2UUBF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uubF00
4LF7F 1F60B 4X65F 1N32F 1FJGF 5IWAF 4LFCF 4DV4F 3ZZPA 4NXNF 1CQNA 4DV0F 1LOUA 4JI0F 4X62F 2UXDF 1IBMF 4JI6F 4DV6F 1XMQF 2YY3A 1G7CB 1XMOF 4DR1F 5LMNF 4DR3F 4LFAF 4DV5F 4DR7F 2KJWA 2B7CB 4DR2F 2UXBF 4JI2F 4AQYF 4K0KF 4B3RF 4JI1F 4B3SF 4GKKF 4LF9F 4JI8F 2UU9F 2VQFF 4JI3F 4LFBF 1N36F 1IJFB 2BXJA 4DUZF 2KJVA 5AJ3F 2UUBF 1QJHA 2UUAF 4X66F 3OTOF 1IBKF 1HR0F 5BR8F 1I94F 4NXMF 4B3TF 4YY3F 3R3TA 1HNWF 5LMUF 1N34F 2VQEF 4LF5F 4KHPF 4JI5F 1GH8A 4GKJF 4JYAF 1IJEB 2F4VF 4JV5F 4DV2F 1FKAF 1XNRF 4DR6F 2RJZA 3T1HF 2B7BB 1HNXF 4LF6F 4JI7F 4YHHF 4DV3F 1HNZF 2UUCF 2UXCF 1B64A 1N33F 4DR4F 2HHHF 2J5AA 1J5EF 3T1YF 1XNQF 4LF8F 1RISA 2BVZA 4OX9F 4DV7F 1IBLF 2ZM6F 4DR5F 1VMBA 4LF4F 1G1XA 2E5LF 4B3MF 4JI4F 4DV1F 4DUYF 1CQMA 4X64F
chains in the Genus database with same CATH superfamily
1K8AT 4DV6J 3ELHA 2GGPA 3MM7A 4DV4F 4UF4A 1FWPA 4OI4A 2KDOA 2MQPA 3HSDA 4CI0B 2CNOB 3MCNA 4ZPWR 1S1XA 4IG3A 2HKEA 3BSCA 3UCUP 2UV8G 3R6LB 1AZSB 2P6SA 2J9CA 2E66A 4W98A 2HVHA 2CQ1A 1XR6A 2GVDB 4BC9A 2AJ4A 4EYHB 2MZJA 2RU3A 5K9FA 1CS4B 4ECZA 3P5BP 3P45B 4OHZA 2UUAF 2Q6BA 4PRFA 1JQGA 1IWGA 4K2XA 4NZ0A 5A0YB 3KLGB 5LMUF 4NASA 3PKMA 2DY1A 2MZQA 3CB4A 1KOOA 4OJHA 2PT0A 3MR6A 5L8RC 1KEKA 3G82B 2OI2A 2MKJA 2BJ7A 3C2PA 2KM8C 3PKYA 2B43A 2FGCA 1L3TA 5KFGA 1J27A 4ZCIA 1VQKS 3V81A 5IT0A 4LF2A 2RS2A 5F9NA 2CIMA 2K3KA 4YR0A 1RACB 4CDIA 3I56S 4OX9J 3R8YA 3HVTB 1S12A 2HSEB 4JI4J 2WBMA 1TKXB 2BZ2A 2BV3A 4RNFA 4IUFA 1UTAA 4AL5A 4OI0A 1LWEB 5JVGQ 3SV3A 1ZBTA 3JTOA 4ER8A 1YJWS 1H2UX 2LXIA 3NMAA 2WVEA 2HHWA 1TK5A 4WBFA 3LPEA 4ES1A 1GX6A 3W9JA 4RO0A 2DGUA 5DQGA 2IAJA 1S9EB 4LF5F 4KV8B 1N0UA 3BDPA 4IFVB 4DV3J 3OVSA 2YH0A 1KVKA 2D9PA 3KK1B 5DM7Q 2CQ3A 1RT4A 3MWBA 2JH3A 4LR9A 5AXLA 2J0SD 1XERA 1KP6A 5F8JA 2IMWP 2EFNA 1N33J 3H0PA 1HHQA 3GFHA 5CYMA 2JL9A 3SDEA 2K7KA 4CO5A 2O5DA 1U1MA 1F60B 4DXLA 1UPMB 3PO4A 5J2PA 2PMHA 3MGJA 2CDRB 1RWWB 2RQ4A 1S79A 3TUPA 1OY9A 4RNMA 3GZ7A 3HKWA 2FGOA 3E01A 1X9WA 4K4UA 3DNCA 3KOAA 3ET6B 1U1LA 3G6ES 1U7LA 1C2PA 4I2QA 5AJ3J 3UVJB 2IJRA 2RF2B 3IN5A 4O0IA 3ITHB 1RHQB 2KXNB 4ZVFA 1SJ4P 4Q8FA 4ELTA 2DXEA 1UW9A 1PYSB 3TZYA 4OZNA 4IOBA 1AFJA 1F9EB 3OXGA 2DCUB 1Q7YT 3VGVA 4XDCA 1FKOA 2RD5C 3OSNA 4ZJQA 2WAQD 2EC0A 3I0SA 4OX8A 1T02A 1VBKA 4LBIA 1SQFA 1HQEA 3IAM9 5KFKA 1FJEB 3RB3A 2GA7A 4FPIA 2OMLA 1B0VA 1PJ7A 1VMBA 4PYDA 1TKZB 2EG2A 4FBUA 1YJNS 3KLFB 5HROA 3VAJA 1OY8A 4FF3A 1X5TA 3NCRA 1PO6A 2HFVA 4NYZA 2A10A 3VAFA 3BBFA 4XPCA 4GKKF 4ZHRA 2BBEA 3NWGA 1NLKL 4CQ1A 1U2RA 3BGUA 1J5OB 4I69A 2DXDA 4NMLA 4KTQA 4YY3F 2DHHA 5LJ3Y 3PYEA 1IKXB 1RB0A 4P71A 5HVFA 2GVZA 3MM9A 2VDHA 3JB9k 4ZVUB 4ES3A 4BBYA 3W3SA 4UUWA 2B5JB 4TQSA 4JV5J 3TWZA 2B9YA 2XI2A 2W2NP 3HFKA 1SJQA 5LSRA 1SIZA 1YJ9S 2DNYA 2R42A 3AHPA 2YKMA 5K8MA 4QCLA 3MD3A 1QAYA 1ZAWA 1XNQJ 4Y2IA 1OPZA 1J2VA 2C2OB 3M1VA 4N47A 4C8LA 1QSLA 3LANA 3W9HA 2P6TA 4I2PA 5JUMA 4M5DB 2CPIA 4C2MA 2ZBQA 4ZOSA 2OELA 3ZZYA 1RWXB 4UZCA 4RU2A 4NLRA 1S7IA 4K0KF 4EU0A 1RT5A 4JI8F 2AEMA 3C6UA 2HZCA 1JLGB 3HLUA 2XMAA 4X4TA 1TR0A 4LMZA 4CTAA 2IM0A 3NGTA 1WF2A 3UDLA 3DOKB 2D3O1 4OYZA 2KT2A 2LQJA 4KFBA 4DUZJ 2HS3A 2ZH5A 3W8GA 1HNXJ 3NBPB 5LM7E 1VOMA 1IR0A 3CJ3A 2ZJRQ 2GJFA 4L73A 1NZ8A 5DDQC 2CAJA 4DR4F 3M8RA 1ICEB 2V69A 3H5UA 1OWXA 1UCNA 4LF4J 4WXWA 4HLBA 3T1YF 4ZVTB 3FSIA 1UEKA 1S1XB 8RUCA 4IG3B 1HWUA 2H5JB 3HULA 3C14A 1QAJA 3IWLA 2KHCA 4DL0C 3BDEA 2W8LA 4DF4A 2MKSA 4Y34A 3ZZOA 3EM1A 2ZFHA 4DV6F 3MTKA 2CPFA 3VR1A 3CDBA 4NLUA 3BGFA 2ACYA 3I4PA 3CC4S 2E5HA 4JI3J 3Q22A 3DLJA 5KFZA 4NLVA 1LK7A 1SJFA 3ZFVA 3QGGA 2QYGA 2DNRA 3I32A 2Q3PA 5KFSA 1AFIA 1HNIB 1MN9A 4PQAA 2Q66A 2K8GA 3D1HA 1MMLA 4ZJLA 4BS2A 1FRMA 2OSQA 3G86A 1HWIA 1RZMA 4JV2A 1IQTA 3G6XA 4X4RA 1TKTA 4KGZB 2KI2A 2K06A 3HJVA 4M5NA 3HD1A 1LFPA 3UE2A 1RTDA 1YBTA 2CQIA 3NG8A 2IBKA 2CWKA 5D0HA 4Z37A 2E7WA 4Q2LA 2RDJA 2EW9A 3OFHA 4MK9A 4RBTA 2C2NA 4DV5J 2RVJA 2Q79A 1RT3A 3CCTA 2I0XA 1I5OB 3I5CA 1VK3A 4WFZA 1S5ZA 4IO9Q 2H51B 2IAJB 3F44A 1RXOB 1UAWA 3HHLA 1HW8A 5KG0A 1RT4B 5JVHQ 3CXCR 3ETMA 3EUNA 1X4BA 4PG7A 3J80Y 3JXOA 3E51A 4ZLJA 3ZNUA 2V50A 2MHNA 3W60A 1QSYA 2IJNA 2L3MA 5CYMB 3SDEB 4DV3F 5B0EA 1CJUA 1RT6A 3OTDA 4OZ1A 2YVSA 5J2PB 1U09A 3EVMA 1RYSA 2MKCA 3R5CA 1I6JA 1SC1B 4NXNJ 3GMGA 3LP0B 3CW2C 3DYAA 2ZDOA 4I2QB 2XG8A 3OR1A 4OZ5A 2O67A 2R8HA 1MU2A 5EHHA 5K8NA 4EYIB 3M6VA 1SH0A 4DR3F 1N5TA 4LF1A 1AUSL 4KB7A 3NS6A 4Q5VA 2HHXA 1FKOB 4L6V3 1VJWA 3QRQA 2G9OA 5AJ3F 1P9YA 2DNQA 1HQEB 1BWVA 5IS2A 1JIHA 1IKYA 1QAXA 1GX5A 2ASYA 3QFHA 2CKWA 2V8VA 1XNRF 2VJVA 2M4MA 2HK3A 3H40A 1B7FA 1C4AA 4P72A 4PWWA 2OEMA 2IDEA 2B8QA 2WW4A 3RUBL 5HROB 1SB6A 2BANA 2XMJA 4NCGA 1D9AA 2ZH8A 2DIUA 3DLEA 1SQGA 1YJ7A 1YI2S 1VQPS 1X4CA 3PFOA 4KGKA 1W7WA 4ZP6A 2XB2D 3AT1B 3LWLA 1GEHA 2XSFA 3PRVA 4CNZA 3PYGA 2BEFA 4USMA 1NK0A 4CWBA 2DGSA 3F0NA 9RUBA 4LF9J 3UWTA 5F9LA 4C97A 2C2ZB 3D6HB 2R8IA 4NLGA 4YDXA 1FRIA 1RWVB 4AYBD 4F3OA 2GVZB 5GMEA 4MIWA 4B9TA 3CCUS 4HHHA 1WACA 4DEZA 4YP3A 1ZTWA 4QYZK 4J91A 2WVBA 2V6AA 3Q86A 4IR9A 2GAHC 1KQFB 1XEZA 2EI5A 1RAIB 2ILYA 4UOGA 3KLEA 3OFEA 5D3GB 3IBFB 1N48A 3V6HA 3OBIA 1JKHA 2IA0A 4PXEA 2M70A 4IG0B 2W9BA 3IS9B 4ZVOB 1PAEX 3KKFA 4YHHJ 2J7WA 2VJUA 1PSDA 2B8PA 3CCLS 4DX5A 4GC7A 1X4HA 2OD4A 3G8TA 1VISA 5B0AA 2PO4A 3PG9A 3R5BA 5KFHA 4RNHA 2MXYA 4ID8A 1C1CB 3HSGA 3BGRB 1RT5B 3C15B 5A6PA 3CCJS 3V5RA 2DO4A 3C6UB 4Q7AA 4G1QB 2KZMA 1YWXA 2E5IA 1UVKA 3OUYA 4ZVPB 3MM8B 2GQ2A 3J81j 2Y1RI 3BH6B 3W2VB 3D7SB 2ZUGA 2VONA 3M2RA 2UU9J 3EZUA 4LFAF 1RTJB 3BREA 2JFDA 4ECQA 2VZ9A 5CD4H 4B3SF 3EDRB 3FZ2A 4EUVA 2YBVA 3W63A 2XMVA 3QIDA 1SUQB 4PWDA 2CPYA 2UVRA 2WCXA 2NZ4A 5AXMA 1HNXF 4F67A 1RHKB 2CQ2A 3J7YI 1R0AB 1M5SA 1M5KC 4QIVA 4LF4F 2EXUA 2Y1IA 2V2KA 3PR5B 4DLEA 1ZAVA 4FYWB 1N6QA 4UOFA 2PN6A 2RDIA 3CIZA 1LOUA 3TAMA 2UVWA 4DFMA 4OZLA 5KFQA 3HI9A 1FNMA 2B7CB 3CCES 1U24A 1CULB 4JI3F 3HSZA 2CPXA 2B3TB 2FVPA 4NLWA 4CM2A 4AE5A 2ALZA 4PQUA 3NNHA 5BR8F 3W61A 3C46A 1TKTB 3J80U 4V19J 4YN3B 5JJBA 3ISND 4RUHA 2JEFA 4O3PA 3DHXA 3NY0A 2RJZA 3OL9A 1SKWA 4B9VA 2M2BA 1WKKA 5BYRA 1C1BB 4M5HA 5LSOA 1REGX 1OS5A 3IAS9 2ZNZA 3GIRA 4WXOA 2HAFA 3L4BC 1UZHA 1EQMA 2HGNA 1R7IA 1RT3B 3FSXA 4WFYA 5J2MA 1CJVA 2V5HG 1H74A 2XZWA 2XY7A 2GQQA 4U8VA 1W25A 3ADAC 1B4SA 2ABYA 2BJEA 1WEZA 1HBNB 4LIWA 1YRXA 1VIXA 1S72S 2ZC3A 2CQDA 4PXCA 3ZZ0A 1S77D 3AQOA 3HHLB 2OH2A 2VF3A 2H5EA 1OMSA 1F1BB 4ZPVR 2R8KA 3PO5A 3UO0A 3HZEA 3TX0A 2NSBA 4DV5F 1PILA 1YQHA 3O8WA 3KJFB 1JXEA 2LQ8A 4CCHA 1FD8A 4MK8A 1GXUA 3AB2B 2MZRA 1HNWJ 5E3CA 5K14B 1QJHA 2AW0A 3IFEA 1RAAB 1CJUB 3NKYA 2OHDA 4CLLA 5T41A 3GJRB 2QFIA 4J90A 1Q86T 3OR2A 4IH5A 2OP5A 5BYSA 1RP5A 1Z2ZA 5KFJA 4OJ3A 2KYZA 2NXNA 2XNRA 3TP2A 2EFPA 2WOMA 3VZIA 2V8GA 1N8RT 1GQEA 2VC1A 3OR1B 5HI7A 2CZVC 5HQMA 4ETZA 1X8DA 5HP1A 2PI5A 4KGXB 2WSFC 1HHTP 1YBAA 2ASDA 4LFCF 2R2TA 1JLCA 4NXNF 1HIYA 5KG4A 3Q8YA 3VALA 4WIIA 4URQU 1Q5VA 2FUG9 5CABA 3FBBA 4RW8B 4RUAA 1U1QA 4P6QA 1GNKA 1NKEA 4P10A 4HYKA 3L3CA 4KY3A 1IKYB 3LH2S 3UR3C 4OLOA 4EWTA 3MECA 4Y2AA 3M8PA 1L5UA 3FMBA 2XCPA 2DNHA 4UT4A 1HKAA 2W01A 5E3QA 4DPTA 3M6XA 2BANB 2HQFA 3KLVA 5HBMA 3IRXB 1VR6A 4K4TA 1J5EJ 2RQMA 3QGPA 1VQ9S 4ECXA 1LW0A 4KPYA 5A8WB 2HFZA 2QEXS 4L74A 4KQZA 4DL3A 3HT0A 3A8KA 4DR5F 2MGZA 1GT8A 3QBCA 3D6MB 2V4JB 2ZHAA 2C2KB 4YS2A 2E44A 2DCLA 1JNZB 4WFNQ 4CLSA 1M1GA 4C9DA 4C11B 4F3QA 1RWUA 3NS5A 5F8HA 2HVZA 5KOWA 3K5NA 4FYVB 2DNMA 2L9WA 4LF9F 1RA7A 4DZ6A 5C24B 1PCAA 4YB5A 3KLEB 2HNDA 2VOPA 2OPPA 4NI2A 3CJ5A 2F4VJ 3LUYA 1YJTA 1WC4A 1X4EA 2W9BB 4KHPF 3PEHA 4DUTA 3N6NA 1TK8A 2ZH4A 2HMIA 3HX9A 4ETXA 1U4BA 1JK9B 5D4NA 4YB6A 3D3CJ 4BHQA 1TVRA 2V9KA 3I55S 1TMJA 3PZPA 2D3UA 1RBAA 2LXUA 2OSRA 4CM0A 5E41A 4A8XA 1NXIA 5IV3A 3AOAA 3NEKA 4LRBA 2B9XA 2XLIA 2JFKA 3OUYB 2QA4G 1JLEA 4X4UA 1F9HA 1B70B 2IM2A 1YKWA 3MEDB 3T9ZA 2UUWA 2ZVSA 3GFYA 3T5HA 3CCZA 4X62J 1UVMA 2KM8B 5ETMA 2DTJA 2UU9F 2AEFA 2QZ8A 3M9MB 2ZH3A 2AYBA 3Q24A 2HYIB 3QQCD 1DLOA 1S4EA 4NPOA 4OYMA 3KJQB 2XTJP 2FLOA 3ILIA 1LV5A 4OYPA 2J9DE 1OO0B 5D15A 4O3OA 2HZAA 1N6QB 3I5AA 3VQSA 2CFXA 2A18A 2HS0A 1X0PA 4DQSA 1RCOB 3PXGa 2GX8A 1T0TV 2RQCA 1VBZA 1VC0A 4LF7J 3ZNJ1 1N56A 2E5JA 1WG5A 1LWFA 2JC0A 5CYQA 1RT2B 3BB5A 2J6SA 4OV6A 3M8ZA 2OLWA 4ITSA 2P9CA 4PQUB 1NJYA 1XJWB 4OHYA 3KJVA 2HHTA 4PXBA 4ZK7M 5GAGU 4RW7A 5L9XA 2HPUA 1IJFB 5DZ7A 5DETA 3RAXA 4NEZA 1YITS 2YNHB 2AYMA 4NXMF 4CLTA 3C6TB 1NSKL 2KVIA 3DU6A 3DRSA 5C25A 4V1Ak 4CH7A 2LVWA 1HNZJ 3A13A 5RUBA 4OZJA 1YLXA 1OQ6A 3BKUA 2N3OA 1T7PA 4H4MB 4QYZJ 5KFVA 3OL6A 1H6KX 4G65A 2HNZA 1U2CA 5F0UA 1U1NA 1T03A 1S57A 3EXCX 3QMQA 1B7YB 4ZCLA 4HR2A 3PYFA 7AT1B 1MN7A 2FHJA 1RWKB 1Y00A 4BDPA 3S8SA 2ZNYA 1P27B 2XCAA 2RQKA 3B4MA 5C7PA 4ZIWA 1VYAA 3BGLA 2EPIA 2CPHA 3LF0A 1KN6A 4LSNA 4NA2A 1JJ2R 2YQ0A 5J1EA 2XWXA 3RW6A 3PIPQ 5GMDA 1QTMA 1URRA 3MEKA 4ILMA 4AFFA 2CXEA 3R97A 1HNWF 4DL4A 1AT1B 3TJ9A 5KG3A 5SZTA 2IA6A 5HP1B 3BO2A 8AT1B 4AL6A 1F3VA 1YDLA 3GP9A 1KR4A 3AB4B 3AJDA 5HVHA 2EFGA 4NLXA 2J5AA 2GFFA 1IXKA 3QJLA 3OT9A 2QMWA 2RE1A 4N8NA 1HWJA 3D9BA 3GQCA 4R0JA 1RKIA 5KT6A 1VBXA 3AJ2A 1T8EA 5GAHI 2MYFA 2EBEA 1PYOB 5J2NA 3MECB 3DLKA 2BRKA 2PDAA 2D3ZA 3VHQA 4F4WA 4A46A 1JB0C 3E8OA 4N77A 4ECWA 2QFJA 1TU0B 1NDCA 2ZBCA 3VGTA 2YQ3A 3QLHB 3R9LA 4JYAJ 2E29A 2KYXA 1LW0B 3R3TA 2J6TA 4A8MP 3CJTA 4K5RA 3VCDA 5D4OA 3VGSA 5SUHA 4IQMA 4ES2A 2HW3A 4C3MA 2MGZB 1V3SA 2IY5B 2BYCA 1WTBA 2HVDA 3TJAA 2RKIB 2CNLB 5I42A 5IT9Y 1UP1A 4I56A 1J5EF 2GW8A 2B4UA 5DLFA 1NUEA 3MZIA 2VICA 2ZOMA 5LOQA 1SPBP 2FJEB 5KFBA 4LVOP 3JSYA 4LUBA 4OZ2A 4KO0B 4NLSA 4F26A 1ZM3A 2R8JA 4LRCA 1WI6A 3UD3P 5I3PA 2FJAB 2HNDB 4GO5X 1ZH5A 3R27A 3EGZA 5KTQA 1A6LA 1SC3B 2OPPB 4NI2B 1DAXA 4Z7YA 4Y00A 1ZZFA 2KXHA 2GJIA 3RB4A 2AT1B 2HMIB 4A8FA 4QIGA 3TVZA 1ZPVA 5DDPC 2VA2A 3FEXB 4X4VA 2WB1D 2GQCA 2W2MP 5M2RA 2E1CA 3GWCA 2F4VF 1XC9A 3MR3A 4EZ9A 1F9FA 3OD2A 1S9GA 2KXFA 2HVIA 4F02A 1K0TA 4PCQA 3I96A 3ETOA 4KE5A 1GAOA 1UEVA 3JSMA 1KS2A 2M8HA 3OPKA 4XIUA 5KFLA 3H2UB 2IC3B 2AJ1A 4CT8A 2BRLA 1K44A 5DS7A 3MEEA 3KWMA 2X1GA 3GCXP 3AAWB 4A48A 1IKWA 1D0EA 2JDJA 4DZDA 1S1WB 2NUHA 2VFTA 1UEUA 2PD1A 5H9FK 3H90A 1OYDA 3D0GE 2M9KA 3JS9A 1S99A 3BQ2A 1FJCA 1NJXA 2UV8A 4CZCA 3PW0A 5L1IA 1URNA 1HI8A 1SL1A 3IG1A 4XTTA 4QW8A 4M95A 2EK1A 4JI2J 4JI1J 2W9CB 4B9NA 2BUNA 1WORA 2D74B 2YKQA 2BACA 4FYYB 3M30A 4Z7CA 2FY1A 1RHUB 3MMCA 1IUJA 3TUJC 1LWFB 4CLZA 5CYQB 1JXLA 3S7RA 3NAHA 2GHWA 3P96A 4HHJA 1VS3A 1ELOA 2XYPB 2V2QA 1YRTA 3HHKA 1GMUA 3U7JA 1WC3A 2B56A 2X7IA 4O44A 3MMAB 4LF7F 4TN2A 4JV0A 3T41A 4WKRA 3DI6A 4KIAA 1XMOJ 4PYAA 4I6YA 3GV5B 4NMXA 3LQVA 1NJZA 5LMNJ 1SV5B 2I6WA 3AXMA 3J7A1 1Q5YA 3FBFA 3M2VB 4HKQA 2NLWA 4OYBA 2YNIA 3UQSA 4ECRA 2DISA 4UW2A 2J9EA 2ERRA 3UNGC 1N34J 3P5TL 2VDIA 2VQEJ 4OI6A 5E33A 5CCLA 2GIQA 3OTOF 4OLPA 2XM3A 2QA1A 2YXLA 2DNPA 2K3IA 1YRUA 4R5PA 4OHVA 2UXCJ 2HNZB 2GS8A 3EE3A 2V8PA 1RKJA 2HQ3A 4CO4A 3BV8A 1HNZF 3K7RA 1H2VZ 1WD6A 3PJWA 4LR7A 4FS2A 5HANA 1FDAA 2MQQA 1RTZA 1V3RA 4PAAA 2XC9A 3G9CA 2D41A 4MIBA 1P1TA 2D1CA 4OHWA 5A2QY 3KDNA 4L76A 1S0OA 2YWHA 3MPWA 4ZVGA 4A8YA 4USTA 4W92B 3FCHA 4DPXA 3RTVA 4LSNB 2MKYA 5J1EB 2CA9A 5L9NA 3SXLA 3GCWP 2AGQA 2V94A 3MFHA 2Z56B 3G96A 2GHVC 3D67A 1OYEA 5CD4A 2DGWA 5HO4A 3CDAA 4CYUA 3K58A 4WF9Q 1Y7PA 1X4FA 3GPAA 1N88A 3QT5A 4YR3A 4CO2A 4HHUA 1FT8A 1H2TZ 7FDRA 4CO3A 2V0NA 4LF6J 3NOGA 3QFWA 1CJKA 1S1UA 1WHXA 4FNHA 3MM6B 4PPDA 4P7TA 1FVSA 2CVEA 1OIAA 1XN9A 4EO8A 3IGNA 4IYQA 6FDRA 1TUGB 4K7QA 3DLKB 5EX0A 3KG0A 5CHCB 1FDBA 2JX2A 1REVA 1XMQJ 3SCLE 1HNVA 1IR2A 1HQ2A 4DV1J 2KFZA 1UWBB 4UOCA 2MTLA 2EFVA 2F63A 2XLJA 3ZTQA 2H4YB 1AZSA 3MI7X 1YBUA 1SIWB 2BQRA 1R6VA 1JLFB 3DM2B 1O5JA 4NA3A 4TKTA 4C6AA 1HBMA 2VG7B 1VCTA 2GVDA 2OTJS 4WJBA 1HD0A 1W2BR 3HDSA 2F5GA 3RRGA 3OV7A 2UP1A 3GB0A 5KFTA 4ECSA 3VVUA 1NK6A 5A0YA 4DG1B 4U9RA 4HDGA 1FI4A 1FHTA 5EX3A 4JI7J 4JYAF 5HMWA 2FHOB 5E3AA 2PI4A 4MKYA 3DHWC 1C0UA 4DPWA 4ZIVA 4E98A 5IM0B 3ZTPA 4JI5J 4ELUA 1X5PA 4WE1A 4ED7A 4JB8B 2HHHF 4B9UA 3CE8A 1WWHA 2LP4A 4LIRA 3EMTA 3ZTOA 5LSLA 4RW6A 1FFGB 2BE2A 1NPKA 4J9OA 4J9QA 3M8YA 2COLA 4Y28C 3HVTA 3FBCA 2ZM6J 2MB0B 1BLUA 1TAQA 2RT3A 1PIEA 1NPRA 2GO8A 4TU8A 5B0DA 1Q1KA 1Q8LA 4J7CA 3R5DA 1SKUB 1LWEA 3N5FA 4X4PA 1U02A 2H3EB 2B6AB 4MFBB 2DNZA 3UDEA 1GXLA 3VGUA 3HFVA 2MKIA 1D09B 1S9GB 3VTIA 3KMQA 4OHXA 3TJ8A 4ZMMA 2QL5B 1HR0F 2W25A 2LMIA 2E1RA 3RGIA 3DDIA 2VA3A 1OJ4A 1T9YA 2KRRA 2XWYA 4IFVA 1W2IA 4HTIA 3SQOP 5DJBA 2KRBA 3D4JA 4HDHA 3PDNA 1WOSA 3UI3A 1YSJA 3CO0P 1SH2A 3MEEB 1FESA 4I6WA 2ZKUA 2WZ1A 2A2CA 4D3GA 2LXFA 2H1YA 4R25A 2LEPA 4C8YA 2FDNA 2XEXA 4IR1A 3TO8A 4C0BA 3C16B 5LXYA 2G0CA 3HVWA 7FD1A 3Q8SB 3BH7B 4QWCA 4ZKAA 4ECVA 4P2MA 2AIRB 1U8WA 2DR9A 3IG1B 5M2PA 1X4AA 2AQ4A 5ETOA 1D1UA 4O3SA 5D77A 4FVCA 1Q0NA 1NHVA 5DDOC 2BKNA 2WVFA 2ROGA 2RF2A 1PJ6A 1IBKJ 3HHLC 2QG9B 5KFAA 4ZITA 1I1GA 4B3OB 5THWA 3MMCB 1EZZB 3EPGA 3N0VA 2YWEA 1HBOA 4DQRA 2POKA 4W4MA 3DRRB 4KT0C 2MHEA 2DR7A 5I4MA 4WZQA 4CH0S 4EGLA 2W7AA 4CO1A 4H54A 3L7PA 4O44B 4ECYA 3CDEA 1MW7A 1VQOS 5K5MA 3DI6B 3CUNA 3HF5A 3PNIA 1KHVA 3MUTP 3SCKE 5LXRA 2M8DB 5F41A 4RWWA 3QWPA 1TKZA 1EAYC 3PIOQ 3SCJE 2Y0SD 3KLFA 2V9WA 3IBCB 2I38A 1FNOA 3K89A 1HI0P 2J7KA 2LA6A 4DSJA 3HMJG 2YNIB 1QD1A 4I4BA 5KFPA 4F04B 2CDQA 4ECUA 2QO3A 4DX6A 1RWNB 1XMOF 1WJ9A 4YQWA 2ASLA 3DOMA 5LMNF 5CCMA 2ADCA 3GG1A 2OIHA 2AJQA 3MD1A 2PEBA 3QZ8A 2AU0A 4RW4A 2IFXA 1X60A 3PJ9A 4WFBQ 4QOTA 3QIPB 1K47A 3MR5A 1K0VA 3OVAA 2ZZTA 3D54A 3R5AA 4J9MA 2QMXA 4BCAA 4IOAQ 1L3VA 1N34F 2VQEF 2AD9A 3H7HB 2DRBA 4WCEQ 2AP6A 2VIHA 4H4OB 2UXCF 2HK2A 2MJUA 2FD2A 1WC1A 1N5QA 2BDPA 1Y5IB 4ZN1A 1T9VA 2I9SA 3MCSA 2QMUB 4FVMA 4QBUA 2WHOA 4CLUA 1GFWB 2RDDA 2C3YA 2KN4A 3RZAA 1ZOTA 4OYXA 2UVVA 1N32F 2BW7A 4GO7X 2VBYA 4CYUB 3CD5A 4OI1A 3TUZC 5D8HB 5EWFA 3JQKA 4M1KA 3ZZTA 4M5DA 4DR2J 4E0DA 3DLGA 3UDCA 3K59A 5B09A 2C1EB 2EC2A 1DTTA 2H4WB 4B9LA 3BKFA 3TNVA 3X3UA 4ZPDA 3UFCX 1JLGA 1FXRA 1CJKB 4ZJOA 1KQKA 1FX2A 5J2QB 1CG2A 2MY7A 4C4WA 3NMRA 3SSSA 4UQGA 2IHR1 1X9SA 1CEZA 4FPRA 4RNOA 4FYDA 9ATCB 3MF5A 4Y2CA 5KG1A 4DPOA 2BMBA 5GAHU 4AT1B 2IMOA 4AXIA 2DITA 4LF6F 1UFWA 3OFGA 2CQPA 5L39A 3PX6A 3O5TB 4CH1A 1REVB 3WIUA 3F73A 1HNVB 3OTEA 1QY7A 2NUUG 1RISA 1S6PB 1EETB 4IRDA 1P6TA 4MIAA 3EZ5A 1FTCA 2MQNA 3CF5Q 4C8OA 4WK1A 1VFJA 3I0RA 4ERDA 1HBMB 1CC8A 2PEHA 4K4ZA 3CC2S 1GMWA 2LECA 3CMQA 3SFGA 1XMQF 4EMDA 3T5LA 3UCZP 5L38A 5L1LA 3I31A 2YKOA 1C0TA 2XYGB 4JI0J 2E1PA 2UXDJ 1R31A 2ZH1A 2A6OA 2ACMA 1C4CA 3W2WA 2YQ1A 4OX6A 3BO3A 1VHFA 2CG8A 1YJUA 1FD2A 1BQNA 4DCPB 2BJ3A 4PEOA 1FWLA 1HNIA 1C0UB 3HFZB 1EKSA 2W4PA 2XMMA 4N76A 3VF0B 2GHPA 5KFRA 1FVQA 4WE1B 4KHMA 2KTQA 4DL2A 4CLKA 2FLLA 5HMYA 1NDLA 3L7UA 1FKAF 2YWWA 4RW6B 1H7XA 3PTWA 2BKPA 3C8YA 4ZVEA 2DGOA 4JI7F 3WQPA 2BE2B 3CGIA 1RE1B 3N79A 4GRSA 4K4WA 1QM9A 5AE1A 4RKUC 3NGRA 1RT7A 3OXLA 3K5LA 3MUMP 1P9QC 5ETVA 1VBYA 1X5OA 4YDDB 2CJBA 2JNJA 1RWOB 2VHGA 2DB1A 2FZGB 2VUGA 3TZZA 2W1BA 3GIIA 4RU9A 3OW2R 2YY3A 4MJKA 4IH7A 4OI2A 3DGPA 2ZD1B 2KHDA 2J6UA 2VBWA 2VQFJ 4XDDA 5KG5A 4KKOB 3QSYB 2IVYA 3LGHA 3MR7A 2Y0BB 2WB4A 2GIRA 2MKHA 1HHSA 3GYXB 4GVBA 3VZHA 3R2CJ 2BA9A 1E6VB 2DO0A 2OGUA 5IOLA 3M6WA 2E9TA 5HVGA 4NA1A 4L75A 5KFYA 4A47A 4X84A 1G6BA 2FVQA 3D6FB 1S0MA 3LO3A 4K2JA 2CZ9A 4CT9A 2FJXA 1NBEB 3EJMA 1NKBA 1Q82T 1TELA 3I4HX 2ATCB 2LEBA 3AD8C 1DTQA 1TV6A 3LP2A 4HEA9 1RU1A 4KR0B 3EWGA 4TXSA 3JSRA 3TA2A 4AL7A 4XPEA 4I64A 3FZBA 3LP0A 4F0MA 1WOPA 1EHWA 2QT7A 4EZ6A 2V34A 2AGPA 2JVRA 2ZWOA 2AF6A 2QLXA 4F2SA 4MKAA 1X9MA 5D0RA 2CYYA 1HBOB 1GMWD 2XY6A 3DKDA 4B3RF 2VPYB 2R7OA 3CVKA 3MCMA 2RUGA 3CCSS 4JP8A 2QSFA 1R43A 3VV2B 1I3OB 1IBKF 1RBLA 1LQ9A 3Q23A 1RAEB 3OSPA 1ITPA 4BWJA 4ICLA 2BQUA 4J37A 1B0PA 2J76E 3PEJA 5A8KA 5A8RB 3W5YA 1TAUA 3DOMB 3SQGB 2CADA 3HD2A 3N28A 4TU7A 2DK2A 1SI9A 1PC5A 4RW4B 3K8WA 2OUGA 4FP9A 4K8RA 3BSNA 4ZA1A 3PM9A 3BR9A 1T95A 4EO6A 3EGWB 1MWYA 2YKNB 3OHAA 3H42A 1H3DA 4RWXA 4PWUA 2H65B 3R7NB 5T7LB 2B4PA 2R4FA 6AT1B 2CZ4A 4CLFA 4FF1A 4IRKA 1DQAA 1Z2LA 2HFUA 2FC8A 4LSZB 2CQ4A 2WBRA 1HW9A 4HL9A 3SIPB 3ZC4A 5D3GA 4ZLLA 2HBQB 2V8DA 3QRPA 1HI1A 2WVCA 1RTIB 5E3RA 4DR6J 4IG0A 3IS9A 5D78A 2E5LJ 4YUDA 1Q4RA 2MEWA 3U02A 4YOEA 2HBZB 1FFWB 2B4OA 5L46A 2Z57B 3G71S 4LBHA 5DRKA 1UVLA 3DLGB 4CRJA 1BY9A 3DDKA 2DNKA 3CCRS 4URGA 3NCPA 1C1CA 1DTTB 2XMUA 2ZWPA 2BW2A 3TUIC 3BGRA 5DG7A 3C15A 4DF8A 1D3WA 4LVNP 3TOQA 3U1NA 4FZVA 4G1QA 3G8SA 3KLIB 1BMQB 3MM8A 1DQ8A 2BE9B 3H4BA 3W2VA 3HO1A 2LLZA 1RTJA 2YKPA 5K20B 4X4QA 4DR2F 3W7BA 3OJSA 2VOOA 1M90T 1R8BA 1AA1B 2VFVA 1TQLA 2OFHX 4EBEA 3PW4A 2GMJA 2IJFA 3A3NB 3QJJA 4RNNA 1YHQS 2QJ3A 5JMNA 4NLDA 1SUQA 1O51A 4GKJJ 4U7CA 2PIIA 3IWNC 4ANDA 5HN0A 3RJMB 2W24A 5EGYA 1WELA 4NL5A 2XULA 2AJ0A 3KUHA 3MPUB 3I0RB 1T9UA 1FX4A 1SKRA 1R0AA 3I5BA 2PSZA 4TU9A 3TRGA 3DC2A 2ZE2A 2BQ3A 3S01A 1TFYA 2DH8A 3FEYB 3QWUA 1HPZB 1RHJB 2BX6A 1KSPA 3RBZA 3FFIB 3SMZA 3V2UC 4I7FA 3RAQA 1C0TB 3DU5A 3AA9A 2J0WA 3HXMA 3TZXA 3W2WB 3SEOA 2DPJA 4MYTA 1BQNB 4DUYJ 3IR5B 3NNAA 4U95A 1HMVB 4ZPTR 2A6MA 1ZA1B 1VJQA 2RNEA 4DV4J 5BJRA 4F0HA 3GJSB 3FKBA 2QTWA 2FJDB 4RUBA 3B54A 2F65A 1N36J 1FE4A 1CULA 2UUBJ 4P52A 3PX4A 1SJ3P 3G6VA 5A76A 4C8MA 5L1KA 4MT1A 4UUXA 3QAEA 1RT7B 5B0FA 4C3KA 1FNXH 2BJ8A 4F4XA 2DNLA 3MAQA 4V19X 3EX7B 4B9SA 3CMAS 4LQ9A 1C1BA 1EP4A 3PVXA 3OHBA 1FEHA 2HHPA 3BBCA 2AZ3A 4PG4A 2MLXA 4IQXA 2E1AA 1F2GA 4OX9F 2R3VA 4LRFA 4PXDA 4JI4F 3DGPB 3TVYA 4HI2A 2IIHA 1ACMB 4L72B 2HZVA 1G2EA 4G1PA 1HBNA 3UW1A 4O4GA 4GVBB 5KG2A 4RZRA 3QGHA 3V6KA 2R7QA 2YX7A 2BM1A 2FIUA 4DSFA 2F7VA 2VQFF 2HEKA 4ZP8A 2O66A 3NXZA 2NQPA 5K14A 3HVAA 4MYUA 3KXDA 4DQQA 2PA3A 3V4IA 3EPIA 2M7SA 3RR8A 1DTQB 1TV6B 3AQPA 3LP2B 1FA0A 2GNKA 4DBQA 3BPSP 2G2OA 4LF5J 3NS7B 3BYRA 2IBOA 1N33F 1FJ7A 3LP1A 1QTNB 4OYIA 3MFIA 3QRRA 4QIFA 3D5MA 1JJCB 2XY5A 1VI7A 4A8KA 1AYEA 2P8IA 1FK9B 3W62A 2NXEA 1PBUA 1T11A 4M5IA 4HI1A 1XR7A 5F8MA 2FJVA 3NOCA 1RA6A 4G3IA 4G6VB 2X1FA 3FSYA 4H4KA 4RW8A 1UA1A 1VQ5S 1UJ6A 2JZ5A 3HM9A 2HRUA 1S1VA 4OFZA 1KD1T 1DZ5A 2KB2A 1NZAA 4O4RA 1VC6A 2L41A 3MPVA 4Q44A 2JRSA 5HJXA 1S59A 3EXYA 4HH0A 4ICLB 4DI6A 1X31C 2GCFA 5IXUA 3EDQB 1RWMB 2EKYA 1HFEL 5A8KB 4USHA 2VG6A 3IRXA 4XO0A 1KVJA 4QWAA 2LEAA 1DQ9A 2RIJA 3ZXWA 3BN4A 2ILZA 2IPOB 5A8WA 2G4BA 4RW9A 3HP6A 1NJWA 1IM4A 3FCWA 1RADB 3DXSX 1VQSA 2YH1A 2V4JA 3GFXA 4J9SA 3T3FA 5HJYA 3P49B 4ZLNA 2GAGC 5IZHA 3WDOA 4DL7A 1CQNA 2U2FA 4O3QA 2ZH7A 1TMMA 2P5VA 5CQGA 1U26A 4C11A 1G7CB 2W2PP 1QVFR 2JLFA 3CC7S 1HBUA 1DBDA 4ED8A 3HHLD 3O6QA 2DVIA 2MQOA 5C24A 3PV8A 2DD8S 4OJ1A 2DHAA 2EK6A 4GKKJ 3JQJA 2RRBA 4DV2J 1KWMA 2CRLA 4E8UA 2VKRA 4RR5A 1UFKA 2R2RA 2XNQA 1FRLA 4O3RA 1SJ1A 4F4KA 4JV5F 2OPRB 1O0PA 1VRQC 2QLBB 2K2PA 2B7BB 5F8NA 3AJ1A 5ADZA 3BPDA 4X2BA 1V5IB 3OFFA 2UVUA 2AEJA 1Q79A 2CJAA 4C3LA 4P74A 3A12A 2CQBA 3VQTA 3K0JA 2X3GA 4K4SA 1XNQF 4M8LA 4FBTA 3TZWA 2D9OA 3H5YA 1TUVA 3H2LA 2E5LF 5D0GA 1ZETA 2DGVA 5ETQA 4RPFA 5MAOA 4ZPAA 3KJNB 2PE8A 2BOAA 3JSBA 3MEDA 2FPHX 4U7UK 4B9MA 2C2RA 4DFPA 1DFDA 1YTYA 2HNYB 4QPXA 4X4OA 1WHYA 2EFOA 5GAEI 3EVOA 1PYTA 3KHLA 1EARA 2VBZA 1N54B 4QPTA 1JLAA 2FVRA 5U47A 2VG5A 3NGUA 2HLTA 1PC4A 4UOHA 4DUZF 1T94A 3RBEA 4U7UD 4LQ3A 2FHMA 1VRTA 4F4AA 1FERA 1RSCA 3TQ1A 4JI8J 4CLWA 3LALA 2OO4A 1HQUB 2DR6A 4GKJF 2ZE2B 3GU0A 3UD4P 4BWMA 1WC0A 5KT4A 1A9NB 2XZDB 1KVIA 1R27B 4I7FB 1DHMA 1LFWA 1UKUA 4M5LA 2MSSA 4DV7J 2LQBA 1TL4A 2WTFA 2CNNB 2M0GB 5B0CA 1HWLA 4BLGA 3GV7B 2G0JA 5HMZA 4DX7A 1FEEA 1KKHA 2HFNA 3O2IA 4C8KA 4EFAC 1RT2A 2CWXA 1ROFA 2VU5A 4WP9A 4DSIA 4OX7A 1RWPB 3GIJA 4DJBA 3MAHA 4DR7J 3Q83A 4LSLA 3MMJA 2E7XA 3B78A 4FDFA 2DHXA 1UL3A 5DG8A 2NYHA 2L9NA 4ZDNA 3CJKB 2F4FA 4N5SA 1CPZA 4X66J 1N36F 2QLFB 3IM8A 2J7UA 3DOLB 2UUBF 2YNHA 1XBWA 1NDPA 2CUYA 1EP4B 2V2VA 2N7YA 5A6WA 3C6TA 5GADI 3CJRA 4NYOA 5K8PA 4CLPA 3THPA 4DS4A 1EJ7L 3Q8UA 3ENQA 1YZ7A 2F8MA 3VAMA 1RI7A 1Y10A 4Y65A 5CXTA 2D3OR 3MTJA 4H4MA 4OV1A 3GJQB 1FDNA 4O4GB 3V4MA 1LW2B 1S49A 3VVTA 2HQGA 2A3JA 2NZCA 3GSDA 2KU7A 5D6GA 3SV4A 3W9IA 5ETPA 1RK8A 4TY8A 2XMTA 4P75A 3CIMA 2PA8D 3V6DA 4ED4A 2DR8A 2MJNA 3V4IB 3U1LA 2A2DA 1ZM2A 3DCAA 4NYPA 3HHDA 1TL1B 3H59A 4Q0BB 2NPIA 3H5SA 2ZKTA 2IRUA 3D28A 2NR0A 2O3DA 3LP1B 3HVRA 3US5A 3KLHA 4PG6A 2ZOFA 3BS9A 1K1QA 3ENWA 4FXWA 1NO8A 2OTLS 1LXNA 3SI8A 1H98A 5IFMA 5H1SV 5D0EA 1UWAA 2Y1LB 3ZTRA 3MAAB 2L48A 2XLKA 2XMWA 4USIA 5E2QA 4KHRA 3TYTA 2PMWA 5T14A 2NPFA 1RYRA 5E7OB 5BXIA 1S1VB 2VODA 4USUA 2VL1A 3LAKA 3F56A 1U45A 4A4JA 4RX6A 4EK2A 4HTJA 2G2ZA 4OMFG 1IKVA 2CJQA 1F5BA 4AQYJ 4MTPA 2ZHOA 1F3FA 3I6PA 1NK9A 3ICLA 5C2GA 4L3NA 3ULHA 3EGVA 2VG6B 2AJFE 5DLGA 1WF1A 4DR3J 1O8BA 3FC9A 4NCAA 3QLHA 2I2YA 1BQMB 1LKZA 2IVFB 2R7SA 4DSLA 4FF2A 5ETLA 2JLEA 3KFWX 2NXCA 2I5JB 1E6YB 4RW9B 2XO6A 3CDWA 3O1LA 5KAKA 3MUVP 3Q0AA 2G13A 2JVOA 1UJ4A 4DFJA 2RKIA 2ZVIA 3PHTA 1VQLS 4NEYA 1XNRJ 4O0NA 3NNCA 2NREA 2HQCA 3HSJA 2VKZG 2FQQB 3UN3A 1PBAA 3WC0A 3OTCA 4RBVA 4X64J 3ILOA 1CQMA 1HBUB 3NAIA 2OPQA 4KO0A 2YNFB 5MLCV 4U96A 2B0GA 2KL8A 3M4XA 3L95X 3CPWR 3WX8A 3EGNA 2O01C 3BKTA 1MSWD 4DOZA 1U1KA 3BO4A 5G0RA 3EZOA 1SJRA 3QSIA 4KGVB 4DN9A 2PGCA 3SSQA 4C98A 2W9AA 2X1AA 2ZBIA 3CCMS 1NSPA 3ISZA 1S9FA 4E2FB 1Q8BA 4NLQA 4DV2F 1UETA 1IQZA 4YHHF 2AJ2A 1XR5A 3TI0A 1WOOA 1KOHA 1A0OB 3POTB 2E1MC 3AOBA 4F7VA 1QLNA 1OY6A 2Z30B 2BVZA 2L08A 2IC3A 2F8EX 4UTGA 4J9LA 2IM1A 2XGQA 3N6MA 1JLAB 1U6ZA 2VG5B 4ZVRB 3GYNA 4L3KA 1S1WA 3DMJB 4WIQA 2V63A 1KONA 2MLZA 5JXSA 1X7VA 2HQIA 1VRTB 4FKXA 3R7SB 4O3NA 2R9LA 4FYXB 2MSTA 2GZOA 3JYTA 3W5ZA 4NCBA 3O44A 4LFAJ 2B51A 3GG0A 5FDLA 4DPYA 4B3SJ 3QJPA 2W9CA 3WC2A 4ZVHA 2FC9A 1GH8A 2UUCJ 4ID5A 4OYOA 2VFSA 1L3KA 1QUPA 1U49A 5F3TA 1S7HA 4TNOA 2XQCA 4J5OA 3E3XA 4Y3CA 1S6QA 2VPXB 4DV7F 2J8AA 3R7BB 2ZDPA 4B17A 1KHWA 3F41A 5KFCA 4LSLB 2YWKA 3MMAA 4NLOA 3EYZA 5I3UA 4DWIA 2GGPB 3MM7B 2MDAA 2Y8WA 2AX1A 2V68A 2NS1B 4HT7A 1ZM4A 4OIXA 2APOA 5B0BA 2AGOA 1WC5A 2QV6A 1VQ8S 1HLWA 1SV5A 2SXLA 3U27A 4UZBA 4LREA 2JEIA 1VQ4S 4DR7F 3UPFA 3M2VA 4IO1A 2BOPA 4M94A 2DXFA 3LGNA 2PFFB 3CD0A 4QIEA 4NZ6A 1I51B 4WK3A 3THTA 4I6AA 5LL6d 2N3LA 4X66F 2JLGA 2FLPA 5KG7A 1VLOA 1QSSA 4A8WA 4DFKA 4KJIA 1BE4A 4WP8A 5BR8J 1YZ6A 2I1RA 4C0OC 4U8YA 1RLDA 3FJ2A 4LF8J 2HWHA 2C3UA 1KFDA 2RU9A 4TY8B 4MKVA 5KG6A 2EKNA 1WKJA 1TK0A 2DY9A 1S6OA 3V6DB 3V81B 3SCIE 5GAGI 4IOCQ 3AOCA 2QLWA 2XSJA 3C3LA 3FEZA 3CMES 4K5SA 1FXLA 3T1AA 1M1HA 2ASJA 3HT3A 3TAPA 2M88A 1P1LA 4MKBA 3CULA 2GIFA 3W66A 1T9WA 2J9DA 1H38A 4CIOA 5KFMA 3BQ1A 3KLHB 1H0HB 2HWIA 3AFGA 2DGTA 1TL3A 5ETRA 2V4QA 2AHOB 4F8RA 2KT3A 2ZUAA 3UR0A 3T1HJ 4M5KA 4ED3A 1U48A 3G2XA 3TVKA 1XTZA 5HQ8A 2NXJA 4QWDA 5FD1A 4LT6A 3K17A 4HT5A 3MM6A 4Z2XA 2CPZA 2FLNA 2DH7A 3OVBA 4RL1A 5EWGA 5HQLA 1HYSA 1TKDA 4URSA 3TR5A 3D2WA 2L9DA 4B3MJ 3K5OA 4DX8H 1FJGJ 1IKVB 1KRPA 2OPSA 2KFNA 4A8OA 3QZ7A 2C22A 2AYEA 3DFEA 5LJ5Y 4NLYA 3SYZA 5GVQA 2W2OP 1UWBA 3BJYA 3ZO7A 1YIJS 4W90B 3E01B 4LFCJ 2UXBJ 4CP5A 1H72C 1JLFA 4N7TA 3DM2A 1Z4UA 1HA1A 2VG7A 3BZQA 1RUSA 3D0HE 4NOHA 3GILA 1XWLA 4AQYF 1R0BG 3PRDA 3E2EA 5CZVA 1APSA 2BABA 4XAKA 1EB0A 1V9OA 1YK9A 3AXKA 4DSKA 4DG1A 1PG5B 4R8UA 2DKOB 4ZVSB 1RAHB 1X0FA 4PABA 1MMDA 1TFWA 4S0MA 3NL0A 3WHIA 3W1YC 1SL0A 2P2CB 5IM0A 5ETKA 4TY9A 3J81Y 1KLNA 2OPQB 3I0SB 2KKHA 1Y11A 2JEGA 3H8YA 4PUOA 5F8IA 1U25A 4QR2A 4YR2A 2J0QD 2QSWA 3M8WA 4N8OA 4QW9A 2QL9B 1TL5A 5HMXA 1RAFB 2QN6B 4X64F 2FHJD 3HHNB 4ZPCA 2DIVA 5G0RB 3R6GB 4DR5J 4WU2A 2KG0A 1B0TA 1NK8A 2MKKA 4F0KA 4MMOA 1EIYB 2ROEA 2Q6CA 2LDIA 1FE0A 1AXQA 1NMEB 3H4DA 2FZKB 3GJTB 2B6AA 4MFBA 3MHYA 3S1TA 3PACA 2YWFA 4ED2A 4KBIA 4ZHRB 1HL6A 1TL7A 3LGMA 3IBWA 2KJVA 1UVJA 2WW8A 4J9VA 1GTEA 2M5YA 1VQ7S 4ZP9A 4EEYA 2K1RA 5FJ4A 2RHQB 1RTHA 4Y2MA 1YX2A 3MM9B 3FCVA 5EDWA 2C2DA 2YX4A 4YEAA 3MOJB 2ZBPA 2VPZB 4KHPJ 2OEJA 1YGYA 4C0HA 4ANEA 4ENOA 3K57A 3A8JA 2CG4A 3HJFA 1U1RA 5GAEU 3FK4A 2IDLA 2QE5A 3UDVA 1VRUA 2YKMB 3B82A 2EBGA 3I82A 3C16A 4DV0J 1PKUA 5CA5A 1QDUB 1NK4A 4DS5A 5IT4A 3CNQP 3KK2A 3M1VB 3JYTB 3BM7A 4X62F 4RUCA 3J7YU 1MMNA 1SBRA 3BYPA 2F40A 5DDRC 5FDLB 4I2PB 2AKWB 4LFBJ 4P7VA 4AD6A 4ID5B 4QQBA 1I94J 3RU0A 4B3OA 4RLEA 4JV1A 3GIKA 4KC5A 4DLGA 4CTAB 1F2HA 5ITHA 5AXNA 3KNGA 4KFBB 3DRRA 2G0IA 1S6QB 3T19A 1R6YA 3PJXA 3M32A 4FKYA 1IBCB 4WFXA 2UUCF 1B64A 2AV5A 2N4CA 1CBKA 5I3UB 2DRDA 3RAMA 2E9RX 2C3PA 1R0CB 4FXVA 5ETSA 4WKYA 2UUTA 1WUUA 3C14B 4FF4A 2LA4A 2WVDA 3QT7A 2BE7D 2CJ9A 2CNKB 1WHWA 4CLYA 5EWEA 4HVZA 1R3NA 2DNOA 5GADU 4Y6IA 2HRTA 4PR6A 1QAIA 2RS8A 3WIVA 2JSXA 4HACA 2A1BA 4NX9A 3OXFA 5FLXY 1MWZA 2W4DA 3VAHA 1RHRB 1MROA 1OQ3A 3GIMA 3QIPA 3D3BJ 4J9PA 4DN0A 1X4DA 1WTFA 5FIIA 4QJVA 1AW0A 2DGQA 4JUZA 4DL5A 3VAIA 3D68A 2PFDA 3B6BA 3U1MA 4K59A 4J9RA 4NXMJ 4H4OA 3Q8RB 3A3OB 4IKAA 1FXDA 2XSJB 2ZH9A 4F4ZA 2R7WA 1IBLJ 3D0IE 5DZ6A 4ZCMA 1SQEA 4LF8F 3QGIA 3R5GA 1RABB 3T6BA 1RTDB 5DQHA 3NWRA 1VIOA 1B3TA 3TW0A 4ECTA 5AE3A 4K4XA 3G6YA 3DN9A 3QATA 3CDUA 1WC6A 4DR1J 1XMBA 4YMEA 3IA0A 1TL3B 2RILA 3OL7A 2R2SA 1T9XA 3CO9A 4D3HA 2KT5A 2GMHA 2MPUA 2CQHA 4N56A 2XGPA 1T9TA 2IM3A 1PJ5A 4TYBA 2F9DA 1XK8A 5J2QA 3RRKA 3A8IA 2Y8YA 1WEYA 4OJGA 2HWTA 3IR7B 1A7GE 3K2YA 2YKAA 5IT9U 3M05A 4LRAA 1S0NA 4LBPA 1HYSB 1KLMA 3WZ0A 2MQ8A 2BR0A 3QYYA 3MDFA 3T1HF 3R1LA 1SH3A 3M8QA 4DCJB 4X4SA 3J81U 1WKLA 2LDYA 3QT8A 2QA2A 2OPSB 1RT6B 3PW7A 2NXUA 1RAGB 3GV8B 3CSKA 1Q16B 1S6PA 1EETA 2CQGA 3SZ2A 1V5VA 4I0WA 4OQJA 1OSDA 1S48A 2C2EA 4B3MF 5D4LA 1FRXA 3NP5A 2X1BA 3FRYA 1N5YA 1MLAA 1FJGF 3DYAB 1N5VA 1U6BA 1WG4A 1T3NA 3NRBA 4USJC 2RHSB 3H98A 1MU2B 3UCGA 4OL8A 1U6FA 3PR4A 4R8UB 3W64A 2UXBF 3BF4A 3BR8A 5H9EK 2C28A 1K73T 4FN5A 3BGOP 4FNIA 2F1FA 4UY85 3RBDA 1R8PA 2Q43A 4PG8A 1U1OA 4PUOB 3Q89A 3FUYA 2XS2A 2KFYA 3M9NB 2B9EA 3WBZA 3C66A 2J0XA 1M1KT 4Y2KA 1PAUB 4KPCA 2MY8A 2U1AA 3S6EA 4NCGB 2YPYA 1LWCA 3DLEB 3LA0A 3G87A 2N82B 1Y0HA 2DRAA 4KSEB 4F36A 1D8YA 4I67A 2ZHBA 2FHKA 3IMQJ 2QX0A 1NPPA 1WNEA 1JLBA 2PC6A 4IRCA 1WSVA 3GR0A 3BSOA 1TL7B 3QNWB 2ZD1A 1RCXB 1O6XA 1U8SA 3PYDA 4KKOA 3CJSA 1GMVA 2ZOGA 2K1RB 1RTHB 1U1PA 5AT1B 3VWSA 1E6VA 2DGXA 3UNYA 1FCAA 3Q2TC 2KG1A 4B08A 1S10A 3EICA 2OMOA 3GLJA 2IYGA 1GK8A 4M5JA 4EBDA 1WEXA 3IWXA 4QIWD 4Q45A 2AWZA 3HZGA 1VRUB 3IP0A 3KYLA 1JKHB 3A8EA 2D69A 1K9MT 2BJ9A 1F5CA 2VFUA 3KK2B 4C7QA 5C5JA 3KK3A 3K5MA 4QU6A 2ZEJA 1NRKA 3TEHB 1ZAXA 1CLFA 3LW5C 1ULRA 1LWXA 3EVWA 2P9EA 4DV0F 2HRYA 1SC4B 4KRWA 2QA4S 3W65A 3R1HA 4WTOB 1JJHA 3DGVA 1WDDA 2FYXA 2QYCA 5FLXU 4GVLA 3M2RB 5KFDA 1RDRA 4JI2F 3SBMA 4JI1F 4RBUA 3M9OB 4DQPA 4LFBF 2AMCB 2HAIA 3CTRA 4WWSA 4PPZA 3FGVA 3ONQA 3DLBA 5IC6B 2EEYA 2IRYA 3M32B 5KFFA 1I94F 1VQ6S 4PWDB 3KDOA 5A2QU 3TA1A 2WRMA 3FQLA 5B7WA 3GSIA 5C42A 1BHNA 4QU7A 1EKRA 1NJIT 1FRHA 3UD5A 1NK7A 3CEDA 1BWEA 1HD1A 5DG9A 2MMYA 3J7Z5 1QUVA 3RB0A 3MOZA 3IGVA 1UPPA 1G3OA 3M8SA 3X1LB 5A8RA 5B08A 3ENAA 4N41A 3MXHP 3CD7A 4OYWA 2DNNA 2UZAA 5CYJA 5IWAJ 1Y3KA 1G4CA 5ETTA 2QL7B 4GMKA 4HACB 3SQGA 4U6PA 1Q8IA 2IYIA 4JI6J 4CNYA 1RGVA 1MROB 3AD7C 3RR7A 3TAMB 1H73A 2LFVA 2MQLA 3UN2A 4H4KC 3C19A 2VFRA 2H48B 4J9KA 5KFXA 3Q8VA 4JBCA 1NDKA 1UJ5A 3BSAA 2YKNA 3RYLA 2M3DA 4TYAA 5LT5A 5T7LA 2W7PA 1SVDA 2OKQA 1RHMB 3MR2A 3PW2A 5CAAA 3OJUA 2RUSA 1L3UA 1VQYA 4ED1A 4ZCKA 4KAIA 3TEGA 3OTOJ 1JLQA 2OJ3A 1VC5A 2HHUA 2JJ4D 3OLBA 2K7JA 1RTIA 4ATNA 5EN1A 3GFZA 4ZVQB 2XS5A 4DDFA 4ILRA 1IBLF 2RAQA 3GE9A 5DGAA 5J2MB 1Y4ZB 1CJVB 3T5KA 2WONA 3PHEA 2H54B 4I1TA 3GYGA 1N0VC 2W4CA 3FQKA 1LEOA 1S0VA 3MM5A 4QWBA 1TTHB 1NEEA 3KLIA 4WU3A 2HHQA 5M2UA 4DR1F 2HURA 2JC1A 3IC1A 1U0SA 1UVNA 1YVFA 2C2MB 4O23A 1RT1A 1NAQA 1RAJA 3DRXA 4K4VA 2HLUA 1KLMB 3AH6A 2C42A 3THVA 3NCQA 3M8QB 3LOUA 4QR0A 2V8HA 3I9V9 1Q78A 2KO1A 1M0SA 5AE2A 2VPWB 1IJEB 3OR2B 3J7AN 4AUKA 4I68A 2GO9A 1N5YB 2F8HA 4NWBA 3PX0A 2WOMB 2FVCA 4K4YA 2G1DA 5B0GA 3A3PB 1G1XA 1HPZA 3OL8A 4DV1F 3FFIA 2LCWA 4KGMA 4OI3A 3ZZPA 5IQQA 5F0WA 3LWMA 1JLCB 3JTNA 4WPAA 2CJKA 2C3MA 1HMVA 2FJBB 3FDSA 1U0HA 2Y1JA 3SFUA 1W26A 2B4VA 1LNQA 3PFEA 2QIFA 1S1TA 1H7WA 2FB0A 2FVSA 3N4WA 2I8EA 1NH8A 1MWQA 4DU7A 3H2VE 1T3OA 1XQIA 2HQDA 3CT9A 4Y0FA 5J1NA 2BJ1A 1S6UA 3L7OA 3M8PB 2RMLA 2DR5A 5CH7B 2HVEA 4P73A 1NB2A 4DMZA 1V6HA 4ANCA 4JI5F 1N52B 1EX8A 3LAMA 1LWCB 5HBMB 4TLQA 3CWJA 1Q95G 2YNGA 1RQ0A 4K50A 1FFSB 5ETNA 3I87A 3CJQA 4MK7A 2HG4A 3D1OA 1OSCA 4IFYA 1JLBB 4Q2MA 3QO9A 4XK8C 2MZSA 2ZM6F 1DY3A 2HHHJ 1YJRA 5IC4B 2E9ZA 4WTYA 2CJXB 2CQ0A 4ILLA 1CC7A 2ZC4A 4X4NA 2YX1A 4UY8T 5IQ6A 1VQMS 4M5MA 3AA8A 3FVYA 3MCOA 3HPOA 5F3ZA 4YB7A 2Z2LA 4M63A 2RRAA 2WK4A 2P9GA 2KJWA 2MZTA 3HCXA 3B8HA 3ZTSA 1FKPA 2DPIA 3CCWA 4DSEA 1S4FA 3JAMY 1D9FA 1WSRA 2Z2MA 4ZPBA 2LU1A 2XBPA 4A8QA 4USWA 3KK3B 3KG1A 1HR0J 2FJWA 4DCOB 1KTVA 1D8ZA 1CJTA 2W7OA 1TVRB 1Y3JA 3VAGA 5E5NA 2AX0A 2BKOA 5F8GA 3T5JA 5E0OA 3RG6A 3CJ8A 1ZM9A 2GJ2A 4X65J 5HLFA 2QRRA 2AZ1A 1FRKA 1HWKA 2XMKA 1FK9A 1JLEB 5KFUA 1ZPWX 3NGKA 3DRPA 1JWWA 2OD6A 1YJVA 6FD1A 3GTYX 1D9DA 4EI2A 3RW7A 4G1IA 1UZDA 2ALYB 2R7XA 5K8OA 3P4UB 2Z4PA 3KTQA 1TZ0A 2Z58B 5C42B 3DDNA 5F8LA 1GXTA 1SCJB 1DLOB 1B99A 1ZS6A 3KUGA 2DEJA 3Q2SC 5KOXA 2R2UA 1IR1A 1TUWA 2HGLA 3Q8QB 5KFEA 1MG7A 5KFOA 2Z8QA 1CSJA 1R8CA 4QWEA 5H9EJ 3MEGA 1N4LA 1QE1A 1WHVA 1KBRA 4WFAQ 1DARA 1JJ4A 1NHKL 2HBYB 2IRXA 1JMTA 1NB7A 2QC3A 2N4DA 5C2CA 2CPDA 4F50A 5IWAF 2DNGA 1NKCA 1U47A 3L9ZA 1T05A 2CPEA 1FTRA 4JI6F 2IVMA 4WYLA 2ZITA 2HS4A 3HHEA 5L1JA 3BEGB 4ZS6A 1IVZA 3RRHA 1ZYQA 2EVZA 1K1SA 3KJVB 4NLPA 5HSPA 1WF0A 4RW7B 2C3OA 3FMWA 1JLQB 3IO1A 5AXKA 3CJ0A 1ZTTA 4B3TJ 4ED5A 3J7ZT 5KFNA 2Z2ZA 3N6LA 4ED0A 4B02A 1DURA 3DRSB 4AXJA 5C25B 1XIQA 2OPRA 2VH7A 1VQNS 3T9NA 1RBOB 2DHGA 3B4DA 4WZMA 3JQMA 4Q8EA 2O1PA 2WONB 1IWAA 1IN0A 1NH7A 4PZVA 2R8GA 2X51A 3MM5B 3MMBA 4KYZA 3TANA 2DBBA 1L3SA 3OLAA 2BM0A 4J9UE 4DQIA 4FXDA 1T03B 5DO2A 5DM6Q 3BQ0A 1DJ0A 4ZP7A 2HFSA 1RT1B 1IBMJ 2GC8A 1Q53A 1FO1A 2VBXA 2PMZD 3W8PA 3G4SS 2JEJA 3FNNA 4MAKA 2HNYA 3V6JA 1N32J 1OPIA 4DPUA 3BN7A 1VDHA 1U2FA 4IH6A 3RBXA 1LXJA 4F25A 3M2UA 1VLYA 3BBBA 1R8HA 4NRTA 2Z2YB 1KQGB 3CCVS 2W2QP 1HQUA 4KH0B 4ALZA 2R7TA 1Q7LB 2AYGA 2BJDA 4R0EA 3L09A 4IDKA 4NE9C 4OYAA 3TX8A 3AY0A 1BGXT 1EQ0A 2E5GA 2YTCA 2ADBA 3PY8A 3DRYA 4P9SA 2HHVA 2R7UA 1M5OC 1U0HB 2CVIA 2ZJPQ 3T6JA 2HIYA 2XHWA 4FS1A 1S1TB 1NNDA 4TQRA 3W5XA 5HK4A 3IRWP 3QPIA 1P8GA 3TQEA 5KT5A 4M5GA 4JI0F 2A0FB 2UXDF 3KHRA 2LKZA 5D4PA 5J2NB 1NSAA 3ILLA 1UVIA 3JTPA 3DXBA 2DHSA 1MNEA 4ELVA 2KH9A 3CJ2A 3CJKA 3MURP 2OEKA 2VD3A 4ED6A 2UUAJ 4WP3A 3JAMU 3FBEA 3DOLA 5LMUJ 1LK5A 2YNGB 2V67A 3LPYA 4C8NA 1V3ZA 4CO0A 1CVJA 4IFYB 1RU2A 3KNAA 1UMJA 2Y9HA 3NLCA 3MPYA 3QO9B 1SC6A 2QGFB 1CS4A 3K5PA 1BC6A 3GR1A 4F3MA 4KH1B 3OTBA 2EFQA 3IXQA 3KLGA 3NGSA 1Q8KA 2F9JA 2OFGX 5I42B 1VHIA 4BC7A 1F6TA 1Y5LB 3D1QA 1WDTA 1LW2A 2DJWA 3AD9C 3QAUA 3D66A 3G82A 1HARA 1FF2A 3SSRA 3GONA 2LU2A 2FY8A 4P2SA 1R8AA 1FKPB 2X3DA 2RRNA 2XI3A 5KT7A 3DLHA 1UW4A 2Q1LA 2Y3YA 4YB1P 1JNRB 1PGZA 3AODA 4YFUA 2OAUA 4OZ0A 1TL1A 2NCKL 4Q0BA 1VGYA 1TKXA 2E7VA 3TA0A 1CJTB 1RAOA 2JHEA 1ZZNA 4Q43A 3OQ2A 3DLLQ 1IM6A 2V4RA 1M5HA 2YPZA 1FRJA 4EBCA 3TAQA 4LRDA 3K8VA 1WG1A 4RJVA 1NM2A 2H5IB 2ZZMA 1FWKA 3N5BA 3ZZRA 5HL7Q 1R89A 5HLFB 2VASA 3P8BB 1NU4A 3UN5A 5CZXA 3CJ4A 4NZ7A 3MAAA 3CCQS 3O3LA 1S9EA 5KT3A 4KV8A 3KG4A 1KDNA 3DRPB 2ZJQQ 3JSMB 2FZCB 1NCLA 4PG5A 4GC6A 2RH3A 4P2XA 3KK1A 4U67Q 1GTHA 3CD6S 2M52A 1SKSA 1BUXA 1Y9OA 2R7RA 5DQIA 3QT6A 4X65F 5DGBA 2ATLA 3R2DJ 5IV4A 1NSQA 3D6TB 1IKWB 1X4GA 2J8SA 4USKA 3KMSA 1JX4A 1DRZA 2EWHA 2F3JA 3M7VA 4QZVB 2NSCA 1AUDA 1SL2A 2RSQA 4DHVA 2BXJA 3ILJA 4WYWA 2VV5A 2MLYA 2Z0GA 2YWGA 1X5SA 4NRUA 1BQMA 2WSEC 3MEGB 2ZZNA 4B3RJ 3ET6A 1QE1B 2I5JA 1E6YA 1KFSA 3PW5A 5EUHA 2HHSA 4TLRA 3UVJA 1F0XA 3TARA 3M30B 2MZ1A 3ITHA 3H5XA 4ZN3A 1SXLA 2NYIA 5GMKa 2HBRB 2CJYB 5HATA 3ZZZA 3Q8PB 1T05B 5KFWA 1TP7A 1JXVA 2ZH6A 1AB8A 3H25A 1NK5A 1Q81T 2GV1A 2YNFA 8ATCB 2LYVA 2DYAA 1WI8A 4OZ3A 1KNZA 4QYRA 4LR8A 3RB6A 4JOUA 4TVAB 3A4TA 5KT2A 1NHUA 1YG0A 3PRBA 1ZA2B 2DEIA 4QR1A 4YY3J 1M5PC 1Z1ZA 4B3TF 5BYQA 4NLTA 2XYHB 2HFOA 4LJMA 3MMBB 2LQ5A 3NGDA 3H20A 4DR6F 4R5PB 1M5VC 2N7CA 5HAOA 1J5OA 3KHGA 4ZLPA 4USVA 3POTA 3KUEA 5E3PA 1KQSR 2LQ9A 1IKXA 4HH1A 2XO7A 1F5AA 3ENVA 3MPDA 4PKDB 2B5JA 2QLJB 3ZZUA 2RB7A 3WX4A 4MH8A 3M6UA 2DH9A 3I9ZA 2G1HA 3P6YC 3FRZA 5I3QA 4J9NA 3M2UB 2CPJA 2G2YA 1S76D 3G8QA 4F4YA 2FTRA 3DMJA 1IBMF 4C8ZA 3VAKA 2V2ZA 2ZH2A 1QVGR 1KTQA 2JWNA 1RLCL 4UQTA 4K0KJ 2VB6A 1UFLA 3IM9A 4F2RA 2D7SA 2KZZA 2JOQA 4DL6A 1AROP 4A8SA 2ZBRA 2CQCA 2H9ZA 3N9UC 5J1PA 2XS7A 3N01A 2WSCC 3LTOA 4IDKB 1VK8A 2B9WA 2ROPA 3A1YG 1BD6A 2R7VA 2VC0A 2KVQE 1Y5NB 4P2FA 2W8KA 3PCOB 3IR6B 2MQMA 3HK2A 3ISNC 4DR4J 3KHHA 1S1UB 5KFIA 1FDDA 2DT9A 3T1YJ 1S97A 3R5JB 3DOKA 1KC8T 1BXNA 4DU8A 3P3DA 2EG1A 1N5SA 5H9FJ 2XHCA 3NBPA 2HIQA 1UA0A 2HGMA 5G4DA 4C48A 2GMLA 1RJJA 4DUYF 1BQXA 3HKZD 2XZTB
chains in the Genus database with same CATH topology
3RAQA 5AE3A 1C0TB 3QMQA 3DU5A 3AA9A 1K8AT 2J0WA 4ZCLA 3HXMA 4K4XA 3G6YA 2GGPA 3MM7A 4DV4F 4OI4A 3DN9A 3W2WB 3SEOA 2KDOA 2MQPA 2DPJA 3CDUA 4MYTA 2FHJA 4CI0B 1BQNB 1XMBA 4ZPWR 4YMEA 3IA0A 1TL3B 2RILA 1S1XA 3IR5B 3NNAA 1HMVB 4IG3A 4ZPTR 3BSCA 3OL7A 3UCUP 2R2SA 2UV8G 1Y00A 4BDPA 3S8SA 2P6SA 2ZNYA 2J9CA 1P27B 2XCAA 2E66A 2RNEA 2RQKA 3B4MA 3CO9A 4D3HA 5BJRA 2KT5A 2HVHA 2GMHA 2CQ1A 1XR6A 2MPUA 3BGLA 2EPIA 2FJDB 2CQHA 2CPHA 3LF0A 1KN6A 4LSNA 4N56A 2XGPA 1FE4A 4NA2A 2IM3A 4BC9A 1JJ2R 4TYBA 2F9DA 5J1EA 2XWXA 2AJ4A 4EYHB 2MZJA 2RU3A 3RW6A 1XK8A 3PX4A 5K9FA 3PIPQ 5J2QA 3RRKA 1SJ3P 1QTMA 3G6VA 1URRA 3MEKA 4ECZA 1WEYA 4OJGA 4OHZA 2HWTA 3IR7B 2UUAF 1A7GE 2Q6BA 3K2YA 2YKAA 4ILMA 4C8MA 3M05A 5L1KA 4PRFA 4NZ0A 4K2XA 4AFFA 4UUXA 5A0YB 3KLGB 1S0NA 3QAEA 1HNWF 5LMUF 1HYSB 1RT7B 5B0FA 4DL4A 1KLMA 5KG3A 3WZ0A 3PKMA 2BR0A 4C3KA 2MZQA 1FNXH 5SZTA 3CB4A 1KOOA 3QYYA 3MDFA 4F4XA 2DNLA 3T1HF 3R1LA 2IA6A 5HP1B 3BO2A 1SH3A 3MAQA 4OJHA 2PT0A 3M8QA 4X4SA 3EX7B 4B9SA 4V19X 3MR6A 5L8RC 3CMAS 4AL6A 4LQ9A 2LDYA 2QA2A 1KEKA 1KR4A 1C1BA 2OPSB 1EP4A 3AB4B 2MKJA 2EFGA 3PVXA 3OHBA 1RT6B 4NLXA 3PW7A 2NXUA 3C2PA 1FEHA 2HHPA 2J5AA 4PG4A 2KM8C 3PKYA 2B43A 2FGCA 2GFFA 3GV8B 4IQXA 2E1AA 3CSKA 1Q16B 1L3TA 5KFGA 1S6PA 1IXKA 1EETA 4ZCIA 2CQGA 3SZ2A 2QMWA 4I0WA 3QJLA 1F2GA 4OQJA 2RE1A 4OX9F 1OSDA 4N8NA 1S48A 4PXDA 2C2EA 4B3MF 1HWJA 5D4LA 1VQKS 3TVYA 4JI4F 1FRXA 3V81A 3NP5A 3GQCA 5IT0A 4HI2A 2X1BA 2RS2A 3FRYA 1N5YA 5F9NA 4R0JA 1RKIA 4L72B 5KT6A 2CIMA 2K3KA 1VBXA 3AJ2A 4YR0A 1T8EA 1FJGF 1G2EA 4G1PA 3I56S 5GAHI 1HBNA 3HVTB 3DYAB 3UW1A 1N5VA 2MYFA 2EBEA 4O4GA 1U6BA 1WG4A 1T3NA 3NRBA 5J2NA 2WBMA 4USJC 3MECB 1TKXB 5KG2A 2BZ2A 2BV3A 3DLKA 4RNFA 3H98A 4RZRA 3QGHA 2BRKA 1MU2B 4IUFA 3V6KA 2PDAA 3UCGA 4OL8A 2D3ZA 4AL5A 4OI0A 2R7QA 1U6FA 3PR4A 4F4WA 1LWEB 5JVGQ 3SV3A 1ZBTA 3JTOA 2YX7A 4R8UB 1YJWS 4A46A 1H2UX 2BM1A 2FIUA 2UXBF 1JB0C 3BF4A 3E8OA 2LXIA 3NMAA 3BR8A 4N77A 4ECWA 4DSFA 2F7VA 2QFJA 2VQFF 2HHWA 1TK5A 4ZP8A 2C28A 1K73T 2O66A 4FN5A 4FNIA 2NQPA 4ES1A 5K14A 2F1FA 2ZBCA 4UY85 3HVAA 1GX6A 2YQ3A 3QLHB 4MYUA 2E29A 2KYXA 3RBDA 1R8PA 2DGUA 2Q43A 5DQGA 1LW0B 3R3TA 4DQQA 2PA3A 4PG8A 3V4IA 2IAJA 1U1OA 2J6TA 1S9EB 4LF5F 4KV8B 3EPIA 4A8MP 2M7SA 3RR8A 1DTQB 4PUOB 1N0UA 1TV6B 3AQPA 3LP2B 3BDPA 4K5RA 4IFVB 1FA0A 3VCDA 2XS2A 2GNKA 4DBQA 5D4OA 3OVSA 2YH0A 2KFYA 2D9PA 3KK1B 5SUHA 5DM7Q 4IQMA 4ES2A 2HW3A 4C3MA 2MGZB 2CQ3A 1RT4A 1V3SA 3M9NB 3WBZA 3C66A 3MWBA 2J0XA 1M1KT 2BYCA 2IBOA 2JH3A 1WTBA 1N33F 1FJ7A 4Y2KA 2RKIB 3LP1A 5AXLA 2J0SD 5I42A 5IT9Y 3MFIA 1UP1A 4I56A 2MY8A 2GW8A 1J5EF 1XERA 2B4UA 2U1AA 5DLFA 5F8JA 3MZIA 3S6EA 2ZOMA 4QIFA 4NCGB 2IMWP 1LWCA 2FJEB 3DLEB 2EFNA 5KFBA 4LVOP 3JSYA 3D5MA 4LUBA 2XY5A 3GFHA 2N82B 5CYMA 2JL9A 1Y0HA 3SDEA 2K7KA 4CO5A 2DRAA 1VI7A 2O5DA 1U1MA 1F60B 4A8KA 4KSEB 4KO0B 4NLSA 4F26A 3PO4A 5J2PA 2PMHA 1ZM3A 3MGJA 2R8JA 1FK9B 1D8YA 4I67A 2ZHBA 1WI6A 2FHKA 2RQ4A 1S79A 4RNMA 1WNEA 3UD3P 3GZ7A 2PC6A 1JLBA 5I3PA 2FJAB 4HI1A 1XR7A 3HKWA 4IRCA 3GR0A 3BSOA 5F8MA 2HNDB 2FJVA 4GO5X 2FGOA 1ZH5A 1RA6A 3R27A 4G3IA 3EGZA 4G6VB 5KTQA 3E01A 2ZD1A 2X1FA 1X9WA 1A6LA 1U8SA 3FSYA 2OPPB 4H4KA 4K4UA 1DAXA 4RW8A 3DNCA 1UA1A 1VQ5S 3KOAA 1UJ6A 2JZ5A 3HM9A 1U1LA 4Y00A 4KKOA 3G6ES 2HRUA 1S1VA 4OFZA 1ZZFA 1KD1T 2KXHA 2ZOGA 1DZ5A 1U7LA 2GJIA 2KB2A 3RB4A 1C2PA 2K1RB 4I2QA 2HMIB 1RTHB 1NZAA 4O4RA 2RF2B 1VC6A 4A8FA 2L41A 3IN5A 1U1PA 4QIGA 3MPVA 3TVZA 4Q44A 4O0IA 3VWSA 3ITHB 2JRSA 1ZPVA 2KXNB 1E6VA 4ZVFA 1SJ4P 4Q8FA 2DGXA 3EXYA 4HH0A 5DDPC 2VA2A 4ELTA 3FEXB 4ICLB 4X4VA 1FCAA 3Q2TC 2WB1D 2GCFA 4OZNA 4IOBA 2KG1A 2GQCA 4B08A 1S10A 5IXUA 1AFJA 2OMOA 5M2RA 2IYGA 3OXGA 4EBDA 2E1CA 3GWCA 1WEXA 2F4VF 2DCUB 2EKYA 3IWXA 1XC9A 1HFEL 4QIWD 5A8KB 1Q7YT 4USHA 3MR3A 4EZ9A 1F9FA 2VG6A 3IRXA 4XDCA 4XO0A 1FKOA 1KVJA 4Q45A 2AWZA 2RD5C 3OSNA 1S9GA 4QWAA 3HZGA 2LEAA 1DQ9A 2KXFA 2HVIA 2WAQD 1VRUB 4F02A 1K0TA 3KYLA 2RIJA 1JKHB 2EC0A 3BN4A 3I0SA 4OX8A 4PCQA 1T02A 3A8EA 2ILZA 1HQEA 3I96A 3IAM9 3ETOA 4KE5A 5KFKA 1GAOA 1FJEB 5A8WA 1K9MT 2G4BA 1F5CA 4RW9A 3RB3A 2VFUA 3KK2B 4C7QA 1UEVA 5C5JA 3HP6A 3JSMA 1NJWA 1IM4A 1KS2A 2GA7A 3KK3A 2OMLA 3K5MA 2M8HA 3OPKA 4XIUA 4QU6A 5KFLA 1NRKA 1B0VA 1VQSA 3DXSX 3H2UB 2IC3B 1VMBA 2YH1A 1TKZB 2AJ1A 2EG2A 1ZAXA 2V4JA 3GFXA 4CT8A 4J9SA 2BRLA 4FBUA 3T3FA 1YJNS 3V2UC 3P49B 1CLFA 3KLFB 5DS7A 5HROA 3MEEA 3VAJA 3KWMA 3LW5C 2X1GA 5IZHA 1ULRA 3WDOA 3AAWB 2P9EA 4DL7A 1CQNA 2U2FA 4FF3A 1X5TA 4DV0F 4O3QA 2HRYA 1IKWA 4A48A 2P5VA 2ZH7A 5CQGA 1U26A 2JDJA 4C11A 1D0EA 4KRWA 2QA4S 1S1WB 3NCRA 1PO6A 2NUHA 2VFTA 1UEUA 2PD1A 1G7CB 3R1HA 1QVFR 2JLFA 4NYZA 2A10A 3CC7S 1JJHA 1HBUA 2QYCA 3VAFA 3M2RB 5KFDA 3D0GE 1DBDA 2M9KA 4ED8A 1RDRA 3HHLD 4XPCA 4JI2F 4JI1F 4RBUA 3M9OB 4GKKF 1S99A 3O6QA 4DQPA 3BQ2A 2DVIA 2MQOA 1FJCA 5C24A 1NJXA 2UV8A 4ZHRA 4LFBF 2HAIA 4CZCA 3PW0A 2BBEA 3CTRA 3NWGA 5L1IA 4CQ1A 4PPZA 1URNA 1U2RA 3PV8A 1HI8A 1SL1A 3IG1A 2DD8S 3BGUA 3FGVA 3ONQA 4QW8A 3DLBA 1J5OB 4M95A 2IRYA 4I69A 3M32B 2EK1A 4OJ1A 5KFFA 2DHAA 4NMLA 4KTQA 2EK6A 1I94F 1VQ6S 2RRBA 4PWDB 2W9CB 2CRLA 4YY3F 4E8UA 4B9NA 2VKRA 2R2RA 5LJ3Y 2BUNA 2XNQA 1IKXB 2D74B 1FRLA 3TA1A 1SJ1A 2YKQA 4F4KA 4O3RA 4JV5F 2OPRB 2WRMA 2BACA 3FQLA 1O0PA 5B7WA 2K2PA 3M30A 5C42A 2B7BB 4QU7A 2FY1A 3MM9A 3JB9k 5F8NA 3AJ1A 4ES3A 4BBYA 3W3SA 4UUWA 1NJIT 2B5JB 1FRHA 5ADZA 1NK7A 4X2BA 3CEDA 3MMCA 1BWEA 3OFFA 4TQSA 1IUJA 2UVUA 3TUJC 1LWFB 5CYQB 1HD1A 5DG9A 2MMYA 1Q79A 2CJAA 1QUVA 4C3LA 3J7Z5 1JXLA 3S7RA 3NAHA 2GHWA 2B9YA 2XI2A 2CQBA 3RB0A 3MOZA 3HFKA 3VQTA 3P96A 3K0JA 4HHJA 1SJQA 1VS3A 2X3GA 4K4SA 5LSRA 3IGVA 1ELOA 4M8LA 4FBTA 1G3OA 3M8SA 1XNQF 3X1LB 5A8RA 5B08A 4N41A 1SIZA 1YJ9S 2DNYA 1YRTA 3MXHP 2D9OA 3CD7A 1TUVA 3AHPA 3H5YA 3HHKA 3H2LA 2DNNA 2UZAA 3U7JA 5CYJA 2E5LF 2B56A 2YKMA 5K8MA 1Y3KA 4QCLA 4GMKA 3MD3A 1QAYA 4O44A 1ZETA 3MMAB 2DGVA 4LF7F 3SQGA 4U6PA 1ZAWA 1Q8IA 5MAOA 2IYIA 4TN2A 4ZPAA 4JV0A 4Y2IA 1OPZA 4CNYA 1J2VA 2PE8A 3M1VA 4N47A 4WKRA 3DI6A 4KIAA 1RGVA 1MROB 3JSBA 3MEDA 1QSLA 4C8LA 2FPHX 4I6YA 3GV5B 4U7UK 3TAMB 3RR7A 4B9MA 2C2RA 4DFPA 3LANA 1DFDA 3LQVA 1YTYA 1NJZA 2P6TA 2HNYB 4QPXA 4I2PA 5JUMA 4M5DB 4X4OA 1WHYA 2MQLA 2EFOA 4H4KC 1SV5B 2CPIA 5GAEI 4C2MA 2VFRA 4ZOSA 3KHLA 2VBZA 3ZZYA 1N54B 4J9KA 3J7A1 4QPTA 5KFXA 4NLRA 4RU2A 3M2VB 1JLAA 2FVRA 5U47A 4JBCA 4K0KF 2VG5A 1RT5A 4EU0A 4HKQA 1UJ5A 4JI8F 2NLWA 2YNIA 3BSAA 3UQSA 2HLTA 2YKNA 3RYLA 4ECRA 2DISA 3C6UA 2HZCA 1PC4A 2M3DA 1JLGB 4TYAA 4UW2A 2J9EA 5LT5A 4DUZF 2ERRA 3UNGC 1T94A 3RBEA 3HLUA 5T7LA 2W7PA 4LQ3A 4X4TA 1TR0A 2FHMA 3P5TL 4LMZA 4OI6A 5E33A 5CCLA 2GIQA 4CTAA 1VRTA 2IM0A 1FERA 3OTOF 4OLPA 2OKQA 1WF2A 3MR2A 3TQ1A 3UDLA 3PW2A 3DOKB 3OJUA 2QA1A 3LALA 2OO4A 1HQUB 1L3UA 2KT2A 1VQYA 2DNPA 2LQJA 4KFBA 2HS3A 2ZH5A 4ZCKA 4ED1A 4GKJF 2K3IA 4KAIA 3NBPB 2ZE2B 1YRUA 3UD4P 4R5PA 4OHVA 1VOMA 4BWMA 2HNZB 1JLQA 2OJ3A 1IR0A 5KT4A 1A9NB 1VC5A 2HHUA 3CJ3A 2JJ4D 1RKJA 3OLBA 2K7JA 2HQ3A 2ZJRQ 4CO4A 1HNZF 3K7RA 1RTIA 1KVIA 1H2VZ 1R27B 1WD6A 4ATNA 3PJWA 4I7FB 4FS2A 5DDQC 1DHMA 1FDAA 1LFWA 4DR4F 3M8RA 1UKUA 2MQQA 1V3RA 5EN1A 3H5UA 1OWXA 3GFZA 2MSSA 2XC9A 2LQBA 2XS5A 3G9CA 2D41A 1TL4A 4WXWA 2WTFA 4HLBA 1P1TA 2D1CA 4MIBA 4OHWA 4DDFA 3T1YF 5A2QY 2M0GB 5B0CA 3FSIA 1S1XB 1HWLA 4IG3B 4ILRA 1IBLF 1HWUA 3GV7B 1S0OA 2YWHA 3GE9A 3MPWA 4ZVGA 4A8YA 5HMZA 5DGAA 5J2MB 1Y4ZB 1QAJA 4W92B 1FEEA 2HFNA 3FCHA 3IWLA 3O2IA 4C8KA 4EFAC 1RT2A 3T5KA 1ROFA 3RTVA 2WONA 2KHCA 4DL0C 4DSIA 3BDEA 3PHEA 2W8LA 4LSNB 4I1TA 4DF4A 2MKSA 4Y34A 1N0VC 2W4CA 3FQKA 4OX7A 3ZZOA 5J1EB 1S0VA 3MM5A 5L9NA 3GIJA 4QWBA 3SXLA 2ZFHA 1NEEA 3KLIA 4DV6F 3MTKA 4DJBA 2AGQA 2V94A 3MAHA 4WU3A 2HHQA 2CPFA 3VR1A 3CDBA 5M2UA 4LSLA 3MFHA 3MMJA 4NLUA 4DR1F 2JC1A 3IC1A 3G96A 3BGFA 2GHVC 2E7XA 3B78A 2ACYA 2DHXA 3I4PA 1UL3A 1YVFA 2E5HA 3CC4S 1UVNA 5DG8A 4O23A 1RT1A 1NAQA 1RAJA 2L9NA 3Q22A 3DRXA 2DGWA 3DLJA 5KFZA 5HO4A 4K4VA 4NLVA 2HLUA 1KLMB 4ZDNA 1LK7A 3CJKB 1SJFA 3ZFVA 3CDAA 3QGGA 4N5SA 3AH6A 1CPZA 2DNRA 2C42A 3K58A 3THVA 3I32A 2Q3PA 3NCQA 1N36F 5KFSA 3M8QB 4WF9Q 1Y7PA 3LOUA 1X4FA 1AFIA 1HNIB 2J7UA