2AV5A

Crystal structure of pyrococcus furiosus pop5, an archaeal ribonuclease p protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
KKRYIAFKVISENQFNKDEIKEAIWNACLRTLGELGTAKAKPWLIKFDETTQTGIIRSDRNHVYDVIFSLTLVSDINGNKAIIKVLGVSGTIKRLKRKFLSQFGWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 2
publication title Structure of Pfu Pop5, an archaeal RNase P protein.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 27
structure length 106
sequence length 106
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01900 RNase_P_Rpp14 Rpp14/Pop5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2av5A00
2AV5A 3WZ0A 2CZVC
chains in the Genus database with same CATH superfamily
1B0PA 1VQSA 2I5JA 1ZTTA 4QIVA 1RT5A 3OFFA 1S76D 5FDLA 2W25A 2F40A 1Q86T 3DRSA 4IRDA 1RWOB 2QYGA 7FD1A 2VASA 2BM1A 3MD3A 2FD2A 2I1RA 3ZZTA 1NHKL 1RT1A 2EBEA 3W62A 4EMDA 1BQXA 4WKRA 4XAKA 4Z37A 1S6QB 2RH3A 3RRHA 1C0UA 1TFWA 4WXOA 4M5DA 1P6TA 1HNZJ 4A8SA 4WZMA 5L46A 1K8AT 2HWIA 3F41A 5GMDA 2M0GB 3T5JA 2WZ1A 2ROGA 2H5JB 4FN5A 2CJYB 5D4OA 1SKRA 2EI5A 1LKZA 2PE8A 4JI4J 3BH6B 1D09B 1U1RA 1JLEA 1RZMA 1HBOA 2B0GA 2AX1A 3QGHA 5KFSA 4A8FA 2HRYA 4ELVA 2K1RA 2Z57B 3SMZA 1S6OA 4EBCA 2WONB 4Y6IA 3G82B 2JL9A 4HDGA 1B70B 3G6XA 1FX4A 2UUAJ 4ES3A 2CVIA 1U1OA 1HI0P 3QSIA 1VRUA 1WG5A 2ZH6A 1IKWB 1AROP 4AYBD 3NAHA 5IS2A 4IR9A 2XULA 3C6UA 1RLCL 4Y34A 3RAQA 1F9EB 4USHA 1J5OA 2XMTA 3VVTA 4N8NA 2R8HA 5HMZA 4R5PB 1FKPB 3VVUA 1IJFB 5U47A 4LIRA 2ZZTA 1ZBTA 1N48A 4DPYA 5LMNJ 1J5EJ 2R8KA 3EWGA 4PG5A 4MJKA 4DX5A 3PKYA 3QRPA 2DHAA 1RAFB 4QR1A 1OS5A 1E6YA 1J27A 3UFCX 3D1HA 1QSYA 1S9GB 4CO5A 2OMLA 4DX7A 3I32A 4HH1A 5F8HA 4M5HA 2KDOA 2UXBF 2KYXA 1QTNB 3UD3P 2V2QA 3EX7B 3AT1B 1HBNA 4NEYA 4UOFA 1U1NA 3UNYA 2GMHA 4FS1A 2AIRB 3PACA 3UE2A 1S0VA 4M5JA 3CDEA 2Z0GA 2VFVA 3BKTA 4CWBA 3H2UB 3TVYA 3GJRB 2BXJA 1MN7A 3LQVA 2DTJA 3CCTA 3SYZA 2HGNA 3N01A 4QWDA 3K5MA 1UCNA 2H54B 3IBFB 1NK9A 3JSBA 2AGQA 3D9BA 1HBMB 1LW0A 4UY8T 2DBBA 2MB0B 4USMA 2GIQA 4ANEA 4YB5A 3QSYB 2K7KA 3V5RA 2XSJB 2NXUA 4OYXA 3LPYA 3QFWA 3CC2S 2RUSA 1RT7A 2IA0A 4NLXA 4RW4A 1KVJA 2JVRA 3M8YA 4W98A 1HWIA 4ENOA 1J2VA 1PILA 2CNLB 4MTPA 3MM7B 1RAEB 2GJ2A 4TYBA 3NBPA 5ETSA 2PFFB 1Y7PA 4EEYA 1LV5A 3VGUA 5CA5A 1SIZA 2AJ1A 3H7HB 3GWCA 2BRKA 3M8ZA 2AHOB 2XQCA 2DNHA 2K3KA 1X60A 2HVEA 3HFZB 4Q8FA 3BGRB 3UWTA 4TXSA 2GVZA 4O44B 3CCWA 2GA7A 4DV4J 4WFZA 4I0WA 1JLAA 4DV2J 2ZH9A 1LWXA 3G8TA 3CTRA 3QBCA 4GKJF 2KTQA 1AB8A 2N4DA 1TUWA 4FF2A 1Q82T 2DNLA 4NRUA 2AT1B 1VQKS 3LA0A 1VRTA 3SI8A 2OFHX 3DLLQ 2LECA 4U96A 2KM8C 2BR0A 1HNIB 3I0RB 2ZHAA 2HBQB 3FQKA 5KG7A 4B3MF 2ZJPQ 1NM2A 1SI9A 1VQNS 2XMWA 4MK7A 4DUZJ 1Y5LB 2DHSA 1UVJA 2HBRB 4HDHA 3TA1A 1KQKA 3FZ2A 2VL1A 3DM2B 3JSMB 4EO8A 1IQTA 2NZCA 4KKOB 3LANA 4X65J 3M2RA 1C1CA 1VISA 2QLJB 1P8GA 5J2NB 2A2DA 4HTJA 1RWNB 1HHSA 2V67A 1S6PA 4PQUA 1IBMJ 3IR5B 2GZOA 2YX7A 2BBEA 3QQCD 3CO9A 2OGUA 4LRAA 1WG4A 5JMNA 1REVB 3B4MA 1WOPA 3AXKA 2NXJA 3Q23A 1OO0B 1QAYA 1H2UX 4JI3J 1F9FA 3R9LA 8RUCA 1O6XA 2MDAA 3VAIA 4K5SA 4BBYA 3SQGB 5C25B 2XTJP 1N88A 4L3NA 1W26A 4K50A 1BWVA 2WVBA 5T41A 2AQ4A 4P75A 2MJNA 4HHUA 4F4ZA 2DHGA 3MR5A 1XBWA 3MR3A 5HMYA 3W2WA 3T6BA 1FT8A 4TYAA 1T9VA 5C5JA 1Y00A 3EYZA 1UETA 3LP0B 2YWGA 4TU7A 3H5XA 5IT9Y 1V3SA 4J90A 3UR0A 2B7BB 2D7SA 3QGGA 2ZHBA 3PEHA 3T41A 2GC8A 2LU1A 1HNZF 1SC6A 3D7SB 1KLMA 2VOPA 2KB2A 1AT1B 2H1YA 2ZC4A 3HI9A 2HNZA 1FD8A 2RJZA 4P2XA 3L09A 2VFSA 3HCXA 3ICLA 3TX8A 2CJ9A 3AH6A 1KBRA 2F4FA 1O0PA 1Z1ZA 2QG9B 3GIKA 2FUG9 1VLOA 1TKTB 1ITPA 5HQLA 1PGZA 2IVFB 3X3UA 2HHQA 1VQLS 4DV0J 1N4LA 1DFDA 3K17A 2V8VA 2AEFA 2V5HG 2JC1A 3L4BC 3GIIA 2J7WA 5JUMA 2X1AA 1NK8A 1XR6A 4GVBB 2W9CA 2AX0A 3MI7X 2CFXA 4PYAA 2UUAF 1E6VA 1HPZB 1RP5A 4NLRA 2RHSB 4A8OA 2KHDA 3OPKA 4CO4A 3MM6A 4DR2J 3ZTSA 2F65A 3KOAA 2HBZB 1BXNA 3HHLD 1MLAA 2XHWA 3OHBA 1YJVA 1RBOB 1SJ1A 1DTTB 3VALA 2R8JA 2I5JB 1VS3A 3MHYA 3TUJC 2AJ2A 4DPOA 5FDLB 2YH1A 1FXLA 2VBYA 3DRSB 3IAM9 3W9IA 1Q95G 5HK4A 4WYLA 3HSGA 3NKYA 4QYRA 3PRVA 1MROB 4RUAA 1X9WA 1APSA 4B9SA 1KFDA 4ZIVA 3I31A 5KOWA 1RT1B 4RNFA 1XR7A 4KR0B 5E2QA 1JWWA 4WIQA 1D8YA 4W4MA 4RBVA 1C0UB 1X4GA 1OMSA 4M5DB 4RWWA 4OJ3A 4GMKA 2R7WA 2QLWA 3KG4A 4P10A 1RLDA 1M5KC 4AL5A 4OHXA 4M5GA 4EYIB 1SL1A 2IMWP 2Z8QA 3D4JA 3PIOQ 5CCMA 1Q16B 1S57A 3DLGA 4X62J 4IG0A 3WIVA 4HYKA 2FJAB 4ZPCA 4LSNA 5BYRA 1UMJA 2DB1A 3UCUP 4HR2A 1RU1A 2HGMA 1JLEB 3M1VA 1HBOB 1S99A 1F2HA 2GIRA 3UDVA 2FJEB 1BQMA 2CKWA 3O6QA 5G4DA 1VK3A 1KQFB 4A46A 2K1RB 1L5UA 2EFVA 4YEAA 2WSFC 4XPEA 5A2QU 4RU2A 1I94F 2MQPA 1TK0A 2G0IA 3QAEA 2QZ8A 1VRUB 4ILRA 1IWAA 3GPAA 4RW8A 4DHVA 5DG7A 5G0RA 3KG0A 4OI3A 4YS2A 1QY7A 1UVKA 3C6UB 4NA1A 2FZKB 2CG8A 3W60A 4N76A 1J5OB 4KHMA 2BW2A 2XCAA 2MEWA 2HZAA 3MPUB 3OSPA 3C16B 5KT7A 2WSCC 3SCLE 4AFFA 1IBKJ 2MZQA 2ZWOA 3KWMA 1E6YB 4WTOB 2ILZA 2ACYA 4ELTA 4DSIA 4DV4F 3NRBA 2X1BA 4DV2F 1RHRB 3Q8UA 2XMVA 2QTWA 4EGLA 1H98A 2V2VA 4Q5VA 1R0BG 2EPIA 2F8EX 2HAFA 2PIIA 1HBNB 1FRXA 4NI2A 1WSRA 1WI6A 3SIPB 4GO5X 2VC1A 3MD1A 4DFPA 5KG0A 2H51B 3C8YA 1JJCB 1DJ0A 3S8SA 2RVJA 4PWDA 3H20A 2JEJA 3JTOA 1MN9A 1JJHA 1UWAA 4CNZA 3OBIA 4DUZF 2HGLA 2UUCF 2XY6A 2ZH7A 3M9MB 1WNEA 3OL6A 3T3FA 1LW0B 3MFIA 1NB7A 1I6JA 1KS2A 3DU5A 3DDKA 3R7BB 2E9TA 4QOTA 4J9SA 2XSFA 3D6TB 4YR0A 3EGVA 3KLHA 3TUPA 4ZVOB 4RW9B 2A0FB 1NDLA 1RT7B 4U9RA 3VZIA 4RW4B 3BSAA 4ZHRA 1MW7A 4FF1A 3GIJA 2KKHA 2FLNA 3FSIA 3R27A 2KRBA 5DRKA 3GFHA 4JI3F 2L08A 2IRUA 2YQ1A 3ZFVA 1YKWA 1H72C 2PMWA 1VC5A 5EDWA 2W2NP 3NBPB 4F4YA 1WELA 3O1LA 5KFLA 4NMLA 4FVCA 2HWTA 5LXRA 1JXVA 1V6HA 3W66A 3HP6A 2XM3A 3OXGA 2GVZB 2FYXA 4MYUA 3NNAA 5B09A 3JS9A 3ETOA 3DLBA 4TLRA 4CLSA 2ASYA 1WDDA 1JLAB 3UDEA 5MLCV 4A8KA 4LBIA 4QW9A 5A8WA 4KPYA 2KT5A 4O3PA 4WF9Q 3ULHA 4Q2LA 3QIDA 2KFNA 2E1RA 4ECXA 1TZ0A 1M1GA 2IM2A 3HVAA 3E51A 2OAUA 4QW8A 1CS4A 1R43A 1WD6A 3JYTA 2VZ9A 5DQGA 5H9EK 3UO0A 2CPXA 2MY8A 5AT1B 3H4BA 1ZM9A 3PJ9A 5F0UA 4UOCA 3CCQS 3KJVA 4WK3A 2N3OA 3PVXA 2HQDA 3M2RB 1C1CB 2QX0A 1SVDA 5B0GA 8ATCB 4J9QA 2JEIA 2KG1A 2DEIA 1CULA 1S48A 1S6PB 4PQUB 3T19A 3U1LA 3VTIA 1VQ4S 1KONA 4LVNP 1RBAA 4ZVUB 1V3RA 3DXSX 2DGVA 2OUGA 4DMZA 3IR7B 4DV1F 1TELA 4CO2A 4DR2F 4V1Ak 5F41A 2L48A 1EQ0A 4JI1J 2WB4A 1WTFA 1U48A 2BACA 1LK5A 2I2YA 3K8VA 2H48B 2V0NA 5LXYA 2MJUA 1C0TA 3MCSA 2DGSA 4DSJA 2XY7A 4P2FA 1NK6A 2M8DB 1XEZA 3GIRA 1S0OA 2FHOB 3W2WB 2CJAA 5H9EJ 2WB1D 1HWKA 3MAHA 3FEYB 1S49A 3CCVS 4A8QA 1U8WA 5A0YA 3E8OA 2FLPA 4AD6A 4Y2AA 1VBKA 1BQNA 2C3MA 3KK3B 2HHPA 4CYUA 5HANA 4CRJA 5KFMA 2HVIA 3HK2A 1WHXA 1HA1A 3OLBA 2NLWA 3P5TL 4KH0B 3QJLA 5B0FA 1FA0A 3J80U 2GVDA 1KLMB 3D3CJ 1UTAA 4CT8A 2M5YA 3BDEA 4ZPDA 3M2VA 1HBUA 5D4PA 3CJRA 1SV5B 1TK8A 1Y11A 1CEZA 1NHVA 2HNZB 3LGHA 4EYHB 5M2RA 4X62F 4CI0B 1TFYA 1FNOA 4NLTA 4B9MA 1BMQB 1JLGA 1ZOTA 2FGOA 2JDJA 1YTYA 4Q44A 1VDHA 2W7OA 2CQ3A 4B3OA 3D68A 1VQPS 1GXLA 2EBGA 2IVYA 2MMYA 2RB7A 4FNIA 1C4AA 2CG4A 2I0XA 2J0XA 4LBPA 4NXNJ 2XCPA 2R9LA 1K44A 1U2FA 3BSCA 3ET6B 2W9CB 3JTNA 1KVKA 2DNQA 1KP6A 3LW5C 4O4RA 4E2FB 4Y3CA 3ENVA 3JSRA 1E6VB 4J9LA 2HS0A 1N0VC 2OPQA 3AD8C 5K8NA 3GONA 2UV8G 2KJWA 2NSBA 1SQEA 3MM6B 2FJXA 1RWUA 5IOLA 2JHEA 4KY3A 3K89A 1DQAA 1VCTA 1Z2LA 1S12A 1DARA 4FYYB 1WC5A 1PIEA 4LF9J 3VCDA 4PR6A 2B8PA 4DI6A 4HL9A 5ETKA 2J7KA 2XBPA 2W8LA 2VG5A 3D0GE 2PEBA 3D1OA 3G6YA 3DLJA 3BV8A 1TKZA 3TUIC 2VPZB 1DURA 2OMOA 1N5YA 3TVZA 2G1DA 3L9ZA 2HLTA 1EKSA 3IGVA 2LDIA 4V19X 2E9ZA 3PW7A 3G6ES 3VAJA 1R27B 1CJTA 1NAQA 1D3WA 4EI2A 2UVVA 2VA2A 3MMJA 1BLUA 1T95A 2J7UA 1NNDA 3DLHA 3AB4B 3DLGB 3A8JA 4IG0B 5HVGA 3JQJA 3MM8A 1HD0A 4LSNB 4FYDA 1RA7A 2YX4A 4F2SA 2WAQD 3NEKA 1RKIA 4X4VA 4XO0A 2RRNA 3DC2A 1HNVB 3CCMS 3CNQP 3I6PA 2VQEF 3M1VB 1CJKA 2J9EA 1BQMB 4CM0A 4OYPA 4GKKJ 3D54A 1MNEA 3W2VA 5K5MA 1JK9B 3EDRB 4YOEA 2DPIA 2QLXA 1YITS 1WEZA 1GMWD 5CZVA 1XMBA 3AQPA 3ZO7A 3MZIA 2YY3A 3PYDA 2IJFA 4PPDA 4G1IA 4QYZK 1NCLA 2OSRA 4PUOA 2XC9A 2W24A 4RW8B 1IWGA 1XWLA 5G0RB 4KRWA 3OT9A 4DSLA 3MWBA 4DFKA 1WEXA 1K1QA 1FTRA 2Z58B 4UUWA 2YTCA 3WC2A 2RDJA 2AGPA 4ZPVR 4LFCJ 4D3GA 4KH1B 4L72B 3AQOA 3CT9A 5FIIA 3CD5A 2KFZA 2UXCF 1NPRA 2BA9A 3BGUA 3GJQB 5LMUJ 5IFMA 3W63A 4CIOA 4WFAQ 4ZJOA 4X4TA 1KSPA 2RF2A 2KM8B 2NPFA 4OZ1A 5EGYA 5I42B 5A2QY 3B82A 1IR2A 3DCAA 3AA8A 2A18A 4IDKA 4NI2B 4QWBA 3CCSS 1YJNS 2JC0A 2UXDJ 2HFOA 2R8GA 4ZLNA 1JIHA 2ZBPA 4F0HA 2HFZA 2RDIA 2R42A 5J2MA 1YIJS 3NAIA 4PWDB 3SSSA 2FHJA 4Q8EA 4RBTA 1MSWD 2BKNA 1M90T 1KQSR 3P4UB 3RBXA 4H4KC 1U09A 4USTA 3UN3A 3DU6A 4GC6A 1WG1A 2BE9B 3ZC4A 5KFCA 3CCZA 4B9LA 3J7Z5 1CSJA 1AFIA 1HHQA 3HFVA 4EBDA 3KLVA 2O01C 1G3OA 2J6UA 4DUYJ 4FS2A 2CQDA 2B9YA 1PCAA 4BWMA 2OJ3A 3KK1A 4J7CA 4KFBA 1B0VA 1LXJA 2DHXA 1RTIA 4OYOA 3KLHB 3MEDB 4DZ6A 3SV3A 1IVZA 4ANCA 4ZVEA 5HBMA 4K4VA 4U8VA 4ZHRB 1N52B 1G1XA 3C3LA 3VZHA 4M1KA 4KSEB 1GEHA 2HQIA 2HRUA 1S7IA 3OXFA 4A47A 3W3SA 2HAIA 1ZM4A 1IUJA 3PHEA 1VIXA 3BB5A 1PBAA 2AJ0A 4JI1F 2AKWB 4I67A 3TYTA 2YKNA 2AJQA 2RE1A 2QA1A 4WP3A 1RGVA 2EG2A 3DDIA 2QLBB 2LQ9A 2DR9A 1NSPA 1G4CA 3GSDA 3BSOA 1IM6A 4F04B 3BYPA 2ZH8A 3M30A 4KO0A 4R25A 1M5HA 1OYDA 1U24A 2EG1A 2PMHA 1I3OB 2OHDA 3M6XA 3QZ7A 4JB8B 4QQBA 5A8WB 1RAGB 4PG6A 5K8OA 2HQGA 3UDLA 1FRIA 4DR6F 2CPDA 3RUBL 3FC9A 5T14A 2XO6A 1NHUA 3TZZA 4DPUA 4J37A 2RNEA 1BY9A 4CTAA 1NBEB 5K8PA 1HYSB 1DHMA 4ECWA 2R4FA 3I4PA 5DO2A 2DCLA 4NZ6A 1CS4B 3JYTB 2GAHC 1I51B 1NEEA 2KXFA 3OW2R 3GG1A 2C2MB 2RD5C 5FJ4A 2JJ4D 1QTMA 3TX0A 1Q8LA 3KJVB 4DV3J 4A8XA 5HMXA 3ZZRA 1T03A 3QJJA 2APOA 4YFUA 2EFNA 2BW7A 1CULB 1KOHA 4NXNF 3KJNB 1Y0HA 5JVHQ 2AEJA 2FDNA 4WFYA 2XI3A 3OD2A 4DL5A 2NZ4A 4YDXA 3OLAA 4RZRA 1SKWA 2LKZA 3FSXA 3DGPA 5F8NA 1T3OA 3NCPA 4F4KA 4FF4A 3GU0A 2FIUA 2CQHA 1GXUA 1IQZA 1C0TB 2JOQA 3G4SS 3PYFA 3W65A 5A8KA 2L41A 2GS8A 4NYZA 1XNRJ 3B54A 1QAXA 2ROPA 2IM1A 4X64F 1A6LA 2WCXA 3R2DJ 1UEKA 3VQSA 4EWTA 1XN9A 5A0YB 4P6QA 1IKYA 3EPIA 1BQNB 4U67Q 2FLLA 4CYUB 2JLFA 4PG8A 2XMMA 4ZS6A 4NEZA 4B3RF 4CLLA 3PNIA 2EWHA 1SC3B 2FVQA 2KXNB 1R7IA 1U45A 3PRDA 1QDUB 4FDFA 4U6PA 1SL0A 2YNGA 2GVDB 3MMAA 1S9EA 2HZVA 2XLJA 4O3OA 1N5QA 2ZVIA 2QA2A 3M2VB 2XYPB 1HBUB 5B0AA 2IC3A 2C2KB 2HHHJ 3NXZA 2DJWA 1S6QA 3VR1A 3M4XA 1JLGB 1C1BA 1T0TV 2N4CA 2K3IA 1FK9A 1XERA 2AYBA 2FQQB 4K2JA 2C22A 3PR5B 4ZP6A 4MT1A 4B3OB 4HI1A 1UPMB 4LF5J 2EK1A 3N9UC 3SCKE 1RT6A 2ZJQQ 1DLOA 4NASA 4KC5A 1M1KT 4GKKF 4FF3A 2A6OA 2MQQA 3DLKA 1YRUA 1ROFA 1X9MA 2D3ZA 2EFOA 4ZLJA 1X5SA 4I68A 4OYIA 4DL6A 5KFQA 1B64A 4HACA 4IO1A 4DPXA 4F3OA 3J80Y 1ZAVA 5A6WA 3A3OB 1Z2ZA 3IG1A 2OPQB 2V4RA 2WBRA 5GVQA 5GAGI 3Q8SB 3ENQA 2BE2A 4I4BA 3IRWP 5E5NA 3R7SB 4E8UA 2B43A 3PJWA 3G82A 4O0IA 4JV5J 2CUYA 1XIQA 4LFCF 4DSKA 4IQMA 3U27A 1T11A 3KHLA 4JI0J 4JI7J 1K1SA 2FPHX 4M5IA 3MEKA 1HQ2A 2VG5B 4OHWA 4LQ3A 2F3JA 4DL7A 4FXDA 5LMUF 1S1UA 2UUTA 1X8DA 1SIWB 1TKZB 2ZUAA 1N5YB 1PJ7A 1SJ3P 4ECRA 1LOUA 1T7PA 3DDNA 3GG0A 4X4SA 4QU7A 1S97A 3CDAA 1QAIA 1CJTB 1FTCA 1LXNA 1OYEA 3MECA 1VHFA 5ETQA 3OR1A 1CQMA 4H4KA 4HH0A 2V2ZA 1OWXA 2UXDF 3WHIA 4L75A 1IBCB 3GR0A 1S1XA 3E3XA 3QGPA 3G96A 2W2QP 4IKAA 1U26A 3MM8B 1S10A 4PXDA 1Q8BA 2EFGA 2IYIA 2PA3A 3NNCA 3W64A 2MKSA 2DK2A 3KLFA 1CJKB 2GO9A 3MCOA 1FNMA 3W2VB 1TU0B 4AQYF 5DLGA 4DUYF 3R5JB 3BSNA 3HULA 3DOLB 1SJ4P 3I96A 3OR2B 2GMJA 2VHGA 1WEYA 1FFGB 4O3SA 4AUKA 2H65B 5DG9A 2DYAA 1NSKL 4PUOB 1QE1A 5EUHA 5KG3A 2E44A 2XG8A 1WI8A 1NB2A 2HNYA 2BE7D 2KYZA 3RJMB 2XB2D 3GP9A 3EVMA 3IBWA 3ZZZA 1U47A 4JV0A 4OV1A 3CULA 1FJ7A 2W7AA 1CLFA 2KI2A 3Q2TC 1KVIA 4LF6J 3ZZPA 3EDQB 1U6ZA 3IWXA 3LAKA 3DKDA 2NUUG 5J1PA 2DR6A 3EMTA 2L9WA 2MGZA 2PO4A 4QIEA 1P9YA 2DCUB 2UVRA 4HLBA 5K14A 2CJKA 2DVIA 4LJMA 4CLUA 1PAEX 3FGVA 1B99A 2HK2A 1VGYA 2B9XA 2O67A 3KK2A 1WC0A 2QT7A 4G3IA 2V9KA 3THVA 3I0SA 2DNKA 1D9DA 5E3CA 2EK6A 4YY3J 1U49A 2M9KA 3OTBA 1ELOA 3NOGA 2BABA 4OJGA 3J7YI 4OX8A 3R8YA 4IDKB 4PWUA 1VQ5S 2YNHA 2D74B 4JP8A 2XZDB 1WKJA 1T9WA 5D0HA 3T1YF 4OFZA 2BMBA 3M9OB 2XYGB 4O44A 3H2VE 2ZH2A 3TI0A 1KLNA 4ATNA 3Q0AA 2UXBJ 3CW2C 3ZZUA 5IT0A 1B4SA 2HZCA 3IN5A 1N32J 2H4YB 4M5MA 1XMQF 3QWUA 1RA6A 4KHPF 2BJDA 1JMTA 1RTDA 4ZVGA 4M5KA 1VI7A 4DV3F 2Z2LA 2YWFA 5DDOC 2DR8A 4PG7A 1I5OB 5I4MA 4XDDA 2G13A 1Q8IA 1YJRA 1RI7A 4DG1A 3ISNC 3KK1B 4KFBB 3TP2A 1RTIB 2HBYB 3J81U 2C1EB 4NZ7A 3L3CA 3G2XA 5D78A 4TKTA 3IP0A 5HBMB 2ILYA 4LF4F 1AXQA 2B51A 2L3MA 1UEVA 4WBFA 3R5GA 4FXWA 2R7UA 4MFBA 3J7ZT 2V4QA 2NPIA 5C7PA 2XMUA 4RO0A 5KT2A 3HPOA 3FJ2A 3RR8A 1Y3JA 2IPOB 1ZYQA 3BDPA 5F3TA 3KJQB 2AGOA 1JB0C 2QO3A 1Q81T 4C0BA 1Q7YT 4QBUA 3SEOA 4WP9A 3LP2A 1HQUA 1BHNA 2YKNB 3FVYA 2ZNZA 4DV5J 2RRBA 2V9WA 1ZPVA 3P5BP 4R8UA 5ITHA 3MTJA 4CLZA 3M30B 4TY8A 4KO0B 3AB2B 1UVIA 5AE1A 4C0OC 4DQPA 5K8MA 2CWXA 4Y00A 5KFIA 1ZAXA 5L1JA 1YZ6A 2A3JA 1H3DA 3V6JA 2A2CA 5BYQA 3C6TA 1WC1A 4NCGA 4ZVSB 2E7VA 1NDCA 5EX0A 3NMRA 2KU7A 2DNGA 4OV6A 3P49B 4RJVA 3H59A 4USUA 5D0GA 3N28A 2HVZA 4GKJJ 4RNHA 2XYHB 1N0UA 1ZA1B 2E5LJ 3A12A 2HHHF 1X5TA 2Q3PA 2DO0A 3CMAS 2DGWA 2EKNA 1EHWA 3OJSA 5H9FK 3HKZD 5KFNA 4TLQA 1MMDA 5D3GA 1T03B 1L3SA 3PW2A 4LF5F 2GNKA 3C2PA 2ZZMA 2MZ1A 3AJ2A 5LSRA 2QFIA 1RAAB 4DX6A 2OD4A 5C2GA 3US5A 1KDNA 3K2YA 2HHXA 2MKJA 1FX2A 3LWLA 4QPXA 3D67A 2BQRA 2E1MC 2HS4A 3KDNA 1R31A 2R7VA 5KFPA 5E3AA 1WDTA 2HRTA 3AOBA 2CYYA 3DGPB 1YK9A 3GMGA 2JH3A 5LJ3Y 3JTPA 4KHRA 4C3KA 2DKOB 4OX6A 4LREA 2BKOA 2ZBQA 9RUBA 4JV5F 3CVKA 3CSKA 3PFOA 1EB0A 2HHVA 5A8KB 4DSEA 2CA9A 2ZKTA 3O5TB 2MHNA 4JI0F 4JI7F 4ED4A 4KIAA 1WACA 4ES1A 3HVWA 1OQ3A 3CE8A 2MZRA 4DS5A 2ZH4A 3PO4A 2FGCA 2C3YA 1IKYB 2D3OR 4RUHA 4K4XA 4C11A 4U7CA 5H9FJ 1HW8A 3EJMA 2OEMA 3K5LA 1BUXA 2DNRA 3M6WA 4X4QA 2DEJA 2YNGB 1YJ7A 3MMAB 1S9EB 2MY7A 3VAFA 2QIFA 4UQTA 2PEHA 1MROA 3WDOA 5ETMA 2P6TA 3CJSA 2V69A 4BC7A 2YBVA 2IC3B 2OTLS 2DGXA 2DXFA 2OEKA 4F3MA 1N5VA 1F60B 4OJ1A 1X4AA 2GJFA 5CABA 1C1BB 5B0EA 1FK9B 1NJIT 1TMMA 4HI2A 4DV6J 1RHQB 1TMJA 4C8YA 4H54A 3D3BJ 4X66J 4USVA 1WC3A 3ETMA 3HT3A 1ICEB 1RT6B 3CJ4A 1QAJA 4QCLA 3UCZP 1DLOB 3BF4A 3U1NA 3DLKB 1WKKA 3R5BA 4RUBA 4NCBA 5AXLA 2GMLA 1NH7A 2XZWA 3Q89A 2R3VA 2MKHA 2EKYA 4OIXA 3EXYA 3N0VA 1RQ0A 1IKVA 2GHVC 4HACB 2R8IA 2ZH5A 4KAIA 3HT0A 3VGVA 5FD1A 3O44A 3IG1B 4MKVA 4G6VB 4WZQA 3N6MA 3OTDA 4LUBA 2HSEB 3FFIA 4NPOA 2HQ3A 5DQHA 3HSJA 4C98A 2BE2B 2H3EB 3FK4A 4JOUA 2WHOA 3W5ZA 1K0TA 2VF3A 1PYTA 3BN7A 2RQCA 4LF6F 1U6BA 2JEFA 1VJQA 4L76A 1R0CB 3WX4A 2P8IA 1VQ6S 3NGSA 3H42A 3H40A 4Q7AA 3VGTA 1S1UB 2M2BA 5AJ3J 4C6AA 1F5BA 3PW5A 2J0WA 1AA1B 3IRXA 5HO4A 1FI4A 3FEXB 3FRYA 1ZETA 1NK5A 4YY3F 5IC4B 3BGOP 3C16A 3DRXA 4ANDA 1IJEB 1YLXA 3B6BA 2C2DA 3MECB 3QWPA 1U1PA 1NKEA 4TN2A 3OR1B 3H5YA 2BJ7A 4UW2A 4J5OA 4LT6A 2ZWPA 4K2XA 2KVIA 4K59A 4RPFA 5MAOA 1S1XB 3THTA 2CDQA 1HFEL 5I3UA 3ITHA 5F9LA 1VMBA 2LXIA 2OKQA 4K4WA 3PKMA 2XLKA 2O1PA 4KYZA 1LFPA 4RU9A 2BANA 3HVTA 2XMAA 3MR6A 2OTJS 2W2MP 2LEAA 1MMLA 4XTTA 3I4HX 4IRCA 4FYWB 1N32F 4DR4J 2OPSA 4MKBA 3KLFB 3A4TA 3L7PA 1T9TA 2P5VA 2QJ3A 2PT0A 3D28A 3IS9B 2QV6A 1X7VA 3CJKA 4ETZA 1UVLA 5KFUA 3GJTB 2V63A 3TA0A 2N7CA 1H73A 4URGA 3M8PA 2CQBA 1OIAA 3D6MB 3NS7B 4FBTA 1NJZA 1HNXJ 2B4UA 1T05A 1RBLA 2P6SA 2Y9HA 2HW3A 4JYAF 3QZ8A 1WF1A 4C2MA 2DT9A 3AD7C 1UVNA 1QE1B 1Q0NA 5DJBA 2XNRA 1NKBA 3TJ9A 2MLZA 2HNYB 3BO3A 4ED8A 4J9PA 2ROEA 5J1EA 1ZM3A 4ECUA 2BJEA 1ZTWA 4DX8H 2W01A 2VODA 3M6VA 5HLFA 3E2EA 1I94J 4P74A 3GTYX 5HI7A 4O0NA 4OYAA 4RW9A 1KQGB 3UDCA 2CPHA 2MGZB 5KG5A 3O3LA 1SJQA 1X4CA 4DV5F 5K14B 2NYIA 4DN9A 5M2UA 3KLGA 1CVJA 4WXWA 4O3RA 3BN4A 1R8HA 3KYLA 3GCWP 3N4WA 3V4MA 2AF6A 4O3NA 4NWBA 1WF2A 3A8IA 3EZUA 1WSVA 3KK2B 4Z7YA 3CJ5A 4FBUA 4YN3B 4UTGA 3OTEA 1OQ6A 2XEXA 2NUHA 3I0SB 3JQMA 3G71S 2GGPA 1FNXH 3HJVA 1RHUB 1VHIA 2V34A 2GX8A 4LSZB 2ACMA 3PW4A 2YNHB 1TL5A 3GILA 2BOPA 4IOAQ 4QIGA 4M63A 2YWEA 1SPBP 5IQ6A 2M52A 3CJTA 4TVAB 2MKKA 3T5KA 2C2ZB 1N56A 3POTB 1F5CA 3DOKB 3G9CA 1N8RT 4B17A 3TNVA 4O3QA 4Q0BA 2E5LF 5DM6Q 1A0OB 2MTLA 3QIPA 4Q43A 4ZMMA 4BS2A 3WX8A 4ZCIA 4UQGA 2C3PA 1X4EA 1RTDB 4OI0A 2E9RX 4QR2A 1H2TZ 1D1UA 3KNGA 2CQ2A 4DSFA 1FJEB 4DG1B 1RCOB 2E66A 4ZVTB 3K59A 2BYCA 2AYMA 3TAMA 3BO2A 2BV3A 1N33F 2G0JA 2Z2MA 3AOAA 1CQNA 3BKFA 4NLOA 2UUCJ 2M4MA 5GAHU 2KFYA 2D3O1 2FHMA 3CDUA 4C8NA 4YB1P 2CVEA 4MFBB 2LP4A 4DLEA 3VAMA 3RB4A 3Q8QB 2B3TB 3NWGA 3P3DA 2HVHA 1TV6A 3QO9A 2J6TA 1UAWA 2FHKA 3RAMA 3OL8A 1NJYA 1KHVA 3GFYA 4J9KA 3QRQA 3LP2B 1HQUB 4KT0C 1JX4A 1IR0A 4KQZA 4U7UD 2HFUA 4KGMA 1PC5A 3PEJA 2E1AA 1B3TA 4R8UB 3BREA 3T9ZA 1A7GE 4GVLA 4TY8B 3JAMU 1DZ5A 4RLEA 4DR1J 4IG3A 5THWA 2HFNA 3J81Y 1FDDA 3V6DA 2MQLA 2D69A 2ZOFA 4I2PA 3Q8VA 3CGIA 2FZCB 2WW4A 1VR6A 3IM8A 4PXBA 1U1QA 2DNPA 3C6TB 3HZEA 2XLIA 1URRA 4NCGB 3LTOA 5CD4A 2QEXS 1VK8A 4I1TA 2P9CA 1R8CA 3I87A 3BYRA 3T9NA 2FC9A 2Q43A 2R2RA 3K0JA 2UV8A 3VAHA 2Z2YB 4RX6A 1TL3A 3KK3A 5C42B 1RJJA 2KZMA 2Q6CA 4WJBA 3SDEA 1UW9A 1HNWJ 1N6QA 1GX5A 2IIHA 4DV6F 4ZLLA 3P96A 2DIUA 4X66F 5D3GB 4QWEA 1V5IB 5JVGQ 2Q66A 3HFKA 5EN1A 3EGWB 3ZTPA 2FY8A 1SV5A 1YWXA 1MU2A 4PQAA 2PGCA 3IAS9 1NPPA 3GQCA 4V19J 2HHWA 2E7XA 1RHKB 1EIYB 2OELA 3L95X 2R7OA 5GAEI 3CD6S 4ZVHA 2RS2A 3W8PA 2LEBA 3C14A 1H2VZ 5IXUA 1VOMA 3X1LB 2KXHA 1IBLJ 2ERRA 4YMEA 2O66A 4Z7CA 1TVRA 2RU9A 2CJXB 3ET6A 1U25A 3EE3A 1NZAA 1YRTA 2RIJA 2NSCA 3NWRA 3RYLA 2M7SA 2XI2A 3NGTA 4DV1J 1NSQA 1F3FA 1WOOA 4K4ZA 3JXOA 1S1WA 5L9XA 4PG4A 5L9NA 1WJ9A 5KG4A 3CEDA 4URQU 3SZ2A 4BHQA 1NZ8A 3RBEA 1TKXA 1EETA 5AJ3F 3A3PB 1W25A 5HVFA 4C11B 2DR5A 2XGPA 2I8EA 3ISND 4QJVA 2F4VF 4WCEQ 1Y3KA 2R7RA 3P6YC 3W5XA 4EFAC 3M32A 1URNA 3OSNA 5KTQA 1YJUA 5KFZA 1UFWA 3M8WA 2GFFA 1Y4ZB 5J2QA 2GCFA 2G1HA 1HWLA 1JLFA 1DTQA 1Q78A 2MSTA 5CAAA 4FZVA 4XDCA 1KNZA 3MOJB 1S4EA 3C46A 4DWIA 1KRPA 2SXLA 3UVJA 2Z4PA 4DR4F 5L38A 2VG7A 4LQ9A 4B08A 4NA2A 3TAPA 3HHLC 2Y8YA 1VBYA 4F2RA 1R6YA 4C9DA 2V8HA 3R6GB 3IA0A 4CM2A 4I64A 1UZDA 3ILJA 1P9QC 3PRBA 4K4TA 2NXCA 1WF0A 4NLYA 5CQGA 1IKVB 4UF4A 2B9WA 2OP5A 3C15A 4WK1A 4BWJA 1HNXF 4N41A 2GO8A 1PJ6A 2V8DA 3BPSP 4LIWA 4DR5F 1HNVA 4KPCA 3MXHP 2W9AA 4LRFA 4M5NA 1NU4A 5KOXA 4NOHA 4S0MA 3HHKA 2W4PA 4DU8A 2HNDA 4I6AA 3FFIB 2ASJA 2JX2A 2F7VA 2NXEA 5AXKA 4MKYA 3R5DA 4EUVA 2CWKA 2WTFA 5ETLA 1SH2A 1WOSA 3FZBA 3OV7A 1QUVA 4P2MA 2RRAA 3CCUS 2CXEA 2LFVA 4UUXA 1UKUA 4X4NA 1LW2A 1ULRA 2I38A 1Q5YA 4L3KA 2JFKA 4MIWA 3CC7S 2AMCB 3PR4A 1T9YA 3WIUA 2RQKA 2VICA 3CJQA 1FO1A 3IRXB 3CMES 1LQ9A 3DYAA 5HVHA 4HEA9 1F1BB 3EICA 1T94A 2LXFA 3BQ1A 2NXNA 3MPYA 3PY8A 1EP4A 4CCHA 4LFBF 1RK8A 1L3KA 5KFTA 3R5AA 5I3PA 5I3UB 3ITHB 1OSDA 5DM7Q 2UUWA 3FNNA 2VBXA 5I42A 1NKCA 5A8RA 4W92B 3N5FA 2BANB 3H4DA 3HVTB 3IFEA 3RTVA 3IXQA 1RCXB 2PN6A 3MM5B 2OPSB 1GFWB 5BR8F 3NOCA 6AT1B 3HSZA 5D0RA 2C2RA 3CJKB 5KFBA 3GLJA 2WK4A 1NDKA 2E5JA 1QD1A 3DHWC 3RRKA 1S5ZA 5DGAA 2F8MA 1FE0A 2YKAA 4Y65A 1Q1KA 5F8MA 3ZTOA 3M8PB 3Q2SC 3CIZA 5B0BA 1UVMA 1T05B 3ILIA 2VQEJ 1UEUA 4OZ2A 4WU2A 2DXEA 2YWHA 3RU0A 4FVMA 1R0AA 2YKOA 2LCWA 2IVMA 5J1EB 2J5AA 3I5CA 1B7YB 5KFYA 3GIMA 2Z2ZA 4P72A 3RW7A 4OI6A 5HLFB 3F73A 1GT8A 1FF2A 2K06A 3PO5A 4OHZA 3K5NA 3HHEA 3MEDA 4JI8F 3LP1A 2E5IA 4NLVA 1FCAA 1YHQS 4DU7A 4FXVA 3TRGA 5E41A 2C3OA 1FRMA 2IM0A 3KLGB 2AJFE 4K0KJ 2HWHA 1RWMB 2CDRB 4J9VA 3BH7B 1RKJA 4YQWA 4DR1F 1UJ6A 4ED0A 3HM9A 3S01A 1TKDA 3OTCA 2ZUGA 1DAXA 1FEHA 1PJ5A 2DNOA 2AYEA 2GGPB 4HKQA 3FUYA 3MCMA 3HXMA 2UXCJ 2BM0A 1TAUA 2YQ3A 3D2WA 3CJ3A 1Q8KA 4OYMA 1XTZA 3KMSA 1S9FA 3EVWA 4C0HA 3KTQA 2D1CA 2COLA 4RNOA 4F3QA 3MM9A 4M95A 4C4WA 4F4XA 4Q0BB 2C2OB 3QIPB 4KBIA 4FYVB 5DG8A 4Y28C 2G4BA 3K5PA 1H7WA 4C8KA 2QL5B 1HNWF 2G9OA 1YX2A 3FRZA 3ENAA 2PC6A 2IM3A 2XHCA 4RR5A 1HYSA 1N54B 4U8YA 2QSFA 3PTWA 3OHAA 5CH7B 1KKHA 4QR0A 4LVOP 4YR2A 2VQFJ 1NDPA 4DV7J 5BXIA 2R7XA 3QGIA 3TAMB 5KFVA 2GJIA 4GRSA 2BUNA 3V6KA 2IBOA 1RXOB 5B7WA 2D41A 3V4IA 3BZQA 3OVSA 1IKXA 4IFVB 4OHVA 1YZ7A 3J81j 4NXMJ 2YNFA 3NY0A 5D4LA 1IBLF 4ZN1A 2VJVA 1TV6B 1Y9OA 3I9ZA 3QO9B 4PPZA 3Q24A 4LMZA 4CLYA 3K58A 3V81A 2LDYA 5DDPC 1U8SA 3THPA 1FD2A 1RT2A 3GYXB 3ONQA 2F9JA 2MLYA 4AE5A 4ZIWA 1UZHA 2WW8A 4UOHA 5DZ6A 4UOGA 4ED5A 1CJUA 4USWA 1YJ9S 2CQCA 5F8GA 2R2TA 4IG3B 3BR9A 3MF5A 3V6DB 3D6HB 4QZVB 4I2PB 3MAQA 5AXMA 2LYVA 2Y0BB 4IOBA 3NGKA 4X4UA 5IV3A 2E7WA 4MYTA 2OFGX 4I69A 1KC8T 3T5HA 1TL1A 3ZTQA 3HHLA 2PA8D 3ILLA 1G6BA 2GW8A 5GAGU 4ZP8A 1TL3B 1XQIA 1JJ2R 1LWEA 3UW1A 2P9GA 1G2EA 4DR6J 3KMQA 3IC1A 3QT8A 3CDBA 2IDEA 4IYQA 3SDEB 1N6QB 5F3ZA 2MXYA 4AXIA 3EM1A 3JB9k 3AAWB 2HEKA 1FWPA 3JAMY 2IYGA 2IA6A 1CC8A 4QPTA 4ED1A 1KOOA 2KL8A 5SZTA 1U4BA 4R0JA 3MPWA 2KHCA 3FKBA 3MFHA 4DDFA 1MU2B 3M8QA 4P7VA 1KHWA 1W2IA 2ADCA 5HQ8A 2YPYA 4JI6F 2R2SA 1FERA 4LF7F 3OFHA 1PYSB 4ZKAA 4TQRA 4IH7A 3Q8RB 3HHDA 4I2QA 2FJVA 1NO8A 3UD4P 3C14B 3TO8A 3NS5A 3DRYA 2ZOGA 3GV7B 4ZJQA 5J2PB 4OX7A 1HW9A 2V4JA 2BJ3A 1TVRB 2DRDA 4FP9A 2Q6BA 2EXUA 3PX4A 2FB0A 1H38A 3W9JA 2FZGB 1RYSA 3DI6A 3N6LA 4P52A 1S1WB 3VWSA 3GV5B 4CQ1A 2V8GA 2FC8A 1TKXB 4AL6A 2HS3A 1EETB 2IRXA 2Y8WA 3CXCR 2MLXA 1FDNA 1M0SA 3KHHA 4QU6A 2CPYA 4WP8A 4ZA1A 4HTIA 4K4YA 4ITSA 4X64J 4ZVPB 2Y3YA 3I82A 2WVEA 3M32B 4Y2CA 2QSWA 4DOZA 2J9CA 5L1IA 3KUEA 4K8RA 1FXDA 3EVOA 2B4VA 5J2QB 3PHTA 1JLFB 1DTQB 3IO1A 3AHPA 4EBEA 4B3RJ 2UUBJ 2FJBB 1RTHA 4ZOSA 1H7XA 1JLCA 3UVJB 2R2UA 3FMWA 1S59A 2RKIB 1JLBA 2VG7B 3M05A 5D4NA 2DITA 2VKRA 4JV2A 3DXBA 2W1BA 1TAQA 1HLWA 2JRSA 1XR5A 5KFJA 1ZZFA 2CAJA 4ECVA 2HMIA 2FVPA 3P8BB 2BVZA 3CB4A 5FLXU 3SCJE 3C15B 3CDWA 3DMJA 2JLEA 2IFXA 4NL5A 1KFSA 1GH8A 2A10A 1XC9A 3BBBA 2KVQE 1FRHA 1Y5IB 2GHPA 3JQKA 2HNDB 2B56A 4OYBA 1JNRB 3J7YU 1D8ZA 1SUQA 5CXTA 3ISZA 4NLPA 3GJSB 4CO1A 2ZKUA 2XO7A 3DOLA 1U6FA 4A48A 3HZGA 2XGQA 3VQTA 4IOCQ 3OR2A 5GADI 2GHWA 2ZDPA 1LW2B 1GK8A 2UZAA 1HR0J 1FWLA 4ED6A 3KLEA 4K0KF 1RT3A 4WE1A 2J9DE 4RNNA 3TJ8A 1RWKB 1AZSA 3KFWX 1U2RA 2KG0A 2X1GA 5E33A 3DYAB 3GYGA 4CLKA 2VG6A 2HHTA 1U7LA 2Q1LA 3C19A 2WVDA 4OI2A 4IFYA 3EGNA 3BBCA 1EP4B 1F6TA 4CH0S 1X4BA 4H4OA 4ID5A 1OSCA 4JI5J 4IH6A 3IMQJ 5GMEA 1RE1B 4PRFA 4NRTA 2ZNYA 1SH3A 2XWXA 5HATA 4IO9Q 2DNZA 5A8RB 1GQEA 2Q79A 2RDDA 3CCES 2ZITA 4OZNA 3CPWR 2FY1A 2CZ9A 3NCQA 2W2PP 2V94A 4EK2A 4DCPB 4B9VA 3LGNA 2XS5A 2MKCA 2IMOA 1LWCA 3CO0P 3QLHA 3GYNA 4NCAA 1OJ4A 3HO1A 2OEJA 2VOOA 3R6LB 3BGFA 2C2NA 3DN9A 4DF4A 5KT5A 4ECSA 2VQFF 4DV7F 4Y0FA 4QYZJ 3OUYA 1IN0A 3SXLA 3GFZA 3H5UA 1UL3A 1X5OA 3I9V9 5IWAJ 4K5RA 3RR7A 4JI4F 2F63A 1R0AB 2K7JA 2AWZA 3HX9A 7AT1B 4YB7A 5J1NA 3SSRA 4AQYJ 1M5OC 4B3SJ 4RL1A 2QMXA 4NXMF 3W61A 4X84A 1RAOA 3PFEA 4BLGA 2Z30B 4HVZA 3SBMA 1P1LA 4MAKA 2I9SA 3LP1B 4DCJB 1HWJA 1VIOA 4ZP7A 2ALYB 2CQGA 1GTHA 4YR3A 2NYHA 2JNJA 1NRKA 3T1AA 1RADB 2MPUA 1WHWA 4HHJA 1M5VC 2VUGA 1JLQA 1R8AA 2Y1IA 2AV5A 3H98A 3RW6A 3J7AN 2DNYA 1CBKA 3NLCA 3D0IE 1RT5B 3DRRA 3LWMA 1QVGR 4RW7A 1V5VA 1RABB 5JXSA 3RB3A 3V2UC 3CMQA 4IH5A 3BKUA 2MQMA 4RUCA 2QA4S 5LMNF 1J5EF 3OXLA 1VBZA 4G1PA 4FKYA 4ZN3A 3TAQA 1SL2A 4ZCKA 2A6MA 4F50A 4F67A 1RWXB 1UA0A 4TY9A 4J91A 1FDBA 3W8GA 3UN2A 2YH0A 2NREA 4ZPBA 3MM9B 1YDLA 1M5SA 4TNOA 5B0DA 4DPTA 4YDDB 3PZPA 1GNKA 2LA6A 1FDAA 2VD3A 3UR3C 5CYMA 1U1LA 1VYAA 3T1YJ 1VFJA 3A8KA 4BDPA 4C97A 2Y1JA 6FD1A 5KFGA 1HI1A 3L7OA 1HMVA 2VDIA 3O2IA 4ZK7M 3HHNB 2V2KA 3N79A 1XMQJ 2MZTA 2HIYA 3H5SA 2BJ8A 2C42A 5HAOA 2CQ4A 3V4IB 1SBRA 4PYDA 2ZBIA 1IKXB 4KHPJ 1YGYA 4AXJA 6FDRA 4UT4A 4PXEA 2UU9J 5LT5A 2YNFB 1Q4RA 1AUSL 4O23A 4NLDA 4ES2A 1M1HA 3BQ0A 2YKMA 3AJDA 4C48A 3IWLA 3V81B 4LF4J 4Y2KA 3AODA 1RT2B 1VQ7S 3RBZA 3MUMP 1RTJA 3SV4A 3HF5A 1S1VA 3WC0A 1V3ZA 1AFJA 1HQEA 2NS1B 2N3LA 2B8QA 4IRKA 3U7JA 2ZD1A 1CJUB 2M3DA 1MWZA 4ID8A 3LALA 1OPZA 1SQGA 1SC4B 5EWFA 2Y1RI 1LFWA 5EWEA 3R7NB 4B9NA 1WKLA 4PWWA 1UWBA 2HIQA 4KGXB 3I5BA 1CG2A 1FE4A 1TL1B 4WIIA 2RHQB 3HHLB 5KFOA 5KT4A 4C3LA 2YX1A 1X5PA 3OFGA 3MURP 5I3QA 4OMFG 4OLPA 1LWEB 5CD4H 4TU8A 1EX8A 3M8SA 2UUBF 2R7SA 3QT6A 1D9AA 2LQBA 1TUVA 1LWFA 1ZM2A 4OX9J 1TTHB 2VDHA 4ED7A 1AW0A 1FJCA 1BD6A 2AJ4A 3R1HA 5L1LA 2LXUA 1HKAA 1KTVA 2ZJRQ 1HHTP 3M8QB 1NUEA 1S0NA 2YKQA 2EFQA 1N5TA 3LO3A 1RB0A 1G7CB 3NGDA 4PABA 3LOUA 4J9RA 3PYEA 4CLWA 3R5CA 4I2QB 5HL7Q 2X51A 2W2OP 4Q45A 3TZXA 2Z56B 3Q22A 2FJWA 4X65F 4ZDNA 2OLWA 2V4JB 2CRLA 4CH7A 4DLGA 2J8AA 4NLQA 4CP5A 5E0OA 2F9DA 2HPUA 3KUHA 1IBMF 4OJHA 2VFRA 3AJ1A 4LFAJ 4ED3A 4LRDA 1EZZB 1S1TA 3DI6B 3KJFB 3E01A 4X4RA 3AOCA 1VBXA 2GQCA 4ER8A 1HR0F 2J0QD 2LLZA 1TUGB 5M2PA 4LBHA 1U1MA 3MTKA 2QGFB 2GQQA 4CLFA 5RUBA 5C24A 1DY3A 3T1HJ 1GMWA 2O3DA 2H5IB 4KGVB 4U7UK 1T3NA 1NH8A 2JWNA 2HFVA 4LRCA 4WU3A 2OPPA 1H74A 2VC0A 3O8WA 3D0HE 2W9BA 2CPJA 5ETVA 4ILLA 4Z2XA 4DL4A 2D9PA 2H5EA 3VF0B 3T6JA 2HG4A 3D5MA 2U1AA 3RGIA 1R6VA 3CCLS 2MZJA 4FPRA 5LSOA 4JI5F 5KFDA 4B9TA 2FHJD 3V6HA 4PEOA 1RTHB 1YJWS 2DRAA 3OVAA 1WUUA 3VAKA 2CPIA 1JLCB 4TQSA 4EU0A 3TANA 7FDRA 1ZH5A 4U95A 2ADBA 4E98A 2DGUA 4ED2A 1VRTB 1JLBB 4OYWA 4WTYA 4YB6A 3FEZA 1MWQA 4RBUA 1FEEA 1XMOJ 1X0PA 5EWGA 2W4CA 3K7RA 4BCAA 2HMIB 2U2FA 1NK7A 3QNWB 2N7YA 4PXCA 1HD1A 4WKYA 3HJFA 3NGUA 2RILA 3DMJB 5CYQA 3HKWA 4RKUC 3H0PA 4NLGA 3PIPQ 5IWAF 4NE9C 3LAMA 3I56S 3ELHA 3GR1A 3IS9A 3OFEA 4DL3A 1SUQB 5KFKA 5AE2A 1CPZA 4B3SF 2QYCA 4ETXA 4DV0F 2EFPA 5IZHA 1YG0A 2Y1LB 3U02A 4F4AA 2VH7A 1C2PA 3QJPA 2J8SA 2DISA 2YVSA 3CJ0A 2C28A 5ETOA 5EX3A 2LEPA 2HFSA 2XNQA 2J76E 2CPFA 4WWSA 1X4HA 3KLEB 4WYWA 1RT3B 4WE1B 4F8RA 3F0NA 2L9DA 2QE5A 1AZSB 2GV1A 5BYSA 5FLXY 3B4DA 1DQ9A 1RWVB 2DNNA 3IBCB 2VG6B 2X1FA 2RUGA 1JJ4A 2AW0A 4IFYB 2BX6A 4H4OB 4ID5B 1RT4A 2VFUA 3IGNA 4DJBA 4NZ0A 2OSQA 2CPZA 1PAUB 3IM9A 4PKDB 3D6FB 2LQJA 5GAHI 1YJTA 1WHYA 4DEZA 3KHRA 1JKHA 2B5JA 4LRBA 4OHYA 4FPIA 1FKOA 3GSIA 2QFJA 3BJYA 1UW4A 1PKUA 3ZXWA 1FXRA 4DQIA 2ZZNA 4G1QA 1LWCB 3QLHB 4AT1B 4KTQA 1HI8A 3K5OA 4XIUA 1FKAF 4PAAA 2LQ5A 2P9EA 3NL0A 1WWHA 4ZPTR 1N36J 3POTA 3CF5Q 3DOKA 3DLEA 4A8WA 3M2UA 3HVRA 3OUYB 2PI5A 2G2YA 4FKXA 4ZLPA 5KFEA 2ZFHA 4QWAA 3PYGA 2A1BA 3DGVA 5KG1A 2UU9F 2KT3A 4YP3A 2BJ1A 4MK9A 3W1YC 1Y10A 4LR8A 3PXGa 3CUNA 1Q5VA 3QATA 4JYAJ 4DN0A 4OZ5A 2WOMA 1B7FA 4OI1A 5D8HB 1EQMA 3AA9A 2H9ZA 2B6AA 4JI2J 4ZJLA 1N34J 3RB0A 4FNHA 1NK4A 4C8MA 4W90B 2RS8A 1FWKA 8AT1B 4J9NA 1JLQB 4YUDA 2NQPA 2XMJA 4NLSA 1JXLA 4F4WA 4LF8J 3ZZOA 3QRRA 3DRRB 4RW7B 4DQSA 3DFEA 2J6SA 1FJGJ 4KB7A 1UPPA 3R2CJ 1RAIB 2VONA 4X4OA 1O51A 2YPZA 1QUPA 2X3GA 1REGX 3MUVP 3LH2S 2PMZD 1IBKF 3GZ7A 3TJAA 5L8RC 5GAEU 2B4OA 3MMCA 4OZJA 4P73A 1DRZA 2W7PA 1XJWB 1RDRA 1YBTA 4HT7A 5IT4A 4NX9A 1VRQC 2E5GA 2HHSA 3UCGA 1CC7A 2RSQA 1Q53A 1NPKA 2M70A 2EEYA 3NCRA 5CYMB 3RBDA 2ALZA 2KRRA 4N7TA 2VPWB 4HT5A 4OX9F 3PV8A 3S1TA 4B3TJ 3MEEA 3OTOJ 1RWWB 3RB6A 4NMXA 2DH8A 1SXLA 1TP7A 5LM7E 3LUYA 2KT2A 1HMVB 5IM0A 2MYFA 1W7WA 2CADA 2QA4G 4WFXA 2BJ9A 3T5LA 5C42A 1KEKA 2HURA 2BQUA 2LMIA 1IR1A 2HQCA 1F5AA 2M88A 2ATLA 2CPEA 2HKEA 1PYOB 4I6YA 3Q8YA 4ZVQB 3N5BA 2BQ3A 1NLKL 1SKUB 1PO6A 5DZ7A 4OL8A 2GIFA 4X2BA 4F02A 1N33J 2YKMB 2LU2A 5ETRA 4F0MA 2IJNA 2CIMA 2ZHOA 2LQ8A 4N56A 3MAAA 5CZXA 4IUFA 2V68A 5HQMA 4OZ3A 1V9OA 1RTJB 4OQJA 1S1VB 1PC4A 1WC4A 5HN0A 2VA3A 4LFAF 3G8QA 3OL7A 4X4PA 2HQFA 1HQEB 2ATCB 2E1PA 4GC7A 3BO4A 3H2LA 2ZD1B 2ZC3A 1PBUA 1X4FA 2DPJA 4F25A 5T7LA 2OPRA 1I1GA 3T1HF 1EARA 1JXEA 1TK5A 2DH9A 1VC0A 4OZLA 5JJBA 1U0HA 3KUGA 1RHJB 2XMKA 3S7RA 2RMLA 4M94A 1UWBB 2JVOA 3OL9A 4IR1A 4CLPA 4ZPWR 5HP1A 1FVQA 3GB0A 2XZTB 1U2CA 4C8OA 3M6UA 1QJHA 1GAOA 1QVFR 4MIAA 3MMBA 5KFRA 1BGXT 2P2CB 3TVKA 4ECTA 3PW0A 1DQ8A 2VU5A 4WFNQ 3UNGC 1N5SA 4Q2MA 2GQ2A 1LWFB 3DOMA 4C7QA 3QAUA 1FHTA 4RW6A 1S72S 3ZNJ1 2FTRA 5B08A 2I6WA 4L73A 5F8IA 1YVFA 5DDQC 2UVWA 2XS2A 3MR7A 3VGSA 3HMJG 1XMOF 3TZWA 3QT7A 1EKRA 1UFKA 4EZ9A 4ZP9A 3UI3A 1LNQA 2EVZA 2ZBRA 1JQGA 1NXIA 5KT3A 1PSDA 4DFMA 4P71A 2VJUA 3U1MA 1RAJA 1X9SA 4LR9A 2RU3A 2E5HA 4OZ0A 4C8LA 3PX6A 4BC9A 4F7VA 1TQLA 4ALZA 3F56A 3C66A 4CT9A 1Q7LB 5D77A 2FVCA 4N47A 4D3HA 2JEGA 3UD5A 3B78A 1D0EA 3BEGB 3I55S 4DF8A 3OJUA 1LK7A 4AL7A 1BE4A 2AD9A 2WVFA 2IAJA 3QYYA 3M9NB 2JZ5A 3H25A 1IM4A 4ICLA 1S1TB 2IY5B 3E01B 2E29A 5D15A 2QL7B 2VV5A 2FVSA 1ZPWX 3AFGA 4H4MA 2DRBA 1XNQJ 3MDFA 3LPEA 5C24B 1GMUA 1AUDA 2YWWA 3FCHA 5C2CA 1L3UA 2RQMA 1SH0A 2ZE2A 5GMKa 2OPPB 5HROA 1FFWB 2B7CB 2W9BB 4EZ6A 3BPDA 3TR5A 1O5JA 2MKYA 2DHHA 2RQ4A 3PJXA 3FQLA 2YQ0A 2QL9B 4LR7A 4CLTA 3TZYA 4I7FA 2MKIA 1S4FA 3A1YG 4J9OA 3HSDA 1X4DA 3FDSA 5IQQA 5DDRC 2F1FA 3CD7A 1CJVA 3MCNA 2QC3A 1VLYA 1NK0A 5B0CA 1K47A 3FCWA 4ELUA 2W8KA 1O8BA 4CNYA 5H1SV 1WC6A 3VV2B 2F4VJ 1RYRA 4NA3A 2JLGA 2CZ4A 5K20B 2BRLA 3MUTP 5F0WA 3NMAA 2VB6A 3HD1A 4KGKA 5E3PA 2DY1A 4CZCA 1GTEA 2ABYA 4N5SA 4NLWA 2ZOMA 3NG8A 5DETA 1U1KA 2YNIA 3TWZA 1QSLA 1N36F 2DIVA 3OQ2A 2ZM6J 2AZ3A 1OY6A 4CH1A 3TQ1A 3MM5A 3B8HA 5CYQB 5KFWA 5ETTA 5L1KA 2O5DA 1QM9A 3JSYA 2WSEC 1U02A 1GX6A 1OY9A 3TQEA 1RSCA 3NNHA 1VQ8S 4MMOA 2BEFA 2HHUA 3MPVA 3KLIA 2HYIB 5AXNA 1RISA 2W4DA 4KV8A 1X31C 4L74A 3K57A 4DR7J 4URSA 4B9UA 1EAYC 1YBAA 1SB6A 4DR5J 1RHMB 3I5AA 3MEGA 3QMQA 3TUZC 4JI2F 2X3DA 1P1TA 1N34F 4MK8A 2QLFB 2UVUA 1TL7A 4QWCA 4K4SA 1JNZB 2G2ZA 2D3UA 1RACB 5CCLA 2MQ8A 1IXKA 3EUNA 5KG2A 1UJ4A 4LF8F 4LSLA 3DRPA 4ZVFA 5CHCB 4ZPAA 1WTBA 1Y5NB 1FJGF 4O4GA 3CCJS 4LF9F 2PD1A 1YQHA 1OPIA 1L3VA 4MKAA 3Q86A 1RT4B 5DGBA 5DS7A 4A8YA 3GE9A 4JBCA 2IJRA 1HL6A 5AE3A 1LEOA 3W5YA 3LF0A 2XY5A 2C3UA 1B0TA 3R97A 1JKHB 1FRJA 3G86A 2B5JB 5KG6A 3GFXA 1FKOB 1WORA 2MSSA 4FYXB 1NJWA 1K73T 1K9MT 4G1QB 2MQNA 4LFBJ 3BQ2A 1MMNA 3J7A1 4G65A 4B3TF 5L39A 2G2OA 3F44A 3OTOF 3MOZA 2B4PA 5KT6A 4WFBQ 1AYEA 2RT3A 9ATCB 2R7TA 1ZAWA 3DLEB 3M2UB 4C8ZA 4Y2IA 4KJIA 2FVRA 1SKSA 3W7BA 5BR8J 4ZITA 2HVDA 2BZ2A 2IBKA 2CNOB 3PX0A 2ZDOA 1VQYA 3KG1A 1S6UA 3A8EA 3RRGA 3Q8PB 1RTZA 3L7UA 4GO7X 2VPYB 2JSXA 1FRLA 4DZDA 1R3NA 1XK8A 3ZZYA 5LL6d 5A76A 2M8HA 3ZNUA 2WOMB 5IV4A 3M7VA 3G87A 2VFTA 4IFVA 4IQXA 2MHEA 2B6AB 3UQSA 3TA2A 3BGLA 2VPXB 1D9FA 3WQPA 4DR3J 3A13A 3R3TA 1F3VA 5HMWA 2PI4A 2VIHA 3ZTRA 4JI8J 2WONA 4JUZA 2PDAA 2CNNB 2DH7A 3M8RA 3RZAA 4ZVRB 3OVBA 2G0CA 5EHHA 2OH2A 4QIWD 5KAKA 5E7OB 1VQMS 4CO0A 1IKWA 1MWYA 2OO4A 3MMCB 1NJXA 4YHHJ 2H4WB 3TEHB 4K7QA 5LJ5Y 3CIMA 2CQPA 1KN6A 1T8EA 4R5PA 1FKPA 2UP1A 4J9MA 2B9EA 2V8PA 1U0SA 1HIYA 3QPIA 1X0FA 2VBZA 3ENWA 3NGRA 4A8MP 2NCKL 3MEEB 2DGQA 2WRMA 3D1QA 3S6EA 2F5GA 4K4UA 3GCXP 3Q83A 3PG9A 2NR0A 1S9GA 1KWMA 3HD2A 1RU2A 3WZ0A 4KE5A 5IM0B 1VQOS 3MR2A 3K8WA 2CQ0A 4LF1A 1OY8A 1R8PA 4DQQA 4DS4A 1T9UA 1TL4A 3SFGA 2EC2A 3NP5A 1NMEB 1UJ5A 2CQIA 2PFDA 1BWEA 4UY85 2C2EA 3HLUA 4P9SA 1ZZNA 5LOQA 2QMUB 2YXLA 3FCVA 3QFHA 1UP1A 3RG6A 2HK3A 1RWPB 3MAAB 2F8HA 2OD6A 4KGZB 3SCIE 2KH9A 1VQ9S 4HHHA 3GV8B 1Z4UA 3IWNC 2KN4A 3QT5A 1KR4A 4OI4A 5HJXA 1HBMA 5ADZA 2CJQA 5J2PA 2ZVSA 4M8LA 3BR8A 2J9DA 4N8OA 5T7LB 2N82B 1XNQF 5DQIA 1S7HA 2OPRB 1F0XA 3NS6A 4R0EA 3TW0A 2XSJA 3G6VA 2ZH3A 1TR0A 4UZCA 3EGZA 1U0HB 2DNMA 4B02A 1YI2S 4CO3A 2CZVC 4M5LA 1SJFA 1VC6A 4UZBA 2KO1A 2AYGA 1SQFA 3CJ8A 5HP1B 2ZH1A 2MQOA 1WHVA 3SQOP 1VJWA 3LGMA 1GXTA 3ILOA 2WBMA 5KFAA 2RF2B 3MGJA 3MM7A 1FRKA 2R7QA 1HARA 3DNCA 3MMBB 5E3QA 4DQRA 2V6AA 4Y2MA 1YSJA 4ECQA 4I56A 2ASLA 1EJ7L 1H0HB 3DOMB 2BOAA 4RW6B 3BGRA 5ETNA 3CWJA 3TEGA 5GADU 1F9HA 1KD1T 4XPCA 4ZCLA 2RAQA 4DL0C 5J2MB 4PZVA 3DHXA 1W2BR 4F0KA 4DPWA 4ECYA 2Y0SD 3R1LA 5KFXA 2K2PA 3BBFA 2FJDB 4DCOB 4A4JA 2ZM6F 2DGTA 3SFUA 2ASDA 1FVSA 3FBBA 2QMWA 2RKIA 4NLUA 1C4CA 4ILMA 2KZZA 1KTQA 3EPGA 2IRYA 4PCQA 1L3TA 2AZ1A 1SCJB 5A6PA 4ERDA 2OI2A 2ZEJA 5D0EA 5K9FA 3WBZA 1HNIA 3I0RA 3SSQA 4EO6A 3KNAA 3FBEA 1FFSB 4JI6J 1F2GA 4LF7J 4USKA 2JFDA 5E3RA 5KFFA 4L6V3 4DR7F 5F8JA 4WPAA 5KFHA 1DBDA 1QSSA 1MG7A 5BJRA 2IAJB 2GAGC 4OYZA 5F9NA 4ICLB 3H8YA 3DM2A 3CC4S 3JSMA 4RWXA 3MPDA 5HSPA 4KKOA 2DR7A 4H4MB 2L9NA 1M5PC 1YRXA 3EXCX 2YWKA 2HLUA 1PG5B 5J2NA 4QIFA 2XWYA 1NSAA 3ADAC 1P27B 2X7IA 2ZE2B 5IT9U 2IHR1 5HROB 3UPFA 1UFLA 2POKA 4DL2A 2J0SD 1REVA 1QLNA 1RUSA 4RNMA 4I7FB 3HDSA 2QRRA 4F36A 2E1CA 2VBWA 3KDOA 1XNRF 3G8SA 3KHGA 1CJVB 1UA1A 4USIA 2ZBCA 3FBCA 2DY9A 3SQGA 1K0VA 1A9NB 5C25A 1H6KX 2DGOA 4USJC 4N77A 3AY0A 4C3MA 1RAHB 3PDNA 3EZ5A 2CNKB 4P2SA 3H90A 1R8BA 1HWUA 2XS7A 2KJVA 2VKZG 4NYOA 1T9XA 3UN5A 4MH8A 4CTAB 1SC1B 3FBFA 2K8GA 4CDIA 2AEMA 4NYPA 3ZZ0A 2CQ1A 5CYJA 2LA4A 3LP0A 2YNIB 1YBUA 5DLFA 3TOQA 3FMBA 5SUHA 4TU9A 3EZOA 5LSLA 2EW9A 3AXMA 3IR6B 3TARA 2BDPA 5F8LA 3A3NB 3BS9A 1Q79A 2BKPA 4J9UE 4B3MJ 4I6WA 3KLIB 4E0DA 4OLOA 3KKFA 2CJBA 4LF2A 1T02A 4KV8B 2QN6B 1ACMB 4JV1A 1FESA 4ECZA 3KXDA 3VAGA 1GMVA 2YKPA 3FSYA 4DFJA 2DXDA 1TKTA 5ETPA 3VHQA 1S0MA 3AD9C 1BC6A 2DO4A 3MEGB 2AU0A 1R89A 4DUTA 2D9OA 1TL7B 2EC0A 1ZA2B 4DR3F 5D6GA 3RAXA 2MZSA 5HJYA 2WVCA 3PM9A 3N6NA 4GVBA 2IDLA 2AP6A 3CD0A 3D66A 2V50A 2OIHA 4LSLB 4MIBA 3DRPB 2PSZA 2LVWA 4O4GB 3P45B 3BM7A 4DXLA 1HPZA 1S77D 1ZS6A 1S79A 3PCOB 4ZCMA 1SJRA 4P7TA 4F26A 4XK8C 3W9HA 3CJ2A 3CCRS 4YHHF 4DBQA 1DTTA 2DD8S 2FLOA 5IC6B
chains in the Genus database with same CATH topology
1B0PA 2BA9A 2MQLA 2ZOFA 4I2PA 2U1AA 1VQSA 2I5JA 3BGUA 3CGIA 1ZTTA 5IFMA 4QIVA 1RT5A 4CIOA 3OFFA 3CCLS 2MZJA 4FPRA 4WFAQ 5FDLA 2W25A 4PXBA 4X4TA 1U1QA 1S76D 5LSOA 2DNPA 2F40A 3C6TB 3DRSA 1Q86T 1KSPA 3HZEA 4IRDA 4JI5F 2XLIA 1URRA 5KFDA 4NCGB 2RF2A 7FD1A 2KM8B 4B9TA 2FHJD 2NPFA 2VASA 2BM1A 4OZ1A 5EGYA 5I42B 3V6HA 2QEXS 1VK8A 5A2QY 3B82A 3MD3A 4I1TA 2FD2A 2P9CA 1RTHB 2I1RA 3ZZTA 3OVAA 1YJWS 2DRAA 3VAKA 2CPIA 1R8CA 1JLCB 3DCAA 3I87A 3AA8A 1RT1A 2EBEA 3T9NA 2FC9A 2A18A 2Q43A 4TQSA 4EU0A 3TANA 7FDRA 1ZH5A 1BQXA 2R2RA 4E98A 2ADBA 2DGUA 4IDKA 4ED2A 4XAKA 3K0JA 4WKRA 4Z37A 4QWBA 1VRTB 2UV8A 3VAHA 1JLBB 4RX6A 3CCSS 1YJNS 4WTYA 2JC0A 4YB6A 3FEZA 1TL3A 1S6QB 2HFOA 2RH3A 3EYZA 3KK3A 4RBUA 1FEEA 3RRHA 2R8GA 1JIHA 1C0UA 1TFWA 4WXOA 5C42B 1RJJA 1X0PA 4M5DA 5EWGA 2HFZA 2KZMA 2RDIA 2Q6CA 1P6TA 5J2MA 2W4CA 3K7RA 4WJBA 4A8SA 1YIJS 3NAIA 4BCAA 2HMIB 2U2FA 3SDEA 1NK7A 1N6QA 4PWDB 1GX5A 3SSSA 2FHJA 4WZMA 4Q8EA 4RBTA 4DV6F 1K8AT 1MSWD 3P96A 2DIUA 1M90T 2N7YA 4X66F 5D3GB 4PXCA 1HD1A 2HWIA 4QWEA 1KQSR 4WKYA 3F41A 3HJFA 4H4KC 2RILA 1U09A 5JVGQ 2Q66A 2M0GB 3HFKA 5EN1A 3EGWB 3DMJB 5CYQA 3DU6A 1SV5A 3HKWA 1YWXA 1MU2A 4RKUC 4GC6A 3T5JA 4PQAA 1WG1A 2PGCA 4NLGA 3PIPQ 3ZC4A 2ROGA 3CCZA 3IAS9 5KFCA 5IWAF 3LAMA 4FN5A 4B9LA 3J7Z5 3I56S 1CSJA 3GQCA 5D4OA 3GR1A 1AFIA 4EBDA 1SKRA 2EI5A 3KLVA 2O01C 4V19J 2HHWA 1G3OA 2E7XA 2J6UA 3IS9A 3OFEA 4FS2A 4DL3A 2CQDA 3L95X 1LKZA 2B9YA 1SUQB 2PE8A 5KFKA 5AE2A 2R7OA 4B3SF 1CPZA 5GAEI 3CD6S 2QYCA 4ZVHA 4ETXA 4DV0F 2EFPA 2RS2A 5IZHA 1YG0A 4BWMA 1U1RA 1JLEA 2LEBA 3KK1A 2OJ3A 4KFBA 1B0VA 1LXJA 1HBOA 1RTIA 2B0GA 2DHXA 2AX1A 1H2VZ 3QGHA 5IXUA 3U02A 1VOMA 5KFSA 2VH7A 1C2PA 3QJPA 3KLHB 3MEDB 3X1LB 2KXHA 4A8FA 3SV3A 2DISA 2YVSA 2HRYA 3CJ0A 4ZVEA 5HBMA 2C28A 2ERRA 4ELVA 4YMEA 2K1RA 4K4VA 2O66A 3SMZA 4ZHRB 1S6OA 5EX3A 2LEPA 1N52B 1G1XA 4EBCA 1TVRA 3C3LA 2XNQA 2RU9A 3VZHA 2WONB 2J76E 4Y6IA 4M1KA 2CPFA 1U25A 2JL9A 1X4HA 3KLEB 4WYWA 4HDGA 1NZAA 1RT3B 1YRTA 4WE1B 2RIJA 2NSCA 4KSEB 3G6XA 4F8RA 2L9DA 2QE5A 2HQIA 2CVIA 2GV1A 2HRUA 4ES3A 1U1OA 5BYSA 1HI0P 3OXFA 4A47A 5FLXY 3RYLA 2HAIA 3W3SA 2M7SA 2XI2A 3B4DA 1ZM4A 1IUJA 1VRUA 3PHEA 1VIXA 1WG5A 3BB5A 1DQ9A 2AJ0A 2ZH6A 4JI1F 1IKWB 4K4ZA 1AROP 5L9XA 1S1WA 4I67A 3TYTA 2DNNA 4AYBD 2YKNA 2VG6B 4PG4A 5L9NA 3NAHA 5KG4A 5IS2A 3CEDA 4URQU 3SZ2A 2RE1A 2RUGA 4IR9A 2XULA 3C6UA 1JJ4A 2X1FA 2QA1A 4BHQA 4Y34A 1TKXA 3RBEA 2AW0A 3RAQA 4IFYB 1RGVA 2EG2A 4USHA 1EETA 1J5OA 2XMTA 2LQ9A 5AJ3F 2DR9A 4N8NA 2R8HA 5HMZA 4R5PB 1FKPB 1IJFB 5U47A 1W25A 4H4OB 3GSDA 1RT4A 4ID5B 2VFUA 3BSOA 3IGNA 4LIRA 4DJBA 4C11B 2DR5A 4NZ0A 2I8EA 2XGPA 2ZH8A 2OSQA 3ISND 3M30A 2CPZA 4KO0A 1ZBTA 1N48A 4QJVA 2F4VF 2R8KA 4R25A 4WCEQ 1M5HA 4PG5A 4MJKA 4PKDB 1U24A 2EG1A 3PKYA 2PMHA 2LQJA 1Y3KA 5GAHI 1YJTA 4DEZA 2R7RA 3P6YC 2DHAA 3M6XA 3KHRA 4QR1A 1OS5A 1JKHA 4QQBA 3QZ7A 2B5JA 4EFAC 3M32A 5A8WB 4OHYA 1URNA 4PG6A 5K8OA 3OSNA 1E6YA 5KTQA 1FKOA 1YJUA 3UFCX 3UDLA 5KFZA 2QFJA 1FRIA 3D1HA 3BJYA 1QSYA 1UFWA 1S9GB 2GFFA 4DR6F 1Y4ZB 1UW4A 2CPDA 4CO5A 5J2QA 2GCFA 2OMLA 3I32A 4HH1A 1FXRA 5F8HA 1HWLA 5T14A 4DQIA 1JLFA 1NHUA 1DTQA 2ZZNA 2KDOA 4G1QA 1Q78A 2MSTA 1LWCB 3QLHB 4FZVA 4KTQA 1HI8A 4XDCA 4J37A 2RNEA 1BY9A 3K5OA 4CTAA 1KNZA 3MOJB 2UXBF 4XIUA 1FKAF 2KYXA 3UD3P 3C46A 4DWIA 5K8PA 1HYSB 2LQ5A 2P9EA 1KRPA 3NL0A 1DHMA 1WWHA 3EX7B 2SXLA 2Z4PA 4ECWA 2R4FA 3I4PA 4ZPTR 5DO2A 2DCLA 4NZ6A 3POTA 1HBNA 3CF5Q 4DR4F 1U1NA 3JYTB 2GMHA 4FS1A 5L38A 3PACA 2VG7A 4LQ9A 3DOKA 3UE2A 4NA2A 4B08A 3DLEA 3HHLC 3TAPA 1S0VA 1NEEA 4A8WA 3M2UA 2KXFA 3CDEA 3HVRA 3OW2R 3OUYB 2Z0GA 2VFVA 1VBYA 2PI5A 4F2RA 3GG1A 1R6YA 4ZLPA 4C9DA 2V8HA 3H2UB 3IA0A 2RD5C 5FJ4A 5KFEA 4I64A 2JJ4D 1QTMA 3TVYA 1Q8LA 2BXJA 3KJVB 2ZFHA 3LQVA 1P9QC 2DTJA 3PRBA 4QWAA 4A8XA 4K4TA 5HMXA 2A1BA 3CCTA 1WF0A 3ZZRA 4NLYA 3SYZA 5KG1A 1T03A 2UU9F 2HGNA 3N01A 2KT3A 4YP3A 5CQGA 1IKVB 4MK9A 3QJJA 2B9WA 2OP5A 2APOA 4YFUA 4WK1A 4BWJA 1HNXF 4N41A 2GO8A 2EFNA 2V8DA 4LIWA 4DR5F 4QWDA 3K5MA 1HNVA 3MXHP 2W9AA 1NK9A 3JSBA 2AGQA 1KOHA 1HBMB 1NU4A 3PXGa 4NOHA 5KOXA 3CUNA 4NXNF 3HHKA 2W4PA 1LW0A 2HNDA 4I6AA 4UY8T 2DBBA 1Y0HA 3FFIB 5JVHQ 2MB0B 4DN0A 2ASJA 2JX2A 4OZ5A 2WOMA 1B7FA 2GIQA 2F7VA 2FDNA 4WFYA 4OI1A 5D8HB 3AA9A 2H9ZA 5AXKA 2B6AA 4MKYA 3R5DA 2XI3A 4YB5A 4EUVA 4DL5A 2WTFA 3RB0A 2K7KA 4FNHA 3V5RA 2NZ4A 1SH2A 2XSJB 1NK4A 4C8MA 2NXUA 4YDXA 3FZBA 3OLAA 3OV7A 4W90B 3LPYA 4RZRA 3CC2S 1QUVA 2RS8A 1SKWA 2RRAA 3CCUS 1RT7A 2LKZA 2IA0A 4J9NA 4NLXA 4RW4A 4UUXA 1UKUA 1JLQB 4YUDA 2NQPA 3FSXA 4X4NA 1KVJA 1LW2A 1ULRA 2JVRA 2I38A 3DGPA 2XMJA 5F8NA 4NLSA 2JFKA 1HWIA 1JXLA 4F4WA 1T3OA 3NCPA 4MIWA 3ZZOA 4F4KA 3CC7S 4FF4A 2FIUA 3PR4A 3DRRB 2CQHA 1GXUA 4RW7B 1IQZA 1C0TB 4DQSA 3DFEA 2JOQA 2J6SA 4KB7A 3G4SS 1J2VA 1PILA 2RQKA 4MTPA 2VONA 4X4OA 1O51A 1QUPA 2X3GA 3MM7B 1FO1A 5A8KA 3MUVP 3IRXB 2GJ2A 2L41A 4TYBA 3CMES 4NYZA 3LH2S 1LQ9A 2PMZD 3DYAA 1QAXA 2ROPA 3NBPA 2IM1A 4X64F 1IBKF 1Y7PA 3GZ7A 2PFFB 4EEYA 1A6LA 1LV5A 5L8RC 5GAEU 4HEA9 2WCXA 5CA5A 2B4OA 1SIZA 2AJ1A 3MMCA 1T94A 4OZJA 2LXFA 1DRZA 3BQ1A 3GWCA 2W7PA 3VQSA 2BRKA 4EWTA 1RDRA 1XN9A 3MPYA 4HT7A 2DNHA 3PY8A 2K3KA 5A0YB 5IT4A 1EP4A 4NX9A 4P6QA 4Q8FA 1IKYA 3BGRB 2E5GA 3EPIA 1BQNB 3UWTA 4U67Q 2FLLA 4CCHA 2HHSA 4TXSA 3UCGA 1CC7A 2JLFA 2RSQA 4PG8A 1Q53A 2XMMA 4LFBF 4ZS6A 1RK8A 1L3KA 5KFTA 4B3RF 4O44B 3CCWA 3R5AA 2GA7A 3PNIA 2EWHA 5I3PA 5I3UB 3ITHB 2FVQA 1OSDA 2KXNB 2M70A 1R7IA 4WFZA 1U45A 4I0WA 3NCRA 5DM7Q 5CYMB 3RBDA 1JLAA 2ZH9A 2ALZA 2UUWA 3FNNA 3PRDA 3G8TA 2KRRA 2VBXA 3CTRA 5I42A 4U6PA 1SL0A 1NKCA 4GKJF 2KTQA 2YNGA 2VPWB 2N4DA 4HT5A 5A8RA 4OX9F 3MMAA 1S9EA 3PV8A 4W92B 3N5FA 2XLJA 3S1TA 3MEEA 2BANB 4O3OA 3H4DA 3HVTB 4FF2A 1N5QA 3RB6A 2QA2A 3IFEA 3RTVA 1Q82T 2DH8A 3IXQA 3M2VB 1SXLA 1HBUB 2PN6A 5B0AA 1TP7A 2DNLA 3MM5B 4NRUA 2IC3A 2OPSB 1VQKS 3LUYA 2KT2A 5BR8F 1HMVB 1VRTA 5IM0A 3SI8A 2MYFA 2OFHX 2DJWA 1S6QA 3DLLQ 2LECA 2QA4G 2C2RA 3VR1A 2KM8C 4WFXA 3M4XA 1JLGB 1C1BA 3T5LA 5C42A 3CJKB 5KFBA 1KEKA 2WK4A 2BR0A 1HNIB 2N4CA 3I0RB 2K3IA 1FK9A 2E5JA 2ZHAA 3DHWC 3RRKA 2BQUA 3FQKA 1XERA 2LMIA 5DGAA 2AYBA 2F8MA 1FE0A 2YKAA 4Y65A 1Q1KA 5KG7A 4B3MF 2C22A 3PR5B 1F5AA 4ZP6A 5F8MA 4B3OB 2M88A 3M8PB 3Q2SC 3CIZA 4HI1A 2ATLA 2ZJPQ 5B0BA 2CPEA 1SI9A 1VQNS 2XMWA 1UVMA 2EK1A 3N9UC 4MK7A 4I6YA 3SCKE 1RT6A 2ZJQQ 1T05B 1DLOA 3N5BA 4KC5A 1M1KT 2BQ3A 1Y5LB 1PO6A 4GKKF 1UEUA 2DHSA 4WU2A 4FF3A 2MQQA 3DLKA 1UVJA 4OL8A 2YWHA 4HDHA 1YRUA 3TA1A 4X2BA 1KQKA 1ROFA 3FZ2A 3RU0A 2VL1A 1X9MA 4F02A 4FVMA 3DM2B 1R0AA 2D3ZA 3JSMB 2YKMB 2LU2A 2EFOA 1X5SA 4EO8A 4I68A 1IQTA 2IJNA 2YKOA 2CIMA 4KKOB 2ZHOA 3LANA 4N56A 2LCWA 2IVMA 5CZXA 5J1EB 4DL6A 3M2RA 1C1CA 4IUFA 5KFQA 1B64A 2J5AA 1V9OA 1RTJB 3I5CA 5KFYA 3GIMA 4IO1A 1P8GA 4OQJA 1S1VB 1PC4A 2A2DA 5J2NB 4HTJA 4F3OA 5HN0A 3J80Y 3RW7A 1ZAVA 2VA3A 5A6WA 4LFAF 3G8QA 3OL7A 4OI6A 4X4PA 5HLFB 1Z2ZA 3IG1A 3F73A 1HQEB 1GT8A 1HHSA 2OPQB 2V4RA 1S6PA 1FF2A 2WBRA 5GVQA 4PQUA 3PO5A 5GAGI 3IR5B 4OHZA 3K5NA 3HHEA 4GC7A 3BO4A 3H2LA 2ZD1B 3MEDA 2YX7A 2BBEA 4JI8F 3LP1A 3CO9A 2E5IA 2ZC3A 1X4FA 3Q8SB 4NLVA 1FCAA 1YHQS 3ENQA 2DPJA 4FXVA 3TRGA 1WG4A 4F25A 5T7LA 1REVB 2BE2A 3B4MA 5E41A 4I4BA 2OPRA 2C3OA 1FRMA 1I1GA 2IM0A 3IRWP 3Q23A 3KLGB 1OO0B 2AJFE 5E5NA 3T1HF 4E8UA 1QAYA 1JXEA 2B43A 2HWHA 3PJWA 1TK5A 4O0IA 2DH9A 1H2UX 1VC0A 1F9FA 4OZLA 5JJBA 1RKJA 4LFCF 2MDAA 2XMKA 4DSKA 4YQWA 4IQMA 3S7RA 3U27A 3VAIA 4DR1F 1UJ6A 4ED0A 2RMLA 3HM9A 3S01A 3KHLA 4M94A 4K5SA 1UWBB 2JVOA 4BBYA 1K1SA 3SQGB 2FPHX 3OL9A 4IR1A 5C25B 3MEKA 1N88A 4ZPWR 1TKDA 4L3NA 3OTCA 5HP1A 1FVQA 2ZUGA 1DAXA 2VG5B 4OHWA 4K50A 4LQ3A 1FEHA 2DNOA 3GB0A 2AYEA 2F3JA 4DL7A 2GGPB 5T41A 4HKQA 2AQ4A 4FXDA 2MJNA 4C8OA 5LMUF 3M6UA 3HXMA 1S1UA 2UUTA 1X8DA 1SIWB 1TKZB 2BM0A 1TAUA 4F4ZA 1QJHA 2DHGA 1GAOA 2YQ3A 3MR5A 1XBWA 1N5YB 1QVFR 3MR3A 3D2WA 1SJ3P 4MIAA 3CJ3A 4ECRA 1LOUA 5HMYA 3W2WA 3MMBA 5KFRA 3T6BA 1BGXT 1T7PA 1FT8A 4TYAA 3TVKA 4ECTA 1XTZA 3KMSA 3PW0A 3DDNA 3GG0A 1DQ8A 4X4SA 1S9FA 4C0HA 4WFNQ 4QU7A 3UNGC 1N5SA 4Q2MA 5C5JA 3KTQA 1S97A 1Y00A 2D1CA 1LWFB 2GQ2A 3CDAA 1QAIA 2COLA 3DOMA 1FTCA 1UETA 2YWGA 3LP0B 4C7QA 1LXNA 4RNOA 3MECA 3QAUA 1VHFA 4F3QA 1V3SA 4TU7A 5IT9Y 1FHTA 4RW6A 3OR1A 1CQMA 1S72S 3MM9A 4H4KA 4HH0A 3UR0A 2B7BB 2D7SA 2FTRA 1OWXA 5B08A 4M95A 4C4WA 4F4XA 4Q0BB 5F8IA 1YVFA 2UXDF 3QIPB 5DDQC 2UVWA 2XS2A 3QGGA 4KBIA 2ZHBA 3GR0A 1S1XA 3E3XA 3QGPA 3PEHA 5DG8A 4Y28C 2GC8A 2LU1A 3HMJG 1XMOF 2G4BA 3K5PA 3G96A 4IKAA 1H7WA 1U26A 1HNZF 3MM8B 4C8KA 1S10A 1HNWF 2G9OA 4PXDA 1SC6A 4EZ9A 3FRZA 4ZP9A 3UI3A 2PC6A 1KLMA 2IM3A 1Q8BA 2EFGA 2EVZA 2IYIA 2VOPA 2PA3A 5KT3A 3NNCA 1HYSA 1N54B 1PSDA 4DFMA 2KB2A 2QSFA 3OHAA 5CH7B 4QR0A 2MKSA 4LVOP 2DK2A 3U1MA 1RAJA 2ZC4A 1X9SA 3HI9A 4YR2A 3KLFA 2R7XA 2HNZA 3QGIA 2GO9A 1FD8A 3TAMB </