2FTRA

Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'ENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0200
publication title Crystal structure of (10172812) from BACILLUS HALODURANS at 1.40 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Unknown function
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07110 EthD EthD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ftrA00
2GGPB 2KT2A 3BN7A 2KT3A 4HH0A 2K2PA 3E8OA 3BF4A 2QYCA 2ZDPA 3LGNA 4A48A 1JK9B 1AW0A 2HFOA 1TL4A 2N7YA 4YEAA 1S6OA 2LXFA 5T7LA 3TRGA 1KVIA 1TUVA 1KVJA 1TL5A 5B0AA 4YDXA 1ULRA 4Y2IA 5B09A 5IXUA 2LQ9A 2BBEA 3BR8A 4NL5A 2N4DA 3GZ7A 1FVQA 3HHLA 2K7JA 3TNVA 3KG1A 1VQYA 1V3ZA 2OFHX 5B0DA 2AJ0A 3LO3A 3IWXA 1FE4A 1QUPA 2HLUA 5B0FA 3QGPA 2GCFA 1KQKA 3CJKA 5B0CA 2ROPA 2OAUA 2XMWA 3IWLA 1N5VA 3BB5A 3HHLC 2GGPA 1MWYA 2GFFA 1N5SA 2AP6A 2N4CA 3FMBA 5A6PA 4FNHA 3HFKA 2K1RB 3KKFA 2W4DA 2FIUA 2QLWA 2XMKA 3HHLD 1W2IA 4ZOSA 2K7KA 2XMTA 2BUNA 1YRXA 2ACYA 4A47A 1Y9OA 1SB6A 3HDSA 3BGUA 2ASYA 4HI1A 1X7VA 1CPZA 1RJJA 2RMLA 3FRYA 1FD8A 2Q3PA 2RSQA 1OQ3A 1FESA 3KNGA 2IYIA 5F0UA 1SI9A 1CC7A 3HF5A 1TZ0A 3BDEA 3DXSX 2QIFA 4FNIA 1K0VA 1P6TA 5F0WA 3BM7A 3LGMA 2FTRA 1CC8A 1MWZA 2EW9A 4OJHA 1IUJA 2K1RA 1FVSA 1YJTA 4F67A 4HI2A 1AFJA 1Y3JA 1YJVA 4U9RA 2IFXA 1URRA 3KG0A 4ZA1A 3UDCA 1FE0A 1APSA 1X0PA 2FHMA 2LQBA 1XBWA 4DL0C 4A46A 2KYZA 3TOQA 4OJ1A 1Q4RA 1Q8LA 2L3MA 3K7RA 3WDOA 4Q2MA 1OPZA 2W4CA 2PGCA 3HHLB 2GV1A 3MZIA 2GA7A 2VH7A 1LQ9A 3F44A 2GO8A 4OIXA 4Q2LA 4EFAC 3QMQA 2RILA 5B0BA 2HQIA 1FEEA 2ROGA 1AFIA 3MCSA 1YJUA 1TR0A 1OQ6A 1SQEA 5A6WA 2VV5A 1Q8BA 2XMJA 5K9FA 4OJ3A 2OKQA 2HLTA 2BJDA 3HX9A 1GXTA 2BYCA 2OD6A 2FB0A 4A4JA 4OJGA 2OP5A 2RU9A 2XMMA 3DCAA 2QLXA 2HFNA 1WD6A 2HIQA 4HH1A 1P8GA 1YJRA 2G9OA 1X8DA 2CRLA 1OSDA 2AW0A 2OD4A 3I9ZA 1N5TA 5T7LB 2XMUA 1Y0HA 3VTIA 4DPOA 1VQSA 1JWWA 2IYGA 1YG0A 2AJ1A 2KKHA 2ZDOA 4DN9A 2BJEA 1GXUA 5KAKA 2LDIA 2XMVA 5B08A 3T9NA 1U7LA 1Q53A 2W4PA 2OFGX 4NPOA 1Y3KA 4QOTA 4Y2KA 4Y2MA 1S6UA 2OMOA 2PD1A 5B0EA 1R6YA 1N5QA 2JDJA 2ROEA 5B0GA 3FGVA 4HL9A 3CJKB
chains in the Genus database with same CATH superfamily
3UCUP 1FDAA 5L1KA 1VHIA 3WC2A 1P9QC 4B9LA 4ZVTB 3RZAA 1HBMB 2LQ5A 5HLFA 1FRLA 2F3JA 2N4DA 3D3CJ 1RT7A 3V81A 1TL3B 1U49A 3CJTA 3FCWA 2HGLA 2JHEA 3G87A 2DYAA 1EHWA 3H5XA 4YB1P 1UJ4A 2NXUA 2VG6A 4IO1A 7FD1A 2MQ8A 4B9SA 3K5MA 3TUPA 2R7XA 3H20A 2LFVA 1RCXB 1XK8A 3OL6A 3BKTA 4IFVA 2VB6A 1VQ8S 4MAKA 4HHHA 2APOA 2PGCA 3KTQA 4DUTA 3PCOB 4DX8H 1OQ6A 2CNNB 4FVMA 4CLKA 4O4RA 4TYBA 1CQNA 3M6WA 3VR1A 3OQ2A 1YJRA 4WWSA 4ECYA 2IBOA 1MMLA 2DR7A 1C2PA 3MAHA 1S6QA 2KJVA 3E2EA 3BV8A 3GR0A 2EK6A 3NS5A 1LWEB 1OYEA 4K50A 2IIHA 4TKTA 4PRFA 1SC6A 1U1OA 3NRBA 4LR7A 4CIOA 3JAMY 1NK8A 3CJ2A 3T1AA 1S48A 2JEIA 3CIZA 2YNGB 2AGOA 2BJ7A 3HXMA 3Q8RB 2NQPA 2FJEB 2JOQA 3NOGA 1SH2A 4X66J 2FVQA 1FTRA 2DRDA 1HLWA 3A13A 3CIMA 2MTLA 2H3EB 3VQSA 3J7Z5 2IVMA 1RISA 4FF2A 4DUYF 4LFCF 3OR2A 4N7TA 2UVUA 2D9PA 4LQ3A 4EFAC 3M6UA 2MQPA 1BQNA 5K5MA 2DXFA 1TVRA 4AUKA 2HBRB 2J6UA 4WPAA 1CULB 2H54B 2UUAJ 3OUYB 2WBRA 3EXCX 3DU6A 1U2FA 2AEMA 4X4PA 3NG8A 2V68A 1Q7LB 4K0KJ 2FZGB 3OTEA 2M5YA 2YWHA 2RQMA 3PEHA 4JI4F 2AZ1A 4YY3F 4ANDA 1Y5IB 2BXJA 5KFYA 1QAIA 1IKYA 1WOSA 3MM7B 3GZ7A 4QW8A 2FYXA 2H51B 1YBTA 5I42A 3MMBB 2MSTA 1RA6A 1CJKB 4FYDA 4KRWA 4CLTA 1R8BA 4XIUA 3GLJA 2E1PA 4OHYA 2K1RA 2P9EA 1Y3JA 2A1BA 4WFZA 2OPRA 1VI7A 2BMBA 2AJ4A 1UPPA 4RW7A 3TUJC 1NSQA 4JP8A 4X65F 3HSDA 4LF7F 3K17A 2MYFA 2QLXA 1KC8T 5IWAF 1IR0A 3HSGA 2OEMA 1OSCA 2EXUA 4C8ZA 2MPUA 3K8VA 2GIFA 1HNVA 1G3OA 4JI8J 2KZZA 2CFXA 5KG7A 2GS8A 3LAMA 5CYQB 1VBZA 4PPZA 3SSQA 3T5KA 4UUXA 1TK8A 2XZTB 2MEWA 4JI1F 1TKDA 1ZAVA 4DSFA 2UZAA 1BE4A 4A8XA 1NKBA 4ID8A 4LF4F 1IJEB 2N4CA 1DY3A 2VL1A 4BWMA 3KUGA 1C1BA 2E5IA 4NLOA 3DOKA 1RJJA 4F3OA 1F2HA 1F5AA 4IOBA 3C6TB 4A8YA 3KDOA 4YHHJ 3JQJA 4B9UA 1VC6A 2B9WA 1URRA 3H7HB 2HNDB 3ENQA 1TV6B 1FEHA 3KLHA 1EJ7L 3CDAA 2KI2A 3J81Y 1LW0B 4WZMA 2CXEA 4HKQA 1ZM9A 4PWDA 2YPZA 2W2NP 2X51A 5DRKA 4F4XA 2J7WA 2X3DA 4ECWA 3I4HX 5ETOA 5LOQA 1SL2A 4UF4A 3TZYA 4NRUA 2Z2ZA 3BQ1A 4NX9A 1HYSB 1LW2B 4PG4A 3TA2A 5H9FJ 1IWGA 3BR8A 4P9SA 2UXDF 2K7JA 3VVTA 2Y9HA 1M1KT 3GMGA 2E5JA 3SQGB 3GCXP 3D0IE 3AOCA 4ZPVR 2X1BA 3I6PA 2G2OA 2AJQA 2F8MA 2WONB 2ZH6A 1PG5B 3VGSA 4X64J 5HVGA 4IR9A 5LJ3Y 4ZIWA 1VOMA 1A9NB 4JI0F 4F4AA 4NI2B 1HW9A 2BDPA 1EP4A 2V67A 2LQBA 2J8SA 2CG4A 3F44A 4CO4A 5D0RA 4EO8A 3S6EA 2CQPA 3D1OA 1RAAB 5FIIA 3O6QA 2V8VA 2FGOA 5DG8A 2W2QP 4UOCA 2IM2A 3OR1B 1R31A 2EC0A 2MZTA 4Z7YA 2PA8D 2UVVA 2EFGA 4RW9A 4B9MA 2JSXA 5HO4A 3CNQP 2R2UA 2YNIA 1IVZA 4ILLA 5J2NA 2JC1A 1IM4A 1JLFB 1X5PA 5KT4A 4ZPBA 4QWCA 3GCWP 4I2QA 1GX6A 1O0PA 3HHLD 5GVQA 1RBLA 1RT4A 3AQOA 2DB1A 4B3OA 4ZKAA 3CCRS 3IS9B 1ZM2A 5KFPA 1PYTA 2QA4S 3GV5B 2VQEJ 3IM9A 5DG9A 4F2RA 4IH5A 2CJXB 3W2WB 2XZDB 4JOUA 2IA6A 1APSA 2BOAA 4FXDA 3A8IA 3CJ5A 2LU1A 1OPZA 2BRLA 3KLGB 2ZZTA 1NDKA 4RLEA 5LSOA 1KFDA 5AXKA 1Q5YA 2RT3A 2W8KA 2WRMA 1HNWJ 5J1NA 3GYNA 1PC4A 1VR6A 4QYZK 1BLUA 1WWHA 2W9CA 4DLGA 3KUEA 1F9EB 2BJEA 2LDIA 2MZQA 5K8NA 1RTJA 2NXJA 4Y0FA 3Q0AA 4CM0A 3BH7B 4JV5F 3H98A 1DARA 2UV8A 3CJQA 2R8GA 1GTEA 3EGWB 3K8WA 1FTCA 1CJTB 4N76A 4IFYA 1LWFA 3QJLA 2DKOB 2O66A 2QFIA 4BHQA 4GC6A 1YX2A 2WBMA 2HGNA 2HFSA 1E6VA 3L3CA 3LA0A 2ACYA 4DCJB 1NPPA 4N41A 3UVJB 1LFPA 1CPZA 5A8WB 2X1FA 2QEXS 1RTDA 4LF6F 2OHDA 2YX7A 4YS2A 4HI2A 5I3UA 3H5UA 1HBNA 1S9GA 2WCXA 4PWUA 3WIUA 5A2QY 4X4SA 4R5PB 1NZ8A 2V4JA 2JL9A 2NSCA 3FZ2A 1GXTA 1N56A 2LMIA 1JKHA 1NZAA 2J9CA 2DNRA 3TZXA 2A2DA 3QZ8A 3KLIA 2E29A 4NOHA 4YB5A 2ZDOA 4OYZA 1R0CB 1XNRF 3WQPA 3ENWA 1EARA 1NJYA 4LF8J 4DUZJ 4DCOB 2MLZA 3BGRA 2KH9A 4HT5A 2LA6A 1S1XB 3OD2A 3I87A 2GHWA 3DM2B 2VA3A 4NMXA 4ZMMA 1TKZB 2VBXA 1UFLA 4KE5A 1I6JA 3MEDB 2OAUA 3NBPB 2E1AA 1SIWB 1AUDA 3NGTA 3ZZYA 2XS7A 1YJNS 1FKOA 1UEVA 3BQ2A 3IBCB 3L7UA 4DS5A 2WVBA 2JVOA 4O44B 5D8HB 1FD8A 2HURA 2OPPA 4K4VA 3HT3A 2V2KA 4IKAA 9RUBA 5GAGU 3GYGA 2IMOA 3ZZPA 3ZTSA 2DNNA 1Q79A 4WU3A 4C4WA 3GQCA 5HN0A 1S97A 2YNFA 1C4CA 3MAAB 3HHDA 3G8QA 3M2UA 3DOLA 3TA0A 2LQJA 4O3OA 4KHRA 1RUSA 5KFIA 1RA7A 5HLFB 4WBFA 3V81B 2ERRA 4EUVA 1NMEB 1UA0A 5HMWA 1M1GA 4EU0A 4M8LA 2KM8B 2VG6B 4URSA 1F2GA 4DR1J 4FS1A 1AROP 1VQPS 3PVXA 2HHQA 1HARA 5F8HA 3I55S 1KSPA 4RUBA 1WI6A 3CB4A 3FMBA 2MSSA 2DCUB 3CW2C 3LGHA 3KDNA 2XI2A 3EE3A 5CQGA 2GVDA 2VONA 4WE1A 3Q8UA 3QLHA 1C1CB 3CEDA 4P75A 2BJ3A 4I7FA 4OZLA 4EGLA 5E0OA 1VQ5S 1XMQF 2VG7A 4OMFG 2E5GA 2QO3A 3TI0A 4K4XA 2PN6A 4NCBA 5B0BA 4EZ9A 3KLVA 1VQLS 3CULA 1PAUB 1S6QB 1HNXJ 3HVAA 4RNHA 4I68A 3CC7S 2Y8YA 1IKVA 3MMJA 2ZH1A 1RAFB 3D6MB 3B78A 2YH0A 3T9NA 3OTOJ 3EMTA 4BBYA 2W9AA 3CDWA 4DQIA 1WHVA 3JSMA 2WVCA 2VODA 2BX6A 2HFOA 1RE1B 3SSSA 1VIOA 3D66A 4HACA 3RB3A 5IT0A 2FDNA 3PIPQ 3ONQA 4URQU 1W2IA 3OR2B 3NGDA 4LQ9A 4DS4A 4J90A 5LXRA 3R5DA 3PYDA 3GV7B 2EFVA 1FXLA 1BQNB 1L3TA 4DL4A 1YI2S 2EKNA 3MPVA 3M2RA 1NK7A 4JB8B 5F9LA 3CO0P 1DTQA 3AA8A 4M5GA 3QO9A 3CCVS 2JEFA 2J0WA 4DDFA 3MM8A 4CLFA 1IKXA 2HHPA 2HK2A 4KHPJ 1S0NA 2BQ3A 2HQ3A 1NUEA 1Q0NA 2IVFB 1N34J 4K5SA 5L38A 2VOOA 1R89A 2BE7D 2OD4A 3CCES 1KR4A 1NDLA 1VQ7S 2CQ4A 5HQ8A 2CA9A 2DNYA 4YB6A 2KDOA 2ZC4A 5I42B 3L95X 3C16B 3EVMA 2FJBB 4M5JA 2N7YA 4M5NA 3R2DJ 1VS3A 3D3BJ 3DDKA 1VJQA 4ES1A 5A6PA 2K1RB 4GC7A 2BR0A 4MKAA 3W3SA 5M2UA 1FNXH 2BE2B 3AH6A 1EETA 1NSKL 2RMLA 2F4VF 4Z7CA 1HWKA 2YWGA 4RW7B 1KBRA 4J9PA 2HHWA 1N36F 2FUG9 5DJBA 2UXBF 4DQPA 3TOQA 1V9OA 5CD4A 1HNVB 2NZ4A 5DDRC 3DI6A 4NA1A 3MPWA 3GFHA 2WAQD 2WW4A 4IO9Q 1BD6A 2UP1A 2WOMA 2OFGX 2H1YA 4N47A 4DU8A 3HP6A 3RW7A 3POTA 3NCRA 1H0HB 2P9GA 5AE2A 3MMAB 5CZXA 5F8MA 2C3OA 1C1BB 3DOKB 2D3UA 3NY0A 1FO1A 1OIAA 4NWBA 3M1VA 4TNOA 3MUVP 1NAQA 3BB5A 2A6MA 1WC6A 4EI2A 3BEGB 2CPYA 4C6AA 1VQKS 1HQUA 3V5RA 3KLHB 2B56A 1SJ1A 3NMAA 1F0XA 4KB7A 2RQCA 4ILRA 1HMVA 4OV1A 3JAMU 3EWGA 3K5NA 4PWDB 2CQ3A 1UJ5A 3RRHA 3VV2B 4USWA 2AQ4A 4LRBA 2E5LJ 3RRGA 3DGVA 4PZVA 4ZLLA 3N0VA 2H5IB 2Z2YB 4BC9A 4USUA 1NRKA 4LBHA 4P52A 4RL1A 2C2ZB 1VQMS 3HSJA 5AJ3F 1NJWA 4QIFA 3GJQB 2QL5B 4X62F 2KT3A 4NZ7A 4PG8A 4IRCA 2H9ZA 1S6PA 2B4UA 2JVRA 3A3NB 1F3FA 2JLFA 5IXUA 3SMZA 2A18A 5KT6A 5IQ6A 4LF9F 4ES2A 2FHOB 3H2LA 2IDLA 1YBUA 3ADAC 2V8GA 5JVGQ 3MMCA 1EP4B 4ZJQA 3PRDA 4NXNJ 1QM9A 5IFMA 1H7XA 1YQHA 3CUNA 3N01A 3D1HA 2VPWB 5CD4H 2BJ1A 1ZA2B 1Y11A 2AMCB 3CMQA 2ZWPA 2GQCA 5DGBA 3QJPA 4ECSA 1LXNA 3TW0A 1TR0A 1TU0B 1SJRA 3BPSP 4RW9B 5KG5A 4DZDA 2GJ2A 2GJFA 5KFJA 5A76A 2YNIB 2DGSA 4NLVA 2JFDA 2G0IA 2ZH7A 2XS5A 5KT2A 5J2NB 1MN9A 1F1BB 4CQ1A 3R2CJ 1FRJA 2BRKA 3EGNA 5KFFA 2CJYB 3LP0A 4I2QB 1NXIA 1VBKA 1IR2A 1X4BA 3NNHA 3ZTOA 1HHSA 4B3OB 2NUHA 3P4UB 2B9EA 3Q22A 1RWKB 2QA1A 2VPXB 1C0UA 2QGFB 2ZM6F 3U02A 4WU2A 2R7WA 3HDSA 4GVLA 1BMQB 2GZOA 2ZKTA 3T1YF 1FT8A 4OZ3A 2NCKL 4NCGA 4P73A 2UUCF 2KVQE 2DIVA 4DL0C 2W9CB 2RIJA 1FJ7A 3A8KA 1UA1A 2V9WA 4E8UA 3PIOQ 4GO7X 2KL8A 1RTJB 2V2QA 2HLTA 4D3GA 4ZIVA 3GSDA 2RDDA 2F40A 1IBKF 3EDQB 1N32F 1K1QA 1IJFB 1N88A 1PSDA 4KSEB 3DRPA 3R7SB 1NJIT 1Q81T 4Y2MA 3EUNA 4IFYB 1GMVA 1HD0A 1LWFB 3KHHA 3AD8C 1PGZA 1E6VB 3GP9A 1XR5A 5GADU 4AL6A 1KVJA 2UVWA 5B0AA 1KQGB 4I69A 3DLEA 1EQMA 1RHJB 1T9YA 2HHXA 3AQPA 1RTDB 4UY85 4FYXB 3EZ5A 1JLBA 2R2TA 3SCLE 2PMHA 3CCSS 4DR4F 1MWYA 2Q79A 1HBNB 3RB4A 1S9GB 1SB6A 4J9MA 2DNHA 2HHTA 4BC7A 2YBVA 3KNGA 5D3GA 4P71A 3U7JA 3L9ZA 1ICEB 2V4JB 4DSKA 3G9CA 3TANA 4HHJA 4HT7A 3PY8A 4MKBA 3Q86A 1HNZJ 2E44A 3KLIB 2GV1A 4NLQA 3SFGA 1QAYA 3MCSA 2XEXA 2UU9F 4OJ3A 3BGRB 4Y28C 2GO9A 2DR8A 3DCAA 3MECA 4DR6J 2Z2LA 3O5TB 1X8DA 5BXIA 3SCJE 2A2CA 2R7SA 3UDEA 2CPJA 1I94J 3DC2A 3MI7X 4K59A 3S1TA 1U8SA 3QSYB 4JI6F 3X1LB 3GIJA 2ACMA 2E5HA 1R7IA 3J7A1 1FKOB 1P1LA 5LMUJ 4Y2IA 4Z2XA 3CF5Q 5L1JA 3KG1A 2RQ4A 4U7UK 4N8OA 2CJ9A 2NPFA 3O2IA 4ER8A 2C28A 4USTA 2MGZB 4ZLNA 1SH3A 4DFPA 3PW4A 5HMZA 3GU0A 3FQLA 3LOUA 4ZLPA 4CLWA 3R5BA 2ADBA 2HS4A 4NLDA 3VZIA 3WHIA 3DLHA 3NGKA 1NNDA 3NGRA 4DSEA 1PJ7A 1SQFA 2CJQA 2GIQA 3DOLB 3M2UB 1HNIA 1B4SA 3VGVA 1BWEA 4N8NA 4YFUA 3PO4A 1LK5A 4ECRA 3TUIC 1ZYQA 4U7CA 3OVSA 2J0SD 2C2MB 3ILIA 2HFZA 3ILJA 4J7CA 4DV3F 3US5A 3WZ0A 1NKEA 1YHQS 3M9OB 2H4YB 1D1UA 2PMWA 4JI5J 3MEGA 5KFSA 5H9FK 2VKRA 4WE1B 4PAAA 2ASDA 3BBBA 4LREA 5KFOA 3ZNUA 4I7FB 3M8PA 3CJKA 3KNAA 4ELTA 1JQGA 4XPEA 4ETZA 2VG7B 2Y1IA 1YKWA 4H4KC 3HKWA 1EAYC 4PXEA 4IH7A 3CSKA 2EBEA 2XSFA 3D5MA 1UVJA 4D3HA 3Q2TC 5LT5A 4G6VB 2VFVA 1RT2A 3M9NB 2DPJA 4DL7A 2DXEA 4O4GA 3CD5A 2HG4A 2QV6A 2FLLA 1NK4A 3TWZA 3BGOP 2BM1A 1IKVB 1RWPB 3UDCA 4JI4J 3HHKA 4JV0A 3UWTA 1B0PA 3OFEA 3NMRA 4RUHA 2YH1A 3VAMA 2KHDA 5A8KA 1S9FA 5E2QA 4RW4A 4FBTA 2LVWA 1WC3A 3GJRB 4GKJF 1N0UA 1WD6A 2IDEA 3H8YA 2L9NA 3Q8QB 4F3QA 4MKVA 2RJZA 4HACB 1J5EF 1Q53A 2VU5A 5B0EA 4LVNP 4NLRA 5A2QU 2B5JA 4HH0A 1YZ6A 2AJ2A 3UN3A 1VDHA 3AD9C 2XLKA 4ERDA 4OFZA 4JI2F 4NZ6A 5KFZA 2ZHAA 2RUSA 1WDTA 3M2RB 3M8QA 4X65J 1JLEA 4CNZA 4RU2A 9ATCB 3ENAA 3ZZRA 4ETXA 5IWAJ 4XPCA 4IUFA 4DV6F 1C4AA 3MM8B 2B9XA 4V19J 3VAIA 4LSLA 4ZDNA 2NZCA 3L7PA 2X7IA 2PA3A 1EIYB 4ZP7A 3QNWB 5IM0A 4PQUA 5GMEA 5H9EJ 4EWTA 3CT9A 2CPIA 4AD6A 4MK7A 4B3SF 4ECTA 3ZTRA 3G8TA 2IJRA 3F41A 4LF4J 5D4LA 2VG5A 2HIQA 1HBUA 4HH1A 3ZZ0A 1L5UA 1RTZA 2VC0A 1VQSA 3PW2A 2QL9B 1SVDA 5KFNA 3P96A 5E33A 4J9VA 5FD1A 1T03B 5ADZA 2M7SA 4CLYA 1SKRA 2ILYA 1GXLA 2LQ8A 3AJ1A 3V4IA 3TUZC 3KK2A 4UQTA 4OLOA 3LO3A 1H72C 2MKCA 4I6WA 2VHGA 2B7CB 3JXOA 4K4UA 4P7TA 2DHXA 2DGOA 1DBDA 2ZH5A 3IG1A 1UVNA 1RK8A 1KLMA 2DIUA 1FXDA 4DR2F 5DZ7A 4TYAA 2XY7A 1KQSR 3LQVA 3D67A 1O6XA 2E1MC 3DI6B 1HD1A 4OI1A 4B3RF 1WHYA 5T41A 1XMOF 3JSBA 2F8HA 4J37A 1VHFA 3E01A 2A0FB 2CJAA 1UW9A 1RT6B 2FY8A 3DRSA 2N3OA 4J9LA 2E7XA 2QLBB 1OYDA 2XCPA 3O44A 4USKA 1SQEA 2OKQA 2Z30B 3POTB 4P2SA 3P5BP 2F7VA 3T6JA 2XZWA 1N5YA 1N5TA 3TAMA 3C15A 3OFFA 2I1RA 4DL3A 3R5CA 3QGGA 3M1VB 2OH2A 3A3OB 3LWMA 4BWJA 4RU9A 5HP1A 2N7CA 5D6GA 5HAOA 3KJVA 1UPMB 4CZCA 3OL7A 4WIQA 3MR6A 1V3RA 1HMVB 3TX8A 4MIWA 3QWPA 4ZOSA 5IC4B 1RI7A 5HROA 2HQDA 4MMOA 1EKRA 5IOLA 5MLCV 1TQLA 4JI7F 3BM7A 1UFWA 1RT1A 1K44A 2XO7A 4NASA 2W2MP 1R43A 5KFHA 3J7ZT 5IT4A 3H25A 2FLOA 4DBQA 2VH7A 3W9JA 1HQEA 4XK8C 3BDPA 4C0BA 3ZTPA 3M32A 1EZZB 5J2MA 1S6PB 8ATCB 2JFKA 2QFJA 3P6YC 5D4OA 1WC0A 2VBYA 5G0RA 3IRXA 5HSPA 4OYOA 5DQHA 1V3SA 1FF2A 4ZHRA 3C14B 2BEFA 1ZAXA 3BF4A 1YSJA 3AOBA 3MMCB 4A8KA 2HVDA 1F6TA 3JSYA 3HHEA 3MPYA 2FVPA 2LP4A 3MFIA 1FRMA 1CQMA 5T14A 4C8NA 2K7KA 4XAKA 2FHJA 5ETVA 3CD7A 3I0RA 3FRYA 5C25A 4PABA 2PIIA 2GC8A 2CQBA 1HIYA 2X3GA 3OSPA 1S1TA 2FTRA 3FRZA 3CCQS 1VLYA 4OHVA 2BJ9A 2OGUA 1NK0A 5KFBA 1AZSA 2GVZA 4ZCLA 1Z1ZA 4YN3B 3UNYA 5G4DA 1VC0A 3P8BB 2KJWA 5LL6d 4ZJOA 1V5VA 3CDEA 2VV5A 4C11A 1ZPWX 3HFVA 1NKCA 3M8YA 2XMMA 3LP0B 3BYRA 3AXKA 2CRLA 3JSRA 3QGHA 2VPYB 3KMQA 1RLCL 4RUCA 2XMVA 3NKYA 5DGAA 4P2MA 2H65B 1GMUA 1JJCB 1C0UB 4M5HA 2IJNA 3KLFA 1CS4A 1SKUB 4FP9A 1ULRA 2M3DA 1S59A 5HVHA 4X84A 3W5ZA 3PX6A 4U96A 2OTJS 3NWGA 2ZH3A 1W2BR 2F9JA 4LJMA 4NCGB 1ZH5A 1SL1A 4USMA 2QLJB 4CT8A 4R0EA 4HTIA 4FYVB 1XNRJ 4QWDA 2UUWA 3CCMS 2LYVA 4E98A 1KDNA 4QPTA 3UD3P 2WSEC 4DR3F 5KFGA 4R25A 1O5JA 3MPDA 1S57A 1RU1A 1W26A 1VBYA 1WDDA 5BYSA 4RW6A 3M6XA 2Z58B 2VJUA 3DLEB 3B8HA 4H4OB 4OX8A 4NLYA 4ED0A 1YJWS 2CZVC 1JLBB 4FXWA 4X4NA 4DFMA 3VCDA 1V6HA 2R7RA 2QYCA 4CT9A 3P49B 3A1YG 1P9YA 2P2CB 3JTOA 3HHLA 2CPXA 5BR8J 1SIZA 2QMWA 1SJ3P 4FN5A 2E66A 4RNOA 1RSCA 3PX4A 2XMKA 4FS2A 2ALYB 2EFPA 4HI1A 3U1LA 3IBWA 4WYLA 2Y1RI 1H74A 2HZVA 5I4MA 3M9MB 2CJBA 1T02A 4V19X 1MWZA 2NXNA 2EG2A 2R9LA 2BKOA 2M2BA 2BA9A 4OIXA 1J5OA 3RB0A 3EGVA 2QLFB 4NLTA 3QGIA 4WXWA 3NCPA 1HR0F 4KO0A 4B3TF 1JLGA 1WJ9A 3ZZUA 3RRKA 3C3LA 4ITSA 3I5CA 1Z4UA 4UOFA 4C8LA 2X1AA 2ZBIA 4HL9A 4A8OA 2QYGA 2ZFHA 1R27B 2QMUB 1S1VA 3HD2A 2G13A 2NR0A 2XS2A 2GJIA 1H2VZ 1TMJA 3IWXA 1ELOA 2BE9B 5B0FA 2VDIA 2HWTA 4TY8A 1B64A 1AT1B 4DSJA 5EDWA 1FFSB 2QA4G 3WC0A 4DG1A 4QIWD 1Y4ZB 3D7SB 1FA0A 4ZPAA 2BJ8A 1IKWA 2MLXA 3SEOA 3B4DA 3ZZOA 4LIWA 3OL9A 4DV0J 3VAKA 4QWBA 2RHSB 1JNZB 2RKIA 2RAQA 3T9ZA 3R6LB 2GX8A 3K7RA 4A8SA 4Q2MA 5KAKA 3MOZA 3M05A 2CPZA 1D8YA 1S1WB 1YRTA 1NHKL 3RBDA 1KFSA 3MEGB 2BQUA 2XYHB 1DLOA 1NK9A 1DRZA 2HNZA 2ZWOA 3MPUB 2RDIA 3THVA 4EMDA 3QT7A 3M8PB 3UR0A 1IN0A 1F9HA 3CJKB 1RHKB 3RB6A 1Q8KA 3BPDA 2RU3A 3QIPA 2XG8A 2FVSA 1JLCA 5EN1A 1CBKA 4A48A 4X66F 3MF5A 4OYWA 5T7LA 2V34A 2DGUA 4M1KA 1G4CA 2CDQA 4NRTA 4O4GB 1VYAA 4O0NA 3J7YI 4K4WA 2DNPA 1YJ7A 1BWVA 3FKBA 1NH7A 5EGYA 1S0MA 3QQCD 2CIMA 3THTA 5KFEA 5GMKa 2CG8A 1U0HA 1G6BA 6FD1A 1RWVB 5BJRA 3TA1A 1GX5A 5A8KB 1QVGR 2UUAF 3KJQB 4KGXB 3NNAA 4RW4B 1AUSL 1HL6A 2KO1A 4K0KF 2YNHA 3GFYA 1RTIA 5E3RA 1XEZA 4L3KA 2GO8A 4FF4A 2M52A 1M0SA 3MR5A 2MKYA 5F8GA 2W24A 4RKUC 2B5JB 3ISZA 2OUGA 4WP9A 2HVZA 2YX4A 2HFNA 1U0SA 5SUHA 1Q86T 2AW0A 4ZN3A 5KFVA 3PYEA 4NLSA 2F4VJ 3PV8A 4OZ1A 3MFHA 2B4PA 3NAHA 5D77A 1JLEB 2Q1LA 3AB2B 4DEZA 3JTNA 2IRXA 4ZPWR 5KG3A 4TY9A 4F8RA 4KQZA 5L1LA 1YTYA 1X5TA 1I51B 3SFUA 4CH0S 4YDDB 2AJFE 4QBUA 4LVOP 2KRBA 1KQKA 2NYIA 3L09A 2C3PA 3PEJA 2PSZA 1B7FA 3SV3A 2DNGA 4NMLA 4CM2A 2ZZMA 1FJGJ 4F02A 1VISA 2V8DA 1YITS 2IMWP 5IM0B 4PQUB 1X4DA 3MR2A 2HS0A 5ETTA 4RR5A 2JNJA 4F36A 1K0VA 1REGX 4PG6A 1DTTA 5ETLA 2VG5B 1HBUB 1S5ZA 1FE0A 8RUCA 3UI3A 1TL7B 5I3PA 1QSLA 4JI8F 3G8SA 3ZC4A 3U27A 4DX7A 2POKA 4P74A 2RD5C 4P72A 2JEJA 2BJDA 2FB0A 2HPUA 2P5VA 3I4PA 3VGUA 1RHQB 1YGYA 3C2PA 4PG5A 3RTVA 3V4IB 3VTIA 1Y0HA 4FPRA 3KK2B 2HW3A 4KPYA 2OTLS 1SPBP 2PC6A 4L75A 2WSCC 2Q66A 1TL4A 3F56A 3IG1B 1KLMB 4QCLA 4K4SA 3QT6A 4MH8A 4YHHF 2HK3A 1HPZA 2ASLA 2ABYA 5DDQC 3PHTA 5LMNJ 4A47A 1WC1A 3E01B 2DT9A 3SBMA 3DRSB 2FLPA 3VHQA 4JI3J 4WF9Q 2B8PA 2I0XA 4G1QA 3R8YA 4JBCA 1ZZFA 2C2DA 4GRSA 2N3LA 2MKKA 2JEGA 3DHWC 1SC1B 2BV3A 2WB4A 4WYWA 3CJ4A 4CTAA 3J80U 1TKTA 3TAMB 3C15B 3V4MA 3TQ1A 1N5YB 3MD1A 4DV4F 1ZAWA 3T5JA 4DX6A 3VZHA 1OPIA 5HMXA 1NB2A 3HHNB 3L4BC 4OHWA 2NLWA 3AFGA 1QAJA 4A8QA 4C8OA 2YKOA 4DSIA 5HP1B 4U7UD 2RVJA 5L46A 3OXFA 3I9ZA 2ASJA 3E3XA 5K8MA 1RT5A 2B43A 3KJVB 3PW7A 1NEEA 2VZ9A 3KHRA 1WI8A 1KN6A 1U6BA 5HROB 1TUVA 2W2OP 1Y10A 3LAKA 4X64F 3MCMA 1RTHB 2HQGA 2Q6BA 1RT1B 3W5XA 3Q2SC 4ED1A 1YRXA 2UV8G 1K8AT 3IWNC 5ETMA 3TYTA 2XHWA 2XSJA 1HQEB 3TEGA 1Q16B 3RG6A 5DDPC 4QR2A 3M32B 4I1TA 2FGCA 3FSYA 4NA2A 2ATLA 3NOCA 4ZA1A 1JMTA 3GJTB 2V69A 1U47A 1BGXT 3MURP 3FBEA 5G0RB 2CNKB 2J9EA 1WG5A 1GAOA 4B17A 1IWAA 1M5HA 3T5LA 4ZHRB 3LP2A 3T6BA 3HI9A 3GPAA 3EVOA 2OPSB 2ADCA 1BC6A 4H4KA 3V6DA 2DGVA 3T1YJ 1RDRA 4DV7J 4OYBA 2F1FA 3R7NB 2WW8A 1BXNA 3PR5B 3JQKA 3BYPA 1RWMB 2PMZD 5C25B 1RHMB 2FJVA 1R6VA 1S1TB 3T1HJ 2CVIA 2VFRA 2J6TA 1TUGB 1N5VA 2NUUG 2XTJP 5CYMA 4UZBA 4RJVA 1WTBA 3LWLA 3C66A 3UN5A 2XB2D 2VJVA 1AZSB 1KTQA 4HTJA 1XQIA 4MK9A 3IAS9 2IYIA 1RWWB 1N32J 3DXSX 1HNWF 1EX8A 3E51A 1RT3A 1RB0A 3CCWA 1M1HA 5E3QA 1YWXA 2YKMA 2DHAA 1OMSA 3AT1B 5EWGA 1R0BG 2C22A 3EICA 2G0JA 4DOZA 3KLFB 2AD9A 2AF6A 1GEHA 2ZBPA 1WHXA 1F9FA 3GIKA 1VCTA 3MTJA 1SJQA 2GAHC 1Y3KA 1U8WA 1CJVA 2L41A 4M5LA 1UVLA 2YY3A 2AJ0A 5CXTA 3C6UA 2V6AA 2XMAA 2UU9J 2IVYA 4Y34A 4JUZA 3GSIA 3DYAB 4ICLA 3HSZA 4V1Ak 2SXLA 4IQXA 2V8HA 2MKJA 1QE1B 3IRWP 4OI0A 3DRRA 5F0WA 4NLPA 2DBBA 1T9TA 2ZE2A 1FHTA 5F41A 4F67A 3R1HA 5H9EK 1CEZA 4RW6B 4Q0BA 1KKHA 2R2RA 4LMZA 2ZKUA 4X4TA 1TL3A 4C0HA 2CQCA 4LF8F 3BS9A 3MM5A 5E3AA 5K9FA 2ZD1A 4LFBJ 4TU8A 4KHMA 5M2RA 2VQFF 1X5SA 4MKYA 2PDAA 1S79A 3VAJA 3PKMA 3D4JA 3ZFVA 1KHVA 4ZVRB 2GAGC 4RPFA 4NA3A 1K1SA 5KFUA 3UCZP 4IG3B 2MKIA 1N33J 1TL5A 1T9WA 3W64A 1WEYA 1B0VA 2BM0A 1MU2A 2OJ3A 1Q1KA 2QN6B 3HCXA 4ZS6A 5K20B 4USJC 2XY5A 4LF1A 2V94A 2VUGA 1J5OB 3KWMA 3EJMA 1FKPA 3HF5A 4MIBA 3R1LA 4ILMA 4JYAF 5DDOC 2KHCA 1X4HA 3MCNA 1JLQA 4A46A 3WX4A 5D0HA 1HI1A 5IZHA 1CSJA 4X2BA 3GFZA 3SSRA 3VAHA 1TL1A 3GWCA 2HRTA 1WC5A 4M5KA 3CCJS 1S1VB 1LEOA 3CDBA 4I56A 1Q5VA 4RO0A 4CI0B 3QT8A 4TY8B 3N5FA 3SDEA 4G3IA 2WVEA 3IBFB 5ETPA 1AW0A 2O3DA 1S6OA 4ALZA 4DG1B 1U25A 2M88A 4DV1J 5CYJA 1IKWB 3KMSA 1QJHA 4KH1B 1EB0A 3LTOA 3LUYA 4ED5A 2YKQA 3BBCA 4GKJJ 4ED8A 2RKIB 2B9YA 4C8YA 3PFOA 4MTPA 3N5BA 4DSLA 3LF0A 3P45B 4ED3A 1HNXF 1UZDA 2YQ3A 4LF2A 1S4FA 3P5TL 1PC5A 3TAPA 5EHHA 4NLWA 1ZPVA 5L9NA 4EO6A 2HNZB 1KRPA 3WDOA 1K73T 3RR7A 3H4BA 3OTOF 2ZBQA 2UXCF 2U2FA 3FCHA 1UFKA 1UWBA 1WSRA 2NS1B 2RF2A 3SQOP 4JI2J 2M70A 4X4QA 5J2QA 1PKUA 1Q82T 3MMBA 4LR9A 2CDRB 2P6TA 2FVCA 2KB2A 1S9EB 5T7LB 2KFZA 1CJKA 1U48A 3W5YA 5KFTA 5KG2A 1PJ6A 4F04B 5C2GA 1KVKA 3ZZZA 1UAWA 4DV6J 3U1NA 1ZZNA 2WVFA 3EZUA 2NSBA 2OEKA 3LGNA 5D4NA 4UQGA 3NS6A 2CVEA 5KFKA 4F0HA 1RAIB 1U0HB 4LBIA 1FCAA 3ETMA 5SZTA 2QL7B 2GCFA 3I9V9 1HFEL 1D9DA 1U09A 4WIIA 5THWA 2QX0A 5A0YB 3FBBA 4UY8T 3M30B 2YNHB 1FX4A 1SV5B 1RTIB 2UUBJ 3BO4A 3NS7B 3D6TB 4KHPF 4W90B 4DR5J 3NGSA 1FVSA 3PG9A 2W7AA 1H73A 4OHZA 3QRQA 1UVMA 2DNOA 1NHUA 2XY6A 3FZBA 1NK5A 1VRUB 2E9RX 1FEEA 3V6JA 2R7TA 4WFYA 4TQRA 2EVZA 4LIRA 4DV2F 3HFZB 2IYGA 5C7PA 1YDLA 5DZ6A 2B51A 4QR0A 2B7BB 1J27A 5KFDA 3DLLQ 2KTQA 2HNDA 1RWNB 1XMOJ 1TV6A 2IAJA 4ED7A 3OPKA 1Z2LA 1CVJA 3MD3A 4KTQA 2JH3A 2L08A 1DTTB 1T3OA 1YLXA 3H90A 1KONA 2P9CA 3OTBA 1BHNA 4EBCA 3KG4A 4O3NA 2OEJA 2QIFA 1FDBA 3DLKA 4B3MJ 2V4QA 1VRTB 2VFUA 4U9RA 3KG0A 4MYUA 5KFRA 4ZVSB 3HJVA 4PYAA 4XDDA 1MMNA 3QAEA 1R8AA 2F9DA 1U1NA 2KZMA 2W9BB 4WFBQ 1HHQA 1XR7A 2AX1A 2CZ4A 3CJ3A 4DU7A 3W61A 2CADA 2PD1A 1KOHA 2GW8A 3M4XA 1FJCA 1H2TZ 2HHHJ 4NI2A 1HPZB 1KD1T 1T7PA 2ZUGA 3PACA 4R8UA 4B9VA 1PCAA 2VBWA 1UVKA 5AE1A 3QGPA 3UO0A 1HQ2A 3GG0A 5ETSA 4CYUA 4FPIA 2YXLA 3K57A 1ZETA 2FIUA 2J0QD 1YBAA 2IPOB 3G6YA 2G1DA 4L3NA 4GKKJ 4CTAB 1TKTB 2ZOMA 3VVUA 2E5LF 2EG1A 4DI6A 2HAFA 1DQ8A 2BVZA 2MZ1A 2HS3A 3Q23A 4C97A 2FHMA 3TO8A 4HYKA 4DV5J 1RT5B 1RT7B 2QA2A 2ZJPQ 2VC1A 5CABA 2XBPA 4B9NA 1VMBA 1RLDA 2XYPB 2OP5A 2RU9A 2GHPA 3LPEA 3G71S 1O51A 5CA5A 2FD2A 2B4VA 2AX0A 4FVCA 1N5QA 5AXLA 2DR6A 4XDCA 3IC1A 5EX0A 1JJHA 4IFVB 3W2WA 5KFLA 2KXFA 6FDRA 2IC3A 2DR9A 1RWUA 2CQ1A 2XSJB 1S49A 3HLUA 2IM0A 2HVHA 5DETA 4LUBA 5GAHU 5K8OA 4N56A 1ZM4A 3C8YA 3WBZA 4YR2A 2AV5A 5BYRA 2VFSA 1CC8A 1HI8A 3JQMA 3OXLA 4WP3A 3MEEA 1WOOA 2G2ZA 2J76E 4C3LA 1NSAA 3THPA 3V6DB 4OYMA 3TVZA 2KFNA 2D7SA 2OPQA 1NSPA 3DLJA 3CJ0A 4BS2A 4QIVA 4OZ5A 2XYGB 1KS2A 3SCIE 4YMEA 2W7OA 2ZOGA 1S1UA 1A6LA 4AE5A 4LF5J 3MOJB 3PDNA 5E3PA 1JNRB 5CYMB 3KK3A 5AT1B 3PXGa 3DNCA 1HBOA 2EPIA 1L3KA 4DMZA 4I64A 4DR3J 4R5PA 1TVRB 5JUMA 2D9OA 5LSLA 1FE4A 3EPIA 5HQLA 4ZCKA 4LFAJ 4P2FA 3R27A 3MGJA 1RT3B 3Q8PB 2X1GA 5MAOA 3D2WA 2DNMA 1ZTTA 4FF1A 3TR5A 1S7IA 2YKMB 4F26A 4U95A 1TZ0A 1RACB 1JXEA 2H48B 3QRRA 1S1XA 4M5MA 1IKYB 4IOCQ 4ZVFA 1SJFA 4OI4A 1T94A 1NH8A 4QR1A 4YQWA 3OHBA 1TKZA 2V50A 1N54B 3AJDA 1YJUA 2F63A 4ANEA 3MEDA 1KEKA 2XWYA 5KFAA 2F8EX 4DPXA 2KG1A 5L39A 5FLXY 1CJVB 2IRUA 1RQ0A 1RKJA 5E3CA 3LH2S 1VQ6S 1PAEX 5D0GA 4NXMF 3AA9A 3C6UB 2FLNA 2HHUA 2IY5B 2JX2A 1T11A 2OPRB 5J1EA 3PR4A 1S76D 4ICLB 4URGA 3M8SA 3OVBA 3IO1A 2BBEA 4MFBA 1X9SA 4U67Q 2Z57B 1GNKA 3IR7B 2C2OB 3DRRB 3GTYX 3MAAA 3HHLC 2ZE2B 3Q24A 3ICLA 1J2VA 3KXDA 3PJ9A 2E1CA 4B3TJ 3A3PB 1HNZF 1LFWA 4RBUA 4Q0BB 1X9WA 2HFUA 1FXRA 1REVA 3DU5A 1SUQA 3OTDA 1X4AA 1TMMA 3MM5B 2EW9A 4DR6F 1FNMA 2ZD1B 4QPXA 2DNKA 4ZPCA 3MR3A 1H3DA 1T8EA 2LU2A 3CGIA 2MLYA 1FERA 2YTCA 3FCVA 1I94F 2ATCB 1IBMJ 3MZIA 1AXQA 4K2JA 2KFYA 4FXVA 1FKAF 2XMJA 4GO5X 5DM6Q 1FRHA 3QJJA 2Q6CA 2Q43A 2V2ZA 2YVSA 1XWLA 5LMUF 5FJ4A 2XMUA 1MSWD 1C1CA 1I5OB 4QQBA 2VA2A 4ECZA 1IQZA 4G1IA 1MU2B 2V2VA 5C2CA 4QW9A 5HL7Q 5IQQA 2YPYA 1WG4A 2MMYA 4PR6A 1KTVA 2DK2A 2V8PA 4WFAQ 2DGTA 2BKPA 1IM6A 5DQIA 4ZITA 4YDXA 2GMJA 2BKNA 2XNRA 3OT9A 4OV6A 5IV3A 3UDVA 1RZMA 2BQRA 2MHNA 1FKPB 2AYGA 4GVBA 3B82A 3S7RA 1JLAA 1XC9A 2YQ0A 1JLQB 3PJWA 4AQYF 1FWKA 1CLFA 3KOAA 1C0TA 2MY7A 4A8WA 3UDLA 1PIEA 1IUJA 4KKOA 2Y3YA 1TL1B 1KP6A 1SH0A 3W2VA 4ELUA 2KYZA 5CZVA 3U1MA 2B8QA 4O3SA 2DRAA 1H98A 3JYTA 4Y3CA 2HHSA 4KC5A 1QTNB 1RAHB 4JI5F 1Q8BA 3CDUA 4L74A 2XI3A 3SDEB 1HI0P 3G6XA 3TVYA 4I67A 4L73A 3K0JA 2AYBA 3UE2A 4UOHA 1B7YB 4TXSA 3RUBL 2R8HA 4ZVGA 2BOPA 2EFNA 1SL0A 5L8RC 3GONA 3TJ8A 4J9UE 2RQKA 1R8PA 4F3MA 1VFJA 1NU4A 4FYWB 1MLAA 1P1TA 2AEFA 2QSFA 4AL5A 4F2SA 4C7QA 2FJDB 1DURA 4WCEQ 5B7WA 1UWBB 2RF2B 1S10A 2AT1B 5J2QB 2XULA 4DPUA 3IP0A 3C16A 2CUYA 3M8RA 5ITHA 2E7VA 2NPIA 4Q43A 2GA7A 5ETNA 3D6HB 4DCPB 4CH7A 3R7BB 1OWXA 4OI2A 2VBZA 2A10A 3R5JB 5HANA 1S4EA 5GAEI 3BSNA 1RT4B 3BKUA 4NLXA 1TUWA 2BE2A 4USIA 4ZVQB 1FDNA 1LWXA 4Y2KA 2RS2A 2HWIA 2JWNA 2KT2A 1B99A 2C3YA 2PI4A 3W1YC 2DY9A 4LRCA 2HBYB 5GAHI 4YEAA 1FVQA 3ZXWA 3I31A 3PZPA 3N28A 4OX7A 1QUPA 3ISNC 7AT1B 4ID5A 1H38A 3CJSA 1U24A 4QYRA 2OELA 4DPWA 4I6YA 4Q5VA 2J5AA 5D0EA 3J7AN 1TK5A 2WTFA 3D28A 3HJFA 2ZEJA 2YQ1A 2VFTA 2HZCA 3VF0B 2C1EB 1FD2A 4H4MA 4CO3A 2AGQA 3MMAA 4Q44A 2CQ2A 1QY7A 4DFJA 2XGPA 4HVZA 1LV5A 3TJAA 2DTJA 2DGXA 3ET6A 4TU9A 3Q89A 4OJGA 2FHJD 5KG1A 1Y5NB 3W66A 3VAGA 4Z37A 2HFVA 2WB1D 4LSZB 4OZ0A 3DLBA 1UZHA 2MQNA 4IH6A 4USHA 1FWPA 1FFWB 3K89A 2GNKA 4OX9J 2LKZA 4J9RA 2HRUA 2IAJB 2RRAA 4C98A 4DN0A 5I3UB 2AYMA 3TEHB 2R4FA 1B0TA 2Z8QA 1TFWA 2OFHX 4DL2A 4WXOA 4DR7J 1DFDA 4DV4J 2B3TB 3ELHA 3GILA 3DLKB 4W92B 1AA1B 1JKHB 2CNLB 2M4MA 3FEZA 4KY3A 2DJWA 2XLIA 4RUAA 2MQLA 3DGPA 5F0UA 3TQEA 1TTHB 5HMYA 2QZ8A 3HD1A 1M5SA 2ZBRA 4ZVUB 5K8PA 2IBKA 3SCKE 2CPEA 3QIDA 4I6AA 1X0PA 4F4KA 2NXEA 3IMQJ 2I38A 2HBZB 1LKZA 4M95A 2G9OA 3CC4S 4F25A 3VALA 4NEZA 3AY0A 2B0GA 2XCAA 2CWXA 4R8UB 2OPPB 3CWJA 1DAXA 2OMOA 4CYUB 4RBVA 3EPGA 7FDRA 1NPRA 4CO2A 3TRGA 1R8CA 5HVFA 3R97A 1GH8A 4I2PA 2R2SA 2LXUA 1RWXB 2DHGA 3PJXA 2YNFB 3BQ0A 3H59A 2DH9A 3FK4A 4I4BA 1H7WA 2RDJA 5DLGA 2MQMA 3PNIA 1AYEA 5C42A 3M8ZA 4RZRA 4L6V3 4O3RA 4BLGA 3PYFA 4LSNA 4B08A 4C3KA 5F3ZA 3MWBA 2Z4PA 4ED2A 4OHXA 4ECXA 4XTTA 5ETKA 3VWSA 1LQ9A 1HWIA 4FF3A 1RXOB 1SKWA 2B6AA 2BACA 1LWCA 4A4JA 5F8IA 4DUYJ 4LFCJ 5C5JA 5A8RA 2BW7A 1NBEB 2GVDB 4P7VA 2IC3B 3QLHB 4KFBA 5F3TA 1U1PA 1X9MA 4KH0B 4OZ2A 4U6PA 4CNYA 3J80Y 3FGVA 1W7WA 5KTQA 2XWXA 3BGFA 3BSAA 1T05A 3KJNB 5B09A 2CQGA 3TNVA 3SV4A 3ITHA 4UUWA 2Y0SD 4MJKA 1GMWA 1XJWB 1RU2A 3NNCA 3MEEB 4FZVA 4YY3J 1T3NA 1WEZA 1NJZA 1B3TA 5AE3A 1YRUA 4ZVHA 4K7QA 3PX0A 2MQOA 2OPQB 5DS7A 2RNEA 5J2PA 2QT7A 3JSMB 4TLRA 1HW8A 5JMNA 2UVRA 3BSOA 5D4PA 1U6FA 4FKYA 1S1UB 4K4ZA 3TJ9A 3PRVA 3GIIA 3KK3B 2XC9A 2DGQA 2EK1A 3F73A 4KGKA 1HBOB 1ZS6A 3DOMA 2VDHA 3OV7A 4QOTA 4M63A 3DN9A 2HGMA 3BN7A 2CAJA 4Q7AA 4LF7J 1DTQB 3CCUS 1WKJA 3IGNA 2D69A 1L3UA 3QO9B 1TAQA 3JTPA 3HT0A 4F50A 3HVTA 1IKXB 1XIQA 5CHCB 5F8LA 2EFQA 6AT1B 4NLGA 4RW8A 2YKNA 1BQMA 1X31C 1ZTWA 2CJKA 4JI1J 2VQFJ 4DJBA 4ZP6A 3DKDA 2L48A 2P6SA 3HM9A 3EVWA 1X4GA 2H4WB 1OJ4A 3IFEA 4E2FB 3IR6B 1M5PC 1SBRA 2FPHX 1F5BA 1JB0C 2HZAA 2MGZA 3GFXA 5F9NA 5J1EB 2FJAB 1EETB 1RYRA 5HQMA 2QMXA 3MCOA 4MFBB 5BR8F 2HBQB 3PKYA 1IBLF 3HVWA 3MDFA 4TN2A 4C8MA 4JYAJ 2ZDPA 3MUTP 3NLCA 3IN5A 4KAIA 1WHWA 3TARA 1REVB 1XR6A 1SUQB 3EX7B 4C2MA 1N4LA 4RNNA 2BW2A 1JJ4A 4CCHA 1Y00A 1SCJB 3ETOA 3JB9k 3N9UC 1NHVA 3LP1A 2ZHOA 2RSQA 2WOMB 2UXDJ 1TAUA 1JIHA 1XNQF 1KNZA 3W7BA 1CJUA 5E5NA 3ISND 1Q8LA 2IRYA 3T3FA 4QWAA 2MDAA 3GJSB 2CQIA 2IHR1 4TLQA 3PFEA 2MQQA 4JI0J 1JX4A 1PYOB 2FHKA 2RRBA 3QFHA 3TZWA 1HQUB 3RBZA 3HK2A 2MKSA 4CO0A 3CVKA 2CKWA 4WFXA 4GVBB 1WELA 3VAFA 2R8IA 5EUHA 1JLAB 1S72S 4YR3A 1QD1A 2VIHA 5CCLA 3V2UC 3BO3A 3QZ7A 3HMJG 4ZVOB 2J8AA 4CLLA 4YUDA 1VQYA 3CJ8A 4AL7A 4DV0F 1C0TB 1L3SA 5LSRA 2UXCJ 2GHVC 4K8RA 3J7YU 4KKOB 4RBTA 5E41A 1R0AA 3W2VB 1BY9A 2V5HG 3JYTB 3FBFA 3IAM9 1P6TA 2I6WA 2DEIA 2C2EA 3QFWA 1MN7A 8AT1B 4PXCA 4X4OA 1Q4RA 2FZCB 1UJ6A 3BH6B 3MR7A 1Q95G 2R8KA 4ZVPB 1RCOB 5DQGA 2HVEA 1WG1A 1N48A 3DLGA 2PT0A 3K58A 3GYXB 1Q78A 4JV2A 1OY8A 2V9KA 2DH8A 2ROEA 1T95A 2JLGA 3ULHA 1U1LA 1N8RT 4RNMA 3RW6A 2FC9A 2DGWA 1V5IB 2MZRA 2AYEA 4OYAA 1AB8A 2E7WA 1SKSA 5FLXU 2FY1A 1ROFA 4YB7A 2O67A 3WIVA 3CCLS 4DQSA 2Y0BB 1ACMB 3UNGC 4JV5J 4O3PA 1B70B 2KVIA 3FEYB 4DV2J 3MUMP 5KFCA 4WFNQ 1UEUA 2MJNA 3NP5A 2D3ZA 4CLUA 1T03A 1RWOB 3C19A 3MTKA 5KFWA 3ZO7A 3K59A 3FC9A 2EFOA 1GK8A 4Q2LA 3CD0A 1W25A 1RAEB 3QSIA 4LF6J 5HBMA 3OFHA 3B54A 1RBOB 4DPYA 3TP2A 2CWKA 3HVRA 2R3VA 4ID5B 2PEHA 1FJGF 1JK9B 3CO9A 3IGVA 4CWBA 3SI8A 1RT6A 4DL6A 4DHVA 1WKKA 2D41A 3C46A 4QIGA 3SXLA 4HDGA 3A8JA 3AB4B 2GFFA 5IT9Y 4K2XA 4H4MB 2DVIA 4ZJLA 1IXKA 5HI7A 2K8GA 1S77D 1WKLA 3DRXA 3DRPB 3VGTA 4DZ6A 2GQ2A 2YWEA 3ET6B 1OY6A 1G2EA 3GB0A 4RNFA 1UP1A 1X0FA 1SC3B 5ETQA 4J5OA 4WP8A 2OMLA 2W1BA 3LALA 1MW7A 5HJXA 1VBXA 1GT8A 4ELVA 3OVAA 3N6LA 4EYIB 5KFMA 1IR1A 4NZ0A 3NWRA 4DN9A 5D3GB 4H54A 1BUXA 1S6UA 4ES3A 3CCTA 4QIEA 1N52B 3G96A 5LMNF 2ZNYA 1U02A 5KT5A 3T41A 3DGPB 4NYPA 4JI3F 3UCGA 4ZVEA 4X4VA 3LW5C 4K4TA 2EI5A 3RAQA 3UPFA 4ZLJA 2YKPA 3FNNA 3HFKA 3MECB 4PUOA 5CCMA 4KJIA 2KXHA 3W9IA 3OFGA 2NYHA 4A8FA 1CC7A 3BJYA 5GAGI 2M0GB 2OSQA 1WOPA 3W63A 3C14A 3UD5A 1NDPA 3RBXA 3F0NA 1RGVA 1SXLA 3OLAA 3SZ2A 2L3MA 1PYSB 5BYQA 2XM3A 2ROGA 2PEBA 4L72B 2ZH8A 2ZNZA 1IQTA 1ZBTA 4NLUA 1XMQJ 2HYIB 4O23A 4TQSA 2OLWA 3DDIA 2VKZG 4LBPA 4I2PB 3R3TA 4P10A 2VF3A 2KYXA 1HWLA 2YKAA 3OBIA 3I5AA 3MHYA 2HNYA 1RADB 2K3IA 1HNIB 3CD6S 3UN2A 1FDDA 2WK4A 1TFYA 2XGQA 3H4DA 4C3MA 5C42B 2AWZA 4I0WA 4M94A 4DFKA 2ROPA 1X4CA 2XQCA 4LSNB 2RS8A 2I5JA 3H5YA 2DO4A 3D54A 1DJ0A 2RH3A 3BZQA 2IJFA 4TU7A 2VOPA 1RHRB 1ZM3A 3K2YA 2B6AB 4O0IA 1LWCB 3HKZD 3QYYA 1WF0A 3J81j 3KK1A 2DEJA 3KLEA 4OYPA 3OJUA 4PKDB 3UQSA 5A8RB 2D3O1 2MKHA 4KFBB 5H1SV 2HQIA 2PE8A 2JZ5A 4DV7F 4KIAA 1N0VC 3I96A 1LNQA 3FMWA 5IS2A 2JLEA 3G6ES 4DL5A 3R9LA 4MK8A 3AHPA 4M5IA 3K5OA 1T05B 4PPDA 3D68A 5HJYA 3OJSA 3PW5A 1RT2B 2MHEA 1U7LA 3ITHB 3T1HF 1RBAA 3N6NA 2RE1A 3GV8B 5DM7Q 1LXJA 3UW1A 4IDKA 3O3LA 3OL8A 2AU0A 1U1RA 4KGZB 4EBDA 2QSWA 5K14A 1FK9A 3P3DA 2W4DA 4L76A 5J2PB 2O1PA 3W8GA 3RR8A 3OXGA 1PBAA 1YK9A 3J81U 4H4OA 3MEKA 2GMHA 1KLNA 3UD4P 3LGMA 2DITA 3EYZA 4NXMJ 3RYLA 3T5HA 4WJBA 3RJMB 1QAXA 2YWWA 4OJ1A 3MXHP 3DOMB 4ECUA 3AJ2A 5KG6A 4DQQA 3G2XA 4DXLA 1N36J 3HX9A 2PO4A 3M8QB 1WSVA 4KPCA 1TKXA 2HEKA 3NEKA 2PI5A 2CYYA 2J9DA 2UXBJ 1BQXA 5LJ5Y 2AJ1A 2ZZNA 3B4MA 3HVTB 1OO0B 3I0SA 1T9XA 2CPDA 5U47A 3CMES 3FVYA 4LSLB 1F60B 3PHEA 4RW8B 2YKNB 1L3VA 1BQMB 5GMDA 2G2YA 5D78A 2GGPA 2AP6A 4EK2A 3HZEA 3GR1A 2DO0A 2WZ1A 4KGMA 4IR1A 4Q8EA 1O8BA 3K5PA 2YWFA 2EC2A 4ED4A 2CPHA 4LFBF 2DHSA 5FDLA 1EQ0A 3G82A 3QATA 1DQ9A 4LRAA 2B4OA 2RUGA 3K5LA 5RUBA 1E6YA 2ZH9A 5EWFA 2KM8C 2LDYA 5A6WA 2OSRA 2W01A 4C0OC 1SJ4P 2IA0A 3FSIA 2PFFB 4Y00A 2C2KB 1N33F 1U1QA 2O01C 3EXYA 4AQYJ 1NCLA 2JC0A 4NCAA 5B08A 1X4FA 2LEAA 4USVA 1CG2A 1RAGB 3OHAA 1D8ZA 4CLPA 1MROA 4PQAA 4IRKA 3G6VA 1VQOS 2MY8A 3NXZA 1DHMA 3SYZA 2DCLA 3QRPA 4EBEA 3LP1B 3OSNA 3W65A 4M5DA 4NYZA 1GQEA 2D74B 2V4RA 5AJ3J 1S1WA 1CJUB 2C3UA 4OYIA 1RAJA 5C24A 4X62J 2LEPA 3OLBA 2RB7A 3HPOA 1TK0A 1KOOA 2NREA 3DDNA 4U8VA 2XHCA 3PW0A 2W8LA 1HKAA 2KT5A 4FNIA 4RWWA 4LF9J 3H5SA 4BCAA 3FFIA 4WK3A 2I9SA 1XBWA 1WF2A 3S8SA 1K0TA 4AT1B 2DNLA 2BZ2A 4FDFA 1T9UA 4P6QA 3EGZA 4X4RA 3W62A 5KG4A 5AXNA 3BSCA 4O3QA 1URNA 3H0PA 1ZA1B 4FKXA 5KFXA 4CLZA 1NJXA 5CH7B 2VPZB 4IYQA 4DV1F 5IC6B 4DF8A 2W4PA 2C3MA 4DWIA 2Y1JA 4UOGA 2HAIA 3H2VE 2CZ9A 2A3JA 4OQJA 3RU0A 2ZHBA 1JXLA 1K9MT 3KHGA 1Q8IA 3N6MA 2UUTA 3CCZA 2Y8WA 2LCWA 4KGVB 4F4ZA 2Z2MA 1R0AB 3DMJA 4B02A 3EZOA 1V3ZA 3QT5A 1D0EA 3M8WA 5DG7A 3N4WA 4G65A 3M6VA 4ZCIA 4EYHB 4DQRA 4CDIA 5J2MB 2BUNA 3QPIA 2BANA 1FJEB 3EM1A 1SI9A 3IRXB 2EBGA 1P27B 4IOAQ 4QU6A 3PYGA 1U4BA 3CE8A 3DLGB 4S0MA 4F0MA 2ZM6J 4PXBA 3FBCA 5LM7E 4WTYA 2K3KA 1AFIA 3SIPB 4KV8A 2EWHA 3M2VA 1T9VA 1NLKL 2OD6A 4UT4A 4IG0A 3A12A 4KYZA 2UUCJ 1P8GA 4ZPTR 1KWMA 2HMIA 2J6SA 3I0RB 2C2NA 1JWWA 1YG0A 5F8NA 2LA4A 2VQEF 1VC5A 4NPOA 4ANCA 5L9XA 2DH7A 5JJBA 4ZN1A 1XERA 4PEOA 4DX5A 1Z2ZA 4FYYB 5IV4A 2GVZB 1TL7A 2UUBF 3ZZTA 3LPYA 2F4FA 1IBKJ 4Y2CA 5D15A 4DR5F 4RX6A 4C11B 2CPFA 4F0KA 3ILLA 1WF1A 2HWHA 1G7CB 3TX0A 1N6QA 3TZZA 3B6BA 4YR0A 3KHLA 5EWEA 3O8WA 4ENOA 1S12A 1RABB 5HBMB 4DR4J 1HHTP 1WUUA 1VJWA 3GG1A 1CS4B 2WHOA 3R5GA 3MM6A 1TP7A 3D6FB 3CXCR 4ECQA 4U8YA 2G0CA 1HWUA 4GMKA 1LK7A 5KT3A 1WACA 1UKUA 4W4MA 2L9DA 2ILZA 5DO2A 1TELA 3A8EA 2HKEA 3MM9A 4HHUA 3CC2S 2D1CA 3EDRB 2W25A 5ETRA 5GADI 5L1IA 4KR0B 3BKFA 1FFGB 3MAQA 1U1MA 4X4UA 4HDHA 1VK3A 1VGYA 2G1HA 4B3MF 4EZ6A 4OL8A 4JI6J 3M7VA 4Y2AA 4Y6IA 5KG0A 4KBIA 3G86A 1HBMA 1QVFR 1PO6A 1D3WA 4DUZF 4PYDA 2KU7A 1UVIA 2W2PP 3AAWB 3GE9A 3CJRA 2WSFC 4NEYA 1YJ9S 1XTZA 1AFJA 2FQQB 2ALZA 4XO0A 5LXYA 2YX1A 1QTMA 3BGLA 2AHOB 5HK4A 3HHLB 3QMQA 4BDPA 2OO4A 3O1LA 4CLSA 4F7VA 2LECA 2HHHF 1RTHA 3QWUA 2XO6A 1D9FA 2BYCA 3NGUA 2LXIA 2GQQA 2AKWB 1F3VA 2XLJA 4JV1A 2YWKA 2C42A 4OZJA 1NB7A 1VRQC 4A8MP 4ED6A 4PUOB 1KQFB 4GKKF 2HVIA 2V63A 3V6HA 4NL5A 2ZH4A 4DV3J 2EEYA 2HLUA 1FI4A 4KO0B 1U6ZA 3IWLA 1LWEA 3QAUA 1JLGB 2COLA 3IR5B 4LRFA 2KN4A 4Q45A 2BABA 2QLWA 1VIXA 4DV5F 1QDUB 2AEJA 3BGUA 2OPSA 1ITPA 3W60A 2E1RA 4B9TA 3BDEA 2MJUA 1U1KA 4YP3A 1JXVA 4OI3A 2YNGA 1M5VC 2QRRA 1VQNS 4DR1F 3ZTQA 3V6KA 2R7OA 2W4CA 3ILOA 4N77A 4ZCMA 3I5BA 2J7UA 3R5AA 1M5OC 2HNYB 4UTGA 4K4YA 5HATA 1U2RA 4QYZJ 4UZCA 3JS9A 3FJ2A 1I1GA 4J9KA 1CULA 3OUYA 3BREA 3AD7C 3FQKA 2I5JB 4RWXA 3RBEA 3N79A 2FVRA 2AIRB 2MZSA 5B0DA 1J5EJ 4QU7A 1HA1A 5B0CA 2XMWA 1WNEA 1DLOB 2DNZA 2RHQB 5KT7A 3KK1B 1SC4B 3KLEB 1Y9OA 3MM7A 1NPKA 4OZNA 4ATNA 2FJWA 1RYSA 1UWAA 4HR2A 1PBUA 2GMLA 3QIPB 2R42A 1JLCB 3HZGA 1PILA 1YJVA 4YOEA 4PWWA 3Q8YA 2JJ4D 5IT9U 3AXMA 2L9WA 3DHXA 2U1AA 4LF5F 2CQDA 2ZITA 4J9SA 2JRSA 1QUVA 1H6KX 1QSSA 4ZP8A 3ENVA 4IDKB 1H2UX 3GIMA 3W9HA 3DYAA 4DPOA 4TVAB 4AYBD 3G4SS 2G4BA 3A4TA 1QE1A 4Y65A 4LFAF 4F4WA 4B3SJ 5K14B 1FK9B 3H40A 3E8OA 4WK1A 2LXFA 4QZVB 2ZC3A 2OIHA 2LQ9A 2R7VA 2ZVSA 4QJVA 1MMDA 3OW2R 4R0JA 2H5JB 2DD8S 1ZOTA 5CYQA 3FDSA 1UETA 1S7HA 1N34F 3KKFA 3RGIA 2KG0A 1QLNA 2XMTA 5AXMA 1X5OA 1UTAA 2D3OR 1FESA 1GTHA 3BN4A 4PCQA 2HQFA 1IBLJ 4C48A 3KFWX 1UMJA 4AXJA 1TKXB 1Q7YT 4IG3A 3PRBA 1DZ5A 5KFQA 3C6TA 4CO1A 4WKYA 2FJXA 4DR2J 3I0SB 4F4YA 2QJ3A 2FC8A 2N82B 2F65A 4WTOB 4E0DA 4B3RJ 2MXYA 2J9DE 2ZUAA 3Q83A 2ZBCA 2QE5A 4LT6A 1VLOA 2MZJA 5KOWA 3I82A 1LOUA 1MNEA 1XNQJ 2I2YA 3CPWR 3WX8A 4MIAA 4PXDA 4ZPDA 1LW0A 2GGPB 2QTWA 3Q8SB 2HRYA 4W98A 3LANA 3DXBA 4LRDA 2W7PA 1NK6A 3AOAA 2GIRA 3RAXA 1X60A 3NL0A 1D9AA 2LLZA 2R7UA 1N5SA 4FNHA 1S99A 5FDLB 2O5DA 3G82B 4CRJA 1LW2A 1HYSA 5CAAA 2KRRA 1VQ9S 2VICA 1IBMF 4AFFA 1E6YB 2FZKB 4J9QA 3PM9A 1PJ5A 3SQGA 3BR9A 2I8EA 4OI6A 2A6OA 2IFXA 1FX2A 2E9TA 2R8JA 1RHUB 1FRIA 3CMAS 2WONA 3IA0A 3TAQA 4UW2A 1VQ4S 4ECVA 1UCNA 3D0GE 2HSEB 3D0HE 4JI7J 1FRXA 1HWJA 1WC4A 1MROB 4HEA9 4DF4A 4OYXA 2DXDA 4C9DA 2J0XA 2LEBA 1YIJS 2NXCA 2J7KA 3S01A 2KKHA 4OLPA 1NO8A 4M5DB 2IM1A 2M8DB 4G1QB 2KXNB 2Y1LB 5C24B 1YZ7A 1DQAA 4HLBA 5KOXA 2ZOFA 1OY9A 2VASA 2ZH2A 3OR1A 2AZ3A 3L7OA 2E9ZA 4OX6A 3KUHA 1JJ2R 2DISA 2F5GA 3RAMA 2Z0GA 1UL3A 5M2PA 4ZK7M 3FFIB 2DHHA 1S9EA 1OQ3A 5F8JA 3FSXA 3H2UB 1JLFA 2EKYA 4MYTA 1YJTA 4NYOA 2CNOB 3CTRA 4DLEA 4IQMA 1D09B 3IS9A 1QSYA 1WEXA 3IM8A 3D1QA 1R3NA 3KJFB 5A0YA 1A7GE 2HIYA 2DPIA 4AXIA 5GAEU 1U26A 3M30A 4NXNF 3DMJB 1SV5A 3KLGA 1GXUA 2R7QA 1R6YA 1EKSA 2QC3A 1VK8A 1X4EA 2K2PA 1FNOA 5JVHQ 1WTFA 1KVIA 1UEKA 2DY1A 2BANB 4J9NA 1XN9A 3H42A 4PG7A 2C2RA 1VRUA 2MB0B 1RP5A 3BO2A 2DR5A 1FWLA 1K47A 3UFCX 3LP2B 3PO5A 2ZJRQ 3AODA 2Z56B 3R6GB 2ASYA 1X7VA 2DNQA 1UW4A 4NE9C 1CJTA 3ZNJ1 4G1PA 1XMBA 1MWQA 3M2VB 2PFDA 4KV8B 4LR8A 4IG0B 1NM2A 3OTCA 4KT0C 2VD3A 2AGPA 4Q8FA 2HMIB 3UVJA 5A8WA 3DRYA 4J9OA 1KHWA 4P2XA 2ZVIA 1M5KC 2H5EA 3NAIA 1OSDA 1SQGA 1U45A 1F5CA 1WORA 1Y7PA 2XNQA 4IRDA 2JDJA 5J1PA 1G1XA 3PTWA 3NCQA 4CO5A 1VRTA 3UR3C 3HULA 5EX3A 4C8KA 4MT1A 1I3OB 1N6QB 4FBUA 3FUYA 2ZJQQ 3HO1A 2HHVA 1M90T 4EEYA 4QWEA 1S0VA 3IXQA 2P8IA 1GFWB 3T19A 3TVKA 3I56S 4J91A 1OS5A 1Y5LB 2DRBA 2WVDA 1MG7A 3DM2A 4CH1A 2W9BA 1S0OA 3KYLA 1A0OB 1T0TV 3MM6B 2OI2A 2IM3A 1R8HA 2Q3PA 3W8PA 4ZP9A 2M8HA 3NBPA 4OJHA 5JXSA 2K06A 3FEXB 1RAOA 4WKRA 4K5RA 3Q8VA 2M9KA 3DFEA 4O44A 3BBFA 3GIRA 4N5SA 4OX9F 2RILA 4WZQA 2V0NA 2CQ0A 1GMWD 3MM9B 1NDCA 5E7OB 5I3QA 3D9BA 4DPTA 1IBCB 3VQTA 3I32A 3QBCA 2HQCA 1FRKA 1U2CA 3X3UA 4DR7F 5DLFA 1RKIA 4CP5A 2QG9B 2RRNA 5B0GA 1YVFA 2CQHA 1HR0J
chains in the Genus database with same CATH topology
1ZZNA 5KFSA 3UCUP 3EZUA 2PEHA 1FJGF 1FDAA 5L1KA 2VKRA 2NSBA 3LGNA 1JK9B 3WC2A 1P9QC 5D4NA 4UQGA 4B9LA 3NS6A 3RZAA 1HBMB 2CVEA 2LQ5A 3CO9A 4WE1B 2ASDA 3IGVA 1FRLA 2F3JA 2N4DA 3SI8A 1RT6A 5HLFA 5KFKA 4DL6A 1RT7A 3V81A 1TL3B 5KFOA 4DHVA 1FCAA 2D41A 3C46A 4I7FB 4QIGA 3M8PA 5SZTA 1U49A 3SXLA 4HDGA 2HGLA 2JHEA 2GCFA 3I9V9 3CJKA 1HFEL 3KNAA 1D9DA 1U09A 4WIIA 5THWA 4ELTA 3AB4B 2GFFA 4XPEA 4ETZA 2VG7B 2Y1IA 3H5XA 5A0YB 5IT9Y 4K2XA 4H4KC 4UY8T 4H4MB 3HKWA 2DVIA 4YB1P 4PXEA 4IH7A 3CSKA 1IXKA 5HI7A 1UJ4A 2NXUA 2VG6A 4IO1A 7FD1A 3M30B 2EBEA 2XSFA 2YNHB 2K8GA 1SV5B 1RTIB 3D5MA 1UVJA 1S77D 4D3HA 3Q2TC 3DRXA 5LT5A 3BO4A 4B9SA 3DRPB 3K5MA 4G6VB 2VFVA 1RT2A 3M9NB 2DPJA 4DL7A 4O4GA 3CD5A 2GQ2A 4KHPF 2YWEA 2HG4A 2R7XA 4W90B 2QV6A 2FLLA 3H20A 1NK4A 1G2EA 3GB0A 1FVSA 1XK8A 2W7AA 4RNFA 2BM1A 1UP1A 3OL6A 1X0FA 4OHZA 4IFVA 1IKVB 2VB6A 3UDCA 1VQ8S 4MAKA 3HHKA 1UVMA 4JV0A 3UWTA 1B0PA 2DNOA 1NHUA 3OFEA 3NMRA 2XY6A 3FZBA 2APOA 2PGCA 3KTQA 1NK5A 4DX8H 1VRUB 4RUHA 2YH1A 1FEEA 2E9RX 3VAMA 2KHDA 5A8KA 4J5OA 1OQ6A 3V6JA 2OMLA 4FVMA 1S9FA 4O4RA 4TYBA 2R7TA 4YOEA 1CQNA 3M6WA 5E2QA 4RW4A 4WFYA 4FBTA 3LALA 1MW7A 4TQRA 2EVZA 1GT8A 2LVWA 3VR1A 1VBXA 4ELVA 4GKJF 1N0UA 3OQ2A 1WD6A 1YJRA 3H8YA 4LIRA 4DV2F 2L9NA 3N6LA 3OVAA 3Q8QB 4EYIB 4F3QA 5KFMA 4ECYA 2RJZA 2IBOA 2IYGA 1MMLA 4NZ0A 4DN9A 2DR7A 5D3GB 1J5EF 1C2PA 1Q53A 4H54A 3MAHA 1S6QA 2KJVA 3E2EA 1S6UA 5B0EA 4ES3A 4LVNP 3CCTA 3GR0A 4NLRA 4QIEA 2B51A 1N52B 2B5JA 4QR0A 2B7BB 2EK6A 3NS5A 1LWEB 4HH0A 3G96A 5LMNF 2ZNYA 5KFDA 3DLLQ 2KTQA 4K50A 2HNDA 5KT5A 4TKTA 4PRFA 1TV6A 1SC6A 1U1OA 3NRBA 4CIOA 2XLKA 4NYPA 4JI3F 3UCGA 4ERDA 4OFZA 4JI2F 4NZ6A 3JAMY 5KFZA 4ZVEA 1NK8A 4X4VA 3LW5C 2ZHAA 4K4TA 2EI5A 2IAJA 3CJ2A 3T1AA 1S48A 4ED7A 3OPKA 2JEIA 3M2RB 1Z2LA 3RAQA 3UPFA 1CVJA 3CIZA 3MD3A 3M8QA 2YKPA 3FNNA 2YNGB 3HFKA 2AGOA 4KTQA 1JLEA 2JH3A 4CNZA 2L08A 3MECB 3Q8RB 3HXMA 4RU2A 2FJEB 1DTTB 1T3OA 4PUOA 5CCMA 1KONA 2JOQA 3ZZRA 1SH2A 2P9CA 3OTBA 4ETXA 2FVQA 4KJIA 1FTRA 4EBCA 2KXHA 3KG4A 4XPCA 4IUFA 4DV6F 3OFGA 1C4AA 3MM8B 4A8FA 3CIMA 1CC7A 4O3NA 3BJYA 2B9XA 4V19J 2QIFA 1FDBA 5GAGI 2M0GB 3VQSA 3VAIA 2OSQA 3J7Z5 4LSLA 4ZDNA 2IVMA 3DLKA 3L7PA 1RISA 2PA3A 4FF2A 4DUYF 2V4QA 1VRTB 1RGVA 1SXLA 4LFCF 2VFUA 4U9RA 4ZP7A 3KG0A 4MYUA 5KFRA 3OR2A 3OLAA 3SZ2A 2UVUA 5IM0A 2D9PA 4PQUA 2L3MA 5H9EJ 4EWTA 4LQ3A 3CT9A 4EFAC 3M6UA 2MQPA 2CPIA 1BQNA 5K5MA 5BYQA 1TVRA 2ROGA 1MMNA 4XDDA 4L72B 4MK7A 2ZH8A 4AUKA 4B3SF 3QAEA 2ZNZA 1IQTA 4ECTA 2J6UA 1ZBTA 4NLUA 3OUYB 3G8TA 2HYIB 4O23A 3F41A 2WBRA 4TQSA 3EXCX 5D4LA 1R8AA 2F9DA 2VG5A 3DU6A 1U2FA 2OLWA 4X4PA 1U1NA 2HIQA 1HBUA 2KZMA 4HH1A 3ZZ0A 2VKZG 2W9BB 3NG8A 4WFBQ 1L5UA 1XR7A 2AX1A 2VC0A 1Q7LB 2CZ4A 1VQSA 4I2PB 3CJ3A 3R3TA 3PW2A 3OTEA 2M5YA 2YWHA 5KFNA 2PD1A 1KOHA 3P96A 5E33A 2GW8A 2KYXA 3M4XA 5FD1A 1T03B 1HWLA 5ADZA 2YKAA 1FJCA 1H2TZ 2RQMA 3OBIA 3PEHA 3I5AA 3MHYA 1HPZB 2HNYA 2M7SA 1SKRA 2ILYA 1GXLA 4JI4F 4YY3F 2K3IA 1QAIA 1HNIB 1Y5IB 2BXJA 5KFYA 3CD6S 1IKYA 3AJ1A 1KD1T 3V4IA 1FDDA 2WK4A 1T7PA 1TFYA 2ZUGA 2XGQA 3H4DA 3MM7B 4C3MA 3GZ7A 5C42B 3TUZC 2AWZA 3PACA 4QW8A 4R8UA 4B9VA 3KK2A 2VBWA 4UQTA 4OLOA 3LO3A 4I0WA 1UVKA 5AE1A 3QGPA 2MKCA 4I6WA 4M94A 3GG0A 2ROPA 2B7CB 4DFKA 5I42A 1X4CA 3K57A 4K4UA 1ZETA 4LSNB 2RS8A 3MMBB 4P7TA 2FIUA 2J0QD 2DHXA 1YBAA 2DGOA 2MSTA 1RA6A 3G6YA 2G1DA 1DBDA 4L3NA 2I5JA 3H5YA 2DO4A 2ZH5A 3D54A 1DJ0A 3IG1A 4CTAB 1TKTB 1UVNA 2ZOMA 2RH3A 4FYDA 1RK8A 1KLMA 3BZQA 2DIUA 4KRWA 2IJFA 4TU7A 2E5LF 1FXDA 4DR2F 2EG1A 4TYAA 1R8BA 2VOPA 2XY7A 1KQSR 4XIUA 1ZM3A 1DQ8A 3K2YA 2BVZA 3LQVA 2MZ1A 2E1MC 2B6AB 2HS3A 3DI6B 4O0IA 1HD1A 4OI1A 4OHYA 1LWCB 2K1RA 3HKZD 3Q23A 4B3RF 3QYYA 1WHYA 2P9EA 1WF0A 5T41A 4C97A 1Y3JA 3KK1A 1XMOF 2A1BA 3JSBA 4WFZA 2F8HA 3KLEA 3OJUA 2OPRA 2FHMA 4PKDB 3TO8A 3UQSA 4J37A 1VHFA 5A8RB 1VI7A 3E01A 4HYKA 2CJAA 1RT6B 2AJ4A 3DRSA 1RT5B 1RT7B 2MKHA 2QA2A 4RW7A 2N3OA 4J9LA 4KFBB 3TUJC 5H1SV 2E7XA 2HQIA 2ZJPQ 2XCPA 2PE8A 2JZ5A 2VC1A 3O44A 4KIAA 4DV7F 1N0VC 1SQEA 3I96A 4X65F 2XBPA 4B9NA 2OKQA 1VMBA 3POTB 4LF7F 4P2SA 2OP5A 3FMWA 5IS2A 2JLEA 2RU9A 3G6ES 4DL5A 2F7VA 2GHPA 3T6JA 2MYFA 2QLXA 1KC8T 4MK8A 3AHPA 3G71S 1O51A 2XZWA 5IWAF 3K5OA 1IR0A 1N5YA 1N5TA 3TAMA 1OSCA 1T05B 4C8ZA 2MPUA 3K8VA 3OFFA 4PPDA 1HNVA 2I1RA 1G3OA 4DL3A 3OJSA 5CA5A 3R5CA 2KZZA 2FD2A 3QGGA 3PW5A 1RT2B 2MHEA 1U7LA 3ITHB 2B4VA 3T1HF 2CFXA 3M1VB 2AX0A 5KG7A 4FVCA 1N5QA 2OH2A 3LWMA 3N6NA 5AXLA 2RE1A 3GV8B 3LAMA 5CYQB 4XDCA 4BWJA 5DM7Q 1LXJA 3IC1A 3UW1A 5EX0A 4RU9A 5HP1A 1VBZA 1JJHA 4IFVB 4IDKA 4PPZA 3W2WA 5KFLA 2N7CA 2KXFA 3SSQA 3O3LA 2IC3A 6FDRA 3T5KA 4UUXA 3OL8A 5D6GA 2AU0A 1TK8A 1U1RA 4JI1F 2DR9A 1TKDA 1RWUA 2CQ1A 1ZAVA 2XSJB 3KJVA 1S49A 4DSFA 2UZAA 3HLUA 4CZCA 3OL7A 2IM0A 4EBDA 2HVHA 2QSWA 4A8XA 1NKBA 5K14A 3MR6A 4ID8A 4LF4F 1IJEB 2N4CA 1FK9A 1V3RA 3P3DA 1HMVB 2VL1A 2W4DA 3TX8A 5J2PB 5DETA 4LUBA 3QWPA 2O1PA 4MIWA 4ZOSA 4BWMA 1RI7A 5HROA 3OXGA 3RR8A 4MMOA 1C1BA 2E5IA 4NLOA 3DOKA 1RJJA 4F3OA 5GAHU 4H4OA 1F5AA 4IOBA 5MLCV 3C6TB 5K8OA 3MEKA 2GMHA 4A8YA 1KLNA 4N56A 3UD4P 1TQLA 1ZM4A 3C8YA 3WBZA 4YR2A 2AV5A 4JI7F 5BYRA 3BM7A 3LGMA 2VFSA 1UFWA 4B9UA 2DITA 1CC8A 1HI8A 3EYZA 1RT1A 2XO7A 1VC6A 3RYLA 3OXLA 3T5HA 4WJBA 1R43A 2B9WA 3MEEA 1URRA 1QAXA 2HNDB 5KFHA 3ENQA 1TV6B 2J76E 4OJ1A 4C3LA 5IT4A 3J7ZT 3H25A 2FLOA 4DBQA 2VH7A 1FEHA 3MXHP 3KLHA 4ECUA 1HQEA 3THPA 3V6DB 3AJ2A 5KG6A 3CDAA 4DQQA 3TVZA 2KFNA 2KI2A 4XK8C 2D7SA 2OPQA 3BDPA 4C0BA 3J81Y 3HX9A 2PO4A 1LW0B 3M8QB 4WZMA 3M32A 4HKQA 1TKXA 3DLJA 1ZM9A 2PI5A 4PWDA 3CJ0A 2X51A 5J2MA 4BS2A 2CYYA 1S6PB 5DRKA 4QIVA 4F4XA 2J9DA 2JFKA 2QFJA 4OZ5A 2J7WA 3P6YC 1KS2A 3SCIE 1BQXA 4YMEA 5LJ5Y 4ECWA 5D4OA 2AJ1A 2ZZNA 3B4MA 2W7OA 2VBYA 5G0RA 3I4HX 3HVTB 1OO0B 3IRXA 3I0SA 2ZOGA 1S1UA 1SL2A 1A6LA 2CPDA 4NRUA 5U47A 5DQHA 3CMES 3FVYA 4LSLB 4AE5A 3BQ1A 1V3SA 1FF2A 3MOJB 4ZHRA 3PDNA 4NX9A 1JNRB 5CYMB 5E3PA 1ZAXA 3BF4A 3KK3A 1YSJA 1HYSB 1F60B 1LW2B 4PG4A 3TA2A 3PXGa 3MMCB 3DNCA 5H9FJ 3PHEA 4A8KA 4RW8B 1HBOA 3BR8A 2EPIA 1L3KA 2YKNB 4DMZA 2UXDF 2K7JA 4I64A 1BQMB 1L3VA 3JSYA 4R5PA 1TVRB 5JUMA 3HHEA 2D9OA 3MPYA 5LSLA 1FE4A 3EPIA 1M1KT 4ZCKA 3GMGA 5D78A 2E5JA 2GGPA 2AP6A 3R27A 2FVPA 3MGJA 3SQGB 1RT3B 3HZEA 3MFIA 1FRMA 1CQMA 5T14A 3Q8PB 2X1GA 3D0IE 3GR1A 4C8NA 5MAOA 4ZPVR 2DO0A 3D2WA 2K7KA 4XAKA 2DNMA 1ZTTA 2X1BA 3I6PA 2FHJA 4KGMA 4IR1A 4FF1A 3TR5A 3CD7A 3I0RA 4Q8EA 2YKMB 2AJQA 3FRYA 2F8MA 1O8BA 2WONB 5C25A 2ZH6A 3K5PA 5LJ3Y 4IR9A 2YWFA 2PIIA 2GC8A 4F26A 2CQBA 2X3GA 3OSPA 1S1TA 1TZ0A 1VOMA 1A9NB 2NQPA 2CPHA 2FTRA 4JI0F 4LFBF 1JXEA 3FRZA 3CCQS 2DHSA 5FDLA 1VLYA 1HW9A 2BDPA 4OHVA 1S1XA 1NK0A 5KFBA 1IKYB 4IOCQ 4ZVFA 1EP4A 1DQ9A 2LQBA 1SJFA 4OI4A 1T94A 4ZCLA 1Z1ZA 5G4DA 1VC0A 1NH8A 2B4OA 4QR1A 4YQWA 2CG4A 3OHBA 3F44A 1TKZA 2RUGA 3K5LA 4CO4A 1E6YA 1N54B 2KJWA 5LL6d 1YJUA 2ZH9A 4EO8A 5EWFA 3MEDA 2KM8C 2LDYA 3S6EA 5A6WA 3CDEA 2VV5A 2OSRA 2CQPA 3D1OA 4C11A 1ZPWX 4C0OC 1NKCA 5FIIA 1KEKA 1SJ4P 2IA0A 3O6QA 2XMMA 2XWYA 5KFAA 2F8EX 3LP0B 3FSIA 2PFFB 4Y00A 1N33F 2KG1A 5L39A 5FLXY 2CRLA 1U1QA 2V8VA 2FGOA 3JSRA 2IRUA 2O01C 1RQ0A 5DG8A 3QGHA 2VPYB 4UOCA 2IM2A 3OR1B