1AFJA

Structure of the mercury-bound form of merp, the periplasmic protein from the bacterial mercury detoxification system, nmr, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
ATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKATADAGYPSSVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Mercury detoxification
molecule keywords MERP
publication title Structures of the reduced and mercury-bound forms of MerP, the periplasmic protein from the bacterial mercury detoxification system.
pubmed doi rcsb
source organism Shigella flexneri
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1afjA00
3KG0A 5B0DA 3HHLD 4ZOSA 1CC8A 1JK9B 1FE0A 2OP5A 2QLWA 2XMWA 2OFGX 2AW0A 1TZ0A 3FMBA 3DCAA 3MCSA 1Q8LA 3HHLA 3MZIA 1RJJA 2ZDOA 4OJHA 4U9RA 5F0WA 1YJUA 2OD4A 5B0CA 2KT2A 1X0PA 2RILA 1AW0A 1CC7A 2AP6A 2JDJA 4EFAC 2W4PA 4NL5A 4Y2KA 2RMLA 4HH1A 2XMJA 2IFXA 2ASYA 2K2PA 1SQEA 3LGMA 4Q2LA 5K9FA 2KYZA 2HFOA 3UDCA 1FESA 2LQBA 2FIUA 2QIFA 1TL4A 3IWLA 4F67A 3F44A 5A6PA 3WDOA 5B09A 4DPOA 1S6OA 3GZ7A 5KAKA 1Q4RA 1N5TA 3BDEA 2IYIA 2ROEA 1YJTA 1SB6A 2GGPA 2W4DA 2XMMA 2N4DA 2BJDA 1KVIA 1N5QA 5T7LA 3TNVA 2EW9A 4OJ3A 4QOTA 1Y3KA 1FVQA 2K7KA 3BF4A 3QGPA 3CJKA 1N5SA 3HHLC 2BYCA 2PD1A 1GXUA 3BN7A 2IYGA 4HH0A 1TUVA 2L3MA 4YDXA 3TRGA 1S6UA 2W4CA 3HHLB 3KKFA 2N4CA 2QYCA 5B0GA 3KNGA 3IWXA 2LXFA 5B0EA 2LDIA 2VH7A 4NPOA 1QUPA 2ACYA 4Q2MA 2GV1A 2ROPA 5B0AA 1X7VA 1V3ZA 1APSA 1Y9OA 1CPZA 2K7JA 4DN9A 2BJEA 3FRYA 4ZA1A 1X8DA 2K1RA 1N5VA 1YJVA 3E8OA 4A46A 4OJGA 4DL0C 3QMQA 2HQIA 1Q53A 4YEAA 2HIQA 5B08A 2FTRA 3KG1A 4FNIA 2GO8A 2PGCA 5F0UA 2OD6A 2GGPB 2RSQA 2XMTA 5B0BA 5T7LB 1AFJA 1VQSA 1JWWA 2OKQA 1Y3JA 2RU9A 1MWZA 1KQKA 2GA7A 2OAUA 2FB0A 2HLTA 3LGNA 3CJKB 2BUNA 2XMKA 4A48A 4HI1A 1IUJA 1OQ3A 3FGVA 1P6TA 5A6WA 2FHMA 2LQ9A 2ZDPA 1GXTA 1U7LA 1OPZA 2HLUA 4OIXA 2GFFA 1LQ9A 4HI2A 5IXUA 3BR8A 4Y2MA 2XMVA 3DXSX 4A4JA 1YJRA 4HL9A 3BGUA 4OJ1A 1AFIA 2ROGA 3VTIA 1K0VA 2Q3PA 2QLXA 1FVSA 1FE4A 1R6YA 1OSDA 1WD6A 3T9NA 2GCFA 2CRLA 2G9OA 3HFKA 2K1RB 3HX9A 1XBWA 1VQYA 3I9ZA 1FD8A 1P8GA 5B0FA 3K7RA 2OMOA 4A47A 2KT3A 1TR0A 1OQ6A 2BBEA 4Y2IA 4FNHA 3TOQA 1W2IA 3BM7A 1SI9A 2KKHA 1Y0HA 3HDSA 1FEEA 2AJ1A 2N7YA 1MWYA 1URRA 3LO3A 2VV5A 1ULRA 1YRXA 3HF5A 2OFHX 3BB5A 1TL5A 1Q8BA 1YG0A 2AJ0A 2HFNA 1KVJA 2XMUA
chains in the Genus database with same CATH superfamily
2NZ4A 5HQMA 3PZPA 4JV1A 1QM9A 4DQSA 3IWNC 5HBMB 1Q8LA 2E1AA 3KK2A 2KZMA 4AL5A 2C3OA 2QMXA 4GKJF 3TX0A 4C8NA 3N9UC 4X64J 2WTFA 2BOAA 1NDLA 5B09A 1LWCB 5CCLA 2XGPA 1M5PC 3DLKA 3X3UA 3R7NB 3CIMA 2RQKA 2V94A 2QLFB 3IRXA 4X2BA 5D0HA 4FXDA 5KFUA 2KHDA 1QVFR 4DI6A 5H9FJ 4OHVA 3KDNA 3DLGB 1OJ4A 2EK1A 3I4HX 1EQ0A 3MECB 5ETOA 3S1TA 1TFWA 1LW2A 2J7UA 2EC0A 1RT5B 4JOUA 5KFVA 4B9NA 2CPYA 3IS9B 3OHAA 4HL9A 5JXSA 1RACB 1VIOA 3FDSA 3PCOB 4OZ0A 3RBZA 3M4XA 3GG1A 3OXLA 3TOQA 4CH7A 4DJBA 4CLFA 2XY6A 1RXOB 2V67A 4OMFG 3CJ0A 3QFWA 2VG7B 5B0DA 2QFIA 2AZ3A 1Q82T 4CI0B 2ZDOA 2MZQA 2LFVA 4ZPVR 3Q89A 3CCWA 1LKZA 1EIYB 3D1OA 4QR0A 1UWAA 1D1UA 1SJ1A 4RUCA 2C1EB 5J2MA 4J37A 5B7WA 2UVWA 1KQSR 4OQJA 3I4PA 2IRUA 1S0VA 2CPXA 4O3OA 4DX5A 2JL9A 1UPPA 4OYAA 2EFNA 4I6WA 5LSRA 3Q0AA 2NUUG 2RU3A 3RBDA 3T5KA 1NPPA 4CCHA 5IXUA 1NK0A 3UE2A 2NS1B 3TZYA 1HBUB 1XBWA 5HAOA 3BBBA 2N7CA 1C0UA 4QR1A 4BHQA 2AT1B 4DV4F 3OSNA 1T3OA 2QA4G 1DLOB 1RLDA 1MSWD 2QTWA 1RE1B 2JDJA 4IQMA 4F3QA 2J9DA 2ZHOA 1IM6A 3FJ2A 1BWEA 1KBRA 4P2XA 2MSTA 5CQGA 1CULB 1Y3KA 4DL3A 2FPHX 3HHLC 4KGMA 3ZTPA 3Q2TC 1SVDA 2OTLS 2HWIA 4ITSA 4URSA 5D6GA 2LXFA 2BJ8A 1YWXA 3OL9A 2LA6A 4DXLA 4FF1A 2ZWPA 2XSJB 3MM9B 3OFGA 2B6AA 4MAKA 3J7YU 5AT1B 3VWSA 1WKLA 2XMKA 2XI2A 2IM2A 2GVDB 1S9GB 3I0RB 1IKVA 3SI8A 4IO1A 2XZTB 4ETXA 3H4BA 4PCQA 3ZTSA 4ES1A 2YQ0A 3H7HB 2YWKA 2J0QD 3W5XA 5KG4A 3NOCA 3EZOA 3NGDA 1WNEA 2OPPA 3LWLA 3JS9A 3DMJB 4ZPWR 4PXDA 3AY0A 1RTJB 3HHEA 3KLGB 1LEOA 3D66A 2LQ5A 3W2WB 4WPAA 1JJ2R 3UDCA 3HVTA 3L7OA 2QGFB 4FZVA 2FLOA 3I55S 1ZH5A 3P3DA 3R27A 4TN2A 2DGWA 1P27B 1V3SA 3DKDA 1YBUA 2DHHA 4P2SA 4IKAA 3ZZTA 2DPIA 4DN9A 2W25A 2H65B 3W60A 1ELOA 2PSZA 1F9EB 2CWKA 1WEZA 2OGUA 1S9EB 3QPIA 3MWBA 2KYXA 3HJFA 2WRMA 3LH2S 4RW6A 3NL0A 2LEBA 1P6TA 3QZ7A 2AX0A 2PMWA 4IO9Q 4EBCA 1K8AT 2Z0GA 4IFVB 2ZD1A 1UL3A 2LA4A 1IN0A 3IG1B 3TW0A 1O51A 2X1FA 2GHPA 3GCWP 3EZUA 1ULRA 2H5JB 4G1IA 2DRDA 1JB0C 4LRAA 1G3OA 1DAXA 1PYTA 1WG1A 4ZIVA 4OYZA 1FCAA 4Y2KA 4CWBA 3H25A 4NXMF 3OL8A 2YH0A 3EXYA 2KN4A 3IBWA 2HHPA 1BHNA 1DTTA 2VBZA 3U27A 1HHQA 1W25A 3K5OA 1UTAA 2XYHB 4NA2A 3D5MA 3DI6A 5I3PA 5JJBA 4N7TA 3H2UB 5D15A 5ETMA 1OIAA 3W1YC 2ATCB 1F5BA 2UXCJ 1BUXA 2ROPA 4UOGA 1IKXB 3FRYA 1RTHA 4GKKF 2B9XA 1SC3B 3FEXB 2G2YA 1D9AA 2YKMB 1FHTA 1RAGB 1YQHA 4DUZJ 3MAAB 1V9OA 4HDGA 4OV1A 3FCVA 1VQKS 2J8AA 3P5TL 1JLFA 1TMJA 2A6MA 1KVJA 2VG5A 2DR5A 1FE0A 2OP5A 2DHAA 3QNWB 1X0PA 3DOLB 2AP6A 2XNRA 2RMLA 5J2QB 3DOMB 3R5JB 1IVZA 4FF2A 1H73A 1CQMA 3MEDA 3RB0A 1S72S 2DB1A 1V5VA 3HHKA 2IY5B 1PC5A 3R7SB 5KFCA 2HRUA 4G1PA 2K7JA 1WG5A 4JI3J 4C11A 4I64A 1NLKL 1QSYA 1Q5YA 3HSJA 1ZBTA 2CJQA 4I2PB 2YX4A 2E5IA 3ILLA 4WU2A 5IV3A 2OEMA 4LJMA 1SC6A 3T9NA 4PQAA 3ET6A 3BO3A 3PJ9A 5I42B 4B3SJ 2YPYA 4A47A 1QE1A 2B43A 2QSFA 5DQHA 1VISA 1J5EJ 2MQQA 5BXIA 2AJ0A 1UVJA 1EETB 5GADU 3I5CA 3JTOA 5E2QA 3GIRA 5LJ3Y 2BE2B 9ATCB 4GVBB 1H38A 2C2ZB 4F36A 3CCES 3IWLA 4EZ9A 2DIVA 4OX8A 4LBHA 2RVJA 5CZVA 2ZJPQ 2HVEA 3GZ7A 5SUHA 2EWHA 2IYIA 2JC0A 3B82A 1U0SA 4K8RA 4ZPDA 4LF5F 1ZYQA 4PXCA 2ZKTA 4DV0F 2W01A 1UVIA 2BQ3A 4LF7F 2IM3A 4HLBA 1UEKA 4LF2A 2LP4A 1B7YB 1NO8A 4DL7A 5HP1A 2K1RA 5KG5A 3PO4A 1HNZJ 4PG5A 1Q53A 1HBMA 3FSIA 1IR0A 4URGA 2QMUB 3L09A 2GW8A 4E8UA 3NBPA 2GHVC 2JFKA 3ELHA 4C4WA 4JYAF 1OPZA 1X5OA 4FPIA 4DUYJ 1IBKF 1K1SA 3QO9A 3KJVA 1RGVA 4EBEA 2PFFB 3TA2A 2M0GB 4YB5A 1VQPS 4C8YA 2KXNB 2BJ7A 1H2VZ 3LP0A 4Z7CA 1HQUB 1RT7A 2PE8A 5A2QY 2GHWA 2IA0A 3W2VA 2LQBA 2QMWA 2VBWA 4J9RA 3H98A 1H0HB 4LF4J 1SB6A 4P6QA 1Z1ZA 1GK8A 4M5DA 5KFFA 2AJFE 2WSFC 3I87A 4M95A 5L46A 5HO4A 2MJUA 5D0GA 2K3IA 5LL6d 4JI6J 3OSPA 3OVAA 5A2QU 5B08A 1S59A 4IYQA 1N6QB 3MF5A 3JB9k 1S99A 4C0HA 4I6YA 4NEZA 2J0WA 5D3GB 5A6WA 2G2ZA 1NJYA 4C6AA 3TUZC 2XC9A 3ZTQA 3DDKA 4XPCA 1TP7A 1RHJB 3C16A 1C1CA 2L9WA 1HYSA 2HNDB 3QIDA 4LSNB 1U09A 2CYYA 1MU2A 2EG1A 1F3VA 1SL0A 1VCTA 1U2RA 3BKFA 2FUG9 2Z4PA 2Q43A 1MNEA 4DR4J 5I3UB 2V2QA 3HT3A 2CZ9A 2KL8A 4Z2XA 2HGMA 3D6FB 3M30A 2VHGA 1JX4A 3NOGA 2Y8WA 4ZPBA 1CC7A 4FKYA 2IVYA 4OV6A 4JI4J 5HMXA 3QLHB 2F9JA 3OHBA 4PQUA 2CJKA 2Z58B 1A9NB 2UZAA 3FMWA 1ZZFA 2WVEA 4U8VA 2O66A 2W2NP 3WIVA 1IBMF 3KFWX 3FBFA 4IUFA 1GXUA 4ED3A 4NX9A 2NXUA 1WC0A 2BKOA 3FUYA 4CNZA 3OQ2A 2B4OA 4H4OA 2WHOA 4KHPF 3DLHA 4YN3B 3V4IB 2CDQA 3D6TB 1VHFA 1TL7A 1VK3A 2WONA 1IKWA 1IBCB 1G7CB 4HACB 5F41A 3G6XA 1LNQA 3HX9A 3UQSA 3K7RA 4ZPCA 2I38A 3RGIA 2DR8A 1GX5A 1RWKB 3K5MA 4TY8A 3BB5A 5GMKa 4ZS6A 2I6WA 1TKTA 4GO7X 2AKWB 3I96A 4RL1A 1H6KX 1HQEB 3CJ3A 4F4YA 3ITHA 1FJGJ 1B70B 3RAMA 1FNXH 4C9DA 2QX0A 2FLNA 3SEOA 2HBRB 3BKUA 4LBIA 2C2NA 4G3IA 2BANA 3D54A 1JNZB 3AODA 6FD1A 3QGPA 5AE3A 8AT1B 5FDLA 2MMYA 2DNQA 3MPYA 1UVKA 1LWEA 1V3ZA 1Y9OA 4UOHA 1UZHA 3C6UA 3NS6A 1UJ5A 4ZA1A 1X9WA 2DNPA 3DDIA 3ADAC 4OYWA 1LW0A 1X4BA 1URNA 3HK2A 2Q66A 4KE5A 2AGPA 1IXKA 1HPZA 2JLFA 3K58A 4ECQA 3RB6A 4NLQA 2SXLA 4KGXB 2H54B 2XCAA 4QJVA 2CPIA 3ZTOA 1SKSA 4WU3A 1O6XA 5CHCB 1P9YA 4MFBB 4W98A 2V34A 1RWVB 3GCXP 3KUHA 1RUSA 2VOOA 2D7SA 4DV1F 4ANCA 2V8HA 3SMZA 3CMAS 1R0AA 3HJVA 3O5TB 1JKHA 3VCDA 2MLYA 3W62A 4KPCA 2OMLA 4PRFA 3BQ1A 1FRLA 1YBTA 2YQ1A 2OPRA 3LGMA 3L9ZA 3T1HJ 2V2KA 3A1YG 3LP2B 1S10A 4IG3A 3AJ1A 3CJTA 4P73A 3CO0P 1VRTA 4YR3A 4K4VA 4IOAQ 3V4MA 2PC6A 5A76A 3G87A 3C2PA 3GILA 1AZSB 5DDRC 1F1BB 3M2UA 4P7VA 1YJVA 2J0SD 2HW3A 4N41A 2WVFA 2AWZA 4IOBA 2CG4A 1Y3JA 4QW8A 2W9BB 3EE3A 2ABYA 4K50A 4DG1B 1WDDA 2CUYA 2BM0A 2W9CB 3TZXA 1ZPVA 3B4DA 3PEHA 1K1QA 3DRRB 1H98A 3V5RA 3MCMA 1W2IA 1ZAWA 3QT8A 4O23A 1JNRB 3OD2A 2AEJA 2WVBA 1I94J 2KT5A 4YMEA 1FFGB 2HIYA 1FKOA 4NL5A 4BWJA 3OLBA 1NZAA 4IQXA 3T6JA 3E2EA 2DXFA 4CYUB 5IQ6A 4WYWA 3VGTA 1U0HA 8ATCB 1RT2B 4KBIA 5C42B 3CDUA 1U4BA 2XULA 4K4SA 2MKIA 1RU2A 1G6BA 4ECYA 4DV5J 5D4OA 2DGVA 2KFZA 3K8WA 4OL8A 3KG1A 1RT1B 3Q8SB 1A6LA 2JH3A 3R1HA 4N47A 4USWA 5A8WB 2Q1LA 2LEPA 1KHWA 3CD5A 1JLBB 4RLEA 5DRKA 4OIXA 2HZCA 4ZCLA 3DYAA 4F3MA 2GZOA 4C0BA 4DCOB 2F8MA 2EC2A 3SIPB 4KB7A 5LMUF 4IH5A 1BQMB 1VQ9S 2O1PA 4M8LA 3CDAA 4M5GA 2QG9B 5FD1A 1I1GA 2XMWA 4B3MF 2POKA 2ZZMA 1RDRA 4WXOA 4DV7J 3NCRA 1F9HA 3TVYA 2HZAA 2FIUA 3RR8A 1NNDA 4KAIA 2MLZA 1WELA 3NAHA 4WK1A 2B5JA 5K14B 1AYEA 1QY7A 1TUVA 2A0FB 5LXYA 3MOJB 2U1AA 2Y3YA 5KT6A 4NXNF 1IJFB 4PWWA 2D3ZA 5KT5A 4ZN1A 4AYBD 3KLEA 4AL6A 4TQRA 1FRKA 3KLVA 1ZTWA 2BJEA 3C14A 4DHVA 2Y1RI 2DJWA 2B56A 4CH0S 3GIKA 4P7TA 3EMTA 3JQKA 3LPEA 2QC3A 1SJ4P 1FA0A 3QFHA 1R8PA 4B02A 5M2RA 3UVJA 1DQAA 1RHKB 2OEKA 3R9LA 3TVZA 1SUQA 2ZKUA 5BR8J 2VJUA 2G2OA 3O6QA 3TJ9A 1Y0HA 3MEEB 3BJYA 2KH9A 2WSCC 3K5NA 3N6LA 3OT9A 2GAHC 5DM6Q 4DSIA 1KLNA 1WOOA 1WKJA 4K2JA 3M6XA 4QWAA 3BSAA 2MZSA 4Q0BB 1TUGB 4Y3CA 1FXRA 2AIRB 4CO3A 2M52A 3J7ZT 4IG0B 1RLCL 4CLPA 4E0DA 2LYVA 4A8QA 1QSSA 2VH7A 3M8PB 2KRBA 2KI2A 2YWHA 3OR1A 2OLWA 1L3TA 2HAIA 2H51B 1BQNB 2EBGA 2RH3A 2J5AA 4PPDA 1QTMA 3MMCA 2HMIB 4JV2A 1UW9A 3C15A 2BXJA 4ZP7A 1FWLA 4H4KC 4L73A 2BOPA 4JI1F 4MK8A 4RW9A 3BGUA 4G1QB 2KHCA 1FVSA 5KFJA 3VZHA 3PX4A 2XHCA 5K8MA 1FDBA 3T3FA 1PAEX 1T94A 4CRJA 4XDCA 4DOZA 1EKSA 2MY8A 3QJPA 5ETSA 2XWYA 3MCNA 2RS8A 3OBIA 4IDKB 4GKJJ 3PW7A 4WTOB 3JSMB 3W61A 1EZZB 3H42A 3DOKB 1Y5LB 1H7XA 4BS2A 2F65A 4RUHA 2R8GA 4UUXA 4NLOA 1RA7A 1RWOB 4EZ6A 2QYGA 2HHTA 2WOMA 3NMRA 4RBTA 2C3UA 1PC4A 1X4EA 4LQ3A 1N0VC 5HANA 2I9SA 3AJDA 3SBMA 1YBAA 1NMEB 3VAMA 2MPUA 4PWDA 1VS3A 5RUBA 1JLEB 5E41A 1U26A 1EJ7L 1N0UA 2OSQA 5HQLA 2CADA 2FC9A 3GONA 3OJUA 3WHIA 2HLUA 4YR0A 2AX1A 1YJWS 3DRXA 3BGRA 2CQCA 1U1NA 2JVRA 1GEHA 3ILJA 5ETLA 5DZ7A 1YDLA 2VPWB 1WTBA 2YKOA 1S1XA 2M3DA 1Y5IB 2XHWA 2HFOA 4RBVA 1Q8IA 2NR0A 2NPIA 1REVA 2W2PP 3NCQA 4OJ3A 3CDWA 3HFZB 2VQEF 3C66A 2GJFA 1HWKA 4IFYB 1NM2A 4ECUA 1TUWA 1HHTP 1C0UB 1CPZA 2HQGA 2FGCA 5KFTA 2R7XA 1FWKA 2IRYA 2R7QA 4OHWA 1L3VA 3A8IA 2E1RA 4NMXA 2DYAA 4N5SA 4I68A 2R2RA 5D8HB 3EVOA 3O2IA 2RUSA 5AXLA 2F8HA 4KC5A 4Y2MA 3C6TA 1E6YB 1N54B 5C25A 4QYRA 3OJSA 4DV4J 5MAOA 3QRPA 4ZP6A 1FRIA 1QLNA 1FX2A 2GAGC 3WIUA 3L7PA 5CYMA 2V8GA 1RWPB 3J81Y 2AW0A 2G0IA 4LF6J 3DN9A 4DF8A 2XLJA 1RHMB 4DFPA 3ZC4A 3HFVA 5C2GA 2BJDA 3CEDA 2DIUA 3D0IE 2YNIB 4Q43A 1NJIT 2P5VA 4LMZA 1JXVA 1RSCA 4LRDA 2LXUA 3GFZA 1IKYB 3I6PA 4BLGA 1VQ5S 4DR2F 3AD7C 1S1VB 4ETZA 4CIOA 2HIQA 2Q6CA 2OPPB 1DRZA 1S57A 1GH8A 1GQEA 1JLCA 1TL3A 2FB0A 4WFZA 3FK4A 3T5JA 3LAMA 2ZHBA 1S0OA 1T03A 1TAQA 5EN1A 2B3TB 1XK8A 1T05B 2RNEA 3HPOA 2OELA 1Q7LB 2YKPA 1L3KA 3FKBA 3HKZD 4L6V3 3BPSP 4QW9A 3EUNA 2IM1A 4ECVA 2CQDA 3QT7A 2ZBIA 4NLSA 3BSNA 2EI5A 4O3QA 2ATLA 4N76A 4DR3F 3UR3C 4RW4B 5JMNA 3HZEA 3ILIA 4MIAA 5GAEI 2I1RA 3DFEA 3OUYB 2PD1A 3ONQA 5AJ3F 4KV8A 2J6UA 3ZXWA 3BH6B 4Q2MA 3W64A 1K47A 4YEAA 1JXEA 4AT1B 3H2LA 3IA0A 3VAKA 3W5YA 4MT1A 2Z2YB 2YKNA 2V50A 3UW1A 4A48A 4ICLA 1HNVA 1WEYA 3SSSA 2CQPA 4ZVUB 4KGKA 4ZVSB 1FKPB 4OJ1A 4FN5A 2CPEA 2Q3PA 4WE1B 1VQ8S 5IOLA 4GO5X 2RRBA 3DI6B 3KHGA 1TFYA 3BEGB 2RD5C 3A13A 4IR1A 3M05A 4HEA9 1V6HA 3W9IA 4GVLA 2LKZA 1VLYA 3KG0A 3TAMA 5DJBA 4DS5A 1P1LA 1H2UX 2CNLB 4LR7A 4NXMJ 2QIFA 1Q8KA 4DFKA 4ZLJA 2LLZA 4AQYJ 2FDNA 3FFIA 1TV6B 3M8SA 4JI5J 4DSLA 1YI2S 3O3LA 3MM6A 2D9PA 1FFWB 1S0NA 2DBBA 1HMVA 1KR4A 3RZAA 4F7VA 3KNAA 4GKKJ 4KFBA 3C46A 2KFYA 3V2UC 5ETRA 4JBCA 4ZN3A 3ZNJ1 1Q81T 3I5AA 2GFFA 1S1UA 2UUAJ 4NRTA 4RWXA 1C1BB 1OSDA 3MEDB 3K17A 2H5IB 1IM4A 3TJ8A 1HKAA 2M8DB 3MM7B 1ZA2B 4CLSA 2VA3A 2C3YA 2VV5A 4KKOA 5HVFA 3N0VA 3H0PA 4RX6A 4M5NA 1HWLA 3BGFA 4NCBA 3CCJS 1N33F 4B9SA 3ENVA 1B0PA 4IRKA 3GJSB 2V8VA 3DRPA 4ZLPA 3AOAA 3R6GB 3O44A 2FZGB 4K7QA 3OTDA 1SV5A 1U25A 1JJCB 3FZBA 3ET6B 1NK9A 1YSJA 1ZM2A 4C3MA 2HHQA 3CD0A 1XR6A 1QE1B 4QR2A 4QZVB 1D9FA 5I3QA 1OY6A 2KTQA 3Q8RB 5EWGA 3N01A 2HQIA 3W3SA 2ZC3A 1WUUA 1T0TV 1PAUB 1YRTA 3QJJA 3K5LA 1VYAA 2E1PA 4OX9F 4UTGA 1FNOA 4F2RA 2HWTA 1PBUA 3R1LA 2ZOFA 2KDOA 3K59A 2QSWA 3CULA 4JB8B 2FJDB 4UY8T 3EGNA 2NUHA 3VVTA 2VONA 4F0KA 4FS2A 2A2CA 3CTRA 3V6JA 3PRBA 2AGOA 3QGGA 4Y2AA 1N32F 3ZTRA 4ZOSA 2IAJB 3V81B 4F4AA 4O0NA 5EHHA 4L75A 2KB2A 4JUZA 3GE9A 3KLFA 5L1LA 4DV2F 4WP3A 4DSEA 2A10A 3DLBA 3R2DJ 3MR3A 3WX8A 4LF5J 5AE2A 4PG7A 4DV0J 1UKUA 2E5HA 4LF7J 3KJVB 3PO5A 2KJWA 3WC0A 2YWFA 3ULHA 3J7YI 3VAGA 2A3JA 4X4VA 1EARA 3I82A 2HHWA 1RT4B 2QL7B 3A8EA 1YJNS 3LP0B 1RT7B 2GC8A 3LGNA 2BW2A 2IJRA 4FP9A 2LQ9A 4PXEA 3V6HA 1GMUA 3BBFA 1NB7A 1IBKJ 3AAWB 1TK5A 2NXJA 1UWBA 3NMAA 3I9ZA 1B99A 4DPTA 1KS2A 4U7CA 5KFKA 1HI0P 2V4QA 2G1DA 4TYBA 4M5DB 2HRYA 2DR7A 4IH6A 2C2RA 3QAUA 1WF1A 1IR1A 3M8YA 4DL5A 2XLIA 5CH7B 4ILLA 4EO8A 3PR5B 3MZIA 2HVZA 4L74A 1CS4A 4Q7AA 3TAQA 4A8MP 2D74B 4LSLA 3R5AA 2ZUGA 4PG6A 5A8KA 1HNIA 4DV3F 2DGUA 4C8LA 1UMJA 1UZDA 4X4QA 5LXRA 3A3NB 3NNCA 5EDWA 3LP1A 2OIHA 1NSAA 3LA0A 4FYXB 2BYCA 1AT1B 5A8RB 1T9WA 2D41A 1HYSB 4NOHA 5KFYA 1LK7A 1MU2B 2CNOB 2GV1A 4I0WA 2F63A 2W24A 2AEFA 2DR9A 4X65F 3M9OB 5BYQA 1RT6B 2E9TA 1N5YB 2GGPB 3KJQB 2BMBA 3PW2A 3M30B 1GTEA 3D2WA 4C48A 2VD3A 4HI1A 3GSIA 3MAQA 3PR4A 3CD6S 4B9LA 1KHVA 4EU0A 3VAJA 3VGUA 4O44A 4OI3A 3A8KA 1NCLA 5CXTA 4I1TA 3OW2R 2V4RA 1J5OA 4WXWA 3LO3A 3ISZA 4N8OA 3DGVA 2OSRA 2HHHJ 4R25A 4DBQA 4ED7A 1D8ZA 4Y65A 3QIPA 4EMDA 4OZ3A 3TANA 1RAAB 1RHQB 1VJQA 4TQSA 2ZFHA 1YIJS 5ETVA 3EYZA 3NCPA 4DEZA 2AYMA 2EFPA 5L9XA 2DO4A 4DL2A 3ETMA 1IBMJ 1Y7PA 4FVCA 4NLTA 3CJKA 2GJIA 1U1MA 4ZK7M 3UI3A 1K9MT 1WC6A 3IWXA 2DNGA 1CJKA 2MZTA 2JHEA 1WEXA 4A8YA 1MROA 2G1HA 4KHPJ 2UV8G 1K0TA 1CJUA 3F73A 4QQBA 5C24A 1TKTB 1U49A 2OAUA 3UCZP 3THTA 4YB6A 1S1TB 4PKDB 3G71S 1B64A 3FC9A 1VJWA 1WI8A 3OV7A 4USTA 1ACMB 2DGSA 5F8HA 3CCQS 4D3GA 2BANB 2CQ4A 1HWJA 5K20B 3HDSA 2FVSA 3CE8A 5FDLB 3P45B 2CPFA 2NYHA 3KK1A 2HFNA 3MFIA 3VV2B 3KLHA 3G4SS 1BQXA 1UPMB 5JVGQ 3Q8VA 4AE5A 1AW0A 2CPHA 3ZZYA 1RCOB 2QA2A 3JQJA 4U7UK 4KO0A 3KK3A 3G86A 3IM8A 1Z2ZA 1FESA 2HURA 2P8IA 4F67A 1RISA 1EHWA 4OYXA 5E3QA 4P2MA 4F4ZA 3PRDA 2HYIB 1UETA 2HHUA 1VQ6S 2Z56B 1N5QA 3RB3A 2RKIA 1FJ7A 1U6FA 3CC4S 2WZ1A 2W7PA 2CVEA 2NXNA 2W4CA 3CT9A 2XO7A 3HD2A 4YUDA 2HK3A 3NLCA 3MXHP 4X64F 2QE5A 3THPA 3OPKA 3GTYX 3GIIA 1B0TA 2DNRA 3M8WA 4B9VA 1BD6A 1JLQA 2JOQA 4G6VB 4ED5A 3FBEA 3BO2A 3HT0A 2VG6A 3TUJC 3EJMA 3CCTA 3CCSS 1U6ZA 2CJYB 5HBMA 2DGXA 3E01A 4J90A 3IC1A 2JEJA 4B3OA 2Q79A 1WG4A 3TP2A 1LWCA 1XNRF 3J7A1 4DV1J 3L7UA 1RKJA 1TVRB 2H5EA 3M1VB 4C98A 1ZTTA 4NYZA 4JI8F 5KT3A 2BJ1A 1JJHA 1NKCA 3NS7B 1YZ7A 4FS1A 4M5KA 5A6PA 1S6OA 2ASLA 1HWIA 3VR1A 4JP8A 3HHDA 2DK2A 1MMLA 5CZXA 4HVZA 2DH9A 3MECA 1Y5NB 3CGIA 3SCKE 1RT5A 3B6BA 5B0GA 3IS9A 2D1CA 4KR0B 3BSOA 3VQSA 3N28A 2FVQA 3PHTA 5A0YA 2FJEB 1WHVA 3F0NA 1NZ8A 4DL0C 4LIRA 1S48A 3UCGA 1M1KT 5LSLA 2DNZA 2HVIA 2VG7A 2X51A 1ROFA 4CLUA 1VQLS 4DR5J 3KJNB 2IM0A 3PHEA 4EWTA 4WYLA 1U0HB 4LFCF 1WI6A 4PYDA 1WC4A 4WF9Q 3VAIA 3MPDA 3M32B 4UW2A 1RAHB 1Q8BA 3G6ES 3N6MA 4K2XA 3LUYA 1HBOB 4O3NA 1UVMA 5JUMA 2F7VA 4OZ2A 5KT2A 1SXLA 1TL4A 1W7WA 4ANDA 5KTQA 3UDEA 2LQ8A 2ROEA 2MQMA 1CJVB 2GMJA 1KQFB 2FHKA 4Y28C 1L3UA 2JLGA 4F04B 1S6PA 3O8WA 4MK9A 3HXMA 4OYBA 4FXWA 1HBUA 3PV8A 3JAMY 4M5MA 2GVZA 4NYOA 1NK5A 4E2FB 1D09B 1M5KC 2HG4A 1R0BG 4MKYA 4Q8EA 4L3NA 2VA2A 2F40A 3BN4A 1Q86T 4ZVPB 1NJWA 3NG8A 3R7BB 3P4UB 1S77D 1QAXA 2MGZB 3KYLA 5KG0A 2UU9F 3D67A 4NCGA 2L9NA 1AUDA 3MI7X 2C28A 1AA1B 1IBLF 3ETOA 3C19A 2I5JB 5IC6B 3P6YC 4CTAA 3SCJE 3GJQB 4ES2A 3BKTA 1N48A 2CFXA 3HHNB 3PNIA 4B3MJ 4DDFA 1KOHA 1RJJA 5HLFA 3A12A 4EEYA 4YHHF 3MM9A 4LFBF 4Q44A 1SKUB 2RE1A 2X1AA 1Q4RA 2YY3A 1FRXA 5T41A 4FBTA 4AFFA 3A8JA 1RTIA 1X60A 2CWXA 5DS7A 3GSDA 2IMWP 2P6TA 2OO4A 9RUBA 3RBXA 2LECA 4P10A 3MTJA 5DDQC 1S9GA 3I0RA 1F3FA 1S6QB 1NJZA 5KFNA 3CCUS 1RWUA 2OJ3A 2Y0SD 5K8OA 3SCLE 3Q8YA 2G0CA 2BUNA 4IR9A 5KFIA 3AH6A 4OFZA 1WSRA 3DHXA 1UFLA 4J9LA 1J2VA 1RTJA 1CG2A 2C2KB 2HS4A 3KLGA 3TEGA 2IMOA 3W2WA 1M90T 5KFDA 3IRWP 2ZBPA 4A8SA 3QT6A 3K8VA 5F3TA 3ENWA 1KTVA 2XMUA 3R5GA 4KT0C 3NKYA 2CJBA 4FDFA 2KM8B 1H7WA 2QFJA 4F0HA 2FJAB 4URQU 1S9EA 2HGNA 4ILMA 4I67A 5IT4A 1MN7A 3PW4A 3AB2B 3N4WA 1SCJB 2DNYA 1SH0A 4DFMA 1B7FA 1U48A 4CT9A 4DQQA 4R8UB 1YLXA 2N82B 5GAGU 4IFVA 1XMQJ 4B17A 3GP9A 4H4MB 1M1HA 3IG1A 2MKYA 5KFZA 4QIVA 5FLXU 1G1XA 2F4FA 4ECTA 4ZKAA 3J80U 1FJEB 1YK9A 4C3KA 2MZJA 1E6VB 2RT3A 1NHUA 5KT4A 4RKUC 2E7VA 4WBFA 2RQCA 2CPZA 1PJ5A 5LMNF 5ETNA 3MMBB 2CXEA 3FBBA 2E1MC 4TKTA 3SDEB 1TMMA 5KFAA 2H4YB 1MWYA 4KY3A 2B8QA 2Z30B 3OFFA 1H3DA 4YY3F 3MM5A 3G6VA 4PG4A 4M5IA 2VJVA 1GMWD 1U2FA 4EYIB 2F1FA 3GV8B 2KJVA 5DDOC 2B51A 4B9TA 2BV3A 3R5BA 2R8JA 1KTQA 4ZVOB 2XS7A 2BX6A 4DQRA 2QA4S 2D9OA 2MQPA 2HFVA 5E3RA 1NKEA 3EICA 2DNOA 2WBMA 3E8OA 1RKIA 2KZZA 3RYLA 1MW7A 3E3XA 2Y1IA 3KWMA 1VQSA 3UDVA 1I3OB 3BS9A 2RDIA 1NH7A 2XEXA 3CW2C 1X5SA 3M8ZA 3H59A 1RAIB 1DTQB 2PI5A 4K0KF 3DOMA 5L1JA 3PW0A 3CVKA 1ZS6A 3R3TA 3FCHA 2V2ZA 2H9ZA 1UCNA 4ECSA 2ZH8A 4IH7A 3RG6A 3L3CA 4XDDA 4ENOA 2DH7A 3LANA 4DU8A 1QUVA 1TKXB 3OTEA 2QLWA 1TQLA 4K4UA 2A18A 1T95A 5B0CA 1FXLA 4RNMA 3IP0A 5U47A 4DFJA 5DGBA 2WW4A 1RTZA 2H48B 5CYJA 1Q5VA 1FD2A 1J5EF 4DS4A 1S9FA 4C8OA 1OYEA 3RR7A 1R6VA 2DVIA 2KU7A 2RJZA 4I2PA 5F8LA 3RBEA 2VQEJ 1T11A 4DL6A 1BXNA 3PFOA 3VAFA 3IM9A 1WTFA 2HFSA 3Q24A 5HMWA 5I42A 2VU5A 3FRZA 4P52A 1MWQA 2V68A 1VDHA 2GS8A 4OI2A 2PO4A 1EP4A 4P2FA 4WP9A 1X4AA 1AFIA 4NE9C 2CRLA 2UUBF 3HZGA 1BLUA 2BE2A 1FD8A 1NSQA 3T19A 2PIIA 2HFZA 5HK4A 4F2SA 5D0RA 3U7JA 1K44A 1XC9A 1YG0A 2CJXB 3KUEA 5J2NB 4DUYF 3TA0A 4ZVQB 3D1QA 3VZIA 5GAHU 2EXUA 3W8PA 1KLMB 4I2QB 2K2PA 4UF4A 4ES3A 2U2FA 4R5PB 4J9VA 4R0EA 4ANEA 1PYSB 3D28A 4N56A 2AEMA 3JYTB 4J7CA 4MYTA 3F56A 2YNFB 2ZH7A 1JXLA 2K7KA 3BF4A 1PIEA 2FJXA 3TRGA 3VAHA 2FZCB 1ICEB 3OTOJ 4XTTA 4DR2J 3FQKA 1M5VC 4MTPA 5GVQA 2FVPA 4OZNA 3THVA 6AT1B 4XPEA 4QWCA 2QO3A 5ETPA 2JEGA 4I7FB 1HQUA 3VTIA 1GXLA 2MHEA 3H5UA 4ELVA 3NY0A 5DETA 2DRAA 4OLOA 3HFKA 1XMOF 1P8GA 3GFXA 2IJFA 2KXFA 2IBKA 2R7TA 3BGLA 4WKRA 3PY8A 4F4XA 1T8EA 3JXOA 5J1NA 2CIMA 5HVGA 2EK6A 5H9EK 3R2CJ 4J9OA 3PW5A 4B3TJ 3OVSA 2MQOA 4OI4A 1HBNB 2M70A 3H4DA 2YVSA 3RAQA 3MUMP 5EGYA 4DR3J 3B54A 2CVIA 2HQFA 1XIQA 1WC1A 2N3OA 3ISND 1VRQC 1YJTA 2FY1A 2YBVA 5KFWA 1L3SA 4AXJA 3WZ0A 5L1IA 2L3MA 5D3GA 4RNNA 4UZBA 5AJ3J 4JI4F 1R8CA 2N4CA 2GMHA 2CQ0A 4PUOB 1JIHA 4KIAA 3HP6A 3AHPA 2PT0A 1TK8A 2XWXA 4CO2A 4LSNA 2BRKA 2J7KA 3TAMB 4EUVA 1M5OC 5KFOA 3V6DB 4ZJOA 3SQGB 5I3UA 3W65A 4L3KA 3GJRB 2YNGB 2NSCA 4Y34A 4DF4A 4MJKA 3ZZUA 3PACA 5KFBA 1NKBA 3G9CA 3QLHA 2IDLA 2OEJA 3O1LA 1FEEA 2LDYA 2YNHB 1VRUB 2B8PA 3MM6B 2X3GA 2NXEA 3WX4A 4A8WA 3CNQP 4DCJB 2QL5B 1HMVB 2BQUA 1F5AA 2YQ3A 1MLAA 1GNKA 4KFBB 2Z2LA 2FHOB 1DY3A 2R9LA 1F5CA 4YP3A 3HI9A 3V4IA 1S1UB 3QWUA 2OUGA 4YDDB 5J2PB 1WACA 1DFDA 2MKHA 2NLWA 1I51B 2WAQD 3CCLS 4HACA 2HS0A 2M88A 3GFYA 2XBPA 2W1BA 3KOAA 3BREA 1S97A 3QGHA 1XERA 4NA3A 4KRWA 4CO0A 4NLYA 2FLLA 2P2CB 3R8YA 3QRRA 2X7IA 1LXJA 1ZM3A 3UWTA 1Y11A 4KHRA 1LQ9A 2Z57B 3DU5A 3OFEA 1HQEA 3MTKA 3RJMB 2HQDA 1H72C 2VFSA 3GR1A 3H90A 3GYGA 4YS2A 2NQPA 2R8KA 1SV5B 2X1BA 4ZVEA 3NP5A 1C0TA 3M2VB 2VPYB 2ZBQA 4NA1A 2I0XA 1S4EA 3KHLA 2UP1A 2BVZA 2DXEA 3BDPA 1SIZA 4LQ9A 4JI7F 1JJ4A 3PX0A 2QN6B 2BE7D 4C8KA 1QJHA 2C42A 4WFNQ 1Y10A 2WBRA 3AD9C 1GTHA 1KD1T 4MFBA 2VPZB 4A46A 2E9RX 2MDAA 1FI4A 2GA7A 4OX9J 1RCXB 1V5IB 4RW7B 5D4NA 5J1EB 1B0VA 4CO5A 4ZITA 4DR1F 3LP2A 2B0GA 2KKHA 5DM7Q 1T9VA 2PDAA 1VQ4S 2J6SA 1N32J 5CA5A 1FFSB 4OI0A 2KFNA 4NASA 2HVDA 2LEAA 3UN3A 1JLAB 4USHA 2XQCA 4RBUA 1LFPA 1IQTA 3F44A 4HDHA 1NB2A 4DV2J 2LXIA 1TL1A 4MKVA 1N36J 3CB4A 3H5SA 5K8NA 4P9SA 1SH3A 2W9BA 2IYGA 2VODA 4RUAA 4DG1A 3BR9A 4NI2B 2F4VF 2DGTA 4W90B 1BY9A 2ALYB 1BWVA 3DRRA 4OZLA 1FNMA 4KPYA 2IVMA 4ZDNA 1WORA 4MKBA 2YWGA 5IM0B 5IFMA 4EO6A 1CS4B 3OR2A 2E5LF 3HVAA 3HVWA 1SC4B 4Z7YA 1KQGB 3U1MA 3OFHA 3N5BA 1AROP 1HR0F 3AXKA 4J5OA 3R6LB 4FBUA 1IQZA 1H74A 3N6NA 3IR6B 3SSRA 3CSKA 3LP1B 1FO1A 4CYUA 2ZVSA 1REGX 2ZBRA 3M2RB 2ILZA 2W7OA 2H4WB 2OPQB 3CCVS 1WOPA 5C42A 3TO8A 2C2EA 1U8WA 4EFAC 3IR5B 2DXDA 3I5BA 1CJTA 4LUBA 5KAKA 3I32A 5EUHA 2RUGA 3CUNA 4KTQA 5A8WA 4CLKA 5K8PA 4X4NA 4K5SA 5DG8A 3H5XA 1HHSA 4KGZB 1N34F 5IV4A 5EX0A 5K5MA 3EPIA 3G96A 1T7PA 5ADZA 3T5HA 2AYBA 4ZCKA 2VDHA 4FYVB 2KXHA 4DX8H 4X65J 1SQFA 3RB4A 4CDIA 3BYRA 1BQMA 4H54A 2R7SA 2MQNA 3H8YA 1U8SA 2HNYB 4R0JA 1HARA 2XI3A 2HBQB 1NDCA 4P72A 3U1NA 1SJQA 4RNOA 3GV7B 1RADB 2ZHAA 3PIPQ 5L8RC 2OFHX 1T02A 5K14A 3BBCA 2R8HA 1EAYC 4FXVA 5BR8F 4TY9A 1X4FA 3G82A 2XMJA 5K9FA 1SQEA 1CJUB 1X5TA 4XO0A 2BJ9A 2FD2A 2V0NA 4ZCIA 5KFGA 4DMZA 4YQWA 2K06A 2WVDA 5KFRA 1KOOA 1FRJA 3LTOA 1SPBP 3PM9A 1QVGR 3PG9A 4ZVFA 1QUPA 3M6VA 3ZNUA 1HQ2A 3M6WA 4WIIA 2DY1A 3FEYB 4B08A 3T1AA 3MEEA 2ZE2B 2NZCA 3ZZPA 3BQ2A 2VQFF 1YJRA 1K0VA 4TXSA 2QLXA 2M4MA 1RT3B 4WKYA 1U47A 4Q0BA 3MM8A 2VASA 2JNJA 1XWLA 2MSSA 4OI6A 2R2SA 4IG0A 1RHUB 4B9UA 2R7OA 4NZ6A 1QSLA 5CD4A 2OI2A 2LCWA 2OFGX 3MD3A 4OJHA 1X4CA 4Y6IA 3UO0A 2IC3A 2D3UA 2EG2A 3M8PA 2ASDA 3AA9A 3KLIB 1UW4A 2R7VA 1C4AA 5JVHQ 1BQNA 1DBDA 2W4DA 3Q83A 2HMIA 1KVIA 1VR6A 4WFYA 3MEGA 3E01B 1ZETA 1SJFA 4RJVA 2W8KA 4PYAA 4G1QA 4B3OB 1NK4A 1NJXA 1R43A 4O4GA 1WSVA 1PILA 7AT1B 3I56S 3WBZA 2PGCA 2V9KA 3PYGA 3W8GA 1HD0A 4ED0A 5AE1A 1PYOB 1WJ9A 3N79A 2XG8A 2VICA 5L39A 2BW7A 2R3VA 4RW8A 3CF5Q 2MKSA 4IDKA 1RB0A 3JSMA 3DOKA 1XNRJ 1URRA 1HNXF 1RP5A 1S1WB 3T1YJ 1VLOA 5HMZA 2YKQA 3DM2B 4TLQA 4JI8J 5A0YB 4DPYA 3P96A 4K4ZA 5KFLA 4CH1A 2GX8A 3LF0A 4ZHRB 3GR0A 2V63A 5KFHA 3WDOA 1OO0B 4CQ1A 4A8FA 2IA6A 1JLEA 3DLEB 2CDRB 1RWMB 3DLLQ 4YFUA 1GX6A 2V9WA 1S6UA 3H20A 1EKRA 4NPOA 2ACMA 4CZCA 1YHQS 5DLGA 4WJBA 4CP5A 5DLFA 2O5DA 3A3PB 1VGYA 5T7LB 2J0XA 3WC2A 4E98A 2GQ2A 3CC2S 1SH2A 2J6TA 2PA8D 4EBDA 4RWWA 3HO1A 4QWBA 1OMSA 1UA1A 2FQQB 2JSXA 4LFCJ 5AXMA 5L38A 4X4SA 3MPUB 2DTJA 1S6PB 1MN9A 3IN5A 4JV5J 3PVXA 2DEJA 3DLJA 4CLZA 2RILA 2CQ1A 1TKZB 3D0GE 4IFYA 3C8YA 2XS2A 4CLYA 1BGXT 5HATA 2GVZB 4Q2LA 1FK9A 5CAAA 3NNAA 2A1BA 1HD1A 3TAPA 3EM1A 2YH1A 2D69A 4XAKA 3T5LA 1FDDA 2NYIA 4LF6F 1WOSA 4S0MA 2MY7A 3HHLB 4LFAF 1UA0A 4NCGB 2AD9A 4DV6F 1E6YA 1U1OA 1RTDA 2M8HA 3I0SB 4CTAB 1PKUA 1R0CB 3I31A 5GMEA 2RSQA 3VF0B 4O3SA 2VFTA 2AF6A 5HLFB 3FGVA 2ADCA 3CMES 3OTBA 4ID5B 5C7PA 2HNZB 3GYXB 1KEKA 4JI0F 1U24A 2IBOA 2UU9J 3CWJA 1RA6A 3AQPA 1VQYA 5KG6A 1LWFA 1RTIB 1IBLJ 1FJCA 4BCAA 4ELTA 2CQGA 1Y00A 3TZZA 4PG8A 1XMBA 2YNIA 7FDRA 4GC6A 4USMA 5G0RA 5AXNA 2BZ2A 4JV0A 1T3NA 1IKYA 6FDRA 1S1VA 4YHHJ 2JLEA 4LFBJ 4X4PA 3SXLA 5D78A 3CJSA 2AJ4A 3IAS9 4X4OA 1WDTA 1CEZA 1UFWA 4X4RA 3G8QA 4ZVHA 2PFDA 2DEIA 1C4CA 3KK2B 1ZAXA 1T05A 2AGQA 5GMDA 4OJGA 4FNIA 3JSRA 3DLKB 4KQZA 1AFJA 1F2GA 1U1RA 2C22A 1ZM4A 2QLJB 4OYOA 3VHQA 2C2OB 3IRXB 1UEVA 1UVNA 2F5GA 3CJ5A 5KT7A 4AXIA 3UNYA 1A7GE 3JTPA 3W9JA 4RW4A 3QZ8A 2IDEA 2C2DA 1WC5A 2KO1A 1RWXB 2RQMA 4LF9F 4C97A 3OUYA 4MIWA 1LW2B 4LT6A 4PABA 2KVQE 1RZMA 5MLCV 2C3PA 3TI0A 2CPJA 1JQGA 3BDEA 2RHQB 4WFAQ 3K57A 1EX8A 4A8OA 2H1YA 4LRCA 1WHXA 3ZZOA 3M8RA 3OL7A 3UD3P 1FKPA 3D3CJ 2UXBF 3D6HB 2ILYA 4AUKA 2HEKA 4WE1A 4AQYF 2IJNA 2YXLA 2DGQA 4JI5F 5F8JA 2DGOA 1U2CA 4F02A 1RAEB 2DNNA 3EDRB 5J2MB 3MM5B 4JI2F 3J7AN 3NRBA 2RHSB 1QAJA 2BM1A 1AUSL 2YKAA 4KH0B 3D7SB 4OYIA 2L41A 5LMNJ 2LU1A 2RS2A 4WFBQ 3DGPA 3MEKA 3M9MB 3PEJA 1TV6A 1EQMA 1KDNA 1VQMS 2UUAF 2J9EA 3BV8A 3MCSA 4B3RF 2GIRA 4YY3J 1LOUA 1DQ8A 4W4MA 1O8BA 4IOCQ 4WP8A 2M9KA 2ZC4A 3AOCA 3PRVA 2ZEJA 3PDNA 5CYQA 3NWGA 3KMSA 1XTZA 4DCPB 2O01C 4NYPA 1FXDA 5HROA 2QYCA 3HSGA 2ZJQQ 1C1BA 4X66F 4J9SA 1I6JA 2EFGA 5IS2A 3GIJA 1F2HA 1T9XA 1O0PA 4CLLA 3MM7A 3CIZA 2BDPA 1J27A 3PJXA 2XY7A 1MMNA 3RU0A 4X4TA 4M63A 4NZ0A 5E3PA 1I5OB 1WHWA 3OXGA 1FTRA 1IR2A 2DKOB 2RQ4A 4ZIWA 4ZCMA 3JSYA 4K0KJ 3Q23A 3KTQA 2MYFA 1GT8A 2BR0A 1P9QC 2BBEA 5E3AA 1R8BA 2B6AB 4DPUA 3FCWA 3OL6A 3GJTB 3HF5A 1S7HA 3DRSA 4A8XA 1YTYA 1S0MA 3W7BA 4FF4A 1D9DA 5IC4B 3QT5A 2KT2A 2W4PA 2XNQA 1IKVB 3POTA 1FEHA 1HIYA 1TKDA 3IO1A 2XCPA 1EP4B 3QSIA 2P9EA 3H2VE 1FVQA 2ZH5A 2W2MP 1YVFA 4WTYA 3NWRA 5KOWA 4WZMA 1OS5A 2YPZA 3HULA 5E3CA 1RK8A 3HVTB 2HAFA 2QJ3A 4QYZK 2UVRA 3UPFA 3NGSA 2ZH3A 3MCOA 3OVBA 2B9EA 1X5PA 2DHXA 1MWZA 3HVRA 3SQOP 3G6YA 5F8MA 1Q16B 4DZDA 1L5UA 4J9PA 1A0OB 3AD8C 4DR7F 2IAJA 3V81A 3IBCB 5BJRA 4NLUA 3GMGA 2UUBJ 1F60B 4FPRA 3DU6A 4DUTA 2MQLA 1SI9A 2GIFA 4LRFA 3TWZA 5THWA 3PKMA 3RW6A 4PPZA 1HWUA 3T41A 1U6BA 2ZNYA 4RW6B 2UXDF 2FJVA 3QSYB 4AL7A 3OTCA 4DR6F 3PIOQ 2ZD1B 5E7OB 2R7UA 2VIHA 2N3LA 2NPFA 2BE9B 1RT4A 3B8HA 1T9UA 2P9CA 3HM9A 5B0EA 1VI7A 2ZOGA 4QPTA 4M94A 2GO9A 5DQGA 3KXDA 1DTTB 4RR5A 4BC7A 3EXCX 2OKQA 4PXBA 5IQQA 3B4MA 4QU6A 2XMVA 4RUBA 4A4JA 4CM2A 1G4CA 1FE4A 3KG4A 2DHGA 1CQNA 3ZO7A 2W8LA 1RTHB 1VIXA 3CMQA 1XMOJ 5F3ZA 2FHJD 2UUCF 3BM7A 4ZP9A 3MURP 4NLWA 1S76D 1NXIA 1VQ7S 3MMAA 5F8NA 3HHLD 5A8RA 4G65A 4U9RA 5F0WA 3L95X 3SFGA 3CDEA 2VDIA 1QAIA 5CCMA 2E5JA 1JLFB 3MR5A 1X4DA 2HHHF 1RT6A 2WK4A 1N5YA 2GGPA 1GMVA 2VG5B 1OY9A 4U96A 5GAGI 4HYKA 1T9YA 3GG0A 2EPIA 4HHJA 4W92B 1UP1A 4QBUA 2GO8A 2LVWA 1NK7A 1NH8A 5J1PA 3RAXA 1XNQF 4NLRA 1NAQA 3BR8A 4OI1A 1DQ9A 1SBRA 1NU4A 4Y0FA 4C11B 2LQJA 2DNKA 2OTJS 2HKEA 1LXNA 5M2UA 3LW5C 4RZRA 5ITHA 2RF2A 1PBAA 2GNKA 1FRHA 4FKXA 3UDLA 4OHZA 5LSOA 2ZBCA 3OLAA 1NK8A 3DRYA 4WZQA 3W5ZA 4O3RA 5ETTA 5CD4H 3M8QA 2FVRA 1HNWF 1GMWA 4USIA 4ED8A 2VBYA 3IXQA 2R42A 2DNMA 3D0HE 4V19J 4HT7A 2VC0A 2B9WA 1S1TA 1APSA 2P6SA 2FYXA 2EFQA 5T14A 3UR0A 3QGIA 1YITS 1C0TB 2IPOB 4ECXA 1N88A 5H9FK 3L4BC 2FHMA 5HL7Q 1GXTA 2ZM6F 2ZH4A 5D77A 3LPYA 4B9MA 3PJWA 3CCRS 1QAYA 4I56A 5HP1B 2K1RB 2KT3A 1HBMB 2BA9A 3MUTP 3NS5A 5IWAF 2JC1A 1XN9A 4OX6A 3NBPB 4M5LA 1PCAA 4FVMA 3CO9A 2YX7A 2JWNA 4YB1P 1UAWA 2VKRA 3QO9B 2ASYA 5SZTA 4LVOP 4DWIA 4K4YA 4J9QA 1XJWB 4JI7J 1RAFB 2CZVC 2R2TA 2MQ8A 3BZQA 2AJQA 2YTCA 4NLDA 4YDXA 2XTJP 1MMDA 2DISA 3RUBL 4F25A 3W2VB 2OPSA 1XR5A 4JYAJ 2GQQA 1ZM9A 2M7SA 4U6PA 2V5HG 1SIWB 2HSEB 1U1LA 1SL1A 2VB6A 5DZ6A 2A2DA 1KQKA 1WC3A 2X1GA 1TVRA 3RRGA 4USKA 4H4KA 3M1VA 2XGQA 2XZWA 3EGZA 2ZH2A 1TL1B 1FKAF 3SZ2A 4NMLA 2VFVA 5C5JA 4DR1J 2HHXA 5GAHI 1RQ0A 3BSCA 1N52B 4KYZA 2HHSA 4C2MA 3SV4A 1PG5B 1JK9B 4DR5F 1FF2A 1TK0A 2HZVA 2K8GA 2H3EB 3C16B 1C1CB 3HMJG 2IFXA 4F0MA 2Q6BA 1WWHA 4X4UA 2ASJA 3I9V9 3OR2B 2JVOA 2PMHA 3CXCR 2NREA 5CABA 1KWMA 4ZP8A 2EW9A 4WK3A 2CZ4A 3EPGA 2XS5A 3MR7A 4RNFA 1S5ZA 5D0EA 3QBCA 4OZ1A 4WIQA 2F4VJ 4LF8F 5EX3A 2DO0A 2DD8S 2E7XA 4PQUB 2GIQA 1ZZNA 1LK5A 2P9GA 4KSEB 1NDKA 1KVKA 2B9YA 2PA3A 2GQCA 4KH1B 3M32A 3CJ2A 4ELUA 2HRTA 2E5LJ 5EWFA 1RBAA 4DSFA 1HBOA 4O3PA 1CJTB 4TVAB 2ERRA 1HR0J 1EB0A 5H9EJ 5KOXA 3DHWC 3RTVA 4H4OB 2RDDA 1KRPA 1CJVA 1TL7B 3GYNA 4V19X 2WONB 5LOQA 4NLPA 1IKWB 2DR6A 4EI2A 1FT8A 2FGOA 3HD1A 3GB0A 4ZVTB 4FF3A 1AXQA 2DT9A 3QYYA 1RABB 4TY8B 4TU9A 4X62F 4ZJLA 2W9AA 4OLPA 1Q79A 3ITHB 3QWPA 1N34J 2MGZA 1X7VA 1JLGA 2Y1JA 1DHMA 1VBXA 5DO2A 1X31C 2YWWA 2V4JA 2HS3A 2XY5A 4F4WA 2I5JA 2CQ2A 1VOMA 1TELA 4DLGA 2DITA 1RBLA 2E66A 3G82B 1QTNB 1LWEB 4WWSA 3C6UB 4EYHB 2ZOMA 1CVJA 2UVUA 3JQMA 1X4GA 3BPDA 1LW0B 3D68A 4NCAA 1HPZB 4QWDA 5ETQA 1KNZA 2ZH9A 2I8EA 2JZ5A 1S6QA 4DPOA 1VHIA 4DX6A 3PYEA 2BRLA 1R0AB 1JKHB 3Q86A 3BGOP 3FVYA 4J91A 2X3DA 3AB4B 1WF2A 2OPRB 3MM8B 3FSXA 1SQGA 4IG3B 3CDBA 4ID8A 2KVIA 3MPVA 2PMZD 2WCXA 1VRTB 3CJRA 4ZVGA 4DSJA 1S12A 3B78A 2BKPA 4ZLLA 5F9LA 2BEFA 1FTCA 1OSCA 2IC3B 4LREA 2LMIA 5DGAA 1HL6A 2VQFJ 1M5SA 1XMQF 4K4TA 1B3TA 3M2UB 3UD4P 3VQTA 4J9NA 3FZ2A 4P74A 2PEHA 2JEFA 5KFMA 2N7YA 3MEGB 3D9BA 3DLGA 4PZVA 2J9CA 4J9UE 4AD6A 4M5HA 3SV3A 4UOFA 4CM0A 2JFDA 2Y8YA 3FMBA 4O4GB 2CPDA 2OD4A 1F6TA 4R8UA 1CBKA 2AJ2A 5EWEA 3ZZ0A 4H4MA 3BYPA 3EVMA 3TUIC 3TX8A 5H1SV 3CC7S 2J8SA 4RW8B 3DNCA 5DDPC 1FKOB 1E6VA 3U1LA 1Q0NA 4DL4A 2EVZA 4WFXA 3M9NB 3MMBA 2FTRA 1U02A 2EEYA 3SDEA 2XMTA 4M1KA 3H5YA 1SC1B 2VFUA 1XR7A 2E5GA 4P71A 2LU2A 2COLA 5FIIA 2L48A 7FD1A 4LRBA 1M5HA 3UFCX 1U1KA 3K5PA 4Y2CA 4N77A 1N4LA 1Z4UA 4U67Q 3E51A 1QD1A 1R8AA 2GJ2A 1HNXJ 3Q8UA 1D8YA 4PAAA 3QJLA 3ENAA 3CJQA 3DYAB 3M7VA 2ADBA 2YX1A 2MXYA 2F8EX 4ECWA 1FWPA 2A6OA 2M5YA 3JTNA 2QZ8A 4FYYB 3G8SA 1U45A 4QOTA 3DDNA 3GLJA 5D4LA 1N5SA 1HW9A 4KGVB 4OX7A 3K0JA 1KFDA 1U1PA 4QPXA 1DLOA 5E0OA 2FY8A 1DTQA 2AHOB 4Z37A 4J9KA 4USUA 3MAHA 3MFHA 3Q22A 4Q8FA 3UD5A 3ISNC 3IAM9 3OXFA 1QDUB 2B5JB 4DN0A 1RYRA 5LMUJ 4DQPA 3TA1A 1OQ3A 1RAOA 2BABA 4ZPTR 3GFHA 3NEKA 4U7UD 2F9DA 1TKXA 1FK9B 2RDJA 1CULA 1FDAA 4UQGA 3KLEB 4NZ7A 3IGNA 2GCFA 3C14B 1SL2A 2MHNA 4UUWA 2F3JA 1ZAVA 2JRSA 4LR9A 2WVCA 5FJ4A 3W66A 5BYRA 2XSJA 3PXGa 1Q1KA 2ZWOA 4USVA 2MLXA 2RAQA 4CLTA 2ZVIA 2QA1A 1RTDB 2Y1LB 3UVJB 2RRAA 5LM7E 3EZ5A 1KFSA 1SUQB 4NXNJ 5BYSA 2GVDA 2HBZB 2V8DA 1V3RA 1Z2LA 2G0JA 3MDFA 2CQBA 2E9ZA 3TR5A 2O67A 3JSBA 4GMKA 3J81j 5L1KA 2GMLA 1VBYA 3TNVA 1CSJA 4ZPAA 3RRKA 3MGJA 3EX7B 4LFAJ 3ICLA 3UNGC 4DV6J 1LWFB 3DMJA 4K4WA 4ED2A 2XB2D 5E5NA 4HKQA 1RI7A 2OD6A 1Q78A 1DJ0A 2B4UA 2IIHA 2AZ1A 3OTOF 5G0RB 4MIBA 1IUJA 5J2NA 3R5CA 1R89A 3J81U 4F8RA 3NNHA 4JI0J 3ILOA 2Y9HA 3OR1B 1KLMA 3PTWA 4I2QA 3J7Z5 1X4HA 5KFXA 3MUVP 4R5PA 4NLVA 3MMCB 1S4FA 3C15B 3JYTA 2CAJA 2MEWA 3SSQA 5HVHA 5FLXY 2AYGA 2YNFA 4UZCA 2RIJA 1CC8A 3J80Y 2MKKA 1NHKL 1NK6A 4CT8A 4RW9B 4EGLA 1UEUA 3IBFB 1RYSA 1W26A 2R7WA 2D3O1 2KM8C 1KSPA 4HH1A 4Q5VA 2JX2A 1VBZA 2UVVA 3KMQA 3LALA 2D3OR 4B3TF 3X1LB 3CCZA 3NXZA 5L9NA 3KKFA 5KFEA 2HQ3A 2UXCF 4I6AA 4I7FA 2VL1A 4JI1J 1NBEB 2XYGB 2HWHA 2FZKB 2IVFB 1R3NA 4XIUA 4EK2A 5IT0A 2QLBB 1LV5A 2XSFA 8RUCA 2HFUA 2ZDPA 2WOMB 1HBNA 4RO0A 4DUZF 4NEYA 2XLKA 2CA9A 2G9OA 4Y00A 3S01A 2ZH1A 2HPUA 5HN0A 4TU7A 3AOBA 4PWDB 5E33A 3NGTA 1IKXA 2CJ9A 4LF9J 3LOUA 4YB7A 1S7IA 5G4DA 2W2QP 2QEXS 3MD1A 1MG7A 2FVCA 3NGUA 3QAEA 2YKMA 2HGLA 4PUOA 3U02A 2AU0A 2L9DA 5AXKA 3GQCA 1VC5A 2HK2A 3US5A 2Z8QA 3MAAA 4UT4A 4RU2A 3BGRB 4MKAA 2G13A 4NWBA 3QQCD 3BQ0A 3MR2A 2DRBA 2CNNB 3V6DA 3IGVA 2VBXA 3SQGA 4ZMMA 2YNGA 1PGZA 1S1XB 4F4KA 3KNGA 4CNYA 2LDIA 2UXBJ 3AFGA 4ECRA 3DGPB 5IT9Y 4JI3F 4C0OC 3HSDA 3DOLA 5J2QA 2RRNA 1REVB 2E29A 3S8SA 3S6EA 2YNHA 3TARA 1VRUA 1IJEB 2WW8A 4JI2J 4QIFA 4HI2A 4BBYA 3TQEA 4O4RA 1XQIA 2ROGA 4UOCA 2OHDA 1K73T 4OYMA 4B3SF 3FSYA 2EFOA 2BACA 4MMOA 2VZ9A 5CYQB 5IT9U 4DQIA 3TQ1A 1VBKA 3KHHA 2ZUAA 5HROB 2PI4A 3RW7A 5IZHA 4C8ZA 4ER8A 1NEEA 5J2PA 3G8TA 3C6TB 1XEZA 4B3RJ 2DCUB 2E44A 1ITPA 3BO4A 5C25B 5KG3A 1B4SA 2XM3A 4ECZA 2ZH6A 3D4JA 4KJIA 4QIGA 4GC7A 2BKNA 5DG9A 2WB1D 4LSZB 5CYMB 3BH7B 3KUGA 2I2YA 2HBYB 1ZA1B 2NSBA 1NDPA 4ZJQA 1EETA 3MHYA 3SYZA 2J7WA 4NRUA 3M6UA 4NLGA 4X66J 3CJ4A 3S7RA 1HNZF 5KFSA 3W9HA 2E7WA 2KG1A 1KC8T 4BDPA 3DRSB 4GVBA 2G4BA 3HSZA 4K4XA 3KJFB 2VOPA 4TU8A 2ZZTA 2UV8A 2DNLA 2BJ3A 3POTB 4D3HA 1DARA 2K3KA 3M2VA 4YR2A 4QU7A 2R7RA 2HVHA 1H2TZ 1C2PA 3AJ2A 3P49B 3T6BA 4DPWA 3EGWB 3ZZZA 3FBCA 2WSEC 2W7AA 1IWAA 1JLCB 1TL3B 5HMYA 4LIWA 2XYPB 1T03B 2HHVA 2B7CB 4ERDA 3HCXA 2AMCB 1KONA 3TUPA 5KG7A 1YRUA 5HJXA 4I4BA 3LGHA 3GU0A 4L72B 1HI8A 2IRXA 1Q7YT 4LF4F 3PYDA 3BN7A 2ALZA 4MH8A 5F9NA 1N8RT 1VK8A 1ZOTA 3MR6A 4U8YA 4JI6F 2MJNA 1N36F 4RW7A 5J1EA 2Z2ZA 5B0BA 4M5JA 2ZZNA 2FC8A 5KG2A 3R97A 4KV8B 4PWUA 4DPXA 2VUGA 1U7LA 4DU7A 1JMTA 4DR7J 1RAJA 3DXSX 4RU9A 4HHHA 1JLAA 4LF1A 1HA1A 2CNKB 1LFWA 4BC9A 3R5DA 1HLWA 2CQHA 2YKNB 1YRXA 4DR4F 2L08A 4ICLB 1HNVB 1N6QA 2UXDJ 2V6AA 4K5RA 4OYPA 3DCAA 1HW8A 2DCLA 3EDQB 4NI2A 2DHSA 3C3LA 4DR6J 3D1HA 3ENQA 1BC6A 2EKNA 2AQ4A 1TU0B 2MB0B 3UN2A 2HNDA 1PJ7A 4DSKA 5I4MA 2XMMA 2PN6A 2ZJRQ 2B4VA 1YKWA 1KP6A 5IM0A 3CD7A 3TJAA 3HLUA 1VQOS 4MK7A 2IHR1 1NHVA 5ETKA 2EFVA 3VALA 5F8GA 3QMQA 3MMAB 3FFIB 4U95A 2XZDB 4F50A 1JWWA 2RU9A 2J9DE 1VQNS 3IMQJ 4OZ5A 1R8HA 4CO4A 1DURA 1NSPA 3M2RA 3AA8A 2EKYA 2OPQA 2MZRA 4HT5A 3A4TA 2YWEA 2OH2A 4DX7A 5D4PA 4L76A 1OY8A 1UVLA 3IFEA 4HTIA 2UUCJ 3WQPA 2AJ1A 2VFRA 4PEOA 4RPFA 4ALZA 2MKCA 2FJBB 1FJGF 4WCEQ 1FRMA 2ZITA 4LVNP 1D3WA 3NGRA 3EVWA 3NAIA 1ZPWX 4TLRA 1KKHA 1Y4ZB 4ED4A 1X0FA 1G2EA 4KKOB 3D3BJ 2DNHA 4PR6A 4HH0A 3W63A 3QATA 4NLXA 2PEBA 3V6KA 4GRSA 1LWXA 1HFEL 2ACYA 2HNYA 1T9TA 3F41A 3FNNA 2V8PA 4RNHA 1X8DA 1N5VA 3FEZA 2RF2B 2DPJA 4YOEA 3DRPB 2BQRA 5HQ8A 2DY9A 4MYUA 1XNQJ 4I69A 1PSDA 3HKWA 3M8QB 4K59A 5F8IA 1WD6A 3MOZA 1YJ9S 4FNHA 5KG1A 2R4FA 4QIWD 1NUEA 1N33J 1TL5A 3RRHA 1NPRA 4TYAA 5LT5A 1TTHB 4ED6A 3PX6A 2R2UA 1VMBA 2FLPA 1YJUA 4Q45A 4C3LA 4USJC 1UFKA 2UUWA 4X84A 5M2PA 3T1HF 1KN6A 2KYZA 3SFUA 2MKJA 1HNWJ 5DQIA 2ZE2A 1S79A 4QIEA 1SKRA 4V1Ak 2AV5A 3PFEA 2MZ1A 4UY85 1WHYA 4UQTA 3VGSA 1M0SA 2VPXB 3TVKA 3TEHB 1RT3A 3KLFB 1O5JA 4HTJA 3K89A 1W2BR 2B4PA 2V2VA 3LQVA 3GIMA 2HLTA 1R27B 3QRQA 3D6MB 2ZM6J 3UCUP 3AXMA 3GV5B 1WF0A 4DZ6A 1FERA 1TR0A 1AZSA 4IRCA 3KLIA 5C2CA 5IWAJ 4P75A 5DG7A 4TNOA 4OHXA 1Q95G 1HI1A 5HSPA 1R31A 2OPSB 1UJ6A 2M2BA 1I94F 4OHYA 3A3OB 1RWNB 3EGVA 5GADI 1UWBB 2UUTA 2QT7A 2KRRA 2ZNZA 4ZVRB 2W9CA 1SKWA 4XK8C 3T1YF 4C7QA 2CQ3A 2O3DA 4QYZJ 4QWEA 1N56A 4CO1A 3PKYA 1RU1A 3T9ZA 1R7IA 1NRKA 1NSKL 1D0EA 4DV5F 4LSLB 4ED1A 1SJ3P 5A8KB 1HNIB 4LBPA 3IR7B 3DXBA 2J76E 1RBOB 1S1WA 1P1TA 2R8IA 3DM2A 3GPAA 4J9MA 1X9SA 4QCLA 4IRDA 1M1GA 1RT2A 1GAOA 2QRRA 1CLFA 3CJ8A 2RB7A 5B0FA 1RHRB 4ZHRA 3H40A 1TAUA 4Y2IA 3FQLA 3CCMS 4OZJA 2CG8A 3DLEA 4DV3J 1RT1A 4O0IA 5HJYA 2Y0BB 3G2XA 1VC0A 4O44B 2JEIA 4DV7F 3P8BB 2APOA 1YX2A 1FDNA 1JLBA 3AT1B 1YZ6A 1NPKA 3MMJA 1J5OB 3MPWA 4JV5F 5T7LA 2VC1A 3CPWR 4N8NA 4BWMA 4F26A 2E1CA 5KFPA 3TZWA 4ILRA 3QIPB 1DZ5A 4LR8A 4LF8J 5B0AA 2W2OP 4C8MA 4ZLNA 3Q8PB 2NCKL 2XO6A 1VFJA 1SJRA 1F9FA 3Q2SC 1OPIA 1X9MA 4FYWB 5F0UA 1WKKA 2EBEA 3KDOA 4FYDA 3CJKB 2C3MA 1PO6A 1YGYA 2MTLA 2FJWA 1CJKB 3AQOA 1IWGA 1R6YA 1TKZA 1MROB 1UJ4A 2C2MB 2OMOA 1BE4A 4ATNA 2VKZG 2FHJA 5C24B 1VC6A 3VGVA 1FX4A 4CLWA 1JLGB 1TZ0A 3HHLA 4KHMA 4DLEA 3K2YA 1YJ7A 4HHUA 2V4JB 2CKWA 2DH8A 4F3OA 3TYTA 3I0SA 3JAMU 2AYEA 1N5TA 2B7BB 1AB8A 1PJ6A 2V69A 4X62J 3KK1B 2N4DA 2Z2MA 2HQCA 3KHRA 3KLHB 3NGKA 5LJ5Y 3SCIE 5GAEU 3ZZRA 4ID5A 1OYDA 2HNZA 3LWMA 1F0XA 4KO0B 3KK3B 2KG0A 5HI7A 2QL9B 3UN5A 1S49A 3N5FA 2RKIB 2VF3A 3VVUA 1OWXA 2CJAA 3ZFVA 3P5BP 3LAKA 2XMAA 2CQIA 3PYFA 1BMQB 3EWGA 1JLQB 3DC2A 1OQ6A 1GFWB 5KFQA 4HR2A 2NXCA 1U1QA 2QV6A 4A8KA 2VG6B 3Q8QB 2JJ4D 2WB4A 3GWCA 1RWWB
chains in the Genus database with same CATH topology
4C2MA 3SV4A 2NZ4A 5CYMA 2V8GA 1JK9B 3WX4A 3PZPA 4DR5F 4A8WA 3J81Y 4JV1A 1QM9A 1FF2A 4DQSA 2AW0A 3IWNC 1TK0A 2K8GA 5HBMB 1HMVB 1Q8LA 2BQUA 2E1AA 1F5AA 2YQ3A 3DN9A 3KK2A 2KZMA 1GNKA 1C1CB 4AL5A 4DF8A 2C3OA 2QMXA 4KFBB 2XLJA 3HMJG 2IFXA 2Z2LA 2FHOB 4GKJF 4C8NA 2Q6BA 4DFPA 1WWHA 3ZC4A 3N9UC 2WTFA 2R9LA 4X4UA 5B09A 1F5CA 1LWCB 5CCLA 2ASJA 2XGPA 3I9V9 3OR2B 2JVOA 2PMHA 1M5PC 4YP3A 3CXCR 2NREA 3HI9A 3DLKA 2BJDA 3CEDA 3V4IA 2DIUA 1S1UB 3D0IE 2YNIB 3X3UA 4ZP8A 2EW9A 3QWUA 4Q43A 4WK3A 1NJIT 2CZ4A 3EPGA 2P5VA 3CIMA 4YDDB 2RQKA 5J2PB 4LMZA 2V94A 2XS5A 4RNFA 3IRXA 4X2BA 4OZ1A 2LXUA 1WACA 1DFDA 2MKHA 4LF8F 4FXDA 3GFZA 5KFUA 1IKYB 2KHDA 3I6PA 2NLWA 1QVFR 2WAQD 1VQ5S 3CCLS 5EX3A 4DR2F 2DO0A 2DD8S 5H9FJ 1S1VB 2E7XA 2HS0A 2M88A 2GIQA 3GFYA 2XBPA 4OHVA 4PQUB 1ZZNA 4ETZA 3DLGB 3KOAA 3BREA 1S97A 1LK5A 2P9GA 3QGHA 4CIOA 2HIQA 4KSEB 2Q6CA 2OPPB 1XERA 2EK1A 1DRZA 4NA3A 3I4HX 4KRWA 4CO0A 4NLYA 1GH8A 2FLLA 2B9YA 2PA3A 2GQCA 1GQEA 3MECB 1JLCA 1TL3A 2FB0A 1LXJA 4WFZA 3S1TA 1ZM3A 3M32A 1TFWA 3T5JA 3CJ2A 3LAMA 4ELUA 2ZHBA 3UWTA 1S0OA 1T03A 5EWFA 1LW2A 2J7UA 1TAQA 1RT5B 4JOUA 5KFVA 4DSFA 2CPYA 4KHRA 4B9NA 2EC0A 2B3TB 1LQ9A 3IS9B 1XK8A 3DU5A 5EN1A 1T05B 3OFEA 4HL9A 5JXSA 3OHAA 1HBOA 4O3PA 1HQEA 2RNEA 1VIOA 3MTKA 2ERRA 3FDSA 3HPOA 5H9EJ 1Q7LB 4OZ0A 2YKPA 5KOXA 3DHWC 3RTVA 4H4OB 2VFSA 3M4XA 3GR1A 3GG1A 1L3KA 1KRPA 3OXLA 2NQPA 3HKZD 3TOQA 2R8KA 4L6V3 4CH7A 1SV5B 4DJBA 2X1BA 4QW9A 4ZVEA 3EUNA 2IM1A 2XY6A 3GYNA 3NP5A 4ECVA 4V19X 4OMFG 2WONB 2CQDA 3CJ0A 4NLPA 1IKWB 2VG7B 1FT8A 5B0DA 1C0TA 3M2VB 1Q82T 2FGOA 2VPYB 2ZBIA 4NLSA 4CI0B 3GB0A 3BSNA 2EI5A 2ZDOA 2MZQA 4ZPVR 4O3QA 4FF3A 1AXQA 4NA1A 2ATLA 4N76A 4DR3F 3UR3C 3CCWA 4RW4B 2DT9A 1LKZA 2I0XA 3QYYA 3HZEA 3KHLA 3D1OA 4TY8B 4MIAA 5GAEI 4QR0A 2UP1A 2BVZA 2I1RA 3BDPA 1SIZA 4TU9A 4X62F 1D1UA 4LQ9A 4JI7F 1SJ1A 4RUCA 1JJ4A 3PX0A 3DFEA 3OUYB 2W9AA 4C8KA 5J2MA 4J37A 2PD1A 1QJHA 3ONQA 2C42A 5B7WA 5AJ3F 4KV8A 2UVWA 4WFNQ 1KQSR 2WBRA 4OLPA 2J6UA 4OQJA 1Q79A 3ITHB 3QWPA 3I4PA 1GTHA 2IRUA 4Q2MA 2MGZA 1S0VA 1X7VA 1JLGA 2CPXA 2Y1JA 1DHMA 1KD1T 4O3OA 1VBXA 4MFBA 2VPZB 4A46A 5DO2A 4YEAA 1JXEA 2JL9A 2EFNA 3H2LA 4I6WA 3IA0A 5LSRA 2E9RX 2V4JA 2HS3A 3Q0AA 2MDAA 3VAKA 2XY5A 4F4WA 2I5JA 2GA7A 2CQ2A 2NUUG 2YKNA 1VOMA 2RU3A 3RBDA 4DLGA 3UW1A 4A48A 3T5KA 4CCHA 4ICLA 1HNVA 2DITA 1WEYA 2E66A 2CQPA 3SSSA 5IXUA 4KGKA 1NK0A 3UE2A 2NS1B 1FKPB 1LWEB 4OJ1A 4FN5A 2CPEA 2Q3PA 3C6UB 4WE1B 1HBUB 1XBWA 4EYHB 1VQ8S 2ZOMA 4RW7B 1CVJA 2UVUA 2N7CA 5D4NA 4GO5X 1X4GA 2RRBA 3DI6B 1B0VA 4CO5A 5J1EB 3KHGA 4DR1F 3LP2A 2B0GA 1TFYA 3BEGB 1LW0B 2RD5C 1C0UA 2KKHA 5DM7Q 4QR1A 4BHQA 4IR1A 3M05A 4DV4F 4HEA9 1V6HA 2PDAA 1VQ4S 4NCAA 3OSNA 2J6SA 1T3OA 2QA4G 1HPZB 1DLOB 4QWDA 2LKZA 1VLYA 3KG0A 3TAMA 5DJBA 1MSWD 5CA5A 4DS5A 1P1LA 4OI0A 2KFNA 1KNZA 2JDJA 1H2UX 2LEAA 2ZH9A 4IQMA 2I8EA 1JLAB 4F3QA 2J9DA 4USHA 2ZHOA 2JZ5A 3FJ2A 4RBUA 1LFPA 2QIFA 1IQTA 3F44A 4HDHA 1BWEA 4DFKA 1S6QA 4DPOA 2LLZA 2LXIA 1TL1A 2MSTA 5CQGA 2FDNA 3CB4A 3FFIA 1TV6B 3H5SA 5K8NA 3M8SA 2BRLA 1R0AB 1JKHB 1Y3KA 4DL3A 2FPHX 1SH3A 3FVYA 3HHLC 2W9BA 4DSLA 4KGMA 2IYGA 3Q2TC 2VODA 4RUAA 2OTLS 2HWIA 3AB4B 4DG1A 4ITSA 3BR9A 4URSA 3O3LA 1YI2S 5D6GA 2F4VF 3MM6A 1WF2A 2OPRB 2LXFA 1YWXA 2D9PA 3OL9A 2DGTA 2LA6A 4FF1A 3MM8B 3FSXA 1S0NA 4W90B 1BY9A 2XSJB 2DBBA 3MM9B 1HMVA 1KR4A 3RZAA 3DRRA 4IG3B 3CDBA 4OZLA 3KNAA 4ID8A 1FNMA 3OFGA 4KFBA 2KVIA 3MPVA 2PMZD 4KPYA 2WCXA 1VRTB 2IVMA 4ZDNA 3C46A 2KFYA 3V2UC 4ZVGA 2B6AA 4DSJA 4JBCA 4MKBA 4MAKA 3J7YU 3B78A 2YWGA 5IM0B 3VWSA 5IFMA 5F9LA 2XMKA 1FTCA 1OSCA 3OR2A 4EO6A 1Q81T 2E5LF 3I5AA 3HVAA 2IC3B 2XI2A 3HVWA 2LMIA 5DGAA 2IM2A 1HL6A 2GFFA 1S1UA 1KQGB 1M5SA 3U1MA 4NRTA 1XMQF 3OFHA 3N5BA 4RWXA 1C1BB 4K4TA 1AROP 1HR0F 1OSDA 1S9GB 3MEDB 4J5OA 3I0RB 3M2UB 1IKVA 1IM4A 4FBUA 3SI8A 4IO1A 1IQZA 3UD4P 3N6NA 3IR6B 3SSRA 3CSKA 4ETXA 3VQTA 2M8DB 4J9NA 3H4BA 3FZ2A 3LP1B 4PCQA 4ES1A 3MM7B 2PEHA 2YWKA 2JEFA 5KFMA 2N7YA 3MEGB 2VA3A 2J0QD 1FO1A 2C3YA 3DLGA 2ZVSA 2VV5A 2J9CA 5KG4A 3NGDA 1WNEA 2OPPA 4KKOA 3M2RB 3SV3A 2ILZA 3LWLA 2JFDA 3N0VA 2OPQB 3DMJB 4ZPWR 2W7OA 3CCVS 4RX6A 3FMBA 4O4GB 4PXDA 3AY0A 5C42A 3TO8A 1RTJB 2CPDA 2OD4A 2C2EA 3HHEA 3KLGB 4EFAC 2LQ5A 3W2WB 1HWLA 3BGFA 1JJ2R 4NCBA 4R8UA 3CCJS 3UDCA 3IR5B 3HVTA 3L7OA 3I5BA 5EWEA 1N33F 4LUBA 4B9SA 5KAKA 3ENVA 3I32A 3ZZ0A 1B0PA 4IRKA 4H4MA 4FZVA 2FLOA 3TUIC 3TX8A 5EUHA 2RUGA 3CUNA 2V8VA 3I55S 3DRPA 5H1SV 4KTQA 3P3DA 3R27A 4ZLPA 1ZH5A 3O44A 4TN2A 5A8WA 3CC7S 3OTDA 1SV5A 1U25A 5K8PA 2DGWA 4X4NA 4RW8B 1P27B 1V3SA 3FZBA 1NK9A 4K5SA 1YSJA 5DG8A 3H5XA 1ZM2A 3DNCA 1HHSA 4C3MA 5DDPC 2HHQA 3CD0A 1XR6A 1N34F 1FKOB 1QE1B 4QR2A 4QZVB 1D9FA 1E6VA 5EX0A 5K5MA 5I3QA 4P2SA 3U1LA 3EPIA 4IKAA 3ZZTA 2DPIA 2KTQA 3Q8RB 4DN9A 3G96A 2W25A 4DL4A 5ADZA 2EVZA 3T5HA 2AYBA 1T7PA 4WFXA 4ZCKA 5EWGA 1ELOA 2KXHA 2PSZA 3N01A 2HQIA 3W3SA 4DX8H 3M9NB 3MMBA 2ZC3A 3RB4A 2FTRA 1WEZA 1S9EB 3SDEA 2XMTA 4M1KA 3H5YA 3QPIA 2VFUA 3MWBA 1YRTA 3QJJA 2KYXA 3K5LA 1XR7A 1BQMA 4H54A 3HJFA 2WRMA 2E5GA 2R7SA 2MQNA 4OX9F 2LU2A 3LH2S 3H8YA 4RW6A 3NL0A 2LEBA 1FNOA 1P6TA 2COLA 4F2RA 2HWTA 2L48A 5FIIA 3QZ7A 2AX0A 1U8SA 7FD1A 4IO9Q 3R1LA 1M5HA 2HNYB 4R0JA 3UFCX 1U1KA 4EBCA 1HARA 2XI3A 2KDOA 2ZOFA 3K5PA 3K59A 2QSWA 1K8AT 4Y2CA 3CULA 2Z0GA 4IFVB 4N77A 2ZD1A 1UL3A 2FJDB 4UY8T 3EGNA 1N4LA 2LA4A 1Z4UA 1IN0A 3IG1B 3TW0A 4U67Q 2NUHA 3E51A 2VONA 1O51A 2X1FA 2GHPA 3U1NA 1SJQA 4RNOA 3GV7B 4FS2A 2A2CA 2ZHAA 3CTRA 3PIPQ 5L8RC 3EZUA 3V6JA 1ULRA 1R8AA 2GJ2A 2OFHX 1T02A 3PRBA 4G1IA 2AGOA 3QGGA 5K14A 1D8YA 4Y2AA 1N32F 1JB0C 2R8HA 4ZOSA 4FXVA 1G3OA 1DAXA 3QJLA 1WG1A 2IAJB 3V81B 3DYAB 5BR8F 2ADBA 1FCAA 4Y2KA 2YX1A 4TY9A 1X4FA 2XMJA 5K9FA 2MXYA 5EHHA 1SQEA 2F8EX 3H25A 4NXMF 2KB2A 4JUZA 4ECWA 3OL8A 2YH0A 3EXYA 1X5TA 2KN4A 3IBWA 4XO0A 3GE9A 3KLFA 2M5YA 5L1LA 4DV2F 2HHPA 4DSEA 2A10A 1DTTA 2VBZA 3JTNA 3U27A 1W25A 2FD2A 2V0NA 3K5OA 2QZ8A 3DLBA 4ZCIA 5KFGA 4NA2A 3D5MA 4DMZA 3DI6A 3MR3A 3G8SA 4YQWA 1U45A 5AE2A 4QOTA 3DDNA 4PG7A 5D4LA 5I3PA 1N5SA 1HW9A 5KFRA 5JJBA 1KOOA 1UKUA 4OX7A 1FRJA 2E5HA 3K0JA 1KFDA 3H2UB 3PM9A 1OIAA 1U1PA 3KJVB 4QPXA 1QVGR 1DLOA 5E0OA 3PO5A 1F5BA 4ZVFA 2KJWA 1QUPA 3WC0A 1DTQA 2ROPA 3M6VA 2YWFA 3M6WA 3ULHA 4Z37A 3J7YI 1IKXB 3FRYA 3VAGA 4WIIA 2A3JA 1RTHA 4X4VA 4J9KA 3FEYB 3MAHA 3MFHA 4GKKF 3Q22A 2B9XA 4Q8FA 4B08A 3T1AA 3ISNC 3I82A 2HHWA 1RT4B 3A8EA 3FEXB 3IAM9 3OXFA 1YJNS 3MEEA 2B5JB 2ZE2B 3LP0B 4DN0A 1RYRA 1RT7B 2GC8A 3LGNA 4DQPA 2BW2A 3TA1A 1D9AA 4FP9A 2YKMB 1FHTA 1OQ3A 2BABA 3ZZPA 4ZPTR 3BQ2A 2LQ9A 3GFHA 4PXEA 2F9DA 1TKXA 1YQHA 1FK9B 3V6HA 2VQFF 2RDJA 1YJRA 1NB7A 1V9OA 4HDGA 4TXSA 1K0VA 1FDAA 4UQGA 2QLXA 3KLEB 3AAWB 2M4MA 4NZ7A 1TK5A 3IGNA 2GCFA 4OV1A 1UWBA 1SL2A 1RT3B 2MHNA 4UUWA 4WKYA 1U47A 3NMAA 1VQKS 3I9ZA 2J8AA 4Q0BA 2F3JA 1KS2A 1ZAVA 3P5TL 2JRSA 5KFKA 4U7CA 1HI0P 2V4QA 5FJ4A 3MM8A 2G1DA 1JLFA 5BYRA 2VASA 4TYBA 4M5DB 2XSJA 1XWLA 2HRYA 2MSSA 2DR7A 4IH6A 2C2RA 3QAUA 4OI6A 2R2SA 4IG0A 3PXGa 1WF1A 1Q1KA 4B9UA 4DL5A 2XLIA 2R7OA 5CH7B 1KVJA 2VG5A 4ILLA 4NZ6A 1QSLA 4EO8A 2DR5A 3PR5B 1FE0A 2LCWA 2OP5A 2DHAA 2QA1A 2OFGX 1RTDB 3MD3A 3MZIA 4OJHA