1Q5YA

Nickel-bound c-terminal regulatory domain of nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
TQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel responsive regulator
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 26
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5yA00
2NZCA 2CAJA 2BJ7A 2BJ8A 1Q5VA 2WVDA 2WVFA 2WVCA 3BKUA 3QSIA 1Q5YA 3LGHA 2HZVA 3OD2A 3PHTA 2WVBA 2HZAA 2CA9A 2F1FA 2BJ3A 2PC6A 2WVEA 2FGCA 2Y3YA 3BKFA 2BJ1A 3BKTA 2BJ9A 2CADA
chains in the Genus database with same CATH superfamily
3LAKA 1SIZA 2ZOMA 3MPVA 3RBXA 3CCMS 2UXBJ 2XHWA 3L4BC 1VQ5S 3TA2A 3UQSA 4XAKA 1Q78A 1RACB 1FRMA 2HQGA 3NY0A 4F4XA 2JFDA 3EDQB 5J1NA 4ZLPA 5B0BA 2OPSA 5HBMA 4C11A 2V2KA 5BYSA 3J80U 1QTMA 3LP0A 3CJ0A 4Q44A 1T8EA 3BGUA 4K4WA 5CHCB 2FDNA 1MW7A 1XR7A 2CPYA 1TKTB 2ADBA 2CG4A 1FRKA 4DV3F 1AFJA 3SYZA 2L08A 3N01A 1ZH5A 1GH8A 4DQPA 2KYXA 1NNDA 1KD1T 4KRWA 1YTYA 2HBRB 3QYYA 2WONA 4DLEA 2XYHB 4ZVTB 2W8KA 1IQZA 2LDIA 4PYAA 5AJ3F 4F4KA 2LA4A 2MQQA 3MUVP 4OYPA 4G3IA 3IXQA 5A8WA 1K8AT 3MMAA 2LKZA 3M2UB 2UV8A 4NLOA 2NXJA 3BKUA 3P5TL 5I3UB 2W2QP 5E3AA 3RJMB 2I0XA 2F8MA 1Z4UA 1YIJS 3QIPB 2ACMA 1EHWA 5EWFA 3W5ZA 1Q95G 4FN5A 1U1NA 2UXCF 1B64A 3HHLA 4MT1A 1X5PA 3NAIA 4YB5A 1S6UA 1JLGB 4Y2AA 5KFQA 2MKKA 4HEA9 5D3GA 1U26A 4F36A 2J76E 1AUDA 2POKA 4Q2MA 1R8CA 1RT6B 4ES1A 1SQFA 1KQSR 2BVZA 1VOMA 4ICLA 1OS5A 1Y11A 1T03B 1SXLA 4LMZA 3KK3A 5AXLA 4OZLA 1RHRB 4OZNA 1F2GA 2ATCB 3DMJB 1VFJA 2XMUA 1F60B 2HVIA 3Q8YA 3DU6A 4PG5A 3MEDB 4F4YA 1T05B 4TLRA 1TP7A 2JDJA 3K8WA 1OQ6A 4UQGA 4DZ6A 3T9NA 1BWEA 5CQGA 2YY3A 4YN3B 1FVSA 3PKYA 5U47A 1PC5A 2OIHA 5D15A 1MN9A 3QBCA 2ZH5A 3SCLE 3DLEB 3CC2S 1C2PA 1F6TA 2H9ZA 3W9HA 5KAKA 4LFBF 3H4DA 1VQOS 2BYCA 2F1FA 3ENWA 3SDEA 1IKVA 3THPA 4WIIA 2QA4G 2BJ9A 4U8YA 2F8EX 1CS4A 2D9PA 2XYGB 3CJ2A 3K5NA 2UU9F 1U0SA 5ITHA 4F3MA 3NCRA 2DNNA 2HHPA 1UETA 2HAFA 5HMYA 2QJ3A 5J2MA 2OPPA 1EAYC 5CZVA 3CCUS 1RWWB 2DR9A 2MKYA 4N7TA 3MD3A 3MM9B 1HBNB 5G4DA 3IGVA 3BDPA 3K5PA 2G0CA 3MGJA 2J9EA 3LP2A 3SCJE 1HNXF 2HNYB 1KWMA 2IDEA 2DNMA 4NZ6A 3IFEA 4KR0B 2HZAA 2Y1IA 2HKEA 1GEHA 4DPYA 3AD8C 1NJWA 1PSDA 1WF1A 5CYQB 3OVSA 2JLFA 2C3UA 3FFIA 3ZNUA 4YMEA 1KLMA 1HFEL 5D4PA 3PHEA 4NA1A 4RBTA 3RU0A 3OR2A 2LQJA 5C25A 2IJRA 2NREA 1ICEB 2V63A 5C2CA 2NYHA 1HQEB 3PDNA 2W9AA 5HJXA 2N4CA 1WKLA 1KBRA 4MKYA 1UVJA 2ZH6A 2AYGA 1Q1KA 1VQYA 2ZD1A 4KHPF 3P3DA 1WWHA 4M1KA 4QW8A 1P6TA 2QSWA 2P8IA 3PTWA 3H2UB 2M3DA 3R7NB 2DEJA 1UCNA 2R7OA 5GADI 3FZBA 2VG5B 3BREA 4UZCA 3I5AA 2XLJA 3ENAA 2BKNA 1GX6A 1XNRJ 4CDIA 2DCLA 3U27A 3WDOA 1O0PA 5KG4A 1U1QA 1JLEA 1S7HA 4R5PB 5ETQA 2HW3A 3QWUA 2VODA 3PRVA 4DZDA 4OHVA 1ELOA 1H72C 3CEDA 3CE8A 2W01A 1FVQA 2I6WA 2V8GA 4DCOB 4JI8J 4M5HA 3EE3A 3PW7A 1NPPA 4F7VA 4X65F 1R0AB 3EZOA 3US5A 3P8BB 3HZGA 1UVIA 1Q86T 4HVZA 5ETVA 3EVWA 4LBPA 1D0EA 3TQ1A 1FERA 2QIFA 4DN9A 1FFWB 3SV3A 3NBPB 2C1EB 1JNRB 4F2RA 4N47A 3O6QA 4TQSA 3NGRA 3P5BP 1UWAA 3ISND 4DXLA 4KGVB 1H73A 3H25A 1DQ8A 3ISZA 1U25A 2R2TA 2V2QA 2YBVA 4ZVQB 2XHCA 3VV2B 1C1CA 2W24A 1CSJA 3AQPA 4E0DA 4KB7A 4Q45A 2HHXA 2JHEA 4WIQA 2BEFA 4MIBA 3IBCB 2KN4A 1UWBB 4DV7J 1GMUA 1KSPA 1RTZA 1SC6A 1S0MA 3DHWC 4DSEA 1RT2A 2IFXA 3DGPA 3A13A 2PDAA 3QGPA 3LALA 1U47A 1EETB 6FD1A 1P9QC 1Q8IA 4PWDA 1HW8A 3C19A 2IVMA 2XCAA 5CZXA 1D09B 4DFPA 1Q82T 3KOAA 1YITS 2AMCB 5LOQA 2NPIA 2RQ4A 3CT9A 2JEFA 2Z2YB 4ED4A 4LQ9A 4TLQA 3MM6B 2UVRA 3GV7B 3CPWR 1XN9A 4YB7A 2Z8QA 1LXNA 2MQLA 2W1BA 1XNQJ 2E1MC 4IOCQ 4DMZA 3NS6A 1TV6A 4WTYA 3BGLA 1VS3A 1FX4A 2JSXA 2ZDPA 1JJCB 1Q0NA 4Y65A 2HEKA 2XQCA 2VICA 1YWXA 4OYMA 4ELTA 3FCVA 2MY7A 2YWGA 4QWBA 4AL7A 1S9EA 3ILLA 3ENVA 1AW0A 4X2BA 2AGQA 3R8YA 5B09A 1B99A 2G2OA 2IRYA 4AE5A 2E9RX 2OAUA 3DNCA 1SJ1A 1IBKF 4YQWA 3K58A 4J9KA 1BC6A 3CJSA 2DHSA 2UXDJ 4I69A 1VQPS 3WC0A 1NXIA 2EBGA 5GAEU 1DFDA 4DF4A 4H4KC 4A8WA 3BS9A 4RNHA 2A3JA 2CADA 3OTCA 1UJ6A 2DHGA 3VCDA 4DR1F 1M0SA 2BW2A 2J7KA 2VOPA 5MLCV 1RTDA 1ZS6A 4ELUA 3IWLA 4WFXA 3DRPA 3SXLA 1SBRA 3L9ZA 3DM2B 1RISA 4J91A 3QLHA 3NGKA 3Q8RB 4URQU 4DPOA 4K50A 1TL1B 4G1QB 1U0HA 3W61A 3EMTA 4X84A 3E01B 1PYOB 2MQMA 1UJ5A 5J1EB 1BQNA 3M2RA 4UTGA 3TX0A 1KNZA 4I2QB 1ZAVA 1JB0C 1KEKA 1EQMA 4WKRA 2QYCA 4URSA 3I55S 2QLFB 3LUYA 1GX5A 1XJWB 3TZXA 4JI0J 4YS2A 2QZ8A 3ZZTA 3R7BB 4H4MB 1V3SA 1W7WA 5KFUA 4DV0F 1YVFA 1ZOTA 1T9VA 3KWMA 2QA4S 1FD2A 3L09A 2Z2ZA 3TP2A 2IRUA 1RAEB 1FI4A 2C2NA 1WHWA 4L72B 4NYZA 3IAM9 3Q24A 2BJ1A 1VDHA 5J2PB 1L3KA 5HATA 4PR6A 1CBKA 1VBXA 2VQEF 3UNGC 4CT9A 5ETKA 2FC9A 1IJEB 2W4PA 1RCXB 1IM4A 1FWLA 3H5YA 4RKUC 2C2DA 1N48A 3AHPA 4DI6A 1I5OB 4IH7A 3GPAA 1RHJB 2DKOB 2RUGA 4FBUA 2VA3A 3QT7A 1S0NA 2YKOA 1MWZA 2JVOA 2K1RB 3T1HF 5EX3A 1N56A 4N41A 4WF9Q 1PJ6A 2O66A 4IG3B 1YX2A 5IT9U 4MK9A 1UAWA 4OX9J 4JYAJ 2J7UA 2B3TB 4C0HA 2RIJA 2VF3A 2BQ3A 3HHKA 2AEJA 1FD8A 1XMOJ 5LJ3Y 3SCIE 4Y28C 1LWFA 4NWBA 4ZVRB 2RHSB 4NLRA 3E8OA 1TMJA 1HR0F 4HI2A 5I3PA 2QMUB 3J7AN 2GMLA 3LP1A 4J9LA 5G0RB 1D9AA 4X4OA 3GJSB 3O3LA 4MKAA 1H74A 5HLFA 1UKUA 1GT8A 4CNYA 3OL9A 4J9PA 2GVZA 2QFIA 1H2VZ 4FF3A 2ZH9A 2A6MA 3DGVA 3Q0AA 1FX2A 2PMZD 1S0VA 3V4IB 3OSPA 1RCOB 2AJQA 2DHXA 4WFYA 1OYEA 3HSDA 1QAJA 5B0FA 1HARA 3UDLA 2G13A 2VV5A 1VI7A 4JI2J 4ZJQA 2U2FA 4B3OB 1M5HA 1JJ2R 1ZZNA 2BOPA 4RW4B 3OXLA 5T7LA 1ZETA 1WG4A 2XSJA 1YRXA 2VL1A 2PC6A 3MR7A 4F67A 3L7OA 1NHKL 2R3VA 3J7ZT 2RKIB 2FLNA 2Y0BB 2IMOA 1Y5IB 5KG6A 1CJTA 2JL9A 1WEXA 2FHJD 4NA2A 1VK3A 2WSFC 2JC0A 1UVNA 3IGNA 2K8GA 2AQ4A 2PA3A 2AEMA 4HTIA 5A2QU 2CQGA 3NAHA 1N33J 5D77A 2MJNA 2HGMA 2HFUA 3E3XA 1X5OA 2EFQA 3GFXA 2XWXA 3D1OA 4K7QA 4X64J 3OJSA 3Q86A 1S1XA 3R5JB 2RS2A 2VB6A 5F8GA 2D3UA 5EWEA 2HRTA 1IR0A 1RBAA 3AFGA 1WKJA 3HKZD 1UZHA 3M1VB 1TVRA 1YI2S 5E0OA 2J9DE 4WFNQ 1B0VA 2GMJA 3T5HA 4QWEA 1FKPA 4P6QA 2AWZA 5K8MA 4QR0A 4ZPBA 2HVDA 3NWGA 4FF1A 5HMWA 1EQ0A 4KQZA 2DRBA 1HNZJ 2G2YA 3KLIB 2V69A 1S9GA 1EZZB 4EZ6A 4HACA 2AYBA 1LW2B 3AXKA 1YJ7A 2XZDB 2KXHA 5ETLA 4YR2A 3T1AA 2D7SA 3BB5A 3M8RA 3CNQP 1N36J 4IUFA 4CH0S 3FRZA 2F4FA 5D3GB 2J5AA 2GV1A 2AEFA 3RAQA 2ZH3A 3KTQA 1K9MT 4LF5J 3BM7A 1G1XA 4NLXA 1JXEA 1VQ7S 1JNZB 1X4CA 3UVJB 4KTQA 3PW0A 3HHEA 3LGHA 2CPIA 4GKJF 2FLPA 2Z56B 1I94F 1TL7A 2ZZTA 2YXLA 2E1CA 4DL3A 4ZS6A 5DO2A 4B3MJ 1N54B 1RA7A 2QLJB 2JH3A 2IC3A 5A0YA 4A48A 5LJ5Y 2PFFB 5A8KB 4FPIA 3HVAA 3JS9A 2IMWP 1APSA 4GO5X 2ZUAA 1IKVB 5DDQC 4IH6A 3QRPA 1ZM2A 5JJBA 1WC0A 1CS4B 4LRAA 3JQMA 2GIQA 5HAOA 4KHMA 5MAOA 2RDIA 4PPDA 4NXMJ 3K5MA 1KS2A 2E7XA 2HQ3A 1FFSB 3OHBA 2F9JA 1R27B 3T41A 1K1SA 2ASJA 4DPWA 4CLZA 3KHHA 3QSYB 1U6BA 4DEZA 4WZMA 5A6WA 2MGZB 2M4MA 1WC6A 4ID8A 4DUZF 2AP6A 4FP9A 3TJAA 3TVKA 1HI8A 3N6MA 1Q8KA 4KO0A 4C4WA 2F4VJ 3BQ2A 4WFBQ 1OIAA 2HHQA 3CTRA 3VAMA 1R0CB 2UUBF 5KFRA 4DQQA 2KZZA 3V6JA 1NK6A 3D9BA 1PBAA 2DEIA 2Z4PA 5HVFA 4DR3F 1QUPA 2RNEA 3OW2R 4CNZA 2QGFB 4TU8A 4TQRA 2LFVA 3SSQA 1NZAA 4PQUA 4ED8A 4M94A 4HKQA 4B3TJ 1RP5A 2HS3A 1B3TA 5L39A 4DV4F 2IRXA 5KG3A 2E1PA 4ZK7M 2OEKA 1TL5A 1C0UA 3KLFA 3FCHA 5M2PA 2W2NP 2BE9B 2FJDB 2ZD1B 3VWSA 3M9OB 5KFWA 2R7TA 1EIYB 3WZ0A 4J5OA 4CH1A 3HHDA 4M63A 4FYDA 3FNNA 1LNQA 4DQRA 1ITPA 3QO9B 3MFHA 3BPSP 3HHLC 3GIKA 1RYRA 2D3OR 1IBLJ 1PIEA 3PHTA 2VJVA 4C98A 4DR7J 4DX8H 2EBEA 5BXIA 2MKIA 1NJYA 1N32F 2R8KA 5E3QA 2B51A 4RW9B 2FC8A 1SH0A 2G4BA 2WVFA 4ED6A 2YPZA 3QSIA 4RW7A 4ANEA 2HVHA 4WZQA 3CCWA 3V4MA 4ED0A 4CLYA 4DWIA 4XIUA 2B4VA 2IHR1 4DV7F 2E29A 1RU1A 1U1OA 5J2NA 1WOPA 1NHVA 1U1MA 1NDCA 1FJCA 2AZ3A 4UOCA 4KGZB 2KXNB 1NKEA 1K0TA 2AYMA 1NDPA 4CO3A 1ZYQA 2WW4A 4OX6A 2C3OA 3H2VE 3JSMA 2OMOA 2FY1A 3GILA 1C1CB 2DNZA 1Y9OA 2GA7A 3UN2A 5K8NA 2I9SA 1D9FA 3BBFA 1OPIA 2V34A 2W25A 4L6V3 1HA1A 4QYRA 3IM8A 2IYIA 3B6BA 4FS2A 2MZ1A 5IC6B 2R7UA 5CXTA 4YEAA 4UOFA 1S1TB 2YH1A 5KFPA 4PWDB 1J27A 4ZVPB 2WZ1A 5HN0A 2YWEA 1U8WA 3MURP 5IS2A 4HYKA 3J7YU 2AIRB 4K2JA 4DX7A 1NKCA 2OTJS 2J9CA 4IQXA 3DLGB 1S6QB 3KNGA 1KR4A 2PGCA 4OZ1A 1D1UA 5D0RA 4NYPA 3KK1B 2NLWA 2OKQA 1VRTB 4KV8A 4ZVGA 4UQTA 1IVZA 1I51B 4NI2A 3CMQA 5GMKa 4N77A 2XB2D 1A0OB 4CLTA 2EI5A 2VG7A 4U8VA 2GC8A 1WF2A 3OTBA 3ZZRA 1R89A 4ZP7A 2BABA 2QX0A 5CABA 3NXZA 3KUGA 1W26A 4LFCJ 1RWPB 1YBTA 3TUZC 1OQ3A 1NB2A 3TOQA 3JQKA 2BM0A 2DR6A 5FDLA 1VC0A 3I4PA 2C3MA 4WWSA 4EUVA 4JI3J 3MCMA 2CA9A 1HI0P 1R6YA 1HBUB 2BE2B 9ATCB 4TNOA 5ETPA 4CLWA 4YFUA 4NCGA 2LEAA 3DLHA 1VQKS 1KRPA 3RR7A 2KJWA 1SKWA 1HHTP 2V8VA 3MFIA 3CO9A 4LBHA 1RLDA 1VISA 2OH2A 2HHWA 3EZUA 4RR5A 4Y00A 3KJNB 2J8SA 1N52B 5KG0A 4KBIA 2HHVA 3RAMA 4DX6A 2HMIB 3OLAA 1JK9B 4K5SA 3P45B 3KMQA 3FBEA 5A8RB 1GXLA 3M2VA 4OZ0A 1VLYA 3PEHA 4JI1J 1CC8A 3D5MA 3OQ2A 1FXRA 3ONQA 2FZKB 3T6BA 1WG1A 1TR0A 2LYVA 1IQTA 3BGFA 3D0HE 1M1GA 3T6JA 2D3O1 1U24A 5D8HB 3EZ5A 2XYPB 4X4QA 5KFYA 1X4GA 1VRUA 5F9LA 1DURA 1FDDA 1T9UA 2KZMA 2W2OP 5KFSA 1PYTA 2KL8A 2XC9A 2ZKTA 3Q8VA 1Y5NB 2DXFA 1FJEB 1T9YA 3NP5A 2E5IA 2PMHA 1RAFB 3PX0A 1TKTA 2VA2A 4RWWA 1S79A 2N82B 2LEPA 2DO4A 3AQOA 5K8OA 2B5JA 3BEGB 4UW2A 3FUYA 4OQJA 1NK8A 1UZDA 1LV5A 3BH6B 4NXNF 4EZ9A 4OHYA 3PIPQ 3OL8A 2I8EA 4B9MA 3TARA 1NSAA 2HGLA 2XS5A 1S6OA 2BZ2A 1NRKA 4XDCA 5DQGA 4JYAF 2VBZA 3X1LB 2CIMA 2C2OB 3M2UA 2V8PA 2CPJA 1EB0A 2KXFA 5I3UA 2ZBCA 1KFDA 4C8NA 4A47A 2OHDA 1KKHA 4GVBB 3GTYX 1FRXA 1UA1A 2WHOA 4PRFA 1RADB 5AXMA 2PO4A 3DI6A 2EW9A 3JTNA 5BJRA 3BGRB 2ZVIA 1C0TB 1X5SA 2DNRA 2E9ZA 4ZCMA 2MXYA 1JLGA 1R43A 2CVIA 2JLEA 4C48A 2LEBA 3NGSA 4I4BA 3N0VA 1UEKA 4P2XA 5KT7A 2J6UA 3W8PA 2CZVC 4N76A 2CNNB 1SC4B 2Q6CA 5L1KA 1T03A 2VIHA 1RT4A 1RB0A 2FVQA 2MMYA 4TXSA 4MK7A 3BR9A 3TR5A 3MEDA 1T05A 3G2XA 3EX7B 2UXCJ 2E1RA 1RT3B 5HQLA 4YR3A 2DB1A 4LF7J 4ZJLA 4JI5F 4OZ3A 2XWYA 3G4SS 3OUYA 1GK8A 1N5SA 3UO0A 2NXEA 1EKSA 3H98A 3DLEA 1F3FA 2IM2A 3MWBA 3POTB 1WHVA 3DC2A 3W66A 4HT7A 5F8JA 1RJJA 3TO8A 3DDIA 1HBMB 3QIDA 2ROPA 2E1AA 1I6JA 2ACYA 4K2XA 3R5CA 2A18A 5L1JA 4Y2MA 4DR6J 1HMVB 5CYMB 3W9IA 3I31A 5B7WA 2WCXA 1CQNA 2GJFA 4ZPAA 2DGSA 1M90T 3AB4B 1XMQF 3CD7A 2CQIA 3M8WA 3ICLA 4B08A 4I68A 2B0GA 3M8YA 1WEZA 3M8PA 1N33F 5IXUA 4LFBJ 3GG1A 2MLYA 1HBNA 1W25A 3DN9A 1RI7A 3HM9A 1TFWA 3R5GA 4DV6F 3GB0A 5ETOA 1P1LA 2HNYA 3NMRA 2XS7A 4IQMA 4OHZA 3A8IA 2UVWA 2B7BB 3DFEA 1CJTB 5E33A 2H3EB 2UU9J 4RBUA 5GAHU 4WFAQ 2BJ8A 2FUG9 4ECVA 1KFSA 1SVDA 2OGUA 5H9EJ 4TYAA 4P2MA 2JLGA 1N8RT 1QVFR 1TQLA 2J8AA 3CVKA 3KJVA 1ZTWA 8RUCA 1X4DA 2C28A 4O3NA 1NK7A 1DLOB 1S1VA 2G1HA 4DR5J 1AFIA 1BWVA 1HQEA 3I4HX 3JQJA 2ZBRA 2YX7A 2BQRA 1HNXJ 1M1KT 1S1XB 1WI6A 2M9KA 3ITHB 3S6EA 2FY8A 3B54A 2VG5A 5KFAA 4RUBA 2NPFA 1Q53A 3K57A 1N36F 5LXYA 4OI4A 4XTTA 1QUVA 3M9NB 2DYAA 4R25A 4R5PA 1ZBTA 4M8LA 4U6PA 1BD6A 2HPUA 2HHTA 4HACB 4B9VA 2QLBB 2C2MB 3K8VA 1RT5A 4QR2A 2CQ4A 5LSOA 3G8SA 3NGUA 5DZ6A 4O3SA 2B6AA 1F9EB 1R0AA 4PCQA 4GC6A 2E5GA 5E5NA 4F8RA 1YJNS 5KT6A 2JNJA 2R7RA 4M5MA 4UY8T 3THTA 3T1YF 3BPDA 1WTBA 2RHQB 3SQOP 3NBPA 4ECYA 5GAEI 4C8OA 4IOBA 2CQ0A 2XLKA 4EO8A 3CSKA 3GYNA 2RF2A 3SIPB 3J81Y 1C1BB 1ZAWA 3J81j 2C2RA 3CW2C 4JV0A 1VHIA 3HMJG 2YQ1A 5C5JA 2MYFA 1LK7A 4RX6A 2UVVA 1FO1A 1HWLA 2DK2A 5KFHA 1UWBA 2DO0A 2AX0A 2UUWA 2XLIA 4KGMA 3TVZA 1HNVA 3W2WA 1G6BA 3BKFA 3UFCX 1GMVA 2CVEA 2VU5A 2BANA 3AD9C 2F63A 5AXNA 4PUOB 2IC3B 3TUJC 4FNHA 2R42A 2VUGA 4Y2KA 3GFZA 3DHXA 4X4RA 4NLYA 4ZVUB 1WC5A 1RWMB 2N7CA 3MM6A 5AE1A 5JUMA 5DG8A 2W9BB 3HFVA 3H42A 2FJXA 5LT5A 4XDDA 4J9OA 2OP5A 1R6VA 4UOHA 3SI8A 1PAUB 5CYJA 3EICA 3AODA 2V4RA 4LFAJ 3QAEA 2UV8G 4OYBA 5C42A 2D41A 4JI7F 3IAS9 1QM9A 4L74A 5K9FA 3PO4A 3TQEA 4RL1A 1T7PA 2LQ9A 4Q8FA 2L3MA 3OT9A 1TKXA 1LWXA 1UMJA 3SFGA 1DTTB 1WHXA 2WSCC 1Y00A 2BE7D 2HWIA 1S48A 1WC1A 3PYDA 1LXJA 2OPQB 2ZH8A 3V6DB 2BW7A 4ITSA 3D7SB 3LGMA 2CQDA 1CJVB 4ZP6A 1B7FA 1X7VA 2K7JA 2P2CB 3IRXA 3K0JA 1HHQA 1HNWJ 2NQPA 3NS7B 3G6XA 3IWXA 2FHMA 3HFZB 3W5XA 4PG8A 5DGAA 3KLFB 1OY6A 2XZWA 2ZOGA 7AT1B 3R5BA 1V5IB 3R97A 2XM3A 2MKJA 3R5DA 3J80Y 2BOAA 2B8PA 1MMNA 2BJEA 2RRNA 3CCZA 2WW8A 3KG1A 1N6QB 2X1BA 3ULHA 2E5JA 3RBDA 2ABYA 2B56A 1WNEA 2ILZA 5HANA 3TWZA 1REVB 1U49A 4BC9A 4ZLJA 4O3OA 2ZBIA 4EK2A 1TL1A 4FYYB 1IKWB 3A3PB 1MU2B 3HZEA 5J1EA 3C2PA 3BF4A 3PJ9A 3MR3A 1WEYA 4C3MA 2FJBB 4C8ZA 4WKYA 2V6AA 1Q16B 1Y0HA 2W2MP 4DFMA 3C46A 1R31A 1YSJA 1SQEA 3P96A 2ZJRQ 3ILOA 5LXRA 4H4MA 3FZ2A 4USHA 1RKIA 3W62A 5J2NB 3FMBA 1RAOA 1FKAF 3QJPA 4OFZA 5GAGU 1X9SA 4F2SA 5L8RC 2M70A 3FEYB 3IP0A 2YKMB 2M7SA 1CG2A 2YX1A 3M6WA 4NMLA 2R7QA 4ZPCA 3JXOA 1RAGB 3T9ZA 4FNIA 2UZAA 4JUZA 1SPBP 4DUYJ 2X3GA 4YY3J 1HBOA 4C8YA 3EGWB 4OZ5A 3C16A 5RUBA 4OV1A 2OI2A 2OPRB 4A8KA 1HQUB 2A10A 4W98A 1NH8A 4M5DA 2NUHA 2DIUA 2L9DA 4DV0J 3CIMA 2GW8A 4AFFA 3GP9A 3U1NA 1NJIT 4K4XA 2Q3PA 4IFVB 4NYOA 5KG2A 1SI9A 2Y3YA 2B43A 5KFXA 4PZVA 3UD3P 3HHLD 3N6NA 3RBZA 3A8EA 3KNAA 1Q4RA 2AV5A 3R5AA 2K1RA 4CYUA 3M8ZA 3K59A 2FZGB 1WI8A 3ADAC 5CA5A 1KVIA 3KLEB 2YNGB 3GR0A 4CM2A 3RAXA 4Z7CA 1F3VA 1HWUA 1QLNA 5H9FK 4A46A 5J2QB 5HVHA 2MHEA 1FTCA 2LU2A 2VQEJ 1FE4A 3PKMA 3A8KA 5IT0A 1U1PA 2LXUA 4LQ3A 1RTJB 1O51A 1M5SA 1JKHB 2ZE2B 4JI3F 1WACA 4NI2B 2HRYA 1RUSA 3MMCA 2JZ5A 3G71S 1CJUB 3SQGA 2XNRA 2GMHA 2BRKA 4DL0C 3T1HJ 1KONA 1VJQA 1RAJA 4ZHRA 4DQIA 2DCUB 2KRRA 5D4LA 1MROB 1YRTA 3HD1A 2CQPA 3ZTSA 4ZCKA 4FDFA 4Q0BA 3MAAB 2HHUA 3QZ7A 1X9WA 4R8UB 3HLUA 1VQLS 5FDLB 3OSNA 4QCLA 2WBMA 3VAGA 4EBCA 5F3TA 3DKDA 4JI1F 2I5JA 3P6YC 2R7SA 4B3RF 1N5YB 2KG0A 3CULA 2O67A 1DARA 3V4IA 1HR0J 4GKKJ 1QSLA 4OZJA 4X4VA 2ZH4A 2M8DB 2X51A 5SUHA 2WVEA 2QL5B 2O1PA 3N5FA 5HO4A 2O5DA 5CAAA 1D3WA 4WTOB 3M9MB 1NK9A 1BMQB 3PW4A 3PYFA 1D8ZA 4RW4A 3RB0A 1T02A 5IT4A 5ETTA 1F9HA 2CJBA 3H7HB 1VIOA 1JX4A 3QPIA 4GC7A 1CJKA 2D74B 2RKIA 3PW2A 3T19A 4V19X 2KT3A 1B0PA 1VRUB 5JXSA 3DOKA 3MM8B 3PY8A 1VJWA 4LF8F 2ZC4A 4IG0B 3ETOA 3IN5A 4M5NA 2NXUA 3R3TA 3ZC4A 1V9OA 3PYGA 3HDSA 1FFGB 3BN4A 2CPZA 3O8WA 2OJ3A 1X31C 3KKFA 2FHKA 1S49A 1QJHA 1NJXA 1RBLA 4KSEB 3N79A 4RU2A 2B5JB 3VALA 1Q8LA 2W8LA 3G96A 1WDTA 3MF5A 1U6ZA 2EG1A 2Y0SD 2PEBA 5D4NA 2EFOA 3M1VA 2HSEB 1YJVA 4KHRA 5IC4B 3CWJA 3MEGB 4CTAA 1SV5B 4DDFA 1EP4B 1F5BA 1RWKB 3BKTA 1WOSA 2A2CA 1KC8T 4Q43A 4J7CA 2XGQA 2M2BA 3F56A 2HURA 2R7XA 2MSTA 3BO4A 2EFGA 4ECSA 3KLIA 4FS1A 3M4XA 4H54A 4PPZA 3JSRA 4I67A 4IO1A 4K4YA 1YBUA 1LW2A 3U7JA 3DOLB 5KOXA 3LQVA 1M5KC 4CCHA 3DI6B 5L46A 4HI1A 4LF7F 2M52A 4OHXA 3NCQA 4CLFA 4C0BA 1NO8A 5EN1A 3PFEA 1DBDA 2WBRA 3ZZ0A 3SCKE 2DR8A 4F4ZA 3QJJA 1Y3JA 1DTQA 2PT0A 4ZOSA 5HVGA 1RT4B 1F9FA 5LL6d 1JLAB 4DV5J 1YK9A 4NE9C 4DU8A 1Z2LA 4ILLA 2OEJA 1IWAA 4ILMA 2HZVA 4DR6F 3HVTA 3UVJA 1N5VA 3OL7A 3LPYA 4MMOA 4GRSA 1CVJA 3WQPA 4C8LA 4CLUA 3E2EA 1H2UX 4L3NA 1Y10A 3FSIA 2VFTA 5CD4H 1SJRA 3CDAA 3OUYB 3NNAA 2FQQB 3HCXA 3C14B 3M6VA 3QZ8A 3NOCA 3HULA 4TVAB 2KH9A 2ZH7A 2CQBA 4A4JA 3WIVA 3VVUA 1WSRA 4NZ0A 1SC1B 5A8KA 2VPXB 2KKHA 1DRZA 2RD5C 1RT1B 1QSSA 4FYVB 3AXMA 5H1SV 4GKJJ 4DS4A 1SKRA 2DNPA 2GAGC 1I94J 2KDOA 1MSWD 5A6PA 4LF4F 4G65A 4J9QA 2ZJQQ 5BYRA 2CPXA 5IQ6A 2FLOA 1FRLA 3I0RA 2CPHA 1LFPA 3M8PB 4LIRA 3ZFVA 1OSDA 4ECXA 4DR5F 4KC5A 2PSZA 2ZC3A 1IKXB 2GIRA 1UEVA 2D1CA 2MGZA 2RQKA 1U8SA 2GO8A 3M7VA 3DXSX 1M1HA 1S77D 3Q2SC 1GFWB 2V8DA 4UUXA 3UDVA 1E6VB 3GLJA 5KFBA 1WC4A 4I0WA 1CC7A 4P71A 2RE1A 3PR4A 3BO3A 4OMFG 2V8HA 5IOLA 3TUPA 2KFYA 1RHUB 2D9OA 3KJVB 4B9NA 2P6TA 3N9UC 4IH5A 3F0NA 1VC6A 2RRAA 4ZVFA 1S1VB 4DG1B 4MTPA 1BHNA 4NLDA 3J7YI 3TA0A 4MKVA 2F5GA 4USIA 4B9UA 2BJ7A 4DUZJ 3K89A 2JVRA 4PQAA 4WPAA 1TL4A 4BBYA 3OXGA 5F41A 2MY8A 2HFZA 2DJWA 2KT5A 2UUBJ 2Q43A 3QO9A 1BQXA 4DR3J 1YHQS 3PM9A 2W2PP 4OX7A 4ECZA 3HKWA 3BSCA 4DQSA 4DF8A 3R2DJ 3SEOA 4ZCIA 1JLCB 4IDKB 2HFSA 2XMTA 4HDHA 2FJWA 4DV4J 1Y7PA 3LWLA 4RW9A 4WU2A 3N28A 4DV2J 1RT5B 4OI1A 3VGUA 3WX4A 3LOUA 3D0GE 1H2TZ 3MPWA 1G2EA 3I56S 2B6AB 4OIXA 3U02A 2CWXA 3UPFA 1K73T 2LQ5A 3IS9B 1WELA 2ZH1A 1K47A 4DPUA 4C8MA 2VPZB 2AJ1A 4TY8B 2ASDA 4JP8A 3FBCA 3OD2A 1K44A 1RHKB 1RKJA 1N32J 3V5RA 1L3SA 1QSYA 1GMWA 2RF2B 1LQ9A 2ERRA 2E5LF 1KVJA 3KG4A 3AT1B 2A1BA 2WVBA 2M88A 3EJMA 5IT9Y 3M32B 1VQ9S 3JAMU 3TAMB 2JFKA 1S1WA 2Y8YA 1HNVB 4LSZB 3CIZA 4Y2CA 3W2WB 1M5VC 1TUVA 1T9TA 1HWKA 3MR5A 4LFAF 4K4ZA 1SH3A 2BANB 4YHHF 2ILYA 3CDUA 3EGNA 1S1TA 1YJWS 2AT1B 3LW5C 3QMQA 1FESA 4CO0A 3THVA 3HSZA 3LANA 4WYWA 1VBZA 4FXWA 2QMWA 1VBKA 1DY3A 1RSCA 4DUTA 2YWFA 3FBBA 4LIWA 4HHJA 3DLGA 4ANCA 1S6QA 1F1BB 4J9VA 3KK1A 1KHWA 4WP3A 4J37A 1VRTA 1W2BR 2GHVC 3GCXP 3M05A 4NCBA 3AD7C 2F7VA 3D2WA 4IFYB 1SL1A 3J7Z5 1G4CA 5C42B 2BQUA 4RUCA 1T9XA 1CEZA 1VLOA 2MEWA 1HNWF 3FJ2A 4TN2A 1JLFB 4L73A 4JV5F 2FHOB 3LAMA 3D6TB 1ROFA 1TKXB 2JOQA 1QD1A 1IN0A 2BJDA 1KLNA 2MZQA 4ZIWA 2LECA 3G9CA 2FIUA 3C6UA 3QQCD 3U1MA 3MMBA 1V5VA 4LUBA 4Y0FA 1MWQA 1HBUA 2DH8A 1CULB 2BE2A 2X7IA 4NMXA 4TY9A 3HXMA 3IRXB 4FXDA 1LW0B 4DSFA 4DR2F 3DRRB 3RRGA 2ZDOA 3FK4A 4ELVA 2M0GB 2ZZNA 4CZCA 2FLLA 1ZPVA 2BUNA 2HMIA 4JI4F 5DQHA 5L9NA 2HVEA 2P9CA 1GQEA 1NDKA 3T3FA 1T11A 5A2QY 3MCSA 1FHTA 2RB7A 1R8BA 5A8RA 4A8FA 4P2FA 4S0MA 2EWHA 2DR7A 5HP1A 4DN0A 4KFBB 4E2FB 2V5HG 1LKZA 3UDCA 4NEYA 5HQMA 2A2DA 2K3IA 2CKWA 2ZOFA 3NGTA 1X8DA 1M5OC 1OMSA 1NSQA 1RWNB 4DUYF 1HWJA 3QWPA 2R8GA 4YY3F 3BDEA 4Q8EA 3MPDA 3QGHA 4E98A 3PW5A 1XBWA 2R2UA 2YTCA 2AGOA 2MKHA 4C9DA 4U67Q 3AJDA 2ASLA 1X4EA 1RTHB 3Q23A 1ZA1B 4RNMA 5K14B 1PO6A 4NLWA 4U7CA 3FQLA 3LGNA 2DHHA 3Q8PB 3CDWA 1ZM3A 1DJ0A 4JOUA 1FJGF 1A7GE 3CCRS 1HBOB 2IBOA 3FMWA 3GR1A 2YNIB 3UN3A 2BDPA 1RAAB 1ZPWX 3KUEA 3NL0A 3C16B 4M5IA 4IR1A 1N5QA 1YQHA 4M5DB 4PXEA 2AJFE 2DGQA 2CNOB 2HIYA 5HJYA 1UL3A 5F9NA 2J9DA 4USUA 3SSSA 4W4MA 4PABA 1N88A 1XWLA 1TKDA 3PEJA 3H5XA 2HVZA 3D28A 2I38A 5GMEA 3TYTA 3GG0A 2CRLA 4GVBA 4B3SJ 4QIWD 5IQQA 4ER8A 4Y6IA 4X4NA 1E6YB 2DNYA 3PVXA 5GAHI 3DCAA 4CYUB 2Q1LA 3MCOA 2WB4A 4FVMA 4NXNJ 2MB0B 4OL8A 2PFDA 3OFHA 4U7UK 4QZVB 3BGRA 3MTKA 2EVZA 1C0TA 2IAJB 2YQ3A 2ZHOA 2ZKUA 2ZHAA 4WK1A 2HWTA 3MECB 4PYDA 4O0NA 1XR6A 2AZ1A 5I42B 5A76A 2H5EA 3KXDA 3MMCB 4X62F 4ZCLA 2R8JA 4EFAC 3HVWA 5F8HA 4K59A 4ES3A 1Z2ZA 3SQGB 4DR4J 2XEXA 2L41A 4F3QA 4XO0A 4BS2A 3CD0A 4OZ2A 4GKKF 1RT3A 4ZHRB 4G6VB 1CQMA 3GJRB 4DV1F 4Q0BB 4OI2A 4OJHA 4AUKA 2QFJA 1NK4A 3N4WA 4DHVA 4ES2A 2NZCA 4DFJA 4PAAA 4MIAA 3L95X 2GVDA 3CJ4A 1Q5YA 3O2IA 2H4WB 1TL3A 3JTPA 4ZN3A 4DSJA 3POTA 4X4PA 4ZVOB 2G2ZA 3AA8A 3RUBL 2X3DA 1HBMA 3MUMP 2I5JB 1D9DA 3VAKA 1A6LA 5T41A 3HJFA 4CP5A 3I96A 3G86A 3G8QA 4KIAA 5FLXU 2NXCA 1HMVA 5CYMA 2LDYA 3R27A 2V4QA 4XPEA 1OY8A 2DGUA 2V50A 2HNZA 4HH1A 1F5CA 4MYUA 3HO1A 4R0EA 5DRKA 3CMES 2CFXA 3RW6A 2VPWB 2MKSA 3UR0A 1WSVA 4JI5J 4CH7A 1HNIB 2AW0A 2IBKA 4FF4A 4NLUA 3Q83A 1LK5A 3K2YA 4P75A 3PX4A 1JLQB 3NWRA 1R7IA 1U2FA 4C3KA 3QGGA 2HFVA 1N34J 3VAJA 1UTAA 2ADCA 3LA0A 5KFJA 4UF4A 3DRSB 3H8YA 4F3OA 2RDDA 1BY9A 3R1LA 2Z2MA 3Q2TC 4ERDA 1HLWA 2P9GA 5HI7A 1CJKB 1TAUA 3UI3A 3K5OA 1U09A 3QJLA 4I64A 4JB8B 3JSYA 3DOKB 1KTVA 2AJ2A 2XO7A 2QSFA 4USWA 3I0SA 4ZITA 2P6SA 3OTDA 4URGA 1XMQJ 3K7RA 1JXLA 3ZO7A 5EUHA 5F8IA 4WBFA 2KVQE 3HFKA 3MOZA 1F0XA 2V4JA 1DLOA 2X1GA 5I3QA 3DRYA 2KHDA 4LRCA 1ZZFA 2H54B 2CNKB 3UCGA 3R6LB 3RYLA 4DV6J 4I1TA 1HI1A 3NOGA 4KAIA 3DLKB 3FBFA 2RUSA 5EHHA 4KYZA 3A1YG 1HKAA 2PEHA 2LMIA 3SMZA 4ZLNA 1QE1A 5FD1A 3ITHA 4CRJA 1EKRA 3M6XA 2AX1A 4EGLA 2IM0A 2ZBQA 4LSNA 3KMSA 4USVA 4CTAB 3G6YA 4KPYA 2N4DA 1KN6A 9RUBA 1BXNA 3HHNB 4QIGA 2CPEA 3IBFB 2ROEA 3Q89A 4BCAA 3ILIA 3MD1A 3TI0A 1FNXH 3G87A 3PR5B 3T5JA 2YKAA 3DDKA 1MNEA 4CLKA 1J5EJ 2JEGA 4C6AA 1S0OA 3NG8A 4LR8A 4DV5F 3MR2A 3D1QA 2FZCB 1TK5A 2CPFA 3CCQS 4XPCA 1XMBA 4M5KA 4ETZA 3VQSA 4N8NA 3KK2B 4F4WA 4F26A 2FJAB 2XI2A 2CQ2A 2W9CB 1K0VA 3OJUA 3QT6A 2BJ3A 4O0IA 1ZM4A 5E3PA 2DIVA 3O44A 1S6PB 2FVSA 1L3UA 3OTEA 2YWHA 4TKTA 2MZSA 1DTQB 3M8QB 5HK4A 3EPGA 2DY1A 3WIUA 4EU0A 2IIHA 3UN5A 4B02A 4ATNA 2M5YA 2PA8D 4NRUA 4RNFA 3R7SB 1C1BA 1NBEB 1NPRA 3OLBA 3HVTB 5AE3A 4OYWA 4MH8A 2R7VA 2ZM6F 4WXOA 1VIXA 1VQSA 2RMLA 1C4CA 2AKWB 3T1YJ 1PAEX 4LRFA 2CAJA 3A12A 4YB6A 4P10A 1U7LA 4G1IA 1VQ4S 4PUOA 1QY7A 1RK8A 1WUUA 1T0TV 2DGTA 3O1LA 2DTJA 5F0WA 3EUNA 3L3CA 4AQYJ 2X1FA 2HQCA 2B4OA 2KFZA 4V19J 1XQIA 4OJ1A 4KT0C 4MJKA 2C2EA 4BDPA 4AL5A 2W9BA 1NEEA 2VONA 5C7PA 3MDFA 1JLBB 4PG7A 1IBMF 2GGPB 2GQ2A 2Y8WA 3WHIA 5GAGI 3MAHA 2DGXA 3I0RB 4C0OC 3IO1A 2RVJA 3R9LA 2Z30B 4D3HA 3MEEB 3QNWB 2IJFA 5GMDA 2MZJA 4BWMA 3TANA 2VDHA 4AXJA 3VTIA 4ENOA 3GQCA 1H6KX 4LBIA 2FPHX 3D66A 4X4TA 2QTWA 1DTTA 1YJ9S 3W2VB 3CJKB 2DBBA 1TELA 2OPQA 3HP6A 3V6DA 3GJTB 4WYLA 4CM0A 4NX9A 3R6GB 1CJVA 2HRUA 2LQBA 2WTFA 1H38A 4JI7J 4LR9A 3FC9A 2ZNYA 2C3PA 3MI7X 4J9UE 5DS7A 2CQCA 5K5MA 1LFWA 5KOWA 1WD6A 3D3CJ 2PMWA 3EGZA 1V3RA 1XTZA 4DV2F 3BN7A 2N7YA 2EC0A 1SIWB 1FA0A 3F44A 5EWGA 3NRBA 1RWOB 3U1LA 1N6QA 5GVQA 3NGDA 4G1PA 4L3KA 2VOOA 3UD5A 2GCFA 1REVA 3SFUA 5IWAF 3VAIA 3FCWA 3D1HA 3H40A 4LF6F 1IKWA 2DXEA 1MU2A 1YBAA 2F9DA 2XGPA 5B0EA 3GIJA 1WOOA 2QO3A 3HX9A 3CCJS 1TK8A 2BBEA 4YDDB 2IVFB 2HQIA 5DETA 2NUUG 1ZAXA 3BSAA 3ZZPA 2G9OA 1H7XA 4Q5VA 5M2UA 3CD5A 4F04B 5C2GA 3BGOP 3MM7B 2DNQA 2QEXS 3TAQA 2ZUGA 2DNLA 2F40A 2YKMA 2GO9A 2C2KB 3H59A 4QU6A 3TJ8A 5IM0B 1QDUB 1XIQA 3G6ES 1B70B 1M5PC 2BX6A 1RE1B 1NK5A 2UP1A 2EG2A 3EGVA 3PXGa 1SKUB 1T9WA 3PIOQ 1X60A 2OPRA 1HQUA 1FK9B 3DOMB 4X66F 3IRWP 1S1WB 2OFGX 1MG7A 2DISA 2MZRA 2PE8A 4QWDA 4IFVA 1TAQA 2GQQA 2LCWA 2MKCA 2UUAJ 4WE1B 1JWWA 3RZAA 4QQBA 3GE9A 3CCTA 1IKYA 2WSEC 1XK8A 1NCLA 4O4RA 2VD3A 1FCAA 5LMUF 3GIMA 2YPYA 2OSRA 3OXFA 1GNKA 3KLEA 1NSPA 4C2MA 2IA6A 5D0EA 4K4VA 2YNGA 2GQCA 1I3OB 2RH3A 2MQOA 2ALZA 5J2QA 4DL7A 5KFFA 1FNMA 3BSNA 3BBCA 3B8HA 3GFYA 3KLGB 2BRLA 1RTJA 5THWA 4EBEA 4IRCA 5D0GA 1JKHA 2YNFA 2ZE2A 1FRJA 2YNHA 3A4TA 2NR0A 2LQ8A 1NLKL 3FSXA 5L9XA 4RU9A 1CJUA 2IPOB 4NLVA 1NPKA 1U45A 3MM5A 1FRIA 3CCES 1VK8A 3TZWA 2EFVA 1MROA 2QMXA 3ZTOA 1FWPA 2N3OA 3MAAA 5IV4A 4HLBA 2HHHJ 3D6FB 5HROA 4R8UA 3S8SA 1X4AA 1TKZB 3LF0A 1SJ3P 4WJBA 3PO5A 2VFSA 2B4PA 3LO3A 4ZLLA 4ECTA 1S12A 4ZIVA 3C6UB 3FSYA 2UUCJ 3MMBB 3AA9A 1RA6A 1R8PA 2QA2A 2EEYA 1PG5B 6AT1B 2OLWA 1N5YA 3SSRA 4ZP8A 1PJ7A 2C2ZB 2H5JB 3FGVA 4M5JA 4DS5A 2RQCA 5F0UA 3UDEA 2HNDB 1UFLA 2E7VA 3MR6A 1JMTA 1GXUA 3RBEA 4HHUA 2CYYA 5E2QA 3M6UA 1YG0A 4CLPA 1J5OB 4I6YA 5B08A 1NKBA 2XMAA 4PXBA 1HWIA 2K06A 1U6FA 2OUGA 4LSLB 4RW8A 1RGVA 3L7UA 2G1DA 5HP1B 4B3RJ 3G82B 1EARA 2HIQA 5BR8F 2BR0A 4QPTA 4JI6F 4O4GB 4CO5A 4DU7A 4UY85 1OO0B 1HPZB 3B4DA 3MM8A 3CJTA 1HIYA 3B82A 4IYQA 3W63A 4IG0A 6FDRA 4FPRA 4MKBA 1OPZA 3QFHA 3FVYA 4QJVA 2APOA 3CJ3A 1NK0A 4ED3A 5DDPC 2K7KA 3ET6B 3MTJA 4OYOA 5ETRA 4B3SF 3HK2A 1SUQB 2HHSA 1WG5A 1PCAA 2OD4A 3RW7A 4YP3A 3I9ZA 2H48B 2BACA 4K4SA 5E41A 2MDAA 3PX6A 4XK8C 2FVCA 2VASA 4I2PB 1C4AA 3MHYA 2Y9HA 4LF8J 2R9LA 3G8TA 3MEGA 1SV5A 1AZSA 1EP4A 1SJ4P 2IDLA 3UR3C 4RW6B 1UW4A 2QV6A 5FIIA 2I1RA 1LWEB 3PRBA 2Z0GA 3SV4A 2F65A 1MMDA 2AJ4A 2KT2A 1P1TA 5CCMA 4DR4F 3BSOA 4ZPWR 1VQNS 2U1AA 1NB7A 2B9WA 1HD0A 3MOJB 3DOLA 2N3LA 3EVOA 5FJ4A 1VQ8S 1BQMB 1VGYA 2XTJP 4PWUA 1URNA 4ED7A 4NLQA 1I1GA 1MLAA 3UCUP 2ATLA 1GAOA 4DCPB 3HVRA 2EK1A 2CJKA 3R1HA 2H5IB 4PWWA 4L76A 2LLZA 4KKOA 1T94A 1Q8BA 4CQ1A 3GSDA 1JLAA 2DGWA 1RZMA 3KFWX 5LMNJ 2KO1A 3H0PA 1IR1A 4NRTA 2JC1A 2PN6A 1YJTA 4WCEQ 4IRKA 5AE2A 2OD6A 3KG0A 2W7AA 2R2RA 2IVYA 4C3LA 2VQFF 2QE5A 4HR2A 1KQKA 4QIVA 2OELA 3DYAB 2L48A 5E3RA 3EYZA 5C24B 5JVHQ 3ENQA 5ETSA 2PI4A 3KHRA 3C15B 4FKYA 2HG4A 2DNGA 2GVDB 3C14A 1RABB 5E3CA 3OPKA 1TL3B 2CNLB 2YKNB 2JWNA 3OR1A 3GU0A 2HGNA 4ID5B 2OEMA 4D3GA 1QVGR 3VZIA 1P27B 1KTQA 4EMDA 1N34F 3PV8A 4HTJA 2LU1A 2A0FB 4DL5A 3V81B 3H90A 3JYTB 2DNHA 1RT1A 2H65B 2WOMB 2IYGA 5KFNA 3KYLA 2VC0A 1U2RA 2CG8A 2HNZB 3S01A 2V94A 4LR7A 2WRMA 1YJRA 1IXKA 1RAHB 4CO2A 3CDBA 3D0IE 1RHQB 4I7FB 3NKYA 3D67A 1WHYA 1WDDA 2RSQA 4RJVA 4KGKA 3CMAS 3QRQA 2AHOB 1FF2A 1IKXA 4AXIA 2C22A 2E66A 3MPYA 4DLGA 2V2ZA 4H4OB 1LWCB 2M8HA 1BUXA 3ZTPA 2UXBF 3TUIC 2DRDA 3OTOJ 1KQFB 4ED1A 2B9XA 3RGIA 4QYZJ 2RRBA 2W7PA 3DLBA 4LF4J 5HMZA 1O6XA 1FKOB 3I0SB 1E6VA 4O44A 1VHFA 1RTIB 1RWXB 2ZHBA 2GIFA 4W92B 2DNOA 2A6OA 1S4EA 1L5UA 2V4JB 1TFYA 4DG1A 3CJQA 1HD1A 1U48A 1UA0A 4NA3A 4F0MA 1J5EF 2KVIA 2DITA 2NZ4A 3NNCA 1S99A 2MQNA 3MCNA 4U7UD 2J0WA 1QE1B 1RDRA 3M30A 1WF0A 2GNKA 1N0VC 4ZJOA 2HBQB 4UT4A 4KGXB 4LSNB 5M2RA 2OPSB 5HBMB 2R7WA 4C11B 2HWHA 2CPDA 2OFHX 1AUSL 1SB6A 4PG6A 3LP0B 4A8SA 3RR8A 1JLCA 2BKPA 5KFEA 1HYSA 1DZ5A 2DRAA 3AOAA 3GONA 1UPMB 4IDKA 3K5LA 5EDWA 2V68A 3H5SA 3HSGA 5D4OA 3DLLQ 5DG9A 4AL6A 1Q7LB 2MZTA 3L7PA 1PILA 4QYZK 4QPXA 3TW0A 2ZBPA 2FJEB 3AJ1A 4ED2A 1NSKL 3DRXA 2VFRA 5B0CA 1JIHA 2WONB 1BGXT 2B7CB 4USMA 2DT9A 2HYIB 2CWKA 3BH7B 3PRDA 3IS9A 3GYGA 2J6TA 1N0UA 5KFOA 3N6LA 2QRRA 4I6AA 2QYGA 4DOZA 1NJZA 5A8WB 2P5VA 1SJFA 2OMLA 2VG6A 3MMAB 4TY8A 1RXOB 2LVWA 4EI2A 1V3ZA 2FJVA 4AD6A 2CJXB 4AQYF 4TU7A 4DX5A 3PCOB 4C8KA 2WAQD 1YZ6A 1UEUA 2HFOA 5SZTA 2YH0A 3M32A 3CCVS 3TAMA 1IUJA 2XMKA 3HHLB 4ALZA 2ZEJA 2IY5B 3IR6B 4UZBA 3CCLS 5EGYA 2D69A 5KT5A 2JJ4D 5AXKA 4DSKA 1H3DA 2H51B 2ROGA 3FQKA 4BHQA 1ZTTA 2QC3A 2YKQA 4A8YA 4ICLB 2RT3A 3KK3B 4ECRA 2J0QD 2RJZA 2E5LJ 5BYQA 2MTLA 1VRQC 3RTVA 2GJ2A 3V6KA 2ZITA 5F8MA 4ECWA 1R0BG 8ATCB 4IFYA 1BLUA 3OHAA 3VAHA 4YHHJ 3IG1A 3VR1A 3OVBA 3A3OB 4IO9Q 1RWVB 1JLFA 4F50A 4AT1B 2W7OA 4RNNA 1DHMA 2MHNA 2PD1A 3GIIA 3OFGA 3SDEB 1S1UA 1NH7A 3KLHA 4Q2LA 1KP6A 3LTOA 2IM3A 4MAKA 4RBVA 1U4BA 7FDRA 5DJBA 3VGVA 1YZ7A 2CJQA 3BO2A 3ZXWA 5J2MB 1RYSA 5IFMA 2OPPB 1RAIB 1CULA 2YWWA 3PNIA 2PIIA 4HDGA 2DNKA 3GJQB 3IBWA 1LW0A 4P2SA 5L1LA 3IR7B 3GSIA 3WC2A 4JV1A 3DRRA 4WU3A 1UJ4A 4JV5J 2DR5A 4OYAA 5DZ7A 1ACMB 3LP2B 1PYSB 4EYHB 2CZ4A 4ZDNA 2RQMA 4HH0A 3VGTA 4UOGA 1B7YB 1QAYA 2HS4A 3RB3A 3RG6A 4MFBA 4WXWA 3AB2B 7FD1A 2XY5A 4O3PA 3B78A 5F8LA 1SKSA 3FFIB 2WK4A 1U02A 1XNRF 1KLMB 2KB2A 3N5BA 2W4DA 1TTHB 2FHJA 3OR2B 4KFBA 3C6TA 5C25B 5F3ZA 3JTOA 1FEEA 4P7TA 4QU7A 4DR2J 3UNYA 4U96A 4N5SA 2GHPA 2CQHA 2QLWA 3H2LA 2DGOA 1QAIA 2KTQA 2NSBA 5KT3A 3ZTRA 3GCWP 3S1TA 2XY6A 4JI8F 4LF9J 4JI4J 4QW9A 1G7CB 2CJYB 2AGPA 4KJIA 5H9FJ 2VHGA 3CF5Q 5DLGA 4ECQA 1RTHA 3G6VA 1VMBA 2DPIA 5K14A 2KFNA 2UUAF 1RLCL 3DXBA 4RLEA 3GV5B 4P9SA 4WK3A 1JLEB 5K20B 3J7A1 1S76D 3TEHB 1P8GA 1U2CA 2IA0A 2VBXA 4CO1A 3BJYA 2YNIA 3PACA 1J2VA 3V2UC 1TU0B 3NS5A 3DU5A 4OYIA 2FD2A 3T5KA 4CLLA 4DL4A 2F3JA 2VZ9A 3Q8SB 2B8QA 2J0SD 3KHGA 4OJ3A 3IM9A 4RO0A 2H1YA 2ZVSA 2K3KA 4N8OA 1IKYB 1WJ9A 3GYXB 1YKWA 4YDXA 1S59A 2VFUA 4MK8A 2EK6A 2O3DA 4EYIB 1RT7A 1E6YA 2QL7B 4ZPDA 1HHSA 1FJGJ 1SH2A 5JVGQ 2KJVA 3NNHA 2NXNA 1X0FA 4BLGA 1KHVA 2HQDA 2CXEA 4NLGA 2IAJA 3AJ2A 2HHHF 4NEZA 3MXHP 3GZ7A 2XMJA 2EFNA 3W8GA 4C7QA 2GX8A 4DCJB 5KFGA 3MECA 4FYWB 3W60A 2PI5A 1X9MA 2UUCF 2SXLA 2YNFB 4F02A 5I42A 1XC9A 1XNQF 2J7WA 2YNHB 1RT2B 5KFVA 1WORA 2V9KA 3DGPB 3TZYA 4F25A 2CUYA 2BV3A 2GS8A 4GO7X 2CJAA 2YVSA 2VDIA 3MM5B 5D0HA 2AYEA 5DLFA 3I9V9 3WX8A 1XEZA 1JXVA 2ZWOA 1AYEA 1A9NB 2XCPA 4J9NA 5HROB 3KJFB 1AA1B 4LVOP 4P74A 1FWKA 3UW1A 5GADU 4B9TA 4I6WA 3RB6A 4LJMA 4CWBA 4A8OA 3NCPA 4X62J 1TV6B 1PJ5A 2UXDF 1G3OA 3HT0A 2DPJA 3QGIA 1NDLA 4EBDA 2DVIA 2LXFA 4ZMMA 4EEYA 1S9EB 1FTRA 2V9WA 1NAQA 2CDRB 1HQ2A 4DV1J 4WP8A 1O5JA 2Z2LA 2R4FA 3AOCA 3K17A 4ECUA 1HNIA 3BBBA 1AXQA 1NM2A 2HS0A 1DQ9A 4ANDA 1JLQA 4LRBA 1OY9A 4OX8A 4Y2IA 1IR2A 1JJ4A 4RW8B 2KG1A 1KVKA 3C3LA 3AAWB 1OYDA 3DRSA 1SC3B 3Q8QB 4CI0B 1IM6A 3CXCR 3PYEA 1KQGB 4M95A 2KYZA 1V6HA 5HSPA 5B0DA 3AH6A 1NU4A 4JV2A 2VFVA 4HL9A 1IJFB 2JRSA 1RTDB 4JI0F 2HK3A 3CC7S 3DDNA 3H5UA 3DRPB 3SBMA 2CDQA 4K0KJ 1SQGA 4J9SA 5B0AA 5KFIA 3O5TB 3IC1A 5JMNA 3QLHB 4YUDA 3S7RA 5T14A 1Y5LB 4Z37A 3I5BA 5ADZA 1YLXA 3DLKA 1FJ7A 1U0HB 1ZM9A 3KJQB 4AYBD 1N4LA 1BQNB 3M2RB 4FKXA 1T3OA 1H7WA 2JEIA 3QT8A 1MWYA 1TUWA 4DSLA 3IMQJ 4OYZA 3C66A 3D3BJ 2AU0A 1X0PA 3EM1A 2K2PA 1AZSB 4K4UA 2B4UA 5DDOC 2L9WA 2VKZG 2RU9A 3KUHA 3OV7A 3QAUA 1CLFA 1OJ4A 5KFKA 5LMNF 4RUAA 1FXDA 3PJXA 4QIEA 4ILRA 4FBTA 1FNOA 3KK2A 4KPCA 2B9YA 3JAMY 1YGYA 1NHUA 4F0KA 2W9CA 4FVCA 2ASYA 4HT5A 5HQ8A 1T3NA 4KE5A 1B0TA 2VBWA 3E51A 1KOHA 1GMWD 4A8MP 1S6PA 2QL9B 4OI3A 4OX9F 4X4UA 3OVAA 3FKBA 2YX4A 3M8QA 3QFWA 3BZQA 4KKOB 1B4SA 1URRA 4GVLA 3GMGA 4DV3J 3KDOA 3QATA 2L9NA 1XMOF 4B9SA 3UCZP 2C3YA 3BYPA 5LSRA 2RILA 2HFNA 1IWGA 4OLPA 3QIPA 3UWTA 4ETXA 2JX2A 5AJ3J 2GFFA 3BR8A 1GXTA 3CCSS 4IKAA 4K4TA 3OR1B 1U1LA 1RT6A 1UP1A 3PFOA 4USKA 4Q7AA 2ZH2A 4OLOA 1X4BA 5DGBA 2UUTA 3OFEA 4J9MA 4B9LA 2B9EA 3DMJA 3W9JA 2FVRA 4MYTA 2F8HA 2X1AA 1LWFB 3OTOF 4RZRA 2VJUA 4WP9A 5KT2A 1MN7A 5IZHA 3MEKA 2ZM6J 4KH0B 4NCAA 2P9EA 3VF0B 4N56A 2MPUA 3BV8A 4R0JA 4USTA 2KHCA 3LP1B 1JLBA 2EXUA 2EFPA 2GGPA 1S5ZA 2RU3A 3W3SA 4ZKAA 2VH7A 1JQGA 4JI2F 2C42A 5KG1A 2J6SA 3MEEA 4LF2A 2EKNA 2E9TA 5CH7B 3RRHA 5HLFB 2E5HA 4RUHA 2KM8B 3IR5B 3A3NB 2GVZB 3EWGA 1MMLA 2O01C 3W2VA 5L38A 2BKOA 4NPOA 1R8AA 3CJKA 1LEOA 2GJIA 4IR9A 3I32A 1TZ0A 2VPYB 3FDSA 4O44B 1IBMJ 5KFTA 4RWXA 2XMMA 1WKKA 3MUTP 5J1PA 2CJ9A 4NL5A 2OTLS 2Q79A 3MM9A 3TJ9A 4DL2A 4RPFA 1WTFA 1N5TA 4FYXB 2MLXA 1U1KA 5T7LB 2XSJB 5ETNA 1T95A 2CQ1A 1K1QA 3P49B 3P4UB 4X64F 1ULRA 2HLUA 1OSCA 4QIFA 3C8YA 3VQTA 1YDLA 3M30B 1Q81T 2XSFA 1REGX 1DQAA 5KG5A 4TYBA 4P52A 1FXLA 4OYXA 1FE0A 1O8BA 4ZVSB 2NYIA 5KFLA 5CYQA 1VCTA 4I56A 4Y34A 3EDRB 1OWXA 4O23A 4L75A 4CIOA 3PZPA 1X4FA 3ISNC 1HYSB 3HD2A 4OI0A 2ALYB 2XBPA 3ZNJ1 2NS1B 3HT3A 3Q8UA 1PGZA 4UUWA 1WC3A 4F0HA 1R8HA 1HNZF 5HL7Q 1FRHA 2Z57B 3OFFA 1SJQA 4A8QA 2V0NA 5D6GA 2XZTB 5KFZA 4PG4A 3CO0P 2W4CA 1XR5A 2G0JA 2HBZB 3MM7A 2BM1A 1TVRB 2YKPA 1VBYA 1RWUA 2Q66A 5IWAJ 2EC2A 1DAXA 1S97A 3ZTQA 1PBUA 1FKPB 4OJGA 4H4KA 2VG6B 4LF6J 3W65A 4OV6A 1FT8A 4LF5F 1H0HB 5DM6Q 3FEZA 1HW9A 3GIRA 5IM0A 2GAHC 3EXYA 1S9GB 2DD8S 3ZZYA 3KDNA 1L3TA 3DLJA 3ETMA 1RU2A 4KHPJ 3EVMA 3TA1A 4BWJA 2EKYA 1S72S 2COLA 1FK9A 3DOMA 3I6PA 5H9EK 2HZCA 3EXCX 4E8UA 1RHMB 2KU7A 4WE1A 2BA9A 2DH7A 4B3MF 2QG9B 3I87A 5K8PA 4J9RA 4QR1A 3CC4S 1R3NA 2YWKA 3R2CJ 1TMMA 3TRGA 5KTQA 4K8RA 3RB4A 4LRDA 4M5LA 2Y1RI 4PKDB 4MIWA 1UPPA 4CLSA 1XERA 3NLCA 3CB4A 1Z1ZA 4FF2A 4CT8A 2KM8C 3IWNC 1UFKA 3QRRA 1SCJB 3KLGA 4X66J 2YQ0A 4QOTA 4X65J 3H20A 2BXJA 4ZN1A 8AT1B 3EPIA 1PC4A 3VAFA 3CD6S 1TL7B 3VGSA 4NXMF 2FGOA 2ZFHA 3IG1B 5LM7E 4KH1B 3JB9k 2HLTA 3AOBA 3GFHA 5LMUJ 1EETA 1NMEB 3ILJA 5FLXY 5A0YB 3TVYA 2KI2A 4YB1P 1NUEA 4DPXA 1UW9A 4LVNP 1S1UB 4OI6A 3H4BA 3KLHB 2LA6A 1TKZA 4M5GA 4QBUA 2F4VF 1Q5VA 2R8HA 1ZA2B 2JEJA 2V67A 4U9RA 2VBYA 3CGIA 5F8NA 3W5YA 3ZZZA 4F4AA 2WVDA 2AF6A 2DY9A 1RQ0A 3BQ0A 4B3TF 2MLZA 4ZVHA 4DL6A 2ZNZA 5KG7A 5KFDA 2MQPA 3TZZA 2E44A 2HNDA 3WBZA 1EX8A 5DG7A 4NASA 2Y1LB 4C97A 3F73A 3NMAA 4KO0B 2FYXA 2H4YB 2DH9A 2QT7A 3FEXB 4LF9F 1UVLA 1J5OA 4MFBB 4DSIA 5AT1B 4LSLA 1F5AA 3PG9A 4WFZA 2WVCA 1S9FA 1YRUA 4TU9A 1RBOB 1BE4A 1JJHA 1AROP 4PQUB 3G82A 1IBLF 2GHWA 3C6TB 2ZJPQ 5E7OB 4LF1A 5KFMA 1TUGB 4DR7F 2HK2A 3TEGA 1U1RA 2HQFA 2D3ZA 4O4GA 4O3QA 3LH2S 2QLXA 1C0UB 1HPZA 1FDBA 3OL6A 4DFKA 2DXDA 2Z58B 3MPUB 3A8JA 4OHWA 3GWCA 1IBKJ 2MQ8A 3DM2A 1S57A 4QWAA 3ET6A 4PXCA 3M8SA 2FTRA 3W7BA 2DGVA 4FXVA 2QN6B 3D68A 2XY7A 3PJWA 2E7WA 4K5RA 5BR8J 1SUQA 3Q22A 4G1QA 3T5LA 1SL0A 3E01A 3F41A 4JI6J 3JSBA 2ZWPA 1CPZA 4I2QA 1H98A 4Z7YA 4I2PA 4RNOA 3SZ2A 4DR1J 4RW7B 3FRYA 1VC5A 1VQMS 5KT4A 5IV3A 3CUNA 3OBIA 3LPEA 2XO6A 3VHQA 4RW6A 3D4JA 2LXIA 4ZVEA 2AJ0A 1LWEA 5EX0A 2R8IA 3D6HB 3TNVA 4U95A 3VZHA 3D54A 3TAPA 2G0IA 2Y1JA 1QAXA 1S4FA 3UD4P 1RT7B 5DDRC 2V2VA 3IA0A 3GV8B 2CQ3A 1D8YA 3JSMB 1Q7YT 4P7VA 2QA1A 5J2PA 1GTEA 2I2YA 1VYAA 4Y3CA 1BQMA 1VQ6S 5D78A 4FZVA 4PEOA 4ZPTR 3KLVA 4USJC 1AT1B 2OO4A 3NEKA 3LWMA 1NZ8A 4LT6A 2OSQA 4ZPVR 1KDNA 3CJ5A 4NLSA 2RAQA 1FEHA 3HI9A 1Y4ZB 4CO4A 2CZ9A 4PXDA 1HL6A 3W64A 2VKRA 2IM1A 1GTHA 4NZ7A 3BYRA 3BQ1A 3B4MA 4ZA1A 1YJUA 3UE2A 3I82A 3RRKA 2IJNA 1AB8A 4P72A 4B17A 4NLPA 2HBYB 2Q6BA 3J81U 1PKUA 5HMXA 4LFCF 3DYAA 2XI3A 2NCKL 3MMJA 5C24A 3VVTA 4ZP9A 4KY3A 2GZOA 3ELHA 3C15A 4IG3A 4O3RA 4NOHA 2XULA 2YKNA 4KV8B 4IOAQ 3HPOA 4ID5A 1UFWA 2FGCA 1P9YA 1X5TA 1X4HA 2AD9A 1L3VA 1F2HA 3V81A 3CJ8A 1UVMA 2MSSA 2VC1A 2XMWA 4GMKA 4DBQA 2NSCA 2KRBA 3JYTA 4YR0A 2VG7B 2MJUA 2WOMA 2XG8A 1UVKA 1FDAA 1FDNA 3TX8A 3X3UA 2VQFJ 4EO6A 1EJ7L 1Q79A 2BMBA 3CJRA 5G0RA 4ED5A 4I7FA 2FB0A 3KHLA 1LOUA 2J0XA 2RS8A 2R2SA 4K0KF 2HAIA 4W90B 3D6MB 2XMVA 1Y3KA 5LSLA 3HF5A 5DM7Q 4JBCA 4EWTA 3W1YC 1W2IA 1QTNB 1KOOA 2XS2A 3CDEA 5ETMA 3ZZOA 3MAQA 1VR6A 3HJVA 5L1IA 5CCLA 4H4OA 1LWCA 4NCGB 5CD4A 4HHHA 4DPTA 3MZIA 2RDJA 2ZZMA 4A8XA 5DQIA 4J90A 5B0GA 4BC7A 1SL2A 3I5CA 2UVUA 1FKOA 1TK0A 4V1Ak 4P73A 1RTIA 4IRDA 5I4MA 4NLTA 1S10A 4QWCA 2FVPA 3ZZUA 3V6HA 4YOEA 1S7IA 3AY0A 4DJBA 4Z2XA 4X4SA 5KFCA 4B3OA 2LP4A 3M2VB 1IBCB 3QT5A 2WB1D 2XNQA 3HSJA 2EPIA 4LREA 2DHAA
chains in the Genus database with same CATH topology
2NZCA 2CAJA 2BJ7A 2BJ8A 1Q5VA 2WVDA 2WVFA 2WVCA 3BKUA 3QSIA 1Q5YA 3LGHA 2HZVA 3OD2A 3PHTA 2WVBA 2HZAA 2CA9A 2F1FA 2BJ3A 2PC6A 2WVEA 2FGCA 2Y3YA 3BKFA 2BJ1A 3BKTA 2BJ9A 2CADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZC A;  2CAJ A;  2BJ7 A;  2BJ8 A;  1Q5V A;  2WVD A;  2WVF A;  2WVC A;  3BKU A;  3QSI A;  1Q5Y A;  3LGH A;  2HZV A;  3OD2 A;  3PHT A;  2WVB A;  2HZA A;  2CA9 A;  2F1F A;  2BJ3 A;  2PC6 A;  2WVE A;  2FGC A;  2Y3Y A;  3BKF A;  2BJ1 A;  3BKT A;  2BJ9 A;  2CAD A; 
#chains in the Genus database with same CATH topology
 3LAK A;  1SIZ A;  2ZOM A;  3MPV A;  3RBX A;  3CCM S;  2UXB J;  2XHW A;  3L4B C;  1VQ5 S;  3TA2 A;  3UQS A;  4XAK A;  1Q78 A;  1RAC B;  1FRM A;  2HQG A;  3NY0 A;  4F4X A;  2JFD A;  3EDQ B;  5J1N A;  4ZLP A;  5B0B A;  2OPS A;  5HBM A;  4C11 A;  2V2K A;  5BYS A;  3J80 U;  1QTM A;  3LP0 A;  3CJ0 A;  4Q44 A;  1T8E A;  3BGU A;  4K4W A;  5CHC B;  2FDN A;  1MW7 A;  1XR7 A;  2CPY A;  1TKT B;  2ADB A;  2CG4 A;  1FRK A;  4DV3 F;  1AFJ A;  3SYZ A;  2L08 A;  3N01 A;  1ZH5 A;  1GH8 A;  4DQP A;  2KYX A;  1NND A;  1KD1 T;  4KRW A;  1YTY A;  2HBR B;  3QYY A;  2WON A;  4DLE A;  2XYH B;  4ZVT B;  2W8K A;  1IQZ A;  2LDI A;  4PYA A;  5AJ3 F;  4F4K A;  2LA4 A;  2MQQ A;  3MUV P;  4OYP A;  4G3I A;  3IXQ A;  5A8W A;  1K8A T;  3MMA A;  2LKZ A;  3M2U B;  2UV8 A;  4NLO A;  2NXJ A;  3BKU A;  3P5T L;  5I3U B;  2W2Q P;  5E3A A;  3RJM B;  2I0X A;  2F8M A;  1Z4U A;  1YIJ S;  3QIP B;  2ACM A;  1EHW A;  5EWF A;  3W5Z A;  1Q95 G;  4FN5 A;  1U1N A;  2UXC F;  1B64 A;  3HHL A;  4MT1 A;  1X5P A;  3NAI A;  4YB5 A;  1S6U A;  1JLG B;  4Y2A A;  5KFQ A;  2MKK A;  4HEA 9;  5D3G A;  1U26 A;  4F36 A;  2J76 E;  1AUD A;  2POK A;  4Q2M A;  1R8C A;  1RT6 B;  4ES1 A;  1SQF A;  1KQS R;  2BVZ A;  1VOM A;  4ICL A;  1OS5 A;  1Y11 A;  1T03 B;  1SXL A;  4LMZ A;  3KK3 A;  5AXL A;  4OZL A;  1RHR B;  4OZN A;  1F2G A;  2ATC B;  3DMJ B;  1VFJ A;  2XMU A;  1F60 B;  2HVI A;  3Q8Y A;  3DU6 A;  4PG5 A;  3MED B;  4F4Y A;  1T05 B;  4TLR A;  1TP7 A;  2JDJ A;  3K8W A;  1OQ6 A;  4UQG A;  4DZ6 A;  3T9N A;  1BWE A;  5CQG A;  2YY3 A;  4YN3 B;  1FVS A;  3PKY A;  5U47 A;  1PC5 A;  2OIH A;  5D15 A;  1MN9 A;  3QBC A;  2ZH5 A;  3SCL E;  3DLE B;  3CC2 S;  1C2P A;  1F6T A;  2H9Z A;  3W9H A;  5KAK A;  4LFB F;  3H4D A;  1VQO S;  2BYC A;  2F1F A;  3ENW A;  3SDE A;  1IKV A;  3THP A;  4WII A;  2QA4 G;  2BJ9 A;  4U8Y A;  2F8E X;  1CS4 A;  2D9P A;  2XYG B;  3CJ2 A;  3K5N A;  2UU9 F;  1U0S A;  5ITH A;  4F3M A;  3NCR A;  2DNN A;  2HHP A;  1UET A;  2HAF A;  5HMY A;  2QJ3 A;  5J2M A;  2OPP A;  1EAY C;  5CZV A;  3CCU S;  1RWW B;  2DR9 A;  2MKY A;  4N7T A;  3MD3 A;  3MM9 B;  1HBN B;  5G4D A;  3IGV A;  3BDP A;  3K5P A;  2G0C A;  3MGJ A;  2J9E A;  3LP2 A;  3SCJ E;  1HNX F;  2HNY B;  1KWM A;  2IDE A;  2DNM A;  4NZ6 A;  3IFE A;  4KR0 B;  2HZA A;  2Y1I A;  2HKE A;  1GEH A;  4DPY A;  3AD8 C;  1NJW A;  1PSD A;  1WF1 A;  5CYQ B;  3OVS A;  2JLF A;  2C3U A;  3FFI A;  3ZNU A;  4YME A;  1KLM A;  1HFE L;  5D4P A;  3PHE A;  4NA1 A;  4RBT A;  3RU0 A;  3OR2 A;  2LQJ A;  5C25 A;  2IJR A;  2NRE A;  1ICE B;  2V63 A;  5C2C A;  2NYH A;  1HQE B;  3PDN A;  2W9A A;  5HJX A;  2N4C A;  1WKL A;  1KBR A;  4MKY A;  1UVJ A;  2ZH6 A;  2AYG A;  1Q1K A;  1VQY A;  2ZD1 A;  4KHP F;  3P3D A;  1WWH A;  4M1K A;  4QW8 A;  1P6T A;  2QSW A;  2P8I A;  3PTW A;  3H2U B;  2M3D A;  3R7N B;  2DEJ A;  1UCN A;  2R7O A;  5GAD I;  3FZB A;  2VG5 B;  3BRE A;  4UZC A;  3I5A A;  2XLJ A;  3ENA A;  2BKN A;  1GX6 A;  1XNR J;  4CDI A;  2DCL A;  3U27 A;  3WDO A;  1O0P A;  5KG4 A;  1U1Q A;  1JLE A;  1S7H A;  4R5P B;  5ETQ A;  2HW3 A;  3QWU A;  2VOD A;  3PRV A;  4DZD A;  4OHV A;  1ELO A;  1H72 C;  3CED A;  3CE8 A;  2W01 A;  1FVQ A;  2I6W A;  2V8G A;  4DCO B;  4JI8 J;  4M5H A;  3EE3 A;  3PW7 A;  1NPP A;  4F7V A;  4X65 F;  1R0A B;  3EZO A;  3US5 A;  3P8B B;  3HZG A;  1UVI A;  1Q86 T;  4HVZ A;  5ETV A;  3EVW A;  4LBP A;  1D0E A;  3TQ1 A;  1FER A;  2QIF A;  4DN9 A;  1FFW B;  3SV3 A;  3NBP B;  2C1E B;  1JNR B;  4F2R A;  4N47 A;  3O6Q A;  4TQS A;  3NGR A;  3P5B P;  1UWA A;  3ISN D;  4DXL A;  4KGV B;  1H73 A;  3H25 A;  1DQ8 A;  3ISZ A;  1U25 A;  2R2T A;  2V2Q A;  2YBV A;  4ZVQ B;  2XHC A;  3VV2 B;  1C1C A;  2W24 A;  1CSJ A;  3AQP A;  4E0D A;  4KB7 A;  4Q45 A;  2HHX A;  2JHE A;  4WIQ A;  2BEF A;  4MIB A;  3IBC B;  2KN4 A;  1UWB B;  4DV7 J;  1GMU A;  1KSP A;  1RTZ A;  1SC6 A;  1S0M A;  3DHW C;  4DSE A;  1RT2 A;  2IFX A;  3DGP A;  3A13 A;  2PDA A;  3QGP A;  3LAL A;  1U47 A;  1EET B;  6FD1 A;  1P9Q C;  1Q8I A;  4PWD A;  1HW8 A;  3C19 A;  2IVM A;  2XCA A;  5CZX A;  1D09 B;  4DFP A;  1Q82 T;  3KOA A;  1YIT S;  2AMC B;  5LOQ A;  2NPI A;  2RQ4 A;  3CT9 A;  2JEF A;  2Z2Y B;  4ED4 A;  4LQ9 A;  4TLQ A;  3MM6 B;  2UVR A;  3GV7 B;  3CPW R;  1XN9 A;  4YB7 A;  2Z8Q A;  1LXN A;  2MQL A;  2W1B A;  1XNQ J;  2E1M C;  4IOC Q;  4DMZ A;  3NS6 A;  1TV6 A;  4WTY A;  3BGL A;  1VS3 A;  1FX4 A;  2JSX A;  2ZDP A;  1JJC B;  1Q0N A;  4Y65 A;  2HEK A;  2XQC A;  2VIC A;  1YWX A;  4OYM A;  4ELT A;  3FCV A;  2MY7 A;  2YWG A;  4QWB A;  4AL7 A;  1S9E A;  3ILL A;  3ENV A;  1AW0 A;  4X2B A;  2AGQ A;  3R8Y A;  5B09 A;  1B99 A;  2G2O A;  2IRY A;  4AE5 A;  2E9R X;  2OAU A;  3DNC A;  1SJ1 A;  1IBK F;  4YQW A;  3K58 A;  4J9K A;  1BC6 A;  3CJS A;  2DHS A;  2UXD J;  4I69 A;  1VQP S;  3WC0 A;  1NXI A;  2EBG A;  5GAE U;  1DFD A;  4DF4 A;  4H4K C;  4A8W A;  3BS9 A;  4RNH A;  2A3J A;  2CAD A;  3OTC A;  1UJ6 A;  2DHG A;  3VCD A;  4DR1 F;  1M0S A;  2BW2 A;  2J7K A;  2VOP A;  5MLC V;  1RTD A;  1ZS6 A;  4ELU A;  3IWL A;  4WFX A;  3DRP A;  3SXL A;  1SBR A;  3L9Z A;  3DM2 B;  1RIS A;  4J91 A;  3QLH A;  3NGK A;  3Q8R B;  4URQ U;  4DPO A;  4K50 A;  1TL1 B;  4G1Q B;  1U0H A;  3W61 A;  3EMT A;  4X84 A;  3E01 B;  1PYO B;  2MQM A;  1UJ5 A;  5J1E B;  1BQN A;  3M2R A;  4UTG A;  3TX0 A;  1KNZ A;  4I2Q B;  1ZAV A;  1JB0 C;  1KEK A;  1EQM A;  4WKR A;  2QYC A;  4URS A;  3I55 S;  2QLF B;  3LUY A;  1GX5 A;  1XJW B;  3TZX A;  4JI0 J;  4YS2 A;  2QZ8 A;  3ZZT A;  3R7B B;  4H4M B;  1V3S A;  1W7W A;  5KFU A;  4DV0 F;  1YVF A;  1ZOT A;  1T9V A;  3KWM A;  2QA4 S;  1FD2 A;  3L09 A;  2Z2Z A;  3TP2 A;  2IRU A;  1RAE B;  1FI4 A;  2C2N A;  1WHW A;  4L72 B;  4NYZ A;  3IAM 9;  3Q24 A;  2BJ1 A;  1VDH A;  5J2P B;  1L3K A;  5HAT A;  4PR6 A;  1CBK A;  1VBX A;  2VQE F;  3UNG C;  4CT9 A;  5ETK A;  2FC9 A;  1IJE B;  2W4P A;  1RCX B;  1IM4 A;  1FWL A;  3H5Y A;  4RKU C;  2C2D A;  1N48 A;  3AHP A;  4DI6 A;  1I5O B;  4IH7 A;  3GPA A;  1RHJ B;  2DKO B;  2RUG A;  4FBU A;  2VA3 A;  3QT7 A;  1S0N A;  2YKO A;  1MWZ A;  2JVO A;  2K1R B;  3T1H F;  5EX3 A;  1N56 A;  4N41 A;  4WF9 Q;  1PJ6 A;  2O66 A;  4IG3 B;  1YX2 A;  5IT9 U;  4MK9 A;  1UAW A;  4OX9 J;  4JYA J;  2J7U A;  2B3T B;  4C0H A;  2RIJ A;  2VF3 A;  2BQ3 A;  3HHK A;  2AEJ A;  1FD8 A;  1XMO J;  5LJ3 Y;  3SCI E;  4Y28 C;  1LWF A;  4NWB A;  4ZVR B;  2RHS B;  4NLR A;  3E8O A;  1TMJ A;  1HR0 F;  4HI2 A;  5I3P A;  2QMU B;  3J7A N;  2GML A;  3LP1 A;  4J9L A;  5G0R B;  1D9A A;  4X4O A;  3GJS B;  3O3L A;  4MKA A;  1H74 A;  5HLF A;  1UKU A;  1GT8 A;  4CNY A;  3OL9 A;  4J9P A;  2GVZ A;  2QFI A;  1H2V Z;  4FF3 A;  2ZH9 A;  2A6M A;  3DGV A;  3Q0A A;  1FX2 A;  2PMZ D;  1S0V A;  3V4I B;  3OSP A;  1RCO B;  2AJQ A;  2DHX A;  4WFY A;  1OYE A;  3HSD A;  1QAJ A;  5B0F A;  1HAR A;  3UDL A;  2G13 A;  2VV5 A;  1VI7 A;  4JI2 J;  4ZJQ A;  2U2F A;  4B3O B;  1M5H A;  1JJ2 R;  1ZZN A;  2BOP A;  4RW4 B;  3OXL A;  5T7L A;  1ZET A;  1WG4 A;  2XSJ A;  1YRX A;  2VL1 A;  2PC6 A;  3MR7 A;  4F67 A;  3L7O A;  1NHK L;  2R3V A;  3J7Z T;  2RKI B;  2FLN A;  2Y0B B;  2IMO A;  1Y5I B;  5KG6 A;  1CJT A;  2JL9 A;  1WEX A;  2FHJ D;  4NA2 A;  1VK3 A;  2WSF C;  2JC0 A;  1UVN A;  3IGN A;  2K8G A;  2AQ4 A;  2PA3 A;  2AEM A;  4HTI A;  5A2Q U;  2CQG A;  3NAH A;  1N33 J;  5D77 A;  2MJN A;  2HGM A;  2HFU A;  3E3X A;  1X5O A;  2EFQ A;  3GFX A;  2XWX A;  3D1O A;  4K7Q A;  4X64 J;  3OJS A;  3Q86 A;  1S1X A;  3R5J B;  2RS2 A;  2VB6 A;  5F8G A;  2D3U A;  5EWE A;  2HRT A;  1IR0 A;  1RBA A;  3AFG A;  1WKJ A;  3HKZ D;  1UZH A;  3M1V B;  1TVR A;  1YI2 S;  5E0O A;  2J9D E;  4WFN Q;  1B0V A;  2GMJ A;  3T5H A;  4QWE A;  1FKP A;  4P6Q A;  2AWZ A;  5K8M A;  4QR0 A;  4ZPB A;  2HVD A;  3NWG A;  4FF1 A;  5HMW A;  1EQ0 A;  4KQZ A;  2DRB A;  1HNZ J;  2G2Y A;  3KLI B;  2V69 A;  1S9G A;  1EZZ B;  4EZ6 A;  4HAC A;  2AYB A;  1LW2 B;  3AXK A;  1YJ7 A;  2XZD B;  2KXH A;  5ETL A;  4YR2 A;  3T1A A;  2D7S A;  3BB5 A;  3M8R A;  3CNQ P;  1N36 J;  4IUF A;  4CH0 S;  3FRZ A;  2F4F A;  5D3G B;  2J5A A;  2GV1 A;  2AEF A;  3RAQ A;  2ZH3 A;  3KTQ A;  1K9M T;  4LF5 J;  3BM7 A;  1G1X A;  4NLX A;  1JXE A;  1VQ7 S;  1JNZ B;  1X4C A;  3UVJ B;  4KTQ A;  3PW0 A;  3HHE A;  3LGH A;  2CPI A;  4GKJ F;  2FLP A;  2Z56 B;  1I94 F;  1TL7 A;  2ZZT A;  2YXL A;  2E1C A;  4DL3 A;  4ZS6 A;  5DO2 A;  4B3M J;  1N54 B;  1RA7 A;  2QLJ B;  2JH3 A;  2IC3 A;  5A0Y A;  4A48 A;  5LJ5 Y;  2PFF B;  5A8K B;  4FPI A;  3HVA A;  3JS9 A;  2IMW P;  1APS A;  4GO5 X;  2ZUA A;  1IKV B;  5DDQ C;  4IH6 A;  3QRP A;  1ZM2 A;  5JJB A;  1WC0 A;  1CS4 B;  4LRA A;  3JQM A;  2GIQ A;  5HAO A;  4KHM A;  5MAO A;  2RDI A;  4PPD A;  4NXM J;  3K5M A;  1KS2 A;  2E7X A;  2HQ3 A;  1FFS B;  3OHB A;  2F9J A;  1R27 B;  3T41 A;  1K1S A;  2ASJ A;  4DPW A;  4CLZ A;  3KHH A;  3QSY B;  1U6B A;  4DEZ A;  4WZM A;  5A6W A;  2MGZ B;  2M4M A;  1WC6 A;  4ID8 A;  4DUZ F;  2AP6 A;  4FP9 A;  3TJA A;  3TVK A;  1HI8 A;  3N6M A;  1Q8K A;  4KO0 A;  4C4W A;  2F4V J;  3BQ2 A;  4WFB Q;  1OIA A;  2HHQ A;  3CTR A;  3VAM A;  1R0C B;  2UUB F;  5KFR A;  4DQQ A;  2KZZ A;  3V6J A;  1NK6 A;  3D9B A;  1PBA A;  2DEI A;  2Z4P A;  5HVF A;  4DR3 F;  1QUP A;  2RNE A;  3OW2 R;  4CNZ A;  2QGF B;  4TU8 A;  4TQR A;  2LFV A;  3SSQ A;  1NZA A;  4PQU A;  4ED8 A;  4M94 A;  4HKQ A;  4B3T J;  1RP5 A;  2HS3 A;  1B3T A;  5L39 A;  4DV4 F;  2IRX A;  5KG3 A;  2E1P A;  4ZK7 M;  2OEK A;  1TL5 A;  1C0U A;  3KLF A;  3FCH A;  5M2P A;  2W2N P;  2BE9 B;  2FJD B;  2ZD1 B;  3VWS A;  3M9O B;  5KFW A;  2R7T A;  1EIY B;  3WZ0 A;  4J5O A;  4CH1 A;  3HHD A;  4M63 A;  4FYD A;  3FNN A;  1LNQ A;  4DQR A;  1ITP A;  3QO9 B;  3MFH A;  3BPS P;  3HHL C;  3GIK A;  1RYR A;  2D3O R;  1IBL J;  1PIE A;  3PHT A;  2VJV A;  4C98 A;  4DR7 J;  4DX8 H;  2EBE A;  5BXI A;  2MKI A;  1NJY A;  1N32 F;  2R8K A;  5E3Q A;  2B51 A;  4RW9 B;  2FC8 A;  1SH0 A;  2G4B A;  2WVF A;  4ED6 A;  2YPZ A;  3QSI A;  4RW7 A;  4ANE A;  2HVH A;  4WZQ A;  3CCW A;  3V4M A;  4ED0 A;  4CLY A;  4DWI A;  4XIU A;  2B4V A;  2IHR 1;  4DV7 F;  2E29 A;  1RU1 A;  1U1O A;  5J2N A;  1WOP A;  1NHV A;  1U1M A;  1NDC A;  1FJC A;  2AZ3 A;  4UOC A;  4KGZ B;  2KXN B;  1NKE A;  1K0T A;  2AYM A;  1NDP A;  4CO3 A;  1ZYQ A;  2WW4 A;  4OX6 A;  2C3O A;  3H2V E;  3JSM A;  2OMO A;  2FY1 A;  3GIL A;  1C1C B;  2DNZ A;  1Y9O A;  2GA7 A;  3UN2 A;  5K8N A;  2I9S A;  1D9F A;  3BBF A;  1OPI A;  2V34 A;  2W25 A;  4L6V 3;  1HA1 A;  4QYR A;  3IM8 A;  2IYI A;  3B6B A;  4FS2 A;  2MZ1 A;  5IC6 B;  2R7U A;  5CXT A;  4YEA A;  4UOF A;  1S1T B;  2YH1 A;  5KFP A;  4PWD B;  1J27 A;  4ZVP B;  2WZ1 A;  5HN0 A;  2YWE A;  1U8W A;  3MUR P;  5IS2 A;  4HYK A;  3J7Y U;  2AIR B;  4K2J A;  4DX7 A;  1NKC A;  2OTJ S;  2J9C A;  4IQX A;  3DLG B;  1S6Q B;  3KNG A;  1KR4 A;  2PGC A;  4OZ1 A;  1D1U A;  5D0R A;  4NYP A;  3KK1 B;  2NLW A;  2OKQ A;  1VRT B;  4KV8 A;  4ZVG A;  4UQT A;  1IVZ A;  1I51 B;  4NI2 A;  3CMQ A;  5GMK a;  4N77 A;  2XB2 D;  1A0O B;  4CLT A;  2EI5 A;  2VG7 A;  4U8V A;  2GC8 A;  1WF2 A;  3OTB A;  3ZZR A;  1R89 A;  4ZP7 A;  2BAB A;  2QX0 A;  5CAB A;  3NXZ A;  3KUG A;  1W26 A;  4LFC J;  1RWP B;  1YBT A;  3TUZ C;  1OQ3 A;  1NB2 A;  3TOQ A;  3JQK A;  2BM0 A;  2DR6 A;  5FDL A;  1VC0 A;  3I4P A;  2C3M A;  4WWS A;  4EUV A;  4JI3 J;  3MCM A;  2CA9 A;  1HI0 P;  1R6Y A;  1HBU B;  2BE2 B;  9ATC B;  4TNO A;  5ETP A;  4CLW A;  4YFU A;  4NCG A;  2LEA A;  3DLH A;  1VQK S;  1KRP A;  3RR7 A;  2KJW A;  1SKW A;  1HHT P;  2V8V A;  3MFI A;  3CO9 A;  4LBH A;  1RLD A;  1VIS A;  2OH2 A;  2HHW A;  3EZU A;  4RR5 A;  4Y00 A;  3KJN B;  2J8S A;  1N52 B;  5KG0 A;  4KBI A;  2HHV A;  3RAM A;  4DX6 A;  2HMI B;  3OLA A;  1JK9 B;  4K5S A;  3P45 B;  3KMQ A;  3FBE A;  5A8R B;  1GXL A;  3M2V A;  4OZ0 A;  1VLY A;  3PEH A;  4JI1 J;  1CC8 A;  3D5M A;  3OQ2 A;  1FXR A;  3ONQ A;  2FZK B;  3T6B A;  1WG1 A;  1TR0 A;  2LYV A;  1IQT A;  3BGF A;  3D0H E;  1M1G A;  3T6J A;  2D3O 1;  1U24 A;  5D8H B;  3EZ5 A;  2XYP B;  4X4Q A;  5KFY A;  1X4G A;  1VRU A;  5F9L A;  1DUR A;  1FDD A;  1T9U A;  2KZM A;  2W2O P;  5KFS A;  1PYT A;  2KL8 A;  2XC9 A;  2ZKT A;  3Q8V A;  1Y5N B;  2DXF A;  1FJE B;  1T9Y A;  3NP5 A;  2E5I A;  2PMH A;  1RAF B;  3PX0 A;  1TKT A;  2VA2 A;  4RWW A;  1S79 A;  2N82 B;  2LEP A;  2DO4 A;  3AQO A;  5K8O A;  2B5J A;  3BEG B;  4UW2 A;  3FUY A;  4OQJ A;  1NK8 A;  1UZD A;  1LV5 A;  3BH6 B;  4NXN F;  4EZ9 A;  4OHY A;  3PIP Q;  3OL8 A;  2I8E A;  4B9M A;  3TAR A;  1NSA A;  2HGL A;  2XS5 A;  1S6O A;  2BZ2 A;  1NRK A;  4XDC A;  5DQG A;  4JYA F;  2VBZ A;  3X1L B;  2CIM A;  2C2O B;  3M2U A;  2V8P A;  2CPJ A;  1EB0 A;  2KXF A;  5I3U A;  2ZBC A;  1KFD A;  4C8N A;  4A47 A;  2OHD A;  1KKH A;  4GVB B;  3GTY X;  1FRX A;  1UA1 A;  2WHO A;  4PRF A;  1RAD B;  5AXM A;  2PO4 A;  3DI6 A;  2EW9 A;  3JTN A;  5BJR A;  3BGR B;  2ZVI A;  1C0T B;  1X5S A;  2DNR A;  2E9Z A;  4ZCM A;  2MXY A;  1JLG A;  1R43 A;  2CVI A;  2JLE A;  4C48 A;  2LEB A;  3NGS A;  4I4B A;  3N0V A;  1UEK A;  4P2X A;  5KT7 A;  2J6U A;  3W8P A;  2CZV C;  4N76 A;  2CNN B;  1SC4 B;  2Q6C A;  5L1K A;  1T03 A;  2VIH A;  1RT4 A;  1RB0 A;  2FVQ A;  2MMY A;  4TXS A;  4MK7 A;  3BR9 A;  3TR5 A;  3MED A;  1T05 A;  3G2X A;  3EX7 B;  2UXC J;  2E1R A;  1RT3 B;  5HQL A;  4YR3 A;  2DB1 A;  4LF7 J;  4ZJL A;  4JI5 F;  4OZ3 A;  2XWY A;  3G4S S;  3OUY A;  1GK8 A;  1N5S A;  3UO0 A;  2NXE A;  1EKS A;  3H98 A;  3DLE A;  1F3F A;  2IM2 A;  3MWB A;  3POT B;  1WHV A;  3DC2 A;  3W66 A;  4HT7 A;  5F8J A;  1RJJ A;  3TO8 A;  3DDI A;  1HBM B;  3QID A;  2ROP A;  2E1A A;  1I6J A;  2ACY A;  4K2X A;  3R5C A;  2A18 A;  5L1J A;  4Y2M A;  4DR6 J;  1HMV B;  5CYM B;  3W9I A;  3I31 A;  5B7W A;  2WCX A;  1CQN A;  2GJF A;  4ZPA A;  2DGS A;  1M90 T;  3AB4 B;  1XMQ F;  3CD7 A;  2CQI A;  3M8W A;  3ICL A;  4B08 A;  4I68 A;  2B0G A;  3M8Y A;  1WEZ A;  3M8P A;  1N33 F;  5IXU A;  4LFB J;  3GG1 A;  2MLY A;  1HBN A;  1W25 A;  3DN9 A;  1RI7 A;  3HM9 A;  1TFW A;  3R5G A;  4DV6 F;  3GB0 A;  5ETO A;  1P1L A;  2HNY A;  3NMR A;  2XS7 A;  4IQM A;  4OHZ A;  3A8I A;  2UVW A;  2B7B B;  3DFE A;  1CJT B;  5E33 A;  2H3E B;  2UU9 J;  4RBU A;  5GAH U;  4WFA Q;  2BJ8 A;  2FUG 9;  4ECV A;  1KFS A;  1SVD A;  2OGU A;  5H9E J;  4TYA A;  4P2M A;  2JLG A;  1N8R T;  1QVF R;  1TQL A;  2J8A A;  3CVK A;  3KJV A;  1ZTW A;  8RUC A;  1X4D A;  2C28 A;  4O3N A;  1NK7 A;  1DLO B;  1S1V A;  2G1H A;  4DR5 J;  1AFI A;  1BWV A;  1HQE A;  3I4H X;  3JQJ A;  2ZBR A;  2YX7 A;  2BQR A;  1HNX J;  1M1K T;  1S1X B;  1WI6 A;  2M9K A;  3ITH B;  3S6E A;  2FY8 A;  3B54 A;  2VG5 A;  5KFA A;  4RUB A;  2NPF A;  1Q53 A;  3K57 A;  1N36 F;  5LXY A;  4OI4 A;  4XTT A;  1QUV A;  3M9N B;  2DYA A;  4R25 A;  4R5P A;  1ZBT A;  4M8L A;  4U6P A;  1BD6 A;  2HPU A;  2HHT A;  4HAC B;  4B9V A;  2QLB B;  2C2M B;  3K8V A;  1RT5 A;  4QR2 A;  2CQ4 A;  5LSO A;  3G8S A;  3NGU A;  5DZ6 A;  4O3S A;  2B6A A;  1F9E B;  1R0A A;  4PCQ A;  4GC6 A;  2E5G A;  5E5N A;  4F8R A;  1YJN S;  5KT6 A;  2JNJ A;  2R7R A;  4M5M A;  4UY8 T;  3THT A;  3T1Y F;  3BPD A;  1WTB A;  2RHQ B;  3SQO P;  3NBP A;  4ECY A;  5GAE I;  4C8O A;  4IOB A;  2CQ0 A;  2XLK A;  4EO8 A;  3CSK A;  3GYN A;  2RF2 A;  3SIP B;  3J81 Y;  1C1B B;  1ZAW A;  3J81 j;  2C2R A;  3CW2 C;  4JV0 A;  1VHI A;  3HMJ G;  2YQ1 A;  5C5J A;  2MYF A;  1LK7 A;  4RX6 A;  2UVV A;  1FO1 A;  1HWL A;  2DK2 A;  5KFH A;  1UWB A;  2DO0 A;  2AX0 A;  2UUW A;  2XLI A;  4KGM A;  3TVZ A;  1HNV A;  3W2W A;  1G6B A;  3BKF A;  3UFC X;  1GMV A;  2CVE A;  2VU5 A;  2BAN A;  3AD9 C;  2F63 A;  5AXN A;  4PUO B;  2IC3 B;  3TUJ C;  4FNH A;  2R42 A;  2VUG A;  4Y2K A;  3GFZ A;  3DHX A;  4X4R A;  4NLY A;  4ZVU B;  1WC5 A;  1RWM B;  2N7C A;  3MM6 A;  5AE1 A;  5JUM A;  5DG8 A;  2W9B B;  3HFV A;  3H42 A;  2FJX A;  5LT5 A;  4XDD A;  4J9O A;  2OP5 A;  1R6V A;  4UOH A;  3SI8 A;  1PAU B;  5CYJ A;  3EIC A;  3AOD A;  2V4R A;  4LFA J;  3QAE A;  2UV8 G;  4OYB A;  5C42 A;  2D41 A;  4JI7 F;  3IAS 9;  1QM9 A;  4L74 A;  5K9F A;  3PO4 A;  3TQE A;  4RL1 A;  1T7P A;  2LQ9 A;  4Q8F A;  2L3M A;  3OT9 A;  1TKX A;  1LWX A;  1UMJ A;  3SFG A;  1DTT B;  1WHX A;  2WSC C;  1Y00 A;  2BE7 D;  2HWI A;  1S48 A;  1WC1 A;  3PYD A;  1LXJ A;  2OPQ B;  2ZH8 A;  3V6D B;  2BW7 A;  4ITS A;  3D7S B;  3LGM A;  2CQD A;  1CJV B;  4ZP6 A;  1B7F A;  1X7V A;  2K7J A;  2P2C B;  3IRX A;  3K0J A;  1HHQ A;  1HNW J;  2NQP A;  3NS7 B;  3G6X A;  3IWX A;  2FHM A;  3HFZ B;  3W5X A;  4PG8 A;  5DGA A;  3KLF B;  1OY6 A;  2XZW A;  2ZOG A;  7AT1 B;  3R5B A;  1V5I B;  3R97 A;  2XM3 A;  2MKJ A;  3R5D A;  3J80 Y;  2BOA A;  2B8P A;  1MMN A;  2BJE A;  2RRN A;  3CCZ A;  2WW8 A;  3KG1 A;  1N6Q B;  2X1B A;  3ULH A;  2E5J A;  3RBD A;  2ABY A;  2B56 A;  1WNE A;  2ILZ A;  5HAN A;  3TWZ A;  1REV B;  1U49 A;  4BC9 A;  4ZLJ A;  4O3O A;  2ZBI A;  4EK2 A;  1TL1 A;  4FYY B;  1IKW B;  3A3P B;  1MU2 B;  3HZE A;  5J1E A;  3C2P A;  3BF4 A;  3PJ9 A;  3MR3 A;  1WEY A;  4C3M A;  2FJB B;  4C8Z A;  4WKY A;  2V6A A;  1Q16 B;  1Y0H A;  2W2M P;  4DFM A;  3C46 A;  1R31 A;  1YSJ A;  1SQE A;  3P96 A;  2ZJR Q;  3ILO A;  5LXR A;  4H4M A;  3FZ2 A;  4USH A;  1RKI A;  3W62 A;  5J2N B;  3FMB A;  1RAO A;  1FKA F;  3QJP A;  4OFZ A;  5GAG U;  1X9S A;  4F2S A;  5L8R C;  2M70 A;  3FEY B;  3IP0 A;  2YKM B;  2M7S A;  1CG2 A;  2YX1 A;  3M6W A;  4NML A;  2R7Q A;  4ZPC A;  3JXO A;  1RAG B;  3T9Z A;  4FNI A;  2UZA A;  4JUZ A;  1SPB P;  4DUY J;  2X3G A;  4YY3 J;  1HBO A;  4C8Y A;  3EGW B;  4OZ5 A;  3C16 A;  5RUB A;  4OV1 A;  2OI2 A;  2OPR B;  4A8K A;  1HQU B;  2A10 A;  4W98 A;  1NH8 A;  4M5D A;  2NUH A;  2DIU A;  2L9D A;  4DV0 J;  3CIM A;  2GW8 A;  4AFF A;  3GP9 A;  3U1N A;  1NJI T;  4K4X A;  2Q3P A;  4IFV B;  4NYO A;  5KG2 A;  1SI9 A;  2Y3Y A;  2B43 A;  5KFX A;  4PZV A;  3UD3 P;  3HHL D;  3N6N A;  3RBZ A;  3A8E A;  3KNA A;  1Q4R A;  2AV5 A;  3R5A A;  2K1R A;  4CYU A;  3M8Z A;  3K59 A;  2FZG B;  1WI8 A;  3ADA C;  5CA5 A;  1KVI A;  3KLE B;  2YNG B;  3GR0 A;  4CM2 A;  3RAX A;  4Z7C A;  1F3V A;  1HWU A;  1QLN A;  5H9F K;  4A46 A;  5J2Q B;  5HVH A;  2MHE A;  1FTC A;  2LU2 A;  2VQE J;  1FE4 A;  3PKM A;  3A8K A;  5IT0 A;  1U1P A;  2LXU A;  4LQ3 A;  1RTJ B;  1O51 A;  1M5S A;  1JKH B;  2ZE2 B;  4JI3 F;  1WAC A;  4NI2 B;  2HRY A;  1RUS A;  3MMC A;  2JZ5 A;  3G71 S;  1CJU B;  3SQG A;  2XNR A;  2GMH A;  2BRK A;  4DL0 C;  3T1H J;  1KON A;  1VJQ A;  1RAJ A;  4ZHR A;  4DQI A;  2DCU B;  2KRR A;  5D4L A;  1MRO B;  1YRT A;  3HD1 A;  2CQP A;  3ZTS A;  4ZCK A;  4FDF A;  4Q0B A;  3MAA B;  2HHU A;  3QZ7 A;  1X9W A;  4R8U B;  3HLU A;  1VQL S;  5FDL B;  3OSN A;  4QCL A;  2WBM A;  3VAG A;  4EBC A;  5F3T A;  3DKD A;  4JI1 F;  2I5J A;  3P6Y C;  2R7S A;  4B3R F;  1N5Y B;  2KG0 A;  3CUL A;  2O67 A;  1DAR A;  3V4I A;  1HR0 J;  4GKK J;  1QSL A;  4OZJ A;  4X4V A;  2ZH4 A;  2M8D B;  2X51 A;  5SUH A;  2WVE A;  2QL5 B;  2O1P A;  3N5F A;  5HO4 A;  2O5D A;  5CAA A;  1D3W A;  4WTO B;  3M9M B;  1NK9 A;  1BMQ B;  3PW4 A;  3PYF A;  1D8Z A;  4RW4 A;  3RB0 A;  1T02 A;  5IT4 A;  5ETT A;  1F9H A;  2CJB A;  3H7H B;  1VIO A;  1JX4 A;  3QPI A;  4GC7 A;  1CJK A;  2D74 B;  2RKI A;  3PW2 A;  3T19 A;  4V19 X;  2KT3 A;  1B0P A;  1VRU B;  5JXS A;  3DOK A;  3MM8 B;  3PY8 A;  1VJW A;  4LF8 F;  2ZC4 A;  4IG0 B;  3ETO A;  3IN5 A;  4M5N A;  2NXU A;  3R3T A;  3ZC4 A;  1V9O A;  3PYG A;  3HDS A;  1FFG B;  3BN4 A;  2CPZ A;  3O8W A;  2OJ3 A;  1X31 C;  3KKF A;  2FHK A;  1S49 A;  1QJH A;  1NJX A;  1RBL A;  4KSE B;  3N79 A;  4RU2 A;  2B5J B;  3VAL A;  1Q8L A;  2W8L A;  3G96 A;  1WDT A;  3MF5 A;  1U6Z A;  2EG1 A;  2Y0S D;  2PEB A;  5D4N A;  2EFO A;  3M1V A;  2HSE B;  1YJV A;  4KHR A;  5IC4 B;  3CWJ A;  3MEG B;  4CTA A;  1SV5 B;  4DDF A;  1EP4 B;  1F5B A;  1RWK B;  3BKT A;  1WOS A;  2A2C A;  1KC8 T;  4Q43 A;  4J7C A;  2XGQ A;  2M2B A;  3F56 A;  2HUR A;  2R7X A;  2MST A;  3BO4 A;  2EFG A;  4ECS A;  3KLI A;  4FS1 A;  3M4X A;  4H54 A;  4PPZ A;  3JSR A;  4I67 A;  4IO1 A;  4K4Y A;  1YBU A;  1LW2 A;  3U7J A;  3DOL B;  5KOX A;  3LQV A;  1M5K C;  4CCH A;  3DI6 B;  5L46 A;  4HI1 A;  4LF7 F;  2M52 A;  4OHX A;  3NCQ A;  4CLF A;  4C0B A;  1NO8 A;  5EN1 A;  3PFE A;  1DBD A;  2WBR A;  3ZZ0 A;  3SCK E;  2DR8 A;  4F4Z A;  3QJJ A;  1Y3J A;  1DTQ A;  2PT0 A;  4ZOS A;  5HVG A;  1RT4 B;  1F9F A;  5LL6 d;  1JLA B;  4DV5 J;  1YK9 A;  4NE9 C;  4DU8 A;  1Z2L A;  4ILL A;  2OEJ A;  1IWA A;  4ILM A;  2HZV A;  4DR6 F;  3HVT A;  3UVJ A;  1N5V A;  3OL7 A;  3LPY A;  4MMO A;  4GRS A;  1CVJ A;  3WQP A;  4C8L A;  4CLU A;  3E2E A;  1H2U X;  4L3N A;  1Y10 A;  3FSI A;  2VFT A;  5CD4 H;  1SJR A;  3CDA A;  3OUY B;  3NNA A;  2FQQ B;  3HCX A;  3C14 B;  3M6V A;  3QZ8 A;  3NOC A;  3HUL A;  4TVA B;  2KH9 A;  2ZH7 A;  2CQB A;  4A4J A;  3WIV A;  3VVU A;  1WSR A;  4NZ0 A;  1SC1 B;  5A8K A;  2VPX B;  2KKH A;  1DRZ A;  2RD5 C;  1RT1 B;  1QSS A;  4FYV B;  3AXM A;  5H1S V;  4GKJ J;  4DS4 A;  1SKR A;  2DNP A;  2GAG C;  1I94 J;  2KDO A;  1MSW D;  5A6P A;  4LF4 F;  4G65 A;  4J9Q A;  2ZJQ Q;  5BYR A;  2CPX A;  5IQ6 A;  2FLO A;  1FRL A;  3I0R A;  2CPH A;  1LFP A;  3M8P B;  4LIR A;  3ZFV A;  1OSD A;  4ECX A;  4DR5 F;  4KC5 A;  2PSZ A;  2ZC3 A;  1IKX B;  2GIR A;  1UEV A;  2D1C A;  2MGZ A;  2RQK A;  1U8S A;  2GO8 A;  3M7V A;  3DXS X;  1M1H A;  1S77 D;  3Q2S C;  1GFW B;  2V8D A;  4UUX A;  3UDV A;  1E6V B;  3GLJ A;  5KFB A;  1WC4 A;  4I0W A;  1CC7 A;  4P71 A;  2RE1 A;  3PR4 A;  3BO3 A;  4OMF G;  2V8H A;  5IOL A;  3TUP A;  2KFY A;  1RHU B;  2D9O A;  3KJV B;  4B9N A;  2P6T A;  3N9U C;  4IH5 A;  3F0N A;  1VC6 A;  2RRA A;  4ZVF A;  1S1V B;  4DG1 B;  4MTP A;  1BHN A;  4NLD A;  3J7Y I;  3TA0 A;  4MKV A;  2F5G A;  4USI A;  4B9U A;  2BJ7 A;  4DUZ J;  3K89 A;  2JVR A;  4PQA A;  4WPA A;  1TL4 A;  4BBY A;  3OXG A;  5F41 A;  2MY8 A;  2HFZ A;  2DJW A;  2KT5 A;  2UUB J;  2Q43 A;  3QO9 A;  1BQX A;  4DR3 J;  1YHQ S;  3PM9 A;  2W2P P;  4OX7 A;  4ECZ A;  3HKW A;  3BSC A;  4DQS A;  4DF8 A;  3R2D J;  3SEO A;  4ZCI A;  1JLC B;  4IDK B;  2HFS A;  2XMT A;  4HDH A;  2FJW A;  4DV4 J;  1Y7P A;  3LWL A;  4RW9 A;  4WU2 A;  3N28 A;  4DV2 J;  1RT5 B;  4OI1 A;  3VGU A;  3WX4 A;  3LOU A;  3D0G E;  1H2T Z;  3MPW A;  1G2E A;  3I56 S;  2B6A B;  4OIX A;  3U02 A;  2CWX A;  3UPF A;  1K73 T;  2LQ5 A;  3IS9 B;  1WEL A;  2ZH1 A;  1K47 A;  4DPU A;  4C8M A;  2VPZ B;  2AJ1 A;  4TY8 B;  2ASD A;  4JP8 A;  3FBC A;  3OD2 A;  1K44 A;  1RHK B;  1RKJ A;  1N32 J;  3V5R A;  1L3S A;  1QSY A;  1GMW A;  2RF2 B;  1LQ9 A;  2ERR A;  2E5L F;  1KVJ A;  3KG4 A;  3AT1 B;  2A1B A;  2WVB A;  2M88 A;  3EJM A;  5IT9 Y;  3M32 B;  1VQ9 S;  3JAM U;  3TAM B;  2JFK A;  1S1W A;  2Y8Y A;  1HNV B;  4LSZ B;  3CIZ A;  4Y2C A;  3W2W B;  1M5V C;  1TUV A;  1T9T A;  1HWK A;  3MR5 A;  4LFA F;  4K4Z A;  1SH3 A;  2BAN B;  4YHH F;  2ILY A;  3CDU A;  3EGN A;  1S1T A;  1YJW S;  2AT1 B;  3LW5 C;  3QMQ A;  1FES A;  4CO0 A;  3THV A;  3HSZ A;  3LAN A;  4WYW A;  1VBZ A;  4FXW A;  2QMW A;  1VBK A;  1DY3 A;  1RSC A;  4DUT A;  2YWF A;  3FBB A;  4LIW A;  4HHJ A;  3DLG A;  4ANC A;  1S6Q A;  1F1B B;  4J9V A;  3KK1 A;  1KHW A;  4WP3 A;  4J37 A;  1VRT A;  1W2B R;  2GHV C;  3GCX P;  3M05 A;  4NCB A;  3AD7 C;  2F7V A;  3D2W A;  4IFY B;  1SL1 A;  3J7Z 5;  1G4C A;  5C42 B;  2BQU A;  4RUC A;  1T9X A;  1CEZ A;  1VLO A;  2MEW A;  1HNW F;  3FJ2 A;  4TN2 A;  1JLF B;  4L73 A;  4JV5 F;  2FHO B;  3LAM A;  3D6T B;  1ROF A;  1TKX B;  2JOQ A;  1QD1 A;  1IN0 A;  2BJD A;  1KLN A;  2MZQ A;  4ZIW A;  2LEC A;  3G9C A;  2FIU A;  3C6U A;  3QQC D;  3U1M A;  3MMB A;  1V5V A;  4LUB A;  4Y0F A;  1MWQ A;  1HBU A;  2DH8 A;  1CUL B;  2BE2 A;  2X7I A;  4NMX A;  4TY9 A;  3HXM A;  3IRX B;  4FXD A;  1LW0 B;  4DSF A;  4DR2 F;  3DRR B;  3RRG A;  2ZDO A;  3FK4 A;  4ELV A;  2M0G B;  2ZZN A;  4CZC A;  2FLL A;  1ZPV A;  2BUN A;  2HMI A;  4JI4 F;  5DQH A;  5L9N A;  2HVE A;  2P9C A;  1GQE A;  1NDK A;  3T3F A;  1T11 A;  5A2Q Y;  3MCS A;  1FHT A;  2RB7 A;  1R8B A;  5A8R A;  4A8F A;  4P2F A;  4S0M A;  2EWH A;  2DR7 A;  5HP1 A;  4DN0 A;  4KFB B;  4E2F B;  2V5H G;  1LKZ A;  3UDC A;  4NEY A;  5HQM A;  2A2D A;  2K3I A;  2CKW A;  2ZOF A;  3NGT A;  1X8D A;  1M5O C;  1OMS A;  1NSQ A;  1RWN B;  4DUY F;  1HWJ A;  3QWP A;  2R8G A;  4YY3 F;  3BDE A;  4Q8E A;  3MPD A;  3QGH A;  4E98 A;  3PW5 A;  1XBW A;  2R2U A;  2YTC A;  2AGO A;  2MKH A;  4C9D A;  4U67 Q;  3AJD A;  2ASL A;  1X4E A;  1RTH B;  3Q23 A;  1ZA1 B;  4RNM A;  5K14 B;  1PO6 A;  4NLW A;  4U7C A;  3FQL A;  3LGN A;  2DHH A;  3Q8P B;  3CDW A;  1ZM3 A;  1DJ0 A;  4JOU A;  1FJG F;  1A7G E;  3CCR S;  1HBO B;  2IBO A;  3FMW A;  3GR1 A;  2YNI B;  3UN3 A;  2BDP A;  1RAA B;  1ZPW X;  3KUE A;  3NL0 A;  3C16 B;  4M5I A;  4IR1 A;  1N5Q A;  1YQH A;  4M5D B;  4PXE A;  2AJF E;  2DGQ A;  2CNO B;  2HIY A;  5HJY A;  1UL3 A;  5F9N A;  2J9D A;  4USU A;  3SSS A;  4W4M A;  4PAB A;  1N88 A;  1XWL A;  1TKD A;  3PEJ A;  3H5X A;  2HVZ A;  3D28 A;  2I38 A;  5GME A;  3TYT A;  3GG0 A;  2CRL A;  4GVB A;  4B3S J;  4QIW D;  5IQQ A;  4ER8 A;  4Y6I A;  4X4N A;  1E6Y B;  2DNY A;  3PVX A;  5GAH I;  3DCA A;  4CYU B;  2Q1L A;  3MCO A;  2WB4 A;  4FVM A;  4NXN J;  2MB0 B;  4OL8 A;  2PFD A;  3OFH A;  4U7U K;  4QZV B;  3BGR A;  3MTK A;  2EVZ A;  1C0T A;  2IAJ B;  2YQ3 A;  2ZHO A;  2ZKU A;  2ZHA A;  4WK1 A;  2HWT A;  3MEC B;  4PYD A;  4O0N A;  1XR6 A;  2AZ1 A;  5I42 B;  5A76 A;  2H5E A;  3KXD A;  3MMC B;  4X62 F;  4ZCL A;  2R8J A;  4EFA C;  3HVW A;  5F8H A;  4K59 A;  4ES3 A;  1Z2Z A;  3SQG B;  4DR4 J;  2XEX A;  2L41 A;  4F3Q A;  4XO0 A;  4BS2 A;  3CD0 A;  4OZ2 A;  4GKK F;  1RT3 A;  4ZHR B;  4G6V B;  1CQM A;  3GJR B;  4DV1 F;  4Q0B B;  4OI2 A;  4OJH A;  4AUK A;  2QFJ A;  1NK4 A;  3N4W A;  4DHV A;  4ES2 A;  2NZC A;  4DFJ A;  4PAA A;  4MIA A;  3L95 X;  2GVD A;  3CJ4 A;  1Q5Y A;  3O2I A;  2H4W B;  1TL3 A;  3JTP A;  4ZN3 A;  4DSJ A;  3POT A;  4X4P A;  4ZVO B;  2G2Z A;  3AA8 A;  3RUB L;  2X3D A;  1HBM A;  3MUM P;  2I5J B;  1D9D A;  3VAK A;  1A6L A;  5T41 A;  3HJF A;  4CP5 A;  3I96 A;  3G86 A;  3G8Q A;  4KIA A;  5FLX U;  2NXC A;  1HMV A;  5CYM A;  2LDY A;  3R27 A;  2V4Q A;  4XPE A;  1OY8 A;  2DGU A;  2V50 A;  2HNZ A;  4HH1 A;  1F5C A;  4MYU A;  3HO1 A;  4R0E A;  5DRK A;  3CME S;  2CFX A;  3RW6 A;  2VPW B;  2MKS A;  3UR0 A;  1WSV A;  4JI5 J;  4CH7 A;  1HNI B;  2AW0 A;  2IBK A;  4FF4 A;  4NLU A;  3Q83 A;  1LK5 A;  3K2Y A;  4P75 A;  3PX4 A;  1JLQ B;  3NWR A;  1R7I A;  1U2F A;  4C3K A;  3QGG A;  2HFV A;  1N34 J;  3VAJ A;  1UTA A;  2ADC A;  3LA0 A;  5KFJ A;  4UF4 A;  3DRS B;  3H8Y A;  4F3O A;  2RDD A;  1BY9 A;  3R1L A;  2Z2M A;  3Q2T C;  4ERD A;  1HLW A;  2P9G A;  5HI7 A;  1CJK B;  1TAU A;  3UI3 A;  3K5O A;  1U09 A;  3QJL A;  4I64 A;  4JB8 B;  3JSY A;  3DOK B;  1KTV A;  2AJ2 A;  2XO7 A;  2QSF A;  4USW A;  3I0S A;  4ZIT A;  2P6S A;  3OTD A;  4URG A;  1XMQ J;  3K7R A;  1JXL A;  3ZO7 A;  5EUH A;  5F8I A;  4WBF A;  2KVQ E;  3HFK A;  3MOZ A;  1F0X A;  2V4J A;  1DLO A;  2X1G A;  5I3Q A;  3DRY A;  2KHD A;  4LRC A;  1ZZF A;  2H54 B;  2CNK B;  3UCG A;  3R6L B;  3RYL A;  4DV6 J;  4I1T A;  1HI1 A;  3NOG A;  4KAI A;  3DLK B;  3FBF A;  2RUS A;  5EHH A;  4KYZ A;  3A1Y G;  1HKA A;  2PEH A;  2LMI A;  3SMZ A;  4ZLN A;  1QE1 A;  5FD1 A;  3ITH A;  4CRJ A;  1EKR A;  3M6X A;  2AX1 A;  4EGL A;  2IM0 A;  2ZBQ A;  4LSN A;  3KMS A;  4USV A;  4CTA B;  3G6Y A;  4KPY A;  2N4D A;  1KN6 A;  9RUB A;  1BXN A;  3HHN B;  4QIG A;  2CPE A;  3IBF B;  2ROE A;  3Q89 A;  4BCA A;  3ILI A;  3MD1 A;  3TI0 A;  1FNX H;  3G87 A;  3PR5 B;  3T5J A;  2YKA A;  3DDK A;  1MNE A;  4CLK A;  1J5E J;  2JEG A;  4C6A A;  1S0O A;  3NG8 A;  4LR8 A;  4DV5 F;  3MR2 A;  3D1Q A;  2FZC B;  1TK5 A;  2CPF A;  3CCQ S;  4XPC A;  1XMB A;  4M5K A;  4ETZ A;  3VQS A;  4N8N A;  3KK2 B;  4F4W A;  4F26 A;  2FJA B;  2XI2 A;  2CQ2 A;  2W9C B;  1K0V A;  3OJU A;  3QT6 A;  2BJ3 A;  4O0I A;  1ZM4 A;  5E3P A;  2DIV A;  3O44 A;  1S6P B;  2FVS A;  1L3U A;  3OTE A;  2YWH A;  4TKT A;  2MZS A;  1DTQ B;  3M8Q B;  5HK4 A;  3EPG A;  2DY1 A;  3WIU A;  4EU0 A;  2IIH A;  3UN5 A;  4B02 A;  4ATN A;  2M5Y A;  2PA8 D;  4NRU A;  4RNF A;  3R7S B;  1C1B A;  1NBE B;  1NPR A;  3OLB A;  3HVT B;  5AE3 A;  4OYW A;  4MH8 A;  2R7V A;  2ZM6 F;  4WXO A;  1VIX A;  1VQS A;  2RML A;  1C4C A;  2AKW B;  3T1Y J;  1PAE X;  4LRF A;  2CAJ A;  3A12 A;  4YB6 A;  4P10 A;  1U7L A;  4G1I A;  1VQ4 S;  4PUO A;  1QY7 A;  1RK8 A;  1WUU A;  1T0T V;  2DGT A;  3O1L A;  2DTJ A;  5F0W A;  3EUN A;  3L3C A;  4AQY J;  2X1F A;  2HQC A;  2B4O A;  2KFZ A;  4V19 J;  1XQI A;  4OJ1 A;  4KT0 C;  4MJK A;  2C2E A;  4BDP A;  4AL5 A;  2W9B A;  1NEE A;  2VON A;  5C7P A;  3MDF A;  1JLB B;  4PG7 A;  1IBM F;  2GGP B;  2GQ2 A;  2Y8W A;  3WHI A;  5GAG I;  3MAH A;  2DGX A;  3I0R B;  4C0O C;  3IO1 A;  2RVJ A;  3R9L A;  2Z30 B;  4D3H A;  3MEE B;  3QNW B;  2IJF A;  5GMD A;  2MZJ A;  4BWM A;  3TAN A;  2VDH A;  4AXJ A;  3VTI A;  4ENO A;  3GQC A;  1H6K X;  4LBI A;  2FPH X;  3D66 A;  4X4T A;  2QTW A;  1DTT A;  1YJ9 S;  3W2V B;  3CJK B;  2DBB A;  1TEL A;  2OPQ A;  3HP6 A;  3V6D A;  3GJT B;  4WYL A;  4CM0 A;  4NX9 A;  3R6G B;  1CJV A;  2HRU A;  2LQB A;  2WTF A;  1H38 A;  4JI7 J;  4LR9 A;  3FC9 A;  2ZNY A;  2C3P A;  3MI7 X;  4J9U E;  5DS7 A;  2CQC A;  5K5M A;  1LFW A;  5KOW A;  1WD6 A;  3D3C J;  2PMW A;  3EGZ A;  1V3R A;  1XTZ A;  4DV2 F;  3BN7 A;  2N7Y A;  2EC0 A;  1SIW B;  1FA0 A;  3F44 A;  5EWG A;  3NRB A;  1RWO B;  3U1L A;  1N6Q A;  5GVQ A;  3NGD A;  4G1P A;  4L3K A;  2VOO A;  3UD5 A;  2GCF A;  1REV A;  3SFU A;  5IWA F;  3VAI A;  3FCW A;  3D1H A;  3H40 A;  4LF6 F;  1IKW A;  2DXE A;  1MU2 A;  1YBA A;  2F9D A;  2XGP A;  5B0E A;  3GIJ A;  1WOO A;  2QO3 A;  3HX9 A;  3CCJ S;  1TK8 A;  2BBE A;  4YDD B;  2IVF B;  2HQI A;  5DET A;  2NUU G;  1ZAX A;  3BSA A;  3ZZP A;  2G9O A;  1H7X A;  4Q5V A;  5M2U A;  3CD5 A;  4F04 B;  5C2G A;  3BGO P;  3MM7 B;  2DNQ A;  2QEX S;  3TAQ A;  2ZUG A;  2DNL A;  2F40 A;  2YKM A;  2GO9 A;  2C2K B;  3H59 A;  4QU6 A;  3TJ8 A;  5IM0 B;  1QDU B;  1XIQ A;  3G6E S;  1B70 B;  1M5P C;  2BX6 A;  1RE1 B;  1NK5 A;  2UP1 A;  2EG2 A;  3EGV A;  3PXG a;  1SKU B;  1T9W A;  3PIO Q;  1X60 A;  2OPR A;  1HQU A;  1FK9 B;  3DOM B;  4X66 F;  3IRW P;  1S1W B;  2OFG X;  1MG7 A;  2DIS A;  2MZR A;  2PE8 A;  4QWD A;  4IFV A;  1TAQ A;  2GQQ A;  2LCW A;  2MKC A;  2UUA J;  4WE1 B;  1JWW A;  3RZA A;  4QQB A;  3GE9 A;  3CCT A;  1IKY A;  2WSE C;  1XK8 A;  1NCL A;  4O4R A;  2VD3 A;  1FCA A;  5LMU F;  3GIM A;  2YPY A;  2OSR A;  3OXF A;  1GNK A;  3KLE A;  1NSP A;  4C2M A;  2IA6 A;  5D0E A;  4K4V A;  2YNG A;  2GQC A;  1I3O B;  2RH3 A;  2MQO A;  2ALZ A;  5J2Q A;  4DL7 A;  5KFF A;  1FNM A;  3BSN A;  3BBC A;  3B8H A;  3GFY A;  3KLG B;  2BRL A;  1RTJ A;  5THW A;  4EBE A;  4IRC A;  5D0G A;  1JKH A;  2YNF A;  2ZE2 A;  1FRJ A;  2YNH A;  3A4T A;  2NR0 A;  2LQ8 A;  1NLK L;  3FSX A;  5L9X A;  4RU9 A;  1CJU A;  2IPO B;  4NLV A;  1NPK A;  1U45 A;  3MM5 A;  1FRI A;  3CCE S;  1VK8 A;  3TZW A;  2EFV A;  1MRO A;  2QMX A;  3ZTO A;  1FWP A;  2N3O A;  3MAA A;  5IV4 A;  4HLB A;  2HHH J;  3D6F B;  5HRO A;  4R8U A;  3S8S A;  1X4A A;  1TKZ B;  3LF0 A;  1SJ3 P;  4WJB A;  3PO5 A;  2VFS A;  2B4P A;  3LO3 A;  4ZLL A;  4ECT A;  1S12 A;  4ZIV A;  3C6U B;  3FSY A;  2UUC J;  3MMB B;  3AA9 A;  1RA6 A;  1R8P A;  2QA2 A;  2EEY A;  1PG5 B;  6AT1 B;  2OLW A;  1N5Y A;  3SSR A;  4ZP8 A;  1PJ7 A;  2C2Z B;  2H5J B;  3FGV A;  4M5J A;  4DS5 A;  2RQC A;  5F0U A;  3UDE A;  2HND B;  1UFL A;  2E7V A;  3MR6 A;  1JMT A;  1GXU A;  3RBE A;  4HHU A;  2CYY A;  5E2Q A;  3M6U A;  1YG0 A;  4CLP A;  1J5O B;  4I6Y A;  5B08 A;  1NKB A;  2XMA A;  4PXB A;  1HWI A;  2K06 A;  1U6F A;  2OUG A;  4LSL B;  4RW8 A;  1RGV A;  3L7U A;  2G1D A;  5HP1 B;  4B3R J;  3G82 B;  1EAR A;  2HIQ A;  5BR8 F;  2BR0 A;  4QPT A;  4JI6 F;  4O4G B;  4CO5 A;  4DU7 A;  4UY8 5;  1OO0 B;  1HPZ B;  3B4D A;  3MM8 A;  3CJT A;  1HIY A;  3B82 A;  4IYQ A;  3W63 A;  4IG0 A;  6FDR A;  4FPR A;  4MKB A;  1OPZ A;  3QFH A;  3FVY A;  4QJV A;  2APO A;  3CJ3 A;  1NK0 A;  4ED3 A;  5DDP C;  2K7K A;  3ET6 B;  3MTJ A;  4OYO A;  5ETR A;  4B3S F;  3HK2 A;  1SUQ B;  2HHS A;  1WG5 A;  1PCA A;  2OD4 A;  3RW7 A;  4YP3 A;  3I9Z A;  2H48 B;  2BAC A;  4K4S A;  5E41 A;  2MDA A;  3PX6 A;  4XK8 C;  2FVC A;  2VAS A;  4I2P B;  1C4A A;  3MHY A;  2Y9H A;  4LF8 J;  2R9L A;  3G8T A;  3MEG A;  1SV5 A;  1AZS A;  1EP4 A;  1SJ4 P;  2IDL A;  3UR3 C;  4RW6 B;  1UW4 A;  2QV6 A;  5FII A;  2I1R A;  1LWE B;  3PRB A;  2Z0G A;  3SV4 A;  2F65 A;  1MMD A;  2AJ4 A;  2KT2 A;  1P1T A;  5CCM A;  4DR4 F;  3BSO A;  4ZPW R;  1VQN S;  2U1A A;  1NB7 A;  2B9W A;  1HD0 A;  3MOJ B;  3DOL A;  2N3L A;  3EVO A;  5FJ4 A;  1VQ8 S;  1BQM B;  1VGY A;  2XTJ P;  4PWU A;  1URN A;  4ED7 A;  4NLQ A;  1I1G A;  1MLA A;  3UCU P;  2ATL A;  1GAO A;  4DCP B;  3HVR A;  2EK1 A;  2CJK A;  3R1H A;  2H5I B;  4PWW A;  4L76 A;  2LLZ A;  4KKO A;  1T94 A;  1Q8B A;  4CQ1 A;  3GSD A;  1JLA A;  2DGW A;  1RZM A;  3KFW X;  5LMN J;  2KO1 A;  3H0P A;  1IR1 A;  4NRT A;  2JC1 A;  2PN6 A;  1YJT A;  4WCE Q;  4IRK A;  5AE2 A;  2OD6 A;  3KG0 A;  2W7A A;  2R2R A;  2IVY A;  4C3L A;  2VQF F;  2QE5 A;  4HR2 A;  1KQK A;  4QIV A;  2OEL A;  3DYA B;  2L48 A;  5E3R A;  3EYZ A;  5C24 B;  5JVH Q;  3ENQ A;  5ETS A;  2PI4 A;  3KHR A;  3C15 B;  4FKY A;  2HG4 A;  2DNG A;  2GVD B;  3C14 A;  1RAB B;  5E3C A;  3OPK A;  1TL3 B;  2CNL B;  2YKN B;  2JWN A;  3OR1 A;  3GU0 A;  2HGN A;  4ID5 B;  2OEM A;  4D3G A;  1QVG R;  3VZI A;  1P27 B;  1KTQ A;  4EMD A;  1N34 F;  3PV8 A;  4HTJ A;  2LU1 A;  2A0F B;  4DL5 A;  3V81 B;  3H90 A;  3JYT B;  2DNH A;  1RT1 A;  2H65 B;  2WOM B;  2IYG A;  5KFN A;  3KYL A;  2VC0 A;  1U2R A;  2CG8 A;  2HNZ B;  3S01 A;  2V94 A;  4LR7 A;  2WRM A;  1YJR A;  1IXK A;  1RAH B;  4CO2 A;  3CDB A;  3D0I E;  1RHQ B;  4I7F B;  3NKY A;  3D67 A;  1WHY A;  1WDD A;  2RSQ A;  4RJV A;  4KGK A;  3CMA S;  3QRQ A;  2AHO B;  1FF2 A;  1IKX A;  4AXI A;  2C22 A;  2E66 A;  3MPY A;  4DLG A;  2V2Z A;  4H4O B;  1LWC B;  2M8H A;  1BUX A;  3ZTP A;  2UXB F;  3TUI C;  2DRD A;  3OTO J;  1KQF B;  4ED1 A;  2B9X A;  3RGI A;  4QYZ J;  2RRB A;  2W7P A;  3DLB A;  4LF4 J;  5HMZ A;  1O6X A;  1FKO B;  3I0S B;  1E6V A;  4O44 A;  1VHF A;  1RTI B;  1RWX B;  2ZHB A;  2GIF A;  4W92 B;  2DNO A;  2A6O A;  1S4E A;  1L5U A;  2V4J B;  1TFY A;  4DG1 A;  3CJQ A;  1HD1 A;  1U48 A;  1UA0 A;  4NA3 A;  4F0M A;  1J5E F;  2KVI A;  2DIT A;  2NZ4 A;  3NNC A;  1S99 A;  2MQN A;  3MCN A;  4U7U D;  2J0W A;  1QE1 B;  1RDR A;  3M30 A;  1WF0 A;  2GNK A;  1N0V C;  4ZJO A;  2HBQ B;  4UT4 A;  4KGX B;  4LSN B;  5M2R A;  2OPS B;  5HBM B;  2R7W A;  4C11 B;  2HWH A;  2CPD A;  2OFH X;  1AUS L;  1SB6 A;  4PG6 A;  3LP0 B;  4A8S A;  3RR8 A;  1JLC A;  2BKP A;  5KFE A;  1HYS A;  1DZ5 A;  2DRA A;  3AOA A;  3GON A;  1UPM B;  4IDK A;  3K5L A;  5EDW A;  2V68 A;  3H5S A;  3HSG A;  5D4O A;  3DLL Q;  5DG9 A;  4AL6 A;  1Q7L B;  2MZT A;  3L7P A;  1PIL A;  4QYZ K;  4QPX A;  3TW0 A;  2ZBP A;  2FJE B;  3AJ1 A;  4ED2 A;  1NSK L;  3DRX A;  2VFR A;  5B0C A;  1JIH A;  2WON B;  1BGX T;  2B7C B;  4USM A;  2DT9 A;  2HYI B;  2CWK A;  3BH7 B;  3PRD A;  3IS9 A;  3GYG A;  2J6T A;  1N0U A;  5KFO A;  3N6L A;  2QRR A;  4I6A A;  2QYG A;  4DOZ A;  1NJZ A;  5A8W B;  2P5V A;  1SJF A;  2OML A;  2VG6 A;  3MMA B;  4TY8 A;  1RXO B;  2LVW A;  4EI2 A;  1V3Z A;  2FJV A;  4AD6 A;  2CJX B;  4AQY F;  4TU7 A;  4DX5 A;  3PCO B;  4C8K A;  2WAQ D;  1YZ6 A;  1UEU A;  2HFO A;  5SZT A;  2YH0 A;  3M32 A;  3CCV S;  3TAM A;  1IUJ A;  2XMK A;  3HHL B;  4ALZ A;  2ZEJ A;  2IY5 B;  3IR6 B;  4UZB A;  3CCL S;  5EGY A;  2D69 A;  5KT5 A;  2JJ4 D;  5AXK A;  4DSK A;  1H3D A;  2H51 B;  2ROG A;  3FQK A;  4BHQ A;  1ZTT A;  2QC3 A;  2YKQ A;  4A8Y A;  4ICL B;  2RT3 A;  3KK3 B;  4ECR A;  2J0Q D;  2RJZ A;  2E5L J;  5BYQ A;  2MTL A;  1VRQ C;  3RTV A;  2GJ2 A;  3V6K A;  2ZIT A;  5F8M A;  4ECW A;  1R0B G;  8ATC B;  4IFY A;  1BLU A;  3OHA A;  3VAH A;  4YHH J;  3IG1 A;  3VR1 A;  3OVB A;  3A3O B;  4IO9 Q;  1RWV B;  1JLF A;  4F50 A;  4AT1 B;  2W7O A;  4RNN A;  1DHM A;  2MHN A;  2PD1 A;  3GII A;  3OFG A;  3SDE B;  1S1U A;  1NH7 A;  3KLH A;  4Q2L A;  1KP6 A;  3LTO A;  2IM3 A;  4MAK A;  4RBV A;  1U4B A;  7FDR A;  5DJB A;  3VGV A;  1YZ7 A;  2CJQ A;  3BO2 A;  3ZXW A;  5J2M B;  1RYS A;  5IFM A;  2OPP B;  1RAI B;  1CUL A;  2YWW A;  3PNI A;  2PII A;  4HDG A;  2DNK A;  3GJQ B;  3IBW A;  1LW0 A;  4P2S A;  5L1L A;  3IR7 B;  3GSI A;  3WC2 A;  4JV1 A;  3DRR A;  4WU3 A;  1UJ4 A;  4JV5 J;  2DR5 A;  4OYA A;  5DZ7 A;  1ACM B;  3LP2 B;  1PYS B;  4EYH B;  2CZ4 A;  4ZDN A;  2RQM A;  4HH0 A;  3VGT A;  4UOG A;  1B7Y B;  1QAY A;  2HS4 A;  3RB3 A;  3RG6 A;  4MFB A;  4WXW A;  3AB2 B;  7FD1 A;  2XY5 A;  4O3P A;  3B78 A;  5F8L A;  1SKS A;  3FFI B;  2WK4 A;  1U02 A;  1XNR F;  1KLM B;  2KB2 A;  3N5B A;  2W4D A;  1TTH B;  2FHJ A;  3OR2 B;  4KFB A;  3C6T A;  5C25 B;  5F3Z A;  3JTO A;  1FEE A;  4P7T A;  4QU7 A;  4DR2 J;  3UNY A;  4U96 A;  4N5S A;  2GHP A;  2CQH A;  2QLW A;  3H2L A;  2DGO A;  1QAI A;  2KTQ A;  2NSB A;  5KT3 A;  3ZTR A;  3GCW P;  3S1T A;  2XY6 A;  4JI8 F;  4LF9 J;  4JI4 J;  4QW9 A;  1G7C B;  2CJY B;  2AGP A;  4KJI A;  5H9F J;  2VHG A;  3CF5 Q;  5DLG A;  4ECQ A;  1RTH A;  3G6V A;  1VMB A;  2DPI A;  5K14 A;  2KFN A;  2UUA F;  1RLC L;  3DXB A;  4RLE A;  3GV5 B;  4P9S A;  4WK3 A;  1JLE B;  5K20 B;  3J7A 1;  1S76 D;  3TEH B;  1P8G A;  1U2C A;  2IA0 A;  2VBX A;  4CO1 A;  3BJY A;  2YNI A;  3PAC A;  1J2V A;  3V2U C;  1TU0 B;  3NS5 A;  3DU5 A;  4OYI A;  2FD2 A;  3T5K A;  4CLL A;  4DL4 A;  2F3J A;  2VZ9 A;  3Q8S B;  2B8Q A;  2J0S D;  3KHG A;  4OJ3 A;  3IM9 A;  4RO0 A;  2H1Y A;  2ZVS A;  2K3K A;  4N8O A;  1IKY B;  1WJ9 A;  3GYX B;  1YKW A;  4YDX A;  1S59 A;  2VFU A;  4MK8 A;  2EK6 A;  2O3D A;  4EYI B;  1RT7 A;  1E6Y A;  2QL7 B;  4ZPD A;  1HHS A;  1FJG J;  1SH2 A;  5JVG Q;  2KJV A;  3NNH A;  2NXN A;  1X0F A;  4BLG A;  1KHV A;  2HQD A;  2CXE A;  4NLG A;  2IAJ A;  3AJ2 A;  2HHH F;  4NEZ A;  3MXH P;  3GZ7 A;  2XMJ A;  2EFN A;  3W8G A;  4C7Q A;  2GX8 A;  4DCJ B;  5KFG A;  3MEC A;  4FYW B;  3W60 A;  2PI5 A;  1X9M A;  2UUC F;  2SXL A;  2YNF B;  4F02 A;  5I42 A;  1XC9 A;  1XNQ F;  2J7W A;  2YNH B;  1RT2 B;  5KFV A;  1WOR A;  2V9K A;  3DGP B;  3TZY A;  4F25 A;  2CUY A;  2BV3 A;  2GS8 A;  4GO7 X;  2CJA A;  2YVS A;  2VDI A;  3MM5 B;  5D0H A;  2AYE A;  5DLF A;  3I9V 9;  3WX8 A;  1XEZ A;  1JXV A;  2ZWO A;  1AYE A;  1A9N B;  2XCP A;  4J9N A;  5HRO B;  3KJF B;  1AA1 B;  4LVO P;  4P74 A;  1FWK A;  3UW1 A;  5GAD U;  4B9T A;  4I6W A;  3RB6 A;  4LJM A;  4CWB A;  4A8O A;  3NCP A;  4X62 J;  1TV6 B;  1PJ5 A;  2UXD F;  1G3O A;  3HT0 A;  2DPJ A;  3QGI A;  1NDL A;  4EBD A;  2DVI A;  2LXF A;  4ZMM A;  4EEY A;  1S9E B;  1FTR A;  2V9W A;  1NAQ A;  2CDR B;  1HQ2 A;  4DV1 J;  4WP8 A;  1O5J A;  2Z2L A;  2R4F A;  3AOC A;  3K17 A;  4ECU A;  1HNI A;  3BBB A;  1AXQ A;  1NM2 A;  2HS0 A;  1DQ9 A;  4AND A;  1JLQ A;  4LRB A;  1OY9 A;  4OX8 A;  4Y2I A;  1IR2 A;  1JJ4 A;  4RW8 B;  2KG1 A;  1KVK A;  3C3L A;  3AAW B;  1OYD A;  3DRS A;  1SC3 B;  3Q8Q B;  4CI0 B;  1IM6 A;  3CXC R;  3PYE A;  1KQG B;  4M95 A;  2KYZ A;  1V6H A;  5HSP A;  5B0D A;  3AH6 A;  1NU4 A;  4JV2 A;  2VFV A;  4HL9 A;  1IJF B;  2JRS A;  1RTD B;  4JI0 F;  2HK3 A;  3CC7 S;  3DDN A;  3H5U A;  3DRP B;  3SBM A;  2CDQ A;  4K0K J;  1SQG A;  4J9S A;  5B0A A;  5KFI A;  3O5T B;  3IC1 A;  5JMN A;  3QLH B;  4YUD A;  3S7R A;  5T14 A;  1Y5L B;  4Z37 A;  3I5B A;  5ADZ A;  1YLX A;  3DLK A;  1FJ7 A;  1U0H B;  1ZM9 A;  3KJQ B;  4AYB D;  1N4L A;  1BQN B;  3M2R B;  4FKX A;  1T3O A;  1H7W A;  2JEI A;  3QT8 A;  1MWY A;  1TUW A;  4DSL A;  3IMQ J;  4OYZ A;  3C66 A;  3D3B J;  2AU0 A;  1X0P A;  3EM1 A;  2K2P A;  1AZS B;  4K4U A;  2B4U A;  5DDO C;  2L9W A;  2VKZ G;  2RU9 A;  3KUH A;  3OV7 A;  3QAU A;  1CLF A;  1OJ4 A;  5KFK A;  5LMN F;  4RUA A;  1FXD A;  3PJX A;  4QIE A;  4ILR A;  4FBT A;  1FNO A;  3KK2 A;  4KPC A;  2B9Y A;  3JAM Y;  1YGY A;  1NHU A;  4F0K A;  2W9C A;  4FVC A;  2ASY A;  4HT5 A;  5HQ8 A;  1T3N A;  4KE5 A;  1B0T A;  2VBW A;  3E51 A;  1KOH A;  1GMW D;  4A8M P;  1S6P A;  2QL9 B;  4OI3 A;  4OX9 F;  4X4U A;  3OVA A;  3FKB A;  2YX4 A;  3M8Q A;  3QFW A;  3BZQ A;  4KKO B;  1B4S A;  1URR A;  4GVL A;  3GMG A;  4DV3 J;  3KDO A;  3QAT A;  2L9N A;  1XMO F;  4B9S A;  3UCZ P;  2C3Y A;  3BYP A;  5LSR A;  2RIL A;  2HFN A;  1IWG A;  4OLP A;  3QIP A;  3UWT A;  4ETX A;  2JX2 A;  5AJ3 J;  2GFF A;  3BR8 A;  1GXT A;  3CCS S;  4IKA A;  4K4T A;  3OR1 B;  1U1L A;  1RT6 A;  1UP1 A;  3PFO A;  4USK A;  4Q7A A;  2ZH2 A;  4OLO A;  1X4B A;  5DGB A;  2UUT A;  3OFE A;  4J9M A;  4B9L A;  2B9E A;  3DMJ A;  3W9J A;  2FVR A;  4MYT A;  2F8H A;  2X1A A;  1LWF B;  3OTO F;  4RZR A;  2VJU A;  4WP9 A;  5KT2 A;  1MN7 A;  5IZH A;  3MEK A;  2ZM6 J;  4KH0 B;  4NCA A;  2P9E A;  3VF0 B;  4N56 A;  2MPU A;  3BV8 A;  4R0J A;  4UST A;  2KHC A;  3LP1 B;  1JLB A;  2EXU A;  2EFP A;  2GGP A;  1S5Z A;  2RU3 A;  3W3S A;  4ZKA A;  2VH7 A;  1JQG A;  4JI2 F;  2C42 A;  5KG1 A;  2J6S A;  3MEE A;  4LF2 A;  2EKN A;  2E9T A;  5CH7 B;  3RRH A;  5HLF B;  2E5H A;  4RUH A;  2KM8 B;  3IR5 B;  3A3N B;  2GVZ B;  3EWG A;  1MML A;  2O01 C;  3W2V A;  5L38 A;  2BKO A;  4NPO A;  1R8A A;  3CJK A;  1LEO A;  2GJI A;  4IR9 A;  3I32 A;  1TZ0 A;  2VPY B;  3FDS A;  4O44 B;  1IBM J;  5KFT A;  4RWX A;  2XMM A;  1WKK A;  3MUT P;  5J1P A;  2CJ9 A;  4NL5 A;  2OTL S;  2Q79 A;  3MM9 A;  3TJ9 A;  4DL2 A;  4RPF A;  1WTF A;  1N5T A;  4FYX B;  2MLX A;  1U1K A;  5T7L B;  2XSJ B;  5ETN A;  1T95 A;  2CQ1 A;  1K1Q A;  3P49 B;  3P4U B;  4X64 F;  1ULR A;  2HLU A;  1OSC A;  4QIF A;  3C8Y A;  3VQT A;  1YDL A;  3M30 B;  1Q81 T;  2XSF A;  1REG X;  1DQA A;  5KG5 A;  4TYB A;  4P52 A;  1FXL A;  4OYX A;  1FE0 A;  1O8B A;  4ZVS B;  2NYI A;  5KFL A;  5CYQ A;  1VCT A;  4I56 A;  4Y34 A;  3EDR B;  1OWX A;  4O23 A;  4L75 A;  4CIO A;  3PZP A;  1X4F A;  3ISN C;  1HYS B;  3HD2 A;  4OI0 A;  2ALY B;  2XBP A;  3ZNJ 1;  2NS1 B;  3HT3 A;  3Q8U A;  1PGZ A;  4UUW A;  1WC3 A;  4F0H A;  1R8H A;  1HNZ F;  5HL7 Q;  1FRH A;  2Z57 B;  3OFF A;  1SJQ A;  4A8Q A;  2V0N A;  5D6G A;  2XZT B;  5KFZ A;  4PG4 A;  3CO0 P;  2W4C A;  1XR5 A;  2G0J A;  2HBZ B;  3MM7 A;  2BM1 A;  1TVR B;  2YKP A;  1VBY A;  1RWU A;  2Q66 A;  5IWA J;  2EC2 A;  1DAX A;  1S97 A;  3ZTQ A;  1PBU A;  1FKP B;  4OJG A;  4H4K A;  2VG6 B;  4LF6 J;  3W65 A;  4OV6 A;  1FT8 A;  4LF5 F;  1H0H B;  5DM6 Q;  3FEZ A;  1HW9 A;  3GIR A;  5IM0 A;  2GAH C;  3EXY A;  1S9G B;  2DD8 S;  3ZZY A;  3KDN A;  1L3T A;  3DLJ A;  3ETM A;  1RU2 A;  4KHP J;  3EVM A;  3TA1 A;  4BWJ A;  2EKY A;  1S72 S;  2COL A;  1FK9 A;  3DOM A;  3I6P A;  5H9E K;  2HZC A;  3EXC X;  4E8U A;  1RHM B;  2KU7 A;  4WE1 A;  2BA9 A;  2DH7 A;  4B3M F;  2QG9 B;  3I87 A;  5K8P A;  4J9R A;  4QR1 A;  3CC4 S;  1R3N A;  2YWK A;  3R2C J;  1TMM A;  3TRG A;  5KTQ A;  4K8R A;  3RB4 A;  4LRD A;  4M5L A;  2Y1R I;  4PKD B;  4MIW A;  1UPP A;  4CLS A;  1XER A;  3NLC A;  3CB4 A;  1Z1Z A;  4FF2 A;  4CT8 A;  2KM8 C;  3IWN C;  1UFK A;  3QRR A;  1SCJ B;  3KLG A;  4X66 J;  2YQ0 A;  4QOT A;  4X65 J;  3H20 A;  2BXJ A;  4ZN1 A;  8AT1 B;  3EPI A;  1PC4 A;  3VAF A;  3CD6 S;  1TL7 B;  3VGS A;  4NXM F;  2FGO A;  2ZFH A;  3IG1 B;  5LM7 E;  4KH1 B;  3JB9 k;  2HLT A;  3AOB A;  3GFH A;  5LMU J;  1EET A;  1NME B;  3ILJ A;  5FLX Y;  5A0Y B;  3TVY A;  2KI2 A;  4YB1 P;  1NUE A;  4DPX A;  1UW9 A;  4LVN P;  1S1U B;  4OI6 A;  3H4B A;  3KLH B;  2LA6 A;  1TKZ A;  4M5G A;  4QBU A;  2F4V F;  1Q5V A;  2R8H A;  1ZA2 B;  2JEJ A;  2V67 A;  4U9R A;  2VBY A;  3CGI A;  5F8N A;  3W5Y A;  3ZZZ A;  4F4A A;  2WVD A;  2AF6 A;  2DY9 A;  1RQ0 A;  3BQ0 A;  4B3T F;  2MLZ A;  4ZVH A;  4DL6 A;  2ZNZ A;  5KG7 A;  5KFD A;  2MQP A;  3TZZ A;  2E44 A;  2HND A;  3WBZ A;  1EX8 A;  5DG7 A;  4NAS A;  2Y1L B;  4C97 A;  3F73 A;  3NMA A;  4KO0 B;  2FYX A;  2H4Y B;  2DH9 A;  2QT7 A;  3FEX B;  4LF9 F;  1UVL A;  1J5O A;  4MFB B;  4DSI A;  5AT1 B;  4LSL A;  1F5A A;  3PG9 A;  4WFZ A;  2WVC A;  1S9F A;  1YRU A;  4TU9 A;  1RBO B;  1BE4 A;  1JJH A;  1ARO P;  4PQU B;  3G82 A;  1IBL F;  2GHW A;  3C6T B;  2ZJP Q;  5E7O B;  4LF1 A;  5KFM A;  1TUG B;  4DR7 F;  2HK2 A;  3TEG A;  1U1R A;  2HQF A;  2D3Z A;  4O4G A;  4O3Q A;  3LH2 S;  2QLX A;  1C0U B;  1HPZ A;  1FDB A;  3OL6 A;  4DFK A;  2DXD A;  2Z58 B;  3MPU B;  3A8J A;  4OHW A;  3GWC A;  1IBK J;  2MQ8 A;  3DM2 A;  1S57 A;  4QWA A;  3ET6 A;  4PXC A;  3M8S A;  2FTR A;  3W7B A;  2DGV A;  4FXV A;  2QN6 B;  3D68 A;  2XY7 A;  3PJW A;  2E7W A;  4K5R A;  5BR8 J;  1SUQ A;  3Q22 A;  4G1Q A;  3T5L A;  1SL0 A;  3E01 A;  3F41 A;  4JI6 J;  3JSB A;  2ZWP A;  1CPZ A;  4I2Q A;  1H98 A;  4Z7Y A;  4I2P A;  4RNO A;  3SZ2 A;  4DR1 J;  4RW7 B;  3FRY A;  1VC5 A;  1VQM S;  5KT4 A;  5IV3 A;  3CUN A;  3OBI A;  3LPE A;  2XO6 A;  3VHQ A;  4RW6 A;  3D4J A;  2LXI A;  4ZVE A;  2AJ0 A;  1LWE A;  5EX0 A;  2R8I A;  3D6H B;  3TNV A;  4U95 A;  3VZH A;  3D54 A;  3TAP A;  2G0I A;  2Y1J A;  1QAX A;  1S4F A;  3UD4 P;  1RT7 B;  5DDR C;  2V2V A;  3IA0 A;  3GV8 B;  2CQ3 A;  1D8Y A;  3JSM B;  1Q7Y T;  4P7V A;  2QA1 A;  5J2P A;  1GTE A;  2I2Y A;  1VYA A;  4Y3C A;  1BQM A;  1VQ6 S;  5D78 A;  4FZV A;  4PEO A;  4ZPT R;  3KLV A;  4USJ C;  1AT1 B;  2OO4 A;  3NEK A;  3LWM A;  1NZ8 A;  4LT6 A;  2OSQ A;  4ZPV R;  1KDN A;  3CJ5 A;  4NLS A;  2RAQ A;  1FEH A;  3HI9 A;  1Y4Z B;  4CO4 A;  2CZ9 A;  4PXD A;  1HL6 A;  3W64 A;  2VKR A;  2IM1 A;  1GTH A;  4NZ7 A;  3BYR A;  3BQ1 A;  3B4M A;  4ZA1 A;  1YJU A;  3UE2 A;  3I82 A;  3RRK A;  2IJN A;  1AB8 A;  4P72 A;  4B17 A;  4NLP A;  2HBY B;  2Q6B A;  3J81 U;  1PKU A;  5HMX A;  4LFC F;  3DYA A;  2XI3 A;  2NCK L;  3MMJ A;  5C24 A;  3VVT A;  4ZP9 A;  4KY3 A;  2GZO A;  3ELH A;  3C15 A;  4IG3 A;  4O3R A;  4NOH A;  2XUL A;  2YKN A;  4KV8 B;  4IOA Q;  3HPO A;  4ID5 A;  1UFW A;  2FGC A;  1P9Y A;  1X5T A;  1X4H A;  2AD9 A;  1L3V A;  1F2H A;  3V81 A;  3CJ8 A;  1UVM A;  2MSS A;  2VC1 A;  2XMW A;  4GMK A;  4DBQ A;  2NSC A;  2KRB A;  3JYT A;  4YR0 A;  2VG7 B;  2MJU A;  2WOM A;  2XG8 A;  1UVK A;  1FDA A;  1FDN A;  3TX8 A;  3X3U A;  2VQF J;  4EO6 A;  1EJ7 L;  1Q79 A;  2BMB A;  3CJR A;  5G0R A;  4ED5 A;  4I7F A;  2FB0 A;  3KHL A;  1LOU A;  2J0X A;  2RS8 A;  2R2S A;  4K0K F;  2HAI A;  4W90 B;  3D6M B;  2XMV A;  1Y3K A;  5LSL A;  3HF5 A;  5DM7 Q;  4JBC A;  4EWT A;  3W1Y C;  1W2I A;  1QTN B;  1KOO A;  2XS2 A;  3CDE A;  5ETM A;  3ZZO A;  3MAQ A;  1VR6 A;  3HJV A;  5L1I A;  5CCL A;  4H4O A;  1LWC A;  4NCG B;  5CD4 A;  4HHH A;  4DPT A;  3MZI A;  2RDJ A;  2ZZM A;  4A8X A;  5DQI A;  4J90 A;  5B0G A;  4BC7 A;  1SL2 A;  3I5C A;  2UVU A;  1FKO A;  1TK0 A;  4V1A k;  4P73 A;  1RTI A;  4IRD A;  5I4M A;  4NLT A;  1S10 A;  4QWC A;  2FVP A;  3ZZU A;  3V6H A;  4YOE A;  1S7I A;  3AY0 A;  4DJB A;  4Z2X A;  4X4S A;  5KFC A;  4B3O A;  2LP4 A;  3M2V B;  1IBC B;  3QT5 A;  2WB1 D;  2XNQ A;  3HSJ A;  2EPI A;  4LRE A;  2DHA A; 
#chains in the Genus database with same CATH homology
 2NZC A;  2CAJ A;  2BJ7 A;  2BJ8 A;  1Q5V A;  2WVD A;  2WVF A;  2WVC A;  3BKU A;  3QSI A;  1Q5Y A;  3LGH A;  2HZV A;  3OD2 A;  3PHT A;  2WVB A;  2HZA A;  2CA9 A;  2F1F A;  2BJ3 A;  2PC6 A;  2WVE A;  2FGC A;  2Y3Y A;  3BKF A;  2BJ1 A;  3BKT A;  2BJ9 A;  2CAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...