2UUBF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uubF00
4X64F 4LF6F 2UXDF 4DUYF 4JI6F 4B3TF 4DV2F 2KJWA 4JI0F 3T1YF 1J5EF 4JI1F 1HR0F 4B3SF 4AQYF 5IWAF 4DR5F 4LF8F 3R3TA 1N33F 4DV4F 1B64A 4KHPF 1IBMF 4JI8F 1XMOF 4JI5F 4DR4F 1RISA 1IBLF 3T1HF 1FKAF 4K0KF 4B3MF 4DV1F 4LFAF 1G7CB 1IJEB 2UUBF 4JI7F 1HNWF 1FJGF 2UU9F 4LF9F 5BR8F 1N32F 2E5LF 1GH8A 4YY3F 4X62F 3ZZPA 2UXCF 2RJZA 4LF7F 5LMNF 4NXNF 2B7BB 1CQMA 2UXBF 4LF4F 4X66F 1LOUA 1CQNA 1XMQF 4DV7F 2HHHF 5AJ3F 2VQEF 4DV0F 4LFBF 4DR2F 4NXMF 4DV6F 1HNZF 4DR6F 4JV5F 2BXJA 4YHHF 4DV5F 4LF5F 4GKJF 3OTOF 1IJFB 4LFCF 4GKKF 1HNXF 4JI2F 2F4VF 2VQFF 1N34F 1XNRF 1QJHA 4DR1F 2UUCF 1F60B 4JYAF 4OX9F 2BVZA 4DV3F 5LMUF 1N36F 2KJVA 4JI3F 4DR3F 1XNQF 4B3RF 4X65F 4DR7F 1I94F 2UUAF 1IBKF 2J5AA 2YY3A 4DUZF 2ZM6F 1VMBA 2B7CB 1G1XA 4JI4F
chains in the Genus database with same CATH superfamily
1RWPB 4K5SA 4B9TA 4AT1B 2XG8A 2OKQA 2VPXB 4UOCA 4HHJA 2ZH5A 4RW7B 2Y0BB 4U95A 3BYPA 3FNNA 2HURA 1WEYA 3MPWA 2HQDA 3DGVA 3HHLC 4QYZJ 3BM7A 3OFEA 3VALA 4WFNQ 1RADB 4H4MB 3PKMA 1N5QA 2VG7A 3FFIB 5DM7Q 2JC0A 1IBKJ 2FJDB 1K0TA 1FXRA 4ZVOB 4ID8A 5HAOA 4BC9A 1AXQA 2FQQB 3SDEB 2V68A 4FVMA 2YWGA 3SSSA 2DK2A 3PHEA 4A8MP 3X1LB 4IUFA 4AXJA 5D8HB 4F0MA 5GMDA 1O0PA 1UVIA 3J7Z5 4YR3A 1XR6A 4ED2A 1FKPB 2AJQA 2FC9A 4UUWA 1Y3KA 5K9FA 2BYCA 1ZAWA 3VGUA 2BA9A 4LR9A 1T3OA 3K5OA 1FDAA 3FCVA 2DHAA 2EG2A 1P9YA 1BQMA 2E7VA 2PFFB 4KE5A 5KG1A 2BM0A 4ZMMA 2AJ2A 2GIQA 4WU2A 2RF2A 5ETNA 1VOMA 4BC7A 3CIZA 1GH8A 3G8SA 4O0IA 1B3TA 3AXMA 5F8LA 3U1LA 1YKWA 2HGLA 3MR6A 1U7LA 1Y9OA 1UVMA 2CQ2A 3A13A 2ADCA 4M1KA 2OPSB 1S7IA 2BRKA 1PBUA 4DR5J 4FF1A 2OGUA 1CSJA 1WC4A 2ZHAA 2DR8A 2LQ5A 1F60B 4R5PB 1WG4A 2DNNA 3J80Y 1Q8IA 4YY3J 1DQAA 2L08A 1UWAA 3GB0A 4DZ6A 3H20A 3AQOA 4DCOB 1REVB 3C19A 3DDNA 1WF0A 5I3UB 4G1IA 1RWNB 3KOAA 1RKIA 1X4HA 4B3TF 5HROB 3DXSX 1F0XA 4MK7A 4OL8A 3DU6A 4B3RJ 5D6GA 2VODA 3GYNA 4A8WA 4KV8A 4K0KF 6FD1A 3D28A 2IAJB 1WC1A 4GO5X 3H5UA 2H4WB 4URQU 2R2SA 1L3VA 3BO4A 4YR0A 3SFGA 4Y28C 3DRSA 2VG5B 3B4MA 1XMQF 1Y11A 4DV0F 1N4LA 4H4MA 4Z37A 5LSRA 1J5EJ 3CJ4A 1V6HA 4CM0A 3FFIA 2QSFA 1EJ7L 4U7UK 1Z2LA 1VRTA 4I1TA 3DM2A 3M7VA 5ITHA 1WC5A 1SL0A 1IWAA 2FJWA 1NLKL 1M1GA 4NE9C 2XNQA 2L9NA 4ED5A 1Q81T 2KXNB 1SJ3P 3JSYA 4UY8T 1BMQB 1RCXB 3NXZA 3MMBA 3RW6A 2EVZA 3SDEA 2AGPA 1TMJA 1NSKL 1R8HA 3B4DA 2EI5A 5D15A 5A8KB 4RNHA 1WHWA 3UCZP 2HNDA 2VL1A 2GCFA 4DQRA 2LLZA 3MEEB 4RW8A 4HR2A 4BS2A 4JI3J 1FKPA 4CLTA 3KJNB 3T1HF 3QJJA 3T5KA 4DFPA 3OTOJ 2YWFA 2B56A 3LQVA 3H59A 5A0YB 3AHPA 1N32F 2AEMA 3NAIA 2R9LA 4ZP9A 5D4LA 1UEVA 1RI7A 2IM1A 3K58A 4WJBA 4JV0A 5A8WA 4OMFG 1WELA 2I1RA 4YEAA 2UVVA 1FE4A 2UXDJ 1B70B 4DQSA 4OJ1A 4EFAC 2CQHA 3UDLA 1ZAXA 1GX6A 4ZPTR 2Q66A 2OPSA 3MPUB 4XDCA 1WDDA 2HQIA 2F5GA 5CABA 1RU1A 2QLJB 2H54B 4DX8H 4ZIWA 3BPDA 2B6AB 1S6UA 3PCOB 4RUCA 1APSA 3B82A 2PEBA 1S72S 2ILYA 1REVA 4Y2AA 3FBBA 4K59A 5I3UA 4DCPB 2N7CA 1M5VC 3R27A 2GV1A 1YJUA 3C3LA 1DARA 5HROA 2N4DA 4ZN1A 2HVHA 3FCWA 2IAJA 3HPOA 1U6BA 1T05A 1VJQA 4CLFA 4DV7F 2X1GA 4PWDB 2D3ZA 2ZE2A 3TUJC 4MYTA 1SJ1A 4NCBA 4USJC 4FF3A 3GJRB 4B02A 2BOPA 3SV3A 2A0FB 1FXLA 3CPWR 1PILA 2C2MB 2ERRA 1UJ6A 3UDVA 2OELA 5FIIA 3N4WA 2KVQE 4EI2A 5HQ8A 2HHVA 2ZWOA 1MU2B 2VFVA 3TWZA 4YHHJ 4I56A 4AXIA 4LBIA 4ZP8A 2FZKB 4Y2KA 1RLDA 3M2RB 5DRKA 3UWTA 5C24B 3ELHA 2ACYA 3PYDA 4OX8A 2UV8A 1VRQC 2MJUA 3R8YA 1I1GA 3NEKA 4NXMJ 5LMUJ 2RDDA 1DHMA 4C48A 2NXNA 2HHPA 4C2MA 2PD1A 4F4YA 1OSCA 4DV1F 5A8KA 3HHLD 4RU9A 2EG1A 1RAHB 5FLXY 1VC5A 2YQ3A 3DOKB 3MEEA 4MKVA 1MW7A 3T6JA 3WQPA 4LF9F 1T8EA 4KGKA 1VQ4S 3W7BA 5AXLA 4ZVGA 2R8IA 4M95A 3G4SS 1EZZB 3X3UA 3SYZA 2VB6A 5A0YA 4KAIA 1BHNA 3QIPB 3ADAC 2KTQA 4I68A 2GHPA 1T9TA 2FYXA 4H54A 2EKYA 4NYZA 5KFHA 5HMWA 3TP2A 1RGVA 1FNXH 4JI7J 3G8TA 4J9RA 3DMJB 5EDWA 4MT1A 3QGIA 4KRWA 4OYOA 1QM9A 1NJZA 3SEOA 2RUSA 2ZM6F 4M5DA 1SC4B 1N8RT 4PWWA 1H2VZ 1HI0P 2K3KA 2CUYA 3WBZA 4KFBB 3RRGA 3L7UA 5F9LA 4OJ3A 1VIXA 3DDIA 2YKOA 4YB1P 2W2QP 3PEHA 2B6AA 2RQMA 2ZFHA 2EC0A 4W4MA 3UN5A 4PABA 3GV7B 2Y9HA 3GQCA 4HTJA 3BF4A 3CC2S 1VYAA 3R7SB 4TYBA 3CD5A 2GHWA 5D0HA 2ZWPA 4YS2A 4AL6A 3VAMA 4C4WA 2QYGA 2XM3A 5DQHA 3PNIA 2DIUA 3K5LA 2Y3YA 5GMEA 4B17A 3G6VA 5LMNJ 5IT0A 4DU7A 2JHEA 2IRXA 1R31A 5DM6Q 3HFKA 4DQPA 3JAMU 2K7KA 2MQ8A 4PWDA 4X4RA 3PJ9A 2FLPA 2Q6CA 2NXCA 3PKYA 5H9EJ 4W90B 1KR4A 1VQNS 3GP9A 4O3PA 2KJVA 2D3O1 2J76E 5D4PA 3D6HB 4N56A 4C8OA 5MAOA 2J9DE 2WOMB 1TVRA 2MY7A 5AXMA 4DX5A 4FP9A 4YB5A 3SCIE 2D3OR 3KUHA 1HBMA 2E7WA 3GV5B 2K2PA 3J7YU 3D4JA 1DJ0A 4NZ6A 3D1HA 5C24A 4CLLA 3NLCA 1VBXA 2ZZTA 3TJ8A 3CMAS 2HNYA 2DNKA 5JVGQ 2OPPB 3OL9A 2AQ4A 5CYJA 1TKTB 1M5OC 3AJDA 2H48B 3MPDA 4CO5A 2NUHA 3DOKA 4U7CA 2LU2A 1ZOTA 3VAJA 2BKNA 5HMXA 1L3SA 1P8GA 3CWJA 2AW0A 2VD3A 1RT2B 1N5YB 2HVDA 3SQOP 4KPCA 1CULB 1SJRA 1S9GB 4V19J 2BANB 1JNZB 3QIPA 3QNWB 4W98A 3HVWA 4B3OA 2RMLA 1P1LA 2M2BA 1FNOA 2FHMA 4O23A 1PJ7A 1T9VA 4NOHA 5EWEA 2H5JB 3Q8VA 4PG4A 2BV3A 4F8RA 3Q0AA 5HQLA 5D0RA 3D6FB 1NZ8A 2CJYB 1R6VA 1U24A 3POTB 1RAOA 3ZTQA 1HMVB 3OXFA 1DQ9A 5BYQA 2U2FA 2XNRA 2JVOA 1VCTA 4X64J 4CH7A 3IA0A 1WHYA 4DFMA 1JLFA 3GSIA 1JX4A 2O1PA 4HDHA 3NGKA 4LF4F 3DLJA 5DGAA 1SH2A 2QEXS 1NK8A 2HK2A 3BREA 4EMDA 3KK3B 2CPXA 2EFNA 1H2TZ 3NY0A 1NK5A 1PJ6A 4PUOB 1HWUA 4KPYA 1HA1A 1LWFA 2BDPA 4NZ0A 5F8NA 4RKUC 5J2QB 4P73A 2HVZA 5L1LA 4CNYA 3JSBA 2R8KA 1B99A 5F41A 1RWOB 1I94F 2HKEA 2CDRB 2J9DA 3L09A 1EKRA 2XWXA 1YJNS 1H7XA 1YIJS 4C6AA 2AZ1A 2IJFA 1KSPA 5CYQA 2AJ0A 2HRTA 2VJUA 3Q8PB 1BWVA 2MKYA 1RABB 4J9VA 5DDPC 2ZC4A 1JLQB 3EZOA 4CP5A 4N8OA 3MCMA 4KR0B 1DAXA 4MTPA 2A6MA 4CM2A 3PJWA 4C3KA 1XMOJ 1YBAA 2V4JB 1NK4A 5L46A 1TK5A 2C2OB 4F02A 3P8BB 2BQ3A 3CD0A 2FLOA 1HR0J 3D2WA 5J2NB 3HHEA 4UZBA 1HIYA 4ZPAA 1FRMA 2VBWA 2BE2B 2HFSA 3PM9A 1ZA1B 1FD8A 1HHSA 3EDQB 3IWLA 4ENOA 1D8YA 3W5XA 3DRXA 3S01A 1BE4A 2PC6A 2XGPA 1N5YA 4B3RF 4S0MA 2W9CB 1CULA 1Q4RA 4G6VB 1S9GA 2J9CA 3BSCA 4GC7A 1TAUA 2VFRA 1Y4ZB 3HX9A 4HACB 2IA0A 3P5BP 3PACA 1PC5A 2G0JA 2CZ9A 4PR6A 2W2MP 1IXKA 4OHVA 2ZD1A 4NZ7A 3N5FA 2ZNYA 2CAJA 2CJAA 5I42B 5LJ3Y 2GGPB 3TJAA 2E5LF 4X62F 5KFBA 5F8HA 2WW8A 5HLFB 1GXUA 3DI6B 2DCUB 3U02A 2HWTA 4QWCA 3NCPA 3I32A 1Q16B 1NK7A 2CJKA 3EZ5A 5JJBA 2N3OA 3M30B 5KT7A 4B3SJ 1T0TV 2RQCA 4ICLB 4RO0A 1UVNA 4FYDA 3M8RA 3LP2B 4C98A 1FVSA 4CLWA 3KK3A 1AZSB 1RBLA 3CCUS 4JI3F 4Z2XA 2RSQA 2IY5B 1M0SA 4G1QB 1S6QB 1JK9B 3KG4A 3J81Y 3TZYA 2MZQA 5ETSA 1IKVB 2BX6A 1CJKB 2UUCJ 1O6XA 1ZPWX 2B9YA 4IH7A 1HWJA 5JVHQ 4LRFA 2RIJA 4JI8F 1RISA 2B43A 3R7BB 2DGQA 2DPIA 4KJIA 4OHWA 1RT4A 3SI8A 3PRVA 4BWMA 2XQCA 1IWGA 4JYAJ 5E7OB 4DWIA 1P1TA 2HNZA 5IZHA 3QRRA 4NMXA 4NEZA 1YLXA 1IBLJ 3Q83A 1UW4A 1S57A 3IWXA 1JLQA 1ZBTA 2E5JA 1ZM9A 3QRQA 1T11A 4ED1A 4J9SA 2D41A 3ZZUA 3UR0A 1VRUA 2V63A 3FKBA 3IXQA 1X4EA 4WXOA 1N88A 3WIVA 2KT5A 2J6TA 5J2NA 3CJ5A 1TUWA 3DXBA 4L75A 3PW0A 4XAKA 2BE2A 3SIPB 1FDBA 2IYIA 3BKFA 2A2CA 4J5OA 1WD6A 1UA0A 2HAFA 4CI0B 2WZ1A 5BYSA 1HNZJ 2W9CA 4NLTA 3RR7A 3TX0A 4BDPA 2AEFA 3CCZA 1X9MA 4RZRA 2BKPA 4HACA 2P5VA 2MLXA 4K4UA 4DR1J 5GADU 4KGVB 2V8DA 5E3CA 1NHUA 5IWAJ 2XS2A 2JC1A 1FRHA 1HNVA 3LAKA 3D1QA 5I42A 5GAEI 3KMSA 1S0OA 2DNHA 2GGPA 1NZAA 2I8EA 4FDFA 1G6BA 1LWCA 2I5JB 4ITSA 3A8IA 4YHHF 4PPDA 5A2QY 2GVDB 3LTOA 3IMQJ 4WFBQ 2AGQA 1NDKA 3HLUA 1FE0A 5LMUF 3M30A 1NJXA 2DPJA 2MZTA 2B4OA 4X4OA 3HF5A 4F36A 4M5KA 4ICLA 4TQSA 4DR7F 1U0HA 2E29A 3FEXB 4UW2A 2B7CB 2M88A 3AA9A 4WZMA 2G13A 3MXHP 3G71S 3UVJB 1AZSA 3M32B 4YP3A 2WVEA 3AJ1A 3AOCA 3UD5A 1FK9B 1OPZA 2E7XA 4G1QA 5GVQA 1S6QA 2FLNA 1VC0A 1YBUA 1C4CA 4OYBA 3OQ2A 1IKVA 1CJKA 4RL1A 2XZWA 1NPKA 3TUPA 3E3XA 4U9RA 3UI3A 3DOLB 4LRCA 4ANDA 2HBQB 3TAPA 4CYUB 4G1PA 4DPTA 4CTAB 1W2IA 1N36J 5IQQA 2RU3A 3BQ0A 2AJFE 2HFVA 2HFUA 3I87A 3U7JA 4OX6A 3VQSA 5EWGA 4C8NA 4TLRA 3ISNC 2WW4A 2OMLA 2BKOA 2QA4S 2CNKB 4FXDA 2DEIA 5DQIA 3KLEA 5J2PB 4RBUA 3EICA 3IO1A 1YWXA 1NSAA 4I67A 3D6MB 5EX3A 3O5TB 2J0XA 1U1LA 4NCGB 3OJUA 3QATA 1CPZA 4ZP6A 2POKA 3M2VA 4ZPCA 3PW2A 1VQ7S 4H4OB 1KLMB 3AD9C 2FHJA 1WSRA 4LIRA 1S6OA 5KG7A 1KDNA 4ANCA 3MM5A 4CDIA 4PXEA 1S77D 3R1LA 2DR9A 5DDRC 1FTRA 4OYWA 4KHPF 1AB8A 2Q43A 3ZTPA 4B3MF 3TR5A 1YGYA 5IT9U 1FO1A 1HNWF 6FDRA 2ZBPA 1MWQA 5LMNF 3AY0A 3KLIB 3CDBA 3PO4A 5B0CA 2RRBA 1XNQJ 2OEMA 1HQUB 2C3YA 2LCWA 2C1EB 4UOGA 5A2QU 2FGOA 2YWKA 4MIBA 2BJDA 4ZVHA 2RHQB 3ENVA 2WTFA 2EC2A 3PYGA 2MZJA 1SQEA 5K5MA 4NLSA 3OHAA 4WTOB 4BBYA 1YDLA 1UJ5A 1WACA 4RWWA 2RE1A 2DNRA 3OTDA 3RG6A 2E66A 3P3DA 2OEKA 5IV3A 1D09B 5DZ6A 2IBOA 1V9OA 2VA3A 3HVAA 2I5JA 2DO4A 3ISZA 1F5CA 5EUHA 4DSIA 3W9IA 1HWLA 2GVDA 3CTRA 5RUBA 5KFNA 4UF4A 2MHEA 2BW2A 4TU7A 2XLIA 4Q5VA 1Q53A 4P9SA 1X5PA 4P72A 1W26A 1RJJA 1WG1A 2NSCA 4Q44A 1JB0C 1OQ3A 3UVJA 2F3JA 4Y3CA 3M32A 5BR8F 3OSNA 1KHVA 1KRPA 3TW0A 4F3MA 1FK9A 2GVZB 4USHA 2HEKA 3IC1A 2BM1A 1RAAB 4WF9Q 2CJQA 4ZVQB 3DOLA 3S1TA 4PG7A 2ZC3A 3LGMA 1O51A 1LK5A 3I9ZA 4OZ0A 1KLNA 4ED4A 3CCJS 2OLWA 4C8MA 2VG6A 1T03B 1QVFR 3HD2A 1IBMJ 2QA1A 1VBZA 3BR9A 3IG1B 3GIMA 2GMHA 2K8GA 3KK1A 4R25A 2XMUA 4IG3A 5J2MB 1HI8A 4QR2A 5J2PA 5HVFA 2DJWA 4IDKB 4F04B 3W9JA 2ZNZA 4ILRA 2Q1LA 4X64F 3CCLS 2KB2A 3KDNA 3CNQP 4CNZA 4KBIA 2WB4A 2MKKA 3CGIA 2NYHA 1RT7B 4LFAF 4OYZA 1BY9A 1RWKB 4GKKJ 4RW4B 4I2QA 2FB0A 1UTAA 2LXUA 4HYKA 2DH7A 4ID5B 4NCAA 4NLRA 1T02A 2AYMA 4J9MA 4ZVFA 3HK2A 2KU7A 4R8UB 5HP1B 2NLWA 5GAHU 5CH7B 5IFMA 4YOEA 2ZH9A 3KLIA 2FVSA 4O3NA 1KVIA 1HQUA 5T41A 4DV5F 3MWBA 1DY3A 3R5DA 1JJCB 1KC8T 2MEWA 3KJVB 2ZH8A 3T5HA 3KWMA 2M9KA 2LQ9A 4ZLLA 2PI5A 2EXUA 1OYDA 1WKLA 3TQ1A 5DG9A 4IH5A 2RKIA 5AE1A 5B0EA 4J90A 1K1QA 3ZTRA 4K4ZA 2LU1A 1UPMB 1U45A 1ZZFA 1XN9A 3PR4A 4WP8A 3T9NA 3IBCB 5KFDA 2KM8B 4EO8A 1IKYA 5AXNA 4QWEA 3UN2A 1XMOF 3NGDA 1JLAB 4IFYB 5E3AA 1U8WA 1WKKA 3GIRA 2OFHX 1LW0B 4J9LA 1HHQA 2R7UA 1X4AA 2F1FA 1PYTA 3NMRA 4X84A 1OIAA 3CC7S 3BSAA 3SBMA 1R8AA 2I0XA 4W92B 1Q8KA 1SV5B 4DV2J 1SUQA 5CXTA 4X4PA 4OZ5A 4IR1A 5H1SV 4WIQA 4K4VA 4A8FA 3K2YA 5K8MA 4J9UE 1CEZA 4Q8FA 3BGUA 1FEEA 3ONQA 5LXRA 1XQIA 2WB1D 5LL6d 5BJRA 1T03A 2VKZG 3F0NA 4RW6B 3OL6A 3NCQA 1LFWA 5B0FA 3MM8B 4LF6F 2C28A 2KDOA 2GS8A 1GAOA 2YNIA 4FNHA 2GIFA 4K4WA 5E3RA 3H2LA 4IDKA 3A8EA 3DN9A 2RDIA 4OI1A 3Q8YA 2CPEA 2G1HA 1RLCL 1NHKL 3D1OA 4DG1A 3ZZPA 2UXCF 1EAYC 2W1BA 1FF2A 1RT7A 4A8SA 4U6PA 3ISND 4HI1A 1U1RA 4RW4A 1UEUA 5G0RA 1Y0HA 4DUZJ 2QL7B 5K20B 1CVJA 4FXVA 3M8ZA 3PR5B 1V3SA 4ID5A 2UU9J 4DEZA 1L3UA 1VBKA 4R8UA 5GADI 3KLHA 5HP1A 2PA3A 2AU0A 4DN0A 4KH0B 2BZ2A 2UUCF 4O4GB 3RTVA 2KG1A 2VH7A 4HHUA 2O5DA 2CQCA 1T7PA 3DRPA 4WZQA 5HO4A 2M8HA 3KJVA 3QO9B 2KI2A 2X7IA 2YBVA 3TOQA 4USUA 4IRKA 3QZ7A 2MXYA 5JUMA 2JSXA 3F44A 3QZ8A 4RWXA 3RUBL 1IBLF 3EGNA 4XK8C 1REGX 5E0OA 4N77A 4QIWD 4OLPA 2L3MA 2QYCA 2HYIB 2VU5A 4NI2A 4R0EA 3QGPA 2DT9A 3J81j 1EQMA 1ELOA 3R1HA 3MR5A 5DO2A 4YR2A 3KKFA 2DHGA 1JLAA 4IFYA 1XC9A 1H74A 2FLLA 2MKSA 1RK8A 2IM0A 2GMLA 1LW0A 1JWWA 3ITHA 2HZVA 4FXWA 3C2PA 4Y00A 1HBUA 1TK0A 1Y5NB 1S48A 3CCES 3RGIA 4CLUA 3A8KA 4UQTA 4DSEA 4JOUA 1KFDA 2ABYA 2HHXA 3IGVA 1T94A 4DR6J 2FTRA 2VA2A 5HI7A 3AT1B 4C3MA 3GONA 2JWNA 1RA6A 2MLZA 3M8SA 4ZJOA 5ETQA 4NLQA 2B4PA 5IWAF 2HHWA 3HDSA 3GG0A 4RW6A 3D68A 3MM8A 2HMIB 5IC4B 1OY6A 3B78A 1RT3B 1H6KX 5GAGU 3TANA 4IQXA 1NAQA 4JB8B 2G4BA 1TL3B 3B8HA 3LAMA 4O3RA 2A2DA 4CLZA 3W9HA 3C15B 1YI2S 1JLEB 2G9OA 4DR2F 3FBFA 5CHCB 5F8JA 1HKAA 4MYUA 5HJXA 3MZIA 2BACA 2WHOA 3JTNA 3MM7B 1MWZA 3MECA 3OUYA 4OZ1A 4GVLA 3KLVA 5F8IA 4EU0A 5KFLA 3NOCA 3MM9B 3OVAA 2ZJRQ 1HNXJ 4DHVA 4O4GA 2N7YA 4YQWA 3N9UC 4C3LA 1FI4A 1XJWB 1Q8BA 3MDFA 3HFVA 3QMQA 5T14A 2HS0A 1CJUA 2IBKA 2ZBRA 2YKAA 1CG2A 1P9QC 3Q8UA 2CA9A 4DV4J 4QWAA 2M3DA 2KZZA 3MMJA 1T9XA 1RT5B 1VFJA 2PE8A 1RA7A 1N56A 3OVSA 4CO2A 2AX0A 3HP6A 4DPOA 1KP6A 4X2BA 1YJRA 3M8PB 1HW9A 3TZXA 3AD8C 3EMTA 4ES2A 1F3FA 1NSQA 4WFAQ 4U7UD 5A6PA 2RU9A 2O01C 3PRBA 2UUAF 3MMAB 4EZ6A 3DCAA 1AROP 1T9WA 1S1VB 3KNGA 1QTNB 2EFQA 3OVBA 1RZMA 3MTJA 4HH1A 5CD4A 3PIOQ 1DQ8A 4JV5J 3ILJA 3US5A 4B9SA 1TKZB 4RUAA 1TKDA 3CJQA 4L76A 1ICEB 2IRUA 4PG6A 4ZVSB 1WF2A 4KIAA 2IVMA 2P9GA 4LF7F 3AD7C 1GQEA 3O2IA 2AX1A 1EP4A 3W66A 2HMIA 4X4TA 1OJ4A 3ENWA 1S1UB 1TL3A 4DL2A 4E2FB 3V2UC 2MGZB 3PYEA 2OI2A 4CO1A 4QZVB 3C15A 1F5BA 3IAM9 1N34F 1JLEA 2LFVA 3THTA 3R5JB 3RRKA 4PQAA 2HFNA 3CIMA 2XI2A 3BBCA 3T19A 3MM7A 2D74B 4M63A 4OI4A 2VFSA 2A3JA 4DUYF 2LVWA 2CG4A 3M8WA 4IO1A 4QU7A 4DF4A 4V1Ak 3CE8A 4CRJA 4DV3J 3MM9A 3Q8QB 3PX4A 3K59A 3RB0A 3IR7B 1FRLA 1FKAF 1ZM2A 3OT9A 3BYRA 2XLKA 3QT6A 1WC6A 4LF2A 3AODA 3BDEA 5KFUA 3RW7A 4USTA 2AYEA 3BQ2A 3PTWA 5I4MA 3E01A 1FJGJ 2RRNA 1RHQB 3OLAA 1D1UA 1NU4A 3D5MA 5L9NA 1WWHA 3PO5A 1SJFA 5DETA 4HLBA 2QFJA 4Q0BB 1NXIA 2R7XA 5CZXA 3DHWC 5I3QA 2PFDA 5CD4H 5I3PA 1IR2A 1U2RA 1RT5A 3EJMA 2MQQA 2B4UA 3NNHA 3R6GB 5IM0B 5HJYA 1RBAA 3K5NA 2UUWA 3M8PA 2ZDOA 4HEA9 4LRDA 4A48A 2Y8YA 2BE7D 4IFVB 2LKZA 1T9UA 1VQOS 1CLFA 1NSPA 3I4PA 4PG8A 3SCJE 3VQTA 5F8MA 3VZHA 1S99A 2R4FA 2QO3A 1SJ4P 2XYHB 3QBCA 3D7SB 2CVIA 4OX9J 2NS1B 1Q79A 2VPZB 2KXHA 1BGXT 1TKZA 2UVRA 3RR8A 5D4NA 2JH3A 3MGJA 5KT6A 4JI4J 1UZDA 2HWHA 3I5CA 3HVTB 4TXSA 2VFUA 5B0BA 3VVUA 2DHHA 4JI2F 2CQDA 1EB0A 1S1UA 2XBPA 2QMUB 3RB6A 1BXNA 4QIVA 2VC0A 3WZ0A 1U1KA 4I6WA 2MGZA 3JSRA 1YG0A 5BYRA 1PG5B 1LXJA 2M7SA 3DKDA 5ETPA 4I0WA 4A8YA 2UXBJ 1IBCB 2VG7B 5EN1A 4QIEA 3MMCA 2BQUA 2CQGA 2FVRA 4KKOB 3OL8A 3JQKA 1XTZA 3S6EA 3WX4A 4BHQA 4YUDA 4F7VA 1LWEA 1GMWD 2FZGB 1HPZA 1YRTA 3Q2SC 1V5IB 2GJFA 2RUGA 5B08A 3CJRA 3KHHA 1N0UA 3BGOP 1I3OB 3TA0A 3W65A 3W2WB 1HFEL 5D0EA 4KT0C 3Q24A 5CCMA 1M5KC 4YN3B 2W2NP 3OJSA 4NLXA 3THVA 3MR2A 3VAHA 4JI1J 2HFOA 1BQMB 2CQ1A 2XMVA 2XHWA 2W7PA 1QJHA 3PVXA 1RUSA 2AIRB 3UNGC 1R89A 3SQGB 3M9NB 2RF2B 3T41A 3OHBA 3UO0A 4FBTA 3R5AA 2AKWB 3K5PA 3JYTA 4Q0BA 3OLBA 4ECVA 3A4TA 3GJSB 2OH2A 4DSLA 5K14B 3HKZD 2BJ1A 4FPRA 1JJ4A 2HHSA 2V8PA 1WKJA 2Z57B 5IM0A 1M90T 2CDQA 5AT1B 1PGZA 3MEGA 4LFBJ 2JRSA 1HBNB 4J9KA 1KN6A 3CW2C 1ACMB 1RU2A 2QRRA 2M5YA 4IFVA 2UU9F 5KTQA 1NB7A 3T6BA 2ZKTA 2IM3A 1MG7A 1TL5A 2YXLA 3NS5A 4FF4A 2EBEA 1LXNA 3M6UA 4DPYA 1Q5YA 9RUBA 4ANEA 4PCQA 4ECUA 1RAGB 3D54A 3PY8A 3L9ZA 5C25B 3MM6B 4NX9A 5HVGA 2F9DA 4Y6IA 2XO7A 1U8SA 1IJFB 1Q95G 3ETOA 1LQ9A 4KV8B 2XZTB 3V4IB 4ALZA 2WVCA 2MSSA 1WTBA 3HVTA 1KTVA 3KUEA 2NCKL 2ZUGA 2LP4A 3QAEA 4WTYA 3L7OA 2P2CB 4YFUA 2DXDA 3DRSB 4DUTA 1F2HA 1KEKA 2KFNA 2SXLA 2DB1A 3K89A 2J8AA 2HIYA 3MUMP 4NRUA 1FESA 1MNEA 3S8SA 4NLWA 4GKJJ 1VRTB 3DM2B 2B4VA 5C2CA 4KKOA 3AB4B 2B8PA 2FC8A 2Z2ZA 3BV8A 2IFXA 1C0UB 2GAHC 2W2PP 2VKRA 3WIUA 3MMBB 5A8RA 5JMNA 3H4BA 4CLSA 1HQEB 2E1AA 4F0HA 4K4XA 1TZ0A 2IMOA 3CCVS 2EFPA 2Q3PA 2C22A 2HNDB 2BBEA 1HBOA 2WVDA 4DR6F 4RW8B 3W2WA 1VK8A 2CVEA 3L4BC 5LSLA 4N5SA 3NNCA 3ENQA 2CPZA 1TU0B 2OEJA 4J9NA 4B08A 2ZZNA 3NS6A 2BJEA 3BSNA 3ZZYA 4OJGA 3D0IE 4Y2IA 2OIHA 3IAS9 4RNFA 4L3NA 1B0TA 4EEYA 4GC6A 1JLCA 3A8JA 5A8WB 3SQGA 1XNRJ 3WHIA 3WDOA 1VQSA 2Z0GA 3HKWA 1U1QA 2K3IA 3PDNA 2Y1JA 2HWIA 3ZNJ1 3I5AA 5K14A 2WCXA 4CT9A 1WORA 4F2SA 4K8RA 3PHTA 1I51B 5HBMB 2UUBF 1VGYA 3PW4A 2YX4A 2M0GB 2HQCA 1HBNA 3ZNUA 2GFFA 3IWNC 5B0GA 1GT8A 4OV1A 2WVBA 1G4CA 3FJ2A 1RCOB 5KFPA 3TUIC 4RUBA 1KOHA 4M5IA 4NLYA 5L39A 2ZH2A 2MB0B 1AFJA 3I4HX 3V81A 3BKTA 3P45B 2GX8A 4LFCF 1HNXF 2F4VF 3P4UB 1K44A 3DGPA 3I55S 5C25A 1FJCA 4FYVB 5FD1A 1S7HA 3MM6A 2MKJA 4P10A 2RH3A 4NXNJ 4LUBA 2FPHX 1NM2A 3BN7A 3FUYA 3V4IA 1YBTA 1IVZA 4URGA 1T05B 4LREA 3I82A 2CNOB 4F4WA 5KFRA 3T1YF 2ZE2B 2OMOA 3UE2A 2JZ5A 2CYYA 4DV4F 1OPIA 2H9ZA 4C8KA 3KTQA 4L6V3 1U6ZA 4TLQA 4Y0FA 1A0OB 4K2JA 1YRXA 1S5ZA 1F9HA 3K57A 4OHZA 4MKAA 3D6TB 4PYDA 4LJMA 3GYXB 4LSLA 3D3BJ 4DI6A 4IQMA 3UD4P 4ECTA 1C0UA 1GTEA 2EK6A 2ROGA 2AD9A 1NK0A 3ZXWA 4F4ZA 4Y34A 1H38A 3E2EA 1HQEA 4LF5F 2IJNA 1SIWB 2X3DA 3H40A 3BGLA 2IJRA 3TI0A 2COLA 4RNNA 1UVKA 1B0VA 2GJIA 3BN4A 4HI2A 3TRGA 1S97A 2XMKA 2RILA 4ZVRB 3QGHA 3SSQA 5B7WA 5KT3A 3CCTA 2O66A 3KNAA 2V67A 1ZS6A 3H42A 2MQNA 2LEPA 3DNCA 3H25A 2YH1A 4L72B 4FYYB 1IKWA 3GSDA 3VV2B 3G8QA 3J80U 2FY8A 4YB6A 2YX7A 3G6YA 5HBMA 4K4TA 1SL2A 4M5DB 2ASJA 1TKXB 7FDRA 3TEHB 5CZVA 4URSA 4EBDA 3BO2A 1EETA 2B51A 1CJTB 4DFJA 2MSTA 3IS9B 2XY5A 2DRDA 4ATNA 4FYXB 2PGCA 3TJ9A 1CJVB 3NOGA 3ZZ0A 2YPYA 1NO8A 1KFSA 4DV3F 2YPZA 4F3OA 3QQCD 3M6VA 3MR3A 1QTMA 2OTLS 1YJVA 3CSKA 3PFOA 4F4KA 1X5SA 2DRAA 2F8MA 4ECSA 3GCXP 5K8OA 2J0QD 2PEHA 5HQMA 4AQYF 1M5HA 4LF8F 3R3TA 1S79A 4H4KA 1TR0A 2W25A 4NLUA 2HZCA 1FJGF 4ED3A 5E33A 1KONA 5CA5A 5ETKA 3TEGA 3V5RA 3NGRA 1TQLA 4A8OA 3NGSA 3PG9A 2WVFA 4NL5A 2CQBA 3K7RA 3L95X 4O3OA 1QAJA 2CQ0A 2JNJA 1OMSA 1V3RA 2HSEB 1TVRB 1UMJA 2X51A 2KH9A 3FRZA 4B3TJ 4O44A 2U1AA 4RBTA 2Z4PA 2WBRA 1HBMB 2GZOA 3M05A 5HMYA 1PAUB 2IM2A 1M5PC 4FS2A 2KHCA 3D67A 3GJQB 3AOBA 3QJPA 1RAEB 2O3DA 4MK9A 2H5EA 1HYSB 5J1PA 1N5VA 1QLNA 2HNYB 1BQXA 1ROFA 1QUVA 4MIAA 3DLLQ 1FFGB 1GMVA 2MQOA 2C3PA 1C2PA 1WEZA 1BUXA 4IOAQ 1XMQJ 4WFXA 4JI6F 2QV6A 4DV0J 3FSYA 1OY9A 3DLGB 4KYZA 3E8OA 2KRRA 4YB7A 2A1BA 2E9ZA 2VASA 1JKHA 1NH8A 3ZO7A 4I2PA 3G86A 1HQ2A 2CPIA 1NJWA 3HD1A 2LMIA 2R7RA 4QPXA 3RB3A 4DBQA 2DXFA 4B3OB 3SSRA 3OR2A 4P71A 4Z7YA 4HDGA 4I7FB 3V6DA 3O1LA 1X31C 1OQ6A 4CO0A 3GTYX 1UFLA 1RKJA 1RTHB 3HHKA 2F65A 2XSJB 3EDRB 4PWUA 2ZBQA 1BQNB 3F56A 5THWA 2ZOGA 3HVRA 2YNHA 4JV2A 3PXGa 1RXOB 1FWKA 3QWPA 1FRXA 4NA2A 3T1HJ 1TKXA 1U09A 2KVIA 4QYZK 4IH6A 4X66J 8AT1B 1C0TA 4X4UA 2IRYA 1N32J 2AMCB 1JLFB 1CJTA 3IS9A 3RRHA 5GAEU 2WONB 5D4OA 2BE9B 1FRJA 4RBVA 1CJVA 3PIPQ 2CPYA 2FD2A 4USVA 4GO7X 2ZOFA 4A8XA 1DBDA 2ZJPQ 2HAIA 2DIVA 2P9CA 1B4SA 4JI5F 2E1CA 2AYGA 1G2EA 4KO0A 4P2MA 2RS8A 2XMAA 1SVDA 1LWFB 4O3QA 3BDPA 1MMLA 2ZKUA 2RVJA 3HHNB 5EGYA 1SKUB 2HVEA 1X9WA 4CWBA 4RNOA 5HATA 3CO9A 2R2TA 1PAEX 3KG0A 2MKIA 2MKCA 1YHQS 3HSDA 5F0WA 4RU2A 3OTBA 2MDAA 5G4DA 3W3SA 4N7TA 2ADBA 1KTQA 1K8AT 2HW3A 1SC3B 5HK4A 5CYQB 2A6OA 5FLXU 3N28A 5LJ5Y 3KYLA 4EBCA 4RPFA 3NKYA 3VAFA 5KG2A 1SC6A 4LR7A 4IRDA 2P9EA 3I96A 3N5BA 4ECZA 2J5AA 3H5SA 4K7QA 1D9DA 4M8LA 1A7GE 2WBMA 3KHRA 1JXEA 8RUCA 2ZH4A 4DV7J 1HYSA 1XIQA 3CJSA 2JEIA 1WOPA 3VTIA 1PIEA 2ZJQQ 1H73A 4EBEA 3HHDA 4DQQA 4OJHA 3HSJA 3QWUA 3DLGA 4FPIA 1PCAA 4LSNA 4ECYA 5E3PA 4HT5A 4OLOA 3AH6A 4LF1A 1U26A 2C2KB 3P96A 4UZCA 4KTQA 3EGVA 3I9V9 4KY3A 2XS5A 3NRBA 5T7LA 1YJWS 4I7FA 3O3LA 4KB7A 2JVRA 2XY6A 4UY85 1RTHA 2LDYA 3QT5A 5E5NA 2ZD1B 4DV1J 4OYPA 2V2ZA 1IR1A 2XSJA 3CJ8A 4QU6A 4LF9J 1BQNA 4RX6A 3IRWP 1H7WA 2F63A 3TZZA 1Q78A 5KG5A 1WOSA 4LIWA 1IBKF 1QVGR 3FEYB 4CQ1A 2Z2MA 4ZA1A 2HHUA 4U8YA 1JJHA 2Y1LB 1RSCA 1S9EB 3MEKA 2HLUA 4DPXA 2WONA 1FVQA 3CJ0A 4PPZA 3TX8A 1QD1A 5J1NA 2W9AA 1YJ9S 1U1OA 3CMES 2V69A 3VGTA 1U48A 1W25A 1VQPS 4OI0A 3DOMA 4QWDA 2DBBA 3V6HA 2FUG9 2CNNB 1RHRB 4DLEA 4WK3A 1TL4A 4K4YA 3GIIA 3VF0B 1RBOB 1R0BG 3VAKA 3DHXA 2QT7A 5F8GA 3OSPA 2ZM6J 1LV5A 5C2GA 3H0PA 1ZAVA 4K5RA 2ZOMA 2DYAA 3HZGA 3MR7A 2QG9B 1XNRF 4QOTA 1RT4B 1RP5A 2W7AA 1RT1A 2OPQB 4TKTA 2IDEA 4ED0A 2HNZB 3KK2B 4JBCA 1HNIA 2KT2A 3ZTSA 5F3TA 2I6WA 1EIYB 1RYSA 4B9LA 5ETTA 4DR5F 2CKWA 3U1NA 1NBEB 1M1HA 3B54A 1VRUB 3RBZA 1LFPA 2VOPA 2GW8A 2HQ3A 3EXYA 4Y2CA 4YY3F 2MQLA 4M94A 2OTJS 2ZH6A 1N33J 2Z58B 3MHYA 2CPFA 5F9NA 2EKNA 1S0MA 3QSIA 3BBFA 5B09A 2CWXA 5H9FJ 2YKQA 2QN6B 1QAXA 1B7FA 2AP6A 5HANA 3DU5A 4K4SA 5ETVA 2DD8S 1URRA 5KFZA 1QSYA 1FJ7A 1NJYA 3W61A 4XPEA 3BB5A 4UOFA 2X1BA 1VQ6S 1HNVB 4ECQA 1HLWA 3MFIA 1LKZA 2E5GA 3LUYA 1J5EF 1CBKA 1LWCB 3KLFA 1QSLA 3BH6B 1KNZA 2CRLA 2PA8D 2GQ2A 1XERA 2AWZA 4P2XA 2YVSA 1DZ5A 1S9EA 1UFKA 2A18A 3CDAA 5LT5A 5HL7Q 2ZH3A 1S6PA 1LW2A 3M8YA 3CCSS 4C7QA 1U0HB 4LSZB 2X1AA 1YRUA 2BJ7A 2XY7A 2KXFA 3EVMA 2C3MA 3DRYA 2HPUA 4LT6A 3C46A 3EUNA 4TY9A 3OTOF 4ZVUB 3MTKA 4N8NA 2H65B 3MCNA 4ZCKA 1KKHA 1V3ZA 2DISA 2W4DA 1WDTA 1PKUA 2OPRA 2DKOB 2OUGA 4UOHA 3I0RB 2JLEA 1XK8A 3OL7A 2R7VA 4LF4J 4NWBA 3TARA 2DY1A 2OPQA 2UXDF 1OY8A 2NREA 1RTDB 2V50A 1CS4A 3OTCA 3O8WA 4J37A 3TVYA 3KK2A 5D3GB 3TAMA 2QC3A 3J7AN 3KLEB 2CJBA 2J0SD 2KO1A 2DH8A 1JJ2R 4ZCMA 2FVPA 1XMBA 2DY9A 4QW9A 2FJBB 3UFCX 3QT8A 2W01A 3OTEA 2QIFA 2XEXA 3HT0A 3CC4S 1YTYA 3BH7B 1EARA 3M2VB 1I94J 4ED8A 1Q1KA 3OW2R 3I31A 2EK1A 4LQ3A 2LQBA 3MM5B 3FGVA 1VQ8S 3PRDA 5JXSA 3W2VB 1H98A 3ZC4A 2PMHA 1E6YB 2W7OA 4ZVTB 5HMZA 2ZVIA 3IM8A 3G6XA 4ZP7A 3PJXA 2MPUA 3IR5B 2R7QA 3C14B 4F67A 2EFVA 5DG8A 1E6VB 2LQJA 3BQ1A 4J9QA 1IM4A 3FC9A 2DGVA 3D9BA 2J6SA 3FVYA 1S4FA 3JB9k 1G3OA 3AQPA 1VQYA 2CADA 3T9ZA 2B9WA 4C0HA 2AJ4A 2MZSA 4A8KA 2KZMA 3T1AA 5H9EK 3ILIA 3R5BA 2DR5A 2R8HA 4PQUB 2QX0A 1R3NA 2OD6A 4ED7A 3A3PB 5E2QA 4L73A 2J7UA 2W2OP 4QQBA 2GJ2A 2B3TB 3J81U 1K47A 2W8LA 3R7NB 2UVUA 1D3WA 1D8ZA 3MCSA 2I38A 3GIJA 1I5OB 2V34A 4OZLA 3ILLA 4Q2LA 4NXMF 4RW7A 1S76D 2FIUA 2ZH1A 3MAAB 5M2UA 2R7OA 4ES1A 4USKA 3W60A 2E5LJ 1FRKA 4ZDNA 4X62J 3ICLA 2HQFA 2NXUA 1X5TA 4OHXA 4XIUA 1WNEA 4WCEQ 3HMJG 1LWXA 2ZUAA 1QUPA 1Z1ZA 2QL9B 3HHLB 2DNLA 1FHTA 3JXOA 5KFAA 3I0RA 2GO8A 4DL5A 2VG6B 1NK9A 1YZ7A 3GCWP 2MLYA 4JI7F 1RTDA 1F9FA 1SJQA 1F2GA 2EBGA 3KK1B 5E3QA 2CJXB 2OJ3A 2HK3A 4JI0J 5D3GA 1X4DA 2N82B 4IG3B 4KGXB 5KFEA 3SXLA 1D9FA 4X66F 1SKRA 1R0AB 1VDHA 2DHXA 3G82B 2QLXA 5KG6A 5DLGA 4F25A 3V6KA 2EW9A 4X4QA 4KGZB 4ZKAA 2X3GA 4JI8J 3KFWX 1VLYA 5DG7A 4I2QB 1NPRA 4USMA 1VJWA 3W2VA 3KDOA 2KG0A 3Q86A 4DF8A 1E6YA 2FHJD 4P7VA 3A12A 2DGTA 1ZTWA 2DRBA 2DHSA 9ATCB 2NPIA 2O67A 4XPCA 2HLTA 3C14A 2D9PA 2JLFA 4OX7A 5LXYA 2HIQA 3IGNA 4RNMA 1Q7LB 3N6NA 1E6VA 1VHIA 3W63A 2GQCA 3AJ2A 1S4EA 1UA1A 3VHQA 4R5PA 1OWXA 1U25A 3QFWA 1UP1A 2KM8C 1OO0B 1YITS 1JLBB 1TMMA 4M5MA 2D7SA 1RWMB 2RKIB 4PQUA 2OO4A 3R5CA 4ERDA 3FZBA 4QR1A 3GLJA 2BW7A 3MURP 2V0NA 1GX5A 2C2RA 1TV6B 3GMGA 3ZZRA 1IKYB 2Y1IA 4DXLA 4P2FA 2JEGA 4X4SA 4BCAA 4XDDA 3VR1A 2CQPA 4OZJA 2KYXA 3MAAA 2WK4A 4WFYA 3NBPB 1K1SA 2NXEA 2VG5A 3ET6B 4NA3A 3W5ZA 3PFEA 4QWBA 4F0KA 4X4VA 5KFOA 4NLDA 1RHUB 2VPWB 2DNOA 2UVWA 4G3IA 1S59A 1SUQB 3LWMA 1UJ4A 1U0SA 1UVJA 3QYYA 4WP9A 2OFGX 3MPYA 3JAMY 2DNYA 2N4CA 1F9EB 3IRXB 1PC4A 2P6TA 3HHLA 4WK1A 3IN5A 2JOQA 1W7WA 5H9FK 1NK6A 2ATLA 5DJBA 4GRSA 1EHWA 4DR7J 1Y00A 4DL6A 2KFZA 2G2YA 2ASYA 1NH7A 4AD6A 3AFGA 1KQGB 2DNMA 1RQ0A 4JP8A 1U02A 1SI9A 2YNIB 1RAJA 3CCRS 5IS2A 5KFCA 1R0AA 2AYBA 3H98A 1UW9A 3G82A 3D0HE 3M4XA 2P6SA 3H2VE 1Q5VA 4NLPA 3EE3A 4DMZA 2VDHA 3OFHA 3EXCX 5IT4A 4DG1B 3CEDA 2XCAA 3BR8A 4DPUA 2YNFB 4J7CA 3KG1A 2MHNA 1JQGA 3C8YA 1GXTA 2JJ4D 4PKDB 4MKYA 5G0RB 1XEZA 2VFTA 4LBPA 4DDFA 4B9NA 1RYRA 2DR6A 3TVKA 3FCHA 3NWRA 4OZ2A 3KLHB 1R8CA 5E41A 2GHVC 5KFFA 3CXCR 1U6FA 4PXDA 2V2QA 4DU8A 2B7BB 2DO0A 4IG0B 3R2CJ 3DRPB 1UEKA 3DC2A 2AZ3A 4OYMA 2BR0A 4NMLA 2PMZD 3JTOA 1S10A 1CC7A 2R8JA 1JLBA 1GK8A 3LPYA 1KQKA 5KOWA 4KHPJ 4EK2A 1UFWA 4B3MJ 1VQ9S 4ZHRB 1U47A 5AJ3J 1HNWJ 2QSWA 3N0VA 1HL6A 3ZZZA 3AB2B 4Q2MA 4DV6J 5L1JA 1X4BA 4NI2B 1TV6A 3MOJB 3OV7A 2ALZA 5A76A 2HG4A 2VQFJ 1G1XA 1C4AA 2W24A 2B5JB 3O44A 1RHKB 4TYAA 3UCUP 3J7A1 4OV6A 1ZM3A 4XTTA 1HR0F 2WSCC 3UQSA 3ITHB 5C7PA 4CLPA 3HFZB 1N33F 3NBPA 3LO3A 1JNRB 1VI7A 3ET6A 1RHJB 4R0JA 1HBUB 5GMKa 1VC6A 4PG5A 1G7CB 4HL9A 3VZIA 4MKBA 5CAAA 1MU2A 2RT3A 3CD6S 2XMJA 3SMZA 2BJ8A 2DGXA 1MMNA 1U1PA 3IRXA 2KT3A 3AA8A 1Y10A 1Y3JA 3UR3C 3M2RA 1KHWA 2DVIA 2QLFB 4ECXA 4ZN3A 2X1FA 2H3EB 4EO6A 3GWCA 4EWTA 2ATCB 1QAIA 2GA7A 4ZPWR 2YKMB 3OFGA 1R43A 3KJQB 2OP5A 2V9KA 3EM1A 1FT8A 4E0DA 5BR8J 5A6WA 4CIOA 3GV8B 1DTTB 3IR6B 5KFTA 1C1CB 1TK8A 3CJTA 1WEXA 2AF6A 4DSFA 2XLJA 1NNDA 3QSYB 3K5MA 2YNFA 2CQ3A 2QMWA 4B3SF 1XR5A 5CCLA 1D0EA 3TUZC 4QIGA 3QFHA 2HGMA 3MECB 3OUYB 2D9OA 1FKOB 4TU8A 2VC1A 3DMJA 4HKQA 2W4CA 2YWEA 3R5GA 4QYRA 4OZNA 3FRYA 3GFHA 3MF5A 1RT6B 1JLGB 1X60A 1S1TB 3M9OB 4KFBA 1L3TA 4NPOA 2PI4A 3QRPA 1QAYA 1SKWA 4IG0A 5DS7A 1CJUB 1C1BB 1WSVA 1PJ5A 4J9PA 2ASDA 4LFAJ 1QE1B 1X9SA 2Q6BA 1OYEA 4JYAF 2RHSB 5BXIA 3TNVA 4ZHRA 2J6UA 2I2YA 3WC2A 5KT5A 5FDLB 1FTCA 2AJ1A 2IYGA 3DRRB 2CIMA 4ZJQA 1K0VA 4M5JA 1AUSL 2XYGB 4EYHB 2G2ZA 2XHCA 1X0FA 1WI8A 4TVAB 4OFZA 4X65J 2H51B 2FJVA 4DV5J 4IOBA 2B5JA 1F3VA 1F6TA 1T9YA 1IN0A 3DLHA 1J2VA 2CWKA 5ETOA 5L8RC 2QTWA 2HBZB 3VCDA 4F3QA 4NYOA 2ZITA 2WOMA 5U47A 1DRZA 2GNKA 1HNZF 1F1BB 1SKSA 3C66A 3UN3A 2DXEA 4DL7A 2F8EX 3H2UB 3U1MA 3PW7A 1OSDA 2V2KA 4HHHA 5AE3A 2J9EA 4DR1F 1X4CA 5LM7E 1MN7A 1MMDA 1YSJA 5KFKA 3SZ2A 1FD2A 2OPPA 5KT2A 2YKMA 1TKTA 3EVWA 3B6BA 1MN9A 2VZ9A 2RB7A 1TFWA 3QLHB 4CCHA 1EP4B 1H3DA 1Q86T 5L38A 2CG8A 4ZPDA 2M8DB 1ULRA 1DTTA 1RWXB 3UDCA 1ZPVA 1RT2A 1O5JA 3PEJA 1JXLA 1C1CA 2DITA 4C97A 2BANA 3CJKB 3PX0A 3M1VB 4A47A 2FDNA 1N0VC 3MD1A 3CCWA 2ZBCA 1R8BA 3VAGA 3GFXA 5KOXA 4IO9Q 4ZCLA 4QW8A 1QY7A 2LXFA 4ZJLA 1KWMA 2D3UA 3RJMB 1Z2ZA 3RU0A 5C5JA 1FKOA 4LF6J 3G96A 3POTA 2D1CA 1NJIT 4FN5A 4Y65A 1X7VA 3MAHA 1HMVA 3C16B 1RT6A 1JLGA 2Z56B 3EWGA 2MQMA 1S1TA 4ZPBA 2VBYA 1LEOA 2ASLA 1YZ6A 3H5XA 2DH9A 4MFBB 4DSJA 4AYBD 3MFHA 2E1RA 1N36F 1NHVA 2UXCJ 1C1BA 4PAAA 2LQ8A 3BPSP 3FMBA 4KHRA 1H72C 1QE1A 5KFXA 2VOOA 5C42B 3E01B 2ROPA 3HZEA 4JI0F 2DGSA 4WYLA 3BKUA 4DR3J 4PUOA 2QE5A 1JIHA 2MKHA 5FDLA 3DRRA 3HJVA 4LR8A 1IJEB 5J2QA 2F4FA 2PSZA 2HS3A 4IKAA 2DR7A 2ZZMA 2WAQD 1BC6A 4P52A 3UNYA 1X4FA 3EPGA 3EZUA 4MJKA 2CPDA 1NEEA 4X4NA 3HT3A 2JDJA 2KN4A 3P6YC 2BMBA 2VUGA 2VQEJ 2PIIA 2F40A 3PX6A 1VIOA 2BRLA 3KMQA 2XULA 2E9RX 1HHTP 4HVZA 1XNQF 1N5TA 5F3ZA 2V4JA 5D77A 2V8GA 2LECA 3R6LB 2ZH7A 4WWSA 2R42A 2RS2A 3AOAA 3U27A 3QLHA 2C2ZB 3JS9A 1TAQA 1HD0A 2CZVC 1EKSA 4CO3A 4OIXA 3W62A 2XYPB 6AT1B 4QIFA 2CZ4A 1UWBB 2W9BB 1ZA2B 2DGOA 1CQMA 3CJKA 3M1VA 5DGBA 1N48A 1FFWB 3FQLA 1CQNA 2R7SA 3MMCB 4WXWA 3DLEB 3ILOA 5HN0A 1YJTA 2LA6A 4LRBA 1VHFA 4RW9B 2LXIA 1WUUA 3VVTA 5IT9Y 1LWEB 2CJ9A 4QPTA 4TY8B 2PN6A 3M9MB 1HPZB 3ETMA 4ECRA 4JV1A 4C9DA 2FHKA 4UUXA 5HLFA 4C8ZA 3C16A 4ZLPA 2JFDA 3DI6A 2FVQA 2Z2LA 5LOQA 1TL7B 7AT1B 3P49B 4B9UA 1RTZA 2UP1A 4MFBA 1F5AA 1U1NA 4DR2J 2MQPA 3G2XA 3IFEA 4A46A 2Q79A 3TVZA 2FY1A 2IVYA 1IBMF 1FCAA 5C42A 2E9TA 5KG4A 4TN2A 5L1IA 3LP2A 2YQ0A 4K50A 3TYTA 3W1YC 1UL3A 3JYTB 1DURA 3LF0A 4NLVA 2ZDPA 2YKPA 3HM9A 4O0NA 2ACMA 3RAXA 1T95A 2YWWA 4MIWA 2RD5C 1WJ9A 1S1WB 3MEGB 4U67Q 2CQ4A 3OPKA 4IOCQ 4GKKF 1KS2A 1BWEA 3NCRA 1NB2A 2R7WA 4WU3A 3M6WA 3GIKA 3J7YI 2FJAB 2JEFA 4WE1B 3LWLA 3SFUA 1PBAA 1TUVA 2VBXA 3R9LA 1LK7A 4FF2A 4A4JA 5ETMA 2HS4A 5K8NA 1RE1B 2IIHA 1KD1T 3MEDB 3D3CJ 2UV8G 2NUUG 3HO1A 2K7JA 1SH3A 1O8BA 4I64A 4F26A 1JMTA 4Q8EA 2W4PA 4TNOA 1SC1B 2HVIA 2NSBA 3WC0A 1J27A 2FJXA 2RJZA 3MUVP 3LALA 2R7TA 5DLFA 3L3CA 2UUAJ 1NUEA 1UCNA 2L9WA 3ZFVA 2ZVSA 5IV4A 5AJ3F 4Q43A 3FBEA 1UWBA 3HULA 2W9BA 3DYAB 4DV6F 2XS7A 3BGRB 4P2SA 2KRBA 4V19X 2DNPA 2C3UA 2V9WA 2VQFF 4NA1A 1VLOA 3QGGA 3DLEA 4FKXA 4ZVEA 2JEJA 3EPIA 4C8YA 3CUNA 4RW9A 3E51A 2DGUA 4HH0A 4LF7J 3OD2A 3UD3P 4NLGA 4PYAA 3VGVA 1W2BR 3CO0P 5A8RB 1H2UX 4TY8A 4NEYA 2NYIA 3R97A 2KKHA 3TA1A 1ITPA 3LP0B 5CQGA 4DV2F 1GFWB 1DLOB 1HBOB 2VJVA 1TL7A 4DL0C 4C0OC 1B64A 1VQLS 2J7KA 1FA0A 2VDIA 1N34J 1RDRA 4B9MA 4PZVA 3TAQA 5EX0A 3NL0A 4ETZA 4MAKA 4DR4J 1R27B 4KH1B 3VGSA 1JLCB 4ER8A 3IM9A 2QA2A 2Z2YB 3WX8A 4N41A 4DUYJ 2YQ1A 3F41A 3LANA 2V8HA 1KQFB 1Q8LA 3G9CA 2HBYB 4M5NA 4L74A 3D66A 1S1WA 4CYUA 2QFIA 4CTAA 1U2CA 2Y0SD 5L1KA 3MOZA 5B0DA 3VWSA 2LA4A 5IC6B 3HXMA 2BJ9A 4DUZF 4E8UA 2KFYA 4WPAA 5KFGA 3Q8RB 3PYFA 3BS9A 4DS5A 4C11B 4RJVA 1IQTA 4MMOA 4WE1A 3SCLE 1X5OA 2JL9A 5IQ6A 4USIA 4ELTA 3V81B 1AT1B 4H4KC 2F9JA 4ZOSA 3EVOA 2AV5A 5KFYA 5J1EB 2G0IA 3DGPB 3FEZA 1B7YB 4NCGA 3MEDA 3T3FA 4Q45A 2MZRA 3NAHA 5MLCV 4H4OA 1KLMA 3AXKA 3QPIA 4J9OA 3OFFA 3FK4A 5KFJA 2FGCA 4CH1A 4EYIB 3SV4A 4U8VA 2DEJA 1L3KA 4A8QA 2V8VA 4F50A 1R8PA 1SIZA 2NQPA 3Q2TC 1Q7YT 1KOOA 1NDPA 3N6LA 4ZLNA 3CVKA 3DYAA 3T5JA 1GEHA 3PZPA 4LBHA 2KYZA 3BGRA 2B9XA 1XWLA 2BJ3A 4X65F 2MYFA 4F4AA 2UZAA 3DLBA 4YMEA 4LSLB 3BBBA 1S49A 1ZYQA 3H7HB 2BOAA 2RNEA 4NYPA 3VAIA 2PO4A 1NMEB 2HBRB 3K0JA 3I5BA 3K8WA 1AFIA 4WYWA 2DNZA 3KJFB 1EX8A 2M4MA 3LP0A 2K1RB 4JI2J 1S9FA 3MCOA 1FX2A 4LRAA 1NPPA 1DLOA 2R3VA 2C42A 5SUHA 3GG1A 4BLGA 2XO6A 1RB0A 5D78A 4CLYA 2VICA 2FVCA 4WKRA 4ZS6A 1NCLA 3GFZA 3N6MA 3BO3A 3M2UB 4NASA 4BWJA 4ZLJA 2GC8A 3LPEA 2QL5B 2Y8WA 3MD3A 3UPFA 3GZ7A 1MLAA 2AEJA 2BUNA 1WF1A 1YK9A 2NXJA 2C2DA 4ZPVR 4LVOP 2E1MC 2HHHJ 4WIIA 4YDXA 2GVZA 1IKWB 4K2XA 3GR1A 3GPAA 3LGHA 2RDJA 2GAGC 2NPFA 2DNGA 4DN9A 3OR1B 1IUJA 3NG8A 1SB6A 1IM6A 1ZH5A 3RAQA 4UTGA 3EYZA 4ZVPB 2QJ3A 1S1XB 2V6AA 2CPHA 1EETB 4PXBA 3IG1A 1P27B 2OHDA 4C11A 2RQ4A 3FZ2A 1NDLA 2EFOA 5J2MA 1UVLA 5IOLA 2DGWA 5LSOA 1UPPA 3RBXA 1FWLA 2BABA 2VV5A 4OYIA 5J1EA 1ZM4A 2LEAA 4ILLA 4UT4A 1Q0NA 2C2NA 4DPWA 3CDEA 3I0SB 3IP0A 3QJLA 3I6PA 1FFSB 2XMMA 4DSKA 2XI3A 3V4MA 3QIDA 3HJFA 1N6QB 1FXDA 2V94A 2OSQA 1S0VA 4DR3F 5KG0A 3CB4A 3A1YG 3CCQS 3H4DA 5F0UA 5M2RA 2B9EA 4DOZA 7FD1A 2R2UA 4DCJB 1V5VA 1NKEA 4AL7A 3SCKE 4O44B 1N54B 2ZBIA 3EGWB 3ULHA 2D69A 4FVCA 1R7IA 4WKYA 4TU9A 3LH2S 1VK3A 2HHQA 2VONA 2GQQA 4RR5A 4IR9A 4ES3A 1TUGB 4KQZA 3QT7A 1KQSR 3W64A 1R6YA 2HQGA 4USWA 1U2FA 1SQFA 4I6YA 4ETXA 3A3OB 1WI6A 4O4RA 2K1RA 1HWIA 4DZDA 1LOUA 3KLGB 2MMYA 2VQEF 2PDAA 4P74A 1TL1B 1FRIA 4DQIA 2VIHA 4CH0S 2CNLB 3L7PA 2C3OA 5KFQA 1JKHB 4JV5F 2XCPA 4DX6A 3PV8A 4I2PB 3M2UA 4G65A 4OQJA 3DFEA 4FS1A 3NS7B 3OR2B 3JSMB 4M5HA 4CO4A 1NKBA 3V6DB 1J5OB 3DDKA 3CDWA 5ADZA 3R2DJ 4P75A 3BZQA 1ZZNA 3C6UB 1SV5A 5K8PA 2CQIA 4KHMA 3CF5Q 3CMQA 3H5YA 2FZCB 4AL5A 3Q22A 4ILMA 2I9SA 1FERA 3M6XA 2YNHB 3N01A 3OR1A 3CD7A 1SCJB 2CXEA 3TO8A 2XMWA 1ZETA 1WC3A 1IR0A 1WC0A 1C0TB 1RACB 1S1XA 3K8VA 3CDUA 2KL8A 2P8IA 4NLOA 2Z8QA 3O6QA 2HGNA 3IBFB 1Y5LB 2YKNB 3KHGA 4MK8A 1EQ0A 1S0NA 2V5HG 4N47A 5EWFA 2HRYA 4PXCA 3H90A 2V2VA 4WBFA 3RZAA 2MY8A 2KHDA 1WG5A 3NNAA 2H1YA 3DLKB 1RWWB 1Q82T 2YNGB 2CFXA 4GVBB 1UETA 4J91A 3EGZA 3NMAA 4KO0B 1RWVB 1RHMB 2UUBJ 3I0SA 3W8PA 5KG3A 1R0CB 4FNIA 3S7RA 2WRMA 1FNMA 4ECWA 5ETRA 3LOUA 4CZCA 2YY3A 1IQZA 2DCLA 2G0CA 1N6QA 1NKCA 1AA1B 4LMZA 1A6LA 1AW0A 3MAQA 3FSXA 5DQGA 4FZVA 1Y5IB 2MJNA 2XZDB 1URNA 1FX4A 1MROB 1RAFB 3NP5A 4DS4A 5EHHA 4C0BA 4LFCJ 2F4VJ 3Q8SB 1N52B 5KFSA 1HW8A 1X4GA 2Z30B 1TELA 5DDOC 1ZTTA 3K17A 4DL3A 4YDDB 3ZZTA 3QO9A 4K0KJ 2YH0A 1S12A 2HZAA 4LVNP 2XSFA 2N3LA 2MZ1A 3FMWA 2XWYA 3T1YJ 3UW1A 2E5HA 2ALYB 3LW5C 3UDEA 3W5YA 1IKXB 3KLGA 1YQHA 4OI6A 2NZCA 1TL1A 2HFZA 4OX9F 5HSPA 1SL1A 1T3NA 4LSNB 1I6JA 1N5SA 2RQKA 3KUGA 3OBIA 2PMWA 4D3HA 1GNKA 4JI4F 2CPJA 4WFZA 2RAQA 4KGMA 3GJTB 1FEHA 3OXLA 3JSMA 1DTQB 5T7LB 2AHOB 4D3GA 4ZIVA 2UUTA 5CYMB 4OHYA 4CLKA 1J5OA 3CULA 1FWPA 4B9VA 3C6UA 4I4BA 4LF5J 5IXUA 4NRTA 2JFKA 3NGUA 1JXVA 2E1PA 1GMUA 1DFDA 2YWHA 4O3SA 8ATCB 1XBWA 5KFWA 2VPYB 5FJ4A 1GXLA 2UXBF 3BGFA 4F4XA 3QAUA 1UAWA 1M5SA 2IA6A 2QMXA 3Q89A 1YVFA 2EFGA 4E98A 2IC3B 2XGQA 3MUTP 2YX1A 4QBUA 2YKNA 1TTHB 3GU0A 1VBYA 3J7ZT 5AE2A 1RT3A 4Z7CA 1NDCA 4P6QA 2AT1B 3CT9A 2E5IA 1PYOB 3DOMB 4HTIA 3DLKA 1CC8A 4DJBA 2YNGA 4GVBA 2FHOB 3W8GA 2M70A 3I56S 2XTJP 3RAMA 1PYSB 3GR0A 2L9DA 3M8QB 2QA4G 3TQEA 5GAHI 4JI1F 1U1MA 2VHGA 4I6AA 4DR4F 5AXKA 3ENAA 2V4RA 3UCGA 3JQMA 4FKYA 1K9MT 1A9NB 2JX2A 4KSEB 4ZK7M 3RBDA 5KFVA 1RT1B 1UZHA 5DZ7A 1AYEA 2VF3A 4EUVA 2JLGA 1RTIB 1MROA 1PO6A 1X0PA 1HNIB 2R8GA 4OI2A 3GYGA 2G2OA 3CJ2A 3HSZA 3THPA 1HARA 5KAKA 1VS3A 5ETLA 4LFBF 2LDIA 3IBWA 2QZ8A 1BD6A 4EGLA 1PSDA 2V4QA 4Y2MA 4AQYJ 2BXJA 1KBRA 4LF8J 1OS5A 3BEGB 3CCMS 4AE5A 1LNQA 1SXLA 3KXDA 1VR6A 1K73T 2BEFA 4P7TA 3RBEA 1IKXA 1QDUB 1YX2A 1VMBA 4UQGA 4PRFA 1AUDA 2EPIA 5B0AA 4N76A 1SH0A 2IPOB 3LP1B 5KT4A 4DL4A 2BQRA 4U96A 3FBCA 4M5LA 3FQKA 1VQKS 2ZHOA 2APOA 3MI7X 4ELVA 1D9AA 3GILA 3JTPA 4QJVA 1DTQA 5SZTA 5CYMA 1RTJB 2NR0A 2YTCA 2J0WA 1KVKA 3MMAA 3BJYA 4DFKA 1S1VA 2LYVA 4I69A 2E44A 4OI3A 3HI9A 3RYLA 4JI6J 2XMTA 1FDNA 2K06A 3JQJA 3C6TB 1WHXA 3KLFB 2B8QA 1HD1A 4GKJF 3NGTA 3CJ3A 4OYAA 3FDSA 4WP3A 3PW5A 2H4YB 5KFIA 1WOOA 1GTHA 2W8KA 2IC3A 3D0GE 2ZEJA 1S6PB 1LW2B 4HT7A 2B0GA 3AAWB 2RRAA 1FJEB 4ED6A 2IDLA 4IRCA 4QCLA 1SPBP 3ZZOA 2L48A 2F7VA 1H0HB 4QR0A 2KJWA 5DDQC 4DX7A 4M5GA 5D0GA 4DLGA 1WTFA 2ILZA 2ROEA 2L41A 2XC9A 1MSWD 2G1DA 3GE9A 2PT0A 3Q23A 3V6JA 2OAUA 1L5UA 3M8QA 1UKUA 2NZ4A 3GFYA 1GMWA 3P5TL 3RB4A 3MPVA 2A10A 2OPRB 1U49A 2IHR1 1Z4UA 4TQRA 2FJEB 3A3NB 1P6TA 2LEBA 1HWKA 2HHHF 2HRUA 3T5LA 1WHVA 1B0PA 3KHLA 1RTIA 2WSEC 1KVJA 1CS4B 4PEOA 2R2RA 3TAMB 3H8YA 1M1KT 1VQMS 1BLUA 4JI5J 5M2PA 4GMKA 1SBRA 3FSIA 1RWUA 2J8SA 4AUKA 4OZ3A 4AFFA 1FDDA 4LQ9A 3N79A 1TP7A 3BSOA 5HVHA 4JUZA 2GMJA 4C8LA 4L3KA 3EX7B 4ELUA 1RAIB 2ZHBA 1X8DA 1Y7PA 4F2RA 3TZWA 5KFMA 2C2EA 4KC5A 1HI1A 2GIRA 1SQGA 3LP1A 2EWHA 2QLWA 3ZTOA 2MTLA 4NXNF 1YJ7A 2H5IB 3LA0A 4FBUA 2XB2D 2HHTA 4EZ9A 3OXGA 4RUHA 3G87A 1XR7A 2EEYA 2OD4A 1NRKA 2F8HA 4ZITA 1RTJA 1TFYA 2OSRA 2WSFC 4ZCIA 2QLBB 4MH8A 1VISA 4CT8A 3TA2A 4OYXA 2AGOA 3NWGA 1VQ5S 2DNQA 2GO9A 3G6ES 2QGFB 1U4BA 2IVFB 2J7WA 1MWYA 4IYQA 4FYWB 3C6TA 2BVZA 3HSGA 2Y1RI 5L9XA 4RLEA 5GAGI 3LGNA 3HCXA 4XO0A 2M52A 2VBZA 2DTJA 4Q7AA 2IMWP 3F73A 1QSSA
chains in the Genus database with same CATH topology
2Q1LA 5C42B 4X64F 4K5SA 3CCLS 4B9TA 2KB2A 3E01B 4WFXA 2ROPA 4JI6F 2QV6A 3HZEA 3FSYA 4JI0F 2XG8A 3DLGB 3E8OA 4CNZA 4KBIA 2DGSA 2WB4A 2OKQA 2KRRA 2VPXB 4YB7A 2A1BA 4WYLA 2E9ZA 2VASA 1JKHA 4UOCA 1NH8A 4HHJA 2ZH5A 2MKKA 4RW7B 3CGIA 4PUOA 2QE5A 1RT7B 1JIHA 4I2PA 2MKHA 3G86A 4LFAF 5FDLA 1BY9A 3FNNA 2CPIA 1NJWA 3DRRA 2LMIA 1IJEB 4RW4B 2R7RA 1WEYA 3MPWA 4I2QA 4DBQA 2FB0A 4QPXA 5J2QA 3RB3A 2LXUA 4B3OB 3SSRA 3HHLC 4HYKA 2DH7A 4QYZJ 3BM7A 4ID5B 3OFEA 3VALA 4NCAA 3OR2A 4NLRA 4WFNQ 1T02A 4HDGA 4I7FB 2AYMA 4H4MB 4J9MA 4ZVFA 3V6DA 3HK2A 2PSZA 3O1LA 2HS3A 3PKMA 1N5QA 2VG7A 1OQ6A 2KU7A 3FFIB 2JC0A 4CO0A 4R8UB 5DM7Q 1UFLA 4IKAA 1RKJA 2DR7A 2FJDB 5HP1B 1RTHB 3HHKA 2ZZMA 1K0TA 1FXRA 2NLWA 5GAHU 5CH7B 5IFMA 2XSJB 4ID8A 4YOEA 2WAQD 4PWUA 2ZH9A 1BC6A 3KLIA 2FVSA 4O3NA 1BQNB 1KVIA 3F56A 5THWA 1X4FA 3EPGA 3EZUA 2ZOGA 1HQUA 3HVRA 2YNHA 4BC9A 1AXQA 4MJKA 4JV2A 2CPDA 5T41A 3PXGa 4DV5F 3MWBA 3SDEB 1NEEA 3QWPA 4FVMA 2YWGA 3SSSA 4X4NA 1FRXA 4NA2A 2DK2A 1TKXA 1U09A 2JDJA 2KN4A 2KVIA 3PHEA 4IH6A 3HT3A 3P6YC 3R5DA 4A8MP 1KC8T 3X1LB 3KJVB 4IUFA 2ZH8A 4AXJA 3T5HA 5D8HB 2VUGA 1C0TA 3KWMA 2PIIA 4X4UA 2F40A 1O0PA 3PX6A 2M9KA 1VIOA 2IRYA 2BRLA 1UVIA 3J7Z5 2LQ9A 3KMQA 2XULA 2E9RX 1JLFB 2PI5A 1HHTP 3IS9A 4HVZA 3RRHA 1XNQF 5GAEU 4YR3A 1XR6A 2WONB 5D4OA 4ED2A 1N5TA 3TQ1A 1FKPB 5DG9A 2AJQA 4IH5A 2RKIA 2FC9A 4UUWA 1FRJA 4RBVA 5F3ZA 5AE1A 1Y3KA 5K9FA 2V4JA 5D77A 5B0EA 3PIPQ 2V8GA 2CPYA 2FD2A 1K1QA 2LECA 2BYCA 4K4ZA 4GO7X 2ZOFA 1ZAWA 2ZH7A 2LU1A 4A8XA 2BA9A 1U45A 1ZZFA 1DBDA 1XN9A 3PR4A 3T9NA 1T3OA 2RS2A 3K5OA 1FDAA 3U27A 2HAIA 2ZJPQ 2DHAA 5KFDA 2EG2A 2KM8B 4EO8A 2DIVA 1IKYA 1BQMA 2P9CA 3QLHA 2PFFB 4KE5A 5AXNA 4QWEA 1XMOF 4JI5F 5KG1A 2BM0A 2E1CA 2AYGA 1G2EA 4KO0A 4ZMMA 2RS8A 3NGDA 1JLAB 1TAQA 1HD0A 4IFYB 2GIQA 2CZVC 4WU2A 5E3AA 2RF2A 1LWFB 4CO3A 4OIXA 1VOMA 4BC7A 3CIZA 4O3QA 3BDPA 1MMLA 2ZKUA 4QIFA 1GH8A 3G8SA 2OFHX 1LW0B 2CZ4A 2RVJA 4J9LA 1UWBB 4O0IA 2W9BB 2R7UA 1X4AA 2F1FA 5EGYA 3HHNB 5F8LA 2DGOA 3U1LA 1X9WA 3NMRA 2HGLA 4X84A 3MR6A 1OIAA 1CQMA 3CJKA 3CC7S 3M1VA 5DGBA 4RNOA 1N48A 3BSAA 1U7LA 1R8AA 3CO9A 3FQLA 2R2TA 1Y9OA 1CQNA 2I0XA 2CQ2A 4W92B 1UVMA 1SV5B 2R7SA 3KG0A 3MMCB 2MKIA 2MKCA 1YHQS 4WXWA 2ADCA 4M1KA 2OPSB 1SUQA 3DLEB 5F0WA 4RU2A 5HN0A 3OTBA 1YJTA 2LA6A 2BRKA 2MDAA 5G4DA 3W3SA 2ADBA 5CXTA 4X4PA 1VHFA 4RW9B 2LXIA 4OZ5A 4IR1A 4FF1A 1KTQA 5H1SV 1K8AT 2HW3A 1CSJA 2ZHAA 2DR8A 4K4VA 2LQ5A 4A8FA 5CYQB 5IT9Y 3K2YA 5K8MA 1LWEB 2CJ9A 4QPTA 4TY8B 3N28A 2PN6A 3M9MB 1CEZA 4Q8FA 3BGUA 1HPZB 5LJ5Y 1F60B 4ECRA 1FEEA 3ONQA 5LXRA 3KYLA 4JV1A 4R5PB 4C9DA 1WG4A 2FHKA 4EBCA 2WB1D 3NKYA 3VAFA 4UUXA 2DNNA 5KG2A 3J80Y 1Q8IA 1SC6A 5HLFA 4C8ZA 1DQAA 2L08A 3GB0A 3H20A 5LL6d 4ZLPA 2JFDA 3AQOA 5BJRA 3DI6A 1T03A 2Z2LA 2FVQA 4IRDA 1REVB 2P9EA 2VKZG 4RW6B 3I96A 3N5BA 4ECZA 2J5AA 3H5SA 1D9DA 3OL6A 4M8LA 1A7GE 3DDNA 1WF0A 3NCQA 3P49B 2WBMA 5I3UB 4B9UA 1LFWA 4G1IA 5B0FA 3KHRA 3MM8B 1JXEA 2UP1A 3KOAA 4LF6F 1RKIA 4MFBA 2ZH4A 2C28A 1X4HA 4B3TF 1HYSA 2KDOA 1F5AA 1U1NA 1GAOA 2JEIA 5HROB 3DXSX 2YNIA 4FNHA 2MQPA 1F0XA 3IFEA 4MK7A 4A46A 4OL8A 4K4WA 3VTIA 3DU6A 2Q79A 3TVZA 2FY1A 2IVYA 5E3RA 1IBMF 3H2LA 5D6GA 2ZJQQ 4IDKA 3A8EA 4EBEA 3GYNA 4A8WA 3DN9A 4KV8A 6FD1A 2VODA 4K0KF 2RDIA 4OI1A 1FCAA 3D28A 3HHDA 5C42A 2IAJB 4DQQA 2CPEA 2E9TA 4OJHA 5KG4A 4TN2A 5L1IA 3LP2A 3QWUA 3DLGA 4GO5X 3D1OA 3H5UA 4DG1A 4LSNA 3ZZPA 4URQU 2UXCF 2R2SA 3TYTA 4ECYA 4K50A 1L3VA 5E3PA 1UL3A 1FF2A 4HT5A 1RT7A 4A8SA 3JYTB 3BO4A 1DURA 3LF0A 4U6PA 4NLVA 4YR0A 2ZDPA 4OLOA 3AH6A 3SFGA 1U26A 3ISND 2YKPA 4HI1A 3HM9A 4Y28C 1U1RA 4RW4A 1UEUA 3P96A 1Y0HA 5G0RA 3DRSA 3RAXA 1T95A 2VG5B 3B4MA 1XMQF 4FXVA 4MIWA 1CVJA 4KTQA 3PR5B 3I9V9 1V3SA 2RD5C 4ID5A 4DV0F 2XS5A 3NRBA 4DEZA 5T7LA 1YJWS 1N4LA 1S1WB 1L3UA 3MEGB 4H4MA 4I7FA 4Z37A 5LSRA 3O3LA 4U67Q 3CJ4A 1V6HA 4KB7A 2CQ4A 3FFIA 3OPKA 2JVRA 4R8UA 5GADI 4IOCQ 2XY6A 2QSFA 3KLHA 4UY85 4U7UK 1Z2LA 5HP1A 1VRTA 4I1TA 4GKKF 3DM2A 1KS2A 1RTHA 2LDYA 2PA3A 3NCRA 2AU0A 1BWEA 5E5NA 2R7WA 2ZD1B 4DN0A 4WU3A 5ITHA 2BZ2A 2XSJA 1SL0A 3M6WA 2UUCF 2FJWA 4O4GB 3GIKA 3RTVA 3J7YI 4QU6A 2KG1A 2XNQA 2FJAB 1BQNA 2L9NA 4RX6A 4ED5A 2VH7A 1Q81T 2O5DA 2KXNB 1SJ3P 3JSYA 2JEFA 4UY8T 2CQCA 4WE1B 3LWLA 3IRWP 1H7WA 3MMBA 3SFUA 1T7PA 3RW6A 2EVZA 3SDEA 1Q78A 5KG5A 2AGPA 3DRPA 4WZQA 4LIWA 5HO4A 1TUVA 1IBKF 1QVGR 1R8HA 3FEYB 4CQ1A 3B4DA 2M8HA 2VBXA 2EI5A 2Z2MA 2KI2A 3QO9B 3KJVA 1LK7A 4ZA1A 5A8KB 4RNHA 4FF2A 1WHWA 3UCZP 2HNDA 2VL1A 2HHUA 2GCFA 4A4JA 4DQRA 3TOQA 1JJHA 2HS4A 2LLZA 5K8NA 1S9EB 3MEEB 4RW8A 4IRKA 3MEKA 3QZ7A 2HLUA 2MXYA 5JUMA 2WONA 1FVQA 3CJ0A 4BS2A 2JSXA 1KD1T 1FKPA 3F44A 3MEDB 4PPZA 2UV8G 3TX8A 2NUUG 5J1NA 3QZ8A 2W9AA 1YJ9S 4RWXA 1U1OA 3CMES 3HO1A 2K7JA 1IBLF 3T1HF 1SH3A 1O8BA 4I64A 3QJJA 3T5KA 4DFPA 4F26A 1U48A 2YWFA 3EGNA 4XK8C 1JMTA 5E0OA 2B56A 3LQVA 1W25A 1VQPS 3H59A 4OI0A 4N77A 4QIWD 4OLPA 2L3MA 5A0YB 4Q8EA 2QYCA 2W4PA 3DOMA 4TNOA 4QWDA 2HYIB 2DBBA 2HVIA 3AHPA 1N32F 2NSBA 3NAIA 3V6HA 4R0EA 3WC0A 2R9LA 2FUG9 4DLEA 4WK3A 1TL4A 3QGPA 4K4YA 2FJXA 2RJZA 2DT9A 3GIIA 4ZP9A 5D4LA 1UEVA 3MUVP 1RI7A 3LALA 3VF0B 2R7TA 2IM1A 1ELOA 3K58A 3R1HA 3MR5A 4WJBA 5DLFA 5DO2A 4JV0A 4YR2A 3KKFA 5A8WA 3VAKA 3L3CA 2DHGA 3DHXA 1JLAA 2QT7A 4IFYA 5F8GA 3OSPA 4OMFG 1XC9A 1WELA 2I1RA 2FLLA 2L9WA 2MKSA 1LV5A 3ZFVA 2ZVSA 5AJ3F 4YEAA 2UVVA 1RK8A 2IM0A 4Q43A 1FE4A 1ZAVA 2GMLA 1LW0A 1UWBA 2W9BA 3DYAB 1JWWA 4DV6F 3ITHA 4K5RA 2XS7A 2ZOMA 3BGRB 4FXWA 4P2SA 4DQSA 4OJ1A 2KRBA 3HZGA 3C2PA 4Y00A 4V19X 2DNPA 4EFAC 2CQHA 1HBUA 1TK0A 2C3UA 1Y5NB 1S48A 3CCES 2V9WA 2VQFF 3UDLA 4NA1A 1XNRF 4QOTA 3QGGA 1ZAXA 1GX6A 1RT4B 4ZPTR 2W7AA 1RP5A 4UQTA 2Q66A 2OPSA 1RT1A 2OPQB 3DLEA 4DSEA 4JOUA 4ZVEA 2JEJA 1KFDA 4XDCA 4TKTA 3EPIA 2ABYA 2HHXA 4ED0A 3IGVA 2HQIA 1T94A 4C8YA 3CUNA 2FTRA 4RW9A 3E51A 2DGUA 2HNZB 4HH0A 2VA2A 3UD3P 4NLGA 3KK2B 4JBCA 1HNIA 1W2BR 5HI7A 4C3MA 2KT2A 5A8RB 1H2UX 4TY8A 4DX8H 2JWNA 2NYIA 1RA6A 2KKHA 3TA1A 5F3TA 2B6AB 3M8SA 1S6UA 3LP0B 5CQGA 4DV2F 4RUCA 1APSA 3B82A 4NLQA 1DLOB 1RYSA 1HBOB 2B4PA 5IWAF 1S72S 3HDSA 2ILYA 4B9LA 1REVA 2HHWA 4Y2AA 2CKWA 3U1NA 4K59A 4DR5F 3GG0A 4DL0C 4RW6A 4C0OC 1B64A 1VQLS 5I3UA 1VRUB 2J7KA 2N7CA 3MM8A 1FA0A 1M5VC 1LFPA 2VOPA 2HMIB 3R27A 2GV1A 1RDRA 4B9MA 1YJUA 3C3LA 3B78A 1RT3B 2GW8A 1DARA 1H6KX 5HROA 5GAGU 3TANA 4IQXA 2HQ3A 1NAQA 3EXYA 4Y2CA 4YY3F 3TAQA 2MQLA 5EX0A 1TL3B 2G4BA 2N4DA 3B8HA 3LAMA 4M94A 2OTJS 2ZH6A 4O3RA 2HVHA 3NL0A 4ETZA 4MAKA 2A2DA 3MHYA 2CPFA 5F9NA 1R27B 2IAJA 3HPOA 1U6BA 1T05A 1JLCB 1YI2S 4DV7F 2QA2A 4N41A 1JLEB 2G9OA 2X1GA 2D3ZA 2ZE2A 3TUJC 4PWDB 1S0MA 4MYTA 1SJ1A 4DR2F 5CHCB 5F8JA 4NCBA 4USJC 4FF3A 4MYUA 3MZIA 5B09A 3F41A 4B02A 5H9FJ 2BOPA 3SV3A 2YKQA 3LANA 2V8HA 2BACA 2WHOA 1KQFB 1FXLA 3CPWR 1PILA 3JTNA 2ERRA 3MM7B 1QAXA 1B7FA 1Q8LA 1MWZA 2AP6A 3MECA 3OUYA 1UJ6A 3DU5A 4OZ1A 3G9CA 4K4SA 5FIIA 3N4WA 2DD8S 5HQ8A 2HHVA 1S1WA 1URRA 5KFZA 3KLVA 5F8IA 1QSYA 1FJ7A 1MU2B 4CTAA 1NJYA 2Y0SD 2VFVA 5L1KA 4XPEA 3BB5A 3MOZA 4EU0A 5B0DA 3VWSA 2X1BA 5KFLA 3MM9B 4I56A 2LA4A 4AXIA 3OVAA 3HXMA 4ZP8A 4Y2KA 4DUZF 4E8UA 2KFYA 1VQ6S 2ZJRQ 1HNVB 4DHVA 4ECQA 5KFGA 3Q8RB 3MFIA 1LKZA 3M2RB 4O4GA 2N7YA 5DRKA 3BS9A 4YQWA 3UWTA 3N9UC 2E5GA 5C24B 2ACYA 3LUYA 4C3LA 4OX8A 4DS5A 2UV8A 4C11B 1Q8BA 3MDFA 1IQTA 4MMOA 3QMQA 4WE1A 3SCLE 5T14A 2MJUA 1J5EF 1X5OA 1I1GA 1LWCB 2HS0A 2JL9A 3KLFA 5IQ6A 1QSLA 4USIA 4ELTA 1DHMA 3V81B 1KNZA 2CRLA 2PA8D 2IBKA 2HHPA 2GQ2A 4C2MA 1XERA 4H4KC 2PD1A 4F4YA 1OSCA 4DV1F 5A8KA 3HHLD 2AWZA 4RU9A 2EG1A 2F9JA 4ZOSA 2AV5A 2YKAA 5KFYA 1CG2A 1P9QC 2YVSA 1DZ5A 5FLXY 1VC5A 1S9EA 2YQ3A 5J1EB 3DOKB 3MEEA 1MW7A 3T6JA 2A18A 3CDAA 4LF9F 5LT5A 5HL7Q 2ZH3A 3FEZA 4KGKA 1T8EA 1S6PA 4NCGA 3MEDA 3W7BA 1LW2A 5AXLA 4ZVGA 1VQ4S 3T3FA 2R8IA 4Q45A 2MZRA 4M95A 3G4SS 3NAHA 3CCSS 5MLCV 4C7QA 3X3UA 4H4OA 1KLMA 4QWAA 3QPIA 4J9OA 3OFFA 2M3DA 3SYZA 2KZZA 2X1AA 3MMJA 2VB6A 5KFJA 1YRUA 5A0YA 2FGCA 4KAIA 4CH1A 4EYIB 3QIPB 3SV4A 1RT5B 2XY7A 2KXFA 2KTQA 4I68A 2GHPA 1VFJA 1L3KA 4H54A 2C3MA 3DRYA 2EKYA 4A8QA 2HPUA 2PE8A 1RA7A 1N56A 4LT6A 4NYZA 3OVS