1Q5YA

Nickel-bound c-terminal regulatory domain of nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
TQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Nickel responsive regulator
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5yA00
2WVEA 3PHTA 3BKFA 2WVFA 2WVDA 2BJ3A 2BJ1A 3BKTA 3QSIA 2Y3YA 2CADA 3BKUA 2FGCA 1Q5VA 2CAJA 2WVBA 2PC6A 3OD2A 2BJ7A 1Q5YA 2CA9A 2BJ9A 2BJ8A 2HZVA 2F1FA 2HZAA 3LGHA 2NZCA 2WVCA
chains in the Genus database with same CATH superfamily
3HPOA 5CD4H 2WRMA 3KDNA 4A48A 3CT9A 2OELA 3DGPB 1RA7A 1TV6B 5D0RA 4TLRA 2VPYB 4FS2A 2E1AA 1FRIA 4G1IA 3CJ0A 3UN5A 4EZ6A 1R0AB 3WQPA 4ANDA 2PDAA 2XQCA 3K57A 3DXBA 2YH1A 2RF2B 2UXDF 1KTQA 3GZ7A 4DR4F 2WVBA 4NA2A 2CPHA 4YP3A 1S1TA 4WU3A 5LMNJ 1T9UA 5DZ6A 4F8RA 4I2QB 3IWNC 4RBTA 2IRYA 3GR0A 2DHAA 5KT5A 4YHHF 2LQ8A 4ZLJA 3G71S 2XO6A 4QQBA 3D1QA 2IVMA 5KTQA 4M5MA 1GH8A 2QL5B 2MXYA 3BF4A 1FKPA 2D3UA 4TVAB 2QZ8A 1FJEB 3GJSB 4DFMA 2V8HA 3Q86A 2K1RA 1RLCL 1VK3A 4KHRA 2IRXA 3VWSA 1UVMA 1WTBA 2AEJA 2HNYB 3M8PB 1OWXA 3P45B 1PJ6A 1YZ6A 2DVIA 3BJYA 5C5JA 1DRZA 2YVSA 5A76A 5KG1A 1D0EA 2BZ2A 3A13A 2BABA 3QIDA 1M5VC 3OLBA 2HBQB 2J9EA 5SUHA 3FSIA 3IO1A 3OQ2A 1WDDA 4QU7A 3MM9A 2VD3A 2ZDPA 4U96A 5E3PA 3KG1A 1RA6A 1U1QA 2DH9A 5EUHA 4KO0A 5KFVA 2LXUA 2LEPA 3S6EA 3QRRA 1KHWA 2QL7B 1CQMA 5AXLA 3MDFA 1C0TB 5KT2A 2HHVA 5HJXA 4I6WA 2UUWA 4IG3B 1TKTB 2VG7A 2JZ5A 2DR9A 2AT1B 2NSCA 4GMKA 3BGFA 1R0CB 4R5PB 2W1BA 4CZCA 4J9PA 2M8HA 4RR5A 4O3PA 2AGOA 3FBBA 3QZ7A 1HPZA 5F9NA 2GO9A 1U4BA 3I55S 4YR3A 4NLDA 3RZAA 3N28A 1XMQF 2UUAF 1OJ4A 1FK9A 2VFSA 4FS1A 3M7VA 4FN5A 5GAGI 1M5HA 2VFRA 4RNHA 1NK5A 2RU3A 1FD8A 2PI5A 4KFBB 1QTNB 3NGUA 5CYQA 2YNHA 1S9EA 4J7CA 1HARA 5IOLA 5KFKA 5GVQA 5F8GA 4B3SF 4USUA 3FZ2A 1HA1A 5B09A 1VQ5S 1FD2A 2CPJA 1DJ0A 5IZHA 1NKCA 2R8GA 1R7IA 1DFDA 1LFWA 1U2CA 2YNGB 3KLEB 1N5TA 2IAJB 3A8KA 3FNNA 3D68A 5K14B 3US5A 8ATCB 2KXFA 2XI2A 2JFKA 5C2CA 2AP6A 2GVDA 4WP3A 5E5NA 1WC4A 5D15A 1NHVA 2OH2A 2J9DA 2V8DA 1HBMA 3C15A 2DGQA 2HQIA 4Q45A 3H90A 4J9RA 2F4VF 1JLCA 1RGVA 4ZPBA 2ZH1A 1VJWA 3ZZYA 1RJJA 2HLUA 5I42B 1U1PA 2ZOGA 1VLOA 4YFUA 1URNA 3VTIA 1NH7A 5HBMB 1U6FA 3THVA 4USTA 4IR9A 2C28A 1P6TA 4ZS6A 5GAHI 4BC9A 1IQTA 2XHWA 1SKRA 2WONA 2LXIA 3ZTOA 2XZDB 2MQ8A 2IA6A 2RU9A 5J1PA 2QEXS 3O44A 1UJ6A 2U1AA 4ZA1A 4M5DB 1EX8A 1HNZF 1N54B 3DC2A 2J7WA 2U2FA 4ZHRB 4U7CA 1S1XB 4JBCA 1S6OA 4IOBA 3NG8A 2CA9A 2EFQA 4A8QA 5DM7Q 1MWYA 3OBIA 4X4SA 3FGVA 2DHGA 4DL3A 4DR6J 2M5YA 2XYPB 4IDKB 4B9TA 4X4RA 1Q8BA 3AAWB 2V5HG 3NWGA 2RSQA 1OQ3A 2GFFA 4LRBA 3BGRA 2HHUA 3QGGA 3CD0A 3BQ1A 4DL6A 2FLLA 1X9WA 2AQ4A 2FZGB 2LCWA 4G1PA 2YY3A 2ZH5A 2HKEA 2J0SD 2BJ8A 4HACA 2FYXA 2XCPA 3VGSA 1TKZB 1OS5A 5KFIA 2HQFA 2VA2A 1XR6A 4EU0A 3D66A 1U0SA 2AU0A 2YKNB 4CNZA 1MN7A 4J9QA 3R2CJ 3DCAA 1RHMB 4JI7J 3JYTA 3G8SA 1VQ9S 1C1BB 4DLEA 3VAMA 1HI1A 2G1DA 3R2DJ 1WD6A 3W2WB 1Q7YT 1XQIA 2YWHA 4YB1P 2UU9F 1DHMA 2ZWOA 3CPWR 3ZO7A 4NRTA 4ZJQA 3IP0A 2HHHJ 2UUBF 3ICLA 1CULA 2OPSB 3WIVA 2PI4A 2GIRA 3RRKA 1H0HB 2KZZA 4DCOB 4EZ9A 3HZGA 3FUYA 4IQXA 3BM7A 1N5YB 4RW8A 1ZPWX 1EZZB 3MZIA 1X7VA 1WF2A 3MCSA 2XZTB 1S97A 5J1EA 3B54A 1U25A 3H5UA 4PWDA 2ZWPA 4O0IA 3J7Z5 4RW4B 2Q3PA 4YY3J 1OY9A 2G0IA 5T7LB 3G87A 1EARA 4ER8A 4DL4A 3BBCA 1UETA 2DRDA 3D67A 4OV6A 1RAEB 1GT8A 4K4VA 3FK4A 2OSRA 5JXSA 4JV0A 2BW7A 2Y0SD 2XG8A 1X9SA 4NZ6A 4ED7A 1RHQB 1KFSA 4N8NA 1HIYA 3AB4B 3D7SB 2I1RA 4AL7A 4GVBA 5A2QY 2QSFA 2R2TA 3OR2B 4F3MA 3OJUA 5E3RA 3R5JB 2HGLA 2O67A 2LA6A 2AW0A 3M05A 4FYXB 2FUG9 3W1YC 3WHIA 2CQ1A 1UZHA 2QLFB 3J80U 2VG6A 2WW8A 4PWUA 1S1WA 1E6VB 1J5EJ 1L3VA 5F3ZA 3W61A 2R7OA 2ZZTA 1P8GA 2XZWA 3DOKB 3OR1A 4GRSA 1HQUA 2X3DA 4DL0C 1WNEA 4JYAJ 2CPIA 3I5BA 2C2NA 3Q2TC 4G6VB 3I4HX 3U27A 2BKPA 3MPWA 1C1CA 1ZETA 4I0WA 1HWLA 4NYPA 3Q23A 3ZZRA 1S9GA 4QU6A 3P4UB 2KZMA 4N7TA 3LPYA 2DPJA 4DR2F 2AV5A 3J7ZT 4FBTA 3LTOA 2GQCA 1IBLJ 4MTPA 2ZBIA 4TXSA 1A9NB 3F73A 1VK8A 2M9KA 4P73A 2HQCA 1B99A 5CZXA 3OFGA 1VHFA 4ZLPA 4NXNJ 2KM8C 2EK1A 2W01A 1ZYQA 3PDNA 3GLJA 3G8TA 4OYBA 4DFPA 4BBYA 2Z2YB 2ZJQQ 3NCPA 2C3MA 3L7OA 2DNOA 2GAHC 2DRBA 4IFVB 2UV8A 5AXKA 5KFWA 1VGYA 3DLKB 4PCQA 1FX2A 2A3JA 2MQQA 5KFYA 2LXFA 3PNIA 1JJHA 2HHSA 2BE2A 2A1BA 1TFYA 3G6XA 2HVEA 4A8OA 1SKWA 1TP7A 4LRCA 5LMUF 3T41A 4N76A 1NHKL 3C6TA 1D1UA 4W92B 3M30B 4ELUA 1WEYA 1HYSB 5E0OA 1WC1A 1N32J 3IG1B 1J5OA 3UD3P 3I0RB 2KRBA 3TW0A 5EHHA 3AJ1A 8RUCA 2DCUB 1YJNS 3G9CA 1KWMA 2AYGA 3SCIE 2RKIB 4Q5VA 2XBPA 5E2QA 4ECUA 3GJTB 4DV7J 2GJIA 3GP9A 2DPIA 1ZM3A 2VBWA 4RBVA 2HQDA 3Q2SC 3IGVA 1PJ5A 3TJAA 4RBUA 3CNQP 4B3MF 4V1Ak 2E5JA 5HL7Q 3NOCA 2ZH2A 2KHCA 3EE3A 1X4CA 5D3GB 2KYXA 2ZUGA 5L8RC 4LSNA 4NA1A 3PZPA 3T1HF 2C1EB 1NDKA 2QTWA 4C8ZA 5FIIA 2EVZA 1PYOB 1FRHA 2ZFHA 2XO7A 3PX6A 3MEGB 3ZZZA 5F0WA 3N6LA 3NNCA 2UVVA 3W64A 1SIZA 2RDIA 4MK8A 4Q2MA 2GAGC 5MLCV 5HI7A 3H7HB 5L1IA 2DCLA 2B4OA 3F44A 3IAS9 2RUSA 5G4DA 4DV5J 3K59A 1N6QB 4Z37A 2QJ3A 3IM8A 3D54A 2VFTA 4KY3A 3EPIA 3VGUA 2MZSA 3PYFA 3GPAA 1GXUA 4H4MB 1YJRA 2YH0A 4MYTA 3ITHA 4C97A 4ZN1A 6FDRA 4JB8B 3D3CJ 2JEJA 3J81j 1I94J 2J5AA 1XC9A 3JSMA 1CC8A 3DYAA 2ATLA 3FEXB 3KJNB 1UFKA 1NSAA 3UNYA 5LJ5Y 5HMZA 2B5JB 4F4XA 2FC9A 4C3LA 4FXDA 3THTA 4IO1A 4ZPDA 4DSFA 2LU2A 1RHKB 4DJBA 4X64F 3MD3A 4XDCA 4PKDB 2AEFA 2KFYA 3ENAA 1AUDA 4WFBQ 1K1QA 2GV1A 2W9BA 1RT1B 1JK9B 1M5SA 4EMDA 2DNPA 1IKXA 2WSCC 5J2NB 4EEYA 4NCAA 1QVGR 2MDAA 4WF9Q 2QA1A 1RT6A 2KXHA 3H5YA 1RTDB 3PRBA 4X62J 1U0HB 1IM4A 4YR2A 2WOMA 2IA0A 4DL5A 3W2VA 3MMBA 4B9MA 1PBUA 5B7WA 3PRDA 3OTDA 4DN0A 1W2IA 1DZ5A 2J6SA 4P2XA 2BXJA 1YG0A 1G7CB 2E1CA 5C25B 2Y0BB 4ECQA 4HDHA 1RBLA 3ET6B 4XO0A 3MPYA 4OHVA 1NJIT 4C7QA 2RH3A 1HWUA 2RIJA 1TL7B 5E3CA 3W9JA 5ETTA 3TNVA 4ZVRB 2JEGA 3FFIB 4GKJF 1S6PB 2XNQA 2RUGA 3DLLQ 1EKSA 1QSSA 3MM5B 4DR7F 1BHNA 1U48A 4IO9Q 4UT4A 3AXMA 2LFVA 3W9IA 3I9V9 2BUNA 4NASA 4KV8B 4WIQA 4A8KA 4M5IA 3UDCA 4LF9F 1RBOB 4ES3A 3GCXP 3ENVA 2NUUG 2HHXA 5EWFA 3PYEA 2LQBA 4OZLA 4JI8F 1JLBB 3M8ZA 3QSIA 1T3NA 2VL1A 1YHQS 2R42A 3PFEA 3TAMB 1U1LA 3V81B 2OD6A 3B4MA 5GMEA 1E6YB 4ZK7M 2IM3A 1SB6A 3DMJB 3GR1A 2LU1A 1GX5A 1TU0B 4DV3F 1Q81T 3VCDA 3IS9B 3CGIA 2CYYA 3A4TA 3W7BA 5GAEI 3TZZA 3SXLA 1LWXA 1NDCA 4DUZF 4HTIA 5BR8J 1UWBB 2HVDA 1HWIA 3OL9A 4NE9C 1WDTA 4EGLA 4LSLB 2RQKA 2ZM6F 1U49A 2NPFA 4Q43A 1R0BG 3DU5A 5IV4A 2QV6A 2G4BA 2RILA 2QN6B 2FZKB 3QYYA 1I51B 4H54A 1QSYA 2ASDA 2KKHA 1RWUA 3OUYB 3C16B 4QZVB 4TYBA 3RBDA 2K2PA 4DS4A 4X65F 1KRPA 1T9VA 1S0VA 4ETXA 3MUVP 4QJVA 3MPUB 2R8KA 1S12A 2YWKA 1RT5B 3TX0A 2DB1A 1RWVB 5H1SV 4WE1B 3CDAA 2QL9B 5K8MA 4IG0B 1VQLS 4IYQA 3ZZ0A 1L5UA 2VH7A 2KFNA 2BANA 2FVPA 3C6UB 1X0PA 2CG4A 4CWBA 5IT9Y 4TQSA 3BGOP 1R3NA 4ES2A 5KAKA 2ZH7A 4QWEA 4ZCIA 4RZRA 1DLOB 3M8QB 1VLYA 3DRSB 2OP5A 4RL1A 1HNVA 3QLHB 4KSEB 1FKOB 4HTJA 2DR8A 3GIRA 3R3TA 5K8OA 4ZITA 3NGKA 5ETLA 3IGNA 2VV5A 1SJFA 1IBKJ 5F3TA 4K4TA 2XY6A 2WCXA 4GC7A 4PXBA 1NJWA 2GVZA 2GHPA 4M5LA 5L38A 3FKBA 9RUBA 2DNYA 3MUTP 4NLWA 1MU2A 3CSKA 3TUPA 4TN2A 1KOHA 3FC9A 1G2EA 2Y8WA 4DSEA 4OV1A 1SJQA 4OYXA 2ZVSA 2W9CB 4NI2B 3AT1B 4PG8A 2FHMA 2HFUA 3CJKB 3HHEA 5KFRA 4CRJA 3EWGA 1TL3A 3UCZP 3V6DA 3D1OA 5EWGA 2H48B 1N36J 2MKSA 2YKMA 4LF4J 4DV2J 4J5OA 2I5JB 3R5DA 4R0JA 4NLTA 4ITSA 2M70A 2I6WA 2DISA 3DLHA 2E29A 5L46A 3JAMU 1X4EA 5LXYA 3CCZA 1U1KA 1AZSB 1CS4B 4X4NA 1FJ7A 2CZVC 4OI2A 3MMAB 3CCLS 2XHCA 2V8PA 5BJRA 4OX8A 1F3FA 4C98A 3CJRA 7AT1B 3HJVA 4CLWA 3HHLB 4DQIA 4FF4A 3T1YJ 3Q8SB 2DEIA 4LRAA 5IM0A 2I8EA 2CWXA 3UDVA 4CT9A 4JV1A 1BGXT 1S6QA 1XJWB 2ZH8A 1H2UX 1SL0A 1Y7PA 4PPDA 2E5LJ 2VKZG 3U7JA 4P52A 1H73A 4DFJA 4CLSA 2UP1A 3BPDA 1DQ8A 1N56A 2Y1LB 4Z7CA 2QA2A 2DNNA 4LT6A 1LWFB 2XM3A 2NQPA 5E3QA 2HFVA 4MK7A 1KKHA 1F5BA 1EKRA 3E01A 5DQIA 3PW2A 4ECYA 1RLDA 2HQ3A 2G13A 4EO6A 1UTAA 1FTCA 3OSPA 4ED8A 2CNNB 4TU7A 1Q8KA 3IN5A 1IBMF 3N6NA 2OO4A 1GFWB 1PKUA 2GQ2A 3OSNA 1A6LA 4AE5A 3T5JA 3OXGA 2AGQA 2HVZA 3D6HB 4UZCA 2RE1A 4YB6A 2JFDA 1CQNA 4OYPA 3DM2A 4QIGA 3SV3A 3G4SS 2E7WA 2CJXB 5DDOC 2NSBA 4USIA 1OSDA 3QT6A 2MY7A 1T9WA 3R7SB 4ETZA 4I7FA 1V3RA 1N0UA 2CQ2A 4GVLA 2D1CA 4O0NA 1HBNA 4CO5A 1JLGB 1FRMA 1JJ4A 3HK2A 4OFZA 4OI0A 5I3PA 4HKQA 4A8YA 1QDUB 4TQRA 4TY9A 4USKA 4LFCJ 2MLXA 4H4OA 2KN4A 3IRWP 4C8LA 1HHSA 2KJVA 3MD1A 1IQZA 1U1OA 4CH0S 3P96A 1VBZA 1QM9A 1PAEX 5IS2A 2M3DA 1GMVA 1HL6A 4ZVSB 4YUDA 3KJVB 1U8WA 1K44A 2VPWB 2XMWA 1FTRA 2B43A 3TA1A 4EWTA 1FKAF 4OHXA 1IKWA 4ZVFA 5LSRA 1BD6A 1FT8A 1T11A 1WSVA 3ISZA 4IFYA 1R8AA 3SCJE 1VC0A 1O0PA 2JLEA 3DOLA 3S8SA 1PAUB 2QT7A 3MM6A 2ZC4A 4KKOA 4QWBA 1DURA 3K5NA 4F0KA 1IKVB 2BR0A 4KPCA 2FGOA 1NJXA 2QMWA 3K17A 3SQGA 5D8HB 1X9MA 3FBCA 5HJYA 4ILLA 2OPPA 3EX7B 3T5KA 2JC0A 1TKXB 3OTEA 5C24B 3HKWA 2KXNB 5HLFB 1ZPVA 1QAIA 3BBBA 1FJCA 3A1YG 1D9FA 4FBUA 4RNMA 4RW6B 3UD4P 2M88A 4TU8A 4JI1F 3O8WA 1BY9A 3HVTB 2DXDA 1ZM4A 2RD5C 4O3RA 3NL0A 1FNOA 4AUKA 2VPZB 3DFEA 3P5TL 4DV1J 5KG0A 1VRTA 4BLGA 4U7UD 2ASJA 2WTFA 1BMQB 2MTLA 2ZBRA 5FDLA 3EYZA 5MAOA 2AGPA 3HO1A 4UOFA 4J9MA 3PJWA 4HHUA 4MKVA 3MFIA 1RI7A 3CW2C 3RYLA 5J2MA 2I2YA 3H25A 1S9FA 1H7WA 3HX9A 1WC5A 4LF8J 2UZAA 2FJAB 4A8XA 2GQQA 2EK6A 1V5IB 3O1LA 1T9TA 5KFGA 1X5PA 2I9SA 3AY0A 2KDOA 3BSCA 4FVCA 3EDRB 4QPTA 1XNRF 4NXMF 7FDRA 4RUAA 4WK3A 3FEZA 1VHIA 4JV2A 2PE8A 2PO4A 3W8PA 1JLEB 3I6PA 3CDWA 4URQU 3PV8A 1F2HA 1KLMA 1N34J 4JI7F 1RT3A 4LFBF 3CC2S 4ZPCA 2L48A 1WHXA 1PG5B 4F4YA 3I0SA 5KG4A 3DI6A 3N79A 2RNEA 1FEHA 4NLVA 2RRNA 3BGUA 1IVZA 1U6BA 3F41A 2DR7A 3LP1B 3DGPA 2YTCA 2F7VA 1VCTA 1F9EB 1LOUA 2O01C 3TX8A 1U26A 2L9NA 3IBFB 4K4UA 1DAXA 2WB1D 3E51A 2RF2A 4DQPA 3MAAB 3J81U 3V4IA 2XCAA 1OO0B 5A6PA 2VG5B 2AHOB 3MEKA 2QMXA 4I2QA 4RUCA 2N4CA 1RHUB 4LUBA 5K8PA 2NYIA 3CUNA 1MLAA 3H2UB 4KGKA 2BM0A 2XULA 1B0VA 1S6UA 3HKZD 1RQ0A 3CD5A 2NLWA 5I3UA 1Q1KA 4UUWA 3UE2A 1YK9A 4ALZA 4LRFA 3AODA 4GKKJ 2PC6A 2XYGB 4RUHA 4I2PB 5KFAA 3FMBA 4CLKA 4QYZK 4DR5J 1HBOB 4EBDA 4RJVA 1RAJA 3NRBA 3MTJA 3ENWA 2A0FB 1DTQB 3Q8PB 3OW2R 1S1VA 2G2ZA 3MF5A 3G82A 3WIUA 5ETKA 2GJ2A 1GMUA 5KT4A 1S99A 4ZN3A 3IBWA 3T3FA 2W7OA 4UOGA 4EBEA 2F8MA 3KHGA 3PJ9A 4JI0F 3CC7S 1DARA 4KIAA 5KFEA 4QR2A 3SZ2A 2DIUA 5KFZA 2CQGA 1EETA 1TAQA 1S1TB 3R5BA 2FPHX 1D8ZA 4JYAF 2JEIA 2E9RX 2HFNA 2GX8A 3ELHA 4UW2A 5KFQA 1X4HA 3P8BB 1TKTA 4X84A 2H54B 4UY85 3TEGA 4X4UA 4R5PA 2EBGA 4J9UE 1R6YA 2P6TA 1N33F 4ATNA 4YR0A 1U1MA 1LFPA 2KVIA 2K1RB 4OX7A 2Q66A 2NXEA 1Y10A 2B9YA 1IUJA 1LWCA 1UVIA 2VOOA 3CCWA 4MJKA 3SDEA 4OX9J 2AD9A 4J37A 3H8YA 5J2QA 3ILLA 2AYBA 3HJFA 1IR1A 1RKIA 1Q53A 3EDQB 2HK3A 4ZP9A 2JVRA 5F8MA 5B0DA 2ZDOA 4KHPJ 4NMLA 3LP0B 3HCXA 4ZCKA 2W2MP 1KVJA 3KDOA 4WFXA 3MM9B 4C4WA 3RB4A 2ZJPQ 3GFYA 4DCPB 4AXIA 4ED4A 4DPYA 2YNGA 4DQSA 1RISA 1T0TV 1F1BB 4KO0B 5KFSA 2H5EA 4WKRA 1YBTA 3RR8A 5K14A 4HDGA 2V9KA 1WG4A 4JI6F 1OY6A 3RB0A 4DU7A 4MFBA 2UUCJ 4U6PA 3DRYA 3VV2B 4B3RF 2VG7B 2UXBJ 2Y3YA 1Q5VA 2HWIA 1A0OB 3RRHA 2ZE2B 3QT7A 2CPDA 1NZAA 3QMQA 1HPZB 1RYSA 1Z1ZA 2VZ9A 5GADI 2ILYA 1C2PA 4JI3J 2V2QA 1FK9B 4WYLA 1HHTP 2IM1A 4G1QA 4CDIA 4YEAA 4UQGA 4WBFA 3MR3A 1C4CA 3N9UC 1LW2A 2W9AA 2Q6BA 1S9EB 3IMQJ 2YNIA 2ZHBA 1TUGB 1UPPA 1RXOB 1PCAA 3AD8C 2DKOB 1HNXJ 3PX4A 2ACYA 4ED2A 1RBAA 3PACA 4NLGA 1JXVA 2YQ1A 2ROGA 1WWHA 1FE4A 1EAYC 1LXNA 1FF2A 2VODA 4QBUA 2MQPA 4DR3J 4C6AA 4WWSA 2H4YB 1S1XA 2MQMA 3BGLA 1ZTTA 2QLJB 3E8OA 3MPDA 4LBIA 2Z2MA 3M32A 5H9EJ 1HNIB 1CJKA 1RAAB 3OFFA 5M2PA 2K8GA 3KMQA 1VJQA 1HBMB 2VQEF 4G65A 4BC7A 4Q44A 3EGNA 1FI4A 3WDOA 2ZNZA 3VHQA 3PKMA 2CPFA 2BACA 3ZFVA 2PIIA 1UEKA 5KG7A 3O5TB 4USVA 3H4DA 1SC1B 5F8HA 2DNKA 3MEDA 2HGMA 1F9FA 1HHQA 2DHHA 4WFYA 2B6AA 1RDRA 2KFZA 2F5GA 1AXQA 2WONB 3ZZOA 1TKDA 4JI5J 3PYGA 3AHPA 1VQSA 3GONA 3QO9B 4DZ6A 2MGZB 1FJGF 2R3VA 2YKNA 1H72C 1GAOA 5KFCA 1RAGB 3JSYA 3KK2A 1C1BA 4PUOA 2XMMA 4I6YA 2VC0A 2AYEA 1YJ9S 4L74A 2VUGA 1I6JA 5LL6d 1AB8A 2BV3A 5M2UA 2CZ9A 5KT3A 4NEZA 5CABA 5DETA 1F2GA 1KQFB 3HSZA 2E66A 2EG2A 2E1MC 2IDLA 2CQ4A 2SXLA 1HD0A 4CLFA 4X62F 1VQMS 2HBRB 2R7VA 1J27A 3PW7A 3V6JA 2B9XA 3BGRB 4PG5A 2RS2A 2OSQA 3CCUS 2C2EA 1SKUB 3MURP 1B70B 5ETVA 2F3JA 2R9LA 3VAFA 2OPQA 1UWAA 2ZNYA 4A8SA 1SQGA 3BO3A 4QPXA 3EVMA 4RLEA 4DCJB 4DV6J 2PA3A 3BH6B 1VQPS 4LRDA 4DV0J 2KO1A 3RB6A 3HLUA 3AB2B 4QIWD 3Q8QB 2W2OP 4E98A 3D5MA 2CJKA 1T05A 3QRPA 3JYTB 2L08A 1X4DA 1KTVA 3DLGA 3PW5A 1WSRA 2EBEA 2RAQA 2XMJA 3RUBL 3NY0A 2B51A 3R5AA 1AT1B 5CYMA 2IRUA 3K2YA 3BN4A 1NO8A 3BQ2A 3UN3A 5F8IA 1Y3JA 2DNRA 1RU2A 1GQEA 3TR5A 1IJEB 1CULB 4W4MA 1GXLA 3O6QA 1NXIA 4Y28C 3VGVA 2XMAA 2UXDJ 1UCNA 3HSDA 5LT5A 4DR4J 1E6VA 2E1RA 4RW8B 4B3OA 3ZTPA 2E5IA 5AE1A 2L41A 2O3DA 1CEZA 5J1EB 5AXMA 4PWDB 4D3HA 2YQ3A 3RRGA 1Q7LB 4Y2KA 3UDEA 1NJYA 3GMGA 1IWAA 2IY5B 1X4AA 4O3OA 5D4NA 4QIEA 4Z7YA 4O44B 3N5BA 1GEHA 3UW1A 4I1TA 3U1NA 2B4UA 2AYMA 1PILA 4XPCA 2HAIA 1F60B 3GIKA 5GMDA 3SYZA 5HROA 2IC3A 4ZLLA 3IR5B 3VF0B 2MJNA 1QVFR 2I38A 1MMLA 3Q8UA 4GVBB 1SL1A 1B4SA 1R8BA 1VBKA 2Q6CA 4K4YA 5K9FA 1ITPA 5CD4A 3C14A 1KNZA 4ZP6A 2K7KA 2C3PA 3M9MB 2R8HA 1RCOB 2VG6B 2VFVA 3GB0A 3KFWX 2CNOB 2CQCA 1UFLA 4H4KC 1S1WB 5DGBA 1C0UA 3KHHA 4CLYA 3OR1B 1HQUB 1HNWJ 1P1LA 2CJ9A 2H1YA 3LGHA 4M5GA 3CIMA 5D77A 4K2XA 3OXLA 1HYSA 4YDXA 3RAXA 1C1CB 3IG1A 1NH8A 3I0RA 2XS7A 3HHKA 4NLRA 1QJHA 1S9GB 2CQ0A 2ADCA 3K58A 4LIWA 3CJ2A 1WOSA 2MZ1A 2W4DA 3D6MB 4IH6A 3D6FB 2BYCA 2UUAJ 3N0VA 2VOPA 2EXUA 1TELA 3EMTA 1M5OC 3S1TA 2J7KA 1W26A 5AJ3F 2P5VA 2E44A 1FDAA 5CYJA 5KFBA 2C2RA 2VICA 2CNKB 3UR0A 1M1HA 2W7AA 1IBKF 3KLGA 4LF5F 4PQAA 4YMEA 4N5SA 2GMHA 3MECA 4WZMA 3CD6S 4KH0B 1VQ7S 4B3SJ 4O4GA 3VZHA 2MKYA 1NZ8A 2XSJA 1S0NA 4DXLA 2A2CA 2ZKTA 4Y2IA 2XWYA 3A3PB 2BKNA 3OTOF 2GMJA 1TFWA 1HMVB 3AD9C 4QIFA 4IUFA 1RU1A 4ED6A 3KG4A 3C6TB 4CM0A 1D3WA 1VQ4S 2BA9A 3NGDA 1J5OB 2CXEA 1SVDA 2HG4A 1S4EA 4WTYA 1N6QA 2HZAA 2KB2A 3HVAA 3TYTA 1Z2LA 2F4VJ 4C2MA 4DSJA 3MPVA 4FPRA 4KGXB 1GNKA 2ZJRQ 2IJFA 2HHPA 1IBCB 1P27B 3NNHA 3CXCR 1KN6A 3MR5A 4Y6IA 1FXRA 1SQEA 4WTOB 3BO2A 4MIBA 2JNJA 1HD1A 4RKUC 4MK9A 5H9EK 2HNZA 3CMAS 3W63A 5KFXA 3T1YF 4LSNB 3RB3A 5K5MA 2J6TA 4UF4A 1HNZJ 3K5MA 1NJZA 2CZ4A 1WEXA 1ELOA 2YWEA 2YKPA 4X2BA 2G2OA 1KLNA 3GFZA 2E5LF 1WHWA 2C2OB 5HP1A 3I4PA 2BJ1A 3MOZA 1H38A 4HT5A 1Q95G 3HHLC 3V4MA 4ES1A 2HYIB 2MHEA 3AXKA 3SQOP 2KHDA 2FHOB 4U95A 2NXUA 2VBZA 2ZKUA 2ZOFA 4B17A 5IT0A 1IKYB 2XLIA 1S57A 3BSAA 4ECZA 4OYMA 4I64A 3GE9A 3ITHB 5H9FJ 1U6ZA 1PSDA 2ILZA 1V9OA 1ZOTA 1XMOF 1BWVA 1LV5A 4FXWA 3OVBA 3JSMB 1S10A 1QAXA 3DYAB 1WEZA 5G0RB 4Y3CA 4C11A 1M1KT 1KFDA 2QSWA 1NK9A 2DHXA 2BM1A 1Q4RA 3EZ5A 3FFIA 3CMQA 3MAQA 2WHOA 4F3OA 1R27B 3D0IE 4PYAA 3DGVA 4QWDA 5C2GA 4LVNP 3MM5A 3NGRA 4KYZA 4K59A 1WG1A 2W9BB 2Y8YA 3HSJA 3M2UA 1IKXB 3T6JA 2UU9J 3NCRA 3J80Y 2Y1RI 2YX1A 3FQKA 2O5DA 3Q0AA 4KPYA 5L1JA 2UUBJ 2DNZA 4Y65A 1JLBA 1K9MT 2NZ4A 3NMAA 2WOMB 3MMBB 4A4JA 3BQ0A 3X1LB 1HWKA 4OIXA 3AOCA 2NYHA 1CC7A 1SH0A 2HIQA 3HVWA 2JEFA 1JLFA 3H2LA 3CCRS 1EIYB 3W66A 3CJQA 4DL7A 4FPIA 2ZD1B 3QGIA 4ZVHA 2MMYA 2J76E 5IQQA 1IM6A 4LR9A 4F0HA 4LMZA 2HS4A 3IXQA 4LF7F 1Y00A 3CCJS 2BBEA 1OPIA 1IXKA 2NREA 1A7GE 2OI2A 3IS9A 2BQRA 1RTJA 2AJ1A 3CVKA 2B0GA 1T9XA 1YZ7A 1DQAA 2L9WA 3I56S 3AA8A 2V8VA 4KR0B 2F9DA 4O3SA 1G3OA 4LSLA 4K4WA 2CQIA 2PFDA 4HLBA 3M2RA 4L72B 1G1XA 2ZH9A 3JTPA 2DHSA 2ZBQA 2BQ3A 1VDHA 2MYFA 3LO3A 4F7VA 4ED5A 4IKAA 1JJCB 3K0JA 1OSCA 4I4BA 2IYGA 3OUYA 2NCKL 2ATCB 1OY8A 2HNDA 3KNGA 2BW2A 2XYHB 2F8HA 3EUNA 1SBRA 2LECA 5J1NA 4NCBA 3JTOA 4EI2A 1KVIA 5T14A 2X51A 3I32A 1RT5A 2HSEB 3ONQA 1N5SA 1TUWA 2X3GA 1KVKA 4P71A 4IG0A 4V19J 4Q2LA 1MROA 1KOOA 3C6UA 3HULA 1WUUA 3M8WA 1NCLA 3OL7A 1TMMA 4NZ7A 4O23A 4OLOA 5FJ4A 3NGTA 2J8AA 5GAEU 5L1KA 3R7NB 3HFKA 1YJ7A 2FD2A 1FKOA 2JC1A 3H40A 3CF5Q 4LREA 4DX7A 1U8SA 1YVFA 3NP5A 4LF8F 1WOOA 3EM1A 3SCLE 4EFAC 3HD1A 1TK8A 4CI0B 1RTZA 3Q24A 4PXCA 2H65B 2P6SA 3H42A 3IC1A 3QAEA 2P9GA 3EZUA 5C42A 4DS5A 4USHA 3CDEA 4W98A 3ZTSA 3VZIA 4QOTA 4L3KA 2RS8A 2V4RA 4OJHA 2JL9A 2W8KA 1FDNA 1X4FA 1BE4A 4F26A 3EVWA 5A8RA 1BXNA 2YKOA 2MZJA 5HANA 1V3ZA 1FHTA 4KT0C 1LKZA 5CCLA 3HSGA 2HMIA 1TR0A 5LMUJ 1YBUA 3POTA 3ISNC 2V63A 4NI2A 2WBRA 5HO4A 4OYZA 2D9PA 2XWXA 1R8PA 4CIOA 3SI8A 2V67A 4A8MP 2BANB 1VQYA 2EG1A 4KQZA 1RT4A 2NPIA 4P74A 1UZDA 1D09B 2I5JA 5CXTA 5CH7B 1U24A 1FNXH 4YQWA 3TAQA 3T6BA 2J8SA 1HNVB 3NXZA 2UXCJ 3I96A 2CPEA 2B4PA 3CB4A 4FP9A 4KH1B 4ZLNA 4EYHB 3QWPA 5KFNA 5A8WB 1UJ5A 3DDNA 1O5JA 4DG1B 2E9ZA 3K8WA 1AZSA 3FSXA 2HRUA 2VC1A 4X4QA 2KTQA 3MMAA 2W2PP 1S5ZA 2V2ZA 4PABA 2GVZB 4B3MJ 3HVRA 2FJVA 5D0GA 1S48A 3O3LA 2E7VA 3JSBA 5AXNA 3DRRA 2A18A 3RGIA 3OTCA 4LF6F 4J9OA 3T1HJ 2D74B 1JWWA 3F56A 3DDKA 1CJUA 3KXDA 4YB7A 2MSTA 3ETOA 3V5RA 3GIJA 1MN9A 4X4PA 1ZS6A 1R43A 2AJ4A 1H3DA 3GG1A 1VRQC 5FLXU 4NCGA 1TL3B 3C3LA 4ED3A 4PYDA 2FJDB 3LP2A 5B0FA 3U1LA 4TU9A 2YKMB 1KHVA 2BDPA 2M0GB 3PY8A 3D2WA 2OEJA 1KEKA 5KOXA 4M5NA 1YSJA 4K2JA 2ZH6A 4XTTA 5DM6Q 3HI9A 2J6UA 3QT8A 2OUGA 2LDIA 3LWLA 4DV4F 1WG5A 3J7A1 2BJ9A 3BS9A 4C3MA 4ID5A 2N3LA 5IXUA 2CPXA 4DU8A 2Z4PA 3EVOA 1OYEA 2ABYA 4EK2A 3R8YA 2C3OA 2CDQA 1BQNB 2FY1A 3QPIA 2HHQA 2QLWA 4X64J 5IWAF 1D9DA 5DG9A 1S6QB 4F02A 3CCES 3TA0A 1VBYA 3MMJA 3PIOQ 1Y5NB 2AKWB 2XLJA 3BKTA 4KRWA 5L9NA 5KFHA 3G96A 2FIUA 4CYUA 2H51B 2AMCB 2NUHA 3H4BA 4ILRA 3TQ1A 3D9BA 2XI3A 2DGWA 2LVWA 2YPZA 4IH5A 2E7XA 1VOMA 1WF0A 2FTRA 3GG0A 4YN3B 4KE5A 3R27A 2WZ1A 3HMJG 4QCLA 4TYAA 1RACB 2LQ5A 1SJ1A 3E01B 2VKRA 4DPOA 2IIHA 4P75A 1AA1B 1RAIB 2LQJA 2FLNA 3ZTRA 3A8JA 3PXGa 2V4JA 3LGMA 3FBFA 3TANA 1NNDA 1ROFA 1UL3A 4IRDA 3KJVA 4ZPTR 3FRYA 2OAUA 2M52A 5BYQA 1HI8A 1REVA 3VAIA 2UUCF 2EKYA 1WC6A 5E7OB 1JNZB 4N41A 3DU6A 2DTJA 2Q43A 1RT7B 3RG6A 1JJ2R 1KQKA 3DM2B 3P5BP 4YDDB 2HRTA 4GKJJ 4OI4A 3UCUP 1JKHB 1Q8IA 3CULA 4CH1A 3OTBA 2MLZA 2W24A 4ECSA 4DR7J 3GYNA 4C0BA 3TZWA 4JI3F 3GFHA 2FDNA 2UV8G 5HVGA 1DY3A 4I7FB 2C2MB 3NAHA 2KU7A 4QW8A 4AYBD 4WCEQ 3NGSA 3G6VA 3R5CA 2AZ3A 1CJVB 2HFZA 4E2FB 4LF9J 1TZ0A 3TP2A 2AJQA 3KK1B 2E5GA 3MM7B 3R6LB 2QG9B 1NAQA 1TKXA 5C24A 4R0EA 4JI8J 4P2MA 5HLFA 5LM7E 4K0KF 1NB2A 1QLNA 3ZTQA 3F0NA 2C42A 1SJ4P 2G2YA 5J2PB 1S0OA 4UQTA 3M8SA 3CC4S 1FRXA 4XDDA 2WAQD 4CO2A 2N7CA 2ALZA 4QIVA 3GSDA 2DGSA 2KI2A 1XNQJ 5HQMA 2Z58B 2PGCA 1MW7A 3QSYB 3DRXA 2MPUA 2LEBA 4AFFA 2R7RA 3UVJB 2ALYB 3EICA 4D3GA 4DV3J 2VF3A 4DF4A 2P2CB 3DOLB 3MOJB 1VISA 1NB7A 2X1BA 1LWEA 4M8LA 3MM6B 3IWLA 4U7UK 3UCGA 4KKOB 1FNMA 4DUZJ 1S7HA 1KDNA 4AD6A 2ROPA 1I5OB 2ZM6J 4M95A 5HQ8A 1Z4UA 4P7TA 1VIOA 3CCSS 2MKHA 3G8QA 5B08A 2R8IA 4AQYF 4PWWA 3L3CA 4F2SA 2X1AA 1N88A 4LQ9A 4PQUB 2VIHA 1XEZA 2OMLA 3PG9A 1K0VA 3SEOA 2HFOA 2C2DA 2BJDA 2QYCA 3RU0A 2XMTA 4BDPA 4Y34A 2V69A 2GCFA 3TEHB 3OFEA 4CP5A 4NX9A 3GU0A 2M4MA 1P9QC 1S1UA 2HGNA 2WVCA 3JTNA 1X0FA 3DOMA 5DG7A 4ZVQB 6FD1A 2CRLA 1VRTB 5F8JA 1SC4B 1B64A 3FQLA 4Y2MA 2DYAA 3JAMY 1NBEB 4ECWA 3L09A 2F63A 3M8YA 1OMSA 4IOCQ 5DQGA 3KLIB 4IRKA 4L3NA 1X8DA 2KT3A 4PEOA 1Y0HA 1H74A 1PJ7A 2DH8A 1B0TA 1K8AT 4GC6A 5J2MB 4UUXA 2V2KA 3MAAA 3T5HA 3UDLA 1T03A 3P3DA 5KFDA 4OJ3A 5HN0A 5JVGQ 1WI8A 3KNAA 4TLQA 4DSIA 3W60A 1VC5A 1VBXA 4Q8EA 2OLWA 4R8UA 4URGA 2C22A 3LA0A 3RAMA 4A8WA 4RW7A 3B6BA 3TWZA 2EC2A 4HR2A 4K4SA 3FZBA 3HM9A 4I2PA 2MB0B 4FYDA 3CJ3A 1IR0A 1RT3B 5DDPC 3R9LA 4UTGA 1HBOA 2WSFC 2PD1A 3DI6B 4R25A 4NEYA 2Z8QA 1DTQA 1WI6A 2CVIA 2DGVA 3AJ2A 3CE8A 1N48A 1PC5A 3DLEB 3GYXB 4QR0A 5A8KB 4HHHA 4NLQA 2W4CA 2BKOA 2F1FA 1F0XA 4DFKA 2HFSA 4OZ3A 1YRTA 2ZITA 5D0EA 1FESA 2OKQA 3M1VA 3W8GA 1I1GA 1UA1A 3V4IB 3MR7A 1N8RT 1RTHA 1NPRA 1BC6A 3QT5A 1F9HA 1PYTA 3AOAA 4OI1A 2MJUA 2ERRA 4CO0A 4Q8FA 1BQMA 5I3UB 1EB0A 1JLQB 4Q7AA 2PFFB 1S77D 1NPPA 3M6UA 1BUXA 3NNAA 2ZZNA 4DX6A 3EJMA 3PJXA 2JLFA 4CLLA 3TOQA 2AX0A 3OVSA 4ZJOA 3QBCA 3QRQA 3Q8YA 2GGPA 4ID8A 1LW0B 4F25A 2XEXA 1YKWA 1HQ2A 1S1VB 4CO1A 3G82B 3CIZA 5HSPA 1O51A 1XBWA 1BLUA 4X66F 2GIFA 4DI6A 1RABB 4F67A 2DGUA 3DNCA 5DQHA 1SUQA 1RT2A 1FEEA 3LP0A 1C4AA 3PCOB 2GC8A 5F8LA 4N47A 5EX0A 4KBIA 3K8VA 3BEGB 1U02A 1HI0P 2VQFF 4ECTA 1EETB 4FYWB 2IPOB 1IBMJ 5JUMA 2VONA 4PPZA 1HNWF 4MYUA 1VQKS 4DL2A 2LDYA 2GA7A 1NK6A 1RSCA 4NLPA 3LH2S 1U7LA 3M2VB 1X5SA 3OT9A 3OL8A 1T02A 2H3EB 4LF2A 4TY8B 2R7QA 4PG6A 2W7PA 4HL9A 3SSSA 1RTIA 5BYSA 2ZE2A 1QE1A 4OJ1A 4N56A 3BKFA 4USJC 5KFPA 4MT1A 4KHMA 3VALA 4I6AA 2VBXA 2MHNA 3RAQA 1CJTA 1LWCB 4B3TJ 1SPBP 4F4KA 1JQGA 2QGFB 3SDEB 1RHRB 5J2QB 4ZVGA 2JVOA 3CJ8A 1KC8T 3AQOA 5IV3A 1RWXB 2D69A 5ETRA 1PGZA 3VAKA 3NBPA 4HH0A 1T7PA 3CDUA 1YRXA 2Z2LA 1TL1A 2IFXA 3UO0A 2XLKA 4OL8A 2A6MA 4NLYA 2NXJA 1APSA 1P9YA 3H5XA 5EDWA 3LANA 4RO0A 2WVEA 3ZZUA 2MQLA 4P10A 2GMLA 4OYIA 1PBAA 4WYWA 2CPZA 4PR6A 4MFBB 4ECRA 4JI2F 4DR1F 1Z2ZA 1HNIA 1HR0J 4U9RA 3IM9A 3QIPA 3PO4A 4WKYA 2RHQB 1V3SA 1ULRA 3JB9k 1YDLA 3KHRA 5HQLA 5ETNA 5GADU 3WC2A 2I0XA 3S7RA 2QO3A 3M4XA 4G1QB 4K50A 3WZ0A 3NS5A 4ZMMA 1TK5A 2OFHX 2Y1IA 2PEBA 3GCWP 2B56A 4LSZB 3FSYA 1LW2B 3J7YU 4JV5J 1K1SA 4WU2A 5LMNF 1AW0A 2PEHA 2YNIB 3MM8A 1SXLA 3L7PA 1MWZA 2XTJP 3SSRA 4DSKA 3IFEA 2UVRA 1T94A 3QO9A 3QFWA 1EQ0A 2MGZA 1DTTB 1VMBA 1HBUA 2V6AA 1CSJA 4J9SA 4JI1J 1BQXA 4BWMA 4Y00A 4F4ZA 2V2VA 4FKXA 1H2TZ 1HQEA 4USWA 2LMIA 2IM2A 5GMKa 4ANEA 4DHVA 2VJVA 4XK8C 4FXVA 2COLA 1XTZA 1ZA1B 3IR6B 3M32B 2DNHA 2HS0A 2PN6A 1D9AA 1CJKB 1T8EA 5M2RA 3J81Y 1OQ6A 2CJYB 3BYPA 2L9DA 1SH3A 2UVUA 3LUYA 4WIIA 4RW9A 2K06A 3QFHA 1QUPA 3CCQS 2RQCA 4DWIA 4F3QA 1N52B 2HAFA 3MEDB 2YX7A 3FEYB 4E8UA 3AH6A 1RWKB 2B6AB 1XNRJ 5HATA 4NXMJ 5LXRA 2VB6A 1P1TA 2HQGA 3T19A 4F50A 1SCJB 4RNNA 3SMZA 2OEMA 2G0JA 3H0PA 5A6WA 1ZAVA 4PXDA 4LFBJ 3CO0P 1WC0A 3KK2B 5LOQA 4PUOB 2BE9B 1U2RA 4ZJLA 2YNFA 3I31A 3A8IA 3NWRA 3PM9A 2WBMA 2J0XA 3TZXA 1X4GA 1R89A 4LR7A 5DLFA 3BKUA 1YITS 4I67A 3AD7C 5BYRA 2EW9A 3OJSA 2W25A 3GTYX 1FFSB 1ZTWA 2B9WA 3TO8A 3JSRA 2DD8S 2UUTA 2OPQB 2XGQA 3KYLA 3K5OA 3PHEA 4CTAA 4B9VA 4ICLB 2CPYA 1RHJB 2C2ZB 1FE0A 3VVUA 1NHUA 4O44A 2GZOA 3U1MA 3W62A 2DBBA 2FLPA 2OPRA 4NYOA 2Z0GA 2YWGA 1UAWA 4RWXA 4ENOA 2JH3A 5AT1B 4OMFG 1T05B 5B0EA 4LF1A 3DLGB 3CO9A 2EPIA 3FVYA 1NKBA 3GV8B 3AJDA 2IM0A 1NLKL 2OHDA 5HVHA 5CZVA 5IT4A 5CYMB 1N5QA 1EP4B 2NS1B 3RR7A 1UFWA 2GW8A 4WK1A 4Q0BB 3QGPA 3GFXA 2FLOA 2MQNA 4JI0J 3KLFB 3IBCB 2MQOA 4JI4J 2PA8D 2J7UA 1Q5YA 1CLFA 4B3OB 4X4VA 5F41A 1MMDA 3PR5B 4AT1B 3HXMA 5D6GA 4XPEA 1TTHB 8AT1B 4AXJA 4G3IA 1EJ7L 5D78A 2AJ2A 3K5PA 2XY7A 2FHJD 3QATA 2BMBA 1XIQA 4BWJA 1DBDA 3MXHP 4DOZA 1WC3A 1Y4ZB 3RJMB 1S76D 5DGAA 1CVJA 1GXTA 2MSSA 1N33J 3QQCD 4DR6F 3MMCA 2DEJA 4OLPA 1TVRA 4BHQA 4USMA 4ZPAA 3GV7B 3DRPA 5A0YA 2ZVIA 5HROB 2IC3B 2KRRA 3VAHA 4RPFA 4OI3A 1X5OA 2DR6A 3KK3B 3UFCX 4C8KA 2MEWA 1H98A 2CQ3A 4OZ1A 4FKYA 4UOCA 5HMXA 1N4LA 4OHWA 3FRZA 1MMNA 3IRXB 3C14B 1RYRA 3N4WA 1RWPB 5JJBA 2FJWA 2NR0A 2QMUB 3W5XA 4V19X 3C8YA 1VYAA 1DQ9A 2HZCA 3PW4A 5RUBA 2ZH3A 2R7UA 2ZBCA 1JXEA 3FCWA 3E3XA 1Q78A 2FZCB 4NLUA 1VIXA 3RW7A 2W4PA 5LJ3Y 1C0UB 1NSPA 1HMVA 1UA0A 3KLHA 3GQCA 1ACMB 4CCHA 4JI6J 2N7YA 2X7IA 1VRUA 2ZBPA 1ZAXA 1N5VA 4S0MA 4B3RJ 4DUYJ 2CIMA 3KUEA 1R8HA 2ZUAA 4UZBA 2CQDA 2EFVA 4ZVOB 4IR1A 1W7WA 1WJ9A 4HH1A 1TV6A 2UXCF 2HHHF 1R0AA 1B0PA 3TJ8A 3KJFB 4MMOA 1Y9OA 2OMOA 4DLGA 2VDHA 3KLGB 2UVWA 1FDDA 5EN1A 2ZZMA 3MECB 3NMRA 4A8FA 2BRKA 2R8JA 4EYIB 4O4GB 2CQPA 4LR8A 2O66A 3AA9A 1SV5B 2XSJB 1YJWS 4YY3F 3CD7A 3M8RA 1JLAB 2LYVA 1S59A 3LALA 2M8DB 4O3NA 4MH8A 4YB5A 2NXNA 2HNYA 3L9ZA 2CQBA 3M8PA 4URSA 2ZEJA 3R97A 2N3OA 5EX3A 4K8RA 3MEEB 5AE2A 5JMNA 1VS3A 2KG1A 2DIVA 2KYZA 2FHJA 4ZP7A 1VC6A 2ZHOA 4DBQA 2VQEJ 4KAIA 3EPGA 1L3KA 1XERA 2V50A 4X4TA 1IKYA 1QY7A 2DT9A 3M6XA 4PZVA 4QYRA 4ZVUB 1TQLA 1GX6A 4C8MA 1XR5A 4Y2AA 2IBOA 4OZJA 4C8NA 1J5EF 5I3QA 3QGHA 4ZPWR 5G0RA 4BS2A 4HT7A 2EFNA 4YS2A 1C0TA 4B9SA 1O6XA 1TL4A 3Q83A 4ANCA 1SJ3P 4O4RA 4YOEA 3NEKA 1FJGJ 4IG3A 2HNZB 4C9DA 1K73T 2IMOA 3KTQA 1V6HA 3EGWB 1FKPB 4FYVB 4QW9A 2GHWA 4KC5A 1T3OA 5IQ6A 5DG8A 3MTKA 2R2SA 5F9LA 3W5ZA 5HP1B 3SSQA 4ELVA 2V9WA 3AQPA 5KFUA 5KG6A 3UWTA 2B7BB 1IBLF 4RUBA 1NUEA 5LSLA 1KR4A 4I69A 4NL5A 2V34A 4LBPA 2DK2A 4P6QA 2ACMA 4M5HA 5JVHQ 2BRLA 1JX4A 4RU2A 4NXNF 4KFBA 4F0MA 4C3KA 1SC3B 1HLWA 2K7JA 2ADBA 2AJ0A 3NCQA 2WVFA 5L9XA 1KBRA 1NMEB 1WKLA 5CAAA 5A2QU 1ZM9A 3OHBA 2P9CA 1KP6A 2CJBA 2J0QD 2B7CB 1Q16B 3OV7A 1LNQA 3IA0A 3KLEA 4A46A 2IAJA 3D0GE 1RCXB 2BVZA 1YI2S 2ZD1A 3PEJA 1RWWB 4WP9A 1YLXA 2RVJA 2QLXA 4C11B 4ERDA 2AJFE 4J90A 2GIQA 2M2BA 4MKAA 1B7YB 5HAOA 2VU5A 4W90B 2IBKA 4PXEA 1N32F 2NXCA 1ZAWA 2MZQA 3ETMA 1NSQA 2FB0A 1I3OB 1X60A 3QAUA 4NA3A 3QJLA 1UEUA 4OZ2A 3NKYA 2QA4G 5I42A 4J9LA 1CBKA 2QC3A 4UY8T 3M2UB 3CWJA 5HBMA 4DV7F 5KFFA 3NAIA 3KUHA 3J7YI 5CYQB 2F8EX 2YNHB 4OZ5A 1ZH5A 3CJ5A 3DKDA 4QWAA 3D4JA 1HKAA 5B0BA 3ENQA 5E41A 3UD5A 2Y9HA 1MNEA 4CM2A 3TA2A 1SH2A 1M5KC 1M1GA 3BBFA 1JLFB 3B4DA 2HW3A 4WP8A 3SIPB 3PVXA 2R7TA 1S79A 2JOQA 2LQ9A 2H5JB 3WBZA 4M5DA 3EXYA 1R6VA 4FYYB 1WHVA 1H7XA 4ZHRA 2IVYA 1XNQF 3D6TB 4DPTA 2E5HA 2K3IA 4PAAA 5DZ7A 3CJ4A 1K47A 4ZIVA 2L3MA 2GVDB 1NEEA 3I82A 1VQ8S 1RTJB 2F65A 2AF6A 5FD1A 2DNLA 3JXOA 4DV5F 1RAFB 1HW9A 4IDKA 1MWQA 5DRKA 2G0CA 4LFAJ 3C15B 1Q86T 4OQJA 1JLCB 4JUZA 5I4MA 3G2XA 2OEKA 3TARA 2FVSA 2BOAA 3D28A 3DXSX 4U8VA 2JX2A 3M2RB 3PYDA 1I94F 2JHEA 3E2EA 4HI2A 3G6YA 1NDPA 1WHYA 2R2RA 2FC8A 1TKZA 2CVEA 2E1PA 2HEKA 4RNOA 2HNDB 2DH7A 1WACA 3GIIA 3PKYA 3HD2A 4OJGA 4ZCMA 2MY8A 3M9OB 2DGOA 4CLTA 4TNOA 4WFZA 1M5PC 2WB4A 3SFUA 1QTMA 4CO4A 1FA0A 3TZYA 3WX8A 3MAHA 2R7XA 4NZ0A 4KGVB 3K89A 2DITA 1MROB 2JWNA 1M90T 4F04B 1FXLA 3D3BJ 4DEZA 1G6BA 2Y1JA 3W2WA 4ZIWA 2XMUA 3QWUA 1FRKA 3OXFA 4QWCA 1GTHA 1YWXA 3BR8A 5ETMA 1D8YA 2OGUA 4JOUA 4CQ1A 3OVAA 1UVLA 1RWNB 2OPSA 4ELTA 1KONA 5A8WA 2KT2A 3Q8VA 1UW4A 4F2RA 5KG3A 4M94A 5AJ3J 4DG1A 1NDLA 3CCTA 4LF5J 5ETQA 1N5YA 2RJZA 1NK8A 3LGNA 4HACB 5C42B 3OLAA 3VAGA 1SC6A 4AL5A 2ASYA 3EGVA 5F8NA 4RW4A 4NLOA 4OX6A 1IWGA 3ZZPA 5T7LA 4CT8A 3RBEA 3W3SA 4MIAA 2X1GA 5A8RB 1YJTA 3OTOJ 2EI5A 1B3TA 2WVDA 2POKA 4C8OA 2FQQB 3UNGC 4WXOA 2RRAA 1YBAA 4NWBA 2HMIB 3POTB 4L75A 5CHCB 4LIRA 1BWEA 2HWTA 1RE1B 3R6GB 1RT4B 5D4PA 2W2QP 4IRCA 1YRUA 1K0TA 2XSFA 4P7VA 1WELA 3B8HA 3OR2A 2OTJS 4DQRA 4JP8A 3MHYA 3OFHA 1V5VA 4QYZJ 1FCAA 1QUVA 2QX0A 3HHNB 4ZVPB 3T5LA 2JDJA 2LP4A 2HZVA 3IWXA 1CG2A 2P8IA 1S4FA 2B3TB 3DOKA 2CAJA 2DJWA 5KG5A 3ZNUA 3BSOA 2B4VA 4C48A 1PIEA 2PSZA 4YHHJ 3THPA 3PO5A 3DRRB 4KGMA 1RWOB 1BQNA 2QA4S 1KQSR 4K5RA 1CJUB 4MAKA 2HVHA 1RWMB 3JQKA 2XC9A 5KT6A 3NLCA 3TUZC 4DZDA 2OD4A 3HF5A 5BR8F 1UW9A 1SKSA 1YX2A 4NCGB 3LAKA 3LP2B 4WFAQ 4OZ0A 3BSNA 2KJWA 1Q0NA 3GJRB 5DLGA 5ETSA 2BEFA 4IFVA 4OYWA 3S01A 3EXCX 2LKZA 2PT0A 3DLKA 2DNGA 1XMOJ 1WOPA 3GSIA 3SFGA 4WFNQ 4B9NA 1LK5A 4CNYA 4ID5B 1L3TA 4CO3A 3QJPA 2R2UA 2RDJA 4I56A 2HLTA 1VFJA 1YJUA 3M30A 5HVFA 2MKJA 3N01A 2ZH4A 1RT7A 2BJEA 3TVYA 2F4FA 2XMVA 1JKHA 2XNRA 3GYGA 4B3TF 1XMQJ 1UVJA 2YKQA 2D41A 2B8PA 2RKIA 3RW6A 1AROP 3CJTA 3AFGA 3V6KA 1CJVA 4OI6A 3KK1A 4F4AA 3BREA 2KVQE 4CYUB 3MM7A 2V68A 2FJBB 1FXDA 1B7FA 2BJ3A 4OYAA 4J9VA 1KSPA 3DN9A 1NU4A 2GJFA 5ADZA 5KOWA 1UMJA 1S72S 3HT3A 4K4XA 5J2PA 3O2IA 4HVZA 2AWZA 4DMZA 3FJ2A 5D3GA 2Q1LA 2LEAA 3WC0A 1F3VA 2HBYB 3QJJA 2V4JB 3MEGA 3I87A 1W2BR 2BE2B 5D4LA 2IYIA 4FNIA 4J9NA 3L7UA 4FZVA 4EO8A 4DX5A 3OPKA 1REVB 3HHDA 4LF7J 1XK8A 4WJBA 3UVJA 2EC0A 4WPAA 4IH7A 1Q79A 1EQMA 3H2VE 1HR0F 2MKCA 1T95A 1N36F 3UI3A 4LF4F 4DV2F 3J7AN 2M7SA 2F9JA 3KHLA 1RUSA 3PFOA 1SIWB 1U1RA 5IT9U 4DN9A 3UPFA 3N6MA 3C46A 3P6YC 4H4MA 1NK7A 4ZPVR 2AIRB 3L4BC 4AL6A 4NLSA 2VA3A 4JV5F 1L3SA 3HT0A 1W25A 3HZEA 4PQUA 2PMHA 1S0MA 1SI9A 4KTQA 3LF0A 5C7PA 1LEOA 2B5JA 3NS6A 1FWLA 5SZTA 3PHTA 2ZOMA 3D0HE 1JMTA 2A6OA 2QYGA 4RX6A 1F5AA 4UOHA 1GK8A 3JS9A 1J2VA 2H9ZA 4NYZA 3T9NA 1RT1A 2FJXA 2VHGA 4GO5X 5J2NA 4C0HA 3KLIA 5EWEA 2OIHA 3T1AA 1FFGB 1LWEB 1H2VZ 3FBEA 1RTDA 3T9ZA 5DJBA 4CLUA 1U0HA 5THWA 3TVZA 1UVKA 2GNKA 3P49B 2EKNA 2X1FA 1HW8A 3A3OB 3TJ9A 2VDIA 4DX8H 1ZZNA 1XWLA 3BDPA 4ZKAA 1RAOA 2O1PA 3V2UC 3RBZA 2Q79A 5KT7A 4DUTA 5C25A 3UR3C 3ET6A 3KKFA 1FWKA 3MR6A 2D3OR 3RBXA 1TL7A 2QFIA 2QE5A 2ZC3A 5FLXY 1TMJA 1S1UB 4WXWA 3TUJC 2RQMA 3DOMB 2HURA 4J9KA 1S6PA 2DXEA 2WSEC 3TRGA 3BDEA 3PRVA 4HHJA 1N0VC 3ILOA 2ROEA 1LXJA 2R4FA 3DLEA 5A8KA 4KV8A 1U2FA 2CKWA 5KG2A 2XS5A 4M5JA 3BN7A 1RT6B 4ZP8A 4K5SA 1FX4A 2D3ZA 1KQGB 1ZA2B 4LJMA 4L6V3 2B9EA 5B0GA 4LFCF 3W2VB 2CJAA 2Z57B 1T03B 3CDBA 2FVCA 2APOA 1U45A 1U09A 1ICEB 2EFGA 3TAMA 1JIHA 2MZRA 4XAKA 3V81A 1XR7A 1WKKA 1UPMB 2HPUA 1JLQA 1E6YA 4R8UB 2RT3A 4ZVEA 4LF6J 4RW7B 4Y0FA 3DMJA 2C3YA 2CDRB 3NOGA 1PC4A 1RP5A 4RU9A 3M6WA 3KJQB 3ILIA 3SV4A 2HK2A 2VFUA 1GTEA 1LW0A 4HI1A 5DS7A 2FGCA 3W5YA 1UWBA 1WKJA 2VBYA 3B78A 2R7SA 2AZ1A 1TAUA 4H4KA 3DHWC 5KFLA 4DQQA 1FDBA 1YIJS 3I9ZA 5EGYA 2F40A 2WW4A 3HHLD 5KFTA 4KGZB 3M1VB 4JI4F 2YXLA 4CLZA 5D0HA 2G1HA 1F5CA 4FF3A 3C16A 1RTHB 1IR2A 2V0NA 2IVFB 1RZMA 4DV4J 2D9OA 4WZQA 1WF1A 2XY5A 4N8OA 2DRAA 2DXFA 2IJNA 1UEVA 5CA5A 4Z2XA 2XB2D 1YGYA 3M2VA 4P9SA 1BQMB 4WE1A 1L3UA 1WTFA 1IJFB 4DV1F 1MG7A 4TY8A 2DY1A 5L39A 4J91A 3PTWA 5DDRC 4NPOA 4CH7A 2KM8B 1Q82T 3KLVA 5IWAJ 3TQEA 2Z30B 3R1LA 4P2SA 2MZTA 1DLOA 3M8QA 4F36A 2KT5A 3OHAA 3DRSA 4DR2J 3BB5A 2EEYA 1U1NA 1LK7A 3QLHA 3LWMA 5B0CA 2GGPB 2YKAA 2HBZB 4IQMA 1Y11A 2N82B 2J9CA 4FNHA 5HMYA 2W2NP 3ADAC 3M9NB 1FWPA 3GJQB 1UKUA 3K5LA 3QNWB 2KG0A 1SUQB 3OD2A 1RT2B 4OZNA 2CQHA 4PG4A 2RDDA 4GO7X 1YJVA 3RTVA 4L76A 1UP1A 2C2KB 3R7BB 2HIYA 1M0SA 1QD1A 1QAYA 1N34F 1AFIA 2YX4A 4NRUA 1VQOS 3QZ8A 2W9CA 1RADB 3OL6A 4P72A 3CJKA 4DUYF 2LLZA 1RTIB 4Y2CA 2JLGA 2FHKA 1QE1B 3ILJA 3HFVA 3MWBA 4KB7A 2D3O1 3KUGA 2VPXB 3DLJA 2EFPA 4B9LA 3HP6A 4P2FA 1CJTB 3C19A 4ED1A 4RNFA 3GWCA 5KFOA 3MUMP 1VI7A 5GAGU 1OIAA 2D7SA 4I68A 1R8CA 3FCVA 4OYOA 1NM2A 2YWFA 1FVSA 2DR5A 4LBHA 3W65A 1CS4A 2PMWA 3VQTA 3NBPB 1X4BA 4MKYA 3MFHA 4K0KJ 3TVKA 4F4WA 1TL1B 2E9TA 4QR1A 3N5FA 3MR2A 1KS2A 2RB7A 1DTTA 3HHLA 3NS7B 2CNLB 4PRFA 9ATCB 1FRJA 1MU2B 2BJ7A 3U02A 4GKKF 5IFMA 3KWMA 5DDQC 5CQGA 4DR5F 3LOUA 1HFEL 2IJRA 1Y5IB 2MLYA 2P9EA 3A12A 3MCMA 3DHXA 2IHR1 1HWJA 4RWWA 2WK4A 4DF8A 2HHWA 5CCMA 3QIPB 3GV5B 3V6DB 2BX6A 4CLPA 3CCVS 5HK4A 3CCMS 1SJRA 1LWFA 3C66A 3GILA 3PW0A 5L1LA 1JNRB 4EBCA 3TAPA 4ZVTB 2OJ3A 2Z2ZA 4NLXA 2FVQA 2DNMA 3B82A 2NZCA 3H5SA 2V8GA 1R31A 4MKBA 4FF2A 3VAJA 2V4QA 2V94A 2A2DA 1GMWD 2XS2A 4AQYJ 4ED0A 4IOAQ 3KMSA 5B0AA 5GAHU 2H4WB 3SCKE 2GHVC 3MM8B 2PMZD 3D1HA 3ZXWA 3R1HA 1TL5A 2LA4A 3DDIA 1PO6A 1FRLA 1REGX 3PR4A 5ETOA 3CEDA 3R5GA 1X5TA 3LPEA 4NOHA 1HBUB 4M5KA 2CJQA 2HWHA 4U8YA 1RAHB 2BQUA 1MSWD 5IM0B 5KFMA 1HQEB 2CUYA 2RQ4A 4ZOSA 5H9FK 2JSXA 5T41A 4B02A 4DPUA 4OX9F 3ISND 4HYKA 1Y3KA 2HS3A 1YTYA 1QSLA 3BV8A 1NSKL 1JLGA 3I5AA 1XN9A 2CADA 3TUIC 2QLBB 2AEMA 1URRA 3FMWA 2A10A 3A3NB 1FO1A 4KHPF 4ZDNA 4RW9B 4OHYA 1NRKA 2MKIA 3CJSA 2OFGX 2CG8A 4K7QA 5KFJA 3LW5C 3HFZB 3LAMA 1RB0A 4NMXA 1S49A 2YBVA 1Y5LB 4B08A 3L95X 1NPKA 2QRRA 2HRYA 1NKEA 4ICLA 3H59A 3EGZA 1Q8LA 4A47A 3ZNJ1 1LQ9A 4EUVA 5IC6B 4U67Q 2UXBF 3BZQA 2JJ4D 1O8BA 3EZOA 2DNQA 2YWWA 1F6TA 5F0UA 3A8EA 5D4OA 2VASA 3IR7B 1AYEA 2YNFB 2B8QA 2EFOA 1IKVA 3UQSA 3JQMA 1OPZA 1PYSB 1ZBTA 1FFWB 3Q8RB 2BOPA 1EP4A 1OYDA 3M6VA 3DLBA 2YPYA 5AE3A 1HBNB 2N4DA 4Q0BA 3IAM9 2RRBA 1CPZA 1X31C 2HHTA 3ULHA 3G6ES 2J0WA 4ZCLA 1HNXF 3PEHA 4BCAA 2XGPA 3KLFA 2GS8A 1TUVA 2MKKA 4H4OB 3Q89A 4TKTA 1AUSL 1FVQA 5ETPA 2IMWP 4RW6A 3WX4A 3Q22A 1KD1T 2QIFA 2CFXA 4ILMA 4KJIA 3HVTA 6AT1B 3H98A 2FJEB 1YQHA 1JB0C 4DR3F 3G86A 1U47A 1NK4A 1GMWA 4XIUA 2FY8A 4LQ3A 3I5CA 4ECXA 3AOBA 3JQJA 2KL8A 4CTAB 3MCOA 3CMES 3SBMA 1IKWB 3LQVA 1AFJA 2OPRB 4C0OC 3TI0A 5U47A 3BR9A 4IFYB 3UN2A 2YQ0A 4LFAF 3C2PA 2C3UA 1NK0A 4ECVA 5K8NA 4PG7A 3ZZTA 3KK3A 2XMKA 4FVMA 1SQFA 3VQSA 3BYRA 1FERA 5BXIA 3MI7X 2CWKA 2DGXA 4X66J 3VR1A 2VJUA 2K3KA 3IRXA 3SQGB 1XMBA 2R7WA 4C8YA 3VVTA 2G9OA 2OPPB 3HDSA 2JRSA 1VQNS 3BPSP 3H20A 3GIMA 4JI5F 1JXLA 1SL2A 2HVIA 1TK0A 2FVRA 5E33A 4N77A 1JLEA 2VQFJ 4FDFA 1G4CA 4DPWA 2QFJA 4DDFA 4X65J 1RK8A 3BH7B 4M63A 5K20B 4B9UA 4K4ZA 3W9HA 4DSLA 3V6HA 3KG0A 2Z56B 1IN0A 2DO4A 3K7RA 3PX0A 3PIPQ 3MCNA 2ZHAA 3BO4A 5E3AA 3FDSA 5LSOA 1S7IA 1EHWA 5IC4B 1WORA 5FDLB 3LP1A 3VGTA 3MMCB 1TVRB 2EWHA 1ZM2A 1RKJA 3DRPB 5A0YB 2DGTA 4O3QA 5HMWA 4DPXA 1VQ6S 3CTRA 2KH9A 4X4OA 4M1KA 2AX1A 3KOAA 2GO8A 4OHZA 4E0DA 1H6KX 2J9DE 2VG5A 2RMLA 4L73A 3X3UA 2IDEA 4FF1A 1T9YA 2BE7D 1SV5A 2DO0A 2ASLA 1ZZFA 7FD1A 1QAJA 2RHSB 1UVNA 1JLAA 1UJ4A 2DY9A 4DV6F 4DV0F 4MIWA 3KLHB 1VR6A 1KLMB 2OTLS 3ZC4A 4LVOP 2H5IB 3MGJA 1VRUB 3I0SB 4HEA9 2W8LA 5DO2A 3FCHA 3MEEA 4JI2J 5ITHA 4DR1J
chains in the Genus database with same CATH topology
2WVEA 3PHTA 3BKFA 2WVFA 2WVDA 2BJ3A 2BJ1A 3BKTA 3QSIA 2Y3YA 2CADA 3BKUA 2FGCA 1Q5VA 2CAJA 2WVBA 2PC6A 3OD2A 2BJ7A 1Q5YA 2CA9A 2BJ9A 2BJ8A 2HZVA 2F1FA 2HZAA 3LGHA 2NZCA 2WVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVE A;  3PHT A;  3BKF A;  2WVF A;  2WVD A;  2BJ3 A;  2BJ1 A;  3BKT A;  3QSI A;  2Y3Y A;  2CAD A;  3BKU A;  2FGC A;  1Q5V A;  2CAJ A;  2WVB A;  2PC6 A;  3OD2 A;  2BJ7 A;  1Q5Y A;  2CA9 A;  2BJ9 A;  2BJ8 A;  2HZV A;  2F1F A;  2HZA A;  3LGH A;  2NZC A;  2WVC A; 
#chains in the Genus database with same CATH topology
 3HPO A;  5CD4 H;  2WRM A;  3KDN A;  4A48 A;  3CT9 A;  2OEL A;  3DGP B;  1RA7 A;  1TV6 B;  5D0R A;  4TLR A;  2VPY B;  4FS2 A;  2E1A A;  1FRI A;  4G1I A;  3CJ0 A;  3UN5 A;  4EZ6 A;  1R0A B;  3WQP A;  4AND A;  2PDA A;  2XQC A;  3K57 A;  3DXB A;  2YH1 A;  2RF2 B;  2UXD F;  1KTQ A;  3GZ7 A;  4DR4 F;  2WVB A;  4NA2 A;  2CPH A;  4YP3 A;  1S1T A;  4WU3 A;  5LMN J;  1T9U A;  5DZ6 A;  4F8R A;  4I2Q B;  3IWN C;  4RBT A;  2IRY A;  3GR0 A;  2DHA A;  5KT5 A;  4YHH F;  2LQ8 A;  4ZLJ A;  3G71 S;  2XO6 A;  4QQB A;  3D1Q A;  2IVM A;  5KTQ A;  4M5M A;  1GH8 A;  2QL5 B;  2MXY A;  3BF4 A;  1FKP A;  2D3U A;  4TVA B;  2QZ8 A;  1FJE B;  3GJS B;  4DFM A;  2V8H A;  3Q86 A;  2K1R A;  1RLC L;  1VK3 A;  4KHR A;  2IRX A;  3VWS A;  1UVM A;  1WTB A;  2AEJ A;  2HNY B;  3M8P B;  1OWX A;  3P45 B;  1PJ6 A;  1YZ6 A;  2DVI A;  3BJY A;  5C5J A;  1DRZ A;  2YVS A;  5A76 A;  5KG1 A;  1D0E A;  2BZ2 A;  3A13 A;  2BAB A;  3QID A;  1M5V C;  3OLB A;  2HBQ B;  2J9E A;  5SUH A;  3FSI A;  3IO1 A;  3OQ2 A;  1WDD A;  4QU7 A;  3MM9 A;  2VD3 A;  2ZDP A;  4U96 A;  5E3P A;  3KG1 A;  1RA6 A;  1U1Q A;  2DH9 A;  5EUH A;  4KO0 A;  5KFV A;  2LXU A;  2LEP A;  3S6E A;  3QRR A;  1KHW A;  2QL7 B;  1CQM A;  5AXL A;  3MDF A;  1C0T B;  5KT2 A;  2HHV A;  5HJX A;  4I6W A;  2UUW A;  4IG3 B;  1TKT B;  2VG7 A;  2JZ5 A;  2DR9 A;  2AT1 B;  2NSC A;  4GMK A;  3BGF A;  1R0C B;  4R5P B;  2W1B A;  4CZC A;  4J9P A;  2M8H A;  4RR5 A;  4O3P A;  2AGO A;  3FBB A;  3QZ7 A;  1HPZ A;  5F9N A;  2GO9 A;  1U4B A;  3I55 S;  4YR3 A;  4NLD A;  3RZA A;  3N28 A;  1XMQ F;  2UUA F;  1OJ4 A;  1FK9 A;  2VFS A;  4FS1 A;  3M7V A;  4FN5 A;  5GAG I;  1M5H A;  2VFR A;  4RNH A;  1NK5 A;  2RU3 A;  1FD8 A;  2PI5 A;  4KFB B;  1QTN B;  3NGU A;  5CYQ A;  2YNH A;  1S9E A;  4J7C A;  1HAR A;  5IOL A;  5KFK A;  5GVQ A;  5F8G A;  4B3S F;  4USU A;  3FZ2 A;  1HA1 A;  5B09 A;  1VQ5 S;  1FD2 A;  2CPJ A;  1DJ0 A;  5IZH A;  1NKC A;  2R8G A;  1R7I A;  1DFD A;  1LFW A;  1U2C A;  2YNG B;  3KLE B;  1N5T A;  2IAJ B;  3A8K A;  3FNN A;  3D68 A;  5K14 B;  3US5 A;  8ATC B;  2KXF A;  2XI2 A;  2JFK A;  5C2C A;  2AP6 A;  2GVD A;  4WP3 A;  5E5N A;  1WC4 A;  5D15 A;  1NHV A;  2OH2 A;  2J9D A;  2V8D A;  1HBM A;  3C15 A;  2DGQ A;  2HQI A;  4Q45 A;  3H90 A;  4J9R A;  2F4V F;  1JLC A;  1RGV A;  4ZPB A;  2ZH1 A;  1VJW A;  3ZZY A;  1RJJ A;  2HLU A;  5I42 B;  1U1P A;  2ZOG A;  1VLO A;  4YFU A;  1URN A;  3VTI A;  1NH7 A;  5HBM B;  1U6F A;  3THV A;  4UST A;  4IR9 A;  2C28 A;  1P6T A;  4ZS6 A;  5GAH I;  4BC9 A;  1IQT A;  2XHW A;  1SKR A;  2WON A;  2LXI A;  3ZTO A;  2XZD B;  2MQ8 A;  2IA6 A;  2RU9 A;  5J1P A;  2QEX S;  3O44 A;  1UJ6 A;  2U1A A;  4ZA1 A;  4M5D B;  1EX8 A;  1HNZ F;  1N54 B;  3DC2 A;  2J7W A;  2U2F A;  4ZHR B;  4U7C A;  1S1X B;  4JBC A;  1S6O A;  4IOB A;  3NG8 A;  2CA9 A;  2EFQ A;  4A8Q A;  5DM7 Q;  1MWY A;  3OBI A;  4X4S A;  3FGV A;  2DHG A;  4DL3 A;  4DR6 J;  2M5Y A;  2XYP B;  4IDK B;  4B9T A;  4X4R A;  1Q8B A;  3AAW B;  2V5H G;  3NWG A;  2RSQ A;  1OQ3 A;  2GFF A;  4LRB A;  3BGR A;  2HHU A;  3QGG A;  3CD0 A;  3BQ1 A;  4DL6 A;  2FLL A;  1X9W A;  2AQ4 A;  2FZG B;  2LCW A;  4G1P A;  2YY3 A;  2ZH5 A;  2HKE A;  2J0S D;  2BJ8 A;  4HAC A;  2FYX A;  2XCP A;  3VGS A;  1TKZ B;  1OS5 A;  5KFI A;  2HQF A;  2VA2 A;  1XR6 A;  4EU0 A;  3D66 A;  1U0S A;  2AU0 A;  2YKN B;  4CNZ A;  1MN7 A;  4J9Q A;  3R2C J;  3DCA A;  1RHM B;  4JI7 J;  3JYT A;  3G8S A;  1VQ9 S;  1C1B B;  4DLE A;  3VAM A;  1HI1 A;  2G1D A;  3R2D J;  1WD6 A;  3W2W B;  1Q7Y T;  1XQI A;  2YWH A;  4YB1 P;  2UU9 F;  1DHM A;  2ZWO A;  3CPW R;  3ZO7 A;  4NRT A;  4ZJQ A;  3IP0 A;  2HHH J;  2UUB F;  3ICL A;  1CUL A;  2OPS B;  3WIV A;  2PI4 A;  2GIR A;  3RRK A;  1H0H B;  2KZZ A;  4DCO B;  4EZ9 A;  3HZG A;  3FUY A;  4IQX A;  3BM7 A;  1N5Y B;  4RW8 A;  1ZPW X;  1EZZ B;  3MZI A;  1X7V A;  1WF2 A;  3MCS A;  2XZT B;  1S97 A;  5J1E A;  3B54 A;  1U25 A;  3H5U A;  4PWD A;  2ZWP A;  4O0I A;  3J7Z 5;  4RW4 B;  2Q3P A;  4YY3 J;  1OY9 A;  2G0I A;  5T7L B;  3G87 A;  1EAR A;  4ER8 A;  4DL4 A;  3BBC A;  1UET A;  2DRD A;  3D67 A;  4OV6 A;  1RAE B;  1GT8 A;  4K4V A;  3FK4 A;  2OSR A;  5JXS A;  4JV0 A;  2BW7 A;  2Y0S D;  2XG8 A;  1X9S A;  4NZ6 A;  4ED7 A;  1RHQ B;  1KFS A;  4N8N A;  1HIY A;  3AB4 B;  3D7S B;  2I1R A;  4AL7 A;  4GVB A;  5A2Q Y;  2QSF A;  2R2T A;  3OR2 B;  4F3M A;  3OJU A;  5E3R A;  3R5J B;  2HGL A;  2O67 A;  2LA6 A;  2AW0 A;  3M05 A;  4FYX B;  2FUG 9;  3W1Y C;  3WHI A;  2CQ1 A;  1UZH A;  2QLF B;  3J80 U;  2VG6 A;  2WW8 A;  4PWU A;  1S1W A;  1E6V B;  1J5E J;  1L3V A;  5F3Z A;  3W61 A;  2R7O A;  2ZZT A;  1P8G A;  2XZW A;  3DOK B;  3OR1 A;  4GRS A;  1HQU A;  2X3D A;  4DL0 C;  1WNE A;  4JYA J;  2CPI A;  3I5B A;  2C2N A;  3Q2T C;  4G6V B;  3I4H X;  3U27 A;  2BKP A;  3MPW A;  1C1C A;  1ZET A;  4I0W A;  1HWL A;  4NYP A;  3Q23 A;  3ZZR A;  1S9G A;  4QU6 A;  3P4U B;  2KZM A;  4N7T A;  3LPY A;  2DPJ A;  4DR2 F;  2AV5 A;  3J7Z T;  4FBT A;  3LTO A;  2GQC A;  1IBL J;  4MTP A;  2ZBI A;  4TXS A;  1A9N B;  3F73 A;  1VK8 A;  2M9K A;  4P73 A;  2HQC A;  1B99 A;  5CZX A;  3OFG A;  1VHF A;  4ZLP A;  4NXN J;  2KM8 C;  2EK1 A;  2W01 A;  1ZYQ A;  3PDN A;  3GLJ A;  3G8T A;  4OYB A;  4DFP A;  4BBY A;  2Z2Y B;  2ZJQ Q;  3NCP A;  2C3M A;  3L7O A;  2DNO A;  2GAH C;  2DRB A;  4IFV B;  2UV8 A;  5AXK A;  5KFW A;  1VGY A;  3DLK B;  4PCQ A;  1FX2 A;  2A3J A;  2MQQ A;  5KFY A;  2LXF A;  3PNI A;  1JJH A;  2HHS A;  2BE2 A;  2A1B A;  1TFY A;  3G6X A;  2HVE A;  4A8O A;  1SKW A;  1TP7 A;  4LRC A;  5LMU F;  3T41 A;  4N76 A;  1NHK L;  3C6T A;  1D1U A;  4W92 B;  3M30 B;  4ELU A;  1WEY A;  1HYS B;  5E0O A;  1WC1 A;  1N32 J;  3IG1 B;  1J5O A;  3UD3 P;  3I0R B;  2KRB A;  3TW0 A;  5EHH A;  3AJ1 A;  8RUC A;  2DCU B;  1YJN S;  3G9C A;  1KWM A;  2AYG A;  3SCI E;  2RKI B;  4Q5V A;  2XBP A;  5E2Q A;  4ECU A;  3GJT B;  4DV7 J;  2GJI A;  3GP9 A;  2DPI A;  1ZM3 A;  2VBW A;  4RBV A;  2HQD A;  3Q2S C;  3IGV A;  1PJ5 A;  3TJA A;  4RBU A;  3CNQ P;  4B3M F;  4V1A k;  2E5J A;  5HL7 Q;  3NOC A;  2ZH2 A;  2KHC A;  3EE3 A;  1X4C A;  5D3G B;  2KYX A;  2ZUG A;  5L8R C;  4LSN A;  4NA1 A;  3PZP A;  3T1H F;  2C1E B;  1NDK A;  2QTW A;  4C8Z A;  5FII A;  2EVZ A;  1PYO B;  1FRH A;  2ZFH A;  2XO7 A;  3PX6 A;  3MEG B;  3ZZZ A;  5F0W A;  3N6L A;  3NNC A;  2UVV A;  3W64 A;  1SIZ A;  2RDI A;  4MK8 A;  4Q2M A;  2GAG C;  5MLC V;  5HI7 A;  3H7H B;  5L1I A;  2DCL A;  2B4O A;  3F44 A;  3IAS 9;  2RUS A;  5G4D A;  4DV5 J;  3K59 A;  1N6Q B;  4Z37 A;  2QJ3 A;  3IM8 A;  3D54 A;  2VFT A;  4KY3 A;  3EPI A;  3VGU A;  2MZS A;  3PYF A;  3GPA A;  1GXU A;  4H4M B;  1YJR A;  2YH0 A;  4MYT A;  3ITH A;  4C97 A;  4ZN1 A;  6FDR A;  4JB8 B;  3D3C J;  2JEJ A;  3J81 j;  1I94 J;  2J5A A;  1XC9 A;  3JSM A;  1CC8 A;  3DYA A;  2ATL A;  3FEX B;  3KJN B;  1UFK A;  1NSA A;  3UNY A;  5LJ5 Y;  5HMZ A;  2B5J B;  4F4X A;  2FC9 A;  4C3L A;  4FXD A;  3THT A;  4IO1 A;  4ZPD A;  4DSF A;  2LU2 A;  1RHK B;  4DJB A;  4X64 F;  3MD3 A;  4XDC A;  4PKD B;  2AEF A;  2KFY A;  3ENA A;  1AUD A;  4WFB Q;  1K1Q A;  2GV1 A;  2W9B A;  1RT1 B;  1JK9 B;  1M5S A;  4EMD A;  2DNP A;  1IKX A;  2WSC C;  5J2N B;  4EEY A;  4NCA A;  1QVG R;  2MDA A;  4WF9 Q;  2QA1 A;  1RT6 A;  2KXH A;  3H5Y A;  1RTD B;  3PRB A;  4X62 J;  1U0H B;  1IM4 A;  4YR2 A;  2WOM A;  2IA0 A;  4DL5 A;  3W2V A;  3MMB A;  4B9M A;  1PBU A;  5B7W A;  3PRD A;  3OTD A;  4DN0 A;  1W2I A;  1DZ5 A;  2J6S A;  4P2X A;  2BXJ A;  1YG0 A;  1G7C B;  2E1C A;  5C25 B;  2Y0B B;  4ECQ A;  4HDH A;  1RBL A;  3ET6 B;  4XO0 A;  3MPY A;  4OHV A;  1NJI T;  4C7Q A;  2RH3 A;  1HWU A;  2RIJ A;  1TL7 B;  5E3C A;  3W9J A;  5ETT A;  3TNV A;  4ZVR B;  2JEG A;  3FFI B;  4GKJ F;  1S6P B;  2XNQ A;  2RUG A;  3DLL Q;  1EKS A;  1QSS A;  3MM5 B;  4DR7 F;  1BHN A;  1U48 A;  4IO9 Q;  4UT4 A;  3AXM A;  2LFV A;  3W9I A;  3I9V 9;  2BUN A;  4NAS A;  4KV8 B;  4WIQ A;  4A8K A;  4M5I A;  3UDC A;  4LF9 F;  1RBO B;  4ES3 A;  3GCX P;  3ENV A;  2NUU G;  2HHX A;  5EWF A;  3PYE A;  2LQB A;  4OZL A;  4JI8 F;  1JLB B;  3M8Z A;  3QSI A;  1T3N A;  2VL1 A;  1YHQ S;  2R42 A;  3PFE A;  3TAM B;  1U1L A;  3V81 B;  2OD6 A;  3B4M A;  5GME A;  1E6Y B;  4ZK7 M;  2IM3 A;  1SB6 A;  3DMJ B;  3GR1 A;  2LU1 A;  1GX5 A;  1TU0 B;  4DV3 F;  1Q81 T;  3VCD A;  3IS9 B;  3CGI A;  2CYY A;  3A4T A;  3W7B A;  5GAE I;  3TZZ A;  3SXL A;  1LWX A;  1NDC A;  4DUZ F;  4HTI A;  5BR8 J;  1UWB B;  2HVD A;  1HWI A;  3OL9 A;  4NE9 C;  1WDT A;  4EGL A;  4LSL B;  2RQK A;  2ZM6 F;  1U49 A;  2NPF A;  4Q43 A;  1R0B G;  3DU5 A;  5IV4 A;  2QV6 A;  2G4B A;  2RIL A;  2QN6 B;  2FZK B;  3QYY A;  1I51 B;  4H54 A;  1QSY A;  2ASD A;  2KKH A;  1RWU A;  3OUY B;  3C16 B;  4QZV B;  4TYB A;  3RBD A;  2K2P A;  4DS4 A;  4X65 F;  1KRP A;  1T9V A;  1S0V A;  4ETX A;  3MUV P;  4QJV A;  3MPU B;  2R8K A;  1S12 A;  2YWK A;  1RT5 B;  3TX0 A;  2DB1 A;  1RWV B;  5H1S V;  4WE1 B;  3CDA A;  2QL9 B;  5K8M A;  4IG0 B;  1VQL S;  4IYQ A;  3ZZ0 A;  1L5U A;  2VH7 A;  2KFN A;  2BAN A;  2FVP A;  3C6U B;  1X0P A;  2CG4 A;  4CWB A;  5IT9 Y;  4TQS A;  3BGO P;  1R3N A;  4ES2 A;  5KAK A;  2ZH7 A;  4QWE A;  4ZCI A;  4RZR A;  1DLO B;  3M8Q B;  1VLY A;  3DRS B;  2OP5 A;  4RL1 A;  1HNV A;  3QLH B;  4KSE B;  1FKO B;  4HTJ A;  2DR8 A;  3GIR A;  3R3T A;  5K8O A;  4ZIT A;  3NGK A;  5ETL A;  3IGN A;  2VV5 A;  1SJF A;  1IBK J;  5F3T A;  4K4T A;  2XY6 A;  2WCX A;  4GC7 A;  4PXB A;  1NJW A;  2GVZ A;  2GHP A;  4M5L A;  5L38 A;  3FKB A;  9RUB A;  2DNY A;  3MUT P;  4NLW A;  1MU2 A;  3CSK A;  3TUP A;  4TN2 A;  1KOH A;  3FC9 A;  1G2E A;  2Y8W A;  4DSE A;  4OV1 A;  1SJQ A;  4OYX A;  2ZVS A;  2W9C B;  4NI2 B;  3AT1 B;  4PG8 A;  2FHM A;  2HFU A;  3CJK B;  3HHE A;  5KFR A;  4CRJ A;  3EWG A;  1TL3 A;  3UCZ P;  3V6D A;  3D1O A;  5EWG A;  2H48 B;  1N36 J;  2MKS A;  2YKM A;  4LF4 J;  4DV2 J;  4J5O A;  2I5J B;  3R5D A;  4R0J A;  4NLT A;  4ITS A;  2M70 A;  2I6W A;  2DIS A;  3DLH A;  2E29 A;  5L46 A;  3JAM U;  1X4E A;  5LXY A;  3CCZ A;  1U1K A;  1AZS B;  1CS4 B;  4X4N A;  1FJ7 A;  2CZV C;  4OI2 A;  3MMA B;  3CCL S;  2XHC A;  2V8P A;  5BJR A;  4OX8 A;  1F3F A;  4C98 A;  3CJR A;  7AT1 B;  3HJV A;  4CLW A;  3HHL B;  4DQI A;  4FF4 A;  3T1Y J;  3Q8S B;  2DEI A;  4LRA A;  5IM0 A;  2I8E A;  2CWX A;  3UDV A;  4CT9 A;  4JV1 A;  1BGX T;  1S6Q A;  1XJW B;  2ZH8 A;  1H2U X;  1SL0 A;  1Y7P A;  4PPD A;  2E5L J;  2VKZ G;  3U7J A;  4P52 A;  1H73 A;  4DFJ A;  4CLS A;  2UP1 A;  3BPD A;  1DQ8 A;  1N56 A;  2Y1L B;  4Z7C A;  2QA2 A;  2DNN A;  4LT6 A;  1LWF B;  2XM3 A;  2NQP A;  5E3Q A;  2HFV A;  4MK7 A;  1KKH A;  1F5B A;  1EKR A;  3E01 A;  5DQI A;  3PW2 A;  4ECY A;  1RLD A;  2HQ3 A;  2G13 A;  4EO6 A;  1UTA A;  1FTC A;  3OSP A;  4ED8 A;  2CNN B;  4TU7 A;  1Q8K A;  3IN5 A;  1IBM F;  3N6N A;  2OO4 A;  1GFW B;  1PKU A;  2GQ2 A;  3OSN A;  1A6L A;  4AE5 A;  3T5J A;  3OXG A;  2AGQ A;  2HVZ A;  3D6H B;  4UZC A;  2RE1 A;  4YB6 A;  2JFD A;  1CQN A;  4OYP A;  3DM2 A;  4QIG A;  3SV3 A;  3G4S S;  2E7W A;  2CJX B;  5DDO C;  2NSB A;  4USI A;  1OSD A;  3QT6 A;  2MY7 A;  1T9W A;  3R7S B;  4ETZ A;  4I7F A;  1V3R A;  1N0U A;  2CQ2 A;  4GVL A;  2D1C A;  4O0N A;  1HBN A;  4CO5 A;  1JLG B;  1FRM A;  1JJ4 A;  3HK2 A;  4OFZ A;  4OI0 A;  5I3P A;  4HKQ A;  4A8Y A;  1QDU B;  4TQR A;  4TY9 A;  4USK A;  4LFC J;  2MLX A;  4H4O A;  2KN4 A;  3IRW P;  4C8L A;  1HHS A;  2KJV A;  3MD1 A;  1IQZ A;  1U1O A;  4CH0 S;  3P96 A;  1VBZ A;  1QM9 A;  1PAE X;  5IS2 A;  2M3D A;  1GMV A;  1HL6 A;  4ZVS B;  4YUD A;  3KJV B;  1U8W A;  1K44 A;  2VPW B;  2XMW A;  1FTR A;  2B43 A;  3TA1 A;  4EWT A;  1FKA F;  4OHX A;  1IKW A;  4ZVF A;  5LSR A;  1BD6 A;  1FT8 A;  1T11 A;  1WSV A;  3ISZ A;  4IFY A;  1R8A A;  3SCJ E;  1VC0 A;  1O0P A;  2JLE A;  3DOL A;  3S8S A;  1PAU B;  2QT7 A;  3MM6 A;  2ZC4 A;  4KKO A;  4QWB A;  1DUR A;  3K5N A;  4F0K A;  1IKV B;  2BR0 A;  4KPC A;  2FGO A;  1NJX A;  2QMW A;  3K17 A;  3SQG A;  5D8H B;  1X9M A;  3FBC A;  5HJY A;  4ILL A;  2OPP A;  3EX7 B;  3T5K A;  2JC0 A;  1TKX B;  3OTE A;  5C24 B;  3HKW A;  2KXN B;  5HLF B;  1ZPV A;  1QAI A;  3BBB A;  1FJC A;  3A1Y G;  1D9F A;  4FBU A;  4RNM A;  4RW6 B;  3UD4 P;  2M88 A;  4TU8 A;  4JI1 F;  3O8W A;  1BY9 A;  3HVT B;  2DXD A;  1ZM4 A;  2RD5 C;  4O3R A;  3NL0 A;  1FNO A;  4AUK A;  2VPZ B;  3DFE A;  3P5T L;  4DV1 J;  5KG0 A;  1VRT A;  4BLG A;  4U7U D;  2ASJ A;  2WTF A;  1BMQ B;  2MTL A;  2ZBR A;  5FDL A;  3EYZ A;  5MAO A;  2AGP A;  3HO1 A;  4UOF A;  4J9M A;  3PJW A;  4HHU A;  4MKV A;  3MFI A;  1RI7 A;  3CW2 C;  3RYL A;  5J2M A;  2I2Y A;  3H25 A;  1S9F A;  1H7W A;  3HX9 A;  1WC5 A;  4LF8 J;  2UZA A;  2FJA B;  4A8X A;  2GQQ A;  2EK6 A;  1V5I B;  3O1L A;  1T9T A;  5KFG A;  1X5P A;  2I9S A;  3AY0 A;  2KDO A;  3BSC A;  4FVC A;  3EDR B;  4QPT A;  1XNR F;  4NXM F;  7FDR A;  4RUA A;  4WK3 A;  3FEZ A;  1VHI A;  4JV2 A;  2PE8 A;  2PO4 A;  3W8P A;  1JLE B;  3I6P A;  3CDW A;  4URQ U;  3PV8 A;  1F2H A;  1KLM A;  1N34 J;  4JI7 F;  1RT3 A;  4LFB F;  3CC2 S;  4ZPC A;  2L48 A;  1WHX A;  1PG5 B;  4F4Y A;  3I0S A;  5KG4 A;  3DI6 A;  3N79 A;  2RNE A;  1FEH A;  4NLV A;  2RRN A;  3BGU A;  1IVZ A;  1U6B A;  3F41 A;  2DR7 A;  3LP1 B;  3DGP A;  2YTC A;  2F7V A;  1VCT A;  1F9E B;  1LOU A;  2O01 C;  3TX8 A;  1U26 A;  2L9N A;  3IBF B;  4K4U A;  1DAX A;  2WB1 D;  3E51 A;  2RF2 A;  4DQP A;  3MAA B;  3J81 U;  3V4I A;  2XCA A;  1OO0 B;  5A6P A;  2VG5 B;  2AHO B;  3MEK A;  2QMX A;  4I2Q A;  4RUC A;  2N4C A;  1RHU B;  4LUB A;  5K8P A;  2NYI A;  3CUN A;  1MLA A;  3H2U B;  4KGK A;  2BM0 A;  2XUL A;  1B0V A;  1S6U A;  3HKZ D;  1RQ0 A;  3CD5 A;  2NLW A;  5I3U A;  1Q1K A;  4UUW A;  3UE2 A;  1YK9 A;  4ALZ A;  4LRF A;  3AOD A;  4GKK J;  2PC6 A;  2XYG B;  4RUH A;  4I2P B;  5KFA A;  3FMB A;  4CLK A;  4QYZ K;  4DR5 J;  1HBO B;  4EBD A;  4RJV A;  1RAJ A;  3NRB A;  3MTJ A;  3ENW A;  2A0F B;  1DTQ B;  3Q8P B;  3OW2 R;  1S1V A;  2G2Z A;  3MF5 A;  3G82 A;  3WIU A;  5ETK A;  2GJ2 A;  1GMU A;  5KT4 A;  1S99 A;  4ZN3 A;  3IBW A;  3T3F A;  2W7O A;  4UOG A;  4EBE A;  2F8M A;  3KHG A;  3PJ9 A;  4JI0 F;  3CC7 S;  1DAR A;  4KIA A;  5KFE A;  4QR2 A;  3SZ2 A;  2DIU A;  5KFZ A;  2CQG A;  1EET A;  1TAQ A;  1S1T B;  3R5B A;  2FPH X;  1D8Z A;  4JYA F;  2JEI A;  2E9R X;  2HFN A;  2GX8 A;  3ELH A;  4UW2 A;  5KFQ A;  1X4H A;  3P8B B;  1TKT A;  4X84 A;  2H54 B;  4UY8 5;  3TEG A;  4X4U A;  4R5P A;  2EBG A;  4J9U E;  1R6Y A;  2P6T A;  1N33 F;  4ATN A;  4YR0 A;  1U1M A;  1LFP A;  2KVI A;  2K1R B;  4OX7 A;  2Q66 A;  2NXE A;  1Y10 A;  2B9Y A;  1IUJ A;  1LWC A;  1UVI A;  2VOO A;  3CCW A;  4MJK A;  3SDE A;  4OX9 J;  2AD9 A;  4J37 A;  3H8Y A;  5J2Q A;  3ILL A;  2AYB A;  3HJF A;  1IR1 A;  1RKI A;  1Q53 A;  3EDQ B;  2HK3 A;  4ZP9 A;  2JVR A;  5F8M A;  5B0D A;  2ZDO A;  4KHP J;  4NML A;  3LP0 B;  3HCX A;  4ZCK A;  2W2M P;  1KVJ A;  3KDO A;  4WFX A;  3MM9 B;  4C4W A;  3RB4 A;  2ZJP Q;  3GFY A;  4DCP B;  4AXI A;  4ED4 A;  4DPY A;  2YNG A;  4DQS A;  1RIS A;  1T0T V;  1F1B B;  4KO0 B;  5KFS A;  2H5E A;  4WKR A;  1YBT A;  3RR8 A;  5K14 A;  4HDG A;  2V9K A;  1WG4 A;  4JI6 F;  1OY6 A;  3RB0 A;  4DU7 A;  4MFB A;  2UUC J;  4U6P A;  3DRY A;  3VV2 B;  4B3R F;  2VG7 B;  2UXB J;  2Y3Y A;  1Q5V A;  2HWI A;  1A0O B;  3RRH A;  2ZE2 B;  3QT7 A;  2CPD A;  1NZA A;  3QMQ A;  1HPZ B;  1RYS A;  1Z1Z A;  2VZ9 A;  5GAD I;  2ILY A;  1C2P A;  4JI3 J;  2V2Q A;  1FK9 B;  4WYL A;  1HHT P;  2IM1 A;  4G1Q A;  4CDI A;  4YEA A;  4UQG A;  4WBF A;  3MR3 A;  1C4C A;  3N9U C;  1LW2 A;  2W9A A;  2Q6B A;  1S9E B;  3IMQ J;  2YNI A;  2ZHB A;  1TUG B;  1UPP A;  1RXO B;  1PCA A;  3AD8 C;  2DKO B;  1HNX J;  3PX4 A;  2ACY A;  4ED2 A;  1RBA A;  3PAC A;  4NLG A;  1JXV A;  2YQ1 A;  2ROG A;  1WWH A;  1FE4 A;  1EAY C;  1LXN A;  1FF2 A;  2VOD A;  4QBU A;  2MQP A;  4DR3 J;  4C6A A;  4WWS A;  2H4Y B;  1S1X A;  2MQM A;  3BGL A;  1ZTT A;  2QLJ B;  3E8O A;  3MPD A;  4LBI A;  2Z2M A;  3M32 A;  5H9E J;  1HNI B;  1CJK A;  1RAA B;  3OFF A;  5M2P A;  2K8G A;  3KMQ A;  1VJQ A;  1HBM B;  2VQE F;  4G65 A;  4BC7 A;  4Q44 A;  3EGN A;  1FI4 A;  3WDO A;  2ZNZ A;  3VHQ A;  3PKM A;  2CPF A;  2BAC A;  3ZFV A;  2PII A;  1UEK A;  5KG7 A;  3O5T B;  4USV A;  3H4D A;  1SC1 B;  5F8H A;  2DNK A;  3MED A;  2HGM A;  1F9F A;  1HHQ A;  2DHH A;  4WFY A;  2B6A A;  1RDR A;  2KFZ A;  2F5G A;  1AXQ A;  2WON B;  3ZZO A;  1TKD A;  4JI5 J;  3PYG A;  3AHP A;  1VQS A;  3GON A;  3QO9 B;  4DZ6 A;  2MGZ B;  1FJG F;  2R3V A;  2YKN A;  1H72 C;  1GAO A;  5KFC A;  1RAG B;  3JSY A;  3KK2 A;  1C1B A;  4PUO A;  2XMM A;  4I6Y A;  2VC0 A;  2AYE A;  1YJ9 S;  4L74 A;  2VUG A;  1I6J A;  5LL6 d;  1AB8 A;  2BV3 A;  5M2U A;  2CZ9 A;  5KT3 A;  4NEZ A;  5CAB A;  5DET A;  1F2G A;  1KQF B;  3HSZ A;  2E66 A;  2EG2 A;  2E1M C;  2IDL A;  2CQ4 A;  2SXL A;  1HD0 A;  4CLF A;  4X62 F;  1VQM S;  2HBR B;  2R7V A;  1J27 A;  3PW7 A;  3V6J A;  2B9X A;  3BGR B;  4PG5 A;  2RS2 A;  2OSQ A;  3CCU S;  2C2E A;  1SKU B;  3MUR P;  1B70 B;  5ETV A;  2F3J A;  2R9L A;  3VAF A;  2OPQ A;  1UWA A;  2ZNY A;  4A8S A;  1SQG A;  3BO3 A;  4QPX A;  3EVM A;  4RLE A;  4DCJ B;  4DV6 J;  2PA3 A;  3BH6 B;  1VQP S;  4LRD A;  4DV0 J;  2KO1 A;  3RB6 A;  3HLU A;  3AB2 B;  4QIW D;  3Q8Q B;  2W2O P;  4E98 A;  3D5M A;  2CJK A;  1T05 A;  3QRP A;  3JYT B;  2L08 A;  1X4D A;  1KTV A;  3DLG A;  3PW5 A;  1WSR A;  2EBE A;  2RAQ A;  2XMJ A;  3RUB L;  3NY0 A;  2B51 A;  3R5A A;  1AT1 B;  5CYM A;  2IRU A;  3K2Y A;  3BN4 A;  1NO8 A;  3BQ2 A;  3UN3 A;  5F8I A;  1Y3J A;  2DNR A;  1RU2 A;  1GQE A;  3TR5 A;  1IJE B;  1CUL B;  4W4M A;  1GXL A;  3O6Q A;  1NXI A;  4Y28 C;  3VGV A;  2XMA A;  2UXD J;  1UCN A;  3HSD A;  5LT5 A;  4DR4 J;  1E6V A;  2E1R A;  4RW8 B;  4B3O A;  3ZTP A;  2E5I A;  5AE1 A;  2L41 A;  2O3D A;  1CEZ A;  5J1E B;  5AXM A;  4PWD B;  4D3H A;  2YQ3 A;  3RRG A;  1Q7L B;  4Y2K A;  3UDE A;  1NJY A;  3GMG A;  1IWA A;  2IY5 B;  1X4A A;  4O3O A;  5D4N A;  4QIE A;  4Z7Y A;  4O44 B;  3N5B A;  1GEH A;  3UW1 A;  4I1T A;  3U1N A;  2B4U A;  2AYM A;  1PIL A;  4XPC A;  2HAI A;  1F60 B;  3GIK A;  5GMD A;  3SYZ A;  5HRO A;  2IC3 A;  4ZLL A;  3IR5 B;  3VF0 B;  2MJN A;  1QVF R;  2I38 A;  1MML A;  3Q8U A;  4GVB B;  1SL1 A;  1B4S A;  1R8B A;  1VBK A;  2Q6C A;  4K4Y A;  5K9F A;  1ITP A;  5CD4 A;  3C14 A;  1KNZ A;  4ZP6 A;  2K7K A;  2C3P A;  3M9M B;  2R8H A;  1RCO B;  2VG6 B;  2VFV A;  3GB0 A;  3KFW X;  2CNO B;  2CQC A;  1UFL A;  4H4K C;  1S1W B;  5DGB A;  1C0U A;  3KHH A;  4CLY A;  3OR1 B;  1HQU B;  1HNW J;  1P1L A;  2CJ9 A;  2H1Y A;  3LGH A;  4M5G A;  3CIM A;  5D77 A;  4K2X A;  3OXL A;  1HYS A;  4YDX A;  3RAX A;  1C1C B;  3IG1 A;  1NH8 A;  3I0R A;  2XS7 A;  3HHK A;  4NLR A;  1QJH A;  1S9G B;  2CQ0 A;  2ADC A;  3K58 A;  4LIW A;  3CJ2 A;  1WOS A;  2MZ1 A;  2W4D A;  3D6M B;  4IH6 A;  3D6F B;  2BYC A;  2UUA J;  3N0V A;  2VOP A;  2EXU A;  1TEL A;  3EMT A;  1M5O C;  3S1T A;  2J7K A;  1W26 A;  5AJ3 F;  2P5V A;  2E44 A;  1FDA A;  5CYJ A;  5KFB A;  2C2R A;  2VIC A;  2CNK B;  3UR0 A;  1M1H A;  2W7A A;  1IBK F;  3KLG A;  4LF5 F;  4PQA A;  4YME A;  4N5S A;  2GMH A;  3MEC A;  4WZM A;  3CD6 S;  4KH0 B;  1VQ7 S;  4B3S J;  4O4G A;  3VZH A;  2MKY A;  1NZ8 A;  2XSJ A;  1S0N A;  4DXL A;  2A2C A;  2ZKT A;  4Y2I A;  2XWY A;  3A3P B;  2BKN A;  3OTO F;  2GMJ A;  1TFW A;  1HMV B;  3AD9 C;  4QIF A;  4IUF A;  1RU1 A;  4ED6 A;  3KG4 A;  3C6T B;  4CM0 A;  1D3W A;  1VQ4 S;  2BA9 A;  3NGD A;  1J5O B;  2CXE A;  1SVD A;  2HG4 A;  1S4E A;  4WTY A;  1N6Q A;  2HZA A;  2KB2 A;  3HVA A;  3TYT A;  1Z2L A;  2F4V J;  4C2M A;  4DSJ A;  3MPV A;  4FPR A;  4KGX B;  1GNK A;  2ZJR Q;  2IJF A;  2HHP A;  1IBC B;  1P27 B;  3NNH A;  3CXC R;  1KN6 A;  3MR5 A;  4Y6I A;  1FXR A;  1SQE A;  4WTO B;  3BO2 A;  4MIB A;  2JNJ A;  1HD1 A;  4RKU C;  4MK9 A;  5H9E K;  2HNZ A;  3CMA S;  3W63 A;  5KFX A;  3T1Y F;  4LSN B;  3RB3 A;  5K5M A;  2J6T A;  4UF4 A;  1HNZ J;  3K5M A;  1NJZ A;  2CZ4 A;  1WEX A;  1ELO A;  2YWE A;  2YKP A;  4X2B A;  2G2O A;  1KLN A;  3GFZ A;  2E5L F;  1WHW A;  2C2O B;  5HP1 A;  3I4P A;  2BJ1 A;  3MOZ A;  1H38 A;  4HT5 A;  1Q95 G;  3HHL C;  3V4M A;  4ES1 A;  2HYI B;  2MHE A;  3AXK A;  3SQO P;  2KHD A;  2FHO B;  4U95 A;  2NXU A;  2VBZ A;  2ZKU A;  2ZOF A;  4B17 A;  5IT0 A;  1IKY B;  2XLI A;  1S57 A;  3BSA A;  4ECZ A;  4OYM A;  4I64 A;  3GE9 A;  3ITH B;  5H9F J;  1U6Z A;  1PSD A;  2ILZ A;  1V9O A;  1ZOT A;  1XMO F;  1BWV A;  1LV5 A;  4FXW A;  3OVB A;  3JSM B;  1S10 A;  1QAX A;  3DYA B;  1WEZ A;  5G0R B;  4Y3C A;  4C11 A;  1M1K T;  1KFD A;  2QSW A;  1NK9 A;  2DHX A;  2BM1 A;  1Q4R A;  3EZ5 A;  3FFI A;  3CMQ A;  3MAQ A;  2WHO A;  4F3O A;  1R27 B;  3D0I E;  4PYA A;  3DGV A;  4QWD A;  5C2G A;  4LVN P;  3MM5 A;  3NGR A;  4KYZ A;  4K59 A;  1WG1 A;  2W9B B;  2Y8Y A;  3HSJ A;  3M2U A;  1IKX B;  3T6J A;  2UU9 J;  3NCR A;  3J80 Y;  2Y1R I;  2YX1 A;  3FQK A;  2O5D A;  3Q0A A;  4KPY A;  5L1J A;  2UUB J;  2DNZ A;  4Y65 A;  1JLB A;  1K9M T;  2NZ4 A;  3NMA A;  2WOM B;  3MMB B;  4A4J A;  3BQ0 A;  3X1L B;  1HWK A;  4OIX A;  3AOC A;  2NYH A;  1CC7 A;  1SH0 A;  2HIQ A;  3HVW A;  2JEF A;  1JLF A;  3H2L A;  3CCR S;  1EIY B;  3W66 A;  3CJQ A;  4DL7 A;  4FPI A;  2ZD1 B;  3QGI A;  4ZVH A;  2MMY A;  2J76 E;  5IQQ A;  1IM6 A;  4LR9 A;  4F0H A;  4LMZ A;  2HS4 A;  3IXQ A;  4LF7 F;  1Y00 A;  3CCJ S;  2BBE A;  1OPI A;  1IXK A;  2NRE A;  1A7G E;  2OI2 A;  3IS9 A;  2BQR A;  1RTJ A;  2AJ1 A;  3CVK A;  2B0G A;  1T9X A;  1YZ7 A;  1DQA A;  2L9W A;  3I56 S;  3AA8 A;  2V8V A;  4KR0 B;  2F9D A;  4O3S A;  1G3O A;  4LSL A;  4K4W A;  2CQI A;  2PFD A;  4HLB A;  3M2R A;  4L72 B;  1G1X A;  2ZH9 A;  3JTP A;  2DHS A;  2ZBQ A;  2BQ3 A;  1VDH A;  2MYF A;  3LO3 A;  4F7V A;  4ED5 A;  4IKA A;  1JJC B;  3K0J A;  1OSC A;  4I4B A;  2IYG A;  3OUY A;  2NCK L;  2ATC B;  1OY8 A;  2HND A;  3KNG A;  2BW2 A;  2XYH B;  2F8H A;  3EUN A;  1SBR A;  2LEC A;  5J1N A;  4NCB A;  3JTO A;  4EI2 A;  1KVI A;  5T14 A;  2X51 A;  3I32 A;  1RT5 A;  2HSE B;  3ONQ A;  1N5S A;  1TUW A;  2X3G A;  1KVK A;  4P71 A;  4IG0 A;  4V19 J;  4Q2L A;  1MRO A;  1KOO A;  3C6U A;  3HUL A;  1WUU A;  3M8W A;  1NCL A;  3OL7 A;  1TMM A;  4NZ7 A;  4O23 A;  4OLO A;  5FJ4 A;  3NGT A;  2J8A A;  5GAE U;  5L1K A;  3R7N B;  3HFK A;  1YJ7 A;  2FD2 A;  1FKO A;  2JC1 A;  3H40 A;  3CF5 Q;  4LRE A;  4DX7 A;  1U8S A;  1YVF A;  3NP5 A;  4LF8 F;  1WOO A;  3EM1 A;  3SCL E;  4EFA C;  3HD1 A;  1TK8 A;  4CI0 B;  1RTZ A;  3Q24 A;  4PXC A;  2H65 B;  2P6S A;  3H42 A;  3IC1 A;  3QAE A;  2P9G A;  3EZU A;  5C42 A;  4DS5 A;  4USH A;  3CDE A;  4W98 A;  3ZTS A;  3VZI A;  4QOT A;  4L3K A;  2RS8 A;  2V4R A;  4OJH A;  2JL9 A;  2W8K A;  1FDN A;  1X4F A;  1BE4 A;  4F26 A;  3EVW A;  5A8R A;  1BXN A;  2YKO A;  2MZJ A;  5HAN A;  1V3Z A;  1FHT A;  4KT0 C;  1LKZ A;  5CCL A;  3HSG A;  2HMI A;  1TR0 A;  5LMU J;  1YBU A;  3POT A;  3ISN C;  2V63 A;  4NI2 A;  2WBR A;  5HO4 A;  4OYZ A;  2D9P A;  2XWX A;  1R8P A;  4CIO A;  3SI8 A;  2V67 A;  4A8M P;  2BAN B;  1VQY A;  2EG1 A;  4KQZ A;  1RT4 A;  2NPI A;  4P74 A;  1UZD A;  1D09 B;  2I5J A;  5CXT A;  5CH7 B;  1U24 A;  1FNX H;  4YQW A;  3TAQ A;  3T6B A;  2J8S A;  1HNV B;  3NXZ A;  2UXC J;  3I96 A;  2CPE A;  2B4P A;  3CB4 A;  4FP9 A;  4KH1 B;  4ZLN A;  4EYH B;  3QWP A;  5KFN A;  5A8W B;  1UJ5 A;  3DDN A;  1O5J A;  4DG1 B;  2E9Z A;  3K8W A;  1AZS A;  3FSX A;  2HRU A;  2VC1 A;  4X4Q A;  2KTQ A;  3MMA A;  2W2P P;  1S5Z A;  2V2Z A;  4PAB A;  2GVZ B;  4B3M J;  3HVR A;  2FJV A;  5D0G A;  1S48 A;  3O3L A;  2E7V A;  3JSB A;  5AXN A;  3DRR A;  2A18 A;  3RGI A;  3OTC A;  4LF6 F;  4J9O A;  3T1H J;  2D74 B;  1JWW A;  3F56 A;  3DDK A;  1CJU A;  3KXD A;  4YB7 A;  2MST A;  3ETO A;  3V5R A;  3GIJ A;  1MN9 A;  4X4P A;  1ZS6 A;  1R43 A;  2AJ4 A;  1H3D A;  3GG1 A;  1VRQ C;  5FLX U;  4NCG A;  1TL3 B;  3C3L A;  4ED3 A;  4PYD A;  2FJD B;  3LP2 A;  5B0F A;  3U1L A;  4TU9 A;  2YKM B;  1KHV A;  2BDP A;  2M0G B;  3PY8 A;  3D2W A;  2OEJ A;  1KEK A;  5KOX A;  4M5N A;  1YSJ A;  4K2J A;  2ZH6 A;  4XTT A;  5DM6 Q;  3HI9 A;  2J6U A;  3QT8 A;  2OUG A;  2LDI A;  3LWL A;  4DV4 F;  1WG5 A;  3J7A 1;  2BJ9 A;  3BS9 A;  4C3M A;  4ID5 A;  2N3L A;  5IXU A;  2CPX A;  4DU8 A;  2Z4P A;  3EVO A;  1OYE A;  2ABY A;  4EK2 A;  3R8Y A;  2C3O A;  2CDQ A;  1BQN B;  2FY1 A;  3QPI A;  2HHQ A;  2QLW A;  4X64 J;  5IWA F;  1D9D A;  5DG9 A;  1S6Q B;  4F02 A;  3CCE S;  3TA0 A;  1VBY A;  3MMJ A;  3PIO Q;  1Y5N B;  2AKW B;  2XLJ A;  3BKT A;  4KRW A;  5L9N A;  5KFH A;  3G96 A;  2FIU A;  4CYU A;  2H51 B;  2AMC B;  2NUH A;  3H4B A;  4ILR A;  3TQ1 A;  3D9B A;  2XI3 A;  2DGW A;  2LVW A;  2YPZ A;  4IH5 A;  2E7X A;  1VOM A;  1WF0 A;  2FTR A;  3GG0 A;  4YN3 B;  4KE5 A;  3R27 A;  2WZ1 A;  3HMJ G;  4QCL A;  4TYA A;  1RAC B;  2LQ5 A;  1SJ1 A;  3E01 B;  2VKR A;  4DPO A;  2IIH A;  4P75 A;  1AA1 B;  1RAI B;  2LQJ A;  2FLN A;  3ZTR A;  3A8J A;  3PXG a;  2V4J A;  3LGM A;  3FBF A;  3TAN A;  1NND A;  1ROF A;  1UL3 A;  4IRD A;  3KJV A;  4ZPT R;  3FRY A;  2OAU A;  2M52 A;  5BYQ A;  1HI8 A;  1REV A;  3VAI A;  2UUC F;  2EKY A;  1WC6 A;  5E7O B;  1JNZ B;  4N41 A;  3DU6 A;  2DTJ A;  2Q43 A;  1RT7 B;  3RG6 A;  1JJ2 R;  1KQK A;  3DM2 B;  3P5B P;  4YDD B;  2HRT A;  4GKJ J;  4OI4 A;  3UCU P;  1JKH B;  1Q8I A;  3CUL A;  4CH1 A;  3OTB A;  2MLZ A;  2W24 A;  4ECS A;  4DR7 J;  3GYN A;  4C0B A;  3TZW A;  4JI3 F;  3GFH A;  2FDN A;  2UV8 G;  5HVG A;  1DY3 A;  4I7F B;  2C2M B;  3NAH A;  2KU7 A;  4QW8 A;  4AYB D;  4WCE Q;  3NGS A;  3G6V A;  3R5C A;  2AZ3 A;  1CJV B;  2HFZ A;  4E2F B;  4LF9 J;  1TZ0 A;  3TP2 A;  2AJQ A;  3KK1 B;  2E5G A;  3MM7 B;  3R6L B;  2QG9 B;  1NAQ A;  1TKX A;  5C24 A;  4R0E A;  4JI8 J;  4P2M A;  5HLF A;  5LM7 E;  4K0K F;  1NB2 A;  1QLN A;  3ZTQ A;  3F0N A;  2C42 A;  1SJ4 P;  2G2Y A;  5J2P B;  1S0O A;  4UQT A;  3M8S A;  3CC4 S;  1FRX A;  4XDD A;  2WAQ D;  4CO2 A;  2N7C A;  2ALZ A;  4QIV A;  3GSD A;  2DGS A;  2KI2 A;  1XNQ J;  5HQM A;  2Z58 B;  2PGC A;  1MW7 A;  3QSY B;  3DRX A;  2MPU A;  2LEB A;  4AFF A;  2R7R A;  3UVJ B;  2ALY B;  3EIC A;  4D3G A;  4DV3 J;  2VF3 A;  4DF4 A;  2P2C B;  3DOL B;  3MOJ B;  1VIS A;  1NB7 A;  2X1B A;  1LWE A;  4M8L A;  3MM6 B;  3IWL A;  4U7U K;  3UCG A;  4KKO B;  1FNM A;  4DUZ J;  1S7H A;  1KDN A;  4AD6 A;  2ROP A;  1I5O B;  2ZM6 J;  4M95 A;  5HQ8 A;  1Z4U A;  4P7T A;  1VIO A;  3CCS S;  2MKH A;  3G8Q A;  5B08 A;  2R8I A;  4AQY F;  4PWW A;  3L3C A;  4F2S A;  2X1A A;  1N88 A;  4LQ9 A;  4PQU B;  2VIH A;  1XEZ A;  2OML A;  3PG9 A;  1K0V A;  3SEO A;  2HFO A;  2C2D A;  2BJD A;  2QYC A;  3RU0 A;  2XMT A;  4BDP A;  4Y34 A;  2V69 A;  2GCF A;  3TEH B;  3OFE A;  4CP5 A;  4NX9 A;  3GU0 A;  2M4M A;  1P9Q C;  1S1U A;  2HGN A;  2WVC A;  3JTN A;  1X0F A;  3DOM A;  5DG7 A;  4ZVQ B;  6FD1 A;  2CRL A;  1VRT B;  5F8J A;  1SC4 B;  1B64 A;  3FQL A;  4Y2M A;  2DYA A;  3JAM Y;  1NBE B;  4ECW A;  3L09 A;  2F63 A;  3M8Y A;  1OMS A;  4IOC Q;  5DQG A;  3KLI B;  4IRK A;  4L3N A;  1X8D A;  2KT3 A;  4PEO A;  1Y0H A;  1H74 A;  1PJ7 A;  2DH8 A;  1B0T A;  1K8A T;  4GC6 A;  5J2M B;  4UUX A;  2V2K A;  3MAA A;  3T5H A;  3UDL A;  1T03 A;  3P3D A;  5KFD A;  4OJ3 A;  5HN0 A;  5JVG Q;  1WI8 A;  3KNA A;  4TLQ A;  4DSI A;  3W60 A;  1VC5 A;  1VBX A;  4Q8E A;  2OLW A;  4R8U A;  4URG A;  2C22 A;  3LA0 A;  3RAM A;  4A8W A;  4RW7 A;  3B6B A;  3TWZ A;  2EC2 A;  4HR2 A;  4K4S A;  3FZB A;  3HM9 A;  4I2P A;  2MB0 B;  4FYD A;  3CJ3 A;  1IR0 A;  1RT3 B;  5DDP C;  3R9L A;  4UTG A;  1HBO A;  2WSF C;  2PD1 A;  3DI6 B;  4R25 A;  4NEY A;  2Z8Q A;  1DTQ A;  1WI6 A;  2CVI A;  2DGV A;  3AJ2 A;  3CE8 A;  1N48 A;  1PC5 A;  3DLE B;  3GYX B;  4QR0 A;  5A8K B;  4HHH A;  4NLQ A;  2W4C A;  2BKO A;  2F1F A;  1F0X A;  4DFK A;  2HFS A;  4OZ3 A;  1YRT A;  2ZIT A;  5D0E A;  1FES A;  2OKQ A;  3M1V A;  3W8G A;  1I1G A;  1UA1 A;  3V4I B;  3MR7 A;  1N8R T;  1RTH A;  1NPR A;  1BC6 A;  3QT5 A;  1F9H A;  1PYT A;  3AOA A;  4OI1 A;  2MJU A;  2ERR A;  4CO0 A;  4Q8F A;  1BQM A;  5I3U B;  1EB0 A;  1JLQ B;  4Q7A A;  2PFF B;  1S77 D;  1NPP A;  3M6U A;  1BUX A;  3NNA A;  2ZZN A;  4DX6 A;  3EJM A;  3PJX A;  2JLF A;  4CLL A;  3TOQ A;  2AX0 A;  3OVS A;  4ZJO A;  3QBC A;  3QRQ A;  3Q8Y A;  2GGP A;  4ID8 A;  1LW0 B;  4F25 A;  2XEX A;  1YKW A;  1HQ2 A;  1S1V B;  4CO1 A;  3G82 B;  3CIZ A;  5HSP A;  1O51 A;  1XBW A;  1BLU A;  4X66 F;  2GIF A;  4DI6 A;  1RAB B;  4F67 A;  2DGU A;  3DNC A;  5DQH A;  1SUQ A;  1RT2 A;  1FEE A;  3LP0 A;  1C4A A;  3PCO B;  2GC8 A;  5F8L A;  4N47 A;  5EX0 A;  4KBI A;  3K8V A;  3BEG B;  1U02 A;  1HI0 P;  2VQF F;  4ECT A;  1EET B;  4FYW B;  2IPO B;  1IBM J;  5JUM A;  2VON A;  4PPZ A;  1HNW F;  4MYU A;  1VQK S;  4DL2 A;  2LDY A;  2GA7 A;  1NK6 A;  1RSC A;  4NLP A;  3LH2 S;  1U7L A;  3M2V B;  1X5S A;  3OT9 A;  3OL8 A;  1T02 A;  2H3E B;  4LF2 A;  4TY8 B;  2R7Q A;  4PG6 A;  2W7P A;  4HL9 A;  3SSS A;  1RTI A;  5BYS A;  2ZE2 A;  1QE1 A;  4OJ1 A;  4N56 A;  3BKF A;  4USJ C;  5KFP A;  4MT1 A;  4KHM A;  3VAL A;  4I6A A;  2VBX A;  2MHN A;  3RAQ A;  1CJT A;  1LWC B;  4B3T J;  1SPB P;  4F4K A;  1JQG A;  2QGF B;  3SDE B;  1RHR B;  5J2Q B;  4ZVG A;  2JVO A;  3CJ8 A;  1KC8 T;  3AQO A;  5IV3 A;  1RWX B;  2D69 A;  5ETR A;  1PGZ A;  3VAK A;  3NBP A;  4HH0 A;  1T7P A;  3CDU A;  1YRX A;  2Z2L A;  1TL1 A;  2IFX A;  3UO0 A;  2XLK A;  4OL8 A;  2A6M A;  4NLY A;  2NXJ A;  1APS A;  1P9Y A;  3H5X A;  5EDW A;  3LAN A;  4RO0 A;  2WVE A;  3ZZU A;  2MQL A;  4P10 A;  2GML A;  4OYI A;  1PBA A;  4WYW A;  2CPZ A;  4PR6 A;  4MFB B;  4ECR A;  4JI2 F;  4DR1 F;  1Z2Z A;  1HNI A;  1HR0 J;  4U9R A;  3IM9 A;  3QIP A;  3PO4 A;  4WKY A;  2RHQ B;  1V3S A;  1ULR A;  3JB9 k;  1YDL A;  3KHR A;  5HQL A;  5ETN A;  5GAD U;  3WC2 A;  2I0X A;  3S7R A;  2QO3 A;  3M4X A;  4G1Q B;  4K50 A;  3WZ0 A;  3NS5 A;  4ZMM A;  1TK5 A;  2OFH X;  2Y1I A;  2PEB A;  3GCW P;  2B56 A;  4LSZ B;  3FSY A;  1LW2 B;  3J7Y U;  4JV5 J;  1K1S A;  4WU2 A;  5LMN F;  1AW0 A;  2PEH A;  2YNI B;  3MM8 A;  1SXL A;  3L7P A;  1MWZ A;  2XTJ P;  3SSR A;  4DSK A;  3IFE A;  2UVR A;  1T94 A;  3QO9 A;  3QFW A;  1EQ0 A;  2MGZ A;  1DTT B;  1VMB A;  1HBU A;  2V6A A;  1CSJ A;  4J9S A;  4JI1 J;  1BQX A;  4BWM A;  4Y00 A;  4F4Z A;  2V2V A;  4FKX A;  1H2T Z;  1HQE A;  4USW A;  2LMI A;  2IM2 A;  5GMK a;  4ANE A;  4DHV A;  2VJV A;  4XK8 C;  4FXV A;  2COL A;  1XTZ A;  1ZA1 B;  3IR6 B;  3M32 B;  2DNH A;  2HS0 A;  2PN6 A;  1D9A A;  1CJK B;  1T8E A;  5M2R A;  3J81 Y;  1OQ6 A;  2CJY B;  3BYP A;  2L9D A;  1SH3 A;  2UVU A;  3LUY A;  4WII A;  4RW9 A;  2K06 A;  3QFH A;  1QUP A;  3CCQ S;  2RQC A;  4DWI A;  4F3Q A;  1N52 B;  2HAF A;  3MED B;  2YX7 A;  3FEY B;  4E8U A;  3AH6 A;  1RWK B;  2B6A B;  1XNR J;  5HAT A;  4NXM J;  5LXR A;  2VB6 A;  1P1T A;  2HQG A;  3T19 A;  4F50 A;  1SCJ B;  4RNN A;  3SMZ A;  2OEM A;  2G0J A;  3H0P A;  5A6W A;  1ZAV A;  4PXD A;  4LFB J;  3CO0 P;  1WC0 A;  3KK2 B;  5LOQ A;  4PUO B;  2BE9 B;  1U2R A;  4ZJL A;  2YNF A;  3I31 A;  3A8I A;  3NWR A;  3PM9 A;  2WBM A;  2J0X A;  3TZX A;  1X4G A;  1R89 A;  4LR7 A;  5DLF A;  3BKU A;  1YIT S;  4I67 A;  3AD7 C;  5BYR A;  2EW9 A;  3OJS A;  2W25 A;  3GTY X;  1FFS B;  1ZTW A;  2B9W A;  3TO8 A;  3JSR A;  2DD8 S;  2UUT A;  2OPQ B;  2XGQ A;  3KYL A;  3K5O A;  3PHE A;  4CTA A;  4B9V A;  4ICL B;  2CPY A;  1RHJ B;  2C2Z B;  1FE0 A;  3VVU A;  1NHU A;  4O44 A;  2GZO A;  3U1M A;  3W62 A;  2DBB A;  2FLP A;  2OPR A;  4NYO A;  2Z0G A;  2YWG A;  1UAW A;  4RWX A;  4ENO A;  2JH3 A;  5AT1 B;  4OMF G;  1T05 B;  5B0E A;  4LF1 A;  3DLG B;  3CO9 A;  2EPI A;  3FVY A;  1NKB A;  3GV8 B;  3AJD A;  2IM0 A;  1NLK L;  2OHD A;  5HVH A;  5CZV A;  5IT4 A;  5CYM B;  1N5Q A;  1EP4 B;  2NS1 B;  3RR7 A;  1UFW A;  2GW8 A;  4WK1 A;  4Q0B B;  3QGP A;  3GFX A;  2FLO A;  2MQN A;  4JI0 J;  3KLF B;  3IBC B;  2MQO A;  4JI4 J;  2PA8 D;  2J7U A;  1Q5Y A;  1CLF A;  4B3O B;  4X4V A;  5F41 A;  1MMD A;  3PR5 B;  4AT1 B;  3HXM A;  5D6G A;  4XPE A;  1TTH B;  8AT1 B;  4AXJ A;  4G3I A;  1EJ7 L;  5D78 A;  2AJ2 A;  3K5P A;  2XY7 A;  2FHJ D;  3QAT A;  2BMB A;  1XIQ A;  4BWJ A;  1DBD A;  3MXH P;  4DOZ A;  1WC3 A;  1Y4Z B;  3RJM B;  1S76 D;  5DGA A;  1CVJ A;  1GXT A;  2MSS A;  1N33 J;  3QQC D;  4DR6 F;  3MMC A;  2DEJ A;  4OLP A;  1TVR A;  4BHQ A;  4USM A;  4ZPA A;  3GV7 B;  3DRP A;  5A0Y A;  2ZVI A;  5HRO B;  2IC3 B;  2KRR A;  3VAH A;  4RPF A;  4OI3 A;  1X5O A;  2DR6 A;  3KK3 B;  3UFC X;  4C8K A;  2MEW A;  1H98 A;  2CQ3 A;  4OZ1 A;  4FKY A;  4UOC A;  5HMX A;  1N4L A;  4OHW A;  3FRZ A;  1MMN A;  3IRX B;  3C14 B;  1RYR A;  3N4W A;  1RWP B;  5JJB A;  2FJW A;  2NR0 A;  2QMU B;  3W5X A;  4V19 X;  3C8Y A;  1VYA A;  1DQ9 A;  2HZC A;  3PW4 A;  5RUB A;  2ZH3 A;  2R7U A;  2ZBC A;  1JXE A;  3FCW A;  3E3X A;  1Q78 A;  2FZC B;  4NLU A;  1VIX A;  3RW7 A;  2W4P A;  5LJ3 Y;  1C0U B;  1NSP A;  1HMV A;  1UA0 A;  3KLH A;  3GQC A;  1ACM B;  4CCH A;  4JI6 J;  2N7Y A;  2X7I A;  1VRU A;  2ZBP A;  1ZAX A;  1N5V A;  4S0M A;  4B3R J;  4DUY J;  2CIM A;  3KUE A;  1R8H A;  2ZUA A;  4UZB A;  2CQD A;  2EFV A;  4ZVO B;  4IR1 A;  1W7W A;  1WJ9 A;  4HH1 A;  1TV6 A;  2UXC F;  2HHH F;  1R0A A;  1B0P A;  3TJ8 A;  3KJF B;  4MMO A;  1Y9O A;  2OMO A;  4DLG A;  2VDH A;  3KLG B;  2UVW A;  1FDD A;  5EN1 A;  2ZZM A;  3MEC B;  3NMR A;  4A8F A;  2BRK A;  2R8J A;  4EYI B;  4O4G B;  2CQP A;  4LR8 A;  2O66 A;  3AA9 A;  1SV5 B;  2XSJ B;  1YJW S;  4YY3 F;  3CD7 A;  3M8R A;  1JLA B;  2LYV A;  1S59 A;  3LAL A;  2M8D B;  4O3N A;  4MH8 A;  4YB5 A;  2NXN A;  2HNY A;  3L9Z A;  2CQB A;  3M8P A;  4URS A;  2ZEJ A;  3R97 A;  2N3O A;  5EX3 A;  4K8R A;  3MEE B;  5AE2 A;  5JMN A;  1VS3 A;  2KG1 A;  2DIV A;  2KYZ A;  2FHJ A;  4ZP7 A;  1VC6 A;  2ZHO A;  4DBQ A;  2VQE J;  4KAI A;  3EPG A;  1L3K A;  1XER A;  2V50 A;  4X4T A;  1IKY A;  1QY7 A;  2DT9 A;  3M6X A;  4PZV A;  4QYR A;  4ZVU B;  1TQL A;  1GX6 A;  4C8M A;  1XR5 A;  4Y2A A;  2IBO A;  4OZJ A;  4C8N A;  1J5E F;  5I3Q A;  3QGH A;  4ZPW R;  5G0R A;  4BS2 A;  4HT7 A;  2EFN A;  4YS2 A;  1C0T A;  4B9S A;  1O6X A;  1TL4 A;  3Q83 A;  4ANC A;  1SJ3 P;  4O4R A;  4YOE A;  3NEK A;  1FJG J;  4IG3 A;  2HNZ B;  4C9D A;  1K73 T;  2IMO A;  3KTQ A;  1V6H A;  3EGW B;  1FKP B;  4FYV B;  4QW9 A;  2GHW A;  4KC5 A;  1T3O A;  5IQ6 A;  5DG8 A;  3MTK A;  2R2S A;  5F9L A;  3W5Z A;  5HP1 B;  3SSQ A;  4ELV A;  2V9W A;  3AQP A;  5KFU A;  5KG6 A;  3UWT A;  2B7B B;  1IBL F;  4RUB A;  1NUE A;  5LSL A;  1KR4 A;  4I69 A;  4NL5 A;  2V34 A;  4LBP A;  2DK2 A;  4P6Q A;  2ACM A;  4M5H A;  5JVH Q;  2BRL A;  1JX4 A;  4RU2 A;  4NXN F;  4KFB A;  4F0M A;  4C3K A;  1SC3 B;  1HLW A;  2K7J A;  2ADB A;  2AJ0 A;  3NCQ A;  2WVF A;  5L9X A;  1KBR A;  1NME B;  1WKL A;  5CAA A;  5A2Q U;  1ZM9 A;  3OHB A;  2P9C A;  1KP6 A;  2CJB A;  2J0Q D;  2B7C B;  1Q16 B;  3OV7 A;  1LNQ A;  3IA0 A;  3KLE A;  4A46 A;  2IAJ A;  3D0G E;  1RCX B;  2BVZ A;  1YI2 S;  2ZD1 A;  3PEJ A;  1RWW B;  4WP9 A;  1YLX A;  2RVJ A;  2QLX A;  4C11 B;  4ERD A;  2AJF E;  4J90 A;  2GIQ A;  2M2B A;  4MKA A;  1B7Y B;  5HAO A;  2VU5 A;  4W90 B;  2IBK A;  4PXE A;  1N32 F;  2NXC A;  1ZAW A;  2MZQ A;  3ETM A;  1NSQ A;  2FB0 A;  1I3O B;  1X60 A;  3QAU A;  4NA3 A;  3QJL A;  1UEU A;  4OZ2 A;  3NKY A;  2QA4 G;  5I42 A;  4J9L A;  1CBK A;  2QC3 A;  4UY8 T;  3M2U B;  3CWJ A;  5HBM A;  4DV7 F;  5KFF A;  3NAI A;  3KUH A;  3J7Y I;  5CYQ B;  2F8E X;  2YNH B;  4OZ5 A;  1ZH5 A;  3CJ5 A;  3DKD A;  4QWA A;  3D4J A;  1HKA A;  5B0B A;  3ENQ A;  5E41 A;  3UD5 A;  2Y9H A;  1MNE A;  4CM2 A;  3TA2 A;  1SH2 A;  1M5K C;  1M1G A;  3BBF A;  1JLF B;  3B4D A;  2HW3 A;  4WP8 A;  3SIP B;  3PVX A;  2R7T A;  1S79 A;  2JOQ A;  2LQ9 A;  2H5J B;  3WBZ A;  4M5D A;  3EXY A;  1R6V A;  4FYY B;  1WHV A;  1H7X A;  4ZHR A;  2IVY A;  1XNQ F;  3D6T B;  4DPT A;  2E5H A;  2K3I A;  4PAA A;  5DZ7 A;  3CJ4 A;  1K47 A;  4ZIV A;  2L3M A;  2GVD B;  1NEE A;  3I82 A;  1VQ8 S;  1RTJ B;  2F65 A;  2AF6 A;  5FD1 A;  2DNL A;  3JXO A;  4DV5 F;  1RAF B;  1HW9 A;  4IDK A;  1MWQ A;  5DRK A;  2G0C A;  4LFA J;  3C15 B;  1Q86 T;  4OQJ A;  1JLC B;  4JUZ A;  5I4M A;  3G2X A;  2OEK A;  3TAR A;  2FVS A;  2BOA A;  3D28 A;  3DXS X;  4U8V A;  2JX2 A;  3M2R B;  3PYD A;  1I94 F;  2JHE A;  3E2E A;  4HI2 A;  3G6Y A;  1NDP A;  1WHY A;  2R2R A;  2FC8 A;  1TKZ A;  2CVE A;  2E1P A;  2HEK A;  4RNO A;  2HND B;  2DH7 A;  1WAC A;  3GII A;  3PKY A;  3HD2 A;  4OJG A;  4ZCM A;  2MY8 A;  3M9O B;  2DGO A;  4CLT A;  4TNO A;  4WFZ A;  1M5P C;  2WB4 A;  3SFU A;  1QTM A;  4CO4 A;  1FA0 A;  3TZY A;  3WX8 A;  3MAH A;  2R7X A;  4NZ0 A;  4KGV B;  3K89 A;  2DIT A;  1MRO B;  2JWN A;  1M90 T;  4F04 B;  1FXL A;  3D3B J;  4DEZ A;  1G6B A;  2Y1J A;  3W2W A;  4ZIW A;  2XMU A;  3QWU A;  1FRK A;  3OXF A;  4QWC A;  1GTH A;  1YWX A;  3BR8 A;  5ETM A;  1D8Y A;  2OGU A;  4JOU A;  4CQ1 A;  3OVA A;  1UVL A;  1RWN B;  2OPS A;  4ELT A;  1KON A;  5A8W A;  2KT2 A;  3Q8V A;  1UW4 A;  4F2R A;  5KG3 A;  4M94 A;  5AJ3 J;  4DG1 A;  1NDL A;  3CCT A;  4LF5 J;  5ETQ A;  1N5Y A;  2RJZ A;  1NK8 A;  3LGN A;  4HAC B;  5C42 B;  3OLA A;  3VAG A;  1SC6 A;  4AL5 A;  2ASY A;  3EGV A;  5F8N A;  4RW4 A;  4NLO A;  4OX6 A;  1IWG A;  3ZZP A;  5T7L A;  4CT8 A;  3RBE A;  3W3S A;  4MIA A;  2X1G A;  5A8R B;  1YJT A;  3OTO J;  2EI5 A;  1B3T A;  2WVD A;  2POK A;  4C8O A;  2FQQ B;  3UNG C;  4WXO A;  2RRA A;  1YBA A;  4NWB A;  2HMI B;  3POT B;  4L75 A;  5CHC B;  4LIR A;  1BWE A;  2HWT A;  1RE1 B;  3R6G B;  1RT4 B;  5D4P A;  2W2Q P;  4IRC A;  1YRU A;  1K0T A;  2XSF A;  4P7V A;  1WEL A;  3B8H A;  3OR2 A;  2OTJ S;  4DQR A;  4JP8 A;  3MHY A;  3OFH A;  1V5V A;  4QYZ J;  1FCA A;  1QUV A;  2QX0 A;  3HHN B;  4ZVP B;  3T5L A;  2JDJ A;  2LP4 A;  2HZV A;  3IWX A;  1CG2 A;  2P8I A;  1S4F A;  2B3T B;  3DOK A;  2CAJ A;  2DJW A;  5KG5 A;  3ZNU A;  3BSO A;  2B4V A;  4C48 A;  1PIE A;  2PSZ A;  4YHH J;  3THP A;  3PO5 A;  3DRR B;  4KGM A;  1RWO B;  1BQN A;  2QA4 S;  1KQS R;  4K5R A;  1CJU B;  4MAK A;  2HVH A;  1RWM B;  3JQK A;  2XC9 A;  5KT6 A;  3NLC A;  3TUZ C;  4DZD A;  2OD4 A;  3HF5 A;  5BR8 F;  1UW9 A;  1SKS A;  1YX2 A;  4NCG B;  3LAK A;  3LP2 B;  4WFA Q;  4OZ0 A;  3BSN A;  2KJW A;  1Q0N A;  3GJR B;  5DLG A;  5ETS A;  2BEF A;  4IFV A;  4OYW A;  3S01 A;  3EXC X;  2LKZ A;  2PT0 A;  3DLK A;  2DNG A;  1XMO J;  1WOP A;  3GSI A;  3SFG A;  4WFN Q;  4B9N A;  1LK5 A;  4CNY A;  4ID5 B;  1L3T A;  4CO3 A;  3QJP A;  2R2U A;  2RDJ A;  4I56 A;  2HLT A;  1VFJ A;  1YJU A;  3M30 A;  5HVF A;  2MKJ A;  3N01 A;  2ZH4 A;  1RT7 A;  2BJE A;  3TVY A;  2F4F A;  2XMV A;  1JKH A;  2XNR A;  3GYG A;  4B3T F;  1XMQ J;  1UVJ A;  2YKQ A;  2D41 A;  2B8P A;  2RKI A;  3RW6 A;  1ARO P;  3CJT A;  3AFG A;  3V6K A;  1CJV A;  4OI6 A;  3KK1 A;  4F4A A;  3BRE A;  2KVQ E;  4CYU B;  3MM7 A;  2V68 A;  2FJB B;  1FXD A;  1B7F A;  2BJ3 A;  4OYA A;  4J9V A;  1KSP A;  3DN9 A;  1NU4 A;  2GJF A;  5ADZ A;  5KOW A;  1UMJ A;  1S72 S;  3HT3 A;  4K4X A;  5J2P A;  3O2I A;  4HVZ A;  2AWZ A;  4DMZ A;  3FJ2 A;  5D3G A;  2Q1L A;  2LEA A;  3WC0 A;  1F3V A;  2HBY B;  3QJJ A;  2V4J B;  3MEG A;  3I87 A;  1W2B R;  2BE2 B;  5D4L A;  2IYI A;  4FNI A;  4J9N A;  3L7U A;  4FZV A;  4EO8 A;  4DX5 A;  3OPK A;  1REV B;  3HHD A;  4LF7 J;  1XK8 A;  4WJB A;  3UVJ A;  2EC0 A;  4WPA A;  4IH7 A;  1Q79 A;  1EQM A;  3H2V E;  1HR0 F;  2MKC A;  1T95 A;  1N36 F;  3UI3 A;  4LF4 F;  4DV2 F;  3J7A N;  2M7S A;  2F9J A;  3KHL A;  1RUS A;  3PFO A;  1SIW B;  1U1R A;  5IT9 U;  4DN9 A;  3UPF A;  3N6M A;  3C46 A;  3P6Y C;  4H4M A;  1NK7 A;  4ZPV R;  2AIR B;  3L4B C;  4AL6 A;  4NLS A;  2VA3 A;  4JV5 F;  1L3S A;  3HT0 A;  1W25 A;  3HZE A;  4PQU A;  2PMH A;  1S0M A;  1SI9 A;  4KTQ A;  3LF0 A;  5C7P A;  1LEO A;  2B5J A;  3NS6 A;  1FWL A;  5SZT A;  3PHT A;  2ZOM A;  3D0H E;  1JMT A;  2A6O A;  2QYG A;  4RX6 A;  1F5A A;  4UOH A;  1GK8 A;  3JS9 A;  1J2V A;  2H9Z A;  4NYZ A;  3T9N A;  1RT1 A;  2FJX A;  2VHG A;  4GO5 X;  5J2N A;  4C0H A;  3KLI A;  5EWE A;  2OIH A;  3T1A A;  1FFG B;  1LWE B;  1H2V Z;  3FBE A;  1RTD A;  3T9Z A;  5DJB A;  4CLU A;  1U0H A;  5THW A;  3TVZ A;  1UVK A;  2GNK A;  3P49 B;  2EKN A;  2X1F A;  1HW8 A;  3A3O B;  3TJ9 A;  2VDI A;  4DX8 H;  1ZZN A;  1XWL A;  3BDP A;  4ZKA A;  1RAO A;  2O1P A;  3V2U C;  3RBZ A;  2Q79 A;  5KT7 A;  4DUT A;  5C25 A;  3UR3 C;  3ET6 A;  3KKF A;  1FWK A;  3MR6 A;  2D3O R;  3RBX A;  1TL7 A;  2QFI A;  2QE5 A;  2ZC3 A;  5FLX Y;  1TMJ A;  1S1U B;  4WXW A;  3TUJ C;  2RQM A;  3DOM B;  2HUR A;  4J9K A;  1S6P A;  2DXE A;  2WSE C;  3TRG A;  3BDE A;  3PRV A;  4HHJ A;  1N0V C;  3ILO A;  2ROE A;  1LXJ A;  2R4F A;  3DLE A;  5A8K A;  4KV8 A;  1U2F A;  2CKW A;  5KG2 A;  2XS5 A;  4M5J A;  3BN7 A;  1RT6 B;  4ZP8 A;  4K5S A;  1FX4 A;  2D3Z A;  1KQG B;  1ZA2 B;  4LJM A;  4L6V 3;  2B9E A;  5B0G A;  4LFC F;  3W2V B;  2CJA A;  2Z57 B;  1T03 B;  3CDB A;  2FVC A;  2APO A;  1U45 A;  1U09 A;  1ICE B;  2EFG A;  3TAM A;  1JIH A;  2MZR A;  4XAK A;  3V81 A;  1XR7 A;  1WKK A;  1UPM B;  2HPU A;  1JLQ A;  1E6Y A;  4R8U B;  2RT3 A;  4ZVE A;  4LF6 J;  4RW7 B;  4Y0F A;  3DMJ A;  2C3Y A;  2CDR B;  3NOG A;  1PC4 A;  1RP5 A;  4RU9 A;  3M6W A;  3KJQ B;  3ILI A;  3SV4 A;  2HK2 A;  2VFU A;  1GTE A;  1LW0 A;  4HI1 A;  5DS7 A;  2FGC A;  3W5Y A;  1UWB A;  1WKJ A;  2VBY A;  3B78 A;  2R7S A;  2AZ1 A;  1TAU A;  4H4K A;  3DHW C;  5KFL A;  4DQQ A;  1FDB A;  1YIJ S;  3I9Z A;  5EGY A;  2F40 A;  2WW4 A;  3HHL D;  5KFT A;  4KGZ B;  3M1V B;  4JI4 F;  2YXL A;  4CLZ A;  5D0H A;  2G1H A;  1F5C A;  4FF3 A;  3C16 A;  1RTH B;  1IR2 A;  2V0N A;  2IVF B;  1RZM A;  4DV4 J;  2D9O A;  4WZQ A;  1WF1 A;  2XY5 A;  4N8O A;  2DRA A;  2DXF A;  2IJN A;  1UEV A;  5CA5 A;  4Z2X A;  2XB2 D;  1YGY A;  3M2V A;  4P9S A;  1BQM B;  4WE1 A;  1L3U A;  1WTF A;  1IJF B;  4DV1 F;  1MG7 A;  4TY8 A;  2DY1 A;  5L39 A;  4J91 A;  3PTW A;  5DDR C;  4NPO A;  4CH7 A;  2KM8 B;  1Q82 T;  3KLV A;  5IWA J;  3TQE A;  2Z30 B;  3R1L A;  4P2S A;  2MZT A;  1DLO A;  3M8Q A;  4F36 A;  2KT5 A;  3OHA A;  3DRS A;  4DR2 J;  3BB5 A;  2EEY A;  1U1N A;  1LK7 A;  3QLH A;  3LWM A;  5B0C A;  2GGP B;  2YKA A;  2HBZ B;  4IQM A;  1Y11 A;  2N82 B;  2J9C A;  4FNH A;  5HMY A;  2W2N P;  3ADA C;  3M9N B;  1FWP A;  3GJQ B;  1UKU A;  3K5L A;  3QNW B;  2KG0 A;  1SUQ B;  3OD2 A;  1RT2 B;  4OZN A;  2CQH A;  4PG4 A;  2RDD A;  4GO7 X;  1YJV A;  3RTV A;  4L76 A;  1UP1 A;  2C2K B;  3R7B B;  2HIY A;  1M0S A;  1QD1 A;  1QAY A;  1N34 F;  1AFI A;  2YX4 A;  4NRU A;  1VQO S;  3QZ8 A;  2W9C A;  1RAD B;  3OL6 A;  4P72 A;  3CJK A;  4DUY F;  2LLZ A;  1RTI B;  4Y2C A;  2JLG A;  2FHK A;  1QE1 B;  3ILJ A;  3HFV A;  3MWB A;  4KB7 A;  2D3O 1;  3KUG A;  2VPX B;  3DLJ A;  2EFP A;  4B9L A;  3HP6 A;  4P2F A;  1CJT B;  3C19 A;  4ED1 A;  4RNF A;  3GWC A;  5KFO A;  3MUM P;  1VI7 A;  5GAG U;  1OIA A;  2D7S A;  4I68 A;  1R8C A;  3FCV A;  4OYO A;  1NM2 A;  2YWF A;  1FVS A;  2DR5 A;  4LBH A;  3W65 A;  1CS4 A;  2PMW A;  3VQT A;  3NBP B;  1X4B A;  4MKY A;  3MFH A;  4K0K J;  3TVK A;  4F4W A;  1TL1 B;  2E9T A;  4QR1 A;  3N5F A;  3MR2 A;  1KS2 A;  2RB7 A;  1DTT A;  3HHL A;  3NS7 B;  2CNL B;  4PRF A;  9ATC B;  1FRJ A;  1MU2 B;  2BJ7 A;  3U02 A;  4GKK F;  5IFM A;  3KWM A;  5DDQ C;  5CQG A;  4DR5 F;  3LOU A;  1HFE L;  2IJR A;  1Y5I B;  2MLY A;  2P9E A;  3A12 A;  3MCM A;  3DHX A;  2IHR 1;  1HWJ A;  4RWW A;  2WK4 A;  4DF8 A;  2HHW A;  5CCM A;  3QIP B;  3GV5 B;  3V6D B;  2BX6 A;  4CLP A;  3CCV S;  5HK4 A;  3CCM S;  1SJR A;  1LWF A;  3C66 A;  3GIL A;  3PW0 A;  5L1L A;  1JNR B;  4EBC A;  3TAP A;  4ZVT B;  2OJ3 A;  2Z2Z A;  4NLX A;  2FVQ A;  2DNM A;  3B82 A;  2NZC A;  3H5S A;  2V8G A;  1R31 A;  4MKB A;  4FF2 A;  3VAJ A;  2V4Q A;  2V94 A;  2A2D A;  1GMW D;  2XS2 A;  4AQY J;  4ED0 A;  4IOA Q;  3KMS A;  5B0A A;  5GAH U;  2H4W B;  3SCK E;  2GHV C;  3MM8 B;  2PMZ D;  3D1H A;  3ZXW A;  3R1H A;  1TL5 A;  2LA4 A;  3DDI A;  1PO6 A;  1FRL A;  1REG X;  3PR4 A;  5ETO A;  3CED A;  3R5G A;  1X5T A;  3LPE A;  4NOH A;  1HBU B;  4M5K A;  2CJQ A;  2HWH A;  4U8Y A;  1RAH B;  2BQU A;  1MSW D;  5IM0 B;  5KFM A;  1HQE B;  2CUY A;  2RQ4 A;  4ZOS A;  5H9F K;  2JSX A;  5T41 A;  4B02 A;  4DPU A;  4OX9 F;  3ISN D;  4HYK A;  1Y3K A;  2HS3 A;  1YTY A;  1QSL A;  3BV8 A;  1NSK L;  1JLG A;  3I5A A;  1XN9 A;  2CAD A;  3TUI C;  2QLB B;  2AEM A;  1URR A;  3FMW A;  2A10 A;  3A3N B;  1FO1 A;  4KHP F;  4ZDN A;  4RW9 B;  4OHY A;  1NRK A;  2MKI A;  3CJS A;  2OFG X;  2CG8 A;  4K7Q A;  5KFJ A;  3LW5 C;  3HFZ B;  3LAM A;  1RB0 A;  4NMX A;  1S49 A;  2YBV A;  1Y5L B;  4B08 A;  3L95 X;  1NPK A;  2QRR A;  2HRY A;  1NKE A;  4ICL A;  3H59 A;  3EGZ A;  1Q8L A;  4A47 A;  3ZNJ 1;  1LQ9 A;  4EUV A;  5IC6 B;  4U67 Q;  2UXB F;  3BZQ A;  2JJ4 D;  1O8B A;  3EZO A;  2DNQ A;  2YWW A;  1F6T A;  5F0U A;  3A8E A;  5D4O A;  2VAS A;  3IR7 B;  1AYE A;  2YNF B;  2B8Q A;  2EFO A;  1IKV A;  3UQS A;  3JQM A;  1OPZ A;  1PYS B;  1ZBT A;  1FFW B;  3Q8R B;  2BOP A;  1EP4 A;  1OYD A;  3M6V A;  3DLB A;  2YPY A;  5AE3 A;  1HBN B;  2N4D A;  4Q0B A;  3IAM 9;  2RRB A;  1CPZ A;  1X31 C;  2HHT A;  3ULH A;  3G6E S;  2J0W A;  4ZCL A;  1HNX F;  3PEH A;  4BCA A;  2XGP A;  3KLF A;  2GS8 A;  1TUV A;  2MKK A;  4H4O B;  3Q89 A;  4TKT A;  1AUS L;  1FVQ A;  5ETP A;  2IMW P;  4RW6 A;  3WX4 A;  3Q22 A;  1KD1 T;  2QIF A;  2CFX A;  4ILM A;  4KJI A;  3HVT A;  6AT1 B;  3H98 A;  2FJE B;  1YQH A;  1JB0 C;  4DR3 F;  3G86 A;  1U47 A;  1NK4 A;  1GMW A;  4XIU A;  2FY8 A;  4LQ3 A;  3I5C A;  4ECX A;  3AOB A;  3JQJ A;  2KL8 A;  4CTA B;  3MCO A;  3CME S;  3SBM A;  1IKW B;  3LQV A;  1AFJ A;  2OPR B;  4C0O C;  3TI0 A;  5U47 A;  3BR9 A;  4IFY B;  3UN2 A;  2YQ0 A;  4LFA F;  3C2P A;  2C3U A;  1NK0 A;  4ECV A;  5K8N A;  4PG7 A;  3ZZT A;  3KK3 A;  2XMK A;  4FVM A;  1SQF A;  3VQS A;  3BYR A;  1FER A;  5BXI A;  3MI7 X;  2CWK A;  2DGX A;  4X66 J;  3VR1 A;  2VJU A;  2K3K A;  3IRX A;  3SQG B;  1XMB A;  2R7W A;  4C8Y A;  3VVT A;  2G9O A;  2OPP B;  3HDS A;  2JRS A;  1VQN S;  3BPS P;  3H20 A;  3GIM A;  4JI5 F;  1JXL A;  1SL2 A;  2HVI A;  1TK0 A;  2FVR A;  5E33 A;  4N77 A;  1JLE A;  2VQF J;  4FDF A;  1G4C A;  4DPW A;  2QFJ A;  4DDF A;  4X65 J;  1RK8 A;  3BH7 B;  4M63 A;  5K20 B;  4B9U A;  4K4Z A;  3W9H A;  4DSL A;  3V6H A;  3KG0 A;  2Z56 B;  1IN0 A;  2DO4 A;  3K7R A;  3PX0 A;  3PIP Q;  3MCN A;  2ZHA A;  3BO4 A;  5E3A A;  3FDS A;  5LSO A;  1S7I A;  1EHW A;  5IC4 B;  1WOR A;  5FDL B;  3LP1 A;  3VGT A;  3MMC B;  1TVR B;  2EWH A;  1ZM2 A;  1RKJ A;  3DRP B;  5A0Y B;  2DGT A;  4O3Q A;  5HMW A;  4DPX A;  1VQ6 S;  3CTR A;  2KH9 A;  4X4O A;  4M1K A;  2AX1 A;  3KOA A;  2GO8 A;  4OHZ A;  4E0D A;  1H6K X;  2J9D E;  2VG5 A;  2RML A;  4L73 A;  3X3U A;  2IDE A;  4FF1 A;  1T9Y A;  2BE7 D;  1SV5 A;  2DO0 A;  2ASL A;  1ZZF A;  7FD1 A;  1QAJ A;  2RHS B;  1UVN A;  1JLA A;  1UJ4 A;  2DY9 A;  4DV6 F;  4DV0 F;  4MIW A;  3KLH B;  1VR6 A;  1KLM B;  2OTL S;  3ZC4 A;  4LVO P;  2H5I B;  3MGJ A;  1VRU B;  3I0S B;  4HEA 9;  2W8L A;  5DO2 A;  3FCH A;  3MEE A;  4JI2 J;  5ITH A;  4DR1 J; 
#chains in the Genus database with same CATH homology
 2WVE A;  3PHT A;  3BKF A;  2WVF A;  2WVD A;  2BJ3 A;  2BJ1 A;  3BKT A;  3QSI A;  2Y3Y A;  2CAD A;  3BKU A;  2FGC A;  1Q5V A;  2CAJ A;  2WVB A;  2PC6 A;  3OD2 A;  2BJ7 A;  1Q5Y A;  2CA9 A;  2BJ9 A;  2BJ8 A;  2HZV A;  2F1F A;  2HZA A;  3LGH A;  2NZC A;  2WVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...