3UVJB

Crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
196
structure length
196
Chain Sequence
b'PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVCDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYSLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanylate cyclase soluble subunit alpha-3
publication title Crystal structures of the catalytic domain of human soluble guanylate cyclase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 54
structure length 196
sequence length 196
chains with identical sequence D
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3uvjB00
1U0HB 1CJVB 1CJKB 3C15B 5D0GA 1CS4A 3ET6A 1WC6A 4WP8A 4OYIA 4CLZA 4OYXA 1TL7A 1WC0A 4NI2A 1AB8A 5D0EA 2GVDA 1WC5A 4P2XA 1Y10A 1CJUB 3MAAB 4OZ3A 1AZSB 4CM2A 5D15A 4WP9A 2GVZB 4P2MA 5D0HA 1Y11A 4USUA 4OYOA 4CLPA 4CLTA 1YBUA 3G82B 4CLUA 1WC4A 4P2FA 3C16B 1FX2A 3UVJB 1CULB 4CLYA 4OYWA 1FX4A 2BW7A 4WPAA 1CJUA 4OYZA 1CS4B 3ET6B 1AZSA 4OYBA 1WC3A 1CJTA 3C14B 2W01A 5IV4A 1U0HA 3MR7A 1CJVA 1TL7B 1YK9A 1CJKA 3C15A 4OYPA 4NI2B 4OZ2A 2GVDB 4CLKA 4CLFA 4USTA 3G82A 4OYMA 3C16A 5IV3A 3UVJA 4CLSA 1YBTA 3MAAA 4USVA 2QV6A 4CLWA 4CM0A 2WZ1A 4CLLA 3C14A 4USWA 3R5GA 2GVZA 4OYAA 4WP3A 1WC1A 1CJTB 5D0RA 1CULA
chains in the Genus database with same CATH superfamily
4ZLLA 2LDYA 2NPIA 3OTBA 4UF4A 3KMSA 2VV5A 5I4MA 1WHXA 2W8LA 2RDIA 4DJBA 2DO4A 2BM1A 4RW9A 4C8MA 1FKPA 1SIZA 3T1AA 2VODA 1JNZB 1ZZFA 4LREA 1SH2A 1UVIA 3DRSA 1N32J 4DU8A 2B7BB 1B0VA 1H74A 3N01A 4ED1A 3CO9A 1FKOB 1HQEA 2J8SA 3EGZA 3I31A 3NOCA 4J9QA 4E0DA 2RU3A 4CLKA 2WONA 5IV3A 3QJLA 4LIRA 2XMUA 2J0WA 2HNDA 2QT7A 2D3ZA 3FKBA 3J7A1 1IBMF 5KFSA 3PJWA 5SUHA 3DOLB 2FHKA 1TV6B 3IMQJ 1X5TA 2PA3A 4B3SF 1P9QC 1NHKL 3IM8A 3ENQA 2GIQA 5AJ3F 3D6MB 2QA4S 2OMOA 1P8GA 2FHJD 4ZPDA 3R7SB 5H9FK 2EG1A 1P1TA 2BE9B 4OYIA 3VAJA 3RGIA 4X4OA 3CW2C 2FB0A 3ITHB 5HMXA 2V9KA 1RHQB 3P4UB 5IQQA 3M30B 3N4WA 3AQOA 2KB2A 2WVFA 2CZVC 2XZDB 4EBCA 5KFEA 3V81A 4A8MP 2ZM6J 1S0NA 4H4MB 2ZBQA 5AXMA 1ULRA 3G82B 3I96A 4F0HA 3K89A 2W9BB 4URSA 5F8LA 3EVWA 5IT4A 4ZIVA 1BXNA 4WFXA 3EVMA 1M5OC 1K1QA 2DNYA 4EBEA 4BS2A 3OTEA 4DI6A 3SEOA 1PYSB 4NA1A 3OV7A 3OL9A 3MCOA 4DFMA 1KLNA 4N8NA 3GTYX 1LWCA 1HWUA 3C6TA 3FBEA 4UTGA 5KG5A 1RHRB 3K8WA 4YR3A 3TUJC 4UUXA 1L3SA 4LQ9A 4RNOA 1E6YB 1TKXA 4X84A 1PGZA 4ETXA 5KFDA 3RBZA 3AD8C 2RDDA 2RB7A 4UUWA 4Q43A 4HDHA 3DU5A 2ZNZA 4AL5A 1KQFB 4C8KA 4OX9F 1N0UA 3ILJA 2BOAA 3FC9A 3EE3A 5CD4H 3O1LA 3I82A 2HVEA 1M5HA 2YKMB 2AHOB 4A8FA 3KLGB 1RU2A 4LRBA 1FJ7A 2BW7A 1SL1A 5GMEA 4KO0A 1FK9A 2MQPA 1FNMA 1VRTA 2XI3A 4PUOA 1KLMA 3W2VB 2XCAA 1WKLA 1GNKA 3SFGA 4OLPA 1IBMJ 1HNVB 3D0IE 3RW7A 1W2IA 4ILMA 1FESA 1FDBA 4B3SJ 2CWKA 5HROB 4X4QA 1AFIA 2F4VF 3MAAA 3HHLC 5AJ3J 2KVIA 4B08A 3LP2A 4MKAA 5LSLA 2NSBA 3P3DA 4PXBA 4F4WA 2QSFA 1P9YA 3DRPA 3MTKA 1FRMA 4JI0F 5J1PA 3KUHA 4P71A 3O3LA 5U47A 4K50A 3GJRB 2QL9B 4GC6A 2F5GA 2BW2A 3VWSA 4OI0A 2MZSA 3H20A 4NMLA 4A4JA 2UU9F 4ED4A 1BQNB 2WSCC 2EW9A 1MMDA 1NJZA 2QMUB 4ZVHA 1P6TA 2AF6A 2CNNB 4MIBA 4OMFG 3JQKA 1DHMA 1MWYA 4NYOA 3AD9C 4PPZA 1N33F 2LQ8A 4X64F 2GGPB 1KFSA 2HNYA 2XMJA 3UD5A 2HHXA 4ER8A 3HVRA 2L9NA 5DQHA 1I94F 3M32B 4JV0A 3IAM9 4ZPWR 2HHTA 1JJ2R 4WF9Q 2AW0A 1NO8A 4AYBD 4M5GA 2EBEA 2ZJRQ 2G0CA 4ZPCA 2RH3A 3JTPA 3NOGA 1Q1KA 2D3O1 3WC2A 2H4WB 3KHRA 4J9KA 5BYRA 3D0HE 3MURP 2PD1A 2WVCA 4OX7A 2X3GA 1V6HA 2L08A 1U26A 4V19J 4RWWA 3FSYA 3VAGA 2C3YA 3H4DA 4WFAQ 4KR0B 3CCMS 1U6BA 4OX9J 2YY3A 3R7BB 2NYIA 3MAQA 2Z57B 1PIEA 1MW7A 4FN5A 1OPZA 1X5OA 3KHHA 1FRXA 2RJZA 2XGPA 2BE2B 1QUVA 5E0OA 2YKNA 2H48B 1XNQF 4CLTA 3CC2S 1JLGA 2B4OA 4J9UE 1OMSA 5A2QY 3F41A 9ATCB 2BJDA 3Q83A 4Z7YA 1CQNA 1S6UA 2MQLA 1URNA 2F4VJ 1Q8BA 1WEYA 2DNGA 4KB7A 2GHPA 1RA7A 3AA8A 3H7HB 2OPQA 2XLJA 2AJFE 2H3EB 4JI0J 3B82A 1RKIA 5LM7E 2LXUA 4K2XA 3SCIE 4QW9A 3N5BA 3J80Y 1AUDA 4KE5A 2QL5B 1HHTP 2FLOA 4KGVB 1TR0A 4K4WA 2BVZA 2JVOA 2ZH7A 1S0OA 1RTIA 5FDLA 3GG0A 2UU9J 1TAQA 5HLFA 1TUGB 1Q16B 3CDBA 2JX2A 5C2CA 1IQTA 1IN0A 3UD3P 1T95A 1LEOA 1YGYA 4ZVEA 3KG1A 1RACB 1U2FA 2JEJA 4IFYB 2XSJB 3QRRA 4X64J 4CYUB 1U2RA 1JJHA 1EETA 4NYPA 1VS3A 3DM2B 1I94J 4IDKB 4DN0A 2E9RX 1FDAA 2J6SA 3PTWA 1BHNA 2QEXS 4X4SA 1FCAA 2IBKA 2VPXB 1UFKA 1HI0P 4TQRA 2VG5A 4B9TA 3I0SB 3OFEA 1HNXF 1N6QA 1TUWA 2GIRA 1VBYA 2DRDA 1GX6A 2XNQA 1F9EB 5HMWA 1UETA 5CZVA 5ETNA 1NKBA 2V8PA 4A8WA 3PFEA 4QR0A 1N0VC 2GNKA 2NSCA 1VJWA 1M1GA 3MUMP 3CCRS 3HI9A 1UWAA 2KHCA 1DQ8A 1SJQA 3TVYA 1NM2A 5GAGI 2V67A 4QU6A 2CXEA 3IRXB 2XMWA 2G1DA 4NLTA 2AMCB 3N0VA 1ZM4A 3FQLA 1XNQJ 3QMQA 5EHHA 3IRWP 3G8QA 4CM2A 1RWXB 3CIZA 5AXNA 2C2MB 3Q0AA 1RYRA 1CVJA 2JLEA 1Y4ZB 1YBUA 1JLEB 3T1HF 2GV1A 3C19A 2ZH3A 5HSPA 4X65F 1F3VA 5C42B 1MU2A 2IMWP 4M5KA 3IS9B 5I42B 2RQKA 2OD4A 1D0EA 1ZM9A 2FGCA 1UWBB 4A8YA 2CRLA 3DOMB 3MECB 2ZBIA 5JJBA 1S9GB 4PG7A 4RBUA 2NPFA 5GAHI 2HFVA 1XN9A 2WAQD 4F2RA 4JI5J 3PVXA 3A3OB 9RUBA 2OH2A 2E5HA 1GFWB 4M63A 3E01A 2EEYA 4YEAA 1F5AA 1JXEA 2YWHA 4XK8C 5H1SV 2EVZA 2M9KA 2Q43A 4HDGA 3CULA 3UDCA 2YWEA 2GCFA 3KG4A 2QMXA 4HKQA 4DF4A 3NGRA 2H5JB 1SVDA 5HQLA 3DI6A 1Q82T 1ZPVA 1JLBA 2HWIA 5AE3A 2XMMA 1C0TB 4F0KA 3IWNC 3CJ4A 5A76A 4F8RA 1BMQB 4K8RA 3E2EA 1TL7B 3IM9A 3QGIA 3KHLA 3Q22A 1B4SA 4LRAA 1VMBA 3KK2B 2MTLA 3S6EA 1SI9A 4IH6A 3DYAA 2X7IA 4FXWA 1REGX 4ID5B 4XO0A 1T9UA 3KUEA 4NRUA 5K8MA 5B0FA 1NSPA 3MM8B 3EVOA 3SIPB 1S97A 2IJNA 4MAKA 4URQU 4LF4J 1UVKA 2MZ1A 2K3IA 4C3LA 1D8ZA 4HLBA 4LF7F 3U1LA 2LXFA 2QIFA 4KV8B 3DOLA 1TV6A 1S1XB 4WKRA 2XS7A 2GW8A 1Q8LA 1U1NA 3T1HJ 2OFGX 3QFHA 4X65J 1EP4A 1NH7A 1IBLF 1YRXA 4DLEA 3GIMA 5D0HA 4O0NA 4MYTA 5D8HB 2KJVA 3V2UC 3EJMA 2AYGA 4LFCF 2D3UA 4Q0BA 4ZN3A 3JYTA 4HTIA 1FX2A 4C9DA 1VK8A 2CQ1A 3TARA 5LSRA 3RRGA 3SV3A 1TL4A 1WELA 2VG6B 4ZPVR 3C14B 4P9SA 2P9EA 4FBUA 2W7OA 1S72S 5C24A 3F56A 4H4MA 2YNGB 3G82A 2XO7A 3BB5A 2FVPA 3GV8B 2W9BA 2HVHA 2DITA 5LJ3Y 4RNNA 3UN5A 3EPIA 2WZ1A 1OY8A 2GVZA 3GJQB 1RWOB 5KTQA 4NLWA 5DLFA 2P6TA 1FJGF 4GVBB 4UZBA 6AT1B 2BUNA 1U09A 1KS2A 2CAJA 3MEGB 5F8HA 3ET6A 3N6MA 1DQ9A 1NK8A 4UW2A 1ITPA 1TVRA 3WX4A 4RW6B 3M8WA 1WOOA 5KFCA 1N5QA 4CO2A 1E6YA 4OYOA 1RBOB 1OSDA 3W66A 5FLXY 2KYXA 2V4JA 1WC3A 1VOMA 2KG1A 1QM9A 1WI6A 1R8PA 2CJ9A 3BSNA 2B6AA 5I3QA 4QWDA 3BV8A 3UE2A 3NMAA 4O44B 1XMBA 2IVYA 2YKMA 1JKHB 2OUGA 3BS9A 4CT9A 4PG4A 1XMOF 4JI4F 2A0FB 2CPXA 4LF7J 3PZPA 4YP3A 1RHJB 4RBTA 4F26A 2RHQB 2EI5A 1Y0HA 2O01C 2WB4A 2D3OR 4ZLPA 1EJ7L 2NS1B 3VHQA 3E3XA 4DL4A 1KHVA 4KRWA 5HROA 4A8XA 1BC6A 4LJMA 4NLRA 1IBLJ 5LJ5Y 3MM5B 3UWTA 3T5KA 3LGMA 4LFCJ 4X4RA 1YQHA 1UFLA 5BXIA 3QLHB 1R8CA 1VHIA 4WTYA 3CDWA 3AT1B 3QZ7A 5L8RC 1GTHA 2NUHA 3TO8A 1A9NB 2HG4A 3A12A 3HHLA 1BQNA 2B9XA 4ECVA 1IWGA 3JSBA 2GQCA 4ERDA 3AJ2A 1NXIA 4QIGA 4NLSA 4WTOB 3BGRA 2LQ9A 2EFVA 3KJVB 4J37A 2DISA 4FNHA 2GGPA 3EZOA 2Z4PA 1FJGJ 3RR7A 4WE1B 3HT3A 5GMDA 1H0HB 3M32A 1T05B 1YJTA 3KNGA 3TI0A 5DG8A 5F9NA 4JV2A 2V50A 4ZITA 3U7JA 5RUBA 3N5FA 1U6ZA 1D8YA 2DD8S 1FEHA 3GFYA 2CQHA 2CQBA 3JS9A 2CPIA 3PYEA 2H51B 2QA4G 3PHTA 4I6AA 3A13A 1TK5A 1GEHA 1JMTA 3NBPB 2BANA 3D5MA 4R5PA 2MQMA 2GMJA 2AJ2A 2XS2A 1NDLA 2OMLA 3T5LA 5HJXA 5CD4A 5IXUA 4EWTA 2YNHA 1JWWA 3PO4A 3MM9B 3H5YA 4DV2F 4QW8A 1XMOJ 4JI4J 3PEJA 4FYXB 2W4CA 2ZE2B 4S0MA 3BBFA 4V19X 1S9FA 2ZH9A 4NASA 3CTRA 4M5HA 1CG2A 4RJVA 4LR9A 3RR8A 5GAEI 4DSLA 5T14A 4EZ9A 1VHFA 2OEKA 4LIWA 3OLBA 4DSKA 4OQJA 4FDFA 4LVOP 2GMHA 2ZJQQ 4I2QB 3KWMA 2HIYA 1RCXB 3G6XA 4J9OA 1UZDA 1Z4UA 1NSKL 4I2PB 1N88A 2YKOA 2VKRA 4TVAB 4QWEA 1TP7A 2K7JA 4OZ3A 5KFOA 3IGNA 4N76A 2OFHX 3U1NA 4FKXA 1DURA 2DGVA 4OLOA 3ZNUA 3SSQA 2MKIA 1U1KA 3TRGA 3IO1A 3D3BJ 4ZVOB 2NZCA 3NKYA 2HK3A 2HSEB 4FF4A 4CYUA 4NYZA 2A2CA 2HFNA 3ENWA 2MGZA 4IDKA 3I9V9 3CDUA 3G96A 1X0PA 4RKUC 1SV5B 1TMMA 2DKOB 3G2XA 5KFLA 2BV3A 2DYAA 2WVBA 2ZKUA 4GC7A 1TQLA 4Z2XA 2UP1A 5D0GA 5ETVA 2CDQA 5DGBA 2A10A 5B0GA 3P5BP 5DDPC 3M6VA 3OVSA 3VGTA 2RUSA 3Q8RB 2Z2LA 3P8BB 3RJMB 3K5PA 1S76D 5EWEA 1LKZA 4DQPA 4R8UB 1NLKL 3IRXA 3UDLA 4DV2J 4QWAA 2MDAA 1WHVA 2MKCA 4FKYA 1M1HA 1G7CB 5KT2A 2FIUA 2OEMA 2HWHA 2XHWA 1YJ9S 2JSXA 1NUEA 2PI5A 4WXWA 3MEKA 3MEDA 5B0AA 4ZP9A 2FJWA 3DHXA 1RA6A 1ZA1B 3HHDA 2RHSB 3VVTA 5C42A 2NR0A 1EIYB 4O3NA 4NLOA 3C6UB 2RVJA 1F9HA 4IFVA 2R8HA 4DV4F 4IR9A 2DBBA 3WDOA 1N36F 4QIVA 3MECA 2L41A 2D9OA 3SDEB 5E2QA 5GVQA 2ADBA 1VBKA 1M90T 3R5CA 2YKAA 1SIWB 1UA0A 1HYSB 2IDLA 3I5AA 3JTOA 1EB0A 2OTLS 1GMVA 3G9CA 4USUA 1NKEA 2DXEA 3SYZA 3TA2A 2OPSA 3DRRB 3LAMA 4OZNA 2HQFA 1KFDA 1ZYQA 1XR5A 4OZJA 1DTQB 3P96A 1CJVA 4HVZA 1XERA 3PW7A 2PI4A 2LU1A 3VAMA 4TY8B 4J5OA 3PNIA 5DJBA 1SKUB 4OX8A 4BLGA 4OJ1A 2WOMB 2Y8YA 2KFZA 1RKJA 2B51A 3KK2A 3QBCA 2K2PA 1GK8A 3FBBA 1NBEB 4DV7F 3QFWA 2X1GA 1AFJA 2YWKA 3QSYB 1X4FA 1BD6A 3OR2B 5HQ8A 2HQGA 3CPWR 4MJKA 4H54A 3UR0A 2ATCB 2J7KA 4QQBA 1MMLA 2FLLA 1OPIA 2E5LF 2B9YA 4NPOA 1SPBP 4X4UA 1GMWA 3P5TL 2WSEC 2C2EA 3TJ9A 1VQ4S 4KIAA 2NLWA 1RDRA 1ACMB 3SSRA 3C16B 3GU0A 5K5MA 3AFGA 3D6FB 4FP9A 3A8JA 3G6YA 2AT1B 4YOEA 5SZTA 3CJRA 2KT2A 1CJTA 3K17A 3AXMA 3WZ0A 5F8MA 4J91A 4DSIA 3CMQA 3HDSA 4MK8A 3AB2B 4HHUA 3D28A 4IH5A 4BCAA 4DV4J 1YJRA 1N36J 2HNZB 4X4TA 2CQPA 3C14A 3SI8A 2MKJA 4TXSA 3SFUA 3D3CJ 2IM0A 5K14B 4J9LA 3O44A 4KPYA 2E1AA 1RU1A 2YNGA 1J5EF 1CULA 3MMJA 4QCLA 1H3DA 2J76E 4DPOA 2R4FA 2OJ3A 2OPPA 1TU0B 2HEKA 1H98A 1WG4A 2DGQA 2V6AA 1WF0A 3CEDA 4IRKA 2QYGA 4GVBA 4ZVUB 2ZBPA 4CT8A 3MEGA 3L9ZA 2AYMA 1I3OB 3T5JA 3R6LB 4ZP7A 1ELOA 3MCMA 4RW6A 2RE1A 3VR1A 1Z1ZA 3ILIA 1XC9A 1PCAA 1O5JA 3BGUA 3K5LA 5DG9A 2DVIA 4DHVA 4WZMA 4MIWA 1PBAA 2OSRA 1VRQC 3NCRA 5E5NA 5JXSA 2HFZA 3KK1B 1RK8A 2Y1LB 2HMIB 2H5EA 1C1CB 2IA0A 4ZCKA 3LGNA 4DV7J 4ZVPB 1FF2A 4KGZB 1D3WA 3TQ1A 2F9DA 1Y00A 3RB3A 1PO6A 2RU9A 2HPUA 1W7WA 1U24A 2OHDA 3MXHP 1VRUB 4EYHB 2ABYA 2MSTA 2E5LJ 3KJNB 5BJRA 4Y28C 2BE7D 5A6PA 2Z30B 2R2TA 5CYQB 4OHXA 5M2RA 4IRDA 4KAIA 2RD5C 3OHBA 1J5OB 4G6VB 2R3VA 3PYFA 3MHYA 4ICLB 1RAFB 3ZFVA 3OL8A 3MM5A 2DB1A 4F4AA 4DX7A 4PG8A 1IKVB 2HFOA 4Q2LA 2HS0A 4MKYA 3KLIB 4DV3F 3EDRB 3T3FA 3W2WB 2A18A 4RNMA 2ZH1A 3TAMB 3PO5A 2LQJA 2NXJA 1BQMA 1T7PA 1J5EJ 3HVTB 4BHQA 4AL6A 1S7IA 1FFWB 2DGOA 1FFSB 3CDAA 4F3QA 2I0XA 1IBKF 4MK9A 4DV1F 2CJKA 2F63A 4F36A 3KJVA 4ITSA 4P73A 5E41A 3GPAA 4WE1A 2V8VA 3H40A 1IJEB 3HSDA 2EPIA 4B3MF 3LAKA 5HMZA 2ZC3A 2OSQA 3GYGA 3UCUP 1S59A 2AGPA 4OFZA 3H2VE 2DNNA 2XEXA 4RPFA 5DDRC 1S1VB 1HBOB 5D4LA 4OZ5A 2LEPA 4DQRA 4CLUA 5AE2A 3CJTA 2GC8A 2IY5B 2UVUA 3R9LA 3LWLA 3GR0A 3OL6A 1U6FA 1QSYA 4QZVB 3RB0A 1X9MA 1VQSA 2LDIA 4CTAA 1T3NA 1EX8A 3US5A 1NU4A 2ASDA 3NBPA 1YHQS 2MZTA 1X4CA 5K8NA 1VCTA 4IQMA 2HQ3A 1Q7LB 2AJQA 2M8HA 2Y3YA 1KBRA 3LO3A 3ILOA 3MCSA 2CDRB 1IQZA 2BJ1A 1YBTA 1IKWB 4ZCIA 4USIA 5EDWA 3LANA 3IAS9 1C4AA 3MM9A 1RYSA 4WKYA 1G2EA 1LOUA 3MFIA 3LOUA 4LF1A 1S1TB 1S5ZA 3NCPA 3GLJA 3T5HA 3C66A 2GMLA 1DTTB 1O6XA 1QAYA 1FXLA 4KHRA 3S1TA 3NNCA 1Y10A 4K4XA 1W26A 4TQSA 1QE1A 1HHSA 4KGMA 3OW2R 1HNIA 4RNFA 4DV3J 3HXMA 3QQCD 3H5SA 3BQ2A 1SJ4P 5J1NA 2Z2MA 3OTCA 3VQTA 2HIQA 4RW9B 2ZHOA 2R8IA 3CJ8A 4RUBA 4OHWA 4N41A 4CLFA 5HBMA 1RHUB 4DS4A 4U8VA 1IBKJ 4DV1J 5G0RB 2ILYA 3PX0A 3NGDA 3DRSB 3TEHB 5AT1B 4Y34A 8RUCA 3J7YU 2HHHF 3BKUA 1S0MA 1CC8A 4CO0A 1HQEB 1WKJA 4DQIA 2QTWA 2Q1LA 4B3MJ 2XY6A 3THPA 4YDDB 1SV5A 3QYYA 2NYHA 2VA3A 4FS2A 3BKFA 4LR7A 1IWAA 3KOAA 1P27B 4O4RA 2AWZA 2J9DE 2ASJA 2HNDB 1U47A 5HVFA 2DNZA 3AA9A 2DXFA 3L95X 1YDLA 3GFXA 2VJVA 3QT8A 1YLXA 2ZWPA 4QIWD 1GQEA 3M2UA 5CH7B 3IGVA 5DG7A 2IJFA 2D9PA 4ANDA 2CPZA 4ZVSB 4KGKA 1KNZA 2J9DA 3TA1A 3NXZA 2DR5A 3E8OA 3CD6S 3CC7S 3UN3A 1EHWA 1B7FA 4ANCA 2JLFA 1PJ5A 2DR8A 1HL6A 1U1PA 2P2CB 4R8UA 2B4PA 2EBGA 1KKHA 5FD1A 4ZVQB 3ZNJ1 4DCJB 4Y2AA 3G86A 2J9EA 3RU0A 3TZYA 4KBIA 1JB0C 1C2PA 3H5XA 2POKA 1YTYA 3C8YA 2BJ8A 1NMEB 2BKOA 5D6GA 5ETSA 2K7KA 4MKBA 2VOOA 2MKSA 3D0GE 1HNZF 2PMWA 1Y3JA 4WP8A 3W5ZA 3QIPB 4A8QA 3DU6A 4HYKA 2CG8A 2GAHC 2LQBA 2VKZG 3OXGA 1VFJA 1K73T 1LWCB 3RB6A 1YWXA 3M8YA 4KY3A 1AW0A 3TQEA 5IQ6A 1YRTA 3C6TB 2M4MA 2DJWA 1H7XA 3HO1A 2G13A 3M9NB 1TKXB 3M6UA 2XGQA 3OL7A 3ZZZA 3PHEA 4DS5A 2R7VA 3PR4A 1D9AA 2ZJPQ 4ZJOA 3NS6A 4Q7AA 1BLUA 3IWXA 1R8BA 1KRPA 1FEEA 1TKZB 4X62F 2R8KA 4EK2A 5EX0A 1RBLA 4ZVGA 2CWXA 1DTQA 2CFXA 3A8KA 3FCVA 4IQXA 2UUBF 2G1HA 3K2YA 5KFWA 4O23A 4TY8A 4E2FB 4KO0B 2CPYA 1FK9B 4Q8EA 4FPIA 2XSFA 1JLAA 1KLMB 3LP0B 1V5VA 4RW7B 2PC6A 1FD2A 1XNRF 4LBIA 4FZVA 1UEKA 1SQEA 2X1BA 3JAMY 1S99A 2YKPA 3AAWB 4NI2A 2B3TB 4KKOA 1VQ8S 5L38A 1F2HA 3MAAB 4WIQA 5GADI 4HHJA 4WFNQ 3LP2B 3QRPA 4UOHA 4NE9C 4X4PA 3A8IA 2R2SA 2AV5A 3DRPB 4NLGA 3LUYA 2M88A 3TA0A 2UUTA 2JHEA 2ASYA 3DXSX 1FDNA 3HP6A 3VAIA 3F0NA 1UW9A 3J7YI 3F44A 3GIKA 3L7PA 3P45B 2JL9A 3ISND 2O3DA 2KVQE 1B64A 3C16A 4DQQA 2ZOGA 4PAAA 1Q8KA 2HHUA 3KLHB 3BR9A 4ED6A 1HNZJ 2JJ4D 1RTZA 4NLXA 1X4EA 2AZ3A 5AE1A 3TJAA 2DNMA 1W2BR 4PQUB 3IR7B 3ZZRA 2LU2A 1BE4A 5L9XA 1ZH5A 2VICA 1N8RT 2J6TA 4P6QA 4DUTA 1FWPA 2MQNA 1S4EA 1NHUA 2F1FA 4F4KA 4O0IA 4LVNP 1JJCB 2V69A 2BABA 4ZA1A 4O3RA 4DPYA 2IA6A 2RQ4A 2IJRA 4GO7X 3MR5A 2QC3A 3BH7B 4URGA 4GO5X 4RBVA 1M5VC 4JV5J 1FA0A 1FERA 3EYZA 2F4FA 2KL8A 2FJVA 2Y1IA 2KG0A 4X62J 2XNRA 3R1LA 4OI3A 3BDPA 1SH3A 3KNAA 1NB2A 2QLFB 3U1MA 5LXRA 4QPXA 2PMHA 2KFYA 4LBHA 1L3UA 3P6YC 2YQ1A 3TX0A 4RX6A 4EFAC 2YWGA 3VQSA 1FFGB 1JLGB 4FVCA 1HIYA 1KQKA 1XNRJ 2W7PA 7AT1B 2V63A 1IXKA 4TLRA 5JMNA 3FVYA 3KK1A 1T03A 1C1CA 2LEAA 5AXLA 2HHSA 4C97A 4NRTA 2WW4A 3PJ9A 4OV6A 2FGOA 4IKAA 2OPQB 1FE0A 2R2RA 4P2XA 4PWWA 4QOTA 2CPDA 2GO9A 4ECWA 1Y11A 2HLTA 3CCQS 1TKTA 3W5YA 1YVFA 2DGTA 1RTIB 5FDLB 4M5MA 4NEZA 4A8KA 2QJ3A 1RISA 2DCLA 3PEHA 3RW6A 5CYQA 5HLFB 5K8PA 4PG6A 2PN6A 2W2PP 2L48A 1WF2A 2UVRA 1R6YA 3AOBA 3PYGA 3JAMU 3PCOB 4O4GB 7FDRA 1OYEA 1HARA 2EFGA 1FO1A 3WBZA 4LUBA 2PA8D 2NUUG 2YBVA 4ZJLA 2X51A 5ADZA 2IMOA 1Q0NA 1EETB 4FXDA 4PRFA 4RW4B 2ASLA 1O8BA 1A7GE 1IKXA 3KLIA 2ADCA 1LWFB 4ZKAA 3OHAA 2ZDPA 4PEOA 1S0VA 1RT6A 3HULA 2C2ZB 2IVFB 4EYIB 2JFDA 1HBUB 4EO8A 1UL3A 1RAGB 4O3QA 4FYDA 1YX2A 2VG5B 3VAFA 3KYLA 4QWCA 3TZXA 3DRXA 4I6WA 5D0EA 2IRYA 3AQPA 3Q23A 2NCKL 3IG1B 2DNPA 3D9BA 3BGOP 3MAHA 3NRBA 4CLPA 3BQ0A 2A2DA 3QIDA 1HQ2A 4FF2A 3UVJB 3CD7A 1YI2S 3AJ1A 3UDVA 3M6WA 3C2PA 1N5TA 3TWZA 3EDQB 2QA1A 1SKSA 3IN5A 2ACYA 4PXCA 2DH7A 2NXUA 1SH0A 3DLGB 1NZAA 1JX4A 4I1TA 2IC3A 1KONA 1X9WA 1U48A 5LMNF 1TKDA 2XC9A 4IOCQ 2OD6A 3BPDA 3IBCB 3UR3C 4I64A 2I1RA 2JC0A 1WACA 5KOXA 5KFKA 4USKA 6FDRA 4ZN1A 4GRSA 2BOPA 1HMVA 5J2QB 1RGVA 3KMQA 1WDDA 1IKWA 2RS2A 3DN9A 4Y2IA 2MSSA 3DC2A 2AYEA 1S6PB 4GKJF 2C3UA 4F4YA 1YITS 1H38A 3TJ8A 2ZD1B 5F0WA 5ETLA 3E01B 3V4IA 2E7WA 2HFSA 3MD1A 3CJ5A 1L3TA 1LQ9A 1WKKA 4RNHA 3PX6A 1VBZA 3QRQA 4WWSA 2N4CA 1HWIA 1NKCA 4RR5A 3KKFA 1RHKB 3DI6B 4UY85 1IUJA 3D1QA 5HO4A 1DFDA 2D74B 2DRAA 2MKKA 1EAYC 1JLBB 1VQMS 3PV8A 4NX9A 1GMWD 2WCXA 1WD6A 3Q8SB 2JC1A 2BQ3A 3BEGB 2FTRA 2ZC4A 3CNQP 1LWEB 4MMOA 4JI3J 2B4VA 1YJWS 3W9IA 3W8PA 5G0RA 3AY0A 1XR6A 4DXLA 4V1Ak 3DYAB 2AZ1A 3U02A 4C11A 3R5BA 5E33A 4ED5A 2ZBRA 1TFWA 2W2MP 4ZLJA 3ZZOA 1MWQA 2KHDA 1UKUA 2QN6B 4C8LA 3H4BA 3HCXA 4DPTA 5KG4A 2LLZA 1QUPA 4IG0A 1C4CA 3TAQA 1S4FA 3HJFA 3L09A 4HACA 1F2GA 2L9DA 3BGFA 4ELVA 2XI2A 5LMNJ 1R0AB 5HP1B 1REVB 3N79A 2HKEA 1FRLA 1EP4B 2HGLA 1R6VA 5J1EA 5CXTA 1U8WA 3Q24A 4Q0BB 3JYTB 4LSZB 3SQOP 4YB7A 1PSDA 1NHVA 1EZZB 2HWTA 3VV2B 1RT7B 2ZFHA 3W62A 1MNEA 2WBRA 3DCAA 3OTOF 2Y1RI 2KZZA 1XQIA 1KVJA 2FC9A 5C24B 8ATCB 2R9LA 2V68A 4BC9A 5LSOA 3D67A 4GKJJ 1JXVA 4ZCMA 4J7CA 2KTQA 1B7YB 2CQDA 2XS5A 1Q79A 1WG1A 4KHMA 3IBWA 4NCAA 3CMES 1G1XA 2GVZB 3GYXB 3QIPA 3OVBA 3SCJE 4G65A 1QLNA 2B56A 1TTHB 3D1OA 4M5JA 4IUFA 2E1MC 1PKUA 2DHGA 3MM6B 3ET6B 2DO0A 2ZITA 1TVRB 3QGHA 3DMJA 1AXQA 3DGPA 1EKSA 2LFVA 1S12A 2BJ3A 3KLVA 3DRYA 1RCOB 2HS3A 1ZZNA 2LQ5A 2OIHA 3R5DA 2W9CB 2P5VA 1X4GA 4WP3A 3Q2TC 2CPJA 3CB4A 5M2UA 3AB4B 1SB6A 1HWKA 2V4JB 1S6OA 1VISA 3CJKB 4OI4A 4LMZA 2W9AA 3NNHA 2B6AB 2HVZA 2YX4A 3RRKA 1TKZA 2MQQA 4MYUA 1RAOA 3FUYA 4ZVTB 1U2CA 4W98A 2VC0A 2GFFA 4YR2A 3QJJA 4RW7A 3LP0A 2NZ4A 2CADA 3HKZD 4OZ0A 1X7VA 4DV6F 1N5YB 3D6TB 4HH1A 5F8NA 2YNIB 3T19A 2HGMA 3RRHA 2CJQA 1T8EA 2R7XA 2V2VA 2KJWA 5C7PA 4IG3A 1GTEA 1R43A 3FEXB 4DX5A 1OJ4A 1Q5VA 2IM2A 5KFJA 4JI8F 2JLGA 3AODA 4DX6A 3CD0A 4CRJA 2XLKA 2NQPA 4GKKF 4CLWA 3OTOJ 1N48A 3FZ2A 3ICLA 1OQ6A 2E1RA 3DLLQ 3HHLB 1LNQA 2AX0A 2HQCA 4YQWA 5GAGU 1LW2B 5B0DA 3MWBA 3D2WA 4C0BA 4HTJA 4P7TA 3KLHA 3BGRB 1UVMA 2ZHAA 2VJUA 1O0PA 2GVDA 4C3MA 4IYQA 2N82B 3ADAC 2FLNA 3ETOA 4PQUA 1KVKA 2YWFA 4JP8A 4I56A 3X1LB 1Y5NB 4F4ZA 2J0SD 1K0VA 1WWHA 4AXIA 4A46A 1B3TA 2VIHA 4CI0B 3AXKA 4NLQA 4PQAA 1OQ3A 1GT8A 5IT9U 1R8HA 1F9FA 5IV4A 1U0HA 1D9FA 1PILA 4IO9Q 1ICEB 5KG2A 1Q53A 3W65A 2K1RA 2C3MA 2GJIA 5DS7A 2YX1A 5DLGA 5KG7A 2BANB 2CJXB 4FXVA 3OFHA 5GAHU 4R5PB 1S10A 3K5MA 5A0YA 1XTZA 3T41A 2EFPA 4LF9F 1RABB 3N6NA 1K9MT 4CO5A 3ISZA 1NK4A 3GJSB 2YNHB 2P9CA 4DQSA 3RZAA 2CUYA 1GXUA 2Z58B 1FNXH 2UVWA 4LSNB 2QG9B 4L3NA 1BWVA 4DV6J 1X8DA 4DBQA 4MT1A 1WNEA 2OI2A 2QL7B 3PYDA 1HQUA 2DXDA 3UDEA 5H9EJ 2VD3A 3N28A 3MMBB 2LYVA 4PWDA 3W63A 2ZOFA 3CCWA 2W8KA 1X9SA 2JWNA 4JI8J 2IBOA 3JSMB 2DIUA 4RUAA 2YQ0A 3FQKA 4GKKJ 1D1UA 4QU7A 5CA5A 4K4VA 3S01A 3TVKA 2CZ9A 4LRCA 1HW9A 1PG5B 2FVCA 3M4XA 2BJEA 3CCLS 4JI5F 3M8ZA 4TNOA 2CNOB 1RWVB 2RAQA 2ALYB 3HSGA 1CLFA 4QYRA 3FSIA 5IM0A 4O4GA 1HI8A 1U1MA 3NAHA 3I9ZA 1VJQA 4G3IA 3BN4A 3GYNA 3CJ0A 4RW4A 2MGZB 2HW3A 4P7VA 4CLZA 1LWFA 4JI2F 5KFPA 1RSCA 3BSAA 1SJRA 5J2PB 2XWYA 1IR2A 1HBUA 4ECZA 3MUVP 1NCLA 2KT3A 1TK0A 2G2OA 1KD1T 1WHYA 2FC8A 3T6BA 2AU0A 2YNFA 4CNYA 3FFIA 4OI1A 1QSLA 4LT6A 1ZPWX 1VIOA 2ERRA 3HSZA 2YX7A 3CJ3A 2DCUB 3RBDA 1V3SA 3PW2A 2AIRB 2FQQB 4KTQA 2HAFA 1BUXA 4YHHF 3EICA 2N4DA 1NSAA 4LBPA 3IG1A 5B0CA 2YTCA 3L7UA 4NCBA 2QX0A 2FVQA 1T9WA 4OYMA 4LF9J 3UVJA 1FDDA 3H42A 1OWXA 4JV1A 1SJ3P 4F4XA 4LF4F 1RWNB 1RHMB 3MDFA 3QT6A 1RQ0A 5L1LA 2WB1D 3DLGA 4YUDA 4KGXB 2B43A 2CKWA 2FVSA 4TU8A 4LF6F 5EWGA 3MEDB 3TW0A 2PEBA 1U45A 3R5JB 1PYTA 4GMKA 2VQEF 1WC5A 4BWJA 4BBYA 3DLHA 1QD1A 5D15A 1QAXA 2DY9A 1HD0A 4IFVB 4WYLA 1UFWA 5J2QA 4DSFA 4LF2A 2V8DA 4O3SA 2FY8A 3ZZPA 2M52A 5E7OB 2VBYA 3J81U 3E51A 1XBWA 3KDNA 1HPZA 2YKQA 4UZCA 5IT0A 1C0UB 1S6PA 2IM3A 4NLVA 3C15A 2HYIB 3DFEA 2ZD1A 4M1KA 1RTJA 2WTFA 4ZIWA 2BACA 1E6VA 3BSOA 1KOHA 3IFEA 2CYYA 5BYSA 3LP1B 4K5RA 4CO4A 2FD2A 1HBNA 1S1UB 3R5AA 4YB5A 4QBUA 1RWMB 2OPSB 1QY7A 4QR1A 4O3PA 2XZTB 3I6PA 1RP5A 4JI2J 1SUQA 5CYJA 1CJVB 4F50A 1UP1A 1RLDA 2MHEA 1MROA 2VG7A 1OO0B 1R3NA 2A1BA 2PEHA 1LWEA 1LK5A 1EQMA 1VQYA 4DX8H 1DQAA 4YHHJ 4K5SA 4KT0C 1UA1A 1RBAA 2AP6A 2AD9A 1VLYA 1RTDB 3QJPA 3R1HA 3KLFB 4DL6A 3N9UC 4M5IA 5L9NA 2K3KA 2ROPA 4L6V3 2NXNA 3BBBA 4YDXA 2O1PA 4XPCA 4USTA 2V5HG 1GXLA 2HVIA 1U02A 2YH1A 2W2NP 2C28A 2DK2A 3V6JA 2XYGB 3A8EA 5EUHA 3QNWB 4LF6J 3FRYA 1R0AA 5HP1A 1REVA 1Y7PA 4X66F 1CJTB 3NG8A 2ATLA 1HLWA 1WG5A 2VQEJ 1FTCA 3H5UA 1KTVA 3M6XA 4PWUA 4C3KA 2R7TA 1WC6A 5HVHA 5EWFA 3W61A 2ZZTA 2ZKTA 2DHXA 1QSSA 3MOJB 3G4SS 2OPRB 1RT7A 3GV7B 1CJUB 2L9WA 3BR8A 1AZSB 4ZMMA 2DNQA 1C1BA 4ILRA 4J9MA 4TU9A 2DHAA 1Y9OA 3R27A 1CULB 3AD7C 4G1QB 4B3TF 2PFDA 4CH7A 3PW5A 3HT0A 4WZQA 3CCJS 4ED2A 5KG0A 2OPPB 4DOZA 1H6KX 3A3NB 2BR0A 2IPOB 4ZS6A 3H90A 4DZDA 2VU5A 2FJBB 2CPEA 3IP0A 1N5SA 1U1RA 3MM6A 4EUVA 1UZHA 5GAEU 3M7VA 3OR1B 2F3JA 3K57A 1FNOA 4FYVB 5A8WA 4J9PA 4AUKA 2OGUA 4DL0C 2ZUAA 3B6BA 5IS2A 4UQTA 2HRUA 1T9YA 3CSKA 4ECXA 2W1BA 2GO8A 2VF3A 3EX7B 2OELA 2W9CA 2KU7A 1PAEX 4F2SA 5KAKA 2VONA 1U25A 1FVQA 3CJKA 5HMYA 2I2YA 2LVWA 2ZH2A 2VL1A 4ED3A 2JFKA 4E8UA 3Q8QB 4ZPTR 3WIVA 2R7WA 2X1AA 2BZ2A 3UN2A 1D09B 3PW0A 1WF1A 1DRZA 2DPJA 2V2ZA 1JLCB 4NL5A 2DGUA 1N34F 1NK5A 3R97A 2R7UA 1N5YA 1JLQB 4JBCA 2RKIB 5JVHQ 1Q81T 2M7SA 2YNIA 2Z2ZA 4X66J 3TR5A 3TP2A 4CLLA 3GZ7A 3CIMA 4RUCA 1H2TZ 4I7FA 2JEFA 2NXCA 2E5JA 2C2NA 5GMKa 1QTNB 3M8RA 2MLZA 3KXDA 3SXLA 4Z7CA 5KFTA 1WC0A 2EKNA 2B7CB 4WXOA 1X4BA 3DLEA 1BQMB 3JB9k 4B3TJ 2MJNA 5L39A 2AGOA 1SQFA 1LW2A 4ZLNA 1M0SA 1VQOS 2X1FA 5C5JA 3JTNA 3QT5A 5IZHA 3MM7B 5IC6B 1F5BA 7FD1A 2R7SA 5DZ7A 3DXBA 3QSIA 4Y2KA 1KDNA 4ZPBA 3MMAA 2JRSA 4B9MA 1V9OA 4I69A 1XIQA 2OO4A 1ZAWA 1EARA 1VQNS 4YB1P 2GQQA 3Q2SC 2RRNA 1H2UX 2F40A 3VF0B 1URRA 2KO1A 3MPWA 1GXTA 2FDNA 4Q45A 4C8ZA 1RT5A 3GV5B 3PIOQ 1HBMA 4DCPB 4Q44A 3R3TA 4CTAB 4C8YA 4AE5A 2M0GB 1K1SA 1TL1B 3JSYA 5THWA 2QLXA 2DR6A 1RJJA 3BQ1A 4DPWA 4ES1A 4NXMF 2P9GA 2K06A 1Q8IA 3PR5B 2HZCA 5KFZA 3GMGA 3VGSA 3PM9A 1RWWB 1S9EA 4LSNA 2VFSA 3WHIA 1B0PA 1N34J 1T9VA 5ETTA 5IWAF 2XWXA 3G8SA 3WX8A 3ETMA 2JVRA 2W01A 5IC4B 5C2GA 1YK9A 2E9ZA 3OJSA 1V5IB 2NREA 1U1OA 1WDTA 1MN7A 4OZ2A 1M5SA 2HHWA 3ZXWA 1JIHA 2DHHA 3D54A 4W92B 2CZ4A 4M94A 3K0JA 3MMBA 1QE1B 1YJ7A 1HNIB 2WBMA 4J90A 2M70A 4A8SA 3NGTA 1SKRA 3JSMA 2LECA 4OYAA 1RAHB 4A48A 4WU3A 3CD5A 4ZVFA 2QSWA 2W4DA 2GJFA 1V3ZA 1CBKA 3W7BA 2B8QA 1RUSA 2MJUA 4TKTA 3S8SA 5KT7A 1LW0A 1T94A 3IR5B 5HBMB 5A8KB 4RO0A 3NEKA 4W90B 5L1IA 1YRUA 4ZP6A 1RAJA 3MCNA 4QR2A 4WP9A 1F1BB 2EC0A 3BGLA 4NA3A 3KUGA 2CVIA 1SXLA 3BBCA 5H9FJ 1SC4B 3GR1A 4C0HA 3DLJA 3OUYB 5J2PA 1MN9A 2FZGB 4B9VA 5CCLA 2Q6CA 2F65A 2VH7A 4LFAF 4U9RA 1B70B 3M9OB 1RTHB 2LCWA 3EGVA 3K7RA 2R8GA 3RUBL 4DF8A 3GSDA 3HLUA 1FKAF 3M2UB 1U8SA 3LH2S 5DQGA 3FEZA 4MKVA 2OP5A 2VBXA 3KDOA 3C46A 4RUHA 3PW4A 3UNGC 3DKDA 4NLYA 4M8LA 4AT1B 1FWKA 3LTOA 3T6JA 2LXIA 4NXMJ 1VQ5S 5FIIA 5M2PA 1X4DA 2I5JB 3BH6B 2UXCF 4J9NA 1RZMA 3BKTA 1WEXA 3UCGA 1NPKA 2BBEA 1DY3A 1FRKA 1B0TA 4F3OA 1NDPA 4DEZA 1X31C 2MZQA 2N7YA 3OSPA 1UEVA 3RAMA 1NEEA 5IWAJ 3GIJA 3LWMA 3IA0A 2ZVSA 3EXCX 2VBZA 4HL9A 1S49A 4PPDA 4F04B 3NS5A 1WORA 4P75A 4Y00A 2FJAB 4OL8A 2XBPA 4RL1A 4N56A 4EBDA 3AOCA 1S7HA 1CJKA 2M3DA 2B9WA 4DV0F 4K4ZA 1R0BG 3ISNC 1WUUA 1P1LA 2PDAA 3DHWC 3NAIA 4AFFA 3M9MB 2VUGA 4MH8A 4LF5F 3FGVA 2XG8A 3SQGB 1RT4A 1C0UA 2LKZA 2HGNA 5D3GA 2ZZMA 1SCJB 4Q5VA 1Q95G 2CNKB 2MZRA 3M8PB 2N3OA 2WW8A 2OEJA 2HBRB 2B9EA 3POTA 1B99A 3LP1A 5MLCV 4KC5A 5D4PA 1S1UA 1Z2LA 3BF4A 3UD4P 3MTJA 1LXNA 3V6DA 2C2OB 5ETRA 1DBDA 4KSEB 4CO3A 1FTRA 3FBFA 4Y2CA 3Q86A 3PFOA 4DL5A 3ZTPA 3M2VA 2GS8A 4P2FA 3PY8A 5KFXA 1PYOB 1ZOTA 3G71S 4LFAJ 1SL2A 1JLAB 2MKHA 2FUG9 4OYBA 5LL6d 2ZH5A 2AYBA 1VYAA 3TYTA 4ECUA 1NNDA 4NI2B 4KKOB 3HF5A 2RS8A 4Y65A 5F41A 1X5SA 2HRYA 4DUZF 4C48A 1RTDA 2GHVC 3V4MA 3KLFA 2UV8A 3QZ8A 1ZBTA 5KFIA 2UXCJ 1N54B 5C25B 1ZETA 2DT9A 3D66A 2B4UA 3R2DJ 2W24A 1DLOA 3MPYA 3HM9A 4M5DB 4YN3B 5IOLA 2DGWA 4KQZA 2XQCA 3ZZ0A 3GWCA 5B0BA 4YS2A 2Q66A 2M5YA 4FVMA 3VCDA 4C4WA 5ETMA 2MQOA 2KXFA 2Q3PA 2ZEJA 3TNVA 2FY1A 3Q8PB 3VAKA 4DV0J 2OPRA 5F9LA 1CJUA 3QWPA 1N33J 1AZSA 2KYZA 4X4NA 2IRXA 3IR6B 1Q5YA 4LF5J 4ED8A 2VFVA 2OAUA 3JSRA 2HK2A 2J0QD 2X3DA 1RT2A 4IOAQ 1WOSA 3THTA 2LMIA 3K58A 4U7UD 1F5CA 2R7QA 1NJXA 4U7CA 3MR3A 2CIMA 4G1QA 2J8AA 3TOQA 2D41A 5D4OA 4EZ6A 2CQCA 2VPYB 4OHZA 2GX8A 1JNRB 5I3UB 4KYZA 3HSJA 3SSSA 3GQCA 3I5CA 3UFCX 3MD3A 4K2JA 1DARA 4WCEQ 1RWKB 1G3OA 3H0PA 2BRLA 4I6YA 2IFXA 1CS4A 1T3OA 3JQMA 1MMNA 3CGIA 5I3PA 2AX1A 2QMWA 5DM7Q 1J27A 3O6QA 1AB8A 3OR1A 4IOBA 1D9DA 4J9VA 4H4OA 3KLEA 2C3OA 1HI1A 4P2MA 3M1VA 3LF0A 1GAOA 2CPHA 4ALZA 2RQCA 3NL0A 2EK6A 2VFUA 1T03B 1X4AA 3THVA 2A3JA 2F8EX 1AUSL 2R2UA 3MPUB 4YR0A 1NAQA 4DUZJ 3GIRA 4I4BA 4RW8A 2MLXA 1NK9A 2QE5A 2IHR1 2QFIA 2YVSA 4F02A 2U1AA 1KVIA 5KFAA 1SC6A 3MR2A 3BO2A 3RTVA 1IM6A 1ZS6A 4ZHRA 1TKTB 3QO9B 1RT1A 2MHNA 3CVKA 2KZMA 3I87A 4LQ3A 2FJDB 1UPMB 3VVUA 4TLQA 3G8TA 1JLCA 3OD2A 5T7LA 4NCGB 3CJ2A 2BDPA 4ID8A 4NA2A 1JLQA 1Q78A 2RKIA 3FCHA 4C6AA 1GH8A 3CF5Q 2FLPA 3KHGA 1BQXA 3FZBA 3H2LA 1KQGB 5A2QU 3KK3B 2EK1A 3DGVA 2HAIA 1IKXB 2DNRA 3OFFA 2QLBB 1RT6B 2WHOA 1QAIA 4PKDB 1KSPA 3D1HA 5DDQC 2B5JB 3S7RA 4A47A 2A6MA 2FJEB 2PE8A 4P52A 4FF1A 3J80U 4PZVA 2UUWA 4Q8FA 3MM7A 3BM7A 4HH0A 1HNXJ 4FF3A 3FK4A 3ONQA 2E1PA 4ENOA 2XMKA 3QGGA 3WQPA 4BWMA 3VALA 4C98A 1WC1A 3HFVA 3GG1A 4EEYA 1VK3A 5B09A 2FHMA 3MF5A 1FKOA 4WYWA 4QYZK 3MPVA 3V6HA 5CQGA 3VZIA 2IC3B 3PRBA 1VQPS 3W9JA 2AQ4A 2CQ4A 4F0MA 4DMZA 1T9XA 1FRJA 2NXEA 1LXJA 2E29A 1SL0A 1TL1A 3L7OA 1NZ8A 1WTBA 2AKWB 2ZBCA 2V0NA 2BEFA 2E44A 2R7OA 1F3FA 1HMVB 3O2IA 2VPWB 3J7ZT 1FWLA 1HWJA 1NDCA 2APOA 2WK4A 2DEJA 1T11A 4ZJQA 4EGLA 3ITHA 4G1PA 1KQSR 2E66A 3M30A 2VHGA 2FZKB 3V4IB 4USWA 3O8WA 2HFUA 5D4NA 1FHTA 2Z2YB 2C3PA 1S6QB 2CJYB 2ZH6A 3LGHA 2GZOA 2XYHB 4UOCA 1MLAA 4FPRA 3I4PA 4QIEA 2ZDOA 5DO2A 1HNWF 3PX4A 5CABA 1S77D 3HD1A 1BWEA 2QLWA 2ZZNA 4QYZJ 3HFKA 4DU7A 3V6KA 2Y0SD 4USHA 5GADU 1MWZA 5AXKA 4KH0B 1RI7A 3SV4A 2W2OP 2ACMA 5KFHA 1ZAXA 4B9UA 1WSVA 3U27A 2YPYA 4ZK7M 3BN7A 4PR6A 1DAXA 5A8KA 3RAQA 3OQ2A 5F0UA 5CAAA 2RILA 1UPPA 1YJUA 2IM1A 5D78A 5KFRA 4C11B 3FJ2A 4N7TA 1FRHA 2XHCA 1VGYA 2EC2A 5KT4A 3PXGa 2BMBA 3OUYA 3M05A 1I5OB 1SQGA 4CM0A 4Y0FA 2HQIA 1UJ5A 3LPYA 3IC1A 5J2NB 3CWJA 3X3UA 3HFZB 4IG0B 3GP9A 2CQ2A 1X4HA 1MSWD 5E3QA 1RTHA 2V34A 3EWGA 2J9CA 4HACB 4PG5A 1T0TV 4JI6F 5KFVA 3KLGA 4DL3A 3D7SB 3KJFB 1IJFB 2W2QP 3W2VA 4XTTA 1JLFB 3NS7B 1HNVA 3R6GB 4DFPA 5J1EB 3I4HX 3A4TA 3TEGA 4ZOSA 5ETPA 3CUNA 2C1EB 2G9OA 3GONA 2FPHX 2I5JA 4DLGA 2AJ0A 1IM4A 2Y9HA 5JVGQ 1CQMA 1L3VA 3B8HA 4EU0A 2PSZA 1FD8A 4ECTA 1VI7A 4UOFA 2XMAA 1CEZA 2AJ1A 4CP5A 3PG9A 3ELHA 4PXEA 4K4UA 3CJSA 2RT3A 1NPRA 2F9JA 1U4BA 2QV6A 1JJ4A 2MYFA 4U7UK 2PGCA 1F0XA 3G6ES 2QZ8A 4CNZA 2RNEA 1RAAB 1OYDA 1HNWJ 1ZM3A 4WIIA 2CQIA 4DDFA 2L3MA 4YFUA 3UQSA 1HWLA 3CDEA 3DMJB 3HKWA 2IDEA 3K5OA 4OHVA 3SQGA 3DGPB 2D69A 3UO0A 5ETQA 2XMVA 3I0RB 2CNLB 4CQ1A 3DLKB 3TUPA 4MTPA 2DGSA 4DFKA 1TAUA 2IYGA 3M8PA 2RUGA 4U8YA 4JV5F 2M2BA 3CO0P 1W25A 4ILLA 2VASA 2DHSA 2DY1A 4F7VA 3DDKA 3M8QB 3PRVA 1CSJA 2J0XA 2KRBA 4C7QA 3J7AN 2IAJB 3MGJA 2BKNA 1OIAA 2HLUA 1K0TA 4DCOB 4H4KC 1UAWA 4XIUA 3RG6A 5KFQA 3HHLD 1QVGR 2BE2A 4JI6J 2JH3A 4JYAF 4N47A 4CWBA 1NDKA 4XPEA 5LOQA 2V2QA 5HAOA 1PJ7A 2QRRA 4D3HA 4ELTA 2MEWA 5BR8F 2JDJA 3GFZA 3RYLA 4IG3B 2RQMA 1R89A 4PCQA 3BPSP 3QWUA 1S1WB 5C25A 4E98A 5FLXU 1TUVA 2V8HA 3HHKA 1VQ9S 2PT0A 2Z0GA 4B9SA 4WU2A 4M5DA 4NLDA 4OHYA 1R31A 5MAOA 3BREA 4TU7A 1KHWA 2VDIA 3K5NA 1N52B 2KDOA 3QAUA 2G0JA 2HHPA 3W3SA 1IR0A 4MIAA 4KFBB 1S48A 3DDIA 4U95A 2G2YA 2K8GA 2Z56B 3Q8UA 2BYCA 1A0OB 1X5PA 2AGQA 2GVDB 3CT9A 2FVRA 4AL7A 4DSJA 2JZ5A 4CCHA 4NZ7A 2KFNA 4IFYA 2XSJA 2E1CA 5CZXA 5K9FA 3QT7A 1XJWB 4L76A 5K8OA 4OJHA 3DM2A 2P8IA 1NJWA 2E5GA 2ROEA 3AJDA 5KG1A 4DG1B 2HHVA 2YXLA 4W4MA 4KPCA 4TY9A 3M8SA 1U0HB 5E3AA 1APSA 2HZAA 2RSQA 4LSLB 3T9NA 2CG4A 4ZDNA 2K1RB 3C3LA 2JEIA 3I0SA 1CPZA 1U1LA 2CA9A 5I3UA 4DL2A 5A0YB 5LT5A 2VDHA 1QVFR 4P72A 4EI2A 2DR7A 3IWLA 3LA0A 5DZ6A 2MQ8A 1TL3B 5EGYA 1EKRA 5KOWA 3HVAA 3HMJG 4KJIA 4LF8F 3SBMA 3H25A 3OVAA 5E3RA 4UT4A 5G4DA 4HR2A 4OZ1A 4BDPA 2GQ2A 4U67Q 4N8OA 4JYAJ 3HK2A 4DR5F 1J2VA 3G87A 1PC5A 2I38A 3JQJA 2KN4A 4R0JA 2BJ7A 1HQUB 5BR8J 1VQ7S 2IRUA 5A8RB 4HT5A 3LALA 2H54B 2ZH8A 3AHPA 4PWDB 1XEZA 1QAJA 3HJVA 1JLEA 4NXNF 5BYQA 4B3OB 1I51B 2VPZB 1F6TA 5D77A 4K4SA 2EFOA 2FJXA 4KH1B 3QO9A 3IS9A 4RU9A 5I42A 3MOZA 1HR0F 3GE9A 3I55S 2HQDA 3V5RA 1UWBA 1KTQA 2JEGA 2C2RA 4NCGA 3NNAA 3GFHA 3DOMA 2AEFA 1S9GA 3MEEB 3HVWA 2RF2B 2XLIA 1NJIT 1UTAA 5IM0B 1FE4A 1X60A 2JNJA 4DR6F 5KFYA 5F3TA 5F8JA 3KK3A 1RLCL 4UY8T 1PAUB 3A3PB 2XTJP 4K4YA 2YH0A 3UPFA 3M2RB 2YWWA 5L1JA 4FYYB 4J9RA 2KT5A 1UMJA 1H72C 2B5JA 2O66A 3TVZA 1A6LA 3BZQA 4ZVRB 5L46A 5CYMB 3TANA 2YNFB 1SBRA 3FFIB 2DNHA 4HT7A 3TAPA 1R8AA 2KKHA 4JI3F 3OJUA 1Y3KA 2WVEA 1C0TA 4CO1A 1EQ0A 4OZLA 2Y0BB 4CIOA 1R0CB 5KFUA 1KN6A 2ZUGA 2BA9A 3LPEA 1TL7A 4Q2MA 1PBUA 1SKWA 5T41A 3H2UB 4DN9A 3JXOA 1JQGA 3I32A 1NB7A 3HHNB 1KWMA 4DR7F 4ID5A 3F73A 3VZHA 3ZZUA 4LF8J 3MM8A 1X0FA 1VLOA 4JOUA 4N5SA 3N6LA 1Q7YT 4DR5J 1YG0A 2J6UA 5HATA 4UOGA 4Y3CA 3I5BA 2W25A 4JB8B 4KV8A 2ZHBA 4DFJA 3EMTA 4FS1A 1NK0A 2VC1A 1S1XA 2DR9A 3VGUA 2MY8A 1DJ0A 3UI3A 4NXNJ 1YKWA 4MK7A 2FZCB 3PDNA 5HN0A 1NPPA 1HR0J 1G4CA 1YJVA 1HPZB 2V4QA 3C15B 2VG6A 4D3GA 5F8IA 2UVVA 3CC4S 1FI4A 1RTJB 5KT5A 4B9NA 3KG0A 1E6VB 1S6QA 3KTQA 4NEYA 3EUNA 2CJAA 3GCXP 4IH7A 2LA6A 4DR6J 1HBNB 4QWBA 2H65B 1VC0A 1IKYB 4DR2F 5KFMA 1U0SA 4B17A 4NZ0A 2UUAF 4WFZA 3D68A 2C22A 1HFEL 2CPFA 1SUQB 2GIFA 2FHJA 4OYWA 3UNYA 4RU2A 2D7SA 1MROB 2VG7B 2XY5A 1WHWA 3TX8A 3MUTP 3CXCR 1KP6A 5ETOA 2E7VA 3VAHA 3FBCA 4OJ3A 1U1QA 4M95A 2H4YB 4HI2A 4OV1A 4DUYF 2GA7A 1T9TA 3UCZP 2SXLA 1K8AT 3RAXA 2V9WA 4WBFA 5B7WA 2HVDA 5KFNA 2BQRA 3CCSS 4DV5F 1OS5A 3NCQA 3T1YF 5J2NA 1O51A 3Q8VA 1VQLS 4DR7J 1WJ9A 1WSRA 1RWUA 3MMCB 1OY9A 3PKYA 2IVMA 4L74A 3W1YC 3QPIA 4O44A 1M1KT 1RAEB 4ES2A 1JKHA 4L73A 1SC1B 4O3OA 1HW8A 1JLFA 1N56A 5LXYA 5E3PA 1H2VZ 4OYZA 1M5KC 4J9SA 2KM8C 3DOKB 4AXJA 4ECQA 3TUIC 2QYCA 1HA1A 3BYRA 3SMZA 4CDIA 2DIVA 2ROGA 3L3CA 2BM0A 5IT9Y 1KOOA 1U7LA 4K59A 3QLHA 1VR6A 1C1BB 1LK7A 4WFBQ 1GX5A 3QGPA 3BDEA 2KXNB 3OTDA 2UZAA 1NH8A 2QFJA 2KM8B 5JUMA 2MZJA 4IO1A 3ZZYA 4I67A 4X2BA 1TMJA 3PJXA 4DR2J 4ECSA 5KFGA 1WTFA 2UUAJ 1UW4A 3ZTQA 1ZM2A 1YIJS 5B0EA 4Z37A 4PYAA 2P6SA 3D4JA 4NZ6A 3VTIA 2G4BA 4DR3F 4N77A 4QJVA 1RB0A 1JXLA 4CH1A 2QA2A 1AYEA 3H59A 3MZIA 3B4MA 1T05A 5A8WB 1NSQA 3B4DA 2AEJA 3I0RA 3DLKA 3HPOA 4DUYJ 5KG6A 3MR7A 3CCTA 3H8YA 5J2MB 3UW1A 1N5VA 2COLA 4IR1A 1UJ4A 4I0WA 4LRDA 2EKYA 4ZCLA 3I56S 2QGFB 5HANA 3OPKA 3M8QA 1PJ6A 3GB0A 2HHQA 4DV5J 1DZ5A 1FVSA 3BYPA 2DNKA 2GAGC 2IAJA 3T1YJ 1LFWA 3OBIA 3FEYB 2XO6A 3GIIA 2YPZA 6FD1A 4KHPF 2Q6BA 1VIXA 3B78A 2MB0B 4JI7F 2N7CA 4PYDA 2VZ9A 2ZE2A 2V4RA 1S79A 5KT3A 4NLUA 5L1KA 3BO3A 4I7FB 2DEIA 4HHHA 5ETKA 4LFBF 4H4KA 3O5TB 3WIUA 4P2SA 3EZUA 1G6BA 1S1WA 4K4TA 2DH8A 4I68A 4MFBB 1I6JA 4I2QA 2F8MA 2VFRA 1RT3B 4C8OA 4I2PA 1WOPA 1XK8A 1GMUA 2AJ4A 3DLEB 2ZH4A 4WJBA 1NK6A 4JI1F 4OJGA 2F8HA 4DZ6A 4KFBA 2XYPB 1TK8A 3EXYA 4L3KA 5E3CA 4ANEA 2RMLA 1FKPB 3NMRA 4TYBA 3MMAB 2R42A 2VOPA 5IFMA 3OSNA 5HL7Q 2XZWA 3CCZA 3EZ5A 5H9EK 3W8GA 4DR3J 1BY9A 3MR6A 2O5DA 4NOHA 4ZPAA 3HD2A 4DG1A 4EMDA 5HJYA 2O67A 4QPTA 1NRKA 4WFYA 1VBXA 4LSLA 3OT9A 4FNIA 1RT5B 3CMAS 2WONB 2ZNYA 1HBMB 3VGVA 1FX4A 3RBXA 2LEBA 4PXDA 1HKAA 1QTMA 1VC6A 1F60B 2PIIA 4TN2A 3FDSA 3GJTB 4PABA 1TL3A 5F8GA 1U49A 4YB6A 5B08A 1YSJA 1Y5IB 3G6VA 3J81Y 4B3RF 1S9EB 1YBAA 1IBCB 2W7AA 4G1IA 2WRMA 2QO3A 5A6WA 4R25A 4K7QA 3HZGA 4KHPJ 3J7Z5 5D0RA 1RWPB 5LMUF 4JI7J 3V81B 2H9ZA 4OX6A 3NWGA 2IIHA 2DNOA 3T9ZA 5A8RA 4LFBJ 3R7NB 2CVEA 2PMZD 3SCKE 4DR4F 1UVNA 2IYIA 3GCWP 4B3OA 1PC4A 1YZ6A 3L4BC 4DPUA 3C6UA 3OXFA 4U6PA 4AQYF 1QDUB 1VQ6S 4UQGA 1LW0B 4JI1J 3SDEA 2OTJS 2VFTA 3MEEA 2RF2A 1SC3B 3NY0A 3R8YA 1OSCA 2UXDF 2XM3A 3BJYA 3ILLA 1Y5LB 3DNCA 2I6WA 5K20B 1HYSA 1N4LA 2HBZB 1IR1A 1LFPA 2RDJA 3ENVA 3Q89A 3M2RA 3AH6A 2DTJA 4C0OC 3EM1A 2HHHJ 3RB4A 3NGUA 4ECRA 3DRRA 1RAIB 1T02A 3DLBA 1TELA 2RIJA 3FMWA 5CYMA 1LV5A 2ALZA 4HEA9 5DM6Q 1YJNS 2HS4A 1RE1B 5HI7A 2CQ3A 1V3RA 5DRKA 3J81j 1AROP 3CE8A 1VRTB 4PUOB 2JOQA 2H5IB 2DNLA 3HHEA 4DSEA 2A6OA 5EX3A 2WOMA 2E7XA 3Q8YA 3TZWA 3AOAA 2E5IA 1NJYA 4F25A 2H1YA 2UUCF 2DPIA 3KFWX 4XAKA 4Y2MA 5KG3A 2W4PA 4R0EA 3OR2A 1XMQF 2C2KB 3HZEA 4B3RJ 3FCWA 2EFQA 1WI8A 2G0IA 1IVZA 5HVGA 3H98A 4B02A 2F7VA 2MLYA 3NGSA 1JK9B 1HHQA 1TZ0A 5LMUJ 5DQIA 1ZTWA 3KJQB 1TL5A 2CQ0A 2KH9A 2VB6A 4TYAA 2U2FA 5HQMA 2BJ9A 2EFNA 2J7WA 4USMA 5EN1A 1CJKB 4DR4J 2MMYA 3MI7X 4U96A 1VDHA 3FSXA 2BRKA 3K59A 2HNYB 5DETA 1I1GA 4AQYJ 5DDOC 2OKQA 2RRBA 4ATNA 2XY7A 1RT4B 2HNZA 2Q79A 8AT1B 2M8DB 5D3GB 4M5NA 1H7WA 2UXBF 3B54A 2DGXA 1KR4A 4L72B 1VQKS 5K14A 4WPAA 3LQVA 4OI6A 3FRZA 2UXDJ 3POTB 4JUZA 2MY7A 5FJ4A 2HZVA 3QAEA 4ELUA 1IKYA 4OYPA 3V6DB 2GJ2A 3DDNA 2KI2A 4ZP8A 3CCUS 1OY6A 3ZTSA 1ZA2B 4K0KF 2BQUA 3GSIA 2R7RA 4X4VA 3M2VB 1R27B 3NP5A 3R5GA 4ECYA 3NWRA 3OFGA 2HURA 4FYWB 4YMEA 2RRAA 4NWBA 2AEMA 2DH9A 4HI1A 2UUBJ 3P49B 3GILA 1FJCA 2YKNB 3A1YG 1R7IA 4QIFA 4OYXA 2FHOB 1BGXT 3NGKA 2FYXA 2UV8G 1UEUA 1UJ6A 3ZC4A 4OIXA 4DR1F 2HMIA 2N3LA 2Z8QA 4FBTA 2UUCJ 4EO6A 2EWHA 4OI2A 1DLOB 2J7UA 2E9TA 1FRIA 1XMQJ 1RADB 2V2KA 3MMCA 4P74A 1HD1A 3IXQA 5ITHA 2VQFF 4RZRA 3NLCA 1VRUA 3MPDA 3PKMA 2C2DA 2C42A 4GVLA 1KC8T 3R2CJ 3ZTRA 3CJQA 4P10A 3W5XA 3PRDA 4AD6A 4ED7A 2ZOMA 4USJC 4CLSA 1Z2ZA 1K44A 2I9SA 2I8EA 4B9LA 3EGNA 1J5OA 3D6HB 2B8PA 5CCMA 2HBQB 3ZO7A 3W64A 3DOKA 1NK7A 4ICLA 1Q4RA 2QLJB 4F67A 3TUZC 4YY3F 3PIPQ 3OLAA 2BKPA 4LR8A 2CQGA 4ES3A 3K8VA 3HX9A 1FXRA 1IKVA 1UVLA 4IRCA 2OLWA 1FJEB 1RT2B 5F3ZA 2V94A 4DWIA 4C2MA 1K47A 3ULHA 2XULA 2Y1JA 2ILZA 2WVDA 3W2WA 3SCLE 2Y8WA 2UXBJ 4RWXA 3SZ2A 3TAMA 1SJ1A 3ENAA 2J5AA 2GHWA 2D1CA 4ED0A 1N6QB 2PFFB 3HVTA 3BO4A 2XB2D 4NLPA 4CLYA 3BSCA 4ETZA 1FXDA 1CS4B 2LA4A 2G2ZA 4WK3A 2ZVIA 5HK4A 4K0KJ 1N32F 5DGAA 2XMTA 4CH0S 2EXUA 4XDDA 1ZAVA 1AT1B 4H4OB 4CZCA 2BX6A 5KFBA 3KLEB 3MFHA 3M1VB 2MKYA 1CC7A 2B0GA 4F3MA 2VA2A 3EPGA 1S57A 1MG7A 3TZZA 2XCPA 1S1VA 3W60A 1HBOA 2LP4A 5J2MA 3FNNA 1Q86T 3LW5C 4M5LA 1TFYA 1WEZA 2BXJA 1RXOB 4RW8B 1L5UA 3WC0A 4Y6IA 1L3KA 1QJHA 4DR1J 3CCES 2R8JA 4L75A 1VC5A 1XWLA 1LWXA 4DPXA 2DRBA 3QATA 1FT8A 1MU2B 5KFFA 4ZHRB 3RBEA 2PO4A 1ROFA 3W9HA 1SJFA 1RT1B 2ZWOA 3ZTOA 3EGWB 3ZZTA 5KT6A 5T7LB 2VQFJ 2HRTA 1WC4A 3FMBA 3PACA 4A8OA 3OXLA 2EG2A 4C8NA 2KXHA 2MXYA 2CJBA 5CHCB 2ZM6F 1AA1B 3CCVS 1H73A 1S1TA 4NMXA 1M5PC 4XDCA 1UVJA 2WSFC 4RLEA 4BC7A 1YZ7A 1DTTA 4LRFA 1ZTTA 2KRRA 2VBWA 4YY3J 4USVA 4DL7A 2V8GA 4MFBA 2YQ3A 3IBFB 1KEKA 1RT3A 2MPUA 1UCNA 4WK1A 2HBYB 1XR7A
chains in the Genus database with same CATH topology
1U0HB 1CJVB 1CJKB 3C15B 5D0GA 1CS4A 3ET6A 1WC6A 4WP8A 4OYIA 4CLZA 4OYXA 1TL7A 1WC0A 4NI2A 1AB8A 5D0EA 2GVDA 1WC5A 4P2XA 1Y10A 1CJUB 3MAAB 4OZ3A 1AZSB 4CM2A 5D15A 4WP9A 2GVZB 4P2MA 5D0HA 1Y11A 4USUA 4OYOA 4CLPA 4CLTA 1YBUA 3G82B 4CLUA 1WC4A 4P2FA 3C16B 1FX2A 3UVJB 1CULB 4CLYA 4OYWA 1FX4A 2BW7A 4WPAA 1CJUA 4OYZA 1CS4B 3ET6B 1AZSA 4OYBA 1WC3A 1CJTA 3C14B 2W01A 5IV4A 1U0HA 3MR7A 1CJVA 1TL7B 1YK9A 1CJKA 3C15A 4OYPA 4NI2B 4OZ2A 2GVDB 4CLKA 4CLFA 4USTA 3G82A 4OYMA 3C16A 5IV3A 3UVJA 4CLSA 1YBTA 3MAAA 4USVA 2QV6A 4CLWA 4CM0A 2WZ1A 4CLLA 3C14A 4USWA 3R5GA 2GVZA 4OYAA 4WP3A 1WC1A 1CJTB 5D0RA 1CULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0H B;  1CJV B;  1CJK B;  3C15 B;  5D0G A;  1CS4 A;  3ET6 A;  1WC6 A;  4WP8 A;  4OYI A;  4CLZ A;  4OYX A;  1TL7 A;  1WC0 A;  4NI2 A;  1AB8 A;  5D0E A;  2GVD A;  1WC5 A;  4P2X A;  1Y10 A;  1CJU B;  3MAA B;  4OZ3 A;  1AZS B;  4CM2 A;  5D15 A;  4WP9 A;  2GVZ B;  4P2M A;  5D0H A;  1Y11 A;  4USU A;  4OYO A;  4CLP A;  4CLT A;  1YBU A;  3G82 B;  4CLU A;  1WC4 A;  4P2F A;  3C16 B;  1FX2 A;  3UVJ B;  1CUL B;  4CLY A;  4OYW A;  1FX4 A;  2BW7 A;  4WPA A;  1CJU A;  4OYZ A;  1CS4 B;  3ET6 B;  1AZS A;  4OYB A;  1WC3 A;  1CJT A;  3C14 B;  2W01 A;  5IV4 A;  1U0H A;  3MR7 A;  1CJV A;  1TL7 B;  1YK9 A;  1CJK A;  3C15 A;  4OYP A;  4NI2 B;  4OZ2 A;  2GVD B;  4CLK A;  4CLF A;  4UST A;  3G82 A;  4OYM A;  3C16 A;  5IV3 A;  3UVJ A;  4CLS A;  1YBT A;  3MAA A;  4USV A;  2QV6 A;  4CLW A;  4CM0 A;  2WZ1 A;  4CLL A;  3C14 A;  4USW A;  3R5G A;  2GVZ A;  4OYA A;  4WP3 A;  1WC1 A;  1CJT B;  5D0R A;  1CUL A; 
#chains in the Genus database with same CATH topology
 4ZLL A;  2LDY A;  2NPI A;  3OTB A;  4UF4 A;  3KMS A;  2VV5 A;  5I4M A;  1WHX A;  2W8L A;  2RDI A;  4DJB A;  2DO4 A;  2BM1 A;  4RW9 A;  4C8M A;  1FKP A;  1SIZ A;  3T1A A;  2VOD A;  1JNZ B;  1ZZF A;  4LRE A;  1SH2 A;  1UVI A;  3DRS A;  1N32 J;  4DU8 A;  2B7B B;  1B0V A;  1H74 A;  3N01 A;  4ED1 A;  3CO9 A;  1FKO B;  1HQE A;  2J8S A;  3EGZ A;  3I31 A;  3NOC A;  4J9Q A;  4E0D A;  2RU3 A;  4CLK A;  2WON A;  5IV3 A;  3QJL A;  4LIR A;  2XMU A;  2J0W A;  2HND A;  2QT7 A;  2D3Z A;  3FKB A;  3J7A 1;  1IBM F;  5KFS A;  3PJW A;  5SUH A;  3DOL B;  2FHK A;  1TV6 B;  3IMQ J;  1X5T A;  2PA3 A;  4B3S F;  1P9Q C;  1NHK L;  3IM8 A;  3ENQ A;  2GIQ A;  5AJ3 F;  3D6M B;  2QA4 S;  2OMO A;  1P8G A;  2FHJ D;  4ZPD A;  3R7S B;  5H9F K;  2EG1 A;  1P1T A;  2BE9 B;  4OYI A;  3VAJ A;  3RGI A;  4X4O A;  3CW2 C;  2FB0 A;  3ITH B;  5HMX A;  2V9K A;  1RHQ B;  3P4U B;  5IQQ A;  3M30 B;  3N4W A;  3AQO A;  2KB2 A;  2WVF A;  2CZV C;  2XZD B;  4EBC A;  5KFE A;  3V81 A;  4A8M P;  2ZM6 J;  1S0N A;  4H4M B;  2ZBQ A;  5AXM A;  1ULR A;  3G82 B;  3I96 A;  4F0H A;  3K89 A;  2W9B B;  4URS A;  5F8L A;  3EVW A;  5IT4 A;  4ZIV A;  1BXN A;  4WFX A;  3EVM A;  1M5O C;  1K1Q A;  2DNY A;  4EBE A;  4BS2 A;  3OTE A;  4DI6 A;  3SEO A;  1PYS B;  4NA1 A;  3OV7 A;  3OL9 A;  3MCO A;  4DFM A;  1KLN A;  4N8N A;  3GTY X;  1LWC A;  1HWU A;  3C6T A;  3FBE A;  4UTG A;  5KG5 A;  1RHR B;  3K8W A;  4YR3 A;  3TUJ C;  4UUX A;  1L3S A;  4LQ9 A;  4RNO A;  1E6Y B;  1TKX A;  4X84 A;  1PGZ A;  4ETX A;  5KFD A;  3RBZ A;  3AD8 C;  2RDD A;  2RB7 A;  4UUW A;  4Q43 A;  4HDH A;  3DU5 A;  2ZNZ A;  4AL5 A;  1KQF B;  4C8K A;  4OX9 F;  1N0U A;  3ILJ A;  2BOA A;  3FC9 A;  3EE3 A;  5CD4 H;  3O1L A;  3I82 A;  2HVE A;  1M5H A;  2YKM B;  2AHO B;  4A8F A;  3KLG B;  1RU2 A;  4LRB A;  1FJ7 A;  2BW7 A;  1SL1 A;  5GME A;  4KO0 A;  1FK9 A;  2MQP A;  1FNM A;  1VRT A;  2XI3 A;  4PUO A;  1KLM A;  3W2V B;  2XCA A;  1WKL A;  1GNK A;  3SFG A;  4OLP A;  1IBM J;  1HNV B;  3D0I E;  3RW7 A;  1W2I A;  4ILM A;  1FES A;  1FDB A;  4B3S J;  2CWK A;  5HRO B;  4X4Q A;  1AFI A;  2F4V F;  3MAA A;  3HHL C;  5AJ3 J;  2KVI A;  4B08 A;  3LP2 A;  4MKA A;  5LSL A;  2NSB A;  3P3D A;  4PXB A;  4F4W A;  2QSF A;  1P9Y A;  3DRP A;  3MTK A;  1FRM A;  4JI0 F;  5J1P A;  3KUH A;  4P71 A;  3O3L A;  5U47 A;  4K50 A;  3GJR B;  2QL9 B;  4GC6 A;  2F5G A;  2BW2 A;  3VWS A;  4OI0 A;  2MZS A;  3H20 A;  4NML A;  4A4J A;  2UU9 F;  4ED4 A;  1BQN B;  2WSC C;  2EW9 A;  1MMD A;  1NJZ A;  2QMU B;  4ZVH A;  1P6T A;  2AF6 A;  2CNN B;  4MIB A;  4OMF G;  3JQK A;  1DHM A;  1MWY A;  4NYO A;  3AD9 C;  4PPZ A;  1N33 F;  2LQ8 A;  4X64 F;  2GGP B;  1KFS A;  2HNY A;  2XMJ A;  3UD5 A;  2HHX A;  4ER8 A;  3HVR A;  2L9N A;  5DQH A;  1I94 F;  3M32 B;  4JV0 A;  3IAM 9;  4ZPW R;  2HHT A;  1JJ2 R;  4WF9 Q;  2AW0 A;  1NO8 A;  4AYB D;  4M5G A;  2EBE A;  2ZJR Q;  2G0C A;  4ZPC A;  2RH3 A;  3JTP A;  3NOG A;  1Q1K A;  2D3O 1;  3WC2 A;  2H4W B;  3KHR A;  4J9K A;  5BYR A;  3D0H E;  3MUR P;  2PD1 A;  2WVC A;  4OX7 A;  2X3G A;  1V6H A;  2L08 A;  1U26 A;  4V19 J;  4RWW A;  3FSY A;  3VAG A;  2C3Y A;  3H4D A;  4WFA Q;  4KR0 B;  3CCM S;  1U6B A;  4OX9 J;  2YY3 A;  3R7B B;  2NYI A;  3MAQ A;  2Z57 B;  1PIE A;  1MW7 A;  4FN5 A;  1OPZ A;  1X5O A;  3KHH A;  1FRX A;  2RJZ A;  2XGP A;  2BE2 B;  1QUV A;  5E0O A;  2YKN A;  2H48 B;  1XNQ F;  4CLT A;  3CC2 S;  1JLG A;  2B4O A;  4J9U E;  1OMS A;  5A2Q Y;  3F41 A;  9ATC B;  2BJD A;  3Q83 A;  4Z7Y A;  1CQN A;  1S6U A;  2MQL A;  1URN A;  2F4V J;  1Q8B A;  1WEY A;  2DNG A;  4KB7 A;  2GHP A;  1RA7 A;  3AA8 A;  3H7H B;  2OPQ A;  2XLJ A;  2AJF E;  2H3E B;  4JI0 J;  3B82 A;  1RKI A;  5LM7 E;  2LXU A;  4K2X A;  3SCI E;  4QW9 A;  3N5B A;  3J80 Y;  1AUD A;  4KE5 A;  2QL5 B;  1HHT P;  2FLO A;  4KGV B;  1TR0 A;  4K4W A;  2BVZ A;  2JVO A;  2ZH7 A;  1S0O A;  1RTI A;  5FDL A;  3GG0 A;  2UU9 J;  1TAQ A;  5HLF A;  1TUG B;  1Q16 B;  3CDB A;  2JX2 A;  5C2C A;  1IQT A;  1IN0 A;  3UD3 P;  1T95 A;  1LEO A;  1YGY A;  4ZVE A;  3KG1 A;  1RAC B;  1U2F A;  2JEJ A;  4IFY B;  2XSJ B;  3QRR A;  4X64 J;  4CYU B;  1U2R A;  1JJH A;  1EET A;  4NYP A;  1VS3 A;  3DM2 B;  1I94 J;  4IDK B;  4DN0 A;  2E9R X;  1FDA A;  2J6S A;  3PTW A;  1BHN A;  2QEX S;  4X4S A;  1FCA A;  2IBK A;  2VPX B;  1UFK A;  1HI0 P;  4TQR A;  2VG5 A;  4B9T A;  3I0S B;  3OFE A;  1HNX F;  1N6Q A;  1TUW A;  2GIR A;  1VBY A;  2DRD A;  1GX6 A;  2XNQ A;  1F9E B;  5HMW A;  1UET A;  5CZV A;  5ETN A;  1NKB A;  2V8P A;  4A8W A;  3PFE A;  4QR0 A;  1N0V C;  2GNK A;  2NSC A;  1VJW A;  1M1G A;  3MUM P;  3CCR S;  3HI9 A;  1UWA A;  2KHC A;  1DQ8 A;  1SJQ A;  3TVY A;  1NM2 A;  5GAG I;  2V67 A;  4QU6 A;  2CXE A;  3IRX B;  2XMW A;  2G1D A;  4NLT A;  2AMC B;  3N0V A;  1ZM4 A;  3FQL A;  1XNQ J;  3QMQ A;  5EHH A;  3IRW P;  3G8Q A;  4CM2 A;  1RWX B;  3CIZ A;  5AXN A;  2C2M B;  3Q0A A;  1RYR A;  1CVJ A;  2JLE A;  1Y4Z B;  1YBU A;  1JLE B;  3T1H F;  2GV1 A;  3C19 A;  2ZH3 A;  5HSP A;  4X65 F;  1F3V A;  5C42 B;  1MU2 A;  2IMW P;  4M5K A;  3IS9 B;  5I42 B;  2RQK A;  2OD4 A;  1D0E A;  1ZM9 A;  2FGC A;  1UWB B;  4A8Y A;  2CRL A;  3DOM B;  3MEC B;  2ZBI A;  5JJB A;  1S9G B;  4PG7 A;  4RBU A;  2NPF A;  5GAH I;  2HFV A;  1XN9 A;  2WAQ D;  4F2R A;  4JI5 J;  3PVX A;  3A3O B;  9RUB A;  2OH2 A;  2E5H A;  1GFW B;  4M63 A;  3E01 A;  2EEY A;  4YEA A;  1F5A A;  1JXE A;  2YWH A;  4XK8 C;  5H1S V;  2EVZ A;  2M9K A;  2Q43 A;  4HDG A;  3CUL A;  3UDC A;  2YWE A;  2GCF A;  3KG4 A;  2QMX A;  4HKQ A;  4DF4 A;  3NGR A;  2H5J B;  1SVD A;  5HQL A;  3DI6 A;  1Q82 T;  1ZPV A;  1JLB A;  2HWI A;  5AE3 A;  2XMM A;  1C0T B;  4F0K A;  3IWN C;  3CJ4 A;  5A76 A;  4F8R A;  1BMQ B;  4K8R A;  3E2E A;  1TL7 B;  3IM9 A;  3QGI A;  3KHL A;  3Q22 A;  1B4S A;  4LRA A;  1VMB A;  3KK2 B;  2MTL A;  3S6E A;  1SI9 A;  4IH6 A;  3DYA A;  2X7I A;  4FXW A;  1REG X;  4ID5 B;  4XO0 A;  1T9U A;  3KUE A;  4NRU A;  5K8M A;  5B0F A;  1NSP A;  3MM8 B;  3EVO A;  3SIP B;  1S97 A;  2IJN A;  4MAK A;  4URQ U;  4LF4 J;  1UVK A;  2MZ1 A;  2K3I A;  4C3L A;  1D8Z A;  4HLB A;  4LF7 F;  3U1L A;  2LXF A;  2QIF A;  4KV8 B;  3DOL A;  1TV6 A;  1S1X B;  4WKR A;  2XS7 A;  2GW8 A;  1Q8L A;  1U1N A;  3T1H J;  2OFG X;  3QFH A;  4X65 J;  1EP4 A;  1NH7 A;  1IBL F;  1YRX A;  4DLE A;  3GIM A;  5D0H A;  4O0N A;  4MYT A;  5D8H B;  2KJV A;  3V2U C;  3EJM A;  2AYG A;  4LFC F;  2D3U A;  4Q0B A;  4ZN3 A;  3JYT A;  4HTI A;  1FX2 A;  4C9D A;  1VK8 A;  2CQ1 A;  3TAR A;  5LSR A;  3RRG A;  3SV3 A;  1TL4 A;  1WEL A;  2VG6 B;  4ZPV R;  3C14 B;  4P9S A;  2P9E A;  4FBU A;  2W7O A;  1S72 S;  5C24 A;  3F56 A;  4H4M A;  2YNG B;  3G82 A;  2XO7 A;  3BB5 A;  2FVP A;  3GV8 B;  2W9B A;  2HVH A;  2DIT A;  5LJ3 Y;  4RNN A;  3UN5 A;  3EPI A;  2WZ1 A;  1OY8 A;  2GVZ A;  3GJQ B;  1RWO B;  5KTQ A;  4NLW A;  5DLF A;  2P6T A;  1FJG F;  4GVB B;  4UZB A;  6AT1 B;  2BUN A;  1U09 A;  1KS2 A;  2CAJ A;  3MEG B;  5F8H A;  3ET6 A;  3N6M A;  1DQ9 A;  1NK8 A;  4UW2 A;  1ITP A;  1TVR A;  3WX4 A;  4RW6 B;  3M8W A;  1WOO A;  5KFC A;  1N5Q A;  4CO2 A;  1E6Y A;  4OYO A;  1RBO B;  1OSD A;  3W66 A;  5FLX Y;  2KYX A;  2V4J A;  1WC3 A;  1VOM A;  2KG1 A;  1QM9 A;  1WI6 A;  1R8P A;  2CJ9 A;  3BSN A;  2B6A A;  5I3Q A;  4QWD A;  3BV8 A;  3UE2 A;  3NMA A;  4O44 B;  1XMB A;  2IVY A;  2YKM A;  1JKH B;  2OUG A;  3BS9 A;  4CT9 A;  4PG4 A;  1XMO F;  4JI4 F;  2A0F B;  2CPX A;  4LF7 J;  3PZP A;  4YP3 A;  1RHJ B;  4RBT A;  4F26 A;  2RHQ B;  2EI5 A;  1Y0H A;  2O01 C;  2WB4 A;  2D3O R;  4ZLP A;  1EJ7 L;  2NS1 B;  3VHQ A;  3E3X A;  4DL4 A;  1KHV A;  4KRW A;  5HRO A;  4A8X A;  1BC6 A;  4LJM A;  4NLR A;  1IBL J;  5LJ5 Y;  3MM5 B;  3UWT A;  3T5K A;  3LGM A;  4LFC J;  4X4R A;  1YQH A;  1UFL A;  5BXI A;  3QLH B;  1R8C A;  1VHI A;  4WTY A;  3CDW A;  3AT1 B;  3QZ7 A;  5L8R C;  1GTH A;  2NUH A;  3TO8 A;  1A9N B;  2HG4 A;  3A12 A;  3HHL A;  1BQN A;  2B9X A;  4ECV A;  1IWG A;  3JSB A;  2GQC A;  4ERD A;  3AJ2 A;  1NXI A;  4QIG A;  4NLS A;  4WTO B;  3BGR A;  2LQ9 A;  2EFV A;  3KJV B;  4J37 A;  2DIS A;  4FNH A;  2GGP A;  3EZO A;  2Z4P A;  1FJG J;  3RR7 A;  4WE1 B;  3HT3 A;  5GMD A;  1H0H B;  3M32 A;  1T05 B;  1YJT A;  3KNG A;  3TI0 A;  5DG8 A;  5F9N A;  4JV2 A;  2V50 A;  4ZIT A;  3U7J A;  5RUB A;  3N5F A;  1U6Z A;  1D8Y A;  2DD8 S;  1FEH A;  3GFY A;  2CQH A;  2CQB A;  3JS9 A;  2CPI A;  3PYE A;  2H51 B;  2QA4 G;  3PHT A;  4I6A A;  3A13 A;  1TK5 A;  1GEH A;  1JMT A;  3NBP B;  2BAN A;  3D5M A;  4R5P A;  2MQM A;  2GMJ A;  2AJ2 A;  2XS2 A;  1NDL A;  2OML A;  3T5L A;  5HJX A;  5CD4 A;  5IXU A;  4EWT A;  2YNH A;  1JWW A;  3PO4 A;  3MM9 B;  3H5Y A;  4DV2 F;  4QW8 A;  1XMO J;  4JI4 J;  3PEJ A;  4FYX B;  2W4C A;  2ZE2 B;  4S0M A;  3BBF A;  4V19 X;  1S9F A;  2ZH9 A;  4NAS A;  3CTR A;  4M5H A;  1CG2 A;  4RJV A;  4LR9 A;  3RR8 A;  5GAE I;  4DSL A;  5T14 A;  4EZ9 A;  1VHF A;  2OEK A;  4LIW A;  3OLB A;  4DSK A;  4OQJ A;  4FDF A;  4LVO P;  2GMH A;  2ZJQ Q;  4I2Q B;  3KWM A;  2HIY A;  1RCX B;  3G6X A;  4J9O A;  1UZD A;  1Z4U A;  1NSK L;  4I2P B;  1N88 A;  2YKO A;  2VKR A;  4TVA B;  4QWE A;  1TP7 A;  2K7J A;  4OZ3 A;  5KFO A;  3IGN A;  4N76 A;  2OFH X;  3U1N A;  4FKX A;  1DUR A;  2DGV A;  4OLO A;  3ZNU A;  3SSQ A;  2MKI A;  1U1K A;  3TRG A;  3IO1 A;  3D3B J;  4ZVO B;  2NZC A;  3NKY A;  2HK3 A;  2HSE B;  4FF4 A;  4CYU A;  4NYZ A;  2A2C A;  2HFN A;  3ENW A;  2MGZ A;  4IDK A;  3I9V 9;  3CDU A;  3G96 A;  1X0P A;  4RKU C;  1SV5 B;  1TMM A;  2DKO B;  3G2X A;  5KFL A;  2BV3 A;  2DYA A;  2WVB A;  2ZKU A;  4GC7 A;  1TQL A;  4Z2X A;  2UP1 A;  5D0G A;  5ETV A;  2CDQ A;  5DGB A;  2A10 A;  5B0G A;  3P5B P;  5DDP C;  3M6V A;  3OVS A;  3VGT A;  2RUS A;  3Q8R B;  2Z2L A;  3P8B B;  3RJM B;  3K5P A;  1S76 D;  5EWE A;  1LKZ A;  4DQP A;  4R8U B;  1NLK L;  3IRX A;  3UDL A;  4DV2 J;  4QWA A;  2MDA A;  1WHV A;  2MKC A;  4FKY A;  1M1H A;  1G7C B;  5KT2 A;  2FIU A;  2OEM A;  2HWH A;  2XHW A;  1YJ9 S;  2JSX A;  1NUE A;  2PI5 A;  4WXW A;  3MEK A;  3MED A;  5B0A A;  4ZP9 A;  2FJW A;  3DHX A;  1RA6 A;  1ZA1 B;  3HHD A;  2RHS B;  3VVT A;  5C42 A;  2NR0 A;  1EIY B;  4O3N A;  4NLO A;  3C6U B;  2RVJ A;  1F9H A;  4IFV A;  2R8H A;  4DV4 F;  4IR9 A;  2DBB A;  3WDO A;  1N36 F;  4QIV A;  3MEC A;  2L41 A;  2D9O A;  3SDE B;  5E2Q A;  5GVQ A;  2ADB A;  1VBK A;  1M90 T;  3R5C A;  2YKA A;  1SIW B;  1UA0 A;  1HYS B;  2IDL A;  3I5A A;  3JTO A;  1EB0 A;  2OTL S;  1GMV A;  3G9C A;  4USU A;  1NKE A;  2DXE A;  3SYZ A;  3TA2 A;  2OPS A;  3DRR B;  3LAM A;  4OZN A;  2HQF A;  1KFD A;  1ZYQ A;  1XR5 A;  4OZJ A;  1DTQ B;  3P96 A;  1CJV A;  4HVZ A;  1XER A;  3PW7 A;  2PI4 A;  2LU1 A;  3VAM A;  4TY8 B;  4J5O A;  3PNI A;  5DJB A;  1SKU B;  4OX8 A;  4BLG A;  4OJ1 A;  2WOM B;  2Y8Y A;  2KFZ A;  1RKJ A;  2B51 A;  3KK2 A;  3QBC A;  2K2P A;  1GK8 A;  3FBB A;  1NBE B;  4DV7 F;  3QFW A;  2X1G A;  1AFJ A;  2YWK A;  3QSY B;  1X4F A;  1BD6 A;  3OR2 B;  5HQ8 A;  2HQG A;  3CPW R;  4MJK A;  4H54 A;  3UR0 A;  2ATC B;  2J7K A;  4QQB A;  1MML A;  2FLL A;  1OPI A;  2E5L F;  2B9Y A;  4NPO A;  1SPB P;  4X4U A;  1GMW A;  3P5T L;  2WSE C;  2C2E A;  3TJ9 A;  1VQ4 S;  4KIA A;  2NLW A;  1RDR A;  1ACM B;  3SSR A;  3C16 B;  3GU0 A;  5K5M A;  3AFG A;  3D6F B;  4FP9 A;  3A8J A;  3G6Y A;  2AT1 B;  4YOE A;  5SZT A;  3CJR A;  2KT2 A;  1CJT A;  3K17 A;  3AXM A;  3WZ0 A;  5F8M A;  4J91 A;  4DSI A;  3CMQ A;  3HDS A;  4MK8 A;  3AB2 B;  4HHU A;  3D28 A;  4IH5 A;  4BCA A;  4DV4 J;  1YJR A;  1N36 J;  2HNZ B;  4X4T A;  2CQP A;  3C14 A;  3SI8 A;  2MKJ A;  4TXS A;  3SFU A;  3D3C J;  2IM0 A;  5K14 B;  4J9L A;  3O44 A;  4KPY A;  2E1A A;  1RU1 A;  2YNG A;  1J5E F;  1CUL A;  3MMJ A;  4QCL A;  1H3D A;  2J76 E;  4DPO A;  2R4F A;  2OJ3 A;  2OPP A;  1TU0 B;  2HEK A;  1H98 A;  1WG4 A;  2DGQ A;  2V6A A;  1WF0 A;  3CED A;  4IRK A;  2QYG A;  4GVB A;  4ZVU B;  2ZBP A;  4CT8 A;  3MEG A;  3L9Z A;  2AYM A;  1I3O B;  3T5J A;  3R6L B;  4ZP7 A;  1ELO A;  3MCM A;  4RW6 A;  2RE1 A;  3VR1 A;  1Z1Z A;  3ILI A;  1XC9 A;  1PCA A;  1O5J A;  3BGU A;  3K5L A;  5DG9 A;  2DVI A;  4DHV A;  4WZM A;  4MIW A;  1PBA A;  2OSR A;  1VRQ C;  3NCR A;  5E5N A;  5JXS A;  2HFZ A;  3KK1 B;  1RK8 A;  2Y1L B;  2HMI B;  2H5E A;  1C1C B;  2IA0 A;  4ZCK A;  3LGN A;  4DV7 J;  4ZVP B;  1FF2 A;  4KGZ B;  1D3W A;  3TQ1 A;  2F9D A;  1Y00 A;  3RB3 A;  1PO6 A;  2RU9 A;  2HPU A;  1W7W A;  1U24 A;  2OHD A;  3MXH P;  1VRU B;  4EYH B;  2ABY A;  2MST A;  2E5L J;  3KJN B;  5BJR A;  4Y28 C;  2BE7 D;  5A6P A;  2Z30 B;  2R2T A;  5CYQ B;  4OHX A;  5M2R A;  4IRD A;  4KAI A;  2RD5 C;  3OHB A;  1J5O B;  4G6V B;  2R3V A;  3PYF A;  3MHY A;  4ICL B;  1RAF B;  3ZFV A;  3OL8 A;  3MM5 A;  2DB1 A;  4F4A A;  4DX7 A;  4PG8 A;  1IKV B;  2HFO A;  4Q2L A;  2HS0 A;  4MKY A;  3KLI B;  4DV3 F;  3EDR B;  3T3F A;  3W2W B;  2A18 A;  4RNM A;  2ZH1 A;  3TAM B;  3PO5 A;  2LQJ A;  2NXJ A;  1BQM A;  1T7P A;  1J5E J;  3HVT B;  4BHQ A;  4AL6 A;  1S7I A;  1FFW B;  2DGO A;  1FFS B;  3CDA A;  4F3Q A;  2I0X A;  1IBK F;  4MK9 A;  4DV1 F;  2CJK A;  2F63 A;  4F36 A;  3KJV A;  4ITS A;  4P73 A;  5E41 A;  3GPA A;  4WE1 A;  2V8V A;  3H40 A;  1IJE B;  3HSD A;  2EPI A;  4B3M F;  3LAK A;  5HMZ A;  2ZC3 A;  2OSQ A;  3GYG A;  3UCU P;  1S59 A;  2AGP A;  4OFZ A;  3H2V E;  2DNN A;  2XEX A;  4RPF A;  5DDR C;  1S1V B;  1HBO B;  5D4L A;  4OZ5 A;  2LEP A;  4DQR A;  4CLU A;  5AE2 A;  3CJT A;  2GC8 A;  2IY5 B;  2UVU A;  3R9L A;  3LWL A;  3GR0 A;  3OL6 A;  1U6F A;  1QSY A;  4QZV B;  3RB0 A;  1X9M A;  1VQS A;  2LDI A;  4CTA A;  1T3N A;  1EX8 A;  3US5 A;  1NU4 A;  2ASD A;  3NBP A;  1YHQ S;  2MZT A;  1X4C A;  5K8N A;  1VCT A;  4IQM A;  2HQ3 A;  1Q7L B;  2AJQ A;  2M8H A;  2Y3Y A;  1KBR A;  3LO3 A;  3ILO A;  3MCS A;  2CDR B;  1IQZ A;  2BJ1 A;  1YBT A;  1IKW B;  4ZCI A;  4USI A;  5EDW A;  3LAN A;  3IAS 9;  1C4A A;  3MM9 A;  1RYS A;  4WKY A;  1G2E A;  1LOU A;  3MFI A;  3LOU A;  4LF1 A;  1S1T B;  1S5Z A;  3NCP A;  3GLJ A;  3T5H A;  3C66 A;  2GML A;  1DTT B;  1O6X A;  1QAY A;  1FXL A;  4KHR A;  3S1T A;  3NNC A;  1Y10 A;  4K4X A;  1W26 A;  4TQS A;  1QE1 A;  1HHS A;  4KGM A;  3OW2 R;  1HNI A;  4RNF A;  4DV3 J;  3HXM A;  3QQC D;  3H5S A;  3BQ2 A;  1SJ4 P;  5J1N A;  2Z2M A;  3OTC A;  3VQT A;  2HIQ A;  4RW9 B;  2ZHO A;  2R8I A;  3CJ8 A;  4RUB A;  4OHW A;  4N41 A;  4CLF A;  5HBM A;  1RHU B;  4DS4 A;  4U8V A;  1IBK J;  4DV1 J;  5G0R B;  2ILY A;  3PX0 A;  3NGD A;  3DRS B;  3TEH B;  5AT1 B;  4Y34 A;  8RUC A;  3J7Y U;  2HHH F;  3BKU A;  1S0M A;  1CC8 A;  4CO0 A;  1HQE B;  1WKJ A;  4DQI A;  2QTW A;  2Q1L A;  4B3M J;  2XY6 A;  3THP A;  4YDD B;  1SV5 A;  3QYY A;  2NYH A;  2VA3 A;  4FS2 A;  3BKF A;  4LR7 A;  1IWA A;  3KOA A;  1P27 B;  4O4R A;  2AWZ A;  2J9D E;  2ASJ A;  2HND B;  1U47 A;  5HVF A;  2DNZ A;  3AA9 A;  2DXF A;  3L95 X;  1YDL A;  3GFX A;  2VJV A;  3QT8 A;  1YLX A;  2ZWP A;  4QIW D;  1GQE A;  3M2U A;  5CH7 B;  3IGV A;  5DG7 A;  2IJF A;  2D9P A;  4AND A;  2CPZ A;  4ZVS B;  4KGK A;  1KNZ A;  2J9D A;  3TA1 A;  3NXZ A;  2DR5 A;  3E8O A;  3CD6 S;  3CC7 S;  3UN3 A;  1EHW A;  1B7F A;  4ANC A;  2JLF A;  1PJ5 A;  2DR8 A;  1HL6 A;  1U1P A;  2P2C B;  4R8U A;  2B4P A;  2EBG A;  1KKH A;  5FD1 A;  4ZVQ B;  3ZNJ 1;  4DCJ B;  4Y2A A;  3G86 A;  2J9E A;  3RU0 A;  3TZY A;  4KBI A;  1JB0 C;  1C2P A;  3H5X A;  2POK A;  1YTY A;  3C8Y A;  2BJ8 A;  1NME B;  2BKO A;  5D6G A;  5ETS A;  2K7K A;  4MKB A;  2VOO A;  2MKS A;  3D0G E;  1HNZ F;  2PMW A;  1Y3J A;  4WP8 A;  3W5Z A;  3QIP B;  4A8Q A;  3DU6 A;  4HYK A;  2CG8 A;  2GAH C;  2LQB A;  2VKZ G;  3OXG A;  1VFJ A;  1K73 T;  1LWC B;  3RB6 A;  1YWX A;  3M8Y A;  4KY3 A;  1AW0 A;  3TQE A;  5IQ6 A;  1YRT A;  3C6T B;  2M4M A;  2DJW A;  1H7X A;  3HO1 A;  2G13 A;  3M9N B;  1TKX B;  3M6U A;  2XGQ A;  3OL7 A;  3ZZZ A;  3PHE A;  4DS5 A;  2R7V A;  3PR4 A;  1D9A A;  2ZJP Q;  4ZJO A;  3NS6 A;  4Q7A A;  1BLU A;  3IWX A;  1R8B A;  1KRP A;  1FEE A;  1TKZ B;  4X62 F;  2R8K A;  4EK2 A;  5EX0 A;  1RBL A;  4ZVG A;  2CWX A;  1DTQ A;  2CFX A;  3A8K A;  3FCV A;  4IQX A;  2UUB F;  2G1H A;  3K2Y A;  5KFW A;  4O23 A;  4TY8 A;  4E2F B;  4KO0 B;  2CPY A;  1FK9 B;  4Q8E A;  4FPI A;  2XSF A;  1JLA A;  1KLM B;  3LP0 B;  1V5V A;  4RW7 B;  2PC6 A;  1FD2 A;  1XNR F;  4LBI A;  4FZV A;  1UEK A;  1SQE A;  2X1B A;  3JAM Y;  1S99 A;  2YKP A;  3AAW B;  4NI2 A;  2B3T B;  4KKO A;  1VQ8 S;  5L38 A;  1F2H A;  3MAA B;  4WIQ A;  5GAD I;  4HHJ A;  4WFN Q;  3LP2 B;  3QRP A;  4UOH A;  4NE9 C;  4X4P A;  3A8I A;  2R2S A;  2AV5 A;  3DRP B;  4NLG A;  3LUY A;  2M88 A;  3TA0 A;  2UUT A;  2JHE A;  2ASY A;  3DXS X;  1FDN A;  3HP6 A;  3VAI A;  3F0N A;  1UW9 A;  3J7Y I;  3F44 A;  3GIK A;  3L7P A;  3P45 B;  2JL9 A;  3ISN D;  2O3D A;  2KVQ E;  1B64 A;  3C16 A;  4DQQ A;  2ZOG A;  4PAA A;  1Q8K A;  2HHU A;  3KLH B;  3BR9 A;  4ED6 A;  1HNZ J;  2JJ4 D;  1RTZ A;  4NLX A;  1X4E A;  2AZ3 A;  5AE1 A;  3TJA A;  2DNM A;  1W2B R;  4PQU B;  3IR7 B;  3ZZR A;  2LU2 A;  1BE4 A;  5L9X A;  1ZH5 A;  2VIC A;  1N8R T;  2J6T A;  4P6Q A;  4DUT A;  1FWP A;  2MQN A;  1S4E A;  1NHU A;  2F1F A;  4F4K A;  4O0I A;  4LVN P;  1JJC B;  2V69 A;  2BAB A;  4ZA1 A;  4O3R A;  4DPY A;  2IA6 A;  2RQ4 A;  2IJR A;  4GO7 X;  3MR5 A;  2QC3 A;  3BH7 B;  4URG A;  4GO5 X;  4RBV A;  1M5V C;  4JV5 J;  1FA0 A;  1FER A;  3EYZ A;  2F4F A;  2KL8 A;  2FJV A;  2Y1I A;  2KG0 A;  4X62 J;  2XNR A;  3R1L A;  4OI3 A;  3BDP A;  1SH3 A;  3KNA A;  1NB2 A;  2QLF B;  3U1M A;  5LXR A;  4QPX A;  2PMH A;  2KFY A;  4LBH A;  1L3U A;  3P6Y C;  2YQ1 A;  3TX0 A;  4RX6 A;  4EFA C;  2YWG A;  3VQS A;  1FFG B;  1JLG B;  4FVC A;  1HIY A;  1KQK A;  1XNR J;  2W7P A;  7AT1 B;  2V63 A;  1IXK A;  4TLR A;  5JMN A;  3FVY A;  3KK1 A;  1T03 A;  1C1C A;  2LEA A;  5AXL A;  2HHS A;  4C97 A;  4NRT A;  2WW4 A;  3PJ9 A;  4OV6 A;  2FGO A;  4IKA A;  2OPQ B;  1FE0 A;  2R2R A;  4P2X A;  4PWW A;  4QOT A;  2CPD A;  2GO9 A;  4ECW A;  1Y11 A;  2HLT A;  3CCQ S;  1TKT A;  3W5Y A;  1YVF A;  2DGT A;  1RTI B;  5FDL B;  4M5M A;  4NEZ A;  4A8K A;  2QJ3 A;  1RIS A;  2DCL A;  3PEH A;  3RW6 A;  5CYQ A;  5HLF B;  5K8P A;  4PG6 A;  2PN6 A;  2W2P P;  2L48 A;  1WF2 A;  2UVR A;  1R6Y A;  3AOB A;  3PYG A;  3JAM U;  3PCO B;  4O4G B;  7FDR A;  1OYE A;  1HAR A;  2EFG A;  1FO1 A;  3WBZ A;  4LUB A;  2PA8 D;  2NUU G;  2YBV A;  4ZJL A;  2X51 A;  5ADZ A;  2IMO A;  1Q0N A;  1EET B;  4FXD A;  4PRF A;  4RW4 B;  2ASL A;  1O8B A;  1A7G E;  1IKX A;  3KLI A;  2ADC A;  1LWF B;  4ZKA A;  3OHA A;  2ZDP A;  4PEO A;  1S0V A;  1RT6 A;  3HUL A;  2C2Z B;  2IVF B;  4EYI B;  2JFD A;  1HBU B;  4EO8 A;  1UL3 A;  1RAG B;  4O3Q A;  4FYD A;  1YX2 A;  2VG5 B;  3VAF A;  3KYL A;  4QWC A;  3TZX A;  3DRX A;  4I6W A;  5D0E A;  2IRY A;  3AQP A;  3Q23 A;  2NCK L;  3IG1 B;  2DNP A;  3D9B A;  3BGO P;  3MAH A;  3NRB A;  4CLP A;  3BQ0 A;  2A2D A;  3QID A;  1HQ2 A;  4FF2 A;  3UVJ B;  3CD7 A;  1YI2 S;  3AJ1 A;  3UDV A;  3M6W A;  3C2P A;  1N5T A;  3TWZ A;  3EDQ B;  2QA1 A;  1SKS A;  3IN5 A;  2ACY A;  4PXC A;  2DH7 A;  2NXU A;  1SH0 A;  3DLG B;  1NZA A;  1JX4 A;  4I1T A;  2IC3 A;  1KON A;  1X9W A;  1U48 A;  5LMN F;  1TKD A;  2XC9 A;  4IOC Q;  2OD6 A;  3BPD A;  3IBC B;  3UR3 C;  4I64 A;  2I1R A;  2JC0 A;  1WAC A;  5KOX A;  5KFK A;  4USK A;  6FDR A;  4ZN1 A;  4GRS A;  2BOP A;  1HMV A;  5J2Q B;  1RGV A;  3KMQ A;  1WDD A;  1IKW A;  2RS2 A;  3DN9 A;  4Y2I A;  2MSS A;  3DC2 A;  2AYE A;  1S6P B;  4GKJ F;  2C3U A;  4F4Y A;  1YIT S;  1H38 A;  3TJ8 A;  2ZD1 B;  5F0W A;  5ETL A;  3E01 B;  3V4I A;  2E7W A;  2HFS A;  3MD1 A;  3CJ5 A;  1L3T A;  1LQ9 A;  1WKK A;  4RNH A;  3PX6 A;  1VBZ A;  3QRQ A;  4WWS A;  2N4C A;  1HWI A;  1NKC A;  4RR5 A;  3KKF A;  1RHK B;  3DI6 B;  4UY8 5;  1IUJ A;  3D1Q A;  5HO4 A;  1DFD A;  2D74 B;  2DRA A;  2MKK A;  1EAY C;  1JLB B;  1VQM S;  3PV8 A;  4NX9 A;  1GMW D;  2WCX A;  1WD6 A;  3Q8S B;  2JC1 A;  2BQ3 A;  3BEG B;  2FTR A;  2ZC4 A;  3CNQ P;  1LWE B;  4MMO A;  4JI3 J;  2B4V A;  1YJW S;  3W9I A;  3W8P A;  5G0R A;  3AY0 A;  1XR6 A;  4DXL A;  4V1A k;  3DYA B;  2AZ1 A;  3U02 A;  4C11 A;  3R5B A;  5E33 A;  4ED5 A;  2ZBR A;  1TFW A;  2W2M P;  4ZLJ A;  3ZZO A;  1MWQ A;  2KHD A;  1UKU A;  2QN6 B;  4C8L A;  3H4B A;  3HCX A;  4DPT A;  5KG4 A;  2LLZ A;  1QUP A;  4IG0 A;  1C4C A;  3TAQ A;  1S4F A;  3HJF A;  3L09 A;  4HAC A;  1F2G A;  2L9D A;  3BGF A;  4ELV A;  2XI2 A;  5LMN J;  1R0A B;  5HP1 B;  1REV B;  3N79 A;  2HKE A;  1FRL A;  1EP4 B;  2HGL A;  1R6V A;  5J1E A;  5CXT A;  1U8W A;  3Q24 A;  4Q0B B;  3JYT B;  4LSZ B;  3SQO P;  4YB7 A;  1PSD A;  1NHV A;  1EZZ B;  2HWT A;  3VV2 B;  1RT7 B;  2ZFH A;  3W62 A;  1MNE A;  2WBR A;  3DCA A;  3OTO F;  2Y1R I;  2KZZ A;  1XQI A;  1KVJ A;  2FC9 A;  5C24 B;  8ATC B;  2R9L A;  2V68 A;  4BC9 A;  5LSO A;  3D67 A;  4GKJ J;  1JXV A;  4ZCM A;  4J7C A;  2KTQ A;  1B7Y B;  2CQD A;  2XS5 A;  1Q79 A;  1WG1 A;  4KHM A;  3IBW A;  4NCA A;  3CME S;  1G1X A;  2GVZ B;  3GYX B;  3QIP A;  3OVB A;  3SCJ E;  4G65 A;  1QLN A;  2B56 A;  1TTH B;  3D1O A;  4M5J A;  4IUF A;  2E1M C;  1PKU A;  2DHG A;  3MM6 B;  3ET6 B;  2DO0 A;  2ZIT A;  1TVR B;  3QGH A;  3DMJ A;  1AXQ A;  3DGP A;  1EKS A;  2LFV A;  1S12 A;  2BJ3 A;  3KLV A;  3DRY A;  1RCO B;  2HS3 A;  1ZZN A;  2LQ5 A;  2OIH A;  3R5D A;  2W9C B;  2P5V A;  1X4G A;  4WP3 A;  3Q2T C;  2CPJ A;  3CB4 A;  5M2U A;  3AB4 B;  1SB6 A;  1HWK A;  2V4J B;  1S6O A;  1VIS A;  3CJK B;  4OI4 A;  4LMZ A;  2W9A A;  3NNH A;  2B6A B;  2HVZ A;  2YX4 A;  3RRK A;  1TKZ A;  2MQQ A;  4MYU A;  1RAO A;  3FUY A;  4ZVT B;  1U2C A;  4W98 A;  2VC0 A;  2GFF A;  4YR2 A;  3QJJ A;  4RW7 A;  3LP0 A;  2NZ4 A;  2CAD A;  3HKZ D;  4OZ0 A;  1X7V A;  4DV6 F;  1N5Y B;  3D6T B;  4HH1 A;  5F8N A;  2YNI B;  3T19 A;  2HGM A;  3RRH A;  2CJQ A;  1T8E A;  2R7X A;  2V2V A;  2KJW A;  5C7P A;  4IG3 A;  1GTE A;  1R43 A;  3FEX B;  4DX5 A;  1OJ4 A;  1Q5V A;  2IM2 A;  5KFJ A;  4JI8 F;  2JLG A;  3AOD A;  4DX6 A;  3CD0 A;  4CRJ A;  2XLK A;  2NQP A;  4GKK F;  4CLW A;  3OTO J;  1N48 A;  3FZ2 A;  3ICL A;  1OQ6 A;  2E1R A;  3DLL Q;  3HHL B;  1LNQ A;  2AX0 A;  2HQC A;  4YQW A;  5GAG U;  1LW2 B;  5B0D A;  3MWB A;  3D2W A;  4C0B A;  4HTJ A;  4P7T A;  3KLH A;  3BGR B;  1UVM A;  2ZHA A;  2VJU A;  1O0P A;  2GVD A;  4C3M A;  4IYQ A;  2N82 B;  3ADA C;  2FLN A;  3ETO A;  4PQU A;  1KVK A;  2YWF A;  4JP8 A;  4I56 A;  3X1L B;  1Y5N B;  4F4Z A;  2J0S D;  1K0V A;  1WWH A;  4AXI A;  4A46 A;  1B3T A;  2VIH A;  4CI0 B;  3AXK A;  4NLQ A;  4PQA A;  1OQ3 A;  1GT8 A;  5IT9 U;  1R8H A;  1F9F A;  5IV4 A;  1U0H A;  1D9F A;  1PIL A;  4IO9 Q;  1ICE B;  5KG2 A;  1Q53 A;  3W65 A;  2K1R A;  2C3M A;  2GJI A;  5DS7 A;  2YX1 A;  5DLG A;  5KG7 A;  2BAN B;  2CJX B;  4FXV A;  3OFH A;  5GAH U;  4R5P B;  1S10 A;  3K5M A;  5A0Y A;  1XTZ A;  3T41 A;  2EFP A;  4LF9 F;  1RAB B;  3N6N A;  1K9M T;  4CO5 A;  3ISZ A;  1NK4 A;  3GJS B;  2YNH B;  2P9C A;  4DQS A;  3RZA A;  2CUY A;  1GXU A;  2Z58 B;  1FNX H;  2UVW A;  4LSN B;  2QG9 B;  4L3N A;  1BWV A;  4DV6 J;  1X8D A;  4DBQ A;  4MT1 A;  1WNE A;  2OI2 A;  2QL7 B;  3PYD A;  1HQU A;  2DXD A;  3UDE A;  5H9E J;  2VD3 A;  3N28 A;  3MMB B;  2LYV A;  4PWD A;  3W63 A;  2ZOF A;  3CCW A;  2W8K A;  1X9S A;  2JWN A;  4JI8 J;  2IBO A;  3JSM B;  2DIU A;  4RUA A;  2YQ0 A;  3FQK A;  4GKK J;  1D1U A;  4QU7 A;  5CA5 A;  4K4V A;  3S01 A;  3TVK A;  2CZ9 A;  4LRC A;  1HW9 A;  1PG5 B;  2FVC A;  3M4X A;  2BJE A;  3CCL S;  4JI5 F;  3M8Z A;  4TNO A;  2CNO B;  1RWV B;  2RAQ A;  2ALY B;  3HSG A;  1CLF A;  4QYR A;  3FSI A;  5IM0 A;  4O4G A;  1HI8 A;  1U1M A;  3NAH A;  3I9Z A;  1VJQ A;  4G3I A;  3BN4 A;  3GYN A;  3CJ0 A;  4RW4 A;  2MGZ B;  2HW3 A;  4P7V A;  4CLZ A;  1LWF A;  4JI2 F;  5KFP A;  1RSC A;  3BSA A;  1SJR A;  5J2P B;  2XWY A;  1IR2 A;  1HBU A;  4ECZ A;  3MUV P;  1NCL A;  2KT3 A;  1TK0 A;  2G2O A;  1KD1 T;  1WHY A;  2FC8 A;  3T6B A;  2AU0 A;  2YNF A;  4CNY A;  3FFI A;  4OI1 A;  1QSL A;  4LT6 A;  1ZPW X;  1VIO A;  2ERR A;  3HSZ A;  2YX7 A;  3CJ3 A;  2DCU B;  3RBD A;  1V3S A;  3PW2 A;  2AIR B;  2FQQ B;  4KTQ A;  2HAF A;  1BUX A;  4YHH F;  3EIC A;  2N4D A;  1NSA A;  4LBP A;  3IG1 A;  5B0C A;  2YTC A;  3L7U A;  4NCB A;  2QX0 A;  2FVQ A;  1T9W A;  4OYM A;  4LF9 J;  3UVJ A;  1FDD A;  3H42 A;  1OWX A;  4JV1 A;  1SJ3 P;  4F4X A;  4LF4 F;  1RWN B;  1RHM B;  3MDF A;  3QT6 A;  1RQ0 A;  5L1L A;  2WB1 D;  3DLG A;  4YUD A;  4KGX B;  2B43 A;  2CKW A;  2FVS A;  4TU8 A;  4LF6 F;  5EWG A;  3MED B;  3TW0 A;  2PEB A;  1U45 A;  3R5J B;  1PYT A;  4GMK A;  2VQE F;  1WC5 A;  4BWJ A;  4BBY A;  3DLH A;  1QD1 A;  5D15 A;  1QAX A;  2DY9 A;  1HD0 A;  4IFV B;  4WYL A;  1UFW A;  5J2Q A;  4DSF A;  4LF2 A;  2V8D A;  4O3S A;  2FY8 A;  3ZZP A;  2M52 A;  5E7O B;  2VBY A;  3J81 U;  3E51 A;  1XBW A;  3KDN A;  1HPZ A;  2YKQ A;  4UZC A;  5IT0 A;  1C0U B;  1S6P A;  2IM3 A;  4NLV A;  3C15 A;  2HYI B;  3DFE A;  2ZD1 A;  4M1K A;  1RTJ A;  2WTF A;  4ZIW A;  2BAC A;  1E6V A;  3BSO A;  1KOH A;  3IFE A;  2CYY A;  5BYS A;  3LP1 B;  4K5R A;  4CO4 A;  2FD2 A;  1HBN A;  1S1U B;  3R5A A;  4YB5 A;  4QBU A;  1RWM B;  2OPS B;  1QY7 A;  4QR1 A;  4O3P A;  2XZT B;  3I6P A;  1RP5 A;  4JI2 J;  1SUQ A;  5CYJ A;  1CJV B;  4F50 A;  1UP1 A;  1RLD A;  2MHE A;  1MRO A;  2VG7 A;  1OO0 B;  1R3N A;  2A1B A;  2PEH A;  1LWE A;  1LK5 A;  1EQM A;  1VQY A;  4DX8 H;  1DQA A;  4YHH J;  4K5S A;  4KT0 C;  1UA1 A;  1RBA A;  2AP6 A;  2AD9 A;  1VLY A;  1RTD B;  3QJP A;  3R1H A;  3KLF B;  4DL6 A;  3N9U C;  4M5I A;  5L9N A;  2K3K A;  2ROP A;  4L6V 3;  2NXN A;  3BBB A;  4YDX A;  2O1P A;  4XPC A;  4UST A;  2V5H G;  1GXL A;  2HVI A;  1U02 A;  2YH1 A;  2W2N P;  2C28 A;  2DK2 A;  3V6J A;  2XYG B;  3A8E A;  5EUH A;  3QNW B;  4LF6 J;  3FRY A;  1R0A A;  5HP1 A;  1REV A;  1Y7P A;  4X66 F;  1CJT B;  3NG8 A;  2ATL A;  1HLW A;  1WG5 A;  2VQE J;  1FTC A;  3H5U A;  1KTV A;  3M6X A;  4PWU A;  4C3K A;  2R7T A;  1WC6 A;  5HVH A;  5EWF A;  3W61 A;  2ZZT A;  2ZKT A;  2DHX A;  1QSS A;  3MOJ B;  3G4S S;  2OPR B;  1RT7 A;  3GV7 B;  1CJU B;  2L9W A;  3BR8 A;  1AZS B;  4ZMM A;  2DNQ A;  1C1B A;  4ILR A;  4J9M A;  4TU9 A;  2DHA A;  1Y9O A;  3R27 A;  1CUL B;  3AD7 C;  4G1Q B;  4B3T F;  2PFD A;  4CH7 A;  3PW5 A;  3HT0 A;  4WZQ A;  3CCJ S;  4ED2 A;  5KG0 A;  2OPP B;  4DOZ A;  1H6K X;  3A3N B;  2BR0 A;  2IPO B;  4ZS6 A;  3H90 A;  4DZD A;  2VU5 A;  2FJB B;  2CPE A;  3IP0 A;  1N5S A;  1U1R A;  3MM6 A;  4EUV A;  1UZH A;  5GAE U;  3M7V A;  3OR1 B;  2F3J A;  3K57 A;  1FNO A;  4FYV B;  5A8W A;  4J9P A;  4AUK A;  2OGU A;  4DL0 C;  2ZUA A;  3B6B A;  5IS2 A;  4UQT A;  2HRU A;  1T9Y A;  3CSK A;  4ECX A;  2W1B A;  2GO8 A;  2VF3 A;  3EX7 B;  2OEL A;  2W9C A;  2KU7 A;  1PAE X;  4F2S A;  5KAK A;  2VON A;  1U25 A;  1FVQ A;  3CJK A;  5HMY A;  2I2Y A;  2LVW A;  2ZH2 A;  2VL1 A;  4ED3 A;  2JFK A;  4E8U A;  3Q8Q B;  4ZPT R;  3WIV A;  2R7W A;  2X1A A;  2BZ2 A;  3UN2 A;  1D09 B;  3PW0 A;  1WF1 A;  1DRZ A;  2DPJ A;  2V2Z A;  1JLC B;  4NL5 A;  2DGU A;  1N34 F;  1NK5 A;  3R97 A;  2R7U A;  1N5Y A;  1JLQ B;  4JBC A;  2RKI B;  5JVH Q;  1Q81 T;  2M7S A;  2YNI A;  2Z2Z A;  4X66 J;  3TR5 A;  3TP2 A;  4CLL A;  3GZ7 A;  3CIM A;  4RUC A;  1H2T Z;  4I7F A;  2JEF A;  2NXC A;  2E5J A;  2C2N A;  5GMK a;  1QTN B;  3M8R A;  2MLZ A;  3KXD A;  3SXL A;  4Z7C A;  5KFT A;  1WC0 A;  2EKN A;  2B7C B;  4WXO A;  1X4B A;  3DLE A;  1BQM B;  3JB9 k;  4B3T J;  2MJN A;  5L39 A;  2AGO A;  1SQF A;  1LW2 A;  4ZLN A;  1M0S A;  1VQO S;  2X1F A;  5C5J A;  3JTN A;  3QT5 A;  5IZH A;  3MM7 B;  5IC6 B;  1F5B A;  7FD1 A;  2R7S A;  5DZ7 A;  3DXB A;  3QSI A;  4Y2K A;  1KDN A;  4ZPB A;  3MMA A;  2JRS A;  4B9M A;  1V9O A;  4I69 A;  1XIQ A;  2OO4 A;  1ZAW A;  1EAR A;  1VQN S;  4YB1 P;  2GQQ A;  3Q2S C;  2RRN A;  1H2U X;  2F40 A;  3VF0 B;  1URR A;  2KO1 A;  3MPW A;  1GXT A;  2FDN A;  4Q45 A;  4C8Z A;  1RT5 A;  3GV5 B;  3PIO Q;  1HBM A;  4DCP B;  4Q44 A;  3R3T A;  4CTA B;  4C8Y A;  4AE5 A;  2M0G B;  1K1S A;  1TL1 B;  3JSY A;  5THW A;  2QLX A;  2DR6 A;  1RJJ A;  3BQ1 A;  4DPW A;  4ES1 A;  4NXM F;  2P9G A;  2K06 A;  1Q8I A;  3PR5 B;  2HZC A;  5KFZ A;  3GMG A;  3VGS A;  3PM9 A;  1RWW B;  1S9E A;  4LSN A;  2VFS A;  3WHI A;  1B0P A;  1N34 J;  1T9V A;  5ETT A;  5IWA F;  2XWX A;  3G8S A;  3WX8 A;  3ETM A;  2JVR A;  2W01 A;  5IC4 B;  5C2G A;  1YK9 A;  2E9Z A;  3OJS A;  1V5I B;  2NRE A;  1U1O A;  1WDT A;  1MN7 A;  4OZ2 A;  1M5S A;  2HHW A;  3ZXW A;  1JIH A;  2DHH A;  3D54 A;  4W92 B;  2CZ4 A;  4M94 A;  3K0J A;  3MMB A;  1QE1 B;  1YJ7 A;  1HNI B;  2WBM A;  4J90 A;  2M70 A;  4A8S A;  3NGT A;  1SKR A;  3JSM A;  2LEC A;  4OYA A;  1RAH B;  4A48 A;  4WU3 A;  3CD5 A;  4ZVF A;  2QSW A;  2W4D A;  2GJF A;  1V3Z A;  1CBK A;  3W7B A;  2B8Q A;  1RUS A;  2MJU A;  4TKT A;  3S8S A;  5KT7 A;  1LW0 A;  1T94 A;  3IR5 B;  5HBM B;  5A8K B;  4RO0 A;  3NEK A;  4W90 B;  5L1I A;  1YRU A;  4ZP6 A;  1RAJ A;  3MCN A;  4QR2 A;  4WP9 A;  1F1B B;  2EC0 A;  3BGL A;  4NA3 A;  3KUG A;  2CVI A;  1SXL A;  3BBC A;  5H9F J;  1SC4 B;  3GR1 A;  4C0H A;  3DLJ A;  3OUY B;  5J2P A;  1MN9 A;  2FZG B;  4B9V A;  5CCL A;  2Q6C A;  2F65 A;  2VH7 A;  4LFA F;  4U9R A;  1B70 B;  3M9O B;  1RTH B;  2LCW A;  3EGV A;  3K7R A;  2R8G A;  3RUB L;  4DF8 A;  3GSD A;  3HLU A;  1FKA F;  3M2U B;  1U8S A;  3LH2 S;  5DQG A;  3FEZ A;  4MKV A;  2OP5 A;  2VBX A;  3KDO A;  3C46 A;  4RUH A;  3PW4 A;  3UNG C;  3DKD A;  4NLY A;  4M8L A;  4AT1 B;  1FWK A;  3LTO A;  3T6J A;  2LXI A;  4NXM J;  1VQ5 S;  5FII A;  5M2P A;  1X4D A;  2I5J B;  3BH6 B;  2UXC F;  4J9N A;  1RZM A;  3BKT A;  1WEX A;  3UCG A;  1NPK A;  2BBE A;  1DY3 A;  1FRK A;  1B0T A;  4F3O A;  1NDP A;  4DEZ A;  1X31 C;  2MZQ A;  2N7Y A;  3OSP A;  1UEV A;  3RAM A;  1NEE A;  5IWA J;  3GIJ A;  3LWM A;  3IA0 A;  2ZVS A;  3EXC X;  2VBZ A;  4HL9 A;  1S49 A;  4PPD A;  4F04 B;  3NS5 A;  1WOR A;  4P75 A;  4Y00 A;  2FJA B;  4OL8 A;  2XBP A;  4RL1 A;  4N56 A;  4EBD A;  3AOC A;  1S7H A;  1CJK A;  2M3D A;  2B9W A;  4DV0 F;  4K4Z A;  1R0B G;  3ISN C;  1WUU A;  1P1L A;  2PDA A;  3DHW C;  3NAI A;  4AFF A;  3M9M B;  2VUG A;  4MH8 A;  4LF5 F;  3FGV A;  2XG8 A;  3SQG B;  1RT4 A;  1C0U A;  2LKZ A;  2HGN A;  5D3G A;  2ZZM A;  1SCJ B;  4Q5V A;  1Q95 G;  2CNK B;  2MZR A;  3M8P B;  2N3O A;  2WW8 A;  2OEJ A;  2HBR B;  2B9E A;  3POT A;  1B99 A;  3LP1 A;  5MLC V;  4KC5 A;  5D4P A;  1S1U A;  1Z2L A;  3BF4 A;  3UD4 P;  3MTJ A;  1LXN A;  3V6D A;  2C2O B;  5ETR A;  1DBD A;  4KSE B;  4CO3 A;  1FTR A;  3FBF A;  4Y2C A;  3Q86 A;  3PFO A;  4DL5 A;  3ZTP A;  3M2V A;  2GS8 A;  4P2F A;  3PY8 A;  5KFX A;  1PYO B;  1ZOT A;  3G71 S;  4LFA J;  1SL2 A;  1JLA B;  2MKH A;  2FUG 9;  4OYB A;  5LL6 d;  2ZH5 A;  2AYB A;  1VYA A;  3TYT A;  4ECU A;  1NND A;  4NI2 B;  4KKO B;  3HF5 A;  2RS8 A;  4Y65 A;  5F41 A;  1X5S A;  2HRY A;  4DUZ F;  4C48 A;  1RTD A;  2GHV C;  3V4M A;  3KLF A;  2UV8 A;  3QZ8 A;  1ZBT A;  5KFI A;  2UXC J;  1N54 B;  5C25 B;  1ZET A;  2DT9 A;  3D66 A;  2B4U A;  3R2D J;  2W24 A;  1DLO A;  3MPY A;  3HM9 A;  4M5D B;  4YN3 B;  5IOL A;  2DGW A;  4KQZ A;  2XQC A;  3ZZ0 A;  3GWC A;  5B0B A;  4YS2 A;  2Q66 A;  2M5Y A;  4FVM A;  3VCD A;  4C4W A;  5ETM A;  2MQO A;  2KXF A;  2Q3P A;  2ZEJ A;  3TNV A;  2FY1 A;  3Q8P B;  3VAK A;  4DV0 J;  2OPR A;  5F9L A;  1CJU A;  3QWP A;  1N33 J;  1AZS A;  2KYZ A;  4X4N A;  2IRX A;  3IR6 B;  1Q5Y A;  4LF5 J;  4ED8 A;  2VFV A;  2OAU A;  3JSR A;  2HK2 A;  2J0Q D;  2X3D A;  1RT2 A;  4IOA Q;  1WOS A;  3THT A;  2LMI A;  3K58 A;  4U7U D;  1F5C A;  2R7Q A;  1NJX A;  4U7C A;  3MR3 A;  2CIM A;  4G1Q A;  2J8A A;  3TOQ A;  2D41 A;  5D4O A;  4EZ6 A;  2CQC A;  2VPY B;  4OHZ A;  2GX8 A;  1JNR B;  5I3U B;  4KYZ A;  3HSJ A;  3SSS A;  3GQC A;  3I5C A;  3UFC X;  3MD3 A;  4K2J A;  1DAR A;  4WCE Q;  1RWK B;  1G3O A;  3H0P A;  2BRL A;  4I6Y A;  2IFX A;  1CS4 A;  1T3O A;  3JQM A;  1MMN A;  3CGI A;  5I3P A;  2AX1 A;  2QMW A;  5DM7 Q;  1J27 A;  3O6Q A;  1AB8 A;  3OR1 A;  4IOB A;  1D9D A;  4J9V A;  4H4O A;  3KLE A;  2C3O A;  1HI1 A;  4P2M A;  3M1V A;  3LF0 A;  1GAO A;  2CPH A;  4ALZ A;  2RQC A;  3NL0 A;  2EK6 A;  2VFU A;  1T03 B;  1X4A A;  3THV A;  2A3J A;  2F8E X;  1AUS L;  2R2U A;  3MPU B;  4YR0 A;  1NAQ A;  4DUZ J;  3GIR A;  4I4B A;  4RW8 A;  2MLX A;  1NK9 A;  2QE5 A;  2IHR 1;  2QFI A;  2YVS A;  4F02 A;  2U1A A;  1KVI A;  5KFA A;  1SC6 A;  3MR2 A;  3BO2 A;  3RTV A;  1IM6 A;  1ZS6 A;  4ZHR A;  1TKT B;  3QO9 B;  1RT1 A;  2MHN A;  3CVK A;  2KZM A;  3I87 A;  4LQ3 A;  2FJD B;  1UPM B;  3VVU A;  4TLQ A;  3G8T A;  1JLC A;  3OD2 A;  5T7L A;  4NCG B;  3CJ2 A;  2BDP A;  4ID8 A;  4NA2 A;  1JLQ A;  1Q78 A;  2RKI A;  3FCH A;  4C6A A;  1GH8 A;  3CF5 Q;  2FLP A;  3KHG A;  1BQX A;  3FZB A;  3H2L A;  1KQG B;  5A2Q U;  3KK3 B;  2EK1 A;  3DGV A;  2HAI A;  1IKX B;  2DNR A;  3OFF A;  2QLB B;  1RT6 B;  2WHO A;  1QAI A;  4PKD B;  1KSP A;  3D1H A;  5DDQ C;  2B5J B;  3S7R A;  4A47 A;  2A6M A;  2FJE B;  2PE8 A;  4P52 A;  4FF1 A;  3J80 U;  4PZV A;  2UUW A;  4Q8F A;  3MM7 A;  3BM7 A;  4HH0 A;  1HNX J;  4FF3 A;  3FK4 A;  3ONQ A;  2E1P A;  4ENO A;  2XMK A;  3QGG A;  3WQP A;  4BWM A;  3VAL A;  4C98 A;  1WC1 A;  3HFV A;  3GG1 A;  4EEY A;  1VK3 A;  5B09 A;  2FHM A;  3MF5 A;  1FKO A;  4WYW A;  4QYZ K;  3MPV A;  3V6H A;  5CQG A;  3VZI A;  2IC3 B;  3PRB A;  1VQP S;  3W9J A;  2AQ4 A;  2CQ4 A;  4F0M A;  4DMZ A;  1T9X A;  1FRJ A;  2NXE A;  1LXJ A;  2E29 A;  1SL0 A;  1TL1 A;  3L7O A;  1NZ8 A;  1WTB A;  2AKW B;  2ZBC A;  2V0N A;  2BEF A;  2E44 A;  2R7O A;  1F3F A;  1HMV B;  3O2I A;  2VPW B;  3J7Z T;  1FWL A;  1HWJ A;  1NDC A;  2APO A;  2WK4 A;  2DEJ A;  1T11 A;  4ZJQ A;  4EGL A;  3ITH A;  4G1P A;  1KQS R;  2E66 A;  3M30 A;  2VHG A;  2FZK B;  3V4I B;  4USW A;  3O8W A;  2HFU A;  5D4N A;  1FHT A;  2Z2Y B;  2C3P A;  1S6Q B;  2CJY B;  2ZH6 A;  3LGH A;  2GZO A;  2XYH B;  4UOC A;  1MLA A;  4FPR A;  3I4P A;  4QIE A;  2ZDO A;  5DO2 A;  1HNW F;  3PX4 A;  5CAB A;  1S77 D;  3HD1 A;  1BWE A;  2QLW A;  2ZZN A;  4QYZ J;  3HFK A;  4DU7 A;  3V6K A;  2Y0S D;  4USH A;  5GAD U;  1MWZ A;  5AXK A;  4KH0 B;  1RI7 A;  3SV4 A;  2W2O P;  2ACM A;  5KFH A;  1ZAX A;  4B9U A;  1WSV A;  3U27 A;  2YPY A;  4ZK7 M;  3BN7 A;  4PR6 A;  1DAX A;  5A8K A;  3RAQ A;  3OQ2 A;  5F0U A;  5CAA A;  2RIL A;  1UPP A;  1YJU A;  2IM1 A;  5D78 A;  5KFR A;  4C11 B;  3FJ2 A;  4N7T A;  1FRH A;  2XHC A;  1VGY A;  2EC2 A;  5KT4 A;  3PXG a;  2BMB A;  3OUY A;  3M05 A;  1I5O B;  1SQG A;  4CM0 A;  4Y0F A;  2HQI A;  1UJ5 A;  3LPY A;  3IC1 A;  5J2N B;  3CWJ A;  3X3U A;  3HFZ B;  4IG0 B;  3GP9 A;  2CQ2 A;  1X4H A;  1MSW D;  5E3Q A;  1RTH A;  2V34 A;  3EWG A;  2J9C A;  4HAC B;  4PG5 A;  1T0T V;  4JI6 F;  5KFV A;  3KLG A;  4DL3 A;  3D7S B;  3KJF B;  1IJF B;  2W2Q P;  3W2V A;  4XTT A;  1JLF B;  3NS7 B;  1HNV A;  3R6G B;  4DFP A;  5J1E B;  3I4H X;  3A4T A;  3TEG A;  4ZOS A;  5ETP A;  3CUN A;  2C1E B;  2G9O A;  3GON A;  2FPH X;  2I5J A;  4DLG A;  2AJ0 A;  1IM4 A;  2Y9H A;  5JVG Q;  1CQM A;  1L3V A;  3B8H A;  4EU0 A;  2PSZ A;  1FD8 A;  4ECT A;  1VI7 A;  4UOF A;  2XMA A;  1CEZ A;  2AJ1 A;  4CP5 A;  3PG9 A;  3ELH A;  4PXE A;  4K4U A;  3CJS A;  2RT3 A;  1NPR A;  2F9J A;  1U4B A;  2QV6 A;  1JJ4 A;  2MYF A;  4U7U K;  2PGC A;  1F0X A;  3G6E S;  2QZ8 A;  4CNZ A;  2RNE A;  1RAA B;  1OYD A;  1HNW J;  1ZM3 A;  4WII A;  2CQI A;  4DDF A;  2L3M A;  4YFU A;  3UQS A;  1HWL A;  3CDE A;  3DMJ B;  3HKW A;  2IDE A;  3K5O A;  4OHV A;  3SQG A;  3DGP B;  2D69 A;  3UO0 A;  5ETQ A;  2XMV A;  3I0R B;  2CNL B;  4CQ1 A;  3DLK B;  3TUP A;  4MTP A;  2DGS A;  4DFK A;  1TAU A;  2IYG A;  3M8P A;  2RUG A;  4U8Y A;  4JV5 F;  2M2B A;  3CO0 P;  1W25 A;  4ILL A;  2VAS A;  2DHS A;  2DY1 A;  4F7V A;  3DDK A;  3M8Q B;  3PRV A;  1CSJ A;  2J0X A;  2KRB A;  4C7Q A;  3J7A N;  2IAJ B;  3MGJ A;  2BKN A;  1OIA A;  2HLU A;  1K0T A;  4DCO B;  4H4K C;  1UAW A;  4XIU A;  3RG6 A;  5KFQ A;  3HHL D;  1QVG R;  2BE2 A;  4JI6 J;  2JH3 A;  4JYA F;  4N47 A;  4CWB A;  1NDK A;  4XPE A;  5LOQ A;  2V2Q A;  5HAO A;  1PJ7 A;  2QRR A;  4D3H A;  4ELT A;  2MEW A;  5BR8 F;  2JDJ A;  3GFZ A;  3RYL A;  4IG3 B;  2RQM A;  1R89 A;  4PCQ A;  3BPS P;  3QWU A;  1S1W B;  5C25 A;  4E98 A;  5FLX U;  1TUV A;  2V8H A;  3HHK A;  1VQ9 S;  2PT0 A;  2Z0G A;  4B9S A;  4WU2 A;  4M5D A;  4NLD A;  4OHY A;  1R31 A;  5MAO A;  3BRE A;  4TU7 A;  1KHW A;  2VDI A;  3K5N A;  1N52 B;  2KDO A;  3QAU A;  2G0J A;  2HHP A;  3W3S A;  1IR0 A;  4MIA A;  4KFB B;  1S48 A;  3DDI A;  4U95 A;  2G2Y A;  2K8G A;  2Z56 B;  3Q8U A;  2BYC A;  1A0O B;  1X5P A;  2AGQ A;  2GVD B;  3CT9 A;  2FVR A;  4AL7 A;  4DSJ A;  2JZ5 A;  4CCH A;  4NZ7 A;  2KFN A;  4IFY A;  2XSJ A;  2E1C A;  5CZX A;  5K9F A;  3QT7 A;  1XJW B;  4L76 A;  5K8O A;  4OJH A;  3DM2 A;  2P8I A;  1NJW A;  2E5G A;  2ROE A;  3AJD A;  5KG1 A;  4DG1 B;  2HHV A;  2YXL A;  4W4M A;  4KPC A;  4TY9 A;  3M8S A;  1U0H B;  5E3A A;  1APS A;  2HZA A;  2RSQ A;  4LSL B;  3T9N A;  2CG4 A;  4ZDN A;  2K1R B;  3C3L A;  2JEI A;  3I0S A;  1CPZ A;  1U1L A;  2CA9 A;  5I3U A;  4DL2 A;  5A0Y B;  5LT5 A;  2VDH A;  1QVF R;  4P72 A;  4EI2 A;  2DR7 A;  3IWL A;  3LA0 A;  5DZ6 A;  2MQ8 A;  1TL3 B;  5EGY A;  1EKR A;  5KOW A;  3HVA A;  3HMJ G;  4KJI A;  4LF8 F;  3SBM A;  3H25 A;  3OVA A;  5E3R A;  4UT4 A;  5G4D A;  4HR2 A;  4OZ1 A;  4BDP A;  2GQ2 A;  4U67 Q;  4N8O A;  4JYA J;  3HK2 A;  4DR5 F;  1J2V A;  3G87 A;  1PC5 A;  2I38 A;  3JQJ A;  2KN4 A;  4R0J A;  2BJ7 A;  1HQU B;  5BR8 J;  1VQ7 S;  2IRU A;  5A8R B;  4HT5 A;  3LAL A;  2H54 B;  2ZH8 A;  3AHP A;  4PWD B;  1XEZ A;  1QAJ A;  3HJV A;  1JLE A;  4NXN F;  5BYQ A;  4B3O B;  1I51 B;  2VPZ B;  1F6T A;  5D77 A;  4K4S A;  2EFO A;  2FJX A;  4KH1 B;  3QO9 A;  3IS9 A;  4RU9 A;  5I42 A;  3MOZ A;  1HR0 F;  3GE9 A;  3I55 S;  2HQD A;  3V5R A;  1UWB A;  1KTQ A;  2JEG A;  2C2R A;  4NCG A;  3NNA A;  3GFH A;  3DOM A;  2AEF A;  1S9G A;  3MEE B;  3HVW A;  2RF2 B;  2XLI A;  1NJI T;  1UTA A;  5IM0 B;  1FE4 A;  1X60 A;  2JNJ A;  4DR6 F;  5KFY A;  5F3T A;  5F8J A;  3KK3 A;  1RLC L;  4UY8 T;  1PAU B;  3A3P B;  2XTJ P;  4K4Y A;  2YH0 A;  3UPF A;  3M2R B;  2YWW A;  5L1J A;  4FYY B;  4J9R A;  2KT5 A;  1UMJ A;  1H72 C;  2B5J A;  2O66 A;  3TVZ A;  1A6L A;  3BZQ A;  4ZVR B;  5L46 A;  5CYM B;  3TAN A;  2YNF B;  1SBR A;  3FFI B;  2DNH A;  4HT7 A;  3TAP A;  1R8A A;  2KKH A;  4JI3 F;  3OJU A;  1Y3K A;  2WVE A;  1C0T A;  4CO1 A;  1EQ0 A;  4OZL A;  2Y0B B;  4CIO A;  1R0C B;  5KFU A;  1KN6 A;  2ZUG A;  2BA9 A;  3LPE A;  1TL7 A;  4Q2M A;  1PBU A;  1SKW A;  5T41 A;  3H2U B;  4DN9 A;  3JXO A;  1JQG A;  3I32 A;  1NB7 A;  3HHN B;  1KWM A;  4DR7 F;  4ID5 A;  3F73 A;  3VZH A;  3ZZU A;  4LF8 J;  3MM8 A;  1X0F A;  1VLO A;  4JOU A;  4N5S A;  3N6L A;  1Q7Y T;  4DR5 J;  1YG0 A;  2J6U A;  5HAT A;  4UOG A;  4Y3C A;  3I5B A;  2W25 A;  4JB8 B;  4KV8 A;  2ZHB A;  4DFJ A;  3EMT A;  4FS1 A;  1NK0 A;  2VC1 A;  1S1X A;  2DR9 A;  3VGU A;  2MY8 A;  1DJ0 A;  3UI3 A;  4NXN J;  1YKW A;  4MK7 A;  2FZC B;  3PDN A;  5HN0 A;  1NPP A;  1HR0 J;  1G4C A;  1YJV A;  1HPZ B;  2V4Q A;  3C15 B;  2VG6 A;  4D3G A;  5F8I A;  2UVV A;  3CC4 S;  1FI4 A;  1RTJ B;  5KT5 A;  4B9N A;  3KG0 A;  1E6V B;  1S6Q A;  3KTQ A;  4NEY A;  3EUN A;  2CJA A;  3GCX P;  4IH7 A;  2LA6 A;  4DR6 J;  1HBN B;  4QWB A;  2H65 B;  1VC0 A;  1IKY B;  4DR2 F;  5KFM A;  1U0S A;  4B17 A;  4NZ0 A;  2UUA F;  4WFZ A;  3D68 A;  2C22 A;  1HFE L;  2CPF A;  1SUQ B;  2GIF A;  2FHJ A;  4OYW A;  3UNY A;  4RU2 A;  2D7S A;  1MRO B;  2VG7 B;  2XY5 A;  1WHW A;  3TX8 A;  3MUT P;  3CXC R;  1KP6 A;  5ETO A;  2E7V A;  3VAH A;  3FBC A;  4OJ3 A;  1U1Q A;  4M95 A;  2H4Y B;  4HI2 A;  4OV1 A;  4DUY F;  2GA7 A;  1T9T A;  3UCZ P;  2SXL A;  1K8A T;  3RAX A;  2V9W A;  4WBF A;  5B7W A;  2HVD A;  5KFN A;  2BQR A;  3CCS S;  4DV5 F;  1OS5 A;  3NCQ A;  3T1Y F;  5J2N A;  1O51 A;  3Q8V A;  1VQL S;  4DR7 J;  1WJ9 A;  1WSR A;  1RWU A;  3MMC B;  1OY9 A;  3PKY A;  2IVM A;  4L74 A;  3W1Y C;  3QPI A;  4O44 A;  1M1K T;  1RAE B;  4ES2 A;  1JKH A;  4L73 A;  1SC1 B;  4O3O A;  1HW8 A;  1JLF A;  1N56 A;  5LXY A;  5E3P A;  1H2V Z;  4OYZ A;  1M5K C;  4J9S A;  2KM8 C;  3DOK B;  4AXJ A;  4ECQ A;  3TUI C;  2QYC A;  1HA1 A;  3BYR A;  3SMZ A;  4CDI A;  2DIV A;  2ROG A;  3L3C A;  2BM0 A;  5IT9 Y;  1KOO A;  1U7L A;  4K59 A;  3QLH A;  1VR6 A;  1C1B B;  1LK7 A;  4WFB Q;  1GX5 A;  3QGP A;  3BDE A;  2KXN B;  3OTD A;  2UZA A;  1NH8 A;  2QFJ A;  2KM8 B;  5JUM A;  2MZJ A;  4IO1 A;  3ZZY A;  4I67 A;  4X2B A;  1TMJ A;  3PJX A;  4DR2 J;  4ECS A;  5KFG A;  1WTF A;  2UUA J;  1UW4 A;  3ZTQ A;  1ZM2 A;  1YIJ S;  5B0E A;  4Z37 A;  4PYA A;  2P6S A;  3D4J A;  4NZ6 A;  3VTI A;  2G4B A;  4DR3 F;  4N77 A;  4QJV A;  1RB0 A;  1JXL A;  4CH1 A;  2QA2 A;  1AYE A;  3H59 A;  3MZI A;  3B4M A;  1T05 A;  5A8W B;  1NSQ A;  3B4D A;  2AEJ A;  3I0R A;  3DLK A;  3HPO A;  4DUY J;  5KG6 A;  3MR7 A;  3CCT A;  3H8Y A;  5J2M B;  3UW1 A;  1N5V A;  2COL A;  4IR1 A;  1UJ4 A;  4I0W A;  4LRD A;  2EKY A;  4ZCL A;  3I56 S;  2QGF B;  5HAN A;  3OPK A;  3M8Q A;  1PJ6 A;  3GB0 A;  2HHQ A;  4DV5 J;  1DZ5 A;  1FVS A;  3BYP A;  2DNK A;  2GAG C;  2IAJ A;  3T1Y J;  1LFW A;  3OBI A;  3FEY B;  2XO6 A;  3GII A;  2YPZ A;  6FD1 A;  4KHP F;  2Q6B A;  1VIX A;  3B78 A;  2MB0 B;  4JI7 F;  2N7C A;  4PYD A;  2VZ9 A;  2ZE2 A;  2V4R A;  1S79 A;  5KT3 A;  4NLU A;  5L1K A;  3BO3 A;  4I7F B;  2DEI A;  4HHH A;  5ETK A;  4LFB F;  4H4K A;  3O5T B;  3WIU A;  4P2S A;  3EZU A;  1G6B A;  1S1W A;  4K4T A;  2DH8 A;  4I68 A;  4MFB B;  1I6J A;  4I2Q A;  2F8M A;  2VFR A;  1RT3 B;  4C8O A;  4I2P A;  1WOP A;  1XK8 A;  1GMU A;  2AJ4 A;  3DLE B;  2ZH4 A;  4WJB A;  1NK6 A;  4JI1 F;  4OJG A;  2F8H A;  4DZ6 A;  4KFB A;  2XYP B;  1TK8 A;  3EXY A;  4L3K A;  5E3C A;  4ANE A;  2RML A;  1FKP B;  3NMR A;  4TYB A;  3MMA B;  2R42 A;  2VOP A;  5IFM A;  3OSN A;  5HL7 Q;  2XZW A;  3CCZ A;  3EZ5 A;  5H9E K;  3W8G A;  4DR3 J;  1BY9 A;  3MR6 A;  2O5D A;  4NOH A;  4ZPA A;  3HD2 A;  4DG1 A;  4EMD A;  5HJY A;  2O67 A;  4QPT A;  1NRK A;  4WFY A;  1VBX A;  4LSL A;  3OT9 A;  4FNI A;  1RT5 B;  3CMA S;  2WON B;  2ZNY A;  1HBM B;  3VGV A;  1FX4 A;  3RBX A;  2LEB A;  4PXD A;  1HKA A;  1QTM A;  1VC6 A;  1F60 B;  2PII A;  4TN2 A;  3FDS A;  3GJT B;  4PAB A;  1TL3 A;  5F8G A;  1U49 A;  4YB6 A;  5B08 A;  1YSJ A;  1Y5I B;  3G6V A;  3J81 Y;  4B3R F;  1S9E B;  1YBA A;  1IBC B;  2W7A A;  4G1I A;  2WRM A;  2QO3 A;  5A6W A;  4R25 A;  4K7Q A;  3HZG A;  4KHP J;  3J7Z 5;  5D0R A;  1RWP B;  5LMU F;  4JI7 J;  3V81 B;  2H9Z A;  4OX6 A;  3NWG A;  2IIH A;  2DNO A;  3T9Z A;  5A8R A;  4LFB J;  3R7N B;  2CVE A;  2PMZ D;  3SCK E;  4DR4 F;  1UVN A;  2IYI A;  3GCW P;  4B3O A;  1PC4 A;  1YZ6 A;  3L4B C;  4DPU A;  3C6U A;  3OXF A;  4U6P A;  4AQY F;  1QDU B;  1VQ6 S;  4UQG A;  1LW0 B;  4JI1 J;  3SDE A;  2OTJ S;  2VFT A;  3MEE A;  2RF2 A;  1SC3 B;  3NY0 A;  3R8Y A;  1OSC A;  2UXD F;  2XM3 A;  3BJY A;  3ILL A;  1Y5L B;  3DNC A;  2I6W A;  5K20 B;  1HYS A;  1N4L A;  2HBZ B;  1IR1 A;  1LFP A;  2RDJ A;  3ENV A;  3Q89 A;  3M2R A;  3AH6 A;  2DTJ A;  4C0O C;  3EM1 A;  2HHH J;  3RB4 A;  3NGU A;  4ECR A;  3DRR A;  1RAI B;  1T02 A;  3DLB A;  1TEL A;  2RIJ A;  3FMW A;  5CYM A;  1LV5 A;  2ALZ A;  4HEA 9;  5DM6 Q;  1YJN S;  2HS4 A;  1RE1 B;  5HI7 A;  2CQ3 A;  1V3R A;  5DRK A;  3J81 j;  1ARO P;  3CE8 A;  1VRT B;  4PUO B;  2JOQ A;  2H5I B;  2DNL A;  3HHE A;  4DSE A;  2A6O A;  5EX3 A;  2WOM A;  2E7X A;  3Q8Y A;  3TZW A;  3AOA A;  2E5I A;  1NJY A;  4F25 A;  2H1Y A;  2UUC F;  2DPI A;  3KFW X;  4XAK A;  4Y2M A;  5KG3 A;  2W4P A;  4R0E A;  3OR2 A;  1XMQ F;  2C2K B;  3HZE A;  4B3R J;  3FCW A;  2EFQ A;  1WI8 A;  2G0I A;  1IVZ A;  5HVG A;  3H98 A;  4B02 A;  2F7V A;  2MLY A;  3NGS A;  1JK9 B;  1HHQ A;  1TZ0 A;  5LMU J;  5DQI A;  1ZTW A;  3KJQ B;  1TL5 A;  2CQ0 A;  2KH9 A;  2VB6 A;  4TYA A;  2U2F A;  5HQM A;  2BJ9 A;  2EFN A;  2J7W A;  4USM A;  5EN1 A;  1CJK B;  4DR4 J;  2MMY A;  3MI7 X;  4U96 A;  1VDH A;  3FSX A;  2BRK A;  3K59 A;  2HNY B;  5DET A;  1I1G A;  4AQY J;  5DDO C;  2OKQ A;  2RRB A;  4ATN A;  2XY7 A;  1RT4 B;  2HNZ A;  2Q79 A;  8AT1 B;  2M8D B;  5D3G B;  4M5N A;  1H7W A;  2UXB F;  3B54 A;  2DGX A;  1KR4 A;  4L72 B;  1VQK S;  5K14 A;  4WPA A;  3LQV A;  4OI6 A;  3FRZ A;  2UXD J;  3POT B;  4JUZ A;  2MY7 A;  5FJ4 A;  2HZV A;  3QAE A;  4ELU A;  1IKY A;  4OYP A;  3V6D B;  2GJ2 A;  3DDN A;  2KI2 A;  4ZP8 A;  3CCU S;  1OY6 A;  3ZTS A;  1ZA2 B;  4K0K F;  2BQU A;  3GSI A;  2R7R A;  4X4V A;  3M2V B;  1R27 B;  3NP5 A;  3R5G A;  4ECY A;  3NWR A;  3OFG A;  2HUR A;  4FYW B;  4YME A;  2RRA A;  4NWB A;  2AEM A;  2DH9 A;  4HI1 A;  2UUB J;  3P49 B;  3GIL A;  1FJC A;  2YKN B;  3A1Y G;  1R7I A;  4QIF A;  4OYX A;  2FHO B;  1BGX T;  3NGK A;  2FYX A;  2UV8 G;  1UEU A;  1UJ6 A;  3ZC4 A;  4OIX A;  4DR1 F;  2HMI A;  2N3L A;  2Z8Q A;  4FBT A;  2UUC J;  4EO6 A;  2EWH A;  4OI2 A;  1DLO B;  2J7U A;  2E9T A;  1FRI A;  1XMQ J;  1RAD B;  2V2K A;  3MMC A;  4P74 A;  1HD1 A;  3IXQ A;  5ITH A;  2VQF F;  4RZR A;  3NLC A;  1VRU A;  3MPD A;  3PKM A;  2C2D A;  2C42 A;  4GVL A;  1KC8 T;  3R2C J;  3ZTR A;  3CJQ A;  4P10 A;  3W5X A;  3PRD A;  4AD6 A;  4ED7 A;  2ZOM A;  4USJ C;  4CLS A;  1Z2Z A;  1K44 A;  2I9S A;  2I8E A;  4B9L A;  3EGN A;  1J5O A;  3D6H B;  2B8P A;  5CCM A;  2HBQ B;  3ZO7 A;  3W64 A;  3DOK A;  1NK7 A;  4ICL A;  1Q4R A;  2QLJ B;  4F67 A;  3TUZ C;  4YY3 F;  3PIP Q;  3OLA A;  2BKP A;  4LR8 A;  2CQG A;  4ES3 A;  3K8V A;  3HX9 A;  1FXR A;  1IKV A;  1UVL A;  4IRC A;  2OLW A;  1FJE B;  1RT2 B;  5F3Z A;  2V94 A;  4DWI A;  4C2M A;  1K47 A;  3ULH A;  2XUL A;  2Y1J A;  2ILZ A;  2WVD A;  3W2W A;  3SCL E;  2Y8W A;  2UXB J;  4RWX A;  3SZ2 A;  3TAM A;  1SJ1 A;  3ENA A;  2J5A A;  2GHW A;  2D1C A;  4ED0 A;  1N6Q B;  2PFF B;  3HVT A;  3BO4 A;  2XB2 D;  4NLP A;  4CLY A;  3BSC A;  4ETZ A;  1FXD A;  1CS4 B;  2LA4 A;  2G2Z A;  4WK3 A;  2ZVI A;  5HK4 A;  4K0K J;  1N32 F;  5DGA A;  2XMT A;  4CH0 S;  2EXU A;  4XDD A;  1ZAV A;  1AT1 B;  4H4O B;  4CZC A;  2BX6 A;  5KFB A;  3KLE B;  3MFH A;  3M1V B;  2MKY A;  1CC7 A;  2B0G A;  4F3M A;  2VA2 A;  3EPG A;  1S57 A;  1MG7 A;  3TZZ A;  2XCP A;  1S1V A;  3W60 A;  1HBO A;  2LP4 A;  5J2M A;  3FNN A;  1Q86 T;  3LW5 C;  4M5L A;  1TFY A;  1WEZ A;  2BXJ A;  1RXO B;  4RW8 B;  1L5U A;  3WC0 A;  4Y6I A;  1L3K A;  1QJH A;  4DR1 J;  3CCE S;  2R8J A;  4L75 A;  1VC5 A;  1XWL A;  1LWX A;  4DPX A;  2DRB A;  3QAT A;  1FT8 A;  1MU2 B;  5KFF A;  4ZHR B;  3RBE A;  2PO4 A;  1ROF A;  3W9H A;  1SJF A;  1RT1 B;  2ZWO A;  3ZTO A;  3EGW B;  3ZZT A;  5KT6 A;  5T7L B;  2VQF J;  2HRT A;  1WC4 A;  3FMB A;  3PAC A;  4A8O A;  3OXL A;  2EG2 A;  4C8N A;  2KXH A;  2MXY A;  2CJB A;  5CHC B;  2ZM6 F;  1AA1 B;  3CCV S;  1H73 A;  1S1T A;  4NMX A;  1M5P C;  4XDC A;  1UVJ A;  2WSF C;  4RLE A;  4BC7 A;  1YZ7 A;  1DTT A;  4LRF A;  1ZTT A;  2KRR A;  2VBW A;  4YY3 J;  4USV A;  4DL7 A;  2V8G A;  4MFB A;  2YQ3 A;  3IBF B;  1KEK A;  1RT3 A;  2MPU A;  1UCN A;  4WK1 A;  2HBY B;  1XR7 A; 
#chains in the Genus database with same CATH homology
 1U0H B;  1CJV B;  1CJK B;  3C15 B;  5D0G A;  1CS4 A;  3ET6 A;  1WC6 A;  4WP8 A;  4OYI A;  4CLZ A;  4OYX A;  1TL7 A;  1WC0 A;  4NI2 A;  1AB8 A;  5D0E A;  2GVD A;  1WC5 A;  4P2X A;  1Y10 A;  1CJU B;  3MAA B;  4OZ3 A;  1AZS B;  4CM2 A;  5D15 A;  4WP9 A;  2GVZ B;  4P2M A;  5D0H A;  1Y11 A;  4USU A;  4OYO A;  4CLP A;  4CLT A;  1YBU A;  3G82 B;  4CLU A;  1WC4 A;  4P2F A;  3C16 B;  1FX2 A;  3UVJ B;  1CUL B;  4CLY A;  4OYW A;  1FX4 A;  2BW7 A;  4WPA A;  1CJU A;  4OYZ A;  1CS4 B;  3ET6 B;  1AZS A;  4OYB A;  1WC3 A;  1CJT A;  3C14 B;  2W01 A;  5IV4 A;  1U0H A;  3MR7 A;  1CJV A;  1TL7 B;  1YK9 A;  1CJK A;  3C15 A;  4OYP A;  4NI2 B;  4OZ2 A;  2GVD B;  4CLK A;  4CLF A;  4UST A;  3G82 A;  4OYM A;  3C16 A;  5IV3 A;  3UVJ A;  4CLS A;  1YBT A;  3MAA A;  4USV A;  2QV6 A;  4CLW A;  4CM0 A;  2WZ1 A;  4CLL A;  3C14 A;  4USW A;  3R5G A;  2GVZ A;  4OYA A;  4WP3 A;  1WC1 A;  1CJT B;  5D0R A;  1CUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...