2FTRA

Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
ENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (10172812) from BACILLUS HALODURANS at 1.40 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Unknown function
molecule keywords BH0200
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07110 EthD EthD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ftrA00
3IWXA 3LO3A 3MZIA 1OQ3A 2HLTA 4HI2A 1GXTA 3CJKB 4F67A 2XMTA 5B09A 2HFOA 4DL0C 3HHLA 4Q2MA 3LGNA 1U7LA 3BM7A 3BF4A 2K7KA 4QOTA 3TRGA 2RMLA 1SQEA 5B0AA 4Y2KA 2IFXA 5T7LA 2HFNA 1RJJA 4FNHA 1S6OA 4YDXA 5B0EA 4HI1A 2JDJA 2HQIA 2L3MA 1CC7A 2Q3PA 3I9ZA 2CRLA 2OFHX 1YRXA 3GZ7A 2RILA 5A6PA 2KKHA 2OKQA 2ZDOA 5T7LB 2KYZA 1Q8BA 1N5VA 2ACYA 1N5TA 2KT3A 1FE0A 1LQ9A 3DCAA 2PD1A 2G9OA 3BGUA 2FHMA 4OJGA 1WD6A 2ASYA 2XMVA 1YJUA 2XMWA 1JWWA 1OPZA 5F0WA 4YEAA 1XBWA 1P8GA 2FIUA 1TZ0A 2OD6A 2BJDA 2GFFA 2QYCA 1X0PA 1TL4A 1Q4RA 1Y9OA 1P6TA 2BBEA 4HL9A 2ROGA 4A47A 1N5QA 1ULRA 2KT2A 4ZOSA 1APSA 2W4CA 4A48A 2OMOA 2ROEA 3FGVA 1W2IA 2GGPB 3WDOA 1Y0HA 3T9NA 3BN7A 2BJEA 1MWZA 3QMQA 3HHLC 2FTRA 2AP6A 2IYGA 4DN9A 2K1RB 1YJRA 4OJ1A 2ZDPA 2W4PA 3TNVA 3HFKA 1AFJA 3KG1A 4NPOA 2GGPA 1X8DA 4OJ3A 5IXUA 2K1RA 5K9FA 2XMMA 1KQKA 2K2PA 4Y2IA 4A46A 5F0UA 2XMUA 3LGMA 1X7VA 2ROPA 2VV5A 5B0BA 5B0DA 4Y2MA 2QLXA 2K7JA 5B08A 2RU9A 2HIQA 2VH7A 3BR8A 2GO8A 2W4DA 2XMJA 2OFGX 2OD4A 1AW0A 2GCFA 1SI9A 1FD8A 2N4DA 1URRA 1TR0A 3MCSA 1YJTA 2LDIA 3QGPA 1FE4A 1OSDA 3HX9A 5A6WA 3VTIA 1YJVA 2RSQA 4OIXA 2PGCA 1TL5A 3KNGA 4ZA1A 3UDCA 2BUNA 3FRYA 1VQYA 3E8OA 3HF5A 4HH0A 1KVIA 3CJKA 2GV1A 3K7RA 2AW0A 4HH1A 4U9RA 2N4CA 1N5SA 1QUPA 1VQSA 1SB6A 1Y3JA 2GA7A 2OAUA 4EFAC 3BB5A 2LQBA 4Q2LA 5KAKA 2EW9A 1IUJA 3HHLB 2LQ9A 2BYCA 1MWYA 2LXFA 1V3ZA 2IYIA 1Q8LA 1R6YA 1TUVA 4A4JA 3HHLD 1FVQA 3FMBA 3BDEA 5B0CA 3KKFA 1S6UA 2N7YA 1AFIA 1YG0A 3DXSX 1KVJA 1OQ6A 3TOQA 2XMKA 2QIFA 2HLUA 4FNIA 1GXUA 1Y3KA 4OJHA 1K0VA 3HDSA 3F44A 5B0GA 2FB0A 5B0FA 2AJ0A 1FESA 2OP5A 1Q53A 3IWLA 3KG0A 1FEEA 4DPOA 1JK9B 1CPZA 4NL5A 2AJ1A 1CC8A 2QLWA 1FVSA
chains in the Genus database with same CATH superfamily
1NKBA 2AZ3A 4RW6A 1OQ3A 2E7XA 4DLGA 4CLTA 1HW9A 1RWPB 5CYMA 4BC9A 1FDNA 3PW0A 1YJWS 3J7A1 3I56S 1F2HA 8AT1B 1RLDA 1CVJA 4RW4B 3MECB 4Z7YA 3PACA 1T05B 1PC4A 2CIMA 1N6QB 3DFEA 1FKPB 3RRGA 3KJQB 1FJGJ 4LMZA 2H51B 2K7KA 1CJVB 2NXNA 2ZBIA 2UUCJ 1EAYC 3MCNA 3IBFB 4B17A 1LWFA 3M4XA 3OXGA 1KFSA 2W25A 4DV0J 2Y0SD 4U95A 5F8NA 2IDEA 1PAEX 4OX9F 3A12A 3DOMB 4B3MF 2Z30B 3NOCA 3F56A 2W8KA 2EFOA 2OI2A 1S77D 4O3RA 4KO0B 1ELOA 3NRBA 1Q8IA 4NEYA 1U1OA 5CCLA 4MYUA 4FYDA 4FDFA 3L4BC 4ES2A 1TVRB 3G6VA 2WONA 3H40A 4CH1A 1MMDA 3MEDB 2XMVA 2IBOA 4OYPA 3GJSB 3ISND 1J5EF 4Y0FA 3FFIB 2AYGA 1TZ0A 3HK2A 3R6LB 4NXMJ 1SC1B 4I6YA 3MEEB 3GE9A 2VICA 4Q45A 2E66A 2E1MC 3BEGB 3GPAA 1WTFA 2V68A 3S1TA 1HIYA 3FSYA 1VR6A 2ROEA 3M32B 5DDOC 4WYLA 1U1RA 2J76E 5KG0A 3QFWA 3D67A 4DDFA 1O8BA 2BACA 2LKZA 4ZVTB 1R6VA 4JV0A 1EQMA 1WI6A 1RT5B 3DMJB 4RBTA 1O51A 2XQCA 4EYHB 4UY85 2AP6A 3QFHA 2XS5A 1WF1A 1S9FA 2CQ0A 1B70B 5AJ3J 4QWAA 1NDKA 2NPIA 4ELVA 2J0SD 1XR6A 1FHTA 4TLRA 3ETOA 2XS7A 2QO3A 4L75A 1G1XA 4UW2A 1H2TZ 3OJSA 1WG4A 2GAHC 1T3NA 1NHVA 1WHVA 5F0UA 4OZLA 5F3ZA 3TUPA 5D0EA 1JJ2R 4L72B 4UF4A 3TI0A 2PT0A 4XPEA 1BHNA 2DD8S 4LSNA 2PSZA 3BR8A 1RHJB 4ZVGA 3T1HJ 4OI0A 4Z37A 3RAMA 2GCFA 1DLOA 2IVFB 1YJTA 2PDAA 2LDIA 3K2YA 3ZNJ1 2CPEA 1U26A 3KG4A 3CTRA 4HTJA 5ETMA 2DGWA 5A6WA 1H73A 2GHVC 4EZ6A 2HKEA 4EK2A 3KNGA 2GO9A 3ZO7A 3TZZA 2FPHX 1RWOB 4J9PA 1H74A 2ZD1A 3UNYA 4OLPA 3ILJA 2AW0A 4DG1A 4X4RA 2E9RX 2MKSA 4OYAA 4DR3F 1VQSA 1RZMA 5T14A 1JLBB 3SCIE 1DQAA 3BB5A 2CNKB 2BJ3A 2YNFB 5DG7A 2AEMA 1IQZA 2B9EA 2OEMA 3KLIB 5CQGA 2JEGA 5LJ3Y 2COLA 2R7QA 5A8WA 1VDHA 2A2CA 2QA2A 3D9BA 3I31A 1Q8LA 4DV3F 2KHDA 1BXNA 1UVLA 3FZ2A 1VQ6S 2DB1A 5A0YA 2X1FA 4X65J 4OYMA 1N36J 5C42B 1LOUA 1SJ1A 4RNOA 1RT6A 3TZYA 1TAQA 4V1Ak 4HDHA 1DTTB 4PYDA 2JEFA 1T11A 1RWUA 2AZ1A 1UKUA 4HLBA 1NPPA 1WC3A 1N5YB 4O3OA 4EO8A 3VWSA 1ZTTA 2B8PA 1C0UA 3FQKA 1RT1B 3GQCA 4K0KJ 1SC4B 1Q53A 1HI8A 1KBRA 3DOMA 4DV7F 2I8EA 1UFWA 2I9SA 2FHJA 2F3JA 4F8RA 3OVBA 2AJ1A 1VBYA 5EN1A 3SEOA 2F65A 5KFLA 3HP6A 2HLTA 4TYAA 4I6WA 1F5BA 3M1VA 1UAWA 1GTEA 4LR9A 4RWWA 4ZCIA 5HMYA 4DS4A 1DTTA 2Q6CA 4Q2MA 5D0GA 1YIJS 2XWXA 2ZNZA 4ZMMA 2HYIB 3AQPA 4JI2J 2HEKA 3NMRA 1F2GA 2GIRA 1U02A 4ZVSB 4LQ3A 1IKWB 4DL3A 4HACA 3UCUP 3CCSS 4JV1A 2XY5A 1TKZB 5KT5A 4E2FB 3HXMA 4LRCA 4ECXA 2R2SA 4ID5B 1RJJA 1QVGR 2OJ3A 3R27A 4KPYA 4K0KF 3J80U 5HL7Q 2HQIA 1LWFB 2M70A 4F36A 3M8PB 5KFWA 4LFBF 3RW6A 3ZZTA 2ZITA 1VRUA 5BXIA 4DX7A 3ZNUA 4X65F 1S0VA 4ZVEA 3BZQA 4PXBA 3EGWB 2BE2B 1FFGB 1EETB 3ZTOA 3OUYA 1WF2A 2YQ3A 2RNEA 4OI1A 3CCVS 1D1UA 2DYAA 4F0HA 1ZM3A 4LF4J 3MPUB 4WFNQ 1FXLA 2AIRB 2BJDA 2GFFA 3QAEA 4PG7A 4C2MA 4FBUA 1ZAWA 4WFBQ 1P6TA 3CDUA 2UXCF 1IWGA 2ROGA 4KGZB 3OSPA 1N5QA 4OZ3A 5L9XA 4TQSA 2W9CB 2J6TA 1UZHA 5M2RA 2UVUA 2DY9A 5J1PA 4PXCA 1U2CA 2VFRA 3PW7A 2C2RA 2LXUA 1BGXT 3I5BA 3PR4A 2PI5A 1MWZA 3M2VA 1B64A 3GSDA 3IRWP 4YFUA 3T5KA 4DL7A 4FVMA 3CCTA 4IKAA 4KBIA 3PW5A 2RQMA 5M2UA 3DLGB 4DBQA 3DMJA 4DL4A 5GVQA 5KT7A 3KG1A 1X0FA 4DFMA 2YX7A 2GGPA 1RAIB 4ILLA 1C1CB 3PV8A 4HHHA 4H4MA 5A0YB 5CZVA 1MWQA 1SH0A 1LEOA 2GZOA 1RADB 2XULA 5HI7A 4DHVA 5A8WB 5B0BA 5RUBA 1UEKA 4RWXA 2LP4A 1UW4A 3HSZA 2XM3A 4NOHA 2R8HA 2R8GA 3TWZA 2N4DA 2E29A 2X3GA 2XTJP 3MCSA 1TKXB 2C3YA 2KM8C 1KOHA 4X4QA 2CJ9A 4OIXA 2CPZA 1LW2A 3H5SA 1RT7B 2B6AA 3PEJA 4OV6A 4S0MA 3UCZP 5HLFB 2VBWA 2HWIA 5K8MA 3LH2S 4M5KA 5KFTA 3EZUA 1WORA 5D4NA 2YH1A 2NUUG 1FKOB 2P9EA 3Q83A 4OZ0A 1S49A 5KAKA 4IFYA 5KFPA 3VAJA 3HHLB 4R5PA 4KRWA 3CB4A 5C5JA 1S97A 3FCVA 2HBRB 3UFCX 3VVTA 2UVVA 3SBMA 4JI3J 4OMFG 5DQHA 4IUFA 4C8ZA 3W9IA 4LIRA 4N77A 3BBBA 2ADBA 1Y5LB 2B4OA 5J2NB 3CCLS 1VHFA 3QIPB 2VKRA 4ZIVA 3PX4A 3BPSP 4LF5J 1TK5A 2AJ2A 5KOWA 5KFCA 3K59A 3LQVA 1NJXA 4B3SF 4HACB 2DNKA 1TKZA 2QIFA 2P9CA 4KKOB 3A8IA 3MPDA 1RAHB 3AQOA 4M5MA 4AXIA 1MU2B 2PMHA 1PC5A 2XSFA 2BABA 4QWCA 3RB3A 3KK2A 4QYZK 1TL1A 3UVJA 2J9DE 2WONB 3IWLA 3TEHB 5KFMA 3KG0A 4IOCQ 3R7BB 3K5LA 2AEJA 2BE9B 2MQPA 1KTVA 4USVA 1S4EA 1AUSL 3OTDA 1EX8A 4OL8A 3ENQA 1YGYA 2Z58B 1NH7A 1V5IB 4RNHA 5U47A 4WXWA 5ETPA 3SCLE 1NHKL 1XN9A 2O01C 1KLMB 4KQZA 2MKIA 2QFJA 1M5PC 1QTMA 4U7UD 4LF5F 4JV2A 2UXBJ 4IRKA 3D68A 3D5MA 1YLXA 4NI2B 3TVZA 4AL7A 2RMLA 2HVDA 4Y2KA 3DU5A 4ILMA 2VG7B 1U0SA 2QG9B 2YKMA 1V9OA 3D66A 1VJWA 4FYXB 3A8KA 4NZ0A 3DKDA 1NK8A 1SJRA 2OUGA 2GHPA 1VQKS 4FXDA 3ET6B 5AE2A 1RSCA 3TX8A 1N5TA 3T1AA 4OJGA 4RBVA 4UOHA 2BRKA 1DURA 1WEXA 1CJKB 2G9OA 3ZTRA 2E7WA 3OHBA 3VAIA 1OSCA 3N6MA 4O4GA 1S6QA 2KT5A 2PMWA 3MECA 1RWMB 2HZCA 5KFSA 1VC5A 4DR7F 1IKXA 1S48A 4DUTA 5J1EA 4C7QA 2F9DA 2MJNA 3M2UB 2M9KA 3S6EA 1BD6A 2OPRA 3MD1A 4XTTA 3SQOP 1WSVA 4DFPA 1XWLA 1U8SA 2RHSB 1UTAA 2J7UA 3L3CA 2NLWA 5BR8J 2HQCA 4DPYA 1RUSA 2OMOA 1UP1A 3VAHA 1S1WB 2ZE2A 3VALA 3UE2A 2HURA 2VOOA 4G6VB 3QLHB 4K4YA 3G2XA 1JLBA 2HGMA 1H6KX 1HHSA 3MPYA 1Q81T 4N76A 3ILLA 5H1SV 2AQ4A 1XMBA 2HGNA 2R42A 2NSCA 3DRYA 3OBIA 4CQ1A 4DN9A 5SUHA 1JLQA 5HN0A 2IJFA 5F8HA 4M5NA 3J81Y 2C28A 4YP3A 3JSBA 1UWAA 1KLMA 3HHDA 1B7YB 3ENVA 4RNMA 2XYPB 4CLFA 1GQEA 2RD5C 3PRBA 1KEKA 2K7JA 1GNKA 5JVHQ 2PEBA 1VGYA 3LOUA 2A10A 4GO5X 3D1HA 3UWTA 3KYLA 3F73A 2I38A 2WZ1A 2I6WA 1AUDA 4UY8T 3NGUA 4ZVHA 1VQNS 2UZAA 2LA6A 1MLAA 1QE1A 2AT1B 2L48A 2NR0A 4K5SA 1FE4A 4P6QA 5DQGA 2JZ5A 1CJUB 3BBFA 3QZ7A 3R9LA 1IKVB 4E8UA 1YBTA 4MYTA 1TL5A 2DPJA 2BUNA 2FHJD 4KHRA 3H8YA 3HF5A 3TR5A 3WQPA 2M7SA 3OL6A 3PZPA 2DR9A 4B3TF 1N34J 4ED2A 3W1YC 2D3OR 3FZBA 2BVZA 1F3VA 4CP5A 1S9GA 2V8VA 1IWAA 2JC0A 1NB7A 4ETXA 4B9TA 1JJCB 3CD7A 2N82B 1RTHB 3EPGA 3BDPA 1N32F 2FZGB 3RG6A 1RT6B 3V4IA 4OX7A 2IYIA 4IFVB 4JOUA 3CXCR 1QD1A 2XHWA 4A4JA 2LYVA 2GIFA 2LQ8A 3FEXB 1N56A 2V63A 4H4OB 4DF8A 4M95A 5DO2A 3BDEA 4LF6F 2AGQA 1VBXA 2QGFB 3KLIA 3NOGA 3MI7X 4DR3J 2RRAA 4PWDA 1XK8A 5F9LA 1VK3A 2N7CA 2BJ8A 1RTIB 5FDLA 2QRRA 2FQQB 3PO5A 3GR0A 1NHUA 4TY9A 2DKOB 3AB2B 2BW7A 4P10A 1XQIA 4WP8A 1RTHA 2DRBA 1FEEA 2EWHA 2WW8A 1FDDA 4P71A 2C2MB 2C42A 1SL0A 3D54A 2NSBA 5JXSA 2MZSA 1SJ4P 2DXFA 2E1PA 2UV8A 5MLCV 2HHXA 3IWXA 2DGTA 3MZIA 5KFKA 4WZMA 1T03A 1GXTA 1LFWA 2EKYA 4RNNA 4A8OA 4TU9A 4ATNA 5EWFA 4AUKA 4NLDA 2R8IA 5AXKA 2MQLA 2GC8A 4NLVA 2AEFA 4YB6A 5F8LA 3R7NB 3U02A 3AHPA 1N88A 4NWBA 3CD0A 2XMAA 5J2QB 1U49A 2GQ2A 3M2VB 1SQEA 1CQMA 3DI6A 1HNIA 1ZZFA 3IM8A 4CNYA 5CA5A 1KNZA 1HHQA 2YNGA 2E5JA 1I51B 1LKZA 2DRDA 3KWMA 3HVTA 4C11A 1T9WA 3LWLA 5AE1A 2AD9A 2B5JA 1HBOB 1NZ8A 4WFZA 5IQ6A 2YPZA 2IIHA 5K8OA 2B7BB 3DRPA 4C9DA 1WJ9A 4X4SA 2V4JB 3C14A 3MXHP 3E3XA 1XJWB 2MHNA 2ZDOA 4ZLJA 2LXIA 4M5IA 2YXLA 2ACYA 4YB7A 3RJMB 3SXLA 1S10A 1NK6A 1KLNA 1IKYA 4OX6A 4FYVB 1IBMJ 4QIVA 4ZJOA 4JI8F 2KXHA 2ATLA 1DTQA 2MDAA 1HNZJ 4ZLPA 1NZAA 1RBLA 2MKJA 5I42A 5HK4A 4JI1F 2DGOA 2QYCA 4F4XA 3UDEA 4PWDB 4TY8B 4LRFA 2O5DA 2WSEC 5IC4B 1VQOS 4ZHRA 2DHGA 1LW0B 1KC8T 2E1RA 3EPIA 3H4BA 2F5GA 1DJ0A 2FHKA 4X4TA 4PG8A 3D2WA 4B9MA 4RL1A 4WKYA 1W2IA 3OFHA 3FUYA 4PPZA 4C4WA 1WHXA 4EEYA 2JWNA 1WC4A 4EMDA 2F8HA 2GQQA 2V94A 3KLVA 3EWGA 3TA0A 3O1LA 4EO6A 1G3OA 3KLFB 1BQMA 3GIJA 4LFCJ 4NCBA 1X4GA 2QSFA 2G0IA 3GMGA 4DN0A 4LF6J 3M8WA 2K2PA 3OR1B 3VGVA 5KG7A 5H9EK 3AJDA 4K4UA 4DV1F 4DU8A 2LQ5A 1NPKA 5F3TA 2RDJA 1HWLA 5AT1B 1WSRA 3HSJA 1WC1A 1BE4A 5HROB 3OVSA 1U1LA 1H0HB 2G2YA 1FD8A 3ADAC 3DRPB 4DUZJ 1WKKA 3JSMB 5D78A 3T1YJ 3GB0A 1CLFA 2EBEA 1S1UB 2HW3A 1R0AA 2X51A 3IBWA 1RACB 3EUNA 2CQ4A 2YWGA 2DCLA 3CJ4A 3FRZA 1NU4A 1KSPA 1HNZF 3MAHA 1SUQA 2DT9A 4DL2A 1GMVA 1WACA 3S7RA 2IM3A 3K5OA 1LWCA 1RBAA 2LA4A 2R7OA 4OHZA 3TVKA 2HZVA 4EFAC 1HBUB 2EK1A 3FFIA 1S1TB 1RBOB 3FEYB 2OH2A 3VF0B 2KTQA 1XR5A 4PKDB 1VLYA 1SJQA 1TUGB 1T03B 5F8MA 1P27B 2GJIA 2W2NP 2APOA 4WE1B 5KFEA 4LF8J 4ZPTR 2X7IA 3B6BA 3HHLD 3UD3P 3UD5A 4WP9A 3AOCA 2ZZTA 1S6UA 2ZOMA 4C11B 4R5PB 3MAQA 2VB6A 3GV8B 3E51A 1OS5A 3BSNA 5FJ4A 1KVJA 1NKCA 4GC6A 2HLUA 4CNZA 1M5HA 2HGLA 4F0MA 1VQPS 1VRTA 5HQ8A 3TAQA 1K0VA 2IM1A 2LMIA 2VFSA 1S79A 5IQQA 4ED0A 3PYDA 2IAJB 2C2KB 2ZOGA 1LW2B 4P7TA 4C6AA 4I7FA 2QL5B 1JK9B 5JVGQ 4JI3F 2UXBF 2GJ2A 2HFOA 1N34F 3MDFA 4Q44A 3L7UA 2ZH1A 1DTQB 4BWJA 1Q7YT 4K2XA 3CMES 3CJKB 1RGVA 4QIWD 5D6GA 3D6TB 4KH0B 3THPA 3DGPA 3EE3A 3QIPA 5IM0A 5I3UA 3U27A 3K0JA 1HARA 1KS2A 5ETQA 2HS4A 2WAQD 1Q7LB 5HATA 5KG6A 1Q5VA 2IDLA 4K4TA 1N8RT 4R0JA 2KL8A 2Z2ZA 2ABYA 3O5TB 2FLLA 4X64J 1JLFA 4YY3J 3UQSA 2UU9F 1GK8A 1YVFA 1LWCB 3K58A 3NG8A 3MMJA 4KV8A 5GAHI 1BC6A 1RTJB 3DLKA 4B3OB 5DDPC 5A6PA 2BX6A 5HVFA 4ZN1A 1S4FA 3J7AN 2DGXA 1OYDA 2VQFF 3HO1A 4JI0J 2D1CA 2UUBJ 1YBUA 3HT3A 3MMCB 2KT3A 4J9RA 1NKEA 1N52B 2BOAA 2CYYA 2UXDF 1WTBA 1YJUA 2BM0A 3QJLA 3SFGA 5F0WA 3CDWA 3DXBA 4QIGA 2PEHA 2QE5A 3KHRA 3FK4A 4X4UA 5FLXU 1WDDA 4M5LA 2WOMB 5L1IA 3QJPA 3MEGA 5D8HB 4JYAF 4FF1A 4F7VA 5A2QY 2A3JA 4A47A 3J7YU 4IR1A 3I0SA 4JB8B 4YY3F 2CQDA 4A48A 4V19J 3I87A 2YWWA 3CJRA 3U7JA 2MZJA 3ENAA 2BRLA 4M5GA 3WZ0A 2C2EA 2BKPA 2GGPB 4CO3A 2FVSA 4F02A 3T9NA 3JSMA 1N0UA 3CJ2A 2ZH2A 4C97A 1WNEA 2L08A 3JAMY 3ZC4A 1YJRA 4DU7A 1YRTA 2J8AA 4P72A 2OTJS 5HQMA 1AFJA 1Y00A 4O44A 1Q86T 2GMJA 2E1AA 3GTYX 1HW8A 3OUYB 3RR7A 3ULHA 3HHNB 1VK8A 2RAQA 1CJKA 1KD1T 5H9EJ 3G6YA 4ZDNA 4ZKAA 3IM9A 4JI4J 3MAAB 3HSDA 2CFXA 3RGIA 3DOKA 4B3TJ 3TVYA 2XMJA 3R5BA 3W2VB 3TA2A 2DNOA 3GFZA 2HFSA 4ZPBA 1Q1KA 2FY8A 2VD3A 3LUYA 5J2PA 2ZZMA 3QGPA 2ACMA 3W8GA 4QZVB 4G3IA 1VRQC 2RSQA 1X9MA 2UVRA 3LPEA 2PC6A 1SIZA 1HL6A 2RS2A 1KN6A 2V34A 3TZWA 3RB0A 2EBGA 2Z4PA 3OQ2A 5ETLA 3VGSA 2KVQE 3W63A 5LSOA 4M5HA 2V4QA 3EXYA 4XO0A 3DLEB 4CLPA 3CUNA 4WCEQ 2ZH9A 1M5VC 2OO4A 2AYBA 3T5LA 1YZ7A 2RKIB 2ZWOA 4LIWA 1GTHA 2QSWA 3DDNA 4AE5A 3DI6B 5LMNJ 2VFUA 4ERDA 2IRYA 1A9NB 4DXLA 1QTNB 4EI2A 4B3SJ 3W5YA 3FMBA 4ICLB 5B0CA 2MHEA 1I3OB 4FZVA 2W9AA 4LSZB 2GW8A 3OL9A 2CQPA 2NCKL 4PXEA 4RW8B 1N36F 2J6SA 1JLGA 3BSCA 4LVNP 3DM2B 1U6BA 4DR2F 5DG9A 4RBUA 3G86A 3MPWA 2RQ4A 1K1SA 2UUWA 4B9LA 4DQRA 3ONQA 3LP0B 1KDNA 3QNWB 2CA9A 1CPZA 2MGZA 2XY7A 4GC7A 2QLWA 1JB0C 3CE8A 4ED8A 3KOAA 1U45A 4OHVA 2XMTA 1B7FA 2HHQA 4IG3B 1FJ7A 2KYXA 2LDYA 1OY8A 4WZQA 1H3DA 4C98A 3GFXA 1NJZA 2JEJA 1U7LA 2FZCB 1MU2A 3C6TA 4KIAA 3BM7A 4LBHA 1Q5YA 4NLXA 4QBUA 2J0XA 2PE8A 2DR6A 3NWRA 3QGGA 2CG4A 3ZZZA 2CJKA 4WYWA 2FJDB 4DX6A 3DLLQ 2W7OA 5LMUJ 1UVMA 2C2OB 4YDXA 4X62F 4EWTA 4F2SA 1C4CA 2CPDA 5LXRA 3U1NA 4QWDA 4TU8A 1S0MA 4GKKF 2XNQA 3RRKA 2QL9B 3W5ZA 1XC9A 1N33F 4K8RA 2ZM6J 4CRJA 4XPCA 2ILYA 4A8YA 2ASJA 4I6AA 4W90B 1S12A 2DHSA 2NREA 4TXSA 3PRDA 4KGMA 2RE1A 3GILA 2CWKA 4RUHA 1BQNA 3LA0A 4NCGB 2B8QA 4PPDA 3U1LA 2M2BA 4KHMA 4ZVFA 2X1AA 3FSIA 2B0GA 4CM2A 3PJ9A 3KHGA 4NLYA 1NDCA 2KM8B 1U09A 4J9VA 1R89A 3CC4S 1IQTA 2QLFB 3EXCX 2D7SA 4P74A 4USIA 1AYEA 1JLGB 2H3EB 3BJYA 2HWHA 5GAGU 2YWFA 1IBLJ 2VASA 3TARA 1CQNA 3KDOA 2RF2A 3I96A 2AMCB 1FX2A 3RBEA 2E1CA 2VC1A 4O3PA 4YR3A 2ADCA 4KTQA 1I94J 4DV2F 1R8PA 2BJEA 2NXJA 3PTWA 2U2FA 2YX4A 3CF5Q 1X9SA 3J7Z5 1JLCB 2IYGA 4WJBA 4ETZA 1TV6B 4I2QA 3KJVB 4DQIA 4KT0C 4L76A 3NS5A 4CYUB 4Z2XA 2CPYA 4NLWA 4DUYF 2VPWB 4LFAJ 2MQQA 3M6UA 1E6VB 3NEKA 1X4FA 4U96A 5LMUF 3D28A 5HROA 3RB6A 2YNIA 4GO7X 1ROFA 3OR2A 4CLLA 2AX0A 5DG8A 4CO4A 1DHMA 3B54A 3IS9A 3E01B 1KQFB 4URGA 1U0HA 1FK9A 3KJFB 1KQSR 2W7AA 3GR1A 4DS5A 1HYSA 1KQGB 1T9TA 1VIOA 4GVLA 4HDGA 4C3LA 1JXLA 4RW9A 2WB1D 4UOCA 3W2VA 2HMIA 2WBMA 2KG0A 2RH3A 3M7VA 4C8YA 3T6JA 5EHHA 5J2MA 4C0BA 2DTJA 5DS7A 2MQOA 4WIIA 3L7PA 3D0IE 1SJFA 2Z2YB 4TLQA 4HYKA 2MQMA 4FXVA 3KK1A 5IT0A 3OFGA 5E3RA 2W2OP 1IKXB 1JXEA 2I5JA 2WVCA 3IO1A 3QQCD 4CLZA 4DR2J 3TANA 1WEYA 2OPPB 1Y11A 1FERA 4I0WA 5KFQA 2KFNA 1TUVA 3AY0A 2RU3A 1FDBA 4H54A 5BYRA 4RW4A 2XZDB 3T5HA 2OEJA 2WCXA 4CCHA 1Q79A 1ZPWX 2UUCF 1JLAB 4DV3J 2R7UA 3W62A 5L1JA 2QL7B 4ANCA 1M5OC 2MZQA 2V50A 7FD1A 2H1YA 3FJ2A 1AZSB 3HT0A 3IP0A 4TN2A 1C2PA 4AT1B 5MAOA 3KLGB 3Q8SB 4LF7J 3PJWA 1X4CA 2XC9A 4Y65A 4U67Q 2W7PA 4F50A 1SC6A 4PABA 3CJ3A 5LOQA 4F3OA 4JP8A 4OQJA 2XI2A 4U7CA 4W92B 3BSOA 3UNGC 3AD8C 2GIQA 2EFVA 3DOLB 3MOJB 2KRRA 1HNVB 2P9GA 3IG1B 4UQGA 4N47A 2EC2A 4RW9B 2LU2A 3PNIA 3BF4A 4BC7A 4NASA 4Q5VA 4OHWA 1WOOA 3L95X 1Q82T 3CJSA 5B0AA 1D8ZA 3CIMA 3QATA 5KFDA 3G96A 3RRHA 4L3NA 1T7PA 2UUBF 2DHXA 1MG7A 3BGRA 4MKVA 3TAMA 4HI1A 3M2RB 2L3MA 1RA6A 2BKOA 3MOZA 4N5SA 4RPFA 2MSTA 2V4RA 2ZKTA 2QT7A 1T94A 2CRLA 2VHGA 1K47A 2HQDA 4H4KA 4ES1A 1CBKA 4Y6IA 1S99A 5J2NA 1Q8BA 1U2FA 3QSIA 2W2PP 2DNQA 2YPYA 3AFGA 3EGNA 4WTOB 3LPYA 2VPYB 3EGVA 1H2UX 1U6ZA 3CT9A 4KKOA 2BZ2A 2X1BA 2OPQB 3E01A 3ELHA 3M05A 5HAOA 4YHHF 1X0PA 3OV7A 3EZOA 1U4BA 3M6WA 2HK2A 1FTCA 5KFAA 1D09B 1WG1A 3LAKA 2V69A 5KFZA 4WU2A 2M88A 4ELUA 4ES3A 3UPFA 4DJBA 5HMXA 1I1GA 2E5LJ 1S76D 1RWWB 2IRXA 3WDOA 5CD4A 4DUZF 1UETA 1PJ7A 2Z8QA 3T1YF 4IFYB 2M52A 3HJVA 2KZZA 1X4AA 4WFAQ 1O0PA 4HR2A 2DIUA 3M8QB 4MKAA 4CLYA 1JXVA 1TL7A 4C8MA 2HQGA 4E98A 2BXJA 1MMNA 1WC6A 4CLKA 2Y8YA 1PYSB 2ZZNA 2R7WA 1NDLA 4HTIA 1J5OB 2FGOA 5E0OA 4N8OA 4DSFA 1SL1A 2YNFA 2QA4S 2G13A 1X7VA 3Q8QB 4JI5J 4OFZA 1TVRA 4Y3CA 4NLOA 4CWBA 2BQUA 3CDAA 4Q7AA 2ZD1B 1XMQJ 1FEHA 4USTA 3KLHB 2HVHA 3FCHA 3D0GE 4RU2A 3C15B 3DRSA 2EPIA 4DLEA 3IMQJ 2NS1B 3MM7A 5HSPA 1UFLA 3PY8A 3QIDA 2PGCA 4O3NA 1HPZA 4PUOA 4O4GB 3HLUA 3DLBA 1RHQB 3OTBA 4OI2A 4MKBA 1S6PA 4AQYF 1SXLA 2B3TB 1J5EJ 2A18A 3BGLA 2N4CA 3M32A 1HWIA 3MMAA 3N9UC 1QAIA 1TAUA 4YOEA 2VJUA 1Y3JA 3CO0P 4JI4F 1TKXA 3I5CA 1NJIT 3KHHA 5DDRC 5J1NA 1ACMB 4NLGA 1QDUB 1Q78A 2ZNYA 2LXFA 3OT9A 1RTZA 3PW2A 4C0OC 3Q8UA 2QYGA 4RW8A 4CI0B 2VG6B 3FMWA 1NJWA 2NUHA 4CO0A 3KLEB 4EZ9A 2DITA 3JSRA 4QR0A 1AFIA 1F60B 5C7PA 4DFKA 4JV5J 4GKJJ 2OLWA 3JYTA 1SQFA 4K2JA 5E7OB 2EK6A 3RTVA 3CDBA 4ID5A 1U1NA 1UA0A 2IMWP 2MGZB 2QX0A 2IBKA 1ZETA 1GMWD 4LRDA 1HQ2A 2DXEA 4C48A 4NLPA 5C25B 4J9SA 4DEZA 3ZFVA 2ZUGA 2DNMA 5CABA 3BQ1A 1RT1A 4C8KA 3C16A 4DL5A 1VRUB 2WK4A 4NLUA 4F4AA 3UDLA 2XEXA 5CYJA 1CULA 3G71S 4OYIA 1N6QA 3UVJB 1YITS 3FBBA 4O23A 4YQWA 4ECWA 1VQ4S 1UVJA 1CJTA 1WKLA 3DDIA 4OZ5A 1YJ7A 1S1WA 1UEUA 2ZE2B 3NKYA 1TL3B 3OTOJ 2HQ3A 3DOLA 3N28A 5IC6B 3G6XA 1W26A 4I68A 3NS6A 3TRGA 5DLGA 2LCWA 4MK9A 3UR0A 3JXOA 4DMZA 3HM9A 1IBMF 2OIHA 4NXNJ 2HNZB 4Y2AA 2PIIA 4X64F 3IWNC 2C3OA 2R9LA 5K20B 3R2DJ 1ITPA 3N01A 1S6OA 4TYBA 7AT1B 1T8EA 1XNRF 4DV0F 4ZCKA 2QFIA 2IC3B 1HD1A 4NXNF 2OPPA 3NGTA 2OFHX 4LQ9A 4PYAA 4B3RJ 1K0TA 3AA9A 2OKQA 1UJ5A 1Q8KA 3THTA 5KFHA 3QLHA 2KYZA 2E5IA 3GIRA 4KB7A 4MIWA 2MLZA 4OZ1A 2FC8A 3Q24A 2NXUA 5G4DA 3DCAA 4KR0B 2IA6A 3IAS9 2ATCB 1Y10A 2BA9A 3BPDA 3TJAA 3V2UC 4DPWA 4IYQA 2Q43A 2AX1A 2C2ZB 4DV4J 4IO9Q 2FLPA 1BMQB 1NCLA 1OPZA 4R0EA 3M30B 1Q0NA 2HPUA 1P8GA 4N7TA 5E3PA 4F26A 5K8NA 3G87A 3NBPB 5LSRA 4IDKA 2VQEF 4O3QA 2UUAJ 1LXNA 2UVWA 2DO4A 3NL0A 1VI7A 4F4ZA 1VQ8S 4ZJLA 4AQYJ 3M8ZA 3N5BA 1ULRA 3BH6B 1TK0A 2E5HA 3QWUA 4UOGA 3FVYA 2C2DA 1FNXH 3UN5A 5LL6d 3B82A 1XIQA 3DRSB 4ZP7A 4BLGA 2CZVC 3K17A 4CH0S 1TQLA 4H4MB 4YDDB 2ZJRQ 4ED1A 1K9MT 2B4UA 2A6OA 4F25A 3DDKA 1QAYA 2P6SA 5HLFA 2ZDPA 3WIVA 4TQRA 3BO3A 3OHAA 2A2DA 2KN4A 2EFNA 2BE7D 4MMOA 3I4HX 2ZVIA 4PCQA 4WPAA 4X84A 1KQKA 2XGPA 4Y2IA 5K8PA 4ALZA 3BBCA 4FF2A 3CNQP 2MYFA 3PCOB 1ZH5A 2J9DA 1RAOA 1KKHA 1F9FA 2DNGA 3I0RA 3GIKA 5BYQA 3EYZA 3GCWP 1TUWA 3DNCA 4P9SA 3PR5B 4W98A 1LWEB 2HHHF 3I55S 1PAUB 3DLEA 1GEHA 2Q1LA 1WUUA 3DGPB 4OI4A 2AU0A 1NK9A 2E5LF 1KVIA 4X4NA 3FEZA 4RUBA 1U0HB 3OL8A 3C3LA 3FNNA 2OSQA 1R0BG 1ICEB 3T41A 2E5GA 1T9VA 4K7QA 3TJ9A 6FD1A 2CDRB 4RR5A 1RYRA 3V6JA 1RCOB 3O2IA 3MR3A 5KFVA 4KHPF 2R7SA 4UQTA 2QZ8A 3KNAA 3PW4A 4WBFA 3RAXA 2JOQA 1K8AT 1NEEA 1YBAA 2P6TA 4IO1A 5F8JA 1ZBTA 4ILRA 4NA1A 1FVQA 4ZPCA 4LREA 3AD7C 3TO8A 4NCAA 1RAFB 4F4WA 3HJFA 2MB0B 5HVGA 1TL7B 3N6LA 2KXFA 3G8QA 4AYBD 2K3KA 4FNIA 1Y3KA 1H7WA 2ZHBA 5B0FA 2CNLB 3CGIA 3EDQB 5L8RC 2D3ZA 2IVMA 2JHEA 2GX8A 3IR7B 4QPTA 2MZTA 1XMOF 4QCLA 4DPOA 2VQEJ 3ZZUA 1HBNA 2IRUA 2V2KA 1L3TA 3RYLA 1RTDB 4ZP9A 2DVIA 3SIPB 1N54B 2CPJA 4NRTA 3OVAA 2ZOFA 2KHCA 3RZAA 1GH8A 3CJ8A 1PG5B 2WBRA 5LM7E 4DV1J 5GADU 4DL0C 2KZMA 3RR8A 2W01A 2HHPA 5GAGI 1S1UA 3BN4A 2R7TA 1XMQF 2V67A 2ZBRA 4KY3A 2BOPA 2VBYA 4A8KA 2HFVA 5E3QA 3D6MB 3TAMB 1QAXA 3Q22A 2GMLA 3CD6S 4LF7F 1HNWJ 4USKA 2CJYB 2JC1A 2V8DA 1HBUA 3I9ZA 1BQNB 1ZYQA 1FRHA 2LQJA 5F41A 5K14B 2R7XA 1LWXA 2BE2A 3KHLA 1RWXB 5IOLA 2WTFA 2CPIA 1VQ9S 3ZZ0A 2RIJA 3HKZD 1SKUB 3BGRB 4MFBB 2CKWA 2MTLA 1D0EA 5K5MA 1LQ9A 4CTAA 2PD1A 3VAGA 2GS8A 3MM5B 2AGOA 2YWHA 4RU9A 3P8BB 4QU7A 2NZ4A 1IVZA 3T19A 4WU3A 4DSKA 1FRMA 1XBWA 3IC1A 1UFKA 2QLBB 3QJJA 1PILA 3M9OB 2BANA 1HNVA 3IG1A 5BR8F 4DWIA 1Y9OA 4DR6F 2D74B 2RRBA 3LAMA 4XDCA 1N4LA 4LJMA 4M94A 3LWMA 1IKWA 2HSEB 1FA0A 4J91A 1APSA 2CXEA 2VL1A 4YB5A 3BKUA 3V6DB 4DQPA 1XNQF 1YJ9S 2DNRA 2B43A 3LGHA 3H98A 4OZNA 3H0PA 4G65A 3MFIA 1FRJA 3OTEA 1R8AA 3US5A 4QPXA 1IKVA 2FTRA 3MGJA 4ICLA 2R8JA 2CVEA 3TW0A 3CIZA 4NYPA 3MM6B 4NZ7A 3IRXA 3TJ8A 2W4PA 2JLFA 1RB0A 2YBVA 3CJQA 3EVOA 5KT6A 5HP1B 2B9WA 3ZZRA 4FP9A 4OX8A 1UCNA 3WHIA 1HQUB 1S1XB 2GVDB 3MEKA 5LJ5Y 3T6BA 1T9XA 3R5GA 3O6QA 5B08A 3PIPQ 3H20A 4ER8A 1JKHA 5DDQC 1VFJA 1FRIA 2R4FA 3GG0A 2QEXS 2W4DA 2OFGX 3DLKB 4TU7A 2PI4A 4BS2A 5D77A 3LW5C 3MM8B 2E9TA 2YH0A 3G82B 1YWXA 4ENOA 4DV2J 3VAKA 2A1BA 1SH3A 1HA1A 1OWXA 1ZM9A 3TYTA 1RU2A 4YHHJ 4P2SA 2BKNA 3CDEA 4NRUA 1UEVA 2IPOB 4HHJA 4KYZA 5KG4A 4EBEA 2ZH3A 3OFFA 3R5DA 1A0OB 1C1CA 2JL9A 3U1MA 2KRBA 1F9EB 3AA8A 2DGVA 5KG2A 2CPFA 1NH8A 3P6YC 4DR4F 4L6V3 3IR6B 4WP3A 1F5CA 3KJVA 4WK1A 2YNHB 3MEEA 3OSNA 2HWTA 4F3MA 3CJ5A 4F0KA 5J2QA 4LF9J 1HBMB 4NMLA 2HHTA 2BV3A 3P49B 2CWXA 4J9UE 2XCPA 5EWEA 4NLSA 4LF9F 1YK9A 4FYWB 1BLUA 2W1BA 3JSYA 2C3PA 1TL1B 1NB2A 1HLWA 2AV5A 1KFDA 2FLOA 2Q6BA 3A4TA 3LP2A 4QJVA 1X4BA 1JLCA 2CZ4A 4QR2A 2Y1JA 5K14A 5H9FK 1YSJA 2FB0A 2F1FA 2DO0A 1A7GE 2JFDA 3TQEA 3PO4A 2P5VA 1HYSB 3QYYA 2CJXB 1ZTWA 4O3SA 2VOPA 4U8YA 3MF5A 1YRUA 5A2QU 1NSKL 3JQJA 3BKFA 2DNPA 2HVIA 4RUCA 1NK7A 4RJVA 3SI8A 3MMAB 3RUBL 3Q2SC 4CO2A 1EZZB 1Z2ZA 3R5JB 4RX6A 1FCAA 1U25A 4F67A 3MUVP 1JLEA 2AJ4A 2KU7A 2G0CA 4C8OA 1QJHA 3HHLA 4I64A 1N48A 4I2PA 5GAEI 1FJGF 2D3O1 4D3GA 5D4PA 4Y28C 3JAMU 1NSQA 3VGTA 3H5XA 3M6XA 3B78A 1RXOB 2IJRA 3HCXA 3L9ZA 1XR7A 3MM9A 1L3UA 1X60A 2CNOB 2XLKA 1EB0A 2WRMA 3JQKA 1UWBA 1UA1A 2HFNA 3BSAA 3W5XA 3T3FA 2PMZD 5IS2A 5B0EA 2KG1A 3AOBA 3NGKA 3VGUA 4CO5A 1SL2A 1IN0A 4RNFA 1CC7A 5A8KA 4MIBA 3JTNA 2B9YA 1GMWA 3MCOA 3AJ1A 1S1VA 1YRXA 2H4YB 2N3LA 2DISA 2RILA 3SQGA 4CT9A 5DGBA 3EZ5A 1HBOA 1DARA 1HFEL 1KOOA 1R7IA 4FVCA 5T7LB 2DNHA 5J2MB 4X4VA 3H59A 4MAKA 1CJUA 4Q8EA 2Y9HA 2OELA 5LMNF 5AXNA 3NXZA 4X4PA 3SYZA 1KWMA 2NXEA 3AH6A 1EARA 2BM1A 3OR1A 4WXOA 1DQ8A 3QO9A 5CYQB 3SSRA 4UT4A 3DC2A 4GVBA 2ZBQA 4FPIA 5KTQA 4DR7J 4ZVQB 4NLQA 3FDSA 2PFDA 2HBZB 2PA8D 2CVIA 4PG4A 1OO0B 3D1QA 1WHYA 2H4WB 5HBMA 2I1RA 1SPBP 5DZ6A 2MKYA 2VZ9A 2J0QD 5ITHA 4B08A 1QM9A 3SFUA 1RAEB 4N8NA 3MR7A 2BQRA 4WF9Q 4QYZJ 3QT7A 1DRZA 5CYMB 3BN7A 3GYXB 5CXTA 1X5TA 4OJ1A 3DM2A 4DPUA 5DZ7A 3M2RA 3TNVA 2VJVA 5HANA 4IOAQ 4QW8A 1HHTP 1PO6A 2M8DB 1EHWA 2ZJPQ 2OPSA 4FKXA 2R2RA 2DHAA 3HULA 3Q0AA 2R8KA 2XMUA 1S1TA 1RHMB 1V3SA 2GHWA 1X5PA 3J81U 4Y2MA 1VC6A 2HIQA 3D4JA 2XYGB 4L73A 4P2MA 2RKIA 4J9MA 4USUA 2GO8A 5IFMA 1U47A 5ETVA 4DR4J 3PG9A 3CCZA 3I5AA 1H38A 2KH9A 3PDNA 1TKTA 2ZBPA 3M8PA 1NM2A 3WX8A 2W9BB 4HVZA 3C8YA 4H4KC 4JV5F 2YWEA 1GMUA 1ZS6A 1U24A 2VDIA 3BS9A 3GSIA 1U1PA 1CS4B 3M6VA 1GXLA 2G0JA 2BANB 4FF4A 2ZVSA 4DZDA 2JSXA 2RT3A 4RUAA 3OJUA 2C2NA 3IFEA 1IUJA 4Y00A 2LQ9A 2VC0A 2EC0A 4XDDA 3CCJS 3IR5B 2UXDJ 1OY6A 4IH6A 2V4JA 3C14B 1GFWB 2J8SA 2M3DA 2XG8A 1RK8A 3N5FA 4G1QA 4NEZA 2G1HA 5C24A 2BJ9A 1FNOA 2OEKA 2FHOB 4TVAB 4B02A 2JLGA 4OHXA 2KXNB 3BQ0A 2N7YA 3GV5B 3MM9B 5HMZA 2CQ1A 4ZITA 1CSJA 2QJ3A 1F1BB 2ZC3A 5HP1A 3VVUA 3H5YA 4ZLLA 3PYEA 3CCES 4WFXA 1KP6A 3J81j 3DLHA 1HBNB 1ZAXA 4NA3A 1YHQS 1LNQA 4YUDA 1G6BA 1CJTB 2DH7A 2PFFB 1FD2A 2EFGA 3ICLA 4ECRA 3A13A 4MIAA 2ZH7A 2V2VA 4PWUA 5EGYA 1WF0A 1C1BB 1XEZA 3B4DA 2UV8G 2F4VF 1TKDA 4HI2A 2AWZA 5CZXA 2HQFA 3A8EA 3HZEA 1SVDA 4EBCA 2DH9A 4D3HA 5ADZA 2O67A 5L38A 1P9QC 5E33A 1RTDA 1B0PA 2HZAA 4USWA 1M0SA 5IT9Y 4UOFA 1ZPVA 4I2PB 1XMOJ 4DG1B 3PKMA 4UUXA 3POTB 2IFXA 4ZVOB 3MCMA 2XLJA 4OV1A 2VG6A 2Q3PA 1N0VC 5HVHA 1IBCB 1T05A 4DSJA 1H98A 1T9YA 5IV4A 5KFXA 4NMXA 3PFEA 4Y34A 2ZFHA 4JI2F 3R97A 5DETA 5CHCB 4PWWA 2ZHAA 4A8FA 2Z56B 3H2VE 2JVOA 4KSEB 1QUVA 1VJQA 4LSNB 5SZTA 1S1VB 1JNRB 4Q43A 4IQXA 2DNNA 3BGUA 5KFUA 4ZN3A 4YR2A 1G7CB 1VQMS 3MM7B 3GJTB 3ISZA 4F4YA 4PEOA 1RT2B 3GFYA 1S6PB 2FJAB 5KFRA 2FIUA 3OL7A 3C16B 3KMSA 1XNQJ 2IJNA 2OD6A 2YKOA 1RKIA 2F63A 5KFGA 4ZP8A 4DX5A 5CYQA 1MROA 4KAIA 3CWJA 3W7BA 2JJ4D 4IFVA 1S0NA 1P9YA 2QA1A 1IBKF 3L7OA 1UVKA 2W4CA 3W66A 1RT5A 3PIOQ 4N41A 1RWNB 5KFJA 2DBBA 2Q79A 2Y3YA 1HKAA 2Y1LB 5IT4A 1F3FA 4DUYJ 2W8LA 2QTWA 5DQIA 1BQXA 3KLEA 2CQGA 1RT4B 4TKTA 1G4CA 2QLJB 2FUG9 3UCGA 4DX8H 3M2UA 2XZTB 4XK8C 1X8DA 2QC3A 4OYWA 5D4OA 3AXKA 3RU0A 3CW2C 5B7WA 2AGPA 4CLSA 2HS3A 2H54B 3CVKA 1WC0A 3EMTA 3FBEA 3KDNA 3ZTSA 3MEDA 4DCPB 2LECA 2VV5A 2OPSB 3HFVA 3MR5A 3LP2B 4OYZA 3EICA 1SQGA 3VZIA 3K57A 2VF3A 1W2BR 4PZVA 3T5JA 4PQUB 2E44A 2OMLA 1RQ0A 1S7HA 2EVZA 5D3GA 2KI2A 1AT1B 1T02A 5HQLA 2XLIA 1IJFB 2MPUA 3RBXA 3PXGa 1FI4A 2H9ZA 3SV4A 4ZA1A 4F2RA 2YWKA 3LP0A 3N79A 3FRYA 3QT8A 4RW7A 3IRXB 5KFBA 3BGFA 3R5CA 4HH1A 2EEYA 3BYRA 4LSLA 4J9QA 4ECTA 1S5ZA 3D6FB 5KFYA 1M1KT 2V2QA 1HQUA 1FWKA 2Y0BB 5ETNA 3I0RB 2KVIA 3SSQA 1IBKJ 1R8BA 2J9EA 3WIUA 5C2CA 3P5TL 5IZHA 2J6UA 4DF4A 1C0TA 1FWPA 1IKYB 3SCJE 1QE1B 3DRXA 3EVWA 1U2RA 2B4PA 1VLOA 2V0NA 2WVEA 3DRRA 3QPIA 2LEBA 4DR1J 4I56A 4V19X 2F4FA 3HD2A 4K4WA 1NXIA 4O0NA 3MURP 5EX3A 5CAAA 4NI2A 4Y2CA 4I69A 1QSSA 3KUHA 1MN7A 5KOXA 1PIEA 3W65A 4ZHRB 4LF4F 2DCUB 5KG1A 1Z4UA 3F44A 3CPWR 4ANDA 2OP5A 3NY0A 4OYBA 1EETA 2MY7A 3ET6A 1HNIB 2FD2A 2MJUA 3I32A 3LALA 4WK3A 5HJXA 3TUZC 1KONA 4NL5A 3QSYB 3V81B 2H65B 4BDPA 4DR6J 1W7WA 2Y1RI 3R3TA 4CIOA 2ZM6F 1HR0F 2AKWB 1UZDA 4OYOA 1S6QB 3DGVA 3DYAB 3G6ES 4J5OA 4CLUA 4ECYA 3PKYA 2DNZA 2LU1A 1BUXA 3D6HB 2ZEJA 2RVJA 3KLGA 3G4SS 1R31A 2YQ1A 2XGQA 3LGNA 4ECZA 2AJQA 3C46A 4JI0F 2J7WA 4XAKA 1VCTA 5D3GB 1AA1B 2E7VA 2CQCA 2RS8A 5ETSA 3EJMA 3VQSA 3NCPA 2IVYA 2OPRB 2MZRA 2CQBA 2XY6A 1SKRA 4O0IA 1SKWA 2LEAA 4HHUA 4IG0B 2JVRA 5L9NA 2XCAA 4GKJF 4URQU 4NYZA 3DU6A 1CG2A 1A6LA 1KHWA 2V5HG 2XZWA 3DYAA 1RP5A 2O1PA 4I7FB 3MMCA 1O6XA 2AJFE 2MKHA 3HVAA 3QGHA 4U7UK 3CCWA 1HMVB 4ANEA 2VODA 3NNHA 7FDRA 5LT5A 4B9SA 1HPZB 2K3IA 3SSSA 4PUOB 2H5EA 3D0HE 4J9OA 4DR1F 3EM1A 1RT4A 5DM6Q 2L41A 4Q0BB 2FJVA 4MJKA 2I2YA 1E6VA 3CCQS 5GMEA 3QT5A 2HAFA 2BR0A 2O3DA 5F8GA 4LFAF 2ZC4A 1J27A 4J7CA 2GNKA 2WVFA 1RAJA 5IWAF 4LBIA 2NYIA 1T95A 2OSRA 2X3DA 3HSGA 1TL4A 1MMLA 2B7CB 5E3AA 5FDLB 2IA0A 5C2GA 3NCRA 3V6HA 1VQ7S 3V6KA 1NJYA 5JJBA 5HJYA 1RWKB 4ZS6A 3K8WA 4ECVA 1UJ4A 5KFNA 2R7VA 1WC5A 4MK7A 1I94F 3M8YA 2GAGC 4P73A 4AXJA 1IR1A 3IGVA 2V8GA 3OXFA 1FRKA 3KXDA 2XO6A 1FRLA 1K44A 1VC0A 2FJXA 2ASLA 3KLHA 2ZUAA 4OLOA 4YR0A 3GIIA 3JYTB 1K73T 5DGAA 2FVPA 4LVOP 3QRPA 4A8XA 4LF8F 1TTHB 3N6NA 5HO4A 3HFKA 1IR0A 4B3RF 4IH5A 1OJ4A 2IAJA 3QBCA 5IXUA 2PA3A 2VFTA 1S9GB 2XMMA 3ILOA 3ITHB 5K9FA 5JUMA 1TU0B 1X4DA 1IJEB 3F41A 4KGKA 2I5JB 2FVCA 3HPOA 1H2VZ 3BYPA 4X4OA 3V4IB 1U1QA 2MKCA 1SIWB 6AT1B 5GMKa 6FDRA 5I3PA 2D9OA 1M90T 1FXDA 3CEDA 4WIQA 4ZP6A 2NZCA 4CT8A 2HAIA 4JI5F 1PKUA 2YKPA 2OD4A 2ZBCA 3H2LA 1SI9A 2ZHOA 4J37A 4P7VA 1HD0A 3H2UB 1DZ5A 1EQ0A 4WE1A 2AYEA 1J2VA 1OSDA 3W2WB 1R0CB 5E3CA 1Y5IB 2FJEB 5EUHA 5I4MA 5D4LA 1RA7A 1RDRA 1YTYA 1FKOA 2GV1A 3IGNA 3M30A 2QV6A 4C0HA 4K4XA 1R43A 4DOZA 3P96A 3UN2A 4ELTA 2RDDA 3I82A 3MMBB 1X31C 3AD9C 3H7HB 4KFBA 5AJ3F 1NRKA 2LQBA 4Q2LA 3CCRS 3IN5A 3FC9A 3OLBA 4GMKA 2HFZA 3BO4A 3ZZYA 9ATCB 4DR5J 4PR6A 1S0OA 4J90A 3MM6A 2BEFA 4BWMA 1V3ZA 3GONA 3NGSA 1LW0A 1S9EB 4CYUA 2Y1IA 3JTPA 4LFCF 5LSLA 1X5SA 3VZHA 4DQQA 3KUEA 5AXMA 3VR1A 2EXUA 5E2QA 4CO1A 1ZOTA 2DNYA 2JRSA 1TK8A 3GYGA 1XNRJ 1C4AA 4KJIA 3BO2A 1YG0A 4KPCA 2XMKA 1HQEA 1EKRA 1TL3A 4IQMA 2L9DA 5HMWA 4G1QB 1FTRA 1LK5A 4NLTA 3VCDA 2ERRA 1KRPA 3ENWA 2AJ0A 2G2OA 2ZJQQ 1FJCA 3HMJG 3R5AA 3PJXA 8RUCA 3KMQA 1IM6A 2M5YA 4FS2A 1VQLS 5A76A 3UD4P 4DSIA 4X62J 2CJQA 1O5JA 2DY1A 3MD3A 4M1KA 2YVSA 3NP5A 3Q2TC 1RHKB 2QMWA 3O3LA 4CH7A 2ILZA 2ZKUA 4IOBA 5B09A 4OYXA 2F8MA 1GX5A 2OPQA 2DGQA 5C25A 3GV7B 3PHTA 5G0RA 1P1TA 4U6PA 1BWEA 3POTA 3AODA 3GWCA 2SXLA 4WTYA 2CPHA 3Q8PB 4U8VA 1VS3A 2CG8A 2YKNB 3H90A 2H48B 5L1KA 2F9JA 1SV5A 2HNYA 1HWUA 2HFUA 2YNIB 5E5NA 2XBPA 4B9UA 5J2PB 3EX7B 2XS2A 1VHIA 4NYOA 3GP9A 4LR8A 1C0TB 1FF2A 1WKJA 3GZ7A 4ED6A 4LR7A 1N5YA 2WW4A 2YY3A 3DHWC 1N33J 3HHEA 2V8PA 1TFYA 5IT9U 1BQMB 1P1LA 1FWLA 1NPRA 2EG2A 2VFVA 4IG3A 1VYAA 5DM7Q 4ZVUB 2XNRA 1WD6A 2IC3A 3QT6A 1VIXA 3PYGA 1JX4A 1HR0J 4JI1J 1HWJA 2V8HA 4YEAA 4AL6A 1TMMA 3V5RA 4O44B 3HVWA 2FLNA 3KK1B 4G1IA 2BBEA 4ZCLA 3EDRB 5THWA 1K1QA 2LVWA 4HL9A 2BQ3A 1X9WA 1SH2A 3C15A 3OTCA 4LRBA 4ZOSA 2GQCA 3NAIA 4DPXA 4EYIB 1SCJB 1BWVA 1F0XA 4TY8A 4PRFA 2HHWA 3AT1B 2LLZA 2KDOA 3H42A 3GU0A 3DOKB 4DFJA 5I3QA 4BBYA 3W2WA 3BQ2A 1VBZA 4IR9A 2XWYA 2JEIA 2XSJA 4BHQA 3MPVA 5AXLA 3MR2A 4JUZA 4WKRA 3HZGA 2ALYB 3O44A 3QRQA 4NXMF 4TNOA 1FKAF 1EP4B 3GFHA 1YKWA 1RT2A 3MMBA 2RUGA 3MUTP 4A46A 3CULA 1I6JA 2ROPA 3J80Y 4FF3A 3TZXA 5B0DA 3TA1A 5KT4A 2A6MA 4OI3A 4FBTA 4M5DB 1UJ6A 2RU9A 1H72C 1SC3B 1FRXA 1S9EA 2OHDA 2VH7A 1WOSA 3S8SA 4GRSA 2FZKB 2F8EX 8ATCB 1S59A 1MROB 1PYOB 3C6TB 2J5AA 2VDHA 3D1OA 3BKTA 1PCAA 3M9NB 3M8SA 4J9KA 1UVNA 4Q0BA 3QRRA 1YJVA 3A1YG 4WFYA 4UZBA 3NGDA 4A8SA 1JLQB 2W9CA 1WELA 1S72S 1QVFR 2M4MA 3ISNC 3K7RA 1FNMA 4U9RA 2G2ZA 3TUJC 9RUBA 1QSYA 1IXKA 2HIYA 3A3NB 4A8MP 1TV6A 4I2QB 2GA7A 2VUGA 5KG3A 4NZ6A 2RQKA 1HI1A 3BGOP 3ILIA 1NK4A 3OR2B 2CADA 2CJAA 4H4OA 2KFYA 4PG5A 2CQIA 5EWGA 2FJWA 2CQ2A 4PXDA 4YN3B 1WHWA 3KK3B 1B0VA 2GMHA 4L74A 1TFWA 3NNAA 4K4VA 2DHHA 4ZVPB 2HVEA 5GMDA 3VAFA 4KH1B 1V5VA 1FT8A 2HBQB 3AXMA 2RUSA 3Q8RB 1RT7A 2B6AB 2FC9A 3KKFA 4URSA 3J7ZT 3DN9A 1RHUB 4MH8A 3HVRA 3B4MA 4UUWA 4AL5A 3QO9B 2G1DA 1MNEA 3C19A 2BJ1A 4LFBJ 3IBCB 1FKPA 3HDSA 3V81A 2RRNA 4FKYA 3AB4B 3K5MA 2FVRA 2EKNA 3W9JA 1EP4A 3O8WA 1R8CA 3CD5A 3UO0A 5F8IA 1U8WA 1RKJA 2F4VJ 1DFDA 4O4RA 2POKA 3VQTA 5C24B 3EGZA 3I9V9 3LO3A 3ZZOA 5L39A 3TAPA 1HNWF 3NWGA 3JB9k 4OHYA 4J9LA 2KO1A 1D8YA 3T9ZA 3M9MB 2MEWA 1T3OA 5KT2A 1FX4A 1OIAA 4Q8FA 3G9CA 2F7VA 4G1PA 3K5NA 3OW2R 4RW6B 5G0RB 1JLAA 1QAJA 1J5OA 1F5AA 1NNDA 3P45B 4PQAA 4ZCMA 2HHUA 4FNHA 4NE9C 5T41A 5D0RA 2JDJA 1HNXF 2DGSA 1REGX 3A3PB 4USJC 3GCXP 3DHXA 5EDWA 2BDPA 2L9WA 1WOPA 2IHR1 2U1AA 1AZSA 4NX9A 4IDKB 2X1GA 2E9ZA 1UW9A 2JFKA 1Y7PA 3ZTQA 3CMAS 2W2QP 4C3KA 5FLXY 3HKWA 2ASYA 1RYSA 1D9FA 1JWWA 3N4WA 3V4MA 3BH7B 1C1BA 1X4EA 3R6GB 2UXCJ 5ETKA 4K4ZA 2NXCA 1R0AB 1CULB 2ZH4A 2QN6B 3SV3A 1UPPA 2ZWPA 3E2EA 1Z2LA 2VBXA 1Y4ZB 3MM5A 2KT2A 1HBMA 2EFQA 3R8YA 2WOMA 2HVZA 2VPZB 1LFPA 3GLJA 3RB4A 4A8WA 3IS9B 2J9CA 2PO4A 4KFBB 1B3TA 4ED3A 2FY1A 1RT3B 1N32J 4I4BA 3HHLC 1PJ6A 1DLOB 4ZJQA 4DSEA 3D3BJ 3WC0A 4B9VA 3ITHA 2VG5B 1C0UB 2K8GA 3CJ0A 4K50A 3OPKA 2V9KA 2VG7A 4NLRA 4ZK7M 4ECUA 4NPOA 4EUVA 1G2EA 4YB1P 2GJFA 2K1RA 4R25A 2YKAA 4WWSA 4R8UA 2YKNA 4MT1A 3KK2B 1LV5A 4DCJB 3H4DA 2FVQA 2CQHA 3R7SB 1H7XA 2FDNA 2JLEA 2EFPA 2L9NA 2R2UA 2HS0A 2QLXA 1RWVB 2RF2B 3AOAA 2VIHA 3CC2S 1NO8A 2CUYA 3UR3C 3NLCA 3G8SA 1UVIA 2MMYA 3GJRB 3NNCA 2HHVA 3C66A 1URRA 1YI2S 1TR0A 1VMBA 4HKQA 1CEZA 3C6UA 4JI7J 1Q95G 3MTJA 4USMA 4LUBA 4MKYA 2GVDA 4EBDA 4QR1A 2XHCA 3MUMP 3VTIA 1TELA 4DR5F 2D9PA 1KHVA 1PBAA 1REVB 1UWBB 4ZPAA 4CZCA 1B0TA 4HT7A 3J7YI 2FGCA 3CJKA 5A8RB 3X3UA 4MK8A 1BY9A 1N5SA 3DRRB 4ID8A 4NCGA 5GADI 4XIUA 4DV7J 4DL6A 2O66A 1SJ3P 3SQGB 2EW9A 2DIVA 3QWPA 4DV6J 2VONA 2BYCA 3MHYA 2IMOA 1JMTA 3JTOA 4KE5A 4M8LA 1B99A 2F40A 1HNXJ 5L46A 3M8RA 3HI9A 3GJQB 3KTQA 4RW7B 1JIHA 2N3OA 1GT8A 2JH3A 4KV8B 1F9HA 4P2FA 4DV4F 4QW9A 1OQ6A 3KFWX 2VA2A 5GAHU 1M1GA 4RZRA 4K59A 4N56A 2Z0GA 4X2BA 1KVKA 1WDTA 1IBLF 3OXLA 5HBMB 1EIYB 2ZH8A 3G8TA 2Q66A 2RHQB 1YQHA 3PEHA 2KJVA 1ZZNA 4ED7A 2RB7A 4M5DA 2OTLS 4PAAA 2MQNA 5F9NA 3PM9A 4GVBB 3TX0A 3I6PA 4ED4A 3FQLA 2R2TA 2C22A 2HRUA 3UW1A 3MEGB 4CM0A 3Q8YA 2J0WA 2MXYA 4M5JA 2V9WA 3C2PA 3HHKA 3LANA 1IR2A 1FO1A 1X5OA 4A8QA 4LF2A 3C6UB 1OPIA 3NCQA 1NK0A 2DJWA 1PBUA 1R3NA 4C3MA 2M8HA 2XSJB 4YMEA 1Q16B 1DBDA 1KTQA 2RDIA 1IM4A 5LXYA 2DPIA 4ECQA 1M5SA 2BW2A 5DJBA 2WSFC 3SMZA 4GKKJ 3HD1A 1MN9A 1RTJA 4FYYB 5FD1A 2BMBA 2IM0A 3TUIC 4B3OA 4J9NA 1LK7A 3W3SA 1MW7A 1OMSA 4UZCA 3ZZPA 2UU9J 2R7RA 2KKHA 4CDIA 3W64A 4MTPA 2XYHB 4ZVRB 3AJ2A 1S57A 2ZH6A 4KGVB 2LFVA 4DV5F 3NMAA 2BJ7A 2H5JB 2XMWA 1NDPA 2PN6A 3W8PA 3K5PA 5IM0B 1JNZB 2QMXA 4F3QA 1ZA2B 1ZM2A 1PGZA 5CCMA 1Q4RA 3AAWB 1ZAVA 3MM8A 4NA2A 3WC2A 1RHRB 2WHOA 1JJ4A 3Q86A 2DXDA 3G82A 3LP1B 4QQBA 3A3OB 5BJRA 2CAJA 2MLYA 5EX0A 2J7KA 3FGVA 2R3VA 1SBRA 4F04B 2WVBA 1SV5B 1YX2A 2VBZA 1RLCL 1Y0HA 3RW7A 3FCWA 5H9FJ 3EVMA 3QMQA 3RAQA 1MSWD 4AFFA 2VQFJ 1U1MA 3B8HA 4PG6A 1RAAB 2EI5A 2W24A 3LTOA 5D15A 1RT3A 4L3KA 4HEA9 4LF1A 4P2XA 4DPTA 2KB2A 1GAOA 3W61A 4OJ3A 2M0GB 5KFFA 1AROP 2VA3A 1VOMA 1CS4A 2B9XA 3SZ2A 1M1HA 4MFBA 1E6YA 4YS2A 1RE1B 4FXWA 1S7IA 1VQ5S 2YNGB 3PX6A 2HG4A 3PYFA 3NBPA 5KFIA 4JBCA 1WEZA 1YZ6A 4RLEA 3FBCA 1AW0A 5C42A 4C8LA 1SKSA 4AD6A 3BV8A 4KC5A 4ZPDA 1FK9B 1D3WA 5KFOA 1TP7A 2HBYB 3UDCA 2VU5A 4DSLA 4I1TA 1RABB 1VQYA 1FFSB 2YTCA 2I0XA 3E8OA 2ZH5A 3RBDA 2B56A 2HMIB 1JJHA 3CJTA 1RAGB 3WX4A 1QUPA 4LRAA 1SB6A 3Q89A 3VHQA 1D9AA 3W9HA 2HRTA 4K5RA 2FJBB 5GAEU 1VBKA 2MQ8A 4JI6J 2IM2A 1DQ9A 3CO9A 3PFOA 1F6TA 1MWYA 4CLWA 3X1LB 1NMEB 4K4SA 3R1LA 2GVZA 3SDEB 4ZPWR 4HT5A 5ETTA 4DCOB 2FYXA 4X66F 2B4VA 4QIEA 5CD4H 1X4HA 3LF0A 4CTAB 1V3RA 4I67A 1HWKA 3VV2B 2NYHA 1T9UA 3ZTPA 3DXSX 1AB8A 1QLNA 3GYNA 4DV5J 2MY8A 1GXUA 2C3MA 4OJHA 1NAQA 3KLFA 1PSDA 1FESA 3ZXWA 2C3UA 4UTGA 4IRCA 2HK3A 1DAXA 5DRKA 1YJNS 3MWBA 4OI6A 5ETOA 2Y8WA 4ED5A 3OTOF 1CC8A 5J1EB 1RCXB 3UI3A 2YKQA 4QIFA 4PQUA 3P3DA 2DK2A 1NSAA 3CCUS 4JI7F 1XERA 1ZA1B 1NBEB 1L5UA 5KT3A 1CJVA 4DV6F 4ZIWA 3MTKA 4OZ2A 1FXRA 1Y5NB 1XTZA 3OFEA 3LP1A 3CC7S 5E41A 3KK3A 2CJBA 2D41A 4QOTA 5IV3A 3TQ1A 3NS7B 4E0DA 5A8RA 2MKKA 4KHPJ 1M5KC 3F0NA 2W2MP 5T7LA 4QWBA 1L3SA 5L1LA 2P8IA 4IH7A 2AF6A 1AXQA 3D7SB 3HFZB 3IXQA 3I4PA 2NPFA 1KR4A 2ASDA 2NQPA 4C8NA 1VISA 3GIMA 2DR8A 1LWEA 4ZLNA 2DRAA 3R2CJ 4FN5A 2CQ3A 3W60A 1HQEB 1RISA 1I5OB 3QGIA 2JX2A 1NLKL 4ITSA 5A8KB 2WSCC 3VAMA 4B9NA 3WBZA 1N5VA 1VRTB 3KJNB 4X66J 3M8QA 1YDLA 3CSKA 1FE0A 3SDEA 4QU6A 5JMNA 4JYAJ 2FHMA 2UUTA 3MR6A 3PX0A 1L3VA 2YX1A 2Z57B 2DR7A 4RO0A 1SUQB 1RTIA 3OLAA 3P4UB 1NUEA 2EG1A 1LXJA 4LBPA 4BCAA 1L3KA 5D0HA 4F4KA 3FBFA 3ETMA 1FDAA 5IWAJ 1ZM4A 2AYMA 3K8VA 1JLEB 1HI0P 5BYSA 4LT6A 3A8JA 3DLJA 5FIIA 3IA0A 5I3UB 3THVA 1URNA 1WG5A 2VKZG 4QWEA 4RKUC 2MLXA 2DEIA 4JI8J 1R27B 1PYTA 2Z2LA 4KO0A 2RJZA 1UL3A 5AE3A 3TP2A 3IAM9 2XO7A 2QA4G 5ETRA 3N0VA 2K1RB 4EGLA 1NSPA 1UMJA 3BREA 1JLFB 1U6FA 3MAAA 2B51A 2HNDB 1WWHA 2CZ9A 2XI3A 2A0FB 2MZ1A 5DLFA 3L09A 2ALZA 2JNJA 3NAHA 1EKSA 3DLGA 1TKTB 2YQ0A 3TEGA 3LGMA 4LSLB 4DZ6A 2W9BA 2G4BA 4QYRA 3R1HA 3D3CJ 2RQCA 1OYEA 4IRDA 1T0TV 3BR9A 1Z1ZA 2Z2MA 4ECSA 1U1KA 2GVZB 2HNYB 3UN3A 4USHA 3SCKE 4JI6F 2LEPA 2D3UA 4EU0A 1EJ7L 2K06A 3NGRA 2UP1A 1W25A 3FKBA 3HX9A 2WVDA 2UUAF 5CH7B 3V6DA 2QMUB 2D69A 1PJ5A 2HRYA 4HH0A 2VG5A 4IG0A 2V6AA 2P2CB 1R8HA 3I0SB 2DH8A 3K89A 3QAUA 5I42B 3KUGA 1TMJA 3JS9A 2AHOB 2OAUA 5KG5A 1V6HA 2WB4A 2YNHA 4W4MA 5M2PA 3Q23A 3CCMS 4B3MJ 4OX9J 2H5IB 1REVA 2KJWA 4P75A 4FPRA 1RI7A 4R8UB 3FSXA 1B4SA 3UDVA 4FS1A 4OZJA 3QZ8A 1JKHB 1R6YA 3Q8VA 2HHSA 1S1XA 3PRVA 3H25A 3HVTB 2IY5B 1QY7A 4M63A 2B5JB 2VPXB 2DEJA 2HNZA 3PHEA 1GX6A 2CNNB 3S01A 1U48A 4Z7CA 2V2ZA 4ZPVR 1FFWB 3MFHA 3TOQA 2XB2D 2DR5A 1HMVA 2DNLA 2YKMB 3P5BP 3OD2A 2CPXA 4P52A 1WI8A 1D9DA 5B0GA 1OY9A 1RU1A 3JQMA 4KGXB 3T1HF 2DGUA 2MSSA 2HNDA 1NK5A 2OGUA 4DI6A 3GG1A 4DQSA 1UPMB 2CDQA 3PVXA 3H5UA 1DY3A 3CMQA 1E6YB 3M1VB 1FJEB 1QSLA 3RBZA 2HHHJ 2KFZA 2C1EB 1FVSA 1JQGA
chains in the Genus database with same CATH topology
1NKBA 4RW6A 1OQ3A 2E7XA 4DLGA 1HW9A 5CYMA 4BC9A 1YJWS 1FDNA 3PW0A 3J7A1 3I56S 1CVJA 4RW4B 3MECB 3PACA 1T05B 1PC4A 2CIMA 1N6QB 3DFEA 1FKPB 3RRGA 4LMZA 2K7KA 2ZBIA 4B17A 1LWFA 3M4XA 3OXGA 1KFSA 2W25A 2Y0SD 5F8NA 4OX9F 4B3MF 3F56A 2W8KA 2EFOA 1S77D 4O3RA 4KO0B 1ELOA 3NRBA 1Q8IA 1U1OA 5CCLA 4MYUA 4FYDA 4ES2A 1TVRB 3G6VA 2WONA 3H40A 4CH1A 1MMDA 3MEDB 2XMVA 2IBOA 3ISND 1J5EF 4Y0FA 3FFIB 2AYGA 1TZ0A 3HK2A 4I6YA 3MEEB 3GE9A 4Q45A 2E66A 2E1MC 3BEGB 1WTFA 3S1TA 3FSYA 5DDOC 2ROEA 3M32B 1U1RA 4WYLA 2J76E 5KG0A 4DDFA 1O8BA 2BACA 2LKZA 4JV0A 1T7PA 4JI7F 3DMJB 1WI6A 1RT5B 4RBTA 4EYHB 1O51A 4UY85 2XS5A 2AP6A 1WF1A 1S9FA 2CQ0A 4QWAA 4ELVA 2NPIA 2J0SD 1FHTA 1XR6A 4TLRA 3ETOA 2QO3A 1G1XA 4UW2A 1H2TZ 3OJSA 1WG4A 1T3NA 1NHVA 1WHVA 5F0UA 4OZLA 5F3ZA 1JJ2R 4L72B 3TI0A 2PT0A 4XPEA 2DD8S 4LSNA 2PSZA 3BR8A 4ZVGA 4OI0A 4Z37A 3RAMA 2GCFA 1DLOA 2IVFB 1YJTA 2PDAA 2LDIA 3K2YA 2CPEA 1U26A 3KG4A 3CTRA 4HTJA 2DGWA 5A6WA 2GHVC 4EZ6A 3KNGA 2GO9A 2FPHX 4J9PA 2ZD1A 4OLPA 4DG1A 2AW0A 2E9RX 4X4RA 2MKSA 4DR3F 1VQSA 5T14A 1JLBB 3SCIE 1DQAA 3BB5A 2YNFB 5DG7A 1IQZA 5CQGA 3KLIB 2JEGA 5LJ3Y 2COLA 2R7QA 5A8WA 2QA2A 2A2CA 3I31A 4DV3F 1UVLA 1Q8LA 2X1FA 2KHDA 3FZ2A 2DB1A 5A0YA 5C42B 1LOUA 1SJ1A 4RNOA 1RT6A 1TAQA 4HDHA 1DTTB 2JEFA 1RWUA 1UKUA 4HLBA 1N5YB 4O3OA 4EO8A 3VWSA 1ZTTA 1C0UA 3FQKA 1RT1B 3GQCA 1Q53A 1HI8A 3DOMA 4DV7F 2I8EA 1UFWA 2I9SA 2FHJA 2F3JA 4F8RA 3OVBA 2AJ1A 1VBYA 5EN1A 3SEOA 5KFLA 3HP6A 2HLTA 4TYAA 4I6WA 1F5BA 3M1VA 1UAWA 1GTEA 4RWWA 4ZCIA 5HMYA 4DS4A 1YIJS 1DTTA 2Q6CA 4Q2MA 1XC9A 2HYIB 2XWXA 2ZNZA 4ZMMA 3AQPA 3NMRA 2GIRA 4LQ3A 1IKWB 4DL3A 3UCUP 4JV1A 3CCSS 2XY5A 1TKZB 5KT5A 3HXMA 4ECXA 2R2SA 4ID5B 1RJJA 1QVGR 2OJ3A 3R27A 4KPYA 4K0KF 5HL7Q 2HQIA 1LWFB 2M70A 4LFBF 3M8PB 5KFWA 3RW6A 3ZZTA 2ZITA 1VRUA 4X65F 1S0VA 4ZVEA 3BZQA 4PXBA 3EGWB 2BE2B 1EETB 3OUYA 1WF2A 2YQ3A 2RNEA 4OI1A 3CCVS 1D1UA 1ZM3A 1FXLA 4WFNQ 3QAEA 2BJDA 2GFFA 4PG7A 4C2MA 1ZAWA 4WFBQ 1P6TA 3CDUA 2UXCF 2ROGA 3OSPA 2J6TA 1N5QA 5L9XA 4TQSA 2W9CB 5M2RA 2UVUA 5J1PA 4PXCA 2VFRA 3PW7A 2C2RA 2LXUA 1BGXT 3I5BA 3PR4A 2PI5A 1MWZA 3M2VA 1B64A 3GSDA 3IRWP 4YFUA 3T5KA 4DL7A 4FVMA 3CCTA 4IKAA 4KBIA 3PW5A 2RQMA 5M2UA 3DLGB 4DBQA 3DMJA 4DL4A 5GVQA 5KT7A 3KG1A 1X0FA 4DFMA 2YX7A 2GGPA 4ILLA 1C1CB 3PV8A 4H4MA 5A0YB 5CZVA 1SH0A 2XULA 5HI7A 4DHVA 5B0BA 5A8WB 4RWXA 1UW4A 4NOHA 2R8HA 2R8GA 2N4DA 2E29A 2X3GA 3MCSA 1TKXB 2C3YA 2KM8C 1KOHA 4X4QA 2CJ9A 4OIXA 2CPZA 1LW2A 3H5SA 1RT7B 2B6AA 3PEJA 3UCZP 5HLFB 2VBWA 2HWIA 5K8MA 3LH2S 5KFTA 3EZUA 5D4NA 2NUUG 1FKOB 2P9EA 4OZ0A 5KAKA 1S49A 5KFPA 4IFYA 3VAJA 3KTQA 3HHLB 4R5PA 4KRWA 3CB4A 5C5JA 1S97A 3UFCX 2UVVA 4C8ZA 4OMFG 5DQHA 4IUFA 4LIRA 4N77A 2ADBA 1Y5LB 2B4OA 5J2NB 3CCLS 1VHFA 3QIPB 2VKRA 3PX4A 1TK5A 5KOWA 5KFCA 3K59A 4B3SF 3LQVA 1NJXA 2DNKA 1TKZA 2QIFA 2P9CA 4KKOB 3AQOA 4AXIA 3RB3A 1MU2B 2PMHA 1PC5A 2XSFA 2BABA 4QWCA 3KK2A 1TL1A 2J9DE 2WONB 3IWLA 5KFMA 4IOCQ 3KG0A 3K5LA 2MQPA 1KTVA 3OTDA 4OL8A 3ENQA 1YGYA 4NXNF 1NH7A 4RNHA 5U47A 3SCLE 4WXWA 2MKIA 2ASJA 1XN9A 2O01C 1KLMB 4KQZA 2QFJA 1M5PC 1QTMA 4LF5F 4JV2A 4IRKA 3D5MA 3TVZA 4AL7A 2RMLA 4Y2KA 3DU5A 4ILMA 2VG7B 2YKMA 1V9OA 1VJWA 4NZ0A 1NK8A 1SJRA 2GHPA 1VQKS 4FXDA 5AE2A 3TX8A 1N5TA 3T1AA 4OJGA 4RBVA 2BRKA 1DURA 1WEXA 2G9OA 3OHBA 3VAIA 2E7WA 2UUCF 3PO4A 1OSCA 3N6MA 4O4GA 1S6QA 2KT5A 3MECA 4DR7F 2HZCA 5KFSA 1VC5A 1IKXA 1S48A 5J1EA 4C7QA 2F9DA 2MJNA 3M2UB 2M9KA 3S6EA 1BD6A 2OPRA 3MD1A 4DFPA 1XWLA 1U8SA 3L3CA 2J7UA 2NLWA 2OMOA 1UP1A 3VAHA 1S1WB 2ZE2A 3VALA 3UE2A 2VOOA 4G6VB 3QLHB 4K4YA 1JLBA 2HGMA 1H6KX 1HHSA 3MPYA 1Q81T 4N76A 2AQ4A 5H1SV 1XMBA 2HGNA 3DRYA 2NSCA 3OBIA 4CQ1A 4DN9A 5F8HA 5SUHA 1JLQA 5HN0A 2IJFA 3J81Y 2C28A 4YP3A 3JSBA 1KLMA 3HHDA 3ENVA 4RNMA 1GQEA 2RD5C 3PRBA 1KEKA 2K7JA 1GNKA 1VGYA 3LOUA 2A10A 4GO5X 3D1HA 3UWTA 3KYLA 3F73A 2I38A 1AUDA 4UY8T 1VQNS 4ZVHA 2UZAA 2LA6A 2NR0A 1QE1A 2L48A 4K5SA 1FE4A 4P6QA 5DQGA 2JZ5A 3QZ7A 4E8UA 1IKVB 4MYTA 2DPJA 1TL5A 2BUNA 2FHJD 4KHRA 3H8YA 3HF5A 3TR5A 3OL6A 2M7SA 3PZPA 2DR9A 4B3TF 4ED2A 2D3OR 3FZBA 2BVZA 1S9GA 2V8VA 2JC0A 1NB7A 4ETXA 4B9TA 3CD7A 2N82B 1RTHB 3EPGA 3BDPA 1N32F 3V4IA 1RT6B 4OX7A 2IYIA 4IFVB 4JOUA 3CXCR 2XHWA 4A4JA 2LYVA 3FEXB 1N56A 4H4OB 4DF8A 4M95A 5DO2A 3BDEA 4LF6F 2AGQA 1VBXA 3KLIA 3MI7X 4PWDA 2RRAA 1XK8A 5F9LA 1VK3A 2N7CA 1RTIB 5FDLA 2QRRA 3PO5A 3GR0A 1NHUA 4TY9A 3AB2B 2DRBA 1RTHA 1FEEA 2EWHA 2WW8A 1FDDA 2C42A 1SL0A 3D54A 2NSBA 5JXSA 2MZSA 1SJ4P 2UV8A 5MLCV 2HHXA 3IWXA 2DGTA 3MZIA 5KFKA 4WZMA 1T03A 1GXTA 1LFWA 2EKYA 4RNNA 4A8OA 4TU9A 4ATNA 5EWFA 4AUKA 4NLDA 2R8IA 5AXKA 2MQLA 2GC8A 4NLVA 4YB6A 5F8LA 3U02A 3AHPA 1N88A 4NWBA 3CD0A 5J2QB 1U49A 2GQ2A 3M2VB 1SQEA 1CQMA 3DI6A 1HNIA 1ZZFA 4CNYA 5CA5A 1KNZA 2YNGA 2E5JA 4C11A 1LKZA 3KWMA 3HVTA 3LWLA 2AD9A 5AE1A 2B5JA 1HBOB 5IQ6A 4WFZA 5K8OA 4C9DA 2B7BB 3DRPA 4X4SA 2V4JB 3MXHP 3E3XA 2MHNA 2ZDOA 2LXIA 1KLNA 2ACYA 4YB7A 3SXLA 1S10A 1NK6A 1IKYA 4OX6A 4QIVA 4JI8F 2KXHA 2ATLA 1DTQA 2MDAA 4ZLPA 1NZAA 2MKJA 5I42A 4JI1F 2DGOA 2QYCA 4F4XA 4PWDB 4TY8B 2WSEC 2O5DA 1VQOS 4ZHRA 2DHGA 1LW0B 1KC8T 2E1RA 3EPIA 3H4BA 1DJ0A 2FHKA 4X4TA 4PG8A 3D2WA 4B9MA 4WKYA 1W2IA 3OFHA 4PPZA 4C4WA 1WHXA 4EEYA 2JWNA 2F8HA 2GQQA 2V94A 3KLVA 3TA0A 3O1LA 4EO6A 1G3OA 3KLFB 1BQMA 3GIJA 4NCBA 1X4GA 2QSFA 3GMGA 4DN0A 3OR1B 2K2PA 5KG7A 4K4UA 4DV1F 2LQ5A 5F3TA 2RDJA 1HWLA 3OVSA 5HROB 1U1LA 1H0HB 1FD8A 3DRPB 3JSMB 5D78A 3GB0A 2EBEA 1S1UB 2HW3A 1R0AA 2X51A 3IBWA 3EUNA 2CQ4A 2YWGA 2DCLA 3CJ4A 3FRZA 1NU4A 1KSPA 1HNZF 3MAHA 1SUQA 2DT9A 4DL2A 1WACA 3S7RA 2IM3A 3K5OA 1LWCA 2R7OA 2LA4A 4OHZA 3TVKA 4EFAC 1HBUB 2EK1A 3FFIA 1S1TB 3FEYB 2OH2A 3VF0B 2KTQA 1XR5A 4PKDB 1VLYA 1SJQA 1T03B 5F8MA 1P27B 2GJIA 5KFEA 2APOA 4WE1B 4ZPTR 3HHLD 3UD3P 1S6UA 2ZOMA 4C11B 4R5PB 3MAQA 2VB6A 3GV8B 3E51A 1OS5A 3BSNA 5FJ4A 1KVJA 1NKCA 4GC6A 2HLUA 4CNZA 1M5HA 2HGLA 1VQPS 1K0VA 1VRTA 5HQ8A 3TAQA 2IM1A 2LMIA 2VFSA 1S79A 5IQQA 4ED0A 2IAJB 2ZOGA 1LW2B 4P7TA 4I7FA 1JK9B 5JVGQ 2UXBF 2GJ2A 2HFOA 1N34F 3MDFA 4Q44A 2ZH1A 1DTQB 4BWJA 1Q7YT 4K2XA 3CMES 3CJKB 1RGVA 4QIWD 5D6GA 3THPA 3DGPA 5I3UA 3QIPA 5IM0A 3K0JA 3U27A 1HARA 1KS2A 2HS4A 2WAQD 1Q7LB 5KG6A 4K4TA 1N8RT 4R0JA 2ABYA 3O5TB 2FLLA 1JLFA 3UQSA 2UU9F 1YVFA 1LWCB 3K58A 3NG8A 3MMJA 4KV8A 5GAHI 1BC6A 1RTJB 3DLKA 4B3OB 5DDPC 5A6PA 1S4FA 2DGXA 2VQFF 3HO1A 2D1CA 3HT3A 3MMCB 2KT3A 4J9RA 1NKEA 1N52B 2CYYA 2UXDF 1WTBA 1YJUA 2BM0A 3QJLA 3SFGA 5F0WA 3CDWA 3DXBA 4QIGA 2PEHA 2QE5A 3KHRA 4X4UA 5L1IA 2WOMB 3QJPA 5D8HB 3MEGA 4JYAF 4FF1A 5A2QY 2A3JA 4A47A 3J7YU 4IR1A 3I0SA 4YY3F 2CQDA 4A48A 4V19J 3I87A 3U7JA 2MZJA 3WZ0A 2BRLA 2C2EA 2FVSA 2GGPB 4CO3A 4F02A 3T9NA 3JSMA 1N0UA 3CJ2A 2ZH2A 4C97A 1WNEA 2L08A 3JAMY 3ZC4A 1YJRA 1YRTA 2J8AA 2OTJS 1AFJA 1Y00A 4O44A 1Q86T 2GMJA 2E1AA 1HW8A 3RR7A 3ULHA 3HHNB 1VK8A 1KD1T 5H9EJ 3G6YA 4ZDNA 4ZKAA 2CFXA 3DOKA 3TVYA 2XMJA 3R5BA 3W2VB 3TA2A 2DNOA 3GFZA 4ZPBA 1Q1KA 2VD3A 3LUYA 5J2PA 2ZZMA 3QGPA 4QZVB 4G3IA 2RSQA 1X9MA 2UVRA 2PC6A 1SIZA 1HL6A 2RS2A 1KN6A 3RB0A 2EBGA 2Z4PA 3OQ2A 5LSOA 2V4QA 3TANA 3CUNA 3EXYA 4XO0A 3DLEB 4WCEQ 2ZH9A 1M5VC 2OO4A 2AYBA 3T5LA 2RKIB 4LIWA 1GTHA 2QSWA 3DDNA