2FTRA

Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
ENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords BH0200
publication title Crystal structure of (10172812) from BACILLUS HALODURANS at 1.40 A resolution
rcsb
source organism Bacillus halodurans
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07110 EthD EthD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ftrA00
1Q8LA 1N5SA 2FTRA 2ROEA 1FVSA 4OJ3A 1KQKA 2VV5A 1OSDA 2HFOA 4A47A 2CRLA 1GXTA 5B08A 1SQEA 1Q4RA 3CJKB 2LQ9A 1TUVA 3UDCA 4DL0C 1XBWA 2KKHA 1CPZA 2RU9A 3QGPA 2Q3PA 1S6UA 5B0FA 1P6TA 2AJ0A 1Y9OA 2PGCA 5KAKA 2KT2A 5B09A 5B0CA 2OFHX 2HLTA 2ROPA 5A6PA 3HHLA 4OIXA 2ZDPA 1GXUA 1MWZA 2GGPA 1X8DA 3KKFA 5B0GA 3HHLD 1YRXA 1CC8A 2OKQA 4YDXA 4DN9A 2BJEA 2ROGA 5B0AA 3MCSA 4NPOA 3HHLB 2GA7A 2GGPB 5B0DA 3IWLA 1AFJA 1U7LA 1YJTA 3MZIA 5A6WA 1TZ0A 1YJUA 3LGMA 2OFGX 2HLUA 1N5TA 2RILA 3QMQA 1JK9B 1FE0A 1FESA 1VQYA 2KYZA 3BN7A 2RMLA 2EW9A 1P8GA 3TRGA 2K1RB 2K2PA 2N7YA 1MWYA 2LQBA 3HFKA 2IYGA 4FNHA 5F0WA 3VTIA 1APSA 2QLXA 2ACYA 2FHMA 3KNGA 1YG0A 3DXSX 3DCAA 1N5QA 3BDEA 1IUJA 3BGUA 2BBEA 3FGVA 4Y2MA 1FEEA 1FE4A 3TOQA 1X0PA 2JDJA 2ASYA 2GCFA 4OJ1A 5B0BA 1W2IA 4Q2MA 2W4CA 4U9RA 3T9NA 1Q8BA 2XMVA 2HQIA 2OD6A 2N4CA 4ZOSA 1KVIA 1TL5A 1Y3KA 4EFAC 2K1RA 1AFIA 4A4JA 2HFNA 3BF4A 4F67A 2QYCA 1OPZA 1URRA 1RJJA 2N4DA 2LXFA 1SB6A 4HH1A 2GV1A 3HHLC 4ZA1A 3LGNA 2OD4A 4NL5A 2BYCA 2BUNA 1WD6A 1FD8A 3FMBA 1CC7A 2XMTA 2AJ1A 1YJRA 2LDIA 4FNIA 2AW0A 2K7KA 5F0UA 2K7JA 3I9ZA 1K0VA 1OQ6A 1Q53A 3K7RA 1KVJA 3TNVA 2GFFA 1FVQA 1Y3JA 2XMWA 4Y2KA 4DPOA 3HF5A 2L3MA 2XMJA 2RSQA 4A46A 2IFXA 2OMOA 2ZDOA 1S6OA 1X7VA 1LQ9A 2QLWA 5IXUA 2IYIA 4A48A 2G9OA 5K9FA 1OQ3A 2FB0A 1TL4A 2XMUA 3CJKA 3HDSA 2FIUA 3WDOA 2XMMA 2KT3A 4OJGA 5B0EA 1JWWA 4Q2LA 3BM7A 2W4DA 3HX9A 4HI2A 1VQSA 5T7LA 1TR0A 3LO3A 2OAUA 1AW0A 3KG0A 1N5VA 2W4PA 1ULRA 4HI1A 2BJDA 4HL9A 1SI9A 3E8OA 3KG1A 1YJVA 2GO8A 4HH0A 2PD1A 2HIQA 2VH7A 1V3ZA 3GZ7A 2XMKA 4QOTA 5T7LB 1R6YA 4YEAA 1Y0HA 3BB5A 3BR8A 3F44A 3FRYA 4OJHA 4Y2IA 3IWXA 1QUPA 2AP6A 2QIFA 2OP5A
chains in the Genus database with same CATH superfamily
1LW0B 2A2DA 1Y5IB 4OZ0A 2YVSA 3JXOA 3Q24A 3GFYA 2EG1A 4WYWA 2LQ9A 3HI9A 3KG4A 1X31C 3NNHA 2PGCA 1BHNA 2V4RA 4NI2A 5U47A 2BXJA 3MM8A 5MAOA 3NGUA 1T02A 3DM2A 5ETLA 3MEKA 4LF6F 3AJ1A 2R42A 4AD6A 4FS2A 5ADZA 3NCRA 3EWGA 3OXFA 3TAQA 1VRQC 4LFAF 2Y1JA 3IXQA 1UEVA 2NS1B 2HVIA 3KLIA 1VCTA 3PNIA 2HHUA 2KHDA 4WTOB 3LPYA 3ZTOA 4A8WA 4HDGA 3RRHA 2FLOA 3AB4B 2N3LA 1FWPA 2HQ3A 3MDFA 5KFWA 4XPEA 4HI2A 2ZHBA 2K06A 1S6QB 3Q8QB 3C16B 1NBEB 3GQCA 1MLAA 3AODA 2ASLA 2AX1A 5J1NA 4IOBA 5ETVA 2OPSA 3OUYA 3W2VA 3EXCX 4I64A 1CBKA 5A8WA 5HN0A 1ZS6A 2X1BA 4TU8A 1RE1B 4MIAA 1NJIT 1WC3A 3ZO7A 4ID5B 4ICLA 3KNGA 5KT3A 5KFLA 2M9KA 5D4OA 1TL7A 5DGBA 1OY8A 2BOAA 4DV2J 2UXBF 2FJXA 2JDJA 1VBYA 1FTCA 3SEOA 4OYBA 4P75A 2QMUB 3L7UA 2W2NP 1GXLA 3CJ5A 2HHTA 4PWDB 2PIIA 2CQDA 1UEKA 1DFDA 2ZKUA 1NUEA 3OSPA 1EKSA 2VL1A 3I6PA 3HLUA 4ZVSB 2JZ5A 5BR8F 4YR0A 4W90B 2B7BB 3GZ7A 3QGHA 3HJFA 2W01A 4WU3A 1UTAA 1KQGB 3RBDA 3WX8A 2LEPA 4ZVGA 2YWHA 3GONA 3OSNA 2A0FB 1KONA 2DHSA 2E1RA 1KWMA 3R3TA 1VQ5S 3N01A 5L46A 4DV3F 4UQGA 1GAOA 1LW2B 3EGNA 3W8PA 3H25A 2ILYA 4FDFA 3PYDA 4L3KA 2P9CA 3CD7A 2ZJRQ 1S48A 3GMGA 3DLLQ 3NBPB 2B0GA 1T05A 3OFGA 1X4HA 4B17A 3UDEA 1TFYA 1NDKA 2GV1A 2KG0A 2W2OP 1CS4B 1UA1A 3QRQA 4CTAA 4DR7J 3M32B 2KFZA 1JJHA 5J2PA 2ERRA 3H98A 3R5JB 5AJ3F 2XHCA 3FEXB 4X4RA 2E7VA 3FFIB 1JLEA 3D6MB 2JRSA 3NNCA 3LA0A 1HW9A 2Z2LA 2ZZMA 1FXDA 5KFRA 2DGUA 5HAOA 3OLBA 1I3OB 2XWYA 1VI7A 4P7TA 3BR8A 2FTRA 3RW6A 4DU8A 1S79A 4NYPA 3D68A 3O5TB 4CI0B 5KFVA 1VR6A 3CB4A 4H4OA 5T14A 4EBDA 3G9CA 2ZOFA 2BJEA 1MSWD 2B51A 1TL3A 2YKAA 2X7IA 3M1VB 4YR3A 4AUKA 1FE0A 3MM6A 2EKNA 1M5OC 2G2YA 4URSA 2HHSA 2BBEA 4HHJA 5K8MA 1U8SA 3ZTRA 4PG6A 5J2NB 4ZOSA 2CQ0A 2B5JA 5BYRA 1NNDA 1NHKL 2OD4A 2XNQA 1BLUA 3LP1B 4LQ9A 1UJ6A 2OI2A 5DG8A 4IH6A 4LBPA 4KGVB 4KHPJ 1YDLA 4C0HA 3K89A 3CWJA 1RWKB 3NGKA 1PBUA 2WVDA 3HHDA 1FJGF 3JSYA 4P7VA 1WC0A 3O2IA 5IWAF 1RT4A 1IR0A 2XCAA 4G1QA 3TUJC 5D0GA 3D6TB 3D1QA 3FEYB 1NJWA 1N33F 1TFWA 1JXVA 3DOKA 4NASA 2XMAA 1RADB 1O8BA 2ZE2B 4Y0FA 2MKHA 3LP2A 2HQCA 4B3RJ 4K4UA 2ROGA 3JTOA 1TZ0A 4WIIA 4ECZA 3TX8A 1A7GE 3UD4P 4M5LA 4QR1A 2MKCA 2AV5A 2OD6A 1T9YA 2XC9A 2KI2A 4C0OC 4HH1A 3BS9A 4FN5A 1NH7A 3UD5A 4LF9J 1S7HA 5F0UA 1G7CB 2VPWB 1P27B 5C25B 1JQGA 2MLXA 1RABB 2P9GA 2QV6A 3NAHA 5CYJA 3PTWA 4WWSA 1WWHA 1N4LA 1A6LA 2E7XA 4AFFA 4NX9A 4DPYA 4LIWA 4F50A 4ED3A 4PR6A 2VZ9A 2RS8A 3PCOB 1AUSL 5HMYA 1MU2B 3BBCA 4QYRA 4QW9A 2LXIA 2J8AA 4ER8A 1RKIA 4IR1A 1CLFA 2UUTA 5A76A 1NM2A 4YHHJ 5KFUA 2UUCJ 4B9LA 3J81Y 4NZ6A 4URGA 2IJFA 3MMAB 1NK6A 4TVAB 3RAQA 1S10A 1DQ9A 3EGWB 1RT6A 2CAJA 4QWAA 4WPAA 2K2PA 2R7UA 3R7NB 2Y0BB 1U49A 1RLDA 3CSKA 3GIMA 2AYMA 1LWCB 5ETPA 4DQRA 4O0IA 5DZ7A 2UU9J 1LXNA 3EZOA 5KTQA 1S77D 2GFFA 3J81j 3PV8A 2FLPA 2V0NA 3H0PA 1WEYA 3TJ9A 2MQQA 3TAMB 1M1HA 1NDPA 3PW7A 4HHHA 1FJCA 3Q2TC 1FFWB 5C42A 1BWVA 4A8OA 5L8RC 4YB1P 4B3MJ 2D3O1 1XK8A 1CULB 3F73A 1NKEA 1RISA 2B6AB 2HNZB 1BQXA 2VV5A 3UD3P 3NY0A 1K0TA 5FLXY 8AT1B 2GQQA 3MUVP 3M9NB 2ZD1B 3FSIA 2XQCA 4C8ZA 5FDLB 3KMQA 3W64A 4CLLA 4JI8F 3D28A 2GO9A 1FJ7A 1YBUA 3JSBA 4ECYA 3GJRB 2GVZB 1ZH5A 2Q66A 1JKHA 1DHMA 5C2CA 5A0YB 3ZZZA 3Q8UA 1Z2LA 3PYFA 3W61A 4NYZA 1RKJA 1PIEA 2N4DA 1B0PA 2V2VA 1X9WA 4NXMJ 4DV6J 2ZC3A 4ZP9A 3M2UA 1RHUB 2ATLA 3DLEA 4XO0A 3I5AA 3RBZA 3FCHA 3AXKA 4ED1A 2KB2A 2XNRA 3QRRA 2MY7A 1HPZA 1NO8A 4HEA9 4NOHA 4RW4A 4K0KF 2QL5B 5M2UA 2W9CB 1HNXJ 3TARA 1RCOB 1SC4B 1FVSA 2HFOA 1RA7A 3ISND 3SQOP 2J7KA 4DL0C 2YQ0A 1U1QA 4DZDA 2DXFA 2RQMA 2WOMA 2HMIB 2YH0A 4NLRA 1EQMA 1TV6B 2DNPA 1YVFA 2KFYA 5JXSA 5CYMB 1AXQA 1RUSA 2QG9B 1W26A 4B3TJ 2VOPA 2W9AA 4BDPA 5DRKA 2FGCA 3QO9A 1OPZA 4NLWA 2CKWA 2DGWA 2BUNA 2VC0A 2YPZA 2NR0A 4OYXA 1JMTA 3CJ0A 3DMJA 2HAIA 4FF2A 1VRTA 4MIWA 3TEGA 2XY5A 2ALYB 2KVQE 4I69A 1HNZF 4FXDA 2KM8B 3LW5C 4WE1A 4CNZA 1R43A 1YJVA 3HD2A 4M5DB 3I0RB 3G6ES 3F41A 1Q8LA 2Z57B 1F3FA 3FQLA 3TEHB 1T8EA 2J7UA 2K8GA 1TELA 1Z2ZA 1S1VB 4YFUA 2R7QA 3D2WA 2Q3PA 4DF4A 1KLNA 2O01C 2HZCA 1NSAA 2XZTB 4ED8A 2ZWPA 2DGSA 2Y1RI 4IG0B 4KH1B 1R0BG 1TAQA 1SH2A 3JYTB 4FVMA 2CNKB 4GKJJ 4I2QB 3DCAA 3I56S 4GKKJ 1X4EA 1X4CA 4LRAA 2C2KB 2HQIA 3H59A 3G87A 3H4BA 3MMCA 1URRA 3HSZA 5IV4A 5JVGQ 4LRFA 1QM9A 2XMTA 2EEYA 2WW4A 1ROFA 1EIYB 4B08A 4P9SA 4M8LA 2CJBA 3M05A 5D0HA 1E6VB 1P1LA 5KOWA 1NHVA 1DLOA 2HVEA 5KG0A 3KTQA 2JFKA 5K9FA 4TY8B 3FZBA 2BDPA 2VC1A 1WG1A 2MB0B 2PT0A 3RAMA 2BANB 1U1LA 4KKOA 2Z30B 2UUBJ 1IJEB 4DMZA 5LMNF 2JVOA 2U2FA 4U67Q 2G2OA 1KOHA 2ZHOA 1R31A 1DTQB 2C3PA 1WC4A 4G6VB 1RTHB 1S57A 4IDKB 3M2VA 2Q6BA 4NLSA 3OTDA 2AWZA 2HS3A 4OL8A 2Z4PA 3BO4A 2C2DA 1HWKA 1OIAA 2JJ4D 2JLGA 2HWIA 4Q8EA 2M52A 2VFTA 2QC3A 4JI4J 4ZVRB 1VGYA 4NCGB 4EZ6A 3TUZC 2MHEA 3NS7B 3UDVA 2V9WA 1BD6A 1HQEA 1U6FA 2HS4A 2VG7B 3HSGA 4NA1A 1WTBA 3IP0A 2AEFA 4PPDA 2OTJS 1ZM3A 3NXZA 4AL6A 5KFMA 3PFOA 3BO3A 1GQEA 1QD1A 1CJTA 4IO9Q 2J8SA 2RSQA 3CULA 1OSCA 2R9LA 2DH7A 2MLZA 4LF2A 1J5OA 2W4DA 1V5VA 3L3CA 1Q79A 4N8OA 1QE1A 4O4RA 4FYWB 2R7RA 3MAQA 4KQZA 1EX8A 2DHAA 4MYUA 3PM9A 1Q78A 3THPA 2CFXA 1SCJB 1SPBP 3T41A 3R2CJ 3NEKA 1FX4A 3DOLB 3F0NA 1IM4A 4NEYA 4J9SA 3KUHA 4K2XA 2I6WA 5L1LA 4B9VA 2XS7A 1QTMA 2DRAA 1TL1B 3N6NA 2KRRA 4RNNA 2PFFB 3D54A 1YRTA 1SJ4P 2FHKA 4USMA 2FJEB 1CJVB 1T95A 4DPXA 3M8QA 1R8PA 4Y2KA 3OXGA 4U8YA 2RKIB 2RB7A 3V81A 4FF3A 4MK8A 2AKWB 2M2BA 2OHDA 2QLJB 4IQXA 2ADCA 4HL9A 3Q23A 1SI9A 4X64F 3LP0B 4R25A 2ZVIA 4QOTA 2UUAF 3GFHA 4KTQA 1XWLA 1DURA 4UQTA 1OO0B 2BJ7A 3CJ8A 4RW7A 2ZFHA 4X65F 2XZDB 2AHOB 3GV5B 3CDEA 1U1KA 2WSCC 1HI0P 4HHUA 1VQLS 2LU1A 1SH3A 2VG6A 2E5GA 2RQKA 2E5IA 4WF9Q 1RXOB 3O3LA 2OEMA 2E5LJ 3TP2A 1FK9B 4RWWA 2CDQA 4QPTA 1B70B 3T6BA 3GWCA 1DRZA 1OYEA 3HT0A 1AFIA 4X4VA 4KB7A 4OYIA 3LGNA 1K73T 3MUTP 4ANEA 4MKAA 2QSWA 4ITSA 2HFVA 4E0DA 3MM7A 4IFVB 2JL9A 3CJQA 1NMEB 4KGXB 2VBXA 3CCWA 2R2UA 1HR0J 5HQ8A 5KG4A 1NK7A 1RHRB 2XGPA 2Y1IA 1KHVA 3MAHA 4IRKA 3W1YC 4ELTA 3EUNA 2B56A 1SJQA 4OZ1A 2AJFE 3NMRA 3THVA 1VDHA 3K8WA 1PAEX 3G6VA 4BS2A 2KJWA 3HZEA 5D4NA 3CCES 1PO6A 5K8PA 2XI3A 2HLUA 3EXYA 4F3OA 3P49B 1P8GA 4F02A 5DETA 2ZNYA 1IQZA 3A3NB 2YNGA 2Z8QA 1W2IA 2VFUA 2VQEF 4DR3J 3AHPA 1Q7LB 2M4MA 4P2FA 5HVHA 4KRWA 2H65B 1MN9A 3AD9C 2F8EX 3CT9A 3IRXB 1IBCB 1AROP 2NREA 2DRBA 2QLBB 2DHGA 4B3SF 4ES3A 5IOLA 3SQGA 4GC6A 4Q44A 2KT3A 5LXRA 1RQ0A 3P45B 3I4PA 4AT1B 2QEXS 5I3UA 2RF2A 1HI1A 3EZUA 4CYUA 1IWGA 4GVLA 4IFYB 3BBBA 1N5SA 4OJ3A 3T5KA 3FDSA 2ZH2A 2CPFA 2UXBJ 1WG4A 3SBMA 2GAHC 1GK8A 5D3GB 1F0XA 5F41A 5E0OA 2HNYB 1X5SA 3T5LA 1GXUA 2WB4A 2ZZTA 4LFCF 1H2TZ 1YJTA 4X2BA 2H5IB 1JLFA 1V9OA 3KMSA 4NLQA 1TVRA 4Q8FA 2AYBA 3DXSX 2YWEA 1WOPA 2D7SA 1JXEA 1NXIA 4LIRA 2N82B 1FT8A 1D9DA 1FRMA 3T1HF 3PYEA 1IKXA 5FD1A 1YJRA 2UP1A 1FKAF 2BJ3A 2J76E 4OYAA 3IG1A 3QT8A 4U6PA 4C7QA 1N36F 4W4MA 2YKOA 1M5SA 2IFXA 4UUWA 1HIYA 2YKNA 5HATA 1CVJA 1FFGB 2FJWA 3N0VA 1HNIB 1HQUB 2CPDA 4UY8T 1X5PA 3F44A 1KVKA 4MKYA 1BMQB 1UPMB 2Q43A 2F4VF 3GV7B 1AYEA 3DRRB 3SIPB 1TKZA 3LAMA 2HVZA 1FNXH 2LP4A 3PIOQ 1SQFA 2R7SA 2MQMA 1RWOB 3OFFA 2YWWA 4FYVB 5EX3A 1EB0A 3CDAA 4M95A 3IR7B 4KH0B 2E1CA 4ZCLA 2HWHA 3X3UA 3HCXA 4WFXA 3SFUA 1O51A 3RR7A 4QZVB 2C3MA 4H4MA 1Q8BA 4WFNQ 4A4JA 3ZNUA 2W25A 3D0IE 1L3TA 3T5HA 4CM2A 4H4KA 1DTTB 2OUGA 4C11A 1GNKA 4S0MA 4KJIA 3BSCA 2FZGB 2OPPB 1QY7A 2AF6A 2FVPA 1RAFB 1Y10A 4NLXA 4C8LA 1YZ7A 2LKZA 1I51B 2HRUA 2AJ2A 3GSIA 5BXIA 4F36A 3FSYA 4JBCA 4I6WA 4CP5A 3ENVA 3KKFA 1WDTA 2F5GA 4RW6A 3CIMA 3KOAA 4QU7A 1VQ7S 2YQ1A 2N3OA 3AOCA 1REGX 4YN3B 1LWEB 3G82A 3CCMS 2DIVA 1C1BB 3BH6B 3K5OA 4YMEA 1EJ7L 3AXMA 2FVQA 1FJGJ 1NKCA 5IWAJ 1C2PA 2NUUG 4QIFA 1KQSR 3NCPA 3Q0AA 3CMAS 3KK1B 3U1NA 3W5YA 3WC2A 4LQ3A 3MEGB 4RR5A 3QNWB 4DV1J 1JNRB 4ZCMA 4DV0J 4ZP7A 2JEJA 3TA2A 3WC0A 2BE9B 4EBEA 2JWNA 1B7YB 3MGJA 3DI6B 2XMUA 2R7WA 3WHIA 4V19X 5J1PA 3IWNC 1FDDA 4HT5A 1RWNB 2V67A 4RUHA 3KG0A 4TQRA 3Q8VA 2I5JB 2E1AA 1IR2A 3PX0A 2XS2A 4DR6J 5KFSA 3PW5A 3D3BJ 2WZ1A 2LYVA 3MECA 4E2FB 4MKVA 3CJKB 4J9KA 3TA1A 1XBWA 3RU0A 3FBFA 4CLFA 2GHVC 1HYSA 5HO4A 4HYKA 2E9ZA 5EUHA 1T7PA 3EM1A 4YB6A 2CPHA 3S7RA 2IRXA 3CCSS 1YX2A 1C4CA 4JUZA 1N6QB 2Y9HA 3DHXA 2Z58B 2QZ8A 3POTB 1BQNB 3G6XA 1VQNS 4WXOA 1EKRA 5DLFA 3GJTB 4F67A 1SC6A 4ZHRA 4DV2F 3ZZTA 2F40A 2MQNA 2CQGA 4C8MA 1M90T 5GMEA 4DR4J 1S1TB 3D0HE 2YNIA 3C14A 1RT7B 5K8NA 3CPWR 4YS2A 1BQMA 1YBTA 1YITS 2QL9B 4RW8B 3HULA 1L3SA 2V2QA 1RGVA 2OEKA 3PHEA 3QLHA 1UMJA 1RAEB 2ASJA 3KLHB 3S8SA 3CF5Q 1S99A 2DCLA 3UCGA 1RT2B 5I42B 1OPIA 2FPHX 2MKIA 3CJTA 3EPIA 3HFVA 3DXBA 2KXHA 2J6SA 1PC4A 1T9TA 1RU2A 1REVA 2U1AA 2CADA 4DFKA 1S12A 3MM5A 1IKVA 3BGUA 1CQMA 3MM9B 3PKMA 3N6LA 3KK3B 2BKPA 1G6BA 1Y3KA 4DSJA 2I1RA 1SKRA 4Y65A 5E2QA 1RA6A 5LOQA 2FJVA 2CZ9A 3HHEA 4LUBA 5H1SV 4AXJA 2CJKA 2R8GA 2M0GB 4CWBA 3EPGA 1VC5A 1KN6A 5HJYA 2NUHA 5IXUA 2PO4A 4URQU 1HBNA 2DRDA 4ZJOA 3FQKA 2BE2B 4O44A 1XQIA 2PD1A 2HHWA 2HZVA 4DHVA 1GFWB 5HROA 1IXKA 4DV7J 1WEXA 2F3JA 2OPRB 3VVUA 1C1CA 2R7OA 2MEWA 1S1XB 1SIZA 3EDQB 3CTRA 4K4ZA 5B0GA 2EKYA 3EVMA 1LW0A 3HHLB 1Q81T 1KS2A 4EEYA 4ZMMA 3GG0A 2F4FA 2NPIA 1YG0A 4TNOA 4ENOA 1NJXA 2Y8WA 2FVRA 4ZPCA 2CJAA 3ULHA 1FRXA 4CIOA 1IBLF 4DU7A 3RJMB 2VBZA 5KG7A 2DISA 2QT7A 1RBAA 2J9EA 5DQIA 5DG9A 1DAXA 3W5ZA 1R8BA 2DXEA 2GMJA 4QYZJ 2AD9A 4V19J 2FHJA 2DH9A 1R27B 5KFBA 4KHPF 2QLFB 2RHQB 4PWWA 1UA0A 4NZ7A 2XSJB 4F0MA 4DCJB 3IWXA 2HFNA 2DR5A 3DRSB 4GO5X 1R0AB 1KQKA 4OYZA 1QAYA 4O3NA 3C16A 4JI3F 1WC6A 1CQNA 3FBBA 4NPOA 4EK2A 4NI2B 4TYAA 3MM8B 4B3RF 2EI5A 3KLFB 3SSSA 5H9FJ 5CXTA 1VISA 4PWUA 2UV8A 1N54B 3MPYA 2HVHA 1S0VA 2AW0A 2K7JA 4RUCA 3KLIB 1VQ4S 4QIVA 1HLWA 3GV8B 4LF9F 3GIRA 2IYIA 3E2EA 2X1FA 5AXKA 2MQ8A 5IM0A 2UV8G 3MFHA 1YTYA 3GYXB 2NXEA 3LWLA 4ZPDA 1S6PB 2CG8A 4LF5J 4R0EA 3QJPA 2KTQA 3ONQA 2L48A 5CCMA 4NLGA 5KFEA 3HM9A 2GGPA 3AD8C 3GYNA 5CQGA 2LA4A 4YHHF 3OUYB 1AFJA 2UUCF 2MY8A 3LGMA 4KPCA 2FZKB 4ZDNA 1YIJS 3KUGA 5EWGA 4OV1A 1NH8A 1IUJA 2BM0A 1NSQA 1FE4A 2R8HA 3U1LA 3QRPA 2J0SD 5F3ZA 1M1KT 1YSJA 1TKTA 3VR1A 2ADBA 5M2PA 4FNIA 5J2QA 3NBPA 3G86A 3HVTA 4F25A 5HQMA 2UU9F 1NSKL 5CAAA 2E29A 4GC7A 2BW7A 1CS4A 3J7AN 1BWEA 2NPFA 5F9LA 2XY6A 1CJUA 2A10A 1UAWA 1JWWA 5T41A 3CCZA 2WRMA 3OPKA 3V4IB 1XN9A 5IZHA 3UNGC 4CO0A 2DPJA 2CPYA 3FFIA 1VQKS 3RBEA 4ANCA 3MCNA 2EWHA 4WP3A 4B3MF 4OYPA 1VS3A 1SVDA 4K5RA 3UNYA 3DYAA 3ISZA 1X4AA 4CO3A 3AA8A 4L73A 1RHQB 2BMBA 3PRDA 4O3SA 2L9WA 1FO1A 3A1YG 1ZYQA 2ZBIA 5CYQA 1KFSA 1YJUA 1NPRA 5G0RA 2LQBA 3HFKA 2NSBA 3NWRA 1V3SA 3OL7A 1FNMA 2B7CB 2WTFA 2BRLA 1XERA 4C98A 4MYTA 4NLTA 3QGIA 4OX8A 4ZVTB 5KFGA 3K57A 1TUWA 4DBQA 4TU7A 4FBUA 3ELHA 2VONA 2AX0A 2DB1A 5J2NA 4ZVFA 3QWPA 3ETMA 4EZ9A 1Y3JA 1WSRA 3V5RA 4LVOP 3TZYA 3D3CJ 4RW9A 1RWMB 2ZITA 3LP1A 4NXMF 4DV6F 1AUDA 5J2PB 4ZP6A 4DL6A 4QIGA 2CVEA 4KO0B 1JLEB 3HXMA 4J91A 5FIIA 4C3KA 4O23A 2J6UA 1TQLA 4USUA 1S9EA 4JYAJ 2KJVA 2FDNA 1HNXF 2AYGA 4PYDA 4O3QA 4BHQA 5EWFA 5B0DA 4JI5J 3CC4S 2RILA 2ZOGA 2Z2MA 1TL3B 1OMSA 1YI2S 2VFVA 4DUTA 1KKHA 2DD8S 3ENWA 1IJFB 3BZQA 3MM6B 1HBUA 3A3PB 1W7WA 4Q5VA 3DDKA 1IBMJ 3PEHA 1UWBA 5C7PA 4X64J 2YX4A 3DLBA 2DR6A 2L41A 4DSKA 4B3TF 2B5JB 4JV0A 4IH7A 2H51B 1U1NA 3U7JA 3T1YF 3OHAA 5J1EB 4E8UA 4WJBA 4A46A 7AT1B 2VB6A 2QO3A 1TU0B 1O5JA 2EBGA 2KDOA 4CO4A 5C25A 3GLJA 1LKZA 2NXNA 4MFBB 2QMWA 1IN0A 2WB1D 4RBTA 5DDQC 2FY1A 1JLAA 4OJHA 2J9DA 3DLJA 4JI0J 1RTJA 3PO5A 4E98A 2HK2A 4EO6A 4NZ0A 1RT4B 5DM6Q 4G1QB 2AMCB 3ADAC 1XNRJ 1UJ5A 3DOKB 4DG1A 5A6PA 1MU2A 1BXNA 5KFOA 2X51A 2IAJB 3EVOA 3LP2B 2NXCA 3OR1A 2MSTA 3WX4A 3W2WB 4DR2J 3CCTA 1ACMB 3UW1A 3G4SS 1N34J 2CZ4A 4PEOA 3TOQA 2AT1B 1SUQA 2DO0A 3NS5A 4GKJF 1N32J 3RB0A 4QYZK 4GKKF 4I6YA 1PSDA 1PJ5A 5DQGA 3DRYA 5HBMB 4J5OA 2ZZNA 1WDDA 1S6OA 3AOAA 1WUUA 3N5BA 4WFAQ 4ZJLA 2XLKA 5DS7A 1L3UA 2YNFA 3DFEA 2XULA 2F9JA 2W4PA 2BJDA 2X1AA 1RTDA 2DYAA 2E5JA 4OZLA 3TAMA 2FQQB 3UCZP 3JAMY 3K59A 3ILOA 1JX4A 3QAEA 1YLXA 2V34A 2LEAA 4M5NA 5KT2A 3V2UC 2UUBF 2OFHX 1XTZA 3D5MA 2HNZA 2C22A 3P8BB 6FDRA 3MCSA 4ZP8A 1IBKJ 3K5NA 2ZD1A 2CPZA 3OTEA 1YZ6A 4ZVHA 5F8JA 2DNYA 4K2JA 5DO2A 4PYAA 3UVJB 1FKOA 4TKTA 4JI6F 3BKTA 4I4BA 4BC9A 1KVIA 4JI4F 3CCVS 2LXFA 2NQPA 4IRDA 2HGNA 2NXUA 4WK1A 5D0RA 4ID8A 3AFGA 3NS6A 2FVCA 2OELA 2C2OB 3MOJB 2IM3A 3L95X 1VK8A 5C42B 1SBRA 3R5BA 3B54A 1KD1T 2P6TA 3A3OB 2B4VA 4DL2A 3WZ0A 2B3TB 4ECQA 3RW7A 4ED6A 4C4WA 3EE3A 2RD5C 3BN4A 3LOUA 2XM3A 3H5SA 5BJRA 1U7LA 4EYIB 4OHZA 1D0EA 2HMIA 2FHMA 3WBZA 5IS2A 3MAAA 3ISNC 4WZQA 1Y7PA 1TV6A 4G1PA 3OFEA 2MGZA 5CYMA 3TW0A 2IVMA 4WYLA 5D4PA 3CD0A 1VYAA 2DITA 4ILMA 2YH1A 4UOCA 4ED0A 1NB2A 1HWUA 2UXDJ 1LFPA 3DKDA 3TVZA 4KHRA 3RTVA 1C4AA 1ZM4A 3AA9A 4J9UE 3V4MA 2MZJA 4K5SA 1MMLA 4O3PA 1N52B 1HA1A 1VMBA 2PMWA 2CQPA 5E3CA 1U0HA 3M2UB 3AOBA 3BR9A 5A2QY 4ERDA 3VQTA 3W9HA 5HSPA 1QJHA 2HFZA 1HPZB 1UFKA 3IGNA 5B7WA 3TJ8A 3NGDA 4RW4B 4DPTA 1HHSA 2WVEA 1H2VZ 3A12A 4PG7A 3SI8A 2C2RA 4D3HA 1N0UA 3M2RA 4M5DA 3RRKA 3I0RA 3GB0A 1FRHA 3GE9A 1DARA 2GMHA 4TY9A 1SKUB 3CDUA 4X4SA 1SJ1A 3KJNB 1PG5B 1VQOS 1CG2A 5KFKA 2C42A 1HW8A 3CJ2A 3PJXA 5L9NA 4RBUA 1BGXT 4P10A 3NWGA 8ATCB 3H7HB 1IKYA 1S72S 3GCXP 2AEJA 2E5LF 2WK4A 4DV5F 4DR5J 3ENQA 1ZETA 4W98A 1X4BA 5KFAA 5KFXA 3DMJB 1KP6A 1RTIA 3BBFA 1VRTB 5CA5A 2BQ3A 3FCVA 2PFDA 3PEJA 1GMUA 1RWVB 3TI0A 2B8PA 1E6VA 3N4WA 2V5HG 5H9EJ 1HR0F 4YEAA 2VPZB 4A8SA 1WOSA 5LSRA 4TY8A 2I0XA 4NLOA 3BREA 3EJMA 5LT5A 3J81U 5D8HB 4USJC 2QFJA 2J7WA 2ZH5A 3ITHB 2BANA 6AT1B 1VQ6S 3TZXA 4DOZA 6FD1A 1SH0A 1MROB 3IBFB 3SSRA 4Y6IA 4O4GB 4D3GA 1TK8A 3LANA 4DLGA 1RTHA 3R1HA 4IDKA 5DQHA 2HZAA 2WAQD 4RX6A 4FNHA 3VAMA 2F1FA 2V2ZA 3BV8A 3Q2SC 2GCFA 2MKKA 1X4FA 2J0XA 2X3DA 5LM7E 2R4FA 3MPUB 4QR2A 3RZAA 2DH8A 4USIA 5HP1A 4ZA1A 2WW8A 5KG2A 3MMCB 4DR3F 2AYEA 3HK2A 4IO1A 2VG7A 1RWXB 3X1LB 2GQCA 3CD6S 1PYOB 3GYGA 1RHJB 2LMIA 1SV5B 2VJUA 3FK4A 2DNGA 1DLOB 2GIQA 3CCRS 3HJVA 5FLXU 5GMDA 3TZZA 3D9BA 4NCAA 5LSOA 4OI1A 4A8YA 5LXYA 4KBIA 2KT2A 1B99A 3QATA 2MJUA 1ZOTA 1H2UX 2MQOA 2DGTA 1K44A 1N5TA 2EW9A 4G3IA 4F0KA 3RBXA 4ANDA 1NK9A 2HAFA 2DNRA 3I31A 5D77A 3ZZUA 1HQEB 3CVKA 4NRTA 3E51A 1D1UA 3EDRB 1E6YA 1TKDA 2HBYB 3EZ5A 1U47A 4HVZA 3OL9A 3UWTA 4DV4J 2MKJA 1UWAA 1CJTB 2N7CA 3CMES 3WDOA 1PJ7A 3DRXA 4X4UA 5A8RB 3GJQB 3NL0A 1J5OB 2RKIA 4IUFA 1R6YA 2MQLA 3NOCA 5JMNA 2ATCB 4ZS6A 3CDBA 5GAEU 4CM0A 4MJKA 5B08A 1L3KA 2EC0A 4NXNJ 2DTJA 2ZH3A 2VA2A 3FCWA 3ZTSA 5L9XA 3HHLD 2XB2D 1TKXA 2G2ZA 1HNVA 2DR8A 4J9PA 2M3DA 5KT7A 4JI2J 5LMUJ 1V3RA 4ZPWR 4RJVA 1NK8A 4EYHB 2IVYA 2RHSB 2N4CA 1IKWB 5EDWA 5KT4A 4M5JA 1FK9A 4JI7F 3VZHA 4WTYA 1FTRA 1FJEB 4OZ5A 4MK9A 5CHCB 3KK2A 2BE7D 5L1IA 1VBZA 3M8QB 2JEGA 3NNAA 1FDNA 1Q7YT 3TUIC 2PI4A 2FB0A 2H48B 2VPYB 1G2EA 2ABYA 3V81B 3R7SB 4KYZA 2DKOB 5KG6A 4DX5A 2RDDA 1ICEB 3MTJA 1XNQJ 3CCQS 4RU9A 2J9CA 2VH7A 2ZH1A 2QSFA 2GC8A 3CDWA 2KYXA 4CT8A 2ZNZA 3BQ1A 5F8HA 3BGRB 1IBLJ 4RW7B 1NPPA 1SL2A 1CC8A 3T19A 3CNQP 5KOXA 3K5MA 4F4AA 3PR5B 2I9SA 1VHFA 1WHVA 1LXJA 4LSNA 2VG6B 1BE4A 1UKUA 4ZITA 1N5YB 2QFIA 3R5GA 4QW8A 4R5PB 4GVBA 1U2RA 1LWFB 3OD2A 1RAGB 2MZRA 2V4JB 3M8ZA 1M5HA 1JLCB 4O0NA 2MKYA 3O44A 2CJXB 3CMQA 3EGZA 2DT9A 1WI6A 3M8PA 1YWXA 2ZBCA 3SDEA 2HYIB 1UJ4A 2YKMB 1RU1A 4FVCA 2KU7A 4K4TA 4J9RA 5DDRC 4JI3J 1FCAA 3VAJA 1S9GA 2POKA 1I5OB 3LQVA 2KZMA 4DV1F 4JI1J 2FIUA 3IRXA 4DV0F 1VQSA 3ZXWA 4DFJA 2B4UA 4Y2IA 3FRYA 2VF3A 1WSVA 3CJ3A 3VQSA 4OX6A 1HNWJ 4DR6F 3AY0A 2VPXB 3MXHP 2BM1A 4LF7J 3IO1A 3TQEA 1RTZA 4G65A 5DM7Q 1MW7A 2GA7A 3KUEA 1HI8A 3PDNA 2Y3YA 1SXLA 2KHCA 2FY8A 1MWYA 2N7YA 2HNYA 5F9NA 2RUSA 3A8JA 3UN2A 3CCJS 5GMKa 2HNDB 3KNAA 5G4DA 5ETNA 3TAPA 2YBVA 1K0VA 1VIXA 3SV4A 1WELA 3HHNB 2G4BA 2F8MA 2DR7A 2JHEA 4I6AA 1D8ZA 2EC2A 3M6VA 3W63A 3B82A 3TO8A 3PRBA 4DR4F 1YJ9S 3KJVA 1TUGB 4ED2A 3HPOA 5LL6d 2XMKA 3R6LB 2RDIA 3HP6A 4FBTA 5I3UB 2OSQA 4ILLA 4CYUB 1HNIA 5IC6B 4X66J 3PR4A 4NRUA 4FXWA 1JLGA 1HQUA 4X62J 1RT3A 2PEHA 1NKBA 4KSEB 1XC9A 2F7VA 1YJWS 2MLYA 2KYZA 4NA2A 2XO7A 3R6GB 3GU0A 4ETZA 3JSMB 3Q22A 1TVRB 2O3DA 5SZTA 3MMJA 3OLAA 4ZVPB 2ZUAA 1S1WB 3BYPA 4RNHA 2CQ2A 2F63A 4CO1A 3N9UC 3UCUP 4IH5A 1AZSA 2JSXA 3BQ2A 1SKWA 4PUOB 4R0JA 4QIEA 3QT6A 2YKNB 5GADU 3IAM9 1TAUA 2AJ4A 1HQ2A 2JC1A 3MEDA 1F6TA 4J90A 4MMOA 3BB5A 3JSRA 1DTTA 3LWMA 3TVKA 3QFWA 1HBOA 3PJ9A 5HMXA 3J7ZT 1P9QC 3WQPA 2AU0A 4IKAA 2OPPA 1B0VA 2VG5A 2V8DA 4AL5A 2O66A 3PX4A 2AJ0A 3AJ2A 4ZIVA 1YBAA 4DV7F 1KDNA 1SL1A 3CXCR 1RI7A 4LSLB 1M5KC 1EETA 1TKZB 4TYBA 1W25A 1ZZFA 3R27A 3VGUA 1T9WA 2IM0A 2VKRA 4FPRA 2G13A 1U48A 4RNMA 1MN7A 5CZXA 2KZZA 2MZQA 3HFZB 3UFCX 1KBRA 3QYYA 2V9KA 2HHVA 4OMFG 3QPIA 1XMQJ 4ZPTR 4QBUA 4ECVA 3PY8A 4H4MB 2VFRA 4B3OB 1WACA 4LVNP 2HBZB 3I0SA 3MEEB 1G4CA 4RZRA 3DLHA 2RU3A 5JUMA 2OPQA 2H4YB 5KFTA 4A8KA 4C8NA 4NEZA 1RAJA 1N56A 1CSJA 2HRYA 4K4WA 1C0TB 4UUXA 3CC7S 1TR0A 5D78A 3F56A 4KGMA 3OJSA 1S59A 2DBBA 3DI6A 3WIVA 1NJZA 2I5JA 1EP4A 3HVWA 2WVFA 3W5XA 3T1YJ 4CH1A 2ZM6J 1VQPS 2P6SA 4RW6B 2Q1LA 4AL7A 3QIPB 3LAKA 2V4QA 2Z56B 2UVRA 3SFGA 3HVRA 3ZZRA 3G82B 1X5OA 3N28A 2W4CA 1VJQA 5EGYA 2BEFA 5HQLA 2D9OA 3GP9A 1OS5A 3PZPA 3ILJA 3POTA 1KTQA 2L3MA 4DQIA 1RP5A 3S01A 5HK4A 3FEZA 4Y2AA 1LEOA 4KHMA 5E3QA 1F2HA 2IIHA 3BO2A 2UVVA 3TUPA 3NAIA 2RUGA 4K4SA 3UI3A 4DSEA 3P6YC 1QUVA 4J9OA 2HPUA 3RUBL 3U27A 1OSDA 4KT0C 4EMDA 3ZZPA 4X4QA 1WORA 3I9V9 2KFNA 4M5KA 4L74A 3MECB 4LF5F 2JH3A 4TLQA 1HYSB 2CA9A 2M8HA 1TTHB 1L3VA 4HDHA 4A8QA 2R8KA 5A6WA 4HACB 5I42A 3SMZA 2C28A 2Z0GA 5HLFA 2DNZA 2MXYA 4OZNA 3MR2A 2ACMA 3C3LA 2IA0A 1MMNA 3H5XA 3BGLA 3W3SA 1RACB 2F9DA 3KHLA 2EPIA 1Y5NB 4WBFA 2DR9A 4EUVA 3I9ZA 5J2MA 4ZHRB 1RBOB 3K7RA 4EWTA 1WKJA 2PE8A 2IRYA 1GT8A 1WTFA 3KJQB 1ZTTA 1YKWA 4ECWA 4WP9A 3OR2B 1JJCB 5F3TA 2XMMA 4OHVA 3R5DA 3MMBA 2IBKA 3PRVA 2XSFA 1I94J 2EFOA 1NRKA 3W9IA 4XAKA 4JI6J 2UXCJ 5HANA 5F8IA 4LFBJ 4KR0B 3KHRA 3IA0A 5B0FA 2Y1LB 5KT6A 2CWKA 1QLNA 2DNLA 3VWSA 3RGIA 4X4PA 1T03A 4GMKA 2Q79A 4I7FB 1TK5A 2OPRA 3IAS9 3OXLA 1F60B 4YB5A 4K4VA 3V6DB 2RMLA 1S1XA 1UEUA 2K1RB 4IQMA 4PG4A 3CJRA 4DPWA 2HHHJ 2MYFA 1VQ9S 3LF0A 4OX7A 1Z1ZA 4UW2A 3BSNA 2B4OA 3SCLE 1R8HA 1VQMS 3D1HA 1Q53A 3JS9A 4K50A 1U1RA 2ALZA 5CD4A 1N48A 2IJNA 3R97A 4ZLLA 5KFDA 2R2TA 3QZ8A 2R3VA 1KHWA 1RZMA 3HDSA 3I55S 4RLEA 3CCUS 3IS9B 5T7LA 1QSLA 1ULRA 2HWTA 1U4BA 2JEFA 2YKPA 4O44B 2DEIA 1K1QA 3T9ZA 2GQ2A 3L4BC 3NGRA 3FJ2A 1C0UB 4LRDA 5KFNA 5HROB 5HL7Q 1WKLA 3I4HX 4DS4A 3UR3C 5B09A 4JYAF 2KM8C 1C1CB 3DRSA 4C3MA 1R0AA 1ZM2A 4DUZJ 3HSDA 3VF0B 2M70A 4F26A 2LFVA 3EMTA 4U8VA 3ILLA 2GHWA 4UZCA 1MG7A 2J9DE 4M5GA 5HMWA 4JI5F 4J9LA 5HJXA 3DOMB 1X60A 4OZ2A 1QAJA 1RT1A 3DGPB 1LFWA 4OQJA 1BUXA 1DQ8A 4DCOB 5C2GA 2MDAA 4XK8C 4NL5A 5D0EA 3QT7A 4RUBA 2ZC4A 3KLFA 2IC3B 1IBMF 4LF8J 2W9BB 2G1DA 3I96A 3VAIA 3H90A 4MKBA 4DDFA 1R8AA 3C2PA 1X7VA 1GEHA 2QYGA 4MAKA 3AT1B 4CH0S 1YHQS 3HZGA 3H5UA 2AGQA 4YB7A 4KV8B 2F65A 4OZ3A 1Y0HA 1PC5A 3C6TA 3UQSA 2ROEA 2HVDA 4USHA 4A47A 1Q1KA 1FD2A 4R8UB 4DV5J 2OEJA 5AT1B 4BCAA 3JQKA 4JI0F 4QIWD 1UCNA 5IC4B 1S6PA 4MIBA 3PX6A 2ZDPA 2RIJA 5KG5A 4FPIA 3MCMA 4PQUA 1XNRF 2JOQA 3NMAA 1IM6A 4UZBA 1R3NA 1R7IA 3ICLA 3CO9A 1FEHA 1BY9A 3R7BB 3DU5A 3U02A 5AE3A 2B9YA 4DR2F 2YQ3A 1V6HA 1NLKL 1N34F 4K4YA 3PO4A 3K5LA 3LGHA 3MTKA 4RL1A 4LR7A 2BJ8A 3CUNA 3TZWA 1VC0A 2UVUA 1KVJA 3O1LA 3SXLA 3AQOA 1N32F 3DHWC 2IM2A 1H6KX 4WFBQ 2ZDOA 2IBOA 1S1UB 3QGGA 4C8YA 2IA6A 1F1BB 5K14B 2BABA 1P9YA 4KPYA 5IM0B 2LVWA 3OTCA 5I3PA 5GAEI 3KLGA 2B43A 1SC3B 3AB2B 1HD1A 2GJFA 5EX0A 3GCWP 4P71A 4CNYA 3V4IA 3NOGA 1HBMB 1CPZA 1FRLA 3M7VA 4DZ6A 1Q86T 1YJ7A 3W9JA 2YY3A 4ED5A 4N56A 2GGPB 1ZAXA 4ZLNA 3C46A 2H3EB 4C97A 1QTNB 3CD5A 3G2XA 3TQ1A 2WBRA 3M30A 3QZ7A 1IBKF 1RDRA 4CQ1A 1K1SA 3VV2B 4F8RA 3MCOA 4IG3A 4DQPA 3QJLA 2HQDA 4AQYJ 2RH3A 1RT5A 1FD8A 3KXDA 4QQBA 2V50A 1LWXA 4Y00A 1TKTB 4ZJQA 1FVQA 2XMWA 5J2QB 2ZEJA 3HVTB 2XHWA 2BQRA 1S0OA 2W7OA 4DI6A 2A2CA 1V5IB 5DDPC 1VLYA 4DF8A 1H7XA 4N76A 4BC7A 1FHTA 5KT5A 1EAYC 1N5VA 1CJUB 2D74B 2GZOA 3FRZA 3SCIE 2J0WA 5IT9Y 1UVNA 4C6AA 4KO0A 2L9NA 3GG1A 3R2DJ 4Y34A 5KFFA 3A8IA 1LV5A 3G6YA 2YWFA 2HGLA 3DYAB 4ECXA 2BKOA 3FNNA 2CXEA 2HHXA 5IT0A 5CYQB 2E1PA 5G0RB 2GNKA 1XIQA 4F7VA 4U9RA 2HS0A 1J5EJ 2LCWA 1SB6A 5BYQA 3RB6A 3C66A 1K47A 5CZVA 2UXDF 5I4MA 4M1KA 4WU2A 5GAHU 1OQ3A 4ZPAA 3HT3A 4RW9B 3IFEA 2PC6A 4AE5A 3DLKB 5J1EA 1U6ZA 3E8OA 3PG9A 2WCXA 1FDAA 2XYHB 2AP6A 1A0OB 2UUWA 4M5IA 2NLWA 4MFBA 2DJWA 2MHNA 1S9EB 4WFZA 1H73A 2AQ4A 5KAKA 4JI7J 3HMJG 4N77A 4J7CA 2XO6A 2DNKA 4USTA 1VRUA 1X9SA 4N8NA 3DLGA 4ES1A 2HURA 2LXUA 1YK9A 1UZHA 2XBPA 2YX7A 4DS5A 2C2ZB 4NLUA 2IAJA 1T3OA 2CQ4A 1TP7A 4Y2MA 1FRJA 3DNCA 1Q8IA 1WC5A 1VBXA 3ET6B 4ETXA 4Q2MA 3W2WA 1HBUB 1PYTA 3JQMA 2FUG9 1KNZA 1UWBB 1XMBA 1KC8T 1I6JA 4F4WA 1KSPA 3J80Y 1DBDA 2KL8A 1HMVA 4DR5F 4XPCA 3TNVA 3O8WA 3NCQA 1KLMA 2I2YA 2KH9A 4DPOA 3FBEA 2I38A 4FF1A 2B8QA 4CLSA 3J7YU 3SYZA 4HLBA 1UPPA 1FWLA 2QL7B 3VAFA 4NMLA 1PYSB 3DN9A 3EVWA 5HBMA 4CZCA 3KLVA 4HH0A 3DRPA 4QCLA 4ALZA 4DLEA 4UOFA 1F5CA 3PW0A 4K59A 1JLAB 2L9DA 3OHBA 2COLA 3ENAA 1RTJB 2C2MB 1DQAA 3KLEB 1K8AT 5E3AA 1HFEL 4ZN1A 2B9WA 2RQCA 3Q83A 1SIWB 5DGAA 1IVZA 3JTNA 4ELVA 4C3LA 4DG1B 5E33A 2QTWA 4DL7A 5E7OB 3OR1B 3QJJA 4U7CA 3H40A 2XLIA 2B9XA 3MR7A 3E01B 5F8LA 1SUQB 3VAGA 3SV3A 3AH6A 2OSRA 2QGFB 1ZPWX 3UVJA 4DUYJ 2JVRA 1CJKB 4WCEQ 4RPFA 4PQAA 2VKZG 1NDCA 4LJMA 5GADI 3LTOA 1NB7A 2HGMA 1Y5LB 2DCUB 3BKUA 2IMWP 4DPUA 1LK7A 1JLQB 3QFHA 3EX7B 2OTLS 4OLOA 2YNFB 4J9QA 1RTDB 2AGPA 2VQFJ 4N7TA 5C24A 3IC1A 2F8HA 3ILIA 4LF4J 1TK0A 2WONB 1X8DA 2BR0A 2HRTA 2E7WA 2M7SA 3C15A 1R6VA 2GIRA 3FSXA 1N5QA 1NHUA 3IMQJ 4Q0BA 2X3GA 2E5HA 2HKEA 2HQGA 2ASYA 2EK1A 2CDRB 2IMOA 1FKOB 5EN1A 2JLEA 4TLRA 3ZTPA 3T3FA 5LSLA 4KFBA 4ILRA 5D15A 3D6FB 4C9DA 4LMZA 1GMWD 2PMHA 4PXCA 4PZVA 2O67A 2FJBB 4F4KA 4Z2XA 1M0SA 4Q45A 4B9NA 3QQCD 3TWZA 2IJRA 4DEZA 4DR1J 4NCBA 4DV4F 2D69A 3D0GE 1NAQA 2AGOA 4MT1A 4UY85 2PSZA 3L7PA 5KFCA 1URNA 3C6UA 4V1Ak 2EVZA 2YNHB 2J0QD 1JLBB 9RUBA 3P3DA 5A8KB 2AZ3A 4HT7A 5IT4A 1UFLA 2R7VA 1SQEA 4XTTA 4CLYA 2XGQA 2RU9A 4F4ZA 3W66A 2HLTA 1NSPA 3HKWA 3W7BA 1U02A 1YRXA 2DGOA 4NXNF 1PBAA 1H72C 3L09A 3M6XA 3RRGA 4I2PA 1WG5A 5KG3A 4RKUC 3FC9A 3MPVA 2VUGA 1XR7A 3B4MA 2KO1A 2GVDB 3MAAB 4JI2F 4I67A 4ECTA 5LMUF 3EICA 4EFAC 2FYXA 1QVFR 2MGZB 2IPOB 3K17A 1NZ8A 2FGOA 4EBCA 1OQ6A 2ZWOA 4H54A 3CW2C 2V8VA 3BH7B 1QSYA 3N79A 1U0HB 4B9TA 4P2MA 3Q89A 2DNHA 3AQPA 2P2CB 3VHQA 5EHHA 2OAUA 4K8RA 5ETKA 3L7OA 2XI2A 4NWBA 2QA4G 1WEZA 3I5CA 3CE8A 3S1TA 2V2KA 3OTOF 1WNEA 3IR6B 4PABA 4RO0A 4ES2A 5DLGA 3M6UA 5GAGI 1GXTA 2OGUA 1NU4A 1XNQF 4RWXA 4YY3J 4DWIA 1UW9A 3OTBA 3H5YA 1HHTP 1T9XA 2RQ4A 1RSCA 4DL4A 3ETOA 2KXNB 3GTYX 3M2RB 5JJBA 2J6TA 5CCLA 3G8SA 2G1HA 1JXLA 3ITHA 3M9MB 2RT3A 2YTCA 2KVIA 1MROA 3M6WA 1R89A 1Y00A 4CLZA 4O4GA 5KG1A 1WJ9A 4OX9J 3T6JA 3K0JA 3UR0A 1Y4ZB 1IKYB 2RS2A 2VBYA 1OWXA 3I82A 4RNFA 3R1LA 4O3RA 4I56A 4ZIWA 1H98A 3KYLA 2D9PA 3K5PA 1FKPB 4ZKAA 1SJFA 2OMOA 5KFZA 2XZWA 2G9OA 1XJWB 2CJQA 4A8MP 1S6QA 1RTIB 3R9LA 3JAMU 2IY5B 4K4XA 1K9MT 4JI1F 1SV5A 1XR6A 4LRBA 4J9VA 3P96A 3DM2B 3GIIA 3ZC4A 3MD1A 3B8HA 3W60A 4DX6A 4F2RA 4KY3A 2HEKA 1G3OA 4NE9C 3V6JA 4DSIA 4U95A 4JV5J 1HNWF 2CQBA 4ID5A 3H8YA 5AE2A 4LF7F 4PXDA 1W2BR 1Q5YA 4NLDA 3GILA 2XY7A 2VJVA 2RRBA 1U24A 2DGVA 1SKSA 4F4XA 5B0BA 4I1TA 4YDDB 1KOOA 2V63A 4I0WA 1RJJA 4DSFA 1GH8A 4PWDA 1RLCL 4L72B 4QWCA 3BPSP 4PG5A 5HP1B 2CQIA 1EARA 4TN2A 3KFWX 1WKKA 2MKSA 3FVYA 2ZH8A 1X4GA 1IR1A 4RU2A 3PIPQ 3W62A 2A6OA 5ITHA 4Q2LA 3VGSA 1J27A 2GMLA 1YGYA 2NZCA 4LF1A 4CLKA 1O6XA 1FXRA 1PAUB 2CVIA 2A6MA 2OPSB 4RNOA 3W2VB 5K5MA 5A8WB 5L1KA 2DIUA 5A8RA 4J9MA 1OYDA 2G0JA 2RRAA 5B0CA 1LW2A 4ICLB 4X66F 1TL7B 2GJ2A 4USKA 3OFHA 3J7A1 1LNQA 3VCDA 4KE5A 4X62F 2CQCA 2R8IA 3I5BA 5K8OA 4U96A 4FKXA 2XMVA 2MPUA 3DU6A 3HHLC 3NP5A 3M32A 3RYLA 2DHXA 1JB0C 4QJVA 4DQQA 1CC7A 2AJ1A 1B0TA 5HMZA 5AXNA 4OHYA 4AYBD 5A2QU 3NKYA 1E6YB 4DL5A 1IKWA 2JEIA 2OIHA 1QAIA 1F2GA 2QLWA 1RCXB 5E3RA 3BDPA 5I3QA 4F4YA 3SCJE 4NYOA 5F8MA 4DSLA 3VZIA 4NLYA 1QUPA 2EK6A 4CLWA 2BA9A 2Z2YB 3GPAA 2LDYA 5IV3A 4TXSA 3B78A 3P5BP 3H2LA 8RUCA 4HKQA 1SJ3P 5IQQA 3MI7X 3M1VA 3PVXA 1NDLA 2FJAB 4DX8H 3GIKA 3DDNA 1KEKA 3THTA 1T05B 1EQ0A 3BGRA 3MR3A 4M63A 4JV2A 2L08A 1F5BA 1F9HA 2BW2A 1TKXB 1Q5VA 1HNVB 4QWEA 1ZA2B 4CTAB 1ELOA 4OJ1A 3V6KA 1IQTA 1YQHA 2M5YA 3KDNA 3G8TA 1N5YA 3BF4A 1X0FA 1U6BA 4R5PA 1WD6A 1LWFA 4GO7X 1XMQF 2V4JA 3CEDA 1JLCA 2E44A 3D6HB 2JX2A 2YWKA 2DNMA 2VFSA 1SQGA 1FA0A 1VC6A 4PAAA 4A8FA 2PMZD 3KK2B 1UW4A 3NLCA 3BKFA 2V6AA 2FHJD 4ECUA 1T9UA 3M8WA 2CUYA 1ZBTA 2YKMA 2A18A 2A3JA 2R7XA 4H4OB 4OI3A 1EHWA 3AAWB 1U26A 2ZE2A 2EXUA 3GR1A 4ED7A 7FDRA 1S4FA 3B6BA 3M8SA 4LF6J 4PXEA 1RYRA 3MZIA 2K3IA 5ETTA 3QMQA 2GHPA 3OVAA 2QMXA 2V8PA 3PW4A 3BGFA 1H7WA 4LSNB 4LFAJ 2ZM6F 1T3NA 2ZHAA 1DJ0A 2IHR1 2V68A 3UE2A 3N6MA 4Z7CA 5CD4H 3T9NA 4GVBB 5KFQA 4KGZB 2CNLB 2LLZA 4P72A 2B9EA 2C2EA 2V94A 2GIFA 3MPDA 4ZPBA 3M8PB 4DFPA 2HNDA 1HWLA 3BJYA 3AD7C 2RJZA 1PJ6A 4OZJA 3D4JA 2BJ9A 3SDEB 1JIHA 3MD3A 2EFPA 2VASA 1H38A 4OI0A 1S49A 1J2VA 1S9GB 5ETQA 3LO3A 1ZAWA 2H5EA 1SL0A 4FKYA 1NK5A 2LEBA 2VU5A 2ZUGA 1NZAA 2Y0SD 1XMOF 5GVQA 2K3KA 3FBCA 3MMAA 4TQSA 2BOPA 1UFWA 1AA1B 1Q95G 2ROPA 1FRKA 4P2XA 4KAIA 4LBIA 4NLPA 3UO0A 2OKQA 3D1OA 2R2SA 4F0HA 2MQPA 3OVBA 1LWCA 4LR8A 4IR9A 2LQ8A 3MWBA 3G96A 1LK5A 1CEZA 3A8KA 3HD1A 3D67A 4MTPA 2RRNA 2P5VA 3NGSA 2BJ1A 1T94A 1PKUA 4MH8A 3JSMA 4MK7A 2GAGC 2MTLA 4UT4A 2EFQA 1FRIA 1OY9A 4JB8B 4ZLJA 2EG2A 5GAHI 5BR8J 1LQ9A 3KDOA 4UOGA 4OYWA 1GMWA 1S4EA 1S1WA 3K2YA 9ATCB 1CULA 2YXLA 2W2PP 3BGOP 2B6AA 2DY9A 3KJVB 4B9UA 5H9FK 4PUOA 4X84A 1S7IA 1KTVA 3CC2S 2CRLA 2CIMA 4DV3J 4XDCA 1I94F 2KKHA 1RT6B 5FDLA 1U2CA 5CABA 1Y9OA 3IBWA 3P5TL 1OY6A 3VALA 1JLGB 2UXCF 4LFBF 4ED4A 1RT3B 3OBIA 2GVZA 4Q7AA 1D9AA 5RUBA 1RWUA 4HR2A 5A0YA 2DHHA 4LSLA 4WZMA 2XEXA 1D8YA 4X4TA 1XR5A 1RWWB 2LQ5A 1ZTWA 3C19A 1S9FA 2DPIA 2DNNA 2HHHF 5AJ3J 3K58A 1T11A 4X4NA 3H2UB 4OHWA 3J7YI 2W2QP 4A8XA 5JVHQ 2W24A 1NK0A 4B3OA 2YX1A 2CQHA 3MEEA 4OI4A 2C3OA 4DFMA 2SXLA 1AZSB 4OHXA 1D9FA 4B9SA 2W9CA 3HX9A 3VAHA 2R7TA 3ZZ0A 4FYDA 2BV3A 1Z4UA 2HQFA 2JLFA 2CG4A 3MEDB 3MR6A 1RHKB 2VBWA 1C0TA 1SC1B 2XLJA 3CGIA 1HBOB 3MR5A 3VAKA 2E1MC 2VG5B 1JKHB 2FZCB 1EETB 3JTPA 4DUZF 5BYSA 3GSDA 3ZNJ1 1GX6A 1U8WA 1DY3A 4GRSA 1KRPA 5KFPA 3QIPA 4KIAA 5E5NA 3DLEB 3FZ2A 2VHGA 1YRUA 4YP3A 2QA4S 2LDIA 1FF2A 3A4TA 5E3PA 4DCPB 3I0SB 4AXIA 3KJFB 3QAUA 4LF8F 1WHYA 2HW3A 1GTHA 2OPQB 2CNOB 2A1BA 2W1BA 1N33J 3BEGB 1PGZA 2H1YA 2HIQA 2G0CA 2WOMB 1S1VA 1RK8A 2WVCA 2ZOMA 4CT9A 5KFHA 1GX5A 3NRBA 2ZJPQ 2CQ3A 2XG8A 3BQ0A 5M2RA 3IBCB 4IG0A 1QSSA 1EP4B 5HVFA 4W92B 3JYTA 1S0MA 3JQJA 1RWPB 3IM9A 4XDDA 2AIRB 4I2QA 1UVIA 1FESA 4NMXA 2VODA 2CJYB 3QO9B 2KG1A 1FWKA 3FGVA 5EWEA 1F9EB 2IM1A 4HACA 2IDEA 2ZBQA 3A8EA 2GJIA 2LECA 3SSQA 1BC6A 1ZZNA 1WHWA 3QBCA 1M1GA 3RB4A 2C3UA 2M88A 2VICA 5F8NA 4WE1B 4P73A 2CPIA 3T1AA 1HL6A 1U45A 4CCHA 3JB9k 4OJGA 1FX2A 1B4SA 3GR0A 1FI4A 2PN6A 4XIUA 3DGVA 2AJQA 3E3XA 1ZA1B 1DTQA 1SJRA 2QN6B 3OR2A 1U25A 3VGVA 1Q4RA 3L9ZA 4J37A 3CO0P 3KHGA 3PFEA 2ZJQQ 4BWMA 3ZZYA 5ETRA 2CPJA 4NCGA 2LA6A 4PPZA 2XWXA 4I7FA 5HLFB 4Y28C 3Q86A 1F5AA 4OI6A 2VIHA 2KXFA 4FF4A 3V6DA 2K1RA 5THWA 1VLOA 2OMLA 2CWXA 3DC2A 2Q6CA 3ZTQA 4CLUA 2XYPB 1TMMA 4IYQA 5ETMA 3ZZOA 3TJAA 5J2MB 4AQYF 4USVA 3HSJA 3NGTA 4KKOB 3CCLS 3R5AA 2LU2A 5B0EA 3OV7A 5MLCV 1KR4A 3CJ4A 5D4LA 3MMBB 3M2VB 2FD2A 3IR5B 4NA3A 1UVKA 4JP8A 4DR7F 3IS9A 4HTJA 4M5MA 4JI8J 4I68A 4N41A 4OV6A 3DOLA 2D3UA 1P1TA 4EU0A 2CJ9A 3BYRA 2HK3A 1B64A 5L38A 4ZVQB 1NPKA 2JNJA 3I87A 3A13A 2HBRB 1C0UA 3O6QA 4CO2A 1T03B 2B4PA 2OFGX 1GMVA 1TL1A 1S5ZA 2QE5A 3BN7A 2BKNA 4FXVA 5L39A 1APSA 3OT9A 2O5DA 1FNOA 4FS1A 4U7UK 3R5CA 2CZVC 4Z7YA 1WF2A 5C5JA 2YWGA 2CPXA 1CJVA 2GS8A 2QYCA 1X4DA 4M94A 1WOOA 2JC0A 1ITPA 2K7KA 3DOMA 1LOUA 1J5EF 1RAIB 3BPDA 3DGPA 3I32A 2OH2A 5KFIA 3OL8A 2AEMA 3MFIA 4OYOA 4CLPA 4RUAA 4K0KJ 4CRJA 4F04B 2ILZA 1Q0NA 4C48A 2IC3A 2W9BA 3PYGA 1QE1B 2P9EA 3TA0A 2FHOB 3LP0A 3PACA 3BM7A 1VIOA 4OYMA 3N5FA 4HI1A 2QA2A 2GO8A 1O0PA 3R8YA 1RYSA 5T7LB 2LQJA 2V69A 4CH7A 3TX0A 4Q43A 3QWUA 2IVFB 3LPEA 1I1GA 5F8GA 2HSEB 4ZCIA 2FC9A 1UVMA 3G8QA 4KC5A 4KV8A 1YJNS 2UZAA 1U1PA 3HVAA 1U1MA 5LJ3Y 5CH7B 4U7UD 3IWLA 4R8UA 2ZVSA 1U0SA 7FD1A 4F3MA 3TRGA 3FMWA 2MZ1A 2QLXA 1M5PC 4OI2A 3CIZA 1X0PA 2ZBPA 3MURP 3DDIA 3PW2A 1FFSB 1FERA 4P52A 1RT1B 3OTOJ 2R2RA 3PHTA 4EO8A 4IFVA 3M8RA 1VHIA 1HNZJ 2MSSA 3US5A 5KFJA 2RNEA 3S6EA 1TL4A 3QT5A 2QJ3A 2DEJA 1WC1A 2XYGB 3W65A 1WF0A 4DL3A 2D41A 1S1UA 1UL3A 2PI5A 4DQSA 5K14A 2EBEA 2O1PA 2IDLA 1R0CB 4KGKA 3C6TB 4QWBA 1QAXA 2D3OR 3FKBA 4ZPVR 4ELUA 2XS5A 1JJ2R 3Q8RB 4OIXA 1N8RT 1MWZA 2WVBA 2MZTA 4C8OA 2KT5A 2MMYA 4UTGA 1HBMA 4PQUB 3W8GA 4WIQA 2G0IA 5F0WA 2ZBRA 2CPEA 4N5SA 2MJNA 2AZ1A 2WSFC 4ZVOB 4WFYA 3UN3A 4CLTA 4JV1A 4F3QA 1NEEA 3NG8A 3GFXA 2DO4A 5DJBA 3MM7B 5IFMA 1T9VA 1PILA 4LREA 3TVYA 2RVJA 2OJ3A 5K20B 2W7AA 1FXLA 1U09A 4F2SA 1RAAB 4L76A 4QPXA 4CO5A 4DUYF 2ZH6A 4QU6A 5LMNJ 2DY1A 2W7PA 3KG1A 4IFYA 1UZDA 5L1JA 3RR8A 5D3GA 3KLGB 4LBHA 3V6HA 5IQ6A 2C2NA 1MNEA 2CNNB 3QSYB 1AB8A 1RB0A 1KQFB 2ZKTA 3PJWA 2VQFF 5D6GA 4Z37A 4OLPA 2YNGB 4ZVEA 2HBQB 4LF4F 4EI2A 2HIYA 3RB3A 5H9EK 3M30B 5DG7A 4WXWA 3T5JA 1RAHB 2D3ZA 4IG3B 1UVJA 3BSOA 3HKZD 3HO1A 3SQGB 2DNOA 1RT5B 3H20A 2VDIA 1QDUB 2RDJA 2RF2B 5AE1A 1U2FA 4A48A 1H74A 2KRBA 1OJ4A 4YUDA 2BQUA 2NYIA 4P74A 3GJSB 2PDAA 2DGQA 1ZM9A 4DR1F 4C0BA 2RE1A 1HWIA 3DLKA 3DRRA 1N0VC 4DN0A 2BZ2A 1JLFB 2EFNA 2VD3A 3H2VE 4IRCA 2E9RX 4Y2CA 3PKYA 1F9FA 3HHKA 3BSAA 3UDLA 4FYYB 4WK3A 2DGXA 2DNQA 2IRUA 2ZH7A 1NK4A 2XCPA 2D1CA 4PRFA 1VOMA 3VTIA 3MHYA 1D3WA 1T0TV 1IKXB 1Q82T 3BDEA 4FZVA 4BLGA 1HD0A 3UPFA 1U1OA 3MOZA 3IN5A 2Y8YA 3IG1B 4L75A 1IWAA 4P2SA 3IM8A 1AT1B 1ZPVA 1UP1A 3ET6A 5HVGA 4K7QA 4QWDA 3OVSA 1S0NA 2GX8A 2UVWA 1S76D 2FVSA 4EGLA 2H9ZA 3D7SB 2GW8A 4IOAQ 2UUAJ 2E66A 2XTJP 2CYYA 3PXGa 3M9OB 3QSIA 4X65J 2JFDA 1V3ZA 2J5AA 3B4DA 4PKDB 2OO4A 3KHHA 4IOCQ 4DXLA 1PCAA 5AXLA 4BWJA 4QR0A 3OJUA 3QGPA 2V8HA 1P6TA 1D09B 3VGTA 4PXBA 1KFDA 2BVZA 2FC8A 5B0AA 1S97A 2HG4A 4YY3F 1F3VA 4YR2A 4RBVA 1LWEA 2QX0A 3CJSA 2H4WB 3GIJA 3KLEA 1JK9B 1C1BA 3Q8SB 4PG8A 3LUYA 1VRUB 2P8IA 3Q8PB 5SUHA 3DLGB 2QRRA 2H54B 2C3YA 4L3NA 2PA3A 3P4UB 2PEBA 3KK1A 3U1MA 3OW2R 2BX6A 4OX9F 3MEGA 3E01A 3C8YA 4C11B 4WKRA 4LR9A 2HHPA 2FLLA 3RAXA 3HF5A 1HMVB 1HKAA 4B02A 1KLMB 2M8DB 5HI7A 4NLVA 4LSZB 3MPWA 1CJKA 2MZSA 4CDIA 1X9MA 4DJBA 1DZ5A 1X5TA 3CJKA 2QIFA 1VBKA 3UN5A 2VOOA 3DRPB 1GTEA 1MMDA 1JLQA 2APOA 2BACA 3H4DA 4YQWA 4BBYA 5KFYA 2KN4A 2DK2A 5ETOA 4DN9A 4TU9A 1UETA 3G71S 3K8VA 1RBLA 1N6QA 3AJDA 2VQEJ 2WONA 2Z2ZA 4JV5F 1N88A 1BQNA 1FEEA 1EZZB 2VDHA 2W8KA 4JOUA 2OLWA 2ZH9A 4ECSA 2FJDB 1WF1A 3GFZA 1VFJA 2BRKA 2PA8D 4DX7A 2BYCA 3FMBA 1S1TA 4B3SJ 3LALA 2DXDA 1UVLA 2W8LA 1RT7A 1XMOJ 3M4XA 2XMJA 4RW8A 2HFSA 1L5UA 4UOHA 3TR5A 3D66A 1B7FA 3TANA 4ZLPA 5GAGU 5IT9U 1H0HB 1M5VC 3KLHA 2R8JA 1VJWA 2QA1A 3RG6A 1RT2A 2X1GA 4LFCJ 4WP8A 3UDCA 1S6UA 3OL6A 3QIDA 4FP9A 5C24B 1Y11A 4Y3CA 2YNHA 1JLBA 4YDXA 5A8KA 5AXMA 2NSCA 4O3OA 4ZVUB 2NXJA 1RAOA 3KWMA 3LH2S 2WHOA 1A9NB 3FUYA 2NYHA 3MM9A 4G1IA 3IGVA 3T1HJ 4M5HA 2RAQA 3KK3A 3H42A 3C15B 2HFUA 3OQ2A 4UF4A 4X4OA 4J9NA 3EGVA 1VK3A 2CQ1A 5ETSA 4Q0BB 1TL5A 4WKYA 2YNIB 1N36J 3C14B 3IRWP 4HTIA 1BQMB 1MWQA 1RHMB 2NCKL 3SZ2A 2NZ4A 4KFBB 3M8YA 2GVDA 4ZK7M 3Q8YA 2ZH4A 2EFVA 4FYXB 1NJYA 1B3TA 4L6V3 1HHQA 1R8CA 2BE2A 3QLHB 1FDBA 4P6QA 1G1XA 3VVTA 4YOEA 2C1EB 1AW0A 1ZAVA 2H5JB 2E9TA 1NCLA 2F4VJ 2V8GA 1XEZA 2FLNA 3J7Z5 3C6UB 3SCKE 1REVB 1H3DA 2WBMA 1TUVA 1WI8A 5DZ6A 1HARA 2HHQA 4PCQA 4LT6A 4H4KC 3ZFVA 3WIUA 4LRCA 3HHLA 4C8KA 1WHXA 1Q16B 3MM5B 1IKVB 3MUMP 2WSEC 2W2MP 1VQYA 1Q8KA 3TYTA 1TMJA 2IYGA 3EYZA 2ACYA 5E41A 4C2MA 1JJ4A 2ASDA 4I2PB 2YKQA 1QVGR 3J80U 2VA3A 5LJ5Y 1HWJA 2DVIA 2I8EA 1VQ8S 1HBNB 4ZN3A 1JNZB 4B9MA 4USWA 4ZCKA 2EFGA 5FJ4A 5DDOC 4ECRA 3MF5A 2YPYA 1FKPA 2XSJA 4OFZA 4ATNA 4N47A 2OP5A
chains in the Genus database with same CATH topology
5I3UB 2OSQA 4ILLA 1LW0B 2A2DA 1Y5IB 4OZ0A 2YVSA 2BA9A 2LYVA 3MECA 1HNIA 3Q24A 3GFYA 2LDYA 3CJKB 4TXSA 3PR4A 2EG1A 4J9KA 3B78A 4WYWA 3TA1A 2LQ9A 4NRUA 3HI9A 4FXWA 1JLGA 1HQUA 1XBWA 3H2LA 3KG4A 3NNHA 3RU0A 4HKQA 1SJ3P 1HYSA 2GHVC 2PGCA 5IQQA 5HO4A 1RT3A 2PEHA 3MI7X 1NKBA 4HYKA 2E9ZA 3M1VA 2V4RA 4KSEB 3PVXA 5EUHA 5U47A 2F7VA 2BXJA 2FJAB 1YJWS 4DX8H 1XC9A 3MM8A 5MAOA 3GIKA 1T7PA 3DDNA 1T02A 4YB6A 1KEKA 3DM2A 3THTA 1T05B 2CPHA 3BGRA 3MR3A 4M63A 4JV2A 2KYZA 2L08A 1F5BA 2BW2A 1TKXB 3S7RA 3MEKA 4LF6F 2IRXA 4NA2A 3AJ1A 2XO7A 3CCSS 1HNVB 4FS2A 1C4CA 4JUZA 5ADZA 1N6QB 4ETZA 4QWEA 3JSMB 3NCRA 3DHXA 3Q22A 1TVRB 2QZ8A 4CTAB 3OXFA 3POTB 1ELOA 4OJ1A 3V6KA 1IQTA 1BQNB 3G6XA 1YQHA 4WXOA 1VQNS 3TAQA 2M5YA 2O3DA 5SZTA 3G8TA 5DLFA 1N5YA 3BF4A 4F67A 1X0FA 1SC6A 4ZHRA 4LFAF 2Y1JA 3MMJA 3OLAA 1U6BA 4DV2F 3ZZTA 1WD6A 1UEVA 2F40A 2NS1B 3IXQA 4R5PA 2HVIA 1VBXA 2MQNA 1LWFA 3KLIA 2CQGA 4GO7X 3PNIA 4C8MA 1XMQF 1M90T 2HHUA 2V4JA 2KHDA 3LPYA 1S1WB 3CEDA 4RNHA 1JLCA 2CQ2A 4A8WA 4CO1A 1S1TB 3N9UC 4HDGA 3D0HE 2YNIA 2E44A 3RRHA 3UCUP 2JX2A 2FLOA 2YWKA 2DNMA 4IH5A 2VFSA 3AB4B 1FA0A 1RT7B 5K8NA 2JSXA 3CPWR 3BQ2A 1SKWA 4R0JA 1BQMA 4PUOB 1VC6A 4QIEA 4A8FA 2N3LA 2PMZD 3KK2B 1UW4A 2HQ3A 3NLCA 1YITS 3MDFA 5KFWA 4RW8B 4XPEA 2YKNB 1L3SA 5GADU 2FHJD 4ECUA 4HI2A 2YKMA 1ZBTA 3IAM9 2A18A 2ZHBA 1TAUA 1RGVA 2AJ4A 3MEDA 2JC1A 1S6QB 2A3JA 2R7XA 3Q8QB 3PHEA 4MMOA 3QLHA 3BB5A 3JSRA 1DTTA 3GQCA 1UMJA 3LWMA 2ASJA 4H4OB 3TVKA 3KLHB 3S8SA 1HBOA 4OI3A 5HMXA 3J7ZT 3CF5Q 3AAWB 1U26A 1P9QC 1S99A 2AU0A 2DCLA 2ZE2A 1K0VA 4IKAA 3UCGA 3GR1A 2ASLA 1RT2B 2OPPA 1B0VA 2VG5A 2V8DA 4ED7A 5I42B 1OPIA 4AL5A 7FDRA 2FPHX 2AX1A 2O66A 5J1NA 2MKIA 3PX4A 2AJ0A 3AJ2A 4IOBA 1S4FA 3EPIA 2OPSA 3DXBA 3OUYA 4DV7F 1YBAA 2KXHA 2J6SA 3M8SA 3W2VA 3EXCX 1SL1A 3CXCR 1PC4A 1RI7A 4LSLB 4I64A 1M5KC 4PXEA 1EETA 1TKZB 4TYBA 1W25A 5A8WA 5HN0A 1REVA 1ZZFA 1RYRA 2X1BA 3MZIA 2U1AA 4TU8A 2K3IA 3R27A 3QMQA 2GHPA 3OVAA 4MIAA 2QMXA 1NJIT 3PW4A 2IM0A 4ID5B 4DFKA 2VKRA 4FPRA 4ICLA 3BGFA 2G13A 3KNGA 1U48A 5KT3A 1H7WA 5KFLA 2M9KA 5D4OA 3MM5A 4RNMA 5CZXA 1IKVA 4LSNB 5DGBA 2KZZA 3BGUA 2ZM6F 1T3NA 2ZHAA 1CQMA 2UXBF 1DJ0A 2MZQA 2IHR1 3MM9B 2FJXA 2JDJA 3UFCX 3UE2A 1VBYA 3N6MA 1FTCA 2V9KA 3QYYA 4OMFG 5CD4H 3QPIA 3SEOA 2HHVA 3T9NA 3PKMA 5KFQA 3N6LA 3KK3B 4ZPTR 1G6BA 1Y3KA 4DSJA 2LLZA 4QBUA 2I1RA 1SKRA 1GXLA 4ECVA 3PY8A 3CJ5A 4H4MB 2VFRA 4B3OB 1WACA 2HHTA 4LVNP 4Y65A 3I0SA 2C2EA 5E2QA 3MEEB 2V94A 1RA6A 4RZRA 2FJVA 4ZPBA 3DLHA 4PWDB 3HHEA 2PIIA 4LUBA 2CQDA 5H1SV 3M8PB 2RU3A 4DFPA 2HNDA 1HWLA 3BJYA 4AXJA 1DFDA 2ZKUA 5JUMA 2CJKA 2OPQA 2RJZA 5KFTA 2R8GA 4OZJA 4A8KA 3OSPA 3SDEB 2M0GB 3EPGA 1JIHA 4C8NA 3MD3A 1VC5A 2EFPA 2NUHA 1KN6A 5IXUA 2VASA 2PO4A 1RAJA 1H38A 1N56A 4URQU 4OI0A 1HBNA 1S49A 1CSJA 2VL1A 3I6PA 3FQKA 1J2VA 1S9GB 2HRYA 3HLUA 1C0TB 2BE2B 4K4WA 2JZ5A 4UUXA 3CC7S 1TR0A 3LO3A 4O44A 5BR8F 4YR0A 5D78A 1ZAWA 3F56A 4KGMA 2H5EA 3OJSA 4W90B 2PD1A 1SL0A 2B7BB 2HHWA 3GZ7A 3QGHA 3HJFA 4DHVA 4WU3A 2DBBA 1KQGB 5HROA 3DI6A 2LEBA 1NK5A 1IXKA 1NJZA 1WEXA 2F3JA 3RBDA 2OPRB 2ZUGA 1NZAA 2Y0SD 1XMOF 2LEPA 2I5JA 5GVQA 1C1CA 4ZVGA 2K3KA 3MMAA 2YWHA 1EP4A 2R7OA 4TQSA 3OSNA 2BOPA 1S1XB 1UFWA 3HVWA 1SIZA 2ROPA 1KONA 2DHSA 1FRKA 2E1RA 4KAIA 3CTRA 3R3TA 1VQ5S 4NLPA 5B0GA 4K4ZA 2EKYA 3N01A 1LW0A 2OKQA 3D1OA 4DV3F 4UQGA 2R2SA 1GAOA 1LW2B 3HHLB 4CH1A 1Q81T 3EGNA 1KS2A 2MQPA 4EEYA 1VQPS 3H25A 2ILYA 2P6SA 4RW6B 2Q1LA 4AL7A 4ZMMA 3QIPB 3GG0A 2NPIA 3LAKA 2V4QA 2P9CA 1LWCA 3CD7A 3OVBA 2UVRA 2ZJRQ 4IR9A 1S48A 3GMGA 3SFGA 3DLLQ 1YG0A 3MWBA 3G96A 4TNOA 3HVRA 1NJXA 3ZZRA 1LK5A 2FVRA 4ZPCA 1CEZA 2CJAA 3NBPB 2B0GA 1T05A 1X5OA 3N28A 3ULHA 3OFGA 2W4CA 1FRXA 4CIOA 1X4HA 4MTPA 5EGYA 1IBLF 2RRNA 2P5VA 4B17A 1TFYA 2D9OA 1T94A 2GV1A 2VBZA 2KG0A 1OS5A 4MH8A 5KG7A 3JSMA 3PZPA 4MK7A 1UA1A 2EFQA 1FRIA 2DISA 4CTAA 2QT7A 3POTA 4ETXA 3M32B 2KFZA 1KTQA 1JJHA 5J2PA 2ERRA 2EG2A 3H98A 5GAHI 2J9EA 5AJ3F 2L3MA 5DQIA 5DG9A 4DQIA 1LQ9A 1DAXA 1RP5A 3FEXB 1R8BA 4X4RA 2GMJA 3FFIB 3S01A 1JLEA 3FEZA 4Y2AA 4QYZJ 4KHMA 5E3QA 2AD9A 4V19J 2FHJA 2JRSA 2DH9A 1S1WA 3K2YA 3BO2A 2UVVA 1R27B 3NNCA 1HW9A 2Z2LA 5KFBA 4KHPF 2ZZMA 1FXDA 5KFRA 2DGUA 2B6AA 3KJVB 3NAIA 3OLBA 2RUGA 4K4SA 3UI3A 2XWYA 4DSEA 1UA0A 4B9UA 3P6YC 1QUVA 1VI7A 4PUOA 4X84A 4J9OA 4NZ7A 2XSJB 4P7TA 2HPUA 3BR8A 3IWXA 1KTVA 2HFNA 2DR5A 3DRSB 4GO5X 1R0AB 2FTRA 1KQKA 3RW6A 3U27A 1OSDA 3CC2S 2CRLA 4KT0C 3ZZPA 1S79A 4X4QA 4NYPA 3I9V9 3O5TB 2KFNA 2CIMA 1QAYA 4CI0B 4XDCA 4O3NA 2KKHA 1I94F 1RT6B 5FDLA 3MECB 4LF5F 5KFVA 1Y9OA 4JI3F 3IBWA 3P5TL 3VALA 3CB4A 2JH3A 1JLGB 4H4OA 4TLQA 5T14A 1CQNA 4EBDA 3G9CA 2UXCF 1HYSB 4LFBF 2M8HA 2ZOFA 2BJEA 1MSWD 1L3VA 2B51A 4NPOA 1RT3B 3OBIA 1TL3A 4HDHA 2YKAA 4YR3A 3M1VB 4Q7AA 4A8QA 4AUKA 2R8KA 5A6WA 1D9AA 5I42A 3SMZA 4TYAA 2C28A 1RWUA 3MM8B 1FE0A 2Z0GA 3MM6A 5HLFA 2DNZA 4B3RF 5A0YA 2MXYA 1M5OC 4OZNA 4URSA 2HHSA 4LSLA 4WZMA 3MR2A 3C3LA 2BBEA 4HHJA 2IA0A 2EI5A 5K8MA 3KLFB 1MMNA 2XEXA 1D8YA 3H5XA 1U8SA 3SSSA 3BGLA 5H9FJ 4PG6A 5J2NB 3W3SA 4ZOSA 2CQ0A 2B5JA 4X4TA 5CXTA 1XR5A 5BYRA 2LQ5A 2F9DA 1NNDA 1ZTWA 3KHLA 4PWUA 1S9FA 2DPIA 2EPIA 2OD4A 2XNQA 1BLUA 2DNNA 1N54B 2UV8A 3LP1B 4LQ9A 1Y5NB 2HHHF 1UJ6A 3MPYA 3K58A 2DR9A 2HVHA 4EUVA 2AW0A 1S0VA 2K7JA 3I9ZA 5J2MA 4ZHRB 5DG8A 4RUCA 3K7RA 4X4NA 3H2UB 4OHWA 4IH6A 3J7YI 3KLIB 1VQ4S 4EWTA 4QIVA 2PE8A 4A8XA 2IRYA 3GV8B 1GT8A 2W24A 1WTFA 5JVHQ 1NK0A 4B3OA 4C0HA 4LF9F 2YX1A 2CQHA 1ZTTA 3MEEA 3CWJA 2IYIA 2C3OA 3NGKA 4OI4A 4ECWA 4DFMA 3E2EA 2X1FA 5AXKA 2SXLA 3OR2B 5IM0A 5F3TA 2XMMA 4OHVA 3R5DA 4OHXA 2UV8G 3MMBA 3HHDA 2W9CA 3MFHA 1YTYA 3HX9A 3VAHA 1D9FA 2IBKA 4B9SA 1FJGF 2R7TA 3GYXB 3JSYA 3ZZ0A 3LWLA 4FYDA 4P7VA 2BV3A 3O2IA 4ZPDA 1Z4UA 2XSFA 5IWAF 1RT4A 1IR0A 2XCAA 4G1QA 2JLFA 2EFOA 1S6PB 3TUJC 1NRKA 2CG4A 4R0EA 3MEDB 4XAKA 3MR6A 3D1QA 3FEYB 2VBWA 1NJWA 1N33F 1TFWA 1C0TA 3DOKA 5F8IA 3QJPA 2KTQA 4KR0B 3KHRA 2XLJA 3IA0A 3CGIA 1O8BA 3ONQA 1HBOB 2L48A 3MR5A 5CCMA 5B0FA 4NLGA 5KT6A 3VAKA 5KFEA 1QLNA 2ZE2B 2DNLA 2E1MC 4Y0FA 3VWSA 2MKHA 3HM9A 3LP2A 4X4PA 2GGPA 2VG5B 1T03A 4GMKA 2Q79A 4K4UA 4I7FB 1JKHB 1TK5A 2ROGA 2OPRA 3GYNA 5CQGA 2LA4A 4YHHF 3OUYB 3IAS9 3OXLA 1F60B 3JTOA 1AFJA 2UUCF 2MY8A 1TZ0A 4YB5A 3LGMA 4K4VA 4WIIA 1EETB 4ECZA 4ZDNA 3V6DB 2RMLA 3JTPA 3TX8A 1S1XA 1UEUA 2K1RB 4DUZF 1YIJS 1A7GE 4IQMA 3UD4P 5EWGA 4OV1A 4PG4A 5BYSA 3GSDA 1NH8A 1IUJA 2BM0A 1GX6A 1FE4A 4QR1A 2MYFA 2R8HA 2MKCA 1KRPA 2AV5A 5KFPA 2OD6A 3U1LA 3QIPA 1VQ9S 2J0SD 3LF0A 4KIAA 2XC9A 4OX7A 5E5NA 5F3ZA 3DLEB 3FZ2A 1Z1ZA 2KI2A 4UW2A 3BSNA 1M1KT 1YRUA 4C0OC 4HH1A 3BS9A 1YSJA 1TKTA 4FN5A 1NH7A 4YP3A 2QA4S 3VR1A 2ADBA 2B4OA 3SCLE 1R8HA 5M2PA 2LDIA 1FF2A 4FNIA 1S7HA 5F0UA 1VQMS 5J2QA 1G7CB 5E3PA 3D1HA 3NBPA 1Q53A 2VPWB 3G86A 1P27B 3HVTA 4F25A 5C25B 1U1RA 4K50A 3I0SB 2ALZA 4AXIA 2UU9F 2E29A 1N48A 2IJNA 2P9GA 2QV6A 5CYJA 3NAHA 4GC7A 3QAUA 4LF8F 1WHYA 2HW3A 5KFDA 2R2TA 1GTHA 1BWEA 2NPFA 3QZ8A 2OPQB 1WWHA 1N4LA 5F9LA 2XY6A 1KHWA 2A10A 1A6LA 2E7XA 4AFFA 1UAWA 3HDSA 2A1BA 3I55S 4NX9A 1JWWA 5T41A 3CCZA 4LIWA 4RLEA 2WRMA 3CCUS 3OPKA 3IS9B 1XN9A 5T7LA 3V4IB 1QSLA 3BEGB 4F50A 1ULRA