2UUBF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uubF00
4LFAF 4DV1F 1LOUA 4JI3F 2VQFF 4LF4F 4DV2F 3R3TA 4X66F 4B3SF 4JI1F 4JI7F 4GKKF 1IJFB 1GH8A 1HNWF 2YY3A 1RISA 3T1HF 1F60B 4X65F 2UXDF 4DUZF 1G7CB 4DV5F 5LMUF 4DR1F 4GKJF 2J5AA 4JI2F 5BR8F 5IWAF 1XNQF 2BXJA 1IBLF 1VMBA 1XMQF 1HR0F 4B3MF 1QJHA 4YY3F 2F4VF 2B7CB 1I94F 4DV7F 4DR7F 4LF6F 4AQYF 4LFCF 4DR5F 4NXNF 4YHHF 5LMNF 1CQMA 4JI4F 1HNXF 2HHHF 1IJEB 3T1YF 4LF7F 4KHPF 2VQEF 4OX9F 4DV3F 4DR3F 1IBKF 2KJWA 1G1XA 1IBMF 2ZM6F 4LFBF 2UXCF 3ZZPA 4DV4F 4DUYF 4B3TF 2B7BB 2BVZA 1J5EF 1XNRF 4LF5F 2UUCF 4JI8F 2UXBF 4DR4F 4DR6F 4JI5F 2UU9F 4LF9F 4DV0F 4JYAF 1N33F 1B64A 2UUBF 3OTOF 1HNZF 1N36F 1FJGF 2E5LF 2KJVA 1N32F 4X62F 1FKAF 1XMOF 4DR2F 2UUAF 4NXMF 2RJZA 4JI0F 4JI6F 4DV6F 4X64F 4B3RF 4JV5F 5AJ3F 1CQNA 4K0KF 1N34F 4LF8F
chains in the Genus database with same CATH superfamily
1GQEA 4FS2A 2N82B 3UFCX 2FLNA 2YKMA 3G71S 5FLXY 2GMLA 5IQQA 1RISA 2AX0A 1S6PB 3PNIA 1CS4B 2X51A 4B9NA 4ED3A 5HMZA 3L09A 9ATCB 1ROFA 3NOGA 3HULA 3TAMA 1P1TA 1LWEA 3HXMA 2XGQA 2VPXB 2EI5A 3BYRA 1K47A 3CCSS 4RWXA 2DHXA 4ATNA 1VHFA 1WUUA 3MEDA 1WTFA 3OTEA 5KG5A 4LFAJ 3QWPA 4DR3F 2ZVIA 2XZWA 4C4WA 2BMBA 3FBEA 1Q7YT 4PG5A 3K5MA 5DG7A 4DEZA 2CPZA 3I6PA 4F2RA 3J80Y 1HNWJ 3JQKA 3A8KA 2N7CA 3J7YI 1BLUA 2ILZA 3OTOF 2XBPA 4C3MA 5C24B 3HHKA 5GADU 2ASLA 4J9NA 4XTTA 1YKWA 3PHEA 4C3KA 4DV7J 4CLFA 1QVGR 3QO9B 3BGOP 1SQEA 3GU0A 4DPWA 3LP1A 3PX6A 4XIUA 1NPPA 3W7BA 1JLCA 5J2MA 2FHKA 3IR6B 1PAEX 3KFWX 3PO4A 2VPWB 3DLHA 2E9RX 4NPOA 3TO8A 3ELHA 2HBQB 3NG8A 5F8GA 3MF5A 1TUGB 4OI3A 2B6AB 4P2MA 3PYFA 2ABYA 1I1GA 2UZAA 3VZHA 2HS0A 4U9RA 2OELA 4DFPA 4QIGA 4OHVA 5CH7B 4NZ7A 3BSOA 3DGPA 4PXCA 5DJBA 1R8CA 4UOFA 4LVNP 3S6EA 3NGTA 4QWEA 5LSOA 2XI2A 1KVKA 1U8WA 1RBOB 3T9ZA 3OTBA 4G1QB 3ICLA 1S1XA 2KG0A 3RRKA 4ZPVR 1S1WB 2ZWPA 1D9FA 4FBTA 3H2LA 4XPCA 4OYIA 2IBOA 5HMXA 1H3DA 2IMOA 3M1VB 2XHCA 2ZBPA 4WPAA 1E6VA 2RU3A 3G6VA 4YR0A 4LVOP 3UVJA 4BCAA 4P2XA 4UUXA 1RT7A 4R8UA 5DDOC 3D6FB 4JV2A 4WZMA 2I38A 4JV0A 1PIEA 2ADBA 1VQ7S 3W62A 1RT3A 1R0CB 5KFQA 3W2WA 1H7WA 2FJDB 1HW8A 2HIQA 3G8TA 4LF9J 3DLLQ 3QFHA 4ES2A 5IWAF 2B4PA 4ZVSB 1VMBA 2R7VA 3NGDA 3K8VA 3GSIA 3ILIA 3IGNA 4Z7CA 4JV1A 4CO2A 1KVIA 1NDCA 4RNMA 1VQ8S 4LSNB 4O44A 2VUGA 4NA3A 3MAAA 2GV1A 4P73A 2VQFJ 4KR0B 4KGZB 1NK0A 1ZM2A 1T03B 4DFKA 4NLPA 2IFXA 1LK5A 2J6UA 2DO0A 1XK8A 3IBWA 2SXLA 3RW7A 2M52A 3H0PA 1N6QA 5J1EB 3DOMB 4LF6J 4IH7A 1KSPA 2EFNA 2M7SA 3V5RA 1BWEA 5AXKA 4C8LA 3BPSP 1SC1B 3UNGC 3H7HB 2E7VA 4FKYA 4IR9A 1RAJA 2L9DA 3I4PA 5LMUF 1QTMA 1QM9A 2O5DA 3MPDA 3J81Y 1TV6B 1EETA 3MI7X 4HYKA 2WVEA 2HVDA 1KFDA 2E5JA 4OX7A 2VG7A 3BQ0A 2FHJA 4HHJA 5G0RA 4A46A 3T19A 4M5IA 3IP0A 3VVTA 2RUGA 2E5HA 4NRTA 3W5ZA 4DUYF 1X0FA 4C8OA 4C11B 4UOHA 2IBKA 2HFZA 4CLKA 1Q8BA 3M8PA 3PG9A 4F4YA 4PABA 4CLWA 1N36F 4NYPA 3NOCA 2XQCA 4FYDA 2MKCA 2OJ3A 1RT2B 2IYIA 1PSDA 4ZPTR 4B3SJ 3CVKA 2G2OA 2U1AA 2KRRA 1RU1A 3OLBA 1MNEA 2V63A 4C9DA 2KDOA 4QQBA 2J8SA 5AXNA 3B78A 4KT0C 3KK3A 1MLAA 2WW8A 3T1YJ 3C6TA 4OYBA 2QEXS 4B9LA 5AE3A 4U8YA 4OZ0A 3NNAA 2B3TB 1HBOA 4PWDB 2DHSA 3OFGA 3SQGA 1LKZA 4YB6A 3D6TB 2MMYA 2MXYA 4ZN1A 4YS2A 2JH3A 4K50A 3I0RA 3OUYA 1DQ9A 1HW9A 2B5JB 3DLGA 3MFHA 3PTWA 3G82B 2HSEB 2JL9A 2EFVA 4FF4A 2CDRB 3Q2SC 4N56A 3U7JA 2LEAA 4O4GA 4DR4J 2RDIA 2HRYA 3R9LA 1OYDA 4MYTA 2VONA 2XMVA 1FDAA 3GYNA 2Z30B 3HZEA 2Z57B 3TX8A 4PUOA 1WOSA 4ID5A 5HROA 1AW0A 2V2KA 1CJKB 3QMQA 2HIYA 4I68A 4RZRA 5KFBA 3ZTRA 2J76E 4DSJA 2BUNA 2D69A 3ISND 4PXEA 4KGKA 3P6YC 1NK9A 3MM6A 4DF4A 2VBXA 1T9WA 3Q8SB 3IR5B 4CM0A 2BW2A 5DLGA 1V6HA 5HMYA 4M94A 4BWJA 3KLVA 1HQUA 3DU6A 1RLDA 4GO7X 2ZH4A 4USKA 3MMCB 3OXLA 4MKYA 3MMJA 5E41A 4FXVA 2HBZB 3VVUA 2GCFA 2X1BA 3F56A 4DR2J 2UXCJ 3H20A 1S6UA 4B3RJ 1I6JA 3ZZRA 1VIXA 5KG6A 4NEZA 4P7VA 3B6BA 3GIKA 1YVFA 3OL6A 1HNVA 4Z7YA 3GP9A 4QYRA 4DPOA 1AROP 3DFEA 1RT1A 2JFKA 1QUVA 2BJDA 2MLYA 4OQJA 3FNNA 1HIYA 2CJ9A 2HHSA 4DSKA 2CG4A 4UOGA 2YPZA 2KT3A 3GE9A 3CD5A 2MKHA 1RT6A 5J2NA 3C14A 2XO7A 4NWBA 2XNRA 2CFXA 1WG1A 1VGYA 3A8JA 2GO9A 3R5BA 2CQDA 1FWPA 2CQ3A 5HJYA 4CO3A 2LDIA 2XMWA 2E9ZA 3Q23A 2DXFA 3ULHA 3BKTA 2DKOB 2KFYA 1IBLF 1UVIA 3L95X 4NCGB 3DC2A 1QJHA 1U02A 4YY3F 3SSRA 3EJMA 4DPTA 4NXNF 1FD8A 1FXRA 2U2FA 2QLBB 2QA4G 3PX4A 1TAUA 4J9UE 2W8LA 3EUNA 2YH1A 1V5VA 3HP6A 1PYSB 3VGSA 3QIPA 1XR6A 2Z2LA 1QE1A 4I7FA 2JLGA 4P10A 2R8GA 2R7OA 4ED0A 4OI6A 2VBYA 3SIPB 2F9JA 5H9EJ 2HQGA 2RT3A 3OL9A 5K8NA 3PCOB 4DDFA 4O3RA 4NZ6A 3UW1A 1KONA 3F44A 3EXCX 2MKIA 3TW0A 1NK8A 4ITSA 1KTQA 2ZBCA 2F4FA 1ZM4A 2XY6A 1L3UA 2B7CB 4RNHA 1C0UA 4WTOB 5AJ3J 1K73T 3HKWA 3ENWA 3AJ1A 1VQ6S 3GFZA 3THTA 4C3LA 3NS5A 4O0IA 5GAGU 2EXUA 1LWFA 3MEEA 3BDEA 4L3KA 3THPA 3Q2TC 3BN7A 3I87A 5FD1A 5KFOA 2PMZD 4F4XA 3CCQS 2K06A 3VAGA 4ELVA 4NXMF 4K5RA 2LU2A 1HMVB 1EAYC 3M6WA 1YWXA 4ENOA 4NL5A 4QPXA 3M9MB 2D3ZA 3K89A 1WSRA 1Y3KA 3FFIB 1WTBA 2ADCA 1N0UA 4MK7A 2DNKA 1T9TA 3VTIA 1BHNA 2DHGA 1TKDA 1OY6A 1Y3JA 2C1EB 2RF2A 3U02A 4C8MA 4QW9A 1K9MT 3DLEB 3C2PA 1FCAA 3V6DB 3TQ1A 4B3OB 2K2PA 1SH0A 2E7XA 1N33J 4EMDA 5BXIA 4DX6A 3KXDA 1RE1B 3QT5A 1N5VA 2FY1A 4ID8A 2BR0A 1Q0NA 2QE5A 5D4OA 3NP5A 1RT5B 1HNXF 4USIA 2HRTA 2DHHA 4F2SA 2J0QD 2OPPA 2H48B 2ASJA 3CJQA 3GG0A 4RW6B 1WC0A 1YJ9S 2KXFA 3JYTA 4ZLNA 3R2CJ 3ZTOA 3AJ2A 1LXJA 5ETLA 1OY8A 1RA6A 3ZZOA 2I1RA 1H2TZ 2FIUA 1NJWA 2AJQA 3RG6A 3MM9B 1KQSR 3H4BA 2AU0A 1FK9A 3RR8A 2HGMA 5KFVA 4ZVGA 1R8PA 3L4BC 1HNIB 2RAQA 3KWMA 4KV8B 5C5JA 1PGZA 4DG1B 5A0YA 3HVTA 1NKCA 2Y0BB 3H5UA 3MTKA 1FE0A 4ILLA 3MHYA 1X8DA 4IRDA 1HR0J 4WU2A 3EMTA 3ZO7A 1KOOA 1S1UA 3VGVA 1ITPA 1SJFA 1NO8A 4DI6A 4WP3A 2M8DB 3IWXA 4J9SA 3O6QA 3KJQB 1JX4A 4RWWA 2LEBA 2QGFB 4C0OC 3TQEA 2R7WA 3AXKA 5KFYA 3BYPA 5KG1A 1HYSA 5GMKa 2VG6A 3GJQB 1YZ7A 3D68A 1YK9A 4J9KA 1QSLA 3BBFA 2DVIA 4IDKB 4MMOA 1V3SA 3M8SA 2DISA 2B43A 4ZCMA 2PA3A 2ERRA 3GFXA 4WFNQ 1IM6A 1Z4UA 3PJWA 1S7HA 1Q8LA 3SQOP 4URSA 4E0DA 1K1QA 1IVZA 2GQ2A 4OX6A 1D9DA 3D1QA 3K5LA 4ED5A 3ENQA 1IBCB 3B8HA 3PIPQ 4M5DA 1NRKA 5EUHA 4LRBA 4FVMA 4KFBA 3KLGB 4DCOB 1RSCA 3CJSA 2APOA 2VFVA 4KKOA 1A7GE 1FEHA 1XNRJ 2R8KA 2D9OA 2VG5B 3PFEA 1TK5A 2BDPA 2LMIA 3M9OB 1Y5NB 4GVBA 4K8RA 3WHIA 2DGTA 3NMRA 2YNGB 3CTRA 3IG1A 1NHUA 2CQ4A 3GSDA 4OL8A 2A6MA 5DRKA 2CJKA 5KFLA 1AZSB 2QYGA 4DV2J 3H4DA 2D1CA 4ZJOA 2YWGA 5GADI 1JLGB 3CGIA 3ITHA 1GEHA 3FVYA 3FZBA 4CYUB 4QR1A 4C8NA 4DX5A 1FWKA 1FTRA 5A8KB 1JLBA 4ECSA 3AB2B 2ZE2B 2H5EA 4NLYA 1V3ZA 1C4AA 4RNNA 2W2QP 2NLWA 3EZOA 4K4XA 1W2BR 1KDNA 4OYZA 2VPZB 2YKMB 3MD1A 2DR5A 3TVZA 2RKIA 3Q86A 5ITHA 2AJ4A 2HHWA 2DNNA 2LDYA 4RBTA 1RBLA 1S9EA 2Y8WA 3MEGA 4K7QA 2ZC3A 2YKAA 2OTLS 1LWEB 3Q83A 2IAJB 3WBZA 3QGHA 4TNOA 3QT8A 1ULRA 1QAIA 1YJNS 2ZZTA 4FVCA 1HD1A 3KLEA 3D0GE 2MSTA 1IWGA 3W2VA 1D0EA 3MM7A 2KHCA 2XSJA 1P6TA 3R5AA 4UQTA 4JI5F 1RU2A 2JJ4D 4HTJA 4Y6IA 2CVEA 4OV1A 2OEKA 4Q43A 2HNYB 1Q7LB 4HEA9 2RILA 4A8KA 2LA6A 2DK2A 3LGMA 1VQKS 1VK8A 3J7AN 2R2UA 5THWA 1H0HB 2HFVA 3UDCA 2WZ1A 4WK3A 1YJTA 3L9ZA 4Y2MA 1JLCB 2KHDA 3S8SA 4Q44A 2XHWA 3GG1A 2DGOA 5IS2A 2NREA 2V68A 4BWMA 2WOMB 3I32A 5ETOA 2ZH7A 4UF4A 2OLWA 5E3AA 3GIJA 5LT5A 2AGOA 2RRBA 4OJHA 2J0XA 5IV4A 5LXYA 3OBIA 1IWAA 3DGPB 4WU3A 2LCWA 2XWXA 3OV7A 2VFUA 4LF5F 2HBRB 4P72A 3O8WA 1IN0A 1ZYQA 1U7LA 2GGPA 1S1XB 1HHSA 4PXBA 2UUTA 3BGFA 3HHLD 1UL3A 1X4BA 1F0XA 3AD7C 2I6WA 4JI0F 3UPFA 2HHQA 3Q8YA 4AE5A 2HGLA 5KFJA 3Q0AA 3QIDA 1RWPB 1WNEA 1HPZA 2CNKB 5LOQA 4R8UB 2AEFA 1JXEA 1U8SA 2ZEJA 3VGUA 1OMSA 4KE5A 2Y1LB 2OGUA 3DLKA 3HZGA 3OL7A 2V94A 1UTAA 4ES3A 2UXDF 1RT3B 4MKBA 5G4DA 1VC0A 1UWAA 3M8RA 2M88A 4RU2A 2J0SD 1VIOA 2DGUA 3MMAA 3RB3A 4PQAA 2MPUA 2BW7A 4M5KA 1VQMS 1I5OB 4MH8A 1U1KA 3TZZA 3BR9A 1U45A 4DR5F 3KK1B 2QL5B 3KJVB 2IPOB 1QAJA 1M5SA 3UD4P 1C1CA 2DIVA 1S0VA 2AYGA 4URQU 3HJVA 2GAHC 2Y9HA 3B4MA 3ZZPA 2B7BB 4CLPA 4DLGA 1U1PA 3ET6A 2XZDB 4A8QA 2PIIA 1WEYA 1D8ZA 1MU2A 1VBYA 1W26A 4XDDA 3N6NA 2DNGA 1MROA 3TA0A 3FBBA 4X62F 3I55S 3KHLA 4Q5VA 5HJXA 1RHKB 2J7KA 3BREA 2B0GA 3UN2A 1NSPA 1NUEA 2IJNA 1JJCB 3GYXB 2KYZA 1XEZA 4QR2A 2KH9A 4ECQA 2XMJA 4WXWA 2A2DA 1J5OA 4IFVA 5HK4A 1VR6A 3BGRB 1U48A 2LQ5A 2D3OR 1WKJA 4HI2A 4K4UA 4Y2CA 2WVDA 3KHGA 3N0VA 1VLYA 2CPYA 1D3WA 3SI8A 4DR6J 2J5AA 2Z2ZA 2AZ1A 4KHPJ 5D8HB 2KFZA 2Y8YA 4EU0A 2XYPB 3FEYB 2N7YA 4N5SA 2W4CA 4OV6A 2VG7B 2K7KA 2OSRA 5G0RB 5I4MA 1ZM3A 3PKMA 3OR1B 1V5IB 4Z37A 5F8MA 4F0KA 4JI3J 5KFUA 4XDCA 2UUAJ 3PXGa 2QSFA 3V6HA 5EGYA 1NKBA 1KHVA 3MUVP 4JBCA 3EPIA 2RH3A 3M8PB 3UCGA 3UDLA 4HT7A 5HI7A 2YX4A 4WZQA 5L9NA 4NI2A 2WSCC 1N34F 4RW9A 2FY8A 4C8ZA 3RRHA 1U1OA 4N8NA 3CIZA 4ZOSA 3KK3B 1RAGB 1IJFB 3DHXA 4F25A 4QIVA 3C6TB 1JK9B 1VQOS 4YB7A 4KQZA 2DRDA 3SQGB 4IRCA 1EIYB 4ZPDA 1OQ3A 3I0RB 2PMWA 3OUYB 4C48A 2E5GA 5HP1A 4ECZA 3KUHA 4IH6A 2OPSA 1N32J 3NL0A 2PEHA 3JSYA 1NU4A 3PDNA 4F3QA 4QBUA 4NLQA 5CABA 3DLBA 1HBNA 4OX9F 2KT2A 2BRLA 1X9WA 2W2MP 3CC2S 4IFYA 1DQ8A 1NSQA 2DPIA 4RW7B 1X5SA 1T0TV 3D67A 1FRMA 2KZZA 4PUOB 5F41A 4ID5B 5LSLA 5EX3A 2MZ1A 1U2CA 5B0EA 2HS4A 4U8VA 4MJKA 2H5IB 1LWCB 4CH1A 1TL4A 2P8IA 1V9OA 4U95A 5KT4A 3TYTA 1VQ5S 3SDEB 5J2QB 2L41A 2HQCA 3LP0A 1TELA 5T7LA 2ALZA 3I5BA 2QMUB 4CO1A 4CNZA 4J90A 2BRKA 3H5XA 2DH8A 2MKSA 2ZBRA 2O67A 1WC4A 5HN0A 4QYZK 3N01A 5I3QA 2CQ1A 3SZ2A 2YKOA 4B3MF 4FXDA 5B0DA 1CLFA 4G1IA 3A8IA 2HHHF 2ZWOA 4J9PA 2PI5A 3G6XA 5F9LA 1NJYA 1J5EF 4FYVB 3CCTA 5KG0A 1L3VA 4JUZA 1NM2A 4BHQA 3QATA 2MZRA 3TNVA 2DNZA 1RYSA 2MQQA 5EDWA 1XMOF 4X2BA 1KQKA 3Q22A 1XNQJ 3K5OA 1GXLA 5F3TA 4J9LA 1RT6B 4GKKJ 3C14B 1F3FA 3OSPA 3B82A 1S97A 4AQYJ 3K2YA 2B4UA 2IC3A 2ZNZA 2FUG9 3KHHA 2DGVA 4FYXB 4IG0B 4P2FA 4GKJJ 3MURP 2YWWA 1DTQB 1YJRA 3SCJE 2F7VA 3QFWA 2AGQA 1SCJB 3UO0A 5F9NA 3PFOA 2P9EA 3SCLE 3IWNC 4PG7A 4J9MA 2NUUG 3IO1A 5GAGI 4I6YA 1DRZA 5DQGA 2HHVA 1SV5A 3CSKA 4LIRA 2DR8A 4ZHRA 3CPWR 3U1LA 1H6KX 4RW4A 1VC6A 1RAAB 1HKAA 2EFQA 4PRFA 4X64J 2GMJA 3G87A 4C0BA 3KK2A 5A8WA 1S6QB 3V6JA 4RO0A 3N6LA 3T5KA 5A6PA 3CDWA 1UFKA 3E51A 3M9NB 4OYMA 2LFVA 5DLFA 5DZ7A 3QIPB 4ECTA 2AYMA 1L3TA 4BLGA 1Q81T 1P27B 4ZP7A 1HWKA 4ZVPB 1AYEA 1NEEA 2CQPA 2LXIA 2W9CB 2GMHA 4QIEA 4CCHA 4I67A 3C6UA 2B51A 3JTNA 3CDEA 5BYSA 3T1HF 5IT9Y 4X4QA 4CM2A 3R6LB 1HBMA 2WBRA 3GJSB 3MR3A 2AD9A 1IBMJ 4WKRA 2Z8QA 2JEFA 1C0UB 3NWGA 5HQMA 1U6ZA 4L72B 4M63A 3NAHA 2BKPA 1FDBA 2ACMA 3KLFA 2XI3A 3DKDA 4UTGA 4X4TA 3RR7A 3M8WA 2FHOB 2VKZG 4FP9A 3C16B 4ICLB 1Q4RA 2JEIA 5C42A 4N76A 1YLXA 4N77A 4X4RA 1ZAXA 2PO4A 4W90B 4MAKA 3OJSA 3AODA 4Y2IA 4LFAF 1XTZA 4A8MP 4DF8A 3G6ES 2DH9A 3N5FA 2ZH3A 4F7VA 1HNWF 3OTCA 2CPHA 2DGWA 1JJ2R 4ZJQA 2RF2B 1KHWA 3CJ8A 3LAMA 2FD2A 1JLAB 3LPEA 1A9NB 3R5JB 4I2PA 3O44A 3OW2R 4QIFA 1U09A 5L1KA 2MSSA 4DV7F 2BOAA 2ZD1B 1PJ7A 5FDLA 2HHUA 1UAWA 3AHPA 4NCAA 4L76A 5JVHQ 2VH7A 4L74A 4GC7A 3OTOJ 4LFBF 2VBZA 1C0TA 3QLHA 3JYTB 4FYWB 4YMEA 5KFMA 2VOOA 4ZPBA 3JXOA 3D1OA 1VBXA 8RUCA 4RLEA 1FJGF 3LF0A 2HPUA 1HQ2A 3CULA 3M2UA 1JLQA 4RR5A 2XNQA 3HHDA 1IQTA 4I64A 1T9XA 5AXLA 3HD2A 4YR3A 3EZ5A 2DNRA 5F8HA 5L1JA 4OFZA 4LF4F 2Q79A 2J9DE 1WF1A 1IM4A 5A0YB 3EGNA 1IKWA 1B7FA 2E5IA 1U6BA 1S99A 3AD9C 2QLXA 1Y5LB 3GILA 3OPKA 5GVQA 3R5CA 2D3UA 2QO3A 3KDOA 4CTAA 3I4HX 3UE2A 3MR6A 2CYYA 1S5ZA 2POKA 5I42B 2R7QA 3T1AA 3UDEA 2IM2A 1JLFB 3FCHA 3TARA 4Q0BA 1AUDA 1FVQA 3G6YA 1HYSB 2VG6B 1X5TA 2XG8A 6FD1A 2HVZA 6AT1B 3GV8B 2ZZNA 4G6VB 4LF9F 1YZ6A 1R6VA 4LQ9A 3I0SB 1YJ7A 2MEWA 3HT0A 5HVFA 1ZA1B 1G2EA 5HATA 5BR8J 2RE1A 4DV6F 3QRQA 1WJ9A 4OYWA 3HX9A 3MFIA 3NLCA 1I94J 5KTQA 2WHOA 4DV1F 2VQFF 2BQUA 2L9NA 2XWYA 3BGUA 3BF4A 2RSQA 5IWAJ 4KFBB 4CH0S 1REGX 1T05A 1APSA 5L1IA 5CCLA 1TKTA 2WK4A 4IQXA 5ETTA 3BZQA 1RCXB 3P4UB 1RAEB 4PWUA 4JB8B 5KFIA 3POTB 2CWKA 3LALA 4LF6F 1DJ0A 3NAIA 5LMNF 2OTJS 1TUVA 2EK1A 3IG1B 1Y7PA 1IJEB 4KO0A 4ER8A 1RZMA 4H4MB 1IKXA 1OS5A 2BV3A 1TTHB 2WAQD 1PILA 2VIHA 3BR8A 4ZVFA 2PMHA 2DCLA 2XSFA 2G2YA 1FF2A 1NHKL 3CCUS 4MKAA 1N48A 1Y5IB 2HRUA 3DDNA 3PR4A 4IYQA 2RDJA 4ZK7M 4YFUA 5EWEA 2KJVA 4X4VA 4WFAQ 3PACA 2HQDA 2RHSB 3UCZP 1K44A 3CD0A 3WIVA 3MCNA 4CT9A 2HLUA 3OVBA 4QPTA 2H54B 1RTIB 2NYHA 1S9FA 5LMUJ 4K4VA 1FTCA 5K8MA 1RHMB 5IQ6A 2AX1A 2RKIB 3AH6A 1NDKA 2W9AA 1S9EB 3I96A 3MEGB 2KZMA 4NLTA 4PXDA 4OI4A 3RTVA 3ZC4A 3T5LA 2OD6A 4DL5A 4DR7F 2AGPA 2E66A 1TP7A 3DCAA 3MPVA 1TK8A 8AT1B 5ETKA 4CLYA 3T1YF 1S48A 3KLEB 1N36J 3W2VB 2N4CA 3CCES 2AYBA 2Q6CA 3MM7B 1HQEA 2DXDA 2QLWA 1L3KA 1YBAA 2MHEA 3GWCA 1KQGB 2OPRA 2QFIA 4IO9Q 2BE9B 2GA7A 1C1BA 3FC9A 1T9YA 2EBEA 2Y3YA 3FMBA 1M1KT 2JDJA 3M2VA 3TA1A 1YRTA 1R0BG 2CZVC 1SVDA 4TN2A 2K3KA 4F3OA 2IM1A 2WB4A 2CVIA 2QMXA 2R9LA 1GK8A 2HLTA 2RDDA 4PZVA 5A76A 4YQWA 3G86A 1NK5A 4X4OA 1UW9A 1CEZA 4L6V3 1U47A 1LFPA 3HF5A 2VBWA 3KJFB 4JI6J 2DGQA 4UUWA 1X4HA 2Z2YB 4K5SA 3LP2A 1D9AA 2DHAA 1B0VA 3U27A 4IH5A 2VFRA 4PAAA 2HKEA 4FBUA 1UA0A 1CULB 3IWLA 4OJ3A 5A2QY 3K8WA 1YBTA 2GGPB 2MQLA 1MWZA 4ZVTB 4NE9C 4DR2F 3BQ1A 4B3RF 1NZ8A 3I31A 4ED2A 1LK7A 2HYIB 2VICA 2OUGA 4X4NA 2F8MA 5KG7A 2BM1A 2PEBA 4OZJA 1MWYA 2ZJPQ 1KLMB 3EGVA 4CT8A 2C28A 1SC4B 5DS7A 3W8PA 2AJFE 4FN5A 3ZXWA 1MN7A 3DMJA 2HVIA 4HH0A 1NB2A 3W3SA 2M9KA 2MLZA 4HI1A 2UXBJ 4CRJA 1ZPVA 2GIFA 3MMAB 1FRLA 3RAQA 3GCWP 2Z58B 4JI4F 1VRTA 2HURA 1JLEA 1T02A 5JXSA 1VQLS 2EC2A 2J9CA 1BQNA 2DEIA 1C1CB 4IG3A 2VC1A 5HL7Q 1CVJA 3LQVA 2A10A 2K8GA 2B9YA 4Y00A 3FDSA 1GTHA 3EM1A 1EKSA 1YRUA 4LSZB 2HFSA 3KLHB 1VHIA 2WTFA 3OQ2A 2RQMA 4JOUA 5HLFB 2JLEA 2XY7A 3H2VE 3CJKB 5KFEA 4EBCA 4ZLJA 2YX1A 3QGIA 1VBKA 4N8OA 3TX0A 1IBLJ 2IJRA 4YY3J 2O66A 4DU8A 1UFLA 2GVZA 2ZH5A 3CUNA 3UR0A 2VPYB 3LGNA 5H9FJ 4M5LA 5IFMA 2HHXA 4OI2A 2GO8A 2WVCA 2CJBA 3SBMA 3AD8C 1RGVA 4RPFA 3MM5A 1M5VC 2CJXB 2XMUA 2AZ3A 4M5MA 2KJWA 3FK4A 3P3DA 3W9IA 2ZDPA 4ZVQB 2P9CA 1QD1A 2R7TA 1U1NA 2J9EA 3EPGA 1YI2S 2X1GA 2RQCA 3MR7A 1U26A 5AJ3F 4NI2B 3C8YA 3WQPA 4IOAQ 2HK2A 4RW9B 1SBRA 3PW4A 3KNAA 1OQ6A 3IMQJ 3AAWB 3K17A 4MFBB 3SCKE 1G4CA 2AT1B 3FBCA 4RX6A 2QRRA 3RBZA 3NBPA 1MN9A 2QT7A 1FRHA 3TA2A 1N5YB 5H9EK 4B3TJ 1NCLA 1ELOA 3GFYA 1FT8A 2V5HG 3BBCA 3NWRA 1KBRA 2JVOA 4J5OA 3J7A1 1HFEL 5HP1B 1X60A 4L3NA 2OPSB 3DM2B 4PPZA 4W4MA 3AJDA 4DQIA 3H25A 2QSWA 2CUYA 2CADA 2ZDOA 4ZCLA 1YJUA 1RHQB 1JMTA 1TKXA 2H4YB 3MR5A 3QGGA 1RCOB 2QX0A 4NLGA 4IFYB 2XYHB 1MMNA 4EFAC 4OZLA 5U47A 2VF3A 4U67Q 3HPOA 2CQIA 1N33F 4WK1A 2ZOGA 5EWFA 3JQMA 1UWBB 4DPUA 3OVAA 2IRXA 4KB7A 5C24A 2PGCA 1NAQA 2C3MA 2WONA 4B9MA 3CCVS 3LP0B 2F65A 2W4PA 2MGZB 2G9OA 4C8YA 4I6AA 4LRCA 3QO9A 3JAMY 1B3TA 1QDUB 3CCLS 2HEKA 2M5YA 1Y10A 4LJMA 3A13A 1HNXJ 4N47A 3UN5A 4ZIVA 4WTYA 2FTRA 3WC0A 5CQGA 2V4RA 1IKYA 1M90T 1SPBP 2DJWA 1WEZA 1RTDB 1NJZA 5AXMA 2N3OA 4KYZA 2XMTA 5HQLA 1S9GB 1RWWB 4DL7A 2HAIA 1LW2B 4ZS6A 3TEGA 3RRGA 3THVA 1IXKA 4I2QB 3LAKA 2H4WB 2XGPA 4QWDA 1UJ6A 4DFJA 3KUEA 2Z0GA 4OYAA 2R8JA 5GAHU 2BJ8A 4NASA 2V2QA 1PG5B 2DD8S 4U7UD 1CJTA 3KLIB 1HA1A 2RU9A 1AB8A 5F8JA 4B9UA 1D09B 4KC5A 2KB2A 4BC9A 3H90A 5T41A 2I9SA 1FHTA 3OHBA 3DRPB 4IUFA 2ATLA 3G96A 3E01B 3J7YU 2AHOB 3CF5Q 1T94A 4Q7AA 2EKNA 4F4ZA 2HNDA 3GIIA 2D9PA 4NMLA 2OIHA 3FSYA 3OHAA 5J2PA 3EXYA 4M1KA 3D6MB 3U1NA 2M4MA 2A6OA 2KKHA 1RWNB 3V81A 1SV5B 3D0IE 4C0HA 2ROEA 3VR1A 2KVQE 2UVWA 1ZTWA 1RT4B 3RB0A 3KNGA 1WC3A 1XNRF 4NOHA 1UPMB 1GNKA 3AOBA 4RW4B 2HAFA 2GVDA 2UUCF 4LSNA 1KLNA 1HWLA 3KK2B 1OYEA 5A8WB 4OI0A 2FHMA 2WW4A 5IM0A 3LO3A 1Q82T 2YNFA 3L7UA 2B4OA 4ED8A 1T03A 1DQAA 1TFYA 3HFKA 2ZJQQ 2ROGA 1WORA 1P8GA 1CC7A 2OPQA 4RKUC 5KFXA 4DV2F 4M5JA 2X1FA 3C6UB 4YEAA 2PN6A 2OFGX 1P9YA 2HZAA 2YXLA 4RW8B 2ZH9A 3FQLA 2MKKA 4EYHB 2C22A 3QYYA 2KRBA 2GHWA 4QU7A 2R2RA 1TL7B 5CYQA 2YNIA 2BJ9A 1W2IA 4NLVA 1HBMB 1ZM9A 2MTLA 2F4VF 4F4WA 2I2YA 3RJMB 3C3LA 1G3OA 4WP8A 3LTOA 1R43A 1TL3B 5KFTA 2VQEF 4F02A 2Z4PA 1REVB 1XBWA 3KLFB 3QSIA 2XCAA 4JI7J 1WC5A 1PKUA 3W5YA 2VU5A 2EBGA 1EZZB 2JEGA 5HBMA 5LXRA 1M1HA 2VDIA 1R8HA 3CWJA 1T8EA 2CQ0A 2CWXA 5C42B 5KFHA 4KAIA 4JV5F 4WFZA 4C11A 2WSEC 1Y11A 4TU7A 1CC8A 4ZVHA 2GQQA 2AEJA 1ICEB 4AL5A 5KFZA 1RT2A 2V8PA 3PYEA 1EJ7L 4USHA 5K20B 4X65F 4JI8J 4LRFA 3AY0A 4DV0J 4TXSA 3CT9A 3H5SA 1AFJA 5K8OA 3T6JA 3H2UB 1WSVA 3M7VA 1RQ0A 2EFOA 2AV5A 3VHQA 2YBVA 1D8YA 4PWDA 3OTDA 4NYZA 4DL4A 3MEKA 4KPYA 4GMKA 2B5JA 2V69A 3V6KA 1H98A 4JI5J 3DRSA 2QL7B 4MIAA 2QC3A 1C0TB 2NS1B 3TI0A 2MZSA 5CYMB 5DG9A 3T5JA 4O4RA 3X3UA 3MGJA 1F2GA 1JLQB 2DB1A 2Z2MA 4ZITA 2IIHA 1NH7A 3AA8A 3GPAA 1HWIA 1CJKA 4NA2A 3MUTP 2PI4A 1YQHA 1A6LA 1OSCA 4B02A 1IKWB 4HT5A 4AL7A 2JWNA 3TAPA 1ZAWA 2J0WA 4A48A 5IT4A 4NLDA 4WFYA 1C2PA 3TUZC 2YH0A 2GS8A 4CTAB 5KG2A 1R8AA 3ZZ0A 1X4CA 3MCSA 5HSPA 1I3OB 4FDFA 3UDVA 3CC4S 3HDSA 2W9BB 2DCUB 3I9V9 2BX6A 3MMCA 4R5PB 4Q0BB 3JTPA 3R1HA 1BMQB 2BVZA 2EK6A 2B4VA 2V34A 4ECWA 4ETZA 2RVJA 1MMLA 1X5PA 1HI0P 1L5UA 1FKAF 3D3CJ 1NNDA 3Q24A 4ANDA 4Q2LA 4L73A 3CD7A 1VQ9S 4I56A 3OT9A 1TU0B 3OXGA 3H40A 4IOCQ 2UXDJ 1FKOB 1KC8T 1RTZA 3QZ7A 4DX7A 3KG1A 3PRBA 3IN5A 2FYXA 4OYPA 3CIMA 3M6XA 4PEOA 2GHPA 4HHHA 1LWXA 2QL9B 4OZ2A 1TKTB 2BJ7A 3D9BA 1QSYA 2LQ9A 1UP1A 3OFEA 1FWLA 5D78A 2FLOA 1G6BA 4Q8EA 3TZYA 4UT4A 2IYGA 1N88A 2XMKA 4H4OB 3M2RB 4OMFG 3G4SS 4KO0B 3ZNUA 2MKJA 4LUBA 2H51B 5SZTA 1X4GA 1XMBA 5FJ4A 1FFGB 2V2ZA 4DR6F 2LVWA 1NBEB 1H74A 2UUBF 4H4KA 5B09A 3MM8B 2ZH6A 2O01C 2F1FA 2YKPA 3QZ8A 1X4EA 2V4JB 6FDRA 2BJEA 4ELUA 3BBBA 1WHXA 1F5BA 1SQGA 3L3CA 4YHHJ 5DDQC 4JI3F 4K4SA 4RJVA 2KN4A 4K2XA 3RYLA 2BE2B 2F3JA 1D1UA 4ED6A 3EDRB 1JKHB 4AT1B 4C8KA 3QJPA 4CWBA 2DH7A 2C2DA 2FC9A 4DN9A 1IUJA 3G9CA 4DSIA 2K1RB 1UVNA 3C15B 4C98A 1T9UA 4M95A 1DZ5A 1H73A 1R0AB 2IDEA 3N4WA 3M30A 5EWGA 1RHUB 3T3FA 4YB1P 3DYAA 3RBXA 1HBUA 3IAM9 3CB4A 3T41A 2VASA 1RDRA 1CPZA 1TKZB 4MTPA 3H42A 5LJ3Y 4NLXA 4ZVUB 1HQEB 5EX0A 1GMVA 3HKZD 1NHVA 2JZ5A 3ZZZA 1N34J 4AD6A 2BQRA 1N32F 2UVRA 4OIXA 1S1VA 2JVRA 2QFJA 1U0HB 3QJLA 1UZHA 5HANA 3M2VB 3R5DA 2HMIB 4CI0B 1IR2A 2JNJA 1UPPA 1WF0A 1HMVA 4QCLA 1ZETA 2DNLA 1FRJA 2QA4S 3FFIA 4DV5F 3N6MA 2GJ2A 3HHLA 5C7PA 4DL6A 4OX9J 3CCWA 3Q8VA 2P6SA 3PZPA 4B17A 4IOBA 1SH2A 3LPYA 2BACA 3TZXA 2J6TA 3KJNB 3V6DA 2CAJA 3TP2A 4B3OA 2ZM6J 2ASYA 5CZXA 5C25A 4OZ3A 3PW7A 1LNQA 1ZZFA 4ZP6A 4AXJA 5DDRC 2KT5A 1WKKA 1M5KC 1RTJA 1Q78A 1R7IA 3DGVA 3J81j 2IY5B 4RW6A 4ZKAA 1S0OA 3MMBA 5A2QU 1B7YB 2BANB 4ZDNA 4RU9A 3MM9A 2KI2A 2D74B 4PYDA 4L75A 1KVJA 2HWIA 1SKUB 3R7BB 3MECA 3QWUA 2RNEA 4K2JA 3HLUA 3ILLA 2MHNA 5E3QA 4DG1A 4EUVA 1A0OB 1DLOA 2HVEA 2VL1A 5LJ5Y 3M8QB 4TQRA 1RAIB 1XNQF 3W61A 1KQFB 2K7JA 5B08A 1HARA 4AQYF 1CSJA 4EK2A 1NJIT 5KFPA 2R7RA 2WVFA 3G2XA 2NCKL 2HBYB 3GV7B 1H2VZ 1MG7A 4PQUA 1VRTB 1IBKF 4DSEA 4DS5A 3EDQB 3BQ2A 2KM8B 2OH2A 2AQ4A 1B0TA 4ZP8A 3DI6A 4X4SA 3CDUA 3GCXP 5D4PA 4JYAF 1B64A 1HLWA 4KGMA 1M5OC 4OJGA 2BZ2A 5D3GA 3IS9B 3E8OA 1WDTA 4XPEA 1SJ1A 2A18A 2NXUA 5DG8A 3EVOA 3IBCB 4DV3J 5KAKA 5IV3A 1FI4A 1RK8A 4LBIA 3KG0A 3ZTSA 2DNYA 2EC0A 1Z2ZA 1FX4A 2GVZB 3VQTA 4ES1A 2NSCA 3CC7S 3BKFA 1MWQA 1T3NA 1RA7A 4OHWA 4OLOA 1TL1A 2J8AA 4AYBD 4Q2MA 3QSYB 4K0KJ 1WI8A 2VG5A 4USJC 3MM5B 4ZCKA 1Z1ZA 2KXHA 3QT6A 1GMWD 2ACYA 1QVFR 4USTA 3HHNB 4JI1J 3D5MA 3HSZA 5HAOA 3C66A 5M2RA 3PVXA 3AQOA 4KY3A 1T11A 5K14A 1VYAA 2FGCA 3M32B 1AZSA 2ZNYA 3IXQA 3J7Z5 4M5NA 3V4IB 4IO1A 3CO0P 1Z2LA 2KM8C 1JLGA 4FS1A 2XLIA 4OI1A 2CJYB 4LF8F 3TUPA 5MAOA 1YX2A 2VFSA 2RD5C 4X66F 4CO4A 2L9WA 1F2HA 2R2TA 3NBPB 2CNNB 1S7IA 3LA0A 1LW0A 2V8GA 1X4AA 3CCRS 2D3O1 1J27A 4RUAA 3NS7B 2NPIA 4A8FA 1S59A 1H7XA 3I5AA 2JX2A 2UV8A 1Q79A 2XEXA 4MIBA 2FJXA 2NQPA 1IQZA 3OLAA 3HHEA 2LQBA 5ETQA 3CD6S 3NGKA 1TKXB 3FEZA 2KXNB 2IAJA 3CCJS 1DBDA 4PCQA 2CQGA 2VZ9A 5GAHI 3M8YA 5JJBA 3TWZA 1BY9A 2WSFC 4D3GA 3VAFA 1VBZA 4G65A 2QLJB 5A6WA 1N56A 2XS7A 2MJUA 1HL6A 5D6GA 2MKYA 1HD0A 2KVIA 5E3PA 5FLXU 1LQ9A 3R97A 3DNCA 2H5JB 1VJWA 4I6WA 1X31C 2HNYA 3TAMB 3BH7B 2CIMA 2WONB 2X1AA 2X7IA 3V4MA 4U7CA 3HFVA 1EP4A 3MEDB 2LA4A 1P9QC 2OO4A 4NLSA 4EGLA 5CAAA 3RU0A 3CJTA 1XMQF 1XN9A 4H54A 3JAMU 1NPKA 1URRA 4LF1A 3SEOA 3ENAA 4LFBJ 2OI2A 1HWUA 1S4FA 1IKYB 3PJXA 2HGNA 2MQMA 4BS2A 3D3BJ 3KYLA 4CLZA 3R2DJ 3J80U 3JS9A 2WOMA 1OPZA 1FJGJ 1SKRA 4O3SA 1EKRA 4P7TA 1N5QA 5ETNA 1F9FA 3ISNC 4OYOA 4F36A 3LP1B 4LRAA 4JI2J 4LF4J 4V19X 2WBMA 3ILOA 3RGIA 5KG4A 5J2MB 2XY5A 3LW5C 1CJTB 3CO9A 4UZCA 3FRYA 3W8GA 1EX8A 3W64A 2BJ3A 5ETPA 4F04B 1LOUA 5B0CA 1DTTA 3R5GA 4CO5A 1SC3B 1TVRA 5GAEU 1PBUA 5K5MA 2QV6A 1WC1A 2VB6A 1LXNA 1GFWB 4DUZF 4X4PA 4DR1F 1RHJB 2HNDB 5BR8F 2WVBA 4RBVA 3KKFA 5J2PB 5DM7Q 3BH6B 3CMES 1WF2A 2ALYB 1I94F 4X4UA 5BYRA 2HWTA 2QTWA 1IR1A 2V9WA 3V81B 1JIHA 3D66A 2PE8A 3ZFVA 2DR6A 2YNHA 4DV6J 1JXVA 1SC6A 1QSSA 3KK1A 2MJNA 3KJVA 2C2NA 1E6VB 2C2KB 2GVDB 2UU9F 5CXTA 3UVJB 4ECVA 1RT7B 1VI7A 2JOQA 1WOOA 4DV1J 5IM0B 1TZ0A 2R8IA 5KOXA 3Q8UA 3BO3A 2YNFB 3JSBA 2L48A 3UI3A 4NMXA 1VCTA 1URNA 5H1SV 2ZOFA 3DOKA 3W2WB 3FRZA 2FZGB 1VJQA 2DIUA 2DY1A 2OPQB 2ZFHA 4WP9A 4A8YA 3ZNJ1 2O1PA 4O0NA 4ZPCA 1WHWA 1FFWB 2DTJA 1UJ4A 3TJAA 5I3PA 3TZWA 3OL8A 3F0NA 3BGLA 5JVGQ 2HQIA 4O44B 5LMNJ 1BWVA 5CYQB 4DLEA 3MAAB 1HNZJ 2H3EB 1VQNS 2YNIB 2V6AA 5CYJA 3BGRA 1HHQA 3VAHA 2FLPA 1RABB 1TK0A 2QLFB 2DYAA 1LFWA 2AJ0A 1KOHA 5LM7E 2MQNA 1XIQA 3TUJC 2QJ3A 3J7ZT 1VRUA 4FF2A 1N6QB 2A3JA 5HBMB 4F67A 1Q53A 4OLPA 3OR1A 3OSNA 3WC2A 5B7WA 5I3UA 3T5HA 1VOMA 2NXEA 4EWTA 3Q89A 1PC5A 5L46A 3JTOA 2IVFB 3UR3C 4OZ1A 1BC6A 5DETA 4LF7J 4XO0A 1EETB 4IQMA 5E5NA 4KGXB 1NK7A 1S1TA 4DL0C 3J81U 2CPIA 2V67A 3TR5A 3QNWB 4DR7J 2V9KA 3C19A 2IMWP 4O3QA 1SB6A 1I51B 3LWLA 1F5AA 3JSMA 5E3RA 3K5NA 1SL1A 3VAIA 4OHZA 2C2ZB 5E0OA 2F5GA 2YWFA 2ZH1A 2V50A 3Q8RB 1U1QA 3UD3P 3PEJA 2HNZA 3M6UA 1Y0HA 3FSIA 2W8KA 1HI8A 4I69A 3UN3A 1FX2A 3LUYA 3HI9A 4KSEB 3DRSB 2XS2A 5CCMA 2Q6BA 4DPYA 5L1LA 2EPIA 4CDIA 2FPHX 1JXLA 3SXLA 4K4ZA 1B0PA 1PYTA 2Y0SD 4DN0A 4FF1A 4HVZA 4A8SA 4LR7A 1WELA 4WIIA 4MT1A 3EVWA 4JI6F 2YWEA 4IR1A 3A8EA 4DQQA 3BEGB 4RW7A 4F4AA 1HBOB 2HW3A 3VQSA 4ZPAA 1FRXA 3N9UC 2DR7A 3ADAC 2XM3A 2VHGA 1S49A 2OEMA 2X3GA 1RADB 3DLGB 2PDAA 1LWCA 3FQKA 3O2IA 2ATCB 3AFGA 1TMJA 5T14A 4DUTA 4WIQA 3NNHA 2VA3A 1FJCA 5IC4B 2BJ1A 2CPDA 2M8HA 1Q5VA 1T95A 4YB5A 4O4GB 3SDEA 5J2QA 2G2ZA 2FVSA 3IM8A 4QWBA 2E5LJ 2VKRA 4ECXA 4LFCF 4P52A 1X9SA 3A1YG 1YRXA 1B4SA 5HROB 5KFDA 5ETVA 3PO5A 3LANA 2FJWA 1F6TA 2C2MB 5HVGA 2FVQA 1FRKA 2R2SA 3HD1A 2UXBF 3MDFA 4GRSA 1NDLA 4ZVRB 4WFXA 2NXCA 5BYQA 5L39A 3UWTA 5KFCA 2Q3PA 4EEYA 3MM6B 1E6YA 4PPDA 2ZZMA 2NR0A 4D3HA 1ZAVA 2HQ3A 2FVRA 3ZZYA 3A4TA 4J7CA 2HZCA 2XZTB 1HQUB 3O3LA 3LH2S 1ZA2B 2KG1A 4WCEQ 4USMA 5F3ZA 2O3DA 2EG1A 3OR2A 4HACA 1EARA 3CE8A 4USWA 5E7OB 4B9SA 5CHCB 4A4JA 4K4TA 4JI4J 3K59A 4IG0A 1HNVB 3NMAA 3DXSX 2R8HA 1RWVB 1DTQA 2CPXA 2BA9A 3QJJA 1SQFA 1RT1B 4TKTA 4KPCA 3NCQA 4WE1A 3NRBA 4DV4F 2RQ4A 4U96A 5J2NB 2J6SA 1TFWA 3MOZA 2JSXA 1S4EA 1ACMB 4MK8A 5KFGA 2HS3A 2C3PA 1SXLA 3PY8A 4DSFA 1S6QA 3CJRA 4F8RA 4LR8A 2DT9A 4NYOA 3L7PA 5D77A 1UA1A 1HI1A 3W9HA 3D6HB 4Q8FA 2RQKA 2IM3A 1S77D 2W9CA 2J9DA 3D2WA 2LP4A 2W01A 2KYXA 3IRXA 1U0SA 2UVVA 5KT5A 5F0WA 4PKDB 2B56A 4PYAA 1RBAA 2AEMA 2PD1A 1DURA 3R7SB 2W7OA 4BC7A 1S0NA 5H9FK 5D4LA 4MYUA 3M30B 3DYAB 2XS5A 2EFPA 1HBUB 4TQSA 1N8RT 4V19J 1QAYA 5E33A 1RKJA 4B3TF 2LECA 1QE1B 2AYEA 4I7FB 2QYCA 2IHR1 2Q43A 3TVKA 5F8NA 4DQRA 3CEDA 4R25A 1V3RA 1XWLA 2DEJA 1U1LA 3VWSA 3N79A 4TU9A 2GHVC 2MB0B 3R6GB 1S1VB 1Q5YA 4FPRA 1PAUB 1WC6A 5GMDA 3C16A 1UVKA 1QUPA 4ICLA 2W7AA 3HO1A 2IA6A 3KMSA 4HR2A 1SUQA 4H4KC 2B8QA 4U6PA 1NSKL 1N4LA 1NK4A 4QWCA 2NZ4A 2LQ8A 3DOLA 1EB0A 1Q16B 4P2SA 1MW7A 3PYDA 1TAQA 3D7SB 3HHLB 2G13A 5KT3A 5B0AA 4C7QA 1LWFB 3SFGA 3MEEB 4WKYA 4MKVA 1JLAA 7FDRA 3BV8A 1NJXA 2CQCA 3JB9k 2QA1A 5C25B 2UUWA 1JB0C 3AA9A 2ZD1A 4EZ9A 4K4WA 4FKXA 1KFSA 4ZVEA 3DRRA 2R7XA 2W2NP 4EBEA 3FJ2A 1RTJB 4B08A 4RUHA 3EICA 4IRKA 3ZTPA 4DFMA 1VDHA 4ILRA 3RW6A 5GMEA 4DL3A 3MMBB 5KG3A 2FHJD 5HQ8A 3QBCA 3CJ2A 1GT8A 3FEXB 3AT1B 2E1AA 3SSSA 4DR3J 4LMZA 2GX8A 4FYYB 3MECB 1U49A 3H98A 2FJBB 2NUHA 2ZH8A 3HVAA 1FVSA 2FJVA 2HFNA 4P6QA 1X5OA 2OPPB 4J9OA 3C46A 1DLOB 1OSDA 1NK6A 2NZCA 5IT0A 1PJ5A 2UVUA 4USUA 1UFWA 3KOAA 1K8AT 1UZDA 1BUXA 1CQMA 3EWGA 5L8RC 1QLNA 2JRSA 4PQUB 3BO2A 2LKZA 3HHLC 4DZDA 3NY0A 1FK9B 1NDPA 2ZBQA 2J7UA 2HHPA 1RWKB 5I42A 1SL0A 1JLFA 3DI6B 4WFBQ 1F9EB 1ZZNA 3HVTB 4WF9Q 2NPFA 1F3VA 2C3OA 1TMMA 3KUGA 3MPYA 5D3GB 5M2UA 2JFDA 4PWWA 3P8BB 2YVSA 3FUYA 1S1UB 1NB7A 3UQSA 5KFFA 3I0SA 3PYGA 2GC8A 3NS6A 2ZHOA 3CW2C 3GB0A 4PG6A 4O3NA 2FVCA 3PX0A 1S0MA 3IFEA 4PG4A 3P5BP 4TY8A 4XAKA 4RNOA 2FC8A 1B99A 1Q8KA 1ZTTA 2G1HA 1U24A 5A8RA 5J1PA 4X84A 1TL1B 4TYAA 2M0GB 3LWMA 1EQMA 2UUCJ 2AWZA 2OMLA 3DDKA 1WG4A 4N41A 1KWMA 3GJRB 4ZJLA 2C3YA 4CNYA 3CXCR 3POTA 3CDBA 4TLRA 3R7NB 2XC9A 2BOPA 3BB5A 3NCRA 5LL6d 2FGOA 4ZMMA 4DHVA 1SKWA 5K14B 4RL1A 4H4MA 4ZCIA 2EKYA 2VOPA 1ZPWX 1R27B 4M5DB 1JNZB 1FNXH 4KKOB 2OP5A 4ILMA 2IRYA 4OJ1A 1SIWB 2LQJA 2G0JA 4QWAA 1TUWA 2QZ8A 4KH1B 2EG2A 2HQFA 5K9FA 1GX6A 2G4BA 3M05A 3TEHB 1FKPA 4JI7F 5AT1B 2FQQB 4GVBB 3CCMS 2IRUA 1F60B 4KRWA 2RMLA 2F4VJ 1LW0B 1RTIA 2QN6B 4J9RA 5IOLA 4FNHA 2VQEJ 4FF3A 2EVZA 5L38A 4DU7A 3ITHB 2XMMA 1FA0A 2ILYA 2D41A 5EHHA 2YKQA 1RWOB 2DNHA 4W92B 2CJQA 1Q86T 2FJAB 3BN4A 4FPIA 1JLBB 3VCDA 2DNOA 4KGVB 3HSJA 3MD3A 1KNZA 1IKVA 4JV5J 4JI8F 5KFAA 3VGTA 4DV0F 4K4YA 5AE1A 4CLUA 5CZVA 2GJIA 2EFGA 2H1YA 2MYFA 1PCAA 1R8BA 3GONA 5GAEI 4CP5A 1UEKA 5HVHA 1VS3A 4CLLA 4X65J 1Y4ZB 4B3SF 1M1GA 1Q1KA 2ZKTA 3DN9A 4ECUA 4DUYJ 1TR0A 1ZBTA 3N28A 2R7UA 1EP4B 4YP3A 3JQJA 1XR7A 4KTQA 5E3CA 2MZJA 1K1SA 2AMCB 3NEKA 4J9VA 1U1RA 2G0IA 3GR0A 3QGPA 2C42A 4HTIA 2XSJB 2DGSA 3E2EA 2YQ0A 1RAOA 2W25A 3VAJA 4NLOA 1QY7A 2HZVA 1NPRA 3PIOQ 2VD3A 2RUSA 1G1XA 4ETXA 3PRVA 4B9TA 2WB1D 3TANA 2JLFA 9RUBA 1YGYA 3EZUA 4DR4F 4NEYA 3MCMA 4LIWA 2BABA 1DAXA 4QOTA 4YOEA 2Y1JA 3PHTA 1VRQC 1UVMA 1CULA 2MQOA 3GMGA 1EHWA 2IJFA 2WRMA 4CLTA 3PR5B 4EO8A 3Q8PB 3PM9A 1NKEA 1GAOA 2MY8A 1FFSB 3R3TA 4KBIA 1DTTB 2WCXA 2RS8A 2OKQA 1TVRB 4DXLA 2I5JA 2MLXA 1FRIA 4DZ6A 3W66A 1YBUA 2QIFA 5KFKA 1OO0B 1KLMA 4OHXA 2MZQA 2GZOA 1P1LA 2V8DA 3R27A 3FCWA 4WYLA 2UV8G 2M3DA 3M4XA 5DDPC 2QG9B 1O6XA 3B4DA 1RWXB 1XQIA 3T9NA 1GX5A 1FNOA 2YKNA 2UXCF 1KEKA 2HFUA 1BD6A 3TRGA 3BSCA 1T7PA 1DARA 2K3IA 1FERA 3KDNA 1SJQA 3GLJA 2YNHB 2NXJA 2CQBA 4KIAA 1RTHA 1R89A 4Y2AA 2ROPA 4YDDB 4OHYA 1NLKL 1HPZB 3FMWA 1QTNB 3A3NB 1PC4A 2E1RA 1S57A 1N5SA 1VISA 2CQHA 3S1TA 1CJVA 3DLKB 1BQMA 3DOKB 3PW2A 3HVWA 2W2PP 2M70A 4BBYA 3KLHA 3OVSA 2LLZA 2BEFA 3H59A 1F5CA 3SMZA 4UZBA 4GVLA 1W7WA 3HJFA 3O1LA 5DZ6A 5HLFA 4U7UK 2ZUGA 2JEJA 2F63A 3CJKA 3BPDA 5CD4A 4G1PA 5HO4A 3M8ZA 4LSLA 3ET6B 3GR1A 2E1CA 3PV8A 4YHHF 1SIZA 4DQPA 4NX9A 1MU2B 4QIWD 4Y3CA 1XERA 1UVJA 2JC1A 1MROB 2UUBJ 1S76D 5KT7A 2LYVA 1FO1A 2ZC4A 3KMQA 1VRUB 4M5GA 5C2CA 2IVMA 3GZ7A 2A1BA 1ZH5A 3GIMA 4GO5X 4F0MA 1J5OB 2YWKA 4IFVB 4FZVA 5I3UB 2DY9A 1LEOA 3D54A 2BBEA 4NLUA 1BQXA 4NXNJ 4FXWA 1XJWB 5SUHA 2GJFA 3DXBA 4A8WA 2IVYA 1GTEA 1S1TB 4DSLA 3VF0B 2AF6A 4AFFA 2YQ3A 4DOZA 1YG0A 4ZA1A 1KD1T 3B54A 4MFBA 1YIJS 4Y65A 3JSMB 4QW8A 5KFWA 4R0JA 1N5YA 4M5HA 2PFFB 3EX7B 1FJ7A 1CJUA 2HNZB 4KHMA 3QAUA 5L9XA 4Y2KA 2MY7A 3NCPA 4J91A 3DM2A 2ZHAA 3PJ9A 1BXNA 4P9SA 2F8HA 1UW4A 2CQ2A 2OHDA 1FDDA 4USVA 2DRAA 2RJZA 1KKHA 3VZIA 4Q45A 2ZM6F 2G1DA 4EI2A 2VDHA 1WD6A 1R6YA 1WWHA 2KO1A 4UW2A 4DV5J 4DJBA 3K58A 3BDPA 4ED4A 1S6PA 1CS4A 2AJ2A 1QAXA 5ETSA 4CO0A 1UWBA 3D4JA 1HBNB 8ATCB 3D28A 3L7OA 4C97A 2CZ9A 3DHWC 2OFHX 1FESA 5B0BA 4E8UA 1O8BA 1SKSA 4NXMJ 4I1TA 2F40A 2MGZA 3SV3A 3NGRA 3HSDA 3I56S 3SYZA 4WBFA 5DGBA 1NSAA 3F41A 3GYGA 2E29A 1ZS6A 2BYCA 2ZUAA 2YPYA 4R0EA 3Q8QB 1HHTP 1RTDA 4YR2A 2B9WA 5EN1A 2N4DA 4CH7A 4TVAB 2QA2A 2Y1IA 1RUSA 5KT2A 1S9GA 2JHEA 4TYBA 1O51A 4QU6A 4UY85 2XULA 1E6YB 5T7LB 2C3UA 3EYZA 3P45B 1KTVA 2W2OP 4ZPWR 1LW2A 1RACB 3R1LA 5IZHA 3SFUA 1AXQA 1AT1B 4I2QA 2G0CA 4EBDA 1RAFB 2DNQA 7FD1A 2CXEA 1WACA 4LREA 3GIRA 1FDNA 2I0XA 3KLIA 5K8PA 1JNRB 1FXDA 3HM9A 2E7WA 4HH1A 1RLCL 3OR2B 4NLWA 4HACB 1IR0A 2W7PA 2DGXA 3AOAA 5IC6B 2GAGC 2OD4A 2BKOA 2VV5A 2B6AA 3BO4A 1HR0F 3GQCA 3DRPA 2ZH2A 1IBKJ 1SI9A 2YX7A 2V8VA 1C4CA 3E01A 3I9ZA 1PJ6A 3RBEA 5ADZA 1VFJA 5KOWA 4Z2XA 3HVRA 4A47A 3BM7A 3CMQA 4DV3F 4JYAJ 2HHTA 1T9VA 4WE1B 4DL2A 4G1QA 2ZOMA 2CKWA 4MIWA 4RUBA 3S01A 4HHUA 4OYXA 1S1WA 1YJWS 3DDIA 1WHYA 2IC3B 5ETRA 1S10A 2OAUA 3X1LB 2QMWA 3CJ4A 1RT4A 4NLRA 2W24A 3M1VA 1YJVA 1H2UX 4K0KF 5C2GA 3VAMA 2DITA 2CNLB 2DNPA 2AW0A 3CDAA 3NGSA 4F26A 1N5TA 2FB0A 1OY9A 1BGXT 4JI1F 1SH3A 1TQLA 1VQ4S 2DPJA 3H5YA 4CIOA 1YSJA 3CJ3A 4UQGA 5D15A 4N7TA 2BM0A 4YUDA 5CA5A 1Q95G 2RRNA 1OPIA 3BKUA 5CD4H 3IRXB 3P96A 5BJRA 4ZHRB 3BJYA 2P9GA 4RW8A 2P5VA 4OZNA 3LOUA 3TOQA 1JWWA 1TL7A 4P75A 2CPFA 2AKWB 1PYOB 5KFSA 1KS2A 4CLSA 1Y9OA 5JMNA 4G3IA 3OFHA 4ECYA 1RHRB 4ZLPA 2N3LA 2D7SA 2VA2A 2HG4A 5KFNA 1TL3A 4LF8J 4E98A 1REVA 3RB6A 3MPUB 1RWUA 1OWXA 4X66J 3MPWA 5J1EA 3DOMA 1KP6A 5D0RA 2V0NA 4ELTA 4LR9A 1WDDA 2YWHA 2B9EA 3AQPA 1SUQB 5IT9U 3I5CA 3FGVA 2COLA 1VK3A 5HMWA 1UJ5A 1PBAA 2CZ4A 4RUCA 3DOLB 2LEPA 3OJUA 3EGZA 2Q66A 1TV6A 2M2BA 4PG8A 1YTYA 3DU5A 2H65B 2XLKA 2P2CB 4RBUA 4DCJB 3SV4A 2FVPA 3PW5A 4HL9A 2UP1A 1DY3A 4O3OA 4WYWA 5JUMA 1WKLA 1S72S 4Y28C 1UEVA 2CPEA 3GTYX 5DQHA 5FIIA 1X9MA 2DR9A 1FNMA 1K0VA 3DRRB 3G8SA 4B9VA 3KTQA 2CNOB 2B8PA 3F73A 3PW0A 1X4DA 2ZBIA 3MUMP 3D1HA 5CYMA 2IDLA 4I2PB 3SSQA 4EO6A 4NRUA 3PKYA 4W98A 2EEYA 3HK2A 3CNQP 5DO2A 1VC5A 1M5PC 2R42A 2W4DA 1XMQJ 3PRDA 1HWJA 1K0TA 5FDLB 1XR5A 2GIQA 3G82A 4JI2F 2MZTA 1X7VA 3VALA 3QLHB 1AA1B 3FBFA 1SL2A 4LT6A 4DWIA 1S12A 3FCVA 2LU1A 4JP8A 1NMEB 1RI7A 5F0UA 1J2VA 2HK3A 3M2UB 4DBQA 4UY8T 3QAEA 3MR2A 1KN6A 2B9XA 3QT7A 4ED1A 2W9BA 3MAHA 4OZ5A 4ZIWA 4R5PA 2V2VA 4ZLLA 3IA0A 3BS9A 1UMJA 4TLQA 2KTQA 2R7SA 3FKBA 2ZHBA 3MXHP 4ED7A 4ECRA 2XYGB 2H9ZA 4QJVA 1AFIA 2I8EA 1X4FA 1GMWA 5D0HA 3K7RA 4DUZJ 5DM6Q 4HKQA 4DR1J 1S6OA 2BKNA 2OMOA 2YY3A 3S7RA 4DX8H 4LF5J 2OSQA 2PT0A 3A3OB 4ZN3A 1FKOA 4M8LA 5F8IA 4TY8B 2VFTA 3IC1A 1SJRA 3GFHA 4JI0J 5A8RB 4KJIA 2BQ3A 3UD5A 4A8OA 2HWHA 1W25A 2L08A 1YITS 2UU9J 5MLCV 3K0JA 4YN3B 2GNKA 2OEJA 3QRRA 2A0FB 4ZVOB 1VQSA 1BE4A 4V1Ak 1FE4A 3ZTQA 4H4OA 2RS2A 3M2RA 1HNZF 1S79A 3G8QA 3JSRA 2XLJA 4IKAA 1UVLA 4I0WA 5ETMA 3DRXA 3HCXA 1T05B 4DR5J 3EE3A 3M6VA 3MM8A 1FEEA 5F8LA 3FZ2A 1FKPB 2V4JA 4LBPA 2ZITA 2ZVSA 3MAQA 3W9JA 1MSWD 3QQCD 4AUKA 2Y1RI 2NSBA 2MQ8A 3OXFA 3WZ0A 1JQGA 3RZAA 2BXJA 4NCGA 1IKXB 4X62J 3LGHA 1TL5A 3P5TL 4KHRA 2BE2A 4F4KA 1JKHA 5D4NA 4KHPF 4LF7F 1SJ4P 4ALZA 3TUIC 1JJ4A 3NXZA 4C2MA 2K1RA 2PC6A 4O3PA 3C15A 4S0MA 1WEXA 1R0AA 2XB2D 3T6BA 1CBKA 2IM0A 3I82A 5D0GA 1IKVB 4LBHA 1UKUA 4O23A 3W60A 1FD2A 2ZJRQ 1RB0A 2VJVA 2CDQA 4BDPA 1TKZA 2LXFA 2UUAF 1MMDA 1O5JA 3WX8A 3CJ5A 4K59A 4F0HA 2GFFA 4P71A 4ANCA 3A12A 2KFNA 1N0VC 4NA1A 3ENVA 1U0HA 4J37A 4PR6A 1ZOTA 1SJ3P 2HMIA 4QZVB 3CCZA 2GW8A 4F3MA 5KFRA 3R8YA 3OFFA 4OX8A 2XCPA 2LXUA 3RBDA 3NNCA 2J7WA 2XMAA 3CJ0A 3GJTB 1B70B 2ZKUA 2FZCB 1M5HA 2NXNA 2RHQB 2OPRB 1RYRA 2KL8A 4XK8C 3PEHA 1C1BB 1R3NA 5RUBA 1NH8A 3RB4A 2V8HA 3AB4B 3HSGA 5AE2A 3KG4A 3IR7B 1U25A 3H8YA 1YDLA 3IM9A 2R4FA 3BSNA 1YHQS 2GIRA 2VJUA 3O5TB 1Q8IA 4E2FB 2E5LF 3US5A 2E1PA 2DRBA 1UEUA 1RXOB 4URGA 3HT3A 3EVMA 1FXLA 5DQIA 1EQ0A 2GQCA 5B0FA 4RNFA 1H72C 1RAHB 5DGAA 3W5XA 5B0GA 4WXOA 4TY9A 4HDHA 4CQ1A 1LV5A 1L3SA 4KH0B 4ZP9A 2BANA 5LSRA 2I5JB 3DLEA 4I4BA 1OJ4A 4QYZJ 4EYIB 3N5BA 2YTCA 1GXUA 3LP2B 1WI6A 5D0EA 4LFCJ 2XTJP 1VLOA 4LQ3A 4UOCA 4ANEA 2F9DA 1RJJA 4DCPB 1CG2A 1RT5A 1KRPA 3CMAS 2HVHA 1UETA 1RP5A 3WIUA 3U1MA 1NXIA 3EGWB 4F50A 3HFZB 4HLBA 1N52B 4WWSA 4Y0FA 3M8QA 1U6FA 3AOCA 2IA0A 3RUBL 1WG5A 1GMUA 2XO6A 2EWHA 3UNYA 3MZIA 1FJEB 3HMJG 2YKNB 2AJ1A 2A2CA 3TAQA 2DXEA 4NCBA 4NZ0A 2MDAA 2W1BA 2AIRB 3NKYA 5KT6A 1VQYA 3V2UC 2E44A 1RTHB 2RRAA 2FLLA 2Q1LA 2RIJA 3DMJB 3KHRA 1HNIA 4P74A 4B3MJ 1CQNA 3IAS9 4J9QA 7AT1B 3TJ8A 4KV8A 3MTJA 1CJVB 1BQMB 2FZKB 2HHHJ 4GKKF 1X0PA 3UCUP 5J1NA 3IS9A 2PSZA 1GH8A 3IRWP 2EW9A 1J5EJ 4ERDA 3ETOA 1U2FA 4GC6A 2ASDA 4FNIA 4DMZA 3ETMA 1T3OA 2NYIA 4CZCA 1DFDA 3W1YC 4GKJF 1JLEB 1UCNA 3SCIE 1PO6A 1BQNB 3MCOA 2VODA 4IG3B 3QRPA 2FDNA 3D0HE 1XMOJ 4C6AA 1O0PA 4DV4J 1U2RA 4LSLB 4YDXA 4HDGA 2CJAA 2CPJA 3BSAA 3W63A 2CA9A 4IDKA 1JJHA 1H38A 5M2PA 3W65A 3MWBA 3VV2B 2MQPA 3QPIA 3RAXA 3TVYA 4DPXA 2V4QA 1XC9A 1DHMA 4QR0A 1KR4A 4Y34A 1RKIA 4X64F 2E9TA 5E2QA 3P49B 4LF2A 3IGVA 2VC0A 2FJEB 2DNMA 3M32A 3ZZTA 2AP6A 2R3VA 3K5PA 1VQPS 3DRYA 3KLGA 4AL6A 3V4IA 2HFOA 3WDOA 2PFDA 4WJBA 3ISZA 1R31A 3VAKA 1F1BB 2YQ1A 3IBFB 3OD2A 1G7CB 2CG8A 1U4BA 2KU7A 2RB7A 5IXUA 1AUSL 2YNGA 3ZZUA 3A3PB 2PA8D 2C2EA 4TU8A 3MOJB 1M0SA 3WX4A 1NZAA 4DS4A 2BE7D 2P6TA 1WHVA 1U1MA 1F9HA 1CJUB 1N54B 3K57A 1IBMF 3E3XA 4DQSA 2E1MC 2Z56B 1GXTA 4MK9A 2CRLA 4LRDA 4CYUA 2C2RA 1OIAA 2L3MA 2C2OB 4AXIA 2DBBA 3T1HJ 3ONQA 3RAMA 2DO4A 3ILJA 5A8KA 1RWMB 2X3DA 2JC0A 3DLJA 3FSXA 3AXMA 2ZE2A 3TJ9A 4EZ6A 4A8XA 1WOPA 1Y00A 3NGUA 2F8EX 3GV5B
chains in the Genus database with same CATH topology
4OJ1A 1GQEA 1SIWB 2LQJA 3OXGA 3H40A 4QWAA 5KT4A 3TYTA 4IOCQ 4FS2A 2N82B 1VQ5S 2QZ8A 3UFCX 2EG2A 5K9FA 1GX6A 1FKOB 1KC8T 2FLNA 2G4BA 3M05A 3QZ7A 3SDEB 5J2QB 2L41A 1FKPA 4JI7F 2YKMA 3KG1A 3LP0A 3G71S 3PRBA 5T7LA 5FLXY 3IN5A 2ALZA 2GMLA 3I5BA 4CO1A 1UVIA 5IQQA 3CCMS 2IRUA 1RISA 2AX0A 1S6PB 4CNZA 1F60B 4KRWA 2RMLA 3CIMA 3PNIA 2BRKA 3M6XA 2X51A 2GHPA 3H5XA 1LW0B 1RTIA 4B9NA 4ED3A 2DH8A 2MKSA 5HMZA 2O67A 3L09A 5HN0A 1TKTB 1ROFA 4J9RA 3N01A 5I3QA 4FNHA 3TAMA 1P1TA 1LWEA 3HXMA 2XGQA 4FF3A 2CQ1A 1QSYA 2VPXB 2EI5A 1UP1A 2LQ9A 2YKOA 3OFEA 3SZ2A 4B3MF 2EVZA 4FXDA 5B0DA 3CCSS 4RWXA 2DHXA 1CLFA 4ATNA 4G1IA 1VHFA 5D78A 5L38A 2FLOA 3ITHB 3MEDA 1G6BA 1WTFA 4Q8EA 2XMMA 1FA0A 2IYGA 2ILYA 2HHHF 2D41A 1N88A 3OTEA 5EHHA 5KG5A 2XMKA 4H4OB 2YKQA 3QWPA 3M2RB 4J9PA 4OMFG 4DR3F 2DNHA 2PI5A 4W92B 2CJQA 3G4SS 2XZWA 4KO0B 2MKJA 3G6XA 4C4WA 1Q86T 2FJAB 4LUBA 3BN4A 5F9LA 1Q7YT 4PG5A 1NJYA 3K5MA 1JLBB 4DEZA 5SZTA 5DG7A 3VCDA 2DNOA 1J5EF 2CPZA 1X4GA 1XMBA 3I6PA 3MD3A 3CCTA 4F2RA 5KG0A 1KNZA 5FJ4A 1IKVA 4JI8F 3J80Y 5KFAA 4DR6F 2N7CA 2LVWA 3J7YI 1L3VA 4JUZA 4DV0F 4K4YA 1BLUA 5AE1A 4BHQA 2ILZA 2UUBF 3OTOF 4H4KA 2MZRA 5B09A 3MM8B 2XBPA 3TNVA 2DNZA 2ZH6A 4C3MA 1RYSA 5CZVA 5C24B 2MQQA 3HHKA 5EDWA 1XMOF 2O01C 2GJIA 2EFGA 4X2BA 5GADU 2F1FA 2YKPA 1KQKA 3Q22A 3K5OA 2MYFA 3QZ8A 1GXLA 5F3TA 1R8BA 1X4EA 4J9LA 2ASLA 1RT6B 2V4JB 6FDRA 2BJEA 5GAEI 4J9NA 3OSPA 3PHEA 4C3KA 4ELUA 3B82A 1S97A 1WHXA 1F5BA 1QVGR 3K2YA 3QO9B 2B4UA 1SQEA 2IC3A 1VS3A 2ZNZA 3L3CA 5DDQC 3LP1A 2FUG9 4JI3F 4K4SA 3KHHA 1Y4ZB 2DGVA 3PX6A 4B3SF 2KN4A 4XIUA 4IG0B 1Q1KA 4K2XA 3RYLA 2ZKTA 3W7BA 3DN9A 4ECUA 1JLCA 5J2MA 2BE2B 2F3JA 2FHKA 3MURP 1D1UA 1TR0A 3IR6B 3KFWX 4ED6A 1DTQB 1ZBTA 3PO4A 2VPWB 1JKHB 1YJRA 3N28A 4C8KA 3SCJE 2F7VA 3DLHA 2E9RX 3QJPA 4NPOA 2DH7A 1EP4B 2C2DA 2FC9A 2AGQA 2R7UA 4YP3A 4DN9A 1IUJA 3G9CA 3TO8A 5F9NA 1XR7A 3PFOA 4KTQA 5E3CA 2MZJA 1K1SA 2P9EA 3SCLE 3NG8A 5F8GA 3MF5A 4DSIA 3IWNC 2K1RB 4PG7A 1U1RA 1UVNA 4C98A 3GR0A 4M95A 3QGPA 4OI3A 2B6AB 4J9MA 1DZ5A 1R0AB 2C42A 2NUUG 4HTIA 2XSJB 2ABYA 1I1GA 3IO1A 3N4WA 2DGSA 5GAGI 3E2EA 2UZAA 2W25A 3M30A 3VZHA 4I6YA 4NLOA 2HS0A 5EWGA 3VAJA 3T3FA 4YB1P 5DQGA 1DRZA 3DYAA 1QY7A 4U9RA 4DFPA 2HHVA 1SV5A 4QIGA 1HBUA 3CSKA 4OHVA 5CH7B 4LIRA 4NZ7A 3PIOQ 3BSOA 3IAM9 3DGPA 3CB4A 2VD3A 4PXCA 2VASA 2DR8A 1G1XA 5DJBA 1R8CA 1RDRA 4ETXA 1CPZA 4LVNP 1TKZB 4ZHRA 3CPWR 2WB1D 3U1LA 4MTPA 3S6EA 4B9TA 1H6KX 5LJ3Y 4NLXA 3TANA 2JLFA 4QWEA 5LSOA 4RW4A 2XI2A 1VC6A 2EFQA 1HQEB 3T9ZA 4PRFA 3OTBA 4G1QB 5EX0A 3ICLA 1S1XA 2KG0A 1YGYA 2GMJA 3EZUA 4C0BA 4DR4F 3KK2A 3HKZD 1S6QB 5A8WA 3V6JA 3RRKA 3N6LA 4LIWA 3T5KA 4ZPVR 1NHVA 2JZ5A 3ZZZA 5A6PA 3CDWA 1S1WB 2BABA 1DAXA 4QOTA 4YOEA 2Y1JA 2BQRA 3E51A 1D9FA 1N32F 3M9NB 4FBTA 2UVRA 4OIXA 3H2LA 4XPCA 1S1VA 2IBOA 2JVRA 3QIPB 3GMGA 2MQOA 5DLFA 1UVMA 5HMXA 2QFJA 1H3DA 4ECTA 2AYMA 2IJFA 2IMOA 3M1VB 1L3TA 3QJLA 2WRMA 1Q81T 1P27B 1E6VA 4ZP7A 3M2VB 3R5DA 2RU3A 3G6VA 1HWKA 2HMIB 3PR5B 1NEEA 4EO8A 4YR0A 4LVOP 3Q8PB 4BCAA 3PM9A 2CQPA 2LXIA 2W9CB 2GMHA 4CI0B 4UUXA 1RT7A 1GAOA 1NKEA 4QIEA 2MY8A 4CCHA 3R3TA 4I67A 3C6UA 4R8UA 4KBIA 5DDOC 1DTTB 1WF0A 1HMVA 2WCXA 4JV2A 2RS8A 4WZMA 2OKQA 1TVRB 2B51A 2I38A 3JTNA 4JV0A 2I5JA 4QCLA 3CDEA 2ADBA 1VQ7S 5BYSA 3T1HF 1FRIA 1RT3A 4QYZJ 1ZETA 2DNLA 5KFQA 2QIFA 3W2WA 5KFKA 1FRJA 1OO0B 2QA4S 5IT9Y 3FFIA 4X4QA 4DV5F 3N6MA 1H7WA 2FJDB 2GJ2A 1HW8A 1KLMA 2HIQA 4OHXA 3G8TA 2MZQA 3DLLQ 4ES2A 3HHLA 1P1LA 2V8DA 5IWAF 2B4PA 1HBMA 3R27A 1VMBA 4DL6A 2R7VA 3NGDA 3K8VA 3CCWA 4WYLA 2WBRA 3MR3A 2AD9A 4WKRA 2Z8QA 3IGNA 2P6SA 2JEFA 2UV8G 4JV1A 3PZPA 2M3DA 4CO2A 4B17A 4IOBA 1C0UB 1KVIA 3M4XA 1SH2A 3LPYA 3NWGA 1U6ZA 2BACA 5DDPC 2J6TA 4L72B 4RNMA 3V6DA 4M63A 3NAHA 3TP2A 1VQ8S 4LSNB 4B3OA 4O44A 2ASYA 1FDBA 2VUGA 5CZXA 3B4DA 4NA3A 3KLFA 2XI3A 3T9NA 1GX5A 1FNOA 5C25A 2GV1A 4X4TA 3PW7A 2YKNA 2UXCF 4KR0B 3RR7A 1KEKA 1ZZFA 1NK0A 1BD6A 3TRGA 3BSCA 4ZP6A 4AXJA 1ZM2A 2FHOB 1T7PA 1T03B 4DFKA 1DARA 2K3IA 1FERA 2VKZG 1SJQA 5DDRC 2KT5A 4FP9A 2YNHB 1M5KC 4NLPA 1RTJA 2CQBA 4KIAA 1Q78A 1R7IA 1RTHA 2IFXA 4ICLB 1LK5A 2J6UA 1R89A 2DO0A 4Y2AA 2ROPA 4YDDB 4OHYA 4RW6A 1Q4RA 2JEIA 5C42A 1HPZB 3FMWA 4ZKAA 1XK8A 4N76A 4N77A 1S0OA 1PC4A 2E1RA 4X4RA 3MMBA 3IBWA 1ZAXA 2SXLA 1N5SA 2PO4A 4W90B 4MAKA 2CQHA 3S1TA 3OJSA 3RW7A 2M52A 1N6QA 5J1EB 2BANB 4ZDNA 4Y2IA 3DLKB 4LFAF 1XTZA 4A8MP 1BQMA 3DOKB 3PW2A 4IH7A 4RU9A 4DF8A 1KSPA 3HVWA 2EFNA 3G6ES 3MM9A 2KI2A 2M70A 2M7SA 4BBYA 3KLHA 2D74B 3OVSA 3V5RA 1BWEA 2DH9A 2LLZA 5AXKA 3H59A 3N5FA 4C8LA 1KVJA 1F5CA 2HWIA 3SMZA 2ZH3A 3MECA 3UNGC 1HNWF 3OTCA 2CPHA 2DGWA 1JJ2R 3QWUA 3HJFA 3O1LA 2RF2B 1KHWA 2RNEA 4IR9A 5HLFA 3LAMA 1RAJA 2FD2A 2L9DA 3HLUA 3I4PA 4U7UK 2MHNA 2ZUGA 1JLAB 5E3QA 5LMUF 2JEJA 3CJKA 1A9NB 1QTMA 1QM9A 2O5DA 4DG1A 4I2PA 4EUVA 3O44A 3OW2R 1DLOA 4QIFA 5LJ5Y 1TV6B 2VL1A 3M8QB 3J81Y 1EETA 4TQRA 3MI7X 4HYKA 1XNQF 1U09A 1KQFB 4G1PA 5L1KA 1KFDA 5HO4A 2E5JA 4OX7A 2VG7A 2K7JA 5B08A 4LSLA 2MSSA 3BQ0A 4DV7F 2FHJA 1HARA 2ZD1B 4HHJA 1CSJA 5FDLA 4AQYF 1UAWA 3GR1A 3AHPA 5G0RA 3PV8A 2E1CA 1NJIT 5KFPA 2HHUA 4YHHF 2R7RA 1SIZA 4DQPA 4NX9A 4A46A 4NCAA 3T19A 1MU2B 4QIWD 3GV7B 1H2VZ 4Y3CA 1XERA 1UVJA 4PQUA 2JC1A 1VRTB 1IBKF 5JVHQ 4DSEA 2RUGA 2E5HA 1MROB 2VH7A 4GC7A 4DS5A 1S76D 4LFBF 4NRTA 2VBZA 1C0TA 4DUYF 3QLHA 3BQ2A 1X0FA 2KM8B 3JYTB 4C8OA 4C11B 2OH2A 4YMEA 5KT7A 2AQ4A 2LYVA 2IBKA 1FO1A 1B0TA 2ZC4A 3KMQA 4ZP8A 5KFMA 3DI6A 4X4SA 1VRUB 3CDUA 2VOOA 4ZPBA 3D1OA 5D4PA 1VBXA 2HFZA 4JYAF 1Q8BA 3M8PA 4F4YA 1B64A 4RLEA 4KGMA 1N36F 1FJGF 4NYPA 1M5OC 2IVMA 3LF0A 2HPUA 3GZ7A 4FYDA 2A1BA 2MKCA 4OJGA 1RT2B 2OJ3A 3CULA 2IYIA 1JLQA 3M2UA 1ZH5A 1PSDA 2XNQA 4ZPTR 3GIMA 3HHDA 4GO5X 1J5OB 1IQTA 2BZ2A 2YWKA 4I64A 4IFVB 3CVKA 4FZVA 5D3GA 5I3UB 2U1AA 2KRRA 3IS9B 3D54A 5AXLA 3E8OA 2BBEA 4NLUA 4XPEA 3OLBA 1MNEA 1SJ1A 4YR3A 4C9DA 2KDOA 4QQBA 3EZ5A 1BQXA 2DNRA 5F8HA 2A18A 2NXUA 5AXNA 5L1JA 4OFZA 3B78A 4KT0C 5DG8A 4LF4F 3KK3A 2Q79A 4FXWA 2WW8A 2J9DE 1WF1A 1IM4A 5A0YB 3EGNA 5KAKA 3C6TA 1IKWA 5SUHA 2QEXS 4B9LA 1B7FA 1RK8A 3DXBA 5AE3A 4A8WA 2E5IA 2IVYA 4OZ0A 3NNAA 1U6BA 1GTEA 2B3TB 1S99A 1HBOA 2QLXA 2DHSA 4PWDB 1S1TB 3OFGA 1Y5LB 4DSLA 3GILA 3KG0A 3SQGA 1LKZA 4YB6A 2DNYA 2MMYA 3VF0B 2MXYA 3OPKA 2AF6A 5GVQA 2EC0A 4AFFA 2JH3A 2YQ3A 4DOZA 4K50A 3R5CA 2D3UA 1Z2ZA 3I0RA 3OUYA 1DQ9A 1HW9A 1YG0A 2B5JB 3VQTA 3DLGA 4ZA1A 1KD1T 3MFHA 4MFBA 4ES1A 1YIJS 2NSCA 2QO3A 4CTAA 3CC7S 3I4HX 4Y65A 2JL9A 2EFVA 3JSMB 1T3NA 1RA7A 4QW8A 4FF4A 4OHWA 4OLOA 1TL1A 3Q2SC 4R0JA 3UE2A 5KFWA 3MR6A 1N5YA 2CYYA 2J8AA 2PFFB 4N56A 4AYBD 2POKA 5I42B 4Q2MA 3EX7B 1FJ7A 1WI8A 2VG5A 2R7QA 3MM5B 4USJC 4ZCKA 1Z1ZA 3T1AA 3U7JA 2LEAA 2IM2A 2KXHA 1JLFB 4O4GA 3FCHA 2HNZB 2RDIA 3TARA 4Q0BA 2ACYA 2HRYA 1QVFR 4KHMA 3QAUA 1AUDA 4MYTA 1FVQA 2VONA 2XMVA 5L9XA 3G6YA 4Y2KA 1HYSB 2VG6B 1FDAA 1X5TA 2MY7A 3GYNA 2XG8A 3NCPA 3HHNB 3D5MA 3HZEA 3DM2A 2ZHAA 6FD1A 2HVZA 3TX8A 4PUOA 3GV8B 2ZZNA 4ID5A 4G6VB 2F8HA 3C66A 1UW4A 2CQ2A 5HROA 4LF9F 5M2RA 1AW0A 3PVXA 3AQOA 5K14A 2V2KA 2FGCA 3QMQA 3M32B 4LQ9A 3I0SB 2ZNYA 1FDDA 4I68A 4RZRA 2DRAA 3IXQA 1G2EA 2RJZA 3J7Z5 5KFBA 3VZIA 3V4IB 2RE1A 4DV6F 4IO1A 1Z2LA 2KM8C 1JLGA 3HX9A 2J76E 4Q45A 4FS1A 3MFIA 2XLIA 4DSJA 4OI1A 2ZM6F 2G1DA 2BUNA 4LF8F 3NLCA 5KTQA 2WHOA 3ISND 5MAOA 4PXEA 4KGKA 4DV1F 2VFSA 3P6YC 1WD6A 2RD5C 1R6YA 1WWHA 2KO1A 3MM6A 4UW2A 2VQFF 1NK9A 4DF4A 2VBXA 4X66F 2BQUA 4DJBA 2L9NA 4CO4A 2XWYA 2L9WA 3K58A 3BDPA 3Q8SB 3BGUA 3IR5B 3BF4A 2RSQA 2R2TA 2BW2A 4KFBB 5DLGA 1S6PA 1V6HA 3NBPB 4CH0S 5HMYA 4M94A 2C22A 4BWJA 1QAXA 3KLVA 4CO0A 1LW0A 1UWBA 2V8GA 1X4AA 1HQUA 3CCRS 1T05A 3DU6A 5L1IA 5CCLA 1APSA 4GO7X 2ZH4A 1HBNB 1TKTA 2WK4A 4IQXA 3D28A 3L7OA 4C97A 4RUAA 3BZQA 2NPIA 3DHWC 4A8FA 3MMCB 3OXLA 4MKYA 2OFHX 1FESA 5B0BA 1H7XA 1O8BA 3MMJA 4E8UA 4PWUA 5E41A 4FXVA 1SKSA 3I5AA 4ILMA 2GCFA 2X1BA 3F56A 5KFIA 3POTB 4I1TA 2JX2A 3H20A 2F40A 3LALA 2MGZA 3SV3A 2UV8A 1S6UA 4LF6F 1Q79A 1I6JA 3ZZRA 2XEXA 1DJ0A 1VIXA 3NAIA 4MIBA 5KG6A 3I56S 5LMNF 3SYZA 2FJXA 2OTJS 1TUVA 5DGBA 2EK1A 2NQPA 3IG1B 1Y7PA 1I