2AV5A

Crystal structure of pyrococcus furiosus pop5, an archaeal ribonuclease p protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
KKRYIAFKVISENQFNKDEIKEAIWNACLRTLGELGTAKAKPWLIKFDETTQTGIIRSDRNHVYDVIFSLTLVSDINGNKAIIKVLGVSGTIKRLKRKFLSQFGWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 2
publication title Structure of Pfu Pop5, an archaeal RNase P protein.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 27
structure length 106
sequence length 106
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01900 RNase_P_Rpp14 Rpp14/Pop5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2av5A00
2AV5A 2CZVC 3WZ0A
chains in the Genus database with same CATH superfamily
1R8AA 2A0FB 3PY8A 2KDOA 2NPFA 3P96A 5E2QA 3F0NA 1FDAA 1RYSA 1G3OA 3KG4A 3SBMA 4BHQA 2QMWA 2OSQA 4DV0J 3MGJA 3P8BB 1GMWA 4UY8T 3LPEA 2KZMA 3IMQJ 5BYRA 4B3OB 2DNHA 1FDNA 1VBYA 2C2KB 3ILOA 1SKRA 3OT9A 3BGLA 1ZS6A 4M1KA 1KQFB 4ZVFA 1RT6B 3MAHA 4UY85 3GCXP 2GMHA 3T9ZA 1I94J 5IT0A 5A8KB 3G8SA 4HDGA 2NSBA 4N56A 4ECYA 5I3QA 1D09B 1HBUA 3KHLA 2V69A 3LTOA 5DDPC 2JFKA 2BXJA 1MU2B 2OFGX 2XG8A 5EDWA 1ZM9A 3HHKA 2CPFA 3NKYA 1FJ7A 1V3RA 2QL9B 4WCEQ 3CJRA 2DHXA 3DM2A 3JXOA 4C48A 4WE1B 3DGVA 3TEGA 5AE2A 3MOZA 3EZUA 5H1SV 3D6MB 1W26A 1NKEA 5KFQA 4B3OA 3GJRB 2VG6B 3B4DA 1IBKF 4U8YA 2HWHA 2VPYB 1FKOB 3CJ2A 3PJWA 4ZVOB 3QPIA 1WORA 1RT6A 4RUCA 4ZVPB 4CH0S 2MEWA 1FX2A 1JLQB 2I6WA 5A8KA 3GFXA 2MLXA 2ZJRQ 3BF4A 4JV5F 3OTBA 5DDQC 3W8PA 3AD9C 4Q5VA 5ETNA 5KFDA 3CIZA 3OSNA 3ZTRA 2IPOB 3TX8A 1GMUA 3JQKA 3MPYA 3BDPA 3PJ9A 1S9GB 4GC6A 1S6UA 5CABA 4X4SA 4NE9C 5L9XA 2N82B 2NXUA 2UUCF 3AB2B 1WC6A 1RYRA 4WE1A 5RUBA 2XY6A 3S6EA 3NGRA 4YEAA 3J7ZT 2R2UA 1GK8A 2E1AA 2VG6A 3D1QA 1O8BA 2OMLA 2UVUA 1FKOA 2GIFA 2AKWB 2BR0A 2LU1A 2ZZMA 5EWFA 1NJIT 3OBIA 4J9SA 2XMUA 2RRAA 2JEGA 3J7Z5 1WF1A 2KRBA 1QUPA 2V0NA 3G6VA 2J7KA 2CWKA 1JLQA 3R7SB 2BEFA 4ILLA 3DYAB 2KHCA 2DBBA 4H4KA 3TZXA 3QATA 4NLGA 4KHPF 1DZ5A 2CPZA 3IAM9 2U2FA 3N6MA 3BEGB 1S9GA 5DM7Q 3LANA 3GILA 5KFSA 3W5XA 2ATLA 1MROB 4ICLB 4KV8B 3KMQA 1GEHA 1XN9A 4RNOA 2PDAA 2HZCA 4DX6A 2RHSB 2CA9A 3CE8A 5D6GA 2DB1A 3W9HA 1UZDA 3HM9A 1VC5A 2FLPA 2BABA 1TK0A 5LM7E 1ZTTA 1PBAA 2IAJB 4RW4A 2V63A 4IR9A 1HQUB 3NBPA 2IC3B 2VONA 2LXFA 3BBBA 2JEJA 4RW9B 1PILA 1RXOB 3BBCA 2FY1A 4I2QB 3DYAA 3ZFVA 3QLHA 4LREA 4WU3A 3PYDA 2XZWA 3DDKA 3Q8PB 2BJ3A 3OLAA 5LMUF 3TR5A 2HVHA 2FPHX 1VFJA 5CYQB 2AYGA 2P9EA 5K8PA 3PX0A 1MROA 4ICLA 4KV8A 2JL9A 2BQ3A 3HFKA 1LWCA 4YFUA 1NZAA 2UXDJ 1YJUA 2RU9A 2QEXS 2GVDB 4DV7J 4JV1A 1ZTWA 3OFFA 2OTJS 2AV5A 2E66A 2FLOA 1J27A 2FQQB 1Q8BA 2E5IA 2IAJA 3WHIA 4IQMA 2R3VA 1RA6A 1VQNS 1RWMB 1XNQF 3JSRA 1HQUA 4CNYA 2IC3A 4OL8A 2OSRA 3BH6B 2DNYA 4RW9A 4C97A 8ATCB 2ZBQA 5DETA 3CCWA 2CPEA 1YIJS 4I2QA 4KH0B 2CRLA 3K57A 3HT0A 1P6TA 3L9ZA 4LF9J 5K8OA 1FVSA 1FWPA 3KNGA 5B0BA 1AW0A 2IM0A 3I4PA 3I32A 3BH7B 2RQKA 5CYQA 2Y3YA 2KG0A 2YTCA 3ENAA 5A76A 2AJ0A 2UUAJ 1TVRB 4HYKA 1N52B 2GVDA 4TQRA 4QBUA 2JX2A 4PUOB 3HFZB 4DFKA 5D4PA 3QT5A 5KFUA 2XBPA 4G1PA 3DRPB 3W8GA 4X65J 2YNGB 3RYLA 3OL8A 4I69A 2UXCJ 2CFXA 3BS9A 1FNXH 4OX6A 1N34F 4C4WA 1VR6A 3AJ1A 4DS5A 4XTTA 3T1HJ 3LP0B 3FGVA 2FTRA 2V4QA 3P3DA 2IIHA 4QU6A 1Q5VA 4M8LA 3TOQA 3US5A 3D1HA 5DJBA 3CSKA 2B4PA 1FRMA 4R8UB 4AXIA 5D0EA 5KFLA 3A3OB 4KJIA 1XMQF 4NCGB 1TVRA 3R6LB 2XMJA 3CJ0A 4PUOA 3AAWB 3UN2A 2RQ4A 1BGXT 3H5SA 1PO6A 2ZDPA 2EFVA 1I51B 3DRPA 2OEMA 1GFWB 5LSOA 2YNGA 2YWWA 2ZC4A 3OTCA 5DGBA 2W9CB 1NJXA 1VQLS 1SH0A 4OV6A 2B9XA 1I1GA 1R89A 3THVA 4DFJA 2FJVA 5C2GA 5AXMA 1HFEL 3JSYA 3LP0A 3GIMA 2BRKA 4BDPA 4DV4F 3IR6B 5J1PA 2XNRA 2I0XA 4ZN3A 3O8WA 3QZ7A 4R8UA 2VFVA 3VAMA 2RSQA 1Q8KA 3QRPA 4QWCA 4NCGA 1D1UA 2HQCA 2A2CA 5JMNA 3TUIC 2UV8A 4K4UA 3MR3A 1FO1A 2RRBA 1F0XA 2YX4A 2XWXA 4M5LA 4HT5A 1YK9A 1KR4A 4Q2MA 4X2BA 4WIIA 1OMSA 2OI2A 3I5BA 5HP1A 2V50A 1B7YB 1HA1A 2AJ1A 3GCWP 5AJ3J 1CJTA 3V6DB 1U48A 3CC4S 1WC3A 1PIEA 4ZVSB 5HVGA 4AL7A 1CJKB 2UUCJ 1RHUB 2BKOA 1UAWA 2DNNA 4H4OB 3H98A 1VQ4S 4ID8A 2YWGA 2R8GA 1SQGA 4U7UD 2KM8C 5LJ3Y 4MAKA 3VR1A 1FFWB 3LGMA 2XS7A 5KFMA 4IR1A 3UW1A 3KLFA 1LWFB 2ZKTA 3V81B 2DKOB 2KO1A 2GQQA 1VRTA 4A46A 2A1BA 1XMBA 3TEHB 4LF5J 2IFXA 3IR5B 1Y00A 2G0JA 1SXLA 5GAEI 4D3HA 2CG4A 2W9BA 3B54A 2FVSA 1GXLA 2HZVA 4LSZB 4R0EA 4JUZA 1X31C 1NB7A 4A8SA 1U1QA 3V6DA 4O3PA 2FLLA 2EPIA 1CJKA 2Q3PA 2Z0GA 5D0GA 1FD8A 5K5MA 2BJ9A 4H4OA 3C14B 3Q2SC 1W2IA 3BPSP 2ALZA 1VBKA 5IT9U 2NXNA 4LF8J 4NLPA 3L4BC 2MZJA 2YKPA 5KG4A 2CADA 1LWFA 2GMLA 1N6QB 3V81A 4IFYB 4ZLNA 1QUVA 3R5JB 1FERA 3FCVA 3TA0A 3H7HB 3MUTP 2D3OR 4DLEA 1V5IB 2OKQA 3H42A 2W2PP 1UKUA 3KUGA 1QSYA 2YBVA 5LMUJ 3BB5A 2CAJA 1EQ0A 4O4RA 2RMLA 3ZC4A 3QGGA 3IM8A 3HVAA 1RT2B 4NA1A 2HQIA 4YHHF 4J7CA 1H2UX 4ZPVR 2HKEA 3CPWR 2FUG9 2JVRA 3AXKA 3CMQA 5GAEU 4P74A 4WWSA 2AJQA 2XY7A 4MKVA 3CDBA 2WW8A 3TWZA 3W66A 8AT1B 2WB4A 1XNQJ 3R1HA 1U2RA 4C8MA 3H0PA 1YHQS 2Z2ZA 5CQGA 5ETRA 4IFYA 4AE5A 2GAHC 4ZJLA 2EG1A 1A6LA 1C1CB 4LIWA 2QT7A 2CNOB 1D9AA 4E98A 1YJ7A 1WNEA 1L3UA 4DR3F 4BC7A 2H5JB 5IOLA 2KFZA 2XCPA 3R97A 1VHIA 5CYJA 4WFNQ 2WVEA 4OI6A 2XSFA 3QJJA 3LWMA 1IUJA 4YB1P 1RT2A 1SL1A 4USVA 2HZAA 3RB6A 4WPAA 1T02A 3VAIA 4FKXA 1LWXA 2MQQA 2ALYB 4FBUA 1NNDA 2YPZA 2R7VA 1S6PB 3C2PA 5CA5A 1O6XA 1MSWD 3DHWC 5H9EJ 2J0QD 1TR0A 1N34J 4JI3J 3T1AA 1B3TA 1NAQA 2YKQA 1C1CA 5HANA 2DIUA 1HHTP 3CO0P 3HKWA 1SB6A 2QSFA 3I82A 3KLIA 4J5OA 1JNZB 1X9WA 4PWDB 1SQFA 4OYZA 4FVCA 1RAOA 1Q78A 3R1LA 1TU0B 3QIPA 4YDDB 2ZHAA 3J7A1 2J9EA 3PHEA 1KC8T 2DR6A 1XMQJ 2BJDA 4F0KA 1E6VB 3SCKE 2CJKA 3CDUA 2DNGA 2AP6A 2HHSA 4M5IA 5J2NB 2R7UA 2KKHA 1UA0A 3QSIA 3RRKA 1YZ7A 4MTPA 2AW0A 5C24B 1S6PA 1WKKA 4KO0A 2PMZD 4FNHA 3IBWA 4ZP6A 1HQEB 2VHGA 1RACB 3KTQA 3I0SB 2V8HA 4X64J 3TZYA 2LQBA 3PW0A 4N8OA 2XB2D 1TL1B 3GIKA 5JJBA 2CYYA 4IO1A 4DV4J 3C46A 3MEDB 4A48A 3D66A 4PWDA 2DGSA 1NH7A 4IOAQ 3VQSA 3KKFA 1HBOB 2MY7A 3PO4A 2HS4A 4C3KA 3V2UC 1E6VA 1P27B 2W2OP 2N7CA 5J2NA 3IO1A 2IRYA 2ZDOA 1WTBA 5C24A 2YKMB 4ZHRB 3CD0A 2MY8A 3I9V9 2IJFA 2RKIB 1TMMA 1UEVA 2DT9A 1HQEA 2ZH9A 3UDCA 3FCHA 3I0SA 2W9AA 3QWPA 2O01C 1MN7A 1YWXA 2QGFB 3DHXA 2KYZA 1IJEB 1TL1A 1NJWA 3X3UA 2PSZA 1JX4A 4YR2A 1R6YA 1VQSA 2L9DA 3TA2A 1WC5A 3FSXA 3MEDA 1UFWA 1HL6A 3TQ1A 3RB4A 4ZPTR 2PE8A 3GFZA 3P5BP 4J91A 5CCLA 2MQOA 1HBOA 3UN3A 2RE1A 2HVZA 4OV1A 3BQ2A 4LVNP 3PDNA 4LF2A 2DEIA 2ZITA 3JTPA 1OS5A 1VI7A 1KOOA 1R3NA 2RS2A 2HAFA 2P2CB 3MEEB 1XR6A 4XPCA 2CPXA 4CLUA 4ZHRA 1RCXB 1WJ9A 2R2SA 4MFBA 3D7SB 5BR8F 4FF3A 4W90B 2HRUA 3DU5A 3QO9A 5DGAA 3BSOA 2R2TA 3IS9A 2B3TB 1N0VC 3HHLB 4N76A 3OFGA 1TUVA 1NUEA 1KFDA 3TANA 5LL6d 4DQIA 4I0WA 4L6V3 3R2CJ 2VPXB 2X1AA 2JC1A 4DV3F 1U1MA 2FJWA 4C0OC 3D1OA 1J5EJ 3M6XA 3T5KA 2HEKA 4M5JA 2WHOA 2MKCA 1Q95G 1RB0A 3WX8A 3JQMA 1S76D 3MEGB 1YTYA 1IBCB 3AOCA 3MEEA 2CPJA 4RUBA 2AWZA 1LV5A 2VQFF 3QRRA 1D0EA 1URNA 4X4TA 3PCOB 2NYHA 3N5BA 4NLUA 4RW8B 4DZDA 2MJUA 4CQ1A 2L08A 1WTFA 1HHSA 3H2UB 5EWEA 4PQAA 4DS4A 1Y9OA 2AYBA 2E9RX 2Y8YA 2DPJA 1M1GA 4EYIB 3IGNA 1RLCL 1X4GA 1ZAXA 4NA2A 2WCXA 4FVMA 2I38A 5GMKa 3L09A 4CP5A 4NZ0A 3HFVA 2WBRA 2VC0A 4FPRA 1SUQA 3GZ7A 4YHHJ 5LT5A 4F2RA 3IAS9 5K14B 4DU7A 3I6PA 2XZTB 2UUTA 3NLCA 4RPFA 2HHUA 2HMIB 5B0GA 5IC6B 3CCZA 5D4OA 3IWNC 4F04B 5F9NA 2XGQA 1K1QA 4F2SA 4F50A 4DQQA 3NGUA 2Z2YB 1HNXF 4NX9A 4RW8A 2W4DA 1JLBB 2D1CA 1BQXA 1Y3KA 2MKKA 4WP8A 4W92B 1VLYA 2BJ7A 3PG9A 3MPDA 1VQYA 1SJ4P 4F4WA 3OLBA 2ASJA 4ZITA 3JTNA 4DXLA 4ED5A 2JVOA 4LRCA 1NU4A 2M8DB 1U1OA 1CPZA 1X5TA 2XWYA 1KQSR 1WUUA 1T3NA 2W8LA 5K14A 1REVA 2QV6A 3KXDA 1TKDA 2X1FA 2HMIA 3CDAA 2DGTA 1X7VA 2KJWA 4AUKA 2FHJD 4B9NA 3AJDA 1C4AA 1WHVA 2X1GA 2PC6A 2E44A 3CDWA 3JSMA 4QR0A 2QTWA 3QT8A 2Y1JA 4U95A 2PA8D 1Q8IA 4IOCQ 3GIRA 3MCOA 4I64A 1RAIB 2YH1A 5CD4H 1JLBA 3OTEA 2BACA 2M5YA 4PCQA 4YB7A 4ILRA 1HBNB 5E33A 2HURA 3OVAA 4G1QB 3FKBA 4OHVA 3NNHA 3UN5A 2AQ4A 1T7PA 1VBZA 3BZQA 2Y1IA 2L3MA 3I0RB 5FLXU 4C9DA 2BANB 1EP4B 1G7CB 3PZPA 2F8HA 4OZLA 3BO3A 1SL0A 4KGKA 3AJ2A 4ZMMA 3FBCA 2VICA 5IQQA 4QCLA 4G1IA 3O3LA 3O5TB 1FRLA 2PEBA 1U26A 1X8DA 1W2BR 4IH7A 4RW7B 3F41A 4BWJA 2UVVA 1VCTA 4I4BA 4YB6A 1TKZB 1U1PA 3W2VB 1BY9A 4M63A 3QZ8A 3VALA 4PXDA 4RO0A 1SC4B 1QAXA 3VGTA 2EFOA 2H4YB 3M2UA 4JI0F 1HBNA 2FJXA 5AXKA 2XI2A 2VG5B 3H59A 1YRUA 1HYSB 4G1QA 2HQ3A 2F8EX 4L74A 3CUNA 4B3MJ 3I0RA 2IYGA 2J6TA 2BANA 1EP4A 2I9SA 2EC2A 4FYYB 2HK3A 4BS2A 4Q0BB 4CLTA 2CDRB 4I6WA 2CPDA 2DIVA 1KBRA 3F73A 4DR4J 1X5OA 3PHTA 3N01A 1TQLA 2CPHA 3ILJA 1HD1A 1UZHA 4AYBD 4ZVQB 2LVWA 2IA0A 4CLWA 5IWAJ 4RW7A 4LBIA 4GRSA 4YUDA 3QJPA 1RU1A 3K5PA 3Q0AA 1TKZA 3RR7A 3GYNA 4FYDA 2OP5A 1Q4RA 1ZOTA 5M2PA 3K89A 4FF2A 4ZPDA 1UA1A 4G6VB 2GVZB 5A8WA 3M6WA 4NLRA 4WJBA 3N5FA 2Y8WA 1RT7A 2XYGB 2VG5A 2HBQB 1YBUA 2VBXA 3E01B 2DCUB 4DF4A 3BBFA 1TL5A 3W7BA 2DH9A 1TL3B 3G82B 5L46A 4PWWA 4IH6A 4TVAB 2FHMA 3K17A 2GX8A 4LFAF 2EWHA 1S7HA 3BQ0A 2VBWA 4Q0BA 4FDFA 4DV6F 2LQ8A 3P4UB 3PRBA 2XMKA 5KG0A 4K4XA 1UFLA 2DGVA 2HS0A 5DLFA 5BR8J 3M2RA 4OHXA 4NXMJ 1DTQB 3FBFA 3FBEA 4LF7J 3DC2A 2FY8A 2CIMA 2ZJQQ 5HN0A 1HWKA 2BE9B 1SC6A 1T9YA 1U47A 3EWGA 2GVZA 3R7NB 2GW8A 1VBXA 4B9UA 4OX7A 2H3EB 4H4KC 2GFFA 4K5RA 1TL3A 4N77A 3G82A 4PAAA 2R7XA 5HMXA 4DV3J 1YRXA 2ZNYA 1U02A 3NOCA 1G2EA 1S10A 2GO8A 4J9NA 2UVWA 4URQU 5JXSA 1S9FA 4LT6A 2VQFJ 2IRXA 4Q43A 4ZS6A 2D9OA 2XMVA 4U67Q 5CHCB 1DTQA 5ETTA 4MIBA 4DPYA 4B9SA 3TAMA 1E6YB 1T11A 4X84A 1R27B 2ZE2B 4ETZA 2WW4A 3KK2A 3L3CA 2NUUG 2DRAA 3HHDA 4DOZA 5KG6A 2C28A 4JI8J 3TA1A 1WACA 2WVDA 4RKUC 4AD6A 4ETXA 3IRWP 1HW9A 2NLWA 5J1NA 4JOUA 1T0TV 4FNIA 4QYZK 3TAPA 3KUHA 2C3YA 5KFRA 3OPKA 3RBZA 4JI6F 1MW7A 4P71A 5HO4A 3BDEA 3H4BA 1PGZA 5GMEA 3HJFA 2BQUA 4I68A 1S0NA 3FEXB 1HNXJ 2YKAA 5SZTA 3VQTA 1YJWS 2WOMB 1QTMA 1SVDA 2M70A 2YQ3A 5D78A 2BQRA 4KHRA 1TELA 3SSRA 1DQ9A 4OYMA 3D28A 2ZM6F 1E6YA 2V2ZA 1S72S 2W1BA 2ZE2A 2G2ZA 2M7SA 1RK8A 1V9OA 3K7RA 4F36A 3DRYA 4KGXB 2OPRB 1AA1B 4Y34A 3J81Y 4F3OA 3R8YA 3CCJS 3A3PB 3DKDA 1PYTA 4CM0A 4TU7A 1NH8A 1H7XA 3MUMP 1YJNS 1JLGB 4J9QA 4NL5A 3GB0A 3EPIA 2RH3A 3KOAA 3WC2A 1GT8A 2F4VJ 5BXIA 4OYPA 4DR7J 4YDXA 4K4YA 4IQXA 2IMWP 4Y2KA 5HJXA 4WXWA 5A2QY 1PYOB 2RF2B 2MQNA 1AZSB 4NWBA 4FF4A 4M5MA 2QYGA 4X66F 4K4WA 3QAUA 5E41A 1NSKL 1LWEA 1CC8A 2VJVA 2JEFA 3HMJG 4IKAA 1ZZNA 4WKRA 3OTOF 4DX7A 3MUVP 1UWAA 2V68A 4MJKA 1DHMA 2VJUA 4UZCA 4DL5A 3CGIA 1OY8A 1C0UB 2V8PA 2OPRA 2WVFA 1QSSA 2W01A 2J8SA 3I5CA 4ZOSA 2R8KA 1F2HA 3W60A 3LGNA 2GJ2A 3AODA 1F5BA 5C25B 5DQHA 7AT1B 2MXYA 2F3JA 1JLGA 3NS7B 3UD5A 2B7BB 1UJ4A 3B82A 3DMJB 2C3MA 2D3O1 4YY3F 3HD1A 2DCLA 2NUHA 4DL2A 4LBHA 2QFJA 3DLJA 3TRGA 5HLFA 2RF2A 1FRIA 1P1LA 1AZSA 3HI9A 3GQCA 3PJXA 1FKPB 4DEZA 4KTQA 4ELTA 1NMEB 3F56A 5KT7A 1HI0P 1S4EA 4JI0J 1KWMA 3PYFA 2GV1A 3GFYA 3MD1A 1KVKA 3IA0A 3QFWA 1C0UA 1XERA 5F41A 1UJ5A 3O1LA 4OI4A 2O1PA 1SH2A 1HR0F 1FXDA 3A1YG 4C3LA 2PFDA 2FDNA 3M9OB 4MKAA 2JC0A 3U7JA 4DL3A 2GCFA 1S12A 4TLRA 3DMJA 3B8HA 2CQ2A 4Z2XA 2AEFA 2CJXB 4DWIA 3T1YJ 5KFGA 2LECA 1S0VA 3VWSA 3BPDA 2DK2A 3EJMA 1F2GA 3G6XA 3NGKA 3EUNA 4DUZJ 1U7LA 2AJ4A 3K58A 4HH0A 1FKPA 2QA4S 5E3PA 1S1TB 4QR2A 2VUGA 1F3VA 2FHOB 3KJVB 4DUYF 3K59A 2L41A 2E5HA 4HDHA 5KFOA 4OFZA 3G96A 3AB4B 4HLBA 4RBVA 4CO2A 5LSRA 2XM3A 2LQJA 1M5SA 2HHVA 4LFAJ 2GHVC 2UZAA 3FNNA 1VYAA 2KYXA 1EB0A 2ZFHA 1RT3B 3P49B 2OD4A 3EGNA 3W5YA 1KLNA 4CCHA 2AGPA 2MQPA 4L76A 3K8WA 2ZH4A 5HVHA 1RJJA 5ETQA 1S1TA 2R8HA 3C15B 2IY5B 2FYXA 3TZZA 3KJVA 1RWNB 2ZH5A 3FMWA 3FRYA 3RUBL 4DR1F 1VLOA 4M5GA 3OL7A 2Q66A 1R0AA 1FEEA 3C66A 3ZNUA 4DV1F 4HHUA 5C5JA 4ZKAA 1RT4B 4JV0A 2NS1B 4CO1A 3KHGA 5KFXA 2DR9A 1RT3A 1J2VA 1X4BA 4NEZA 2F7VA 2Y9HA 2OFHX 4LSLB 4CM2A 4NYOA 1F9FA 1H72C 4WZMA 2GMJA 3GYGA 2F8MA 2XS2A 3SMZA 2J0WA 2UXBF 3ZTQA 5ETPA 2VOPA 3C15A 3SCJE 3UQSA 2EVZA 4ZP7A 2R2RA 3GJSB 4F0HA 5LMNJ 1U1NA 1M90T 1CJUB 4P2FA 3Q8RB 2XO7A 2B9EA 1DQAA 1KVIA 4PQUB 4O0IA 3NAHA 1OSDA 1CG2A 1H6KX 1HNIB 2EKYA 3MDFA 1SC3B 3MR6A 4OZ5A 5KAKA 4KKOA 4NPOA 5EN1A 4JI6J 1MG7A 1X60A 3MR5A 4PR6A 1YZ6A 2YWFA 4DV0F 3SQGA 2H48B 2VFUA 1EJ7L 1APSA 5KG7A 2H9ZA 2WVBA 1NZ8A 2KJVA 1HWUA 4LSLA 2ZM6J 1NDKA 3J7YU 4RNHA 1RHJB 3M2VB 2C3PA 4USHA 1HWLA 2B8PA 1I94F 1NSPA 2LEPA 3MM7A 3W63A 2HK2A 1FCAA 3R2DJ 2DPIA 1YG0A 1CJUA 1ZM2A 2HFSA 5KG3A 4PQUA 1T9UA 3HZGA 1IKVB 4W4MA 4DL7A 2XY5A 1HNIA 2VFRA 1NPRA 2C2ZB 1RAJA 3JYTB 2Q79A 5GADI 1IR1A 1Y5NB 1ZA1B 3R27A 1QAYA 1DRZA 5ETOA 3CJ8A 3MHYA 3CW2C 4KPCA 4F4XA 2DGQA 1AT1B 1TKXB 4HVZA 4X66J 3TJ8A 3CMES 2FJAB 1WD6A 4ZLPA 3OTOJ 5IS2A 5KG5A 4RU9A 3M2VA 4RNMA 3W61A 1U24A 3CEDA 4C8OA 1YITS 2GQCA 1UVJA 2J9CA 3BV8A 2DR8A 4QU7A 2DITA 1S48A 1WG4A 1LFWA 3QMQA 4IRKA 4OMFG 5KFPA 1TV6B 1NCLA 1IKVA 2FB0A 5KFBA 2RQCA 1NSAA 2NZCA 2VB6A 2HGMA 3QQCD 3JYTA 4GVLA 3N0VA 4E8UA 2E5LF 4C8YA 3CC2S 5DLGA 2AIRB 4HHJA 4DQPA 5ETSA 3TUJC 2BJ1A 1NDLA 5HROB 1VJWA 1TKXA 3RU0A 3GG0A 2CQ3A 2MQLA 4NOHA 3T9NA 1FDBA 1V3SA 3KFWX 3FRZA 2Y1RI 4F7VA 2XULA 3EGVA 3GR1A 1SBRA 5CZVA 4LMZA 1PG5B 2DO0A 1CQMA 2QE5A 4ERDA 2ZUAA 3MEKA 2VODA 3G8QA 4Q8FA 4KT0C 4DDFA 1HR0J 5GAHU 2ZUGA 1CVJA 1QJHA 1SH3A 3GFHA 4NLOA 5LJ5Y 2CQIA 2OD6A 3FDSA 1RQ0A 5L1JA 1URRA 5E3RA 1TV6A 2DNOA 3WC0A 4ECWA 3PEHA 4DU8A 3OFHA 4K8RA 1Z2LA 3BGOP 2K7JA 5L1KA 3DDIA 3E3XA 1I3OB 5HROA 2ADCA 1YDLA 4KH1B 2D3UA 2O67A 4HEA9 2J5AA 2OHDA 4MKYA 2GJIA 2KVIA 1IKXB 4G3IA 3P5TL 1VGYA 1T9WA 1SJFA 4DUYJ 4ZCIA 3DDNA 5DM6Q 2ZEJA 2RD5C 4KFBB 4DSIA 2XNQA 4YMEA 3B78A 3DGPB 3SQOP 2V4JB 3K2YA 2YY3A 1CJVB 3V6JA 1JLFB 1PAUB 2B4UA 4I7FB 1U09A 4C3MA 1S1WB 4QIVA 4HACB 2CQBA 2OUGA 4K50A 3D4JA 4KYZA 2VKRA 2MDAA 2E9ZA 4JI7F 3Q86A 3K5MA 2C3OA 3VZHA 4G65A 5H9FJ 2GA7A 4PG8A 3I9ZA 3TVKA 2BOPA 3ZZRA 4Q7AA 3KUEA 3V4IB 4Z7CA 4OX8A 4TU8A 2KHDA 1IKXA 1S1VB 4DR2F 1HD0A 2P5VA 2HWIA 2IJRA 4KFBA 2V9WA 3DFEA 5JUMA 1UW4A 4DR1J 2BUNA 2CQDA 1RBLA 2EKNA 3DGPA 2BX6A 2M8HA 2XGPA 2V4JA 3BO4A 4EYHB 1JXEA 2OIHA 2B8QA 1CJVA 1M5KC 2R7WA 1JLFA 3P6YC 5M2RA 4DV1J 4I7FA 3RTVA 2HGNA 1S1WA 3QGHA 2C2NA 3JTOA 1LW2B 3FVYA 4HACA 4AL6A 1RABB 2K8GA 1IR2A 2IBOA 1O51A 2C2OB 4EZ6A 1WF2A 3HSGA 2LU2A 3PRDA 3PFOA 4XDDA 2HNDB 2V8GA 1K44A 4ED1A 5ETMA 4EO8A 4ZVHA 2ZOFA 4ATNA 4C0BA 4USIA 2UXBJ 5KFNA 4K4SA 2YNFB 3V4IA 4ZJQA 5B0CA 3PIOQ 2RS8A 1H73A 1S1VA 5DQIA 1RGVA 2IVMA 2WK4A 1N5VA 4NLDA 2HNYB 2K3IA 4OZ1A 3M9NB 4ED2A 1U0HB 2HNZB 4EK2A 3T1HF 3GR0A 1VQPS 1WI6A 4QIFA 3RAMA 2PI5A 3KK3B 1M5OC 2J9DE 2IA6A 2UP1A 4P6QA 5K8MA 4RX6A 2DNQA 1UWBB 4L3KA 1L3KA 2MZRA 2F9DA 2R7TA 4EBDA 3N6LA 2AMCB 1H2TZ 3PO5A 4OZ2A 2WONB 4P9SA 2HNDA 5KFHA 2FZCB 5KT2A 2RB7A 1QD1A 4O3OA 3SSSA 1VRQC 3ADAC 3D3CJ 4PXEA 2MZ1A 3TP2A 3CO9A 3M8PB 1ACMB 2YNFA 2C2DA 1RWUA 3DLHA 2QYCA 3BM7A 2H5EA 2CQCA 4Y2IA 3A12A 3AQPA 5HAOA 1NK0A 3M8WA 3BQ1A 3BYPA 2D69A 3CCQS 1U0HA 2HNZA 3NCPA 3GYXB 2NQPA 2V2KA 1FXRA 5F0WA 2KT5A 3M8ZA 3KK3A 4GC7A 3PXGa 3QWUA 2JWNA 1UWBA 1MLAA 1ZAVA 3I5AA 3HO1A 3KYLA 2IDLA 5FJ4A 5HMZA 4LUBA 3HLUA 4ZP8A 2RDIA 1QE1B 3EMTA 3ZZ0A 4FF1A 3PTWA 4CWBA 3DLLQ 3KWMA 2EK6A 4NRTA 3GWCA 1JNRB 3DLKB 2WONA 2HIYA 4A47A 2KTQA 1U0SA 4F8RA 5JVGQ 2G9OA 2PI4A 1UEUA 2PO4A 2LEAA 4PKDB 4KAIA 2O66A 5E5NA 3M8PA 3R5DA 4YQWA 2BDPA 1A7GE 4F0MA 3MMBB 2G1HA 1DURA 2DRDA 2JLEA 3AXMA 2ZKUA 2GNKA 1MU2A 1JWWA 2BYCA 1SIZA 3OSPA 3WIUA 2MB0B 1W7WA 5AJ3F 5K8NA 4UQTA 2IMOA 2N3OA 1ZPWX 3NGSA 1ULRA 2E5LJ 2GQ2A 2KZZA 1Z2ZA 3ZZZA 1FKAF 3SCIE 4R25A 3LUYA 3BREA 3N4WA 4CT9A 5E7OB 3RAXA 4Y0FA 1QE1A 1BWEA 3FJ2A 2QN6B 2YXLA 1GTHA 2ZZTA 3DLKA 5F8MA 2NYIA 4ZLLA 4XDCA 1FNMA 5I3UB 2YWHA 1SQEA 4CLFA 3WX4A 2R8IA 4ZJOA 3LOUA 4WK3A 1U1RA 4ALZA 4NXNF 1NLKL 2LQ5A 4LF5F 1HNVB 2W2QP 2EI5A 3FEYB 3ENWA 1RBAA 3W64A 2GHPA 3OJSA 1Y0HA 2QX0A 5EWGA 3Q22A 3KG0A 3M9MB 2D74B 4OJ3A 2QLJB 4NZ6A 3UCGA 3FC9A 4QYZJ 2KI2A 1DY3A 3MPWA 3SV3A 2F5GA 5T7LB 4A8XA 4CI0B 3K5NA 2M2BA 4O3QA 2QL5B 2Z4PA 3DXSX 2CZ4A 1KSPA 3LAKA 4LF8F 3ZZOA 4RNNA 2VH7A 3EX7B 1XR7A 1KRPA 5I3UA 4IOBA 2QO3A 1FVQA 4MH8A 1NBEB 4PWUA 1K8AT 5EX0A 1HNWJ 5KT5A 4B9MA 4MYTA 4C8NA 2PMWA 3LF0A 1HNVA 3C6UB 2IBKA 2B5JB 4EUVA 2JLGA 4YB5A 2PN6A 3RJMB 4ZK7M 1IBMF 5B0EA 2V6AA 3H20A 3NGDA 4OJHA 1QM9A 3J80Y 2EBGA 1N33F 1S0MA 4FP9A 2V94A 3OXLA 1KLMB 4J9RA 3PVXA 1A9NB 4JI7J 1U2FA 4ZCMA 5T7LA 3CJKB 2KL8A 2Z2LA 4L73A 1ELOA 4Y2AA 2RIJA 3DI6B 4QIWD 1MWZA 2HWTA 4P72A 3CD7A 1WOSA 2LCWA 1SL2A 5KT3A 1VMBA 4DR2J 1A0OB 4M94A 5FIIA 1RWXB 2FGOA 3IWLA 2OPPB 1Q1KA 3TZWA 3G71S 5KFWA 4EMDA 1OQ6A 3BGFA 2P6TA 2Z8QA 1GX6A 1RWOB 4CLZA 4DX5A 3FZ2A 4X62J 3OL9A 1RAHB 3OW2R 1KLMA 1QDUB 2FC8A 3N28A 3CJKA 2ZH8A 2BE7D 3DI6A 4DSKA 1H38A 5J2MB 2N4DA 4PG5A 3C16B 3CF5Q 4KGZB 3DRXA 5F8LA 1B0PA 4JI3F 3V4MA 2HHPA 1HIYA 3MCSA 1OJ4A 4I2PB 4J37A 2OPPA 3HCXA 4ELVA 1HQ2A 4USMA 4RBTA 1IWAA 3LA0A 2XS5A 3IWXA 4OYIA 5DG8A 4J9LA 5KG2A 1VK8A 3DOMB 1WHYA 1RTDB 2ZJPQ 5A8RB 2HPUA 2NR0A 2HHWA 1CQNA 2ZH2A 1RE1B 4ZCLA 5FDLB 1PBUA 4F4ZA 2LXUA 3IXQA 2H54B 3RAQA 2M4MA 2HBZB 4U8VA 4QW9A 2DXEA 3QT6A 1IKWB 5DRKA 3OJUA 1EQMA 1UVIA 5J2MA 4QWBA 4HL9A 3C16A 5CD4A 4X64F 1O5JA 2WRMA 3CJSA 3IC1A 3RG6A 5IC4B 4HKQA 1Y4ZB 5E3AA 3AFGA 1QAIA 1ICEB 4I2PA 4JYAJ 4E2FB 1F60B 1F5CA 3M8QB 3TO8A 2P8IA 2O3DA 3RW6A 2YNHB 3T41A 1QAJA 2BOAA 1KP6A 1G1XA 1BQMB 3AH6A 2RNEA 3CNQP 3LWLA 2AJFE 1H74A 4Y6IA 4OYWA 2G0IA 4N47A 5M2UA 2WBMA 3OQ2A 1RT5B 3NOGA 3RGIA 3L95X 1YX2A 2QA1A 4C6AA 2IVYA 4OYBA 2HVIA 4XO0A 1IKWA 3NRBA 2XEXA 3LGHA 2QL7B 4DJBA 2MKHA 1IJFB 2ACYA 1N36F 2W9CA 3EDQB 3PNIA 3ILLA 4HT7A 4OZ0A 2CPIA 4ZN1A 2JH3A 2QG9B 2QLXA 1VQKS 2WTFA 3AOBA 3VGUA 1FHTA 2NXCA 1DQ8A 5EX3A 4KR0B 2G0CA 3OUYB 3M8QA 2FHKA 2MQ8A 4WYWA 2CXEA 4UW2A 2YNHA 3O44A 5L1LA 2IHR1 3A4TA 3D6HB 4ECTA 2BE2B 4DSJA 1X5SA 1YJVA 1BQMA 4M5DB 2C1EB 2FZGB 3M32B 2Z30B 4RR5A 1G4CA 4P10A 4CNZA 5J2PB 4DL0C 3CCMS 1RT5A 1FRHA 1GXUA 1VQ6S 5U47A 1VDHA 4CZCA 4KPYA 3ELHA 1TFYA 3CCRS 1NJYA 4NXNJ 2NREA 2CJYB 1NK4A 3K5OA 2HVDA 4ZVTB 3KJNB 1JLEB 2V9KA 3BGUA 2Q43A 3KMSA 4ED7A 2DVIA 3KLEB 4B9TA 3DLEB 3WIVA 3RR8A 4EEYA 2LFVA 3FSYA 1NO8A 4TYBA 2V8DA 3PM9A 1B64A 1FT8A 3N6NA 1O0PA 2ERRA 2JOQA 2YWEA 2BBEA 1KTVA 3CXCR 2BE2A 1JK9B 1T03B 2B9YA 1DFDA 2GS8A 3NWGA 1U25A 4M5DA 2YQ1A 1J5EF 3GV7B 1OWXA 3TAQA 4BWMA 1S1UB 3F44A 3R7BB 1ZPVA 4Q8EA 4H54A 3Q2TC 1RTJB 3UVJB 3RB0A 4JI4J 3MM8B 1S59A 3LW5C 4CLPA 1FD2A 2JHEA 3MMCB 4ZPBA 1C2PA 1JLEA 3S01A 3KLEA 4H4MB 4K2JA 1KKHA 2PT0A 4MYUA 2QRRA 3G2XA 4PG7A 2Z56B 1IBMJ 4N41A 3AY0A 2VKZG 3SI8A 1N33J 3BGRB 2VU5A 8RUCA 3C14A 1R7IA 4WBFA 5LXRA 2BMBA 3FFIB 2YKNB 2XC9A 3G6YA 1KVJA 3MR2A 1LXNA 1FJGJ 2W7OA 1WEYA 1BC6A 1KTQA 1S1UA 1JQGA 2H4WB 1M0SA 3UVJA 4TY9A 3MM8A 4KSEB 4LRDA 1N6QA 4PYDA 5F8NA 3EDRB 2FVPA 3PFEA 3PR5B 1T05B 4ECUA 3MMCA 4AXJA 1R8BA 1EAYC 4ENOA 5AE1A 3TNVA 3VAKA 2DJWA 3L7OA 2OO4A 3HPOA 4P7TA 3AA8A 4BCAA 3AT1B 5LSLA 3W62A 4FXVA 2R7RA 2N7YA 2Y1LB 5B7WA 3OHAA 3BGRA 2HLUA 4DSEA 1GXTA 5HJYA 4OZ3A 1SJQA 4IO9Q 4MK8A 3Q8VA 3FFIA 2YKNA 3HSZA 4LFCF 3DOLB 3IG1B 3ZO7A 2NXJA 3L7PA 2NPIA 2AEMA 1Q0NA 3OVSA 2V5HG 2K2PA 4L72B 5F9LA 2E1MC 1T95A 3TJ9A 2AU0A 1K0VA 2H5IB 5KFFA 1KD1T 3HX9A 4GO7X 5KFJA 3HP6A 4L75A 4CDIA 2ROGA 5B0FA 3HHLD 4LRAA 3J81U 1T05A 3SSQA 4N7TA 3ULHA 5EGYA 1CULB 3D0IE 3Q83A 2XHCA 1JJHA 3HVWA 2A6OA 3EICA 2FGCA 2ROEA 4OHZA 4EI2A 4DHVA 1KQGB 2HIQA 2FJDB 4NA3A 2QZ8A 1D8ZA 3M05A 1JJ4A 5KG1A 3HSJA 3SFGA 4KE5A 1MNEA 2BW2A 5A2QU 1FDDA 4Q45A 2NZ4A 3DOLA 5BYQA 4DL4A 3IG1A 2VL1A 3OXFA 1IKYB 4YR0A 1YJTA 4YP3A 2MSSA 2E9TA 4I56A 4NASA 3VVUA 1YRTA 2ZWPA 4YR3A 3HJVA 1H3DA 2ZBRA 1CC7A 2BVZA 3KDNA 3LP2B 1MWQA 3H8YA 1CLFA 1HNZF 4LQ9A 1FWKA 1OSCA 1MMNA 1UMJA 3Q8YA 3Q23A 1VC6A 2Q1LA 2W4CA 1R43A 2DGUA 4Y2MA 4B3MF 3MXHP 2E1CA 1I6JA 3GONA 1RU2A 4FPIA 2CWXA 3M7VA 2DH8A 2HFVA 4DR4F 5GVQA 2F1FA 1IKYA 2ZHBA 3WQPA 1FJEB 3B4MA 3DM2B 1BXNA 3U1MA 1N36J 2QJ3A 3UFCX 4K4TA 5IWAF 1AROP 2YWKA 3VGVA 3T19A 4TN2A 1UFKA 3LP2A 4IRDA 1U49A 2DNZA 1HWIA 3JB9k 3D3BJ 2ZH1A 2HG4A 1Q79A 5AXLA 5IQ6A 2EFNA 3M4XA 2DH7A 1D9DA 3RBEA 1KS2A 4WTOB 1S97A 1WOPA 3FUYA 2EEYA 3HF5A 1RWWB 1LQ9A 4TKTA 1D3WA 2FD2A 1ITPA 1NDCA 4K7QA 1M5VC 2HRYA 2YKMA 4P2XA 4QWAA 3W3SA 2RKIA 2R7QA 2VF3A 4NXMF 3GU0A 2VQEF 2K06A 3IBFB 4LF7F 4K4ZA 3ZNJ1 1ZZFA 5HQ8A 3GTYX 3DOKB 1SI9A 4JI1J 2MJNA 1RHMB 2X1BA 2F9JA 4LQ3A 3H90A 4CLLA 3QGIA 4WP9A 1U8SA 1Y10A 4LR7A 1QTNB 4CO4A 5B09A 1GQEA 4LIRA 2HGLA 2DHAA 3RB3A 2RUSA 4B3SJ 2JSXA 3TVYA 4Y00A 2PMHA 1VRUB 4HHHA 4P2SA 2EC0A 4X4PA 3ICLA 1XR5A 3Q89A 5F8HA 2CQGA 2A10A 2MPUA 2U1AA 4C8ZA 4IDKB 3SYZA 1SCJB 3X1LB 2XZDB 1U8WA 3M30B 3HZEA 2HHTA 3EZOA 2CNNB 3BJYA 2NCKL 4DSFA 3UDLA 3HHLA 2H1YA 4RW4B 3DOKA 2PGCA 4OX9J 3NBPB 2R4FA 4DQRA 2E7XA 1B0VA 1AB8A 4DN9A 4JI8F 3JAMU 3NMAA 2J6SA 4DV5J 4P75A 3VTIA 3QLHB 2RVJA 1S6QB 2OPSB 4ZCKA 2AX1A 3DLGB 3FBBA 1VRUA 4O3RA 4IRCA 3MEGA 5DZ7A 1EX8A 2HBYB 4NEYA 2MTLA 1LWCB 3WZ0A 1FA0A 1IWGA 4PEOA 4IDKA 1Y3JA 3VAFA 3M30A 1EIYB 2LA6A 1WHXA 4WFBQ 4TQSA 3EYZA 3CT9A 1QVGR 5KT6A 1VS3A 4OI0A 2LMIA 4ES2A 4I6AA 3RZAA 3ENQA 3GSDA 2V4RA 3CJ4A 3J7AN 2XQCA 1NKCA 4RUHA 2HAIA 1JXVA 1OPZA 6FDRA 2WAQD 2ZD1B 4LVOP 2DEJA 1VC0A 1UETA 4LFCJ 2VA2A 1S6QA 2OPSA 2VZ9A 4ZVEA 1W25A 4LRFA 1FXLA 3DXBA 2F4VF 4JI5J 3DLGA 4FYWB 4LRBA 4DR7F 1LFPA 1UVLA 4OYXA 4I6YA 4K0KF 1PAEX 4LF4J 3D2WA 3VAHA 2AT1B 3V6HA 2B51A 5K9FA 2DY9A 3NY0A 3TARA 4Z37A 4IFVB 4DPUA 1S4FA 3C6TB 3NNCA 2MHNA 1Y7PA 1X4HA 3LQVA 5AXNA 2MLZA 3OHBA 2YKOA 1UP1A 4ES3A 2G1DA 1C1BB 3D0HE 2MMYA 5L39A 3JSBA 4AT1B 1NPKA 2ZD1A 3OD2A 3HT3A 2A2DA 2XYHB 3PYEA 4ILMA 2HHHF 3BSNA 2LXIA 3T5HA 2DGXA 2BJ8A 1LEOA 2M3DA 1YJ9S 1XQIA 2IJNA 4EWTA 2HYIB 1RHRB 4OZJA 2UV8G 4C2MA 2X3DA 2APOA 2KT3A 1TK8A 3VAJA 4C8KA 2E7VA 1HNZJ 4IFVA 2UUBF 4PRFA 3C6TA 4FYXB 3SXLA 1QLNA 1XWLA 2H51B 4PYAA 1DAXA 3GE9A 4EZ9A 4ELUA 1MMLA 3UR3C 1C1BA 1TKTB 2I5JB 4PPZA 1HWJA 5F3TA 4MK9A 4HI1A 3ETOA 3KHHA 5THWA 4WK1A 4OJGA 1ZYQA 1B99A 2BZ2A 4NLVA 1IM4A 4I1TA 3UDEA 4EO6A 3MF5A 3T1YF 2HQDA 4P7VA 3M1VB 5B0AA 1X0PA 2CZVC 4UF4A 1S79A 5C2CA 5DG9A 3CCSS 2AX0A 4PG4A 4DUZF 3CTRA 1RWPB 3W2VA 2UUWA 1TAQA 3UI3A 5D8HB 5F3ZA 2BJEA 1UVKA 2QIFA 3DLBA 1WELA 5AE3A 1VQ5S 4A8WA 3CD6S 5KOXA 2J9DA 1HW8A 4CLYA 3ISND 4NMXA 1HYSA 5IXUA 1TKTA 2I5JA 3SFUA 2KG1A 3OR2B 2I1RA 2CJAA 4LR8A 5KOWA 5HP1B 2QLBB 4J9OA 4CH7A 5F8JA 5KT4A 5HSPA 1CJTB 3CJ5A 3D68A 1TP7A 1DLOB 2OPQB 3E2EA 1OYDA 1WF0A 3M1VA 4X4QA 2G2OA 3ENVA 2VQEJ 4X4RA 3BN4A 4B3TF 3B6BA 4KB7A 3KJFB 1R6VA 1IBKJ 1WKJA 2XMWA 2B9WA 4UOCA 2OGUA 2R42A 4WYLA 1PSDA 3KLFB 5DDRC 2M88A 4O3NA 4QIGA 3E01A 1VRTB 2J0SD 3UWTA 2C3UA 7FDRA 3GJTB 3W9JA 1T9XA 1AFIA 4JV5J 3OR2A 2W9BB 2G4BA 2B7CB 3KLVA 4A8MP 4RBUA 3E8OA 3IBCB 3TUZC 4NI2B 4ZIWA 5HQMA 1DLOA 2OPQA 4DQSA 2KFNA 3PRVA 3VVTA 1TMJA 1YSJA 4USUA 4WKYA 4U7UK 4D3GA 1KHVA 3SIPB 4F3MA 4DLGA 1C0TB 5IFMA 1MN9A 3E51A 2MKSA 5KFYA 2FJBB 4P2MA 5CCMA 4EBCA 4LJMA 4DPXA 1BMQB 3VF0B 3ZTSA 4PXBA 3CB4A 4NLWA 2D41A 5LMNF 4MIAA 5D15A 1RAAB 2MLYA 1EARA 4C8LA 1SJ3P 1T8EA 3CCLS 4KHPJ 2SXLA 4GO5X 4OHYA 4URSA 1S6OA 3KK1B 2YVSA 2DR7A 3A3NB 4NI2A 2K7KA 2VFTA 4RWWA 2VC1A 1S9EB 1TZ0A 1RKJA 4ED8A 1I5OB 2K1RB 4B17A 4WIQA 3OFEA 4RWXA 1UTAA 2CJBA 1FRXA 1AFJA 1C0TA 4V19J 1F1BB 3CCUS 4DN0A 4N8NA 3AA9A 2IYIA 1RAEB 3H40A 2CQPA 4WXOA 4PPDA 2V2VA 2AZ1A 2DHGA 1PC4A 3P45B 1RZMA 3AQOA 3W2WB 9RUBA 3EM1A 1WSVA 2Z57B 4FS1A 2W24A 2EFQA 3KK1A 1Q8LA 3JS9A 2EBEA 4XAKA 4K0KJ 1R31A 2J7WA 1GNKA 1JLCB 2IM2A 2L9NA 5KFIA 2WOMA 4LBPA 4USKA 1S9EA 4EGLA 4J9MA 3UNGC 1HARA 2L9WA 9ATCB 1XC9A 2H65B 3TW0A 5ETVA 2E5GA 2K1RA 3TQEA 3KG1A 1JMTA 3W1YC 1JKHB 2M52A 3GV5B 1H0HB 1WDTA 3ETMA 2JNJA 2HFUA 2AGOA 4RJVA 1R8PA 2G13A 3A8IA 3CD5A 2LQ9A 1VHFA 3I87A 1TL4A 3EXYA 1RWKB 4MK7A 5ETKA 3MMAB 3H5YA 2WSCC 2B56A 1V5VA 5HBMB 1K1SA 2YX7A 1OYEA 3W2WA 1P9QC 2W4PA 1J5OB 1HMVB 1WEZA 5LXYA 3KLIB 4ECRA 3SDEB 2HHHJ 2FJEB 2KT2A 3BR9A 3ONQA 5D4NA 2CQ1A 4QWDA 3QIPB 1JLCA 1G6BA 3QT7A 5C42B 2EFGA 1IBLF 1UL3A 3ZTOA 1N54B 4KIAA 4RL1A 3TX0A 4CLKA 4UUXA 3T6JA 3FEZA 4A8YA 3OV7A 3GP9A 1S0OA 4WU2A 2UUBJ 2HQGA 4MT1A 4F4AA 1WHWA 2GZOA 1IVZA 1JKHA 3D6FB 1RISA 4AFFA 4KO0B 3G9CA 2HHQA 1F9HA 3ET6B 4ZPCA 5KFAA 3MMAA 3S7RA 3BO2A 5C25A 1FWLA 5HBMA 2DISA 2VG7B 2BW7A 1CS4B 1J5OA 1HMVA 2E1RA 2OH2A 4O44B 2P6SA 3SDEA 5C7PA 3MD3A 3ZZYA 1Y5LB 2KVQE 4RU2A 3QYYA 2ZVIA 3I55S 2VDHA 2KXHA 2HSEB 4ANCA 2J7UA 5C42A 1RADB 2X3GA 2EFPA 2KXFA 5T14A 3S8SA 1NKBA 5KFKA 2C42A 3MTKA 2ABYA 1S99A 3UCUP 1YBAA 3MCNA 4A8KA 5CXTA 3MCMA 5DO2A 1NHKL 4E0DA 5HL7Q 4CYUB 1RDRA 4P52A 4DPOA 4PG6A 3OL6A 1OY9A 3ET6A 3GG1A 2QLFB 3HVRA 4Y3CA 2Q6BA 1M5HA 1HI8A 2YNIB 3Q8UA 3D6TB 3QFHA 3LO3A 2G2YA 1LNQA 3NAIA 2DNPA 1SKSA 3ITHB 2ACMA 4DF8A 2JJ4D 2VG7A 2A6MA 3V6KA 1FE0A 1CS4A 1Q16B 5A0YB 3FZBA 2B4VA 1X4EA 5LOQA 4O44A 2RQMA 2DXDA 4LF6F 1PJ5A 4DX8H 4HI2A 3Q24A 3QBCA 4KC5A 4B3TJ 2MHEA 4X4OA 2RU3A 2ASDA 3UR0A 2RAQA 1ZAWA 4CH1A 2HRTA 1MWYA 3EXCX 2GC8A 4UUWA 2VFSA 4KBIA 3K5LA 1IQTA 4MFBB 3HKZD 4CYUA 3GV8B 1PCAA 3J7YI 5A6WA 1X9MA 3BKUA 1ROFA 2QMUB 3J80U 2OEJA 2YNIA 3H2VE 1IM6A 3QO9B 1NXIA 2Z2MA 4AQYF 1D8YA 4ECQA 3GPAA 3IS9B 3ITHA 1LW0B 2HFZA 2MZTA 3VV2B 1F5AA 2AZ3A 2BM0A 5A0YA 3R5AA 4QPXA 2Q6CA 2R7OA 1FJCA 1PJ6A 3RBDA 4UOGA 1L3SA 2HW3A 3HD2A 4DUTA 3VZIA 2B0GA 4ED6A 3KLHB 3PV8A 1U4BA 1XNRF 1JJ2R 3DNCA 2JZ5A 1R0CB 4J90A 1YGYA 3HHEA 1NRKA 3MURP 1UPMB 1VQOS 4CO3A 3GMGA 1FTCA 4NLYA 3TVZA 2XSJB 4JB8B 4QYRA 3R9LA 1S5ZA 2VV5A 2ZC3A 1PYSB 1LW0A 4ZP9A 2W7AA 3MR7A 2QFIA 1RT4A 3SEOA 4RLEA 3N79A 2NXEA 1SUQB 1RHQB 4Y2CA 2ASYA 3KLGB 3CDEA 2BKNA 1KEKA 3KLHA 1HLWA 2IRUA 3THPA 4OYAA 2IDEA 1S57A 4B9LA 4DR5F 2VPZB 3CJ3A 1S49A 5DDOC 4HTIA 3GJQB 1T94A 4USWA 2HFNA 3MZIA 4QQBA 3BYRA 3IR7B 4P73A 4PXCA 1N5YB 2AD9A 5J1EB 2QMXA 4J9KA 5T41A 3AD7C 2XSJA 3NS6A 2RDDA 1Q53A 2CPYA 2KB2A 2P9CA 2B6AB 3NWRA 2BRLA 5GAHI 2BKPA 3RRHA 4YN3B 3A13A 4UZBA 2KXNB 1F6TA 2V2QA 4DFPA 4TY8B 5CYMB 1YI2S 1NDPA 3GIIA 3C8YA 4URGA 3RBXA 3KLGA 2W7PA 1REVB 4F4YA 4C7QA 1TFWA 1HPZB 2C2MB 3KDOA 1HHQA 5K20B 1VQ9S 2B43A 1ZETA 3JSMB 4LFBF 2CQ0A 2ROPA 1FF2A 2AJ2A 4A8OA 4OI1A 4ITSA 1NM2A 1N5YA 2JLFA 2ZOMA 3Q8QB 5D3GB 2CNKB 5J1EA 3UCZP 3T3FA 1FE4A 4DR3J 1OPIA 3DRSB 4ECXA 3MAAB 1P8GA 1EKRA 2N4CA 4GKJF 2B6AA 4U6PA 3LAMA 4ECVA 4OI2A 1RT1B 4ES1A 4QOTA 4WFZA 2JDJA 1NK6A 1BLUA 1IBLJ 2WSEC 1Q5YA 4TY8A 5CYMA 2ZOGA 4DR6F 5KFCA 1KFSA 2O5DA 2PEHA 4QZVB 4ZA1A 1WC0A 1RA7A 2DYAA 1VOMA 4F02A 2ADBA 1HPZA 1WG1A 4UT4A 3C19A 3WBZA 1FI4A 2C2RA 3UD3P 2DRBA 2AEJA 4ZPAA 5DG7A 3PX6A 5H9FK 1TK5A 4BC9A 1S1XB 5IV4A 1U1KA 1L5UA 4EBEA 2W2MP 3D5MA 4DV2F 1SV5B 5HVFA 2MSTA 4DG1B 4N5SA 5MAOA 5D3GA 1HBMB 4K2XA 4YOEA 1RI7A 2J0XA 4ECSA 2P9GA 1RKIA 3H25A 3M2UB 1NK9A 3DRSA 4MMOA 3THTA 2GGPB 3R5BA 2A18A 3MAAA 4I67A 1B70B 5D0HA 3H5UA 1YLXA 1GTEA 1ZA2B 1RT1A 1N32F 2XMTA 2YPYA 4OJ1A 1X0FA 5F8GA 3QSYB 4JV2A 1XMOF 4X4UA 1DTTB 3M8YA 3DCAA 3R6GB 2FVQA 4USJC 1KOHA 4DCPB 3MECB 2D9PA 2I2YA 4QW8A 4C98A 1VIOA 1Q82T 5E0OA 2FC9A 1HNWF 2RJZA 2VBZA 2HS3A 1S1XA 1MMDA 3CCTA 3TI0A 3TYTA 3MAQA 4KY3A 1SV5A 1FFSB 4DG1A 4ZVGA 1HBMA 2XLIA 3CWJA 5A8WB 3O6QA 1D9FA 1RT7B 3ZZPA 2PIIA 4DMZA 3MPVA 4Z7YA 2GGPA 1YBTA 5G0RB 2MZSA 4KGMA 4LF6J 1UVMA 1LK5A 3GSIA 2ILZA 5D77A 1UCNA 4RNFA 1YVFA 5DZ6A 3PR4A 2Z58B 5KFZA 2XYPB 2GIRA 2RHQB 2KN4A 4ID5B 4M5HA 4FXWA 1U6FA 1FNOA 1DTTA 4M95A 3MECA 3LPYA 2ZH7A 4ZVRB 3M2RB 2RT3A 1LOUA 3OTDA 1HKAA 1K73T 2YH0A 1ZH5A 3EVOA 4AQYJ 1GMVA 2CQHA 2ATCB 2OAUA 4B9VA 1S77D 3LALA 1FESA 4X62F 2DHSA 5G0RA 4DL6A 4R0JA 4NMLA 5B08A 1N56A 2V67A 2DD8S 4TNOA 2XTJP 3W5ZA 2VOOA 1CBKA 2VPWB 2JFDA 3IRXB 1WEXA 1XNRJ 4TU9A 2JEIA 4FBTA 3MFIA 4UOHA 4TXSA 2RRNA 2KRRA 4ID5A 2WSFC 4V19X 3IGVA 2OEKA 4CLSA 2CJQA 5IT9Y 4IUFA 5B0DA 3NMRA 3BSCA 1U45A 3SZ2A 4WFAQ 4K59A 4C0HA 2QA2A 3TAMB 3O2IA 3A8JA 2OTLS 5IZHA 3HHLC 1F9EB 5L9NA 1Q81T 2MKIA 3KK2B 2UU9F 3HVTB 1XTZA 1X4CA 2DY1A 5IT4A 3G87A 2CKWA 1LW2A 3QGPA 3MM9B 1KQKA 3L7UA 2DNKA 4NLQA 3D67A 4F25A 1KHWA 3D9BA 2HVEA 5F8IA 2KU7A 4JBCA 4QJVA 2QLWA 3IRXA 1FTRA 2M0GB 1SKUB 4DR5J 1EETB 3MMJA 2FIUA 1IN0A 3CIMA 2LP4A 3PACA 1AUDA 4UOFA 3FK4A 1WDDA 2UVRA 3POTB 4OIXA 1SIWB 1H7WA 1JLAB 4Q44A 2HNYA 2FHJA 1VQ7S 2RDJA 4JYAF 4F67A 4MIWA 2PD1A 3IP0A 1RP5A 3BKTA 2AYMA 1AXQA 3NS5A 1SC1B 2C2EA 3HVTA 4XPEA 5E3CA 4HR2A 1R8HA 4M5NA 5F0UA 1B4SA 4MKBA 1ZM3A 5CZXA 3MM9A 1M5PC 1VK3A 4B02A 2CQ4A 1GAOA 5JVHQ 1Q7YT 3CMAS 4DPTA 3NXZA 3PW5A 2F4FA 4IH5A 2HHXA 1EETA 3UNYA 2E7WA 4LFBJ 1K9MT 4CIOA 2ZWOA 3DRRB 4ZLJA 1JXLA 3DU6A 3ISZA 3POTA 4BBYA 1VQ8S 1JLAA 3PIPQ 3PKYA 4NLXA 2C22A 3H5XA 5HQLA 1X9SA 4J9UE 1LWEB 2MKJA 4W98A 4NYZA 1XJWB 1PJ7A 1B7FA 2F40A 5L38A 1IXKA 1Y11A 4CT8A 4GKJJ 1VQMS 2LYVA 4A4JA 1UW9A 1DJ0A 2CNLB 2MZQA 3IFEA 3HDSA 2KM8B 4DR6J 3K0JA 1LK7A 1R8CA 2WVCA 5IM0B 1N8RT 4NLTA 5KFVA 2BV3A 3OR1B 1IR0A 5A6PA 1FX4A 5GAGI 5D4LA 2VBYA 3ILIA 3KJQB 1YKWA 3M8RA 2XCAA 1BD6A 3MMBA 3MOJB 5HLFB 3DRRA 3Q8SB 2XHWA 4DV2J 2XMMA 3FMBA 5L1IA 4OQJA 4R5PB 1BUXA 2XO6A 3VGSA 3V5RA 3EVMA 1N48A 1RCOB 1X4FA 1M1KT 5IV3A 3CCES 5ETLA 4NCBA 4Y28C 5HMYA 3NCRA 1CSJA 3I4HX 3R3TA 2GAGC 2YQ0A 2OJ3A 1WC1A 1V3ZA 3DN9A 1WC4A 2AYEA 1N32J 4IG0B 4JP8A 5IM0A 2LA4A 1XMOJ 1UPPA 5J2QB 4GKKF 3OR1A 5HATA 4JI4F 4X4NA 1SPBP 1X5PA 1TTHB 1XIQA 3HHNB 2W8KA 1WOOA 1P1TA 5G4DA 2OMOA 2EXUA 1NK8A 3HSDA 1T9TA 1TUWA 4O23A 4R5PA 4DBQA 2ZZNA 2POKA 2DXFA 1FRKA 1NPPA 4DI6A 3IN5A 4ZVUB 3JQJA 1RHKB 4M5KA 5GAGU 1C4CA 5SUHA 4NRUA 1XBWA 3T5LA 5KFEA 5CH7B 3U02A 1GH8A 2VA3A 1K47A 3QAEA 1OQ3A 1L3VA 1UVNA 1TL7B 2YX1A 1FJGF 4IG0A 3H4DA 1TUGB 2DTJA 1B0TA 3CCVS 4O3SA 1RAGB 1RUSA 4OLPA 5J2QA 4ZPWR 3CJTA 1PC5A 1QY7A 4L3NA 3PW7A 1RTIB 2W25A 4WTYA 3C6UA 3PX4A 4Y65A 3I96A 4OLOA 2B5JA 3SV4A 5FD1A 3GLJA 3EZ5A 2AGQA 1EHWA 4KHMA 3TJAA 3LP1B 2LEBA 3A8EA 3EGWB 1WI8A 4OHWA 1KDNA 1RLDA 1UEKA 3VHQA 4S0MA 3G6ES 2X51A 2FVCA 3HK2A 3GIJA 4EU0A 2LDYA 1FRJA 1TL7A 1Y5IB 1R0AB 1X4AA 3R5CA 1DARA 1OO0B 2WZ1A 4DV6J 4IYQA 3BSAA 2BM1A 2OELA 3G4SS 2V34A 1RTIA 4OZNA 3H2LA 2VDIA 5I4MA 1Q86T 5EHHA 4KRWA 1ZM4A 1N0UA 4J9VA 4FZVA 3PW2A 6FD1A 3PEJA 3M8SA 2DNMA 5E3QA 3QJLA 1WG5A 3EVWA 2UU9J 2VASA 4V1Ak 1YJRA 2CG8A 5KTQA 2FLNA 4B08A 3LP1A 3HULA 4A8FA 2ZBCA 1WKLA 3OXGA 1N4LA 2CVEA 2GIQA 4KKOB 3SCLE 2EW9A 4WFYA 4DSLA 4U9RA 3QRQA 3VAGA 3JAMY 4F26A 1BWVA 3FQLA 3I56S 3ZZUA 1U1LA 1N5SA 4LR9A 1VJQA 4O0NA 2VIHA 5DQGA 4ED0A 3SQGB 5I42B 4NZ7A 3CULA 2IM3A 4EFAC 2N3LA 2I8EA 3AD8C 3VCDA 2GHWA 1BQNB 3D54A 4TYAA 1WWHA 1SKWA 4NYPA 1RSCA 3QNWB 4B3RF 2CUYA 1CEZA 3MM7B 1GX5A 4JI2F 3R5GA 3DOMA 4ANEA 4RZRA 1RTDA 5A8RA 2KFYA 3K8VA 1U6ZA 3MPUB 2E1PA 5FDLA 3MFHA 1JIHA 2CZ9A 2ZH3A 4DPWA 2WB1D 3EGZA 3NG8A 1EKSA 3LH2S 2NSCA 3RW7A 3M6UA 1EZZB 1YQHA 4DFMA 5I42A 1X4DA 1NK7A 1Z4UA 2DNRA 3MM6B 4WFXA 4QIEA 3KNAA 1BQNA 1ZBTA 2FVRA 4AL5A 2GO9A 3NP5A 4NCAA 2E5JA 2ZH6A 4QR1A 3ZXWA 4YS2A 1NB2A 1BE4A 4UQGA 2GJFA 4FXDA 3ISNC 5CAAA 3MTJA 1FEHA 4BLGA 3FQKA 5KFTA 1NEEA 2R9LA 3CVKA 1M1HA 3A8KA 1NK5A 3S1TA 5FLXY 1RBOB 1R0BG 2J8AA 4KQZA 4USTA 4ECZA 3U27A 1N88A 2FZKB 1NSQA 1TAUA 2BA9A 1SJ1A 2AF6A 2ZHOA 3MM6A 4DCOB 2F63A 4JI1F 4FKYA 4LSNB 2ASLA 3OUYA 4UTGA 3NGTA 1Z1ZA 3D0GE 2EK1A 2K3KA 3C3LA 2ZNZA 3WDOA 3I31A 3UDVA 3ZZTA 1N5TA 2DR5A 1T3OA 2AHOB 3CJQA 3M32A 4B3SF 2Y0SD 3MM5B 5I3PA 5J2PA 1PKUA 4F3QA 1GMWD 4CO5A 1LKZA 4ZIVA 1RWVB 2CJ9A 4GKKJ 1FK9B 1NHVA 1AUSL 5MLCV 1REGX 4ED3A 4OYOA 5BYSA 4YY3J 2XI3A 4XK8C 2F65A 1VIXA 2HFOA 2D3ZA 3AOAA 3UPFA 2M9KA 2EG2A 3FCWA 3W65A 3DLEA 3OVBA 1FFGB 1N5QA 5H9EK 2IM1A 3TUPA 2VD3A 4X4VA 2XMAA 3W9IA 3UO0A 2HBRB 4RUAA 2LKZA 1NJZA 2V8VA 4LSNA 1L3TA 1QVFR 4OX9F 1RTHB 4DCJB 4C11B 1KN6A 4IG3B 5ITHA 3N9UC 4LF1A 3G86A 1XK8A 4FS2A 1T03A 4DV5F 4K4VA 5GADU 2XLJA 3M6VA 3PYGA 3MI7X 2PFFB 3MM5A 1UJ6A 3BR8A 2DGOA 3PW4A 2PA3A 4OI3A 3HXMA 1Q7LB 6AT1B 1JJCB 1FK9A 2MGZB 1RTJA 1K0TA 4QPTA 4WP3A 2KH9A 2RUGA 3KHRA 2OLWA 4XIUA 1AYEA 3EPGA 3IM9A 2QC3A 2CVIA 2ILYA 2X7IA 4J9PA 3U1LA 3ZTPA 2ZVSA 3NL0A 4H4MA 4ANDA 3NNAA 3NEKA 1RTZA 3MWBA 1DBDA 1RTHA 2HQFA 4CO0A 4C11A 4IG3A 1H98A 4CRJA 2B4OA 5D0RA 2J76E 3EE3A 2COLA 5EUHA 5L8RC 4ZDNA 3BN7A 1BHNA 3RRGA 2XLKA 4U96A 3T6BA 1OIAA 3NCQA 2ZBPA 4DZ6A 1XEZA 4JI5F 1SJRA 2MYFA 1S7IA 4A8QA 4PABA 2MGZA 4LF4F 1KNZA 3QIDA 4WF9Q 1P9YA 4GVBB 4U7CA 2UXDF 5GMDA 4QWEA 1QSLA 1U6BA 1F3FA 4RW6B 4O4GB 4KGVB 7FD1A 4DV7F 2J6UA 4TLQA 4ER8A 2A3JA 5HMWA 4K5SA 2ZBIA 5BJRA 4HH1A 4FN5A 5HI7A 2D7SA 1KONA 1V6HA 2RILA 4CTAB 4PZVA 1HI1A 1U2CA 3J81j 3T5JA 2DO4A 1VISA 1H2VZ 4LF9F 3BKFA 4ED4A 2R7SA 1RAFB 3PKMA 2MKYA 3U1NA 2JRSA 4GVBA 3AHPA 2UUAF 2Y0BB 4RW6A 2DHHA 4O4GA 3UD4P 2DGWA 4GMKA 1T9VA 2QA4G 5ADZA 4F4KA 1CULA 1OY6A 2QSWA 1WSRA 2R8JA 3CC7S 1JB0C 1IQZA 2E29A 2L48A 4B3RJ 5HK4A 2CDQA 2LDIA 4X65F 2MQMA 4JI2J 2LLZA 4FYVB 4NLSA 4Q2LA 1NHUA 4CTAA 2UXCF 1LXJA 4HTJA 2HLTA 2DNLA 1HBUB 3FSIA 5DS7A 2W2NP 5AT1B 2IVFB 4WZQA 3UE2A 3G8TA
chains in the Genus database with same CATH topology
4HL9A 1R8AA 1ROFA 3PY8A 2KDOA 2YNIA 3PRBA 3H2VE 4X64F 1O5JA 2WRMA 2XMKA 5KG0A 3QO9B 3IC1A 2NPFA 4K4XA 2Z2MA 3P96A 5E2QA 4AQYF 1UFLA 1D8YA 4HKQA 1Y4ZB 2DGVA 4ECQA 1FDAA 2HS0A 1RYSA 5E3AA 5DLFA 1QAIA 1G3OA 3KG4A 3M2RA 3IS9B 3ITHA 4OHXA 4I2PA 1LW0B 4BHQA 2QMWA 2OSQA 2HFZA 2MZTA 1DTQB 3MGJA 1F5AA 4UY8T 1F60B 2BM0A 1F5CA 5A0YA 2KZMA 3M8QB 3R5AA 3TO8A 4QPXA 5BYRA 4B3OB 3DC2A 2DNHA 2Q6CA 2CIMA 1FDNA 2R7OA 2O3DA 3RW6A 1FJCA 2YNHB 1VBYA 2ZJQQ 5HN0A 3RBDA 1HWKA 1SC6A 1SKRA 1L3SA 1QAJA 2HW3A 3BGLA 4M1KA 1U47A 1G1XA 3VZIA 1KQFB 1BQMB 2B0GA 4ZVFA 4ED6A 3AH6A 2GW8A 3KLHB 1RT6B 3PV8A 1VBXA 2RNEA 1U4BA 4B9UA 3MAHA 3LWLA 2AJFE 4Y6IA 4OX7A 4UY85 1XNRF 1JJ2R 3DNCA 2JZ5A 4N47A 2GMHA 3T9ZA 4H4KC 2WBMA 5M2UA 5IT0A 3OQ2A 5A8KB 3G8SA 1YGYA 2GFFA 4K5RA 4HDGA 3HHEA 1TL3A 4N77A 1RT5B 1NRKA 2R7XA 3MURP 2NSBA 3L95X 5HMXA 4N56A 1YRXA 5I3QA 4ECYA 2QA1A 1VQOS 2IVYA 2ZNYA 4CO3A 1HBUA 3KHLA 2HVIA 5DDPC 4XO0A 1IKWA 3GMGA 1FTCA 2JFKA 2BXJA 3NRBA 2XEXA 1MU2B 1G2EA 2OFGX 4DJBA 2GO8A 1S10A 2MKHA 2XG8A 1IJFB 2ACYA 5EDWA 4J9NA 4NLYA 2UVWA 1ZM9A 1N36F 3HHKA 3TVZA 2W9CA 2CPFA 4URQU 2XSJB 5JXSA 3NKYA 3PNIA 4OZ0A 4HT7A 4QYRA 1S9FA 4LT6A 2CPIA 1FJ7A 1V3RA 2IRXA 2VV5A 4Q43A 4ZS6A 2JH3A 2ZC3A 2D9OA 2QLXA 2XMVA 4WCEQ 1VQKS 4U67Q 2WTFA 2DHXA 3DM2A 1FHTA 1LW0A 4ZP9A 5CHCB 4WE1B 1DTQA 1DQ8A 2W7AA 3MOZA 3EZUA 5EX3A 5AE2A 5H1SV 4KR0B 4MIBA 2G0CA 1RT4A 3SEOA 3OUYB 1NKEA 4B9SA 3M8QA 5KFQA 2FHKA 4B3OA 3TAMA 1E6YB 4X84A 1R27B 4WYWA 4RLEA 2VG6B 2ZE2B 4UW2A 4ETZA 2YNHA 3N79A 3O44A 3B4DA 1IBKF 5L1LA 1SUQB 2HWHA 2IHR1 2VPYB 3KK2A 4ECTA 1FKOB 3L3CA 2BE2B 3CJ2A 4Y2CA 4DSJA 1X5SA 2ASYA 3PJWA 1YJVA 3QPIA 3KLGB 2NUUG 2DRAA 3CDEA 1KEKA 1BQMA 3KLHA 1RT6A 3HHDA 4M5DB 4DOZA 4RUCA 3M32B 2IRUA 5KG6A 3THPA 2C28A 3TA1A 1WACA 4CNZA 4CH0S 4B9LA 4DR5F 2VPZB 3CJ3A 5J2PB 1JLQB 4RKUC 1S49A 4DL0C 5A8KA 3GFXA 5DDOC 3CCMS 4ETXA 4HTIA 1T94A 1RT5A 3IRWP 2ZJRQ 3BF4A 1FRHA 1GXUA 1VQ6S 2HFNA 4JV5F 1HW9A 2NLWA 3OTBA 5J1NA 4JOUA 4FNIA 5DDQC 5U47A 4Q5VA 3TAPA 4CZCA 5KFDA 4KPYA 3CIZA 3MZIA 2C3YA 3OSNA 5KFRA 3OPKA 4QQBA 1TFYA 3IR7B 4PXCA 4JI6F 1N5YB 1MW7A 3CCRS 3TX8A 2AD9A 1NJYA 3MPYA 3BDPA 5J1EB 2QMXA 2NREA 4J9KA 5HO4A 5T41A 1NK4A 3BDEA 3K5OA 3H4BA 1S9GB 4GC6A 1PGZA 1S6UA 3HJFA 2XSJA 3NS6A 4X4SA 2BQUA 4I68A 1Q53A 2CPYA 1JLEB 5L9XA 1S0NA 2V9KA 3BGUA 2Q43A 3KMSA 4ED7A 2N82B 2DVIA 3FEXB 3KLEB 4B9TA 2YKAA 5SZTA 3VQTA 1YJWS 3DLEB 2WOMB 2NXUA 3RR8A 4EEYA 1QTMA 2UUCF 3AB2B 1RYRA 2KB2A 2M70A 2P9CA 2YQ3A 5D78A 2B6AB 4WE1A 2XY6A 2BQRA 3FSYA 1NO8A 4KHRA 4TYBA 2BRLA 2V8DA 3S6EA 3PM9A 3SSRA 1DQ9A 5GAHI 3D28A 2ZM6F 1B64A 4YEAA 3J7ZT 3RRHA 2R2UA 1FT8A 3N6NA 1O0PA 2ERRA 1E6YA 2KXNB 2JOQA 2E1AA 1S72S 2VG6A 2YWEA 2ZE2A 3D1QA 4DFPA 4TY8B 2BBEA 5CYMB 1O8BA 1YI2S 1KTVA 2OMLA 2M7SA 1RK8A 2UVUA 3CXCR 1V9OA 3K7RA 1FKOA 2BE2A 3DRYA 3GIIA 1JK9B 3C8YA 2OPRB 4URGA 1T03B 2BR0A 4Y34A 3KLGA 2W7PA 2B9YA 1REVB 3J81Y 4F3OA 2LU1A 4F4YA 1DFDA 2ZZMA 4C7QA 1TFWA 1HPZB 3NWGA 5EWFA 1U25A 4M5DA 3CCJS 1NJIT 3OBIA 4J9SA 2XMUA 2RRAA 1J5EF 2JEGA 3J7Z5 1WF1A 2KRBA 4TU7A 1QUPA 2V0NA 3GV7B 1VQ9S 1OWXA 3G6VA 2B43A 3TAQA 4BWMA 2J7KA 1NH8A 1H7XA 1S1UB 3F44A 3MUMP 1ZETA 1JLQA 3JSMB 1ZPVA 4Q8EA 4ILLA 4LFBF 1YJNS 3DYAB 4H54A 1JLGB 2KHCA 4J9QA 2DBBA 3Q2TC 4H4KA 4NL5A 3GB0A 1RTJB 2RH3A 2ROPA 2CQ0A 3EPIA 3RB0A 1FF2A 3MM8B 3KOAA 4A8OA 4OI1A 4NLGA 4KHPF 3LW5C 3WC2A 1DZ5A 1GT8A 4ITSA 2CPZA 1N5YA 3IAM9 2JLFA 1FD2A 2U2FA 2ZOMA 3Q8QB 3N6MA 5D3GB 5J1EA 2JHEA 3BEGB 3UCZP 4YDXA 4K4YA 4IQXA 1S9GA 2IMWP 4Y2KA 3MMCB 1FE4A 4ZPBA 3LANA 3T3FA 3GILA 5DM7Q 1C2PA 1OPIA 4WXWA 5KFSA 5A2QY 2ATLA 1JLEA 1MROB 4ICLB 4KV8B 3KMQA 3S01A 1XN9A 2RF2B 2MQNA 4RNOA 3KLEA 3DRSB 2PDAA 4NWBA 4ECXA 2HZCA 4H4MB 4FF4A 3CE8A 5D6GA 1P8GA 4X66F 2DB1A 4K4WA 2N4CA 2PT0A 4MYUA 4GKJF 2B6AA 2QRRA 4U6PA 3QAUA 4PG7A 5E41A 3LAMA 4ECVA 1LWEA 1CC8A 2JEFA 4OI2A 3HM9A 3HMJG 4IKAA 1RT1B 1ZZNA 4WKRA 4ES1A 3OTOF 4QOTA 4WFZA 2JDJA 1VC5A 4N41A 1NK6A 2FLPA 1BLUA 3AY0A 2BABA 2VKZG 3MUVP 3SI8A 2WSEC 4MJKA 1DHMA 1TK0A 3BGRB 4TY8A 5CYMA 1ZTTA 2ZOGA 4DL5A 4DR6F 2IAJB 3CGIA 5KFCA 1KFSA 2O5DA 2PEHA 1C0UB 4QZVB 2OPRA 4RW4A 1QSSA 4ZA1A 1R7IA 1RA7A 3I5CA 4IR9A 1HQUB 1VOMA 4ZOSA 3NBPA 5LXRA 3FFIB 4F02A 2IC3B 2YKNB 2R8KA 2ADBA 1HPZA 2VONA 1WG1A 2XC9A 3G6YA 1KVJA 3MR2A 3LGNA 1LXNA 2LXFA 2W7OA 1WEYA 2JEJA 1BC6A 4RW9B 1KTQA 3WBZA 2GJ2A 1S1UA 2C2RA 1F5BA 5C25B 1PILA 3UD3P 5DQHA 2DRBA 4ZPAA 5DG7A 3PX6A 2MXYA 2FY1A 2F3JA 1TK5A 4I2QB 3DYAA 4BC9A 1JLGA 1S1XB 1M0SA 2B7BB 1UJ4A 1U1KA 3B82A 3DMJB 3ZFVA 1L5UA 4EBEA 4TY9A 3QLHA 3D5MA 3MM8A 2C3MA 4WU3A 4DV2F 2XZWA 4KSEB 1N6QA 1SV5B 4YY3F 3DDKA 3Q8PB 3OLAA 2MSTA 5F8NA 2DCLA 2NUHA 4DL2A 4DG1B 4N5SA 5MAOA 5LMUF 5D3GA 1HBMB 4K2XA 4YOEA 1RI7A 2J0XA 3TR5A 2FVPA 2FPHX 2HVHA 1VFJA 3PFEA 3PR5B 4ECUA 2QFJA 1T05B 3MMCA 5CYQB 1R8BA 3DLJA 2P9EA 4AXJA 4ECSA 5K8PA 2AYGA 3TRGA 2P9GA 3PX0A 1RKIA 3H25A 3M2UB 5AE1A 1MROA 4ICLA 4KV8A 2JL9A 5HLFA 1NK9A 2RF2A 2BQ3A 3TNVA 3VAKA 3DRSA 2DJWA 4MMOA 1FRIA 1P1LA 3HFKA 3THTA 1LWCA 2GGPB 3HI9A 3R5BA 4YFUA 3GQCA 3L7OA 2A18A 1NZAA 3PJXA 4I67A 1FKPB 4DEZA 2OO4A 1YJUA 2RU9A 3HPOA 2QEXS 4KTQA 4ELTA 4P7TA 3H5UA 3AA8A 3F56A 4BCAA 5KT7A 1GTEA 5LSLA 4JV1A 1ZTWA 1RT1A 1HI0P 4FXVA 3OFFA 2R7RA 2OTJS 2N7YA 2AV5A 2E66A 2FLOA 5B7WA 3OHAA 1N32F 2XMTA 1Q8BA 2GV1A 3BGRA 3GFYA 4OJ1A 2E5IA 3MD1A 1X0FA 5F8GA 2HLUA 4DSEA 3IA0A 2IAJA 4IQMA 1GXTA 1RA6A 1C0UA 1VQNS 4JV2A 1XERA 5F41A 1UJ5A 3O1LA 1SJQA 1XNQF 3JSRA 1XMOF 4OI4A 4IO9Q 4MK8A 4X4UA 1HQUA 1DTTB 2O1PA 3FFIA 4CNYA 2IC3A 2YKNA 4LFCF 1SH2A 3DCAA 3DOLB 1HR0F 4USJC 1KOHA 2FVQA 4OL8A 3IG1B 2OSRA 1FXDA 3L7PA 2NPIA 3A1YG 4C3LA 3MECB 2D9PA 2I2YA 2DNYA 4QW8A 4RW9A 4C98A 4C97A 3OVSA 1VIOA 2V5HG 2FDNA 1Q82T 3M9OB 5E0OA 2FC9A 4MKAA 2JC0A 3U7JA 1HNWF 5DETA 3CCWA 2CPEA 2K2PA 2RJZA 4L72B 5F9LA 2VBZA 1YIJS 4DL3A 2E1MC 4I2QA 2HS3A 1S1XA 2GCFA 1T95A 4TLRA 2AU0A 3DMJA 1K0VA 2CRLA 3K57A 3B8HA 2CQ2A 4Z2XA 5KFFA 1MMDA 4DWIA 1KD1T 1P6TA 3CCTA 3TI0A 3HX9A 4GO7X 5KFJA 3HP6A 3TYTA 3MAQA 1SV5A 5K8OA 1FVSA 2ROGA 5KFGA 5B0FA 3HHLD 2LECA 1S0VA 3KNGA 5B0BA 4DG1A 3VWSA 1AW0A 4ZVGA 2IM0A 2DK2A 1HBMA 2XLIA 3I4PA 1F2GA 3I32A 1T05A 3SSQA 2RQKA 5CYQA 3CWJA 3NGKA 3G6XA 5A8WB 3ULHA 5EGYA 3EUNA 3O6QA 1D9FA 1RT7B 3ZZPA 2PIIA 1U7LA 3D0IE 2AJ4A 4DMZA 2KG0A 3MPVA 3K58A 2GGPA 4HH0A 1JJHA 3HVWA 2YTCA 5G0RB 2MZSA 1FKPA 2AJ0A 4KGMA 1TVRB 2QA4S 5E3PA 4HYKA 1N52B 1S1TB 1UVMA 4QR2A 2FGCA 1LK5A 4TQRA 4QBUA 2VUGA 2ROEA 2ILZA 2JX2A 4OHZA 4PUOB 4DHVA 1KQGB 4DFKA 2HIQA 2FJDB 5D77A 4RNFA 2FHOB 3KJVB 4DUYF 1YVFA 5D4PA 3PR4A 3K59A 4NA3A 2L41A 5KFUA 2E5HA 2XBPA 4G1PA 2QZ8A 4HDHA 5KFZA 5KFOA 3DRPB 2GIRA 4OFZA 1D8ZA 3M05A 3G96A 1JJ4A 2YNGB 3RYLA 5KG1A 2KN4A 3OL8A 3AB4B 3SFGA 4HLBA 4ID5B 4KE5A 1MNEA 2BW2A 4FXWA 1U6FA 4I69A 1FNOA 1DTTA 4RBVA 4CO2A 1FDDA 4M95A 4Q45A 2NZ4A 5LSRA 3DOLA 5BYQA 4DL4A 3IG1A 2LQJA 2VL1A 1M5SA 2CFXA 3BS9A 3OXFA 1FNXH 2HHVA 4OX6A 3MECA 1IKYB 1N34F 3LPYA 4YR0A 2ZH7A 1YJTA 4YP3A 2GHVC 4C4WA 2MSSA 2E9TA 4I56A 2UZAA 2RT3A 3M2RB 3AJ1A 3FNNA 4DS5A 1LOUA 3OTDA 2KYXA 1YRTA 3LP0B 4YR3A 3FGVA 1K73T 2FTRA 2ZFHA 2V4QA 1H3DA 2YH0A 1ZH5A 1RT3B 2CQHA 3P3DA 1CC7A 3P49B 2BVZA 2OD4A 4QU6A 3EGNA 3LP2B 4M8LA 2OAUA 3TOQA 4B9VA 3US5A 3D1HA 5DJBA 4CCHA 1KLNA 3H8YA 3CSKA 1CLFA 1HNZF 1S77D 2B4PA 1FRMA 4LQ9A 4R8UB 4AXIA 3LALA 2AGPA 2MQPA 1OSCA 1MMNA 3K8WA 5KFLA 1FESA 1UMJA 4X62F 4KJIA 2DHSA 3Q23A 2ZH4A 1XMQF 5G0RA 4DL6A 4NCGB 4R0JA 1TVRA 4NMLA 5B08A 1RJJA 1VC6A 2XMJA 2Q1LA 1S1TA 1N56A 2W4CA 1R43A 2DGUA 3CJ0A 4Y2MA 2DD8S 4TNOA 4PUOA 3AAWB 2R8HA 4B3MF 2RQ4A 3MXHP 1BGXT 3H5SA 1PO6A 2E1CA 2VOOA 2ZDPA 2EFVA 3KJVA 2VPWB 2JFDA 3IRXB 1I6JA 1WEXA 2ZH5A 3DRPA 4TU9A 2JEIA 4FBTA 3FMWA 3MFIA 3FRYA 4TXSA 5LSOA 4DR1F 2YNGA 2RRNA 2ZC4A 3OTCA 5DGBA 2W9CB 1NJXA 1VQLS 1SH0A 2KRRA 4ID5A 2WSFC 4V19X 3IGVA 2DH8A 3OL7A 2B9XA 4DR4F 1I1GA 5GVQA 1R89A 3THVA 2F1FA 2Q66A 1IKYA 1R0AA 2CJQA 5IT9Y 1FEEA 2ZHBA 4IUFA 4DFJA 5B0DA 1FJEB 3B4MA 3NMRA 3C66A 3DM2B 2FJVA 4DV1F 3BSCA 5AXMA 3U1MA 1U45A 3SZ2A 4WFAQ 4K59A 1HFEL 3JSYA 3UFCX 4C0HA 5IWAF 5C5JA 3LP0A 4ZKAA 1AROP 2QA2A 3GIMA 2YWKA 2BRKA 1RT4B 4JV0A 4BDPA 2NS1B 3TAMB 4CO1A 3KHGA 3O2IA 4DV4F 5KFXA 3IR6B 2DR9A 5J1PA 2OTLS 5IZHA 3HHLC 3T19A 5L9NA 2XNRA 1RT3A 2I0XA 1Q81T 1J2VA 4TN2A 2MKIA 1X4BA 3KK2B 3LP2A 4IRDA 2UU9F 3O8WA 3QZ7A 1U49A 2DNZA 2F7VA 3HVTB 2OFHX 1XTZA 4LSLB 1X4CA 4NYOA 4R8UA 5IT4A 1F9FA 1HWIA 2VFVA 3VAMA 3JB9k 2CKWA 4WZMA 2ZH1A 2GMJA 2HG4A 2RSQA 1Q79A 1LW2A 3QGPA 3MM9B 1KQKA 4QWCA 4NCGA 1D1UA 2F8MA 2XS2A 3SMZA 2DNKA 5AXLA 2J0WA 2UXBF 5IQ6A 4NLQA 2EFNA 3M4XA 4F25A 2DH7A 2A2CA 1KHWA 1D9DA 3TUIC 2UV8A 3RBEA 5F8IA 2VOPA 1KS2A 4K4UA 2KU7A 4JBCA 2EVZA 3SCJE 3UQSA 1S97A 4ZP7A 4QJVA 3MR3A 2R2RA 1FO1A 2QLWA 3IRXA 3HF5A 1FTRA 1U1NA