4NXNF

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nxnF00
4AQYF 1FJGF 4YY3F 4JI1F 1N32F 5LMUF 4DR7F 4JI8F 4OX9F 4DR5F 1J5EF 4DUYF 1B64A 4DV0F 1FKAF 2J5AA 1IBKF 1HR0F 2UXCF 1F60B 1N36F 4X66F 4LF6F 2UUCF 4JI3F 4DUZF 2E5LF 2F4VF 1CQMA 4B3SF 1IBLF 2UUBF 4DV1F 4JI6F 2KJVA 1GH8A 4DV7F 1VMBA 1HNXF 4LF7F 1QJHA 2HHHF 2YY3A 1G1XA 4DV2F 4NXNF 4LF8F 1XMOF 4LF9F 1IJFB 4DV5F 2KJWA 1XNRF 4LFAF 4DR3F 4B3TF 4GKJF 4LFBF 4JYAF 4B3RF 4YHHF 4JV5F 2UU9F 2B7CB 4DR2F 4DV4F 4DV3F 4KHPF 4JI4F 3R3TA 3T1YF 2ZM6F 3ZZPA 4LF5F 1XMQF 4JI7F 1HNWF 4JI2F 1N34F 2BVZA 4JI5F 1I94F 4DR6F 2BXJA 1CQNA 1HNZF 2UXDF 1IJEB 4DV6F 1LOUA 4X64F 1XNQF 2B7BB 4B3MF 1RISA 2UUAF 3OTOF 2UXBF 4NXMF 1IBMF 5IWAF 2RJZA 4GKKF 5BR8F 2VQEF 4DR4F 4K0KF 4X62F 2VQFF 3T1HF 5AJ3F 1N33F 4LFCF 4DR1F 4JI0F 4LF4F 4X65F 1G7CB 5LMNF
chains in the Genus database with same CATH superfamily
1ZM9A 3D0HE 2K06A 4IQMA 3KK2B 1S6PB 1RKIA 1HBUB 4F67A 2FVCA 4IDKB 2QL5B 3E3XA 1UFLA 3T9ZA 3UN5A 1CC7A 3PY8A 5KFVA 2WSEC 2EWHA 4B3SF 3KOAA 4J9KA 2RQ4A 3EZOA 3TJ9A 4WFAQ 3M7VA 1RTJB 2NS1B 2W01A 1OQ6A 4DUZJ 3DLJA 2GIFA 1FKOB 4KRWA 1QE1B 4OI1A 2CFXA 1HWJA 5KT6A 3KLGA 4DV4F 8AT1B 4PUOB 1FNXH 4KJIA 2YNIB 4UOGA 4YR2A 4A8OA 4UY85 3UNGC 5K20B 4IUFA 4C3MA 3OXFA 3AFGA 4PKDB 1M5HA 3TUIC 4EBCA 1RE1B 3GFXA 2YNHA 4LBHA 5C25B 2EC2A 1R8BA 2DGVA 4MJKA 4URGA 2B9YA 1W25A 2RT3A 3JXOA 4J9UE 2DXEA 2M5YA 3BPSP 1XR6A 5L1IA 4ED3A 1F0XA 4DG1B 1P8GA 2P2CB 4Q43A 3ZTSA 1JNRB 5KT3A 5C2CA 1HI1A 1RSCA 3SSRA 4IR1A 3ISND 2KG1A 4F4AA 3HVWA 1OWXA 2JC1A 3FSIA 2HNZB 4DV7J 2HNDB 3F41A 2AJ0A 3AY0A 1F2GA 1TAQA 2KJVA 1SUQB 3I0RA 1VMBA 2JRSA 2VPXB 5B09A 1S57A 3IFEA 3AQPA 2XMTA 3DM2A 1QSYA 5L1KA 3BN7A 1SL1A 1JLEA 3EGVA 3M2VB 2YKAA 3ENAA 2ZJPQ 3M30A 4OHZA 3BGRA 4B3OA 3A13A 4JI4F 1FESA 3N4WA 3HX9A 2DY1A 3KLEB 1I94J 4KIAA 3SFGA 1GEHA 1K73T 3GG1A 3W60A 3IWNC 2ZUAA 1H2TZ 1X5PA 5D0RA 2VBYA 1IKWA 4C8YA 4ZPWR 4W4MA 4CLWA 3HD2A 4O3PA 2MQLA 3OFHA 5J2PB 1RWVB 2VASA 4OX9J 1IQTA 1J5EJ 2CQGA 4LSLB 2J5AA 3A8IA 3IMQJ 1VCTA 2V94A 1U6BA 3D6FB 4RBVA 4DMZA 2FVRA 4DX5A 1U2CA 3G4SS 4Y2CA 1RACB 3MCMA 2WZ1A 3AXKA 4RL1A 1JLBA 3UW1A 4F02A 1MU2B 2YKOA 2YWHA 4EWTA 5KFJA 3KTQA 2PA3A 1ZAWA 3E01B 3LTOA 3N5BA 4IRCA 4NCBA 2GHWA 5CAAA 1UWBB 1R0AB 5KFFA 3N6MA 4EI2A 3CJ3A 1LWXA 4F4YA 1KN6A 2IYGA 3NS7B 4YB7A 1RDRA 4QIWD 3H40A 4QYRA 3H2LA 4AE5A 4X64F 4CH0S 2AJFE 2HK2A 1FNMA 1K0VA 1UVNA 4ZVHA 4UT4A 4ILMA 4DHVA 4YR3A 1YJUA 1RAFB 2G1HA 2HURA 3M32A 1PO6A 2B5JA 2KI2A 4DCPB 1NK4A 1IQZA 4J91A 2ZD1A 3NWRA 1J5OA 1JLQB 2JFDA 4P2MA 2UUCF 2YQ0A 4F4WA 3ZTOA 4BBYA 2ZBPA 3N0VA 3L7PA 3A3OB 1D1UA 4K4ZA 2MQOA 4DR3J 2RDDA 4JBCA 2A6OA 1R31A 5FDLA 2HS0A 1QUPA 2DKOB 4A8SA 3DMJA 5JJBA 2A2CA 1S10A 4B9LA 1O51A 2HKEA 3IM9A 4OHVA 3PVXA 1KNZA 1S6UA 4EZ6A 2C3MA 4CYUA 4DR6J 4KKOB 3VAJA 1HI8A 4M5JA 2EBEA 2VHGA 1TVRB 4PPDA 2DO0A 3HVRA 2JEIA 5DDPC 3IS9B 3AJ1A 2FPHX 1IBMF 2ABYA 2NYHA 5CZXA 3R9LA 4BLGA 3BZQA 1GMVA 4LVOP 3UDVA 4DR1F 2DB1A 2ASDA 2JVOA 1HQUA 5A6PA 4OZNA 1LW0B 1VQNS 1YI2S 2GVDB 5DS7A 1M5PC 5D4OA 5CD4A 2YWKA 3KMQA 2LDIA 2IFXA 4X4VA 1WDDA 3LW5C 4ZCMA 3R6LB 1HBOA 5E2QA 2B9EA 2MKYA 2YH0A 2GMLA 5LT5A 4RBTA 1VIOA 4P74A 4LFBJ 1I3OB 2IC3A 4DV3J 4WFYA 4NEYA 1BXNA 2G2OA 3R5JB 3ILJA 4CT8A 3M8WA 3U1NA 4KT0C 5BXIA 2AT1B 1CG2A 3IBCB 4FXDA 2LMIA 2M4MA 1RWNB 3MM8B 4I1TA 3D0GE 3NAHA 1F5AA 4B3MJ 3GILA 2KXNB 1H38A 1SCJB 2DXFA 1R43A 4DWIA 2L9WA 4GO7X 1TL3B 2E1CA 4C9DA 1RT7A 2ZZTA 4R5PB 3IBFB 1HQEB 4CRJA 3VGVA 1ZA1B 1VRTA 4USKA 2G0IA 4EMDA 2MZSA 1K8AT 4URSA 4QIGA 2Z58B 4WBFA 2NSCA 4N8OA 5DGBA 1MWQA 1S1VB 1S5ZA 4AYBD 3V81B 3K7RA 3ONQA 2XI3A 4WTYA 2DGUA 1EETB 1A0OB 1V3ZA 2B51A 3PG9A 3OVBA 3FMBA 1HI0P 1DQ9A 2ZNYA 1D9DA 4K4TA 3KWMA 3VAFA 2CJAA 1RP5A 4A8XA 2HHTA 4QIVA 2OPSA 1PBUA 2XCPA 1TKXB 1MNEA 1IR1A 3MMAA 3IC1A 4B08A 3NWGA 1HNIA 3K5LA 3OUYA 3H25A 5HN0A 2F9JA 3C6TB 1RQ0A 3GU0A 3UCGA 3FKBA 3ZO7A 1REGX 3Q24A 4F8RA 2Q6BA 2LXUA 3BR8A 4NOHA 5IS2A 2HVIA 2OEMA 2HRTA 4NMXA 3B6BA 4USMA 5CYQB 1FKAF 5KT5A 2MQ8A 3N9UC 1UFKA 2H65B 1BWEA 2DITA 4Q0BA 2V0NA 2CJXB 1HBNB 1LWEA 3HHKA 1BUXA 3IRXB 2XYPB 4G6VB 2CPJA 1S7HA 2L3MA 3NNHA 1MROA 4RNFA 4F3MA 4ILLA 1YG0A 2D3OR 4P2FA 1UVLA 3G82B 6AT1B 5KG4A 4ECZA 1J27A 3HHNB 3V2UC 2X3GA 2ZH6A 1XMBA 2V8HA 3HI9A 2YWGA 1S97A 1C4AA 3DOKB 1IKVB 3GE9A 2M9KA 4KC5A 1SXLA 4ERDA 2H3EB 4FZVA 4KB7A 4P2SA 3DLEA 3MUMP 2VPZB 3ZZ0A 5I3PA 1T0TV 4DDFA 4FS2A 3UFCX 4AFFA 4HT7A 3PIPQ 2WCXA 2DH7A 2ZC4A 3RB4A 2RF2B 3C16B 1Y11A 1RJJA 3G6ES 2JFKA 1NCLA 2QG9B 3NAIA 2LQ8A 3UDCA 1FX4A 1YJWS 1AUDA 3PCOB 1X4FA 3LUYA 2OI2A 3GIJA 3THVA 1I5OB 1DZ5A 2VOPA 4ZHRB 3M6UA 3MD3A 3T6BA 3US5A 3MM9A 3TZWA 3HFZB 2DHAA 2XBPA 1S1TA 1WI8A 4NEZA 4DS4A 5LOQA 5CCMA 3AJ2A 2NXCA 4RJVA 1HW9A 1H7XA 3VAGA 2AWZA 4PXBA 2HHUA 3P5TL 4MT1A 2BBEA 3TA2A 3TAMB 1FJCA 3OR2A 1EX8A 1M5SA 4BDPA 1HNZJ 1WF0A 3H42A 4CNZA 4TU9A 4ECTA 4LRBA 2D9OA 3EPIA 3QT8A 4K5RA 3JSMB 3THTA 2R7VA 2FQQB 1U4BA 2RMLA 2F4FA 4ZJQA 4X4OA 3OSPA 2XI2A 2GQQA 5D0GA 2JL9A 5HQMA 4IG0B 1N36F 1SV5B 4OL8A 4DSJA 3KJVA 4DV1J 3CMES 4F25A 2AF6A 3IP0A 1QDUB 2KVQE 2W7OA 1NH8A 3AD7C 1B99A 3L09A 4JYAJ 2J6UA 2UUCJ 3ISZA 2GFFA 4DR2J 1ZOTA 2KO1A 1HIYA 2YQ3A 1U1MA 3LP0A 1YDLA 1E6YB 2A3JA 1N34J 4K50A 1KQFB 4ZVGA 3RW6A 2YWEA 2LCWA 4CNYA 4MK9A 3WIUA 4NL5A 3H4BA 1TP7A 1B3TA 2PDAA 4X62J 3RRKA 4K4YA 2X1GA 2VPWB 4RW9B 2YKPA 3AT1B 3IN5A 1NNDA 1VI7A 5HSPA 4W92B 3MEDA 1H6KX 4MTPA 1HBMB 3D7SB 4ZJLA 1FFGB 1B4SA 1IBMJ 2HW3A 4OX8A 3RAMA 4PWWA 2RVJA 3TA0A 4DR1J 2ASJA 3P45B 4RPFA 3PYEA 3BJYA 1JLCA 3H90A 2OIHA 1OS5A 1P1LA 2R8GA 3LGNA 1V9OA 3KG1A 2CNNB 2DHGA 1WKKA 4TQRA 4D3GA 2R42A 3N28A 4WIQA 2XMVA 1AZSB 1D09B 3AD9C 3POTB 1KLMA 2CQBA 1YX2A 5F0WA 2W7AA 2BE2B 1HWUA 4J9MA 3BBBA 4UOCA 3H4DA 2W9CB 1VLYA 3Q86A 4RW4B 1CJUA 1T9YA 5H9FJ 2XSJB 3V4MA 4DSEA 3VGSA 1PAUB 4MKBA 4K5SA 4ZVUB 2UVVA 1Q1KA 1VQLS 2Q1LA 4KPYA 5J1NA 5DZ6A 3RBXA 4ZPTR 3IM8A 5AJ3J 1HHQA 4K0KF 1X4CA 1QD1A 4AL6A 1XR7A 5AXLA 1JKHB 3M05A 2UVWA 5AE2A 4EFAC 2HHSA 4H4OA 2J6SA 1RHKB 1S1XB 5EGYA 3KLHB 4RWWA 2U2FA 2PMZD 2DYAA 2MLXA 2NXEA 1RUSA 4TXSA 2WTFA 2DHHA 4BHQA 4RZRA 4IR9A 1BY9A 4C8NA 2MY8A 2HMIB 1YVFA 3PX0A 2QT7A 3IR6B 2FVSA 2IY5B 2HFZA 3Q89A 2M8HA 2Y1LB 5KTQA 2C2EA 1XTZA 4N7TA 4CLTA 2ACYA 2GO8A 4MH8A 3FRZA 1TELA 2RHSB 1Y5LB 2MY7A 5BR8F 4OLPA 1KOOA 2NXNA 4NRUA 4E8UA 2C3PA 4ED6A 3DFEA 2B8PA 4DUYJ 1GQEA 1QUVA 4WU3A 5HBMB 1DQ8A 2IJNA 3PX6A 2WBMA 5D3GB 3LGHA 4YS2A 4HACB 3OV7A 1RT6B 4R8UA 4DU8A 3GG0A 4HR2A 3W2WB 4HL9A 2B6AA 1U1NA 3W61A 2CWKA 4LF9F 2KJWA 1Y10A 5A0YB 2H1YA 1BQNA 3PHEA 4NLWA 2RU9A 4ZLPA 2XQCA 1U6ZA 2BQ3A 1V3RA 1UPMB 2EG1A 2Y1IA 5D0EA 3D66A 1C0TB 2RQKA 3Q83A 4ITSA 3MR5A 3J7Z5 3L3CA 5HLFA 4B9TA 1UL3A 2OPRB 1YQHA 4QR0A 1KVJA 1FERA 2GA7A 3F0NA 1TL1A 4ZVTB 4BS2A 1SIWB 3TANA 2VFSA 1S99A 5KFKA 1TL7A 4Y2KA 3ZZOA 3RAQA 4IG3B 4AUKA 4C97A 3DDKA 5GAHI 1B7FA 2IVYA 2DO4A 1F3VA 3TA1A 1SKUB 2E5HA 4ID5A 2DEJA 2JZ5A 3NG8A 1T11A 1IM6A 5DQIA 2NSBA 3W5ZA 2HHHF 2OEJA 8RUCA 3FZ2A 3QWUA 1LV5A 1OJ4A 7FDRA 3FQKA 1XN9A 4F0KA 3M8SA 1WEZA 1KEKA 1SKSA 5F3TA 4JV5F 3U27A 2BM1A 4MKVA 2RQMA 4P73A 2KDOA 3QAUA 2ZM6F 1YITS 1QLNA 2YX4A 1JXLA 7AT1B 3KG4A 5C2GA 2WSCC 2VC1A 4I2QB 3D6MB 2UVRA 2FVPA 3GWCA 3TOQA 4I7FA 1EIYB 2CJKA 1SC3B 1VBZA 2AEJA 3M8QA 2VF3A 2VQEJ 2IMOA 1GXUA 2D9PA 3H5SA 5KFXA 4IRKA 4JB8B 2BV3A 1QY7A 2YWFA 3J81Y 2FY8A 5C24A 3LP2A 5U47A 4OZ2A 2HNYA 1DHMA 3Q0AA 1NK7A 3PR5B 5I3UA 1Q81T 2J9DE 5K5MA 2FJXA 1Q5VA 3NCQA 2SXLA 3DI6A 4C8KA 2VA2A 1VJWA 3AA9A 2W2PP 2QIFA 3HVAA 4LF7F 1PCAA 3K5OA 3ZZTA 4KBIA 1RAEB 5CXTA 3FSXA 1NKBA 4ECYA 1RLDA 2YWWA 3BGLA 1R8CA 2DGTA 3KNAA 4QPXA 3SI8A 1HHTP 2IMWP 2GJFA 1REVB 3J7A1 2E9TA 2UUWA 3GMGA 2HVDA 3ENQA 3P8BB 4YR0A 2GMJA 4CDIA 5ETRA 5I4MA 2W7PA 3ZZRA 2HS3A 2GMHA 1YRTA 2R7OA 3HK2A 3H2UB 1R6VA 2ZBRA 3OT9A 2DCUB 3MFIA 2ZITA 4DQQA 3G9CA 1NXIA 2M2BA 4FF4A 1KVKA 4N77A 2Z2YB 3K5NA 3MUTP 5DZ7A 3WZ0A 1R7IA 2VZ9A 4FYXB 3OFFA 3R5DA 2R8KA 5DDQC 1JLAA 3JQMA 4DV2J 4NXNJ 2PE8A 3BQ0A 2FLPA 2BKOA 2C2RA 3CCJS 1FKPB 1XMOF 4O4GA 4EBDA 1RTIB 1X4EA 3P5BP 3KLIA 2H4WB 1WWHA 3DRSB 4PAAA 3MOZA 1HKAA 4LR9A 5A8KA 4LF5J 1NDCA 2YNFB 3J7YI 4BC9A 2YH1A 2BACA 3PACA 4DZ6A 1GAOA 2WBRA 2V8PA 3DLKB 1PYOB 2I9SA 1X4AA 2C3OA 4OI4A 2HHVA 3NGKA 1CJVA 5EX0A 3WC0A 4NI2B 4DV6F 4FDFA 3FJ2A 2AMCB 1SL2A 3Q8PB 3E2EA 3AXMA 1N5YA 5DQHA 3QGPA 2AGQA 5LMNF 3PRVA 3TJAA 2XMWA 1LXJA 2E44A 3KHRA 2CPIA 3KJNB 5MLCV 1LWFA 3C8YA 3T9NA 4MMOA 4ZLLA 4RUHA 3ZTRA 2D1CA 1CQMA 2OAUA 1Q8LA 2Y8YA 2V9WA 4WPAA 5KFYA 2HWTA 4YHHJ 3TJ8A 1Q53A 3RYLA 2VU5A 3BSCA 1T94A 3UCUP 1H3DA 2D3ZA 5HQ8A 2YKMB 3N01A 1BQMB 1HNWJ 4WXOA 4MIAA 4X4TA 2ZDPA 3GIMA 5E3AA 5LM7E 3JAMY 2ATCB 2NPIA 2WVBA 2I38A 4PRFA 3MCNA 2AEFA 1UZHA 2RJZA 1HMVB 3IWLA 3ZXWA 1U0HB 3OFGA 2FJEB 3LP1B 4QCLA 4HT5A 3MMBA 4JI8F 5B08A 5CD4H 3F73A 1S1UA 3MM6A 2I1RA 1B7YB 2HSEB 2V2VA 4MIWA 4TY8A 3NOCA 2J9CA 3X3UA 2E1AA 2VOOA 4IFYA 3LAMA 3MAQA 2FB0A 1IN0A 3PO4A 2RSQA 1T9UA 2Z56B 3NS6A 1EP4B 3OVSA 4LF8F 3R6GB 4I2PA 2K1RB 1FDDA 1P1TA 2KRBA 5L46A 4B3OB 3L7UA 3ENVA 1KRPA 4XDDA 5RUBA 5DG9A 4HTIA 4KHPF 3N6LA 3T1YF 3KLVA 2K8GA 3VALA 2FGCA 4WE1A 1LK5A 4USTA 2BKNA 2BM0A 4LRFA 3Q8UA 1CS4A 5JMNA 4NLTA 1TR0A 2DH9A 3NGDA 3DC2A 1IJEB 1H73A 1UKUA 4OYWA 1R27B 1MG7A 2VG5A 5HMZA 3ET6B 3QJPA 3T1HF 2IBOA 1A9NB 1BHNA 1R0CB 1S9EA 4DFPA 3QZ8A 1S6QB 2XM3A 4RU9A 3NXZA 3W8GA 4HVZA 2E66A 1VISA 2CQDA 1EHWA 4O3RA 4PG8A 1WACA 1G2EA 1I6JA 1SJ1A 1T8EA 5J2QA 3J81j 4XPEA 1ZS6A 4CM0A 1KC8T 2XC9A 4DL5A 2JLGA 1SJFA 5A2QU 2HAIA 4QIFA 4DXLA 1RGVA 5SUHA 3SCIE 3S01A 5F8JA 2L48A 5A6WA 2C2KB 3C66A 1PC5A 1RWOB 1RWXB 1HPZA 3RR8A 2HHHJ 4GRSA 3IO1A 1SKWA 4KAIA 3K57A 3T41A 4K4VA 1JJHA 3NL0A 4EO8A 4LIRA 2KL8A 2MXYA 3AB4B 4EUVA 3EZUA 1Z2LA 4W90B 1GX6A 2EFPA 4UTGA 1KHWA 2AX0A 2ZE2A 1QSSA 3GLJA 3QT7A 1FJEB 3I4HX 5HI7A 3I5CA 3SV4A 1R89A 5IQQA 2IRXA 1G7CB 3ADAC 3RGIA 2Z2ZA 2ZBIA 4DR5F 2KU7A 1T7PA 4EO6A 5KFDA 1NJZA 2K3KA 4KYZA 4OJHA 2UUBJ 1RAOA 3KUGA 1T03A 4K59A 2GZOA 3UCZP 3OTCA 1C1BA 1N8RT 2N4CA 4USHA 5KFEA 1WC1A 3FBCA 3O6QA 4XDCA 4ZCIA 5HROA 4LF7J 3KLFB 3OPKA 2BYCA 2V8GA 1S6OA 4LSNB 1U1RA 2LA6A 3BKFA 4O44A 3MMJA 2ZZMA 4E2FB 1L3VA 1UPPA 2V2ZA 5DDOC 1YWXA 5F9LA 1BMQB 1XNQF 3BF4A 4H4KA 1RTHB 4KHMA 4V1Ak 2YPYA 3EJMA 2CZVC 1NJXA 3FC9A 4WTOB 4YY3F 3SFUA 4M5GA 4C8OA 4HEA9 3HDSA 4ZPDA 3DYAA 2YX7A 2ZDOA 2Y0BB 1QVGR 3S6EA 1WOPA 3CEDA 4L72B 3G2XA 3WC2A 3GPAA 4YB1P 2LEBA 2DTJA 3MECB 4ZIVA 2IC3B 1C1CA 3JTNA 3ELHA 2DGQA 3MPVA 1H98A 2V4QA 1E6VA 2CQPA 1RT4A 2MZRA 4P71A 4F2RA 3HHLD 2AYMA 2VA3A 2W25A 1LW2A 1QAJA 3JYTA 5C42B 3IA0A 1DFDA 4FPIA 2FVQA 1CULB 4OX7A 1SJRA 4NLSA 3LQVA 3OR1B 4CLLA 1WUUA 4CLKA 2J8AA 2MKIA 2PN6A 5I3QA 4ZJOA 5KAKA 1YHQS 2OTJS 1ACMB 3NBPA 2O67A 3ZTQA 1VRTB 3HKZD 4DR4F 4RW8A 3H7HB 3PFOA 4ALZA 2XY6A 3HJVA 2XCAA 1KP6A 5AXMA 2HQDA 1S0OA 4HI2A 4LF2A 3SQGA 3OD2A 1WNEA 1HR0F 3I5BA 4PYDA 2VBZA 3AOAA 1T95A 1FRLA 1WKLA 4NLPA 3I6PA 2FUG9 4QYZJ 4F0HA 3A8KA 3HZEA 1YJ7A 1WHYA 2DRDA 1Z4UA 3HPOA 1R8HA 3FFIA 3QO9A 4P10A 2H48B 3NGUA 2V2QA 1B70B 4A8MP 3A3NB 3MM7B 3QRQA 3S1TA 4LFAF 4PQAA 5LXRA 1U1LA 3NOGA 1WSRA 5K8NA 3C6UA 2ZH5A 2GVZB 1RYSA 2YKNA 1RHMB 1T3OA 2DGWA 3K58A 3UN2A 4Y65A 1S0MA 3ZTPA 2K7JA 1PC4A 2D74B 1L5UA 1S49A 2I5JA 2CAJA 2DPJA 2V68A 3M8RA 1N88A 3C14A 2DXDA 4CH7A 4JV2A 5GAHU 1P9YA 1Q86T 2FC9A 1PJ5A 1KR4A 1W7WA 1TKDA 3DOMB 4DSFA 4ZPCA 2JVRA 4IFVB 2ERRA 1IBKF 1KSPA 5HP1A 3W5YA 4ZCKA 4OYBA 2HGNA 4LF6F 2FLNA 3QLHB 3RJMB 2DHXA 1C4CA 2DNLA 1X7VA 4ZS6A 4ELVA 2J7WA 1KDNA 3W7BA 5GAGI 2DNOA 2F65A 4USWA 5AXNA 5EX3A 4M8LA 2FZKB 4ECVA 1XNRF 2QEXS 1NKEA 4P2XA 2CPFA 1W26A 3KXDA 1X0FA 1M1HA 5M2RA 1OMSA 2HZAA 1QTNB 2XYGB 2MKHA 5HMWA 2C2MB 2Z30B 3C15A 3N79A 4DPWA 1P9QC 4PXEA 2RHQB 3DLBA 3SXLA 4OV6A 5J2NB 2JNJA 5DRKA 1RLCL 1U1KA 2G1DA 6FDRA 1X5OA 2KZMA 2DK2A 4QIEA 5CQGA 2MQNA 1KONA 5CYMA 2E9ZA 1VRUB 1NBEB 2VQFF 1PIEA 3R7BB 4LF4F 5CA5A 4A47A 2OMLA 3QSYB 1X60A 1TAUA 3SCKE 1S1WA 3EDRB 1WG4A 1B64A 1VC5A 1VRQC 3MAAB 1RHRB 2XGPA 4GVBB 4JI6J 4NLXA 1TL5A 2KTQA 3M2UB 4Q44A 1UA0A 3HLUA 4HTJA 2P5VA 4O0NA 2VG6B 3KK2A 1S6PA 1HBUA 4IDKA 1JJCB 4ZVRB 5M2PA 3GIRA 3BO2A 2AJ1A 5F9NA 2BJ1A 4M1KA 4J9QA 4RW7B 2V4JB 1NRKA 5E5NA 4PYAA 4NA1A 2A2DA 2DVIA 2DJWA 1Y5NB 3QQCD 2IJRA 3KK3B 1RTJA 2MJUA 2CPXA 3HFVA 1S0NA 4ES1A 1ZAXA 1FKOA 4OFZA 4OI3A 1SH3A 4PUOA 3GCXP 2YNIA 4J9RA 3P49B 2HZVA 1SBRA 5IQ6A 3NKYA 1NB7A 2LU1A 2XO6A 2RRNA 3HZGA 1X9SA 3IRWP 1N32J 1UA1A 2IDLA 3JSRA 4DR7F 2HLUA 3BDEA 2BJ8A 5C25A 4M94A 1JB0C 2HGLA 5GMEA 1HA1A 5K14B 4LRAA 2RB7A 2C3YA 1VQ5S 3CCRS 4C8MA 4QWCA 4DG1A 3J7YU 2R4FA 4I6YA 1BD6A 4OYMA 3KMSA 3VAIA 1D8YA 4NMLA 1PG5B 5HK4A 3CJKB 2ZOGA 1IR2A 1P6TA 2MSSA 4DSIA 4CI0B 2M7SA 4JI7F 2HNDA 4JI2J 3I56S 1SUQA 2GS8A 4FYDA 2UV8A 3SCJE 1NKCA 2J9EA 2CUYA 3W5XA 1EZZB 3M2VA 3OXGA 5D15A 3OJSA 3IGNA 5HAOA 2J0QD 4GKKF 3EGWB 5IV4A 2F63A 5KFAA 5KT2A 5H9FK 4K7QA 2R2SA 1PJ6A 3U1MA 5LMUJ 4CH1A 2RNEA 2FZCB 1RXOB 4ZITA 5KFRA 2ASLA 2O66A 2QL9B 4Q8EA 2VH7A 1QVFR 1HD0A 4DJBA 2W4DA 4F36A 3HHDA 4ETXA 3GP9A 1QJHA 2DCLA 5J2PA 1FX2A 4CT9A 5D4PA 3P3DA 4BWJA 4FPRA 4LSLA 4M5HA 3RB3A 2HFSA 1HD1A 2XZDB 1FRXA 1H7WA 4ANCA 3MF5A 4C0BA 1RBLA 4I67A 3M8PB 3M4XA 3SYZA 3CO0P 1LK7A 2GAHC 3I9ZA 4DOZA 4F4XA 1DBDA 2DH8A 5DG8A 1UCNA 5FD1A 1MU2A 3E01A 2FD2A 3GIIA 3GR1A 2B56A 4HI1A 3MCSA 1UWBA 3JSYA 2JWNA 2IJFA 1R0AA 3MR3A 1N4LA 3AQOA 1RCOB 2UXDF 2R7TA 4H4OB 4DS5A 2GQ2A 3UQSA 4YMEA 1VBKA 1JMTA 1YK9A 2OPQB 2ZNZA 2BJ7A 3D1HA 3TUPA 2XEXA 2NUUG 4U7UK 1NHKL 1T9TA 1MW7A 4UZBA 2Y9HA 1WC3A 1UMJA 4ZVPB 5A8WB 3MEGA 2HBQB 4NZ0A 3R5GA 2HZCA 1U26A 1JLQA 1WHWA 4ZLNA 3ZC4A 3A8EA 2QA4G 1NAQA 3TEGA 4IO9Q 2JLFA 4N41A 1FDNA 4LFAJ 3I4PA 4ZN3A 2VKZG 1TKTB 5L9NA 1M1GA 2Z8QA 2G4BA 2A0FB 2J0WA 3RRHA 4MKAA 3CPWR 1S59A 2RIJA 4F26A 2KXFA 1U8SA 4Y6IA 4DCOB 4Y0FA 2VFUA 3IAM9 4X65F 4ZLJA 2R7XA 2HPUA 4KKOA 1GXTA 3DKDA 2ADBA 1TVRA 4ATNA 1HNVB 1KTVA 3IS9A 2HWHA 2D41A 3CDAA 2EW9A 1TK8A 1F9FA 3W2VB 4ELTA 3QMQA 1TV6B 2V69A 2V2KA 5J1PA 3OHAA 2BQUA 1NPKA 3CW2C 1LW0A 1NK6A 2EG2A 2GVDA 1RB0A 2B8QA 3HVTB 3U7JA 1WOSA 3ZNUA 4ZVOB 1N52B 1VYAA 3R3TA 4DSKA 2G2YA 2XMMA 2AJ4A 2L9NA 3GIKA 4EYHB 1FA0A 5HLFB 1O0PA 2VD3A 3PYDA 1KQSR 2W4CA 4MKYA 2RS8A 3TO8A 4ECRA 3BSOA 3D6TB 3OVAA 3CC7S 1FNOA 4C3LA 5L39A 2X51A 2GIRA 5IWAF 1NB2A 3QRRA 1JLGB 2FYXA 3PRDA 3CB4A 1MWZA 3TEHB 5LL6d 5SZTA 4JI1J 2HLTA 2CJBA 2OGUA 1WC6A 3TR5A 1CVJA 3MM8A 1X4GA 2B4VA 2LLZA 2PD1A 3IXQA 1RBAA 2BOAA 1S77D 1ZM3A 3BO4A 3CD0A 4JI3J 4DPYA 3CC4S 3THPA 5KFBA 5KFZA 2E5LF 1TL3A 2MGZB 3EICA 2BJ9A 3IGVA 2IAJA 4UOHA 3MTKA 2R3VA 1HQEA 2DNGA 2PMWA 4TN2A 5KFUA 3CMQA 2VG7B 4CO3A 3RU0A 3TQ1A 2AKWB 4I56A 1JX4A 5JVGQ 1NUEA 2VUGA 3QGIA 3QFHA 1DTTB 2AP6A 2RKIA 1S1VA 3Q8QB 3MPUB 3JSBA 4I7FB 2W9BB 2DNMA 4QR2A 3RB0A 2MZTA 1WHXA 3GV7B 2VC0A 3O5TB 5IM0B 2FHKA 5KFWA 1EETA 4P6QA 1RISA 3Q8YA 4NXMF 1H0HB 4I6AA 3UI3A 3UVJB 1SH0A 2WSFC 2BZ2A 5C24B 3W9JA 4Y00A 4OI0A 1QAIA 3EGZA 4YUDA 4JI0F 2WVFA 5I3UB 2ZFHA 4DPTA 5F8LA 1TKXA 1AFJA 3MFHA 2UV8G 4KGVB 3AODA 4QPTA 1T9VA 4L3NA 4QU6A 4ICLB 4CZCA 1Q7YT 4DR7J 4Z37A 3TNVA 2XNRA 2KRRA 1W2BR 4DV5F 1U6FA 1SJQA 3P4UB 2J7UA 5CYQA 2B7CB 2WW4A 1UVKA 3HSZA 1APSA 3V4IB 4F3OA 3UPFA 5EUHA 4I64A 1CJTB 1HBNA 3IRXA 4GO5X 3M9NB 2QZ8A 3WDOA 2ZH2A 7FD1A 2BANB 2DIVA 2ZJQQ 1T05B 2F9DA 2R7SA 2VBXA 5DM6Q 5A2QY 3G82A 4JI7J 3EPGA 1N33J 4LFCJ 2R8IA 4MFBB 1RADB 3OQ2A 1N5SA 4AQYJ 3VVUA 3QT6A 2MQPA 1Q16B 1FE0A 2G0JA 1IKVA 5B0FA 2P8IA 3R5AA 2GHVC 2RE1A 3HSJA 4KY3A 3DLGB 1HARA 1YTYA 2CWXA 5L8RC 1RK8A 5GADI 2LU2A 5C5JA 4KE5A 3MPWA 2RF2A 3VR1A 4IH7A 5J1EB 4PG7A 3WX8A 4WJBA 3WIVA 5I42A 3VWSA 1IM4A 1CJVB 4AD6A 1X4DA 1RA6A 2KYZA 1AYEA 4ZHRA 3MDFA 2R8JA 2HVZA 3VZHA 2UXBF 2G13A 4NLYA 2MB0B 4OX6A 3JQKA 3W66A 3BBFA 2E5IA 3CCSS 2DNNA 2V4RA 3TAMA 4RNNA 2B4UA 2NPFA 2VONA 5GAGU 2IM1A 3JSMA 2F4VF 1RT1A 1FO1A 3CCQS 3AOBA 5DLFA 2CPDA 2W2NP 5LXYA 5B0DA 5KG7A 2VDHA 2GQCA 4OV1A 1VIXA 1B0PA 4TQSA 2E7XA 2ZH9A 3TX8A 2DR9A 4ZN1A 4PCQA 3PNIA 5C7PA 3ULHA 3TUZC 4IG0A 2QX0A 4MK7A 4U67Q 1Z1ZA 2QJ3A 1SV5A 1WSVA 1GTHA 3UD4P 2COLA 3PW7A 3M9OB 3UR3C 2WHOA 1TFYA 2CNOB 3Q22A 2ATLA 2GW8A 2LVWA 3A3PB 1WF1A 3HULA 3FGVA 4KTQA 2CQ0A 2M52A 2ZHAA 3T5LA 2FDNA 3V6DB 4GC6A 2MZ1A 3VAMA 3K8VA 1IWGA 2CPEA 3RBZA 1E6YA 3GR0A 1K1QA 2OD6A 2P9EA 3H5UA 2F8MA 4WF9Q 2O3DA 3P96A 1EQMA 2XY7A 1FK9B 3IWXA 3KG0A 4RW9A 1IBLF 3BS9A 2G0CA 4JV0A 1HNXF 5E0OA 5ETMA 3PHTA 4YB6A 1HBMA 2LXFA 3RR7A 4B3TJ 3D3CJ 3DXSX 1UJ5A 4CIOA 3OTEA 1O6XA 3K59A 2XY5A 4GKJF 2VKRA 2WW8A 5J2MB 4NLGA 4NCAA 1D3WA 2KT2A 5B0GA 4DSLA 5E41A 4WYWA 3HSDA 4C8ZA 4CLPA 3TX0A 1S9GB 1JNZB 4Q2MA 4DUTA 2C42A 3TRGA 1DTQA 1V6HA 4DPXA 4FKXA 3R7NB 3I9V9 2QLJB 2ILYA 2VG5B 4EZ9A 1OPIA 1AZSA 3POTA 2CYYA 3IG1B 2RUGA 2BE2A 1OY6A 4QU7A 1ZH5A 2EBGA 2K2PA 2W9CA 1F6TA 3M2RB 4RW4A 4DPUA 3BKTA 3T5HA 4U8YA 3DGVA 2XSJA 4C8LA 1Y5IB 4USJC 3ILIA 5ETNA 5IC6B 1DURA 3K5MA 2JEJA 4E98A 1SC1B 1TTHB 2DGSA 4PWDB 3FEZA 2N3OA 4B3SJ 4DL0C 1IXKA 2U1AA 1U45A 4M5NA 4WIIA 3TAPA 4L76A 3CJQA 1LQ9A 1Z2ZA 2HS4A 2HHXA 3BGOP 4RW6B 4DV4J 4HH0A 1K9MT 4CO1A 3V6HA 1S1XA 1C0UB 3TVKA 3KLHA 3NS5A 1URRA 5KFPA 1H72C 1NK8A 3QT5A 2UZAA 3MOJB 2CZ4A 1XJWB 2CQ2A 5D4NA 5HVGA 1KOHA 2KVIA 4GMKA 2Q66A 4B02A 2HMIA 4PG4A 1NK5A 4ZVSB 2DNRA 4V19X 5HQLA 4DF4A 3UR0A 3RAXA 4C48A 5D0HA 2N7YA 1TK0A 3ICLA 4LVNP 4LREA 4OI2A 1T9WA 5A8RA 1GFWB 1AXQA 2LA4A 5KFTA 4JI0J 3G71S 2E7VA 4TU7A 3AJDA 2QSWA 4DV7F 2BW2A 2YVSA 4USVA 2VBWA 2HHQA 2R9LA 1RAJA 3PW0A 5HROB 5HBMA 4DX8H 5EWGA 4JI4J 5D3GA 4HACA 2CDRB 1RT6A 2QV6A 1VQYA 2H9ZA 1JXEA 3W2WA 2XWYA 2FJWA 3M6WA 2HRUA 4IQXA 1RU1A 2WOMB 4JI5F 2OHDA 1I94F 2Y1RI 2OP5A 3GFHA 2V67A 1DLOB 2M8DB 3M1VB 5CYJA 4C7QA 2AX1A 5A0YA 1JXVA 3NGTA 4OJGA 2WAQD 1Y00A 1KD1T 2YBVA 3QSIA 1V3SA 1IVZA 1C0TA 1EKSA 2I2YA 2KFNA 1J2VA 3GJRB 2D3O1 4OX9F 2XS5A 3ZZUA 3OTBA 1J5EF 2PO4A 3HCXA 4KO0B 1F60B 2OMOA 1NSAA 2Z2MA 2ZBQA 2ZHOA 2GO9A 4DL3A 2QC3A 2DNQA 2IBKA 5KFQA 1JJ4A 3SV3A 2V8VA 3PJXA 2H4YB 2E29A 1U48A 3FMWA 3PYGA 1VBYA 2C2ZB 4IG3A 3KK1B 5L1JA 1NSKL 2RDIA 4HDHA 2CJQA 4QYZK 4HLBA 1GNKA 1M5VC 2L9DA 2H5IB 1N6QB 2N7CA 1NPPA 1OO0B 1F2HA 3BQ1A 1M1KT 5A76A 2NUHA 3NBPB 4X64J 1SJ4P 2BRKA 2RRBA 1Q8KA 4RNHA 3PXGa 2HWIA 2HBZB 4FF3A 4RW8B 2ZKUA 4B9VA 5EN1A 5D8HB 2NXJA 4RX6A 2ZKTA 4I6WA 4LRDA 2XLKA 2ROEA 2OJ3A 4NLUA 2WONB 4KH1B 4P7TA 1CC8A 4CP5A 3T5JA 2NZ4A 3SEOA 4G1QB 4ZDNA 3B78A 2E1PA 1GH8A 4NYZA 2QO3A 1IUJA 1NSQA 2EEYA 1YJVA 2AHOB 1NZ8A 4DR3F 1TKZB 3CC2S 3VTIA 3MEEB 2R8HA 2ZHBA 3VQTA 4N76A 3H8YA 3PJ9A 1FFSB 5G0RB 5LSLA 5IOLA 4DR6F 4J9PA 2CNLB 3CJ4A 3B4DA 4N47A 2HQGA 1SQFA 1WHVA 4B9UA 3AAWB 2B3TB 3RTVA 1REVA 2C28A 4H54A 3CCZA 3GCWP 1PSDA 3VVTA 4AT1B 2YNGB 3PYFA 2XLJA 1SC6A 4YEAA 4ED8A 3MMCB 2XLIA 2RAQA 2LYVA 4J9OA 3GV8B 2JEGA 4A48A 1UAWA 3T3FA 1LEOA 2XS2A 3OL8A 4LQ3A 3PJWA 1F5BA 1ZYQA 2PFFB 4Y28C 3NMRA 4LFBF 3MI7X 3EX7B 1IBLJ 3P6YC 5ETQA 4DV3F 3OW2R 3MPYA 4OZ0A 2CVIA 4Z7YA 1JJ2R 1XMQF 3SIPB 4P75A 3PX4A 3LWMA 4GKJJ 2PI5A 1UEVA 3OSNA 3HP6A 4HHJA 3T1AA 4RWXA 1FKPA 1NPRA 1RTIA 3DGPB 4B9SA 4B3MF 1XWLA 3DRSA 4N5SA 4DQRA 2OFGX 4QWBA 2XMJA 3D54A 5DM7Q 2DRAA 1BWVA 2YNFA 5D4LA 2ZVSA 1S48A 4UOFA 1XEZA 4NASA 1U0SA 3DLKA 1SC4B 3HT0A 2HQFA 1RT5B 2VJUA 2CJYB 4WK3A 2CADA 4KGKA 2HBRB 3E51A 3K89A 5HJYA 2L41A 2QL7B 5GAEI 4NI2A 5GVQA 1YZ7A 4UF4A 1D9AA 4ED2A 4O3OA 3KHGA 4H4MB 2LEAA 3L9ZA 1H74A 4XIUA 1OQ3A 2XNQA 2DR6A 3EVOA 3DRPB 3I55S 2QMXA 1U02A 2AGPA 2R7WA 5KOWA 2DR8A 2NREA 4G65A 3SQOP 2QGFB 3I0SB 4DBQA 4JV1A 5ETVA 1IKYB 4DQIA 2DNYA 5G4DA 2LP4A 4M5LA 3MM5B 2D7SA 3UN3A 1M0SA 1HYSB 3CD5A 3NCRA 3MURP 1AB8A 2HQIA 3CDBA 1TFWA 4PQUB 1HL6A 1Y0HA 3VGUA 4CLSA 3PEHA 2YKMA 5EWEA 1BQMA 4FF1A 3TP2A 4BC7A 2FJDB 4F0MA 4KH0B 3RZAA 3QWPA 3GJQB 3KJFB 1R8AA 2CQ1A 5GADU 2MMYA 4QOTA 3SDEB 4WZMA 4AXIA 4WKYA 2VL1A 3UO0A 1HMVA 5KG6A 2L08A 1FWLA 4I69A 1NLKL 1U0HA 2W9AA 1VBXA 3LP1A 2RUSA 2HFUA 4UUWA 4CTAA 3IAS9 2WVEA 1IKXB 4E0DA 3I87A 4ZP6A 1WC4A 2C2DA 2GGPB 3AB2B 2B9XA 4WXWA 4Q2LA 2X1FA 3MR7A 1NHUA 1G3OA 3ISNC 3J81U 3H5YA 1EP4A 4HKQA 4CM2A 3R7SB 2K1RA 4IO1A 1ROFA 2B7BB 3J7ZT 3HHLB 4A8QA 2MKSA 4W98A 1NHVA 2IM2A 2RD5C 4JI5J 5HATA 5KT7A 5CCLA 1YLXA 4QW8A 1X0PA 2IYIA 4NCGB 4JOUA 3CCUS 3Q8RB 2XGQA 2Q6CA 2ZOFA 3W3SA 1F9EB 3CF5Q 3RRGA 2HHWA 1HWIA 5KG2A 5H9EJ 2FLLA 4NE9C 4B9NA 4EU0A 3AA8A 1FT8A 3QAEA 3MCOA 1BLUA 3ET6A 5T7LB 1NU4A 4OQJA 1FD2A 3A4TA 5KFIA 1AFIA 3R97A 4NZ6A 3NNCA 5BYRA 1S6QA 2GAGC 3NGRA 3KJQB 1UP1A 3ETMA 1RYRA 1X8DA 1VOMA 3FEXB 2HHPA 2ZWPA 2JEFA 3CCTA 3X1LB 4C11B 1UFWA 5DJBA 3PFEA 3CJ0A 1HNZF 4BWMA 4OI6A 2Y8WA 2J7KA 3AH6A 4HH1A 4J37A 1U2FA 4RU2A 4LBIA 1YRUA 3W64A 4LUBA 3CIZA 1UJ6A 1S12A 1SB6A 4R0JA 1N36J 1HLWA 2HFOA 3B8HA 2JLEA 4ZK7M 3J80U 2QLFB 4OJ3A 4UUXA 2E1MC 4DV1F 3OFEA 4IOCQ 3LAKA 3Q8SB 3MEGB 3BSNA 1NK0A 2N82B 4FYVB 4JYAF 1Q95G 3QIPB 4DR2F 4XAKA 3PW5A 1RAHB 2WB1D 1OYEA 2GIQA 5DETA 2HFNA 3GYXB 4M5DA 2I6WA 2O5DA 3KUHA 2QA4S 1TU0B 5KG0A 4GVLA 2HBYB 1N34F 1FXRA 4DN0A 2IA0A 1R0BG 1YIJS 3TVZA 3LF0A 4Q45A 4KSEB 2GJIA 3CJRA 3KLFA 3DHWC 4X62F 3R27A 2ACMA 1RT3B 4M5IA 4BCAA 4LSNA 4RLEA 2OSRA 1KHVA 1RTDB 4KV8B 1RCXB 2EKYA 3LPYA 3W63A 1RT2B 5LJ5Y 1ZTTA 2DNPA 4PEOA 4NLVA 1X5SA 1FHTA 3D3BJ 5DG7A 2YQ1A 1RTHA 3EYZA 4IKAA 2N4DA 3UDEA 1LNQA 2YY3A 1VHFA 2QRRA 5FJ4A 2FHJD 4IYQA 5HO4A 4J9NA 3NRBA 4P52A 1CJKB 3DU6A 3ITHB 1AT1B 4ED1A 2MLYA 3BSAA 3JAMU 2UU9F 4O23A 5L9XA 1VQ8S 2FJVA 5BJRA 1SKRA 1JLFB 4DL7A 2W2MP 1X31C 3KDNA 2OEKA 3N5FA 3MECA 4LR7A 4WWSA 2E1RA 4WCEQ 2BRLA 5ETKA 1YSJA 2MKCA 3SSSA 1VC0A 5EDWA 3OL6A 2IDEA 1FCAA 1XMQJ 1XK8A 4K0KJ 3U02A 2ROGA 1PJ7A 2ZC3A 3BYPA 1MMNA 3DRXA 1H2VZ 2J9DA 5AJ3F 5C42A 3NGSA 2BUNA 2DGOA 1I1GA 5LSOA 1CULA 3HSGA 1Q79A 3D1QA 4U96A 2X1BA 1SIZA 3OR1A 4OLOA 3G6YA 5KFCA 4DV0F 5CABA 3KLGB 2HVHA 3EE3A 1MMLA 4X4RA 1A6LA 2IAJB 4B9MA 2IM3A 1UTAA 4YQWA 4FNHA 4FYWB 2YNHB 2RILA 2Y0SD 2Z2LA 4EBEA 1EAYC 4ID8A 4B3RF 3PRBA 2RKIB 2HIYA 4P7VA 2OD4A 4Y2AA 1NDLA 1FRJA 2XMKA 4C4WA 2RH3A 1OY8A 5GMKa 1DY3A 3BPDA 3CTRA 4FBUA 4YN3B 1RHQB 2NQPA 3FBBA 3FBFA 3QBCA 4DEZA 1UETA 5ADZA 3OL9A 4M5KA 2P6SA 3MM7A 4C0HA 3HHEA 3WHIA 5BR8J 2QTWA 2GVZA 4LSZB 2PA8D 2AGOA 2ZEJA 3K17A 1NO8A 1M5OC 3Q2TC 2VICA 3I0RB 2AJQA 4JUZA 5L38A 3KKFA 3BREA 1FJGF 4OZJA 4PWUA 3DM2B 1Y3KA 1JLEB 1RI7A 4DUYF 2LQ5A 4ZVEA 3W62A 3M30B 3VAKA 3BGRB 4Y2MA 1MWYA 2H54B 2A1BA 2M0GB 4DCJB 5F8GA 3O3LA 4PABA 3L7OA 2ZH3A 2EFOA 1MMDA 1KVIA 4LF9J 3SZ2A 3BQ2A 1L3SA 1RHUB 2M88A 3CJ5A 4PPZA 3BO3A 2DNZA 4ECSA 3GSIA 2NZCA 3DOMA 1RWKB 2DBBA 4IFVA 2YTCA 1IKWB 2XB2D 2EK1A 4L6V3 1P27B 2OELA 4WFXA 4I68A 3HO1A 3QLHA 4U8VA 5DGAA 4M63A 2CXEA 2KKHA 4FS1A 3MEKA 2BR0A 4C3KA 3EWGA 1OIAA 1F3FA 3QATA 1CSJA 2XMUA 3DRRA 3DU5A 2X7IA 2KFYA 1NJIT 4WYLA 3CT9A 3AHPA 2JOQA 4ZP9A 2K3IA 4A8WA 1FXLA 2F40A 3MPDA 4MAKA 3VZIA 1JLBB 1DARA 5J2NA 5T14A 4Q7AA 5F8NA 5D6GA 2ALYB 5KFNA 3TYTA 1VRUA 3O8WA 2XMAA 4TYAA 4J90A 4UQGA 2MHEA 4JV5J 3CIMA 2DT9A 5I42B 1S72S 3MAAA 3C3LA 1KFSA 4GVBA 2ZM6J 4NLRA 1U25A 3GFYA 9RUBA 3RW7A 3M32B 2B5JB 1VQPS 2KM8C 1VQOS 2ZD1B 3M2UA 3R8YA 4DQPA 3R2CJ 2ZH1A 1J5OB 2ZOMA 3TW0A 2VG6A 2A6MA 1N54B 1T9XA 4G1IA 4X4UA 4ENOA 2VQEF 2BABA 2QSFA 4F2SA 1X4HA 5E33A 4ANEA 4FVCA 5B0EA 1A7GE 4RW7A 2V4JA 1FEEA 4LJMA 4ES2A 3CMAS 3QPIA 2MKJA 3KK3A 2KG0A 5FDLB 3G96A 4Y3CA 3W8PA 2MZJA 1RT1B 3DMJB 3EVMA 4L74A 5ETLA 1RAIB 4X66F 5E3CA 4R25A 4CYUB 2UVUA 2QFJA 2KFZA 3CXCR 3LA0A 2MPUA 2Z4PA 3OHBA 5K9FA 1OPZA 2LQJA 4ZP8A 3JB9k 5K14A 2R7QA 1VS3A 2PIIA 4RNMA 1CPZA 3TZXA 1HQUB 3LGMA 2NXUA 2BMBA 3EUNA 1PYSB 1S7IA 3PEJA 2AQ4A 2GNKA 2FHJA 5FLXU 3D68A 3DOLA 4ED5A 3CJKA 5GAEU 1HBOB 1PGZA 2EI5A 1ZAVA 4ZVQB 4X4QA 5AT1B 2H5JB 2DISA 3HJFA 1MSWD 4Q5VA 1UW4A 2OPPA 3C2PA 2PSZA 1TMMA 4EGLA 3CDUA 1K1SA 3BYRA 4TKTA 5B7WA 4D3HA 2RDJA 2XWXA 3KNGA 3I5AA 4IOBA 3CULA 2VFVA 1S0VA 5K8MA 1XMOJ 5F8HA 1GXLA 1SVDA 2Q79A 2RRAA 1N5TA 3W65A 4DV2F 4NXNF 1U8WA 2X3DA 3DCAA 2H5EA 2CKWA 1D9FA 4PZVA 2OO4A 4KFBA 3I82A 1RT7B 1DTQB 2JC0A 2PFDA 1VQ6S 4LF5F 3GTYX 1WD6A 2XYHB 4DF8A 2W1BA 1H2UX 2CQ4A 4AL5A 2UU9J 2AIRB 2OLWA 4G3IA 4DV6J 3HXMA 4RNOA 3G86A 4M95A 2R7UA 4ZCLA 4LF1A 3FBEA 3UDLA 1VGYA 1QSLA 1VQMS 5JUMA 1FF2A 2C22A 3DLLQ 4A4JA 2GHPA 1WELA 5LMNJ 2IA6A 1RTZA 4TNOA 1U49A 2YPZA 2AJ2A 3M8PA 2LEPA 4OYOA 5JVHQ 2Y1JA 3EGNA 2V8DA 2F8HA 3MZIA 1QM9A 1V5VA 4F7VA 4KHRA 2F7VA 2KB2A 3L4BC 2IVMA 3H5XA 4HYKA 2C2OB 2OPSB 4DV0J 1RHJB 2C3UA 4C6AA 4OYPA 1XC9A 4NLDA 3MMAB 1HNIB 4CQ1A 4YHHF 3OUYB 3C19A 1UVMA 2FZGB 3OJUA 4J9VA 2OPQA 5IZHA 2IM0A 1DQAA 4XK8C 5BYQA 4B3RJ 2CVEA 1HNWF 3JQJA 4KGXB 5A8WA 2LDYA 1CQNA 3PIOQ 3QGHA 2VFTA 4K4SA 1ZTWA 1FDAA 3M6XA 1LWCA 4Q0BB 2KZZA 1LWEB 3TI0A 1ITPA 2YKQA 1TMJA 3CWJA 4U95A 1FWPA 1MROB 4JI8J 4N8NA 1TKTA 3TAQA 5A8RB 1JIHA 3D0IE 2ZH4A 4NA3A 3VHQA 2ZBCA 1K44A 3GV5B 1FJGJ 2JHEA 4ECWA 2ZUGA 2FY1A 2W2QP 4LF8J 2V9KA 1Q8BA 3CVKA 4KHPJ 1ICEB 4F4ZA 2HRYA 4UW2A 1N56A 1HQ2A 2XZWA 2JH3A 1HNVA 3T1YJ 1FJ7A 4K4XA 6FD1A 3DLEB 2KN4A 3CD6S 1GTEA 2KHDA 3W2VA 1FVQA 4NX9A 3QYYA 4WKRA 4YDDB 1NJYA 1TV6A 1I51B 1NJWA 2BXJA 1S9FA 2PMHA 3HVTA 2VV5A 3OTOF 1ZM4A 3CUNA 4X4PA 5F3ZA 3T1HJ 1T02A 2AEMA 2I8EA 4WFBQ 3O2IA 1FRMA 2C2NA 3MM9B 2N3LA 3H2VE 3OL7A 1S1TB 1URNA 4DI6A 1FE4A 2YX1A 5JXSA 1JLGA 1KBRA 1TZ0A 3UD5A 2DNKA 3DDNA 3OR2B 4XPCA 3EZ5A 4ECUA 1FDBA 3CNQP 3V6JA 2QYCA 1V5IB 3TQEA 1GMUA 3HF5A 2DNHA 5ITHA 4RO0A 2ALZA 3SMZA 2H51B 2W24A 4ETZA 5THWA 1QE1A 3CDEA 4HHUA 4ZPVR 2MGZA 4NLQA 1RKJA 4NPOA 2LQ9A 2ZH7A 2JDJA 1NM2A 2VG7A 3BH7B 3K5PA 3UWTA 4TU8A 4F3QA 5KFOA 4PXDA 4QWAA 4FBTA 3KJVB 3M9MB 4AXJA 2XS7A 1DTTA 2LECA 2DRBA 1SQGA 2MQMA 1FVSA 3LPEA 5B0AA 2RU3A 2W9BA 1FRIA 4DR5J 2V63A 2DR7A 3BDPA 4J9SA 2HVEA 2JSXA 1YJNS 3TARA 5IM0A 4OZ1A 3UVJA 2AV5A 1XIQA 3R2DJ 5DLGA 3LP0B 4USUA 1Y9OA 2UUBF 1GX5A 2LFVA 4ZVFA 3VQSA 2HNZA 2W8KA 3D1OA 3QNWB 4MYTA 2M3DA 2ADCA 4R0EA 4X66J 4AL7A 5HMXA 1IJFB 3FUYA 2DD8S 3HMJG 3H0PA 5IT9U 3ENWA 1UJ4A 1SPBP 1S4FA 4MIBA 1Q78A 4FVMA 1WF2A 1U1PA 4A8KA 2KXHA 3VV2B 4ICLA 3ZNJ1 1ZPWX 3MEDB 2AW0A 1M5KC 1KQGB 4OHYA 1X9WA 3MR2A 3D5MA 3LANA 4NRTA 1ZM2A 1XNQJ 3KLEA 3Q8VA 4WP9A 3GYGA 1B0VA 1XBWA 1L3UA 2HQ3A 2GC8A 5ETOA 2APOA 3VAHA 1B0TA 1JLCB 3V4IA 3HT3A 2OSQA 1CJTA 4ED0A 3F44A 4YY3J 1X9MA 3PV8A 3DRYA 4FF2A 2A18A 4O3SA 2AYBA 3EDQB 2NR0A 2BANA 1EKRA 2EC0A 1T05A 1DAXA 1KLMB 5F0UA 5HVFA 3A12A 3D2WA 3MWBA 1K47A 1CJUB 4MFBA 4O3NA 1ZA2B 3IR7B 1HWKA 1BGXT 3R1LA 1WC5A 3HM9A 1SL0A 3N6NA 1KTQA 2DIUA 1EARA 5D78A 3Q2SC 1PBAA 3DLGA 4DFMA 1Q4RA 4RKUC 4QQBA 5IC4B 3OLAA 2WVDA 2O01C 1N5QA 2F1FA 4I0WA 1SJ3P 2QFIA 1VQKS 4DLEA 1UVJA 2GX8A 4YFUA 3J80Y 3W9IA 1Q0NA 1NSPA 1AUSL 4U6PA 5F8IA 4M5MA 3TUJC 1U1QA 1IWAA 5J1EA 4DR4J 4TLQA 3QJLA 1VQ7S 3W1YC 2PT0A 2P9CA 4O3QA 5L1LA 4ES3A 1VHIA 4H4KC 2P9GA 3I31A 3V5RA 2EFGA 1HR0J 5KFHA 2IRYA 4OIXA 3PZPA 4U7UD 1WI6A 2OKQA 4PXCA 4TY9A 3QZ7A 2CG4A 2DGXA 5KG5A 1IBCB 3W9HA 4Y2IA 3D9BA 2F3JA 2XULA 1C2PA 2D69A 3DXBA 4RBUA 2IHR1 4K2JA 3BM7A 3KYLA 2HFVA 2FJAB 5E3QA 8ATCB 1U2RA 3B54A 2O1PA 3NLCA 4PG6A 1FD8A 1O8BA 4U9RA 4J7CA 3H98A 1CBKA 1RABB 1AROP 3LH2S 3DHXA 5KFMA 4YDXA 2VJVA 3ILLA 3BV8A 3O1LA 4NA2A 3CJTA 2P6TA 3GJTB 2NCKL 2DEIA 4R8UB 4C0OC 3KHLA 4CLUA 1WTBA 4F4KA 2B6AB 2CPHA 2VODA 4P72A 2HK3A 4QWEA 5IT4A 1VJQA 1IBKJ 2FTRA 1BQNB 3GFZA 3FVYA 4IRDA 3QRPA 4LF6J 2UP1A 2BDPA 2CQ3A 3D6HB 2KM8B 2CJ9A 2UUTA 3V6DA 3G6XA 1VR6A 2XTJP 1JWWA 3T19A 4J5OA 2MHNA 1CLFA 1RWPB 4C2MA 2KHCA 4CTAB 3EXYA 1YRXA 2HQCA 1XNRJ 3KFWX 1MN9A 3BB5A 1YJTA 4QJVA 5BYSA 3BR9A 5H9EK 4ZP7A 1TL1B 2VB6A 2OH2A 5LSRA 1OYDA 3MXHP 1U47A 1FK9A 5ETSA 2ZZNA 2MKKA 3A8JA 5DDRC 4HDGA 1ZETA 2CQCA 1TL7B 4QZVB 3IBWA 2GCFA 3NNAA 3OXLA 3PTWA 1ZZFA 5J2MA 1VQ4S 1YJ9S 1R6YA 4Z2XA 3QJJA 2EKNA 2VQFJ 3PO5A 1WG1A 2DPIA 4ID5B 1L3KA 1S9GA 4LF4J 1FWKA 3GONA 3CGIA 2AYGA 3RG6A 2NLWA 4R5PA 3OTOJ 5F8MA 1FTCA 3Q23A 3CE8A 2B0GA 3PW2A 3IG1A 2BE7D 1EJ7L 3EXCX 5HMYA 1HHSA 4GC7A 1RA7A 2KT3A 4JI6F 1N0UA 2HYIB 3M2RA 3CJ2A 1QAYA 3EM1A 4K2XA 5K8PA 5CHCB 4K4UA 3V81A 4UY8T 4CCHA 3M8QB 1VQSA 1Y7PA 2R2UA 4ANDA 4PWDA 1N48A 3VF0B 4TVAB 3KHHA 5HVHA 3PR4A 3PKYA 1FTRA 4DQSA 4C98A 3E8OA 3LP2B 3GYNA 2AYEA 2CNKB 2X1AA 2HNYB 3ZFVA 4K4WA 1U24A 3DN9A 4RW6A 5IV3A 2I0XA 1YKWA 4IH6A 4TYBA 1LFPA 3DI6B 1WOOA 3T6JA 1NMEB 1C0UA 1BE4A 3C6TA 1RBOB 2G2ZA 3TZZA 1N32F 1GMWD 3CSKA 4U7CA 2BEFA 2VIHA 2QMWA 2FLOA 2IPOB 3SCLE 1RZMA 2BJEA 1X4BA 1G6BA 5F41A 5HANA 4OYAA 4WU2A 4EYIB 2BOPA 4DN9A 5M2UA 2POKA 4WK1A 5DQGA 4M5DB 4YP3A 4J9LA 3LWLA 4TLRA 2Q3PA 4WP3A 2FHMA 2Y3YA 2JJ4D 1UZDA 3HD1A 4ZPAA 1RAGB 4L73A 4FXWA 4JI2F 4DFKA 1HW8A 1WKJA 1WEXA 3DOKA 4DFJA 3RB6A 4GKKJ 1SQEA 2FGOA 2QMUB 3FEYB 4LRCA 4Q8FA 3DLHA 3FRYA 2RQCA 4IOAQ 1NK9A 3D28A 4X4SA 1VK8A 1RWMB 3GB0A 2DHSA 1JLAB 9ATCB 3F56A 4DL4A 1WORA 3LO3A 4O4GB 4USIA 2QN6B 2WOMA 5LMUF 3V6KA 3OLBA 2LKZA 1DLOA 3KLIB 4FYYB 1LFWA 3M1VA 4FKYA 4WFZA 4LR8A 3CCMS 3G6VA 5A8KB 4ZKAA 3C16A 2ZVIA 5MAOA 2B4PA 3C46A 1NEEA 2J76E 4CWBA 4A8YA 2ROPA 4O4RA 1XQIA 1JK9B 2BJ3A 2AZ3A 4EK2A 2MSTA 1FRHA 1WC0A 2LXIA 4NWBA 3DDIA 3GQCA 2G9OA 5CZVA 3TWZA 4CLYA 3NMAA 1LKZA 3PM9A 1ZPVA 3OTDA 5KFLA 3BGUA 4DZDA 4KO0A 3K8WA 2QLBB 3VGTA 2WK4A 1N5YB 3NCPA 5EWFA 2IRUA 2B4OA 3CO9A 1QAXA 1QTMA 4ZMMA 1YZ6A 1LWFB 1F5CA 3KK1A 2LQBA 3FCHA 1Q5YA 2BJDA 3GZ7A 4O0IA 2PGCA 4OZLA 2HG4A 4ED7A 1CEZA 2UXDJ 2QLWA 5E3PA 1N6QA 4KQZA 2B43A 1U7LA 3NP5A 2WRMA 4KGZB 1EB0A 3HHLC 3O44A 3ZZZA 4ZOSA 3S8SA 1RWWB 3FK4A 2CPZA 2MJNA 2Q43A 2UXCF 1FFWB 1N5VA 4NZ7A 1KQKA 2F5GA 4ZPBA 3ETOA 5FLXY 2XHCA 4ED4A 5ETTA 4FN5A 2KT5A 4RUCA 1UVIA 2WVCA 2EXUA 2C1EB 3M8ZA 3HKWA 1PKUA 1FXDA 1UWAA 2CDQA 2WONA 1JQGA 3CCLS 4DPOA 2CZ9A 2QYGA 4G1QA 3ZZPA 5IXUA 1YBAA 4CLFA 3BKUA 4QR1A 2CRLA 3BEGB 4LT6A 1AA1B 3MMBB 2BVZA 1FRKA 3H59A 3CDWA 5KOXA 1S1UB 1Q7LB 4OZ3A 3MM6B 1TKZA 5FIIA 2UUAF 3MEEA 4TY8B 1UEUA 1VC6A 4A46A 4IFYB 5B0CA 2MQQA 4X65J 3T5KA 2OFHX 1KKHA 3CD7A 1D8ZA 3D67A 2JX2A 3J7AN 5G0RA 4DX6A 4I2PB 2V6AA 1GK8A 4LQ9A 1MLAA 4ER8A 3LALA 2AU0A 3SBMA 3FDSA 5HL7Q 2VPYB 4EEYA 3ILOA 4RUAA 1SH2A 4WE1B 3KUEA 1PAEX 3R5CA 1AW0A 1CS4B 2XG8A 4ZIWA 1VDHA 1WTFA 3I96A 1VLOA 4F50A 4ECQA 2YNGA 4WFNQ 4X4NA 3CJSA 3MTJA 3B4MA 3MMCA 2E5JA 1NZAA 2R2RA 1YGYA 4YB5A 2J0XA 3BN4A 3K2YA 4UQTA 1S9EB 3WX4A 4DL6A 3WQPA 1UEKA 2V34A 5D77A 4X2BA 1KS2A 2EFQA 4N56A 2BE9B 3DRRB 5IWAJ 4OHXA 2GJ2A 3TVYA 5J2QB 4YOEA 5EHHA 5IFMA 2ASYA 1S4EA 4L75A 1R8PA 3CCVS 1G4CA 2QLXA 1FEHA 4XTTA 4JI1F 4DX7A 4V19J 3RBDA 1JKHA 3MR6A 4OYZA 3H20A 3DGPA 3G8QA 2E5LJ 4NLOA 1HPZB 1L3TA 3S7RA 4JI3F 4DUZF 3G8SA 2MYFA 4L3KA 1BQXA 2AZ1A 3IR5B 4KGMA 3QIDA 3RBEA 4Y34A 4KR0B 2K7KA 3JTOA 1VFJA 1RT5A 2Z0GA 4OZ5A 1TK5A 1GMWA 1N0VC 2ZE2B 3RUBL 2YXLA 3R5BA 1NDPA 5AE3A 1YJRA 4H4MA 2J6TA 4X84A 3JTPA 1SI9A 3VCDA 4DL2A 2CIMA 1GT8A 3DRPA 5ETPA 1F1BB 4NXMJ 1LOUA 3AOCA 1IR0A 1EQ0A 1HFEL 2CA9A 3GJSB 4DLGA 1PYTA 4WZQA 3I0SA 1T03B 5E3RA 1D0EA 2PEHA 1WG5A 1IKYA 2CPYA 1HWLA 1C1BB 3A1YG 2Z57B 2EPIA 3MM5A 3EMTA 1HYSA 1Q82T 5H1SV 2MDAA 3FQLA 2BQRA 3JS9A 4PQUA 4LBPA 2MTLA 4O44B 2XO7A 2M70A 4DV5J 1UW9A 4A8FA 1TL4A 1Y3JA 4Z7CA 4ECXA 1Q8IA 3SDEA 4OYXA 3UNYA 5T41A 3L95X 1FI4A 3FCVA 2E9RX 4B17A 4FP9A 4PG5A 2OUGA 2EK6A 4UZCA 3DOLB 3FCWA 3DYAB 2W8LA 2HEKA 5B0BA 5KFSA 4F04B 1ZBTA 1IKXA 4OMFG 5CH7B 5KG3A 1ELOA 4XO0A 2OPRA 4MK8A 3G8TA 1ULRA 2GGPA 3GSDA 1VK3A 3BH6B 5LJ3Y 1N33F 2OPPB 4LFCF 2V5HG 4I4BA 1C1CB 4CLZA 2MLZA 2CQIA 1YBTA 3KDOA 4AQYF 2NYIA 1LXNA 2MZQA 2XZTB 1BC6A 1E6VB 4NYPA 2ZH8A 1RT4B 2GV1A 5K8OA 3MD1A 2B9WA 4QWDA 3HHLA 3MGJA 2DY9A 1XR5A 1LW2B 1VQ9S 3JYTB 2XSFA 3EVWA 4OJ1A 3HFKA 2QE5A 1MN7A 2KH9A 4NCGA 2IIHA 5KG1A 3MAHA 4CO0A 4KFBB 4K8RA 2FHOB 5AXKA 4QBUA 1M90T 1WJ9A 5AE1A 4MYUA 2BA9A 3PKMA 1T3NA 1TQLA 3TZYA 2OTLS 1TUGB 3G87A 5T7LA 4P9SA 3U1LA 2J8SA 3QGGA 3SQGB 2E5GA 4I2QA 2UXBJ 3WBZA 3OBIA 3K0JA 2ZJRQ 2R2TA 2XHWA 1KLNA 4KPCA 3LOUA 4LIWA 4S0MA 3ZZYA 4CO5A 3PW4A 3CCES 5IT9Y 3FFIB 3B82A 3QO9B 1O5JA 3MHYA 2HIQA 4C11A 2F8EX 2DR5A 5DO2A 3M8YA 3R1HA 3C6UB 2YKNB 2MEWA 2VDIA 1WDTA 2F4VJ 4FNIA 1U09A 2BW7A 1NDKA 3QFWA 5HJXA 2PC6A 1WEYA 1NH7A 2J0SD 4CO2A 3AD8C 2UXCJ 2EFVA 3DNCA 3M6VA 2I5JB 2CG8A 3BGFA 2ZWOA 1X5TA 1RU2A 2R7RA 4NYOA 1DRZA 2D3UA 1XERA 3C14B 1U1OA 4URQU 5KFGA 3CJ8A 2EFNA 3FNNA 3UE2A 4ELUA 3BBCA 4LMZA 1LWCB 3NY0A 4DU7A 5HP1B 2PEBA 1RAAB 4G1PA 3QIPA 2EVZA 1KWMA 2QA1A 4FXVA 4JP8A 1TUWA 2UUAJ 5IT0A 1F9HA 2V50A 4ILRA 1RWUA 2CQHA 2ILZA 1K0TA 3D4JA 3PDNA 2WB4A 1HNXJ 2IVFB 3NEKA 1TUVA 2AD9A 1W2IA 1KFDA 1OY9A 1R3NA 3C15B 2KYXA 1PILA 1RT3A 1G1XA 4IH5A 2BKPA 2FJBB 4PR6A 1RTDA 1OSCA 4KV8A 1RT2A 4HHHA 4B3TF 4WP8A 2HAFA 2W2OP 5GMDA 3CCWA 3UD3P 1S76D 1ZZNA 5KT4A 5CYMB 2E7WA 2FIUA 2PI4A 4RUBA 4RR5A 2QA2A 3SSQA 2BX6A 1DJ0A 4QW9A 2HGMA 3FZBA 1S1WB 2A10A 2FC8A 3I32A 1CJKA 1YBUA 3ITHA 4CO4A 4ZA1A 4OYIA 3FSYA 1OSDA 4OHWA 2VFRA 5E7OB 1S79A 2RS2A 1JLFA 2W4PA 3MUVP 1Y4ZB
chains in the Genus database with same CATH topology
2XSJA 4C8LA 1Y5IB 1ZM9A 3D0HE 4USJC 4N8NA 1TKTA 3TAQA 4HT5A 5A8RB 3MMBA 4JI8F 4IQMA 3KK2B 5B08A 5CD4H 1S6PB 1RKIA 1HBUB 3F73A 1DURA 3K5MA 4F67A 2FVCA 4IDKB 1JIHA 2JEJA 1S1UA 3E3XA 4E98A 1UFLA 2DGSA 2I1RA 3MM6A 4PWDB 3FEZA 3T9ZA 4MIWA 3D0IE 4TY8A 2N3OA 2ZH4A 2J9CA 4NA3A 3X3UA 1CC7A 2ZBCA 2E1AA 3PY8A 2VOOA 4IFYA 3GV5B 4DL0C 5KFVA 3LAMA 1IXKA 3MAQA 2U1AA 2WSEC 2EWHA 2FB0A 1U45A 4B3SF 1IN0A 3KOAA 3PO4A 2RSQA 2JHEA 4J9KA 4ECWA 2RQ4A 4WIIA 3TAPA 2ZUGA 2FY1A 1LQ9A 1Z2ZA 3NS6A 1EP4B 4WFAQ 3OVSA 4LF8F 1RTJB 2NS1B 2HS4A 2HHXA 4I2PA 1OQ6A 2K1RB 1FDDA 1P1TA 2KRBA 2V9KA 4B3OB 3DLJA 4RW6B 1Q8BA 3CVKA 3ENVA 1FKOB 1KRPA 4KRWA 4F4ZA 2HRYA 1QE1B 4UW2A 2CFXA 1HWJA 4OI1A 5KT6A 3KLGA 4XDDA 2XZWA 4DV4F 1N56A 4PUOB 5DG9A 2JH3A 1HNVA 2YNIB 1FNXH 4KJIA 4HH0A 4HTIA 4K4XA 4YR2A 6FD1A 3DLEB 4CO1A 1K9MT 4KHPF 2KN4A 3N6LA 4A8OA 4UY85 3V6HA 3CD6S 3UNGC 3T1YF 1GTEA 1S1XA 2K8GA 2KHDA 1C0UB 2FGCA 3W2VA 4WE1A 3TVKA 3KLVA 3VALA 1LK5A 4C3MA 3KLHA 1FVQA 3OXFA 4NX9A 3NS5A 3QYYA 4WKRA 2BM0A 4YDDB 4PKDB 1M5HA 1NJYA 1TV6A 1URRA 3TUIC 5KFPA 4EBCA 1NK8A 3GFXA 2YNHA 1NJWA 4NLTA 1TR0A 2DH9A 2BXJA 5C25B 3NGDA 3DC2A 1S9FA 2UZAA 1IJEB 1UKUA 3MOJB 1R8BA 2DGVA 2CZ4A 2CQ2A 4MJKA 5D4NA 4URGA 2PMHA 1KOHA 3HVTA 2VV5A 3OTOF 1ZM4A 2KVIA 2B9YA 1W25A 1R27B 2RT3A 4GMKA 3CUNA 2Q66A 4B02A 2HMIA 2VG5A 4X4PA 5HMZA 5F3ZA 4PG4A 1NK5A 2M5YA 2DNRA 4IUFA 1T02A 4V19X 1XR6A 5L1IA 4ED3A 3T1HF 3QJPA 4DF4A 1F0XA 2IBOA 1A9NB 3UR0A 2I8EA 4DG1B 1P8GA 4WFBQ 3RAXA 4Q43A 3O2IA 1FRMA 1JNRB 1S9EA 2N7YA 4DFPA 3QZ8A 5KT3A 1TK0A 3MM9B 2N3LA 1S6QB 3H2VE 3ICLA 4RU9A 3OL7A 1HI1A 4LVNP 4HVZA 1S1TB 1URNA 3SSRA 4IR1A 2E66A 2CQDA 4OI2A 4O3RA 5A8RA 3ISND 4PG8A 2KG1A 1WACA 1G2EA 1AXQA 3HVWA 1I6JA 1SJ1A 2LA4A 5KFTA 1T8EA 5J2QA 1OWXA 2JC1A 4XPEA 3FSIA 3G71S 1FE4A 2YX1A 2HNZB 5JXSA 4TU7A 1JLGA 1KC8T 1TZ0A 2XC9A 4DL5A 2HNDB 3F41A 2AJ0A 2QSWA 3AY0A 1TAQA 1F2GA 2DNKA 2KJVA 3DDNA 1SUQB 3I0RA 4DV7F 1VMBA 2JLGA 2BW2A 2YVSA 3OR2B 2VBWA 2JRSA 2VPXB 5B09A 4XPCA 1SJFA 2HHQA 3IFEA 3AQPA 2R9LA 2HAIA 4QIFA 1RAJA 2XMTA 3EZ5A 3DM2A 1QSYA 1RGVA 5L1KA 4ECUA 3BN7A 5SUHA 3SCIE 1FDBA 1SL1A 3PW0A 3S01A 5F8JA 3V6JA 5HROB 2QYCA 5HBMA 2L48A 5A6WA 1JLEA 3C66A 3M2VB 2YKAA 4DX8H 3HF5A 5EWGA 2ZJPQ 2DNHA 1PC5A 3M30A 5ITHA 5D3GA 4OHZA 3BGRA 4B3OA 2ALZA 1HPZA 3RR8A 3SMZA 2W24A 4JI4F 4ETZA 1FESA 5THWA 3IO1A 1QE1A 1RT6A 3CDEA 3N4WA 4ZPVR 1SKWA 2MGZA 2QV6A 1VQYA 3HX9A 4NLQA 1RKJA 2H9ZA 4KAIA 3K57A 4NPOA 1JXEA 2LQ9A 3W2WA 2ZH7A 2XWYA 3KLEB 2FJWA 4KIAA 3SFGA 3M6WA 2HRUA 4IQXA 2WOMB 4K4VA 4JI5F 1K73T 2JDJA 2Y1RI 1I94F 1JJHA 2OP5A 2VG7A 3GFHA 3GG1A 1DLOB 3K5PA 3IWNC 3NL0A 2M8DB 3M1VB 4EO8A 3UWTA 4TU8A 4LIRA 1H2TZ 5CYJA 3AB4B 4C7QA 4EUVA 4F3QA 2AX1A 5KFOA 2MXYA 3EZUA 1Z2LA 1X5PA 4PXDA 5A0YA 4QWAA 4W90B 2VBYA 1GX6A 2EFPA 1IKWA 1KHWA 2AX0A 2ZE2A 1QSSA 4FBTA 4C8YA 4OJGA 3KJVB 1FJEB 3M9MB 4AXJA 2WAQD 1Y00A 4ZPWR 2XS7A 1DTTA 3I4HX 1KD1T 2LECA 2DRBA 5HI7A 1V3SA 3I5CA 2MQMA 1FVSA 3SV4A 4O3PA 2MQLA 1R89A 5IQQA 3OFHA 5J2PB 5B0AA 1C0TA 2RU3A 2VASA 2IRXA 1G7CB 2I2YA 2W9BA 1IQTA 1FRIA 2KFNA 1J2VA 2DR7A 3BDPA 4J9SA 2ZBIA 2JSXA 4OX9F 2XS5A 3ZZUA 4DR5F 3OTBA 1J5EF 2PO4A 2KU7A 2CQGA 3TARA 5IM0A 4LSLB 1YJNS 2J5AA 1T7PA 4KO0B 1F60B 2OMOA 2V94A 4EO6A 5KFDA 1U6BA 2Z2MA 2ZHOA 2GO9A 4OZ1A 4DL3A 4RBVA 1NJZA 2K3KA 2DNQA 2AV5A 4OJHA 2IBKA 5KFQA 1JJ4A 5DLGA 4DMZA 3SV3A 3LP0B 1T03A 2V8VA 4K59A 3PJXA 1Y9OA 2FVRA 2UUBF 3G4SS 1GX5A 4ZVFA 4Y2CA 2E29A 3VQSA 2HNZA 3UCZP 1U48A 2W8KA 3FMWA 3OTCA 3D1OA 1C1BA 4MYTA 1N8RT 2M3DA 2ADCA 2N4CA 4USHA 5KFEA 4R0EA 4AL7A 5HMXA 1IJFB 3O6QA 2DD8S 1JLBA 3UW1A 3HMJG 1VBYA 4XDCA 4ZCIA 4F02A 1MU2B 4IG3A 2YKOA 3KK1B 3ENWA 5L1JA 2RDIA 2YWHA 1UJ4A 4EWTA 1S4FA 4HDHA 2CJQA 5KFJA 4MIBA 3KTQA 4HLBA 5HROA 1Q78A 2PA3A 1ZAWA 3E01B 3KLFB 4FVMA 1GNKA 3OPKA 3N5BA 4IRCA 1WF2A 1U1PA 1M5VC 4NCBA 4A8KA 2V8GA 2BYCA 2GHWA 2KXHA 2L9DA 1UWBB 4ICLA 1R0AB 5KFFA 1N6QB 2N7CA 1S6OA 1ZPWX 4LSNB 3N6MA 1OO0B 3MEDB 1U1RA 2AW0A 3CJ3A 1M5KC 1KQGB 4OHYA 2LA6A 1X9WA 3MR2A 3D5MA 4O44A 3MMJA 4F4YA 1KN6A 2ZZMA 3LANA 4NRTA 1L3VA 3BQ1A 1M1KT 1ZM2A 5DDOC 2IYGA 2NUHA 3NBPB 1YWXA 5F9LA 1SJ4P 2BRKA 4YB7A 2RRBA 3KLEA 1RDRA 4RNHA 3PXGa 4QIWD 3H40A 2HWIA 4QYRA 3H2LA 4AE5A 4X64F 1XNQF 1B0VA 1XBWA 2AJFE 4CH0S 4FF3A 4RW8B 1L3UA 1FNMA 2ZKUA 4B9VA 2HQ3A 2GC8A 3BF4A 5EN1A 4H4KA 5D8HB 1RTHB 2APOA 4KHMA 3VAHA 1B0TA 4RX6A 1JLCB 3V4IA 1K0VA 3HT3A 2OSQA 4ZVHA 1UVNA 4ILMA 4DHVA 4YR3A 4ED0A 1YJUA 2CZVC 2ZKTA 3F44A 3M32A 1PO6A 2B5JA 1NJXA 4I6WA 2KI2A 1X9MA 3PV8A 3DRYA 1NK4A 4FF2A 4YY3F 2XLKA 2A18A 3SFUA 1IQZA 4O3SA 2ZD1A 2AYBA 2ROEA 4C8OA 2NR0A 2BANA 2OJ3A 4HEA9 3HDSA 1JLQB 1J5OA 2EC0A 2JFDA 4ZPDA 3DYAA 1T05A 1DAXA 1KLMB 4NLUA 5F0UA 2WONB 4P7TA 1CC8A 2YX7A 2ZDOA 3T5JA 2NZ4A 1QVGR 3SEOA 2UUCF 3S6EA 3CEDA 4F4WA 4L72B 4G1QB 3D2WA 3MWBA 3WC2A 4ZDNA 3B78A 4BBYA 4YB1P 4MFBA 2LEBA 4O3NA 3IR7B 1GH8A 3N0VA 1HWKA 2DTJA 3L7PA 3MECB 1BGXT 1IUJA 2QO3A 4NYZA 2IC3B 1C1CA 3JTNA 1D1UA 4K4ZA 2MQOA 3R1LA 3HM9A 2DGQA 1YJVA 1SL0A 3N6NA 4JBCA 3MPVA 1H98A 2V4QA 1KTQA 2DIUA 1E6VA 2CQPA 1TKZB 1R31A 5FDLA 4DR3F 1RT4A 3CC2S 3VTIA 3MEEB 2HS0A 2MZRA 2R8HA 1QUPA 2ZHBA 4A8SA 5D78A 3DMJA 3Q2SC 3DLGA 5JJBA 2A2CA 4F2RA 4DFMA 1Q4RA 1S10A 4B9LA 3HHLD 1O51A 3VQTA 4OHVA 2AYMA 4RKUC 3PVXA 4N76A 4QQBA 2VA3A 2W25A 1LW2A 3OLAA 3H8YA 1KNZA 1S6UA 1QAJA 3JYTA 5C42B 4EZ6A 3IA0A 2O01C 1DFDA 1N5QA 2C3MA 2F1FA 4I0WA 2FVQA 1SJ3P 5G0RB 5LSLA 4OX7A 4KKOB 1VQKS 3VAJA 1SJRA 4NLSA 3LQVA 4DLEA 1HI8A 1UVJA 3OR1B 2GX8A 4YFUA 2J8AA 4DR6F 3J80Y 2EBEA 2MKIA 1TVRB 2PN6A 5I3QA 4PPDA 4J9PA 5KAKA 2DO0A 1YHQS 3CJ4A 4U6PA 3HVRA 5F8IA 2JEIA 2OTJS 5DDPC 3B4DA 3IS9B 3TUJC 4N47A 3AJ1A 3NBPA 2FPHX 1U1QA 5J1EA 1IBMF 2ABYA 4TLQA 1WHVA 5CZXA 2O67A 4B9UA 3QJLA 1VRTB 3HKZD 3AAWB 1VQ7S 4DR4F 2B3TB 3BZQA 4RW8A 2XY6A 3PFOA 4ALZA 3RTVA 2PT0A 2XCAA 5AXMA 2P9CA 4LVOP 4O3QA 5L1LA 4ES3A 4DR1F 1REVA 2DB1A 2ASDA 4H4KC 2JVOA 1HQUA 2C28A 2P9GA 1S0OA 4H54A 4HI2A 5A6PA 3CCZA 1PSDA 4OZNA 1LW0B 1VQNS 1YI2S 3I31A 3V5RA 2EFGA 5DS7A 1M5PC 3SQGA 5KFHA 2YNGB 2IRYA 5D4OA 1WNEA 2XLJA 2YWKA 1HR0F 3KMQA 3I5BA 4OIXA 2LDIA 2VBZA 1T95A 1SC6A 4YEAA 1FRLA 2IFXA 4NLPA 4ED8A 3MMCB 4X4VA 3PZPA 1WI6A 2OKQA 4PXCA 4TY9A 3LW5C 2XLIA 3QZ7A 2CG4A 3I6PA 2FUG9 4ZCMA 4QYZJ 2DGXA 3HZEA 5KG5A 1HBOA 2LYVA 4Y2IA 4J9OA 1WHYA 5E2QA 3GV8B 2F3JA 2YH0A 2JEGA 1Z4UA 4A48A 2GMLA 1UAWA 3HPOA 3T3FA 1R8HA 5LT5A 2XS2A 3OL8A 4LQ3A 2XULA 4RBTA 3FFIA 3PJWA 1F5BA 3QO9A 1C2PA 1ZYQA 3DXBA 1VIOA 4RBUA 2IHR1 2PFFB 4Y28C 3NMRA 4A8MP 3MM7B 3BM7A 3KYLA 2IC3A 2FJAB 3S1TA 4LFAF 4PQAA 4LFBF 5LXRA 1U1LA 3MI7X 4WFYA 5E3QA 3EX7B 5K8NA 3C6UA 2ZH5A 1RYSA 3P6YC 1U2RA 2YKNA 4DV3F 3OW2R 2O1PA 3NLCA 4CT8A 4PG6A 3U1NA 3MPYA 1T3OA 4KT0C 2DGWA 2CVIA 4OZ0A 1FD8A 1O8BA 4U9RA 1CG2A 1JJ2R 3H98A 1XMQF 4FXDA 3K58A 3PX4A 2LMIA 2M4MA 3LWMA 2PI5A 1UEVA 3OSNA 3MM8B 3HP6A 4HHJA 1AROP 4I1TA 3D0GE 3LH2S 4Y65A 4RWXA 3DHXA 3T1AA 1S0MA 5KFMA 4YDXA 2K7JA 1FKPA 3NAHA 1PC4A 2D74B 1F5AA 1S49A 1L5UA 2I5JA 1RTIA 3O1LA 2DPJA 3GILA 3M8RA 2KXNB 4B9SA 4B3MF 1XWLA 4NA2A 1H38A 2P6TA 1R43A 3DRSA 4DWIA 4N5SA 2L9WA 4DQRA 4GO7X 2OFGX 4QWBA 1TL3B 2XMJA 2E1CA 4R8UB 4C0OC 1N88A 3D54A 4CH7A 3KHLA 5DM7Q 2DRAA 1RT7A 4C9DA 4JV2A 5GAHU 4R5PB 2YNFA 5D4LA 1Q86T 1WTBA 2FC9A 1KR4A 1S48A 2ZVSA 2B6AB 1XEZA 4F4KA 1HQEB 2CPHA 1VRTA 1TKDA 3DLKA 2VODA 2MZSA 1K8AT 4QWEA 1RT5B 4URSA 4DSFA 4QIGA 5IT4A 4ZPCA 2JVRA 4WK3A 2FTRA 4IFVB 4KGKA 3E51A 2ERRA 1BQNB 3GFZA 3FVYA 2L41A 2NSCA 5GAEI 4IRDA 1IBKF 1KSPA 5GVQA 5HP1A 4ZCKA 2UP1A 2BDPA 2CQ3A 2KM8B 2CJ9A 1D9AA 4ED2A 4N8OA 5DGBA 2UUTA 4O3OA 3KHGA 2HGNA 4LF6F 3V6DA 4H4MB 2FLNA 3QLHB 3G6XA 1S1VB 2LEAA 2DHXA 1C4CA 1JWWA 2DNLA 4J5OA 3T19A 4AYBD 4XIUA 2MHNA 1OQ3A 1CLFA 1X7VA 3V81B 2XNQA 4ZS6A 3K7RA 4ELVA 2J7WA 4C2MA 2KHCA 3ONQA 3W7BA 4CTAB 3EXYA 1YRXA 3DRPB 2XI3A 2DNOA 5GAGI 3I55S 5AXNA 4WTYA 3KFWX 5EX3A 2QMXA 4M8LA 2DGUA 1EETB 2AGPA 3BB5A 4ECVA 1YJTA 4QJVA 1XNRF 2QEXS 1NKEA 5BYSA 3BR9A 5KOWA 2R7WA 2DR8A 1V3ZA 4ZP7A 1TL1B 2B51A 2CPFA 3OVBA 2VB6A 3FMBA 1HI0P 1X0FA 2NREA 1DQ9A 3I0SB 2OH2A 5LSRA 4DBQA