1EETB

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
423
structure length
399
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
total genus 109
structure length 399
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetB02
2YNFB 3CDEA 1SH0A 1S9GB 4EO6A 1FKOA 3UPFA 4RW6B 3V6DA 2AWZA 2UUTA 1JLQA 1LW2A 3Q8RB 2R2TA 1IKXB 2IBKA 2YNFA 1RT5A 3I5AA 1HNIA 4RW6A 4F4WA 4O4RA 1IKVB 1IKXA 4R0EA 1U09A 2XI3A 4Q0BB 1S1UB 3KLHB 2UUWA 3V6KA 2B5JA 1TVRB 3QGGA 3CWJA 3PW5A 3OL9A 4XO0A 3IRXB 5KT3A 1RAJA 3HVTA 2ILZA 4LQ9A 2YKNA 5J2PA 4IFYB 4RW8B 2BR0A 3DYAB 5CYMB 5KG0A 1IKVA 4PUOB 2E9ZA 3KLHA 5KT4A 3ISNC 3DRPB 4Q8EA 3OLAA 3KLGA 3IRXA 1EETB 5KFBA 3KK1B 3M9OB 4URGA 4NLRA 4YR3A 5CYMA 5KG7A 3TVKA 3DRPA 3DMJB 4YR2A 3OHBA 1IKYA 1EETA 3KK1A 4R8UA 2I1RA 1HNVA 2XWYA 4I7FB 4NLTA 1N4LA 1VRTB 2C22A 1FKPB 4Q45A 4NLQA 4EEYA 2WTFA 4IKAA 4I7FA 4RNMA 4KSEB 4J9OA 4IQXA 4IR9A 3MR3A 2JEGA 2IM2A 2WONB 2YKMA 3DRRB 3QYYA 4RUCA 4J9SA 1WNEA 3KMQA 2IC3B 2HNDB 5DQIA 4O3RA 2RF2A 1JLCA 5KG2A 3GILA 1TQLA 2FVPA 2RKIB 1JLBB 4QPXA 3DRRA 4LQ3A 3MEEB 4KHRA 3JYTA 4I2PB 4MK9A 4EO8A 3MEGA 3HVWA 1EP4A 1TL3B 5C24B 2OPRB 5J1EA 2F8EX 3KK2B 5KFDA 4U6PA 4RW4B 3D28A 1TP7A 1SUQB 1RTDB 1DTTB 2VG6B 3M8PB 3OHAA 1JLBA 2D3ZA 4TQSA 2RDJA 4K4UA 3I5CA 1DTQA 3TQ1A 5C24A 3KK2A 5C25A 2GIQA 1ZTTA 1RTIB 3E01A 4KB7A 1RTDA 2ILYA 2WCXA 4QWEA 1DTTA 2VG6A 3V4IB 3HKWA 5K14A 4DL6A 1LWFB 4K50A 4ZPBA 1OS5A 1J5OB 4ECZA 3BR9A 3KHRA 4B3OA 2B43A 2R8KA 1HMVB 1NHVA 4WYLA 1R0AA 2AX0A 3C6UB 3T5LA 1JLEB 2BRLA 2D3UA 1LWFA 1RT2A 4IR1A 4IRCA 3QO9B 5KG4A 4ED2A 1QE1B 2FJVA 1J5OA 3H5YA 1S9FA 5F8MA 2YNIB 1HMVA 4ZHRA 1C2PA 3G86A 2IM0A 5KFAA 3C6UA 3FQLA 1BQMB 2DPJA 1S1XA 4TY9A 1RA7A 4TN2A 3CJ5A 1QE1A 1XR6A 4WYWA 1GX5A 4WFZA 5J2NA 5KFUA 5KT5A 3G6YA 2ASDA 1N6QB 2YNIA 2WOMA 3GIKA 3QIPA 4YMEA 1S49A 3BQ1A 5D3GA 4K4WA 2ASJA 1S10A 1BQMA 5HROA 2JLEA 4KKOB 3BSNA 4RU9A 5F8NA 4NRUA 1N6QA 3V6HA 3KLFA 4ZMMA 4IH6A 4K4YA 3QZ7A 4WZQA 4X2BA 4WXWA 1C0UA 4KKOA 4ZP7A 5KG6A 3KHGA 4O3SA 2XCAA 4ECXA 3EPIA 1RYRA 4KAIA 1T05B 3DLEB 4ZVGA 1RT4B 5JUMA 4M95A 4NLGA 1S1VB 3BSAA 4Y2CA 2W9AA 4EBCA 2HWHA 1HPZB 4H4OA 3NGDA 1VRUB 1IKWB 4K4ZA 4KFBB 2BQ3A 1T05A 3DLEA 2V4QA 4Q8FA 1RTJA 1C1BB 4ID5B 3JSMB 3BQ0A 4EBDA 2IJNA 3BJYA 1HPZA 3BQ2A 2I5JB 1IKWA 5T14A 1RT1B 3PW2A 4KFBA 4O44B 5KFTA 3G6VA 2JEJA 2HNYB 3DRSB 4URSA 3IG1B 4DEZA 1LWCB 4ID5A 4ECQA 3LP1B 3KHHA 4RW9B 2IAJB 2BE2B 2I5JA 1RT1A 4KV8B 3PR5B 1S9GA 2HNYA 1SV5B 3IG1A 1LWCA 4KO0B 2QE5A 2ZE2B 1ZETA 2W9CB 2FJWA 4NZ0A 4RW9A 3MR2A 1N48A 5HBMB 3N6LA 1TKXB 2R2UA 4KV8A 4K4XA 4ED6A 1DLOB 4G1QB 5CYQB 3PW7A 4MK7A 5HLFB 4MKAA 3LP2B 5EWEA 1S97A 3GIJA 4J9QA 3CJ2A 3MFHA 2W9CA 4ED1A 4Q0BA 1S1UA 2CJQA 5HBMA 1TVRA 2O5DA 4NLOA 3H5SA 5KT2A 3CJ4A 3HHKA 2XI2A 1YVFA 4NLXA 4ZVHA 5DGBA 1HQEB 3MECB 5DG7A 4IFYA 4RW8A 4K4TA 3DYAA 2OPSB 3I0SB 4IFVB 3DOKB 4PUOA 4OL8A 4ZP8A 4NLDA 1T94A 5KFJA 3OL6A 4WZMA 4YR0A 2JEIA 3MECA 2E9RX 4GC6A 5F9NA 1D0EA 4DG1B 1REVB 4QWDA 4XPCA 4MFBB 1T03B 2HNZB 2FJXA 1GX6A 2XCPA 3PZPA 3DMJA 4U7CA 2IJFA 4IG3B 4MH8A 3LALA 5FDLB 4DG1A 4MIBA 4NYZA 2YNHB 5EUHA 2J6SA 4IRKA 4MFBA 2AGQA 2HNZA 3DM2B 3QGHA 3RB4A 1VRTA 3H5UA 2W9BB 1TKZB 2C2EA 1FKPA 2CKWA 3UR0A 4I2QB 5DG8A 1I6JA 2D41A 2UVRA 3DM2A 2OPPB 2HMIB 4RUAA 2IM1A 3CJ0A 2W9BA 1S1WB 2GIRA 3IGNA 1MU2B 4I2QA 3DOLB 2WONA 2ZD1B 2E9TA 2R8IA 3QZ8A 1TV6B 2W8KA 2IC3A 2FVCA 4ECRA 2HNDA 2AX1A 5JXSA 3V6JA 4DL7A 3NAHA 3NMAA 3PVXA 3QLHB 2JC1A 4J9LA 1JX4A 2OH2A 1S1WA 3CIZA 2RKIA 4ZVEA 5KFMA 2ZD1A 5F8GA 3MEEA 4O3PA 4I2PA 1TV6A 3C6TB 4PQUB 5EWGA 1TL3A 4ED8A 2OPRA 3GIMA 4RW4A 1SUQA 4ZPDA 3DLKB 3OSPA 3M8PA 3RBEA 3KLIB 4TQRA 4O3QA 4NLPA 1KHWA 3KK3B 4EBEA 3PW4A 3RB0A 1RTIA 4NLWA 3NL0A 3N6MA 3PHEA 4QWBA 3V4IA 1S6QB 5KFNA 2C28A 3HVAA 4KHMA 4MIAA 4Q44A 4DL2A 3KK3A 1S0NA 3CVKA 4RNFA 5F8IA 4QWAA 3CJ3A 4ED3A 5DLGA 4YP3A 3CDUA 1JKHB 4MKBA 3Q8PB 1JLEA 4IH7A 5DLFA 2AU0A 5DQHA 2VA3A 3M8QB 3QO9A 3KHLA 1S6PB 5KFEA 2J6TA 3MEDB 2W7OA 4WFXA 5EDWA 3EPGA 4HKQA 4IDKB 3GIIA 3QIDA 2R8HA 3GV5B 2FVRA 3T5JA 2RDIA 5HP1B 2GC8A 2IM3A 4ZPAA 4XPEA 2W7PA 3MEDA 3QGIA 3RBDA 4J9NA 3E51A 3T1AA 4LSNB 1C1CB 5J2MB 4FBTA 3DLGB 5HP1A 4O3NA 3NBPB 3BSOA 3RAXA 3RAQA 2V9WA 1FK9B 5KFFA 3H4DA 4F4XA 3RB3A 3IN5A 1C1CA 1Z4UA 2YNGB 4NRTA 3H59A 3DLGA 2VG5B 3NBPA 5C42B 1LWEB 5I3UB 1K1SA 1QUVA 4ECVA 1UWBB 3V81B 4IG0B 4KE5A 1SH2A 2FVQA 3H5XA 4J9MA 2OPQB 1D1UA 1RT4A 3ISND 5KG5A 4EYIB 5L1IA 4JV2A 1S1VA 1LWEA 5I3UA 2FVSA 4IG0A 1VRUA 2IMWP 2IA6A 3IS9B 4IH5A 3T5KA 3CO9A 4Y3CA 3MR6A 1RTHB 2FLLA 1C1BA 2OPQA 3KJVB 4NLYA 3JSMA 4ZP9A 2UVUA 3H40A 1S9EB 5KFOA 5L9XA 1JLAB 4R5PB 3FRZA 4O44A 5F8HA 3DRSA 5KFYA 1QAJA 4Y34A 3KJVA 3VQSA 5KFQA 1IM4A 3LP1A 1KLMB 2IAJA 4RZRA 4K4SA 2BE2A 2WB4A 4R5PA 3GQCA 5KFHA 2AGOA 2UVVA 1FKOB 1JLGB 1MMLA 3KLEB 3V6DB 2QV6A 1SV5A 4J9RA 4KO0A 2ZE2A 4GC7A 1BQNB 1RT5B 2WK4A 1RT7B 4TYAA 1HARA 1XR7A 1HNIB 1TKXA 2BANB 5KFKA 1JLGA 3KLEA 1DLOA 4G1QA 5CYQA 3PW0A 2BQUA 5HLFA 3H4BA 4NCGB 3LP2A 3MTKA 5EWFA 4IRDA 3Q8SB 4ECTA 2B5JB 2WRMA 1BQNA 4JUZA 2AQ4A 1RT7A 5F9LA 4NLUA 4RNOA 2BANA 4F4YA 2FLNA 4JV1A 3HVTB 3CDWA 2YKNB 5J2PB 1LW0B 1HQEA 4NCGA 4RW7B 2XC9A 3I0SA 2OPSA 4IFVA 3I5BA 3DOKA 4LSLB 4ZP6A 3OSNA 2DPIA 3FSIA 2R8JA 5DQGA 2R8GA 1RA6A 3KLGB 1JLFB 2VG7B 2R2SA 3LAKA 3M9MB 1LW0A 1HQUB 4RW7A 4TYBA 2W8LA 1REVA 4LSLA 5F8LA 4RNNA 4ECSA 5KG1A 4ECYA 3LP0B 1T03A 1IKYB 1JLFA 4IOBA 4NLVA 4ZPCA 4JV0A 4R8UB 4J9KA 2VG7A 1QAIA 4EYHB 4ED0A 1HQUA 4QWCA 4IG3A 3KNAA 1HNVB 5FDLA 3H98A 5KFXA 4TY8B 2YNHA 1RDRA 3LP0A 5I42B 5J2QB 3GV8B 3N6NA 1W25A 1TKZA 1N5YB 3M9NB 4NLSA 4TY8A 3TAMB 2V0NA 5I42A 2OPPA 5J2QA 2HMIA 1HYSB 3G6XA 2AGPA 2YKMB 1MU2A 1N5YA 5KFZA 3DOLA 3TAMA 1ZTWA 2HWIA 4TLRA 5KFGA 2RF2B 1JLCB 1HYSA 3QLHA 2XGPA 4K4VA 2BRKA 4FS2A 2EC0A 3NAIA 3JYTB 3T5HA 3MEGB 1EP4B 5J1EB 4J9PA 1T3NA 4FBUA 3DDKA 3C6TA 4PQUA 4ECUA 1NNDA 3RB6A 4H54A 2D7SA 3DLKA 1CSJA 3KLIA 4H4MB 5KFWA 1DTQB 5L1JA 5C25B 4Y2AA 3E01B 3UDLA 1TL1B 2ATLA 3BGRB 1TKTB 5K14B 4M94A 1S6QA 2WHOA 4ZVFA 5KFSA 5DGAA 4H4MA 3SI8A 4ED7A 2VA2A 4G3IA 2ASLA 5C5JA 3FDSA 4QW9A 2UVWA 3OL8A 3KOAA 1TL1A 4B3OB 3BGRA 2ZKUA 1JKHA 1TKTA 3I0RB 1R0AB 4ECWA 3BREA 2XGQA 1RT2B 2JEFA 4WE1B 1S48A 3M8QA 3T19A 1S6PA 3UQSA 2JC0A 4ZHRB 3MR5A 3I0RA 5KFCA 1RT3B 4IDKA 3OLBA 2J6UA 3IGVA 4PWDB 1S1XB 4URQU 4F4ZA 5DG9A 1S1TB 3OL7A 1N56A 4WE1A 5J2NB 4TXSA 3SFUA 2WOMB 4F50A 3H2LA 3QIPB 1JIHA 3D5MA 4DL3A 1RT3A 2BQRA 5D3GB 4RNHA 1S0MA 3FFIB 1SH3A 4PWDA 5HROB 3PR4A 4LSNA 5J2MA 1S1TA 5KFIA 3Q8QB 5L1KA 3MF5A 4QW8A 3LAMA 3KLFB 1FK9A 2V4RA 3FFIA 2HAIA 1C0UB 4DL5A 4YQWA 2YNGA 2C2DA 3GYNA 2VG5A 3SFGA 3NKYA 5C42A 2C2RA 5KT7A 3PJWA 3GV7B 1UWBA 3V81A 3FQKA 3PJXA 1K1QA 4O3OA 1JXLA 5KFVA 1KHVA 1S4FA 2R2RA 3LANA 5F8JA 4H4OB 3EZUA 4WXOA 4WFYA 3DI6B 3ITHB 5KFRA 1RT6B 4DL4A 1C0TB 2B6AB 1S0OA 1RTJB 3IS9A 3ICLA 1NHUA 4ICLB 5L1LA 2FLPA 4O4GB 3KMSA 1RYSA 1RTHA 2ALZA 5KG3A 4KBIA 5KFPA 1S9EA 3DI6A 3ITHA 3BSCA 1RT6A 1JLAA 1C0TA 2B6AA 4Q43A 4FS1A 4ICLA 1XR5A 4HYKA 4O4GA 5KFLA 1JLQB 1LW2B 3KLVA 3MFIA 5KT6A 4MK8A 1KLMA
chains in the Genus database with same CATH superfamily
2A3JA 2LFVA 3GCWP 4TLQA 5HK4A 3H90A 1T8EA 5ETTA 4JI5F 2MLYA 1MROB 3LPYA 3UCUP 4RJVA 1A6LA 3G4SS 1UFWA 3OHBA 4X66J 3D68A 1MROA 2RVJA 2KRBA 1QAYA 2HIQA 4GKKF 2J7UA 5J1NA 2BVZA 1RHRB 1X60A 2YWEA 4J9OA 1OQ6A 2PEBA 1SIZA 2W1BA 1CEZA 2JVRA 4FVCA 1Y11A 1TP7A 4ZCLA 1RTIB 1QJHA 2DCUB 1PBUA 2ZHOA 4F26A 1N8RT 3KHRA 4B3OA 4WYLA 3PTWA 5H9EK 1CC8A 1HA1A 2VQEJ 5F8MA 2LA4A 2JLFA 4DPTA 2XS5A 1QSSA 5E2QA 4DN0A 2XTJP 3CCSS 1XERA 2H5IB 4IH6A 3MOZA 1RWKB 4PXEA 2VKZG 2DH9A 2WVDA 3ZTOA 2Y1LB 4FF1A 2OELA 3UR3C 2CDQA 2IDEA 3JSMB 2C2MB 3GE9A 3BJYA 2KT5A 1T95A 2AP6A 3TUIC 3PW2A 1M5PC 3G6VA 3TEGA 2RJZA 2E29A 2LQ9A 3OR2B 4U67Q 1LV5A 2W9CB 2KFNA 4S0MA 2MMYA 1S97A 4K0KF 5D77A 1TUVA 2W9CA 1TVRA 2XSJB 3JSRA 1KD1T 3MPDA 2CNKB 2XSJA 1LXJA 4GC6A 3H7HB 4FP9A 2FJXA 1GX6A 2H3EB 4IG3B 2ZZNA 5IT0A 3DXBA 2DNRA 5F41A 2C2EA 4I2QB 4A48A 2ZH8A 3PKMA 4I2QA 1SJQA 5D0HA 3QZ8A 1T0TV 1MMNA 3PVXA 2F9JA 3EJMA 1N34J 3BGUA 3GTYX 4X62F 1V5IB 4NWBA 4EU0A 3PHEA 4QWBA 2C28A 4KGKA 3EGWB 4RNFA 3BV8A 2E1RA 5DLGA 2CRLA 1D8ZA 2KYZA 2VODA 2AU0A 4XDDA 2VA3A 2BDPA 1OMSA 2KFYA 4UOHA 2GC8A 4AL6A 3QGIA 3QATA 4OYMA 2V69A 2WSFC 2A6OA 2HFNA 5I3QA 2VG5B 1UPPA 2VFVA 3KG1A 4J9MA 4JV2A 3J7YI 5M2UA 1NB2A 2FLLA 4X4NA 2AMCB 4KGXB 1TMMA 1JLAB 3T9ZA 4O44A 1M90T 4FXDA 5KFYA 5LMUF 3FJ2A 1HARA 1HNIB 5KFKA 2F40A 3EZ5A 3ETOA 4OX8A 4ELTA 2FHJA 1ZAWA 3TVYA 3HVTB 1SQFA 3MI7X 2SXLA 3I5BA 5J1PA 4IO1A 2FGOA 3U1MA 1SQGA 4OZ1A 3RBXA 3M9MB 1QVGR 1B99A 1IKYB 1WKKA 4R8UB 2KL8A 2M7SA 4OYWA 2BW7A 4ELVA 2YNHA 1RDRA 1NJZA 2B4OA 3N6NA 1TKZA 3RJMB 3UN3A 4CO3A 2JRSA 3DLBA 2V2KA 2HMIA 3K89A 2YX7A 1MU2A 2OJ3A 2F65A 4A4JA 2YPZA 4RWXA 1R8AA 4ZKAA 2EFPA 1SJ1A 2HZVA 2OUGA 1S77D 4K7QA 5DGAA 2XZDB 3FDSA 2MKKA 1JKHA 1RUSA 2QL7B 4U95A 2JEFA 2MKSA 2XLKA 3HSGA 5IWAF 2MZTA 1N56A 3J81j 1GXTA 1SQEA 3CMES 1GFWB 4MTPA 2CQ3A 1RWWB 5L1KA 2KH9A 2DNPA 3MMCA 1XK8A 3SSRA 3M2RA 4ED5A 3PJXA 1K1QA 5F0WA 2K8GA 4WXOA 1HWLA 2MKCA 2VF3A 4GO5X 3CDAA 3S1TA 4F3QA 4OIXA 1BD6A 1RT5A 4XIUA 4UF4A 3ELHA 3OL9A 4HVZA 3OTOJ 5B0AA 4LQ9A 3GONA 1SJ4P 3RTVA 2HVEA 3OLAA 3KLGA 3BYPA 4OI0A 4FXWA 1QSLA 1WHWA 4JI3J 2XMUA 3OTCA 4I7FB 2VHGA 4DV6F 3AB2B 4I7FA 3OUYA 3HPOA 1LK5A 2B4VA 4ANDA 2UUCF 4M5GA 4CI0B 2JOQA 3EWGA 4DMZA 4LFAF 3D3BJ 1SL0A 2RDJA 2FUG9 1F60B 3B82A 3AOCA 2YKOA 3W66A 4OYXA 4F67A 4HT7A 2DNMA 3HXMA 1Q7LB 1FVQA 3W5XA 2FJVA 3EGNA 3VGUA 2KKHA 1ITPA 1O8BA 2GQCA 1CS4B 2WVCA 1DRZA 1NZ8A 4WXWA 3OXGA 2L08A 3AAWB 3R5JB 1VRQC 3N5BA 3NGDA 3PX4A 3KG0A 4ZLJA 3SBMA 4DV3J 1ULRA 3T1HJ 2HNYB 2CFXA 2V6AA 4WP3A 1T9WA 5AXKA 2BE2B 4QR1A 1UPMB 2HNYA 1TU0B 2CPHA 4E8UA 2LXFA 4OZ0A 3CCRS 3H5SA 1YVFA 4UUXA 4OX6A 3MECB 2ROPA 3MECA 3BM7A 3VGSA 2DHSA 3JQMA 2ZFHA 3CE8A 3MPWA 1MMDA 2K3IA 1NM2A 3KUHA 3FBFA 3R1LA 4Y65A 1QDUB 2R7WA 4RUAA 3GFZA 3IRWP 4HT5A 3OTDA 3CPWR 2RKIA 2KN4A 4I2PA 3W9HA 3NGUA 4X4VA 4GO7X 3OSPA 2I0XA 4NLPA 2JFKA 3K58A 1S7IA 1YWXA 2W01A 3V4IA 2RD5C 4MIAA 4HDHA 2HQIA 3CVKA 3B4MA 1F6TA 2BACA 4CCHA 5D0RA 2VDIA 2WSCC 2CAJA 4KC5A 4FN5A 4H4KA 4DR7J 2ZOMA 4X66F 1C1CB 2GGPB 2DGQA 2VU5A 1NSQA 1W2BR 3HHLD 1C1CA 2FHJD 5GAEI 1ZS6A 4OMFG 3V81B 3K5PA 1OPIA 3H5XA 1DAXA 3M2UA 4UW2A 1CBKA 4TU7A 2WVEA 3DRSA 4Z7CA 1WKJA 4DF4A 4G1IA 2JJ4D 4DU8A 1YZ7A 3BN7A 1BQNB 1YK9A 3RBEA 2DXEA 4UY85 3DRYA 4JV5J 3MTKA 4DX5A 4ZIVA 3Q8SB 1RWXB 3DDNA 1BQNA 1TK8A 3OFGA 3HHLC 2VQEF 3DC2A 1PYOB 2CNOB 3PYDA 2WW8A 1NK0A 1D9AA 1VQ7S 1H38A 3ILLA 1RE1B 1XMBA 4AYBD 1VGYA 4LMZA 4DX7A 2BXJA 4LF5J 2C1EB 3RGIA 4ES1A 2VOPA 4J9PA 1WHYA 1NNDA 3PFOA 1WI6A 1BXNA 3MM7B 1CSJA 1VI7A 4NZ6A 4PKDB 1EARA 2MTLA 4LF6J 2UVWA 2ZH5A 2Z8QA 1R0AB 3BREA 1Y3JA 2HBZB 1S99A 4FPIA 3T19A 3T1YJ 2J6UA 1U1NA 1WC3A 1C4CA 4KYZA 1T7PA 5D3GB 1SJ3P 3ZC4A 1UCNA 1C0UB 4YQWA 5BYRA 1WC0A 1NPKA 2WAQD 3NLCA 2MQMA 2MQOA 3BSCA 1N34F 2D74B 2AJQA 3M1VA 4EO6A 1IVZA 3BO3A 1IKVB 1O51A 1S1UB 3QGGA 3OQ2A 2V2QA 2BR0A 4RW8B 5D4LA 1IKVA 1RAHB 4NOHA 1AT1B 3D0IE 1NJIT 3RG6A 4AUKA 4QCLA 1OIAA 1YIJS 3BGLA 1IN0A 5A2QU 2OSQA 3HVRA 3T3FA 1HNVA 5T7LB 4NLQA 4B3TJ 3FVYA 5T7LA 5BYSA 1RAAB 5B09A 2AF6A 3IA0A 1TR0A 4EO8A 3MEGA 1TL3B 3OHAA 1N33J 4K4UA 1JJCB 2HZAA 3KWMA 4K8RA 1NEEA 4DOZA 5IS2A 2LQ5A 2BW2A 3US5A 3PEJA 3C6UB 4USTA 5IZHA 1B0TA 3G86A 2Y3YA 1C2PA 3C6UA 3FQLA 1BQMB 1GMUA 1F9HA 2WOMA 1TL7B 3BDEA 4QIFA 2KHDA 1BQMA 3CUNA 1U2RA 1NK9A 5F8NA 1U1MA 2LQBA 4DSKA 1P27B 4EUVA 3DLEB 3I31A 1WF1A 3MUTP 5BYQA 2F3JA 3DLEA 1C1BB 1RAGB 2P9CA 3NGTA 2MKJA 4URSA 3IG1B 1RK8A 4DEZA 4M1KA 3LP1B 2QYCA 2GIFA 3GJQB 4F0KA 3IG1A 2ATCB 1GNKA 3MAAA 2ZM6J 2QLWA 3IO1A 4ED6A 4X65J 1KQSR 3HK2A 3LP2B 3GIJA 5HMXA 4Q0BA 2HHHJ 2O5DA 2M52A 3CJ4A 2N3OA 2KZZA 2HQDA 4MYUA 2OPSB 4NLDA 1N36J 3PIOQ 1JNZB 4DPYA 3ILOA 4DG1B 4RBVA 1E6VA 2BJ9A 1FI4A 2QMXA 1F2HA 4DG1A 4MJKA 2X51A 3H5UA 4DQIA 3GP9A 3UD3P 4KR0B 4USVA 3G6ES 1GT8A 3A3OB 3QLHB 2JC1A 5EX3A 1U0HB 1GXUA 5A8WB 3R7SB 4PQUB 4GKJJ 1U0HA 3M8PA 4PYAA 4FF2A 1K44A 3N6MA 1M5VC 1U1KA 1S0NA 3FGVA 3I4PA 2Y8YA 2BZ2A 4JI6F 3OTOF 2Z2MA 3AXKA 3NG8A 4PABA 5KFEA 4IDKB 2NPFA 3RR8A 2QJ3A 1VC5A 3ILIA 1H72C 5J2MB 4P72A 1BY9A 4JI3F 1TMJA 4BDPA 3RB3A 2YNGB 2Q6CA 3CJKB 1XBWA 1DFDA 2QT7A 5C2GA 3OFEA 2XHWA 3A1YG 3CJKA 2IRXA 5KFOA 4HTIA 4NA3A 4E0DA 2ZOGA 3P3DA 1VCTA 1CJTB 4AXIA 3LUYA 4TYAA 4DR3F 4ZK7M 3H4BA 4WFAQ 2WRMA 4JUZA 3CJTA 4RNOA 4X64F 2VPXB 1LW0B 3LWLA 2DJWA 4L3KA 1JLFB 5CD4H 1LW0A 2DXDA 3F0NA 1REVA 4RNNA 3QNWB 3LP0B 1JLFA 1V3SA 2DRAA 1QTNB 2CYYA 5L39A 4ZVQB 3LP0A 1N5YB 3MM9A 3MPUB 1HBUB 1RWOB 4HR2A 1N5YA 4M8LA 3MMBB 3TZYA 1HBUA 3ZFVA 4WF9Q 3Q89A 1EP4B 4EGLA 3NNHA 2Q66A 5MAOA 2LXIA 3BGRB 3SI8A 4EZ6A 3SIPB 2ASLA 3BGRA 3PX6A 3L3CA 4DPXA 4WWSA 5F3ZA 4ETXA 2XHCA 1S1XB 1FD8A 2WB1D 5HROB 4NA1A 4CZCA 3MF5A 2PMZD 2C2DA 5D78A 5KT7A 4WBFA 4USJC 5B08A 3SSQA 2BJ8A 1FHTA 1ZAVA 3C14A 1TFWA 5B0DA 3OXFA 3PYEA 4WP9A 3HZEA 4I4BA 1VQ6S 3FCHA 3W1YC 2AWZA 4P73A 2MEWA 2HAFA 3CCTA 4LSZB 2XI3A 4CWBA 1YITS 4LRFA 4XO0A 3R2CJ 1KFDA 5GAHU 2EFNA 3G9CA 2I6WA 1IBMJ 2P9GA 3KK1B 2D3OR 1LFPA 4F4AA 3KK1A 2Y0BB 3D54A 3D1HA 3T6BA 2K7KA 4WIQA 2HIYA 2HZCA 2MY7A 4IYQA 1RU1A 1TELA 4V19X 2E5IA 2DNQA 1NUEA 3AJ2A 2N4CA 1X4DA 1HWIA 1Q78A 3W2WB 1UA0A 3HO1A 3CF5Q 3R6GB 3JXOA 4CTAB 2E5HA 4CH0S 3QT6A 3HSDA 1VQOS 3CJRA 2Z0GA 4CTAA 3GG1A 5DJBA 1DTQA 4FNHA 4KRWA 1FX4A 2AYBA 5K14A 3OV7A 4JV5F 2EEYA 1OS5A 3NOGA 3IBFB 2AX0A 5AE2A 1JLEB 3VVTA 4AL7A 1R6YA 4I68A 3T9NA 2VBXA 4DV0F 3C15B 3D4JA 3QMQA 4HACB 5CZXA 1IUJA 4NRUA 3V6HA 4OZLA 4HACA 3CC7S 1NLKL 3AHPA 2WBRA 4O3SA 3KKFA 7FDRA 2BJ7A 3H42A 4ECXA 1Q82T 4DR6J 1T05B 4KGZB 2V8VA 1XNRJ 3VQTA 3B54A 2M5YA 4WFNQ 1T05A 1P9YA 2RILA 2IJNA 4B08A 2B9XA 2B7CB 1WC1A 2FJBB 3FCWA 4KO0B 4NZ0A 2DH7A 3MR2A 4RR5A 3TP2A 2IJRA 4LF6F 1DLOB 5CYQB 2FJEB 3CCLS 3TAPA 1KQGB 3HHKA 5E3CA 4ZVHA 2NQPA 3T1YF 4OL8A 2VKRA 2VJUA 2DISA 4WZMA 3AD8C 1BGXT 5CZVA 3BDPA 3PZPA 4X4OA 1P1TA 4FYVB 4MIBA 3PX0A 1VRTA 3RW6A 2CKWA 1K47A 2UVRA 3PJ9A 2ASYA 2L9WA 4U7UD 4ES2A 2ZD1B 3SCJE 1A0OB 3J7AN 2IC3A 5JXSA 3NAHA 4PG6A 3O5TB 1SVDA 2ZD1A 5H9FJ 4USHA 3DLKB 9ATCB 1M0SA 2AT1B 4NLWA 4LFBJ 1NDCA 2F8MA 3G82A 2ZZTA 2PI4A 4HKQA 2GQ2A 1B7YB 4OJ1A 2HHQA 4ED4A 2KVQE 2OD6A 3T1AA 3FSYA 2QA4G 2P5VA 4O3NA 3ZTSA 5CABA 1FK9B 2DNHA 5HO4A 1DBDA 3O2IA 4ZVSB 2NXUA 5CXTA 4ZIWA 1BMQB 2XMKA 4ZP9A 2DH8A 2UXDJ 3W5ZA 1YRTA 1N33F 4CLLA 2WB4A 1U1LA 2W2MP 2QV6A 4ZLLA 5BR8J 4Q7AA 5HLFA 1P9QC 3VAHA 2AJ1A 4JV1A 5J2PB 5K5MA 1HQEA 3PV8A 3M6WA 4DR2J 1SC1B 1Q8BA 5HL7Q 1V6HA 2X1FA 4LRCA 3EUNA 2FHOB 5F8LA 2CQHA 3CT9A 2JVOA 3UVJA 3VAMA 3IM9A 3PG9A 4CM0A 2CQDA 5A8RB 2CQPA 2V0NA 5LXRA 4NZ7A 4C11A 3KNGA 5A8RA 2XMTA 5KFGA 2W24A 4TLRA 5AXLA 1JLCB 1WC6A 3AJDA 3OW2R 3DRXA 5J1EB 1T3NA 4OYOA 3THTA 3UW1A 1R89A 2R7RA 3KLIA 4KHPF 3UWTA 1NJYA 2ZM6F 2WHOA 4X65F 5C5JA 3OFHA 3OL8A 4OYZA 4W4MA 2GMHA 3BGFA 5GMKa 1S6PA 1XWLA 1N36F 4PWDB 4URQU 3O6QA 4DR5J 4PWDA 3PY8A 4ES3A 4OZ2A 3G8QA 5DRKA 4RL1A 2V4RA 4DCOB 3CCVS 1G7CB 2EFOA 4UZBA 2NCKL 3SSSA 3FQKA 3R5CA 4DS5A 2QSWA 4TU9A 2BBEA 2BM1A 1RYSA 4CLSA 1FE4A 4GKJF 3SCKE 2ZEJA 1VDHA 1AW0A 4CO0A 1SH0A 4OYIA 2W2PP 1UVKA 2R7QA 3V6DA 2HLUA 3Q8RB 4YB1P 3I96A 3ISZA 2IBKA 3I5AA 2GS8A 2B0GA 2B5JA 4C98A 2YKNA 2HS0A 3ISNC 3M9OB 4YR3A 3B4DA 4FVMA 4ATNA 3KYLA 4OI6A 2FD2A 4F36A 2KDOA 2C22A 1VLYA 2XM3A 4KY3A 3FCVA 2ROEA 2YKMA 1U4BA 3T6JA 2G1HA 2HVIA 1HBMB 1NCLA 1GK8A 4LQ3A 2RNEA 2V8PA 4QJVA 2WZ1A 5C25A 4EWTA 2CZ9A 5LMNJ 2PA8D 3UDCA 2D9OA 2BX6A 2D3UA 2XQCA 4UOCA 2GNKA 4V19J 1WEYA 1Q8IA 3SQGB 4J9UE 4YMEA 2A2CA 3OR1B 3SQGA 3KLFA 2OP5A 4X2BA 1FEHA 1RABB 3EPIA 5L46A 4ZVGA 1RT4B 1UVMA 3POTA 2QLXA 2JL9A 4Q8FA 1I94F 3B78A 2DNOA 2LCWA 5LT5A 2I5JB 1UW4A 2I5JA 4DUYJ 3AJ1A 4A8KA 2MZSA 3GSIA 2XYPB 1TKXB 3ZZPA 5EWEA 1EJ7L 1F1BB 2XO6A 4IFYA 4HL9A 1T94A 2RUSA 4NCAA 1KVKA 3I56S 2KXFA 3FUYA 4ZPTR 1V9OA 2RT3A 3HLUA 3A4TA 1FKPA 1X4EA 5DG8A 3D0GE 5AJ3F 2B9WA 2ZWPA 2IM1A 4NYOA 3J81U 4FZVA 2UZAA 2UV8G 4K5RA 4LF1A 1JX4A 4ILLA 4UQGA 3IBCB 4O3PA 2HRYA 1F5BA 1UJ6A 1AZSB 4EBEA 4UOFA 2HQ3A 2H54B 1AZSA 3R5DA 4MKBA 1RBOB 1NH7A 5H9FK 2OTLS 3SEOA 3DFEA 3TZXA 1IBMF 4TKTA 3Q2SC 2CQ0A 2NZ4A 3UN5A 3E51A 3KDOA 3DLGB 3CCWA 2E1AA 1PJ6A 2LP4A 3DLGA 1WACA 2BKNA 4CH7A 2YWGA 4ECVA 2Z56B 2X1AA 1CULA 4M5LA 4EYIB 3CD6S 3GJTB 3T5KA 2CZ4A 4DBQA 2UUAJ 1FFSB 2E1CA 5ETSA 2HVZA 1IM4A 2DNYA 2IAJA 3GQCA 1MMLA 3BF4A 4KIAA 1N5VA 3CMAS 2RDDA 2YH1A 3LO3A 4DSLA 1HBNB 5A8KB 1XN9A 4RW7B 2MSTA 2OTJS 2LYVA 4ZP6A 5A8KA 5HN0A 1RA6A 4OHVA 4RW7A 4PYDA 4ECYA 1QY7A 4ED1A 4L74A 2CIMA 4EYHB 4I67A 1IBCB 2BKPA 2DNZA 1U1PA 2M8DB 3TA1A 4L73A 4DR6F 2WSEC 1KBRA 1XNRF 3G6XA 3QSYB 5EHHA 1YSJA 2DVIA 2Z57B 3OFFA 1G2EA 2XGPA 4B3RJ 5G0RB 4A47A 1QAXA 4PZVA 2JSXA 1OYEA 2D7SA 2CWXA 5EN1A 5G0RA 3KUEA 4RUHA 3W61A 3CO0P 1WTFA 1D9DA 2R7XA 5ETKA 1RT2B 2HFOA 1YI2S 3N01A 4KGMA 2J0QD 3FRYA 2IY5B 2L9DA 2JHEA 1XEZA 3D5MA 4LREA 2GAHC 2X3DA 1S0MA 4U96A 1EB0A 4LSNA 2XYGB 3TA2A 1MWYA 2EFQA 2KHCA 2KFZA 1E6YA 4L6V3 3HSJA 3DGPB 1LKZA 1VFJA 2O66A 2ZNZA 3EZUA 2QLBB 2KB2A 4DL4A 2FLPA 4PXBA 1NAQA 1P8GA 1I5OB 1XR5A 3G8TA 3BN4A 5KT6A 1S9GB 3UPFA 5MLCV 1Q5VA 3FC9A 1LWXA 3DDIA 3CNQP 2XB2D 2E5JA 3KLHB 2UUWA 5KT3A 2CPXA 4B9LA 3PEHA 3KLHA 2LQ8A 3D6TB 1CPZA 4CO1A 2OO4A 3CGIA 4MYTA 2GA7A 1P6TA 2MQLA 1AROP 4R25A 1VJWA 1U26A 2ZITA 1B0PA 3R3TA 4RUBA 4RNMA 2JEGA 1YZ6A 2WONB 1F3FA 2HNDB 2RF2A 3KDNA 3GILA 4QPXA 2GVDB 3DHXA 3HJFA 4U6PA 2UXDF 5KFDA 1YBAA 1SUQB 2C3OA 3HD1A 1BQXA 2WCXA 3HM9A 4DL6A 1LWFB 2LXUA 3VVUA 1GMWA 2YX4A 5D4NA 4HI1A 1HMVB 3HX9A 1YJ9S 2JX2A 1LWFA 4J9VA 1ZOTA 2YNIB 4MAKA 4ZPVR 1HMVA 3BBFA 4DR2F 4ENOA 3R97A 4TY9A 3IAM9 1RA7A 4BWMA 5KT5A 5LJ5Y 1PJ5A 5FLXU 2YNIA 2BUNA 1VQ4S 1WDTA 2NS1B 4C6AA 2DR9A 1FERA 2HKEA 4WZQA 5SZTA 2O3DA 3EVOA 3K7RA 1QLNA 2DRBA 1FNOA 4DI6A 4DUZJ 1U6FA 2QX0A 2CJAA 4JI1J 2AYGA 2E1PA 1NDLA 2FY8A 3DLJA 2RAQA 5E3PA 3NWGA 4DN9A 3ULHA 4K4XA 1VK3A 1F9EB 2ZH2A 1ZH5A 4R0JA 4WK3A 3R27A 5DGBA 4UTGA 4IFVB 1Q53A 3DOMB 5EX0A 3DOKB 5KOXA 1VJQA 3KJQB 4DR5F 4ZCMA 1D0EA 4PWUA 3GPAA 2XCPA 2MYFA 1PIEA 1KOHA 2AGQA 1TZ0A 4U8VA 4O0NA 2A1BA 2A10A 3IGNA 4GVBB 2V2ZA 3TQEA 2W25A 4RU2A 4TQRA 4O3QA 4QIWD 4GVLA 3I82A 2DNGA 4K2XA 3D6FB 5A6PA 3S6EA 3TW0A 3QO9A 3KHLA 5HP1B 5ITHA 4ZPAA 2MLXA 2RB7A 2G9OA 2AW0A 2GV1A 5LOQA 5HP1A 5HMWA 4BS2A 1HFEL 2IDLA 1T3OA 1ZZFA 3H4DA 3IN5A 3PRDA 2NUUG 2FVQA 1KEKA 1H3DA 1S1VA 2IBOA 1TKDA 3CCMS 3LGNA 4JI2J 1VR6A 1S9EB 5IM0A 4ZN1A 3B6BA 3GZ7A 3J7Z5 5KFHA 1TAUA 2V67A 5LMNF 4DHVA 3PW0A 4CO4A 3K8VA 5F9LA 3BO4A 3HCXA 4KT0C 3OSNA 2R8JA 1HI1A 2JDJA 5DDRC 2W8LA 4ZPCA 1QAIA 1UMJA 4B02A 4N7TA 3NXZA 3K5LA 2GVZB 4YEAA 4J5OA 3SDEB 3BZQA 2RQMA 3QBCA 2GVZA 2OPPA 3I4HX 1IM6A 1XJWB 2QG9B 1DZ5A 1SXLA 2ZC4A 1OWXA 5B0EA 3FKBA 2EC0A 1WUUA 1OY9A 2KRRA 4DUYF 2Z58B 4OI1A 2VL1A 4YN3B 4PXCA 2YBVA 2F7VA 2MQPA 3JTPA 5BJRA 3M8QA 2NR0A 3UQSA 2JC0A 1HBOB 3CCES 2BEFA 5SUHA 4F4ZA 2YTCA 1GEHA 1JIHA 1URRA 3PR4A 4MT1A 2ACYA 3AQPA 3WC0A 2HYIB 1KLNA 1UWBA 3NNCA 4KJIA 1KHVA 3LANA 1RT6B 4CLPA 3AD9C 2MKHA 1RT6A 2X1BA 4F2RA 5THWA 1LW2B 4ZDNA 3IC1A 2YNFB 3H2VE 3TX8A 2PT0A 2KJVA 5IC6B 1LW2A 3W60A 2PSZA 3UFCX 3MOJB 2YNFA 3BBBA 3HFVA 3N79A 2CQCA 5DS7A 1FFWB 2YVSA 1RAJA 2ILZA 1MLAA 1CC7A 2E9ZA 3HSZA 5KT4A 1SKSA 2G2OA 1EETB 3OPKA 4URGA 4ANEA 3J80U 2HFZA 3BEGB 3ZO7A 3TWZA 2ZH4A 1EETA 3NGSA 1GMWD 3ONQA 2NYHA 3JSBA 2CNLB 4FYYB 4IQXA 3MEKA 2IM2A 3TVZA 3P5BP 4XAKA 1S57A 2UUAF 2G0IA 3IP0A 3NEKA 2H4WB 4RW4B 2DNKA 1GMVA 1KKHA 3JAMY 4TNOA 3E01A 1M5KC 4PRFA 4MIWA 5AE3A 1IWGA 3CD0A 2VH7A 2ZVSA 3F41A 4OZJA 4USIA 3GCXP 2QMWA 4ZHRA 1L3UA 3H0PA 2POKA 4OV1A 1GH8A 1GX5A 5KFUA 1FXLA 2ZHAA 3NP5A 4ZMMA 2MHEA 4OJ3A 2FZGB 2LEBA 4LJMA 2LU2A 1RYRA 3LGHA 2P6SA 2RH3A 3ENWA 4C8YA 1VRUB 5KTQA 2V4QA 1VHFA 1EX8A 2DY1A 1DARA 1K73T 4B3SF 1FJ7A 4W98A 1H74A 3EE3A 1WKLA 2B9YA 1NB7A 1REGX 3DU5A 3L09A 2FJWA 2VJVA 3N6LA 1U6BA 2M8HA 3M8SA 3CJ2A 5A6WA 3K5NA 2XI2A 3GFXA 1M5SA 4PUOA 2DGTA 2JEIA 2UP1A 2L9NA 3MWBA 2EFVA 2CJXB 3DMJA 2IJFA 1WEXA 3P45B 4IUFA 3UR0A 1FWLA 3DOLB 4AT1B 2FVCA 3WZ0A 3W9IA 4CO5A 1U1RA 2P8IA 1FDAA 3MEEA 4HHJA 2OPRA 3PCOB 1VBZA 1EQMA 3D6MB 1CQMA 1KOOA 3NL0A 5IT4A 1NJXA 2XWXA 5GMEA 3D1QA 2DR5A 3CDUA 1FXRA 4AFFA 3A13A 2J6TA 2AJFE 1IJEB 2FVRA 2W7PA 1ZA1B 1FDDA 2C3YA 5T41A 3W9JA 2DHAA 4NASA 5I3UB 3Q2TC 2F4FA 4KPYA 2YPYA 3R9LA 5I3UA 5DZ7A 2IA6A 2IIHA 1RTHB 3H40A 3LPEA 2CDRB 3H25A 2IVFB 4LBPA 4I69A 1J2VA 3R6LB 1X4FA 2WK4A 4P9SA 3M30B 1RCXB 2V8GA 4N77A 3M30A 3IXQA 4U8YA 3I0SA 2KZMA 2WVFA 1JJHA 1RAIB 4QIVA 2K3KA 2CPDA 5IQQA 3GR0A 4LR7A 2HHWA 4IOBA 5FDLA 2CVIA 2OEMA 2QRRA 4K5SA 2FDNA 4PG8A 4HDGA 2HWIA 2PEHA 4ERDA 4DUZF 3ZTPA 2Z2LA 1JB0C 4JI1F 1UFKA 2YQ1A 1Z1ZA 3C6TA 2XLJA 2FB0A 2U1AA 4Y2AA 2CUYA 4QIGA 3UDLA 1TKTB 1U47A 1S6QA 1OYDA 1NK6A 1RWMB 1ZPWX 4B3OB 1TKTA 3I0RB 4ECWA 3BB5A 3U02A 4GRSA 5CCLA 3I0RA 5GAGU 1CJKA 1HI8A 3OL7A 1WJ9A 4Z7YA 3SFUA 1R0BG 3H2LA 3D66A 2EG1A 3JS9A 2KG0A 5HVGA 1FVSA 1G3OA 1T11A 4M5HA 5KFVA 3SCIE 2MZ1A 4ZS6A 3IS9A 4O4GB 4OHXA 4LUBA 1H2TZ 2EK1A 3U1NA 4HYKA 4O4GA 1FJGJ 3LTOA 1KLMA 3W2VB 2B7BB 3CJQA 1R6VA 2R2TA 3C16A 4OX9J 3W2VA 2GJFA 4O4RA 3UNGC 4FDFA 1TVRB 1DY3A 2JLGA 1YLXA 4ZVPB 3PO4A 2ZOFA 3L95X 1EHWA 4QOTA 3BH6B 3DXSX 5ETQA 2AJ2A 4C3LA 3VHQA 3R5GA 9RUBA 3MR3A 3C46A 3QYYA 1UZDA 4JI2F 4F4KA 4KHRA 3JYTA 2ALZA 3HVWA 3A8JA 3D28A 4FYDA 2DIUA 5CAAA 3QJLA 3TQ1A 2VFTA 2HLTA 3EDQB 4A8OA 2ZDOA 2R8KA 4F0HA 3OBIA 2HVDA 5AXMA 3H5YA 3TI0A 5K8MA 1N5QA 3TJAA 4TN2A 1HIYA 5J2NA 3QIPA 1S49A 1S10A 4K4WA 2ASJA 3UI3A 1RWVB 4YB7A 4X4UA 4MKYA 2PI5A 4KAIA 3MDFA 2XMWA 2XNQA 3IMQJ 2OSRA 4H4OA 4N8NA 4K4ZA 5JVGQ 1RTJA 4ID5B 4O44B 3GWCA 4ID5A 4P6QA 4Y2MA 1G1XA 3ZZOA 2R4FA 2MHNA 2R2UA 5IV3A 3PW7A 3HHLB 3MFHA 1R8CA 3HHLA 2V34A 3DYAA 5KFJA 3S7RA 4ALZA 1KNZA 4MFBB 1PYSB 1X8DA 2VFRA 4WPAA 2BA9A 3QRQA 2YNHB 5EUHA 1SC6A 4MFBA 1TKZB 2ALYB 5CCMA 4CLUA 2HMIB 5D4OA 2GIRA 1MU2B 1WSVA 1K0VA 3PFEA 3M2VB 5F8GA 2X7IA 2LQJA 1XMOJ 4L72B 2EBEA 1UJ5A 3MZIA 3M2VA 4OYPA 3Q8YA 1QVFR 1DHMA 1AFIA 1JKHB 4PPZA 4LF8J 4ELUA 2W7OA 3EPGA 2CPZA 3DLLQ 2CQIA 4NMXA 3G8SA 2MB0B 2NLWA 1X9SA 3SCLE 4N5SA 4JI4J 2RU9A 2BOPA 3U27A 3MMCB 1U1QA 2O01C 4B9TA 3M2RB 5D0GA 3H59A 3PYFA 2APOA 1Q16B 2KT2A 4CRJA 1FTCA 2VPYB 1VBXA 1Z2LA 4JOUA 4IH5A 3KJVB 3VAGA 4D3GA 4QYZJ 4QBUA 3KJVA 3VQSA 2AGOA 1HWJA 1X4GA 4GC7A 1YGYA 1RT5B 2BQUA 4G1QA 2KO1A 4ECTA 2KG1A 4F4YA 2DKOB 2NUHA 3CDWA 5GMDA 3EMTA 1TUWA 4QU6A 3KLGB 4JI6J 2N82B 5D4PA 3I32A 1T03A 4J9KA 3P49B 2CJ9A 8RUCA 4QWCA 1TL5A 3TAMB 3OUYB 1HWKA 4OLPA 2B4PA 3TAMA 3OD2A 3WC2A 5IQ6A 1PAEX 1I51B 1CQNA 1LEOA 1GXLA 3DDKA 2YQ0A 3RB6A 3W3SA 1D8YA 4C8NA 3VAIA 1NU4A 5M2PA 3LWMA 3FBEA 2B3TB 1RXOB 4EMDA 2GHWA 1TL1B 2HHPA 5CH7B 4G3IA 2HK2A 1X5OA 2BABA 4QPTA 1TL1A 2ZKUA 5HAOA 1UVLA 2M0GB 1WWHA 4UQTA 4DR3J 2AYEA 1BWVA 2ZBPA 2IVMA 1UEUA 1R8PA 3TARA 4X64J 3ZTQA 1OQ3A 4DLGA 4BCAA 1V5VA 1S76D 4DR1J 1SC4B 2D1CA 5LSLA 1YKWA 4IO9Q 1X0PA 1VQYA 1MN7A 3DNCA 5F0UA 3GB0A 5C42A 4G6VB 3GV7B 3UD4P 4DSEA 2R2RA 2E1MC 4X4TA 2OFHX 4ICLB 3FSXA 3SV4A 2I9SA 4PR6A 2E44A 2XS2A 2OIHA 4ICLA 4KH0B 5DDOC 3KLVA 2WW4A 1JXVA 2FQQB 1LFWA 2HSEB 1FKOA 2UUTA 1T9TA 2HRUA 3IBWA 3BBCA 1WHVA 1T9UA 3M6VA 5KFBA 3DGVA 2BE9B 5L8RC 1RJJA 4YR2A 3GU0A 4BLGA 3OVAA 4NLTA 3QAEA 2PE8A 5K9FA 2L41A 4RBUA 3EYZA 4I6WA 5B7WA 3U1LA 1RQ0A 4C8OA 2RKIB 4CLZA 4I2PB 3UN2A 2F8EX 4Y00A 3EX7B 2Y9HA 2G4BA 1RP5A 2BYCA 4RWWA 4UUWA 5GAHI 4C0HA 2NXCA 3V4IB 2DCLA 3LOUA 1AB8A 4ZPBA 3VAKA 4P2XA 5KG4A 3UE2A 3QJPA 2DPJA 1H2VZ 1YDLA 3CJ5A 3CDBA 1N6QB 3BQ1A 1N6QA 3A12A 2Z30B 3MM8A 2ZJRQ 4BHQA 1EZZB 2ZVIA 3M2UB 1KQFB 1Q4RA 4L3NA 3QFHA 3Q24A 2BKOA 1IKWB 3VGVA 3OT9A 2NXNA 3MAQA 4F02A 1FKAF 1IKWA 3DRSB 1FJCA 1GTHA 3CJ8A 1KRPA 2YQ3A 2V94A 1ZETA 2V4JA 1X31C 4MK7A 4MKAA 3SMZA 2DNNA 1VBKA 5HQMA 2DNLA 3U7JA 5F9NA 1YJWS 1IBLJ 4DV0J 3BPDA 4IRKA 4GMKA 3K2YA 4KTQA 3HDSA 2EC2A 1F5CA 3EXYA 3HI9A 4DV7J 2OH2A 4J9LA 2MZRA 4ZVEA 5A0YB 3MGJA 3G71S 1FJGF 2ACMA 4L75A 3W5YA 4DL0C 5HJYA 1APSA 5A0YA 3JSYA 4RPFA 4OX9F 2ZUGA 3HVAA 2M9KA 1YJ7A 3PNIA 2DEIA 2V2VA 4IH7A 5DQHA 3T41A 2NSBA 2ZBRA 3HHEA 3HMJG 2IM3A 3BS9A 3NS5A 2JNJA 2EW9A 3K59A 1N5SA 3AH6A 3HT3A 3GLJA 2V9WA 1S72S 4C8MA 4M5MA 1K1SA 1DQ9A 2C2KB 3NRBA 3NOCA 2ERRA 4NLYA 2ZBCA 1EIYB 1H2UX 3AQOA 4Z37A 4K4SA 3M1VB 1JLGB 3KLEB 2IHR1 1RB0A 1SV5A 2ZE2A 4PG5A 1JLGA 3KLEA 3BO2A 2PMHA 3K5MA 2M3DA 1CG2A 4QYZK 4YHHF 3M8YA 1UWAA 2R9LA 5DQGA 1AXQA 3OVBA 4PQAA 3UNYA 1HNVB 4YDXA 1L3VA 2KXNB 4I1TA 2ABYA 1Y10A 1S5ZA 2VIHA 1BC6A 3MUVP 2BRKA 3MEGB 1TTHB 2XMAA 3O8WA 5KFWA 5L1JA 2ATLA 1WOOA 2GJ2A 4ZVFA 2Z2YB 2CADA 4M5NA 2QLFB 1VIXA 1WHXA 4X4PA 4Z2XA 5DDQC 3I55S 4LT6A 3JTNA 3ZZYA 1HR0J 1R43A 5KFCA 3IGVA 1WDDA 1S1TB 4OZ3A 1NK7A 3W7BA 2WOMB 2EFGA 3G96A 3FFIB 4CH1A 1S1TA 2HQCA 1K8AT 2PGCA 4DFJA 1FRMA 3LAMA 3JQKA 3UDVA 3BR8A 3FFIA 4UOGA 5L9NA 4ILMA 1PAUB 4FKYA 4WTYA 2C2RA 2CJBA 3Q86A 5LJ3Y 3DI6B 5KFRA 1IBKJ 3AXMA 2BJ3A 3RRGA 4DXLA 3THVA 3DI6A 1XMOF 1Q7YT 4DPUA 3MFIA 2H48B 2UUBJ 2B51A 1Q0NA 3MAAB 1EKRA 1SPBP 4KHPJ 1VK8A 1U09A 1X5PA 4Q0BB 5RUBA 4LF8F 3GSDA 1HLWA 3CTRA 5CA5A 4DV1J 2NSCA 2PN6A 2D69A 5KG7A 4ZJLA 4JI4F 1E6VB 2JZ5A 2I1RA 2J7KA 5FIIA 2PFDA 4IKAA 1W26A 2G2ZA 3GIRA 2N4DA 1UVJA 2EWHA 2Q43A 4O3RA 1R0CB 4MK9A 2OHDA 3EGZA 3R5AA 2CQ4A 1DTTB 3M8PB 2QIFA 4X84A 1WC5A 1DTTA 4QZVB 3OJUA 4DLEA 1WG1A 4CNZA 4K50A 3VZIA 2R42A 1X5SA 1IXKA 1ZM2A 4P52A 5AXNA 1VQLS 3CC4S 2XS7A 4IRCA 4ED2A 2Y1IA 1KDNA 5A76A 4DF8A 1T9YA 1FRIA 1S6OA 4K4YA 3CCUS 2BOAA 1PKUA 1UETA 2XZTB 3K17A 1VQMS 3ZNUA 3TX0A 3KUGA 3IM8A 3VALA 3V5RA 1QUPA 1CJUA 4EBDA 1CJVB 3X3UA 3BQ2A 2J9DA 1WOSA 1CJVA 2Q79A 2BJ1A 1H7WA 2IA0A 3TYTA 8ATCB 1B3TA 3M4XA 1URNA 2GCFA 8AT1B 1X9WA 2RUGA 3OL6A 1VQSA 3ZZRA 3MCMA 1REVB 2CWKA 4DR1F 4OLOA 4ID8A 4USUA 3R7BB 3LALA 3N9UC 4J37A 3QGHA 2HWTA 3MM9B 2RMLA 2C3UA 3E2EA 1OY8A 3B8HA 1HW8A 2W8KA 4DL7A 4KH1B 1PCAA 1I94J 1ZM4A 2NXJA 2ZHBA 5G4DA 1RTIA 1FNMA 4DL2A 4HEA9 1IR1A 5IT9Y 4F3MA 5HMYA 4HTJA 2UXBJ 1DURA 1RHJB 3IR7B 4DR4J 2RDIA 3OXLA 4J9NA 3HT0A 3QWUA 2XY7A 4C2MA 3ADAC 2Y1RI 4A8SA 4A8XA 1NSKL 4RLEA 3C14B 5AJ3J 3JSMA 3MMJA 1R3NA 2GO8A 3FRZA 2HEKA 2ZDPA 4A8MP 4TVAB 5HQLA 1N5TA 3OR2A 1RBLA 1U25A 4RKUC 1UA1A 1M1KT 3D3CJ 1DQ8A 1XR7A 2CQGA 2MZJA 2A0FB 4U7UK 2D3O1 5DDPC 3WIUA 4ZN3A 3FSIA 2XMJA 4Y6IA 4ZLNA 2KI2A 4P2MA 5KG1A 2VPWB 2ZWOA 4NA2A 4IG3A 3Q8VA 4EI2A 3EGVA 5I42B 3WX4A 3PO5A 3M9NB 5ETVA 4NLSA 1U49A 2RRAA 5I42A 1FRLA 4JBCA 3AOBA 5K20B 2QYGA 2HW3A 4FS2A 1RAFB 4ZPWR 1YHQS 4FF4A 3UDEA 1T9XA 4H4MB 1DTQB 3Q22A 3PIPQ 4B9VA 5K14B 2MDAA 2CPFA 3D9BA 4H4MA 1FXDA 2DITA 4YOEA 4QU7A 2GJIA 3OTEA 1YTYA 5B0GA 3CCQS 1HKAA 1UJ4A 2XO7A 1IBLF 1GTEA 3CJSA 2HRTA 2DK2A 1H0HB 4KQZA 3P4UB 2VG5A 2A18A 3AY0A 1MNEA 1IJFB 2CZVC 4JI8J 2VDHA 2DEJA 2VBYA 2J8AA 3ITHB 4DV7F 1K0TA 2IPOB 3TRGA 3ITHA 1JLAA 1X0FA 1KWMA 2VASA 1JLQB 2KM8C 4B9MA 4X4RA 1UEKA 1WTBA 1JLQA 4I56A 1VC6A 4JI7F 1YRUA 1HNIA 3TUJC 4HH0A 3IRXB 1RGVA 3HVTA 5CYMB 5KG0A 1OY6A 1DQAA 2YWHA 3EM1A 3IRXA 2IMOA 4AL5A 2XNRA 4NLRA 4K2JA 5CYMA 2DBBA 3TVKA 2NYIA 1SB6A 1IKYA 1Y5NB 3PRBA 2QN6B 4R8UA 3TJ9A 1VRTB 3OTBA 4WU3A 5E41A 3QT8A 4DU7A 2V8HA 1YRXA 4NCBA 2G2YA 4LF4J 2BM0A 3FBCA 2VICA 2EKNA 4DPWA 2IC3B 1N88A 1F5AA 3FEXB 5U47A 5GVQA 4PWWA 1KSPA 2HS4A 3CMQA 1FX2A 4DSIA 3AFGA 2ILYA 4RX6A 4ECZA 3F56A 3G82B 1JNRB 2DIVA 1QE1B 5L38A 1VQPS 4WP8A 5D0EA 1QE1A 3NCRA 2FC9A 2AZ3A 1JJ4A 2QMUB 2IYGA 3M6UA 2XEXA 4DX6A 1JK9B 2OI2A 3EVWA 3THPA 2XLIA 2HBYB 3I6PA 2W9AA 2LDYA 1HPZB 2HQFA 3P8BB 4P10A 1ACMB 3ZZUA 1HPZA 5T14A 4UY8T 4LRAA 1RWPB 3ZNJ1 3L7PA 1ZBTA 3KJNB 5HLFB 4WU2A 1PO6A 4J9QA 2ZC3A 1HQEB 1HR0F 4ZP8A 1TUGB 5M2RA 2OD4A 2CVEA 1VQ9S 3UVJB 4U7CA 4M63A 1UEVA 3RZAA 1RLCL 2U2FA 1UP1A 4NYZA 5CQGA 1S12A 3ILJA 2C2NA 2NZCA 3KG4A 4NEZA 5B0CA 4C11B 2J0XA 1IBKF 2AX1A 3UCZP 1XQIA 4A8YA 2XBPA 4EK2A 3E3XA 3KLIB 3K57A 2J76E 3GMGA 3QPIA 2UUBF 1SKWA 4IOAQ 5KFNA 4Q44A 4KHMA 1QSYA 2ADCA 5F8IA 4YP3A 1ZAXA 2I38A 4J91A 1XMQJ 2QA4S 3GFYA 1TK0A 1S6PB 4DV1F 1Y5IB 4OV6A 3T5JA 2CQ2A 1F0XA 2R7TA 2H5EA 3L4BC 1CS4A 2K7JA 2YWWA 1X4CA 3W64A 3FNNA 5E5NA 4XK8C 3C8YA 1KS2A 4NRTA 4P7VA 1R8HA 2OEJA 4KE5A 2V50A 2DGOA 1LK7A 4A8QA 2OPQB 3ISND 3DCAA 1HI0P 2RIJA 2OPQA 1VBYA 4Y34A 2D9PA 1UTAA 4RZRA 2BE2A 3V6DB 4MMOA 1S4EA 1X4HA 4NCGB 2QO3A 4IRDA 2F4VJ 2B5JB 1VHIA 2AQ4A 4DX8H 5HQ8A 4WFBQ 4A8WA 2YKNB 4NCGA 2ZKTA 4LSLB 3DU6A 4NXNJ 2VG7B 2R2SA 2DXFA 1B70B 2CJKA 4LSLA 4ER8A 2VG7A 4NL5A 3KNAA 3M8ZA 4CLYA 1WOPA 3GYGA 3BYRA 4LF7J 2YKMB 2HK3A 2QA1A 4DQPA 2I2YA 3HFZB 4H54A 2XULA 2ZZMA 1I3OB 1ZA2B 5C25B 4ZJQA 3A3NB 5AE1A 1RWUA 2VA2A 1VS3A 4NPOA 2FLOA 1VLOA 4G65A 2F5GA 1R31A 2PMWA 1KP6A 3QSIA 2H9ZA 1PG5B 2XMVA 2GGPA 3KLFB 2W2NP 2GQQA 5DETA 2PD1A 3GYXB 2ZUAA 3LW5C 4F04B 4V1Ak 3PJWA 3V81A 4NYPA 2R7SA 3POTB 5F8JA 1S0OA 1JMTA 4G1PA 2E5LJ 2DGUA 1RWNB 3W8GA 1HHSA 3CDEA 1Z2ZA 2P9EA 1CLFA 4P71A 3VGTA 2DR8A 1PC5A 3NGRA 1RAOA 2QLJB 2UXBF 5B0FA 3V6KA 1U0SA 4IFYB 2HHVA 3MXHP 3AA9A 4IOCQ 4DR4F 2AKWB 4Y0FA 2FZCB 1FCAA 3R2DJ 4ZCIA 4E2FB 1V3RA 2MZQA 1IR2A 2VQFJ 1FKPB 4EEYA 4CT8A 3FMBA 3NCPA 4LFCJ 1Y00A 4J9SA 3TO8A 4L76A 1PILA 5IOLA 2Q6BA 1HNWJ 3R8YA 1RTDB 3EICA 4NMLA 3MM7A 1RTDA 3TUZC 1HD0A 3HKWA 2HHTA 3EZOA 1R0AA 2YWKA 5HATA 3K5OA 2RQ4A 1YX2A 4OZ5A 3H8YA 1PYTA 2VC0A 5D3GA 1U24A 3BSNA 5ETPA 4ZP7A 1C0UA 1YJVA 1CULB 1SI9A 2FGCA 2B4UA 4ZOSA 2N7YA 1RT1B 1XNQJ 5HVFA 1LWCB 3QAUA 6FD1A 2IAJB 1RBAA 1RT1A 3FEYB 2MSSA 3IR5B 3X1LB 5E3RA 1LWCA 2QSFA 2IVYA 5I3PA 2ZJPQ 1S1UA 2CJQA 5KT2A 1P1LA 3W65A 4F0MA 4N56A 4RW8A 4OJGA 3TA0A 5B0BA 1EQ0A 4CYUB 2E9RX 1IQTA 2LECA 2OMOA 3K8WA 4CYUA 3SYZA 4ITSA 4JI8F 2D41A 4ZLPA 4P74A 2XY5A 4FPRA 2GHPA 3IFEA 4P2FA 1L3TA 2NPIA 2OLWA 1CVJA 2VFSA 1TL3A 3G2XA 3SV3A 4DPOA 3J7YU 2DO0A 4B3SJ 1KHWA 3MAHA 3RB0A 3KJFB 3PKYA 4CLWA 1O5JA 4M5DB 4PG4A 2DTJA 4YUDA 1WI8A 3WX8A 1HNZJ 1NJWA 2R3VA 4M5DA 4HI2A 4IQMA 5EDWA 2EI5A 3HZGA 4DQQA 1TL7A 1FRXA 4LSNB 1HQ2A 1YBTA 2EPIA 1U48A 2Q3PA 1LWEB 5E0OA 1E6YB 4O0IA 4C3KA 3Q83A 3LH2S 5KG5A 4LF4F 1LWEA 4PEOA 3CO9A 3I9V9 1C1BA 3CC2S 2AHOB 4R5PB 4N47A 5GADI 3LP1A 4R5PA 1NDPA 3MPYA 2HGLA 2FPHX 1ELOA 2OKQA 2HFSA 3M7VA 3ET6B 4DCJB 3LP2A 3AOAA 1BE4A 4LIWA 4CLTA 2LLZA 3ET6A 4DZ6A 2DD8S 2XC9A 2OPSA 1T9VA 2R8GA 1HD1A 5EGYA 2WVBA 2HBRB 2LA6A 2CQBA 3H98A 4UT4A 2VV5A 5HVHA 1JQGA 1U2FA 3GV8B 1F3VA 2GX8A 1DJ0A 3MCOA 4CNYA 5A2QY 1BHNA 1HYSB 4M5IA 4LR8A 2QC3A 1ZTWA 1QD1A 2RF2B 1HYSA 3QLHA 1HHTP 4F7VA 5A8WA 4PQUA 4ECUA 7FD1A 4Y28C 4UZCA 1NPRA 5LSRA 2RQKA 1PJ7A 1HWUA 1M1HA 2EXUA 1ZYQA 4M94A 2Q1LA 1OO0B 4DDFA 3KOAA 1UL3A 3KTQA 5DO2A 1KTQA 3VWSA 4IDKA 4Y2KA 4H4KC 2B56A 4TXSA 2EK6A 4OZNA 5J2MA 2CPYA 4ZITA 4FF3A 2Z4PA 3IAS9 2HAIA 3NS7B 5FD1A 1TL4A 2YNGA 4B9NA 3GYNA 2ZNYA 3SFGA 1IQZA 1W2IA 4OYAA 5KG3A 3OJSA 3D2WA 4Q43A 1L5UA 4QQBA 1KFSA 2GMJA 2AJ4A 1UVNA 2CJYB 4OI2A 3EVMA 3FBBA 3P96A 1IKXB 1CJTA 2B8PA 5GAGI 3AA8A 2FYXA 3M6XA 3CXCR 1B4SA 4R0EA 1IKXA 3QQCD 1XMQF 4P75A 4DUTA 3GG0A 5IV4A 3KXDA 2QEXS 2C3MA 1KONA 2RHQB 3GR1A 1Q1KA 3VF0B 2AEJA 4OHZA 1RHUB 3FZBA 2WTFA 2K06A 4LBIA 1YJRA 3VZHA 4DV3F 1WNEA 2KYXA 3T1HF 2H51B 3MMBA 1JLBB 1EP4A 2OAUA 2G0JA 3HJVA 1AYEA 1JLBA 2R7OA 4TQSA 3MUMP 1NSAA 4QWEA 1FRHA 2DGVA 4OQJA 5D6GA 1FD2A 5ETLA 1J5OB 2B43A 2QA2A 2F4VF 3CW2C 4OHYA 3T5LA 2BRLA 3BPSP 3QO9B 3PRVA 3RW7A 1J5OA 1S9FA 4NXNF 4C7QA 5E7OB 1S1XA 3DHWC 2CXEA 2M88A 4BC7A 4WFZA 3CB4A 3GIKA 2OFGX 5HROA 5K8NA 2AYMA 1KVJA 2VB6A 3DKDA 1VYAA 5HMZA 4LF7F 1S1VB 1B0VA 3S01A 4EBCA 3QJJA 2GZOA 3VTIA 2C3PA 2BQ3A 4F3OA 1WG5A 1FA0A 5IM0B 2MGZB 2LEAA 4KV8B 2OEKA 4HLBA 4C0OC 1X9MA 2MGZA 3C3LA 5HI7A 2DHXA 4KV8A 2J9EA 2HBQB 1TFYA 3M32B 4E98A 1O0PA 3BKUA 3LF0A 1U45A 5DG7A 4DR7F 1ICEB 2PFFB 4B17A 3M32A 2H65B 1SKRA 1B64A 4YR0A 1NKCA 3VAJA 3MD3A 5AT1B 4QWDA 5LL6d 2PC6A 4AE5A 2FJAB 1PBAA 2W9BB 4CDIA 2OPPB 2QGFB 2W9BA 4OJHA 1S1WB 3JAMU 1WC4A 2EKYA 3MM5B 3W2WA 3NMAA 2C2ZB 5GAEU 1J27A 1S1WA 2LMIA 3CIZA 3MM5A 1MWZA 5EWGA 4ED8A 3IWXA 2E5LF 3WHIA 3GJRB 2V63A 3QGPA 3GJSB 4C9DA 3KK3B 3PHTA 3MTJA 4NE9C 3KK3A 3L9ZA 1TK5A 2VFUA 1X5TA 1JLEA 3MD1A 5DLFA 2H1YA 3M8QB 1S79A 5JVHQ 3GV5B 3C15A 4XPEA 4DV4J 2ZBQA 1RCOB 4F2SA 5KFFA 2VQFF 1FDBA 1UWBB 3IWNC 4LF5F 4LFCF 3O3LA 4U9RA 5L1IA 1SL2A 3AD7C 1U1OA 2DR6A 2UVUA 1WEZA 5L9XA 3C2PA 4USMA 1HNWF 1NZAA 1QAJA 4CM2A 2Y1JA 1L3KA 5KFQA 1Q86T 2Z2ZA 3BH7B 2W4DA 4DV2J 1RACB 2MKIA 4B3MJ 4KO0A 4CT9A 2BANB 3JQJA 1DLOA 5CYQA 5EWFA 1J5EJ 4NLUA 2BANA 3NNAA 5ETMA 2PO4A 2B9EA 4TYBA 5K8OA 4ECSA 4M5JA 2HHSA 2AIRB 2QFIA 4JV0A 3WDOA 1JJ2R 1NH8A 4QYRA 4DQRA 4OFZA 2DRDA 4W90B 3HD2A 1KC8T 2AGPA 1RAEB 1N0VC 4LRDA 1XNQF 2UV8A 1PC4A 1RU2A 3Q23A 3DLKA 1RSCA 1NBEB 1K9MT 3E01B 1N32J 2JFDA 2V9KA 4OI3A 4JYAJ 1ZPVA 1A7GE 2DO4A 2QTWA 5JJBA 1S48A 3RU0A 2UXCJ 4ZHRB 3MR7A 1FT8A 5DG9A 4OHWA 4N76A 3G87A 1H73A 1FNXH 3F73A 2C42A 2BV3A 1FK9A 4B3TF 4BWJA 2QL9B 4O3OA 2H5JB 4WFYA 5L1LA 1B7FA 4I6AA 2NXEA 3W62A 4DJBA 2FC8A 3RBZA 2ROGA 1FF2A 4WK1A 1KR4A 4YY3J 4P7TA 2HHXA 1RI7A 3N5FA 3CWJA 1HNZF 4Q2MA 4XDCA 1X7VA 5J2PA 4PUOB 3AT1B 1YG0A 4J7CA 1PGZA 3DMJB 3PXGa 3SQOP 2HQGA 1KN6A 4YS2A 4I6YA 1UKUA 4Q45A 1M5OC 1BWEA 4CLFA 3O44A 3CIMA 4KSEB 4B9SA 2M70A 3WBZA 2FHMA 3DRRB 5DQIA 1JLCA 3LGMA 1HL6A 3DRRA 3MEEB 4PCQA 5J1EA 5C24B 5IFMA 2OPRB 1TAQA 2AEFA 4C0BA 4NEYA 3DN9A 3R5BA 4I0WA 1UFLA 5C24A 4KB7A 1UAWA 2HHHF 1FDNA 3AODA 1UZHA 4LF9J 2FY1A 2DGWA 5GADU 5KFAA 3CULA 2IM0A 3G6YA 2ASDA 3UCGA 1ZM3A 5CHCB 3JB9k 4PPDA 4RU9A 4PG7A 3QZ7A 3KHGA 1FWKA 3RRHA 3DLHA 3ZTRA 4Q5VA 1WG4A 3H2UB 3I9ZA 4ANCA 2EVZA 3MHYA 4PXDA 4MKVA 2JEJA 2I8EA 4ECQA 3TZZA 4RW9B 3QT5A 2DHGA 5HSPA 4RW9A 1HNXJ 2CG4A 1YJNS 1IR0A 2XSFA 2VONA 3BKFA 4FYWB 4ZJOA 1H98A 5IXUA 3FMWA 5E3AA 2ZBIA 3I0SB 5DM6Q 2DGSA 1FTRA 2WBMA 4LVOP 2E5GA 3MPVA 2MKYA 5FDLB 1JWWA 2J6SA 3DM2B 1FWPA 2DHHA 2V8DA 2ZH6A 3GFHA 1KVIA 3DM2A 1O6XA 2FIUA 4JI0J 2GO9A 2FTRA 1R7IA 2E9TA 4J90A 2VOOA 3RRKA 4C4WA 3HKZD 3HF5A 1HBMA 3C6TB 1SL1A 4ZPDA 4C8LA 1Y4ZB 4Y2IA 1S6QB 3R7NB 2OGUA 4XTTA 2J0SD 1XTZA 3QRPA 3QFWA 3L7OA 2F1FA 5F3TA 5ADZA 3QIDA 1CJKB 2G0CA 3A8IA 2R8HA 1M5HA 2HFVA 2HS3A 3W63A 3OR1A 2A2DA 3NBPB 2CPJA 2J9DE 4F4XA 2RQCA 3NBPA 1QUVA 4IG0B 4M5KA 3L7UA 1RT4A 4D3HA 2UU9J 4IG0A 3IS9B 2FHKA 2RSQA 5F8HA 2J9CA 1UVIA 1KLMB 2J8SA 1L3SA 3C16B 1TKXA 2X3GA 1FFGB 4KGVB 4FNIA 4W92B 4EFAC 5CYJA 2BMBA 3MMAB 4AD6A 2Y8WA 3MMAA 4LIRA 2W2QP 3RYLA 2DY9A 2P6TA 4C97A 3RR7A 3NAIA 3JYTB 1VISA 1VC0A 1OSDA 2YXLA 3MM6B 3K0JA 4QW9A 3MM6A 2XGQA 1NSPA 1FRKA 1RT3B 2VC1A 5J2NB 2DB1A 4YHHJ 5DM7Q 3QIPB 3AB4B 1RT3A 2MQNA 4TU8A 1MN9A 2V5HG 3Q8QB 2ZH3A 6FDRA 4O23A 1AUDA 2W4PA 5LSOA 3CD7A 4NXMJ 3TZWA 1S4FA 4H4OB 3WQPA 1RTJB 2VPZB 3ICLA 1NHUA 7AT1B 4KBIA 4BC9A 3MURP 2IRUA 4RW6B 1G6BA 3NMRA 2MQQA 1S6UA 2LDIA 1RHMB 4FXVA 2R7UA 4RW6A 4LVNP 1SIWB 1HBNA 2HG4A 3D1OA 3JTOA 3PW5A 1ZM9A 4CO2A 1WORA 3DYAB 4F8RA 2AEMA 3V4MA 3DRPB 4Q8EA 4I64A 3VAFA 4DV4F 1S59A 2MJUA 1FE0A 3DRPA 1N52B 2XWYA 1N4LA 3D7SB 3V2UC 2JWNA 4N41A 3ENVA 5HJXA 4IR9A 3TNVA 3NY0A 4RUCA 2RE1A 2CPIA 2IFXA 4ZVUB 3HP6A 5KG2A 2FVPA 4ILRA 1RHQB 1F9FA 2CPEA 1AUSL 5C7PA 1WELA 3J81Y 3I5CA 4DV2F 2JH3A 4B3MF 4DFKA 4KPCA 2RS2A 1RKIA 4WTOB 3E8OA 3ZZ0A 2W7AA 2VZ9A 3BR9A 1J5EF 1NHVA 2K1RB 3VR1A 1RT2A 1S7HA 3QT7A 2ADBA 1MSWD 5DZ6A 2K1RA 3S8SA 4B9UA 1H6KX 1XR6A 4WYWA 4A8FA 4BBYA 4KKOB 2GHVC 3A8EA 3D0HE 1SC3B 4KKOA 4P2SA 2XCAA 4HHUA 2F9DA 4C3MA 3DGPA 4M95A 3EXCX 4KFBB 3J7ZT 4WIIA 2YKQA 2RU3A 4Q2LA 4KFBA 5KFTA 1RADB 4CIOA 1LOUA 3CCJS 2K2PA 3PR5B 1S9GA 4LFBF 1N32F 4ZVTB 2YKPA 2QE5A 5E33A 4AQYJ 4G1QB 2YY3A 1BLUA 4JYAF 1G4CA 1NO8A 2QFJA 2UXCF 2MY8A 1YQHA 1KTVA 2RRNA 2VUGA 2HGNA 3HFKA 3H20A 1T03B 1QM9A 2HGMA 1X4BA 4CP5A 3RB4A 2C2OB 2IYIA 1S0VA 3CJ0A 2WONA 1U7LA 2R7VA 1TV6B 4ECRA 2HNDA 3V6JA 2XYHB 2GVDA 1TV6A 2E66A 5K8PA 1Q79A 3GIMA 1FO1A 3R1HA 1SUQA 1NK4A 5BR8F 4DV5J 1WF2A 3N4WA 3CD5A 4YY3F 2HHUA 4DQSA 3VV2B 1NDKA 2COLA 2LEPA 3QRRA 5LM7E 1NPPA 4A46A 3Q8PB 1SBRA 3I87A 1MG7A 3MEDB 4JI5J 4YB5A 2B8QA 3HULA 3D6HB 3MEDA 3RBDA 1VQKS 3RAXA 3RAQA 4ZVOB 2PIIA 4QR0A 4GKKJ 1Z4UA 3LA0A 5C42B 3CCZA 4K59A 1H7XA 2AJ0A 3TR5A 2CG8A 2O1PA 1LNQA 2GFFA 4PAAA 3FK4A 1M1GA 3ZZTA 1XC9A 2YX1A 5FJ4A 2CA9A 2J7WA 2UVVA 1FKOB 4J9RA 2XG8A 2GW8A 1N54B 2G13A 1GAOA 2E7XA 4LF9F 1WF0A 2FLNA 3CSKA 3MCNA 1U8WA 4IFVA 3DOMA 3DOKA 2HPUA 3LAKA 2HVHA 5BXIA 1HQUB 3PM9A 4X4QA 2ZH9A 1NKEA 1RISA 1Y3KA 4ED0A 1HQUA 1NRKA 4OI4A 3ENAA 1NKBA 1ROFA 1W25A 1X4AA 3ENQA 5D15A 4DS4A 2MXYA 2X1GA 4JP8A 2NREA 4GVBA 2V68A 1RKJA 4K4VA 3TJ8A 2A6MA 3T5HA 3NS6A 3HHDA 2N3LA 1C4AA 2HURA 3TOQA 1HNXF 2FZKB 3J7A1 4ED7A 4X4SA 1LQ9A 1YJTA 1MWQA 2DYAA 4K0KJ 3RAMA 4WE1B 1BUXA 3OLBA 3RUBL 3M05A 4FKXA 4CLKA 2EG2A 2LVWA 4WE1A 4F50A 4HHHA 2BQRA 3ETMA 5KFIA 5H1SV 1AFJA 1Y0HA 3MM8B 2MJNA 2QL5B 1A9NB 1R27B 5FLXY 4JI0F 3W8PA 2VD3A 1JXLA 1OSCA 3SZ2A 2B6AB 3N0VA 2BJEA 1S9EA 2B6AA 4FS1A 5D8HB 2DR7A 3EDRB 4X62J 3M8RA 4MK8A 1F2GA 4NI2B 2V4JB 1Q95G 4NI2A 2IRYA 1U2CA 3NCQA 4F4WA 5I4MA 4OYBA 4DFPA 5C2CA 4QR2A 4CQ1A 4C48A 4YFUA 2KT3A 3SXLA 3FEZA 2L48A 3SDEA 4ETZA 2W2OP 1NXIA 3UO0A 2UU9F 5KAKA 1D3WA 3KMQA 1TQLA 5H9EJ 1WD6A 3KK2B 5KOWA 2VG6B 2D3ZA 3KK2A 2GIQA 1ZTTA 2ZH7A 5LMUJ 1RTZA 2VG6A 2W4CA 2FJDB 1LXNA 1VQ5S 2DGXA 1Y5LB 4JI7J 3A8KA 4IR1A 2CNNB 3ZZZA 1SCJB 1HBOA 2E7VA 2AV5A 3A3PB 4RO0A 1NMEB 1Q8KA 2VBZA 5LXYA 2PDAA 1RHKB 2JLEA 4YDDB 4WCEQ 4ZA1A 1Q5YA 3VCDA 5KG6A 3KFWX 3TANA 1QTMA 5JUMA 4NLGA 2O67A 3PYGA 3BSAA 2MQ8A 4Y2CA 2HWHA 4DSFA 5IC4B 2GMLA 1YBUA 3BQ0A 1FJEB 1I1GA 3KHHA 3BKTA 3ZXWA 3HHNB 2CQ1A 4WKRA 2Y0SD 1SV5B 2N7CA 2ZE2B 1N48A 5HBMB 2YWFA 1Q81T 2BE7D 2J0WA 4DZDA 5HBMA 1N0UA 4NLOA 4NLXA 4K4TA 4WKYA 2KTQA 5IWAJ 3PACA 4DFMA 1EAYC 1RZMA 4XPCA 2HNZB 4LR9A 4MH8A 1U02A 2HNZA 3Q0AA 3P6YC 3PDNA 4DCPB 1FESA 2QZ8A 4N8OA 4NXMF 1I6JA 2G1DA 1SJRA 4F25A 4USWA 2R8IA 2PA3A 2HFUA 4EZ9A 5KFMA 1VQ8S 5ETRA 4RW4A 1HHQA 1YJUA 3BGOP 2L3MA 3PW4A 4LF2A 4JB8B 4QWAA 4ED3A 3CJ3A 4OX7A 1SKUB 4WFXA 2RS8A 3GIIA 3O1LA 3LQVA 2LKZA 3QWPA 3UD5A 4FBTA 3BSOA 5ETOA 2P2CB 2LU1A 4DV6J 4AXJA 1SH2A 3TEHB 1D1UA 1EKSA 5ETNA 1IWAA 4B3RF 3OVSA 2YKAA 2FVSA 2IMWP 1VRUA 2UUCJ 4Y3CA 3MR6A 2XMMA 2OMLA 1V3ZA 3TUPA 1NHKL 2KM8B 4LFAJ 2BJDA 2AD9A 1NK5A 3NWRA 3D67A 1OPZA 4NX9A 1RT7B 4DL5A 2VBWA 4LRBA 1R8BA 6AT1B 4ZCKA 1RT7A 3IR6B 1MW7A 2J5AA 1XIQA 1Y7PA 2M4MA 2DPIA 3P5TL 1KQKA 1T02A 1OJ4A 1UW9A 4NLVA 4QIEA 3C66A 5CD4A 2KU7A 1SJFA 4DSJA 1ZZNA 5KFXA 4TY8B 2EBGA 5J2QB 2ZH1A 4USKA 3TAQA 3M8WA 3J80Y 1WSRA 4TY8A 5J2QA 4WJBA 1D09B 5KFZA 3DOLA 3Q8UA 2RHSB 1PSDA 5HANA 2ZJQQ 1AA1B 3IWLA 1Y9OA 2M2BA 4ZVRB 4FBUA 5IT9U 2GAGC 3NGKA 1D9FA 3FZ2A 2KJWA 2E7WA 2F63A 1VMBA 2XY6A 2RRBA 2KVIA 2H4YB 4LBHA 5KFSA 4AQYF 3CEDA 3MCSA 4C8ZA 1JXEA 1VIOA 2MPUA 2XZWA 4YB6A 5JMNA 4C8KA 1VQNS 1RLDA 3MR5A 2YH0A 2DT9A 4DL3A 4RNHA 1VOMA 1SH3A 2F8HA 4QW8A 1Q8LA 2KXHA 5E3QA 3WIVA 1FEEA 1FRJA 1U6ZA 3NKYA 1U8SA 1W7WA 3C19A 1GQEA 4RBTA 2AZ1A 3N28A 1C0TB 4FYXB 1HW9A 3KMSA 1RTHA 1CJUB 2MLZA 5KFPA 1C0TA 3F44A 1NK8A 5KFLA 4DWIA 4HH1A 4DV5F
chains in the Genus database with same CATH topology
1SH0A 1LFWA 1UVKA 2A3JA 1FKOA 2R7QA 3V6DA 2HLUA 3Q8RB 2UUTA 4YB1P 4OI2A 3P96A 1IKXB 3I96A 3ISZA 2IBKA 5GAGI 3AA8A 3M6XA 3I5AA 3CXCR 2HRUA 3IBWA 2B0GA 1IKXA 4R0EA 4TLQA 1WHVA 1XMQF 2B5JA 4C98A 3GG0A 2YKNA 1T8EA 4JI5F 2HS0A 3ISNC 2QEXS 3M6VA 5KFBA 1MROB 3LPYA 3M9OB 3UCUP 2C3MA 4YR3A 1KONA 3B4DA 3GR1A 4FVMA 5L8RC 4ATNA 1A6LA 1RJJA 4OI6A 1UFWA 3KYLA 4YR2A 3OHBA 3G4SS 1MROA 2RVJA 2FD2A 2KRBA 1QAYA 2HIQA 1Q1KA 3OVAA 4GKKF 4NLTA 2J7UA 2KDOA 5J1NA 3QAEA 2PE8A 3VF0B 4OHZA 2C22A 3FZBA 2BVZA 5K9FA 2L41A 2WTFA 1VLYA 2YWEA 4RBUA 4J9OA 2ROEA 1YJRA 3EYZA 1OQ6A 3VZHA 4I6WA 5B7WA 4DV3F 2YKMA 3U1LA 1WNEA 1U4BA 2KYXA 3T6JA 1RQ0A 3T1HF 4C8OA 1SIZA 3MMBA 1CEZA 2RKIB 2HVIA 1JLBB 1HBMB 4LQ3A 2JVRA 4I2PB 2RNEA 4FVCA 1EP4A 2OAUA 2F8EX 1TP7A 4Y00A 3EX7B 4QJVA 1JLBA 2R7OA 1RP5A 2BYCA 4RWWA 4ZCLA 4TQSA 3MUMP 2G4BA 4UUWA 5GAHI 5C25A 4C0HA 1RTIB 1QJHA 4QWEA 3V4IB 2DCLA 4EWTA 2XS2A 3LOUA 2DCUB 1FRHA 2DGVA 4OQJA 4ZPBA 5D6GA 2PA8D 1FD2A 2ZHOA 1J5OB 4F26A 1N8RT 3KHRA 3UDCA 4B3OA 2B43A 2D9OA 2QA2A 2F4VF 4WYLA 4OHYA 3T5LA 3VAKA 2BRLA 2D3UA 3QO9B 1CC8A 5KG4A 1HA1A 3RW7A 1J5OA 4UOCA 1S9FA 5F8MA 2GNKA 3UE2A 4V19J 3QJPA 4NXNF 4C7QA 5E7OB 2DPJA 1S1XA 1H2VZ 2LA4A 3CJ5A 2M88A 3DHWC 4BC7A 1WEYA 4WFZA 2JLFA 1Q8IA 3CDBA 3CB4A 1N6QB 3SQGB 3GIKA 4YMEA 3BQ1A 2OFGX 2A2CA 3OR1B 2XS5A 5HROA 5E2QA 5K8NA 1QSSA 2AYMA 1KVJA 4DN0A 1N6QA 3CCSS 3SQGA 3KLFA 1XERA 4IH6A 3MM8A 3MOZA 2VB6A 2OP5A 2ZJRQ 4BHQA 4X2BA 1FEHA 4PXEA 2VKZG 3EPIA 2DH9A 5HMZA 3M2UB 4LF7F 4ZVGA 1RT4B 1KQFB 3POTA 1Q4RA 1UVMA 1S1VB 1B0VA 2QLXA 4L3NA 3S01A 4EBCA 4FF1A 3QJJA 3VTIA 3Q24A 1IKWB 2JL9A 2CDQA 2C3PA 3UR3C 2BQ3A 4Q8FA 4F3OA 1I94F 1WG5A 3B78A 3JSMB 2DNOA 1FA0A 2LCWA 3GE9A 5LT5A 3BJYA 2KT5A 3MAQA 1T95A 4F02A 1FKAF 2I5JB 1IKWA 2AP6A 3TUIC 5IM0B 3PW2A 1M5PC 1UW4A 3G6VA 3DRSB 1FJCA 1GTHA 2MGZB 2RJZA 2E29A 2LEAA 2LQ9A 2I5JA 3OR2B 4KV8B 4HLBA 4C0OC 1X9MA 3AJ1A 4U67Q 4A8KA 2YQ3A 1LV5A 1KRPA 2MZSA 2V94A 2MGZA 1ZETA