4CO2A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
total genus 21
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co2A00
4CO2A 2XZWA 2J9CA 5D4OA 1XK8A 4D3GA 5D4PA 1PILA 4D3HA 1NZAA 2XULA 1H3DA 4YB6A 2RD5C 4NYOA 3NCPA 1O5JA 4Y6IA 3T9ZA 1NAQA 2EG1A 2V5HG 5D4LA 1P1LA 1Q1KA 2E66A 4ZK7M 3AH6A 4IYQA 4CO1A 3NCRA 4YB7A 1NH7A 2GX8A 1UMJA 2XBPA 2GW8A 3AA8A 4CO4A 2CZ4A 4RWXA 4RLEA 4OZLA 2VD3A 1GNKA 4USJC 3O5TB 4OZJA 1V3SA 3BZQA 3AHPA 3GSDA 4R25A 4CNZA 3M05A 2O67A 5D4NA 2ZFHA 3TA0A 1O51A 4AFFA 4CNYA 2PIIA 4RX6A 3X3UA 3O8WA 3TA1A 4USHA 4NYPA 4CO3A 1NH8A 1V9OA 1VHFA 3AA9A 2GNKA 3MHYA 1UKUA 4C3MA 1V6HA 3NCQA 5DRKA 2O66A 2NS1B 4RWWA 4WK3A 2NUHA 3OPKA 3L7PA 2J9EA 4CO5A 1HWUA 5L9NA 1VFJA 1UFLA 4CO0A 2JJ4D 3HLUA 3N5BA 4C3LA 4E98A 1V3RA 3DFEA 1OSCA 4USIA 1KR4A 4WK1A 2J9DE 4Y65A 2J9DA 2XG8A 2EG2A 1QY7A 4YB5A 3LF0A 2NUUG 4C3KA 1J2VA 2Z0GA 5DS7A 1UL3A 3CE8A 2DCLA 4OZNA 3TA2A 2ZOMA
chains in the Genus database with same CATH superfamily
1NDCA 2YKOA 3SEOA 4ES1A 5AXNA 1HQUB 3JTPA 1W2IA 2A2DA 1PGZA 3MR5A 2XTJP 2R2SA 2GAHC 1S9EA 1P6TA 4KKOA 4CH7A 3MM6B 1BY9A 5F3TA 2VBYA 4M95A 1EP4A 5KFGA 3TP2A 2JLEA 4ZVRB 2R4FA 2CQDA 1XNRJ 1ZTWA 3OL8A 4NEYA 3RW7A 1CJUA 4X64F 2GIRA 3LPYA 1ZH5A 5A2QU 1RWMB 3W5ZA 4O4RA 5FJ4A 1NPRA 2DXEA 2IA6A 2RMLA 3UW1A 2BV3A 1JIHA 2GVZB 3K57A 3AXMA 1V3RA 1YRTA 2YNGB 2H5EA 3CJKA 4CCHA 4Q7AA 4YR2A 3M8PA 2Y0BB 4K4VA 1DAXA 5H9FJ 4IG0A 1SCJB 3ZTRA 1KQSR 2M0GB 4RU9A 2J7KA 1CJVB 4UY8T 3ZNJ1 2GQCA 1HWJA 5C7PA 2XY7A 1F5BA 1Y9OA 5KFEA 4ES2A 2EC0A 2UV8G 1RT1A 2G2ZA 4PCQA 2HAFA 4X62J 2Z8QA 2OFGX 4G3IA 1IUJA 3QLHA 5B0AA 1XN9A 4DX8H 1IN0A 1WNEA 3MD3A 2A1BA 4WYLA 3CCZA 3LGHA 2L9WA 3GB0A 3N9UC 4F4XA 1VBKA 3JAMU 3NXZA 1K1SA 4EFAC 5H9EK 1D09B 1RTJB 1X4GA 3NWGA 3NP5A 3UDEA 5BR8J 2HFOA 2K7KA 2QLJB 5GAEU 1NK0A 2V8HA 3Q24A 4K4WA 2BMBA 3V4IA 3ENWA 2OTJS 5L9NA 4O3OA 2KKHA 2YVSA 4DV2J 3FKBA 2O3DA 1UVNA 1PIEA 2R2TA 1ZAWA 1RADB 5KG0A 2V4RA 1HNVA 2YNIB 1NHVA 3WIUA 5J2PA 4K59A 2IC3B 1IQZA 2R42A 3KLGB 1PKUA 3TI0A 4FVCA 3NLCA 3BV8A 1FESA 2CJAA 1TFWA 2UVRA 2CPFA 1S9FA 1KOOA 5D15A 4P72A 4C6AA 2X51A 1C0UA 4ECYA 1YZ7A 5C25A 1LWCB 5KG7A 1XMQJ 1YJNS 1RT6B 4ZHRA 4PXEA 2E7XA 1IR0A 5HAOA 1A6LA 4LF6F 4DV7J 4A8WA 4J9VA 2BW2A 3PW5A 2BJ1A 1VBYA 5L1JA 5KT5A 1EKRA 3G82B 2MGZA 5F8GA 2XO7A 2IBOA 3BR9A 3W63A 1XQIA 1X5SA 4X4QA 1Y5NB 4RW6B 2YNFA 3TO8A 5DLFA 1RB0A 2HHHF 4QU6A 2UXCF 4P73A 1QAIA 1LFWA 2C3OA 1DTQA 1T9UA 2ZH8A 5M2PA 1H2VZ 1URRA 2E7VA 3UVJB 4NPOA 5EUHA 3W2VA 1MMDA 2B3TB 2W9CB 2CQ3A 4W90B 1K44A 2KI2A 3NKYA 1U48A 3EVWA 1IKYB 2Y9HA 1KHVA 2HWTA 2ILYA 3BH6B 4ZJQA 1GK8A 3PJXA 5IT0A 3T1HF 5KFDA 4YP3A 5HLFB 4JI3F 1S76D 4RW8B 1B0TA 2QYCA 4ZVPB 5F9NA 1CQMA 4URQU 3VHQA 2V2QA 3PACA 3HJVA 1HLWA 1EETB 1Q86T 2RDJA 2V67A 1FKOB 3FSXA 1M1HA 2MKKA 2J0QD 2NXNA 2KXNB 3R7SB 4Y3CA 3NNCA 5FIIA 4Y2IA 2CPJA 4TVAB 2H5IB 4BHQA 2CFXA 1JLEA 1VISA 1YJRA 1X5TA 4U95A 4HVZA 1LK5A 1RUSA 3BR8A 1WHWA 2ZM6F 4E2FB 3ZTOA 3HI9A 2CQHA 4EYIB 1LQ9A 1LWEB 2QG9B 4I64A 5KFTA 4ECVA 2DO0A 4DLGA 2LYVA 2ROEA 4CYUA 4MJKA 4CTAA 3OBIA 3QT8A 1WC1A 1D8ZA 2HHVA 3CCQS 1TFYA 4L73A 1S59A 2PMHA 2YX4A 3WX8A 4DV1F 4MIWA 3IXQA 5HJYA 1NDKA 3QMQA 3M9OB 3G6ES 2EC2A 2GV1A 5H9EJ 2BDPA 3S7RA 5DG7A 4ALZA 2GW8A 5L8RC 5HO4A 1CQNA 4IG3A 2CPHA 2MY8A 3MD1A 1S1TA 2DNMA 5LL6d 1TKTA 4I6AA 3M6VA 3MWBA 3A3PB 3AJDA 4YHHF 3GIKA 4FS1A 2CJKA 5C2GA 3GCXP 1U6ZA 2V8PA 3RYLA 3IO1A 2MSSA 3JSMB 3TANA 4C3LA 3IS9A 2R8GA 3EICA 3SSRA 3AB4B 2JFKA 2EEYA 2FHMA 1AB8A 1LW2A 4FPRA 1HHQA 4KH0B 1PC5A 1NDPA 3WDOA 1Q78A 3QAUA 2BUNA 2X1AA 2RD5C 5K8PA 3CCJS 3C8YA 1T95A 2N7CA 2DR9A 3SYZA 2FPHX 4IFYB 3G6YA 2RRAA 2C2KB 4GRSA 3PYFA 2RIJA 4RLEA 3PFOA 4M63A 4OZJA 2YKPA 3PX4A 2FZCB 3T41A 4YN3B 4DSLA 4LQ3A 2DIVA 2K3IA 2XZTB 1KFDA 4TU9A 2R2UA 1WTFA 5KG2A 1N32F 3VALA 1REVA 2ZH5A 1FDBA 2FJXA 1LW0A 2GC8A 3TAMA 4QW8A 2BVZA 3NNAA 3MR3A 1U6BA 2WK4A 1PBUA 2MDAA 1RAJA 1U24A 4K8RA 3TX8A 4WCEQ 1TV6A 3VV2B 2XS2A 3ZNUA 1IBLJ 3MR7A 5KFQA 1N48A 3N0VA 3ZO7A 1RSCA 4A48A 4F4AA 2IVYA 3H40A 3KLHB 3DLLQ 1MN9A 1S5ZA 4JV0A 1TK5A 1ZM2A 4D3GA 5LJ3Y 1SJ1A 5A8WA 2ZHBA 4X66F 3W5XA 3KOAA 1SL0A 1EIYB 2CJBA 1TKXA 1EB0A 2ASDA 1RHMB 1GXTA 3MR2A 1M90T 3EGNA 3BO2A 1JXVA 3KLEB 2AGQA 3VCDA 2CA9A 4C8ZA 1N5VA 4A8YA 4IRKA 4NLOA 3HX9A 2WHOA 1LK7A 1MMLA 2MQPA 4I7FA 2DH9A 1M5SA 2HHUA 3M1VA 2RB7A 3NMRA 3TVYA 2R7XA 3H0PA 4CNYA 3QRQA 2Q1LA 1JLCA 4DR3F 3R2CJ 3C6TB 4FBUA 3ZTQA 3CIMA 3OUYA 3MFIA 4WTYA 3L7PA 1NBEB 2CWKA 3M8ZA 1QD1A 5RUBA 3SV3A 2F40A 4EWTA 4L3KA 2BJ8A 2Z0GA 4DV3F 1HBMB 2B9YA 2BRKA 5HP1A 2GGPA 4USTA 2P9CA 1MW7A 1ZM3A 4ZA1A 3RG6A 4FF4A 1D3WA 2HNDB 3UNGC 2L9DA 3EX7B 5GAHI 3TQ1A 1SQFA 1CJTB 3KDNA 1UW4A 2ZNYA 3IFEA 2YQ0A 4ETZA 4WYWA 4RNNA 1FERA 5LXYA 1GNKA 4J9UE 3BB5A 4RNMA 3D3CJ 1OS5A 2YPYA 4EK2A 3F44A 1MG7A 2DGQA 3Q8UA 4ZVTB 2LLZA 3SBMA 4DR6J 3KLVA 4KGZB 2V9WA 2CZ9A 2IVMA 4ZVOB 3J81j 4L72B 3MXHP 1KLNA 1O8BA 3J81Y 4YS2A 3OVSA 1Q4RA 2C22A 1RDRA 4IQMA 2LVWA 2P6TA 4B3RF 1H3DA 3CDBA 2CVIA 3QIPA 2QEXS 1DZ5A 4ANCA 3SCJE 2YQ3A 4NOHA 4Y2KA 2MLXA 4DV3J 2MQLA 4C0HA 3FZBA 4KGXB 4JI4F 2VHGA 3NGRA 4NLUA 1VIXA 5L9XA 1XMOJ 2Z57B 3A13A 3VWSA 2AWZA 5F8LA 1EAYC 4GO7X 3EUNA 4LSZB 1R8CA 1AYEA 3LH2S 1RT4A 3GYNA 2GQ2A 4E0DA 4C8MA 4LF5F 1AUSL 2WW8A 4LF9F 2KDOA 2G0CA 3AXKA 3MURP 1FTCA 5E5NA 3Q8YA 2E5GA 3DRPA 3PM9A 4V19J 4C8KA 4IO9Q 2UU9F 4RW7B 3ZC4A 3C15A 4CWBA 2E29A 3GIRA 1D0EA 3NGSA 1JJHA 4WP9A 2V6AA 3DM2B 4KV8A 4Q8EA 4ED5A 3W8PA 3DOMB 5MLCV 4O0IA 2DEJA 2M2BA 3ZFVA 2L41A 2VONA 3UN3A 1BWVA 2OSQA 1C1CA 3EWGA 3JS9A 2EG1A 3H4BA 3DRSA 3V6DA 3ZZUA 1WG5A 3R1HA 3PDNA 3TX0A 3KJVA 4WFBQ 4WZMA 3MMAB 2I9SA 4DV6F 4YR0A 4B3RJ 1FJCA 1IM4A 1Y0HA 2RHQB 4AXJA 4OZ1A 2RNEA 4M5JA 3A8IA 4IDKB 3MM7A 1O51A 3OL6A 1L3KA 2ASLA 2EWHA 4F02A 5ETQA 1RTZA 3RGIA 4C7QA 2IJNA 1WDTA 3NGKA 4TY8B 3ITHB 4TY9A 2HG4A 4OYPA 3HLUA 1S1XB 3K5PA 4KPYA 5KFFA 1ZPVA 4WIIA 3LALA 2GHWA 2HYIB 2JRSA 3ZZYA 3KHLA 1F3VA 4MKYA 2M4MA 1SXLA 1U02A 3ETOA 2OH2A 2R7RA 5B0FA 2RE1A 1WF1A 1QUVA 3O44A 4DV5F 5KFCA 3HHLB 2DCUB 2FZGB 5IWAF 4P9SA 2DNRA 1NH7A 3QFWA 1FA0A 3IM8A 3UR0A 2Z2MA 1RAEB 4W4MA 1ZZNA 5HN0A 2HHTA 1TUGB 4ERDA 3QZ8A 4AUKA 5D0HA 2JX2A 1UTAA 1YVFA 3KK2B 2A6MA 4MK7A 3CDAA 2UV8A 3JQMA 4BC9A 3LP2A 3R5JB 4QIWD 2UUCJ 3QT7A 2IIHA 4DUYF 2OO4A 2BE2B 4AT1B 2WSEC 1FNOA 1KTVA 4HH0A 1T9YA 3CF5Q 2HEKA 3PHTA 2E1AA 2K1RA 3TUJC 5DQHA 2NSBA 2WAQD 7FD1A 3VGVA 1ZTTA 4QBUA 1F2GA 1Z2ZA 4DSFA 3WBZA 4LRBA 2XLIA 2RT3A 4JI5J 1R89A 1VQLS 1YSJA 4ZP6A 1S10A 2KU7A 1JB0C 3TA2A 3D66A 4CO2A 3UCGA 2FC8A 1VQPS 4LSLA 4H54A 2JVOA 3MUMP 1R43A 5B09A 1ZAVA 4ZIVA 3F73A 2MHEA 2DK2A 3IRXA 3KUEA 5B0CA 4RWXA 1RT2A 1TL5A 1SJRA 4JV2A 5E3PA 2E5JA 4NLYA 4QWEA 2IMOA 2FDNA 1IR2A 1NU4A 4CNZA 4PG4A 2HFSA 3SFUA 3ISZA 2G1HA 4HHJA 2V8VA 4MAKA 3RBDA 3R3TA 1Q8KA 1E6VB 4DPXA 5DRKA 1GH8A 1G1XA 2OPSB 4WJBA 1V5VA 2RF2A 4C0OC 3D67A 1EZZB 5DM6Q 3MTJA 4P2SA 1PJ7A 2XMJA 2J5AA 3SIPB 1AXQA 2R8JA 3CCTA 3QQCD 3VVUA 3ULHA 1QY7A 1FHTA 4DUYJ 2Z2YB 4QR1A 5KFPA 2VJVA 3E01B 2G2YA 1S1UA 1RLDA 1MN7A 2DKOB 2ATCB 3MPYA 2HFVA 3D5MA 2HVEA 2HVIA 1IVZA 4UT4A 2BRLA 4DR1J 5AE1A 4GKJJ 1AROP 2CDRB 4DR2J 3MEEA 2QLXA 1TK8A 4LJMA 1ZM4A 2DHXA 3CJ5A 5BYRA 1WSVA 4ZS6A 4RBTA 2MZRA 2QZ8A 3HZGA 3FBEA 2DGXA 1OWXA 5G4DA 2RS2A 2J6TA 1QM9A 4FYXB 3M30A 2WVDA 3H5SA 1F2HA 3RW6A 2AF6A 5ETVA 2ROPA 2C2ZB 3G71S 1KS2A 1VQ7S 2CZVC 4MKVA 1KBRA 2RS8A 4DQPA 2HHQA 1TL4A 1ZYQA 4CLWA 4KB7A 1VQ5S 3RBEA 3UO0A 5E41A 5F8MA 4YUDA 2V50A 3N79A 3EJMA 1LWXA 3Q8QB 2W25A 4P6QA 5IV4A 5SZTA 1DRZA 1U1QA 2WZ1A 1TL3B 1BQXA 1RWVB 8AT1B 4QU7A 3FVYA 5HI7A 4KBIA 1KR4A 5E3CA 2W4PA 4JUZA 2RH3A 3B54A 1L3UA 3D6HB 1N4LA 1H2UX 2YWEA 4F2RA 4DZDA 5C42A 1IM6A 2P9EA 4ZN3A 4D3HA 5KFMA 1KDNA 4CLTA 3LP0A 4M5MA 3LWMA 3TJAA 4UOHA 3J7Z5 1U1MA 4ED3A 1X4FA 3IG1B 3KLFA 2MZ1A 4U67Q 2C2RA 4JV5F 1WF0A 3DDNA 2AZ1A 3ADAC 3QIDA 2HIYA 1RBLA 4LF1A 4OI2A 2VOOA 1FWKA 4I2QA 3IR5B 3I5AA 3W5YA 2BOPA 3TW0A 1LXNA 2V2KA 1UFKA 2HQ3A 2AV5A 4Q2LA 4JV1A 4KKOB 2DGSA 1YIJS 2C2DA 2ZHOA 3BKFA 2IHR1 3GLJA 4U8VA 5EWEA 5ETMA 2RHSB 4CLZA 4YY3J 5D3GA 4USVA 2V4JA 1S77D 2X3GA 2E5LJ 1FEEA 2EG2A 1C4AA 4DV0J 1VJQA 2V2VA 1Q95G 4DCJB 2ZDPA 2V8GA 3FFIA 3PHEA 4NE9C 1RZMA 4L3NA 3GJSB 4FNHA 4HI2A 2PMWA 1VQMS 4JI2F 1TTHB 5IOLA 2CDQA 5G0RA 5CZVA 3UE2A 3PJ9A 3KK1B 1TKDA 3SQGA 1FXRA 1M5HA 2Y3YA 5LT5A 3DLEB 3AHPA 4K4SA 4ZPWR 1E6YA 4L74A 1NRKA 2FQQB 1FKPA 2CQGA 2WVEA 2D3ZA 3DLGB 3GILA 5J2MA 1IKWA 3DYAB 1JJ2R 4HYKA 3R5BA 2HQDA 4TKTA 4CO0A 5J2QA 4RUCA 1HIYA 1DQAA 1VIOA 5B0BA 2J9DE 2EI5A 1N8RT 3EPIA 2PEBA 4WBFA 4F3QA 5KFRA 5D8HB 2V34A 1S0OA 3K7RA 2PD1A 4HTJA 2U1AA 1NK9A 4L6V3 3D1HA 4RW9B 4EEYA 2ZUGA 1NUEA 1Q1KA 2L3MA 2WONA 4HHUA 1RHJB 2B4VA 4IRDA 3FCWA 4RNHA 2DNZA 2XSJB 2FLOA 4KHRA 2MXYA 2MY7A 1NCLA 2I2YA 2F65A 4QWCA 4MYTA 5J2PB 2VASA 4N76A 3OJUA 4ED8A 2R7OA 3SQOP 1VHIA 1K9MT 4KFBB 4BS2A 1WHVA 1UFWA 2ZJQQ 5HQLA 4OYBA 1FVQA 5C25B 1DJ0A 1I5OB 3ETMA 1CC7A 1TVRA 4JI7F 4LRCA 1QAYA 2XMUA 4B17A 3G8TA 2MKSA 1X4HA 1WC6A 1SKUB 3CDUA 3DXBA 3LA0A 3RJMB 3CEDA 2N3LA 4LUBA 3T5HA 2RVJA 2R7TA 3F0NA 1XR5A 1S1WB 1VQ4S 4FBTA 2OELA 1K1QA 5HMYA 2HNZA 4ZN1A 3B4MA 3MCOA 4BLGA 2PT0A 3G86A 1S7HA 2EFGA 4B3OA 4HACB 2BR0A 5E2QA 2JEFA 1FO1A 4ZIWA 1DTQB 3WHIA 1HNIB 4JP8A 1RAIB 4ZLPA 4NA3A 1S1VB 3KWMA 3OJSA 4DG1B 2YPZA 4WFXA 2DRAA 3I5BA 3G8SA 3ICLA 2QSFA 1V5IB 2CPZA 2X1BA 2VPXB 1H6KX 3MGJA 5K14A 2GMHA 1GXLA 5B08A 2UUBJ 1FRJA 4ENOA 3HXMA 4PXCA 4RWWA 4ZVFA 3W9HA 1HHTP 1N33J 1MWYA 5KFHA 1U47A 2FHJD 5DO2A 1EX8A 1U49A 3GFZA 2KXFA 1VRTB 1IBMF 2OLWA 1W7WA 3P5BP 1RK8A 4ZJLA 4DPUA 3ZZOA 3LWLA 3M2VA 4ICLB 1F5AA 3WQPA 1F6TA 1KLMA 1NO8A 5A8RA 2KG1A 4H4MB 3FZ2A 4ECWA 1HQEB 3CJ3A 3DHXA 2BQ3A 1KSPA 1P1TA 1N5YA 1APSA 3I87A 4B3MF 3GE9A 3C14A 1TMJA 3MTKA 8ATCB 3B8HA 2GIFA 4CIOA 2C2EA 1HWLA 3BF4A 4RPFA 2M5YA 2AYEA 4AQYF 1DQ8A 2BJ9A 5HMWA 4O3PA 3LAMA 2HFNA 4TYBA 4CM2A 3HVTA 3GIMA 4NEZA 2VOPA 2MJNA 3IC1A 4XPEA 1X7VA 4EBEA 4DSJA 1WWHA 3BPSP 2XWXA 3HZEA 2QV6A 3D0GE 5LMUF 3SCKE 3J7YU 1TKZA 3L3CA 1FJ7A 3AQPA 3QSYB 1WKKA 2LQJA 4LRDA 1FJGF 2P5VA 2QGFB 4EZ6A 4XDDA 4TLRA 2DD8S 3M8WA 4C97A 2BYCA 2KT3A 1QLNA 2AKWB 2KVQE 2ZVSA 3TJ9A 1T9VA 3IMQJ 5IT4A 3AODA 2KRRA 3NCPA 1P9QC 3HHEA 2XB2D 1X4CA 4QJVA 1LWFB 2AJ0A 3BQ0A 1L3SA 1SC1B 5F41A 3PEHA 1D9AA 5C24A 1YJTA 4ED2A 1SKSA 3NS7B 1WG4A 3MM8B 3U7JA 5ETLA 4B3MJ 1VQ8S 1UETA 4X4TA 2YKMA 1IBKJ 4ZLLA 1Q16B 5KG3A 3QO9A 4NMLA 1ZAXA 4K5RA 1P27B 3OFHA 4N8OA 4NRTA 5DGBA 1BLUA 1IR1A 4ES3A 2O1PA 3DMJB 5BYQA 1JLAB 5LMUJ 1M1KT 1R0BG 5AJ3J 2XCAA 3W2WA 2L08A 2Y8YA 3DLKB 1HPZB 3K5NA 2GMJA 3FK4A 1S4FA 5D4LA 5J1EA 3TAMB 3PRVA 2LEBA 1N5TA 1GTEA 4X4PA 3CCES 1BQNA 2Q6BA 5KFAA 3OFEA 1S6QB 2IA0A 5J1NA 4CLFA 1VBXA 1X0FA 3HHLC 2ATLA 3KMQA 3BN7A 3TUPA 3IWXA 1U1NA 5DZ6A 1SQGA 3K8VA 2UUAF 3CCVS 1SKRA 5JMNA 1N6QA 2POKA 1HQ2A 4DI6A 1LKZA 1T94A 3LQVA 1S6UA 3MCNA 4IH7A 3GG0A 1JNZB 1AA1B 2C3YA 2K8GA 3KLIB 2ZH1A 4X65J 1FD8A 2YWFA 1NSPA 2G13A 3M1VB 3OVBA 4O44A 2ZWOA 4OX8A 2KHCA 1YRUA 2C3PA 5AXLA 2DPIA 3H59A 2JEJA 4Y6IA 4DN9A 1JLQA 2RQKA 2HLUA 5FD1A 1R6VA 1S0MA 1EJ7L 1R0CB 1UPPA 2R7WA 4OYOA 2FLLA 4XIUA 4OX7A 2E1RA 4USJC 1FRMA 2D3O1 1GFWB 1RYSA 1GTHA 4R25A 1VQKS 2LECA 1VRQC 5L39A 3HKZD 1SUQA 1KKHA 1IKXA 4NYPA 3J7A1 4MFBB 1CJKB 2FHJA 2WTFA 2AIRB 4KHMA 3TZWA 5GMDA 4ZPTR 4WKYA 3O2IA 1NJZA 2DNOA 3TJ8A 4Z37A 2QLWA 3FJ2A 1X60A 3F41A 2M8HA 4U9RA 4A8MP 3ENAA 4LF8F 2BOAA 2YWKA 2ZBCA 4ECSA 2PI5A 3R6GB 3BO4A 1C4CA 4TN2A 3T1YF 4CLKA 3OV7A 3W66A 2GJFA 4F26A 1P9YA 5LMNF 5I3UA 2QFJA 1NZAA 4DUTA 2FJVA 1RT7B 2W9BA 2OMOA 1NAQA 1S12A 5HATA 2KYZA 2NYHA 3WC0A 4ID5A 4ED7A 2YWHA 2M7SA 4HH1A 3BGRB 5I4MA 3MUTP 2CPYA 1RTDA 2ALYB 5KFNA 4Y2MA 1R8HA 2HGNA 2EK6A 3AOAA 3QJJA 1WC3A 3BSCA 3TOQA 1VQYA 1VRUA 2F7VA 1TL7B 2A10A 3RR8A 2AW0A 2BJ7A 4DLEA 2I5JB 1JQGA 2HLTA 5HMZA 3ZXWA 1RLCL 4YR3A 1HYSA 2YH1A 3KJNB 1H7WA 3W1YC 2NR0A 2AQ4A 3FRYA 4WWSA 1RT4B 4B9MA 3G6XA 4GKKJ 1UL3A 3D9BA 3U1MA 3PIPQ 1JKHB 1U1LA 2LFVA 4ANEA 4OYIA 1UJ5A 2DYAA 4IFVA 2VG7B 1B0VA 3FCVA 4QWAA 4O4GB 2BJDA 2GFFA 3DDKA 1P1LA 3N5FA 2E66A 2G0JA 1H7XA 4LF8J 3C15B 4NL5A 3EDQB 5HBMB 4NXNF 2QLFB 2B8QA 2LA4A 1FK9A 2FD2A 1PJ5A 4H4OA 3BS9A 1UWAA 4V1Ak 2WSFC 1F9FA 3TARA 4C11B 2IBKA 5L1KA 4P75A 2FGOA 4ZPDA 3MMCB 3DLBA 4CRJA 1R8PA 4WU2A 2XI3A 1KNZA 1FEHA 1RWNB 2KG0A 2F8HA 3TVZA 1AZSA 1RTHB 4J9KA 2XNRA 1YRXA 4G1PA 3UDLA 4Y65A 3D28A 2ZUAA 3GP9A 4I4BA 1WUUA 2IJRA 1WACA 1XR6A 2BANB 3RZAA 3BKUA 4OJ3A 2CQCA 2VG5B 3UN2A 2DNPA 2FHKA 4FPIA 5DQGA 1J27A 3I9V9 3CCMS 3D3BJ 4Q45A 2K2PA 1VBZA 2UUWA 4LSNB 4NCGA 3T9ZA 2Q79A 3J80Y 3QWPA 3PX6A 4OL8A 4UOGA 2MYFA 4DN0A 2D9OA 2ILZA 2UXBF 3FMWA 2HHPA 3MM9B 1YKWA 3VAFA 4N7TA 4KIAA 1XNQF 1CULA 4U6PA 3V81A 2ZE2A 5HROB 4OHZA 4EBDA 2HSEB 2VDHA 3B82A 3EXCX 2A2CA 3AD9C 3KK3A 3GJRB 3C46A 2LQ9A 2AEJA 3EVOA 3EZ5A 4NLTA 1PJ6A 5B0GA 4OI3A 4YDDB 1NDLA 2VG6A 1B4SA 2MKCA 2DNLA 1WOSA 3V4MA 2F4VJ 3DU5A 4JI8F 3Q8PB 5J1PA 1HQUA 5B0EA 2DEIA 4OYZA 1TAQA 4FYVB 2CQ1A 3BSOA 3MM6A 2DNKA 4K0KJ 3MM5B 2K3KA 1MROB 1X8DA 3GR0A 4IH6A 3I0SA 1RACB 3QGGA 3NBPB 1N54B 1W25A 2GAGC 2XMTA 1RGVA 5HL7Q 4ELTA 2PFFB 1NPKA 4YDXA 2LXFA 3SDEB 5DJBA 4J9PA 3OFGA 4DOZA 2XMWA 4KAIA 1UPMB 3IRWP 3QGPA 1HHSA 4B9VA 3MDFA 3AQOA 1L3TA 1UWBB 2B56A 3AT1B 3HULA 4LSLB 1YG0A 2HMIB 2HNYB 2WRMA 2ZZMA 1RHUB 2GVZA 4USHA 1ITPA 3OT9A 3GTYX 4WP3A 5D78A 2YNGA 1GT8A 4C3MA 2VKRA 2VIHA 2C42A 4KJIA 1NKBA 1SIWB 2YXLA 1Z1ZA 2UVWA 1B7YB 3BN4A 1DHMA 2BKNA 1CJVA 1UCNA 1JLBB 1MWZA 5CYQB 3MMBB 3H2VE 5A6WA 5EHHA 2J6SA 1Y5LB 3ET6B 2HFUA 4KGMA 4ECZA 4QYRA 1LXJA 3DRYA 4ZVEA 2X1FA 5IC6B 2HGLA 1F60B 2W1BA 4QZVB 4G1QB 1UVMA 2QA4G 1QAXA 4B3SJ 2NXEA 2VFTA 2HZAA 1ELOA 4NA1A 1RTJA 3ENVA 3H5XA 3IAM9 3U1NA 4HT7A 4CH0S 5HK4A 4MK9A 1IWGA 3KFWX 4OFZA 4KSEB 3VR1A 2HRYA 4UUXA 1QE1B 3H20A 4C0BA 1VHFA 1SC4B 3K5OA 4J9QA 1URNA 2B5JB 2XMMA 2YNIA 4DPWA 5CD4H 1KQKA 3JXOA 3D6MB 5E33A 3V6HA 3BBBA 3MUVP 2IC3A 2OEMA 2ADBA 4Q8FA 5JXSA 3LGNA 2FGCA 4MTPA 3H2LA 3MEDB 4DR5F 4YB1P 4B3TF 2CQ2A 3GFXA 2VFRA 2I8EA 1FRIA 3NOGA 1QTNB 1WDDA 4DV4F 2RQMA 3UCZP 3I5CA 2J8SA 2GJIA 3BSAA 5FDLB 4CO1A 3PY8A 4IOBA 3F56A 2ZITA 4F4YA 3B4DA 3M9NB 3RRHA 5B7WA 1PBAA 5KFKA 1OPZA 4OI4A 1NJXA 3G82A 3ZZPA 3D6TB 4OZLA 3IN5A 2QE5A 4EO6A 1YZ6A 5GAGI 4X4VA 1Y7PA 1KFSA 1RT3B 1SV5B 4A4JA 3JSRA 2RDDA 2C28A 4RW6A 5KFYA 5IM0B 4CO3A 4J9MA 4XDCA 1U1PA 1SH3A 2XWYA 2RILA 3OFFA 4ZP8A 3UVJA 2W9CA 3JYTA 1TL1B 1IKYA 4FVMA 2J9DA 2WB1D 4K2JA 1FRKA 2IYGA 3DOLB 3H4DA 2QIFA 4BBYA 4FXDA 4J7CA 5E3RA 1X4BA 1BE4A 5HLFA 3R5GA 5EN1A 4FF2A 3CJ0A 5KG5A 4DEZA 3M8QB 1W26A 1TP7A 3TZYA 1FWPA 2R7UA 4ZCLA 3BDEA 3MOZA 2JEGA 5DDQC 3V6KA 1EETA 4LIRA 1FKOA 1WC0A 4DR5J 3RAMA 4OV6A 3OTOJ 4RBVA 1HI0P 3D1OA 5DG8A 4CLLA 1BQMB 1UZDA 2LQ5A 3DOKB 3OL9A 3M05A 5T14A 2OAUA 4LF4F 2WBMA 3HSGA 1YJUA 4JI1F 1I6JA 3NAHA 1LWEA 2HGMA 3ILLA 1TQLA 5KT6A 2ASJA 4F50A 1WHXA 3ZTPA 2J9EA 1DLOB 1U09A 1HNXJ 2EW9A 4F25A 4DXLA 2RQCA 1NMEB 1N56A 1E6YB 1R0AB 3BGLA 4AYBD 5F0WA 4J9LA 3EXYA 4HDHA 4DSKA 4K4YA 3KJFB 3HVWA 4K2XA 2KT5A 4EZ9A 2LU1A 1JJ4A 5J2MB 1RAOA 3J80U 3PO5A 4DR7F 1RWXB 2NYIA 4A8XA 2MKHA 2QTWA 2E9RX 2RKIB 2AGPA 1HFEL 4KRWA 2MSTA 1UMJA 4I56A 4QYZK 1VLYA 2MKJA 2CPIA 2VKZG 2J6UA 1U7LA 5CD4A 4CO4A 2Y1JA 3M9MB 3QGIA 4OYWA 1BGXT 3RB4A 1ZA1B 4JYAF 2VV5A 3JTOA 3JTNA 3VF0B 2CG8A 2CIMA 1HNZF 4X64J 1NSKL 1QSSA 3NAIA 4RX6A 4F0MA 3DHWC 1HBNB 2E9TA 4IKAA 4CT8A 3C6UB 2WONB 5CQGA 2DGVA 2KJVA 4M5NA 1DY3A 5D0GA 1T02A 2BEFA 3M8SA 2CPDA 2OPRA 3K8WA 5IFMA 1CS4B 1D9DA 2VPWB 3GV7B 1I3OB 2VZ9A 3HKWA 5I42B 4TXSA 4RZRA 3GSIA 5CYMB 4JI0F 2QT7A 2MZJA 4AXIA 4NLQA 1VQNS 3NL0A 3IM9A 1S9GA 2P9GA 1AW0A 4CZCA 2PE8A 4IFYA 2KFZA 2OD4A 2GO9A 2LXUA 3EGVA 2BZ2A 2Z58B 3FQLA 1B7FA 2OKQA 5D6GA 2F4FA 3SCLE 3W7BA 5GMEA 1DTTB 1M5OC 1Q81T 3Q83A 1U0HB 2M9KA 1NHKL 3DGPB 2EFQA 2R7VA 1BUXA 3T9NA 4MH8A 3IBWA 4KQZA 4ZDNA 1HI8A 5DDRC 1GXUA 2JVRA 3OR2B 3TZXA 2GO8A 5F3ZA 2KJWA 5KFWA 1UVIA 2HQIA 1PCAA 4OZ2A 3N5BA 3KLHA 3PKYA 4NWBA 4WK1A 2IRXA 1C1BB 2DIUA 2XG8A 2O5DA 2MQMA 3CWJA 1CBKA 4PWWA 4O0NA 4ECXA 3M8YA 1NK8A 1XIQA 3DU6A 2GMLA 4P71A 3KLEA 3HHLD 3U1LA 1YJWS 4NXMF 4DCPB 2F3JA 1WKLA 3AH6A 2HS0A 4TNOA 2B4PA 5IT9Y 4HTIA 5FLXY 3TEGA 2HIQA 3UN5A 4IH5A 4R8UB 4RNOA 1UVJA 3T5KA 1QVFR 3C6TA 1MMNA 3POTB 4LF6J 1ACMB 1KLMB 5KAKA 1KTQA 2I38A 1FRLA 1WOOA 2ADCA 3J7ZT 3CCRS 3E3XA 2HFZA 1FX2A 1RWOB 9RUBA 1YQHA 4DPTA 1MU2B 1HBMA 4JOUA 2HHHJ 1F3FA 3PTWA 3UDCA 2UXCJ 4N41A 1G4CA 1OYEA 4H4KC 1ZZFA 4ZVGA 4LF7F 1QVGR 4PXBA 2N4CA 1SJFA 3OTCA 4X2BA 1UA0A 2DH8A 4QYZJ 2HNDA 2YX7A 2XNQA 2B4OA 3CD0A 2OTLS 1F9HA 1Z4UA 1CJTA 1YBAA 1RTIB 3PX0A 3D1QA 1F5CA 1KHWA 2DBBA 1NSQA 2CQIA 2KO1A 3PIOQ 1FFWB 5GAGU 3BJYA 2W7PA 4OX6A 2VJUA 3T1HJ 2AJ2A 1HBUB 4JI3J 2RDIA 3M32B 3SV4A 3AA8A 3CIZA 4FDFA 4U7UK 3IGVA 3CD7A 1N5QA 3M7VA 4OZ0A 3DCAA 4I0WA 1CEZA 1VC0A 2CQPA 3I6PA 2W2PP 2YKAA 3VAKA 3LO3A 4ZLJA 1FCAA 4DL0C 3AJ1A 1HNWF 4XO0A 5L1IA 4OJGA 1VQOS 2ZM6J 1SH2A 4KO0B 3SI8A 1S72S 4Y2CA 2EFVA 3S1TA 2I6WA 2VFSA 5DQIA 4PUOB 1UJ6A 5J2NB 2W9AA 4G1IA 1CSJA 3BBCA 2B7CB 2CNKB 2ZOGA 3LP1B 2QFIA 4KHPF 2JFDA 1XEZA 3LUYA 3OL7A 4DL6A 2AZ3A 2DXDA 3Q86A 1I94F 5AXKA 2QMXA 4DV1J 2B43A 3O6QA 3QO9B 3H5YA 2HPUA 2CNNB 2DHAA 3PKMA 4CLYA 2LEAA 2L48A 3R8YA 2OFHX 3PXGa 2E1PA 5IV3A 2YKNB 4EGLA 4WF9Q 3KNAA 1RBOB 2KL8A 4O3QA 1HA1A 1UJ4A 4A8KA 4IOCQ 4YHHJ 4RW7A 2KFYA 3PRBA 1REGX 2HWIA 2OPPB 3K5LA 1UEVA 4X4RA 3DM2A 2ZBQA 4ECTA 2NUHA 3DOMA 3IGNA 2FYXA 4U96A 1FT8A 2QRRA 1Q7LB 4KYZA 4LT6A 2DJWA 1WI8A 3CT9A 1UA1A 1DURA 1IXKA 3RRGA 4OZ5A 4K5SA 4W92B 1OY9A 1WHYA 4M1KA 2OMLA 1X31C 1T03B 2WOMB 1J5OA 4ITSA 2ZOMA 2FJDB 2ZHAA 2FVRA 2DGOA 3OR1B 1X5OA 1RAGB 4ZITA 3K58A 4R5PB 3KUHA 3MMAA 2A0FB 3N6MA 1HWKA 2QMUB 3TYTA 1DQ9A 1S49A 4YEAA 1YK9A 5D0EA 4C98A 2CNLB 4IDKA 4B08A 3PNIA 1B3TA 3CW2C 2F5GA 3Q2SC 2E5HA 2U2FA 3OW2R 1Y4ZB 2VFUA 1WEYA 4RBUA 2FJWA 5LOQA 3PR4A 4YMEA 1N32J 4TY8A 3ITHA 3I0RB 2A3JA 1S1XA 4UOFA 2L9NA 5JVHQ 2MZQA 3ISND 3QGHA 4NZ0A 2J7WA 5ETKA 2D69A 2FC9A 4NZ6A 2Y1LB 5B0DA 3T1AA 4ECQA 4QIEA 3TRGA 4PPZA 2DT9A 3LF0A 1Q82T 2PFDA 1RQ0A 3HHLA 4GVBB 3EZUA 2CWXA 2HWHA 3A8KA 3L09A 3CC7S 1XK8A 1KEKA 4FN5A 4LBHA 3B78A 3M2UA 3OHAA 2KT2A 2QL7B 3HT0A 4NASA 4P2FA 4X66J 5GAEI 7AT1B 1ROFA 3DRRB 2R8KA 2N7YA 4HT5A 6AT1B 3VQSA 3KK2A 3HSDA 1WC5A 3VAHA 3ZZTA 5KFBA 3I55S 4PG8A 2DB1A 2BE2A 3MI7X 1J5EF 4DL3A 1C0TB 5I3UB 2VQFF 4DS4A 2IM1A 4DR3J 2HQCA 4USWA 3QBCA 5U47A 4RW4B 2AMCB 1YJ7A 1WELA 1QSYA 1Q53A 1N36F 4DQRA 1R3NA 2KTQA 2ZZTA 5A8KB 4NZ7A 2NSCA 3VZIA 5GMKa 4F67A 2UUTA 2WVBA 1N88A 3G8QA 5E7OB 1H2TZ 4FF1A 1JLFB 4F0KA 1RWKB 1WC4A 2AP6A 4RJVA 2KVIA 3FSYA 2GJ2A 5IT9U 5LM7E 3IR7B 4V19X 4LR8A 5FLXU 2AJ4A 1RT5B 2VPZB 4A46A 5JJBA 2J0SD 3AAWB 3CVKA 1MLAA 3HSZA 3EMTA 1PYOB 2HBRB 2VA3A 2VQEF 4JI6F 1E6VA 1VYAA 2OPSA 3H25A 3D6FB 3CO9A 1X9MA 3A8EA 4IFVB 2DR6A 1QAJA 3RBZA 4KC5A 2BW7A 1VMBA 2NXCA 2P6SA 5GVQA 4F3MA 1HD0A 1OO0B 3E01A 3G9CA 1VK8A 4KR0B 3HHNB 4LFCF 4TQRA 3I4PA 1FXDA 5DS7A 3CCWA 3CMAS 1F9EB 2FZKB 1M5KC 2AYMA 2AEMA 2YH0A 1RYRA 2X7IA 3N4WA 2KRBA 4K7QA 3HVRA 3VQTA 2YX1A 2H4YB 4P7VA 3H42A 2VBZA 1SJQA 2B9EA 4DWIA 2Z30B 1RJJA 3ZZ0A 2BA9A 4M5DB 2WCXA 4F36A 4JI4J 2DNYA 2F8EX 2YBVA 1XNRF 2OPQB 4QR2A 1M5PC 2H1YA 3GFHA 4WXWA 5CCLA 1PSDA 5D4NA 5K8MA 2GIQA 3H8YA 2Z2ZA 3TUIC 3VGTA 1AUDA 4AFFA 3GV8B 5F8JA 4LF5J 4LF9J 4DF4A 1TL3A 2ZJRQ 4DU7A 4NLDA 4HLBA 2JSXA 2JC0A 2G9OA 2MJUA 3RAXA 2JZ5A 3K5MA 1O6XA 3ELHA 4K4TA 3SFGA 1CULB 2VQEJ 2UU9J 1T05B 2VB6A 3IA0A 5KTQA 3HHDA 4A8OA 1VC5A 2NXJA 4L76A 1I51B 1J2VA 1T9WA 4N8NA 1YBTA 2QL5B 2VBXA 2H48B 4NI2B 5T41A 4F2SA 3IG1A 1KQFB 1SC3B 3OTEA 2HZVA 4DJBA 4X62F 3FBCA 4AL5A 2C2OB 3PG9A 4F3OA 1IKVB 3RB0A 3T6BA 2VODA 3AB2B 4DV6J 5JUMA 5T7LB 3R9LA 1SVDA 3UD5A 3Q8SB 4PXDA 5AXMA 1YTYA 1FNMA 2CG4A 2JOQA 2VC0A 2O67A 2VICA 1JNRB 4URGA 3QRRA 1KWMA 3I0SB 3GG1A 4PQUB 2OEKA 5BR8F 2ZBIA 2XGPA 3DI6B 2J0WA 2VH7A 2YQ1A 4Z7CA 2GS8A 3TVKA 3FEYB 4WKRA 2Q6CA 4DV2F 1OPIA 1H72C 1VOMA 4USIA 1Y11A 3IBFB 3BGOP 5KG1A 4RUBA 3RR7A 3BO3A 3HDSA 2V8DA 3QYYA 1L3VA 5D4PA 1RISA 4DV5J 3KK1A 2NZCA 1SPBP 5EDWA 2ZC3A 4IQXA 4J9NA 3CDWA 1ULRA 5IWAJ 2AJ1A 3DLEA 4Q0BB 1Q8IA 1XMQF 4FZVA 2IMWP 3I96A 1VC6A 1SC6A 4DV7F 4ELUA 3DLGA 3CJ4A 4HL9A 3DYAA 2LU2A 4DL5A 4NLXA 2EBEA 5K20B 5DG9A 3C16B 1FDDA 4CP5A 3MHYA 1K73T 2VA2A 5GAHU 2Z4PA 3CJTA 2LQBA 5E3AA 4ZOSA 2DITA 2DR8A 3US5A 3RB6A 2O01C 2B0GA 2CKWA 2RJZA 3VGUA 2FY1A 4WFAQ 5KFJA 4RW9A 2I1RA 3Q8RB 1OIAA 4ETXA 5D4OA 3A4TA 3R7NB 5ETSA 1HMVB 3FQKA 1U25A 2XSJA 2WVCA 4WXOA 2PO4A 3BDPA 3LPEA 4LBIA 3HFKA 4FS2A 1VLOA 2IAJB 2JWNA 3MECB 1JLGB 1TAUA 4X4NA 5K8NA 1YGYA 4B9LA 2N4DA 4KFBA 5BYSA 2CJXB 4DDFA 2XC9A 3G2XA 2C3UA 1EARA 2YNHB 3A12A 4RKUC 4LRAA 4GC7A 4OX9F 5HVFA 4LIWA 4WTOB 3CJSA 2JLFA 3QATA 3MAAB 2ZWPA 4U7UD 1UZHA 2JJ4D 2VBWA 5F8NA 4UQGA 3DDIA 3QRPA 1KC8T 2Z56B 1JMTA 1KVKA 1S1WA 4I1TA 5KFLA 3V6JA 2DCLA 4B9UA 1KOHA 4OZNA 4I2PB 4PWDA 4HACA 1YHQS 1RA6A 1S6PB 1HNIA 1X5PA 4PAAA 3WC2A 3UD3P 4RL1A 3A3OB 1S1VA 5KT2A 1QTMA 3PRDA 4DG1A 3QZ7A 3CSKA 3JYTB 2EFOA 4EI2A 1YJ9S 2RAQA 3D4JA 1SKWA 1S9EB 1S4EA 5CXTA 3GYGA 5EX0A 3T6JA 4LREA 1SB6A 2RU9A 4PRFA 2B9WA 1CLFA 1EP4B 1IBCB 4NCBA 4AE5A 2DNNA 1NHUA 1VDHA 4IR9A 5JVGQ 2PIIA 2HHXA 4DHVA 8RUCA 2GNKA 4ZVQB 1CJUB 1VRTA 3PV8A 2Y1IA 2BKPA 3VAGA 3OLAA 3JB9k 1RWPB 4MIBA 2FHOB 2APOA 4ICLA 4QIFA 1FVSA 2EK1A 3DN9A 3LOUA 2H5JB 3L7OA 4OX9J 5LSRA 4H4MA 4B9SA 1HQEA 2DVIA 4C48A 4LR7A 2V94A 3CJKB 3M8PB 4OI1A 1GAOA 2IDLA 2B51A 1YWXA 4IG0B 2HAIA 2QSWA 3P4UB 1Y10A 2DHGA 2HBZB 3AFGA 2E7WA 5CYJA 5KG6A 4JV5J 3EVMA 4WFZA 2NPFA 1RT1B 4QWDA 1H38A 5AE2A 2IM0A 3GSDA 3DKDA 3QLHB 2W01A 4FYYB 3MMJA 4J90A 4OHVA 2FY8A 4X84A 1RHKB 1TR0A 2R8IA 4PABA 4ED0A 2ZD1A 3CJRA 3M2RA 4LFAF 3OTDA 2GVDA 2UVVA 2ZNZA 1V6HA 2UP1A 3BM7A 3THPA 5E3QA 1SH0A 2DGWA 2ZH9A 3ZTSA 3QAEA 1YX2A 4ZP9A 3M6WA 2EFPA 4I68A 3DNCA 5IZHA 1IBLF 3V4IB 1VK3A 2R8HA 4Y34A 3FNNA 1NLKL 5KFZA 1F0XA 2ZDOA 1SQEA 2XZWA 3PJWA 2J76E 3NRBA 4ZMMA 1HNVB 3GPAA 2IRYA 1LWFA 2X1GA 4WU3A 5F8HA 2IDEA 1S99A 4JI2J 2OPRB 2QX0A 1XMBA 5EWGA 2HRUA 4X4SA 3NG8A 5E0OA 3T19A 1QUPA 3MM8A 1KVIA 3O5TB 1C0UB 4ZLNA 2GHPA 2CQ0A 2E9ZA 1ICEB 2XYPB 1S9GB 5KOXA 4ZHRB 4FKXA 4DX6A 1NEEA 5ITHA 3P8BB 1HBOA 2PEHA 3MCSA 4J9SA 2CPXA 3S6EA 4WE1A 3DMJA 4ECUA 2MGZB 2ZH7A 2QA2A 2NLWA 2W2OP 4QIGA 5M2UA 3V2UC 1JLAA 2VF3A 2FVQA 4CDIA 4L75A 2X3DA 3ENQA 4LFAJ 2YNFB 3DLKA 1HPZA 3OQ2A 1KONA 2ZBRA 1YITS 1RAHB 2OHDA 2KZMA 3WX4A 2PN6A 1NM2A 3UR3C 3W2VB 2XZDB 4DS5A 1U6FA 4HKQA 5CZXA 1KN6A 4IUFA 1S6QA 3PR5B 2YY3A 3I56S 1RAFB 2PA3A 3OXGA 4DMZA 2DNGA 3QNWB 1AFIA 4LVNP 3THVA 2BJ3A 2HQGA 1EQMA 1EKSA 1RABB 4F8RA 3LGMA 2W8KA 1RCXB 1FI4A 4DU8A 3K2YA 5ETOA 4MKAA 2JL9A 3TA1A 4QWBA 3KLIA 5THWA 3PYDA 3FDSA 1T7PA 3KDOA 2FLNA 4DR6F 4NA2A 3BREA 5BXIA 4FXVA 5KFXA 2VU5A 3K0JA 1JLEB 2LP4A 3TZZA 4JI7J 3FEZA 4YB5A 1PYSB 2GA7A 4I6YA 3GONA 1RCOB 1ZS6A 4OHXA 4BWMA 4CYUB 3E2EA 5AT1B 4CTAB 3D2WA 2ZH4A 3K17A 4ED1A 3HO1A 1Q0NA 2XHCA 2DTJA 1JK9B 4UOCA 5HSPA 3AD7C 4EYHB 1KVJA 3NCRA 4J37A 3H90A 2ABYA 2V9KA 5DETA 1XMOF 1X9WA 3G6VA 3MOJB 1YDLA 4QOTA 2J0XA 1OQ3A 4HHHA 4KE5A 1M5VC 3KUGA 2W2MP 2Y1RI 5DM7Q 4MFBA 3TAPA 4C4WA 1CJKA 3PVXA 4UZCA 4IG3B 1RWUA 1S1TB 5D0RA 4ANDA 2QMWA 5CH7B 1ZA2B 2M8DB 4PYAA 4QPTA 1TKTB 2MPUA 2RSQA 2G0IA 5KFVA 1UKUA 2COLA 4B9NA 2DY9A 4N47A 1BWEA 4DSEA 5A0YA 3H98A 1T3OA 3FUYA 3RRKA 4DL2A 2CADA 1IBMJ 1X4EA 4DZ6A 5A76A 1HW9A 1RT7A 5K5MA 3CB4A 3IS9B 1UEUA 3EM1A 1RU2A 1OJ4A 1QSLA 4CQ1A 2IY5B 2V2ZA 3L4BC 1A0OB 3R6LB 4O23A 2QLBB 3IR6B 3BGUA 2EKYA 3BGRA 4ZVUB 1LW2B 5LSLA 2EVZA 2W8LA 2V4QA 3Q22A 3OSPA 4H4KA 4CT9A 2NCKL 1Y3JA 2V68A 4R0JA 1Q8LA 5KFUA 1EQ0A 4QR0A 1TL7A 2WB4A 2N3OA 3LTOA 4AQYJ 3SMZA 4K4ZA 3AOCA 2PDAA 3PFEA 2I5JA 3AD8C 1FTRA 4OIXA 2DHHA 3BQ1A 2QYGA 2B6AA 2XCPA 3RUBL 3BYPA 3W3SA 2KHDA 2XY5A 1REVB 3GR1A 4I67A 3M6UA 1JKHA 2W2NP 4QIVA 1TUWA 1N52B 4MIAA 1LW0B 1FJGJ 2ZEJA 2VG7A 4Q43A 3D68A 6FDRA 2G1DA 4O4GA 3FSIA 4S0MA 1H74A 2Y8WA 1OY6A 2XGQA 2LQ8A 1TV6B 5HBMA 4PEOA 4LF2A 4ID8A 2KYXA 3FMBA 2KZZA 2AT1B 1VQ9S 3JSYA 2EKNA 3W9JA 1SIZA 5A8WB 4C11A 4ELVA 1TKXB 3GJTB 3MMCA 1WORA 1J5OB 2R7SA 1HR0F 4OHWA 3CO0P 5DGAA 3UFCX 2HW3A 5K9FA 1RTHA 2YTCA 4KT0C 4QQBA 2UUCF 4TQSA 2OEJA 3HPOA 3Q8VA 3HP6A 2MMYA 3S01A 4I7FB 2C3MA 4Y0FA 4OLPA 3I9ZA 2MLZA 4XPCA 3C3LA 1JLCB 5HVGA 2K7JA 4P74A 2IRUA 3KG1A 1U1RA 1XC9A 2BANA 4JI5F 2CQ4A 5IC4B 4M94A 2VG5A 3OUYB 4YQWA 4NRUA 4F4WA 4M5HA 2AGOA 4LSNA 2D41A 2DR5A 3VAIA 5KT7A 2H54B 1T3NA 3MM9A 4NLGA 5HP1B 3P45B 2GGPB 5HROA 2ZH6A 2HK3A 5H1SV 5IQQA 3P5TL 2PSZA 3S8SA 3RU0A 2FUG9 3TUZC 2BM0A 3LANA 2FTRA 1V3SA 3G4SS 3DLJA 1VCTA 2I0XA 4RUHA 3CC2S 4ZKAA 1NKEA 3M2UB 3DRXA 2MZSA 4ZCMA 4M5LA 1Z2LA 1H73A 4A8FA 2UUAJ 2GQQA 2ZZNA 3CMES 2VFVA 3AA9A 2XYHB 4ZP7A 4UY85 5EGYA 2ZVIA 1U45A 3FGVA 1FF2A 1L5UA 2XLKA 2NPIA 1HR0J 3NGTA 4ATNA 4YFUA 5BJRA 3BQ2A 4WFYA 3MM5A 3CMQA 1MROA 3GQCA 1R8BA 5M2RA 3MEGA 1ZBTA 3RB3A 3CD6S 2BX6A 4QPXA 3MAQA 3NBPA 2HK2A 1HI1A 4DR1F 4ZPBA 1OSDA 4NCAA 1B99A 4GKJF 3SDEA 3OVAA 3LAKA 4DR2F 1FKAF 4EUVA 3R2DJ 4M5KA 1WTBA 1EHWA 1PC4A 2CUYA 3QIPB 1UWBA 2HMIA 2HNYA 4F04B 1H0HB 4C8OA 1ZOTA 1B64A 5DLGA 3M6XA 2VUGA 2AYGA 2E44A 4PKDB 2XEXA 4K4UA 4USUA 3N6LA 1FNXH 5I3PA 2KH9A 3I4HX 3C19A 2ACYA 2UXDF 5L38A 3JQKA 5LJ5Y 2FJAB 2RU3A 4BC7A 4IO1A 1JLBA 4IRCA 1O0PA 1HWUA 5CYQA 3P6YC 2JHEA 3MMBA 2MTLA 3T3FA 1OSCA 3DRPB 3ET6A 4P2XA 2UVUA 4F0HA 3DLHA 4PQAA 3UCUP 4Z2XA 3CE8A 4MT1A 4NMXA 3QT5A 2BJEA 3RBXA 2IM2A 1VI7A 3ILJA 2J9CA 4G1QA 2IYIA 4KV8B 3T1YJ 5DDPC 4DPOA 5LMNJ 3SXLA 2SXLA 2C2NA 2HVZA 4ZPCA 4KPCA 1IWAA 3CCSS 3KHRA 2GX8A 2AJFE 3PEJA 5KFSA 1C1CB 1NK6A 1WOPA 1FE0A 1TELA 3DRSB 3V6DB 3HJFA 5CABA 1NPPA 4EMDA 1U0SA 2QC3A 1QE1A 1HD1A 3MPWA 2BE7D 1WF2A 3KJVB 1PAEX 2EFNA 1LEOA 5C2CA 3BGFA 4A47A 4ZVHA 4M5IA 2B5JA 4P10A 1N0VC 4I69A 1NK7A 1KRPA 3CGIA 5IS2A 3L7UA 5F9LA 2W2QP 4OYMA 1MWQA 2NS1B 4PPDA 3CULA 4YY3F 3MM7B 3ISNC 1A7GE 2WW4A 4DUZF 2E5LF 2FB0A 2HVHA 3MEDA 4E98A 2XM3A 2V0NA 2ZBPA 2G2OA 4DV0F 4UTGA 4M8LA 2DRBA 3W65A 3DXSX 2UXDJ 3OHBA 1ZETA 2BKOA 5HJXA 2Y0SD 2NXUA 2N82B 3CJ2A 2J7UA 3SCIE 4PWUA 5FDLA 4TYAA 1XJWB 2OSRA 1X0PA 2PGCA 1XR7A 4HI1A 3KG0A 3ZZZA 1VR6A 3J81U 1BC6A 3HCXA 1IJEB 3R5CA 3MEKA 4OMFG 3NOCA 3J7YI 2W7AA 1RT3A 1SV5A 4NXNJ 1OYDA 4PZVA 4CH1A 1S0NA 3OXFA 5DZ7A 4UW2A 4DCOB 3IWLA 2KM8B 5IM0A 1FE4A 5AE3A 1U2CA 2FIUA 1UVKA 3IAS9 2BXJA 4N77A 4ZCIA 5EX3A 4RR5A 2W4CA 3AOBA 3O8WA 4NLPA 4UF4A 2PMZD 5EWFA 1KD1T 2CJYB 1TL1A 2O66A 3DOLA 2LDIA 4OYXA 3LP2B 1RBAA 3TQEA 3CDEA 2B9XA 2QA4S 4HDGA 1Q79A 3M8QA 3J7AN 4MYUA 1S57A 2K1RB 1BD6A 2RQ4A 2MQOA 2XS7A 2RRBA 4DUZJ 2QN6B 3W61A 4JBCA 3BKTA 2ZOFA 3KTQA 1DBDA 1AT1B 1RKIA 4HEA9 1BQMA 3DOKA 1KP6A 4GMKA 1JX4A 3DGVA 2UXBJ 2B8PA 3HK2A 1R31A 1GEHA 1XNQJ 4DL4A 2MKYA 2LEPA 4DQIA 4LMZA 3IRXB 3PW2A 1FRXA 4BWJA 1RT2B 2RUGA 3UNYA 4MKBA 2AEFA 3H5UA 1DLOA 4MMOA 4CLPA 4P52A 1SBRA 4DSIA 3NY0A 1R0AA 4XK8C 4DF8A 5HANA 3NGUA 1R6YA 5CCMA 3SSSA 2MB0B 3GIIA 4JI8J 3HFVA 1RP5A 2ROGA 2RF2B 1K0VA 4WZQA 3W62A 1PO6A 3CTRA 3M8RA 2RKIA 3R7BB 2XULA 2G4BA 4YB6A 3UPFA 2HQFA 1VJWA 4OV1A 1S1UB 2OGUA 2JDJA 1M0SA 4KH1B 4F4KA 1MSWD 3CCUS 4O3RA 3THTA 3HFZB 3V5RA 2CZ4A 2XMKA 5KT4A 2BACA 2KB2A 3MEEB 4OZ3A 2EPIA 3EGWB 2AYBA 1IQTA 1FDAA 4RNFA 3BZQA 1HBNA 1QJHA 4ZPVR 4J9OA 3C6UA 2IM3A 2Q66A 4C8NA 2CAJA 2FVCA 4NLRA 5K8OA 3O1LA 3KLGA 4C8YA 3M30B 2UUBF 2AJQA 4USKA 1CS4A 3NWRA 4B02A 4EO8A 4B9TA 2OUGA 5I42A 1N33F 2A6OA 3RAQA 5CYMA 4OJHA 3R97A 1XERA 2W4DA 4PR6A 3OSNA 2LXIA 3FBFA 1LWCA 4P2MA 4EU0A 1NSAA 1VS3A 1RT6A 1G3OA 2NUUG 2HS4A 1U1KA 4FNIA 3TNVA 5IQ6A 3TEHB 3Q89A 2D3OR 1R7IA 2QA1A 3BBFA 1PILA 1TU0B 2E5IA 1DTTA 3HMJG 2HS3A 2FVSA 5C42B 1U0HA 5SUHA 2KN4A 4YB7A 1GX5A 2DXFA 3DGPA 4A8SA 1S0VA 2JC1A 4KTQA 4QCLA 3LP0B 3IWNC 4DX7A 5CA5A 3OR2A 1R8AA 4Y00A 3KLFB 4PWDB 5KOWA 1TZ0A 3FRZA 3B6BA 4FF3A 2LA6A 2R7QA 3AY0A 3N6NA 5KG4A 3PW7A 2P8IA 1NH8A 4I2QB 3HM9A 1C1BA 2DNHA 2CXEA 4YOEA 4RW8A 5ETNA 2EXUA 3CPWR 3VVTA 5D3GB 3GZ7A 1U1OA 2V4JB 4ED6A 3EE3A 1U4BA 1S48A 1CG2A 4B3TJ 1FDNA 2ZKTA 2XHWA 3VGSA 4OI0A 3UQSA 1RAAB 3K59A 4R8UA 3P3DA 4DV4J 3FFIB 3POTA 2JEIA 3HVAA 2MZTA 4ZCKA 3AJ2A 3NMAA 5HQ8A 4E8UA 3U27A 5ETPA 5G0RB 3KJQB 3VAMA 3GWCA 3OD2A 3SQGB 3HHKA 1MU2A 3KXDA 2XS5A 2VL1A 1IBKF 2W24A 4LRFA 1RU1A 1FKPB 2R9LA 2V63A 2XI2A 4NX9A 4A8QA 5GADI 5HMXA 1M1GA 4M5GA 1IKWB 1RTIA 3MZIA 5L46A 2AHOB 4IR1A 4NLWA 3CJ8A 3MF5A 5J2QB 1BMQB 3I32A 5AJ3F 4X4OA 1HBUA 2ZD1B 3M2RB 2XMAA 2DPJA 2B7BB 3M32A 2GVDB 1U2FA 3PW4A 1OQ6A 1TUVA 1NKCA 2H65B 1JJCB 4IYQA 1FXLA 2CQBA 4BCAA 2F1FA 2MKIA 1NJYA 2ASYA 1NK5A 3JSMA 2F63A 3KHHA 2VPYB 5KFOA 4KY3A 1PAUB 3KYLA 2XMVA 2FLPA 4TLQA 4LF4J 4KO0A 1YI2S 2NREA 1BHNA 4JI1J 2CJQA 4CM0A 3UDVA 4OLOA 4DQSA 1K47A 4PUOA 5J2NA 4X65F 2AX0A 3BPDA 1YLXA 3LP1A 3OTBA 1LV5A 2ALZA 3ILIA 1WG1A 3X1LB 3PCOB 2RUSA 2DRDA 1TVRB 1C2PA 1NZ8A 2MQNA 2MHNA 1HBOB 1R27B 2XYGB 2K06A 3D0IE 3BEGB 3TAQA 2YWWA 3HD2A 4WE1B 4DR7J 3BH7B 2Q43A 4ZK7M 2YKNA 4UZBA 2BBEA 3LW5C 2HNZB 3L95X 4F7VA 4B3OB 2P2CB 1T0TV 1SL2A 1SI9A 1NB2A 1S6OA 2OPPA 2HVDA 1G6BA 4JYAJ 3EYZA 4JB8B 3NS5A 1BXNA 2MLYA 4EBCA 4TU7A 3TA0A 3IP0A 1N5SA 4LBPA 1HNZJ 5HVHA 3GJQB 3UWTA 2PC6A 1V9OA 4DX5A 3CXCR 1S7IA 3UI3A 4UUWA 2DR7A 2WSCC 3W9IA 1CC8A 1HW8A 3D7SB 4NLVA 5K14B 2LKZA 1T03A 2WOMA 4DBQA 1ZM9A 3OR1A 3DC2A 2DISA 2R3VA 1RHRB 3NEKA 4R5PA 5L1LA 4JI0J 2JNJA 1F1BB 1UP1A 3KHGA 2D9PA 2E1MC 3MR6A 3Q0AA 1RE1B 1T9XA 2BM1A 4AL7A 4XTTA 4FYWB 1Q5YA 4GC6A 2WVFA 3W8GA 3M2VB 3TWZA 3MPUB 1Y3KA 2YKQA 4MK8A 1Y5IB 5A8RB 4PG6A 2HURA 4LFBF 3N01A 1WEXA 2H3EB 2NQPA 4ILMA 3I0RA 1N5YB 1HWIA 2PA8D 3HF5A 3P96A 3C14B 3KG4A 3GFYA 1KQGB 2H51B 1HARA 3UD4P 4Y2AA 2AX1A 4F4ZA 5I3QA 1YJVA 3E8OA 5MAOA 3HVTB 4OJ1A 4WK3A 4CLUA 2M52A 4GVBA 1ZPWX 1GX6A 1FFSB 3KNGA 3O3LA 4RU2A 4OQJA 1YBUA 5IXUA 4GKKF 1TKZB 4N5SA 3FBBA 1MNEA 5LSOA 4DFJA 3ONQA 3DRRA 1UW9A 4N56A 3QJPA 3A3NB 4NLSA 2ZH2A 3OXLA 2HKEA 1XWLA 5A0YB 2MQQA 4NXMJ 3EDRB 3QFHA 1JXLA 2MEWA 2XBPA 1B0PA 2DH7A 2GZOA 3T5JA 1C0TA 3MFHA 4ED4A 3BYRA 1S97A 2F9JA 2NZ4A 1DARA 4PG7A 4Z7YA 4DR4F 4J9RA 4R0EA 2A18A 4RW4A 4DFMA 2HHSA 5A6PA 6FD1A 4DL7A 3X3UA 3P49B 1S79A 5C24B 1HL6A 4LFBJ 1VGYA 5A8KA 1X4DA 3R27A 2HHWA 3G87A 1FD2A 1X4AA 1UFLA 1JLFA 2YKMB 1W2BR 3NS6A 1N0UA 2CRLA 3PYGA 4LF7J 2QO3A 4C3KA 1RA7A 5ETTA 4BDPA 1GMWD 4O3NA 2IPOB 1RT5A 1Y00A 7FDRA 1LNQA 4Q5VA 1SJ3P 1H98A 1IJFB 3CD5A 2B6AB 3RTVA 1SL1A 4ILRA 2V5HG 2QJ3A 3HD1A 2KFNA 1K8AT 4LQ9A 2OJ3A 3W2WB 2FVPA 3GMGA 1JWWA 2ZJPQ 4WP8A 3L9ZA 3QJLA 3M4XA 5J1EB 1V3ZA 4ECRA 1Q7YT 9ATCB 4OYAA 1BQNB 3EPGA 3G96A 5GADU 1I1GA 2ZFHA 4PG5A 4K50A 4C9DA 4O3SA 1OMSA 4ZVSB 2J8AA 2E1CA 3QWUA 2ZC4A 2AD9A 2YWGA 1N34F 4FP9A 5A2QY 1OY8A 1HNWJ 2KM8C 2F4VF 4DR4J 1D8YA 2Z2LA 5C5JA 1B70B 4CO5A 1N6QB 1U2RA 3R5AA 3ZZRA 1NB7A 4DFKA 1JXEA 2FJEB 2M70A 2DHSA 2OD6A 1RXOB 3T5LA 4RUAA 4J5OA 4Y28C 2XO6A 2XQCA 3PZPA 4K0KF 2BABA 3PO4A 4M5DA 4KHPJ 1NXIA 2IJFA 1T11A 1O5JA 2CNOB 3WZ0A 2D1CA 1I94J 2MQ8A 4O44B 3CJQA 2XLJA 2OPQA 4WIQA 2C1EB 3MPDA 3CCLS 1X9SA 1JLQB 1LOUA 3GYXB 1VQ6S 4U8YA 1RWWB 1CPZA 3OLBA 5F0UA 2OIHA 1XTZA 1A9NB 2DGTA 2HRTA 1NJWA 2AU0A 3JAMY 4PYDA 5KFIA 3QPIA 4W98A 1T9TA 3VTIA 1WEZA 1T05A 4QW9A 4IOAQ 1K0TA 1DFDA 4LR9A 2Q3PA 1GQEA 1Q8BA 3NCQA 3VAJA 1NNDA 1UEKA 1SUQB 2LCWA 1IKXB 3GU0A 4AL6A 3CC4S 3DFEA 4NI2A 4RO0A 3JQJA 5ETRA 1D9FA 2ZH3A 1N34J 3H2UB 1WD6A 4ZJOA 2DNQA 3KKFA 2KXHA 2V69A 1G7CB 3C2PA 2C2MB 1WI6A 4URSA 5CAAA 1IKVA 4C2MA 4AD6A 2F9DA 3A8JA 4OI6A 2JLGA 2ERRA 3W64A 4UQTA 4B3SF 3EGZA 5T7LA 2M3DA 1SJ4P 2B4UA 2UZAA 1CVJA 4TU8A 4Q2MA 2DO4A 2W9BB 2CYYA 4DQQA 2LDYA 1PG5B 2BQUA 2VD3A 4PQUA 3MEGB 3FEXB 1UAWA 4WFNQ 3DI6A 4ID5B 3CNQP 4K4XA 2JH3A 3MCMA 2QL9B 1VQSA 2D74B 4FYDA 1WKJA 2OI2A 1RTDB 5D77A 3NGDA 2HZCA 1U8WA 1FX4A 3PW0A 1Q5VA 3VZHA 3I82A 3OPKA 1RKJA 1WSRA 1VRUB 4NYZA 4U7CA 2CPEA 1NK4A 3U02A 1FJEB 1TK0A 2BQRA 1T8EA 5DDOC 3GV5B 2VC1A 2HBQB 3W60A 1HYSB 4ILLA 2DY1A 2PI4A 3SZ2A 3TR5A 1XBWA 3JSBA 4P7TA 4Q0BA 2H9ZA 5LXRA 4KGKA 3C66A 1P8GA 5KT3A 4NYOA 4J91A 2LMIA 2XSFA 1U26A 1UVLA 4C8LA 5H9FK 3GCWP 4GVLA 1QDUB 2EBGA 1FWLA 4GO5X 3D0HE 4G6VB 3Q23A 3WIVA 3C16A 4G65A 1D1UA 4X4UA 5ADZA 3PYEA 3ILOA 3HSJA 1J5EJ 1FK9B 2CJ9A 5F8IA 2VQFJ 4H4OB 2IFXA 3H7HB 3BSNA 1FRHA 2XY6A 3KMSA 1N36J 4USMA 2ACMA 3E51A 3K89A 4ER8A 1GMWA 1G2EA 1U8SA 1RHQB 1AZSB 4FXWA 5HQMA 3MPVA 1HMVA 1GMUA 5CHCB 3FCHA 4I6WA 2IVFB 3R5DA 3IBCB 2WBRA 2IAJA 3MECA 1JLGA 4FKYA 4ZPAA 4KGVB 1NJIT 3QSIA 3CUNA 2RRNA 3OTOF 2GHVC 4OHYA 3MAHA 3FC9A 3N28A 2YNHA 4DPYA 3HT3A 3I31A 4NCGB 2W7OA 1FFGB 3NNHA 1TMMA 3R1LA 2ZKUA 2DGUA 3V81B 1RI7A 2HBYB 2ZE2B 4JI6J 3MAAA 4CI0B 2VDIA 3D54A 1HKAA 2R2RA 3SSQA 2FJBB 2BE9B 3KK3B 2F8MA 4LVOP 2OP5A 1PYTA 3GIJA 3Q2TC 1WJ9A 3QT6A 2H4WB 1VFJA 1HNXF 3A1YG 2CVEA 4WPAA 4XAKA 4I2PA 4CLSA 4DFPA 2M88A 2VG6B 3EZOA 4HR2A 1S6PA 2D3UA 1LFPA 1AFJA 4LFCJ 2GCFA 1GMVA 2D7SA 4Q44A
chains in the Genus database with same CATH topology
2ZOGA 2YKOA 4QPXA 3MAQA 3LP1B 3NBPA 3SEOA 4ES1A 2R7TA 4KHPF 5AXNA 1HI1A 1HQUB 4DR1F 4ZPBA 2JFDA 3JTPA 1XR5A 1XEZA 1S1WB 1OSDA 1W2IA 3LUYA 3OL7A 4DL6A 4NCAA 2A2DA 1PGZA 3SDEA 1VQ4S 4FBTA 4GKJF 3OVAA 3MR5A 3LAKA 1I94F 1K1QA 2R2SA 5AXKA 5HMYA 2HNZA 4DR2F 2QMXA 2B43A 1S9EA 3O6QA 1P6TA 3QO9B 4KKOA 1FKAF 4CH7A 3H5YA 2HPUA 3B4MA 2PT0A 3G86A 1S7HA 2EFGA 3MM6B 2DHAA 4EUVA 3PKMA 4B3OA 1BY9A 2LEAA 5E2QA 1FO1A 2BR0A 1DTQB 5F3TA 2JEFA 2L48A 2VBYA 2OFHX 1WTBA 1HNIB 4M95A 1EP4A 5KFGA 4ZLPA 3PXGa 1PC4A 3QIPB 1UWBA 4NA3A 2HMIA 2HNYA 1S1VB 1H0HB 3TP2A 2JLEA 3KWMA 3OJSA 4C8OA 2R4FA 1ZOTA 2CQDA 4DG1B 1B64A 2YKNB 4EGLA 3M6XA 5DLGA 4WF9Q 2VUGA 2AYGA 1ZTWA 2E44A 3KNAA 4PKDB 3OL8A 2XEXA 4K4UA 3RW7A 4WFXA 2DRAA 4X64F 2GIRA 3I5BA 3G8SA 3LPYA 1ZH5A 3ICLA 3N6LA 4O3QA 2QSFA 1FNXH 1HA1A 1UJ4A 2CPZA 2X1BA 4A8KA 4IOCQ 2VPXB 5I3PA 4RW7A 1H6KX 3MGJA 2KFYA 5K14A 2KH9A 4O4RA 2GMHA 1GXLA 3I4HX 3PRBA 5FJ4A 5B08A 2ACYA 2HWIA 2OPPB 2UXDF 3K5LA 1UEVA 5L38A 4X4RA 1FRJA 3DM2A 2IA6A 2RMLA 5LJ5Y 3HXMA 4ECTA 2FJAB 2RU3A 4PXCA 4RWWA 4ZVFA 4IO1A 3UW1A 2NUHA 4BC7A 1HHTP 1JLBA 4IRCA 1O0PA 1HWUA 1JIHA 1MWYA 2BV3A 5KFHA 3DOMA 5CYQA 3P6YC 1U47A 2JHEA 3IGNA 3K57A 3MMBA 1FT8A 1V3RA 2QRRA 1YRTA 2YNGB 1Q7LB 2FHJD 3T3FA 2H5EA 4LT6A 5DO2A 2DJWA 1OSCA 1WI8A 3CT9A 3GFZA 1UA1A 1DURA 2KXFA 3DRPB 1U49A 1IXKA 1VRTB 3CJKA 1IBMF 2OLWA 4CCHA 2UVUA 4Q7AA 3RRGA 4OZ5A 3DLHA 4YR2A 3M8PA 1RK8A 4K5SA 4PQAA 4W92B 1WHYA 3UCUP 4K4VA 1DAXA 4Z2XA 4M1KA 5H9FJ 3CE8A 2BJEA 2OMLA 4IG0A 3ZZOA 1T03B 3LWLA 2WOMB 3M2VA 2IM2A 1VI7A 1J5OA 4ITSA 2ZOMA 2FJDB 1KQSR 4ICLB 2J9CA 2ZHAA 2M0GB 4G1QA 1F5AA 4RU9A 2FVRA 2DGOA 2IYIA 2J7KA 3OR1B 4KV8B 1X5OA 4UY8T 1KLMA 1NO8A 2GQCA 5DDPC 4DPOA 3K58A 5A8RA 2KG1A 4R5PB 4H4MB 1HWJA 3MMAA 2XY7A 3SXLA 1F5BA 2SXLA 3FZ2A 4ECWA 1Y9OA 3N6MA 5KFEA 2HVZA 4ES2A 1HWKA 4ZPCA 3TYTA 2EC0A 1HQEB 2UV8G 1RT1A 3CCSS 3CJ3A 1DQ9A 1S49A 4PCQA 3KHRA 4YEAA 3DHXA 2BQ3A 2GX8A 4C98A 1KSPA 2AJFE 3PEJA 1P1TA 2Z8QA 2OFGX 1N5YA 4G3IA 1IUJA 3QLHA 5B0AA 1APSA 1XN9A 5KFSA 1C1CB 3I87A 4DX8H 4B3MF 1NK6A 3GE9A 1IN0A 3MTKA 1WNEA 4DSLA 1FE0A 4IDKA 4B08A 3B8HA 3MD3A 3DRSB 3V6DB 2A1BA 3HJFA 3PNIA 3CCZA 4WYLA 4CIOA 2C2EA 1HWLA 2L9WA 3BF4A 2M5YA 3Q2SC 3GB0A 2AYEA 4AQYF 2E5HA 2U2FA 1DQ8A 3N9UC 1QE1A 4F4XA 3OW2R 1HD1A 3MPWA 1WF2A 5HMWA 3KJVB 4O3PA 1Y4ZB 3LAMA 2EFNA 2HFNA 4TYBA 2VFUA 1WEYA 3HVTA 4RBUA 3BGFA 3GIMA 2FJWA 1K1SA 4A47A 4EFAC 4ZVHA 2B5JA 2VOPA 2MJNA 4YMEA 1RTJB 3IC1A 3PR4A 4TY8A 1X4GA 4XPEA 1N0VC 1X7VA 3I0RB 3ITHA 3NWGA 4EBEA 4DSJA 2A3JA 1S1XA 3NP5A 1WWHA 2HFOA 2XWXA 4I69A 3HZEA 1NK7A 1KRPA 2K7KA 2L9NA 2QV6A 3CGIA 5JVHQ 5GAEU 1NK0A 5IS2A 2MZQA 2V8HA 3D0GE 3ISND 3Q24A 5F9LA 5LMUF 3SCKE 3QGHA 4K4WA 4NZ0A 3J7YU 2J7WA 2NS1B 4PPDA 3V4IA 4YY3F 3CULA 3MM7B 3ISNC 1A7GE 1TKZA 4DUZF 2FC9A 3ENWA 4NZ6A 2OTJS 3L3CA 1FJ7A 5L9NA 5B0DA 4O3OA 3T1AA 2E5LF 4ECQA 2FB0A 3AQPA 2HVHA 3MEDA 4E98A 2KKHA 2YVSA 4QIEA 2LQJA 3TRGA 2O3DA 4PPZA 2V0NA 2DT9A 1UVNA 2R2TA 1ZAWA 5KG0A 1FJGF 4DV0F 3LF0A 2V4RA 1HNVA 4M8LA 1Q82T 2P5VA 1RQ0A 3HHLA 2DRBA 2YNIB 3DXSX 4EZ6A 1NHVA 3OHBA 3EZUA 1ZETA 2HWHA 4XDDA 5J2PA 3L09A 2Y0SD 2NXUA 4K59A 4TLRA 2N82B 2DD8S 3CJ2A 2J7UA 2IC3B 1IQZA 3SCIE 4PWUA 4C97A 2BYCA 3KLGB 3CC7S 2KT3A 5FDLA 1QLNA 1XK8A 4TYAA 1KEKA 3TI0A 4FVCA 2OSRA 3NLCA 4FN5A 1FESA 1X0PA 3B78A 2ZVSA 2PGCA 3M2UA 1XR7A 2CJAA 4HI1A 1TFWA 2UVRA 3OHAA 3KG0A 2CPFA 3ZZZA 1S9FA 2KT2A 1KOOA 5IT4A 2KRRA 3NCPA 1BC6A 1IJEB 1P9QC 5GAEI 3R5CA 1ROFA 2X51A 3MEKA 1C0UA 4OMFG 4ECYA 3DRRB 3J7YI 2R8KA 2N7YA 2W7AA 4HT5A 3HHEA 2XB2D 5C25A 3VQSA 1RT3A 1X4CA 1SV5A 4QJVA 1LWCB 1LWFB 3KK2A 2AJ0A 5KG7A 4CH1A 3VAHA 1S0NA 3BQ0A 3OXFA 1RT6B 4ZHRA 1YTYA 1YJNS 1L3SA 4PXEA 5F41A 3PEHA 4UW2A 3ZZTA 5KFBA 3I55S 2E7XA 1D9AA 1IR0A 3IWLA 1A6LA 5C24A 5IM0A 2KM8B 4PG8A 1YJTA 2DB1A 4LF6F 4A8WA 1FE4A 2BE2A 5AE3A 3MI7X 4ED2A 2FIUA 1SKSA 2BW2A 1UVKA 3PW5A 1VBYA 3IAS9 5L1JA 2BXJA 1J5EF 5KT5A 4DL3A 1C0TB 4N77A 1WG4A 4ZCIA 3MM8B 5EX3A 3U7JA 2W4CA 5I3UB 2VQFF 4DS4A 2MGZA 5F8GA 2XO7A 3O8WA 2IM1A 4NLPA 2IBOA 1VQ8S 3BR9A 1UETA 4X4TA 2YKMA 5U47A 2PMZD 5EWFA 1KD1T 4RW4B 1X5SA 1TL1A 1WELA 1QSYA 1Q16B 1Q53A 2O66A 1Y5NB 4X4QA 1N36F 4RW6B 5KG3A 3QO9A 4DQRA 1R3NA 3DOLA 2YNFA 3TO8A 4NMLA 5DLFA 2HHHF 4QU6A 2LDIA 2KTQA 3LP2B 2UXCF 1QAIA 1ZAXA 4K5RA 1LFWA 2C3OA 1P27B 1DTQA 3CDEA 2B9XA 3OFHA 4N8OA 4NRTA 5DGBA 2ZH8A 1BLUA 5M2PA 1H2VZ 1URRA 4NZ7A 5A8KB 2NSCA 4HDGA 3VZIA 5GMKa 2QA4S 1Q79A 4F67A 2UUTA 4NPOA 1N88A 3M8QA 5EUHA 3W2VA 4ES3A 4MYUA 3G8QA 2O1PA 1MMDA 3DMJB 2K1RB 5BYQA 5E7OB 2B3TB 1BD6A 2RQ4A 1H2TZ 2W9CB 4FF1A 2MQOA 1JLFB 1JLAB 2CQ3A 4W90B 2KI2A 3NKYA 1U48A 1M1KT 2XS7A 2RRBA 2AP6A 2XCAA 1IKYB 2KVIA 1KHVA 3W2WA 2HWTA 2L08A 2ILYA 1HPZB 3DLKB 3FSYA 4JBCA 3K5NA 2ZOFA 3KTQA 1DBDA 1RKIA 2GJ2A 4HEA9 1BQMA 2GMJA 3PJXA 5IT0A 1S4FA 3IR7B 3T1HF 4V19X 5D4LA 5J1EA 5KFDA 3TAMB 4YP3A 5HLFB 4JI3F 1S76D 3DOKA 2AJ4A 1RT5B 2LEBA 4RW8B 1B0TA 2VPZB 4A46A 5JJBA 4GMKA 1N5TA 1JX4A 2QYCA 2J0SD 1GTEA 4X4PA 3CCES 5F9NA 1BQNA 1CQMA 2Q6BA 5KFAA 4URQU 3HK2A 3AAWB 3OFEA 1R31A 1S6QB 3CVKA 2IA0A 5J1NA 1VBXA 4DL4A 3PACA 1EETB 1Q86T 1X0FA 2LEPA 3HHLC 2RDJA 2ATLA 2VA3A 4DQIA 3KMQA 1FKOB 3FSXA 2MKKA 2VQEF 2J0QD 4LMZA 3BN7A 3IRXB 4JI6F 1E6VA 1FRXA 3PW2A 4BWJA 2KXNB 2OPSA 4Y3CA 3H25A 1RT2B 3NNCA 5FIIA 2RUGA 3IWXA 3CO9A 1U1NA 4Y2IA 2CPJA 4MKBA 1X9MA 3A8EA 4IFVB 4BHQA 3K8VA 1QAJA 2UUAF 4KC5A 3CCVS 1SKRA 2CFXA 3H5UA 1DLOA 1JLEA 4MMOA 1N6QA 1VMBA 2POKA 1YJRA 1X5TA 4HVZA 1LK5A 2P6SA 3BR8A 1LKZA 1T94A 1SBRA 3LQVA 1S6UA 1WHWA 2ZM6F 4DSIA 5GVQA 4F3MA 1HD0A 1R0AA 3HI9A 4IH7A 3GG0A 1JNZB 1OO0B 2CQHA 4XK8C 4DF8A 4EYIB 3E01A 3G9CA 2C3YA 2K8GA 1LQ9A 1LWEB 3KLIB 4I64A 1R6YA 1VK8A 5KFTA 2ZH1A 4KR0B 4ECVA 5CCMA 1FD8A 2DO0A 3HHNB 3SSSA 4DLGA 2MB0B 2LYVA 3GIIA 4LFCF 2ROEA 4MJKA 2YWFA 4TQRA 3I4PA 1FXDA 1RP5A 4CTAA 2ROGA 2RF2B 1K0VA 4WZQA 5DS7A 3OBIA 3CCWA 1PO6A 3CMAS 2G13A 3CTRA 3M1VB 1M5KC 3OVBA 2AYMA 1D8ZA 2HHVA 4O44A 3M8RA 2YH0A 3CCQS 1RYRA 2RKIA 1TFYA 3N4WA 2PMHA 4OX8A 2KRBA 2KHCA 3HVRA 1YRUA 2YX4A 2C3PA 2XULA 2G4BA 3VQTA 4DV1F 2YX1A 4YB6A 5AXLA 3UPFA 2DPIA 4MIWA 3IXQA 1VJWA 3H59A 2JEJA 3QMQA 4OV1A 4Y6IA 1S1UB 3M9OB 4DN9A 4P7VA 1JLQA 3G6ES 2JDJA 2RQKA 2VBZA 1SJQA 2HLUA 1M0SA 5FD1A 4F4KA 1MSWD 2GV1A 5H9EJ 4DWIA 1RJJA 3ZZ0A 3CCUS 3THTA 4O3RA 1S0MA 2BA9A 4M5DB 2R7WA 2BDPA 3S7RA 5DG7A 4ALZA 2GW8A 3V5RA 5L8RC 2WCXA 5HO4A 1CQNA 2FLLA 2CZ4A 2XMKA 2DNYA 4IG3A 5KT4A 4XIUA 2BACA 2KB2A 2CPHA 2F8EX 2MY8A 3MD1A 1S1TA 3MEEB 4OX7A 2DNMA 2EPIA 3EGWB 2AYBA 1IQTA 1FDAA 2E1RA 4RNFA 1XNRF 2OPQB 4USJC 1FRMA 4QR2A 1M5PC 3BZQA 3GFHA 4WXWA 1RYSA 1HBNA 1QJHA 1GTHA 4R25A 5LL6d 4ZPVR 4J9OA 5CCLA 1TKTA 1VQKS 3C6UA 4I6AA 1PSDA 2IM3A 3M6VA 5D4NA 5K8MA 2LECA 2Q66A 2GIQA 3H8YA 3MWBA 4C8NA 5L39A 2FVCA 3TUIC 1AUDA 4AFFA 4NLRA 4YHHF 3GV8B 3GIKA 5K8OA 5F8JA 3HKZD 3O1LA 4FS1A 2CJKA 3KLGA 1SUQA 4DF4A 4C8YA 1IKXA 1TL3A 3M30B 4NYPA 2ZJRQ 3J7A1 4MFBB 2UUBF 2AJQA 1U6ZA 2FHJA 4NLDA 4B02A 4HLBA 2WTFA 2JSXA 2JC0A 4EO8A 2G9OA 2MJUA 3RAXA 4B9TA 4KHMA 2JZ5A 3RYLA 5I42A 3K5MA 1N33F 3RAQA 3IO1A 5CYMA 2MSSA 4K4TA 3SFGA 4OJHA 3JSMB 4ZPTR 2VB6A 1T05B 1XERA 3IA0A 3O2IA 4WKYA 3TANA 2W4DA 4C3LA 1NJZA 4PR6A 2DNOA 5KTQA 3HHDA 4Z37A 3OSNA 3IS9A 2LXIA 2QLWA 1LWCA 2R8GA 3FJ2A 4EU0A 1VS3A 4A8OA 3F41A 1VC5A 2M8HA 1RT6A 4U9RA 1G3OA 2NUUG 4A8MP 4LF8F 3SSRA 1J2VA 2HS4A 3AB4B 2YWKA 2JFKA 2ZBCA 4ECSA 2PI5A 4N8NA 1U1KA 3BO4A 1C4CA 4FNIA 3TNVA 2VBXA 4TN2A 5IQ6A 3T1YF 2D3OR 2FHMA 5T41A 1LW2A 3OV7A 4FPRA 4F26A 1R7IA 5LMNF 2QA1A 5I3UA 4F2SA 3IG1A 1PILA 1PC5A 1KQFB 3WDOA 1Q78A 2QFJA 1NZAA 3QAUA 2BUNA 2FJVA 2X1AA 2E5IA 1RT7B 2RD5C 2W9BA 1DTTA 5K8PA 3HMJG 3CCJS 3C8YA 2HS3A 3OTEA 1T95A 2OMOA 2FVSA 1NAQA 4DJBA 5C42B 2N7CA 2DR9A 4X62F 5SUHA 2KYZA 2KN4A 4YB7A 1GX5A 4AL5A 4F3OA 3SYZA 3DGPA 3WC0A 4A8SA 1S0VA 2FPHX 2JC1A 1IKVB 3RB0A 4IFYB 4ID5A 3T6BA 4KTQA 3G6YA 2RRAA 4ED7A 2VODA 4QCLA 3LP0B 2RIJA 2YWHA 3AB2B 3IWNC 2M7SA 4RLEA 4HH1A 5JUMA 3BGRB 3PFOA 5I4MA 3MUTP 4M63A 2CPYA 4OZJA