2CJXB

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-Ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 92
sequence length 92
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2cjxB00
2HBRB 2C2OB 2C2KB 2QL5B 4ZVRB 4ZVSB 2QLJB 1RWPB 5IC4B 2H54B 2QLFB 3D6HB 2CNKB 2CNNB 4JB8B 2P2CB 3R7SB 1SC3B 1ICEB 1QDUB 1RWOB 1RWKB 2QLBB 1IBCB 3RJMB 2H65B 1PYOB 3R6LB 4LSZB 1RHKB 3IBFB 2H5IB 1BMQB 1RWXB 1RWNB 3D6FB 1QTNB 2Y1LB 1I51B 2C2MB 5K20B 1RWVB 3R7BB 2H51B 2XYPB 3EDRB 1NMEB 4DCOB 2QL9B 5IC6B 2H48B 4DCJB 3GJRB 4DCPB 1RWMB 3R7NB 1SC1B 2XZTB 2C1EB 3EDQB 1RHMB 2HBZB 1GFWB 1F9EB 1RHQB 4ZVTB 3P4UB 1RE1B 2CJXB 2CJYB 3KJFB 2DKOB 3IBCB 2HBQB 1SC4B 3R5JB 3R6GB 4ZVPB 4ZVUB 3GJQB 3KJNB 1RHJB 2QL7B 2XYHB 2CNOB 3KJQB 2CDRB 2HBYB 2CNLB 3SIPB 3P45B 3GJTB 3QNWB 1PAUB 3NS7B 2H5JB 2Y0BB 3D6MB 2FQQB 2H4WB 2XZDB 4ZVQB 4ZVOB 3GJSB 2C2ZB 1RWWB 1RHUB 1I3OB 1RHRB 2H4YB 2XYGB
chains in the Genus database with same CATH superfamily
4P6QA 4MKVA 3NBPA 1HWLA 3W5XA 4OYAA 5GADU 3LALA 4X4NA 1LXJA 5A6WA 1GTEA 4DQQA 3FVYA 4P7TA 2WBRA 4I64A 2RRAA 5DJBA 1HQEA 2Y8YA 2HMIB 3NAHA 1GXUA 4WCEQ 1F5BA 1OSCA 4EGLA 2R7VA 3CCWA 3BN7A 4Y0FA 2ZVSA 4GVLA 5HI7A 3H0PA 2YKQA 4KC5A 3BKUA 3G6VA 1SPBP 2C3OA 2HZAA 1RHQB 2BABA 3QQCD 3HFKA 1HW9A 2POKA 5E3CA 1Y9OA 3BGOP 3HHLB 4P9SA 3EUNA 1PGZA 3HD2A 2VB6A 2HMIA 5DRKA 4OYBA 4OZLA 1FE4A 2NZCA 3LH2S 5EUHA 2DRBA 2IA0A 3M8RA 2JEIA 3LWMA 3ISND 3QGHA 1N33J 2VG5B 4UW2A 1ZYQA 3BM7A 4BLGA 4ED1A 2V67A 1KN6A 3I9ZA 3ZZOA 5D4PA 2WW4A 3N4WA 1I94J 1YSJA 3MM8B 2DR9A 3HHLA 1U0HB 1AT1B 3KMSA 1G3OA 5IS2A 3E01B 5EWEA 4Q43A 5FLXY 1ZM3A 3FBCA 4KJIA 1ZZNA 1NSQA 4X62J 3FSIA 4YB7A 2PSZA 1N0VC 2HRTA 2Z2MA 3IGNA 4X65F 1JB0C 3V6DA 3IR7B 2V4RA 3PX6A 3HJVA 4NMXA 1U0HA 3DU5A 2D3UA 3R97A 3EGZA 3SSSA 2MKSA 1TKXB 1KHWA 3E01A 4C8LA 5ETQA 3AODA 3RAXA 3KG0A 1HI1A 1NB7A 2V63A 2VFUA 2B9YA 1XMQJ 2DIVA 4LREA 4J9QA 3QFHA 4X4TA 5J1PA 1RAEB 4ZP7A 2KO1A 3MR6A 2LA4A 1N88A 1UMJA 3HSGA 4AQYJ 3ILJA 1QTMA 1TKXA 2LEPA 2W2QP 1XJWB 2CUYA 4DV1F 3RAMA 2V8HA 2IBKA 2CQHA 5T14A 3GB0A 1ICEB 2U2FA 2V4QA 3HHKA 3MF5A 1SCJB 4OJHA 3BSOA 2W2MP 1M1GA 3JAMY 3SSQA 4IG0A 2AX0A 4DN0A 4DX8H 4PG7A 4YY3J 2ZUAA 1S6PB 4QIFA 2GX8A 2E7XA 4OJ3A 4HEA9 3THVA 1I5OB 2L9WA 4PG6A 1UA0A 1VQKS 5CCLA 3MM5A 2AKWB 2YWKA 4NLDA 3DOLB 2VV5A 4PUOB 1H2TZ 2AEJA 2H1YA 3R1LA 4K5SA 3W62A 4NLWA 3OR1B 2OJ3A 3EZUA 2N7CA 1S6PA 1UJ4A 4ANEA 4U7CA 3MM9B 4KGXB 3F41A 1YITS 4ETXA 4DSLA 2HFVA 4I6AA 3RB3A 5DG9A 1QAJA 1RTJB 1Q8BA 2JC0A 1PC4A 3DHXA 1HNXJ 3SI8A 4PUOA 3GV8B 2GA7A 3J7YI 3THPA 2Q79A 1HBNB 1N48A 3TZZA 3QJLA 3OVSA 2P9EA 3Q0AA 4H54A 3BQ2A 4FYDA 1Y3JA 3ZNUA 2AJQA 2DRAA 4HI2A 3OFEA 3WBZA 3KHGA 2QMUB 3PNIA 1HBNA 5CAAA 3TA2A 4DV2F 1HWUA 3AB2B 2DNQA 3OL7A 4CLLA 2F3JA 5IOLA 4E0DA 2MQPA 2F40A 2LYVA 2GGPB 2KRRA 2OELA 2MQ8A 1LOUA 2G9OA 2DH7A 3GFHA 2HFNA 1LNQA 2HGNA 4C9DA 3KK2B 2BKOA 1YBTA 4NRTA 3NOCA 2R9LA 4J9UE 3DRRA 3SCJE 5KT5A 3TRGA 3OFFA 2FJAB 1UEKA 5A8KA 3DYAA 5GADI 2MLZA 4JUZA 2B43A 4OI0A 1Y5NB 2ZBIA 3KK2A 3VAFA 3NEKA 3O5TB 2IDEA 2XI2A 4A8OA 3ZZUA 3R6LB 1NDLA 4ZVGA 4JYAJ 3D0IE 3T1HF 3PJ9A 3MPVA 3TA1A 4OX7A 2XTJP 3A8EA 4LF9J 4GKJF 3Q83A 2M3DA 2IC3A 1TELA 1UW9A 1T11A 1WOOA 3R5CA 4KY3A 2CJ9A 2MQOA 2OPSA 4DXLA 5KG5A 4YB1P 5HVFA 3BDEA 4LUBA 2CPHA 3THTA 1KONA 1Q7LB 5LT5A 3O1LA 3QT8A 2C2DA 3W65A 1DY3A 3BDPA 2ZKTA 2GQ2A 1Y4ZB 2N82B 1UVKA 1I3OB 1KOOA 2BANA 2DGWA 3ENWA 5CCMA 2E5HA 4NLYA 4NEZA 1Y0HA 4MK7A 1TV6B 2P9GA 5MLCV 2K7KA 1BQXA 1WI8A 3EVMA 3CPWR 4YN3B 3CDWA 3PRDA 2YQ1A 1NB2A 3BQ0A 3TQ1A 1WD6A 2KJVA 1JKHA 3EWGA 1RWVB 4R5PA 3B54A 2E44A 3IWXA 3KUEA 3KNAA 2RHQB 4LR9A 1TL1B 4M95A 2RD5C 1TKZA 1IWGA 1AZSA 2D69A 3H98A 1AYEA 4OZ1A 2XM3A 3RBDA 1F9EB 3K58A 3GWCA 5HVHA 3PX4A 3HHDA 4URSA 1S1VB 5LSOA 4DR2J 2GJIA 4NLQA 1JNZB 4CM0A 4DSKA 2IYGA 2AEFA 4K5RA 2LCWA 5H1SV 3F56A 4UUWA 4DU8A 1TL1A 3MFIA 1CS4B 2V94A 3NCPA 4FBTA 3D7SB 2RVJA 3C6UB 3KJVB 1FFGB 1SL1A 1AFIA 5AXNA 3M30A 3G6YA 4H4KA 2HBRB 2C2OB 4J90A 4CT9A 3KHRA 4ZPAA 4A8FA 4F3OA 4AUKA 4LIWA 4OYWA 3FRZA 3LAMA 4ED3A 4K59A 4N8OA 1LWXA 3IFEA 4QIWD 3CDUA 3Q22A 1OQ6A 5CXTA 1RACB 3IAM9 2K8GA 1PC5A 3C6UA 4Q45A 3KJVA 4B3RF 3I56S 2VFVA 2Z58B 4I6YA 3BH6B 2J8SA 4F4AA 3OLAA 1T02A 4YQWA 3D66A 3RBXA 4LR7A 1N5SA 2KXFA 2CJKA 2AYGA 3TW0A 2RMLA 2W1BA 3MD3A 4ECZA 4OI3A 3CJRA 2N3OA 3PIOQ 3N79A 4WFYA 1NDPA 2B51A 3HFVA 2VFRA 3E51A 4A47A 4ZVUB 2QL7B 4AL5A 2NXNA 2GVZB 2R8HA 1YLXA 3CD6S 2CPYA 1SUQA 2PGCA 2RQKA 2Y1RI 3I0RB 3RW7A 1YJ9S 2VODA 4K0KJ 1VLYA 3G4SS 2E1CA 4O3PA 1JQGA 3R5GA 4URGA 2HHVA 4MKAA 2ZDOA 3JQMA 2EKNA 2R2TA 5KFGA 4USTA 5KG4A 1PYOB 2GVZA 2IMWP 1KRPA 2LEAA 3MR7A 5DLGA 4WK3A 2ZD1A 1RAAB 1PO6A 4M5JA 3W8PA 2AJ2A 4JI8F 1C4CA 2XWXA 5AJ3F 4PWUA 4DL2A 2WBMA 1HL6A 2XMKA 4FP9A 5AXMA 2ZJRQ 3CF5Q 1FRLA 2FC9A 2R7RA 3LUYA 1S9EB 2Q1LA 2E66A 1C1BB 1AXQA 2UXDF 2KM8C 1R8CA 3EVOA 3GJTB 1NK7A 2VQEF 1H7XA 1VLOA 5L1KA 2JC1A 3N01A 4Y00A 2A2DA 2YY3A 3LGMA 2YKNB 5CH7B 2D74B 4ES2A 1NSKL 4ELVA 3U1MA 4C8KA 1S9EA 2DTJA 1C1BA 2D1CA 2KT2A 1R0CB 2DD8S 1PG5B 3KLIA 1YJTA 1B0TA 2KT5A 2YKNA 1X4GA 5KFPA 4ER8A 2NSBA 1TFYA 4MK9A 2OLWA 1Y5IB 3MMCA 1G7CB 3I6PA 1SL0A 4WP3A 3CT9A 3GJRB 3TZWA 4ZLNA 1V3ZA 1S7HA 3J7A1 2DISA 1FNMA 4G65A 4U7UK 3IWNC 3QYYA 3K57A 5AE1A 1X4BA 1NKBA 3PYEA 1N0UA 4UY85 2LXFA 3DXBA 2IVMA 3FCWA 2NUUG 1CJKB 4F3MA 1RADB 4ZIWA 1GMVA 3M8ZA 1S6UA 2XS5A 4DU7A 1IBLF 3R5DA 4ES3A 2G1DA 3W60A 2AYBA 1VI7A 3MMJA 5AE2A 2VBZA 5KFDA 2HGLA 2DHSA 1PJ6A 3CCQS 4B9UA 4ZITA 2V8PA 3E8OA 2F63A 5LM7E 5HJXA 2Y1LB 1W7WA 4OL8A 3JTOA 1A7GE 1IKVB 1NKEA 3M6VA 2YWGA 4WZQA 4XAKA 1OIAA 4U67Q 3OUYA 3C8YA 5KFQA 4ZOSA 4MFBB 3FNNA 1PYTA 1SH3A 3HHLD 4USHA 3CC7S 1YK9A 3I0SA 2CJBA 2GC8A 1O5JA 4QU6A 5IV4A 2O01C 2QFJA 1IKVA 2JH3A 5B0FA 3MM6B 2MPUA 3SIPB 1NU4A 4LF7J 2QN6B 1FHTA 3ENQA 4MJKA 2EG1A 4Q2MA 4NRUA 2UUAJ 3OV7A 2Y3YA 2BOPA 1RUSA 5EX0A 2RUSA 1C0UB 2MXYA 3UD4P 1SBRA 5HLFA 3RG6A 4J9SA 2XULA 4Y6IA 3K0JA 4X66F 2VQFF 2YBVA 3KOAA 4KHRA 3TAQA 2RDDA 4RZRA 4WK1A 3WX8A 4LVOP 4B3TJ 2C3YA 3ETOA 2HRUA 1HBMB 4MYUA 3BKFA 1RT6B 1EQMA 3H4DA 3W2VB 1VQ7S 3CIMA 4NLPA 1X0FA 1N56A 5FDLB 3UNYA 4USVA 3MAQA 3KYLA 1CULA 3FEXB 4FYWB 3KJFB 2M70A 2YTCA 1HBMA 1RT6A 2HHQA 4CTAA 3PR4A 4J9OA 4HT5A 2W2NP 3FKBA 1B64A 3ZNJ1 2JJ4D 3AB4B 3AHPA 5FDLA 1Q79A 1UJ5A 1U1MA 3RGIA 5H9FK 5A0YA 3M9MB 1QE1B 1WF1A 4F0KA 2QA4G 3KDOA 3OTDA 2OTLS 1PBAA 4IOAQ 4BCAA 4OHXA 2QMXA 3Q89A 2OEJA 3B4MA 4WZMA 3ADAC 2GQQA 1D9AA 2G0IA 2AMCB 1L3TA 3H42A 4O23A 3DI6B 3BN4A 3C14A 5K8NA 3I31A 2ASLA 3SMZA 3CB4A 1HHQA 1TVRB 2HGMA 2PIIA 1YJ7A 1PCAA 3WDOA 4WXWA 3GG1A 1K1SA 2KM8B 2R3VA 4QZVB 1OQ3A 2VONA 4XDDA 5D15A 3PV8A 3DI6A 5BR8J 1KLMA 2MYFA 3AJDA 1N36J 4I2QB 2M52A 1SKSA 1S6QB 4WJBA 3CC4S 1RT5B 4AT1B 1EB0A 1ZM9A 4OIXA 2KFYA 2NREA 1RHUB 3U1LA 1KFDA 2RT3A 2J9DE 4BDPA 1UZDA 3EPIA 4OX9F 2R2UA 3HKZD 4I7FB 2BW7A 4B3MF 1NSPA 4I2QA 1S6QA 4DQSA 2WTFA 3ZZYA 2CJAA 3TI0A 2O67A 1RT5A 4WYLA 3WX4A 4QWAA 3HT3A 2OP5A 3GIIA 2XEXA 4NWBA 2QL9B 2GAGC 1FI4A 4I7FA 5D0EA 3NGSA 1FD2A 2E5JA 3RR7A 2PC6A 2HBZB 2B7BB 1A0OB 4ZVTB 3D54A 5IT4A 4QIGA 1DTQA 1VIOA 1VR6A 2YQ3A 1YZ7A 2HFSA 2PI5A 3NLCA 4IYQA 4XTTA 3KMQA 4OHVA 2YNHB 3H25A 1NPKA 2ZKUA 4CO3A 2JZ5A 3ZZZA 3QLHA 4W92B 2QL5B 4LSNB 4ATNA 2L3MA 4ED6A 2CNNB 4UF4A 1KVIA 2HVIA 3SSRA 4KKOA 4O44A 4C8ZA 1REGX 3RB4A 2GW8A 3HVTA 2AW0A 1JLFB 1FRHA 2OPRB 1I94F 2YNHA 4ID8A 2DNGA 1FT8A 3GG0A 2LFVA 3SQOP 5F8NA 2YKMB 3K17A 4FS2A 4IFVB 5IWAJ 2VDHA 4LSNA 1CG2A 1M1KT 4DCJB 1OO0B 3PRBA 2HFZA 3RRKA 1FKOB 4DUYF 1TR0A 3BO3A 4FYVB 4NZ6A 4X62F 2XY6A 2XS7A 2HHXA 1T9VA 3M8PB 3WQPA 4YDDB 1JLFA 4LRAA 2OPRA 1N34F 2JSXA 2VDIA 3ISZA 1Y10A 2BJ7A 3B78A 3LP2B 2YKMA 4JI2J 4RBUA 3HVAA 4IFVA 1XQIA 3Q24A 2F5GA 4EI2A 2DY1A 4M5NA 2YWFA 2FD2A 1JNRB 5A76A 1WDTA 5KFRA 4FF3A 1HD1A 3J7ZT 5HMYA 1XMQF 2A6MA 4DL4A 3IO1A 1WG4A 3PHEA 3HHNB 1U6BA 2WONB 3H2UB 3LP2A 3KTQA 5GAEU 2R7QA 4AQYF 3CJ0A 5E5NA 3OW2R 3H59A 2X3GA 3MWBA 5B0BA 3IBFB 2QZ8A 1KTQA 4Y2AA 1VQLS 3D6FB 1RAHB 2R8GA 2PA3A 2J9DA 2B56A 1EETB 4JI1F 4HACA 1XR7A 4IR1A 1WDDA 2DVIA 2WONA 1IN0A 2XO7A 8ATCB 1RAOA 1IUJA 2HNZB 1UAWA 4LMZA 1PJ5A 4K2JA 3CCUS 3FEYB 3V81A 2HVDA 1S1UB 3LWLA 2V5HG 1Z1ZA 1UVLA 3TA0A 3UN5A 4FXDA 5HAOA 5E3AA 1UEVA 2GHPA 4IOCQ 3LGNA 2HNYA 1EETA 4QPTA 2KRBA 2WVCA 3GFZA 3P45B 3ZTPA 3BBCA 1BGXT 3MMAB 3T5HA 2HNZA 4ZVOB 4AD6A 3MECB 3OTOF 4J7CA 2BXJA 4HH0A 1S1UA 2B3TB 3T5JA 4JB8B 4ZCMA 2DH8A 2W9CB 4LF6J 2HWIA 4M94A 3ZTQA 4DI6A 5A8WA 5KFFA 4JI0J 3M1VA 2M9KA 1QY7A 2IAJB 3PG9A 3Q8VA 1W2BR 3A3NB 3MMAA 2M4MA 1T05B 4O3RA 4KQZA 4B9NA 4TY9A 2HHPA 5K20B 2KN4A 2XC9A 5LOQA 3TVYA 3UN2A 2OSQA 3N6NA 1SIWB 1VQSA 1NK0A 2W9CA 2BACA 1M5PC 1L3VA 3DDIA 2GIQA 1WHVA 2KJWA 1MLAA 3W63A 2VJUA 5D6GA 4JV2A 4ECXA 5A6PA 1OMSA 1JLGA 3D1HA 5KOWA 4ETZA 5C2CA 2W25A 1IR1A 2B7CB 5HROB 3FBEA 3ZFVA 5EGYA 3PYDA 1G2EA 1OSDA 1D8ZA 1CJUB 1VGYA 2XLIA 5HATA 1H72C 1MWQA 5KG3A 5C24B 3G86A 3RB0A 5KG1A 2HYIB 3LP1A 3F44A 2YNFB 4HHUA 3HO1A 4N56A 5CYJA 4C6AA 5HQ8A 3MPWA 3KUHA 4RU9A 1WEXA 2EC0A 5HROA 2EWHA 5KOXA 2B8PA 3CCTA 1CJUA 5KFVA 1FDDA 4C4WA 3F73A 5C24A 3FUYA 1JLEB 4D3GA 4USUA 3QRQA 2YNFA 1YIJS 5DZ7A 4DL6A 2ASJA 4L6V3 2RF2B 1OY9A 1IKXB 1U1KA 1VRQC 1TQLA 2DGUA 1CQNA 2PFFB 3CNQP 2P6TA 3UDLA 4TYAA 1ZETA 3IMQJ 2OTJS 1YRXA 2CPZA 5BYRA 1R8BA 2R7XA 1Q8KA 4DR5F 5ETPA 1URNA 1JLEA 5K14B 3KUGA 5F3ZA 3KJNB 2HIQA 1RHJB 4YHHF 4QYRA 4QBUA 2RF2A 1IKXA 1RT7B 1FRKA 3MI7X 1RYSA 2APOA 3N6LA 3DRPB 2OSRA 3HDSA 1VDHA 3DXSX 4RW8B 4KB7A 4LRCA 3BR9A 4CLSA 3K5LA 5M2RA 2ATCB 4USIA 4KT0C 2YX1A 2OFGX 4B9MA 2VOPA 4TYBA 2H65B 1Z2LA 1S1WB 2W9BA 2Z30B 2PDAA 3DRPA 4C3KA 4FF1A 4RW8A 4DV7J 2RS2A 2G1HA 4O3NA 2V2KA 2W8LA 2L48A 2KYXA 2E7WA 2CQCA 4O3OA 2A3JA 1T8EA 1F60B 4DCPB 2XSFA 3B6BA 1K0TA 1VQ6S 5B0GA 2XZTB 4DJBA 1UFWA 2AQ4A 1EAYC 1DQAA 5G0RB 3OTCA 1HHTP 4L75A 1S1WA 4ECYA 1V3RA 4F4XA 1K44A 1U02A 3PFEA 2LQ9A 2GV1A 3CGIA 4Y65A 1RISA 2UUWA 5DGAA 3Q8YA 3FBBA 3H5SA 1VFJA 5F3TA 3U02A 4AL7A 1FWKA 4P52A 3WIUA 1JLBA 2QE5A 4NCAA 4OYZA 1FWPA 2F8HA 2QC3A 5L39A 2HSEB 4X4UA 2I0XA 4RUCA 1TUWA 3BKTA 1WC4A 3MOZA 3HSDA 2UV8A 5BJRA 5CZVA 4RBVA 3J7AN 4NASA 3N9UC 4P71A 2F4FA 4F7VA 2DB1A 3DMJB 4UTGA 4USMA 4H4OB 1VHIA 4I56A 2IPOB 1HBUB 2FC8A 4BC9A 3CW2C 1FE0A 2ZH3A 4LF4F 5C7PA 4ZA1A 1VC5A 1SC1B 3Q86A 3Q8PB 4RJVA 5KFCA 2V34A 5H9EK 2C2NA 1FESA 1YX2A 4NA1A 5IFMA 2OD4A 3PY8A 2FPHX 1YTYA 1KVKA 1OS5A 2UU9F 3R5AA 4H4OA 4P73A 2ADBA 2CQ0A 4EBCA 1VQYA 3ILOA 1HBUA 1X4EA 4CH1A 1NDKA 1XNQF 5HK4A 1Z2ZA 2VFTA 5B09A 3TR5A 3FZ2A 2BE9B 3O2IA 1WACA 1H2VZ 1HBOB 4JOUA 1WJ9A 2MKHA 3FQKA 4IFYA 1REVB 2A2CA 2QLWA 3HM9A 1NJIT 5L46A 1Q8IA 1RHKB 2HVZA 4DDFA 4M5GA 4Q7AA 1BUXA 4I2PB 1VC0A 3R7BB 3L3CA 3DLLQ 4LQ3A 3VHQA 4FS1A 3M8WA 4ANDA 3R7NB 1REVA 3OR2B 5BYQA 2C1EB 3KHLA 1NZAA 2E9TA 1RP5A 5KFKA 1N5QA 3OBIA 2CJXB 4GO7X 1U8SA 3OVBA 4ED4A 2GHWA 5LSLA 4RUHA 2XI3A 1CJVB 3QGGA 3ZO7A 3QFWA 3VGUA 3OTEA 2CNLB 5B0CA 1TTHB 4NXNF 3U1NA 4QJVA 3QWUA 4J9MA 4B9LA 1MROB 3OR2A 9ATCB 4R0EA 2DGSA 2Z57B 2BRKA 4ZVSB 4EO6A 3S8SA 1ZTWA 3CO0P 4OHZA 3MM7B 4ID5A 4PWDB 1TK5A 1B7FA 2IBOA 2F4VJ 3UCGA 1WF0A 1CJVA 4WU3A 3QMQA 1HNIA 4LT6A 4WIQA 1SL2A 4GVBB 5DS7A 2NLWA 2QYGA 4N7TA 3LW5C 2HIYA 1FD8A 1Y11A 1QD1A 2B5JA 1NH7A 1BQMB 3MUTP 2YKPA 2CPEA 3PYFA 1HNZF 3MM7A 1OJ4A 2QLXA 1WORA 3T1AA 4QR0A 1KD1T 2QIFA 1TUGB 3IG1B 5T7LA 7AT1B 1KEKA 1HA1A 2NCKL 4MTPA 3I96A 4PQUB 2DGXA 3GIRA 1BQMA 4FKXA 1DBDA 4LQ9A 2DYAA 4BWJA 3G96A 2W4PA 3H5YA 3MAHA 4ZVFA 3CCMS 2FQQB 3NWGA 1S59A 2HNDA 2BQUA 3PR5B 3IG1A 3DDKA 3W9JA 3R9LA 2G2OA 1WUUA 4ED7A 4TQSA 4I68A 2L41A 2ZITA 3JSBA 4YB5A 4UOCA 7FD1A 4ZK7M 5C2GA 5DGBA 1EARA 4B3SJ 3R2DJ 5B7WA 3Q8UA 1ZA2B 3H8YA 1UFLA 3HI9A 4JI5J 4P7VA 4NXMF 5KG2A 2ZWOA 1TL7B 2PMWA 2UXBJ 1XWLA 2EXUA 4DPUA 3TEHB 1U45A 2A10A 4FXVA 1VMBA 4GRSA 2DRDA 3GV7B 4IDKB 5ETRA 3IAS9 1KSPA 1GMUA 3P49B 4V1Ak 1RB0A 2MZJA 4ZPBA 4DUTA 5AXKA 2C3MA 5A8RB 4DR7J 2B4OA 4PABA 2XLKA 1IQTA 3VAJA 4IDKA 2DHXA 2ZNYA 4KGVB 3T5KA 4GKKJ 1OWXA 2XG8A 4FZVA 2RS8A 2ZH2A 4DV3F 5L1LA 2MLYA 2J6TA 4A8WA 2PD1A 5DO2A 1YQHA 4CO2A 3OL8A 5D8HB 5KFBA 4RNHA 3NCRA 5A8RA 1S10A 3BO4A 3ZTRA 3BBFA 1NHUA 4ICLB 3WIVA 1U1RA 4PZVA 2ASDA 1WHXA 1FX2A 5J2MA 1AUSL 2M8DB 4KO0A 2GCFA 5K8OA 5DQGA 4AXIA 2Z2ZA 4AXJA 2FDNA 4WPAA 1KQGB 2B8QA 4DR6F 3SEOA 1NK9A 3MEDB 1B3TA 3AXMA 3BZQA 3VAGA 3NL0A 4ZPDA 2MGZB 4ICLA 1DQ9A 4FNIA 2JLEA 2FHKA 4Z2XA 3DRXA 2QMWA 5ITHA 1ITPA 1Q16B 1J2VA 2MKJA 1GH8A 1SVDA 3IN5A 1S12A 2YH0A 4DQRA 5KT4A 3BH7B 4YB6A 3MD1A 4B9VA 2MGZA 4NMLA 1IBCB 2OD6A 2RILA 3CJ4A 4KH0B 1QSYA 1C4AA 3VGTA 3RTVA 1GEHA 2WOMA 4CLUA 3RU0A 4JI4F 2P9CA 1R0BG 2NXUA 1H74A 2B0GA 4F25A 4CYUB 4YDXA 3QZ7A 1XR5A 8RUCA 3MURP 4DV0J 4DV6J 4WTOB 2C3UA 3IRWP 1HNWF 4RW6B 5CA5A 1RU1A 2DBBA 1FDNA 2UZAA 4KGKA 3TUIC 4DX5A 2HW3A 2KFNA 4JBCA 3NGTA 2E1PA 2FLOA 3NGUA 1ROFA 2FLLA 3IC1A 2EC2A 2QA1A 3D28A 5ETMA 5HVGA 3QAEA 1T03B 1N36F 4CYUA 2I2YA 1UL3A 4JI3J 2UVRA 2IJRA 3UR3C 1RKIA 5J2NB 2DR5A 4IUFA 5IC4B 2CQGA 2MTLA 4PEOA 2LDIA 4RW6A 1S97A 2BJEA 3QJJA 1XK8A 3JTPA 1BQNB 1WTFA 4AFFA 2DXEA 2FHOB 4U96A 1T03A 4Z7YA 3GIKA 3NS6A 1JLCB 4LF5J 2VU5A 2Y0SD 4CLYA 3I4PA 5J2NA 2VG6B 2UUBF 3O44A 4WE1A 5HO4A 2HVHA 4KIAA 4Y28C 2RQ4A 1CEZA 4L3NA 1FJCA 2VH7A 2M7SA 2HURA 1S9GB 8AT1B 2U1AA 5J1EB 1AROP 2BJ1A 4MYTA 1JLCA 4MIBA 3VF0B 5LMUJ 2ALYB 2JOQA 1IBMF 4ZP6A 3QT7A 1J5EJ 4DZ6A 3CC2S 3KLGA 4KV8A 1IKYB 1UVIA 2VBYA 2IFXA 4JP8A 5BXIA 2I8EA 2VPXB 3NMRA 2HQ3A 3JB9k 4BS2A 5IZHA 5J1EA 1IBKF 1JJ4A 2FZCB 4C7QA 1XTZA 1DRZA 2HZCA 2J7KA 1X5PA 4KFBA 1IVZA 4DR3J 1NPPA 1R7IA 4ENOA 3EGNA 2C2MB 4J9VA 1D09B 1E6VB 2FGOA 1F2HA 4DFKA 1EKSA 1CVJA 1LWEB 4TQRA 5HP1A 4G1PA 5HMZA 2PA8D 3UN3A 4Z37A 1SJ3P 2OMLA 2KXHA 3A8JA 1VQMS 1SQGA 4M5KA 3AOBA 1CC8A 1CBKA 1GTHA 2VJVA 4ECRA 1E6VA 2LXIA 4F02A 3J7YU 3M8SA 2J7WA 2BJ8A 4P2MA 4A8SA 2XMAA 2W7AA 4F2RA 2HRYA 1YDLA 2EG2A 2VA2A 1M5HA 2UVWA 2LXUA 2LU1A 3ET6B 2B9XA 3M2UB 5E7OB 1RT4B 4WKRA 1XMOF 3HK2A 1QDUB 4N77A 3OLBA 4RW7A 3R2CJ 1U2CA 1FXLA 1N5VA 2CZ9A 2MY8A 3OPKA 2XSJB 5KFHA 2EBGA 4I6WA 4CO0A 3DOKB 4XPCA 5F41A 1WC3A 4Q0BB 1YWXA 3EDRB 3MPDA 2IY5B 4I0WA 1NMEB 2CQ3A 4L3KA 1YJWS 1RT4A 3WZ0A 1K9MT 1N5YA 4X65J 3UVJB 2OI2A 3H2LA 4DBQA 2IRYA 6FDRA 1ACMB 3CCLS 1NO8A 3RAQA 5JJBA 3DOKA 2V8GA 4QW9A 4EO8A 2IRXA 3A1YG 4OYIA 5ETNA 2RDIA 3HCXA 3QRRA 5F0WA 4O3SA 4KBIA 1E6YB 1FCAA 2ILYA 3LA0A 2EFOA 5KT2A 1TL5A 5D0HA 3PKYA 3TX8A 1TKTB 3WC0A 2DEJA 2QFIA 5CD4A 3QSYB 1Q5VA 2ROGA 1SC3B 3ONQA 1RDRA 2F65A 1ZBTA 2MKCA 3PKMA 3M32B 1BC6A 2VKZG 2DR6A 2MB0B 1E6YA 1ZM2A 3JAMU 3SFGA 1ULRA 4LF6F 2MJUA 4NZ0A 1O8BA 4LVNP 1VBKA 1SH0A 3W66A 4QU7A 4MKBA 5GMKa 5ETLA 4RO0A 5KFJA 2KG0A 4QWDA 2FHJA 1HR0F 1FJGF 1IM6A 1M1HA 3GILA 5AXLA 1R43A 3FC9A 4OZ5A 3C15B 2QGFB 2R2RA 3KKFA 1U8WA 3JYTB 5B0EA 4P74A 1FXRA 1DTTB 2MHEA 1NBEB 1U6ZA 4NCGB 4YFUA 3CCSS 3X1LB 3SBMA 5I3QA 4PG8A 2H4YB 4WIIA 2X1GA 2W01A 1RT2B 4CNYA 3CMAS 3CDBA 2WSFC 2VG5A 2W9AA 1UVNA 4F26A 3T3FA 3VALA 2I1RA 3RR8A 1QJHA 5LJ3Y 4IRDA 3CCVS 4EFAC 1DTTA 3MM8A 4Q2LA 2CQ2A 2FJXA 4NCGA 3EX7B 1XNRF 2VC0A 1S1XB 2XYPB 3DCAA 5EWFA 3P3DA 3UE2A 1F9FA 1HKAA 5D3GB 3IR5B 2AX1A 1H98A 1RWMB 2BDPA 3O3LA 3L4BC 2DITA 2IM1A 2OFHX 4DV2J 4EU0A 1IR0A 2VPYB 3AD7C 2VICA 4ZDNA 2JLFA 4A4JA 2RU3A 2V50A 3IWLA 3BV8A 2LDYA 2J7UA 4ILRA 1L3KA 5DDOC 1P8GA 4DFMA 4DL3A 3H20A 2CDRB 4U7UD 5D3GA 1O6XA 4LBPA 4OX8A 2W4DA 3OHAA 1WELA 4CH7A 2C2KB 2E29A 4F4ZA 4W98A 4ZVRB 5HSPA 2H54B 2FVQA 3VZHA 4CCHA 2J0WA 4F50A 3FFIB 1RWKB 4O0IA 2IMOA 6AT1B 4ERDA 2CXEA 3FBFA 3L9ZA 3L7PA 3CCES 2XY7A 2KVIA 4OZJA 4H4MB 2MQQA 3K8WA 4CM2A 2UUCF 2RQMA 3ILIA 2IYIA 4GKJJ 2Y9HA 2VASA 3EE3A 3V2UC 4WP9A 5DETA 4QYZJ 2H3EB 2LQ8A 1CQMA 1K1QA 2Y8WA 2ACYA 4GO5X 1QAYA 2AJFE 4NE9C 2KH9A 4L76A 4RNOA 3UWTA 2AHOB 4FNHA 3IBCB 2QJ3A 2HWTA 1LK7A 5KFWA 3DOLA 4TLRA 4J9KA 2DR7A 1VBXA 1S0VA 2KDOA 5CQGA 3OR1A 2J8AA 2B9WA 4ZPCA 4N41A 3GYNA 4X64F 1H73A 3MM9A 3MCOA 2RB7A 4EEYA 2UXCF 4V19X 2RSQA 4X4RA 4DFJA 3D6HB 2GHVC 4LFBF 2NQPA 4NZ7A 1RTJA 5J1NA 2CA9A 1VBZA 1S0MA 2BJDA 1U2FA 5M2PA 2OPQB 3QO9B 2HFOA 3BGRB 1NKCA 2UUTA 2K06A 4FF4A 1U6FA 3BSNA 4IQMA 3A3OB 2ZZNA 2HK3A 2ACMA 2H48B 5JMNA 1FA0A 1C0TB 4R0JA 2DNYA 2FJWA 3QO9A 1U25A 4CO4A 3OFGA 1U26A 3KFWX 4DPXA 4X4SA 4TU7A 1WI6A 3TAPA 2GGPA 2KFZA 5C42B 3MGJA 4M5DB 1C0TA 4CP5A 2EFGA 3G71S 4OYPA 1QVFR 2HS0A 2RNEA 4KHMA 1DARA 2VBWA 2K2PA 2CNKB 2DR8A 2RKIB 1MG7A 5L9NA 1JJCB 5KFIA 3MEKA 1XR6A 1RA7A 2KI2A 2KTQA 5C42A 5DLFA 4HKQA 1KNZA 4M5DA 2EKYA 3AY0A 1HWIA 3C6TB 4ALZA 4DS4A 1NK6A 1VJQA 4MK8A 3CCRS 5E0OA 4WFBQ 4ECTA 1FDAA 2W7OA 3KLEB 1U48A 1YVFA 2A0FB 2FJVA 3AOCA 3D1QA 1U1LA 1U1QA 3V6KA 2RKIA 3PEJA 1DZ5A 3X3UA 2ZBPA 2HQFA 3HPOA 3PW7A 3GU0A 4R25A 1YHQS 1YI2S 5SZTA 3IXQA 1SJQA 4RUAA 3NGKA 3GTYX 1S48A 3P96A 3KLEA 3DKDA 1LK5A 4IKAA 3JS9A 2YWEA 4CIOA 3QNWB 2JVRA 2K3IA 4ELTA 4JI7J 2D3ZA 5M2UA 2IHR1 2HS3A 2F8MA 2YWHA 4MT1A 4C8YA 4K4TA 3MEGB 3BEGB 3T9NA 2X1AA 1LWCB 2F9DA 3RBZA 4L74A 4OYOA 2YVSA 1P6TA 4A8YA 3F0NA 2Q43A 1TV6A 3J81Y 1NLKL 1NK5A 1BMQB 4YEAA 2E5LF 3QRPA 5IV3A 4DL7A 3D0HE 2MZTA 4KYZA 5KG7A 3M8QB 1SI9A 3VVTA 2YNGB 1HD0A 1JXEA 3H5XA 3NKYA 2RRBA 1NAQA 3K8VA 5BYSA 2BUNA 2R4FA 3RYLA 4J9NA 3GYXB 3TUPA 1QAIA 3H5UA 4HTJA 3GIMA 1J27A 3GJQB 2CKWA 2COLA 3MEEB 2DY9A 2J0QD 3MFHA 1S1VA 3SV3A 3JQKA 3M8QA 4JV0A 2XZDB 2YNGA 2VQEJ 2XYGB 1CS4A 4DSJA 2ERRA 1V5VA 4NLVA 3UO0A 2O66A 3A8KA 5ADZA 1HMVB 2JL9A 4M5LA 4PAAA 4G1QB 3QGPA 3MEEA 5LJ5Y 2MQMA 3D3BJ 1PSDA 1YJVA 3SXLA 1V5IB 2WK4A 2LEBA 4FBUA 3CDEA 5GMDA 1X9WA 1RWNB 1HI8A 1YRTA 5L1JA 2JRSA 3W8GA 1Q7YT 2XHWA 1BHNA 3BPSP 3CO9A 4B3SF 4M1KA 2BMBA 1WC5A 2FUG9 4G1QA 4P10A 3M6UA 1WWHA 4ES1A 4K4VA 1PKUA 1J5OB 1VQNS 1AW0A 3R5JB 2UXBF 3GFXA 1F0XA 3KLVA 3I87A 4FYYB 4E98A 2BW2A 4DS5A 4WFZA 1BWEA 1XBWA 3K5MA 5ETOA 4NI2B 4DHVA 1DHMA 5IM0B 1HYSB 1MSWD 3FMWA 1J5OA 1UA1A 1JLQB 2ASYA 3I0RA 2QT7A 3M2RB 1IBLJ 1ZPVA 2ZHOA 2VPWB 1SJFA 4DR7F 1ZOTA 3LPEA 2Q3PA 2DHAA 3BPDA 3GSDA 4F04B 1WKLA 4GKKF 1MNEA 4EZ9A 3N6MA 4RX6A 1RWXB 3CJKB 1VRUB 1IQZA 1NJYA 4NLOA 5KFSA 4NLTA 1CC7A 3JTNA 3M2RA 3FJ2A 2FTRA 4ZJOA 2WHOA 1GT8A 3AQOA 2BZ2A 3V4MA 4HDGA 4OJGA 1RE1B 3QZ8A 3MZIA 3TANA 2E1RA 1VRUA 2NXEA 1UFKA 5LMNF 3PCOB 4UT4A 1R27B 2XMTA 3Q8QB 1DURA 2VD3A 3VVUA 3PW4A 2E1AA 2YNIB 2F9JA 1MMDA 2ZOFA 1U09A 1EZZB 5LSRA 3MCSA 2QA2A 3NWRA 2Z2YB 2R7OA 3ZXWA 2VUGA 4RWXA 1HIYA 4DOZA 2VQFJ 1KQFB 3EICA 2XWYA 3TNVA 2CFXA 1QVGR 3B82A 2YNIA 1S0NA 3NGRA 4C3MA 1VS3A 2MKYA 2DO0A 2AIRB 2HQCA 2RDJA 1K47A 3KDNA 2JDJA 2DH9A 3HVRA 2ZJQQ 4LFAF 1PAEX 3M7VA 4ZJLA 3DRSB 1VQ5S 5CYMB 3BO2A 1WHWA 3QJPA 4ZCLA 2XB2D 1MW7A 2BM1A 1RBOB 3OJSA 2WW8A 2AZ1A 1JWWA 2P5VA 5EX3A 2V4JB 3L95X 1CJKA 1VK8A 2OMOA 5IT9Y 3HZEA 1H6KX 1TUVA 1UWAA 1D9DA 5CYMA 2B4PA 3MTKA 3GIJA 2ZJPQ 1HNVB 2XO6A 2FHJD 2LKZA 3C66A 2ZOGA 4ZCKA 4P2FA 5I42B 4DR1F 2W2OP 4M8LA 2OHDA 3RRHA 2V4JA 4O4GB 4UQGA 4NX9A 2ZE2B 3FGVA 3PX0A 3EPGA 1JLAB 4ECWA 1ZPWX 4OI2A 2QG9B 3FEZA 2CZVC 4K4XA 1RAIB 2RRNA 1GNKA 2QTWA 3JSMB 1WTBA 5I42A 3FRYA 4ED8A 3G6ES 5IXUA 2VIHA 5DG8A 1OYDA 4O4GA 4WFAQ 4XIUA 2FJBB 4WKYA 1VQOS 3RW6A 3B8HA 2ZDPA 4ZP8A 3PEHA 3ELHA 1SKWA 2HHSA 2ZE2A 3K5PA 4MFBA 2KT3A 1FFWB 4RUBA 1VQ4S 4NYOA 3CJSA 4X4OA 2C42A 5DDRC 4C2MA 5LMUF 1GAOA 1FKAF 3MM6A 1T9XA 3T9ZA 4BHQA 4HR2A 3D0GE 3T6BA 3OHBA 2CG4A 3PRVA 4OX9J 2WVEA 4B3MJ 1C0UA 4LSZB 1JK9B 1M5OC 1RAFB 2BKNA 1RTZA 1HI0P 1Y3KA 4EK2A 1B0VA 3HXMA 4TY8B 5JVHQ 2UP1A 1ZTTA 4DR3F 3UCUP 1FNXH 4ZVHA 3I9V9 3TO8A 1FJ7A 3TARA 3H4BA 5D4OA 5L38A 4U95A 1WKJA 3JSRA 3EDQB 1N8RT 3W2VA 1Q1KA 2YKOA 3T19A 1B0PA 3CJ8A 2LLZA 3GYGA 4GMKA 3OD2A 2MSSA 3HLUA 3PW5A 5I3UB 4TY8A 3W64A 5KFLA 1X9SA 3PJWA 3UPFA 1P9YA 5D0GA 2DNRA 3ZZRA 4PPZA 2Y1IA 3QT6A 4LFCF 3GJSB 3BYRA 1FO1A 2GQCA 3QIPB 4X84A 4CNZA 4F4YA 1EP4B 2PE8A 3E3XA 1WEZA 1X5SA 2ZEJA 2N7YA 2QLFB 3VAHA 5EDWA 1M5KC 2OEMA 5J2QB 3TAMB 5I3UA 1QE1A 2VHGA 2WB4A 2HEKA 2I6WA 3J80U 2RQCA 2CZ4A 3QIPA 2NR0A 3HKWA 3V6DB 2YQ0A 1U24A 2AU0A 3TQEA 1JJ2R 1EP4A 3T6JA 3CJ3A 5HANA 5EHHA 3I55S 5J2QA 3TAMA 1X4CA 1MMLA 2XMMA 4LJMA 1TVRA 3D4JA 4DUYJ 1YJRA 2HHHF 3O8WA 2DKOB 2YKAA 1N32F 4OV1A 2J6SA 3A3PB 5DM7Q 1N34J 3G9CA 3VQSA 4MAKA 2MSTA 1FDBA 5LL6d 4ILMA 2CNOB 3OL9A 2Y1JA 4DPWA 5I4MA 1RA6A 1R6YA 3VGSA 4OHWA 2YH1A 2NPIA 2CQBA 1BE4A 2E5GA 4DSFA 4H4KC 4Q44A 1X7VA 1LV5A 4IG0B 4YOEA 3UDVA 1UCNA 4DUZJ 4I67A 1V3SA 5L9XA 2E1MC 2HAFA 1S1TB 3POTB 2M0GB 3BSAA 4P75A 1UKUA 2A6OA 2DPJA 3IA0A 5K8MA 3MM5B 4IG3B 1ELOA 2R8KA 4N47A 4Y2MA 1T3NA 2EFNA 2BOAA 2WZ1A 4JI1J 5IT0A 4AYBD 4X4QA 4ED0A 5CABA 2ROPA 2CPJA 1SJ1A 3HX9A 2DNLA 1M5SA 4UUXA 1S1TA 3GR0A 2HFUA 1NHVA 2JVOA 1RU2A 3POTA 5B08A 2NUHA 3GE9A 2NYHA 4IG3A 2KHDA 2WVDA 4TU9A 2YPYA 1N33F 2B4VA 2R7SA 5E41A 3FDSA 1KKHA 3AH6A 3J7Z5 3V5RA 1I1GA 1UPPA 1FNOA 3J80Y 1Q86T 1BXNA 2P6SA 3OTOJ 4Y3CA 1IWAA 2VKRA 2ZUGA 2C28A 1SXLA 2P2CB 5D4LA 1SKRA 1Q5YA 2HQGA 4DV5J 3P8BB 4DPYA 1LW2B 2X1FA 3K5OA 3AXKA 2G2ZA 2KYZA 1RK8A 4OLOA 3HHEA 3OQ2A 2I5JB 1M90T 2C2RA 4RKUC 2DHHA 4KHPJ 3I82A 3HF5A 3M6XA 1QUVA 4GC7A 3TX0A 1F5CA 1LW2A 1FKOA 4EZ6A 4U8VA 3A4TA 2UV8G 3I4HX 1LKZA 4OZNA 3GFYA 2HK2A 4HTIA 5DM6Q 3M8PA 4ITSA 2I5JA 2HG4A 3DOMB 1TAQA 4IH7A 3DRRB 2DXFA 2HKEA 2IM0A 1ZAVA 2ZBRA 3LPYA 5JXSA 5A8KB 4ZJQA 1WF2A 5I3PA 1Q81T 3DYAB 3D68A 1FRJA 1WSRA 2EFPA 1NJZA 1GK8A 3D3CJ 2PMZD 2WRMA 3ICLA 1IXKA 2GJFA 4NCBA 5H9FJ 1YGYA 3GP9A 3DOMA 2CQ1A 3DRYA 2KXNB 2GFFA 5GAHU 4YY3F 1B7YB 3VAIA 2IC3B 1AA1B 3RZAA 2VG7B 5CHCB 3K59A 4FDFA 4C11B 1T9UA 5MAOA 3T1YJ 2LA6A 3CUNA 2OPSB 4UOHA 1H7WA 3CWJA 4YR3A 3AD8C 3W5ZA 2XHCA 1D1UA 3V6HA 4TU8A 2XGQA 2D7SA 5DG7A 4JV1A 3R6GB 2R8JA 2CQDA 2RH3A 3GZ7A 1T9WA 2VG7A 3E2EA 4C11A 4DR5J 3KG4A 5CYQB 5ETSA 2BANB 3U7JA 4KPYA 3JSYA 4YHHJ 3NAIA 3EZOA 3NOGA 4K50A 1UJ6A 3UDEA 2MJNA 1MMNA 1HNXF 4RPFA 3MPYA 2FZGB 1IJEB 1RI7A 5E3RA 2PT0A 2XCAA 3MECA 2MMYA 3BYPA 3W9IA 1NPRA 4DLEA 4V19J 1SJ4P 3K7RA 3VWSA 2VF3A 5CYQA 2D9PA 1JKHB 4PG4A 4R5PB 4Q8FA 4DR4J 1ZH5A 2Q6BA 3MCNA 2IAJA 2XBPA 1TKZB 1AZSB 3EXYA 4FPIA 7FDRA 4ZPVR 1T05A 4ECQA 4DV4J 1D3WA 3NP5A 1FTRA 2OIHA 3KLFB 2MZSA 4RR5A 2JEFA 2BV3A 1VBYA 5GAGU 4RW9B 2OGUA 4WP8A 4FVCA 2IDLA 1NHKL 2RIJA 1KP6A 1C2PA 5HL7Q 2ADCA 3ENVA 2IJFA 2XMUA 3W61A 2FHMA 2XGPA 3IR6B 3M30B 2OKQA 3KLFA 4NA2A 2DCUB 4UQTA 1HFEL 3QGIA 1LWFB 4YUDA 4RW9A 1RLDA 4ELUA 2GO9A 1S5ZA 1PBUA 3W5YA 1KR4A 5K9FA 1JXLA 3R5BA 1RCOB 1SV5B 2WSEC 2V6AA 4JYAF 4ECVA 3KK3B 4ECUA 4LF9F 4DPOA 4QIEA 1UWBB 3AD9C 2BJ3A 1LWFA 2V2ZA 5EN1A 3DLKB 4C0OC 3SCIE 1FRXA 3SCKE 4RNMA 2FY8A 1TL3B 4C97A 4D3HA 3BBBA 1SV5A 3AQPA 2GIRA 1G6BA 4LF4J 4K4ZA 3KK3A 2ZH5A 1SQEA 5E3PA 5T41A 4NLGA 4HDHA 3VV2B 2EFQA 4C8MA 4OZ3A 1RGVA 3TZXA 1UWBA 1L5UA 3FSYA 3PO5A 3DLKA 3TP2A 1SUQB 2G4BA 3IGVA 3AOAA 1YG0A 2UU9J 1R8AA 1AUDA 1IKWB 1IM4A 5K14A 5HBMB 4TNOA 1TL3A 2BA9A 3IM9A 3ZZPA 5KT6A 1XNQJ 1RT7A 3SCLE 1QLNA 2F8EX 3UR0A 4R8UB 2R42A 4JI7F 2CQPA 4YMEA 3R7SB 2M8HA 3BGUA 1R31A 2QSWA 4ZN3A 4DF8A 4CDIA 3R8YA 3BJYA 4B3OB 2B6AB 4KRWA 2ZD1B 1IKWA 2CVEA 5HBMA 3VZIA 2FY1A 2KVQE 4M5IA 1GXTA 3V4IB 1S6OA 4B9TA 2NS1B 4ZMMA 2HAIA 4R8UA 2LVWA 3J81j 2N4CA 4LF8J 4PXCA 1RHMB 3D1OA 2Z8QA 4DR2F 4B3OA 2B6AA 4B02A 1Q0NA 2XNRA 2GIFA 1RYRA 1S79A 4HI1A 1SH2A 1RWUA 5G0RA 3V4IA 4DN9A 4OHYA 1VISA 1X8DA 3ITHB 4O0NA 2BR0A 2CDQA 3N0VA 1KVJA 2MQNA 3DLGB 2MDAA 3L7UA 2YX7A 3W2WB 2Y0BB 4NXNJ 3P6YC 5RUBA 4WYWA 3T5LA 2HVEA 4WXOA 1RSCA 3KLIB 4DMZA 3IRXB 2OEKA 2FVPA 1YZ6A 4OI4A 5F9NA 3SYZA 5ETKA 3ITHA 2AZ3A 2LECA 2FJEB 4C98A 3DLGA 3ZC4A 3W2WA 5GAHI 3MMCB 2R2SA 4CLZA 1RAJA 4O4RA 3PFOA 1X9MA 1HARA 1FK9B 2HQDA 3LAKA 4NOHA 4DSEA 2V8DA 3IRXA 3D9BA 3DMJA 1GQEA 4FKYA 3LP0B 1HNZJ 2E9ZA 1CSJA 2M88A 3BS9A 4P2SA 3C3LA 4ZHRB 4B17A 1T95A 1F6TA 2RU9A 3IBWA 2PFDA 1HQUB 4LBHA 4I4BA 3CXCR 2IIHA 3D67A 1N52B 1NM2A 4UOFA 1FK9A 1WEYA 5CD4H 4PYDA 4ZPTR 3RRGA 1MU2B 2P8IA 4K0KF 3LP0A 3V6JA 1MWZA 2EEYA 4FVMA 3N5FA 2CIMA 2WVBA 4XPEA 1DQ8A 4IR9A 4K7QA 2DNPA 2Q6CA 4ZHRA 5F8IA 3G2XA 1VQ9S 3MTJA 3S7RA 1HQUA 1R6VA 3DLJA 1H0HB 1FJEB 4U9RA 1U1OA 1VHFA 2IM3A 1HBOA 3T41A 1TAUA 2MZRA 4Y2KA 1MU2A 3LANA 4Z7CA 5FIIA 1QTNB 5KFZA 4JV5J 4PYAA 1RJJA 3G82B 2A18A 2H5EA 2ZZTA 5E33A 4DX6A 3VGVA 4QR2A 4I2PA 1WSVA 4NXMJ 3A12A 3QSIA 3OUYB 4USWA 4C8OA 5GAGI 4G3IA 2XZWA 4HHHA 3I0SB 2J76E 4QOTA 3K2YA 2BQ3A 1NZ8A 4UY8T 3MDFA 1WG1A 2I38A 1U7LA 2LU2A 1CJTB 4IRKA 2AJ0A 3G82A 4ILLA 4F0HA 4Q5VA 2W8KA 3MHYA 1SIZA 4JI6J 2LQJA 5J2PB 5ETTA 5KFAA 2DNHA 2O5DA 1F3FA 4WBFA 2DK2A 3EGVA 3CVKA 5KT3A 3BQ1A 1SKUB 1NXIA 4TN2A 4FN5A 5HLFB 1HHSA 4F8RA 1MROA 1S9FA 2W4CA 2G0JA 3EJMA 3SZ2A 1HQ2A 1CJTA 2OAUA 3OL6A 4WFNQ 3QBCA 3DU6A 1KWMA 4PWDA 4DV3J 4LRFA 1XEZA 3AT1B 1LFPA 3Q23A 2V69A 2ZH9A 5J2PA 3S01A 4GVBA 3O6QA 2JFKA 4PPDA 1QAXA 2K1RB 5F8HA 4EYHB 4UOGA 4LF1A 1CULB 4UZBA 4NL5A 3BGFA 5DDQC 2L9DA 4G6VB 2X7IA 3DGPB 4J5OA 3PIPQ 3HP6A 1WKKA 1MN9A 4CTAB 2BVZA 2CJQA 3HSZA 4XK8C 3PZPA 2CPDA 4DR6J 1SJRA 4Q8EA 4RW4B 2QYCA 2CPIA 2K1RA 3C16B 2KHCA 3DDNA 4DFPA 3P5TL 1UZHA 4PQUA 2Z2LA 2HZVA 4DLGA 5A0YB 1HW8A 4A8QA 1EIYB 1B4SA 3I5BA 3DGPA 1SC6A 4NYPA 2ZH6A 4E2FB 4WU2A 1N4LA 4CRJA 4ANCA 4G1IA 4RW4A 1T0TV 3C16A 4QR1A 2HS4A 5B0AA 3C14B 4CLPA 1X4HA 4KH1B 2GMLA 2FLPA 5KFNA 2XNQA 2BBEA 3P5BP 1TP7A 1EQ0A 3SV4A 3IM8A 1EX8A 3AJ1A 1F5AA 2QSFA 4JI4J 1TL7A 1S4EA 2GMJA 3CTRA 1N5TA 1KLMB 2V2QA 2L9NA 1N6QB 3ILLA 4ZLLA 1ZS6A 5H9EJ 3CMES 4HHJA 1HNWJ 1F2GA 4LF7F 3GLJA 3SFUA 2DGOA 4RLEA 3D2WA 3NY0A 2UUAF 3FCHA 4MIWA 1UVMA 2MZ1A 4U8YA 1UEUA 3HZGA 1WC6A 2I9SA 3W3SA 1N6QA 3VTIA 3PVXA 3MOJB 1P1TA 4CWBA 2W24A 3W7BA 3GCXP 1EKRA 1T94A 4OQJA 1TU0B 1X4FA 4KGZB 3HSJA 2NYIA 3DLEB 4B3TF 2Z56B 4QIVA 2H5IB 5EWGA 1L3UA 2M5YA 2MKIA 3SQGB 5D4NA 2JFDA 2BEFA 1RLCL 4B08A 2ATLA 3DC2A 4QWCA 3OSNA 2UUBJ 4HL9A 1DTQB 2K7JA 4IRCA 1NUEA 3ZTOA 4HLBA 2VPZB 3CJTA 3DLEA 1RTHB 3TJ8A 2FB0A 1S7IA 4J91A 3EGWB 1NCLA 3M2VB 4YR2A 1BLUA 3SQGA 1R3NA 3QLHB 3MEDA 4ZCIA 3UW1A 1IBMJ 4HH1A 5KAKA 2DHGA 3ENAA 4TLQA 4ZLPA 2MEWA 3Q2SC 3R3TA 4A46A 3LTOA 4KKOB 1RTHA 5KFXA 4ZPWR 2ZC4A 5E2QA 3SDEB 4CLKA 4O44B 2CAJA 4F4WA 3HVTB 3CCJS 3UI3A 1IBKJ 3TVZA 3M2VA 4EWTA 3DM2B 3BR8A 2ZC3A 3Q8SB 4DZDA 3EXCX 2C22A 2ZFHA 2DIUA 1JXVA 5IQQA 4PRFA 1I6JA 1FEEA 3GPAA 1R89A 4RNNA 2LP4A 3PACA 2ZM6J 4U6PA 4DCOB 3S1TA 2PEHA 3SDEA 4P2XA 2DO4A 3CSKA 3UNGC 1KQKA 2DEIA 2V9KA 3DM2A 1Z4UA 4USKA 3M6WA 5BR8F 2AD9A 1TK0A 4YR0A 4EUVA 4ZP9A 3DHWC 1K73T 3S6EA 4ZKAA 3NG8A 1OPIA 2DT9A 1DLOB 4W90B 1D0EA 4OZ2A 2PMHA 2Q66A 4DPTA 1PAUB 1NEEA 3PM9A 3QWPA 3AFGA 4NLSA 2L08A 2NXJA 3PDNA 1FVSA 3FSXA 1RXOB 1X31C 2QLJB 1RWPB 2V0NA 2IVYA 2E9RX 1Y00A 1XMOJ 1DLOA 3HD1A 3DLBA 3NXZA 4HACB 2NZ4A 1BQNA 1TKDA 4DUZF 5C5JA 4QWEA 3Q8RB 2HPUA 2DPIA 4PQAA 1YBAA 3UFCX 3V81B 4C0HA 1TFWA 5C25B 4OI6A 1TZ0A 1G1XA 2VG6A 5HN0A 2O1PA 3MMBB 5ETVA 1H2UX 2HNYB 4DEZA 3TEGA 3W1YC 4CLTA 2GJ2A 4K4SA 3CDAA 1S9GA 3LQVA 2CWXA 4KTQA 2V9WA 4X4VA 4KSEB 5C25A 4EBEA 1P9QC 3MMBA 1IKYA 2CYYA 1UPMB 4XDCA 5A8WB 3ISNC 3M1VB 3G8TA 2KU7A 4I69A 2FVSA 1M5VC 2CG8A 2QRRA 4RU2A 2E7VA 3PHTA 3ULHA 3VAMA 5F0UA 4KAIA 5IWAF 5F8LA 2UVUA 3RBEA 2JWNA 1O0PA 4NPOA 2XMVA 3UD5A 2AV5A 3CEDA 3FMBA 4DV5F 2KG1A 4OFZA 4W4MA 1JIHA 2EW9A 4ZIVA 1PILA 1LWEA 1JLGB 1GMWA 2DNNA 3WHIA 1NSAA 4JI2F 1HR0J 4KHPF 1FJGJ 2N3LA 2QX0A 4KE5A 1VOMA 3VR1A 3IS9B 5U47A 5DDPC 5KFMA 2HBYB 3LP1B 1JX4A 2PN6A 3CIZA 2KKHA 2J0XA 2ZBCA 4YP3A 5JUMA 2X51A 2GMHA 2ZH7A 4OV6A 1FF2A 5KFYA 2BJ9A 1VIXA 5THWA 1MN7A 1YBUA 3KHHA 1FERA 4PXDA 3ET6A 3M2UA 1RQ0A 3IS9A 5E3QA 3Q2TC 4FF2A 4KR0B 5KFOA 1PIEA 2ZWPA 2HQIA 1B70B 1KBRA 1NRKA 1EHWA 1TMMA 1ZA1B 2XSJA 3M9NB 1XNRJ 1FVQA 4Q0BA 1RZMA 3MUMP 1X4DA 3QATA 3H90A 3US5A 4ZN1A 3UQSA 3VQTA 3T1YF 3UVJA 4M5MA 2WSCC 3PW2A 5AT1B 4IH6A 2AT1B 3TUJC 3TWZA 2YWWA 4URQU 2D41A 4DV1J 3R27A 4HT7A 1V6HA 2DGVA 5HQLA 2MKKA 1V9OA 4HYKA 4E8UA 2Z4PA 4F67A 3HFZB 3KNGA 2X1BA 3K89A 2XS2A 4BWMA 1XERA 1TKTA 4JI0F 3CJQA 2RE1A 3H40A 2W9BB 2WVFA 4M63A 3A8IA 2F1FA 3M32A 1P27B 1DFDA 2QEXS 2DNZA 2AGQA 4LRDA 2EBEA 2EK6A 3OXGA 4DR4F 2UUCJ 1AFJA 2AP6A 1VYAA 2AYEA 5HJYA 4LF2A 3OFHA 3UD3P 2ZZMA 3LOUA 1X4AA 5L8RC 2FGCA 4DV4F 1OY8A 4QQBA 1D8YA 1T3OA 4NLUA 2MY7A 3HVWA 4F36A 3MR5A 3TZYA 1JLBB 3C15A 4J37A 2AJ1A 4DQIA 3PO4A 2J9CA 2FVRA 3H7HB 4Y34A 3NS7B 4A48A 3JYTA 1APSA 5F8GA 2GVDB 5B0DA 5KG0A 4ZVQB 5FJ4A 3C46A 3L09A 3I32A 1EJ7L 2SXLA 1K0VA 4DF4A 3CD0A 4X64J 1SB6A 3NS5A 3PXGa 1LFWA 2UXCJ 1F1BB 4QCLA 4CH0S 1RT2A 4LFBJ 5LXYA 2E5IA 3RUBL 2QA4S 2XMJA 3FCVA 3DN9A 1HPZB 4X4PA 1X5OA 1FX4A 2AJ4A 3NNCA 3CD7A 3D5MA 2QO3A 4IO1A 2GVDA 4CZCA 3NNAA 4ED2A 1A6LA 4DX7A 1X0PA 1KLNA 4XO0A 1LQ9A 1CLFA 2A1BA 5GAEI 1KS2A 2EFVA 1KTVA 3BGLA 2ZHBA 4F4KA 1S1XA 1XN9A 2OUGA 4LBIA 2FIUA 1FFSB 1HPZA 3TJAA 1TL4A 1VRTB 3AAWB 4OI1A 2GO8A 4A8XA 2JLGA 2GS8A 2RAQA 1Q95G 3AJ2A 2KL8A 5GVQA 4OLPA 1WOPA 4B9SA 2XYHB 1IR2A 2DGTA 4FPRA 1YRUA 5AE3A 1RKJA 2GAHC 2J6UA 2W2PP 3NNHA 2IRUA 2H5JB 4EBDA 3GMGA 2ZBQA 4F2SA 1RT3B 1S99A 4HVZA 4C48A 3MAAB 2BM0A 4FYXB 1VRTA 4DSIA 4C3LA 4IFYB 3VAKA 2JEGA 5DZ6A 2XMWA 2V8VA 3TOQA 4ZS6A 4DL5A 2HWHA 3T1HJ 2VFSA 1S76D 2CPXA 1F3VA 1N54B 1U2RA 3FFIA 1XC9A 1HLWA 1PJ7A 4DV7F 1RT3A 1VK3A 4WWSA 2BKPA 2H51B 3MAAA 1RBAA 2EI5A 4PR6A 2WB1D 4C0BA 2V68A 4H4MA 3DGVA 3LO3A 2DJWA 4ED5A 4P72A 3MUVP 4F0MA 4CO5A 1C1CB 4CO1A 3BSCA 1ZM4A 4F3QA 9RUBA 3MR3A 2C3PA 3RB6A 3OSPA 4LF8F 2R8IA 3N28A 5KTQA 4AE5A 5GMEA 1NJXA 2YPZA 3JQJA 2ZVIA 2RHSB 3TYTA 1LEOA 2H4WB 1FKPB 4ID5B 1WG5A 2VOOA 3FQLA 5JVGQ 1C1CA 4OZ0A 4N76A 1DJ0A 1QM9A 1HNIB 2K3KA 2XQCA 1HWKA 2QLBB 2BE7D 2HLTA 3NGDA 2B5JB 3J81U 3EM1A 3RJMB 4MMOA 2O3DA 3TVKA 2IA6A 1FKPA 2ILZA 1H38A 4RBTA 2OPQA 4MH8A 1NJWA 5HMWA 3BGRA 2G2YA 3HT0A 4TKTA 2E5LJ 4LSLB 2CQIA 4USJC 1VQ8S 4DQPA 4UZCA 5CZXA 2NPFA 2B4UA 5T7LB 1S72S 1IJFB 4Y2CA 3EZ5A 1U49A 3CJ2A 3QT5A 2ROEA 4A8KA 4IH5A 3OTBA 2ZHAA 4ZVPB 3MPUB 2ZH8A 4LSLA 1UVJA 2HNDB 1D9FA 3VCDA 3BB5A 5D0RA 3DNCA 1RHRB 2EVZA 3GSIA 3CMQA 4ZLJA 5IQ6A 2CADA 1JMTA 1T9YA 5HQMA 5A2QU 4B3RJ 5DQIA 1QSSA 2AEMA 2HHWA 4PKDB 2JNJA 3EYZA 3PW0A 2FVCA 5KFUA 3ZZ0A 1RTDB 1UTAA 1RT1B 3GQCA 2BQRA 3BREA 5LXRA 1MWYA 1URRA 2DCLA 4IOBA 1VCTA 3C6TA 1WC0A 2NSCA 2AGPA 4JV5F 1QUPA 4K4WA 1FXDA 4CLFA 5F8JA 2WAQD 5KG6A 2BX6A 1K8AT 1U4BA 2JEJA 4MKYA 3OT9A 1RTDA 2GZOA 2FJDB 3M4XA 4LRBA 1RT1A 4DWIA 3LF0A 2ZH4A 4K2XA 2RUGA 3C19A 1DAXA 2DNMA 5K8PA 3HMJG 1ZAXA 2H9ZA 3CJ5A 2EPIA 1FTCA 2B9EA 1RWWB 2ALZA 3CCZA 3GONA 4JI6F 4EMDA 2F4VF 4K8RA 4RNFA 4X2BA 4ZVEA 3IP0A 3MEGA 1VC6A 1LWCA 2CPFA 2R7TA 2KB2A 1FEHA 3BF4A 1RABB 4JI8J 2LQBA 1U0SA 2ZOMA 5J2MB 1S57A 5AJ3J 1KHVA 4KO0B 3KLHB 5F8MA 3OXLA 2ZNZA 2QV6A 2MQLA 3KK1B 4NYZA 2XCPA 4OJ1A 2IM2A 4TVAB 2FLNA 2UXDJ 1GFWB 1RCXB 1R8PA 1XIQA 2OH2A 1O51A 2N4DA 4J9PA 3G6XA 1WOSA 3M05A 1Q53A 1OY6A 3A13A 4WTYA 5FD1A 4K4YA 3KLHA 4GC6A 5A2QY 1P1LA 3W9HA 5LMNJ 3DLHA 3JXOA 1F9HA 3GCWP 2CRLA 2IVFB 1YJNS 3KK1A 3EVWA 3LGHA 1UP1A 2AYMA 1W26A 4N5SA 2VL1A 5KT7A 3TJ9A 3DFEA 3ZZTA 4L72B 2XLJA 4CT8A 2BYCA 2CWKA 2DNOA 1S77D 4PXEA 2R7UA 3PJXA 4DL0C 4NEYA 3EMTA 5D78A 1U1PA 3KXDA 4CQ1A 1HMVA 2MHNA 2MZQA 4IO9Q 1Q82T 3NRBA 1U1NA 2PO4A 3UCZP 2WOMB 2W7PA 3PYGA 4Y2IA 4JI5F 4CLWA 1I51B 1OYEA 1BD6A 1W25A 4PXBA 5IC6B 2KZZA 5F9LA 3B4DA 1ZZFA 2D3O1 6FD1A 3HJFA 2ABYA 3PTWA 1SC4B 3OXFA 3CD5A 4LFAJ 2XY5A 2IJNA 4DG1B 2C2EA 4OYMA 5DQHA 4NA3A 4EYIB 4RL1A 2F7VA 2FZKB 3G87A 2YX4A 1WHYA 2MLXA 3HULA 1RTIB 4FXWA 1G4CA 3FK4A 2C2ZB 3HHLC 5IT9U 2ZH1A 4NI2A 2J0SD 5IM0A 3GV5B 4A8MP 2M2BA 4QWBA 1HYSA 3G8SA 1U47A 3MR2A 1KFSA 4DG1A 1JLQA 5L1IA 2PEBA 1YJUA 1H3DA 1GMWD 2DNKA 1Y5LB 1GX6A 3I5CA 2YXLA 1RTIA 3TUZC 3QIDA 5G4DA 4DR1J 1VQPS 4WE1B 1JJHA 4YS2A 2BRLA 3OJUA 3KWMA 1Q8LA 3CJKA 3ETMA 3MXHP 2BE2B 3UDCA 1NNDA 3CE8A 1R8HA 3MCMA 4IQXA 4L73A 3AA9A 1T7PA 2CJYB 5K5MA 1KQSR 2X3DA 2R7WA 1UETA 4WF9Q 3KLGB 4KV8B 3G8QA 4I1TA 1NK8A 4J9RA 1LW0B 4RWWA 1S4FA 2VBXA 1NK4A 2BE2A 1WNEA 3QAUA 2HLUA 3NCQA 4M5HA 4X66J 1WC1A 1FRIA 3ZTSA 4LIRA 4OYXA 5HMXA 2OO4A 5SUHA 4BBYA 1PYSB 1GXLA 4KFBB 1QSLA 3AA8A 2NXCA 2LMIA 1KOHA 2DXDA 1FWLA 3K5NA 1LW0A 3QPIA 3OVAA 5HP1B 4AL6A 5KFTA 1GX5A 1SQFA 4OMFG 3N5BA 1RAGB 3WC2A 2J5AA 2PI4A 4J9LA 4DV0F 5KFEA 4DV6F 4N8NA 2Z0GA 2ZM6F 2D9OA 1Q78A 2AF6A 3KG1A 3P4UB 1OPZA 4QPXA 1ZAWA 4O3QA 2CVIA 1TK8A 1KDNA 2DGQA 2HHTA 3DRSA 2VC1A 1YKWA 4LR8A 3R1HA 2UVVA 4PG5A 1Q4RA 4JI3F 1T9TA 3NMAA 2OPPB 2JX2A 1RBLA 1VJWA 3H2VE 3I5AA 4LFCJ 4KGMA 2D3OR 1TMJA 4RW7B 1S49A 4WFXA 2RJZA 1NDCA 4QW8A 2G13A 1RWOB 1CPZA 2VA3A 1A9NB 3GR1A 4PWWA 4K4UA 4S0MA 1HNVA 4KPCA 1KC8T 1B99A 4LF5F 2OPPA 1XMBA 2JHEA 1X60A 3M9OB 1N5YB 1X5TA 4NLRA 2KZMA 4QYZK 4BC7A 2AGOA 1R0AB 1FRMA 2FYXA 1UW4A 3M8YA 2J9EA 3C2PA 2LQ5A 2HHUA 4CI0B 4NLXA 4MIAA 3L7OA 3U27A 1LXNA 5FLXU 1W2IA 1NH8A 1JLAA 4TXSA 1AB8A 1M0SA 2V2VA 3NBPB 1Y7PA 1S0OA 2VZ9A 2HBQB 3JSMA 2EK1A 1J5EF 2HHHJ 3D6TB 2CQ4A 2WCXA 4OX6A 1N32J 1BY9A 2AWZA 1R0AA 1HWJA 3KJQB 2G0CA 2GNKA 3CULA 4ECSA 3D6MB 4C8NA 1BWVA 3FZBA 4PCQA 1HQEB 5D77A 1L3SA
chains in the Genus database with same CATH topology
2HBRB 2C2OB 2C2KB 2QL5B 4ZVRB 4ZVSB 2QLJB 1RWPB 5IC4B 2H54B 2QLFB 3D6HB 2CNKB 2CNNB 4JB8B 2P2CB 3R7SB 1SC3B 1ICEB 1QDUB 1RWOB 1RWKB 2QLBB 1IBCB 3RJMB 2H65B 1PYOB 3R6LB 4LSZB 1RHKB 3IBFB 2H5IB 1BMQB 1RWXB 1RWNB 3D6FB 1QTNB 2Y1LB 1I51B 2C2MB 5K20B 1RWVB 3R7BB 2H51B 2XYPB 3EDRB 1NMEB 4DCOB 2QL9B 5IC6B 2H48B 4DCJB 3GJRB 4DCPB 1RWMB 3R7NB 1SC1B 2XZTB 2C1EB 3EDQB 1RHMB 2HBZB 1GFWB 1F9EB 1RHQB 4ZVTB 3P4UB 1RE1B 2CJXB 2CJYB 3KJFB 2DKOB 3IBCB 2HBQB 1SC4B 3R5JB 3R6GB 4ZVPB 4ZVUB 3GJQB 3KJNB 1RHJB 2QL7B 2XYHB 2CNOB 3KJQB 2CDRB 2HBYB 2CNLB 3SIPB 3P45B 3GJTB 3QNWB 1PAUB 3NS7B 2H5JB 2Y0BB 3D6MB 2FQQB 2H4WB 2XZDB 4ZVQB 4ZVOB 3GJSB 2C2ZB 1RWWB 1RHUB 1I3OB 1RHRB 2H4YB 2XYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBR B;  2C2O B;  2C2K B;  2QL5 B;  4ZVR B;  4ZVS B;  2QLJ B;  1RWP B;  5IC4 B;  2H54 B;  2QLF B;  3D6H B;  2CNK B;  2CNN B;  4JB8 B;  2P2C B;  3R7S B;  1SC3 B;  1ICE B;  1QDU B;  1RWO B;  1RWK B;  2QLB B;  1IBC B;  3RJM B;  2H65 B;  1PYO B;  3R6L B;  4LSZ B;  1RHK B;  3IBF B;  2H5I B;  1BMQ B;  1RWX B;  1RWN B;  3D6F B;  1QTN B;  2Y1L B;  1I51 B;  2C2M B;  5K20 B;  1RWV B;  3R7B B;  2H51 B;  2XYP B;  3EDR B;  1NME B;  4DCO B;  2QL9 B;  5IC6 B;  2H48 B;  4DCJ B;  3GJR B;  4DCP B;  1RWM B;  3R7N B;  1SC1 B;  2XZT B;  2C1E B;  3EDQ B;  1RHM B;  2HBZ B;  1GFW B;  1F9E B;  1RHQ B;  4ZVT B;  3P4U B;  1RE1 B;  2CJX B;  2CJY B;  3KJF B;  2DKO B;  3IBC B;  2HBQ B;  1SC4 B;  3R5J B;  3R6G B;  4ZVP B;  4ZVU B;  3GJQ B;  3KJN B;  1RHJ B;  2QL7 B;  2XYH B;  2CNO B;  3KJQ B;  2CDR B;  2HBY B;  2CNL B;  3SIP B;  3P45 B;  3GJT B;  3QNW B;  1PAU B;  3NS7 B;  2H5J B;  2Y0B B;  3D6M B;  2FQQ B;  2H4W B;  2XZD B;  4ZVQ B;  4ZVO B;  3GJS B;  2C2Z B;  1RWW B;  1RHU B;  1I3O B;  1RHR B;  2H4Y B;  2XYG B; 
#chains in the Genus database with same CATH topology
 4P6Q A;  4MKV A;  3NBP A;  1HWL A;  3W5X A;  4OYA A;  5GAD U;  3LAL A;  4X4N A;  1LXJ A;  5A6W A;  1GTE A;  4DQQ A;  3FVY A;  4P7T A;  2WBR A;  4I64 A;  2RRA A;  5DJB A;  1HQE A;  2Y8Y A;  2HMI B;  3NAH A;  1GXU A;  4WCE Q;  1F5B A;  1OSC A;  4EGL A;  2R7V A;  3CCW A;  3BN7 A;  4Y0F A;  2ZVS A;  4GVL A;  5HI7 A;  3H0P A;  2YKQ A;  4KC5 A;  3BKU A;  3G6V A;  1SPB P;  2C3O A;  2HZA A;  1RHQ B;  2BAB A;  3QQC D;  3HFK A;  1HW9 A;  2POK A;  5E3C A;  1Y9O A;  3BGO P;  3HHL B;  4P9S A;  3EUN A;  1PGZ A;  3HD2 A;  2VB6 A;  2HMI A;  5DRK A;  4OYB A;  4OZL A;  1FE4 A;  2NZC A;  3LH2 S;  5EUH A;  2DRB A;  2IA0 A;  3M8R A;  2JEI A;  3LWM A;  3ISN D;  3QGH A;  1N33 J;  2VG5 B;  4UW2 A;  1ZYQ A;  3BM7 A;  4BLG A;  4ED1 A;  2V67 A;  1KN6 A;  3I9Z A;  3ZZO A;  5D4P A;  2WW4 A;  3N4W A;  1I94 J;  1YSJ A;  3MM8 B;  2DR9 A;  3HHL A;  1U0H B;  1AT1 B;  3KMS A;  1G3O A;  5IS2 A;  3E01 B;  5EWE A;  4Q43 A;  5FLX Y;  1ZM3 A;  3FBC A;  4KJI A;  1ZZN A;  1NSQ A;  4X62 J;  3FSI A;  4YB7 A;  2PSZ A;  1N0V C;  2HRT A;  2Z2M A;  3IGN A;  4X65 F;  1JB0 C;  3V6D A;  3IR7 B;  2V4R A;  3PX6 A;  3HJV A;  4NMX A;  1U0H A;  3DU5 A;  2D3U A;  3R97 A;  3EGZ A;  3SSS A;  2MKS A;  1TKX B;  1KHW A;  3E01 A;  4C8L A;  5ETQ A;  3AOD A;  3RAX A;  3KG0 A;  1HI1 A;  1NB7 A;  2V63 A;  2VFU A;  2B9Y A;  1XMQ J;  2DIV A;  4LRE A;  4J9Q A;  3QFH A;  4X4T A;  5J1P A;  1RAE B;  4ZP7 A;  2KO1 A;  3MR6 A;  2LA4 A;  1N88 A;  1UMJ A;  3HSG A;  4AQY J;  3ILJ A;  1QTM A;  1TKX A;  2LEP A;  2W2Q P;  1XJW B;  2CUY A;  4DV1 F;  3RAM A;  2V8H A;  2IBK A;  2CQH A;  5T14 A;  3GB0 A;  1ICE B;  2U2F A;  2V4Q A;  3HHK A;  3MF5 A;  1SCJ B;  4OJH A;  3BSO A;  2W2M P;  1M1G A;  3JAM Y;  3SSQ A;  4IG0 A;  2AX0 A;  4DN0 A;  4DX8 H;  4PG7 A;  4YY3 J;  2ZUA A;  1S6P B;  4QIF A;  2GX8 A;  2E7X A;  4OJ3 A;  4HEA 9;  3THV A;  1I5O B;  2L9W A;  4PG6 A;  1UA0 A;  1VQK S;  5CCL A;  3MM5 A;  2AKW B;  2YWK A;  4NLD A;  3DOL B;  2VV5 A;  4PUO B;  1H2T Z;  2AEJ A;  2H1Y A;  3R1L A;  4K5S A;  3W62 A;  4NLW A;  3OR1 B;  2OJ3 A;  3EZU A;  2N7C A;  1S6P A;  1UJ4 A;  4ANE A;  4U7C A;  3MM9 B;  4KGX B;  3F41 A;  1YIT S;  4ETX A;  4DSL A;  2HFV A;  4I6A A;  3RB3 A;  5DG9 A;  1QAJ A;  1RTJ B;  1Q8B A;  2JC0 A;  1PC4 A;  3DHX A;  1HNX J;  3SI8 A;  4PUO A;  3GV8 B;  2GA7 A;  3J7Y I;  3THP A;  2Q79 A;  1HBN B;  1N48 A;  3TZZ A;  3QJL A;  3OVS A;  2P9E A;  3Q0A A;  4H54 A;  3BQ2 A;  4FYD A;  1Y3J A;  3ZNU A;  2AJQ A;  2DRA A;  4HI2 A;  3OFE A;  3WBZ A;  3KHG A;  2QMU B;  3PNI A;  1HBN A;  5CAA A;  3TA2 A;  4DV2 F;  1HWU A;  3AB2 B;  2DNQ A;  3OL7 A;  4CLL A;  2F3J A;  5IOL A;  4E0D A;  2MQP A;  2F40 A;  2LYV A;  2GGP B;  2KRR A;  2OEL A;  2MQ8 A;  1LOU A;  2G9O A;  2DH7 A;  3GFH A;  2HFN A;  1LNQ A;  2HGN A;  4C9D A;  3KK2 B;  2BKO A;  1YBT A;  4NRT A;  3NOC A;  2R9L A;  4J9U E;  3DRR A;  3SCJ E;  5KT5 A;  3TRG A;  3OFF A;  2FJA B;  1UEK A;  5A8K A;  3DYA A;  5GAD I;  2MLZ A;  4JUZ A;  2B43 A;  4OI0 A;  1Y5N B;  2ZBI A;  3KK2 A;  3VAF A;  3NEK A;  3O5T B;  2IDE A;  2XI2 A;  4A8O A;  3ZZU A;  3R6L B;  1NDL A;  4ZVG A;  4JYA J;  3D0I E;  3T1H F;  3PJ9 A;  3MPV A;  3TA1 A;  4OX7 A;  2XTJ P;  3A8E A;  4LF9 J;  4GKJ F;  3Q83 A;  2M3D A;  2IC3 A;  1TEL A;  1UW9 A;  1T11 A;  1WOO A;  3R5C A;  4KY3 A;  2CJ9 A;  2MQO A;  2OPS A;  4DXL A;  5KG5 A;  4YB1 P;  5HVF A;  3BDE A;  4LUB A;  2CPH A;  3THT A;  1KON A;  1Q7L B;  5LT5 A;  3O1L A;  3QT8 A;  2C2D A;  3W65 A;  1DY3 A;  3BDP A;  2ZKT A;  2GQ2 A;  1Y4Z B;  2N82 B;  1UVK A;  1I3O B;  1KOO A;  2BAN A;  2DGW A;  3ENW A;  5CCM A;  2E5H A;  4NLY A;  4NEZ A;  1Y0H A;  4MK7 A;  1TV6 B;  2P9G A;  5MLC V;  2K7K A;  1BQX A;  1WI8 A;  3EVM A;  3CPW R;  4YN3 B;  3CDW A;  3PRD A;  2YQ1 A;  1NB2 A;  3BQ0 A;  3TQ1 A;  1WD6 A;  2KJV A;  1JKH A;  3EWG A;  1RWV B;  4R5P A;  3B54 A;  2E44 A;  3IWX A;  3KUE A;  3KNA A;  2RHQ B;  4LR9 A;  1TL1 B;  4M95 A;  2RD5 C;  1TKZ A;  1IWG A;  1AZS A;  2D69 A;  3H98 A;  1AYE A;  4OZ1 A;  2XM3 A;  3RBD A;  1F9E B;  3K58 A;  3GWC A;  5HVH A;  3PX4 A;  3HHD A;  4URS A;  1S1V B;  5LSO A;  4DR2 J;  2GJI A;  4NLQ A;  1JNZ B;  4CM0 A;  4DSK A;  2IYG A;  2AEF A;  4K5R A;  2LCW A;  5H1S V;  3F56 A;  4UUW A;  4DU8 A;  1TL1 A;  3MFI A;  1CS4 B;  2V94 A;  3NCP A;  4FBT A;  3D7S B;  2RVJ A;  3C6U B;  3KJV B;  1FFG B;  1SL1 A;  1AFI A;  5AXN A;  3M30 A;  3G6Y A;  4H4K A;  2HBR B;  2C2O B;  4J90 A;  4CT9 A;  3KHR A;  4ZPA A;  4A8F A;  4F3O A;  4AUK A;  4LIW A;  4OYW A;  3FRZ A;  3LAM A;  4ED3 A;  4K59 A;  4N8O A;  1LWX A;  3IFE A;  4QIW D;  3CDU A;  3Q22 A;  1OQ6 A;  5CXT A;  1RAC B;  3IAM 9;  2K8G A;  1PC5 A;  3C6U A;  4Q45 A;  3KJV A;  4B3R F;  3I56 S;  2VFV A;  2Z58 B;  4I6Y A;  3BH6 B;  2J8S A;  4F4A A;  3OLA A;  1T02 A;  4YQW A;  3D66 A;  3RBX A;  4LR7 A;  1N5S A;  2KXF A;  2CJK A;  2AYG A;  3TW0 A;  2RML A;  2W1B A;  3MD3 A;  4ECZ A;  4OI3 A;  3CJR A;  2N3O A;  3PIO Q;  3N79 A;  4WFY A;  1NDP A;  2B51 A;  3HFV A;  2VFR A;  3E51 A;  4A47 A;  4ZVU B;  2QL7 B;  4AL5 A;  2NXN A;  2GVZ B;  2R8H A;  1YLX A;  3CD6 S;  2CPY A;  1SUQ A;  2PGC A;  2RQK A;  2Y1R I;  3I0R B;  3RW7 A;  1YJ9 S;  2VOD A;  4K0K J;  1VLY A;  3G4S S;  2E1C A;  4O3P A;  1JQG A;  3R5G A;  4URG A;  2HHV A;  4MKA A;  2ZDO A;  3JQM A;  2EKN A;  2R2T A;  5KFG A;  4UST A;  5KG4 A;  1PYO B;  2GVZ A;  2IMW P;  1KRP A;  2LEA A;  3MR7 A;  5DLG A;  4WK3 A;  2ZD1 A;  1RAA B;  1PO6 A;  4M5J A;  3W8P A;  2AJ2 A;  4JI8 F;  1C4C A;  2XWX A;  5AJ3 F;  4PWU A;  4DL2 A;  2WBM A;  1HL6 A;  2XMK A;  4FP9 A;  5AXM A;  2ZJR Q;  3CF5 Q;  1FRL A;  2FC9 A;  2R7R A;  3LUY A;  1S9E B;  2Q1L A;  2E66 A;  1C1B B;  1AXQ A;  2UXD F;  2KM8 C;  1R8C A;  3EVO A;  3GJT B;  1NK7 A;  2VQE F;  1H7X A;  1VLO A;  5L1K A;  2JC1 A;  3N01 A;  4Y00 A;  2A2D A;  2YY3 A;  3LGM A;  2YKN B;  5CH7 B;  2D74 B;  4ES2 A;  1NSK L;  4ELV A;  3U1M A;  4C8K A;  1S9E A;  2DTJ A;  1C1B A;  2D1C A;  2KT2 A;  1R0C B;  2DD8 S;  1PG5 B;  3KLI A;  1YJT A;  1B0T A;  2KT5 A;  2YKN A;  1X4G A;  5KFP A;  4ER8 A;  2NSB A;  1TFY A;  4MK9 A;  2OLW A;  1Y5I B;  3MMC A;  1G7C B;  3I6P A;  1SL0 A;  4WP3 A;  3CT9 A;  3GJR B;  3TZW A;  4ZLN A;  1V3Z A;  1S7H A;  3J7A 1;  2DIS A;  1FNM A;  4G65 A;  4U7U K;  3IWN C;  3QYY A;  3K57 A;  5AE1 A;  1X4B A;  1NKB A;  3PYE A;  1N0U A;  4UY8 5;  2LXF A;  3DXB A;  2IVM A;  3FCW A;  2NUU G;  1CJK B;  4F3M A;  1RAD B;  4ZIW A;  1GMV A;  3M8Z A;  1S6U A;  2XS5 A;  4DU7 A;  1IBL F;  3R5D A;  4ES3 A;  2G1D A;  3W60 A;  2AYB A;  1VI7 A;  3MMJ A;  5AE2 A;  2VBZ A;  5KFD A;  2HGL A;  2DHS A;  1PJ6 A;  3CCQ S;  4B9U A;  4ZIT A;  2V8P A;  3E8O A;  2F63 A;  5LM7 E;  5HJX A;  2Y1L B;  1W7W A;  4OL8 A;  3JTO A;  1A7G E;  1IKV B;  1NKE A;  3M6V A;  2YWG A;  4WZQ A;  4XAK A;  1OIA A;  4U67 Q;  3OUY A;  3C8Y A;  5KFQ A;  4ZOS A;  4MFB B;  3FNN A;  1PYT A;  1SH3 A;  3HHL D;  4USH A;  3CC7 S;  1YK9 A;  3I0S A;  2CJB A;  2GC8 A;  1O5J A;  4QU6 A;  5IV4 A;  2O01 C;  2QFJ A;  1IKV A;  2JH3 A;  5B0F A;  3MM6 B;  2MPU A;  3SIP B;  1NU4 A;  4LF7 J;  2QN6 B;  1FHT A;  3ENQ A;  4MJK A;  2EG1 A;  4Q2M A;  4NRU A;  2UUA J;  3OV7 A;  2Y3Y A;  2BOP A;  1RUS A;  5EX0 A;  2RUS A;  1C0U B;  2MXY A;  3UD4 P;  1SBR A;  5HLF A;  3RG6 A;  4J9S A;  2XUL A;  4Y6I A;  3K0J A;  4X66 F;  2VQF F;  2YBV A;  3KOA A;  4KHR A;  3TAQ A;  2RDD A;  4RZR A;  4WK1 A;  3WX8 A;  4LVO P;  4B3T J;  2C3Y A;  3ETO A;  2HRU A;  1HBM B;  4MYU A;  3BKF A;  1RT6 B;  1EQM A;  3H4D A;  3W2V B;  1VQ7 S;  3CIM A;  4NLP A;  1X0F A;  1N56 A;  5FDL B;  3UNY A;  4USV A;  3MAQ A;  3KYL A;  1CUL A;  3FEX B;  4FYW B;  3KJF B;  2M70 A;  2YTC A;  1HBM A;  1RT6 A;  2HHQ A;  4CTA A;  3PR4 A;  4J9O A;  4HT5 A;  2W2N P;  3FKB A;  1B64 A;  3ZNJ 1;  2JJ4 D;  3AB4 B;  3AHP A;  5FDL A;  1Q79 A;  1UJ5 A;  1U1M A;  3RGI A;  5H9F K;  5A0Y A;  3M9M B;  1QE1 B;  1WF1 A;  4F0K A;  2QA4 G;  3KDO A;  3OTD A;  2OTL S;  1PBA A;  4IOA Q;  4BCA A;  4OHX A;  2QMX A;  3Q89 A;  2OEJ A;  3B4M A;  4WZM A;  3ADA C;  2GQQ A;  1D9A A;  2G0I A;  2AMC B;  1L3T A;  3H42 A;  4O23 A;  3DI6 B;  3BN4 A;  3C14 A;  5K8N A;  3I31 A;  2ASL A;  3SMZ A;  3CB4 A;  1HHQ A;  1TVR B;  2HGM A;  2PII A;  1YJ7 A;  1PCA A;  3WDO A;  4WXW A;  3GG1 A;  1K1S A;  2KM8 B;  2R3V A;  4QZV B;  1OQ3 A;  2VON A;  4XDD A;  5D15 A;  3PV8 A;  3DI6 A;  5BR8 J;  1KLM A;  2MYF A;  3AJD A;  1N36 J;  4I2Q B;  2M52 A;  1SKS A;  1S6Q B;  4WJB A;  3CC4 S;  1RT5 B;  4AT1 B;  1EB0 A;  1ZM9 A;  4OIX A;  2KFY A;  2NRE A;  1RHU B;  3U1L A;  1KFD A;  2RT3 A;  2J9D E;  4BDP A;  1UZD A;  3EPI A;  4OX9 F;  2R2U A;  3HKZ D;  4I7F B;  2BW7 A;  4B3M F;  1NSP A;  4I2Q A;  1S6Q A;  4DQS A;  2WTF A;  3ZZY A;  2CJA A;  3TI0 A;  2O67 A;  1RT5 A;  4WYL A;  3WX4 A;  4QWA A;  3HT3 A;  2OP5 A;  3GII A;  2XEX A;  4NWB A;  2QL9 B;  2GAG C;  1FI4 A;  4I7F A;  5D0E A;  3NGS A;  1FD2 A;  2E5J A;  3RR7 A;  2PC6 A;  2HBZ B;  2B7B B;  1A0O B;  4ZVT B;  3D54 A;  5IT4 A;  4QIG A;  1DTQ A;  1VIO A;  1VR6 A;  2YQ3 A;  1YZ7 A;  2HFS A;  2PI5 A;  3NLC A;  4IYQ A;  4XTT A;  3KMQ A;  4OHV A;  2YNH B;  3H25 A;  1NPK A;  2ZKU A;  4CO3 A;  2JZ5 A;  3ZZZ A;  3QLH A;  4W92 B;  2QL5 B;  4LSN B;  4ATN A;  2L3M A;  4ED6 A;  2CNN B;  4UF4 A;  1KVI A;  2HVI A;  3SSR A;  4KKO A;  4O44 A;  4C8Z A;  1REG X;  3RB4 A;  2GW8 A;  3HVT A;  2AW0 A;  1JLF B;  1FRH A;  2OPR B;  1I94 F;  2YNH A;  4ID8 A;  2DNG A;  1FT8 A;  3GG0 A;  2LFV A;  3SQO P;  5F8N A;  2YKM B;  3K17 A;  4FS2 A;  4IFV B;  5IWA J;  2VDH A;  4LSN A;  1CG2 A;  1M1K T;  4DCJ B;  1OO0 B;  3PRB A;  2HFZ A;  3RRK A;  1FKO B;  4DUY F;  1TR0 A;  3BO3 A;  4FYV B;  4NZ6 A;  4X62 F;  2XY6 A;  2XS7 A;  2HHX A;  1T9V A;  3M8P B;  3WQP A;  4YDD B;  1JLF A;  4LRA A;  2OPR A;  1N34 F;  2JSX A;  2VDI A;  3ISZ A;  1Y10 A;  2BJ7 A;  3B78 A;  3LP2 B;  2YKM A;  4JI2 J;  4RBU A;  3HVA A;  4IFV A;  1XQI A;  3Q24 A;  2F5G A;  4EI2 A;  2DY1 A;  4M5N A;  2YWF A;  2FD2 A;  1JNR B;  5A76 A;  1WDT A;  5KFR A;  4FF3 A;  1HD1 A;  3J7Z T;  5HMY A;  1XMQ F;  2A6M A;  4DL4 A;  3IO1 A;  1WG4 A;  3PHE A;  3HHN B;  1U6B A;  2WON B;  3H2U B;  3LP2 A;  3KTQ A;  5GAE U;  2R7Q A;  4AQY F;  3CJ0 A;  5E5N A;  3OW2 R;  3H59 A;  2X3G A;  3MWB A;  5B0B A;  3IBF B;  2QZ8 A;  1KTQ A;  4Y2A A;  1VQL S;  3D6F B;  1RAH B;  2R8G A;  2PA3 A;  2J9D A;  2B56 A;  1EET B;  4JI1 F;  4HAC A;  1XR7 A;  4IR1 A;  1WDD A;  2DVI A;  2WON A;  1IN0 A;  2XO7 A;  8ATC B;  1RAO A;  1IUJ A;  2HNZ B;  1UAW A;  4LMZ A;  1PJ5 A;  4K2J A;  3CCU S;  3FEY B;  3V81 A;  2HVD A;  1S1U B;  3LWL A;  2V5H G;  1Z1Z A;  1UVL A;  3TA0 A;  3UN5 A;  4FXD A;  5HAO A;  5E3A A;  1UEV A;  2GHP A;  4IOC Q;  3LGN A;  2HNY A;  1EET A;  4QPT A;  2KRB A;  2WVC A;  3GFZ A;  3P45 B;  3ZTP A;  3BBC A;  1BGX T;  3MMA B;  3T5H A;  2HNZ A;  4ZVO B;  4AD6 A;  3MEC B;  3OTO F;  4J7C A;  2BXJ A;  4HH0 A;  1S1U A;  2B3T B;  3T5J A;  4JB8 B;  4ZCM A;  2DH8 A;  2W9C B;  4LF6 J;  2HWI A;  4M94 A;  3ZTQ A;  4DI6 A;  5A8W A;  5KFF A;  4JI0 J;  3M1V A;  2M9K A;  1QY7 A;  2IAJ B;  3PG9 A;  3Q8V A;  1W2B R;  3A3N B;  3MMA A;  2M4M A;  1T05 B;  4O3R A;  4KQZ A;  4B9N A;  4TY9 A;  2HHP A;  5K20 B;  2KN4 A;  2XC9 A;  5LOQ A;  3TVY A;  3UN2 A;  2OSQ A;  3N6N A;  1SIW B;  1VQS A;  1NK0 A;  2W9C A;  2BAC A;  1M5P C;  1L3V A;  3DDI A;  2GIQ A;  1WHV A;  2KJW A;  1MLA A;  3W63 A;  2VJU A;  5D6G A;  4JV2 A;  4ECX A;  5A6P A;  1OMS A;  1JLG A;  3D1H A;  5KOW A;  4ETZ A;  5C2C A;  2W25 A;  1IR1 A;  2B7C B;  5HRO B;  3FBE A;  3ZFV A;  5EGY A;  3PYD A;  1G2E A;  1OSD A;  1D8Z A;  1CJU B;  1VGY A;  2XLI A;  5HAT A;  1H72 C;  1MWQ A;  5KG3 A;  5C24 B;  3G86 A;  3RB0 A;  5KG1 A;  2HYI B;  3LP1 A;  3F44 A;  2YNF B;  4HHU A;  3HO1 A;  4N56 A;  5CYJ A;  4C6A A;  5HQ8 A;  3MPW A;  3KUH A;  4RU9 A;  1WEX A;  2EC0 A;  5HRO A;  2EWH A;  5KOX A;  2B8P A;  3CCT A;  1CJU A;  5KFV A;  1FDD A;  4C4W A;  3F73 A;  5C24 A;  3FUY A;  1JLE B;  4D3G A;  4USU A;  3QRQ A;  2YNF A;  1YIJ S;  5DZ7 A;  4DL6 A;  2ASJ A;  4L6V 3;  2RF2 B;  1OY9 A;  1IKX B;  1U1K A;  1VRQ C;  1TQL A;  2DGU A;  1CQN A;  2PFF B;  3CNQ P;  2P6T A;  3UDL A;  4TYA A;  1ZET A;  3IMQ J;  2OTJ S;  1YRX A;  2CPZ A;  5BYR A;  1R8B A;  2R7X A;  1Q8K A;  4DR5 F;  5ETP A;  1URN A;  1JLE A;  5K14 B;  3KUG A;  5F3Z A;  3KJN B;  2HIQ A;  1RHJ B;  4YHH F;  4QYR A;  4QBU A;  2RF2 A;  1IKX A;  1RT7 B;  1FRK A;  3MI7 X;  1RYS A;  2APO A;  3N6L A;  3DRP B;  2OSR A;  3HDS A;  1VDH A;  3DXS X;  4RW8 B;  4KB7 A;  4LRC A;  3BR9 A;  4CLS A;  3K5L A;  5M2R A;  2ATC B;  4USI A;  4KT0 C;  2YX1 A;  2OFG X;  4B9M A;  2VOP A;  4TYB A;  2H65 B;  1Z2L A;  1S1W B;  2W9B A;  2Z30 B;  2PDA A;  3DRP A;  4C3K A;  4FF1 A;  4RW8 A;  4DV7 J;  2RS2 A;  2G1H A;  4O3N A;  2V2K A;  2W8L A;  2L48 A;  2KYX A;  2E7W A;  2CQC A;  4O3O A;  2A3J A;  1T8E A;  1F60 B;  4DCP B;  2XSF A;  3B6B A;  1K0T A;  1VQ6 S;  5B0G A;  2XZT B;  4DJB A;  1UFW A;  2AQ4 A;  1EAY C;  1DQA A;  5G0R B;  3OTC A;  1HHT P;  4L75 A;  1S1W A;  4ECY A;  1V3R A;  4F4X A;  1K44 A;  1U02 A;  3PFE A;  2LQ9 A;  2GV1 A;  3CGI A;  4Y65 A;  1RIS A;  2UUW A;  5DGA A;  3Q8Y A;  3FBB A;  3H5S A;  1VFJ A;  5F3T A;  3U02 A;  4AL7 A;  1FWK A;  4P52 A;  3WIU A;  1JLB A;  2QE5 A;  4NCA A;  4OYZ A;  1FWP A;  2F8H A;  2QC3 A;  5L39 A;  2HSE B;  4X4U A;  2I0X A;  4RUC A;  1TUW A;  3BKT A;  1WC4 A;  3MOZ A;  3HSD A;  2UV8 A;  5BJR A;  5CZV A;  4RBV A;  3J7A N;  4NAS A;  3N9U C;  4P71 A;  2F4F A;  4F7V A;  2DB1 A;  3DMJ B;  4UTG A;  4USM A;  4H4O B;  1VHI A;  4I56 A;  2IPO B;  1HBU B;  2FC8 A;  4BC9 A;  3CW2 C;  1FE0 A;  2ZH3 A;  4LF4 F;  5C7P A;  4ZA1 A;  1VC5 A;  1SC1 B;  3Q86 A;  3Q8P B;  4RJV A;  5KFC A;  2V34 A;  5H9E K;  2C2N A;  1FES A;  1YX2 A;  4NA1 A;  5IFM A;  2OD4 A;  3PY8 A;  2FPH X;  1YTY A;  1KVK A;  1OS5 A;  2UU9 F;  3R5A A;  4H4O A;  4P73 A;  2ADB A;  2CQ0 A;  4EBC A;  1VQY A;  3ILO A;  1HBU A;  1X4E A;  4CH1 A;  1NDK A;  1XNQ F;  5HK4 A;  1Z2Z A;  2VFT A;  5B09 A;  3TR5 A;  3FZ2 A;  2BE9 B;  3O2I A;  1WAC A;  1H2V Z;  1HBO B;  4JOU A;  1WJ9 A;  2MKH A;  3FQK A;  4IFY A;  1REV B;  2A2C A;  2QLW A;  3HM9 A;  1NJI T;  5L46 A;  1Q8I A;  1RHK B;  2HVZ A;  4DDF A;  4M5G A;  4Q7A A;  1BUX A;  4I2P B;  1VC0 A;  3R7B B;  3L3C A;  3DLL Q;  4LQ3 A;  3VHQ A;  4FS1 A;  3M8W A;  4AND A;  3R7N B;  1REV A;  3OR2 B;  5BYQ A;  2C1E B;  3KHL A;  1NZA A;  2E9T A;  1RP5 A;  5KFK A;  1N5Q A;  3OBI A;  2CJX B;  4GO7 X;  1U8S A;  3OVB A;  4ED4 A;  2GHW A;  5LSL A;  4RUH A;  2XI3 A;  1CJV B;  3QGG A;  3ZO7 A;  3QFW A;  3VGU A;  3OTE A;  2CNL B;  5B0C A;  1TTH B;  4NXN F;  3U1N A;  4QJV A;  3QWU A;  4J9M A;  4B9L A;  1MRO B;  3OR2 A;  9ATC B;  4R0E A;  2DGS A;  2Z57 B;  2BRK A;  4ZVS B;  4EO6 A;  3S8S A;  1ZTW A;  3CO0 P;  4OHZ A;  3MM7 B;  4ID5 A;  4PWD B;  1TK5 A;  1B7F A;  2IBO A;  2F4V J;  3UCG A;  1WF0 A;  1CJV A;  4WU3 A;  3QMQ A;  1HNI A;  4LT6 A;  4WIQ A;  1SL2 A;  4GVB B;  5DS7 A;  2NLW A;  2QYG A;  4N7T A;  3LW5 C;  2HIY A;  1FD8 A;  1Y11 A;  1QD1 A;  2B5J A;  1NH7 A;  1BQM B;  3MUT P;  2YKP A;  2CPE A;  3PYF A;  1HNZ F;  3MM7 A;  1OJ4 A;  2QLX A;  1WOR A;  3T1A A;  4QR0 A;  1KD1 T;  2QIF A;  1TUG B;  3IG1 B;  5T7L A;  7AT1 B;  1KEK A;  1HA1 A;  2NCK L;  4MTP A;  3I96 A;  4PQU B;  2DGX A;  3GIR A;  1BQM A;  4FKX A;  1DBD A;  4LQ9 A;  2DYA A;  4BWJ A;  3G96 A;  2W4P A;  3H5Y A;  3MAH A;  4ZVF A;  3CCM S;  2FQQ B;  3NWG A;  1S59 A;  2HND A;  2BQU A;  3PR5 B;  3IG1 A;  3DDK A;  3W9J A;  3R9L A;  2G2O A;  1WUU A;  4ED7 A;  4TQS A;  4I68 A;  2L41 A;  2ZIT A;  3JSB A;  4YB5 A;  4UOC A;  7FD1 A;  4ZK7 M;  5C2G A;  5DGB A;  1EAR A;  4B3S J;  3R2D J;  5B7W A;  3Q8U A;  1ZA2 B;  3H8Y A;  1UFL A;  3HI9 A;  4JI5 J;  4P7V A;  4NXM F;  5KG2 A;  2ZWO A;  1TL7 B;  2PMW A;  2UXB J;  1XWL A;  2EXU A;  4DPU A;  3TEH B;  1U45 A;  2A10 A;  4FXV A;  1VMB A;  4GRS A;  2DRD A;  3GV7 B;  4IDK B;  5ETR A;  3IAS 9;  1KSP A;  1GMU A;  3P49 B;  4V1A k;  1RB0 A;  2MZJ A;  4ZPB A;  4DUT A;  5AXK A;  2C3M A;  5A8R B;  4DR7 J;  2B4O A;  4PAB A;  2XLK A;  1IQT A;  3VAJ A;  4IDK A;  2DHX A;  2ZNY A;  4KGV B;  3T5K A;  4GKK J;  1OWX A;  2XG8 A;  4FZV A;  2RS8 A;  2ZH2 A;  4DV3 F;  5L1L A;  2MLY A;  2J6T A;  4A8W A;  2PD1 A;  5DO2 A;  1YQH A;  4CO2 A;  3OL8 A;  5D8H B;  5KFB A;  4RNH A;  3NCR A;  5A8R A;  1S10 A;  3BO4 A;  3ZTR A;  3BBF A;  1NHU A;  4ICL B;  3WIV A;  1U1R A;  4PZV A;  2ASD A;  1WHX A;  1FX2 A;  5J2M A;  1AUS L;  2M8D B;  4KO0 A;  2GCF A;  5K8O A;  5DQG A;  4AXI A;  2Z2Z A;  4AXJ A;  2FDN A;  4WPA A;  1KQG B;  2B8Q A;  4DR6 F;  3SEO A;  1NK9 A;  3MED B;  1B3T A;  3AXM A;  3BZQ A;  3VAG A;  3NL0 A;  4ZPD A;  2MGZ B;  4ICL A;  1DQ9 A;  4FNI A;  2JLE A;  2FHK A;  4Z2X A;  3DRX A;  2QMW A;  5ITH A;  1ITP A;  1Q16 B;  1J2V A;  2MKJ A;  1GH8 A;  1SVD A;  3IN5 A;  1S12 A;  2YH0 A;  4DQR A;  5KT4 A;  3BH7 B;  4YB6 A;  3MD1 A;  4B9V A;  2MGZ A;  4NML A;  1IBC B;  2OD6 A;  2RIL A;  3CJ4 A;  4KH0 B;  1QSY A;  1C4A A;  3VGT A;  3RTV A;  1GEH A;  2WOM A;  4CLU A;  3RU0 A;  4JI4 F;  2P9C A;  1R0B G;  2NXU A;  1H74 A;  2B0G A;  4F25 A;  4CYU B;  4YDX A;  3QZ7 A;  1XR5 A;  8RUC A;  3MUR P;  4DV0 J;  4DV6 J;  4WTO B;  2C3U A;  3IRW P;  1HNW F;  4RW6 B;  5CA5 A;  1RU1 A;  2DBB A;  1FDN A;  2UZA A;  4KGK A;  3TUI C;  4DX5 A;  2HW3 A;  2KFN A;  4JBC A;  3NGT A;  2E1P A;  2FLO A;  3NGU A;  1ROF A;  2FLL A;  3IC1 A;  2EC2 A;  2QA1 A;  3D28 A;  5ETM A;  5HVG A;  3QAE A;  1T03 B;  1N36 F;  4CYU A;  2I2Y A;  1UL3 A;  4JI3 J;  2UVR A;  2IJR A;  3UR3 C;  1RKI A;  5J2N B;  2DR5 A;  4IUF A;  5IC4 B;  2CQG A;  2MTL A;  4PEO A;  2LDI A;  4RW6 A;  1S97 A;  2BJE A;  3QJJ A;  1XK8 A;  3JTP A;  1BQN B;  1WTF A;  4AFF A;  2DXE A;  2FHO B;  4U96 A;  1T03 A;  4Z7Y A;  3GIK A;  3NS6 A;  1JLC B;  4LF5 J;  2VU5 A;  2Y0S D;  4CLY A;  3I4P A;  5J2N A;  2VG6 B;  2UUB F;  3O44 A;  4WE1 A;  5HO4 A;  2HVH A;  4KIA A;  4Y28 C;  2RQ4 A;  1CEZ A;  4L3N A;  1FJC A;  2VH7 A;  2M7S A;  2HUR A;  1S9G B;  8AT1 B;  2U1A A;  5J1E B;  1ARO P;  2BJ1 A;  4MYT A;  1JLC A;  4MIB A;  3VF0 B;  5LMU J;  2ALY B;  2JOQ A;  1IBM F;  4ZP6 A;  3QT7 A;  1J5E J;  4DZ6 A;  3CC2 S;  3KLG A;  4KV8 A;  1IKY B;  1UVI A;  2VBY A;  2IFX A;  4JP8 A;  5BXI A;  2I8E A;  2VPX B;  3NMR A;  2HQ3 A;  3JB9 k;  4BS2 A;  5IZH A;  5J1E A;  1IBK F;  1JJ4 A;  2FZC B;  4C7Q A;  1XTZ A;  1DRZ A;  2HZC A;  2J7K A;  1X5P A;  4KFB A;  1IVZ A;  4DR3 J;  1NPP A;  1R7I A;  4ENO A;  3EGN A;  2C2M B;  4J9V A;  1D09 B;  1E6V B;  2FGO A;  1F2H A;  4DFK A;  1EKS A;  1CVJ A;  1LWE B;  4TQR A;  5HP1 A;  4G1P A;  5HMZ A;  2PA8 D;  3UN3 A;  4Z37 A;  1SJ3 P;  2OML A;  2KXH A;  3A8J A;  1VQM S;  1SQG A;  4M5K A;  3AOB A;  1CC8 A;  1CBK A;  1GTH A;  2VJV A;  4ECR A;  1E6V A;  2LXI A;  4F02 A;  3J7Y U;  3M8S A;  2J7W A;  2BJ8 A;  4P2M A;  4A8S A;  2XMA A;  2W7A A;  4F2R A;  2HRY A;  1YDL A;  2EG2 A;  2VA2 A;  1M5H A;  2UVW A;  2LXU A;  2LU1 A;  3ET6 B;  2B9X A;  3M2U B;  5E7O B;  1RT4 B;  4WKR A;  1XMO F;  3HK2 A;  1QDU B;  4N77 A;  3OLB A;  4RW7 A;  3R2C J;  1U2C A;  1FXL A;  1N5V A;  2CZ9 A;  2MY8 A;  3OPK A;  2XSJ B;  5KFH A;  2EBG A;  4I6W A;  4CO0 A;  3DOK B;  4XPC A;  5F41 A;  1WC3 A;  4Q0B B;  1YWX A;  3EDR B;  3MPD A;  2IY5 B;  4I0W A;  1NME B;  2CQ3 A;  4L3K A;  1YJW S;  1RT4 A;  3WZ0 A;  1K9M T;  1N5Y A;  4X65 J;  3UVJ B;  2OI2 A;  3H2L A;  4DBQ A;  2IRY A;  6FDR A;  1ACM B;  3CCL S;  1NO8 A;  3RAQ A;  5JJB A;  3DOK A;  2V8G A;  4QW9 A;  4EO8 A;  2IRX A;  3A1Y G;  4OYI A;  5ETN A;  2RDI A;  3HCX A;  3QRR A;  5F0W A;  4O3S A;  4KBI A;  1E6Y B;  1FCA A;  2ILY A;  3LA0 A;  2EFO A;  5KT2 A;  1TL5 A;  5D0H A;  3PKY A;  3TX8 A;  1TKT B;  3WC0 A;  2DEJ A;  2QFI A;  5CD4 A;  3QSY B;  1Q5V A;  2ROG A;  1SC3 B;  3ONQ A;  1RDR A;  2F65 A;  1ZBT A;  2MKC A;  3PKM A;  3M32 B;  1BC6 A;  2VKZ G;  2DR6 A;  2MB0 B;  1E6Y A;  1ZM2 A;  3JAM U;  3SFG A;  1ULR A;  4LF6 F;  2MJU A;  4NZ0 A;  1O8B A;  4LVN P;  1VBK A;  1SH0 A;  3W66 A;  4QU7 A;  4MKB A;  5GMK a;  5ETL A;  4RO0 A;  5KFJ A;  2KG0 A;  4QWD A;  2FHJ A;  1HR0 F;  1FJG F;  1IM6 A;  1M1H A;  3GIL A;  5AXL A;  1R43 A;  3FC9 A;  4OZ5 A;  3C15 B;  2QGF B;  2R2R A;  3KKF A;  1U8W A;  3JYT B;  5B0E A;  4P74 A;  1FXR A;  1DTT B;  2MHE A;  1NBE B;  1U6Z A;  4NCG B;  4YFU A;  3CCS S;  3X1L B;  3SBM A;  5I3Q A;  4PG8 A;  2H4Y B;  4WII A;  2X1G A;  2W01 A;  1RT2 B;  4CNY A;  3CMA S;  3CDB A;  2WSF C;  2VG5 A;  2W9A A;  1UVN A;  4F26 A;  3T3F A;  3VAL A;  2I1R A;  3RR8 A;  1QJH A;  5LJ3 Y;  4IRD A;  3CCV S;  4EFA C;  1DTT A;  3MM8 A;  4Q2L A;  2CQ2 A;  2FJX A;  4NCG A;  3EX7 B;  1XNR F;  2VC0 A;  1S1X B;  2XYP B;  3DCA A;  5EWF A;  3P3D A;  3UE2 A;  1F9F A;  1HKA A;  5D3G B;  3IR5 B;  2AX1 A;  1H98 A;  1RWM B;  2BDP A;  3O3L A;  3L4B C;  2DIT A;  2IM1 A;  2OFH X;  4DV2 J;  4EU0 A;  1IR0 A;  2VPY B;  3AD7 C;  2VIC A;  4ZDN A;  2JLF A;  4A4J A;  2RU3 A;  2V50 A;  3IWL A;  3BV8 A;  2LDY A;  2J7U A;  4ILR A;  1L3K A;  5DDO C;  1P8G A;  4DFM A;  4DL3 A;  3H20 A;  2CDR B;  4U7U D;  5D3G A;  1O6X A;  4LBP A;  4OX8 A;  2W4D A;  3OHA A;  1WEL A;  4CH7 A;  2C2K B;  2E29 A;  4F4Z A;  4W98 A;  4ZVR B;  5HSP A;  2H54 B;  2FVQ A;  3VZH A;  4CCH A;  2J0W A;  4F50 A;  3FFI B;  1RWK B;  4O0I A;  2IMO A;  6AT1 B;  4ERD A;  2CXE A;  3FBF A;  3L9Z A;  3L7P A;  3CCE S;  2XY7 A;  2KVI A;  4OZJ A;  4H4M B;  2MQQ A;  3K8W A;  4CM2 A;  2UUC F;  2RQM A;  3ILI A;  2IYI A;  4GKJ J;  2Y9H A;  2VAS A;  3EE3 A;  3V2U C;  4WP9 A;  5DET A;  4QYZ J;  2H3E B;  2LQ8 A;  1CQM A;  1K1Q A;  2Y8W A;  2ACY A;  4GO5 X;  1QAY A;  2AJF E;  4NE9 C;  2KH9 A;  4L76 A;  4RNO A;  3UWT A;  2AHO B;  4FNH A;  3IBC B;  2QJ3 A;  2HWT A;  1LK7 A;  5KFW A;  3DOL A;  4TLR A;  4J9K A;  2DR7 A;  1VBX A;  1S0V A;  2KDO A;  5CQG A;  3OR1 A;  2J8A A;  2B9W A;  4ZPC A;  4N41 A;  3GYN A;  4X64 F;  1H73 A;  3MM9 A;  3MCO A;  2RB7 A;  4EEY A;  2UXC F;  4V19 X;  2RSQ A;  4X4R A;  4DFJ A;  3D6H B;  2GHV C;  4LFB F;  2NQP A;  4NZ7 A;  1RTJ A;  5J1N A;  2CA9 A;  1VBZ A;  1S0M A;  2BJD A;  1U2F A;  5M2P A;  2OPQ B;  3QO9 B;  2HFO A;  3BGR B;  1NKC A;  2UUT A;  2K06 A;  4FF4 A;  1U6F A;  3BSN A;  4IQM A;  3A3O B;  2ZZN A;  2HK3 A;  2ACM A;  2H48 B;  5JMN A;  1FA0 A;  1C0T B;  4R0J A;  2DNY A;  2FJW A;  3QO9 A;  1U25 A;  4CO4 A;  3OFG A;  1U26 A;  3KFW X;  4DPX A;  4X4S A;  4TU7 A;  1WI6 A;  3TAP A;  2GGP A;  2KFZ A;  5C42 B;  3MGJ A;  4M5D B;  1C0T A;  4CP5 A;  2EFG A;  3G71 S;  4OYP A;  1QVF R;  2HS0 A;  2RNE A;  4KHM A;  1DAR A;  2VBW A;  2K2P A;  2CNK B;  2DR8 A;  2RKI B;  1MG7 A;  5L9N A;  1JJC B;  5KFI A;  3MEK A;  1XR6 A;  1RA7 A;  2KI2 A;  2KTQ A;  5C42 A;  5DLF A;  4HKQ A;  1KNZ A;  4M5D A;  2EKY A;  3AY0 A;  1HWI A;  3C6T B;  4ALZ A;  4DS4 A;  1NK6 A;  1VJQ A;  4MK8 A;  3CCR S;  5E0O A;  4WFB Q;  4ECT A;  1FDA A;  2W7O A;  3KLE B;  1U48 A;  1YVF A;  2A0F B;  2FJV A;  3AOC A;  3D1Q A;  1U1L A;  1U1Q A;  3V6K A;  2RKI A;  3PEJ A;  1DZ5 A;  3X3U A;  2ZBP A;  2HQF A;  3HPO A;  3PW7 A;  3GU0 A;  4R25 A;  1YHQ S;  1YI2 S;  5SZT A;  3IXQ A;  1SJQ A;  4RUA A;  3NGK A;  3GTY X;  1S48 A;  3P96 A;  3KLE A;  3DKD A;  1LK5 A;  4IKA A;  3JS9 A;  2YWE A;  4CIO A;  3QNW B;  2JVR A;  2K3I A;  4ELT A;  4JI7 J;  2D3Z A;  5M2U A;  2IHR 1;  2HS3 A;  2F8M A;  2YWH A;  4MT1 A;  4C8Y A;  4K4T A;  3MEG B;  3BEG B;  3T9N A;  2X1A A;  1LWC B;  2F9D A;  3RBZ A;  4L74 A;  4OYO A;  2YVS A;  1P6T A;  4A8Y A;  3F0N A;  2Q43 A;  1TV6 A;  3J81 Y;  1NLK L;  1NK5 A;  1BMQ B;  4YEA A;  2E5L F;  3QRP A;  5IV3 A;  4DL7 A;  3D0H E;  2MZT A;  4KYZ A;  5KG7 A;  3M8Q B;  1SI9 A;  3VVT A;  2YNG B;  1HD0 A;  1JXE A;  3H5X A;  3NKY A;  2RRB A;  1NAQ A;  3K8V A;  5BYS A;  2BUN A;  2R4F A;  3RYL A;  4J9N A;  3GYX B;  3TUP A;  1QAI A;  3H5U A;  4HTJ A;  3GIM A;  1J27 A;  3GJQ B;  2CKW A;  2COL A;  3MEE B;  2DY9 A;  2J0Q D;  3MFH A;  1S1V A;  3SV3 A;  3JQK A;  3M8Q A;  4JV0 A;  2XZD B;  2YNG A;  2VQE J;  2XYG B;  1CS4 A;  4DSJ A;  2ERR A;  1V5V A;  4NLV A;  3UO0 A;  2O66 A;  3A8K A;  5ADZ A;  1HMV B;  2JL9 A;  4M5L A;  4PAA A;  4G1Q B;  3QGP A;  3MEE A;  5LJ5 Y;  2MQM A;  3D3B J;  1PSD A;  1YJV A;  3SXL A;  1V5I B;  2WK4 A;  2LEB A;  4FBU A;  3CDE A;  5GMD A;  1X9W A;  1RWN B;  1HI8 A;  1YRT A;  5L1J A;  2JRS A;  3W8G A;  1Q7Y T;  2XHW A;  1BHN A;  3BPS P;  3CO9 A;  4B3S F;  4M1K A;  2BMB A;  1WC5 A;  2FUG 9;  4G1Q A;  4P10 A;  3M6U A;  1WWH A;  4ES1 A;  4K4V A;  1PKU A;  1J5O B;  1VQN S;  1AW0 A;  3R5J B;  2UXB F;  3GFX A;  1F0X A;  3KLV A;  3I87 A;  4FYY B;  4E98 A;  2BW2 A;  4DS5 A;  4WFZ A;  1BWE A;  1XBW A;  3K5M A;  5ETO A;  4NI2 B;  4DHV A;  1DHM A;  5IM0 B;  1HYS B;  1MSW D;  3FMW A;  1J5O A;  1UA1 A;  1JLQ B;  2ASY A;  3I0R A;  2QT7 A;  3M2R B;  1IBL J;  1ZPV A;  2ZHO A;  2VPW B;  1SJF A;  4DR7 F;  1ZOT A;  3LPE A;  2Q3P A;  2DHA A;  3BPD A;  3GSD A;  4F04 B;  1WKL A;  4GKK F;  1MNE A;  4EZ9 A;  3N6M A;  4RX6 A;  1RWX B;  3CJK B;  1VRU B;  1IQZ A;  1NJY A;  4NLO A;  5KFS A;  4NLT A;  1CC7 A;  3JTN A;  3M2R A;  3FJ2 A;  2FTR A;  4ZJO A;  2WHO A;  1GT8 A;  3AQO A;  2BZ2 A;  3V4M A;  4HDG A;  4OJG A;  1RE1 B;  3QZ8 A;  3MZI A;  3TAN A;  2E1R A;  1VRU A;  2NXE A;  1UFK A;  5LMN F;  3PCO B;  4UT4 A;  1R27 B;  2XMT A;  3Q8Q B;  1DUR A;  2VD3 A;  3VVU A;  3PW4 A;  2E1A A;  2YNI B;  2F9J A;  1MMD A;  2ZOF A;  1U09 A;  1EZZ B;  5LSR A;  3MCS A;  2QA2 A;  3NWR A;  2Z2Y B;  2R7O A;  3ZXW A;  2VUG A;  4RWX A;  1HIY A;  4DOZ A;  2VQF J;  1KQF B;  3EIC A;  2XWY A;  3TNV A;  2CFX A;  1QVG R;  3B82 A;  2YNI A;  1S0N A;  3NGR A;  4C3M A;  1VS3 A;  2MKY A;  2DO0 A;  2AIR B;  2HQC A;  2RDJ A;  1K47 A;  3KDN A;  2JDJ A;  2DH9 A;  3HVR A;  2ZJQ Q;  4LFA F;  1PAE X;  3M7V A;  4ZJL A;  3DRS B;  1VQ5 S;  5CYM B;  3BO2 A;  1WHW A;  3QJP A;  4ZCL A;  2XB2 D;  1MW7 A;  2BM1 A;  1RBO B;  3OJS A;  2WW8 A;  2AZ1 A;  1JWW A;  2P5V A;  5EX3 A;  2V4J B;  3L95 X;  1CJK A;  1VK8 A;  2OMO A;  5IT9 Y;  3HZE A;  1H6K X;  1TUV A;  1UWA A;  1D9D A;  5CYM A;  2B4P A;  3MTK A;  3GIJ A;  2ZJP Q;  1HNV B;  2XO6 A;  2FHJ D;  2LKZ A;  3C66 A;  2ZOG A;  4ZCK A;  4P2F A;  5I42 B;  4DR1 F;  2W2O P;  4M8L A;  2OHD A;  3RRH A;  2V4J A;  4O4G B;  4UQG A;  4NX9 A;  2ZE2 B;  3FGV A;  3PX0 A;  3EPG A;  1JLA B;  4ECW A;  1ZPW X;  4OI2 A;  2QG9 B;  3FEZ A;  2CZV C;  4K4X A;  1RAI B;  2RRN A;  1GNK A;  2QTW A;  3JSM B;  1WTB A;  5I42 A;  3FRY A;  4ED8 A;  3G6E S;  5IXU A;  2VIH A;  5DG8 A;  1OYD A;  4O4G A;  4WFA Q;  4XIU A;  2FJB B;  4WKY A;  1VQO S;  3RW6 A;  3B8H A;  2ZDP A;  4ZP8 A;  3PEH A;  3ELH A;  1SKW A;  2HHS A;  2ZE2 A;  3K5P A;  4MFB A;  2KT3 A;  1FFW B;  4RUB A;  1VQ4 S;  4NYO A;  3CJS A;  4X4O A;  2C42 A;  5DDR C;  4C2M A;  5LMU F;  1GAO A;  1FKA F;  3MM6 A;  1T9X A;  3T9Z A;  4BHQ A;  4HR2 A;  3D0G E;  3T6B A;  3OHB A;  2CG4 A;  3PRV A;  4OX9 J;  2WVE A;  4B3M J;  1C0U A;  4LSZ B;  1JK9 B;  1M5O C;  1RAF B;  2BKN A;  1RTZ A;  1HI0 P;  1Y3K A;  4EK2 A;  1B0V A;  3HXM A;  4TY8 B;  5JVH Q;  2UP1 A;  1ZTT A;  4DR3 F;  3UCU P;  1FNX H;  4ZVH A;  3I9V 9;  3TO8 A;  1FJ7 A;  3TAR A;  3H4B A;  5D4O A;  5L38 A;  4U95 A;  1WKJ A;  3JSR A;  3EDQ B;  1N8R T;  3W2V A;  1Q1K A;  2YKO A;  3T19 A;  1B0P A;  3CJ8 A;  2LLZ A;  3GYG A;  4GMK A;  3OD2 A;  2MSS A;  3HLU A;  3PW5 A;  5I3U B;  4TY8 A;  3W64 A;  5KFL A;  1X9S A;  3PJW A;  3UPF A;  1P9Y A;  5D0G A;  2DNR A;  3ZZR A;  4PPZ A;  2Y1I A;  3QT6 A;  4LFC F;  3GJS B;  3BYR A;  1FO1 A;  2GQC A;  3QIP B;  4X84 A;  4CNZ A;  4F4Y A;  1EP4 B;  2PE8 A;  3E3X A;  1WEZ A;  1X5S A;  2ZEJ A;  2N7Y A;  2QLF B;  3VAH A;  5EDW A;  1M5K C;  2OEM A;  5J2Q B;  3TAM B;  5I3U A;  1QE1 A;  2VHG A;  2WB4 A;  2HEK A;  2I6W A;  3J80 U;  2RQC A;  2CZ4 A;  3QIP A;  2NR0 A;  3HKW A;  3V6D B;  2YQ0 A;  1U24 A;  2AU0 A;  3TQE A;  1JJ2 R;  1EP4 A;  3T6J A;  3CJ3 A;  5HAN A;  5EHH A;  3I55 S;  5J2Q A;  3TAM A;  1X4C A;  1MML A;  2XMM A;  4LJM A;  1TVR A;  3D4J A;  4DUY J;  1YJR A;  2HHH F;  3O8W A;  2DKO B;  2YKA A;  1N32 F;  4OV1 A;  2J6S A;  3A3P B;  5DM7 Q;  1N34 J;  3G9C A;  3VQS A;  4MAK A;  2MST A;  1FDB A;  5LL6 d;  4ILM A;  2CNO B;  3OL9 A;  2Y1J A;  4DPW A;  5I4M A;  1RA6 A;  1R6Y A;  3VGS A;  4OHW A;  2YH1 A;  2NPI A;  2CQB A;  1BE4 A;  2E5G A;  4DSF A;  4H4K C;  4Q44 A;  1X7V A;  1LV5 A;  4IG0 B;  4YOE A;  3UDV A;  1UCN A;  4DUZ J;  4I67 A;  1V3S A;  5L9X A;  2E1M C;  2HAF A;  1S1T B;  3POT B;  2M0G B;  3BSA A;  4P75 A;  1UKU A;  2A6O A;  2DPJ A;  3IA0 A;  5K8M A;  3MM5 B;  4IG3 B;  1ELO A;  2R8K A;  4N47 A;  4Y2M A;  1T3N A;  2EFN A;  2BOA A;  2WZ1 A;  4JI1 J;  5IT0 A;  4AYB D;  4X4Q A;  4ED0 A;  5CAB A;  2ROP A;  2CPJ A;  1SJ1 A;  3HX9 A;  2DNL A;  1M5S A;  4UUX A;  1S1T A;  3GR0 A;  2HFU A;  1NHV A;  2JVO A;  1RU2 A;  3POT A;  5B08 A;  2NUH A;  3GE9 A;  2NYH A;  4IG3 A;  2KHD A;  2WVD A;  4TU9 A;  2YPY A;  1N33 F;  2B4V A;  2R7S A;  5E41 A;  3FDS A;  1KKH A;  3AH6 A;  3J7Z 5;  3V5R A;  1I1G A;  1UPP A;  1FNO A;  3J80 Y;  1Q86 T;  1BXN A;  2P6S A;  3OTO J;  4Y3C A;  1IWA A;  2VKR A;  2ZUG A;  2C28 A;  1SXL A;  2P2C B;  5D4L A;  1SKR A;  1Q5Y A;  2HQG A;  4DV5 J;  3P8B B;  4DPY A;  1LW2 B;  2X1F A;  3K5O A;  3AXK A;  2G2Z A;  2KYZ A;  1RK8 A;  4OLO A;  3HHE A;  3OQ2 A;  2I5J B;  1M90 T;  2C2R A;  4RKU C;  2DHH A;  4KHP J;  3I82 A;  3HF5 A;  3M6X A;  1QUV A;  4GC7 A;  3TX0 A;  1F5C A;  1LW2 A;  1FKO A;  4EZ6 A;  4U8V A;  3A4T A;  2UV8 G;  3I4H X;  1LKZ A;  4OZN A;  3GFY A;  2HK2 A;  4HTI A;  5DM6 Q;  3M8P A;  4ITS A;  2I5J A;  2HG4 A;  3DOM B;  1TAQ A;  4IH7 A;  3DRR B;  2DXF A;  2HKE A;  2IM0 A;  1ZAV A;  2ZBR A;  3LPY A;  5JXS A;  5A8K B;  4ZJQ A;  1WF2 A;  5I3P A;  1Q81 T;  3DYA B;  3D68 A;  1FRJ A;  1WSR A;  2EFP A;  1NJZ A;  1GK8 A;  3D3C J;  2PMZ D;  2WRM A;  3ICL A;  1IXK A;  2GJF A;  4NCB A;  5H9F J;  1YGY A;  3GP9 A;  3DOM A;  2CQ1 A;  3DRY A;  2KXN B;  2GFF A;  5GAH U;  4YY3 F;  1B7Y B;  3VAI A;  2IC3 B;  1AA1 B;  3RZA A;  2VG7 B;  5CHC B;  3K59 A;  4FDF A;  4C11 B;  1T9U A;  5MAO A;  3T1Y J;  2LA6 A;  3CUN A;  2OPS B;  4UOH A;  1H7W A;  3CWJ A;  4YR3 A;  3AD8 C;  3W5Z A;  2XHC A;  1D1U A;  3V6H A;  4TU8 A;  2XGQ A;  2D7S A;  5DG7 A;  4JV1 A;  3R6G B;  2R8J A;  2CQD A;  2RH3 A;  3GZ7 A;  1T9W A;  2VG7 A;  3E2E A;  4C11 A;  4DR5 J;  3KG4 A;  5CYQ B;  5ETS A;  2BAN B;  3U7J A;  4KPY A;  3JSY A;  4YHH J;  3NAI A;  3EZO A;  3NOG A;  4K50 A;  1UJ6 A;  3UDE A;  2MJN A;  1MMN A;  1HNX F;  4RPF A;  3MPY A;  2FZG B;  1IJE B;  1RI7 A;  5E3R A;  2PT0 A;  2XCA A;  3MEC A;  2MMY A;  3BYP A;  3W9I A;  1NPR A;  4DLE A;  4V19 J;  1SJ4 P;  3K7R A;  3VWS A;  2VF3 A;  5CYQ A;  2D9P A;  1JKH B;  4PG4 A;  4R5P B;  4Q8F A;  4DR4 J;  1ZH5 A;  2Q6B A;  3MCN A;  2IAJ A;  2XBP A;  1TKZ B;  1AZS B;  3EXY A;  4FPI A;  7FDR A;  4ZPV R;  1T05 A;  4ECQ A;  4DV4 J;  1D3W A;  3NP5 A;  1FTR A;  2OIH A;  3KLF B;  2MZS A;  4RR5 A;  2JEF A;  2BV3 A;  1VBY A;  5GAG U;  4RW9 B;  2OGU A;  4WP8 A;  4FVC A;  2IDL A;  1NHK L;  2RIJ A;  1KP6 A;  1C2P A;  5HL7 Q;  2ADC A;  3ENV A;  2IJF A;  2XMU A;  3W61 A;  2FHM A;  2XGP A;  3IR6 B;  3M30 B;  2OKQ A;  3KLF A;  4NA2 A;  2DCU B;  4UQT A;  1HFE L;  3QGI A;  1LWF B;  4YUD A;  4RW9 A;  1RLD A;  4ELU A;  2GO9 A;  1S5Z A;  1PBU A;  3W5Y A;  1KR4 A;  5K9F A;  1JXL A;  3R5B A;  1RCO B;  1SV5 B;  2WSE C;  2V6A A;  4JYA F;  4ECV A;  3KK3 B;  4ECU A;  4LF9 F;  4DPO A;  4QIE A;  1UWB B;  3AD9 C;  2BJ3 A;  1LWF A;  2V2Z A;  5EN1 A;  3DLK B;  4C0O C;  3SCI E;  1FRX A;  3SCK E;  4RNM A;  2FY8 A;  1TL3 B;  4C97 A;  4D3H A;  3BBB A;  1SV5 A;  3AQP A;  2GIR A;  1G6B A;  4LF4 J;  4K4Z A;  3KK3 A;  2ZH5 A;  1SQE A;  5E3P A;  5T41 A;  4NLG A;  4HDH A;  3VV2 B;  2EFQ A;  4C8M A;  4OZ3 A;  1RGV A;  3TZX A;  1UWB A;  1L5U A;  3FSY A;  3PO5 A;  3DLK A;  3TP2 A;  1SUQ B;  2G4B A;  3IGV A;  3AOA A;  1YG0 A;  2UU9 J;  1R8A A;  1AUD A;  1IKW B;  1IM4 A;  5K14 A;  5HBM B;  4TNO A;  1TL3 A;  2BA9 A;  3IM9 A;  3ZZP A;  5KT6 A;  1XNQ J;  1RT7 A;  3SCL E;  1QLN A;  2F8E X;  3UR0 A;  4R8U B;  2R42 A;  4JI7 F;  2CQP A;  4YME A;  3R7S B;  2M8H A;  3BGU A;  1R31 A;  2QSW A;  4ZN3 A;  4DF8 A;  4CDI A;  3R8Y A;  3BJY A;  4B3O B;  2B6A B;  4KRW A;  2ZD1 B;  1IKW A;  2CVE A;  5HBM A;  3VZI A;  2FY1 A;  2KVQ E;  4M5I A;  1GXT A;  3V4I B;  1S6O A;  4B9T A;  2NS1 B;  4ZMM A;  2HAI A;  4R8U A;  2LVW A;  3J81 j;  2N4C A;  4LF8 J;  4PXC A;  1RHM B;  3D1O A;  2Z8Q A;  4DR2 F;  4B3O A;  2B6A A;  4B02 A;  1Q0N A;  2XNR A;  2GIF A;  1RYR A;  1S79 A;  4HI1 A;  1SH2 A;  1RWU A;  5G0R A;  3V4I A;  4DN9 A;  4OHY A;  1VIS A;  1X8D A;  3ITH B;  4O0N A;  2BR0 A;  2CDQ A;  3N0V A;  1KVJ A;  2MQN A;  3DLG B;  2MDA A;  3L7U A;  2YX7 A;  3W2W B;  2Y0B B;  4NXN J;  3P6Y C;  5RUB A;  4WYW A;  3T5L A;  2HVE A;  4WXO A;  1RSC A;  3KLI B;  4DMZ A;  3IRX B;  2OEK A;  2FVP A;  1YZ6 A;  4OI4 A;  5F9N A;  3SYZ A;  5ETK A;  3ITH A;  2AZ3 A;  2LEC A;  2FJE B;  4C98 A;  3DLG A;  3ZC4 A;  3W2W A;  5GAH I;  3MMC B;  2R2S A;  4CLZ A;  1RAJ A;  4O4R A;  3PFO A;  1X9M A;  1HAR A;  1FK9 B;  2HQD A;  3LAK A;  4NOH A;  4DSE A;  2V8D A;  3IRX A;  3D9B A;  3DMJ A;  1GQE A;  4FKY A;  3LP0 B;  1HNZ J;  2E9Z A;  1CSJ A;  2M88 A;  3BS9 A;  4P2S A;  3C3L A;  4ZHR B;  4B17 A;  1T95 A;  1F6T A;  2RU9 A;  3IBW A;  2PFD A;  1HQU B;  4LBH A;  4I4B A;  3CXC R;  2IIH A;  3D67 A;  1N52 B;  1NM2 A;  4UOF A;  1FK9 A;  1WEY A;  5CD4 H;  4PYD A;  4ZPT R;  3RRG A;  1MU2 B;  2P8I A;  4K0K F;  3LP0 A;  3V6J A;  1MWZ A;  2EEY A;  4FVM A;  3N5F A;  2CIM A;  2WVB A;  4XPE A;  1DQ8 A;  4IR9 A;  4K7Q A;  2DNP A;  2Q6C A;  4ZHR A;  5F8I A;  3G2X A;  1VQ9 S;  3MTJ A;  3S7R A;  1HQU A;  1R6V A;  3DLJ A;  1H0H B;  1FJE B;  4U9R A;  1U1O A;  1VHF A;  2IM3 A;  1HBO A;  3T41 A;  1TAU A;  2MZR A;  4Y2K A;  1MU2 A;  3LAN A;  4Z7C A;  5FII A;  1QTN B;  5KFZ A;  4JV5 J;  4PYA A;  1RJJ A;  3G82 B;  2A18 A;  2H5E A;  2ZZT A;  5E33 A;  4DX6 A;  3VGV A;  4QR2 A;  4I2P A;  1WSV A;  4NXM J;  3A12 A;  3QSI A;  3OUY B;  4USW A;  4C8O A;  5GAG I;  4G3I A;  2XZW A;  4HHH A;  3I0S B;  2J76 E;  4QOT A;  3K2Y A;  2BQ3 A;  1NZ8 A;  4UY8 T;  3MDF A;  1WG1 A;  2I38 A;  1U7L A;  2LU2 A;  1CJT B;  4IRK A;  2AJ0 A;  3G82 A;  4ILL A;  4F0H A;  4Q5V A;  2W8K A;  3MHY A;  1SIZ A;  4JI6 J;  2LQJ A;  5J2P B;  5ETT A;  5KFA A;  2DNH A;  2O5D A;  1F3F A;  4WBF A;  2DK2 A;  3EGV A;  3CVK A;  5KT3 A;  3BQ1 A;  1SKU B;  1NXI A;  4TN2 A;  4FN5 A;  5HLF B;  1HHS A;  4F8R A;  1MRO A;  1S9F A;  2W4C A;  2G0J A;  3EJM A;  3SZ2 A;  1HQ2 A;  1CJT A;  2OAU A;  3OL6 A;  4WFN Q;  3QBC A;  3DU6 A;  1KWM A;  4PWD A;  4DV3 J;  4LRF A;  1XEZ A;  3AT1 B;  1LFP A;  3Q23 A;  2V69 A;  2ZH9 A;  5J2P A;  3S01 A;  4GVB A;  3O6Q A;  2JFK A;  4PPD A;  1QAX A;  2K1R B;  5F8H A;  4EYH B;  4UOG A;  4LF1 A;  1CUL B;  4UZB A;  4NL5 A;  3BGF A;  5DDQ C;  2L9D A;  4G6V B;  2X7I A;  3DGP B;  4J5O A;  3PIP Q;  3HP6 A;  1WKK A;  1MN9 A;  4CTA B;  2BVZ A;  2CJQ A;  3HSZ A;  4XK8 C;  3PZP A;  2CPD A;  4DR6 J;  1SJR A;  4Q8E A;  4RW4 B;  2QYC A;  2CPI A;  2K1R A;  3C16 B;  2KHC A;  3DDN A;  4DFP A;  3P5T L;  1UZH A;  4PQU A;  2Z2L A;  2HZV A;  4DLG A;  5A0Y B;  1HW8 A;  4A8Q A;  1EIY B;  1B4S A;  3I5B A;  3DGP A;  1SC6 A;  4NYP A;  2ZH6 A;  4E2F B;  4WU2 A;  1N4L A;  4CRJ A;  4ANC A;  4G1I A;  4RW4 A;  1T0T V;  3C16 A;  4QR1 A;  2HS4 A;  5B0A A;  3C14 B;  4CLP A;  1X4H A;  4KH1 B;  2GML A;  2FLP A;  5KFN A;  2XNQ A;  2BBE A;  3P5B P;  1TP7 A;  1EQ0 A;  3SV4 A;  3IM8 A;  1EX8 A;  3AJ1 A;  1F5A A;  2QSF A;  4JI4 J;  1TL7 A;  1S4E A;  2GMJ A;  3CTR A;  1N5T A;  1KLM B;  2V2Q A;  2L9N A;  1N6Q B;  3ILL A;  4ZLL A;  1ZS6 A;  5H9E J;  3CME S;  4HHJ A;  1HNW J;  1F2G A;  4LF7 F;  3GLJ A;  3SFU A;  2DGO A;  4RLE A;  3D2W A;  3NY0 A;  2UUA F;  3FCH A;  4MIW A;  1UVM A;  2MZ1 A;  4U8Y A;  1UEU A;  3HZG A;  1WC6 A;  2I9S A;  3W3S A;  1N6Q A;  3VTI A;  3PVX A;  3MOJ B;  1P1T A;  4CWB A;  2W24 A;  3W7B A;  3GCX P;  1EKR A;  1T94 A;  4OQJ A;  1TU0 B;  1X4F A;  4KGZ B;  3HSJ A;  2NYI A;  3DLE B;  4B3T F;  2Z56 B;  4QIV A;  2H5I B;  5EWG A;  1L3U A;  2M5Y A;  2MKI A;  3SQG B;  5D4N A;  2JFD A;  2BEF A;  1RLC L;  4B08 A;  2ATL A;  3DC2 A;  4QWC A;  3OSN A;  2UUB J;  4HL9 A;  1DTQ B;  2K7J A;  4IRC A;  1NUE A;  3ZTO A;  4HLB A;  2VPZ B;  3CJT A;  3DLE A;  1RTH B;  3TJ8 A;  2FB0 A;  1S7I A;  4J91 A;  3EGW B;  1NCL A;  3M2V B;  4YR2 A;  1BLU A;  3SQG A;  1R3N A;  3QLH B;  3MED A;  4ZCI A;  3UW1 A;  1IBM J;  4HH1 A;  5KAK A;  2DHG A;  3ENA A;  4TLQ A;  4ZLP A;  2MEW A;  3Q2S C;  3R3T A;  4A46 A;  3LTO A;  4KKO B;  1RTH A;  5KFX A;  4ZPW R;  2ZC4 A;  5E2Q A;  3SDE B;  4CLK A;  4O44 B;  2CAJ A;  4F4W A;  3HVT B;  3CCJ S;  3UI3 A;  1IBK J;  3TVZ A;  3M2V A;  4EWT A;  3DM2 B;  3BR8 A;  2ZC3 A;  3Q8S B;  4DZD A;  3EXC X;  2C22 A;  2ZFH A;  2DIU A;  1JXV A;  5IQQ A;  4PRF A;  1I6J A;  1FEE A;  3GPA A;  1R89 A;  4RNN A;  2LP4 A;  3PAC A;  2ZM6 J;  4U6P A;  4DCO B;  3S1T A;  2PEH A;  3SDE A;  4P2X A;  2DO4 A;  3CSK A;  3UNG C;  1KQK A;  2DEI A;  2V9K A;  3DM2 A;  1Z4U A;  4USK A;  3M6W A;  5BR8 F;  2AD9 A;  1TK0 A;  4YR0 A;  4EUV A;  4ZP9 A;  3DHW C;  1K73 T;  3S6E A;  4ZKA A;  3NG8 A;  1OPI A;  2DT9 A;  1DLO B;  4W90 B;  1D0E A;  4OZ2 A;  2PMH A;  2Q66 A;  4DPT A;  1PAU B;  1NEE A;  3PM9 A;  3QWP A;  3AFG A;  4NLS A;  2L08 A;  2NXJ A;  3PDN A;  1FVS A;  3FSX A;  1RXO B;  1X31 C;  2QLJ B;  1RWP B;  2V0N A;  2IVY A;  2E9R X;  1Y00 A;  1XMO J;  1DLO A;  3HD1 A;  3DLB A;  3NXZ A;  4HAC B;  2NZ4 A;  1BQN A;  1TKD A;  4DUZ F;  5C5J A;  4QWE A;  3Q8R B;  2HPU A;  2DPI A;  4PQA A;  1YBA A;  3UFC X;  3V81 B;  4C0H A;  1TFW A;  5C25 B;  4OI6 A;  1TZ0 A;  1G1X A;  2VG6 A;  5HN0 A;  2O1P A;  3MMB B;  5ETV A;  1H2U X;  2HNY B;  4DEZ A;  3TEG A;  3W1Y C;  4CLT A;  2GJ2 A;  4K4S A;  3CDA A;  1S9G A;  3LQV A;  2CWX A;  4KTQ A;  2V9W A;  4X4V A;  4KSE B;  5C25 A;  4EBE A;  1P9Q C;  3MMB A;  1IKY A;  2CYY A;  1UPM B;  4XDC A;  5A8W B;  3ISN C;  3M1V B;  3G8T A;  2KU7 A;  4I69 A;  2FVS A;  1M5V C;  2CG8 A;  2QRR A;  4RU2 A;  2E7V A;  3PHT A;  3ULH A;  3VAM A;  5F0U A;  4KAI A;  5IWA F;  5F8L A;  2UVU A;  3RBE A;  2JWN A;  1O0P A;  4NPO A;  2XMV A;  3UD5 A;  2AV5 A;  3CED A;  3FMB A;  4DV5 F;  2KG1 A;  4OFZ A;  4W4M A;  1JIH A;  2EW9 A;  4ZIV A;  1PIL A;  1LWE A;  1JLG B;  1GMW A;  2DNN A;  3WHI A;  1NSA A;  4JI2 F;  1HR0 J;  4KHP F;  1FJG J;  2N3L A;  2QX0 A;  4KE5 A;  1VOM A;  3VR1 A;  3IS9 B;  5U47 A;  5DDP C;  5KFM A;  2HBY B;  3LP1 B;  1JX4 A;  2PN6 A;  3CIZ A;  2KKH A;  2J0X A;  2ZBC A;  4YP3 A;  5JUM A;  2X51 A;  2GMH A;  2ZH7 A;  4OV6 A;  1FF2 A;  5KFY A;  2BJ9 A;  1VIX A;  5THW A;  1MN7 A;  1YBU A;  3KHH A;  1FER A;  4PXD A;  3ET6 A;  3M2U A;  1RQ0 A;  3IS9 A;  5E3Q A;  3Q2T C;  4FF2 A;  4KR0 B;  5KFO A;  1PIE A;  2ZWP A;  2HQI A;  1B70 B;  1KBR A;  1NRK A;  1EHW A;  1TMM A;  1ZA1 B;  2XSJ A;  3M9N B;  1XNR J;  1FVQ A;  4Q0B A;  1RZM A;  3MUM P;  1X4D A;  3QAT A;  3H90 A;  3US5 A;  4ZN1 A;  3UQS A;  3VQT A;  3T1Y F;  3UVJ A;  4M5M A;  2WSC C;  3PW2 A;  5AT1 B;  4IH6 A;  2AT1 B;  3TUJ C;  3TWZ A;  2YWW A;  4URQ U;  2D41 A;  4DV1 J;  3R27 A;  4HT7 A;  1V6H A;  2DGV A;  5HQL A;  2MKK A;  1V9O A;  4HYK A;  4E8U A;  2Z4P A;  4F67 A;  3HFZ B;  3KNG A;  2X1B A;  3K89 A;  2XS2 A;  4BWM A;  1XER A;  1TKT A;  4JI0 F;  3CJQ A;  2RE1 A;  3H40 A;  2W9B B;  2WVF A;  4M63 A;  3A8I A;  2F1F A;  3M32 A;  1P27 B;  1DFD A;  2QEX S;  2DNZ A;  2AGQ A;  4LRD A;  2EBE A;  2EK6 A;  3OXG A;  4DR4 F;  2UUC J;  1AFJ A;  2AP6 A;  1VYA A;  2AYE A;  5HJY A;  4LF2 A;  3OFH A;  3UD3 P;  2ZZM A;  3LOU A;  1X4A A;  5L8R C;  2FGC A;  4DV4 F;  1OY8 A;  4QQB A;  1D8Y A;  1T3O A;  4NLU A;  2MY7 A;  3HVW A;  4F36 A;  3MR5 A;  3TZY A;  1JLB B;  3C15 A;  4J37 A;  2AJ1 A;  4DQI A;  3PO4 A;  2J9C A;  2FVR A;  3H7H B;  4Y34 A;  3NS7 B;  4A48 A;  3JYT A;  1APS A;  5F8G A;  2GVD B;  5B0D A;  5KG0 A;  4ZVQ B;  5FJ4 A;  3C46 A;  3L09 A;  3I32 A;  1EJ7 L;  2SXL A;  1K0V A;  4DF4 A;  3CD0 A;  4X64 J;  1SB6 A;  3NS5 A;  3PXG a;  1LFW A;  2UXC J;  1F1B B;  4QCL A;  4CH0 S;  1RT2 A;  4LFB J;  5LXY A;  2E5I A;  3RUB L;  2QA4 S;  2XMJ A;  3FCV A;  3DN9 A;  1HPZ B;  4X4P A;  1X5O A;  1FX4 A;  2AJ4 A;  3NNC A;  3CD7 A;  3D5M A;  2QO3 A;  4IO1 A;  2GVD A;  4CZC A;  3NNA A;  4ED2 A;  1A6L A;  4DX7 A;  1X0P A;  1KLN A;  4XO0 A;  1LQ9 A;  1CLF A;  2A1B A;  5GAE I;  1KS2 A;  2EFV A;  1KTV A;  3BGL A;  2ZHB A;  4F4K A;  1S1X A;  1XN9 A;  2OUG A;  4LBI A;  2FIU A;  1FFS B;  1HPZ A;  3TJA A;  1TL4 A;  1VRT B;  3AAW B;  4OI1 A;  2GO8 A;  4A8X A;  2JLG A;  2GS8 A;  2RAQ A;  1Q95 G;  3AJ2 A;  2KL8 A;  5GVQ A;  4OLP A;  1WOP A;  4B9S A;  2XYH B;  1IR2 A;  2DGT A;  4FPR A;  1YRU A;  5AE3 A;  1RKJ A;  2GAH C;  2J6U A;  2W2P P;  3NNH A;  2IRU A;  2H5J B;  4EBD A;  3GMG A;  2ZBQ A;  4F2S A;  1RT3 B;  1S99 A;  4HVZ A;  4C48 A;  3MAA B;  2BM0 A;  4FYX B;  1VRT A;  4DSI A;  4C3L A;  4IFY B;  3VAK A;  2JEG A;  5DZ6 A;  2XMW A;  2V8V A;  3TOQ A;  4ZS6 A;  4DL5 A;  2HWH A;  3T1H J;  2VFS A;  1S76 D;  2CPX A;  1F3V A;  1N54 B;  1U2R A;  3FFI A;  1XC9 A;  1HLW A;  1PJ7 A;  4DV7 F;  1RT3 A;  1VK3 A;  4WWS A;  2BKP A;  2H51 B;  3MAA A;  1RBA A;  2EI5 A;  4PR6 A;  2WB1 D;  4C0B A;  2V68 A;  4H4M A;  3DGV A;  3LO3 A;  2DJW A;  4ED5 A;  4P72 A;  3MUV P;  4F0M A;  4CO5 A;  1C1C B;  4CO1 A;  3BSC A;  1ZM4 A;  4F3Q A;  9RUB A;  3MR3 A;  2C3P A;  3RB6 A;  3OSP A;  4LF8 F;  2R8I A;  3N28 A;  5KTQ A;  4AE5 A;  5GME A;  1NJX A;  2YPZ A;  3JQJ A;  2ZVI A;  2RHS B;  3TYT A;  1LEO A;  2H4W B;  1FKP B;  4ID5 B;  1WG5 A;  2VOO A;  3FQL A;  5JVG Q;  1C1C A;  4OZ0 A;  4N76 A;  1DJ0 A;  1QM9 A;  1HNI B;  2K3K A;  2XQC A;  1HWK A;  2QLB B;  2BE7 D;  2HLT A;  3NGD A;  2B5J B;  3J81 U;  3EM1 A;  3RJM B;  4MMO A;  2O3D A;  3TVK A;  2IA6 A;  1FKP A;  2ILZ A;  1H38 A;  4RBT A;  2OPQ A;  4MH8 A;  1NJW A;  5HMW A;  3BGR A;  2G2Y A;  3HT0 A;  4TKT A;  2E5L J;  4LSL B;  2CQI A;  4USJ C;  1VQ8 S;  4DQP A;  4UZC A;  5CZX A;  2NPF A;  2B4U A;  5T7L B;  1S72 S;  1IJF B;  4Y2C A;  3EZ5 A;  1U49 A;  3CJ2 A;  3QT5 A;  2ROE A;  4A8K A;  4IH5 A;  3OTB A;  2ZHA A;  4ZVP B;  3MPU B;  2ZH8 A;  4LSL A;  1UVJ A;  2HND B;  1D9F A;  3VCD A;  3BB5 A;  5D0R A;  3DNC A;  1RHR B;  2EVZ A;  3GSI A;  3CMQ A;  4ZLJ A;  5IQ6 A;  2CAD A;  1JMT A;  1T9Y A;  5HQM A;  5A2Q U;  4B3R J;  5DQI A;  1QSS A;  2AEM A;  2HHW A;  4PKD B;  2JNJ A;  3EYZ A;  3PW0 A;  2FVC A;  5KFU A;  3ZZ0 A;  1RTD B;  1UTA A;  1RT1 B;  3GQC A;  2BQR A;  3BRE A;  5LXR A;  1MWY A;  1URR A;  2DCL A;  4IOB A;  1VCT A;  3C6T A;  1WC0 A;  2NSC A;  2AGP A;  4JV5 F;  1QUP A;  4K4W A;  1FXD A;  4CLF A;  5F8J A;  2WAQ D;  5KG6 A;  2BX6 A;  1K8A T;  1U4B A;  2JEJ A;  4MKY A;  3OT9 A;  1RTD A;  2GZO A;  2FJD B;  3M4X A;  4LRB A;  1RT1 A;  4DWI A;  3LF0 A;  2ZH4 A;  4K2X A;  2RUG A;  3C19 A;  1DAX A;  2DNM A;  5K8P A;  3HMJ G;  1ZAX A;  2H9Z A;  3CJ5 A;  2EPI A;  1FTC A;  2B9E A;  1RWW B;  2ALZ A;  3CCZ A;  3GON A;  4JI6 F;  4EMD A;  2F4V F;  4K8R A;  4RNF A;  4X2B A;  4ZVE A;  3IP0 A;  3MEG A;  1VC6 A;  1LWC A;  2CPF A;  2R7T A;  2KB2 A;  1FEH A;  3BF4 A;  1RAB B;  4JI8 J;  2LQB A;  1U0S A;  2ZOM A;  5J2M B;  1S57 A;  5AJ3 J;  1KHV A;  4KO0 B;  3KLH B;  5F8M A;  3OXL A;  2ZNZ A;  2QV6 A;  2MQL A;  3KK1 B;  4NYZ A;  2XCP A;  4OJ1 A;  2IM2 A;  4TVA B;  2FLN A;  2UXD J;  1GFW B;  1RCX B;  1R8P A;  1XIQ A;  2OH2 A;  1O51 A;  2N4D A;  4J9P A;  3G6X A;  1WOS A;  3M05 A;  1Q53 A;  1OY6 A;  3A13 A;  4WTY A;  5FD1 A;  4K4Y A;  3KLH A;  4GC6 A;  5A2Q Y;  1P1L A;  3W9H A;  5LMN J;  3DLH A;  3JXO A;  1F9H A;  3GCW P;  2CRL A;  2IVF B;  1YJN S;  3KK1 A;  3EVW A;  3LGH A;  1UP1 A;  2AYM A;  1W26 A;  4N5S A;  2VL1 A;  5KT7 A;  3TJ9 A;  3DFE A;  3ZZT A;  4L72 B;  2XLJ A;  4CT8 A;  2BYC A;  2CWK A;  2DNO A;  1S77 D;  4PXE A;  2R7U A;  3PJX A;  4DL0 C;  4NEY A;  3EMT A;  5D78 A;  1U1P A;  3KXD A;  4CQ1 A;  1HMV A;  2MHN A;  2MZQ A;  4IO9 Q;  1Q82 T;  3NRB A;  1U1N A;  2PO4 A;  3UCZ P;  2WOM B;  2W7P A;  3PYG A;  4Y2I A;  4JI5 F;  4CLW A;  1I51 B;  1OYE A;  1BD6 A;  1W25 A;  4PXB A;  5IC6 B;  2KZZ A;  5F9L A;  3B4D A;  1ZZF A;  2D3O 1;  6FD1 A;  3HJF A;  2ABY A;  3PTW A;  1SC4 B;  3OXF A;  3CD5 A;  4LFA J;  2XY5 A;  2IJN A;  4DG1 B;  2C2E A;  4OYM A;  5DQH A;  4NA3 A;  4EYI B;  4RL1 A;  2F7V A;  2FZK B;  3G87 A;  2YX4 A;  1WHY A;  2MLX A;  3HUL A;  1RTI B;  4FXW A;  1G4C A;  3FK4 A;  2C2Z B;  3HHL C;  5IT9 U;  2ZH1 A;  4NI2 A;  2J0S D;  5IM0 A;  3GV5 B;  4A8M P;  2M2B A;  4QWB A;  1HYS A;  3G8S A;  1U47 A;  3MR2 A;  1KFS A;  4DG1 A;  1JLQ A;  5L1I A;  2PEB A;  1YJU A;  1H3D A;  1GMW D;  2DNK A;  1Y5L B;  1GX6 A;  3I5C A;  2YXL A;  1RTI A;  3TUZ C;  3QID A;  5G4D A;  4DR1 J;  1VQP S;  4WE1 B;  1JJH A;  4YS2 A;  2BRL A;  3OJU A;  3KWM A;  1Q8L A;  3CJK A;  3ETM A;  3MXH P;  2BE2 B;  3UDC A;  1NND A;  3CE8 A;  1R8H A;  3MCM A;  4IQX A;  4L73 A;  3AA9 A;  1T7P A;  2CJY B;  5K5M A;  1KQS R;  2X3D A;  2R7W A;  1UET A;  4WF9 Q;  3KLG B;  4KV8 B;  3G8Q A;  4I1T A;  1NK8 A;  4J9R A;  1LW0 B;  4RWW A;  1S4F A;  2VBX A;  1NK4 A;  2BE2 A;  1WNE A;  3QAU A;  2HLU A;  3NCQ A;  4M5H A;  4X66 J;  1WC1 A;  1FRI A;  3ZTS A;  4LIR A;  4OYX A;  5HMX A;  2OO4 A;  5SUH A;  4BBY A;  1PYS B;  1GXL A;  4KFB B;  1QSL A;  3AA8 A;  2NXC A;  2LMI A;  1KOH A;  2DXD A;  1FWL A;  3K5N A;  1LW0 A;  3QPI A;  3OVA A;  5HP1 B;  4AL6 A;  5KFT A;  1GX5 A;  1SQF A;  4OMF G;  3N5B A;  1RAG B;  3WC2 A;  2J5A A;  2PI4 A;  4J9L A;  4DV0 F;  5KFE A;  4DV6 F;  4N8N A;  2Z0G A;  2ZM6 F;  2D9O A;  1Q78 A;  2AF6 A;  3KG1 A;  3P4U B;  1OPZ A;  4QPX A;  1ZAW A;  4O3Q A;  2CVI A;  1TK8 A;  1KDN A;  2DGQ A;  2HHT A;  3DRS A;  2VC1 A;  1YKW A;  4LR8 A;  3R1H A;  2UVV A;  4PG5 A;  1Q4R A;  4JI3 F;  1T9T A;  3NMA A;  2OPP B;  2JX2 A;  1RBL A;  1VJW A;  3H2V E;  3I5A A;  4LFC J;  4KGM A;  2D3O R;  1TMJ A;  4RW7 B;  1S49 A;  4WFX A;  2RJZ A;  1NDC A;  4QW8 A;  2G13 A;  1RWO B;  1CPZ A;  2VA3 A;  1A9N B;  3GR1 A;  4PWW A;  4K4U A;  4S0M A;  1HNV A;  4KPC A;  1KC8 T;  1B99 A;  4LF5 F;  2OPP A;  1XMB A;  2JHE A;  1X60 A;  3M9O B;  1N5Y B;  1X5T A;  4NLR A;  2KZM A;  4QYZ K;  4BC7 A;  2AGO A;  1R0A B;  1FRM A;  2FYX A;  1UW4 A;  3M8Y A;  2J9E A;  3C2P A;  2LQ5 A;  2HHU A;  4CI0 B;  4NLX A;  4MIA A;  3L7O A;  3U27 A;  1LXN A;  5FLX U;  1W2I A;  1NH8 A;  1JLA A;  4TXS A;  1AB8 A;  1M0S A;  2V2V A;  3NBP B;  1Y7P A;  1S0O A;  2VZ9 A;  2HBQ B;  3JSM A;  2EK1 A;  1J5E F;  2HHH J;  3D6T B;  2CQ4 A;  2WCX A;  4OX6 A;  1N32 J;  1BY9 A;  2AWZ A;  1R0A A;  1HWJ A;  3KJQ B;  2G0C A;  2GNK A;  3CUL A;  4ECS A;  3D6M B;  4C8N A;  1BWV A;  3FZB A;  4PCQ A;  1HQE B;  5D77 A;  1L3S A; 
#chains in the Genus database with same CATH homology
 2HBR B;  2C2O B;  2C2K B;  2QL5 B;  4ZVR B;  4ZVS B;  2QLJ B;  1RWP B;  5IC4 B;  2H54 B;  2QLF B;  3D6H B;  2CNK B;  2CNN B;  4JB8 B;  2P2C B;  3R7S B;  1SC3 B;  1ICE B;  1QDU B;  1RWO B;  1RWK B;  2QLB B;  1IBC B;  3RJM B;  2H65 B;  1PYO B;  3R6L B;  4LSZ B;  1RHK B;  3IBF B;  2H5I B;  1BMQ B;  1RWX B;  1RWN B;  3D6F B;  1QTN B;  2Y1L B;  1I51 B;  2C2M B;  5K20 B;  1RWV B;  3R7B B;  2H51 B;  2XYP B;  3EDR B;  1NME B;  4DCO B;  2QL9 B;  5IC6 B;  2H48 B;  4DCJ B;  3GJR B;  4DCP B;  1RWM B;  3R7N B;  1SC1 B;  2XZT B;  2C1E B;  3EDQ B;  1RHM B;  2HBZ B;  1GFW B;  1F9E B;  1RHQ B;  4ZVT B;  3P4U B;  1RE1 B;  2CJX B;  2CJY B;  3KJF B;  2DKO B;  3IBC B;  2HBQ B;  1SC4 B;  3R5J B;  3R6G B;  4ZVP B;  4ZVU B;  3GJQ B;  3KJN B;  1RHJ B;  2QL7 B;  2XYH B;  2CNO B;  3KJQ B;  2CDR B;  2HBY B;  2CNL B;  3SIP B;  3P45 B;  3GJT B;  3QNW B;  1PAU B;  3NS7 B;  2H5J B;  2Y0B B;  3D6M B;  2FQQ B;  2H4W B;  2XZD B;  4ZVQ B;  4ZVO B;  3GJS B;  2C2Z B;  1RWW B;  1RHU B;  1I3O B;  1RHR B;  2H4Y B;  2XYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...