;  1KOO A;  3MMC B;  1CJK A;  2PDA A;  3ITH A;  3QID A;  1T94 A;  3R5D A;  4CO0 A;  4RZR A;  4N7T A;  1DAX A;  3OT9 A;  5HMW A;  1DTT B;  2RIJ A;  3ENV A;  4WU3 A;  2CJA A;  4DV3 J;  2ZNZ A;  2V4R A;  3D4J A;  2AIR B;  3QRR A;  2OO4 A;  5C2C A;  4ECR A;  5LSO A;  1DQ8 A;  3DU6 A;  2JEI A;  2CUY A;  3B4D A;  3R7N B;  5EN1 A;  3H0P A;  4JB8 B;  5GAD I;  4O3Q A;  1K47 A;  4F4A A;  3ZZU A;  3DYA A;  4PCQ A;  5D4L A;  2DXE A;  3GIM A;  4KH1 B;  3OJU A;  2VQF J;  2ZD1 B;  3CCL S;  3FCH A;  3Q8Y A;  3TRG A;  5FDL B;  3UDE A;  4AXI A;  3KLH A;  2XS5 A;  2M5Y A;  4QYZ K;  3VAH A;  2WVB A;  1KQK A;  2BYC A;  1B3T A;  2VOP A;  2AGQ A;  3GLJ A;  1RT4 B;  2DR7 A;  5JUM A;  3BH7 B;  1JLF B;  4EMD A;  3DI6 B;  1CJT A;  2IFX A;  3M2R A;  4FYY B;  3AA9 A;  3RU0 A;  4DX8 H;  2V2Z A;  9RUB A;  2R7S A;  3A4T A;  1T9Y A;  2CAD A;  1RAA B;  2LVW A;  2VFT A;  3W9H A;  4HAC A;  4GKJ F;  3W5X A;  3TAN A;  4FBU A;  5DQG A;  2QMW A;  3MOZ A;  5F8H A;  3BGR A;  3PTW A;  4WXW A;  2DR8 A;  2VBY A;  2DEI A;  1FF2 A;  1KVK A;  2FIU A;  3BKU A;  2DIS A;  3FCW A;  2VKZ G;  5KAK A;  2G4B A;  1FES A;  2GJI A;  2D41 A;  2DHA A;  5G0R A;  4CZC A;  3NGD A;  2YNF A;  1Q16 B;  3I55 S;  3CPW R;  4D3G A;  5L1K A;  5J2M A;  7FDR A;  3BGF A;  1N6Q A;  4L3N A;  4OX7 A;  2X1B A;  4O3P A;  3OXG A;  1RT3 B;  1QVF R;  3MDF A;  2NZ4 A;  5EGY A;  4ZP6 A;  1S1X B;  2MZT A;  3FSY A;  3MMB A;  5E33 A;  2EFV A;  3UCU P;  4DR7 J;  4F2R A;  1U0S A;  1VQY A;  2DGV A;  3L3C A;  2VJV A;  4OYI A;  1KP6 A;  3N6N A;  1TTH B;  2BJ3 A;  3CCW A;  2E1C A;  4CNY A;  1QAX A;  1OPI A;  1RAB B;  1AFI A;  2H51 B;  1HHS A;  2R8G A;  2CQ0 A;  3T6J A;  2ADB A;  1Q53 A;  2AKW B;  1RTJ A;  1UZD A;  2JC0 A;  3OPK A;  5IS2 A;  1HWK A;  2XS7 A;  1RK8 A;  3HFK A;  2CYY A;  4Z37 A;  1NDP A;  3G71 S;  3T1Y J;  4O44 B;  1S0N A;  3CJK B;  3AB4 B;  4LSL B;  4CLU A;  3C8Y A;  1QAJ A;  3DI6 A;  5JJB A;  1ZBT A;  4WCE Q;  1PC5 A;  1RDR A;  3I56 S;  2PGC A;  2E5G A;  4ZMM A;  1T3O A;  3EVW A;  2KFZ A;  2DNZ A;  4USW A;  5DG8 A;  4OZ3 A;  1VRT A;  3LGM A;  4A46 A;  1NDC A;  2G1D A;  4C11 B;  2W7P A;  2QSW A;  2R8I A;  3I32 A;  1HW8 A;  1LK7 A;  5KFL A;  1JJC B;  4FNI A;  3S1T A;  4F0H A;  1Q81 T;  4JI8 J;  1O51 A;  1T11 A;  4O3S A;  5KFF A;  4UOC A;  1RTD B;  3UVJ B;  2EC0 A;  1BC6 A;  5CAA A;  5KOW A;  3H5U A;  3DYA B;  3T1H J;  2DHX A;  3VTI A;  2HGL A;  3BSN A;  2PE8 A;  3IG1 B;  3UD3 P;  3DLG A;  1FJG J;  3GG1 A;  5KG0 A;  1QVG R;  3BM7 A;  1M5P C;  2M8H A;  1KC8 T;  1CS4 A;  4TKT A;  5LM7 E;  3EX7 B;  3V6J A;  4DPX A;  2VIH A;  1I3O B;  2V69 A;  1TVR A;  1XR6 A;  4A8O A;  4EK2 A;  2PMH A;  4G1I A;  2FTR A;  2IRY A;  3KJV A;  1NK5 A;  4CTA B;  1D1U A;  1B7F A;  3RZA A;  4N41 A;  3PHT A;  4E2F B;  3TA0 A;  2WTF A;  4IOC Q;  5KFK A;  1WI6 A;  3KYL A;  1TP7 A;  4X4P A;  3IGV A;  3NBP A;  3M8S A;  3AD7 C;  3DOK B;  2PEH A;  2HFN A;  2FLO A;  3N79 A;  1XQI A;  4TYB A;  4F7V A;  3W9I A;  2HNY B;  5LMN F;  1JLG A;  3G2X A;  3FMW A;  4I67 A;  3GV8 B;  5LL6 d;  4ED6 A;  4Q8E A;  4ER8 A;  2OPP A;  1F1B B;  1U09 A;  3CO9 A;  4C98 A;  1RAH B;  3A8J A;  2N3O A;  5T14 A;  4DQP A;  2DRD A;  4K4U A;  2OP5 A;  2CQ1 A;  4CQ1 A;  2RJZ A;  1IXK A;  1PC4 A;  4DR4 J;  3OTB A;  4MYT A;  2DNG A;  1OPZ A;  3LGH A;  2KO1 A;  4HEA 9;  4KQZ A;  2UVW A;  2OTJ S;  1FTR A;  4OYO A;  2W7A A;  2A2D A;  4JUZ A;  3LUY A;  5L46 A;  4M5N A;  5ETK A;  2ZJP Q;  2B7B B;  2H4Y B;  1V3Z A;  3I0R B;  3DRR A;  4KO0 B;  2JZ5 A;  3J7Y U;  2DR5 A;  4RW6 B;  4MK9 A;  1U26 A;  4NCA A;  3AJ1 A;  2V9K A;  5E41 A;  5H9E K;  1JXV A;  2EVZ A;  2XMK A;  1R8P A;  3IP0 A;  2PEB A;  1IJE B;  3O2I A;  4DF8 A;  3A3O B;  5IT9 Y;  1UPM B;  4M5L A;  5C42 B;  2Q6B A;  5KFJ A;  4DR1 J;  3CJ4 A;  2W25 A;  2AP6 A;  1IKX B;  2EI5 A;  3MM9 B;  3QT5 A;  1FJC A;  4F25 A;  2BKP A;  4ZCM A;  1QLN A;  2MST A;  4JYA J;  3VAK A;  4X62 F;  4HI1 A;  1VGY A;  3BQ0 A;  3W63 A;  1FJG F;  2GQC A;  3M8W A;  3CDA A;  5BYS A;  3NGR A;  1YTY A;  2ZOG A;  3A8K A;  4MH8 A;  2XY7 A;  1K1Q A;  3BN4 A;  2CPI A;  1EB0 A;  3BS9 A;  4R25 A;  3QT6 A;  1VRT B;  2LA4 A;  3IWL A;  4JBC A;  2FHJ D;  1U8W A;  1H72 C;  4LT6 A;  1NU4 A;  2RUS A;  3MTJ A;  4QIG A;  4DUT A;  4DV7 J;  5DRK A;  2I38 A;  2V63 A;  5BYQ A;  3ILJ A;  4GVB B;  1FWK A;  2DH8 A;  5KFO A;  3I6P A;  1RQ0 A;  3FUY A;  1TL1 A;  1FXR A;  2CIM A;  4UW2 A;  4DZ6 A;  1RYR A;  1IBK J;  1ZOT A;  4PQA A;  5K8N A;  1U6F A;  4QPT A;  1JJ4 A;  1VRQ C;  4DPT A;  1JB0 C;  1BHN A;  4AE5 A;  4IR9 A;  1AYE A;  3H4D A;  2MHE A;  3GCW P;  1S1W B;  3EXC X;  2HFO A;  3NS6 A;  3OJS A;  1FRM A;  2RIL A;  1OY9 A;  4F67 A;  4DZD A;  1AFJ A;  3ONQ A;  4IG3 B;  1G2E A;  1N5Q A;  2GMJ A;  3MI7 X;  2Z2Z A;  2CXE A;  4TXS A;  4LR8 A;  2YQ1 A;  2CQ3 A;  4ED4 A;  3IBF B;  1JLC B;  2BW7 A;  4OZ5 A;  1FX2 A;  4RU9 A;  2RU3 A;  1IBM J;  1JXE A;  1NHV A;  4DCJ B;  4FF4 A;  1U6B A;  3PJ9 A;  1RAJ A;  4WYL A;  5JXS A;  3MMJ A;  5KT2 A;  3EDR B;  2AZ3 A;  2UVR A;  3HX9 A;  4P74 A;  1RT7 A;  3PEJ A;  3VAF A;  1OY6 A;  4CLW A;  4ED3 A;  2VG6 A;  1FDA A;  4I6Y A;  1I94 F;  1T05 B;  3KJN B;  2FVP A;  2IM3 A;  1I6J A;  3R1L A;  3N5F A;  1RCX B;  1VJW A;  3CJK A;  2DTJ A;  3G6X A;  1RJJ A;  3TQE A;  1DZ5 A;  2IBK A;  2HK3 A;  2XBP A;  4V19 J;  1NB2 A;  2DH9 A;  2ASL A;  1CS4 B;  1L3K A;  3K8V A;  2PMW A;  4G65 A;  4ID5 A;  1P9Q C;  1RA6 A;  3AQO A;  1CPZ A;  3DU5 A;  2RQ4 A;  2EBE A;  2KVI A;  5IV4 A;  1CG2 A;  3OFE A;  3EPI A;  2CQI A;  5E3P A;  5F8J A;  3DNC A;  4C0O C;  1PO6 A;  1RTD A;  1RI7 A;  2LQ5 A;  2BRL A;  3OBI A;  1FKP B;  3W64 A;  1X9W A;  1HPZ A;  2ZD1 A;  4A8F A;  1D8Z A;  4KGM A;  1YJT A;  4F26 A;  1NM2 A;  4UUX A;  3RAX A;  4ZPC A;  4CH0 S;  2XMW A;  2LU1 A;  4F4X A;  3FEY B;  1WF1 A;  2YNF B;  3HZG A;  3GP9 A;  3P96 A;  3V5R A;  2YWE A;  1J5E F;  2BOA A;  2L3M A;  2EKY A;  4I56 A;  3RGI A;  1RWO B;  4USH A;  3NAI A;  2RDI A;  2LDI A;  3MFH A;  2KJV A;  1Y11 A;  2FLP A;  4M8L A;  3ENQ A;  1EKR A;  4HAC B;  4QR0 A;  5KG4 A;  2PI4 A;  3S6E A;  4WWS A;  2NXN A;  4YME A;  1R6V A;  2KZZ A;  5JVH Q;  3GV5 B;  1FKO A;  1RWW B;  2ZE2 A;  2ZZT A;  1H7X A;  3T3F A;  1U25 A;  2L9W A;  4DL2 A;  1XMO J;  1RTH A;  3MR5 A;  5KFY A;  1IKY A;  4K4T A;  1S48 A;  1OWX A;  1FFS B;  1R31 A;  2D74 B;  3DOL A;  4FP9 A;  3QFW A;  4ZA1 A;  2R7X A;  4NCG B;  4LBI A;  1RGV A;  1IKW A;  3BZQ A;  3HHK A;  2H65 B;  2YQ0 A;  2X1A A;  2ZH3 A;  5EDW A;  2IM0 A;  3HHD A;  1FNM A;  4CO4 A;  1REV B;  2NXJ A;  3RB6 A;  1TKT B;  3H4B A;  1FXD A;  1P1T A;  3H40 A;  3MPU B;  2DHH A;  5CZV A;  4ED8 A;  4USV A;  5L1I A;  2KH9 A;  3MEC B;  2RE1 A;  1H73 A;  1IM6 A;  1N0U A;  2ZKT A;  2CQP A;  3NLC A;  1IJF B;  3VAM A;  4DR3 J;  4CWB A;  2R42 A;  2ZC3 A;  2ATC B;  1TK8 A;  4DG1 B;  4LF9 F;  4Z2X A;  2DIU A;  2DXF A;  2W2P P;  5HLF A;  2R2S A;  3LA0 A;  3NGK A;  4JV1 A;  2G13 A;  1X9S A;  2VV5 A;  4IFY B;  3U27 A;  4ZHR B;  5C7P A;  1AUS L;  3F56 A;  1G7C B;  2DGW A;  4OZJ A;  3FRY A;  4P9S A;  3MUV P;  1C0T B;  5A6P A;  3CCQ S;  2A3J A;  2CPH A;  2GAH C;  2Z4P A;  3GSI A;  3M4X A;  3MCN A;  3BBC A;  2M3D A;  5CQG A;  3TR5 A;  1HHQ A;  1VQL S;  3LP2 B;  1RT5 A;  2DGU A;  4ZP7 A;  5DQI A;  1RT1 B;  5A8K B;  1FK9 B;  5CYQ B;  3M2U A;  4EWT A;  2O66 A;  3J7Z T;  5GAG U;  3NGT A;  2ZUG A;  3R5J B;  4MTP A;  2W9A A;  1RLD A;  1XNQ J;  3C6U B;  2NR0 A;  3MM6 A;  1ICE B;  2OD6 A;  3GFZ A;  3UD5 A;  4OJG A;  4OJH A;  1XC9 A;  2QIF A;  1N33 F;  1NK6 A;  2EW9 A;  3ICL A;  4N8N A;  1X0P A;  3CGI A;  3NG8 A;  1S6P B;  1R0C B;  3D1Q A;  4NYZ A;  1FDN A;  3C66 A;  4RL1 A;  4JI6 F;  2KT3 A;  1RLC L;  4NE9 C;  4YB6 A;  2MY7 A;  3GFH A;  1F2H A;  3PHE A;  5A8W B;  2IVF B;  4V19 X;  3W60 A;  1AZS B;  2R9L A;  2MQP A;  4H4K C;  3DKD A;  4P72 A;  5B0C A;  4ZLN A;  3HMJ G;  2FJX A;  1YJ9 S;  4USI A;  2IYI A;  3FZ2 A;  4NLX A;  5SZT A;  4B3T F;  4CRJ A;  4XDC A;  3NGU A;  1QAI A;  4LFB F;  1OS5 A;  2WON A;  2OLW A;  4DR3 F;  2ROP A;  3HM9 A;  4WU2 A;  3A3P B;  3DDK A;  4JI2 J;  3UW1 A;  2BMB A;  2UUT A;  3NOG A;  1C0U B;  4DL6 A;  1UW9 A;  3TYT A;  1X4G A;  1I94 J;  1TL1 B;  3HJV A;  3J7Y I;  2JVO A;  4F8R A;  5LOQ A;  1VDH A;  4G1Q A;  3D6H B;  2BKO A;  3CXC R;  2ZHB A;  1SCJ B;  4CLZ A;  1KSP A;  1TL7 B;  4NPO A;  3GZ7 A;  1FNO A;  3Q83 A;  4MKB A;  3CUN A;  4FS1 A;  2E29 A;  3FFI A;  5KFP A;  3CDE A;  2W2M P;  4IQM A;  3KUG A;  2BAN A;  4OYZ A;  4AND A;  4CIO A;  3BSO A;  3PX0 A;  1FA0 A;  4OI2 A;  4ECW A;  1REG X;  4YY3 J;  1HBU A;  1SVD A;  5KFD A;  1U2C A;  4H4O B;  4YB7 A;  1RAD B;  2XB2 D;  4CYU B;  1U02 A;  3B4M A;  4RX6 A;  2XCP A;  3EGW B;  2LCW A;  2YWK A;  3ISN C;  4DWI A;  1E6Y A;  3JQJ A;  2BJ9 A;  4AXJ A;  4FYV B;  1DJ0 A;  4WZQ A;  4Z7Y A;  2O1P A;  1S49 A;  2ZH8 A;  1LEO A;  3TVZ A;  2GV1 A;  4FPR A;  3N28 A;  1PJ6 A;  1MU2 A;  1RBO B;  2HQF A;  4DDF A;  1VQK S;  1RAI B;  3G6Y A;  3CMQ A;  3LTO A;  4DV0 F;  3RW6 A;  4JV2 A;  3RB3 A;  2XYH B;  1CVJ A;  3SFU A;  4WP8 A;  3KK1 B;  1F3V A;  5B0D A;  3DRR B;  1IQZ A;  3O3L A;  1PCA A;  3K2Y A;  3T19 A;  4AL7 A;  1RKJ A;  5FJ4 A;  4BC9 A;  1NO8 A;  2BM1 A;  2Q66 A;  2HLT A;  3JSM A;  3T5H A;  3JQK A;  1PKU A;  1PYT A;  3LF0 A;  4BHQ A;  1BE4 A;  2J7W A;  1Q8B A;  1SUQ B;  2MTL A;  2HGM A;  3HSD A;  1YWX A;  3M8R A;  2ZIT A;  3WX4 A;  4LRC A;  1S6P A;  1DUR A;  2WB4 A;  4CLK A;  4DQR A;  1NJZ A;  4WKR A;  1CJU B;  1JMT A;  1HNI A;  4ED0 A;  1LWE A;  4GKK J;  3UI3 A;  1N4L A;  3OLA A;  4O4G B;  4F3O A;  3C6U A;  4RWX A;  4NXM F;  2CQD A;  2LDY A;  2QGF B;  1Q4R A;  4J37 A;  1PIE A;  2HS4 A;  1X4C A;  4G1P A;  2CAJ A;  3D6M B;  5BYR A;  3PZP A;  1YJN S;  3J81 j;  5CYJ A;  2MZS A;  4JYA F;  3W5Y A;  3PYD A;  2E7V A;  3DOK A;  2G0J A;  3C19 A;  3DMJ B;  3ENW A;  2WAQ D;  2UP1 A;  1R89 A;  4PZV A;  2DD8 S;  5F41 A;  3QJJ A;  4IFV A;  2ZDP A;  4A8W A;  3OD2 A;  4LVO P;  2HQD A;  3CCZ A;  5HL7 Q;  4J9S A;  5DG7 A;  1WI8 A;  3NEK A;  1RBL A;  5HK4 A;  4M95 A;  2DYA A;  1HNW J;  1EZZ B;  4MIA A;  1WF2 A;  2PD1 A;  2GIF A;  4QU7 A;  2VL1 A;  4KFB A;  2ZZM A;  2XWX A;  3GJQ B;  2V8D A;  2XY5 A;  3DOM B;  3TQ1 A;  4PG8 A;  5GAH I;  1AW0 A;  2NQP A;  1KLN A;  2H9Z A;  1TKZ A;  4B3R J;  3KMQ A;  1GH8 A;  3QZ7 A;  1MRO B;  3ETM A;  2VKR A;  3MGJ A;  5F8M A;  1WKL A;  1TKT A;  7AT1 B;  4BC7 A;  4L75 A;  5E7O B;  1APS A;  1ZYQ A;  5D4O A;  3Q2T C;  4ZN3 A;  5CH7 B;  4A8K A;  5J2N B;  1YIJ S;  3NS7 B;  4HHU A;  1K73 T;  4KBI A;  2VON A;  1IM4 A;  5L8R C;  2XUL A;  4DSK A;  1RCO B;  4ZVP B;  4J91 A;  1IKY B;  1GX6 A;  2J6T A;  2A18 A;  1BQN B;  2RU9 A;  2AV5 A;  2KXH A;  4NLS A;  3MUM P;  2QYG A;  4KSE B;  2HHV A;  1RHR B;  1HQU B;  2V34 A;  3CJ2 A;  1N88 A;  4JI2 F;  2KM8 B;  2HBQ B;  3BSC A;  4ATN A;  2CJY B;  2Z2Y B;  5DLG A;  2CPJ A;  1TUW A;  3D6F B;  2C3O A;  1LK5 A;  2DGX A;  3C6T B;  5IC4 B;  4USK A;  2L41 A;  1N34 F;  3BF4 A;  2HQC A;  3QGH A;  4TNO A;  3HP6 A;  4DLG A;  4JI1 F;  4LBH A;  3HCX A;  5E3A A;  1YK9 A;  2VG5 A;  5DDO C;  2YNH A;  2HUR A;  4Q5V A;  2APO A;  4LRF A;  3NAH A;  2FJE B;  2E9T A;  2IMW P;  1S6O A;  2K7J A;  4IO1 A;  5KG5 A;  5LXR A;  1U1Q A;  4B3T J;  1NJW A;  2C3U A;  1DQ9 A;  3PG9 A;  4IG3 A;  4M5D B;  4OYP A;  1S9G A;  1WD6 A;  3FVY A;  5AE3 A;  2GIQ A; 
#chains in the Genus database with same CATH homology
 3MAA B;  5IV4 A;  4OYA A;  4CM2 A;  5IV3 A;  4WPA A;  1FX4 A;  2W01 A;  1TL7 A;  4UST A;  4CLY A;  4OYM A;  2GVZ A;  3C16 A;  3C16 B;  4CM0 A;  1CJK A;  4CLL A;  2QV6 A;  5D0R A;  3ET6 A;  4CLF A;  1Y11 A;  4WP8 A;  4OYO A;  1CJV B;  1YBT A;  1WC4 A;  3C14 B;  1YBU A;  1Y10 A;  4CLT A;  4CLK A;  3C14 A;  1CJU B;  4CLP A;  1CJT A;  4OYB A;  1AZS A;  1CJT B;  1WC3 A;  5D0G A;  4USU A;  3MR7 A;  4OYW A;  4USV A;  5D0H A;  3ET6 B;  4NI2 B;  5D15 A;  4P2X A;  1U0H A;  3C15 A;  1U0H B;  2GVD A;  1CJU A;  4OYX A;  4OYI A;  2WZ1 A;  1WC0 A;  1CJV A;  1WC1 A;  4OZ2 A;  4CLS A;  3UVJ A;  4WP9 A;  2GVD B;  4P2F A;  3G82 A;  4CLU A;  2GVZ B;  1AZS B;  1CUL A;  4USW A;  4OZ3 A;  4P2M A;  2BW7 A;  1FX2 A;  1WC5 A;  1AB8 A;  3UVJ B;  4CLW A;  1CJK B;  1YK9 A;  1WC6 A;  4NI2 A;  3C15 B;  4CLZ A;  4WP3 A;  3G82 B;  1TL7 B;  3MAA A;  3R5G A;  1CS4 A;  5D0E A;  1CS4 B;  4OYP A;  1CUL B;  4OYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...