4CO2A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
b'MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
total genus 21
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co2A00
1HWUA 4CO3A 4USIA 2XULA 2J9DA 1UL3A 3AA8A 1O5JA 3AH6A 2Z0GA 3X3UA 2EG1A 1OSCA 2V5HG 5D4LA 1V6HA 1UMJA 3O5TB 1NH7A 4Y6IA 5DS7A 3MHYA 1V9OA 4OZNA 2J9DE 1KR4A 1NH8A 3GSDA 4RX6A 2XG8A 4WK1A 3OPKA 4USJC 3DFEA 2NUHA 2NS1B 1H3DA 2NUUG 3TA0A 2EG2A 1QY7A 4C3MA 4C3KA 2JJ4D 4CO1A 4RLEA 4CO5A 1NAQA 1J2VA 1VHFA 2ZOMA 1NZAA 3AHPA 3NCRA 3O8WA 3TA1A 1PILA 4CNYA 4D3HA 5D4NA 1Q1KA 4AFFA 4IYQA 2DCLA 2VD3A 2GX8A 4CNZA 4R25A 4C3LA 4CO0A 4YB6A 4YB7A 1GNKA 2XBPA 1P1LA 2CZ4A 2RD5C 1V3SA 1UFLA 2GW8A 5DRKA 3NCQA 2GNKA 4OZLA 4CO2A 3N5BA 1VFJA 4CO4A 4E98A 3M05A 2XZWA 5L9NA 2J9EA 3AA9A 2J9CA 2E66A 3HLUA 1XK8A 3LF0A 4D3GA 2O66A 4NYOA 3CE8A 4YB5A 4RWWA 2PIIA 4WK3A 4Y65A 3TA2A 1UKUA 2O67A 4USHA 2ZFHA 4RWXA 5D4PA 3L7PA 3NCPA 3T9ZA 5D4OA 3BZQA 4OZJA 1O51A 4NYPA 4ZK7M 1V3RA
chains in the Genus database with same CATH superfamily
1FWKA 2FHJD 3C16B 4FYYB 5F41A 1T9TA 4RW4A 1N36F 4OZ2A 4DCPB 4K5SA 3PR4A 2F5GA 1RT4A 4L3KA 1RT1A 3LP1A 4QOTA 1RTIB 3ISND 2IIHA 1YRXA 3RBZA 3AD9C 1K9MT 3M8RA 2ZZMA 4QU6A 3C14B 2J0SD 9RUBA 1HQUA 4HR2A 3VALA 3NEKA 4RUBA 4L74A 1SJRA 3R97A 3HFZB 2GMLA 4DR1F 2DR6A 1F1BB 4QR2A 3M6VA 2X1AA 1HHTP 3MEGA 4MAKA 4ZHRB 5HVHA 3G8SA 4LF4J 1VQPS 2VQFJ 1D8ZA 2LQ9A 3RJMB 1WSVA 3CDEA 2UUAF 1WKKA 3QQCD 1TL7B 4Z7YA 4LRCA 2J6TA 4R5PB 4E0DA 3Q89A 4ATNA 1TKZA 3PKYA 4CI0B 2RDJA 4NXMJ 5DQGA 2R2RA 2N82B 3UQSA 3X3UA 1KN6A 5EWGA 3MR5A 4FF2A 1GTHA 4MYTA 1PO6A 2KYZA 4YMEA 2OI2A 3D6MB 1XJWB 1M5VC 2ATLA 1S9FA 3FGVA 2F9DA 3MI7X 4FNIA 1VQSA 3RU0A 1FD2A 1J5OB 2BE7D 2KRBA 1M5PC 2DY9A 3CW2C 4ZP7A 1IUJA 2D7SA 1Q82T 4R0EA 1FO1A 1PAUB 1EZZB 2M52A 3HHNB 2QSWA 3IS9B 4A8QA 1RLCL 2NXNA 4DLEA 2NSBA 4K4YA 4GC6A 2H51B 4TNOA 2C42A 4DL7A 1WNEA 4KBIA 4PXCA 2Y1RI 2PEHA 2HVHA 2ACYA 1VQOS 1JLGB 4Y3CA 1B0PA 1NK0A 2A0FB 1F9FA 4Q44A 1VI7A 5EWFA 4PZVA 1REGX 4EO6A 4KRWA 2Q43A 3ENAA 1KVJA 2GFFA 4OLOA 3BF4A 2R7OA 4OX9F 4DU7A 4LRDA 3CCVS 3WBZA 3D7SB 3ULHA 2OPQA 3ZTOA 3M2UB 4QPXA 2Y8WA 1UW4A 3GONA 1H74A 1UFWA 1N32F 4M5LA 4A8WA 4X4OA 1H72C 2V8VA 3AODA 5LJ3Y 5L9XA 4PWWA 4QYZK 4Y0FA 3IN5A 4DXLA 3DKDA 3CXCR 2R8HA 3LGMA 1HMVB 4U7UD 4F4AA 3BV8A 1CJUA 4WFYA 4WTOB 2OH2A 5DGAA 3UN5A 1YZ7A 4TU8A 1U2CA 4C8ZA 5J2NB 4CP5A 1S1WB 4Y65A 4QYRA 5D0EA 1LOUA 2C2DA 3OL7A 2MZ1A 2EEYA 2K06A 5DDQC 1NJYA 1YIJS 1N6QB 4CO3A 3CJ8A 2C2MB 3BPSP 3IFEA 4ZPCA 2HNYA 1TKTB 3KLVA 3FZ2A 3I31A 1MROB 2QL7B 3D6FB 3T1AA 1OS5A 2B4UA 2I6WA 1ELOA 4USVA 4DN9A 3EZOA 2RE1A 2OELA 5HMYA 3MWBA 5KFAA 4M63A 1O0PA 1NK4A 3M8PB 5ETVA 4YB6A 2FQQB 2A3JA 1ZM4A 2RT3A 3AOAA 4OJHA 2XY7A 2HIYA 1RHMB 3RTVA 2XY6A 3DDKA 4CT9A 4NA2A 4B9NA 4C4WA 1T11A 3CUNA 2R8GA 3PYDA 2E9RX 5D0HA 1HYSB 4DSEA 1RT7A 1Z1ZA 1RACB 2C3YA 2YY3A 3VCDA 4EYHB 1KLMB 1SJ3P 4CM2A 2HSEB 2XMWA 3M32A 2DK2A 1R0AB 4Y6IA 3AXMA 1LV5A 3OJSA 1KLNA 1J5EJ 3JTOA 2Y1JA 4Q7AA 2WSFC 4U8YA 1LW2A 2HS0A 4L73A 3NAHA 4TYAA 2VFSA 3TVKA 2WW8A 3V4IA 4XPEA 1LFPA 2IYGA 4MIWA 1NZAA 2OIHA 2FJDB 1Q86T 2H3EB 4J9VA 2KH9A 2VQEJ 1G7CB 3IBFB 4DX6A 1R89A 2DHXA 1JLQA 3JYTB 3MCNA 2FJEB 2VV5A 1Y9OA 1D9AA 3JXOA 1VQ6S 1UA1A 2JHEA 2UU9J 4XO0A 2GNKA 4Q5VA 2BRKA 3EVMA 3SV4A 3I0SB 4DX8H 3CCUS 1YJ9S 3SCLE 1KOHA 3QGPA 3BR9A 3E01B 5HVGA 4RR5A 2HWIA 2KU7A 3JQKA 2VFUA 2K3IA 3I4PA 4KYZA 3L7PA 2AYMA 1S1UA 2BE2A 1HWUA 3LWMA 2E5JA 3BGFA 4FS2A 4ZVFA 2G4BA 3TX0A 4IG3B 4C98A 3FMBA 2DGOA 4ED2A 4ERDA 1S1TB 2CQIA 3AQPA 1AA1B 2E1RA 2YNHB 2I9SA 2LKZA 3I5AA 5LXYA 1ZM3A 5KFEA 4PWDB 1NHUA 4K50A 2CWKA 1RXOB 4FF4A 1JIHA 3S01A 1UJ5A 4JI5J 1B70B 4ED6A 3RR8A 1IKYB 4DFMA 1FXDA 2PD1A 1DAXA 2L41A 3KHLA 4JI2J 3TAMA 3ZNJ1 3OHBA 4PRFA 1KVIA 2KN4A 5B7WA 3OR2B 1M1GA 1Q7LB 1FD8A 2E5GA 4D3GA 1E6VA 2DGQA 5C25A 2MTLA 4DR7F 2AJ4A 4WPAA 2W8KA 2BR0A 2BE9B 1S4FA 5IT9U 3RGIA 3MM6B 4P2SA 4W4MA 1HWJA 1OSCA 2YXLA 1W26A 3IWXA 3IG1B 4ECTA 4NLGA 1R6VA 2GC8A 3H2UB 3KMQA 2BANB 4M1KA 2XZTB 3VGUA 3KNAA 1IVZA 1SH2A 2MHEA 4MJKA 3P45B 3CDBA 3SSSA 1HNWF 3PCOB 2WVDA 3O44A 2KB2A 1N8RT 4OX8A 2FVRA 1B7YB 3DI6A 2HQCA 4C6AA 3PNIA 1S10A 1AFJA 4B02A 2AZ3A 4KFBA 3V6KA 5D78A 3CWJA 5L46A 1ZA1B 4IRKA 4ZVEA 3VGSA 2H54B 3TZWA 1QD1A 1T3OA 3KDOA 4DOZA 3GILA 5T41A 5HMXA 5G0RB 4F04B 2MZQA 4F4YA 2RF2A 2VJUA 1WI6A 5AT1B 3SFUA 3KK1B 5IS2A 4V19X 2GHPA 4WWSA 1NDPA 1R7IA 1IN0A 2V34A 4X65J 3EJMA 2W25A 1F2GA 1FVQA 1N5TA 4U95A 4OL8A 3CC4S 2L08A 3C8YA 3R1HA 2NLWA 5KFYA 3PDNA 1DQ9A 2XLIA 2VASA 4X66J 3AJ1A 1KFDA 2GZOA 1ZZFA 3OUYA 1TQLA 5KFMA 1H0HB 2VPWB 2P2CB 4P72A 4WK1A 2QA4S 3QJLA 4RBVA 3JS9A 3TP2A 3GB0A 1QY7A 4C3KA 3PJWA 3IGNA 1S1VB 1WSRA 3CIMA 2VJVA 4CRJA 5JUMA 3Q0AA 2R2TA 2BJ8A 1WEXA 2HPUA 2HZAA 2IVMA 3DLEA 3JQMA 3ENQA 4QQBA 1VQ9S 4O0NA 2VFTA 1NJWA 1NKCA 1TKDA 3EDRB 5CZXA 3HT0A 3UDEA 3CJ4A 1WDDA 3GWCA 3HMJG 3TAPA 1B0TA 2C2EA 3KG1A 4Y2KA 2WW4A 4NLPA 1S6QA 2DXFA 5DJBA 3K5MA 4F3OA 2IM3A 3ILIA 2AGQA 2MKJA 1PJ5A 4FNHA 4PXBA 3MEEB 1KEKA 3Q23A 2VF3A 2CPZA 4H54A 4ECVA 2MYFA 1FWPA 2LCWA 4BBYA 5LL6d 3D3BJ 3PX4A 5DDRC 1UAWA 4ZDNA 2FC9A 5D15A 2RS8A 4S0MA 5KG0A 1RBAA 2HVIA 1U2RA 1BQNB 1FJEB 1AUSL 2IPOB 4DV0J 1KHVA 4RW7A 4MKVA 5A6WA 2C3UA 4UZBA 5KFNA 4BLGA 3IMQJ 4EK2A 3CIZA 4XAKA 1VCTA 4QIFA 3QPIA 4QWCA 2XBPA 5KOXA 4KIAA 4CLWA 4PEOA 2IVYA 3BGUA 3EGZA 3QWUA 1NPPA 2EVZA 5L9NA 1G1XA 2DGUA 6FDRA 1DARA 1I94F 2O5DA 1WKLA 3OV7A 3KUHA 3DLLQ 3FFIB 3TAQA 1VQ7S 2G2YA 2HFUA 4FBUA 4V1Ak 1WHYA 1HA1A 3CJTA 4QW8A 2EXUA 1F9HA 1SL2A 3PY8A 1HNIA 2CZVC 3FZBA 2DR8A 4QR0A 4M5KA 3MHYA 3PZPA 3O2IA 3OHAA 4C3MA 1NJXA 4DS4A 2QMXA 3AQOA 2Z4PA 2VQFF 2VFVA 2R7WA 3ZTSA 2ZVSA 5F0WA 5D3GA 3DU6A 2RQCA 4WFZA 2E1CA 4DBQA 3QMQA 1RP5A 2WRMA 2HVEA 5DQIA 1BWEA 2M70A 2V2QA 4HEA9 1SXLA 1I51B 4MKAA 3ICLA 4X4PA 2G1HA 2LU1A 4DV4J 3DCAA 1XMQJ 3PACA 2VBXA 1D1UA 2ZFHA 5HROA 5HSPA 4F4WA 4DZ6A 4EBDA 3KUEA 3M9OB 4B3TJ 2LVWA 1HR0F 4OYZA 3KLIA 5IC6B 3TJ9A 4IRCA 4JI6F 3Q22A 4U7UK 5T7LA 2F40A 3RR7A 2AD9A 3DRYA 4TU7A 2NS1B 5KFGA 2M8HA 4DQRA 1D9DA 1HBOA 2BBEA 4K2JA 3I5CA 1TL4A 5HQMA 1Y4ZB 2QGFB 3HD1A 3CJKA 1RT1B 3LP1B 3PW5A 2MLXA 4X4RA 2HGMA 2GJIA 4OI1A 4PG4A 2CJ9A 1C1CA 1RKJA 1LK5A 2KJVA 1LWEA 3DN9A 1HQUB 2CJBA 2Y1IA 2UV8G 1RHQB 3M2VA 4DL4A 1HNXJ 3BGRB 2HAFA 3MPYA 4FXWA 4PQUA 1BWVA 2KI2A 2BEFA 2H65B 3TJAA 3MEGB 4Q2MA 4RWWA 3N6MA 2YNIA 4USHA 2FJBB 4X2BA 2OEKA 4JP8A 1BUXA 3SV3A 4WIQA 1RUSA 1T05B 3HI9A 1FDBA 5KFRA 4DPTA 4N76A 3C15A 3IAM9 4EFAC 3Q2TC 1TKZB 3MOJB 1V9OA 4QIEA 2QFIA 4YS2A 1NSKL 3BYRA 3W8GA 1FRXA 1S4EA 1FK9A 3D0IE 4NWBA 3UCZP 1NSAA 3D66A 2HZVA 2Q3PA 3HVTA 5ETRA 1F9EB 1FJ7A 3FQKA 2D69A 3DLGB 2QLBB 4B3RJ 3MR3A 4LFCJ 1XR6A 4C0HA 3HKZD 3MR2A 1QAJA 1HPZA 3M05A 2AEJA 5I42B 2HHSA 1N5YB 2DH8A 3K5LA 3OFGA 3HD2A 2ZITA 3R6GB 1SCJB 1X7VA 1TV6A 2CJYB 2PT0A 4DV2J 1WEYA 1FJGJ 2XS2A 5KFIA 3A8KA 2FC8A 2FJAB 1UP1A 3HP6A 1YLXA 4RW8A 1RI7A 1OPZA 4DV5F 5I3UA 2HFVA 1H2VZ 4N8OA 3FVYA 2BM1A 2ERRA 3LPYA 1KHWA 2DHSA 4BS2A 3BQ1A 2MZRA 4P75A 4F67A 3IR6B 4EBEA 2A2CA 1HHSA 3H25A 2BJ3A 3HSJA 1QTNB 2HFSA 1A9NB 4FPIA 4YFUA 3BSNA 3CVKA 3PIPQ 3CC7S 4QWDA 2OPQB 2VG7A 2DO4A 4AFFA 3J81U 4HVZA 1WOSA 3TANA 3DXSX 5IZHA 1U09A 1VBKA 3GIRA 2DNYA 4NLRA 4ZPWR 4X4TA 2E7VA 1IKWA 4YP3A 3C3LA 1J5EF 1UCNA 2FVSA 1N5SA 1Z2LA 3TUZC 5CAAA 1CJUB 3JSBA 4DR3J 2DNNA 2ZH4A 1F6TA 1VQ5S 1F5AA 3BO2A 2VQEF 4DPUA 3UN3A 4I64A 2UUBJ 3JB9k 4ICLA 3UDVA 5GAEI 3CCJS 3NS5A 4GKJJ 3G86A 4FKXA 1CC8A 2FZKB 1SIZA 3FUYA 4JV2A 3KK3A 2JH3A 1JXLA 1EHWA 3MMBA 2HNYB 2WVCA 3LH2S 3CJRA 4IYQA 2ZHBA 2HRUA 3CD5A 1HI8A 3WX8A 1PKUA 4RJVA 1S48A 1G4CA 3OW2R 4EO8A 3G8TA 3KUGA 4A4JA 2P6TA 2RVJA 3M2RA 2J0QD 3N01A 5D0GA 5GAGU 4J5OA 2CPHA 1FA0A 3T5JA 3BM7A 2O3DA 3V6DB 5CYQA 4DR5J 4HH1A 4USKA 4DL0C 1MMLA 2W9BA 4O44A 2IRUA 4JI5F 2OPRA 5ETKA 2E1PA 3ZO7A 5D4LA 4XTTA 2IM2A 4UF4A 4HT7A 1JK9B 2MKYA 3OTEA 4DV1J 1WF0A 3H5YA 2HHHJ 1F5BA 2OP5A 1GXUA 3D6HB 3RAMA 2IM0A 3W9IA 3BS9A 2JJ4D 3M32B 3DLKA 4A8OA 2IA0A 1U1RA 1UPPA 2GAGC 1LW2B 3Q8PB 3BDPA 3W65A 4NA1A 1S6OA 1HFEL 4OMFG 3V4IB 3FRZA 1DHMA 3TOQA 5H9EJ 1LWFA 3N28A 3RB4A 1N88A 2B43A 2UUTA 1FE4A 4TVAB 1KD1T 4A8XA 1JLQB 2EBEA 4FVCA 3KFWX 4JI7F 1HQEB 4GO7X 1VLYA 4IG0A 2RSQA 4JV0A 4BDPA 3H5UA 3UE2A 1UKUA 2HG4A 4EUVA 2DXEA 3MF5A 2IMWP 4HHJA 1M90T 3MPUB 3THVA 1NNDA 3CC2S 2DNZA 2JEFA 2AX1A 2AX0A 1WG4A 1NH7A 1X4BA 2ZOFA 4DL6A 2EFVA 2J9DE 3KLHB 1KVKA 1S1UB 5KG4A 2Y3YA 2BE2B 4PWUA 4R8UB 3C6TA 2F1FA 1NPRA 4NLWA 5E0OA 1HKAA 1KKHA 2IFXA 4A48A 4RNFA 4ILLA 2EFQA 4ZIVA 1UWAA 3GV7B 2NPFA 4DEZA 4X65F 1U1LA 3BQ0A 1L3KA 2JVOA 3D3CJ 3KXDA 4X66F 3ET6A 4JI0F 3J7YI 2QX0A 3T6JA 1FFGB 3L4BC 3OTCA 6AT1B 2IRXA 4DR6J 4ILRA 1NZ8A 4K5RA 4CH0S 2N4DA 2ROPA 1MU2A 1YTYA 4ZK7M 5E3RA 1E6VB 3AA8A 3DRPA 4X4VA 2Z0GA 5C25B 3A3OB 3DOKA 5K9FA 3HHLA 4LSNB 1BLUA 2GO8A 2OAUA 3TR5A 4CWBA 5KG2A 3OXFA 3P8BB 2QMWA 1FRLA 1Q53A 5ETMA 3QGGA 5DLFA 3PO4A 1OWXA 1QJHA 3I82A 3V2UC 1RTDB 4J37A 3Q83A 3DXBA 3M6XA 3OTOF 1QSSA 2CJXB 3D0HE 1IWAA 1R27B 1T9VA 4PABA 2IYIA 2CDQA 1Q4RA 3JAMU 1Q1KA 4ZIWA 2UXCJ 2LA6A 2Z30B 4IOCQ 3VVTA 2R2UA 1VLOA 1GNKA 1X9WA 2CQCA 2M8DB 2DXDA 4ED3A 3T3FA 4DU8A 4WU2A 1RTHA 4BWMA 2OO4A 1CPZA 5KFTA 3QIDA 3DI6B 4K4TA 1X5SA 4C8MA 1H2TZ 1R0BG 4NLXA 4KFBB 2CJKA 3HHEA 2LQJA 5HVFA 1EP4A 1RDRA 1JLEA 1YK9A 5ETSA 3MD3A 2E5LF 2W01A 2NXJA 4DV0F 2RF2B 3QAEA 2E29A 2OLWA 1RGVA 4J9KA 3QT8A 3GIMA 1GX5A 5F9NA 1ULRA 3LUYA 4WYLA 3L7UA 1WOPA 3PJXA 1O8BA 2RQMA 4QJVA 1X9MA 3MR6A 1RWWB 3J81Y 2X1FA 5DLGA 3QBCA 4FYDA 2VG6B 2YH1A 5KT2A 4DSIA 2RDIA 4NASA 3OUYB 3BKTA 2W8LA 2MLYA 4ZPDA 1AB8A 4FZVA 1LEOA 5IFMA 3OT9A 5K20B 5E3CA 1TVRA 3Q8QB 4EWTA 1CG2A 1IR1A 4H4OA 3H4DA 3RBEA 2NPIA 5CQGA 3NGUA 2B4VA 3PV8A 2AEMA 3R3TA 4H4KA 4O3SA 2QG9B 2IMOA 2R7VA 3Q86A 2C2NA 4QWAA 3GLJA 4B17A 4K7QA 4K59A 2XYGB 3HULA 1Q79A 2MGZA 2AMCB 2N7YA 1DLOA 4EU0A 2BW7A 4OYOA 4DLGA 1GAOA 3QNWB 4C0BA 2DNGA 1IKVB 3H42A 3OFEA 3LGNA 2RU3A 3N0VA 5GAHI 5GAEU 2IJRA 1S6QB 1UMJA 3MAAB 2XM3A 3KLEA 4F4KA 4DCOB 5LSLA 1G6BA 2DHAA 3HX9A 4C2MA 2JOQA 1TUVA 1Q78A 4YDXA 4CTAA 4IH7A 4USJC 3GJRB 3DRSA 3OTBA 2XWXA 5F0UA 4LF7F 2W24A 1RABB 1HNVA 4ZCMA 3PTWA 4KT0C 1D09B 1C1BA 2KO1A 4RW9A 3BGLA 2HLUA 5GMKa 4U6PA 4DV4F 1XMQF 3W5YA 4DG1A 4N5SA 1VRTB 2YWFA 1U25A 1FRMA 3JTPA 3NCQA 3KK2B 1WHXA 2OGUA 4DR1J 2DB1A 3DLBA 5K5MA 5B0BA 2DIUA 1TR0A 4Q45A 5J2MA 1D9FA 4O3PA 1JB0C 2V2KA 3GJTB 2VPXB 4XDCA 2AU0A 2LECA 4IRDA 5KFDA 4DPYA 3LP2A 2B9WA 1EETA 2UUAJ 3UNGC 3EVWA 2W2QP 1UL3A 3VAGA 2P9GA 2QIFA 3G71S 2BQ3A 3IM8A 2AEFA 5DG8A 3C6UA 2KVQE 3W9JA 3J7Z5 5HK4A 2QA2A 1RWOB 1HNXF 1HNIB 2EG2A 4Y2AA 3IBWA 2XMVA 2YWKA 5EX0A 2RIJA 4ZVUB 4Q8FA 1GMWA 2MQQA 5F9LA 3OVBA 4Q8EA 1HL6A 4ED8A 2ZD1A 1FDNA 2RDDA 1Y7PA 2FIUA 2DR7A 1GQEA 1C0TA 3KLGA 1NPKA 4EYIB 1SJ4P 1SQFA 2JLGA 4JUZA 4DSLA 2R8IA 1WTFA 2GMHA 1NJZA 3EXYA 7FD1A 2ASJA 3NGTA 1RWPB 3B6BA 1RAEB 1TK0A 3E2EA 1VC5A 5AE2A 9ATCB 2D3OR 4X4NA 3WIUA 1VQMS 3K58A 3ZXWA 2J0WA 3A3PB 4USTA 1IJEB 1FNOA 3G9CA 5KT4A 2KJWA 3IBCB 2Q6CA 5KFHA 4NCGB 4O4RA 2XI3A 4UOHA 5A8KA 2F8MA 1UEUA 3SQOP 3SBMA 4ECQA 5AXNA 2YQ0A 2X51A 3G8QA 4OX9J 1UVLA 4C97A 2C3PA 3MAQA 4F0HA 3KLIB 1N48A 1RWMB 4OX7A 4WXOA 5T7LB 4ZPBA 3LWLA 1V5VA 2XHCA 1HBOB 2EWHA 4ENOA 4W92B 1LWXA 3CJ0A 1MMDA 1G3OA 2BA9A 4Q43A 3SFGA 4CLLA 4LF6F 3KOAA 3GFXA 3MM9B 5M2RA 3J7YU 4LIRA 2UVRA 4KO0A 4MYUA 4N77A 2DBBA 2XS5A 3C19A 2MKCA 1B4SA 2MZJA 3RRGA 1K1QA 1LWEB 3CO9A 2HRYA 4M5GA 2ZUAA 3T5HA 3G82A 3EDQB 2BKPA 3J80U 3M2VB 2G0CA 5HP1A 1MSWD 4DHVA 2UVWA 1ZTWA 4PQUB 3D1QA 3GG1A 1S12A 3NL0A 4OJGA 5EUHA 1EAYC 2NXEA 3GJSB 1I3OB 3MM7A 3UI3A 2YNIB 2BJEA 2AT1B 2HFNA 3T5LA 1RAOA 2PE8A 4R0JA 3OJUA 2DRBA 4DSKA 3M8WA 2GCFA 4PPZA 3D54A 1RTJA 5F8HA 2KM8B 3ZFVA 4ZVQB 3OL8A 3U1NA 1I6JA 3KG4A 1ZOTA 2KVIA 1FK9B 4WJBA 3DNCA 4DR3F 4CQ1A 1R6YA 2XQCA 5L1JA 5A8RA 2FLNA 5F8NA 2V67A 2FLOA 1YSJA 3LW5C 1XN9A 3ZC4A 4OZ1A 2BKNA 3TZXA 5GVQA 1ICEB 2UUBF 2ZDPA 3QRQA 4C7QA 2KT3A 3NGSA 3WQPA 3CCTA 2HMIA 1HPZB 3MAHA 3PW0A 2KM8C 5HQ8A 1S0NA 4TU9A 2AGOA 1S7HA 2D74B 1REVA 1P8GA 4USIA 3D4JA 2MSTA 3KJVA 3T9NA 4BHQA 2R9LA 3EVOA 3FNNA 2Q6BA 3GP9A 1U49A 2HLTA 3AFGA 3JQJA 3WIVA 1XC9A 4MFBB 5KFOA 2QZ8A 4RW8B 5HN0A 1SQEA 1RWNB 5I3UB 4RU2A 3QYYA 1V5IB 2RRBA 3QGHA 4ED4A 2GHVC 4LVNP 4CLFA 3QLHB 4OI4A 4WE1A 3GCWP 1VK8A 2ZC4A 1TFYA 3TYTA 3CPWR 2DVIA 1QE1A 2B8PA 2UVUA 1SVDA 2P9CA 2GS8A 1Z2ZA 3BSCA 3DDNA 1RAJA 3R9LA 1DTQA 2B5JA 1CS4A 2YVSA 1VBZA 4YB5A 2AQ4A 4F25A 4HKQA 2IA6A 1URRA 1YBUA 1IKWB 5BYSA 3QATA 3FJ2A 5KFUA 3TI0A 3U1LA 3IAS9 2RQ4A 2V50A 3ILJA 4OHWA 3W5XA 1SKWA 4P9SA 3DFEA 1SJ1A 4KTQA 1OYEA 3BKUA 3ZZUA 4B9VA 4ICLB 5A8WA 3QAUA 1VS3A 1OO0B 2KXHA 2ROGA 2WVFA 3FBCA 5ETTA 2ZOGA 1PILA 2NXCA 3Q2SC 2WBMA 5CXTA 4ECYA 1D0EA 2J7KA 4DFJA 2AV5A 2DT9A 1KTQA 5LXRA 2G13A 2W2OP 3OR1A 4CH1A 2X3DA 1R8AA 3CGIA 5SUHA 4M5JA 1GFWB 1X0PA 2DNHA 3QGIA 2BQRA 2F63A 2YBVA 4MIBA 1TAQA 2CA9A 3KTQA 5L1KA 2HRTA 5DGBA 2IVFB 3PJ9A 2J6UA 1UETA 3R2DJ 2A1BA 3VR1A 3CB4A 2UXDF 5IM0A 2VPZB 1S9EA 3Q8RB 4I56A 1BQMA 2OPSB 2W7OA 1L3SA 1X9SA 5IQ6A 3QJPA 3SEOA 3UCGA 5DS7A 5CYQB 4K8RA 2LMIA 1P6TA 2XYHB 4ECWA 5J1EA 3KNGA 4EMDA 4TLQA 3F56A 2OPRB 3D28A 2B4OA 2IAJA 4G1QA 1SI9A 1QM9A 4FXDA 3QO9A 3OSNA 4CZCA 2HQDA 1S6PA 1UVMA 5KFQA 1GMVA 1H73A 2LA4A 1HNZJ 1PC5A 1ZH5A 1PBAA 4K4UA 2Y8YA 4FF1A 1UEVA 4JI1J 1Q8BA 3IXQA 1W25A 3NWRA 3AT1B 4ECXA 1U1NA 3DLKB 1HQ2A 4LRAA 4NOHA 2FHKA 1C4CA 1TFWA 1DQ8A 1U6ZA 4L75A 1LWFB 1JJHA 1Q8IA 3M6WA 4J9PA 1OQ3A 1T8EA 3NS6A 1Q95G 2HNDB 3NCPA 4K0KF 1FJCA 3TUPA 2SXLA 1XWLA 5EWEA 2RNEA 2CKWA 2ZC3A 2A2DA 5FDLA 2R7RA 2FVQA 1PYOB 5FJ4A 4KV8A 1RU2A 3M8QA 4RO0A 4J9QA 1WKJA 2YKMA 2BM0A 2QN6B 4IDKB 2HHUA 1L5UA 1J2VA 4KH1B 2ZH7A 4KPCA 4FXVA 2FYXA 3ILOA 3C6TB 2BMBA 2MY8A 3GIJA 4ZJQA 3VWSA 1TK5A 1RAHB 3HSGA 2R7SA 2KFNA 3CDAA 1D8YA 4GKKF 1TELA 3MECB 4F0MA 1YKWA 3VHQA 3N5BA 3CCQS 3MCOA 2D9OA 5KFFA 1FFSB 4LR7A 3PRDA 3HVWA 4ILMA 4MH8A 3QSYB 2ATCB 4KR0B 4ID5A 2VIHA 1RWXB 3BREA 3BBCA 4ALZA 3ET6B 2J7WA 5D4OA 3CTRA 2NREA 2MKKA 4TKTA 3LAKA 2UUWA 4KGVB 2L3MA 2I0XA 2WTFA 3OFHA 2QA4G 2HVZA 3F0NA 4IH5A 1HHQA 3S1TA 3AOCA 2BV3A 1K73T 2BRLA 3SCJE 1TL3A 1MU2B 4AYBD 4J9OA 3QSIA 4K4VA 2XMUA 3DRPB 3ENVA 4URQU 3GSIA 4RLEA 3HHLB 2PN6A 1VYAA 2NCKL 4Y00A 3TZZA 1CJVA 5AE1A 2PSZA 1NJIT 1Q5VA 4ZVHA 2BJ9A 2EFOA 2YPZA 4AL6A 1U45A 1SBRA 2QO3A 4USMA 2CQPA 4NCBA 2KZMA 3NNCA 3OLBA 1NEEA 5MLCV 2J9EA 2VC0A 5HBMA 4ANDA 4ZCIA 1PSDA 3RBXA 4RW6A 1SKRA 1FDAA 2FGCA 4YUDA 1N5QA 3POTB 1FNXH 4IUFA 1NCLA 4B9MA 4KGKA 1RTHB 2LDIA 1X4GA 1YJNS 4CLTA 5BR8J 1I94J 3HHLC 5J1PA 3J7A1 2F65A 1FRHA 4JI4J 4DV6J 3UNYA 1QAYA 3AJ2A 2EI5A 1ZYQA 1QAIA 5F3TA 3SMZA 4P2FA 1E6YA 3A8IA 1B99A 1O5JA 1HW9A 3P6YC 1EP4B 1JLEB 2EPIA 1AZSB 4ZVTB 2HS3A 1XMOF 8RUCA 1H3DA 2HBZB 2NXUA 2K7KA 4L3NA 2HFZA 2MMYA 2W7PA 4RBUA 3C14A 2MPUA 3QRRA 3FBFA 4PAAA 2CYYA 1R8BA 1T0TV 2RB7A 3TWZA 2WSCC 3DGPA 3VVUA 2DH7A 1Y10A 5GADI 4HDHA 2B7CB 1PG5B 1RHUB 1K0VA 1N33J 4CYUA 2LYVA 2YKNB 1TVRB 1T03B 4B3OB 1U2FA 3BBFA 2XO7A 2B8QA 3K5PA 2JNJA 1RT6B 1TL7A 3IRWP 3R7NB 4OYMA 1BXNA 3JSMB 1Y0HA 3ENWA 4QBUA 1JLBB 3OL6A 2N3OA 4ZN3A 2NR0A 2B7BB 1RWKB 5B09A 1P1TA 1AFIA 4ZPAA 2R4FA 1DLOB 3ETOA 3OQ2A 4P2MA 3CCMS 4RL1A 1QUPA 1KR4A 2DHGA 1HR0J 4JI6J 2VA3A 4PG5A 5LSOA 3G6YA 1KBRA 1R8HA 3KLEB 3UR3C 4CTAB 5HANA 2BOAA 4WCEQ 1VQKS 3DMJA 3DRSB 4KHPJ 4Z7CA 5DO2A 1L3UA 3QT5A 1EIYB 3P4UB 4OLPA 1C1BB 2MEWA 2GGPB 4RW9B 4UOFA 2XMMA 2RKIA 1OSDA 4OFZA 4DG1B 2BYCA 4ZN1A 2LQ8A 1CJKA 1H7WA 2OJ3A 3QT6A 1OJ4A 2CUYA 4LRFA 3JSYA 2RUSA 2DNQA 3T41A 4W90B 2KTQA 1ZPWX 1NK9A 3OVAA 5IT0A 1H38A 4LVOP 3BR8A 4ZP9A 3IR7B 4RNMA 2C22A 3W60A 2QT7A 1UVIA 4E8UA 4ETXA 4NLVA 2WB4A 3GSDA 2LEPA 4YR2A 1CULA 3EZ5A 2QLWA 1DJ0A 2CQGA 4DMZA 3M2UA 2CNOB 3MMJA 3MUVP 2XNQA 3O8WA 4NZ7A 4M5IA 5HLFB 1RT3B 3R1LA 3C6UB 1JJ4A 3PX6A 1RT5A 3AJDA 5C2CA 1IWGA 5KT6A 1HIYA 3IA0A 2IBOA 3GCXP 4AE5A 2R7XA 2F4VF 1LW0A 1C0TB 1VIXA 3MR7A 2FHJA 1ACMB 2CZ9A 2XHWA 3BH6B 1BQXA 2CNKB 2IDLA 2QL9B 5D4PA 4TQSA 2FHMA 2WB1D 3EGWB 2ZZNA 1X8DA 2B9YA 2R3VA 2DNOA 4JV1A 1TK8A 2QMUB 5L1IA 4DV5J 1RT2A 4JV5F 1IBLF 4LMZA 4KH0B 3ZZOA 4FKYA 2FD2A 3PHTA 4NLTA 2AJ0A 4I6WA 3NBPA 4Z37A 1WG5A 4X84A 2F8HA 4NMXA 1BC6A 2VKRA 1NRKA 5D8HB 4C11A 1DZ5A 4DR2F 3T1YF 3GYNA 4AQYJ 4HLBA 3I0RA 2QA1A 2XSJA 3QZ8A 3TX8A 1NLKL 4WP8A 1R8CA 2XY5A 2ZVIA 2CQ1A 1ZTTA 1JJ2R 2VFRA 3I4HX 1TL5A 1T9YA 4FBTA 2GVDA 5CHCB 2YNFA 4OHZA 2XEXA 2BJ1A 4KO0B 1N54B 2J76E 2J9DA 2FLPA 5KT5A 3G82B 4CLKA 2W4CA 2C2OB 4HTIA 2V4QA 5HP1B 1JKHA 1KOOA 3UVJA 1S72S 1RYSA 2E9ZA 2JEGA 2ZBPA 2M3DA 3I56S 5HATA 3MM7B 4C8NA 2IY5B 4OI6A 1OIAA 1IJFB 4NLDA 5CYJA 2XMJA 5KAKA 1NK5A 3KHRA 2DCLA 4UZCA 1VC6A 2H1YA 5HQLA 1SC3B 3NGDA 4CCHA 2PA8D 2JEJA 2CJAA 1X5TA 3W61A 4E98A 1XEZA 4JI3F 2OFGX 2V8HA 3I0SA 3VTIA 4CT8A 5A0YB 3US5A 5A8RB 1NDKA 1VOMA 4DV7J 1OPIA 1T95A 2IDEA 4K4WA 3S8SA 4NZ0A 2PFDA 3D67A 3PW4A 2HMIB 2XGQA 2EBGA 3W3SA 1SL1A 1UVNA 3GPAA 4IG3A 4M8LA 3SQGA 1REVB 3N79A 1VQLS 2AJ2A 2E1AA 1S1TA 3B82A 5KG5A 5DQHA 2EFNA 1U8WA 1SIWB 1HWLA 5DDOC 4PWDA 3MDFA 1GK8A 2E5IA 5KT7A 2RAQA 2ZWPA 4KGXB 5GADU 3HCXA 4FYXB 2DY1A 4B08A 1IBMF 3HHDA 2EK6A 4KC5A 2RD5C 3IR5B 4IH6A 2JDJA 2Q66A 3NG8A 4WE1B 5KFJA 1XMBA 4OX6A 1IQTA 4LBHA 2V63A 2K2PA 1QE1B 4TY9A 4JI7J 3M4XA 3RRKA 5IOLA 2VOOA 4I1TA 3T1HF 3HHKA 3I87A 2F8EX 2EFGA 1DTQB 1NO8A 2B5JB 5HAOA 1TZ0A 1CS4B 1HNZF 2QYGA 4Y2IA 2NQPA 2Z57B 3MM6A 1FX2A 3DM2A 4JI1F 2WHOA 3MFHA 3ADAC 5SZTA 3P5TL 1Y11A 2OHDA 5CABA 3PVXA 3PO5A 4M5HA 1RHRB 4I68A 2XLJA 1X4CA 3LOUA 2PO4A 4URGA 1RA7A 2C2KB 2UV8A 3FMWA 4BWJA 1ZETA 3CDUA 2J6SA 5D4NA 4NA3A 3RRHA 3CCLS 2ADCA 5A8WB 4FF3A 3ONQA 1FTRA 2MJNA 1VGYA 1UFLA 4I2PB 2F7VA 4AXJA 1NU4A 2WVEA 3LQVA 1JLAB 2OEMA 5IWAJ 2DGTA 3RB6A 4HHUA 1U48A 5BYRA 1RHJB 1JXEA 3MD1A 4O4GB 4JI0J 1FNMA 4EI2A 3IC1A 3I6PA 1TAUA 1KQKA 4J9SA 2QEXS 3T9ZA 2MJUA 1WUUA 4QIVA 2YQ3A 2L9DA 5LSRA 2IJFA 1P9YA 3K2YA 2VOPA 5I3QA 5B0DA 3H5SA 3MMCB 4BC9A 4EZ6A 3FRYA 1X5OA 1S9EB 3G96A 3MM5B 1PAEX 1BQMB 1TL1A 3LP0B 3MM8A 2HHTA 2HKEA 1WORA 2I2YA 5J1EB 2FJXA 4PYAA 3ZZYA 1WTBA 2DGXA 3OTOJ 3N4WA 1WDTA 4WBFA 3DOLB 2DYAA 2AW0A 2ZM6J 2ZDOA 4UY8T 2IAJB 3P49B 3NNHA 3QO9B 3FBBA 4BC7A 1S6PB 2XZWA 1S9GA 2EFPA 2NZ4A 2J9CA 1RHKB 1Q7YT 3EICA 1TMMA 2K1RB 2VA2A 4GRSA 3P3DA 1LQ9A 2EC0A 4DUYF 1BD6A 1WC1A 3CJ2A 5BYQA 4OZJA 1V3RA 1GMUA 2CQ4A 4DQIA 2HHPA 2YWGA 4ZLPA 3VAFA 3RB0A 3NY0A 2E5LJ 3R5GA 1U1PA 3GFZA 2I5JA 2KRRA 3CULA 4QU7A 4UOGA 5FDLB 2XWYA 1S1XA 2Y9HA 2OSRA 2RS2A 3D5MA 1BQNA 3HZGA 1N4LA 1ZAXA 2ZH5A 3A13A 4KV8B 3M8QB 4FYWB 4PXEA 4PYDA 2VL1A 4W98A 1D3WA 3U7JA 5BR8F 2J8AA 3PW2A 2YKMB 4M94A 2CIMA 4JI4F 4I4BA 4DV6F 1Z4UA 1B0VA 2WCXA 5A6PA 4P71A 4X4SA 1K44A 1S0VA 2KXNB 3M1VA 2W9CA 2CVIA 3GR0A 3V4MA 4PQAA 4CLYA 1W2BR 4ES1A 4DFPA 3G87A 3TA2A 1RCXB 3VZHA 4CLZA 1VJWA 1H7XA 4MT1A 1RADB 3ZTRA 1WHWA 3MMAA 3RYLA 3EPGA 2X1GA 4A47A 2CPIA 4IO1A 3CEDA 5CCMA 5DG7A 4ID5B 3FEXB 1RKIA 1X4EA 4IQMA 5AXMA 2XG8A 5HI7A 1JQGA 5DZ6A 1NK7A 4IR9A 3A4TA 3UWTA 3PYEA 3HF5A 5LMNJ 1N33F 4DR4F 3CMAS 1HD1A 1YRTA 3I9ZA 2X7IA 2ROEA 4NXNJ 1TL3B 5H9FK 5B0EA 4LF7J 2VG5B 3G6XA 3W2VA 2ILZA 4OYBA 4LF9F 2DNMA 4MMOA 1U4BA 4CO0A 2M88A 4TY8A 3T19A 4TQRA 3EE3A 5L39A 4M5DA 3KDNA 5D6GA 2HNZB 2H9ZA 1CJVB 2XB2D 3QJJA 4USWA 1A7GE 4G3IA 3IGVA 3EGVA 1YVFA 1U6BA 4ZJOA 3AB2B 5LM7E 3I32A 3QIPA 1PYSB 3PHEA 2CQ2A 1IR2A 3BYPA 2OUGA 4ZP8A 2HQGA 2ZNYA 1WJ9A 1VQNS 5CD4A 5RUBA 1EARA 4KHPF 4DL2A 4RW4B 1F5CA 1SQGA 3MGJA 1RT4B 4WZQA 4G65A 2DRDA 2KZZA 3QRPA 1VIOA 1CVJA 2FUG9 1E6YB 4LF5J 4WFAQ 4LBPA 5B0GA 1UVKA 3BPDA 4CO1A 2UZAA 4ANCA 1JLCA 3MXHP 3H40A 3NCRA 4ZPVR 4E2FB 2FJVA 5HJYA 1YZ6A 5E5NA 2HHXA 4LF2A 4ZVOB 1JX4A 4ECUA 3UN2A 2YKQA 2CZ4A 3RBDA 1RZMA 3CSKA 1UVJA 1LNQA 3ETMA 1EQMA 1GX6A 4PUOA 2JFDA 1UEKA 1F60B 4EBCA 3DGPB 3BGRA 2KG1A 2DD8S 3W9HA 2V94A 4UUWA 1ZPVA 4NYOA 4ZITA 4O3RA 2ZEJA 3ZZTA 3VAJA 4CYUB 2CRLA 4O3OA 4ZVGA 2WONA 2KFZA 3SDEA 3DLJA 5LT5A 3TRGA 2D3ZA 2B6AA 4UQTA 1T05A 5AJ3J 4FPRA 2HAIA 2ALYB 3EZUA 2HK3A 4A8SA 4WKRA 4HT5A 1VQ4S 1M5SA 3NKYA 3K57A 5KFLA 4LRBA 4OHXA 2MXYA 4Y34A 2Z8QA 2CPFA 3TA0A 2LXUA 3KHHA 2PA3A 1S79A 2R7TA 2GV1A 3LANA 1IM4A 2GQQA 2ABYA 2OEJA 1RAAB 1WACA 3D1OA 5HL7Q 3DLGA 1AYEA 1Q81T 3MTJA 1OYDA 3R5JB 2G1DA 2FY8A 3FEZA 1NKEA 4CIOA 2H48B 3DMJB 2R8KA 1SB6A 3S6EA 4LF6J 5I42A 2B56A 1N5YA 3L7OA 3QZ7A 1NK8A 3B54A 1IR0A 2RKIB 2O01C 1GH8A 2O67A 3VF0B 2K7JA 2CVEA 3HFKA 5J2QA 1R0CB 1CJKB 2OD4A 2M7SA 2XULA 3DYAA 5FLXY 2E1MC 5GMEA 4AQYF 3GZ7A 5M2PA 2FDNA 1A0OB 3OPKA 4WTYA 1TUGB 1K8AT 3PRBA 3MUMP 1S77D 2DPJA 4ELUA 1QSYA 5ETQA 1CULB 2YH0A 2H5IB 2CPYA 2FPHX 2ZNZA 2D9PA 3CDWA 1K1SA 2CQHA 3C2PA 2WAQD 4U96A 4LUBA 1KDNA 3OLAA 2FVPA 2YPYA 4RU9A 5KFCA 3HSDA 4HHHA 2MSSA 2ILYA 4P73A 4OJ3A 1RT5B 2XGPA 2PDAA 1FCAA 2M5YA 4M95A 3NGKA 4A8FA 4CDIA 1C0UA 2CPEA 4F4ZA 1LW0B 3RW6A 2BOPA 2ZH3A 1PJ7A 5ETLA 1O51A 1OY9A 4ER8A 4LF1A 4P7TA 2ACMA 2H5JB 4Y2MA 4N56A 1CQMA 5C2GA 4C8KA 2A10A 1X5PA 1Q8LA 1FESA 4ZCKA 1S0MA 4EZ9A 4B9UA 3BBBA 2C3MA 1RYRA 1HBNA 2PMWA 4DV7F 2B51A 4OYWA 4QWBA 3CO0P 4F7VA 1PC4A 4B3MJ 1RT2B 4YB7A 1J27A 4IFYA 3NBPB 2BZ2A 4JYAF 2MLZA 4A8KA 4C11B 4YB1P 3ISNC 2VH7A 3VAIA 3I0RB 1YBAA 1KSPA 2XSJB 4QIGA 3SCIE 3PFOA 1QTMA 1RT7B 2HWTA 2V9WA 3BO4A 1SH3A 4L76A 3V6DA 3A1YG 3CCSS 4Q0BA 1P27B 2HS4A 1MNEA 1UPMB 3I55S 2GVDB 2YNFB 3R5AA 1VC0A 2JC1A 2AP6A 3K89A 3W2WA 5F3ZA 3ZZ0A 4UT4A 2CNLB 1NKBA 2YWHA 2MDAA 3VAHA 1JKHB 3QFWA 4USUA 1VHFA 2QSFA 2J8SA 5JMNA 3DGVA 4ZPTR 2V9KA 3UVJB 1ZM2A 4QW9A 2MY7A 1Y3KA 1PGZA 2GA7A 4R25A 4RPFA 4NEZA 1U02A 4GC7A 4Y28C 2Y0BB 5M2UA 1NMEB 5J2PA 2D3UA 5DG9A 2UXBF 1VFJA 4YN3B 2ZBCA 1TKXA 3AA9A 4C8YA 5F8MA 1N34J 1HQEA 3TVYA 1CEZA 7FDRA 2CWXA 3M8ZA 4GVLA 3VZIA 4WP3A 1XNRF 2DGSA 5EGYA 3TJ8A 2B4PA 3GTYX 3HO1A 3J81j 4AD6A 4X4QA 2GJFA 2UXDJ 4X64J 4HH0A 5GMDA 3KLHA 1SH0A 2V8PA 3M6UA 2QYCA 1ZM9A 4ZS6A 1QVGR 4R8UA 3BB5A 5IWAF 2C1EB 3VGVA 1X4FA 1Y5NB 5KFSA 1ZBTA 1HW8A 4DL5A 3SQGB 3C66A 1X0FA 2ADBA 4L72B 3W7BA 2XO6A 1T9WA 2IBKA 2XCAA 3VV2B 5KFKA 3TAMB 2G2ZA 5B0FA 4DCJB 5DDPC 4OZLA 1MN7A 1WHVA 2MKSA 7AT1B 2YNGA 4J90A 3NGRA 1MMNA 2V0NA 4JBCA 8ATCB 2CPJA 3OSPA 2HGNA 2VBWA 1VBYA 3PEHA 3VQTA 4NX9A 3AOBA 5ITHA 1X60A 2CADA 4LR9A 3V5RA 3L95X 1NHVA 4XK8C 2EG1A 4K0KJ 4NRUA 2ZM6F 4FVMA 3IM9A 4LSNA 1KWMA 3MPVA 3S7RA 2QL5B 3DM2B 3LGHA 3D6TB 4ECRA 1HD0A 1WD6A 2J5AA 1RTDA 1RAIB 1XERA 3AHPA 2OSQA 1W7WA 3OXGA 3MPDA 1LWCA 2OMOA 1DURA 2W2PP 5A2QU 4IQXA 2OD6A 4KSEB 2QLXA 4JI8J 3GE9A 1U1MA 2ZH9A 4GKKJ 1JXVA 3FEYB 4I7FA 2BDPA 1ROFA 5CZVA 3GFYA 3C46A 2E5HA 1CSJA 1KQSR 2PIIA 4WK3A 2IC3A 1MWYA 3ZZRA 5HMZA 3TEGA 2YTCA 2GQCA 4I2QA 1KP6A 3BZQA 3RAXA 4Y2CA 1S99A 1U0SA 1NBEB 1AXQA 2LEAA 2C2RA 3W8PA 4LJMA 2HBRB 4P2XA 3FDSA 1X31C 5DM6Q 1MWQA 2P8IA 1RE1B 1SKUB 4UW2A 4F02A 2VG6A 4UTGA 1QSLA 2FZCB 3DLEB 3D0GE 1FKPA 3GYXB 2V2VA 3F44A 4LFBJ 1Q0NA 4ED5A 2JVRA 1TL1B 4B3SJ 3MM8B 2DO0A 1S57A 2N3LA 4YR0A 3M30A 1S7IA 3JTNA 3OD2A 2JX2A 3KLFA 4B9TA 3KJFB 2FLLA 1XK8A 1Y5LB 3DOMA 5AXLA 2XMTA 1HWIA 1SJFA 5LMNF 2FJWA 3WHIA 1S9GB 3RUBL 3L3CA 4NXNF 1IKVA 4OQJA 5CA5A 3HSZA 1IKXA 4DN0A 4C9DA 5C42A 2F3JA 3MAAA 3BGOP 3DHWC 1KTVA 2QV6A 1DFDA 1BGXT 2GAHC 1Q8KA 2HVDA 1ZZNA 3HT3A 4X62J 2APOA 5BJRA 2CPDA 1XMOJ 1FFWB 3QT7A 2CQ3A 1CQNA 2BABA 3K8VA 2LDYA 3P5BP 4NI2A 4RW7B 2I5JB 1TUWA 1SL0A 2PGCA 3M9NB 1XNQF 1U26A 1S1XB 2K8GA 1VRTA 2YWEA 2ASLA 3TNVA 1FXRA 3H2LA 4ZLNA 1T9UA 2QLFB 3KK2A 1UTAA 4A46A 4P52A 2LQBA 1NDLA 2RMLA 1HBMA 4MKBA 4DF8A 3Q8YA 2O66A 4DUZF 1ZAVA 2P9EA 5CYMA 1RU1A 4OYXA 1IM6A 4YQWA 1U0HA 2ZJPQ 4LF5F 4WFNQ 3M1VB 3H4BA 3ZTPA 4RWXA 2W9CB 2ZBQA 5KFPA 2ASYA 3NS7B 5IXUA 2V4JA 1N52B 5GAGI 4A8MP 4IOBA 1X4HA 3M8SA 1OQ6A 3ITHA 4LFAJ 2HW3A 3MMAB 3PXGa 1WC6A 4LSLA 2BW2A 2KT5A 2UUCJ 1UWBA 5KTQA 5K8NA 3H5XA 1QAXA 3HVAA 5D3GB 4J9NA 2JLEA 2LLZA 1NSQA 3L09A 1X4AA 3RZAA 3E8OA 4LF4F 1Q16B 2VICA 2BJDA 4PKDB 1VRUA 1SC6A 2BKOA 3H0PA 5AJ3F 4B9LA 1WELA 2JC0A 1U7LA 3W2VB 2FTRA 3LO3A 2JRSA 2VBYA 2M0GB 3TZYA 2E66A 4LREA 1ZAWA 4TY8B 4NXMF 5K14A 2RQKA 1GXLA 4M5DB 3AAWB 5HROB 5EHHA 5AE3A 3HVRA 4QYZJ 4AXIA 3UCUP 2LQ5A 3QIPB 4ELVA 3H2VE 4WKYA 4NCAA 4NCGA 2ZJQQ 1FI4A 1UJ4A 2K3KA 2VPYB 1TP7A 4DQPA 1UJ6A 4KAIA 4DS5A 1KQGB 2R8JA 3G6VA 1T02A 3VQSA 2CJQA 3RW7A 3H98A 1WC5A 1JLFA 3PYGA 2ZOMA 3CJKB 3K17A 1NHKL 4DZDA 1I5OB 3UR0A 4OYIA 3WC2A 2CPXA 2D41A 3FBEA 1C1CB 4F36A 5F8GA 2W2NP 2QJ3A 1YJUA 3MCSA 1JLCB 3M8YA 2OTJS 2FB0A 2AYBA 3W62A 3CJSA 2GVZA 2VONA 3SIPB 4LSZB 2XTJP 3MM9A 4J9LA 3PX0A 4TXSA 1EKSA 1IBCB 4DPWA 4LBIA 2DJWA 2ZE2A 3KYLA 2F4VJ 3V6JA 4PUOB 2ASDA 2R42A 1HI1A 2DEJA 1WOOA 3FSYA 3C15B 5IT9Y 2I38A 4AT1B 1DRZA 1APSA 3B4MA 1NSPA 3BDEA 4V19J 5B08A 1EX8A 2PMZD 4LR8A 2WONB 5CH7B 3SDEB 3GR1A 4F2RA 2AKWB 2B6AB 3IP0A 1XQIA 2ZHOA 1EKRA 3A8JA 3KKFA 3HVTB 1YRUA 5MAOA 2MHNA 3UD3P 4IKAA 2DR9A 5A2QY 2RRNA 4NL5A 2D1CA 4GO5X 1WWHA 2Z2MA 2P5VA 4JV5J 1IBLJ 4IFVA 4WP9A 3UO0A 3Q24A 1M1KT 3SI8A 5KG7A 1N0VC 2FY1A 3MEDA 3OFFA 1GTEA 3CMES 3BSAA 4DPOA 3PEJA 1SV5A 5DZ7A 2VZ9A 4LQ3A 4DR2J 4DX7A 1MLAA 3T1YJ 2LU2A 1LXNA 3M7VA 5ETOA 1O6XA 1VQYA 3IWLA 1SC4B 1HBUA 1XR5A 2JZ5A 4U67Q 3HJFA 3ZNUA 1TV6B 4YHHJ 1RTZA 4ED0A 4HACA 4NLSA 4KKOA 2CQBA 2G9OA 3HZEA 3ELHA 1JMTA 4KHRA 3MZIA 4YEAA 2RJZA 2BACA 2Y0SD 3O1LA 4C48A 2Z2LA 2POKA 2DGVA 4B3MF 1C2PA 1V6HA 2ZH2A 2H5EA 1Y5IB 2AYGA 3FC9A 1ZS6A 5J2QB 1FF2A 1NH8A 4RX6A 4P74A 1AROP 4M5MA 4QWEA 4F3MA 3DYAB 1FRKA 2ZJRQ 1LKZA 1CC7A 1DTTA 3BKFA 4MFBA 1UZDA 1YJRA 4H4MA 2VG7B 4ED1A 3JSRA 3F73A 2A6OA 3N6LA 2RILA 5KOWA 4OIXA 3CCRS 2IRYA 3QLHA 1NXIA 4G1PA 2Z2YB 3IRXA 2XLKA 4DL3A 2OPPA 2RRAA 4TYBA 1IBKJ 3I96A 5E33A 1U8SA 4JOUA 2CNNB 3Q8UA 5GAHU 3FSXA 2M9KA 4OI2A 4JI3J 2RU9A 4IOAQ 3WC0A 1M5HA 4YR3A 4FS1A 2ZH8A 3NAIA 4MK7A 2LXIA 5F8IA 2GJ2A 3F41A 3HPOA 1RWUA 4JB8B 3J7AN 2PI4A 2HHWA 3ISZA 3NXZA 2E44A 2CQ0A 2MQLA 3OL9A 4MKYA 3PKMA 5L8RC 3SYZA 1C0UB 4O23A 1YJTA 3KK3B 2BVZA 2OTLS 4ECZA 1QVFR 3A12A 3NWGA 2AHOB 5A76A 3G6ES 2Z56B 4CM0A 3MMBB 4F50A 2EKYA 3CF5Q 1YDLA 2EKNA 3HHLD 1N34F 1FERA 2UU9F 1YX2A 4OV1A 5FD1A 2BQUA 3TUIC 1Y00A 1HBNB 4RNOA 3LALA 2DNPA 1TMJA 1NB7A 2VKZG 4WZMA 4KHMA 4MK8A 1IBMJ 3M2RB 3UDLA 4YY3J 1HARA 4EEYA 4GVBA 4X64F 4IFYB 3I5BA 1K0TA 2HK2A 4O3QA 3AD7C 3SCKE 4P10A 5BXIA 3CCWA 3L9ZA 3HDSA 1T9XA 4KY3A 3UD4P 1UA0A 3NMRA 5U47A 3MUTP 2W9BB 4O44B 5CD4H 3OVSA 1G2EA 1R8PA 3AY0A 1VHIA 2M4MA 3DC2A 3T1HJ 3R7BB 2OPSA 2LEBA 1RISA 3CNQP 1FVSA 1RQ0A 2V8GA 2DIVA 2KHDA 4Q0BB 3G2XA 2KG0A 2NUUG 2ALZA 1KNZA 2AJ1A 4J7CA 1RK8A 3W2WB 5LJ5Y 1N0UA 3HFVA 3TA1A 3R27A 4ZLLA 3PYFA 5C24A 4JI2F 2OKQA 3MOZA 2VD3A 2CDRB 2RH3A 2XS7A 1JWWA 5J1NA 1VISA 1T94A 1SUQA 2QC3A 1NDCA 1S97A 1OY8A 5KFVA 5E3PA 2MKIA 4PPDA 3IWNC 3R2CJ 1MWZA 1B7FA 2WOMA 3H59A 2I8EA 2V6AA 3AB4B 4IG0B 1PIEA 4OZ0A 2Q79A 5J2PB 3FCVA 5KG1A 3NP5A 1WC3A 2WK4A 2VDIA 4I67A 3R7SB 2L9NA 1QUVA 3SSQA 1TKXB 3H8YA 2HNDA 4PG6A 4DWIA 4NE9C 1F3FA 4DV3J 1GEHA 2OMLA 2JFKA 4PCQA 2NUHA 4FP9A 4ZP6A 3BJYA 4JI8F 3V6HA 1L3VA 3UFCX 4AUKA 4WF9Q 3MFIA 4IDKA 2DCUB 5E2QA 3A3NB 1U1QA 3D9BA 4CNYA 3VAMA 1RLDA 4NLOA 4KJIA 2NYHA 5KFZA 4G6VB 1FKOA 5HJXA 2EW9A 2HYIB 4I69A 4PG8A 3RAQA 2HQ3A 2X1BA 3MECA 1XTZA 1NK6A 4QR1A 2YQ1A 3MURP 3R8YA 3K5NA 3LTOA 4KPYA 3W5ZA 2E7WA 3TO8A 1FTCA 5D77A 2HURA 3UW1A 1BHNA 4OYPA 3MTKA 1Q5YA 5EN1A 3PR5B 2YNGB 4YDDB 2GIRA 6FD1A 3DOKB 4DUYJ 4X4UA 3DLHA 4LF8J 4LFBF 4J9RA 3MEKA 1RJJA 4B3SF 2KYXA 4OI0A 1FWLA 1I1GA 4KB7A 4WXWA 1CJTA 2DH9A 2YKOA 2DGWA 2WVBA 4FYVB 4DSFA 2YX7A 4RNNA 3TEHB 1RAGB 1KS2A 3DRRA 1KQFB 1YITS 2MKHA 2E7XA 3CCZA 3P96A 2BJ7A 1GXTA 4CLUA 1PBUA 5ETPA 3V81A 3RB3A 4O0IA 3SSRA 1V3SA 3B4DA 2N7CA 1GMWD 1QLNA 1F2HA 1H98A 2C3OA 3TQEA 1LWCB 1S76D 4OI3A 2HQIA 4RUCA 5LMUJ 2B9EA 3CD7A 3C16A 3EMTA 1B3TA 3POTA 3K7RA 3W63A 1FKAF 4X62F 4ANEA 3BH7B 3QWPA 2AYEA 4NLYA 1U6FA 4I7FB 1W2IA 3U1MA 1LFWA 1RTIA 3CCES 4RBTA 2HZCA 3TQ1A 4I6AA 2IC3B 3H90A 4YOEA 5H9FJ 2W2MP 2KT2A 2ZH1A 4I2QB 1H6KX 1YQHA 3LA0A 1AZSA 1FT8A 3AD8C 3WX4A 2W4DA 2WSEC 1R3NA 2DEIA 4F4XA 4F3QA 3EPIA 1M5KC 4I0WA 5E3QA 4ZHRA 2GIQA 4DR4J 2XI2A 2FVCA 3HK2A 3SXLA 1L3TA 5H1SV 5K8PA 2GX8A 1F3VA 5EX3A 3NNAA 2UVVA 4H4OB 3R5BA 4P7VA 2N4CA 3FCWA 3QFHA 3FSIA 1PYTA 3NLCA 4LF9J 3TW0A 3OXLA 2KHCA 4R5PA 3J7ZT 3D1HA 4ELTA 1FKPB 2HHVA 1M5OC 2B3TB 3Q8SB 2YKNA 3K8WA 4ZOSA 1T03A 2LFVA 4B3OA 4NEYA 4U8VA 4LFAF 2MGZB 1WF1A 1MG7A 3KHGA 3M30B 3PM9A 1RBLA 1RT6A 2UUCF 2O1PA 1YGYA 3BN7A 2RHQB 3SZ2A 4N47A 3KLFB 4CLSA 1LK7A 3JSMA 1HWKA 4RNHA 2L9WA 1JLBA 2MZSA 1UZHA 3DOMB 3O5TB 1RSCA 1CLFA 4OZNA 5B0CA 4WFXA 3KG0A 1J5OA 4H4KC 1K47A 3PRVA 2WZ1A 3NOGA 1HNVB 2HWHA 3EWGA 1IKXB 1IQZA 3I9V9 5C42B 5E41A 3WDOA 4CO5A 3THPA 4FN5A 2VUGA 2ZUGA 3DRXA 3IS9A 4P6QA 4PXDA 3KJNB 4IR1A 4ES2A 1N36J 2YX4A 4LT6A 2PI5A 3ILLA 3GJQB 4NI2B 3O6QA 5I3PA 5DRKA 3RG6A 3MPWA 2GGPA 1VQ8S 2CG8A 1JLGA 4NLQA 3EYZA 2PFFB 2DNRA 5J2MB 2DPIA 3TUJC 3LF0A 2YWWA 2QRRA 5KT3A 1WG1A 3EX7B 2B0GA 4MIAA 3LP2B 1EETB 2DITA 4WFBQ 2NZCA 4LQ9A 4DJBA 4B3TF 3HJVA 2NYIA 1HBMB 2XSFA 3ZZPA 2GO9A 2DTJA 2VC1A 1MW7A 4KQZA 5CYMB 2ZBIA 1U0HB 2F9JA 4HTJA 2AJFE 2JLFA 1F0XA 3OBIA 2XC9A 5K8MA 1XBWA 3PFEA 4KGZB 4OHVA 2CQDA 2DHHA 3UD5A 5DM7Q 2V4JB 3LAMA 2ZBRA 5HO4A 1HMVA 3A8EA 1M1HA 4C8LA 2KFYA 2GQ2A 2ZD1B 1S59A 5I4MA 3ITHB 2Z58B 4OZ3A 4UUXA 3KLGB 4LSLB 3O3LA 4K4XA 5HLFA 5L1LA 1RT3A 3EXCX 2A18A 1A6LA 5IV3A 2WBRA 1UWBB 1CBKA 4XIUA 4DX5A 4EGLA 5J2NA 2F4FA 1YG0A 2GW8A 1S1WA 4HYKA 2HQFA 4CO2A 3NMAA 1YJWS 2FHOB 4ZA1A 1S6UA 1RBOB 1N56A 1MN9A 4DUTA 1C4AA 5C5JA 4ITSA 1N6QA 1VRUB 4RKUC 2RUGA 3AXKA 4IO9Q 2HGLA 1DY3A 4QZVB 1TKTA 1RCOB 1WC0A 2AJQA 1MROA 4ZCLA 5AXKA 8AT1B 3GG0A 1X4DA 3OTDA 2I1RA 5K14B 5A8KB 3K59A 2EC2A 4OYAA 1VJQA 3X1LB 3ZTQA 1KFSA 3GYGA 4TN2A 4ZVSB 5EDWA 2G2OA 3M8PA 2NSCA 2KKHA 3H20A 4KGMA 3WZ0A 4B3RF 4LFCF 2R7QA 1FX4A 3BQ2A 2G0JA 3B78A 4YHHF 2LP4A 4GMKA 4CNZA 2GHWA 1JLFB 2MQMA 3PW7A 3DDIA 3CT9A 2E9TA 2B9XA 1HYSA 2V4RA 1GT8A 3HLUA 1N32J 4DV2F 1KLMA 3IO1A 1FJGF 4U9RA 1FHTA 2BUNA 2AZ1A 4ED7A 2GVZB 1AW0A 3Q8VA 1R0AA 2X3GA 1NB2A 1YJ7A 1SKSA 2ZE2B 2ZHAA 4K4SA 3ZZZA 2M2BA 4RUHA 2YKAA 4K4ZA 2Y1LB 2DISA 2HEKA 3JYTA 1IBKF 5JJBA 1RTJB 2BX6A 4RUAA 1JNRB 4ES3A 2UP1A 3LPEA 4QPTA 1NM2A 4DQQA 4NRTA 4ETZA 2OFHX 3W1YC 3FCHA 4A8YA 3GMGA 2DR5A 3JAMY 1KRPA 4HL9A 2IJNA 4XPCA 3E01A 3R5DA 3CJ5A 3DU5A 3VGTA 4IFVB 4J9MA 3GFHA 4ZVPB 1URNA 3MEDB 1V3ZA 5D0RA 2LXFA 4JYAJ 5A0YA 1QDUB 1BMQB 1U1KA 1SV5B 3R6LB 5IT4A 5KG6A 2V2ZA 3B8HA 4FDFA 2HFOA 2DNLA 2W4PA 3PIOQ 2U2FA 2COLA 4U7CA 1HBUB 3M9MB 3KJVB 4GKJF 2JSXA 3R5CA 1EQ0A 3AH6A 1JNZB 1R43A 1H2UX 2YNHA 4MK9A 4K2XA 3U27A 5JVHQ 4HACB 4KKOB 5G4DA 2J0XA 1RA6A 2AGPA 2PC6A 4ECSA 1IKYA 1FDDA 4M5NA 5LOQA 2KL8A 4YY3F 1RWVB 3GIKA 3NRBA 2QFJA 1YJVA 3TVZA 2HHQA 2JWNA 1VRQC 3N5FA 3OR2A 2ZZTA 2R7UA 1DTTB 1FXLA 3KMSA 3MCMA 1VR6A 3UDCA 2V69A 3G4SS 4AL7A 2QLJB 4H4MB 2MQOA 1WF2A 4CO4A 2VB6A 4L6V3 4NYZA 1S0OA 1U1OA 5KFWA 1DBDA 2UXBJ 2PMHA 5ETNA 4URSA 5KFBA 4DR5F 3IRXB 1N5VA 2OPPB 3T6BA 1UW9A 1B64A 3IG1A 4N41A 3THTA 2RHSB 2BANA 3CD6S 5K8OA 1RB0A 2Z2ZA 4ZJLA 1XNRJ 4DV1F 3CJ3A 2V8DA 2HHHF 3TARA 2XYPB 3EGNA 2KXFA 4I6YA 1XIQA 2P6SA 4NZ6A 3BSOA 1P9QC 2J7UA 4QCLA 3DHXA 2ZKUA 1UFKA 2CG4A 2ZH6A 1R31A 5DETA 2C28A 4DFKA 1BE4A 3GU0A 1WI8A 1KONA 4OJ1A 2ZKTA 4D3HA 1S49A 2XCPA 1FE0A 4Z2XA 3OR1B 3BO3A 5G0RA 5IV4A 1TTHB 3FKBA 3CD0A 1P1LA 3KK1A 2HIQA 5THWA 1U24A 4I2PA 1WEZA 1JLAA 1FRIA 2FZGB 1TU0B 2HBYB 4ID8A 4DV3F 1DQAA 1M0SA 3CJQA 1VMBA 2AIRB 1T3NA 5H9EK 4PG7A 4O4GA 2W7AA 1YBTA 4XDDA 5IM0B 4GVBB 4NYPA 4N8NA 2V68A 3FK4A 4F8RA 5FLXU 3D68A 4MTPA 2V5HG 2ZWOA 1S1VA 1YI2S 3W64A 4TLRA 3N6NA 1VDHA 3HKWA 1SJQA 2DKOB 2VODA 1PCAA 1PJ6A 3K5OA 3MMCA 2MZTA 3BN4A 2H4WB 1ZA2B 4OZ5A 4RZRA 2XMAA 3MM5A 4G1QB 4DR7J 3LP0A 5FIIA 5F8JA 4C8OA 4QIWD 4DI6A 2MQ8A 2Q1LA 3BEGB 2MQNA 4CLPA 4C3LA 3HM9A 5JXSA 5T14A 2YKPA 3DOLA 4HI2A 2PEBA 2QTWA 4WIIA 1HI0P 2AWZA 2MB0B 3T5KA 3K0JA 1BY9A 3EM1A 1VK3A 5C24B 4LF8F 4NLUA 4DR6F 1WC4A 2L48A 1ITPA 1HNWJ 2R2SA 2VHGA 1SUQB 2D3O1 3W66A 2MQPA 2K1RA 3MEEA 4C0OC 2WOMB 1FEHA 4ZVRB 1OY6A 3GV8B 5HMWA 2H4YB 3GQCA 3UPFA 1SPBP 1FEEA 3D2WA 3E3XA 3FQLA 4KE5A 1EJ7L 4F0KA 4HDGA 1IXKA 4F2SA 3E51A 4UQGA 3N9UC 2KDOA 2U1AA 1S5ZA 2UXCF 3EUNA 5CCLA 1Y3JA 2IM1A 4HI1A 4G1IA 1YWXA 5LMUF 2JL9A 2G0IA 4WYWA 2HBQB 2CAJA 1OMSA 2DNKA 4DSJA 3NOCA 3KJQB 2CXEA 2XMKA 4CH7A 2GMJA 1AT1B 4OHYA 3GIIA 2YX1A 3FFIA 3PG9A 4DDFA 4DQSA 5L38A 1FKOB 4NPOA 4WU3A 4F26A 1XR7A 2IHR1 2VDHA 2VBZA 1SC1B 1LXJA 3J80Y 4OV6A 2W1BA 1EB0A 4BCAA 3KWMA 4Q2LA 3H7HB 1U47A 1FRJA 5KG3A 2JEIA 4NMLA 2XZDB 2DRAA 4DF4A 4UY85 4B9SA 2GIFA 1VBXA 4ZKAA 1NUEA 5IQQA 5C7PA 2QE5A 5ADZA 4PR6A 1RAFB 2AF6A 4O3NA 2C2ZB 2VU5A 5F8LA 1NAQA 2FGOA 2A6MA 2BXJA 1CJTB 4AL5A 2W9AA 2EK1A 3CMQA 2VG5A 1YHQS 4J91A 5E7OB 5E3AA 1HLWA 1XNQJ 3DRRB 4ZLJA 5HBMB 4DPXA 2HNZA 4RW6B 5IC4B 4LIWA 4J9UE 3V81B 1JJCB 5KFXA 4ZMMA 3GV5B 3CE8A 1AUDA 1T7PA 3U02A 5JVGQ 4N7TA 5B0AA 2XNRA 2CFXA 1KC8T 4DUZJ 4UOCA 3VAKA 3HXMA
chains in the Genus database with same CATH topology
5E3RA 2I38A 1E6VB 3AA8A 1DRZA 1APSA 3DRPA 2FHJD 4X4VA 3B4MA 3BDEA 2Z0GA 5C25B 3PW4A 5L1LA 3DOKA 2HMIB 4V19J 5F41A 4RW4A 1N36F 5B08A 2XGQA 2EBGA 5K9FA 3W3SA 3HHLA 4K5SA 4LSNB 1SL1A 1UVNA 1BLUA 2GO8A 2OAUA 2PMZD 3TR5A 5KG2A 3PR4A 3OXFA 4IG3A 2QMWA 1RT4A 2WONB 4M8LA 5CH7B 3SQGA 1FRLA 1Q53A 3SDEB 1REVB 1RT1A 3LP1A 3GR1A 3N79A 1VQLS 4QOTA 2E1AA 1RTIB 1S1TA 2B6AB 3B82A 3ISND 4F2RA 3QGGA 5DLFA 5KG5A 3PO4A 1OWXA 1QJHA 1YRXA 2ZHOA 3I82A 5DQHA 3V2UC 3KKFA 1RTDB 3HVTB 1YRUA 4J37A 1K9MT 3DXBA 3M6XA 3M8RA 3OTOF 2EFNA 2ZZMA 5MAOA 2MHNA 3UD3P 1QSSA 4QU6A 4IKAA 2DR9A 5A2QY 2RRNA 1SIWB 3D0HE 2J0SD 4NL5A 2D1CA 1HQUA 4GO5X 1HWLA 1R27B 1WWHA 2Z2MA 5DDOC 3VALA 2P5VA 4PWDA 3MDFA 2IYIA 2CDQA 1SJRA 1Q4RA 4IFVA 2E5IA 5KT7A 1Q1KA 2GMLA 2LA6A 3Q24A 5GADU 4DR1F 1M1KT 4IOCQ 3SI8A 2R2UA 5KG7A 1N0VC 2FY1A 1GNKA 3MEDA 1GTEA 3OFFA 4QR2A 3CMES 4B08A 1X9WA 3M6VA 2X1AA 2CQCA 3BSAA 3HHDA 1HHTP 1IBMF 2M8DB 2EK6A 3MEGA 4ED3A 4DPOA 3PEJA 2RD5C 4KC5A 4MAKA 4ZHRB 3G8SA 3T3FA 1SV5A 4WU2A 2VZ9A 1RTHA 3IR5B 4BWMA 4LQ3A 2LU2A 2OO4A 4IH6A 1VQPS 1CPZA 2JDJA 1LXNA 5KFTA 2Q66A 3QIDA 3DI6B 3NG8A 1D8ZA 2LQ9A 1VQYA 3IWLA 4K4TA 3CDEA 4WE1B 5KFJA 1X5SA 4C8MA 1XMBA 1H2TZ 4OX6A 1HBUA 4NLXA 1XR5A 1IQTA 4KFBB 2CJKA 2UUAF 3HHEA 2K2PA 2JZ5A 2LQJA 4U67Q 1QE1B 3HJFA 1TV6B 4TY9A 2J6TA 1EP4A 4R5PB 3M4XA 1RDRA 3RRKA 1JLEA 4ED0A 2VOOA 4E0DA 4NLSA 4ATNA 1TKZA 3MD3A 4I1TA 3PKYA 4CI0B 4KKOA 2RDJA 2CQBA 5DQGA 2G9OA 3T1HF 3HZEA 1JMTA 3HHKA 3I87A 2F8EX 2E5LF 4KHRA 4DV0F 2RF2B 3QAEA 2EFGA 1DTQB 2E29A 2OLWA 3MZIA 2R2RA 1RGVA 1NO8A 4YEAA 2RJZA 2B5JB 1TZ0A 1HNZF 2N82B 3UQSA 2BACA 2Y0SD 3O1LA 4J9KA 4Y2IA 2NQPA 3GIMA 1GX5A 3X3UA 2Z2LA 1KN6A 3MM6A 2POKA 2DGVA 3DM2A 5EWGA 5F9NA 3MR5A 1C2PA 4B3MF 1V6HA 1ULRA 2WHOA 3MFHA 4JI1F 3LUYA 4FF2A 2ZH2A 4K4UA 2H5EA 1Y5IB 4WYLA 2AYGA 1GTHA 4MYTA 1PO6A 3PJXA 5J2QB 2KYZA 1O8BA 5SZTA 1FF2A 3P5TL 1NH8A 2RQMA 4QJVA 4YMEA 4RX6A 1X9MA 3PVXA 3PO5A 3MR6A 1AROP 3J81Y 2X1FA 4QWEA 4F3MA 4I68A 3DYAB 5DLGA 2XLJA 1M5VC 1FRKA 1X4CA 2ZJRQ 3LOUA 2ATLA 2PO4A 4FYDA 1LKZA 2VG6B 2YH1A 1CC7A 5KT2A 4DSIA 1DTTA 4URGA 2RDIA 4MFBA 1S9FA 1RA7A 3OUYB 2UV8A 3FGVA 2F9DA 3MI7X 1YJRA 2W8LA 3FMWA 1VQSA 4FNIA 3RU0A 1FD2A 4ZPDA 1J5OB 4FZVA 2VG7B 4H4MA 3JSRA 4BWJA 3F73A 4ED1A 1ZETA 5IFMA 2KRBA 1M5PC 3CDUA 3N6LA 2J6SA 2RILA 5E3CA 5KOWA 4OIXA 4NA3A 5D4NA 3CCRS 1TVRA 3RRHA 2IRYA 4ZP7A 3CCLS 1IUJA 3Q8QB 2D7SA 4EWTA 1Q82T 2ADCA 4R0EA 3QLHA 5A8WB 4FF3A 3ONQA 1FTRA 4G1PA 2MJNA 1CG2A 1VGYA 1FO1A 4H4OA 3IRXA 2XLKA 1UFLA 4I2PB 3H4DA 2F7VA 3RBEA 4AXJA 1NU4A 2NPIA 4DL3A 2M52A 5CQGA 3LQVA 1JLAB 2OPPA 2RRAA 3HHNB 4TYBA 2B4VA 3PV8A 2QSWA 3IS9B 3R3TA 4A8QA 4H4KA 3I96A 4O3SA 4DLEA 2NSBA 2DGTA 2IMOA 2R7VA 5E33A 4K4YA 1U8SA 4JOUA 4GC6A 4QWAA 3RB6A 4TNOA 5GAHU 3FSXA 2C42A 2M9KA 4B17A 4DL7A 1U48A 1WNEA 4OI2A 4K59A 5BYRA 2RU9A 4IOAQ 1JXEA 4KBIA 3MD1A 3WC0A 1Q79A 1M5HA 4YR3A 2MGZA 4FS1A 4PXCA 4O4GB 2N7YA 2PEHA 2Y1RI 2ZH8A 2HVHA 1FNMA 1DLOA 2ACYA 1VQOS 4EU0A 1JLGB 4DLGA 3IC1A 1GAOA 3I6PA 3NAIA 4Y3CA 4C0BA 2DNGA 1KQKA 1TAUA 1B0PA 4MK7A 1NK0A 2LXIA 1IKVB 5F8IA 2GJ2A 4J9SA 2QEXS 3T9ZA 2MJUA 1F9FA 4Q44A 4QIVA 2YQ3A 3OFEA 1VI7A 2L9DA 5LSRA 3F41A 3HPOA 1RWUA 5EWFA 3LGNA 4EO6A 2PI4A 2IJFA 4KRWA 2HHWA 2RU3A 2Q43A 3K2YA 3N0VA 1KVJA 2VOPA 2GFFA 3ISZA 5GAHI 2E44A 2CQ0A 2MQLA 3OL9A 5GAEU 5I3QA 4OLOA 3BF4A 4MKYA 2R7OA 4OX9F 1S6QB 1UMJA 5L8RC 3PKMA 5B0DA 3H5SA 3SYZA 3KLEA 1C0UB 4F4KA 4O23A 1G6BA 3MMCB 5LSLA 2DHAA 3HX9A 4C2MA 2JOQA 1TUVA 4BC9A 1YJTA 4EZ6A 3KK3B 1Q78A 4YDXA 3CCVS 2BVZA 4CTAA 3WBZA 2OTLS 4ECZA 4IH7A 4USJC 3FRYA 1QVFR 3ULHA 1X5OA 3DRSA 1S9EB 2OPQA 3M2UB 3G96A 3MM5B 4QPXA 3OTBA 3NWGA 1UW4A 2XWXA 1BQMB 1TL1A 5F0UA 4LF7F 3LP0B 2W24A 3G6ES 3MM8A 1HNVA 3MMBB 2HHTA 4F50A 4ZCMA 4KT0C 1UFWA 1C1BA 2EKYA 1N32F 3CF5Q 2KO1A 4X4OA 4A8WA 4RW9A 3BGLA 3HHLD 1N34F 2HLUA 5GMKa 2I2YA 5J1EB 2FJXA 2V8VA 1FERA 2UU9F 5LJ3Y 4U6PA 4DV4F 3ZZYA 1WTBA 2DGXA 5L9XA 3N4WA 1XMQF 4OV1A 5FD1A 4Y0FA 3IN5A 2BQUA 3DOLB 4DG1A 4N5SA 1VRTB 2AW0A 2YWFA 2ZDOA 3CXCR 4UY8T 2IAJB 3TUIC 3P49B 2R8HA 1Y00A 1HMVB 3LGMA 3NNHA 1U25A 3QO9B 1HBNB 1FRMA 4RNOA 3LALA 3JTPA 2DNPA 3NCQA 4BC7A 1S6PB 4WFYA 3KK2B 1WHXA 1NB7A 2VKZG 2XZWA 4WZMA 4KHMA 2DB1A 2OH2A 1S9GA 4MK8A 3DLBA 2EFPA 2NZ4A 3M2RB 3UDLA 2J9CA 5DGAA 1HARA 5K5MA 4EEYA 1Q7YT 4TU8A 5B0BA 2DIUA 1TR0A 4C8ZA 4X64F 4Q45A 5J2MA 1D9FA 4O3PA 5J2NB 2K1RB 1JB0C 2V2KA 2VA2A 4IFYB 1S1WB 3I5BA 1K0TA 3P3DA 2VPXB 1LQ9A 4XDCA 2AU0A 2LECA 4Y65A 4QYRA 4IRDA 4O3QA 1LOUA 3SCKE 5KFDA 2EC0A 2C2DA 3LP2A 3CCWA 3HDSA 2B9WA 1EETA 4DUYF 3OL7A 3UD4P 2MZ1A 1UA0A 1BD6A 3NMRA 5U47A 3CJ2A 3MUTP 2W9BB 5BYQA 4OZJA 5DDQC 1NJYA 1V3RA 3UNGC 2CQ4A 4O44B 1YIJS 1N6QB 2HHPA 4CO3A 4DQIA 5CD4H 2YWGA 4ZLPA 3OVSA 3VAFA 1G2EA 1UL3A 1R8PA 3VAGA 3AY0A 2P9GA 3RB0A 3DC2A 2M4MA 2QIFA 3IFEA 3G71S 2OPSA 2BQ3A 1U1PA 4ZPCA 2LEBA 1RISA 1TKTB 2HNYA 3GFZA 1FVSA 1RQ0A 2V8GA 3KLVA 3FZ2A 3I31A 2I5JA 2DIVA 1MROB 2KHDA 2KRRA 3CULA 4Q0BB 5DG8A 3C6UA 3J7Z5 2QA2A 3T1AA 1OS5A 2B4UA 2KG0A 2NUUG 4QU7A 5FDLB 2XWYA 1HNIB 2ALZA 2EG2A 1HNXF 4Y2AA 1KNZA 1S1XA 3IBWA 2OSRA 2AJ1A 2XMVA 2YWKA 5EX0A 2RS2A 1ELOA 2RIJA 4DN9A 1RK8A 4Q8FA 3D5MA 3W2WB 2RE1A 1BQNA 3HZGA 5LJ5Y 5F9LA 1N0UA 2MQQA 1N4LA 1ZAXA 5HMYA 3MWBA 5KFAA 2ZH5A 3OVBA 4KV8B 4M63A 3TA1A 4Q8EA 1HL6A 3M8QB 3R27A 4ED8A 1O0PA 2ZD1A 1NK4A 1FDNA 3M8PB 4PXEA 1Y7PA 2FIUA 5C24A 4JI2F 2VL1A 1D3WA 3U7JA 2OKQA 2DR7A 1GQEA 5BR8F 3MOZA 2VD3A 1C0TA 3KLGA 2RH3A 4EYIB 2J8AA 3PW2A 1SJ4P 2YKMB 2XS7A 5J1NA 1JWWA 1T94A 4YB6A 1SUQA 2JLGA 4M94A 2CIMA 4JUZA 4DSLA 4JI4F 4I4BA 4DV6F 2R8IA 1S97A 2A3JA 1WTFA 5KFVA 1ZM4A 5E3PA 2MKIA 1Z4UA 2GMHA 1B0VA 4PPDA 3IWNC 2WCXA 2RT3A 4OJHA 5A6PA 1NJZA 4X4SA 1MWZA 3EXYA 2XY7A 1S0VA 1B7FA 2KXNB 7FD1A 2ASJA 2WOMA 3H59A 3M1VA 2I8EA 3RTVA 1TK0A 3AB4B 3E2EA 2W9CA 4IG0B 2CVIA 2XY6A 3GR0A 1VC5A 3DDKA 4CT9A 3V4MA 4OZ0A 2Q79A 5AE2A 4PQAA 2D3OR 5J2PB 4X4NA 4NA2A 4B9NA 4C4WA 5KG1A 1W2BR 3NP5A 2WK4A 4ES1A 1VQMS 4DFPA 3CUNA 3K58A 2J0WA 4I67A 2R8GA 3TA2A 2L9NA 1QUVA 3VZHA 2E9RX 3SSQA 1IJEB 1TKXB 1VJWA 1HYSB 1H7XA 1FNOA 4DSEA 1RT7A 5KT4A 3G9CA 1Z1ZA 2YY3A 2C3YA 3VCDA 2KJWA 1WHWA 3H8YA 3MMAA 4EYHB 2HNDA 4PG6A 3RYLA 2X1GA 3EPGA 2Q6CA 4A47A 1KLMB 2CPIA 4IO1A 5KFHA 3CEDA 1SJ3P 4NCGB 5CCMA 5DG7A 4DWIA 2XMWA 4ID5B 4O4RA 2XI3A 3FEXB 3M32A 2DK2A 5A8KA 1R0AB 1RKIA 4Y6IA 1LV5A 3OJSA 1KLNA 2F8MA 1X4EA 1UEUA 3JTOA 2Y1JA 4ECQA 4Q7AA 4IQMA 5AXMA 2OMLA 2XG8A 5AXNA 2WSFC 2JFKA 5HI7A 2X51A 1NK7A 4PCQA 2NUHA 1LW2A 2HS0A 3G8QA 1UVLA 4C97A 4IR9A 3UWTA 4FP9A 2C3PA 3NAHA 3HF5A 4TYAA 4ZP6A 3MAQA 3BJYA 1N33F 4JI8F 2VFSA 3V6HA 3TVKA 4DR4F 3KLIB 1L3VA 3UFCX 2WW8A 1N48A 3V4IA 3CMAS 4XPEA 1LFPA 1HD1A 2IYGA 4MIWA 4OX7A 4WXOA 1YRTA 3I9ZA 4AUKA 1NZAA 4WF9Q 2OIHA 3MFIA 4IDKA 2ROEA 2DCUB 2FJDB 1Q86T 5T7LB 5E2QA 1TL3B 2KH9A 1U1QA 5B0EA 1G7CB 2VG5B 4ZPBA 3G6XA 1R89A 2DHXA 1JLQA 4CNYA 3LWLA 3W2VA 3VAMA 4NLOA 2ILZA 3JYTB 2FJEB 2VV5A 4LF9F 4KJIA 5KFZA 2DNMA 1FKOA 1HBOB 1Y9OA 1D9AA 2EWHA 4G6VB 4MMOA 1U4BA 4CO0A 2EW9A 1VQ6S 2M88A 1UA1A 4TY8A 2HYIB 4I69A 3T19A 4W92B 3CJ0A 2JHEA 1MMDA 4TQRA 5L39A 4PG8A 3RAQA 2HQ3A 2X1BA 1G3OA 4XO0A 2BA9A 4Q43A 3SFGA 3MECA 4LF6F 2GNKA 4M5DA 1XTZA 1NK6A 3KOAA 5D6GA 2HNZB 4QR1A 2H9ZA 4Q5VA 2BRKA 3GFXA 3MURP 3SV4A 3MM9B 5M2RA 2XB2D 3K5NA 3QJJA 3J7YU 3I0SB 1A7GE 4G3IA 3IGVA 4LIRA 2UVRA 4DX8H 4KO0A 4MYUA 4N77A 3CCUS 2DBBA 2XS5A 1YVFA 4KPYA 1U6BA 3AB2B 3I32A 1YJ9S 2E7WA 2MKCA 3SCLE 1FTCA 2MZJA 3TO8A 5D77A 1KOHA 3RRGA 1K1QA 3QGPA 3BR9A 3QIPA 3E01B 1LWEB 3CO9A 2HRYA 3T5HA 3UW1A 2HWIA 2KU7A 3PHEA 3M2VB 2G0CA 5HP1A 1MSWD 2CQ2A 3MTKA 2VFUA 2K3IA 3I4PA 4DHVA 5EN1A 2UVWA 3L7PA 2AYMA 4ZP8A 3PR5B 2YNGB 4YDDB 1ZTWA 1S1UA 2GIRA 4PQUB 3D1QA 2ZNYA 6FD1A 3GG1A 2BE2A 1HWUA 3LWMA 2E5JA 3BGFA 1VQNS 3NL0A 3DOKB 4OJGA 5EUHA 4KHPF 4X4UA 4DL2A 3MM7A 4RW4B 1F5CA 3DLHA 4FS2A 4ZVFA 2G4BA 4LFBF 4J9RA 3UI3A 3MEKA 1RJJA 2YNIB 3MGJA 2BJEA 4IG3B 1RT4B 4B3SF 4C98A 2HFNA 2KYXA 3FMBA 2DGOA 4ED2A 4OI0A 4WZQA 3T5LA 4ERDA 1S1TB 2CQI