4CO2A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
total genus 21
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co2A00
4USHA 5D4NA 4CO1A 2E66A 1J2VA 1NH7A 3MHYA 1UKUA 4WK1A 4RX6A 1OSCA 3M05A 3BZQA 4E98A 2J9DA 4D3GA 1KR4A 1V3SA 2XBPA 4USJC 4D3HA 3TA2A 4RWXA 2EG1A 2PIIA 3TA1A 5DRKA 3DFEA 2DCLA 5DS7A 4C3MA 1XK8A 5D4OA 1V9OA 4CNYA 3NCPA 1VHFA 4USIA 2Z0GA 3O5TB 1UFLA 2JJ4D 3GSDA 2XULA 2EG2A 1V3RA 4RLEA 4YB7A 4CNZA 1Q1KA 3AHPA 1NH8A 2GW8A 4OZJA 2VD3A 4R25A 4CO0A 1H3DA 4YB6A 4NYOA 3CE8A 4ZK7M 2O66A 4CO4A 1PILA 2NUUG 2J9EA 2XZWA 1V6HA 4RWWA 4CO5A 5D4PA 2RD5C 4Y65A 3LF0A 2J9CA 4OZLA 3HLUA 5D4LA 4NYPA 1O51A 4IYQA 3NCQA 1UMJA 2XG8A 4C3LA 1P1LA 3N5BA 1UL3A 4WK3A 4AFFA 2GNKA 3AA9A 1O5JA 4YB5A 4CO3A 4CO2A 3TA0A 1NZAA 2ZOMA 3OPKA 3AA8A 2NUHA 4Y6IA 3O8WA 1NAQA 2NS1B 3AH6A 3L7PA 2V5HG 1HWUA 1QY7A 4C3KA 3T9ZA 5L9NA 2J9DE 1VFJA 2GX8A 1GNKA 4OZNA 3X3UA 3NCRA 2ZFHA 2O67A 2CZ4A
chains in the Genus database with same CATH superfamily
2BJDA 3D0IE 3EMTA 4KC5A 4USHA 2XMAA 2N7YA 4P2FA 4RBVA 2LU2A 3KG0A 3UN2A 4PR6A 1RAIB 3DGPA 4B17A 2VUGA 3MD1A 1LFWA 4OYXA 2YKAA 1HQ2A 3MPDA 2HFZA 3U27A 3H5UA 4C0OC 5CCLA 4OIXA 1HMVA 3OW2R 4ELUA 2MTLA 3Q23A 4J9NA 1CJUB 4QQBA 5BYSA 4DV5F 4DR5J 3H7HB 4AL6A 4WK1A 1KHVA 1YBTA 2WBRA 4QYRA 2W8LA 4FS1A 3GYNA 4WFXA 2BE2B 2DJWA 4NLTA 2DITA 5F8IA 5EDWA 3DOMB 4ZVRB 4KKOB 3RB3A 4I64A 2KZZA 1QUVA 4AXJA 2RIJA 5BYQA 3MUTP 2MJNA 2QTWA 3MM7A 1LNQA 5HP1A 1FDBA 4FBTA 1B0VA 1N0UA 4FF4A 2WCXA 2OELA 3M8QA 1L3KA 1S72S 1IR0A 3O1LA 4ZPWR 2G0IA 1CJKB 1YJRA 5A0YA 1UW4A 5LMUF 1U7LA 4X65J 3G9CA 2VG7B 2R4FA 3BKUA 5E41A 3ITHA 3D6FB 1GQEA 1VGYA 3K5PA 4KQZA 2J6UA 5KG1A 3CO0P 3CCQS 2QEXS 3DFEA 3MZIA 1NDCA 4Q0BA 4RPFA 3NEKA 2V4RA 1EARA 2GA7A 5KFZA 4IG3A 4RUAA 1FE0A 3GWCA 2NXUA 3HHEA 5DJBA 3PVXA 3HO1A 2ZITA 2HS4A 4UUXA 1LWXA 2SXLA 1EETA 3HD2A 3H98A 1GMUA 4U7UK 3TJAA 1SC4B 5KFKA 4J9LA 5ITHA 2GFFA 4DUYF 1Z2LA 3MM8A 3WZ0A 2BW7A 3DRRB 4HT7A 5KG5A 1KQGB 1YRTA 2OTJS 1VIXA 1BD6A 2QSWA 3N9UC 1BGXT 5CD4H 2ZC4A 2AU0A 3CIZA 3M4XA 2VA3A 4LT6A 5LXRA 3EX7B 1IKWB 1NK0A 2XYHB 1JLBA 1H3DA 2P6TA 1RT3B 5E0OA 5JXSA 3FRYA 3DXSX 1P9QC 2CYYA 1EJ7L 4WU3A 4C7QA 5C42A 1KOOA 1NO8A 4K59A 2HWTA 3MXHP 1QTNB 1HLWA 3BJYA 2C2OB 4P7TA 2VPYB 5IFMA 1JX4A 1TQLA 4X64J 4NZ6A 2OUGA 1TL3A 2YNGA 4PKDB 1R7IA 1ZM4A 2RD5C 3IGNA 1I94F 2Z30B 3TAQA 1JXVA 4F7VA 5SZTA 3IAM9 4TQRA 2HNZB 1WDTA 4Q8EA 3CMQA 3NCQA 4LBIA 4ED0A 3AAWB 2DXFA 2F1FA 1Y10A 2LDYA 3WIVA 1UZHA 5KT3A 4F4AA 1AZSB 1JLAA 3P5TL 4WK3A 1IBLF 1U09A 4NXNJ 4DX6A 1WC6A 4ERDA 1PJ6A 1AB8A 4WP9A 3C14A 2VH7A 4PYAA 4EK2A 3OLAA 2DPIA 4CO2A 1UEKA 2ILYA 4PG8A 3TJ8A 4TQSA 1U1OA 3WC2A 2L9WA 3N6MA 4DSLA 3ONQA 2UXDJ 2CPIA 5ETKA 5KT7A 1FNXH 1RAGB 1QD1A 1GFWB 2KT3A 2UU9J 3MD3A 4ECSA 1BC6A 2B7CB 2C1EB 3AA8A 1HWKA 3THPA 4DQRA 2Z2LA 3DOKA 2QX0A 3F56A 4IDKB 2Z56B 2HHHF 2RVJA 4F0HA 2KT2A 4DUZJ 1S97A 1QY7A 3G8QA 2HMIB 3PX0A 4HT5A 2I0XA 2FC8A 3P45B 1M5OC 3DRSB 2KHCA 3S7RA 1FEEA 2YWGA 5AXMA 3CW2C 4ZCIA 5LJ3Y 2B7BB 2FUG9 2FGOA 2P9GA 3ELHA 3I9V9 3TVKA 1KLNA 4BC7A 1OSDA 5AJ3F 2HHHJ 3PO5A 3KUHA 1GEHA 2L9DA 2OAUA 1K9MT 2R2SA 3HJFA 2CQDA 1F9FA 4ENOA 1R43A 2LXUA 2YX4A 4DG1A 5HMZA 1X4BA 1BWVA 1SB6A 2G1HA 2VFRA 1BY9A 3M2UA 2UVVA 3VALA 5G4DA 3PW4A 3L95X 5E7OB 2CZ4A 2DR8A 4OYMA 4BWMA 2AGPA 4NCGA 1X60A 3LP0B 4P52A 3PYFA 4PXDA 2YNFA 4ZP6A 4J9OA 2AEJA 1FD2A 3MM6B 5E3RA 2IVFB 1SJ3P 3GB0A 1MU2B 4I0WA 4O23A 1ULRA 1T95A 2BJ9A 1N32J 2KN4A 3PHEA 5CZVA 5LSOA 3QMQA 1U24A 3HHDA 2AZ1A 4RX6A 4Y2CA 4ZPCA 4BDPA 4DR4J 1KBRA 5CHCB 2F5GA 3BZQA 1UVLA 2D9OA 5EUHA 5L8RC 4O0NA 2ZBRA 4A8WA 1QAIA 2UUBF 1U0SA 3BS9A 3KUEA 4B08A 5F9LA 1TVRB 2VQFJ 2KFZA 3KLEA 3H2VE 3NAIA 1X5TA 3B78A 2ZZMA 5C5JA 1W26A 1SUQB 1RLDA 2DGUA 3JQJA 3P5BP 2ZM6F 4ED7A 5EN1A 4QWAA 2JOQA 1Q86T 3ZNJ1 1HD0A 1WEYA 5KFYA 4CI0B 2Z57B 1W2BR 3U02A 3GFZA 1AFJA 1GXUA 2B56A 4WZQA 3BYPA 4MAKA 1RT1A 1Y7PA 4CLWA 4NCAA 3BBBA 2AX1A 2JFDA 2PN6A 3PNIA 4TY8A 3ZZPA 4ATNA 4CLKA 2QT7A 4LVNP 4Y0FA 3EICA 2IM1A 3MTKA 2JJ4D 4C0HA 3HXMA 1C4CA 2QFJA 1D9DA 1F5BA 3G2XA 3NGKA 2H4YB 2RHQB 4NLDA 4GKJJ 2M4MA 1K44A 2WBMA 3PYEA 4JV1A 2MEWA 1PC4A 4M5IA 1VRUA 3KK1B 1N6QA 2HMIA 4J37A 2OFHX 2CJQA 1JLCB 1W7WA 4LBPA 4B9TA 1IM4A 2X3GA 4RW6A 2B9XA 4TKTA 3U7JA 5ETNA 2RKIA 4A46A 3KK2A 1RUSA 4ZCKA 4JI8F 2OPQA 3CF5Q 4B9NA 1FE4A 1PJ5A 1PILA 1UWBB 4NL5A 2VZ9A 4JI3F 2ZH8A 4X4UA 3FUYA 4Y65A 2CPXA 2DVIA 1FKOB 2R7OA 3FBEA 5HQMA 1ZZFA 2J9CA 4NCGB 2CPYA 2H51B 3HLUA 1JJCB 4K0KF 4ECZA 2D9PA 5HROA 1R8PA 1SH0A 2DHGA 2O3DA 3K17A 3MM6A 4RBTA 3T1YJ 1NBEB 2EFQA 3AOCA 3AA9A 5IT9U 1TV6B 3CJKA 4YB5A 4JI7J 1JKHB 1S6QA 2J8AA 2MGZA 1HQEB 4RZRA 4ELTA 1RHRB 3KG4A 3KLVA 3TQEA 1Q95G 4GKKF 4WXWA 1AXQA 3R97A 4C8OA 2W25A 4C48A 4X4PA 3JQMA 1M90T 4FF3A 4AXIA 1QSSA 3V4MA 4JV2A 3G4SS 5BR8F 2OMOA 2E1RA 1SUQA 5HMXA 1RTHA 2MQQA 5K8PA 1HNVB 3BR8A 2ZDPA 1RQ0A 1ZS6A 1WACA 2Y0SD 3D1HA 4C3KA 3T5JA 5J2NA 1S6OA 3HD1A 2YKPA 4IUFA 3TANA 1N5SA 4WCEQ 3DRYA 2IM2A 2HQDA 1OJ4A 4DBQA 1IN0A 2DR5A 1CJUA 5KFQA 2I2YA 3C3LA 1FKPB 1VOMA 2LQJA 2VA2A 1GMWA 1JLGB 2YKMA 4Y3CA 4WKRA 2AJQA 2ZC3A 1DQ9A 1FXDA 2QLXA 2VFTA 3H59A 3IA0A 3QATA 4XAKA 4OX9F 1NJYA 2OPSA 3KLGB 1PO6A 4DHVA 2ZUGA 2BZ2A 3I6PA 2RB7A 2DR7A 4JUZA 4B3MJ 1JLQA 4OLOA 1HBUB 1TVRA 5FIIA 5DDRC 3OR1B 1KHWA 4RW6B 2XY7A 3SI8A 4PEOA 1PSDA 2F3JA 3I0RB 2BKPA 3BPSP 3JQKA 4K5SA 4OLPA 4Y28C 3ITHB 5D78A 2HVDA 4R0EA 5L1KA 2ASDA 3HHNB 1L3SA 3JAMY 3UI3A 2PGCA 4LFBF 4IFYA 2ASLA 2F8HA 3Q24A 5AXLA 1N54B 5B0DA 1QSLA 3OTOJ 2XZTB 4ZIVA 1NDKA 1VQ9S 1TL7A 2KI2A 5M2UA 2X7IA 2BACA 2ZJPQ 4N76A 1CSJA 2R8GA 3MM8B 3I5CA 2ZJQQ 4OX8A 3NGDA 3RTVA 5B0AA 1WUUA 1M5PC 4A8XA 2GMHA 1RT5A 3BGRB 1SIWB 1VRQC 5DRKA 5ETVA 3CJ3A 1NB2A 2V4JB 3OHAA 4CH0S 5D0RA 2Y0BB 4ZVEA 1CJVA 3UNYA 1FD8A 4IR9A 3LP1A 2DEIA 4HDGA 3RBXA 4YR0A 3J81U 4KGZB 4E2FB 4P2MA 5DG7A 2ADCA 2XMJA 3H90A 3R6LB 4OV6A 3J7YU 1N5QA 2NPIA 2PC6A 3D28A 2RKIB 3OT9A 2OH2A 1FJGF 1H2UX 2E29A 5KT2A 5L1JA 4DV7J 4LRBA 2FC9A 3Q8PB 1TL3B 1Q53A 3TNVA 4R0JA 1XBWA 1FESA 4WP3A 3SSRA 1OS5A 2B51A 1YLXA 2EFNA 1IBLJ 1V5IB 2HLTA 2QMUB 3JSYA 3EZUA 1APSA 5BYRA 1ZM3A 5BJRA 2Q6CA 2QLBB 3FSXA 3ZZZA 3EM1A 2C2RA 2ZDOA 1REVB 2I38A 5B0FA 1NMEB 3FZ2A 2L08A 3OL8A 3OHBA 4W90B 3OUYA 1NSKL 4KE5A 3KJVB 1ZTWA 3MEDB 2A10A 1JKHA 3LF0A 4Q43A 5CYQB 5GADI 1PJ7A 3TQ1A 1FNOA 1WOSA 3SZ2A 5HSPA 2R7SA 5A8RB 2XGPA 2FYXA 1HWIA 1HA1A 3CSKA 4OI3A 1S0OA 1TL1A 4DSJA 2G4BA 1G1XA 1UW9A 1Q0NA 5DLGA 1CQMA 2A2DA 1U2RA 2IA0A 3F0NA 5DO2A 3V2UC 3BF4A 4CDIA 3PIOQ 2V69A 4N77A 4I69A 1IBMJ 1NRKA 3CDAA 3DRSA 1TFYA 3UQSA 3KNGA 4DV6J 1FJCA 2RE1A 2NSBA 1GXLA 5AXNA 3MR6A 3DHWC 4S0MA 2BANB 5KG6A 4ZN3A 2HNYB 2DNPA 1KWMA 1U49A 3HJVA 2HIYA 3ILJA 3N0VA 4GVLA 1PG5B 5FLXY 3W66A 2E9ZA 3CCWA 3QIPB 5HVFA 1T05B 2UZAA 3AH6A 4KTQA 1P27B 2OPRA 1UJ4A 3FEZA 2ALYB 2DNNA 1JLGA 2G2ZA 2YKMB 4G65A 2HWHA 5J1EB 1YJ9S 4C8KA 2IC3A 2FVRA 2KTQA 1I3OB 1FTCA 1LW0A 1NK6A 4IRCA 4N41A 1RT5B 3BGRA 4JV5J 2AJ1A 1MU2A 2WVDA 3QO9A 5EWGA 3GTYX 1QUPA 3OJSA 4DFPA 1NNDA 1VJQA 3OVAA 2JEGA 2XHWA 3R3TA 2IRXA 1JQGA 2OMLA 5KFJA 2EKYA 1AA1B 1TZ0A 2HQIA 5EX3A 4CLPA 3FMBA 1QDUB 4P71A 1LOUA 1CC7A 2WSFC 2DRAA 1HNIB 2OEJA 5HJYA 1NB7A 3SCKE 1KD1T 2M0GB 3W64A 2AV5A 2YNHA 4P9SA 1G6BA 3POTA 3PX4A 2KFYA 4KO0B 2ZD1B 1YX2A 4WE1A 1ZAWA 3K5MA 3TZXA 4RKUC 2E66A 2VBZA 1Q8IA 1YJWS 1VQLS 3KHHA 3ZC4A 1WEXA 4DL6A 4IO9Q 2MYFA 4I7FA 2XGQA 4DQQA 1HWJA 1OWXA 2W24A 3O3LA 3MM9A 3MR2A 5AE1A 2VOOA 2CKWA 4FZVA 2KB2A 4XPEA 1RHUB 1ZH5A 2QE5A 2RJZA 2UVUA 4KV8B 3NP5A 2WW8A 2YWHA 3MDFA 3ZO7A 1R8HA 2FVCA 3MEDA 4ZP9A 4C9DA 4AE5A 3JAMU 2GC8A 2CZVC 1OYEA 2WVFA 3JSRA 1F1BB 2CPHA 4NEZA 3C46A 3K8VA 4B3SJ 2QA4G 2PA8D 3DLEA 2BJ8A 2CAJA 2GVDB 3BBFA 3LH2S 1OPIA 3QIDA 4USKA 3OVSA 1MNEA 4GC6A 4C8ZA 2W2PP 3FQLA 2CDRB 4MJKA 5HQLA 3H20A 1RWWB 4A8KA 2ALZA 3CGIA 3NLCA 2KT5A 2OPPA 1ACMB 2A0FB 2Z2YB 1UP1A 1RTIB 3EGWB 3EPGA 4GKKJ 4URQU 1FO1A 2C3MA 1FX4A 3ZZRA 1S1UA 4I56A 4L3KA 3T9NA 2W9CA 1CVJA 2VDIA 5HLFB 3W61A 3T5KA 3K2YA 1LW2B 3R2CJ 1H0HB 2M52A 1RHJB 1T05A 4K8RA 2PT0A 4OYIA 2H3EB 1HW8A 4ILRA 2OPRB 3L7UA 4XK8C 2ZZTA 2GW8A 1UETA 3TYTA 2BW2A 2WOMA 5J1EA 2CXEA 5HROB 2VHGA 1FJGJ 4DCPB 2KRRA 4PQUA 3UWTA 1A6LA 4K2JA 1OQ6A 1S6UA 1WKKA 4RW8B 1YSJA 3CE8A 3W1YC 1HBMA 1T9VA 4ES2A 1X5SA 2K1RA 4ZK7M 4HHUA 3W9JA 2DR6A 3R5JB 2K06A 5F8LA 3KLHB 2KU7A 2MZTA 4RBUA 2KJWA 4DV4F 5F8HA 4LSNB 1CJKA 2E7WA 5A0YB 2FLLA 5KFAA 1HNIA 2UUTA 3M2RA 2DNKA 4C0BA 3MAQA 2B4OA 4RNMA 4DR7F 1NHKL 4IYQA 4QWDA 3DYAA 1UMJA 3V81B 2E5GA 3KDNA 3GYXB 4XDDA 2VQFF 3C15A 1RAEB 2MZRA 4Q0BB 2CWXA 3K58A 1JJ2R 2B6AB 5T7LA 3MR7A 4U7UD 4WYWA 5F8JA 4JI4J 1RTJB 4QYZJ 3QWUA 1IM6A 3GZ7A 1T9TA 3CCUS 5F9NA 1FI4A 1FRJA 1WELA 5IM0A 2W7PA 4FBUA 2EI5A 3HM9A 4ETZA 1VQKS 4OYPA 4RNOA 1FT8A 1JB0C 3A8IA 4YDXA 3M7VA 1LW0B 1NPRA 2JLFA 2JLGA 4F2RA 2DGQA 2HQFA 2ZH2A 4W4MA 3OV7A 3UCUP 1HQUB 4X4SA 3E01A 4M5LA 1K47A 3VAIA 1U8SA 2CQ1A 2DKOB 4P2XA 3H4BA 3JSBA 2A3JA 1RTDB 2AYEA 4O3OA 2KXHA 4NX9A 4OZ5A 4C6AA 4OZ3A 3FFIB 4DFKA 1TP7A 3AD7C 3QLHA 4B3RJ 2V8GA 3KXDA 5LM7E 4HACB 5I42B 3OL6A 4USVA 2CJXB 4M5KA 1IUJA 5JMNA 2HHXA 1KN6A 1RWKB 3OR1A 4ANDA 1SVDA 2GV1A 2J0QD 1GK8A 3I0RA 2BYCA 3HP6A 3VR1A 2CPFA 4WXOA 1NKCA 1S9GA 1SQFA 3C6TB 1KFDA 1P9YA 4KH0B 3I5BA 4F2SA 3OLBA 1QE1A 4KAIA 2ZH6A 3NMAA 2LXIA 2FHMA 4TYBA 3CMES 2CWKA 1XIQA 4KIAA 4M5HA 4KV8A 3CUNA 1WC5A 3MHYA 4JV5F 5J2MB 3ZTRA 2C22A 3DDIA 3PX6A 2DD8S 3NS6A 3EGNA 4PQAA 4QWEA 4C8YA 2DGVA 1TK5A 5GAEU 1UTAA 4NYZA 4BHQA 2E1CA 1MROA 2N82B 5KG2A 2WK4A 3NGUA 1HNWJ 1RA7A 3JXOA 3HX9A 3LA0A 5LL6d 2Z58B 3QJJA 4EO8A 3MEGA 2K3KA 2OSRA 2XBPA 3TEHB 4KPYA 2KG0A 3TAMA 3M32B 2GMLA 2AP6A 3IWLA 4AQYJ 3IMQJ 3C15B 1WOOA 2E7VA 5AE3A 3PR4A 2WZ1A 2BRLA 2HEKA 4W98A 5CXTA 2E5LF 3D7SB 2UXBF 2RSQA 1NSAA 2MHNA 2DGSA 2OI2A 3EVWA 3ICLA 4OMFG 4JI2F 3GJQB 2XQCA 2LEBA 1J27A 3HVTB 1QSYA 1F5AA 1QTMA 2IAJA 4DEZA 3NRBA 1FFGB 1BMQB 3OD2A 1LWFB 1NLKL 1R8CA 2N3OA 1ZZNA 1YJ7A 1JMTA 1REVA 3ZTQA 4PAAA 4FYDA 3GYGA 2JNJA 2MLXA 5GAGI 4PQUB 4IOBA 4RW8A 4DR3F 4K4ZA 1VC5A 4C11B 3CCVS 3OUYB 2K1RB 4RNNA 1QM9A 4DSKA 4WIIA 3OR2B 4LJMA 2PI5A 4OHZA 1JXEA 1T11A 2R8HA 3NGRA 1UVNA 1QAJA 4JB8B 1WHWA 3BB5A 1EQMA 4WWSA 5DZ6A 4YB6A 3U1LA 3M2RB 1XMBA 3K5LA 5I42A 4NLWA 3TX8A 4KHPF 2O66A 2Y8YA 4LSLB 3JSMA 4QU7A 3FNNA 4URGA 2EVZA 2CQHA 3HZEA 5IWAJ 4CO5A 3B4MA 3B6BA 1RCXB 2GAHC 5LMUJ 4RUBA 4Z7CA 1WHYA 1X4EA 2RT3A 4ZPDA 2DH8A 2N4CA 3KLFB 2FVSA 2B9YA 4OX6A 3DRPB 1PKUA 1VS3A 2B5JB 5A6WA 2PMHA 2XO7A 1WJ9A 1XERA 2MQ8A 4UZCA 1B64A 1Q78A 4LF2A 2B43A 2DPJA 2G13A 2C3YA 3TI0A 4TLRA 3TRGA 4FVCA 2ZE2B 3TR5A 4B9LA 3TEGA 4O3NA 4K5RA 3ET6B 5A8WA 5KFBA 5DDOC 4DR5F 1Q81T 1NDLA 1Q7YT 1TMMA 5L1IA 4UTGA 3VAGA 1EAYC 3I87A 1RWXB 4EZ6A 4Y6IA 5SUHA 2J8SA 1F9HA 1HW9A 2BOPA 2BDPA 2F7VA 3L7PA 2DO4A 1X4AA 4F67A 1DQ8A 2AGQA 1FERA 3JTNA 3VHQA 3J7A1 1N52B 1FKAF 1AUSL 4J90A 2YNHB 3UR3C 1WF1A 3POTB 4H4KC 1VQ7S 2E9RX 3BN7A 3AODA 3DNCA 3SMZA 3KJFB 4OZ2A 5T14A 5C2CA 1FRLA 2PI4A 3QRQA 3ZNUA 4DV4J 1LWEA 1C0TA 1XNRF 4USWA 4FYXB 4YR2A 1N0VC 5IT9Y 4X62J 1Q79A 3RAMA 2EXUA 1HHQA 3C16A 1U6FA 3AXMA 3K5NA 5F8GA 1TKXA 3I5AA 2XTJP 1R6VA 2ZHOA 1ZYQA 2DO0A 1Q8KA 3IR5B 2RUSA 2B8QA 1TV6A 2BM0A 1VRTA 2CZ9A 3FSYA 3CJKB 3ZZOA 4ETXA 4UOGA 1CULB 1NK7A 4W92B 5KFWA 4WIQA 3BGFA 5EGYA 4DLGA 3NS7B 1J5OA 4USUA 4FKXA 2XLIA 3UE2A 2G2YA 1RAJA 1X9MA 1MWQA 3QGPA 2H54B 3FVYA 4RU2A 2DY1A 1EP4A 1EQ0A 2XYGB 4LF4F 1JJ4A 4LSLA 3JSMB 2XZDB 2V67A 1PAEX 3GFYA 5K14A 4Q45A 4DV0F 3NNCA 4DSEA 2UXBJ 4BLGA 4TU9A 1YK9A 4MT1A 2NREA 2ZVSA 3G82A 4LF7F 5F3TA 3SXLA 2EPIA 2W9CB 3H8YA 4KHRA 4USJC 1TFWA 4OI4A 3THVA 2YWKA 2YPYA 4K4VA 1F60B 4O4GB 3CDEA 5FDLA 4DL4A 2WONA 4ELVA 3GV5B 4ID5A 4OYAA 2YPZA 2EC0A 1AFIA 1LWFA 2XMTA 2CQ4A 3GR0A 2HHUA 4Y2MA 3HPOA 2EBGA 4OFZA 1FKPA 1SJRA 4P6QA 2DCLA 2ZE2A 5ADZA 1NK8A 3MFIA 1XK8A 5D4OA 4KFBA 2PD1A 2A6MA 3ET6A 3NNAA 3RW6A 1NUEA 4MK7A 3ENAA 5GAHU 3O5TB 5E3QA 2ZKTA 4RL1A 3TP2A 4WFBQ 3PIPQ 2DY9A 3D1QA 1U1MA 2EG2A 3SSSA 4CH1A 1M1KT 1S1TA 1RADB 2P9EA 5D77A 1CBKA 2VKZG 1IKYB 3D2WA 1V3ZA 4TU8A 3HULA 4LSNA 1D8YA 1NPKA 3MAHA 3K89A 5F8MA 4MIWA 1SI9A 1RACB 5HATA 5DG8A 4DV6F 3DYAB 2APOA 5CCMA 4ZLPA 3B4DA 1T9YA 2MQNA 2ZBCA 3MPWA 4Y2IA 3ENWA 2BKNA 3H5YA 3SEOA 2LA4A 4B9VA 3OSPA 1SV5B 2WVEA 3HSJA 4DR2F 3SFUA 2X1BA 4YS2A 1HD1A 4PABA 1GTEA 4H4KA 3MAAA 3Q86A 2E5JA 5KOWA 1NKEA 2M8HA 4YMEA 1NK4A 4GC7A 4N56A 2R9LA 3SCJE 4RUHA 4RR5A 1N5TA 3X1LB 1SJ4P 1VRTB 4BC9A 4ZJOA 1NHVA 1UL3A 1K1QA 2H1YA 1BXNA 4ANCA 3CCSS 1IWGA 2WW4A 4IFVA 4NXNF 3MM5A 3PJXA 1IKVA 1SH2A 5C24A 2I5JA 1A0OB 1KONA 1JLFA 1SQEA 2DNYA 2ZWPA 4I6YA 4J9PA 1GAOA 2QL5B 1M5SA 1SKRA 1HHSA 1RAHB 2M7SA 4AT1B 3O6QA 1RISA 2DHSA 3WQPA 1S4EA 4EBDA 3W5YA 4DUTA 2N7CA 3CJ2A 3P3DA 2HZVA 3MGJA 1N8RT 5CYJA 2ZHAA 3D3CJ 1X8DA 1RTZA 3LUYA 1NJXA 1FWPA 3B54A 4K7QA 4GVBB 1YJTA 1YDLA 2YWFA 3VAKA 3PRDA 4CTAA 4IH6A 2JEJA 1UVKA 3Q8UA 2D41A 1OIAA 2PFDA 2R42A 2OIHA 5M2PA 4OZ1A 4CLSA 1JLBB 2YXLA 4DR6F 1N32F 3NWRA 1O8BA 4KFBB 4DUYJ 4BS2A 3MCSA 2EFVA 4NMLA 5J2MA 1BLUA 4IH7A 4EBEA 1CJTA 2YQ3A 2Z8QA 2CJAA 3NCRA 4G1QA 3JTPA 4OQJA 4DLEA 4ED1A 3RB0A 1IBMF 1MW7A 3DMJA 4RNFA 1WTBA 4P75A 3D9BA 3Q8YA 2ZNZA 2FY8A 2UUWA 3AJ2A 3R5AA 4ECYA 2XS7A 3CWJA 3HSDA 1QVGR 3G6XA 4M1KA 4NRTA 4X84A 3KDOA 1DY3A 1HL6A 2CPEA 5E5NA 8RUCA 1OY8A 1R3NA 5K14B 1RHKB 4HTJA 1VYAA 1X31C 3D0GE 1J2VA 3T1AA 4YHHJ 4Q8FA 3ULHA 5AJ3J 5DGAA 2LCWA 2RF2B 1JWWA 2D69A 1LXNA 2LLZA 3H25A 4N7TA 3EYZA 2LP4A 3DLJA 4Z37A 1VQOS 2BANA 3KJNB 4UY85 1MMDA 4MH8A 3RGIA 3PM9A 3IBWA 3VGUA 4YOEA 3J80U 5I3UA 3AT1B 4PUOB 4YDDB 5DLFA 2ADBA 2CG8A 3LP2A 2CQ0A 3LGNA 3KKFA 2ZOGA 3MECB 1F2HA 3Q2SC 3N28A 2DB1A 4L73A 2GAGC 4YB1P 2MQPA 2D3ZA 4LR9A 4U9RA 3BSAA 3EXYA 4JI6F 1EX8A 3ZTSA 4OHVA 5KFHA 1VQ6S 3QO9B 3IS9A 3OFGA 5IQQA 4WYLA 6AT1B 4WFNQ 3A8EA 1KVJA 1VQMS 2CPZA 4P7VA 5DS7A 1G3OA 3V5RA 1T9WA 1FXRA 4A8SA 5F8NA 1S7IA 1X5OA 2ZEJA 5E3PA 4HH0A 3W2WA 1TKDA 4LF5J 2XNRA 3FBFA 4EEYA 2JVOA 2M2BA 3DOLB 3NG8A 1PIEA 1T02A 2N4DA 1KC8T 3BR9A 1KQSR 4ANEA 1W2IA 2HRUA 4K4TA 1PCAA 2ZD1A 4M5MA 5E3CA 3VF0B 2RNEA 2FZGB 4ZVFA 2UUCJ 1IKXA 3HKZD 4RLEA 4LQ3A 4CP5A 4ZHRB 1HBOA 5F0WA 4CNZA 4DV0J 4X2BA 2VFUA 2XI2A 4WU2A 1KOHA 1OO0B 3QFHA 4OZJA 1E6VA 1XMOF 3SV4A 3CCLS 2GVZB 3MUVP 3WC0A 2VASA 1L3UA 4F36A 3M6VA 2JX2A 1RYSA 2CPDA 3G86A 2XS5A 3ZZYA 3BKTA 3M6XA 3ISZA 2CJYB 2RRNA 1URRA 3PRBA 1WWHA 2LECA 3NGTA 2FHKA 3BQ2A 1UPPA 1XMOJ 2PA3A 3M1VB 3LWMA 2BM1A 3Q8SB 3RR8A 2R7RA 1S1XA 4I2PB 1V5VA 2LU1A 2UV8A 3AJ1A 3H5SA 1FRXA 3MEKA 5D6GA 4JI3J 4HH1A 4O44B 3QRRA 3GCWP 1SKUB 3LPYA 5ETOA 2CQBA 3Q8QB 2EFOA 1RTIA 5B0GA 2MB0B 1SKSA 1S1UB 2DIVA 1NXIA 2HKEA 4FKYA 3KHLA 3Q89A 5LMNF 3QZ7A 2RQKA 2IPOB 1WG5A 4PWDB 1BQMA 4ECRA 4J9SA 2D1CA 1RT4B 2HIQA 2CVEA 2J7KA 3BV8A 5M2RA 3THTA 2VG5A 4FN5A 5G0RB 3R1HA 3NL0A 2KRBA 2WOMB 2XLJA 2Y1JA 1X0FA 1TKXB 4PCQA 1FWKA 3T1YF 3BEGB 4G1QB 3SCLE 5DDPC 4ECWA 2H48B 1Q82T 1K1SA 4F8RA 3MCOA 5D15A 2AJ2A 4EBCA 3PYGA 1T9XA 2ATCB 3N6NA 3HK2A 4ECVA 2JWNA 3F44A 2XHCA 4KB7A 1RB0A 2W1BA 1YQHA 4JI5F 1HYSA 3QT5A 3UR0A 1WF2A 2VBYA 5DQGA 1AUDA 3W3SA 1RWNB 2BA9A 2IJNA 1Y5LB 2KM8C 3R6GB 3VAMA 1Y5NB 3V81A 4F4KA 4N8OA 4NXMJ 4RO0A 2V68A 1UFWA 5KG4A 3TOQA 1IBKF 1B7FA 1B99A 4Z7YA 1P1TA 4I1TA 2C2ZB 1IWAA 1MMLA 3HVAA 2RQCA 5CD4A 2NR0A 2V8DA 1U1RA 3BSCA 4C97A 4GO5X 2FQQB 4KRWA 4HHJA 4URSA 2W9AA 1UWAA 2IVMA 2JSXA 2Y1LB 3K8WA 4PPZA 5I4MA 3PKYA 2C3PA 5KFGA 4N47A 2FHOB 1WSRA 2QRRA 2NPFA 4EI2A 1MMNA 2IA6A 2F4VF 5E2QA 2OD4A 3CDBA 3MOZA 3RZAA 3TVYA 2AGOA 1UJ6A 5IT0A 1VDHA 3M1VA 3RYLA 2VG6A 1EKSA 2HURA 4B3OA 1YVFA 3D66A 4CYUB 4IG3B 2ZM6J 1HNVA 2BOAA 2A6OA 4DR2J 2J0XA 1RGVA 4UY8T 1QLNA 2V9KA 1U1KA 2I8EA 3IBFB 2K8GA 2R3VA 4TNOA 2CA9A 4C3MA 1X4HA 1L3TA 3JB9k 1FVSA 1REGX 1V9OA 3B82A 1C1BA 4O3QA 3FMWA 2HK3A 3PHTA 1UFLA 2F8EX 3QZ8A 4DR4F 1AT1B 3SDEB 4DL3A 2UVRA 4WBFA 3NBPB 4ZMMA 2XO6A 2FHJD 4LFCJ 1F2GA 2X3DA 4HVZA 4IG0A 3I0SA 2OPSB 3QT7A 3A3OB 1TAUA 3OJUA 2UV8G 4UW2A 4F0KA 2XY5A 4F25A 4HKQA 3OSNA 2BX6A 2GJIA 1S49A 4FVMA 1NH8A 2FVPA 2CQPA 2KVQE 2A18A 1T03A 4CT9A 4CO0A 4QR1A 1RBLA 1SC3B 4NA2A 3L9ZA 3DLBA 3HHLB 3E2EA 3M8PB 5A8KA 2HS0A 2I9SA 5B7WA 4JI1F 3GFHA 2J9EA 3IM9A 2BJ7A 3KNAA 3T5LA 1WOPA 2AJ0A 4MKBA 3CT9A 4NPOA 2HQCA 4NLRA 3M32A 3PG9A 4LFCF 3MMJA 4LMZA 3M6WA 5IS2A 2LMIA 3W5XA 1U1NA 5LT5A 2HFSA 5A2QU 3CULA 3IRXA 1LK5A 1Q5YA 4C3LA 2CVIA 1TU0B 2IMOA 2HQGA 3N01A 4LRCA 2EK6A 4NASA 4ZPBA 3U1MA 2MQLA 3K59A 4DQSA 1MWYA 5D3GB 3W65A 3MF5A 3PW7A 2R8KA 4LFBJ 2BUNA 3QT6A 4NLOA 4CO3A 2CNNB 1SCJB 1MN9A 4JI0F 3IGVA 4QWBA 1VIOA 3CTRA 2HFVA 3FZBA 3LPEA 4NA3A 3VQTA 4DX7A 4J9UE 1YRUA 2DNGA 2FIUA 2ZH7A 3ENQA 2RQMA 3PDNA 2JDJA 2IJFA 2HG4A 1M5KC 1FWLA 2DNOA 3O8WA 2XI3A 3AFGA 4P73A 2WRMA 1AYEA 5D8HB 1K73T 3WIUA 5HAOA 3DMJB 3EE3A 3KLEB 1UVIA 2U2FA 1HWUA 2Y8WA 3FDSA 4P72A 2DXEA 2AMCB 1K0VA 3M2UB 3I82A 3WDOA 2GO9A 4EWTA 5CAAA 3FGVA 3MUMP 3CCRS 1X9WA 2WVCA 2E9TA 1RT2A 3IR6B 1I94J 1Q7LB 2LA6A 2C2NA 2VFSA 3IFEA 1KKHA 3UD5A 3D6TB 3M8YA 2DHHA 1M0SA 1OQ3A 2F63A 2JEFA 1A9NB 3DXBA 2HS3A 2ROGA 4DU8A 1B3TA 5L1LA 4O4RA 2BJ3A 5K20B 2O67A 4KGVB 1RAAB 5B0CA 3D5MA 4IOAQ 4ZIWA 3IWXA 3ZXWA 3HHLD 4CM0A 5F3ZA 3CCES 2G0JA 1RT6A 3BN4A 5CYQA 3SIPB 3UNGC 5KFMA 3JYTA 3BO3A 2D3O1 2DNZA 2CNOB 1TL1B 2POKA 1XNQJ 3R1LA 4ZOSA 4LVOP 4WFZA 3SQOP 4JI6J 5D0GA 4K0KJ 1UAWA 3DLKB 2X1FA 2M5YA 5IOLA 2RAQA 2L41A 4RNHA 5L9XA 3M05A 3DU6A 5GAHI 2W9BB 4H4OA 3RBDA 3RAQA 2BXJA 3H5XA 5RUBA 5J2PA 5J2QA 1NJZA 2BKOA 2OPQB 3QGGA 1ZAXA 1KTVA 2RS2A 4YEAA 1GMVA 3AXKA 5EWEA 3OFFA 4OJGA 2LYVA 4CLUA 1SL0A 4RWXA 3PW5A 2XYPB 4ECTA 4J9VA 1RK8A 1H6KX 5JJBA 2DCUB 3BGLA 2EW9A 2V63A 1R89A 3SFGA 1IKXB 4YFUA 1S6PB 1LWEB 2MXYA 2AT1B 3NBPA 1U4BA 4KKOA 5LOQA 1N88A 2OKQA 1DJ0A 3DHXA 3SYZA 4KGKA 2AD9A 1SL2A 2HHWA 3MM7B 1FF2A 2DHXA 3ETOA 1IKWA 3CB4A 3NGSA 4OV1A 3HFKA 3NAHA 5CH7B 5FD1A 3S1TA 1PYSB 1RJJA 2CUYA 3SBMA 2O01C 4QPXA 2BV3A 2GMJA 3LANA 3GJTB 2RUGA 4KR0B 3GIMA 3ZTOA 4H54A 1T03B 2GCFA 1F3VA 1BHNA 3HFVA 3RRGA 2ROPA 1S10A 4M5DB 4YB7A 2HAIA 3Q8VA 1SJQA 5K8OA 1U2FA 2MDAA 3FKBA 3ISNC 3ZZ0A 4UQGA 2D3UA 2V8HA 3DLGB 2V94A 3KHRA 2WSEC 1HKAA 1T94A 4LRAA 2ZH4A 2XSJA 1FKOA 1S5ZA 3D68A 3MTJA 1LV5A 2HWIA 2RHSB 5FLXU 1VLYA 4K4SA 2QC3A 1FTRA 2VDHA 3GJSB 3FRZA 4DPUA 1J5EF 2ABYA 7FD1A 1HNZF 1H74A 1WI8A 3OL9A 4K4XA 1HR0J 4FYWB 2UUCF 2MGZB 1C0UA 4MFBB 2EFPA 1XR6A 1B70B 2K3IA 3QYYA 4FPIA 4OZLA 1O51A 2QSFA 2H4WB 3K57A 5D0EA 3UVJB 4TXSA 1N48A 4L76A 2KFNA 3CJQA 2CG4A 2DR9A 3T41A 2FZKB 2R7WA 1Z2ZA 2JLEA 4KBIA 5C42B 1FX2A 1IBCB 1LXJA 5A2QY 3FJ2A 3JS9A 2FB0A 3DLKA 2KHDA 3C6UA 4LQ9A 5J1NA 1NJWA 5K5MA 1TMJA 2MHEA 4H4OB 2ZOMA 5C7PA 2DNQA 2L3MA 2VICA 6FDRA 1NSPA 4ES1A 2YY3A 4IQMA 1PBUA 3QBCA 4FDFA 3IXQA 2VB6A 2UUAF 4F26A 2HFOA 3I31A 4H4MA 4HI2A 4B3TF 1Y11A 2V5HG 2N3LA 2CFXA 4Y2AA 3LGHA 2GHPA 4DV3F 3BGUA 4AQYF 3RBZA 4J9RA 2CQCA 1LEOA 2G1DA 5ETQA 4ICLB 4LF6J 2HVHA 2HZCA 4MMOA 1SKWA 5KG3A 1HNWF 1RU2A 2QMXA 2Z2MA 3KOAA 1VFJA 3GG0A 3OTDA 3X3UA 3QRPA 4ZN1A 2ZKUA 1NCLA 1JLQB 4NLPA 5KFEA 3CIMA 3KLHA 1CLFA 3GCXP 3PJWA 2Q66A 2PMZD 2GS8A 1S9EA 4M8LA 3R8YA 2X1AA 1WORA 2OP5A 2QV6A 1R31A 2ZH1A 4DV1J 1IKVB 1TAQA 2ERRA 1S48A 5IZHA 4ED3A 3A8KA 1WC4A 3J80Y 2VODA 2KL8A 2AJFE 3VGTA 3BPDA 4USMA 4LR8A 1HNXJ 1LK7A 3FCHA 2BEFA 5DGBA 4PG7A 3KMQA 3F41A 3BSNA 5HI7A 5B0EA 4ZPVR 1HR0F 1RT7B 3IG1B 4J5OA 5CYMB 1VC0A 1S0MA 4I68A 4DF8A 4GVBA 3NKYA 1CC8A 1IR2A 2XWYA 2YKOA 1UA0A 2R7UA 1X7VA 1DTTA 2HRTA 1C0UB 4FNHA 4MFBA 3WX8A 2FJXA 3GP9A 1DURA 2LVWA 2W4DA 4I4BA 3EVOA 1VR6A 4DPOA 1FVQA 4J9MA 1SBRA 1WTFA 4B02A 4PZVA 1DFDA 4C2MA 4CLLA 4F0MA 4UOHA 4O3PA 4DI6A 2W8KA 2DNMA 2NLWA 1CJTB 3J7AN 2WHOA 3C6UB 2GHWA 2VBXA 1S99A 4G1PA 2PSZA 2FJBB 3OQ2A 2B8PA 2IIHA 2HRYA 2B4UA 1VJWA 4FP9A 4IO1A 2AEFA 4JV0A 3C8YA 3VZHA 5HBMB 4YQWA 2HHTA 3RB6A 3M8PA 1VQYA 1GTHA 3DGPB 4QIEA 4OI2A 4NLXA 1XNRJ 1S9GB 1DARA 2DNHA 2QLFB 1HMVB 1ZAVA 2QZ8A 3M8ZA 4LIRA 2AF6A 1D1UA 4QBUA 4ZVTB 2RF2A 1KQFB 1Q1KA 2AX0A 3GLJA 2E5HA 5KFOA 1RE1B 4Q7AA 4DR7J 4QYZK 2HHQA 2WB1D 3G6ES 2MZQA 5H1SV 1IBKJ 3IRXB 1W25A 1VMBA 4XDCA 2NCKL 4UQTA 3BREA 2KM8B 3F73A 3ILLA 2IC3B 5HP1B 1ZTTA 2XNQA 3AOBA 4U96A 5AE2A 1RP5A 1S6QB 4O0IA 1F5CA 3R5DA 3M8QB 2QGFB 4KPCA 1NDPA 4NCBA 1H72C 1S9EB 3TARA 3AD9C 3PKMA 2AKWB 5D4LA 5GAGU 1OPZA 2HYIB 5C25B 2J5AA 4DZ6A 2UXCF 2J6TA 4WFYA 1YHQS 2HNYA 2HVEA 1LKZA 3HSGA 5HK4A 4CH7A 3SV3A 1T7PA 1U45A 4LUBA 4KO0A 2MY8A 4WE1B 4V1Ak 5F41A 3D67A 3T19A 2KG1A 2R2UA 7FDRA 5J2NB 2HFUA 2M70A 3HVTA 2DGXA 3BQ0A 2VJUA 3CD7A 3M9OB 2R8IA 5LMNJ 4U8YA 2XY6A 2J76E 5KT4A 3PJ9A 2AWZA 1H7WA 3TAPA 1X9SA 1HBOB 4CQ1A 3CPWR 1X4GA 2OEMA 2WSCC 3EZOA 1XWLA 4NMXA 5HJXA 4KHPJ 2HVZA 3Q2TC 4CWBA 3AOAA 2Q79A 2VPZB 3ETMA 3IP0A 3KWMA 3CJSA 4C11A 1BE4A 3V6KA 1N33J 4LF1A 3QJPA 1S1WA 3A8JA 3OR2A 2IM3A 2DHAA 3MWBA 2B0GA 3T3FA 8ATCB 2LDIA 5H9EK 1SQGA 7AT1B 4M5GA 4LFAJ 2D74B 2FVQA 4FXWA 4MYTA 4WZMA 3GG1A 2ATLA 2JC0A 4DX5A 5DM7Q 3GIRA 3NNHA 1YBUA 3W62A 3RBEA 5CQGA 3PW2A 2HNZA 1D0EA 4JI0J 1DRZA 1WD6A 2QL7B 1G4CA 3DI6A 4I7FB 4WJBA 4QPTA 4DJBA 4KJIA 5B0BA 1XC9A 1FRHA 3T6JA 2AYBA 2B5JA 3LAKA 2DNRA 5CA5A 1RT7A 1IJFB 2VV5A 3IG1A 5CYMA 2MY7A 4ED5A 4L6V3 4HYKA 3MR5A 3OXGA 5DZ7A 3M9NB 3UDCA 2XMVA 1DTTB 2OO4A 3US5A 2X1GA 3LAMA 2XLKA 2KH9A 4PXEA 1S6PA 2HPUA 4WPAA 4F50A 3FCVA 3W63A 2JL9A 4HDHA 3I4HX 3PY8A 3NMRA 3H2LA 2DRDA 2XSFA 1Z4UA 2ZVIA 4F4WA 1KFSA 2AW0A 1ROFA 2BE9B 1HI1A 1X0PA 2DEJA 4P10A 3ZFVA 4J9QA 3LOUA 1HBUA 3TA2A 2KKHA 4YR3A 4FXVA 3AB2B 4TU7A 3HVRA 4Z2XA 4RU9A 2EG1A 4AUKA 1SC1B 2BRKA 3TA1A 5KG7A 3MOJB 1DLOA 4P2SA 4HHHA 5HLFA 3MPVA 1VK8A 3BBCA 2ZBQA 5GADU 2RDJA 4ZJLA 2HGMA 4DQIA 2OFGX 1FDDA 1C0TB 4DL0C 2W4CA 1KDNA 2KYXA 3W9IA 3J7ZT 2PO4A 3SSQA 4EZ9A 4ZP8A 2H5JB 4G3IA 2Y1RI 2VU5A 2WB4A 3GSDA 1FA0A 1FJ7A 4CRJA 1N36J 1V3RA 3DLHA 3HMJG 1CG2A 3M8SA 1KP6A 1RWUA 1C1CB 2W4PA 2RU3A 3R9LA 3IAS9 1B7YB 1JNRB 2MPUA 1OMSA 1S1WB 1CULA 2VKRA 4M5JA 3M9MB 2IY5B 2O1PA 2QMWA 1SC6A 5FJ4A 3E01B 2FDNA 3QJLA 1U48A 4ZS6A 4A48A 4GO7X 2C2KB 2E1PA 1NU4A 2QYGA 4FPRA 4QR2A 5B09A 1KEKA 1P8GA 2MZSA 3W8GA 4OI0A 1NK9A 1WNEA 2CQ3A 2HVIA 1TKTB 2HSEB 3UN5A 4DV1F 1TUWA 1ZBTA 4NLUA 1G7CB 2GQQA 4ZP7A 4XO0A 2MZ1A 1RTJA 3TZYA 4OHXA 2H65B 1TK0A 2AYGA 2O5DA 2Y9HA 4DR1J 4F4XA 1VQSA 1ZPVA 2BQRA 5IM0B 1UWBA 3RW7A 1U2CA 1U6ZA 2GNKA 2D7SA 1QAYA 4H4MB 2IVYA 4NLYA 5IC6B 3SQGB 3LGMA 3KK3B 3CCMS 2BR0A 4GRSA 3DM2A 1U0HA 3RG6A 3M8WA 3J81j 5K8MA 5MLCV 3W9HA 3QGHA 3M2VA 3ISND 2VQEJ 4RW4A 3SDEA 1FJEB 4F3OA 1TKZB 1NZAA 2GJ2A 5U47A 1YKWA 2QG9B 3UO0A 4NI2A 2V4QA 1GH8A 4QIWD 2H9ZA 2ZH3A 1T3NA 1RTDA 3Q83A 4ECQA 4JI5J 3CNQP 3VCDA 3ILOA 2VFVA 4C98A 3HKWA 5A8RA 5IV3A 1S1TB 1UCNA 2MKYA 2MSTA 3QGIA 4QIVA 4DWIA 1XQIA 3HDSA 3GIIA 3MEGB 3DN9A 3R27A 1XN9A 1ZOTA 1S1VA 3HHLA 2M3DA 5JVGQ 1SXLA 2W7AA 3C6TA 3R2DJ 2W2QP 2F40A 2IFXA 2W2OP 1UVMA 5GVQA 2P9CA 3N4WA 2RS8A 1RTHB 3DLLQ 5GMEA 4G1IA 4F04B 2Y1IA 2AJ4A 3MAAB 3QIPA 4NOHA 1MWZA 1C2PA 2MQMA 4N8NA 2NXEA 3AY0A 4NRUA 8AT1B 4ZVSB 1VHIA 2DBBA 2BJ1A 2GIRA 1HWLA 3HZGA 4L74A 4X4TA 4M95A 3GR1A 1ELOA 4LF4J 1VBKA 1VISA 1IXKA 3ZZUA 4ZPTR 3GE9A 3G71S 4OX9J 4MK9A 4M5NA 1LFPA 1OSCA 4ZCLA 3A3NB 5KFXA 4F3QA 5MAOA 5KT5A 3PZPA 2L9NA 1D9FA 4OJ3A 4DN0A 2XMMA 1TKTA 4C8LA 1BQXA 2NYIA 3MMBB 4U8VA 4ZDNA 4V19J 3PW0A 1YITS 4OHWA 5EHHA 2MJUA 3FCWA 5E33A 4F3MA 4L75A 1RZMA 5IC4B 4AD6A 2W01A 3S6EA 1RWMB 1U26A 2F9JA 5I3PA 4WKYA 3DU5A 3I4PA 4XIUA 2PIIA 1H98A 1AZSA 1JLAB 2C3UA 2OHDA 2F9DA 3AQPA 4IFYB 4KGXB 4DPXA 3DRPA 1CQNA 5BR8J 4DZDA 2ZHBA 4LF7J 4MKVA 4AYBD 3TUJC 5KFUA 2AEMA 1U0HB 2DGTA 4QU6A 1C1CA 2VPXB 2CDQA 4ITSA 1Z1ZA 4KHMA 4PWUA 1LWCB 2CIMA 3P8BB 4NI2B 4R8UA 4ED4A 1RU1A 2ASYA 3KLGA 3ENVA 5A8WB 1N5VA 1NKBA 1N56A 1RAOA 2MSSA 3DOKB 4LRDA 3UDEA 3Q0AA 3VGVA 5K8NA 5KFIA 1S57A 2W9BA 3NWGA 1FDAA 2UP1A 4DOZA 5ETMA 1MN7A 3DC2A 3P96A 2W2MP 1HI8A 2E5IA 2MKJA 3KJQB 4LBHA 3NS5A 1NZ8A 4R25A 4MKYA 3G8SA 4YY3F 1XR5A 2LKZA 2B6AA 5T7LB 2B3TB 1D9AA 4DG1B 2V2KA 4PUOA 4X4NA 1TL7B 1Q4RA 2YVSA 4X66J 2V50A 4X4RA 2IDEA 2G0CA 3KK3A 3LTOA 5D4PA 4CM2A 4DFMA 3DM2B 4ECUA 1F9EB 1I1GA 4B9SA 4K4YA 2H5IB 3C16B 4DS4A 1RABB 2EK1A 2PMWA 2KVIA 4O3RA 2LEAA 4RJVA 2BABA 5I3QA 4JYAJ 2VF3A 3BYRA 3L3CA 4EFAC 1HBMB 1CS4B 2UUBJ 2X51A 4MYUA 1RXOB 3S01A 4DR1F 2KYZA 3LP1B 2R2RA 3EGZA 4DSIA 2QA4S 3W2WB 3QLHB 2GJFA 4IH5A 2IBKA 3OFEA 3H42A 1H2VZ 3DOLA 4I67A 5ETPA 2VOPA 1EP4B 4NWBA 1WF0A 2GHVC 4M5DA 1RCOB 3IM8A 2LQ8A 2YQ1A 4FF2A 2BE7D 1JLEA 3QFWA 4IRKA 4ZHRA 4ZA1A 4OYOA 4NLSA 1YGYA 1JXLA 2DXDA 4X4VA 2GZOA 2QN6B 3FK4A 4KT0C 1I51B 2QFIA 3GIJA 2M8DB 2HW3A 1FFSB 1QE1B 2J7UA 3MMCB 4PXBA 1DZ5A 3UN3A 2F8MA 2FJAB 5L9NA 2YQ0A 2J9DE 3QQCD 2E5LJ 1N36F 1GNKA 3NY0A 1WHXA 4UUWA 3MMAB 1LWCA 3I56S 2YNIA 3PYDA 1J5EJ 1TELA 4DL2A 4NEYA 4PPDA 1Y00A 1S59A 2PEHA 3GONA 2I6WA 3DKDA 4CNYA 4EO6A 1WG1A 4DUZF 3R7SB 1DTQA 1FHTA 3GMGA 3UCZP 1Y4ZB 4DV2J 5ETLA 1MROB 1D09B 2FHJA 3FFIA 2K7JA 3PTWA 4QIGA 3W7BA 2QJ3A 3T1HF 1N34J 4Q44A 1WEZA 2CJBA 3M8RA 2UU9F 1UKUA 3GIKA 3QSYB 3Q8RB 3LW5C 2OJ3A 2CADA 2VIHA 1PYTA 2DRBA 3P49B 1TR0A 2E1MC 5H9EJ 2VL1A 2XCAA 3HCXA 3GPAA 3H4DA 3TO8A 4JI2J 4ZJQA 1EIYB 1XJWB 3BSOA 3PACA 1H38A 4DV2F 2CNKB 5BXIA 2G9OA 1JNZB 1V3SA 2V0NA 2P8IA 2KXFA 4QCLA 2ZJRQ 3UD4P 5KOXA 4ICLA 2HNDB 4ID8A 1HPZB 3FSIA 4TVAB 1SH3A 4HL9A 3HFZB 2NXCA 3GQCA 4B3TJ 1T9UA 2R7XA 3D4JA 2UUAJ 1C4AA 1BWEA 1VCTA 1HQEA 4PXCA 2XC9A 4B9MA 5LSLA 3IBCB 4YUDA 3OTBA 1Q8LA 3TVZA 3CC7S 5C24B 3EPIA 1TK8A 1FRIA 2G2OA 3NCPA 1A7GE 4USIA 5J1PA 2DK2A 3K0JA 2GVDA 4X4OA 1RYRA 3G96A 4I2QB 4L3NA 1NPPA 3D1OA 1KQKA 2B4VA 5KFDA 5IT4A 1OY9A 4MTPA 2NZ4A 3C66A 4PWWA 3SCIE 2OTLS 2KZMA 1ZETA 1FK9B 4WTYA 3VAHA 4QR0A 1MLAA 2CQIA 3CJ8A 1URNA 1S0VA 3MM9B 3H0PA 1EZZB 1H73A 3NXZA 4ZPAA 5HMWA 4QW8A 1KRPA 4NLGA 1VBZA 1L5UA 1LW2A 2AYMA 3VQSA 4JI4F 1RBAA 3SQGA 5JUMA 1WI6A 2HHPA 1M5VC 3MMAA 5L46A 3PR5B 2YNIB 3IR7B 4DX8H 4EMDA 5HN0A 4F4YA 1BUXA 3M2VB 4RW4B 3KYLA 2HHVA 3W60A 1L3VA 4LREA 2F4FA 1JLFB 2VG6B 4NA1A 2B9WA 3UD3P 2PFFB 2L48A 2XMWA 5D0HA 4CZCA 4WF9Q 2XG8A 1S77D 3CDUA 4X66F 1NK5A 3N5BA 3R5CA 3CJ0A 4KGMA 1UVJA 1RHQB 1S4FA 4UOCA 1RWPB 4HEA9 1O5JA 1B0TA 4ILMA 5GMDA 4YY3J 2MZJA 3KLIB 2XCPA 4CT8A 5HBMA 2F65A 1JLEB 4A8FA 1S1VB 2P6SA 4ZVUB 4HR2A 3VZIA 2V8VA 1FFWB 4CTAB 1FCAA 4MIBA 3G8TA 4FXDA 3B8HA 2BBEA 2R2TA 4X4QA 5EX0A 2BE2A 4K4WA 3EXCX 3RAXA 2C2MB 3PO4A 2XS2A 4JI8J 4ZCMA 4NZ0A 3DRXA 1R0AA 1HI0P 4DCOB 2IMWP 2YWWA 3DDKA 4J91A 2QL9B 2GGPB 3I55S 2AIRB 2QLJB 1IQZA 4LRFA 1EKRA 1FXLA 1DBDA 3EDQB 3CD6S 1DTQB 2JRSA 1KLMB 1Y3JA 4A8MP 3FEXB 2V4JA 2IHR1 2Q1LA 4GKJF 3QSIA 3OBIA 4ED6A 4B3SF 1WDDA 5LSRA 3GV8B 1I6JA 2J0SD 1U25A 3HT0A 2V2ZA 5C25A 3CDWA 3BM7A 4OYZA 4HACA 3GSIA 2IDLA 1DHMA 3NOGA 3NOCA 4J9KA 3EWGA 3R5BA 1KNZA 3H40A 1FK9A 2QA1A 3G82B 3V4IA 3CJ5A 2WTFA 1X4DA 2ILZA 5D3GA 2FLOA 3DRRA 1NEEA 1NH7A 3QAEA 3W5ZA 2QLWA 1SL1A 1K0TA 1Y9OA 5FDLB 3LO3A 2DGWA 6FD1A 2V9WA 4BWJA 3CXCR 4FF1A 1MG7A 1E6VB 1UFKA 2A2CA 2MKSA 4DF4A 4USTA 1SJFA 2R7TA 1T3OA 5E3AA 3WHIA 1ZM2A 5C2GA 1GX6A 2EFGA 2NXJA 4DFJA 1JIHA 2ACMA 2J9DA 4EYIB 3J7YI 2DYAA 1UJ5A 1RDRA 4LF8J 2RU9A 4G6VB 2GQCA 5GMKa 3E51A 5JVHQ 4MKAA 2XM3A 4J7CA 2YNGB 1RBOB 3ZZTA 4U6PA 2FLPA 2EBEA 3T5HA 4LF5F 4JBCA 1IKYA 1PAUB 4HLBA 4C4WA 1M1HA 2GIFA 2LEPA 2DIUA 3OXFA 4DR3J 2VBWA 4NZ7A 3L7OA 3V6HA 1S0NA 3HHKA 1NHUA 5KTQA 2ZH9A 1PBAA 1VK3A 3MPUB 1XMQJ 3CC4S 3C2PA 4WP8A 1VHFA 4LF9F 2ZH5A 3R7BB 4MIAA 5KFLA 2XULA 4OX7A 9RUBA 4PG6A 4MK8A 3V6JA 3RR7A 3MCMA 1WHVA 1HIYA 2XMKA 3KMSA 1FRMA 4UF4A 1PYOB 3QNWB 4PG5A 3RJMB 5EWFA 1X4CA 2VC1A 1F0XA 3PFEA 4ZKAA 2QA2A 3AHPA 4IDKA 1R8BA 4AL7A 2J6SA 5HO4A 4A8QA 3TZZA 5H9FK 3EUNA 1RKIA 1KS2A 4Q2LA 2MQOA 3BH6B 3W2VB 4QWCA 1WC1A 3MEEA 4NYOA 3LQVA 1RKJA 4CLFA 4A8YA 2V34A 5KFSA 1ZPWX 3A1YG 4ED8A 4B9UA 2HQ3A 2DH9A 1ZM9A 2E1AA 2MKHA 3BQ1A 1VQPS 2XZWA 4JI1J 2HGNA 5J2PB 5J2QB 4DCJB 1YZ6A 2YH1A 2CJKA 2P2CB 3J7Z5 1HYSB 5KFPA 3IRWP 5ETSA 1U1LA 4O3SA 1WC0A 5DETA 1KSPA 3BO4A 2NYHA 1DLOB 1JK9B 2IRUA 3EVMA 1G2EA 1VQNS 1IVZA 3BDEA 4ZITA 1BQNA 4RW7A 3E3XA 3LP0A 2CQGA 3HI9A 1N34F 2YNFB 4TYAA 2VG5B 4ER8A 3TUPA 1TUGB 2CRLA 4BCAA 3G6VA 3TA0A 3CJ4A 2V8PA 2BQUA 5HVGA 3HHLC 3MMCA 2GGPA 1N5YB 1EHWA 4X64F 1RHMB 2ZBPA 2NUHA 2Z4PA 4DS5A 3TJ9A 3DDNA 3CD5A 3L09A 1RWOB 2R8JA 1R27B 4DV7F 1NAQA 2NS1B 2ZZNA 1KLMA 3MM5B 1WSVA 3T6BA 2H5EA 4OI1A 3RUBL 4FYVB 4UZBA 2FTRA 2LQ5A 4QJVA 1YTYA 1GT8A 3DLEB 4OZ0A 2ROEA 1WKLA 3DLGA 3OXLA 2WVBA 2YKQA 2WAQD 1B0PA 2XSJB 1NSQA 3QT8A 2Z2ZA 5CZXA 2F4VJ 2XB2D 2DT9A 3MR3A 4KH1B 3I9ZA 4OYBA 5HVHA 1N5YA 4C8MA 4WFAQ 2K7KA 4L72B 2OD6A 1FEHA 2V2VA 2OGUA 2HK2A 2CJ9A 2EWHA 2XWXA 3DGVA 4A8OA 5LJ5Y 4IRDA 1C1BB 3WX4A 3VV2B 2AZ3A 2GQ2A 2IYIA 1F3FA 1ZA1B 4A47A 3OTOF 2HHSA 1UA1A 3LP2B 2HZAA 4CO1A 1ZA2B 1IQTA 3ILIA 4JOUA 2RRBA 2YX1A 3U1NA 3FBBA 4X65F 3IN5A 1TKZA 1VRUB 2FPHX 2QIFA 4OJ1A 1HPZA 1XTZA 3L4BC 2YKNA 3G87A 4FYYB 4ZVOB 1YRXA 3W2VA 5KT6A 1JLCA 4NXMF 1ITPA 3TW0A 3VTIA 3EDRB 1DAXA 3IS9B 4NLVA 2KDOA 4DV3J 4E0DA 1S9FA 2XMUA 2RQ4A 4D3GA 4EUVA 1OYDA 4PYDA 3KK2B 4EYHB 1PGZA 1Y5IB 5H9FJ 2VONA 4F02A 2BVZA 3VGSA 4U67Q 3UCGA 4D3HA 1M5HA 2PDAA 3TX0A 2KO1A 2QO3A 5A6PA 4OHYA 2ZUAA 2W2NP 2YWEA 3JTOA 3LALA 4I2QA 2Q43A 4DV5J 4R5PA 4RW7B 1EB0A 4ES3A 3GV7B 1VC6A 4TN2A 4LF9J 1XNQF 2UXDF 1LQ9A 3CO9A 3FBCA 4KY3A 2KJVA 1H2TZ 5THWA 5KFRA 3I0SB 2RDDA 3TUIC 4A4JA 4PG4A 1KTQA 4DPTA 4YP3A 4V19X 2C2EA 2P5VA 3AD8C 4GMKA 1U8WA 3K5OA 4O4GA 1YJNS 3CJTA 2IRYA 2Z0GA 5ETRA 1MSWD 2GVZA 2MMYA 2V2QA 1UEVA 1N33F 1U02A 3PEHA 3TWZA 4BBYA 4RUCA 3A4TA 2NXNA 2ZOFA 3MURP 1U6BA 3MEEB 4LR7A 3EJMA 2IJRA 4ZLNA 3UPFA 2FJWA 1HQUA 1OY6A 1GXTA 3KFWX 5HQ8A 1J5OB 4B3MF 3P6YC 1Q8BA 3VVTA 2MKIA 1IR1A 2BQ3A 2YBVA 5HMYA 4CIOA 2IM0A 2HBRB 4I2PA 3VAJA 2VD3A 2LQBA 3MPYA 1F6TA 3P4UB 2LXFA 2MKCA 2KXNB 3M30A 1TTHB 2EEYA 2GO8A 3D0HE 3MMBA 4O44A 2E44A 5KFCA 3MFHA 3DCAA 4DL5A 2ASJA 4CO4A 3I32A 1T0TV 3KLIA 2HFNA 1BQNB 2NUUG 2Q3PA 3PEJA 4RW9A 4C8NA 3G6YA 1V6HA 4RWWA 3V6DA 2JEIA 4QW9A 2UXCJ 4I6AA 1HBNB 1U1QA 4I6WA 4QZVB 3RRKA 3PCOB 2E7XA 3O44A 4E8UA 4ZVHA 1YWXA 3CEDA 4KSEB 2FJVA 3N5FA 5DG9A 1QVFR 3IC1A 4DMZA 1JJHA 1P1LA 4UOFA 4ECXA 3GFXA 4X62F 3CC2S 2VPWB 1K8AT 2JHEA 4ZVQB 4AFFA 3CVKA 1R0AB 1NJIT 1VQ4S 4CLZA 1FDNA 1SPBP 4CLYA 2C3OA 4NLQA 4R8UB 2MLYA 4DDFA 3AQOA 1YG0A 3ZTPA 1O6XA 3CJRA 1D8ZA 3UDLA 2M88A 2UVWA 4XPCA 3A12A 2YX7A 4IFVB 4YHHF 1S1XB 1M1GA 1XR7A 3H2UB 2HBZB 3AJDA 2DISA 3D3BJ 4ZVPB 4JI7F 2I5JB 1U47A 3OTEA 4YN3B 5IQ6A 2IYGA 2C28A 5L39A 4DXLA 3HSZA 4XTTA 2C2DA 2Q6BA 3TAMB 4CLTA 2EKNA 4OJHA 4ZVGA 5DDQC 4R5PB 1E6YA 3RB4A 3W8PA 3OFHA 1SV5A 1O0PA 2RMLA 4LIWA 3T9ZA 3QAUA 4ILLA 1SIZA 4OL8A 4HI1A 1AW0A 2J7WA 5A76A 1H7XA 1RSCA 1BQMB 3S8SA 1S76D 5IXUA 5GAEI 2GX8A 4DR6J 1RT4A 1CEZA 2R7VA 1YBAA 5HANA 5CABA 4PRFA 2IAJB 2ZFHA 3N79A 1VI7A 4ZLJA 2K2PA 2VC0A 1PC5A 1S12A 3OTCA 4K50A 2RRAA 1CJVB 1WKJA 2YKNB 1RA6A 2VQEF 4N5SA 3TUZC 1VLOA 3AB4B 5D4NA 2J0WA 1NM2A 4DU7A 3TZWA 1HHTP 1CS4A 1WC3A 2OLWA 2YH0A 3N6LA 1S79A 4KYZA 4U95A 5IWAF 1DQAA 5DQHA 3BO2A 4Q2MA 2RILA 4DPWA 1AROP 2B9EA 2PE8A 4B3OB 3BDPA 1VBYA 3QWPA 3FEYB 3IWNC 2JC1A 2YTCA 4LSZB 5KFVA 1XEZA 3ADAC 5KFFA 4IOCQ 1HNXF 3J81Y 1R6YA 3M30B 3E8OA 3PFOA 5KAKA 1I5OB 4TLQA 2HGLA 1RWVB 2CQ2A 3GJRB 2JVRA 5KFTA 3EGVA 4E98A 3V6DB 3UDVA 2DNLA 2EC2A 3D54A 1VBXA 2I1RA 4DPYA 4DSFA 1KR4A 2CPJA 2ZBIA 2CNLB 3KG1A 1UZDA 2FGCA 5AT1B 3KLFA 5KG0A 3HT3A 1IJEB 4EU0A 3KJVA 1S7HA 3VWSA 2MLZA 4K2XA 3EZ5A 4CCHA 1KVKA 2LFVA 3K7RA 2LQ9A 5I3UB 1YI2S 1X5PA 5T41A 4TY9A 3UVJA 1B4SA 3D6HB 3GILA 1Y0HA 1Y3KA 3RU0A 2GIQA 2HLUA 2HBQB 1GMWD 3O2IA 4UT4A 4Q5VA 3OL7A 1U1PA 1HFEL 4DQPA 4IR1A 3OVBA 4OI6A 3R5GA 5KFNA 4LF6F 3MCNA 2B4PA 2FD2A 1T8EA 2FLNA 1R0CB 2HBYB 2U1AA 5B08A 3M6UA 4CYUA 3DI6B 2COLA 3GU0A 3HF5A 3C19A 5L38A 2BMBA 4Y00A 1FRKA 2MKKA 4K4UA 2OEKA 4RW9B 4ED2A 1QJHA 1RT1B 2ACYA 5K9FA 1E6YB 3LWLA 1YIJS 4TY8B 1HBNA 1EETB 1UEUA 1XMQF 3FC9A 2RDIA 5DM6Q 4FNIA 2VJVA 1KVIA 1P6TA 5LXYA 1VQ8S 4F4ZA 5IV4A 3DOMA 3MECA 4FS2A 1TUVA 2HAFA 1FNMA 4IG0B 4ALZA 3T1HJ 4WTOB 2FY1A 1HARA 4QIFA 2A1BA 3KK1A 2FJEB 2HNDA 5F0UA 1N6QB 5HL7Q 3BGOP 2V6AA 2DGOA 2W7OA 2BJEA 4U7CA 4NYPA 1Q5VA 2JFKA 3VVUA 4LF8F 3A13A 3PRVA 2FJDB 1RLCL 2VG7A 3I96A 3R7NB 3KHGA 3CCJS 1N4LA 1HNZJ 4AL5A 4M94A 2ZNYA 2JZ5A 5A8KB 2DH7A 3PXGa 3CMAS 1GX5A 3PV8A 2XEXA 4HTIA 3BH7B 4ZLLA 4Y2KA 3VAFA 5DQIA 4B3RF 3KUGA 3CCTA 5ETTA 3KTQA 1TL5A 4M63A 1RT2B 1YJUA 3OPKA 3UFCX 3BKFA 1WG4A 4IKAA 4EGLA 2NQPA 2Y3YA 3A3PB 2JH3A 4QOTA 1VQ5S 4IQXA 3CD0A 3RRHA 1SJ1A 3C14B 2C42A 3FQKA 1X4FA 3HVWA 4DL7A 3V4IB 1RAFB 4LFAF 3IO1A 2NZCA 3CCZA 3Q22A 2FZCB 3QPIA 1TL4A 1UPMB 2RH3A 2WONB 1YZ7A 2QYCA 4ID5B 1RT6B 1R0BG 4JP8A 5AXKA 3JYTB 4PWDA 2PEBA 1R8AA 3D6MB 3MI7X 1D3WA 2AHOB 1RT3A 2IBOA 1Q16B 4NE9C 5G0RA 3WBZA 2M9KA 2NSCA 2R7QA 4P74A 1CPZA 4Y34A 4OZNA 2D3OR 1QAXA 4JYAF 2ZWOA 3UW1A 1RI7A 1ICEB 4OYWA 2OPPB 2DTJA 4DN9A 2AQ4A 9ATCB 2OSQA 1YJVA
chains in the Genus database with same CATH topology
2BJDA 3D0IE 4KC5A 4USHA 2N7YA 4RBVA 2LU2A 3KG0A 4PR6A 3DGPA 4B17A 2VUGA 3MD1A 1LFWA 3U27A 2YKAA 5CCLA 4C0OC 2HFZA 3H5UA 4OIXA 1HMVA 3OW2R 4ELUA 3Q23A 4J9NA 4QQBA 4DV5F 5BYSA 4AL6A 4WK1A 1KHVA 2WBRA 4QYRA 2W8LA 4FS1A 3GYNA 4WFXA 2BE2B 2DJWA 4NLTA 2DITA 5F8IA 5EDWA 1JJ2R 4KKOB 3RB3A 4I64A 2KZZA 1QUVA 4AXJA 2RIJA 5BYQA 3MUTP 2MJNA 3MM7A 5HP1A 1FDBA 4FBTA 1B0VA 1N0UA 4FF4A 2WCXA 3M8QA 1L3KA 1S72S 1IR0A 3O1LA 4ZPWR 1VC0A 1YJRA 5A0YA 5LMUF 1UW4A 3G9CA 1U7LA 2VG7B 2R4FA 5E41A 3ITHA 1GQEA 1VGYA 3K5PA 4KQZA 2J6UA 5KG1A 3CCQS 2QEXS 3DFEA 3MZIA 4Q0BA 2V4RA 2GA7A 5KFZA 4IG3A 4RUAA 1FE0A 3GWCA 2NXUA 3HHEA 5DJBA 3PVXA 3HO1A 2ZITA 2HS4A 4UUXA 5KFKA 2SXLA 1EETA 3H98A 4U7UK 4J9LA 1QVGR 1D0EA 3V4IA 4DUYF 1B7FA 5ITHA 2GFFA 1Z2LA 3MM8A 3WZ0A 3DRRB 4HT7A 5KG5A 1KQGB 1YRTA 2OTJS 1VIXA 1BD6A 2QSWA 3N9UC 1BGXT 5CD4H 2ZC4A 2AU0A 3CIZA 3M4XA 2VA3A 4LT6A 5LXRA 3EX7B 1IKWB 1NK0A 1JLBA 1H3DA 2P6TA 1RT3B 5E0OA 5JXSA 3FRYA 3DXSX 1P9QC 2CYYA 4C7QA 4WU3A 2XLIA 5C42A 1KOOA 1NO8A 4K59A 2HWTA 3MXHP 3BJYA 1JX4A 4P7TA 2VPYB 5IFMA 1TQLA 4NZ6A 1TL3A 2YNGA 4PKDB 1R7IA 1ZM4A 2RD5C 3IGNA 1I94F 3TAQA 5SZTA 3IAM9 4TQRA 2HNZB 4Q8EA 3NCQA 4ED0A 3AAWB 2F1FA 2LDYA 5KT3A 1JLAA 4WK3A 3P5TL 1U09A 4ERDA 2VH7A 3OLAA 2DPIA 4CO2A 2ILYA 4TQSA 1U1OA 3WC2A 4DSLA 2L9WA 3N6MA 3ONQA 2CPIA 5KT7A 1FNXH 2KT3A 3MD3A 4ECSA 1BC6A 2B7CB 3AA8A 4DQRA 1HWKA 3THPA 2Z2LA 3DOKA 3F56A 4IDKB 2HHHF 2RVJA 2KT2A 1S97A 1QY7A 3G8QA 2HMIB 3PX0A 4HT5A 2I0XA 2FC8A 1M5OC 3DRSB 2KHCA 3S7RA 1FEEA 2YWGA 5AXMA 5LJ3Y 4ZCIA 1IBMF 2B7BB 2FUG9 2FGOA 2P9GA 3I9V9 3TVKA 1KLNA 3PO5A 4BC7A 1OSDA 5AJ3F 2L9DA 2OAUA 1K9MT 2R2SA 3HJFA 2CQDA 1F9FA 1R43A 2LXUA 2YX4A 4DG1A 5HMZA 1X4BA 1SB6A 3M2UA 2VFRA 1BY9A 2UVVA 3VALA 5G4DA 3PW4A 3L95X 5E7OB 2CZ4A 2DR8A 4BWMA 2AGPA 4NCGA 3LP0B 4PXDA 2YNFA 4ZP6A 4J9OA 5E3RA 1FD2A 3MM6B 2IVFB 1SJ3P 3GB0A 1MU2B 4I0WA 4O23A 1ULRA 1T95A 2KN4A 3PHEA 5CZVA 5LSOA 3QMQA 1U24A 3HHDA 4RX6A 4Y2CA 4ZPCA 4BDPA 5CHCB 3BZQA 1UVLA 2D9OA 5EUHA 5L8RC 1QAIA 2UUBF 4A8WA 3BS9A 5F9LA 4B08A 1TVRB 2KFZA 3KLEA 3H2VE 3NAIA 1X5TA 3B78A 2ZZMA 5C5JA 4ED7A 1SUQB 5EN1A 2DGUA 2ZM6F 4QWAA 2JOQA 1Q86T 1HD0A 1WEYA 5KFYA 4CI0B 1W2BR 3U02A 3GFZA 1AFJA 1GXUA 2B56A 4WZQA 4MAKA 1RT1A 1Y7PA 4NCAA 3ZZPA 2AX1A 2JFDA 2PN6A 3PNIA 4TY8A 4ATNA 2QT7A 4LVNP 4Y0FA 2IM1A 3MTKA 2JJ4D 4C0HA 3HXMA 1C4CA 2QFJA 1D9DA 1F5BA 3NGKA 4NLDA 2M4MA 2WBMA 4JV1A 1PC4A 3KK1B 1VRUA 1N6QA 2HMIA 4J37A 2OFHX 2CJQA 1JLCB 4B9TA 1IM4A 2X3GA 4RW6A 2B9XA 4TKTA 3U7JA 2RKIA 4A46A 3KK2A 4ZCKA 4JI8F 2OPQA 3CF5Q 4B9NA 1FE4A 1PILA 1UWBB 4NL5A 2VZ9A 4JI3F 2ZH8A 4X4UA 4Y65A 2CPXA 2DVIA 1FKOB 2R7OA 1ZZFA 2J9CA 4NCGB 2CPYA 3HLUA 4K0KF 4ECZA 2D9PA 5HROA 1R8PA 1SH0A 2DHGA 2O3DA 3MM6A 4RBTA 2EFQA 3AA9A 1TV6B 3CJKA 4YB5A 1JKHB 1S6QA 2J8AA 2MGZA 1HQEB 4RZRA 4ELTA 3KG4A 3KLVA 4GKKF 4WXWA 1AXQA 4C8OA 2W25A 4X4PA 1M90T 4FF3A 4AXIA 1QSSA 3V4MA 4JV2A 3G4SS 5BR8F 2OMOA 2E1RA 1SUQA 5HMXA 1RTHA 2MQQA 5K8PA 1HNVB 3BR8A 2ZDPA 1RQ0A 1WACA 2Y0SD 3D1HA 4C3KA 3T5JA 5J2NA 1S6OA 2YKPA 4IUFA 3TANA 1N5SA 4WCEQ 3DRYA 2IM2A 4DBQA 1IN0A 2DR5A 5KFQA 2I2YA 3C3LA 1FKPB 1VOMA 2LQJA 2VA2A 1JLGB 2YKMA 4Y3CA 4WKRA 2AJQA 2ZC3A 1DQ9A 1FXDA 2QLXA 2VFTA 3H59A 3IA0A 4XAKA 4OX9F 1NJYA 2OPSA 3KLGB 1PO6A 4DHVA 2ZUGA 2BZ2A 3I6PA 2RB7A 2DR7A 4JUZA 1JLQA 4OLOA 1HBUB 1TVRA 5FIIA 5DDRC 3OR1B 1KHWA 4RW6B 2XY7A 3SI8A 1PSDA 2F3JA 3I0RB 4K5SA 4OLPA 4Y28C 5L1KA 3ITHB 5D78A 4R0EA 2ASDA 3HHNB 1L3SA 3JAMY 3UI3A 2PGCA 4IFYA 2ASLA 2F8HA 3Q24A 5AXLA 1N54B 5B0DA 1QSLA 1VQ9S 2KI2A 5M2UA 2BACA 2ZJPQ 4N76A 1CSJA 2R8GA 3MM8B 3I5CA 2ZJQQ 4OX8A 3NGDA 3RTVA 5B0AA 1M5PC 4A8XA 2GMHA 1RT5A 3BGRB 1SIWB 5DRKA 3CJ3A 2V4JB 3OHAA 4CH0S 4ZVEA 1FD8A 4IR9A 3LP1A 4HDGA 4YR0A 5DG7A 2ADCA 2XMJA 3J7YU 1N5QA 2NPIA 2PC6A 3D28A 2RKIB 2OH2A 1FJGF 1H2UX 2E29A 5KT2A 5L1JA 2FC9A 3Q8PB 1TL3B 1Q53A 3TNVA 4R0JA 1XBWA 1FESA 3SSRA 1OS5A 2B51A 2EFNA 1APSA 2HLTA 3JSYA 3EZUA 5BYRA 1ZM3A 5BJRA 2Q6CA 3FSXA 3ZZZA 2C2RA 2ZDOA 1REVB 2I38A 5B0FA 3FZ2A 2L08A 3OL8A 3OHBA 4W90B 3OUYA 4KE5A 3KJVB 1ZTWA 3MEDB 2A10A 1JKHA 3LF0A 4Q43A 5CYQB 5GADI 3TQ1A 1FNOA 2R7SA 3SZ2A 5A8RB 2XGPA 4OI3A 1HWIA 1HA1A 3CSKA 1S0OA 4DSJA 1TL1A 2G4BA 1G1XA 5DLGA 1CQMA 2A2DA 1U2RA 2IA0A 5DO2A 3V2UC 3PIOQ 3BF4A 4N77A 4I69A 1NRKA 3CDAA 3DRSA 1TFYA 3UQSA 3KNGA 2RE1A 2NSBA 1GXLA 5AXNA 3MR6A 3DHWC 2HW3A 2BANB 5KG6A 2HNYB 2DNPA 1U49A 3N0VA 5FLXY 2E9ZA 3CCWA 3QIPB 1T05B 2UZAA 3AH6A 4KTQA 1P27B 2OPRA 1UJ4A 3FEZA 2DNNA 4I56A 1JLGA 2YKMB 1YJ9S 4C8KA 2HWHA 5J1EB 2IC3A 2FVRA 2KTQA 1NK6A 1FTCA 1LW0A 4IRCA 4N41A 1RT5B 3BGRA 2AJ1A 1MU2A 4DFPA 3QO9A 5EWGA 3OJSA 1QUPA 2JEGA 1NNDA 3OVAA 2XHWA 3R3TA 2IRXA 2OMLA 5KFJA 2EKYA 1TZ0A 2HQIA 5EX3A 3FMBA 2DRAA 1LOUA 1CC7A 2WSFC 1HNIB 1NB7A 3SCKE 1KD1T 2M0GB 2AV5A 2YNHA 1G6BA 3POTA 3PX4A 2KFYA 4KO0B 2ZD1B 4WE1A 3K5MA 1ZAWA 4RKUC 2E66A 2VBZA 1Q8IA 1YJWS 1VQLS 3KHHA 3ZC4A 1WEXA 4DL6A 4IO9Q 2MYFA 4I7FA 2XGQA 4DQQA 1HWJA 1OWXA 2W24A 3O3LA 3MM9A 3MR2A 5AE1A 2VOOA 2CKWA 4FZVA 2KB2A 4XPEA 1ZH5A 2QE5A 2RJZA 2UVUA 4KV8B 3NP5A 2WW8A 2YWHA 3MDFA 1R8HA 2FVCA 3MEDA 4ZP9A 4C9DA 4AE5A 2CZVC 2GC8A 3JSRA 2CPHA 3C46A 3K8VA 2QA4G 2PA8D 3DLEA 3OVSA 3LH2S 3QIDA 4GC6A 1OPIA 4C8ZA 1MNEA 3FQLA 4MJKA 3H20A 4A8KA 2ALZA 3CGIA 3NLCA 2KT5A 2OPPA 1UP1A 1RTIB 3EGWB 3EPGA 4URQU 1FO1A 2C3MA 3ZZRA 2W9CA 1S1UA 3T9NA 1CVJA 5HLFB 3T5KA 3K2YA 1LW2B 1H0HB 2M52A 1T05A 2PT0A 1HW8A 4ILRA 2OPRB 4XK8C 1UETA 2GW8A 3TYTA 2BW2A 2WOMA 5J1EA 5HROB 2KRRA 4PQUA 3UWTA 1A6LA 4RW8B 1OQ6A 1S6UA 3CE8A 1YSJA 4ZK7M 1HBMA 4ES2A 1X5SA 2K1RA 5F8LA 3KLHB 2KU7A 2MZTA 4RBUA 2KJWA 4DV4F 5F8HA 4LSNB 5A0YB 2E7WA 2FLLA 5KFAA 1HNIA 2UUTA 3M2RA 2DNKA 4C0BA 3MAQA 2B4OA 4RNMA 4DR7F 4IYQA 4QWDA 3DYAA 1UMJA 3V81B 2E5GA 3GYXB 4XDDA 2VQFF 2MZRA 4Q0BB 3K58A 2B6AB 5T7LA 4WYWA 5F8JA 1RTJB 4QYZJ 3QWUA 3GZ7A 3CCUS 5F9NA 1FRJA 1WELA 5IM0A 2W7PA 4FBUA 2EI5A 3HM9A 4ETZA 1VQKS 4RNOA 1FT8A 1JB0C 4YDXA 1LW0B 2JLFA 2JLGA 4F2RA 2DGQA 2ZH2A 3UCUP 3OV7A 1HQUB 4X4SA 3E01A 3VAIA 1U8SA 2CQ1A 3H4BA 3JSBA 2A3JA 1RTDB 2AYEA 4O3OA 2KXHA 4NX9A 4OZ5A 4DFKA 3FFIB 1TP7A 3QLHA 2V8GA 5I42B 3OL6A 1IUJA 2HHXA 1KN6A 3OR1A 2GV1A 2J0QD 3I0RA 2BYCA 3HP6A 3VR1A 2CPFA 4WXOA 1NKCA 1S9GA 3C6TB 1KFDA 4F2SA 3I5BA 3OLBA 1QE1A 4KAIA 2ZH6A 3NMAA 2LXIA 2FHMA 4TYBA 3CMES 4KIAA 3CUNA 4KV8A 3MHYA 4JV5F 5J2MB 2C22A 3PX6A 2DD8S 3NS6A 3EGNA 4PQAA 4QWEA 4C8YA 2DGVA 1TK5A 5GAEU 4NYZA 4BHQA 2E1CA 1MROA 2N82B 5KG2A 2WK4A 3QJJA 1RA7A 3HX9A 5LL6d 4EO8A 3MEGA 2K3KA 2OSRA 2XBPA 4KPYA 2KG0A 3TAMA 3M32B 2GMLA 2AP6A 3IWLA 5AE3A 3PR4A 2BRLA 2E5LF 5CXTA 2UXBF 2RSQA 3ICLA 2MHNA 2DGSA 4OMFG 4JI2F 1QSYA 2LEBA 3HVTB 1F5AA 1QTMA 2IAJA 4DEZA 3NRBA 1LWFB 1R8CA 2N3OA 1ZZNA 1JMTA 1REVA 4FYDA 5GAGI 4PQUB 4IOBA 4RW8A 4DR3F 4K4ZA 1VC5A 4C11B 3CCVS 3OUYB 2K1RB 4RNNA 1QM9A 4DSKA 4WIIA 3OR2B 4LJMA 2PI5A 4OHZA 1JXEA 2R8HA 1UVNA 1QAJA 1SJ4P 1WHWA 3BB5A 1IBLF 3U1LA 4YB6A 3K5LA 3M2RB 1XMBA 5I42A 4NLWA 3TX8A 4KHPF 2O66A 4QU7A 4LSLB 3JSMA 3FNNA 4URGA 2EVZA 2CQHA 3HZEA 4CO5A 3B4MA 2RT3A 1WHYA 1X4EA 4ZPDA 2DH8A 2N4CA 3KLFB 2FVSA 2B9YA 4OX6A 3DRPB 1VS3A 2B5JB 5A6WA 2PMHA 2XO7A 1XERA 1B64A 1Q78A 2B43A 2DPJA 2G13A 2C3YA 3TI0A 4TLRA 3TRGA 4FVCA 2ZE2B 3TR5A 4B9LA 4O3NA 4K5RA 1Q81T 5A8WA 5KFBA 5DDOC 4DR5F 5D8HB 1Q7YT 5L1IA 3VAGA 3I87A 4EZ6A 4Y6IA 5SUHA 1HW9A 2BOPA 2BDPA 2F7VA 3L7PA 2DO4A 1X4AA 4F67A 1DQ8A 2AGQA 1FERA 3JTNA 3J7A1 1N52B 1FKAF 2YNHB 3UR3C 1WF1A 3POTB 4H4KC 1VQ7S 2E9RX 3BN7A 3SMZA 3DNCA 5T14A 1FRLA 2PI4A 1LWEA 1C0TA 1XNRF 5IT9Y 4YR2A 1N0VC 1Q79A 3RAMA 1U6FA 3K5NA 5F8GA 1TKXA 3I5AA 2ZHOA 1ZYQA 2DO0A 3IR5B 1TV6A 2BM0A 1VRTA 3FSYA 3CJKB 3ZZOA 1NK7A 4W92B 5KFWA 3BGFA 5EGYA 4DLGA 1J5OA 3UE2A 1RAJA 1X9MA 3QGPA 3FVYA 4RU2A 1EP4A 4LF4F 1JJ4A 4LSLA 3JSMB 4Q45A 3GFYA 5K14A 4DV0F 3NNCA 4DSEA 4TU9A 2NREA 2ZVSA 4LF7F 5F3TA 3SXLA 2EPIA 2W9CB 3H8YA 4KHRA 4USJC 1TFWA 4OI4A 3THVA 2YWKA 4K4VA 1F60B 4O4GB 3CDEA 5FDLA 4DL4A 2WONA 4ELVA 3GV5B 4ID5A 2EC0A 1AFIA 1LWFA 2XMTA 2CQ4A 3GR0A 2HHUA 4Y2MA