1AFJA

Structure of the mercury-bound form of merp, the periplasmic protein from the bacterial mercury detoxification system, nmr, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
ATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKATADAGYPSSVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the reduced and mercury-bound forms of MerP, the periplasmic protein from the bacterial mercury detoxification system.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Mercury detoxification
molecule keywords MERP
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1afjA00
4EFAC 3DCAA 1YJRA 2ROGA 4Y2KA 4FNHA 2XMWA 3HF5A 3CJKA 1K0VA 2K1RB 2FB0A 1FVQA 1YJTA 1GXUA 2BYCA 2GA7A 5B0EA 5B0GA 1Y3JA 2RSQA 4DN9A 3TOQA 1Y9OA 5B0FA 3HHLC 1TL4A 4HL9A 5B0AA 4A48A 1Q8LA 4A4JA 1V3ZA 1SB6A 2XMVA 3CJKB 2GO8A 4Q2LA 2IYIA 4QOTA 4A46A 1Y0HA 1X7VA 2K7KA 2KKHA 3BN7A 2KT2A 1TL5A 1VQSA 1FEEA 3IWXA 2HFOA 1FD8A 2LQ9A 2G9OA 2GCFA 4NPOA 1CPZA 3I9ZA 2OAUA 4FNIA 2PD1A 5K9FA 1AW0A 1Y3KA 2N4DA 3BR8A 3UDCA 5KAKA 3HHLD 1Q8BA 1QUPA 2GFFA 3FRYA 4ZA1A 1YJVA 2XMUA 2KT3A 2XMKA 3FMBA 3HX9A 5F0UA 3BF4A 2QYCA 1X8DA 1URRA 1JK9B 2HLTA 3HHLA 2AJ1A 2RMLA 2HLUA 3E8OA 5B08A 2IFXA 1KVIA 1S6OA 1FE4A 1KVJA 1P6TA 2OD4A 2W4PA 3LGMA 3QMQA 5B09A 2BJDA 2GGPA 3QGPA 2LDIA 1OSDA 1MWZA 1YJUA 3BM7A 2HQIA 3HHLB 2KYZA 3KG0A 2QLWA 4HH0A 3DXSX 3TNVA 3MZIA 1OPZA 3K7RA 2FHMA 3FGVA 2ROEA 1AFJA 1TZ0A 4YDXA 4Y2MA 1KQKA 4YEAA 5A6WA 4DPOA 1P8GA 4OJGA 2LQBA 4OJ1A 3IWLA 2L3MA 2XMJA 1MWYA 2OFHX 1N5SA 5IXUA 1LQ9A 2BJEA 3F44A 5B0DA 1YG0A 2XMTA 2RILA 3BB5A 1U7LA 1WD6A 2HFNA 2OD6A 2OMOA 4HI1A 4U9RA 1N5VA 2AW0A 2ZDPA 4F67A 2EW9A 2BBEA 3LO3A 3HFKA 1FE0A 1CC7A 2OKQA 1GXTA 2LXFA 1Q4RA 1X0PA 2N4CA 4HI2A 4DL0C 1AFIA 4HH1A 2W4DA 3KNGA 1RJJA 2ACYA 4A47A 2RU9A 3BDEA 5F0WA 4Q2MA 2HIQA 1Q53A 1OQ6A 3KKFA 1TUVA 3VTIA 2FIUA 2K1RA 2OP5A 3KG1A 1VQYA 2ROPA 3TRGA 4OJHA 3LGNA 2XMMA 5B0CA 4NL5A 1N5TA 1N5QA 1APSA 2VV5A 1XBWA 1TR0A 2JDJA 2K2PA 1OQ3A 1SI9A 5T7LA 1ULRA 2CRLA 1CC8A 3HDSA 2QIFA 5A6PA 2IYGA 3GZ7A 5B0BA 2OFGX 2W4CA 1FESA 2FTRA 1JWWA 2BUNA 3T9NA 2GV1A 2ZDOA 2GGPB 2ASYA 4Y2IA 3MCSA 1R6YA 2N7YA 1FVSA 2PGCA 1SQEA 5T7LB 1IUJA 2AP6A 2QLXA 1YRXA 4OIXA 2VH7A 2K7JA 4ZOSA 2AJ0A 1W2IA 4OJ3A 3WDOA 2Q3PA 1S6UA 3BGUA
chains in the Genus database with same CATH superfamily
1WSRA 1REGX 2F4FA 4QWAA 1S6PB 2V8VA 3M8YA 4QU7A 1B3TA 3BH6B 2K3IA 1FK9A 1NPRA 2W2OP 3PJWA 2MZ1A 3E2EA 3GJSB 2IRUA 3FCHA 5B0EA 3ZZPA 4UZBA 5D3GA 2MJUA 3CD6S 1YJ7A 1ZM2A 4TU9A 3UDVA 3MWBA 1Y9OA 5L8RC 1S4EA 1DRZA 4ZIVA 1S1TB 3C19A 3HKZD 4X62J 1CQNA 3RW7A 3MM9A 2APOA 5KOWA 1IBLJ 3W5XA 2AU0A 1H7XA 2GO8A 1JKHB 2QFIA 4ZP8A 3FSYA 1DARA 2V9KA 3G2XA 4R5PA 5DRKA 2QL5B 5LSOA 3BQ1A 1VQSA 3GFYA 2WSFC 5KFKA 1N6QA 2ZJPQ 5D0RA 5HANA 1NK5A 2G9OA 1Q7YT 1CPZA 2RE1A 1TL7B 3SCKE 1CVJA 1ZS6A 4PPDA 1RTJA 3W64A 4K2JA 3H25A 3CCMS 4K59A 5HL7Q 2AIRB 3N79A 1FX4A 3LPEA 1S10A 3QIDA 3ILIA 2QA2A 4XDDA 5KAKA 2E1AA 1RT4B 2LDYA 3O5TB 1JLQA 4ZVSB 1UTAA 1DFDA 2V8HA 1FRLA 5A0YB 2MYFA 1S97A 1WKJA 3CCVS 5C25B 2PEBA 4LIWA 1Q5VA 4DR7F 5IT4A 3OFFA 3D6FB 2ZOFA 3UPFA 3VALA 5F41A 5ETMA 3FSXA 2Z57B 4YDDB 4G3IA 1RHKB 3UDLA 2JC1A 1H98A 1AZSA 3ETMA 1C4CA 4RNFA 3OQ2A 3DXSX 3OVAA 1N32F 1NKCA 2X3DA 1HQEB 1RISA 1XIQA 4QJVA 1WI6A 4BWMA 4DR2F 1XMQJ 1HPZB 2HNDB 5F9NA 1EP4B 1UAWA 3NWRA 3K89A 4QPXA 4I67A 1AFJA 2B3TB 5F8HA 3M2UB 3NAHA 4DR5F 9RUBA 3FVYA 4OJGA 3SBMA 3K5NA 3HSJA 1U25A 2NXUA 2QG9B 4Q45A 4AL7A 1IKWB 1LQ9A 3CMES 2JEGA 5CYQA 2Y9HA 4JI8F 1SH2A 2ZOMA 3GE9A 4IFVA 4A8OA 2NUUG 3RU0A 1LKZA 4DV2F 4F26A 1RYRA 1N5YA 2BVZA 2CQ3A 4MH8A 1CJKB 1N52B 2GIQA 2GVDB 3PV8A 1AUSL 1VCTA 4I1TA 1RLCL 2RQMA 1QE1A 2WZ1A 4KFBB 4O3OA 2B6AB 4EI2A 2Y8YA 4ZCKA 4OHYA 2IRXA 4F0HA 4Q2MA 2NXNA 3HHDA 2M52A 3GR1A 2F7VA 3CE8A 1ELOA 3AOCA 2R8KA 2BANB 2X51A 2ROPA 2VPXB 4WJBA 3LP0B 4ENOA 1S72S 2YWKA 1KVKA 4HHUA 4DZDA 2NXJA 2LECA 2EC0A 1UP1A 4OYOA 4XK8C 5B0CA 1M1HA 3KOAA 1GTEA 3GLJA 4NL5A 4CLYA 4WF9Q 3CCQS 1LWEB 2K2PA 2CRLA 2FJBB 2CJ9A 3UD3P 2FHKA 3RAQA 2BQRA 2YNFB 2MTLA 2ALYB 3PR4A 1WOSA 2FHOB 1YZ7A 2O67A 5FLXY 1HD1A 4LF5F 4RW8B 1A6LA 1PJ5A 1FESA 1YX2A 3VF0B 3I55S 4R8UA 2J8SA 3PACA 3UFCX 1DZ5A 1NHUA 2FHJD 4MFBB 4QWCA 4DV5J 4JYAJ 4CDIA 3D6MB 4NEYA 2ZEJA 4DI6A 2LLZA 3MMAB 3J81Y 3MEKA 3IS9B 2C3YA 3MMJA 1WKLA 4OJ3A 4PWUA 4WIQA 1VS3A 1XNRJ 2HS3A 2J7UA 2J6SA 3MAAB 4YB7A 1S1WA 2IJFA 3CCZA 3HJFA 5A76A 4B9LA 5A8RA 2PEHA 3GPAA 4B3RJ 4RW4B 2FB0A 5ETRA 5GVQA 4YUDA 1UWBB 4DV0F 2OJ3A 3FQLA 4IYQA 2EBGA 2W01A 3BH7B 2UUWA 5A2QY 1LNQA 1R0AA 3E01A 1VBXA 1C2PA 2RRBA 1GQEA 3T41A 1M5OC 3MEDA 3FC9A 1X9MA 4LT6A 4JI8J 5IS2A 4LR7A 3AXKA 3V81B 3NLCA 1KTQA 2JLFA 2OPRB 5DJBA 2M0GB 3EMTA 4G65A 4H4KC 3WX8A 3JTNA 4USIA 3HT3A 1MW7A 1UZHA 4C11B 2J76E 3JSYA 2PO4A 2VJVA 4QR2A 1YTYA 4EZ6A 4IO1A 4MAKA 2FVCA 3NS5A 4EU0A 3DGPB 1IKWA 2D1CA 2CQ2A 2A18A 3OFHA 3QWUA 2GS8A 4Y2AA 3UDCA 4KHPF 1XMOJ 3BV8A 3TQEA 5LXYA 2IA0A 7FDRA 1BWVA 3K5OA 3QLHB 4LFBF 1NZAA 1X4CA 4CM0A 2R7VA 4DFKA 1FO1A 5L46A 3MEGB 3R7NB 3ZXWA 5HI7A 2Q1LA 1FHTA 3D7SB 3WHIA 4AE5A 4LBIA 3BGRB 4KFBA 4EK2A 1WDTA 2WCXA 4FS2A 1KRPA 1HQEA 4EEYA 1KNZA 4KO0A 2PI4A 1D9AA 1X5PA 2BE2A 2BV3A 3F56A 2W25A 1RTIB 2G0JA 4FXWA 5B09A 1TKXB 2GGPA 5HBMB 2AF6A 2YVSA 3SMZA 2EFNA 2WRMA 4LSZB 4P2XA 3OBIA 1YDLA 4LF8F 3TNVA 2GJFA 2CYYA 2JL9A 5SZTA 4FF2A 2E9RX 2BOAA 4D3HA 1T9XA 3H5XA 1SIZA 5EHHA 3EXYA 5IT0A 2XQCA 1HNWJ 3Q86A 2R4FA 2GVZB 2H5JB 1FERA 3GFXA 2MMYA 3HKWA 3PEJA 4RW6A 3RR7A 5DZ7A 3C16B 1K73T 4DQIA 1NO8A 1QD1A 4CP5A 4FPRA 8ATCB 5GAHU 4O4GA 1VC5A 2HFNA 4ICLA 2V50A 3GIJA 3HSZA 3TAMB 4OFZA 2DGQA 3FZBA 4IRKA 3AOBA 4LF6J 4P10A 2W2NP 3BSAA 4X2BA 1FTRA 3IXQA 1HR0J 3MAAA 3QYYA 1TV6B 2XMAA 2BE9B 3DM2A 3TJ9A 4Y0FA 3KNGA 2LKZA 1BXNA 3FEYB 1MNEA 2D74B 3BDEA 1N33F 1IJFB 1UWBA 2AX0A 3WIVA 5I3PA 2OP5A 2EFPA 3UN2A 4O3RA 1H73A 2DCUB 4TY8A 1YVFA 3M2RB 3M6UA 2GHVC 3T5HA 3GP9A 2AJ2A 4NYZA 4P2SA 3VAJA 3NY0A 1D0EA 1MMDA 1WKKA 2WOMA 5HQMA 2W7OA 4JI7F 4JV0A 2Z4PA 3HDSA 4ANDA 3DLEB 3GZ7A 3A8EA 2JNJA 2H5EA 5CYMB 4DU7A 2VPYB 2R7RA 2AGOA 3R5AA 4JI5J 1WOOA 2YWEA 4TXSA 2IDEA 2IM1A 2R9LA 4NLQA 2OPSA 2W9BA 3W8PA 4LJMA 3BPSP 2NXEA 4RZRA 1VQ8S 1SQEA 3G87A 4ZVTB 1TL3A 2KVQE 1FKPA 2QLXA 3A3PB 4I2QA 4XTTA 5CH7B 2DITA 3OV7A 3R2DJ 4QR1A 2RRNA 3IWLA 3W65A 4M63A 3F0NA 2YWGA 4L3NA 2K8GA 2QLJB 1JXVA 3CT9A 4NLUA 2RDJA 4DV6F 2FGCA 1VC6A 3D67A 5GAEI 2AJFE 2ALZA 2IM2A 1RZMA 3EVOA 4QW8A 3EWGA 1U6ZA 1RADB 2MLXA 5CYQB 4DCPB 4RUHA 4KKOB 1RWUA 3UCGA 4NZ0A 1TMMA 2VKRA 4J9MA 3NRBA 4B9MA 1SKUB 1YWXA 2WHOA 4I56A 1VGYA 2HBYB 3BN4A 4ZP9A 4X66J 3ZTPA 3EZUA 3B82A 3NCQA 5HMYA 4W4MA 1KHWA 4CT8A 1FEEA 3IWXA 4ED0A 1GX5A 3POTA 5KG4A 2IC3B 2MQMA 3KJVB 2NR0A 1T03A 5CHCB 1RTHA 1S9EA 1S1XB 2R8IA 1CEZA 3PNIA 2BJ7A 3M6VA 1SKSA 3GMGA 4MYUA 5IV3A 3E51A 4F3MA 4KBIA 4RU9A 2MKIA 2YKQA 3RRKA 3SSSA 4M5NA 1RWMB 2UP1A 4DCOB 4CLPA 1IBKF 3ZZZA 4PQUB 3OJUA 2CNLB 2P2CB 4JOUA 2AT1B 4LRFA 1FFSB 2MLYA 3PHEA 2RT3A 2HIYA 4BWJA 4AXIA 1RCOB 3J7ZT 4C4WA 1HYSB 4OYZA 4J5OA 3V6KA 1GEHA 3BSCA 3F41A 2QE5A 3MR5A 3C46A 4PG8A 3N6LA 3OFEA 2KYZA 4TKTA 5A2QU 2HHUA 4OYWA 5C25A 3G86A 3PHTA 5FDLB 1FEHA 3KLGA 3MMAA 1LFWA 1WTFA 1PBUA 2UZAA 2GX8A 1QVGR 3I82A 1RHJB 4YQWA 1S7HA 4TU8A 2C3MA 1C0UA 4M95A 4KY3A 2VL1A 1LEOA 3OLAA 2DEJA 1TK5A 2OHDA 2QMWA 5DLGA 2VBYA 1NJXA 3KG4A 2UXBF 1WG4A 2VOOA 1R43A 1FX2A 2VG6A 2XSJA 3GG1A 5U47A 4UW2A 1XTZA 2I9SA 4BBYA 3MR6A 4ECVA 2RILA 3K0JA 2CPEA 1VDHA 3MHYA 1WHXA 3MF5A 4HEA9 2ZNZA 4P2MA 5KTQA 3C6UB 2OI2A 2WONB 3GYNA 3MFHA 4OZ0A 4DUYF 4DLEA 3J81j 4F0MA 2EW9A 2C1EB 4DL3A 1KVJA 1CC7A 5KFAA 3T5JA 4YY3F 1WEZA 4CI0B 5KFQA 1FNMA 4IFVB 3MMBA 1VBZA 1RDRA 3M8QB 4CNYA 4F0KA 3R1HA 2XHCA 1X5SA 4KR0B 5L1KA 4MK7A 1RAAB 1Q81T 4C8OA 2W1BA 3HVAA 1J5OB 4RBTA 5ETSA 2KHDA 4J91A 4A8FA 1QAXA 3B6BA 1PO6A 2F63A 4CH0S 3IBFB 2ZH1A 1U2RA 4M5GA 3B4MA 3FCWA 4JI2J 2XG8A 3HZGA 2GMJA 4TU7A 2WVCA 4NA2A 2JDJA 2Z0GA 2FJAB 3K8VA 3LALA 2CZ4A 4P75A 4EMDA 2DH7A 1H3DA 3NCRA 2JZ5A 1ZAVA 5EWGA 3NMRA 2HHWA 1T03B 3I6PA 1T94A 1JWWA 4P7VA 2HFSA 1RHRB 3PFOA 2ASYA 1LWEA 2AZ3A 1NLKL 2FVSA 3BBBA 4RNNA 4LF5J 3CGIA 5HSPA 2YNFA 2ZUAA 1T02A 3C15B 1OSCA 2AJ0A 3LAMA 3PYGA 3U27A 4ZVRB 2OIHA 3UR0A 3NNHA 3DCAA 2F5GA 4ZJLA 4Y2KA 5CA5A 1T95A 1WC1A 5J2MA 3M2UA 2XZWA 4KIAA 4MFBA 4WWSA 3CJKA 2K1RB 2LA6A 1PAEX 1RWOB 4WK3A 3D54A 3MCMA 3LWLA 4USMA 1P9QC 1C1CB 1DQ9A 1S99A 1HNIB 2CJAA 3C16A 4LF4F 2DGTA 5D0EA 4X84A 1WJ9A 4OX8A 1QSSA 4WZMA 1IR2A 2DNNA 3BO2A 3CCLS 4MKYA 4OZ3A 3TANA 4ZLNA 3WC0A 3PEHA 2M3DA 3AQOA 3DOMA 1HNVB 1AXQA 4ZVEA 4N56A 1VQ5S 1DQAA 3CCSS 2YX7A 3W2WA 1Y3KA 2GQ2A 1IWGA 3GB0A 3HO1A 4P71A 4WXOA 1Y00A 2IVYA 3M1VA 4R5PB 2RHSB 4DPWA 2H9ZA 4Q0BB 2V4RA 1Z2ZA 3CC4S 1YHQS 3BF4A 2VPWB 4LFBJ 2KVIA 2XI2A 2HLTA 4GO5X 4WK1A 1CJUB 2ZH8A 3PTWA 4O4RA 2D7SA 2W24A 4CO3A 3HFVA 3DMJA 1P6TA 3LH2S 4DX6A 1TTHB 3GIMA 2CQ0A 1PKUA 2BJDA 2P6TA 4ITSA 4ZJQA 3EGZA 2HQIA 4K5RA 5E3RA 5HMXA 1S6QA 3NEKA 5FD1A 3QGHA 4NLTA 2WW4A 4KGKA 5I4MA 2KO1A 2MZSA 3UNYA 4DZ6A 2N3OA 3BBFA 2HRUA 3OHBA 2FHMA 1TL3B 2NUHA 1I3OB 3PKYA 2LXUA 4ED1A 4OYPA 1OYDA 2PA3A 3WBZA 3MPDA 5D8HB 3WQPA 2A6MA 1JJHA 1VQKS 3GJRB 2E1MC 5A6WA 5IWAJ 1P8GA 4QW9A 1ZETA 2D41A 2DHGA 2DNGA 5BYSA 1SH3A 2FVQA 2YX1A 3KJNB 5ETOA 5I3UA 3GFHA 3FFIA 3DLHA 5IQ6A 2HRTA 2FVPA 4NRUA 2BW2A 4OV6A 4EBEA 1PYTA 4NZ7A 4ZVGA 5ETQA 2XYGB 1KS2A 2PIIA 3B54A 4U9RA 3PVXA 4B9TA 2N3LA 4KGMA 4OYAA 4ZN1A 4QYZJ 2OKQA 3US5A 4DSEA 4CM2A 4YP3A 2JX2A 2DHAA 1YRUA 3EM1A 2E1RA 1U2FA 2MKSA 3OR1B 3HSDA 4A47A 2CAJA 2ZM6F 2VG7A 2J0XA 3ZTOA 1S9EB 3JTPA 3D5MA 3KJQB 5GADI 3KLFA 3EDQB 5C5JA 1WACA 3M8ZA 3VTIA 3Q23A 4DV1F 5JMNA 2C2EA 3MM6B 1KN6A 4DR4F 1J5EJ 2WBRA 4NCGB 3LGNA 1QVFR 1TV6A 4Y65A 4ELVA 3VAFA 4C0BA 2OTLS 4JP8A 1IQTA 3I0RB 2V8GA 2E66A 4LRBA 4ZPBA 3T9ZA 5KFUA 4CTAA 1SJ4P 1N6QB 4FKYA 2UUAF 5KFCA 4ZVOB 4K4ZA 3IGVA 1W7WA 4PQUA 2IYGA 3LP2B 2M70A 2YKMB 4LREA 4NLRA 4OI2A 2I2YA 4WCEQ 2FTRA 4TQSA 1S0MA 2J9DA 4Y6IA 2GQCA 4QPTA 1PAUB 2W2MP 4YB5A 2ZJRQ 4OI4A 1V9OA 5KG6A 5CABA 3JSMB 1WHYA 2VUGA 5HAOA 3PW7A 2OMLA 5FDLA 4K0KJ 2OUGA 1WHWA 5J2QA 2MDAA 2DR6A 3RBXA 3GWCA 3BGUA 5L1LA 1QAJA 4HACB 4CYUA 1RA6A 2DGWA 4FNHA 2XMWA 5JUMA 3B78A 4YR0A 1K0VA 1FJGJ 3HLUA 3G96A 4O0NA 2AJQA 3PX6A 2DIVA 3JS9A 5CD4A 2BACA 5J1EA 7FD1A 1S5ZA 3JSBA 2UV8G 5D77A 3WX4A 1SUQB 2B9WA 1RAEB 3DDNA 1YK9A 4RW9B 4TYBA 3IC1A 4ES1A 4JI1J 3QO9A 2ZKTA 1WELA 1QSYA 1SV5A 4B9VA 5GAGU 3D28A 4WFYA 4N5SA 1TL5A 1IBLF 4IFYA 2IM0A 4DUZF 4KKOA 2OO4A 3CJ0A 1Y11A 2DGSA 3DM2B 1PG5B 2Y0BB 4FNIA 4X65F 5J2NA 1S1VB 1HNZF 2QSFA 1L3VA 2HWTA 4F2RA 4EO6A 5KFGA 4B3OA 3AJ2A 1SJRA 2VG5B 2ZWPA 1L3TA 3ZZ0A 2P9GA 4ED3A 2EXUA 1QUPA 2GFFA 3V81A 3FDSA 5KFIA 3KTQA 4ZLLA 3IMQJ 5DDRC 1TK0A 4X4TA 2DVIA 1IVZA 2CXEA 4DL4A 2FJEB 3ZZYA 4TNOA 1E6YB 3NL0A 3W63A 3IG1B 3H5UA 1T0TV 2V2QA 3BBCA 1S6OA 2Z2YB 2YKNB 3MMCA 4B9NA 3LGMA 4XAKA 2UUBJ 4DR7J 3SCLE 4DUTA 5DGBA 4F4YA 1M90T 1PSDA 3MEGA 2LQ5A 3CD0A 1RK8A 3TAQA 3HULA 1JLBB 5E0OA 2BEFA 2PDAA 4F4AA 4U95A 5DM6Q 2ZH5A 4KH1B 2AJ4A 3CULA 2R2SA 3TEGA 1NHKL 4AFFA 2J6UA 2O01C 5IFMA 2G0IA 1KQKA 1KLMA 5A8WA 4DPTA 2BW7A 4ZN3A 1QTMA 3SSQA 2WVBA 4DV6J 4RO0A 3OXFA 2Y3YA 2ZC3A 4RW8A 5IXUA 4IRCA 3CDAA 5K8MA 2FJWA 2G2ZA 3FEXB 2UU9F 4WKRA 3CDUA 2DISA 1SKWA 4CO0A 2VG7B 1HBOA 2KU7A 4ID5A 1BQXA 3CJSA 5AXLA 5DDOC 1N5VA 2XY5A 4DCJB 2ZWOA 3CJ4A 3HFKA 1XNRF 2MQNA 2NYHA 1Q4RA 3MEEA 2H5IB 4L73A 4IQXA 2FDNA 4C97A 1TKDA 5C2GA 4DFJA 1ZTWA 2IHR1 1RJJA 3BSOA 1NPKA 1HNVA 3AHPA 2IC3A 1KWMA 2BKNA 1CG2A 1C0TB 4RUBA 3W8GA 1RBAA 4IOAQ 1K0TA 2ASDA 2W7AA 4HTJA 2LVWA 1KHVA 2FIUA 4L75A 1K1QA 3HP6A 4I4BA 4DSFA 4RUAA 1RBOB 1ZM9A 2V2KA 2YKMA 2XHWA 2NS1B 4F4KA 3NGKA 3GJTB 2OLWA 3MM9B 3W2VA 2B7CB 3R27A 4CH7A 4RKUC 1FRKA 3MEDB 5CZXA 2KG0A 2AZ1A 2GIRA 2QZ8A 4D3GA 1EHWA 4WYLA 1OQ3A 1FXLA 4QWBA 1CC8A 1X0FA 2D3UA 4OZLA 3MAHA 5F3TA 1IN0A 1YQHA 4ZPAA 1FDDA 3EX7B 4U96A 1IBKJ 2CQ4A 1YJWS 2HSEB 1PIEA 3OJSA 1UW9A 2F9DA 3T9NA 1N48A 3R1LA 2AEFA 1PBAA 2VDIA 3AODA 3DGPA 3I5BA 4WPAA 1OIAA 4P72A 1FXRA 2CNNB 2LA4A 3BGOP 3SCIE 4YR3A 2J6TA 1RKJA 4LFAJ 4A8WA 5E41A 2AEJA 2KRBA 1EKSA 4M5HA 1GMVA 2Q3PA 1D8ZA 2RVJA 3A8JA 4N41A 2QLBB 2Z30B 3RAMA 4ZPVR 2HHHJ 3TI0A 5E3AA 3B8HA 1RWKB 2JFKA 1RAFB 3TUPA 1U1NA 3ISND 1BQMA 3TX8A 1C1BA 1SIWB 3ZC4A 3RG6A 1JLEB 1HLWA 3PYEA 3M8RA 3KHGA 3UD4P 4CCHA 4ETZA 4N8NA 1CBKA 4CLTA 3EJMA 2HGNA 2Q6CA 3KJFB 3SQOP 2ZH2A 4OHVA 1AA1B 4A46A 4W92B 1M5HA 2B7BB 1HWJA 1ZOTA 2OGUA 4J7CA 3SXLA 2UU9J 1WF2A 5E33A 2B43A 4DEZA 4DLGA 2Q43A 3FK4A 4USUA 1FDBA 1RA7A 4ED6A 4A8KA 4X64F 3T19A 4HDGA 4JUZA 1IKYA 2MSTA 1HBOB 3HSGA 4ID5B 1U02A 4ICLB 1X5OA 5F0UA 4UOGA 2FJXA 4OZNA 4KHPJ 2V9WA 4O4GB 1VC0A 4DV2J 4WE1A 4LRAA 4BC7A 2OEKA 3MUTP 1JLBA 4QIFA 4P7TA 4DSLA 3KHLA 1M1KT 2CQHA 2OD4A 3HXMA 1RT7A 1KR4A 3QMQA 4ANCA 1PYOB 2OELA 3PFEA 3OXLA 4F25A 3H20A 5EX0A 4ZVPB 1U47A 1U0SA 2HS4A 3THTA 4LQ3A 4G1QA 3DOKB 4DX8H 3NBPB 5EX3A 3KLHB 4DR3J 3AJDA 4ZHRB 2G1DA 4PXBA 5HQ8A 4LMZA 4UF4A 3MZIA 2ILZA 5AXNA 2R2UA 4LF7J 2AEMA 4GVBB 2HNZB 2J0QD 4K4SA 4A8QA 4RLEA 2C2MB 1HYSA 1X4FA 5HP1B 3NS6A 3K17A 2PT0A 4E98A 1EQMA 4NLPA 1S6PA 2AD9A 4LFAF 3ITHA 4OJ1A 2ZH3A 4ANEA 3G9CA 2QMUB 3NS7B 5HN0A 1S49A 3FUYA 4F8RA 3MM8A 3GYGA 1MWYA 4MT1A 3FBCA 3F44A 2YY3A 1YG0A 3W5YA 2MB0B 3QRRA 1DLOB 4PZVA 2VIHA 2LCWA 5KFDA 2UUBF 1HNXF 2OD6A 3VVTA 1MG7A 3CEDA 3CCRS 1VBKA 1CULA 4LF4J 3IS9A 1FE0A 1HW8A 2B8QA 3LP1A 2W8KA 2VF3A 3A3OB 2HWHA 2DH9A 1FA0A 3N9UC 3PM9A 4WYWA 5BXIA 1TFWA 2Z2MA 3QAEA 4NYPA 4U8VA 5KG7A 3FZ2A 1Y4ZB 4CLSA 4JI6F 2HQ3A 3JB9k 5F8JA 2DNPA 2QFJA 1F2GA 4PWWA 4CO1A 2JVRA 3UQSA 2XS5A 2F4VF 2RU3A 4FYYB 1VQMS 2HK2A 4OZ2A 5EWFA 3OR1A 3AB2B 3GCXP 3DI6A 7AT1B 4DV1J 1T7PA 3JAMY 2WW8A 3A4TA 3NKYA 5C7PA 1OMSA 2R2TA 4RBUA 3V4IA 4Z7YA 4O23A 4DR1J 2QIFA 2HKEA 3PRDA 3IAM9 2B4OA 2BQUA 1QLNA 5B0BA 1BWEA 3C6TA 2ZBQA 3MPVA 1V5VA 3FBEA 3KK3B 2B4VA 4Y3CA 4RX6A 3FCVA 1GMUA 1L3KA 2NLWA 4DR6F 1BD6A 2CWXA 3A8KA 4CTAB 1IUJA 1UPPA 2QC3A 2I6WA 3VWSA 2GAGC 1NJIT 2K7JA 3WDOA 2IVFB 4GC6A 3OLBA 5C42B 1DBDA 2VA2A 1JLEA 1HQUA 1GTHA 3D0GE 3OSNA 1YJRA 4N7TA 3D0HE 4RR5A 1RP5A 3QNWB 3BGRA 1RT6B 2H4YB 4B9SA 2VOPA 4P2FA 2BE7D 2L9NA 4OYMA 1XC9A 5B0GA 2CA9A 2DT9A 5D78A 5J2QB 1RCXB 4LBPA 3TZYA 1URNA 4OL8A 4F3QA 4WFNQ 1U1MA 4KSEB 1RYSA 1F9FA 1SJQA 4OX9J 4QIWD 5EWEA 2MQ8A 3CJKB 4C7QA 3Q8RB 1K8AT 4CZCA 2ZBCA 3BPDA 2QA4S 3N6NA 4EBCA 1RGVA 3H90A 1ZTTA 4RUCA 2VQFF 1ACMB 1B7YB 2DEIA 1X4DA 1IM6A 3BQ2A 4IG0A 1TAUA 2QO3A 3JQJA 1DTQA 1N56A 3GSDA 1R89A 2OAUA 5H9EJ 3W9HA 5K9FA 5HQLA 1TL1A 1X60A 2B5JA 3ZNJ1 2VFTA 4DV0J 1VQ7S 2AGQA 4U7UK 3M7VA 1U1LA 2MZTA 1HI1A 1Q1KA 1SC1B 5C24A 2E5LF 5KG1A 3MM6A 3N28A 4ZA1A 2JC0A 2OPPB 1L3UA 1RB0A 1ZPWX 2HHQA 2KH9A 4DSIA 1M5KC 1CULB 3UVJA 4CO2A 5IM0B 1S1VA 4G1QB 2DK2A 1NH7A 3J80Y 3UCZP 2MY8A 1LWFB 5M2UA 2C22A 1WUUA 1RHQB 3E8OA 2IFXA 4ETXA 4HLBA 4KHMA 4I2PA 3MUMP 2JEIA 1KVIA 3L7OA 3GFZA 1DAXA 1Z1ZA 4NA3A 4ED5A 1RAGB 2R7SA 2R7QA 2PMWA 1S0OA 1N33J 4CT9A 3GIIA 4Z7CA 4ZCIA 2ZHOA 1XR6A 3VR1A 2XZTB 4U7CA 1RWVB 2U1AA 3DMJB 3K7RA 3DYAA 4B3TF 5H9FK 5H1SV 2GMLA 3BGLA 1PYSB 1V3SA 3PJ9A 1NB7A 2HWIA 4OX6A 3P3DA 1RSCA 4NI2A 2CDQA 4NWBA 3CD5A 1WEXA 2HQDA 4LRDA 4WTYA 3H5YA 3IR7B 4K4TA 1HBNA 1F60B 2XCAA 4URSA 2R7WA 2RS8A 3QLHA 5J1EB 2VASA 4ZPTR 1RQ0A 3NWGA 2EK1A 2HVDA 2E5JA 2YKOA 3DU6A 3M2VA 4H4MB 1LW0A 2Y1JA 1U4BA 3AXMA 4NCBA 2O3DA 3PDNA 4E2FB 1S76D 1SV5B 2D9PA 3RTVA 4EFAC 4JI1F 3FBFA 3V6DB 1U24A 4A8MP 2ZE2A 4ZKAA 2UUCJ 3DLBA 1T9YA 4O44A 2IMOA 1HMVA 1RT2B 1JLAB 4IH6A 4OI1A 2FD2A 4QIGA 4LFCF 3JQMA 2OEMA 1UVLA 2GJ2A 1C1CA 2K1RA 1IKYB 1N0UA 4OJHA 2Y8WA 5J1NA 3TA1A 2YNHA 2GAHC 2Y1RI 4O3QA 4X4PA 3MPUB 4P6QA 4Y34A 1WG1A 3OR2B 3FMWA 3K57A 2ABYA 3VZIA 3K5LA 3ZZUA 2KJWA 4F7VA 4UT4A 4WXWA 2BKOA 3GG0A 1G4CA 3GILA 2OFGX 4ZCLA 2H4WB 1M1GA 1LXJA 3DRRB 2XZDB 2XNQA 1RT7B 3CO0P 5IOLA 3GCWP 6AT1B 2IPOB 4C98A 2ZJQQ 4DPYA 1S1XA 1QY7A 4J9NA 2GGPB 1TKXA 1FT8A 5FLXU 5HVHA 2AYBA 2N7YA 1U1KA 2H48B 1QM9A 2XYPB 5M2PA 4LUBA 1M5SA 3MGJA 5MLCV 2RB7A 4FPIA 1SB6A 1W2IA 3AD8C 1VI7A 1YSJA 2GIFA 1FF2A 1PJ6A 4IG3A 5K20B 4R8UB 4C8MA 4KTQA 4ZK7M 1R8HA 2KZZA 3NAIA 3CMQA 3Q83A 1MU2B 4WFXA 1I94J 4TYAA 3G8TA 5A0YA 2EI5A 5K5MA 1KD1T 3WC2A 3KK2A 1B70B 1MLAA 5ADZA 3MECB 4PUOA 1DLOA 3D66A 2RSQA 4OHXA 1MMNA 3NMAA 1R27B 2B0GA 1RAOA 4GMKA 5H9FJ 1S6QB 2CIMA 3T5LA 2RDIA 1X4BA 2Z2ZA 2COLA 3ISNC 2C2ZB 2DRDA 3NGTA 2B9EA 4A8SA 3AJ1A 1N4LA 4LSNB 4Q2LA 2RF2A 2KDOA 2E9ZA 2BMBA 4EZ9A 5CYMA 4B3MF 1C1BB 1RAIB 2BJ1A 2J9EA 4KE5A 2SXLA 2HMIB 3G4SS 3LA0A 5FIIA 2PD1A 3NGUA 4FP9A 1A0OB 3SIPB 2G4BA 1R8AA 4PRFA 2R7TA 2CVIA 2OPQB 2KJVA 4UQGA 2YTCA 3TUIC 5A8KB 4KYZA 3HHLD 2BABA 3MFIA 4ZJOA 2WONA 1HHTP 2XMKA 4PWDA 4LFCJ 2Y1IA 1NB2A 4E8UA 4CLUA 4DQSA 4C6AA 4X64J 1JK9B 2KRRA 4KH0B 4RBVA 3ENAA 1HBUA 2QRRA 2HLUA 1F3FA 4CLLA 3F73A 4K4WA 5IC6B 2JH3A 1FE4A 1JJ2R 3I87A 1H74A 4P74A 3CCES 1G6BA 2XS7A 2KTQA 3RYLA 5J2PB 1U8WA 2G1HA 1Y5IB 2JEJA 1LWCB 3M4XA 4PEOA 3TUJC 3OL8A 2MJNA 2QJ3A 1X4AA 3D0IE 2BZ2A 3Q2SC 5DM7Q 4ES3A 1XWLA 5AE1A 2XB2D 1OPZA 4URQU 5C42A 2J9DE 3QBCA 4B9UA 3OR2A 1XMOF 2J9CA 1VHIA 2ROEA 3QGGA 4MTPA 4OZJA 1F5BA 4LVOP 1SL2A 2ZITA 3MAQA 3MDFA 2HZAA 3KXDA 4M5DB 4EUVA 2AGPA 2UXDJ 1WF1A 3L3CA 3M05A 2L9WA 3VAGA 4HDHA 4RW7B 3O3LA 1LK7A 1JLFB 4JBCA 1H2UX 2V67A 3JYTB 2XMTA 1U1QA 1GK8A 3PW0A 5HK4A 4W98A 3HHEA 4JV1A 3JXOA 2RD5C 1VRQC 2AV5A 3MM5A 2QA4G 2OMOA 2DR8A 1BE4A 4IH5A 3Q22A 3L95X 1SVDA 2YKAA 3AD7C 1U45A 1CLFA 2LQ8A 2J8AA 4IG0B 4LSLB 4OYBA 2W4DA 2IA6A 5I42A 1VK3A 3A3NB 4B3RF 2VBZA 1XEZA 4V1Ak 2HIQA 2HBQB 3ILJA 3KHHA 4UY85 2YX4A 3KMQA 4C8KA 2BRKA 3EXCX 3ZZRA 1VQ6S 3LP1B 1SXLA 2DHHA 4ZDNA 2ATLA 2A0FB 1GMWD 2V34A 3RZAA 5KFFA 2AYGA 2R2RA 4NYOA 4PKDB 4C3MA 2Q6BA 1D9DA 2QA1A 4EWTA 3UN5A 4NOHA 5L1IA 1J5EF 1APSA 4J9UE 4USHA 3KFWX 1VHFA 1SI9A 5D4NA 5IC4B 5CXTA 3PO5A 1CS4B 2P9EA 5CAAA 2UVWA 1NCLA 1AT1B 3DDKA 4DN0A 5HJYA 4YHHJ 3OTOF 2XCPA 4DV7J 2UUAJ 4NLWA 3MTKA 4JI3F 4KGZB 3QRPA 3HD2A 5I3QA 1NJZA 3EICA 2B9YA 1RT3B 2PN6A 3S1TA 3SQGB 1X4HA 4C11A 2RS2A 4DWIA 4WP9A 4HYKA 4OZ5A 4DQQA 1V3RA 3LOUA 2H65B 3GV7B 2KXNB 2QSWA 4CLFA 2DGOA 4ED8A 2BQ3A 2JSXA 4M5KA 1RT1A 1YITS 2XLKA 1RKIA 3EYZA 1JLQB 4DS4A 1OY6A 2DY9A 4O3PA 4LF9J 2WVEA 4BCAA 5J2PA 1WSVA 3O8WA 2IVMA 1AYEA 1J2VA 2XSJB 1HHSA 2BX6A 4N77A 3TR5A 3U02A 3DN9A 2RAQA 2RUSA 3QZ8A 1WC4A 4ECSA 1T8EA 1GT8A 1AB8A 2CPHA 4A48A 1RXOB 1N8RT 2ADCA 4LF8J 3DLKB 4OI6A 1TUGB 1NH8A 4MIBA 3BN7A 3DOLA 4OLOA 2KT2A 4M5JA 4ILMA 1B0VA 3EVMA 3H40A 2LQ9A 1HI8A 3MD1A 2G2OA 3R7BB 2Z56B 1NK4A 3M30A 1MN7A 1RT2A 2M88A 4I0WA 1VFJA 1HNWF 1FDNA 3NNAA 3CCTA 3HVWA 3JQKA 1NJWA 2N4DA 2MLZA 4C2MA 4GKKJ 3RRHA 3KYLA 3L09A 5LMNF 3ZTQA 5LMUF 4X65J 4DL7A 1IBMJ 3H7HB 1LXNA 2BXJA 3M9MB 3Q2TC 4I7FB 1Q16B 1DJ0A 4KRWA 1UW4A 3TA2A 3EGWB 3IA0A 1URRA 1FFWB 2KN4A 4DXLA 3KK1B 2O5DA 1ZAXA 3MPYA 1X9SA 2HS0A 5C24B 3T1YJ 1FK9B 1UJ6A 2HRYA 2HURA 2EFQA 3G82A 1NK9A 4X62F 3C6TB 1C0TA 2IIHA 1JX4A 1XN9A 1H2TZ 3A1YG 4EO8A 2KM8B 1B4SA 2M5YA 2R42A 3KG0A 1RWNB 5CZVA 1U1PA 4ZPWR 2LMIA 3SI8A 2FZCB 4G6VB 5H9EK 2DKOB 1FNOA 2VKZG 4N76A 5HJXA 3O2IA 4KV8A 1U1RA 1S12A 4Y2MA 4FZVA 5JJBA 4GKJJ 1UJ4A 3O1LA 3ICLA 3DLJA 3DOKA 4F4WA 3D3CJ 1CJTB 2DNRA 3BKTA 3UR3C 4YB1P 1VYAA 2XMJA 3DRSA 4ECQA 5G4DA 3DFEA 2XYHB 2WVFA 4UQTA 3LWMA 2ZD1A 1O6XA 3DYAB 2O66A 4RWXA 3CCUS 4PXCA 4ALZA 3SV3A 2FQQB 4CNZA 2A2DA 5KFLA 1QSLA 2DNYA 1LW2B 4ES2A 2IJNA 1HA1A 3OPKA 4NI2B 2W9BB 3Q0AA 5KFHA 1FKOB 2ZDPA 3LO3A 2NYIA 3ULHA 2HEKA 2W2QP 4HI2A 4HACA 3SDEB 3SEOA 3VVUA 1NZ8A 4J37A 4J9RA 3H4DA 1JLCA 5F8GA 4HR2A 2MKKA 1JXLA 5LT5A 1F9HA 3KLIB 2DGXA 3BKUA 1Q53A 3T5KA 2HFZA 4I69A 1PJ7A 3BYRA 2MZRA 3I32A 2DNKA 4M1KA 3Q8PB 1VQ9S 1VQYA 2UXBJ 1VRTA 1WC3A 2ZE2B 3VCDA 5IV4A 3C14B 3CUNA 4CRJA 5D4OA 1JMTA 2DNZA 3MMBB 2U2FA 4FYVB 4X66F 3HI9A 1RU1A 3V6JA 5DLFA 4UZCA 2EFVA 2AKWB 1F5CA 1HBUB 1PC5A 5A6PA 5DS7A 4K7QA 3N0VA 3UI3A 5IT9U 4DDFA 3EGVA 2MZJA 1RAHB 2GHWA 1LWCA 3VGTA 4I64A 3IP0A 5IT9Y 3QIPA 1JB0C 1R8CA 1R3NA 3G6VA 3T1YF 3HHKA 2FLPA 2CQPA 3DRYA 1Q8KA 2HGLA 1R6VA 3KLEB 1RABB 3VGUA 2N7CA 2VH7A 1U6FA 3VGVA 4DPXA 2Z8QA 2P6SA 3DRRA 3KG1A 2HBRB 3SFGA 1NSKL 1DHMA 2VBWA 1JLGA 2DD8S 3TQ1A 3N5FA 3IAS9 4V19X 2BJ3A 3LGHA 1K1SA 2O1PA 1GXUA 2MQOA 2A6OA 2BANA 4AL5A 1VK8A 1JLFA 3CXCR 3WZ0A 5I3UB 2DTJA 2PA8D 2MQLA 2RHQB 2ZBIA 3TVKA 4BHQA 3M9OB 1GH8A 2GMHA 1UVKA 2DNQA 2YPYA 1NPPA 5AJ3J 1RT6A 3IRWP 3MOZA 3MR3A 3CJ2A 3QT8A 1MN9A 3MM7A 1YI2S 2IBKA 3OVSA 5EN1A 1X4EA 4HTIA 4DS5A 4H54A 3AA8A 4JI4F 1Y7PA 2V68A 1BQNB 1RT5A 2KI2A 4B02A 1HKAA 3PG9A 1BC6A 3DHWC 2YNIB 4J9LA 4NPOA 5HP1A 4O44B 1TQLA 3IBCB 2KYXA 1H72C 3NNCA 1FRHA 2CFXA 4DG1B 5DDPC 1XNQF 3CPWR 1RTDB 2B4UA 3DDIA 1TMJA 1Z2LA 3EZOA 3FRYA 3CJ3A 3J7Z5 1FWLA 2V63A 1LW2A 5D15A 3V4MA 1EETA 3NG8A 2IDLA 4IDKA 3QJPA 1LWXA 4RU2A 1H7WA 4URGA 1U0HA 2OSQA 5HO4A 1HW9A 2C28A 3KLVA 4ELUA 2VFSA 3C2PA 3EPGA 4WBFA 5A8KA 4EYHB 1S77D 4QR0A 2YH1A 4FF4A 5JXSA 2LDIA 3D4JA 3DNCA 3T1HF 3H2VE 4XPCA 3E01B 4Q43A 3PY8A 1RT3A 3SQGA 1KEKA 1R8BA 1HL6A 4HT5A 5RUBA 3G6XA 3FEZA 1NU4A 5LSLA 2A2CA 2JHEA 4KGVB 4ERDA 1F5AA 2YWFA 1XJWB 1NDCA 1SC6A 3HM9A 3RGIA 2C2RA 2IAJA 1T05A 2BOPA 3BREA 3IRXA 1ZAWA 2P8IA 3QPIA 3V4IB 3RB0A 3D1OA 5GAGI 2XO6A 2DB1A 2KXFA 3PCOB 3KDOA 4L76A 3D6TB 2C2OB 2CWKA 4IKAA 3UE2A 5KFEA 3SDEA 5L1JA 3KNAA 4YR2A 1A7GE 3MECA 2JVOA 4PUOB 1O0PA 3OUYA 1IKVA 3KDNA 4DV4J 3PX4A 4NE9C 4U67Q 4ECRA 4FBTA 1E6YA 2EFOA 3N6MA 2AW0A 3DOLB 3PJXA 1Q0NA 3HVTB 3UNGC 1WF0A 3V5RA 2ZH6A 3ZFVA 3THPA 5T14A 2LXIA 4HH1A 3X1LB 5L38A 3M30B 2DIUA 5HLFA 3JAMU 2V4QA 1U8SA 3RJMB 2HHHF 4L6V3 5J2NB 1BUXA 1TUVA 4DSKA 3C8YA 5KFSA 1YKWA 5DO2A 4Q44A 1TUWA 1HPZA 2FUG9 2HNDA 4LBHA 1NK6A 2A1BA 3H8YA 1U2CA 5I42B 4HVZA 1YBAA 1CJVB 2ZZNA 3QZ7A 3AB4B 3VZHA 4DX7A 3CCWA 2HFUA 4IRDA 3BDPA 1B64A 4OHWA 2HHSA 5ETPA 4E0DA 3JTOA 2GVZA 1HI0P 2EK6A 1PCAA 3K8WA 5LSRA 3Q24A 1X4GA 3T3FA 3CJRA 5GADU 1ZA2B 2C2KB 3AY0A 2ZDOA 1UFWA 3LW5C 3ONQA 3I0RA 5E2QA 3PYDA 2V4JB 4PG5A 5HROA 2HHVA 1RHUB 4WP8A 2MHEA 4DV7F 2KG1A 4ZPCA 1YGYA 4X4OA 3DLLQ 5M2RA 1RACB 1D8YA 4ZMMA 5SUHA 2VC0A 2M7SA 1Q5YA 2XMMA 1F9EB 2ACMA 3PIPQ 3VAMA 2BJ8A 3P96A 3BKFA 4ZLJA 4ED7A 3IM8A 1VBYA 1T11A 3M6WA 4PCQA 4I2PB 4PG6A 5GAHI 5KT7A 2EWHA 1RWWB 4K4VA 4TY8B 1YJTA 5D0GA 2DNOA 1Y3JA 3QAUA 1VJQA 2ZD1B 5C2CA 1BHNA 3I4PA 5B0FA 3TVZA 2YNIA 3H98A 1EZZB 5K8OA 5GAEU 1TL7A 2ATCB 1Q8LA 5G0RA 1V3ZA 1I6JA 4BLGA 2VONA 2YBVA 2DXEA 3AOAA 3S7RA 2CPFA 3MI7X 3TX0A 3DLEA 3BSNA 3PW4A 1ZYQA 1KSPA 1GXLA 1T3OA 3R7SB 1S1UA 2HFOA 4CH1A 3KUHA 2W7PA 4AQYF 4LF2A 4ECTA 1U1OA 4KHRA 1C0UB 2C2NA 3DXBA 4FYDA 4F3OA 1G2EA 4WIIA 3MM8B 5CCLA 1GAOA 2MKJA 4LF1A 3DRPA 4PG7A 5KFYA 4JV5F 3PRBA 1DTTA 3MURP 2VDHA 3M8PB 2I8EA 3G8QA 1S1WB 1KP6A 3R5DA 2E5LJ 4DL6A 1UFKA 2QYCA 5LMNJ 4KPCA 1M5VC 2UUTA 2LEAA 4ZLPA 2RMLA 4YS2A 2OPQA 1OYEA 2MEWA 1KKHA 3PKMA 2KXHA 4NEZA 1NAQA 3CIMA 3D68A 4OV1A 2MKYA 1HMVB 2BM1A 2QL9B 4I7FA 1HFEL 2D3O1 2KFZA 4IOBA 1H38A 3HHLB 4AT1B 2KFNA 5F8LA 1HNZJ 2F40A 4K4XA 3P49B 1ZH5A 1Q79A 2B4PA 3BR9A 4K8RA 4KQZA 5E5NA 2C2DA 3FGVA 1TU0B 2L08A 3W61A 4J9KA 3PZPA 4MKVA 3I4HX 4X4VA 3FRZA 5D6GA 2A10A 3R2CJ 1G3OA 4M5MA 3W9JA 4DMZA 1FRMA 2D9OA 2HVEA 3NP5A 3CTRA 1U6BA 1JXEA 1S9GA 2OEJA 3ENQA 2H3EB 5KFBA 1V5IB 2VFUA 1UVIA 1K44A 4O0IA 4PYAA 2R8JA 2XWYA 4F67A 3UWTA 4LF7F 4HHJA 2NSBA 3LQVA 1TKZB 1VLOA 3TEHB 5D4LA 3IBWA 3ZNUA 1HQUB 4DL0C 4DOZA 5F3ZA 5DQHA 2DR5A 4C8ZA 1LOUA 5DG9A 1VQNS 1EIYB 1UEUA 3KHRA 3PXGa 5L39A 3GONA 2FYXA 4DV5F 4JYAF 1Z4UA 4J90A 4L3KA 1NNDA 4NLVA 2LFVA 2NPIA 3KK2B 3BO3A 3K5PA 3SYZA 2MKHA 3MCNA 3GR0A 4TVAB 2GNKA 1W26A 3RB3A 1FFGB 1JLCB 1N5TA 4JV2A 1EAYC 4OX9F 5DGAA 2FLOA 4Z37A 5MAOA 2VG6B 1JKHA 3AA9A 2XEXA 3O6QA 4KAIA 3PX0A 4WFZA 2ZFHA 1DTQB 1HHQA 2WB1D 3H59A 2R7XA 1NDLA 2MPUA 1T9WA 1VQ4S 1JNRB 1SC4B 3G82B 4USWA 4B17A 3ILLA 4PYDA 1NK8A 1VLYA 2E7XA 2HNYB 3EUNA 1R6YA 2YQ0A 1FWPA 3D6HB 3M1VB 1K47A 1Q95G 1SQGA 3R5JB 4G1IA 5LL6d 1D1UA 2XULA 1HWLA 4CLZA 3BS9A 3SFUA 4Q0BA 1PILA 1AROP 4QYZK 4C9DA 3HF5A 1SCJB 2XSFA 4H4OA 1P1LA 4DU8A 2I0XA 1NHVA 3R5BA 2X1AA 4X4QA 2HHTA 2F8MA 3P4UB 1KQFB 2ZZTA 2W8LA 1NJYA 1N88A 1OWXA 2ZNYA 1U26A 3W60A 3TO8A 1SBRA 1TL4A 3BZQA 3LANA 3OUYB 4LIRA 1N5YB 2HPUA 3KMSA 1FWKA 2KFYA 2E7VA 3HVTA 3BQ0A 2X7IA 4XDCA 4L74A 4ELTA 4A8YA 1DTTB 1DY3A 2JRSA 3ILOA 1TP7A 4Z2XA 3H0PA 3M8PA 4B3TJ 5IWAF 2ZHAA 2GJIA 3DKDA 2XLIA 1Y5LB 3S01A 5F8IA 2OPSB 4UTGA 1KOOA 4ZVUB 2ZUGA 2RQCA 1UA1A 4B3MJ 1S0VA 2R7UA 3IM9A 1WC5A 4RW7A 4KT0C 1EKRA 3NGSA 2VA3A 1N36J 3JSRA 2Z58B 2RRAA 3HK2A 1TKTA 3CJ5A 5HVFA 1B0PA 3ET6B 4DR2J 3V6HA 2WB4A 2E1PA 2XMUA 4Q8EA 3FMBA 3HX9A 1ZA1B 1CJVA 2RDDA 4FDFA 2CDRB 4CO4A 3FKBA 3DGVA 3R5GA 1F6TA 5KT4A 3HHLA 2HG4A 3RRGA 5FJ4A 3V2UC 1WHVA 4BC9A 5KFOA 4KPYA 1RWXB 3TW0A 5B08A 4CWBA 1JJCB 5LJ3Y 2XO7A 6FDRA 3PYFA 2ZBRA 3QJJA 2B51A 1QAYA 1Y10A 2XLJA 1EETB 2V0NA 3PIOQ 2LYVA 2GC8A 3QATA 2XGPA 1FRIA 2ZC4A 2QLWA 1FXDA 3J7A1 2NREA 2DY1A 1EARA 2D69A 1OY9A 2V94A 4WFAQ 2DNLA 2OTJS 3LP0A 4YB6A 3MCOA 4QQBA 2FHJA 3K59A 1TZ0A 1T9UA 1U09A 2FJVA 1LV5A 1O51A 3DOMB 4YEAA 1RTHB 2WBMA 2Y0SD 2MQPA 3CB4A 4USKA 1V6HA 4DFMA 1TELA 1XQIA 1KQGB 2HNZA 4NLOA 3RUBL 3BB5A 5F8MA 1UVJA 1R0AB 4LR9A 5GMKa 2CZVC 1WD6A 2Q79A 2C3OA 3FQKA 3MD3A 4ZITA 3HMJG 2CPDA 1NEEA 3AT1B 3I96A 3OT9A 4HI1A 5G0RB 1H6KX 2CKWA 2AMCB 4RJVA 5K14A 4TY9A 5L9NA 3RBDA 3HHNB 1X0PA 4IG3B 2BJ9A 1FRXA 1YZ6A 4C0HA 5CCMA 4JI5F 1XMBA 3O44A 4PQAA 4QIVA 5DZ6A 1EX8A 3PRVA 1SL0A 2RU9A 4LVNP 4TLQA 1I94F 4OX7A 1VR6A 2CZ9A 2DHSA 2G0CA 2ZBPA 4RPFA 4ZVFA 4I6YA 5LJ5Y 4UUWA 5GMEA 1XMQF 2DO0A 4QYRA 4QBUA 3D2WA 3DLGB 2V8DA 3QO9B 4I68A 3P6YC 5KFTA 2I38A 4ZP6A 1SUQA 3AH6A 1I51B 3DLKA 1KOHA 4IDKB 2E5HA 1XBWA 4PAAA 5E3CA 3I56S 3PW5A 4MIAA 4AL6A 3J7YI 4J9SA 2GHPA 3WIUA 2DH8A 3OHAA 1ZM4A 2DRBA 4ZIWA 2HMIA 3ETOA 3Q8VA 3C14A 3OTEA 2GQQA 2BUNA 5AXKA 4K50A 3OTCA 1LW0B 4C8NA 4Y2IA 3G71S 3W7BA 5ETKA 2DR9A 4UOFA 2J7KA 4N8OA 5E3PA 1E6VB 1HBMA 2AP6A 1YRXA 1F1BB 2QT7A 1RHMB 2YPZA 3CC7S 4G1PA 1L5UA 4K4UA 1WWHA 2B6AA 1IQZA 2FZGB 2ERRA 4OI3A 4NCAA 2FPHX 2I5JA 2Y1LB 5DG7A 2E5GA 1MMLA 2VFVA 4WE1B 3KLEA 1KFSA 2GA7A 2BYCA 2RUGA 3KLFB 1VRUA 2E29A 4IQMA 3UD5A 3CSKA 3POTB 3QGIA 2VQEF 1S9GB 2KHCA 3MUVP 3QSYB 2FY1A 3TAMA 3IN5A 5HBMA 2E9TA 4YOEA 1VOMA 4KC5A 5KG0A 2M2BA 3KUGA 4PABA 5KFRA 3S8SA 1QTNB 2IYIA 3KWMA 3NBPA 4DPUA 2RQKA 5LXRA 2X3GA 3GIKA 4B3SJ 3CJQA 1X31C 3D1HA 4KV8B 4JI3J 1U48A 1B7FA 3LTOA 2ZOGA 3LF0A 1WDDA 3J7AN 3I9ZA 3PW2A 1UL3A 3DRSB 3T6BA 1NRKA 1RU2A 2YH0A 4MK9A 4J9QA 2QLFB 2W2PP 4ZVQB 2J0WA 3TUZC 3TARA 3OVBA 1VJWA 2QGFB 2YNGB 3SV4A 1YJVA 1CQMA 2R7OA 3DU5A 2FLNA 1IBMF 4RNHA 1VMBA 1X8DA 5T41A 1NM2A 1FJCA 2JFDA 1WOPA 1LFPA 2H51B 4LSLA 3A12A 4AUKA 5EUHA 3HZEA 9ATCB 2W9CB 4DR1F 2AYMA 1EQ0A 3MEEB 1GX6A 3BEGB 1DURA 3X3UA 3KLIA 4NLXA 3QGPA 5AE3A 4ID8A 1OSDA 5HVGA 4DUYJ 8RUCA 1YJUA 1U0HB 5D0HA 5F9LA 5KFMA 3HCXA 3GQCA 4ER8A 1LWFA 5ITHA 5ETVA 2F4VJ 4PXEA 4A8XA 3DC2A 3R97A 4YY3J 2R8GA 2FC9A 1TAQA 4FN5A 2UVUA 1NXIA 4DQRA 2JLGA 1Q78A 2VU5A 2DPIA 3K58A 4EBDA 2L48A 2M4MA 4WKYA 3HVRA 1CSJA 2MY7A 3C6UA 1BGXT 3IO1A 2C3UA 4PPZA 4TN2A 5LM7E 1QJHA 5KT2A 4CIOA 1UWAA 2CG4A 2LQBA 2Z2LA 3AAWB 2J7WA 4K5SA 2DGVA 4H4OB 5IZHA 2N82B 1RTJB 2QYGA 3VAKA 3LUYA 1UVNA 2B9XA 1N5SA 2OFHX 3OXGA 2XI3A 4R0JA 5BYRA 2UXCF 1M5PC 2BA9A 3W62A 4OYIA 2CQGA 1R8PA 2XNRA 4X4UA 3IRXB 3GU0A 3N4WA 4ZVHA 3E3XA 5KFXA 4J9PA 2BBEA 4YMEA 2CPIA 1T3NA 1FJEB 1JQGA 1REVA 1S59A 2I1RA 3Q8SB 2AHOB 4F50A 3C3LA 3OTBA 1O8BA 2UXDF 2LP4A 2EPIA 4Q5VA 1FJ7A 4LQ9A 3U1LA 5K8PA 5DDQC 1D3WA 2YQ3A 4NLGA 3KKFA 4PXDA 4MMOA 1ZZNA 4CO5A 4K2XA 3SCJE 2CJXB 2EKYA 2CJQA 3ELHA 1BQMB 4WFBQ 4ECUA 2NCKL 3Q8YA 4NLYA 2ADBA 2F65A 4Y2CA 1MROA 3FJ2A 3GV8B 3HPOA 3MM7B 1IBCB 1SJFA 3IGNA 1Q8IA 4ECZA 2UVVA 3VQSA 5A8WB 5KFPA 2DRAA 2HHXA 3A13A 2FVRA 5E3QA 5ETNA 3W3SA 2F3JA 3QFHA 1HARA 4IR1A 2X1BA 3M9NB 4FVMA 1NK7A 3OL7A 2EFGA 2XC9A 2M9KA 3KLGB 3KJVA 5T7LB 2QN6B 4IO9Q 1BY9A 1JNZB 3CW2C 4P52A 3OTDA 2EG1A 5LMUJ 4OIXA 3ZTRA 1KDNA 2RIJA 2GO9A 3QQCD 2J0SD 1AUDA 1Q7LB 2VPZB 1Q82T 1TVRA 2RH3A 1NBEB 4GVLA 1FD2A 2VC1A 1S1TA 3TP2A 3SZ2A 2AWZA 2WVDA 4USVA 5L9XA 3QWPA 1P9YA 4JI0F 2HW3A 5DQGA 1QUVA 5BR8J 1FVQA 3N01A 2XS2A 4YHHF 3OTOJ 2HFVA 1BLUA 3M32B 2KB2A 4U6PA 2DHXA 1WEYA 3TOQA 2BRLA 2G13A 5E7OB 1N34J 3HHLC 3KLHA 4A4JA 2P5VA 2MZQA 4OQJA 1VIOA 1FCAA 5ETLA 2XMVA 3H5SA 1S4FA 5KG5A 4Y28C 2DYAA 1KONA 3EVWA 1RBLA 1CS4A 3BO4A 8AT1B 4UY8T 3W9IA 3TA0A 1HIYA 4XO0A 4ECXA 5B7WA 3EGNA 4GVBA 1FD8A 2IAJB 2OH2A 2DJWA 3M8QA 2VBXA 4CLKA 3J80U 1N34F 2JOQA 4XIUA 2DO4A 3R6GB 1NKEA 2EC2A 1OY8A 4H4KA 3ITHB 2KM8C 5CYJA 3DHXA 3NCPA 4EYIB 2V5HG 4NXMJ 1ZPVA 2CNKB 2B8PA 3I0SA 3RB6A 3B4DA 1FKOA 1LK5A 1AZSB 3AD9C 2CJYB 1UCNA 2PC6A 3HT0A 3M2VB 4H4MA 2JEFA 4IR9A 1YLXA 2HVZA 2VFRA 3GYXB 4X4SA 3H2LA 4RW4A 3EDRB 3I5CA 4DV3J 3V6DA 1EP4A 3L4BC 5F8NA 4Y00A 5KFVA 3QT5A 4AD6A 5HLFB 1RUSA 3BM7A 3GJQB 4V19J 4GKKF 1E6VA 2PFFB 3EE3A 4HH0A 3RW6A 1YJ9S 2QX0A 3A8IA 2HHPA 1FTCA 2A3JA 1H0HB 4M5LA 4OLPA 2VICA 1J5OA 2HVHA 1WORA 4NX9A 4IH7A 3DI6B 4DFPA 1PC4A 3R5CA 1FDAA 2FJDB 2YNHB 4YDXA 1D9FA 4RNMA 2IMWP 2OPRA 1EB0A 4DPOA 1RT1B 1N0VC 2ZKUA 2EVZA 1M0SA 3PO4A 3K5MA 2CADA 2HYIB 1SJ3P 2I5JB 4TLRA 1KC8T 2CPZA 4QCLA 4I6WA 3CDEA 1HNIA 3AFGA 4DX5A 2ZZMA 1S0NA 4QU6A 1NSAA 5BR8F 4KGXB 1G1XA 2EEYA 1YIJS 4C48A 3KK3A 4MKBA 1HR0F 3VAIA 5HROB 3ISZA 4OYXA 5F0WA 4AYBD 5KT3A 2YKNA 3MMCB 4QWEA 1YBUA 4KO0B 2LEBA 4DF4A 1TVRB 1WG5A 1AFIA 2FGOA 2QMXA 1NMEB 3C15A 1JLGB 1UMJA 4I6AA 1GNKA 2GW8A 2XWXA 1MWQA 4U7UD 5AE2A 1UETA 2CQDA 2ZH7A 2YQ1A 1RTIA 3TYTA 2F8EX 1UKUA 3FSIA 3CIZA 5K14B 3RR8A 1NSPA 1HD0A 4BDPA 1MU2A 5K8NA 1R0CB 1TKZA 4HT7A 3OL6A 3TRGA 4KB7A 3RBEA 1MSWD 2PSZA 3C66A 4LR8A 1TKTB 2NPFA 5CD4H 1NDPA 5BJRA 2HAFA 1RWPB 3ET6A 3OD2A 4JB8B 4ED2A 1N5QA 1KLMB 1SKRA 3W1YC 4JI7J 2RKIB 1CJUA 5AJ3F 3EPIA 4C8YA 1TR0A 1H2VZ 1IR1A 2LEPA 5BYQA 3I9V9 4P73A 1ULRA 2YXLA 5D4PA 5T7LA 3KK1A 3JSMA 2RF2B 4NXMF 3QFWA 3G6YA 2VD3A 1XR7A 4RL1A 4F4ZA 4JI4J 3OL9A 4RW6B 5AXMA 2W4CA 4FBUA 2WK4A 2DXFA 1RLDA 2NSCA 4CYUB 2EBEA 4NRTA 3R8YA 4DG1A 2NZ4A 2CNOB 1R7IA 3ENVA 4DV3F 2G2YA 3MCSA 2DPJA 1TL1B 4MYTA 3RAXA 4R0EA 1XNQJ 3DRPB 2OPPA 2CQCA 3UCUP 1IKXB 4DR5J 3W66A 3MR7A 1WC6A 4F4XA 1O5JA 1S6UA 4FYXB 4B3SF 1IR0A 1S57A 1HWUA 1GFWB 2ROGA 6FD1A 1T9TA 2L9DA 1KLNA 2HK3A 2AX1A 2B56A 2MKCA 2GZOA 4HHHA 3SSRA 2CVEA 2ZHBA 4NLSA 3ADAC 5GMDA 1RE1B 1OJ4A 4IFYB 4F2SA 3Q89A 3RB4A 1FI4A 4DN9A 5HATA 1HWKA 1YRTA 5KT5A 3M6XA 4ED4A 4HL9A 2IBOA 3L9ZA 2IM3A 2WAQD 3T1HJ 4B3OB 3L7PA 2KKHA 4PG4A 1OS5A 1TFYA 2FC8A 1KFDA 2CQ1A 4ILRA 2H54B 2CQIA 2L41A 3I0SB 3TZWA 1KQSR 1FJGF 3NGRA 2J5AA 1AW0A 4FF1A 1HBNB 2R8HA 4M5DA 2DBBA 3CF5Q 1A9NB 4WZQA 1UEVA 1FKPB 4I2QB 4P9SA 5JVGQ 3BR8A 4GO7X 2FZKB 4OI0A 2V2VA 1IKVB 4O3NA 1VRTB 5EGYA 3UN3A 3T6JA 4IUFA 2KT3A 2BM0A 1IJEB 3CWJA 1WI8A 4USTA 3JYTA 2ILYA 1F3VA 2P9CA 2MGZA 2ZVSA 4RWWA 2AJ1A 4YFUA 4KJIA 3G8SA 2FY8A 2PMHA 4QIEA 4NXNF 3TZXA 1PGZA 2YNGA 3GTYX 1BMQB 4OHZA 3IWNC 1SC3B 3S6EA 3IFEA 3VV2B 3PR5B 4DL2A 1JLAA 1MWZA 1T9VA 4FVCA 4GC7A 4L72B 3QIPB 1WNEA 5KG2A 3QJLA 1QDUB 4ATNA 1N32J 3H2UB 4MK8A 3D3BJ 2UV8A 4NA1A 3Q8QB 4NCGA 3UW1A 2E7WA 4DBQA 2VHGA 2X1GA 2CPYA 1RI7A 5EDWA 2ZM6J 3M8WA 2L3MA 1RTDA 2VB6A 5HMZA 2CPJA 1ROFA 3J81U 2XM3A 3P45B 3MXHP 2KL8A 3H42A 1VRUB 3OFGA 2XY7A 3NOCA 1KTVA 4FKXA 2NQPA 1R31A 1U7LA 1D09B 4UUXA 3UVJB 1EJ7L 2HGMA 3P8BB 5IM0A 4J9OA 1WTBA 2M8HA 3QRQA 4XPEA 2D3ZA 2DGUA 2K06A 2HNYA 2VQEJ 1SQFA 1GXTA 1ZM3A 2IRYA 2N4CA 3I31A 4DF8A 2ASJA 2PFDA 1Q86T 1BQNA 1RT5B 1C4AA 1WC0A 3W2VB 4HKQA 4LRCA 4GKJF 5KFJA 4LF9F 2E44A 4FXVA 4ZHRA 2EKNA 2EG2A 2UXCJ 1OQ6A 3MR2A 2VG5A 1ITPA 3K2YA 4JI2F 1REVB 1ICEB 5JVHQ 1RT4A 1F2HA 1HQ2A 2V8PA 3H4BA 2QEXS 2UUCF 3D9BA 5KT6A 2KZMA 4DV4F 4QZVB 3FBBA 1SL1A 4B08A 1VIXA 4LSNA 2VV5A 3R6LB 3CDBA 2HQGA 2RJZA 3TVYA 2XGQA 1SPBP 3L7UA 4OMFG 2V2ZA 2F8HA 3BJYA 1ZZFA 4DL5A 1S1UB 2LQJA 4Q8FA 1B0TA 5KFWA 1IM4A 1N54B 1I5OB 2MXYA 3DLGA 2HZCA 3HFZB 2E1CA 2C42A 4FYWB 4C3LA 4NMXA 2AQ4A 1RTZA 2XTJP 4M8LA 4C0OC 2DNMA 4NXNJ 5DETA 1FVSA 2XY6A 2QV6A 1GMWA 4WTOB 1HNXJ 1XK8A 2F1FA 4OZ1A 2K3KA 2E5IA 4DSJA 1UZDA 5THWA 4NASA 2FLLA 1YJNS 4S0MA 1S79A 2V6AA 4R25A 3D1QA 4IOCQ 2ZVIA 1T05B 4MIWA 3R9LA 4CQ1A 5J1PA 3VQTA 1XR5A 4JI6J 3MOJB 1HBMB 1P27B 2WSEC 4UOCA 5DQIA 3TZZA 5CQGA 3AQPA 3QT7A 4Q7AA 1W25A 2RNEA 3QSIA 5DG8A 2W9AA 1NSQA 4JI0J 2QTWA 2LU2A 4LF6F 5B0AA 4F36A 1B99A 2H1YA 2YWHA 1CJKA 2GVDA 2YKPA 4QOTA 1VQPS 4PR6A 1Y0HA 1X7VA 2K7KA 4WU2A 3G6ES 1UA0A 1X9WA 3TWZA 2HQCA 3M32A 4K4YA 1UPMB 1KBRA 1RAJA 2CJBA 1X5TA 3LPYA 1NDKA 1QE1B 2QL7B 3P5TL 3UDEA 2GCFA 3LP2A 4NLDA 2NZCA 2RQ4A 3CC2S 3Q8UA 2DXDA 2MGZB 3IR5B 2BDPA 4ILLA 4F04B 4DR3F 1OO0B 4K0KF 1CJTA 3U7JA 1U49A 2CQBA 2PE8A 3CJ8A 3M2RA 3ZZOA 1Q8BA 3P5BP 1P1TA 1VISA 2JLEA 3MPWA 4TQRA 2VJUA 3EZ5A 2V69A 4FS1A 1OPIA 3CD7A 3MM5B 4MJKA 2RKIA 5J2MB 4BS2A 2AYEA 4USJC 1S9FA 1S48A 1L3SA 2WOMB 3OSPA 2M8DB 3VGSA 5AT1B 2F9JA 5KG3A 1I1GA 1G7CB 3W5ZA 2HQFA 2C3PA 3ZZTA 4N47A 4AQYJ 2W4PA 1NKBA 2NXCA 4ZCMA 3U1NA 5D3GB 3T1AA 2BR0A 2CPXA 3FNNA 3NOGA 4DHVA 4RNOA 1JIHA 1UJ5A 2BKPA 4RW9A 4JV5J 3BGFA 1TK8A 3U1MA 2V4JA 3CDWA 3GIRA 2UVRA 2W9CA 2ASLA 1R0BG 2DNHA 1J27A 3NXZA 3NGDA 4DUZJ 1VQLS 2PI5A 1IKXA 2MQQA 2JJ4D 2KT5A 1FRJA 3KUEA 4J9VA 2VQFJ 2POKA 4DJBA 3CCJS 3VAHA 1UVMA 3R3TA 2B5JB 1JJ4A 5LOQA 5A8RB 5ETTA 3QT6A 3TJAA 3MTJA 3UO0A 5IQQA 3TAPA 3W2WB 2X1FA 2IJRA 4X4NA 2D3OR 1XERA 4FF3A 1HWIA 2BJEA 5B0DA 5KFNA 2WSCC 4GRSA 1FNXH 1K9MT 3CNQP 2ZH4A 3BYPA 4PWDB 3M8SA 2VODA 4U8YA 1SJ1A 1W2BR 3HJVA 1F0XA 2PMZD 4NMLA 4CLWA 2LXFA 4W90B 2R3VA 4MKAA 4ZP7A 3IG1A 4C3KA 3ZO7A 3IR6B 1SH0A 4UOHA 4C8LA 2IY5B 2ACYA 2YWWA 3THVA 2CG8A 4X4RA 4DR4J 2OSRA 4WP3A 3GV5B 4DR6J 1Y5NB 1YBTA 2DR7A 4EGLA 4ZS6A 2JWNA 1UEKA 1NK0A 2XBPA 1QAIA 4O3SA 1IXKA 3CMAS 3ZTSA 3J7YU 5HMWA 3CO9A 4NZ6A 1IWAA 3HD1A 2MSSA 2WTFA 1VQOS 2HZVA 3CJTA 4M5IA 2HBZB 2MHNA 4ECWA 2CJKA 1NUEA 2HVIA 4WU3A 4F02A 4ZPDA 1UFLA 1DQ8A 2HAIA 5KOXA 3N5BA 1FKAF 3CVKA 4FXDA 3RBZA 1MROB 2CUYA 2BE2B 3VHQA 2GV1A 2ZH9A 3FFIB 4YN3B 3OW2R 2VZ9A 3I5AA 4M94A 5KFZA 1ZBTA 2DCLA 1S7IA 2LU1A 2PGCA 3LAKA 4QWDA 1N36F 3ENWA 3GSIA 3TJ8A 4DQPA 2Q66A 4ZOSA 4ECYA 4AXJA 3DRXA
chains in the Genus database with same CATH topology
4QWAA 1S6PB 2V8VA 4QU7A 2K3IA 1FK9A 3PJWA 2MZ1A 3E2EA 2IRUA 3FCHA 5B0EA 3ZZPA 5D3GA 3CD6S 2MJUA 1ZM2A 4TU9A 3MWBA 1Y9OA 5L8RC 1DRZA 1S1TB 3HKZD 2UUBF 1CQNA 3RW7A 3MM9A 2APOA 5KOWA 2AU0A 1H7XA 2GO8A 1JKHB 4ZP8A 3FSYA 1DARA 2V9KA 4R5PA 3BQ1A 5DRKA 5LSOA 1SJFA 1VQSA 3GFYA 2WSFC 5KFKA 1N6QA 2ZJPQ 1NK5A 2G9OA 1Q7YT 1CPZA 2RE1A 3SCKE 1CVJA 4PPDA 1RTJA 3H25A 3CCMS 4K59A 5HL7Q 3N79A 1S10A 3QIDA 4XDDA 2QA2A 5KAKA 2E1AA 1RT4B 2LDYA 3O5TB 1JLQA 1DFDA 2V8HA 1FRLA 5A0YB 2MYFA 1S97A 3CCVS 5C25B 4LIWA 4DR7F 5IT4A 3OFFA 2ZOFA 3UPFA 3VALA 5F41A 3FSXA 4YDDB 3UDLA 2JC1A 1H98A 1C4CA 4RNFA 3OQ2A 3DXSX 3OVAA 1NKCA 1HQEB 1RISA 4QJVA 4BWMA 1WI6A 4DR2F 1HPZB 2HNDB 5F9NA 1EP4B 1UAWA 4QPXA 4I67A 1AFJA 2B3TB 5F8HA 3M2UB 3NAHA 4DR5F 3FVYA 4OJGA 3K5NA 1U25A 2NXUA 4Q45A 4AL7A 1IKWB 1LQ9A 3CMES 2JEGA 5CYQA 4JI8F 1SH2A 2ZOMA 3GE9A 4IFVA 4A8OA 2NUUG 3RU0A 1LKZA 4DV2F 1RYRA 1N5YA 2BVZA 2CQ3A 4MH8A 1N52B 2GIQA 3PV8A 4I1TA 2RQMA 4KFBB 1QE1A 4O3OA 2B6AB 4ZCKA 4OHYA 2IRXA 4Q2MA 3HHDA 2M52A 3GR1A 2F7VA 3CE8A 1ELOA 2R8KA 2BANB 2X51A 2ROPA 2VPXB 4WJBA 3LP0B 1S72S 2YWKA 3KOAA 2LECA 2EC0A 1UP1A 4XK8C 5B0CA 1GTEA 4NL5A 4WF9Q 3CCQS 1LWEB 2K2PA 2CRLA 2FJBB 2CJ9A 3UD3P 2FHKA 3RAQA 2BQRA 2YNFB 3PR4A 1HD1A 2FHOB 2O67A 5FLXY 4LF5F 4RW8B 1A6LA 2KZZA 1FESA 3VF0B 3I55S 1DZ5A 4R8UA 3UFCX 3PACA 1NHUA 2FHJD 4MFBB 4QWCA 2LLZA 3MMAB 3J81Y 3MEKA 3IS9B 2C3YA 3MMJA 4OJ3A 4PWUA 1VS3A 2HS3A 2J7UA 2J6SA 4YB7A 1S1WA 2IJFA 3CCZA 3HJFA 4B9LA 5A8RA 2PEHA 4RW4B 2FB0A 4YUDA 5GVQA 1UWBB 4DV0F 2OJ3A 3FQLA 4IYQA 2EBGA 2UUWA 5A2QY 1R0AA 3E01A 1VBXA 1C2PA 2RRBA 1GQEA 1M5OC 3MEDA 1X9MA 4LT6A 5IS2A 3V81B 3NLCA 1KTQA 2JLFA 2OPRB 5DJBA 2M0GB 4H4KC 3JTNA 4USIA 3HT3A 1MW7A 4C11B 2J76E 3JSYA 2PO4A 1YTYA 4QR2A 4EZ6A 4B3OA 4IO1A 4MAKA 2FVCA 3NS5A 4EU0A 3QWUA 1IKWA 2D1CA 2CQ2A 2A18A 3OFHA 4Y2AA 3UDCA 4LFBF 4KHPF 5LXYA 2IA0A 7FDRA 3K5OA 3QLHB 1NZAA 1X4CA 2R7VA 4DFKA 1FO1A 3MEGB 1FHTA 5HI7A 2Q1LA 4AE5A 4FS2A 3BGRB 4KFBA 2WCXA 1KRPA 1HQEA 4EEYA 1KNZA 4KO0A 2PI4A 1D9AA 1X5PA 2BE2A 2BV3A 3F56A 2W25A 1RTIB 4FXWA 5B09A 1TKXB 2GGPA 5HBMB 2AF6A 2YVSA 3SMZA 2EFNA 2WRMA 3OBIA 4LF8F 3TNVA 2CYYA 2JL9A 5SZTA 4FF2A 2E9RX 4D3HA 1SIZA 5EHHA 3EXYA 5IT0A 2R4FA 1FERA 3GFXA 2MMYA 3HKWA 3PEJA 4RW6A 3RR7A 1K73T 4DQIA 1NO8A 5GAHU 4FPRA 4O4GA 1VC5A 2HFNA 4ICLA 3GIJA 3TAMB 4OFZA 2DGQA 3FZBA 4IRKA 3BSAA 4X2BA 1FTRA 3IXQA 3QYYA 1TV6B 3DM2A 4Y0FA 3KNGA 2LKZA 3FEYB 1MNEA 2D74B 3BDEA 1N33F 1IJFB 1UWBA 2AX0A 5I3PA 2OP5A 2EFPA 4O3RA 2DCUB 4TY8A 1YVFA 3M2RB 3M6UA 2GHVC 3T5HA 4NYZA 4P2SA 3VAJA 1MMDA 2WOMA 2W7OA 4JI7F 4JV0A 2Z4PA 3HDSA 3DLEB 3GZ7A 3A8EA 5CYMB 2H5EA 2R7RA 2AGOA 2VPYB 3R5AA 2YWEA 4TXSA 2R9LA 2IM1A 4NLQA 2OPSA 2W9BA 4LJMA 4RZRA 1VQ8S 1SQEA 1TL3A 2QLXA 1FKPA 4I2QA 3OV7A 5CH7B 2DITA 4QR1A 2RRNA 3IWLA 4M63A 2YWGA 4L3NA 2K8GA 4NLUA 3CT9A 4DV6F 2RDJA 1VC6A 2FGCA 5GAEI 2AJFE 2ALZA 2IM2A 4QW8A 1U6ZA 5CYQB 4RUHA 4KKOB 1RWUA 3UCGA 4NZ0A 2VKRA 4J9MA 3NRBA 4B9MA 1YWXA 2WHOA 4I56A 1VGYA 3BN4A 4ZP9A 3EZUA 3B82A 3NCQA 5HMYA 1KHWA 4CT8A 1FEEA 3IWXA 4ED0A 1GX5A 3POTA 5KG4A 2IC3B 2MQMA 3KJVB 1T03A 5CHCB 1RTHA 1S9EA 1S1XB 2R8IA 1CEZA 3PNIA 3M6VA 1SKSA 3GMGA 4MYUA 3E51A 4F3MA 4KBIA 4RU9A 2MKIA 2YKQA 3RRKA 3SSSA 2UP1A 1IBKF 3ZZZA 4PQUB 3OJUA 4JOUA 4AXIA 1YJWS 4FBUA 3PHEA 4BWJA 2RT3A 3J7ZT 4C4WA 1HYSB 4J5OA 3V6KA 3BSCA 3F41A 2QE5A 3MR5A 3C46A 4PG8A 3N6LA 3OFEA 2KYZA 4TKTA 2HHUA 5C25A 3G86A 5FDLB 3KLGA 1FEHA 1QVGR 3MMAA 1LFWA 1WTFA 2UZAA 2GX8A 3I82A 4YQWA 1S7HA 4TU8A 2C3MA 1C0UA 4M95A 2VL1A 3OLAA 1TK5A 2QMWA 5DLGA 2VBYA 1NJXA 3KG4A 2UXBF 1WG4A 2VOOA 1R43A 2VG6A 2RS2A 2XSJA 3GG1A 5U47A 4UW2A 1XTZA 2I9SA 4BBYA 3MR6A 4ECVA 2RILA 3K0JA 2CPEA 3MHYA 4HEA9 1WHXA 3MF5A 5KTQA 2ZNZA 1HHTP 3C6UB 3GYNA 2WONB 3MFHA 4DUYF 4OZ0A 4DLEA 2EW9A 4DL3A 1KVJA 1CC7A 5KFAA 3T5JA 4YY3F 1WEZA 4CI0B 5KFQA 1FNMA 4IFVB 3MMBA 1VBZA 1RDRA 3M8QB 4CNYA 3R1HA 5L1KA 1X5SA 4KR0B 1Q81T 4MK7A 4C8OA 3HVAA 1J5OB 4RBTA 2KHDA 4A8FA 1QAXA 1PO6A 4CH0S 2ZH1A 1U2RA 3B4MA 2XG8A 3HZGA 2GMJA 4TU7A 4NA2A 2JDJA 2Z0GA 2FJAB 3K8VA 3LALA 2CZ4A 2DH7A 1H3DA 3NCRA 2JZ5A 1ZAVA 5EWGA 3NMRA 2HHWA 1T03B 3I6PA 1T94A 1JWWA 4P7VA 3PFOA 2ASYA 1LWEA 2FVSA 4RNNA 3CGIA 2YNFA 2OIHA 1T02A 1OSCA 2AJ0A 3LAMA 3U27A 3NNHA 3UR0A 3DCAA 4Y2KA 5CA5A 1T95A 5J2MA 3M2UA 2XZWA 4KIAA 4MFBA 3CJKA 2K1RB 2LA6A 4WK3A 3D54A 3LWLA 1P9QC 1C1CB 1DQ9A 1S99A 1HNIB 2CJAA 4LF4F 2DGTA 4X84A 4OX8A 1QSSA 4WZMA 2DNNA 3BO2A 3CCLS 4MKYA 3TANA 3WC0A 3PEHA 2M3DA 3AQOA 3DOMA 1HNVB 1AXQA 4ZVEA 4N56A 1VQ5S 1DQAA 3CCSS 2YX7A 3W2WA 1Y3KA 2GQ2A 3GB0A 3HO1A 4WXOA 1Y00A 2IVYA 3M1VA 4R5PB 2H9ZA 4Q0BB 2V4RA 1Z2ZA 3CC4S 1YHQS 3BF4A 2VPWB 2KVIA 2XI2A 2HLTA 4GO5X 4WK1A 2ZH8A 4O4RA 2D7SA 2W24A 4CO3A 3DMJA 1P6TA 3LH2S 3GIMA 2CQ0A 2BJDA 2P6TA 4ITSA 3EGZA 2HQIA 4K5RA 5E3RA 5HMXA 1S6QA 5FD1A 3QGHA 4NLTA 4KGKA 5I4MA 2KO1A 2MZSA 2N3OA 3OHBA 2HRUA 1TL3B 2FHMA 2NUHA 3PKYA 2LXUA 4ED1A 2PA3A 3WBZA 5D8HB 1JJHA 1VQKS 2E1MC 5A6WA 1P8GA 4QW9A 1ZETA 2D41A 2DHGA 2DNGA 5BYSA 1SH3A 2FVQA 2YX1A 5I3UA 3GFHA 3FFIA 3DLHA 5IQ6A 2FVPA 4NRUA 2BW2A 4EBEA 4NZ7A 4ZVGA 4U9RA 1KS2A 2PIIA 4B9TA 3PVXA 2N3LA 4KGMA 4QYZJ 2OKQA 3US5A 4DSEA 4YP3A 2JX2A 2DHAA 1YRUA 2E1RA 1U2FA 2MKSA 3OR1B 4A47A 2ZM6F 2VG7A 2J0XA 1S9EB 3JTPA 3D5MA 5GADI 3KLFA 5C5JA 3Q23A 1WACA 3VTIA 2C2EA 4DV1F 3MM6B 1KN6A 4DR4F 2WBRA 4NCGB 3LGNA 1QVFR 1TV6A 4Y65A 4ELVA 3VAFA 4C0BA 2OTLS 1IQTA 3I0RB 2V8GA 2E66A 4ZPBA 3T9ZA 5KFUA 4CTAA 1SJ4P 1N6QB 2UUAF 4PQUA 5KFCA 4K4ZA 3IGVA 2IYGA 3LP2B 2M70A 2YKMB 4NLRA 4OI2A 2I2YA 4WCEQ 2FTRA 4TQSA 1S0MA 2J9DA 4Y6IA 2GQCA 4QPTA 4YB5A 2ZJRQ 4OI4A 1V9OA 5KG6A 3JSMB 1WHYA 2VUGA 3PW7A 2OMLA 5FDLA 5J2QA 1WHWA 2MDAA 3GWCA 3BGUA 5L1LA 1QAJA 1RA6A 2DGWA 4FNHA 2XMWA 5JUMA 3B78A 4YR0A 1K0VA 3HLUA 3G96A 2AJQA 3PX6A 2DIVA 2BACA 5J1EA 7FD1A 3JSBA 2UV8G 5D77A 3WX4A 1SUQB 2B9WA 4ES1A 3DDNA 4RW9B 4TYBA 3IC1A 3QO9A 2ZKTA 1WELA 1QSYA 1SV5A 4B9VA 5GAGU 3D28A 4WFYA 4N5SA 1TL5A 1IBLF 4IFYA 2IM0A 4DUZF 4KKOA 2OO4A 3CJ0A 3DM2B 2DGSA 4FNIA 4X65F 5J2NA 1S1VB 1HNZF 2QSFA 4F2RA 2HWTA 4EO6A 5KFGA 3AJ2A 1SJRA 2VG5B 1L3TA 3ZZ0A 2P9GA 4ED3A 1QUPA 2GFFA 3V81A 3FDSA 5KFIA 3KTQA 1TK0A 5DDRC 4X4TA 2DVIA 4DL4A 2FJEB 3ZZYA 4TNOA 1E6YB 3NL0A 3IG1B 3H5UA 1S6OA 2YKNB 3MMCA 4B9NA 3LGMA 4XAKA 3SCLE 5DGBA 4F4YA 1M90T 1PSDA 3MEGA 2LQ5A 3CD0A 1RK8A 3TAQA 1JLBB 5E0OA 2PDAA 5DM6Q 2ZH5A 2AJ4A 3CULA 2R2SA 2J6UA 4AFFA 2O01C 5IFMA 1KQKA 1KLMA 5A8WA 1QTMA 3SSQA 3OXFA 2ZC3A 4RW8A 5IXUA 4IRCA 3CDAA 5K8MA 2FJWA 3FEXB 2UU9F 4WKRA 3CDUA 2DISA 1SKWA 4CO0A 2VG7B 1HBOA 2KU7A 4ID5A 1BQXA 5AXLA 5DDOC 1N5VA 2XY5A 3CJ4A 3HFKA 1XNRF 2MQNA 1Q4RA 3MEEA 2FDNA 4C97A 1TKDA 4DFJA 1ZTWA 2IHR1 1RJJA 3BSOA 1HNVA 3AHPA 2IC3A 1CG2A 1C0TB 4IOAQ 1K0TA 2ASDA 2W7AA 4HTJA 2LVWA 1KHVA 2FIUA 4DSFA 1K1QA 3HP6A 4I4BA 4RUAA 1ZM9A 2V2KA 4F4KA 2YKMA 2XHWA 2NS1B 3NGKA 2OLWA 3MM9B 3W2VA 2B7CB 3R27A 4CH7A 4RKUC 1FRKA 3MEDB 5CZXA 2KG0A 2GIRA 2QZ8A 4D3GA 4WYLA 1OQ3A 1FXLA 4QWBA 1CC8A 1X0FA 2D3UA 4OZLA 3MAHA 5F3TA 1IN0A 1YQHA 4ZPAA 1FDDA 3EX7B 2CQ4A 3OJSA 2F9DA 3T9NA 1N48A 3R1LA 3DGPA 3I5BA 1OIAA 3SCIE 1FXRA 2J6TA 2LA4A 1RKJA