4CO2A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
total genus 21
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co2A00
2EG1A 4Y65A 4NYOA 5D4OA 3BZQA 1UFLA 1O51A 3NCQA 4CO4A 2O67A 1OSCA 2NUUG 2XZWA 2ZFHA 4RLEA 4D3GA 4YB6A 3AA8A 5D4LA 2XULA 4Y6IA 3TA0A 2PIIA 4CO5A 3L7PA 3N5BA 3TA1A 4NYPA 1GNKA 1P1LA 5DS7A 1UKUA 2XBPA 3CE8A 4C3KA 4YB5A 1KR4A 2J9CA 4USHA 4E98A 4CO2A 2E66A 4YB7A 3T9ZA 4OZNA 3M05A 2J9DA 2O66A 3TA2A 4C3LA 1XK8A 1HWUA 2V5HG 4USIA 5DRKA 4C3MA 2JJ4D 1H3DA 1UMJA 4ZK7M 1J2VA 2RD5C 1Q1KA 2CZ4A 1V9OA 4CNYA 4CO0A 1V6HA 2NS1B 4RWWA 3AA9A 5D4NA 1UL3A 4OZJA 1PILA 2J9DE 4WK3A 2NUHA 2GW8A 3GSDA 1NH8A 4RWXA 4CNZA 2J9EA 2Z0GA 3HLUA 4WK1A 5D4PA 2GX8A 3O8WA 4IYQA 3X3UA 2VD3A 3AH6A 3NCRA 1VFJA 3OPKA 1V3SA 1NH7A 4CO3A 3O5TB 3DFEA 3AHPA 2DCLA 4CO1A 1V3RA 2EG2A 2GNKA 5L9NA 1NZAA 4R25A 1QY7A 4D3HA 1NAQA 2ZOMA 4RX6A 4USJC 2XG8A 1VHFA 4AFFA 1O5JA 4OZLA 3LF0A 3NCPA 3MHYA
chains in the Genus database with same CATH superfamily
1DHMA 3PTWA 4NCGA 2EG1A 3KG0A 3W9HA 4DS5A 2JZ5A 1U1RA 3H25A 4TU9A 3BSNA 4F3OA 3MXHP 1GX5A 4K4SA 3AQOA 3M8PA 2JLGA 1BQNB 1BWVA 5I3PA 2ZHBA 1NKCA 1EQ0A 1MG7A 2RS8A 2W7AA 4AL6A 2F4VJ 1N36J 1ZPVA 2UU9F 1TP7A 2PA8D 4LT6A 4RLEA 1KRPA 4FXDA 1KVKA 2ZBQA 2EKYA 4N47A 2JH3A 3TAMA 4YB6A 1X31C 1M5KC 3H5SA 1TKXB 3G96A 3PY8A 3G8QA 3GYXB 3TA0A 3M8SA 5RUBA 1R89A 2X1FA 3PZPA 4P7TA 5HROA 2W24A 4YR0A 3K5LA 1TFYA 2YKAA 3QPIA 1VQLS 2VDIA 5B0AA 3RUBL 3AXKA 2D3UA 4DBQA 3L7OA 3N6MA 3GIMA 3GIKA 3V4IA 4KHPF 1GNKA 4H4OB 2BE7D 2J6SA 1S7HA 1YG0A 1HBMB 2V9KA 3JB9k 3CC7S 1TL7B 3E01A 3QT5A 2M7SA 1IUJA 3NLCA 1VRUB 4MK8A 3K5PA 2I2YA 4OZ0A 2BM0A 4J9NA 4Y28C 5KG6A 4FBUA 3MM7B 2RU3A 4E2FB 2DR5A 3TW0A 3T5LA 1JKHB 3B78A 3EDQB 1GXTA 1UETA 2CJAA 3ISNC 4KHMA 2W9BA 4AT1B 2ATCB 3MTJA 4C97A 2OPSB 4MFBA 2CPDA 1WWHA 3I0RB 1CJTB 4MJKA 4DZDA 3ZZPA 3BQ1A 1JLEA 3PX4A 4RBTA 1CG2A 2ZBRA 4OYMA 2ZKTA 3G6YA 1AZSA 2IVMA 2PDAA 2EXUA 1T3OA 2BXJA 2CUYA 3THPA 3ZNJ1 5KOWA 4C8OA 1FRXA 2QSWA 4IOAQ 4JB8B 1I5OB 5J2QA 2E5GA 4EZ9A 1FDNA 3KK2A 1N32F 1WACA 1ZAVA 1CULB 1RT5A 1UJ6A 4NA2A 5ETKA 4ZVPB 5B0FA 4EGLA 2QLWA 5SZTA 4PRFA 3PHEA 2EKNA 3KJVB 1ZAXA 2ZJRQ 2DR9A 1T9YA 1WDDA 1TU0B 1M5VC 1XJWB 2KI2A 4LF9F 5I3QA 1MU2A 4U6PA 1U7LA 1SUQB 4WFZA 2E1RA 3TZZA 3RZAA 2KH9A 5KOXA 1S79A 2B4PA 4ID5A 1HPZA 4J9OA 1O6XA 1S1UB 4OX8A 2H4WB 3BQ0A 4ED4A 1PC4A 1T9TA 2F9JA 3M6UA 1VQ7S 4F50A 5U47A 5DG8A 4KBIA 3RB0A 3LO3A 3P45B 1LWEB 2EFNA 5ITHA 2XS5A 1WC3A 3RJMB 4FS2A 1M5OC 3AHPA 3JSBA 4USWA 4CO1A 2F8MA 3GZ7A 1KQKA 4B3OB 4URQU 1S6OA 5KFVA 1VQ8S 1RHQB 1IWGA 1K44A 4PWWA 4ZVTB 3CGIA 4UT4A 2HGNA 5BR8F 1NK5A 4ZCKA 2Z2ZA 3TVKA 3ZZ0A 4DR1J 1W7WA 3UNYA 1WEYA 3A4TA 3MWBA 1NJIT 1HYSB 1NAQA 1UZHA 1N36F 3V5RA 3BH6B 1X5SA 2F4VF 2FD2A 4N77A 4DR7F 1NO8A 3QLHB 2MZ1A 3RAXA 3CIMA 4V19J 2HVEA 3DXSX 4YEAA 5KFAA 2XG8A 3KKFA 4AFFA 1NXIA 4DUYJ 1YTYA 3U1MA 3VZHA 1HI0P 2OEKA 1Q5VA 1T95A 2D7SA 2C2RA 2HIYA 3M32A 4RNHA 1JLEB 2XMMA 3BSOA 1CJTA 3Q8PB 3KHLA 4NLUA 3S1TA 2RIJA 3MM6B 1NHVA 4DUYF 1UPPA 4NYOA 4UTGA 3T5JA 4GVBA 4FN5A 3IAM9 2RT3A 1S97A 5J2PB 3AD9C 4A8YA 3OBIA 3I0SA 4K8RA 3PV8A 4Y34A 3GTYX 2V8PA 3NCQA 3GILA 4HHHA 4KIAA 1P9QC 2M2BA 3PHTA 3OL7A 4JV2A 5CZVA 4D3GA 2D9OA 2VG6A 4GMKA 2RE1A 1HKAA 2B56A 5JJBA 2MZJA 1IKYB 2N4CA 2PT0A 2PMZD 4DR6F 3CCVS 1OIAA 1N5YB 1R43A 4DU8A 4OHYA 1HMVA 2DITA 4H54A 4NA1A 3FUYA 4G1QA 4QW9A 2CQ3A 2ATLA 5DGBA 1FRMA 1LEOA 1N5VA 2QA2A 4DSKA 2G2OA 3TA1A 5HO4A 3FJ2A 3M9NB 3BBBA 3TUJC 3O6QA 2F4FA 3EGWB 4ECZA 3R1LA 3CDBA 4WFAQ 3W5XA 2PN6A 5KFLA 4X4OA 4FYVB 2V2ZA 1ICEB 4Y2CA 5GMEA 3BF4A 4G3IA 1FFGB 4YN3B 2DO4A 1S0OA 2Y1RI 1JXEA 1O8BA 1OJ4A 5L38A 4CLUA 4S0MA 1SC6A 3DRSB 3RB3A 5ETQA 1NDKA 3UCGA 4UQGA 1B4SA 3NAHA 4CM0A 4RNFA 3QAEA 1RYSA 3ZZUA 2HHVA 2OD6A 4ZVFA 3A3PB 5FD1A 2FZGB 2J7UA 4G1IA 5K14B 4EUVA 3HVTA 3IMQJ 2LXIA 3MPDA 2CFXA 2YNIB 3FBBA 4KE5A 4UQTA 3QRRA 1WNEA 1WTBA 3M32B 1TL1B 1RAHB 5F0WA 5T7LB 4V1Ak 2R2UA 1KKHA 5KFDA 2DY9A 4ZPCA 1HWLA 2D3O1 1SKRA 4NXMJ 3D2WA 3MAHA 3EZ5A 4EYIB 1VLOA 4FZVA 5IC4B 2XS7A 1U8WA 4RWWA 4X66F 3LP1A 1ZOTA 3PO5A 3IM8A 2GQQA 4ICLB 3PDNA 4ZP9A 2VFVA 3Q89A 3SI8A 3PRBA 2DKOB 4CNZA 2G2ZA 2JVRA 4LR8A 5KT5A 1QLNA 2CVEA 3C14A 2QJ3A 4UUXA 1HBNA 2NZCA 2ROPA 3EZUA 1CQMA 2DNMA 2WCXA 3BEGB 3HLUA 3CB4A 4OX6A 1VQNS 3FK4A 1MWYA 2MKCA 3LANA 5A8RA 4CLKA 1VQ9S 4I6YA 2VB6A 1NLKL 3FC9A 4EK2A 2QO3A 1BUXA 3BV8A 3MUMP 1NEEA 2KT2A 2DNZA 3BN7A 4CH0S 5A8WB 3MFIA 4ECVA 2DGOA 2WVBA 2OMOA 3D1QA 4DCOB 1TUGB 2LQBA 2EEYA 1AB8A 3FKBA 3GPAA 4NZ7A 3PYEA 5L9NA 4YHHJ 1NZAA 5KT7A 1UA1A 1SC4B 3OR2A 4Y00A 4IH5A 1FRLA 3W5ZA 4USTA 1BXNA 5LJ5Y 1FCAA 4RL1A 4DS4A 2R7QA 2UU9J 2YH0A 3GYNA 2PEBA 3QRQA 2GMLA 1F5BA 1JLCA 2DIVA 4C6AA 3OL9A 3K89A 1REVB 5HN0A 2HHUA 4DQRA 1VHFA 3MAAA 1S1TA 1RBAA 4ECYA 2ZD1B 2M9KA 2EC0A 4LSZB 4RPFA 2V8VA 3FZBA 3LF0A 4I6AA 5LM7E 4WJBA 2OAUA 2FLPA 2HHHF 1FWLA 3QNWB 4GKKJ 1U0SA 2YNHA 2ALYB 1FDBA 3C6UB 1WUUA 2IAJA 4FVMA 4HR2A 4ZVOB 3QRPA 1VBXA 5HJXA 2HYIB 4OYIA 1QDUB 1S1WA 3LP2A 3PJ9A 3PVXA 2QX0A 3BZQA 4C0OC 1KTQA 4BLGA 5AE3A 3TAPA 3LGHA 2IA0A 5E7OB 1LXJA 4Q43A 2IYGA 3W62A 2C22A 5AE1A 1UA0A 3CC4S 2JFDA 2KXHA 2M0GB 3A3OB 2HLTA 3J7YI 2YWGA 1SKSA 3E3XA 2HNZA 3CO0P 2DPIA 4PAAA 5JMNA 1PAUB 3DM2B 5G0RB 2VQFF 2HBRB 2HFSA 2HK2A 2V8DA 2R7OA 3OTDA 4R0EA 5D77A 3VF0B 3KK3B 2VICA 4PWDB 2EFQA 2VBWA 1J5OB 3I32A 1JLBA 5HJYA 4M5HA 2KVQE 4DCJB 1YJUA 2CNLB 1UKUA 5J1NA 4A48A 4UOFA 1JJCB 2H9ZA 1VQ5S 5A8WA 2MLYA 5HMXA 2ZKUA 1GMWD 4E98A 4CO2A 4DV3J 2XYPB 4IO1A 2E66A 2HS4A 4K4UA 2I8EA 2AQ4A 1KOOA 2MZSA 2CZVC 3LOUA 1IR2A 1FT8A 2EFOA 3FZ2A 1Y0HA 4DV5F 3BGFA 2AZ3A 1RWMB 4NXMF 4DQQA 3TR5A 1LOUA 2AJQA 1JLCB 3FBCA 2B4UA 2I9SA 3J7Z5 4Q8EA 4UOCA 3R2DJ 3ICLA 2HHHJ 1WJ9A 5F8LA 3UR3C 5DRKA 1LWXA 3T3FA 4CLZA 4ANCA 4F36A 1DQAA 1BQNA 1IM6A 1WD6A 4PG8A 5L9XA 1Q82T 3ZTSA 2R8HA 3RW6A 1FXLA 4GKJF 1BHNA 2GMHA 1RHUB 4TY9A 2Z4PA 2CWKA 1NK9A 2CRLA 4O23A 4P7VA 2BV3A 2OEMA 3QYYA 1BC6A 2XLJA 2UXBJ 2JL9A 1P27B 1VQYA 3IM9A 3POTA 5E3QA 3SEOA 3THVA 2AU0A 2ASLA 1NJXA 3I82A 1HLWA 4LF4F 3UR0A 3C3LA 3HI9A 1HQUB 2LA6A 3TNVA 5KFJA 1RAIB 3CMQA 2VBYA 3BS9A 3PRVA 3QFWA 3ZZZA 4CYUA 4N5SA 3EXCX 3VGTA 3RB6A 2HAFA 3M6VA 1K0VA 1FKPA 3QO9B 3R7BB 3NRBA 1AXQA 4IYQA 1BMQB 4JV1A 1UVMA 3BGRB 2R9LA 4MT1A 1V3SA 4O0NA 1UJ4A 2AF6A 1NK8A 4JI1J 1CJKB 2U2FA 5EGYA 1MN9A 1F5AA 2FLOA 2ZWOA 4DQSA 3QT8A 3FBFA 2C3MA 1XWLA 2MQLA 2LLZA 3V2UC 1V3RA 1VCTA 3R5JB 4ALZA 1VC0A 1H72C 1HQEB 3R7SB 2MZQA 2HNDA 2B9WA 3DHXA 1N88A 4I1TA 5LSLA 5A2QY 1VBYA 2E5LF 4NLSA 4RBUA 4ANEA 1G2EA 3NOGA 2RDIA 1TL1A 4A8KA 1U6BA 1IKXA 3H98A 4HI1A 5JVHQ 3M2VB 2YQ1A 2XWYA 3RW7A 3T6JA 2VPWB 3CCUS 1UVNA 2ALZA 2YQ3A 2RHSB 1HD0A 4ZA1A 4X65F 3CJQA 5H9EJ 3EGVA 3HHKA 2RQMA 4RW9A 5IV4A 4C48A 5GMKa 1O5JA 2HKEA 2NXUA 1LXNA 4URGA 3CDUA 2MKKA 1X5PA 2DXFA 3K2YA 5FIIA 3JSRA 4DL5A 4DI6A 1PJ6A 1CJVA 2KYXA 3M6XA 3CJ2A 1RTHA 2J76E 3NGDA 2DEIA 1S57A 1WG1A 3J81Y 1FHTA 2BYCA 4Z7YA 1VQ6S 1BGXT 4JBCA 1UZDA 2F7VA 4A8OA 1YZ6A 4KR0B 4NCBA 3MOJB 4FKYA 4C8ZA 1XBWA 5B0EA 5BYSA 1VRQC 2MLXA 5I4MA 1FJEB 3PFEA 4NXNF 2HVHA 1WEZA 5KT4A 2W9AA 1RB0A 4RNMA 1JIHA 2XQCA 5D3GB 3OW2R 3LWMA 1YWXA 4XTTA 1VIXA 3PCOB 1N0UA 4C98A 1HHQA 4F2RA 1I51B 4OX9F 5HQLA 3E2EA 3W9JA 3CTRA 3T1HJ 1DFDA 1FERA 2IRXA 1BQMB 4X62J 3DGPB 3HFZB 2V2QA 4DOZA 1R0AB 2ASDA 3RR7A 3HULA 1LK7A 4ED2A 2NZ4A 2YTCA 1RWXB 4CO5A 3PW7A 2RDJA 1HNWJ 2MYFA 2DHHA 3N5BA 2L48A 3I87A 4TYBA 3TQ1A 3M8QB 2WVFA 3MPUB 4U9RA 1P1LA 1FK9B 3QBCA 1UVIA 1OYEA 3H59A 4DL0C 5J2NB 1PYSB 2JHEA 1H2UX 3DDIA 2VKZG 3VV2B 4QBUA 3LTOA 2VU5A 4W98A 2NSBA 5KFHA 3OFEA 3JYTA 4DX6A 1WG4A 1S9GA 3KWMA 1HBUB 1WHWA 3OR1B 4DPUA 5E3PA 4JYAF 2D69A 1X8DA 5C24A 2HNDB 3E51A 2FJBB 4EI2A 4YB7A 4NL5A 1S1WB 3OTOF 2XC9A 4KKOB 4KSEB 2UUBF 1C4AA 4C0HA 2ZBCA 2R8GA 4DMZA 4L6V3 4YOEA 4NLRA 4DQPA 4UY8T 3IWNC 2X1GA 3PW0A 3ET6B 4OYZA 1N4LA 4PPZA 1NKBA 5HSPA 2KT5A 3OHBA 4O44A 2OHDA 2QC3A 2XLIA 1IJFB 1UMJA 3D3CJ 2KXFA 2NPIA 5KFCA 1D9FA 2XEXA 5A0YB 4RW7A 3RAQA 2Z30B 3FVYA 4LVOP 2YH1A 2KG1A 3CC2S 1GMVA 2HQFA 5BYRA 2VG6B 1G4CA 3HX9A 1RTIA 4LFCF 1ZM3A 1Q8IA 2NS1B 4M63A 2V34A 1YJWS 2P6SA 1N33J 1U02A 1QTNB 2RNEA 1NDPA 2VG7A 3DOMB 1IKXB 2FPHX 4O3PA 4CT9A 4USKA 4OHWA 3F73A 1PIEA 4WPAA 1PYTA 4JV5J 3MUVP 3L95X 1S1XA 2RILA 4HDHA 3TQEA 1KHWA 1C1BB 1FJGJ 2XY7A 5EX0A 3CMAS 5CABA 2P2CB 1YRTA 3QT6A 5ETVA 2GO9A 4J9RA 3PR4A 1RT3B 3S7RA 3V4MA 4CLWA 5LSRA 2F5GA 2FHKA 3BBCA 3C66A 3L09A 2KZZA 1V5VA 5F9LA 1LW2B 1KEKA 2CDRB 3GQCA 2FGOA 2HQDA 3D67A 3EZOA 5C2GA 3Q8SB 2KTQA 1RP5A 4UF4A 3CJRA 1A7GE 2H5IB 3IP0A 2A6MA 4LQ9A 1R31A 1KS2A 3QAUA 3GFHA 5C5JA 4I2PB 1LWCA 4WU2A 4OX9J 1NBEB 1QUPA 1S99A 4TXSA 5D3GA 1FRKA 4Q7AA 4QIEA 4BC7A 2OLWA 5J2NA 4FP9A 1MROB 3VGUA 1RCOB 3PFOA 3I55S 3I56S 1Y7PA 3AOAA 2R7TA 4QOTA 3ZZRA 1K8AT 1TELA 2ZE2A 2RRBA 2OGUA 3NG8A 3J81j 1CJUB 3RTVA 1HI1A 1TKXA 2HIQA 3A3NB 1YIJS 3UDVA 1NK7A 2YNIA 1JKHA 1WG5A 4DEZA 2MB0B 5IV3A 1WKLA 2DNRA 1U26A 4HVZA 2L3MA 3VGVA 2E9ZA 1FNMA 1TKZA 1U8SA 1SJ1A 3CCWA 3HHDA 4IFYB 1IKWB 5GVQA 2F1FA 3V81A 2JEIA 4W90B 3GSIA 4ZPAA 5C2CA 2MDAA 3KLFB 5B0GA 1HFEL 3IBFB 4H4OA 4GC6A 4HYKA 1L3KA 2N4DA 3SV3A 2DYAA 3LQVA 1GK8A 2E5IA 2M4MA 4LUBA 2UXDJ 4WF9Q 4RW7B 1KLMB 4RUAA 2POKA 3V6HA 3T1AA 3D7SB 1KWMA 2IJFA 1KP6A 2XZWA 3I9V9 3M2RB 3MMAB 5KFOA 3C2PA 5J2QB 2CQ4A 2VG7B 1QUVA 1VK3A 3Q8VA 4N7TA 4MKVA 2XYGB 3GJTB 4KGZB 3BSCA 5CYJA 5D4LA 2RAQA 3BH7B 3HSJA 2XULA 2IIHA 1X4CA 2VL1A 4KHPJ 4A8FA 4O3NA 1F60B 2J7KA 2K1RB 4F4WA 5AE2A 4ZHRB 2VODA 1X9MA 3AY0A 2VQFJ 1NKEA 2Y8YA 2KJWA 2QL9B 1VISA 4F0KA 4RNOA 3HXMA 1NK0A 1GEHA 4A4JA 3NNAA 3CD7A 2ZHOA 1N6QB 1VLYA 3TVYA 1SH0A 3SQOP 3KLIA 4PQUA 3KJFB 2AJ2A 4FXVA 2VKRA 4TY8A 2R8KA 1TV6B 2R4FA 5L1JA 2YKMB 3CNQP 5AT1B 1VR6A 4EEYA 3UE2A 4UOHA 2BOPA 3SDEB 1T03A 3IR6B 1XR7A 2HVIA 2HHSA 2EPIA 3DOMA 5LJ3Y 2Z58B 1HNZF 5FLXY 2J6UA 4JI2J 2IPOB 5DZ6A 4HI2A 1JLQB 2AP6A 1GXUA 2XS2A 1RWVB 3AJ2A 5IT9Y 1TL3B 2BUNA 3MEGB 3UWTA 1KN6A 2WB1D 2YNHB 1G1XA 3UO0A 1SL0A 2DRDA 2Q43A 3VAMA 3TI0A 4WYLA 2EFGA 1B64A 4A8SA 4YY3F 4NASA 2QE5A 1T8EA 3PR5B 2KJVA 1FKAF 1RWKB 2M88A 1OQ3A 1J2VA 3MMBA 3B4MA 2V63A 4LR7A 1Q95G 2VC1A 1DARA 1R8CA 4ETXA 3GIIA 3RBXA 3CW2C 5KFEA 1Q7LB 4QWDA 2NYIA 3LWLA 1XQIA 2JDJA 3M30A 2XMUA 3MCOA 2DIUA 3GV7B 4DL7A 1X7VA 3N6LA 4LIWA 4B3RF 4KB7A 5FJ4A 4LF7J 1XNQJ 4J9PA 3R2CJ 1UL3A 4ZJOA 1XNRJ 4KH1B 1HBMA 2LEAA 3C19A 3NL0A 4HHUA 2QA4S 1VMBA 3BKTA 4ATNA 2AT1B 4HL9A 2WONB 1U1QA 2WSEC 5L8RC 2UUAF 4N76A 1Z2ZA 4WK1A 1RJJA 1JJHA 1R7IA 2JVOA 3MM7A 4B3TF 4BS2A 3M7VA 1ZZNA 3KUEA 4K0KJ 1A0OB 4ZHRA 3K58A 4PWDA 2LQ5A 3BKUA 4IG0A 1R3NA 1RT4A 1RUSA 2NCKL 1Y9OA 2VPYB 3L9ZA 4P2SA 5HMYA 3KLHB 4EYHB 1N52B 3M9MB 2UUAJ 4JI3F 1CLFA 1OY8A 1DTTB 4Y2IA 5F9NA 5IWAF 2F8EX 2G13A 1IN0A 3DXBA 4GVBB 3PW2A 1H2VZ 3H2UB 2W01A 3KLIB 2C2KB 1HW9A 3VVTA 2DNOA 2IYIA 2DXDA 4R25A 4LBPA 4OZ3A 4X64F 8RUCA 4KGMA 3PACA 3OLAA 4PG7A 1YJRA 2PFDA 2D3ZA 4C8MA 4CIOA 4B9TA 1N5TA 2LQ8A 2DHAA 3KNAA 3OUYB 3DLLQ 1IVZA 2AW0A 5CD4H 2C2OB 2ZOFA 1BWEA 4RUHA 2OFGX 5C42A 2CQCA 4H4MA 2FJXA 4OZLA 2H5JB 1H7WA 2RKIA 3NGSA 2ZHAA 1H74A 2FHJA 1HR0F 1GAOA 1YDLA 1GMWA 3LA0A 4P9SA 3DLKA 3IG1A 3CULA 1SQEA 4OJGA 3NNCA 2KFYA 3POTB 2XY6A 2CJ9A 4ED8A 4RU9A 5D4OA 4C11B 3TANA 3IAS9 4DXLA 2DPJA 3T19A 2RVJA 3VTIA 1UFLA 1YQHA 4CWBA 5IQQA 4B3MF 3HJFA 2MPUA 3LPYA 3M8WA 3QGIA 5DZ7A 2UUCJ 3NY0A 4FYWB 2VF3A 2OELA 3B54A 1R8HA 3Q83A 1Y4ZB 2KT3A 2IC3B 3C16A 3ENQA 3TX0A 2J8SA 4WXWA 3ZFVA 5D0RA 4ECWA 3TZWA 3IS9A 2ZDPA 3DC2A 3NAIA 4Q45A 2QLJB 4KJIA 1PC5A 2R2RA 1L3SA 2FJWA 1MROA 1FXDA 2CA9A 3UVJA 3WHIA 1HBOA 2KO1A 3K5OA 1HBNB 4H4KA 5A6WA 4LBIA 3D0IE 4O3QA 5T7LA 4DR6J 4NLOA 3CJKA 2MHNA 4ELUA 4N8NA 1RT4B 3KLHA 2IFXA 1VRTB 3AAWB 3NBPA 1CS4A 1C0TA 2WB4A 3HZGA 5EDWA 2A3JA 4JP8A 3GIJA 4DV2J 4JI8J 3LP1B 1MMDA 1UEKA 2Y0SD 4P75A 4KFBA 4ICLA 2M8HA 2YNGA 3KTQA 1XNQF 3Q86A 3MAQA 1QSLA 4ED0A 3FRZA 2MQMA 5J2PA 1U6ZA 3AOBA 4K2XA 2MZTA 2GGPA 1MMLA 2ZD1A 3KG4A 3M8RA 3RB4A 2H65B 4OLPA 4RW8B 1OY9A 4ITSA 4O0IA 3H0PA 2ZH1A 3HDSA 1UEVA 4F25A 4QQBA 1W2BR 3P49B 4RU2A 3KHGA 2PC6A 2V2VA 2V0NA 4DR5J 2NLWA 4WZMA 4JV0A 3FSIA 3IRXA 4CLFA 4CNYA 3QJPA 3MEEA 4OZ5A 3UFCX 3VAGA 1TAUA 5HK4A 1FD8A 4I7FA 3MR6A 1Q79A 3LPEA 1J5EF 5KFMA 3KJQB 5KFNA 4U8YA 3I4HX 2KHDA 4X4QA 2QYCA 5I42B 3OFGA 3DI6A 5ADZA 2Q1LA 2HHTA 5HROB 2GW8A 3OUYA 4DQIA 3IGNA 2EK1A 4N41A 3QSYB 3CCSS 1SJQA 4X4VA 1RWOB 1V3ZA 2CDQA 1L3UA 2FB0A 2GS8A 5D4PA 1APSA 1RACB 3BR8A 2COLA 3X3UA 4RNNA 3LH2S 3NCRA 4NWBA 1AT1B 1FRHA 1VFJA 2JLFA 3GG0A 4MYTA 1VDHA 4FKXA 2CJYB 2K8GA 4ILMA 3M1VB 4IG3A 5DG7A 4CO3A 1HHSA 4EO6A 3IS9B 1S49A 4GRSA 5KFPA 2XO6A 1AW0A 4J5OA 3JYTB 3NNHA 4ZJQA 1CC8A 2ZWPA 5K14A 2G1HA 3CXCR 3H5YA 3VAHA 1T05A 2GIFA 2WSFC 4LFAJ 2W7PA 1FX4A 2IJNA 1QD1A 1RAAB 2C1EB 4PABA 4LF9J 2HGMA 2AJFE 4OYXA 2YWHA 3BSAA 3HHEA 2W9BB 1JLBB 1SBRA 2CNNB 2PMHA 2W9CA 1CS4B 2RS2A 4OI4A 4F2SA 2XI2A 2RRNA 1FE4A 1VGYA 4CRJA 1JLGA 2ZOGA 5HLFB 3NWGA 2D74B 3S8SA 2NYHA 3Q24A 5A2QU 1GTHA 3CDAA 7FD1A 4RW6A 2J0SD 2KVIA 2GC8A 2YWEA 3EDRB 3GONA 1T0TV 1RISA 4ZVRB 3D9BA 3KMSA 4O44B 4ZLLA 1H38A 1OO0B 4FF2A 4ZVGA 1R0CB 1KHVA 2VHGA 3T9NA 3ONQA 2CADA 2I6WA 1XEZA 2A1BA 2F8HA 3MHYA 3KLGB 3R1HA 1SL1A 4M94A 1UVKA 3KMQA 1WC4A 2ZVSA 4YB1P 1QE1A 2M3DA 4J91A 4U7CA 4AXIA 5KFGA 2NQPA 2BQ3A 3DOLB 3H90A 2B6AA 3FSYA 5SUHA 1O51A 4A8XA 2HRYA 3M4XA 4LF6J 1NSKL 1SIWB 2O67A 3VGSA 2ILYA 1JNZB 3HD2A 2BEFA 5CH7B 2MGZA 1RA6A 2AV5A 1RWWB 3AFGA 2OFHX 2V94A 1HL6A 1FA0A 4ZLPA 4KGXB 1Y10A 2MHEA 3QIPA 2B3TB 3ZXWA 1S9FA 1RHKB 4IR9A 1RT6A 1PGZA 3TUPA 5H9FK 1NSPA 3B82A 1YJVA 2QFIA 3LP0A 3MR2A 2AJ1A 3CCQS 1PJ7A 4TQRA 2FHOB 2FDNA 4CTAB 3KK2B 1W2IA 1HNVB 2XWXA 2YXLA 5IFMA 2E1PA 1Y3JA 3ZZOA 4C7QA 3MZIA 3DMJB 2E1MC 1NM2A 4EBDA 1JNRB 3T1HF 3DLEA 1FNOA 3FFIA 2XI3A 3A8KA 2QMUB 5IOLA 1T9WA 4DHVA 3G87A 2LDIA 1CJKA 3O44A 1DRZA 1Q8BA 4OLOA 3H8YA 2VA3A 2J9CA 2QA4G 3TAQA 3C6UA 4JUZA 2FHMA 3ISZA 1VQMS 5T14A 4RBVA 2HHXA 3MTKA 1GMUA 1UWAA 1BLUA 1R6YA 2MKSA 1TMMA 4ZPWR 5IM0A 2ZITA 3NP5A 1IWAA 4ZN1A 2L9DA 1RXOB 1CC7A 1GH8A 1V5IB 2WTFA 3EVOA 4FYXB 5DLGA 1NK4A 2NR0A 4MIAA 3WX8A 3ZNUA 3J80U 3IRWP 1RK8A 3LAMA 3EICA 1TMJA 1X4DA 3GJQB 4LRDA 1FKOB 4OV6A 2EWHA 4IFVB 5A8KA 2Q66A 1UW4A 2M52A 2K2PA 3HD1A 2X51A 1VBZA 1KLMA 2CZ4A 3QZ7A 2HNZB 2AEMA 2E7XA 3TX8A 3WZ0A 4C0BA 4CM2A 3AJ1A 4PWUA 4ZMMA 1KVIA 3IWXA 1PBUA 1IKYA 3OJUA 2HNYA 3DNCA 1WF1A 2HEKA 2O1PA 2FYXA 2NSCA 1PILA 1VOMA 3QGGA 4C8KA 2DR7A 4PUOA 1VRTA 2K1RA 2JEFA 1S6PB 4C8LA 4JI4J 3G9CA 4ENOA 4JI1F 1N34F 4J37A 4IH6A 3DDNA 2EBEA 4DL4A 1WC0A 4TLRA 1QAIA 4DFMA 4K4ZA 4ZPDA 3RU0A 2IY5B 2IVYA 4BHQA 4PXEA 4F3QA 1RT6B 1ZM4A 2WVDA 4PEOA 1S0VA 4DUZJ 3OVBA 1PSDA 1FWPA 2YKQA 4NCGB 1VC5A 1B7YB 2BQUA 3DMJA 3MM5B 4NX9A 2GJ2A 4IOBA 4ZCIA 4X62F 2YNFA 2ZC4A 1TQLA 3SBMA 2RRAA 1U1LA 1REGX 2I38A 4DR1F 2BA9A 1K73T 2ZZNA 1KNZA 1HWIA 3EE3A 1VQOS 3Q8UA 1FTCA 2AEJA 2X1BA 4A8QA 4X84A 2XYHB 2N3OA 3HVTB 1AROP 3F56A 4NXNJ 5HBMA 4XK8C 2G0JA 3PXGa 1CSJA 3CJ5A 3GCWP 3DYAA 3AJDA 4DX7A 2CG8A 2BDPA 3CIZA 2BMBA 1NSAA 4U7UD 4C4WA 2GZOA 2XMKA 2CPFA 1SCJB 1MNEA 3HJVA 3KHHA 1LWEA 5DM7Q 1EIYB 1UFKA 1R6VA 2IRUA 5D78A 4CYUB 2B5JB 4DV5J 1OY6A 2F65A 1RT2A 3K57A 2FLLA 5HATA 1HQ2A 4DR4F 2LYVA 4OYPA 2JFKA 4ES1A 1PKUA 5IQ6A 2DGTA 1L3TA 4OZ2A 1HWJA 2LP4A 2HFUA 3C15A 2MZRA 4XPCA 3EGNA 1KBRA 2M5YA 3FMWA 3I5BA 4ETZA 2JC0A 3KK1B 4YR2A 3VAIA 1WOSA 3FEXB 1D9DA 3CF5Q 1N48A 3SCIE 1D1UA 1U48A 5M2RA 3OXFA 5LOQA 3DRRB 1KC8T 1EQMA 1ZS6A 5HLFA 4RUCA 3N01A 2JWNA 1DURA 3KDNA 5AJ3J 4JI7F 5KFQA 3VAFA 4MIWA 3W2WB 1OWXA 3OR2B 4MH8A 2ZJPQ 2V4QA 1QAYA 4DV7F 4DFKA 1WC5A 2KKHA 4WIIA 4FF4A 2DVIA 4WTOB 2F40A 3BBFA 3VHQA 4HH1A 3HPOA 3L7UA 4ED1A 2OPPA 3Q2SC 3DRPB 4M5LA 5HMZA 1Y5NB 2VG5B 1U1NA 3W7BA 3A8EA 2GAGC 4IKAA 4DR4J 1IQTA 4B9VA 2K3IA 1NB7A 5HI7A 3CEDA 2IM1A 3T9ZA 5CQGA 2RKIB 4PUOB 2Q6CA 4K4WA 5C42B 3IC1A 3Q8YA 4DN9A 2HFOA 2MY7A 4YS2A 5F8NA 1U0HA 4WIQA 1F6TA 1HWUA 2C3UA 4DPOA 1WF0A 1MN7A 4QYRA 4X4TA 1FTRA 5HVHA 5DDOC 3Q8RB 5KAKA 4P2XA 4AL7A 1AUDA 5IT9U 4NYZA 3ITHB 4DSLA 1X9SA 2A0FB 4J9MA 1FD2A 4BBYA 2Z2MA 2KL8A 3WC0A 1EP4A 2HWHA 4B3OA 3H5UA 1RT2B 1RABB 1RAEB 2EBGA 2IC3A 5IS2A 3D68A 3I9ZA 3GFXA 5EHHA 2CPEA 3SCJE 5D4NA 4ZPBA 5KG3A 2W1BA 3O3LA 3LGNA 2L9WA 4KV8A 1AA1B 1RLCL 3DKDA 4CP5A 2BZ2A 2DY1A 3GSDA 4TKTA 2MTLA 5HBMB 2XO7A 1EAYC 4QU7A 1N5SA 1Y3KA 3C15B 3WIUA 5CZXA 4MMOA 2GIQA 2R8IA 2C2ZB 1RTJA 1UCNA 4M5DA 2GVZA 5AXMA 2Z56B 2DNYA 2RU9A 1TKZB 1M5SA 2JSXA 4F26A 4K4YA 3T5KA 4UZCA 1DLOB 1FJGF 5LXYA 2UVRA 3ET6A 2QLXA 4J9VA 4PPDA 1EHWA 1TR0A 2N82B 4ELTA 4OYWA 1YRXA 2R7XA 2CNKB 3P3DA 2XZDB 4QWBA 3UCUP 1TK5A 2ILZA 3D54A 2OPPB 2IDLA 3DU5A 4LRFA 1TVRB 5DDPC 3M2RA 3MMAA 4NLWA 4B3RJ 4KH0B 2QTWA 1RHMB 3DRPA 3KUGA 3MR7A 4P2FA 4OYOA 4CI0B 2O3DA 4TN2A 2UXDF 1D8ZA 4QR2A 3A8JA 2LMIA 2WHOA 3R6LB 4BDPA 3IGVA 2V67A 2X1AA 2KXNB 3R97A 2VDHA 2VV5A 2E7VA 1B70B 3DRRA 4QJVA 1I94J 4QYZK 4UZBA 3NCPA 4XO0A 5EX3A 2B9EA 2RMLA 2WOMB 3FGVA 4PXBA 4Q44A 1W25A 1GFWB 2J8AA 2PE8A 2CG4A 1TK0A 2UUTA 3R5BA 4C9DA 3T1YF 1FO1A 3SQGA 5ETRA 1KD1T 2ACMA 2H4YB 1DAXA 3BM7A 2CJBA 3I5CA 4G6VB 4ZPTR 4JYAJ 4NI2A 2UXCJ 1FXRA 1FFWB 3AD8C 3I6PA 1CULA 1RT5B 3SMZA 3EYZA 1GXLA 2K7JA 2XMTA 2XZTB 5CA5A 2RQCA 4BWJA 3MM5A 2UVWA 3JSYA 5E5NA 2V4JA 5E41A 1RHRB 2B4VA 1NCLA 1S77D 4DL2A 2FJVA 2XHCA 3BPDA 4KPCA 1Y5IB 4Y6IA 3FNNA 4I2QA 5HL7Q 1RKJA 3CMES 4F3MA 3NXZA 3TUIC 2UV8A 3QWUA 1DJ0A 2DNNA 1VIOA 2XMJA 4U7UK 3GE9A 5KFYA 2R7SA 2H5EA 1RT7A 1NMEB 2MKHA 4NE9C 2PGCA 3TP2A 1YI2S 6AT1B 2QL5B 5F8IA 2IJRA 3ZZTA 4ED3A 4ZS6A 4Z37A 2BJ9A 2BKOA 1JXVA 4LRBA 4ZCLA 1X4EA 2JX2A 1JLGB 2P9GA 1S4FA 4DPXA 3UNGC 2ZJQQ 3HKZD 4JI4F 5KFXA 1SJ4P 9RUBA 1DLOA 5D0HA 4EU0A 3V81B 3FBEA 4USHA 5HAOA 2HQGA 2HHPA 2HBQB 2IM0A 1T11A 5CYQB 4IQMA 2ASJA 2CPYA 1U6FA 4DV4J 3VZIA 3M05A 2DJWA 2OPRA 1Y5LB 5K9FA 1JX4A 2CQDA 4A46A 2FZKB 5D15A 3TRGA 4C3LA 4ZP8A 5ETLA 5DDQC 4UOGA 1XK8A 2V5HG 2YX1A 2OPQB 1P8GA 2R8JA 4USIA 1IR1A 1QVGR 2DNGA 1MWZA 4XDDA 2B6AB 1R8AA 1U47A 1ZZFA 1MSWD 2V8HA 1MLAA 4I69A 3DOLA 1D3WA 2MJUA 3G86A 2ACYA 3KXDA 3U02A 2W4CA 5KT6A 3CUNA 5KFRA 2V2KA 3IFEA 2Z2LA 4DPTA 3KLEB 4DV0J 1Z2LA 4NLXA 4ILLA 3TZYA 2LU1A 1F1BB 3ETOA 1Q8LA 4DSEA 3ILJA 2FVSA 3DRYA 3ILLA 3U1LA 1HA1A 2HFNA 3I0SB 1YKWA 3GJRB 4M5NA 4QR0A 2DNLA 4KTQA 1T9VA 2H51B 4LFAF 4HACB 3QIPB 3LP0B 1E6VA 3N6NA 1S9EA 1X5OA 3OXLA 3P4UB 5THWA 1EJ7L 1NH8A 3NOCA 5L1IA 4JI6F 1IBMF 1RAOA 3EVWA 3TJAA 4Q2MA 3OXGA 2GCFA 3SSSA 3O8WA 2E29A 2VZ9A 2GQ2A 2ZUAA 2RJZA 2JOQA 3Q0AA 1NH7A 3MEDB 4WKYA 2DHXA 3HFVA 4F4AA 4IOCQ 2XGQA 2Q6BA 4X4SA 5K8PA 2HBYB 1LNQA 2DR6A 5GAEU 2FJEB 5AXNA 1X9WA 4KGVB 1HBOB 1Y11A 1ZBTA 4E8UA 4WZQA 2M8DB 4ZDNA 3WIVA 1RKIA 2QN6B 4QW8A 4LVNP 5KG1A 1W26A 3K5MA 2DH8A 1FEHA 2Z57B 1F3FA 2FC9A 1HNXJ 3D1HA 3IA0A 3K8WA 2AMCB 2R7RA 2OSQA 1HI8A 1NZ8A 4WTYA 4I64A 3ZTPA 4D3HA 4U95A 3KYLA 1SJ3P 1X4GA 1T02A 3M30B 4QU6A 5HMWA 2WSCC 3R5DA 1U1OA 1KLNA 4NLVA 2V4JB 2XMAA 3SCKE 1WELA 3OJSA 3VQSA 4DPWA 2VQEJ 1FNXH 2Y8WA 2QL7B 2VFSA 5ETMA 5KFKA 3M8ZA 2MMYA 3SSQA 5C25A 3DM2A 4TQSA 5K8MA 1S59A 1G3OA 1ZAWA 2JEJA 3CO9A 5JXSA 1TKTB 3ELHA 1PO6A 3EM1A 3KHRA 4OL8A 4R5PA 3QGPA 4ZPVR 2MQNA 4DR7J 1B7FA 2ZVIA 5F8HA 3Q8QB 3OSNA 2XNRA 2GHWA 1L3VA 5MAOA 1K47A 2ZH6A 5F3TA 3DLGB 2QEXS 5JUMA 1RZMA 2FVPA 3MD3A 1U25A 3M2UB 3MCNA 1G6BA 3W5YA 4WE1A 4RKUC 1AYEA 3TZXA 4TU8A 4XIUA 4ID5B 4KPYA 1E6VB 2Y9HA 5A0YA 4RW9B 5DQGA 3AXMA 5H9EK 1B0TA 5GAGU 2IM3A 2PIIA 2PI5A 2BVZA 3BR9A 3DN9A 1S9EB 4L76A 5E33A 1HD1A 4M5KA 4O3RA 2HZCA 3PJWA 1RE1B 1RT1B 1YBUA 4O4RA 1URNA 3C6TA 2FY1A 3D3BJ 2R2SA 3IN5A 4I2PA 3ZC4A 3SSRA 1S1TB 3KNGA 3UQSA 1YJTA 2YNFB 2VIHA 5DS7A 3MEEB 3UD4P 4B02A 3KLEA 2ROEA 1GQEA 4YB5A 4ES2A 4YMEA 4ZITA 3CCJS 1KR4A 4DF4A 1OPZA 2QT7A 2XHWA 2IAJB 5KFTA 5KG0A 2HWIA 2XGPA 1Q81T 1WKKA 3NKYA 4CDIA 2HWTA 3T5HA 2GFFA 3T1YJ 3SQGB 4LR9A 1J5EJ 3CWJA 1P1TA 2J9DA 2V69A 4DL6A 1VYAA 1F5CA 1U45A 1IKWA 4ZOSA 3H5XA 3BKFA 2G4BA 3R5GA 1IBKJ 2B8PA 2FTRA 3GB0A 3OFHA 5KFZA 4ZLJA 5CHCB 4C8YA 4X4NA 1UEUA 4LFBJ 1LK5A 2HS3A 1S1VB 2RD5C 4ZIVA 2WRMA 2HURA 2CYYA 2GVDB 2AX0A 4M5IA 1RA7A 3PYDA 3E01B 2CQ2A 1JXLA 1WORA 2QMXA 4KHRA 1HNIA 1SVDA 3AB4B 3MMJA 1B3TA 1QTMA 3H7HB 2J6TA 5E0OA 2N7YA 3QMQA 1H0HB 3KOAA 1XC9A 1FJCA 4P73A 5CXTA 2DRAA 1Q4RA 5EWEA 2NUHA 3S6EA 5GAHU 1EX8A 1QVFR 2DHGA 3GCXP 3LALA 3J7A1 3NBPB 3X1LB 1AUSL 2CQIA 2GMJA 2J9EA 1C1CA 3W2VB 3DLGA 4K4XA 5DQIA 4NA3A 2GX8A 1WOOA 5LL6d 3F44A 4ES3A 3MUTP 3PW4A 1ROFA 1JWWA 2HAIA 3MM8B 2E44A 5I3UA 4MIBA 4B3TJ 4J9LA 1TV6A 2ZH5A 1HHTP 4OHXA 2DNHA 4B9SA 2GA7A 1EKRA 2R42A 4QIVA 5E3RA 4O3OA 5LXRA 3G6XA 4DCPB 1X4AA 1S10A 2GNKA 4KGKA 3M8PB 2RSQA 1NU4A 4FVCA 2EW9A 1PYOB 2H3EB 1CQNA 2VJUA 1TUWA 2KM8C 2W8LA 2B9XA 2R7WA 2QFJA 3UD5A 3SXLA 3J80Y 4L73A 2UUCF 3K0JA 2WK4A 4IQXA 1RDRA 4KO0A 1K9MT 4GKJJ 2IA6A 3BPSP 3BO2A 2DTJA 2RQKA 2AYGA 1QSSA 1FF2A 2QZ8A 3JTOA 1N6QA 4ECXA 4USJC 1UAWA 4PQUB 4ED6A 1KDNA 2NXCA 2CQPA 2VH7A 3W9IA 1ELOA 5IM0B 5HANA 2XSJB 4DSJA 4HACA 3CJTA 3O1LA 1RT1A 3BDEA 4R8UA 2MKIA 1F2HA 2P9EA 1Q86T 5BJRA 4L74A 4MTPA 4OYBA 3I31A 2BABA 1FKPB 5L1LA 1S0MA 4F4KA 1S1VA 1JLQA 2LDYA 3PIPQ 1RBOB 1XERA 3SV4A 3K5NA 1CVJA 5DO2A 2BM1A 4KQZA 5IXUA 3BDPA 1XR5A 1M1GA 2YPZA 5DETA 1NJZA 2FVRA 1N0VC 2E9TA 4HLBA 2HLUA 3OD2A 5L39A 2ZFHA 1HYSA 3BO3A 4FDFA 2MQ8A 4NLTA 2DNKA 5CCMA 1U24A 3F41A 2GJFA 3AA8A 4CLPA 4PG5A 2OJ3A 5B0CA 2BKNA 2KM8B 3R7NB 2VBZA 2LVWA 1RBLA 2XTJP 3M2VA 4FF1A 4JI3J 4PXDA 3TWZA 1LFPA 1FKOA 5KFSA 1TL4A 2YBVA 4M5MA 3TYTA 3MMCA 4QIFA 3AT1B 5I3UB 2BJ7A 4DV1F 3MPYA 5D8HB 3EX7B 4RZRA 3QATA 2B7BB 2K06A 4ELVA 3UN2A 3N28A 4UW2A 1CEZA 1SPBP 2FVQA 1SXLA 2AJ0A 3RBEA 4MYUA 1M1HA 5M2PA 2ZZMA 3D6FB 2RHQB 3JQKA 5HQMA 2Y0BB 2YKNA 1T9UA 2C42A 3CJ0A 2VJVA 2BKPA 4IH7A 1DY3A 5LMUF 3WBZA 4BC9A 4I68A 5GMDA 3CJ8A 2YWWA 4H4MB 4KO0B 4Y2MA 2DH9A 3N9UC 3W61A 3HP6A 1C1CB 3W2VA 2RUGA 3HHNB 2UVUA 1DTTA 2KRBA 3N5FA 4F4ZA 4MKYA 3H2VE 4H4KC 2YVSA 3NWRA 4AL5A 2UZAA 3R9LA 2HZAA 2P5VA 3FEZA 4LSNB 2MQOA 4Q2LA 1ZPWX 1WTFA 2VQEF 1U1PA 3C46A 3EPIA 1BQMA 4L3NA 3H2LA 3GR0A 2LXFA 3A1YG 2AGQA 2VC0A 3E8OA 4K5SA 4PYAA 3NGUA 1FDDA 3D6HB 5FDLA 4ZVQB 5GAHI 1PJ5A 5J2MB 4DPYA 3GIRA 4FNHA 3ZTOA 2B8QA 2KU7A 3BGUA 2CZ9A 2WW8A 2RDDA 3D6MB 4OHZA 3A13A 2HRUA 3SDEA 5KG4A 5A76A 1T03B 4JI2F 1HNZJ 3DLJA 2BRLA 3FFIB 3HHLD 3BN4A 3JAMY 3AODA 2C2DA 1U1MA 1RAJA 2HHWA 3KFWX 2E1AA 1VRUA 2VBXA 3QFHA 4I2QB 3RBZA 3JSMB 1FDAA 1F2GA 5D0EA 1RT7B 4F67A 1K1SA 2MKYA 4DV7J 1EB0A 2L9NA 1YBAA 3GYGA 4P72A 2XSJA 3CPWR 1XMQF 4X4PA 3O2IA 1S72S 1HR0J 1FRJA 2JNJA 2BANB 4JI7J 2QYGA 3HT0A 4C2MA 1N8RT 3VQTA 1NDCA 3T6BA 3DFEA 4DN0A 2F3JA 2J0QD 5HP1A 2DCLA 4K7QA 2B5JA 2CKWA 2KFZA 2EG2A 4ANDA 2D1CA 2IBKA 2W2OP 2JC1A 1YJ7A 2KFNA 2B51A 3BB5A 3UCZP 3VALA 3SIPB 1TL7A 3UDCA 3HHLC 1VBKA 3R27A 3RG6A 4IR1A 1N32J 3NS5A 2OPQA 3ZTQA 3OTCA 2WZ1A 5MLCV 3R6GB 3PKMA 1HNIB 4ERDA 3BGLA 5AXKA 1C2PA 4QCLA 1SQGA 4RX6A 1N5YA 2YKNB 2I5JA 2QSFA 2ZNYA 4IRCA 4AXJA 2VASA 5A8RB 2ZH7A 1C0TB 5K5MA 1VQSA 1XN9A 4IDKA 2JLEA 5IT4A 2MY8A 4JOUA 1S6PA 2NXEA 4J9QA 2HMIB 3HK2A 1S6QB 1X0PA 4G65A 2DGSA 1I3OB 2D3OR 1AZSB 4QWCA 1IKVB 1WKJA 5K8NA 4LF5F 3JXOA 2B7CB 2UUWA 4LIRA 2DD8S 2BW7A 1FX2A 2CAJA 2Q3PA 3B4DA 3CD0A 3KG1A 4LBHA 2CWXA 5AXLA 2G0CA 3NEKA 1OSCA 2DGXA 3TUZC 3GLJA 2LQ9A 3MECA 3HM9A 1S4EA 4RW4B 5CYMB 3KJVA 2IVFB 2RUSA 3MFHA 1M90T 1HNXF 2APOA 4OI0A 1QAJA 2DISA 2KN4A 3J7YU 5HVFA 4ZJLA 3EPGA 2ZH2A 4NOHA 4KYZA 4ZN3A 3IRXB 4FNIA 2AKWB 1MWQA 1O0PA 2E9RX 2R7UA 1WHVA 1F3VA 2DB1A 1RT3A 2SXLA 3JAMU 1WHXA 1F0XA 2ZEJA 3CJ3A 5F8JA 3ISND 1RTZA 2D9PA 4DLGA 3ENAA 4I56A 2M70A 2X3GA 2CXEA 3ENWA 3TEHB 3DYAB 4QPXA 2CJXB 4J7CA 3CVKA 3RBDA 3GJSB 7FDRA 1YHQS 3N0VA 1IBMJ 2L41A 4NEZA 1GTEA 1ZA2B 3IBWA 3IR7B 2XY5A 2DGUA 4QZVB 1U1KA 3QIDA 3MF5A 3QO9A 2EFPA 2UP1A 2DT9A 3B6BA 5B7WA 4OI3A 5C25B 4LF5J 1ACMB 2JRSA 4X4RA 1NRKA 1DQ9A 4DR2F 3D0GE 4DSFA 5KFFA 4PG6A 3P6YC 1CJVB 1YGYA 4ED5A 2HK3A 1TTHB 3U7JA 2HSEB 1KTVA 3HVWA 4X2BA 1OS5A 2BANA 2F9DA 2YPYA 3MDFA 3PJXA 2DR8A 4DJBA 4B9LA 2U1AA 2YX7A 2FIUA 4Q5VA 2XNQA 2GJIA 5C7PA 3PKYA 1S6QA 2AHOB 2XMWA 3JQJA 4OI1A 4IDKB 4TLQA 3UD3P 2HMIA 2NXNA 3HF5A 2IM2A 2P8IA 3M2UA 4N8OA 3J81U 2N7CA 1T05B 4LSLB 1Z4UA 4O4GB 2E7WA 5KG2A 2W4PA 4WKRA 2BBEA 1WHYA 4FPRA 4LQ3A 2QGFB 4NI2B 4FYYB 2YKMA 1A6LA 2DGWA 3FDSA 8AT1B 1EZZB 3CCTA 2PA3A 3C6TB 3NGRA 3MECB 4QR1A 4WBFA 1P6TA 2OSRA 2HHQA 8ATCB 2YKOA 2GAHC 4OMFG 3QJJA 1AFIA 2MEWA 2OO4A 5LSOA 3EWGA 2MSSA 3W8PA 1HMVB 2CQ1A 4GC7A 1ZETA 1UJ5A 5D6GA 2WOMA 2C3OA 4CZCA 5H1SV 3TJ8A 2PI4A 1JQGA 2DNPA 2X7IA 4MKAA 2XCAA 3TJ9A 4FYDA 1U0HB 1FRIA 2CQ0A 2WW4A 2OTJS 3SCLE 4UY85 4CLSA 1ZTWA 5B0BA 1D9AA 1TKDA 3LW5C 3EGZA 2LEBA 3MMBB 3BYPA 3V6KA 4DFJA 1C0UA 2WBRA 4R0JA 5BYQA 1UW9A 3V6JA 1D8YA 3PO4A 1JLFB 3R8YA 4USMA 5KT2A 2ERRA 1N33F 1YRUA 2KHCA 4CT8A 1EKSA 3OL6A 2XLKA 1ZTTA 2HS0A 2BR0A 4Y2AA 4LREA 4EFAC 2G2YA 2AYBA 3PRDA 2D41A 1RI7A 5ETSA 3DLEB 5KFWA 4XAKA 2BJ8A 3P5BP 3D28A 4PKDB 2A2DA 3W66A 4YDDB 4GKKF 3K8VA 1VQ4S 2RQ4A 3R3TA 3Q22A 4ECSA 3ZO7A 5D0GA 1HBUA 2FC8A 3RGIA 1IBLJ 4HDGA 1NK6A 2ZUGA 4XDCA 4Y65A 1EARA 5LMUJ 4P2MA 1JB0C 4DV4F 1F9EB 1HQEA 1LKZA 2A18A 4P6QA 2C3YA 4PR6A 2DNQA 4BWMA 2H48B 1FEEA 4J9KA 3DU6A 1LQ9A 2FZCB 3H4BA 1LWFB 3V6DA 2ABYA 3IWLA 2P9CA 4DV2F 3DRXA 4J9SA 3OV7A 4ECQA 3Q23A 4F02A 4Z2XA 4X64J 5JVGQ 2CQGA 1U09A 3VCDA 3RRHA 1SC1B 2G1DA 1VK8A 3EXYA 5EUHA 1JLAB 3TVZA 4ECUA 1ITPA 1F9FA 3EMTA 3FRYA 3IR5B 3MM9A 5AJ3F 3OVAA 1JMTA 4FF3A 4CLTA 4OI6A 4P52A 3I5AA 4OJ3A 4CLYA 3BO4A 3QQCD 5K20B 3KLGA 1RWNB 3L4BC 4OJ1A 5G4DA 4ZP7A 1NDLA 4WP9A 2BRKA 5F3ZA 1T94A 3QSIA 1REVA 4EMDA 3MGJA 4NYPA 2BE2B 2EC2A 4AQYJ 2DGQA 3ETMA 5I42A 4K0KF 1U2RA 2E5HA 5HVGA 2GHPA 3PX0A 3C8YA 1U2FA 3WDOA 4K5RA 2V9WA 3GP9A 3W8GA 1S1XB 1WEXA 4USVA 2KYZA 5K8OA 2QA1A 4B08A 3GWCA 2ZM6J 1ZH5A 1B0VA 3M8YA 4B3MJ 4LRCA 1VQKS 2OMLA 1HPZB 4WFXA 4LF4J 2RH3A 5GADI 3PG9A 4P74A 4RR5A 2OH2A 3MD1A 3VAKA 2AGPA 4AUKA 4JI0J 1M0SA 2VOOA 3FCHA 2W2MP 2AGOA 1YJNS 1FJ7A 1SQFA 2A2CA 1JLFA 2DRBA 4DSIA 2PFFB 3B8HA 1U2CA 1K1QA 2NXJA 2BQRA 2R3VA 3W65A 2LQJA 1A9NB 1IQZA 1WSVA 4AE5A 3BGOP 2JJ4D 3R5AA 1FESA 3AOCA 3FSXA 3FCVA 3GFYA 2BJ3A 3M1VA 4HTIA 4IG3B 4ZK7M 4YY3J 1K0TA 3NS7B 5DDRC 1HWKA 1VS3A 4A47A 4CO0A 2XB2D 4X4UA 2KRRA 2QRRA 2ZC3A 5KFUA 2ZE2B 1EETA 4Y3CA 2QG9B 3TAMB 2HVZA 2ADCA 4DFPA 3G6VA 3GR1A 3ZTRA 2BW2A 1B99A 2PMWA 4OZJA 4RUBA 2AYMA 2J9DE 4HT5A 3VWSA 3J7ZT 4MK7A 1J27A 4CLLA 4RWXA 1NB2A 2J0WA 4UUWA 2AX1A 2BACA 1KVJA 1YSJA 3MMCB 3FCWA 2VOPA 4PQAA 2V68A 3AH6A 2DH7A 1SI9A 2EK6A 4DV1J 4WFNQ 3MM9B 4QPTA 5CCLA 1X5TA 2HQCA 1S0NA 4DZ6A 1NPPA 2DXEA 3P96A 4WP8A 3DOKA 2VG5A 5G0RA 1YITS 2H1YA 4OJHA 1TKTA 3F0NA 4WWSA 3CCMS 4NMXA 3SFUA 3MPVA 5GAEI 2C3PA 2IDEA 1UP1A 3AB2B 4OZ1A 1H98A 1LWFA 1IJEB 4NEYA 3UN5A 4LF7F 3ZZYA 2Z2YB 3HSDA 3THTA 4F8RA 1CBKA 1X4FA 2X3DA 1TL3A 2XCPA 4ZVHA 3MCSA 2KG0A 3HT3A 4K2JA 4HEA9 3JTPA 4I7FB 4M8LA 3UDLA 1LW0A 3DGPA 3MURP 3MI7X 4OYAA 4ZVSB 3UPFA 3CD5A 1VJWA 1RGVA 4NLQA 2W7OA 2ADBA 1XMBA 4F4YA 4JI5F 1HQUA 2HGLA 3QWPA 3ITHA 4DV6F 4RW8A 3U27A 3PW5A 1QJHA 2QMWA 2IBOA 1KQGB 3JQMA 4KY3A 3DRSA 1MW7A 1PG5B 1RU1A 4KV8B 3VR1A 3OVSA 5T41A 2B0GA 3MEDA 3OSPA 3CCZA 2B9YA 3KJNB 1KFSA 1H2TZ 1EETB 3MEKA 2NUUG 9ATCB 1YZ7A 3PEJA 5L46A 3GV8B 2WONA 4PYDA 3G2XA 2CJQA 4K50A 1JJ2R 2HQIA 4ID8A 4OQJA 2Y1IA 5IWAJ 2GVZB 5HP1B 2CPIA 3L7PA 1WC1A 2OP5A 4YFUA 3OHAA 2VA2A 1KOHA 1S7IA 2HPUA 3U1NA 1TL5A 2EI5A 4Z7CA 1KSPA 3PEHA 4RW6B 4QIGA 2W8KA 1HW8A 1TK8A 2OKQA 3KLFA 2IHR1 1X4HA 4LFBF 3EJMA 2ZBPA 4AD6A 2HW3A 4B3SF 1N34J 4MK9A 2XBPA 4C3KA 5LMNF 1S48A 2WBMA 4JV5F 2LEPA 3H40A 4LMZA 1XNRF 2PSZA 2ZH9A 4RJVA 2W9CB 4M5DB 2AEFA 3P5TL 4X66J 4NLYA 2NREA 2FUG9 2ROGA 4R5PB 1IBLF 3A8IA 2AIRB 4ILRA 2HFZA 1WF2A 2GO8A 3CJSA 2UV8G 3TARA 1SKWA 1LV5A 4B9MA 4M95A 2VONA 4FXWA 3K59A 2MGZB 4DWIA 1PCAA 2XM3A 4C3MA 1XTZA 1GX6A 1OSDA 2LKZA 2FJDB 3DGVA 1NJYA 1DTQA 2LA4A 1SV5A 1M1KT 1IBKF 4LRAA 4C11A 1XIQA 2CVIA 3D0HE 2AYEA 1V9OA 3LAKA 3CDEA 4YUDA 3QZ8A 3MR3A 1H6KX 4DR2J 2J0XA 1S76D 4JI0F 3NMAA 1R0BG 1ZM9A 2CPJA 4EO8A 3I96A 4K59A 3WX4A 1LWCB 3W3SA 4P71A 3CD6S 1SH2A 5BR8J 1G7CB 5B0DA 4CQ1A 4HT7A 2OI2A 1SKUB 4G1QB 4WK3A 4M5JA 2ZM6F 2GHVC 4DUZF 3HVAA 4TU7A 1LW0B 2FLNA 1CPZA 5A6PA 3OQ2A 4U67Q 1ULRA 4Q0BB 3UVJB 2ZH3A 1ZYQA 1NSQA 2VD3A 2CPXA 3RRGA 4B9NA 1DQ8A 2KZMA 2V6AA 2ZZTA 1R8PA 2ZDOA 5L1KA 2W2NP 4R8UB 1R0AA 3UW1A 3O5TB 2Z8QA 1UFWA 2OEJA 3GMGA 4JI6J 4QYZJ 2P6TA 3M6WA 1NNDA 4WYWA 5CYQA 1YJ9S 3H4DA 4OX7A 4TYAA 4EBEA 2FGCA 1NPRA 2CQBA 2OPRB 4OIXA 1H7XA 1X60A 1SJFA 2LFVA 5EWFA 1XR6A 4DV0F 4IO9Q 4IRKA 1RAFB 1SJRA 4EBCA 4NMLA 2DO0A 2MQQA 4U8VA 3NS6A 3PM9A 2BJEA 3UI3A 2ZH8A 1BE4A 1UTAA 2G0IA 1QSYA 1UVJA 1YBTA 4YQWA 3FQKA 1Q16B 3PYFA 1BD6A 2GQCA 1RTJB 2MKJA 3W63A 2IRYA 2LECA 4OHVA 5J1PA 2N3LA 1N56A 5ETTA 1I1GA 5ETPA 1HARA 2BE9B 2YY3A 3CJ4A 4Y0FA 1JJ4A 3OTBA 4O3SA 4NZ0A 4F0MA 1KONA 2ZBIA 3R5CA 1SV5B 5H9FJ 2V4RA 1YVFA 1M5HA 4O4GA 4CH7A 3OTOJ 2XSFA 2HFVA 1BQXA 3CDWA 4DX5A 4NRTA 3BJYA 4PXCA 1WOPA 1YLXA 2VPZB 1RTIB 1QM9A 3DI6B 3GU0A 3VVUA 5DJBA 4CO4A 2BJ1A 2C2MB 3ADAC 1FVQA 5LMNJ 5J2MA 3NMRA 1D0EA 1X4BA 3OT9A 4URSA 2WVEA 3RAMA 3W60A 7AT1B 1MU2B 3ILIA 6FD1A 3J7AN 5CAAA 2QLFB 3WQPA 1C1BA 4OV1A 2L08A 2W4DA 3BYRA 5BXIA 4F4XA 1TZ0A 2H54B 3FMBA 3P8BB 4LJMA 4QWAA 2JEGA 4M5GA 1HNWF 3QJLA 3D5MA 1TUVA 3RRKA 4HHJA 1XMQJ 1FVSA 1UWBA 1UVLA 1CJUA 4Q0BA 1S1UA 2CIMA 1QAXA 4DG1A 3NGTA 3MOZA 3OLBA 1WC6A 5ETOA 3ULHA 3VAJA 4PZVA 1LW2A 4ECRA 4ED7A 1S6UA 5F41A 1C0UB 2AWZA 2Y1JA 2UXCF 1R27B 4LF6F 4L3KA 2DHSA 4IRDA 4DLEA 2YX4A 3HKWA 3EVMA 2V8GA 2HG4A 5IT0A 3MAAB 3AQPA 3DLHA 4YDXA 2QLBB 1OMSA 2V50A 2LU2A 3LUYA 3C16B 4NPOA 4OZNA 2C2EA 5KG7A 5DM6Q 1T7PA 3HO1A 4DL3A 2VPXB 3TA2A 3JSMA 2VFTA 2MXYA 2ZH4A 1SB6A 1DBDA 1T9XA 4LF1A 4OI2A 5CD4A 3CCES 4DR5F 4F0HA 4CCHA 4V19X 5F8GA 4IG0B 1H3DA 4C8NA 4GVLA 2I5JB 1RADB 1GT8A 3GG1A 4X65J 4DU7A 1MMNA 3V6DB 3PYGA 2OIHA 2BOAA 4PCQA 3PX6A 2AZ1A 1NUEA 1E6YA 2DEJA 3HZEA 4ZP6A 2W2QP 1V6HA 2CNOB 3MM6A 4IFYA 4L75A 4WP3A 1YX2A 1S12A 3HCXA 4K4TA 3AA9A 4FS1A 2UUBJ 4L72B 3W2WA 4KRWA 1TVRA 1VJQA 3T41A 3KLVA 1BY9A 2EFVA 4DV3F 2E5LJ 4NRUA 4WU3A 4A8WA 1UPMB 4TY8B 1U4BA 4JI8F 1OQ6A 1IBCB 4B9UA 3K17A 2PO4A 1PAEX 3TO8A 1Q5YA 1RWUA 2Z0GA 4Y2KA 1H73A 3KK1A 4GO5X 1ZM2A 4RW4A 5CYMA 2AD9A 1PBAA 4CTAA 5GAGI 3G6ES 2DCUB 3KDOA 3HFKA 4LF8F 1Z1ZA 3ILOA 3JS9A 1WI6A 3OFFA 1WSRA 3OPKA 3US5A 3HMJG 3SZ2A 4K4VA 2I0XA 3IG1B 2AJ4A 2CPHA 4I6WA 3D4JA 3MEGA 4KC5A 5DQHA 4ECTA 2QIFA 4G1PA 5GADU 4ZIWA 5KFIA 2EVZA 5E3AA 4DG1B 4LSNA 3HHLA 5KT3A 2MJNA 6FDRA 2VFUA 2VUGA 5E3CA 2J7WA 1FI4A 2NPFA 3G4SS 4IUFA 4NCAA 1QY7A 2GIRA 2HQ3A 2UXBF 2GV1A 1Q53A 1EP4B 3H42A 2E1CA 3D66A 5FDLB 3RR8A 3W1YC 3N79A 2W2PP 1RLDA 2FVCA 2OUGA 2PD1A 2PEHA 1N54B 1TAQA 1ZA1B 2J5AA 3M8QA 3RYLA 1X0FA 1FK9A 3K7RA 1RYRA 2BJDA 3BQ2A 2GVDA 3BGRA 4CH1A 3M9OB 5M2UA 2A6OA 3GFZA 4Q8FA 4WXOA 4WCEQ 5IZHA 1B0PA 4DV6J 4A8MP 2HVDA 4DUTA 5DGAA 3Q2TC 1FWKA 2C2NA 1VI7A 1YK9A 1I94F 4JI5J 2K7KA 1OYDA 4NZ6A 1P9YA 1IXKA 2ASYA 4MKBA 4F7VA 3V4IB 3G71S 1WDTA 2WAQD 2MQPA 1WI8A 4HKQA 4NLDA 4HH0A 1RCXB 2OTLS 1FFSB 1VC6A 5E2QA 3FEYB 3LGMA 1E6YB 3MCMA 4KFBB 4WFYA 4ZVEA 2DBBA 4M1KA 2LXUA 1T3NA 2F63A 2R7VA 1NPKA 2DK2A 4B3SJ 1Q7YT 2G9OA 3NGKA 2YWFA 4YHHF 1IR0A 1Q8KA 3BREA 4AQYF 4USUA 4LSLA 2FJAB 3DDKA 4J9UE 3MPWA 3SFGA 2KB2A 3DOKB 4QWEA 3CCLS 1I6JA 2KDOA 4BCAA 4ZKAA 1Q78A 3A12A 3HSGA 4I4BA 4F04B 2B43A 5F0UA 1RTHB 4ZLNA 3SYZA 3C14B 3TOQA 1N5QA 4HTJA 4J90A 4EWTA 3FQLA 4KAIA 1HIYA 1VHIA 3CT9A 4TVAB 1XMOJ 1Q0NA 2RF2B 3CE8A 4DR3J 1SUQA 3DLKB 1RTDA 2C28A 1LFWA 3UN3A 3D1OA 5J1EA 4FPIA 5HQ8A 3D6TB 3HHLB 1SL2A 1KQSR 3DLBA 1IKVA 4NLPA 1OPIA 2CJKA 4YR3A 3IO1A 2Y1LB 2W25A 1NHKL 3G82B 2O66A 2DGVA 5KFBA 4AYBD 4FBTA 2BX6A 2CPZA 2Q79A 1M5PC 4ZCMA 1NJWA 2UVVA 1RWPB 4YP3A 4GO7X 2LCWA 4I0WA 4DDFA 5F8MA 3WC2A 2OD4A 5B09A 4E0DA 2O5DA 2HBZB 4RO0A 4OFZA 1Q1KA 4EZ6A 4DF8A 5KG5A 1Y00A 5ETNA 2ZNZA 1KQFB 3EUNA 2MSTA 4ZVUB 3MR5A 2R2TA 2HRTA 3PIOQ 3QLHA 4XPEA 4NLGA 3S01A 1D09B 1S9GB 3OR1A 2FHJD 4DX8H 1UWBB 2YKPA 3H20A 1SIZA 1URRA 1F9HA 4KT0C 3LP2B 3HSZA 2QV6A 2YQ0A 3CJKB 1IM4A 2FQQB 3ENVA 4I67A 5B08A 1NHUA 4TNOA 4DR3F 2RB7A 2O01C 3I0RA 2WVCA 3DCAA 1SC3B 5DG9A 2FY8A 1XMOF 3OTEA 5EN1A 3G8SA 2YNGB 3W64A 2HZVA 4LF8J 1S5ZA 2VFRA 2YWKA 5KTQA 4IFVA 5A8KB 2B4OA 3CSKA 3PNIA 2IMOA 3JTNA 1R8BA 5FLXU 1QE1B 2I1RA 1J5OA 4ER8A 4WFBQ 3OL8A 5C24B 4MAKA 3IXQA 3KK3A 1L5UA 2IMWP 2MLZA 1FE0A 4W92B 5LT5A 3QT7A 4KKOA 4QIWD 3CCRS 2HNYB 2BE2A 3I4PA 1U49A 3QGHA 3DHWC 1DZ5A 1RAGB 4LFCJ 4B17A 2A10A 4N56A 1C4CA 4U96A 2RF2A 5DLFA 5J1EB 3UDEA 3KUHA 3GV5B 1JK9B 1RQ0A 2OPSA 2ZOMA 1KFDA 4LF2A 2Y3YA 4MFBB 4P10A 1VQPS 4WE1B 3HVRA 1RTDB 3AD7C 1JLAA 1RU2A 1DTQB 4PG4A 2K3KA 3G82A 2E5JA 2XMVA 1SH3A 3MM8A 3G8TA 3L3CA 1TFWA 1RSCA 1RHJB 5EWGA 4W4MA 1HNVA 5IC6B 1AFJA 2GGPB 3N4WA 2CQHA 3IBCB 3TEGA
chains in the Genus database with same CATH topology
1DHMA 4NCGA 2EG1A 3KG0A 4DS5A 2JZ5A 1U1RA 3H25A 4TU9A 3BSNA 4F3OA 3MXHP 1GX5A 4K4SA 3AQOA 3M8PA 2JLGA 1BQNB 5I3PA 2ZHBA 1NKCA 2RS8A 2W7AA 4AL6A 1ZPVA 2UU9F 1TP7A 2PA8D 4LT6A 4RLEA 1KRPA 4FXDA 2EKYA 4N47A 2JH3A 3TAMA 4YB6A 1M5KC 3H5SA 1TKXB 3G96A 3PY8A 3G8QA 3GYXB 3TA0A 3M8SA 1R89A 2X1FA 3PZPA 4P7TA 5HROA 2W24A 4YR0A 3K5LA 1TFYA 2YKAA 3QPIA 1VQLS 5B0AA 2D3UA 4DBQA 3L7OA 3N6MA 3GIMA 3GIKA 4KHPF 1GNKA 4H4OB 3CC7S 2J6SA 1S7HA 1YG0A 1HBMB 2V9KA 3JB9k 3E01A 2M7SA 1IUJA 3NLCA 1VRUB 4MK8A 3K5PA 2I2YA 4OZ0A 2BM0A 4J9NA 4Y28C 5KG6A 4FBUA 3MM7B 2RU3A 2DR5A 3TW0A 3T5LA 1JKHB 3B78A 1GXTA 1UETA 2CJAA 3ISNC 4KHMA 2W9BA 4C97A 3MTJA 2OPSB 4MFBA 2CPDA 1WWHA 3I0RB 4MJKA 3ZZPA 3BQ1A 1JLEA 3PX4A 4RBTA 1CG2A 2ZKTA 3G6YA 2IVMA 2PDAA 1T3OA 2BXJA 3THPA 5KOWA 4C8OA 1FRXA 2QSWA 4IOAQ 5J2QA 1N32F 2E5GA 4EZ9A 1FDNA 3KK2A 1WACA 1ZAVA 1RT5A 1UJ6A 5B0FA 4NA2A 4EGLA 4DR1F 2QLWA 5SZTA 4PRFA 3PHEA 3KJVB 2ZJRQ 1ZAXA 2DR9A 1M5VC 4LF9F 2KI2A 5I3QA 1MU2A 4U6PA 1U7LA 1SUQB 4WFZA 2E1RA 3RZAA 2KH9A 5KOXA 1S79A 2B4PA 4ID5A 1HPZA 4J9OA 4OX8A 1S1UB 3BQ0A 1PC4A 3M6UA 2F9JA 1VQ7S 4F50A 5U47A 5DG8A 4KBIA 3RB0A 3LO3A 2XS5A 1LWEB 2EFNA 5ITHA 1M5OC 4FS2A 3AHPA 3JSBA 4CO1A 2F8MA 3GZ7A 1KQKA 4B3OB 4URQU 1S6OA 5KFVA 1VQ8S 5BR8F 3CGIA 2HGNA 1NK5A 4ZCKA 3TVKA 3ZZ0A 1WEYA 3MWBA 1HYSB 1NJIT 1NAQA 1N36F 3V5RA 2F4VF 1X5SA 2FD2A 4N77A 4DR7F 1NO8A 3QLHB 2MZ1A 3RAXA 3CIMA 4V19J 3DXSX 4YEAA 5KFAA 2XG8A 3KKFA 4AFFA 1YTYA 1HI0P 3U1MA 3VZHA 2D7SA 1T95A 2C2RA 3M32A 4RNHA 1JLEB 2XMMA 3BSOA 3Q8PB 3KHLA 4NLUA 3S1TA 2RIJA 3MM6B 1NHVA 4DUYF 4NYOA 3T5JA 4FN5A 3IAM9 2RT3A 1S97A 5J2PB 4A8YA 3OBIA 3I0SA 3PV8A 4Y34A 3GILA 3NCQA 4KIAA 1P9QC 2M2BA 3OL7A 4JV2A 5CZVA 4D3GA 2D9OA 2VG6A 4GMKA 2RE1A 2B56A 5JJBA 2MZJA 1IKYB 2N4CA 2PT0A 2PMZD 4DR6F 3CCVS 1OIAA 1N5YB 1R43A 4OHYA 1HMVA 2DITA 4H54A 4NA1A 4G1QA 4QW9A 2ATLA 2CQ3A 5DGBA 1FRMA 1N5VA 2QA2A 4DSKA 3TA1A 5HO4A 3FJ2A 3TUJC 3O6QA 3EGWB 4ECZA 3R1LA 3CDBA 4WFAQ 2PN6A 5KFLA 4X4OA 4Y2CA 4G3IA 3BF4A 2DO4A 1S0OA 2Y1RI 1JXEA 1O8BA 5L38A 1SC6A 3DRSB 3RB3A 3UCGA 4UQGA 3NAHA 4RNFA 1RYSA 3QAEA 3ZZUA 2HHVA 2OD6A 4ZVFA 5FD1A 2J7UA 4G1IA 5K14B 4EUVA 3HVTA 2LXIA 2CFXA 2YNIB 4KE5A 4UQTA 1WTBA 3M32B 1TL1B 5F0WA 5T7LB 2R2UA 5KFDA 4ZPCA 1HWLA 1SKRA 3D2WA 3MAHA 3EZ5A 4EYIB 4FZVA 2XS7A 4RWWA 4X66F 3LP1A 1ZOTA 3PO5A 2GQQA 4ICLB 3PDNA 4ZP9A 2VFVA 3SI8A 3PRBA 4CNZA 5KT5A 2JVRA 1QLNA 2CVEA 4UUXA 1HBNA 2ROPA 3EZUA 3HLUA 1CQMA 2DNMA 2WCXA 3BEGB 1VQNS 3CB4A 4OX6A 1MWYA 2MKCA 3LANA 5A8RA 1VQ9S 4I6YA 2VB6A 2QO3A 3MUMP 3MFIA 1NEEA 2KT2A 2DNZA 3BN7A 4CH0S 5A8WB 4ECVA 2DGOA 2OMOA 3D1QA 2LQBA 4NZ7A 5L9NA 1UA1A 1NZAA 5KT7A 3OR2A 4Y00A 4IH5A 1FRLA 5LJ5Y 1FCAA 4DS4A 2R7QA 2YH0A 3GYNA 2GMLA 1F5BA 1JLCA 2DIVA 3OL9A 1REVB 5HN0A 2HHUA 1VHFA 1S1TA 4ECYA 2EC0A 2M9KA 2V8VA 3FZBA 3LF0A 4I6AA 2FLPA 4WJBA 2OAUA 2HHHF 2YNHA 1FDBA 3C6UB 2IAJA 4FVMA 1VBXA 2HYIB 1S1WA 3LP2A 3PVXA 3BZQA 4C0OC 1KTQA 5AE3A 3TAPA 2IA0A 5E7OB 1LXJA 4Q43A 2IYGA 2C22A 5AE1A 1UA0A 2JFDA 2KXHA 2M0GB 2HLTA 3J7YI 2YWGA 1SKSA 3E3XA 2HNZA 2DPIA 5G0RB 3DM2B 2VQFF 2V8DA 3OTDA 4R0EA 2R7OA 5D77A 3KK3B 3VF0B 4PWDB 2EFQA 2VBWA 1J5OB 3I32A 1JLBA 1YJUA 5J1NA 1UKUA 4A48A 1VQ5S 2H9ZA 5A8WA 5HMXA 2ZKUA 4E98A 4K4UA 4CO2A 4IO1A 2E66A 2HS4A 2I8EA 2AQ4A 1KOOA 2MZSA 2CZVC 3LOUA 1FT8A 3FZ2A 2EFOA 1Y0HA 4DV5F 3BGFA 4NXMF 4DQQA 3TR5A 1LOUA 2AJQA 1JLCB 2B4UA 2I9SA 3J7Z5 4Q8EA 4UOCA 3ICLA 5F8LA 3UR3C 5DRKA 3T3FA 1DQAA 1BQNA 1WD6A 4PG8A 5L9XA 1Q82T 2R8HA 1FXLA 3RW6A 4GKJF 2GMHA 4TY9A 2Z4PA 1NK9A 2CRLA 4O23A 4P7VA 2BV3A 3QYYA 1BC6A 2XLJA 2JL9A 1P27B 1VQYA 3POTA 5E3QA 3SEOA 3THVA 2ASLA 2AU0A 1NJXA 3I82A 4LF4F 3UR0A 3C3LA 3HI9A 1HQUB 2LA6A 3TNVA 5KFJA 3ZZZA 4N5SA 2VBYA 3BS9A 3EXCX 3RB6A 3M6VA 1K0VA 1FKPA 3QO9B 4IYQA 3NRBA 1AXQA 4JV1A 1UVMA 3BGRB 2R9LA 1V3SA 1NK8A 1UJ4A 2AF6A 2U2FA 5EGYA 1F5AA 2FLOA 4DQSA 4AUKA 2C3MA 1XWLA 2MQLA 2LLZA 3V2UC 1V3RA 4ALZA 1VC0A 1HQEB 2MZQA 2HNDA 2B9WA 3DHXA 1N88A 4I1TA 5LSLA 5A2QY 1VBYA 2E5LF 4NLSA 4RBUA 1G2EA 2RDIA 1TL1A 4A8KA 1U6BA 1IKXA 3H98A 4HI1A 5JVHQ 3M2VB 3T6JA 2XWYA 3RW7A 1UVNA 2VPWB 3CCUS 2ALZA 2YQ3A 1HD0A 4ZA1A 4X65F 4RW9A 3HHKA 2RQMA 5GMKa 1O5JA 2NXUA 4URGA 1LXNA 2ZJPQ 3CDUA 2MKKA 1X5PA 3K2YA 5FIIA 4DL5A 3JSRA 1T05A 2KYXA 3M6XA 3CJ2A 1RTHA 2J76E 3NGDA 1WG1A 3J81Y 1FHTA 2BYCA 1VQ6S 1BGXT 4JBCA 4NCBA 2F7VA 4A8OA 3MOJB 4KR0B 4C8ZA 1XBWA 5B0EA 5BYSA 5I4MA 1FJEB 3PFEA 4NXNF 2HVHA 1WEZA 5KT4A 2W9AA 5D3GB 4RNMA 1JIHA 3OW2R 3LWMA 1YWXA 1VIXA 1N0UA 4C98A 4F2RA 3E2EA 4OX9F 3CTRA 1DFDA 1FERA 2IRXA 1BQMB 1R0AB 4DOZA 2ASDA 3RR7A 4ED2A 1LK7A 2NZ4A 2YTCA 4CO5A 3PW7A 2RDJA 2MYFA 3N5BA 2L48A 3I87A 4TYBA 3TQ1A 3M8QB 4U9RA 1P1LA 1FK9B 1UVIA 3H59A 4DL0C 5J2NB 2JHEA 1H2UX 4QBUA 2VKZG 2NSBA 5KFHA 3OFEA 3JYTA 1WG4A 1S9GA 3KWMA 1HBUB 1WHWA 3OR1B 5E3PA 4JYAF 1X8DA 5C24A 2HNDB 3E51A 2FJBB 3OTOF 4YB7A 4NL5A 1S1WB 5H9EJ 2XC9A 4KKOB 4KSEB 2UUBF 1C4AA 4C0HA 2ZBCA 2R8GA 4DMZA 4L6V3 4YOEA 4NLRA 4DQPA 4UY8T 3IWNC 2X1GA 3PW0A 1N4LA 4PPZA 1NKBA 3OHBA 2KT5A 1H38A 4O44A 2XLIA 1D9FA 1IJFB 1UMJA 2KXFA 2NPIA 5KFCA 2XEXA 5A0YB 4RW7A 3RAQA 3FVYA 4LVOP 2YH1A 2KG1A 3CC2S 5BYRA 2VG6B 3HX9A 1RTIA 4LFCF 1ZM3A 1Q8IA 2NS1B 4M63A 1YJWS 2P6SA 2RNEA 2VG7A 1IKXB 2FPHX 4O3PA 4CT9A 4OHWA 3F73A 3MUVP 3L95X 1S1XA 2RILA 4HDHA 1KHWA 1C1BB 2XY7A 5EX0A 3CMAS 1YRTA 2GO9A 4J9RA 3PR4A 1RT3B 3S7RA 3V4MA 5LSRA 2FHKA 3C66A 3L09A 2KZZA 5F9LA 1LW2B 1KEKA 3GQCA 2FGOA 3Q8SB 1RP5A 1A7GE 4LQ9A 1R31A 1KS2A 3QAUA 3GFHA 5C5JA 4I2PB 1LWCA 4WU2A 5D3GA 1QUPA 1S99A 4TXSA 1FRKA 4Q7AA 4QIEA 4BC7A 2OLWA 5J2NA 4FP9A 1MROB 3I55S 3I56S 3PFOA 1Y7PA 2R7TA 4QOTA 3ZZRA 1K8AT 2ZE2A 2RRBA 3NG8A 3RTVA 1HI1A 1TKXA 2HIQA 1YIJS 1NK7A 2YNIA 1JKHA 1WG5A 4DEZA 2MB0B 2DNRA 1U26A 4HVZA 2L3MA 2E9ZA 1FNMA 1TKZA 1U8SA 1SJ1A 3CCWA 3HHDA 4IFYB 1IKWB 5GVQA 2F1FA 3V81A 2JEIA 4W90B 4ZPAA 2MDAA 3KLFB 5B0GA 1HFEL 4H4OA 4GC6A 4HYKA 1L3KA 2N4DA 3SV3A 3LQVA 2E5IA 2M4MA 4LUBA 4WF9Q 4RW7B 1KLMB 4RUAA 2POKA 3V6HA 3T1AA 2IJFA 3I9V9 3M2RB 2XZWA 3MMAB 5KFOA 3C2PA 5J2QB 2CQ4A 2VG7B 1QUVA 1VK3A 3BSCA 5CYJA 5D4LA 2XULA 1X4CA 2VL1A 4A8FA 4O3NA 1F60B 2J7KA 2K1RB 4F4WA 5AE2A 4ZHRB 2VODA 1X9MA 3AY0A 1NKEA 2KJWA 4RNOA 3HXMA 1NK0A 4A4JA 3NNAA 3CD7A 2ZHOA 1N6QB 1VLYA 3TVYA 1SH0A 3KLIA 4PQUA 4TY8A 4FXVA 2VKRA 2R8KA 1TV6B 2R4FA 5L1JA 2YKMB 3UE2A 2BOPA 2HVIA 3SDEB 1T03A 3IR6B 1XR7A 2HHSA 2EPIA 3DOMA 5LJ3Y 1HNZF 5FLXY 2J6UA 4HI2A 1JLQB 2AP6A 1GXUA 2XS2A 3AJ2A 5IT9Y 1TL3B 2BUNA 3MEGB 3UWTA 1KN6A 2WB1D 2YNHB 1G1XA 1SL0A 3VAMA 2Q43A 3TI0A 4WYLA 2EFGA 1B64A 4A8SA 4YY3F 2QE5A 1T8EA 3PR5B 2KJVA 1FKAF 2M88A 1OQ3A 1J2VA 3MMBA 3B4MA 2VC1A 1DARA 1R8CA 4ETXA 3GIIA 3V4IA 5KFEA 4QWDA 1Q7LB 3LWLA 2NYIA 4DL7A 2JDJA 3M30A 3GV7B 2XMUA 2DIUA 1X7VA 3N6LA 4LIWA 4B3RF 4KB7A 5FJ4A 4J9PA 1UL3A 1HBMA 2LEAA 3NL0A 2QA4S 1VMBA 4ATNA 1U1QA 4HL9A 2UUAF 2WONB 4N76A 2WSEC 5L8RC 1Z2ZA 4WK1A 1RJJA 1JJHA 1R7IA 2JVOA 3MM7A 4B3TF 4BS2A 1ZZNA 3K58A 4ZHRA 4PWDA 2LQ5A 4IG0A 1R3NA 1RT4A 4P2SA 2VPYB 1Y9OA 5HMYA 3KLHB 4EYHB 4ELVA 4JI3F 1N52B 3M9MB 1CLFA 1DTTB 4Y2IA 5F9NA 5IWAF 2F8EX 2G13A 1IN0A 3DXBA 3PW2A 1H2VZ 3H2UB 3KLIB 1HW9A 2DNOA 2IYIA 4R25A 4X64F 4KGMA 3PACA 3OLAA 4PG7A 1YJRA 4C8MA 2D3ZA 4CIOA 4B9TA 3KNAA 1N5TA 2DHAA 3OUYB 3DLLQ 2AW0A 5CD4H 2ZOFA 1BWEA 4RUHA 2OFGX 5C42A 2CQCA 4H4MA 2FJXA 4OZLA 2ZHAA 1H7WA 2RKIA 1HR0F 2FHJA 1GAOA 3DLKA 3IG1A 1SQEA 4OJGA 3NNCA 2KFYA 3POTB 2XY6A 2CJ9A 4ED8A 4RU9A 5D4OA 4C11B 3TANA 3IAS9 2DPJA 3T19A 2RVJA 3VTIA 1UFLA 1YQHA 5IQQA 4B3MF 3HJFA 2MPUA 3LPYA 3QGIA 1R8HA 1Y4ZB 2KT3A 2IC3B 3ENQA 4WXWA 3ZFVA 4ECWA 3IS9A 2ZDPA 3DC2A 3NAIA 4Q45A 4KJIA 1PC5A 2R2RA 1L3SA 2FJWA 1MROA 1FXDA 1HBOA 2KO1A 3K5OA 1HBNB 4H4KA 5A6WA 3D0IE 4O3QA 5T7LA 4NLOA 3CJKA 2MHNA 4ELUA 4N8NA 1RT4B 3KLHA 2IFXA 1VRTB 3AAWB 3NBPA 1C0TA 2WB4A 3HZGA 5EDWA 2A3JA 3GIJA 3LP1B 1MMDA 2Y0SD 4KFBA 4ICLA 2M8HA 2YNGA 3KTQA 1XNQF 3MAQA 1QSLA 3FRZA 2MQMA 5J2PA 1U6ZA 4K2XA 2MZTA 2GGPA 1MMLA 2ZD1A 3KG4A 3M8RA 3RB4A 4OLPA 4RW8B 4ITSA 4O0IA 2ZH1A