1EETB

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
423
structure length
399
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 109
structure length 399
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetB02
5FDLA 5J1EA 3M9MB 1S6PA 1JLGB 3QO9B 2HWIA 1HPZA 2BE2B 4ICLA 4ZPBA 3PR5B 4NLYA 3KK1B 5F8HA 4ED7A 5L9XA 1JIHA 2ATLA 3FSIA 2YNIB 3ICLA 4LSLA 4TYBA 4Q8FA 1VRUB 4FS2A 1S9EA 3RBDA 2R8JA 5FDLB 4Q43A 3KLHB 3OL6A 4ZVHA 2ASJA 3MECA 1HPZB 4PUOA 3IRXA 4PWDA 1KHVA 4KFBA 2HMIB 3CJ4A 4O3SA 1RT7A 4K4YA 2HNYA 3KLEA 4LQ9A 3KLIB 2C2DA 2GIRA 1S9EB 2FLPA 5HBMA 2BR0A 1WNEA 3KLGA 3EPIA 4H4OA 1BQMA 1JLAA 3MECB 4MH8A 4NLDA 5T14A 2I5JB 4B3OB 3HVAA 1S6QB 1J5OA 2IAJA 4KSEB 3NMAA 1TV6A 1EP4A 2UUTA 3GV5B 3KLEB 1RTIA 2YNHB 4RW4B 5I42B 2D3UA 3FRZA 4URQU 5EUHA 3H5YA 2FLNA 4EYIB 3DYAA 2JLEA 1S9GA 3PHEA 2RF2B 1BQMB 3OHBA 3FQKA 5KG3A 3NAIA 2HAIA 3JYTA 5DG7A 4YR2A 3DMJB 4G1QA 3KLVA 1N4LA 2VA2A 5KFTA 4TQSA 1EP4B 3KHGA 2AGPA 4R5PA 3D28A 4O4GA 3BGRA 5C42A 4R8UA 3MEEA 2IM1A 1IKYB 3DYAB 5KFWA 4RZRA 3KK3A 2FJWA 2IM3A 3PVXA 2XGPA 4Q0BA 1XR5A 2AGOA 2IBKA 2RKIA 1JLBA 3UQSA 2WONB 3JYTB 1S1UA 1JLEA 5KFEA 4TY8A 1OS5A 1C0TA 2OPRB 4R5PB 5KFAA 5KFQA 5C42B 3DRRA 3E51A 3MEEB 4R8UB 3T5KA 3NBPB 2UVWA 3LP0B 4TN2A 3RB3A 4NCGA 1T05A 4J9LA 3DM2B 5KFUA 5C5JA 3DOLA 4NLQA 5KFBA 4O3RA 1XR6A 1JLQB 5HLFA 1JLEB 3KK2B 4KAIA 1N5YB 4IRDA 1R0AA 2BANA 1C0TB 4DL5A 3C6UB 2ZD1A 3DRSB 4XPCA 3DRRB 2EC0A 4URSA 4RU9A 3G6VA 4NCGB 4DL2A 4J9SA 1QAIA 1JKHB 1RT1B 3ISNC 3UDLA 3H5SA 3GYNA 5HLFB 1BQNA 2HNZA 1SUQB 3GIKA 4NLTA 1HQUA 2HWHA 4Y2CA 2R8HA 3CJ0A 4RUCA 2UVVA 5J2MB 3IGNA 1LWEA 4IG3A 1QE1B 2VA3A 1C1BA 5KT7A 4ECVA 1JLFA 5KFXA 3I0RA 2XI3A 1RT4A 3PW4A 5KFKA 3M9NB 4RNFA 4MIAA 1S1WB 3C6TA 2D41A 2HNZB 3GV7B 3JSMA 5F9LA 4R0EA 4WYWA 4Q44A 2IM2A 1GX6A 1EETB 2BRKA 4IG3B 4F4XA 3QGHA 2J6UA 2FVPA 5C25A 3ITHA 3NKYA 3V4IB 3KJVA 4HYKA 5KFIA 3QLHA 2GIQA 3KHRA 5J2PA 2VG5A 4FS1A 4MFBA 3M8PA 3QIPA 1W25A 4URGA 1IKXB 1NHVA 1IKVB 2DPJA 4IQXA 5F8GA 2W9BB 1LWFB 4NLPA 5C25B 5I3UB 2YNGB 1S1VA 1HARA 3CDEA 3VQSA 2XWYA 3IG1B 4NYZA 3DRPA 3Q8RB 1DTQA 5C24B 5F8MA 4GC7A 2IJNA 1TKTA 2V9WA 3MR2A 4PQUA 2JC0A 4IH7A 4MFBB 4EO6A 5KG5A 3QIPB 5DG9A 5DGBA 2XCAA 3GIJA 3GV8B 4TLRA 1HNIB 3RAQA 2UVRA 4MKBA 2GC8A 4KKOB 4EBEA 3IS9A 1FKPA 4RW7A 5KG1A 3EPGA 3OSPA 4QWAA 4ECYA 4JV2A 3BQ2A 2FJXA 1LWCB 2AWZA 5CYMB 3V81A 4RW8A 4RNNA 3PJWA 4PQUB 3FQLA 3QGIA 4WXWA 4ZPCA 4ID5B 3PR4A 4KHRA 2BE2A 4NRTA 4WE1B 5EWFA 1HYSB 3KK1A 4IKAA 1FKPB 3DDKA 2R8GA 3GIMA 3D5MA 3PW5A 5KFMA 1VRUA 3TAMB 2B5JB 1RTHB 1T94A 4KO0B 3BREA 3KLHA 3CJ3A 3LP1A 2UUWA 3MFHA 2HMIA 2DPIA 2J6TA 3KLFB 1S49A 3DLKB 2D7SA 1MU2B 4IH6A 3LP2B 4NZ0A 3KLIA 3KHHA 2OPSA 4F4ZA 2CJQA 1S0NA 4G3IA 1UWBB 3M8QB 4KV8B 1KHWA 3DOKB 2I5JA 4B3OA 3LP1B 1U09A 3BQ0A 4IR9A 1S6QA 3KHLA 4RUAA 4ED2A 1CSJA 4EBDA 2YKNA 3TQ1A 2YNHA 4RW4A 2R2RA 2OPSB 1HNVA 5I42A 1RA7A 4Y2AA 2OPQB 4U7CA 4J9PA 3MR6A 4XO0A 2RF2A 4TQRA 5KFYA 3NGDA 3DMJA 4I2QB 3DI6B 5KFZA 3DLGB 3NL0A 3H4DA 3V6JA 4IFYB 2YKNB 2R8IA 1HNVB 2R2SA 1S0OA 2W9AA 1IKYA 3Q8SB 4RNMA 3LALA 4O3NA 4O3OA 4J9RA 4O4RA 2XI2A 3I5CA 1NHUA 4TYAA 2WONA 3CIZA 1HMVB 3H98A 2W8KA 1NNDA 3KMSA 2WRMA 5CYQB 4ECQA 1MMLA 2OPRA 4KE5A 1C0UB 4ZHRB 2ASLA 3NBPA 3LP0A 4WZQA 1T03B 5KFPA 4IDKB 3DM2A 4O44B 1ZTWA 1RYSA 3LAMA 3TVKA 2BQUA 1JLQA 3FDSA 4LSNB 3KK2A 3H5UA 1N5YA 5F8IA 2R2TA 3MR5A 1N6QB 3SI8A 2VG6A 4IRKA 3C6UA 3DRSA 3HHKA 2C28A 1RT2B 2ZKUA 1RT6B 1TKXA 1GX5A 4WFZA 1C1CB 4DL7A 4IR1A 2V4RA 1JKHA 1RT1A 2JEJA 5K14B 2WCXA 3N6LA 5DG8A 1SUQA 2C2EA 3V6DA 1REVB 5DLGA 4ZVEA 3KOAA 1IKWB 2VG6B 2F8EX 4I7FB 3G86A 4ZP7A 5J2MA 4JV0A 2QE5A 1QE1A 1RT3A 1TKXB 5L1JA 2UVUA 3I0SB 5F8JA 1S1WA 4Q8EA 1SV5B 3QZ7A 3V6DB 4F50A 4LQ3A 3OL8A 1EETA 1RT3B 2E9RX 3QZ8A 1RT5B 2W7OA 1RTDB 4NLWA 3H40A 3V4IA 4YMEA 4ZVGA 4H4MA 4WZMA 4IFVB 3CVKA 4XPEA 1ZTTA 2OH2A 1JLCA 2HNDB 2YNFB 1JX4A 5KFDA 5J2NB 1IKXA 1S1TB 1IKVA 2IC3B 4RNOA 2W9BA 1RTJB 1LWFA 5I3UA 4KB7A 2YNGA 2JEGA 3IG1A 4EYHB 5C24A 4H4MB 3G6XA 2ASDA 4ECTA 1JLCB 2FVCA 3QYYA 4QW8A 1S4FA 4DG1B 2AU0A 1HNIA 5KT6A 4J9OA 4IRCA 2E9TA 4KKOA 5KT5A 1SH2A 4MK9A 1N56A 4K4ZA 3IGVA 3UR0A 4J9KA 3CDWA 1LWCA 5EWGA 5CYMA 4RW9B 2IMWP 1I6JA 4ZPDA 5KG4A 3PZPA 3QIDA 2JEIA 4QPXA 2RDJA 4ID5A 2ZE2B 4WE1A 1HYSA 2IM0A 1SH0A 1KLMB 5D3GA 4O3PA 5KG0A 5JUMA 5L1KA 1S1XA 4J9NA 3TAMA 3KNAA 2B5JA 4K50A 1RTHA 2FVSA 3OHAA 4KO0A 4X2BA 2B6AB 2C22A 2XGQA 1LW2A 3N6MA 2JC1A 3SFGA 5EDWA 3I5AA 4NLGA 3MEGB 5D3GB 4QWBA 3OLBA 1S9FA 3KLFA 1S97A 3DLKA 1S1XB 1TQLA 1MU2A 4I2PB 4QW9A 3LP2A 4H54A 2O5DA 3GILA 1DTTA 4FBUA 2V4QA 3GIIA 1XR7A 1UWBA 4ECXA 3M8QA 4KV8A 4RW6A 5HP1B 1LW2B 3DOKA 2XCPA 2J6SA 4TXSA 4M94A 4YP3A 4WFYA 1SH3A 1K1SA 4DL6A 2QV6A 1QAJA 4WYLA 1DTTB 2BRLA 2W9CB 3FFIA 1D1UA 2OPQA 4NLRA 1S48A 3T19A 3CWJA 1FKOA 4RW6B 2AX0A 3BSOA 3E01B 3CDUA 2BQRA 4I2QA 4JV1A 3DI6A 3DLGA 2FLLA 1JXLA 4IG0A 4QWEA 4IFYA 4J9QA 2ILYA 5KFGA 3FFIB 5J2QA 1QUVA 3T5HA 1FKOB 2ILZA 2JEFA 3HVWA 5F9NA 4NLXA 1TL1A 3G6YA 1HMVA 2OPPB 4WFXA 5HROB 3BJYA 1RAJA 2YKMA 5CYQA 3MTKA 4EBCA 4IG0B 4MK7A 1C0UA 4ZHRA 4NRUA 1C2PA 5J1EB 5J2QB 1T03A 4OL8A 1S6PB 4MKAA 4YR3A 2BQ3A 4IDKA 1RA6A 4KBIA 4K4TA 4ICLB 4O44A 2FVQA 4ED8A 5DLFA 1HQEA 4ZP6A 3V6HA 3PW2A 1TL1B 4KHMA 4LSNA 4DL4A 4Y3CA 3BSAA 5JXSA 2YKMB 4Q45A 1N6QA 3HKWA 4LSLB 5KT3A 3H2LA 4K4XA 2AQ4A 4RNHA 5KFJA 1RT2A 1RT6A 1T3NA 1C1CA 4PUOB 3IRXB 4YR0A 4ECWA 5DGAA 1IM4A 1HQEB 3MEDA 4TY9A 5K14A 4PWDB 4ZVFA 4KFBB 5KFRA 1TP7A 4ED6A 3T5JA 2R8KA 1RT7B 1REVA 2HNYB 1IKWA 1TKZA 4I7FA 2FJVA 5DQGA 5HBMB 3KLGB 1D0EA 3OSNA 4H4OB 4ED1A 3MFIA 1JLAB 2WK4A 3I0SA 4EO8A 1J5OB 3MEDB 2IAJB 5L1IA 1TV6B 4GC6A 1SV5A 1S0MA 1TVRA 1RTIB 2IJFA 3HVTA 1TKZB 1DLOA 3PW7A 5L1LA 3OL9A 4K4SA 1S9GB 5KFFA 4ED0A 1VRTA 1RT5A 3RB0A 1RTDA 5KFOA 3GQCA 3I5BA 4G1QB 4ZPAA 3PJXA 4IFVA 3CO9A 4MK8A 4K4VA 4O4GB 3BGRB 5KFVA 1TVRB 2HNDA 2YNFA 1TL3A 3HVTB 4K4UA 1DLOB 1FK9A 5J2NA 1RYRA 1S1TA 2AX1A 3M9OB 2IC3A 3KK3B 5KG2A 4ECUA 1VRTB 1RTJA 3V6KA 4Q0BB 3BSCA 3NAHA 2AGQA 2RKIB 1JLBB 2D3ZA 4DL3A 1S1UB 2R2UA 4TY8B 5KFLA 4JUZA 5KG7A 4QWCA 3T5LA 2RDIA 1TL3B 4DG1A 1FK9B 3Q8PB 1YVFA 1ZETA 2WB4A 5KFNA 3N6NA 1T05B 4O3QA 4HKQA 4MIBA 3DOLB 4QWDA 4RW9A 4F4YA 1R0AB 2BANB 4NLUA 2C2RA 5KT4A 2ZD1B 2FVRA 3H59A 2V0NA 3H5XA 3ISND 3MF5A 2ZE2A 1LW0A 4FBTA 1KLMA 4IOBA 4ECZA 4ZMMA 5DQIA 2E9ZA 3RB4A 5KT2A 3RBEA 3IN5A 3H4BA 1BQNB 3PW0A 1S10A 4F4WA 4ZP9A 1HQUB 2B6AA 1LWEB 4J9MA 1LW0B 1C1BB 4ED3A 1JLFB 2I1RA 2ALZA 3MEGA 3DLEA 1RT4B 3I0RB 3BR9A 3SFUA 4NLSA 3RAXA 2B43A 3OL7A 3CJ5A 4I2PA 3C6TB 4U6PA 3JSMB 4K4WA 2CKWA 2XC9A 5EWEA 2WTFA 5HP1A 4WXOA 5KFSA 5DQHA 3BQ1A 2VG7A 3LAKA 1K1QA 4EEYA 3ITHB 3DLEB 3MR3A 3KJVB 3KMQA 2W8LA 5KFCA 3RB6A 2IA6A 2W9CA 2W7PA 3QLHB 1RDRA 5J2PB 2VG5B 4NLOA 3LANA 3M8PB 4ZP8A 4Y34A 2VG7B 3E01A 5F8LA 4NLVA 3CJ2A 2WOMA 1S1VB 4M95A 3DRPB 4ECSA 1Z4UA 1DTQB 1TKTB 5F8NA 5KG6A 1JLGA 3QO9A 3QGGA 3OLAA 3BSNA 3T1AA 3UPFA 1N48A 4ECRA 3IS9B 2WOMB 2OPPA 4RW7B 5HROA 3EZUA 4DEZA 3Q8QB 4IH5A 5KFHA 2YNIA 2WHOA 3V81B 4RW8B 4YQWA
chains in the Genus database with same CATH superfamily
3M9MB 3MOJB 1X4GA 2KVQE 4A8QA 2W24A 4TYBA 4LSLA 3RBDA 2KG1A 4Q43A 3AD9C 4EZ6A 2DHXA 3DGPA 2FLPA 1X4DA 4B3OB 3GWCA 4URQU 1H2UX 2E7VA 3BB5A 5KG3A 2LDYA 1S6OA 1N4LA 3EJMA 4J9VA 4NX9A 2DGOA 4B17A 1OS5A 2LEAA 3LP0B 3TX0A 2A18A 4OYAA 5C5JA 1V3ZA 2HW3A 2XMVA 4RWWA 3BBCA 4LF5F 5HMXA 2ZD1A 3DRSB 3A3OB 3AA9A 1RXOB 1LOUA 5C2CA 1BC6A 1DFDA 2RMLA 2LA4A 2DR9A 3UCZP 5I4MA 2XO7A 4I67A 1CEZA 4G1PA 3SZ2A 4HYKA 1Z1ZA 4N76A 3L7PA 1N5VA 2VFUA 3VQSA 2E1AA 4B3TJ 2PD1A 4CO4A 4NXNF 2XYHB 2XHCA 2FJXA 2H51B 1FT8A 4RW8A 2F1FA 4JI0F 1OY6A 2R8GA 1HNZJ 1TL4A 2FJAB 1SPBP 2Z0GA 3BYPA 3UN2A 4ZJOA 3HO1A 3Q22A 2CZ9A 2R7RA 3BN7A 4ED2A 4UQTA 1CSJA 3UI3A 2ZZTA 1RACB 2OPQB 4ZVTB 4XO0A 2VC0A 1WORA 3HHLB 1GMUA 2W8KA 4JP8A 1HMVB 3K8VA 4I6WA 2G13A 1T03B 2GQQA 3DM2A 3M05A 1ZTWA 4P2MA 2CJXB 3HZGA 3OFGA 3M6UA 2F9JA 3MR5A 3NCPA 3ELHA 5EGYA 1U1MA 4DL0C 1MMDA 3LGNA 1WDDA 4KHPF 4WFZA 4N8NA 3L3CA 3V6DA 1SIWB 3SQGB 1EKRA 1N34J 3M2VB 1HR0F 3AHPA 4M8LA 4F67A 3EVMA 2LKZA 1RT3B 5H9EK 2AJQA 3V4IA 1Q8KA 1ZTTA 3OD2A 2IC3B 1LWFA 1RAEB 3MCSA 1K0TA 1S4FA 4OYOA 1FXRA 4OYIA 1WEXA 2WZ1A 2CQIA 3Q83A 1N56A 2VHGA 4KY3A 2Y0SD 3CJSA 3M2RB 2CJBA 5I3QA 4WE1A 4NEYA 4RPFA 1UPMB 2GFFA 4CLFA 5A8RB 4KO0A 4HTIA 3H90A 3SFGA 3GP9A 1UW9A 3AY0A 4NLGA 3KLFA 2DNOA 5H9FJ 4M94A 2FUG9 4GO7X 4B02A 2V94A 1HNXJ 4RW6B 4QCLA 4XDCA 1UCNA 3UCUP 4AXIA 2EBGA 4IG0A 3NWRA 3T5HA 1FKOB 1GXUA 2OPPB 4NEZA 5LSOA 1S6PB 4DPWA 1RA6A 2CVEA 2FVQA 1X5PA 4KHMA 2J7WA 3GFYA 1N6QA 3H2LA 2V68A 1Q8IA 3H7HB 1YKWA 1VQOS 1S5ZA 1U6ZA 2J9EA 1TP7A 4LRAA 1SL1A 1XMQJ 4USWA 1S4EA 3MR7A 3KG0A 2QA4G 1NZ8A 3DDIA 4YS2A 2XO6A 3ZZTA 1N33J 1RTDA 2HRUA 5K8MA 3M7VA 1C4AA 2YH0A 3CB4A 2YNFA 1F2GA 2E7WA 2H4YB 1F9EB 4U8VA 1T05B 4MIBA 3DOLB 1AZSB 3ISND 1LW0A 5KT2A 3H4BA 3ADAC 3E3XA 2BVZA 3MEGA 4I2PA 3UD3P 3ILLA 3W63A 3O5TB 1J2VA 3Q8YA 3POTB 2AF6A 4Y34A 4OX9J 1X4HA 3GCXP 2W4DA 3HD2A 2CZVC 4OV1A 2HQDA 1HQ2A 4P52A 4DS4A 1OO0B 4B9UA 3C19A 5DRKA 4B9MA 4CNZA 5L46A 5FDLA 3R5AA 2ATLA 2B9WA 2RRNA 2Z2MA 3JQKA 4A4JA 1M5HA 4HH1A 4DR2F 1S6QB 2VFRA 4CLPA 2YNHB 3DYAA 1S9GA 3TI0A 1X9MA 2A3JA 2HAIA 3KLVA 1TFYA 1D9AA 3S6EA 2X1GA 1KONA 4UZBA 1HW9A 2WONB 1JLEA 1QJHA 2AZ3A 1VQKS 3NBPB 4X4UA 4LRCA 4DOZA 2PN6A 1CJTA 2DNMA 1NB7A 3UDLA 3H5SA 1KEKA 4LMZA 4NYPA 2W2QP 3JSRA 4MTPA 4WK1A 3K8WA 2D41A 3G6ES 2Z30B 4Q44A 4F02A 1GX6A 5C25A 3JB9k 3OR2B 4U96A 2EWHA 2VG5A 4IQXA 1HBNB 4I68A 3B8HA 4ANDA 2QL5B 3OSPA 3MUVP 3NGTA 2GGPA 3PJWA 4IOAQ 1PIEA 3UDEA 3OQ2A 4QBUA 3DDKA 3QJPA 2GJ2A 1CQMA 4WF9Q 4EWTA 2ADBA 4IH6A 4PABA 4JI7F 3EVOA 3UNGC 3LP1B 2DCLA 3EUNA 1SKRA 3HT0A 3TQ1A 2R2RA 1RA7A 4PG5A 4USMA 5KFYA 2A0FB 3NL0A 2CJKA 1VFJA 2R8IA 4DF4A 2W9AA 4C3LA 1NHUA 2GIFA 2RUSA 5LM7E 1T9WA 1SB6A 2RHQB 2X1FA 4JI8J 3D0IE 2AYEA 2V4RA 2B0GA 1T9XA 4ZLPA 3DXSX 2CUYA 3EGNA 2R7OA 2XY6A 1YDLA 2M2BA 4B3MF 5ETSA 2C3YA 1IBCB 2X51A 2DR6A 5AXNA 2PE8A 1UJ4A 2E9RX 4BC7A 1S6UA 1VQPS 3CCJS 3U1MA 3TQEA 2LQ8A 2RIJA 1YIJS 3LWMA 2B8PA 3UR0A 5CYMA 4TU8A 4S0MA 4X4OA 2OEMA 4DV3F 4G1IA 2XM3A 3ET6A 3UNYA 1O8BA 1VQ9S 5JUMA 5A6WA 1IBKJ 2CA9A 2B7CB 1RTHA 3R2DJ 2B6AB 5D3GB 4QW9A 4NASA 4U8YA 3AFGA 2J6SA 1SC1B 4DL6A 4M5LA 1D1UA 2XS2A 2YWHA 3BSOA 3RGIA 2HHQA 2F5GA 4FVMA 2PT0A 4DV2F 3LPYA 4C48A 4NLXA 1GT8A 1Q7LB 2AJ1A 3G9CA 2HBZB 5GAEI 1X5TA 5CYJA 5K20B 3Q89A 1Q95G 3IXQA 4Q45A 1RWNB 4LSLB 2BXJA 2CRLA 4ECWA 5DGAA 2GVDA 2PO4A 1FDDA 1UA1A 3WC2A 4I7FA 3DGPB 1ZAVA 2K3IA 4I6YA 4FNIA 2Z4PA 2X1BA 1ZYQA 2H54B 2FJEB 2RB7A 1KOHA 3X1LB 1TKZB 4FXDA 3HSDA 4LF6J 4DV7J 3HVTB 1U7LA 2C2KB 3W66A 2CQCA 1J27A 1OIAA 3FNNA 4DV6F 1QDUB 2M0GB 2LLZA 4LFBF 4PWWA 2EKYA 4BBYA 3M8WA 3DGVA 1HBMA 3SCJE 4RW9A 1ZA2B 3BF4A 4D3HA 2ZD1B 4D3GA 3W5XA 2M88A 1URNA 3GLJA 1DQAA 2VBWA 2VICA 1FE0A 1O0PA 4DN9A 1VQSA 4J7CA 2PSZA 2N82B 1OY9A 2WTFA 1LKZA 2MHNA 3KXDA 2W8LA 3ILJA 2K1RB 2HVIA 3IMQJ 4FKXA 2NLWA 5LOQA 1Z4UA 1RSCA 1WKLA 3HSJA 3DLLQ 4P75A 1XBWA 4IH5A 3MOZA 4X4QA 3IR7B 4RW8B 2BV3A 3ETMA 2IPOB 4ICLA 1CJUA 1WF0A 4X84A 2NCKL 5JVGQ 3B6BA 3TVYA 3QT7A 2ASJA 1Y0HA 3DRXA 2IHR1 1N5SA 4F7VA 4PUOA 4EUVA 3GFZA 2OD6A 4CLSA 3D0GE 3EE3A 1S9EB 3MECB 4I0WA 5T14A 1YWXA 3RW6A 2IAJA 1RTIA 3C16A 4DX8H 3FQKA 3JYTA 1R27B 5DG7A 2VA2A 3M8RA 2Z8QA 4BS2A 1UVLA 2V2VA 3DM2B 3VF0B 4URSA 3A8EA 5A0YA 2MQNA 4DR4J 1WC4A 5BYQA 3CE8A 4Y2CA 2EVZA 3DCAA 5KFXA 1EHWA 4DI6A 9ATCB 1IR1A 1P1LA 3RTVA 3V4IB 2OUGA 4TNOA 3OT9A 1XIQA 1XNRJ 3MWBA 4DX7A 2R7VA 1NHVA 1FO1A 2VIHA 1LWFB 3US5A 1TZ0A 2MLXA 2CNLB 3QIPB 3OFHA 2HLUA 3AB4B 1I3OB 4MKBA 1KR4A 1DQ8A 2DIVA 2J7UA 1Z2ZA 3FQLA 4WE1B 5LMUJ 2N4CA 3MM6A 4DV4J 4KO0B 3CO0P 2WAQD 2R7UA 3P3DA 3FCHA 2I6WA 2VPXB 2UUWA 3KLFB 2HVDA 4F4ZA 1MN7A 2W01A 4DPYA 1RBAA 3T1YJ 2KRRA 3NEKA 4J9PA 4LF2A 3N01A 4FKYA 3MR6A 2E1PA 2RHSB 2L08A 2IDEA 1U1PA 2MQ8A 4G6VB 2IJRA 2C3MA 2AYBA 5DETA 3KDNA 2AIRB 3MAAA 5EX0A 2DNYA 4TVAB 2AHOB 1T9VA 4PXEA 4DV5J 3SI8A 1N6QB 2AEMA 3WQPA 1KLNA 2DHGA 3J81U 4LF8F 2WCXA 5DG8A 4PR6A 1NHKL 4HACA 4EK2A 4EZ9A 2DISA 4F50A 3RAMA 3W9IA 2V9KA 1DHMA 1RTDB 1PJ5A 2M8HA 4M63A 1G7CB 4R0JA 3I56S 1JK9B 1JLCA 2YNFB 4RNOA 3UE2A 2DRBA 1HI0P 2YX1A 1H0HB 1AA1B 1HNWF 3ETOA 2E9TA 3QPIA 3CUNA 2MKYA 4FYVB 4YY3F 4M5HA 2DD8S 4J9NA 4ELVA 3T1HJ 4WFBQ 3MEGB 3FJ2A 4I2PB 2NPIA 4KJIA 1AXQA 2ZDOA 2XCPA 2RS2A 4YP3A 2GHPA 2D9OA 8AT1B 3CWJA 4EU0A 2WBRA 1ZPVA 2AX0A 3A8IA 1R43A 4IFYA 2QL7B 1CULB 3R5BA 2W1BA 2ZVSA 5MLCV 1F5AA 1HHTP 4ZCIA 3V6HA 2HS0A 2V8DA 2P9EA 5KT3A 2E66A 2AQ4A 2KFNA 4NXMJ 1IQZA 4HT5A 2OHDA 1XEZA 2CPFA 4TY9A 2ZH9A 3M6WA 4ED6A 3QATA 5HI7A 3MCMA 2B4UA 4CH1A 3OSNA 1WDTA 3NS7B 5L1IA 3H0PA 4A46A 1ZPWX 2L3MA 2KG0A 1S9GB 2FB0A 2QYGA 3MMBA 3DXBA 2BACA 5KFVA 2KU7A 2V8HA 1FK9A 2AX1A 1OMSA 4X4RA 2MY7A 4QWCA 4OJHA 1APSA 4DBQA 2QYCA 2UXDJ 3HD1A 4DSJA 3CD6S 1NU4A 1S10A 1B4SA 4P72A 2BZ2A 5B0AA 3Q2TC 4ED3A 2NUHA 1U2RA 4LF1A 3NCRA 5EWEA 4ANCA 1K1QA 4ETXA 4OI6A 3ENQA 3RB6A 2QC3A 2VG5B 2CJ9A 4OZ5A 3G8QA 3JSBA 1KQGB 3BZQA 1VDHA 3BSNA 1IJFB 3TZYA 2GW8A 2QLFB 2J9DE 3IWNC 2H1YA 2ZH5A 2GGPB 4OZ0A 4M5DA 4GO5X 4ANEA 1T9UA 3RZAA 4F0HA 4Y28C 3GYGA 3TX8A 3A4TA 4KFBA 1YJRA 3KLEA 2C2DA 1YBTA 2E5IA 4FF1A 2WBMA 3TUIC 2GCFA 3P4UB 5BXIA 1BQMB 3DDNA 1U26A 1U1KA 4R8UA 1K9MT 3P5TL 3PEJA 1F0XA 2RKIA 3E51A 2D74B 3P8BB 2R3VA 4NLQA 1R0AA 1WEZA 3T9ZA 2DGXA 2EC0A 1Z2LA 4JI1J 4NCGB 2HBYB 1YJ7A 3GYNA 1HQUA 3RRKA 3SYZA 3PW4A 2UV8A 2J0QD 2GO9A 1VRQC 3R1HA 4KIAA 2GX8A 5KFIA 1LFPA 3I87A 2RJZA 4Z7YA 5IM0A 3CW2C 4WP8A 4C0BA 2HFVA 3ZZYA 4Q7AA 4PQUA 3GIJA 4MFBB 2FZGB 4TLRA 3RAQA 2GC8A 4EBEA 5CYMB 2A6OA 4Y0FA 3SDEA 1UA0A 4OHXA 3VVTA 5I3PA 5HN0A 3PW5A 4MYUA 1RTHB 1RWUA 2OP5A 1HWIA 2CG8A 2LEBA 3FMBA 1S76D 1RLDA 1RWMB 1XC9A 4RU2A 4HDHA 2RU9A 3HJVA 4L72B 1FVQA 2Y1RI 3R27A 3K89A 1KVIA 3J80Y 4LVNP 5AXKA 5SZTA 1Q7YT 3ZC4A 4HHHA 2XMMA 2ASLA 3A3PB 1ZAXA 4FXVA 3MCOA 2UV8G 2R42A 3C15B 4DV0J 1N5YA 3EXCX 1OYEA 3C6UA 3QT8A 2ZZMA 2J0WA 4IR1A 5L9NA 2LVWA 4AFFA 3VAKA 4ZVEA 4I7FB 1Q79A 2JSXA 3J7YU 1QE1A 3MMAA 5GAHI 4JV5F 3HXMA 2UXBJ 2ZH1A 3EWGA 2H9ZA 3D54A 1Q78A 4WIQA 4ZVGA 2PIIA 3R6GB 5HJYA 1YITS 1VQMS 2CPHA 4OZJA 3IG1A 4H4MB 3JAMY 5EN1A 1SH2A 1HBMB 4J9KA 2W25A 1LWCA 4KGKA 5DDPC 4RW9B 3EGWB 2JEIA 1A9NB 5M2PA 1SH0A 5KOWA 3G8TA 2B5JA 4K50A 1ZBTA 1NBEB 4OFZA 1LW2A 4LF4F 2KDOA 1X8DA 1BWVA 4FBUA 1HBOB 2BJ7A 2K06A 5E3QA 2J76E 1Q8BA 4QIEA 1K1SA 1K8AT 1DTTB 3FFIA 5FJ4A 1EX8A 1UVKA 2KM8C 5IWAF 3W62A 3DI6A 2G1DA 3TUPA 4I4BA 1D9DA 4P2SA 2CPZA 5J2QA 3IP0A 2ILZA 3OR1B 3BM7A 3BJYA 2YKMA 2LYVA 2HBRB 4MK7A 2FZKB 4NRUA 4CO2A 5HMYA 4ICLB 2HQCA 2Z2YB 1CJUB 4DR6J 2ZUAA 1RTZA 4KYZA 3SSQA 2FC9A 2G9OA 1C1CA 4PUOB 3CCVS 3MEDA 1IKWA 3KUGA 1V3SA 1F3VA 2GO8A 3FZ2A 3PACA 2IAJB 5LMNJ 1RTIB 3VGSA 2R7TA 3C16B 3UN3A 1A0OB 4ZPAA 1M90T 1D09B 1TVRB 1FA0A 4U9RA 1B70B 5K8PA 2XBPA 3HLUA 1WF1A 5LXYA 2LU1A 2F8HA 3IAM9 3O44A 1HHSA 3H59A 3H5XA 3RRGA 2ZE2A 1OYDA 3VR1A 5A0YB 1VIOA 2ROEA 1SIZA 1XERA 2B7BB 2ZC4A 4LREA 3TEGA 2Q66A 1W2BR 1KC8T 3DKDA 3RAXA 1WEYA 3PYEA 4OZLA 1SQGA 1NJXA 3MR3A 3KUHA 1SJRA 2W7PA 2VG7B 2D3OR 2WOMA 3QT5A 2JFKA 3PHTA 1N48A 3EZUA 2OTLS 3PFEA 4NA1A 3VGVA 1LNQA 1JLGB 5L8RC 2DIUA 1WC5A 3MM6B 3ICLA 1UKUA 2MEWA 5IXUA 2HHSA 1RU1A 4LQ9A 3MEKA 3D9BA 3W5ZA 3CSKA 1X0FA 4H4OA 3R5JB 1CS4A 8RUCA 4CH0S 3H5YA 4DCOB 4NZ7A 5B0BA 2CQ1A 4TQSA 2XZTB 1RBLA 5D6GA 4F3MA 3K5MA 1XNRF 2IBKA 2MPUA 4ZLJA 1D8YA 1MWQA 5C42B 1U6FA 5HJXA 1Q5VA 2DNZA 1HWLA 5DM7Q 3DRRB 3W1YC 5AE3A 3TZZA 1MROA 4J91A 3WC0A 5A2QU 4CTAA 4HACB 3EXYA 1FJGJ 5LJ3Y 1C1BA 2Q3PA 1SXLA 3WX8A 5AJ3J 1HWJA 1M1HA 1VMBA 2HFUA 2YXLA 1LXJA 2WSFC 1U0SA 3EPGA 4Y6IA 4ECYA 3BQ2A 1UPPA 2AWZA 4P10A 1U8SA 3HCXA 4AL6A 4DPXA 2J5AA 2F4VJ 3QSYB 3O2IA 3D5MA 3CJ3A 2HHVA 1PBUA 2HMIA 4X66J 3CCSS 3KHHA 4G3IA 2UUBJ 3MM5A 3QGPA 2FY8A 2YKNA 4RW4A 3TUZC 5CHCB 3DMJA 4IFYB 2WVDA 1HNVB 4O3NA 2RH3A 4O4RA 1S57A 3I5CA 3TP2A 3H98A 2ZHOA 1XK8A 4WZQA 3NS6A 4ALZA 4GRSA 5CCLA 1ZAWA 1NH7A 1OPZA 3PYFA 3MM9A 1W26A 2IDLA 2ZEJA 4PXBA 1YZ6A 1WOOA 2CNKB 2AYMA 3MM7A 3TRGA 1LFWA 1OSDA 5J2MA 4JV0A 2Y8YA 1R6YA 1S1WA 4Q8EA 2O3DA 1NK6A 3FRYA 2DCUB 3GTYX 1FX2A 1UFWA 3IWLA 3EM1A 4MKYA 5IT9U 3GB0A 2HHHF 2ZOGA 2YNGA 3IWXA 4EYHB 4M5JA 4K4ZA 2XQCA 1X9SA 2IMWP 4BCAA 2PC6A 3OXGA 3N28A 3OW2R 3QBCA 3ILIA 1FVSA 1EQ0A 5U47A 1PCAA 4NXMF 3OLBA 1QD1A 1Y11A 1WI6A 3GIIA 4KV8A 4N7TA 4XIUA 4NLRA 3NNHA 4DZ6A 1NDCA 3CCTA 1TK0A 4QWEA 2ILYA 4OX7A 2PEBA 1PYSB 4LFAJ 1KBRA 1JNZB 4MKAA 4M5DB 4ZPVR 1TL1B 4F26A 5JXSA 3BSAA 4F4KA 4MMOA 3UDVA 3Q2SC 4WWSA 5AT1B 1TR0A 5K14A 4KFBB 4A8WA 2Q43A 3P5BP 2L9NA 1D0EA 2N7CA 1ACMB 1F2HA 5KFFA 2R7WA 1LWXA 4DFPA 2UUAJ 2MQOA 1VC0A 1VLYA 3PX4A 4P9SA 4ECUA 2KFYA 1U02A 2NXEA 4AD6A 5ETNA 2RKIB 1WC0A 1HI8A 2RSQA 1YRUA 1PAUB 4UOFA 3D66A 4IO9Q 2FGOA 3Q8PB 3D67A 1KTQA 2ZKTA 2BKNA 3KJNB 2CQ4A 1RAIB 4OI1A 1WG1A 1DJ0A 1R0AB 1B99A 2QN6B 2C2RA 2BOAA 4RO0A 3H8YA 4ZMMA 3RB4A 4A8KA 3IN5A 4F4WA 1PKUA 1HQUB 5BYRA 3LGMA 3SFUA 3W8GA 1W7WA 2ZBRA 4G65A 4PYDA 3KMQA 5KFCA 2G0CA 3RRHA 4C8NA 1VBKA 4LF5J 3E01A 5IM0B 2CNOB 4RBTA 3OXLA 1PYTA 4OYWA 2NSBA 3UPFA 4DEZA 1U0HA 4ES3A 2QSFA 2ZJRQ 3SDEB 2CPJA 4CDIA 2B56A 2VDHA 3G82A 3TANA 4ZVHA 1T02A 3QAEA 2DITA 4DSIA 4JI1F 3RUBL 5ETOA 5FLXU 2ZH2A 3KLGA 4MH8A 4NXNJ 1JB0C 4JI0J 4G1QA 5FIIA 4YEAA 2VPWB 1JLBA 1SCJB 1UJ5A 3MEEB 1XR6A 4KPYA 3GYXB 1N5YB 4C3KA 3C6UB 2H5IB 1QSSA 4L73A 3NOCA 1VQNS 3GONA 1LWEA 1QE1B 3MMAB 4K0KF 5BJRA 3MPVA 1KRPA 1SJ3P 1YLXA 2A1BA 3NKYA 3AOCA 5B7WA 5JMNA 4QYRA 4AE5A 3ISZA 2JVRA 2VV5A 3MD1A 4M5KA 1RB0A 2BE9B 1WKKA 3IG1B 2J0SD 2GV1A 2OAUA 1DTQA 4V1Ak 4KHPJ 2V9WA 3GV8B 5F41A 5D4PA 2KFZA 1LWCB 3QGIA 1RAAB 1FJEB 1ZM2A 4HI1A 4DQPA 4AQYF 2B5JB 1PO6A 4DV0F 3BREA 3O8WA 2D69A 2O67A 1R8HA 2IMOA 3D68A 1VQ8S 4NZ0A 4DPUA 1KHWA 3HHLA 4AUKA 4EBDA 2MY8A 3QAUA 3DI6B 1VOMA 1V3RA 1RE1B 3N0VA 2XI2A 5IS2A 2XG8A 3VZIA 2KTQA 1U6BA 3MTJA 2YWFA 1RYSA 1XQIA 2BQUA 2CAJA 2R2TA 3OVBA 4A47A 4ZLNA 3MD3A 1V9OA 3SQGA 5E3PA 4WP3A 1C1CB 4BHQA 5HQLA 3BKUA 1IKWB 2VG6B 1I5OB 1BWEA 1DARA 2YWGA 1RT3A 1Q8LA 1PC5A 1LXNA 2Y3YA 1AW0A 3AB2B 4WZMA 1JX4A 1ELOA 3KJQB 2OJ3A 2DJWA 3AJ1A 4OI3A 4MYTA 4KKOA 3T6JA 1UVIA 2F3JA 5A8RA 3QIDA 1EQMA 2ZE2B 3N5FA 3MPUB 4DR6F 3TAMA 1PJ7A 1QY7A 3Q23A 3AT1B 2K2PA 4C8ZA 4I64A 2FIUA 4PKDB 4RW6A 3L09A 1JXEA 2KXFA 3DHWC 1KWMA 1SH3A 1QSYA 2IA6A 3DOMA 4MAKA 2HHXA 1FKOA 5LMNF 2DB1A 3CDUA 1QSLA 2FLLA 1I94J 1QUVA 1D9FA 2IY5B 3CTRA 2FPHX 1Y9OA 3T3FA 2K8GA 2NREA 4CYUA 3GJTB 3OTCA 2VPZB 3N4WA 4RNHA 1OJ4A 5KFRA 2CQ3A 3QFHA 2R8KA 3LF0A 2FJVA 2GHWA 4H4OB 1ZOTA 3I0SA 2O66A 3GSIA 1CS4B 1SL2A 1HHQA 2LXIA 2RRBA 5L1LA 4CLLA 1FDBA 2R4FA 3CO9A 2QLJB 3EX7B 2IVMA 1P27B 5GAGU 2BBEA 1VRTB 4DUZF 1WELA 5E0OA 5E3AA 3GG1A 1ULRA 4U7UK 4DG1A 2ZH7A 1VCTA 3CJKB 4F4YA 5IOLA 4DR2J 1NMEB 1MROB 1KLMA 3RBEA 3M2UA 2D3O1 2ZOMA 4ZP9A 2DGSA 1C1BB 1NUEA 3VAIA 3QRRA 2DNHA 5HP1A 1GMVA 1NJYA 4QIFA 1PBAA 4DSFA 1RDRA 3DNCA 2GA7A 5GMEA 2AJ2A 4H4KC 5THWA 3GCWP 2YKQA 1RADB 1T8EA 2HQFA 4K7QA 1FRJA 2ZH6A 2V8PA 4OYXA 1S99A 3PR5B 1BE4A 2ZOFA 2CPXA 5F8HA 4ED7A 1F3FA 1JIHA 4Q8FA 1J5EJ 1HPZB 2HMIB 3CJ4A 3BGFA 4P73A 5KAKA 4CM0A 1FJGF 5E3RA 4KSEB 3TJAA 2M9KA 4RW4B 2DEIA 2ZH8A 2CNNB 1JQGA 3DMJB 4JI3J 1UVNA 5KFWA 1LK7A 3PIOQ 5AJ3F 2BMBA 3L7OA 1S1UA 2NXNA 2EEYA 3CXCR 3W64A 3TAPA 1TFWA 3RB3A 5FD1A 4DR1F 4JI7J 4ED4A 4IRDA 3MM9B 1NLKL 2YKAA 3G2XA 2N7YA 4A8YA 4XDDA 5T7LB 5F3ZA 5J2MB 4PPDA 1S1WB 1FJCA 4ZA1A 4HH0A 2PA8D 3J80U 3D1HA 4IOCQ 4I6AA 5C7PA 3QLHA 4FS1A 2PA3A 4DX5A 4FN5A 4BC9A 2YNGB 1H74A 2KL8A 4DR5F 3MR2A 1FI4A 3FMWA 4WTYA 4IO1A 5ETTA 4FXWA 2OI2A 3V81A 5DDRC 2DGVA 1EARA 2H3EB 4WFNQ 4B3MJ 2L41A 2DNKA 4CQ1A 3SSSA 4CZCA 3RG6A 4ERDA 2QFJA 2DT9A 4UQGA 4FF4A 3LP1A 2NPFA 3OJSA 4KV8B 1HI1A 2QMXA 4KQZA 1U1OA 5I42A 1FD8A 1YTYA 1GMWD 1SVDA 2H65B 2DGQA 5K8NA 4JI6F 4DV3J 3F41A 3IM9A 4PG6A 2XTJP 4RLEA 1HWUA 5KFPA 5HMWA 1H38A 3H5UA 4HT7A 3GFXA 3MMCB 3PRDA 4OHZA 5K14B 3QQCD 5MAOA 4HI2A 2G0JA 3G86A 3B82A 4DCPB 3BGLA 2KXHA 3MPDA 4DV2J 2HS3A 1YHQS 4YMEA 1RKIA 3CVKA 2AT1B 1EIYB 4WKYA 1QTNB 1YSJA 5C24A 3S1TA 3HHEA 2ASDA 4ECTA 3ILOA 5AE2A 2HKEA 4CO5A 5KT5A 1VR6A 3ENAA 1SC6A 4PG8A 4JI2J 5D3GA 5KG0A 1FRHA 2LXFA 3SCKE 3OHAA 2XGQA 2JC1A 1G3OA 2Q79A 3I5AA 2C3PA 4KH0B 4USTA 1RCXB 3D6HB 4LBIA 4DV6J 4TXSA 2DH9A 2JLGA 3PV8A 4LFBJ 4DR3F 3BKTA 4NMXA 2QV6A 1QAJA 3T19A 1FX4A 2NQPA 2CWXA 3E01B 3CF5Q 4I1TA 1JXVA 1VQ7S 4PCQA 4YB7A 3B54A 4Y2MA 2OGUA 3OTDA 2HVZA 3THVA 3HVWA 3NRBA 3IC1A 4EBCA 1U0HB 1C0UA 4ZHRA 3PIPQ 5CAAA 1VBXA 3PW2A 3PKMA 1AFIA 4DL4A 2KJVA 3K5LA 3N9UC 4N5SA 1VLOA 1L3TA 3G82B 3S8SA 4FF3A 2XYGB 2K7KA 1HQEB 2E7XA 2ERRA 3T5JA 1TKZA 1H7XA 2JL9A 3L4BC 2V63A 3KLGB 2YQ3A 3M30A 3F56A 3PX0A 2W4PA 2YBVA 3HVTA 3OL9A 4QZVB 2IFXA 3N5BA 1RT5A 2KYXA 2JOQA 4G1QB 2PI4A 4B9SA 2W2PP 1S1TA 3M9OB 1L3VA 1JLBB 1Y10A 2LFVA 4B9NA 2LQJA 3TUJC 4OV6A 1SBRA 1U1NA 4P2FA 3W65A 1LWEB 2CQDA 2ALZA 2FDNA 3ZZPA 4QR2A 2PDAA 2K1RA 4W4MA 2I9SA 3DLEB 1VYAA 3QRQA 4ZK7M 3MXHP 2KJWA 2X7IA 1VHFA 2VJUA 3IBWA 5DZ7A 3JQMA 1DTQB 4L3KA 5D4NA 3OUYB 1JNRB 1BQXA 1CG2A 2HWIA 3CD7A 3QRPA 4F8RA 1F6TA 1L3SA 2MZ1A 3K2YA 1S9EA 3MECA 2NS1B 3K5PA 3A12A 4DS5A 2EC2A 2ZITA 3UN5A 2HNYA 1JLAA 1U45A 4ZDNA 5CABA 5GMDA 3NMAA 1X0PA 4WCEQ 2UUTA 3OFEA 3G8SA 3EVWA 4UY85 1VQ4S 2QZ8A 4C8KA 5LXRA 2B9XA 5KFTA 2ZBCA 1NJZA 1U2CA 3CULA 2OFGX 4I69A 2HHWA 4Q0BA 1SJQA 4ITSA 1LQ9A 3D3BJ 4DSLA 1X31C 3D0HE 3BN4A 2OEJA 3NP5A 3GFHA 3WZ0A 4O3RA 1WHWA 1YJ9S 4DL5A 2DNQA 2XMUA 1U1LA 2DO0A 4J9SA 3R6LB 4KR0B 2NXCA 5HLFB 4CO0A 3LWLA 4K5RA 2AEJA 4ECVA 3M9NB 4Q2LA 2HNZB 4IG3B 2X1AA 2KRBA 2FVPA 3B78A 2C2ZB 2RQ4A 3QIPA 4URGA 2AJFE 5B0FA 4O0NA 3DRPA 4LF8J 3HK2A 2DY9A 3P45B 5DG9A 2X3GA 3CJ8A 4F04B 4KKOB 1G6BA 4F2SA 2PFDA 3HFVA 4XAKA 1B7FA 5K9FA 1FKPB 3TAMB 3KLHA 2KVIA 5ETLA 3B4MA 1HL6A 3JTNA 2E5HA 2MSSA 1NJWA 3FVYA 3ZTOA 1U09A 2XSJB 3MAHA 4RUHA 1HNWJ 2VFSA 4BWMA 4Y2AA 3DOMB 2RF2A 3W2VA 4YY3J 2N4DA 5KFZA 2HFSA 3GG0A 3V6JA 4ZIWA 2BM1A 3UR3C 3Q8SB 2ZDPA 2VQFF 3E2EA 3KMSA 2DRAA 3SMZA 4CYUB 3TVKA 3FDSA 5ETVA 3OTEA 1Y3KA 2ZKUA 1VBZA 4CH7A 4DL7A 2W4CA 1SUQA 2ALYB 2RVJA 1U49A 5M2UA 3D4JA 3I0SB 1GTHA 1RU2A 2DEJA 3QZ8A 3H40A 2H5EA 4MIWA 2JWNA 3M32B 1IKVA 2BABA 5I3UA 1U2FA 2JNJA 2H5JB 1RHMB 3QYYA 1IXKA 4DG1B 2V2ZA 1I94F 3CDWA 4F0MA 2RU3A 1HYSA 1KLMB 4CLKA 1Y4ZB 2QTWA 5CD4A 3M2UB 4OZ1A 4IYQA 1KFDA 4TLQA 1PILA 2VPYB 2OEKA 1S1XB 1X4EA 3ZFVA 5HP1B 5HL7Q 2XSFA 2HRTA 3QJJA 1U47A 2RT3A 1CULA 2BQRA 4XTTA 5DO2A 1RAGB 2XEXA 2VODA 1RHKB 1UETA 1NKEA 2CADA 3GR0A 1HKAA 5IZHA 5B0GA 5HATA 4K4TA 4K59A 5ITHA 3BYRA 1RT6A 3IFEA 4ZVFA 4NCAA 2BOPA 5HMZA 2KXNB 3KFWX 1H2VZ 2CPYA 4DX6A 5CQGA 2PGCA 2M7SA 4YOEA 3D6FB 4CT8A 5KFOA 3IRWP 3I5BA 2IA0A 5D77A 2L48A 2M70A 1IQTA 3C8YA 3G4SS 1S1UB 1K0VA 2QFIA 4LSZB 2RDIA 4KPCA 1YVFA 4ER8A 3N6NA 3ZZZA 5M2RA 3CJQA 5GAEU 1WSRA 2P8IA 4PRFA 2CQGA 2XMKA 3H20A 1J5EF 1SC4B 1SKUB 3ZZOA 2VJVA 3BQ1A 4EEYA 3CDBA 4OI0A 2W9CA 3OTOJ 5CCMA 3QLHB 4NLOA 2ACMA 3HVRA 4UY8T 5F8LA 1N0VC 1YQHA 1DAXA 4OJ3A 4QIWD 2UXCJ 3F44A 3F73A 4JI3F 6FDRA 4ZS6A 3SV4A 1MWYA 2XY7A 3FBBA 3V81B 4YQWA 4C4WA 2EFVA 3QO9B 3UVJB 4NLYA 2GS8A 5L9XA 2YNIB 4FS2A 4JI5J 1AROP 3I31A 4LRDA 3ZNJ1 2VQEJ 4OZ3A 4PWDA 1BXNA 2CXEA 2WVEA 1FWKA 1Q86T 3PTWA 4USJC 2BR0A 4USKA 1BQMA 5F0UA 4YN3B 5I42B 1Y5LB 2JLEA 3M6VA 1SC3B 3FSXA 1U8WA 3KHGA 2MJUA 3KK3A 3MCNA 2OTJS 1XR5A 2V4JB 2B51A 3U1LA 2ZH4A 1FRXA 1XNQJ 4NCGA 4DXLA 1IR0A 3OTBA 3MM8A 4CP5A 4KGVB 3FEXB 1C0TB 1WC3A 2WSEC 1F5CA 1Q0NA 4K8RA 4Y2IA 3P96A 1QAIA 1BQNA 2Z2ZA 3MGJA 2VKZG 2HG4A 1JLFA 1JJCB 2ZZNA 3JSMA 1F5BA 2FZCB 2BRKA 2OSRA 5CA5A 3PDNA 4KGMA 2CFXA 2GIQA 3KHRA 4MFBA 2LXUA 3PRVA 4NLPA 1ZA1B 5C24B 4YB5A 2DHSA 2JJ4D 4ZVPB 1IBLF 4EO6A 1NPRA 4IH7A 2XCAA 3NNAA 4ILLA 4OI4A 3V5RA 3IS9A 4JV2A 3K7RA 1IJEB 4XK8C 4JV5J 2BE2A 3Q8UA 1NDLA 5B0CA 2F9DA 1A6LA 1NSPA 1KVJA 3Q8VA 4DF8A 1FRLA 1HA1A 2DPIA 1S49A 1MW7A 1S0NA 2G4BA 4P7TA 2CVIA 4IR9A 2ZWOA 2OFHX 3ZXWA 3QJLA 2OPSB 2IYIA 3HULA 3MUTP 3H4DA 2DNPA 2R2SA 4RNMA 3LOUA 3C15A 2E5JA 2FHJD 4LF4J 2W7AA 1NPKA 3M4XA 1C0UB 4ZHRB 3CCQS 2MZRA 5E33A 3LAMA 3TJ8A 1M5PC 4KH1B 2HVHA 2XLKA 2CQPA 1X4CA 4JI2F 1JKHA 3WX4A 4OHVA 5KOXA 5IWAJ 3R3TA 2M52A 3M30B 4ZN1A 3HSGA 4JBCA 4ATNA 1CC8A 3QZ7A 2LECA 1NJIT 2VASA 1RT5B 4OIXA 2W7OA 1M5VC 4F0KA 2BJ9A 4H4MA 3AQOA 3OPKA 2YPZA 4ES1A 1MSWD 1S1TB 1TELA 4W98A 2FLOA 1VQYA 5KT6A 2PMZD 1UWAA 4OYPA 3R5GA 1RHUB 1V5VA 2L9WA 3C3LA 4QPXA 2FHKA 1WHVA 2UUCF 2A2DA 3PX6A 2JH3A 3E8OA 2Z58B 1HBOA 5CZXA 5F3TA 4JI4F 4LIRA 3AXMA 3DLKA 3QSIA 1TQLA 3LP2A 1DTTA 3CT9A 5D8HB 1OQ3A 1TK8A 4PAAA 1RHJB 2BYCA 3OR1A 2E5LF 1UL3A 2PMHA 2CPDA 4C8MA 3H42A 2BKPA 1C2PA 4YR3A 4ID8A 3BGOP 3PJ9A 4IDKA 1PAEX 4O44A 2Q1LA 4Y3CA 1OY8A 3HM9A 5IQQA 4DR7F 3HFKA 3JS9A 1YX2A 3AA8A 2DHAA 2EFGA 2QX0A 3J7A1 2HNYB 2VC1A 1JLAB 2JZ5A 5LT5A 2COLA 3OBIA 3ENVA 3RBZA 1TVRA 1U25A 1UVJA 4ES2A 1FDAA 4CLZA 1LK5A 1R6VA 2VDIA 4IFVA 1AYEA 1ICEB 2D1CA 4X4VA 4Q0BB 3BSCA 5D4OA 1NK5A 4JUZA 2ZHBA 1TL3B 1VIXA 1ZETA 4QWDA 3PEHA 4ETZA 1KFSA 5KT4A 1SJ1A 2V0NA 1KNZA 2E9ZA 3LW5C 2VFTA 4M5IA 5B08A 2HHTA 2I0XA 2VG7A 1U1RA 3FCVA 4UUWA 1S79A 3J81Y 1VQ5S 3D6MB 2QMUB 1GEHA 4C7QA 3DRPB 4ECSA 1YRXA 3AQPA 5HQ8A 4OLPA 1JLGA 2EPIA 2JLFA 2OKQA 3QNWB 3G71S 5AXLA 1L3KA 3K57A 1F9FA 1FFSB 2KT2A 3OL6A 3KLHB 3IRXA 2B8QA 4GKJF 2MLZA 1TAQA 1FWPA 2JHEA 4FNHA 3HVAA 3DLBA 2FC8A 3FRZA 2ZNYA 2RF2B 3W2VB 2FQQB 3I32A 4B9VA 4YR2A 3DRYA 2AGPA 2XULA 3BGRA 1HD1A 5C42A 2RQCA 5D15A 1OPIA 5IV4A 4U95A 4FZVA 3BBBA 3U02A 1H6KX 4R5PB 2FJBB 3FBFA 5KFQA 3DRRA 3M8YA 2FYXA 4QU7A 4KAIA 2HYIB 5LSLA 3EYZA 2RAQA 1SUQB 3GIKA 2C42A 1E6YA 3CJ0A 2XMTA 4N41A 3IGNA 2DR8A 5KFKA 2QL9B 2IM2A 2Y1IA 2M5YA 1X7VA 3UO0A 5E5NA 2B9YA 4K2JA 3BPDA 4DUYF 1SJFA 3FZBA 1IKVB 4DQSA 5I3UB 2P9GA 4NYZA 4GC7A 3Q0AA 3EDQB 4A8OA 4LUBA 1CJVB 4QWAA 3AOAA 4CI0B 3ZNUA 1B0TA 3C66A 1HYSB 1R8BA 3KK1A 2F8MA 5KFMA 1VRUA 1T94A 1X4AA 5IC6B 3CJTA 4OHYA 2D7SA 3CMAS 4X65F 2HHHJ 2NUUG 4E8UA 2R7SA 5GMKa 3HHLC 1WG4A 4EMDA 3BQ0A 3KHLA 1YZ7A 2O01C 1Q16B 1Y3JA 1N5TA 1HNVA 1VK8A 2YKPA 2VBZA 2MKIA 3EDRB 3J7ZT 4J9RA 2V67A 4TYAA 1WG5A 1NNDA 1NZAA 2CWKA 4OX8A 4ZPTR 5HO4A 5B0DA 1MG7A 2V50A 1VISA 5LSRA 2XYPB 4RKUC 1RT6B 1GX5A 4LT6A 4FPIA 5HVFA 2C2EA 2GMHA 5DLGA 2DKOB 4UTGA 2QE5A 2HZVA 1RHQB 4LR9A 3OL8A 4OLOA 3VCDA 4FDFA 1HD0A 2LQBA 4WKRA 2DRDA 2Y0BB 1NSQA 3TO8A 1N88A 2VB6A 3LPEA 3G6XA 2AJ4A 3I4PA 5D0RA 5DDQC 3GJSB 4J9OA 2DH7A 4MK9A 1ZM3A 3VZHA 2EK6A 4ID5A 3TEHB 4O3PA 5A6PA 2RUGA 2FVSA 4LF7J 5D0EA 7AT1B 2XB2D 1NEEA 1MU2A 1XJWB 1NK0A 5IV3A 5GAHU 2GZOA 2RILA 4YDDB 1URRA 2BRLA 5LJ5Y 2W9CB 1S48A 1MNEA 9RUBA 1XMOF 4J9QA 3HX9A 1NM2A 1CJKA 2FHOB 5F9NA 1TL1A 3G6YA 1P9YA 4ED8A 4B3SF 3HKWA 1I1GA 4O0IA 4DQRA 1R0CB 1WNEA 4PWDB 3CIMA 1PJ6A 1REVA 4JYAJ 4LF9J 4EO8A 1KQFB 4LJMA 1SV5A 3A13A 1VHIA 4CT9A 1Q4RA 3ENWA 2IRYA 2VBYA 4TU7A 2HNDA 3R97A 1DLOB 5J2NA 1B7YB 2V6AA 3NG8A 3V6KA 3KK3B 2YH1A 3OTOF 2IRXA 2AGQA 2R2UA 4U67Q 5K5MA 3BR8A 4ENOA 2UXCF 4DSKA 4PG4A 3VWSA 3MM8B 3AJDA 4MT1A 4QOTA 2FVRA 3MF5A 4ECZA 5DQIA 2JVOA 1BQNB 2BKOA 2OLWA 3GMGA 1N5QA 4JI5F 1JLFB 1PSDA 4NLSA 2VQEF 3JSMB 5DQHA 4USVA 5IQ6A 3BKFA 1P9QC 2HURA 4OI2A 3LANA 3HP6A 3MHYA 4M95A 2YPYA 1P6TA 1OSCA 1E6VA 5KG6A 2G2ZA 3OLAA 7FD1A 2MZQA 3IS9B 1SKWA 2WHOA 2MQPA 1N32J 1GMWA 4K0KJ 3C2PA 4V19J 2BE2B 4ZPBA 1XNQF 2HS4A 3L7UA 2UU9J 1G4CA 4CLUA 2XS7A 2YY3A 1HLWA 3JSYA 3CCZA 1QUPA 2H48B 4Q2MA 1U24A 4NLDA 2NSCA 1CC7A 1T0TV 4F2RA 3GV5B 1BUXA 3PHEA 1WUUA 3FBCA 1EP4B 3D28A 2V8VA 3MEEA 2IM1A 2K3KA 5D0HA 1UJ6A 2AP6A 2FJWA 2MKCA 4QYZK 4AQYJ 3UQSA 5KFEA 3R7BB 4TN2A 3T41A 1P1TA 4J9LA 1M0SA 2Y9HA 4RBUA 1S0VA 3IAS9 3GIRA 3PRBA 1UTAA 2KO1A 1JKHB 2ZH3A 4NLTA 5E7OB 2QG9B 4RUCA 4ZJLA 2XI3A 3H25A 1WHYA 3GV7B 3CEDA 4F4XA 2J6UA 2ADCA 1T95A 3J7AN 3ITHA 3KJVA 4A8XA 3W9JA 5J2PA 3M8PA 3CDEA 4K5SA 3A1YG 2LDIA 5KG5A 1XMBA 2QLXA 1H72C 1IBMF 4WXWA 2V2QA 3PR4A 4KHRA 3PO5A 2P6TA 3VAGA 2RQMA 1VQ6S 4FVCA 4WIIA 3V4MA 3HDSA 3DLKB 3LP2B 4PQAA 2GQCA 5B0EA 1RCOB 2DYAA 2OO4A 4HVZA 2DY1A 2BW7A 1O5JA 2M4MA 2MKHA 3BDEA 4WU3A 1FFWB 3CIZA 4BDPA 1WC1A 2IYGA 4B9TA 4IDKB 1CBKA 4O44B 6FD1A 3HF5A 3KK2A 4GMKA 3TZXA 3UWTA 3TA0A 4WBFA 1EKSA 2VG6A 3NLCA 3HHKA 2F7VA 4NWBA 4AYBD 3HMJG 1RT1A 3KOAA 3MZIA 1NXIA 4W90B 1TKXB 3W60A 2UVUA 3PG9A 2MZSA 5DJBA 2I8EA 4J9UE 2GVZA 4LR7A 1EETA 3IR6B 2R7QA 4IFVB 2ZBQA 2VOOA 1X5SA 2XHWA 1IKXA 3CCLS 1B3TA 3FSYA 1NCLA 4E98A 1RKJA 3MAQA 1C4CA 1UP1A 1FRKA 4L3NA 3SV3A 4LFCJ 5IC4B 2YVSA 2XZWA 2KZZA 2AZ1A 4X2BA 1KP6A 1MWZA 2KYZA 2V4QA 4DUZJ 2V69A 4LR8A 2E5GA 1CQNA 1TL5A 4WFAQ 5A2QY 3TARA 4I2QA 5RUBA 4Q5VA 2V8GA 2QLWA 2PMWA 2KM8B 2G0IA 3L95X 3QFWA 4HEA9 3BBFA 2HSEB 1RBOB 3VAJA 4KBIA 4ZP6A 2CG4A 4OMFG 3GU0A 5KFJA 1RT2A 4LIWA 1T3NA 3K5OA 3IRXB 4QJVA 2MMYA 2MB0B 1S7HA 3WIUA 1ITPA 4YHHF 2EI5A 2E44A 4UF4A 1S0MA 3O1LA 1VRTA 2BJEA 3MI7X 2KI2A 3R8YA 3BGRB 1RYRA 3CJKA 1D3WA 1RTJA 4OZ2A 2LA6A 3T5LA 4ILRA 5DS7A 5KFNA 1M1GA 2BEFA 2OIHA 2ABYA 3EGVA 2K7JA 2I2YA 1GK8A 4IOBA 2ZJQQ 1BGXT 1E6YB 4J9MA 1IN0A 5D0GA 2B43A 3OL7A 3NS5A 2XC9A 2F4FA 2KT5A 5L39A 1ZH5A 1FXLA 4PWUA 3OJUA 2MDAA 3OXFA 4DR1J 4ZP8A 2EFPA 3IBFB 1K44A 4NLVA 3CJ2A 3UD4P 4ZVQB 3TOQA 2G1HA 1N36F 5J1NA 4ZKAA 4M5MA 4ELTA 3J81j 5J1EA 2CQ2A 1HPZA 2LCWA 5IT9Y 3KK1B 3ZZ0A 3W9HA 3W7BA 4FYYB 5HANA 1VRUB 2MJNA 1RT7A 1FWLA 5H9EJ 4AXJA 4K4YA 3D6TB 3HHLD 3HHDA 3R1LA 5HBMA 1EB0A 4USIA 4DR5J 5G0RA 4NA3A 1PGZA 3V2UC 1TV6A 3CD5A 1TK5A 3OHBA 4CLWA 4A8SA 4GKKJ 2RD5C 2YQ0A 1H3DA 4RZRA 2IM3A 2MZJA 2ZHAA 3HT3A 2WSCC 4TY8A 1O51A 4X64F 1WKJA 2UVWA 4F36A 2B4PA 5K8OA 5JVHQ 4GVLA 4W92B 1YGYA 4NMLA 3O6QA 5T7LA 4F25A 2WVFA 3EGZA 5BR8F 4RU9A 4DL2A 4ELUA 1VJQA 4LBHA 1WI8A 4N56A 2R8HA 2MHEA 2UVVA 1V6HA 4JI6J 2VA3A 3HSZA 2BUNA 1WWHA 1NDKA 2DNGA 2ZM6J 3K0JA 2CQBA 3SBMA 2DPJA 3Q8RB 2V34A 3ZZRA 3FEZA 2DVIA 1TKTA 2CDQA 2BJDA 3HI9A 2JC0A 5DGBA 4QIVA 3QWPA 3FCWA 2HFNA 3I4HX 4ILMA 1AUDA 4H4KA 1JJ4A 4ID5B 5EWFA 4NRTA 3GIMA 2NYHA 3T6BA 2QLBB 2HZAA 2J9DA 1MU2B 4ED5A 3RR7A 1JXLA 1FHTA 2CIMA 3AD7C 1WSVA 1IKYA 1CJKB 4AL5A 3ZTSA 2WRMA 2OPRA 1VBYA 1ZZNA 3MMCA 3OVSA 3VGTA 5ETMA 4B3TF 4OX6A 4DDFA 5G4DA 1WOPA 2PEHA 4DR3J 2H4WB 2NXJA 1T11A 1REVB 3CCUS 1N0UA 3JQJA 4Z2XA 4LF7F 4A8FA 3KDOA 1SV5B 3V6DB 1HNZF 1IWGA 1X9WA 3DLJA 1YJTA 2HNDB 5FLXY 3SIPB 5J2NB 1UAWA 2W9BA 5ETKA 2C1EB 4LBPA 3LA0A 4QW8A 2J9CA 2DR5A 2Q6BA 1Y5NB 3PZPA 2RDJA 1LV5A 2P5VA 4GVBA 3M1VA 3D1QA 1JJ2R 4UT4A 2L9DA 3CC7S 3AD8C 2QO3A 3S01A 4C6AA 5EDWA 1UZDA 1Q5YA 2HIYA 4QWBA 4NI2A 1ZZFA 3GILA 5F0WA 2MKKA 1QAYA 5KTQA 1L3UA 4JYAF 4LF9F 2RS8A 2CPEA 2EW9A 2ZFHA 1IR2A 1UFLA 4V19X 1N34F 2B9EA 1E6VB 3BO2A 2QIFA 2LMIA 3KYLA 2QA2A 1RAJA 1KSPA 4IG0B 2FHMA 3WIVA 2VBXA 4P7VA 1HQEA 4KC5A 2MTLA 1HBUA 2ZJPQ 2E1MC 1RWOB 3EMTA 4K2XA 5D4LA 3CMES 1Y7PA 3VAMA 4ED1A 2W2NP 1U1QA 1WTFA 1H98A 2CQHA 4K4SA 4ED0A 3RB0A 1PYOB 3AODA 1S12A 3M8SA 1FTCA 2DXDA 2D3ZA 4C9DA 2DGUA 2A6MA 4QIGA 3HFZB 3PO4A 1WJ9A 2WB4A 5CXTA 1HNXF 4EI2A 2MGZA 1WHXA 2GMJA 1UVMA 4NLUA 3ULHA 2YX4A 1N32F 4HR2A 5GADU 2UU9F 1LW0B 3DLEA 3BR9A 2ZC3A 3UCGA 2IVYA 2EFOA 3K59A 1T9TA 4ZIVA 1TUVA 3ITHB 1RWVB 3KJVB 1HW8A 2AD9A 5J2PB 3BEGB 4NE9C 3M8PB 1XMQF 5HVGA 3OUYA 2HHPA 3DLHA 2HVEA 2M3DA 1PG5B 2AJ0A 4AL7A 1N52B 2MLYA 3TYTA 5HROA 2NYIA 4RUBA 1N33F 1OQ6A 3BS9A 5KFHA 4N77A 4C8LA 1PC4A 4X4NA 4C11A 3TR5A 5FDLB 2FHJA 2F65A 4O3SA 3PM9A 5GVQA 4CLYA 3CDAA 1RUSA 3KKFA 2D3UA 5EUHA 1VK3A 4EYIB 3SSRA 1FFGB 5HVHA 2SXLA 1YJNS 4PZVA 3THTA 2QJ3A 3DYAB 1W2IA 2HGMA 4RX6A 3B4DA 3NGRA 4RWXA 3SEOA 1NPPA 5KFAA 2J0XA 4RR5A 1MN9A 5L38A 2FGCA 2RDDA 5KFBA 4OX9F 5HLFA 1JLEB 3KK2B 4XPCA 2ROGA 4OHWA 1RT1B 1UEKA 1T3OA 2HNZA 2CJYB 5EHHA 4IG3A 2XZDB 2ZWPA 1CJTB 1RT4A 1CLFA 4RNFA 2GVZB 2VQFJ 3NGKA 1EETB 4E0DA 2B4VA 3QGHA 2JRSA 1LEOA 1W25A 1IKXB 4OZNA 1AFJA 1M5OC 1NKCA 5C25B 2X3DA 1UZHA 2MKJA 5F8MA 3A8KA 1FKPA 3M8ZA 5KG1A 4OYMA 1BMQB 5DZ6A 4RNNA 3AAWB 2WW4A 4C98A 1XN9A 4UZCA 2WVBA 4DU8A 2Q6CA 2XSJA 1FRIA 2J6TA 4F4AA 1QLNA 3KLIA 2CJQA 2I5JA 2GJIA 3IO1A 2Z2LA 1KS2A 2HIQA 4I2QB 1NK9A 1VGYA 1DQ9A 4A8MP 4PXDA 4KE5A 2DXFA 2HQIA 3BPSP 2P2CB 1JLQA 1NK7A 4IRKA 4PYAA 2C3OA 1RT2B 3VALA 4J37A 2KHDA 2JEJA 2ZVIA 2ASYA 3W61A 2F8EX 4LFCF 4L74A 2LEPA 3MPYA 4LQ3A 4C8YA 4P71A 3M32A 2MKSA 1TTHB 4WK3A 4C8OA 4U7UD 2C2MB 2OH2A 5KFDA 2J8SA 1RTJB 3KG4A 3X3UA 2VKRA 4M5GA 3I9ZA 2BM0A 4ZCMA 1UFKA 2AU0A 4HDGA 3CMQA 3CGIA 3CC2S 3BO3A 4X62J 4ZPDA 2C3UA 1GQEA 2F40A 4A48A 1S1XA 1TAUA 1FERA 3R7NB 4DJBA 3RU0A 1GH8A 3ET6B 1NDPA 1XR7A 1UWBA 3M8QA 3DOKA 1S72S 3OVAA 4JI8F 3PYDA 3IA0A 1GFWB 2GAGC 3U27A 4OJGA 2GMLA 4JV1A 4P2XA 5KFGA 3CD0A 4WFXA 3U1NA 3MTKA 2XS5A 4MJKA 5J1EB 3N79A 1M5SA 1X4FA 4DCJB 2DHHA 4DPOA 1NO8A 1RAOA 4O23A 3MPWA 3LQVA 1X4BA 2DXEA 1RT7B 2KB2A 1MLAA 5HBMB 3MFIA 3EZ5A 3R5CA 5G0RB 4Y00A 4WTOB 2OELA 2GVDB 1TV6B 2IJFA 5H9FK 5DDOC 3NNCA 1IBKF 4CCHA 3H2UB 3QMQA 4FP9A 1FXDA 1R7IA 4DHVA 4CIOA 1FEHA 4PPZA 2FTRA 4L6V3 2VOPA 3GJQB 4C0OC 2HZCA 3NAHA 2FJDB 4TY8B 5HK4A 2XLIA 1FRMA 4UW2A 3TJ9A 2MQMA 2EKNA 1RP5A 4ZITA 3R9LA 1RWWB 2OD4A 2YWKA 1JMTA 4B3RJ 4HHUA 2HLTA 4C3MA 4WXOA 5KFSA 2O1PA 4CRJA 2MQLA 1UEVA 2HAFA 2QGFB 3FEYB 1DURA 4ZCKA 1TKTB 3MMJA 3QO9A 1ZM9A 3UVJA 3T1AA 2HQGA 4GKKF 1KN6A 1TL7A 2YNIA 5EX3A 1K73T 1KDNA 4LF6F 4JOUA 4DV7F 2HFOA 1U48A 1RI7A 3H2VE 3FSIA 3MURP 4YB6A 1KHVA 1NSAA 3NCQA 2GIRA 5CH7B 1J5OA 3AXKA 1IBLJ 3JAMU 2Y8WA 1QAXA 4KT0C 2FLNA 2RNEA 1R89A 4Z37A 2V4JA 3JTOA 2ZM6F 2QSWA 4O4GA 2BE7D 1IKYB 3PVXA 4X4TA 2XGPA 4DFJA 3JYTB 2GQ2A 2KT3A 1NAQA 1C0TA 2OPRB 4X4PA 2RE1A 2VL1A 3IR5B 2MQQA 1FTRA 5KFUA 4DN0A 2BANA 3NGSA 3ZTPA 2ZNZA 2G2OA 3CCWA 2YWWA 2HWHA 1R8CA 1F60B 1Y00A 2DK2A 5KT7A 3PFOA 3I0RA 3TA1A 1QM9A 1YK9A 3W3SA 1WOSA 2P9CA 3I82A 1BY9A 2LQ9A 5F8GA 2W9BB 1KQSR 1S1VA 1HARA 3R5DA 4Y65A 2WB1D 4NYOA 3DU6A 4AT1B 4RW7A 3D2WA 4N47A 4ZPCA 3FGVA 4WJBA 4GVBB 3M1VB 4IKAA 5J1PA 2YX7A 4YFUA 4L76A 1MMNA 3DHXA 1B0PA 3MFHA 4NI2B 3J7YI 2EK1A 2OPSA 4ZPWR 4RUAA 4DR4F 4U7CA 4ZVRB 3IM8A 3TZWA 1UMJA 2UUCJ 5CZVA 1S0OA 4DLGA 3LALA 4O3OA 5E41A 4JI4J 1RK8A 3WDOA 3TNVA 4PXCA 1TU0B 3MAAB 3TA2A 1AB8A 1TMJA 2QMWA 3KJFB 5F8IA 3PKYA 1ZM4A 1HBUB 1M1KT 1VS3A 2DGWA 4P74A 2N3OA 1NKBA 3MDFA 3VVUA 2E5LJ 2JFDA 5L1JA 5F8JA 5LMUF 2HBQB 4DV4F 3VAFA 2Z56B 3HPOA 1FNXH 3FC9A 4WU2A 1T7PA 3VHQA 3BDPA 4DR7J 3T1YF 2DGTA 1JLCB 4WP9A 3G96A 2KH9A 1HNIA 1SQEA 3UW1A 4DFMA 3FBEA 2MGZB 4WPAA 5KG4A 1FESA 2VZ9A 4FPRA 2IM0A 3LUYA 5A8KA 4RBVA 3PCOB 2HHUA 1Q53A 1S9FA 1F9HA 7FDRA 4HTJA 3CJRA 4H54A 2O5DA 4NZ6A 4ECXA 4DV5F 1GAOA 2MSTA 3NWGA 3L9ZA 4FYDA 4BWJA 4WFYA 3ZTQA 4ZJQA 2N3LA 2HRYA 1RAHB 1GTEA 1REGX 3DLGA 3R7SB 4C0HA 4Z7CA 3GSDA 2JEFA 2U2FA 5HROB 5CYQA 2KKHA 4NPOA 4R25A 2JX2A 1DY3A 3I9V9 4LSNA 1FNOA 3RJMB 4C11B 5A8WA 2XY5A 2Y1LB 2VFVA 4K4XA 2XWXA 1KVKA 3KWMA 3BV8A 1IM4A 2J7KA 2XNRA 2V2KA 2WVCA 1UEUA 2YTCA 4NCBA 2HK3A 1N54B 1NK4A 2ZBIA 3NMRA 1S7IA 2QA4S 2EG2A 3T1HF 2HWTA 1RABB 1QVFR 4MK8A 4K4UA 1TL3A 1YRTA 3D7SB 3MMBB 4DL3A 2M8DB 5KFLA 5KG7A 2KZMA 3HJFA 3TVZA 3SCIE 3RR8A 1RWKB 2EG1A 2HGNA 1FK9B 4RJVA 4GKJJ 4J90A 2VH7A 2E29A 4IQMA 4CO1A 3CCMS 2XMAA 4FBTA 1R8PA 3C14A 2W2OP 2I1RA 1RT4B 3GE9A 2FD2A 3CJ5A 1KKHA 3OV7A 2ROPA 3LAKA 3D1OA 1FKAF 3RW7A 3K58A 2G2YA 1YJUA 3W2WA 5D78A 3VQTA 4QYZJ 1I51B 5F8NA 1XTZA 3QGGA 2P6SA 2R9LA 3Q8QB 3CNQP 2LU2A 3HZEA 1FDNA 3FKBA 4CNYA 3I55S 2HK2A 4DUYJ 2JDJA 3KLIB 1AUSL 3EPIA 4DV1J 2I5JB 2UXDF 2A10A 3KLEB 4LVOP 2VU5A 2LP4A 5C2GA 5HSPA 3NAIA 4QQBA 3UFCX 2F63A 4R5PA 1FNMA 4UOHA 4ZLLA 3THPA 2J8AA 3LTOA 3W5YA 2AGOA 1ROFA 5BYSA 4R8UB 3T5KA 4X65J 1JLQB 5E3CA 1GNKA 4F3QA 2XLJA 1EAYC 1SQFA 3PNIA 4LRBA 4OYZA 1L5UA 2HQ3A 1DRZA 2DBBA 3K5NA 3P49B 3C6TA 1WF2A 4R0EA 1AT1B 4NOHA 2AV5A 2C2NA 3CCRS 1FF2A 5HAOA 1X5OA 4RL1A 3AH6A 1CJVA 2XWYA 3RBXA 3JXOA 4CWBA 1G1XA 2U1AA 1VC5A 2DNRA 5H1SV 4PQUB 2KN4A 2IRUA 4HLBA 4EGLA 5A76A 4KGXB 4F3OA 3BH6B 4ZVOB 4I56A 3F0NA 1Y5IB 1UWBB 1KD1T 3M8QB 4NA2A 4USUA 4OJ1A 3DOKB 1O6XA 4B3OA 1DZ5A 1S59A 2UVRA 3HHNB 4TQRA 1TMMA 3NGDA 2XNQA 4M1KA 3NY0A 3W8PA 4M5NA 2IBOA 2OSQA 3LP0A 2HFZA 2RQKA 2MXYA 3DRSA 2C28A 2AMCB 1KOOA 4ZVSB 4X62F 3CPWR 1VJWA 1CVJA 3N6LA 2I38A 2VF3A 2MZTA 4ZP7A 3TWZA 3BO4A 2ACYA 1XMOJ 3DU5A 5ADZA 4N8OA 2DO4A 1XWLA 5IT4A 1CPZA 3Q86A 5CD4H 4NLWA 3GZ7A 2Z57B 4Y2KA 3ZO7A 2CYYA 1NK8A 4B3SJ 4KB7A 2JEGA 1RZMA 1YBUA 2QA1A 2FVCA 4L75A 1A7GE 1QTMA 3IGVA 2NZCA 2Y1JA 5EWGA 1DBDA 3LO3A 1I6JA 2GAHC 1QVGR 1P8GA 3G87A 4ZVUB 5L1KA 3GR1A 5AXMA 3KNAA 1HR0J 3N6MA 3LGHA 3BH7B 1S97A 2AKWB 1RJJA 1LW2B 2DTJA 3SQOP 3PXGa 2WW8A 2EFNA 5DM6Q 3EICA 2LQ5A 4WYLA 1WTBA 2OPQA 4YB1P 4FF2A 2B3TB 4DWIA 1WACA 3FFIB 3ZTRA 2UXBF 1TL7B 1HMVA 2DNNA 4KGZB 5J2QB 1T03A 4OL8A 2YKMB 1BHNA 2R7XA 2BJ3A 1HIYA 4YR0A 3NOGA 1VI7A 2NR0A 1RGVA 5DQGA 3M2VA 1RQ0A 1J5OB 3MEDB 4GC6A 4B3RF 1DLOA 3PW7A 3ONQA 2QEXS 2XMJA 4TKTA 4O4GB 3CC4S 4CLTA 2HEKA 2IC3A 5KG2A 2ZUGA 2VONA 2PI5A 4DLEA 1SI9A 6AT1B 1Q82T 2CDRB 2YQ1A 4MKVA 3NGUA 5ETRA 1KQKA 2EXUA 2IIHA 4O3QA 4HKQA 4KRWA 4TU9A 2BANB 3M2RA 1TUWA 3P6YC 4QR1A 1SKSA 1YI2S 2KHCA 1WC6A 3TW0A 4ZCLA 1FE4A 3I0RB 1EJ7L 4J5OA 4K4WA 2CKWA 3SXLA 3KTQA 3AOBA 4E2FB 2QT7A 1S1VB 3EZOA 3C46A 1SJ4P 4YDXA 4QU6A 2WOMB 2OPPA 4RW7B 1TUGB 2MYFA 4USHA 5IT0A 3M6XA 4DSEA 3R2CJ 1S6PA 2GJFA 1UW4A 1X60A 1KTVA 1H7WA 2V5HG 1FEEA 2R8JA 2FY1A 1ZS6A 1GXTA 1U4BA 1NSKL 1FCAA 5GADI 1EP4A 3FUYA 1JWWA 2E1CA 1M5KC 1IBMJ 2NZ4A 3SCLE 3DFEA 2A2CA 2NXUA 3S7RA 4B08A 1T05A 1BLUA 3DOLA 1AZSA 2C2OB 3G6VA 3ISNC 3TAQA 4OQJA 2DNLA 3I6PA 4MIAA 4CM2A 3MUMP 3J7Z5 5F9LA 4CTAB 1H2TZ 4WYWA 1R31A 3DN9A 2CZ4A 2YWEA 3POTA 1OWXA 4DQQA 2E1RA 1B64A 5DLFA 1VQLS 3VV2B 2IJNA 2GHVC 4X4SA 1HNIB 3BGUA 4ZOSA 1RLCL 4B9LA 1G2EA 4DPTA 4CO3A 1Q81T 2BW2A 5A8KB 5E2QA 4NL5A 4DZDA 3D3CJ 4KTQA 4JB8B 5AE1A 2GNKA 1S6QA 3UD5A 3I96A 2YNHA 2RRAA 3MM5B 3DLGB 2DH8A 2YKNB 2BX6A 4YUDA 1K47A 5SUHA 2WONA 4C2MA 5CYQB 4ECQA 1MMLA 2IVFB 2AEFA 4UOGA 3NBPA 1YJVA 5HQMA 5JJBA 1YJWS 4LSNB 5A8WB 1R3NA 3VTIA 4PEOA 3WBZA 1TKXA 1S77D 4BLGA 3QT6A 3VGUA 3KG1A 1JJHA 2POKA 3LH2S 4QPTA 2XMWA 1HWKA 2OMLA 2F4VF 2EFQA 3MM7B 1BD6A 1F1BB 1YBAA 3NXZA 4ZN3A 3KUEA 2HPUA 3OR2A 4XPEA 4X66F 2CJAA 1HBNA 3A8JA 2UUBF 2ZBPA 2BA9A 1RHRB 4UOCA 1IM6A 1WD6A 4DU7A 3VAHA 2DR7A 4IRCA 1V5IB 1N8RT 3QWUA 4FYWB 2VD3A 4YHHJ 2AW0A 8ATCB 5ETPA 1GXLA 5B09A 2UZAA 1NH8A 1RAFB 3C14B 1RWPB 2C22A 2HGLA 2ATCB 2PFFB 3RYLA 4EFAC 3AJ2A 2QRRA 2VUGA 4UUXA 4FYXB 1B0VA 3JTPA 5T41A 3K17A 1NRKA 2D9PA 3W2WB 5GAGI 4HL9A 1T9YA 2AYGA 3GPAA 3IBCB 3KNGA 2BJ1A 3A3NB 5IFMA 1H73A 1NB2A 2UP1A 3PYGA 4DQIA 1FJ7A 2CPIA 2BQ3A 4DUTA 1D8ZA 4DFKA 3GJRB 2APOA 2WK4A 3OFFA 1N36J 2EBEA 1VC6A 5LL6d 1YG0A 1EZZB 4LRFA 2BDPA 1IVZA 1FD2A 3GQCA 1TKDA 3PJXA 4K4VA 4OYBA 1R0BG 1RWXB 2YKOA 4IUFA 1Q1KA 3T9NA 4QR0A 4HHJA 4P6QA 4C97A 3PW0A 1SL0A 4LFAF 2B6AA 4DMZA 3C6TB 4U6PA 3FK4A 3UDCA 1R8AA 1IUJA 4X64J 4DV1F 1HFEL 2BJ8A 2CQ0A 3WHIA 1IWAA 2W2MP 5BR8J 5ETQA 3O3LA 3ZZUA 4PG7A 3DC2A 2OMOA 3Q24A 3HKZD 4ECRA 1RISA 3PY8A 3U7JA 2UUAF 3CCES 2B4OA
chains in the Genus database with same CATH topology
3M9MB 3MOJB 1X4GA 4C4WA 1JLGB 2EFVA 3QO9B 1PC4A 5L8RC 2DIUA 4NLYA 4X4NA 4C11A 4A8QA 3MM6B 5L9XA 2W24A 2YNIB 3ICLA 4LSLA 4TYBA 1UKUA 3TR5A 4FS2A 1AROP 3RBDA 5FDLB 4Q43A 2KG1A 3I31A 4EZ6A 2FHJA 5IXUA 4PWDA 4O3SA 2HHSA 1Q86T 4LQ9A 3MEKA 3PM9A 2DHXA 5GVQA 4USJC 3DGPA 3CSKA 2BR0A 2FLPA 1X4DA 1X0FA 4H4OA 1BQMA 5F0UA 4B3OB 3CDAA 3GWCA 4CH0S 3KKFA 5I42B 2D3UA 1Y5LB 4URQU 5EUHA 1VK3A 3H5YA 4EYIB 2JLEA 1H2UX 3FSXA 3M6VA 3SSRA 2SXLA 3BB5A 5KG3A 1YJNS 2LDYA 1S6OA 4NZ7A 5B0BA 1N4LA 2CQ1A 4TQSA 3KHGA 2MJUA 3THTA 5D6GA 3DYAB 1W2IA 4NX9A 3KK3A 2HGMA 4RX6A 4F3MA 3K5MA 1XNRF 2OTJS 1XR5A 2DGOA 2IBKA 2V4JB 3B4DA 4B17A 4RWXA 2MPUA 3SEOA 1OS5A 2B51A 1D8YA 5KFAA 2J0XA 5C42B 2LEAA 3U1LA 2ZH4A 1FRXA 3LP0B 4NCGA 1U6FA 2A18A 5L38A 1IR0A 3OTBA 2FGCA 3MM8A 5C5JA 1V3ZA 5KFBA 2DNZA 4OX9F 5HLFA 1JLEB 3KK2B 1HWLA 2HW3A 2XMVA 4RWWA 4LF5F 3FEXB 1C0TB 5HMXA 5DM7Q 2ZD1A 3DRSB 4XPCA 3DRRB 2WSEC 2ROGA 5AE3A 1F5CA 4Y2IA 3AA9A 4OHWA 1MROA 3P96A 1QAIA 1LOUA 1RT1B 1T3OA 3WC0A 1BQNA 2HNZA 4CTAA 5EHHA 1BC6A 3EXYA 1DFDA 2RMLA 4IG3A 3MGJA 2VKZG 2LA4A 5LJ3Y 1C1BA 2HG4A 2DR9A 2Q3PA 1JLFA 1RT4A 1CLFA 4RNFA 3UCZP 1SXLA 2ZZNA 3JSMA 5I4MA 2XO7A 1F5BA 3NGKA 1EETB 2BRKA 4E0DA 2B4VA 3QGHA 2OSRA 4I67A 2JRSA 4G1PA 1CEZA 5CA5A 3SZ2A 3PDNA 4KGMA 4HYKA 2CFXA 2GIQA 3KHRA 1Z1ZA 4MFBA 2LXUA 1W25A 4N76A 1IKXB 4OZNA 3L7PA 1AFJA 1HWJA 1NKCA 1M5OC 1N5VA 2VFUA 1VMBA 5C25B 4NLPA 2E1AA 3VQSA 5C24B 2MKJA 5F8MA 4YB5A 2DHSA 1LXJA 2JJ4D 2WSFC 1IBLF 4EO6A 4IH7A 2XCAA 3NNAA 2PD1A 4CO4A 4NXNF 4ILLA 4OI4A 3V5RA 3IS9A 1FKPA 5KG1A 3EPGA 4Y6IA 4ECYA 3K7RA 4JV2A 3BQ2A 2FJXA 2AWZA 1FT8A 4RW8A 1U8SA 2F1FA 4RNNA 4JI0F 1IJEB 3AAWB 4XK8C 4AL6A 2J5AA 2BE2A 4C98A 1XN9A 3O2IA 5B0CA 2R8GA 3D5MA 2F9DA 1TL4A 1A6LA 2FJAB 1KVJA 2Z0GA 4DF8A 1FRLA 3CJ3A 2Q6CA 2XSJA 2HHVA 1FRIA 2HMIA 1HA1A 2DPIA 2J6TA 1S49A 3HO1A 1MW7A 3CCSS 1QLNA 3KLIA 3KHHA 2CJQA 1S0NA 4G3IA 2G4BA 3Q22A 2R7RA 3BN7A 2I5JA 4P7TA 2CVIA 3MM5A 4IR9A 2OFHX