1Q5YA

Nickel-bound c-terminal regulatory domain of nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
b'TQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel responsive regulator
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 26
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5yA00
2Y3YA 2NZCA 2CA9A 2PC6A 3OD2A 3BKUA 2WVDA 3BKFA 2F1FA 3PHTA 2WVBA 2BJ7A 2BJ9A 2FGCA 2HZAA 1Q5VA 2BJ3A 3LGHA 2WVFA 2BJ1A 2CAJA 3BKTA 2BJ8A 2WVEA 2HZVA 2WVCA 3QSIA 2CADA 1Q5YA
chains in the Genus database with same CATH superfamily
4DMZA 1BUXA 1ZM4A 3KKFA 4ES1A 3KXDA 4DDFA 1G7CB 1GK8A 2F1FA 3NOGA 4PEOA 1SH2A 1KFSA 2KFNA 5ETTA 4NLTA 3O2IA 2GVDA 3J81j 2JFKA 3MPYA 4OI1A 4C97A 3CCJS 4NZ6A 2B5JB 2EW9A 4IH7A 2RHSB 2FVPA 3OL6A 4ED2A 3FMWA 1T03A 3L95X 1DQAA 2MYFA 5D78A 4WK1A 2RU9A 2MJNA 4OI2A 1F1BB 4X4PA 4C3MA 2W4DA 3OR1B 2PMHA 1QE1A 3I96A 2P6SA 1XMBA 1FX2A 3VV2B 4Y65A 3GIRA 1G3OA 4PXBA 1G2EA 2VIHA 3TW0A 5DQGA 4PXDA 3M7VA 3MR5A 2IDEA 5AE1A 1VC0A 4LF6F 2K3IA 5IV3A 1CC7A 2RB7A 4F4ZA 1QDUB 4KT0C 1H98A 3NBPA 1TTHB 2AX0A 2V2ZA 4UY8T 3EDRB 1Q16B 4KRWA 3D1HA 1W2IA 2AYGA 5KG4A 3KYLA 2HQIA 2V34A 1DZ5A 2CZVC 2YWEA 3D6TB 4MFBA 1IR2A 1WEZA 2F9JA 1Y9OA 2RQ4A 1SVDA 4LFBJ 3D2WA 2XY5A 3A1YG 2Y0BB 3VF0B 1E6YA 1VRTA 2F65A 3NXZA 1P8GA 1EARA 3CJRA 3OD2A 1GMWD 2MHEA 4ZP6A 2VFSA 1GTEA 3TAQA 3D0GE 1HWLA 5HJYA 2OPSA 3CJ2A 3HKWA 1IQTA 2XWXA 2ZBPA 4AQYF 4UOCA 1VQYA 3GJTB 1GMVA 3CCTA 1Y10A 3HPOA 1Y5IB 3ZZYA 5C42B 4LR8A 1H7WA 3VGUA 1YKWA 4ANDA 1XC9A 2FZKB 1RUSA 3H42A 4ELVA 2HIYA 2AJQA 5GADI 3GR1A 1FRIA 2E5GA 1NJIT 4UOHA 1PCAA 3CO0P 4A4JA 3VGTA 4AXIA 1X4DA 3OLAA 1JLFA 4B3MJ 2POKA 5AJ3J 1HL6A 2HWIA 3M6VA 1S0VA 2MKIA 3EPGA 5KFSA 3DLKA 2F5GA 4F3QA 4A8XA 4MK7A 2W8KA 5L9NA 1PIEA 1PJ7A 1HQEA 4LIWA 5A0YB 5KG5A 2HRUA 1WC1A 5C5JA 1RWKB 1LEOA 1G6BA 2MHNA 2GHVC 4ZVGA 2MKSA 3TWZA 4PG4A 2P2CB 3HHDA 1F2HA 4IUFA 2MQNA 2GJIA 2QLXA 4DX7A 2XS2A 4X4RA 4C3LA 4DJBA 2VF3A 3FUYA 2XGQA 1FCAA 1D1UA 3SSRA 5M2RA 3SXLA 2XTJP 2R2UA 4XDCA 2YKNB 3BGRB 5EN1A 3WBZA 1FXLA 1GNKA 1UJ5A 3HHLA 3PFOA 5ETMA 4F4AA 4JI4F 1U48A 3IGVA 3OBIA 5LJ5Y 3MCMA 4B3SF 4QYZK 2FQQB 4ECVA 4K0KF 1VQKS 3T9ZA 2GQ2A 2KFYA 4ZPTR 3OVBA 2RUGA 3SZ2A 2HWTA 3JSBA 2D74B 4EZ6A 2N82B 4LSNB 1JKHB 1SCJB 1KHWA 1NPRA 2VFRA 4LT6A 1Q8LA 2UXCF 3M9OB 2GIFA 1LWEA 2A6OA 4DFJA 1DAXA 4DR6J 3HMJG 3LOUA 2JX2A 4Z37A 2MJUA 2ZD1A 3MECA 1HHTP 1CS4B 2ZC4A 4QIWD 4QWDA 2YX7A 1KS2A 3P6YC 2CZ9A 1NDCA 4DV2J 4DL4A 3ZZPA 5JMNA 2XYHB 4OYPA 1U0HB 2ASJA 3UNYA 4ECUA 1XBWA 3AB2B 1HLWA 2GAGC 4Z7YA 4WU3A 3W7BA 3QIPB 4OZ1A 1ZBTA 3W9JA 3CJTA 2DNMA 4NXNJ 1O51A 2Y8YA 1RHQB 1R0CB 2OJ3A 3DLBA 3M2VA 3MMCB 2B5JA 4AYBD 1CJKB 4N56A 2QA2A 5HLFB 1TVRB 2QLBB 3R5CA 4HKQA 3OR1A 3F56A 2AQ4A 4PYDA 2O67A 4MKBA 2DGTA 4YB1P 3BR8A 1FDAA 4LF5J 1SUQB 1M5VC 3I87A 3L09A 2ASYA 2DRBA 2C3UA 5IM0B 1HNVB 5SZTA 2UUTA 4LFBF 2DHGA 1QSLA 1VLYA 2Y1LB 2IDLA 2WSCC 4M5HA 1GMUA 4L3KA 3NMAA 5I4MA 3W5XA 1SJQA 3CWJA 2V0NA 4ZHRB 3NL0A 2HAFA 3HFKA 3DHWC 1RT5B 4C8LA 4DFPA 4UQGA 2DNOA 4OL8A 1TKTB 3R2CJ 1LW0B 5GMKa 1Q78A 4P73A 1RAOA 2BZ2A 3VVUA 1HBMB 2ZZMA 2BVZA 5A76A 4ZCLA 4CLZA 2W2QP 2V2QA 3I9ZA 1FFSB 3HHLC 4ZVSB 1ITPA 3BGLA 3K5LA 5C42A 2R2TA 1L3VA 4QBUA 2C28A 3THTA 3HHEA 2QA4S 1RTZA 2HBZB 3IC1A 3IWLA 1NO8A 3S01A 3K17A 2YX1A 2LXIA 2W24A 4F36A 5GVQA 3NKYA 3CCES 3QMQA 1PYSB 3KG4A 1U4BA 1IQZA 2Q1LA 2DK2A 4MMOA 1EZZB 1VQ6S 5K5MA 2PMWA 4OYMA 1LV5A 3PM9A 4OX7A 2HGNA 1W26A 1PO6A 5CH7B 1D9AA 3TZZA 4UT4A 2B9YA 4H4KA 2CPDA 4UUWA 5A0YA 4K4WA 1RCXB 5J1EB 4YDDB 2VC1A 2JRSA 2R2SA 1YITS 2ALYB 4DX8H 3MUMP 4OZ2A 4P71A 1WOPA 3SI8A 2CQBA 3BJYA 2MKYA 2YKNA 3BGRA 2LXUA 4CO3A 3RB6A 1VQPS 1YZ6A 2LCWA 3CGIA 3ILIA 3RW6A 2JVRA 2Y9HA 2KG1A 3NGRA 4Y34A 2IM0A 1BXNA 4QIEA 3EPIA 1QAYA 2JEFA 4OFZA 2PD1A 3CJ5A 4HH0A 3EX7B 4ED1A 2JDJA 3PW2A 1VR6A 3KJQB 3Q86A 4L75A 1RT4B 4LBPA 2X1GA 1UEVA 4F4XA 1T05B 2HFZA 1X0FA 4DR6F 2CQ3A 1JKHA 3IS9B 2DR6A 4W92B 2HW3A 4DR2J 3OTCA 3QT6A 3DN9A 4URSA 5J1NA 2VQEJ 4DV2F 1N5QA 2R4FA 1EKRA 4EZ9A 3RUBL 3GYXB 3Q22A 4U7UK 2H9ZA 5L1IA 1ZAVA 1CS4A 1KVKA 2HKEA 1H3DA 4O23A 2WB1D 5D15A 2XSJB 4Y2IA 4NXNF 1RXOB 2QMWA 2BEFA 1CJVB 2DEIA 1U0HA 1DLOB 1S4EA 2ILYA 2CRLA 4PWWA 5I3UB 4DU7A 4S0MA 4MKVA 1JIHA 4DXLA 4CO5A 3QIPA 4PPZA 4CWBA 4ZCMA 3PX0A 4B9UA 2XULA 2H4YB 1TUWA 2E9ZA 4LIRA 1S12A 2QIFA 1CJKA 1Q8IA 4LF5F 3ETOA 3BBBA 4LF2A 5HLFA 1W7WA 2QT7A 1TVRA 5ETQA 3KJNB 1Y3KA 3M8SA 2GMJA 4J9RA 3KJVB 2ZOFA 2AV5A 4FF2A 1U0SA 5F0WA 4WIIA 4ZJLA 4H54A 1SUQA 4ZPDA 2AGQA 2KKHA 1UETA 1LQ9A 1HNVA 3US5A 1FNXH 2QL7B 2DKOB 4EBDA 4H4KC 1WOSA 1F9FA 4QWCA 3G6VA 4ZHRA 3DLEB 3BGFA 2XMKA 1TL7A 5KFDA 3MM5B 1VQSA 3IG1B 2AKWB 3B78A 1NHUA 1TKTA 1UW4A 2RKIB 2GFFA 4IQMA 4KYZA 1LW0A 1NEEA 4DQPA 4B17A 2OFGX 1SJ4P 3CT9A 1HBMA 1RISA 3UW1A 3OW2R 1N32J 2WHOA 3ISNC 5GAHU 2X51A 3CUNA 4IRKA 2G2ZA 3NS5A 1M5OC 4MK8A 5KFIA 3I55S 2V9WA 4RBVA 3DDNA 2EFVA 2E5JA 2B9WA 1N4LA 1PYOB 3MUTP 2R8HA 5DGAA 2WVEA 2FVRA 2BR0A 5KFTA 2R9LA 5CYQB 1GFWB 2PEBA 3Q24A 3KHRA 3I0SB 4WZQA 3GJQB 2IFXA 2E1PA 2BKOA 3V81B 3GV8B 5J2QB 2ZZNA 3W2WB 5E41A 3CCLS 1S1VB 3M6XA 3MD3A 1P1LA 1RLDA 1F3VA 3GE9A 3H59A 1PYTA 5KT3A 2ZBQA 1FRMA 2YNFB 2PIIA 2XWYA 3VAFA 1OJ4A 3KFWX 3FCVA 1U24A 3AOAA 3G96A 5F8NA 5J1EA 3GCXP 2BE9B 1JMTA 1C4AA 1LWFB 4B9NA 4HHUA 5HMYA 4P2MA 2QRRA 3BV8A 4HI1A 2BACA 4QW9A 2ATLA 4L73A 4F8RA 3V4MA 5LOQA 3UCZP 2OLWA 2D9PA 1B0PA 3W2VB 2CPIA 3QATA 3KUGA 3V6DB 2FGOA 4LR9A 3K59A 1NSAA 4P75A 5B0BA 3C3LA 2RD5C 2KTQA 2XZWA 4IKAA 4DLGA 3FBFA 4EYHB 4DR5J 4ED3A 2HZCA 2XLKA 2DNPA 1Y11A 3ADAC 2CFXA 2OAUA 2VQEF 1KDNA 1TL3B 2G0CA 1FRXA 4TVAB 3FBBA 4NZ7A 2X3GA 1T05A 1L5UA 2JZ5A 1WHYA 2CPZA 4D3HA 3SEOA 4LQ9A 3IS9A 5BJRA 1L3TA 1ZM9A 3V5RA 3PRBA 3AD9C 1VQLS 2RU3A 3F73A 4I6AA 4K4SA 2DGQA 2LXFA 2DISA 3QAEA 5KT5A 6AT1B 3G6ES 3MD1A 4TYAA 2LEPA 2OEJA 4PG7A 4C3KA 2MQQA 5IT0A 3TQEA 3CDAA 5LL6d 1S5ZA 4WBFA 1MNEA 2DXDA 2Z2MA 1CJVA 1V5IB 3EGZA 4ERDA 1YGYA 1DLOA 4JI7J 3IN5A 4KGKA 3HD1A 3BF4A 1JJCB 4OLOA 2WVCA 4EFAC 1WC6A 2BRKA 3PW0A 4ECRA 2QGFB 2IYGA 2VBZA 5LMNJ 1BC6A 4OHXA 5HVGA 2ZBIA 3ULHA 3CJ4A 3D6FB 2APOA 3Q2SC 4DFMA 4JYAJ 1FNOA 1T95A 2MZJA 1JJHA 1UFKA 3KJVA 3VGVA 4OYAA 4ZVQB 2D7SA 2IMOA 4DPTA 1RI7A 2J9DE 4AFFA 4J9LA 2PDAA 4YUDA 4IDKB 5K8PA 4GKKJ 2JEJA 1R0AB 5DETA 5JXSA 2X3DA 4PR6A 5KTQA 5A8KB 5D6GA 2KT2A 1HQUB 2JJ4D 2L48A 1XN9A 1UEUA 2CG4A 1TK0A 3FDSA 4FYDA 4FZVA 2C2KB 4AL6A 2C2NA 4DFKA 2AJ1A 2B7CB 1WKLA 1HNZJ 3WX4A 4A8WA 2W1BA 1NXIA 3DLEA 3HFVA 3NGTA 3MM5A 6FDRA 3LWMA 1U6FA 3IG1A 3CDEA 3OHAA 2F63A 1WF0A 2R2RA 5DDQC 1OQ6A 3W5ZA 4TN2A 2ZDOA 2FHOB 3O1LA 4ZVFA 3W9HA 1IJFB 3HDSA 4DI6A 3H4DA 2H51B 2HMIB 1FDDA 3FRZA 1FFGB 5F8JA 3MTKA 2P9CA 4LQ3A 4FBUA 1HBOB 5DS7A 4OZ3A 3CCZA 3BYPA 1VBXA 3RBZA 3NP5A 4RU2A 1BQXA 1C0TB 2Q66A 4C8OA 4ILLA 1IBMJ 4CRJA 5CYQA 3I0SA 4G1QA 1ICEB 1IM6A 3V81A 3W2WA 3DLJA 3G87A 1FEHA 4PUOB 4I2PB 3CJKB 1S1VA 5D3GB 4CQ1A 2EFNA 4KHRA 1NHVA 3RJMB 2AD9A 4TY8B 4RNNA 2YNFA 2UP1A 4RNHA 2DR5A 1TFYA 2BX6A 4NLPA 3EZOA 2W9CB 4Q8EA 2HVHA 5KFWA 5KFCA 1N54B 3SSQA 3ZO7A 1GT8A 3EM1A 1NB7A 5GADU 2YWFA 1LWFA 3RTVA 2ZH1A 2RH3A 4NCBA 3W1YC 4F0KA 2VQFJ 3BS9A 2LLZA 3IGNA 3JQMA 3BM7A 3LUYA 1S1XB 3GPAA 4DR5F 2D1CA 3D6MB 3V6HA 3W2VA 2DRAA 3W61A 3V6DA 1J27A 3ZZUA 1LOUA 1EHWA 2WVFA 2FHKA 1JLQA 1P27B 2HS3A 4WTOB 1RHRB 4PQUB 4GO7X 1IUJA 1YBAA 2AIRB 1TL3A 3TJAA 4YB6A 4RL1A 1NDLA 4L3NA 3KWMA 1TUVA 1R8AA 5HAOA 3J7ZT 2FC9A 1AXQA 2NSCA 4DSEA 3MAHA 3ILJA 5A2QY 3A13A 3OTOJ 4HLBA 4JI7F 2HAIA 3BQ2A 2ROPA 4MIAA 2CNKB 2JH3A 2RS2A 1MN9A 1SI9A 4UOGA 5DG9A 4KC5A 4C8NA 3MM7A 4MYTA 2YVSA 4Y6IA 5LMNF 2MDAA 5CYMB 4ED0A 1TAQA 5KAKA 2DNHA 5HVHA 5KFOA 3U1LA 4JYAF 2UUWA 2IYIA 1MWZA 4ZJQA 2J7UA 2IVFB 1VQNS 4RZRA 4ECQA 3POTB 2H1YA 4GKKF 4FF4A 4NRTA 1K8AT 2CDRB 1BQNB 4I64A 1TMMA 3GWCA 4IR9A 2RQKA 2HVZA 2F8HA 1SC1B 2CIMA 2VA3A 1QVFR 2HFNA 1IWGA 1R0AA 3C2PA 1FO1A 2QE5A 1LWCB 1I5OB 2ROEA 1HNZF 3DYAB 4KSEB 2AEMA 5JUMA 1HQUA 2PN6A 2Z0GA 2JVOA 1VBYA 1HW8A 1U1LA 4A8QA 3HJFA 4CLYA 2DT9A 4WFZA 1NJYA 3MZIA 1UL3A 1UFWA 1D09B 1V3SA 2IY5B 4DL0C 4ID5B 2JSXA 3BN4A 4ZLLA 2BJ8A 4DQRA 2GQQA 2M7SA 1R43A 1IKYB 3PYEA 2B9XA 2V2VA 2OP5A 1ROFA 5CCMA 4E0DA 1EB0A 2YXLA 2XG8A 3C6TB 4W4MA 1JK9B 2G9OA 2HMIA 3PR5B 1IBMF 4XK8C 1IVZA 3H8YA 3RAMA 1KVJA 3HSDA 1HBOA 2ZHAA 1RWWB 4F4YA 2XLIA 2DYAA 1D9DA 2KXFA 1R0BG 2AYMA 1C0TA 3JS9A 2CJAA 2CYYA 1V9OA 2YNHB 4YN3B 3GIJA 4CH1A 1FRKA 3X1LB 3PO5A 4I2PA 4PUOA 2O1PA 3CJKA 1VJWA 2HQDA 4QIFA 5J1PA 5D3GA 5IC4B 2WOMB 4ZP9A 2OD4A 2M88A 3A8IA 2CUYA 4TY8A 4CLTA 3KHHA 2FHMA 5A6WA 5J2PB 1XEZA 1H2UX 2VQFF 2W9CA 1YBTA 2ZWPA 3JXOA 4DPYA 4YR0A 1FRJA 2CQPA 1H72C 5KT7A 4B9MA 2DO0A 2HQGA 3GV5B 2EXUA 1N36F 3PFEA 1T02A 3ZTRA 2RQMA 4DSIA 4AL7A 2QSWA 5DLFA 4M95A 2AEFA 3KDOA 3SDEB 4KQZA 1KLMB 3BKTA 3NGKA 1S1XA 2RMLA 1NH7A 4R8UB 5IWAJ 2B4PA 2G0IA 3AB4B 2FYXA 2XYGB 3TANA 2W9BB 3NEKA 1BHNA 2R7RA 1KQSR 3MMAB 2CQGA 2IJFA 4U7CA 2XHCA 2E7WA 2ZHBA 2ZOGA 4ED6A 1CQMA 4PQUA 2JL9A 1I1GA 3C15B 4JBCA 4EBEA 3GIKA 1X9SA 2HFUA 1S49A 1L3SA 2L9DA 3N9UC 2GQCA 3OTOF 3TI0A 3OTBA 3QGIA 3MCSA 2C42A 3MGJA 4CNYA 1GX5A 2WONB 1R89A 1WD6A 2P5VA 4K4UA 4P10A 2ZE2B 3K5NA 1L3UA 1CBKA 2C3MA 2AWZA 5IOLA 3ZZZA 1H73A 4Q2LA 1KQFB 1Q8KA 2DHAA 4NPOA 5CD4H 1FKOB 2V94A 2W8LA 2U2FA 2MSTA 2DGVA 1RAEB 1DTQB 1HNWJ 3M8PB 1TL4A 1TAUA 3ILOA 2YX4A 2ZH4A 5CYMA 2QV6A 3TA0A 3D1QA 4OMFG 4F2RA 5F8IA 2DGXA 4AL5A 1ACMB 4FXWA 3HSZA 1GMWA 2Y1RI 3POTA 4Y2AA 1VIOA 2ZUAA 3TUPA 4GKJJ 3KHLA 1BQNA 1O6XA 3OHBA 3O5TB 3KMSA 4FKYA 1VDHA 3E8OA 3HF5A 4WWSA 3DRRB 4ITSA 4TNOA 1IBLJ 4DL5A 3OUYB 4CIOA 1RKJA 3ZZRA 2M8DB 3SQGB 3MCNA 4Y28C 2HZVA 5KG0A 1RJJA 4ZIWA 1S6OA 2WCXA 3DYAA 2UXDJ 3H40A 1QUVA 3D54A 2MZTA 5DG8A 1HW9A 2RRBA 4DS4A 3JTPA 2GO8A 2EI5A 3C16B 5EWGA 2KYXA 2DPIA 3G6YA 1QSSA 2QSFA 2NSBA 4DWIA 1QVGR 3N5FA 4ID5A 3M32B 1JB0C 4X4TA 2JC1A 4CZCA 3DC2A 1O8BA 3EZUA 1IKYA 4ZK7M 2KVQE 1FRHA 1QAXA 3C6TA 1U45A 1VQOS 3D66A 1NK6A 1Y7PA 4O3SA 2W7PA 2WSEC 4OZLA 3H25A 1NRKA 5B0CA 3DCAA 4USTA 2FJBB 4NA2A 2V9KA 2MQ8A 4G1PA 5E2QA 1F5CA 3LP2B 1WC0A 1K44A 2QJ3A 2OEKA 1U09A 2G4BA 2YNHA 3GG0A 1RWMB 1UPPA 1CC8A 4CM0A 4EWTA 3HT3A 4B3OB 4WFAQ 1G1XA 4F4WA 5CAAA 5FDLB 3ZZTA 1FI4A 3RRGA 2WOMA 4ANCA 3Q8RB 1S9EB 3J81Y 1F3FA 2AJ0A 2H5EA 5B0AA 2OIHA 5J2PA 1RQ0A 4LREA 3Q23A 3T1HJ 2M0GB 1EKSA 3PXGa 1QUPA 3Q8VA 5IWAF 1Z2ZA 3E2EA 2AGOA 1S0OA 1C1CB 1I3OB 3N6MA 2F3JA 1BQMB 3AJDA 1X4AA 2IBKA 2UUAJ 1SH0A 2BJ3A 3CCWA 3SDEA 2CQ0A 5K9FA 1KLMA 3WIVA 2XM3A 4R8UA 2UU9J 4QR2A 3V4IB 4JV2A 4YP3A 2EC2A 5L1KA 2OH2A 1OSDA 3MR3A 5CXTA 2W9BA 2NXEA 4NLWA 3PO4A 1EAYC 4GC6A 2NYHA 2B3TB 1FJGF 3OV7A 3MMAA 5IZHA 1YQHA 1RA6A 2JEIA 4WK3A 5F8GA 4MT1A 2GJ2A 5E3PA 4DUZJ 5A8WB 4Y2KA 3SFUA 3C15A 3ITHA 2IVYA 4DQSA 2DGOA 4DQIA 3MUVP 3JTOA 1FJEB 2AU0A 2F4VJ 1NJZA 3RBEA 3R97A 4Y0FA 3JTNA 4AXJA 3MPUB 2HHWA 2ZFHA 4JI5F 4A46A 3PRVA 4DF8A 1U02A 4PG6A 4HHHA 3OFEA 3GQCA 2WONA 4Q2MA 1HNWF 1TK8A 1UJ6A 2ZE2A 2Z57B 2DH8A 1LXNA 4C9DA 3HVWA 1R31A 3PNIA 3GIMA 1KBRA 1VFJA 2HHQA 4RKUC 3QYYA 1FKOA 4C4WA 2FJDB 4YY3F 2RDIA 1DTQA 3R7NB 2GNKA 3M8PA 2Z2LA 3N5BA 2CJKA 3IP0A 1YJRA 5KG1A 1AA1B 4O3RA 2FLOA 1U6ZA 5EWEA 1MROB 1YDLA 3T3FA 3TA1A 3OVAA 2VPWB 3VR1A 2FJWA 4GKJF 3L3CA 1TZ0A 4QW8A 4IQXA 4DLEA 3Q83A 1KRPA 2DTJA 1H2TZ 4DQQA 1IBLF 1WTBA 4KH1B 3CDWA 3TO8A 2DJWA 4PQAA 2EG1A 3I31A 2GIQA 1P9QC 2D9OA 3VHQA 4NEZA 4OZJA 2R7OA 2DD8S 3QLHB 1HARA 2PO4A 1ZZFA 2UXDF 4KIAA 3DRRA 5D0HA 2QL9B 3DHXA 4FDFA 2J5AA 3OUYA 3SQGA 1EIYB 4FS2A 4OV1A 1YZ7A 3QSYB 3AJ2A 2ZH9A 2YNGB 3NWRA 4OZ5A 1YK9A 2AJ4A 1KOOA 3DRSB 2MQOA 1ZZNA 5JVGQ 1OO0B 3Q2TC 3R6LB 4AD6A 2V68A 1UZHA 3CD7A 4P7TA 4NLYA 4HT5A 1SKUB 3C16A 4GVBB 2RIJA 4WFNQ 3C6UB 1FTRA 1YJNS 4CNZA 1JLGB 4KV8B 4ELTA 3FSXA 3MPDA 3M32A 3KUEA 3EYZA 3LWLA 5I42B 2Y1JA 4P72A 3LP1B 4Y2CA 4ZVOB 2QA4G 2COLA 2DNGA 4QIVA 3G8TA 1S79A 3JSRA 3L7OA 3FQKA 3JQJA 2GO9A 1S76D 4ZA1A 1R8PA 2H54B 2K7JA 3AQPA 4QYZJ 2WB4A 2J6UA 1FJ7A 1JX4A 5GAGU 3NGUA 3OXGA 4G3IA 3LP2A 4FBTA 3CCRS 1ZA2B 2OMLA 1LFPA 5ETVA 1OYDA 2DO4A 2VG5B 1NU4A 4B3OA 3MR2A 5CHCB 1HBUB 5FDLA 3T1HF 4URQU 3TZWA 1WOOA 4DV0J 3QT5A 3VAJA 4OZ0A 2PFDA 1ZAWA 4USKA 5B0FA 4BS2A 1VK3A 2N4DA 1XJWB 3CCSS 1RE1B 3OT9A 4KGMA 3TAMB 3I5AA 5L9XA 2VONA 1X4EA 2MLYA 1SQEA 1MN7A 4O4GB 2UUAF 3LP0B 4CT8A 2M70A 2CKWA 3UDLA 1HWUA 2NUUG 1FDBA 3CD0A 3IRXB 3IR6B 3ONQA 2AGPA 1DFDA 1C1CA 1X0PA 3QRQA 3VAGA 3EMTA 1BQMA 4ZCIA 2CJYB 5HROB 1I94J 2AHOB 3CIMA 1HBNB 1YTYA 4DV3J 1KFDA 1Q79A 3V4IA 4DSJA 1FK9B 2ACYA 3K8VA 3UE2A 4DPWA 4WFYA 2J8AA 4BLGA 2C2MB 4DUZF 2LP4A 1U2FA 4DEZA 1FD8A 3ENWA 1Q0NA 1TMJA 2VG6A 2F4VF 2I6WA 5KG7A 3Q8UA 1MMDA 3H98A 3I6PA 5AE3A 3VGSA 4OIXA 3MURP 3UQSA 1VQ9S 4K8RA 2GJFA 1NZ8A 3THPA 1T11A 2RT3A 2P9EA 2HVDA 2XNQA 3PV8A 1RHMB 1NKBA 2I9SA 8ATCB 4B3RJ 2PA3A 3KK1B 1X4CA 4U7UD 3QZ7A 2EWHA 4ZP8A 1UWBB 1MW7A 5GAHI 1KNZA 4PRFA 1RT3B 4MIBA 5D4NA 4KHMA 2FLPA 3TP2A 2FJEB 3I56S 2HFSA 2QO3A 3S1TA 4YFUA 1S0NA 3BSAA 3NMRA 2ZNYA 2CQ2A 3V6KA 1VRTB 5J2MB 2DR9A 1MWQA 1WHXA 2UVVA 2B8PA 1ZM3A 2ZM6J 3QJLA 5HANA 1MROA 3W65A 3CCVS 1K73T 4HR2A 3J7YI 2ADBA 3N6LA 1KKHA 4LUBA 1UKUA 1FESA 4I6WA 1UZDA 1SL2A 2NXJA 3CCUS 5DO2A 5B0DA 1X5PA 3DLHA 1TL5A 3A3NB 1XERA 2RF2B 3QLHA 5CCLA 3HSGA 1JWWA 3QRPA 3W5YA 4WF9Q 2OHDA 5HMWA 2DRDA 2HFVA 3N79A 2ZDPA 2UUCJ 2VODA 5K8OA 3DLKB 2XO6A 5DGBA 2YNGA 1Y5LB 4EGLA 1NB2A 4FS1A 1NK8A 1WNEA 2HHUA 4UF4A 2E1AA 1PBAA 3NGSA 4Z2XA 1AFIA 3VQSA 2HS0A 1VQ5S 4GVBA 1V5VA 2OMOA 1N5YB 2JC0A 3HKZD 2O01C 4H4OB 4DV7J 1JLGA 1Q5VA 4FPIA 4KV8A 2XGPA 2H5JB 3T6BA 4O44B 2XYPB 4DX6A 3K2YA 3NS6A 2VHGA 5I42A 3HHLB 4QYRA 3T5HA 2BBEA 3LP1A 4F02A 4OI4A 2Q3PA 4RBTA 5B09A 2QFIA 4NASA 3B54A 4OI3A 2DNLA 2C2DA 2V4RA 4ECXA 4KGXB 1AYEA 4DV0F 3MEEB 1WHWA 1SKRA 3UDCA 5DZ7A 2LU2A 5T14A 1QSYA 2CWKA 4K4ZA 4WFBQ 2BW2A 3CB4A 2XZTB 3BQ1A 4ECTA 4JI2J 2VBWA 2VG5A 4B3SJ 5MLCV 1HBUA 2IPOB 3WX8A 3T1AA 1RACB 4RU9A 3LA0A 5CYJA 5IQ6A 2FLLA 3I4PA 2DY9A 2MKJA 2Z58B 1SPBP 3R7BB 2GGPB 3TAMA 2E7XA 4DZDA 5IFMA 2OKQA 1T7PA 4OYZA 2ZD1B 4O4GA 2XY7A 3LP0A 1I94F 4ZJOA 1FXRA 1VC5A 2HVEA 2P8IA 4DV3F 2AMCB 4NYPA 3HO1A 3F44A 4OZNA 5D0GA 3PVXA 2YBVA 3T19A 1FNMA 5HROA 1YJVA 4ZIVA 2H4WB 1SC3B 1HBNA 3BR9A 2EPIA 5A2QU 4JP8A 4PXEA 1IKVB 4B08A 3NCRA 1FK9A 2B4OA 1FVQA 4RR5A 3M2VB 3A4TA 2YQ3A 4K2JA 4W98A 4YEAA 2MZQA 2ZBRA 2QFJA 1K0VA 1M5HA 1EX8A 2BUNA 4NEYA 1RU1A 2RS8A 3VCDA 3K89A 1Y00A 4B3RF 1NSKL 1RT2B 4JUZA 3OL7A 1VQ8S 1EETB 4QU6A 3M6UA 3NAHA 4Q7AA 3T1YF 1H0HB 1NPPA 1YJUA 1S59A 1VLOA 4KAIA 2Q43A 3A8EA 3D4JA 3F0NA 4TU8A 3J7AN 3OQ2A 3KK1A 5D0EA 3DU5A 3DOKA 5CZXA 3M8QB 5LMUJ 1UWBA 4HT7A 1SJRA 1RT3A 3HZGA 2UXBJ 2B51A 1AB8A 3EVOA 4DN9A 3GFZA 3B8HA 2IC3B 2ZM6F 3V6JA 2E1MC 4CLFA 5F41A 1U1NA 3BH6B 5J2MA 1V3RA 3CC2S 4F4KA 4ZVTB 1TKZB 1U7LA 3A3PB 3WHIA 2ZH3A 4QR0A 4OX8A 2AF6A 2NPFA 3HXMA 2D41A 2KU7A 3FBCA 3R8YA 1DQ8A 3CDBA 2W7AA 4YB7A 3KJFB 4RW8B 1B7YB 3CDUA 3CSKA 5F9LA 2C2ZB 1E6VB 1ULRA 3PHTA 3O8WA 2Z8QA 4QU7A 4FNHA 1AZSB 2UUCF 3TX8A 5B0GA 2VG7B 2RF2A 2E5IA 4J7CA 2NXCA 3CULA 1VCTA 5HMZA 4HHJA 2B7BB 2IRXA 4P74A 3M05A 4X66J 5KT4A 1VGYA 3MAQA 1J5EJ 2RNEA 4MKAA 4O0IA 4DV7F 8AT1B 1OWXA 1P6TA 1DRZA 2RILA 4KY3A 3KLGB 4ER8A 5EHHA 2J9CA 1UTAA 1N5YA 4K5RA 4RUCA 4H4OA 4R5PB 2NCKL 1NK9A 3FEZA 3EXCX 2KZMA 3X3UA 4ES3A 3B4MA 3SV4A 3D9BA 5E3RA 4O44A 4CI0B 3H7HB 2X1AA 2ADCA 1NK5A 3GB0A 1N48A 3QIDA 3RZAA 5BYRA 3H4BA 4MH8A 4JI2F 3H20A 5EX3A 1WG4A 4R0JA 3Q0AA 4Q43A 2EK1A 2V4QA 2KHDA 3AFGA 2MY8A 2K2PA 4LF9J 2VPXB 2F7VA 2V8HA 1B4SA 1JLBB 3MEEA 3HM9A 2WK4A 1ZS6A 4DX5A 4NCAA 2VB6A 3TA2A 3CJ3A 1DJ0A 4E2FB 3D6HB 4DV5J 4NWBA 3SBMA 2J7WA 2BOAA 2MMYA 2YKAA 4RW7B 2ZH2A 5I3QA 2NZ4A 2GGPA 5AT1B 3TUIC 3J7Z5 2KT5A 1N88A 3JYTB 4M5GA 1CJUA 2CJ9A 4NMXA 3BREA 4IH6A 3S7RA 3TNVA 4FVCA 1B0VA 4MIWA 5FLXY 2BDPA 4NCGB 3K5OA 2N3LA 1NUEA 4IOBA 4JV5F 3DOMB 1GH8A 1FTCA 1IKVA 2KB2A 2K06A 4IG3B 2B6AB 1N6QB 1M1HA 5HJXA 2WVDA 1AUSL 1UWAA 3OPKA 4ED4A 1VBZA 3FJ2A 4I0WA 4LF8J 4J9OA 3OTDA 1N52B 3SCIE 4NZ0A 3EICA 3PEJA 1B64A 2PFFB 1RT2A 3DMJB 5LSOA 5LMUF 1U2CA 1EETA 5KG6A 2HYIB 2UXBF 2H65B 3GCWP 5JJBA 4ZLNA 2DCLA 3G71S 2CJQA 3PIOQ 3L7UA 2IM1A 2JWNA 2KFZA 3QPIA 3VQTA 4F0HA 4J9SA 3M8QA 4I56A 2BE7D 6FD1A 1UCNA 2XHWA 1QAJA 5KOXA 5HQLA 2K1RB 5HSPA 2IC3A 1Y4ZB 4ZPVR 1TL7B 4M5KA 2J0SD 2Q79A 1KTVA 1WG5A 3PG9A 4BWJA 3G6XA 1VJQA 1RYRA 2HNZB 5HO4A 1TKZA 3FCHA 4KTQA 4M8LA 1RLCL 3GFYA 3H0PA 4QZVB 3GIIA 4DR4J 2GC8A 1I6JA 3I5BA 1UVJA 1QTNB 4QWAA 2OPPB 2ZWOA 1F6TA 4RW8A 2I38A 1NDKA 4ZDNA 1E6VA 1MLAA 4DV1J 5FD1A 3PKYA 3NNCA 1AZSA 5EUHA 2RVJA 4X66F 4WYWA 2VG7A 3MM8B 2V5HG 3IM8A 2DCUB 4ECWA 3EGNA 4OJ1A 1J5EF 2R7SA 4I6YA 3UWTA 2LMIA 1NK0A 4N7TA 2R7QA 4UZCA 2VBXA 2ZVIA 3ILLA 4Z7CA 4ZVEA 2W4CA 1EJ7L 2XCAA 3LPEA 4ZPWR 1U47A 5C7PA 3T5LA 3BO3A 3FZ2A 4DCPB 2CQDA 3KLGA 1TELA 5RUBA 3UD4P 1SKWA 2IAJB 5U47A 2QTWA 1WTFA 2OPRB 1MU2B 4LF7J 3CCQS 3HVTB 4R5PA 4DSFA 3IBCB 4USVA 3ET6B 3J81U 1PC5A 3OFHA 4K2XA 2AX1A 2GMHA 4AUKA 3DRYA 4LF9F 2R7VA 1S97A 4HDGA 1YX2A 3I5CA 2EFPA 1HPZB 4RW9B 2KJVA 1JLEB 4EUVA 4TU9A 5KFQA 4NLXA 4DV5F 2FIUA 4N41A 5G0RB 2MQMA 1JLBA 3PACA 5DLGA 2WAQD 2HHPA 3PYFA 1V6HA 1MWYA 1FWPA 4HL9A 4UQTA 4YQWA 2J0QD 3DI6A 2FJVA 1B99A 3HX9A 4RW7A 1RABB 4CH0S 1NJWA 4LVOP 4PKDB 3ISZA 2DXEA 3JYTA 2LDIA 1JNZB 1SIZA 1SC6A 1Q8BA 5KFZA 2K7KA 2XMJA 4MJKA 2LQBA 1N5VA 3L7PA 3BB5A 1H6KX 1JLCA 4V19X 3GTYX 1ZPVA 4ID8A 4IO9Q 4NCGA 4GRSA 3QGGA 2MEWA 3A12A 4WP3A 1CQNA 1X8DA 4LF8F 3DOMA 3PX4A 1YI2S 2FHJA 2RUSA 4IG3A 5E7OB 2J6SA 2B6AA 1N6QA 3QFHA 2XEXA 4C7QA 1T3OA 1Q7YT 1PJ6A 2F4FA 2XMWA 2QC3A 3AT1B 4Q8FA 2Z56B 4CLKA 2MTLA 4QOTA 2X1FA 5F0UA 5BR8J 2QEXS 3IBFB 3UD3P 2HIQA 4J9NA 2ALZA 3G82B 3R5BA 3DMJA 1FF2A 4FN5A 1OQ3A 2VU5A 4RX6A 2FZGB 1A0OB 5HMXA 3DXBA 1XQIA 4HTIA 4ILRA 4M5JA 3PYDA 5KFUA 1RSCA 3H5UA 3GYNA 4P7VA 2LDYA 2MZRA 2YQ1A 4A8MP 3OJUA 3MFHA 3IAS9 1ZTWA 5IS2A 2K1RA 4IG0B 5H1SV 3WZ0A 3FNNA 4NLOA 4DR4F 1BLUA 2OEMA 1VQ7S 1PG5B 1HI8A 2AEJA 4CO2A 2W7OA 1WG1A 1Z1ZA 4L72B 2HNZA 1VHIA 2OSQA 1X4HA 5GAEU 5IT9Y 4IYQA 4DV1F 4F2SA 4A8YA 1AFJA 1S1TB 3GU0A 3MR7A 4XAKA 2E44A 2OPPA 3MEGB 2MQPA 1BWVA 1UEKA 1RT1B 2KHCA 3LGNA 2E5LJ 3BO2A 1PILA 3OL8A 4IFVB 2NPIA 3IBWA 3MM8A 1RHUB 2JFDA 4G1QB 4J37A 1HD0A 2LQ8A 3C14B 2WTFA 1F9HA 3MXHP 2C22A 1QLNA 3KLVA 5BYQA 3J7YU 2CZ4A 1SV5B 1WJ9A 4DBQA 3J80Y 3K5PA 2NLWA 4LF7F 1BY9A 4L74A 3GP9A 1Q95G 5AXMA 4X65J 4FYVB 3QAUA 3D0HE 3UD5A 4M63A 4FYWB 1X4BA 4DG1B 4M5MA 1FE0A 1RAFB 3KDNA 2WW8A 2IAJA 7AT1B 3JB9k 3EXYA 2OPRA 1MU2A 3HVTA 2HWHA 3Q8SB 3C8YA 2H48B 2A1BA 5IV4A 1KTQA 3ET6A 1DARA 4C8ZA 3QJJA 2CPEA 5GMDA 1KC8T 4OYOA 2VOPA 2V4JB 1X5SA 3FKBA 4K5SA 3CD5A 3R2DJ 2ZC3A 1TR0A 1RDRA 4JOUA 1WHVA 3ZNUA 2VICA 4YMEA 3UDEA 4LSLB 4CLPA 1TK5A 1HPZA 4RW9A 1JLQB 5IXUA 1YJTA 1JLEA 3QRRA 1S77D 2B56A 4OYBA 2PMZD 2NZCA 3EGVA 5F9NA 1VMBA 1S0MA 5G0RA 3CPWR 1UA0A 4K50A 2VZ9A 3HULA 3PTWA 4ETZA 4OHYA 5DQIA 3MWBA 3U1MA 3UI3A 2BQRA 4KHPJ 4UUXA 1VK8A 2E1CA 3D67A 3PJXA 2YKMB 1U1QA 1IWAA 2HHVA 5ETPA 4MTPA 1ZAXA 5HL7Q 3DLLQ 1PC4A 3CEDA 2DPJA 1RHKB 3MPWA 1Q7LB 4RJVA 1S7IA 1K9MT 4WXWA 4DU8A 2B9EA 1HIYA 2HPUA 4DHVA 5BYSA 2C3YA 3FK4A 4IH5A 1A9NB 5L38A 4O3NA 1VRUB 5CQGA 3MM7B 3LF0A 4OHVA 3EVWA 2HLUA 2F8EX 3UR3C 2IJRA 1S6QB 2BOPA 5BR8F 3M1VA 5EDWA 2Y3YA 4TKTA 2ZKTA 2AP6A 1WDDA 4QR1A 4CLWA 5G4DA 2VKZG 2BE2B 2HK2A 3CJQA 1XMOJ 3W3SA 3QGPA 1WUUA 3DOLA 3CJ8A 3VAKA 1IM4A 4J9PA 1D9FA 1VIXA 3CJ0A 3G82A 3CC7S 2LFVA 5DZ6A 3CF5Q 1NSPA 3JAMY 3PEHA 1RTIB 1HI1A 4DUYJ 1TKDA 1WF2A 3KLHB 1R8CA 1GQEA 1OY9A 1CJTB 3EVMA 4OJ3A 2CAJA 2YY3A 4RWWA 4LSZB 3CD6S 2WRMA 4C0OC 1AT1B 2Y8WA 1XNRJ 4CYUB 4DN0A 2R7WA 1FHTA 2E29A 2R42A 2X7IA 1U1RA 4IG0A 2E7VA 2NXNA 2LEBA 1NBEB 5GAGI 1RA7A 4WTYA 1HHQA 5CD4A 2K3KA 4BDPA 1Y3JA 3R5DA 4FXDA 2E5LF 3QWPA 3ZXWA 4F7VA 1N5SA 1S1TA 3MEKA 3MEGA 5DDRC 1FKPB 1MMNA 2PC6A 3NY0A 4B9LA 1RTDB 1RT1A 1X5OA 1CSJA 4JI8J 2JNJA 1D8ZA 3EZ5A 4IFVA 2HBYB 2MGZB 2HQFA 4Q44A 5B0EA 4ZITA 3FGVA 3OR2B 1SL0A 4NOHA 3C14A 1Q53A 2KYZA 2CPYA 3U02A 4X65F 4CLSA 3VVTA 1SV5A 3C46A 2K8GA 2J7KA 1CPZA 5F8LA 3GILA 2FB0A 3PJ9A 1O5JA 1ELOA 3R1LA 1M0SA 3EWGA 3TVKA 2M3DA 1MG7A 2O3DA 1RAIB 3TUJC 4DG1A 2HG4A 3ENAA 3W8PA 5D4OA 3OJSA 3BGUA 5KFEA 4ZVPB 1PGZA 3CO9A 1X5TA 1SKSA 4FYXB 2M4MA 2ROGA 1WWHA 3OTEA 1EQ0A 3A8KA 1DBDA 4RNMA 3QSIA 3DRPB 4X64J 2V4JA 2J8SA 4ZPAA 1N36J 3FSIA 2FD2A 1XIQA 1GAOA 5M2PA 1RBAA 2QLFB 4LSLA 3TVYA 3CE8A 2F40A 2CNOB 4IO1A 4KHPF 4CLUA 1T0TV 4DZ6A 2IIHA 2AYBA 4O4RA 4WP8A 1C1BB 4QWBA 2XMAA 3BSNA 2XB2D 3TR5A 2UVWA 5HI7A 3N01A 3MFIA 1Z4UA 5BXIA 4OQJA 2KXNB 1LWXA 1URNA 3CVKA 2DB1A 5KT2A 2YKMA 3DLGB 4RUAA 2V50A 2VPYB 2UVUA 1AW0A 3GONA 3Q8PB 1KONA 1YWXA 3H5XA 2AJFE 5KFKA 1VQMS 4LF4J 3QJPA 2LA4A 1NSQA 3HVAA 1UJ4A 2KO1A 5B08A 3ZTSA 4NLRA 1FRLA 4ZVUB 3SSSA 2G13A 4B9SA 4I69A 2LECA 3AXMA 4P2XA 3ZTPA 1VRUA 5THWA 3KMQA 2AZ1A 2GW8A 5ETSA 4JB8B 9ATCB 2YTCA 5HP1B 2ZVSA 2OD6A 4ANEA 4QCLA 1XMOF 1KSPA 3MR6A 1B7FA 1H74A 1S6QA 3B4DA 4GC7A 2B43A 2IRUA 5L46A 2RHQB 3RR8A 2VJVA 1SJFA 3QGHA 1SH3A 3E51A 4C98A 2BE2A 1KOHA 2QA1A 4FXVA 5D77A 1TUGB 2BKPA 3HHKA 4DUYF 3DXSX 3AAWB 4CO4A 4BWMA 3I0RB 2J9DA 3VZHA 3U7JA 2LYVA 1HI0P 4IRDA 2ACMA 2MKKA 1XNRF 1RTIA 3FBEA 4WE1B 3P45B 3RGIA 3KLHA 1JLAB 5DJBA 1CJTA 2KH9A 3M2RB 2M8HA 2EBEA 2C2EA 2CVEA 2QMXA 1S6PB 3N0VA 5HBMB 4BHQA 2FY8A 1TP7A 4CYUA 3WQPA 2NQPA 1N8RT 2YPYA 1R6YA 2NS1B 1AROP 2WVBA 1GXLA 2WZ1A 2B0GA 4PG8A 3WDOA 1C2PA 2QYCA 1KLNA 4ZPBA 3GV7B 1HNXJ 2DITA 2ZBCA 4JI8F 3PYGA 1QTMA 2AW0A 2UV8G 3K8WA 2A2DA 5H9EK 1OSCA 3T6JA 1UP1A 1SL1A 2KI2A 1FKPA 4X4QA 4V19J 3CW2C 3MDFA 3ZZ0A 4NA3A 1RTDA 4N5SA 1Q4RA 2OTJS 3RYLA 4B3MF 1ZYQA 1Y0HA 2DNZA 1LK7A 3M30B 5AJ3F 2KM8C 2HNYB 3PW5A 2HHSA 2MGZA 2OSRA 3A8JA 3J7A1 3CJSA 3OR2A 3UDVA 2Z2YB 4B3TJ 3K5MA 1REGX 1T9WA 4TY9A 3AY0A 1H7XA 3PJWA 4F25A 2ILZA 4ZS6A 3MMJA 4XTTA 1P9YA 2A0FB 2G0JA 3G8QA 3QT8A 1S9FA 1F5AA 4JI1J 5FIIA 4B02A 4HACB 4J91A 5H9FK 1JNRB 4C11B 1VYAA 5KFBA 1RU2A 1HA1A 4X64F 3ENQA 1RB0A 3KLEB 1T9VA 1FFWB 1HMVB 3HCXA 1RHJB 1IR1A 1TQLA 4M5LA 2HK3A 3VAMA 3GG1A 3ZFVA 4ED8A 3LGMA 1JJ4A 3NWGA 2ZZTA 4KH0B 3HK2A 4LMZA 1GEHA 3T5KA 3T5JA 2XCPA 1S4FA 3P4UB 3DRPA 2BV3A 1RTHB 1REVB 4PZVA 3M9NB 3NLCA 5KFGA 3BPDA 2VDIA 2QZ8A 1T9XA 1YRXA 2C2RA 2W25A 4V1Ak 3M4XA 1N0UA 3P49B 3IA0A 1FEEA 3LO3A 4ETXA 5FLXU 2KT3A 2BMBA 1R7IA 3EGWB 1DQ9A 3WC0A 1C1BA 4LVNP 3VZIA 3S6EA 3UCUP 1G4CA 3FQLA 4Q0BB 3ITHB 3AOBA 2WSFC 2CQCA 1FJGJ 3KUHA 2VH7A 1Q82T 4C8MA 4LF4F 4LSNA 3F41A 3O44A 3DLGA 4WPAA 4X2BA 5ADZA 3PKMA 3KK2B 4IOAQ 2BJ1A 1RK8A 3D1OA 1IN0A 3K58A 4EMDA 3SCJE 1IKWB 2DHSA 4FF1A 4U8VA 3KK3B 1RWNB 4UY85 5HQ8A 2XNRA 2DNYA 4OHZA 4IR1A 4JI5J 2MPUA 4MYUA 4EI2A 3WIUA 2GVZB 2R7UA 2XMVA 4FP9A 3BEGB 5HP1A 1QM9A 4YY3J 1NK4A 1OMSA 2XC9A 4ZCKA 3GMGA 1S7HA 2R7TA 2HBQB 3NNAA 1UA1A 5C2CA 3H2UB 2CJXB 1WDTA 3BDEA 2HGMA 3MMCA 3D28A 4DCJB 1RAAB 1GXTA 1Z2LA 3M8ZA 3VTIA 4DOZA 4C8KA 3TJ8A 2CPXA 4MAKA 3CTRA 3I0RA 3MHYA 3JSMB 2YQ0A 1SQGA 4K59A 4NX9A 2WBMA 2B8QA 2MLXA 4HEA9 3H5YA 1TV6B 2LEAA 4WE1A 2VD3A 3TVZA 1JLAA 1NH8A 5IM0A 2I0XA 3PDNA 1CULB 3M2RA 2DEJA 3HT0A 1XNQJ 3THVA 4HDHA 1S6PA 5HBMA 4P2FA 4CO1A 2UUBJ 2L9WA 1HNXF 4XO0A 5DM6Q 1RT5A 1XTZA 3GFXA 3A3OB 4CP5A 4LF1A 2GZOA 4PWDB 1M5SA 5EGYA 4ALZA 3OFGA 3HI9A 1A7GE 4CLLA 2NUHA 4WCEQ 1R3NA 2QX0A 2FY1A 3DKDA 1HWJA 3CMQA 3SIPB 2M2BA 2NYIA 2IVMA 2CG8A 5CA5A 3EUNA 4B3TF 1KR4A 5D8HB 2YWWA 1J5OB 2CQIA 3M30A 3WC2A 2HNYA 2DVIA 2EKNA 3W62A 2BANB 1SB6A 3FEYB 4JI1F 3TOQA 3AOCA 3S8SA 4RNOA 4WIQA 1S1WB 2Z2ZA 3BSOA 1DY3A 1F5BA 3PW7A 2XSFA 4WYLA 2MQLA 4ZVRB 2YWHA 1YSJA 2U1AA 2IRYA 3CXCR 4HACA 3T41A 1DTTB 4A8SA 4KKOB 5T7LB 4ICLB 1K1SA 4C11A 3R5JB 2Y0SD 4YR2A 1HQ2A 2C3OA 2RDDA 4NE9C 3KLEA 1HMVA 3HVRA 3HHNB 3W9IA 2KVIA 4DL2A 5C24B 4PCQA 2BM0A 5GMEA 5KFPA 2I2YA 4J9MA 2BJDA 3QWUA 5AXKA 4BCAA 4ZP7A 1RKIA 1T9YA 3DU6A 3BN7A 5E3QA 4ELUA 4DPOA 1RTHA 1REVA 4P9SA 2OI2A 4CCHA 2RJZA 2HQCA 1FERA 4ZOSA 4RUHA 2NREA 3P5TL 5AXNA 3AHPA 3OXLA 1KP6A 1XR5A 1PJ5A 4DCOB 3SQOP 2VG6B 2OGUA 4NYZA 3IAM9 2CPJA 3LQVA 4M5NA 3ZTOA 2YWKA 2BM1A 4DR2F 1RAGB 1YJWS 4Q0BA 2HURA 4XPCA 3SV3A 1RT4A 3W64A 4NRUA 2L9NA 2GMLA 4USIA 2VPZB 1EQMA 2DH7A 4OI0A 2UVRA 2CXEA 3GFHA 1F9EB 3KK2A 3K0JA 3IRWP 1WKKA 2XI2A 5K8NA 3FMBA 3P96A 1QAIA 1NK7A 2HSEB 5A6PA 1IKWA 2MSSA 1WORA 3KK3A 1BWEA 3IR5B 3LH2S 4LBHA 3O6QA 4DV6J 2N7CA 3MI7X 3TARA 1BMQB 2ZJPQ 3PRDA 3G9CA 2GVZA 2FC8A 2XSJA 5KT6A 4UOFA 5B7WA 5LSRA 1X60A 2QG9B 4I68A 2OPQB 3UN2A 2RRNA 2WW4A 4LJMA 3UR0A 3FRYA 2DGUA 3B82A 2DHXA 2JLFA 1NMEB 4J9VA 5I3UA 3P3DA 5C2GA 1OPZA 1HNIB 3UVJB 2JOQA 1RAJA 2CA9A 3FC9A 4L6V3 4F26A 1TKXB 2V69A 5KFHA 1JXLA 3KG0A 2M9KA 2RE1A 4NYOA 5IT9U 3W63A 2QLWA 5LM7E 3JSMA 3OSPA 1XNQF 1OY6A 3DFEA 1TV6A 2VKRA 4KGVB 4G65A 2G1DA 2UUBF 2EEYA 4U9RA 2ATCB 4GO5X 4CT9A 2CWXA 4P52A 4HTJA 1CULA 2BJ7A 1FWKA 1IXKA 2XMTA 3RBXA 2A3JA 3OL9A 4O0NA 2W4PA 1APSA 3ETMA 5D4LA 2QN6B 3KNGA 3IXQA 3OLBA 3IR7B 2L08A 4DS5A 5EX0A 3QQCD 3DRXA 1N32F 4WKYA 3IM9A 2YWGA 4O3QA 3J80U 4PWDA 4UTGA 5E33A 2RKIA 2RDJA 3OFFA 3KLFB 3JSYA 5T41A 3ELHA 4YHHJ 4LFAJ 5KFVA 1HR0J 3IFEA 1N5TA 1KQGB 4ZN1A 1N34J 1R8BA 1RWPB 2IJNA 5E0OA 3RAQA 2GX8A 3H2LA 1P1TA 5FJ4A 2XO7A 2V67A 2FVCA 2VV5A 1JXVA 1J5OA 2BQUA 9RUBA 1H38A 2BANA 5LXRA 4KR0B 1AUDA 3OSNA 3RW7A 3CCMS 1UVMA 2A6MA 5J2QA 2QLJB 2D3ZA 2O5DA 1N33J 4FNIA 1S1WA 2EKYA 1PAUB 3P5BP 1KQKA 4EU0A 3E01B 3CIZA 5DG7A 3R5AA 3AA8A 2I5JB 1HFEL 4YR3A 1WC4A 3QO9B 1WI6A 1DTTA 4KKOA 5T7LA 2FGCA 4ICLA 3H5SA 4U95A 4N8NA 5A8RB 3NS7B 5KFMA 2IMWP 1GXUA 2L41A 3MEDB 4P6QA 2KJWA 3HHLD 5C24A 1F0XA 4N8OA 1UVIA 4H4MB 2BYCA 1XK8A 2MKCA 4G1IA 1CEZA 4GMKA 2E66A 3DDIA 3M8RA 5ETKA 5KFNA 4RUBA 1FE4A 3SCLE 4FPRA 3PCOB 2PEHA 1I51B 3PW4A 5ITHA 5HK4A 4ECSA 3PHEA 2R8GA 3BBFA 5KFYA 4LRCA 3R6GB 4PPDA 2M5YA 4JI0J 4A8FA 2NXUA 2V8VA 3TX0A 3OVSA 3W66A 3LANA 3ZTQA 4AE5A 1YJ7A 1RYSA 3W60A 3I82A 1A6LA 1CG2A 2AJ2A 2DNQA 5GAEI 2MY7A 1UVLA 4DV6F 2I1RA 2N7YA 4J9QA 3DOKB 1YRUA 4W90B 5F3ZA 1ZH5A 3T1YJ 2G2YA 1NJXA 3D5MA 1EP4B 1T94A 3KG1A 1HHSA 1W25A 3JAMU 5L1LA 3GR0A 5K14B 2D3OR 1LFWA 3NOCA 1T9UA 2BKNA 5CABA 1CVJA 1U8WA 5LJ3Y 1C0UB 2V63A 2OPQA 3NRBA 1YHQS 1HYSB 5C25B 3VALA 1S1UB 4TXSA 1RWOB 2HNDB 1DURA 1HNIA 3UVJA 2HS4A 3LPYA 1LNQA 3L4BC 4ENOA 1IBKJ 4KPCA 3Q8QB 2PSZA 3MOZA 4K7QA 4RBUA 1R6VA 1TKXA 4PXCA 1OPIA 3HFZB 3BBCA 4B9TA 4FKXA 1VI7A 3H90A 3RBDA 4M5DB 1UAWA 4RWXA 3LALA 3HZEA 4USWA 1HWIA 1SBRA 2JHEA 2HHXA 2W2MP 4U6PA 4IDKA 4PABA 3I4HX 2HQ3A 2EK6A 7FD1A 3FCWA 4NLDA 5A8KA 3RG6A 2J9EA 1CLFA 2ZH5A 3K57A 1X31C 3BGOP 2BJ9A 1Q86T 3TUZC 3QT7A 1D3WA 2VFVA 4WU2A 3B6BA 1NNDA 4YHHF 4LFAF 2KDOA 2Z30B 1HR0F 2EFOA 1N34F 5E3AA 4WJBA 1RBLA 2GV1A 4Y3CA 1Q1KA 3R1HA 3KLFA 2CVIA 3CMAS 2FJAB 3BYRA 2FVQA 3T9NA 4X4VA 1YG0A 3RRKA 3EDQB 4ES2A 4EO6A 3O3LA 5HATA 2PI5A 1FDNA 1JQGA 1U26A 1YVFA 2J76E 3HLUA 4FVMA 1N33F 1U2RA 1SIWB 4YB5A 2W2NP 4KJIA 4X4UA 1YRTA 4DL3A 1ZPWX 3NCPA 3MTJA 3BKUA 4CM2A 2MZ1A 3R3TA 2NR0A 2G1HA 2XS7A 2XQCA 1ZOTA 1MSWD 3AA9A 2Y1IA 3E01A 1UVKA 3AODA 1RWXB 3CC4S 2E9TA 2PE8A 2FJXA 2I5JA 4J90A 5JVHQ 4QQBA 3FZBA 1JJ2R 2W01A 4CH7A 3QO9A 1W2BR 3N4WA 1CJUB 4ED5A 2GHWA 2IHR1 4USHA 4USJC 3KTQA 5A8RA 3NNHA 2CPFA 3H2VE 4MK9A 5K8MA 1LK5A 4JI3J 3ISND 4E98A 4LRBA 4XPEA 3MEDA 2DR7A 2PT0A 2HHTA 4H4MA 4BC7A 3K7RA 1UPMB 3EJMA 3UPFA 3IO1A 2AYEA 3R27A 4JI0F 5LT5A 2DXFA 4YOEA 7FDRA 1QY7A 2LQ9A 4DR3J 1BD6A 2DGWA 1VS3A 2DNNA 5DQHA 2OELA 2ZH8A 4JV5J 4F0MA 3GSIA 1RTJB 4OX9J 4ILMA 4ZMMA 4I4BA 4UW2A 4TLQA 3BZQA 4K4TA 3ZZOA 2CNLB 2DBBA 4NLVA 3KNAA 4XIUA 2HZAA 1K0TA 1PKUA 8RUCA 1S6UA 2J0XA 5KFFA 1UMJA 4CTAB 3U27A 2RAQA 1X9WA 5L39A 1KHVA 3BSCA 2N4CA 4P2SA 3G86A 1M1KT 3NG8A 1T9TA 4NL5A 1PBUA 1F2GA 4EYIB 1WC5A 1PAEX 1GX6A 4E8UA 2MB0B 4LBIA 2GIRA 5ETOA 1NKCA 2MLZA 2W2PP 1EP4A 3MPVA 2ZKUA 3MAAB 1TL1B 1H2VZ 5KFRA 2V2KA 4EK2A 5K14A 5KG3A 3LAMA 2R8IA 2FHJD 4C6AA 2V8DA 2BJEA 1TU0B 1IBKF 2JLEA 5ETLA 1C0UA 4Y2MA 3C66A 3DM2B 4PYAA 1HYSA 2HBRB 5C25A 2KL8A 3R7SB 4I2QB 2FUG9 3TJ9A 1LKZA 1S1UA 2HNDA 4NLUA 2VL1A 1U49A 2YNIB 1X7VA 4K4XA 4BC9A 4Y00A 2BABA 1N0VC 2VBYA 2GS8A 2VA2A 1WEXA 3DGVA 3IMQJ 1S99A 4DPXA 4I7FB 2OFHX 2B4UA 2DHHA 5KFLA 4OYXA 2PI4A 4M5DA 5EWFA 2ZJQQ 2HEKA 2CQ4A 2CPHA 2SXLA 1S9GB 4K4VA 2AT1B 4DL6A 4F3OA 2QMUB 1LWCA 1Q5YA 4J9KA 4DR1J 4LRAA 1NLKL 3U1NA 3SFGA 4M5IA 2DNKA 4RW6B 3FSYA 1KVIA 1SJ1A 2EFGA 1F60B 3PR4A 1NZAA 3AQOA 4X4NA 1PSDA 4OLPA 2W2OP 4QJVA 4ED7A 3KLIB 1S48A 3DNCA 5LSLA 1VC6A 4F67A 2LVWA 4IRCA 2Q6CA 1OIAA 3FFIB 3DGPB 4MKYA 5E3CA 1ZA1B 4NLQA 3M9MB 2E9RX 1IR0A 1IBCB 3ICLA 2DR8A 4TQSA 4J9UE 4IOCQ 2VFUA 4LR7A 4LRFA 1BGXT 2D69A 2UV8A 4LRDA 4USUA 1FWLA 3RB0A 2RQCA 4KBIA 1S10A 2ZNZA 3DI6B 3TAPA 4CO0A 3LGHA 3AH6A 4NLSA 5D0RA 4JI3F 1V3ZA 2EVZA 4BBYA 4DR7J 2DNRA 4F3MA 3AD7C 1M5KC 4NXMJ 2A2CA 5ETNA 4X62J 2CNNB 2D3O1 2IA6A 2HRYA 3BQ0A 1JLCB 3V2UC 5F3TA 2VC0A 5AXLA 4DR3F 5M2UA 3M2UB 1UFLA 2J6TA 2N3OA 4I67A 2BW7A 1YLXA 2QL5B 3ZNJ1 4F04B 4OX9F 3KOAA 2EG2A 4ZKAA 2JLGA 3TZYA 2ZH7A 1ZM2A 3QZ8A 5CZVA 2IM2A 3QBCA 2VUGA 2ASLA 1O0PA 3SYZA 3RRHA 2G2OA 4GVLA 5L8RC 3G8SA 4K4YA 2XY6A 4YDXA 5IC6B 1RTJA 2WBRA 1XR6A 3MF5A 2P6TA 1RZMA 3HSJA 4HH1A 1VHFA 4ZPCA 4LFCJ 2ABYA 1RWVB 2PGCA 1WSRA 3UFCX 2HHHJ 1WKJA 3IWXA 4CTAA 2R8JA 2XLJA 1VISA 2QYGA 4EEYA 4FYYB 4OJGA 3N28A 4ECZA 2ZEJA 4L76A 5KFJA 1RBOB 4RPFA 2VOOA 4OX6A 4QPTA 5DDOC 3MAAA 1TL1A 3AJ1A 5F8MA 4U96A 1HD1A 4J5OA 1WSVA 1QD1A 4RLEA 3IWNC 4A48A 4OYIA 2KZZA 3DDKA 3I9V9 4U8YA 2GHPA 1QJHA 2YPZA 2MXYA 4DSKA 4O3PA 3DM2A 2VJUA 2F8MA 3PX6A 4I2QA 5F8HA 2FLNA 5E5NA 2YNIA 1M90T 1VQ4S 2B4VA 3E3XA 2XI3A 3VAIA 4KO0B 1NPKA 2H3EB 3M6WA 2VDHA 3L9ZA 3SCKE 4ZVHA 4I7FA 1RT6B 2ASDA 2KXHA 1C4CA 3MM9B 4DR1F 4AT1B 3R5GA 3BPSP 2Z4PA 4DF4A 3VAHA 2YKPA 1SJ3P 4X84A 2ZH6A 3D68A 3D3BJ 3Q89A 3PZPA 4EBCA 1OY8A 1S9GA 1M1GA 1WEYA 1X9MA 2IA0A 4JI6J 2P9GA 3KHGA 4KE5A 3NCQA 3C19A 4NI2B 3MMBB 4OV6A 4QIGA 4DV4J 2HVIA 2DGSA 3QFWA 2VASA 2CQ1A 3BH7B 4R25A 3LW5C 4M1KA 1U25A 1XWLA 1RT7B 1U1MA 4RW6A 1LW2B 4ECYA 3N6NA 3CMES 3RU0A 3GLJA 5ETRA 4B9VA 3BDPA 3UN5A 4HI2A 5J2NB 5L1JA 2FVSA 1R8HA 3KLIA 2H5IB 4NLGA 1IJEB 1WI8A 2E1RA 2ZUGA 4A8OA 4O3OA 3FFIA 3FEXB 4M94A 3DGPA 1WACA 3AXKA 2EFQA 1RP5A 3UN3A 4EO8A 4RW4B 2HRTA 4RNFA 5DM7Q 2M52A 3D7SB 1RGVA 4QPXA 1U8SA 2EBGA 1IKXB 1Q81T 2LA6A 1T3NA 4A47A 1FKAF 3VWSA 2A10A 1N56A 3TEHB 1SC4B 4OJHA 4DR7F 4KB7A 3D0IE 2XBPA 3GYGA 1U1PA 2ZITA 3TYTA 4NXMF 2GAHC 1XR7A 2FPHX 1SQFA 3UO0A 2KRBA 4X62F 1XMQJ 4RO0A 2DY1A 2LQ5A 1DHMA 4ZLJA 4JV0A 1S9EA 2BQ3A 2RSQA 2FDNA 1NHKL 4URGA 4NMLA 5HVFA 2VFTA 4U67Q 3MM6B 4WXOA 3W8GA 1NDPA 4OYWA 4KFBB 2CDQA 3Q8YA 3I32A 2PA8D 4JV1A 4WFXA 4HYKA 1B70B 5KOWA 2UU9F 4IFYB 1X4GA 1FD2A 3R9LA 2MZSA 2XS5A 4TQRA 3M2UA 1K1QA 2C3PA 2KN4A 4DPUA 3RB4A 1OS5A 1NAQA 3RAXA 2GVDB 5HN0A 5K20B 3M1VB 5HQMA 3HD2A 1B0TA 4LFCF 2EC0A 4Q5VA 2KRRA 4KPYA 2OTLS 5DDPC 1T03B 3DOLB 2HHHF 3SMZA 2CADA 4C48A 3RB3A 3PIPQ 1QE1B 5D4PA 3BKFA 1KEKA 2RRAA 1D0EA 5A8WA 5AE2A 1NKEA 2FZCB 1WELA 3GZ7A 3G2XA 2GA7A 3NGDA 4F50A 4PG5A 3GSDA 4G6VB 1YJ9S 4NA1A 4HVZA 2ZOMA 1T8EA 3NBPB 4KGZB 2OO4A 4ZN3A 1ZETA 1FXDA 2CQHA 2R7XA 4PWUA 1K47A 2ZJRQ 2J0WA 2IM3A 4FF3A 4ZLPA 1MMLA 2LU1A 3LTOA 5MAOA 4LF6J 4MFBB 3GJSB 3ENVA 1B3TA 4C8YA 2L3MA 1YBUA 4YS2A 5KFAA 2DIUA 1KD1T 1R27B 3PY8A 1Y5NB 4N47A 2C2OB 1UVNA 1U1OA 1E6YB 1HKAA 4A8KA 2OUGA 3TZXA 2Q6BA 4OI6A 1FT8A 4N76A 1YIJS 2OPSB 1RAHB 2E5HA 5KFXA 2V6AA 1NM2A 5IT4A 2V8PA 5H9EJ 4CDIA 5LXYA 4TU7A 4DUTA 4KO0A 3M8YA 1FX4A 4JI6F 2R3VA 1WF1A 1JXEA 2CJBA 3HJVA 1RT6A 2R8KA 4DV4F 2BXJA 2D3UA 3TRGA 4DL7A 4AQYJ 3MM9A 2GCFA 2W9AA 1U6BA 4N77A 2YKQA 2F9DA 3JQKA 4XDDA 2C1EB 3MCOA 2ERRA 2HLTA 1U1KA 2A18A 1JLFB 4C0HA 3QNWB 3G4SS 2IBOA 1FVSA 4DSLA 1S72S 4NI2A 3MMBA 5DRKA 1KN6A 4I1TA 2BA9A 1ZTTA 4ATNA 4USMA 3DRSA 4PAAA 1HQEB 1KWMA 1RT7A 3M8WA 1X4FA 1VOMA 5H9FJ 1TFWA 2UZAA 3HP6A 1LW2A 1VBKA 5IQQA 2YKOA 3C6UA 1VRQC 1L3KA 1RADB 1BE4A 1RCOB 1D8YA 5I3PA 3BO4A 5J2NA 2XMMA 2LKZA 5SUHA 3UNGC 1SXLA 1J2VA 2I8EA 2X1BA 4WZMA 1URRA 4X4OA 3MOJB 1WC3A 1FJCA 4OHWA 1UW9A 2DH9A 2DIVA 4QWEA 3TEGA 2MKHA 2HFOA 1HWKA 3NAIA 4RW4A 3UCGA 4TYBA 4C2MA 2KM8B 2LQJA 3P8BB 1IKXA 1LXJA 1RWUA 3ZC4A 4UZBA 1XMQF 3D3CJ 4WKRA 2HGLA 4TLRA 2BRLA 5KG2A 4JI4J 3TQ1A 3FVYA 2XMUA 3RR7A 4K0KJ 4X4SA 4C0BA 4R0EA 3OXFA 4WP9A 1OYEA 1NCLA 3LAKA 1GTHA 1M5PC 2O66A 1S57A 4Q45A 1LWEB 3CNQP 2JEGA 3GJRB 3AD8C 2YH0A 3EE3A 2YH1A 3MM6A 3MECB 4KFBA 2V8GA 4D3GA 2ZHOA 2KG0A 2XZDB 2UXCJ 2AZ3A 1FA0A 4IFYA 2FTRA 3IRXA
chains in the Genus database with same CATH topology
2Y3YA 2NZCA 2CA9A 2PC6A 3OD2A 3BKUA 2WVDA 3BKFA 2F1FA 3PHTA 2WVBA 2BJ7A 2BJ9A 2FGCA 2HZAA 1Q5VA 2BJ3A 3LGHA 2WVFA 2BJ1A 2CAJA 3BKTA 2BJ8A 2WVEA 2HZVA 2WVCA 3QSIA 2CADA 1Q5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3Y A;  2NZC A;  2CA9 A;  2PC6 A;  3OD2 A;  3BKU A;  2WVD A;  3BKF A;  2F1F A;  3PHT A;  2WVB A;  2BJ7 A;  2BJ9 A;  2FGC A;  2HZA A;  1Q5V A;  2BJ3 A;  3LGH A;  2WVF A;  2BJ1 A;  2CAJ A;  3BKT A;  2BJ8 A;  2WVE A;  2HZV A;  2WVC A;  3QSI A;  2CAD A;  1Q5Y A; 
#chains in the Genus database with same CATH topology
 4DMZ A;  1BUX A;  1ZM4 A;  3KKF A;  4ES1 A;  3KXD A;  4DDF A;  1G7C B;  1GK8 A;  2F1F A;  3NOG A;  4PEO A;  1SH2 A;  1KFS A;  2KFN A;  5ETT A;  4NLT A;  3O2I A;  2GVD A;  3J81 j;  2JFK A;  3MPY A;  4OI1 A;  4C97 A;  3CCJ S;  4NZ6 A;  2B5J B;  2EW9 A;  4IH7 A;  2RHS B;  2FVP A;  3OL6 A;  4ED2 A;  3FMW A;  1T03 A;  3L95 X;  1DQA A;  2MYF A;  5D78 A;  4WK1 A;  2RU9 A;  2MJN A;  4OI2 A;  1F1B B;  4X4P A;  4C3M A;  2W4D A;  3OR1 B;  2PMH A;  1QE1 A;  3I96 A;  2P6S A;  1XMB A;  1FX2 A;  3VV2 B;  4Y65 A;  3GIR A;  1G3O A;  4PXB A;  1G2E A;  2VIH A;  3TW0 A;  5DQG A;  4PXD A;  3M7V A;  3MR5 A;  2IDE A;  5AE1 A;  1VC0 A;  4LF6 F;  2K3I A;  5IV3 A;  1CC7 A;  2RB7 A;  4F4Z A;  1QDU B;  4KT0 C;  1H98 A;  3NBP A;  1TTH B;  2AX0 A;  2V2Z A;  4UY8 T;  3EDR B;  1Q16 B;  4KRW A;  3D1H A;  1W2I A;  2AYG A;  5KG4 A;  3KYL A;  2HQI A;  2V34 A;  1DZ5 A;  2CZV C;  2YWE A;  3D6T B;  4MFB A;  1IR2 A;  1WEZ A;  2F9J A;  1Y9O A;  2RQ4 A;  1SVD A;  4LFB J;  3D2W A;  2XY5 A;  3A1Y G;  2Y0B B;  3VF0 B;  1E6Y A;  1VRT A;  2F65 A;  3NXZ A;  1P8G A;  1EAR A;  3CJR A;  3OD2 A;  1GMW D;  2MHE A;  4ZP6 A;  2VFS A;  1GTE A;  3TAQ A;  3D0G E;  1HWL A;  5HJY A;  2OPS A;  3CJ2 A;  3HKW A;  1IQT A;  2XWX A;  2ZBP A;  4AQY F;  4UOC A;  1VQY A;  3GJT B;  1GMV A;  3CCT A;  1Y10 A;  3HPO A;  1Y5I B;  3ZZY A;  5C42 B;  4LR8 A;  1H7W A;  3VGU A;  1YKW A;  4AND A;  1XC9 A;  2FZK B;  1RUS A;  3H42 A;  4ELV A;  2HIY A;  2AJQ A;  5GAD I;  3GR1 A;  1FRI A;  2E5G A;  1NJI T;  4UOH A;  1PCA A;  3CO0 P;  4A4J A;  3VGT A;  4AXI A;  1X4D A;  3OLA A;  1JLF A;  4B3M J;  2POK A;  5AJ3 J;  1HL6 A;  2HWI A;  3M6V A;  1S0V A;  2MKI A;  3EPG A;  5KFS A;  3DLK A;  2F5G A;  4F3Q A;  4A8X A;  4MK7 A;  2W8K A;  5L9N A;  1PIE A;  1PJ7 A;  1HQE A;  4LIW A;  5A0Y B;  5KG5 A;  2HRU A;  1WC1 A;  5C5J A;  1RWK B;  1LEO A;  1G6B A;  2MHN A;  2GHV C;  4ZVG A;  2MKS A;  3TWZ A;  4PG4 A;  2P2C B;  3HHD A;  1F2H A;  4IUF A;  2MQN A;  2GJI A;  2QLX A;  4DX7 A;  2XS2 A;  4X4R A;  4C3L A;  4DJB A;  2VF3 A;  3FUY A;  2XGQ A;  1FCA A;  1D1U A;  3SSR A;  5M2R A;  3SXL A;  2XTJ P;  2R2U A;  4XDC A;  2YKN B;  3BGR B;  5EN1 A;  3WBZ A;  1FXL A;  1GNK A;  1UJ5 A;  3HHL A;  3PFO A;  5ETM A;  4F4A A;  4JI4 F;  1U48 A;  3IGV A;  3OBI A;  5LJ5 Y;  3MCM A;  4B3S F;  4QYZ K;  2FQQ B;  4ECV A;  4K0K F;  1VQK S;  3T9Z A;  2GQ2 A;  2KFY A;  4ZPT R;  3OVB A;  2RUG A;  3SZ2 A;  2HWT A;  3JSB A;  2D74 B;  4EZ6 A;  2N82 B;  4LSN B;  1JKH B;  1SCJ B;  1KHW A;  1NPR A;  2VFR A;  4LT6 A;  1Q8L A;  2UXC F;  3M9O B;  2GIF A;  1LWE A;  2A6O A;  4DFJ A;  1DAX A;  4DR6 J;  3HMJ G;  3LOU A;  2JX2 A;  4Z37 A;  2MJU A;  2ZD1 A;  3MEC A;  1HHT P;  1CS4 B;  2ZC4 A;  4QIW D;  4QWD A;  2YX7 A;  1KS2 A;  3P6Y C;  2CZ9 A;  1NDC A;  4DV2 J;  4DL4 A;  3ZZP A;  5JMN A;  2XYH B;  4OYP A;  1U0H B;  2ASJ A;  3UNY A;  4ECU A;  1XBW A;  3AB2 B;  1HLW A;  2GAG C;  4Z7Y A;  4WU3 A;  3W7B A;  3QIP B;  4OZ1 A;  1ZBT A;  3W9J A;  3CJT A;  2DNM A;  4NXN J;  1O51 A;  2Y8Y A;  1RHQ B;  1R0C B;  2OJ3 A;  3DLB A;  3M2V A;  3MMC B;  2B5J A;  4AYB D;  1CJK B;  4N56 A;  2QA2 A;  5HLF B;  1TVR B;  2QLB B;  3R5C A;  4HKQ A;  3OR1 A;  3F56 A;  2AQ4 A;  4PYD A;  2O67 A;  4MKB A;  2DGT A;  4YB1 P;  3BR8 A;  1FDA A;  4LF5 J;  1SUQ B;  1M5V C;  3I87 A;  3L09 A;  2ASY A;  2DRB A;  2C3U A;  5IM0 B;  1HNV B;  5SZT A;  2UUT A;  4LFB F;  2DHG A;  1QSL A;  1VLY A;  2Y1L B;  2IDL A;  2WSC C;  4M5H A;  1GMU A;  4L3K A;  3NMA A;  5I4M A;  3W5X A;  1SJQ A;  3CWJ A;  2V0N A;  4ZHR B;  3NL0 A;  2HAF A;  3HFK A;  3DHW C;  1RT5 B;  4C8L A;  4DFP A;  4UQG A;  2DNO A;  4OL8 A;  1TKT B;  3R2C J;  1LW0 B;  5GMK a;  1Q78 A;  4P73 A;  1RAO A;  2BZ2 A;  3VVU A;  1HBM B;  2ZZM A;  2BVZ A;  5A76 A;  4ZCL A;  4CLZ A;  2W2Q P;  2V2Q A;  3I9Z A;  1FFS B;  3HHL C;  4ZVS B;  1ITP A;  3BGL A;  3K5L A;  5C42 A;  2R2T A;  1L3V A;  4QBU A;  2C28 A;  3THT A;  3HHE A;  2QA4 S;  1RTZ A;  2HBZ B;  3IC1 A;  3IWL A;  1NO8 A;  3S01 A;  3K17 A;  2YX1 A;  2LXI A;  2W24 A;  4F36 A;  5GVQ A;  3NKY A;  3CCE S;  3QMQ A;  1PYS B;  3KG4 A;  1U4B A;  1IQZ A;  2Q1L A;  2DK2 A;  4MMO A;  1EZZ B;  1VQ6 S;  5K5M A;  2PMW A;  4OYM A;  1LV5 A;  3PM9 A;  4OX7 A;  2HGN A;  1W26 A;  1PO6 A;  5CH7 B;  1D9A A;  3TZZ A;  4UT4 A;  2B9Y A;  4H4K A;  2CPD A;  4UUW A;  5A0Y A;  4K4W A;  1RCX B;  5J1E B;  4YDD B;  2VC1 A;  2JRS A;  2R2S A;  1YIT S;  2ALY B;  4DX8 H;  3MUM P;  4OZ2 A;  4P71 A;  1WOP A;  3SI8 A;  2CQB A;  3BJY A;  2MKY A;  2YKN A;  3BGR A;  2LXU A;  4CO3 A;  3RB6 A;  1VQP S;  1YZ6 A;  2LCW A;  3CGI A;  3ILI A;  3RW6 A;  2JVR A;  2Y9H A;  2KG1 A;  3NGR A;  4Y34 A;  2IM0 A;  1BXN A;  4QIE A;  3EPI A;  1QAY A;  2JEF A;  4OFZ A;  2PD1 A;  3CJ5 A;  4HH0 A;  3EX7 B;  4ED1 A;  2JDJ A;  3PW2 A;  1VR6 A;  3KJQ B;  3Q86 A;  4L75 A;  1RT4 B;  4LBP A;  2X1G A;  1UEV A;  4F4X A;  1T05 B;  2HFZ A;  1X0F A;  4DR6 F;  2CQ3 A;  1JKH A;  3IS9 B;  2DR6 A;  4W92 B;  2HW3 A;  4DR2 J;  3OTC A;  3QT6 A;  3DN9 A;  4URS A;  5J1N A;  2VQE J;  4DV2 F;  1N5Q A;  2R4F A;  1EKR A;  4EZ9 A;  3RUB L;  3GYX B;  3Q22 A;  4U7U K;  2H9Z A;  5L1I A;  1ZAV A;  1CS4 A;  1KVK A;  2HKE A;  1H3D A;  4O23 A;  2WB1 D;  5D15 A;  2XSJ B;  4Y2I A;  4NXN F;  1RXO B;  2QMW A;  2BEF A;  1CJV B;  2DEI A;  1U0H A;  1DLO B;  1S4E A;  2ILY A;  2CRL A;  4PWW A;  5I3U B;  4DU7 A;  4S0M A;  4MKV A;  1JIH A;  4DXL A;  4CO5 A;  3QIP A;  4PPZ A;  4CWB A;  4ZCM A;  3PX0 A;  4B9U A;  2XUL A;  2H4Y B;  1TUW A;  2E9Z A;  4LIR A;  1S12 A;  2QIF A;  1CJK A;  1Q8I A;  4LF5 F;  3ETO A;  3BBB A;  4LF2 A;  5HLF A;  1W7W A;  2QT7 A;  1TVR A;  5ETQ A;  3KJN B;  1Y3K A;  3M8S A;  2GMJ A;  4J9R A;  3KJV B;  2ZOF A;  2AV5 A;  4FF2 A;  1U0S A;  5F0W A;  4WII A;  4ZJL A;  4H54 A;  1SUQ A;  4ZPD A;  2AGQ A;  2KKH A;  1UET A;  1LQ9 A;  1HNV A;  3US5 A;  1FNX H;  2QL7 B;  2DKO B;  4EBD A;  4H4K C;  1WOS A;  1F9F A;  4QWC A;  3G6V A;  4ZHR A;  3DLE B;  3BGF A;  2XMK A;  1TL7 A;  5KFD A;  3MM5 B;  1VQS A;  3IG1 B;  2AKW B;  3B78 A;  1NHU A;  1TKT A;  1UW4 A;  2RKI B;  2GFF A;  4IQM A;  4KYZ A;  1LW0 A;  1NEE A;  4DQP A;  4B17 A;  2OFG X;  1SJ4 P;  3CT9 A;  1HBM A;  1RIS A;  3UW1 A;  3OW2 R;  1N32 J;  2WHO A;  3ISN C;  5GAH U;  2X51 A;  3CUN A;  4IRK A;  2G2Z A;  3NS5 A;  1M5O C;  4MK8 A;  5KFI A;  3I55 S;  2V9W A;  4RBV A;  3DDN A;  2EFV A;  2E5J A;  2B9W A;  1N4L A;  1PYO B;  3MUT P;  2R8H A;  5DGA A;  2WVE A;  2FVR A;  2BR0 A;  5KFT A;  2R9L A;  5CYQ B;  1GFW B;  2PEB A;  3Q24 A;  3KHR A;  3I0S B;  4WZQ A;  3GJQ B;  2IFX A;  2E1P A;  2BKO A;  3V81 B;  3GV8 B;  5J2Q B;  2ZZN A;  3W2W B;  5E41 A;  3CCL S;  1S1V B;  3M6X A;  3MD3 A;  1P1L A;  1RLD A;  1F3V A;  3GE9 A;  3H59 A;  1PYT A;  5KT3 A;  2ZBQ A;  1FRM A;  2YNF B;  2PII A;  2XWY A;  3VAF A;  1OJ4 A;  3KFW X;  3FCV A;  1U24 A;  3AOA A;  3G96 A;  5F8N A;  5J1E A;  3GCX P;  2BE9 B;  1JMT A;  1C4A A;  1LWF B;  4B9N A;  4HHU A;  5HMY A;  4P2M A;  2QRR A;  3BV8 A;  4HI1 A;  2BAC A;  4QW9 A;  2ATL A;  4L73 A;  4F8R A;  3V4M A;  5LOQ A;  3UCZ P;  2OLW A;  2D9P A;  1B0P A;  3W2V B;  2CPI A;  3QAT A;  3KUG A;  3V6D B;  2FGO A;  4LR9 A;  3K59 A;  1NSA A;  4P75 A;  5B0B A;  3C3L A;  2RD5 C;  2KTQ A;  2XZW A;  4IKA A;  4DLG A;  3FBF A;  4EYH B;  4DR5 J;  4ED3 A;  2HZC A;  2XLK A;  2DNP A;  1Y11 A;  3ADA C;  2CFX A;  2OAU A;  2VQE F;  1KDN A;  1TL3 B;  2G0C A;  1FRX A;  4TVA B;  3FBB A;  4NZ7 A;  2X3G A;  1T05 A;  1L5U A;  2JZ5 A;  1WHY A;  2CPZ A;  4D3H A;  3SEO A;  4LQ9 A;  3IS9 A;  5BJR A;  1L3T A;  1ZM9 A;  3V5R A;  3PRB A;  3AD9 C;  1VQL S;  2RU3 A;  3F73 A;  4I6A A;  4K4S A;  2DGQ A;  2LXF A;  2DIS A;  3QAE A;  5KT5 A;  6AT1 B;  3G6E S;  3MD1 A;  4TYA A;  2LEP A;  2OEJ A;  4PG7 A;  4C3K A;  2MQQ A;  5IT0 A;  3TQE A;  3CDA A;  5LL6 d;  1S5Z A;  4WBF A;  1MNE A;  2DXD A;  2Z2M A;  1CJV A;  1V5I B;  3EGZ A;  4ERD A;  1YGY A;  1DLO A;  4JI7 J;  3IN5 A;  4KGK A;  3HD1 A;  3BF4 A;  1JJC B;  4OLO A;  2WVC A;  4EFA C;  1WC6 A;  2BRK A;  3PW0 A;  4ECR A;  2QGF B;  2IYG A;  2VBZ A;  5LMN J;  1BC6 A;  4OHX A;  5HVG A;  2ZBI A;  3ULH A;  3CJ4 A;  3D6F B;  2APO A;  3Q2S C;  4DFM A;  4JYA J;  1FNO A;  1T95 A;  2MZJ A;  1JJH A;  1UFK A;  3KJV A;  3VGV A;  4OYA A;  4ZVQ B;  2D7S A;  2IMO A;  4DPT A;  1RI7 A;  2J9D E;  4AFF A;  4J9L A;  2PDA A;  4YUD A;  4IDK B;  5K8P A;  4GKK J;  2JEJ A;  1R0A B;  5DET A;  5JXS A;  2X3D A;  4PR6 A;  5KTQ A;  5A8K B;  5D6G A;  2KT2 A;  1HQU B;  2JJ4 D;  2L48 A;  1XN9 A;  1UEU A;  2CG4 A;  1TK0 A;  3FDS A;  4FYD A;  4FZV A;  2C2K B;  4AL6 A;  2C2N A;  4DFK A;  2AJ1 A;  2B7C B;  1WKL A;  1HNZ J;  3WX4 A;  4A8W A;  2W1B A;  1NXI A;  3DLE A;  3HFV A;  3NGT A;  3MM5 A;  6FDR A;  3LWM A;  1U6F A;  3IG1 A;  3CDE A;  3OHA A;  2F63 A;  1WF0 A;  2R2R A;  5DDQ C;  1OQ6 A;  3W5Z A;  4TN2 A;  2ZDO A;  2FHO B;  3O1L A;  4ZVF A;  3W9H A;  1IJF B;  3HDS A;  4DI6 A;  3H4D A;  2H51 B;  2HMI B;  1FDD A;  3FRZ A;  1FFG B;  5F8J A;  3MTK A;  2P9C A;  4LQ3 A;  4FBU A;  1HBO B;  5DS7 A;  4OZ3 A;  3CCZ A;  3BYP A;  1VBX A;  3RBZ A;  3NP5 A;  4RU2 A;  1BQX A;  1C0T B;  2Q66 A;  4C8O A;  4ILL A;  1IBM J;  4CRJ A;  5CYQ A;  3I0S A;  4G1Q A;  1ICE B;  1IM6 A;  3V81 A;  3W2W A;  3DLJ A;  3G87 A;  1FEH A;  4PUO B;  4I2P B;  3CJK B;  1S1V A;  5D3G B;  4CQ1 A;  2EFN A;  4KHR A;  1NHV A;  3RJM B;  2AD9 A;  4TY8 B;  4RNN A;  2YNF A;  2UP1 A;  4RNH A;  2DR5 A;  1TFY A;  2BX6 A;  4NLP A;  3EZO A;  2W9C B;  4Q8E A;  2HVH A;  5KFW A;  5KFC A;  1N54 B;  3SSQ A;  3ZO7 A;  1GT8 A;  3EM1 A;  1NB7 A;  5GAD U;  2YWF A;  1LWF A;  3RTV A;  2ZH1 A;  2RH3 A;  4NCB A;  3W1Y C;  4F0K A;  2VQF J;  3BS9 A;  2LLZ A;  3IGN A;  3JQM A;  3BM7 A;  3LUY A;  1S1X B;  3GPA A;  4DR5 F;  2D1C A;  3D6M B;  3V6H A;  3W2V A;  2DRA A;  3W61 A;  3V6D A;  1J27 A;  3ZZU A;  1LOU A;  1EHW A;  2WVF A;  2FHK A;  1JLQ A;  1P27 B;  2HS3 A;  4WTO B;  1RHR B;  4PQU B;  4GO7 X;  1IUJ A;  1YBA A;  2AIR B;  1TL3 A;  3TJA A;  4YB6 A;  4RL1 A;  1NDL A;  4L3N A;  3KWM A;  1TUV A;  1R8A A;  5HAO A;  3J7Z T;  2FC9 A;  1AXQ A;  2NSC A;  4DSE A;  3MAH A;  3ILJ A;  5A2Q Y;  3A13 A;  3OTO J;  4HLB A;  4JI7 F;  2HAI A;  3BQ2 A;  2ROP A;  4MIA A;  2CNK B;  2JH3 A;  2RS2 A;  1MN9 A;  1SI9 A;  4UOG A;  5DG9 A;  4KC5 A;  4C8N A;  3MM7 A;  4MYT A;  2YVS A;  4Y6I A;  5LMN F;  2MDA A;  5CYM B;  4ED0 A;  1TAQ A;  5KAK A;  2DNH A;  5HVH A;  5KFO A;  3U1L A;  4JYA F;  2UUW A;  2IYI A;  1MWZ A;  4ZJQ A;  2J7U A;  2IVF B;  1VQN S;  4RZR A;  4ECQ A;  3POT B;  2H1Y A;  4GKK F;  4FF4 A;  4NRT A;  1K8A T;  2CDR B;  1BQN B;  4I64 A;  1TMM A;  3GWC A;  4IR9 A;  2RQK A;  2HVZ A;  2F8H A;  1SC1 B;  2CIM A;  2VA3 A;  1QVF R;  2HFN A;  1IWG A;  1R0A A;  3C2P A;  1FO1 A;  2QE5 A;  1LWC B;  1I5O B;  2ROE A;  1HNZ F;  3DYA B;  4KSE B;  2AEM A;  5JUM A;  1HQU A;  2PN6 A;  2Z0G A;  2JVO A;  1VBY A;  1HW8 A;  1U1L A;  4A8Q A;  3HJF A;  4CLY A;  2DT9 A;  4WFZ A;  1NJY A;  3MZI A;  1UL3 A;  1UFW A;  1D09 B;  1V3S A;  2IY5 B;  4DL0 C;  4ID5 B;  2JSX A;  3BN4 A;  4ZLL A;  2BJ8 A;  4DQR A;  2GQQ A;  2M7S A;  1R43 A;  1IKY B;  3PYE A;  2B9X A;  2V2V A;  2OP5 A;  1ROF A;  5CCM A;  4E0D A;  1EB0 A;  2YXL A;  2XG8 A;  3C6T B;  4W4M A;  1JK9 B;  2G9O A;  2HMI A;  3PR5 B;  1IBM F;  4XK8 C;  1IVZ A;  3H8Y A;  3RAM A;  1KVJ A;  3HSD A;  1HBO A;  2ZHA A;  1RWW B;  4F4Y A;  2XLI A;  2DYA A;  1D9D A;  2KXF A;  1R0B G;  2AYM A;  1C0T A;  3JS9 A;  2CJA A;  2CYY A;  1V9O A;  2YNH B;  4YN3 B;  3GIJ A;  4CH1 A;  1FRK A;  3X1L B;  3PO5 A;  4I2P A;  4PUO A;  2O1P A;  3CJK A;  1VJW A;  2HQD A;  4QIF A;  5J1P A;  5D3G A;  5IC4 B;  2WOM B;  4ZP9 A;  2OD4 A;  2M88 A;  3A8I A;  2CUY A;  4TY8 A;  4CLT A;  3KHH A;  2FHM A;  5A6W A;  5J2P B;  1XEZ A;  1H2U X;  2VQF F;  2W9C A;  1YBT A;  2ZWP A;  3JXO A;  4DPY A;  4YR0 A;  1FRJ A;  2CQP A;  1H72 C;  5KT7 A;  4B9M A;  2DO0 A;  2HQG A;  3GV5 B;  2EXU A;  1N36 F;  3PFE A;  1T02 A;  3ZTR A;  2RQM A;  4DSI A;  4AL7 A;  2QSW A;  5DLF A;  4M95 A;  2AEF A;  3KDO A;  3SDE B;  4KQZ A;  1KLM B;  3BKT A;  3NGK A;  1S1X A;  2RML A;  1NH7 A;  4R8U B;  5IWA J;  2B4P A;  2G0I A;  3AB4 B;  2FYX A;  2XYG B;  3TAN A;  2W9B B;  3NEK A;  1BHN A;  2R7R A;  1KQS R;  3MMA B;  2CQG A;  2IJF A;  4U7C A;  2XHC A;  2E7W A;  2ZHB A;  2ZOG A;  4ED6 A;  1CQM A;  4PQU A;  2JL9 A;  1I1G A;  3C15 B;  4JBC A;  4EBE A;  3GIK A;  1X9S A;  2HFU A;  1S49 A;  1L3S A;  2L9D A;  3N9U C;  2GQC A;  3OTO F;  3TI0 A;  3OTB A;  3QGI A;  3MCS A;  2C42 A;  3MGJ A;  4CNY A;  1GX5 A;  2WON B;  1R89 A;  1WD6 A;  2P5V A;  4K4U A;  4P10 A;  2ZE2 B;  3K5N A;  1L3U A;  1CBK A;  2C3M A;  2AWZ A;  5IOL A;  3ZZZ A;  1H73 A;  4Q2L A;  1KQF B;  1Q8K A;  2DHA A;  4NPO A;  5CD4 H;  1FKO B;  2V94 A;  2W8L A;  2U2F A;  2MST A;  2DGV A;  1RAE B;  1DTQ B;  1HNW J;  3M8P B;  1TL4 A;  1TAU A;  3ILO A;  2YX4 A;  2ZH4 A;  5CYM A;  2QV6 A;  3TA0 A;  3D1Q A;  4OMF G;  4F2R A;  5F8I A;  2DGX A;  4AL5 A;  1ACM B;  4FXW A;  3HSZ A;  1GMW A;  2Y1R I;  3POT A;  4Y2A A;  1VIO A;  2ZUA A;  3TUP A;  4GKJ J;  3KHL A;  1BQN A;  1O6X A;  3OHB A;  3O5T B;  3KMS A;  4FKY A;  1VDH A;  3E8O A;  3HF5 A;  4WWS A;  3DRR B;  4ITS A;  4TNO A;  1IBL J;  4DL5 A;  3OUY B;  4CIO A;  1RKJ A;  3ZZR A;  2M8D B;  3SQG B;  3MCN A;  4Y28 C;  2HZV A;  5KG0 A;  1RJJ A;  4ZIW A;  1S6O A;  2WCX A;  3DYA A;  2UXD J;  3H40 A;  1QUV A;  3D54 A;  2MZT A;  5DG8 A;  1HW9 A;  2RRB A;  4DS4 A;  3JTP A;  2GO8 A;  2EI5 A;  3C16 B;  5EWG A;  2KYX A;  2DPI A;  3G6Y A;  1QSS A;  2QSF A;  2NSB A;  4DWI A;  1QVG R;  3N5F A;  4ID5 A;  3M32 B;  1JB0 C;  4X4T A;  2JC1 A;  4CZC A;  3DC2 A;  1O8B A;  3EZU A;  1IKY A;  4ZK7 M;  2KVQ E;  1FRH A;  1QAX A;  3C6T A;  1U45 A;  1VQO S;  3D66 A;  1NK6 A;  1Y7P A;  4O3S A;  2W7P A;  2WSE C;  4OZL A;  3H25 A;  1NRK A;  5B0C A;  3DCA A;  4UST A;  2FJB B;  4NA2 A;  2V9K A;  2MQ8 A;  4G1P A;  5E2Q A;  1F5C A;  3LP2 B;  1WC0 A;  1K44 A;  2QJ3 A;  2OEK A;  1U09 A;  2G4B A;  2YNH A;  3GG0 A;  1RWM B;  1UPP A;  1CC8 A;  4CM0 A;  4EWT A;  3HT3 A;  4B3O B;  4WFA Q;  1G1X A;  4F4W A;  5CAA A;  5FDL B;  3ZZT A;  1FI4 A;  3RRG A;  2WOM A;  4ANC A;  3Q8R B;  1S9E B;  3J81 Y;  1F3F A;  2AJ0 A;  2H5E A;  5B0A A;  2OIH A;  5J2P A;  1RQ0 A;  4LRE A;  3Q23 A;  3T1H J;  2M0G B;  1EKS A;  3PXG a;  1QUP A;  3Q8V A;  5IWA F;  1Z2Z A;  3E2E A;  2AGO A;  1S0O A;  1C1C B;  1I3O B;  3N6M A;  2F3J A;  1BQM B;  3AJD A;  1X4A A;  2IBK A;  2UUA J;  1SH0 A;  2BJ3 A;  3CCW A;  3SDE A;  2CQ0 A;  5K9F A;  1KLM A;  3WIV A;  2XM3 A;  4R8U A;  2UU9 J;  4QR2 A;  3V4I B;  4JV2 A;  4YP3 A;  2EC2 A;  5L1K A;  2OH2 A;  1OSD A;  3MR3 A;  5CXT A;  2W9B A;  2NXE A;  4NLW A;  3PO4 A;  1EAY C;  4GC6 A;  2NYH A;  2B3T B;  1FJG F;  3OV7 A;  3MMA A;  5IZH A;  1YQH A;  1RA6 A;  2JEI A;  4WK3 A;  5F8G A;  4MT1 A;  2GJ2 A;  5E3P A;  4DUZ J;  5A8W B;  4Y2K A;  3SFU A;  3C15 A;  3ITH A;  2IVY A;  4DQS A;  2DGO A;  4DQI A;  3MUV P;  3JTO A;  1FJE B;  2AU0 A;  2F4V J;  1NJZ A;  3RBE A;  3R97 A;  4Y0F A;  3JTN A;  4AXJ A;  3MPU B;  2HHW A;  2ZFH A;  4JI5 F;  4A46 A;  3PRV A;  4DF8 A;  1U02 A;  4PG6 A;  4HHH A;  3OFE A;  3GQC A;  2WON A;  4Q2M A;  1HNW F;  1TK8 A;  1UJ6 A;  2ZE2 A;  2Z57 B;  2DH8 A;  1LXN A;  4C9D A;  3HVW A;  1R31 A;  3PNI A;  3GIM A;  1KBR A;  1VFJ A;  2HHQ A;  4RKU C;  3QYY A;  1FKO A;  4C4W A;  2FJD B;  4YY3 F;  2RDI A;  1DTQ A;  3R7N B;  2GNK A;  3M8P A;  2Z2L A;  3N5B A;  2CJK A;  3IP0 A;  1YJR A;  5KG1 A;  1AA1 B;  4O3R A;  2FLO A;  1U6Z A;  5EWE A;  1MRO B;  1YDL A;  3T3F A;  3TA1 A;  3OVA A;  2VPW B;  3VR1 A;  2FJW A;  4GKJ F;  3L3C A;  1TZ0 A;  4QW8 A;  4IQX A;  4DLE A;  3Q83 A;  1KRP A;  2DTJ A;  1H2T Z;  4DQQ A;  1IBL F;  1WTB A;  4KH1 B;  3CDW A;  3TO8 A;  2DJW A;  4PQA A;  2EG1 A;  3I31 A;  2GIQ A;  1P9Q C;  2D9O A;  3VHQ A;  4NEZ A;  4OZJ A;  2R7O A;  2DD8 S;  3QLH B;  1HAR A;  2PO4 A;  1ZZF A;  2UXD F;  4KIA A;  3DRR A;  5D0H A;  2QL9 B;  3DHX A;  4FDF A;  2J5A A;  3OUY A;  3SQG A;  1EIY B;  4FS2 A;  4OV1 A;  1YZ7 A;  3QSY B;  3AJ2 A;  2ZH9 A;  2YNG B;  3NWR A;  4OZ5 A;  1YK9 A;  2AJ4 A;  1KOO A;  3DRS B;  2MQO A;  1ZZN A;  5JVG Q;  1OO0 B;  3Q2T C;  3R6L B;  4AD6 A;  2V68 A;  1UZH A;  3CD7 A;  4P7T A;  4NLY A;  4HT5 A;  1SKU B;  3C16 A;  4GVB B;  2RIJ A;  4WFN Q;  3C6U B;  1FTR A;  1YJN S;  4CNZ A;  1JLG B;  4KV8 B;  4ELT A;  3FSX A;  3MPD A;  3M32 A;  3KUE A;  3EYZ A;  3LWL A;  5I42 B;  2Y1J A;  4P72 A;  3LP1 B;  4Y2C A;  4ZVO B;  2QA4 G;  2COL A;  2DNG A;  4QIV A;  3G8T A;  1S79 A;  3JSR A;  3L7O A;  3FQK A;  3JQJ A;  2GO9 A;  1S76 D;  4ZA1 A;  1R8P A;  2H54 B;  2K7J A;  3AQP A;  4QYZ J;  2WB4 A;  2J6U A;  1FJ7 A;  1JX4 A;  5GAG U;  3NGU A;  3OXG A;  4G3I A;  3LP2 A;  4FBT A;  3CCR S;  1ZA2 B;  2OML A;  1LFP A;  5ETV A;  1OYD A;  2DO4 A;  2VG5 B;  1NU4 A;  4B3O A;  3MR2 A;  5CHC B;  1HBU B;  5FDL A;  3T1H F;  4URQ U;  3TZW A;  1WOO A;  4DV0 J;  3QT5 A;  3VAJ A;  4OZ0 A;  2PFD A;  1ZAW A;  4USK A;  5B0F A;  4BS2 A;  1VK3 A;  2N4D A;  1XJW B;  3CCS S;  1RE1 B;  3OT9 A;  4KGM A;  3TAM B;  3I5A A;  5L9X A;  2VON A;  1X4E A;  2MLY A;  1SQE A;  1MN7 A;  4O4G B;  2UUA F;  3LP0 B;  4CT8 A;  2M70 A;  2CKW A;  3UDL A;  1HWU A;  2NUU G;  1FDB A;  3CD0 A;  3IRX B;  3IR6 B;  3ONQ A;  2AGP A;  1DFD A;  1C1C A;  1X0P A;  3QRQ A;  3VAG A;  3EMT A;  1BQM A;  4ZCI A;  2CJY B;  5HRO B;  1I94 J;  2AHO B;  3CIM A;  1HBN B;  1YTY A;  4DV3 J;  1KFD A;  1Q79 A;  3V4I A;  4DSJ A;  1FK9 B;  2ACY A;  3K8V A;  3UE2 A;  4DPW A;  4WFY A;  2J8A A;  4BLG A;  2C2M B;  4DUZ F;  2LP4 A;  1U2F A;  4DEZ A;  1FD8 A;  3ENW A;  1Q0N A;  1TMJ A;  2VG6 A;  2F4V F;  2I6W A;  5KG7 A;  3Q8U A;  1MMD A;  3H98 A;  3I6P A;  5AE3 A;  3VGS A;  4OIX A;  3MUR P;  3UQS A;  1VQ9 S;  4K8R A;  2GJF A;  1NZ8 A;  3THP A;  1T11 A;  2RT3 A;  2P9E A;  2HVD A;  2XNQ A;  3PV8 A;  1RHM B;  1NKB A;  2I9S A;  8ATC B;  4B3R J;  2PA3 A;  3KK1 B;  1X4C A;  4U7U D;  3QZ7 A;  2EWH A;  4ZP8 A;  1UWB B;  1MW7 A;  5GAH I;  1KNZ A;  4PRF A;  1RT3 B;  4MIB A;  5D4N A;  4KHM A;  2FLP A;  3TP2 A;  2FJE B;  3I56 S;  2HFS A;  2QO3 A;  3S1T A;  4YFU A;  1S0N A;  3BSA A;  3NMR A;  2ZNY A;  2CQ2 A;  3V6K A;  1VRT B;  5J2M B;  2DR9 A;  1MWQ A;  1WHX A;  2UVV A;  2B8P A;  1ZM3 A;  2ZM6 J;  3QJL A;  5HAN A;  1MRO A;  3W65 A;  3CCV S;  1K73 T;  4HR2 A;  3J7Y I;  2ADB A;  3N6L A;  1KKH A;  4LUB A;  1UKU A;  1FES A;  4I6W A;  1UZD A;  1SL2 A;  2NXJ A;  3CCU S;  5DO2 A;  5B0D A;  1X5P A;  3DLH A;  1TL5 A;  3A3N B;  1XER A;  2RF2 B;  3QLH A;  5CCL A;  3HSG A;  1JWW A;  3QRP A;  3W5Y A;  4WF9 Q;  2OHD A;  5HMW A;  2DRD A;  2HFV A;  3N79 A;  2ZDP A;  2UUC J;  2VOD A;  5K8O A;  3DLK B;  2XO6 A;  5DGB A;  2YNG A;  1Y5L B;  4EGL A;  1NB2 A;  4FS1 A;  1NK8 A;  1WNE A;  2HHU A;  4UF4 A;  2E1A A;  1PBA A;  3NGS A;  4Z2X A;  1AFI A;  3VQS A;  2HS0 A;  1VQ5 S;  4GVB A;  1V5V A;  2OMO A;  1N5Y B;  2JC0 A;  3HKZ D;  2O01 C;  4H4O B;  4DV7 J;  1JLG A;  1Q5V A;  4FPI A;  4KV8 A;  2XGP A;  2H5J B;  3T6B A;  4O44 B;  2XYP B;  4DX6 A;  3K2Y A;  3NS6 A;  2VHG A;  5I42 A;  3HHL B;  4QYR A;  3T5H A;  2BBE A;  3LP1 A;  4F02 A;  4OI4 A;  2Q3P A;  4RBT A;  5B09 A;  2QFI A;  4NAS A;  3B54 A;  4OI3 A;  2DNL A;  2C2D A;  2V4R A;  4ECX A;  4KGX B;  1AYE A;  4DV0 F;  3MEE B;  1WHW A;  1SKR A;  3UDC A;  5DZ7 A;  2LU2 A;  5T14 A;  1QSY A;  2CWK A;  4K4Z A;  4WFB Q;  2BW2 A;  3CB4 A;  2XZT B;  3BQ1 A;  4ECT A;  4JI2 J;  2VBW A;  2VG5 A;  4B3S J;  5MLC V;  1HBU A;  2IPO B;  3WX8 A;  3T1A A;  1RAC B;  4RU9 A;  3LA0 A;  5CYJ A;  5IQ6 A;  2FLL A;  3I4P A;  2DY9 A;  2MKJ A;  2Z58 B;  1SPB P;  3R7B B;  2GGP B;  3TAM A;  2E7X A;  4DZD A;  5IFM A;  2OKQ A;  1T7P A;  4OYZ A;  2ZD1 B;  4O4G A;  2XY7 A;  3LP0 A;  1I94 F;  4ZJO A;  1FXR A;  1VC5 A;  2HVE A;  2P8I A;  4DV3 F;  2AMC B;  4NYP A;  3HO1 A;  3F44 A;  4OZN A;  5D0G A;  3PVX A;  2YBV A;  3T19 A;  1FNM A;  5HRO A;  1YJV A;  4ZIV A;  2H4W B;  1SC3 B;  1HBN A;  3BR9 A;  2EPI A;  5A2Q U;  4JP8 A;  4PXE A;  1IKV B;  4B08 A;  3NCR A;  1FK9 A;  2B4O A;  1FVQ A;  4RR5 A;  3M2V B;  3A4T A;  2YQ3 A;  4K2J A;  4W98 A;  4YEA A;  2MZQ A;  2ZBR A;  2QFJ A;  1K0V A;  1M5H A;  1EX8 A;  2BUN A;  4NEY A;  1RU1 A;  2RS8 A;  3VCD A;  3K89 A;  1Y00 A;  4B3R F;  1NSK L;  1RT2 B;  4JUZ A;  3OL7 A;  1VQ8 S;  1EET B;  4QU6 A;  3M6U A;  3NAH A;  4Q7A A;  3T1Y F;  1H0H B;  1NPP A;  1YJU A;  1S59 A;  1VLO A;  4KAI A;  2Q43 A;  3A8E A;  3D4J A;  3F0N A;  4TU8 A;  3J7A N;  3OQ2 A;  3KK1 A;  5D0E A;  3DU5 A;  3DOK A;  5CZX A;  3M8Q B;  5LMU J;  1UWB A;  4HT7 A;  1SJR A;  1RT3 A;  3HZG A;  2UXB J;  2B51 A;  1AB8 A;  3EVO A;  4DN9 A;  3GFZ A;  3B8H A;  2IC3 B;  2ZM6 F;  3V6J A;  2E1M C;  4CLF A;  5F41 A;  1U1N A;  3BH6 B;  5J2M A;  1V3R A;  3CC2 S;  4F4K A;  4ZVT B;  1TKZ B;  1U7L A;  3A3P B;  3WHI A;  2ZH3 A;  4QR0 A;  4OX8 A;  2AF6 A;  2NPF A;  3HXM A;  2D41 A;  2KU7 A;  3FBC A;  3R8Y A;  1DQ8 A;  3CDB A;  2W7A A;  4YB7 A;  3KJF B;  4RW8 B;  1B7Y B;  3CDU A;  3CSK A;  5F9L A;  2C2Z B;  1E6V B;  1ULR A;  3PHT A;  3O8W A;  2Z8Q A;  4QU7 A;  4FNH A;  1AZS B;  2UUC F;  3TX8 A;  5B0G A;  2VG7 B;  2RF2 A;  2E5I A;  4J7C A;  2NXC A;  3CUL A;  1VCT A;  5HMZ A;  4HHJ A;  2B7B B;  2IRX A;  4P74 A;  3M05 A;  4X66 J;  5KT4 A;  1VGY A;  3MAQ A;  1J5E J;  2RNE A;  4MKA A;  4O0I A;  4DV7 F;  8AT1 B;  1OWX A;  1P6T A;  1DRZ A;  2RIL A;  4KY3 A;  3KLG B;  4ER8 A;  5EHH A;  2J9C A;  1UTA A;  1N5Y A;  4K5R A;  4RUC A;  4H4O A;  4R5P B;  2NCK L;  1NK9 A;  3FEZ A;  3EXC X;  2KZM A;  3X3U A;  4ES3 A;  3B4M A;  3SV4 A;  3D9B A;  5E3R A;  4O44 A;  4CI0 B;  3H7H B;  2X1A A;  2ADC A;  1NK5 A;  3GB0 A;  1N48 A;  3QID A;  3RZA A;  5BYR A;  3H4B A;  4MH8 A;  4JI2 F;  3H20 A;  5EX3 A;  1WG4 A;  4R0J A;  3Q0A A;  4Q43 A;  2EK1 A;  2V4Q A;  2KHD A;  3AFG A;  2MY8 A;  2K2P A;  4LF9 J;  2VPX B;  2F7V A;  2V8H A;  1B4S A;  1JLB B;  3MEE A;  3HM9 A;  2WK4 A;  1ZS6 A;  4DX5 A;  4NCA A;  2VB6 A;  3TA2 A;  3CJ3 A;  1DJ0 A;  4E2F B;  3D6H B;  4DV5 J;  4NWB A;  3SBM A;  2J7W A;  2BOA A;  2MMY A;  2YKA A;  4RW7 B;  2ZH2 A;  5I3Q A;  2NZ4 A;  2GGP A;  5AT1 B;  3TUI C;  3J7Z 5;  2KT5 A;  1N88 A;  3JYT B;  4M5G A;  1CJU A;  2CJ9 A;  4NMX A;  3BRE A;  4IH6 A;  3S7R A;  3TNV A;  4FVC A;  1B0V A;  4MIW A;  5FLX Y;  2BDP A;  4NCG B;  3K5O A;  2N3L A;  1NUE A;  4IOB A;  4JV5 F;  3DOM B;  1GH8 A;  1FTC A;  1IKV A;  2KB2 A;  2K06 A;  4IG3 B;  2B6A B;  1N6Q B;  1M1H A;  5HJX A;  2WVD A;  1AUS L;  1UWA A;  3OPK A;  4ED4 A;  1VBZ A;  3FJ2 A;  4I0W A;  4LF8 J;  4J9O A;  3OTD A;  1N52 B;  3SCI E;  4NZ0 A;  3EIC A;  3PEJ A;  1B64 A;  2PFF B;  1RT2 A;  3DMJ B;  5LSO A;  5LMU F;  1U2C A;  1EET A;  5KG6 A;  2HYI B;  2UXB F;  2H65 B;  3GCW P;  5JJB A;  4ZLN A;  2DCL A;  3G71 S;  2CJQ A;  3PIO Q;  3L7U A;  2IM1 A;  2JWN A;  2KFZ A;  3QPI A;  3VQT A;  4F0H A;  4J9S A;  3M8Q A;  4I56 A;  2BE7 D;  6FD1 A;  1UCN A;  2XHW A;  1QAJ A;  5KOX A;  5HQL A;  2K1R B;  5HSP A;  2IC3 A;  1Y4Z B;  4ZPV R;  1TL7 B;  4M5K A;  2J0S D;  2Q79 A;  1KTV A;  1WG5 A;  3PG9 A;  4BWJ A;  3G6X A;  1VJQ A;  1RYR A;  2HNZ B;  5HO4 A;  1TKZ A;  3FCH A;  4KTQ A;  4M8L A;  1RLC L;  3GFY A;  3H0P A;  4QZV B;  3GII A;  4DR4 J;  2GC8 A;  1I6J A;  3I5B A;  1UVJ A;  1QTN B;  4QWA A;  2OPP B;  2ZWO A;  1F6T A;  4RW8 A;  2I38 A;  1NDK A;  4ZDN A;  1E6V A;  1MLA A;  4DV1 J;  5FD1 A;  3PKY A;  3NNC A;  1AZS A;  5EUH A;  2RVJ A;  4X66 F;  4WYW A;  2VG7 A;  3MM8 B;  2V5H G;  3IM8 A;  2DCU B;  4ECW A;  3EGN A;  4OJ1 A;  1J5E F;  2R7S A;  4I6Y A;  3UWT A;  2LMI A;  1NK0 A;  4N7T A;  2R7Q A;  4UZC A;  2VBX A;  2ZVI A;  3ILL A;  4Z7C A;  4ZVE A;  2W4C A;  1EJ7 L;  2XCA A;  3LPE A;  4ZPW R;  1U47 A;  5C7P A;  3T5L A;  3BO3 A;  3FZ2 A;  4DCP B;  2CQD A;  3KLG A;  1TEL A;  5RUB A;  3UD4 P;  1SKW A;  2IAJ B;  5U47 A;  2QTW A;  1WTF A;  2OPR B;  1MU2 B;  4LF7 J;  3CCQ S;  3HVT B;  4R5P A;  4DSF A;  3IBC B;  4USV A;  3ET6 B;  3J81 U;  1PC5 A;  3OFH A;  4K2X A;  2AX1 A;  2GMH A;  4AUK A;  3DRY A;  4LF9 F;  2R7V A;  1S97 A;  4HDG A;  1YX2 A;  3I5C A;  2EFP A;  1HPZ B;  4RW9 B;  2KJV A;  1JLE B;  4EUV A;  4TU9 A;  5KFQ A;  4NLX A;  4DV5 F;  2FIU A;  4N41 A;  5G0R B;  2MQM A;  1JLB A;  3PAC A;  5DLG A;  2WAQ D;  2HHP A;  3PYF A;  1V6H A;  1MWY A;  1FWP A;  4HL9 A;  4UQT A;  4YQW A;  2J0Q D;  3DI6 A;  2FJV A;  1B99 A;  3HX9 A;  4RW7 A;  1RAB B;  4CH0 S;  1NJW A;  4LVO P;  4PKD B;  3ISZ A;  2DXE A;  3JYT A;  2LDI A;  1JNZ B;  1SIZ A;  1SC6 A;  1Q8B A;  5KFZ A;  2K7K A;  2XMJ A;  4MJK A;  2LQB A;  1N5V A;  3L7P A;  3BB5 A;  1H6K X;  1JLC A;  4V19 X;  3GTY X;  1ZPV A;  4ID8 A;  4IO9 Q;  4NCG A;  4GRS A;  3QGG A;  2MEW A;  3A12 A;  4WP3 A;  1CQN A;  1X8D A;  4LF8 F;  3DOM A;  3PX4 A;  1YI2 S;  2FHJ A;  2RUS A;  4IG3 A;  5E7O B;  2J6S A;  2B6A A;  1N6Q A;  3QFH A;  2XEX A;  4C7Q A;  1T3O A;  1Q7Y T;  1PJ6 A;  2F4F A;  2XMW A;  2QC3 A;  3AT1 B;  4Q8F A;  2Z56 B;  4CLK A;  2MTL A;  4QOT A;  2X1F A;  5F0U A;  5BR8 J;  2QEX S;  3IBF B;  3UD3 P;  2HIQ A;  4J9N A;  2ALZ A;  3G82 B;  3R5B A;  3DMJ A;  1FF2 A;  4FN5 A;  1OQ3 A;  2VU5 A;  4RX6 A;  2FZG B;  1A0O B;  5HMX A;  3DXB A;  1XQI A;  4HTI A;  4ILR A;  4M5J A;  3PYD A;  5KFU A;  1RSC A;  3H5U A;  3GYN A;  4P7V A;  2LDY A;  2MZR A;  2YQ1 A;  4A8M P;  3OJU A;  3MFH A;  3IAS 9;  1ZTW A;  5IS2 A;  2K1R A;  4IG0 B;  5H1S V;  3WZ0 A;  3FNN A;  4NLO A;  4DR4 F;  1BLU A;  2OEM A;  1VQ7 S;  1PG5 B;  1HI8 A;  2AEJ A;  4CO2 A;  2W7O A;  1WG1 A;  1Z1Z A;  4L72 B;  2HNZ A;  1VHI A;  2OSQ A;  1X4H A;  5GAE U;  5IT9 Y;  4IYQ A;  4DV1 F;  4F2S A;  4A8Y A;  1AFJ A;  1S1T B;  3GU0 A;  3MR7 A;  4XAK A;  2E44 A;  2OPP A;  3MEG B;  2MQP A;  1BWV A;  1UEK A;  1RT1 B;  2KHC A;  3LGN A;  2E5L J;  3BO2 A;  1PIL A;  3OL8 A;  4IFV B;  2NPI A;  3IBW A;  3MM8 A;  1RHU B;  2JFD A;  4G1Q B;  4J37 A;  1HD0 A;  2LQ8 A;  3C14 B;  2WTF A;  1F9H A;  3MXH P;  2C22 A;  1QLN A;  3KLV A;  5BYQ A;  3J7Y U;  2CZ4 A;  1SV5 B;  1WJ9 A;  4DBQ A;  3J80 Y;  3K5P A;  2NLW A;  4LF7 F;  1BY9 A;  4L74 A;  3GP9 A;  1Q95 G;  5AXM A;  4X65 J;  4FYV B;  3QAU A;  3D0H E;  3UD5 A;  4M63 A;  4FYW B;  1X4B A;  4DG1 B;  4M5M A;  1FE0 A;  1RAF B;  3KDN A;  2WW8 A;  2IAJ A;  7AT1 B;  3JB9 k;  3EXY A;  2OPR A;  1MU2 A;  3HVT A;  2HWH A;  3Q8S B;  3C8Y A;  2H48 B;  2A1B A;  5IV4 A;  1KTQ A;  3ET6 A;  1DAR A;  4C8Z A;  3QJJ A;  2CPE A;  5GMD A;  1KC8 T;  4OYO A;  2VOP A;  2V4J B;  1X5S A;  3FKB A;  4K5S A;  3CD5 A;  3R2D J;  2ZC3 A;  1TR0 A;  1RDR A;  4JOU A;  1WHV A;  3ZNU A;  2VIC A;  4YME A;  3UDE A;  4LSL B;  4CLP A;  1TK5 A;  1HPZ A;  4RW9 A;  1JLQ B;  5IXU A;  1YJT A;  1JLE A;  3QRR A;  1S77 D;  2B56 A;  4OYB A;  2PMZ D;  2NZC A;  3EGV A;  5F9N A;  1VMB A;  1S0M A;  5G0R A;  3CPW R;  1UA0 A;  4K50 A;  2VZ9 A;  3HUL A;  3PTW A;  4ETZ A;  4OHY A;  5DQI A;  3MWB A;  3U1M A;  3UI3 A;  2BQR A;  4KHP J;  4UUX A;  1VK8 A;  2E1C A;  3D67 A;  3PJX A;  2YKM B;  1U1Q A;  1IWA A;  2HHV A;  5ETP A;  4MTP A;  1ZAX A;  5HL7 Q;  3DLL Q;  1PC4 A;  3CED A;  2DPJ A;  1RHK B;  3MPW A;  1Q7L B;  4RJV A;  1S7I A;  1K9M T;  4WXW A;  4DU8 A;  2B9E A;  1HIY A;  2HPU A;  4DHV A;  5BYS A;  2C3Y A;  3FK4 A;  4IH5 A;  1A9N B;  5L38 A;  4O3N A;  1VRU B;  5CQG A;  3MM7 B;  3LF0 A;  4OHV A;  3EVW A;  2HLU A;  2F8E X;  3UR3 C;  2IJR A;  1S6Q B;  2BOP A;  5BR8 F;  3M1V A;  5EDW A;  2Y3Y A;  4TKT A;  2ZKT A;  2AP6 A;  1WDD A;  4QR1 A;  4CLW A;  5G4D A;  2VKZ G;  2BE2 B;  2HK2 A;  3CJQ A;  1XMO J;  3W3S A;  3QGP A;  1WUU A;  3DOL A;  3CJ8 A;  3VAK A;  1IM4 A;  4J9P A;  1D9F A;  1VIX A;  3CJ0 A;  3G82 A;  3CC7 S;  2LFV A;  5DZ6 A;  3CF5 Q;  1NSP A;  3JAM Y;  3PEH A;  1RTI B;  1HI1 A;  4DUY J;  1TKD A;  1WF2 A;  3KLH B;  1R8C A;  1GQE A;  1OY9 A;  1CJT B;  3EVM A;  4OJ3 A;  2CAJ A;  2YY3 A;  4RWW A;  4LSZ B;  3CD6 S;  2WRM A;  4C0O C;  1AT1 B;  2Y8W A;  1XNR J;  4CYU B;  4DN0 A;  2R7W A;  1FHT A;  2E29 A;  2R42 A;  2X7I A;  1U1R A;  4IG0 A;  2E7V A;  2NXN A;  2LEB A;  1NBE B;  5GAG I;  1RA7 A;  4WTY A;  1HHQ A;  5CD4 A;  2K3K A;  4BDP A;  1Y3J A;  3R5D A;  4FXD A;  2E5L F;  3QWP A;  3ZXW A;  4F7V A;  1N5S A;  1S1T A;  3MEK A;  3MEG A;  5DDR C;  1FKP B;  1MMN A;  2PC6 A;  3NY0 A;  4B9L A;  1RTD B;  1RT1 A;  1X5O A;  1CSJ A;  4JI8 J;  2JNJ A;  1D8Z A;  3EZ5 A;  4IFV A;  2HBY B;  2MGZ B;  2HQF A;  4Q44 A;  5B0E A;  4ZIT A;  3FGV A;  3OR2 B;  1SL0 A;  4NOH A;  3C14 A;  1Q53 A;  2KYZ A;  2CPY A;  3U02 A;  4X65 F;  4CLS A;  3VVT A;  1SV5 A;  3C46 A;  2K8G A;  2J7K A;  1CPZ A;  5F8L A;  3GIL A;  2FB0 A;  3PJ9 A;  1O5J A;  1ELO A;  3R1L A;  1M0S A;  3EWG A;  3TVK A;  2M3D A;  1MG7 A;  2O3D A;  1RAI B;  3TUJ C;  4DG1 A;  2HG4 A;  3ENA A;  3W8P A;  5D4O A;  3OJS A;  3BGU A;  5KFE A;  4ZVP B;  1PGZ A;  3CO9 A;  1X5T A;  1SKS A;  4FYX B;  2M4M A;  2ROG A;  1WWH A;  3OTE A;  1EQ0 A;  3A8K A;  1DBD A;  4RNM A;  3QSI A;  3DRP B;  4X64 J;  2V4J A;  2J8S A;  4ZPA A;  1N36 J;  3FSI A;  2FD2 A;  1XIQ A;  1GAO A;  5M2P A;  1RBA A;  2QLF B;  4LSL A;  3TVY A;  3CE8 A;  2F40 A;  2CNO B;  4IO1 A;  4KHP F;  4CLU A;  1T0T V;  4DZ6 A;  2IIH A;  2AYB A;  4O4R A;  4WP8 A;  1C1B B;  4QWB A;  2XMA A;  3BSN A;  2XB2 D;  3TR5 A;  2UVW A;  5HI7 A;  3N01 A;  3MFI A;  1Z4U A;  5BXI A;  4OQJ A;  2KXN B;  1LWX A;  1URN A;  3CVK A;  2DB1 A;  5KT2 A;  2YKM A;  3DLG B;  4RUA A;  2V50 A;  2VPY B;  2UVU A;  1AW0 A;  3GON A;  3Q8P B;  1KON A;  1YWX A;  3H5X A;  2AJF E;  5KFK A;  1VQM S;  4LF4 J;  3QJP A;  2LA4 A;  1NSQ A;  3HVA A;  1UJ4 A;  2KO1 A;  5B08 A;  3ZTS A;  4NLR A;  1FRL A;  4ZVU B;  3SSS A;  2G13 A;  4B9S A;  4I69 A;  2LEC A;  3AXM A;  4P2X A;  3ZTP A;  1VRU A;  5THW A;  3KMQ A;  2AZ1 A;  2GW8 A;  5ETS A;  4JB8 B;  9ATC B;  2YTC A;  5HP1 B;  2ZVS A;  2OD6 A;  4ANE A;  4QCL A;  1XMO F;  1KSP A;  3MR6 A;  1B7F A;  1H74 A;  1S6Q A;  3B4D A;  4GC7 A;  2B43 A;  2IRU A;  5L46 A;  2RHQ B;  3RR8 A;  2VJV A;  1SJF A;  3QGH A;  1SH3 A;  3E51 A;  4C98 A;  2BE2 A;  1KOH A;  2QA1 A;  4FXV A;  5D77 A;  1TUG B;  2BKP A;  3HHK A;  4DUY F;  3DXS X;  3AAW B;  4CO4 A;  4BWM A;  3I0R B;  2J9D A;  3VZH A;  3U7J A;  2LYV A;  1HI0 P;  4IRD A;  2ACM A;  2MKK A;  1XNR F;  1RTI A;  3FBE A;  4WE1 B;  3P45 B;  3RGI A;  3KLH A;  1JLA B;  5DJB A;  1CJT A;  2KH9 A;  3M2R B;  2M8H A;  2EBE A;  2C2E A;  2CVE A;  2QMX A;  1S6P B;  3N0V A;  5HBM B;  4BHQ A;  2FY8 A;  1TP7 A;  4CYU A;  3WQP A;  2NQP A;  1N8R T;  2YPY A;  1R6Y A;  2NS1 B;  1ARO P;  2WVB A;  1GXL A;  2WZ1 A;  2B0G A;  4PG8 A;  3WDO A;  1C2P A;  2QYC A;  1KLN A;  4ZPB A;  3GV7 B;  1HNX J;  2DIT A;  2ZBC A;  4JI8 F;  3PYG A;  1QTM A;  2AW0 A;  2UV8 G;  3K8W A;  2A2D A;  5H9E K;  1OSC A;  3T6J A;  1UP1 A;  1SL1 A;  2KI2 A;  1FKP A;  4X4Q A;  4V19 J;  3CW2 C;  3MDF A;  3ZZ0 A;  4NA3 A;  1RTD A;  4N5S A;  1Q4R A;  2OTJ S;  3RYL A;  4B3M F;  1ZYQ A;  1Y0H A;  2DNZ A;  1LK7 A;  3M30 B;  5AJ3 F;  2KM8 C;  2HNY B;  3PW5 A;  2HHS A;  2MGZ A;  2OSR A;  3A8J A;  3J7A 1;  3CJS A;  3OR2 A;  3UDV A;  2Z2Y B;  4B3T J;  3K5M A;  1REG X;  1T9W A;  4TY9 A;  3AY0 A;  1H7X A;  3PJW A;  4F25 A;  2ILZ A;  4ZS6 A;  3MMJ A;  4XTT A;  1P9Y A;  2A0F B;  2G0J A;  3G8Q A;  3QT8 A;  1S9F A;  1F5A A;  4JI1 J;  5FII A;  4B02 A;  4HAC B;  4J91 A;  5H9F K;  1JNR B;  4C11 B;  1VYA A;  5KFB A;  1RU2 A;  1HA1 A;  4X64 F;  3ENQ A;  1RB0 A;  3KLE B;  1T9V A;  1FFW B;  1HMV B;  3HCX A;  1RHJ B;  1IR1 A;  1TQL A;  4M5L A;  2HK3 A;  3VAM A;  3GG1 A;  3ZFV A;  4ED8 A;  3LGM A;  1JJ4 A;  3NWG A;  2ZZT A;  4KH0 B;  3HK2 A;  4LMZ A;  1GEH A;  3T5K A;  3T5J A;  2XCP A;  1S4F A;  3P4U B;  3DRP A;  2BV3 A;  1RTH B;  1REV B;  4PZV A;  3M9N B;  3NLC A;  5KFG A;  3BPD A;  2VDI A;  2QZ8 A;  1T9X A;  1YRX A;  2C2R A;  2W25 A;  4V1A k;  3M4X A;  1N0U A;  3P49 B;  3IA0 A;  1FEE A;  3LO3 A;  4ETX A;  5FLX U;  2KT3 A;  2BMB A;  1R7I A;  3EGW B;  1DQ9 A;  3WC0 A;  1C1B A;  4LVN P;  3VZI A;  3S6E A;  3UCU P;  1G4C A;  3FQL A;  4Q0B B;  3ITH B;  3AOB A;  2WSF C;  2CQC A;  1FJG J;  3KUH A;  2VH7 A;  1Q82 T;  4C8M A;  4LF4 F;  4LSN A;  3F41 A;  3O44 A;  3DLG A;  4WPA A;  4X2B A;  5ADZ A;  3PKM A;  3KK2 B;  4IOA Q;  2BJ1 A;  1RK8 A;  3D1O A;  1IN0 A;  3K58 A;  4EMD A;  3SCJ E;  1IKW B;  2DHS A;  4FF1 A;  4U8V A;  3KK3 B;  1RWN B;  4UY8 5;  5HQ8 A;  2XNR A;  2DNY A;  4OHZ A;  4IR1 A;  4JI5 J;  2MPU A;  4MYU A;  4EI2 A;  3WIU A;  2GVZ B;  2R7U A;  2XMV A;  4FP9 A;  3BEG B;  5HP1 A;  1QM9 A;  4YY3 J;  1NK4 A;  1OMS A;  2XC9 A;  4ZCK A;  3GMG A;  1S7H A;  2R7T A;  2HBQ B;  3NNA A;  1UA1 A;  5C2C A;  3H2U B;  2CJX B;  1WDT A;  3BDE A;  2HGM A;  3MMC A;  3D28 A;  4DCJ B;  1RAA B;  1GXT A;  1Z2L A;  3M8Z A;  3VTI A;  4DOZ A;  4C8K A;  3TJ8 A;  2CPX A;  4MAK A;  3CTR A;  3I0R A;  3MHY A;  3JSM B;  2YQ0 A;  1SQG A;  4K59 A;  4NX9 A;  2WBM A;  2B8Q A;  2MLX A;  4HEA 9;  3H5Y A;  1TV6 B;  2LEA A;  4WE1 A;  2VD3 A;  3TVZ A;  1JLA A;  1NH8 A;  5IM0 A;  2I0X A;  3PDN A;  1CUL B;  3M2R A;  2DEJ A;  3HT0 A;  1XNQ J;  3THV A;  4HDH A;  1S6P A;  5HBM A;  4P2F A;  4CO1 A;  2UUB J;  2L9W A;  1HNX F;  4XO0 A;  5DM6 Q;  1RT5 A;  1XTZ A;  3GFX A;  3A3O B;  4CP5 A;  4LF1 A;  2GZO A;  4PWD B;  1M5S A;  5EGY A;  4ALZ A;  3OFG A;  3HI9 A;  1A7G E;  4CLL A;  2NUH A;  4WCE Q;  1R3N A;  2QX0 A;  2FY1 A;  3DKD A;  1HWJ A;  3CMQ A;  3SIP B;  2M2B A;  2NYI A;  2IVM A;  2CG8 A;  5CA5 A;  3EUN A;  4B3T F;  1KR4 A;  5D8H B;  2YWW A;  1J5O B;  2CQI A;  3M30 A;  3WC2 A;  2HNY A;  2DVI A;  2EKN A;  3W62 A;  2BAN B;  1SB6 A;  3FEY B;  4JI1 F;  3TOQ A;  3AOC A;  3S8S A;  4RNO A;  4WIQ A;  1S1W B;  2Z2Z A;  3BSO A;  1DY3 A;  1F5B A;  3PW7 A;  2XSF A;  4WYL A;  2MQL A;  4ZVR B;  2YWH A;  1YSJ A;  2U1A A;  2IRY A;  3CXC R;  4HAC A;  3T41 A;  1DTT B;  4A8S A;  4KKO B;  5T7L B;  4ICL B;  1K1S A;  4C11 A;  3R5J B;  2Y0S D;  4YR2 A;  1HQ2 A;  2C3O A;  2RDD A;  4NE9 C;  3KLE A;  1HMV A;  3HVR A;  3HHN B;  3W9I A;  2KVI A;  4DL2 A;  5C24 B;  4PCQ A;  2BM0 A;  5GME A;  5KFP A;  2I2Y A;  4J9M A;  2BJD A;  3QWU A;  5AXK A;  4BCA A;  4ZP7 A;  1RKI A;  1T9Y A;  3DU6 A;  3BN7 A;  5E3Q A;  4ELU A;  4DPO A;  1RTH A;  1REV A;  4P9S A;  2OI2 A;  4CCH A;  2RJZ A;  2HQC A;  1FER A;  4ZOS A;  4RUH A;  2NRE A;  3P5T L;  5AXN A;  3AHP A;  3OXL A;  1KP6 A;  1XR5 A;  1PJ5 A;  4DCO B;  3SQO P;  2VG6 B;  2OGU A;  4NYZ A;  3IAM 9;  2CPJ A;  3LQV A;  4M5N A;  3ZTO A;  2YWK A;  2BM1 A;  4DR2 F;  1RAG B;  1YJW S;  4Q0B A;  2HUR A;  4XPC A;  3SV3 A;  1RT4 A;  3W64 A;  4NRU A;  2L9N A;  2GML A;  4USI A;  2VPZ B;  1EQM A;  2DH7 A;  4OI0 A;  2UVR A;  2CXE A;  3GFH A;  1F9E B;  3KK2 A;  3K0J A;  3IRW P;  1WKK A;  2XI2 A;  5K8N A;  3FMB A;  3P96 A;  1QAI A;  1NK7 A;  2HSE B;  5A6P A;  1IKW A;  2MSS A;  1WOR A;  3KK3 A;  1BWE A;  3IR5 B;  3LH2 S;  4LBH A;  3O6Q A;  4DV6 J;  2N7C A;  3MI7 X;  3TAR A;  1BMQ B;  2ZJP Q;  3PRD A;  3G9C A;  2GVZ A;  2FC8 A;  2XSJ A;  5KT6 A;  4UOF A;  5B7W A;  5LSR A;  1X60 A;  2QG9 B;  4I68 A;  2OPQ B;  3UN2 A;  2RRN A;  2WW4 A;  4LJM A;  3UR0 A;  3FRY A;  2DGU A;  3B82 A;  2DHX A;  2JLF A;  1NME B;  4J9V A;  5I3U A;  3P3D A;  5C2G A;  1OPZ A;  1HNI B;  3UVJ B;  2JOQ A;  1RAJ A;  2CA9 A;  3FC9 A;  4L6V 3;  4F26 A;  1TKX B;  2V69 A;  5KFH A;  1JXL A;  3KG0 A;  2M9K A;  2RE1 A;  4NYO A;  5IT9 U;  3W63 A;  2QLW A;  5LM7 E;  3JSM A;  3OSP A;  1XNQ F;  1OY6 A;  3DFE A;  1TV6 A;  2VKR A;  4KGV B;  4G65 A;  2G1D A;  2UUB F;  2EEY A;  4U9R A;  2ATC B;  4GO5 X;  4CT9 A;  2CWX A;  4P52 A;  4HTJ A;  1CUL A;  2BJ7 A;  1FWK A;  1IXK A;  2XMT A;  3RBX A;  2A3J A;  3OL9 A;  4O0N A;  2W4P A;  1APS A;  3ETM A;  5D4L A;  2QN6 B;  3KNG A;  3IXQ A;  3OLB A;  3IR7 B;  2L08 A;  4DS5 A;  5EX0 A;  3QQC D;  3DRX A;  1N32 F;  4WKY A;  3IM9 A;  2YWG A;  4O3Q A;  3J80 U;  4PWD A;  4UTG A;  5E33 A;  2RKI A;  2RDJ A;  3OFF A;  3KLF B;  3JSY A;  5T41 A;  3ELH A;  4YHH J;  4LFA J;  5KFV A;  1HR0 J;  3IFE A;  1N5T A;  1KQG B;  4ZN1 A;  1N34 J;  1R8B A;  1RWP B;  2IJN A;  5E0O A;  3RAQ A;  2GX8 A;  3H2L A;  1P1T A;  5FJ4 A;  2XO7 A;  2V67 A;  2FVC A;  2VV5 A;  1JXV A;  1J5O A;  2BQU A;  9RUB A;  1H38 A;  2BAN A;  5LXR A;  4KR0 B;  1AUD A;  3OSN A;  3RW7 A;  3CCM S;  1UVM A;  2A6M A;  5J2Q A;  2QLJ B;  2D3Z A;  2O5D A;  1N33 J;  4FNI A;  1S1W A;  2EKY A;  1PAU B;  3P5B P;  1KQK A;  4EU0 A;  3E01 B;  3CIZ A;  5DG7 A;  3R5A A;  3AA8 A;  2I5J B;  1HFE L;  4YR3 A;  1WC4 A;  3QO9 B;  1WI6 A;  1DTT A;  4KKO A;  5T7L A;  2FGC A;  4ICL A;  3H5S A;  4U95 A;  4N8N A;  5A8R B;  3NS7 B;  5KFM A;  2IMW P;  1GXU A;  2L41 A;  3MED B;  4P6Q A;  2KJW A;  3HHL D;  5C24 A;  1F0X A;  4N8O A;  1UVI A;  4H4M B;  2BYC A;  1XK8 A;  2MKC A;  4G1I A;  1CEZ A;  4GMK A;  2E66 A;  3DDI A;  3M8R A;  5ETK A;  5KFN A;  4RUB A;  1FE4 A;  3SCL E;  4FPR A;  3PCO B;  2PEH A;  1I51 B;  3PW4 A;  5ITH A;  5HK4 A;  4ECS A;  3PHE A;  2R8G A;  3BBF A;  5KFY A;  4LRC A;  3R6G B;  4PPD A;  2M5Y A;  4JI0 J;  4A8F A;  2NXU A;  2V8V A;  3TX0 A;  3OVS A;  3W66 A;  3LAN A;  3ZTQ A;  4AE5 A;  1YJ7 A;  1RYS A;  3W60 A;  3I82 A;  1A6L A;  1CG2 A;  2AJ2 A;  2DNQ A;  5GAE I;  2MY7 A;  1UVL A;  4DV6 F;  2I1R A;  2N7Y A;  4J9Q A;  3DOK B;  1YRU A;  4W90 B;  5F3Z A;  1ZH5 A;  3T1Y J;  2G2Y A;  1NJX A;  3D5M A;  1EP4 B;  1T94 A;  3KG1 A;  1HHS A;  1W25 A;  3JAM U;  5L1L A;  3GR0 A;  5K14 B;  2D3O R;  1LFW A;  3NOC A;  1T9U A;  2BKN A;  5CAB A;  1CVJ A;  1U8W A;  5LJ3 Y;  1C0U B;  2V63 A;  2OPQ A;  3NRB A;  1YHQ S;  1HYS B;  5C25 B;  3VAL A;  1S1U B;  4TXS A;  1RWO B;  2HND B;  1DUR A;  1HNI A;  3UVJ A;  2HS4 A;  3LPY A;  1LNQ A;  3L4B C;  4ENO A;  1IBK J;  4KPC A;  3Q8Q B;  2PSZ A;  3MOZ A;  4K7Q A;  4RBU A;  1R6V A;  1TKX A;  4PXC A;  1OPI A;  3HFZ B;  3BBC A;  4B9T A;  4FKX A;  1VI7 A;  3H90 A;  3RBD A;  4M5D B;  1UAW A;  4RWX A;  3LAL A;  3HZE A;  4USW A;  1HWI A;  1SBR A;  2JHE A;  2HHX A;  2W2M P;  4U6P A;  4IDK A;  4PAB A;  3I4H X;  2HQ3 A;  2EK6 A;  7FD1 A;  3FCW A;  4NLD A;  5A8K A;  3RG6 A;  2J9E A;  1CLF A;  2ZH5 A;  3K57 A;  1X31 C;  3BGO P;  2BJ9 A;  1Q86 T;  3TUZ C;  3QT7 A;  1D3W A;  2VFV A;  4WU2 A;  3B6B A;  1NND A;  4YHH F;  4LFA F;  2KDO A;  2Z30 B;  1HR0 F;  2EFO A;  1N34 F;  5E3A A;  4WJB A;  1RBL A;  2GV1 A;  4Y3C A;  1Q1K A;  3R1H A;  3KLF A;  2CVI A;  3CMA S;  2FJA B;  3BYR A;  2FVQ A;  3T9N A;  4X4V A;  1YG0 A;  3RRK A;  3EDQ B;  4ES2 A;  4EO6 A;  3O3L A;  5HAT A;  2PI5 A;  1FDN A;  1JQG A;  1U26 A;  1YVF A;  2J76 E;  3HLU A;  4FVM A;  1N33 F;  1U2R A;  1SIW B;  4YB5 A;  2W2N P;  4KJI A;  4X4U A;  1YRT A;  4DL3 A;  1ZPW X;  3NCP A;  3MTJ A;  3BKU A;  4CM2 A;  2MZ1 A;  3R3T A;  2NR0 A;  2G1H A;  2XS7 A;  2XQC A;  1ZOT A;  1MSW D;  3AA9 A;  2Y1I A;  3E01 A;  1UVK A;  3AOD A;  1RWX B;  3CC4 S;  2E9T A;  2PE8 A;  2FJX A;  2I5J A;  4J90 A;  5JVH Q;  4QQB A;  3FZB A;  1JJ2 R;  2W01 A;  4CH7 A;  3QO9 A;  1W2B R;  3N4W A;  1CJU B;  4ED5 A;  2GHW A;  2IHR 1;  4USH A;  4USJ C;  3KTQ A;  5A8R A;  3NNH A;  2CPF A;  3H2V E;  4MK9 A;  5K8M A;  1LK5 A;  4JI3 J;  3ISN D;  4E98 A;  4LRB A;  4XPE A;  3MED A;  2DR7 A;  2PT0 A;  2HHT A;  4H4M A;  4BC7 A;  3K7R A;  1UPM B;  3EJM A;  3UPF A;  3IO1 A;  2AYE A;  3R27 A;  4JI0 F;  5LT5 A;  2DXF A;  4YOE A;  7FDR A;  1QY7 A;  2LQ9 A;  4DR3 J;  1BD6 A;  2DGW A;  1VS3 A;  2DNN A;  5DQH A;  2OEL A;  2ZH8 A;  4JV5 J;  4F0M A;  3GSI A;  1RTJ B;  4OX9 J;  4ILM A;  4ZMM A;  4I4B A;  4UW2 A;  4TLQ A;  3BZQ A;  4K4T A;  3ZZO A;  2CNL B;  2DBB A;  4NLV A;  3KNA A;  4XIU A;  2HZA A;  1K0T A;  1PKU A;  8RUC A;  1S6U A;  2J0X A;  5KFF A;  1UMJ A;  4CTA B;  3U27 A;  2RAQ A;  1X9W A;  5L39 A;  1KHV A;  3BSC A;  2N4C A;  4P2S A;  3G86 A;  1M1K T;  3NG8 A;  1T9T A;  4NL5 A;  1PBU A;  1F2G A;  4EYI B;  1WC5 A;  1PAE X;  1GX6 A;  4E8U A;  2MB0 B;  4LBI A;  2GIR A;  5ETO A;  1NKC A;  2MLZ A;  2W2P P;  1EP4 A;  3MPV A;  2ZKU A;  3MAA B;  1TL1 B;  1H2V Z;  5KFR A;  2V2K A;  4EK2 A;  5K14 A;  5KG3 A;  3LAM A;  2R8I A;  2FHJ D;  4C6A A;  2V8D A;  2BJE A;  1TU0 B;  1IBK F;  2JLE A;  5ETL A;  1C0U A;  4Y2M A;  3C66 A;  3DM2 B;  4PYA A;  1HYS A;  2HBR B;  5C25 A;  2KL8 A;  3R7S B;  4I2Q B;  2FUG 9;  3TJ9 A;  1LKZ A;  1S1U A;  2HND A;  4NLU A;  2VL1 A;  1U49 A;  2YNI B;  1X7V A;  4K4X A;  4BC9 A;  4Y00 A;  2BAB A;  1N0V C;  2VBY A;  2GS8 A;  2VA2 A;  1WEX A;  3DGV A;  3IMQ J;  1S99 A;  4DPX A;  4I7F B;  2OFH X;  2B4U A;  2DHH A;  5KFL A;  4OYX A;  2PI4 A;  4M5D A;  5EWF A;  2ZJQ Q;  2HEK A;  2CQ4 A;  2CPH A;  2SXL A;  1S9G B;  4K4V A;  2AT1 B;  4DL6 A;  4F3O A;  2QMU B;  1LWC A;  1Q5Y A;  4J9K A;  4DR1 J;  4LRA A;  1NLK L;  3U1N A;  3SFG A;  4M5I A;  2DNK A;  4RW6 B;  3FSY A;  1KVI A;  1SJ1 A;  2EFG A;  1F60 B;  3PR4 A;  1NZA A;  3AQO A;  4X4N A;  1PSD A;  4OLP A;  2W2O P;  4QJV A;  4ED7 A;  3KLI B;  1S48 A;  3DNC A;  5LSL A;  1VC6 A;  4F67 A;  2LVW A;  4IRC A;  2Q6C A;  1OIA A;  3FFI B;  3DGP B;  4MKY A;  5E3C A;  1ZA1 B;  4NLQ A;  3M9M B;  2E9R X;  1IR0 A;  1IBC B;  3ICL A;  2DR8 A;  4TQS A;  4J9U E;  4IOC Q;  2VFU A;  4LR7 A;  4LRF A;  1BGX T;  2D69 A;  2UV8 A;  4LRD A;  4USU A;  1FWL A;  3RB0 A;  2RQC A;  4KBI A;  1S10 A;  2ZNZ A;  3DI6 B;  3TAP A;  4CO0 A;  3LGH A;  3AH6 A;  4NLS A;  5D0R A;  4JI3 F;  1V3Z A;  2EVZ A;  4BBY A;  4DR7 J;  2DNR A;  4F3M A;  3AD7 C;  1M5K C;  4NXM J;  2A2C A;  5ETN A;  4X62 J;  2CNN B;  2D3O 1;  2IA6 A;  2HRY A;  3BQ0 A;  1JLC B;  3V2U C;  5F3T A;  2VC0 A;  5AXL A;  4DR3 F;  5M2U A;  3M2U B;  1UFL A;  2J6T A;  2N3O A;  4I67 A;  2BW7 A;  1YLX A;  2QL5 B;  3ZNJ 1;  4F04 B;  4OX9 F;  3KOA A;  2EG2 A;  4ZKA A;  2JLG A;  3TZY A;  2ZH7 A;  1ZM2 A;  3QZ8 A;  5CZV A;  2IM2 A;  3QBC A;  2VUG A;  2ASL A;  1O0P A;  3SYZ A;  3RRH A;  2G2O A;  4GVL A;  5L8R C;  3G8S A;  4K4Y A;  2XY6 A;  4YDX A;  5IC6 B;  1RTJ A;  2WBR A;  1XR6 A;  3MF5 A;  2P6T A;  1RZM A;  3HSJ A;  4HH1 A;  1VHF A;  4ZPC A;  4LFC J;  2ABY A;  1RWV B;  2PGC A;  1WSR A;  3UFC X;  2HHH J;  1WKJ A;  3IWX A;  4CTA A;  2R8J A;  2XLJ A;  1VIS A;  2QYG A;  4EEY A;  4FYY B;  4OJG A;  3N28 A;  4ECZ A;  2ZEJ A;  4L76 A;  5KFJ A;  1RBO B;  4RPF A;  2VOO A;  4OX6 A;  4QPT A;  5DDO C;  3MAA A;  1TL1 A;  3AJ1 A;  5F8M A;  4U96 A;  1HD1 A;  4J5O A;  1WSV A;  1QD1 A;  4RLE A;  3IWN C;  4A48 A;  4OYI A;  2KZZ A;  3DDK A;  3I9V 9;  4U8Y A;  2GHP A;  1QJH A;  2YPZ A;  2MXY A;  4DSK A;  4O3P A;  3DM2 A;  2VJU A;  2F8M A;  3PX6 A;  4I2Q A;  5F8H A;  2FLN A;  5E5N A;  2YNI A;  1M90 T;  1VQ4 S;  2B4V A;  3E3X A;  2XI3 A;  3VAI A;  4KO0 B;  1NPK A;  2H3E B;  3M6W A;  2VDH A;  3L9Z A;  3SCK E;  4ZVH A;  4I7F A;  1RT6 B;  2ASD A;  2KXH A;  1C4C A;  3MM9 B;  4DR1 F;  4AT1 B;  3R5G A;  3BPS P;  2Z4P A;  4DF4 A;  3VAH A;  2YKP A;  1SJ3 P;  4X84 A;  2ZH6 A;  3D68 A;  3D3B J;  3Q89 A;  3PZP A;  4EBC A;  1OY8 A;  1S9G A;  1M1G A;  1WEY A;  1X9M A;  2IA0 A;  4JI6 J;  2P9G A;  3KHG A;  4KE5 A;  3NCQ A;  3C19 A;  4NI2 B;  3MMB B;  4OV6 A;  4QIG A;  4DV4 J;  2HVI A;  2DGS A;  3QFW A;  2VAS A;  2CQ1 A;  3BH7 B;  4R25 A;  3LW5 C;  4M1K A;  1U25 A;  1XWL A;  1RT7 B;  1U1M A;  4RW6 A;  1LW2 B;  4ECY A;  3N6N A;  3CME S;  3RU0 A;  3GLJ A;  5ETR A;  4B9V A;  3BDP A;  3UN5 A;  4HI2 A;  5J2N B;  5L1J A;  2FVS A;  1R8H A;  3KLI A;  2H5I B;  4NLG A;  1IJE B;  1WI8 A;  2E1R A;  2ZUG A;  4A8O A;  4O3O A;  3FFI A;  3FEX B;  4M94 A;  3DGP A;  1WAC A;  3AXK A;  2EFQ A;  1RP5 A;  3UN3 A;  4EO8 A;  4RW4 B;  2HRT A;  4RNF A;  5DM7 Q;  2M52 A;  3D7S B;  1RGV A;  4QPX A;  1U8S A;  2EBG A;  1IKX B;  1Q81 T;  2LA6 A;  1T3N A;  4A47 A;  1FKA F;  3VWS A;  2A10 A;  1N56 A;  3TEH B;  1SC4 B;  4OJH A;  4DR7 F;  4KB7 A;  3D0I E;  2XBP A;  3GYG A;  1U1P A;  2ZIT A;  3TYT A;  4NXM F;  2GAH C;  1XR7 A;  2FPH X;  1SQF A;  3UO0 A;  2KRB A;  4X62 F;  1XMQ J;  4RO0 A;  2DY1 A;  2LQ5 A;  1DHM A;  4ZLJ A;  4JV0 A;  1S9E A;  2BQ3 A;  2RSQ A;  2FDN A;  1NHK L;  4URG A;  4NML A;  5HVF A;  2VFT A;  4U67 Q;  3MM6 B;  4WXO A;  3W8G A;  1NDP A;  4OYW A;  4KFB B;  2CDQ A;  3Q8Y A;  3I32 A;  2PA8 D;  4JV1 A;  4WFX A;  4HYK A;  1B70 B;  5KOW A;  2UU9 F;  4IFY B;  1X4G A;  1FD2 A;  3R9L A;  2MZS A;  2XS5 A;  4TQR A;  3M2U A;  1K1Q A;  2C3P A;  2KN4 A;  4DPU A;  3RB4 A;  1OS5 A;  1NAQ A;  3RAX A;  2GVD B;  5HN0 A;  5K20 B;  3M1V B;  5HQM A;  3HD2 A;  1B0T A;  4LFC F;  2EC0 A;  4Q5V A;  2KRR A;  4KPY A;  2OTL S;  5DDP C;  1T03 B;  3DOL B;  2HHH F;  3SMZ A;  2CAD A;  4C48 A;  3RB3 A;  3PIP Q;  1QE1 B;  5D4P A;  3BKF A;  1KEK A;  2RRA A;  1D0E A;  5A8W A;  5AE2 A;  1NKE A;  2FZC B;  1WEL A;  3GZ7 A;  3G2X A;  2GA7 A;  3NGD A;  4F50 A;  4PG5 A;  3GSD A;  4G6V B;  1YJ9 S;  4NA1 A;  4HVZ A;  2ZOM A;  1T8E A;  3NBP B;  4KGZ B;  2OO4 A;  4ZN3 A;  1ZET A;  1FXD A;  2CQH A;  2R7X A;  4PWU A;  1K47 A;  2ZJR Q;  2J0W A;  2IM3 A;  4FF3 A;  4ZLP A;  1MML A;  2LU1 A;  3LTO A;  5MAO A;  4LF6 J;  4MFB B;  3GJS B;  3ENV A;  1B3T A;  4C8Y A;  2L3M A;  1YBU A;  4YS2 A;  5KFA A;  2DIU A;  1KD1 T;  1R27 B;  3PY8 A;  1Y5N B;  4N47 A;  2C2O B;  1UVN A;  1U1O A;  1E6Y B;  1HKA A;  4A8K A;  2OUG A;  3TZX A;  2Q6B A;  4OI6 A;  1FT8 A;  4N76 A;  1YIJ S;  2OPS B;  1RAH B;  2E5H A;  5KFX A;  2V6A A;  1NM2 A;  5IT4 A;  2V8P A;  5H9E J;  4CDI A;  5LXY A;  4TU7 A;  4DUT A;  4KO0 A;  3M8Y A;  1FX4 A;  4JI6 F;  2R3V A;  1WF1 A;  1JXE A;  2CJB A;  3HJV A;  1RT6 A;  2R8K A;  4DV4 F;  2BXJ A;  2D3U A;  3TRG A;  4DL7 A;  4AQY J;  3MM9 A;  2GCF A;  2W9A A;  1U6B A;  4N77 A;  2YKQ A;  2F9D A;  3JQK A;  4XDD A;  2C1E B;  3MCO A;  2ERR A;  2HLT A;  1U1K A;  2A18 A;  1JLF B;  4C0H A;  3QNW B;  3G4S S;  2IBO A;  1FVS A;  4DSL A;  1S72 S;  4NI2 A;  3MMB A;  5DRK A;  1KN6 A;  4I1T A;  2BA9 A;  1ZTT A;  4ATN A;  4USM A;  3DRS A;  4PAA A;  1HQE B;  1KWM A;  1RT7 A;  3M8W A;  1X4F A;  1VOM A;  5H9F J;  1TFW A;  2UZA A;  3HP6 A;  1LW2 A;  1VBK A;  5IQQ A;  2YKO A;  3C6U A;  1VRQ C;  1L3K A;  1RAD B;  1BE4 A;  1RCO B;  1D8Y A;  5I3P A;  3BO4 A;  5J2N A;  2XMM A;  2LKZ A;  5SUH A;  3UNG C;  1SXL A;  1J2V A;  2I8E A;  2X1B A;  4WZM A;  1URR A;  4X4O A;  3MOJ B;  1WC3 A;  1FJC A;  4OHW A;  1UW9 A;  2DH9 A;  2DIV A;  4QWE A;  3TEG A;  2MKH A;  2HFO A;  1HWK A;  3NAI A;  4RW4 A;  3UCG A;  4TYB A;  4C2M A;  2KM8 B;  2LQJ A;  3P8B B;  1IKX A;  1LXJ A;  1RWU A;  3ZC4 A;  4UZB A;  1XMQ F;  3D3C J;  4WKR A;  2HGL A;  4TLR A;  2BRL A;  5KG2 A;  4JI4 J;  3TQ1 A;  3FVY A;  2XMU A;  3RR7 A;  4K0K J;  4X4S A;  4C0B A;  4R0E A;  3OXF A;  4WP9 A;  1OYE A;  1NCL A;  3LAK A;  1GTH A;  1M5P C;  2O66 A;  1S57 A;  4Q45 A;  1LWE B;  3CNQ P;  2JEG A;  3GJR B;  3AD8 C;  2YH0 A;  3EE3 A;  2YH1 A;  3MM6 A;  3MEC B;  4KFB A;  2V8G A;  4D3G A;  2ZHO A;  2KG0 A;  2XZD B;  2UXC J;  2AZ3 A;  1FA0 A;  4IFY A;  2FTR A;  3IRX A; 
#chains in the Genus database with same CATH homology
 2Y3Y A;  2NZC A;  2CA9 A;  2PC6 A;  3OD2 A;  3BKU A;  2WVD A;  3BKF A;  2F1F A;  3PHT A;  2WVB A;  2BJ7 A;  2BJ9 A;  2FGC A;  2HZA A;  1Q5V A;  2BJ3 A;  3LGH A;  2WVF A;  2BJ1 A;  2CAJ A;  3BKT A;  2BJ8 A;  2WVE A;  2HZV A;  2WVC A;  3QSI A;  2CAD A;  1Q5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...