4NXNF

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nxnF00
4JI8F 2ZM6F 1HNZF 4X62F 3ZZPA 4DV3F 2B7BB 1IBLF 4LF9F 4B3RF 4JV5F 4LF4F 4B3SF 4B3MF 4NXMF 2UU9F 4B3TF 4JI0F 3OTOF 2RJZA 5AJ3F 1IBKF 4JYAF 1G7CB 1J5EF 2UUAF 4DV5F 4X65F 4JI6F 1FJGF 1F60B 4DV0F 4YY3F 1QJHA 1N36F 1IBMF 4LF8F 4DV1F 4JI3F 4LF7F 2HHHF 1LOUA 1RISA 2YY3A 1HNXF 4DR2F 4NXNF 1IJFB 2KJWA 5LMUF 4DR7F 1HNWF 4GKKF 4DR1F 1N34F 1HR0F 1XNRF 4JI2F 4DV4F 4LFCF 4DV2F 1VMBA 1N33F 2UUBF 4YHHF 5LMNF 4DR6F 1B64A 4LF5F 1IJEB 4OX9F 2VQEF 4AQYF 2UUCF 4DR3F 3R3TA 4X64F 4K0KF 2E5LF 2UXCF 4DV6F 3T1HF 4DR4F 3T1YF 1G1XA 4KHPF 1N32F 2BVZA 2F4VF 2J5AA 4LFBF 4JI4F 4DUYF 4JI7F 4LFAF 4GKJF 2UXBF 2UXDF 4DR5F 1XMOF 4DUZF 5IWAF 1CQNA 2BXJA 1FKAF 1XNQF 4X66F 1XMQF 4DV7F 2KJVA 5BR8F 1GH8A 4LF6F 1CQMA 1I94F 4JI5F 2B7CB 4JI1F 2VQFF
chains in the Genus database with same CATH superfamily
4WP9A 4DL0C 3AQPA 3CC7S 4DWIA 5LXRA 2ASJA 2R2TA 3OVBA 2QTWA 4AD6A 1HNZF 3OR2B 1FRKA 1NM2A 4YB5A 4YEAA 1PBUA 2KL8A 3LP2A 4A48A 4QIVA 5C2GA 3EYZA 3TJ8A 1S1UA 2OPPB 2MQ8A 4NL5A 1C4AA 3LUYA 1HBNA 1RT2A 2XHWA 4L75A 5T7LA 3U27A 2YWEA 4QR1A 1LQ9A 1BQMA 2V4JA 2FHKA 4HDHA 1W2IA 2Q43A 4ED7A 1LXNA 1NJZA 4KB7A 1KNZA 2X1GA 2GHVC 3IO1A 1U6FA 3PW4A 3MAAB 1HARA 4WK1A 3HD2A 4FP9A 4HDGA 3DLLQ 1HWJA 3NCRA 4KO0A 1EKRA 1G4CA 1X4HA 1NB7A 4MKYA 3MM5A 1S6UA 5C25A 4MKVA 5K14B 4O3SA 3PACA 1FRHA 3GFXA 5EGYA 1FF2A 4Z7CA 4K5RA 1AFJA 1N56A 2MKSA 4J9PA 2OFGX 5EWFA 4PQAA 1VK8A 4PXBA 3W9IA 4ZDNA 2OPSA 1R7IA 3MTJA 3VR1A 5F9LA 1HYSA 5B7WA 1JLQB 1SJQA 3OFHA 3UR0A 2ZNZA 3EE3A 4KY3A 4ES3A 4U8VA 3T5KA 2R4FA 3N79A 1NJYA 4OX7A 3CJKA 2B5JB 4CLZA 3THVA 1RYSA 4FS2A 2LXIA 4FYVB 3R7NB 4KHMA 3G8TA 2NZCA 1NKBA 2LU2A 1FE4A 4ZPWR 2HIYA 1NH8A 3U02A 3P8BB 1VFJA 3UD3P 1U2RA 2LDIA 5LMUJ 1EP4B 4HH0A 4ZPCA 1KQFB 2HHPA 3BB5A 3BO3A 5I3QA 1IBKJ 3KLGB 2Q66A 3TVYA 4ZJLA 1RGVA 2VV5A 2VFUA 3POTA 4J9QA 3X1LB 1A9NB 2J76E 3TNVA 4CLLA 3GSDA 1RT1B 5D4NA 4X84A 1SL0A 2E1PA 1TL3A 3DDIA 2ZHOA 3A8KA 3LP0A 1Q95G 4A8SA 2BV3A 3QT8A 3AOCA 1VHFA 4RBVA 1RK8A 4NRTA 4O3NA 4LVOP 1IBLJ 2FJVA 1SPBP 2AWZA 3N28A 1NPKA 5G0RA 3TZYA 3M2VB 1RT6A 2VQEF 4PABA 5KT6A 2GO8A 3DM2B 1QAXA 3BDPA 3W5ZA 1DZ5A 3BO4A 4F4AA 3A8JA 5KAKA 5D8HB 3KHLA 2DGVA 4DL4A 2RNEA 2CWKA 3GPAA 2E5GA 1FWLA 1AZSA 3EGVA 5ETKA 2I6WA 4TNOA 4CLSA 3KK3A 2GJFA 2ZM6J 2JEGA 4FBTA 5J1PA 1AB8A 5A6WA 1KLNA 4FYDA 1JLAA 1JWWA 1YJRA 2J9DE 4P75A 3I31A 2BVZA 3QWPA 4J9OA 3GE9A 1X0FA 4NXMJ 2ATLA 3CWJA 4OJGA 2RRBA 3M8PA 4LFBF 3HI9A 1FKOA 2G0JA 2HLTA 4LFAF 1XN9A 2R42A 2V8GA 1BQNB 2DIVA 2KU7A 3MCNA 4K2XA 4O4RA 4YQWA 5L1KA 3K17A 3CCRS 5L9NA 1CQNA 1TR0A 2QG9B 1JLEB 3W8GA 2FVQA 3KJNB 1R3NA 4QIWD 1S7IA 3GMGA 2F63A 3MECB 5IQQA 1UVLA 3HHEA 2B4OA 3DHXA 5C2CA 2HAIA 2QE5A 4JI3J 3RGIA 4C97A 5BR8J 4OI6A 4RJVA 4LF6J 1DLOA 2YH0A 4ZOSA 4ZCIA 3D3BJ 4LBPA 4B3MJ 1JQGA 1WC3A 4LRCA 1S9EB 1MSWD 3GV7B 4USMA 3CCWA 3N0VA 3M2RB 2BQUA 3BSNA 4QU6A 2IMOA 2DNYA 2RS8A 5KFVA 5KG7A 2VZ9A 1NK6A 3DRYA 4C2MA 2E5LJ 4PUOA 1LXJA 3PJWA 2VC0A 4ZVHA 3CDEA 4CLPA 3UWTA 2Q3PA 4DDFA 2HMIB 3K0JA 2OEMA 1VBZA 5I42A 2ZJQQ 4W90B 4BDPA 3GIJA 2VG6A 2CUYA 2W2NP 4O23A 4A46A 1Q4RA 2Y1JA 4WFYA 1WOPA 2RF2B 4IOCQ 1UVJA 4HTJA 5LMNJ 1VRQC 2WSCC 4HHUA 3DRSB 5GMDA 4O3OA 1FWKA 2W9CA 2C22A 3FGVA 3VAGA 1K9MT 3DI6B 4Q2LA 1KR4A 3DRPA 2HBQB 4PG7A 3TVKA 1I94J 2GFFA 3UFCX 4GRSA 4ZN1A 3DU5A 2GA7A 5K14A 2ZBPA 3TO8A 1GAOA 1RA6A 4WIIA 1QSYA 2W7OA 2YKNB 3MM9A 1RWPB 1WHXA 1UMJA 1T3NA 2OTLS 1O51A 2DNQA 3R5GA 1G7CB 5D15A 4QBUA 1NJWA 4URGA 1UFWA 3M6XA 1J5EF 5CXTA 1RDRA 1WOOA 3N6LA 3NNHA 3E01B 3AXMA 4DQQA 1FCAA 3PFOA 4RNOA 1OYDA 3PYEA 1C0UA 1NUEA 4OX9J 2IPOB 3DOLB 3JSYA 2DK2A 4BC9A 2CQHA 2Y0BB 4XAKA 2Z2ZA 4DPUA 4U7UK 4OHZA 4DV0J 2VKZG 4RW9B 2UVUA 1NU4A 3NOCA 4KC5A 5B0DA 4U9RA 5CYJA 3PV8A 1U6BA 3RBEA 4KPCA 1UKUA 2VDHA 5HK4A 2V94A 2V63A 4M5MA 1WKJA 3IXQA 1IVZA 1HNXF 1PYTA 4LFCJ 3WHIA 5KFDA 2CNOB 4M5LA 1RKJA 3KWMA 2LYVA 4DF4A 4PWDB 2H5EA 3L95X 4PG8A 1H2VZ 2QV6A 3GV8B 2AJFE 5BYQA 3SIPB 3BV8A 1LWCA 4DI6A 2IRXA 4M1KA 2HFZA 1GFWB 2BX6A 2FJDB 1SIZA 2RIJA 2CJBA 1S1WA 4Q44A 1NHUA 4G65A 1Y00A 2DY1A 4RZRA 2UUCJ 1VBYA 1KWMA 1RT7A 3GR0A 2B0GA 1PYOB 3DLGA 4DS4A 1U1KA 1T9VA 2V8DA 7FDRA 3MD1A 2MZQA 3PCOB 1HFEL 2QL9B 2HQCA 4AUKA 5L46A 2IHR1 3VAKA 3PEHA 3MPVA 2OHDA 4B9UA 1VQNS 4Y2MA 4I2PB 4P2XA 2HWTA 2M70A 1X4AA 3HHDA 5KG5A 2OLWA 1OQ6A 1RCXB 3ETMA 3V5RA 4JV2A 1AUSL 1SIWB 3ENVA 4W92B 3W5YA 3FCHA 4KHPF 1XQIA 4BBYA 4FF2A 1B99A 1N0UA 5JXSA 5ETNA 1UFLA 2FUG9 1WF2A 4NX9A 1YZ6A 3L7UA 3M30B 2CVIA 4NLQA 4QR2A 3OL6A 2HMIA 1GMVA 1X60A 3FDSA 4HACA 3SV4A 2YH1A 4WU3A 5EHHA 4MK7A 3VVTA 2FLLA 1NMEB 3PFEA 4ZPTR 1TFYA 4GO5X 5KT2A 3PDNA 3V6DB 2MLYA 2R9LA 1RLDA 4OYXA 3PO5A 4IRKA 5ETPA 2LEBA 3BBFA 3ILLA 3HX9A 3KLVA 4X66F 5J2MA 1C0TB 4ED4A 2UUBJ 1PSDA 3HO1A 3MMBA 5KG6A 1RCOB 4RBUA 2FJXA 4WFAQ 5E7OB 1HI0P 1RT4A 2ATCB 1S9GA 1N5QA 1VBKA 2UUWA 4OLOA 3N01A 3GIKA 1NK4A 5D4LA 1WTFA 2KN4A 3V2UC 4R5PB 3CMQA 4B9VA 2HKEA 3NEKA 2XSJB 2WVCA 3T5JA 1L5UA 2R8IA 4JYAJ 1N88A 4L6V3 5IC4B 1F9HA 1YRTA 2YNHB 3I4HX 3JXOA 4IYQA 1S1WB 1S6PB 3AB2B 4OJ3A 5EX3A 3MUMP 3CCMS 2G4BA 2NXEA 2OKQA 3AD9C 1MN9A 2B7BB 3CO0P 1I1GA 3U1MA 5DG7A 4C8OA 3O44A 3J7ZT 2VG5A 3VCDA 5D3GB 2WOMB 5JVGQ 4RNFA 2NYHA 5B0CA 4NXMF 3HZGA 3OTEA 3UPFA 4C3LA 2CIMA 5HP1B 1FD8A 1H2UX 4ID5B 3ZO7A 4U8YA 2ACMA 2FY1A 1S10A 3L9ZA 3OVAA 1RQ0A 2H65B 1EB0A 1X4FA 3DGPA 4WYWA 1K73T 5EWGA 2FZCB 2LFVA 4USKA 3SBMA 2MXYA 3EVOA 3ZZTA 3EZOA 1BUXA 2C3MA 2AYEA 3BYPA 4J9VA 2RT3A 2DNGA 2QIFA 4OYWA 1ZBTA 4DV2J 4KPYA 1QD1A 3C14B 4X65F 2PO4A 2ZZMA 2WB1D 2HHWA 3CCSS 3OVSA 3C15B 3OSNA 1RHJB 3PHEA 3LAMA 1NCLA 1MU2B 1WNEA 4NZ6A 5ETSA 1L3VA 1YRXA 4LUBA 4DQPA 1F2GA 5CQGA 1HMVB 2ZFHA 3SMZA 3BS9A 3HM9A 1TKZA 1DTQA 4LF8F 3HK2A 1QM9A 3AJ1A 4IDKA 2HHHF 4Q8FA 2IA6A 4P2SA 2V2ZA 1OPIA 2G13A 4OI3A 1S12A 1S1VB 4B3RJ 4RNNA 1IJFB 3SDEA 3UDLA 1S7HA 2OSQA 1ZTWA 2HVIA 1KHVA 3H5YA 3Q0AA 4H4OB 2XYHB 1TU0B 5G4DA 3QPIA 2B6AA 5DGBA 5IOLA 5AJ3J 2PEBA 3I0SB 2VQFF 1LW2B 1OYEA 2ZBRA 2M3DA 2QA4G 4WIQA 3TX8A 2FQQB 2CJYB 4BC7A 2B9YA 4MFBA 3LWMA 4QIEA 2BA9A 4QWBA 3B78A 4DCOB 1U47A 4B9SA 1NZAA 2UV8G 3CD7A 2ERRA 3DLHA 2R7TA 2J0XA 2LA6A 2LCWA 2IC3B 2ZEJA 2HQIA 4GMKA 2ZH5A 2E9TA 1AXQA 2J8AA 2WW8A 2MZSA 4FXDA 4A47A 1GMUA 4DLGA 3TAQA 1FO1A 4DLEA 1SC4B 4USJC 4Y3CA 1IKVB 2XQCA 4Z7YA 2ZOFA 3DLBA 2A0FB 4QWAA 2J7UA 1X4GA 3FZBA 1DQ8A 2PMWA 3E01A 3ZZZA 4ECUA 3D66A 2KHDA 2OEJA 2FJBB 2EFPA 2EG1A 2Z8QA 3DOKA 4OI1A 3OTOJ 5LSOA 4DR4F 2FY8A 4DPXA 3CMAS 5HJYA 1NHVA 3FSIA 1U02A 3DC2A 4KO0B 5THWA 4RWWA 1F5BA 4LQ3A 4DL7A 1L3UA 2V67A 1DAXA 3C8YA 4Y34A 2DR7A 3PKYA 3W63A 2HSEB 2DH9A 2V9KA 3BDEA 4UUXA 3M30A 2XMKA 4O3QA 4A4JA 2RQCA 4LR9A 1VQ5S 1K0VA 4UOHA 2COLA 3DRPB 3JAMY 2HNZB 4X4UA 3IS9A 3PYDA 3FCVA 3R5JB 1BGXT 3LTOA 2ZH2A 3JTPA 1A0OB 5I3PA 4KIAA 3CJ0A 4CI0B 5HMYA 4ECTA 4DQRA 2RF2A 1H38A 2Z4PA 2Q6BA 1UFKA 3KLEA 3OFEA 3TAPA 2HHUA 4OV6A 5E33A 2V9WA 1O8BA 1HW8A 1RP5A 1N36J 1RAIB 4B3OB 1VC5A 2RKIB 2VQFJ 2JX2A 2YNGB 3PRDA 5SUHA 3SEOA 4EU0A 1C2PA 4HT7A 2C3YA 4PAAA 3PJ9A 2HS3A 1RWKB 2ZHBA 1APSA 2VG7B 3FBEA 3NCQA 1MMDA 2M7SA 1U8WA 5KG0A 1HPZB 2NLWA 4KGMA 4DX6A 3L3CA 1BWEA 1GK8A 3O6QA 4NPOA 4W4MA 1N48A 2QZ8A 2DB1A 2M4MA 3HULA 3MPUB 4RPFA 1HNIB 5LT5A 3EICA 1KHWA 4J9NA 4N41A 3I0RB 2IYIA 4M95A 5C24B 5M2UA 4O44A 4B02A 4M5DB 1VJQA 4QW9A 4PWWA 5DDOC 1X31C 1FERA 2K1RB 2OFHX 2F9DA 3OFFA 1VQSA 5DRKA 3KLIB 4CM0A 4CRJA 1S76D 1YI2S 1HWUA 4TVAB 4M94A 1YBTA 3I5BA 2VH7A 1REGX 2KKHA 5GADU 3SZ2A 1S9FA 4RWXA 2W7AA 3FVYA 4NOHA 1C1BA 5GVQA 3TARA 2F9JA 2DHGA 1VRTA 1WEZA 1TL5A 4N8OA 5DDRC 1C1CA 3V4IB 2R7QA 3D7SB 1WC5A 1DY3A 1SL2A 1D8YA 5KFOA 4V19X 1S6QB 2MJUA 3DLKB 4F3QA 3WX8A 5A8WA 2CZVC 4OYOA 4C9DA 2ZC3A 1V5VA 4MIBA 4K2JA 4CT8A 1UJ4A 1SVDA 4LSZB 4JI6F 3CCJS 3T3FA 3R6GB 3BSCA 1FTCA 3Q8VA 4CIOA 3KK2A 2VOPA 4J7CA 4DV0F 5KFSA 2GQQA 4B08A 4AL5A 1UEUA 3D0GE 3JTNA 2H48B 2BJ7A 2YNFB 4FYWB 4NLYA 2BW7A 2Z30B 4EO8A 3MM9B 3GIIA 2A6OA 3GCXP 1P9YA 4YY3F 1OJ4A 1YJVA 4CLFA 2MDAA 4F4ZA 3C6UB 2VUGA 2OEKA 2GAHC 4NYPA 2X7IA 3PIOQ 1KRPA 1KN6A 3D4JA 2VOOA 5CYMA 3DGVA 4DR3J 2HG4A 3I9V9 1LW0B 4OYAA 4NZ7A 4I4BA 5LJ5Y 4C3KA 4V19J 2GV1A 1CBKA 3TAMA 3AQOA 3OJUA 1R27B 1F3FA 4EYHB 4EGLA 3H4BA 2I2YA 3R5AA 1VI7A 5GADI 3K5NA 3EX7B 1T05A 4OHYA 3MUVP 1QUVA 1T9YA 5KFIA 1N5SA 2JOQA 3CDWA 4H54A 4YDXA 2L3MA 1GXLA 1HYSB 2CG8A 3LPYA 3PR5B 1IXKA 3RBDA 4X62J 4KYZA 1WDTA 4IDKB 2ZOGA 4ZP9A 4KBIA 5KFCA 5C24A 5HLFB 1MG7A 1XMQJ 1NLKL 2BACA 3MPWA 3CIZA 4JV0A 1TL1B 2DGUA 4MAKA 4OFZA 3G96A 2JC1A 1RBLA 2VC1A 2L9DA 2KZMA 4PEOA 2R2UA 4JV5J 2H4YB 3D1HA 3WC2A 1H2TZ 3JQKA 4TU8A 4KHPJ 1QY7A 2GJ2A 4KGXB 3CULA 2XWYA 2CQPA 2AEFA 3ZZUA 3PW0A 1NSAA 3HPOA 1EETB 1FA0A 5H9FJ 1KFDA 3M8PB 5IT4A 4CCHA 4C8LA 5EN1A 2HGNA 5HBMB 3EGNA 1UCNA 4F4KA 3ZZOA 2V8VA 3UDEA 3KMSA 3GCWP 2VFTA 3CPWR 2PMHA 3GP9A 2CPHA 1RHKB 3IWXA 3OFGA 1WG4A 4JI1F 2GCFA 3NS6A 2JZ5A 3K5MA 2ZBQA 2ZKUA 2HRTA 2IAJB 1TL7A 1S0NA 2GVZB 4F3MA 3KUGA 1I51B 4Q8EA 2YKPA 5F0WA 1FK9A 2DITA 2MZTA 2QMUB 3C3LA 1S6OA 1RAEB 4CH1A 3HXMA 4PG6A 4PWDA 1B7YB 3HT3A 3LQVA 4HL9A 2Z57B 2XULA 3D28A 1T8EA 3P49B 2QT7A 2YNHA 2HNDB 2EFNA 4HR2A 1NPRA 1RT1A 1RB0A 2AHOB 3QNWB 1NK5A 4KJIA 1CJVB 1HMVA 1HL6A 2OMOA 2BOPA 3RW7A 3NS5A 1JLBB 3D6FB 1VK3A 1WWHA 3QGHA 2JEFA 2CQIA 3C6TB 3MEDA 4K50A 3KLGA 3W7BA 4RW9A 5LXYA 3JSMB 2AGOA 2HURA 4QU7A 2CKWA 2LLZA 2YWGA 4HLBA 4KH1B 3CCTA 1RT4B 2U1AA 3C16B 1J2VA 1ULRA 1IBLF 3N6NA 4O4GA 4JI7J 2K3IA 2ALYB 4ER8A 4B3OA 2VBYA 2UV8A 4LSNA 3HSDA 3W66A 5D0HA 2MKKA 3TUPA 4M5HA 3FMWA 4P7TA 5KG4A 4C0HA 5KOXA 1XEZA 1H0HB 1EX8A 3LA0A 4G1QB 1JLCB 1XBWA 3DLEB 3KJQB 5D0GA 4DG1B 8RUCA 2VDIA 4LT6A 1X5TA 2QLXA 4EZ6A 1R31A 3DU6A 3QJJA 2R7SA 1UEVA 2HGLA 2POKA 3ZNJ1 5K8OA 3KTQA 3TA0A 2FHJA 2HHVA 3P4UB 4KE5A 3MR5A 2OGUA 1JMTA 4ED8A 3WIUA 3CO9A 2C1EB 4QIGA 4DL3A 5J2QB 1U25A 3N6MA 1EHWA 3TQEA 5MAOA 3AXKA 1PJ6A 4DG1A 3BEGB 2UVRA 3J7YI 5K20B 2ZDOA 5D6GA 3IM9A 4JI3F 4MT1A 1HA1A 2W2MP 4H4KC 4NEZA 2DRAA 1VYAA 2OD4A 3DMJA 3ITHB 1F2HA 3Q8YA 4LBHA 2AF6A 2CPEA 2FLPA 3RRGA 3MMAA 4NXNF 4OX8A 4DR7F 3KG0A 1HBMB 3J7YU 1QVGR 1HD0A 3RJMB 2CZ4A 2XNQA 3GWCA 3JQJA 2KHCA 4KR0B 4CO2A 2R8JA 3FEZA 1DLOB 2W2OP 3OTDA 3T9NA 3LGHA 4ZHRA 3GV5B 3UO0A 2RILA 3FFIB 4HI2A 1U49A 1IWAA 1LK5A 3OUYA 3KHRA 1SC3B 3PKMA 3NGDA 1FXDA 5K9FA 2CNLB 3UVJB 3CDBA 4M63A 2WSFC 2JJ4D 5LMNF 1YX2A 2MLXA 2XC9A 3MGJA 4OI2A 3G6VA 4JV1A 1B70B 1VIXA 2Z58B 5B0FA 3FFIA 5T41A 3CDUA 1R6VA 3THPA 4CNZA 1HQUA 4RW6B 5KFBA 5DDPC 4EK2A 2YQ0A 3M1VA 4Q45A 3AJ2A 3D0IE 4IOBA 3UI3A 1VRUB 3QZ7A 1UP1A 1UL3A 4CO0A 4YP3A 4I6WA 4USUA 4D3HA 3T1YF 1HBUB 5DLFA 2CZ9A 4ICLA 2XSJA 1Y5LB 3D6MB 5L1JA 3EM1A 1U1PA 3FQKA 2MSTA 1KSPA 1HBOB 4K4VA 3C46A 5KG2A 2CDRB 3D3CJ 2DJWA 2NREA 2MLZA 2CQ0A 3G87A 2D9OA 3PJXA 2DGTA 2OO4A 2QC3A 2AQ4A 5HMWA 3KUEA 5A8KA 3GJSB 3UCZP 2C3UA 4FF3A 1S1TB 2GHWA 4L3KA 2OUGA 4E0DA 2C42A 1M1GA 2EC2A 2FPHX 2LQ5A 3VGSA 4GC7A 3HFKA 4E98A 2AJ2A 3BKFA 4CO1A 1SBRA 5T14A 5K5MA 1XNQF 3MMCB 4A8WA 3DOKB 2DPIA 4P74A 4USTA 2FB0A 2LEPA 1FFWB 1D9DA 2HIQA 1U1NA 5DQHA 5KFGA 2ZH9A 2PGCA 4UOCA 3PX0A 1RZMA 2H5IB 4QIFA 1DURA 1F6TA 2XY7A 3DRRB 4ANDA 1R89A 2G9OA 1QSLA 2ZD1B 3KFWX 2XGPA 4I56A 3WBZA 2V2QA 3QFHA 5BYSA 2FJWA 4RUBA 4IOAQ 4MFBB 2D3OR 2RQKA 1N5YA 4X62F 1CS4B 2G2YA 5K8NA 2IM1A 1RYRA 4LSNB 4LF5F 2ZD1A 2W4DA 1ZAXA 1WACA 1N5TA 5H1SV 5IFMA 2XMTA 2R7RA 2PFDA 3RRHA 1XR5A 1SCJB 4JV5F 4KGVB 1RAFB 3FJ2A 2IJFA 2YWFA 3HSZA 1T03A 1KQGB 4I0WA 2CJKA 2DVIA 1ITPA 3HCXA 1FTRA 2HRYA 1TMMA 1LFPA 2K2PA 3RB4A 1HR0J 5FLXU 3CW2C 4O3PA 1WSRA 1VGYA 2ZITA 4KQZA 3W1YC 2YKNA 4AQYJ 1UWAA 1T9XA 2ZH1A 3R1LA 4NLUA 3EVMA 4X64J 2DGSA 2Y8YA 4K0KJ 2B4PA 4OI4A 1GT8A 3P45B 4RW8A 4ECYA 1R8PA 1RTJB 1SH2A 3T1AA 4M5KA 2V6AA 2L9WA 3NOGA 4ICLB 2KVIA 1PJ5A 4CLYA 3C2PA 1DQAA 4ZCMA 1S1UB 2OP5A 2BEFA 2JDJA 2OPPA 2ROEA 5CZVA 4F3OA 3MD3A 5KT4A 2JWNA 5H9FK 3IR5B 1N8RT 5SZTA 4OYPA 2BE9B 3QIPA 4JB8B 5ADZA 5BXIA 3KUHA 2O01C 1ZM4A 3MR2A 3DXSX 1T9TA 1GNKA 4ZLJA 3TZXA 2QLJB 4PXDA 3CF5Q 3MDFA 4WE1A 3SCJE 4IR1A 3R2DJ 4R8UA 2Y3YA 1JNRB 1GX6A 3GIRA 2A2CA 4C4WA 3ILOA 4C11A 5DJBA 2XGQA 2F3JA 5ETOA 3FBBA 5AXLA 4DCJB 1Z2ZA 2EFGA 2HFNA 4ATNA 4ZITA 2BQRA 1SKRA 4IFVA 5CH7B 2P5VA 1Y5NB 3NCPA 3J81j 5LSRA 4ED1A 5E5NA 1XWLA 2A2DA 3Q8RB 2J0SD 3RB3A 2XEXA 5A76A 5HSPA 5F8GA 2PC6A 4DV2F 2LECA 3PX4A 1P1LA 4CLKA 1IKXA 4OIXA 3M9OB 2E1CA 4Y65A 3UQSA 3T5LA 4FXVA 4MYTA 1UW4A 1RWMB 4UOFA 1HBUA 2W1BA 3W64A 3QIPB 1FNOA 1YLXA 2CPYA 1FRMA 4USVA 3CJKB 4K7QA 1FDDA 5A2QY 1LK7A 2AJ1A 4ID8A 4URQU 3TW0A 2HHHJ 1VRUA 2FD2A 4JUZA 2XMJA 5E3QA 1XNRJ 3I55S 2HK3A 1HKAA 2DXEA 1V6HA 3IS9B 2CA9A 4QZVB 5AE1A 3GZ7A 3QRQA 1DFDA 4PRFA 2RE1A 5ETMA 5AE3A 1S9EA 4XIUA 4HACB 1XNRF 4X65J 1W25A 3CB4A 2F4FA 5G0RB 4Q5VA 4LF9J 4FPIA 1R0CB 3R9LA 3CT9A 3A3NB 4IO9Q 1N6QA 3ETOA 1CJUB 2QJ3A 1SQGA 2AX0A 3BJYA 4DR5J 3F56A 2BE7D 5HVGA 1X9SA 3ZC4A 3HHLC 1T3OA 4ZJQA 3CCVS 5IQ6A 1T0TV 1UWBB 2DNHA 2ZE2A 3X3UA 4DV5J 4DV7F 1HBMA 4ECZA 2R8GA 3ZZ0A 1CULB 2W9CB 2CQ3A 1EIYB 2KJVA 2NUHA 1OY6A 1TTHB 5AXKA 3GU0A 2F1FA 3MAQA 3P3DA 2F4VJ 2VPXB 4MMOA 3TP2A 3FRZA 3QAUA 1PG5B 1WTBA 1ZPWX 2JFKA 1KLMB 2V0NA 2BKNA 3DGPB 3H90A 3LP2B 3SCKE 2HQGA 4CO5A 1VC6A 4WXWA 4EWTA 4JI8F 3DCAA 3RW6A 2C2EA 7AT1B 1CEZA 2XO7A 1ZM3A 2DNKA 2H54B 2J0WA 2XSFA 3BO2A 5E0OA 3BBCA 4QYRA 3M1VB 2J9CA 3G6XA 5E3PA 2E9RX 1FK9B 3CCES 1IM4A 1X7VA 4LSLB 2EC0A 2KTQA 3KHHA 3T1YJ 2AEJA 1T94A 1TKXA 2MKCA 3EJMA 3G82B 1QLNA 3PNIA 5KFEA 3PX6A 5KG3A 5EDWA 5C25B 2ILZA 4G1QA 1UA0A 1Q0NA 2BBEA 2XB2D 1F1BB 3A1YG 3W8PA 1U1RA 4TN2A 3G6ES 4LRBA 2XS5A 3VVUA 4GKKJ 4ED5A 1RTHA 2YXLA 3MAAA 3DNCA 1VJWA 2PE8A 5A8KB 2JHEA 3H25A 4RU2A 3HHLD 3NKYA 1X4CA 4IH5A 2MKIA 1HQEA 1Z1ZA 2ALZA 3CMES 1U0HA 5J2PB 1EQMA 3AFGA 1R6YA 1T95A 2Q79A 1C0UB 2HPUA 4YY3J 2VIHA 1ZAWA 3M4XA 1C0TA 3IBWA 3SXLA 2HW3A 2W01A 2CPZA 3Q8QB 1PKUA 2KFZA 2BKPA 1RAGB 2MQQA 1PGZA 3EMTA 4OMFG 4CZCA 4ILMA 2KYXA 4ALZA 3LALA 2IYGA 3QGPA 4NLRA 5KT5A 2DPJA 4DN9A 2Z0GA 4FBUA 1N36F 1PC5A 5HI7A 3CDAA 2P9EA 3IMQJ 1DTTA 5I4MA 4NCBA 1FX4A 2MB0B 1U7LA 3CJ3A 2YY3A 4IH7A 4ZVFA 4HKQA 1O0PA 2WW4A 2VG5B 7FD1A 4EBDA 1DBDA 1N34F 2OMLA 3GJTB 2Y1RI 4DSEA 1WHYA 4I2QB 4C0OC 4IRDA 4DN0A 4ETZA 3FK4A 5F3TA 2DHHA 2F7VA 2WONA 2ZVSA 4ZCLA 5HBMA 3OL7A 1SJ3P 3JSMA 4OZNA 2A3JA 4D3GA 3MEDB 3LOUA 2O67A 1F5AA 4TYBA 3QYYA 1LKZA 4KKOA 5CYMB 1KOHA 2XZWA 3EZUA 4CNYA 1H6KX 3FEYB 4Q0BB 3C16A 4X4TA 4FS1A 4AQYF 2RRNA 1YRUA 4DPWA 1NDCA 2PMZD 4X66J 2X3GA 4X64F 2H51B 2CQ1A 3SCIE 3U1LA 1DRZA 3U1NA 4K0KF 2H4WB 3BR9A 2BJEA 1U1LA 3UDCA 3Q23A 1KP6A 5LL6d 4C11B 1FDBA 4L3NA 4MJKA 4NYOA 4WJBA 2EW9A 3MCOA 4FKYA 3ILJA 5KFRA 1JLGA 2XTJP 1ZOTA 1NSQA 3G8SA 3LPEA 5DM7Q 1XJWB 3CJQA 3NRBA 4WE1B 4GC6A 4ECSA 2E7XA 1BD6A 3ZXWA 3H4DA 3JYTB 4YR0A 4JI6J 1TKZB 4RU9A 3V4IA 4ZVEA 4R0JA 5AXNA 1NH7A 3BGRB 2PI4A 3LAKA 2M5YA 2WBMA 5A2QU 3W3SA 1B4SA 2XO6A 1F3VA 2JVOA 1MU2A 2KYZA 4MTPA 1SJRA 3VHQA 1E6YB 1NRKA 2NPFA 3K5OA 4CTAA 2ZWOA 1MWQA 3T5HA 1NK0A 2ZH8A 2M8DB 3OTBA 2DH7A 1EQ0A 2ROPA 4B9TA 1C4CA 2MKHA 1CULA 3J80Y 1Q86T 2UUAF 4ECVA 2J6UA 2X1BA 4TKTA 1QTNB 4KRWA 1E6YA 4TLRA 1UZDA 2MJNA 4NEYA 3I4PA 1I6JA 1D9AA 4G1PA 3DHWC 4PQUA 4ED3A 1ACMB 1VOMA 4EUVA 1H73A 1KKHA 3IGNA 3PM9A 2DY9A 4M5GA 3R5BA 4MKAA 3R97A 5E3AA 2ZM6F 3JSRA 1VLOA 1WKLA 2WZ1A 2CJAA 2QRRA 2YNIB 4RLEA 2M0GB 1LWFA 3GFHA 3S7RA 5IM0A 2CNNB 4S0MA 4DXLA 1A7GE 3WQPA 1PJ7A 3NAIA 3Q8SB 3CXCR 2CXEA 2C2DA 2PFFB 4LIRA 1FFSB 3MCSA 4NLTA 2H1YA 4LQ9A 5DLGA 4ZP8A 1U24A 2FC9A 4N47A 2N4DA 1TL7B 2BW2A 4B3SJ 1OY8A 1HHQA 1K1QA 1XR6A 2KT2A 3KLFA 1NAQA 2KFYA 1JX4A 3E2EA 2VFVA 2V8HA 2XYPB 4I7FA 2PIIA 1S1XB 2BJ8A 5KFHA 4X4OA 2OTJS 3CJRA 1NSPA 2OH2A 1S48A 5CD4A 4YB7A 2Y9HA 1NEEA 3B8HA 3JQMA 2BMBA 2QMWA 3EVWA 3N9UC 4PCQA 4W98A 5U47A 2EFQA 4LF2A 1H98A 3QO9A 5D0EA 5J1NA 5KFJA 2K06A 3CJ2A 2JEIA 1ZYQA 1TKDA 4DV5F 4IFVB 1JLBA 2C2ZB 2N3LA 3AA8A 4EI2A 2ZNYA 5GAEU 1CJVA 3S01A 5IZHA 5F8IA 3MPYA 2B4UA 2FVPA 1F60B 1NDLA 3HSGA 3RAXA 1RWVB 2B43A 3QSYB 1VQOS 1TK0A 2A1BA 2QSFA 3K5LA 1Q79A 4KGKA 5D78A 4DR7J 1U6ZA 2VG7A 4MK8A 2I1RA 3D68A 3FQLA 4HHHA 4I6AA 3TUJC 1WF0A 3O1LA 4R25A 5M2PA 4DSFA 1NDKA 2QGFB 5L38A 3BKUA 2YNGA 1Y9OA 2MMYA 2RRAA 4PPZA 1V3SA 3F41A 4WXOA 4DR2F 4DQIA 2YWKA 5HQMA 2MHNA 2WSEC 3HHKA 4K4XA 1CVJA 2QFJA 1W26A 4DQSA 2GO9A 3RR8A 3V4MA 3H2UB 2JH3A 1YDLA 2HFUA 3NXZA 4QR0A 3TAMB 3OV7A 2F8HA 1B7FA 1RT5A 4H4OA 4OZ0A 3KMQA 1B0PA 1VQ6S 2VPYB 3I0RA 3M8WA 4DV3J 1IQZA 1FHTA 1YK9A 1VQ9S 2LXUA 3GILA 3IBCB 4A8QA 4PYDA 3JS9A 4FYXB 4OX9F 3ISND 3EPIA 3MXHP 2YX4A 2JRSA 3R3TA 1TL1A 3Q2SC 2UU9J 1GEHA 2ROGA 4DX5A 3AJDA 2W24A 4JI5J 4J91A 1URNA 3D67A 2DHAA 2UVVA 1M5KC 1SKUB 2DXFA 1HPZA 4Y2CA 3E51A 1ELOA 4BWMA 3TQ1A 4H4MB 1L3SA 2MEWA 1FRIA 3CE8A 2EVZA 3RB6A 2VODA 1T05B 1E6VA 1PAEX 3K5PA 1JJHA 2JFDA 2R2SA 3LGMA 4B9MA 1S0OA 2YKAA 3MOZA 5KFTA 1RAJA 4CLWA 3D2WA 4DR5F 2BXJA 5FLXY 4WK3A 4QOTA 3VZHA 2W25A 3KLIA 3OXLA 4ENOA 1NJIT 4FVCA 1O5JA 4JP8A 3VF0B 2G0CA 4DV1J 4LF7J 1TZ0A 3FEXB 3M2UB 2ASDA 4F8RA 4Q43A 1FXLA 2YNIA 3V81B 1NNDA 2Z2YB 3H42A 3NWRA 5HVFA 1Q1KA 1UAWA 1MMNA 2IVYA 3KDNA 2AYMA 1S1TA 5JVHQ 1WHWA 5C42A 3P5BP 1FJGJ 3TEHB 2KDOA 1N32F 3Q24A 3AA9A 2JNJA 3B82A 3CJ5A 1SH3A 3DN9A 1OY9A 4M5JA 5BYRA 1X4BA 2YVSA 2IM3A 1X4EA 1WJ9A 4YB1P 4DPYA 2VFSA 3QT6A 5HAOA 3FUYA 2IVMA 2DR9A 3UE2A 4ZPAA 2LVWA 4CTAB 3L09A 4AL6A 1YJ9S 2D3O1 3ULHA 1ZTTA 2VPWB 4WF9Q 2VG6B 3QQCD 4LF4F 4G3IA 5GMEA 2RVJA 3K8VA 3PW2A 5DO2A 3PR4A 2CAJA 3KHGA 2CPXA 4QYZJ 2PT0A 3NMRA 4PG5A 3UN2A 2PA8D 5H9EK 2K1RA 1TKXB 3G82A 4OZLA 4CLUA 3MEKA 2R8KA 3D6TB 1H3DA 2J9EA 2E5IA 2YPZA 1IBCB 1UJ5A 5HJXA 2AIRB 1X9MA 5GMKa 1IN0A 2YKQA 4B3TJ 4KAIA 5DETA 1RBOB 3KG4A 3MHYA 1ZAVA 3MECA 1CC8A 3SI8A 1WHVA 4OLPA 4OL8A 1I3OB 4UQGA 3NGRA 2QMXA 1HW9A 4EEYA 2UXBJ 4FDFA 4DZ6A 2NYIA 3NNCA 2XS2A 2LDYA 4USWA 1JLFA 4DBQA 3UCGA 1NXIA 1CSJA 4KKOB 1Q7LB 4F67A 2XYGB 1X5PA 5FDLB 1SJFA 2RQMA 3C66A 5L9XA 3BQ1A 4YDDB 4ED0A 3OSPA 4YMEA 4IQMA 1FVQA 3RB0A 3UNGC 2GIFA 2D3UA 1S77D 2JLEA 2MY8A 3DDKA 3IR6B 2R2RA 1KVKA 4UOGA 2ADBA 3EZ5A 4XPEA 3OQ2A 4DEZA 1S72S 2B8QA 3HVTA 4IG3B 4M8LA 2RQ4A 2DNRA 2F65A 2MKJA 1LW2A 4RW8B 3D0HE 5CYQA 3OR2A 4AXIA 9ATCB 4F36A 2KG1A 1B0TA 4DV4F 2HQDA 3BH7B 1RT6B 2WAQD 4CDIA 1IR2A 4F0HA 2PI5A 3J81U 1KFSA 2IMWP 1S6PA 1JLCA 3DLEA 2E29A 2YKMB 4OZJA 3PYGA 2BJ9A 5B0EA 4ZCKA 2AMCB 2XZTB 1TK5A 2NPIA 4RUCA 5ETLA 1JJCB 3EPGA 2KM8C 2X1FA 1NDPA 1ROFA 1X8DA 2RDJA 2XY5A 2E7WA 1SUQA 1WSVA 4Y0FA 2OELA 2MZ1A 4LF8J 2KFNA 4IKAA 2E5HA 3DOLA 2QL7B 2G1DA 4DX7A 2CG4A 2N7YA 2E1AA 5DG9A 3HF5A 2HQFA 3OL8A 1U1OA 2ZH3A 5E41A 1IKXB 4TY9A 2HBYB 2EPIA 1V5IB 3GLJA 3M7VA 2L41A 4DUYF 1KS2A 3HFVA 1ZA1B 3R7BB 2O1PA 2IJRA 1HD1A 3V6DA 1BY9A 3W2WB 3Q83A 1HNVA 2DKOB 2UXDF 2YNFA 4L73A 2W8KA 5HP1A 1FKAF 2ABYA 2NS1B 4OYBA 5J2MB 3TI0A 2FVSA 3GFYA 1Q5YA 4DSJA 3EDRB 1R8BA 1CG2A 4MKBA 1VQYA 5BJRA 4LRAA 2BR0A 4J9KA 1HHSA 1KVIA 2NUUG 1DTTB 1GH8A 1Q16B 3H59A 2FYXA 4Q7AA 1EARA 1I94F 1HI1A 4C3MA 3MM7B 2QFIA 3MM8B 3HD1A 2AYGA 2FHMA 1KLMA 1WDDA 2EFOA 2HBRB 2ZUAA 3CJTA 3MI7X 1T9WA 2EK1A 3I96A 2LMIA 1VQ4S 2PN6A 5JUMA 5B0AA 1Q8KA 3I82A 4R0EA 3J7AN 4F0KA 2C28A 4QQBA 3BN7A 5DQIA 3M2RA 3M6VA 4DUZJ 3WZ0A 1IUJA 4ILRA 5E3CA 1K0TA 2X3DA 3EWGA 1U0HB 5J2PA 4K5SA 4I64A 4RUHA 4HI1A 1M1HA 2NR0A 3G6YA 2Y0SD 2WK4A 4Z2XA 2DGXA 3NG8A 2RMLA 3Q86A 4B3SF 4DS5A 2LQ8A 2W9BB 3SV3A 4EYIB 4L72B 3MCMA 1RA7A 1OQ3A 1FWPA 1S49A 4JI0F 1TUWA 3LP1A 3TYTA 3CUNA 5K8MA 1KC8T 3DI6A 1X4DA 3I87A 5AT1B 3IP0A 4OX6A 5F8MA 1OWXA 3PIPQ 2EKYA 3M8YA 3HLUA 2RHQB 2KM8B 2B9WA 5HQ8A 1KEKA 1HNXJ 3NNAA 1S5ZA 3TWZA 3R1HA 2EK6A 2GVDB 2L48A 4DL6A 1Q82T 1VC0A 3DYAA 2IM2A 2OD6A 1FVSA 1JLAB 3AT1B 3PEJA 3PG9A 1SL1A 5B0BA 5IC6B 3FBCA 3LO3A 3QZ8A 1U48A 1SV5A 3GFZA 4XO0A 5GAEI 1U4BA 2VL1A 2XHCA 1VQKS 3W65A 1NO8A 3GSIA 2LA4A 3HVRA 2VB6A 4EBCA 2W4CA 2ZJPQ 1ZETA 5FJ4A 2IY5B 5F9NA 3IG1B 4B9NA 3W9JA 3IRXB 2DYAA 3NBPA 4HT5A 4PXCA 3GIMA 1IR0A 4I6YA 5D4PA 3IR7B 4ZVUB 4ZKAA 3LWLA 4GKKF 5F8NA 4QWDA 2X1AA 1VQ7S 1RWWB 1CJTA 2D69A 3IAS9 3S6EA 4O3RA 4U7CA 1HI8A 3CD5A 1MROA 4G6VB 1S6QA 3DLKA 2V2VA 5A8WB 4K4WA 2XNRA 2N7CA 3FSYA 2A10A 3H7HB 3O8WA 2GW8A 1DQ9A 2XWXA 4HHJA 4NLOA 1QAIA 3QGIA 2IC3A 3LF0A 4WFZA 3GONA 3KOAA 4BHQA 3G2XA 2GQ2A 1S1XA 4FVMA 4DPOA 5I42B 2XY6A 1R0AB 4PXEA 3JB9k 5AXMA 4ZVSB 2MZRA 4USHA 3HJFA 3LW5C 3MFIA 2CQ2A 1JXLA 3ET6B 1M5HA 2XMWA 4XPCA 2MSSA 4WFXA 2KXFA 3AY0A 2EKNA 2H9ZA 4RUAA 1KTVA 1Y11A 1RHQB 2OIHA 5C5JA 3FKBA 2IDLA 2JVRA 3IAM9 3ENWA 4DFMA 1WG1A 3GG0A 1RTDB 2IBKA 1RT7B 1OPZA 3VGVA 4DL5A 1LWFB 1QDUB 2CJXB 5I3UB 4HVZA 1WI8A 1M1KT 1TL3B 3LP0B 2ASLA 1UVMA 1DTQB 2HFSA 4NA3A 5GAHI 1YVFA 1FEEA 1S0VA 1RTDA 1XERA 1YBUA 2OPRA 2VJVA 2UVWA 4RR5A 1S59A 5CA5A 4N76A 2BUNA 3H2VE 4LIWA 3PZPA 3BQ2A 1JLEA 1BWVA 3RG6A 1X5SA 1AYEA 1ZM2A 3S8SA 1IBMJ 2RKIA 1RABB 3TANA 3H20A 3MPDA 4CH0S 3ET6A 5A0YB 3OJSA 4HTIA 3KK1B 3DMJB 3ITHA 4DV4J 2QEXS 5LM7E 1JJ2R 1I5OB 1Q8BA 2F5GA 3ZNUA 2R8HA 3I5CA 3OR1B 2F40A 1FESA 2FHOB 3QSIA 2JLGA 1N34J 1TFWA 4URSA 5KFXA 3G9CA 1AA1B 3EXYA 4C48A 3KNAA 2LEAA 4DFKA 2GZOA 3BYRA 5C7PA 4DSLA 1MMLA 3UR3C 2V4QA 2FLOA 1P8GA 2NSCA 1YBAA 3OLBA 5D3GA 1TAUA 1WORA 2XZDB 2HBZB 3AHPA 1MW7A 3FC9A 4JOUA 4M5DA 1VQ8S 3K2YA 3T6BA 5HVHA 1B0VA 2G0IA 3PHTA 1S57A 2DNPA 2BKOA 4FYYB 2NZ4A 2BRKA 3RRKA 3W2WA 1NHKL 1KTQA 1VHIA 3G4SS 4EZ9A 5DGAA 2NCKL 4UF4A 4DPTA 4HYKA 3ENAA 4NASA 2QYGA 3D6HB 2D41A 3DLJA 3CD0A 1Y10A 4K4ZA 5ITHA 1H7XA 4CYUB 4WU2A 4NE9C 2C3PA 2IRUA 2XMUA 4QYZK 1KBRA 2M2BA 4CP5A 4PG4A 4PZVA 1HBNB 1RT2B 4QPTA 4C7QA 1L3TA 2GGPB 1RLCL 9RUBA 3DXBA 3AOBA 2GVDA 4ZK7M 2C2OB 3HMJG 1KQSR 4LF5J 1HHTP 1AW0A 2OPSB 3BM7A 3AD8C 2PA3A 4LR8A 4ANCA 4PUOB 2HNDA 4N8NA 3EGWB 2MPUA 3W2VA 3ISZA 2DNMA 1H74A 2W4PA 5CABA 2VJUA 2K7KA 1PO6A 4IRCA 2P9GA 3DM2A 4X4RA 1QJHA 3M2VA 1PAUB 5C42B 1WC4A 2OPQB 4OHWA 2ADCA 2HVDA 4WZMA 1Y3KA 1BXNA 1RAOA 2VBXA 3V81A 1YJNS 2IAJA 3M8ZA 4WFBQ 1FJEB 1J27A 3MEEB 2DCLA 3C15A 2J0QD 2LKZA 3RYLA 4J9SA 1Q81T 2WCXA 3A4TA 3MZIA 3Q89A 2FVRA 1MWYA 3Q2TC 3D5MA 3OHAA 1JKHA 2ACYA 4RKUC 4J5OA 4Q2MA 1RUSA 4NMXA 2AYBA 3P6YC 1N33F 5JMNA 2HVHA 2UUTA 5DZ7A 4IR9A 2FDNA 4ZN3A 4ZPBA 1GMWD 3BGRA 2ZBIA 4QW8A 3M8SA 3SYZA 4ES2A 8ATCB 2JSXA 2PEHA 3IC1A 3ZTRA 4DR6F 1DHMA 1E6VB 1B64A 1FRLA 2CYYA 3K57A 5H9EJ 1AUDA 2HZVA 4ZVRB 4ECQA 4H4MA 2GIQA 2E5LF 5KFWA 4DMZA 2MQNA 4F02A 4C0BA 2XBPA 1JB0C 1FRJA 1NB2A 2M9KA 4C98A 2CQ4A 1OS5A 3ZTPA 3H5XA 3PRBA 4J9RA 4JI4F 4CH7A 2J7KA 5I3UA 3BKTA 1IKWA 4NCGB 3CCLS 1U26A 3KG1A 3MURP 4U6PA 1T03B 1S4FA 4JBCA 4FNIA 3SSRA 3I5AA 1XMOF 1FI4A 1RU2A 2DTJA 4FKXA 4GVBA 1SC6A 4DX8H 4C8KA 5CHCB 4F50A 2APOA 3OW2R 4DU7A 1FKPA 2MGZB 1SUQB 5FIIA 3A13A 1EP4A 4NRUA 4E8UA 1H7WA 3CCQS 4IG0A 1RSCA 5DQGA 2CPDA 2CPIA 2HNYB 5T7LB 4ZIWA 3CC4S 3H40A 1QAYA 3R5DA 4B17A 4A8KA 4JI5F 4YR2A 3NMAA 2NXUA 5B09A 3NY0A 4GVLA 1WOSA 3MFHA 3KXDA 1GQEA 4M5IA 2NSBA 3QGGA 2QLWA 3KDOA 2DR8A 3SCLE 2YWHA 2QYCA 1HNWJ 1K47A 1SB6A 1PYSB 3N5FA 1RTIA 4OYZA 5CZXA 2XCPA 2D7SA 2AT1B 4DV3F 1RHMB 4PYAA 5IT9U 1N0VC 1LEOA 1UZHA 2HQ3A 3B4DA 4RW4B 4AE5A 2KT5A 1R0BG 2GNKA 3IRXA 5CD4H 4UTGA 5HROA 1VRTB 3OLAA 2BQ3A 3LANA 2B3TB 2UU9F 1EZZB 1IR1A 4B3TF 1M5PC 3QJLA 5FDLA 3AODA 3W62A 3T1HJ 3H8YA 3VGUA 3EDQB 1RE1B 1SXLA 1Y0HA 3VV2B 2KZZA 3HZEA 2XM3A 2CQCA 3K8WA 3MR7A 4OQJA 4N7TA 3FRYA 2YQ3A 4EMDA 1N32J 3BGFA 5LOQA 2CRLA 1XTZA 2WVDA 3QMQA 2GS8A 5E2QA 1ZPVA 2D9PA 2VD3A 1AT1B 2QA2A 4XDDA 3UD5A 1HQUB 2RB7A 2X51A 3IGVA 4RW6A 4UT4A 1NKCA 4UZBA 1EAYC 4J9UE 1PC4A 2I5JA 2JLFA 1F9EB 2HZCA 4NMLA 5KFKA 2HEKA 4X4QA 1M0SA 4WKRA 2W2PP 1XC9A 2BM1A 3R2CJ 1P6TA 4RW7A 2UZAA 1TMJA 1PCAA 3BQ0A 6FDRA 4DV1F 4LF7F 4I68A 5ETRA 2UXCJ 2CPJA 2I0XA 2AD9A 1ZH5A 2HHTA 1P9QC 4IO1A 2FJAB 2ZKTA 3AOAA 3KJFB 1C1BB 5HQLA 2RUGA 2MQMA 3HKZD 4UY8T 1DJ0A 2H3EB 4AL7A 1HR0F 3SSQA 1NBEB 2KI2A 3M8RA 1RU1A 1G3OA 4LFCF 2BRLA 3BREA 1FXRA 4UY85 1BQXA 4DU8A 3C6UA 2UUBF 4NA2A 3DLGB 1F9FA 3ADAC 2W8LA 4QJVA 5ETVA 3QWUA 3S1TA 3UN3A 4U95A 3JYTA 4U7UD 2OAUA 3V6HA 2QX0A 4F7VA 2DRDA 4LF1A 1LWCB 2FGOA 2IDEA 3L4BC 3POTB 2DH8A 2EI5A 3TZWA 3MAHA 1K1SA 1RI7A 1D0EA 1UETA 3CSKA 2FZKB 2VBWA 4E2FB 2FTRA 5LSLA 2AJ4A 1WC6A 4DCPB 2MGZA 2DCUB 3M32A 1D1UA 2CJ9A 2FC8A 4A8MP 4DV6J 2QL5B 4ZLLA 4EBEA 2DT9A 4C8YA 4Q0BA 4ZP6A 3OD2A 1R0AA 4EFAC 4P71A 2IIHA 3NAHA 3RBZA 2D3ZA 3DFEA 4MIAA 4WFNQ 2BOAA 2DEIA 1TV6B 3NGUA 3E3XA 4P2FA 2UXBF 1T11A 1IWGA 4L76A 4YN3B 2AU0A 1X9WA 1JXEA 2R7XA 3ZTSA 1FJ7A 5IS2A 5EWEA 4P72A 3OTCA 1VQLS 2Z2LA 5HMXA 1R8HA 2AKWB 4J9MA 5IXUA 3W5XA 3J81Y 4LMZA 2CPFA 2KB2A 3B6BA 4IFYA 1YKWA 2E1MC 1J5OA 1CQMA 3M8QA 2VA2A 4DSKA 1YGYA 5KT3A 4P10A 3NBPB 4QCLA 2HWIA 4RO0A 1QVFR 1N33J 1JK9B 2I38A 2P8IA 1WKKA 1BQNA 4WZQA 4OZ2A 2FHJD 1NSKL 2O5DA 1U09A 1UVKA 2KVQE 1OIAA 2GC8A 2YWWA 3ILIA 4P9SA 4RL1A 2IVFB 3TX0A 4PQUB 4LFAJ 3PY8A 2DRBA 4ERDA 3E8OA 3HHLB 3K89A 3OR1A 3P5TL 1UJ6A 4NI2A 1DARA 5F0UA 1SI9A 3ZFVA 3ZZPA 1GMWA 1RWOB 5HL7Q 4DR1J 1N4LA 1JNZB 1Q78A 2QLFB 5KFLA 1M90T 3HVAA 1RWXB 4I2PA 4ZVGA 4LF9F 4B3RF 3HSJA 3DYAB 1TP7A 1SKSA 4ZVPB 1HLWA 4O0NA 3JAMU 3TEGA 3G8QA 1KOOA 3AH6A 5KFAA 3TUIC 2B6AB 4WPAA 4B3MF 2B9EA 3SSSA 3TRGA 1WD6A 1VS3A 2CFXA 4GVBB 4Y2IA 3THTA 4AXJA 5JJBA 4DJBA 1YTYA 1XK8A 4CYUA 1JKHB 2MHEA 1UEKA 2CWXA 2Y1LB 2RHSB 2AJ0A 4DR2J 2WVFA 2B9XA 4CWBA 1UPMB 2A6MA 3M05A 4ZMMA 4TY8B 1XMOJ 1RAHB 3QT5A 2AGPA 1PILA 1NPPA 1BE4A 1V9OA 1HNIA 4H4KA 4BLGA 4N5SA 4OHXA 2BJ3A 3IRWP 4DUYJ 4ECRA 3QATA 2EWHA 2CJQA 3FSXA 2XG8A 1TK8A 4Y6IA 1NZ8A 2HAFA 1TAQA 4ZIVA 3BPDA 3NP5A 4X4SA 3WIVA 1EKSA 3L7PA 4WCEQ 3MMAB 2ZJRQ 3C19A 1FKOB 1RHUB 2U2FA 3HKWA 3G71S 1AROP 4DR4J 1MN7A 2FZGB 4GKJJ 1LOUA 3FMBA 1B3TA 2BABA 3VAIA 2K7JA 5IWAJ 3OT9A 4FPRA 2G1HA 3BN4A 4UUWA 3PO4A 3MM7A 2KJWA 1TVRA 3KLHA 1QE1B 4XTTA 1J5EJ 3DOMB 2CQGA 3UDVA 4JI0J 1HNWF 4ANEA 1UPPA 5J2QA 2KXNB 1TL4A 2CVEA 2YBVA 1NKEA 1LWEA 1TKTA 3HDSA 4USIA 1CJTB 3VZIA 2HYIB 3M9NB 4FXWA 5HMZA 1X0PA 1YZ7A 4J37A 2B51A 4A8FA 3KKFA 2ZH6A 3MM5B 5HANA 3T9ZA 1WUUA 5K8PA 4YHHJ 4NLSA 1VDHA 2B4VA 2PDAA 1N6QB 4JI2J 2P2CB 4ZPDA 4LVNP 2DHXA 4PR6A 3M8QB 4LBIA 4NXNJ 4J90A 2EXUA 3KK2B 2YTCA 3HJVA 2BM0A 3H2LA 4L74A 4NA1A 5KFMA 1ICEB 3EXCX 4OJHA 1HBOA 1SQFA 4IG0B 4UQTA 1U0SA 2XMMA 5J1EA 1XNQJ 3F44A 3GYNA 1CC7A 3F73A 2JL9A 2W9AA 3D1QA 4P52A 3VAFA 3KLHB 2LXFA 4C8NA 1XIQA 2BDPA 3C6TA 1RHRB 3T6JA 3CD6S 2J5AA 2MYFA 2QO3A 2RDDA 3AB4B 3JTOA 4I7FB 3RR7A 1IKWB 4NCGA 3WDOA 4NLGA 3NGKA 4YB6A 2AZ3A 2J9DA 4KV8A 3N4WA 1N5VA 4RW7B 2GMLA 4K59A 3A8IA 3RZAA 3PW7A 3GJRB 2L08A 4KH0B 4OYMA 3VQSA 4ZPVR 2NQPA 4KFBA 4NZ0A 3OXGA 2ZZTA 4CT9A 2DGOA 1KVJA 2C2KB 1S1VA 2YX7A 1KONA 2NXCA 1BC6A 4DF8A 3CCUS 4C8ZA 3I6PA 2OI2A 3VAMA 3M6UA 4DSIA 1VISA 2P6TA 4Y2KA 2CNKB 2LP4A 2R7VA 2NXNA 4YFUA 3CCZA 3WX4A 2H5JB 1BMQB 2MKYA 3O3LA 1EETA 3D9BA 4K4YA 3M6WA 4U67Q 1LWXA 2BANA 2VONA 3SQGB 3UN5A 3J7Z5 2WTFA 2ZH4A 3IN5A 5HATA 2ILYA 3MMBB 2WBRA 5L1LA 4ETXA 3GTYX 3H0PA 4F2RA 3IFEA 2VICA 3FCWA 5A0YA 1T7PA 3KK3B 4F4YA 1YJUA 3W61A 2ZZNA 2QA4S 1WELA 2R7WA 4ZA1A 3ELHA 2XMAA 4NLPA 3U7JA 1BLUA 3HT0A 4FNHA 3CC2S 1PIEA 2BE2B 3CVKA 4ITSA 3RAMA 1SJ1A 3IM8A 2VBZA 1D09B 1ZA2B 4DHVA 4O0IA 3BSOA 4F4XA 4ED2A 4OZ1A 1IBKF 2V50A 4C8MA 3MMJA 4JYAF 2E5JA 3QIDA 1F0XA 2J8SA 3KYLA 1UVIA 1XR7A 3CJSA 4OZ5A 4IFYB 2E44A 3US5A 2Q6CA 2DEJA 1KD1T 1F5CA 3IWNC 2HHSA 2BJ1A 2IBOA 2VFRA 3TZZA 2IJNA 2AZ1A 2HVZA 2GGPA 4PKDB 2BANB 2GMJA 4A8XA 3BGUA 2BZ2A 1VBXA 4WTYA 3K59A 1LFWA 2W7PA 1FT8A 5J1EB 2M52A 2IM0A 1M5OC 1AFIA 1Y5IB 1SV5B 2DGQA 3MWBA 3UW1A 4NCAA 4ILLA 5CAAA 1YHQS 1IBMF 1O6XA 2CDQA 3NGTA 1D9FA 1GXTA 1FJCA 3LGNA 5LJ3Y 3QAEA 1HWKA 2HFVA 1RISA 2V8PA 2V68A 3M32B 3OXFA 4KT0C 1JLQA 5KTQA 3KJVA 1LV5A 3DRRA 5EUHA 1VQMS 1QAJA 3CEDA 1IKYB 1RWNB 3MEGB 4NLXA 4DR1F 1RWUA 3J7A1 2LQJA 3FBFA 4I69A 2VASA 1RTIB 2I9SA 3MTKA 5KFPA 4LFBJ 2PSZA 5CYQB 2VPZB 2R3VA 1RT3B 4R8UB 1LWEB 4TQRA 5IT9Y 2Q1LA 3MMCA 2GQCA 2XCAA 4XK8C 1IKYA 3MEGA 3BSAA 3QFWA 4ZLNA 1Q5VA 1Q53A 1VMBA 4GO7X 2HVEA 2DNZA 4DUTA 1CLFA 2DXDA 4B9LA 1IJEB 2PD1A 3NLCA 1YJTA 2IA0A 3BBBA 3TJAA 2KG0A 3RTVA 4ZS6A 5F8HA 1L3KA 1FNMA 4YUDA 2N82B 2GMHA 1VLYA 3P96A 2HNYA 1BQMB 1VR6A 2DR6A 4NYZA 1OSDA 1HQ2A 3GR1A 4WYLA 4YR3A 2ZVIA 4ZVTB 5RUBA 1M5VC 5IT0A 1MWZA 2DISA 2GJIA 1UWBA 2ZE2B 5L39A 2C3OA 3QRPA 4UW2A 5DM6Q 3Q8PB 1WI6A 3MM8A 2F4VF 8AT1B 1MLAA 1FE0A 1KDNA 4ID5A 1Y3JA 5ETTA 2MY7A 3ICLA 1JJ4A 2RH3A 2YKMA 4U96A 1NK9A 2FJEB 4PPDA 2EFVA 1R8AA 2XMVA 4ECXA 1QTMA 3R27A 5IV3A 4JI7F 3UVJA 4TYAA 4JI8J 4GKJF 3MR6A 2XI3A 1YITS 2A18A 4QWCA 3W2VB 2ZUGA 2NXJA 3ONQA 4LSLA 2ZC4A 5IWAF 1FEHA 2QA1A 2O3DA 4DUZF 1D8ZA 3OL9A 3PXGa 2RU9A 1HWLA 2AEMA 2F8MA 1RT5B 4TXSA 3RUBL 4A8OA 3Q22A 4NWBA 2E7VA 3BGLA 1N54B 1Q7YT 1R8CA 1KQKA 4DOZA 5F8LA 1GTHA 2WVEA 4KTQA 2K3KA 3BR8A 3PRVA 1VQPS 4BCAA 2HS0A 2G2OA 2VU5A 2I8EA 4WKYA 4KSEB 4DFPA 2CQDA 2B5JA 1LW0A 2EBEA 3CJ8A 4F25A 4ELTA 3QJPA 2HNZA 3ZTQA 3MR3A 2HHQA 4ELUA 2L9NA 4LF6F 4F26A 3V6JA 3AAWB 2ZDPA 2KO1A 3FZ2A 4YOEA 2QN6B 2DO0A 3VAHA 1N5YB 2RAQA 1HNZJ 2HS4A 1MROB 3AD7C 2OSRA 4JI4J 3TVZA 2DR5A 2DGWA 2RSQA 4EO6A 2ZWPA 5A8RA 5J2NB 4CQ1A 3W9HA 3TA2A 3MF5A 2RD5C 5AE2A 4WP8A 4FF4A 4DR6J 4RNMA 3FNNA 1U1MA 2C2MB 1REVB 2F8EX 3IA0A 5HLFA 2FLNA 2YKOA 1U45A 4ZLPA 2N4CA 5KFFA 3G86A 3N5BA 3ENQA 3BGOP 3QLHB 2XLIA 1TVRB 4P73A 4X2BA 4KGZB 3R7SB 3CNQP 3I32A 4TLQA 3A12A 3R8YA 1SKWA 1S4EA 1UW9A 4Y2AA 3BPSP 2MQPA 6FD1A 1NJXA 4LRFA 3KLFB 2DNLA 1TUGB 1WEXA 4AT1B 2B8PA 4OJ1A 3KK1A 2J6TA 2YPYA 1NK8A 3IWLA 1V3RA 5M2RA 4O4GB 3SQGA 4F04B 1UA1A 2KRBA 1FJGF 4K8RA 1G2EA 3MM6B 4IH6A 4O44B 4MK9A 1W7WA 2HLUA 3H5SA 4J9LA 2AGQA 2OPRB 2FGCA 4HH1A 4UZCA 4A8YA 2V5HG 1JLFB 1FD2A 1FRXA 3LP1B 1R43A 4G1IA 4HEA9 5L8RC 4CM2A 2AW0A 3MUTP 4DFJA 3ZTOA 1GX5A 1YQHA 1J5OB 1TUVA 2HHXA 3NGSA 3O2IA 3CGIA 5LMUF 4F4WA 1G6BA 1P1TA 2P9CA 3I56S 1IQTA 1FFGB 3UD4P 2KH9A 2VA3A 3MM6A 3M2UA 3O5TB 3A3OB 2XI2A 1TELA 2ASYA 2IRYA 2RU3A 4IG3A 3C14A 5GAHU 2BJDA 4AYBD 3IBFB 3JSBA 5HN0A 3ZZYA 4KV8B 2ZBCA 2W2QP 3KLEB 1JXVA 3DOMA 3H98A 3GJQB 1SQEA 2UXDJ 3OBIA 1Y4ZB 4YHHF 4ES1A 2YX1A 3Q8UA 4OV1A 3HP6A 4LR7A 2OJ3A 4ECWA 2CQBA 1UTAA 2O66A 3VQTA 3V6KA 3SFUA 4M5NA 4P6QA 1U8SA 5KOWA 3PVXA 1YWXA 2DD8S 4MYUA 5A6PA 4QPXA 2V69A 4KHRA 5IV4A 1P27B 4DR3F 3A3PB 2UUCF 3HHNB 1K44A 2DNNA 2UXCF 4DV6F 3WC0A 2M8HA 2FVCA 2P6SA 3T1HF 4BWJA 3GYGA 1RAAB 2AV5A 2LQBA 2WB4A 1RACB 4F0MA 2MTLA 3PYFA 2DIUA 1D3WA 4CO4A 3DRXA 1HNVB 3EGZA 3KJVB 4N77A 2HRUA 1ZM9A 3QO9B 1A6LA 2E66A 2RUSA 3TJ9A 2WRMA 1W2BR 2Z56B 4BS2A 2XS7A 1URRA 5KFQA 2ZHAA 4K4UA 3BZQA 3HVWA 4P2MA 2SXLA 2HZAA 2KRRA 1OO0B 2V4JB 4OI0A 1SC1B 2IFXA 4MH8A 4OYIA 5FD1A 2EG2A 3TR5A 2J6SA 1RTZA 1CJKA 5DZ6A 5F41A 1XMQF 1RKIA 2VF3A 2R7OA 2V2KA 5BR8F 3I0SA 2JC0A 5KFNA 1CJKB 3K7RA 4OHVA 4V1Ak 3NL0A 3A8EA 3D1OA 3T19A 3R6LB 4RX6A 2QSWA 1CPZA 3GYXB 3SDEB 3CTRA 2G2ZA 3HHLA 1WC1A 3J80U 2B7CB 4ED6A 2C2RA 4LRDA 3PW5A 4K4TA 1RXOB 3TA1A 4FZVA 3VGTA 4NLWA 1GTEA 1U2FA 2ZH7A 2N3OA 2MZJA 3KNGA 1QSSA 4IQXA 4Y00A 3GQCA 5KFZA 6AT1B 1REVA 1YG0A 4MIWA 4X4VA 1YSJA 3R5CA 2WHOA 4RBTA 2HK2A 3HVTB 4WWSA 3DKDA 4TY8A 2UP1A 2R7UA 3UCUP 2MQLA 5A8RB 5HO4A 5J2NA 4DZDA 3CJ4A 3L7OA 3F0NA 1ZZNA 1LNQA 3D54A 5DDQC 2WVBA 1U2CA 2Z2MA 1Y7PA 2B56A 5GAGI 1HQEB 1JIHA 1GXUA 3QRRA 1YIJS 2DO4A 4TQSA 2BYCA 1V3ZA 1FDAA 2LQ9A 3OTOF 1NK7A 2D74B 2RJZA 5AJ3F 1RTHB 4QWEA 1FX2A 2VQEJ 3SQOP 2K8GA 4C6AA 3MOJB 2DBBA 1T9UA 1RBAA 2HFOA 3B54A 1ZS6A 1AZSB 3ISNC 2GIRA 3NWGA 4LREA 1RTJA 1Q8IA 5KFYA 3K58A 1S0MA 1RT3A 4NI2B 1S79A 1SJ4P 4JI1J 1ZZFA 4RNHA 4DL2A 1Q8LA 4KFBB 3UNYA 5KG1A 1N52B 3OPKA 4ZJOA 5ETQA 2JEJA 1YJWS 4CLTA 1WF1A 2J7WA 2M88A 1Z2LA 2CADA 3GB0A 4ZP7A 3OUYB 3CIMA 2LU1A 4Y28C 1K8AT 3RBXA 2W9BA 2VHGA 2UUAJ 1S99A 5EX0A 4Z37A 4ZHRB 3M9MB 3TOQA 1RADB 4OZ3A 5CCMA 5D77A 3VAJA 4WP3A 3ZZRA 4JI2F 1TV6A 4TU7A 2RDIA 1CS4A 2YQ1A 2KT3A 1T02A 1FNXH 3DDNA 4WBFA 5GAGU 3MEEA 2KXHA 3H5UA 5DS7A 3EUNA 4DV7J 2D1CA 2FIUA 5L1IA 1VIOA 1CJUA 3SFGA 2V34A 2XLKA 3QLHA 2V4RA 4I67A 1VCTA 3T41A 2HWHA 4RW4A 4CO3A 2BE2A 1M5SA 4XDCA 2WOMA 1TQLA 1X5OA 1OSCA 3TUZC 1HWIA 2GVZA 2I5JB 5MLCV 1TKTB 3GG1A 3DRSA 1PBAA 3LH2S 5IM0B 4ELVA 5E3RA 1SH0A 4AFFA 1OMSA 2E9ZA 1G1XA 1QE1A 1FDNA 3VTIA 4YS2A 2AX1A 2EBGA 1C1CB 1IKVA 1WEYA 4PWUA 5DG8A 3NS7B 5F3ZA 3IG1A 4X4NA 5KT7A 4I1TA 3BF4A 3RU0A 1U1QA 4FF1A 4X4PA 1Z4UA 2DHSA 2AP6A 4NLDA 2MQOA 4IUFA 2GHPA 3HFZB 4R5PA 3B4MA 4NLVA 2XLJA 1WG5A 1QUPA 2VKRA 5B0GA 2AJQA 2RS2A 3I9ZA 5D0RA 5KFUA 5F8JA 1MNEA 1FKPB 1S9GB 2DNOA 4P7VA 2ZOMA 3QBCA 2WONB 3W60A 2GAGC 1WC0A 2QLBB 3RAQA 2EEYA 1H72C 4FN5A 4ZVQB 4N56A 3VALA 5HROB 1RJJA 1HIYA 5D4OA 4I2QA 2OPQA 4F2SA 3QT7A 4ZVOB 1XMBA 2E1RA 2GX8A 3BH6B 1EJ7L 2C2NA 1S97A 5CCLA 4LF4J 1UVNA 1YJ7A 2HGMA 5B08A 3OHBA 2Y1IA 3PTWA 4K4SA 4LJMA 1IM6A 1JLGB 3VWSA 2Y8WA 1BHNA 4WTOB 4TU9A
chains in the Genus database with same CATH topology
4DL0C 3AQPA 3CC7S 4DWIA 5LXRA 2ASJA 2R2TA 3OVBA 1HNZF 3OR2B 1FRKA 4YB5A 4A48A 4YEAA 3EYZA 3LP2A 4QIVA 1S1UA 2OPPB 4NL5A 3U27A 1C4AA 3LUYA 1HBNA 1RT2A 2XHWA 5T7LA 2YWEA 4QR1A 1LQ9A 1BQMA 2V4JA 2FHKA 4HDHA 1W2IA 2Q43A 4ED7A 1LXNA 1NJZA 4KB7A 1KNZA 2X1GA 2GHVC 3IO1A 1U6FA 3PW4A 1HARA 4WK1A 3DLLQ 4FP9A 4HDGA 1HWJA 3NCRA 4KO0A 1X4HA 1NB7A 4MKYA 3MM5A 1S6UA 5C25A 5K14B 4O3SA 3PACA 1FRHA 3GFXA 5EGYA 1FF2A 4K5RA 1AFJA 1N56A 2MKSA 4J9PA 2OFGX 5EWFA 4PQAA 1VK8A 4PXBA 4ZDNA 2OPSA 1R7IA 3MTJA 3VR1A 5F9LA 1HYSA 5B7WA 1JLQB 1SJQA 3OFHA 3UR0A 2ZNZA 1NJYA 1L3TA 4ES3A 3T5KA 2VODA 2R4FA 3N79A 3W3SA 4OX7A 3CJKA 2B5JB 3THVA 1RYSA 4FS2A 2LXIA 3G8TA 4KHMA 1NKBA 2LU2A 1FE4A 4ZPWR 1NH8A 3U02A 3UD3P 1VFJA 1U2RA 2LDIA 1EP4B 4HH0A 4ZPCA 1KQFB 2HHPA 3BB5A 3BO3A 5I3QA 2Q66A 3KLGB 3TVYA 1RGVA 2VV5A 2VFUA 3POTA 4J9QA 3X1LB 1A9NB 2J76E 3TNVA 3GSDA 1RT1B 5D4NA 4X84A 1SL0A 1TL3A 3LP0A 2ZHOA 4A8SA 2BV3A 2FJVA 1VHFA 4RBVA 1RK8A 4NRTA 4O3NA 4LVOP 4LF5F 2AWZA 3N28A 5G0RA 2VQEF 3M2VB 1RT6A 5KT6A 4F02A 2GO8A 3DM2B 1QAXA 3BDPA 5D8HB 3BO4A 5KAKA 3KHLA 2DGVA 4DL4A 2RNEA 2V9WA 2E5GA 3KK3A 4TNOA 2JEGA 4FBTA 5J1PA 5A6WA 1KLNA 4FYDA 1JLAA 1JWWA 1YJRA 2J9DE 4J9OA 3I31A 2BVZA 3QWPA 1X0FA 3GE9A 2ATLA 3CWJA 4OJGA 2RRBA 3M8PA 4LFBF 3HI9A 1FKOA 2HLTA 4LFAF 1XN9A 2V8GA 4K2XA 1BQNB 2DIVA 2KU7A 4YQWA 3J7Z5 4O4RA 5L1KA 3CCRS 5L9NA 1CQNA 1TR0A 1JLEB 2FVQA 1R3NA 4QIWD 3GMGA 5IQQA 3MECB 1UVLA 3HHEA 2B4OA 3DHXA 2HAIA 2QE5A 4C97A 4OI6A 1DLOA 2YH0A 4ZOSA 4ZCIA 1MSWD 1S9EB 3GV7B 3CCWA 3N0VA 3M2RB 2BQUA 3BSNA 4QU6A 2IMOA 2DNYA 2RS8A 5KFVA 5KG7A 2VZ9A 1NK6A 3DRYA 4C2MA 4PUOA 1LXJA 3PJWA 2VC0A 4ZVHA 3CDEA 4DDFA 3UWTA 2Q3PA 3K0JA 2HMIB 4W90B 1VBZA 5I42A 2ZJQQ 4BDPA 3GIJA 2VG6A 4O23A 4A46A 1Q4RA 2Y1JA 4WFYA 2RF2B 4IOCQ 1UVJA 4HTJA 2WSCC 4O3OA 3DRSB 2W9CA 2C22A 3FGVA 3VAGA 1K9MT 3DI6B 4Q2LA 1KR4A 3DRPA 4PG7A 3TVKA 2GFFA 3UFCX 3DU5A 2GA7A 5K14A 3TO8A 1GAOA 1RA6A 4WIIA 1QSYA 2W7OA 2YKNB 3MM9A 1WHXA 1UMJA 1T3NA 2OTLS 1O51A 2DNQA 4QBUA 1G7CB 1NJWA 4URGA 1UFWA 3M6XA 1J5EF 5CXTA 1RDRA 3N6LA 3NNHA 3E01B 4DQQA 1FCAA 3PFOA 4RNOA 1C0UA 4BC9A 3DOLB 3JSYA 2DK2A 3VAHA 2CQHA 4XAKA 1N5YA 4U7UK 4OHZA 2VKZG 4RW9B 2UVUA 1NU4A 4KC5A 5B0DA 5CYJA 4U9RA 3PV8A 1U6BA 3RBEA 1UKUA 2V94A 3IXQA 1HNXF 5KFDA 1RKJA 4PWDB 3KWMA 2LYVA 4DF4A 2H5EA 3L95X 4PG8A 1H2VZ 2QV6A 3GV8B 2AJFE 5BYQA 1LWCA 2IRXA 4M1KA 2HFZA 2FJDB 1SIZA 2RIJA 2CJBA 1S1WA 4Q44A 1NHUA 1Y00A 4RZRA 1VBYA 1RT7A 3GR0A 2B0GA 3DLGA 4DS4A 1U1KA 2V8DA 7FDRA 3MD1A 2MZQA 1HFEL 4AUKA 3VAKA 2IHR1 3PEHA 3MPVA 4B9UA 1VQNS 4Y2MA 4I2PB 3GIMA 2HWTA 2M70A 1X4AA 3HHDA 5KG5A 2OLWA 1OQ6A 4ED3A 3V5RA 4JV2A 4W92B 1SIWB 3ENVA 3FCHA 4KHPF 4BBYA 4FF2A 1N0UA 5JXSA 1UFLA 2FUG9 1WF2A 4NX9A 3M30B 4QR2A 4NLQA 2CVIA 3OL6A 2HMIA 3FDSA 2YH1A 3SV4A 4WU3A 5EHHA 4MK7A 2FLLA 3PFEA 4ZPTR 1TFYA 4GO5X 5KT2A 3PDNA 3V6DB 2R9LA 3PO5A 4IRKA 2LEBA 3KLVA 5J2MA 3HX9A 4X66F 1C0TB 1PSDA 3MMBA 5KG6A 4RBUA 2FJXA 4WFAQ 5E7OB 1HI0P 1RT4A 1S9GA 1N5QA 2UUWA 4OLOA 3N01A 3GIKA 1NK4A 5D4LA 1WTFA 2KN4A 3V2UC 4R5PB 4B9VA 2XSJB 3T5JA 1L5UA 2R8IA 1N88A 4L6V3 1YRTA 4IYQA 2YNHB 3I4HX 4OJ3A 5EX3A 1S1WB 1S6PB 3AB2B 3MUMP 3CCMS 2G4BA 2OKQA 2B7BB 1I1GA 3U1MA 5DG7A 4C8OA 3O44A 3J7ZT 2VG5A 3VCDA 5D3GB 2WOMB 5JVGQ 4RNFA 5B0CA 4NXMF 3HZGA 3OTEA 3UPFA 4C3LA 2CIMA 5HP1B 1FD8A 1H2UX 4ID5B 2FY1A 1S10A 3OVAA 1RQ0A 4WYWA 1X4FA 3DGPA 1K73T 5EWGA 2MXYA 3ZZTA 2AYEA 2C3MA 2RT3A 2DNGA 2QIFA 1ZBTA 4KPYA 4X65F 2PO4A 2ZZMA 2WB1D 3CCSS 3OVSA 3OSNA 3PHEA 3LAMA 1MU2B 1WNEA 4NZ6A 1L3VA 1YRXA 4LUBA 4DQPA 1F2GA 5CQGA 1HMVB 2ZFHA 3SMZA 3BS9A 3HM9A 1TKZA 1DTQA 4LF8F 3HK2A 1QM9A 3AJ1A 4IDKA 2HHHF 4Q8FA 2IA6A 4P2SA 1OPIA 2G13A 4OI3A 1S1VB 4RNNA 1IJFB 3SDEA 3UDLA 1S7HA 2OSQA 1ZTWA 2HVIA 1KHVA 3H5YA 3Q0AA 4H4OB 5G4DA 4LMZA 3QPIA 2B6AA 5DGBA 2VQFF 3I0SB 1LW2B 2QA4G 2M3DA 3TX8A 4BC7A 2B9YA 4MFBA 3LWMA 4QIEA 2BA9A 4QWBA 3B78A 1U47A 4B9SA 1NZAA 2UV8G 3CD7A 2ERRA 3DLHA 2R7TA 2J0XA 2LA6A 2LCWA 2IC3B 2HQIA 4GMKA 2ZH5A 2E9TA 1AXQA 2J8AA 2WW8A 2MZSA 4FXDA 4A47A 3TAQA 4DLGA 1FO1A 4DLEA 4USJC 4Y3CA 1IKVB 3DLBA 2ZOFA 4QWAA 2J7UA 1X4GA 3FZBA 1DQ8A 3ZZZA 3E01A 4ECUA 2KHDA 2Z8QA 2FJBB 2EFPA 2EG1A 3DOKA 4OI1A 4DR4F 5LSOA 3CMAS 1NHVA 3FSIA 4KO0B 3DC2A 5THWA 4RWWA 1F5BA 4LQ3A 4DL7A 1L3UA 1DAXA 3C8YA 4Y34A 2DR7A 3PKYA 1KVIA 2V9KA 2DH9A 3BDEA 1K0VA 4UUXA 3M30A 2XMKA 4O3QA 4A4JA 2RQCA 1VQ5S 2COLA 3DRPB 3JAMY 2HNZB 4X4UA 3IS9A 1BGXT 2ZH2A 3JTPA 5I3PA 4CI0B 4KIAA 3CJ0A 5HMYA 4ECTA 4DQRA 1H38A 2RF2A 2Z4PA 2Q6BA 3KLEA 3OFEA 3TAPA 5E33A 1O8BA 1HW8A 1RP5A 4B3OB 1VC5A 2RKIB 2JX2A 2YNGB 3PRDA 5SUHA 3SEOA 4EU0A 1C2PA 4HT7A 2C3YA 2ZHBA 2HS3A 1APSA 2VG7B 3NCQA 1MMDA 2M7SA 5KG0A 1HPZB 2NLWA 4KGMA 3L3CA 1BWEA 3O6QA 4NPOA 1N48A 2QZ8A 2DB1A 2M4MA 4J9NA 5LT5A 1S0MA 1HNIB 2HHWA 1KHWA 4N41A 3I0RB 2IYIA 4M95A 5C24B 5M2UA 4O44A 4B02A 4M5DB 4QW9A 5DDOC 1FERA 2K1RB 2OFHX 2F9DA 3OFFA 1VQSA 5DRKA 3KLIB 1S76D 1YI2S 1HWUA 4M94A 3I5BA 5GADU 2VH7A 2KKHA 3SZ2A 1S9FA 4RWXA 2W7AA 3FVYA 4NOHA 1C1BA 5GVQA 3TARA 2F9JA 2DHGA 1VRTA 1WEZA 1TL5A 4N8OA 5DDRC 1C1CA 3V4IB 2R7QA 1SL2A 1D8YA 5KFOA 4V19X 1S6QB 2MJUA 3DLKB 4F3QA 5A8WA 4C9DA 2CZVC 2ZC3A 4MIBA 4CT8A 3CCJS 1UJ4A 4JI6F 3T3FA 3BSCA 1FTCA 3KK2A 4CIOA 2VOPA 4DV0F 5KFSA 2GQQA 4B08A 4AL5A 1UEUA 3D0GE 3JTNA 2YNFB 3GIIA 4NLYA 4EO8A 3MM9B 4YY3F 1YJVA 4F4ZA 2MDAA 3C6UB 2VUGA 4NYPA 3PIOQ 1KN6A 1KRPA 2VOOA 5CYMA 2HG4A 3I9V9 1LW0B 4NZ7A 4I4BA 5LJ5Y 4C3KA 4V19J 2GV1A 3TAMA 3AQOA 3OJUA 1R27B 4EYHB 4EGLA 3H4BA 2I2YA 3R5AA 1VI7A 5GADI 3K5NA 3EX7B 1T05A 4OHYA 3MUVP 1QUVA 5KFIA 1N5SA 2JOQA 3CDWA 4H54A 4YDXA 2L3MA 1GXLA 1HYSB 3LPYA 3PR5B 1IXKA 3RBDA 4IDKB 4ZP9A 2ZOGA 4KBIA 5KFCA 5C24A 5HLFB 2BACA 3MPWA 3CIZA 4JV0A 1TL1B 2DGUA 4MAKA 4OFZA 3G96A 2JC1A 2VC1A 2L9DA 2KZMA 2R2UA 3WC2A 3D1HA 1H2TZ 4TU8A 1QY7A 2GJ2A 3CULA 2XWYA 2CQPA 3ZZUA 3PW0A 3HPOA 1EETB 1FA0A 5H9FJ 1KFDA 3M8PB 5IT4A 4CCHA 4C8LA 5EN1A 2HGNA 5HBMB 3EGNA 4F4KA 2V8VA 3KMSA 2VFTA 3CPWR 2PMHA 2CPHA 3IWXA 3OFGA 1WG4A 2GCFA 3NS6A 2JZ5A 3K5MA 2ZKUA 2IAJB 1S0NA 4F3MA 4Q8EA 2YKPA 5F0WA 1FK9A 2DITA 2MZTA 3C3LA 1S6OA 4PWDA 4CH1A 3HXMA 4PG6A 3HT3A 3LQVA 4HL9A 2XULA 3D28A 1T8EA 3P49B 2QT7A 2YNHA 2HNDB 2EFNA 1RT1A 4KJIA 1NK5A 1HMVA 1HL6A 2OMOA 2BOPA 3RW7A 3NS5A 1JLBB 3QGHA 1VK3A 1WWHA 2JEFA 4K50A 2CQIA 3C6TB 3MEDA 3KLGA 3W7BA 4RW9A 2AGOA 3JSMB 4QU7A 2CKWA 2LLZA 2YWGA 4HLBA 3CCTA 1RT4B 2U1AA 1IBLF 1J2VA 1ULRA 3N6NA 4O4GA 2K3IA 4B3OA 2VBYA 2UV8A 4LSNA 2MKKA 3FMWA 4P7TA 5KG4A 4C0HA 5KOXA 1XEZA 1H0HB 4G1QB 1JLCB 1XBWA 3DLEB 4DG1B 5LXYA 4LT6A 4EZ6A 1X5TA 2QLXA 1R31A 3DU6A 3QJJA 2R7SA 1UEVA 2HGLA 2POKA 5K8OA 3KTQA 3TA0A 2FHJA 2HHVA 4KE5A 3MR5A 1JMTA 4ED8A 3CO9A 4QIGA 4DL3A 5J2QB 1U25A 3N6MA 5MAOA 4DG1A 3BEGB 2UVRA 3J7YI 2ZDOA 5D6GA 4JI3F 1HA1A 4H4KC 2DRAA 2OD4A 3DMJA 3ITHB 2FLPA 2AF6A 2CPEA 3RRGA 3MMAA 4NXNF 4OX8A 4DR7F 3KG0A 1HBMB 3J7YU 1QVGR 1HD0A 2CZ4A 2XNQA 3GWCA 4KR0B 2KHCA 4CO2A 2R8JA 3FEZA 1DLOB 3OTDA 3T9NA 4ZHRA 3GV5B 2RILA 3FFIB 4HI2A 1U49A 1LK5A 3OUYA 3KHRA 3PKMA 3NGDA 1FXDA 5K9FA 3CDBA 4M63A 2WSFC 2JJ4D 5LMNF 2XC9A 4JV1A 3MGJA 4OI2A 3G6VA 1VIXA 5B0FA 5T41A 3FFIA 3THPA 3CDUA 4CNZA 4J9RA 5DDPC 1HQUA 4RW6B 5KFBA 3M1VA 4Q45A 3AJ2A 3D0IE 4IOBA 3UI3A 1VRUB 3QZ7A 1UP1A 1UL3A 4CO0A 4YP3A 4I6WA 3T1YF 4D3HA 1HBUB 5DLFA 4ICLA 2XSJA 1Y5LB 5L1JA 1KSPA 1U1PA 3FQKA 2MSTA 4K4VA 1HBOB 3C46A 5KG2A 2DJWA 2NREA 3PJXA 2CQ0A 2D9OA 2DGTA 2OO4A 2AQ4A 5HMWA 5A8KA 4FF3A 3UCZP 2C3UA 1S1TB 2GHWA 4E0DA 2C42A 2FPHX 2LQ5A 4GC7A 3HFKA 4E98A 4CO1A 1SBRA 5T14A 5K5MA 1XNQF 3MMCB 4A8WA 3DOKB 2DPIA 2FB0A 2LEPA 1D9DA 2HIQA 1U1NA 5DQHA 5KFGA 2ZH9A 2PGCA 4UOCA 3PX0A 4QIFA 1DURA 2XY7A 3DRRB 1R89A 2G9OA 1QSLA 2ZD1B 3KFWX 2XGPA 4I56A 3WBZA 5BYSA 2FJWA 4IOAQ 4MFBB 2D3OR 2RQKA 4X62F 5K8NA 2IM1A 1RYRA 4LSNB 2ZD1A 2W4DA 1ZAXA 1WACA 1N5TA 5H1SV 5IFMA 2XMTA 2R7RA 3RRHA 1XR5A 4JV5F 3FJ2A 2IJFA 2YWFA 1T03A 1KQGB 4I0WA 2CJKA 2DVIA 1FTRA 2HRYA 2K2PA 1LFPA 3RB4A 4O3PA 2ZITA 1VGYA 4KQZA 2YKNA 2ZH1A 3R1LA 4NLUA 2DGSA 2B4PA 4OI4A 1GT8A 4RW8A 4ECYA 1R8PA 1RTJB 1SH2A 3T1AA 2L9WA 4ICLB 2KVIA