2AV5A

Crystal structure of pyrococcus furiosus pop5, an archaeal ribonuclease p protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'KKRYIAFKVISENQFNKDEIKEAIWNACLRTLGELGTAKAKPWLIKFDETTQTGIIRSDRNHVYDVIFSLTLVSDINGNKAIIKVLGVSGTIKRLKRKFLSQFGWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 2
publication title Structure of Pfu Pop5, an archaeal RNase P protein.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 27
structure length 106
sequence length 106
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01900 RNase_P_Rpp14 Rpp14/Pop5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2av5A00
2CZVC 3WZ0A 2AV5A
chains in the Genus database with same CATH superfamily
3HHLC 1RYRA 2GMJA 4UY85 5DRKA 2DB1A 2E1AA 4HLBA 1VI7A 1H6KX 1RTDA 1BE4A 4YMEA 2YNHB 2JVRA 5ETTA 2DIUA 2ZVSA 3I4PA 1U0SA 3HPOA 3QIPA 3IM9A 3W62A 2IBOA 3GYNA 2EFVA 1EQMA 1M90T 1NSPA 1IR2A 2ZWOA 5IM0A 4FS2A 3M8PB 2RAQA 3G6VA 4GVLA 2IM0A 4X65F 2FIUA 4ZPTR 2XTJP 4U96A 1WF1A 1HNXJ 2VQEJ 1TQLA 3TA2A 4WWSA 5DGAA 1IM4A 2W7PA 2MKKA 4AQYJ 1IM6A 2RQMA 7FDRA 4KKOB 4QIFA 2GGPA 1DJ0A 2QGFB 4RNHA 4C8KA 1FJGJ 3D6TB 4J9PA 3FBCA 1JIHA 2EFQA 1LWCA 1Y3JA 1KFDA 1I94J 2MKSA 1V3SA 4I67A 3FEZA 5H9FK 3RBDA 3MM5A 3R8YA 2VG5A 1UZDA 2MQNA 4AL6A 1FK9B 1HNWJ 1FRLA 2WB1D 3RYLA 1U02A 3BQ0A 4DMZA 2HHPA 2HVZA 1BQXA 1TKTB 2IM2A 1WC6A 6FD1A 3CNQP 2VDIA 3TNVA 4PQUA 3PW7A 2L9WA 4DX6A 4LF4F 3CCVS 2Q79A 2Y1LB 2DNPA 4ZVGA 4RWXA 4C9DA 1I6JA 4DR2J 5IWAJ 2AZ3A 3NGDA 1F1BB 3KLFA 1VDHA 1D0EA 3U02A 5KFIA 4GRSA 4WFYA 4EU0A 4LUBA 3T3FA 1LXJA 2AMCB 4LF6F 1YK9A 2GNKA 3QAUA 3ENQA 2V8VA 3NCPA 1NK0A 5KT7A 2WOMA 1WHVA 4G6VB 4A8OA 2NPFA 2V4QA 4FYDA 3GR1A 1NEEA 3TEHB 3VVUA 1W25A 1FDNA 3HT3A 4ANEA 4LRDA 4WK1A 3UCZP 1GT8A 4IH7A 3MGJA 4IO9Q 4RU2A 3HFZB 2HRUA 4B9LA 1UVIA 3LP0B 4N5SA 3CDAA 4ZN1A 2HMIA 4OZ0A 1OY9A 1VQ4S 4DFPA 2LMIA 4CLUA 1FNMA 3JSBA 2BV3A 5KG6A 3TARA 3AXKA 2FHMA 2VD3A 1DURA 5D78A 1BGXT 2QA2A 2OPSB 2OPRA 3CJ5A 2W7AA 5L39A 3KJVB 3WZ0A 1AXQA 1SJFA 3T5KA 1X5PA 2V8DA 4OI2A 2OKQA 4M5KA 2ZH1A 5L1LA 5E3QA 3CSKA 4K4WA 4QU7A 4ZIWA 4K4ZA 1UW9A 1SL1A 2B7CB 1YJUA 1HQ2A 3B54A 1T05A 3GIRA 2CPZA 2JRSA 4WFAQ 2UXBJ 2HNYB 1QTNB 4OMFG 5KFJA 3K8VA 1HHQA 4H4KC 1RB0A 3D66A 1WNEA 2FD2A 2WONB 1T03A 3TP2A 4ITSA 1RTIB 3OSPA 1ZETA 2HHQA 2LKZA 2AJ2A 3QWPA 3UDCA 1MMDA 4LREA 3DOMA 1U1MA 2HHSA 1MWYA 3IWXA 5DQGA 3LALA 4JI5J 1RE1B 1WEXA 5ETMA 4CTAA 2B6AB 4Y2KA 2KB2A 1FXLA 3C3LA 4C8YA 2FZGB 2HBZB 4LSZB 2ZEJA 3UR0A 1PG5B 1X60A 3F73A 3NGKA 2GQ2A 4JI6J 1UVMA 1FFSB 3M8QA 4CYUB 4P71A 2VQFJ 3NKYA 4OZ1A 3L7OA 3VGSA 4JBCA 5D77A 3TUJC 1TL4A 3D1HA 1U0HA 3H0PA 4B9TA 2M8DB 2DGSA 2Z4PA 2V2ZA 5B0EA 2AD9A 4K5RA 2J0SD 4NWBA 3EWGA 3O1LA 1SKWA 1C1CB 4OX6A 1NB7A 3N4WA 3A3NB 3EGZA 2VBXA 4FF4A 1S48A 4UT4A 2CVIA 4OZ3A 3EYZA 3FCHA 4K0KJ 2AF6A 1OS5A 3UR3C 4B3OA 5FDLB 4H4MA 1AYEA 3A8JA 2GHVC 2JOQA 4JYAJ 3CEDA 3K5OA 1VR6A 3R7BB 3UDEA 1R8CA 1WD6A 1WEZA 2VPYB 3I4HX 1EETA 1WWHA 4E0DA 5HP1A 3EPIA 4DV3F 1J2VA 3TQ1A 2QC3A 3MR7A 2HVIA 4NOHA 5A76A 3PNIA 3OTBA 4KH0B 2R42A 4YB1P 1T94A 2OPPA 3TQEA 2GVDA 2CG4A 4PXBA 3C66A 2CKWA 4IG0A 3U7JA 1HBNA 4QYRA 1CG2A 2QLXA 1IWAA 1REVB 2BE2A 3QWUA 4IR9A 4NLQA 3J7ZT 5EGYA 2RQKA 2XO6A 1IJEB 3CULA 3GG0A 1RTZA 1HMVA 1TFWA 4ZVRB 4PWWA 2XM3A 3BS9A 1NB2A 4KE5A 1ELOA 4J9VA 5D15A 2AV5A 4MAKA 3MM6A 3HXMA 1W2BR 2YNIB 1DTQB 4WYLA 1EKRA 4DCPB 1RT3A 3HHLB 1FKAF 1BY9A 4BLGA 4QR2A 3W7BA 4DSKA 3W5YA 4HT7A 2G1DA 1JX4A 1ZM4A 2R8JA 4LBHA 3MECA 1JJCB 4Z7CA 2VKRA 3UNYA 4DZ6A 4IG3B 1UFKA 1LW2A 1U1OA 2CQ0A 4OQJA 4P73A 4KGMA 4U6PA 3CD7A 2DHGA 2B7BB 4LSNA 5KFWA 3SI8A 5KFKA 1VHIA 3QSYB 3MEEB 1S9GA 1CJVA 3FQKA 3A1YG 3H4BA 4ZVHA 3GQCA 2W25A 2JFKA 2MLZA 5SUHA 1HNVA 3V5RA 2QN6B 3E51A 2PSZA 1RWPB 4AL7A 3FBBA 3FUYA 3EDRB 4RBVA 3KLIA 2KHCA 3J81Y 1EZZB 2NR0A 2PEHA 2A3JA 2GJIA 3W1YC 2IMOA 3PKYA 4X66J 4EEYA 4A8SA 2MQLA 2DR5A 3OT9A 1WF0A 4ICLB 5CYQB 2V6AA 2G0IA 4RWWA 1N5YA 3D67A 2NQPA 2IA0A 2XG8A 2WK4A 2W4PA 4WYWA 1D09B 4DV0F 3CW2C 2DNKA 3A8EA 1CS4B 2BANA 3SFGA 1U1NA 1K9MT 3GU0A 2DEJA 2RRAA 1NHUA 4K5SA 2A10A 1SC6A 3WX8A 3DCAA 4TYBA 1YJTA 4LF2A 5HL7Q 1WELA 1RHRB 2AWZA 2DEIA 2AYMA 2Q66A 4PWDB 2ABYA 6AT1B 1XNQJ 3KHRA 3DLKB 3ET6B 1Q81T 2C3YA 3Q83A 3PV8A 3Q8YA 4DCJB 3OXFA 2QIFA 4WCEQ 1S6PB 5T14A 3R97A 1UFLA 2M8HA 2HK3A 1YRXA 4QPXA 1SKSA 4LF8J 3CUNA 1IR0A 3R5CA 5E41A 4K59A 4ED8A 3DKDA 4DN0A 2CWKA 4B3TJ 4USKA 1RLDA 4NLUA 4DR4F 1SB6A 3FFIA 5HMZA 2ALYB 3H98A 3UVJA 1AUDA 1NLKL 2JL9A 3HSZA 2Z2LA 3DRYA 2B9EA 1JLBB 4J9NA 4N8NA 3S7RA 1SV5A 4ZLJA 5KTQA 4P2FA 1XBWA 3DRXA 4Y34A 5J2MA 1KLMB 2ZBRA 2MTLA 4U7UD 3CMQA 4YS2A 3HM9A 3NNCA 2H1YA 5DDOC 4FXWA 2BJ9A 3LQVA 1J27A 2MKIA 4J9MA 2UVRA 3KG0A 4X84A 2HYIB 4ECUA 3R5GA 2RRBA 3T19A 1D3WA 1T9XA 1JNZB 4CLLA 1RSCA 3GYGA 3W60A 5HMYA 3MTJA 2DR9A 2EFOA 2LQBA 3UD4P 1U6FA 2JH3A 2PT0A 3OXGA 4M5DB 3S1TA 2C2EA 3ITHA 2OFHX 1HNIA 4KFBA 4WTOB 3EMTA 4K4SA 3BQ1A 4DQRA 1NSKL 2V5HG 4YR3A 1UVLA 3SQOP 3ENVA 4Q44A 4DSEA 4Y28C 4TYAA 4WU3A 4I1TA 3K5PA 2XYHB 4LFBJ 3TOQA 5E3AA 1LWFB 4ZHRB 1PIEA 1CLFA 1HW8A 3FKBA 2MKJA 3I31A 2DH8A 2QX0A 2NREA 4LFAF 3I96A 3IWLA 2VPXB 2V4JB 2LXIA 2VIHA 4W92B 1KR4A 1CJTA 1FTRA 4OV1A 2D41A 4X62J 3H2VE 4IFVA 1YJ9S 2BABA 1HPZA 2BM0A 1YHQS 5CZXA 1BQMA 1C0UB 4OX8A 3DOKB 3K7RA 2E29A 2AGPA 4CNZA 4LMZA 2EG2A 1RAFB 4KGZB 4A46A 4RKUC 4QWDA 5D3GB 2BX6A 1F9HA 3R5DA 3M2VB 4LSLB 2XQCA 3GMGA 5DS7A 2CNKB 1HQEB 1JLEB 4PXDA 2MZJA 5EX3A 1VQ5S 4C8LA 3FEXB 5F8IA 4CO4A 3ZC4A 1N88A 3P3DA 2F63A 2XY6A 3GV8B 2CPFA 3OVAA 2DPIA 1FD2A 4R8UB 3BGUA 5KFFA 3CJ8A 1UEUA 1HYSA 3ZO7A 4C11A 5F8GA 3TVYA 1FNXH 5B0GA 5EX0A 3U27A 3KJQB 4I2QA 2ZWPA 4A8KA 2CJKA 4IDKA 3Q86A 1GNKA 5GAHI 4WXWA 3NBPB 4M5LA 7FD1A 4J9LA 3AOCA 4X4TA 5KFYA 1SIWB 5C42A 3BGOP 1B3TA 3OTOJ 4OHVA 1S7IA 2KZMA 2FVRA 1RT7A 4MIWA 5EN1A 2X1FA 2FHKA 3SXLA 2WHOA 4PUOA 1MNEA 4DBQA 1LW0A 3VWSA 3JSMB 4LR8A 2FLLA 1R3NA 1Y00A 1HBOB 3OVBA 2QEXS 3PHEA 2LEPA 2F8EX 2AEJA 1WKLA 3CB4A 1Q16B 2M88A 4V19J 1WF2A 3VGVA 4DG1A 2UUAF 2WCXA 4CLPA 2CQ4A 4FDFA 2Q3PA 3ZXWA 8RUCA 2DBBA 2UU9J 4CCHA 3POTB 3U1MA 1S0MA 5F3TA 4DL6A 4DUYF 2NXNA 1RT4A 1GXTA 4LBPA 1TAQA 4DV2J 3RGIA 1RTJA 2CZ9A 5EHHA 2RQ4A 2FLNA 2CJBA 3ENWA 3GE9A 1UA1A 2NYHA 3SSSA 3M6UA 2CZ4A 2HHXA 2VODA 3TO8A 3PRBA 4KPCA 1RKIA 1E6VB 4NE9C 5F0WA 2UV8A 1CSJA 2N3OA 3HD2A 1Q0NA 4W90B 2G9OA 1SIZA 1RA6A 1TK0A 1X5SA 3H7HB 3PW5A 3NCRA 1YZ7A 3MMCB 2XLKA 2ERRA 2GVZA 2IRXA 3KDOA 2CG8A 3BBFA 1J5OB 3VVTA 3DXSX 2Z8QA 1UFWA 2ZBCA 4ZIVA 3L7UA 2D3ZA 4OZ2A 2CJYB 4NXMF 4BWMA 2Z2ZA 4F2RA 2EBEA 2YQ0A 3B4MA 2DGUA 1T3OA 2WAQD 3OHAA 5DDRC 2J8SA 1V3ZA 3F56A 2YX1A 4B08A 1LQ9A 2GAHC 4P74A 2CQBA 3TZWA 2LEBA 3MPDA 3W65A 2CZVC 3IR5B 2VG7A 2ZH8A 2OHDA 4RLEA 3DLEB 3CF5Q 3IR7B 1KOOA 1RZMA 1V5VA 3PX0A 1S57A 4IO1A 2FZKB 1EHWA 5KOXA 5DJBA 3W3SA 4C0OC 3WBZA 2MB0B 1N5QA 3T41A 1ZAXA 5CYJA 1JLAB 1WI8A 3MPUB 1SH0A 5KFVA 4Q7AA 1P1LA 1RACB 2YX7A 4RNOA 2KH9A 3BSAA 3CIMA 3QO9A 4DR5F 4RW4A 4ZK7M 2AQ4A 4WE1B 1NM2A 1T02A 2E1RA 4NPOA 1C0TB 4DOZA 1F2GA 4UZBA 2QMUB 5KG3A 4KV8A 2DNYA 1BC6A 1RT1B 4O4GB 4NMLA 5KFRA 3UE2A 2HBYB 4OHXA 2RDJA 1B7FA 2AGOA 3MMBB 4RNMA 2HAFA 2XMAA 8ATCB 1XMOJ 3SCLE 3PG9A 1HFEL 4R5PA 3MEGA 1S9EB 3ZTRA 2B0GA 3M30A 2CDRB 2HQFA 2XS5A 3UWTA 4UUWA 1TKZA 4HT5A 1VGYA 2VF3A 4B9VA 1B4SA 3R1LA 3OTCA 3KK1B 2WSFC 3N28A 3TZXA 2Z56B 3L4BC 4YB5A 2XS7A 3JTNA 2HQCA 3RBZA 2OTJS 2HVEA 2CPEA 4Q0BB 2C28A 1R0AA 4YUDA 2FVSA 3FZBA 2A6MA 3MM9B 2FDNA 2DNGA 3NG8A 1VLOA 3EVOA 4LRFA 4ZVPB 3IP0A 4KGKA 1QJHA 2QG9B 4FKYA 4FNIA 1HIYA 3ZZOA 2B5JB 3VAKA 2DGVA 3RRKA 3W5ZA 2WB4A 1A0OB 2MGZA 1TP7A 2M52A 3KLVA 2AYEA 1S1UA 1UETA 1LEOA 2WVDA 4BDPA 3P49B 5K20B 2HRTA 4DS5A 4P9SA 2DHHA 3I5CA 3IC1A 3SCKE 3DYAA 4KPYA 2A2CA 1R8BA 2QA4G 3LGNA 4WFXA 2ROEA 2C3MA 2YKOA 4C0BA 3OUYA 5MLCV 1CPZA 1TZ0A 2X1BA 4IH6A 2ZC3A 1X7VA 5LSRA 1BHNA 2QYCA 2D3O1 1NRKA 4YDXA 1KD1T 2J6TA 3MR3A 1ZAWA 5GADU 1L3VA 3OVSA 2VFSA 5KG1A 4ZPDA 4DV6J 2DGTA 2FJBB 2UXDF 4OI0A 1P8GA 5G0RB 3DOLB 2JSXA 2DT9A 1JLGB 1N5VA 4FBUA 4F0MA 3QGHA 5EDWA 3PIPQ 4ERDA 2ZH3A 1GX6A 2ZBQA 4J9SA 4LF7F 2ZOGA 1SH2A 5LMUF 1YITS 3QFHA 4EGLA 1WHYA 2CPIA 3RG6A 1C2PA 1NDPA 4B3RJ 4QR1A 2AGQA 2UVUA 1TR0A 4CH7A 3JQMA 2BW7A 3LF0A 4ECVA 4QYZJ 1UWBB 2W4DA 2OTLS 4OZ5A 3WQPA 4RW6B 4DCOB 1RAGB 4OHWA 1TL7B 4NYPA 5RUBA 2EXUA 4NXNF 4Y2MA 1NK4A 2VG6A 4NX9A 3D0IE 3MM8A 5L8RC 1ZOTA 4LRCA 4ECWA 4L76A 3W61A 2YH1A 1N8RT 3M32A 1HQUB 1Z2ZA 1ZZFA 5JMNA 1AZSB 2DRBA 4JUZA 4QWBA 1S97A 1K0TA 3TUIC 2KFYA 1JWWA 2QL9B 2YQ3A 3PFEA 1NNDA 3HO1A 2YKNB 4XPCA 1LWEB 4DUZJ 1FRHA 4F7VA 2AU0A 4RW9A 1CQMA 5A6WA 2R7UA 2IHR1 4EFAC 3MAAA 2GO9A 1H74A 2G0CA 4RUBA 1M5VC 2DGOA 4ZJLA 1IBCB 2DTJA 4NLOA 3M8ZA 4QR0A 2GHWA 2AEMA 3MEDB 4ZPWR 4GKKJ 1SBRA 2IDLA 2F5GA 1OSDA 3EGWB 1GMUA 2I1RA 2E9ZA 1VFJA 2MSTA 1FKOB 4M5JA 2CJXB 1JKHB 1WSRA 2VOPA 4F3QA 2YWHA 1TL1A 1XK8A 3QT5A 1R8PA 4I2PA 4DF4A 4JOUA 1FRMA 1Q8LA 4OYXA 1Q79A 3W2VB 5CHCB 2WRMA 4JI0F 2UXCF 2H48B 4CM0A 1IWGA 4BHQA 2FYXA 4OJ1A 1FVQA 3M2UB 5ETQA 2IMWP 4PWUA 3G96A 4LVOP 2ZZMA 1OYDA 1Y5IB 1N48A 1K0VA 3IO1A 3FRZA 4YR0A 1WC0A 1TELA 3CJKA 3UPFA 1YSJA 1RDRA 3OR1A 2PFDA 3BKUA 1S1VA 4CIOA 4P7VA 4DS4A 3CO0P 3D4JA 2DITA 4USIA 1PYOB 1UVJA 4XDDA 3U1NA 2LDYA 2G13A 2Y9HA 5F9LA 1U45A 4ECSA 3LWMA 3EVMA 4NCGB 2NXEA 2KTQA 2HS3A 1U1KA 3M8SA 1HBUA 4PG6A 2VJVA 1BWEA 1U8WA 3HJFA 4ECXA 2QL5B 2YWEA 2IVMA 2XGPA 2D74B 1S6QA 1D9FA 5FLXY 1KKHA 1N6QA 4RW8B 1QE1A 3I0SB 1S79A 4DQQA 1Q53A 3UCGA 2PEBA 2H54B 3LP2A 5J1EA 3QQCD 1ZS6A 1NDLA 1JXEA 1S0OA 3G87A 1R89A 3D2WA 2E66A 4Y6IA 2IPOB 3Q2TC 4OX7A 1FRKA 2RF2B 3CJSA 3TAMB 3HVTA 4X65J 3VCDA 1VRQC 4UZCA 3OBIA 1RKJA 2V9WA 3RTVA 4ED6A 1FFGB 1IKXA 4HR2A 4GKJF 4WXOA 3GV5B 3J81U 2RRNA 3NY0A 2HWTA 2ROPA 3GB0A 1RT6A 3VR1A 1QY7A 4YQWA 1IUJA 2Y8YA 1VRTB 1NCLA 2YKQA 2PMZD 2KYZA 3FCWA 1OYEA 3T1YF 3PX6A 4TQSA 3EXYA 1RA7A 3AJDA 5C2GA 3AQOA 1DHMA 3BBCA 1TK5A 1VQ8S 2OLWA 2V34A 5FJ4A 4ZP6A 4AFFA 1XR7A 3E2EA 3FEYB 4K8RA 4LF4J 4CO3A 2ASYA 4LFCF 5K14A 2RSQA 5LXYA 4DEZA 5J2QA 5L38A 1KFSA 4NA3A 1RT2B 4USWA 3OJUA 3B8HA 3BR9A 3C16B 2KO1A 1FA0A 2OGUA 3I5BA 3DRRA 5K8MA 1RTHA 1AFIA 4RUHA 3KG1A 3CCSS 5J2NA 2Y0SD 3WC0A 4LF6J 4NA1A 5T7LA 4UUXA 4JI3F 1OY6A 5KG5A 1X4CA 2LA6A 1XJWB 3KK3B 2E5GA 4DFMA 3DU6A 2VBZA 5L9NA 5DM6Q 2YXLA 3X1LB 1KOHA 1Y0HA 3J80Y 3D1QA 4AD6A 3A8KA 4ZP9A 3HHNB 5HBMB 3W5XA 2BKNA 3KLHB 1XWLA 4WPAA 2LVWA 3GJRB 1LFWA 1H72C 4DU8A 2KXFA 2DNLA 2DYAA 5DG9A 3J81j 1BD6A 2JLEA 3KFWX 1W26A 4C48A 3MD3A 1WDTA 1YLXA 4X4QA 2EC2A 4J37A 3M6XA 1RU2A 2B9XA 3R6LB 3DLJA 1F9FA 4PPDA 2HLUA 1QSSA 2H65B 1DLOA 5AXLA 3FSYA 2HGNA 1HARA 2XBPA 5A2QU 3KLEA 1NPKA 1MU2B 1OPIA 3V6DB 1H2VZ 5B0DA 4HACA 3M7VA 5BYRA 4ZPCA 2XWXA 1BQNB 5KFCA 4NEZA 2FGCA 4P52A 3MMAB 4F3OA 2Y8WA 2EFPA 2R8IA 4B02A 1IN0A 4NZ6A 2EEYA 4N47A 2M70A 4KY3A 3D68A 1NK5A 3PW4A 1X0PA 4OYAA 5AE1A 4TY8A 3BGRB 2M0GB 3QSIA 4HHHA 4LIRA 3L09A 5GAGU 1VQOS 4D3GA 3GJTB 2E5HA 3ZFVA 3RAXA 4MK8A 3H5UA 2I5JA 4J91A 4X4NA 4QIVA 2IRYA 3ILIA 4KHPF 4ZVQB 2GQCA 1RT5B 5ETLA 5KT2A 3I0RB 1TK8A 4CH0S 3C6UA 1WC1A 2ROGA 1O5JA 3PW0A 4QOTA 1MWQA 4USHA 1V3RA 2HS4A 4Z37A 1MROB 4Q5VA 1F5CA 4B9NA 3U1LA 2EG1A 1UAWA 2P8IA 4QCLA 4FVCA 3Q8RB 1JLCA 4URQU 4NCBA 3GCWP 3JS9A 2DGQA 2YTCA 2ZNYA 3NS6A 1HNWF 3M8RA 4HKQA 3HMJG 2FHJA 3TX0A 1S49A 4DN9A 4M5GA 4DV3J 1NDCA 1YTYA 3M9OB 1FO1A 2BQRA 2BUNA 1VC6A 4WZQA 3RB3A 4MIBA 9RUBA 1TVRA 3FCVA 4PZVA 1RTDB 2R7SA 2XMJA 3DGPA 2W8LA 1RHJB 5HVHA 4Y2AA 3KLGA 2ZHAA 3QIPB 3ILJA 3BREA 2HPUA 2H3EB 3CT9A 2GW8A 2V2KA 7AT1B 3X3UA 3BEGB 5IM0B 1Y3KA 1Q78A 4NMXA 2PMWA 3IWNC 2AX0A 1HR0J 1DZ5A 3FMBA 3W2WA 2XB2D 4WP9A 4LJMA 3M9NB 3MM7A 3RAMA 2CWXA 2MKHA 2J6SA 3WIUA 2F4VJ 4MKBA 5D4LA 2GJ2A 2LXFA 2RUGA 2DPJA 4DV7F 4DL7A 1ULRA 4DX7A 2APOA 1OJ4A 2GGPB 3FC9A 2ATCB 2OD4A 3Q2SC 3RR8A 3K5NA 3PYEA 1LWCB 4MFBA 1RWWB 3CCQS 5F9NA 3PHTA 5F41A 4CWBA 1PAUB 3MM5B 1QSYA 2VG5B 2X3DA 2DHXA 4ID5A 3IXQA 2UVVA 5CCLA 2D3UA 2QV6A 2WZ1A 3TANA 4MH8A 4LRBA 4CO5A 5LT5A 3RBEA 1T0TV 4NLTA 4PQUB 4QIGA 5DO2A 2XHCA 1Y5LB 5KFSA 1ACMB 4DU7A 2DCLA 1X4AA 4C0HA 4BBYA 2DXEA 1KLNA 1UVNA 2CPXA 3KLFB 1YG0A 3NCQA 1JJ2R 3QLHA 1G7CB 2M5YA 1DFDA 1M1HA 2C22A 2LFVA 1ZM9A 4RO0A 3D0GE 4KRWA 3HHDA 4DL4A 3QT7A 3BBBA 5IXUA 2WOMB 2RKIA 2R3VA 3NNAA 4RU9A 4FF2A 2R7XA 2IVYA 4CP5A 1S72S 4NI2A 1QDUB 1RQ0A 1SQFA 1NKCA 2X51A 1AUSL 2UUCF 3KUEA 4V19X 1FKPA 4Q8EA 2HMIB 5DQIA 4QPTA 1RWKB 3C19A 3THTA 5A8WA 4ECQA 2ZHBA 1NZ8A 4AE5A 2OEKA 2OPRB 1DQAA 3G86A 5I3PA 1WI6A 3G9CA 5KFEA 4IFYA 2V9KA 1LFPA 4OFZA 2Q6CA 1S10A 3JYTA 1QAIA 5GMKa 2DVIA 3HD1A 1HWIA 1T05B 1HWJA 1K47A 3ULHA 4DR4J 2JLGA 1CULA 2P9CA 2WTFA 3M1VA 4NLXA 4TVAB 3VGTA 2G2OA 1T03B 1KTVA 3MR6A 3BH6B 3CWJA 3D9BA 5M2UA 3DOMB 3BGLA 1S7HA 1BWVA 2BJ1A 4ZVFA 4GC7A 4YHHF 2IIHA 3D28A 5HAOA 3PDNA 3NEKA 2B8QA 2MKYA 4ED2A 4CTAB 5A8KA 3FBFA 1L3SA 2H4YB 5C25A 2J9EA 1IJFB 2Q6BA 4H4OA 4KTQA 2M2BA 3LP1A 1MMLA 4LF9F 2FPHX 3HSJA 3M8QB 2BRKA 4ZCKA 2CPJA 2F65A 3ZZUA 2ZH5A 3R3TA 1U0HB 4YDDB 3R6GB 4X64F 1JNRB 4I0WA 1K1SA 3P6YC 4LF5F 2ZZTA 4OZJA 2YPYA 1W2IA 2EPIA 4MKYA 5HMXA 2JC1A 4DQSA 1HI0P 1SQGA 2K7KA 4FVMA 1WHXA 4B3OB 3NS7B 4H4MB 1PBAA 2M4MA 4LFAJ 3TA0A 2LP4A 3AA8A 2MQPA 4OL8A 2JWNA 3QRQA 3B4DA 1EETB 3JB9k 5HP1B 3CCUS 4DR3F 4HTJA 3LPEA 4MYTA 2CNLB 2LCWA 1TUWA 4U7UK 1WOOA 2HS0A 2HIYA 1Y4ZB 2OPPB 2Z2YB 4O4RA 2GVDB 3AJ1A 4NASA 4DWIA 3QPIA 4IG0B 1HBNB 1B7YB 4PRFA 1EJ7L 1OO0B 1TKXA 2MY8A 2KKHA 5IQQA 4JV1A 1LOUA 2CJQA 1M1GA 2W2OP 5B7WA 3EUNA 2BE2B 1QSLA 1M5PC 3BR8A 5IT4A 1U1PA 4G1QA 5I3QA 2YVSA 1S1TA 3K17A 1HMVB 1WC5A 2ZH2A 3ZTQA 3M8WA 3GP9A 4FPIA 3B78A 2G4BA 4JP8A 4L3KA 2BDPA 4IKAA 2DO0A 1RT3B 4DR6F 4P75A 2ZM6F 1PILA 4EWTA 2HWIA 3MECB 2OPQA 1LW2B 1VJQA 1U24A 3AAWB 4KB7A 2BOAA 4K2XA 4DJBA 1N56A 4LSNB 5A8RA 5JUMA 2GA7A 2ZFHA 2VH7A 2VL1A 2XZTB 1S9GB 5DETA 2L08A 1CJVB 3E8OA 3QGGA 3DLLQ 3DC2A 2CAJA 2FJVA 2ZDPA 5KFHA 4DSFA 3VAMA 4X4SA 5B0BA 1G6BA 1HNVB 4FF3A 2ZOFA 3SSQA 4HYKA 2UUAJ 2HGLA 3EVWA 3C2PA 4P2SA 5JJBA 3D3BJ 1IQZA 4X4PA 3KLIB 4OJGA 3CJ3A 1SJ1A 5F8HA 2ZHOA 1XMQF 4MTPA 4MMOA 2NUHA 4DUYJ 1KVIA 1N5YB 2NSBA 2J7UA 3CC7S 1FHTA 3TZZA 1JLQA 2D9OA 4TU7A 5KFMA 4ANCA 5EWFA 1GXUA 2BANB 3KJFB 4AL5A 4J5OA 2JEFA 2XMUA 4U8YA 1HLWA 4HHUA 2XI2A 4CLYA 4EO8A 1N5SA 2YKMA 1JK9B 1H2UX 2ZJPQ 4EYIB 3H4DA 1DTTA 3KYLA 3HI9A 2CQ3A 3GFYA 4C8OA 1NJIT 2QT7A 1P6TA 2K1RA 2RVJA 3GONA 4DHVA 5IT0A 4V1Ak 2GZOA 2MLYA 2AT1B 4DZDA 1WACA 3P96A 5KFAA 3CJ2A 2RHQB 4CH1A 4OX9F 4ZN3A 1ZPWX 2MKCA 2Z0GA 2HHHF 4N77A 1C0TA 2BOPA 4DF8A 3I55S 1YKWA 4NXMJ 3J7Z5 3FFIB 3UVJB 4C8MA 3EE3A 2CRLA 2ATLA 1AB8A 2DKOB 5M2RA 3RW6A 1SV5B 3ZZRA 3DU5A 1RBOB 1NH8A 4ETZA 5H1SV 2N4DA 5J2MB 2B51A 4C2MA 4N8OA 4K4TA 1S1XA 2GX8A 2WBMA 1PCAA 4B9MA 3R5BA 3N5BA 1QVGR 3PVXA 2YWKA 1IXKA 4ZLPA 2W9CA 2PDAA 4I64A 4RW7A 4CLWA 4DPYA 2WW4A 4DX5A 2PC6A 2KL8A 3FDSA 1OQ6A 2UUTA 3ITHB 5CYMA 4LBIA 1XQIA 4KHMA 1EX8A 2MLXA 4CLZA 3C46A 1HNIB 2E7VA 4KFBB 3BN4A 1JLFA 2GFFA 5IC4B 1WDDA 1RAIB 2RD5C 1H7WA 2ASDA 2J6UA 3SDEA 4DR5J 3KTQA 2B4UA 4EYHB 1NPRA 2EFNA 3R9LA 2DNHA 4Y3CA 4LVNP 1P27B 1CJTB 3PCOB 1X0FA 2RS8A 4IFVB 2DCUB 3BM7A 3M05A 3GIKA 2YNFA 2HW3A 1HPZB 1N54B 4M5HA 1BQMB 5FLXU 1EB0A 4XK8C 3OLAA 5A6PA 2HFSA 2W4CA 3L9ZA 3CD6S 1YRTA 4YFUA 1M5SA 1ITPA 3BGFA 2A0FB 3R2DJ 4DV1F 1EP4A 5HMWA 2L41A 1KDNA 4KSEB 4ZCLA 2COLA 2B4PA 2GMLA 2RU9A 2LLZA 3OLBA 4DFKA 4J9KA 3DXBA 5GMDA 3NWRA 2K06A 2Y0BB 3CC2S 2HLTA 3PJXA 2N7YA 2G2ZA 1MN9A 2C2RA 1DQ8A 2Y1JA 1HYSB 2VPZB 4C11B 4BCAA 2FY1A 2RQCA 1U6BA 4OI4A 1BLUA 4X4VA 4USTA 2QMXA 5SZTA 1N0VC 4HVZA 1QUPA 3EZ5A 4I2QB 4R25A 1R7IA 3TWZA 2J76E 2RUSA 4IDKB 3KHGA 4UTGA 5JXSA 4ZLNA 3EGNA 1M1KT 3T9ZA 1ZM2A 1RAJA 3L95X 4CDIA 5C42B 5HVGA 1NPPA 4JI2F 2YQ1A 3GG1A 1M5HA 1Q8KA 5GADI 1RT7B 1KVJA 1RUSA 2FC8A 3MPYA 4PUOB 2HNDA 3QBCA 2OJ3A 2FJEB 1LW0B 3GIIA 1N36F 1SKUB 3NL0A 4N56A 2F3JA 4N41A 2IC3B 1FRJA 2CNNB 5E33A 2ILYA 4I69A 2GV1A 4O0NA 2XLJA 3THPA 4YY3F 2CNOB 2UXDJ 2JEJA 4RL1A 2W8KA 3TRGA 3H90A 2NS1B 3DM2A 3R7NB 2W2NP 3UDVA 2YKNA 2QLBB 4CLFA 3ETOA 3QGIA 2CIMA 3H5YA 3J80U 2MQ8A 3BSCA 4Z7YA 1RT4B 2PD1A 4FYYB 2QZ8A 3N01A 3DDNA 3TX8A 1YJNS 3PM9A 3HSGA 5A0YA 1RTJB 2V68A 4LF7J 5LMUJ 4KQZA 2BMBA 4HDHA 2R2SA 3OR2A 1TL3A 5L1KA 5IV3A 1NBEB 4ZS6A 3MAQA 1K1QA 5G4DA 2GIQA 3O3LA 1QAYA 4BWJA 3GJSB 1VYAA 1VCTA 4GVBA 3SCJE 4ZCMA 4KGXB 2IDEA 4AT1B 2FJXA 1CBKA 2NUUG 1G1XA 5F3ZA 5I3UA 2PIIA 4ED7A 1IQTA 1FKOA 1F3FA 3HZEA 1N32F 1VQLS 2QLFB 3BKFA 2C2MB 2ASLA 1G3OA 1RWMB 3IRXA 1L5UA 3NMRA 3V81A 2E5LF 4NXNJ 2GVZB 3TUPA 2IM3A 2AJFE 2JJ4D 2Z58B 4XPEA 2XY5A 2MQOA 3BQ2A 2DGWA 2WW8A 5D4OA 2CJAA 4BC7A 4O3QA 1N33F 3RBXA 4PEOA 2V0NA 1AW0A 4NCAA 1SC3B 3ISZA 2UUBF 1TV6A 3QYYA 4JV5F 3SEOA 4HH1A 2WVEA 2XMMA 1I3OB 3G71S 3TA1A 2J7WA 2DHAA 3T9NA 3HKWA 1KS2A 3RU0A 3GSDA 2VC1A 3SIPB 4Q45A 2VG7B 4DLGA 1KSPA 3HKZD 3FSXA 1KNZA 3C14A 5CQGA 1FT8A 3VTIA 2QTWA 2MJNA 3KHLA 1RCOB 1C1BA 1LNQA 3AH6A 3OL9A 1WC4A 5IOLA 2ACMA 1U48A 3PJWA 3MI7X 2KRRA 3QRPA 2IAJA 5DDPC 2W9BA 5HO4A 2DH7A 2V8PA 1FWKA 2F8MA 2NPIA 2POKA 3CJRA 1ZYQA 4GO5X 2ZC4A 1Q95G 3PYDA 3GCXP 4FBTA 4I4BA 3LTOA 2H9ZA 3IRWP 2PO4A 3PW2A 2CPHA 2J5AA 1SUQA 2BVZA 3MDFA 1NK9A 3I9ZA 3TR5A 1X9MA 2IY5B 3NNHA 4RW4B 4USMA 1SVDA 3UW1A 2RDIA 2C1EB 4JI0J 2UXCJ 4KV8B 2FJWA 1HWKA 4DSLA 3CIZA 2ZE2A 3G6YA 2XZDB 3DLHA 2FVCA 3T1AA 3PEHA 4EZ6A 4CQ1A 4LR9A 1VQ6S 2HFNA 3ZTOA 5HLFA 2L48A 4R5PB 4NLRA 3MEGB 1QAJA 2C42A 3M30B 3TJ8A 3PACA 2QO3A 1B0PA 5HVFA 4YOEA 1U1QA 1TKZB 2HIQA 1N0UA 3HK2A 4F04B 4EUVA 1VBXA 2V63A 1IKWA 1VC0A 3H8YA 4KGVB 3ENAA 3TW0A 4ETXA 3THVA 4F8RA 2C2OB 1R0AB 1NH7A 1WJ9A 1VRUA 2N4CA 5ETNA 2LQ8A 1RHQB 2E5IA 1Z4UA 2QMWA 1VIOA 3OHBA 2ZBPA 3BN7A 4ZVOB 2LU1A 2P2CB 4USUA 4QZVB 1SCJB 3G82A 3C16A 4KJIA 2ASJA 3D0HE 1BUXA 1IBLF 4EBEA 2J8AA 5CD4H 5FD1A 1REGX 4C7QA 2ACYA 2MGZB 4PYAA 1Q5VA 1S1UB 3AFGA 1SJQA 1S1WA 2OP5A 2IJNA 3DN9A 2VKZG 3D54A 2JDJA 2YKAA 2R9LA 4L3NA 1CJUA 1IKVA 1Y11A 2Q1LA 3DYAB 4K7QA 5HSPA 3FZ2A 2RNEA 2Y1IA 1V6HA 3UD5A 2VONA 3LWLA 3OUYB 3SQGA 1RCXB 5IZHA 1VQ9S 4EZ9A 4P2MA 3IBWA 1S5ZA 4A8XA 1T11A 4GKJJ 5LMNF 5GAEU 5F8NA 3IGVA 1CEZA 1XEZA 1SJ4P 4F2SA 1LKZA 4X4OA 3OFEA 3VALA 4MYUA 2RE1A 5ADZA 2G1HA 4NLVA 2AJ4A 5AE2A 4ZP8A 3T1YJ 3D1OA 1DRZA 3O44A 2YKPA 1G2EA 3CTRA 1URNA 1P1TA 2KU7A 2C2DA 4LFCJ 4CLKA 3C6TA 2ZH6A 1VBZA 1ICEB 3AXMA 5HI7A 3V4IA 2AIRB 4HL9A 4RNFA 4NLYA 5HJYA 3GSIA 1F0XA 2GMHA 2NXJA 2XCPA 1SL2A 2VICA 3BPSP 3IM8A 4FP9A 1HHTP 3A12A 3AQPA 2HRYA 2R4FA 4JI7F 4JI3J 1U8SA 5ITHA 2VDHA 1S99A 1SC4B 1TUVA 3BGRA 1PKUA 1B0VA 1D8ZA 3QJLA 1NAQA 2VG6B 2KT3A 3DHXA 3MM8B 1YJRA 4TY9A 1O6XA 2I9SA 3HCXA 3UN5A 2RIJA 2LQJA 4KIAA 2X3GA 5CABA 1BXNA 1UZHA 1OWXA 3M32B 3MZIA 3UNGC 3M6VA 4CI0B 2OH2A 4F50A 1OSCA 1M5KC 5KG2A 1S6UA 1RK8A 1UEVA 4LIWA 3UFCX 1DQ9A 3G2XA 2MHNA 2X1AA 2CQCA 4CO1A 5IV4A 2R7RA 1R0CB 4DV4F 2YPZA 2U2FA 2KFNA 4RW9B 2N7CA 4I7FA 3MAAB 3BJYA 3KUHA 4F36A 4TNOA 2XSJA 2F40A 1LK7A 1F5BA 3PRDA 2RDDA 3E01A 3UN3A 1KWMA 1WKKA 2FTRA 4CO2A 4NZ0A 2MZQA 1NUEA 2V2VA 5GAGI 3BSOA 1VISA 5AXMA 4A8QA 3HDSA 5HROA 3FBEA 2E5JA 2GCFA 3G8QA 5HQ8A 2BW2A 4OZLA 3DMJA 1WC3A 2XNQA 3GZ7A 1RHKB 4M5MA 1PJ5A 2J9DA 2VFVA 3W64A 3BO3A 1NSQA 4DI6A 1MN7A 4OLOA 1TL1B 1VQNS 4O3OA 4JI8F 4I2PB 1EIYB 3CCZA 3FK4A 4RX6A 1MW7A 3CCES 1NK6A 1V9OA 3HVAA 4K50A 3NGTA 2ZZNA 2J0WA 3JQJA 4DQIA 4DV5F 4KHPJ 1VHFA 3I82A 5CA5A 2VFRA 1WG1A 3OD2A 3LO3A 4F02A 2QJ3A 4WKYA 4OHZA 4G65A 3CJKB 4I56A 3OR1B 1FEEA 1NZAA 1OY8A 2GC8A 2MZRA 1S1VB 4QWAA 1Q7YT 3TZYA 1WHWA 2KHDA 2B3TB 2IBKA 1AROP 3EGVA 3NAIA 5KOWA 3CJTA 1X4GA 3P5TL 4O44A 4MKVA 1RU1A 3MUMP 1KONA 3FNNA 5IT9Y 2JEGA 2B9YA 1FJEB 1HD1A 1HBUB 3UN2A 5JVGQ 2HZCA 3AY0A 3IS9A 4C3MA 2LA4A 3OSNA 2VFTA 1S6QB 2IVFB 1N6QB 3WC2A 1QE1B 2EK6A 1WTFA 2QA4S 2BACA 4USJC 1F60B 3LP2B 1S4FA 2VV5A 5J1EB 3R2CJ 2HZVA 4RZRA 4K4XA 3HP6A 2MPUA 4KBIA 4YR2A 5F8LA 1URRA 1GMWA 4DR7F 3HVTB 5EWEA 3PX4A 4IQMA 2GJFA 4ED1A 2KJWA 2IYIA 4B3MF 1Q8IA 5J2PA 4M63A 1JJ4A 3ZZZA 3QATA 4DV7J 3OJSA 1KQGB 5LSOA 5E3PA 1IKXB 2YH0A 4WZMA 3KNGA 2E1CA 5B09A 1RYSA 1NDKA 4CLSA 2JFDA 4N7TA 1RT6B 2DNZA 5CAAA 2XMKA 3V6KA 2GIFA 3HVRA 4QJVA 1T9YA 3OV7A 3GWCA 4A8YA 3I6PA 1XN9A 2FLOA 2KM8C 3UD3P 2K3IA 1YVFA 2NYIA 3OL6A 1HI1A 4IRKA 1FTCA 4RBUA 3ISND 3Q23A 1U47A 3D6HB 2VPWB 2EC0A 4B9UA 5K14B 1HW9A 4EI2A 5KFUA 2ZBIA 5J2QB 2FB0A 5DG7A 3C8YA 4UOHA 4FN5A 2R8GA 4WIIA 2J7KA 2MDAA 1CJKA 3DRRB 1RTHB 3QIDA 5J2NB 3P8BB 3US5A 4F4AA 3DRSA 2DY1A 3SFUA 3SBMA 3EPGA 4ILRA 3H25A 5T7LB 3V6JA 3KMQA 3O8WA 2XNRA 4DR1F 3MCOA 3PJ9A 3PYFA 3HFKA 5GMEA 3M8YA 4FYWB 3VQTA 2I8EA 2NCKL 3RAQA 5AJ3F 3TAQA 3ZZPA 1IKYA 4UY8T 3IAM9 1TMMA 1ROFA 3CDUA 1ZA1B 2UUCJ 4AXIA 3KK2B 5C24A 2DRAA 2R2TA 2CA9A 1IBKF 3DI6A 3TI0A 1K8AT 4U95A 2G2YA 5D0EA 2EVZA 2HNZA 1GMWD 3MFIA 4EK2A 1X4HA 5B0FA 1NK8A 4OJ3A 4PG8A 1RWXB 4J9OA 3PO5A 2YNGA 4C97A 1HNZF 1DLOB 1NK7A 4O0IA 5DM7Q 1X4FA 3BV8A 2W2PP 1KHWA 1N52B 4HEA9 4DXLA 3D7SB 1QD1A 1Z2LA 4TLQA 4NLGA 1VK8A 3KLEB 3NGSA 2JC0A 4Z2XA 2BE9B 1T9UA 1QTMA 1NHKL 2U1AA 4HACB 2W2QP 2UVWA 2LECA 2C3UA 2HFVA 1SQEA 2LQ9A 1EKSA 3IG1A 2P5VA 3C15A 3PYGA 3AJ2A 2HAIA 4M95A 1FESA 4CLTA 3CXCR 3GIJA 4KO0A 4YHHJ 3BPDA 2E9RX 1Q7LB 2ZD1A 5KFTA 4TY8B 4JI1F 4OYBA 4X4RA 2MXYA 1WG5A 4JI4F 2JZ5A 1VMBA 3M2RA 2I5JB 3DRPA 1VQKS 3WHIA 4LF9J 1KHVA 4FPRA 3K2YA 4OYMA 1HR0F 1RADB 2I0XA 3LA0A 3IBFB 4ED3A 4PG5A 1FERA 4LRAA 1Q82T 2RB7A 3C6UB 3HZGA 2X1GA 4X64J 3QRRA 4PXEA 2PE8A 2F4VF 1R6VA 4QU6A 1TMJA 4WTYA 4QIEA 1PBUA 1TU0B 4LF5J 4ZJOA 1HBMA 3V4MA 1VC5A 1JQGA 1E6YA 1JLCB 3HJVA 3DLGA 3CDBA 4I6AA 2O66A 1X9WA 1VK3A 1RI7A 1UVKA 3KNAA 3BDEA 1U1LA 5I42A 2R8HA 2MHEA 1Q4RA 2KJVA 4DL3A 4DR3J 4XO0A 3QT6A 1L3KA 3PTWA 1S76D 2V8GA 3TAPA 3MEKA 1U7LA 4ELUA 4DSIA 4U9RA 1F3VA 4NLPA 2P6SA 2V69A 1TVRB 3N6MA 3G4SS 2YNHA 3LPYA 1BMQB 1WSVA 3VGUA 1N34F 3DGPB 3FQLA 1KP6A 5KG7A 3KLGB 1MSWD 2JNJA 2DK2A 2XMWA 2IA6A 1YI2S 4ELVA 2F9DA 3H20A 1NXIA 4PG4A 4QQBA 2KG1A 3Q24A 4FZVA 3M8PA 1XNRF 3GFHA 3W2WB 4TKTA 2HG4A 4BS2A 3MM7B 5AT1B 3D6MB 3PO4A 5BXIA 5D4NA 4KH1B 5D0RA 2FVQA 2M9KA 4F4ZA 4KKOA 4DR6J 5E5NA 4PKDB 3L7PA 2ZM6J 4F67A 4QW9A 2K7JA 4MFBB 2BE7D 2XI3A 5ETSA 1KC8T 1FK9A 4ID5B 2E1MC 3H2LA 3D6FB 2HFUA 2ZVIA 5LJ5Y 1TKTA 4W98A 2J9DE 2HFOA 2QLJB 4XAKA 3AD7C 2DXDA 2BJ7A 2E7WA 1GFWB 2BJEA 1VBKA 4FXVA 3IBCB 4UQTA 4F4WA 1YWXA 5AXKA 3O6QA 3PXGa 2DJWA 5ETVA 4JV0A 4IRCA 4M94A 4JV2A 1J5EF 2VUGA 4WP8A 4A8WA 2HHWA 4B3SF 4ZDNA 4UOGA 3QLHB 3KMSA 2E1PA 5ETKA 4ZOSA 2E7XA 1T95A 3MOZA 1XMQJ 4DFJA 3P4UB 3ZTSA 4ZVEA 1XERA 2KM8B 2DNOA 3ADAC 4K4VA 2RKIB 4GC6A 4OYWA 1A9NB 3ZZ0A 2E44A 3LANA 3EDQB 4DSJA 1CC7A 4J90A 2ADBA 2CQDA 1ZZNA 4NI2B 2CQ2A 2UZAA 3LP0A 1TTHB 4NYOA 4OV6A 2RS2A 4UW2A 4ZJQA 5A2QY 1FKPB 3T1HF 2CPDA 3DGVA 5D8HB 1HWUA 4F0KA 5C5JA 5A8WB 3BF4A 2C3OA 2OPSA 4AUKA 4TXSA 1S0VA 3H5XA 3KJVA 3V6HA 5IFMA 1NSAA 2ZH7A 5L1IA 3P5BP 4A4JA 4IFYB 3GR0A 3T6JA 3CGIA 2DNNA 3FGVA 4OX9J 2BXJA 2XGQA 2MEWA 3MURP 5E3CA 2HHHJ 3JYTB 3AT1B 2EFGA 2HVDA 1UPMB 3AD8C 2HNYA 3QGPA 2O5DA 1CULB 4U67Q 2XSFA 3BO4A 4G1IA 8AT1B 2I38A 3M1VB 3J7YU 2WONA 4IH5A 1U26A 2L9DA 1RTIA 2DIVA 4TN2A 3RUBL 4URSA 1Q86T 4PAAA 3K5LA 3EZOA 3CPWR 1AA1B 1B70B 4DPXA 1CVJA 2B6AA 2AHOB 5A8KB 2MSSA 2AYGA 2VOOA 3K57A 4PPZA 1VLYA 4ZVSB 5C25B 3F0NA 3I9V9 4H4OB 3LP1B 2QRRA 1JB0C 4YP3A 4CYUA 3J7AN 3TVZA 1DAXA 2C2KB 3JAMY 4WFBQ 2KZZA 1IBMF 3MTKA 4NLDA 4HDGA 1FRIA 3ZZYA 1MG7A 4A47A 2EKYA 2XS2A 5F8MA 5BR8F 1C1CA 1FX4A 4CNYA 2WSCC 1T9WA 2DR8A 3E3XA 3T5LA 3UDLA 4DUTA 1APSA 1GXLA 2AYBA 2D9PA 1VQPS 2B4OA 3M4XA 2R2RA 1M0SA 3AOBA 3CCTA 1C4CA 1ZA2B 3ZNJ1 2HHVA 1QM9A 5FDLA 4L6V3 1QVFR 2ZJQQ 3LAKA 1GX5A 4ZVUB 3GIMA 4TU8A 2SXLA 5HATA 1UW4A 3S8SA 3BO2A 5KFQA 3NS5A 5F8JA 1OPZA 3A4TA 2A2DA 3CJQA 2DNQA 4I68A 1A6LA 2BR0A 1H73A 1X31C 2BQUA 1ZAVA 2MMYA 2FQQB 3K59A 2OI2A 3DLBA 1FDBA 2IC3A 3OW2R 4IR1A 1U49A 5DGBA 4ECRA 4DX8H 4M8LA 3B82A 1KEKA 4DV1J 2J9CA 3HHKA 1R6YA 3PR5B 4FYVB 1TKXB 4ID8A 4QBUA 2PA3A 1N5TA 1REVA 4HI2A 5BYSA 4ZCIA 2FUG9 1AFJA 4OYIA 3QT8A 4G1QB 2GO8A 3NWGA 1S1TB 5CH7B 4M1KA 2ZUGA 2JHEA 2Z30B 2DD8S 3G8TA 1HNXF 2VQEF 9ATCB 3DNCA 2YNIA 1DTQA 1YBTA 1Z1ZA 3GYXB 4UF4A 4AQYF 3QAEA 3H59A 1UMJA 1U2RA 3HHLA 4A8MP 1O0PA 3MPVA 2ZKTA 3ILLA 5HJXA 3HLUA 3CCJS 5KFGA 1FJGF 2KT2A 2A1BA 1I94F 3ICLA 3GJQB 2KG0A 1YQHA 2OPQB 4IG3A 2CQPA 2XO7A 1UJ6A 3AOAA 2B56A 3DHWC 1LWXA 1P9QC 4WF9Q 3V2UC 1FVSA 4JI2J 4IQXA 5A8RB 2O01C 3TYTA 2WBRA 1PJ7A 5E0OA 3MEEA 3EICA 2V67A 4IYQA 5ETRA 1N36J 4E8UA 5E2QA 5C7PA 3GTYX 4F4YA 3NP5A 4M5NA 1FX2A 4Y0FA 4KC5A 2MZSA 3RR7A 4DR2F 5IWAF 1G4CA 3UI3A 4YY3J 1FCAA 1S77D 3QZ7A 5KFZA 3IGNA 4M5IA 2CQIA 1H7XA 4Q43A 2AKWB 1WG4A 4ICLA 5CYQA 1UL3A 3W66A 5KFXA 2KXNB 2BRLA 3OXLA 1HD0A 2OD6A 3UO0A 4LT6A 5DLFA 1JLQB 2C2ZB 1CS4A 1F6TA 3BKTA 3PFOA 3LGHA 5D0GA 1WKJA 2DXFA 2EK1A 2K8GA 3NGUA 1QAXA 4ES3A 4MK7A 1JXVA 4ZLLA 2B8PA 3MCSA 1AT1B 1YZ6A 3B6BA 2MJUA 2HBQB 4DPOA 2YKMB 4PWDA 4NA2A 3RB6A 3DLKA 3ET6A 1DTTB 5DG8A 1N32J 3AHPA 2K1RB 2EW9A 4RNNA 1SL0A 2I6WA 4LQ9A 2E5LJ 1S6PA 3HX9A 1HWLA 3G6XA 2VJUA 2VBYA 3HHLD 4P7TA 5IS2A 1RAEB 4C8NA 2VA2A 2HQIA 2UXBF 2L3MA 3IR6B 3NXZA 1N33J 4C4WA 2H5IB 5DLGA 4U7CA 2C2NA 1JLBA 4NEYA 2NLWA 2IJRA 2W1BA 2UUBJ 4WKRA 4OLPA 4JV5J 1KVKA 5IC6B 1KQKA 4LQ3A 3JSYA 4G1PA 4RUCA 2FGOA 5ETPA 2PI4A 1N4LA 1KLMA 4MK9A 1U2CA 2XCAA 2AEFA 2FHJD 1S1XB 3BH7B 5H9EJ 1UP1A 1YDLA 3ELHA 5AXNA 4JI5F 4AYBD 2RJZA 2DR7A 3W8GA 1YJVA 1HHSA 5F0UA 1EAYC 1V5IB 3A13A 4DV0J 6FDRA 1IVZA 2W9CB 3OFHA 4YN3B 4RW7B 4X4UA 1L3UA 2XWYA 4JI6F 2VA3A 3I87A 2VQFF 1SJ3P 3QJPA 4O3NA 5I4MA 4M5DA 4CRJA 3R7SB 4OJHA 4H4KA 1U1RA 2NZ4A 5CYMB 5E3RA 5AE3A 2R7WA 2W01A 2QL7B 4ZPBA 4WP3A 4ZA1A 2KVQE 1FDDA 1JLFB 4NYZA 3CD0A 3BYRA 4KR0B 1X9SA 4A8FA 3VV2B 4DPTA 2BKOA 3HT0A 2AJ1A 5KT3A 4C3KA 3SDEB 4K0KF 2LU2A 3MFHA 1LWFA 4ZHRA 3BZQA 2AJQA 2KVIA 5JVHQ 3CCMS 1TL5A 4JYAF 1WEYA 3CMAS 3CC4S 2V4JA 5IT9U 4DL0C 1RLCL 2FJDB 4R0EA 3GLJA 3OPKA 2I2YA 2HBRB 3JSRA 1FXRA 5D6GA 1RXOB 3KOAA 2KT5A 1HL6A 4J9RA 2YNFB 3FSIA 5B0CA 1C0UA 3DOKA 3NAHA 1PYTA 3H42A 4Y00A 1PJ6A 2D1CA 1KQSR 2IJFA 3JXOA 3FJ2A 3PIOQ 1FFWB 3VHQA 4O3RA 5D3GA 4P72A 3I5AA 3M2VA 4LSLA 4CT9A 4RJVA 1EP4B 3O5TB 3K5MA 4RR5A 1HQEA 3RRHA 1JLEA 2NZCA 3M9MB 4OHYA 1SKRA 2LXUA 4C3LA 3BB5A 3MHYA 3MCNA 5KFDA 1ZBTA 1UJ4A 3TEGA 5K9FA 3N5FA 4R8UA 3MWBA 2AZ1A 3KHHA 1CC8A 4L74A 1KBRA 4PQAA 3LAMA 1ZTWA 2QSWA 3N9UC 2K2PA 1FJ7A 1JXLA 1PSDA 1YGYA 1TUGB 3NLCA 3R5JB 4U8VA 4FNHA 4O3SA 5DQHA 1FE0A 1W7WA 3W8PA 4Y65A 2NXCA 1IBLJ 1D1UA 2WVBA 2XULA 1K44A 1KQFB 3FVYA 3NBPA 4NLWA 1XR5A 4IRDA 2KFZA 2Y3YA 2P9GA 3MR5A 3K0JA 2MZ1A 5GAEI 3TJ9A 4DLEA 1XC9A 1NKEA 1H38A 4ED5A 2HQ3A 2HNDB 1GH8A 4E98A 3JSMA 4F3MA 1HBOA 2O67A 5IQ6A 1NU4A 4RBTA 4ZKAA 5LMNJ 1WOPA 4HTIA 1B0TA 4FS1A 3LW5C 3CDWA 4OI3A 5M2PA 1RWOB 2UUWA 5KFOA 5GVQA 2F9JA 1QUVA 4L75A 2B4VA 2YWGA 3DM2B 3POTA 4F4KA 1FI4A 4X66F 1I5OB 2XZWA 4C8ZA 2LQ5A 4DQPA 2HHUA 4WJBA 4G3IA 2HQDA 1S12A 2PN6A 2CUYA 1C4AA 2DNMA 1S4EA 3MM6B 2BJDA 5FIIA 3F44A 5A0YB 2OO4A 5LSLA 4Q2LA 4CM2A 4OYPA 2GQQA 4PYDA 2R2UA 3OR2B 1TL3B 4DPWA 4CZCA 4QWCA 1RP5A 3MPWA 4CT8A 1E6VA 1RISA 4E2FB 4GVBB 2IFXA 4OI1A 3Q0AA 1S9FA 4ECTA 2CPYA 5U47A 1XNQF 5I3UB 2VBWA 3DFEA 2IRUA 3W9HA 1FDAA 4JI7J 2OEJA 3LGMA 3HULA 4J9QA 2GAGC 1Q5YA 2F7VA 3T5JA 3IRXB 2H5JB 4R0JA 3MMCA 1FNOA 3V81B 1J5OA 4TLRA 2HQGA 4ILLA 3EJMA 4LF8F 2R7QA 4EBCA 1EQ0A 1NHVA 2M7SA 2RMLA 4B3TF 4ZMMA 4ES2A 5KT5A 3KDNA 4K2JA 3L3CA 1FWPA 3CJ0A 2BJ8A 4ZP7A 2XHWA 2CYYA 4W4MA 3DDKA 1GK8A 2K3KA 2Z57B 2M3DA 1PYSB 1TV6B 1UA0A 2OIHA 3CMES 4ATNA 2HGMA 2DH9A 4XIUA 1RAAB 4ER8A 1PC5A 4DV4J 3M6WA 4KHRA 2AJ0A 3DLEA 1L3TA 4LF1A 5CCMA 3C14B 2W24A 4L72B 2CQHA 2ADCA 3Q8UA 1C1BB 4OYZA 2BM1A 3SYZA 5K8NA 3JTOA 2IAJB 4IOBA 2W9BB 5KFNA 4UOCA 3ISNC 2R7VA 3GV7B 4TQRA 4HHJA 3NGRA 3NMAA 3IMQJ 4IUFA 3ZZTA 1JLAA 2W2MP 2FZCB 1VBYA 1FJCA 3K8WA 3RB0A 2VFUA 3OL7A 1SUQB 2ALZA 3N79A 2DY9A 1RWVB 4LFBF 4JI8J 3EM1A 2RU3A 4WE1A 2BZ2A 2OMOA 2JEIA 3PEJA 1WORA 5KG4A 4TU9A 2N3LA 2QA1A 4DV5J 3OL8A 3FMWA 2HHTA 1Q8BA 3W9IA 1VQMS 4ILMA 1RT1A 4O4GA 2ZE2B 3NOGA 5K8OA 4X62F 3MMBA 1RBAA 2YWFA 1R8AA 4KYZA 1H2TZ 2BEFA 2CDQA 3FRYA 2RH3A 4X2BA 5HLFB 1S9EA 4FXDA 2XYGB 2MQQA 2XLIA 2XY7A 2FY8A 4MJKA 2P9EA 3G6ES 2HVHA 5KFLA 3H40A 1LXNA 2ZKUA 2MZTA 1X5TA 3KK1A 1B64A 2XMVA 2RT3A 3D3CJ 3CD5A 3IN5A 1IKWB 2V94A 3QFWA 1NKBA 2MY7A 1R43A 4Q0BA 4PABA 1ZH5A 3CVKA 4GO7X 5LM7E 5KAKA 1UEKA 1VRUB 5HK4A 4N76A 1H3DA 2NSCA 2N82B 3NOCA 3MM9A 1RHMB 2B43A 2O1PA 3HFVA 5L9XA 2J0QD 2RILA 1ZM3A 5DZ6A 2VZ9A 2B5JA 3TJAA 4PCQA 3G82B 3J7A1 4NLSA 2W7OA 3T5HA 2ZJRQ 1H98A 2DISA 1S1WB 3W63A 4FKXA 1YJWS 4J9UE 3OTOF 4EMDA 3EZUA 2MQMA 1CJUB 1IKVB 4DR7J 4IOAQ 3A8IA 4ZPVR 3QZ8A 2QFJA 3SV4A 1SJRA 5GAHU 3N6LA 4B3MJ 4NL5A 2NXUA 3SQGB 1T9TA 3MR2A 4OIXA 3PZPA 4URGA 4L73A 1GQEA 3SSRA 2A18A 2DRDA 2D69A 4MIAA 3KK2A 3HVWA 3OFFA 2CFXA 1RJJA 3PR4A 2PFFB 5G0RA 2UU9F 3DOLA 3N0VA 2XC9A 1A7GE 1SI9A 1JLGA 1VQYA 1CQNA 4O3PA 2AP6A 2HFZA 2OUGA 1IR1A 3I32A 4DV2F 2V4RA 1U25A 2Y1RI 2W9AA 5H9FJ 3S01A 1NJXA 3EXCX 3C6TB 1WTBA 3RRGA 2UV8G 2AX1A 3GFZA 4QWEA 3R1HA 3V4IB 4JB8B 2XEXA 2DGXA 2OMLA 2YX4A 1UWBA 5LXRA 2H51B 3PKMA 1HKAA 1SPBP 1GEHA 1S6OA 2G0JA 2RHSB 3R5AA 1RABB 2JLFA 4RW6A 2LEAA 4LR7A 1TL7A 5DDQC 1YJ7A 5KFBA 2OELA 4DR1J 1XMBA 2UP1A 3D5MA 4ECZA 2AW0A 1FD8A 3SV3A 3GPAA 3W9JA 2HWHA 5AJ3J 2HK2A 3TUZC 4AXJA 3RB4A 2LDIA 5H9EK 4F0HA 1HQUA 2IYGA 1AZSA 5MAOA 2KDOA 2L9NA 4DG1B 4RPFA 4ED4A 3EX7B 1YRUA 4WK3A 3KJNB 2BBEA 1IBKJ 4C98A 3K58A 5CZVA 4NRTA 3R27A 2V50A 4ENOA 2PMHA 1FXDA 5L1JA 2BJ3A 1P9YA 3Q89A 3RJMB 2VB6A 5EUHA 1XR6A 3VAIA 1LWEA 1R8HA 5HN0A 4Y2IA 4YB6A 3ONQA 1HNZJ 3CE8A 2QLWA 4I7FB 4PG7A 4YB7A 5KG0A 1HA1A 3UCUP 3KUGA 2XSJB 3TVKA 3JAMU 4QIWD 4EBDA 3MEDA 1MMNA 5J1PA 3E01B 2P6TA 5B08A 1X4DA 2XYPB 1Y5NB 2CVEA 2H4WB 4DL5A 2EWHA 1PC4A 5HROB 5HANA 1TAUA 1GTHA 3H2UB 4KAIA 2QYGA 1I51B 2PGCA 4S0MA 1KTQA 1R27B 2GS8A 3OFGA 3DMJB 2CJ9A 1JKHA 4PR6A 1Y7PA 3ETMA 2C3PA 4ED0A 4JI1J 2HKEA 1VQSA 2PI5A 2FJAB 4MKAA 5CD4A 4JI4J 1O51A 3W2VA 4F25A 4H54A 4ALZA 2DO4A 2EBGA 3CO9A 1U6ZA 4B17A 1UTAA 1FF2A 2FVPA 2CQGA 3KWMA 4CO0A 3M2UA 1X4EA 2VASA 3OTDA 1JMTA 3MOJB 2H5EA 1XMOF 2HZAA 4XTTA 1U2FA 1YBAA 2A6OA 2CXEA 2KN4A 1VOMA 1SXLA 4USVA 3SMZA 3G8SA 3OQ2A 5D0HA 2OAUA 1F2HA 4PXCA 1RGVA 4MT1A 1R0BG 2BQ3A 3ILOA 1RAHB 2OFGX 1NMEB 3BYPA 3VAHA 1HI8A 1VJWA 1PGZA 3CCLS 3LUYA 4O44B 1SC1B 2D3OR 2ZH4A 2J0XA 1UPPA 4NCGA 4QYZK 1FWLA 3QMQA 2HEKA 3IAS9 5ETOA 3AODA 1M5OC 3VAFA 5K8PA 2D7SA 3IS9B 3A3OB 2BKPA 1D9DA 1WOSA 2V8HA 2DHSA 1QLNA 4GMKA 4RW8A 3I0SA 3P45B 1N34J 2F8HA 3QO9B 1WUUA 3T6BA 2OEMA 5E7OB 1T3NA 2OSRA 4IOCQ 3MD1A 2LYVA 1VS3A 4WBFA 2QE5A 3WIVA 1T8EA 5T41A 1Q1KA 4DL2A 1OMSA 1LV5A 4XDCA 5BYQA 2RF2A 1XNRJ 1NO8A 3TAMA 2PA8D 2KYXA 4I6YA 1LK5A 3CDEA 5LOQA 1T9VA 1SH3A 3KG4A 3CCRS 1Y10A 5BJRA 2XMTA 5J2PB 1KRPA 3Q8SB 1ZPVA 2VU5A 1NJWA 2KXHA 1PAEX 1FE4A 3IFEA 1X5OA 2B9WA 3SCIE 3MAHA 3Q22A 1TFYA 5KT6A 5CXTA 3RZAA 3JQKA 4DV6F 1YIJS 5HQMA 1XTZA 1VRTA 1RAOA 3VZHA 2F4FA 1DBDA 2DR6A 3KKFA 2HSEB 2YY3A 4F4XA 2X7IA 1S0NA 4DDFA 2ZOMA 2QSFA 3NRBA 1MWZA 4WU2A 4Q2MA 2CQ1A 4OI6A 3BSNA 3O2IA 1YBUA 1RHUB 2QFIA 3MUVP 1RT2A 2BYCA 1YX2A 3ZTPA 1J5EJ 4B3RF 1F5AA 4F26A 4I6WA 4B3SJ 4RUAA 1OIAA 2MYFA 3JTPA 1CJKB 4EO6A 1OQ3A 2V2QA 3DRSB 1X4BA 1D9AA 3AB4B 1X8DA 3MXHP 4ES1A 5LL6d 3K89A 2ZH9A 1U09A 1EARA 3GILA 3H5SA 1TKDA 3KK3A 2BA9A 3LH2S 2VHGA 1DARA 3HF5A 3I56S 3OTEA 3BDPA 4HI1A 3CJ4A 4ZPAA 3KXDA 1RBLA 3AD9C 1IKYB 3MMJA 2GIRA 5HBMA 1K73T 3KLHA 4WIQA 1F9EB 4P10A 1R31A 2EI5A 5EWGA 2ILZA 1DY3A 4OYOA 5C24B 3T1HJ 2YBVA 1B99A 3A3PB 3Q8VA 4UOFA 4ELTA 3DI6B 4P6QA 1NJYA 4Y2CA 2HNZB 5B0AA 2IM1A 1UCNA 4P2XA 3MUTP 4ECYA 4DUZF 5K5MA 5KFPA 3VAGA 2VC0A 2FLPA 2YNGB 5DZ7A 3J7YI 2O3DA 3QNWB 1UWAA 2Z2MA 4B9SA 4WFNQ 4WFZA 4KT0C 1FRXA 4QW8A 2R7OA 5D4PA 4D3HA 3S6EA 1JJHA 1GMVA 1RWNB 1MU2A 4J7CA 3V6DA 1UJ5A 1BQNA 1XIQA 4GKKF 3MMAA 3VF0B 3HSDA 3VAJA 2F1FA 2ZDOA 3AB2B 1T7PA 3Q8QB 2Q43A 5J1NA 3UQSA 3IG1B 2FC9A 3C15B 1RWUA 2KRBA 1VQ7S 1S59A 2ZITA 4KO0B 3QJJA 1KN6A 3Q8PB 2WVCA 3VQSA 2ZD1B 1MLAA 2FHOB 1FEHA 5HQLA 2KI2A 4DPUA 3M2RB 3DRPB 4ANDA 2EKNA 3AA9A 4NRUA 4C6AA 3PRVA 4Q8FA 4A48A 1RT5A 4FF1A 4ZITA 1GAOA 1O8BA 3I0RA 1IBMJ 3RW7A 1VIXA 4OZNA 3PY8A 2ZNZA 3LOUA 5BR8J 5C2CA 2YWWA 3MF5A 1UKUA 3SZ2A 1MROA 1GTEA 1D8YA 1I1GA 2DNRA 3F41A 2GHPA 3VZIA 1PO6A 1HBMB 4HH0A 4ZVTB 4FYXB 3HHEA 3IA0A 4YEAA 2R7TA 2E9TA 2OSQA 4NZ7A 5KT4A 2JX2A 1E6YB 3ZNUA 3DLGB 3MCMA 4K4UA 2WSEC 1U4BA 2R8KA 1H0HB 2ZUAA 4BC9A 3WDOA 4O23A 4UQGA 1Y9OA 3N6NA 5I42B 2HURA 5THWA 1NJZA 3CCWA 2JVOA 5L46A 2WVFA 3WX4A 3DDIA 3GFXA 2CADA 4K4YA 1ZTTA 5LJ3Y
chains in the Genus database with same CATH topology
3HHLC 3NMRA 3V81A 2VOPA 1RYRA 2E5LF 2GMJA 4UY85 4E8UA 4F3QA 2IM3A 2YWHA 5DRKA 2DB1A 2AJFE 2E1AA 4HLBA 5E2QA 1TL1A 1VI7A 1H6KX 1XK8A 1RTDA 2JJ4D 4YMEA 2YNHB 1R8PA 2JVRA 4I2PA 4JOUA 1FRMA 4XPEA 3NP5A 2MQOA 3BQ2A 2DGWA 4F4YA 2XY5A 2DIUA 2WW8A 2ZVSA 1Q8LA 3I4PA 5D4OA 4Y0FA 2CJAA 4KC5A 2MZSA 3QIPA 3W2VB 1Q79A 3HPOA 4BC7A 4DR2F 5IWAF 3RR7A 2IBOA 5CHCB 3GYNA 2WRMA 2EFVA 4O3QA 3UI3A 1N33F 4JI0F 1M90T 2UXCF 2V0NA 4BHQA 1AW0A 4NCAA 1FCAA 1S77D 5IM0A 4OJ1A 3ISZA 1FVQA 3M2UB 4FS2A 2IMWP 2UUBF 3QZ7A 1TV6A 3QYYA 5KFZA 3IGNA 3M8PB 4PWUA 4JV5F 3G96A 3G6VA 4LVOP 2CQIA 3SEOA 2IM0A 2ZZMA 4HH1A 4X65F 1H7XA 2FIUA 4Q43A 2XMMA 1WG4A 4ZPTR 1Y5IB 3G71S 1N48A 4ICLA 5CYQA 3TA1A 2J7WA 1WF1A 1UL3A 1K0VA 2DHAA 3IO1A 3T9NA 3FRZA 4YR0A 3HKWA 1TQLA 3TA2A 5KFXA 2KXNB 5DGAA 3CJKA 1KS2A 2BRLA 3OXLA 1HD0A 2OD6A 3UPFA 1YSJA 1IM4A 3RU0A 1RDRA 3GSDA 4LT6A 2VC1A 3OR1A 2W7PA 5DLFA 1JLQB 4Q45A 2MKKA 2VG7B 4DLGA 1KSPA 3HKZD 3FSXA 1S1VA 1KNZA 2RQMA 7FDRA 4CIOA 3PFOA 5CQGA 4KKOB 4QIFA 1FT8A 4P7VA 2GGPA 1DJ0A 4RNHA 3VTIA 2EK1A 4C8KA 4DS4A 2K8GA 2MJNA 3KHLA 4J9PA 1C1BA 1JIHA 1QAXA 4ES3A 2EFQA 1LWCA 1Y3JA 1KFDA 2MKSA 3AH6A 2DITA 4MK7A 1V3SA 4USIA 3OL9A 4I67A 3FEZA 1U48A 3MCSA 3PJWA 3RBDA 1UVJA 2MJUA 3MM5A 3MI7X 4XDDA 4DPOA 2YKMB 3IRXA 2VG5A 3U1NA 2KRRA 2MQNA 4AL6A 2LDYA 2G13A 2IAJA 4PWDA 5DDPC 5F9LA 5HO4A 1FK9B 4NA2A 2W9BA 2DH7A 1U45A 3RB6A 2F8MA 2NPIA 4ECSA 2POKA 3DLKA 3LWMA 1FRLA 2WB1D 3RYLA 1DTTB 1ZYQA 4GO5X 2ZC4A 4NCGB 3BQ0A 4DMZA 2HHPA 2HVZA 1BQXA 5DG8A 2KTQA 2HS3A 1TKTB 4FBTA 4I4BA 1U1KA 2IM2A 3AHPA 3M8SA 1HBUA 2K1RB 4PG6A 2H9ZA 2EW9A 4RNNA 3IRWP 2PO4A 6FD1A 1BWEA 1SL0A 3PW2A 2CPHA 3TNVA 3HJFA 4ECXA 4LQ9A 2J5AA 3PW7A 1SUQA 2L9WA 4PQUA 4LF4F 2YWEA 1S6PA 3HX9A 2IVMA 2BVZA 2D74B 2XGPA 1HWLA 3MDFA 3CCVS 2Q79A 1S6QA 1D9FA 5FLXY 1N6QA 1NK9A 3I9ZA 3G6XA 4RW8B 1QE1A 3I0SB 3TR5A 1X9MA 2VBYA 3HHLD 4RW4B 3NNHA 1S79A 4P7TA 5IS2A 2DNPA 4DQQA 1Q53A 3UCGA 4ZVGA 4RWXA 4C8NA 4C9DA 1I6JA 2VA2A 2HQIA 2UXBF 2L3MA 3LP2A 3UW1A 2RDIA 3IR6B 3NGDA 3KLFA 5J1EA 4C4WA 1D0EA 3U02A 5KFIA 4WFYA 1JXEA 5DLGA 4U7CA 4EU0A 4KV8B 1S0OA 1JLBA 2FJWA 4LUBA 2NLWA 1HWKA 3T3FA 1R89A 3D2WA 4DSLA 2E66A 4Y6IA 3CIZA 2ZE2A 3Q2TC 1LXJA 4OX7A 3G6YA 3DLHA 4OLPA 4WKRA 1FRKA 2RF2B 1KQKA 4LF6F 2FVCA 4LQ3A 3TAMB 3T1AA 2GNKA 3HVTA 3QAUA 3JSYA 4G1PA 4RUCA 3ENQA 3PEHA 2FGOA 3VCDA 2V8VA 2PI4A 3NCPA 1N4LA 4EZ6A 4CQ1A 1KLMA 1VQ6S 2HFNA 4MK9A 2XCAA 1NK0A 5KT7A 5HLFA 2WOMA 2L48A 1WHVA 2FHJD 1S1XB 3OBIA 4G6VB 4R5PB 4A8OA 2NPFA 2V4QA 5H9EJ 1RKJA 2V9WA 3GR1A 1UP1A 1NEEA 4NLRA 3MEGB 4FYDA 3RTVA 1QAJA 5AXNA 4JI5F 1W25A 4AYBD 2RJZA 2C42A 2DR7A 3M30B 1FDNA 3HT3A 4ED6A 1YJVA 3PACA 4WK1A 3UCZP 1HHSA 1GT8A 5F0UA 4IH7A 3MGJA 2QO3A 1B0PA 4IO9Q 1IKXA 4RU2A 6FDRA 2HRUA 4B9LA 1UVIA 4YOEA 1U1QA 2W9CB 1TKZB 3OFHA 4WXOA 3GV5B 4GKJF 3LP0B 2HIQA 2RRNA 1N0UA 3CDAA 4N5SA 3HK2A 4EUVA 4RW7B 2HWTA 4X4UA 1VBXA 1L3UA 2HMIA 2ROPA 4OZ0A 3GB0A 2XWYA 4JI6F 1VQ4S 1RT6A 3VR1A 4DFPA 2VA3A 1IKWA 2LMIA 3I87A 2VQFF 1VC0A 3H8YA 1SJ3P 1FNMA 1QY7A 4YQWA 3JSBA 3QJPA 1IUJA 2BV3A 3TW0A 4O3NA 5KG6A 4ETXA 3TARA 1VRTB 3THVA 5I4MA 4M5DA 2YKQA 4F8RA 2FHMA 2VD3A 4OJHA 1DURA 4H4KA 5D78A 1U1RA 2NZ4A 2PMZD 5CYMB 1BGXT 5E3RA 2KYZA 5AE3A 2R7WA 3T1YF 3PX6A 2QA2A 1NH7A 1R0AB 4TQSA 4ZPBA 2OPSB 3EXYA 1RA7A 2OPRA 1VRUA 2N4CA 3CJ5A 3AQOA 1DHMA 1VQ8S 2W7AA 5L39A 2OLWA 1TK5A 3KJVB 3WZ0A 4ZA1A 5FJ4A 1AXQA 1FDDA 1SJFA 2E5IA 3T5KA 1Z4UA 1X5PA 1JLFB 2V8DA 4OI2A 4NYZA 2QMWA 4ZP6A 1XR7A 4AFFA 3E2EA 2OKQA 3CD0A 2ZH1A 5L1LA 5E3QA 3FEYB 4KR0B 3CSKA 1VIOA 4K4WA 4QU7A 1X9SA 4A8FA 4CO3A 2ASYA 3OHBA 4LFCF 3BN7A 5K14A 2RSQA 4K4ZA 5LXYA 2AJ1A 2LU1A 1SL1A 5KT3A 4C3KA 3SDEB 4QZVB 4DEZA 5J2QA 4K0KF 2LU2A 5L38A 2B7CB 1YJUA 3MFHA 1KFSA 4NA3A 1RT2B 1LWFA 1T05A 4ZHRA 2CPZA 4KJIA 3BZQA 2ASJA 2JRSA 3D0HE 2AJQA 2KVIA 4WFAQ 3OJUA 4EBEA 1IBLF 3B8HA 2J8AA 5CD4H 5FD1A 5JVHQ 4C7QA 3CCMS 2ACYA 2HNYB 3BR9A 2MGZB 1TL5A 4JYAF 1S1UB 1WEYA 4OMFG 2KO1A 5KFJA 1FA0A 3I5BA 3K8VA 3CMAS 3DRRA 5K8MA 3CC4S 2V4JA 4H4KC 1RTHA 1SJQA 4DL0C 1AFIA 1S1WA 2FJDB 2OP5A 2IJNA 3OPKA 3DN9A 4R0EA 2FD2A 3KG1A 2WONB 2VKZG 3CCSS 5J2NA 3D54A 1WNEA 3JSRA 1FXRA 2JDJA 2Y0SD 5D6GA 1T03A 3KOAA 3TP2A 4ITSA 1RTIB 2YKAA 3OSPA 3WC0A 2R9LA 4L3NA 1ZETA 2HHQA 2LKZA 2KT5A 1IKVA 1HL6A 2Q1LA 4NA1A 3DYAB 4J9RA 5T7LA 4UUXA 3QWPA 3UDCA 2YNFB 1MMDA 4JI3F 5KG5A 3DOMA 3FSIA 5B0CA 1U1MA 1C0UA 3FZ2A 2RNEA 3DOKA 1V6HA 3NAHA 2Y1IA 1X4CA 2HHSA 1MWYA 2LA6A 3IWXA 2VONA 4Y00A 3LWLA 5DQGA 3KK3B 2E5GA 2D1CA 4DFMA 3DU6A 3LALA 1KQSR 2IJFA 2VBZA 5L9NA 3OUYB 5DM6Q 3SQGA 3FJ2A 5IZHA 1WEXA 1VQ9S 4EZ9A 3X1LB 1KOHA 3PIOQ 1Y0HA 3IBWA 3J80Y 3D1QA 4CTAA 4O3RA 5D3GA 4A8XA 2B6AB 4Y2KA 2KB2A 4ZP9A 3I5AA 3HHNB 3M2VA 1FXLA 3C3LA 4LSLA 4C8YA 4CT9A 5HBMB 5LMNF 5GAEU 5F8NA 3KLHB 2I2YA 3UR0A 1EP4B 1XWLA 3O5TB 3IGVA 3K5MA 1CEZA 1HQEA 1XEZA 3F73A 3NGKA 3RRHA 2LVWA 1JLEA 1SJ4P 2GQ2A 1UVMA 4F2SA 1LKZA 1LFWA 4X4OA 3M8QA 3M9MB 3OFEA 3VALA 4MYUA 2RE1A 3NKYA 4OZ1A 4OHYA 5ADZA 3L7OA 1SKRA 2KXFA 4NLVA 2DNLA 2AJ4A 4JBCA 5DG9A 2LXUA 4C3LA 3BB5A 3MHYA 5AE2A 1BD6A 2JLEA 3KFWX 5D77A 3TUJC 1TL4A 3D1HA 5KFDA 1ZBTA 4ZP8A 2M8DB 1UJ4A 3MD3A 4B9TA 5K9FA 3N5FA 2DGSA 2Z4PA 5B0EA 4X4QA 4R8UA 2AD9A 4K5RA 3MWBA 2J0SD 3D1OA 4NWBA 3KHHA 3O1LA 1SKWA 4J37A 1C1CB 1CC8A 3M6XA 1DRZA 2B9XA 3O44A 2YKPA 3DLJA 4OX6A 1G2EA 1F9FA 1NB7A 4PPDA 3N4WA 4PQAA 3CTRA 2HLUA 1URNA 1QSSA 1DLOA 3LAMA 1P1TA 2KU7A 2QSWA 3N9UC 1ZTWA 5AXLA 3EGZA 2K2PA 2C2DA 1FJ7A 2VBXA 1JXLA 4FF4A 3FSYA 1S48A 2CVIA 3C6TA 1PSDA 3EYZA 1YGYA 2ZH6A 1VBZA 3NLCA 3FCHA 2HGNA 1HARA 2AF6A 1OS5A 2XBPA 4FNHA 4O3SA 5DQHA 1FE0A 3UR3C 3KLEA 4B3OA 5FDLB 4H4MA 5HI7A 4Y65A 3V4IA 1MU2B 1OPIA 4HL9A 1H2VZ 2GHVC 3V6DB 1D1UA 5B0DA 2XULA 2JOQA 1KQFB 4RNFA 5BYRA 4ZPCA 3CEDA 3FVYA 3NBPA 2XWXA 3K5OA 4NLYA 1BQNB 5KFCA 1R8CA 1WD6A 1WEZA 2VPYB 4NLWA 1F0XA 1XR5A 2FGCA 2GMHA 3MMAB 3I4HX 4F3OA 4IRDA 1EETA 2EFPA 2XCPA 2R8IA 4B02A 1SL2A 2KFZA 1WWHA 2P9GA 4E0DA 3MR5A 4FP9A 5HP1A 1HHTP 3K0JA 2MZ1A 1IN0A 5GAEI 4DLEA 4NZ6A 3AQPA 3EPIA 4DV3F 1XC9A 1J2VA 2HRYA 4N47A 2M70A 2R4FA 3TQ1A 1NKEA 4JI7F 1U8SA 5ITHA 1H38A 1S99A 4ED5A 2HVIA 1NK5A 1TUVA 2HQ3A 4RUHA 3PW4A 1X0PA 2HNDB 3BGRA 1GH8A 1B0VA 1D8ZA 5AE1A 4NOHA 4E98A 3QJLA 1NAQA 3PNIA 3OTBA 3JSMA 4TY8A 2VG6B 2KT3A 4YB1P 3DHXA 1T94A 2OPPA 3BGRB 4F3MA 3MM8B 1HBOA 2M0GB 2O67A 1YJRA 4TY9A 4LIRA 3L09A 5GAGU 1VQOS 4D3GA 2I9SA 5IQ6A 2CG4A 1NU4A 4RBTA 2RIJA 4ZKAA 2E5HA 2LQJA 4KIAA 4PXBA 2X3GA 3C66A 2CKWA 4IG0A 3ZFVA 3RAXA 3U7JA 4HTIA 1OWXA 4MK8A 1HBNA 3H5UA 2I5JA 1B0TA 3M32B 4QYRA 4FS1A 4X4NA 1CG2A 4QIVA 2IRYA 3LW5C 3MZIA 3UNGC 3M6VA 4CI0B 2OH2A 3CDWA 4OI3A 2QLXA 5M2PA 4KHPF 1REVB 2BE2A 3QWUA 4F50A 2GQCA 2UUWA 1RT5B 4IR9A 1OSCA 4NLQA 5KFOA 5GVQA 2F9JA 3J7ZT 1QUVA 1M5KC 5KG2A 1S6UA 5EGYA 2RQKA 1RK8A 1UEVA 5KT2A 2B4VA 4LIWA 2YWGA 3DM2B 3POTA 4F4KA 3UFCX 3I0RB 1TK8A 1IJEB 4X66F 3CULA 3GG0A 4CH0S 3C6UA 1DQ9A 1HMVA 1TFWA 2MHNA 2X1AA 2CQCA 4CO1A 2ROGA 1O5JA 3PW0A 3BS9A 4QOTA 2XZWA 4KE5A 2R7RA 4USHA 4C8ZA 1ELOA 4DV4F 2LQ5A 4DQPA 2HHUA 2U2FA 2AV5A 1V3RA 4MAKA 4WJBA 2KFNA 3MM6A 3HXMA 4G3IA 1W2BR 4RW9B 2HS4A 2YNIB 1MROB 4Z37A 2PN6A 1DTQB 4Q5VA 1C4AA 2DNMA 1F5CA 3MM6B 2N7CA 2BJDA 4B9NA 5FIIA 3F44A 3U1LA 4I7FA 4WYLA 5A0YB 3BJYA 2OO4A 1RT3A 2EG1A 1UAWA 5LSLA 3HHLB 4Q2LA 1FKAF 1BY9A 4TNOA 4QCLA 4QR2A 2XSJA 4FVCA 3W7BA 4DSKA 2F40A 2GQQA 3Q8RB 1LK7A 1JLCA 2R2UA 1F5BA 3PRDA 3OR2B 4HT7A 4URQU 4NCBA 1TL3B 2G1DA 1JX4A 4CZCA 1ZM4A 4QWCA 2R8JA 1RP5A 3MECA 2DGQA 2YTCA 3MPWA 2ZNYA 2VKRA 3E01A 4CT8A 4IG3B 1U1OA 1LW2A 1E6VA 1RISA 2CQ0A 3NS6A 1HNWF 2IFXA 3M8RA 4OQJA 2FTRA 4KGMA 4CO2A 4NZ0A 4U6PA 4OI1A 4HKQA 3Q0AA 2MZQA 3CD7A 1S9FA 2DHGA 4ECTA 5GAGI 3BSOA 3HMJG 2CPYA 5U47A 1XNQF 2B7BB 2FHJA 4LSNA 5I3UB 2VBWA 5AXMA 5KFWA 3HDSA 4A8QA 5HROA 1S49A 4DN9A 3SI8A 3DFEA 5KFKA 2IRUA 1FDAA 2E5JA 1YTYA 2GCFA 3LGMA 1S9GA 3G8QA 2BW2A 3MEEB 5HQ8A 4OZLA 3DMJA 3M9OB 4J9QA 1FO1A 2XNQA 2BQRA 2F7VA 3FQKA 3GZ7A 3T5JA 3IRXB 3A1YG 2BUNA 1VC6A 2J9DA 2VFVA 4WZQA 3BO3A 4R0JA 3MMCA 4MIBA 3RB3A 3H4BA 1FNOA 3V81B 1TVRA 4OLOA 1J5OA 4TLRA 4ILLA 1TL1B 4ZVHA 3GQCA 1RTDB 1VQNS 2R7SA 2W25A 4LF8F 2R7QA 4EBCA 2XMJA 3DGPA 4O3OA 4JI8F 4I2PB 2W8LA 2JFKA 3CCZA 4RX6A 1NHVA 1MW7A 5SUHA 3CCES 1NK6A 2M7SA 1HNVA 1V9OA 2RMLA 4Y2AA 3V5RA 4B3TF 4ZMMA 3E51A 2PSZA 3KLGA 3HVAA 2ZHAA 4K50A 2ZZNA 3QIPB 2J0WA 4ES2A 5KT5A 3BREA 4AL7A 3L3CA 4DQIA 3CJ0A 4ZP7A 4RBVA 2XHWA 4DV5F 2CYYA 2HPUA 3CT9A 1VHFA 2GW8A 3KLIA 2KHCA 2V2KA 3I82A 3J81Y 3DDKA 5CA5A 3X3UA 2NR0A 2K3KA 2VFRA 3BEGB 5IM0B 1Y3KA 1Q78A 2PEHA 2M3DA 2AX0A 3IWNC 1WG1A 2A3JA 1DZ5A 2GJIA 1TV6B 3LO3A 4F02A 3FMBA 1UA0A 2OIHA 3W2WA 2XB2D 2IMOA 3PKYA 4LJMA 3CMES 4ATNA 3M9NB 4EEYA 4A8SA 2MQLA 2DR5A 2HGMA 1WF0A 4WKYA 3MM7A 2DH9A 3RAMA 4XIUA