1Q5YA

Nickel-bound c-terminal regulatory domain of nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
TQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Nickel responsive regulator
total genus 26
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5yA00
3QSIA 2WVEA 2WVCA 2F1FA 2BJ3A 2BJ8A 2WVFA 2BJ1A 2HZVA 2WVBA 2CA9A 2Y3YA 3PHTA 3BKTA 2FGCA 2BJ7A 1Q5VA 2HZAA 2PC6A 1Q5YA 2CADA 2CAJA 2BJ9A 3LGHA 3OD2A 2NZCA 3BKFA 3BKUA 2WVDA
chains in the Genus database with same CATH superfamily
3J7AN 5KG5A 2QLFB 3I82A 2ZDOA 1B7YB 3EVMA 4RPFA 2WVFA 4FYYB 4RLEA 1OY9A 2AP6A 4I64A 2GQ2A 4ZJOA 4URGA 2QYGA 3OLAA 2R7WA 1U0HA 2OH2A 5A8WA 2Z30B 4LF9J 3QRRA 3KNAA 2BUNA 4CTAB 2C2EA 4EO8A 1ULRA 5KFMA 1B7FA 2B43A 2CJKA 4USJC 1QAJA 2CNNB 3CJKA 1TV6B 5KFNA 1YZ6A 4NMLA 3KHHA 2M9KA 1HQUA 1YJ9S 1MSWD 1GH8A 1VBYA 2COLA 3QGIA 3TUIC 1H7XA 2PC6A 4UY8T 3QLHB 3Q8PB 2JRSA 2D9PA 1KLMA 3GONA 3NG8A 2XTJP 2CPZA 1FDNA 1KOHA 3HVTB 4WJBA 3QLHA 1HHTP 3KFWX 4M63A 3OV7A 3I31A 3Q8UA 3EXCX 1T03B 1PGZA 4QR1A 1WI8A 2BZ2A 3BREA 3GJTB 2HIQA 3SCKE 4PQUA 2D3ZA 3PZPA 5HLFB 2GIQA 4B9LA 2R7XA 2HWIA 3FSXA 1XWLA 4CIOA 3FSIA 2GHWA 2DPIA 1S1VB 1TK5A 1V3SA 1XJWB 1AYEA 3GMGA 1RBLA 3AFGA 3RR7A 4YY3F 4IDKA 1K9MT 1YJRA 5A8KA 2CPIA 3LGMA 2W9CA 3UCUP 4DR1J 1EP4A 1SJRA 2DHGA 3JTOA 4B9SA 2FVCA 3MPDA 2CNOB 2B5JA 2J0WA 2RB7A 3EVWA 3P8BB 4TKTA 2PMZD 3NLCA 4DU8A 3NBPB 3ZTSA 3AHPA 4PG6A 3FMWA 4WP8A 2OFGX 1S1WA 1M0SA 6FD1A 1I5OB 4ZP6A 2DXFA 2J76E 1T3NA 1JLBA 2CUYA 1PC4A 2WAQD 3QWUA 1YIJS 5L1LA 1JX4A 3UDEA 4QR2A 3D1HA 4DX5A 4JI2F 2MSTA 4X4RA 3KK3A 3MTJA 1JLBB 2CDQA 2DD8S 4FP9A 2AGQA 3HHNB 2RIJA 5FIIA 4NCGB 4KGMA 2IVFB 1BQMA 2KJVA 2YX7A 3T1HF 1X31C 1GMWD 4DHVA 4X4VA 3VAJA 4K5SA 1CJTB 4YDDB 4I2QB 2GQQA 4NRUA 4ZVSB 3SSSA 1FRMA 2Y8WA 3CCUS 3Q2TC 1K1SA 1S76D 2MZQA 4QWEA 1IM6A 3HCXA 3IWXA 4ECVA 1TL1A 4ZJQA 1GTHA 2BMBA 1S9GA 1Y00A 2DGOA 3GFZA 2DH7A 3TW0A 4B9MA 2R7TA 4B3RF 3QIPA 2V69A 3G6YA 4ZOSA 1S6PA 3VGSA 1S12A 5KG3A 2ALYB 2HHPA 4J37A 2ILYA 2GHVC 3FMBA 4YQWA 2W9BA 3D67A 3W1YC 2MQOA 1EQMA 2AYEA 2H5IB 5CD4A 3K5PA 2GMHA 1S6PB 5G0RA 4JV2A 4JV5F 4UOGA 2B8PA 3B6BA 1HBMA 4DSEA 3OR1A 3TVYA 4X64F 1VK3A 3EGVA 3FBFA 1VCTA 2BJ8A 2WONB 2DNRA 3LO3A 4QWBA 5C25B 2KG1A 2E1PA 2HQCA 4OI2A 5EUHA 5KG6A 4J9UE 4K4XA 1JJCB 2W7OA 1R0AB 2E44A 2GZOA 2GJ2A 1VQLS 2E9ZA 2IM1A 2W25A 2J7UA 5J1NA 3SEOA 3TAPA 4IKAA 4C4WA 4F3QA 1UVIA 4EMDA 3GYNA 3PV8A 1S0MA 5DLGA 1U7LA 4N8OA 2M8DB 5KFWA 2Y9HA 1Q16B 2YQ1A 4LBIA 4WXWA 4L72B 2RRNA 2UUTA 4DV4J 3QGHA 2LEAA 5IV4A 2GV1A 3C6UA 1A0OB 2F65A 5KFRA 1AROP 2QLJB 3IAS9 1HIYA 2VU5A 3LAKA 4RZRA 4CM0A 4ER8A 1YJNS 4L75A 5CXTA 4I7FA 2GMLA 5IV3A 4Y28C 3PKYA 4I56A 4CO1A 1HYSA 3DRSB 3EXYA 3KDOA 2WW8A 3KLIB 1KQFB 3VHQA 3PNIA 3H4BA 4B3OA 3M32B 2D41A 2W9CB 1O8BA 3QJLA 1SJQA 4QIVA 1Z1ZA 4QIFA 5KFIA 1B64A 3IRXA 1NB7A 2J9DA 3WC0A 2MYFA 2BEFA 1X4GA 5I4MA 4LSLA 2ASYA 1O6XA 2GC8A 2MSSA 4P73A 3ZNJ1 1LWCB 4J9MA 2KXHA 5DGAA 1WTBA 4NWBA 1WG5A 1RAAB 2YKNB 3FJ2A 3TP2A 2IA0A 1PO6A 4Q5VA 1HD0A 4CP5A 4LVOP 2VZ9A 4QR0A 3H42A 5C42A 3M2UA 4CO3A 1ZTTA 3O1LA 3GZ7A 2P2CB 3BBFA 3D2WA 3PVXA 4DLEA 1HARA 4DSIA 4AYBD 2RS8A 1DAXA 3RBXA 3W9JA 4EYHB 2HMIA 1RTDA 1U8WA 2U2FA 4ZPWR 4E2FB 3QGPA 3DDKA 3R97A 4CCHA 2E5IA 2DHXA 2GO8A 3Q2SC 4IG0B 3CD7A 3HULA 3NWRA 2PD1A 3ITHA 3OXFA 2K3IA 4MFBB 3C6TB 3LP0A 1D9DA 4QYZK 5F0UA 2B56A 1QSLA 5CQGA 4ZPVR 1FXRA 3G4SS 2HNZB 2QSWA 4RNMA 3OW2R 2DB1A 2ZH9A 5H9EK 4NLRA 3NCRA 4G65A 1BQNB 1ZM9A 4DXLA 1CQNA 1JLAB 3DOMB 3RW7A 5FLXU 3BN7A 3NGDA 3MMCA 1NZ8A 3DOLA 2XLKA 1SL0A 1RAFB 1T0TV 2Y0SD 4UOFA 4RNNA 3IRXB 4DN9A 3HPOA 2QV6A 2BW2A 1LW2A 1WORA 2R42A 1BMQB 1RCOB 4PCQA 1SC3B 2BX6A 1YJUA 3I96A 4ZPBA 5DZ6A 2A1BA 3RAMA 2ZKUA 3PKMA 3K5OA 4FNIA 4F50A 3V6DB 1NJYA 1FJ7A 4A8OA 2F9JA 3ISZA 4KB7A 4NPOA 3HSJA 4NMXA 3DRRA 2HZVA 5D0GA 1P6TA 9RUBA 1SH3A 1KN6A 3DGPA 4H4KA 4K4SA 3PX6A 1R0CB 4I6AA 4UZCA 2HNDB 2GA7A 3IGVA 2LQJA 2AQ4A 2HQFA 3AD9C 4MKAA 5A2QU 3CF5Q 1E6VA 1F5AA 1T7PA 2MQNA 4DR4F 2CQHA 3MMBB 2MGZA 4O4RA 1VQ9S 2YQ0A 1UP1A 2H51B 1E6VB 2EFNA 5D4LA 4P72A 2L08A 1TQLA 2HLUA 2E66A 3UWTA 2KHCA 1K44A 1YHQS 1F2HA 2GVZA 2ZWOA 4A8QA 2ZH7A 4CH0S 2J0QD 4KT0C 3TZZA 1QM9A 5B0EA 1NK9A 1U25A 1SUQB 2RF2B 5GADI 1BLUA 1H74A 1WEYA 2PE8A 4TNOA 3TZYA 4YHHJ 2V5HG 3OQ2A 3KLEB 1PAUB 3CW2C 4JI8F 4I68A 2DCUB 4EK2A 2BDPA 2B9XA 2YKNA 4DOZA 3PYGA 2CQCA 3DLEA 4PEOA 2V4JA 5ETSA 2F4FA 5ETTA 2RU3A 1N88A 2YWKA 1HWKA 1SV5A 1PYSB 5J2PB 3AB2B 1X4EA 4G6VB 2UV8A 2DK2A 3J7YU 2MQMA 2OJ3A 1O5JA 1IKVA 2QX0A 4HT5A 2QL5B 1YJTA 4LR9A 2LU1A 4WTYA 5DGBA 2EC0A 4RW8A 1C0TB 2R7QA 3HD2A 2YKAA 2UP1A 2CZ4A 4PYAA 4WE1B 2VBXA 1KSPA 3QAUA 1MWQA 4RBTA 1VBXA 4DR4J 3RRKA 4F4WA 1O51A 1Q79A 1SI9A 3W2VB 2AYGA 3N5BA 4B3TJ 3L7PA 4C9DA 3HLUA 4USVA 3MAAB 2KHDA 2BANB 5C2CA 3ILJA 1GXLA 2EI5A 1U1RA 2VG6A 4KKOA 5J2MB 4KBIA 2FQQB 4DSFA 4B9TA 4FXWA 4PXCA 2M0GB 4IFYB 3TVKA 3K8VA 3W65A 4DEZA 1YGYA 4F25A 7FDRA 3K58A 2ZH3A 4DFJA 4A8MP 1U1NA 1PCAA 3CJ5A 2I1RA 3BPSP 2GX8A 3CJ8A 2B0GA 2BKOA 2WRMA 4ID8A 4NI2A 4BHQA 4J9RA 1L3UA 3CC2S 4RU2A 1R27B 1WG4A 2J8AA 3ENAA 1T05A 2Z58B 3LGNA 2IMWP 1C0UA 3ENVA 3OVSA 2GO9A 3TI0A 5J1EA 4OZLA 4RWXA 2CWXA 3BQ1A 3MR6A 1PJ7A 2G1HA 2AWZA 3QFWA 3A3PB 4H4MB 1VQ7S 3HXMA 4DPWA 2HHUA 5HAOA 4G1QA 4Q2LA 1YSJA 4YR3A 4DR3F 2I6WA 4ECTA 4NLDA 4O44A 3N79A 1R8HA 2VQFF 5D3GB 3VALA 4OYWA 5EWEA 4YMEA 4DDFA 2HBRB 3J81Y 5HROA 4OJ3A 3CIZA 2JHEA 2GVDA 4ZVTB 1Q8KA 4K2JA 2ASLA 2UVRA 2FC8A 4WYLA 1NRKA 2CWKA 3PXGa 4Y2CA 4I6YA 3VZHA 3A8IA 1VQ5S 2VICA 1Q4RA 2DO4A 1N5VA 2L41A 4X4PA 1HMVA 3BH6B 3M6WA 3MCSA 1DQ9A 2ATCB 1U0HB 4WFNQ 4RW8B 2K1RA 2NYHA 2R4FA 1S6QA 5KG4A 4RNOA 3DU6A 1IVZA 3D7SB 2IM3A 2YNIB 1FD2A 4E8UA 4Y34A 4E0DA 3W66A 1AUSL 2DIUA 3NXZA 1B0TA 1UJ5A 3HDSA 2IHR1 4Y2KA 3S01A 1ZPWX 2O3DA 3TJ9A 3PIPQ 4DQSA 2DNQA 2HSEB 5CYQB 5HMZA 2YKMB 4ENOA 2RD5C 3O8WA 5KT7A 2QA4G 3TZXA 5G0RB 4OV6A 1S9EB 4NX9A 1U0SA 2F9DA 3W8PA 2P9CA 1I94F 4FN5A 4BWMA 2IM2A 3IMQJ 4URSA 3QZ7A 4JP8A 3H40A 2AD9A 3HVWA 4P7VA 1KFSA 1U6BA 1AW0A 2U1AA 1WJ9A 5AXNA 1T3OA 2AZ1A 2OD4A 3O5TB 2CQBA 5HLFA 2AJ2A 1LOUA 3BJYA 2DRAA 1SQFA 4FVCA 3S7RA 4ED1A 3HJVA 3P3DA 2EEYA 2MEWA 4AT1B 1VLOA 1MMLA 1GTEA 1RA7A 1LFPA 5KOXA 2FB0A 4KHRA 4MYTA 1P27B 5L38A 5L1IA 1H38A 2B4PA 2WOMB 2V9WA 5IT9U 3K59A 1XMOJ 2ALZA 1VRTA 1F6TA 2A18A 4LSZB 1NH7A 2FHJA 4FPRA 4RW4A 2ZZMA 3M8QA 1MLAA 1W2BR 2H4YB 3R1LA 2KZMA 4CO4A 2Q3PA 1FERA 2LA4A 5DM6Q 1M1KT 3P49B 3FBBA 3C2PA 2W24A 3MAQA 3BZQA 2DHHA 4ZHRB 1LWFA 1NPKA 1TTHB 3HI9A 1LXNA 2IY5B 1DLOB 1FDDA 1SCJB 2LQBA 2MZTA 5IM0B 4GVBB 5KFXA 1AXQA 2DY9A 4HEA9 2H9ZA 2XGPA 5KTQA 3MURP 4V19X 1C2PA 3A8EA 3SFUA 2C42A 4FF3A 4KGVB 3W2WA 1RWUA 2XGQA 2C3UA 2V50A 3UW1A 8ATCB 3BQ2A 1TFWA 3CJTA 2V67A 3DN9A 2ACYA 3MECB 4A48A 4ZJLA 1AZSB 1E6YB 4IO1A 4FS2A 2D3O1 3OTDA 3SDEB 2VG7B 3NNAA 4OYPA 1NSKL 4JUZA 4MKVA 2BACA 4P9SA 1IBMF 2DEIA 1HNZJ 2EBEA 2WBRA 2W4CA 3CJQA 2J9CA 4RUCA 3L7OA 5SUHA 2KM8B 3T1YJ 5I3UA 3DOKB 2HRTA 2OPPA 2Z2YB 2PI4A 2B6AA 2IRUA 2BJDA 1U1OA 2F3JA 2G2OA 3NRBA 3P5TL 4C3MA 2ZBIA 1V3ZA 4MFBA 1KDNA 4LQ3A 3GTYX 4RU9A 1T8EA 5DDQC 4YY3J 2CJYB 3N6LA 2H54B 4J9SA 3RGIA 1I6JA 3LWMA 4MTPA 3QT7A 3UVJA 7AT1B 5KAKA 2NLWA 3JQMA 4AQYJ 4ZPDA 5KFHA 3HP6A 4X65J 3GCXP 2CNLB 1UFLA 3R2DJ 4R8UA 3OFGA 1ACMB 1KHVA 3KUGA 3BKTA 3CT9A 1TKTA 1RDRA 3ULHA 3MEDA 1N4LA 4BS2A 1EHWA 1RTIB 1TUWA 2ZZTA 1VC0A 1TK8A 1IKYB 4PZVA 4MK7A 2WZ1A 1FDBA 1TL4A 2FZKB 3CXCR 3ZZ0A 1DURA 1WWHA 4QIWD 5LOQA 5H9FK 2EKYA 2YPYA 1IJEB 2E1CA 2DGWA 2RQCA 4M5IA 2UUBJ 3SDEA 4U67Q 1JJ4A 1SV5B 2B7CB 2JEIA 2L9NA 2ZVIA 3I0SA 2AX0A 1M5SA 4OYOA 4LFAF 2OGUA 3IR7B 4TN2A 2DGUA 2FHOB 3LPYA 1XMBA 3NBPA 4OJGA 2PA8D 5IOLA 3KWMA 3LQVA 5FDLB 2LFVA 1QTNB 2XMJA 4FNHA 1S48A 1LWXA 5KFBA 2BQ3A 1R0BG 2D7SA 1CJVB 4XIUA 3LF0A 1L5UA 2I5JB 4JI3F 3R7SB 4PQAA 2ZJRQ 2HW3A 3AOAA 3CDBA 1CULA 1UW9A 2Q43A 3CTRA 3N01A 3QO9B 5D0RA 4N41A 2HMIB 3QMQA 3ETMA 3OJUA 1D3WA 2BJEA 2OKQA 3FSYA 3GG1A 5B0CA 3I9ZA 4NE9C 3EGNA 4ECSA 2VA3A 2PFFB 3KYLA 1VFJA 4CLWA 1BE4A 4DWIA 2DO0A 3HHLB 3N5FA 1S1TB 1WHXA 2P6TA 2Z2ZA 3FBCA 2Q79A 5DDOC 1HPZA 3H59A 4LF6J 1RWVB 3HZEA 3TX8A 3GWCA 3PM9A 1S1TA 5A6WA 4EFAC 1U1PA 1F2GA 1KKHA 4GO7X 2KXNB 1MROB 4FDFA 2YVSA 1FWLA 5E3AA 1IJFB 1YDLA 1FXDA 3L3CA 5I42A 2DNNA 2N7YA 2CQGA 3MPVA 4H4MA 3VGVA 3I55S 3KHRA 1X0PA 4J5OA 3HO1A 2WB4A 2JH3A 1QVGR 1XNRF 1X5TA 4ILMA 2DNLA 2KB2A 3C16B 4DQRA 4OZ1A 3K0JA 1F5BA 3NEKA 2WSFC 2VG6B 3BEGB 2RSQA 4KKOB 5BYSA 2DITA 4IRCA 1L3TA 3JYTB 1F9HA 3KJNB 3OFHA 1MMDA 1PG5B 2KI2A 2YNGB 1XNRJ 4CLZA 1KQKA 4J9NA 3MOZA 4LBHA 1ZBTA 5I3QA 3U1MA 1WHVA 2X51A 1PBAA 2EFGA 1DJ0A 4NYOA 4U7UK 4AXIA 4EGLA 1EIYB 3MM7B 3CMES 1CBKA 1HNVB 3EUNA 2XNRA 5J2MA 2FHKA 5LMUF 3LPEA 4F4XA 4DZDA 2K1RB 5J2QB 5JUMA 3PW7A 2EFOA 1SJ1A 1MMNA 2IDLA 2E7XA 3ILOA 3CC4S 3MEGB 3SFGA 5KG1A 3LA0A 3EZ5A 1NJZA 5BXIA 4Y00A 1REVA 2HKEA 4Z7CA 2XNQA 5AJ3F 2YH1A 2XHWA 3BS9A 2HYIB 3UD4P 2BKNA 3FZ2A 5HK4A 1PBUA 2RDJA 4DL6A 3QNWB 4ZDNA 2LMIA 3BN4A 4DV7F 2MLXA 1HR0J 3PJXA 1IBCB 1NXIA 2N4DA 5CYMB 1Q86T 1J5OA 3CC7S 1RISA 3TANA 1WSRA 4GRSA 1HLWA 2VFUA 1FWPA 3CNQP 3QIPB 3V4MA 1M1GA 2F8HA 1QE1A 5CYMA 3WHIA 4EYIB 2FTRA 4OIXA 2VONA 2VQEJ 2V4RA 1TL5A 4KHPF 2XI3A 1OJ4A 1BWVA 2W2OP 3EZOA 4O3OA 2GHPA 4LMZA 5LXRA 4DX7A 3H90A 2ZHBA 4RW9B 4X62F 2XMVA 2ZBRA 4NLYA 5HP1A 3Q8SB 2L9DA 1RP5A 5E3PA 4A8FA 1FE0A 4OLPA 1IWAA 4JYAJ 4QCLA 3TAMB 3FVYA 2VOOA 3K5LA 4DUZF 2C3PA 3PACA 2UUAJ 3OSNA 4ELTA 3O2IA 1JKHB 2YNHA 5CD4H 3DRPB 1JLFA 1RLCL 2WB1D 3DMJB 5E2QA 4ELVA 3MM7A 4NXNF 2AJ1A 4USUA 3A1YG 3T9NA 2GNKA 4DU7A 2XBPA 1AZSA 1LK5A 3CMAS 1ZH5A 4JBCA 4CLTA 1Q95G 1S1XB 5JVGQ 1VK8A 2KN4A 4YUDA 3F0NA 4LBPA 2CQ3A 3GFHA 1OO0B 4DQQA 4OHYA 4V19J 4CLFA 1X0FA 2BQRA 2CJAA 2OAUA 2J9EA 4DV6F 4KY3A 4P74A 3ZNUA 2YNFB 4WFYA 3WC2A 3JSBA 4KIAA 2AZ3A 3E2EA 2AX1A 2RRAA 3OT9A 5E3CA 3Q0AA 4Q0BB 3OR1B 3FDSA 1UVKA 4KO0B 3OR2B 2AEFA 4ZPCA 4DV2J 4OL8A 5KFGA 1WTFA 4C6AA 3UI3A 4G1QB 2PMWA 3DLEB 3T5JA 4M8LA 1FA0A 4OHXA 2V6AA 5IC6B 1C4AA 4HVZA 3SCIE 4W4MA 3UDCA 2DR7A 1IWGA 2PSZA 4IFVA 1PJ6A 4F3OA 1JLGB 5K14A 1FO1A 1X4CA 4HHUA 5EWFA 2PEHA 1RYSA 1YK9A 2B9YA 3NCPA 2VC1A 1NPPA 2ZJPQ 2MJUA 4RW9A 1JLGA 5K14B 4DCOB 3C15B 2BW7A 1C4CA 2XS2A 1FRJA 3PIOQ 3VAHA 4ZLPA 2YKQA 3BYPA 3UDLA 5F8NA 2C28A 4LVNP 3RJMB 2QEXS 5THWA 2MQQA 4ECUA 1UW4A 2CPJA 3AY0A 4JOUA 1RKJA 1S77D 3WQPA 2FHMA 3R27A 2FGCA 3AB4B 2G0JA 2EK6A 1LKZA 1RT1B 2GJFA 4F7VA 4JI1J 2XYPB 4MKBA 2JX2A 3MUMP 1RTHA 2HGMA 1SJFA 2Y1LB 3GQCA 3NNCA 5CZXA 1H2VZ 1MN9A 5IT0A 3DYAA 4UY85 5GMEA 3WBZA 1OS5A 2E5LF 3NMAA 2QSFA 4PG5A 2LEBA 1HBOB 1HQEB 1WKJA 1WKKA 3H98A 3BBBA 3QSIA 1FE4A 5CYQA 5T7LA 3X3UA 5IM0A 2EC2A 3BO4A 1ZETA 1IKWB 5KT2A 1XR6A 1LWCA 3B82A 3HFVA 3TX0A 3MMAB 4YDXA 4NLGA 5KT5A 1HQ2A 4DG1A 3K17A 1WEXA 3SI8A 2VFTA 2XSJB 2YQ3A 2VOPA 3DOLB 4KQZA 1Y10A 2W2NP 2UUWA 2HS3A 4DG1B 4ECXA 4ITSA 3GJQB 2F8MA 2OSQA 1HMVB 4KH0B 5A2QY 3M6XA 3RW6A 3TUZC 4B3SF 3H20A 4RUHA 4F3MA 2P9EA 3QT8A 4U96A 3TJ8A 1VBZA 1Z2ZA 4NA3A 2FUG9 2FZCB 3JQJA 4OZ2A 1WC1A 3I32A 5IFMA 2YKOA 5LT5A 4PABA 5I3UB 3JSMB 1ZZNA 3C46A 3KG4A 4EBCA 2ZOMA 1XEZA 4CYUB 1YKWA 4C98A 5B08A 3I0RB 5EDWA 3PYFA 4G3IA 2MQPA 2HWHA 4P71A 1M5KC 4NLTA 1Q81T 4DV5F 4P52A 3ZZRA 1U2FA 2R3VA 2QT7A 5D15A 5DO2A 1PC5A 4OI3A 4D3GA 3EX7B 4OYIA 5J1EB 1X4HA 4HL9A 3CD6S 1QAXA 4ZVGA 4P7TA 1IQTA 1RSCA 5CH7B 3SQOP 1H98A 3FFIB 3KK1A 2OO4A 2FLOA 2J5AA 4IFVB 4IQMA 4A46A 1P8GA 2HFZA 2ZH5A 5L39A 2DR5A 4CLSA 1RA6A 3MTKA 2K3KA 3LGHA 4OI6A 1JB0C 1JLQA 2HQIA 2J7WA 2JNJA 2P9GA 1MWZA 5ETRA 4JI0J 2HGNA 5D77A 1K8AT 1FJEB 1NHVA 3BDPA 4DFPA 1WC4A 5ETOA 2R7UA 1QLNA 4YEAA 4B9NA 3H5YA 3DI6B 4K4YA 3AOBA 1RHRB 4NLVA 5L46A 3W5YA 2DPJA 2MKCA 1CVJA 2AGOA 3NGKA 3NGSA 1KS2A 3SMZA 3UR3C 2Y1JA 2R8JA 5GAGI 4C8KA 1WHWA 2CZ9A 4DZ6A 2IJRA 2DR8A 3CCSS 1FTRA 2VL1A 2ZD1B 4N47A 4DX8H 4B3MF 6AT1B 1TKZA 2UUCJ 1V3RA 2ROPA 3D3BJ 3DYAB 3R5GA 5JJBA 1UA1A 4IR1A 5M2UA 1HBUA 4QW9A 1FFSB 2MY7A 2QA4S 2YNIA 3ZZPA 5LMNJ 1LQ9A 2CJBA 2FZGB 3LAMA 4MH8A 1NSQA 4C8NA 4BDPA 1QY7A 3RYLA 1R31A 2VV5A 4C0BA 1WOPA 3UCZP 5IC4B 1JK9B 2LP4A 2VFRA 2YX4A 2EFQA 3MMAA 4C7QA 1U1QA 2LCWA 1SJ4P 2ILZA 3R5JB 4HYKA 2VUGA 2FJVA 1CS4A 3DNCA 5KT6A 1ITPA 3HD1A 2RRBA 4CLUA 2VPXB 4WK3A 2ZDPA 1S49A 2KKHA 1KC8T 3FFIA 3FCVA 1F9FA 1WDDA 2Y8YA 5HP1B 2IYIA 3C16A 1X60A 1DARA 2BE2B 3Q8YA 1RGVA 3VCDA 5B0AA 5ADZA 4ZMMA 1RT4A 5KT4A 5DG9A 1SC4B 2CPDA 3TA0A 3UN5A 4Q44A 2ACMA 3MR5A 3HVRA 2LQ5A 2WSCC 2DRBA 2PMHA 1RI7A 2VDIA 4PUOB 2RAQA 3CSKA 4B3TF 4URQU 4ZVFA 3DLKA 2R7RA 1EKRA 3QT5A 2CJXB 4CYUA 3BM7A 2V9KA 3JAMU 3C15A 2IRXA 1F9EB 2NXCA 3K89A 3KLVA 2ZBPA 3THTA 2E5LJ 1OYEA 4P10A 5D0HA 3RB6A 1C0TA 4ZCLA 2ZHOA 1PYTA 3PYDA 3EMTA 4PKDB 5J2QA 1F60B 1PJ5A 2X3GA 2DR9A 2J6UA 2VIHA 2YX1A 2HK2A 1KVIA 2DY1A 4JI1F 1BUXA 1UVMA 5KFZA 3DRXA 5KFUA 3BSNA 2AGPA 4NXMJ 3I5CA 1UCNA 2XZTB 5F0WA 4JI8J 2AV5A 2DH9A 1UZHA 2HBQB 4M5MA 1UEUA 3IBWA 4W90B 4AUKA 2XLIA 1JLEB 2KDOA 2FJEB 3BR8A 3ELHA 4F36A 3SCJE 4IH5A 3C3LA 2HHHJ 3HVAA 1NZAA 1WC6A 1XNQF 2LDIA 2KH9A 2FGOA 3A3OB 3P96A 1XN9A 2MHNA 1HNIA 3M8YA 4RUBA 3ZZUA 2VBWA 4A8WA 4WZMA 1WC0A 2CJ9A 3C6UB 3TA2A 2O66A 1U02A 4ZVUB 2K7KA 2E29A 2LKZA 3MPYA 1GAOA 5LL6d 2AMCB 4B02A 1RHJB 2FLPA 1FX2A 3HKZD 3EPIA 2HVHA 2MQ8A 2OPPB 3PFOA 2C2MB 3PW2A 3GYGA 3M4XA 1SIZA 5B09A 4N5SA 4ED0A 5AXMA 4V1Ak 1UEKA 3KJVB 3G96A 4FYXB 1UZDA 4RW7B 4WP3A 1Y5NB 2XMKA 1QAYA 4LR7A 4KPYA 1HBNA 1NHUA 3G87A 1W2IA 1P9YA 3OTOJ 2IJNA 1D1UA 1NKBA 2QO3A 1IBMJ 1GMVA 3KHLA 4Q7AA 4KFBA 3ADAC 4P2MA 5ETVA 4WXOA 5D6GA 1Q82T 1FXLA 4J91A 4P6QA 1NK6A 1XIQA 4FF2A 4BC9A 2UXDF 1HNVA 1N5SA 4WKYA 2UU9J 4B3RJ 3LP1B 2D3OR 1S1WB 2UUAF 2V94A 2L9WA 4IG3A 4USWA 3CUNA 2VC0A 4OI1A 5KFJA 5IT9Y 3AQOA 1RT2A 1VIOA 2KT2A 1TL1B 3H5UA 4I7FB 4LF6F 1GMWA 3MDFA 3NY0A 2VODA 4KC5A 2BOPA 1BQMB 2OPQB 5H9EJ 1V5IB 4OLOA 3J81U 2VA2A 3EGZA 5ETKA 5GAEU 3M7VA 3UQSA 3A12A 2Y1RI 3PTWA 1U4BA 1S10A 2I9SA 2RT3A 3ZC4A 3T3FA 3W9HA 3GSIA 1I3OB 3Q24A 2EFVA 2MY8A 1N8RT 4RKUC 3TR5A 1E6YA 1Y5LB 1FI4A 1RBAA 2HBYB 2NSBA 5ITHA 1QAIA 3BGRB 1FK9B 2KRBA 1HFEL 2QA2A 2VG5B 2B5JB 3HVTA 2X1GA 3I4HX 3MMCB 3D0GE 2VHGA 1IBKJ 2RHSB 1R0AA 3ILLA 1S72S 2KFYA 1W25A 4DFMA 4R5PA 1H7WA 2KL8A 1RUSA 1NAQA 5L8RC 4A47A 3RAQA 3D1QA 1NK5A 3L4BC 2DNYA 4DN0A 1WI6A 3CCRS 1SH2A 3PEHA 2IVYA 4PPDA 4ECWA 5HANA 3E01A 2EG1A 2JEGA 2KT5A 3LW5C 3JS9A 5T41A 5DLFA 3HHDA 2EW9A 2VPWB 2DH8A 4D3HA 3GIJA 4ZIVA 1BQXA 5DQHA 2OPRA 4DR2F 1B99A 3MCNA 1J5OB 2GJIA 3N4WA 3EGWB 3LANA 4UZBA 4PPZA 1KFDA 3FC9A 3IC1A 5F8JA 2XYHB 3H7HB 4RWWA 2N82B 3KNGA 1TUVA 1CJKA 2RVJA 1RTJB 1FNMA 1VHFA 2APOA 2QYCA 1NDKA 5ETNA 3D0IE 2X1FA 4X65F 4IR9A 2MKIA 3DCAA 2GCFA 3SZ2A 2DNZA 1VS3A 1L3KA 2F40A 2NPFA 5D0EA 4C0OC 1FNXH 5KFLA 4ECYA 1NBEB 4F04B 2CQIA 1RAOA 2QMWA 4GVLA 5HMYA 2M4MA 2MZSA 2HGLA 4WYWA 1VBKA 2G0CA 4IOBA 5B0GA 2JC0A 2LEPA 4OMFG 5CYJA 2OPQA 3SV4A 4DV3F 2V4JB 1NSPA 1GT8A 3R6LB 3CJ3A 4NL5A 4QIEA 5DS7A 4ANEA 1NDCA 2NCKL 4K5RA 4K0KJ 2ERRA 3DLHA 3UCGA 4ED3A 1S0OA 1NHKL 4DSJA 1U2RA 4O0IA 1HNZF 1H6KX 3DHWC 2O5DA 3M8PB 3OXLA 4WU3A 2LQ8A 4PWUA 1UJ4A 1NDLA 5KFDA 4DQPA 3TA1A 3TNVA 2C2OB 1HA1A 4ED8A 4RUAA 2BE2A 3AOCA 4LF8F 4Q45A 4NXMF 3J7ZT 1HWJA 3FZBA 3HHLD 4HACA 4O0NA 3J80Y 1C0UB 2JZ5A 1N48A 2WSEC 3GYXB 3DMJA 1I51B 1RU1A 2HRYA 2V2VA 4KGZB 2B9WA 5F8GA 3MPWA 1X7VA 3GIKA 1BWEA 3UO0A 2LQ9A 4XDDA 2M70A 2VBZA 4K2XA 2CG8A 3ZZTA 1RB0A 1HPZB 2R8GA 5L9NA 4PWDA 2MMYA 3D6FB 4TQSA 4LFAJ 5K20B 4F4AA 4X4TA 4ED7A 1APSA 1GXTA 3MD3A 4ZITA 2PT0A 5KFSA 2QL9B 3TRGA 3VVTA 4TXSA 2R2TA 3CCJS 2W9BB 2HQ3A 4KTQA 4HLBA 1NSAA 2WVCA 3N28A 2HHWA 4CDIA 4QOTA 3FEZA 3OFFA 1JXVA 2XQCA 4W92B 4OYXA 4KGKA 2ZWPA 4OHWA 4F0KA 3FBEA 4F4YA 4W98A 1FKOA 4OZ0A 4X2BA 3KLFB 4ES1A 2OFHX 4LRFA 3TQEA 4NYPA 1SVDA 5JMNA 2ZJQQ 2BRKA 4OZ3A 4WWSA 3U02A 1OWXA 2Y3YA 4AQYF 2HPUA 1XTZA 2AW0A 2JSXA 1F3VA 3D4JA 3UFCX 3VR1A 5FDLA 3DKDA 3LWLA 4CO0A 3RB4A 3S6EA 3J7A1 2K8GA 4M5NA 2ZC3A 3W62A 2LA6A 3RRHA 3VQTA 1D9FA 1QDUB 1JXLA 1NK7A 4K50A 2KVIA 2KZZA 1Z4UA 1S57A 1S79A 1DTQB 4RL1A 2YXLA 3B4MA 2ZUAA 5LMNF 2HNZA 4TLQA 1TKDA 4ATNA 4OQJA 2W9AA 3GE9A 1IM4A 1JLCB 5ETPA 5ETQA 3WIVA 2UUCF 3CD5A 4TYBA 2ASDA 2I2YA 3UD3P 3MFIA 1VQMS 1UJ6A 1F5CA 3BGOP 3KJVA 2LXIA 3AA8A 1F3FA 3CJSA 3DLKB 2YY3A 1AA1B 4UUXA 4WP9A 2ATLA 2CQ2A 2QE5A 5HVFA 3UNGC 2WTFA 1WSVA 2PO4A 1WKLA 4DL0C 1CJUB 4FKYA 3KOAA 3D9BA 4LSNB 2RHQB 1ZAXA 4PYDA 5HJYA 2Q66A 1FHTA 2OI2A 3JSMA 3GPAA 1Q5YA 3SSRA 3R5DA 2A6MA 4L73A 5E3RA 4CRJA 3O44A 4ZK7M 3JSRA 4NRTA 4DPOA 3CCQS 1YVFA 5FD1A 1LWEA 4LF4F 2CZVC 4ETZA 4KHMA 3ET6B 4ETXA 3FQLA 2AJFE 2RJZA 2VJUA 4USKA 3GILA 3DLBA 3OFEA 4OJHA 4ILLA 2H48B 3BDEA 4PG4A 1HNXF 1UA0A 1ZAWA 1SB6A 2BJ3A 3L7UA 2QC3A 2M3DA 3MFHA 4J9VA 3MR2A 2XS7A 4ZVQB 1FRXA 5C24A 1U1KA 2R7VA 4NLUA 5LJ5Y 2HZCA 1TV6A 1U8SA 3KK3B 2VASA 3EWGA 2VD3A 2DGTA 1N32J 2FY8A 3GU0A 2BVZA 4DR3J 3V5RA 3TVZA 1HD1A 4BBYA 2HWTA 3HMJG 3M8WA 2J6SA 1PIEA 1XMQF 3MEKA 1U09A 5T7LB 1H73A 1KHWA 2D74B 4S0MA 1N33J 1DFDA 2LXFA 2BM0A 3N6NA 2DVIA 1FJGF 4B17A 1RKIA 4QYZJ 3MEEB 3H2LA 4F0MA 1NH8A 1VYAA 2A3JA 5FJ4A 1RT7A 5GAEI 5LM7E 3Q89A 3A13A 2F8EX 3IS9B 4CNZA 5CCMA 1CLFA 3KLHA 1BC6A 3M1VA 3NS7B 3HF5A 1DLOA 5AXLA 2KFZA 3PRBA 4XAKA 4G1PA 4USMA 2PI5A 1OY6A 1RT4B 1RWPB 1AT1B 2HHQA 1CC8A 3D28A 3KHGA 1S1UA 1TELA 5BYQA 2ROEA 2ZITA 2XMUA 3P4UB 1SKRA 1I94J 2MKJA 3E01B 3JTPA 2L48A 2QN6B 3AAWB 2CQDA 2OHDA 3NP5A 4C48A 1OYDA 2H4WB 1NO8A 2CDRB 2WONA 3IP0A 4YN3B 5C25A 3KLGB 1C1BA 1FKOB 1JQGA 2MDAA 4KH1B 5ETLA 4CQ1A 1N5YB 1YBTA 3BB5A 3MAHA 4FBTA 1A6LA 3BH7B 2GIFA 2CFXA 2OLWA 4LSLB 4RW7A 2W8LA 2CAJA 4UOHA 1G2EA 1CS4B 3W7BA 3KG0A 3OL9A 2JVRA 1GK8A 1YRUA 4ALZA 4IYQA 2QMUB 3SCLE 2MGZB 2E5GA 3T6JA 1RT3B 3EYZA 3HSDA 3NGUA 3G82B 4HACB 2R8IA 1KVKA 1FFWB 3CIMA 3DLLQ 1SBRA 3CJRA 3D1OA 4JI5J 1VGYA 3MM6B 3TJAA 1A9NB 1T9VA 3MAAA 5DM7Q 2MPUA 4Y65A 3HKWA 3E8OA 1NNDA 3D6HB 3ONQA 2GGPA 5E7OB 1KONA 1YITS 2MHEA 3I6PA 3EDRB 4GO5X 3F56A 3D6TB 2UXBJ 4JI5F 4MK9A 2C3OA 1TKXA 5B7WA 4Y6IA 1FVSA 2QMXA 2W2MP 3EICA 3SXLA 5CA5A 1D0EA 2KM8C 2B4VA 1P1TA 2UVVA 3HFKA 4BWJA 2KJWA 3M8SA 2XZWA 4UTGA 3DM2A 3NAIA 1RT5A 5A76A 1SKWA 1OSDA 4DR6F 1TZ0A 2V8HA 4XPCA 3MXHP 2KRRA 4HT7A 1RT7B 2MLZA 4DL2A 1I1GA 2IBKA 1REGX 1HNWF 2GFFA 1TL3A 3G86A 4RW4B 3SV3A 1QVFR 4C8ZA 1GX5A 3LP2B 4TU7A 3H5XA 3MM8A 3AJ2A 4FXDA 2QFIA 3KG1A 3GR1A 5IQQA 2PDAA 1RZMA 3ETOA 5IT4A 1T95A 3IGNA 2AJ0A 1RTHB 3FEXB 2BOAA 1GXUA 4CO2A 2JFDA 4CT8A 3I4PA 4FYWB 3TEHB 5HROB 3Q86A 5EWGA 3A8JA 3CO9A 1V6HA 5CHCB 4WFZA 3T1AA 1RT3A 3IG1A 3HT3A 4ZVOB 1FRLA 4Q2MA 4U95A 2OTJS 4Z2XA 2EVZA 2R8HA 4HI2A 4OV1A 1TL7A 3VF0B 4ZVRB 5E41A 4QBUA 3POTA 2J8SA 2OTLS 3SSQA 3KLEA 3U1LA 1NJXA 1XK8A 5KT3A 1FJGJ 2CKWA 3DU5A 2R9LA 4E98A 3V6JA 3NS6A 2EXUA 1K0TA 1SKUB 3OL7A 2GVZB 2P5VA 4LJMA 1KOOA 2DGQA 2W2PP 2HK3A 3CCMS 1CJUA 2W7AA 1VLYA 2JVOA 5EX0A 2MLYA 1S7HA 2Z57B 3JTNA 3LOUA 4L3NA 2AHOB 3W60A 1FRIA 3K5NA 4DS5A 2BR0A 2C22A 3CVKA 1XC9A 3ENWA 2V2ZA 2MKYA 2XSFA 4KPCA 4K7QA 2UXBF 2RS2A 1VRQC 3DXBA 3M8PA 2H5EA 4F4ZA 2NR0A 2UVWA 2XS5A 4C11B 2DHAA 3KXDA 1EX8A 2QLBB 4C8MA 3V4IB 2UU9F 3GIMA 2DBBA 4LIWA 4ELUA 3RU0A 4C11A 4P75A 1UFWA 2P6SA 1NK8A 2ADBA 2GQCA 1LK7A 2ZVSA 4WFXA 5KG0A 3AH6A 5AJ3J 4DR5F 3UDVA 3PO5A 4K4ZA 4WE1A 2N3OA 2MZJA 3MHYA 2Q6CA 4J9KA 2BRLA 2MTLA 3ZXWA 2NYIA 1NK4A 2VPZB 1RTDB 4A8SA 1S6QB 1Y7PA 1W7WA 2PIIA 2QGFB 2GMJA 3CJ4A 3GJSB 3ISND 2ZM6J 3VGTA 5J2PA 1U45A 4PWDB 2J0SD 5DG7A 4Y3CA 5B0FA 1T9WA 3PHEA 3LALA 4MIBA 4NLXA 1U6ZA 3R1HA 4NCAA 3HK2A 5I3PA 1S99A 3M2RA 3Q22A 5KFQA 3NOCA 2LU2A 2X7IA 3TZWA 4C97A 3QJJA 1QUVA 2HURA 5HQ8A 1F1BB 1FDAA 1VQKS 3KTQA 2SXLA 2IVMA 3VAKA 1X9MA 2WW4A 4ZP7A 3PO4A 2ROGA 1M5HA 4L3KA 2I8EA 2V0NA 3BGUA 4DMZA 4HH1A 3P45B 4DV1J 3BV8A 2WVEA 1DY3A 2CPEA 1Q7YT 1WELA 3C14A 2FVQA 2HS0A 3JQKA 1AFIA 3NWGA 4UUWA 3G6VA 1ZZFA 2DNKA 1C1CA 4NASA 1HI8A 1VDHA 4HHJA 4IQXA 1N33F 1T9TA 2UZAA 2V8VA 3IXQA 3LP2A 5F8MA 1VQ8S 1FD8A 1JIHA 3HHEA 4OZ5A 4QZVB 3IM8A 1PSDA 2POKA 4KR0B 2AYBA 3MR7A 1N32F 3CO0P 2VH7A 5IXUA 4JV5J 1S1XA 2QL7B 4YS2A 5IS2A 3G71S 3L95X 5KG7A 1HI1A 2BJ9A 2G0IA 1R6VA 1FWKA 4NCGA 5CZVA 4O3PA 4NI2B 3V81B 2Z0GA 1TKZB 2YWHA 3GCWP 4ES2A 1JJHA 1WUUA 3E51A 2IBOA 3I56S 4AL6A 1IR0A 4DCJB 4DR7F 2XMTA 4HDGA 4IH6A 5LSRA 4KJIA 3IA0A 4OFZA 4HDHA 3F41A 1WF0A 3VV2B 4F67A 4DL4A 2KYZA 2X1BA 4LT6A 1N56A 3NKYA 5A8KB 4GKKJ 2UV8G 1SUQA 5H1SV 3VVUA 4QQBA 1JJ2R 4U6PA 2HLTA 4EO6A 3I5AA 1B3TA 5SZTA 4ID5A 4LF8J 1KNZA 2HHXA 4L76A 3T1HJ 3BF4A 3PDNA 3ZZOA 3H5SA 3MF5A 1Y5IB 3VGUA 1T03A 2XULA 3PY8A 2J9DE 1Q8LA 2YWFA 5AE3A 5D3GA 3L9ZA 1RADB 2HFVA 2UUBF 1SPBP 1CEZA 3T19A 1VC6A 4JV0A 4UQGA 4Q8FA 1IKYA 3D66A 5B0DA 1VRTB 3HT0A 2FDNA 3BKFA 3DRYA 2G13A 5F3TA 3W63A 5F8LA 1TP7A 1TAQA 3L09A 3NNHA 1RLDA 4CT9A 3C66A 4IH7A 3M2UB 1LW0A 1T9UA 1ZPVA 5C42B 4DR1F 4U7UD 3CJKB 1S4EA 5EN1A 2FJDB 4NOHA 1OQ3A 1M5VC 1WHYA 1WOSA 1HWIA 2PEBA 4YB5A 1Q0NA 4QU6A 1NPRA 1OY8A 2QFJA 4K59A 3THPA 4LREA 2HHSA 5D78A 1GQEA 3I5BA 4HKQA 3MM5B 3PG9A 2ZC4A 4M95A 5AT1B 3GFYA 1RE1B 2I5JA 2KG0A 1YRXA 1KP6A 2NXEA 3OUYB 3GJRB 1LV5A 2K2PA 2JJ4D 2QRRA 5DG8A 1VRUA 1B0PA 2K06A 4O3SA 1SQGA 2Y0BB 1RHQB 1EB0A 2DT9A 2WCXA 2ZH1A 4QPTA 1G3OA 4DR2J 2DKOB 5K8NA 2DHSA 3DRRB 4X4OA 1NDPA 2HNYA 2C2DA 2ZM6F 2DISA 3W5XA 1U2CA 2CRLA 3CPWR 2YWEA 4OYAA 2FJAB 1MNEA 1T9YA 2BA9A 3MMJA 2ZHAA 4QU7A 4TY8B 4C3LA 1RHKB 1LEOA 3ZTQA 2FVSA 2O1PA 3GV8B 4O3RA 3MECA 2MXYA 3J81j 3B78A 2WOMA 1GEHA 1S6UA 1RWXB 1A7GE 5CAAA 2FIUA 2QJ3A 2G4BA 1RCXB 2QLWA 4B9UA 5HSPA 4WZQA 3LP1A 1DZ5A 3ZZYA 3QGGA 1N36J 4DR7J 2MKSA 2ZBQA 2EKNA 4H4OB 4C0HA 5B0BA 3K5MA 5C24B 4EZ6A 2RUGA 2KXFA 4WFBQ 4ANCA 1X9SA 4QJVA 4IG0A 4J9QA 1D9AA 3UR0A 2XCAA 2JL9A 2HVIA 4FPIA 4KYZA 2XWXA 1WF1A 2B8QA 4O4GA 2EG2A 2HFUA 1R6YA 2EFPA 1H0HB 4MAKA 3TUJC 4WTOB 2OSRA 2YKMA 1NKEA 1LW0B 1UKUA 4O23A 5HQMA 1CQMA 1K47A 4J90A 4M5JA 1M5OC 2NXNA 4DV3J 1H72C 3M8ZA 1RAGB 4ZPAA 2DGXA 4ZLLA 1RAEB 3CCZA 1T05B 3RB0A 2CQ4A 4EU0A 3IRWP 5E0OA 4I2PB 3M8RA 2N7CA 1S9FA 4FF1A 1RK8A 2PA3A 1VJWA 4DL7A 1KR4A 2ZFHA 3G8QA 2KTQA 4Y2AA 2UXDJ 2C3MA 1XERA 1NB2A 4JV1A 4DV1F 5DRKA 4QPXA 4U8VA 3TARA 1IR2A 2CQ1A 3SIPB 1RTIA 1ZTWA 1J2VA 2HFOA 1DTTB 1XQIA 2CNKB 1RT6B 3OJSA 2C3YA 2HQDA 1R8AA 1AB8A 1FKPB 1VRUB 3HHLC 5HMXA 3UD5A 2AJ4A 1EP4B 2G9OA 1YJVA 2NPIA 3PW0A 1FESA 1CJVA 1RT6A 5HATA 3N6MA 3RRGA 2HVDA 3MM5A 1FJCA 2JFKA 3GP9A 1DQ8A 5KFEA 1P9QC 3Q8QB 2IFXA 4EZ9A 2KT3A 2DR6A 3IAM9 4F2RA 2X3DA 1LWFB 2WVBA 3MI7X 2LLZA 2MB0B 2Z2LA 3T5KA 3PCOB 1FTCA 4U7CA 3M30A 1SQEA 3OBIA 3UVJB 1OPIA 4IO9Q 4DR6J 2DYAA 4PAAA 3FEYB 1KVJA 2WHOA 2C1EB 2QIFA 3THVA 1BGXT 2Q1LA 4FXVA 3W8GA 3MUVP 3RBEA 2UXCJ 3B4DA 1J27A 2DNMA 2R2RA 4DR5J 5FLXY 5KFAA 1UWBB 5G4DA 3RTVA 3UN3A 2JLEA 1N6QA 3S1TA 1IBKF 1QSYA 3ZTOA 3G6ES 3KK1B 2W8KA 3RG6A 2LDYA 3POTB 5HO4A 3F44A 4A8KA 4JI4F 4OX9J 1ZOTA 4MIWA 3W9IA 2N4CA 4JI7F 4DPTA 2RE1A 2VG7A 3ZO7A 1ZAVA 4EI2A 3QFHA 1VC5A 2ABYA 4PXBA 1R89A 3ZZZA 2XO6A 1UFKA 2DGVA 1FF2A 2IC3B 4F02A 2W4DA 5IWAF 2XO7A 3BSOA 4YR2A 3IWNC 2ZKTA 3IR6B 4O44B 2XM3A 3MMBA 3RBDA 2VQFJ 5HVGA 3BSCA 1X5PA 4K4TA 1QJHA 1VQPS 2HAFA 4F2SA 4MIAA 4M5KA 3W2VA 3W61A 3FKBA 2HZAA 5EHHA 1X8DA 1S4FA 4GC7A 1TK0A 1VQSA 4Q0BA 1AUDA 2K7JA 1RAHB 1N0UA 1OMSA 4EWTA 2ZUGA 1J5EJ 3OD2A 4LF7F 4EBDA 1KBRA 3EPGA 3CCES 1TFYA 4ED5A 1Q8BA 2CG4A 2R8KA 4FYDA 4TY9A 2VBYA 3AQPA 2E1RA 1VQNS 1DTTA 5DETA 3CGIA 5K8PA 1SKSA 4KFBB 2N3LA 5AE1A 4WKRA 1L3SA 1HWLA 3DFEA 2GAGC 1SC6A 4ZP9A 4R25A 3OTOF 2VB6A 2XMAA 3IS9A 4A8YA 4M5GA 1B0VA 1IKWA 1Q53A 2XI2A 1FT8A 2DTJA 1RU2A 3OTCA 2J6TA 4FS1A 2ZNZA 3MM6A 5GVQA 1SL2A 5LJ3Y 2Z8QA 3IN5A 3J7YI 3GV7B 1TKTB 1RT2B 2E5HA 2YBVA 2D9OA 3R8YA 1EAYC 4Y2IA 5HI7A 3CCLS 2CXEA 4N7TA 4DV0F 2CYYA 2KU7A 2WVDA 5F3ZA 2I38A 3G2XA 2GS8A 2AF6A 5KFFA 1XNQJ 2F1FA 1MU2A 1X9WA 1U6FA 2HNDA 4MT1A 4DF4A 3HM9A 4B9VA 4KV8A 1RWWB 3RR8A 4O3QA 4DJBA 4B3MJ 1TVRB 4OX8A 2XCPA 2XLJA 4DUYF 5BJRA 1IBLF 4K4VA 4LFCF 5E33A 1TMJA 2V8PA 2OUGA 4CLYA 1TR0A 3K2YA 4QYRA 1TL7B 1TL3B 2BABA 3CULA 1RWOB 3V2UC 1NUEA 4FYVB 4Y0FA 3F73A 4LF4J 3G9CA 3P6YC 3RUBL 4JI0F 1R7IA 1UPPA 4TU9A 3N9UC 2D1CA 4IFYA 2GIRA 3AD7C 4MK8A 5GAGU 2PFDA 2AU0A 4DPXA 4A8XA 4LRDA 3MOJB 3PFEA 4IOAQ 3NL0A 1JXEA 1TKXB 3HSGA 4H4KC 3O6QA 1HHQA 2MJNA 4NCBA 2MKKA 1MG7A 5A8RB 3PJ9A 3M6UA 2F4VJ 3IWLA 1ZM2A 2F63A 3TAQA 1WOOA 3J80U 2G2YA 2BM1A 3WZ0A 3CCVS 3A4TA 3RBZA 1VISA 3G6XA 2CPYA 4IG3B 3S8SA 2W1BA 2AKWB 4QWCA 2IAJA 4PUOA 3HJFA 1QSSA 2B3TB 5GAHI 3H2VE 4WK1A 2J0XA 2BJ7A 5KFKA 1K1QA 4X4NA 4K4UA 3DRPA 4PG7A 3KDNA 3MEDB 1Y3KA 5KFPA 2OEMA 2YNGA 4YOEA 4TQRA 1FRKA 1O0PA 3EJMA 4AL7A 1JWWA 1IKXB 1QTMA 4O4GB 3RZAA 1FEHA 1MN7A 2JWNA 2YTCA 4C8OA 2HFNA 1Y11A 3KKFA 2M5YA 4X4SA 1URNA 3IG1B 2E9RX 3NGTA 1XMQJ 3OL8A 1OPZA 3R6GB 5D8HB 3GSDA 3LUYA 2B7BB 1S6OA 4KO0A 4X4QA 2BE7D 2F4VF 3NMRA 1JNZB 5C2GA 2LVWA 4RR5A 3W64A 4AL5A 2G1DA 1FCAA 1JLCA 4UF4A 1H2TZ 4XPEA 2RH3A 2BQUA 4AE5A 3W2WB 1HI0P 1HHSA 2CIMA 2J7KA 5K5MA 1R8BA 4TU8A 1FKPA 4GKJJ 4JI6J 4YB1P 2XY5A 3DDIA 3NOGA 4OI4A 4EEYA 3QT6A 4I1TA 2GW8A 4NYZA 1Y3JA 5A0YA 3QZ8A 2H5JB 2KFNA 1ICEB 4LF5J 4WPAA 2HAIA 2ZOGA 4DUTA 3HX9A 2ZE2B 2VJVA 2MZRA 4OJ1A 4OX6A 3UN2A 1UL3A 1YI2S 1IKVB 2R2UA 5EX3A 4Z37A 3UE2A 1RTJA 3V4IA 2RQKA 3KLHB 1YTYA 1IXKA 1B4SA 4ED4A 4FVMA 1VOMA 3ZTRA 5LSOA 4DUYJ 4I69A 4X4UA 3QIDA 1EARA 3C8YA 4P2FA 5BR8F 2GAHC 2VKZG 2GVDB 2HHTA 3IBCB 2ZD1A 3IM9A 1S0NA 4YB6A 3G8TA 4IDKB 1C1CB 1R3NA 2L3MA 3D5MA 3NGRA 2RF2A 4DV0J 1NK0A 2AIRB 1QUPA 2B4UA 2VDHA 2V2KA 2E7VA 3PRVA 4DV4F 3H8YA 4DV2F 1DHMA 1RT1A 4H4OA 3DC2A 4ZCMA 3CJ0A 4QIGA 4GMKA 3D3CJ 1HW8A 5MLCV 5F8HA 4RO0A 1JNRB 4N56A 2HHVA 3RAXA 3PJWA 5J2NB 2BE9B 1SXLA 3HHLA 1N0VC 4CLLA 4ZLNA 4B3SJ 3US5A 4NLQA 1UWBA 2IDEA 2EWHA 3C19A 4A4JA 4ZS6A 3OHBA 4EBEA 1N6QB 5EGYA 2BBEA 4DBQA 4QWAA 3W3SA 3DOKA 4NLOA 3VAIA 5AE2A 5K9FA 1ROFA 4LQ9A 4OHVA 5AXKA 3FK4A 2JOQA 1URRA 3GR0A 3IO1A 4X64J 3R5BA 2HRUA 4ZCKA 3M9OB 2IM0A 4WCEQ 2IA6A 3QPIA 2R2SA 4ZPTR 5D4PA 2XB2D 3N0VA 4NLPA 2ZH2A 3CWJA 2JDJA 1B70B 1RHUB 1HL6A 3GIIA 1KTQA 5H9FJ 4YP3A 4DUZJ 4HTIA 3Q83A 4NZ0A 3QJPA 4C8YA 1FNOA 4X62J 2OMLA 3CD0A 3QATA 5L1JA 3TQ1A 3KMQA 4ERDA 3JAMY 4DPYA 4RX6A 3MEGA 1EJ7L 2FVRA 1NKCA 4RNHA 3IR5B 2Z4PA 3V81A 1KQSR 2JEJA 2NZ4A 1OSCA 4USIA 3CDWA 2X1AA 1SL1A 4DS4A 1CSJA 2HIYA 3EZUA 5HBMB 1Y4ZB 1NJIT 4J9LA 3CCTA 3DHXA 2CVEA 4IRDA 4C3KA 2V34A 2ZNYA 4DV7J 2YWGA 4PG8A 1Q5VA 3AXKA 4LR8A 4RJVA 1HR0F 3OXGA 1VMBA 5JXSA 5KFOA 4X84A 4JI2J 1WEZA 1Q7LB 4PXEA 3PEJA 3KK2A 1T94A 3MD1A 1CJKB 1VQOS 2VKRA 4U9RA 4WIQA 5HQLA 1U48A 4AFFA 1YRTA 5HN0A 2UXCF 5F9NA 3OSPA 2FJWA 3VAGA 4K0KF 4XK8C 1IQZA 5KOWA 4CLKA 2OPRB 4NEZA 4UW2A 1KLNA 3VZIA 3OUYA 4P2XA 3TOQA 1JLQB 1RAJA 2DXDA 3ENQA 4ED2A 1PAEX 3GIRA 1DRZA 4OHZA 2G2ZA 1ZA1B 4ICLA 4OYBA 4YR0A 1F0XA 3TUPA 2W01A 4USTA 1AFJA 4B3OB 3QQCD 2IC3A 2B6AB 5D4OA 4ICLB 4BCAA 3CB4A 1HW9A 2NXJA 3MCMA 3M9NB 1L3VA 3H2UB 1UVNA 1R8PA 1BXNA 1IKXA 4R5PB 5RUBA 4QWDA 1Q78A 1EQ0A 1U49A 1SC1B 1NCLA 4X66F 2OMOA 2VFSA 3DLGB 3LTOA 1X5OA 1RWKB 2JC1A 3AT1B 3DGPB 5J2NA 3I0RA 4Y2MA 3AA9A 1VQYA 2M52A 3DGVA 4XDCA 2BV3A 4N76A 4PXDA 1XBWA 5HBMA 1G4CA 2ZH8A 1LFWA 1JLFB 3ICLA 3PW4A 4UT4A 2ZH4A 1V5VA 4OYMA 5KG2A 3M30B 2NXUA 2V8GA 4PRFA 4Z7YA 2QG9B 1OQ6A 4I2PA 2C2ZB 4KE5A 3W5ZA 4JYAF 4OYZA 1WF2A 3M6VA 4LF9F 2Z56B 1GNKA 1NEEA 2IMOA 1FEEA 4QW8A 4MKYA 1YLXA 3DRSA 3KLIA 1FFGB 4FZVA 3HZGA 1RWNB 3IFEA 4RNFA 2DGSA 4F8RA 1HBOA 1FKAF 3R5AA 2EPIA 4R8UB 5IQ6A 1UEVA 4PR6A 4KHPJ 2H1YA 3ITHB 3I0SB 2JEFA 2MZ1A 2XWYA 3DLJA 1S1VA 2OEKA 2F5GA 1M1HA 2O67A 1N36F 3D6MB 3BR9A 3HSZA 1D8ZA 1S9GB 1GX6A 3MCOA 1WACA 5E5NA 3AJ1A 5I42B 2CVIA 4JB8B 4LF1A 4MYUA 1HQEA 1RYRA 1VIXA 4JI3J 4I67A 2FHJD 3AJDA 3ET6A 2BJ1A 3TO8A 1YBUA 3M05A 1OIAA 4DSLA 2OEJA 3VQSA 4ECQA 2FLLA 3CDUA 5L9XA 1EETB 1GFWB 3QRPA 3OTBA 1RAIB 4Q43A 3Q8VA 4R0EA 2V68A 1RTZA 2CA9A 4NEYA 3Q23A 1EETA 1XR5A 2HVEA 3PHTA 1EZZB 4ZA1A 3QAEA 1KTVA 3G82A 5F41A 2HVZA 3BGFA 3KK2B 5L1KA 5LMUJ 4M94A 3CJ2A 3WDOA 4DQIA 1S5ZA 2NUHA 4LFBJ 5F8IA 4ES3A 2PGCA 3D54A 3T5LA 1WNEA 3VAFA 1HBUB 2CADA 3BO3A 1PYOB 3K57A 4DF8A 4BC7A 1HNIB 2XZDB 4HI1A 5D4NA 4GC6A 1BD6A 1VHIA 2DIVA 2H3EB 2Q6BA 5C7PA 3JB9k 2LECA 4WIIA 4IOCQ 2NQPA 3B54A 3M2RB 1PKUA 2E1AA 3AODA 1G7CB 3PW5A 1YQHA 1S9EA 2MQLA 4X66J 3G8SA 2A10A 2E9TA 1KQGB 2FPHX 2YNFA 1W26A 1KEKA 4DPUA 4DX6A 2C2NA 1KRPA 1DTQA 1DQAA 3R5CA 3BBCA 4GVBA 3MWBA 4TLRA 2BXJA 2P8IA 2YWWA 3P5BP 2ZBCA 1LW2B 3TWZA 2HG4A 4RW6B 5BYRA 2B51A 2FY1A 2XSJA 3R2CJ 5A0YB 1RHMB 2BYCA 4TVAB 4IRKA 3FCWA 1YJ7A 2RQMA 3CDAA 1ZM4A 2O01C 2YNHB 2ZE2A 3MM9B 3KJQB 1UVJA 2BANA 3KLFA 1NM2A 1U26A 3BQ0A 4WFAQ 1YJWS 5HL7Q 4M5DB 3PX0A 1TVRA 5GAHU 1Y0HA 2W4PA 1D09B 1FRHA 1SIWB 1ZA2B 4CLPA 3T1YF 1HBNB 2HHHF 1VQ6S 1WDTA 1H2UX 2WK4A 3VWSA 3JYTA 1ZS6A 4ZHRA 2DNGA 5DJBA 1SJ3P 4LIRA 4G1IA 4ZVEA 3DI6A 5ETMA 2RU9A 2H65B 2DJWA 1S0VA 3I9V9 4ZVHA 2ZOFA 3CDEA 1RJJA 4LUBA 4LF5F 1IUJA 3E3XA 8RUCA 3MZIA 2RNEA 3PYEA 4XO0A 2IPOB 4GKKF 5A8WB 2CQPA 3CEDA 4JI6F 2RKIA 3M32A 4WU2A 1BHNA 2RDDA 1KWMA 2OPSB 3BGLA 3FGVA 4I4BA 2FYXA 4I2QA 2KVQE 3ILIA 4I6WA 3D68A 1REVB 1QE1B 2AJQA 4CNYA 2NZCA 4KV8B 2R7SA 1HQUB 2DCLA 1X5SA 1M5PC 4LSNA 1H3DA 2XYGB 2D69A 3FRYA 2UVUA 2IAJB 4ECRA 1TAUA 4DL5A 1U47A 3OR2A 1T11A 4M5HA 2IYGA 4ZN3A 5DDPC 4MMOA 2XEXA 3K8WA 1HYSB 3H4DA 3BO2A 3M1VB 1M90T 3ISNC 4NLSA 3CE8A 3DXSX 4HHHA 5K8OA 4F4KA 4HR2A 1XMOF 1JKHA 2KO1A 2VF3A 4M5DA 6FDRA 2ZEJA 4ILRA 4CO5A 2FD2A 4OZJA 3OL6A 1X4BA 3EM1A 4CH7A 1YZ7A 2QZ8A 2NS1B 5E3QA 4DSKA 3QSYB 1KD1T 1K0VA 3OHAA 2AT1B 3CCWA 1ELOA 1N5QA 3CMQA 2BKPA 3TYTA 2B4OA 1LNQA 3C6TA 3LP0B 4I0WA 3R9LA 3VAMA 4P2SA 1TMMA 2DRDA 1R43A 4ZVPB 1UAWA 3GLJA 3OTEA 2FVPA 3EE3A 1VQ4S 1IN0A 2V4QA 2MKHA 2OELA 1S7IA 5GADU 1NLKL 1FX4A 2GGPB 4FKXA 5LXYA 2NSCA 4U8YA 4H54A 3B8HA 3T41A 2Z2MA 4ZCIA 4KGXB 5CABA 4CH1A 2QA1A 4BLGA 1WC5A 1R8CA 5BR8J 2OPSA 4M5LA 1N34F 2HEKA 3OPKA 1YX2A 4FBUA 3QRQA 3GB0A 1UWAA 4UQTA 2NUUG 1WC3A 1UPMB 4O3NA 4RBVA 4K8RA 4CWBA 2A2DA 3BSAA 5CCLA 1S1UB 3R7BB 5JVHQ 1N52B 2DEJA 3WX4A 3SQGA 2CPFA 5KFCA 5F9LA 1MROA 1HKAA 1Q8IA 3DDNA 2C2RA 3IBFB 3SQGB 3EVOA 2ZZNA 3JXOA 2E7WA 3QWPA 2QTWA 3BKUA 1N54B 3BPDA 1C1BB 3FUYA 3HFZB 2AEMA 4MJKA 4GKJF 2VFVA 1FK9A 2DNPA 2VG5A 4OX7A 1X4AA 4XTTA 4YFUA 1K73T 4N8NA 4LFCJ 2M88A 5MAOA 3BYRA 2XC9A 2OP5A 1N34J 2RQ4A 2ADCA 1DBDA 2EBGA 1ZM3A 3V6DA 3M2VA 3EDQB 4FF4A 4AXJA 4DV5J 1HWUA 3MPUB 4AD6A 4DLGA 2LYVA 5U47A 5KFYA 3M2VB 3OLBA 5DQIA 1RACB 2RUSA 2YKPA 5GMDA 5K8MA 3PR4A 1VR6A 4EUVA 4CZCA 4LRCA 1CPZA 5T14A 3GV5B 4HH0A 4C8LA 1Z2LA 4DCPB 4WF9Q 1YG0A 2RKIB 5KFVA 3FNNA 1S59A 2E5JA 1KLMB 2KYXA 2EK1A 4M1KA 4DV6J 2XMWA 1FVQA 4DI6A 2F7VA 1U1LA 2NREA 1UTAA 3R3TA 2CPHA 4F0HA 1PILA 1MWYA 1G6BA 2HFSA 2A2CA 1NMEB 2JLFA 3JSYA 2LXUA 3QYYA 1Q1KA 2E1MC 1UMJA 1WD6A 1MW7A 1HBMB 1ZYQA 4UOCA 4B08A 2XHCA 2XMMA 3HHKA 2RDIA 4NA2A 4NA1A 3DLGA 2D3UA 3OVAA 2HBZB 2V63A 1IR1A 3Q8RB 3MM8B 4NZ6A 2HQGA 4ID5B 1LXJA 2W7PA 1J5EF 1XR7A 2Y1IA 4LF7J 1HNWJ 4ECZA 3OVBA 3QBCA 3M8QB 2XY7A 4TY8A 3M9MB 2OIHA 3U1NA 3KLGA 3KUHA 3V6HA 1BY9A 1SH0A 4NZ7A 4J7CA 3MR3A 2YPZA 2YH0A 4KAIA 4L6V3 5HMWA 2DNHA 4ED6A 4CTAA 1V9OA 3PR5B 2M8HA 2DNOA 2RILA 2V2QA 3BGRA 1UETA 3R7NB 1CULB 2IIHA 3QO9A 2FJXA 8AT1B 4HTJA 3V6KA 5M2RA 3KUEA 2ASJA 2B9EA 4YB7A 4Q8EA 2M2BA 9ATCB 4JI7J 3K7RA 1RWMB 1JLEA 4ZLJA 1IBLJ 3T9ZA 1CJTA 3T6BA 3A8KA 3H0PA 3FRZA 5C5JA 4OZNA 3U27A 4LRAA 1Y9OA 7FD1A 5A8RA 4KSEB 5A6PA 4N77A 4ANDA 2W2QP 1JMTA 4J9PA 2IRYA 3ZTPA 3NAHA 5DZ7A 4C2MA 5HVHA 2JLGA 4NLWA 1T02A 3C14B 4ZP8A 1P1LA 1CC7A 4F26A 4RBUA 3DM2B 4ZN1A 1JLAA 1YBAA 1TUGB 3I87A 4R0JA 3SYZA 2XY6A 1VI7A 1N5TA 2CJQA 5DQGA 3TAMA 3RB3A 2FLNA 2I0XA 4KRWA 1N5YA 3H25A 3KJFB 3PRDA 2HS4A 4LF2A 5KFTA 4CM2A 3O3LA 3T5HA 2CQ0A 1VJQA 2PN6A 3GFXA 1MU2B 2C2KB 3NCQA 3WIUA 3PX4A 4TYAA 3FCHA 2A6OA 2R7OA 4DL3A 3LH2S 2A0FB 1G1XA 4CI0B 2ZH6A 1X4FA 4DFKA 3MGJA 1T9XA 2DXEA 3TEGA 5GMKa 4NXNJ 4L74A 4PQUB 1U24A 2OD6A 3GG0A 4PWWA 3D0HE 3J7Z5 4OI0A 2WBMA 2AEJA 1CG2A 4LRBA 3UPFA 4ZKAA 4LFBF 2FJBB 1U1MA 3A3NB 2M7SA 3AXMA 3MEEA 2AYMA 3WX8A 1S97A 3AD8C 1RXOB 2CPXA 1WG1A 4K4WA 4USHA 3VTIA 1QD1A 1YWXA 5DDRC 1D8YA 3MM9A 5J1PA 1TU0B 1RABB 5LSLA 3X1LB 3NS5A 2QLXA 5IZHA 4WBFA 2HNYB 1NJWA 2IJFA 1X4DA 1RQ0A 3SBMA 2VQEF 1RT5B 3UNYA 5IWAJ 2FC9A 2V8DA 4IUFA 4RW6A 1HNXJ 3MUTP 2RMLA 2VPYB 1EKSA 4ZIWA 5M2PA 4J9OA 4OX9F 4JI4J 1NU4A 1GMUA 3FQKA 3ZFVA 1BQNA 5HJXA 2XG8A 3DOMA 4YHHF 1UVLA 3U7JA 1RBOB 1LWEB 3KMSA
chains in the Genus database with same CATH topology
3QSIA 2WVEA 2WVCA 2F1FA 2BJ3A 2BJ8A 2WVFA 2BJ1A 2HZVA 2WVBA 2CA9A 2Y3YA 3PHTA 3BKTA 2FGCA 2BJ7A 1Q5VA 2HZAA 2PC6A 1Q5YA 2CADA 2CAJA 2BJ9A 3LGHA 3OD2A 2NZCA 3BKFA 3BKUA 2WVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSI A;  2WVE A;  2WVC A;  2F1F A;  2BJ3 A;  2BJ8 A;  2WVF A;  2BJ1 A;  2HZV A;  2WVB A;  2CA9 A;  2Y3Y A;  3PHT A;  3BKT A;  2FGC A;  2BJ7 A;  1Q5V A;  2HZA A;  2PC6 A;  1Q5Y A;  2CAD A;  2CAJ A;  2BJ9 A;  3LGH A;  3OD2 A;  2NZC A;  3BKF A;  3BKU A;  2WVD A; 
#chains in the Genus database with same CATH topology
 3J7A N;  5KG5 A;  2QLF B;  3I82 A;  2ZDO A;  1B7Y B;  3EVM A;  4RPF A;  2WVF A;  4FYY B;  4RLE A;  1OY9 A;  2AP6 A;  4I64 A;  2GQ2 A;  4ZJO A;  4URG A;  2QYG A;  3OLA A;  2R7W A;  1U0H A;  2OH2 A;  5A8W A;  2Z30 B;  4LF9 J;  3QRR A;  3KNA A;  2BUN A;  4CTA B;  2C2E A;  4EO8 A;  1ULR A;  5KFM A;  1B7F A;  2B43 A;  2CJK A;  4USJ C;  1QAJ A;  2CNN B;  3CJK A;  1TV6 B;  5KFN A;  1YZ6 A;  4NML A;  3KHH A;  2M9K A;  1HQU A;  1YJ9 S;  1MSW D;  1GH8 A;  1VBY A;  2COL A;  3QGI A;  3TUI C;  1H7X A;  2PC6 A;  4UY8 T;  3QLH B;  3Q8P B;  2JRS A;  2D9P A;  1KLM A;  3GON A;  3NG8 A;  2XTJ P;  2CPZ A;  1FDN A;  1KOH A;  3HVT B;  4WJB A;  3QLH A;  1HHT P;  3KFW X;  4M63 A;  3OV7 A;  3I31 A;  3Q8U A;  3EXC X;  1T03 B;  1PGZ A;  4QR1 A;  1WI8 A;  2BZ2 A;  3BRE A;  3GJT B;  2HIQ A;  3SCK E;  4PQU A;  2D3Z A;  3PZP A;  5HLF B;  2GIQ A;  4B9L A;  2R7X A;  2HWI A;  3FSX A;  1XWL A;  4CIO A;  3FSI A;  2GHW A;  2DPI A;  1S1V B;  1TK5 A;  1V3S A;  1XJW B;  1AYE A;  3GMG A;  1RBL A;  3AFG A;  3RR7 A;  4YY3 F;  4IDK A;  1K9M T;  1YJR A;  5A8K A;  2CPI A;  3LGM A;  2W9C A;  3UCU P;  4DR1 J;  1EP4 A;  1SJR A;  2DHG A;  3JTO A;  4B9S A;  2FVC A;  3MPD A;  2CNO B;  2B5J A;  2J0W A;  2RB7 A;  3EVW A;  3P8B B;  4TKT A;  2PMZ D;  3NLC A;  4DU8 A;  3NBP B;  3ZTS A;  3AHP A;  4PG6 A;  3FMW A;  4WP8 A;  2OFG X;  1S1W A;  1M0S A;  6FD1 A;  1I5O B;  4ZP6 A;  2DXF A;  2J76 E;  1T3N A;  1JLB A;  2CUY A;  1PC4 A;  2WAQ D;  3QWU A;  1YIJ S;  5L1L A;  1JX4 A;  3UDE A;  4QR2 A;  3D1H A;  4DX5 A;  4JI2 F;  2MST A;  4X4R A;  3KK3 A;  3MTJ A;  1JLB B;  2CDQ A;  2DD8 S;  4FP9 A;  2AGQ A;  3HHN B;  2RIJ A;  5FII A;  4NCG B;  4KGM A;  2IVF B;  1BQM A;  2KJV A;  2YX7 A;  3T1H F;  1X31 C;  1GMW D;  4DHV A;  4X4V A;  3VAJ A;  4K5S A;  1CJT B;  4YDD B;  4I2Q B;  2GQQ A;  4NRU A;  4ZVS B;  3SSS A;  1FRM A;  2Y8W A;  3CCU S;  3Q2T C;  1K1S A;  1S76 D;  2MZQ A;  4QWE A;  1IM6 A;  3HCX A;  3IWX A;  4ECV A;  1TL1 A;  4ZJQ A;  1GTH A;  2BMB A;  1S9G A;  1Y00 A;  2DGO A;  3GFZ A;  2DH7 A;  3TW0 A;  4B9M A;  2R7T A;  4B3R F;  3QIP A;  2V69 A;  3G6Y A;  4ZOS A;  1S6P A;  3VGS A;  1S12 A;  5KG3 A;  2ALY B;  2HHP A;  4J37 A;  2ILY A;  2GHV C;  3FMB A;  4YQW A;  2W9B A;  3D67 A;  3W1Y C;  2MQO A;  1EQM A;  2AYE A;  2H5I B;  5CD4 A;  3K5P A;  2GMH A;  1S6P B;  5G0R A;  4JV2 A;  4JV5 F;  4UOG A;  2B8P A;  3B6B A;  1HBM A;  4DSE A;  3OR1 A;  3TVY A;  4X64 F;  1VK3 A;  3EGV A;  3FBF A;  1VCT A;  2BJ8 A;  2WON B;  2DNR A;  3LO3 A;  4QWB A;  5C25 B;  2KG1 A;  2E1P A;  2HQC A;  4OI2 A;  5EUH A;  5KG6 A;  4J9U E;  4K4X A;  1JJC B;  2W7O A;  1R0A B;  2E44 A;  2GZO A;  2GJ2 A;  1VQL S;  2E9Z A;  2IM1 A;  2W25 A;  2J7U A;  5J1N A;  3SEO A;  3TAP A;  4IKA A;  4C4W A;  4F3Q A;  1UVI A;  4EMD A;  3GYN A;  3PV8 A;  1S0M A;  5DLG A;  1U7L A;  4N8O A;  2M8D B;  5KFW A;  2Y9H A;  1Q16 B;  2YQ1 A;  4LBI A;  4WXW A;  4L72 B;  2RRN A;  2UUT A;  4DV4 J;  3QGH A;  2LEA A;  5IV4 A;  2GV1 A;  3C6U A;  1A0O B;  2F65 A;  5KFR A;  1ARO P;  2QLJ B;  3IAS 9;  1HIY A;  2VU5 A;  3LAK A;  4RZR A;  4CM0 A;  4ER8 A;  1YJN S;  4L75 A;  5CXT A;  4I7F A;  2GML A;  5IV3 A;  4Y28 C;  3PKY A;  4I56 A;  4CO1 A;  1HYS A;  3DRS B;  3EXY A;  3KDO A;  2WW8 A;  3KLI B;  1KQF B;  3VHQ A;  3PNI A;  3H4B A;  4B3O A;  3M32 B;  2D41 A;  2W9C B;  1O8B A;  3QJL A;  1SJQ A;  4QIV A;  1Z1Z A;  4QIF A;  5KFI A;  1B64 A;  3IRX A;  1NB7 A;  2J9D A;  3WC0 A;  2MYF A;  2BEF A;  1X4G A;  5I4M A;  4LSL A;  2ASY A;  1O6X A;  2GC8 A;  2MSS A;  4P73 A;  3ZNJ 1;  1LWC B;  4J9M A;  2KXH A;  5DGA A;  1WTB A;  4NWB A;  1WG5 A;  1RAA B;  2YKN B;  3FJ2 A;  3TP2 A;  2IA0 A;  1PO6 A;  4Q5V A;  1HD0 A;  4CP5 A;  4LVO P;  2VZ9 A;  4QR0 A;  3H42 A;  5C42 A;  3M2U A;  4CO3 A;  1ZTT A;  3O1L A;  3GZ7 A;  2P2C B;  3BBF A;  3D2W A;  3PVX A;  4DLE A;  1HAR A;  4DSI A;  4AYB D;  2RS8 A;  1DAX A;  3RBX A;  3W9J A;  4EYH B;  2HMI A;  1RTD A;  1U8W A;  2U2F A;  4ZPW R;  4E2F B;  3QGP A;  3DDK A;  3R97 A;  4CCH A;  2E5I A;  2DHX A;  2GO8 A;  3Q2S C;  4IG0 B;  3CD7 A;  3HUL A;  3NWR A;  2PD1 A;  3ITH A;  3OXF A;  2K3I A;  4MFB B;  3C6T B;  3LP0 A;  1D9D A;  4QYZ K;  5F0U A;  2B56 A;  1QSL A;  5CQG A;  4ZPV R;  1FXR A;  3G4S S;  2HNZ B;  2QSW A;  4RNM A;  3OW2 R;  2DB1 A;  2ZH9 A;  5H9E K;  4NLR A;  3NCR A;  4G65 A;  1BQN B;  1ZM9 A;  4DXL A;  1CQN A;  1JLA B;  3DOM B;  3RW7 A;  5FLX U;  3BN7 A;  3NGD A;  3MMC A;  1NZ8 A;  3DOL A;  2XLK A;  1SL0 A;  1RAF B;  1T0T V;  2Y0S D;  4UOF A;  4RNN A;  3IRX B;  4DN9 A;  3HPO A;  2QV6 A;  2BW2 A;  1LW2 A;  1WOR A;  2R42 A;  1BMQ B;  1RCO B;  4PCQ A;  1SC3 B;  2BX6 A;  1YJU A;  3I96 A;  4ZPB A;  5DZ6 A;  2A1B A;  3RAM A;  2ZKU A;  3PKM A;  3K5O A;  4FNI A;  4F50 A;  3V6D B;  1NJY A;  1FJ7 A;  4A8O A;  2F9J A;  3ISZ A;  4KB7 A;  4NPO A;  3HSJ A;  4NMX A;  3DRR A;  2HZV A;  5D0G A;  1P6T A;  9RUB A;  1SH3 A;  1KN6 A;  3DGP A;  4H4K A;  4K4S A;  3PX6 A;  1R0C B;  4I6A A;  4UZC A;  2HND B;  2GA7 A;  3IGV A;  2LQJ A;  2AQ4 A;  2HQF A;  3AD9 C;  4MKA A;  5A2Q U;  3CF5 Q;  1E6V A;  1F5A A;  1T7P A;  2MQN A;  4DR4 F;  2CQH A;  3MMB B;  2MGZ A;  4O4R A;  1VQ9 S;  2YQ0 A;  1UP1 A;  2H51 B;  1E6V B;  2EFN A;  5D4L A;  4P72 A;  2L08 A;  1TQL A;  2HLU A;  2E66 A;  3UWT A;  2KHC A;  1K44 A;  1YHQ S;  1F2H A;  2GVZ A;  2ZWO A;  4A8Q A;  2ZH7 A;  4CH0 S;  2J0Q D;  4KT0 C;  3TZZ A;  1QM9 A;  5B0E A;  1NK9 A;  1U25 A;  1SUQ B;  2RF2 B;  5GAD I;  1BLU A;  1H74 A;  1WEY A;  2PE8 A;  4TNO A;  3TZY A;  4YHH J;  2V5H G;  3OQ2 A;  3KLE B;  1PAU B;  3CW2 C;  4JI8 F;  4I68 A;  2DCU B;  4EK2 A;  2BDP A;  2B9X A;  2YKN A;  4DOZ A;  3PYG A;  2CQC A;  3DLE A;  4PEO A;  2V4J A;  5ETS A;  2F4F A;  5ETT A;  2RU3 A;  1N88 A;  2YWK A;  1HWK A;  1SV5 A;  1PYS B;  5J2P B;  3AB2 B;  1X4E A;  4G6V B;  2UV8 A;  2DK2 A;  3J7Y U;  2MQM A;  2OJ3 A;  1O5J A;  1IKV A;  2QX0 A;  4HT5 A;  2QL5 B;  1YJT A;  4LR9 A;  2LU1 A;  4WTY A;  5DGB A;  2EC0 A;  4RW8 A;  1C0T B;  2R7Q A;  3HD2 A;  2YKA A;  2UP1 A;  2CZ4 A;  4PYA A;  4WE1 B;  2VBX A;  1KSP A;  3QAU A;  1MWQ A;  4RBT A;  1VBX A;  4DR4 J;  3RRK A;  4F4W A;  1O51 A;  1Q79 A;  1SI9 A;  3W2V B;  2AYG A;  3N5B A;  4B3T J;  3L7P A;  4C9D A;  3HLU A;  4USV A;  3MAA B;  2KHD A;  2BAN B;  5C2C A;  3ILJ A;  1GXL A;  2EI5 A;  1U1R A;  2VG6 A;  4KKO A;  5J2M B;  4KBI A;  2FQQ B;  4DSF A;  4B9T A;  4FXW A;  4PXC A;  2M0G B;  4IFY B;  3TVK A;  3K8V A;  3W65 A;  4DEZ A;  1YGY A;  4F25 A;  7FDR A;  3K58 A;  2ZH3 A;  4DFJ A;  4A8M P;  1U1N A;  1PCA A;  3CJ5 A;  2I1R A;  3BPS P;  2GX8 A;  3CJ8 A;  2B0G A;  2BKO A;  2WRM A;  4ID8 A;  4NI2 A;  4BHQ A;  4J9R A;  1L3U A;  3CC2 S;  4RU2 A;  1R27 B;  1WG4 A;  2J8A A;  3ENA A;  1T05 A;  2Z58 B;  3LGN A;  2IMW P;  1C0U A;  3ENV A;  3OVS A;  2GO9 A;  3TI0 A;  5J1E A;  4OZL A;  4RWX A;  2CWX A;  3BQ1 A;  3MR6 A;  1PJ7 A;  2G1H A;  2AWZ A;  3QFW A;  3A3P B;  4H4M B;  1VQ7 S;  3HXM A;  4DPW A;  2HHU A;  5HAO A;  4G1Q A;  4Q2L A;  1YSJ A;  4YR3 A;  4DR3 F;  2I6W A;  4ECT A;  4NLD A;  4O44 A;  3N79 A;  1R8H A;  2VQF F;  5D3G B;  3VAL A;  4OYW A;  5EWE A;  4YME A;  4DDF A;  2HBR B;  3J81 Y;  5HRO A;  4OJ3 A;  3CIZ A;  2JHE A;  2GVD A;  4ZVT B;  1Q8K A;  4K2J A;  2ASL A;  2UVR A;  2FC8 A;  4WYL A;  1NRK A;  2CWK A;  3PXG a;  4Y2C A;  4I6Y A;  3VZH A;  3A8I A;  1VQ5 S;  2VIC A;  1Q4R A;  2DO4 A;  1N5V A;  2L41 A;  4X4P A;  1HMV A;  3BH6 B;  3M6W A;  3MCS A;  1DQ9 A;  2ATC B;  1U0H B;  4WFN Q;  4RW8 B;  2K1R A;  2NYH A;  2R4F A;  1S6Q A;  5KG4 A;  4RNO A;  3DU6 A;  1IVZ A;  3D7S B;  2IM3 A;  2YNI B;  1FD2 A;  4E8U A;  4Y34 A;  4E0D A;  3W66 A;  1AUS L;  2DIU A;  3NXZ A;  1B0T A;  1UJ5 A;  3HDS A;  2IHR 1;  4Y2K A;  3S01 A;  1ZPW X;  2O3D A;  3TJ9 A;  3PIP Q;  4DQS A;  2DNQ A;  2HSE B;  5CYQ B;  5HMZ A;  2YKM B;  4ENO A;  2RD5 C;  3O8W A;  5KT7 A;  2QA4 G;  3TZX A;  5G0R B;  4OV6 A;  1S9E B;  4NX9 A;  1U0S A;  2F9D A;  3W8P A;  2P9C A;  1I94 F;  4FN5 A;  4BWM A;  2IM2 A;  3IMQ J;  4URS A;  3QZ7 A;  4JP8 A;  3H40 A;  2AD9 A;  3HVW A;  4P7V A;  1KFS A;  1U6B A;  1AW0 A;  2U1A A;  1WJ9 A;  5AXN A;  1T3O A;  2AZ1 A;  2OD4 A;  3O5T B;  2CQB A;  5HLF A;  2AJ2 A;  1LOU A;  3BJY A;  2DRA A;  1SQF A;  4FVC A;  3S7R A;  4ED1 A;  3HJV A;  3P3D A;  2EEY A;  2MEW A;  4AT1 B;  1VLO A;  1MML A;  1GTE A;  1RA7 A;  1LFP A;  5KOX A;  2FB0 A;  4KHR A;  4MYT A;  1P27 B;  5L38 A;  5L1I A;  1H38 A;  2B4P A;  2WOM B;  2V9W A;  5IT9 U;  3K59 A;  1XMO J;  2ALZ A;  1VRT A;  1F6T A;  2A18 A;  4LSZ B;  1NH7 A;  2FHJ A;  4FPR A;  4RW4 A;  2ZZM A;  3M8Q A;  1MLA A;  1W2B R;  2H4Y B;  3R1L A;  2KZM A;  4CO4 A;  2Q3P A;  1FER A;  2LA4 A;  5DM6 Q;  1M1K T;  3P49 B;  3FBB A;  3C2P A;  2W24 A;  3MAQ A;  3BZQ A;  2DHH A;  4ZHR B;  1LWF A;  1NPK A;  1TTH B;  3HI9 A;  1LXN A;  2IY5 B;  1DLO B;  1FDD A;  1SCJ B;  2LQB A;  2MZT A;  5IM0 B;  4GVB B;  5KFX A;  1AXQ A;  2DY9 A;  4HEA 9;  2H9Z A;  2XGP A;  5KTQ A;  3MUR P;  4V19 X;  1C2P A;  3A8E A;  3SFU A;  2C42 A;  4FF3 A;  4KGV B;  3W2W A;  1RWU A;  2XGQ A;  2C3U A;  2V50 A;  3UW1 A;  8ATC B;  3BQ2 A;  1TFW A;  3CJT A;  2V67 A;  3DN9 A;  2ACY A;  3MEC B;  4A48 A;  4ZJL A;  1AZS B;  1E6Y B;  4IO1 A;  4FS2 A;  2D3O 1;  3OTD A;  3SDE B;  2VG7 B;  3NNA A;  4OYP A;  1NSK L;  4JUZ A;  4MKV A;  2BAC A;  4P9S A;  1IBM F;  2DEI A;  1HNZ J;  2EBE A;  2WBR A;  2W4C A;  3CJQ A;  2J9C A;  4RUC A;  3L7O A;  5SUH A;  2KM8 B;  3T1Y J;  5I3U A;  3DOK B;  2HRT A;  2OPP A;  2Z2Y B;  2PI4 A;  2B6A A;  2IRU A;  2BJD A;  1U1O A;  2F3J A;  2G2O A;  3NRB A;  3P5T L;  4C3M A;  2ZBI A;  1V3Z A;  4MFB A;  1KDN A;  4LQ3 A;  3GTY X;  4RU9 A;  1T8E A;  5DDQ C;  4YY3 J;  2CJY B;  3N6L A;  2H54 B;  4J9S A;  3RGI A;  1I6J A;  3LWM A;  4MTP A;  3QT7 A;  3UVJ A;  7AT1 B;  5KAK A;  2NLW A;  3JQM A;  4AQY J;  4ZPD A;  5KFH A;  3HP6 A;  4X65 J;  3GCX P;  2CNL B;  1UFL A;  3R2D J;  4R8U A;  3OFG A;  1ACM B;  1KHV A;  3KUG A;  3BKT A;  3CT9 A;  1TKT A;  1RDR A;  3ULH A;  3MED A;  1N4L A;  4BS2 A;  1EHW A;  1RTI B;  1TUW A;  2ZZT A;  1VC0 A;  1TK8 A;  1IKY B;  4PZV A;  4MK7 A;  2WZ1 A;  1FDB A;  1TL4 A;  2FZK B;  3CXC R;  3ZZ0 A;  1DUR A;  1WWH A;  4QIW D;  5LOQ A;  5H9F K;  2EKY A;  2YPY A;  1IJE B;  2E1C A;  2DGW A;  2RQC A;  4M5I A;  2UUB J;  3SDE A;  4U67 Q;  1JJ4 A;  1SV5 B;  2B7C B;  2JEI A;  2L9N A;  2ZVI A;  3I0S A;  2AX0 A;  1M5S A;  4OYO A;  4LFA F;  2OGU A;  3IR7 B;  4TN2 A;  2DGU A;  2FHO B;  3LPY A;  1XMB A;  3NBP A;  4OJG A;  2PA8 D;  5IOL A;  3KWM A;  3LQV A;  5FDL B;  2LFV A;  1QTN B;  2XMJ A;  4FNH A;  1S48 A;  1LWX A;  5KFB A;  2BQ3 A;  1R0B G;  2D7S A;  1CJV B;  4XIU A;  3LF0 A;  1L5U A;  2I5J B;  4JI3 F;  3R7S B;  4PQA A;  2ZJR Q;  2HW3 A;  3AOA A;  3CDB A;  1CUL A;  1UW9 A;  2Q43 A;  3CTR A;  3N01 A;  3QO9 B;  5D0R A;  4N41 A;  2HMI B;  3QMQ A;  3ETM A;  3OJU A;  1D3W A;  2BJE A;  2OKQ A;  3FSY A;  3GG1 A;  5B0C A;  3I9Z A;  4NE9 C;  3EGN A;  4ECS A;  2VA3 A;  2PFF B;  3KYL A;  1VFJ A;  4CLW A;  1BE4 A;  4DWI A;  2DO0 A;  3HHL B;  3N5F A;  1S1T B;  1WHX A;  2P6T A;  2Z2Z A;  3FBC A;  2Q79 A;  5DDO C;  1HPZ A;  3H59 A;  4LF6 J;  1RWV B;  3HZE A;  3TX8 A;  3GWC A;  3PM9 A;  1S1T A;  5A6W A;  4EFA C;  1U1P A;  1F2G A;  1KKH A;  4GO7 X;  2KXN B;  1MRO B;  4FDF A;  2YVS A;  1FWL A;  5E3A A;  1IJF B;  1YDL A;  1FXD A;  3L3C A;  5I42 A;  2DNN A;  2N7Y A;  2CQG A;  3MPV A;  4H4M A;  3VGV A;  3I55 S;  3KHR A;  1X0P A;  4J5O A;  3HO1 A;  2WB4 A;  2JH3 A;  1QVG R;  1XNR F;  1X5T A;  4ILM A;  2DNL A;  2KB2 A;  3C16 B;  4DQR A;  4OZ1 A;  3K0J A;  1F5B A;  3NEK A;  2WSF C;  2VG6 B;  3BEG B;  2RSQ A;  4KKO B;  5BYS A;  2DIT A;  4IRC A;  1L3T A;  3JYT B;  1F9H A;  3KJN B;  3OFH A;  1MMD A;  1PG5 B;  2KI2 A;  2YNG B;  1XNR J;  4CLZ A;  1KQK A;  4J9N A;  3MOZ A;  4LBH A;  1ZBT A;  5I3Q A;  3U1M A;  1WHV A;  2X51 A;  1PBA A;  2EFG A;  1DJ0 A;  4NYO A;  4U7U K;  4AXI A;  4EGL A;  1EIY B;  3MM7 B;  3CME S;  1CBK A;  1HNV B;  3EUN A;  2XNR A;  5J2M A;  2FHK A;  5LMU F;  3LPE A;  4F4X A;  4DZD A;  2K1R B;  5J2Q B;  5JUM A;  3PW7 A;  2EFO A;  1SJ1 A;  1MMN A;  2IDL A;  2E7X A;  3ILO A;  3CC4 S;  3MEG B;  3SFG A;  5KG1 A;  3LA0 A;  3EZ5 A;  1NJZ A;  5BXI A;  4Y00 A;  1REV A;  2HKE A;  4Z7C A;  2XNQ A;  5AJ3 F;  2YH1 A;  2XHW A;  3BS9 A;  2HYI B;  3UD4 P;  2BKN A;  3FZ2 A;  5HK4 A;  1PBU A;  2RDJ A;  4DL6 A;  3QNW B;  4ZDN A;  2LMI A;  3BN4 A;  4DV7 F;  2MLX A;  1HR0 J;  3PJX A;  1IBC B;  1NXI A;  2N4D A;  5CYM B;  1Q86 T;  1J5O A;  3CC7 S;  1RIS A;  3TAN A;  1WSR A;  4GRS A;  1HLW A;  2VFU A;  1FWP A;  3CNQ P;  3QIP B;  3V4M A;  1M1G A;  2F8H A;  1QE1 A;  5CYM A;  3WHI A;  4EYI B;  2FTR A;  4OIX A;  2VON A;  2VQE J;  2V4R A;  1TL5 A;  4KHP F;  2XI3 A;  1OJ4 A;  1BWV A;  2W2O P;  3EZO A;  4O3O A;  2GHP A;  4LMZ A;  5LXR A;  4DX7 A;  3H90 A;  2ZHB A;  4RW9 B;  4X62 F;  2XMV A;  2ZBR A;  4NLY A;  5HP1 A;  3Q8S B;  2L9D A;  1RP5 A;  5E3P A;  4A8F A;  1FE0 A;  4OLP A;  1IWA A;  4JYA J;  4QCL A;  3TAM B;  3FVY A;  2VOO A;  3K5L A;  4DUZ F;  2C3P A;  3PAC A;  2UUA J;  3OSN A;  4ELT A;  3O2I A;  1JKH B;  2YNH A;  5CD4 H;  3DRP B;  1JLF A;  1RLC L;  2WB1 D;  3DMJ B;  5E2Q A;  4ELV A;  3MM7 A;  4NXN F;  2AJ1 A;  4USU A;  3A1Y G;  3T9N A;  2GNK A;  4DU7 A;  2XBP A;  1AZS A;  1LK5 A;  3CMA S;  1ZH5 A;  4JBC A;  4CLT A;  1Q95 G;  1S1X B;  5JVG Q;  1VK8 A;  2KN4 A;  4YUD A;  3F0N A;  4LBP A;  2CQ3 A;  3GFH A;  1OO0 B;  4DQQ A;  4OHY A;  4V19 J;  4CLF A;  1X0F A;  2BQR A;  2CJA A;  2OAU A;  2J9E A;  4DV6 F;  4KY3 A;  4P74 A;  3ZNU A;  2YNF B;  4WFY A;  3WC2 A;  3JSB A;  4KIA A;  2AZ3 A;  3E2E A;  2AX1 A;  2RRA A;  3OT9 A;  5E3C A;  3Q0A A;  4Q0B B;  3OR1 B;  3FDS A;  1UVK A;  4KO0 B;  3OR2 B;  2AEF A;  4ZPC A;  4DV2 J;  4OL8 A;  5KFG A;  1WTF A;  4C6A A;  3UI3 A;  4G1Q B;  2PMW A;  3DLE B;  3T5J A;  4M8L A;  1FA0 A;  4OHX A;  2V6A A;  5IC6 B;  1C4A A;  4HVZ A;  3SCI E;  4W4M A;  3UDC A;  2DR7 A;  1IWG A;  2PSZ A;  4IFV A;  1PJ6 A;  4F3O A;  1JLG B;  5K14 A;  1FO1 A;  1X4C A;  4HHU A;  5EWF A;  2PEH A;  1RYS A;  1YK9 A;  2B9Y A;  3NCP A;  2VC1 A;  1NPP A;  2ZJP Q;  2MJU A;  4RW9 A;  1JLG A;  5K14 B;  4DCO B;  3C15 B;  2BW7 A;  1C4C A;  2XS2 A;  1FRJ A;  3PIO Q;  3VAH A;  4ZLP A;  2YKQ A;  3BYP A;  3UDL A;  5F8N A;  2C28 A;  4LVN P;  3RJM B;  2QEX S;  5THW A;  2MQQ A;  4ECU A;  1UW4 A;  2CPJ A;  3AY0 A;  4JOU A;  1RKJ A;  1S77 D;  3WQP A;  2FHM A;  3R27 A;  2FGC A;  3AB4 B;  2G0J A;  2EK6 A;  1LKZ A;  1RT1 B;  2GJF A;  4F7V A;  4JI1 J;  2XYP B;  4MKB A;  2JX2 A;  3MUM P;  1RTH A;  2HGM A;  1SJF A;  2Y1L B;  3GQC A;  3NNC A;  5CZX A;  1H2V Z;  1MN9 A;  5IT0 A;  3DYA A;  4UY8 5;  5GME A;  3WBZ A;  1OS5 A;  2E5L F;  3NMA A;  2QSF A;  4PG5 A;  2LEB A;  1HBO B;  1HQE B;  1WKJ A;  1WKK A;  3H98 A;  3BBB A;  3QSI A;  1FE4 A;  5CYQ A;  5T7L A;  3X3U A;  5IM0 A;  2EC2 A;  3BO4 A;  1ZET A;  1IKW B;  5KT2 A;  1XR6 A;  1LWC A;  3B82 A;  3HFV A;  3TX0 A;  3MMA B;  4YDX A;  4NLG A;  5KT5 A;  1HQ2 A;  4DG1 A;  3K17 A;  1WEX A;  3SI8 A;  2VFT A;  2XSJ B;  2YQ3 A;  2VOP A;  3DOL B;  4KQZ A;  1Y10 A;  2W2N P;  2UUW A;  2HS3 A;  4DG1 B;  4ECX A;  4ITS A;  3GJQ B;  2F8M A;  2OSQ A;  1HMV B;  4KH0 B;  5A2Q Y;  3M6X A;  3RW6 A;  3TUZ C;  4B3S F;  3H20 A;  4RUH A;  4F3M A;  2P9E A;  3QT8 A;  4U96 A;  3TJ8 A;  1VBZ A;  1Z2Z A;  4NA3 A;  2FUG 9;  2FZC B;  3JQJ A;  4OZ2 A;  1WC1 A;  3I32 A;  5IFM A;  2YKO A;  5LT5 A;  4PAB A;  5I3U B;  3JSM B;  1ZZN A;  3C46 A;  3KG4 A;  4EBC A;  2ZOM A;  1XEZ A;  4CYU B;  1YKW A;  4C98 A;  5B08 A;  3I0R B;  5EDW A;  3PYF A;  4G3I A;  2MQP A;  2HWH A;  4P71 A;  1M5K C;  4NLT A;  1Q81 T;  4DV5 F;  4P52 A;  3ZZR A;  1U2F A;  2R3V A;  2QT7 A;  5D15 A;  5DO2 A;  1PC5 A;  4OI3 A;  4D3G A;  3EX7 B;  4OYI A;  5J1E B;  1X4H A;  4HL9 A;  3CD6 S;  1QAX A;  4ZVG A;  4P7T A;  1IQT A;  1RSC A;  5CH7 B;  3SQO P;  1H98 A;  3FFI B;  3KK1 A;  2OO4 A;  2FLO A;  2J5A A;  4IFV B;  4IQM A;  4A46 A;  1P8G A;  2HFZ A;  2ZH5 A;  5L39 A;  2DR5 A;  4CLS A;  1RA6 A;  3MTK A;  2K3K A;  3LGH A;  4OI6 A;  1JB0 C;  1JLQ A;  2HQI A;  2J7W A;  2JNJ A;  2P9G A;  1MWZ A;  5ETR A;  4JI0 J;  2HGN A;  5D77 A;  1K8A T;  1FJE B;  1NHV A;  3BDP A;  4DFP A;  1WC4 A;  5ETO A;  2R7U A;  1QLN A;  4YEA A;  4B9N A;  3H5Y A;  3DI6 B;  4K4Y A;  3AOB A;  1RHR B;  4NLV A;  5L46 A;  3W5Y A;  2DPJ A;  2MKC A;  1CVJ A;  2AGO A;  3NGK A;  3NGS A;  1KS2 A;  3SMZ A;  3UR3 C;  2Y1J A;  2R8J A;  5GAG I;  4C8K A;  1WHW A;  2CZ9 A;  4DZ6 A;  2IJR A;  2DR8 A;  3CCS S;  1FTR A;  2VL1 A;  2ZD1 B;  4N47 A;  4DX8 H;  4B3M F;  6AT1 B;  1TKZ A;  2UUC J;  1V3R A;  2ROP A;  3D3B J;  3DYA B;  3R5G A;  5JJB A;  1UA1 A;  4IR1 A;  5M2U A;  1HBU A;  4QW9 A;  1FFS B;  2MY7 A;  2QA4 S;  2YNI A;  3ZZP A;  5LMN J;  1LQ9 A;  2CJB A;  2FZG B;  3LAM A;  4MH8 A;  1NSQ A;  4C8N A;  4BDP A;  1QY7 A;  3RYL A;  1R31 A;  2VV5 A;  4C0B A;  1WOP A;  3UCZ P;  5IC4 B;  1JK9 B;  2LP4 A;  2VFR A;  2YX4 A;  2EFQ A;  3MMA A;  4C7Q A;  1U1Q A;  2LCW A;  1SJ4 P;  2ILZ A;  3R5J B;  4HYK A;  2VUG A;  2FJV A;  1CS4 A;  3DNC A;  5KT6 A;  1ITP A;  3HD1 A;  2RRB A;  4CLU A;  2VPX B;  4WK3 A;  2ZDP A;  1S49 A;  2KKH A;  1KC8 T;  3FFI A;  3FCV A;  1F9F A;  1WDD A;  2Y8Y A;  5HP1 B;  2IYI A;  3C16 A;  1X60 A;  1DAR A;  2BE2 B;  3Q8Y A;  1RGV A;  3VCD A;  5B0A A;  5ADZ A;  4ZMM A;  1RT4 A;  5KT4 A;  5DG9 A;  1SC4 B;  2CPD A;  3TA0 A;  3UN5 A;  4Q44 A;  2ACM A;  3MR5 A;  3HVR A;  2LQ5 A;  2WSC C;  2DRB A;  2PMH A;  1RI7 A;  2VDI A;  4PUO B;  2RAQ A;  3CSK A;  4B3T F;  4URQ U;  4ZVF A;  3DLK A;  2R7R A;  1EKR A;  3QT5 A;  2CJX B;  4CYU A;  3BM7 A;  2V9K A;  3JAM U;  3C15 A;  2IRX A;  1F9E B;  2NXC A;  3K89 A;  3KLV A;  2ZBP A;  3THT A;  2E5L J;  1OYE A;  4P10 A;  5D0H A;  3RB6 A;  1C0T A;  4ZCL A;  2ZHO A;  1PYT A;  3PYD A;  3EMT A;  4PKD B;  5J2Q A;  1F60 B;  1PJ5 A;  2X3G A;  2DR9 A;  2J6U A;  2VIH A;  2YX1 A;  2HK2 A;  1KVI A;  2DY1 A;  4JI1 F;  1BUX A;  1UVM A;  5KFZ A;  3DRX A;  5KFU A;  3BSN A;  2AGP A;  4NXM J;  3I5C A;  1UCN A;  2XZT B;  5F0W A;  4JI8 J;  2AV5 A;  2DH9 A;  1UZH A;  2HBQ B;  4M5M A;  1UEU A;  3IBW A;  4W90 B;  4AUK A;  2XLI A;  1JLE B;  2KDO A;  2FJE B;  3BR8 A;  3ELH A;  4F36 A;  3SCJ E;  4IH5 A;  3C3L A;  2HHH J;  3HVA A;  1NZA A;  1WC6 A;  1XNQ F;  2LDI A;  2KH9 A;  2FGO A;  3A3O B;  3P96 A;  1XN9 A;  2MHN A;  1HNI A;  3M8Y A;  4RUB A;  3ZZU A;  2VBW A;  4A8W A;  4WZM A;  1WC0 A;  2CJ9 A;  3C6U B;  3TA2 A;  2O66 A;  1U02 A;  4ZVU B;  2K7K A;  2E29 A;  2LKZ A;  3MPY A;  1GAO A;  5LL6 d;  2AMC B;  4B02 A;  1RHJ B;  2FLP A;  1FX2 A;  3HKZ D;  3EPI A;  2HVH A;  2MQ8 A;  2OPP B;  3PFO A;  2C2M B;  3PW2 A;  3GYG A;  3M4X A;  1SIZ A;  5B09 A;  4N5S A;  4ED0 A;  5AXM A;  4V1A k;  1UEK A;  3KJV B;  3G96 A;  4FYX B;  1UZD A;  4RW7 B;  4WP3 A;  1Y5N B;  2XMK A;  1QAY A;  4LR7 A;  4KPY A;  1HBN A;  1NHU A;  3G87 A;  1W2I A;  1P9Y A;  3OTO J;  2IJN A;  1D1U A;  1NKB A;  2QO3 A;  1IBM J;  1GMV A;  3KHL A;  4Q7A A;  4KFB A;  3ADA C;  4P2M A;  5ETV A;  4WXO A;  5D6G A;  1Q82 T;  1FXL A;  4J91 A;  4P6Q A;  1NK6 A;  1XIQ A;  4FF2 A;  4BC9 A;  2UXD F;  1HNV A;  1N5S A;  4WKY A;  2UU9 J;  4B3R J;  3LP1 B;  2D3O R;  1S1W B;  2UUA F;  2V94 A;  2L9W A;  4IG3 A;  4USW A;  3CUN A;  2VC0 A;  4OI1 A;  5KFJ A;  5IT9 Y;  3AQO A;  1RT2 A;  1VIO A;  2KT2 A;  1TL1 B;  3H5U A;  4I7F B;  4LF6 F;  1GMW A;  3MDF A;  3NY0 A;  2VOD A;  4KC5 A;  2BOP A;  1BQM B;  2OPQ B;  5H9E J;  1V5I B;  4OLO A;  3J81 U;  2VA2 A;  3EGZ A;  5ETK A;  5GAE U;  3M7V A;  3UQS A;  3A12 A;  2Y1R I;  3PTW A;  1U4B A;  1S10 A;  2I9S A;  2RT3 A;  3ZC4 A;  3T3F A;  3W9H A;  3GSI A;  1I3O B;  3Q24 A;  2EFV A;  2MY8 A;  1N8R T;  4RKU C;  3TR5 A;  1E6Y A;  1Y5L B;  1FI4 A;  1RBA A;  2HBY B;  2NSB A;  5ITH A;  1QAI A;  3BGR B;  1FK9 B;  2KRB A;  1HFE L;  2QA2 A;  2VG5 B;  2B5J B;  3HVT A;  2X1G A;  3I4H X;  3MMC B;  3D0G E;  2VHG A;  1IBK J;  2RHS B;  1R0A A;  3ILL A;  1S72 S;  2KFY A;  1W25 A;  4DFM A;  4R5P A;  1H7W A;  2KL8 A;  1RUS A;  1NAQ A;  5L8R C;  4A47 A;  3RAQ A;  3D1Q A;  1NK5 A;  3L4B C;  2DNY A;  4DN0 A;  1WI6 A;  3CCR S;  1SH2 A;  3PEH A;  2IVY A;  4PPD A;  4ECW A;  5HAN A;  3E01 A;  2EG1 A;  2JEG A;  2KT5 A;  3LW5 C;  3JS9 A;  5T41 A;  5DLF A;  3HHD A;  2EW9 A;  2VPW B;  2DH8 A;  4D3H A;  3GIJ A;  4ZIV A;  1BQX A;  5DQH A;  2OPR A;  4DR2 F;  1B99 A;  3MCN A;  1J5O B;  2GJI A;  3N4W A;  3EGW B;  3LAN A;  4UZB A;  4PPZ A;  1KFD A;  3FC9 A;  3IC1 A;  5F8J A;  2XYH B;  3H7H B;  4RWW A;  2N82 B;  3KNG A;  1TUV A;  1CJK A;  2RVJ A;  1RTJ B;  1FNM A;  1VHF A;  2APO A;  2QYC A;  1NDK A;  5ETN A;  3D0I E;  2X1F A;  4X65 F;  4IR9 A;  2MKI A;  3DCA A;  2GCF A;  3SZ2 A;  2DNZ A;  1VS3 A;  1L3K A;  2F40 A;  2NPF A;  5D0E A;  4C0O C;  1FNX H;  5KFL A;  4ECY A;  1NBE B;  4F04 B;  2CQI A;  1RAO A;  2QMW A;  4GVL A;  5HMY A;  2M4M A;  2MZS A;  2HGL A;  4WYW A;  1VBK A;  2G0C A;  4IOB A;  5B0G A;  2JC0 A;  2LEP A;  4OMF G;  5CYJ A;  2OPQ A;  3SV4 A;  4DV3 F;  2V4J B;  1NSP A;  1GT8 A;  3R6L B;  3CJ3 A;  4NL5 A;  4QIE A;  5DS7 A;  4ANE A;  1NDC A;  2NCK L;  4K5R A;  4K0K J;  2ERR A;  3DLH A;  3UCG A;  4ED3 A;  1S0O A;  1NHK L;  4DSJ A;  1U2R A;  4O0I A;  1HNZ F;  1H6K X;  3DHW C;  2O5D A;  3M8P B;  3OXL A;  4WU3 A;  2LQ8 A;  4PWU A;  1UJ4 A;  1NDL A;  5KFD A;  4DQP A;  3TA1 A;  3TNV A;  2C2O B;  1HA1 A;  4ED8 A;  4RUA A;  2BE2 A;  3AOC A;  4LF8 F;  4Q45 A;  4NXM F;  3J7Z T;  1HWJ A;  3FZB A;  3HHL D;  4HAC A;  4O0N A;  3J80 Y;  1C0U B;  2JZ5 A;  1N48 A;  2WSE C;  3GYX B;  3DMJ A;  1I51 B;  1RU1 A;  2HRY A;  2V2V A;  4KGZ B;  2B9W A;  5F8G A;  3MPW A;  1X7V A;  3GIK A;  1BWE A;  3UO0 A;  2LQ9 A;  4XDD A;  2M70 A;  2VBZ A;  4K2X A;  2CG8 A;  3ZZT A;  1RB0 A;  1HPZ B;  2R8G A;  5L9N A;  4PWD A;  2MMY A;  3D6F B;  4TQS A;  4LFA J;  5K20 B;  4F4A A;  4X4T A;  4ED7 A;  1APS A;  1GXT A;  3MD3 A;  4ZIT A;  2PT0 A;  5KFS A;  2QL9 B;  3TRG A;  3VVT A;  4TXS A;  2R2T A;  3CCJ S;  2W9B B;  2HQ3 A;  4KTQ A;  4HLB A;  1NSA A;  2WVC A;  3N28 A;  2HHW A;  4CDI A;  4QOT A;  3FEZ A;  3OFF A;  1JXV A;  2XQC A;  4W92 B;  4OYX A;  4KGK A;  2ZWP A;  4OHW A;  4F0K A;  3FBE A;  4F4Y A;  4W98 A;  1FKO A;  4OZ0 A;  4X2B A;  3KLF B;  4ES1 A;  2OFH X;  4LRF A;  3TQE A;  4NYP A;  1SVD A;  5JMN A;  2ZJQ Q;  2BRK A;  4OZ3 A;  4WWS A;  3U02 A;  1OWX A;  2Y3Y A;  4AQY F;  2HPU A;  1XTZ A;  2AW0 A;  2JSX A;  1F3V A;  3D4J A;  3UFC X;  3VR1 A;  5FDL A;  3DKD A;  3LWL A;  4CO0 A;  3RB4 A;  3S6E A;  3J7A 1;  2K8G A;  4M5N A;  2ZC3 A;  3W62 A;  2LA6 A;  3RRH A;  3VQT A;  1D9F A;  1QDU B;  1JXL A;  1NK7 A;  4K50 A;  2KVI A;  2KZZ A;  1Z4U A;  1S57 A;  1S79 A;  1DTQ B;  4RL1 A;  2YXL A;  3B4M A;  2ZUA A;  5LMN F;  2HNZ A;  4TLQ A;  1TKD A;  4ATN A;  4OQJ A;  2W9A A;  3GE9 A;  1IM4 A;  1JLC B;  5ETP A;  5ETQ A;  3WIV A;  2UUC F;  3CD5 A;  4TYB A;  2ASD A;  2I2Y A;  3UD3 P;  3MFI A;  1VQM S;  1UJ6 A;  1F5C A;  3BGO P;  3KJV A;  2LXI A;  3AA8 A;  1F3F A;  3CJS A;  3DLK B;  2YY3 A;  1AA1 B;  4UUX A;  4WP9 A;  2ATL A;  2CQ2 A;  2QE5 A;  5HVF A;  3UNG C;  2WTF A;  1WSV A;  2PO4 A;  1WKL A;  4DL0 C;  1CJU B;  4FKY A;  3KOA A;  3D9B A;  4LSN B;  2RHQ B;  1ZAX A;  4PYD A;  5HJY A;  2Q66 A;  1FHT A;  2OI2 A;  3JSM A;  3GPA A;  1Q5Y A;  3SSR A;  3R5D A;  2A6M A;  4L73 A;  5E3R A;  4CRJ A;  3O44 A;  4ZK7 M;  3JSR A;  4NRT A;  4DPO A;  3CCQ S;  1YVF A;  5FD1 A;  1LWE A;  4LF4 F;  2CZV C;  4ETZ A;  4KHM A;  3ET6 B;  4ETX A;  3FQL A;  2AJF E;  2RJZ A;  2VJU A;  4USK A;  3GIL A;  3DLB A;  3OFE A;  4OJH A;  4ILL A;  2H48 B;  3BDE A;  4PG4 A;  1HNX F;  1UA0 A;  1ZAW A;  1SB6 A;  2BJ3 A;  3L7U A;  2QC3 A;  2M3D A;  3MFH A;  4J9V A;  3MR2 A;  2XS7 A;  4ZVQ B;  1FRX A;  5C24 A;  1U1K A;  2R7V A;  4NLU A;  5LJ5 Y;  2HZC A;  1TV6 A;  1U8S A;  3KK3 B;  2VAS A;  3EWG A;  2VD3 A;  2DGT A;  1N32 J;  2FY8 A;  3GU0 A;  2BVZ A;  4DR3 J;  3V5R A;  3TVZ A;  1HD1 A;  4BBY A;  2HWT A;  3HMJ G;  3M8W A;  2J6S A;  1PIE A;  1XMQ F;  3MEK A;  1U09 A;  5T7L B;  1H73 A;  1KHW A;  2D74 B;  4S0M A;  1N33 J;  1DFD A;  2LXF A;  2BM0 A;  3N6N A;  2DVI A;  1FJG F;  4B17 A;  1RKI A;  4QYZ J;  3MEE B;  3H2L A;  4F0M A;  1NH8 A;  1VYA A;  2A3J A;  5FJ4 A;  1RT7 A;  5GAE I;  5LM7 E;  3Q89 A;  3A13 A;  2F8E X;  3IS9 B;  4CNZ A;  5CCM A;  1CLF A;  3KLH A;  1BC6 A;  3M1V A;  3NS7 B;  3HF5 A;  1DLO A;  5AXL A;  2KFZ A;  3PRB A;  4XAK A;  4G1P A;  4USM A;  2PI5 A;  1OY6 A;  1RT4 B;  1RWP B;  1AT1 B;  2HHQ A;  1CC8 A;  3D28 A;  3KHG A;  1S1U A;  1TEL A;  5BYQ A;  2ROE A;  2ZIT A;  2XMU A;  3P4U B;  1SKR A;  1I94 J;  2MKJ A;  3E01 B;  3JTP A;  2L48 A;  2QN6 B;  3AAW B;  2CQD A;  2OHD A;  3NP5 A;  4C48 A;  1OYD A;  2H4W B;  1NO8 A;  2CDR B;  2WON A;  3IP0 A;  4YN3 B;  5C25 A;  3KLG B;  1C1B A;  1FKO B;  1JQG A;  2MDA A;  4KH1 B;  5ETL A;  4CQ1 A;  1N5Y B;  1YBT A;  3BB5 A;  3MAH A;  4FBT A;  1A6L A;  3BH7 B;  2GIF A;  2CFX A;  2OLW A;  4LSL B;  4RW7 A;  2W8L A;  2CAJ A;  4UOH A;  1G2E A;  1CS4 B;  3W7B A;  3KG0 A;  3OL9 A;  2JVR A;  1GK8 A;  1YRU A;  4ALZ A;  4IYQ A;  2QMU B;  3SCL E;  2MGZ B;  2E5G A;  3T6J A;  1RT3 B;  3EYZ A;  3HSD A;  3NGU A;  3G82 B;  4HAC B;  2R8I A;  1KVK A;  1FFW B;  3CIM A;  3DLL Q;  1SBR A;  3CJR A;  3D1O A;  4JI5 J;  1VGY A;  3MM6 B;  3TJA A;  1A9N B;  1T9V A;  3MAA A;  5DM7 Q;  2MPU A;  4Y65 A;  3HKW A;  3E8O A;  1NND A;  3D6H B;  3ONQ A;  2GGP A;  5E7O B;  1KON A;  1YIT S;  2MHE A;  3I6P A;  3EDR B;  4GO5 X;  3F56 A;  3D6T B;  2UXB J;  4JI5 F;  4MK9 A;  2C3O A;  1TKX A;  5B7W A;  4Y6I A;  1FVS A;  2QMX A;  2W2M P;  3EIC A;  3SXL A;  5CA5 A;  1D0E A;  2KM8 C;  2B4V A;  1P1T A;  2UVV A;  3HFK A;  4BWJ A;  2KJW A;  3M8S A;  2XZW A;  4UTG A;  3DM2 A;  3NAI A;  1RT5 A;  5A76 A;  1SKW A;  1OSD A;  4DR6 F;  1TZ0 A;  2V8H A;  4XPC A;  3MXH P;  2KRR A;  4HT7 A;  1RT7 B;  2MLZ A;  4DL2 A;  1I1G A;  2IBK A;  1REG X;  1HNW F;  2GFF A;  1TL3 A;  3G86 A;  4RW4 B;  3SV3 A;  1QVF R;  4C8Z A;  1GX5 A;  3LP2 B;  4TU7 A;  3H5X A;  3MM8 A;  3AJ2 A;  4FXD A;  2QFI A;  3KG1 A;  3GR1 A;  5IQQ A;  2PDA A;  1RZM A;  3ETO A;  5IT4 A;  1T95 A;  3IGN A;  2AJ0 A;  1RTH B;  3FEX B;  2BOA A;  1GXU A;  4CO2 A;  2JFD A;  4CT8 A;  3I4P A;  4FYW B;  3TEH B;  5HRO B;  3Q86 A;  5EWG A;  3A8J A;  3CO9 A;  1V6H A;  5CHC B;  4WFZ A;  3T1A A;  1RT3 A;  3IG1 A;  3HT3 A;  4ZVO B;  1FRL A;  4Q2M A;  4U95 A;  2OTJ S;  4Z2X A;  2EVZ A;  2R8H A;  4HI2 A;  4OV1 A;  1TL7 A;  3VF0 B;  4ZVR B;  5E41 A;  4QBU A;  3POT A;  2J8S A;  2OTL S;  3SSQ A;  3KLE A;  3U1L A;  1NJX A;  1XK8 A;  5KT3 A;  1FJG J;  2CKW A;  3DU5 A;  2R9L A;  4E98 A;  3V6J A;  3NS6 A;  2EXU A;  1K0T A;  1SKU B;  3OL7 A;  2GVZ B;  2P5V A;  4LJM A;  1KOO A;  2DGQ A;  2W2P P;  2HK3 A;  3CCM S;  1CJU A;  2W7A A;  1VLY A;  2JVO A;  5EX0 A;  2MLY A;  1S7H A;  2Z57 B;  3JTN A;  3LOU A;  4L3N A;  2AHO B;  3W60 A;  1FRI A;  3K5N A;  4DS5 A;  2BR0 A;  2C22 A;  3CVK A;  1XC9 A;  3ENW A;  2V2Z A;  2MKY A;  2XSF A;  4KPC A;  4K7Q A;  2UXB F;  2RS2 A;  1VRQ C;  3DXB A;  3M8P A;  2H5E A;  4F4Z A;  2NR0 A;  2UVW A;  2XS5 A;  4C11 B;  2DHA A;  3KXD A;  1EX8 A;  2QLB B;  4C8M A;  3V4I B;  2UU9 F;  3GIM A;  2DBB A;  4LIW A;  4ELU A;  3RU0 A;  4C11 A;  4P75 A;  1UFW A;  2P6S A;  1NK8 A;  2ADB A;  2GQC A;  1LK7 A;  2ZVS A;  4WFX A;  5KG0 A;  3AH6 A;  5AJ3 J;  4DR5 F;  3UDV A;  3PO5 A;  4K4Z A;  4WE1 A;  2N3O A;  2MZJ A;  3MHY A;  2Q6C A;  4J9K A;  2BRL A;  2MTL A;  3ZXW A;  2NYI A;  1NK4 A;  2VPZ B;  1RTD B;  4A8S A;  1S6Q B;  1Y7P A;  1W7W A;  2PII A;  2QGF B;  2GMJ A;  3CJ4 A;  3GJS B;  3ISN D;  2ZM6 J;  3VGT A;  5J2P A;  1U45 A;  4PWD B;  2J0S D;  5DG7 A;  4Y3C A;  5B0F A;  1T9W A;  3PHE A;  3LAL A;  4MIB A;  4NLX A;  1U6Z A;  3R1H A;  4NCA A;  3HK2 A;  5I3P A;  1S99 A;  3M2R A;  3Q22 A;  5KFQ A;  3NOC A;  2LU2 A;  2X7I A;  3TZW A;  4C97 A;  3QJJ A;  1QUV A;  2HUR A;  5HQ8 A;  1F1B B;  1FDA A;  1VQK S;  3KTQ A;  2SXL A;  2IVM A;  3VAK A;  1X9M A;  2WW4 A;  4ZP7 A;  3PO4 A;  2ROG A;  1M5H A;  4L3K A;  2I8E A;  2V0N A;  3BGU A;  4DMZ A;  4HH1 A;  3P45 B;  4DV1 J;  3BV8 A;  2WVE A;  1DY3 A;  2CPE A;  1Q7Y T;  1WEL A;  3C14 A;  2FVQ A;  2HS0 A;  3JQK A;  1AFI A;  3NWG A;  4UUW A;  3G6V A;  1ZZF A;  2DNK A;  1C1C A;  4NAS A;  1HI8 A;  1VDH A;  4HHJ A;  4IQX A;  1N33 F;  1T9T A;  2UZA A;  2V8V A;  3IXQ A;  3LP2 A;  5F8M A;  1VQ8 S;  1FD8 A;  1JIH A;  3HHE A;  4OZ5 A;  4QZV B;  3IM8 A;  1PSD A;  2POK A;  4KR0 B;  2AYB A;  3MR7 A;  1N32 F;  3CO0 P;  2VH7 A;  5IXU A;  4JV5 J;  1S1X A;  2QL7 B;  4YS2 A;  5IS2 A;  3G71 S;  3L95 X;  5KG7 A;  1HI1 A;  2BJ9 A;  2G0I A;  1R6V A;  1FWK A;  4NCG A;  5CZV A;  4O3P A;  4NI2 B;  3V81 B;  2Z0G A;  1TKZ B;  2YWH A;  3GCW P;  4ES2 A;  1JJH A;  1WUU A;  3E51 A;  2IBO A;  3I56 S;  4AL6 A;  1IR0 A;  4DCJ B;  4DR7 F;  2XMT A;  4HDG A;  4IH6 A;  5LSR A;  4KJI A;  3IA0 A;  4OFZ A;  4HDH A;  3F41 A;  1WF0 A;  3VV2 B;  4F67 A;  4DL4 A;  2KYZ A;  2X1B A;  4LT6 A;  1N56 A;  3NKY A;  5A8K B;  4GKK J;  2UV8 G;  1SUQ A;  5H1S V;  3VVU A;  4QQB A;  1JJ2 R;  4U6P A;  2HLT A;  4EO6 A;  3I5A A;  1B3T A;  5SZT A;  4ID5 A;  4LF8 J;  1KNZ A;  2HHX A;  4L76 A;  3T1H J;  3BF4 A;  3PDN A;  3ZZO A;  3H5S A;  3MF5 A;  1Y5I B;  3VGU A;  1T03 A;  2XUL A;  3PY8 A;  2J9D E;  1Q8L A;  2YWF A;  5AE3 A;  5D3G A;  3L9Z A;  1RAD B;  2HFV A;  2UUB F;  1SPB P;  1CEZ A;  3T19 A;  1VC6 A;  4JV0 A;  4UQG A;  4Q8F A;  1IKY A;  3D66 A;  5B0D A;  1VRT B;  3HT0 A;  2FDN A;  3BKF A;  3DRY A;  2G13 A;  5F3T A;  3W63 A;  5F8L A;  1TP7 A;  1TAQ A;  3L09 A;  3NNH A;  1RLD A;  4CT9 A;  3C66 A;  4IH7 A;  3M2U B;  1LW0 A;  1T9U A;  1ZPV A;  5C42 B;  4DR1 F;  4U7U D;  3CJK B;  1S4E A;  5EN1 A;  2FJD B;  4NOH A;  1OQ3 A;  1M5V C;  1WHY A;  1WOS A;  1HWI A;  2PEB A;  4YB5 A;  1Q0N A;  4QU6 A;  1NPR A;  1OY8 A;  2QFJ A;  4K59 A;  3THP A;  4LRE A;  2HHS A;  5D78 A;  1GQE A;  3I5B A;  4HKQ A;  3MM5 B;  3PG9 A;  2ZC4 A;  4M95 A;  5AT1 B;  3GFY A;  1RE1 B;  2I5J A;  2KG0 A;  1YRX A;  1KP6 A;  2NXE A;  3OUY B;  3GJR B;  1LV5 A;  2K2P A;  2JJ4 D;  2QRR A;  5DG8 A;  1VRU A;  1B0P A;  2K06 A;  4O3S A;  1SQG A;  2Y0B B;  1RHQ B;  1EB0 A;  2DT9 A;  2WCX A;  2ZH1 A;  4QPT A;  1G3O A;  4DR2 J;  2DKO B;  5K8N A;  2DHS A;  3DRR B;  4X4O A;  1NDP A;  2HNY A;  2C2D A;  2ZM6 F;  2DIS A;  3W5X A;  1U2C A;  2CRL A;  3CPW R;  2YWE A;  4OYA A;  2FJA B;  1MNE A;  1T9Y A;  2BA9 A;  3MMJ A;  2ZHA A;  4QU7 A;  4TY8 B;  4C3L A;  1RHK B;  1LEO A;  3ZTQ A;  2FVS A;  2O1P A;  3GV8 B;  4O3R A;  3MEC A;  2MXY A;  3J81 j;  3B78 A;  2WOM A;  1GEH A;  1S6U A;  1RWX B;  1A7G E;  5CAA A;  2FIU A;  2QJ3 A;  2G4B A;  1RCX B;  2QLW A;  4B9U A;  5HSP A;  4WZQ A;  3LP1 A;  1DZ5 A;  3ZZY A;  3QGG A;  1N36 J;  4DR7 J;  2MKS A;  2ZBQ A;  2EKN A;  4H4O B;  4C0H A;  5B0B A;  3K5M A;  5C24 B;  4EZ6 A;  2RUG A;  2KXF A;  4WFB Q;  4ANC A;  1X9S A;  4QJV A;  4IG0 A;  4J9Q A;  1D9A A;  3UR0 A;  2XCA A;  2JL9 A;  2HVI A;  4FPI A;  4KYZ A;  2XWX A;  1WF1 A;  2B8Q A;  4O4G A;  2EG2 A;  2HFU A;  1R6Y A;  2EFP A;  1H0H B;  4MAK A;  3TUJ C;  4WTO B;  2OSR A;  2YKM A;  1NKE A;  1LW0 B;  1UKU A;  4O23 A;  5HQM A;  1CQM A;  1K47 A;  4J90 A;  4M5J A;  1M5O C;  2NXN A;  4DV3 J;  1H72 C;  3M8Z A;  1RAG B;  4ZPA A;  2DGX A;  4ZLL A;  1RAE B;  3CCZ A;  1T05 B;  3RB0 A;  2CQ4 A;  4EU0 A;  3IRW P;  5E0O A;  4I2P B;  3M8R A;  2N7C A;  1S9F A;  4FF1 A;  1RK8 A;  2PA3 A;  1VJW A;  4DL7 A;  1KR4 A;  2ZFH A;  3G8Q A;  2KTQ A;  4Y2A A;  2UXD J;  2C3M A;  1XER A;  1NB2 A;  4JV1 A;  4DV1 F;  5DRK A;  4QPX A;  4U8V A;  3TAR A;  1IR2 A;  2CQ1 A;  3SIP B;  1RTI A;  1ZTW A;  1J2V A;  2HFO A;  1DTT B;  1XQI A;  2CNK B;  1RT6 B;  3OJS A;  2C3Y A;  2HQD A;  1R8A A;  1AB8 A;  1FKP B;  1VRU B;  3HHL C;  5HMX A;  3UD5 A;  2AJ4 A;  1EP4 B;  2G9O A;  1YJV A;  2NPI A;  3PW0 A;  1FES A;  1CJV A;  1RT6 A;  5HAT A;  3N6M A;  3RRG A;  2HVD A;  3MM5 A;  1FJC A;  2JFK A;  3GP9 A;  1DQ8 A;  5KFE A;  1P9Q C;  3Q8Q B;  2IFX A;  4EZ9 A;  2KT3 A;  2DR6 A;  3IAM 9;  4F2R A;  2X3D A;  1LWF B;  2WVB A;  3MI7 X;  2LLZ A;  2MB0 B;  2Z2L A;  3T5K A;  3PCO B;  1FTC A;  4U7C A;  3M30 A;  1SQE A;  3OBI A;  3UVJ B;  1OPI A;  4IO9 Q;  4DR6 J;  2DYA A;  4PAA A;  3FEY B;  1KVJ A;  2WHO A;  2C1E B;  2QIF A;  3THV A;  1BGX T;  2Q1L A;  4FXV A;  3W8G A;  3MUV P;  3RBE A;  2UXC J;  3B4D A;  1J27 A;  2DNM A;  2R2R A;  4DR5 J;  5FLX Y;  5KFA A;  1UWB B;  5G4D A;  3RTV A;  3UN3 A;  2JLE A;  1N6Q A;  3S1T A;  1IBK F;  1QSY A;  3ZTO A;  3G6E S;  3KK1 B;  2W8K A;  3RG6 A;  2LDY A;  3POT B;  5HO4 A;  3F44 A;  4A8K A;  4JI4 F;  4OX9 J;  1ZOT A;  4MIW A;  3W9I A;  2N4C A;  4JI7 F;  4DPT A;  2RE1 A;  2VG7 A;  3ZO7 A;  1ZAV A;  4EI2 A;  3QFH A;  1VC5 A;  2ABY A;  4PXB A;  1R89 A;  3ZZZ A;  2XO6 A;  1UFK A;  2DGV A;  1FF2 A;  2IC3 B;  4F02 A;  2W4D A;  5IWA F;  2XO7 A;  3BSO A;  4YR2 A;  3IWN C;  2ZKT A;  3IR6 B;  4O44 B;  2XM3 A;  3MMB A;  3RBD A;  2VQF J;  5HVG A;  3BSC A;  1X5P A;  4K4T A;  1QJH A;  1VQP S;  2HAF A;  4F2S A;  4MIA A;  4M5K A;  3W2V A;  3W61 A;  3FKB A;  2HZA A;  5EHH A;  1X8D A;  1S4F A;  4GC7 A;  1TK0 A;  1VQS A;  4Q0B A;  1AUD A;  2K7J A;  1RAH B;  1N0U A;  1OMS A;  4EWT A;  2ZUG A;  1J5E J;  3OD2 A;  4LF7 F;  4EBD A;  1KBR A;  3EPG A;  3CCE S;  1TFY A;  4ED5 A;  1Q8B A;  2CG4 A;  2R8K A;  4FYD A;  4TY9 A;  2VBY A;  3AQP A;  2E1R A;  1VQN S;  1DTT A;  5DET A;  3CGI A;  5K8P A;  1SKS A;  4KFB B;  2N3L A;  5AE1 A;  4WKR A;  1L3S A;  1HWL A;  3DFE A;  2GAG C;  1SC6 A;  4ZP9 A;  4R25 A;  3OTO F;  2VB6 A;  2XMA A;  3IS9 A;  4A8Y A;  4M5G A;  1B0V A;  1IKW A;  1Q53 A;  2XI2 A;  1FT8 A;  2DTJ A;  1RU2 A;  3OTC A;  2J6T A;  4FS1 A;  2ZNZ A;  3MM6 A;  5GVQ A;  1SL2 A;  5LJ3 Y;  2Z8Q A;  3IN5 A;  3J7Y I;  3GV7 B;  1TKT B;  1RT2 B;  2E5H A;  2YBV A;  2D9O A;  3R8Y A;  1EAY C;  4Y2I A;  5HI7 A;  3CCL S;  2CXE A;  4N7T A;  4DV0 F;  2CYY A;  2KU7 A;  2WVD A;  5F3Z A;  2I38 A;  3G2X A;  2GS8 A;  2AF6 A;  5KFF A;  1XNQ J;  2F1F A;  1MU2 A;  1X9W A;  1U6F A;  2HND A;  4MT1 A;  4DF4 A;  3HM9 A;  4B9V A;  4KV8 A;  1RWW B;  3RR8 A;  4O3Q A;  4DJB A;  4B3M J;  1TVR B;  4OX8 A;  2XCP A;  2XLJ A;  4DUY F;  5BJR A;  1IBL F;  4K4V A;  4LFC F;  5E33 A;  1TMJ A;  2V8P A;  2OUG A;  4CLY A;  1TR0 A;  3K2Y A;  4QYR A;  1TL7 B;  1TL3 B;  2BAB A;  3CUL A;  1RWO B;  3V2U C;  1NUE A;  4FYV B;  4Y0F A;  3F73 A;  4LF4 J;  3G9C A;  3P6Y C;  3RUB L;  4JI0 F;  1R7I A;  1UPP A;  4TU9 A;  3N9U C;  2D1C A;  4IFY A;  2GIR A;  3AD7 C;  4MK8 A;  5GAG U;  2PFD A;  2AU0 A;  4DPX A;  4A8X A;  4LRD A;  3MOJ B;  3PFE A;  4IOA Q;  3NL0 A;  1JXE A;  1TKX B;  3HSG A;  4H4K C;  3O6Q A;  1HHQ A;  2MJN A;  4NCB A;  2MKK A;  1MG7 A;  5A8R B;  3PJ9 A;  3M6U A;  2F4V J;  3IWL A;  1ZM2 A;  2F63 A;  3TAQ A;  1WOO A;  3J80 U;  2G2Y A;  2BM1 A;  3WZ0 A;  3CCV S;  3A4T A;  3RBZ A;  1VIS A;  3G6X A;  2CPY A;  4IG3 B;  3S8S A;  2W1B A;  2AKW B;  4QWC A;  2IAJ A;  4PUO A;  3HJF A;  1QSS A;  2B3T B;  5GAH I;  3H2V E;  4WK1 A;  2J0X A;  2BJ7 A;  5KFK A;  1K1Q A;  4X4N A;  4K4U A;  3DRP A;  4PG7 A;  3KDN A;  3MED B;  1Y3K A;  5KFP A;  2OEM A;  2YNG A;  4YOE A;  4TQR A;  1FRK A;  1O0P A;  3EJM A;  4AL7 A;  1JWW A;  1IKX B;  1QTM A;  4O4G B;  3RZA A;  1FEH A;  1MN7 A;  2JWN A;  2YTC A;  4C8O A;  2HFN A;  1Y11 A;  3KKF A;  2M5Y A;  4X4S A;  1URN A;  3IG1 B;  2E9R X;  3NGT A;  1XMQ J;  3OL8 A;  1OPZ A;  3R6G B;  5D8H B;  3GSD A;  3LUY A;  2B7B B;  1S6O A;  4KO0 A;  4X4Q A;  2BE7 D;  2F4V F;  3NMR A;  1JNZ B;  5C2G A;  2LVW A;  4RR5 A;  3W64 A;  4AL5 A;  2G1D A;  1FCA A;  1JLC A;  4UF4 A;  1H2T Z;  4XPE A;  2RH3 A;  2BQU A;  4AE5 A;  3W2W B;  1HI0 P;  1HHS A;  2CIM A;  2J7K A;  5K5M A;  1R8B A;  4TU8 A;  1FKP A;  4GKJ J;  4JI6 J;  4YB1 P;  2XY5 A;  3DDI A;  3NOG A;  4OI4 A;  4EEY A;  3QT6 A;  4I1T A;  2GW8 A;  4NYZ A;  1Y3J A;  5A0Y A;  3QZ8 A;  2H5J B;  2KFN A;  1ICE B;  4LF5 J;  4WPA A;  2HAI A;  2ZOG A;  4DUT A;  3HX9 A;  2ZE2 B;  2VJV A;  2MZR A;  4OJ1 A;  4OX6 A;  3UN2 A;  1UL3 A;  1YI2 S;  1IKV B;  2R2U A;  5EX3 A;  4Z37 A;  3UE2 A;  1RTJ A;  3V4I A;  2RQK A;  3KLH B;  1YTY A;  1IXK A;  1B4S A;  4ED4 A;  4FVM A;  1VOM A;  3ZTR A;  5LSO A;  4DUY J;  4I69 A;  4X4U A;  3QID A;  1EAR A;  3C8Y A;  4P2F A;  5BR8 F;  2GAH C;  2VKZ G;  2GVD B;  2HHT A;  3IBC B;  2ZD1 A;  3IM9 A;  1S0N A;  4YB6 A;  3G8T A;  4IDK B;  1C1C B;  1R3N A;  2L3M A;  3D5M A;  3NGR A;  2RF2 A;  4DV0 J;  1NK0 A;  2AIR B;  1QUP A;  2B4U A;  2VDH A;  2V2K A;  2E7V A;  3PRV A;  4DV4 F;  3H8Y A;  4DV2 F;  1DHM A;  1RT1 A;  4H4O A;  3DC2 A;  4ZCM A;  3CJ0 A;  4QIG A;  4GMK A;  3D3C J;  1HW8 A;  5MLC V;  5F8H A;  4RO0 A;  1JNR B;  4N56 A;  2HHV A;  3RAX A;  3PJW A;  5J2N B;  2BE9 B;  1SXL A;  3HHL A;  1N0V C;  4CLL A;  4ZLN A;  4B3S J;  3US5 A;  4NLQ A;  1UWB A;  2IDE A;  2EWH A;  3C19 A;  4A4J A;  4ZS6 A;  3OHB A;  4EBE A;  1N6Q B;  5EGY A;  2BBE A;  4DBQ A;  4QWA A;  3W3S A;  3DOK A;  4NLO A;  3VAI A;  5AE2 A;  5K9F A;  1ROF A;  4LQ9 A;  4OHV A;  5AXK A;  3FK4 A;  2JOQ A;  1URR A;  3GR0 A;  3IO1 A;  4X64 J;  3R5B A;  2HRU A;  4ZCK A;  3M9O B;  2IM0 A;  4WCE Q;  2IA6 A;  3QPI A;  2R2S A;  4ZPT R;  5D4P A;  2XB2 D;  3N0V A;  4NLP A;  2ZH2 A;  3CWJ A;  2JDJ A;  1B70 B;  1RHU B;  1HL6 A;  3GII A;  1KTQ A;  5H9F J;  4YP3 A;  4DUZ J;  4HTI A;  3Q83 A;  4NZ0 A;  3QJP A;  4C8Y A;  1FNO A;  4X62 J;  2OML A;  3CD0 A;  3QAT A;  5L1J A;  3TQ1 A;  3KMQ A;  4ERD A;  3JAM Y;  4DPY A;  4RX6 A;  3MEG A;  1EJ7 L;  2FVR A;  1NKC A;  4RNH A;  3IR5 B;  2Z4P A;  3V81 A;  1KQS R;  2JEJ A;  2NZ4 A;  1OSC A;  4USI A;  3CDW A;  2X1A A;  1SL1 A;  4DS4 A;  1CSJ A;  2HIY A;  3EZU A;  5HBM B;  1Y4Z B;  1NJI T;  4J9L A;  3CCT A;  3DHX A;  2CVE A;  4IRD A;  4C3K A;  2V34 A;  2ZNY A;  4DV7 J;  2YWG A;  4PG8 A;  1Q5V A;  3AXK A;  4LR8 A;  4RJV A;  1HR0 F;  3OXG A;  1VMB A;  5JXS A;  5KFO A;  4X84 A;  4JI2 J;  1WEZ A;  1Q7L B;  4PXE A;  3PEJ A;  3KK2 A;  1T94 A;  3MD1 A;  1CJK B;  1VQO S;  2VKR A;  4U9R A;  4WIQ A;  5HQL A;  1U48 A;  4AFF A;  1YRT A;  5HN0 A;  2UXC F;  5F9N A;  3OSP A;  2FJW A;  3VAG A;  4K0K F;  4XK8 C;  1IQZ A;  5KOW A;  4CLK A;  2OPR B;  4NEZ A;  4UW2 A;  1KLN A;  3VZI A;  3OUY A;  4P2X A;  3TOQ A;  1JLQ B;  1RAJ A;  2DXD A;  3ENQ A;  4ED2 A;  1PAE X;  3GIR A;  1DRZ A;  4OHZ A;  2G2Z A;  1ZA1 B;  4ICL A;  4OYB A;  4YR0 A;  1F0X A;  3TUP A;  2W01 A;  4UST A;  1AFJ A;  4B3O B;  3QQC D;  2IC3 A;  2B6A B;  5D4O A;  4ICL B;  4BCA A;  3CB4 A;  1HW9 A;  2NXJ A;  3MCM A;  3M9N B;  1L3V A;  3H2U B;  1UVN A;  1R8P A;  1BXN A;  1IKX A;  4R5P B;  5RUB A;  4QWD A;  1Q78 A;  1EQ0 A;  1U49 A;  1SC1 B;  1NCL A;  4X66 F;  2OMO A;  2VFS A;  3DLG B;  3LTO A;  1X5O A;  1RWK B;  2JC1 A;  3AT1 B;  3DGP B;  5J2N A;  3I0R A;  4Y2M A;  3AA9 A;  1VQY A;  2M52 A;  3DGV A;  4XDC A;  2BV3 A;  4N76 A;  4PXD A;  1XBW A;  5HBM A;  1G4C A;  2ZH8 A;  1LFW A;  1JLF B;  3ICL A;  3PW4 A;  4UT4 A;  2ZH4 A;  1V5V A;  4OYM A;  5KG2 A;  3M30 B;  2NXU A;  2V8G A;  4PRF A;  4Z7Y A;  2QG9 B;  1OQ6 A;  4I2P A;  2C2Z B;  4KE5 A;  3W5Z A;  4JYA F;  4OYZ A;  1WF2 A;  3M6V A;  4LF9 F;  2Z56 B;  1GNK A;  1NEE A;  2IMO A;  1FEE A;  4QW8 A;  4MKY A;  1YLX A;  3DRS A;  3KLI A;  1FFG B;  4FZV A;  3HZG A;  1RWN B;  3IFE A;  4RNF A;  2DGS A;  4F8R A;  1HBO A;  1FKA F;  3R5A A;  2EPI A;  4R8U B;  5IQ6 A;  1UEV A;  4PR6 A;  4KHP J;  2H1Y A;  3ITH B;  3I0S B;  2JEF A;  2MZ1 A;  2XWY A;  3DLJ A;  1S1V A;  2OEK A;  2F5G A;  1M1H A;  2O67 A;  1N36 F;  3D6M B;  3BR9 A;  3HSZ A;  1D8Z A;  1S9G B;  1GX6 A;  3MCO A;  1WAC A;  5E5N A;  3AJ1 A;  5I42 B;  2CVI A;  4JB8 B;  4LF1 A;  4MYU A;  1HQE A;  1RYR A;  1VIX A;  4JI3 J;  4I67 A;  2FHJ D;  3AJD A;  3ET6 A;  2BJ1 A;  3TO8 A;  1YBU A;  3M05 A;  1OIA A;  4DSL A;  2OEJ A;  3VQS A;  4ECQ A;  2FLL A;  3CDU A;  5L9X A;  1EET B;  1GFW B;  3QRP A;  3OTB A;  1RAI B;  4Q43 A;  3Q8V A;  4R0E A;  2V68 A;  1RTZ A;  2CA9 A;  4NEY A;  3Q23 A;  1EET A;  1XR5 A;  2HVE A;  3PHT A;  1EZZ B;  4ZA1 A;  3QAE A;  1KTV A;  3G82 A;  5F41 A;  2HVZ A;  3BGF A;  3KK2 B;  5L1K A;  5LMU J;  4M94 A;  3CJ2 A;  3WDO A;  4DQI A;  1S5Z A;  2NUH A;  4LFB J;  5F8I A;  4ES3 A;  2PGC A;  3D54 A;  3T5L A;  1WNE A;  3VAF A;  1HBU B;  2CAD A;  3BO3 A;  1PYO B;  3K57 A;  4DF8 A;  4BC7 A;  1HNI B;  2XZD B;  4HI1 A;  5D4N A;  4GC6 A;  1BD6 A;  1VHI A;  2DIV A;  2H3E B;  2Q6B A;  5C7P A;  3JB9 k;  2LEC A;  4WII A;  4IOC Q;  2NQP A;  3B54 A;  3M2R B;  1PKU A;  2E1A A;  3AOD A;  1G7C B;  3PW5 A;  1YQH A;  1S9E A;  2MQL A;  4X66 J;  3G8S A;  2A10 A;  2E9T A;  1KQG B;  2FPH X;  2YNF A;  1W26 A;  1KEK A;  4DPU A;  4DX6 A;  2C2N A;  1KRP A;  1DTQ A;  1DQA A;  3R5C A;  3BBC A;  4GVB A;  3MWB A;  4TLR A;  2BXJ A;  2P8I A;  2YWW A;  3P5B P;  2ZBC A;  1LW2 B;  3TWZ A;  2HG4 A;  4RW6 B;  5BYR A;  2B51 A;  2FY1 A;  2XSJ A;  3R2C J;  5A0Y B;  1RHM B;  2BYC A;  4TVA B;  4IRK A;  3FCW A;  1YJ7 A;  2RQM A;  3CDA A;  1ZM4 A;  2O01 C;  2YNH B;  2ZE2 A;  3MM9 B;  3KJQ B;  1UVJ A;  2BAN A;  3KLF A;  1NM2 A;  1U26 A;  3BQ0 A;  4WFA Q;  1YJW S;  5HL7 Q;  4M5D B;  3PX0 A;  1TVR A;  5GAH U;  1Y0H A;  2W4P A;  1D09 B;  1FRH A;  1SIW B;  1ZA2 B;  4CLP A;  3T1Y F;  1HBN B;  2HHH F;  1VQ6 S;  1WDT A;  1H2U X;  2WK4 A;  3VWS A;  3JYT A;  1ZS6 A;  4ZHR A;  2DNG A;  5DJB A;  1SJ3 P;  4LIR A;  4G1I A;  4ZVE A;  3DI6 A;  5ETM A;  2RU9 A;  2H65 B;  2DJW A;  1S0V A;  3I9V 9;  4ZVH A;  2ZOF A;  3CDE A;  1RJJ A;  4LUB A;  4LF5 F;  1IUJ A;  3E3X A;  8RUC A;  3MZI A;  2RNE A;  3PYE A;  4XO0 A;  2IPO B;  4GKK F;  5A8W B;  2CQP A;  3CED A;  4JI6 F;  2RKI A;  3M32 A;  4WU2 A;  1BHN A;  2RDD A;  1KWM A;  2OPS B;  3BGL A;  3FGV A;  4I4B A;  2FYX A;  4I2Q A;  2KVQ E;  3ILI A;  4I6W A;  3D68 A;  1REV B;  1QE1 B;  2AJQ A;  4CNY A;  2NZC A;  4KV8 B;  2R7S A;  1HQU B;  2DCL A;  1X5S A;  1M5P C;  4LSN A;  1H3D A;  2XYG B;  2D69 A;  3FRY A;  2UVU A;  2IAJ B;  4ECR A;  1TAU A;  4DL5 A;  1U47 A;  3OR2 A;  1T11 A;  4M5H A;  2IYG A;  4ZN3 A;  5DDP C;  4MMO A;  2XEX A;  3K8W A;  1HYS B;  3H4D A;  3BO2 A;  3M1V B;  1M90 T;  3ISN C;  4NLS A;  3CE8 A;  3DXS X;  4HHH A;  5K8O A;  4F4K A;  4HR2 A;  1XMO F;  1JKH A;  2KO1 A;  2VF3 A;  4M5D A;  6FDR A;  2ZEJ A;  4ILR A;  4CO5 A;  2FD2 A;  4OZJ A;  3OL6 A;  1X4B A;  3EM1 A;  4CH7 A;  1YZ7 A;  2QZ8 A;  2NS1 B;  5E3Q A;  4DSK A;  3QSY B;  1KD1 T;  1K0V A;  3OHA A;  2AT1 B;  3CCW A;  1ELO A;  1N5Q A;  3CMQ A;  2BKP A;  3TYT A;  2B4O A;  1LNQ A;  3C6T A;  3LP0 B;  4I0W A;  3R9L A;  3VAM A;  4P2S A;  1TMM A;  2DRD A;  1R43 A;  4ZVP B;  1UAW A;  3GLJ A;  3OTE A;  2FVP A;  3EE3 A;  1VQ4 S;  1IN0 A;  2V4Q A;  2MKH A;  2OEL A;  1S7I A;  5GAD U;  1NLK L;  1FX4 A;  2GGP B;  4FKX A;  5LXY A;  2NSC A;  4U8Y A;  4H54 A;  3B8H A;  3T41 A;  2Z2M A;  4ZCI A;  4KGX B;  5CAB A;  4CH1 A;  2QA1 A;  4BLG A;  1WC5 A;  1R8C A;  5BR8 J;  2OPS A;  4M5L A;  1N34 F;  2HEK A;  3OPK A;  1YX2 A;  4FBU A;  3QRQ A;  3GB0 A;  1UWA A;  4UQT A;  2NUU G;  1WC3 A;  1UPM B;  4O3N A;  4RBV A;  4K8R A;  4CWB A;  2A2D A;  3BSA A;  5CCL A;  1S1U B;  3R7B B;  5JVH Q;  1N52 B;  2DEJ A;  3WX4 A;  3SQG A;  2CPF A;  5KFC A;  5F9L A;  1MRO A;  1HKA A;  1Q8I A;  3DDN A;  2C2R A;  3IBF B;  3SQG B;  3EVO A;  2ZZN A;  3JXO A;  2E7W A;  3QWP A;  2QTW A;  3BKU A;  1N54 B;  3BPD A;  1C1B B;  3FUY A;  3HFZ B;  2AEM A;  4MJK A;  4GKJ F;  2VFV A;  1FK9 A;  2DNP A;  2VG5 A;  4OX7 A;  1X4A A;  4XTT A;  4YFU A;  1K73 T;  4N8N A;  4LFC J;  2M88 A;  5MAO A;  3BYR A;  2XC9 A;  2OP5 A;  1N34 J;  2RQ4 A;  2ADC A;  1DBD A;  2EBG A;  1ZM3 A;  3V6D A;  3M2V A;  3EDQ B;  4FF4 A;  4AXJ A;  4DV5 J;  1HWU A;  3MPU B;  4AD6 A;  4DLG A;  2LYV A;  5U47 A;  5KFY A;  3M2V B;  3OLB A;  5DQI A;  1RAC B;  2RUS A;  2YKP A;  5GMD A;  5K8M A;  3PR4 A;  1VR6 A;  4EUV A;  4CZC A;  4LRC A;  1CPZ A;  5T14 A;  3GV5 B;  4HH0 A;  4C8L A;  1Z2L A;  4DCP B;  4WF9 Q;  1YG0 A;  2RKI B;  5KFV A;  3FNN A;  1S59 A;  2E5J A;  1KLM B;  2KYX A;  2EK1 A;  4M1K A;  4DV6 J;  2XMW A;  1FVQ A;  4DI6 A;  2F7V A;  1U1L A;  2NRE A;  1UTA A;  3R3T A;  2CPH A;  4F0H A;  1PIL A;  1MWY A;  1G6B A;  2HFS A;  2A2C A;  1NME B;  2JLF A;  3JSY A;  2LXU A;  3QYY A;  1Q1K A;  2E1M C;  1UMJ A;  1WD6 A;  1MW7 A;  1HBM B;  1ZYQ A;  4UOC A;  4B08 A;  2XHC A;  2XMM A;  3HHK A;  2RDI A;  4NA2 A;  4NA1 A;  3DLG A;  2D3U A;  3OVA A;  2HBZ B;  2V63 A;  1IR1 A;  3Q8R B;  3MM8 B;  4NZ6 A;  2HQG A;  4ID5 B;  1LXJ A;  2W7P A;  1J5E F;  1XR7 A;  2Y1I A;  4LF7 J;  1HNW J;  4ECZ A;  3OVB A;  3QBC A;  3M8Q B;  2XY7 A;  4TY8 A;  3M9M B;  2OIH A;  3U1N A;  3KLG A;  3KUH A;  3V6H A;  1BY9 A;  1SH0 A;  4NZ7 A;  4J7C A;  3MR3 A;  2YPZ A;  2YH0 A;  4KAI A;  4L6V 3;  5HMW A;  2DNH A;  4ED6 A;  4CTA A;  1V9O A;  3PR5 B;  2M8H A;  2DNO A;  2RIL A;  2V2Q A;  3BGR A;  1UET A;  3R7N B;  1CUL B;  2IIH A;  3QO9 A;  2FJX A;  8AT1 B;  4HTJ A;  3V6K A;  5M2R A;  3KUE A;  2ASJ A;  2B9E A;  4YB7 A;  4Q8E A;  2M2B A;  9ATC B;  4JI7 J;  3K7R A;  1RWM B;  1JLE A;  4ZLJ A;  1IBL J;  3T9Z A;  1CJT A;  3T6B A;  3A8K A;  3H0P A;  3FRZ A;  5C5J A;  4OZN A;  3U27 A;  4LRA A;  1Y9O A;  7FD1 A;  5A8R A;  4KSE B;  5A6P A;  4N77 A;  4AND A;  2W2Q P;  1JMT A;  4J9P A;  2IRY A;  3ZTP A;  3NAH A;  5DZ7 A;  4C2M A;  5HVH A;  2JLG A;  4NLW A;  1T02 A;  3C14 B;  4ZP8 A;  1P1L A;  1CC7 A;  4F26 A;  4RBU A;  3DM2 B;  4ZN1 A;  1JLA A;  1YBA A;  1TUG B;  3I87 A;  4R0J A;  3SYZ A;  2XY6 A;  1VI7 A;  1N5T A;  2CJQ A;  5DQG A;  3TAM A;  3RB3 A;  2FLN A;  2I0X A;  4KRW A;  1N5Y A;  3H25 A;  3KJF B;  3PRD A;  2HS4 A;  4LF2 A;  5KFT A;  4CM2 A;  3O3L A;  3T5H A;  2CQ0 A;  1VJQ A;  2PN6 A;  3GFX A;  1MU2 B;  2C2K B;  3NCQ A;  3WIU A;  3PX4 A;  4TYA A;  3FCH A;  2A6O A;  2R7O A;  4DL3 A;  3LH2 S;  2A0F B;  1G1X A;  4CI0 B;  2ZH6 A;  1X4F A;  4DFK A;  3MGJ A;  1T9X A;  2DXE A;  3TEG A;  5GMK a;  4NXN J;  4L74 A;  4PQU B;  1U24 A;  2OD6 A;  3GG0 A;  4PWW A;  3D0H E;  3J7Z 5;  4OI0 A;  2WBM A;  2AEJ A;  1CG2 A;  4LRB A;  3UPF A;  4ZKA A;  4LFB F;  2FJB B;  1U1M A;  3A3N B;  2M7S A;  3AXM A;  3MEE A;  2AYM A;  3WX8 A;  1S97 A;  3AD8 C;  1RXO B;  2CPX A;  1WG1 A;  4K4W A;  4USH A;  3VTI A;  1QD1 A;  1YWX A;  5DDR C;  1D8Y A;  3MM9 A;  5J1P A;  1TU0 B;  1RAB B;  5LSL A;  3X1L B;  3NS5 A;  2QLX A;  5IZH A;  4WBF A;  2HNY B;  1NJW A;  2IJF A;  1X4D A;  1RQ0 A;  3SBM A;  2VQE F;  1RT5 B;  3UNY A;  5IWA J;  2FC9 A;  2V8D A;  4IUF A;  4RW6 A;  1HNX J;  3MUT P;  2RML A;  2VPY B;  1EKS A;  4ZIW A;  5M2P A;  4J9O A;  4OX9 F;  4JI4 J;  1NU4 A;  1GMU A;  3FQK A;  3ZFV A;  1BQN A;  5HJX A;  2XG8 A;  3DOM A;  4YHH F;  1UVL A;  3U7J A;  1RBO B;  1LWE B;  3KMS A; 
#chains in the Genus database with same CATH homology
 3QSI A;  2WVE A;  2WVC A;  2F1F A;  2BJ3 A;  2BJ8 A;  2WVF A;  2BJ1 A;  2HZV A;  2WVB A;  2CA9 A;  2Y3Y A;  3PHT A;  3BKT A;  2FGC A;  2BJ7 A;  1Q5V A;  2HZA A;  2PC6 A;  1Q5Y A;  2CAD A;  2CAJ A;  2BJ9 A;  3LGH A;  3OD2 A;  2NZC A;  3BKF A;  3BKU A;  2WVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...