4CO2A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
total genus 21
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co2A00
3NCPA 2J9DA 5L9NA 4RWXA 1Q1KA 3M05A 2EG1A 4CO2A 4RLEA 3X3UA 2ZOMA 3BZQA 2GNKA 1O51A 3NCQA 2JJ4D 4YB7A 2GX8A 1GNKA 2DCLA 2XG8A 2O67A 3O5TB 4ZK7M 2XULA 1HWUA 2NS1B 4CO4A 4IYQA 5DS7A 4WK1A 3NCRA 3LF0A 1H3DA 1V9OA 1UFLA 1V3SA 1KR4A 3HLUA 1PILA 4USJC 5D4PA 5D4NA 3N5BA 1P1LA 4NYOA 4C3KA 2Z0GA 4C3LA 1VHFA 4NYPA 4USIA 2O66A 4CO3A 2VD3A 3MHYA 4OZNA 4CNYA 2GW8A 2EG2A 3DFEA 3O8WA 2RD5C 4CNZA 4AFFA 4CO5A 3L7PA 2XZWA 3AA9A 1XK8A 2E66A 3AHPA 1NAQA 2ZFHA 4Y65A 2J9DE 3TA0A 2NUUG 1UL3A 3TA1A 4C3MA 1VFJA 1QY7A 2V5HG 2XBPA 3TA2A 4R25A 1NH7A 4WK3A 5DRKA 4USHA 1UKUA 2J9CA 4CO1A 2CZ4A 3AH6A 1V3RA 1NH8A 2PIIA 1J2VA 3T9ZA 4YB6A 3OPKA 1O5JA 3AA8A 4RX6A 3CE8A 1UMJA 2J9EA 3GSDA 4E98A 4OZLA 5D4LA 4CO0A 4YB5A 4OZJA 1V6HA 4Y6IA 1NZAA 4D3GA 5D4OA 1OSCA 4RWWA 4D3HA 2NUHA
chains in the Genus database with same CATH superfamily
2IFXA 3R5CA 1ZM2A 2XQCA 3ZTOA 3UD3P 2FHKA 4ZP8A 3CDUA 1DTTA 3FQKA 3SFUA 2GGPA 5C25A 1XMOF 4DSKA 2YQ3A 3D28A 2HVHA 5IXUA 4N7TA 1UJ5A 5K8PA 1NK5A 3LAMA 4J9LA 2VBZA 3VVUA 3KNGA 3DDNA 5A0YA 2L41A 1H3DA 3BGOP 5F8NA 5DETA 2X1AA 1HW9A 4DR7J 5ETMA 3T1YJ 1FE0A 4J37A 3BO2A 4DV7J 4RW6B 2OO4A 1LWCA 1KQGB 1QLNA 1UJ4A 4F7VA 4I67A 5GMEA 4QWAA 3QWUA 3CEDA 1XQIA 3ISND 1S9FA 2HQDA 1UPMB 3KXDA 1PJ5A 2CVEA 1C4AA 4PXCA 1CC7A 1HBOB 2BZ2A 2DXEA 4M5KA 3FUYA 4NL5A 5AE1A 1SQGA 3TQEA 2RRBA 2IM0A 2AZ1A 4E2FB 2DKOB 1G7CB 4DR4J 1X4DA 3RB0A 4RWWA 5IWAJ 2E1CA 2B8QA 2WVDA 1R8BA 3QATA 1RYRA 2E29A 3KLFA 4HACA 1FDNA 3OVBA 1BQNA 2W4DA 4H54A 1FEHA 5IM0B 5E3PA 2E5HA 2W2MP 3FKBA 1VRTA 4V19X 4IRDA 2DBBA 2VHGA 2JFDA 3G6ES 1JJHA 4KPCA 2MZ1A 1C0UA 2HVIA 4C3KA 3NMRA 2RS8A 2LYVA 2OFHX 3C14A 3R7SB 4CP5A 2HHVA 1HNWF 3FCWA 2DIVA 2LQ8A 2M5YA 2FTRA 3D67A 3AOCA 3AHPA 4QJVA 4PYAA 3VQSA 2M8DB 1O6XA 1N88A 4WYLA 3DI6A 2FHJA 4LRFA 2CPIA 5KG3A 2BJ9A 1CC8A 1N0VC 4HDGA 2I5JA 3MEEA 2EBGA 4CLUA 2B9EA 4GC6A 1RWKB 3JQJA 2LDIA 5A8RA 1X60A 4OX8A 5ETRA 3H40A 2FC9A 3EXYA 2QC3A 1UWAA 1F5CA 1P9YA 4OYWA 2M52A 5AJ3J 2VPWB 4V19J 5ADZA 3M2RB 1WHVA 4XTTA 1C1CB 2BYCA 4DSFA 1O8BA 3A3OB 4LT6A 4WXOA 2R4FA 1JLAA 4CO4A 1H2VZ 5H9FJ 3LP2B 2UUCF 2B4UA 2O3DA 4U7CA 2IJFA 5CH7B 4BC9A 4DR1F 3VV2B 2HHSA 1N4LA 4KQZA 2FJXA 3OT9A 2WVFA 3QBCA 3UN5A 3GTYX 2V94A 4ZPTR 1GTHA 2DY1A 1IBKF 4MKVA 3ZZZA 4F0MA 2PC6A 3CNQP 4MFBA 3O44A 5B7WA 4K4YA 2FVQA 1OYDA 4LUBA 4L3KA 1X5OA 3M6UA 2NSCA 4FP9A 1FESA 3FZ2A 1RAOA 4JV5J 1N33F 3GV7B 2VQEF 4NI2A 1U0SA 1WACA 3M8PA 1XC9A 4ERDA 3V4IA 4FDFA 1AZSB 1QVFR 2ZOMA 4NZ6A 3VHQA 1FKPB 1F5BA 3ZZTA 4W4MA 3BPDA 2L48A 5BJRA 2W2PP 4LJMA 3EE3A 2OIHA 4ZLNA 1C1BB 5H9EK 1J5EJ 1Y5NB 2VBYA 3DFEA 2YH1A 3O8WA 5JVGQ 4Y2IA 4USUA 4ZVTB 1S6QA 4OMFG 5KFDA 5CQGA 3T1AA 1M90T 1M1GA 1F6TA 3KLEA 3PO5A 4ZP9A 1IBKJ 3M6XA 3DLKB 4LFBJ 5H1SV 4TQSA 3HHLD 4TVAB 2WAQD 1VBZA 3PX4A 2I9SA 2SXLA 3SQGB 4GVBA 2P9EA 4LFCJ 3IGNA 1FJGJ 4P2MA 2QIFA 2CNKB 2C3YA 3FK4A 3CDAA 5SUHA 4OX7A 2XYHB 1VBYA 3CMQA 4WFXA 1JK9B 3HCXA 1CJTB 4DV6F 3M9OB 1H74A 3HT0A 3O5TB 5E3CA 3GYGA 2QLWA 3HVRA 2J76E 2UUAF 1F2GA 2W9BA 3RYLA 4NXNF 3HLUA 1TVRB 3RRKA 4DL7A 1NJZA 2RQ4A 4HHUA 2V69A 2YX4A 5ETOA 4JYAF 1Q5VA 3H4DA 2D9OA 1XNRJ 2NLWA 2ZH9A 3W66A 2LEAA 5KFTA 3V81B 4WXWA 5L1IA 3T9NA 3QJJA 4WZMA 2EFVA 1MLAA 2J9CA 4I4BA 3UN2A 3CULA 1PG5B 1SPBP 2OD4A 4M5DA 3AA8A 2OJ3A 2FYXA 4OL8A 1ZYQA 2YNFA 4OQJA 2ZZMA 5A8WB 3CCMS 3QPIA 4NLSA 2C2DA 3NCPA 4ES3A 1Y10A 3VCDA 1FHTA 2ZJQQ 3NWRA 4K8RA 2HGLA 2DR8A 2UP1A 3RB6A 4URQU 1YJNS 1K9MT 2EKYA 2PMWA 3H5SA 1O51A 2OTJS 2R7XA 3AODA 5KG7A 3HDSA 4B3RF 2E1AA 1IQZA 4LSNA 2AW0A 1UVJA 1SCJB 3CC4S 3TUZC 3OVAA 1RBLA 1RU2A 3VGVA 1TFWA 1VHFA 1EARA 3AD7C 3ZZPA 4CQ1A 3FCVA 3ET6B 2VD3A 3I4PA 2PO4A 3HFKA 3T6BA 2MLZA 4HYKA 4RUCA 2Z2LA 4C7QA 1VYAA 1U2RA 3SCLE 3PRDA 3N4WA 4TLRA 3R1LA 4K0KJ 4NXMF 2G0JA 1WHYA 2RHQB 2LQ9A 3HHEA 4HT7A 5KT6A 4WKRA 4NEYA 1VK8A 1S1UB 4FYXB 3HSGA 2B4VA 1M5SA 3BKUA 4UQGA 3T5JA 2VA2A 5HJXA 2MB0B 5HMYA 2IVFB 1YJUA 4C11A 2XGPA 4P2XA 1ZPWX 5BYQA 2QZ8A 2J0QD 2DR6A 2MZRA 3KG4A 5A8KA 4HI2A 4OFZA 1TKTA 5DM6Q 3W5ZA 4OHZA 4DCPB 4FBTA 2XS2A 2RT3A 2O67A 1K44A 3TZWA 1LXNA 3MMBB 3DRXA 2AJQA 2VONA 2ABYA 1RI7A 2NXEA 3FCHA 1CBKA 4I2PA 4DDFA 2WVBA 4NA1A 1NRKA 2RKIB 2XSJA 3OFGA 1YRUA 2B0GA 4J9PA 4DQQA 3MEDB 5CCLA 3DYAA 2V9WA 3PEHA 4B9TA 1IKVB 3QJLA 1NSKL 2MGZB 2QRRA 3DRSB 2K8GA 1ZM4A 4ZJLA 3W2WB 1U6FA 2DITA 2UXCF 1NZAA 4DPUA 1RAAB 1FVQA 1MMLA 3K17A 4I6AA 2DNOA 2EPIA 3IG1A 3D6TB 3IRWP 3S6EA 2Z56B 3IBCB 1M5OC 4DUZF 3GILA 3H8YA 2NCKL 1S0OA 2YKAA 2R7SA 4RW4A 3N5BA 4TU7A 3GR0A 5EN1A 1P1LA 2MHEA 2B9YA 3MR7A 4CO3A 2BE2A 1R31A 4NLWA 3TX8A 4LF9J 1U7LA 4RJVA 5G0RB 5KFIA 3M8ZA 3H2VE 4C2MA 4Q43A 2FLNA 2B9XA 2MXYA 1UWBB 4OLOA 3KHHA 3TZYA 4LRDA 1NKBA 2MQMA 4QPTA 2FVCA 2IJNA 1NBEB 2YWGA 4HTJA 1KFSA 1DTQA 1WOSA 2WCXA 4NMLA 1GTEA 3IP0A 4DSIA 3NNCA 1RCXB 3H90A 4EZ9A 1U25A 1KQSR 2POKA 4ZVFA 1SKWA 3ZNUA 2F65A 3KDNA 1EAYC 2B7BB 3IAM9 1RYSA 5HL7Q 1SC6A 4RWXA 1JNZB 5AE2A 1YITS 3PYEA 2YXLA 4B17A 4DV5F 2FLPA 4DV4J 2KZMA 1H98A 2RAQA 4LF4F 4YP3A 2HHUA 3I6PA 5T7LB 4TY9A 3UVJA 3RUBL 3G4SS 2JVRA 2COLA 3RRHA 3JYTA 2KU7A 4CCHA 3J7AN 4ZVRB 2M0GB 4IH5A 3OFFA 1FX2A 1RP5A 5D15A 2R7OA 8ATCB 2LECA 1OQ6A 3M1VB 5FIIA 2OPSB 1Q4RA 1Q8KA 4X66J 5E3QA 3EICA 2GAGC 4I7FA 4ZPVR 4JI4F 4QWCA 3SZ2A 4DF8A 4MT1A 2ZH5A 3CSKA 2FZKB 3UN3A 1YJRA 2DH9A 4DZ6A 2B6AB 4O0IA 3U02A 4PKDB 3LANA 3BQ2A 1RA7A 1NB2A 1FXLA 3B4MA 1IBMF 1TV6B 1S1TA 3NRBA 2NQPA 4H4KC 8AT1B 2VUGA 3W9HA 3KKFA 4DQRA 2OELA 1Q86T 2XMTA 2RRAA 2GMHA 1U6BA 4GKJJ 1HR0F 2QO3A 2KDOA 1J5OB 1KQFB 3TZXA 1HQUA 2X51A 3A13A 3BR9A 1FRJA 2NUUG 1F9FA 1HNIA 3CCWA 3EGZA 2BBEA 5C2CA 5CABA 2R8HA 5D3GA 4QIGA 4X4UA 2ZWPA 1UPPA 4LR8A 2YQ0A 1S48A 4NE9C 3MD1A 4XDCA 4UY85 4DQSA 4C4WA 4C0OC 1WF2A 3QT6A 1FRKA 4RPFA 1SKUB 2HHWA 4KHMA 4O4RA 2AX1A 3T5HA 3CIZA 2GVZA 1RAFB 2DT9A 3OL6A 3JSMA 4F2RA 1D0EA 4QWEA 1IR0A 1FNMA 2CVIA 3ZO7A 3AQOA 3OVSA 2DEJA 1EP4A 2HPUA 2HEKA 1R27B 2WHOA 2YNHB 5KFAA 2H5EA 5A76A 1KNZA 3D9BA 1BQMA 1DURA 3PFEA 3K5NA 2HBZB 4OHXA 5KFMA 4ECVA 3H20A 1UVMA 4K7QA 1SB6A 1B7YB 2A2CA 4OI2A 2KB2A 2HVDA 2CJYB 4PABA 2AKWB 2L08A 1DLOA 4WK3A 4K4UA 3KHLA 2HNDA 2XCPA 3SCIE 4G3IA 1W2IA 3FSYA 5E3AA 3S7RA 5H9FK 4Y28C 3R5AA 1TL1B 1RT7B 4CH1A 4P2SA 2J9DA 3MMCA 2DNYA 3NAIA 2X1BA 5BR8J 1RWWB 4K4XA 1U47A 2OTLS 5DO2A 3NWGA 4KGZB 1HIYA 5KFJA 2OEKA 1EZZB 3DLJA 3M32B 1I6JA 3R7NB 3FSIA 3T1HJ 2OHDA 2H4WB 3F73A 4DN0A 5E33A 4DL4A 4OZNA 2JLGA 2FIUA 1HWLA 3CJ0A 2HZCA 2C28A 1LWEA 2CADA 2B4OA 4O44A 5MLCV 3LGHA 3JSBA 1SC1B 3A3NB 4JI6J 1NK6A 1Q79A 4LVOP 5HROA 4EMDA 3BGRA 3AB4B 2CQ4A 2RHSB 3S1TA 5CD4A 2J9EA 2VJVA 4LF7F 4UOCA 2YWFA 3IWLA 3C66A 3R2DJ 1Q95G 4O3SA 4WKYA 1RT6A 1SUQB 3A1YG 4ZIWA 3OFEA 1HNXF 1AFIA 2QLJB 1HQEA 3AB2B 4W90B 4NRTA 3HHLC 4U7UK 4ES1A 2KL8A 2HWHA 4B9LA 1U02A 4J9VA 5JVHQ 3UFCX 2CQPA 3NCRA 3I82A 5L9XA 1JJ2R 5F8JA 2IDEA 4AXIA 3IS9B 1F3VA 3MOZA 4H4KA 4TKTA 4UOFA 2JLEA 3U27A 2A10A 4C8ZA 3DOMB 3CJ4A 1H72C 4BDPA 4JP8A 2AEMA 1HI1A 4K4TA 1YI2S 1KHWA 4RBUA 1CJUA 2AMCB 2ZJRQ 1J2VA 1TELA 1OY9A 1TUVA 4DFJA 2JEJA 2OGUA 4HT5A 5DDQC 1N5YA 4PG5A 1LW0A 2RQMA 4ID8A 1IXKA 1FVSA 2KRBA 4AUKA 3VQTA 1U09A 1HHQA 4YN3B 4RO0A 1HBMB 1SC3B 2HQ3A 4LREA 3A8JA 2F7VA 2IYIA 2HLTA 3R27A 1UFLA 5D4PA 2JEIA 4BBYA 4YMEA 3TO8A 1NM2A 3H5YA 3OR2B 4UT4A 1I3OB 2XWYA 3CJ2A 1S76D 1VISA 3HZGA 2I8EA 3M8RA 2C2MB 2KJVA 1L3KA 2E66A 1NAQA 2I2YA 2P8IA 3BQ0A 1P27B 1HQ2A 1CG2A 2EW9A 3QFWA 2FPHX 4KKOA 3CDEA 4MK9A 4A8OA 1X31C 5ETSA 3QZ7A 2K1RA 2YPYA 3F44A 1S6PB 2I38A 2K3IA 2G13A 2XYGB 2ZH6A 3TARA 2FC8A 1XTZA 1FT8A 2DTJA 2FHMA 3SSQA 4X4SA 3DLEB 3M2UB 2QYCA 1KBRA 4OYOA 4LR9A 1TQLA 3KOAA 1QUVA 1CS4B 1S59A 4H4OB 4O23A 4DV3J 2B5JA 2UXDF 2CXEA 2UUWA 4KO0B 3LUYA 1JX4A 3GWCA 2WONA 4YUDA 2M7SA 2BKPA 4XPEA 2DEIA 4PZVA 2FGCA 4O3QA 3TVZA 3PIOQ 1QJHA 1WKJA 2HK2A 4P10A 1RZMA 3HVTA 2EG2A 3R6LB 2UUTA 4LR7A 3W9IA 4M5IA 1Q5YA 4PCQA 5F3TA 2OFGX 3KK2A 4F4KA 4R8UB 4ED3A 1L3SA 2V5HG 2FD2A 4NLGA 4U67Q 4OZ0A 4B9VA 5IT9U 1TMJA 2W8LA 4DV0J 4EBDA 5IT4A 1VQ5S 5L1LA 1R8AA 3QNWB 2V4JA 5KT4A 2LLZA 1GMUA 1MROB 1IBLF 2CQ1A 4MJKA 3VAJA 1NJXA 1N32F 4KHPJ 4YHHF 3CCRS 3TAQA 3GPAA 2R8KA 4K2XA 3VAHA 1Q78A 3C6UB 2EFNA 4URSA 2AGPA 2DXDA 3M9NB 3X1LB 4ID5A 1WKLA 1WHXA 5KFLA 2H1YA 1KOOA 2YWEA 3GMGA 5C24B 1X4HA 5HBMA 1AA1B 1BHNA 4NOHA 2AD9A 1KOHA 2DNPA 1SL2A 3HHLA 2R7QA 1OYEA 5D0HA 2FUG9 1HYSA 3UR0A 3U1MA 2R8JA 4ANEA 2ZM6F 3FJ2A 3MAQA 4KE5A 2IC3B 3SFGA 2X7IA 1UEUA 4DR2F 1RT1B 3HP6A 4WFZA 1XIQA 1HBUA 4DR6F 4MAKA 1U4BA 3MI7X 3S8SA 3K5PA 2O5DA 2A18A 2ZNYA 2V68A 1RT3B 1S6UA 4KAIA 4FVCA 3I0RA 3MWBA 2DR9A 3MAHA 4DUYF 4M5NA 3CDBA 1Y5LB 4IKAA 4MKBA 3I0SA 3R5GA 2Y1RI 2QX0A 3VGUA 2K2PA 3OFHA 5C42A 1XJWB 3RBXA 2CPJA 2H65B 4ZITA 2CFXA 4XIUA 3QFHA 3N01A 2VKRA 2JJ4D 4I6YA 4ZP7A 2OSRA 3DHXA 1DBDA 2J6SA 4Q7AA 4ZPCA 5KFPA 3V6DA 1RTJA 1RHJB 4F0KA 4EUVA 4ALZA 2ZH8A 4DS5A 2GJ2A 3BH7B 5KOWA 2HZAA 1BY9A 2MSSA 4USWA 4ETXA 2AGOA 1P9QC 2BW7A 1FTRA 2DR7A 2QLFB 1KN6A 4E8UA 4QOTA 1RAIB 1TU0B 2HNYB 5MAOA 1ZM3A 4C8NA 3RAQA 2KTQA 5K8NA 4QWDA 2ZJPQ 2MLYA 2GO8A 2NREA 3CWJA 3DMJA 4ENOA 3Q8QB 3A8IA 4CTAB 1DY3A 3C2PA 1VC5A 1B4SA 3DGVA 2XY5A 1DAXA 2GQCA 3Q24A 3DU5A 3D4JA 3SSRA 3IXQA 1T02A 2J8AA 3WQPA 1FWPA 4CT8A 1FA0A 1FK9A 1ZS6A 4X4PA 5F3ZA 3W9JA 4OX9F 4JI0F 5HVGA 1WG4A 1SQFA 2ZDOA 1JWWA 4FS1A 3P8BB 1D9FA 3M8SA 2JC1A 4DG1B 3MM9A 4FF1A 3MXHP 2GA7A 3PJXA 3BZQA 4PYDA 2CYYA 2P6SA 5C5JA 2DCLA 2N3LA 2IMOA 1YVFA 2XULA 2GCFA 1FKOB 4M5JA 3CGIA 1SC4B 2RIJA 1UTAA 4YR3A 1M1HA 5EWGA 1EKSA 5ETKA 2N4DA 4FF2A 4HHJA 1HFEL 3AOAA 4RU9A 2Z2MA 2XMJA 2KHCA 2RF2A 2PE8A 3TX0A 2C2NA 3MUTP 1KTVA 1YSJA 2YWHA 2HZVA 3M30A 2R42A 5DDRC 2IAJB 5KG5A 2DRDA 5HP1B 3MM7A 4LF8F 1T3NA 3A12A 1IKXA 1RK8A 1NZ8A 4RW8A 3ZTSA 4I69A 2H48B 4K4SA 5L8RC 2WOMB 3T19A 1WC6A 2DXFA 2LXFA 3MPWA 3P45B 4QYZJ 5T14A 4JI3J 5CYMB 1G2EA 3D6FB 2V67A 2ZBPA 2GVDB 5IV3A 1RSCA 1SJ4P 1X4BA 4WPAA 3NGSA 2KN4A 4ED2A 1UFKA 2NSBA 5THWA 3DM2A 1RBOB 5EUHA 1EETA 4CI0B 3OTEA 5LSRA 2Z0GA 5E5NA 4RW6A 1LFPA 1LK5A 3KK1A 1N36J 2AJ0A 1A6LA 1OJ4A 3OSNA 3U1NA 3HSDA 1O0PA 1CQMA 2BV3A 4ED1A 3DKDA 2BQ3A 2HWIA 2W2QP 2HQIA 3VVTA 4Q44A 5ETNA 5LM7E 3H25A 5JMNA 3AH6A 1HBOA 4PR6A 3GJQB 2BQUA 4ZJOA 2MZJA 4LSLB 1T03A 2Z30B 3O1LA 2VC0A 3DGPA 4ZJQA 3J7YU 2X1GA 3DRPA 3C15B 4KHRA 3PZPA 3PJ9A 2DO0A 1LW2A 4KGVB 7FD1A 5CZVA 4HI1A 1U2FA 4MIAA 4URGA 3RRGA 2W2OP 3CT9A 2C3MA 4B3SF 4XPCA 2W9CB 5EDWA 2YKNA 1IBCB 4Z37A 1U1KA 2GGPB 4A47A 3GR1A 2YKMA 3QT8A 2DNKA 3L7PA 1UJ6A 3DOKB 3TA0A 2J0XA 4QYRA 1KEKA 5J2PA 4X4OA 3HHNB 3UDCA 1HA1A 2YKQA 4NASA 3MMAB 3HK2A 1Q8BA 2JLFA 2C2ZB 3BGFA 3QAUA 3H59A 1NLKL 1LWCB 1FKAF 2ASYA 4IG0B 1RE1B 3EGWB 2GHVC 2X3GA 3FBEA 3HJFA 4CRJA 3M2RA 1FI4A 3L4BC 3BGUA 1UFWA 3FGVA 3NEKA 2BRKA 2KFZA 3W3SA 3TNVA 1X4GA 4M63A 4JI2J 2DISA 4OLPA 2WRMA 4WIIA 2XMVA 2UVVA 2UXBJ 4I1TA 4IDKA 3AY0A 5K5MA 1PJ6A 1RWMB 1NPPA 4OHWA 4HACB 3G71S 4AL7A 1M5HA 1BQNB 2HGMA 4DX6A 2PI4A 3HT3A 3SV4A 3GV5B 4H4MB 3G82A 1VRTB 4A8MP 4HH0A 1FRXA 1KP6A 2MKSA 2HHPA 1HNVA 1C0UB 1Y11A 5DRKA 4KC5A 4PAAA 2CPEA 2XMKA 2ADCA 2BQRA 3C14B 1MW7A 4JI8F 4DLEA 2MSTA 3HSZA 1PGZA 4Y6IA 4X65F 3VZHA 3DI6B 2CJ9A 4ILRA 2M70A 2PSZA 3M4XA 3E01A 1S9GA 3QT7A 4NZ7A 3M7VA 3MEEB 4LSZB 2ZUAA 5A8RB 1YDLA 1IR2A 4ANDA 4RLEA 2J7UA 4FS2A 2NYIA 4WE1B 4LMZA 3O6QA 3GFXA 1RWPB 3B78A 5I4MA 4X4QA 2IDLA 1W7WA 2VV5A 1NK7A 3SEOA 1D9AA 1IM4A 4GKKF 3QYYA 2ALYB 2PA8D 3CC2S 1JLCB 1B64A 4PWDA 2M2BA 4ITSA 4X4NA 2W25A 5ETTA 3UWTA 1JLAB 1VR6A 4DBQA 4ZVPB 1ELOA 1S1VB 4OYPA 1KS2A 2ZEJA 5J1NA 3NNAA 3QQCD 1TTHB 2GAHC 1SKSA 2VU5A 1S97A 4Z2XA 1WF1A 3SQGA 4IFVA 4OYXA 4Z7YA 1RTDA 1T9TA 4L72B 3MEGA 2YKPA 1TKDA 5IOLA 5E41A 4QU6A 4MFBB 2AV5A 4DV1J 2VODA 2B43A 3VTIA 4C8MA 4DEZA 4GVLA 3VGSA 4ZPDA 1L5UA 2IPOB 3E8OA 2GQ2A 3G6YA 1SQEA 3QSIA 1LNQA 3HX9A 3C16B 3BKFA 3MM6A 1FWKA 1U1OA 4U95A 4K50A 2QA1A 3M8PB 2R3VA 5J2MA 1N0UA 2UV8G 3D0GE 2ZC3A 4UW2A 1JKHB 2XY6A 1WC4A 4AYBD 1D1UA 2V8GA 5EWEA 3GFYA 3V81A 1RQ0A 4DJBA 3ZC4A 4FYDA 4G1QA 2GO9A 3EMTA 3QT5A 1LKZA 4CDIA 2RJZA 3IGVA 1R7IA 2VG6A 5HMZA 1DQ9A 1S9EA 4QIVA 4NWBA 1S6QB 5HMXA 1FWLA 5HLFA 2KFYA 1G6BA 1Q82T 1WKKA 2HK3A 3MGJA 2PFDA 5D4OA 5IC4B 4E0DA 1S1WA 1GMWD 4F4XA 1U26A 3KLEB 2BX6A 2BOAA 2GS8A 4PQUB 2Q6BA 1B99A 1LWFB 3BS9A 1FDBA 2PT0A 3CMES 1ZOTA 4GMKA 1R8CA 1S57A 3V4MA 3G2XA 4I6WA 5DLGA 3BYRA 4GVBB 1S7HA 3TUPA 3ILIA 2N7CA 2EEYA 2AF6A 4W92B 2BJEA 5HQ8A 2A2DA 3ET6A 2AT1B 2YY3A 2QL9B 2H5JB 3B4DA 2GMJA 3KLHA 2CNNB 1E6VB 4K59A 4N77A 2V4QA 5KFFA 4OV6A 4N8OA 2W9BB 4JI7F 3OTBA 1T05B 4RBTA 3IWNC 1I94F 3EDRB 4IG3A 4MMOA 2CPXA 4M1KA 1FJEB 2FJVA 2VKZG 4M8LA 1F60B 1DARA 2R2UA 1U1PA 4NLOA 4UY8T 1UETA 3Q8SB 2F8HA 2P9GA 4O3NA 4Y00A 3BV8A 1JLFB 2MKCA 3BM7A 3EZOA 1LQ9A 4J7CA 3MF5A 1MWZA 4HDHA 1PBUA 3CCUS 1X4CA 4M5DB 5I3UA 5KFXA 2JOQA 5LMUJ 1UW9A 3TEGA 2YNFB 5DS7A 4B3MF 4QPXA 3QIPA 4QCLA 1E6YA 2J6UA 1OWXA 3U7JA 5LSOA 1KLMA 4WTYA 3D1QA 5J2NA 2HFSA 5J2QB 1T95A 3PO4A 5LJ5Y 4DF4A 2HRYA 4BC7A 1WEXA 3MM8B 1H38A 2CWXA 3OL8A 2NXUA 4KR0B 4LSNB 1NNDA 4DCOB 1IKVA 3HHKA 2MGZA 3KHRA 5D78A 3DRSA 4A8WA 2B51A 2NXJA 3PY8A 4DV2J 3QGIA 2BEFA 5E2QA 1XMQJ 2XI3A 2QMWA 4DU8A 1QAYA 5KFSA 3NP5A 4PPDA 4USMA 2A6MA 4N5SA 3GYNA 4DR5F 4FN5A 3M6VA 3FVYA 4LF5F 4NEZA 1RWVB 3LPEA 4OYAA 3ZFVA 1YJTA 1Q16B 1ZETA 5DQGA 4C11B 5A2QY 5BYSA 2OI2A 4F3OA 2WVCA 4I68A 2EWHA 3Q2TC 4ELUA 5A8KB 2HFOA 4ZVEA 2ZZNA 1ZZNA 2Y3YA 1TK8A 1Q0NA 3NOGA 1D09B 3NBPA 2PI5A 4DFMA 3BGLA 1UWBA 3KJVA 4EBEA 4NCGB 3GQCA 3ETMA 3BN7A 2XHCA 2IRYA 4A8SA 1N5VA 2DPIA 3ENAA 5FDLB 3JQMA 3T3FA 1VOMA 4PWUA 4B9NA 4I2PB 1P1TA 4DX8H 2E7VA 1PBAA 2ATCB 2XSJB 1VQNS 1SXLA 4DSJA 1Y0HA 1OPIA 4DR7F 1K47A 2CQBA 3T1YF 1X8DA 3DYAB 2VIHA 1JMTA 4DV7F 3DRRA 3FBFA 1TR0A 2AYEA 2JEFA 5LXRA 3D66A 5KG1A 2IHR1 1VRUB 5KFRA 3Q8YA 4FNIA 1UZHA 3QLHA 1EX8A 2W9AA 1S4EA 4ECQA 2KT5A 4Q0BA 2WVEA 4NYOA 2C22A 1VQ8S 4J91A 3IG1B 3M1VA 4HH1A 2CG8A 2DH7A 4LFAJ 4ED7A 5T41A 4QYZK 2APOA 4DR4F 2LA6A 2VASA 3DRYA 5IWAF 3PR5B 4FXDA 2FJDB 4MKAA 3GG0A 4RW4B 2OH2A 4C48A 4CLFA 1PAEX 2BE2B 1M5KC 1RJJA 2V4RA 3MR3A 2DHGA 5DGAA 3E51A 5D4LA 2B6AA 4AL6A 3I56S 2F8EX 2MZSA 4C8YA 1Y9OA 3SDEA 2CDQA 3D1HA 2F9JA 4L75A 5KFOA 1TL7A 5IV4A 2VICA 4N41A 3JSRA 1TUWA 1D3WA 1WDDA 3HO1A 2CJQA 1FEEA 4DHVA 3ZZOA 1GX5A 4DFPA 3H0PA 1HWUA 4X4RA 1FO1A 2QLXA 1RTIB 2H51B 2QT7A 1IR1A 5HMWA 3RAXA 2FHJD 1QAIA 5L46A 2EFPA 2O66A 2G4BA 1ZAXA 5DQHA 3PDNA 1J5OA 2NZCA 4CM0A 3HFVA 2CQ3A 3FEXB 1U8WA 3OTOJ 1B0TA 2QE5A 2WBRA 1RT5A 5AJ3F 5DDOC 3VAIA 1VMBA 3TRGA 3UVJB 1XR6A 4LRBA 4F4WA 2WSFC 3RW6A 4YDDB 2XS5A 2G2YA 2IVYA 2ZC4A 3RR7A 1ULRA 3PVXA 2YNIB 3LH2S 2DNZA 2KZZA 4RU2A 1FD2A 1S4FA 4WIQA 5KAKA 4R5PA 3KFWX 4J9NA 1XEZA 3OHAA 1TUGB 4I7FB 2XC9A 2VA3A 5EX3A 3AJDA 4JI5J 4KGXB 3G87A 2HVZA 2HRTA 1S49A 2JH3A 3VGTA 2HIYA 1DQ8A 3B6BA 1TFYA 2OMLA 1VJWA 2B8PA 1X0FA 4B3TJ 3OD2A 2V9KA 3LALA 3N79A 2QEXS 1URRA 1ITPA 1SJQA 2AEFA 1EJ7L 3HPOA 1RHRB 3PM9A 2B56A 4TYAA 3QRPA 3ELHA 1X4EA 4EI2A 2RUSA 3AD9C 1FXRA 4JV5F 2WW8A 1IJFB 2E44A 3R1HA 3VAGA 2E9ZA 4FKXA 3KUGA 5KG0A 5HQLA 2XMUA 5AXMA 3GV8B 5LT5A 1LK7A 2MMYA 3LW5C 2DGOA 2UVRA 1N5TA 1MNEA 3MEKA 1VIOA 1V5IB 1RT7A 3QGHA 4MYUA 4OX6A 1HQUB 2MJNA 5F8MA 1VGYA 4PRFA 3M6WA 1LEOA 5HVFA 4FNHA 3J7A1 3W8GA 1NHUA 3BSAA 5D3GB 3CCJS 1J5EF 4RNNA 3I5CA 4QQBA 3D3CJ 3KUEA 2EVZA 4P52A 3M32A 4OZ1A 1RAGB 3LA0A 5HI7A 5LMNJ 1D8YA 2MQNA 2BR0A 1SJRA 3QO9A 4LFBF 3BBFA 3ILOA 5LL6d 4ZVUB 1IJEB 2BANA 3JSMB 1KTQA 4LFCF 3LWMA 1FJGF 5HQMA 4IQMA 3G8QA 1CJKA 1JQGA 5KFEA 4EBCA 3K2YA 2C2OB 3GG1A 3CB4A 4OYZA 1TKZA 2F8MA 2XSFA 1UEKA 1BQMB 4NLQA 3CE8A 4NLPA 2XMAA 2MEWA 1XNQJ 1U0HB 1FRMA 1IVZA 3CCVS 3D2WA 2HNDB 2CQHA 4EO6A 4LF6J 1TKXA 5CD4H 4IQXA 3LAKA 1XNRF 4ZS6A 3AJ1A 1MWQA 3W1YC 1LOUA 5JXSA 5D8HB 1KC8T 3MZIA 4IYQA 4WK1A 2L3MA 3PFOA 2DGUA 2OP5A 1BC6A 3V6KA 3MMCB 2HRUA 2ZUGA 2G9OA 1KKHA 3J81U 4NLVA 1HMVA 5B0CA 1W2BR 2AYBA 2ZFHA 3SBMA 1X9MA 4U96A 1Z4UA 4X64J 2XCAA 2FQQB 3BJYA 4KIAA 3MR6A 1NHKL 1A7GE 3L3CA 5KFQA 1GMVA 3MPYA 2FVSA 1F9EB 3RAMA 1LWEB 1MG7A 4O44B 2Z4PA 2ROEA 3MMJA 1VIXA 5F0UA 1WG1A 4ZCIA 1U49A 2Y1LB 2H3EB 4EO8A 3PW5A 3BGRB 3GONA 4ICLA 2GIQA 2O1PA 2G1DA 5M2PA 1ZTWA 1Y00A 4K0KF 2V2QA 1YBUA 4Y0FA 2FHOB 1L3UA 2QL7B 2CJAA 2UUBJ 2V63A 4USJC 3LWLA 5ETPA 3OR2A 1FFGB 3TJ8A 1REVA 2Z2YB 1HQEB 2Y1JA 2CWKA 2IA0A 3BDEA 2VG5A 5B0BA 2CIMA 2BOPA 3E2EA 1TP7A 3HD2A 2LEBA 4R25A 3SMZA 2UZAA 3LP0A 1NSAA 4ED8A 3UQSA 3H98A 3KG1A 3JTNA 4KSEB 2BJ7A 3DCAA 4ECWA 1RGVA 4JI1J 4KJIA 1Q53A 3CJ3A 5F9LA 3TVKA 4NLTA 3TZZA 3DLEA 2YX7A 3N9UC 1NCLA 4H4OA 1WI8A 5ETQA 4TQRA 4K5RA 3I55S 1HARA 1PAUB 2CDRB 4PXEA 2W1BA 3R97A 3J7YI 5GAHU 1N5YB 1QUPA 1Q8LA 1LW0B 1MU2A 2HHHJ 5EGYA 1M5VC 1SL0A 2R7UA 3H5UA 3W7BA 2Y0SD 4EFAC 3B82A 3IRXA 3PX6A 2EK1A 3DLLQ 4JV1A 1U45A 2MQLA 1OS5A 1YIJS 1NK0A 3PRVA 1RWUA 1VFJA 1FRIA 2XBPA 3TA2A 4ZLJA 5KFHA 4J9SA 3BDPA 1P6TA 2D3ZA 4C0BA 1CLFA 1XR7A 1MMDA 2FB0A 1O5JA 2QA2A 2F1FA 2KXHA 2MQPA 2UU9J 2LXIA 4F4YA 3CD7A 3JXOA 3TAMA 4OHYA 2NUHA 3FSXA 4BWMA 1N34J 1H0HB 2ZNZA 3C6UA 4CZCA 3WC2A 2K1RB 4LF9F 5AXKA 2EI5A 4BHQA 2HQGA 5GMKa 1M5PC 2ZBCA 4X4VA 1WELA 5HATA 3R5DA 5C24A 2BA9A 3BREA 2C3UA 2RVJA 4UOHA 2BXJA 1GEHA 3MTJA 1V3SA 3CW2C 1U1RA 4EYIB 5D4NA 5HO4A 2Q3PA 4NA2A 2IRXA 1QE1B 1BMQB 3SYZA 2XO7A 1TL4A 2VPXB 3I96A 1YJVA 3WIVA 3JAMU 4QR0A 3T6JA 1RT2A 2E1PA 1XWLA 2JEGA 5AXLA 1TL3A 2WB4A 3CCQS 4DV4F 5DG9A 2Y1IA 3IBWA 3A8EA 4X62J 3HVTB 3FEZA 4HR2A 2KG1A 1R8PA 5ITHA 3DLGA 1K0TA 2CA9A 3KK2B 4LVNP 5F0WA 4LF2A 1KVIA 5F8HA 3N6LA 1C2PA 2RNEA 2ZOGA 3GJRB 5BYRA 3R9LA 4B3OA 2I1RA 4FPRA 4OZ2A 1NDLA 3PEJA 1T3OA 4X66F 5AE3A 2W7AA 3L7UA 5KT3A 5KFWA 5CA5A 2GZOA 2IRUA 3D7SB 1YX2A 2HNYA 3OXFA 1UVIA 1VLYA 2F4VJ 3TJ9A 4F67A 2HW3A 2ACMA 4ID5B 4NCAA 3QRQA 3FC9A 3IWXA 1SV5B 1AT1B 4ILLA 2IJRA 4WTOB 5HBMB 4ECTA 1UVNA 3I32A 4Q8EA 1QY7A 1AYEA 2XB2D 4WZQA 1UCNA 2PFFB 3HHLB 3HVWA 1S1XB 2N4CA 1HYSB 3DXBA 4RW7A 2MJUA 2J7WA 2HS0A 2MQOA 4P6QA 3AXKA 4WBFA 2I0XA 1VK3A 5CYQA 4ECXA 4FYYB 1ICEB 2DCUB 1YK9A 3MFHA 1WTBA 3BEGB 4RW9A 3I4HX 4O3PA 1HBUB 5BXIA 4QU7A 2EFOA 4O4GB 1FXDA 4M95A 4QIFA 4GKJF 4PQAA 1WC5A 4DG1A 3FRZA 3EGVA 2KM8C 1U1LA 2OPQA 4V1Ak 3EXCX 1KQKA 3EWGA 1H7WA 2EK6A 2MKIA 2LCWA 1VQKS 1RCOB 2FZGB 3FRYA 3CJ8A 4DFKA 1QDUB 4GRSA 4TXSA 3GIIA 2IIHA 4YR0A 3PR4A 2YBVA 1VC6A 4DL5A 3I5AA 1H7XA 1RA6A 1VQYA 4I2QB 1WC3A 2V0NA 1PSDA 2ZH2A 1B0PA 2OLWA 2IAJA 3V6DB 2J9DE 1RTJB 1K1QA 3MM5A 3CJ5A 5HP1A 2AYGA 3KK3A 4AE5A 1FDAA 4P7VA 5C2GA 2O01C 3KLGA 2W24A 3ISNC 3BF4A 4ZN1A 1DQAA 1IWAA 2XMMA 5B08A 2V8PA 2VG7A 2JFKA 2CQ2A 4D3GA 3I87A 2KO1A 3DMJB 4WJBA 4DLGA 4ZMMA 3KJFB 2MY8A 4OJ1A 5ETVA 3OUYB 2YX1A 1GX6A 2A3JA 3PW7A 2HFVA 5A2QU 4W98A 4TU9A 5D0EA 2QA4S 1FK9B 3LF0A 4OI4A 1W25A 4PEOA 2ADBA 3POTB 2KXFA 4NYPA 5CYJA 3KJQB 3N6MA 3MM9B 3GIRA 4IUFA 1W26A 2QL5B 4ZLLA 4F26A 1JLGA 1FRLA 4DCJB 4FF3A 3MECA 4DR3J 2AJ4A 3KDOA 1JLEB 3CO0P 1HWIA 4EWTA 4TU8A 1NH7A 3H2LA 1Y7PA 4KH1B 5BR8F 3JB9k 4X2BA 3CD5A 1SH3A 1YWXA 1JNRB 1VQPS 4LSLA 4NZ0A 5K20B 1RTHA 2RF2B 5RUBA 1MN7A 3OJUA 3T1HF 4ES2A 5LSLA 3N6NA 3KHGA 3ITHA 4P73A 3J81j 2FJBB 4B9SA 2W7PA 2KJWA 4AQYJ 1IKXB 1JLQA 2JC0A 4YY3J 4RW8B 2VFVA 2R2RA 3UR3C 3QAEA 5K14A 5I3QA 2VPZB 4XO0A 4JI6F 2MTLA 4L76A 1J27A 5F9NA 2AGQA 3TWZA 3Q86A 1U8SA 1A9NB 3WDOA 3KNAA 4KGMA 2E5LJ 5ETLA 2VH7A 3DOKA 2RD5C 3D3BJ 4LBHA 1SBRA 1AFJA 2VQFJ 3BN4A 1C0TA 2AQ4A 4ZDNA 3DM2B 1YJ7A 4BS2A 1CULB 1EETB 4ZHRA 3MMAA 4TN2A 1NKCA 1UKUA 1GT8A 5B0EA 1U1QA 1RWOB 4B02A 3KK1B 1UA0A 4IG0A 4DL0C 2JNJA 2LQ5A 4N47A 3BPSP 4LRCA 4C0HA 4Q2MA 2ACYA 5FJ4A 3KUHA 2Q66A 5IZHA 2QJ3A 4OI3A 5A6WA 1QSYA 1B7FA 2Z2ZA 4M5GA 3ISZA 2A6OA 1HNZJ 3T5KA 4YDXA 5LXYA 1T03B 4ILMA 3DXSX 3EVMA 5KFVA 3KJNB 4QR2A 3BSOA 4LIRA 5B0AA 3RR8A 1XR5A 2ZE2A 5GMDA 3DGPB 3DRPB 3UCUP 1SL1A 2UVUA 1S10A 3MD3A 1LW2B 1HPZA 3CJSA 4ZCLA 4KV8B 2KKHA 2GJFA 3ONQA 2F5GA 2VPYB 4JBCA 4BCAA 4H4MA 1L3VA 1CVJA 1XMOJ 2Q79A 3SCKE 3WHIA 3FZBA 2QGFB 2X3DA 1AW0A 4LQ3A 2YTCA 1K0VA 3CD0A 2FDNA 2YKNB 4PUOA 3NGTA 4OZ5A 1X4AA 3Q8UA 2ALZA 4BWJA 1S72S 2YKMB 3GFZA 5B0GA 4NLRA 5U47A 2DGXA 1SJ1A 4QR1A 1SH2A 1WC1A 2XLKA 5J2PB 4CLWA 3CJQA 3CPWR 2ZH7A 2Q43A 2DNRA 3LP1A 1X9SA 4R0JA 3VZIA 4WE1A 2EG1A 1EQ0A 1MMNA 2YVSA 2YNGA 1KONA 4DN9A 4MTPA 3TI0A 2D3O1 2HMIA 5CCMA 3SI8A 2HHQA 3R5JB 3LTOA 3VAKA 3PTWA 3C19A 4P71A 4DX5A 5I42A 1JLCA 4USIA 4HHHA 5KT5A 4AXJA 5HVHA 2LEPA 2CJKA 2BW2A 2W4PA 4F50A 4U9RA 3AA9A 3NXZA 1RB0A 1S1VA 1WEYA 3CJKA 3SSSA 3KLIA 2V8DA 4IDKB 5LOQA 4RNOA 2DB1A 4DV3F 2HBYB 1FFWB 1GK8A 2LMIA 5F41A 3THVA 3AJ2A 2G2ZA 3UDVA 4O3OA 1HNWJ 3G96A 1IUJA 4DPYA 3P5TL 3G82B 2XWXA 1NK4A 4OZJA 2F63A 2GHPA 4TY8B 3VAMA 2VBXA 4K4WA 1YHQS 1HNVB 2V2ZA 2R7VA 4G1PA 2HFUA 1HLWA 3THTA 2DHXA 5GVQA 5JUMA 3C16A 1VRQC 4LBPA 3WZ0A 2K06A 3E01B 1S9GB 1VQ9S 4DV0F 1JKHA 4CLKA 3OLBA 2L9DA 1YLXA 1WSVA 2ZKUA 2CNOB 4WYWA 1Q7YT 3OLAA 5J1EA 4CNZA 1NJIT 1OQ3A 1N6QA 2B3TB 1MSWD 3BSNA 4KHPF 3R3TA 4RNMA 2MKJA 1Y3KA 2UUCJ 2AZ3A 4LBIA 2RDDA 3I5BA 3PHTA 1DZ5A 4DR1J 3TUIC 4PWDB 1JLBA 3BQ1A 3B8HA 1IWGA 4DPTA 1SJFA 2BE9B 4Y3CA 4FXVA 3CCTA 5B0DA 3AT1B 3M2VA 3V2UC 3KLVA 4F4ZA 3TQ1A 1RHMB 4DPXA 2XNQA 4PQUA 3C6TA 4RNHA 1LWFA 3AD8C 2M8HA 2CPZA 2DNMA 5E7OB 5IT9Y 3MCMA 2DPJA 1FJ7A 4ZOSA 3PW0A 4G65A 2A1BA 4L6V3 4CO2A 1RLDA 1ZPVA 4F4AA 1VQOS 3MAAA 2ZHBA 1NO8A 3ENWA 2GIRA 4N76A 3KMQA 4IFVB 2CQGA 3MFIA 1RTDB 2UVWA 1WWHA 3KMSA 3MEGB 2R7RA 1RU1A 1N33J 4OHVA 3DOLB 2VQEJ 1HI8A 3H4BA 2DHHA 3JQKA 3UPFA 1IKWA 4YR2A 2GW8A 1E6VA 3QZ8A 2MKHA 2HKEA 4OJGA 1T7PA 2ZHOA 3CUNA 1BWVA 1N8RT 1S77D 3MM6B 1T05A 4RUBA 1C4CA 3ZTPA 3P96A 3W2VA 3F41A 5J2MB 4UUXA 2CZ4A 4RKUC 2KYXA 3L7OA 2E7WA 1HHSA 1UMJA 5GAGU 2JWNA 1JLFA 3EDQB 4R0EA 3QIDA 3A8KA 1QD1A 2C2RA 1RUSA 4NYZA 2JL9A 4G1QB 1X7VA 4WCEQ 2DVIA 3BO3A 2BMBA 1OY6A 6FD1A 2VG6B 1H6KX 1Z1ZA 3ILLA 1NDCA 1S9EB 1HBNA 5HLFB 4ETZA 1DHMA 1OPZA 1S1WB 2LA4A 1LFWA 5J2QA 3US5A 2AJFE 2H9ZA 3MM8A 3K7RA 3RBEA 2ASLA 3N0VA 4LRAA 1JXEA 3W5XA 3FBBA 2PA3A 1ZM9A 1NEEA 1RABB 4DV6J 5CXTA 1SH0A 4CYUA 1X5PA 2V8HA 3TP2A 7FDRA 2UUAJ 2CQDA 4IFYA 3TYTA 2B7CB 1REGX 4UQTA 4NXNJ 1D8ZA 4FZVA 1VBXA 2OPRB 3ICLA 3KLHB 5HSPA 3FDSA 3CJTA 4JYAJ 3OR1B 3UD4P 4F3QA 2J7KA 5L1JA 3K0JA 3ZZYA 2W8KA 2ILZA 3G6XA 1R0AB 3ULHA 3Q83A 3O3LA 3PYDA 1NDPA 5HJYA 2QA4G 3PHEA 4IG3B 4FKYA 3I9V9 1FTCA 1NJWA 4JUZA 1EIYB 1U2CA 4PPZA 4IO1A 2M3DA 1BE4A 1F0XA 5DQIA 5DJBA 1XERA 4F25A 3RJMB 3VALA 3H7HB 3TANA 1QTNB 2KT3A 3IO1A 3ZNJ1 3FNNA 1KR4A 1F5AA 1KSPA 2RQKA 4C3LA 2XMWA 1WTFA 5CAAA 4EU0A 1IKYA 3HD1A 1N54B 2R7WA 1GQEA 5I3UB 4PXDA 2I6WA 1PYOB 2HYIB 4JI3F 5D0RA 3HI9A 4NCGA 3W64A 2IY5B 3NGRA 3K59A 4J5OA 1QSLA 4B3RJ 8RUCA 4OZ3A 3QIPB 5FDLA 1FDDA 4Q5VA 4U7UD 2E5GA 3IN5A 2C1EB 4KTQA 1RAEB 1E6YB 3J7Z5 1KLMB 4M94A 5J2NB 2VC1A 3E3XA 1FNOA 2NZ4A 2CG4A 3RBZA 2GV1A 3PIPQ 1RT4A 4CIOA 2E5IA 4DQIA 2DNHA 5JJBA 1WOPA 1SJ3P 2F3JA 2HAFA 1OSCA 4KFBA 4DSEA 1G3OA 2ZD1B 4NXMJ 1N36F 4HL9A 2CQIA 4YEAA 1CJVB 1VRUA 2B4PA 1L3TA 3EUNA 1PO6A 4U6PA 4DZDA 4A46A 1OO0B 3DU6A 4CLTA 2XG8A 3CTRA 2VB6A 2XM3A 1WSRA 2XZTB 2PDAA 2R2SA 3FFIA 2FVPA 2HSEB 4IOCQ 3D5MA 5DG7A 3L09A 1NPRA 4OJ3A 3DLBA 1YGYA 5M2UA 4ANCA 1T9WA 2MKKA 5SZTA 3QSYB 5AXNA 1HWJA 1NK8A 1LV5A 2KYZA 2DNLA 2HNZA 2RQCA 3M8QB 2NXCA 3NS6A 2HVEA 4UTGA 1WHWA 3OJSA 1S7IA 2EC0A 1R8HA 2XO6A 3D54A 5D0GA 4WP8A 1GFWB 2MQ8A 2Y8YA 3K5OA 3NBPB 1H73A 3OXLA 2XYPB 3KJVB 4NLUA 3K58A 1KDNA 1WD6A 1X0PA 4F0HA 1Y5IB 3WC0A 3ILJA 2LKZA 2ZVIA 3PYGA 4UUWA 4F8RA 4YOEA 4MYTA 3QRRA 1DRZA 1RTIA 5GAEU 5DGBA 3PRBA 4IOBA 2UXCJ 3TVYA 3HZEA 1RXOB 1G1XA 2W01A 4F3MA 3V6JA 3DRRB 1YBTA 3J80Y 5GAHI 1D9DA 3TJAA 1YG0A 2XGQA 1WDTA 3QLHB 3W60A 4I56A 2AJ2A 3NGUA 2WSCC 1VJQA 3OTCA 4DUZJ 1KWMA 2YNIA 2KVQE 2HQFA 4Q0BB 1TK5A 4JI2F 4NA3A 3GP9A 5F8GA 4PG8A 2RSQA 2XEXA 1HL6A 5IQ6A 4ECRA 3F0NA 4ZPWR 2OPPB 2UXBF 2E7XA 5IM0A 2KH9A 3KWMA 4OYBA 1PYTA 4UZCA 1V6HA 1PIEA 4WU2A 4GO5X 1AUDA 2WB1D 2RDJA 3MOJB 1PJ7A 2M88A 1EHWA 3I31A 3R5BA 4XK8C 3U1LA 3OW2R 3RU0A 4A8KA 1DTTB 3C3LA 5C25B 5D6GA 4C8OA 3CIMA 4YB7A 4ZIVA 4A4JA 4KB7A 4O3RA 2IM2A 3MCNA 3SDEB 4ZN3A 2ZBQA 1FX4A 5A0YB 1S0MA 4M5MA 4Y2KA 1AXQA 1TL7B 2XTJP 4ELVA 4DUTA 2DY9A 2GHWA 3OHBA 1I5OB 1T9VA 4ZPAA 5DZ6A 2XZWA 5GADU 4ER8A 4DV5J 3IM9A 1TZ0A 4Y65A 5G4DA 3IR6B 4LF4J 1H2TZ 4BLGA 3JS9A 4ZCKA 2EXUA 2G2OA 4C98A 3BBCA 1F3FA 3RG6A 3NS5A 3UI3A 1UP1A 3VAFA 1C1CA 3R7BB 2J0SD 2BJ8A 2HIQA 1RT5B 4ZVGA 2X1FA 3UDEA 4ZVSB 2VFUA 3CD6S 5KG4A 3LP2A 2ROPA 3IM8A 1VDHA 3ZZ0A 1KVKA 2WSEC 2ZDPA 4J9MA 4MIWA 4JI4J 1QM9A 3KLFB 3SXLA 2MDAA 4I0WA 1NKEA 1SKRA 4R5PB 1NDKA 2R8IA 4KH0B 1ZA2B 2DNNA 2PEBA 3ZTRA 2V34A 1UZDA 1VQ7S 2CUYA 1T11A 4CNYA 5K9FA 1PCAA 2J6TA 2EFQA 4AD6A 1IBMJ 2FY8A 2H5IB 3CJRA 4J90A 3HSJA 3EYZA 4CH7A 4DV1F 4HEA9 2KFNA 4HKQA 1R6VA 3QGGA 4RR5A 1AZSA 2I5JB 5EHHA 3IR5B 3G6VA 3KYLA 2NR0A 4NX9A 2BM0A 1HWKA 3THPA 5IFMA 1HR0J 3Q8PB 4IH7A 1U0HA 5KFKA 1FKPA 3DHWC 4JV2A 2C42A 4B08A 2JDJA 4IH6A 4ECYA 2W2NP 3L9ZA 2AHOB 4ED4A 4O0NA 2IBKA 1WORA 4S0MA 1C1BA 4FYWB 1A0OB 5KG2A 3RB4A 2KHDA 3CCLS 1RWXB 4A8FA 5DLFA 4L74A 3NMAA 5B09A 3BH6B 1YQHA 1U6ZA 3OXGA 2ZHAA 3BB5A 1RAJA 4DL3A 2YKOA 1PKUA 1QAJA 3UD5A 2PEHA 2KVIA 3DLKA 2DNQA 3LOUA 1RKIA 2K7KA 1QAXA 3K57A 3FMWA 4U8YA 4MKYA 3GYXB 5EWFA 2V2VA 3IBFB 1T9YA 3UCGA 3G86A 3QO9B 4RUHA 3AQPA 1B70B 5DDPC 3NY0A 3EZ5A 2RU3A 2BANB 2BKNA 1CJTA 2QSWA 4E98A 4FPIA 3HXMA 4FXWA 3EVWA 4PG6A 1CJKB 4TLQA 1QTMA 2R7TA 3M8YA 4NI2B 3AOBA 1TKZB 3K5MA 1TVRA 2AIRB 3NLCA 2AP6A 1VBKA 3V4IB 1FNXH 1TAQA 3R6GB 2P5VA 4ECZA 3D0IE 1S12A 4CLSA 2K3KA 5FLXY 4P9SA 3TAPA 4J9KA 4OI1A 1S0NA 3WX8A 1VQSA 2XI2A 2FJAB 4FYVB 3MR5A 4C97A 1TKXB 1FERA 3OTDA 1NMEB 5B0FA 4K5SA 3BSCA 3B54A 4DU7A 4EK2A 1HD1A 2GFFA 2BJ3A 1U24A 2RDIA 4CLYA 5A8WA 2D3UA 3PX0A 2F40A 1YRTA 4CWBA 3N5FA 5F8IA 3P5BP 2E1MC 5LMUF 2FLOA 1HMVB 1IN0A 1X5SA 3ZZUA 4A8XA 3RBDA 1XMBA 3D1OA 5KT2A 2DHSA 1Y3JA 3H5XA 4M5LA 5IC6B 1R3NA 2DD8S 2DGTA 7AT1B 3Q0AA 4C8LA 2VZ9A 3CCZA 3DDIA 1WF0A 2Y0BB 2FLLA 1NB7A 4ZCMA 1N5SA 4LF7J 2HQCA 3W65A 1K1SA 4IR1A 4DV2F 1BLUA 1EB0A 3CMAS 3HF5A 4NMXA 1S1UA 3HKWA 1XMQF 2QMUB 4ICLB 2QFIA 4DL2A 1HNXJ 3Q22A 4CO5A 4G6VB 5DM7Q 3FQLA 4IR9A 1NPKA 1QSSA 1AB8A 2VJUA 3BKTA 1F2HA 3JTOA 2L9NA 2OUGA 1REVB 2RB7A 2OEMA 2VG5B 4OZLA 1YBAA 3GIMA 4WFBQ 1R6YA 2WTFA 3MMBA 3BO4A 1Q8IA 2EKNA 2F4FA 3NG8A 1YZ7A 4USKA 3LP0B 2JZ5A 2DRAA 2P2CB 1GH8A 1OY8A 1S79A 3NCQA 3R8YA 3RTVA 2J0WA 2RKIA 1URNA 5HK4A 3DC2A 1RHQB 1I51B 2LXUA 1VQ6S 4N56A 1R0BG 3MEDA 1OMSA 1QE1A 1X4FA 2MY7A 3HHDA 2YQ1A 3EX7B 3T5LA 2LDYA 2MHNA 4ZP6A 3W2WA 4DI6A 2DO4A 2DYAA 3GCWP 4AFFA 4GO7X 1MU2B 1ZZFA 4EGLA 5DG8A 2WBMA 1NK9A 2DGQA 3CXCR 3GJTB 3LGNA 2FVRA 2QG9B 2ASJA 4L3NA 1V3ZA 3IRXB 2PIIA 1RKJA 2C3OA 2DGWA 2D9PA 3QGPA 2XLIA 3LO3A 4NLXA 5M2RA 3D68A 2ILYA 4LFAF 4JB8B 2L9WA 1V5VA 1HI0P 3TR5A 1TKTB 5G0RA 3ZTQA 3TAMB 2ZITA 1APSA 2NXNA 3AAWB 2BKOA 3RW7A 4UOGA 4ZKAA 2CPFA 4XAKA 2A0FB 2XZDB 1RHKB 5IT0A 1SV5A 3C8YA 2D69A 1ZAVA 2UXDJ 1F1BB 2HBQB 2WW4A 2VBWA 3GZ7A 2GMLA 2PN6A 3TA1A 3P3DA 1LWXA 1S1XA 4F2SA 3IA0A 1T9UA 1V3RA 1VC0A 4C6AA 1Q81T 2C3PA 5KT7A 1DFDA 3QWPA 4Y2MA 2LVWA 4O4GA 5T7LA 4IRCA 4DXLA 2XHWA 3IMQJ 1RT2B 2ZOFA 3OL7A 1TL3B 3DN9A 3OTOF 5J1PA 1UW4A 1N52B 2DJWA 3I9ZA 3DLGB 3ENVA 2FZCB 4OI6A 2OPSA 3W62A 1X5TA 3D6MB 1VHIA 1IBLJ 4KYZA 1Y4ZB 1N32J 4YHHJ 1R89A 4I2QA 4B3OB 1IM6A 3VR1A 1AROP 5I3PA 4NLYA 2RUGA 4MH8A 4QWBA 3HM9A 3EVOA 2H54B 1RADB 1ZA1B 3D6HB 4JI5F 5KTQA 2BDPA 4LF1A 2N82B 2IA6A 4Y2CA 1M0SA 2E5JA 1TV6A 4ZA1A 1BD6A 4ZVOB 4KPYA 3GIJA 4B3TF 5E3RA 1DTQB 4A48A 2ZM6J 3NGDA 4P74A 5KFCA 2OD6A 4DR2J 4PG7A 1S6OA 3MDFA 4D3HA 2CJBA 4WP9A 1UA1A 3OUYA 4RW7B 4DR6J 4PXBA 1SIWB 2KI2A 2VFRA 4QIWD 1KFDA 4QIEA 2KXNB 5CYQB 2F9DA 3WIUA 3TEHB 2BACA 3PJWA 2Z58B 2DNGA 4RW9B 2MKYA 3POTA 2ZH1A 4OI0A 4DUYJ 2MLXA 4HTIA 1JB0C 2CNLB 2VFSA 2OPQB 5K8OA 3JYTB 3Q23A 5KFGA 2E1RA 2DIUA 4WFYA 1RDRA 2U2FA 2D41A 4WP3A 2LFVA 3TUJC 1JLEA 2C2EA 1WC0A 4CLLA 3HJVA 3HFZB 4J9OA 3DLHA 2D3OR 3MPVA 1NU4A 1TAUA 2G0IA 1HW8A 1CEZA 1WUUA 1AUSL 4KT0C 2CPDA 2FJWA 3IAS9 3RZAA 4UZBA 2VF3A 3SIPB 2NYHA 3GSDA 5LMNF 4CO0A 2OSQA 3H2UB 2Q1LA 2IM1A 1RWNB 3LPYA 3MM5B 1KVJA 1WI6A 3AXMA 1PC4A 2NPFA 2BVZA 3JTPA 2YNHA 3KK3B 2QSFA 2KG0A 3PW4A 5KOXA 4NCBA 1VQMS 2D1CA 3LQVA 3KLGB 4ECSA 2CAJA 4TYBA 3PACA 3GB0A 1JIHA 5GAGI 1OIAA 4RUAA 4Q8FA 1YZ6A 3CCES 1WNEA 3L95X 1S1TB 1CSJA 2VG7B 3IFEA 3MCOA 4OYIA 4X84A 4DSLA 2JSXA 4C8KA 2XNRA 1ZAWA 5E0OA 4GC7A 4OX9J 4JI0J 2BE7D 3NNHA 2ZBIA 3ADAC 1XNQF 1SI9A 4RNFA 4MK8A 2HFNA 4ZVHA 3K8WA 3OQ2A 1CULA 1TL1A 2J8SA 2PD1A 3C46A 1ROFA 5CZXA 4LF6F 2QYGA 3V6HA 2QMXA 2E9RX 4USHA 1HNIB 1UAWA 3CVKA 4CLPA 1B0VA 3ZZRA 1RAHB 1NSQA 2RMLA 3FMBA 1R43A 2P9CA 1JLGB 3MECB 3H42A 4YB5A 3GE9A 2GC8A 2RILA 4WFAQ 4J9RA 1N56A 1RLCL 3RB3A 1VCTA 4EYHB 5KFNA 2VOPA 4A8QA 4LF8J 2N3OA 3ZXWA 2BM1A 3OL9A 2BJDA 1JXLA 2JX2A 2YWKA 4HVZA 4RL1A 2GVZB 4X64F 1RTHB 1ZH5A 1S99A 1LXJA 2QLBB 2DHAA 3ITHB 4KV8A 2IBOA 4A8YA 1EP4B 2EC2A 2DR5A 3J80U 2ASDA 4PWWA 5KFYA 1JLQB 4QBUA 3T41A 1YJWS 5K14B 2EFGA 9RUBA 5KFBA 3RGIA 2C2KB 3N28A 2XS7A 4C3MA 1SUQA 1DLOB 3J81Y 4FBUA 1NH8A 2ZH4A 1ZTTA 2WZ1A 1JXVA 2ERRA 3BR8A 5DZ7A 2G1HA 1HD0A 2UUBF 1C0TB 3M8WA 3WBZA 1CPZA 4ZHRB 1MWYA 3IS9A 2YWWA 2XLJA 3TW0A 5FD1A 4Y2AA 2RRNA 5EX0A 2HAIA 3DOMA 3MPDA 4I64A 2VDHA 3MPUB 4YQWA 2KT2A 2CKWA 3DDKA 3UO0A 6FDRA 2QN6B 4P72A 4JI1F 4ELTA 2D7SA 4WWSA 3OV7A 4J9QA 2NPIA 2KM8B 4U8VA 3PKYA 2ZE2B 2YH0A 3DNCA 2XY7A 3NGKA 4YFUA 1N48A 1DJ0A 3SV3A 3P49B 3HKZD 4DPWA 3UCZP 4B3SJ 1HPZB 1R0CB 2CQCA 2UV8A 4OIXA 3J7ZT 2D74B 4FF4A 2V8VA 1BGXT 1GAOA 1HBMA 3OPKA 5HROB 3G9CA 2HHHF 4RX6A 3KG0A 4Z7CA 4WFNQ 1EQMA 4TY8A 1NJYA 2CQ0A 2BRLA 4PG4A 1RTZA 2E9TA 5L39A 3PYFA 3SCJE 1TK0A 3PV8A 4QZVB 2CZVC 4PUOB 1T0TV 3MUVP 1RT6B 2G0CA 2YPZA 2LU2A 4ED0A 2V2KA 4EZ6A 1IQTA 1VLOA 3A3PB 3ENQA 3MTKA 2DH8A 4P75A 1XBWA 2AU0A 1PYSB 2V50A 2RE1A 1U1MA 3HMJG 3HVAA 3W8PA 1GXTA 1PILA 2J5AA 3UNGC 5C7PA 3LP1B 2QV6A 4OYMA 2Y8WA 5KFZA 6AT1B 4DMZA 4B9MA 2UU9F 5GAEI 1S6PA 2YNGB 4NRUA 2HHXA 2LQBA 3NS7B 4FVMA 2PMZD 2HMIB 3OBIA 3PNIA 2VFTA 2CZ9A 2Z57B 1TL5A 2HS3A 1N34F 4RBVA 3GFHA 3M2UA 3S01A 2Y9HA 3WX4A 4JV0A 2ZWOA 5I42B 2GJIA 4AT1B 1CS4A 4DL6A 4KGKA 3CCSS 4USVA 1CJUB 2BUNA 3UDLA 4ZLPA 5H9EJ 4KO0A 3NOCA 2V6AA 4K4ZA 4RZRA 3CJKB 3KLIB 3SQOP 3PKMA 1F9HA 4L73A 2JVOA 4P2FA 2AYMA 1FFSB 3GSIA 1VQLS 2CPYA 1B3TA 4Q2LA 1NHVA 4KBIA 4JI8J 4WF9Q 3EPIA 1M1KT 2M4MA 1GNKA 1ZBTA 2ZZTA 4ECUA 2QTWA 3DOLA 1K8AT 1FJCA 1S5ZA 2HHTA 4R8UA 2LQJA 3D0HE 4X62F 4X65J 4NLDA 2WK4A 3KTQA 4F04B 2JHEA 2ATLA 4KRWA 2HLUA 3NAHA 3R2CJ 3IR7B 4IRKA 1BXNA 1MROA 3VF0B 2DGSA 2HFZA 4B9UA 1WOOA 4OV1A 4CM2A 3K8VA 1KHVA 3TOQA 3NKYA 1WEZA 1UVKA 5HN0A 4KKOB 1EKRA 2W4CA 4CO1A 1RACB 1NUEA 5GADI 4AL5A 1YTYA 4GKKJ 5J1EB 2BJ1A 1X9WA 1N6QB 3JAMY 3GJSB 4HLBA 1UVLA 4UF4A 2FGOA 4DOZA 3NL0A 1T8EA 3GCXP 2AX0A 3A4TA 1HHTP 3P6YC 1T94A 1FE4A 3MURP 2F4VF 3EJMA 2MQQA 3G8TA 5KG6A 5L38A 4XDDA 4TNOA 2IC3A 2HWTA 1JLBB 2B5JB 5FLXU 3Q2SC 1RT1A 5F8LA 2IYGA 3M2VB 4ZK7M 2IMWP 2P6TA 1VQ4S 2AEJA 3BYPA 2WONB 3C6TB 1JJCB 2VL1A 1RHUB 4DS4A 3EGNA 1GXUA 1TMMA 4CH0S 3MHYA 4CT9A 3M9MB 2JRSA 2ZVSA 3VWSA 1RT3A 3MAAB 1XK8A 1UEVA 4MK7A 5AT1B 2QFJA 3W63A 1KD1T 3Q8VA 4DX7A 1FRHA 1N5QA 1I1GA 3QJPA 1MN9A 4ED6A 1T9XA 4QW8A 3W61A 2OAUA 4DWIA 1IKWB 2OPRA 3OR1A 2RU9A 2KRRA 2V4JB 1WJ9A 1R0AA 1SIZA 2VDIA 3W2VB 4ZVQB 3V5RA 5L9NA 3MUMP 2B9WA 1BWEA 4C9DA 4F02A 3GLJA 3PXGa 5CHCB 3Q8RB 2ZBRA 2HG4A 1GMWA 1GXLA 4JOUA 1V9OA 5LJ3Y 2RS2A 4Q45A 1HKAA 5HANA 2N7YA 2OEJA 4IOAQ 4CTAA 4K2JA 3QMQA 3MCSA 1BQXA 4LQ9A 2MPUA 2RH3A 5KFUA 4YS2A 4K4VA 1HBNB 1VI7A 1CQNA 4USTA 3K89A 1VS3A 1Q7LB 3CDWA 4G1IA 4N8NA 3GIKA 3FBCA 1S0VA 4YB6A 2R8GA 2R9LA 1KRPA 2K7JA 3FEYB 3Q89A 1NSPA 1G4CA 3I0RB 1FKOA 2ZD1A 4MIBA 4CYUB 1OSDA 3K5LA 1H2UX 3EZUA 3I0SB 9ATCB 3LGMA 4IFYB 1CJVA 4ZPBA 4JI7J 2MYFA 3GU0A 4ED5A 2HS4A 5A6PA 2MZQA 3M05A 3UNYA 5C42B 3G8SA 2U1AA 1I94J 4DR3F 2DRBA 1K73T 4YB1P 2GX8A 2CPHA 3UE2A 1ACMB 2Z8QA 2NS1B 4ATNA 4LIWA 4WU3A 3PCOB 3BBBA 1YKWA 1NXIA 2ZKTA 2FY1A 3P4UB 2CJXB 3W5YA 3UW1A 2ROGA 2GIFA 2AWZA 2WOMA 3AFGA 2HGNA 1FCAA 3M8QA 5CYMA 4AQYF 2OMOA 2DK2A 4YY3F 2OKQA 1QVGR 2PGCA 5D77A 4B3MJ 2GVDA 2CRLA 3EPGA 2H4YB 1IKYB 4QW9A 3T9ZA 1U1NA 4OJHA 3CF5Q 4EEYA 5L1KA 1RBAA 2Q6CA 2R2TA 1XN9A 1Z2LA 2E5LF 2EBEA 3CC7S 4X4TA 4IO9Q 1YRXA 3PG9A 1Q1KA 1SVDA 2GQQA 3IC1A 2LP4A 3X3UA 2VQFF 2GNKA 1RT4B 3F56A 3OSPA 1WG5A 2BABA 3O2IA 5K8MA 2IVMA 2LU1A 4CLZA 2AJ1A 2PMHA 4KFBB 4M5HA 1PC5A 4DR5J 4DQPA 4LF5J 4F36A 2HURA 1Z2ZA 2FJEB 3ETOA 4Y34A 1FD8A 1RISA 2HBRB 2VOOA 5IQQA 4J9UE 3MR2A 1P8GA 4NPOA 3FFIB 4P7TA 1UL3A 1U48A 1BUXA 5IS2A 3C15A 3EM1A 1YJ9S 2DGVA 3M30B 1HNZF 3JSYA 2MZTA 2M9KA 3CO9A 2OPPA 3HULA 4DPOA 3MM7B 1FF2A 4KY3A 2ZH3A 2IM3A 5HAOA 3PW2A 1JJ4A 2HNZB 1KLNA 2W9CA 2W7OA
chains in the Genus database with same CATH topology
4H4OA 2IFXA 3R5CA 1ZM2A 1WI8A 4TQRA 2K2PA 2FHKA 3OFHA 4K5RA 3CDUA 1DTTA 3FQKA 4ZP8A 5C42A 2IBKA 3SFUA 2GGPA 3I55S 5C25A 1HARA 1XMOF 2CPJA 4DSKA 1C1BA 2YQ3A 2CFXA 5KG2A 3D28A 2HVHA 4PXEA 4XIUA 5IXUA 3RB4A 3N01A 1UJ5A 5K8PA 1NK5A 2VKRA 2KHDA 3CCLS 2JJ4D 4I6YA 3J7YI 5GAHU 1N5YB 1QUPA 1Q8LA 4ZP7A 3LAMA 2OSRA 4J9LA 1LW0B 2VBZA 3DHXA 1MU2A 5DLFA 1DBDA 4A8FA 3KNGA 3DDNA 2J6SA 5B09A 3NMAA 5EGYA 4Q7AA 4ZPCA 5KFPA 5A0YA 3V6DA 1RTJA 1YQHA 2L41A 1M5VC 1SL0A 1H3DA 1U6ZA 3OXGA 5F8NA 2R7UA 2ZHAA 3BB5A 5DETA 1RAJA 3H5UA 3W7BA 4ALZA 2Y0SD 4EUVA 4DL3A 2ZH8A 2X1AA 1HW9A 4DS5A 2GJ2A 2YKOA 4EFAC 3B82A 5KOWA 3IRXA 1BY9A 2MSSA 1FE0A 4ETXA 2AGOA 1P9QC 1QAJA 4J37A 1FTRA 2PEHA 2DR7A 2KVIA 3BO2A 1KN6A 3PX6A 3DLKA 2EK1A 4E8UA 3DLLQ 2DNQA 4JV1A 4QOTA 3LOUA 4RW6B 1U45A 2OO4A 1LWCA 2HNYB 5MAOA 1ZM3A 1RKIA 1KQGB 1QLNA 2MQLA 1UJ4A 4C8NA 3RAQA 1OS5A 2K7KA 4I67A 2KTQA 5K8NA 1QAXA 1YIJS 1NK0A 4QWDA 2ZJPQ 3K57A 4QWAA 3FMWA 4MKYA 2GO8A 3QWUA 3GYXB 3CEDA 5EWFA 1RWUA 1VFJA 2NREA 1FRIA 2XBPA 3TA2A 3UCGA 3CWJA 3DMJA 5KFHA 4J9SA 3G86A 3ISND 3Q8QB 3QO9B 3BDPA 4RUHA 3AQPA 1P6TA 4CTAB 5DDPC 1S9FA 3C2PA 1VC5A 2CVEA 2XY5A 2D3ZA 4C0BA 3EZ5A 1DAXA 2RU3A 2GQCA 1CLFA 3Q24A 1C4AA 1XR7A 4PXCA 1CC7A 2BANB 3DU5A 1MMDA 1HBOB 2FB0A 1O5JA 2BZ2A 2QA2A 3SSRA 2F1FA 2QSWA 2KXHA 2MQPA 3IXQA 4NL5A 4E98A 5AE1A 1T02A 2LXIA 2J8AA 2RRBA 2IM0A 4F4YA 4CT8A 3HXMA 1FA0A 1FK9A 4FXWA 4PG6A 5F3ZA 3CD7A 4TLQA 3TAMA 4X4PA 4OHYA 1G7CB 4OX9F 4JI0F 1X4DA 3RB0A 1WG4A 4RWWA 1QTMA 2R7TA 2NUHA 3FSXA 2ZDOA 2E1CA 1JWWA 4FS1A 1D9FA 4BWMA 1TKZB 3M8SA 1R8BA 3K5MA 1RYRA 2E29A 2JC1A 1H0HB 1TVRA 3KLFA 2ZNZA 3C6UA 4CZCA 3WC2A 4DG1B 1FDNA 2K1RB 4LF9F 3NLCA 5AXKA 3OVBA 2AP6A 2EI5A 4BHQA 3V4IB 3MM9A 1TAQA 1FNXH 4FF1A 1BQNA 5GMKa 3MXHP 2W4DA 2GA7A 3PJXA 2P5VA 1M5PC 2ZBCA 4H54A 4ECZA 3D0IE 3BZQA 4X4VA 1FEHA 1WELA 2CYYA 2K3KA 5IM0B 2P6SA 5FLXY 5C24A 3R5DA 2E5HA 2BA9A 5E3PA 5C5JA 3TAPA 2DCLA 2N3LA 3BREA 1VRTA 4J9KA 2C3UA 2RVJA 2IMOA 4V19X 1YVFA 2XULA 4IRDA 4OI1A 2DBBA 2GCFA 1FKOB 3CGIA 1S0NA 2BXJA 1VQSA 2RIJA 3MTJA 2JFDA 2XI2A 1JJHA 1V3SA 3G6ES 1U1RA 2MZ1A 1C0UA 2FJAB 5D4NA 5EWGA 4YR3A 4EYIB 2HVIA 4C3KA 3MR5A 3NMRA 5HO4A 4C97A 2RS8A 1TKXB 1FERA 2Q3PA 2LYVA 2OFHX 3OTDA 4NA2A 2N4DA 4FF2A 2IRXA 1QE1B 2HHVA 1HNWF 4HHJA 3SYZA 2DIVA 1HFEL 2XO7A 5B0FA 4RU9A 1TL4A 2VPXB 3I96A 4K5SA 3BSCA 1YJVA 2Z2MA 2XMJA 2KHCA 2M5YA 2FTRA 2RF2A 2PE8A 3AHPA 4QJVA 3MUTP 3VQSA 2M8DB 1HD1A 2GFFA 1KTVA 1U24A 1YSJA 2RDIA 1N88A 2YWHA 4QR0A 3M30A 4WYLA 3DI6A 3T6JA 5DDRC 2FHJA 5A8WA 2IAJB 2CPIA 2D3UA 1RT2A 5KG3A 3PX0A 1XWLA 2F40A 2JEGA 5KG5A 1YRTA 1CC8A 5HP1B 3MM7A 1N0VC 4LF8F 5AXLA 4HDGA 1T3NA 1TL3A 2I5JA 1IKXA 2WB4A 3N5FA 3CCQS 5F8IA 4DV4F 5DG9A 1RK8A 3IBWA 3A8EA 2Y1IA 3MEEA 2EBGA 2E1MC 3HVTB 4RW8A 3FEZA 4GC6A 5A8RA 2LDIA 2KG1A 1R8PA 5LMUF 4I69A 4OX8A 2FLOA 1HMVB 1IN0A 5ITHA 3H40A 4K4SA 5L8RC 2FC9A 3EXYA 1X5SA 2WOMB 3T19A 3DLGA 3ZZUA 2LXFA 1F5CA 3MPWA 1K0TA 4A8XA 4QYZJ 3KK2B 4LVNP 5T14A 2M52A 5F0WA 3RBDA 1XMBA 3D1OA 1KVIA 5CYMB 2VPWB 4V19J 5ADZA 5F8HA 5KT2A 1G2EA 2DHSA 3N6LA 1C2PA 3M2RB 1Y3JA 2RNEA 3H5XA 1WHVA 2ZOGA 1R3NA 2DD8S 5BYRA 4B3OA 1C1CB 2BYCA 2I1RA 2DGTA 4FPRA 1SJ4P 3Q0AA 4DSFA 4C8LA 1O8BA 1X4BA 3PEJA 1T3OA 2VZ9A 2KN4A 3CCZA 4X66F 4LT6A 1WF0A 4WXOA 2R4FA 4ED2A 2FLLA 5AE3A 1JLAA 2W7AA 2NSBA 5THWA 1NB7A 4CO4A 1H2VZ 4ZCMA 3DM2A 5H9FJ 1N5SA 3LP2B 5EUHA 2B4UA 2UUCF 5KT3A 2O3DA 4U7CA 1EETA 5KFWA 5CA5A 4CI0B 2IJFA 2IRUA 3OTEA 5CH7B 1K1SA 4BC9A 4DR1F 5LSRA 2Z0GA 2HHSA 5E5NA 4IR1A 4DV2F 1N4LA 1BLUA 4KQZA 3CMAS 2FJXA 3HF5A 1S1UA 3HKWA 4RW6A 1LFPA 2HNYA 3OXFA 1XMQF 1LK5A 3KK1A 1UVIA 1VLYA 4ICLB 2AJ0A 4DL2A 4F67A 2HW3A 1A6LA 3OSNA 3Q22A 4CO5A 3U1NA 4ID5B 4NCAA 2V94A 4G6VB 4ZPTR 1GTHA 3IWXA 1SV5B 4ILLA 1O0PA 1CQMA 2BV3A 4ED1A 5DM7Q 5HBMB 2BQ3A 1IBKF 4ECTA 2HWIA 3FQLA 1UVNA 3I32A 2HQIA 3ZZZA 4IR9A 4Q44A 4Q8EA 1QY7A 2PC6A 1QSSA 4MFBA 3O44A 5B7WA 4K4YA 3H25A 2XB2D 2FVQA 4WZQA 2PFFB 3HHLB 3HVWA 1S1XB 2N4CA 1HYSB 3DXBA 3JTOA 3AH6A 4RW7A 2MJUA 2L9NA 2J7WA 1HBOA 1REVB 2RB7A 2HS0A 4PR6A 2MQOA 4LUBA 4P6QA 1X5OA 3M6UA 2I0XA 2NSCA 2BQUA 1VK3A 2VG5B 4FP9A 5CYQA 4ECXA 2MZJA 4LSLB 1T03A 1FESA 2DCUB 3MFHA 3FZ2A 1YBAA 4OZLA 1N33F 1WTBA 3BEGB 3GV7B 3GIMA 4RW9A 3I4HX 3O1LA 2VC0A 4WFBQ 3DGPA 2VQEF 1R6YA 2WTFA 4O3PA 1HBUB 3MMBA 3BO4A 4QU7A 3J7YU 1Q8IA 1WACA 2X1GA 3DRPA 4KHRA 2EFOA 4O4GB 1FXDA 3M8PA 4M95A 4QIFA 1XC9A 3PZPA 3NG8A 4GKJF 4PQAA 2DO0A 4DG1A 3FRZA 2KM8C 1U1LA 4ERDA 1LW2A 3V4IA 7FD1A 3LP0B 2OPQA 2JZ5A 5CZVA 4HI1A 2DRAA 1U2FA 1GH8A 3EXCX 1S79A 1KQKA 1QVFR 1H7WA 2ZOMA 3NCQA 2EK6A 2MKIA 2LCWA 3RTVA 4MIAA 4NZ6A 2J0WA 2RKIA 4URGA 1VQKS 1URNA 3RRGA 3DC2A 1FKPB 3CT9A 1F5BA 2C3MA 3ZZTA 4B3SF 3FRYA 2LXUA 4XPCA 1VQ6S 4N56A 4DFKA 2L48A 5EDWA 2W9CB 3MEDA 5BJRA 4TXSA 2YKNA 1QE1A 3GIIA 1X4FA 2MY7A 4Z37A 3HHDA 4LJMA 1U1KA 2GGPB 4YR0A 4A47A 3EX7B 3GR1A 2OIHA 3PR4A 3T5LA 1C1BB 1VC6A 2LDYA 2MHNA 4ZP6A 4DL5A 2YKMA 3I5AA 2DNKA 1H7XA 1Y5NB 2VBYA 1RA6A 1VQYA 3DFEA 3O8WA 4I2QB 3W2WA 5JVGQ 2YH1A 2DO4A 4AFFA 2V0NA 3L7PA 4GO7X 1UJ6A 3DOKB 1PSDA 4Y2IA 1S6QA 1MU2B 1ZZFA 4EGLA 1B0PA 4OMFG 2ZH2A 2OLWA 2IAJA 2WBMA 5DG8A 3V6DB 2J9DE 1RTJB 1NK9A 3TA0A 2J0XA 1K1QA 5KFDA 4QYRA 5CQGA 3MM5A 3T1AA 1KEKA 5J2PA 1M90T 2DGQA 3CJ5A 5HP1A 2AYGA 4X4OA 3CXCR 3HHNB 3KK3A 3UDCA 3KLEA 4AE5A 1FDAA 3PO5A 4P7VA 1HA1A 2O01C 3LGNA 2ASJA 2YKQA 2FVRA 4L3NA 4ZP9A 1V3ZA 3KLGA 3IRXB 2W24A 3MMAB 3ISNC 1Q8BA 2PIIA 3HK2A 2JLFA 1RKJA 3M6XA 3BGFA 3QAUA 3DLKB 3H59A 3BF4A 2C3OA 2DGWA 1DQAA 1LWCB 2D9PA 5H1SV 3QGPA 4TQSA 1FKAF 3HHLD 2WAQD 2XLIA 2ASYA 4IG0B 1VBZA 2XMMA 5B08A 3LO3A 3PX4A 2I9SA 2VG7A 3EGWB 2X3GA 2GHVC 2JFKA 2SXLA 3SQGB 2CQ2A 2P9EA 4D3GA 3I87A 3IGNA 3HJFA 2KO1A 3M2RA 2QIFA 3DMJB 4NLXA 2C3YA 5M2RA 4WJBA 4DLGA 4ZMMA 2ILYA 2MY8A 3BGUA 1UFWA 3CDAA 3FGVA 5SUHA 4LFAF 2BRKA 2KFZA 3W3SA 4OJ1A 4OX7A 3TNVA 1X4GA 2L9WA 4M63A 3OUYB 2DISA 1VBYA 4OLPA 2WRMA 1HI0P 4WFXA 2YX1A 1JK9B 3TR5A 4WIIA 1GX6A 2A3JA 3PW7A 1TKTB 5G0RA 4DV6F 3M9OB 2XMVA 4TU9A 2UVVA 2QA4S 3O5TB 5E3CA 1FK9B 2QLWA 3TAMB 3HVRA 2J76E 4I1TA 2UUAF 1F2GA 2ZITA 1APSA 2W9BA 3LF0A 4IDKA 4OI4A 3RYLA 1W25A 3AAWB 3AY0A 5K5MA 4NXNF 3HLUA 3RW7A 2ADBA 3POTB 2KXFA 4ZKAA 2CPFA 1TVRB 3RRKA 4OHWA 4NYPA 4XAKA 4DL7A 5CYJA 2RQ4A 3G71S 1NJZA 4AL7A 3N6MA 1M5HA 3MM9B 2YX4A 1BQNB 4JYAF 2HGMA 5IT0A 3H4DA 4IUFA 2PI4A 1SV5A 2D9OA 4F26A 1JLGA 2NLWA 3C8YA 1ZAVA 3HT3A 3SV4A 3GV5B 4H4MB 1FRLA 1VRTB 4A8MP 4FF3A 3MECA 2ZH9A 4HH0A 2AJ4A 2LEAA 1JLEB 2VBWA 1HWIA 5KFTA 3GZ7A 2GMLA 2PN6A 3TA1A 3P3DA 1FRXA 4EWTA 1S1XA 2MKSA 2HHPA 1HNVA 3V81B 4WXWA 4F2SA 3IA0A 1C0UB 3T9NA 4TU8A 1NH7A 5L1IA 5DRKA 4KC5A 3QJJA 3H2LA 2EFVA 4WZMA 1Y7PA 5BR8F 3JB9k 4X2BA 2J9CA 3CD5A 2CPEA 1SH3A 2XMKA 4I4BA 2ADCA 1YWXA 2BQRA 1V3RA 1JNRB 1MW7A 3CULA 4JI8F 1VQPS 1VC0A 4LSLA 4DLEA 2OD4A 4NZ0A 4M5DA 3AA8A 2OJ3A 2MSTA 1PGZA 1Q81T 1RTHA 2C3PA 2RF2B 5KT7A 1DFDA 3QWPA 3OJUA 4OL8A 1ZYQA 4Y2MA 2LVWA 4O4GA 3T1HF 4ES2A 5LSLA 5T7LA 2YNFA 4Y6IA 4IRCA 4X65F 3VZHA 3DI6B 3N6NA 2CJ9A 2XHWA 4OQJA 5A8WB 3KHGA 4ILRA 3ITHA 1RT2B 3CCMS 2ZZMA 3QPIA 2ZOFA 2M70A 2PSZA 3M4XA 4NLSA 2C2DA 2FJBB 1S9GA 3E01A 3NCPA 4ES3A 4B9SA 2W7PA 3VCDA 2KJWA 3OL7A 1FHTA 1TL3B 1IKXB 3DN9A 4NZ7A 1JLQA 2ZJQQ 3OTOF 2JC0A 3MEEB 2HGLA 2DR8A 2UP1A 4RW8B 3RB6A 4URQU 5A8RB 2VFVA 2R2RA 1YJNS 4RLEA 2J7UA 1K9MT 4FS2A 2EKYA 2NYIA 3H5SA 4WE1B 5J1PA 1O51A 3UR3C 3QAEA 2OTJS 1UW4A 5K14A 4LMZA 2R7XA 1N52B 2DJWA 3I9ZA 5I3QA 3HDSA 3O6QA 5KG7A 3GFXA 3DLGB 4B3RF 2E1AA 3B78A 3ENVA 1IQZA 2VPZB 5I4MA 4LSNA 2AW0A 4XO0A 4JI6F 4OI6A 1UVJA 2OPSA 4X4QA 1X5TA 3CC4S 5F9NA 3TUZC 3OVAA 2AGQA 2VV5A 1Y4ZB 1NK7A 1U8SA 1A9NB 3WDOA 3SEOA 1D9AA 1IM4A 3KNAA 4KGMA 1TFWA 4GKKF 1VHFA 3QYYA 3ZZPA 4CQ1A 2PA8D 1R89A 3CC2S 2VD3A 4I2QA 4B3OB 3VR1A 3I4PA 1AROP 1JLCB 1B64A 2PO4A 4PWDA 2VH7A 3DOKA 3HFKA 3T6BA 5I3PA 4NLYA 2RUGA 2RD5C 4HYKA 2M2BA 4MH8A 4RUCA 2Z2LA 1SBRA 4QWBA 4C7QA 3HM9A 4ITSA 1U2RA 4X4NA 3SCLE 2W25A 1AFJA 3BN4A 3PRDA 3UWTA 1JLAB 1C0TA 3N4WA 4TLRA 3