1Q5YA

Nickel-bound c-terminal regulatory domain of nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
TQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Nickel responsive regulator
total genus 26
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5yA00
2CADA 3QSIA 2F1FA 2WVEA 2FGCA 2WVFA 3PHTA 2HZAA 3LGHA 2Y3YA 1Q5VA 2CAJA 1Q5YA 2BJ8A 2NZCA 2BJ1A 2WVBA 3BKTA 3BKUA 3OD2A 2BJ3A 2WVCA 2WVDA 3BKFA 2CA9A 2BJ9A 2PC6A 2BJ7A 2HZVA
chains in the Genus database with same CATH superfamily
2DT9A 3H0PA 4E2FB 1AA1B 1Q0NA 2AT1B 2HBQB 2MKYA 3AB4B 3Q0AA 4LMZA 2OIHA 1CSJA 3EGVA 3A4TA 1S6UA 3NG8A 3WZ0A 1URNA 1S1VB 3AY0A 2CPYA 2CNKB 3FEXB 2IRXA 3W9IA 1TL1B 1TAUA 2EG2A 3I56S 2X1AA 1WWHA 4OHZA 2PMZD 4YMEA 2DR6A 3P45B 1I94J 1NCLA 3HLUA 2AEMA 3BQ2A 1R8AA 3V6KA 4PR6A 4GVLA 4WCEQ 5GAEU 3FSYA 3GFZA 2QG9B 1ZM2A 1RQ0A 2DJWA 2GAHC 4ITSA 2DKOB 1FNOA 4YDXA 3ENQA 2VQEF 1VOMA 3OT9A 2FY8A 4TU9A 1EQ0A 1PKUA 1SPBP 5F8JA 2BW7A 3PJWA 2MSTA 3SIPB 5J2NA 1HNVA 3S8SA 4WFNQ 4LSNA 4O4GA 5GAEI 1VIOA 2W2NP 3KHHA 1HR0F 3C2PA 4DLEA 1WF2A 3QZ7A 4M63A 2UUCF 4WK3A 1HQ2A 2LDIA 4DUYF 2V9KA 2MKJA 3AD7C 4YR2A 3DM2A 4TQRA 3I55S 1T8EA 4DR4J 2EI5A 5KFDA 3W5ZA 2R7OA 1N0UA 3QFWA 3MMBB 2W8LA 1HYSA 5D4NA 2H65B 5DG7A 2FGOA 1RT1A 3D1QA 3AA9A 4HHJA 4ZCMA 4Q8FA 1X60A 1JJHA 3WBZA 5HATA 3OJSA 5HMXA 1MWZA 2PD1A 1N0VC 1SKRA 1VR6A 5HN0A 3DOKA 3A3PB 4DU7A 2CQ3A 3OTOJ 3V6JA 2EFOA 1RAFB 3R3TA 3VVTA 3H4DA 5MAOA 2DISA 1UEKA 4G1QA 3DFEA 2O66A 1SJ4P 1WI8A 4DPWA 2BQRA 1RDRA 2GQQA 2WAQD 3EGNA 4AQYJ 2FGCA 4XIUA 2BVZA 2HHQA 4MYUA 2WVFA 3M8SA 5LSRA 3EZUA 3O5TB 2OHDA 4CRJA 1LNQA 5FIIA 5EN1A 4C0HA 2W2MP 1DY3A 3H7HB 3PEJA 3AH6A 4X84A 1LWEA 4EMDA 2AGPA 4CYUA 3M8ZA 2ZKTA 3LP0A 3QT6A 4QBUA 1K0TA 2B4UA 1WEZA 2WHOA 1QAJA 5F8GA 3EXYA 5DGAA 4MKBA 2B5JA 4IFVA 4DJBA 1C0UA 3EVWA 4RW6B 5KG1A 3GONA 3CJ5A 2IM0A 3NKYA 4H4KC 2GV1A 5IV3A 4XDDA 2CUYA 1DTTA 2DNYA 2DTJA 3JQJA 1RISA 3O3LA 4N8NA 4OJ1A 1LWFA 2DIVA 2FHJA 1S1XA 1TL4A 3OFEA 4DV6F 2ZBRA 4ECVA 2E5LF 2FVSA 1MSWD 3AJ2A 2JNJA 2J9CA 3VVUA 1NSQA 4RUBA 1A9NB 1TP7A 3BM7A 2JHEA 4J9UE 4NZ0A 1VLOA 1NDLA 2F1FA 2NCKL 3OR1A 4ES3A 5K8PA 2KM8C 2XBPA 4OZ5A 1NH7A 1Q7YT 1WC0A 3VGTA 1J27A 2AIRB 3R8YA 4BC9A 3WX8A 1R8HA 2KHDA 2YX4A 2HRUA 3UR0A 4TLRA 4LF4J 2Y3YA 2FZKB 1J5OB 1IKYB 1N8RT 1VQYA 2C2ZB 2HFUA 4OYAA 3ADAC 3HVAA 4QPTA 2XMWA 3T5KA 4BBYA 2A18A 5DDOC 2FJBB 3HDSA 3CJSA 4L73A 5CCMA 2R7XA 2ZH4A 3OL7A 4MMOA 3AOAA 2R7SA 1VDHA 2A1BA 1S7IA 2FZGB 2GHPA 2HWIA 1WDTA 3M8QB 3QQCD 3CCVS 2OPQA 3UCGA 3I9V9 5E3CA 1FEEA 2CQ0A 1HLWA 4J9VA 5BJRA 3HHKA 1VYAA 4DFKA 1HBOA 2AQ4A 1T3NA 2EFNA 2VBWA 4W92B 3M30A 4K50A 2IRUA 3VAHA 2V50A 4ES1A 3FBFA 5LJ3Y 1CJTA 2AJ0A 3MOJB 3HSDA 3RR8A 2VONA 5LL6d 2DNKA 4OYMA 4LF9J 1RAHB 1TTHB 2Q3PA 3CO0P 3DRRA 1RTDB 2V8PA 3H2UB 5D15A 2NXCA 1WHXA 5A6PA 2ZH9A 4B3RF 1HD1A 3HFKA 2AZ3A 2ZHBA 3ZTOA 3DN9A 3IWXA 1S79A 1U7LA 1Y5NB 3NBPB 1R0AB 5LMUJ 1U4BA 3KJNB 5G0RA 4Q44A 2IJRA 4JI8J 3SEOA 3BDPA 3WQPA 3MEKA 2YX7A 4UUWA 5SZTA 4DUZJ 1KNZA 4RNHA 5KFWA 2DNRA 2DY1A 1LW2A 2ZNZA 1NHVA 1RTHB 1FD8A 4ERDA 3GZ7A 4DF8A 2VG5B 1S6PA 2HVZA 3F41A 4I6WA 4YOEA 4DPXA 2GAGC 1KLNA 3D66A 3NWRA 3BREA 4JBCA 2KM8B 4QWAA 2E44A 2XLJA 4A8XA 1B70B 3LGMA 1XN9A 5L8RC 3VGVA 1IBLF 3LPEA 3QSIA 1LXJA 1YVFA 2RDIA 3QO9B 4FKXA 2BE2B 4K2XA 4LF4F 3HK2A 2I1RA 5KT3A 5A8RB 4PYDA 5T14A 4HLBA 3MM9B 3O6QA 3DMJA 3Q89A 5C2CA 5CD4A 3DRSA 4IOAQ 4K0KJ 2K1RB 2WOMA 1S48A 5CZXA 1RT7A 4ED4A 2ZE2B 3H5SA 1VRUA 4C2MA 1FK9A 1R6YA 1UFLA 4CLFA 2E5LJ 3CDBA 2OSRA 1VS3A 4PXCA 4TYAA 2RU3A 5IT9U 1H7XA 2J0XA 3IWNC 2I8EA 4P2XA 4PWUA 4F26A 3MZIA 3K57A 1EKSA 1KHWA 2CQBA 1HPZA 2YPYA 3ICLA 2VKZG 3PCOB 4ZVSB 4DX5A 3R6GB 2DNMA 3MPDA 3T41A 3TA0A 2GO8A 2QFIA 3K7RA 4A48A 5KFHA 2BOPA 3KUEA 1QAIA 3D6MB 1TKDA 2M3DA 2BKOA 4DR2J 4FXDA 1RTIB 1G1XA 1SJ1A 1U02A 1ZA2B 3HJVA 4P2MA 4PWWA 5KFNA 4YFUA 1TQLA 2YNGA 3IWLA 4KGXB 4AE5A 4GKKF 1G4CA 5DM7Q 2V63A 4NA3A 2JJ4D 2Q66A 2V8GA 1KFSA 2DEJA 1NU4A 1C4CA 1RACB 2Y0BB 4H4OB 3UI3A 2JEJA 1VJQA 3EDQB 4CWBA 3DLEA 1JLCA 4AT1B 1QE1A 2XO7A 4J9PA 4A8OA 1E6YB 4OHYA 4CDIA 3LP1B 4WPAA 2XSFA 5KG7A 1NM2A 2ROPA 4Q7AA 3OFGA 4TXSA 1IR0A 1H73A 1M5KC 2ZHOA 2LFVA 1CJKB 1AT1B 3KMQA 3FMWA 2GA7A 3HMJG 4CH7A 3VAJA 3BN7A 1H7WA 1PJ6A 4FNIA 3JSYA 4OYPA 3OL6A 2EXUA 1FKPA 1S4FA 2P9GA 3DOMA 5F8MA 1VI7A 5I42B 2LLZA 3WDOA 1LK7A 3MEGB 5KG2A 3MWBA 4ECUA 2LU2A 3NWGA 1J5EF 2PGCA 2YQ0A 1ZOTA 4YB6A 1XMQJ 2YKMA 3H4BA 2HQGA 1YBAA 3VAMA 4PQAA 1NKEA 3ZZZA 3DKDA 3RAQA 3R5BA 4EFAC 3MECA 5ADZA 1IKXB 2K06A 3G82B 4MKAA 4ZPDA 3G6XA 3KHGA 3EPIA 1WEYA 2VD3A 4USKA 1XR5A 1N5TA 1YJ9S 2R7TA 3B8HA 1UJ6A 4C8KA 4Y2IA 4P71A 4JI4F 4JI3J 5KFVA 1TL1A 1FESA 2LEPA 4K0KF 2CA9A 3K2YA 1FI4A 3UD5A 3GILA 5KFZA 1M5VC 1QY7A 4PG4A 3VTIA 4UOCA 1AROP 1GMWD 2DHXA 1WHWA 4UF4A 4O23A 4CO1A 3HF5A 3CJKA 2QTWA 4YEAA 4F4WA 4I2QB 4YN3B 3SCKE 1LW0B 4USVA 2XYGB 2GJIA 2UVUA 2FHKA 4PG7A 4ED0A 3ZTPA 2BM0A 3KNGA 4AUKA 4X64J 3UN3A 1FRMA 3KLGB 4DWIA 2VG7B 5HJXA 1MMDA 1P6TA 3DLKB 4X66J 5K14B 1JJ4A 4LSNB 2YKPA 2H51B 3HFZB 3ISND 4ZIWA 4OJGA 2X1BA 5HVGA 1HW9A 1FERA 2AJ1A 3RBZA 4P9SA 1RKJA 1CQNA 1RKIA 3RZAA 3RYLA 3Q8SB 2UVWA 2BE7D 4DSKA 2G13A 2Z57B 1U1QA 3W63A 3R1HA 1AUSL 5G4DA 1N32F 4H4MA 3DRYA 1D8ZA 2WW4A 1HYSB 3MR2A 1FO1A 4O3NA 4WBFA 4DX8H 3M7VA 4IH7A 5EHHA 5L1LA 2OI2A 3K0JA 1O5JA 4EZ6A 1A7GE 3CPWR 3EVOA 4DV1F 1KC8T 2E7VA 1HBMA 4Y00A 4QWCA 3ITHA 4UY8T 3SQGA 3GIMA 1T05A 2EG1A 1B99A 3I0SB 4JV5J 3UQSA 2XYPB 2XGQA 3D0IE 4O44B 3ISZA 4DSLA 4OYIA 3TAMB 3FDSA 3LF0A 1S6OA 2DNPA 2V68A 3BKTA 4X66F 4DQRA 2KB2A 2DCLA 4C3KA 1RHUB 2D9PA 5KFAA 2P6SA 4YY3F 1Y3KA 4F67A 1S12A 2KN4A 2FVCA 3KLFA 1LWEB 1T9TA 2W4PA 1PC5A 3LP0B 5F3ZA 3BR9A 3H5YA 3D9BA 1AYEA 4TY8A 5E41A 2BR0A 1WD6A 1EAYC 3V4IB 4IFVB 1FFWB 3CMAS 1C0UB 4RW6A 4DL6A 4CO3A 3LAMA 2E5IA 3HHLC 2G1DA 2N4CA 2HHVA 5DG9A 2F63A 1DTTB 2QZ8A 5AE2A 3D3BJ 4CTAA 1ZPWX 1OJ4A 3EYZA 1LWFB 3UD3P 1XIQA 4BLGA 2UXBF 2MQOA 3IAS9 4MFBA 1CC8A 3SCLE 3SYZA 1KP6A 4K4ZA 3DLGA 4OYBA 4MIWA 2GHVC 2HAFA 4J9SA 4F02A 2UVRA 2B7CB 2DK2A 2VFUA 2CPHA 1SIWB 3NCPA 3KK3B 2Q43A 1T7PA 4MIAA 3VF0B 5C24A 2KFNA 2W4CA 1HNZF 4FBUA 2M70A 1JJ2R 1N34F 2DHGA 3N6MA 3ZTSA 1J5OA 3UD4P 4DFPA 3C15B 3GJQB 2V6AA 4USWA 2YTCA 3IRWP 2C2RA 3MM7B 5F9LA 2P5VA 1J5EJ 2NR0A 3Q86A 1MWYA 2HRTA 3HVWA 4I7FB 2BV3A 3M8QA 4NLPA 4YB5A 1NPKA 2CJYB 2HGLA 2QYGA 5KFIA 3PNIA 5HO4A 3QZ8A 4NLTA 2GIQA 1SKWA 3GIRA 1BC6A 3TOQA 4X4TA 3R2DJ 1S0OA 2YNFA 1GX5A 5F41A 2DBBA 5L9NA 4PG5A 4PG8A 3A3NB 4UUXA 3RW6A 1MROA 1WF0A 3UNYA 4ZJLA 5LMNJ 4IYQA 2IBKA 1JIHA 2BYCA 2R7WA 2UXCJ 2OEMA 2LA4A 1JXEA 4DR4F 1FWKA 4DQSA 2V8VA 2V67A 4NYPA 3EJMA 3NBPA 2APOA 2ZZNA 5KFOA 2P9CA 4ZPWR 3RRGA 1D09B 2QRRA 1RT4B 5HBMB 2VC0A 1TK5A 2W7PA 3KOAA 1ROFA 2HSEB 3DGVA 3FUYA 2DR7A 3G8QA 4ZOSA 2KZMA 2DO0A 3GFYA 1IR2A 3FBBA 4QR2A 2IJFA 3A8KA 5C25A 2EFQA 3G4SS 3K58A 1F9HA 4U7UK 1LW2B 3LW5C 4LFAJ 3MUTP 1H98A 1TKZB 3D28A 1RTHA 3M32A 1TV6B 4NLQA 1FKOB 1FEHA 1FTCA 1PYSB 1S59A 1UWBB 2NXUA 4NYZA 2R2SA 3EVMA 3FBEA 1NSAA 2RVJA 1MU2A 4WIIA 4RU9A 5HJYA 1SKUB 4JI5F 3KFWX 4A8MP 2NYIA 3HHLB 1DHMA 4URQU 1RBLA 3IR7B 3KXDA 1KFDA 3LA0A 1M1HA 3DMJB 3ZZOA 4B17A 3TZXA 4X4RA 4IR9A 4PQUA 2K1RA 2VFRA 3RB4A 3DDIA 5D77A 1NXIA 3A3OB 3RR7A 4NI2A 1EX8A 2QFJA 3PX0A 3JB9k 4PCQA 4B3TF 2WSCC 1IKWB 4LSLB 3SSSA 2FLOA 1OPIA 3N28A 3UDLA 4F04B 5A2QU 2NREA 1TVRB 1WG1A 5A8KB 1P8GA 4JI2F 4FF3A 1PSDA 1QUVA 3CJTA 1HPZB 1YLXA 1K44A 3FQKA 5JXSA 4DSEA 3MM8B 1RT5B 4NPOA 5IT4A 4R5PB 2CXEA 3GR1A 5HP1A 5M2UA 1UA0A 2YQ1A 1TL3B 4F50A 5HMZA 4M5KA 1FRKA 3C19A 4DUZF 1UA1A 1CJUB 4UOHA 9RUBA 1RK8A 4WF9Q 3LP2B 3CCJS 2D3OR 1HFEL 1U0SA 4QZVB 3R5JB 4E8UA 2JX2A 2OD6A 2E7XA 1VBZA 2GVDA 3VCDA 5CYJA 4XPEA 1NKBA 2AX0A 3TVZA 3DLEB 2QYCA 2WB4A 3KK1B 3K5LA 1QE1B 3RW7A 3PHTA 4PXEA 3R2CJ 2CPDA 3LP1A 4ZPVR 2AEJA 4DG1B 1X4HA 4U95A 5F8LA 4LF9F 4CO4A 2DNOA 2OMOA 2XMJA 3DHWC 2HBYB 2DR5A 2J9DE 2E1AA 3GU0A 2EWHA 2IDEA 2XHCA 4HKQA 3QJLA 3RBDA 5DS7A 5GAGU 5GAHU 4RNOA 1FKPB 3MTKA 2WBMA 2MGZB 4N7TA 3CF5Q 5B0EA 4HDHA 1BQNA 4IG3B 2ZWOA 2QN6B 2OMLA 3MEGA 3TVYA 1ZA1B 3M6UA 1HNXF 2KH9A 2MQNA 1LWCB 2H4YB 1U0HB 3C8YA 1XTZA 4ZPTR 5B0GA 5KT7A 4KHPF 1Y10A 4Y2CA 4HVZA 2B6AB 1U8WA 2GMJA 3MECB 4OHXA 3ZZ0A 1IKXA 4JI4J 3HHEA 1HHTP 3SV4A 4IFYB 4USUA 4CI0B 1N36J 3F44A 1Q1KA 2H48B 4IDKA 4KT0C 3ZO7A 4NXNJ 2V0NA 2JOQA 3HKZD 3KHLA 4LFBJ 1C1BB 4WTOB 5H9EK 4K4XA 4ED5A 4WP8A 3BBFA 4YDDB 5CXTA 2KO1A 2Y8YA 1C0TB 3O44A 3IGNA 2WZ1A 3H8YA 1SUQA 1WJ9A 4OZLA 3R5DA 5F3TA 1RWKB 1U6ZA 1UVKA 3CJKB 1VFJA 4HH1A 2KXNB 1QAXA 2A6OA 2V5HG 2WVDA 3M1VA 1X9WA 4J9QA 1H2UX 3V4MA 4QQBA 5J2PB 3PYDA 4MKYA 2ACMA 5B0DA 3T6BA 1YHQS 3MOZA 1XJWB 3FRYA 4L6V3 4OYWA 1TMJA 1F5CA 2CQHA 1OYDA 1Q8BA 2XZDB 3DLKA 4KHRA 4PEOA 5E3RA 4X4PA 2G2OA 4AQYF 5F8NA 2RJZA 1U1OA 2FJXA 2OP5A 3LAKA 4QWEA 2MHEA 3VHQA 3GFHA 4MK7A 5C7PA 2CPJA 3OTOF 2Z58B 3BJYA 3I5AA 3KJFB 2HHHJ 1QAYA 1IM4A 5C2GA 3NLCA 5LSLA 1PO6A 1TKTA 5A8WA 4YR0A 3MHYA 2ZBPA 1QM9A 4H4MB 3T3FA 2EC0A 4DR3F 3POTB 4MIBA 3FJ2A 2L3MA 3PIPQ 3W7BA 1H2VZ 3SCJE 2QO3A 2VQFF 2HGNA 1W26A 2OJ3A 4GKKJ 4RWXA 4JI0J 2DHAA 4HTJA 3P49B 4UZCA 1R27B 3J81j 3OR2B 3PJXA 3PM9A 4QR0A 4Q0BA 3ITHB 4A8SA 1NDPA 1Y00A 1H38A 2JEGA 5IWAF 3LPYA 1RLDA 4HYKA 3CMQA 3CMES 1Q16B 1RT6B 5C5JA 4O0NA 3TAMA 3MMJA 1KRPA 1FXDA 2PFDA 2VBXA 5GMEA 2R3VA 3GV5B 4KJIA 2RF2A 4B02A 5D0HA 1IR1A 1WKKA 4XPCA 2VQEJ 1HWJA 3CJ3A 1NLKL 3TEHB 1BQMA 4USTA 3N6LA 4UQGA 3QT5A 5J1NA 1ZAVA 5DETA 2QLJB 1X4BA 2E5GA 3Q24A 4M5HA 2BJ3A 3CCTA 1T9YA 3A1YG 2MKIA 3CWJA 5LMNF 3D2WA 2RT3A 5BYRA 4KH0B 1S0MA 1IBLJ 3ZTRA 1T0TV 1Y4ZB 2BJ7A 3RB6A 5ETVA 4M5DB 3HVTA 2J7UA 1H3DA 4LRDA 4YP3A 4OZ0A 4ANEA 3V6DA 1VQ7S 4QIEA 3KHRA 4F4AA 2P2CB 3D3CJ 3C6TA 4OIXA 2VJVA 5JJBA 3GCXP 4U8VA 4DS4A 1UPMB 1SL0A 2XB2D 2ZZTA 3UVJB 1M1GA 1X4EA 3MTJA 1Q5VA 1V5IB 1I51B 2DRDA 4R0JA 2M0GB 2L41A 3CVKA 3J80Y 2W1BA 2MQPA 2XY5A 2R2TA 1KVKA 3W8GA 2NYHA 3CB4A 2BJ8A 3C15A 1NJWA 3RUBL 2H3EB 4U6PA 3MM7A 4NCGB 2CQGA 5DJBA 1VRQC 3U1LA 1NHUA 3W61A 3HP6A 4I67A 3LWLA 3C66A 4J9KA 2CNLB 1RYRA 4QU6A 4ZITA 2CJBA 3G2XA 4A8KA 2FJAB 1N48A 5ETOA 3RGIA 5HI7A 4PWDA 4ECSA 3PW7A 3MM5B 2DGUA 4HHUA 2ZNYA 1S1UB 3K5OA 5D0RA 4DR1J 1MROB 1WC3A 2W25A 3MM6A 5KT4A 3JYTB 3FCVA 2ZD1B 4ZVPB 1TUVA 2ILZA 2R2RA 4QR1A 2J6SA 4ECQA 5DDRC 1HL6A 2DXFA 2MJNA 2RQMA 5EDWA 4EI2A 1JLEA 1DURA 3NY0A 4B3TJ 4LFCF 3MFIA 2QSWA 1U6BA 3T5LA 3P6YC 4DR7J 4M5MA 4WKRA 3WHIA 4CLTA 1N5SA 5C25B 1QVGR 4JI1J 3D4JA 1GH8A 2B4PA 1BMQB 3NRBA 5SUHA 2DXEA 1TV6A 3JTOA 3CT9A 3BYRA 1G3OA 3Q83A 1IN0A 1UWBA 5LM7E 3EXCX 3SV3A 2HG4A 2ZOGA 5DQIA 1Q4RA 2HHXA 2ZEJA 4LVOP 2CZVC 1N32J 2J8SA 1YI2S 2DGVA 1PCAA 3HSGA 4O0IA 3CC2S 5I3QA 2FVQA 1RT2A 1HBNB 4NZ7A 4DS5A 1ZTWA 4PPDA 3EZ5A 2VICA 1A6LA 3SSQA 5T7LB 1KTVA 5E7OB 3FEYB 4K5RA 1FFSB 5F8IA 3OTCA 3UCZP 1TAQA 3OJUA 2DPJA 3BGLA 3T1YJ 3E51A 2MQMA 2ZKUA 2CJKA 1NH8A 1B4SA 3G8TA 2FD2A 1JLQB 2XG8A 1KHVA 3A8JA 2D9OA 4J5OA 1YG0A 3BO3A 1F9EB 3ILOA 4EU0A 3C6UB 1TL7A 1HI0P 4U7UD 1WG4A 2ZC3A 3FBCA 1JK9B 5A8KA 4QWBA 2KRBA 3P8BB 1I6JA 5J1EA 3PVXA 1RT5A 7FD1A 2BA9A 4AD6A 3MMBA 4IG0A 1CULA 1SH3A 3P5TL 4LJMA 5HP1B 1S9FA 2UXCF 2XSJB 2B4OA 1RT1B 2IYGA 3BSNA 2VOPA 3FFIB 2GIRA 2BEFA 2VPXB 3EUNA 2GVZA 4R25A 2FIUA 3PW2A 4KKOA 1CJUA 4RWWA 3IA0A 4BWJA 2RDDA 3DOKB 2HW3A 1RAIB 5KT5A 3LP2A 1N88A 1T9WA 2GVDB 4ELVA 4WTYA 4WXWA 4YUDA 2RQKA 4YQWA 1ZM3A 3L7OA 1IQTA 4ANCA 1FJEB 5EX0A 1C2PA 1YWXA 2Q6BA 1FRJA 3V81A 3TANA 4LQ3A 2OKQA 3X3UA 4ZN1A 5IQQA 1FDDA 4OMFG 5IQ6A 2HYIB 1KKHA 2CPFA 3D1OA 5LXRA 2W24A 1WTFA 3SFUA 1MG7A 4CYUB 8RUCA 1C1CA 2G2YA 1F1BB 1Y0HA 3CDEA 1BWVA 2GIFA 4ZA1A 4DZDA 5DDPC 4DSFA 1JB0C 4FF2A 4M5JA 1Y5LB 3MR3A 1RWXB 5THWA 3BSAA 5CHCB 2AGOA 2C2NA 3PV8A 2ROGA 4GKJJ 1XMBA 1YGYA 5D0GA 2EKNA 4F0MA 3RB3A 4FPIA 3TAPA 3J7A1 2UXBJ 5A2QY 1S1XB 4CLZA 1VC5A 2MKKA 1IM6A 4DV5F 1X5PA 3LGNA 3NGKA 4K4TA 3GYXB 3GIJA 3VZHA 3G6YA 2J9DA 3IGVA 5ETRA 2RRAA 3JTNA 1BQXA 4DMZA 4A46A 3JQKA 4RUHA 3VAFA 4ID8A 3QATA 4RL1A 2CKWA 2J9EA 2MKCA 2MZTA 2NPIA 1S99A 2JC0A 1H0HB 3M9OB 2V2KA 2UXDJ 3GE9A 4DZ6A 4IDKB 3OLBA 4G6VB 4B9TA 2XLKA 4DX6A 3HI9A 3NAIA 4QIVA 1C1BA 4MTPA 2ZVIA 5K20B 2KVIA 4DV4J 2RUGA 2C2KB 2HZAA 1M1KT 5DRKA 4C3MA 1WG5A 2XC9A 1S57A 1SUQB 4S0MA 2NUHA 4DL7A 3H2LA 4RNFA 1VQPS 4IUFA 4ECYA 4NCBA 3K8WA 1HBOB 4CLKA 1U1PA 2ZH6A 1NBEB 1R7IA 4X65J 1MMNA 3PJ9A 5H9FJ 2VHGA 1UVMA 1BWEA 2V2VA 5DO2A 3EX7B 1RT3A 2C2EA 3DRRB 4J37A 5E0OA 4ED6A 1CEZA 3AJ1A 3I4PA 2GQCA 1V3ZA 2F9JA 3AAWB 4ZVQB 5DLFA 1CS4A 3KK2A 4O3SA 3CNQP 1U1MA 4CT8A 1HQEB 5HVHA 3JSRA 2B43A 3QLHA 2B9YA 4LRAA 1RUSA 2UUTA 1WC6A 3TQEA 2DRAA 4C4WA 1RHQB 4ZP8A 4RU2A 1NK6A 1U24A 1UMJA 2D3UA 4OI2A 3C16B 2AYBA 1PJ7A 4DL2A 2WK4A 1UVJA 1RCOB 2VPYB 3SDEA 2B7BB 3AD9C 3BZQA 3LO3A 3POTA 2HEKA 4C3LA 2VODA 4NEZA 4AL5A 1P1LA 3B78A 4UY85 3C14B 2KTQA 2PMHA 2RKIB 2E7WA 4Q0BB 2QLWA 4UQTA 1AB8A 3TA1A 1N5YA 3PYFA 2L9DA 3I0RA 2IDLA 3ZZPA 3DI6B 3JSMB 2HAIA 4P7TA 1X8DA 2BE2A 2DGQA 1FVSA 4MJKA 3PDNA 4OHWA 4CM2A 3MM9A 3VR1A 1HIYA 1EB0A 1FF2A 3DRSB 2R8IA 4OX9F 4EYIB 1NPRA 2WOMB 5B7WA 1WOSA 3ZZRA 3CC4S 3LUYA 4FNHA 2ZE2A 3ZTQA 3F0NA 1U1RA 4LRCA 1HNWF 4OFZA 2AD9A 1RB0A 1GX6A 3R7BB 1JLAA 1HHQA 2M8HA 2MZSA 3M6XA 3W3SA 3ULHA 3OHBA 2KYXA 3LQVA 1UCNA 3OPKA 3MR6A 2F4VJ 3DCAA 4CO5A 1N52B 4C48A 5AJ3F 2NS1B 2Z8QA 2UUBF 4X4UA 5KFGA 1HW8A 1K9MT 2CJAA 4F2SA 3TUPA 1U09A 1N6QA 1VQ8S 3DYAB 5LXYA 4HL9A 2Y9HA 3V6DB 2KVQE 2ZVSA 2KRRA 3CCQS 4A8WA 1Y3JA 3PHEA 5JVGQ 1JLGB 1HI8A 2YNGB 3BGUA 3BBBA 5KG3A 4RUCA 1SCJB 3Q8UA 4LF5J 3UVJA 1F60B 1HHSA 1G7CB 2ASLA 1D3WA 1SJRA 4IH6A 4H4OA 5EGYA 3L09A 4URSA 3CDAA 5ETPA 5IM0A 4EBEA 3PW5A 2QMUB 2ZH2A 3S6EA 1EZZB 2XTJP 1X4DA 4IRKA 3H25A 2MY7A 1LWXA 4FN5A 2ZJRQ 1FKAF 1WSRA 3M2RA 3UDEA 1CJKA 1XNQF 4DF4A 3C46A 4TU7A 1X31C 4DDFA 1KBRA 1I1GA 3HSZA 1XNQJ 1M5OC 1FWLA 1O0PA 4MK8A 1U45A 2OH2A 2MLXA 1RWUA 2HWTA 3MDFA 3OL8A 2LQ9A 1M5PC 4M95A 4IO9Q 3NCRA 4N47A 4JV1A 4AL6A 3MM6B 4PUOB 4OQJA 4RNMA 3T19A 1RAGB 3JYTA 1HQUA 4HACA 4IH5A 1QTMA 3NOCA 2YKMB 1UW4A 2IC3B 3GP9A 4F0KA 3Q2TC 2PE8A 3QIPB 4EGLA 4Q43A 2Z30B 3NL0A 2JDJA 3C3LA 4LF5F 2EVZA 4M8LA 1JLEB 3M6VA 4DFMA 4Y6IA 2MSSA 2C3OA 1UKUA 1KD1T 3DDKA 2J5AA 2EBGA 3QYYA 2J0QD 4DI6A 1SXLA 1YJNS 2CJQA 2DEIA 2AGQA 3DRPB 3T1HJ 2XMVA 2IAJB 1FE0A 2HWHA 2Z2ZA 4GVBB 2E9RX 2UUWA 1F0XA 3Q8QB 2PEHA 4MYTA 2BM1A 4QW9A 4NYOA 4K4SA 3DXBA 1WSVA 3CSKA 4I2QA 4L3KA 5LSOA 4C8NA 3W9JA 4F0HA 1HNWJ 1QD1A 3DLBA 3T6JA 2BOAA 5HANA 4LF8F 1Q79A 1R89A 4OX9J 2C2OB 4ECWA 5CAAA 1GFWB 2VG7A 3AXKA 3IRXA 4MKVA 4K4WA 3VAKA 5K14A 3MGJA 4OX8A 2C22A 3TI0A 4FBTA 2FDNA 1F3FA 2OD4A 2W9CB 1X4GA 3JSBA 4NRUA 2R7VA 2GS8A 3HCXA 1TL7B 2YWHA 3GMGA 2CAJA 3CUNA 1KDNA 4CNYA 1S77D 2KG0A 4LF1A 2MLZA 2VFTA 5J1EB 2PSZA 4WE1B 4ZK7M 1IJEB 3UCUP 3ENWA 2R8GA 2HPUA 2V2ZA 4KH1B 3QJPA 2J0SD 2LQBA 2G2ZA 4DL0C 2DB1A 1ZZNA 3VALA 4KKOB 2XS5A 3KLHB 1HBMB 4UW2A 3N6NA 3BYPA 4NLWA 2H54B 3N4WA 1FHTA 1IWAA 3H5UA 2IIHA 4WU2A 4A8QA 3G6VA 2B9EA 2GHWA 4Y65A 2H9ZA 3TUIC 4USMA 5KFEA 1RXOB 3RG6A 3MI7X 2N7CA 5H9FK 1JWWA 4F25A 2A2CA 1XC9A 1IBCB 1RHRB 1ZAWA 3LOUA 4YB1P 4V19X 2NQPA 3MMAB 4N8OA 3VZIA 3ENAA 3M4XA 5KFCA 4ZLJA 3P4UB 1V5VA 2D3O1 1X7VA 1Q82T 4X2BA 3CCWA 3LWMA 3MCNA 5DM6Q 1VC6A 3Q8YA 1RAEB 2ZITA 1O6XA 1SJQA 2W7OA 3RAMA 5D3GA 5BR8F 1Q8LA 1L3KA 3V4IA 1HA1A 1UZDA 3OD2A 1RADB 4OI4A 4E0DA 2VASA 4JI7J 4FP9A 1T11A 1WORA 2DY9A 3UW1A 1DTQB 5FD1A 5CQGA 3D1HA 5K8OA 2EC2A 4DV6J 1XNRJ 2RAQA 2XYHB 1SH0A 3R9LA 1L5UA 3GB0A 1TZ0A 3KG4A 4FPRA 2D69A 4JOUA 2LXUA 3RU0A 4KIAA 1X4FA 2AEFA 4OJ3A 1W25A 3S7RA 5EWFA 1T03B 1KQSR 4I64A 2RIJA 1FTRA 3KLIA 3OXLA 1FJGJ 3PYGA 3GYNA 1UEUA 1SC3B 1TKXB 3TA2A 5C24B 1NZ8A 5CA5A 2FHMA 1ZBTA 1FWPA 2VPWB 2ZBIA 2BW2A 2DH9A 3PR4A 1CJVA 1FXRA 2YWGA 3I6PA 3UR3C 4LR9A 2IA6A 3CIZA 2GO9A 2EFVA 4B3MF 2XY7A 4WFYA 1DZ5A 2ZJPQ 1GEHA 3SCIE 2XCAA 1FXLA 4CLYA 3W60A 3I82A 2PI5A 1RHKB 8ATCB 2LP4A 4I56A 4PZVA 4LIRA 1B0VA 3D6FB 3QGIA 3RBXA 5A0YB 3PXGa 2OTLS 3GJSB 2CJXB 2Z56B 3BH7B 4OYXA 5B0AA 3U02A 1OQ3A 1RBOB 5KFTA 3BV8A 3CJQA 5E5NA 5HMYA 1NK5A 1NK0A 2K3IA 1HKAA 1MNEA 1CS4B 2VH7A 2IRYA 4P73A 3KK2B 3NEKA 1JMTA 1HBUA 1HQEA 1RJJA 2C3YA 3DGPB 5AXLA 4UZBA 2J0WA 2O1PA 4P6QA 3U7JA 3QJJA 2EKYA 2AX1A 1RA7A 4EBDA 2MB0B 3MURP 5HBMA 3TEGA 2LXIA 1GTEA 3GG1A 4DX7A 1JLFB 2MPUA 2OPSA 3IFEA 4CQ1A 3SDEB 3MFHA 2W9BA 2UUAJ 2H5IB 1X9SA 5LJ5Y 3RJMB 2AZ1A 2M88A 3FCHA 1SC1B 4DCPB 3OTDA 3FSXA 1YX2A 3G6ES 3M8PA 2QA1A 3M32B 4J9LA 4QPXA 4EO8A 3T5HA 3B4MA 3M2VB 2GZOA 2RKIA 3TUJC 4KC5A 3EPGA 2FVRA 4K4VA 3P3DA 4Q45A 1LKZA 3PYEA 4UTGA 4MH8A 1TR0A 2XMUA 1XQIA 3KG0A 1N5YB 4KE5A 3FKBA 3G8SA 2DR9A 3DI6A 3JSMA 1NK9A 2ZFHA 2IY5B 2HFVA 3UDVA 1TUWA 2V4JA 3CO9A 3W5XA 4DV2J 2IVFB 3KG1A 4ZP6A 1S0NA 1TFYA 4F3MA 4PQUB 2LU1A 1OWXA 1NJYA 4XK8C 2ADCA 4DPOA 1RWMB 2A6MA 2EFGA 1YZ7A 1WNEA 4DUTA 4ANDA 1OY9A 2L48A 1B0TA 4NI2B 4TVAB 1HNIB 1AW0A 5IC4B 1IKWA 4LSLA 3H40A 1SQFA 1RE1B 2FJDB 2KT3A 1GXTA 2M7SA 2BJEA 3IBFB 2XMKA 4PYAA 4DOZA 2Q6CA 4NA1A 1HWIA 3AFGA 4XTTA 4KBIA 3QT8A 2B9XA 3FQLA 2VJUA 5HVFA 4B9MA 1T9UA 2I9SA 2PDAA 3AD8C 2K2PA 2X3GA 3DYAA 3LH2S 4RBVA 4ED8A 3VAGA 2E1CA 2FY1A 1TL3A 3NXZA 1FDNA 3CW2C 3CDWA 2IM1A 3TO8A 4EWTA 4WFZA 5H9EJ 2K7JA 3BPSP 1RTZA 2U1AA 2YVSA 1VRTA 2HNZA 2OPPB 1OS5A 3VV2B 2RHSB 4F8RA 3GPAA 1OIAA 2JRSA 5DGBA 1S10A 2J8AA 3OVBA 3BR8A 1FA0A 3H20A 4IOCQ 2ZH1A 2WW8A 5AT1B 5IOLA 2HFZA 3QWPA 4DG1A 4CZCA 2GX8A 2U2FA 4QYZJ 1EJ7L 2HIYA 2LEBA 3EGZA 4J91A 4RW9A 4RW7B 3D68A 1UEVA 2JZ5A 1FD2A 2MJUA 2CWKA 1YKWA 1JQGA 2QT7A 3J7ZT 3EMTA 5EWGA 1NK4A 4QCLA 2BQ3A 2I5JA 5DZ6A 3NOGA 1ZH5A 1UAWA 1NEEA 4H54A 2KXFA 4ZPBA 5DG8A 2KFZA 4IG3A 1BQNB 2VF3A 2DGTA 4QIFA 2R42A 1Q8IA 3OQ2A 5KFFA 2MQQA 4X62J 3J81Y 4I2PA 2Q79A 5HLFB 3MF5A 1HQUB 4K4UA 4NWBA 2W01A 4A8YA 3RB0A 1U0HA 2RILA 5GMKa 4OV1A 1RBAA 3NP5A 3QMQA 4NLRA 2QA4G 2AMCB 3CD5A 2V34A 4B9NA 1Y9OA 2JFKA 2IM2A 3W2WA 4BCAA 2CZ4A 1F9FA 1Y7PA 5KFYA 4KFBB 3DOLA 3TNVA 4RKUC 3T1AA 4JI8F 3M8WA 4NMLA 4RNNA 4DPYA 4IFYA 2UU9F 3MMCB 5E33A 1IBMF 1U2FA 3K8VA 2A3JA 1I5OB 1F3VA 3CJ2A 4KTQA 3J7YU 2DGOA 2IAJA 4GVBA 2ZHAA 4J90A 5L1JA 2KJVA 5J2MB 2KT5A 2AU0A 2G0CA 3ELHA 4FVMA 1C0TA 1DBDA 2ZDOA 5EUHA 4LF7J 4DU8A 1YSJA 3E3XA 2E1PA 3IR6B 4TQSA 3UNGC 4B08A 2E29A 1RSCA 3ZZTA 1P9QC 2C2MB 3M1VB 3RTVA 3X1LB 2CNNB 3HHLD 5J2PA 4KR0B 2CQPA 2I38A 2XZWA 2XMMA 4F36A 4UOGA 4NXMJ 2AYEA 4KB7A 4ILLA 2NPFA 5BYQA 3MUMP 3IRXB 4DV3F 3D67A 3R5CA 2XWXA 4EBCA 1U48A 3THPA 2HNDB 4NLVA 2DO4A 1N33J 2ZM6F 1OPZA 4I69A 1AXQA 1BGXT 1V9OA 3VWSA 2DNZA 3H5XA 2CIMA 2LXFA 4DPTA 2VA3A 1LQ9A 2DH7A 1XR7A 2IM3A 1WUUA 2Z2LA 1TKTB 5A8WB 1Q53A 4X4VA 3F73A 2VQFJ 2XULA 3A8EA 3U1MA 1S97A 3HZGA 2KT2A 4HHHA 3EE3A 3UWTA 1S9EA 2HFSA 4ER8A 5IFMA 4LR8A 4DFJA 3TZZA 2JWNA 3HKWA 4CCHA 2AV5A 3N79A 3KLHA 3OR2A 3ZNUA 4DQIA 5CYQB 4OZ1A 4ZVUB 4OV6A 3W2VA 2FB0A 1VQ4S 4ICLA 2PI4A 3VGSA 4IQMA 1NPPA 2QLXA 3IBCB 1EARA 3A13A 3M9MB 2FLLA 3FGVA 2W7AA 4ZVEA 1RT6A 2CRLA 5HROA 3QSYB 2IVYA 3H42A 3OLAA 1M5SA 3MAAA 4DL5A 1B7YB 2CYYA 1K47A 1RTJA 3BH6B 3MMAA 4IR1A 1GMUA 1NMEB 3IG1A 1F2GA 1S1TA 2F9DA 2M4MA 2CPIA 4OZNA 3BO2A 3J7AN 1PBUA 1Q8KA 4DHVA 1B0PA 3M05A 1YRUA 3PO4A 4LVNP 2RQCA 4ZPCA 1Z1ZA 1MN9A 2JSXA 4M94A 4PPZA 2OPRB 4NRTA 4CT9A 3VGUA 4KSEB 1S76D 3HJFA 2CQIA 4LFBF 1DTQA 1SI9A 2V4QA 3O1LA 3QRPA 3QBCA 2B51A 1K0VA 1RWNB 3WC0A 1XMOJ 3ONQA 1R3NA 2J7WA 3ILLA 1W7WA 2BE9B 5KOWA 3MR7A 3QRRA 1Z2ZA 2NSBA 3BKUA 5KFSA 2CG4A 1U49A 1T03A 1VMBA 3C6TB 2QA4S 2ZH3A 1CPZA 3UPFA 3A8IA 2GFFA 1S6QB 2KFYA 1TKXA 2V8HA 2KYZA 3BKFA 3UN2A 1RAJA 3LTOA 4WZMA 2B4VA 2CADA 1CJVB 2FJVA 2HS0A 3AXMA 5E3PA 4ID5B 4JP8A 2R7RA 2D1CA 4NCGA 2NUUG 4W90B 2W2OP 2Y1RI 2MLYA 2DGXA 1S1WB 2HK2A 4LR7A 5E3QA 2ZBCA 3DU6A 2F8EX 3M6WA 2AW0A 1SV5B 1ZZFA 3IXQA 2QLBB 3AA8A 4O4RA 4ZLNA 5EX3A 1RAAB 3J80U 3TARA 2KJWA 3KKFA 2HIQA 4PXDA 3G71S 4W4MA 2A2DA 4ZPAA 4HI2A 1WKJA 2R8HA 2HHUA 1P9YA 3THTA 1X5TA 5U47A 5GADU 1YQHA 3B54A 2BZ2A 4FS2A 1WTBA 3OTBA 3CCES 5MLCV 2VU5A 4HEA9 3SXLA 2EK6A 4AFFA 3DGPA 4LF2A 2AWZA 3N5FA 2R9LA 1QSLA 1Y11A 2ROEA 2DRBA 4BS2A 2BQUA 1CLFA 3CCSS 2WVEA 1NNDA 5ETLA 2XNQA 3CD7A 3B4DA 3US5A 3TWZA 3E01A 2XQCA 3DHXA 3GJRB 2V69A 4X4OA 1Y5IB 1VQNS 1HI1A 1NAQA 1S4EA 1GQEA 3Q2SC 2UZAA 5ETTA 2DPIA 2ILYA 2ZUAA 5ETKA 1VQKS 2HHWA 1NB2A 1NDCA 2CPZA 1AFJA 2YNHA 3CE8A 4EYHB 3K17A 4HH0A 1XMOF 1JXVA 1R8BA 5J2QB 2FTRA 4ZIVA 1ELOA 5F8HA 2QA2A 2EBEA 4FXVA 1RT2B 1HBNA 2W9AA 2YWKA 5GMDA 1RU1A 5IXUA 2RHQB 3VQSA 3TUZC 2Y1LB 4I4BA 3G86A 2C28A 3DLLQ 1CBKA 5T7LA 5HQ8A 2DR8A 4XAKA 1S49A 4ZHRB 3E8OA 1L3VA 2DHHA 2D74B 1ZM4A 4O3PA 1AZSA 4ETXA 3OVAA 3PW0A 1D1UA 1NO8A 3R1LA 2HVHA 2FC9A 1JLQA 1JLBB 4KHMA 1HNIA 4ZCLA 2V94A 4TKTA 1ZYQA 2LDYA 4H4KA 4B3SJ 5JUMA 5D4LA 1KQKA 4ILRA 3C6UA 5KFQA 2E5HA 4NX9A 5FLXU 2A10A 3PR5B 4IQXA 1N5QA 4ALZA 1RWOB 2GJFA 2DNNA 2VBZA 1ZAXA 2N3LA 4B9SA 2AJQA 3OUYB 2FHJD 1P1TA 1CQMA 1WC4A 4PABA 2YH1A 2MEWA 4KPYA 1NHKL 1CULB 1FRHA 2WONA 1RWWB 4IG0B 2SXLA 1UVLA 2QV6A 2XSJA 3I87A 4KAIA 3TZYA 4WFAQ 3KLEA 2ZZMA 3GTYX 3FFIA 1KSPA 2QIFA 4WK1A 2EK1A 1TMMA 2GVZB 2ZDPA 2XCPA 2XWYA 5F0UA 1LK5A 4HT7A 4DR6F 2G9OA 4NOHA 2AYMA 2LA6A 2PT0A 1SL1A 1EP4A 3D6TB 3OVSA 1NJXA 2GJ2A 2M52A 1VRTB 5K8NA 4IRCA 2DHSA 2E1MC 4GO5X 4RW8B 4ED3A 5I3UA 2OEKA 1IBKJ 4B3OB 3D0GE 1U8SA 4RW4B 1YBUA 1IJFB 2BKNA 3BQ1A 2UVVA 3NGTA 5B0FA 3WC2A 4ELTA 3V81B 2HKEA 2B9WA 4RUAA 3D5MA 4DR6J 2HMIB 1N33F 1GT8A 1W2IA 1QDUB 4RW9B 4WYLA 4F4YA 2H4WB 1C1CB 4DV3J 1KN6A 4CLUA 1YJ7A 4NXMF 3KYLA 4N41A 3ETOA 1OY6A 4L76A 1KOOA 2VB6A 2JVRA 1OQ6A 4FYVB 5CABA 4U67Q 3L95X 3RRHA 1QSSA 4ZP9A 1DLOB 1JKHA 4I2PB 5HLFA 4L72B 2IBOA 2MKHA 5H1SV 1HMVA 2VDHA 2FLPA 1SH2A 2VFVA 3J7Z5 4B3SF 3KJQB 2VZ9A 4LF7F 2MZRA 2Y0SD 4Q2LA 5AJ3J 4DV7J 1Z2LA 4DCJB 4TNOA 2XMAA 3CC7S 1Q86T 1O51A 2WRMA 3OV7A 2X51A 4Q8EA 1N54B 2YKAA 2Z2YB 4K4YA 4KY3A 2H5EA 1FX4A 4C97A 4ZCIA 3TYTA 4DL4A 3TQ1A 1BXNA 2MZ1A 2HBRB 2ZOFA 3E2EA 4I68A 3GLJA 1QSYA 2UV8A 5DQGA 4Q2MA 9ATCB 4KGKA 1VJWA 1KOHA 2L9NA 4RPFA 3CD0A 3JXOA 1DJ0A 1R43A 2MDAA 4RZRA 4P72A 5KG6A 5F9NA 5J2MA 2QEXS 5IV4A 4IRDA 4G3IA 2C42A 2O3DA 2VBYA 3W62A 5LOQA 5BR8J 1VK8A 3MEDB 4ZS6A 2POKA 3IC1A 1RGVA 3KUGA 4DL3A 2HVEA 4D3GA 2O5DA 2VG6B 2Y1JA 1I3OB 3NNHA 4JV0A 4Y28C 1BLUA 1X5SA 4PXBA 3OSPA 4F4KA 1RA6A 1FVQA 2F7VA 4O3QA 1RT3B 2OLWA 2KZZA 1S9GA 4QIGA 2HNDA 2IJNA 5CH7B 5KFKA 3QLHB 2MZQA 3CJ4A 2QX0A 1Q5YA 3T9ZA 3D54A 3PTWA 2E9TA 3C16A 1YDLA 4DR1F 5FJ4A 1U1KA 4O3RA 3QIDA 3HD1A 3BO4A 1T95A 1EETA 2AP6A 3IN5A 2HHSA 1OMSA 1NDKA 2JLFA 4V1Ak 3TX0A 5C42B 5GAGI 5GAHI 1NRKA 5HAOA 1S9EB 1J2VA 4OJHA 2HLUA 3C14A 4RLEA 4Y2MA 2YWWA 5AE1A 4QOTA 4R0EA 4OL8A 3K59A 4I1TA 4IKAA 5CYQA 1GXLA 4OX6A 2GNKA 2MQLA 3W2VB 5FDLA 2HRYA 3I0RB 3NGUA 3KNAA 3B6BA 2EFPA 2HVDA 1PBAA 4ZVRB 2IYIA 1KLMA 1UJ5A 4O3OA 5HROB 4EK2A 3NNAA 3MAAB 2Z0GA 3FZ2A 4A47A 3PW4A 1U26A 4KO0B 4WIQA 1S1TB 3W5YA 4C6AA 1ACMB 2V9WA 2UXDF 1KWMA 2MTLA 2F4FA 2BJ1A 3MPUB 1TK8A 1JNZB 4EEYA 4GC6A 1JLAB 4FYDA 2HLTA 1BUXA 4FYXB 3KJVA 2C3UA 1FNXH 4ED7A 2OPRA 2G0IA 4OYZA 6FDRA 1D8YA 2D3ZA 2C3MA 5IT9Y 3D7SB 4GRSA 4USHA 4HT5A 4DV7F 3IS9A 2CPEA 1MW7A 1S5ZA 4GO7X 1NUEA 4W98A 4XDCA 4ZVGA 3SBMA 2XI3A 3BPDA 4EO6A 1YJVA 2MXYA 3T1HF 1N6QB 4LF6J 2DNGA 2FPHX 2M2BA 3L3CA 2VOOA 2HS4A 3T9NA 4CM0A 5KG0A 4J9RA 3N5BA 3QPIA 3CCMS 2HVIA 1RHJB 1PJ5A 2CQ2A 3JTPA 1KTQA 2OFGX 4HI1A 1JLGA 2FZCB 3PIOQ 1IUJA 3PACA 4G1PA 4CH0S 4OX7A 1S6QA 1IBKF 1QVFR 2XNRA 1XK8A 1UTAA 5J2NB 1HNVB 1RP5A 1ZS6A 2BKPA 4NE9C 3PX4A 1Q78A 2VKRA 1EKRA 2DITA 3BF4A 4NLYA 4ZJOA 5IM0B 2N3OA 3GSDA 3JQMA 5IWAJ 4GC7A 2ZBQA 1YITS 1L3SA 1U2CA 1WC1A 3BEGB 4CLSA 3UO0A 1FX2A 4F2RA 2OO4A 2NZ4A 1NSKL 3TJ8A 4CLLA 1K1SA 4PAAA 2CNOB 3M2RB 1U1LA 1HD0A 1SV5A 3EM1A 1U1NA 4NL5A 1AFIA 1LXNA 2Z2MA 2QSFA 3KDNA 5B09A 1VQMS 3JS9A 4AL7A 2QGFB 4UT4A 4DV0J 3I5CA 4DPUA 4TN2A 2CQCA 1DQ9A 4GMKA 1VQ9S 3NS7B 5K9FA 3R7SB 2N82B 1YJTA 1YZ6A 2B0GA 3DXSX 1TFWA 1SC4B 2X7IA 4HACB 2VPZB 4FF4A 1TELA 4G1QB 2H1YA 2IC3A 2J7KA 2OGUA 3TZWA 4Q5VA 2ZH5A 2BDPA 1FRLA 1REGX 2RD5C 3QGPA 3QIPA 4C8MA 4B3MJ 2DVIA 5LT5A 2KHCA 3PRBA 3HX9A 5GVQA 3V6HA 1FFGB 2F8MA 1JX4A 4C8YA 3U1NA 4OI1A 4YHHJ 1JJCB 3HHDA 4DR2F 1FRIA 4OI0A 3PO5A 2IA0A 2WCXA 2AF6A 3SFGA 2ACYA 1FJGF 2BJ9A 3DRPA 4M5LA 3L7PA 4WU3A 2CVEA 1S7HA 1KS2A 5KFBA 1X0FA 2B5JB 3D6HB 1RLCL 5AXMA 3M2UA 3VAIA 2YNHB 4M5IA 2RS2A 4WFXA 4C98A 4QW8A 3ET6A 5L1IA 3RAXA 1MN7A 4A8FA 2F4VF 1PAEX 5JMNA 3K5PA 3M8RA 5J2QA 1H2TZ 1BHNA 4FZVA 1T9VA 1Q7LB 2G0JA 2K8GA 3BSCA 4C0OC 4Y3CA 1NSPA 5ETQA 1BY9A 3MPVA 3R27A 2Y1IA 1RCXB 1IWGA 4AXJA 1R31A 3S1TA 3BGOP 2ZC4A 2ZJQQ 2F65A 3AB2B 4ED2A 3OR1B 2JLEA 5L9XA 1WC5A 1LOUA 4N5SA 4DQQA 1N56A 2BRKA 2CG8A 1ULRA 1AZSB 1F6TA 3AHPA 4NLDA 1VBXA 3R5AA 2OFHX 4ATNA 1REVB 2NXEA 3IM9A 5CYMA 2W9CA 1JLBA 4LFCJ 6AT1B 1IKYA 5B0BA 1ZM9A 5KG5A 2IPOB 2RE1A 4C8ZA 1OSCA 3QGGA 1NKCA 3VQTA 3FK4A 3HULA 3OUYA 5KFJA 4M5NA 3TX8A 3IBWA 4CLPA 3THVA 3QAEA 3MPWA 2RS8A 4WE1A 1XBWA 4NASA 4ZVFA 4ZVOB 3Q8PB 3FEZA 2JVOA 4OZ2A 4QYRA 4CLWA 3PRVA 3KLEB 2L08A 2C2DA 2BANB 4PKDB 4QJVA 6FD1A 2HQDA 1RZMA 2V2QA 3CULA 1UFKA 2MZJA 1R8CA 3K5MA 4ZP7A 1EQMA 2YY3A 4U7CA 5LMUF 1RTDA 3OXFA 2LEAA 2HQ3A 1D9AA 2WBRA 2LECA 1VBYA 1UWAA 1UZHA 1GNKA 1UVNA 1R0AA 2BXJA 3MEEA 5HMWA 1D0EA 5G0RB 2F3JA 3MD3A 2YNIA 3CXCR 2LCWA 2HMIA 1MWQA 3W9HA 3CJ8A 2QL5B 5L38A 4WP9A 5D8HB 2KI2A 2QL9B 2GW8A 4LRFA 5D3GB 3S01A 4DN9A 2VL1A 3MAHA 2RNEA 3J7YI 4TYBA 1U2RA 3DDNA 3Q8VA 3W1YC 4MT1A 4AXIA 1OY8A 4BC7A 1XR6A 3R97A 4F3QA 3ZNJ1 3M9NB 3KMSA 1DLOA 1JKHB 2CWXA 4R8UB 2ZUGA 3KTQA 2GMLA 1HMVB 4ZLPA 5FLXY 5AXKA 3I5BA 1SL2A 1LEOA 2PIIA 2R8KA 1SQGA 4N76A 1YJWS 3BB5A 2YH0A 1G6BA 5CCLA 2ZWPA 2JH3A 3IO1A 3KLIB 5D0EA 3MR5A 4ZN3A 3HPOA 3LALA 3HD2A 3HM9A 3W64A 1ITPA 3I32A 3O8WA 1FK9B 4DV5J 3KLVA 3CIMA 2HZCA 4YHHF 1ZPVA 2WTFA 2X3DA 4YB7A 4ZVTB 2E1RA 3ISNC 3MCOA 5KFPA 4P2FA 3PKYA 1L3TA 3PKMA 4GKJF 2K3KA 2BBEA 2ABYA 4ZVHA 7AT1B 4EUVA 1NJZA 5ETNA 5RUBA 1EIYB 4ECTA 4Y2KA 3GQCA 4LFAF 3MEDA 1RU2A 2MQ8A 3DNCA 2FJWA 4BHQA 1VHIA 4C7QA 4LF8J 4RR5A 4KPCA 3G87A 1UVIA 5A0YA 5BXIA 2CQ4A 4DBQA 4IO1A 2W2QP 4OI3A 2UUAF 1CVJA 4Y2AA 2DNQA 1WELA 2HQIA 4KV8A 5T41A 5HSPA 4DV0F 4DR3J 1DFDA 3KJVB 1VBKA 3R7NB 3MCSA 1WHYA 2XI2A 4P10A 4CO2A 4ZCKA 1HBUB 4CIOA 2QL7B 1YBTA 2HHHF 4FVCA 1JLCB 4D3HA 3TAQA 4PG6A 1E6YA 3IMQJ 5KFRA 4K7QA 1JLFA 2OPSB 3LGHA 4L75A 1FDBA 1JNRB 2W9BB 1VC0A 2VUGA 2KU7A 5KFXA 2C3PA 2CDQA 4USIA 4QIWD 1H72C 3M8PB 1GMVA 2WSEC 2FC8A 2DD8S 2ZOMA 3PG9A 1PG5B 3M2VA 4N77A 3NNCA 3CJRA 5I42A 2CJ9A 1PAUB 3MCMA 3MPYA 3GG0A 5FDLB 3DU5A 4DQPA 1T02A 4LF6F 1IVZA 1YJUA 2GGPB 2MKSA 1WACA 1NB7A 2V4JB 3HT3A 4OLOA 4EZ9A 1M0SA 3EZOA 4OHVA 2FHOB 4ILMA 2HQFA 1VHFA 3OFHA 4B9LA 2CVIA 2XGPA 1LFWA 3G82A 1DQAA 1IBMJ 2R8JA 1I94F 3HO1A 2PA3A 3ZFVA 2RSQA 2YKOA 1SBRA 2RQ4A 4N56A 2LQ8A 1WOPA 1XEZA 4K2JA 5B0CA 3CEDA 1YK9A 2W2PP 4CO0A 4HR2A 4Z7CA 3GJTB 1FCAA 1UP1A 4WKYA 5KT2A 1O8BA 2JLGA 3CCUS 3HSJA 1HWUA 3WIUA 1G2EA 4BWMA 5I3PA 1T9XA 3IS9B 4NLSA 5KT6A 3JAMY 2D7SA 3KUHA 3EWGA 2AJFE 1TUGB 2EW9A 4KGVB 2ERRA 2VDIA 1HARA 1SIZA 3CCRS 1Q95G 1IQZA 2ATCB 1LW0A 2PA8D 4X62F 1N4LA 1IKVB 3BDEA 1UPPA 5K5MA 4DR7F 1PYOB 2HHPA 2RB7A 4NLUA 4RJVA 4Y34A 2ZH7A 2WVCA 1GTHA 2VA2A 3H2VE 3KLGA 1VISA 1MMLA 3AOCA 5HK4A 3PRDA 2HNZB 2OPPA 2XM3A 2HHTA 5IZHA 2B8QA 4DSJA 4JV5F 2G4BA 3Q23A 4JI6J 2EEYA 3N9UC 1X0PA 1W2BR 4ETZA 1LFPA 3NS6A 4LIWA 4LREA 3T5JA 5HQMA 4C9DA 2LYVA 4RW7A 1VK3A 5DZ7A 2V4RA 1YRXA 3FC9A 3GYGA 3L4BC 4KGMA 1SVDA 3M8YA 3TVKA 1UL3A 2YQ3A 2YWEA 4RBTA 2I5JB 5CD4H 2N4DA 1PYTA 5HQLA 4OI6A 2PN6A 5JVHQ 1WOOA 3NAHA 4Z7YA 3D0HE 2NXNA 2YXLA 1Z4UA 2HNYA 3UN5A 4ES2A 3HT0A 3AODA 3OSNA 3RBEA 3I9ZA 5DDQC 3SQGB 1T05B 3DRXA 3I0SA 4LBHA 3AOBA 2DIUA 3TP2A 4ECZA 5BYSA 4DV4F 1BE4A 4O44A 3O2IA 2F40A 4ENOA 4U96A 3MXHP 1UW9A 2OAUA 4X64F 5L39A 4DSIA 3W2WB 2F8HA 4X4SA 2V8DA 2J6UA 4NLXA 4ECRA 3OBIA 3DOLB 4KFBA 4DXLA 3GSIA 1FE4A 3KLFB 3QGHA 2J6TA 3MMCA 4JYAF 3OFFA 4YS2A 4DLGA 2M9KA 5I4MA 3QRQA 1SB6A 3NMAA 1RI7A 4U9RA 1WEXA 4TY8B 3Q8RB 1FT8A 2RRBA 2PO4A 4ELUA 1RAOA 3M2UB 3QFHA 4DV2F 3ET6B 3MUVP 3L7UA 1VQ5S 3NCQA 1X5OA 5M2PA 4JI3F 1EHWA 1SQEA 1UFWA 2NLWA 2QJ3A 3KDOA 5A6WA 1FDAA 3DLJA 3HFVA 4CTAB 2AHOB 3AQPA 4TU8A 2XLIA 2CFXA 3SI8A 4B9VA 2R4FA 4MFBB 3Q22A 4F4ZA 2XZTB 2IHR1 3A12A 3GR0A 3FSIA 1KVJA 3DLGB 3PFOA 2G1HA 1BD6A 3BGRB 5D6GA 3WIVA 1R8PA 1E6VB 4J9NA 3CCLS 3KK3A 2M8DB 2J76E 2OUGA 2HQCA 2YX1A 1T3OA 2COLA 4TY9A 1NK8A 4KQZA 1REVA 1R6VA 4RO0A 5CYMB 2HGMA 2XMTA 2RU9A 5M2RA 1XMQF 1H74A 1MLAA 1CC7A 2AYGA 1YIJS 4NLGA 3J81U 1JXLA 2NZCA 3I31A 2MYFA 4I7FA 2E66A 1K8AT 4DUYJ 1FJ7A 4QWDA 3CCZA 1WF1A 1QTNB 1PILA 1A0OB 1D9DA 1UETA 2BJDA 2LQJA 3H98A 3R5GA 2BANA 2X1GA 1VLYA 2YNFB 2HFNA 3FNNA 4X4NA 3WX4A 3I4HX 3G96A 4C11B 4M1KA 2YKNA 2KKHA 4P52A 4ICLB 3EICA 4RBUA 4OLPA 2GQ2A 1FNMA 2FLNA 3CTRA 3GCWP 2JL9A 2A0FB 2Z4PA 4WJBA 4J7CA 3MEEB 1RTJB 1RWVB 4IOBA 2MMYA 2YNIB 2CPXA 1RT4A 2ASJA 3IG1B 3OL9A 1B64A 1HNZJ 3N01A 5L46A 1K73T 4J9OA 4UOFA 1VGYA 3TJAA 4X4QA 1R0BG 1OO0B 2I6WA 4ED1A 4A4JA 1S1VA 2XO6A 1TKZA 2BUNA 1FKOA 3GWCA 7FDRA 1GXUA 2JC1A 3I96A 3SZ2A 2UUBJ 3NMRA 4R8UA 3CD6S 3BGFA 4FYYB 1MU2B 3IP0A 3OXGA 3QT7A 1KQGB 4NZ6A 2BACA 3IR5B 4WXOA 2DH8A 3FMBA 3HHLA 4URGA 1N36F 3FVYA 5KFLA 4JI7F 1X9MA 4P74A 3CDUA 4TLQA 1YRTA 3HXMA 2PEBA 2E5JA 4Z2XA 4MK9A 1RHMB 3TR5A 1APSA 2FQQB 2ASYA 2P9EA 2RMLA 1X4CA 5D4PA 3PZPA 4O4GB 1DARA 4WYWA 1NK7A 5AE3A 2CDRB 2Q1LA 4ID5A 1HNXJ 2X1FA 1QUPA 1SJFA 1S72S 1TVRA 1KR4A 3MAQA 3DM2B 4QU7A 2KXHA 1S1WA 1Q81T 2YBVA 4PUOA 3MM8A 2OTJS 2HS3A 3K5NA 1C4AA 3EGWB 5IS2A 4R5PA 3PY8A 1XNRF 2KDOA 1DAXA 1ZETA 1U25A 1K1QA 3G9CA 1HWLA 4DR5F 1VQ6S 1D9FA 2PFFB 4KV8B 4NMXA 3GV8B 3P96A 4DEZA 5CZVA 5KFMA 1VQLS 3P5BP 1F2HA 2I2YA 3AJDA 4C0BA 1FJCA 1KVIA 2GCFA 5ETSA 2ATLA 3BSOA 3NGDA 4B3RJ 3KK1A 3R6LB 3ILIA 1NJIT 2AJ2A 2WB1D 2LVWA 4DR5J 4KYZA 1WI6A 4P75A 4USJC 4ZKAA 4F3OA 2AKWB 2P6TA 3FZBA 2VV5A 3QNWB 1TU0B 1LV5A 3E01B 4X65F 4LT6A 3OW2R 3GFXA 5KTQA 4LSZB 4ZJQA 2HZVA 4DN0A 2MGZA 2RDJA 1V3RA 1M5HA 2HK3A 2P8IA 4JI2J 2HBZB 3ETMA 2YKQA 4F7VA 4WZQA 2B56A 4JV2A 2PMWA 4KRWA 2GGPA 1LWCA 2XHWA 1QJHA 5HL7Q 4OYOA 2KL8A 4HDGA 3OHAA 2B6AA 2W8KA 4P2SA 1OYEA 5KG4A 2JFDA 1WKLA 4Y0FA 4ZHRA 2LQ5A 3AQOA 1RYSA 4FF1A 5L1KA 4CNZA 2C1EB 3QAUA 2OEJA 4HTIA 4NEYA 3TJ9A 4ZLLA 2Y8WA 2O67A 3BQ0A 1SC6A 3ILJA 4OZJA 4JI5J 1VIXA 4I0WA 3KWMA 1NZAA 1N5VA 5KOXA 1TK0A 2IFXA 3B82A 4FKYA 4ZMMA 2W4DA 4I6AA 4WWSA 1M90T 3ZZYA 4J9MA 1URRA 3BN4A 3GV7B 1XERA 2WONB 2OPQB 2XS7A 2CZ9A 2NXJA 3TW0A 2DNLA 3UE2A 3ENVA 3H90A 4DCOB 1IKVA 1PC4A 3HHNB 2VIHA 5ITHA 4CH1A 4PRFA 4C8LA 4Z37A 3M30B 4JI0F 5D4OA 2FVPA 1CJTB 1H6KX 4C8OA 1F5AA 3PFEA 4E98A 1S0VA 1GAOA 4FS1A 4L3NA 2QE5A 3OTEA 1EP4B 2O01C 5K8MA 4B9UA 5KFUA 1WHVA 3BS9A 4RW8A 5I3UB 3LANA 2B8PA 4B3OA 4RW4A 2XY6A 1P27B 4K59A 2XS2A 3SQOP 1X4AA 2YWFA 4FDFA 4G1IA 2CQ1A 2I0XA 3ZC4A 2F5GA 3L9ZA 4I6YA 4LRBA 2RUSA 2OELA 5EWEA 3K89A 3PEHA 3W8PA 1V3SA 3QWUA 4JB8B 4FXWA 1XWLA 1KEKA 2RRNA 2ZM6J 1VQOS 2M5YA 3EDRB 4WP3A 4OZ3A 1T94A 2IMOA 4K8RA 2DNHA 3NS5A 3UDCA 5DQHA 4LQ9A 1UJ4A 1B3TA 2VG5A 1S6PB 3IAM9 2HNYB 2ALZA 4L74A 1TL5A 3NGSA 3JAMU 2UUCJ 1R0CB 2VC1A 3ZZUA 3AT1B 3MD1A 2MY8A 1HR0J 4FYWB 4G65A 1B7FA 1N34J 3QO9A 2EPIA 1KONA 3UFCX 5F0WA 5A8RA 2ASDA 5DLGA 2WVBA 1IXKA 2AJ4A 2GC8A 4AYBD 5A76A 1SJ3P 2GMHA 3T1YF 1DRZA 2UP1A 5IT0A 1YJRA 4NXNF 2R7UA 2DYAA 2RF2B 1RT7B 2VFSA 3HVRA 1VRUB 4M5GA 2JEIA 1BQMB 2UU9J 1U47A 2R7QA 1CG2A 1WDDA 3IM8A 1PIEA 1FRXA 5IC6B 2RH3A 5KAKA 2BABA 5J1PA 2KG1A 3H59A 2FYXA 2BMBA 2BRLA 2MHNA 2IMWP 4KHPJ 2YPZA 3BBCA 4P7VA 1ICEB 1HWKA 3GIIA 2ADBA 3RRKA 2ZH8A 3F56A 4M5DA 4JYAJ 3HVTB 2XEXA 3NGRA 2VG6A 5AXNA 1OSDA 2D41A 2N7YA 2QLFB 5E3AA 4JI1F 1RTIA 3BGRA 3W66A 4YY3J 3N0VA 2HURA 2DCUB 1E6VA 2QMWA 5ETMA 3W65A 3U27A 3GIKA 2R2UA 4K5SA 3V2UC 2QC3A 1DQ8A 1S9GB 2HFOA 1V6HA 2BX6A 3ZXWA 2B3TB 5B08A 4ZDNA 1GK8A 1VQSA 3PX6A 1YTYA 2PC6A 4RX6A 2IVMA 4YR3A 2DXDA 4MAKA 1SKSA 4QYZK 2LKZA 4NLOA 4LUBA 2L9WA 3HZEA 1ZTTA 2CQDA 4DV1J 4ECXA 3FCWA 2LMIA 1EETB 3SSRA 2DGSA 5E2QA 4XO0A 1QLNA 5C42A 4U8YA 4WFBQ 2FUG9 2H5JB 1F5BA 3CJ0A 3V5RA 1PGZA 1AUDA 4JUZA 2WSFC 3TRGA 3DC2A 4NCAA 4PWDB 1KQFB 4LBIA 3DOMB 4LBPA 4C11A 4CP5A 1RWPB 3MM5A 2OSQA 1S1UA 2YKNB 3FRZA 4JI6F 4BDPA 1VCTA 2K7KA 2DGWA 1U6FA 2ZD1A 4NA2A 2ALYB 3CGIA 4F4XA 1RABB 4V19J 4KGZB 1KLMB 2UV8G 3SMZA 2FJEB 5D78A 8AT1B 2E9ZA 2QMXA 5GADI 1L3UA 2JEFA 3DLHA 1GMWA 4KO0A 2NSCA
chains in the Genus database with same CATH topology
2CADA 3QSIA 2F1FA 2WVEA 2FGCA 2WVFA 3PHTA 2HZAA 3LGHA 2Y3YA 1Q5VA 2CAJA 1Q5YA 2BJ8A 2NZCA 2BJ1A 2WVBA 3BKTA 3BKUA 3OD2A 2BJ3A 2WVCA 2WVDA 3BKFA 2CA9A 2BJ9A 2PC6A 2BJ7A 2HZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAD A;  3QSI A;  2F1F A;  2WVE A;  2FGC A;  2WVF A;  3PHT A;  2HZA A;  3LGH A;  2Y3Y A;  1Q5V A;  2CAJ A;  1Q5Y A;  2BJ8 A;  2NZC A;  2BJ1 A;  2WVB A;  3BKT A;  3BKU A;  3OD2 A;  2BJ3 A;  2WVC A;  2WVD A;  3BKF A;  2CA9 A;  2BJ9 A;  2PC6 A;  2BJ7 A;  2HZV A; 
#chains in the Genus database with same CATH topology
 2DT9 A;  3H0P A;  4E2F B;  1AA1 B;  1Q0N A;  2AT1 B;  2HBQ B;  2MKY A;  3AB4 B;  3Q0A A;  4LMZ A;  2OIH A;  1CSJ A;  3EGV A;  3A4T A;  1S6U A;  3NG8 A;  3WZ0 A;  1URN A;  1S1V B;  3AY0 A;  2CPY A;  2CNK B;  3FEX B;  2IRX A;  3W9I A;  1TL1 B;  1TAU A;  2EG2 A;  3I56 S;  2X1A A;  1WWH A;  4OHZ A;  2PMZ D;  4YME A;  2DR6 A;  3P45 B;  1I94 J;  1NCL A;  3HLU A;  2AEM A;  3BQ2 A;  1R8A A;  3V6K A;  4PR6 A;  4GVL A;  4WCE Q;  5GAE U;  3FSY A;  3GFZ A;  2QG9 B;  1ZM2 A;  1RQ0 A;  2DJW A;  2GAH C;  4ITS A;  2DKO B;  1FNO A;  4YDX A;  3ENQ A;  2VQE F;  1VOM A;  3OT9 A;  2FY8 A;  4TU9 A;  1EQ0 A;  1PKU A;  1SPB P;  5F8J A;  2BW7 A;  3PJW A;  2MST A;  3SIP B;  5J2N A;  1HNV A;  3S8S A;  4WFN Q;  4LSN A;  4O4G A;  5GAE I;  1VIO A;  2W2N P;  3KHH A;  1HR0 F;  3C2P A;  4DLE A;  1WF2 A;  3QZ7 A;  4M63 A;  2UUC F;  4WK3 A;  1HQ2 A;  2LDI A;  4DUY F;  2V9K A;  2MKJ A;  3AD7 C;  4YR2 A;  3DM2 A;  4TQR A;  3I55 S;  1T8E A;  4DR4 J;  2EI5 A;  5KFD A;  3W5Z A;  2R7O A;  1N0U A;  3QFW A;  3MMB B;  2W8L A;  1HYS A;  5D4N A;  2H65 B;  5DG7 A;  2FGO A;  1RT1 A;  3D1Q A;  3AA9 A;  4HHJ A;  4ZCM A;  4Q8F A;  1X60 A;  1JJH A;  3WBZ A;  5HAT A;  3OJS A;  5HMX A;  1MWZ A;  2PD1 A;  1N0V C;  1SKR A;  1VR6 A;  5HN0 A;  3DOK A;  3A3P B;  4DU7 A;  2CQ3 A;  3OTO J;  3V6J A;  2EFO A;  1RAF B;  3R3T A;  3VVT A;  3H4D A;  5MAO A;  2DIS A;  1UEK A;  4G1Q A;  3DFE A;  2O66 A;  1SJ4 P;  1WI8 A;  4DPW A;  2BQR A;  1RDR A;  2GQQ A;  2WAQ D;  3EGN A;  4AQY J;  2FGC A;  4XIU A;  2BVZ A;  2HHQ A;  4MYU A;  2WVF A;  3M8S A;  5LSR A;  3EZU A;  3O5T B;  2OHD A;  4CRJ A;  1LNQ A;  5FII A;  5EN1 A;  4C0H A;  2W2M P;  1DY3 A;  3H7H B;  3PEJ A;  3AH6 A;  4X84 A;  1LWE A;  4EMD A;  2AGP A;  4CYU A;  3M8Z A;  2ZKT A;  3LP0 A;  3QT6 A;  4QBU A;  1K0T A;  2B4U A;  1WEZ A;  2WHO A;  1QAJ A;  5F8G A;  3EXY A;  5DGA A;  4MKB A;  2B5J A;  4IFV A;  4DJB A;  1C0U A;  3EVW A;  4RW6 B;  5KG1 A;  3GON A;  3CJ5 A;  2IM0 A;  3NKY A;  4H4K C;  2GV1 A;  5IV3 A;  4XDD A;  2CUY A;  1DTT A;  2DNY A;  2DTJ A;  3JQJ A;  1RIS A;  3O3L A;  4N8N A;  4OJ1 A;  1LWF A;  2DIV A;  2FHJ A;  1S1X A;  1TL4 A;  3OFE A;  4DV6 F;  2ZBR A;  4ECV A;  2E5L F;  2FVS A;  1MSW D;  3AJ2 A;  2JNJ A;  2J9C A;  3VVU A;  1NSQ A;  4RUB A;  1A9N B;  1TP7 A;  3BM7 A;  2JHE A;  4J9U E;  4NZ0 A;  1VLO A;  1NDL A;  2F1F A;  2NCK L;  3OR1 A;  4ES3 A;  5K8P A;  2KM8 C;  2XBP A;  4OZ5 A;  1NH7 A;  1Q7Y T;  1WC0 A;  3VGT A;  1J27 A;  2AIR B;  3R8Y A;  4BC9 A;  3WX8 A;  1R8H A;  2KHD A;  2YX4 A;  2HRU A;  3UR0 A;  4TLR A;  4LF4 J;  2Y3Y A;  2FZK B;  1J5O B;  1IKY B;  1N8R T;  1VQY A;  2C2Z B;  2HFU A;  4OYA A;  3ADA C;  3HVA A;  4QPT A;  2XMW A;  3T5K A;  4BBY A;  2A18 A;  5DDO C;  2FJB B;  3HDS A;  3CJS A;  4L73 A;  5CCM A;  2R7X A;  2ZH4 A;  3OL7 A;  4MMO A;  3AOA A;  2R7S A;  1VDH A;  2A1B A;  1S7I A;  2FZG B;  2GHP A;  2HWI A;  1WDT A;  3M8Q B;  3QQC D;  3CCV S;  2OPQ A;  3UCG A;  3I9V 9;  5E3C A;  1FEE A;  2CQ0 A;  1HLW A;  4J9V A;  5BJR A;  3HHK A;  1VYA A;  4DFK A;  1HBO A;  2AQ4 A;  1T3N A;  2EFN A;  2VBW A;  4W92 B;  3M30 A;  4K50 A;  2IRU A;  3VAH A;  2V50 A;  4ES1 A;  3FBF A;  5LJ3 Y;  1CJT A;  2AJ0 A;  3MOJ B;  3HSD A;  3RR8 A;  2VON A;  5LL6 d;  2DNK A;  4OYM A;  4LF9 J;  1RAH B;  1TTH B;  2Q3P A;  3CO0 P;  3DRR A;  1RTD B;  2V8P A;  3H2U B;  5D15 A;  2NXC A;  1WHX A;  5A6P A;  2ZH9 A;  4B3R F;  1HD1 A;  3HFK A;  2AZ3 A;  2ZHB A;  3ZTO A;  3DN9 A;  3IWX A;  1S79 A;  1U7L A;  1Y5N B;  3NBP B;  1R0A B;  5LMU J;  1U4B A;  3KJN B;  5G0R A;  4Q44 A;  2IJR A;  4JI8 J;  3SEO A;  3BDP A;  3WQP A;  3MEK A;  2YX7 A;  4UUW A;  5SZT A;  4DUZ J;  1KNZ A;  4RNH A;  5KFW A;  2DNR A;  2DY1 A;  1LW2 A;  2ZNZ A;  1NHV A;  1RTH B;  1FD8 A;  4ERD A;  3GZ7 A;  4DF8 A;  2VG5 B;  1S6P A;  2HVZ A;  3F41 A;  4I6W A;  4YOE A;  4DPX A;  2GAG C;  1KLN A;  3D66 A;  3NWR A;  3BRE A;  4JBC A;  2KM8 B;  4QWA A;  2E44 A;  2XLJ A;  4A8X A;  1B70 B;  3LGM A;  1XN9 A;  5L8R C;  3VGV A;  1IBL F;  3LPE A;  3QSI A;  1LXJ A;  1YVF A;  2RDI A;  3QO9 B;  4FKX A;  2BE2 B;  4K2X A;  4LF4 F;  3HK2 A;  2I1R A;  5KT3 A;  5A8R B;  4PYD A;  5T14 A;  4HLB A;  3MM9 B;  3O6Q A;  3DMJ A;  3Q89 A;  5C2C A;  5CD4 A;  3DRS A;  4IOA Q;  4K0K J;  2K1R B;  2WOM A;  1S48 A;  5CZX A;  1RT7 A;  4ED4 A;  2ZE2 B;  3H5S A;  1VRU A;  4C2M A;  1FK9 A;  1R6Y A;  1UFL A;  4CLF A;  2E5L J;  3CDB A;  2OSR A;  1VS3 A;  4PXC A;  4TYA A;  2RU3 A;  5IT9 U;  1H7X A;  2J0X A;  3IWN C;  2I8E A;  4P2X A;  4PWU A;  4F26 A;  3MZI A;  3K57 A;  1EKS A;  1KHW A;  2CQB A;  1HPZ A;  2YPY A;  3ICL A;  2VKZ G;  3PCO B;  4ZVS B;  4DX5 A;  3R6G B;  2DNM A;  3MPD A;  3T41 A;  3TA0 A;  2GO8 A;  2QFI A;  3K7R A;  4A48 A;  5KFH A;  2BOP A;  3KUE A;  1QAI A;  3D6M B;  1TKD A;  2M3D A;  2BKO A;  4DR2 J;  4FXD A;  1RTI B;  1G1X A;  1SJ1 A;  1U02 A;  1ZA2 B;  3HJV A;  4P2M A;  4PWW A;  5KFN A;  4YFU A;  1TQL A;  2YNG A;  3IWL A;  4KGX B;  4AE5 A;  4GKK F;  1G4C A;  5DM7 Q;  2V63 A;  4NA3 A;  2JJ4 D;  2Q66 A;  2V8G A;  1KFS A;  2DEJ A;  1NU4 A;  1C4C A;  1RAC B;  2Y0B B;  4H4O B;  3UI3 A;  2JEJ A;  1VJQ A;  3EDQ B;  4CWB A;  3DLE A;  1JLC A;  4AT1 B;  1QE1 A;  2XO7 A;  4J9P A;  4A8O A;  1E6Y B;  4OHY A;  4CDI A;  3LP1 B;  4WPA A;  2XSF A;  5KG7 A;  1NM2 A;  2ROP A;  4Q7A A;  3OFG A;  4TXS A;  1IR0 A;  1H73 A;  1M5K C;  2ZHO A;  2LFV A;  1CJK B;  1AT1 B;  3KMQ A;  3FMW A;  2GA7 A;  3HMJ G;  4CH7 A;  3VAJ A;  3BN7 A;  1H7W A;  1PJ6 A;  4FNI A;  3JSY A;  4OYP A;  3OL6 A;  2EXU A;  1FKP A;  1S4F A;  2P9G A;  3DOM A;  5F8M A;  1VI7 A;  5I42 B;  2LLZ A;  3WDO A;  1LK7 A;  3MEG B;  5KG2 A;  3MWB A;  4ECU A;  2LU2 A;  3NWG A;  1J5E F;  2PGC A;  2YQ0 A;  1ZOT A;  4YB6 A;  1XMQ J;  2YKM A;  3H4B A;  2HQG A;  1YBA A;  3VAM A;  4PQA A;  1NKE A;  3ZZZ A;  3DKD A;  3RAQ A;  3R5B A;  4EFA C;  3MEC A;  5ADZ A;  1IKX B;  2K06 A;  3G82 B;  4MKA A;  4ZPD A;  3G6X A;  3KHG A;  3EPI A;  1WEY A;  2VD3 A;  4USK A;  1XR5 A;  1N5T A;  1YJ9 S;  2R7T A;  3B8H A;  1UJ6 A;  4C8K A;  4Y2I A;  4P71 A;  4JI4 F;  4JI3 J;  5KFV A;  1TL1 A;  1FES A;  2LEP A;  4K0K F;  2CA9 A;  3K2Y A;  1FI4 A;  3UD5 A;  3GIL A;  5KFZ A;  1M5V C;  1QY7 A;  4PG4 A;  3VTI A;  4UOC A;  1ARO P;  1GMW D;  2DHX A;  1WHW A;  4UF4 A;  4O23 A;  4CO1 A;  3HF5 A;  3CJK A;  2QTW A;  4YEA A;  4F4W A;  4I2Q B;  4YN3 B;  3SCK E;  1LW0 B;  4USV A;  2XYG B;  2GJI A;  2UVU A;  2FHK A;  4PG7 A;  4ED0 A;  3ZTP A;  2BM0 A;  3KNG A;  4AUK A;  4X64 J;  3UN3 A;  1FRM A;  3KLG B;  4DWI A;  2VG7 B;  5HJX A;  1MMD A;  1P6T A;  3DLK B;  4X66 J;  5K14 B;  1JJ4 A;  4LSN B;  2YKP A;  2H51 B;  3HFZ B;  3ISN D;  4ZIW A;  4OJG A;  2X1B A;  5HVG A;  1HW9 A;  1FER A;  2AJ1 A;  3RBZ A;  4P9S A;  1RKJ A;  1CQN A;  1RKI A;  3RZA A;  3RYL A;  3Q8S B;  2UVW A;  2BE7 D;  4DSK A;  2G13 A;  2Z57 B;  1U1Q A;  3W63 A;  3R1H A;  1AUS L;  5G4D A;  1N32 F;  4H4M A;  3DRY A;  1D8Z A;  2WW4 A;  1HYS B;  3MR2 A;  1FO1 A;  4O3N A;  4WBF A;  4DX8 H;  3M7V A;  4IH7 A;  5EHH A;  5L1L A;  2OI2 A;  3K0J A;  1O5J A;  4EZ6 A;  1A7G E;  3CPW R;  3EVO A;  4DV1 F;  1KC8 T;  2E7V A;  1HBM A;  4Y00 A;  4QWC A;  3ITH A;  4UY8 T;  3SQG A;  3GIM A;  1T05 A;  2EG1 A;  1B99 A;  3I0S B;  4JV5 J;  3UQS A;  2XYP B;  2XGQ A;  3D0I E;  4O44 B;  3ISZ A;  4DSL A;  4OYI A;  3TAM B;  3FDS A;  3LF0 A;  1S6O A;  2DNP A;  2V68 A;  3BKT A;  4X66 F;  4DQR A;  2KB2 A;  2DCL A;  4C3K A;  1RHU B;  2D9P A;  5KFA A;  2P6S A;  4YY3 F;  1Y3K A;  4F67 A;  1S12 A;  2KN4 A;  2FVC A;  3KLF A;  1LWE B;  1T9T A;  2W4P A;  1PC5 A;  3LP0 B;  5F3Z A;  3BR9 A;  3H5Y A;  3D9B A;  1AYE A;  4TY8 A;  5E41 A;  2BR0 A;  1WD6 A;  1EAY C;  3V4I B;  4IFV B;  1FFW B;  3CMA S;  1C0U B;  4RW6 A;  4DL6 A;  4CO3 A;  3LAM A;  2E5I A;  3HHL C;  2G1D A;  2N4C A;  2HHV A;  5DG9 A;  2F63 A;  1DTT B;  2QZ8 A;  5AE2 A;  3D3B J;  4CTA A;  1ZPW X;  1OJ4 A;  3EYZ A;  1LWF B;  3UD3 P;  1XIQ A;  4BLG A;  2UXB F;  2MQO A;  3IAS 9;  4MFB A;  1CC8 A;  3SCL E;  3SYZ A;  1KP6 A;  4K4Z A;  3DLG A;  4OYB A;  4MIW A;  2GHV C;  2HAF A;  4J9S A;  4F02 A;  2UVR A;  2B7C B;  2DK2 A;  2VFU A;  2CPH A;  1SIW B;  3NCP A;  3KK3 B;  2Q43 A;  1T7P A;  4MIA A;  3VF0 B;  5C24 A;  2KFN A;  2W4C A;  1HNZ F;  4FBU A;  2M70 A;  1JJ2 R;  1N34 F;  2DHG A;  3N6M A;  3ZTS A;  1J5O A;  3UD4 P;  4DFP A;  3C15 B;  3GJQ B;  2V6A A;  4USW A;  2YTC A;  3IRW P;  2C2R A;  3MM7 B;  5F9L A;  2P5V A;  1J5E J;  2NR0 A;  3Q86 A;  1MWY A;  2HRT A;  3HVW A;  4I7F B;  2BV3 A;  3M8Q A;  4NLP A;  4YB5 A;  1NPK A;  2CJY B;  2HGL A;  2QYG A;  5KFI A;  3PNI A;  5HO4 A;  3QZ8 A;  4NLT A;  2GIQ A;  1SKW A;  3GIR A;  1BC6 A;  3TOQ A;  4X4T A;  3R2D J;  1S0O A;  2YNF A;  1GX5 A;  5F41 A;  2DBB A;  5L9N A;  4PG5 A;  4PG8 A;  3A3N B;  4UUX A;  3RW6 A;  1MRO A;  1WF0 A;  3UNY A;  4ZJL A;  5LMN J;  4IYQ A;  2IBK A;  1JIH A;  2BYC A;  2R7W A;  2UXC J;  2OEM A;  2LA4 A;  1JXE A;  4DR4 F;  1FWK A;  4DQS A;  2V8V A;  2V67 A;  4NYP A;  3EJM A;  3NBP A;  2APO A;  2ZZN A;  5KFO A;  2P9C A;  4ZPW R;  3RRG A;  1D09 B;  2QRR A;  1RT4 B;  5HBM B;  2VC0 A;  1TK5 A;  2W7P A;  3KOA A;  1ROF A;  2HSE B;  3DGV A;  3FUY A;  2DR7 A;  3G8Q A;  4ZOS A;  2KZM A;  2DO0 A;  3GFY A;  1IR2 A;  3FBB A;  4QR2 A;  2IJF A;  3A8K A;  5C25 A;  2EFQ A;  3G4S S;  3K58 A;  1F9H A;  4U7U K;  1LW2 B;  3LW5 C;  4LFA J;  3MUT P;  1H98 A;  1TKZ B;  3D28 A;  1RTH A;  3M32 A;  1TV6 B;  4NLQ A;  1FKO B;  1FEH A;  1FTC A;  1PYS B;  1S59 A;  1UWB B;  2NXU A;  4NYZ A;  2R2S A;  3EVM A;  3FBE A;  1NSA A;  2RVJ A;  1MU2 A;  4WII A;  4RU9 A;  5HJY A;  1SKU B;  4JI5 F;  3KFW X;  4A8M P;  2NYI A;  3HHL B;  1DHM A;  4URQ U;  1RBL A;  3IR7 B;  3KXD A;  1KFD A;  3LA0 A;  1M1H A;  3DMJ B;  3ZZO A;  4B17 A;  3TZX A;  4X4R A;  4IR9 A;  4PQU A;  2K1R A;  2VFR A;  3RB4 A;  3DDI A;  5D77 A;  1NXI A;  3A3O B;  3RR7 A;  4NI2 A;  1EX8 A;  2QFJ A;  3PX0 A;  3JB9 k;  4PCQ A;  4B3T F;  2WSC C;  1IKW B;  4LSL B;  3SSS A;  2FLO A;  1OPI A;  3N28 A;  3UDL A;  4F04 B;  5A2Q U;  2NRE A;  1TVR B;  1WG1 A;  5A8K B;  1P8G A;  4JI2 F;  4FF3 A;  1PSD A;  1QUV A;  3CJT A;  1HPZ B;  1YLX A;  1K44 A;  3FQK A;  5JXS A;  4DSE A;  3MM8 B;  1RT5 B;  4NPO A;  5IT4 A;  4R5P B;  2CXE A;  3GR1 A;  5HP1 A;  5M2U A;  1UA0 A;  2YQ1 A;  1TL3 B;  4F50 A;  5HMZ A;  4M5K A;  1FRK A;  3C19 A;  4DUZ F;  1UA1 A;  1CJU B;  4UOH A;  9RUB A;  1RK8 A;  4WF9 Q;  3LP2 B;  3CCJ S;  2D3O R;  1HFE L;  1U0S A;  4QZV B;  3R5J B;  4E8U A;  2JX2 A;  2OD6 A;  2E7X A;  1VBZ A;  2GVD A;  3VCD A;  5CYJ A;  4XPE A;  1NKB A;  2AX0 A;  3TVZ A;  3DLE B;  2QYC A;  2WB4 A;  3KK1 B;  3K5L A;  1QE1 B;  3RW7 A;  3PHT A;  4PXE A;  3R2C J;  2CPD A;  3LP1 A;  4ZPV R;  2AEJ A;  4DG1 B;  1X4H A;  4U95 A;  5F8L A;  4LF9 F;  4CO4 A;  2DNO A;  2OMO A;  2XMJ A;  3DHW C;  2HBY B;  2DR5 A;  2J9D E;  2E1A A;  3GU0 A;  2EWH A;  2IDE A;  2XHC A;  4HKQ A;  3QJL A;  3RBD A;  5DS7 A;  5GAG U;  5GAH U;  4RNO A;  1FKP B;  3MTK A;  2WBM A;  2MGZ B;  4N7T A;  3CF5 Q;  5B0E A;  4HDH A;  1BQN A;  4IG3 B;  2ZWO A;  2QN6 B;  2OML A;  3MEG A;  3TVY A;  1ZA1 B;  3M6U A;  1HNX F;  2KH9 A;  2MQN A;  1LWC B;  2H4Y B;  1U0H B;  3C8Y A;  1XTZ A;  4ZPT R;  5B0G A;  5KT7 A;  4KHP F;  1Y10 A;  4Y2C A;  4HVZ A;  2B6A B;  1U8W A;  2GMJ A;  3MEC B;  4OHX A;  3ZZ0 A;  1IKX A;  4JI4 J;  3HHE A;  1HHT P;  3SV4 A;  4IFY B;  4USU A;  4CI0 B;  1N36 J;  3F44 A;  1Q1K A;  2H48 B;  4IDK A;  4KT0 C;  3ZO7 A;  4NXN J;  2V0N A;  2JOQ A;  3HKZ D;  3KHL A;  4LFB J;  1C1B B;  4WTO B;  5H9E K;  4K4X A;  4ED5 A;  4WP8 A;  3BBF A;  4YDD B;  5CXT A;  2KO1 A;  2Y8Y A;  1C0T B;  3O44 A;  3IGN A;  2WZ1 A;  3H8Y A;  1SUQ A;  1WJ9 A;  4OZL A;  3R5D A;  5F3T A;  1RWK B;  1U6Z A;  1UVK A;  3CJK B;  1VFJ A;  4HH1 A;  2KXN B;  1QAX A;  2A6O A;  2V5H G;  2WVD A;  3M1V A;  1X9W A;  4J9Q A;  1H2U X;  3V4M A;  4QQB A;  5J2P B;  3PYD A;  4MKY A;  2ACM A;  5B0D A;  3T6B A;  1YHQ S;  3MOZ A;  1XJW B;  3FRY A;  4L6V 3;  4OYW A;  1TMJ A;  1F5C A;  2CQH A;  1OYD A;  1Q8B A;  2XZD B;  3DLK A;  4KHR A;  4PEO A;  5E3R A;  4X4P A;  2G2O A;  4AQY F;  5F8N A;  2RJZ A;  1U1O A;  2FJX A;  2OP5 A;  3LAK A;  4QWE A;  2MHE A;  3VHQ A;  3GFH A;  4MK7 A;  5C7P A;  2CPJ A;  3OTO F;  2Z58 B;  3BJY A;  3I5A A;  3KJF B;  2HHH J;  1QAY A;  1IM4 A;  5C2G A;  3NLC A;  5LSL A;  1PO6 A;  1TKT A;  5A8W A;  4YR0 A;  3MHY A;  2ZBP A;  1QM9 A;  4H4M B;  3T3F A;  2EC0 A;  4DR3 F;  3POT B;  4MIB A;  3FJ2 A;  2L3M A;  3PIP Q;  3W7B A;  1H2V Z;  3SCJ E;  2QO3 A;  2VQF F;  2HGN A;  1W26 A;  2OJ3 A;  4GKK J;  4RWX A;  4JI0 J;  2DHA A;  4HTJ A;  3P49 B;  4UZC A;  1R27 B;  3J81 j;  3OR2 B;  3PJX A;  3PM9 A;  4QR0 A;  4Q0B A;  3ITH B;  4A8S A;  1NDP A;  1Y00 A;  1H38 A;  2JEG A;  5IWA F;  3LPY A;  1RLD A;  4HYK A;  3CMQ A;  3CME S;  1Q16 B;  1RT6 B;  5C5J A;  4O0N A;  3TAM A;  3MMJ A;  1KRP A;  1FXD A;  2PFD A;  2VBX A;  5GME A;  2R3V A;  3GV5 B;  4KJI A;  2RF2 A;  4B02 A;  5D0H A;  1IR1 A;  1WKK A;  4XPC A;  2VQE J;  1HWJ A;  3CJ3 A;  1NLK L;  3TEH B;  1BQM A;  4UST A;  3N6L A;  4UQG A;  3QT5 A;  5J1N A;  1ZAV A;  5DET A;  2QLJ B;  1X4B A;  2E5G A;  3Q24 A;  4M5H A;  2BJ3 A;  3CCT A;  1T9Y A;  3A1Y G;  2MKI A;  3CWJ A;  5LMN F;  3D2W A;  2RT3 A;  5BYR A;  4KH0 B;  1S0M A;  1IBL J;  3ZTR A;  1T0T V;  1Y4Z B;  2BJ7 A;  3RB6 A;  5ETV A;  4M5D B;  3HVT A;  2J7U A;  1H3D A;  4LRD A;  4YP3 A;  4OZ0 A;  4ANE A;  3V6D A;  1VQ7 S;  4QIE A;  3KHR A;  4F4A A;  2P2C B;  3D3C J;  3C6T A;  4OIX A;  2VJV A;  5JJB A;  3GCX P;  4U8V A;  4DS4 A;  1UPM B;  1SL0 A;  2XB2 D;  2ZZT A;  3UVJ B;  1M1G A;  1X4E A;  3MTJ A;  1Q5V A;  1V5I B;  1I51 B;  2DRD A;  4R0J A;  2M0G B;  2L41 A;  3CVK A;  3J80 Y;  2W1B A;  2MQP A;  2XY5 A;  2R2T A;  1KVK A;  3W8G A;  2NYH A;  3CB4 A;  2BJ8 A;  3C15 A;  1NJW A;  3RUB L;  2H3E B;  4U6P A;  3MM7 A;  4NCG B;  2CQG A;  5DJB A;  1VRQ C;  3U1L A;  1NHU A;  3W61 A;  3HP6 A;  4I67 A;  3LWL A;  3C66 A;  4J9K A;  2CNL B;  1RYR A;  4QU6 A;  4ZIT A;  2CJB A;  3G2X A;  4A8K A;  2FJA B;  1N48 A;  5ETO A;  3RGI A;  5HI7 A;  4PWD A;  4ECS A;  3PW7 A;  3MM5 B;  2DGU A;  4HHU A;  2ZNY A;  1S1U B;  3K5O A;  5D0R A;  4DR1 J;  1MRO B;  1WC3 A;  2W25 A;  3MM6 A;  5KT4 A;  3JYT B;  3FCV A;  2ZD1 B;  4ZVP B;  1TUV A;  2ILZ A;  2R2R A;  4QR1 A;  2J6S A;  4ECQ A;  5DDR C;  1HL6 A;  2DXF A;  2MJN A;  2RQM A;  5EDW A;  4EI2 A;  1JLE A;  1DUR A;  3NY0 A;  4B3T J;  4LFC F;  3MFI A;  2QSW A;  1U6B A;  3T5L A;  3P6Y C;  4DR7 J;  4M5M A;  4WKR A;  3WHI A;  4CLT A;  1N5S A;  5C25 B;  1QVG R;  4JI1 J;  3D4J A;  1GH8 A;  2B4P A;  1BMQ B;  3NRB A;  5SUH A;  2DXE A;  1TV6 A;  3JTO A;  3CT9 A;  3BYR A;  1G3O A;  3Q83 A;  1IN0 A;  1UWB A;  5LM7 E;  3EXC X;  3SV3 A;  2HG4 A;  2ZOG A;  5DQI A;  1Q4R A;  2HHX A;  2ZEJ A;  4LVO P;  2CZV C;  1N32 J;  2J8S A;  1YI2 S;  2DGV A;  1PCA A;  3HSG A;  4O0I A;  3CC2 S;  5I3Q A;  2FVQ A;  1RT2 A;  1HBN B;  4NZ7 A;  4DS5 A;  1ZTW A;  4PPD A;  3EZ5 A;  2VIC A;  1A6L A;  3SSQ A;  5T7L B;  1KTV A;  5E7O B;  3FEY B;  4K5R A;  1FFS B;  5F8I A;  3OTC A;  3UCZ P;  1TAQ A;  3OJU A;  2DPJ A;  3BGL A;  3T1Y J;  3E51 A;  2MQM A;  2ZKU A;  2CJK A;  1NH8 A;  1B4S A;  3G8T A;  2FD2 A;  1JLQ B;  2XG8 A;  1KHV A;  3A8J A;  2D9O A;  4J5O A;  1YG0 A;  3BO3 A;  1F9E B;  3ILO A;  4EU0 A;  3C6U B;  1TL7 A;  1HI0 P;  4U7U D;  1WG4 A;  2ZC3 A;  3FBC A;  1JK9 B;  5A8K A;  4QWB A;  2KRB A;  3P8B B;  1I6J A;  5J1E A;  3PVX A;  1RT5 A;  7FD1 A;  2BA9 A;  4AD6 A;  3MMB A;  4IG0 A;  1CUL A;  1SH3 A;  3P5T L;  4LJM A;  5HP1 B;  1S9F A;  2UXC F;  2XSJ B;  2B4O A;  1RT1 B;  2IYG A;  3BSN A;  2VOP A;  3FFI B;  2GIR A;  2BEF A;  2VPX B;  3EUN A;  2GVZ A;  4R25 A;  2FIU A;  3PW2 A;  4KKO A;  1CJU A;  4RWW A;  3IA0 A;  4BWJ A;  2RDD A;  3DOK B;  2HW3 A;  1RAI B;  5KT5 A;  3LP2 A;  1N88 A;  1T9W A;  2GVD B;  4ELV A;  4WTY A;  4WXW A;  4YUD A;  2RQK A;  4YQW A;  1ZM3 A;  3L7O A;  1IQT A;  4ANC A;  1FJE B;  5EX0 A;  1C2P A;  1YWX A;  2Q6B A;  1FRJ A;  3V81 A;  3TAN A;  4LQ3 A;  2OKQ A;  3X3U A;  4ZN1 A;  5IQQ A;  1FDD A;  4OMF G;  5IQ6 A;  2HYI B;  1KKH A;  2CPF A;  3D1O A;  5LXR A;  2W24 A;  1WTF A;  3SFU A;  1MG7 A;  4CYU B;  8RUC A;  1C1C A;  2G2Y A;  1F1B B;  1Y0H A;  3CDE A;  1BWV A;  2GIF A;  4ZA1 A;  4DZD A;  5DDP C;  4DSF A;  1JB0 C;  4FF2 A;  4M5J A;  1Y5L B;  3MR3 A;  1RWX B;  5THW A;  3BSA A;  5CHC B;  2AGO A;  2C2N A;  3PV8 A;  2ROG A;  4GKJ J;  1XMB A;  1YGY A;  5D0G A;  2EKN A;  4F0M A;  3RB3 A;  4FPI A;  3TAP A;  3J7A 1;  2UXB J;  5A2Q Y;  1S1X B;  4CLZ A;  1VC5 A;  2MKK A;  1IM6 A;  4DV5 F;  1X5P A;  3LGN A;  3NGK A;  4K4T A;  3GYX B;  3GIJ A;  3VZH A;  3G6Y A;  2J9D A;  3IGV A;  5ETR A;  2RRA A;  3JTN A;  1BQX A;  4DMZ A;  4A46 A;  3JQK A;  4RUH A;  3VAF A;  4ID8 A;  3QAT A;  4RL1 A;  2CKW A;  2J9E A;  2MKC A;  2MZT A;  2NPI A;  1S99 A;  2JC0 A;  1H0H B;  3M9O B;  2V2K A;  2UXD J;  3GE9 A;  4DZ6 A;  4IDK B;  3OLB A;  4G6V B;  4B9T A;  2XLK A;  4DX6 A;  3HI9 A;  3NAI A;  4QIV A;  1C1B A;  4MTP A;  2ZVI A;  5K20 B;  2KVI A;  4DV4 J;  2RUG A;  2C2K B;  2HZA A;  1M1K T;  5DRK A;  4C3M A;  1WG5 A;  2XC9 A;  1S57 A;  1SUQ B;  4S0M A;  2NUH A;  4DL7 A;  3H2L A;  4RNF A;  1VQP S;  4IUF A;  4ECY A;  4NCB A;  3K8W A;  1HBO B;  4CLK A;  1U1P A;  2ZH6 A;  1NBE B;  1R7I A;  4X65 J;  1MMN A;  3PJ9 A;  5H9F J;  2VHG A;  1UVM A;  1BWE A;  2V2V A;  5DO2 A;  3EX7 B;  1RT3 A;  2C2E A;  3DRR B;  4J37 A;  5E0O A;  4ED6 A;  1CEZ A;  3AJ1 A;  3I4P A;  2GQC A;  1V3Z A;  2F9J A;  3AAW B;  4ZVQ B;  5DLF A;  1CS4 A;  3KK2 A;  4O3S A;  3CNQ P;  1U1M A;  4CT8 A;  1HQE B;  5HVH A;  3JSR A;  2B43 A;  3QLH A;  2B9Y A;  4LRA A;  1RUS A;  2UUT A;  1WC6 A;  3TQE A;  2DRA A;  4C4W A;  1RHQ B;  4ZP8 A;  4RU2 A;  1NK6 A;  1U24 A;  1UMJ A;  2D3U A;  4OI2 A;  3C16 B;  2AYB A;  1PJ7 A;  4DL2 A;  2WK4 A;  1UVJ A;  1RCO B;  2VPY B;  3SDE A;  2B7B B;  3AD9 C;  3BZQ A;  3LO3 A;  3POT A;  2HEK A;  4C3L A;  2VOD A;  4NEZ A;  4AL5 A;  1P1L A;  3B78 A;  4UY8 5;  3C14 B;  2KTQ A;  2PMH A;  2RKI B;  2E7W A;  4Q0B B;  2QLW A;  4UQT A;  1AB8 A;  3TA1 A;  1N5Y A;  3PYF A;  2L9D A;  3I0R A;  2IDL A;  3ZZP A;  3DI6 B;  3JSM B;  2HAI A;  4P7T A;  1X8D A;  2BE2 A;  2DGQ A;  1FVS A;  4MJK A;  3PDN A;  4OHW A;  4CM2 A;  3MM9 A;  3VR1 A;  1HIY A;  1EB0 A;  1FF2 A;  3DRS B;  2R8I A;  4OX9 F;  4EYI B;  1NPR A;  2WOM B;  5B7W A;  1WOS A;  3ZZR A;  3CC4 S;  3LUY A;  4FNH A;  2ZE2 A;  3ZTQ A;  3F0N A;  1U1R A;  4LRC A;  1HNW F;  4OFZ A;  2AD9 A;  1RB0 A;  1GX6 A;  3R7B B;  1JLA A;  1HHQ A;  2M8H A;  2MZS A;  3M6X A;  3W3S A;  3ULH A;  3OHB A;  2KYX A;  3LQV A;  1UCN A;  3OPK A;  3MR6 A;  2F4V J;  3DCA A;  4CO5 A;  1N52 B;  4C48 A;  5AJ3 F;  2NS1 B;  2Z8Q A;  2UUB F;  4X4U A;  5KFG A;  1HW8 A;  1K9M T;  2CJA A;  4F2S A;  3TUP A;  1U09 A;  1N6Q A;  1VQ8 S;  3DYA B;  5LXY A;  4HL9 A;  2Y9H A;  3V6D B;  2KVQ E;  2ZVS A;  2KRR A;  3CCQ S;  4A8W A;  1Y3J A;  3PHE A;  5JVG Q;  1JLG B;  1HI8 A;  2YNG B;  3BGU A;  3BBB A;  5KG3 A;  4RUC A;  1SCJ B;  3Q8U A;  4LF5 J;  3UVJ A;  1F60 B;  1HHS A;  1G7C B;  2ASL A;  1D3W A;  1SJR A;  4IH6 A;  4H4O A;  5EGY A;  3L09 A;  4URS A;  3CDA A;  5ETP A;  5IM0 A;  4EBE A;  3PW5 A;  2QMU B;  2ZH2 A;  3S6E A;  1EZZ B;  2XTJ P;  1X4D A;  4IRK A;  3H25 A;  2MY7 A;  1LWX A;  4FN5 A;  2ZJR Q;  1FKA F;  1WSR A;  3M2R A;  3UDE A;  1CJK A;  1XNQ F;  4DF4 A;  3C46 A;  4TU7 A;  1X31 C;  4DDF A;  1KBR A;  1I1G A;  3HSZ A;  1XNQ J;  1M5O C;  1FWL A;  1O0P A;  4MK8 A;  1U45 A;  2OH2 A;  2MLX A;  1RWU A;  2HWT A;  3MDF A;  3OL8 A;  2LQ9 A;  1M5P C;  4M95 A;  4IO9 Q;  3NCR A;  4N47 A;  4JV1 A;  4AL6 A;  3MM6 B;  4PUO B;  4OQJ A;  4RNM A;  3T19 A;  1RAG B;  3JYT A;  1HQU A;  4HAC A;  4IH5 A;  1QTM A;  3NOC A;  2YKM B;  1UW4 A;  2IC3 B;  3GP9 A;  4F0K A;  3Q2T C;  2PE8 A;  3QIP B;  4EGL A;  4Q43 A;  2Z30 B;  3NL0 A;  2JDJ A;  3C3L A;  4LF5 F;  2EVZ A;  4M8L A;  1JLE B;  3M6V A;  4DFM A;  4Y6I A;  2MSS A;  2C3O A;  1UKU A;  1KD1 T;  3DDK A;  2J5A A;  2EBG A;  3QYY A;  2J0Q D;  4DI6 A;  1SXL A;  1YJN S;  2CJQ A;  2DEI A;  2AGQ A;  3DRP B;  3T1H J;  2XMV A;  2IAJ B;  1FE0 A;  2HWH A;  2Z2Z A;  4GVB B;  2E9R X;  2UUW A;  1F0X A;  3Q8Q B;  2PEH A;  4MYT A;  2BM1 A;  4QW9 A;  4NYO A;  4K4S A;  3DXB A;  1WSV A;  3CSK A;  4I2Q A;  4L3K A;  5LSO A;  4C8N A;  3W9J A;  4F0H A;  1HNW J;  1QD1 A;  3DLB A;  3T6J A;  2BOA A;  5HAN A;  4LF8 F;  1Q79 A;  1R89 A;  4OX9 J;  2C2O B;  4ECW A;  5CAA A;  1GFW B;  2VG7 A;  3AXK A;  3IRX A;  4MKV A;  4K4W A;  3VAK A;  5K14 A;  3MGJ A;  4OX8 A;  2C22 A;  3TI0 A;  4FBT A;  2FDN A;  1F3F A;  2OD4 A;  2W9C B;  1X4G A;  3JSB A;  4NRU A;  2R7V A;  2GS8 A;  3HCX A;  1TL7 B;  2YWH A;  3GMG A;  2CAJ A;  3CUN A;  1KDN A;  4CNY A;  1S77 D;  2KG0 A;  4LF1 A;  2MLZ A;  2VFT A;  5J1E B;  2PSZ A;  4WE1 B;  4ZK7 M;  1IJE B;  3UCU P;  3ENW A;  2R8G A;  2HPU A;  2V2Z A;  4KH1 B;  3QJP A;  2J0S D;  2LQB A;  2G2Z A;  4DL0 C;  2DB1 A;  1ZZN A;  3VAL A;  4KKO B;  2XS5 A;  3KLH B;  1HBM B;  4UW2 A;  3N6N A;  3BYP A;  4NLW A;  2H54 B;  3N4W A;  1FHT A;  1IWA A;  3H5U A;  2IIH A;  4WU2 A;  4A8Q A;  3G6V A;  2B9E A;  2GHW A;  4Y65 A;  2H9Z A;  3TUI C;  4USM A;  5KFE A;  1RXO B;  3RG6 A;  3MI7 X;  2N7C A;  5H9F K;  1JWW A;  4F25 A;  2A2C A;  1XC9 A;  1IBC B;  1RHR B;  1ZAW A;  3LOU A;  4YB1 P;  4V19 X;  2NQP A;  3MMA B;  4N8O A;  3VZI A;  3ENA A;  3M4X A;  5KFC A;  4ZLJ A;  3P4U B;  1V5V A;  2D3O 1;  1X7V A;  1Q82 T;  4X2B A;  3CCW A;  3LWM A;  3MCN A;  5DM6 Q;  1VC6 A;  3Q8Y A;  1RAE B;  2ZIT A;  1O6X A;  1SJQ A;  2W7O A;  3RAM A;  5D3G A;  5BR8 F;  1Q8L A;  1L3K A;  3V4I A;  1HA1 A;  1UZD A;  3OD2 A;  1RAD B;  4OI4 A;  4E0D A;  2VAS A;  4JI7 J;  4FP9 A;  1T11 A;  1WOR A;  2DY9 A;  3UW1 A;  1DTQ B;  5FD1 A;  5CQG A;  3D1H A;  5K8O A;  2EC2 A;  4DV6 J;  1XNR J;  2RAQ A;  2XYH B;  1SH0 A;  3R9L A;  1L5U A;  3GB0 A;  1TZ0 A;  3KG4 A;  4FPR A;  2D69 A;  4JOU A;  2LXU A;  3RU0 A;  4KIA A;  1X4F A;  2AEF A;  4OJ3 A;  1W25 A;  3S7R A;  5EWF A;  1T03 B;  1KQS R;  4I64 A;  2RIJ A;  1FTR A;  3KLI A;  3OXL A;  1FJG J;  3PYG A;  3GYN A;  1UEU A;  1SC3 B;  1TKX B;  3TA2 A;  5C24 B;  1NZ8 A;  5CA5 A;  2FHM A;  1ZBT A;  1FWP A;  2VPW B;  2ZBI A;  2BW2 A;  2DH9 A;  3PR4 A;  1CJV A;  1FXR A;  2YWG A;  3I6P A;  3UR3 C;  4LR9 A;  2IA6 A;  3CIZ A;  2GO9 A;  2EFV A;  4B3M F;  2XY7 A;  4WFY A;  1DZ5 A;  2ZJP Q;  1GEH A;  3SCI E;  2XCA A;  1FXL A;  4CLY A;  3W60 A;  3I82 A;  2PI5 A;  1RHK B;  8ATC B;  2LP4 A;  4I56 A;  4PZV A;  4LIR A;  1B0V A;  3D6F B;  3QGI A;  3RBX A;  5A0Y B;  3PXG a;  2OTL S;  3GJS B;  2CJX B;  2Z56 B;  3BH7 B;  4OYX A;  5B0A A;  3U02 A;  1OQ3 A;  1RBO B;  5KFT A;  3BV8 A;  3CJQ A;  5E5N A;  5HMY A;  1NK5 A;  1NK0 A;  2K3I A;  1HKA A;  1MNE A;  1CS4 B;  2VH7 A;  2IRY A;  4P73 A;  3KK2 B;  3NEK A;  1JMT A;  1HBU A;  1HQE A;  1RJJ A;  2C3Y A;  3DGP B;  5AXL A;  4UZB A;  2J0W A;  2O1P A;  4P6Q A;  3U7J A;  3QJJ A;  2EKY A;  2AX1 A;  1RA7 A;  4EBD A;  2MB0 B;  3MUR P;  5HBM A;  3TEG A;  2LXI A;  1GTE A;  3GG1 A;  4DX7 A;  1JLF B;  2MPU A;  2OPS A;  3IFE A;  4CQ1 A;  3SDE B;  3MFH A;  2W9B A;  2UUA J;  2H5I B;  1X9S A;  5LJ5 Y;  3RJM B;  2AZ1 A;  2M88 A;  3FCH A;  1SC1 B;  4DCP B;  3OTD A;  3FSX A;  1YX2 A;  3G6E S;  3M8P A;  2QA1 A;  3M32 B;  4J9L A;  4QPX A;  4EO8 A;  3T5H A;  3B4M A;  3M2V B;  2GZO A;  2RKI A;  3TUJ C;  4KC5 A;  3EPG A;  2FVR A;  4K4V A;  3P3D A;  4Q45 A;  1LKZ A;  3PYE A;  4UTG A;  4MH8 A;  1TR0 A;  2XMU A;  1XQI A;  3KG0 A;  1N5Y B;  4KE5 A;  3FKB A;  3G8S A;  2DR9 A;  3DI6 A;  3JSM A;  1NK9 A;  2ZFH A;  2IY5 B;  2HFV A;  3UDV A;  1TUW A;  2V4J A;  3CO9 A;  3W5X A;  4DV2 J;  2IVF B;  3KG1 A;  4ZP6 A;  1S0N A;  1TFY A;  4F3M A;  4PQU B;  2LU1 A;  1OWX A;  1NJY A;  4XK8 C;  2ADC A;  4DPO A;  1RWM B;  2A6M A;  2EFG A;  1YZ7 A;  1WNE A;  4DUT A;  4AND A;  1OY9 A;  2L48 A;  1B0T A;  4NI2 B;  4TVA B;  1HNI B;  1AW0 A;  5IC4 B;  1IKW A;  4LSL A;  3H40 A;  1SQF A;  1RE1 B;  2FJD B;  2KT3 A;  1GXT A;  2M7S A;  2BJE A;  3IBF B;  2XMK A;  4PYA A;  4DOZ A;  2Q6C A;  4NA1 A;  1HWI A;  3AFG A;  4XTT A;  4KBI A;  3QT8 A;  2B9X A;  3FQL A;  2VJU A;  5HVF A;  4B9M A;  1T9U A;  2I9S A;  2PDA A;  3AD8 C;  2K2P A;  2X3G A;  3DYA A;  3LH2 S;  4RBV A;  4ED8 A;  3VAG A;  2E1C A;  2FY1 A;  1TL3 A;  3NXZ A;  1FDN A;  3CW2 C;  3CDW A;  2IM1 A;  3TO8 A;  4EWT A;  4WFZ A;  5H9E J;  2K7J A;  3BPS P;  1RTZ A;  2U1A A;  2YVS A;  1VRT A;  2HNZ A;  2OPP B;  1OS5 A;  3VV2 B;  2RHS B;  4F8R A;  3GPA A;  1OIA A;  2JRS A;  5DGB A;  1S10 A;  2J8A A;  3OVB A;  3BR8 A;  1FA0 A;  3H20 A;  4IOC Q;  2ZH1 A;  2WW8 A;  5AT1 B;  5IOL A;  2HFZ A;  3QWP A;  4DG1 A;  4CZC A;  2GX8 A;  2U2F A;  4QYZ J;  1EJ7 L;  2HIY A;  2LEB A;  3EGZ A;  4J91 A;  4RW9 A;  4RW7 B;  3D68 A;  1UEV A;  2JZ5 A;  1FD2 A;  2MJU A;  2CWK A;  1YKW A;  1JQG A;  2QT7 A;  3J7Z T;  3EMT A;  5EWG A;  1NK4 A;  4QCL A;  2BQ3 A;  2I5J A;  5DZ6 A;  3NOG A;  1ZH5 A;  1UAW A;  1NEE A;  4H54 A;  2KXF A;  4ZPB A;  5DG8 A;  2KFZ A;  4IG3 A;  1BQN B;  2VF3 A;  2DGT A;  4QIF A;  2R42 A;  1Q8I A;  3OQ2 A;  5KFF A;  2MQQ A;  4X62 J;  3J81 Y;  4I2P A;  2Q79 A;  5HLF B;  3MF5 A;  1HQU B;  4K4U A;  4NWB A;  2W01 A;  4A8Y A;  3RB0 A;  1U0H A;  2RIL A;  5GMK a;  4OV1 A;  1RBA A;  3NP5 A;  3QMQ A;  4NLR A;  2QA4 G;  2AMC B;  3CD5 A;  2V34 A;  4B9N A;  1Y9O A;  2JFK A;  2IM2 A;  3W2W A;  4BCA A;  2CZ4 A;  1F9F A;  1Y7P A;  5KFY A;  4KFB B;  3DOL A;  3TNV A;  4RKU C;  3T1A A;  4JI8 F;  3M8W A;  4NML A;  4RNN A;  4DPY A;  4IFY A;  2UU9 F;  3MMC B;  5E33 A;  1IBM F;  1U2F A;  3K8V A;  2A3J A;  1I5O B;  1F3V A;  3CJ2 A;  4KTQ A;  3J7Y U;  2DGO A;  2IAJ A;  4GVB A;  2ZHA A;  4J90 A;  5L1J A;  2KJV A;  5J2M B;  2KT5 A;  2AU0 A;  2G0C A;  3ELH A;  4FVM A;  1C0T A;  1DBD A;  2ZDO A;  5EUH A;  4LF7 J;  4DU8 A;  1YSJ A;  3E3X A;  2E1P A;  3IR6 B;  4TQS A;  3UNG C;  4B08 A;  2E29 A;  1RSC A;  3ZZT A;  1P9Q C;  2C2M B;  3M1V B;  3RTV A;  3X1L B;  2CNN B;  3HHL D;  5J2P A;  4KR0 B;  2CQP A;  2I38 A;  2XZW A;  2XMM A;  4F36 A;  4UOG A;  4NXM J;  2AYE A;  4KB7 A;  4ILL A;  2NPF A;  5BYQ A;  3MUM P;  3IRX B;  4DV3 F;  3D67 A;  3R5C A;  2XWX A;  4EBC A;  1U48 A;  3THP A;  2HND B;  4NLV A;  2DO4 A;  1N33 J;  2ZM6 F;  1OPZ A;  4I69 A;  1AXQ A;  1BGX T;  1V9O A;  3VWS A;  2DNZ A;  3H5X A;  2CIM A;  2LXF A;  4DPT A;  2VA3 A;  1LQ9 A;  2DH7 A;  1XR7 A;  2IM3 A;  1WUU A;  2Z2L A;  1TKT B;  5A8W B;  1Q53 A;  4X4V A;  3F73 A;  2VQF J;  2XUL A;  3A8E A;  3U1M A;  1S97 A;  3HZG A;  2KT2 A;  4HHH A;  3EE3 A;  3UWT A;  1S9E A;  2HFS A;  4ER8 A;  5IFM A;  4LR8 A;  4DFJ A;  3TZZ A;  2JWN A;  3HKW A;  4CCH A;  2AV5 A;  3N79 A;  3KLH A;  3OR2 A;  3ZNU A;  4DQI A;  5CYQ B;  4OZ1 A;  4ZVU B;  4OV6 A;  3W2V A;  2FB0 A;  1VQ4 S;  4ICL A;  2PI4 A;  3VGS A;  4IQM A;  1NPP A;  2QLX A;  3IBC B;  1EAR A;  3A13 A;  3M9M B;  2FLL A;  3FGV A;  2W7A A;  4ZVE A;  1RT6 A;  2CRL A;  5HRO A;  3QSY B;  2IVY A;  3H42 A;  3OLA A;  1M5S A;  3MAA A;  4DL5 A;  1B7Y B;  2CYY A;  1K47 A;  1RTJ A;  3BH6 B;  3MMA A;  4IR1 A;  1GMU A;  1NME B;  3IG1 A;  1F2G A;  1S1T A;  2F9D A;  2M4M A;  2CPI A;  4OZN A;  3BO2 A;  3J7A N;  1PBU A;  1Q8K A;  4DHV A;  1B0P A;  3M05 A;  1YRU A;  3PO4 A;  4LVN P;  2RQC A;  4ZPC A;  1Z1Z A;  1MN9 A;  2JSX A;  4M94 A;  4PPZ A;  2OPR B;  4NRT A;  4CT9 A;  3VGU A;  4KSE B;  1S76 D;  3HJF A;  2CQI A;  4LFB F;  1DTQ A;  1SI9 A;  2V4Q A;  3O1L A;  3QRP A;  3QBC A;  2B51 A;  1K0V A;  1RWN B;  3WC0 A;  1XMO J;  3ONQ A;  1R3N A;  2J7W A;  3ILL A;  1W7W A;  2BE9 B;  5KOW A;  3MR7 A;  3QRR A;  1Z2Z A;  2NSB A;  3BKU A;  5KFS A;  2CG4 A;  1U49 A;  1T03 A;  1VMB A;  3C6T B;  2QA4 S;  2ZH3 A;  1CPZ A;  3UPF A;  3A8I A;  2GFF A;  1S6Q B;  2KFY A;  1TKX A;  2V8H A;  2KYZ A;  3BKF A;  3UN2 A;  1RAJ A;  3LTO A;  4WZM A;  2B4V A;  2CAD A;  1CJV B;  2FJV A;  2HS0 A;  3AXM A;  5E3P A;  4ID5 B;  4JP8 A;  2R7R A;  2D1C A;  4NCG A;  2NUU G;  4W90 B;  2W2O P;  2Y1R I;  2MLY A;  2DGX A;  1S1W B;  2HK2 A;  4LR7 A;  5E3Q A;  2ZBC A;  3DU6 A;  2F8E X;  3M6W A;  2AW0 A;  1SV5 B;  1ZZF A;  3IXQ A;  2QLB B;  3AA8 A;  4O4R A;  4ZLN A;  5EX3 A;  1RAA B;  3J80 U;  3TAR A;  2KJW A;  3KKF A;  2HIQ A;  4PXD A;  3G71 S;  4W4M A;  2A2D A;  4ZPA A;  4HI2 A;  1WKJ A;  2R8H A;  2HHU A;  1P9Y A;  3THT A;  1X5T A;  5U47 A;  5GAD U;  1YQH A;  3B54 A;  2BZ2 A;  4FS2 A;  1WTB A;  3OTB A;  3CCE S;  5MLC V;  2VU5 A;  4HEA 9;  3SXL A;  2EK6 A;  4AFF A;  3DGP A;  4LF2 A;  2AWZ A;  3N5F A;  2R9L A;  1QSL A;  1Y11 A;  2ROE A;  2DRB A;  4BS2 A;  2BQU A;  1CLF A;  3CCS S;  2WVE A;  1NND A;  5ETL A;  2XNQ A;  3CD7 A;  3B4D A;  3US5 A;  3TWZ A;  3E01 A;  2XQC A;  3DHX A;  3GJR B;  2V69 A;  4X4O A;  1Y5I B;  1VQN S;  1HI1 A;  1NAQ A;  1S4E A;  1GQE A;  3Q2S C;  2UZA A;  5ETT A;  2DPI A;  2ILY A;  2ZUA A;  5ETK A;  1VQK S;  2HHW A;  1NB2 A;  1NDC A;  2CPZ A;  1AFJ A;  2YNH A;  3CE8 A;  4EYH B;  3K17 A;  4HH0 A;  1XMO F;  1JXV A;  1R8B A;  5J2Q B;  2FTR A;  4ZIV A;  1ELO A;  5F8H A;  2QA2 A;  2EBE A;  4FXV A;  1RT2 B;  1HBN A;  2W9A A;  2YWK A;  5GMD A;  1RU1 A;  5IXU A;  2RHQ B;  3VQS A;  3TUZ C;  2Y1L B;  4I4B A;  3G86 A;  2C28 A;  3DLL Q;  1CBK A;  5T7L A;  5HQ8 A;  2DR8 A;  4XAK A;  1S49 A;  4ZHR B;  3E8O A;  1L3V A;  2DHH A;  2D74 B;  1ZM4 A;  4O3P A;  1AZS A;  4ETX A;  3OVA A;  3PW0 A;  1D1U A;  1NO8 A;  3R1L A;  2HVH A;  2FC9 A;  1JLQ A;  1JLB B;  4KHM A;  1HNI A;  4ZCL A;  2V94 A;  4TKT A;  1ZYQ A;  2LDY A;  4H4K A;  4B3S J;  5JUM A;  5D4L A;  1KQK A;  4ILR A;  3C6U A;  5KFQ A;  2E5H A;  4NX9 A;  5FLX U;  2A10 A;  3PR5 B;  4IQX A;  1N5Q A;  4ALZ A;  1RWO B;  2GJF A;  2DNN A;  2VBZ A;  1ZAX A;  2N3L A;  4B9S A;  2AJQ A;  3OUY B;  2FHJ D;  1P1T A;  1CQM A;  1WC4 A;  4PAB A;  2YH1 A;  2MEW A;  4KPY A;  1NHK L;  1CUL B;  1FRH A;  2WON A;  1RWW B;  4IG0 B;  2SXL A;  1UVL A;  2QV6 A;  2XSJ A;  3I87 A;  4KAI A;  3TZY A;  4WFA Q;  3KLE A;  2ZZM A;  3GTY X;  3FFI A;  1KSP A;  2QIF A;  4WK1 A;  2EK1 A;  1TMM A;  2GVZ B;  2ZDP A;  2XCP A;  2XWY A;  5F0U A;  1LK5 A;  4HT7 A;  4DR6 F;  2G9O A;  4NOH A;  2AYM A;  2LA6 A;  2PT0 A;  1SL1 A;  1EP4 A;  3D6T B;  3OVS A;  1NJX A;  2GJ2 A;  2M52 A;  1VRT B;  5K8N A;  4IRC A;  2DHS A;  2E1M C;  4GO5 X;  4RW8 B;  4ED3 A;  5I3U A;  2OEK A;  1IBK J;  4B3O B;  3D0G E;  1U8S A;  4RW4 B;  1YBU A;  1IJF B;  2BKN A;  3BQ1 A;  2UVV A;  3NGT A;  5B0F A;  3WC2 A;  4ELT A;  3V81 B;  2HKE A;  2B9W A;  4RUA A;  3D5M A;  4DR6 J;  2HMI B;  1N33 F;  1GT8 A;  1W2I A;  1QDU B;  4RW9 B;  4WYL A;  4F4Y A;  2H4W B;  1C1C B;  4DV3 J;  1KN6 A;  4CLU A;  1YJ7 A;  4NXM F;  3KYL A;  4N41 A;  3ETO A;  1OY6 A;  4L76 A;  1KOO A;  2VB6 A;  2JVR A;  1OQ6 A;  4FYV B;  5CAB A;  4U67 Q;  3L95 X;  3RRH A;  1QSS A;  4ZP9 A;  1DLO B;  1JKH A;  4I2P B;  5HLF A;  4L72 B;  2IBO A;  2MKH A;  5H1S V;  1HMV A;  2VDH A;  2FLP A;  1SH2 A;  2VFV A;  3J7Z 5;  4B3S F;  3KJQ B;  2VZ9 A;  4LF7 F;  2MZR A;  2Y0S D;  4Q2L A;  5AJ3 J;  4DV7 J;  1Z2L A;  4DCJ B;  4TNO A;  2XMA A;  3CC7 S;  1Q86 T;  1O51 A;  2WRM A;  3OV7 A;  2X51 A;  4Q8E A;  1N54 B;  2YKA A;  2Z2Y B;  4K4Y A;  4KY3 A;  2H5E A;  1FX4 A;  4C97 A;  4ZCI A;  3TYT A;  4DL4 A;  3TQ1 A;  1BXN A;  2MZ1 A;  2HBR B;  2ZOF A;  3E2E A;  4I68 A;  3GLJ A;  1QSY A;  2UV8 A;  5DQG A;  4Q2M A;  9ATC B;  4KGK A;  1VJW A;  1KOH A;  2L9N A;  4RPF A;  3CD0 A;  3JXO A;  1DJ0 A;  1R43 A;  2MDA A;  4RZR A;  4P72 A;  5KG6 A;  5F9N A;  5J2M A;  2QEX S;  5IV4 A;  4IRD A;  4G3I A;  2C42 A;  2O3D A;  2VBY A;  3W62 A;  5LOQ A;  5BR8 J;  1VK8 A;  3MED B;  4ZS6 A;  2POK A;  3IC1 A;  1RGV A;  3KUG A;  4DL3 A;  2HVE A;  4D3G A;  2O5D A;  2VG6 B;  2Y1J A;  1I3O B;  3NNH A;  4JV0 A;  4Y28 C;  1BLU A;  1X5S A;  4PXB A;  3OSP A;  4F4K A;  1RA6 A;  1FVQ A;  2F7V A;  4O3Q A;  1RT3 B;  2OLW A;  2KZZ A;  1S9G A;  4QIG A;  2HND A;  2IJN A;  5CH7 B;  5KFK A;  3QLH B;  2MZQ A;  3CJ4 A;  2QX0 A;  1Q5Y A;  3T9Z A;  3D54 A;  3PTW A;  2E9T A;  3C16 A;  1YDL A;  4DR1 F;  5FJ4 A;  1U1K A;  4O3R A;  3QID A;  3HD1 A;  3BO4 A;  1T95 A;  1EET A;  2AP6 A;  3IN5 A;  2HHS A;  1OMS A;  1NDK A;  2JLF A;  4V1A k;  3TX0 A;  5C42 B;  5GAG I;  5GAH I;  1NRK A;  5HAO A;  1S9E B;  1J2V A;  4OJH A;  2HLU A;  3C14 A;  4RLE A;  4Y2M A;  2YWW A;  5AE1 A;  4QOT A;  4R0E A;  4OL8 A;  3K59 A;  4I1T A;  4IKA A;  5CYQ A;  1GXL A;  4OX6 A;  2GNK A;  2MQL A;  3W2V B;  5FDL A;  2HRY A;  3I0R B;  3NGU A;  3KNA A;  3B6B A;  2EFP A;  2HVD A;  1PBA A;  4ZVR B;  2IYI A;  1KLM A;  1UJ5 A;  4O3O A;  5HRO B;  4EK2 A;  3NNA A;  3MAA B;  2Z0G A;  3FZ2 A;  4A47 A;  3PW4 A;  1U26 A;  4KO0 B;  4WIQ A;  1S1T B;  3W5Y A;  4C6A A;  1ACM B;  2V9W A;  2UXD F;  1KWM A;  2MTL A;  2F4F A;  2BJ1 A;  3MPU B;  1TK8 A;  1JNZ B;  4EEY A;  4GC6 A;  1JLA B;  4FYD A;  2HLT A;  1BUX A;  4FYX B;  3KJV A;  2C3U A;  1FNX H;  4ED7 A;  2OPR A;  2G0I A;  4OYZ A;  6FDR A;  1D8Y A;  2D3Z A;  2C3M A;  5IT9 Y;  3D7S B;  4GRS A;  4USH A;  4HT5 A;  4DV7 F;  3IS9 A;  2CPE A;  1MW7 A;  1S5Z A;  4GO7 X;  1NUE A;  4W98 A;  4XDC A;  4ZVG A;  3SBM A;  2XI3 A;  3BPD A;  4EO6 A;  1YJV A;  2MXY A;  3T1H F;  1N6Q B;  4LF6 J;  2DNG A;  2FPH X;  2M2B A;  3L3C A;  2VOO A;  2HS4 A;  3T9N A;  4CM0 A;  5KG0 A;  4J9R A;  3N5B A;  3QPI A;  3CCM S;  2HVI A;  1RHJ B;  1PJ5 A;  2CQ2 A;  3JTP A;  1KTQ A;  2OFG X;  4HI1 A;  1JLG A;  2FZC B;  3PIO Q;  1IUJ A;  3PAC A;  4G1P A;  4CH0 S;  4OX7 A;  1S6Q A;  1IBK F;  1QVF R;  2XNR A;  1XK8 A;  1UTA A;  5J2N B;  1HNV B;  1RP5 A;  1ZS6 A;  2BKP A;  4NE9 C;  3PX4 A;  1Q78 A;  2VKR A;  1EKR A;  2DIT A;  3BF4 A;  4NLY A;  4ZJO A;  5IM0 B;  2N3O A;  3GSD A;  3JQM A;  5IWA J;  4GC7 A;  2ZBQ A;  1YIT S;  1L3S A;  1U2C A;  1WC1 A;  3BEG B;  4CLS A;  3UO0 A;  1FX2 A;  4F2R A;  2OO4 A;  2NZ4 A;  1NSK L;  3TJ8 A;  4CLL A;  1K1S A;  4PAA A;  2CNO B;  3M2R B;  1U1L A;  1HD0 A;  1SV5 A;  3EM1 A;  1U1N A;  4NL5 A;  1AFI A;  1LXN A;  2Z2M A;  2QSF A;  3KDN A;  5B09 A;  1VQM S;  3JS9 A;  4AL7 A;  2QGF B;  4UT4 A;  4DV0 J;  3I5C A;  4DPU A;  4TN2 A;  2CQC A;  1DQ9 A;  4GMK A;  1VQ9 S;  3NS7 B;  5K9F A;  3R7S B;  2N82 B;  1YJT A;  1YZ6 A;  2B0G A;  3DXS X;  1TFW A;  1SC4 B;  2X7I A;  4HAC B;  2VPZ B;  4FF4 A;  1TEL A;  4G1Q B;  2H1Y A;  2IC3 A;  2J7K A;  2OGU A;  3TZW A;  4Q5V A;  2ZH5 A;  2BDP A;  1FRL A;  1REG X;  2RD5 C;  3QGP A;  3QIP A;  4C8M A;  4B3M J;  2DVI A;  5LT5 A;  2KHC A;  3PRB A;  3HX9 A;  5GVQ A;  3V6H A;  1FFG B;  2F8M A;  1JX4 A;  4C8Y A;  3U1N A;  4OI1 A;  4YHH J;  1JJC B;  3HHD A;  4DR2 F;  1FRI A;  4OI0 A;  3PO5 A;  2IA0 A;  2WCX A;  2AF6 A;  3SFG A;  2ACY A;  1FJG F;  2BJ9 A;  3DRP A;  4M5L A;  3L7P A;  4WU3 A;  2CVE A;  1S7H A;  1KS2 A;  5KFB A;  1X0F A;  2B5J B;  3D6H B;  1RLC L;  5AXM A;  3M2U A;  3VAI A;  2YNH B;  4M5I A;  2RS2 A;  4WFX A;  4C98 A;  4QW8 A;  3ET6 A;  5L1I A;  3RAX A;  1MN7 A;  4A8F A;  2F4V F;  1PAE X;  5JMN A;  3K5P A;  3M8R A;  5J2Q A;  1H2T Z;  1BHN A;  4FZV A;  1T9V A;  1Q7L B;  2G0J A;  2K8G A;  3BSC A;  4C0O C;  4Y3C A;  1NSP A;  5ETQ A;  1BY9 A;  3MPV A;  3R27 A;  2Y1I A;  1RCX B;  1IWG A;  4AXJ A;  1R31 A;  3S1T A;  3BGO P;  2ZC4 A;  2ZJQ Q;  2F65 A;  3AB2 B;  4ED2 A;  3OR1 B;  2JLE A;  5L9X A;  1WC5 A;  1LOU A;  4N5S A;  4DQQ A;  1N56 A;  2BRK A;  2CG8 A;  1ULR A;  1AZS B;  1F6T A;  3AHP A;  4NLD A;  1VBX A;  3R5A A;  2OFH X;  4ATN A;  1REV B;  2NXE A;  3IM9 A;  5CYM A;  2W9C A;  1JLB A;  4LFC J;  6AT1 B;  1IKY A;  5B0B A;  1ZM9 A;  5KG5 A;  2IPO B;  2RE1 A;  4C8Z A;  1OSC A;  3QGG A;  1NKC A;  3VQT A;  3FK4 A;  3HUL A;  3OUY A;  5KFJ A;  4M5N A;  3TX8 A;  3IBW A;  4CLP A;  3THV A;  3QAE A;  3MPW A;  2RS8 A;  4WE1 A;  1XBW A;  4NAS A;  4ZVF A;  4ZVO B;  3Q8P B;  3FEZ A;  2JVO A;  4OZ2 A;  4QYR A;  4CLW A;  3PRV A;  3KLE B;  2L08 A;  2C2D A;  2BAN B;  4PKD B;  4QJV A;  6FD1 A;  2HQD A;  1RZM A;  2V2Q A;  3CUL A;  1UFK A;  2MZJ A;  1R8C A;  3K5M A;  4ZP7 A;  1EQM A;  2YY3 A;  4U7C A;  5LMU F;  1RTD A;  3OXF A;  2LEA A;  2HQ3 A;  1D9A A;  2WBR A;  2LEC A;  1VBY A;  1UWA A;  1UZH A;  1GNK A;  1UVN A;  1R0A A;  2BXJ A;  3MEE A;  5HMW A;  1D0E A;  5G0R B;  2F3J A;  3MD3 A;  2YNI A;  3CXC R;  2LCW A;  2HMI A;  1MWQ A;  3W9H A;  3CJ8 A;  2QL5 B;  5L38 A;  4WP9 A;  5D8H B;  2KI2 A;  2QL9 B;  2GW8 A;  4LRF A;  5D3G B;  3S01 A;  4DN9 A;  2VL1 A;  3MAH A;  2RNE A;  3J7Y I;  4TYB A;  1U2R A;  3DDN A;  3Q8V A;  3W1Y C;  4MT1 A;  4AXI A;  1OY8 A;  4BC7 A;  1XR6 A;  3R97 A;  4F3Q A;  3ZNJ 1;  3M9N B;  3KMS A;  1DLO A;  1JKH B;  2CWX A;  4R8U B;  2ZUG A;  3KTQ A;  2GML A;  1HMV B;  4ZLP A;  5FLX Y;  5AXK A;  3I5B A;  1SL2 A;  1LEO A;  2PII A;  2R8K A;  1SQG A;  4N76 A;  1YJW S;  3BB5 A;  2YH0 A;  1G6B A;  5CCL A;  2ZWP A;  2JH3 A;  3IO1 A;  3KLI B;  5D0E A;  3MR5 A;  4ZN3 A;  3HPO A;  3LAL A;  3HD2 A;  3HM9 A;  3W64 A;  1ITP A;  3I32 A;  3O8W A;  1FK9 B;  4DV5 J;  3KLV A;  3CIM A;  2HZC A;  4YHH F;  1ZPV A;  2WTF A;  2X3D A;  4YB7 A;  4ZVT B;  2E1R A;  3ISN C;  3MCO A;  5KFP A;  4P2F A;  3PKY A;  1L3T A;  3PKM A;  4GKJ F;  2K3K A;  2BBE A;  2ABY A;  4ZVH A;  7AT1 B;  4EUV A;  1NJZ A;  5ETN A;  5RUB A;  1EIY B;  4ECT A;  4Y2K A;  3GQC A;  4LFA F;  3MED A;  1RU2 A;  2MQ8 A;  3DNC A;  2FJW A;  4BHQ A;  1VHI A;  4C7Q A;  4LF8 J;  4RR5 A;  4KPC A;  3G87 A;  1UVI A;  5A0Y A;  5BXI A;  2CQ4 A;  4DBQ A;  4IO1 A;  2W2Q P;  4OI3 A;  2UUA F;  1CVJ A;  4Y2A A;  2DNQ A;  1WEL A;  2HQI A;  4KV8 A;  5T41 A;  5HSP A;  4DV0 F;  4DR3 J;  1DFD A;  3KJV B;  1VBK A;  3R7N B;  3MCS A;  1WHY A;  2XI2 A;  4P10 A;  4CO2 A;  4ZCK A;  1HBU B;  4CIO A;  2QL7 B;  1YBT A;  2HHH F;  4FVC A;  1JLC B;  4D3H A;  3TAQ A;  4PG6 A;  1E6Y A;  3IMQ J;  5KFR A;  4K7Q A;  1JLF A;  2OPS B;  3LGH A;  4L75 A;  1FDB A;  1JNR B;  2W9B B;  1VC0 A;  2VUG A;  2KU7 A;  5KFX A;  2C3P A;  2CDQ A;  4USI A;  4QIW D;  1H72 C;  3M8P B;  1GMV A;  2WSE C;  2FC8 A;  2DD8 S;  2ZOM A;  3PG9 A;  1PG5 B;  3M2V A;  4N77 A;  3NNC A;  3CJR A;  5I42 A;  2CJ9 A;  1PAU B;  3MCM A;  3MPY A;  3GG0 A;  5FDL B;  3DU5 A;  4DQP A;  1T02 A;  4LF6 F;  1IVZ A;  1YJU A;  2GGP B;  2MKS A;  1WAC A;  1NB7 A;  2V4J B;  3HT3 A;  4OLO A;  4EZ9 A;  1M0S A;  3EZO A;  4OHV A;  2FHO B;  4ILM A;  2HQF A;  1VHF A;  3OFH A;  4B9L A;  2CVI A;  2XGP A;  1LFW A;  3G82 A;  1DQA A;  1IBM J;  2R8J A;  1I94 F;  3HO1 A;  2PA3 A;  3ZFV A;  2RSQ A;  2YKO A;  1SBR A;  2RQ4 A;  4N56 A;  2LQ8 A;  1WOP A;  1XEZ A;  4K2J A;  5B0C A;  3CED A;  1YK9 A;  2W2P P;  4CO0 A;  4HR2 A;  4Z7C A;  3GJT B;  1FCA A;  1UP1 A;  4WKY A;  5KT2 A;  1O8B A;  2JLG A;  3CCU S;  3HSJ A;  1HWU A;  3WIU A;  1G2E A;  4BWM A;  5I3P A;  1T9X A;  3IS9 B;  4NLS A;  5KT6 A;  3JAM Y;  2D7S A;  3KUH A;  3EWG A;  2AJF E;  1TUG B;  2EW9 A;  4KGV B;  2ERR A;  2VDI A;  1HAR A;  1SIZ A;  3CCR S;  1Q95 G;  1IQZ A;  2ATC B;  1LW0 A;  2PA8 D;  4X62 F;  1N4L A;  1IKV B;  3BDE A;  1UPP A;  5K5M A;  4DR7 F;  1PYO B;  2HHP A;  2RB7 A;  4NLU A;  4RJV A;  4Y34 A;  2ZH7 A;  2WVC A;  1GTH A;  2VA2 A;  3H2V E;  3KLG A;  1VIS A;  1MML A;  3AOC A;  5HK4 A;  3PRD A;  2HNZ B;  2OPP A;  2XM3 A;  2HHT A;  5IZH A;  2B8Q A;  4DSJ A;  4JV5 F;  2G4B A;  3Q23 A;  4JI6 J;  2EEY A;  3N9U C;  1X0P A;  1W2B R;  4ETZ A;  1LFP A;  3NS6 A;  4LIW A;  4LRE A;  3T5J A;  5HQM A;  4C9D A;  2LYV A;  4RW7 A;  1VK3 A;  5DZ7 A;  2V4R A;  1YRX A;  3FC9 A;  3GYG A;  3L4B C;  4KGM A;  1SVD A;  3M8Y A;  3TVK A;  1UL3 A;  2YQ3 A;  2YWE A;  4RBT A;  2I5J B;  5CD4 H;  2N4D A;  1PYT A;  5HQL A;  4OI6 A;  2PN6 A;  5JVH Q;  1WOO A;  3NAH A;  4Z7Y A;  3D0H E;  2NXN A;  2YXL A;  1Z4U A;  2HNY A;  3UN5 A;  4ES2 A;  3HT0 A;  3AOD A;  3OSN A;  3RBE A;  3I9Z A;  5DDQ C;  3SQG B;  1T05 B;  3DRX A;  3I0S A;  4LBH A;  3AOB A;  2DIU A;  3TP2 A;  4ECZ A;  5BYS A;  4DV4 F;  1BE4 A;  4O44 A;  3O2I A;  2F40 A;  4ENO A;  4U96 A;  3MXH P;  1UW9 A;  2OAU A;  4X64 F;  5L39 A;  4DSI A;  3W2W B;  2F8H A;  4X4S A;  2V8D A;  2J6U A;  4NLX A;  4ECR A;  3OBI A;  3DOL B;  4KFB A;  4DXL A;  3GSI A;  1FE4 A;  3KLF B;  3QGH A;  2J6T A;  3MMC A;  4JYA F;  3OFF A;  4YS2 A;  4DLG A;  2M9K A;  5I4M A;  3QRQ A;  1SB6 A;  3NMA A;  1RI7 A;  4U9R A;  1WEX A;  4TY8 B;  3Q8R B;  1FT8 A;  2RRB A;  2PO4 A;  4ELU A;  1RAO A;  3M2U B;  3QFH A;  4DV2 F;  3ET6 B;  3MUV P;  3L7U A;  1VQ5 S;  3NCQ A;  1X5O A;  5M2P A;  4JI3 F;  1EHW A;  1SQE A;  1UFW A;  2NLW A;  2QJ3 A;  3KDO A;  5A6W A;  1FDA A;  3DLJ A;  3HFV A;  4CTA B;  2AHO B;  3AQP A;  4TU8 A;  2XLI A;  2CFX A;  3SI8 A;  4B9V A;  2R4F A;  4MFB B;  3Q22 A;  4F4Z A;  2XZT B;  2IHR 1;  3A12 A;  3GR0 A;  3FSI A;  1KVJ A;  3DLG B;  3PFO A;  2G1H A;  1BD6 A;  3BGR B;  5D6G A;  3WIV A;  1R8P A;  1E6V B;  4J9N A;  3CCL S;  3KK3 A;  2M8D B;  2J76 E;  2OUG A;  2HQC A;  2YX1 A;  1T3O A;  2COL A;  4TY9 A;  1NK8 A;  4KQZ A;  1REV A;  1R6V A;  4RO0 A;  5CYM B;  2HGM A;  2XMT A;  2RU9 A;  5M2R A;  1XMQ F;  1H74 A;  1MLA A;  1CC7 A;  2AYG A;  1YIJ S;  4NLG A;  3J81 U;  1JXL A;  2NZC A;  3I31 A;  2MYF A;  4I7F A;  2E66 A;  1K8A T;  4DUY J;  1FJ7 A;  4QWD A;  3CCZ A;  1WF1 A;  1QTN B;  1PIL A;  1A0O B;  1D9D A;  1UET A;  2BJD A;  2LQJ A;  3H98 A;  3R5G A;  2BAN A;  2X1G A;  1VLY A;  2YNF B;  2HFN A;  3FNN A;  4X4N A;  3WX4 A;  3I4H X;  3G96 A;  4C11 B;  4M1K A;  2YKN A;  2KKH A;  4P52 A;  4ICL B;  3EIC A;  4RBU A;  4OLP A;  2GQ2 A;  1FNM A;  2FLN A;  3CTR A;  3GCW P;  2JL9 A;  2A0F B;  2Z4P A;  4WJB A;  4J7C A;  3MEE B;  1RTJ B;  1RWV B;  4IOB A;  2MMY A;  2YNI B;  2CPX A;  1RT4 A;  2ASJ A;  3IG1 B;  3OL9 A;  1B64 A;  1HNZ J;  3N01 A;  5L46 A;  1K73 T;  4J9O A;  4UOF A;  1VGY A;  3TJA A;  4X4Q A;  1R0B G;  1OO0 B;  2I6W A;  4ED1 A;  4A4J A;  1S1V A;  2XO6 A;  1TKZ A;  2BUN A;  1FKO A;  3GWC A;  7FDR A;  1GXU A;  2JC1 A;  3I96 A;  3SZ2 A;  2UUB J;  3NMR A;  4R8U A;  3CD6 S;  3BGF A;  4FYY B;  1MU2 B;  3IP0 A;  3OXG A;  3QT7 A;  1KQG B;  4NZ6 A;  2BAC A;  3IR5 B;  4WXO A;  2DH8 A;  3FMB A;  3HHL A;  4URG A;  1N36 F;  3FVY A;  5KFL A;  4JI7 F;  1X9M A;  4P74 A;  3CDU A;  4TLQ A;  1YRT A;  3HXM A;  2PEB A;  2E5J A;  4Z2X A;  4MK9 A;  1RHM B;  3TR5 A;  1APS A;  2FQQ B;  2ASY A;  2P9E A;  2RML A;  1X4C A;  5D4P A;  3PZP A;  4O4G B;  1DAR A;  4WYW A;  1NK7 A;  5AE3 A;  2CDR B;  2Q1L A;  4ID5 A;  1HNX J;  2X1F A;  1QUP A;  1SJF A;  1S72 S;  1TVR A;  1KR4 A;  3MAQ A;  3DM2 B;  4QU7 A;  2KXH A;  1S1W A;  1Q81 T;  2YBV A;  4PUO A;  3MM8 A;  2OTJ S;  2HS3 A;  3K5N A;  1C4A A;  3EGW B;  5IS2 A;  4R5P A;  3PY8 A;  1XNR F;  2KDO A;  1DAX A;  1ZET A;  1U25 A;  1K1Q A;  3G9C A;  1HWL A;  4DR5 F;  1VQ6 S;  1D9F A;  2PFF B;  4KV8 B;  4NMX A;  3GV8 B;  3P96 A;  4DEZ A;  5CZV A;  5KFM A;  1VQL S;  3P5B P;  1F2H A;  2I2Y A;  3AJD A;  4C0B A;  1FJC A;  1KVI A;  2GCF A;  5ETS A;  2ATL A;  3BSO A;  3NGD A;  4B3R J;  3KK1 A;  3R6L B;  3ILI A;  1NJI T;  2AJ2 A;  2WB1 D;  2LVW A;  4DR5 J;  4KYZ A;  1WI6 A;  4P75 A;  4USJ C;  4ZKA A;  4F3O A;  2AKW B;  2P6T A;  3FZB A;  2VV5 A;  3QNW B;  1TU0 B;  1LV5 A;  3E01 B;  4X65 F;  4LT6 A;  3OW2 R;  3GFX A;  5KTQ A;  4LSZ B;  4ZJQ A;  2HZV A;  4DN0 A;  2MGZ A;  2RDJ A;  1V3R A;  1M5H A;  2HK3 A;  2P8I A;  4JI2 J;  2HBZ B;  3ETM A;  2YKQ A;  4F7V A;  4WZQ A;  2B56 A;  4JV2 A;  2PMW A;  4KRW A;  2GGP A;  1LWC A;  2XHW A;  1QJH A;  5HL7 Q;  4OYO A;  2KL8 A;  4HDG A;  3OHA A;  2B6A A;  2W8K A;  4P2S A;  1OYE A;  5KG4 A;  2JFD A;  1WKL A;  4Y0F A;  4ZHR A;  2LQ5 A;  3AQO A;  1RYS A;  4FF1 A;  5L1K A;  4CNZ A;  2C1E B;  3QAU A;  2OEJ A;  4HTI A;  4NEY A;  3TJ9 A;  4ZLL A;  2Y8W A;  2O67 A;  3BQ0 A;  1SC6 A;  3ILJ A;  4OZJ A;  4JI5 J;  1VIX A;  4I0W A;  3KWM A;  1NZA A;  1N5V A;  5KOX A;  1TK0 A;  2IFX A;  3B82 A;  4FKY A;  4ZMM A;  2W4D A;  4I6A A;  4WWS A;  1M90 T;  3ZZY A;  4J9M A;  1URR A;  3BN4 A;  3GV7 B;  1XER A;  2WON B;  2OPQ B;  2XS7 A;  2CZ9 A;  2NXJ A;  3TW0 A;  2DNL A;  3UE2 A;  3ENV A;  3H90 A;  4DCO B;  1IKV A;  1PC4 A;  3HHN B;  2VIH A;  5ITH A;  4CH1 A;  4PRF A;  4C8L A;  4Z37 A;  3M30 B;  4JI0 F;  5D4O A;  2FVP A;  1CJT B;  1H6K X;  4C8O A;  1F5A A;  3PFE A;  4E98 A;  1S0V A;  1GAO A;  4FS1 A;  4L3N A;  2QE5 A;  3OTE A;  1EP4 B;  2O01 C;  5K8M A;  4B9U A;  5KFU A;  1WHV A;  3BS9 A;  4RW8 A;  5I3U B;  3LAN A;  2B8P A;  4B3O A;  4RW4 A;  2XY6 A;  1P27 B;  4K59 A;  2XS2 A;  3SQO P;  1X4A A;  2YWF A;  4FDF A;  4G1I A;  2CQ1 A;  2I0X A;  3ZC4 A;  2F5G A;  3L9Z A;  4I6Y A;  4LRB A;  2RUS A;  2OEL A;  5EWE A;  3K89 A;  3PEH A;  3W8P A;  1V3S A;  3QWU A;  4JB8 B;  4FXW A;  1XWL A;  1KEK A;  2RRN A;  2ZM6 J;  1VQO S;  2M5Y A;  3EDR B;  4WP3 A;  4OZ3 A;  1T94 A;  2IMO A;  4K8R A;  2DNH A;  3NS5 A;  3UDC A;  5DQH A;  4LQ9 A;  1UJ4 A;  1B3T A;  2VG5 A;  1S6P B;  3IAM 9;  2HNY B;  2ALZ A;  4L74 A;  1TL5 A;  3NGS A;  3JAM U;  2UUC J;  1R0C B;  2VC1 A;  3ZZU A;  3AT1 B;  3MD1 A;  2MY8 A;  1HR0 J;  4FYW B;  4G65 A;  1B7F A;  1N34 J;  3QO9 A;  2EPI A;  1KON A;  3UFC X;  5F0W A;  5A8R A;  2ASD A;  5DLG A;  2WVB A;  1IXK A;  2AJ4 A;  2GC8 A;  4AYB D;  5A76 A;  1SJ3 P;  2GMH A;  3T1Y F;  1DRZ A;  2UP1 A;  5IT0 A;  1YJR A;  4NXN F;  2R7U A;  2DYA A;  2RF2 B;  1RT7 B;  2VFS A;  3HVR A;  1VRU B;  4M5G A;  2JEI A;  1BQM B;  2UU9 J;  1U47 A;  2R7Q A;  1CG2 A;  1WDD A;  3IM8 A;  1PIE A;  1FRX A;  5IC6 B;  2RH3 A;  5KAK A;  2BAB A;  5J1P A;  2KG1 A;  3H59 A;  2FYX A;  2BMB A;  2BRL A;  2MHN A;  2IMW P;  4KHP J;  2YPZ A;  3BBC A;  4P7V A;  1ICE B;  1HWK A;  3GII A;  2ADB A;  3RRK A;  2ZH8 A;  3F56 A;  4M5D A;  4JYA J;  3HVT B;  2XEX A;  3NGR A;  2VG6 A;  5AXN A;  1OSD A;  2D41 A;  2N7Y A;  2QLF B;  5E3A A;  4JI1 F;  1RTI A;  3BGR A;  3W66 A;  4YY3 J;  3N0V A;  2HUR A;  2DCU B;  1E6V A;  2QMW A;  5ETM A;  3W65 A;  3U27 A;  3GIK A;  2R2U A;  4K5S A;  3V2U C;  2QC3 A;  1DQ8 A;  1S9G B;  2HFO A;  1V6H A;  2BX6 A;  3ZXW A;  2B3T B;  5B08 A;  4ZDN A;  1GK8 A;  1VQS A;  3PX6 A;  1YTY A;  2PC6 A;  4RX6 A;  2IVM A;  4YR3 A;  2DXD A;  4MAK A;  1SKS A;  4QYZ K;  2LKZ A;  4NLO A;  4LUB A;  2L9W A;  3HZE A;  1ZTT A;  2CQD A;  4DV1 J;  4ECX A;  3FCW A;  2LMI A;  1EET B;  3SSR A;  2DGS A;  5E2Q A;  4XO0 A;  1QLN A;  5C42 A;  4U8Y A;  4WFB Q;  2FUG 9;  2H5J B;  1F5B A;  3CJ0 A;  3V5R A;  1PGZ A;  1AUD A;  4JUZ A;  2WSF C;  3TRG A;  3DC2 A;  4NCA A;  4PWD B;  1KQF B;  4LBI A;  3DOM B;  4LBP A;  4C11 A;  4CP5 A;  1RWP B;  3MM5 A;  2OSQ A;  1S1U A;  2YKN B;  3FRZ A;  4JI6 F;  4BDP A;  1VCT A;  2K7K A;  2DGW A;  1U6F A;  2ZD1 A;  4NA2 A;  2ALY B;  3CGI A;  4F4X A;  1RAB B;  4V19 J;  4KGZ B;  1KLM B;  2UV8 G;  3SMZ A;  2FJE B;  5D78 A;  8AT1 B;  2E9Z A;  2QMX A;  5GAD I;  1L3U A;  2JEF A;  3DLH A;  1GMW A;  4KO0 A;  2NSC A; 
#chains in the Genus database with same CATH homology
 2CAD A;  3QSI A;  2F1F A;  2WVE A;  2FGC A;  2WVF A;  3PHT A;  2HZA A;  3LGH A;  2Y3Y A;  1Q5V A;  2CAJ A;  1Q5Y A;  2BJ8 A;  2NZC A;  2BJ1 A;  2WVB A;  3BKT A;  3BKU A;  3OD2 A;  2BJ3 A;  2WVC A;  2WVD A;  3BKF A;  2CA9 A;  2BJ9 A;  2PC6 A;  2BJ7 A;  2HZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...