4NXNF

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nxnF00
4DR4F 4JI6F 4JI8F 1CQNA 3T1YF 1J5EF 4DV2F 4LFBF 2J5AA 4NXNF 4LF9F 4X66F 5AJ3F 4B3SF 3R3TA 4DR3F 2BXJA 2UUAF 3ZZPA 2UU9F 2VQEF 1CQMA 4DV7F 4K0KF 2VQFF 1N33F 4JI0F 1F60B 2UXBF 1HR0F 4B3TF 4LF8F 1RISA 2KJVA 1IJFB 4JI7F 1GH8A 1N34F 4DV6F 4JI4F 1HNZF 4DUYF 2YY3A 1VMBA 2UXCF 1IBMF 4GKJF 4DR7F 4LF6F 2KJWA 4OX9F 4DR5F 1FJGF 1HNWF 4DV4F 5LMNF 1IBLF 1QJHA 4JYAF 2E5LF 5IWAF 1XNRF 4DR2F 1G7CB 1FKAF 2BVZA 4KHPF 1B64A 4DV5F 4DR6F 4B3MF 1G1XA 1LOUA 4X64F 4JV5F 3OTOF 4LFAF 4LF4F 1XNQF 4LF5F 4JI3F 4LF7F 4X62F 1HNXF 1N32F 2UUCF 4DUZF 4X65F 3T1HF 2UXDF 4GKKF 2RJZA 4JI5F 2HHHF 2ZM6F 1IJEB 4DV1F 1IBKF 5BR8F 1N36F 2B7CB 4B3RF 4DR1F 1XMQF 4DV0F 4JI1F 4JI2F 4YY3F 5LMUF 1XMOF 2B7BB 2F4VF 4LFCF 1I94F 4YHHF 4NXMF 4AQYF 4DV3F 2UUBF
chains in the Genus database with same CATH superfamily
4NX9A 1NDCA 2MZ1A 4HI1A 5IZHA 3N6NA 1OPZA 2CXEA 1JX4A 4CDIA 2RDIA 2HS0A 2IPOB 3D67A 3J81Y 3T1HJ 1NK9A 3NGKA 3P3DA 3IRWP 5ETMA 4P52A 2PEBA 4Z2XA 2ZWPA 2FJBB 2RF2B 2VG5B 4B9LA 4BCAA 3MM6B 4EFAC 4A8YA 3M8YA 2J6TA 1RWWB 4EYHB 2KFZA 2QA2A 3L7PA 2GNKA 2QL7B 4C97A 1HI8A 3KLGB 4KIAA 3TX8A 2ZUGA 1WKLA 1ZAXA 3CDWA 3Q22A 2VOOA 1BUXA 4ZCLA 3VALA 2I5JA 4WFAQ 5HMWA 1UWBA 3K58A 2HG4A 1M5HA 3DI6B 3AQOA 3MFHA 5GAEU 2R7TA 3O5TB 3F56A 4PG6A 4O3NA 1F9HA 3G4SS 2Z30B 1RAFB 2JEGA 1CS4A 1T9WA 2QLWA 4PXEA 3K89A 4ZPVR 4N56A 3FVYA 2EW9A 5D8HB 2HHPA 4FDFA 4CRJA 3NAHA 4P9SA 3QJLA 3OHBA 3WC0A 4IR1A 4J9KA 2DKOB 4K2JA 3KJQB 3V6DA 1S4FA 2HAIA 4F7VA 1YZ7A 4KHPJ 3JSMB 2BKPA 1S9EB 5KG3A 1OIAA 4MJKA 2OTJS 4G1QA 4ES2A 1WORA 1YDLA 1RTIB 4ELTA 3BR9A 3S01A 1EARA 2WSFC 1JMTA 4OLPA 1HIYA 1HHTP 2ALZA 1Q4RA 5J2NA 4BC7A 3E01A 1C1BA 5F9LA 4CLTA 2GMLA 5KT5A 2RU9A 3AB2B 2RDDA 4IOCQ 4CLPA 1FRXA 3M8QB 4K4SA 3B82A 4A8MP 3LPYA 2VG7B 1KQSR 1Q86T 2XG8A 4LF9F 1VBZA 4ID8A 1UPPA 3Q8VA 1XNQJ 1HW8A 4F4AA 5EDWA 1PCAA 1FRIA 4C8OA 5KG5A 4OYOA 2Z8QA 2DHAA 1NH8A 2VBWA 2Y0BB 1UL3A 1WTFA 3MECB 1SIZA 4RBTA 2OI2A 1FJGF 2V8GA 1D3WA 1YHQS 2DVIA 1JLBA 5DDPC 5DG8A 3V81A 2E1MC 3GSDA 4DG1B 4LQ3A 1RAEB 3LPEA 4NPOA 2KL8A 5KTQA 1MMNA 5IV3A 4O23A 3V6HA 4OI2A 5LSOA 1Y5IB 4ZPTR 1A7GE 4QU6A 2VICA 4DQRA 1K1QA 1WI6A 2UXCJ 3CIMA 2E44A 2NREA 3GYGA 2HQCA 3D4JA 2EI5A 1C4CA 1B0VA 3JTPA 1C0TB 4M5NA 4FKYA 3OD2A 4TNOA 1FESA 4RR5A 3I4PA 2WTFA 5IQ6A 3GP9A 1RAGB 4O4GB 2DNOA 2AYEA 1DY3A 3Q86A 2YWWA 3OVSA 3QAUA 1OYDA 5ETVA 1TMMA 3J7AN 1YBTA 1U25A 1U2CA 2RHQB 2V2QA 3KNGA 4ZP8A 5KFCA 1T7PA 3FCHA 3C16A 1HNIB 4C98A 1K1SA 1R8PA 1BMQB 3TA2A 4HKQA 4CP5A 5JUMA 4NLOA 3AT1B 2PMWA 2E1PA 4KGXB 2Y0SD 2Z2MA 2MLYA 2XZDB 4QWCA 2BQUA 2CYYA 1RLDA 3HT3A 1LK5A 4WFZA 2HWHA 4A8OA 4X4NA 2EK6A 3TEGA 3MZIA 4AQYF 2NZ4A 3V6JA 3GILA 2YVSA 3C15B 2CJXB 4TQRA 3QO9A 3CJKA 2ZITA 1RT2B 3GQCA 2YTCA 3IM9A 5AE1A 4ZKAA 5FJ4A 1JLAA 4FF3A 1X0FA 4J5OA 4F3MA 2QEXS 2KZZA 1GXLA 1UEUA 3R27A 3HJFA 3QT7A 4FBTA 1YJNS 4USKA 4AXIA 1N4LA 4O44A 3WBZA 1WUUA 4R8UA 4FXDA 4NXMJ 2OSRA 1NHKL 2ACMA 2IJRA 2MY7A 2CQ1A 2HFZA 3FFIB 1G1XA 4YOEA 3AY0A 1LWFA 4UZCA 1CJTB 4CO1A 4G3IA 1S9FA 4NLXA 2LXIA 2RUSA 2JDJA 5IM0A 3BBBA 3ET6A 2MKSA 5KG7A 2ZEJA 8ATCB 3I56S 1N8RT 5LSLA 3V4IB 1WF2A 1FERA 3KK3B 5L8RC 4NEZA 1PAEX 5KFMA 2PC6A 3ZXWA 3GJRB 1AUDA 4JI3J 3T5JA 1U4BA 3ITHB 4WKYA 3M2UB 1V3RA 3PRBA 1U26A 1S1VA 1I94J 1BWEA 3GIMA 2PI5A 3QT8A 3IWNC 3T5LA 4WTOB 4NRUA 5DO2A 3RRGA 2MZQA 3PX6A 1YQHA 3CD6S 2ZH3A 2IM0A 3DN9A 1Q5VA 5L38A 2XLJA 3SQGB 4ECXA 4QPXA 2CQCA 5FLXY 3EICA 4KGMA 5IC6B 5DDQC 3HHDA 4I2QB 2MQQA 4F4ZA 4L76A 2HSEB 3D6HB 2ZJPQ 2PE8A 2ADBA 1VJQA 3KJVA 1RJJA 2YWGA 1UTAA 2X3GA 1TVRA 2N3OA 1NK8A 4LF2A 4RJVA 1RAHB 3ETOA 3MM7B 3MAHA 5G4DA 4ZVTB 4R0EA 4TY8B 1N5YB 1X5PA 1NB7A 2LFVA 4QPTA 2G2OA 1OS5A 1U45A 3KLEB 2MQOA 3T5KA 2QYCA 4ZVRB 2EFGA 2Y1RI 1CG2A 5LSRA 1H74A 3TYTA 1S7IA 1E6YA 4HT7A 5AXLA 1WEYA 3S8SA 1RT7A 4DL7A 4OYWA 4OLOA 1SL0A 2IDEA 1FX2A 1X4FA 2GZOA 4MYTA 2KI2A 1D0EA 4HHJA 1H73A 3CXCR 1QLNA 4MFBA 1S6QA 2R9LA 3KLHA 2C2RA 3IA0A 3LWMA 2JSXA 2I1RA 2MHNA 1T03B 3CJSA 3IS9A 1O8BA 1ZAVA 1RCXB 3HPOA 4RL1A 2XYGB 4RW4A 2YNFB 4EK2A 4KHMA 3KMSA 1K44A 4O3SA 4NWBA 3SQOP 2CNLB 1V9OA 4OJ3A 4J9OA 4HACB 4Y2KA 1CQNA 1HQ2A 3UR0A 3WIUA 2HLTA 1QM9A 4KHRA 3AFGA 1OYEA 1W2IA 4P2XA 1KOOA 2D1CA 1IKXA 4RNFA 4U7UK 3KDNA 2N3LA 1WKKA 2AJQA 5KT3A 3VHQA 2UXBF 2V9KA 4ANEA 2BE2B 2H51B 3AOBA 2AP6A 4NA1A 2HBYB 3BO2A 3QIDA 2UUCJ 4ECQA 1R3NA 1VCTA 2HHWA 3DC2A 4DR5F 2GVDA 1HD1A 4CZCA 2FVCA 1MROB 4LRFA 5C7PA 2BVZA 3CJRA 1URRA 3M30A 2XMKA 3MEEB 3UN2A 3KDOA 1Q16B 2R42A 4LVOP 4M5IA 1RGVA 3GR1A 3I55S 1PYTA 1IBMJ 2ZZTA 5FIIA 3IWLA 1CJVB 1UZHA 1HQEB 3TAMA 2YBVA 1S1TA 5B0EA 2NPIA 1D9AA 4DSEA 3H59A 4H4OA 2ROEA 4QIEA 4OX8A 3A8EA 2R8GA 5JVHQ 1F6TA 4Y3CA 2E5GA 4ED6A 1XQIA 1B3TA 4DS5A 2PGCA 1S5ZA 4K5RA 4N5SA 3LP0B 3UDLA 1Y00A 1ZYQA 2JL9A 3GE9A 2UVVA 4NL5A 2R7OA 1N34F 2RT3A 2O01C 3F44A 1YKWA 4KKOA 4C3LA 3WZ0A 1Q53A 1RA7A 3KJFB 1HBNA 1U1MA 4FYDA 1MG7A 3DLBA 1HWLA 1N6QA 2AT1B 4DV4F 2ZHAA 3N6LA 1IKWB 4XPEA 3KHHA 3UO0A 4FXWA 4W90B 3C46A 1IR0A 5D4PA 4LF4F 2ZC3A 2ZDOA 1QTMA 3E3XA 3AXKA 1EB0A 3GG1A 4PUOA 5AXNA 2ZKUA 5B7WA 2HHHF 1QAJA 1I1GA 1RT5B 4M5GA 1TR0A 4O3OA 1Z2ZA 2YNGB 1SQFA 1F5CA 2OELA 3R1HA 5IWAJ 4ZVGA 1JXVA 3N0VA 5CZVA 4X64J 1RTHB 3ZTRA 1NK0A 1Q8LA 1PAUB 2WHOA 1RWNB 2KHCA 3H5UA 1BXNA 4OV1A 5EWFA 1DBDA 1SJFA 2VQFF 4LFCJ 1SC3B 3EMTA 3TUJC 2HNYA 2RAQA 4ZHRA 1J5EJ 2LP4A 4C48A 4RBUA 3MAAB 5JJBA 2ABYA 2FUG9 1YG0A 3D6TB 2IYGA 3GPAA 4DR2F 4Q2LA 2YQ1A 4PXBA 4GO7X 3CJTA 3VF0B 3MR2A 2HNZB 2AGOA 1U1RA 2OKQA 4USIA 4X4PA 2RVJA 4QCLA 1RT3B 4X65F 2XBPA 4JI5F 2NSBA 3ISZA 2Y3YA 4BS2A 2C3PA 2FVPA 4K4VA 3TA1A 3QRQA 3KLFB 2GQQA 5E7OB 1NAQA 1X9MA 3L7OA 3PFEA 4TYBA 5I3PA 4J37A 2EVZA 4J9SA 1KDNA 2CPDA 4DU7A 4ZN1A 2POKA 1ZA2B 4TU8A 2VPZB 2YX7A 5F0WA 1T9VA 2DT9A 2YKOA 3MMCA 3PO4A 1DQ8A 2CPXA 5HMYA 1NKEA 2UU9F 3DDKA 3G9CA 1YRTA 3G87A 3QZ8A 2R2RA 4CLKA 4HH1A 5MAOA 4LSLA 5EWGA 3QNWB 2WBRA 3RW7A 2RD5C 2DNPA 3VAMA 4DV5F 2E9TA 4F8RA 2OEMA 2W2PP 2RQCA 4NI2B 2ZBCA 4B3TJ 2Y8WA 3NNHA 3MM8B 2DXDA 5BYSA 4IDKA 3NCRA 4OI3A 4TXSA 5GAGU 3QT5A 5DGAA 2D3O1 2B5JB 1ZM2A 3VQTA 1PBUA 5ETPA 5IXUA 4LSNA 5CAAA 2M3DA 1VQLS 2ZH1A 2ZD1A 2H5IB 5HBMA 4MKBA 4KPYA 3HXMA 3TARA 2DR9A 1RQ0A 1Y9OA 2L41A 1N0UA 1S0MA 4B9TA 5KFQA 1UW4A 2VZ9A 2GVZB 4WFXA 3K5LA 4F3QA 4PWDA 2MY8A 3I0RB 5C24B 1IUJA 1Q5YA 3HHLB 3AD7C 4PKDB 3UNYA 2DRBA 2ZDPA 1FWKA 4JYAF 4PR6A 1NK6A 3U7JA 1JKHB 1K73T 2BJEA 2I6WA 2BE7D 4A8QA 5KOWA 1RABB 4CLSA 4DSLA 3ZZTA 5A0YA 1HR0J 2WVEA 2D3OR 4RUHA 2PDAA 2R7XA 1AB8A 2B6AB 2GHPA 1S1UB 2CAJA 1RBOB 2GJ2A 4NLVA 2CKWA 4RO0A 3PW2A 4PABA 4DV7F 4CCHA 1LFPA 3BGRA 1U1KA 3FBEA 2Q6BA 4E8UA 3TX0A 4ZIVA 3D54A 3QT6A 4DR3F 2MQNA 1F2HA 3NL0A 1X60A 3SCKE 2XULA 5E3RA 3AQPA 4HI2A 4I64A 1CQMA 1GT8A 1KKHA 3V6KA 1WDTA 5I4MA 2YKQA 2LEAA 1IM4A 1ZM9A 4V19J 3GR0A 4IFVA 3THVA 1LKZA 3DOLA 3OJSA 2HEKA 2MJNA 2YH0A 3OXLA 4OI4A 4PZVA 4WP8A 1IBLF 3I82A 5IS2A 4OX6A 4ZVUB 3M8WA 3NGRA 1N5VA 2J0WA 3OT9A 4KGVB 5IV4A 1MU2A 2HFSA 3MD1A 3NOCA 2C28A 4DSJA 5BYQA 4H4KA 2R7VA 3DRPB 4P7VA 1GAOA 4GKKF 3W5XA 4QJVA 1XMQF 2KN4A 4DFMA 2Z57B 4OHWA 2AWZA 3KLIA 4JB8B 2BX6A 5B0BA 2ZH9A 2PFFB 1I51B 5CCMA 1FEEA 2WSCC 2FJXA 2W9CB 3L09A 4AXJA 1R27B 4G65A 3CNQP 2ASDA 2G1DA 4ZJQA 2C2DA 2AZ1A 3AOCA 3G8TA 3GIIA 5A8RA 3CD5A 1TUWA 3EPIA 5H1SV 5C25B 2DR5A 1S6OA 1HNZF 2HK3A 1JLGA 2HFOA 3L3CA 1RTJA 5EWEA 4DPTA 3IXQA 5DJBA 2VFVA 5E3AA 1LK7A 5HLFA 3KUEA 3H25A 5H9FJ 3PYDA 1TKTB 3UVJB 3DHXA 4U9RA 5ETRA 2NUHA 2WB4A 4R25A 3CTRA 1VBYA 3T1HF 1SJ3P 3PR4A 2MKJA 1UFWA 1VQ6S 1S99A 3Q89A 5LMUF 2CPJA 2B3TB 2O3DA 2IRYA 2KG1A 4IFYA 2JFDA 5DQHA 1X31C 2V2ZA 4HDHA 2D7SA 1D9FA 3CD7A 3TUZC 3W5YA 4S0MA 1VQ8S 2ZNYA 2GAHC 3DYAB 4JI1J 3R5BA 2BJ7A 2E1AA 4PAAA 2R8KA 1ROFA 5U47A 1KNZA 4F0KA 3MM9A 4NLGA 2OFGX 1D09B 5D4OA 2G0IA 3H0PA 1BQMA 3W2VA 4I0WA 2XSJA 1SH0A 4FKXA 3RUBL 1MNEA 2F5GA 5A8WB 1G4CA 3D5MA 3IAS9 3J80Y 1YBAA 1DRZA 2GIQA 3NBPB 1D9DA 2WONA 2HAFA 2FIUA 1BGXT 2HNDA 4UOFA 4NE9C 5CYJA 2HVZA 4U67Q 2JRSA 3CWJA 3HMJG 4O4RA 4WU2A 2CIMA 2PO4A 1JJ4A 3ONQA 2QA1A 4IH6A 2ZH8A 5KFZA 3QPIA 1EZZB 4CWBA 5DZ6A 4KR0B 5F9NA 1T9XA 4DLGA 4YB1P 2W2QP 2JVOA 4NRTA 4F4KA 3JQJA 3M32B 3WQPA 4ANDA 3ISNC 2DNMA 2AKWB 3SSSA 1D1UA 4FYVB 4YY3J 5B0AA 4A8KA 2K7KA 2YKAA 1N5SA 1FWPA 4BWMA 2C1EB 5KFJA 3TZZA 1VIXA 5E0OA 2XMUA 5L1LA 2F8EX 3QAEA 1KTQA 5A2QU 3LGMA 1P27B 1WDDA 4Y2AA 2ZNZA 1RXOB 1KR4A 4DR4J 2K1RA 1XNQF 1NUEA 1JJCB 2DNHA 2FY8A 2R8IA 2XYHB 2BZ2A 1J2VA 2DIUA 4G6VB 3THTA 3SDEB 2PSZA 1RWUA 4CTAA 3DNCA 3CCLS 1X4BA 3OL9A 3OSPA 1AYEA 5JVGQ 2AYMA 2OEJA 1A0OB 4RNHA 2QLXA 2R2SA 3VGVA 2OUGA 1TKXB 4CLLA 3M8ZA 4P2MA 1GMWA 3QGGA 5HJXA 1QUVA 3H2VE 5ETKA 1SKSA 2J76E 3JQKA 3DOMB 1ZBTA 1R0BG 2UXCF 1B4SA 3C8YA 4ILRA 4MKYA 3A8IA 1Q8IA 3NRBA 2RMLA 5GAHU 2Y9HA 3BSAA 5ETOA 3PVXA 1VQNS 1U02A 1SC6A 4A4JA 4J9NA 5HL7Q 4U7UD 3AA9A 2MZRA 4E98A 4WCEQ 3TW0A 1ZZNA 2E1CA 4OIXA 1RWKB 1NKBA 2CQGA 4USMA 5L9NA 2Q6CA 5IT9Y 2WVCA 3UWTA 3AB4B 4DL3A 1KOHA 2CJYB 1UJ5A 1RHJB 5B0DA 1QSYA 4DL0C 2B7BB 1M5SA 3LH2S 2DR8A 1SKWA 3DFEA 3JSRA 5KFNA 1U1OA 1RBAA 2CG4A 4OZ0A 5D3GB 5KT2A 3JYTB 2HGNA 5K9FA 1RSCA 3OR1B 2Z4PA 4WXOA 4USTA 4ZPBA 4RW7A 1HNWJ 2DRDA 3OVAA 1FKOA 4DV1J 4DQQA 4DS4A 4UQTA 3GYXB 1HNVA 3EGNA 1HBMA 2YNHA 2FC9A 1XMOJ 1UVLA 1P1LA 4DV3J 1JLQA 2W24A 3I0SB 2JHEA 3IG1A 3T1YJ 5HAOA 3HFVA 3T6BA 5AE2A 3NMRA 1W26A 4EUVA 1SI9A 4NMXA 1T9UA 1RTDB 1I6JA 2ZHOA 2RNEA 1UWBB 3GIJA 4MKAA 3IP0A 2J7UA 2ZZNA 2BANA 2MSTA 4NYOA 4C0OC 2ZUAA 1NB2A 3L9ZA 1SIWB 3TJ8A 3V4MA 3GU0A 5F0UA 2G2YA 1MMDA 2OD6A 3B6BA 5HMZA 1B0PA 1F9FA 3JTOA 4QIGA 1RHQB 2QMXA 1SUQA 4NXMF 5KFDA 4DFJA 2MDAA 4ZVSB 2FLOA 2XS2A 4AL7A 3EPGA 1FJEB 2WK4A 7FDRA 1CJKA 2GV1A 2Z2YB 5I3UA 3BSNA 3CCUS 4ENOA 4Z7YA 5DLFA 5F8GA 3OJUA 4MMOA 3M1VA 3EUNA 1PJ7A 2OPPB 3WC2A 5CABA 3LQVA 1N88A 3C14A 3S1TA 2KH9A 2FZCB 2W7PA 3C3LA 1BY9A 1IR2A 2DH7A 2HZVA 1M1GA 3HKWA 3QYYA 3ZO7A 3TI0A 2AJ1A 2C22A 1B0TA 3VAJA 3AOAA 1U1NA 4J9MA 5L1IA 2CA9A 2DGQA 3QFWA 4DPXA 2MZSA 3DDNA 2MZJA 3L4BC 2F63A 3DHWC 2V34A 1IBCB 3P5TL 2ACYA 4WP9A 4U95A 1W7WA 4F4YA 4JI3F 3R6LB 2L08A 5D15A 2HMIB 3O6QA 4TYAA 1UVJA 2MQPA 1HW9A 1NKCA 2L3MA 4ZVFA 2J8SA 1J5OA 5J2QA 3T41A 1R31A 2KRBA 1U49A 1I94F 1YJRA 1LW2B 4ZITA 1EKSA 1B99A 4FYWB 1S9GA 3LF0A 4J9VA 3NP5A 1EETB 2CQDA 1T05B 2XMVA 2E7WA 1NJXA 1KRPA 3TJ9A 3M2VA 3MPUB 3MMJA 3BDPA 4DQPA 3AH6A 5HANA 2WVFA 1TKZB 2LQBA 2WVBA 2BQRA 2XY7A 4RUAA 1XR7A 1FRKA 4KE5A 4IOAQ 3P45B 3JQMA 1JB0C 3R7BB 1EP4A 2X7IA 3JAMU 2XO6A 1HYSA 1UMJA 1DTTA 1S76D 2VHGA 5T7LB 3HZGA 5D0GA 1R7IA 2OPQA 3A8KA 5KFIA 3FC9A 3UD4P 4DPYA 1REVA 1SB6A 1C1CB 2BE9B 2R2UA 1F9EB 3SFGA 4P10A 2IBKA 2OIHA 2PI4A 4FS1A 2LDIA 4PCQA 2GW8A 1NHVA 2MQLA 1V3SA 2RH3A 3BBFA 5FDLB 4CNYA 3GV5B 4WFNQ 1R8BA 3VAGA 5K14A 4QYZJ 1HI0P 2B8PA 5LL6d 5I42B 1XTZA 1TP7A 3MMBB 4LRAA 3DGPB 3D68A 1Y4ZB 4J7CA 3THPA 4ECRA 2G0CA 1YIJS 5J2MB 3BKFA 4JI7F 5IT0A 4ZP7A 1X4EA 2PMHA 3VGSA 4CNZA 1RT1B 1OSCA 2DEJA 4I69A 4QWEA 2B4VA 1S0VA 1S4EA 2QFJA 3OVBA 2YXLA 1KSPA 2IVMA 4BWJA 2RF2A 2VG5A 3P8BB 2XNRA 3MM6A 3I5BA 2FLNA 2QTWA 2W8LA 3RBXA 3LP1B 1WF0A 2YKMB 3KLGA 5IT9U 1SKUB 2CQ3A 2H4YB 2H1YA 2BW7A 1MWYA 3PEJA 2KM8C 2VFSA 3IBWA 3CDUA 5CD4A 3DLHA 4UT4A 4NLRA 3LP2B 2HW3A 2VKRA 3HHLC 2QC3A 3HO1A 3FMBA 3DI6A 4H4MB 1RT6B 3H98A 2H4WB 2V5HG 3LW5C 2WSEC 1VI7A 2QN6B 2VG6B 5D78A 4DR1J 5HQLA 1CBKA 3R97A 1LWCB 1F60B 2A1BA 1RISA 2MEWA 1HMVB 2MTLA 4IO9Q 2NZCA 1GTEA 4XIUA 2YY3A 1SJQA 4OZ2A 2UVUA 3A12A 2NXEA 1IBMF 2M70A 4P7TA 1K9MT 1YK9A 2CPYA 4ZPAA 1R0AB 3HJVA 5CCLA 3Q8SB 3JSMA 2DNZA 2HFUA 1XN9A 1S9EA 5IM0B 3W2WB 4LSZB 1FO1A 3FBFA 2XMJA 1RTIA 3X3UA 2IRUA 2X1FA 4F0HA 4EZ6A 3OUYB 2HGLA 4J9PA 2EFNA 1Y5LB 4ECSA 1CPZA 4Q43A 1WKJA 1QAXA 5HJYA 3HT0A 2YPYA 3GFXA 3SV4A 5BYRA 5K8OA 3X1LB 1AW0A 3VZIA 3M8QA 3MEKA 4KO0B 1XNRJ 4LR8A 3RJMB 1WHWA 4CT9A 4AE5A 4F2RA 1FE4A 1FWLA 5ETNA 4F4WA 3EZOA 2HRYA 2JOQA 3CCSS 4JV1A 2PD1A 1C2PA 4OJGA 4DX5A 5K8MA 5LJ5Y 5IWAF 4RW6B 1LWEB 2ZFHA 4X64F 4IG3B 3IN5A 2ALYB 2V8PA 4IH7A 4NYPA 3KJVB 4BC9A 2D74B 2ZM6F 5KFHA 1SPBP 3MECA 1KWMA 5CHCB 4CLYA 2CQPA 4Y34A 4LFCF 1VISA 1JK9B 4DG1A 2XLKA 2R3VA 1TELA 1RT4B 1HWIA 2OLWA 4M5KA 1GQEA 2B56A 1J5EF 3QIPB 4F25A 2NUUG 1OPIA 1KVKA 2LYVA 3OTOJ 2DTJA 1DFDA 4X62J 4PG8A 3PYGA 4OJHA 2KT3A 2RILA 4ILMA 3CULA 3KLVA 2NR0A 4W92B 1GX6A 3CCVS 5KFBA 1TZ0A 1C0TA 5DGBA 1MSWD 4ES3A 3CD0A 1NPPA 3MPYA 2LECA 1PILA 4UUXA 3W65A 3QFHA 1SCJB 4O4GA 1AA1B 4B3SJ 3TP2A 2IA0A 3BEGB 1S6UA 1UVNA 5GAGI 1FNXH 3FQLA 5A8KB 4ECYA 3HFKA 3A4TA 2V63A 3PX4A 2N82B 5HROB 1FT8A 3QLHB 4YUDA 4OJ1A 5KFTA 1HNIA 2DXEA 1Q78A 3CVKA 1Y11A 2MQMA 4OYXA 3I9ZA 3T3FA 2APOA 2EPIA 1H2VZ 2M9KA 3RG6A 1KD1T 2V4JB 3NWGA 4PQAA 3SV3A 4C8MA 4OFZA 2CUYA 3O44A 1TK0A 2Y8YA 3EVMA 2XB2D 2QA4S 2WCXA 1C0UB 2N4DA 4I6YA 3S7RA 3FDSA 1ZM3A 4C11B 4KC5A 5F8JA 2WW8A 4PXDA 3UFCX 4X4SA 5ITHA 4C8KA 4B3TF 3H8YA 4WIQA 1RKJA 3U02A 3UCUP 3PW0A 3C15A 3A3OB 1RT2A 2C3YA 1RU1A 5AXKA 2QO3A 2GQ2A 1HKAA 4QWDA 2DNYA 1HBUB 2HHQA 2V6AA 1NXIA 2DYAA 2L48A 3HKZD 1QAIA 3N28A 3QJJA 4DCPB 2CPHA 3KKFA 3HVTB 2I2YA 4GC6A 2RJZA 2ADCA 2W4DA 2IC3B 2W2MP 2D9OA 2YWFA 2QYGA 4OZJA 2MKYA 3MFIA 5CD4H 2IBOA 1TL4A 3FFIA 2E5LJ 2R7SA 1RI7A 1S49A 3FGVA 3WIVA 1WELA 1ZH5A 3ZNJ1 2BJ8A 4MIBA 1RDRA 3PJXA 3VQSA 1CJTA 3NS7B 2IMOA 3W9JA 1QUPA 3I32A 2Z58B 4RW8B 3QGHA 2UXDJ 2HVIA 2XHWA 3V4IA 1DZ5A 1VR6A 1HR0F 5KG0A 3R7NB 3KK3A 2BOPA 1WOSA 4M5LA 4LRBA 4OYIA 5E3QA 5D6GA 4ED3A 1DLOB 2XGQA 3IWXA 1YVFA 3IO1A 3ITHA 5H9EJ 5ETSA 3I87A 4TLRA 1NHUA 3ZZYA 1QE1B 3DDIA 3TVYA 3M2UA 3RAXA 2KXNB 4D3HA 2CQ0A 3M2RB 1IQZA 2JLFA 1QY7A 3MCSA 2W25A 4I56A 4WF9Q 2KYXA 3HULA 2QMWA 1VJWA 1HARA 5DG7A 3D6FB 2UUWA 3JSBA 2WOMB 4I4BA 1Q79A 4ED1A 4QW8A 3SIPB 5KFUA 3SQGA 2HQGA 3MF5A 4I2QA 2NSCA 4YQWA 3RBDA 5CQGA 2HS3A 2MXYA 3MTJA 2CVIA 1PC5A 1FKPB 1S1WB 3FK4A 2HFVA 2AMCB 3ZTPA 2KJVA 4NYZA 2RKIA 1VQKS 2W4PA 3MM7A 4JI6J 4DL5A 4P73A 4O0NA 4TY8A 4RUBA 1BHNA 1N5YA 3UQSA 3R5CA 3KLEA 3ULHA 3EE3A 2CPEA 2FB0A 2GGPA 3AAWB 2UUAJ 3A1YG 2VFRA 3U1LA 4LF5F 3R2CJ 4RZRA 3RB3A 1YLXA 4OV6A 3RBEA 1X4AA 4NLUA 3R2DJ 1K0TA 2VB6A 3DM2B 4C3MA 5GVQA 2FVSA 2AEFA 4DSIA 4HR2A 2EKNA 5HQ8A 4ECZA 1X0PA 1WWHA 4M1KA 1WSVA 3ELHA 1T03A 4F2SA 3CJ8A 2V67A 4BLGA 1IBKJ 2HBRB 2YNFA 3IMQJ 3LA0A 3KUGA 3N01A 2BQ3A 1VBKA 5J2PB 4QYRA 1HHQA 1U6BA 4HACA 2BR0A 3CB4A 3D1HA 4QU7A 1ELOA 2V9WA 2J0SD 4DFPA 4Y28C 2C2OB 4DI6A 4B3OB 6FD1A 1TL3B 4GRSA 3VGTA 3BYRA 1Y7PA 5B0FA 1YZ6A 3N6MA 3IRXB 1KEKA 4X4VA 9RUBA 3HI9A 2BE2A 4I7FB 3K5OA 4DV6J 2RRAA 5CXTA 4RX6A 3AD9C 1KLNA 4JI1F 1N5QA 4QW9A 2OSQA 2AGPA 4K7QA 2M5YA 2VV5A 1MROA 2ZD1B 4M5JA 2ZC4A 2C2MB 3MEEA 1NJWA 2OGUA 4HLBA 3V2UC 5DDRC 1Y0HA 1UWAA 5F8MA 3NXZA 2QSFA 3OLBA 3DLKB 3DRRB 3TVZA 4CH7A 1VGYA 3SBMA 2NQPA 4TLQA 5KFFA 2DGVA 3PG9A 1CJVA 1HQEA 1PKUA 1VHFA 2ERRA 1S7HA 3HHKA 2U1AA 4I2PB 4N7TA 3CJ0A 1VC6A 3LP0A 2JEFA 4K2XA 4F3OA 3IR6B 3H4BA 2VQEJ 2E5JA 2IIHA 3EDRB 2DGUA 2KKHA 2ZJQQ 4DZDA 2YWKA 2VA3A 4B9UA 4NCAA 4YY3F 3KOAA 1IKWA 3GZ7A 2QG9B 3ISND 2K8GA 1WF1A 1DURA 4RW9B 4IH5A 5JXSA 2L9NA 2G9OA 4KFBB 1EHWA 1NDPA 3IGVA 4K59A 4MIWA 4PG5A 1DJ0A 2IHR1 1RT5A 1RE1B 3SZ2A 1Q95G 3I9V9 3G6YA 5GAHI 2YNGA 3FSIA 1FVQA 3K8VA 4QIWD 1MWQA 3R5JB 2A3JA 3W1YC 5M2UA 1APSA 4USJC 1LFWA 3K5MA 3FSYA 1RTHA 1YTYA 1AROP 1EX8A 4KAIA 4U6PA 3D0GE 2E9RX 1XWLA 2ILYA 2LQ8A 3J7YI 3VVTA 2K3IA 5DM7Q 2FGOA 3R1LA 1Z1ZA 5KT7A 5M2RA 1LW0B 3EGVA 1DAXA 2EFQA 3ENAA 5LOQA 7AT1B 4WFYA 3MAAA 3MM5B 1SJRA 4RLEA 4AL6A 3EJMA 5EX3A 1UVKA 1R89A 3CIZA 2HNZA 2ZH5A 2OMOA 4L72B 4I1TA 1JLFB 2COLA 4KYZA 3OFHA 2HWTA 1RT3A 4RWWA 4A8SA 3CGIA 5J1EB 3TAPA 2V2VA 4OZ5A 1N52B 2XCPA 4K50A 3CCJS 5IT4A 3KLFA 2P6SA 3D0HE 1RTJB 1QDUB 2XY6A 4YN3B 1T94A 5HLFB 2FJAB 1ICEB 4ZVPB 1XMBA 2OD4A 1VQ9S 2MKHA 2LVWA 3TEHB 2XYPB 2FDNA 1JQGA 3PW5A 1NJZA 1S48A 1X5OA 4EBDA 4DR6F 1BD6A 3T1AA 1Q81T 3KK1B 3R5DA 1JLCB 2JVRA 1FI4A 4DV1F 1V6HA 4BDPA 2M88A 1S6PB 3TO8A 3NGUA 1EIYB 2BJ1A 2FJEB 1XMOF 4Y6IA 2F7VA 4DV3F 2MMYA 4HL9A 3CMAS 2IJNA 1P1TA 1HFEL 1M0SA 3C6UB 1H38A 2OPRB 4O3RA 3T1YF 4YB6A 4NI2A 1TK5A 3J81U 3J7A1 3PO5A 4KB7A 1YITS 3MM8A 1DQAA 8RUCA 3SSRA 4DR5J 4R5PB 2B5JA 2CDRB 2ZH6A 4JI2J 1RACB 4EWTA 2VA2A 4ZK7M 2HURA 3RRHA 2V2KA 1VMBA 4OYAA 4CLFA 4P2FA 3PZPA 2VPXB 3NAIA 3DMJB 1WG4A 1RAOA 4DU8A 3OR2B 3LAKA 4ATNA 2MPUA 1Q0NA 2FYXA 3CJ5A 1FRHA 4P71A 2XWXA 2GVZA 2W9BB 2CADA 4IO1A 3SCIE 3I0RA 5C24A 1KVIA 3HHLA 3OXGA 2ATLA 2VASA 4DJBA 1AFJA 1KS2A 1IWGA 4UF4A 4UUWA 1X4DA 2AZ3A 2QZ8A 1JKHA 5KFSA 5LMNJ 4CH1A 3J7ZT 1RWXB 1XR6A 3KHLA 2KZMA 1TV6A 2BYCA 4YDDB 4HH0A 4JV5J 2L9WA 5C2GA 2XQCA 2HHTA 3M6XA 3PYEA 2QL9B 1HNXJ 3BR8A 2M7SA 2ZBRA 2DHXA 2B6AA 1S1UA 1NEEA 2EBGA 3VGUA 2UV8G 2V68A 3RB4A 4DMZA 4ZP6A 1OY6A 3RYLA 1S1XB 1CSJA 2QE5A 4F67A 4LF4J 2VPWB 1B7YB 2ZWOA 1EJ7L 2YQ0A 2FHMA 1RUSA 2HHHJ 1IVZA 2DNRA 3E8OA 2BA9A 2A6OA 3LAMA 1FK9B 1FEHA 4HT5A 3TZYA 1NJYA 3T6JA 1OWXA 2HVHA 3QGIA 4K0KJ 4FVCA 1N33J 4IQXA 4URSA 5KFGA 5ETLA 4KJIA 4ITSA 4GO5X 2XEXA 3W62A 4LRCA 1KFDA 5GADI 2B43A 3P49B 4QIFA 2RQKA 1NK4A 2J7WA 1CC8A 1U8SA 4B3MJ 2X3DA 3TZXA 3DRPA 2NXNA 3HD2A 2DB1A 4NZ0A 4DL4A 1XEZA 4CIOA 3RZAA 4K4WA 1SL2A 3MI7X 1LXJA 1T02A 1RHKB 1WC1A 2QFIA 1SL1A 3GV7B 1VRUB 1S59A 2DNQA 2UUBJ 3OL7A 2L9DA 3DLEB 2W9CA 1WC4A 1A9NB 1FNMA 2F4FA 2R8HA 4AYBD 3VAHA 2PA3A 3EVOA 1IKYB 2RIJA 2I0XA 2V8DA 4ELVA 5HN0A 1D8YA 4DSFA 4HDGA 1VRTB 4C7QA 4XDDA 2X1AA 1RAIB 3VCDA 2AJ0A 5C25A 1EQ0A 1ULRA 5B0CA 2DY1A 3BQ2A 4DUYJ 3IBFB 3NKYA 1AZSB 4J9LA 4O3QA 3KG1A 2BKOA 2BACA 1TKTA 2P8IA 3UVJA 1U24A 1UKUA 4CLZA 4ZPCA 3MCNA 1F2GA 4KGKA 4USUA 2G4BA 4OMFG 4PQUB 1T0TV 2NXCA 3CCES 1RWPB 4ANCA 4DN9A 1VLYA 3ENQA 2VC1A 5CYQB 3W64A 3T5HA 1H0HB 4CM2A 1WEXA 2VU5A 1TU0B 4MTPA 4N77A 4WXWA 4ICLB 2KO1A 2J8AA 4WE1B 3IG1B 2RS8A 4N8OA 4X4RA 2XMMA 3MEGB 4ED4A 2AYGA 2XTJP 3VVUA 1T3NA 1Y5NB 3ZC4A 2I9SA 2PA8D 2DGSA 1FXLA 2FLPA 2M8HA 4EBCA 1HQUB 3DYAA 2M52A 3PW7A 3SCJE 5KFEA 2LQ9A 2OPSB 3MPWA 2RQMA 1GTHA 2Z0GA 3HHLD 3KWMA 2HKEA 4DR1F 2M2BA 1UEVA 4C9DA 3GONA 5A8WA 4ES1A 4FNIA 1KN6A 4ID5B 4CH0S 3TANA 2B51A 1UJ4A 3NBPA 1JLEB 3CC2S 3E2EA 5CZXA 4IG0B 3BPSP 1AXQA 3FKBA 3G82B 4TU7A 2CQHA 4Q8EA 2NXJA 3RRKA 1GXUA 2R2TA 2QX0A 2IM3A 2VD3A 3FBBA 3GFZA 5EUHA 4C0BA 3H4DA 1Y10A 4AT1B 1AT1B 2W4CA 1RU2A 2DHHA 4B9MA 4ZPWR 4ZCKA 4ZLNA 2F8HA 2KB2A 1OY8A 2SXLA 4LBIA 4OHZA 2ZH2A 3M32A 1U2FA 2BEFA 4UW2A 4CO4A 2IAJB 3GB0A 3PV8A 4CO2A 1RK8A 1YJUA 1FDNA 3TRGA 2R4FA 2VKZG 3B4DA 2UV8A 1YJVA 4M8LA 5J2QB 4DR3J 2LXFA 3RAMA 4LF6J 2YX4A 1U0HB 5F8LA 1MWZA 4RWXA 2HVEA 3MMAB 4GVBB 5HATA 5CH7B 3W66A 2DXFA 3W7BA 3MHYA 1VBXA 1U1QA 4USWA 3SDEA 4C6AA 1M5VC 3KJNB 3QWUA 2GO9A 2KVQE 3D7SB 4DR7J 2Q66A 5K8PA 2J0XA 2H65B 3U27A 5KFVA 4GKKJ 1WSRA 3SFUA 5C42B 4LFBJ 4Q0BB 4TKTA 4YR3A 1G3OA 2IM2A 3HZEA 1TKXA 1DHMA 2HPUA 2Q43A 2JX2A 2ZKTA 5FLXU 3NS5A 3CO9A 2JFKA 3D9BA 3M9OB 1SC4B 3OTOF 1NNDA 1VC0A 2EG2A 1KFSA 2OJ3A 4X62F 1SQGA 1ACMB 3DOMA 2LDYA 4Y2CA 4FPRA 2X1GA 1UJ6A 1VC5A 2HQDA 2ZH4A 4J9QA 2CRLA 1YJTA 1NDLA 3GIKA 2Z56B 4OL8A 5HVGA 3WX8A 4OZLA 1TUVA 5G0RA 5K14B 3KK2B 2V4RA 4DV2F 4TN2A 4B3SF 2IY5B 2A18A 2H5EA 4ED5A 1B7FA 3ZZPA 1QVGR 4K4XA 4DUTA 1PJ6A 1KLMB 3M9NB 4DZ6A 1WHXA 3VWSA 3D1QA 5L1KA 4K8RA 2HFNA 5D3GA 3OPKA 3JYTA 3W8PA 3PX0A 3G71S 3KG4A 3OR1A 2DR7A 2ZBQA 5LMUJ 3LO3A 4G1PA 3HP6A 4L3NA 2BJ3A 2RSQA 1X4HA 1HL6A 2ZOMA 4U8VA 3I0SA 2QA4G 4MT1A 2HZAA 3IFEA 1IN0A 4JV0A 2LU1A 1RTDA 2E1RA 5K20B 4WZQA 2LQ5A 2DO0A 1RAJA 2ZH7A 3B78A 4BBYA 2KM8B 2AW0A 2O66A 3RGIA 4ZVQB 2YNIB 2XCAA 3BKTA 4OI0A 1WC0A 4XAKA 4MK9A 5IOLA 1P9YA 1R6VA 4QQBA 3ZTSA 2UVRA 1BQNB 2OFHX 1LV5A 2LQJA 3OW2R 2EC2A 4X4QA 3C6TB 3EXCX 4JI8J 5KFXA 4ECTA 2JZ5A 2XZWA 2CJAA 2ATCB 4N8NA 4J90A 4P6QA 1DTQA 1HWUA 2E5LF 1L3KA 1G7CB 1P9QC 2OPPA 4MIAA 1XC9A 2HBQB 1GX5A 3EXYA 3DOKB 3QBCA 1W2BR 2BJDA 2UXDF 4JI4J 3QGPA 1KVJA 2DNLA 4WFBQ 1UZDA 4CYUB 3K5PA 2CZ9A 1TUGB 3LUYA 1QAYA 4QBUA 3FRZA 3IM8A 4W98A 1AFIA 4ZLJA 1TK8A 1I5OB 3W9HA 2CJ9A 1TL1B 1KONA 1YBUA 3CC4S 3GSIA 4AUKA 3L7UA 2HMIA 4YMEA 1N32J 1FDAA 6AT1B 3CDEA 1QTNB 4H4KC 4HYKA 2IFXA 4DDFA 2A2DA 5KFLA 1LW2A 5HP1B 1HPZB 4NZ7A 3MUTP 3PACA 1T11A 4FYYB 5CYMB 2MGZB 4KTQA 1EETA 1T05A 1S12A 5ETQA 2BM1A 3HDSA 2FTRA 3I4HX 4CI0B 3CDBA 5KG6A 4DF4A 1TFYA 1TKZA 1VLOA 4ZP9A 3CCZA 2KXHA 2VIHA 1F1BB 1F5BA 4DPWA 2Q79A 3C66A 3QWPA 1A6LA 3CCTA 4B3RF 4YEAA 1CULB 3IGNA 2HRUA 3ICLA 1R8HA 2NYHA 1OMSA 3TOQA 3AD8C 1F3VA 3MPVA 3UCZP 4JI6F 3GCWP 1S79A 5T41A 1F5AA 4L6V3 5T7LA 1L3TA 1X9WA 4LR7A 2FJWA 2PMZD 2ZOGA 2QL5B 4DUZJ 1YJWS 2CDQA 5K5MA 2UUAF 3AJDA 4MH8A 2RQ4A 1C1CA 2QLFB 3ZZRA 4DX6A 4UY8T 3UR3C 4C8LA 3PRDA 5GAEI 1WOPA 4M5MA 2W7AA 2XMAA 3VAFA 2EXUA 1OQ6A 1VQOS 1FDBA 5FDLA 2H48B 3MURP 2KJWA 3Q24A 1TL7B 4WK1A 2XZTB 3WDOA 5I42A 3ENVA 2EWHA 3H7HB 3MMBA 1ZZFA 3NG8A 2NS1B 3DGPA 3I5CA 4QR2A 3ADAC 3QRRA 2W2OP 4DQIA 4U8YA 5J2MA 4DCOB 1WG5A 4JI0J 2GHVC 1P8GA 3EZ5A 3GMGA 4LIRA 1RT1A 1IBKF 1BWVA 2D41A 4NEYA 3CE8A 4YB7A 3HVWA 5BXIA 1M90T 4GKJJ 3H5YA 2DPIA 2MLXA 2WW4A 4Q8FA 4K4YA 3POTB 1FTCA 2AIRB 4F04B 4NA3A 2QSWA 3HHNB 1VFJA 3WHIA 1M5PC 2DK2A 4ZVOB 2F8MA 3NGSA 4U96A 4JOUA 5D4NA 2F9JA 1SV5B 3LP1A 2BW2A 2K06A 3Q2TC 2YKMA 2IJFA 2MB0B 3VV2B 2R7UA 1VQYA 3UDCA 2OP5A 1FXRA 2F1FA 2CPIA 3M6UA 1NU4A 3MR6A 4DV6F 4M95A 2GJFA 2WB1D 2HQ3A 2B9XA 4EEYA 4F02A 1NRKA 3EGZA 3CCRS 3LP2A 4OYZA 3U1NA 3DGVA 3P96A 3Q8YA 4X66J 3JSYA 4H4MA 1RT6A 1RWMB 3BYPA 4KHPF 2VG6A 4LIWA 4NCGB 4MKVA 1WOOA 4URQU 1LWCA 4C8ZA 2HIQA 4TY9A 4Q7AA 4CLUA 4EU0A 2KU7A 4RPFA 2XSFA 1HMVA 4ZLLA 3C19A 4OZNA 3TUPA 3ZZOA 3NGDA 1O51A 3LANA 1FNOA 3GG0A 2QJ3A 4LR9A 1U0SA 4KV8A 4M5DB 1R0AA 4FBUA 3ZZ0A 1OO0B 3W9IA 4CO5A 2FHOB 5BJRA 4WTYA 1HBOB 3TA0A 3W2WA 3DRSB 1FFSB 2YKNB 3W63A 5AT1B 2J6SA 2IRXA 3CJ3A 3OUYA 2VQEF 1NLKL 2Y1IA 2FHKA 4KY3A 3D3CJ 2IA6A 3PKMA 4Q2MA 1E6VB 3NS6A 3NY0A 1FF2A 4WYLA 2DO4A 5H9FK 3CCMS 4WU3A 1VQ5S 2ZVIA 4KO0A 4K4TA 3EM1A 4LVNP 3BDEA 3IAM9 2CQ4A 3MEDB 3R9LA 3NEKA 4ECVA 2W1BA 3G6VA 3IR5B 3SI8A 3CDAA 3SSQA 2QIFA 5DLGA 3DLGB 1PO6A 3BSOA 4PPDA 1X5SA 3RU0A 5F8NA 4RW6A 1LWEA 4IRDA 1X9SA 4IG3A 3AJ2A 5KG1A 3HSGA 2WZ1A 2H3EB 5D0RA 4JV2A 2F40A 1IKVB 1BQXA 3B8HA 4LREA 1VRQC 4YB5A 1YWXA 3RW6A 1N36J 4B08A 2RKIB 2D3UA 2MLZA 1RP5A 4DV0J 5HSPA 4WKRA 4HHHA 2N7CA 5KT6A 1Q8KA 5GMDA 3M8PB 4WZMA 1RT4A 3H5SA 4A46A 3CEDA 3OL6A 4M94A 3QIPA 2R7RA 1F3FA 2EK1A 4KQZA 2H9ZA 2GGPB 4RU9A 5I3QA 2ZE2B 3FRYA 1ZOTA 4IQMA 1CJUB 5HI7A 1B64A 2J6UA 2FY1A 2KFYA 2N7YA 5E2QA 2OMLA 3IC1A 2OTLS 1ZA1B 3P5BP 3RR8A 3G2XA 1WACA 4AFFA 2AV5A 3CW2C 3PW4A 5KOXA 3BN4A 3EX7B 2N4CA 1PSDA 3BZQA 5A8KA 3JXOA 4LQ9A 2MYFA 2CWKA 4JI7J 2V94A 2VBYA 1QVFR 2UP1A 4ZDNA 1PYSB 3EDQB 2WVDA 1URNA 3PY8A 3Q8UA 2OEKA 3PHTA 1ZTWA 2GIFA 3M6WA 5HROA 4G1IA 3QLHA 1K47A 4FF4A 1XR5A 1UFLA 2LA4A 4LUBA 4ED2A 4A47A 1S10A 2I5JB 1GH8A 2KXFA 2XY5A 1NDKA 1S97A 2X51A 1RZMA 2V4JA 1UPMB 2K7JA 1JNZB 2HHSA 3K59A 2V4QA 1ZPWX 2CQBA 1VYAA 5AJ3J 1C0UA 1FX4A 2AF6A 1O6XA 3US5A 4C11A 1CS4B 1ZTTA 4KBIA 5F3TA 4MAKA 4QR1A 4RUCA 4XDCA 1H72C 4MYUA 5HMXA 4NOHA 1Q82T 1U1LA 1T8EA 2OO4A 4KGZB 3V6DB 1HBUA 5M2PA 4A8FA 3BO3A 4JI2F 4DSKA 4RBVA 3MR3A 1FCAA 2VONA 2VL1A 1WJ9A 3SEOA 4G1QB 8AT1B 4K5SA 3P6YC 1NSAA 3HVTA 1VQMS 4LF7J 1FJCA 1UA0A 4DQSA 2IC3A 2C2EA 2HWIA 3HVRA 3M6VA 2JC1A 3GV8B 2YQ3A 2PIIA 5J2NB 4FZVA 4Y2MA 3E01B 5EGYA 2YWHA 3UE2A 1C1BB 2XWYA 5L1JA 4OYBA 4RW8A 5LMNF 3J80U 2IM1A 4M63A 3G8SA 4WWSA 3CUNA 2GJIA 4CQ1A 5MLCV 6FDRA 4HVZA 2DHGA 1UVIA 1M5KC 4JV5F 3QSYB 2DD8S 1U47A 5L9XA 1HNXF 3ENWA 5CA5A 3JTNA 1VQPS 3GLJA 4HTIA 1DLOA 4NCBA 2QRRA 4NLYA 2C3MA 5DRKA 1SH3A 4PG7A 1QE1A 3CMQA 4YDXA 3M8RA 3AJ1A 4C0HA 3HK2A 1U48A 1OSDA 2MHEA 3M2RA 1V5VA 3BGUA 3G86A 4IRCA 1U09A 2EKYA 4WK3A 1JLBB 1GXTA 3V81B 1CC7A 4AL5A 3M8SA 2JNJA 4K0KF 1N33F 5AXMA 1NCLA 3BPDA 4QWBA 2WOMA 5E5NA 2F4VJ 3TUIC 3TVKA 2CNNB 4YR2A 2BKNA 2J9EA 5KFOA 2ZM6J 4IUFA 1CVJA 2HVDA 3H90A 2WAQD 3B54A 2FQQB 1KBRA 4ZMMA 3GFHA 1FKPA 1WEZA 4B3MF 1S1WA 4NLTA 4P2SA 5T14A 1VDHA 1OQ3A 1NK7A 5GMKa 3K8WA 4UOGA 2FVRA 3BF4A 3BN7A 2XMWA 2B7CB 3G8QA 3FZ2A 3PFOA 2HZCA 4L74A 2J9DA 5GMEA 4OX9J 2B4OA 1SXLA 5E41A 2JH3A 2UUBF 3AA8A 2CJQA 3KXDA 3Q0AA 5IFMA 2GAGC 4ECUA 2HQIA 4LFAJ 3ILLA 1FFGB 1RLCL 1YRXA 3C16B 4Y00A 2QMUB 3N9UC 3KUHA 2AX0A 2DRAA 3BJYA 3BH6B 3NMAA 3HF5A 3DM2A 2DR6A 1G2EA 1Z2LA 1FD2A 9ATCB 3N79A 4YHHJ 4DUYF 3H42A 2BRLA 3LTOA 4NXNJ 3K5NA 1SVDA 1Y3JA 2W2NP 4WIIA 2G0JA 5B0GA 2AJFE 4PEOA 1Q7LB 2KT5A 3W3SA 5DQGA 4FPIA 2RU3A 1T9YA 3QO9B 3CJKB 2UVWA 5J2PA 3QQCD 2UUCF 2PN6A 1JLAB 4A8XA 1REGX 3DU6A 5JMNA 2DCLA 2DISA 1N54B 3GTYX 5F8IA 1RWOB 3VTIA 4B3OA 1TL3A 1OY9A 4I67A 4O44B 4R8UB 2VOPA 2LEBA 4EYIB 5KFRA 3IRXA 3BM7A 2AQ4A 2Q3PA 4I68A 4WYWA 4I7FA 2BJ9A 3R3TA 2B9EA 4LT6A 4F50A 1FDDA 3HVAA 2HGMA 3O8WA 4X4UA 3MPDA 3KMQA 3P4UB 1O5JA 1LWFB 5DETA 4CLWA 1LWXA 2DNKA 4L3KA 3DRYA 1FFWB 3TWZA 2CZVC 4WBFA 5EX0A 3TQ1A 3ET6B 2B8QA 1EQMA 3DLKA 3PNIA 3DRRA 4C8NA 1FTRA 2VPYB 2I8EA 2DPJA 1FKAF 5A2QY 4V19X 4NMLA 2F65A 3CCQS 3A3PB 1LOUA 4E0DA 3HSDA 4OI1A 3BQ0A 5KFKA 3MWBA 4H54A 1IQTA 3D28A 1MMLA 1N0VC 2R8JA 4I2PA 3QSIA 4DEZA 2XM3A 1TV6B 3PDNA 1S1VB 4PWWA 4L75A 1KP6A 2VUGA 2C3OA 3NCPA 4QYZK 4ZVHA 2VG7A 2HLUA 1K8AT 1YJ7A 2JLEA 2OHDA 2GQCA 3I5AA 1JJ2R 1T3OA 3FEXB 5DM6Q 3MOJB 1V3ZA 3R6GB 4RW9A 3PTWA 1TAUA 2NXUA 4DX7A 4KFBA 5FD1A 1ZAWA 4LF6F 1MLAA 3PJWA 4IYQA 5HVHA 4C4WA 4RU2A 1MN9A 3N5BA 3F0NA 2LLZA 1TVRB 3M7VA 3G96A 3TR5A 1JXEA 3MTKA 4ZIWA 4ZPDA 1VQ7S 2Z2LA 4DX8H 4LF8J 3FUYA 3EYZA 2LEPA 1IJEB 2RE1A 3OSNA 2CWXA 3OLAA 3Q83A 5LXRA 4XK8C 1S57A 1KC8T 3BB5A 4E2FB 1E6YB 2ROPA 5DQIA 4DR7F 4NZ6A 1NH7A 2M8DB 2W8KA 1RT7B 4L73A 4ZVEA 4NASA 4LFBF 3HLUA 2MKKA 3L95X 1LW0A 2GS8A 2DBBA 4DPUA 2CVEA 2CQ2A 3RB6A 4QOTA 5BR8J 3MM5A 2DCUB 4EBEA 3D3BJ 4RNOA 2XLIA 4MFBB 1S6QB 1WC3A 3KLHB 2A10A 1R8CA 3FJ2A 4OYMA 4LF5J 1RWVB 2CG8A 3IS9B 1JLFA 4YR0A 3FEZA 5F41A 5K8NA 2FZGB 3NWRA 4RW4B 1RCOB 1O0PA 5KAKA 2VJVA 1VIOA 5J1EA 3MOZA 1H2TZ 1PJ5A 2KDOA 1X8DA 3PCOB 1H2UX 4ELUA 3EZUA 3KTQA 3N5FA 2VBZA 3OFEA 3NLCA 3VZHA 1UW9A 3SYZA 2RS2A 1TQLA 1IKXB 2UZAA 1JJHA 4PRFA 3QATA 4R0JA 1EAYC 2AHOB 5IQQA 5LXYA 2FD2A 3ZTQA 2Y1JA 4ALZA 4I6AA 3KK1A 2J5AA 4USVA 3OHAA 4JBCA 1JLCA 2GVDB 3UN5A 2IDLA 2D9PA 1RADB 2AYBA 1NJIT 5F8HA 4OHYA 4DXLA 1S6PA 3Q8PB 5L46A 2KYZA 3M30B 5RUBA 3RB0A 1H6KX 1DARA 4ZCIA 1IJFB 2IMWP 3C6UA 2OPRA 3MUMP 3LGNA 1D8ZA 4LRDA 4DHVA 1GMUA 3LOUA 2CZ4A 3TAMB 1S1TB 1GEHA 4EI2A 4R5PA 1UEKA 2MKIA 1P6TA 4H4OB 2A0FB 3I31A 1BC6A 1CLFA 1C4AA 1GNKA 4WP3A 1Z4UA 4FP9A 4ZN3A 5C5JA 2XMTA 2GMHA 4RNMA 3DMJA 4A48A 4GMKA 1WG1A 2O1PA 3FSXA 1VQ4S 3TQEA 3DLLQ 3OR2A 3PM9A 2O67A 4TVAB 3BO4A 1WHVA 4JI8F 4KKOB 2C2ZB 3CF5Q 4PXCA 2W9BA 1WC5A 1HBNB 4B02A 3V5RA 3PKYA 1N6QB 1ZETA 1L5UA 2FGCA 4DWIA 2OAUA 2GFFA 2EFOA 2FJDB 3J7Z5 2HHXA 2B9WA 3ILJA 2BMBA 4RNNA 3W8GA 3HSZA 2AJ2A 3I6PA 4JI4F 4Y65A 1B70B 2GCFA 1QD1A 4PUOB 1HWJA 2ZJRQ 2VC0A 1H3DA 3HHEA 4LF9J 2J7KA 3O3LA 7FD1A 4X4OA 1KHVA 4DBQA 5C2CA 1TFWA 3D1OA 1L3VA 4ZA1A 1PYOB 3JAMY 2HYIB 4B9VA 2CJBA 5AE3A 1S1XA 1PG5B 1N32F 2A2CA 3D66A 2KT2A 2D3ZA 3M4XA 1OJ4A 4F26A 2P6TA 2X1BA 2LU2A 2EC0A 3RR7A 5F3ZA 3PRVA 1FJGJ 1U6ZA 1FK9A 3BS9A 2ROGA 2H54B 4GVLA 3H40A 3MR7A 3MCOA 2HNYB 4ZHRB 1PGZA 3ZTOA 3PIOQ 4FF1A 1KHWA 1TKDA 3CO0P 2MJUA 2W01A 5SUHA 2E5HA 5A76A 4EMDA 2GIRA 2O5DA 2RB7A 2VJUA 3R7SB 2J0QD 1TTHB 1RKIA 4DL6A 4M5HA 2CQIA 2AJ4A 2P9CA 3K7RA 1RHRB 3K57A 2BDPA 2DGWA 2AEJA 4K4UA 3DLJA 3UI3A 1KQGB 1VRUA 4FYXB 4DUZF 1WTBA 3H5XA 4JUZA 3MMCB 3DLEA 2CPZA 4K4ZA 3FEYB 3OTBA 1FVSA 5G0RB 1NK5A 1IKYA 1HI1A 2AD9A 2VODA 3DRXA 2CFXA 1VRTA 2M0GB 1RYSA 2DJWA 4LF1A 4OHVA 1YI2S 3MAQA 3T19A 3VAIA 5HQMA 4LSLB 1ZPVA 1SKRA 4OX7A 2HIYA 3CJ2A 2BXJA 2DY9A 1AZSA 2VBXA 3J7YU 2XC9A 2HHUA 3BGOP 4JI0F 4DR6J 1TL5A 3M9MB 4QZVB 5A6WA 4AQYJ 2JEIA 3CCWA 4NLDA 3NNCA 1F0XA 1VK8A 3NCQA 4PQUA 4GKJF 4IDKB 5H9EK 5CYQA 4Q44A 4YS2A 2XS7A 4DOZA 2LMIA 2CPFA 2DEIA 3DXBA 4P72A 4LSNB 4JP8A 4ICLA 1JNRB 2JLGA 2HK2A 1L3UA 4WE1A 2ZHBA 2DGTA 2GC8A 1U2RA 5HBMB 3MEGA 1M5OC 4C8YA 4ETXA 1RHMB 2WRMA 2R7WA 1NPRA 1LNQA 3OV7A 1HQUA 4FS2A 2IVYA 3F41A 4PWDB 4I6WA 5HVFA 2MQ8A 4X66F 3NOGA 1QSSA 2OPSA 3TNVA 3HX9A 3MDFA 4WPAA 1X5TA 1Q8BA 2DHSA 3DU5A 4OHXA 2RRNA 3FBCA 4FF2A 2OH2A 4MK7A 1Q1KA 5DS7A 2Q1LA 2V8VA 5A0YB 4ID5A 1JLEA 2DGOA 1DTQB 1RHUB 1KQFB 3QRPA 4DPOA 5B09A 3J81j 4IG0A 2HRTA 5IC4B 3G82A 3Q8RB 1VOMA 3UCGA 1ZS6A 2W7OA 3BGRB 2P9EA 2BABA 2XNQA 4YFUA 4ETZA 1NSKL 4RKUC 1RA6A 3CPWR 1WC6A 3A13A 5KG2A 3CT9A 1HHSA 1YGYA 2RHSB 4U7CA 4XPCA 1RB0A 4EO6A 3HSJA 2IAJA 4IOBA 1T95A 1BLUA 1IR1A 4DR4F 1ITPA 3OXFA 4W4MA 4IFVB 2V69A 3DOLB 3UNGC 4TU9A 4P75A 1FA0A 1NO8A 3ETMA 3NNAA 4HEA9 1NM2A 3KHRA 1SBRA 3SXLA 2KTQA 1MU2B 2F3JA 1U0HA 4J91A 1KTVA 3OTCA 1TAQA 1RAAB 1YRUA 4PYAA 1G6BA 3OTDA 2QLJB 2V8HA 4ZLPA 3MMAA 4LBPA 4GVBA 3TAQA 1N48A 5J1NA 3LGHA 2E7VA 3K0JA 3KLIB 1JWWA 1UA1A 1GMWD 2ASYA 2HS4A 1XIQA 1XJWB 3QJPA 4LBHA 1YJ9S 4KSEB 5DG9A 3VAKA 3PIPQ 4QIVA 3Q2SC 4NLWA 2BRKA 1SQEA 4OZ1A 1UCNA 5THWA 5E33A 1N36F 3CJ4A 5C42A 4Q0BA 2P2CB 2E7XA 4DV0F 4V1Ak 5A8RB 4DFKA 3CSKA 1YSJA 2CNKB 3PR5B 1SJ1A 3UD5A 1JLGB 2B4UA 2Z2ZA 1R43A 2B9YA 2DNGA 4OI6A 2RRBA 2BOAA 1PIEA 3KG0A 4LMZA 5E3CA 5D77A 5SZTA 1N56A 3BKUA 3O1LA 1FRMA 1YX2A 3T9NA 4ERDA 1XBWA 3KK2A 5HO4A 4WJBA 5KFWA 1HNWF 1WHYA 5GADU 1U8WA 1Y3KA 2U2FA 1T9TA 4IFYB 2DITA 4Z37A 1KLMA 2XGPA 4UTGA 2UXBJ 3U1MA 1TMJA 3ZZZA 4C3KA 2XO7A 3D6MB 4LJMA 4NLQA 4NLPA 3MGJA 4QR0A 3TZWA 3RTVA 2P9GA 3ZFVA 2LCWA 4Q45A 4DCJB 1PC4A 5E3PA 3JB9k 2M4MA 2CJKA 2IYIA 3KFWX 3LALA 4FNHA 3MM9B 2NYIA 2G13A 3OQ2A 3BH7B 1H98A 3AODA 1UP1A 2KRRA 2AU0A 5AJ3F 3N4WA 2D69A 1BQMB 4CO0A 3W2VB 2KVIA 3PYFA 2JWNA 2G2ZA 3PEHA 2XSJB 2KFNA 2BM0A 4KH1B 3Q8QB 1IXKA 1Q7YT 2WONB 2Y1LB 4XO0A 3H20A 5A6PA 3VR1A 2HNDB 1RTZA 3EWGA 2HBZB 1NPKA 4MK8A 1SJ4P 2YNIA 3LWLA 4URGA 1N5TA 4CO3A 3CMES 1IM6A 2LXUA 2W9AA 2YH1A 2E29A 1BQNA 3RAQA 1M1HA 2ASLA 2BUNA 4LF7F 2MSSA 2ASJA 2IVFB 3E51A 3C6TA 1XERA 1NZ8A 1N34J 1NZAA 2NCKL 2FLLA 3BV8A 2NLWA 4UQGA 4KV8B 5LT5A 1UETA 3FMWA 3RBZA 4N41A 3BREA 4DV4J 5LJ3Y 4Y2IA 3GJQB 4AD6A 4Q5VA 2P5VA 2FZKB 2C42A 4FN5A 3BGFA 1MW7A 2DNNA 3W61A 3DOKA 4PYDA 1S72S 2QGFB 4F4XA 1R8AA 3O2IA 4X2BA 4CYUA 3UDVA 4ED8A 3BGLA 1NSQA 3MCMA 1W25A 4PWUA 4QWAA 3UN3A 2K1RB 4DLEA 1TL1A 1GFWB 5HK4A 1BE4A 3I96A 5EHHA 2F9DA 2AEMA 1KQKA 2WBMA 4FVMA 1J27A 3BSCA 4CTAB 1H7XA 2LKZA 5HP1A 2VQFJ 2YKPA 4X84A 3Q23A 1M1KT 2V50A 2ZVSA 1HPZA 4J9RA 4ZJLA 1WD6A 2AGQA 5CYMA 2MGZA 2PEHA 2CNOB 1LXNA 1U7LA 4USHA 2YWEA 2C2NA 3BBCA 5D4LA 1ZM4A 2VDHA 2F4VF 4F0MA 3UD3P 3GIRA 5KG4A 4B9NA 2G1HA 4DR2J 3BQ1A 3FZBA 3ZZUA 1MN7A 3ZNUA 3ILOA 2GA7A 4C2MA 2DIVA 2UUTA 3T9ZA 4BHQA 1V5IB 4X65J 2ZOFA 4JI5J 3UW1A 1CULA 3W60A 1JIHA 4ZOSA 1K0VA 2GO8A 1VQSA 4OQJA 1RBLA 2PT0A 2V0NA 1EKRA 2EEYA 2RDJA 3ILIA 2MZTA 3SMZA 1H7WA 3C2PA 2KHDA 4DN0A 4HTJA 2ILZA 3OFGA 3HD1A 3W5ZA 2XI3A 2E5IA 4OX9F 5LM7E 3TJAA 2C2KB 4UY85 2AX1A 3GJSB 4DF8A 3OTEA 2ZZMA 3OBIA 4IRKA 1HA1A 2FPHX 3CC7S 2UU9J 4LFAF 2FHJA 5ETTA 3HM9A 3FQKA 2FVQA 2GHWA 3CJQA 3OFFA 4DV2J 1GK8A 2EFPA 1RYRA 3B4MA 1FXDA 2C3UA 4RW7B 1FKOB 5ADZA 4NA2A 4FXVA 4KT0C 3F73A 3G6ES 1TL7A 1HNVB 1HBMB 2YNHB 4YHHF 2EG1A 3A3NB 1S0NA 1VS3A 1JLQB 4DV5J 2LA6A 3NGTA 4O3PA 1HD0A 4ED7A 1U1PA 4NXNF 2K2PA 1X4CA 1UAWA 3FCVA 2VFUA 2HHVA 1GMVA 1XK8A 3QZ7A 3KNAA 4P74A 4ED0A 3GFYA 3R5GA 3AHPA 4B9SA 2ZBPA 3K2YA 3GJTB 3M05A 2RUGA 1VK3A 2BANB 2GX8A 3POTA 1FRLA 2MKCA 2KG0A 4N76A 2QT7A 5DZ7A 3PXGa 4KH0B 3EVWA 1QJHA 1SV5A 1IWAA 4ER8A 2EBEA 1SUQB 2VDIA 1NSPA 4N47A 1WI8A 4DL2A 4UOHA 1U6FA 1CJKB 3WX4A 4A8WA 4IKAA 5I3UB 1SH2A 3SCLE 3DKDA 3MUVP 4YP3A 2JEJA 3D0IE 4D3GA 2QV6A 2VH7A 3A8JA 3M1VB 3HFZB 2ZBIA 1S0OA 2R7QA 4O0IA 3QMQA 4X4TA 3JS9A 2VFTA 4JYAJ 3C14B 2NPFA 4NCGA 2JC0A 3AXMA 2XI2A 3H2LA 2BV3A 4UOCA 4CT8A 5KFYA 1HWKA 1NMEB 2A6MA 3D2WA 2YX1A 2E9ZA 5EN1A 2B4PA 1FJ7A 4M5DA 3R8YA 1FD8A 4DV7J 4KRWA 1JXLA 3KHGA 3DCAA 3KYLA 3PJ9A 1HBOA 3MR5A 2EFVA 2E66A 3DRSA 4ZJOA 3DXSX 3HCXA 1J5OB 2YKNA 1XNRF 1FRJA 4J9UE 3S6EA 1NBEB 1S9GB 2DH9A 3MD3A 1LQ9A 1LEOA 2JJ4D 1R0CB 4UZBA 5KFPA 2I38A 3FCWA 5L39A 4B17A 5J1PA 1L3SA 4CM0A 3MXHP 4Z7CA 1E6VA 1R6YA 3M2VB 1S77D 2K3KA 1AUSL 2J9DE 3G6XA 4EGLA 5KT4A 3EGWB 1IBLJ 2XS5A 1FHTA 4HHUA 1X7VA 4ZCMA 4NLSA 2GMJA 2J9CA 1SC1B 2VF3A 3MEDA 1EP4B 2QLBB 4Y0FA 5D0HA 3PHEA 3UDEA 3DLGA 1HYSB 4OYPA 4ILLA 1X4GA 1UFKA 1XMQJ 1DTTB 2DGXA 2FJVA 2FC8A 4LF8F 3FNNA 5DDOC 1HLWA 5B08A 4EZ9A 2OPQB 2XHCA 2DH8A 1I3OB 3IR7B 2HQFA 3K17A 1REVB 1IKVA 1DQ9A 3IBCB 5D0EA 4F36A 1PBAA 1VHIA 2H5JB 4B3RJ 2B0GA 1CEZA 1UVMA 4EO8A 4PPZA 3R5AA 5KFAA 3GCXP 3GYNA 4IR9A 3M8PA 1WNEA 4GC7A 2FHJD 2YPZA 3H2UB 4ECWA 4PG4A 1HNZJ 2BBEA 3GWCA 3OL8A 4KPCA 5BR8F 4ZS6A 4TQSA 4OZ3A 1QSLA 2ZE2A 4XTTA 2PFDA 3UPFA 1CJUA 1FE0A
chains in the Genus database with same CATH topology
4O44B 1X4BA 1XR6A 4NX9A 4R8UB 3OL9A 3KHLA 3OSPA 2KZMA 1TV6A 2MZ1A 2VOPA 2LEBA 4EYIB 4HI1A 5KFRA 5JVGQ 2BYCA 4YDDB 3IRXA 4HH0A 2AYMA 2L9WA 5IZHA 3N6NA 3BM7A 2AQ4A 1OPZA 2Q3PA 4I68A 4WYWA 2HHTA 3M6XA 1JX4A 4I7FA 4RNHA 2QLXA 2R2SA 2RDIA 3R3TA 2HS0A 3BR8A 4LT6A 3J81Y 1TKXB 2M7SA 4F50A 1NK9A 2DHXA 2B6AA 1FDDA 3HVAA 3NGKA 1S1UA 1NEEA 2EBGA 2HGMA 3O8WA 2UV8G 3P3DA 3IRWP 4X4UA 3RB4A 4Z2XA 4DMZA 3KMQA 3QGGA 4ZP6A 2FJBB 2RF2B 1QUVA 2VG5B 3RYLA 3H2VE 4B9LA 1O5JA 1LWFB 1S1XB 5DETA 1CSJA 1SKSA 2J76E 2QE5A 4BCAA 3MM6B 4F67A 1ZBTA 2VPWB 4EFAC 4A8YA 2UXCF 2DNKA 3DRYA 3C8YA 4ILRA 2CZVC 2FHMA 4MKYA 5EX0A 3TQ1A 2J6TA 1Q8IA 3NRBA 4EYHB 2KFZA 2QA2A 2RMLA 3DLKA 2GNKA 3DRRA 3L7PA 3PNIA 4C8NA 1FTRA 2DNRA 4C97A 2VPYB 1HI8A 3BSAA 3E8OA 2BA9A 2I8EA 3KLGB 4KIAA 3LAMA 3TX8A 2DPJA 2ZUGA 3PVXA 1FKAF 1FK9B 1VQNS 1FEHA 4HT5A 1SC6A 4A4JA 5A2QY 5HL7Q 4J9NA 1NJYA 4V19X 4NMLA 3T6JA 1OWXA 3CCQS 3AA9A 2HVHA 1LOUA 1ZAXA 2MZRA 4E0DA 4E98A 3CDWA 3Q22A 3QGIA 4WCEQ 3TW0A 1ZZNA 4OI1A 2E1CA 2VOOA 4OIXA 4ZCLA 3VALA 2I5JA 1NKBA 2CQGA 4WFAQ 4FVCA 5HMWA 1UWBA 5L9NA 4IQXA 3BQ0A 2Q6CA 5KFKA 5IT9Y 4URSA 5KFGA 3K58A 2HG4A 3UWTA 1M5HA 3MWBA 4H54A 3DI6B 3AB4B 3AQOA 3D28A 4DL3A 1IQTA 1KOHA 4KJIA 1MMLA 1N0VC 3MFHA 2R8JA 5GAEU 4I2PA 4ITSA 2R7TA 3O5TB 1UJ5A 3F56A 4GO5X 4PG6A 5B0DA 4DEZA 1QSYA 2XEXA 4DL0C 2B7BB 4O3NA 3G4SS 1M5SA 1TV6B 3LH2S 1KFDA 3PDNA 2DR8A 5GADI 1SKWA 2B43A 2JEGA 3P49B 1S1VB 4QIFA 3DFEA 2QLWA 3JSRA 4PXEA 2RQKA 5KFNA 4ZPVR 4N56A 1U1OA 1NK4A 2J7WA 1CC8A 1U8SA 3FVYA 2VUGA 2CG4A 2C3OA 4OZ0A 5D3GB 5KT2A 3NCPA 3JYTB 2HGNA 3DRPA 4ZVHA 2EW9A 5K9FA 5D8HB 2HHPA 2VG7A 2DB1A 2HLUA 3OR1B 2Z4PA 3NAHA 4NZ0A 4WXOA 4ZPBA 4DL4A 1XEZA 3OHBA 1K8AT 3QJLA 3WC0A 4IR1A 4J9KA 4RW7A 4CIOA 2JLEA 3OVAA 1FKOA 2GQCA 3I5AA 3RZAA 4K4WA 1SL2A 1JJ2R 3V6DA 4DQQA 4DS4A 3MI7X 4UQTA 1S4FA 2HAIA 1T3OA 3GYXB 3FEXB 1LXJA 1T02A 5DM6Q 1HNVA 3EGNA 1HBMA 2YNHA 2FC9A 1UVLA 3JSMB 1SL1A 3MOJB 1S9EB 5KG3A 1OIAA 4MJKA 1VRUB 3GV7B 1V3ZA 2DNQA 2OTJS 4G1QA 1P1LA 1JLQA 4ES2A 4RW9A 2W24A 3OL7A 3I0SB 1TAUA 2NXUA 2JHEA 2L9DA 4KFBA 5FD1A 3DLEB 3IG1A 1RTIB 4ELTA 2W9CA 1ZAWA 3BR9A 5AE2A 3T6BA 3NMRA 4LF6F 3PJWA 4IYQA 3S01A 1A9NB 1FNMA 4C4WA 4EUVA 1SI9A 4RU2A 2WSFC 3N5BA 2R8HA 4AYBD 1RTDB 1JMTA 3VAHA 2PA3A 1I6JA 1IKYB 4OLPA 2RIJA 2I0XA 2ZHOA 2V8DA 2LLZA 2RNEA 1TVRB 1HHTP 4ELVA 1UWBB 3G96A 3GIJA 4MKAA 5HN0A 2J7UA 3TR5A 1Q4RA 2ALZA 1JXEA 4HDGA 4DSFA 1VRTB 3MTKA 1D8YA 5J2NA 2ZZNA 4C7QA 4XDDA 2BANA 2X1AA 4ZPDA 1VQ7S 2MSTA 4BC7A 4NYOA 4C0OC 2Z2LA 3E01A 3VCDA 2AJ0A 5C25A 4DX8H 1SIWB 3V4MA 3EYZA 1C1BA 5F9LA 1ULRA 2GMLA 2LEPA 5F0UA 5B0CA 5KT5A 3BQ2A 2RU9A 1IJEB 3AB2B 2RE1A 3NKYA 4IOCQ 3OSNA 1MMDA 2OD6A 5HMZA 3OLAA 4J9LA 5LXRA 1B0PA 1FRXA 4XK8C 3M8QB 4K4SA 4O3QA 1F9FA 1KC8T 3JTOA 3KG1A 3BB5A 3B82A 4QIGA 1E6YB 2ROPA 2QMXA 1SUQA 4NXMF 2BACA 1TKTA 5DQIA 5KFDA 4A8MP 1U24A 4NZ6A 4DFJA 4DR7F 2MDAA 1NH7A 2FLOA 3LPYA 2M8DB 1UKUA 2XS2A 2W8KA 4ZPCA 4AL7A 1RT7B 3EPGA 4ZVEA 2VG7B 1KQSR 1FJEB 1F2GA 4KGKA 2G4BA 2WK4A 4OMFG 7FDRA 2XG8A 1Q86T 2GV1A 4LFBF 4LF9F 4PQUB 3CCES 3HLUA 2MKKA 5I3UA 1VBZA 4ID8A 3L95X 1HW8A 4DN9A 1LW0A 1VLYA 3ENQA 3BSNA 3CCUS 2VC1A 2DBBA 5DLFA 5CYQB 5F8GA 3OJUA 3T5HA 2CVEA 4MMOA 1H0HB 2CQ2A 5EDWA 3RB6A 4QOTA 1WEXA 3M1VA 1FRIA 3MM5A 3EUNA 4MTPA 4C8OA 2DCUB 4EBEA 4N77A 5KG5A 4RNOA 4WXWA 2OPPB 2XLIA 4ICLB 3WC2A 4MFBB 1S6QB 3LQVA 1N88A 2Z8QA 3S1TA 2A10A 3KLHB 2KH9A 1R8CA 2KO1A 2DHAA 2J8AA 2W7PA 4WE1B 3IG1B 2RS8A 4N8OA 3C3LA 3FJ2A 1NH8A 1BY9A 2XMMA 4X4RA 2DH7A 2VBWA 3MEGB 3HKWA 3QYYA 3IS9B 1JLFA 1UL3A 4YR0A 3TI0A 2AJ1A 1WTFA 3MECB 1SIZA 4RBTA 2AYGA 2C22A 3FEZA 5F41A 1T3NA 5K8NA 1B0TA 1Y5NB 2I9SA 3ZC4A 3VAJA 1U1NA 4J9MA 2PA8D 2V8GA 1D3WA 4RW4B 1YHQS 5KAKA 1O0PA 5L1IA 1FJGF 1VIOA 2DVIA 1JLBA 2DGQA 5DDPC 5J1EA 2DGSA 2MZSA 3DDNA 5DG8A 3V81A 1FXLA 2E1MC 3GSDA 3MOZA 2MZJA 4DG1B 2M8HA 2FLPA 1H2TZ 4LQ3A 2KDOA 1X8DA 4EBCA 1HQUB 3DYAA 1H2UX 2M52A 3DHWC 4NPOA 5KTQA 4ELUA 1MMNA 3PW7A 3EZUA 2ACYA 3P5TL 3SCJE 3KTQA 4O23A 3N5FA 3V6HA 2VBZA 4OI2A 4F4YA 4JI3F 5KFEA 5LSOA 1Y5IB 3OFEA 2L08A 2LQ9A 4ZPTR 3NLCA 1A7GE 3VZHA 4QU6A 2OPSB 2HMIB 3SYZA 2RS2A 4DQRA 1K1QA 3MPWA 3O6QA 1TQLA 1WI6A 2RQMA 1IKXB 2UZAA 1GTHA 4TYAA 2Z0GA 1JJHA 3CIMA 1UVJA 3HHLD 3KWMA 4PRFA 2MQPA 1HW9A 4DR1F 2E44A 2M2BA 4R0JA 1NKCA 2L3MA 2NREA 4ZVFA 1UEVA 4C9DA 1J5OA 5J2QA 1R31A 2KRBA 1U49A 2EI5A 1I94F 1YJRA 1C4CA 1B0VA 1LW2B 3JTPA 5A8WA 1C0TB 4ES1A 4FNIA 1KN6A 4ID5B 4CH0S 3TANA 2B51A 1UJ4A 5IQQA 3NBPA 1JLEB 1S9GA 5LXYA 2FD2A 4TNOA 3LF0A 3CC2S 1FESA 3I4PA 2WTFA 2Y1JA 4ALZA 4I6AA 3KK1A 2J5AA 3E2EA 3NP5A 1EETB 5CZXA 2CQDA 1T05B 4IG0B 1AXQA 2XMVA 3OHAA 4JBCA 2E7WA 1NJXA 4TU7A 1KRPA 3M2VA 1JLCA 2CQHA 5IQ6A 4Q8EA 2D9PA 2AYBA 3RRKA 1NJIT 5GAHU 4O4GB 2DNOA 5F8HA 1GXUA 4OHYA 2AYEA 2R2TA 3MMJA 2IM3A 3OVSA 1S6PA 3QAUA 3Q8PB 3BDPA 4DQPA 2KYZA 3AH6A 2VD3A 3M30B 3GFZA 3RB0A 5EUHA 4C0BA 3H4DA 1TKZB 1H6KX 2LQBA 1DARA 2W4CA 4ZCIA 1IJFB 2BQRA 4B9MA 2XY7A 4ZPWR 4RUAA 1XR7A 2IMWP 1FRKA 4KE5A 4IOAQ 4ZCKA 1U25A 2F8HA 3C6UA 2OPRA 3MUMP 2KB2A 3KNGA 4ZP8A 5KFCA 3LGNA 1T7PA 1JB0C 2SXLA 1D8ZA 1EP4A 3FCHA 4OHZA 4DHVA 2ZH2A 3M32A 1U2FA 1HNIB 4UW2A 3LOUA 4CO4A 4C98A 2CZ4A 3TAMB 2IAJB 3GB0A 1S1TB 1K1SA 1HYSA 1R8PA 1UMJA 3PV8A 4R5PA 4CO2A 2MKIA 1P6TA 3TA2A 4HKQA 1RK8A 1DTTA 1YJUA 4H4OB 1FDNA 5JUMA 3I31A 4NLOA 1S76D 3TRGA 1BC6A 1CLFA 5T7LB 2R4FA 1C4AA 1GNKA 3HZGA 1R7IA 1Z4UA 2OPQA 4FP9A 2Y0SD 5KFIA 2Z2MA 2VKZG 3B4DA 3UD4P 2UV8A 1YJVA 2XMTA 4M8LA 5C5JA 4QWCA 2BQUA 5J2QB 2CYYA 1REVA 1SB6A 3HT3A 1LK5A 2GMHA 4WFZA 2HWHA 4A8OA 1C1CB 2LXFA 2R2UA 4X4NA 3RAMA 4RNMA 3DMJA 2EK6A 4A48A 2YX4A 3MZIA 3SFGA 4GMKA 1WG1A 2O1PA 3FSXA 1VQ4S 5F8LA 3DLLQ 2IBKA 3OR2A 3PM9A 4AQYF 2NZ4A 2O67A 2OIHA 2PI4A 3BO4A 3V6JA 1WHVA 1MWZA 4RWXA 3GILA 4FS1A 4JI8F 2YVSA 2LDIA 4PCQA 2GW8A 1NHVA 4TQRA 4KKOB 3QO9A 3CJKA 2MQLA 1V3SA 1RT2B 2ZITA 2RH3A 2YTCA 3GQCA 5AE1A 3CF5Q 4PXCA 2W9BA 5FDLB 3MMAB 1HBNB 4ZKAA 4CNYA 3GV5B 4B02A 4WFNQ 1R8BA 5FJ4A 3VAGA 3V5RA 1JLAA 3PKYA 5K14A 1ZETA 5CH7B 1N6QB 4FF3A 1L5UA 1X0FA 2FGCA 4QYZJ 1HI0P 5LL6d 4DWIA 3W7BA 3MHYA 4J5OA 4F3MA 5I42B 1XTZA 1VBXA 2OAUA 2QEXS 2KZZA 2GFFA 1GXLA 1UEUA 2EFOA 2FJDB 1TP7A 3R27A 1U1QA 3HJFA 3MMBB 3J7Z5 3SDEA 2HHXA 2B9WA 4FBTA 1Y4ZB 1M5VC 4RNNA 1YJNS 3QWUA 4AXIA 3THPA 4ECRA 2G0CA 1N4LA 1YIJS 3I6PA 4O44A 5J2MB 2GO9A 3WBZA 4JI7F 4R8UA 4JI4F 4FXDA 4Y65A 5IT0A 2GCFA 4ZP7A 4PUOB 2Q66A 5K8PA 2OSRA 2J0XA 1X4EA 2PMHA 4CNZA 1HWJA 3U27A 2ZJRQ 5KFVA 1RT1B 2VC0A 1OSCA 3SFUA 5C42B 1H3DA 3HHEA 4Q0BB 4TKTA 4YR3A 1G3OA 2IM2A 2J7KA 4I69A 3HZEA 4QWEA 3O3LA 1TKXA 2B4VA 7FD1A 1DHMA 2HPUA 2MY7A 2CQ1A 2Q43A 4X4OA 1S0VA 2JX2A 1KHVA 2HFZA 2ZKTA 4DBQA 2QFJA 3NS5A 3OVBA 3CO9A 3FFIB 1TFWA 2JFKA 1KSPA 3D1OA 1L3VA 4ZA1A 3M9OB 2IVMA 1G1XA 3JAMY 4BWJA 2HYIB 4YOEA 4B9VA 3OTOF 1NNDA 2RF2A 2CJBA 3AY0A 1VC0A 2VG5A 2EG2A 5AE3A 1KFSA 2OJ3A 1LWFA 4X62F 1S1XA 2XNRA 1N32F 2A2CA 3MM6A 3DOMA 3I5BA 4CO1A 2LDYA 2KT2A 4G3IA 2D3ZA 2FLNA 1S9FA 3M4XA 4Y2CA 4FPRA 2X1GA 1UJ6A 2LXIA 4NLXA 4F26A 2W8LA 2P6TA 2X1BA 3LP1B 2JDJA 5IM0A 2ZH4A 1VC5A 2LU2A 1WF0A 2YKMB 4J9QA 2MKSA 5KG7A 2EC0A 3RR7A 3I56S 3KLGA 1N8RT 5LSLA 3V4IB 5F3ZA 1WF2A 2CRLA 2CQ3A 1YJTA 1U6ZA 1FERA 1FK9A 3BS9A 3GIKA 2ROGA 3KK3B 4OL8A 1MWYA 5L8RC 3PEJA 2KM8C 4OZLA 2VFSA 3IBWA 1TUVA 3CDUA 5G0RA 5K14B 3H40A 3KK2B 2V4RA 3DLHA 4DV2F 4TN2A 2HNYB 5KFMA 4NLRA 4ZHRB 2PC6A 3LP2B 2HW3A 2VKRA 1PGZA 3HHLC 1AUDA 3PIOQ 3HO1A 3FMBA 3T5JA 1U4BA 4B3SF 4FF1A 1KHWA 3DI6A 1TKDA 4H4MB 1RT6B 2MJUA 3H98A 2A18A 3ITHB 2H5EA 4ED5A 1B7FA 3ZZPA 2V5HG 1QVGR 4K4XA 3LW5C 2WSEC 1VI7A 5SUHA 2E5HA 2KTQA 2VG6B 4WKYA 3M2UB 5D78A 1KLMB 3M9NB 1WHXA 1LWCB 1F60B 1V3RA 2GIRA 3PRBA 2A1BA 3VWSA 1RISA 3D1QA 1U26A 1HMVB 1S1VA 2O5DA 2RB7A 1BWEA 4IO9Q 5L1KA 2J0QD 3GIMA 1RKIA 1GTEA 4XIUA 2YY3A 2PI5A 1SJQA 2UVUA 1IBMF 2HFNA 5D3GA 2M70A 4DL6A 2CQIA 4P7TA 3IWNC 3OPKA 3JYTA 1K9MT 3PX0A 3G71S 2AJ4A 3T5LA 3KG4A 4NRUA 2P9CA 3K7RA 3OR1A 2DR7A 5DO2A 3RRGA 2MZQA 2CPYA 3K57A 2BDPA 2DGWA 3PX6A 3LO3A 1YQHA 3CD6S 4G1PA 3HP6A 2ZH3A 2IM0A 3DN9A 5L38A 4K4UA 4ZPAA