2FTRA

Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
ENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0200
publication title Crystal structure of (10172812) from BACILLUS HALODURANS at 1.40 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Unknown function
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07110 EthD EthD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ftrA00
2RILA 4YDXA 3TNVA 3T9NA 2XMKA 2GV1A 3BDEA 2LDIA 3F44A 2AP6A 4OIXA 2XMMA 1N5TA 1MWZA 1Y0HA 3LGNA 2OFHX 4OJGA 1KVJA 2HIQA 5T7LB 2K1RB 1Y9OA 2GA7A 3CJKB 1N5VA 2OD4A 3I9ZA 2XMUA 3MZIA 2N4CA 1LQ9A 4OJ3A 5B0FA 1K0VA 3BR8A 3KNGA 2BBEA 3KKFA 1SQEA 2IYIA 5F0UA 3BF4A 4QOTA 3BGUA 1U7LA 3MCSA 2BYCA 1Y3JA 2GO8A 4FNIA 3BB5A 2ZDOA 4HH1A 1YJVA 5B0CA 2HLUA 4DPOA 1OQ3A 1JWWA 2N4DA 4DN9A 1AFIA 3UDCA 3HHLB 5B0AA 1OQ6A 1KQKA 2ZDPA 1X8DA 4Q2LA 5A6PA 1FESA 2FB0A 3E8OA 5B0DA 1N5SA 5A6WA 1RJJA 4HI1A 1OSDA 1APSA 2VV5A 2K2PA 3KG0A 1X7VA 3QMQA 3FMBA 2OKQA 2AJ0A 1GXUA 2G9OA 2QLXA 4EFAC 1QUPA 1Q53A 4NL5A 1Q4RA 2W4CA 1MWYA 2EW9A 2BUNA 2GGPA 2IYGA 1S6OA 1TZ0A 1Q8BA 2PGCA 2ROEA 2HQIA 1AFJA 1JK9B 3HX9A 1FE4A 2XMJA 5IXUA 2ROPA 3IWXA 2FIUA 2OD6A 4A4JA 4NPOA 2QLWA 1CC7A 5T7LA 3TOQA 2K1RA 2KT2A 4HL9A 2VH7A 2LXFA 4U9RA 4Y2MA 5F0WA 5KAKA 5B0BA 2CRLA 4Y2KA 2XMVA 2FTRA 2JDJA 1SB6A 2OMOA 2L3MA 1VQYA 2RU9A 1OPZA 2ROGA 2W4DA 3DCAA 3HF5A 3DXSX 1XBWA 2KT3A 4Y2IA 1GXTA 1TL5A 2HLTA 3VTIA 1IUJA 2BJEA 1WD6A 2GFFA 3FRYA 2BJDA 1ULRA 1YJUA 1R6YA 1TR0A 2OAUA 3QGPA 1FVSA 3HFKA 1FVQA 5B09A 2KKHA 1FD8A 2K7JA 1KVIA 2N7YA 1Y3KA 1X0PA 2ACYA 1FE0A 2HFOA 3HHLD 4YEAA 1CPZA 2AW0A 2GCFA 4ZOSA 2QIFA 2OFGX 1SI9A 1N5QA 2W4PA 3BN7A 3IWLA 2K7KA 4A48A 2GGPB 2HFNA 4FNHA 2XMTA 1YG0A 2RSQA 4OJ1A 3CJKA 5B08A 5K9FA 1YJTA 1AW0A 3LO3A 4A47A 1V3ZA 4ZA1A 1W2IA 2OP5A 2Q3PA 1CC8A 1Q8LA 4HI2A 2AJ1A 1VQSA 2FHMA 4DL0C 3FGVA 1FEEA 2IFXA 1P6TA 4HH0A 5B0GA 2LQBA 4Q2MA 1TUVA 1URRA 4A46A 1P8GA 1YRXA 3K7RA 1YJRA 3GZ7A 3HHLC 5B0EA 3BM7A 3WDOA 3HDSA 3LGMA 1TL4A 1S6UA 2ASYA 2RMLA 2XMWA 3KG1A 3HHLA 3TRGA 2KYZA 2LQ9A 4OJHA 2PD1A 4F67A 2QYCA
chains in the Genus database with same CATH superfamily
4WFZA 1NJIT 3UD4P 3AOCA 2HHUA 3QO9B 4YR0A 4ECQA 2K8GA 2DRDA 2ZHBA 3BBCA 4OYAA 3KHHA 1N8RT 4PQUA 3R5BA 1DQ8A 2IA0A 4W4MA 1YJVA 5E3AA 4U95A 1XC9A 3H2VE 5KFZA 3T6BA 4R0EA 2J9DA 4KGKA 2K3KA 4FYVB 4JV5F 1LWCA 4DDFA 1HR0J 2CJAA 1WNEA 3OHBA 4I67A 3TJ9A 3CO9A 2KT3A 2IBOA 4CO4A 1TR0A 3DGPB 2MMYA 1S48A 2VDIA 1VQKS 3KMQA 4CDIA 3NEKA 2CKWA 3MCMA 1Q8KA 1RACB 4IR9A 2XI3A 2VODA 2RU3A 1OJ4A 5DDQC 3AODA 5DLFA 4LVNP 2YWGA 4ECUA 2EEYA 3HHLA 2IAJB 2OIHA 3J7A1 4IQMA 4ELTA 2K1RB 1WC6A 2DHXA 3GFZA 1X5TA 3UCZP 1F2GA 5L38A 5HJYA 2PI4A 2RDJA 1GAOA 5G0RA 1JLGA 1FWLA 1LWXA 1RJJA 2CQ2A 3LALA 2L9DA 4G65A 3RB3A 1NPKA 2GGPA 2MB0B 1RAEB 4DMZA 3HP6A 1TTHB 2LEAA 3OJUA 3NNAA 2BA9A 3G6VA 4Y2MA 2OPRA 3SMZA 4EI2A 1SQFA 4Y2IA 5IFMA 1T02A 1DTQB 3PR4A 4LREA 4WCEQ 3AOAA 1NEEA 1WC3A 4DZ6A 4X2BA 4V19X 2F7VA 2GJ2A 4K5SA 4DLGA 3N6NA 1Y7PA 2ZUAA 4NXMF 3EUNA 3M8YA 4WFNQ 2VFRA 3CIMA 1H6KX 3MM7B 4A8QA 2N4CA 4KB7A 2IYIA 4JI7J 3FBFA 1XMQF 1TQLA 3H20A 4HH1A 4EU0A 2DGUA 4PXEA 3T3FA 3N6MA 3H5YA 2XS7A 4NCGA 1GXUA 5JUMA 5I3UA 3ZZRA 3T19A 4U7UD 4AFFA 3KTQA 3BN4A 3MM9A 2DIUA 4OZ5A 2HBQB 3AJ1A 3QT8A 5HJXA 2HHHF 2E5JA 4USHA 4MMOA 5KFFA 4RLEA 1BQNB 4H4MA 4DFMA 2QV6A 5CYQB 1ZAXA 3R8YA 1L3SA 4PAAA 1AROP 2EFOA 1Q8LA 3C16B 4RBTA 3WIUA 3TANA 3WDOA 2XO7A 2BM1A 2ADBA 1Q78A 2EFQA 4YR3A 1B3TA 2V94A 2Q1LA 3NNHA 4JYAF 3RYLA 1XN9A 2D9PA 2VG6A 2JEGA 1VQPS 1PC5A 2EBGA 4ER8A 2W2QP 2FD2A 5LSOA 2DNKA 5B0AA 3DLGA 1U2RA 3ZZUA 2KDOA 4OI4A 5B0DA 3DDNA 1D3WA 2BABA 2FHJD 4EFAC 3HFVA 1HNWJ 1IBLJ 4K4SA 4K4ZA 3FQLA 5I4MA 4ZCIA 2GC8A 5KT4A 4KV8A 2KVIA 2OMOA 3DRPA 3R5GA 5BYRA 3FEZA 1NJWA 1FJGF 3Q8SB 4F4XA 1T03A 2VHGA 1RT1A 2YKOA 2CDQA 1Q95G 5KFAA 1Q1KA 4F0MA 1HYSA 2Y0BB 4B3OB 4ZN1A 4RX6A 2CPDA 5B08A 2C2RA 4ZA1A 2WSCC 2V2ZA 3OFHA 3K89A 1URRA 1UTAA 2B6AB 1LNQA 4IOBA 4E2FB 1XERA 2ZE2A 4DSKA 1XWLA 4CP5A 4G3IA 4F2RA 3H8YA 3M8SA 3CSKA 2CJ9A 4O3NA 3GJRB 4FPIA 4O44B 1N5VA 2OD4A 2ZBCA 5IC6B 5D0HA 2RB7A 2MHNA 3W8PA 3OSPA 3OFEA 3UVJB 3DRYA 3RBZA 2FUG9 2WVEA 5HVHA 1UZDA 1FKPB 2MDAA 3L95X 2QMUB 3CJ8A 3JTPA 2ZOGA 1APSA 2V8GA 1UAWA 3H5SA 2R3VA 3ULHA 5HMXA 4XDDA 2HHVA 3MAQA 2LEPA 1JK9B 3M9NB 3K5MA 2ZFHA 3M1VA 4DV6F 2HNDB 1FKOA 4PUOA 4F8RA 3T1HJ 3C66A 4KHMA 1LXJA 1RT3B 4QU6A 3H4BA 2RIJA 1RLCL 2MEWA 3OTCA 4N5SA 3L09A 1HI8A 3HZEA 3MEDA 1GMWD 1FT8A 2CQHA 1P6TA 2IFXA 4ILRA 1B7FA 1Q82T 1SL1A 1VLYA 5LM7E 2LQ9A 3QJLA 1TKZB 3JAMU 4JV2A 3MM5B 3OV7A 2V5HG 1YK9A 3BQ2A 1RTHB 1A6LA 1QAIA 4KT0C 2XY5A 2GQCA 1Z1ZA 2BXJA 1CJUB 2YXLA 4UQTA 3RGIA 4ED8A 4Q45A 1UCNA 1KS2A 1XNRJ 5CH7B 1WG1A 4HTIA 3AXKA 3RAMA 4LJMA 4FXVA 4DV5J 3JTNA 1SKSA 5CAAA 4KFBB 2VBZA 1X7VA 5KG0A 4M63A 3J7AN 2KN4A 4I56A 4ZPWR 2FIUA 2JFKA 4DSJA 1FDAA 5HP1B 2KT2A 4ECZA 2JEJA 1BMQB 4ZN3A 2EFNA 4OHWA 3FRYA 3QGPA 2WBRA 1WKLA 3SQOP 3ZXWA 5C25A 4LSZB 2AYBA 2BEFA 3GG1A 2YTCA 5E33A 1OYDA 3PJWA 2H5IB 3FFIB 3HVTB 4USWA 2W9BA 5F9LA 2KXNB 2NUHA 4NZ0A 3M6VA 2AJFE 3CJ5A 1P8GA 2XY6A 3FVYA 2SXLA 8RUCA 2YWKA 2DNOA 5DDOC 2CFXA 2IBKA 3KKFA 1NBEB 1WOOA 1VQ9S 1C0TB 1RBOB 2QA4S 1IM4A 2UV8A 3MR2A 3E3XA 1S9GB 2H4YB 4KQZA 3KLFB 5HI7A 1S6QA 3VAGA 1S9EA 2MKHA 2BR0A 3HM9A 1S59A 2DK2A 2AJ2A 1D8ZA 4NLGA 3R1LA 2B9EA 2AGQA 2AYMA 2XI2A 1CJTA 2H51B 3I5CA 5HO4A 4FXWA 1OPZA 2W8LA 2GQQA 1QY7A 2CQIA 5THWA 4YB7A 1HD0A 4X4QA 2AU0A 4B02A 4Q0BA 4W98A 3O6QA 2WK4A 3D3BJ 3DI6A 3MEEA 1J2VA 1SKWA 1WUUA 3DRSB 3OVBA 1SUQA 1TKTA 4QWEA 4MAKA 3MUVP 3I55S 3BH7B 5D4LA 4XDCA 1MG7A 1HNWF 3KUEA 1ZZNA 1RT7B 4GVBB 1IBMJ 1KQGB 1TKXB 2F9JA 2EFPA 3CDEA 2XSJB 4Y65A 3FSIA 2BQ3A 2EFVA 4YR2A 2P9EA 1RHRB 3C14A 2MPUA 1O8BA 2KT5A 4URGA 5HANA 2LDYA 1S1UA 4CCHA 1WJ9A 5HATA 1WI8A 3VVUA 5K20B 3J81j 5LMNF 9RUBA 1V9OA 4NLQA 3N79A 3SCIE 1JLQB 1NNDA 4EWTA 1KHVA 1KQFB 3ZTSA 3S6EA 5ETOA 3RBXA 5KG2A 2JDJA 5A2QY 1RB0A 4C2MA 1TL7B 4C11A 2WBMA 1NK8A 1SC4B 1MW7A 3DXBA 2DRAA 1IUJA 2XB2D 2JZ5A 1OPIA 1ICEB 5KFKA 3D1QA 1GH8A 1VS3A 1HBMB 3T1AA 4DPYA 1RT5A 3PEJA 3I56S 1IKYB 1X0FA 2M7SA 1X4BA 3W9HA 3GJSB 4M5KA 5J2MB 4KAIA 4MFBB 3FGVA 3IN5A 1TUVA 2OPQB 1M1KT 3NAHA 1M5HA 2CPFA 2X1FA 4L3NA 4USKA 2HBRB 4HDGA 1BQMA 2IM3A 4LF8J 2VC0A 4Z7CA 2JJ4D 1JLFB 3M4XA 2OLWA 2YPYA 4K4VA 3NWGA 4YY3J 1WHVA 3QLHA 4CTAA 1B0TA 1VK3A 5CZVA 2RQMA 3LP1B 1FERA 5JJBA 1VRTB 4WZMA 2AYGA 2AYEA 3ZO7A 2W4CA 4HL9A 1P9YA 4RW7B 1OWXA 3CCQS 2PO4A 1HNIA 5IZHA 1WDTA 1FVSA 1RHQB 3C6UA 2P5VA 3H42A 4ECWA 4IDKB 1RHKB 4IG0B 3US5A 3HJFA 2RT3A 3OPKA 5IQ6A 1N36F 4DV5F 3P49B 4C8KA 5ITHA 5B0GA 3RU0A 4XTTA 3F0NA 3AD9C 1KVKA 2R42A 2KRBA 2YWFA 3I31A 2R8HA 3DLEA 1D8YA 4UY85 1FF2A 2L41A 2DHHA 1M1HA 3MCNA 3KNGA 4N41A 4RW9B 4CO5A 3J7YU 1S0VA 5CZXA 4IG3A 2P8IA 4H4OB 3H2LA 1S57A 2NXJA 4A8XA 4ELUA 4WBFA 4PQAA 4Q7AA 1NSKL 3V6JA 1RADB 5MLCV 2EWHA 3TWZA 1U25A 1LW2B 3VAFA 3D2WA 3DOLA 3HVRA 5EX3A 1EQ0A 2D3ZA 4DL7A 3J7YI 4WTOB 2GVDA 2W4DA 4IFVB 3PKMA 5HBMB 3QGGA 2XHWA 2DIVA 1ULRA 3MUMP 2PFFB 2MZSA 4ZPBA 5IM0A 4ES2A 3LH2S 3J80Y 2R9LA 1WWHA 4YMEA 2E7XA 1RAIB 5K8PA 1WHWA 3CT9A 1SV5B 5HMYA 1NSQA 2AJQA 2NS1B 1K47A 2DH8A 2DT9A 2YNHB 2C2MB 3IXQA 2HIQA 3G8QA 1H38A 2I6WA 1NU4A 1OY6A 1CS4B 5FIIA 1G1XA 3IR7B 4NX9A 3SQGB 3UN3A 4FF4A 4BDPA 3IR5B 1F9HA 3EZOA 4HDHA 2DNHA 2GHPA 3TUZC 5KG1A 3R5CA 3CUNA 4ED3A 4LR9A 1YBAA 3CJTA 1IBMF 1NK4A 4BCAA 5J2QA 2O5DA 5KT6A 1PJ5A 1NM2A 5ETKA 4CO2A 4ANEA 1HHSA 4ZKAA 4F4ZA 3VALA 3V6DB 4CO3A 4FKYA 1B4SA 3N01A 2QL7B 4ECXA 2VPWB 3NGSA 3M8ZA 1JQGA 1HBOB 1DAXA 2LXUA 3GSIA 5K8OA 3A3PB 1MROA 1C1BA 3GP9A 2KU7A 3A8KA 4FKXA 3BBBA 1IVZA 3OR2B 1ZM3A 4NLTA 3MDFA 3BQ0A 2NYHA 3MCOA 5FLXY 4DV7J 4DX6A 2CDRB 4AXIA 1NDPA 3LUYA 3W8GA 5A76A 2DNRA 4HT7A 4QWAA 1TV6A 3AQPA 3BR8A 1DFDA 3CVKA 2YWEA 3LP2B 4IR1A 1HIYA 2HHSA 3H5UA 2CPEA 1I51B 2NXCA 1EIYB 1OSDA 3DYAA 1U49A 2D9OA 4ED4A 4ECTA 1J5OB 1Q7LB 3RAQA 4LUBA 2VG5A 2XMJA 5D0GA 5F8LA 3NOGA 1SB6A 3C19A 3I87A 4LF8F 3TAMA 5HQMA 2RQ4A 5JMNA 2VA2A 3CWJA 2OELA 4RNOA 2YKMA 1VK8A 3BEGB 3HHNB 2R4FA 4ZHRA 1DBDA 2MZRA 4ZVEA 2J6SA 3HMJG 3ILJA 2RNEA 4YY3F 4HACB 3GFXA 1SH3A 3M7VA 3TEGA 4J9QA 1TU0B 2H5EA 3QNWB 1TL4A 4C97A 4K4TA 3BDPA 1RK8A 2RILA 4YDXA 1C4AA 2ADCA 1K0TA 3Q8PB 4B3MJ 3W2VB 4MT1A 3OUYA 2RE1A 3AAWB 1LQ9A 2B4PA 3I82A 1H7WA 8ATCB 1U7LA 3OT9A 1QUVA 2MZQA 2B0GA 2X1AA 3EZ5A 3G96A 2B5JB 2ZBIA 4B3SJ 2YQ3A 4IH5A 3W2WA 3CGIA 1T05A 4F04B 1PO6A 2R8KA 3Q2TC 3B8HA 5KG7A 5ETLA 5EN1A 4ZMMA 1QM9A 4DU7A 2XS2A 1WF1A 4HYKA 3U27A 1CQMA 4OZLA 3ITHA 4PWUA 4G1QA 5CCMA 4LIRA 3V6HA 4F4AA 1MWQA 2RF2A 4KR0B 1RWMB 3VAKA 2I2YA 2DNYA 2ZH5A 3DDIA 2YPZA 4Q5VA 3IR6B 3EGNA 4CH1A 1VQLS 3B54A 1EETA 4DV0J 1ZM4A 2ZKTA 2DGSA 2DEJA 3FNNA 3GZ7A 4M8LA 4M5JA 5DQGA 3QMQA 4V1Ak 5J2NA 2JNJA 5F3ZA 2A0FB 5IT9Y 2W7PA 3M32B 3PW7A 3BSOA 4GMKA 3IAS9 2MTLA 4LFAJ 2HNYA 1RTIA 1JLEA 1VBYA 2CPZA 5KT3A 4L73A 1DURA 3DOMB 3M2UB 3MPYA 1NCLA 3QYYA 4M5GA 2QL9B 3VR1A 2MKSA 1S6PB 2Y1IA 1GQEA 3RBDA 1MWYA 2HWTA 3GIRA 1JX4A 3GV8B 1E6VA 4ICLA 4Y2KA 4DUTA 1O51A 5KFWA 4ZLNA 2QT7A 8AT1B 1N34J 2WVCA 2UVUA 1J5EF 5BYQA 1CPZA 1IBCB 3IBCB 2XMTA 5FDLB 3MMBB 4NRUA 5KFUA 3SSSA 1U09A 3NOCA 1MMLA 4I69A 1Q79A 2RMLA 1LWEA 2QYCA 2KG0A 1S12A 4FPRA 2HQGA 2MQ8A 2Y9HA 1S4EA 3MM6A 5KFVA 4ID5A 4OZJA 5F0UA 1C1CB 1HBNB 4ES3A 4RUBA 1YKWA 4C8OA 4QR0A 3SDEB 4DN9A 3UDCA 4DCOB 2NXEA 3MMAB 3RR8A 3CCZA 3ET6A 1GX6A 2BKNA 2MQMA 5BR8J 1FTCA 2XZDB 3K2YA 4NL5A 5KOXA 2JHEA 2D7SA 3M2VB 3DLLQ 3KWMA 5CXTA 2BJEA 3F73A 2N3LA 3I0RA 3SCLE 1R31A 2MKKA 2V50A 1KLMA 3HJVA 1CC8A 3PY8A 3AY0A 2UVWA 3MD3A 2J0SD 3HKWA 5L8RC 1VI7A 3K5LA 2C2OB 4AXJA 4USTA 1FRIA 3GWCA 2LDIA 1CJKA 5L9NA 3G8SA 3TJAA 2XMUA 2ZEJA 2QA1A 2DNZA 3PCOB 2W2OP 1NDLA 4WJBA 3BO4A 3A3OB 1OIAA 3TQ1A 3L7UA 1JWWA 5HLFA 3NGDA 2KM8B 3D6TB 3TI0A 3I32A 3ICLA 3UNYA 3UI3A 1JNRB 4M5LA 2B7CB 3CJRA 2VOPA 3MWBA 1B64A 1EARA 4C48A 1VR6A 2BJDA 2UV8G 3KLEA 3TJ8A 1XJWB 2HNZB 3ZNUA 3IS9A 1YRTA 4B3SF 4DU8A 2IVMA 2DEIA 2H48B 2PA3A 1TELA 1KKHA 3DDKA 4NLPA 2B56A 4S0MA 4J9OA 1FDBA 1P1LA 1UJ5A 3A1YG 1R0BG 4DN0A 4CM0A 2IPOB 5E0OA 2VQEJ 3AD8C 2XMMA 2OJ3A 3SIPB 3AA9A 2J6TA 2JEIA 2ERRA 2QSFA 2JSXA 3FCVA 4LF7J 2DVIA 1KQSR 2C2KB 1I5OB 3EMTA 4YS2A 3EE3A 4CLUA 2PIIA 3CW2C 4DV0F 4IYQA 1FXLA 3IAM9 4WP3A 4LSNA 2VB6A 2HMIB 3D54A 2R2SA 3IP0A 1RWVB 3AQOA 3LW5C 3R5DA 1XR5A 1NJYA 4WPAA 1CULB 1UMJA 1T9UA 4AQYJ 1VBXA 1WF0A 2XULA 3M9OB 1B99A 1S1TA 1UW9A 4KHPF 1V3ZA 4EK2A 4X65J 4HT5A 2G2ZA 2QG9B 3KG4A 1H2UX 4ED7A 3ZZ0A 1YX2A 4QIVA 3VQSA 3TRGA 4KRWA 1X4DA 2CG8A 4N8NA 4A8WA 4NYZA 1HWLA 2PMWA 1K9MT 3JS9A 1BWVA 3NP5A 2YX7A 1IBKJ 4CO1A 1HD1A 2E7WA 1PYSB 1ZAWA 1N34F 4ECSA 2RJZA 5M2PA 1B7YB 4WK3A 3L3CA 1YHQS 3CF5Q 2AMCB 4AL6A 4RW6A 3DGPA 4B3RJ 5A6WA 2E5LJ 3FMBA 2XSFA 4HEA9 4UY8T 1JKHB 1TMMA 1VDHA 3SSRA 4DG1B 1Q86T 1AFJA 3W7BA 4MTPA 5F0WA 3GYGA 2B9WA 4JI5J 2P6TA 2RS2A 2FHJA 4GC6A 2R7WA 5I3PA 4LBHA 3QRPA 2NXNA 4OZNA 3TW0A 4I2QA 1HWJA 1HQ2A 2RH3A 3PYDA 3GR0A 4NA1A 3HI9A 2Z58B 3HHEA 5GADI 2HFVA 1U8WA 4MJKA 4GO5X 7FD1A 3LPEA 2XLIA 1SCJB 4NI2B 1U4BA 2FYXA 3NWRA 4R5PB 2MQPA 1B70B 3TX0A 3GPAA 4DLEA 2VC1A 2WOMA 3M8PA 2V4JB 3VWSA 5A8WB 2E7VA 2KTQA 2MXYA 1CEZA 1XEZA 3QZ8A 2BRKA 4ZVGA 3OLAA 1M5SA 4H4KA 3P96A 1DTQA 4LSLB 3FRZA 1ZH5A 1GXLA 1N4LA 2KH9A 1HQEB 3S01A 4PZVA 5M2RA 3DOKB 1REGX 5DRKA 2AEMA 4LBPA 4EYHB 1HPZB 2L9NA 1DLOB 2ACYA 1RCOB 1D9DA 3EICA 2KRRA 2HRTA 3EGVA 1Q0NA 3MM7A 1UVLA 3NNCA 1X4AA 3P3DA 3BKUA 2XO6A 3HO1A 2AX0A 3F56A 4F3MA 4JI3J 1QE1B 1WEZA 4DF4A 1HMVB 2FVQA 3KK1B 5J2PB 3BR9A 5L39A 4USJC 3T5JA 2E1AA 4RKUC 1RSCA 2VPZB 3MECB 3R2CJ 3MEGB 3W5ZA 3TZYA 2R2RA 2MLXA 2QMWA 3VVTA 5CYQA 4IFYB 4KGMA 1JLAA 4KHRA 2UUWA 4DPWA 5J1EB 5H9EK 3PFEA 4NEYA 1OS5A 3ADAC 2GFFA 3DFEA 4GKKJ 1MMDA 4IRDA 1FE0A 2F4FA 3NBPB 2ACMA 1U6ZA 1URNA 1Z2LA 5LT5A 1AZSB 3L9ZA 4QW8A 2CYYA 4I2PB 5HQLA 1R27B 3C15A 4CWBA 4DR1J 3U1NA 2UXCJ 2HQDA 2YKPA 1UEKA 2ILZA 3JSBA 2Z2ZA 3CO0P 1RHMB 2KHDA 2XM3A 3OFFA 4AQYF 3MPVA 4U67Q 3LAMA 3MCSA 5E2QA 4OYIA 1KC8T 3RB4A 4O4RA 4RW8B 2GO9A 4F0HA 1Q5VA 3U1MA 2P9GA 4B08A 2VL1A 4DSLA 1RZMA 3NMRA 4B3OA 3NGTA 3CDUA 2JOQA 3MMJA 4DV3J 4BWJA 5KG3A 4LRFA 4Y2CA 4LMZA 2ALYB 3VAHA 1H72C 4GKJJ 4ANDA 2C3OA 3Q22A 2B6AA 3QIDA 2UXDJ 4I7FB 3QGHA 1IBKF 2CQ4A 1FWPA 2GMJA 3R7NB 1GMUA 3V81B 3DKDA 3KLGA 2L9WA 4B3RF 3JYTB 3KHLA 3UVJA 3ZNJ1 3GV7B 2R8IA 3QAEA 1LWCB 1FKPA 3C8YA 4XO0A 3JQJA 2BACA 4U96A 1TK5A 5KTQA 3G86A 1HBUB 4JI5F 1FWKA 1RAGB 3IM8A 1E6YB 2HNDA 4OYOA 3LAKA 1ZA1B 3UN5A 1AFIA 3RW7A 2HHTA 1SJ4P 2FLOA 1ACMB 1RT3A 1TK8A 3I0SA 1FRJA 4XAKA 1SIZA 3FSXA 5KFNA 1VJWA 4DI6A 4C3LA 3OBIA 3H4DA 4XIUA 2DISA 4ZP6A 3OVSA 4URSA 2J8AA 1L3TA 2FGOA 4WWSA 3A8JA 1RUSA 2I5JB 2DHSA 2Z4PA 2KJVA 3MM5A 1U6BA 1X5PA 1UPPA 1U0SA 1RTHA 2W4PA 2GS8A 4JV1A 2KZMA 5DQHA 1CJUA 1DQ9A 4TY9A 4GO7X 1YITS 1HNXJ 2HSEB 1IJEB 5CD4H 2ASYA 5C5JA 4URQU 4M5NA 3GJQB 5DZ6A 3GB0A 4FF2A 4DQIA 2OFHX 1HHQA 1GTEA 1VQ7S 5HP1A 2X3GA 3R6LB 4MK8A 5KFQA 2EBEA 1A7GE 4ED0A 2AIRB 5ETRA 3B82A 5CQGA 4KYZA 1UFWA 3CCMS 4IKAA 3KNAA 4UQGA 5B0EA 3FCHA 2E29A 1GEHA 5E3RA 5EUHA 2VH7A 3FFIA 2BANB 2XMVA 2I38A 1SH0A 2LECA 1AYEA 3PRBA 2F9DA 4X4VA 3CEDA 1ZM9A 4HLBA 4DF8A 4CO0A 4ELVA 4CLKA 1VIOA 3PX6A 5DM7Q 1VGYA 3LOUA 3DRRB 2WHOA 2Z30B 1C0TA 5IT9U 4QJVA 3KDOA 4IH6A 1EP4B 3QT5A 1S9GA 1WOSA 3THPA 4NCGB 3RR7A 1PIEA 4OYWA 4PPZA 5CABA 4OJ3A 4F36A 4CLYA 1IWGA 2ZH8A 1FKAF 2EK1A 4GKKF 2J9EA 1LK5A 4WFAQ 3EXCX 2ZDOA 1PYOB 3IBFB 1P1TA 1FX2A 5DETA 2BKPA 1L3KA 1G6BA 4U7UK 5DO2A 2VFUA 3LGHA 4DR7J 1EQMA 1FCAA 2PN6A 2A1BA 3I5AA 5J1NA 2ROEA 2KFYA 1RKIA 5H9FJ 3FZ2A 2J8SA 3DRSA 4X84A 4NLWA 4ZITA 3ISNC 1DZ5A 1VQYA 1K1QA 4JI8F 3R7SB 3MFIA 1BY9A 4O0IA 2RHSB 1RT7A 1FD8A 1TKXA 5F8GA 5H1SV 5KFXA 4DJBA 2XSJA 4HVZA 4ZVFA 4ILMA 4F4WA 6AT1B 4OYPA 2ZH6A 2KHCA 2CUYA 3DMJA 1N48A 3EM1A 4UOCA 3TQEA 2RKIB 4J9KA 1FRMA 2DBBA 5T41A 4DV3F 3D68A 4N7TA 2IY5B 1FDNA 2VASA 2W2NP 4J7CA 3A4TA 4OHVA 1JLQA 3CMES 2G0IA 1ZYQA 2UXDF 3DRPB 2ZZMA 2VG7B 2H65B 2WW8A 1T03B 5B0CA 4WP8A 5LSLA 3CD6S 2XY7A 4PXBA 5F9NA 2FY8A 1RT6A 1HYSB 2KXFA 3PO5A 4NLXA 2NPFA 5CYMB 3JTOA 3NMAA 5FJ4A 1WEYA 3MHYA 1IKYA 3ENVA 3FEXB 4M5IA 4PKDB 3JXOA 5J2MA 2FVCA 4MFBA 5HMWA 2ZE2B 1T8EA 3PX4A 5LXYA 2OPQA 2Y1RI 5L46A 2KG1A 1IXKA 2YH1A 4W90B 4XPCA 2B8PA 3C6TA 2MKCA 4A8OA 1YVFA 2F8HA 2JX2A 1FJCA 4P2SA 2V68A 3NCPA 3A3NB 3CCJS 2AKWB 4WIIA 2ZD1B 1TL1B 1KTVA 2BOAA 3BO2A 2I1RA 2GAGC 2UVRA 3QGIA 4JI4J 1YJRA 4M5MA 4NLUA 3W61A 3DHWC 2HZVA 5AJ3J 3AHPA 1T7PA 4DL2A 2C3UA 3GCXP 1HW8A 4PUOB 2CZVC 1G7CB 2M3DA 5GAGI 2G13A 2DR7A 3BB5A 4RW7A 5KFEA 2E9TA 1F9EB 3KK3A 3JSMA 3G71S 5IS2A 3NS7B 2B9XA 4TU9A 4X62J 1HNXF 2G2YA 4IG0A 4MH8A 3GU0A 3B6BA 1MNEA 1UVMA 1RTDB 1HWIA 5GMEA 4G1IA 4ZVTB 3TVZA 1UZHA 5GAEU 3V6KA 4PCQA 1XTZA 2J6UA 4KPYA 2IJFA 4RW9A 4RU9A 1IQTA 4HH0A 4H4OA 2NSCA 3CDWA 3TVKA 3LGMA 1NK9A 4U8YA 4NLVA 2ZKUA 4PR6A 2U2FA 2CJXB 2J0QD 4WKRA 2WTFA 1J27A 2D3UA 3ONQA 4UZCA 2ILYA 4Y28C 3O44A 5C25B 2PC6A 4HHUA 2VU5A 3P4UB 5K14A 3ILOA 2KFNA 4ANCA 2R7RA 1WHXA 1U02A 2GVZB 4PG6A 1PBUA 3DGVA 2CVIA 2DKOB 1C4CA 5T14A 4QR2A 1XBWA 1YQHA 1UWAA 2FVRA 1SV5A 1HNZF 2R8GA 1KVIA 3TVYA 2RVJA 1V3SA 1HI1A 5A8KA 2YNHA 3E01B 2DNNA 1X4EA 1FNXH 2E9ZA 2CJQA 2YWHA 1YJTA 2R8JA 3GYXB 3FC9A 4ETXA 4DR7F 2LQBA 4Q2MA 5KFSA 3NY0A 3VZHA 5BXIA 3HHLC 2DCLA 1FJ7A 4Z37A 3ZZYA 4UUWA 3J7Z5 1U1NA 4MK7A 4DR2F 3L4BC 1D9AA 2AF6A 2OUGA 4ZPDA 4LFCJ 3H5XA 3LWMA 2EI5A 2F8MA 4WTYA 3SCKE 2BE7D 1OQ3A 3IRXB 2LXIA 2YVSA 4NLYA 4X4TA 4M94A 1HKAA 3V6DA 4RNMA 2E5HA 1XNQJ 3C2PA 2BE2A 2O1PA 3MEEB 4WF9Q 1HBOA 4KIAA 2QLWA 4EZ9A 5KAKA 1KD1T 1KFSA 3QJPA 4X4PA 2G0JA 2PE8A 5KFMA 3PW5A 4Q43A 3LA0A 3OR2A 1SJQA 3IC1A 5AXMA 2M88A 2W8KA 2PFDA 1IKXA 3O2IA 3HD2A 3L7PA 3W5XA 5KG5A 2MKIA 3LP2A 2FLPA 1WF2A 2B43A 4YN3B 2EG1A 2UVVA 1NSAA 1F5BA 1KOOA 3KLIB 3RG6A 2IRUA 4LVOP 3D3CJ 3LGNA 2YQ1A 1IWAA 3T9ZA 1LV5A 1J5OA 4QOTA 1Q5YA 4B3TJ 2YNFB 4ILLA 3GIIA 2KVQE 4JI1J 4Q2LA 4PWWA 3MM8B 4PPDA 4CLFA 2D3O1 5E3PA 1YSJA 4TLRA 5DZ7A 3IGVA 2B3TB 3OQ2A 3BV8A 2IM2A 4HACA 4Q8EA 3G2XA 3H59A 1T9WA 3DHXA 5AJ3F 4ECYA 3OR1B 1UVIA 3BYPA 1FVQA 1UEUA 3KJVB 1T94A 5ADZA 3W2VA 4RPFA 3RW6A 1XMOJ 1N5YB 3KK2B 2XZWA 3I4HX 3UNGC 2P2CB 2QN6B 3QLHB 4CTAB 2LYVA 4WP9A 2B5JA 4TLQA 2PEBA 4X62F 2AZ3A 2JLGA 4X4RA 2W25A 1U24A 2AZ1A 5DLGA 1RWOB 1NLKL 5C24B 2CADA 2FLLA 4RL1A 2DITA 1S1XB 2C42A 4ZK7M 1TFWA 2VZ9A 4B17A 4N77A 2CQDA 3N5BA 2Z57B 5CYJA 1BUXA 4KKOB 3LF0A 2G1DA 4EZ6A 2Q6CA 4ZLPA 3OVAA 4P75A 4K50A 5D15A 1TK0A 4NLDA 3WHIA 1RU1A 3G6XA 3PKYA 4KGVB 7AT1B 1YJ7A 1ZOTA 2XYGB 1U2FA 4BWMA 4CLPA 3M32A 2WSEC 3QT7A 4RW4B 5H9FK 3K57A 2KL8A 1QSYA 4P73A 3OL6A 4ED1A 1LWFB 4C8ZA 1RAAB 2R7VA 4LF5J 2QX0A 4K8RA 1TVRB 3DOMA 3EYZA 1V3RA 3M2UA 3PIPQ 1FD2A 3IM9A 2GV1A 1N6QB 1SJFA 3M2RB 1S6PA 1YRUA 4NA2A 3MR7A 1PAEX 2Z2MA 4J9VA 1NB2A 1C2PA 2AV5A 4OI3A 3FDSA 4ZIVA 5A8RB 4USMA 2V4QA 2IM0A 3VGTA 2BQUA 3PRDA 1K1SA 3MMBA 5FDLA 4DFJA 5GMKa 1R0AB 3TOQA 3M8RA 4IUFA 4ED5A 2C2ZB 4J9UE 2CJYB 1YJ9S 4GRSA 4LFCF 3R7BB 1UVKA 1QAYA 4DUZJ 1V5VA 1RI7A 1HR0F 3VAIA 4IRKA 1KNZA 4ZOSA 4ES1A 2HVZA 4NMLA 5DDPC 2K7KA 4EYIB 2EK6A 1UW4A 2VKRA 4DR3J 1NO8A 2BW2A 1C1CA 1HBNA 2IVYA 4OI0A 1VBKA 4TNOA 4NZ6A 3SDEA 4ZCMA 4F3OA 3BM7A 3M6WA 1I94J 3M30B 3MMAA 3NCRA 3D6HB 2IMWP 1EX8A 2GNKA 1MWZA 5HK4A 1M0SA 1VJQA 3CJKB 1N0UA 1RU2A 2FC9A 3M2VA 1LW0B 2R2TA 2A10A 4EBCA 2KJWA 1UA0A 4ZJQA 5DGAA 3OXLA 4DSIA 3LPYA 2YNGB 2VICA 3CIZA 4DXLA 2WW4A 1XQIA 2VKZG 2DNPA 4ZVUB 2XCAA 1R6VA 2FJVA 3MPDA 3G87A 1KRPA 3A8IA 1HLWA 2K06A 2HFUA 1B0PA 3M8QB 4LF6J 2HFOA 5KT2A 1TV6B 4BC9A 4B3TF 3ETMA 2W2MP 3OHAA 3A13A 4CRJA 2UP1A 1X60A 4M5DB 4JI1F 2Y8YA 4XPEA 2EG2A 1QLNA 1FEEA 1Y4ZB 5E3QA 3CC4S 3GIJA 4CYUB 1BC6A 1C0UB 5AE3A 2VG5B 1U1MA 5F41A 3OW2R 4O3RA 3K5PA 1RWKB 3PJXA 1TL3B 1RP5A 3R27A 3TAMB 4GC7A 1WG5A 2VPYB 1BHNA 4YFUA 1XMOF 1OQ6A 2B4UA 2HVHA 2X1BA 4MKBA 4ZPVR 4ZHRB 3TUPA 5E41A 1VFJA 3D7SB 1Z4UA 2ZUGA 4JI7F 2RDIA 2PGCA 1X4FA 2BJ7A 1EKSA 4JUZA 4NCAA 4L76A 1VIXA 1JJ2R 2DHGA 2MQQA 1TKDA 3J81Y 2J7KA 4PG7A 1RYSA 5J1PA 3OUYB 2Q6BA 4KSEB 4R25A 1OY8A 3Q8QB 1PG5B 5SUHA 4MKVA 4YEAA 1NDKA 2XG8A 4TVAB 3Q2SC 3O1LA 3TUJC 1FEHA 4DQRA 2ZBQA 3MGJA 4CLSA 2IC3B 4CQ1A 2MQLA 3QFHA 3H0PA 3FK4A 3CJ3A 4FVCA 1SKUB 2XMKA 4QW9A 2UUAJ 5D3GB 1N5TA 3OTOJ 4PYDA 4G1QB 2Q66A 3ZZZA 2A6MA 4DCJB 5IC4B 2CNOB 3W5YA 5KG6A 3K17A 2WVDA 4RNNA 1VMBA 1SL2A 1CULA 2CAJA 1SJRA 3W60A 2FVPA 2CZ9A 1CQNA 1RHJB 2MLZA 3UQSA 4B9UA 1YDLA 4LF5F 3PW4A 2DR9A 1U26A 4H54A 1JXLA 4A8MP 2W9AA 3B4DA 3CC2S 4QIFA 2JVRA 3DXSX 3KJNB 2NREA 4P7VA 4DR6J 1NHUA 1IBLF 3GJTB 1R7IA 4PABA 3DLKB 3OSNA 1S7HA 4DV4J 1HWKA 4DL3A 3Q0AA 2HRUA 1SBRA 1RT2A 1YTYA 1K73T 2DGVA 3PG9A 3OTBA 5IT4A 1MU2B 4ZDNA 1JKHA 5HMZA 3GILA 4DG1A 2HQCA 2M8HA 2HZAA 3PNIA 3ETOA 2ZNYA 2RAQA 1CJVB 2QA4G 3PW0A 3EX7B 2KZZA 3KJFB 2CQ0A 2DO0A 4F25A 4R8UB 1FESA 2JC0A 3N6LA 3OL9A 1XR7A 3GYNA 4EBEA 1ZPVA 2M2BA 1U45A 1TZ0A 1IR2A 3E51A 3BO3A 3D1OA 2LXFA 1N88A 2FTRA 4CNZA 1LWEB 1HARA 4CNYA 4RWWA 4FYWB 3ZTPA 2HLTA 1WDDA 1VQNS 1W26A 2V2KA 3DLHA 4NI2A 2DTJA 1Y3KA 4P72A 2V2VA 1JLBB 3MM6B 4RWXA 1NZAA 4HTJA 2ZC4A 4QIGA 3ZTRA 4DQPA 3ENAA 3T1HF 2DNMA 3PO4A 1ZM2A 5A8WA 1F60B 1JJHA 2NSBA 2HAIA 3THTA 2GZOA 3WX8A 3VGUA 4WFXA 3DNCA 2OH2A 3BPSP 4LSLA 4ZJLA 2XC9A 2DH9A 2FZKB 2YKQA 5CD4A 3PW2A 1HQEA 2HFZA 2BYCA 1Y3JA 4KE5A 4LF6F 3DOKA 2PEHA 5SZTA 1DLOA 4OZ1A 3KFWX 2AEJA 3KXDA 3T1YJ 1XNRF 4LFBJ 5T7LA 2YNIB 2CIMA 4TYBA 4L6V3 4DV2J 2C28A 1HMVA 2I8EA 2V6AA 1TL5A 3MUTP 2YKNA 3KK1A 2CA9A 3GMGA 5AXLA 4WFBQ 4FNHA 1P27B 3NKYA 1AA1B 3VHQA 4O4GB 4CI0B 3MECA 3MEGA 1S5ZA 2AJ1A 4DSEA 4MIAA 2DGTA 1FRLA 4PRFA 3G6YA 1XMQJ 2EPIA 4WU3A 1RA7A 4WKYA 2WB4A 3PYFA 1RTJB 4OHZA 4P10A 1JIHA 4IFYA 3D0HE 3PIOQ 2PI5A 4KJIA 4JI2J 2M0GB 2CVEA 1SJ3P 5DG8A 3ILLA 4LBIA 1GFWB 3MEKA 2DR8A 2HHHJ 5G4DA 4PWDB 1U1PA 3NBPA 2QLXA 1BE4A 3GQCA 3G82B 1VQMS 1AZSA 4I2PA 3H40A 4WYLA 5A0YB 1G2EA 1S1VB 1VQ5S 1WC5A 3OTOF 1RHUB 2CPIA 4ZPCA 4C8YA 5EGYA 3QWUA 4OFZA 3K5OA 3GONA 1UEVA 4X4NA 2X7IA 2HHXA 1A9NB 3K0JA 4IOCQ 1KN6A 1R89A 3IFEA 4NA3A 2DRBA 4FF3A 3BGRB 2WVFA 1FDDA 2VIHA 4WE1A 2LMIA 3Q8RB 1REVB 2FVSA 1R8CA 2BJ9A 4LSNB 2GX8A 4RW8A 2HBYB 2BRLA 2KYXA 1S76D 4ERDA 2H54B 1SC3B 2G4BA 4P71A 1Y00A 3FBBA 3K58A 3SFUA 4FBTA 3BF4A 2HWIA 4DR6F 2DD8S 4BLGA 3EPGA 1SH2A 4I7FA 4TY8A 1S1TB 2GMLA 1X8DA 4DV4F 4F4YA 2VBXA 1FJGJ 1KDNA 3GR1A 1R43A 3MPWA 3V81A 4NRTA 5M2UA 1OO0B 4DR5J 2EW9A 2QLBB 3BGOP 2W7AA 1NH7A 2MGZB 4ZVPB 3JYTA 2RU9A 3AA8A 4NCBA 5AXNA 2ZH1A 3KHGA 2VA3A 2XWXA 2OAUA 1X0PA 3AOBA 1NK5A 2KFZA 3CCWA 4OZ2A 3WC2A 3RB6A 2LQJA 2JLFA 3BREA 3FEYB 3VF0B 5K9FA 4RBUA 1HBUA 3R6GB 2CQ1A 4N47A 1S0MA 1E6YA 2MSTA 4OMFG 2GHWA 4RNHA 4RW6B 3A8EA 1FK9B 3PFOA 4A8SA 2RUSA 4ED6A 2E1PA 4RJVA 2B7BB 4K4UA 3T9NA 4DPTA 2EKNA 3PDNA 5ETVA 3DM2B 1I3OB 5F3TA 5LOQA 3QIPB 1YJNS 1H2TZ 3EZUA 4DV1J 1VCTA 3MAHA 4DV6J 3SCJE 4X4SA 4YB6A 4OV1A 2I5JA 3Q24A 4WFYA 1F3VA 1R8HA 2IA6A 2XTJP 1QTMA 4J9SA 1X31C 4I2QB 4UOFA 4C0BA 2R7QA 1VC0A 2BW7A 3EWGA 4U7CA 1NUEA 4WIQA 4O3PA 2I9SA 4NOHA 1HQUA 4C8LA 3V5RA 2HKEA 1OYEA 2DPIA 4B9NA 1NB7A 3RUBL 1HI0P 1GTHA 1ZS6A 1LEOA 3QZ7A 2WOMB 5EWEA 3M8PB 1B0VA 2E1RA 3HHDA 4EBDA 3HK2A 4FYDA 4A47A 2B9YA 1UWBA 2FHMA 2ZITA 2R7OA 3M05A 1IKWB 1SC6A 3W64A 2LEBA 1MLAA 2IJNA 1DTTB 3T1YF 4UTGA 1YBTA 3V4IB 4LFBF 4QWBA 3Q8VA 3IO1A 4CZCA 3I5BA 1U47A 2AP6A 4DV2F 1IN0A 3ZC4A 2XGQA 2V67A 2ZM6J 1DY3A 1U2CA 1FNMA 3UDLA 3MMCB 2BANA 3TZZA 1JXEA 2AT1B 4C0HA 5HAOA 1S1WB 5IOLA 2F65A 3CJSA 4MIWA 1RXOB 4OYZA 1WSRA 1NK0A 2L48A 1Q8BA 4CT8A 2Y1JA 3DRRA 2XQCA 1VBZA 1KHWA 3R1HA 4QPXA 1VLOA 3GFYA 1EP4A 3CMQA 3RRHA 3BZQA 2LCWA 4USIA 3SEOA 2KKHA 4YUDA 4OLOA 1FJEB 4DCPB 1JLCB 3G8TA 4LF1A 5LJ3Y 2GCFA 4O3SA 2QZ8A 2OFGX 3SV4A 2V2QA 4JI2F 4QCLA 4WU2A 2W9CB 4C8MA 2OPSA 1O6XA 4AT1B 3IMQJ 2HAFA 1WHYA 2JFDA 1WI6A 2G1HA 2LFVA 4A46A 4ALZA 1XK8A 4Y0FA 9ATCB 4UZBA 5H9EJ 3HSZA 1ZAVA 3DLBA 1U8SA 4PYAA 2RRAA 2HK2A 2VBWA 1JLAB 1Y9OA 4DL4A 2DNQA 2O66A 2O01C 5KFIA 4I6WA 4P2FA 3PVXA 3OD2A 1K8AT 4KH1B 4DPOA 3H2UB 2HGNA 1M5VC 2DGXA 4V19J 2FHOB 1RA6A 4LRBA 5DG7A 6FDRA 3ZZTA 3N4WA 3QSIA 4WYWA 1KBRA 3ENQA 2CNNB 1TUGB 2HQIA 3C15B 3BQ1A 2UXBJ 4KH0B 5DGBA 1RDRA 2AHOB 2RKIA 2BM0A 2P9CA 2HRYA 5C7PA 4Y2AA 2JEFA 2UUCJ 4NYPA 3IG1A 1BLUA 3HZGA 3O8WA 3RTVA 3U1LA 4RO0A 1XR6A 2VG7A 2XWYA 2NCKL 4DR5F 1JJCB 3OJSA 4UOHA 2CPYA 4LR7A 4OIXA 5CYMA 4OJGA 5LMNJ 1WACA 4Z7YA 2A3JA 3HXMA 2H5JB 4KO0A 2IVFB 2Z2YB 2AWZA 3RZAA 5IQQA 5D4NA 1A0OB 2NPIA 4TU8A 4DV7F 3LP0B 3ISZA 3W9JA 2ZZNA 2D1CA 3H98A 2R7SA 1ELOA 4DL5A 3UWTA 3KLGB 4ZLJA 2B8QA 3IRWP 1QAJA 2HEKA 4UUXA 2DGWA 2ZD1A 2QSWA 1TL1A 3ELHA 4KC5A 2JWNA 2DH7A 5KFRA 2PMHA 2VONA 3QAUA 5DM6Q 4C98A 2OO4A 2LP4A 1M5PC 1PC4A 4RR5A 2ZH3A 3QBCA 4DV1F 3WC0A 3GFHA 2F8EX 2MY8A 1HNVB 1IKVB 2NLWA 3IGNA 1RCXB 5DDRC 1T9YA 3I0SB 3BYRA 2DB1A 5HQ8A 3B4MA 3UFCX 4HR2A 4DEZA 2WONB 1ZPWX 1NPRA 4ETZA 4I1TA 4CH0S 3NGUA 2ZWOA 4IQXA 1WORA 1PJ6A 1G4CA 1RTDA 1QTNB 4KBIA 5L1IA 4B3MF 4GVLA 5KFPA 2NUUG 4ZVHA 2A18A 2OEKA 3P8BB 2VV5A 2J7UA 3I4PA 3VZIA 1WG4A 5DJBA 2AJ0A 1U0HB 4ENOA 3J81U 3IA0A 2KXHA 2EFGA 4AL5A 2W7OA 4A4JA 3NAIA 3KOAA 4OYMA 1F1BB 3UDEA 4D3GA 1UFLA 1N36J 2ZVIA 3SBMA 2OMLA 2OSQA 2ZM6F 4QR1A 5KFHA 1H2VZ 1UPMB 2I0XA 3TYTA 1G3OA 2RSQA 3B78A 4CLZA 4B9VA 1BD6A 5C42B 4WZQA 1DARA 2BDPA 2HGMA 2RDDA 1S79A 2OEJA 3VAJA 1I6JA 2GVZA 2BE9B 4HHJA 3RRKA 1U6FA 2QL5B 3OXFA 4NLSA 4YHHJ 1U1OA 3E8OA 5EWFA 3Q23A 2HZCA 1DRZA 1VRUA 3FUYA 3OTEA 7FDRA 3OLBA 4LFAF 2MJNA 2J0WA 3E01A 2B51A 4QYZJ 4ZVOB 3IWXA 3QO9A 1RWUA 5LMUJ 1EZZB 2HW3A 4DX5A 3BKTA 4CM2A 3GIKA 2UU9J 4FDFA 1FA0A 1F5AA 1Q81T 2BQRA 2WAQD 4P52A 5I42B 3T5KA 1WD6A 2QLJB 2IDLA 4UW2A 2BKOA 1QVFR 2FZGB 2E1MC 2IJRA 4QWDA 1AB8A 4YOEA 4F3QA 2GW8A 2RHQB 4X4UA 2IRYA 3P5TL 5KFGA 4X66J 4RZRA 2LU1A 2JL9A 4EUVA 1X9SA 3JSRA 3T5HA 3IRXA 2ZHOA 3HDSA 3NG8A 3OL8A 2OPPB 4I68A 3HSGA 3CCES 4RU2A 1QSLA 1K44A 2UXBF 3KDNA 4OHXA 1NPPA 2ZH9A 1FRKA 2GIRA 2M52A 3TR5A 5L1JA 3LTOA 4LQ3A 4MYTA 2UUCF 1NKEA 3PR5B 4H4KC 2XLKA 1L3VA 4A8FA 5KT5A 1S99A 2IAJA 4NASA 5L1KA 3POTB 2RRNA 1VQ8S 4L3KA 2E1CA 3DMJB 2CZ4A 5L9XA 2ZJPQ 2K1RA 2V4RA 2F63A 2FJWA 1KWMA 2UUBJ 1HL6A 2CRLA 2ZWPA 2DPJA 2U1AA 2C2DA 1KSPA 2DHAA 3QWPA 4F50A 3KLIA 5BR8F 2K7JA 4O23A 5HROB 3MAAB 1N54B 3DU6A 1JJ4A 4ID8A 3HCXA 4I0WA 2CNLB 5F8HA 1RT6B 4K4XA 2ZHAA 2X51A 2DXDA 2BMBA 2YNFA 1Y11A 3TP2A 2HS3A 2FJEB 3MM8A 1YZ7A 3F44A 1F3FA 1YWXA 2XNQA 4UOGA 1NKCA 4JV0A 1VOMA 3T5LA 3OR1A 5KFBA 1KTQA 3C6TB 4BC7A 2YH0A 1YI2S 2HVDA 4BHQA 4N56A 4DSFA 3KJVA 1TAUA 2QFJA 1QUPA 1R8AA 1S7IA 2AD9A 1N5YA 3KK2A 2K3IA 4RUAA 2Z2LA 2Y0SD 2KI2A 4AE5A 4M5HA 3IBWA 5B09A 5HL7Q 2BJ1A 1AXQA 4J37A 3BN7A 1RAOA 2QRRA 5AXKA 1NJZA 1CLFA 1UP1A 3LO3A 5C24A 1ITPA 1UA1A 1GMWA 2Y8WA 4NXNJ 2IDEA 1YGYA 2FJBB 3KK3B 2HFSA 4FS2A 1EAYC 3JSMB 1S1XA 2F1FA 4J9NA 4CIOA 1LOUA 1KONA 5CA5A 3CC7S 1KVJA 4KKOA 4WXWA 1BQNA 5JVGQ 3U02A 1PAUB 1UVJA 1S0NA 2CG4A 2ZC3A 5EX0A 1W2BR 4OZ3A 1U1KA 2VQEF 1Q16B 5ETPA 2MZ1A 4JI6J 2E9RX 3C16A 4AD6A 1S72S 3CMAS 1VYAA 2H1YA 4HI1A 1RT4B 3EDRB 4CLWA 3CXCR 1FX4A 4LF7F 4RW4A 2ZH2A 5BYSA 3U7JA 1UJ6A 1LWFA 3N9UC 4A8YA 1NZ8A 4LQ9A 4ECVA 3R3TA 1SKRA 2CQGA 2VDHA 1L5UA 2ZH7A 3EPIA 1TVRA 1RWNB 2OGUA 1EHWA 3PHEA 1X4CA 4DOZA 2MY7A 3HVAA 3JQMA 2AW0A 1N6QA 3M2RA 4F26A 5IV3A 1TAQA 4O0NA 1T95A 4YHHF 2VBYA 1WC1A 1VC6A 3BGLA 2ZOMA 2HVEA 3N5FA 4TU7A 2QO3A 1T3NA 5K14B 5A8RA 1QAXA 1YIJS 1PCAA 4L74A 2HQFA 5LMUF 2HURA 2A2DA 3SV3A 1TMJA 4X65F 3CD7A 4OX6A 3KLHB 2UU9F 2QC3A 2BBEA 1SQEA 1R0AA 3K8VA 3CNQP 4CLTA 3ISND 5A8KB 1M5KC 2FB0A 2AEFA 4B9LA 5GMDA 5E5NA 5KFDA 4X66F 4QU7A 3D5MA 1D09B 1J5EJ 1NK6A 1IR0A 3JB9k 4PQUB 3OXGA 4O44A 3GLJA 1FXRA 1NHVA 5D4PA 4J91A 3DN9A 4KY3A 3D66A 3THVA 2E5LF 1IM6A 3AFGA 1M90T 4JI0J 3M30A 1S4FA 4B9TA 1HA1A 3X1LB 2AQ4A 3AB2B 3AD7C 3TEHB 4EMDA 2POKA 3K59A 3CJKA 2DXEA 3CE8A 2XNRA 3NS6A 3TZWA 3BJYA 1LW0A 3JSYA 4KGXB 2UUTA 4DHVA 4P2XA 4E0DA 1XIQA 3HULA 2BE2B 1TP7A 4ECRA 5F8NA 5L1LA 2YNGA 3BSAA 2DCUB 2UUBF 4WK1A 4FYYB 2ZVSA 2P6SA 4PG8A 2CJKA 4B9MA 1KR4A 5ETTA 2ZJQQ 3EGWB 2CQPA 2LA4A 3HHLB 4C8NA 1JXVA 5ETNA 3MXHP 3CJ0A 1IKXB 3M8QA 2K2PA 4D3HA 1TKZA 3BBFA 5ETMA 1R8BA 5IXUA 1WOPA 4M5DA 3MTKA 1UJ4A 2M5YA 1Y5NB 3RB0A 2C2EA 4CYUA 3M8WA 1GX5A 4WXOA 5G0RB 1C0UA 1JLGB 2CWXA 1U1LA 4N76A 5BJRA 1S97A 3C3LA 1N5QA 4KFBA 1D0EA 2D69A 1RAJA 2GGPB 2HFNA 2JRSA 2WSFC 1UETA 1TL3A 2AJ4A 1ZETA 2E66A 2ASLA 2OPRB 1QD1A 1WSVA 4NLRA 3PRVA 4ZVSB 1RGVA 3BDEA 3WX4A 1VHIA 2XBPA 1Y0HA 3HVWA 4K2JA 1K0VA 4QZVB 4JI3F 2OTLS 3SFGA 5KFJA 4FYXB 5IWAJ 2GO8A 4MK9A 3UW1A 2HLUA 4HHHA 3DC2A 4PXCA 3AH6A 3HVTA 1FHTA 3CCSS 3UR0A 2O67A 3EDQB 4OV6A 4F0KA 4NXNF 5F8JA 2C2NA 2G0CA 2JVOA 4TQRA 4B9SA 2BJ8A 2NQPA 2IC3A 5FD1A 2MZTA 2KB2A 3QFWA 2VJVA 2Y3YA 3MR3A 1R6YA 5KFTA 2N7YA 3D9BA 2AX1A 2GQ2A 3KLFA 4ZPAA 5D3GA 4QYZK 5I3UB 2Q43A 3D1HA 1TFYA 1YG0A 1AUSL 4JI6F 3MM9B 2FJAB 3GCWP 3K8WA 4P2MA 1S10A 2B4VA 5AE2A 3TNVA 2D41A 2QFIA 4C7QA 4FXDA 1H0HB 3D67A 4H4MB 4FBUA 2J7WA 4NEZA 3DRXA 5CCLA 4DR1F 2AGOA 2UXCF 4LF2A 2V8DA 2JC1A 2BX6A 4C3KA 3ZZPA 3HPOA 2XHCA 1IR1A 2IHR1 1RAHB 2HYIB 3AJ2A 1ZZFA 2XEXA 4LRAA 4ZJOA 3E2EA 2VQFJ 4GVBA 2V34A 1Q4RA 3DLKA 2VG6B 2YBVA 1NXIA 2FY1A 4FVMA 2R2UA 5D8HB 1FTRA 4KHPJ 3SI8A 3D0GE 2B4OA 2IRXA 3DLGB 3UDVA 4C9DA 3HLUA 1O5JA 2VOOA 1SPBP 3D6FB 3SXLA 2NXUA 3HHLD 4EO6A 1T9XA 3V4MA 1MU2A 1X5SA 2FDNA 3WQPA 1EJ7L 2G2OA 3I6PA 4GKJF 3EVWA 4KV8B 5KFOA 1CJVA 2RD5C 3WZ0A 2LLZA 3P45B 4TKTA 5D4OA 1RT1B 1TL7A 4R8UA 2Z56B 2V0NA 1FFSB 2XS5A 2GA7A 4ED2A 1F2HA 2HWHA 3P5BP 2YY3A 1HBMA 4YQWA 4JI0F 2VD3A 4RBVA 4DFKA 3PXGa 1ZBTA 1RWWB 5D0EA 4JBCA 2ZDPA 4RUHA 3MD1A 2E44A 3FBEA 4L72B 3BGFA 1AT1B 1JLBA 2LA6A 3UD3P 2NZCA 4Z2XA 1UKUA 3HX9A 2DNLA 5KFYA 3L7OA 4OI2A 2DXFA 3R2DJ 2DR6A 3HSDA 1JLFA 1FRHA 4YP3A 4DUYJ 4BBYA 4OHYA 3AXMA 2C3PA 4ZCKA 3CTRA 3KUHA 3PTWA 2XYHB 3R97A 4A8KA 1RBLA 4EEYA 3LP1A 1NMEB 4DPUA 5KT7A 1VRTA 3M1VB 2YX4A 1FKOB 2HS0A 2N3OA 4LIWA 3PACA 1S6UA 1Y10A 1OSCA 3HT0A 3KHRA 3SYZA 2A6OA 1QDUB 2W24A 3HHKA 2M8DB 2A2CA 4KTQA 4DL6A 4ZP9A 3I9ZA 3MEDB 1QSSA 5EDWA 4IDKA 2YNIA 1F9FA 3NS5A 3CD0A 1GMVA 2W1BA 2WVBA 1FFGB 1WC4A 3NGKA 3PHTA 3RAXA 3NRBA 5K5MA 2N82B 1FE4A 2QYGA 4M95A 4O4GA 5F8IA 3EGZA 4DBQA 4YDDB 1T9TA 1WTBA 1PILA 1GXTA 1WTFA 1N52B 1OY9A 5IWAF 1RYRA 2J76E 2WB1D 1RTJA 1JMTA 2MYFA 3TAQA 1X5OA 3QJJA 1CBKA 3WBZA 5GAEI 2VFSA 1RE1B 1LW2A 1Q7YT 2EKYA 5HVFA 1YRXA 3OTDA 3UR3C 4F67A 4IFVA 5HBMA 4PWDA 1BWEA 2XCPA 3QATA 3W65A 3G82A 1VQ4S 3MURP 2W9BB 2V8PA 1T3OA 5A0YA 4MYUA 1RWPB 2M70A 1S1VA 1DHMA 1RAFB 1DJ0A 2DJWA 4C3MA 4U6PA 4QQBA 4C4WA 4AUKA 2XMAA 3N28A 2YKAA 3PV8A 2DGQA 3UCGA 2HIYA 2HPUA 3BGRA 4F4KA 1HFEL 4F02A 3GSDA 3FZBA 4JP8A 1CS4A 1REVA 2QA2A 3HF5A 4OX8A 1S6QB 2C22A 3SQGA 1S9EB 3S1TA 2H4WB 2MZJA 2COLA 1N33J 5U47A 3ZTOA 1S9FA 3HT3A 1CJTB 1RTZA 1WELA 2MQNA 1EB0A 1YJWS 2F4VJ 2APOA 4CLLA 2VQFF 5K8MA 5D0RA 1LK7A 1QVGR 1T11A 1YZ6A 3KG1A 2KYZA 2DYAA 3VQTA 4EGLA 4R0JA 4OYXA 2V9WA 4Q0BB 3DI6B 4NWBA 1LFWA 1CG2A 4MIBA 3UD5A 3Q8YA 2D74B 1SUQB 3SZ2A 1TKTB 3Q83A 2MGZA 2LQ5A 2GJFA 1H7XA 3P6YC 3KMSA 4I6AA 1FXDA 1N5SA 3SSQA 2DR5A 2OKQA 1HW9A 1GT8A 2EC2A 4LRCA 4PG4A 3CULA 3VAMA 2BUNA 2OI2A 3MTJA 1X9MA 4K0KJ 4ZIWA 1RT2B 2V8VA 3C14B 1NDCA 2QGFB 2BZ2A 2L3MA 3VGVA 3DCAA 1FK9A 2NZ4A 1S1UB 1F5CA 2VFTA 5GAHU 5A2QU 2FGCA 2ABYA 2ZJRQ 2LVWA 4K2XA 4Y3CA 1SI9A 3DM2A 1M5OC 4X64J 1BXNA 4DZDA 5GADU 3QIPA 3CCRS 1AW0A 3GV5B 3S7RA 2Q3PA 3VV2B 4C11B 1RBAA 3EVOA 5DS7A 3PEHA 3CD5A 4KGZB 3MOZA 2IM1A 2CWKA 3W1YC 5GAHI 1RT5B 4G6VB 2LU2A 4ZLLA 4M1KA 4QWCA 3HSJA 4DUYF 4PG5A 1BGXT 2D3OR 4JI4F 2GAHC 4I64A 3AB4B 1I1GA 3M6XA 4P9SA 4USVA 2W2PP 1AUDA 3RBEA 2Y1LB 2MJUA 3KG0A 1F6TA 1BQMB 2F5GA 3PJ9A 3A12A 4JOUA 3S8SA 4DX7A 2IIHA 1CC7A 3ZTQA 2PA8D 1UFKA 5HSPA 4FP9A 4C0OC 2R7UA 1MMNA 1IKWA 3O5TB 1IQZA 1DTTA 1N32J 2ZH4A 3Q86A 4K59A 3V4IA 3CCUS 1S77D 3TA0A 3HFZB 4Y6IA 1SL0A 3QQCD 1SJ1A 2YWWA 2UZAA 2XLJA 2ZZTA 2EXUA 1GK8A 4JB8B 3CDBA 3MMCA 1CVJA 3BH6B 5E7OB 3GG0A 2ASJA 1HNIB 1JB0C 3TUIC 1S1WA 3CCVS 2NR0A 3C6UB 4OI1A 4QBUA 3UCUP 4IO1A 5T7LB 2BOPA 1FRXA 2GIQA 1H98A 4DS5A 3QSYB 2HS4A 5K8NA 2FPHX 1T0TV 1M1GA 1R8PA 1KFDA 2YKNB 3CCTA 5AE1A 4FZVA 1KOHA 2MHEA 1KP6A 4LF4J 1SVDA 3DLEB 1JLCA 3HKZD 2RUGA 4E98A 2C1EB 2BVZA 2W9CA 3DU5A 2DO4A 4DX8H 1V6HA 4OQJA 2ATCB 4IG3B 4U9RA 4U8VA 1NKBA 4NLOA 3BSNA 2J9DE 4ZVQB 2XGPA 3UO0A 3QPIA 3C46A 2E5GA 4A48A 5HVGA 1Z2ZA 2IMOA 3DOLB 1W2IA 3V2UC 2KO1A 3J80U 4OLPA 1X4GA 2J9CA 2GVDB 5LXRA 3D28A 1T9VA 5IM0B 4LR8A 3FJ2A 3MOJB 2O3DA 1P9QC 4J9RA 2MSSA 4C6AA 4K4YA 2OTJS 2CXEA 3EXYA 1JNZB 4FNIA 1N33F 2GJIA 4P74A 5LL6d 1FI4A 1PGZA 4JI8J 1H3DA 3GTYX 3FMWA 4DPXA 5ETQA 3TZXA 1S0OA 2F4VF 2ALZA 4WE1B 3GE9A 4OX9J 2ROPA 1OMSA 4DR4J 2ATLA 1NSPA 1XNQF 4K5RA 4OI6A 3EVMA 1H73A 2JH3A 3RJMB 4Q44A 3OL7A 1CSJA 2F40A 3Q8UA 4I6YA 4DFPA 2J5AA 2V9KA 4DWIA 3I9V9 3N0VA 5J2QB 4LRDA 5CHCB 1FNOA 4TY8B 2LKZA 2QE5A 2KM8C 3QRQA 3UE2A 3LP0A 4K0KF 1VISA 5JXSA 3LANA 1MN9A 1RISA 5D77A 2M9KA 5FLXU 1X9WA 1MROB 4IOAQ 3D4JA 1C1BB 4Q8FA 1HHTP 4DQSA 3QRRA 3I96A 1QJHA 5MAOA 2FQQB 2LQ8A 3G6ES 4X64F 2HK3A 1HWUA 2M4MA 5IV4A 3BKFA 5JVHQ 3OFGA 4CH7A 1RLDA 2BV3A 2VFVA 1HNVA 1PSDA 4PXDA 1ZTTA 2OD6A 5AT1B 1IKVA 2CQCA 3RRGA 4QYRA 4Y34A 2HQ3A 3T6JA 3BSCA 3AJDA 3W3SA 3VTIA 2VF3A 3HFKA 4RUCA 2VJUA 2OHDA 3DYAB 4HKQA 4TQSA 2HHQA 2DNGA 2QIFA 3KJQB 3R9LA 2DY1A 4UT4A 2WRMA 3TAPA 3NLCA 4J9PA 2WONA 3VGSA 2FZCB 4TXSA 2R7XA 3CPWR 2HVIA 2C3YA 3FKBA 3WIVA 5EWGA 3G9CA 1GNKA 1MN7A 2YKMB 1NRKA 1LFPA 1LXNA 2MKYA 1U0HA 2V8HA 1HQUB 3JAMY 1N32F 2HNZA 1LKZA 2X3DA 1N56A 4RNFA 4AL7A 1R3NA 1Q8IA 3UN2A 3MPUB 2XYPB 4ZP8A 2VUGA 4IRCA 4KPCA 2G9OA 3MR6A 1S49A 3FQKA 1UWBB 2IYGA 3MI7X 4QIEA 1SQGA 3VCDA 5I3QA 4NYOA 5IT0A 2MLYA 2EVZA 5C42A 3NGRA 2XZTB 3W2WB 1T05B 3CJQA 3M6UA 4AYBD 5HN0A 4ATNA 5DG9A 4W92B 1U1QA 2FJDB 3CCLS 1YBUA 3T41A 1NJXA 3G4SS 1RQ0A 2CPHA 4OX7A 4NMXA 4LF4F 2HMIA 5KG4A 3ITHB 4HI2A 3M9MB 4DL0C 1SXLA 5KOWA 3TX8A 2BJ3A 4DS4A 2RF2B 1R0CB 2HG4A 2Z0GA 2H3EB 4ZP7A 1SC1B 3PX0A 2QTWA 1KLNA 2QEXS 2HBZB 3MF5A 1NK7A 1EETB 2VPXB 2CQ3A 4F2SA 1Y5IB 5KFLA 3H25A 3BS9A 4ZS6A 2X1GA 3R5JB 5GVQA 1O0PA 5LJ5Y 1KQKA 5I42A 3NXZA 3KYLA 5J2NB 4LF9J 1SIWB 4F7VA 2DGOA 4I4BA 2CPXA 2OPSB 2FLNA 1IJFB 1HNZJ 2HHWA 5DQIA 3EJMA 5RUBA 4J9LA 5KFCA 2FC8A 1L3UA 3KUGA 1VRQC 1F0XA 2HNYB 4XK8C 3CJ4A 1RTIB 4J90A 1JLEB 4X4OA 1WKJA 2EC0A 3F41A 2QLFB 2V69A 1D9FA 2ZBPA 2OPPA 2HGLA 4DQQA 4ITSA 2ASDA 3W9IA 3IWLA 2GHVC 3FCWA 3O3LA 4EO8A 3PM9A 2R7TA 2OP5A 3X3UA 4DR2J 4J9MA 3K5NA 2F3JA 4K7QA 1E6VB 4ICLB 1VQSA 4JV5J 1KEKA 1NAQA 4DUZF 2J0XA 3H90A 4OX9F 2CPJA 2MKJA 4DR3F 2JLEA 4DR4F 3POTA 2MQOA 3MZIA 3HD1A 2RS8A 3ZFVA 3ILIA 1WEXA 4MKAA 1RWXB 4ZPTR 3MR5A 5LSRA 2YX1A 1NH8A 2V63A 1I94F 3R5AA 2N4DA 3TA1A 3W66A 4Y00A 4YB1P 3IG1B 5HROA 3TA2A 3MAAA 2QJ3A 2FHKA 1FO1A 1S6OA 4R5PA 4ID5B 1PKUA 2ZOFA 4K4WA 1WC0A 4IH7A 3KLVA 3PYEA 2CNKB 4UF4A 2ROGA 2V4JA 3LWLA 2HHPA 3ET6B 2YQ0A 3FSYA 3TARA 2OEMA 4TYAA 4KO0B 1DQAA 4G1PA 1XMBA 2ZNZA 3FBCA 1N0VC 2WCXA 5F8MA 1BQXA 2Z8QA 3CB4A 4O3OA 3I0RB 3W62A 5C2CA 3CJ2A 5GAGU 1KLMB 1PYTA 1HPZA 3ZZOA 2PDAA 4N8OA 2AGPA 1PJ7A 1ZA2B 3J7ZT 3AT1B 5E3CA 3BGUA 5EHHA 4J5OA 1V5IB 5ETSA 1QE1A 2H9ZA 3NL0A 1CJKB 2WZ1A 2PT0A 1W7WA 5J2PA 4CT9A 2ZBRA 1RKJA 4TN2A 4FN5A 4NXMJ 2NYIA 4BS2A 5HLFB 4P7TA 1U1RA 3W63A 4OZ0A 4ZCLA 1FFWB 2L08A 2QMXA 4L75A 4IO9Q 2W01A 4LT6A 1Y5LB 5D6GA 1W25A 5B7WA 1UL3A 2N7CA 1WKKA 2PSZA 4FS1A 4PEOA 4P6QA 5J1EA 4ZVRB 3CDAA 1VQOS 4OJHA 2PD1A 3IWNC 3H7HB 4OYBA 3NCQA 3KLEB 2Q79A 2DY9A 1RT4A 3D6MB 3UPFA 4E8UA 3IS9B 5C2GA 4O3QA 5B0FA 3GIMA 3PZPA 1TUWA 3JQKA 1ZTWA 4OL8A 1UVNA 4QIWD 2PMZD 1D1UA 2UUAF 1PBAA 3DLJA 4MKYA 2OSRA 5A6PA 4NE9C 1VHFA 3PYGA 1YLXA 3TO8A 2GIFA 4QPTA 1Q53A 4YB5A 1EKRA 4USUA 3QT6A 2E5IA 4NPOA 5B0BA 4JYAJ 1NHKL 1U48A 1X4HA 4FF1A 4NZ7A 1VC5A 2GMHA 1MSWD 1YJUA 3BPDA 2C3MA 1RABB 1ROFA 2FJXA 2CQBA 2RRBA 1VQ6S 3KLHA 3ENWA 3LQVA 4OJ1A 3Q89A 5D78A 2RQCA 3MFHA 1H74A 4LF9F 3D0IE 6FD1A 3K7RA 1VRUB 2XMWA 2RQKA 2CJBA
chains in the Genus database with same CATH topology
5E0OA 1TP7A 4WFZA 4ECRA 5F8NA 5L1LA 2YNGA 3BSAA 1NJIT 5AE3A 2DCUB 3UD4P 2XMMA 2UUBF 2VG5B 1U1MA 2OJ3A 2HHUA 5F41A 3OW2R 3QO9B 4YR0A 4O3RA 4ECQA 2K8GA 4WK1A 2ZHBA 3K5PA 3AA9A 2J6TA 3KHHA 3PJXA 2JEIA 1TL3B 2ERRA 1N8RT 2QSFA 1RP5A 4PQUA 2JSXA 2ZVSA 3R27A 2P6SA 3R5BA 4PG8A 2CJKA 2DVIA 1DQ8A 4B9MA 2IA0A 3TAMB 1KR4A 1KQSR 1YJVA 5E3AA 4GC7A 2ZJQQ 3EGWB 1XC9A 1WG5A 2VPYB 2CQPA 2LA4A 3HHLB 4C8NA 4YFUA 1XMOF 1OQ6A 2B4UA 2HVHA 2X1BA 4MKBA 2PIIA 3H2VE 3CJ0A 5KFZA 4DV0F 3MXHP 1IKXB 4ZPVR 4ZHRB 3M8QA 5E41A 1VFJA 3T6BA 4R0EA 2J9DA 4IYQA 4KGKA 2K3KA 1FXLA 2K2PA 3IAM9 4LSNA 4D3HA 1Z4UA 2ZUGA 1LWCA 4JV5F 2VB6A 1TKZA 4DDFA 4JI7F 2RDIA 2HMIB 1R8BA 2PGCA 3D54A 2R2SA 2CJAA 1X4FA 5IXUA 1WNEA 4M5DA 3AQOA 3LW5C 3R5DA 3OHBA 4JUZA 4NCAA 1XR5A 4I67A 1VIXA 1JJ2R 2DHGA 3MTKA 2MQQA 1UJ4A 1NJYA 1TKDA 2M5YA 3J81Y 1Y5NB 3CO9A 1UMJA 2J7KA 4PG7A 1RYSA 2KT3A 1VBXA 3RB0A 2IBOA 5J1PA 2C2EA 4CO4A 3OUYB 2Q6BA 4KSEB 1GX5A 1WF0A 4R25A 1TR0A 4WXOA 1C0UA 5G0RB 2XULA 3Q8QB 3M9OB 5SUHA 1JLGB 2MMYA 1S48A 4YEAA 1VQKS 2XG8A 3KMQA 1U1LA 1S1TA 3Q2SC 5BJRA 1S97A 3C3LA 2CKWA 3O1LA 4N76A 3TUJC 1N5QA 4KFBA 1FEHA 1D0EA 4DQRA 1RAJA 2GGPB 2HFNA 2JRSA 2WSFC 4IR9A 4KHPF 2XI3A 2VODA 3MGJA 1UETA 1V3ZA 2RU3A 1TL3A 2AJ4A 1ZETA 4HT5A 3KG4A 1H2UX 2E66A 2IC3B 2ASLA 4CQ1A 2MQLA 2OPRB 5DDQC 4ED7A 5DLFA 3ZZ0A 3CJ3A 4LVNP 4QIVA 3VQSA 4NLRA 2YWGA 4FVCA 4ECUA 3TRGA 4KRWA 1X4DA 3HHLA 2IAJB 4N8NA 4A8WA 2OIHA 4NYZA 1RGVA 1HWLA 2XMKA 4QW9A 3BDEA 3J7A1 3WX4A 4IQMA 5D3GB 1N5TA 1K9MT 2XBPA 1Y0HA 4ELTA 3NP5A 2YX7A 3HVWA 2K1RB 1K0VA 4QZVB 4JI3F 2DHXA 3GFZA 2E7WA 4G1QB 4CO1A 1HD1A 1ZAWA 1X5TA 3SFGA 2OTLS 2Q66A 5KFJA 3ZZZA 1N34F 3UCZP 1F2GA 2GO8A 4ECSA 2RJZA 4MK9A 5M2PA 5KG6A 3UW1A 2HLUA 4WK3A 4RNNA 5L38A 1VMBA 3L3CA 1YHQS 1SL2A 3DC2A 4PXCA 3AH6A 3HVTA 3CF5Q 1FHTA 1SJRA 2FVPA 2PI4A 4AL6A 3CCSS 3UR0A 2O67A 4RW6A 2RDJA 1CQNA 1GAOA 5G0RA 3DGPA 1JLGA 5A6WA 1RJJA 4NXNF 3FMBA 3UQSA 2XSFA 4HEA9 4B9UA 2CQ2A 5F8JA 4LF5F 2G0CA 4UY8T 3LALA 3PW4A 2JVOA 2L9DA 1JKHB 3RB3A 2GGPA 3SSRA 4DG1B 4TQRA 2MB0B 1Q86T 2DR9A 1AFJA 4DMZA 1U26A 4H54A 3HP6A 1JXLA 4B9SA 2LEAA 3W7BA 3OJUA 3NNAA 4A8MP 2BA9A 2NQPA 2W9AA 4MTPA 2IC3A 4Y2MA 3B4DA 5F0WA 5FD1A 3G6VA 2OPRA 3CC2S 2MZTA 3SMZA 4QIFA 2JVRA 3DXSX 2KB2A 2B9WA 2NREA 4Y2IA 5IFMA 2P6TA 2RS2A 1T02A 2FHJA 4P7VA 4GC6A 3MR3A 1R6YA 1NHUA 5KFTA 2N7YA 1IBLF 2R7WA 5I3PA 1DTQB 2AX1A 2GQ2A 3KLFA 4ZPAA 3PR4A 5D3GA 1R7IA 4OZNA 3DLKB 5I3UB 2Q43A 3D1HA 1TFYA 3OSNA 1S7HA 1YG0A 4JI6F 4WCEQ 3TW0A 3MM9B 1NEEA 4I2QA 1HWKA 1HWJA 2FJAB 2RH3A 4X2BA 3GR0A 4NA1A 4DL3A 3K8WA 3Q0AA 4V19X 2HRUA 3HI9A 1SBRA 3HHEA 5GADI 1RT2A 4MJKA 1YTYA 1S10A 4GO5X 7FD1A 2F7VA 2GJ2A 2B4VA 1K73T 4K5SA 2DGVA 2XLIA 5AE2A 4DLGA 3TNVA 3N6NA 1U4BA 3OTBA 2D41A 1Y7PA 4C7QA 4FXDA 5IT4A 1H0HB 1MU2B 4NXMF 3EUNA 4ZDNA 4R5PB 4WFNQ 2VFRA 4H4MB 3CIMA 2MQPA 2J7WA 4FBUA 1H6KX 3MM7B 4A8QA 1JKHA 5HMZA 3GILA 4DG1A 4DLEA 2N4CA 3DRXA 2VC1A 5CCLA 4DR1F 2M8HA 2WOMA 4KB7A 2IYIA 2AGOA 2UXCF 3M8PA 2V4JB 3VWSA 3PNIA 1XMQF 1TQLA 2V8DA 2ZNYA 3ETOA 5A8WB 2KTQA 3H20A 2JC1A 4HH1A 2MXYA 4C3KA 3ZZPA 3HPOA 1XEZA 2IHR1 1CEZA 2QA4G 3PW0A 3EX7B 3QZ8A 4EU0A 2KZZA 2DGUA 2BRKA 4PXEA 4ZVGA 3T3FA 3N6MA 3OLAA 2CQ0A 2DO0A 2HYIB 4F25A 3AJ2A 1FESA 2JC0A 4R8UB 3H5YA 1ZZFA 1M5SA 2XEXA 4H4KA 3P96A 2XS7A 3E2EA 3N6LA 3OL9A 1DTQA 4LSLB 4NCGA 1XR7A 1GXUA 3GYNA 4EBEA 3FRZA 1ZPVA 5JUMA 1Q4RA 1GXLA 1ZH5A 2M2BA 3DLKA 5I3UA 2VG6B 1U45A 2FY1A 3ZZRA 1TZ0A 3T19A 1N4LA 2KH9A 1HQEB 3S01A 4FVMA 3E51A 5M2RA 2R2UA 4AFFA 3KTQA 3BN4A 3MM9A 5D8HB 3BO3A 2DIUA 3D1OA 1FTRA 4OZ5A 2LXFA 1N88A 3DOKB 2FTRA 4CNZA 3AJ1A 3SI8A 1LWEB 3D0GE 2HHHF 1HARA 5DRKA 2E5JA 2B4OA 4CNYA 4RWWA 4EYHB 2IRXA 2HLTA 3DLGB 4USHA 4C9DA 3HLUA 1HPZB 1VQNS 1O5JA 2L9NA 2V2KA 2VOOA 1DLOB 3DLHA 4MMOA 2DTJA 5KFFA 3SXLA 1Y3KA 4RLEA 2NXUA 2ACYA 3HHLD 1D9DA 1BQNB 1JLBB 4EO6A 3V4MA 1MU2A 1X5SA 2FDNA 4H4MA 2KRRA 3MM6B 4DFMA 2QV6A 1NZAA 3MM7A 4RWXA 1UVLA 3NNCA 4HTJA 2ZC4A 4QIGA 1X4AA 3P3DA 5CYQB 1ZAXA 3I6PA 3HO1A 4DQPA 3T1HF 4GKJF 2DNMA 1L3SA 2AX0A 1AROP 2EFOA 4KV8B 3PO4A 3F56A 4F3MA 1Q8LA 1ZM2A 5KFOA 1QE1B 5A8WA 1WEZA 2RD5C 1F60B 4RBTA 3WZ0A 2LLZA 4DF4A 1HMVB 3TANA 1JJHA 2NSBA 3WDOA 2HAIA 4TKTA 3THTA 2XO7A 2BM1A 2ADBA 1Q78A 2FVQA 5D4OA 4WFXA 2EFQA 1RT1B 3DNCA 4YR3A 3KK1B 2OH2A 4R8UA 5J2PB 3BR9A 5L39A 4USJC 2V94A 4LSLA 3T5JA 2Q1LA 2XC9A 3NNHA 2V0NA 2XS5A 2DH9A 3RYLA 4JYAF 2E1AA 1XN9A 2YKQA 4RKUC 2GA7A 4ED2A 3PW2A 2VPZB 2D9PA 2VG6A 2HWHA 1HQEA 2JEGA 2YY3A 1VQPS 3MECB 1HBMA 1PC5A 2HFZA 4YQWA 3MEGB 2EBGA 4JI0F 2VD3A 2FD2A 4RBVA 2BYCA 1Y3JA 4KE5A 5LSOA 4DFKA 4LF6F 3DOKA 2PEHA 3PXGa 1ZBTA 5SZTA 2DNKA 4JBCA 5B0AA 3DLGA 2ZDPA 4RUHA 1U2RA 3MD1A 3ZZUA 2KDOA 4OI4A 5B0DA 2E44A 1DLOA 3DDNA 4OZ1A 4L72B 3KFWX 1D3WA 3BGFA 2R2RA 2BABA 2FHJD 1JLBA 2LA6A 4EFAC 2QMWA 4K4SA 3UD3P 1XNRF 4Z2XA 4K4ZA 1UKUA 3HX9A 5CYQA 2DNLA 3FQLA 4IFYB 5I4MA 4KGMA 5KFYA 3L7OA 1JLAA 4OI2A 5T7LA 2GC8A 4KHRA 4ZCIA 5KT4A 2UUWA 4KV8A 5J1EB 2KVIA 2YNIB 2OMOA 3DRPA 2CIMA 3PFEA 2R7UA 4TYBA 4L6V3 1OS5A 5BYRA 3FEZA 1NJWA 1FJGF 1JLFA 1FRHA 1HMVA 2I8EA 4YP3A 2C28A 1TL5A 3Q8SB 4F4XA 1T03A 4BBYA 4OHYA 2GFFA 3MUTP 3DFEA 2C3PA 2YKNA 1RT1A 2YKOA 3KK1A 1MMDA 2CDQA 3CTRA 4ZCKA 4IRDA 1FE0A 5KFAA 1Q1KA 3NBPB 1U6ZA 3GMGA 1URNA 1HYSA 4B3OB 5AXLA 4A8KA 1Z2LA 4EEYA 4WFBQ 4RX6A 2CPDA 3LP1A 4FNHA 5B08A 5LT5A 1P27B 3NKYA 5KT7A 1VRTA 3M1VB 2C2RA 4ZA1A 4O4GB 4QW8A 2CYYA 4I2PB 2YX4A 3MECA 4CI0B 1FKOB 2HS0A 2WSCC 1R27B 3MEGA 2AJ1A 4DSEA 4MIAA 2DGTA 3OFHA 2N3OA 1FRLA 1URRA 3U1NA 4PRFA 2B6AB 4LIWA 3G6YA 4IOBA 2YKPA 3PACA 2EPIA 1S6UA 4WU3A 1OSCA 1XERA 2ZE2A 2ILZA 1RA7A 4DSKA 3KHRA 3JSBA 1XWLA 4WKYA 2WB4A 3SYZA 4G3IA 4F2RA 3HHKA 2W24A 3H8YA 3M8SA 3CSKA 2M8DB 2A2CA 2CJ9A 1RTJB 4OHZA 4KTQA 2KHDA 4O3NA 4DL6A 4O44B 1N5VA 2OD4A 2ZBCA 3I9ZA 3MEDB 3OFFA 1JIHA 4ZP9A 4AQYF 1QSSA 5EDWA 4IDKA 4IFYA 3MPVA 3D0HE 3PIOQ 2RB7A 4U67Q 2MHNA 3LAMA 3OSPA 3MCSA 5E2QA 2PI5A 4KJIA 2YNIA 3OFEA 1F9FA 1KC8T 3DRYA 3NS5A 2M0GB 3RB4A 4O4RA 2CVEA 1SJ3P 5DG8A 2FUG9 4RW8B 3MEKA 2DR8A 3CD0A 1FKPB 2GO9A 2MDAA 3L95X 5G4DA 4PWDB 3JTPA 1U1PA 2ZOGA 3U1MA 1APSA 2V8GA 2P9GA 1UAWA 3NBPA 4B08A 3NGKA 2VL1A 3H5SA 2QLXA 4DSLA 3ULHA 5HMXA 3RAXA 4XDDA 3NMRA 4B3OA 2HHVA 3MAQA 3NRBA 3CDUA 2JOQA 5K5MA 3GQCA 2LEPA 3MMJA 1JK9B 2N82B 1VQMS 1FE4A 3M9NB 3K5MA 2ZFHA 3M1VA 4M95A 4DV6F 4O4GA 4BWJA 5KG3A 5F8IA 3EGZA 2HNDB 4DBQA 4I2PA 1FKOA 4Y2CA 4LMZA 3H40A 4WYLA 3VAHA 4PUOA 4F8RA 4YDDB 5A0YB 1G2EA 2C3OA 3Q22A 1S1VB 2B6AA 3C66A 1VQ5S 3QIDA 1WTBA 1PILA 3OTOF 4KHMA 4I7FB 3QGHA 1GXTA 1LXJA 1WTFA 2CPIA 2CQ4A 4ZPCA 1IBKF 4C8YA 5EGYA 1N52B 3QWUA 4OFZA 2GMJA 1RT3B 4QU6A 3H4BA 3K5OA 1UEVA 2RIJA 4X4NA 5IWAF 1RYRA 2J76E 3OTCA 2WB1D 3V81B 4N5SA 2HHXA 1RTJA 1A9NB 3L09A 1JMTA 2MYFA 3TAQA 1X5OA 3QJJA 3K0JA 4IOCQ 1HI8A 1R89A 3HZEA 3KLGA 2L9WA 3MEDA 3IFEA 3WBZA 4NA3A 1KN6A 2DRBA 4FF3A 3BGRB 5GAEI 2VFSA 1FDDA 1FT8A 1LW2A 1Q7YT 4WE1A 2LMIA 3Q8RB 4B3RF 3JYTB 2CQHA 1P6TA 2EKYA 2IFXA 4ILRA 1B7FA 3KHLA 1REVB 1Q82T 1YRXA 1SL1A 2FVSA 1VLYA 3OTDA 3UR3C 1R8CA 3GV7B 2R8IA 4LSNB 2LQ9A 3QAEA 3QJLA 4F67A 1LWCB 2GX8A 1TKZB 4RW8A 1FKPA 4IFVA