2UUBF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uubF00
4LF6F 1HNXF 4LF9F 4X64F 4DUYF 1N32F 4DR5F 1HR0F 4B3MF 2BXJA 1N34F 4DR4F 4KHPF 1I94F 4NXMF 4JI8F 2YY3A 4YHHF 4NXNF 4AQYF 4DR6F 1F60B 4DR1F 1HNWF 4JI0F 1XNRF 1G7CB 2KJWA 4JI1F 4K0KF 1B64A 5BR8F 2VQFF 4YY3F 1FKAF 4DR7F 3R3TA 4DUZF 1VMBA 4DV4F 2UXCF 4DV1F 4LF8F 4DV5F 3T1HF 1GH8A 1N36F 4DR2F 4B3TF 1G1XA 2UU9F 4JI6F 4LFCF 4JI5F 3ZZPA 4X65F 1HNZF 1IBLF 5LMUF 1IBKF 4B3SF 4GKJF 4JI2F 2UXDF 4LF4F 2UUBF 1QJHA 1IJFB 2ZM6F 4DV3F 2UUCF 5LMNF 3T1YF 4LFBF 1IJEB 4DV6F 2UUAF 2B7CB 2E5LF 4LF5F 1IBMF 4DV2F 2BVZA 4X62F 4DV7F 1J5EF 1XMOF 5AJ3F 4LFAF 1FJGF 2J5AA 4JYAF 1XNQF 4DV0F 1N33F 1CQMA 2RJZA 2HHHF 2VQEF 1XMQF 2B7BB 4JI4F 1RISA 2UXBF 4X66F 1LOUA 5IWAF 4B3RF 4JV5F 4JI3F 1CQNA 2KJVA 4GKKF 4LF7F 2F4VF 3OTOF 4JI7F 4OX9F 4DR3F
chains in the Genus database with same CATH superfamily
5CXTA 4O0NA 3T1AA 4IFYB 3PZPA 2KG0A 3BR8A 4OX8A 4BC9A 3JSMB 4LBIA 2GMJA 2E9ZA 1PG5B 3JB9k 2UVVA 2YNFB 4JI1J 2HHVA 2L3MA 2YWGA 2YNGB 4P74A 3W65A 5KT6A 1S1TA 2I5JB 2E7VA 3KLGA 2VFRA 3E51A 1F9HA 4X4VA 1GT8A 2X3DA 4N7TA 3KK3B 2H5JB 1U1QA 4O44A 3Q23A 3E01B 3U02A 4M5KA 1O8BA 1PJ6A 5M2RA 1IBCB 2RQKA 3SDEB 3MM7A 3Q89A 1ZTWA 3N9UC 1MROB 4JI8F 2DGTA 3DOLA 4RWWA 3W2WB 2L48A 4MFBB 4TU9A 1RLDA 2BJ9A 2MZRA 1JK9B 2M8HA 1R43A 3ZZUA 3K5NA 1D8ZA 2HS3A 2HWHA 3W9HA 2MKKA 2HNDA 1M1KT 3GLJA 5KFRA 2G2OA 3S6EA 1TV6B 1LV5A 3D5MA 4N47A 3QSYB 4NEZA 4NLVA 4C7QA 3H2VE 2VA2A 1XNRF 4JV2A 4GVLA 1S1TB 2XEXA 1LW0A 3N4WA 2H54B 1OWXA 2W2PP 2BR0A 2PT0A 4FNIA 4WBFA 2VQFF 3D54A 2VG6B 3HD1A 1NSAA 3CGIA 4C6AA 4CLKA 2RH3A 3GCWP 4URQU 3MPUB 3EGVA 4DR4J 1WF2A 1HYSA 5CA5A 2QFJA 3OBIA 4ZVUB 2DGXA 4ATNA 2HQIA 2HZVA 1F2HA 3TQEA 4DR2F 4J7CA 5HVFA 1I94J 3HF5A 2I6WA 1TVRA 2MLXA 3M8PA 2J9DE 3VAFA 2R7TA 2XY6A 1R8BA 2B43A 4UOCA 5SZTA 4KGKA 3TAPA 1TL3A 2XS2A 3M6VA 3DLGA 3NCPA 2JJ4D 4P9SA 1GX6A 3GR1A 4JI5J 2BACA 3VWSA 3TI0A 5D3GA 3LWMA 4LSNB 3LTOA 1VJWA 1TZ0A 1SUQA 3ELHA 1MNEA 4ZVHA 4DG1A 4CM0A 2XGPA 1B7YB 2V68A 2ZDOA 3KK1A 2ZHOA 3PRVA 2HIYA 1BQNA 1VC6A 1UWAA 3DDNA 3MR2A 2UUAJ 1WTFA 4DV3F 2FPHX 2HBYB 2FJAB 4FYDA 2UXCJ 4USUA 3ZTPA 3O5TB 5DO2A 1BE4A 5AT1B 3BH7B 3MZIA 3FZBA 1FVSA 2CA9A 4F67A 5AXNA 4GC6A 3KMSA 4DQRA 2OKQA 4KY3A 3RBEA 1ROFA 4TYAA 3UVJA 4U6PA 1UVMA 1FXRA 1HWLA 1VGYA 4LRDA 4OIXA 5T41A 4EMDA 2GJFA 6AT1B 1U45A 3EGWB 3UNGC 3K58A 2ZD1B 2O3DA 5E3PA 2FJEB 4ZVSB 5HMWA 2R2SA 1NK0A 3MMAA 4Y00A 2IBKA 3SMZA 4J9QA 1RQ0A 1X4CA 4M8LA 3EGZA 3KOAA 3EZOA 1N33J 2H9ZA 2WBRA 1Q4RA 2DCUB 3BYRA 2HBZB 3G82A 3OJSA 4JI4F 5C42B 1E6VA 3BQ1A 1HI8A 4DDFA 3OUYB 4ZKAA 3F73A 3RB3A 4B3OB 1TMMA 3W2VB 4ZDNA 1SPBP 3M8YA 2Q6CA 1MU2B 4NLOA 2W1BA 5GAEU 4M5IA 2B0GA 1QUVA 2CJXB 3P5BP 4NLSA 2OPPA 3ZTQA 2JL9A 4K4YA 4DUZJ 1UVIA 3N5BA 1S6PA 3AB4B 2WW8A 1FESA 2EI5A 3GJTB 3LPYA 3EE3A 2ASYA 4OV6A 1VFJA 4YHHJ 2W7OA 1YIJS 4ENOA 2XWXA 4NX9A 4QWDA 4DV5J 4N76A 4LF6J 1Q5VA 3MR3A 3SZ2A 2QN6B 2N7YA 3DOMA 3V6KA 3RG6A 1T11A 3JYTB 3X3UA 3THTA 2DRDA 2EKNA 4KO0A 4KKOA 4EBCA 5IT9U 2DHHA 3CO9A 3QT8A 3QRQA 3T9NA 1QAYA 4AT1B 4WWSA 3ZTOA 4ITSA 2YPYA 1JLFB 4KGVB 1CS4A 1AFIA 4ECUA 1TK0A 4OLOA 1FEEA 3BM7A 3H7HB 3UI3A 4JI2J 4P73A 4DFKA 4TU8A 4LSLA 2NUUG 2J7UA 2WZ1A 1DBDA 3PKMA 1S1VA 1FI4A 2DBBA 2JC1A 3A3NB 3ZZTA 3PR5B 2GHVC 2VIHA 2RHSB 3G8SA 2PA8D 3C8YA 3QO9B 2XO7A 4EI2A 4KHPF 3EDQB 3G87A 2CPZA 3UN2A 1S0OA 1CG2A 4DFMA 1VLOA 2IM1A 3KJVA 4ED7A 3DOMB 3OR2B 3DRXA 3H8YA 4Q8FA 3HFKA 5K9FA 4ANDA 1T05B 1T03A 4KBIA 4YS2A 2UVWA 4O4RA 5KFEA 3EZ5A 1GMWA 3M32A 1RTIA 4MTPA 2B5JB 4I7FB 1RACB 3PW5A 3MAAA 3KLFB 1NK6A 2WONA 1H3DA 1U0SA 2LU1A 2R7SA 4OI3A 2FYXA 1IBKJ 4RBTA 3BYPA 4X2BA 1FRIA 4RWXA 3NS5A 1X8DA 2YKAA 4P6QA 1REGX 3GPAA 3O6QA 4MMOA 4QBUA 1I5OB 1ZZNA 3BB5A 3GIIA 3OFEA 3HHLA 3WHIA 3KYLA 4OI0A 1S6PB 1YSJA 1UCNA 3KJNB 3MD3A 3OQ2A 7AT1B 4JI5F 2BKOA 4LR8A 3IRXB 2RRAA 1KQKA 1PYOB 3FGVA 1SV5A 2KU7A 1IBLF 2BE7D 4H4KC 2XSFA 1ZS6A 4WKRA 2XY5A 4ECSA 2AGQA 4K59A 4PXDA 2ZH3A 2J9EA 2PFDA 3P8BB 1TAUA 4KRWA 1T9XA 2UUBF 2KN4A 2LEPA 3RR8A 1UVJA 4HLBA 1T8EA 3MEKA 1YHQS 1C1BB 2GIFA 5MLCV 2LYVA 4DF4A 2B8PA 4WU2A 2ZZNA 2J9CA 2E66A 2DB1A 2WB4A 2E5LF 2MY8A 3HI9A 5C24A 4NXMJ 1R8HA 2YBVA 1S1XB 4AD6A 2B6AA 2ZITA 2BABA 1Q7LB 2W7AA 1S99A 3I96A 3QO9A 4HH0A 2VG5A 4A8MP 2B4VA 3TAMB 3EMTA 1YZ6A 3DM2A 3C14A 3NS7B 4LT6A 4OI2A 4Y0FA 2ZE2B 4JYAF 3G6XA 1S6UA 2OPSA 1HLWA 3VAGA 2FHJA 2B4OA 2U1AA 2YTCA 3M8PB 4RW8A 4Y6IA 2HMIA 4Q0BB 2FZKB 4USHA 3AT1B 3T6JA 1RADB 3TYTA 2PFFB 5KG1A 5KFBA 1QDUB 2NXJA 3M2UB 3SFUA 2GVDB 1KOHA 4DG1B 4ZLNA 2UXBF 2V8DA 1AYEA 3UCZP 3ETOA 1B7FA 5LJ3Y 2BJ8A 2L9DA 2MKSA 4RW9B 2B51A 3JTNA 2ZH2A 2WSFC 4J9OA 2YKNB 1RHKB 1VC0A 1KVIA 3X1LB 2I5JA 2RQ4A 5KFGA 1A0OB 2LCWA 3P5TL 5IFMA 4QR1A 2KHCA 3B4MA 3B8HA 1YGYA 4ED5A 4NYPA 4USMA 5CHCB 1EKSA 5MAOA 1LWCA 4NOHA 1GXTA 4ILRA 4LF1A 3EYZA 1HWJA 5HLFA 2Q3PA 2N3LA 2VB6A 1FKOB 2M70A 1YITS 1DTQA 2C2KB 3UFCX 2DR8A 1PJ7A 1JLEB 4DSFA 1HNXF 4JI7J 3PRDA 4B9NA 3B6BA 4DQPA 5B0FA 2RMLA 5FLXU 3DI6B 4HT5A 4P7TA 1VRTA 4WXWA 4B9VA 4FF2A 3MMAB 4CWBA 3J81Y 3MOJB 1WUUA 2OPQA 4N77A 4ZVQB 5LSRA 2JOQA 3F56A 2R7QA 2VA3A 2GJ2A 2BEFA 1LW2A 1S7IA 3Q86A 3GJRB 4RNFA 4Z7YA 4ELVA 3NNAA 4TKTA 1OY9A 1WORA 2YH0A 4M5DA 2RUGA 2VONA 3UR0A 5F8NA 2B9XA 3CJRA 4NLDA 4OMFG 4U7UK 5DG7A 3BSAA 1QVGR 3RRHA 3N5FA 3D67A 3M2RB 2CFXA 2VG6A 3OTEA 4AXIA 1WTBA 2XTJP 2D74B 3NMAA 4O4GA 5T14A 4ZMMA 1RGVA 1BQMA 2RDDA 4ZJLA 1XTZA 1HYSB 4IG3B 2BJEA 1HQEB 1SH2A 3I0RA 4UUWA 1L3KA 1QUPA 4C8MA 5D4NA 4BBYA 5I3UB 2CJKA 1HWUA 1JLAB 3UE2A 1QAXA 1GNKA 5ETQA 1UW4A 1F5AA 3LP2A 5GMDA 4ZCLA 2JEIA 2DGSA 3O1LA 2G9OA 3DLJA 4DEZA 4DWIA 4CQ1A 1SJQA 2MKHA 3R3TA 4ED8A 2J8AA 1VMBA 2E7WA 2LMIA 3DC2A 1S1UB 2F40A 3NWGA 4ZLPA 3SV3A 1ZAVA 4LREA 4CTAA 1NPRA 3TR5A 2Y8WA 1WHYA 3A8EA 4RW7A 1MN7A 4IH6A 1GH8A 2CDQA 4NLGA 4HH1A 5GAGU 4EBEA 1G1XA 1RWNB 1FRKA 1TUWA 1TR0A 4CLTA 3NGDA 3L95X 5KG3A 3W64A 2R8IA 1RUSA 4ZLLA 1Y7PA 2AP6A 2WB1D 2XMWA 2V4RA 4ZVEA 2HNZB 2UP1A 4L74A 2PEHA 5LL6d 2UVUA 1FNOA 1IBKF 2DPIA 1KWMA 3ITHB 4OI4A 4WYLA 5DZ6A 2XGQA 1WHWA 4F7VA 5IM0B 2RUSA 4I0WA 1Q82T 5C2GA 3RB6A 1FX2A 1HQ2A 2EPIA 3J81U 1JLGB 1TUGB 4G1QB 4KPCA 5H9FJ 3SCJE 3VGTA 3PIOQ 3DHWC 3JSMA 1RCXB 1UPMB 2F1FA 4ZITA 4WIQA 3HPOA 3GB0A 1GMWD 3JAMY 1VQ9S 2UUCF 5CD4A 2E5IA 1D09B 1RT1A 2QA4S 1XR6A 4X84A 1BY9A 4YDDB 4S0MA 1PYTA 4JI8J 1M1GA 4Y2AA 5F0UA 2HWTA 3PYEA 4NCGA 4U96A 4CO0A 3CJ8A 5CCLA 1HW8A 3HD2A 1V3SA 1UAWA 3TO8A 3VAMA 5HMYA 4ZPTR 4KHMA 2AJQA 1LWEA 4O44B 2KL8A 2WK4A 2HHUA 4PYDA 1PBAA 1RWXB 2VPYB 3KUEA 1NPPA 5KFNA 2V8PA 4CLLA 4CRJA 3I0RB 5F41A 4IG3A 1IKVA 3T5JA 1JLQB 4ZPWR 3AFGA 3KTQA 3HVAA 3GQCA 3BEGB 3G8TA 4MK8A 2PMWA 2F63A 1IWGA 2WVFA 1FTRA 1ICEB 2E5HA 4UF4A 5ETSA 2ZH5A 1SI9A 3H42A 1LOUA 4RX6A 4QWBA 3TVYA 1RAFB 2CZ4A 3GIMA 1RKIA 3CTRA 3IG1B 1I1GA 2A2DA 4MKAA 2O66A 1VHIA 2J0SD 2M4MA 2ATLA 2W2QP 2P9GA 1CJVA 3GSDA 4HL9A 4OYMA 3RGIA 2QO3A 5THWA 1Q5YA 5IZHA 3KLHA 1T3NA 1L3VA 1MW7A 2C3OA 3MM7B 1IKVB 2WBMA 2P6TA 1VQSA 3I0SB 4PAAA 4Y28C 2FDNA 4O3OA 3SI8A 2CVIA 1R6YA 1C0UA 1GX5A 3GILA 1RYSA 4WP3A 4WIIA 2J6UA 2B3TB 2AWZA 4UOHA 3PY8A 2ZZTA 3SCKE 2BJ7A 2LQBA 3MTKA 4HR2A 5HP1B 3FRYA 1HR0F 1XEZA 2UXDJ 4A8QA 4YMEA 3M6XA 1K47A 4LQ9A 2FLLA 5HQMA 1PCAA 1TAQA 1Y3KA 3FNNA 2XWYA 4C8KA 4UZCA 3DLEA 1LK5A 3FFIB 4ID5B 4UQTA 4ZK7M 4Q44A 2IC3A 4ZCMA 3PW0A 4H4OB 4F2SA 3D2WA 2OP5A 3CE8A 3QYYA 4FS2A 1I6JA 3IO1A 1WNEA 3PX6A 3JQJA 4LIRA 2CPHA 4DU8A 5HLFB 3EPIA 4U8YA 5HROA 4FBUA 1KNZA 4XO0A 3IM8A 1KLNA 2ZH7A 4JYAJ 3CC7S 4QR0A 4OQJA 1YI2S 3MHYA 1D9AA 1OSCA 2OPRA 3OFGA 4ZP8A 5KFPA 1KQSR 4ZVFA 1U0HB 2KJWA 4PR6A 1Y5IB 2SXLA 3NAIA 1YJRA 4HACA 1SV5B 3E8OA 2ZC3A 3T9ZA 4ZJOA 3VVUA 1MWYA 4JI0J 4R8UB 2CPYA 3G2XA 3VHQA 5DZ7A 4MJKA 2BOPA 2U2FA 4WE1A 3OT9A 3BKUA 2Y9HA 1BLUA 2OO4A 4FPRA 2YKMB 2MQPA 2XZDB 2CJBA 4DQIA 1M5SA 2BRLA 3KUGA 3NRBA 2BZ2A 4DV5F 2E9TA 4DZ6A 2XS5A 2YWEA 1X60A 1AB8A 4KH0B 3UDVA 2UU9F 2RD5C 4FNHA 2RQMA 4M5JA 1TL5A 4LFCF 3DNCA 2HNZA 4DR2J 1RWMB 1IM6A 4FVCA 4KSEB 2K7KA 3TJAA 2KFYA 1URNA 3PTWA 4OI1A 4DL0C 3SV4A 5I42A 3BO3A 3WIUA 3QGHA 1JLAA 1DTTB 2J9DA 5GADU 3ETMA 2NXEA 3HVTB 1IJFB 5KFQA 4EZ9A 1OSDA 1WC6A 4DV2J 4I68A 4YB1P 1SL0A 1K1QA 2DIVA 2DNOA 2OHDA 2XMVA 3T5LA 2UUAF 5KFJA 5K8OA 1KFDA 1P9YA 2ILYA 4I2QA 4DV7F 2EFOA 5J2QA 1UVLA 4QYZJ 3IFEA 1ZOTA 5KAKA 1FT8A 1OIAA 4FF4A 4W90B 2O01C 1NKCA 4BC7A 2YKNA 4DCJB 1EJ7L 2FD2A 4YB6A 1FJGF 3CJQA 3SCIE 3D6MB 4WFYA 4WZMA 2COLA 2HMIB 4Q0BA 2PD1A 2C1EB 4KT0C 2B7BB 2ZEJA 3C14B 4U7UD 1FDAA 2Y0SD 3AD7C 3CMQA 5HAOA 5CH7B 2WCXA 3K89A 4RKUC 4DL6A 4RW8B 2VG7A 4CLYA 3FEXB 1TV6A 2AV5A 1A7GE 5J1PA 1YJ9S 1WI8A 4IDKB 4M5HA 1U26A 1R6VA 2F8HA 2BX6A 2EFPA 3T6BA 2HNYA 3EX7B 3CCRS 3JSBA 4Y34A 1P1LA 3JS9A 4PWDB 2QV6A 4NA3A 4MAKA 4K4TA 3NL0A 2P2CB 3MD1A 3OR1B 5DDRC 4C98A 4LF6F 4DI6A 3POTB 1WC0A 4I4BA 5DQHA 3DOKB 4U7CA 1RP5A 2IVFB 2WVBA 3V5RA 1Q53A 3M30B 2R8JA 2AW0A 4N5SA 1UFLA 2ZD1A 1FK9B 2EC0A 2IJFA 4C8NA 3H98A 2I0XA 4X4OA 3MMBB 4NLUA 4IO9Q 1ZAWA 4PUOA 3I9V9 4GKKJ 3V6HA 2QSWA 2BA9A 2QGFB 4ZPDA 2GAHC 2GHWA 1M90T 2FVPA 2AGOA 3Q8UA 1D1UA 2LP4A 2D9OA 1DQAA 4KHPJ 1X4FA 2QL5B 4Q5VA 1S1UA 2MKJA 4HI2A 3FC9A 4KAIA 4C11B 3KFWX 3T5HA 3VAIA 3WC2A 3H25A 4FPIA 2OUGA 1IKYB 2LQ5A 2WAQD 2WHOA 3LUYA 1NM2A 1YJUA 2MYFA 4CM2A 4UOFA 1FA0A 3DM2B 5HMZA 3MXHP 4JI0F 3HFZB 3IR5B 4ELTA 2EFGA 4NMXA 1B0PA 4K5SA 5F8GA 3H5YA 5E3AA 1ULRA 1IQTA 1PJ5A 2K3KA 1TP7A 2PMHA 2A6OA 2RU9A 4L73A 1S49A 3TEGA 2GIQA 2P6SA 4ED0A 1TL4A 5HN0A 3BSOA 3AJ2A 1Q8BA 4DV4F 5BR8J 4PQUB 2NXNA 2RNEA 4ECZA 3CJSA 3K2YA 4JB8B 2V9KA 2XCAA 3QFWA 4FXDA 2KZMA 2WVEA 3VZHA 1MG7A 1NSPA 1HW9A 2J6TA 1W25A 3LQVA 3BF4A 3MEGA 3J80U 1N8RT 2ZFHA 4GVBA 5KFXA 1WD6A 4PXCA 2LLZA 3HSJA 2ROEA 4NLWA 3AODA 4OHVA 3ZC4A 2KH9A 4WK3A 3CUNA 2Q66A 3LP1B 5HVGA 1NHUA 1W7WA 2H4WB 1TVRB 3KJQB 4HTIA 2VOPA 4RNNA 2HFVA 3D1HA 1B0TA 3PO5A 1RI7A 4NWBA 3TUZC 5C25B 1FDBA 1WDDA 3Q24A 4NZ7A 5ADZA 1Y10A 3MCSA 5L1LA 2BJ1A 1FDDA 1NRKA 4KYZA 4MYTA 2CNOB 2QIFA 5CYQA 4DL4A 4CO5A 2R4FA 1NEEA 4P2SA 1S9EA 5LOQA 4LFBF 1AW0A 1IJEB 2KRRA 2ZBCA 1ZPVA 2B7CB 3N6NA 5KT7A 1IBMF 5KFTA 4DSEA 1TFYA 2FJDB 4ANEA 2GAGC 2F8MA 1JLFA 1T94A 3FZ2A 3N01A 4EYIB 1NPKA 4ERDA 2HRUA 3M9OB 2FJBB 4AQYJ 4LSLB 5JJBA 4XDDA 5F9LA 1S7HA 4G65A 2GA7A 3BDEA 1WKKA 3KLEB 1CQMA 3P3DA 2ZJQQ 4ZVGA 2MGZA 1WG4A 3V2UC 3FBEA 3FUYA 1NB7A 3DYAB 3GFZA 1EARA 5DETA 5KFDA 5C25A 3BN4A 3H5XA 3CCVS 3BBFA 2JDJA 1MN9A 1NXIA 2L41A 4ED3A 3MMJA 1S0MA 1TKTA 5GVQA 3ISZA 3Q8RB 3HULA 1RDRA 4RW6A 3CJTA 1CQNA 3QT6A 4WFNQ 4K4ZA 3ZNJ1 1WACA 2BJDA 1F3VA 4CO4A 3R5AA 3HKZD 3K7RA 2DEJA 5KT4A 1C4AA 1JX4A 2YPZA 1NUEA 3MM6A 3OD2A 2KXHA 3OVSA 2G4BA 4B3OA 1JKHA 1YQHA 2OSRA 4I2QB 1H72C 1S10A 4TXSA 5K5MA 2HHQA 3OTOF 3IS9A 1VLYA 3ULHA 4L6V3 3W8PA 2FLPA 3SSSA 2OLWA 2WRMA 3HJVA 3O44A 1X0FA 1XBWA 3MM8A 1RABB 2GIRA 4A48A 1NBEB 4K2XA 3HO1A 4NCBA 3VTIA 1RWUA 3M9NB 3MAQA 1QLNA 2XYGB 4OYXA 4IYQA 2RILA 3FCWA 4Y2IA 2MJUA 1TTHB 3CDAA 4XPCA 1ITPA 1X5SA 3A8KA 1NJIT 2FJWA 2ROPA 4ZP6A 4CO3A 5EWGA 2FHOB 1CBKA 4RU9A 4ECVA 5HL7Q 3RB0A 3U7JA 5H9FK 5BXIA 3IRXA 3HZGA 2DNGA 5DJBA 1S72S 5CYMA 2EWHA 3C16B 3IA0A 2XNQA 4NLXA 4B02A 1HBMA 1YK9A 2Y1LB 3R5JB 5CYJA 3IS9B 3VCDA 1BC6A 1N56A 3ICLA 4J9SA 2X7IA 5D4LA 2YY3A 3EM1A 1NDKA 2XMTA 2YKMA 3TZWA 2KG1A 4LQ3A 2AZ3A 4NXNF 2B5JA 2A3JA 2FHKA 2A0FB 2GGPA 3SIPB 5DGAA 2GZOA 2KYXA 1NZAA 2KT3A 4DR3J 1CULB 1KHVA 2CDRB 2NXUA 4AE5A 4RUBA 1KS2A 2YNHB 4O23A 1KQFB 3CCTA 1N6QA 1XWLA 1HQUB 1LFPA 3QMQA 4JOUA 4E98A 4UT4A 4DL2A 2N82B 2W9AA 4H54A 2NR0A 2VU5A 4WYWA 2G0IA 3UDLA 1JXLA 2CPFA 3TJ8A 3KLIA 2LU2A 5BR8F 3NGRA 1D3WA 4MYUA 5HROB 5L1JA 1VBYA 3IXQA 3PW4A 4W98A 3IC1A 4PKDB 3JYTA 5LMNJ 4YFUA 1W2IA 3T1YJ 2FY8A 2B9EA 3NMRA 1J27A 1VQOS 1UA0A 2Y0BB 3Q0AA 4X4TA 3TJ9A 5F0WA 1NH7A 1FCAA 3D3CJ 5A8KB 3G6YA 2ZH6A 4JI6F 1OY6A 1DLOA 4NZ0A 2EFNA 3R7SB 1VQ6S 4OFZA 4GO7X 5GAHI 2VL1A 3FEYB 1B3TA 1NJZA 1OQ3A 3CCWA 2CQCA 4UTGA 3AOBA 3V81A 1HNZF 1IN0A 1OYEA 4Z7CA 1WC4A 3A8IA 2UXDF 2NUHA 5A8WB 2APOA 2WVDA 3EICA 1HNWJ 2CQ1A 3F41A 4DQSA 2J7KA 3US5A 1C0TA 1JB0C 5GAHU 1HBNA 2ZBIA 2EC2A 2PGCA 4NLQA 5KFLA 3Q8SB 4PWUA 3BZQA 4LFBJ 2QL7B 1WI6A 1C2PA 1DAXA 1HNIA 2NYHA 4RO0A 3QLHA 2XLKA 4K50A 4JBCA 5D3GB 1L3SA 2DD8S 3K17A 2VPWB 5IV4A 2X1FA 3SQOP 2BM0A 4X62F 3CC2S 4F50A 3C2PA 2OEJA 2DGOA 3OFHA 3A3PB 5K20B 1H2TZ 3CMAS 2IRYA 3CT9A 3NBPB 2RQCA 5KFKA 1SL2A 4K4XA 2AU0A 4YOEA 3W60A 4AFFA 3SYZA 2ZKTA 1KFSA 3L9ZA 1LFWA 2A6MA 1NSQA 1X9WA 4NLTA 4WP8A 2UUWA 1DHMA 3MMCB 2UUBJ 4HHHA 5D4PA 2MMYA 3KLHB 2AJ0A 1XMQF 3VALA 1S1WA 4LBHA 3MF5A 3WC0A 2D3UA 2XMUA 3QWUA 3OSNA 3UR3C 4IO1A 4DZDA 4JV5F 2CXEA 3QRRA 2RHQB 4BS2A 4K4VA 4FXVA 2LA6A 4DS4A 4YR3A 4DSKA 1YRUA 4MH8A 1FNXH 1TKZB 1FXDA 3GR0A 5D4OA 3OSPA 2RKIA 1EQ0A 2JZ5A 4P2XA 1SCJB 5LXRA 1TUVA 2YNFA 5AJ3J 3J7ZT 3MUMP 4TU7A 4KGMA 1NJWA 3MM5B 3RW7A 2ZBRA 3P45B 3T41A 4C3MA 4KV8B 1NU4A 4IFYA 3NOGA 1XR7A 5KFCA 1YTYA 2DISA 2JLFA 1K9MT 4F4WA 2DY9A 1OMSA 3OW2R 2OD6A 5ETRA 1U6FA 2EXUA 1WDTA 3N6LA 4QIFA 4IUFA 2YXLA 2HFUA 2HYIB 1TFWA 3CF5Q 2V69A 4QOTA 2DNLA 5BJRA 2CNKB 2V4QA 2C2MB 1OQ6A 2M88A 2OPRB 3QWPA 2DXFA 5A6WA 3M30A 4Y2KA 5L9XA 3VAKA 2J0QD 3DU6A 3LAMA 4FYXB 1AZSA 5B0DA 3O8WA 1GTHA 4IQXA 1UZDA 3LAKA 2R7OA 5KG0A 4Z37A 1NDCA 2FLNA 2HHTA 3UCGA 4MFBA 3BGLA 4WFZA 5F3ZA 2R2TA 5EX0A 3GFXA 3KHGA 1JLGA 2K3IA 4UY8T 1FJGJ 2LVWA 2MQMA 4USKA 1N36J 2Y1RI 4UZBA 4KIAA 4ZA1A 4UW2A 3ZTSA 1U4BA 4NLRA 3TX0A 1AT1B 1Q16B 3IGNA 1R7IA 2M3DA 3IWLA 3T19A 4J9KA 1F6TA 1GMUA 2F4FA 1X4BA 4YB5A 3CEDA 3BJYA 4AQYF 3OVBA 4DR6F 4C8ZA 4CDIA 2LXUA 1T02A 1P9QC 3CIMA 3OXLA 3RJMB 3NNHA 3CJ5A 1GEHA 3D28A 3EGNA 5CZXA 4ALZA 2DGWA 3H0PA 2DR6A 2HVZA 3TAQA 4OZ1A 3R2DJ 1HWIA 4X4SA 3IAS9 2VJUA 3I31A 4J9MA 3RW6A 3RAMA 3BGOP 2UUTA 3JAMU 4W4MA 2HGLA 3GIKA 5CAAA 2N7CA 3KHHA 3IWNC 3K0JA 3RAXA 1UVKA 4OZ3A 2PDAA 3NKYA 5EN1A 2GMLA 2W2OP 2W2MP 4LF2A 2FJXA 1Z1ZA 2KKHA 2P8IA 3H40A 5BYSA 3TVZA 4BHQA 3ZZYA 1DJ0A 2BQ3A 1O0PA 3FSIA 2N4CA 2CPJA 4DR1J 2AJ1A 1WC1A 4IR1A 2VPZB 2HHWA 2JEFA 4UOGA 3QGPA 4QIGA 1REVA 3EXCX 3DMJB 3CMES 1RU1A 2NS1B 1U1KA 3CD0A 3VF0B 4CLPA 2D3ZA 4C2MA 3N28A 2IRUA 1S6OA 3I5BA 3HXMA 2RIJA 1LKZA 1AZSB 1IUJA 4P2MA 2GCFA 5A0YB 1JXVA 2VFVA 3UWTA 1TL3B 4A4JA 5KFMA 2GNKA 2IDLA 2OEMA 4OYPA 4DV2F 2HLTA 1NK7A 4IRDA 2MZQA 4Y2MA 1R31A 3M8QB 1X4GA 2ATCB 2CQGA 3Q83A 2C2EA 1KSPA 2ZNYA 3PO4A 3W5XA 2J5AA 3W7BA 2KFNA 1DLOB 4MIBA 1HD0A 3GTYX 2AIRB 2DH8A 2OPQB 2RS8A 4JV0A 4AYBD 2JLGA 4NXNJ 4WPAA 2W25A 1PIEA 3RZAA 2NZCA 3T3FA 4F8RA 4ZOSA 3TA2A 2IVYA 2FGCA 1T95A 2RSQA 1YX2A 3QIPA 1N5YA 1Y9OA 2XLIA 1F0XA 4JV5J 1HR0J 4PQAA 3OTBA 3CC4S 2QMWA 3R7BB 2CIMA 5T7LB 1S12A 1SH0A 1JLQA 5A8WA 2ZJPQ 1RJJA 2XYHB 4KFBA 2OFHX 5D78A 4XDCA 4ZVOB 2DNRA 2E5LJ 4NYOA 2F5GA 4U8VA 1NJXA 3QLHB 4RUHA 1YVFA 4M95A 2YH1A 3HCXA 4NCAA 1EAYC 4BWJA 4N56A 4EO8A 2XULA 3ONQA 4WTYA 1KN6A 2HEKA 4PXBA 3CD6S 2BANB 2DKOB 3AQPA 3PJXA 1YBTA 4QIEA 4WFXA 5D77A 4DN9A 2M8DB 4JI1F 4HHUA 2OJ3A 4ELUA 1H98A 2HIQA 2R7UA 2FVCA 2ASJA 3M2UA 1WC5A 2LKZA 2FVSA 5DLGA 3BSNA 4IR9A 2UXBJ 1J2VA 4X64F 2OPPB 4CLZA 1EKRA 1I51B 4J9NA 2BE2B 1AA1B 1C0UB 2E1PA 2F65A 1N5TA 3A13A 5KOWA 2ZDPA 8AT1B 2VDHA 3VGVA 2BXJA 3PEHA 1N34F 4DR4F 5KG4A 1U6BA 4EZ6A 3BREA 2UU9J 3ZO7A 2H3EB 3SSQA 5KTQA 5JUMA 1Q8LA 2LXIA 1RK8A 4I56A 3LALA 5E2QA 2FZGB 1SKWA 5DDOC 2HFSA 3U1LA 4KC5A 1SB6A 4M94A 4DPTA 5C7PA 4YP3A 1T9TA 4GRSA 5BYRA 1VK3A 1U49A 3GCXP 2W7PA 2LQJA 3FBBA 3PKYA 3V6DA 5KFSA 2DIUA 5LJ5Y 4P71A 4ECXA 4RLEA 4YY3J 1N32J 2YNHA 3TA0A 3DLKB 3MEDB 1NKBA 3QIDA 4DR7F 1TU0B 1K0VA 2E1MC 3AOCA 4HDHA 5T7LA 3GYGA 1U8WA 1KVKA 1TKXB 4J5OA 4B17A 4QZVB 4LF8F 3BO2A 2G1DA 3R5BA 4LSZB 1Q7YT 3QQCD 1RHMB 2B4PA 1VBXA 4B3TF 3H2UB 2A2CA 5EGYA 1RT2B 1FKPA 1RHRB 4CYUA 2JH3A 4DF8A 4OLPA 2ZH1A 1T9UA 4USVA 3J81j 1VI7A 1ACMB 4J91A 1MSWD 1WSVA 3RRGA 1QTMA 2AHOB 3W62A 3FEZA 4I67A 2Q43A 5LMUF 1H2UX 1OPIA 4DPWA 3CCSS 2HVHA 1WEXA 1YJWS 4EBDA 4FKYA 4A8SA 3HHNB 5F8LA 1N88A 1LWFA 2DNQA 3KMQA 3KHRA 2XI2A 4C8OA 1U8SA 4O3NA 1Y3JA 2PI5A 1TL7A 4DUYJ 3SCLE 1FEHA 2D7SA 4DV6F 3H4DA 3TQ1A 2BE2A 1NMEB 2CQHA 2PSZA 2E9RX 1Z4UA 1HFEL 1Q8KA 3LP0B 5ETPA 4DL7A 2D41A 1PAEX 3MCNA 1RT5A 2P5VA 1TKTB 3FSXA 1IBMJ 1XJWB 2GVDA 1NK5A 3L7OA 2KM8C 4YR0A 3MMBA 4DX6A 3MWBA 4PUOB 4M5MA 1R0CB 4KO0B 3ILJA 2XNRA 3BKTA 4ZVPB 2FC8A 2W2NP 3DGVA 1Q81T 5JMNA 2Y8YA 2DITA 1VYAA 4L3NA 4B9TA 2DHGA 3TANA 1CC8A 1RBOB 1UVNA 2QEXS 4FS1A 5G4DA 2VQEF 3CWJA 2IPOB 4PABA 1RT7B 3DLHA 1VC5A 4QPTA 1HWKA 3BGRB 3AJDA 1IVZA 1OY8A 2HHPA 5JVHQ 1SC4B 2V2ZA 3HVWA 2BUNA 1MMNA 2XCPA 4GKKF 1F2GA 2XSJA 3I9ZA 5DG9A 3DLKA 3MEDA 2XZTB 1QY7A 4NA1A 5ETNA 1VJQA 2HGNA 1Q95G 3I5CA 1K8AT 1D9FA 2DRAA 1VQLS 4A8WA 1RT5B 3IP0A 2A10A 3PHTA 5L38A 3OR2A 1YRXA 4R0JA 3W1YC 1RAEB 4XPEA 1M5KC 3FJ2A 2D3OR 3Q8YA 1JQGA 1X31C 3TWZA 1HBMB 4QR2A 5HI7A 5CCMA 2V4JA 3GMGA 2HG4A 2KT5A 1NO8A 4X4QA 4IOBA 5KFOA 3PYFA 2HNYB 1IWAA 3KK1B 1N4LA 2E44A 1L3TA 2WONB 1LK7A 4PYAA 2L9NA 5HVHA 4OYZA 3TOQA 1FWKA 4LF9J 3OTDA 1CS4B 2ACMA 5GADI 2UV8G 1RYRA 2E1CA 2XBPA 1X4AA 2PEBA 1SKUB 2DT9A 3BSCA 4YEAA 1TL7B 1X4DA 1AUDA 3G71S 4C11A 2ASDA 2L9WA 1UJ6A 3HHLB 3MR7A 2YWWA 2MQNA 2Z2ZA 5FD1A 1XC9A 1I94F 4O0IA 2ZH9A 1X5OA 2NSCA 1RAAB 2AMCB 2OI2A 2WOMB 5FLXY 3T1HJ 2D1CA 1Z2LA 1XR5A 4IH7A 4ZP7A 2QMXA 2V8GA 4QYZK 2BMBA 1RE1B 4BDPA 1YJVA 2CVEA 4UUXA 4IRKA 3UQSA 4OJHA 1RHJB 2GV1A 5FIIA 1YBAA 5CZVA 3NP5A 1RU2A 1HPZA 2YVSA 3FQKA 5B0GA 5D6GA 2QT7A 1U02A 2E1AA 2HQCA 4ZHRB 5J2NA 1XMQJ 3CCES 2PN6A 4FZVA 4NASA 4QQBA 2G13A 3W2VA 3MFIA 1RTIB 3OUYA 2HLUA 3IG1A 4A8YA 3ILIA 4CLSA 1RT7A 3EZUA 1VRUB 2MKCA 1JLBB 4OX7A 5H1SV 3V4IB 2EW9A 3RTVA 4LRFA 2DNKA 2F7VA 1EQMA 2RF2A 2BKPA 1SIWB 2RRNA 3HX9A 3RR7A 3OPKA 2PO4A 1V5VA 2AEMA 2HQFA 2ZE2A 1U0HA 3H20A 4I6AA 2YX7A 2ZKUA 1XK8A 3BBBA 1LNQA 1Q1KA 3E3XA 4CT8A 5J2PB 2HVEA 1NHKL 1KHWA 3CJ2A 4HVZA 5J1EA 5H9EK 4NE9C 1TKDA 1SC1B 4EO6A 4C8YA 3CSKA 1PC5A 3LGNA 3WX4A 3AB2B 4EEYA 4CP5A 4P7VA 2RDJA 1NB2A 5CYQB 1RWOB 4NCGB 3A12A 1AXQA 2HQ3A 2MB0B 2RAQA 1Q0NA 4OZ2A 1VQMS 2QRRA 4ZLJA 2AX0A 2IAJA 4IKAA 4YQWA 1IQZA 2QE5A 3I32A 4HTJA 2CQPA 2Q79A 2DNHA 5E0OA 1QD1A 2BYCA 2IHR1 4OHWA 3AA8A 3MUTP 4ZN1A 3IGVA 2W8KA 4KFBB 2QFIA 4NRUA 2V0NA 3C15B 3PIPQ 3PVXA 3V6JA 1CEZA 3UN3A 3D3BJ 2GO8A 4G1PA 2FVQA 2V63A 5B09A 2EG1A 5J1EB 3G96A 4WFAQ 4DR6J 5B08A 3CDUA 2LEBA 2HBQB 1WOSA 3I82A 4URGA 2CRLA 1ZA1B 2HBRB 2HFZA 3QZ8A 4PPZA 1JMTA 2P9EA 2HAFA 3HHLD 4G6VB 4CLFA 2HHHF 2OIHA 2ZJRQ 2BANA 1CJTA 4N41A 3A3OB 1U24A 4QU6A 4B3RJ 1RT4A 3U27A 3TUJC 3BQ2A 1G2EA 3PX0A 2NCKL 3TVKA 4JUZA 3DU5A 2AD9A 3HT3A 2KJVA 5DRKA 4Y65A 5B0EA 3H90A 5D0RA 2J6SA 5K8PA 3MTJA 3Q8VA 4X66J 4D3GA 1CC7A 3GG0A 1FJCA 1QSSA 4HYKA 1T9YA 2QLFB 4NLYA 2Y3YA 2DY1A 4FF3A 2R7RA 1IKXB 4RW4B 4AUKA 4LRAA 1OPZA 4LF8J 2FUG9 4R0EA 3FCHA 1QVFR 2HHSA 3DRYA 2CQDA 3G86A 3CULA 4DR3F 3C6UB 2GO9A 3MECB 2MZJA 3B78A 3PYDA 4WF9Q 2DK2A 2ALYB 2WW4A 3GG1A 4WZQA 2QYCA 2CADA 2IVMA 3W63A 3HFVA 3NBPA 5HK4A 4EGLA 4LF9F 2AGPA 1S0VA 4DPYA 5HQLA 2FB0A 2X1BA 3CDBA 3GYNA 1RTJA 1SUQB 2YNIA 3C66A 3PDNA 5DDQC 4LSNA 3KLGB 1YJ7A 1N0VC 5SUHA 4IRCA 2VV5A 2CQ0A 2KDOA 4BWMA 1NK4A 3MGJA 4OV1A 5J1NA 2Z57B 3NG8A 4O3PA 4TQRA 1U1LA 1FXLA 1KOOA 2E1RA 3OFFA 3NNCA 3DMJA 4YB7A 4RNMA 1R27B 2CPDA 3DOLB 1C0TB 2C2RA 4C0BA 3KK2A 1D9DA 2HW3A 2VPXB 4ED4A 4P52A 3NXZA 2MQOA 1N5VA 2K2PA 2MZTA 3C6UA 3FCVA 3GE9A 1F5BA 3PR4A 3OHAA 1U48A 1UFKA 4ECTA 4QCLA 1QE1A 1Z2ZA 2MSTA 3CJ3A 2M52A 2DGVA 3OJUA 1VQPS 1UETA 1LW0B 1FK9A 4LR7A 3NEKA 4N8OA 5D0GA 1G7CB 1RCOB 4A8KA 5KFZA 1HBUA 1XQIA 2MLYA 4FYVB 3VV2B 4OHYA 4K0KF 1B64A 1S0NA 3OL7A 1IR0A 1RT1B 3QAEA 1DRZA 3NLCA 3PHEA 1SXLA 5EDWA 4C8LA 3G9CA 5A8KA 2UUCJ 4ZJQA 3EWGA 2QL9B 4DPXA 4MT1A 4F0MA 1O51A 4ZP9A 3KK2B 3KNGA 5E5NA 4KGZB 4CTAB 1GTEA 2O67A 1GK8A 1UA1A 3HP6A 4XK8C 1BMQB 1E6YB 2AEJA 2MQ8A 2DXEA 2MQLA 3MPDA 3PACA 5ETVA 3ZZPA 1IXKA 3LWLA 2Q6BA 2OFGX 1TK8A 4A8FA 2L08A 3CDEA 1U25A 1CSJA 4DXLA 1RTHB 1RT6A 2FY1A 3MECA 2AT1B 5CABA 1BQNB 1EHWA 2GJIA 2ZOFA 5E7OB 3SXLA 4QWCA 2RB7A 2HFNA 1QJHA 1ZPWX 1Y5LB 3D1QA 3QIPB 5AXKA 2N3OA 4WFBQ 4CLUA 4QWAA 4X4UA 3ZNUA 4DV4J 2D69A 1VRUA 4DX7A 4B3MJ 3BV8A 3EJMA 1RWWB 2QA2A 2QA1A 2E5JA 4CH0S 3CCMS 1O6XA 1P1TA 1RHUB 1CJVB 1YRTA 1RAOA 2AJ2A 3BH6B 3R5GA 2OH2A 1KBRA 3R9LA 1N6QB 2VODA 4C9DA 1E6YA 2UV8A 2OSQA 1FVQA 1S59A 1XMOF 2HAIA 4F4AA 1GQEA 4ES3A 2BQUA 3VR1A 2JEGA 3KDNA 1S97A 1DFDA 4C97A 2G0JA 1RAGB 4CLWA 3LANA 4X4NA 1UEVA 5EUHA 1IBLJ 2C2NA 4M5NA 2ASLA 2ZVSA 2OGUA 1RT4B 3EVWA 2CKWA 3VZIA 4F26A 4DV0J 1G3OA 3UN5A 1WJ9A 2BE9B 3UD3P 5KFFA 4PQUA 5DM6Q 5FJ4A 5CYMB 3EDRB 4DV3J 2RKIB 5F8IA 4X66F 1VQ8S 2C3MA 2POKA 4ANCA 2V5HG 4P2FA 2XZWA 1S77D 1U6ZA 3E2EA 3D66A 2JFKA 3MM5A 3SQGB 2J76E 1NKEA 4JI3J 3M6UA 2EFVA 4HKQA 3M2VA 2VG5B 3BKFA 1S4EA 3D68A 2DGQA 3GP9A 3M05A 1L5UA 4BCAA 1SKSA 4OZLA 3LH2S 2VFSA 2F4VF 3K5MA 1NZ8A 4J90A 2QZ8A 3C6TB 4ZIVA 3BR9A 3Q22A 4KJIA 4RW6B 1HNIB 4L75A 3TZYA 3OL9A 1Y0HA 3ITHA 2LXFA 2WOMA 1Y00A 3LPEA 4OX6A 4TNOA 3OXGA 5K14A 3KLIB 1RTZA 2HKEA 4G1QA 2RU3A 3QGGA 5EWFA 5I4MA 1FRXA 3AAWB 3THPA 1JKHB 3HSGA 2CPIA 4LVNP 5IS2A 1ZA2B 2I2YA 4DUYF 3CCQS 2Y1JA 2M0GB 2GQCA 4DV6J 1JWWA 1S6QA 2MLZA 1N5SA 1S9GB 4XIUA 3KNAA 5D8HB 3D6TB 4TY8A 4EYHB 1B4SA 4DU7A 1BHNA 2RE1A 4TYBA 1FWPA 2V2VA 5DLFA 2ALZA 3DDKA 5A2QU 3HSZA 3N0VA 1U1RA 4OJGA 1KVJA 2PC6A 3EUNA 3HLUA 3W5YA 2OEKA 1WEZA 1NAQA 2RF2B 1FKOA 3A1YG 3IBCB 3VGUA 3UPFA 2KTQA 4O3SA 1UJ5A 3IBWA 3QZ7A 4K4WA 1HBNB 1URRA 2Z30B 4DLEA 4PEOA 4K0KJ 3DGPA 1UKUA 5K8MA 1FE4A 4ICLA 2ZH8A 1S57A 1VIXA 5ETKA 1CJUB 2HURA 2ZHBA 2AEFA 1QTNB 2EFQA 3D6HB 3A4TA 3D4JA 3H5SA 1F9FA 1C1CA 2KYZA 3PM9A 4YY3F 5IOLA 2GGPB 2KZZA 1VS3A 3UD4P 2DHXA 3R6GB 4KHRA 4LRBA 2ZBPA 3CCLS 4DR7J 1T9WA 2F9JA 4PZVA 5ETMA 1N5YB 2RS2A 3QRPA 2F9DA 3G6VA 3RBDA 2R2RA 4HT7A 4HDGA 3ISNC 3ENWA 4DV7J 1R3NA 5F3TA 4B9MA 1JJ2R 3F44A 4PG6A 1CVJA 1P6TA 3I4PA 1JLBA 3CJ4A 4YDXA 3V4IA 2V8VA 5F8MA 1GMVA 3ZZZA 4MK9A 2RDIA 1WG5A 3TW0A 4ICLB 3EPGA 4P75A 2YWKA 5FDLB 4GKJF 1R0AA 1RA6A 4EU0A 4OYBA 4NLPA 4LF4F 5DDPC 1X9SA 2M9KA 2DHSA 5A0YA 5H9EJ 1KQGB 2VF3A 3K5OA 3PYGA 3VQTA 4ZS6A 5LMNF 2VBZA 3T1YF 1X0PA 2CNLB 3KXDA 4C0OC 2PI4A 2V2KA 4LF5F 1LW2B 5HANA 1X7VA 1XMOJ 5U47A 2XSJB 2JWNA 2LFVA 4AXJA 1KDNA 1KP6A 2I1RA 2BVZA 2CZ9A 3QPIA 4K7QA 7FDRA 3I87A 2V67A 1B0VA 1SQEA 4USTA 2DNZA 4A8XA 1JNZB 2LQ8A 2X1GA 4NI2A 3SBMA 3QJPA 2GVZA 1RTDB 3RRKA 1N0UA 4GMKA 3HT0A 4DV0F 1S48A 2CQ3A 2Z56B 2XLJA 2RJZA 3GJQB 1HA1A 1UMJA 5EX3A 4QWEA 4DX8H 4G1IA 1RA7A 2B4UA 3NGUA 1HBOA 3OVAA 4I1TA 3WZ0A 5HSPA 4DLGA 1ZTTA 5B0CA 3GWCA 3PJ9A 3MDFA 1RISA 4WE1B 2DHAA 2FGOA 2F3JA 3PNIA 4F3OA 1F9EB 2KO1A 4OYIA 3W61A 4JI3F 4F02A 1UEUA 4HHJA 2H5IB 4P10A 4DMZA 3Q2TC 1CLFA 4USWA 2ROGA 1UZHA 2ZOGA 4R25A 1HD1A 2KXFA 1C1BA 2CQIA 1UWBA 2DNMA 4LVOP 4EWTA 3V6DB 1AROP 3VAJA 3LO3A 4Z2XA 2B6AB 2BOAA 3T5KA 2IMOA 2X51A 3OV7A 2XM3A 2R2UA 4ER8A 5GAEI 1A6LA 2IJRA 2XHWA 3DYAA 5F8HA 4OJ1A 3DLBA 2H65B 3JXOA 4OX9F 2IYGA 3ET6B 2YKPA 3LGHA 3W2WA 1GAOA 1K44A 1YBUA 2MHEA 3MEEA 4NPOA 4ZPVR 3WIVA 3ZXWA 3LF0A 3R1HA 2R8GA 1R8PA 4OHXA 1VQ5S 5A76A 1APSA 3MM9B 2RVJA 3L7UA 2MJNA 4Y3CA 3Q2SC 3AXKA 3FRZA 4WTOB 1AUSL 4CYUB 3ENAA 2NPFA 4C3KA 3M8SA 2DEIA 4LRCA 1WEYA 2ERRA 2JEJA 1H0HB 9ATCB 3D0IE 2ZH4A 1U09A 3D9BA 1J5OB 5I3QA 3BGRA 2VBXA 4MKYA 1DARA 1Y4ZB 4O4GB 2QA4G 1VIOA 1FWLA 2C2DA 4DL3A 3QAUA 2HHHJ 1BD6A 4BLGA 1N48A 2PA3A 3LP1A 2C28A 1GFWB 5ETLA 4ECQA 4NI2B 2P9CA 3DXBA 1F60B 1BWVA 1IKYA 3H59A 3M8ZA 3TEHB 8RUCA 5KFWA 1T05A 2MHNA 2CJ9A 1CJUA 3M1VA 4RUAA 2ZNZA 4CO2A 5DM7Q 2IDEA 2CWKA 1MMDA 2QLXA 1VRTB 3JTPA 4CH7A 4ES1A 5IV3A 1EP4B 3ENVA 2CNNB 2GFFA 2DO0A 4I2PB 5AE1A 1PSDA 3LOUA 2KFZA 1FKPB 2A18A 3RBZA 2UXCF 3BBCA 3OXFA 1S9GA 3CJ0A 2IA6A 4F36A 1A9NB 1CJKA 4MKBA 1VBZA 3CVKA 1N36F 3R7NB 3MAAB 3KLFA 5F9NA 1JLCA 1KLMA 2XS7A 3C46A 1X5PA 2JFDA 1ZM4A 3O3LA 2J0WA 4NYZA 1RZMA 2FHJD 3IR7B 5CQGA 3K59A 4LF4J 3MEEB 3ENQA 3ET6A 4ECWA 3R6LB 1EIYB 4C4WA 3HHDA 2IM0A 2DH9A 4L3KA 4OZNA 3W9IA 5L1IA 1R0BG 2HRTA 3IBFB 3CO0P 1RLCL 4KKOB 4WKYA 3MPYA 1NSKL 3LW5C 4FF1A 1RWVB 2B9WA 2FZCB 3A8JA 1NDPA 5AE2A 4DBQA 4CCHA 3MM6B 2ACYA 4F4XA 1BXNA 2X1AA 3G8QA 2UZAA 3CDWA 3SSRA 1MLAA 3UD5A 2GMHA 4K8RA 1S5ZA 2J7WA 2JVRA 2WSEC 1QAJA 4PXEA 2OMOA 1F3FA 2Z2MA 1WSRA 3PFOA 2H4YB 1U7LA 4J9RA 3GZ7A 1T9VA 4PG4A 2ZWOA 3ILOA 1SJ1A 2R42A 3MCOA 1M5PC 3R8YA 1ZAXA 2AQ4A 3M9MB 4RZRA 1TKXA 5IT4A 4V19J 5L8RC 3KLEA 1YZ7A 1UJ4A 5F8JA 2QG9B 1X5TA 1REVB 2BW2A 1H74A 3DOKA 1T3OA 2AJFE 1ZZFA 2DTJA 4DUTA 5KG5A 1JJHA 4CO1A 3HMJG 4PPDA 4A46A 2FIUA 1R0AB 1OYDA 3EVOA 4ID8A 1G6BA 1VHFA 3MAHA 5KT2A 4B3RF 3M32B 3GSIA 4R8UA 1F5CA 1RWPB 2CJYB 4DJBA 3L3CA 2KHDA 4DV1J 3PV8A 1AFJA 1V3RA 4KGXB 3F0NA 4EUVA 1HPZB 5E41A 3M8QA 1H7WA 4RNOA 4KPYA 2DCLA 2HS0A 2LDYA 4M5GA 1JJCB 4MIWA 4NEYA 5HBMA 3M8RA 2ABYA 1NCLA 2HFOA 4WJBA 4J9LA 2OTJS 3B82A 3CXCR 2DNYA 2VKRA 2PMZD 3TX8A 3TUPA 2BW7A 2R9LA 1RBAA 2V6AA 5L1KA 2C3UA 3EXYA 3IN5A 5KFAA 2OAUA 5E3CA 3D0GE 4LIWA 2KB2A 4R5PB 1U2FA 4L76A 1FHTA 2JX2A 6FDRA 1FD8A 1TKZA 2HK3A 2HK2A 2HZAA 3CNQP 5AXMA 3GV7B 3RUBL 4DR5F 4B3MF 1WF1A 1XN9A 1RT3A 1S79A 3MOZA 1FRLA 3ZZOA 1KONA 5K14B 1N54B 2YNGA 4DSLA 2ADCA 1FTCA 2EVZA 1C4CA 2DO4A 3LGMA 1IR1A 5ITHA 1SKRA 2HQGA 1O5JA 2CPEA 2IY5B 3B54A 1JXEA 1KKHA 3WQPA 3CCJS 2BRKA 2HQDA 4RR5A 2GQ2A 3U1NA 1KEKA 4TQSA 4MK7A 2FQQB 3M6WA 2QLBB 3R5DA 4ZCKA 5LSLA 3HHLC 4JI6J 5CD4H 2Q1LA 3FVYA 1IKXA 4RW4A 2EKYA 2DYAA 3VAHA 5IT0A 1Q78A 1RWKB 3C15A 2W4PA 4X64J 1VRQC 1RTHA 2H48B 3CJKB 1KC8T 5HMXA 5DS7A 3DGPB 3O2IA 3KG4A 1UL3A 2EK1A 1NNDA 5HATA 3UDEA 4O3QA 2I8EA 1UTAA 2XMJA 3UNYA 4C0HA 5M2UA 1NK9A 4MKVA 4OL8A 2G1HA 3DN9A 5A8RB 2JNJA 3MURP 3P49B 4FXWA 2C3PA 4XTTA 3R5CA 4OZJA 1YKWA 2F4VJ 5B0BA 3KG1A 4KQZA 4NRTA 2K1RB 2IA0A 3BO4A 2V34A 5LSOA 4IDKA 4CZCA 4QW9A 3FDSA 2KVIA 3AD9C 4LR9A 4ZIWA 3HM9A 1MU2A 3GU0A 2XB2D 5DQGA 1NLKL 4TY9A 1HIYA 3R1LA 2VH7A 1R8CA 2AF6A 2AKWB 1U1NA 3CB4A 2V50A 1ZETA 3PXGa 4PG8A 3GV5B 1DZ5A 1SQGA 3MUVP 3TUIC 1M5HA 1HHSA 1Y5NB 3NWRA 2QJ3A 3I55S 4IG0B 2VJVA 2XY7A 1EB0A 2VFUA 3MR6A 2W9BA 4GO5X 4XAKA 1YJTA 1JIHA 2C42A 3LA0A 3K57A 4CH1A 4RL1A 1RT3B 3N6MA 4Q7AA 3GIRA 4PG5A 1RB0A 4G3IA 4PRFA 1U47A 2HZCA 1WF0A 4RBUA 1K1SA 4E8UA 4YUDA 1OS5A 5AJ3F 4M5DB 1HMVA 4NZ6A 1XNQJ 3HSDA 2ZUGA 9RUBA 3FMBA 4WCEQ 4FYWB 1J5EJ 2AYBA 4ZCIA 8ATCB 1T0TV 1ZM9A 1DQ8A 2C3YA 2JHEA 4M5LA 5HJXA 4LFAJ 2C22A 3DRSA 1ZBTA 4J37A 3ZFVA 1Q8IA 3FBCA 1P8GA 3WBZA 1U1OA 3H5UA 3FBFA 2MDAA 4OZ5A 2NSBA 4F25A 4OYOA 1JLEA 3K8VA 1LXNA 1WOOA 5G0RB 5EWEA 4KH1B 3I0SA 4K2JA 1U1MA 3CJKA 2V9WA 2BBEA 1RT6B 2VBWA 5IXUA 3B4DA 1EZZB 4CNYA 4ZPBA 4ECYA 3DLGB 1QE1B 5BYQA 1KTQA 5IWAJ 2IYIA 3GV8B 3DRRB 5HBMB 2R7WA 2WSCC 4EK2A 3QBCA 4WU3A 5KT5A 2BDPA 4H4MA 3ZZ0A 2PE8A 3EVMA 4A8OA 3GYXB 1SC3B 4ETXA 4U95A 2XMAA 4V19X 3C3LA 3HDSA 4KR0B 2MTLA 1WC3A 1K73T 4RPFA 2CPXA 3TA1A 3QT7A 4DPUA 4GKJJ 2GX8A 2IAJB 2ADBA 1BQMB 2CJAA 2HVIA 2NYIA 4TY8B 1H38A 3RBXA 2RT3A 3M2RA 2I9SA 2DR5A 2CWXA 2OD4A 1ZM2A 2HPUA 2VUGA 4ZVTB 4IH5A 4LMZA 4LF5J 4X4PA 2C2ZB 5KOXA 1VK8A 1U1PA 3D1OA 3MFHA 4J9VA 1ELOA 2VD3A 1NH8A 3ZZRA 2W9BB 2IBOA 4FN5A 4NMLA 4YN3B 2ZM6J 5J2PA 4ZPCA 1WELA 1H6KX 1LWXA 2MKYA 3QFHA 5KFUA 4UY85 3DLLQ 3LP2B 3VQSA 5HO4A 3DLEB 2JLEA 4YHHF 4QIVA 2IMWP 1V3ZA 1VQYA 2V94A 2VDIA 1HNZJ 4JP8A 2YWHA 2EK6A 3AJ1A 2MY7A 5L9NA 2CG8A 3KK3A 4DHVA 2QLWA 3OLAA 4DFPA 4IFVB 4OYWA 1HNWF 1JLCB 1KLMB 4FBTA 5KFYA 2FHMA 3NAHA 2WTFA 1EETB 3D6FB 5A2QY 2D9PA 3NOCA 1X4EA 5G0RA 5B7WA 4DPOA 3DFEA 2NPIA 5LM7E 3P6YC 4ILLA 5A8RA 3GONA 3MPVA 2C2OB 1MWZA 4X62J 4URSA 4DV1F 4ETZA 3RU0A 2VC0A 4C3LA 2VHGA 3T1HF 1RBLA 5ETTA 4PG7A 2W9CB 4W92B 4ZVRB 5KFHA 3W3SA 2IM3A 2O5DA 1UEKA 3HKWA 2J0XA 1EP4A 4X65F 3I6PA 1CULA 3DHXA 2CG4A 1B70B 4RU2A 4QW8A 1S4FA 3K5LA 1NJYA 2IJNA 4B3SF 1IKWB 1TL1B 2YKQA 2I38A 1I3OB 1V9OA 4TLRA 4A47A 3OL8A 2XO6A 2Y1IA 2HWIA 3UO0A 3CCUS 2DPJA 2YQ1A 3AY0A 2DGUA 4I6YA 4Q43A 3VGSA 3GFHA 3KDOA 3JSYA 1LWCB 1ZM3A 2W8LA 1P27B 2JVOA 4P72A 2MXYA 4Q8EA 1VDHA 1W26A 4CT9A 3UDCA 4J9PA 2QSFA 3G4SS 3PFEA 2VKZG 3I56S 3L7PA 3W8GA 3QSIA 3UCUP 1F1BB 2MEWA 3PG9A 1TK5A 1QSYA 1VQKS 1J5EF 3R2CJ 2IRXA 3AXMA 3C16A 5E3QA 2VFTA 2DXDA 1ZH5A 2BKNA 3DCAA 1SJ4P 3BN7A 4LFAF 1HHQA 2G0CA 2MPUA 4ZHRA 1V5IB 2K1RA 4F4ZA 3CD7A 5J2MB 3IAM9 3KJFB 5C24B 1NHVA 4X4RA 3HHEA 4RW7B 4ZN3A 4HEA9 3RYLA 3MEGB 4QJVA 1N33F 4LUBA 1QSLA 3N79A 2NLWA 4N8NA 2IIHA 4DOZA 3W5ZA 2MQQA 2QYGA 2FJVA 1PILA 2IFXA 3UW1A 4H4KA 4F0HA 1RAHB 4PCQA 3OR1A 2OTLS 2H5EA 3KKFA 1GXLA 4AL5A 2CQ4A 1HQUA 5IWAF 1HI0P 3LP0A 1GXUA 3FMWA 4M1KA 3MI7X 1YG0A 2IM2A 2R7VA 1RSCA 4F2RA 3HJFA 4HACB 3G6ES 1PO6A 1S9EB 2R3VA 1G4CA 3S8SA 3ISND 4D3HA 1N34J 2E5GA 2M2BA 4LBPA 3S1TA 2M7SA 3FQLA 3G82B 4QYRA 4LF7J 4RW9A 4QPXA 3MM8B 4KE5A 1FE0A 1WOPA 2A1BA 3C19A 1V6HA 3D7SB 3QATA 1B99A 4H4OA 5IC6B 4USIA 3JQMA 1W2BR 2DNPA 3GFYA 3V81B 4TN2A 1M0SA 3PW7A 2AYEA 4OX9J 2LQ9A 4B08A 4Q2LA 4ES2A 2LEAA 2MGZB 5HJYA 2ZBQA 1WHVA 2E7XA 4FDFA 4E2FB 3PX4A 1N32F 3M1VB 3WX8A 3IRWP 1BQXA 2OPSB 4R5PA 3KLVA 2KVQE 2W01A 1PAUB 2YX4A 1HNVB 3CW2C 5DG8A 2BM1A 2XYPB 2DH7A 2YWFA 3UVJB 1NK8A 2R8KA 1NDLA 1XERA 4FYYB 3OLBA 3IM9A 1K0TA 2KI2A 2V4JB 2F8EX 2GHPA 3ADAC 1R8AA 1SIZA 4JV1A 3DRPA 3OTOJ 1PBUA 1LXJA 1WWHA 2XMMA 3BGFA 3OHBA 4ED6A 2H1YA 5DQIA 1QM9A 2W24A 3AOAA 4LFCJ 4I2PA 3JQKA 1KTVA 4F4YA 5IC4B 1S1VB 1KR4A 2CYYA 2NXCA 5J2MA 1TMJA 2W4DA 1YWXA 4DR1F 1XMBA 1EETA 1DY3A 2HRYA 3M2VB 1HQEA 4DSJA 4DCOB 2RRBA 2B56A 1VQNS 3SFGA 2DR7A 2Z58B 4RNHA 2ZZMA 3MR5A 3L4BC 1FFGB 2MSSA 3M4XA 2VC1A 5LT5A 4RJVA 1LQ9A 5RUBA 1FNMA 2OELA 3Q8PB 1SJFA 2ILZA 3CPWR 1DTQB 3AQOA 3K5PA 2MZ1A 3NCQA 4U9RA 4J9UE 1FX4A 1BUXA 1VCTA 2YKOA 2W9CA 3M7VA 1QAIA 3R97A 3DRPB 4Q45A 3J7Z5 3RAQA 4X65J 2HHXA 5KG7A 1L3UA 4I7FA 5C5JA 2CQ2A 3P4UB 3R27A 4Q2MA 2D3O1 2CUYA 3I5AA 1J5OA 4B3SJ 4RUCA 3J7AN 4OI6A 2H51B 2YX1A 2NZ4A 4NL5A 1SQFA 1XIQA 2HVDA 4RBVA 4GVBB 2XC9A 2VBYA 1FRHA 3DDIA 3ILLA 4DN0A 4DR5J 3TARA 5LXYA 2LDIA 4PWDA 2VQEJ 3JTOA 1U2CA 1LEOA 4GC7A 3KUHA 3OTCA 2G2YA 2VASA 2MZSA 1Y11A 1M5VC 5I3PA 3S01A 5D0EA 3KJVB 2KXNB 1HNVA 1UPPA 3C6TA 4FKXA 2CAJA 4F3QA 3VVTA 1HHTP 4DSIA 2N4DA 1FERA 2GW8A 2XI3A 2B8QA 1RHQB 7FD1A 1S9FA 4F04B 4WK1A 5C42A 2EBEA 3AHPA 4CI0B 1RAJA 1FRJA 5M2PA 1HBOB 4DS5A 2E29A 5K8NA 5C2CA 3NY0A 3L09A 2XMKA 2EG2A 1JNRB 3FSYA 1SVDA 3IR6B 2HGMA 2VZ9A 2M5YA 1E6VB 1OJ4A 3QNWB 1ZYQA 1HARA 2DVIA 2GVZB 3W66A 1RTDA 1FF2A 3FFIA 1PYSB 3K8WA 3NGKA 1UW9A 3POTA 4I69A 4ID5A 1MWQA 4LJMA 4C48A 3TAMA 1PGZA 1YDLA 1UWBB 4ZPAA 1WHXA 3PJWA 2JRSA 3QT5A 3THVA 2O1PA 3RB4A 4B9LA 3GJSB 1MMLA 5E33A 4LF7F 3IMQJ 3BGUA 1DURA 2Z2LA 2ZOMA 4FVMA 4AL7A 1M1HA 1UP1A 1RT2A 4I6WA 2VOOA 3I4HX 5I3UA 2KT2A 3BPSP 3DXSX 3CCZA 4F4KA 2FTRA 3HK2A 2UVRA 5GAGI 4JI7F 4ECRA 1FO1A 4AL6A 1WG1A 1HNXJ 2AJ4A 1SJ3P 2AYGA 1VQ4S 1DQ9A 4CNZA 1JJ4A 1RAIB 1VQ7S 3J7A1 1PC4A 1YLXA 2W4CA 1C1CB 2QX0A 3OL6A 4QU7A 2BJ3A 1FJEB 1LWFB 4M63A 4H4MB 3MMCA 2KM8B 2ZWPA 5KFVA 3NCRA 1EX8A 3KWMA 3AD8C 5D15A 3H4BA 3SQGA 1SH3A 4KB7A 1CPZA 2HSEB 3Q8QB 3MM9A 1M5OC 1KD1T 4I64A 2BQRA 3W9JA 4DCPB 3SEOA 1H7XA 1SC6A 1FDNA 4WP9A 1FJ7A 4IG0A 1HI1A 1FFSB 1VISA 3WDOA 4B3TJ 1N52B 1X9MA 4NXMF 3HVTA 1DTTA 3SDEA 1D8YA 2AZ1A 3PW2A 4OJ3A 2HS4A 2YQ3A 5D0HA 5FDLA 2MKIA 4ED1A 1X4HA 3CD5A 2EEYA 2DJWA 2ZUAA 4KV8A 3CIZA 2DRBA 3PRBA 1S6QB 4QIWD 2AYMA 4UQGA 4JI4J 1TQLA 2HNDB 1HMVB 3BPDA 1HBUB 1Q79A 2CJQA 4E0DA 1RXOB 2K8GA 5J2QB 4K4UA 2CZVC 1SL1A 2Z0GA 4IFVA 2KRBA 1FFWB 4B9UA 4DX5A 1XNRJ 4CIOA 3HZEA 1FKAF 4DFJA 2CQBA 4OHZA 4DQQA 2EBGA 4DUZF 2ZC4A 4K5RA 3FKBA 3BQ0A 1VOMA 1IR2A 2XHCA 1H73A 3D0HE 3FK4A 5GMEA 2VQFJ 2QLJB 1SJRA 4NA2A 1OO0B 2NQPA 1IM4A 5JVGQ 5ETOA 2ZVIA 2J8SA 3M8WA 4IOCQ 5EHHA 2GC8A 3AA9A 3NS6A 5HP1A 1RKJA 4DL5A 5L39A 3P96A 2X3GA 3MPWA 4F0KA 2DNNA 2Z4PA 2K06A 3DRRA 5KG6A 1HKAA 1R89A 1HL6A 5E3RA 5B0AA 2GS8A 3DKDA 2QTWA 2VG7B 2Z8QA 4F3MA 2DR9A 4O3RA 4KTQA 4ILMA 3QJLA 1D0EA 4JI2F 1WKLA 4IOAQ 1S1XA 4USJC 3S7RA 2IC3B 3BS9A 3AH6A 2GQQA 2YQ0A 4IQMA 3BDPA 4Y2CA 3GIJA 5KG2A 2QMUB 4TLQA 1S76D 3PEJA 4YR2A 1VBKA 2V8HA 2ZM6F 1TELA 4HI1A 3ZTRA 3E01A 3QGIA 5I42B 3DRSB 1N5QA 2QC3A 4OYAA 5AXLA 5L46A 1IKWA 1TL1A 5KFIA 3TRGA 3HVRA 4EFAC 3TZZA 1PKUA 3PCOB 2NREA 3IWXA 3TP2A 5IM0A 1FD2A 5AE3A 3KHLA 2PIIA 2AX1A 2OMLA 3KG0A 4WXOA 2FC9A 5J2NB 5GMKa 4TVAB 2FLOA 2VICA 3HHKA 5KT3A 1XNQF 3V4MA 2R7XA 3U1MA 1RTJB 2YNIB 4ED2A 5LMUJ 4FP9A 5DGBA 2XQCA 4PWWA 2ZHAA 2BV3A 1CJKB 1H2VZ 4MIAA 1YJNS 1U2RA 1CJTB 3JSRA 6FD1A 3H2LA 1LWEB 2Z2YB 1VR6A 3TNVA 2K7JA 2R8HA 2FVRA 5IQ6A 2JSXA 1WKJA 3J7YU 1SBRA 5A6PA 3J80Y 1BGXT 3NGTA 2XG8A 1FRMA 1T7PA 1BWEA 4K4SA 3DI6A 2JC0A 1S1WB 2G2ZA 2LA4A 5IQQA 2LECA 1Q86T 4B9SA 3QJJA 2B9YA 4L72B 4OZ0A 5JXSA 1MROA 3TZXA 4V1Ak 3MCMA 4U67Q 3J7YI 1T03B 1KRPA 2V2QA 3NGSA 5IT9Y 2WVCA 1UFWA 5HQ8A
chains in the Genus database with same CATH topology
5CXTA 3T1AA 4IFYB 3PZPA 2KG0A 3BR8A 4OX8A 4BC9A 3JSMB 2GMJA 2E9ZA 3JB9k 2UVVA 2YNFB 2HHVA 2L3MA 2YWGA 2YNGB 5KT6A 1S1TA 2I5JB 3KLGA 2VFRA 3E51A 4X4VA 1GT8A 3KK3B 1U1QA 4O44A 3Q23A 3E01B 3U02A 1O8BA 5M2RA 2RQKA 3SDEB 3MM7A 1ZTWA 3N9UC 1MROB 4JI8F 2DGTA 3DOLA 4RWWA 3W2WB 2L48A 4MFBB 4TU9A 2MZRA 1JK9B 2M8HA 1R43A 3ZZUA 3K5NA 1D8ZA 2HS3A 2HWHA 2MKKA 2HNDA 1M1KT 5KFRA 3S6EA 1TV6B 1LV5A 3D5MA 4N47A 4NLVA 4C7QA 3H2VE 2VA2A 1XNRF 4JV2A 1S1TB 2XEXA 1LW0A 3N4WA 1OWXA 2BR0A 2PT0A 4FNIA 2VQFF 3D54A 2VG6B 3CGIA 2RH3A 4URQU 1WF2A 1HYSA 5CA5A 2QFJA 3OBIA 2DGXA 4ATNA 2HQIA 4DR2F 3HF5A 1TVRA 3M8PA 2J9DE 3VAFA 2R7TA 2XY6A 1R8BA 2B43A 4UOCA 5SZTA 4KGKA 3TAPA 1TL3A 2XS2A 3M6VA 3DLGA 3NCPA 2JJ4D 1GX6A 3GR1A 5D3GA 2BACA 3VWSA 3TI0A 3LWMA 4LSNB 1VJWA 1TZ0A 1SUQA 4ZVHA 1MNEA 4DG1A 2XGPA 2ZDOA 3KK1A 2ZHOA 1BQNA 1VC6A 3DDNA 3MR2A 1WTFA 4DV3F 2FPHX 2FJAB 4FYDA 3O5TB 5DO2A 3MZIA 3FZBA 1FVSA 4F67A 5AXNA 4GC6A 3RBEA 3KMSA 4DQRA 2OKQA 4NCAA 1UVMA 1ROFA 4TYAA 4U6PA 1FXRA 1HWLA 1VGYA 4OIXA 5T41A 1U45A 3EGWB 3UNGC 3K58A 2ZD1B 2O3DA 5E3PA 2FJEB 5HMWA 2R2SA 1NK0A 2IBKA 3MMAA 4Y00A 3SMZA 4J9QA 1RQ0A 1X4CA 4M8LA 3EGZA 3KOAA 2H9ZA 2WBRA 1Q4RA 2DCUB 3OJSA 4JI4F 5C42B 1E6VA 3BQ1A 1HI8A 4DDFA 3OUYB 4ZKAA 3F73A 3RB3A 4B3OB 3W2VB 4ZDNA 2Q6CA 1MU2B 4NLOA 5GAEU 2B0GA 1QUVA 4NLSA 2OPPA 2JL9A 4K4YA 1UVIA 3N5BA 1S6PA 3AB4B 2WW8A 1FESA 2EI5A 3LPYA 2W7OA 1YIJS 2ASYA 1VFJA 4QWDA 2XWXA 4NX9A 4N76A 3MR3A 3SZ2A 2N7YA 3DOMA 3V6KA 3JYTB 3X3UA 3THTA 4KO0A 4KKOA 4EBCA 3CO9A 3T9NA 1QAYA 4ITSA 1JLFB 1AFIA 4ECUA 1TK0A 4OLOA 1FEEA 3BM7A 3UI3A 4DFKA 4TU8A 4LSLA 2NUUG 2J7UA 1DBDA 3PKMA 1S1VA 2JC1A 2DBBA 3ZZTA 3PR5B 2GHVC 3G8SA 2PA8D 3C8YA 3QO9B 2XO7A 4KHPF 2CPZA 1S0OA 1CG2A 4DFMA 2IM1A 3KJVA 4ED7A 3OR2B 3DRXA 3H8YA 4Q8FA 3HFKA 5K9FA 1T05B 1T03A 4KBIA 2UVWA 4O4RA 5KFEA 3EZ5A 3M32A 1RTIA 4MTPA 2B5JB 4I7FB 3PW5A 3KLFB 1NK6A 2WONA 1H3DA 2LU1A 2R7SA 4OI3A 4RBTA 1FRIA 4RWXA 3NS5A 1X8DA 2YKAA 4P6QA 3O6QA 4MMOA 4QBUA 1ZZNA 3BB5A 3GIIA 3OFEA 3HHLA 3KYLA 4OI0A 1S6PB 1YSJA 3MD3A 3OQ2A 4JI5F 3IRXB 2RRAA 1KQKA 3FGVA 1SV5A 2KU7A 1IBLF 4H4KC 2XSFA 4WKRA 2XY5A 4ECSA 2AGQA 4K59A 4PXDA 2ZH3A 2J9EA 1TAUA 4KRWA 2UUBF 2KN4A 2LEPA 3RR8A 1UVJA 4HLBA 1T8EA 3MEKA 1YHQS 1C1BB 5MLCV 4DF4A 2LYVA 2ZZNA 4WU2A 2J9CA 2E66A 2DB1A 2WB4A 2E5LF 2MY8A 3HI9A 5C24A 1DFDA 1R8HA 1S1XB 2B6AA 2ZITA 2BABA 1Q7LB 2W7AA 1S99A 3I96A 3QO9A 4HH0A 2VG5A 4A8MP 2B4VA 3TAMB 4LT6A 3DM2A 4OI2A 4Y0FA 2ZE2B 4JYAF 3G6XA 1S6UA 2OPSA 3VAGA 2FHJA 2B4OA 2U1AA 2YTCA 3M8PB 4RW8A 4Y6IA 2HMIA 4Q0BB 4USHA 3T6JA 3TYTA 2PFFB 5KG1A 5KFBA 3M2UB 3SFUA 1KOHA 4DG1B 2UXBF 2V8DA 3UCZP 3ETOA 1B7FA 5LJ3Y 2L9DA 2MKSA 4RW9B 2B51A 3JTNA 2ZH2A 2WSFC 4J9OA 2YKNB 1VC0A 1KVIA 3X1LB 2I5JA 2RQ4A 5KFGA 2LCWA 3P5TL 5IFMA 4QR1A 2KHCA 3B4MA 3B8HA 1YGYA 4ED5A 4NYPA 5CHCB 5MAOA 1LWCA 4NOHA 1GXTA 4ILRA 3EYZA 1HWJA 5HLFA 2Q3PA 2N3LA 2VB6A 1FKOB 2M70A 1YITS 1DTQA 3UFCX 2DR8A 4DSFA 1JLEB 1HNXF 3PRDA 4DQPA 5B0FA 2RMLA 3DI6B 4HT5A 4P7TA 1VRTA 4WXWA 4B9VA 4FF2A 3MMAB 3J81Y 3MOJB 2OPQA 4N77A 5LSRA 2VA3A 2JOQA 3F56A 2R7QA 2GJ2A 1LW2A 4RNFA 4ELVA 3NNAA 4TKTA 2YH0A 2VONA 4M5DA 2RUGA 3UR0A 5F8NA 2B9XA 4OMFG 4NLDA 4U7UK 5DG7A 3BSAA 1QVGR 3RRHA 3N5FA 3M2RB 2CFXA 2VG6A 3OTEA 4AXIA 1WTBA 2D74B 3NMAA 4O4GA 5T14A 4ZMMA 1RGVA 1BQMA 1XTZA 1HYSB 4IG3B 2BJEA 1HQEB 1SH2A 3I0RA 4UUWA 1L3KA 1QUPA 4C8MA 5D4NA 4BBYA 5I3UB 2CJKA 1HWUA 1JLAB 3UE2A 1QAXA 1GNKA 1UW4A 1F5AA 3LP2A 4ZCLA 2JEIA 2DGSA 3O1LA 2G9OA 3DLJA 4DEZA 4DWIA 4CQ1A 1SJQA 2MKHA 3R3TA 4ED8A 2J8AA 1VMBA 2E7WA 2LMIA 3DC2A 1S1UB 2F40A 3NWGA 4ZLPA 3SV3A 1ZAVA 4CTAA 3TR5A 1WHYA 3A8EA 4RW7A 4IH6A 1GH8A 2CDQA 4NLGA 4HH1A 5GAGU 4EBEA 1G1XA 1FRKA 1TR0A 3NGDA 3L95X 5KG3A 2R8IA 1Y7PA 2AP6A 2WB1D 2XMWA 2V4RA 2HNZB 2UP1A 2UVUA 2PEHA 5LL6d 1FNOA 1IBKF 2DPIA 3ITHB 4OI4A 4WYLA 2XGQA 1WHWA 5IM0B 4I0WA 1Q82T 3RB6A 2EPIA 1JLGB 5H9FJ 4G1QB 3PIOQ 3SCJE 3DHWC 3JSMA 2F1FA 1VQ9S 3HPOA 3GB0A 3JAMY 2UUCF 2E5IA 2QA4S 1RT1A 1XR6A 4X84A 1BY9A 4YDDB 4Y2AA 3PX0A 5F0UA 2HWTA 4NCGA 4CO0A 5CCLA 1HW8A 3VAMA 1V3SA 1UAWA 3TO8A 5HMYA 4ZPTR 4KHMA 2AJQA 1LWEA 4O44B 2WK4A 2HHUA 2VPYB 5KFNA 3I0RB 5F41A 4IG3A 1IKVA 3T5JA 1JLQB 4ZPWR 3KTQA 3HVAA 3GQCA 3BEGB 3G8TA 4MK8A 1FTRA 2ZH5A 2E5HA 1SI9A 1LOUA 4RX6A 4QWBA 3TVYA 3GIMA 2CZ4A 1RKIA 3CTRA 3IG1B 1I1GA 2A2DA 4MKAA 2O66A 2J0SD 2M4MA 2ATLA 2P9GA 3GSDA 4HL9A 3KLHA 5IZHA 2QO3A 5THWA 1T3NA 1L3VA 1MW7A 2C3OA 3MM7B 1IKVB 2WBMA 2P6TA 1VQSA 3I0SB 4Y28C 2FDNA 4O3OA 3SI8A 2CVIA 1R6YA 1C0UA 1GX5A 3GILA 1RYSA 2J6UA 4WIIA 3PY8A 2B3TB 2AWZA 3SCKE 2LQBA 3MTKA 5HP1B 3FRYA 1HR0F 1XEZA 4A8QA 4YMEA 3M6XA 4LQ9A 2FLLA 1TAQA 1Y3KA 3FNNA 2XWYA 4C8KA 4ZK7M 3DLEA 1LK5A 3FFIB 4ID5B 4UQTA 4Q44A 2IC3A 4ZCMA 3PW0A 4H4OB 4F2SA 3D2WA 2OP5A 3CE8A 3QYYA 4FS2A 1I6JA 3IO1A 1WNEA 3PX6A 4LIRA 2CPHA 5HLFB 3EPIA 5HROA 4FBUA 1KNZA 4XO0A 1KLNA 2ZH7A 3CC7S 4QR0A 4OQJA 1YI2S 3MHYA 1OSCA 1D9AA 2OPRA 3OFGA 4ZP8A 5KFPA 1KQSR 4ZVFA 2KJWA 4PR6A 1Y5IB 2SXLA 3NAIA 1YJRA 1SV5B 3E8OA 2ZC3A 3T9ZA 1MWYA 4R8UB 2CPYA 4MJKA 2BOPA 2U2FA 4WE1A 1BLUA 2OO4A 4FPRA 2YKMB 2MQPA 2CJBA 4DQIA 1M5SA 2BRLA 3NRBA 4DV5F 2BZ2A 2E9TA 2XS5A 2YWEA 2UU9F 2RD5C 4FNHA 2RQMA 4LFCF 1TL5A 3DNCA 2HNZA 4FVCA 4KSEB 2K7KA 2KFYA 1URNA 4OI1A 4DL0C 3SV4A 5I42A 3BO3A 3QGHA 1JLAA 1DTTB 2J9DA 5GADU 3HVTB 1IJFB 5KFQA 4EZ9A 1OSDA 4I68A 4YB1P 1SL0A 1K1QA 2DIVA 2DNOA 2XMVA 3T5LA 2UUAF 5KFJA 5K8OA 1KFDA 2ILYA 4I2QA 4DV7F 2EFOA 5J2QA 1UVLA 4QYZJ 3IFEA 1ZOTA 5KAKA 1FT8A 1OIAA 4FF4A 4W90B 2O01C 1NKCA 4BC7A 2YKNA 2FD2A 1FJGF 4YB6A 3SCIE 4WZMA 4WFYA 2COLA 2HMIB 4Q0BA 2PD1A 4KT0C 2B7BB 1FDAA 2Y0SD 5CH7B 2WCXA 4RKUC 4DL6A 4RW8B 2VG7A 3FEXB 1TV6A 2AV5A 1A7GE 5J1PA 1YJ9S 1WI8A 4IDKB 1U26A 2F8HA 2EFPA 3T6BA 2HNYA 3EX7B 3CCRS 3JSBA 4Y34A 1P1LA 4PWDB 2QV6A 4NA3A 4MAKA 4K4TA 3NL0A 3MD1A 5DDRC 3OR1B 4C98A 4LF6F 3POTB 4I4BA 5DQHA 3DOKB 4U7CA 1RP5A 2IVFB 3V5RA 1Q53A 3M30B 2R8JA 2AW0A 4N5SA 1UFLA 2ZD1A 1FK9B 2EC0A 2IJFA 4C8NA 3H98A 2I0XA 4X4OA 3MMBB 4NLUA 4IO9Q 1ZAWA 4PUOA 3I9V9 3V6HA 2QSWA 2BA9A 4ZPDA 2GHWA 1M90T 2FVPA 2AGOA 1D1UA 2D9OA 1DQAA 1X4FA 4Q5VA 1S1UA 2MKJA 4HI2A 4KAIA 4C11B 3KFWX 3T5HA 3VAIA 3WC2A 3H25A 2WAQD 1IKYB 2LQ5A 2WHOA 3LUYA 1YJUA 2MYFA 1FA0A 3DM2B 5HMZA 3MXHP 4JI0F 4ELTA 3IR5B 2EFGA 3H5YA 1B0PA 4K5SA 5F8GA 5E3AA 1ULRA 2K3KA 2PMHA 1TP7A 2RU9A 1S49A 2GIQA 2P6SA 4ED0A 1TL4A 5HN0A 3BSOA 3AJ2A 1Q8BA 4DV4F 4PQUB 2RNEA 4ECZA 3K2YA 2XCAA 2V9KA 4FXDA 2KZMA 3VZHA 1HW9A 2J6TA 1W25A 3LQVA 3BF4A 3MEGA 1N8RT 2ZFHA 5KFXA 1WD6A 4PXCA 2LLZA 2ROEA 4NLWA 4OHVA 3ZC4A 2KH9A 4WK3A 3CUNA 2Q66A 3LP1B 1NHUA 1TVRB 4HTIA 2VOPA 4RNNA 3D1HA 1B0TA 3PO5A 1RI7A 4NWBA 3TUZC 5C25B 1FDBA 3Q24A 4NZ7A 5ADZA 3MCSA 5L1LA 1FDDA 1NRKA 4MYTA 2QIFA 4DL4A 5CYQA 4CO5A 2R4FA 1NEEA 4P2SA 1S9EA 4LFBF 1AW0A 1IJEB 2KRRA 2ZBCA 1ZPVA 2B7CB 3N6NA 5KT7A 1IBMF 5KFTA 4DSEA 1TFYA 2FJDB 2R7VA 2F8MA 1JLFA 1T94A 3FZ2A 3N01A 4EYIB 4ERDA 2HRUA 3M9OB 2FJBB 4LSLB 5JJBA 4XDDA 5F9LA 1S7HA 2GA7A 3BDEA 2ZJQQ 3KLEB 1CQMA 3P3DA 4ZVGA 2MGZA 1WG4A 3V2UC 1NB7A 3DYAB 3GFZA 5DETA 5KFDA 5C25A 3BN4A 3H5XA 3CCVS 1S0MA 2JDJA 2L41A 4ED3A 3MMJA 1TKTA 5GVQA 3ISZA 3Q8RB 1RDRA 4RW6A 1CQNA 4WFNQ 4K4ZA 1WACA 2BJDA 4CO4A 3R5AA 3HKZD 3K7RA 5KT4A 1JX4A 1C4AA 3MM6A 3OVSA 2KXHA 4B3OA 2G4BA 1JKHA 1YQHA 2OSRA 4I2QB 1S10A 4TXSA 5K5MA 2HHQA 3OTOF 3IS9A 1VLYA 3ULHA 4L6V3 2FLPA 3SSSA 2OLWA 2WRMA 3O44A 1X0FA 1XBWA 3MM8A 2GIRA 4A48A 4K2XA 3HO1A 4NCBA 3VTIA 1RWUA 3M9NB 3MAQA 1QLNA 4IYQA 2RILA 4Y2IA 2MJUA 3CDAA 4XPCA 1X5SA 1NJIT 2FJWA 2ROPA 4ZP6A 4CO3A 5EWGA 2FHOB 4ECVA 4RU9A 3RB0A 5HL7Q 3U7JA 3IRXA 3HZGA 2DNGA 5DJBA 1S72S 5CYMA 2EWHA 3IA0A 2XNQA 4NLXA 4B02A 1HBMA 5CYJA 1BC6A 3IS9B 3VCDA 1N56A 3ICLA 4J9SA 5D4LA 2YY3A 2KG1A 2XMTA 2YKMA 4LQ3A 4NXNF 2B5JA 2A3JA 2FHKA 2GGPA 5DGAA 2KYXA 1NZAA 2KT3A 1KHVA 2NXUA 4AE5A 1KS2A 2YNHB 4O23A 1KQFB 3CCTA 1N6QA 1XWLA 1HQUB 1LFPA 3QMQA 4JOUA 4E98A 4DL2A 2N82B 2W9AA 4H54A 2NR0A 3UDLA 4WYWA 1JXLA 2CPFA 5BR8F 3KLIA 2LU2A 5L1JA 4MYUA 1D3WA 5HROB 1VBYA 3IXQA 3PW4A 3IC1A 4PKDB 3JYTA 4YFUA 1W2IA