1C1BB

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
432
structure length
415
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYNLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 113
structure length 415
sequence length 432
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB03
4IRCA 5J1EA 1JLGA 3UQSA 4RUAA 1HQEA 2AQ4A 3H5XA 4I7FA 4NLPA 4DG1B 5KT6A 4ED3A 1S10A 4IKAA 4ZPDA 4ICLB 3RBEA 4RW8B 4GC6A 1TP7A 3RB4A 3IG1B 1HNIB 2YKNB 5D3GB 3H98A 3H5YA 1T94A 4JUZA 1IKXB 2XC9A 3KHRA 4IG3B 4J9MA 5KG3A 3BSNA 4ECVA 1DTTA 2R8JA 5KFGA 4MKAA 3V6HA 1RTIB 1RT6B 1J5OA 5L1LA 1S6PB 4TYAA 3DYAA 4PUOA 5KG5A 3H59A 3KK1B 4MKBA 1RA7A 3HVWA 1RT3A 1HPZA 3JYTA 5KFUA 3Q8RB 2WRMA 3D28A 2I5JB 2ASJA 3QLHA 3M8QB 5I42B 2E9RX 2HAIA 5FDLA 4WYWA 3EPIA 4NYZA 4KV8B 5L9XA 3GILA 4KO0A 2VG6A 3MEGA 4O4GB 3KOAA 2QE5A 2HNDA 1S9EB 3QO9A 1C0TA 2FVPA 5J2PA 5J2MA 3QIPA 3I0SB 1N6QA 4Q0BA 2OPSB 3G6VA 3T5KA 1S1WA 4KFBA 5I3UA 4IR9A 4QWDA 4MFBA 1S9GA 3DLGB 2JEGA 4EO8A 4I2QB 2OPRA 2C2DA 4ED7A 3I0RA 4LQ9A 1EP4A 5KFQA 4NLYA 1TKZA 1WNEA 4J9LA 5DG7A 5HROA 4WXWA 2V4QA 3UPFA 1S48A 2W9BA 1R0AB 3UR0A 2AGOA 3PZPA 1S0NA 1UWBB 1KLMA 1KHWA 4EYHB 4K4WA 1RT2A 3GV7B 2BQ3A 2WB4A 3DM2A 1RT7A 2WONB 4KBIA 5KG1A 3RAQA 3IGNA 1S1UB 1TVRB 2QV6A 3LALA 3OL7A 4NLRA 1JLQB 2B5JA 2HWIA 3KLEB 1N56A 2YNHA 1JLGB 5J1EB 2HNZA 5KFXA 4M95A 1HQEB 4H4OA 1S1XB 2AWZA 4I7FB 2R2TA 4EYIB 1QE1A 3NMAA 4ZVHA 4EBEA 3KNAA 2UUTA 3TAMA 1T05A 4MK7A 2UVRA 3M9MB 2FVQA 5KFKA 3OLAA 3LP0A 1TQLA 2HWHA 3M9OB 1S0MA 2BQRA 1C1CB 3V6DA 5F8NA 1DTTB 4IG3A 3NBPA 1SH3A 1D0EA 4RU9A 4RZRA 3H4BA 2R8IA 1T3NA 4NLUA 4PUOB 2YNFA 3QIDA 4YR3A 3DLEA 2GIQA 2FJXA 2JC0A 1HPZB 3JYTB 2ZD1A 3MF5A 2W8KA 4ED8A 3QLHB 3MECA 4WXOA 2AGPA 5FDLB 2R2UA 4RW7A 4JV2A 5KT5A 2O5DA 3M8QA 2R8KA 4IOBA 4WFZA 2VG6B 3MEGB 4URSA 5KFJA 2WTFA 4IRDA 2HNDB 4DL4A 3KMSA 4O4RA 3QO9B 3UDLA 5KFDA 1C0TB 4IFVB 3DLKA 5J2MB 3QIPB 1HQUA 5J2PB 1QAIA 2CJQA 5F9LA 4ECQA 1N6QB 5K14A 4Q0BB 2IBKA 5KFSA 4ZPAA 4MK9A 3I0SA 1S1WB 4KFBB 5I3UB 4EBDA 2OPSA 4FS2A 5F8GA 4MFBB 1S9GB 2IC3A 1W25A 2D41A 2CKWA 2IJNA 1LW2A 3I0RB 1EP4B 2BE2A 2IJFA 5KFFA 1TKZB 4TY8A 4YR0A 5HROB 4NLXA 5KFLA 5KG7A 4URGA 2VA2A 2W9BB 1S97A 4ZPCA 2XCAA 2ZE2A 4RUCA 3E01A 3BSOA 4YP3A 1KLMB 4TYBA 4NLSA 3KLGA 1RT2B 5KFNA 4ECYA 4R8UA 2J6TA 1RT7B 1S1VA 1VRTA 3DM2B 3JSMA 2UUWA 2YNIA 4G1QA 4NLOA 2ALZA 2ATLA 4Q8FA 3BQ2A 4LSNB 4RW4B 1CSJA 4PWDA 3M9NB 5KT7A 3MR6A 5KFCA 4K4TA 2YNHB 2HNZB 2DPJA 3LANA 1LW0A 3KJVA 3CO9A 4ZP6A 4H4OB 1XR6A 4NZ0A 4WE1A 3KLEA 4Y3CA 4QPXA 1QE1B 3PW7A 3M8PA 3TAMB 1S1XA 1TV6A 1T05B 3CVKA 2WOMA 3QGIA 4PQUA 3TVKA 4F4ZA 2BRKA 3LP0B 1N5YA 3RB6A 4R5PA 2IM3A 3CJ0A 1IKYA 5KFHA 4NLVA 3BREA 4H54A 3V6DB 3MR3A 3TQ1A 3CJ5A 3NBPB 1RT1A 4EO6A 1C1CA 2AX0A 2YNFB 1KHVA 4NLTA 1HNVB 3DLEB 3KLFA 2ZD1B 4ZHRA 3MECB 2RDIA 4DL2A 3FDSA 4RW7B 4O3PA 4QW9A 4JV1A 5C25B 2XWYA 4NRTA 2XGPA 3DI6A 2IA6A 4NRUA 5L1JA 3GYNA 1VRUA 2FJWA 3DLKB 4NLGA 1HQUB 1TKXA 5K14B 1HARA 5KFIA 4IFVA 4QW8A 4U7CA 4IRKA 5KG6A 3DDKA 4IH5A 2V0NA 5T14A 5F8MA 4IDKA 3RAXA 3OLBA 3DRPA 2IC3B 3FRZA 3IGVA 1JIHA 3KHLA 4J9KA 1LW2B 4ZVGA 5KFTA 2FLLA 2BE2B 3I5AA 4KHRA 3MEEA 3KHGA 1FK9A 4TY8B 5DGAA 4Q8EA 5CYQA 4I2PB 4IQXA 1JLFB 3N6NA 3V81A 2ZE2B 4Q43A 3GIJA 3E01B 3QZ7A 3SI8A 4O3NA 4ZP8A 5DQHA 3Q8PB 3KLGB 3BSCA 3HHKA 4TLRA 4R8UB 3GQCA 1S1VB 1VRTB 4ID5B 3JSMB 1T03A 2YNIB 3C6TA 4G1QB 5EDWA 3GV8B 4IG0A 4KSEB 2I1RA 4PWDB 3ITHA 5L1IA 1K1QA 1LWCA 1SH0A 4U6PA 5HP1A 1SV5A 4RNNA 4LSNA 4RW4A 4LSLA 1U09A 4Y2AA 3RB3A 1LW0B 3KJVB 4WE1B 5KG0A 4IFYA 2YKMA 1S1TA 3SFGA 3PR4A 3NL0A 3MFHA 4H4MB 3M8PB 1TV6B 3N6MA 5EUHA 2WOMB 3HVAA 5KFVA 2XCPA 2E9TA 4PQUB 1TKTB 3PVXA 2R8GA 2BQUA 1N5YB 2BRLA 4R5PB 3BJYA 2OH2A 1IKYB 4O3OA 4ZMMA 2FLNA 1RTHA 3OHBA 1MU2A 1S9FA 4K4ZA 5F8JA 1JLCA 1RT1B 2IM1A 2XI2A 5EWFA 1LWEA 4B3OA 4RNMA 3FFIA 3T1AA 3H2LA 4ZVFA 3BGRA 2ZKUA 2BR0A 3LP1A 3KLFB 4ZHRB 1HNVA 2VG7A 4OL8A 3MFIA 2C28A 1LWFA 3G86A 2XI3A 5DQGA 3DI6B 3DOLA 5C42B 2OPQB 3H5UA 4J9OA 1FKPA 5C25A 4MK8A 1VRUB 1XR5A 3G6YA 3NAHA 3MR2A 3CDWA 3DMJA 1S6QA 4JV0A 1TKXB 1GX5A 2C2RA 3EZUA 4RNHA 2W7PA 2ASLA 4F4YA 5KFMA 5F8HA 4K4XA 4IDKB 4KAIA 1N4LA 3DRPB 1ZTWA 2FVSA 2GIRA 3V6JA 2DPIA 2RF2A 4FBTA 3HVTA 1JLEA 3FQKA 3MEEB 4RW9A 4NLDA 1FK9B 3BR9A 5CYQB 4X2BA 5KT4A 1RDRA 3V81B 1REVA 2FVRA 4J9PA 3QGGA 5DLGA 1ZTTA 4Y34A 3NGDA 3DRSA 3IRXA 2W9CB 1RT5A 4I2PA 3BQ0A 1JLBA 1JLFA 1HYSA 1S4FA 3PW0A 1RA6A 1T03B 2VA3A 3C6TB 2JEIA 5DG8A 2FLPA 4HKQA 4IG0B 1NNDA 4J9RA 5KFAA 4Q44A 4ID5A 3PW2A 3ITHB 2AU0A 1LWCB 4ZPBA 4O3RA 5HP1B 1SV5B 1RTDA 4TN2A 3CDEA 4LSLB 3IS9B 4RNFA 4K4VA 4IFYB 2YKMB 1S1TB 3VQSA 1DTQA 1RYSA 1DLOA 1HMVA 4K4SA 4H4MA 4F50A 4MH8A 5L1KA 1JXLA 2J6SA 2WHOA 2F8EX 4IH6A 1TKTA 3FQLA 1RTJA 3RBDA 1RTHB 1D1UA 1MU2B 2J6UA 3KLIB 4XPEA 1C0UA 1JLCB 1TL3A 1S49A 4NCGA 2IM2A 3CIZA 3C6UA 1LWEB 4B3OB 4KB7A 3FFIB 3SFUA 3BQ1A 3CDUA 2C2EA 3PR5B 2C22A 3BGRB 3V4IA 5KG2A 4WZQA 3LP1B 5CYMB 4M94A 5F9NA 2VG7B 3CJ3A 4O44A 3MTKA 4NLWA 1LWFB 1IKVA 2AX1A 2W7OA 3KLVA 4NLQA 1BQNA 2EC0A 1QUVA 3DOLB 2WK4A 4ECZA 3KLHB 3OL8A 4DL5A 1FKPB 1JLAA 2HMIA 4ZP7A 4QWCA 4TXSA 4IH7A 5C42A 2OPQA 2D7SA 3EPGA 3OSPA 5KT3A 3DMJB 1S6QB 3T5HA 3NAIA 4TY9A 3DOKA 1SUQA 5KFRA 3PJXA 4YQWA 4RNOA 5KFBA 3KHHA 1S0OA 3GIKA 1Z4UA 4URQU 2VG5A 2RDJA 2IM0A 3KK3A 2BANA 2ILYA 5JXSA 5DLFA 2RF2B 2YNGB 1RAJA 3HVTB 1JLEB 1BQMB 5C5JA 4DEZA 3OL6A 4QWBA 4RW9B 4LQ3A 5J2NA 1SH2A 4XO0A 4K50A 2JLEA 4KHMA 3RB0A 1REVB 4J9SA 3LP2B 4K4YA 4F4XA 4FS1A 3DRSB 3IRXB 4ED1A 1RT5B 1N48A 1IM4A 1JLBB 1HYSB 4YMEA 2XGQA 1C1BB 5KFWA 2W9CA 1QAJA 3T19A 3DRRA 2ASDA 3QZ8A 4GC7A 2HNYA 4ECUA 1YVFA 1RT4A 1TL1A 3KK2A 2FJVA 3ICLA 1RTDB 5EWGA 2W8LA 2GC8A 1ZETA 4ECSA 1I6JA 2RKIA 5HBMA 3KMQA 1EETB 2UVUA 2IAJA 1DTQB 3ISND 3IS9A 2R2RA 4KE5A 3OSNA 2R2SA 3MEDB 4ZP9A 1DLOB 4DL7A 1HMVB 1NHVA 3NKYA 2V9WA 4RW6B 3I5BA 3H40A 3LAMA 4KKOA 4WFXA 3PW5A 5HLFA 4ED0A 1RTJB 5J2QB 3PHEA 1C0UB 1TL3B 2E9ZA 5KG4A 4NCGB 5F8IA 4TQRA 3C6UB 3OHAA 2JEJA 3KLIA 3V4IB 2UVWA 4K4UA 2OPPA 4ECWA 1IKWB 3PJWA 2B6AA 2W9AA 4TQSA 4O44B 5KFPA 1FKOA 1IKVB 5CYMA 3MR5A 5DQIA 2V4RA 1BQNB 3CWJA 2D3ZA 5C24A 3N6LA 1RYRA 1JLAB 2HMIB 3G6XA 1JX4A 4EBCA 4DL6A 1JKHA 4O3SA 3KLHA 4O3QA 3GIMA 5KFOA 5F8LA 3DOKB 1SUQB 1K1SA 4HYKA 4WZMA 4DG1A 5JUMA 4EEYA 4ICLA 4R0EA 4RW8A 3ISNC 3Q8SB 1OS5A 3IG1A 1HNIA 2YKNA 5D3GA 4ECTA 5KT2A 2VG5B 2D3UA 5DGBA 3KK3B 2BANB 1IKXA 3Q8QB 4ED2A 3CJ2A 5KFYA 4QWAA 1J5OB 3T5JA 3DYAB 5J2NB 4QWEA 2YNGA 3QYYA 4WYLA 1BQMA 1RT6A 1RT3B 1RTIA 1S6PA 1NHUA 3KK1A 2R8HA 4MIBA 4Y2CA 2JC1A 2I5JA 3LP2A 5I42A 1XR7A 4DL3A 3DRRB 4KO0B 3I5CA 2HNYB 1C1BA 4F4WA 4G3IA 4KV8A 3V6KA 4XPCA 1RT4B 1TL1B 3KK2B 3CJ4A 2UVVA 4FBUA 2FVCA 4O4GA 4ECXA 2AGQA 4MIAA 1S9EA 2RKIB 5HBMB 3E51A 3HKWA 4YR2A 2IAJB 4ED6A 4IR1A 5DG9A 2WCXA 3T5LA 3D5MA 1GX6A 1EETA 5EWEA 3GIIA 2OPRB 4KKOB 3MEDA 2ILZA 3DLGA 5KFEA 4I2QA 4RW6A 3IN5A 3GV5B 3H5SA 4ECRA 5HLFB 3LAKA 3BSAA 3OL9A 2JEFA 5J2QA 1MMLA 3PW4A 1R0AA 5KFZA 4Q45A 4J9QA 2OPPB 1UWBA 3FSIA 2B43A 2B6AB 4J9NA 3QGHA 1FKOB 4WFYA 4ZVEA 1IKWA 2WONA 2B5JB 1C2PA 1S1UA 3H4DA 1TVRA 5C24B 2IMWP 1JLQA 1JKHB
chains in the Genus database with same CATH superfamily
1JJ2R 2W2PP 1JLGA 2DITA 1N33F 3GFXA 1HQEA 3A4TA 3J81U 4DG1B 4ICLB 1RBAA 3RBEA 4I56A 3H98A 1ZAXA 2MTLA 3QRRA 3BSNA 2HQDA 2F5GA 4MKAA 2XLJA 3KK1B 3CD0A 1M1KT 4C0BA 1OPZA 1RA7A 3DOMA 4ZCKA 3C15B 2ASJA 1NK7A 3EPIA 4KV8B 1X5TA 3HPOA 3I56S 4P2MA 4LFBF 4DPUA 4JI0J 4KRWA 1C0TA 1N6QA 5IZHA 2OPSB 4AQYF 1HWUA 8RUCA 4ANDA 1FFGB 1L3KA 2W9BA 3P8BB 3KUHA 1ITPA 4PYDA 2FHJD 3W8GA 4ETZA 4KBIA 3RAQA 2PEBA 5ETQA 1DAXA 1MLAA 3C66A 5HI7A 3GZ7A 1JLGB 2F65A 2FZGB 1HQEB 3DU6A 3PRBA 4EYIB 4HLBA 4X4QA 5IS2A 1MN9A 4ZPWR 3V6DA 5EHHA 2YWKA 4OI4A 2VJVA 4DR3F 2XMUA 1U1RA 3CXCR 4ED8A 1H73A 2O5DA 3CSKA 3W66A 4LF6J 1C0TB 4ECQA 1N6QB 1RGVA 4IQMA 3QJPA 1XBWA 1W25A 3EGWB 1NAQA 2I8EA 4CH0S 2W9BB 1S97A 4RUCA 2G4BA 2G0JA 5A76A 3D6MB 4R8UA 2QTWA 4XTTA 2YNIA 1FXRA 4A8FA 3BQ2A 4DUYF 4OQJA 4OZNA 4K2JA 3QGIA 3TVKA 3BEGB 5ETNA 3VGTA 3RB6A 4JV5J 2R7XA 3IAM9 3C3LA 3V6DB 1WF0A 2Y1LB 3C19A 1QVFR 3FDSA 5B0AA 2ABYA 3TJ9A 3CCRS 2RIJA 2QO3A 5EGYA 2LEAA 4DN9A 5F8MA 3D9BA 1KDNA 4RKUC 1UCNA 4JI8F 1F60B 4R8UB 5EDWA 2YNIB 1I51B 2CUYA 2Z8QA 5D8HB 1T9WA 5KG0A 4IFYA 3SFGA 1KKHA 5IFMA 4P52A 1VQLS 2BM0A 1RE1B 2X3DA 5F8JA 1R31A 3HHNB 4OHYA 1NH8A 1LWFA 1XMOJ 1LFWA 1FEEA 2K7JA 5C42B 2NXCA 4XDDA 1U02A 3ZO7A 4ZLLA 3FKBA 1N33J 2FZKB 5C7PA 1VC5A 3DKDA 2VICA 3GP9A 3TWZA 3R6GB 1SC3B 5D4LA 1HKAA 1ZBTA 2DGVA 5CQGA 2R7TA 4JYAF 3IRXA 4I2PA 3D0IE 4X4VA 1X8DA 4ZVRB 2VA3A 2EBEA 3T1HF 4C8YA 4X4SA 4LFBJ 4IFYB 2KG1A 4AQYJ 2HLTA 1EKSA 2QLBB 1JXLA 3GCWP 3G71S 2J6SA 1WEXA 2FJEB 3BQ1A 2VU5A 2P5VA 1SJ3P 4ZIVA 4JOUA 1LWFB 1IKVA 4I68A 4A8KA 2EC0A 1QUVA 1R8CA 2G2YA 4CI0B 2D7SA 1QVGR 2F4FA 3NAIA 3DOKA 2VBZA 5E2QA 4RNOA 1NJYA 1Z4UA 4LIRA 1GMWA 2X1BA 1R8BA 4C7QA 4YOEA 3QJJA 2OEJA 3GTYX 1KQFB 3IRXB 4DR3J 2AJ0A 4AL7A 3N01A 4QYZJ 1HLWA 3KG0A 3MM5B 4GKJF 4M5KA 4UW2A 4FNHA 2GC8A 4ECSA 5LXYA 3K5OA 2FGCA 1R7IA 2L9WA 1DZ5A 3PHEA 4WU2A 5KG4A 2JEJA 1HNWF 5IQ6A 3BDPA 2W9AA 1SCJB 2Y1RI 2IFXA 1IKVB 5HATA 5BR8F 4C8KA 1F3VA 4DUYJ 4ZOSA 1FRXA 3DOKB 5ETPA 1Y4ZB 3P96A 4RW8A 3UN2A 2YKNA 5D3GA 4KGZB 4LR7A 5DDOC 5AXKA 3TI0A 5D4PA 2Q66A 4Y2CA 2ZHOA 1PAEX 1YX2A 2IPOB 1J2VA 2BE9B 3KDOA 2UVVA 2VODA 4ITSA 2QT7A 1TFWA 3E51A 4FF1A 3GIIA 5GAHU 3GB0A 4I2QA 1TR0A 2J9CA 2D3OR 2JEFA 3VALA 3FSIA 4M5GA 4JI8J 2YKPA 1S1UA 2ZJQQ 4LT6A 5J1EA 2JRSA 2X7IA 3H5XA 2VHGA 2HHUA 4RW8B 5DM7Q 2YKNB 5D3GB 1T9UA 1A0OB 3QJLA 4HH1A 2XC9A 1Q95G 1HD0A 4U9RA 1TUWA 1N5TA 3M2UA 3CE8A 3DYAA 2DGXA 4NYZA 2MB0B 4C8NA 4P71A 2AJQA 2HGNA 2RUSA 4DUTA 5J2MA 3NRBA 2MZSA 1G3OA 4DSFA 4IR9A 5MAOA 1V9OA 1S9GA 4A8YA 4I2QB 4ZJLA 1EP4A 1XC9A 3V5RA 4DR7F 1KLMA 4JYAJ 2RB7A 1RT2A 3CC7S 1S1UB 2G2ZA 2IVFB 4AFFA 1IBKF 5J1EB 3T1HJ 1D9FA 3CIMA 2DNHA 2BKPA 2UVRA 4WP3A 1NEEA 2B7CB 4Y28C 1NK8A 4NEZA 4ELVA 5F8NA 3M2UB 1O0PA 1ZA2B 1IXKA 2ZD1A 2HFVA 4RW7A 3Q23A 3TP2A 5KFJA 4IRDA 3M05A 1QSSA 3DLKA 4IFVB 2W4CA 5J2MB 1HL6A 2KL8A 3I0SA 3HKZD 1S9GB 3ENQA 3S7RA 1EP4B 2IJFA 3IBWA 4NLXA 3VTIA 2XCAA 4RBUA 2OSRA 1KLMB 1F0XA 1RT2B 4ECYA 2UUWA 4G1QA 4EMDA 4LSNB 3M9NB 4GKJJ 1ZM9A 4NPOA 1VJWA 1YRTA 2JNJA 4PQUA 3N0VA 1RTZA 3GU0A 5CCMA 1YJNS 3PYDA 1DFDA 2HURA 1XTZA 1CJUA 1HNWJ 1HNVB 2ZD1B 5KTQA 5D4OA 4RW7B 3UE2A 2C2MB 5BR8J 4DBQA 3DLKB 1FE0A 3MCMA 2VJUA 3R2CJ 2FLLA 1E6VA 1PG5B 4I67A 3TJ8A 4G1QB 1NPRA 2OTLS 4WP8A 4RBVA 3ENAA 3MPDA 4K2XA 3B82A 2RU3A 1FDBA 2VQFF 4PQUB 3C8YA 5DDRC 4ZMMA 3A8IA 2E5LF 1CJUB 1Y10A 3HK2A 4F26A 2DTJA 4HI2A 1U8WA 4L72B 1WKJA 2XMWA 3J80U 5HN0A 2VFRA 4DU7A 4RW9A 1Z2ZA 1KOHA 3R9LA 3HHLD 1ZTTA 1RT5A 1B0PA 3PIOQ 3MHYA 2RRAA 2AZ3A 4P2XA 1TL7A 1U6ZA 1Y7PA 1RYSA 4B9UA 1LXJA 2CQ1A 1R0CB 3FQLA 5ETKA 4PKDB 3CMES 4WZQA 3GPAA 1SJ1A 4DR7J 1WOOA 3OL8A 3O5TB 3OSPA 3EPGA 1Z1ZA 1IBKJ 2WVCA 1GXLA 1S5ZA 3PXGa 2NSBA 3IBFB 2HS4A 1BQMB 1X9MA 4RW9B 1NK4A 4QU6A 1RT5B 3HF5A 2YVSA 3AOBA 1SIWB 4DPXA 2IYIA 1SKWA 2K7KA 1TL7B 2ZNYA 3IS9A 3VAKA 2CFXA 1NHVA 2B0GA 1HA1A 3PEJA 2M8DB 2LXIA 1LNQA 1HBUA 2DGOA 2JWNA 3KLIA 2HG4A 4K4UA 4UOGA 1YJTA 2Y8WA 2B6AA 3D3CJ 4ZCIA 4N8NA 4RUHA 4EBCA 2CPEA 3I4HX 1KWMA 5B7WA 2LU2A 5G4DA 5A8RA 2CG8A 4DS5A 1OJ4A 6FD1A 3IM8A 1VMBA 1H38A 1U2FA 2VBWA 2EFQA 1LKZA 1C1BA 2CPIA 2DKOB 1BE4A 5GAEI 5L46A 1ICEB 7AT1B 2MKSA 3TJAA 2BYCA 5CYJA 4ECRA 1HBUB 2VONA 5ADZA 3SDEA 2ZH2A 5A2QY 4FYYB 3GYXB 3EZ5A 1WF2A 3M2VA 4DJBA 2B6AB 3GFZA 3FC9A 3ZZ0A 1VQKS 4EWTA 3KDNA 5B0CA 3GMGA 4ED5A 2BDPA 1M5OC 3ILIA 5IT0A 2OUGA 5A8RB 3L7UA 1TP7A 1AROP 2VQFJ 2DJWA 1NJWA 1FXDA 2KYXA 1U7LA 2E5LJ 2HS0A 1RQ0A 3Q2SC 4KGKA 5EN1A 1U8SA 1RI7A 3VR1A 2VFSA 5FD1A 2O1PA 3QRPA 1MWYA 1LWXA 4L76A 4EO8A 2WAQD 3SDEB 4Q5VA 1T8EA 3QT5A 1PAUB 1WNEA 2JVOA 3KYLA 2Z0GA 3M2VB 1NKBA 1XWLA 4K4WA 2VPXB 5DZ7A 3V2UC 3IRWP 1N36F 2R42A 3FUYA 4B08A 4WFNQ 2VDIA 1RHRB 1OY8A 1Q81T 2ZDOA 2UUBF 3QIDA 2FJXA 4WXOA 2H4YB 5E0OA 3UD5A 3BPDA 1RP5A 3ZTOA 5F9LA 1VBKA 2AHOB 4NEYA 1TK8A 3TQEA 4NASA 3MCOA 5LMNF 2J5AA 1VQMS 3MM8A 1TKDA 3KLGA 2PIIA 3C16A 3JSMA 3I31A 2HRTA 3MDFA 4OZ0A 3NEKA 3JTNA 1FJEB 2RQCA 2KN4A 1FESA 1S76D 4FYDA 4PAAA 4OLPA 3B8HA 2XWYA 4NA1A 2IA6A 2EFPA 1CS4A 2CQ4A 3NGTA 3TUPA 2DCUB 4X4RA 1VQ4S 3SCLE 3EXCX 4U7CA 1ZAVA 3BH7B 3DRPA 4X4UA 4BS2A 3MM8B 1YRXA 3KLGB 3HHKA 2HK2A 3C16B 3JSMB 1SBRA 2I1RA 1MWQA 1SH0A 2LMIA 3C2PA 3K89A 3ZTSA 5D78A 5HMXA 2IRXA 2R8GA 2F4VF 3OHBA 2W25A 1K8AT 2XLIA 2FZCB 5C25A 1QJHA 2F9JA 3G6YA 3UD3P 1UP1A 4DR2F 3MD3A 3DRPB 2P2CB 2ZITA 4A8MP 1NDPA 2FHJA 3I87A 2DGSA 4QBUA 4AUKA 4Q44A 2AU0A 4ZPBA 1PC4A 1RAAB 4AT1B 4P7TA 1KONA 4YB7A 3UO0A 4RWXA 3QNWB 3RBDA 4X4NA 4O3SA 3TQ1A 3WIUA 4NCGA 3BR8A 5KG2A 2BOAA 1GK8A 2W7OA 4NLQA 1N36J 4UY85 4IH7A 3VZIA 4NWBA 1WWHA 4Y00A 2ZUGA 1YSJA 1WC6A 3BN4A 2QIFA 5C5JA 3Q24A 4QWBA 2M88A 2HGLA 2UUBJ 3HJVA 2E7XA 2RE1A 4LIWA 4DV1F 4GC7A 4OI1A 4W98A 3CB4A 3S01A 2CZVC 1OYDA 1FE4A 2KVQE 4USMA 4DF8A 2AYMA 4N8OA 3EXYA 1PIEA 4NCGB 1PO6A 3FRYA 5LMNJ 3J7YI 1FJ7A 4TQSA 4QZVB 4EU0A 1UPMB 3GIMA 3KTQA 2V9KA 5T7LA 4R0EA 1OS5A 1GNKA 1RBOB 1Q5YA 1UJ4A 3AJ1A 1N5SA 3CJ8A 1RTIA 2CJ9A 2HHVA 5BJRA 3PKYA 4OI0A 4XDCA 4KO0B 2XS2A 1GQEA 3V6KA 3M7VA 1WC5A 4ES1A 4OX9F 3T6JA 4B9TA 4B9LA 2DR8A 3R8YA 2GJFA 3FBFA 2QZ8A 3QAUA 1XNQF 2Z2YB 1MMLA 2YQ3A 1R0AA 1VRQC 3TANA 1EAYC 4HEA9 2KU7A 3UWTA 2AF6A 4IRCA 2HZCA 2ZBRA 3T9ZA 1RAFB 5T7LB 3GFYA 3ZZYA 3LUYA 3R27A 4CP5A 2F4VJ 1DTTA 1RTIB 1J5OA 2H1YA 4AXIA 5FDLA 3O3LA 1Q8KA 1RWXB 3UDEA 5IT4A 5LT5A 2LQ5A 4DR2J 1SJRA 3GIRA 1TL4A 2XG8A 1HD1A 4J9LA 5HROA 2DEJA 1R0AB 1S0NA 3PZPA 2BQ3A 2WB4A 2OFHX 1YJVA 3DM2A 1M5HA 2HBYB 1U26A 3KNAA 4Y2KA 3RBZA 1Y0HA 2BQRA 1DTTB 1D0EA 2CPXA 1T3NA 2C3PA 2L41A 2BJ8A 4C6AA 4X4OA 5FDLB 4KTQA 4URSA 3BO3A 3MTJA 3EVMA 2DK2A 2L9DA 5H9EK 5HROB 5KG7A 4ANCA 1WSRA 2DR5A 2LDIA 4YN3B 2IHR1 3DM2B 1S1VA 3OTCA 1KRPA 4DV1J 1RAGB 2BJ9A 1TAUA 4NZ0A 3TA1A 4QIVA 2NZCA 2FJBB 2XLKA 2BRKA 2XHCA 1Q5VA 1VCTA 3CJ5A 4LRFA 1RT1A 3DLLQ 2XYHB 4I64A 1DQ9A 1X4CA 2OFGX 4C97A 4C8MA 2HIQA 3TNVA 4QW9A 2XGPA 2LXUA 3GYNA 1BGXT 2D74B 2DXFA 2DNYA 4NLGA 5KG6A 2V0NA 1IN0A 4HDGA 3I9V9 4KHRA 1T02A 2HEKA 2YQ1A 3QZ7A 3F0NA 3QGPA 2J7KA 1O5JA 1S1VB 3C6TA 3J7Z5 2ACMA 3RAMA 3J7A1 1TTHB 2ERRA 2Y1IA 4RNNA 3EX7B 2YWEA 3HFVA 4OX9J 3VF0B 3N6MA 3LF0A 1WEZA 4XK8C 2BRLA 2YQ0A 2RS8A 1RT1B 2FUG9 1XNQJ 3BGRA 2G0CA 3MFIA 3SSSA 1M5SA 3UR3C 4MKVA 3ZZZA 1HHSA 4A4JA 4X4TA 2PT0A 1BWVA 3RRGA 1HNXF 3MAHA 2C2RA 1R27B 2MJNA 5CD4A 3K0JA 4HL9A 3HFZB 3W63A 1PSDA 1X5OA 3BF4A 4NMXA 3CMQA 4J9PA 3NGDA 4RU2A 1PC5A 4CCHA 3C6TB 2JEIA 4O3RA 4TN2A 1OSCA 3IBCB 5CCLA 1DTQA 1YJRA 3IWXA 1RWNB 2F7VA 3CCES 5LL6d 2HVZA 2CZ9A 3JSBA 4BHQA 1RTJA 3MD1A 1Q4RA 3C14A 2DB1A 2JHEA 3BGRB 1G7CB 1ZOTA 5IQQA 2MJUA 2XYPB 1BQNA 2HMIA 3ZTRA 3GSIA 3PV8A 1DHMA 1HWIA 2O3DA 1FO1A 5L38A 1JJHA 3UN3A 1VIOA 1IJEB 4DCPB 4OI6A 3EE3A 2JLGA 1N48A 4HT7A 2XGQA 4DQSA 2Z30B 1U1KA 4DV6F 3BGFA 3PX6A 5F41A 2IAJA 2XULA 1DTQB 3CJKB 3MEDB 1XEZA 2FTRA 3D0GE 3PW5A 1RTJB 2FIUA 3OHAA 3C14B 1YIJS 5IWAF 1FKOA 5CYMA 1BQNB 1P8GA 3R5CA 2HMIB 5CXTA 2ASYA 3MMJA 2CDRB 3CNQP 1DARA 1K1SA 1S99A 5HSPA 2GHVC 1NKCA 4ECTA 5KFYA 3U27A 3T5JA 4RBTA 4E98A 1H2VZ 4MIBA 3EDRB 1Q7YT 4JI6F 4XPCA 3P49B 2V34A 1YLXA 1GH8A 4GKKF 2IAJB 1GX6A 5EWEA 3IAS9 1H74A 3H5SA 4RO0A 1WD6A 5J2QA 4DV0F 4J9NA 1FKOB 2HFUA 3IP0A 2C2DA 5EX3A 4CO4A 1B64A 1HWKA 4J91A 2YKQA 4BLGA 1PJ7A 4JUZA 4IG3B 4J9MA 3AFGA 2DNOA 4YUDA 3HHLA 2DHHA 4NCAA 3UCGA 2VD3A 4ZK7M 1U1LA 1Q79A 1VQ7S 4X4PA 1ZS6A 3E3XA 4OJHA 3FBCA 1HNXJ 5I3UA 4DMZA 4MFBA 1UVIA 2OPRA 1CBKA 5KFQA 3T3FA 2E5IA 1WJ9A 3TO8A 2IRYA 1IQZA 4EZ9A 2QJ3A 4OZJA 4PPDA 3PO5A 3PYFA 4WKRA 1IBLF 3NMAA 1D09B 3JQMA 4ZVHA 5I4MA 2EK1A 3OLAA 4OYXA 3M9OB 1S0MA 2LYVA 1JXEA 1UMJA 2R8IA 3HHLB 3BKUA 4AXJA 2C2KB 4FNIA 2NYHA 2PN6A 5HO4A 2DNLA 1F3FA 2DH7A 2FC8A 1U49A 5I3UB 4MFBB 1OIAA 2GJIA 4EZ6A 2DH9A 3QT6A 1AUDA 2FDNA 2CPFA 1TELA 3E01A 2ZWOA 1TUGB 2QL5B 5IT9U 5KFNA 1VRTA 5CH7B 5A8KA 4PWDA 4DV6J 4AE5A 2YWWA 2N3OA 1H7WA 2Q3PA 3KLEA 4B17A 2WOMA 4HACB 1WOPA 3OTDA 3AOAA 4LBPA 3DC2A 1FX2A 1BLUA 5IWAJ 1VIXA 3VGSA 4O3PA 1WG5A 1WTFA 4OV6A 3T1YF 4USJC 5KFIA 4U96A 2DIUA 4IDKA 2EVZA 2J7WA 4Q7AA 5KFTA 2B4UA 2BABA 4IQXA 1JLFB 1H98A 1Y11A 5IOLA 3E01B 2R9LA 1H0HB 3GG0A 1VRTB 4FPIA 4PWDB 3K5PA 4JI6J 4HVZA 2AP6A 4GKKJ 2WOMB 1TKTB 4ZVOB 1MU2A 3ET6A 2XI2A 4RNMA 2CJAA 4DV0J 1KC8T 3PACA 4J9OA 3R5GA 4OX8A 3BYPA 2WSFC 1FVQA 3AODA 5I3QA 3QFHA 1ACMB 3TRGA 4IDKB 2E1PA 4LF2A 1P27B 2CPDA 2J0QD 1FJCA 4FBTA 1JK9B 2P6SA 2JH3A 2DGQA 3OXGA 4Y34A 1JLBA 1JB0C 1IM6A 3W5YA 3OR2B 2GIFA 2QSFA 3SQOP 1WC4A 1D1UA 1MU2B 3IGVA 3ET6B 2B51A 2OEKA 3HD1A 4F3OA 1HQ2A 3I55S 4MJKA 4FF3A 2HFOA 4CYUB 4K0KF 3DGVA 5LJ3Y 2C2ZB 3HJFA 2M9KA 1IBLJ 4CH1A 1RHUB 4A48A 2YNGB 4UZCA 1FA0A 4C9DA 4C11A 1SH2A 4KHMA 2D1CA 2FD2A 5THWA 1JLBB 1JNZB 1QAJA 3JSRA 2NPFA 1ZM2A 3FMBA 4H4KA 4ELTA 4F2RA 3LAMA 3OD2A 3SV4A 2CNKB 3HZEA 4FP9A 4ED0A 2X51A 2J9DA 4ZS6A 4KY3A 3MURP 1HI0P 1PJ6A 4UOHA 3TAPA 1EKRA 2VFVA 3KLHA 3AXMA 2XM3A 4MT1A 3EZOA 2HVDA 1QD1A 4C11B 2H51B 2QLJB 1M1GA 2HAFA 3QYYA 2W2OP 2NLWA 4J37A 4DL3A 3DFEA 3NY0A 2GAHC 3CJ4A 4FBUA 1Q16B 2XZTB 3ENWA 3T1YJ 4DSEA 3VGVA 4DI6A 2ACYA 3BSAA 3BM7A 3PW4A 1UWBA 1TFYA 2ZBPA 1F5BA 3BKFA 3QGHA 1IKWA 1ZZNA 1RXOB 1IWAA 3HCXA 3FCHA 4C0OC 4M5JA 1KBRA 2C3YA 3P3DA 1GMUA 1H2UX 5D0EA 2OMLA 4OZ2A 1Q0NA 1Y5IB 2RQKA 3TA0A 4NX9A 3CCUS 3AD8C 3G6VA 3EGVA 4G6VB 2AYBA 2HBZB 1A6LA 1UWBB 3GV7B 1NKEA 1RT7A 2G13A 3LA0A 1WDTA 2XHWA 1XN9A 1UPPA 3OL7A 5GMEA 1B7YB 5A0YB 1QE1A 1T05A 2C2NA 1TQLA 1C1CB 1TU0B 2KFYA 1C4CA 3MOJB 4NLUA 4ZPVR 3ZTQA 4A8WA 1H7XA 1I94F 1L5UA 3MECA 1HI8A 2V8VA 4JV2A 2QGFB 1AB8A 4WFZA 4OHZA 3FCVA 4NL5A 2L48A 4K0KJ 1HQUA 2IBKA 3OFEA 3F73A 4EBDA 4DV7F 4ENOA 4DFKA 1U24A 2K3IA 4K5RA 2BE2A 1KVJA 2LA6A 1YITS 2A6MA 3U1MA 1SI9A 4URGA 4F0KA 2MQMA 2AZ1A 2J6TA 1RT7B 3UN5A 4RW4B 2RT3A 3MR6A 3F56A 2ROGA 3KJVA 3FK4A 4Y3CA 4QPXA 1QE1B 2B8QA 4N47A 1T05B 1S1XA 1SVDA 3M6VA 2DRBA 4ZKAA 3M2RA 2C3MA 4H54A 4V1Ak 2AX0A 1FX4A 1VGYA 1T11A 3MECB 3L95X 5E3QA 1XERA 1HQUB 2XWXA 4IH5A 4M5LA 2KZZA 2KXHA 1DQ8A 2BE2B 1XNRF 3MPYA 4N77A 3Q8PB 1HBMA 2CXEA 2XZWA 4ZVPB 4GMKA 1NJZA 1LWCA 3KJQB 3KJVB 3JSYA 2M2BA 2N4CA 2GZOA 2XCPA 1RKIA 1T9VA 2DNKA 3M2RB 3U7JA 1W7WA 1UJ6A 1W2BR 2Q1LA 1CJVA 4DPYA 3DOLA 2B9YA 1UA0A 1FKPA 2BJEA 1XR5A 2ZH8A 2FC9A 1X4BA 2DPIA 1G4CA 4ZJOA 1JLEA 2DXEA 1GTEA 3GLJA 3TZWA 2W9CB 2B4VA 1YKWA 4QIGA 2OD4A 1S4FA 3PW0A 1HBMB 2IYGA 1EJ7L 1LWCB 2E5GA 3D1OA 1FJGF 5SUHA 4RNFA 4A46A 2A6OA 1KD1T 4K4VA 2VB6A 4V19X 4MH8A 3RGIA 3DN9A 2YH0A 5DQHA 3C6UA 1BQXA 3V4IA 3P4UB 3TYTA 3MTKA 3VHQA 3EICA 1CJVB 3NOCA 3DOLB 1FKPB 4ZP7A 2KH9A 2MKKA 3RW7A 2HYIB 3PJXA 3GIKA 4URQU 2HPUA 4ZVQB 1JLEB 3TVYA 1YI2S 1I94J 2MDAA 5U47A 5AT1B 2XY7A 1WHVA 1RT4A 2FJVA 2DVIA 2HSEB 3VZHA 2UVUA 2AYEA 4JI2F 1BMQB 3OPKA 4DV7J 2E1RA 3ETOA 2E9ZA 3C6UB 3Q8UA 3V4IB 4KPYA 3UW1A 3K57A 4TU7A 1ZA1B 3CUNA 3UNGC 3KJFB 3CC4S 2BACA 3Q8SB 4ANEA 4FKYA 2D3UA 3UCUP 1U48A 1S6PA 2ZFHA 4WK3A 2H54B 1XR7A 3G2XA 5LMUF 1R0BG 5DO2A 1RT4B 2KKHA 2XMMA 2RHSB 3D5MA 1R89A 3MM6A 1T9TA 4GVBA 1L3VA 1V5VA 3LAKA 3OL9A 5H9FK 3EWGA 1XNRJ 5MLCV 1KR4A 4WFYA 3PFEA 2B5JB 4FYWB 2LEBA 2BJ1A 2PMZD 4E0DA 4I7FA 3TVZA 1RAOA 3KWMA 4IKAA 2B8PA 2DHXA 3Q89A 5A6WA 1QTNB 4YY3F 1JNRB 1KFDA 1X5PA 5L1LA 1S6PB 4TYAA 5KG5A 2PFDA 3LTOA 4MKBA 1RT3A 3ZXWA 5E5NA 3M8QB 2VG6A 5SZTA 3ZNUA 2YWHA 4YB5A 2OTJS 2FVPA 4ZN3A 3BZQA 4C0HA 2KG0A 1Y9OA 1K44A 1KTQA 3MM6B 1Q8BA 2GX8A 4GVBB 4NZ7A 1WELA 2V2KA 2VFTA 2ZC4A 3LALA 1VJQA 1FJGJ 3PG9A 4PG4A 2AWZA 4I7FB 4F25A 2ZM6F 4EBEA 4YFUA 2D9OA 3NP5A 3CC2S 3K58A 4WIIA 4UOFA 2ZJRQ 3EJMA 2MQNA 4U8VA 1T0TV 1CJKA 1HWJA 2VG6B 1V3SA 2W01A 2DY1A 3FBEA 1FVSA 2MLXA 3GE9A 2BA9A 4MK9A 4EUVA 1OQ3A 1WI6A 1IVZA 3HT0A 2KJVA 4J9VA 2IC3A 3T41A 2YTCA 1TK5A 4DDFA 4TY8A 3SIPB 3MUTP 4TYBA 4OJGA 2ZOMA 5B0EA 2M52A 3TUIC 1TV6A 2RRBA 4JI2J 1KVKA 1VQYA 4AD6A 5FLXU 1EQMA 2VASA 3KLFA 1F9EB 3DDIA 1CJKB 4DZ6A 3D6HB 1VQ9S 3DGPA 3D6TB 2IC3B 1FI4A 5D77A 1FDAA 3I5AA 3MEEA 4TY8B 2CJXB 1VC6A 3SI8A 4TLRA 4OHVA 5LMUJ 3GV8B 1SL1A 1D8ZA 3RB3A 3FEZA 1TV6B 1F9HA 3Q83A 2NXEA 3PVXA 4NI2A 4Y65A 3QT8A 2BJ7A 3H2LA 1ZAWA 3NLCA 4YHHF 1OPIA 3KLFB 2CQBA 2Q6CA 3CDAA 5DQGA 3OTOF 2OPQB 2M5YA 1SC6A 3MR2A 2ASLA 1SXLA 3BH6B 4IYQA 1HHTP 3DGPB 2X1AA 1N4LA 1NSPA 2CVEA 4AYBD 1NH7A 5HJXA 3MEEB 4YY3J 1NSKL 1REVA 4LF5F 4TU8A 5DG8A 3HSJA 4OIXA 4HTJA 2OHDA 1DLOA 3U02A 4H4MA 3D1HA 2LVWA 1BC6A 2J6UA 3EMTA 1WKKA 4KB7A 2C22A 1ZPVA 1QDUB 4O44A 2LDYA 3GJQB 3SQGB 2YWGA 5DZ6A 1U47A 2J0SD 5AXNA 2ZM6J 4KYZA 1G2EA 2MY7A 3KK3A 5JXSA 3MPUB 2HQFA 5AE3A 4ID8A 1REVB 1KQGB 2NUHA 4C4WA 3LP2B 3C46A 4ZLJA 1WHWA 4M5NA 3PHTA 4CLLA 5LJ5Y 3B4DA 2F3JA 4OYPA 1HNZF 2GGPA 5EWGA 2W8LA 2G1HA 2V2VA 2UXDF 1AFJA 4ALZA 5ETMA 4B3RF 1DLOB 3BKTA 3N4WA 3I5BA 3THPA 3LOUA 5F8IA 2UVWA 2D9PA 4O44B 5B0GA 2V4RA 2BZ2A 4OFZA 1FWPA 1XMQF 1RCOB 4JI3F 3ISNC 2PA8D 3KK3B 1B70B 1VLYA 2CJYB 3LO3A 4B9VA 4HT5A 2O67A 3DOMB 1URNA 3TEHB 1Y3JA 4G3IA 2ZBIA 3N9UC 2GGPB 3OVAA 3N28A 1EETA 2R4FA 2Z58B 4RW6A 4CLTA 3IN5A 3UDCA 1Q78A 3PM9A 2GMJA 3Q22A 1U4BA 1T95A 2XEXA 3AD7C 1ROFA 5CABA 1JLQA 4HHJA 4NXMF 5M2RA 2WVFA 4ED3A 4X64F 4USHA 1T94A 3A12A 2QA1A 5B0DA 3NGUA 5KFGA 1S0VA 1SQFA 3VWSA 4IO1A 4LF9F 2AJ4A 4YHHJ 5B09A 2Y1JA 4PRFA 4M5MA 3OTOJ 2QE5A 1WACA 2MZQA 2IVYA 2DO4A 3QSIA 4OZLA 2XB2D 5CZVA 4HR2A 2JEGA 1YZ7A 1Y5LB 3DDNA 1CVJA 2V4QA 4DFMA 1P1LA 1NDCA 4DX6A 1IBMF 2AW0A 4LF5J 2E5JA 2GHWA 4CO1A 3IMQJ 3IM9A 4XIUA 1JLQB 2DRDA 5AE1A 4H4OA 1TAQA 2EC2A 3TAMA 4LF7F 2K1RA 3UCZP 4YDXA 4RPFA 3ILOA 1SH3A 3NBPA 4CIOA 3H4BA 4LRDA 3P5BP 1VQNS 3GFHA 2GVZA 4Y2IA 2PD1A 4B9NA 3QT7A 3D68A 1R6VA 2CJQA 1ZH5A 4IOCQ 1P9QC 1YBTA 2AJ1A 4OI3A 3J7YU 4P10A 3DHWC 3AQPA 5IV4A 4Z7YA 2PI4A 1IBCB 2YXLA 3H42A 4NLSA 5IV3A 5D0GA 4QQBA 1HNZJ 3CT9A 5KFCA 1M5PC 4H4OB 3F44A 4MMOA 3MWBA 5DM6Q 2UXDJ 4DFPA 3TAMB 2ATCB 2V8DA 4B3RJ 2G0IA 2K1RB 1IKYA 1D8YA 3NBPB 2CPHA 2ZHBA 3HHLC 4M8LA 5KOXA 2GVZB 5FIIA 4YDDB 3JQKA 3W9IA 1XMQJ 1M5KC 3L09A 2HFNA 2IDEA 4JI3J 1XJWB 3RAXA 1HFEL 2QFJA 5L8RC 2WVEA 1FK9A 1TZ0A 2K2PA 3K5MA 4I2PB 3U1NA 1NXIA 1OMSA 2ZVSA 4DOZA 4U6PA 5HP1A 3TR5A 3CPWR 1KLNA 3O2IA 2MZTA 3FEXB 1IKYB 2OH2A 1R6YA 1RTHA 4CM0A 3T1AA 3MMAA 1GXTA 1QTMA 3W9JA 4Q2LA 2YPZA 2QC3A 3QBCA 2G9OA 3ISZA 3S1TA 2YKOA 3PIPQ 4NXMJ 3AB2B 3W3SA 4DX8H 4X64J 4K4XA 2FVSA 3UVJA 1FK9B 5KT4A 1RDRA 4I69A 4L3NA 4G1PA 4LF9J 2V67A 3DLBA 5KFAA 1YJUA 5HP1B 3PCOB 2E44A 1S57A 3CF5Q 1B4SA 3IR7B 3RTVA 1RTHB 2GO9A 3CDUA 2C2EA 3MUMP 3MMAB 2MXYA 4USKA 2QYCA 1NDLA 1IBMJ 1NZ8A 2C3OA 2MLZA 2N3LA 1JLAA 4Z2XA 1K73T 4OMFG 2QLFB 1N0VC 1FXLA 5KFBA 4WBFA 3GJSB 4DV4F 3UVJB 4LF7J 3OL6A 1GEHA 4J9SA 4K4YA 4F4XA 4N5SA 4ZJQA 1KTVA 4USUA 4CNYA 2ASDA 4ECUA 1YVFA 3KK2A 5E3AA 3KXDA 3LGMA 2F63A 1P6TA 1HBNA 1UZDA 3ISND 3PKMA 2ZOFA 4ZP9A 3MEKA 2DNNA 2QSWA 3BBCA 1LOUA 2VFUA 5E3PA 1JJ4A 2SXLA 1WC1A 1NHKL 1JLAB 2ZH1A 3HT3A 5JUMA 5KT2A 4DV2F 4KIAA 3R5JB 1IKXA 1FHTA 3DYAB 3SSQA 2BW2A 3M8SA 2QMWA 2OI2A 2OKQA 3NGRA 2I5JA 4LVOP 2MKYA 4F4WA 3KK2B 2FVCA 4KGXB 3WHIA 2AGQA 1R8HA 2NXNA 2P9CA 3HKWA 2E5HA 2WCXA 4FF2A 3AOCA 1WG1A 2I6WA 2KXNB 4C3MA 2ZH3A 1YRUA 1WTBA 3JAMY 1OY9A 2K3KA 2NXUA 2DR6A 3GCXP 3FZ2A 2AEMA 1M5VC 4QYRA 2WONA 2PEHA 2CJBA 1TVRA 1RWPB 3KMSA 1F2HA 1RU1A 3UQSA 2KHDA 2DCLA 1VS3A 3EDQB 4IOAQ 5HMZA 1IKXB 1NRKA 4K7QA 3AXKA 4C8OA 2APOA 3JB9k 2G1DA 5ETRA 2I5JB 2KT3A 4O0NA 1PYSB 2AJ2A 4DSIA 3FBBA 4H4KC 3I0SB 2UXBF 2L9NA 2VPWB 1AZSA 2CQIA 4PABA 4QWDA 1KFSA 1X5SA 2DEIA 4Y6IA 3NGSA 2CVIA 5DG7A 1S48A 1ZZFA 3MCSA 2EFVA 1NPPA 2WONB 1NK6A 2XNQA 1TVRB 4NLRA 4DPTA 3G82A 2MQ8A 4M95A 2YX7A 2VOOA 2XY6A 4OJ1A 2EKYA 3LP0A 2GQ2A 4RZRA 2OJ3A 2GIQA 2CQHA 4IOBA 3M32A 4ZVTB 2DHAA 4U67Q 2GV1A 2E7VA 3W5XA 1FKAF 4LRCA 2J9EA 4FS2A 1UJ5A 4PWUA 2CKWA 4DV4J 1E6VB 2V2ZA 2BE7D 3W2VA 2ZE2A 3S8SA 2DR7A 2CDQA 4I0WA 2QRRA 2ATLA 5K5MA 2H4WB 2RJZA 1MMDA 3G82B 3LANA 2VL1A 1RWVB 2RD5C 2D3O1 1KOOA 4F4ZA 4W92B 3LP0B 3PRDA 3GR1A 2HVHA 2EW9A 2C1EB 4Q2MA 5AXMA 2KT2A 1W26A 4J9UE 2RVJA 1KNZA 2O01C 1T7PA 3NCRA 3M32B 1SJ4P 3E8OA 3SXLA 5ETVA 2XO6A 4MKYA 1OYEA 2ZH9A 3TZZA 4J9KA 4DV2J 3IA0A 4DSKA 2M70A 2LU1A 2ZE2B 4I6AA 4ZP8A 3GQCA 5HMYA 5IC6B 1NU4A 3IXQA 3D67A 3EUNA 4EI2A 3NL0A 2IJRA 2X3GA 1NK9A 4LBIA 3QRQA 3MAQA 4B3TF 2ZKUA 1SKSA 3X3UA 4CO3A 1REGX 4BWMA 2VC0A 2JSXA 3I6PA 2Y0BB 2GIRA 4WFBQ 3J81Y 5HVFA 2N82B 2AIRB 1HYSA 1JJCB 4HKQA 4ID5A 3IS9B 4P9SA 4P74A 3VQSA 4J5OA 4X84A 1VBZA 1VQ5S 2UXBJ 3BYRA 4I1TA 2B7BB 2YH1A 1RU2A 4QR0A 4UOCA 1NDKA 3K8VA 5C2CA 3KLIB 3MXHP 5H9EJ 2ROEA 3THTA 3NOGA 1FRKA 2QA4G 2CQ2A 2VBXA 3CJRA 5KFRA 3NG8A 1RADB 3N5FA 1NCLA 1FRJA 2BANA 1RAJA 4LQ3A 3IFEA 3NXZA 4FS1A 3UDVA 2IMWP 1HYSB 2Y0SD 1C1BB 1NB7A 3LH2S 3DRRA 3CJQA 2HNYA 4CO0A 2QG9B 2RKIA 4K59A 2M3DA 1L3TA 2V9WA 3DCAA 2UZAA 4KGMA 1RHMB 1GAOA 1Y3KA 4LR9A 4BDPA 3K5LA 4F3MA 3MR5A 3IWNC 2V63A 4QPTA 4P7VA 5F0UA 1VQOS 2KYZA 3OUYA 3CCQS 5HVHA 2HK3A 2CZ4A 2BANB 1GTHA 4B9MA 3AD9C 4MAKA 3GYGA 1VK3A 4PG7A 5I42A 3DRRB 2HNYB 1J5EF 3MI7X 1RHJB 4O4GA 5F3ZA 4QIFA 2RKIB 1NK5A 5DG9A 3MM7A 2F8HA 2MHNA 2PC6A 2PMHA 2H9ZA 3AJDA 3P6YC 4U95A 1NPKA 3RR7A 1IR0A 3AH6A 4M63A 3H4DA 1FWKA 4A8SA 1QY7A 3OUYB 4ZPDA 3TA2A 2N7CA 4I6WA 3MAAA 4TU9A 4ZVUB 2NQPA 4B3TJ 2C3UA 1HPZA 3JYTA 3RU0A 2YY3A 2LECA 5I42B 2HAIA 2VH7A 2ADCA 2P8IA 4O4GB 3RJMB 3UNYA 2U1AA 3MM7B 1AFIA 1RACB 2ZHAA 4L75A 2OD6A 3K17A 4NLYA 1TKZA 2UUCF 1CG2A 4NXNF 1S59A 1UTAA 3FSYA 2HQIA 4K5SA 1A7GE 5KG1A 3IGNA 2IY5B 1RLCL 3KG4A 4XAKA 2R2TA 3SEOA 2FVQA 1R43A 5CHCB 3MAAB 3T6BA 1TMJA 4YR3A 2JC0A 1HPZB 3JYTB 3DRYA 1CS4B 2U2FA 3C15A 3TZYA 3SZ2A 2WTFA 1HR0F 1D3WA 1PBAA 4FYXB 4ZPAA 3OFFA 6AT1B 2OPSA 4PXCA 4NMLA 3ZFVA 3CJTA 1VFJA 3WC2A 2AV5A 3M1VA 1TKZB 2FHKA 2V5HG 1PKUA 3HVRA 5KFLA 2LQ8A 4Y0FA 1U0HA 2Y9HA 3G96A 1H3DA 5DDQC 5KT7A 1RHKB 4LF4F 3M30A 2XZDB 2HZAA 1XR6A 2RNEA 4FN5A 3CD5A 3KUGA 4CLUA 2IM3A 4W90B 4FXDA 2XQCA 1APSA 4EO6A 1IUJA 4F0MA 2LQ9A 2I38A 2ZZNA 5C25B 1PBUA 2XTJP 4NRTA 5GMDA 3LGHA 4EGLA 2GW8A 2BJDA 1VRUA 5A2QU 4MTPA 3DDKA 2VDHA 3FRZA 1WEYA 1Y5NB 3M1VB 2B4PA 4ELUA 4CLZA 1U0HB 5K20B 5LSOA 2GMLA 5BXIA 4DR1F 1NM2A 5HL7Q 1BUXA 1K1QA 2DY9A 4PG5A 3M30B 1J5EJ 3PR4A 2A1BA 2HGMA 2LP4A 4TNOA 2MQLA 2P6TA 3D3BJ 3HVAA 3QSYB 3M8RA 3OJUA 2CNOB 1PYOB 4WTYA 2H5EA 2BR0A 4LR8A 2WSEC 2VG7A 4OL8A 4PXBA 2JJ4D 2E1CA 4WKYA 4F0HA 3LGNA 4MK8A 1VRUB 1N5QA 4CLYA 3EZUA 2W7PA 5KFMA 5K8PA 4KAIA 3MOZA 2RF2A 3NNCA 3FQKA 1F6TA 2XSJA 3A8KA 4BCAA 3NCPA 3DRSA 3M8YA 4B02A 2MPUA 3EVWA 4J9RA 3AA8A 3H25A 4PQAA 3CDEA 3LWMA 3NWGA 2ZJPQ 1OSDA 4F50A 5L1KA 1C0UA 1TL3A 2EG1A 2UUCJ 2P9EA 2QL9B 4NXNJ 2VG7B 1UZHA 4NLWA 3KLVA 1WORA 1FTCA 5C42A 4C3KA 5KT3A 4C8ZA 2KB2A 1X9SA 2RF2B 2XSJB 3RUBL 1IWGA 3DRSB 2G2OA 1OO0B 1UEUA 3ADAC 2MSSA 1ZETA 1HR0J 4DN0A 1QAYA 4RJVA 4KE5A 4UQGA 3H40A 4KKOA 4WFXA 1LXNA 2XNRA 1C0UB 1TL3B 4U7UK 2NR0A 4TQRA 2EEYA 3VAGA 1HI1A 1U25A 2EPIA 3CWJA 2CWKA 2D3ZA 1RYRA 3TX0A 4LF4J 4DLGA 5F8LA 2CA9A 4PG8A 4UUXA 4BC7A 3IG1A 4FVCA 1G1XA 2V8HA 1S6OA 4QWAA 4G1IA 1J5OB 2ZWPA 1RT6A 3NWRA 4DWIA 2MZRA 2JC1A 1VQPS 3B78A 3MM5A 1NBEB 4A47A 3V4MA 5I3PA 4IR1A 5K8MA 4UTGA 4DCJB 2ZKTA 4KKOB 4V19J 3P5TL 3ELHA 4DCOB 1URRA 2LFVA 1R8AA 2B43A 4F2SA 3L7OA 4HH0A 3D2WA 4DR1J 3NS5A 3PYEA 2YBVA 3T9NA 3MR7A 4RWWA 4RX6A 5KT6A 2MQQA 4GC6A 3IG1B 3FNNA 4UQTA 5GADU 4ECVA 4QU7A 4YB1P 1YGYA 1RT6B 3R97A 3PEHA 2JZ5A 2WRMA 1VISA 2VPZB 2Z2MA 2BEFA 2PDAA 3QQCD 3A1YG 2QX0A 3RG6A 3QWUA 4KFBA 1VR6A 3OXLA 3HMJG 4LQ9A 3J80Y 1AW0A 3BBFA 2JVRA 4KHPF 4DSJA 3KNGA 4OZ5A 2QV6A 2XMAA 4OJ3A 1NB2A 2Q6BA 2ZH4A 2DNQA 2VKZG 1EIYB 1MSWD 4MK7A 2J0WA 1VDHA 5KFKA 1RUSA 4RLEA 2HWHA 2JOQA 2CADA 2B56A 1N32F 1UA1A 4NYPA 2W8KA 3CCMS 5KT5A 1YJ7A 1RLDA 1Y00A 2GVDA 3H90A 3TAQA 4O4RA 5KFDA 4CT8A 5KFSA 2FJDB 3PTWA 4KFBB 4CRJA 1UW4A 4FXVA 2GJ2A 3NCQA 4FVMA 2IJNA 1LW2A 2H3EB 3WBZA 2VA2A 1SKUB 4ZPCA 3FSXA 2HQ3A 4YP3A 2VPYB 1Q8LA 2A2CA 3R7BB 2V4JA 3CO9A 3IR5B 3QWPA 4WE1A 5F3TA 2XS5A 2ZZTA 3BREA 3ZZPA 1TK0A 4CZCA 1Q82T 3TX8A 4DZDA 2BM1A 1N5VA 1FRIA 1RISA 4DL2A 1NO8A 2GVDB 4ZCMA 4ILLA 3D54A 2NCKL 5B0BA 4IFVA 4IRKA 5KAKA 3HSGA 2OGUA 3OLBA 3HLUA 1LW2B 1CQMA 3MGJA 2EFNA 3JXOA 2V2QA 3G87A 3MPWA 2A0FB 1YHQS 1NSAA 1HIYA 3BSCA 3LWLA 1T03A 2M4MA 4ZCLA 2V4JB 2OMOA 1SV5A 4LSNA 5D0HA 4WE1B 4OX6A 3MFHA 5HANA 3BJYA 2QMUB 4WWSA 2MMYA 1Z2LA 3CW2C 1HNVA 3O44A 4HHHA 3JQJA 5KOWA 2XI3A 3H5UA 2V6AA 3CDWA 2DD8S 4F4YA 2CNLB 3PYGA 1CPZA 4USVA 1ZTWA 2KM8B 3R7NB 1LQ9A 1UEVA 5DJBA 2Q79A 4F8RA 4GVLA 4DU8A 3SV3A 2GHPA 3HO1A 1MWZA 4P72A 1T03B 4KR0B 1SV5B 3VV2B 5HQ8A 3JS9A 2CQ0A 3EGNA 3H8YA 1K47A 1HWLA 2NYIA 1QAXA 2WHOA 2NPIA 5M2PA 2IM2A 2WB1D 4ZLPA 5CYMB 4KHPJ 2KRBA 2AX1A 1RAEB 2BXJA 1JXVA 3L4BC 1F5CA 2AKWB 2RILA 4QWCA 3VQTA 3CDBA 4PXEA 2FHOB 2R7RA 1SUQA 4ATNA 3KHHA 4F02A 3TARA 2IM0A 4USWA 1BWEA 3FGVA 2YX4A 1RWUA 2OSQA 4LSZB 1N32J 1CULA 1FF2A 3G8TA 4QIEA 5HBMA 2B9XA 1UVLA 3OSNA 2HHQA 3WDOA 5GAGU 5BYRA 3UFCX 3KJNB 3CEDA 2WZ1A 5J2QB 2V8PA 4KH0B 3ZZTA 2OPPA 4JB8B 4L3KA 1YJ9S 2QA2A 3G4SS 2IIHA 4DL6A 1CC7A 4IUFA 5HQMA 3W2WA 3BV8A 4CNZA 5KFOA 1SUQB 2DGUA 4BBYA 1HNIA 3HZGA 4UT4A 4WYLA 4QJVA 1BQMA 1UAWA 2W2MP 4NA2A 1CULB 1RWMB 5CZXA 2P9GA 1S9EA 4DV3F 4DR6F 5HBMB 3M6XA 3M6UA 4D3HA 2R7OA 1YQHA 2OPRB 1ZM3A 3DLGA 3GJTB 1GFWB 1L3UA 1RABB 1TUVA 2DISA 1RB0A 2OPPB 2W4PA 2FHMA 2PMWA 2RMLA 3W2WB 3RB4A 1HNIB 3KHRA 1RAIB 3OTBA 2IBOA 2Y8YA 1FWLA 1VI7A 3V6HA 4GRSA 2V8GA 1BHNA 3MM9A 5KFUA 3HVWA 3D28A 1M1HA 2VZ9A 2HKEA 4C3LA 2C2OB 5AE2A 1S9EB 1RBLA 3QO9A 4Q0BA 4CLPA 3MPVA 3DLGB 1O6XA 3J81j 1I3OB 2AEJA 2I0XA 2ZBQA 2AGOA 3DU5A 1KHWA 1O8BA 3F41A 4BWJA 5A8KB 1FFSB 5D0RA 2WW8A 4HI1A 1X60A 2HWIA 3KLEB 4ED4A 3AY0A 1SC1B 4P75A 3VAIA 5HK4A 2WSCC 4RU9A 3CO0P 4N7TA 1LK5A 2IRUA 3N79A 3MM9B 3E2EA 4ETXA 3H2VE 3AB4B 3QO9B 3UDLA 3WX4A 1HHQA 4Q0BB 4BC9A 2I9SA 3Q0AA 4GO5X 4CWBA 2ALYB 2D41A 4OX7A 3W5ZA 2A18A 5KFFA 4USIA 1U45A 1SPBP 1BD6A 3RYLA 4QOTA 2NUUG 1LK7A 4K4TA 1NZAA 3CVKA 1BXNA 1B0VA 2CWXA 4ZPTR 4X66F 2KTQA 3AQOA 5H9FJ 1KHVA 2ZC3A 5JJBA 4QYZK 2RDIA 2RHQB 4DL0C 3W8PA 1X4HA 4DXLA 3MUVP 4FXWA 4FKXA 2LQJA 4X62F 1TKXA 1HARA 3QMQA 5E7OB 4E2FB 4CO2A 2POKA 4ZVGA 2VQEF 2CQDA 3N6NA 3D0HE 4ER8A 1FD2A 4UZBA 2D69A 2FPHX 4CLKA 2W24A 3HSDA 4DV3J 4DR6J 1X7VA 5ETOA 3CCSS 4CQ1A 5HAOA 2C42A 3FZBA 2FLNA 1RCXB 4K4ZA 2DIVA 2IDLA 1JLCA 4K8RA 4DS4A 2B4OA 1R3NA 1WC0A 3MMBA 1JMTA 2R7SA 3A8EA 2N4DA 3NAHA 5DRKA 4JV0A 1TKXB 1I5OB 3M8ZA 4DPOA 4RNHA 1FDDA 2E7WA 3VGUA 4YS2A 1A9NB 3CCJS 2F40A 2IMOA 3BO2A 4NLDA 4CT9A 2CIMA 2OLWA 3QGGA 5DLGA 3LQVA 1X0FA 4R0JA 4RUBA 3UI3A 4QR2A 3SSRA 2CQ3A 4QCLA 1RTDA 3ONQA 3GSDA 4OLOA 4FPRA 2CNNB 2Q43A 4N56A 1JLCB 2VV5A 4ZVSB 3PR5B 1S77D 3SMZA 4J90A 5F9NA 3MMBB 2ADBA 3KLHB 2PA3A 1FRLA 2GCFA 8ATCB 3B4MA 4WCEQ 5D4NA 2RQMA 9RUBA 2AMCB 2ILYA 3IC1A 3FJ2A 4DEZA 3IWLA 4JI7F 2OELA 2XMVA 4ED1A 1IM4A 4CLWA 5KFWA 1U0SA 2WW4A 1TL1A 4LRBA 1RTDB 2H48B 4WK1A 4OHWA 1ELOA 2ZUAA 3WQPA 1WI8A 3NKYA 1FERA 1S4EA 3M8WA 1SQGA 3TZXA 2QN6B 4WF9Q 4ECWA 1IKWB 1SL0A 5KFPA 1C4AA 1EQ0A 5DQIA 3GONA 3VVTA 3G6XA 2QFIA 2QMXA 2H5IB 4HYKA 2KFNA 4NOHA 1RWOB 3PX0A 3CJ2A 2HVEA 4X66J 1F5AA 5JVGQ 1SL2A 2X1FA 3HSZA 1TL1B 4A8OA 3TOQA 3OW2R 4ILMA 5LOQA 4YR2A 2M7SA 4X62J 4LUBA 3PDNA 2CQGA 2B9EA 2MZ1A 3GV5B 2KRRA 2ZH7A 5HQLA 1VQ8S 4F4KA 2DGWA 1FDNA 3PRVA 2VQEJ 4Q45A 4J9QA 3HX9A 2VC1A 4LF8F 1MROA 1N54B 2XBPA 2JDJA 3PO4A 2LEPA 4EK2A 3VCDA 3W64A 4RUAA 2AQ4A 3Q8VA 1S10A 3H5YA 2HBQB 2F8MA 4PUOA 3GWCA 1GMVA 4OHXA 3QLHA 1SJFA 4WYWA 1SQEA 4KO0A 3KOAA 1EZZB 2HNDA 1KP6A 1Q86T 5RUBA 1DRZA 3AJ2A 2ZBCA 2J0XA 1S1WA 2BBEA 5F0WA 1N0UA 2Y3YA 3D4JA 3I0RA 1SJQA 2LA4A 1YBAA 2F1FA 1VHFA 1MROB 1UWAA 3BGLA 2YNHA 5KFXA 1S1XB 4F4AA 4N76A 2GQQA 5BYSA 3EYZA 2GAGC 3G6ES 2XYGB 3J7AN 4PUOB 1YJWS 4ZN1A 3QLHB 5LM7E 1VQ6S 4X65F 2HNDB 4DL4A 3A3NB 2VBYA 1S1WB 5F8GA 5K8NA 5E41A 3DXBA 3I0RB 4IO9Q 3WIVA 1TL5A 4JI7J 1KEKA 1JX4A 4NLOA 1DQAA 1CSJA 4OZ3A 2YNHB 4ZP6A 4G65A 2DHGA 5HVGA 3NS7B 1PCAA 2DNMA 3MR3A 2W4DA 2ZVIA 4ZHRA 1ZPWX 3L7PA 3PJ9A 3Q2TC 1LEOA 1S7HA 5EX0A 4TLQA 5G0RA 1JIHA 2H65B 3M4XA 4Q8EA 5CYQA 3DLJA 3GIJA 2LXFA 3KG1A 1VYAA 4PEOA 2MKIA 1CQNA 3HXMA 2J76E 5CAAA 4LSLA 4CTAA 5EUHA 3R1LA 7FDRA 1G6BA 4DR4F 4O3OA 2EKNA 2KVIA 2GMHA 5EWFA 4B3OA 1WOSA 5GAHI 3LP1A 4P73A 4ZHRB 2UV8A 1UEKA 1N34F 9ATCB 1UFWA 3G86A 4DQIA 4LF8J 1IJFB 4LJMA 1GX5A 2PFFB 1OQ6A 4KJIA 5G0RB 1O51A 2EBGA 3POTA 2EG2A 1B3TA 1QUPA 2UUAF 3BPSP 5CYQB 2YKAA 3A8JA 2FVRA 3CCZA 1FRMA 3W1YC 1RK8A 1FFWB 4LSLB 4NA3A 4PG6A 4CTAB 5IC4B 4DQQA 1HMVA 5J1PA 4MYTA 2DH8A 4IH6A 3BBBA 3OQ2A 4B3OB 4DHVA 3S6EA 3LP1B 4M94A 2VKRA 2PSZA 3LPYA 4DL5A 4OYBA 5L9NA 2HHSA 3MZIA 3AAWB 3T5HA 3R2DJ 3VAJA 2EWHA 4YQWA 1S0OA 1EX8A 1NSQA 5FJ4A 3POTB 4XO0A 3IR6B 1ULRA 3WZ0A 3B54A 2QL7B 4P2FA 1Q7LB 2XO7A 1P1TA 3CD6S 1T9YA 3D6FB 3D1QA 3ICLA 3A3OB 4X65J 4DV5F 2R2SA 4CM2A 1HMVB 4ES3A 5HLFA 3ZTPA 1X4EA 4OYWA 4L74A 4WTOB 2IVMA 5C24A 4NYOA 3K2YA 3K7RA 4WJBA 4O3QA 5IT9Y 2V68A 2FY1A 4PPZA 2MZJA 1RT3B 4F7VA 1F2GA 3I5CA 2CPZA 4ZITA 4ECXA 5A6PA 5LSLA 1UVJA 2EI5A 2BKOA 3OVSA 1N52B 3T5LA 3RZAA 4DLEA 1U1QA 5BYQA 3CJKA 2CPYA 4I6YA 3MEDA 3B6BA 2L08A 5HLFB 5AJ3F 3JTPA 2VOPA 2MLYA 2BVZA 4HTIA 4ZVEA 5DETA 5K8OA 2JX2A 4CO5A 5C24B 1QSLA 4S0MA 1S7IA 4AL6A 5B08A 2V69A 2KHCA 1I1GA 4NLPA 5KG3A 1S72S 4DR4J 2RQ4A 1UL3A 4PR6A 3EM1A 5GAEU 4QR1A 1QSYA 4DQRA 1N34J 2XMJA 3MEGA 4C48A 2DBBA 3QIPA 2HW3A 1D9AA 4DSLA 2RH3A 4FF4A 2DHSA 3NMRA 2GQCA 3HM9A 2UUAJ 4NZ6A 2DNPA 1UKUA 4CLFA 2XMTA 3TUJC 3OFHA 3JTOA 2AJFE 2UUTA 3O8WA 1WG4A 1KVIA 1VLOA 4UY8T 4ES2A 2MQPA 4IG3A 1QLNA 3RBXA 3H0PA 1E6YA 3DLEA 1MN7A 4USTA 2HLUA 2R2UA 1VC0A 3MEGB 3EGZA 3QIPB 5K14A 1FD8A 1CLFA 1D9DA 3HFKA 1FNOA 3M6WA 3PFOA 1YBUA 1B99A 2Z56B 3SCKE 3BN7A 3OT9A 4B3MF 4AL5A 2DXDA 3R5AA 3BS9A 2DRAA 4Q8FA 1X4DA 2KO1A 2UP1A 2DPJA 4KC5A 5AXLA 3FMWA 4DV5J 4GO7X 3PW7A 4NI2B 1N5YA 3CJ0A 4WPAA 4NLVA 4B9SA 2RSQA 2E66A 1E6YB 4NLTA 3DLEB 5ETTA 2UXCF 3VAFA 4TVAB 3CCLS 3BGOP 2FJWA 1U6BA 3CD7A 5K14B 4QW8A 3QATA 2ROPA 1N8RT 2BV3A 3DRXA 3THVA 5GMKa 3KHGA 5DGAA 4Q43A 3Q86A 1WUUA 3SCJE 4PXDA 2R3VA 4P2SA 1T3OA 5L1IA 7FD1A 2HBRB 1U09A 3H20A 3D66A 3NS6A 4H4MB 1N5YB 2HS3A 2A10A 4HACA 3CCVS 3GR0A 1S9FA 5AJ3J 2FY8A 3FFIA 4ZVFA 3MCNA 2VUGA 4FDFA 3QPIA 3KKFA 3LW5C 1S12A 1XK8A 3CTRA 1RSCA 1K0TA 3H7HB 3DMJA 4KGVB 3X1LB 1SB6A 1ZYQA 3R1HA 1UETA 4O0IA 2QLXA 3V6JA 1WDDA 2WBMA 3I82A 3BQ0A 1JLFA 2BOPA 1HW8A 2WBRA 2O66A 4DUZF 1LV5A 3GJRB 1U2RA 2KXFA 1AA1B 2GFFA 2E1MC 1U1OA 1IR1A 2HHHF 1TKTA 5D15A 1U2CA 2AYGA 3FFIB 1YZ6A 3HP6A 1VHIA 4DQPA 3CJ3A 2WK4A 4ECZA 2JFDA 4TXSA 4DX5A 3DMJB 4ZLNA 4J7CA 2VG5A 2KM8C 4FYVB 2HHWA 1T9XA 4K50A 3RB0A 4LRAA 4MIWA 3QZ8A 5GVQA 2RDDA 1I6JA 3KMQA 1EETB 3OR2A 3SYZA 4RW6B 1VQSA 2HQGA 5J1NA 5B0FA 1WF1A 3RRHA 1OY6A 4B3MJ 1PILA 1S79A 3PJWA 1PJ5A 4M5IA 1VBYA 2RU9A 3OBIA 2HZVA 2EFGA 3DNCA 4CYUA 3PY8A 2RS2A 5D6GA 4EFAC 2VG5B 1SKRA 1VK8A 2YNGA 1DJ0A 1NHUA 3G8QA 2HHXA 3CGIA 1X31C 5HJYA 3O6QA 2UXCJ 4QIWD 3WC0A 3TW0A 2MKHA 4TKTA 4L6V3 2CQPA 3J7ZT 2ILZA 4KH1B 4U8YA 3W65A 5KFZA 4WIQA 1YWXA 3DHXA 4Z37A 1C2PA 1UW9A 1OWXA 4LF1A 2NZ4A 2EXUA 1SIZA 1X4FA 3GG1A 4CLSA 1MNEA 1AYEA 2WVBA 1GXUA 2R8JA 3K5NA 3Q8RB 2YPYA 4Y2MA 3O1LA 5CA5A 2MGZA 1FTRA 2Z2ZA 1EB0A 3R6LB 2QYGA 2IA0A 4ILRA 3ILLA 3OFGA 1DY3A 2BX6A 2JFKA 3AA9A 4ED7A 1Q8IA 2W7AA 4WXWA 1RWKB 3UR0A 5LSRA 4HDHA 2XSFA 4DPWA 3ZZRA 2MKCA 4CDIA 1N56A 2HNZA 3G8SA 4DUZJ 4OYIA 1QM9A 2ZH5A 1P9YA 1L3SA 5LXRA 3M9MB 1KQKA 2FYXA 3WX8A 2XY5A 2XS7A 2YWFA 2HHHJ 4F04B 2YNFA 1YTYA 2ZDPA 4ZA1A 3NGKA 2AGPA 1GT8A 4LFAF 2MGZB 2VF3A 2J8AA 1B7FA 1UFKA 1V3RA 3I96A 3HHDA 1JWWA 4A8QA 1GMWD 1TMMA 1VOMA 4JP8A 4JI4F 3BSOA 4WFAQ 3IO1A 3U1LA 2MSTA 3NNAA 3L9ZA 2NXJA 2J8SA 2OEMA 2RUGA 2MEWA 2HNZB 4DFJA 3ZNJ1 2ZH6A 2YX1A 3M8PA 1X4GA 5A0YA 4R5PA 2BUNA 1BY9A 2BJ3A 3I9ZA 1C1CA 3SBMA 2YNFB 2Z2LA 3W60A 5IXUA 4MYUA 2OP5A 3HDSA 4WP9A 1U6FA 3I4PA 4JI5F 2RRNA 3DI6A 3D7SB 5L1JA 3KFWX 4PYAA 1FEHA 2LKZA 2MHEA 2CAJA 4KQZA 5T14A 2B9WA 6FDRA 2A3JA 3KHLA 2M0GB 4LVNP 1UVKA 2AD9A 3FEYB 4ZDNA 1X9WA 4IG0A 4RW4A 5CD4H 4Y2AA 5M2UA 2HFSA 2FLOA 4DX7A 3M8PB 3A13A 5DS7A 5KFVA 2E9TA 2HVIA 4R5PB 4ERDA 3CJSA 3QFWA 4OYAA 1WKLA 1LWEA 5T41A 1HBOA 5ITHA 4P6QA 3DI6B 5A8WA 2DGTA 4UUWA 1NJXA 1ZM4A 1FNXH 1XMBA 3BR9A 1PYTA 1SC4B 2DNZA 4KT0C 1RHQB 2Z4PA 2CYYA 2FLPA 4IG0B 3ENVA 1HBNB 1NLKL 1MMNA 3OTEA 1U1NA 1U1MA 1R8PA 2F8EX 4JI1F 2KZMA 1S49A 4XPEA 2MKJA 3RRKA 3BO4A 1LWEB 2HFZA 2FJAB 3R5BA 2MYFA 1HBOB 1NMEB 2KDOA 2H5JB 5A8WB 1DBDA 1N88A 3AHPA 4NCBA 1RAHB 2CRLA 3R5DA 1EHWA 1EARA 1FCAA 1AXQA 3BGUA 4F67A 5DLFA 2EK6A 2HHTA 3OVBA 2WVDA 1RJJA 2JLEA 3W7BA 2UU9F 2R7WA 1V5IB 1NK0A 2W9CA 3T19A 2HRUA 1RZMA 1YK9A 2QA4S 4LFAJ 2LCWA 1MW7A 2Z57B 3BDEA 4LMZA 2R7VA 5DDPC 3MMCA 4DR5F 4PWWA 1UFLA 2I2YA 4D3GA 4R25A 3PNIA 4JI4J 3ETMA 5ETLA 1JKHA 5IM0A 2V94A 3AT1B 3SCIE 3TEGA 3L3CA 2AT1B 2M8HA 3I32A 4OV1A 1WHXA 4OZ1A 4ED2A 3Q8QB 3OV7A 4KPCA 2JLFA 4JBCA 5FLXY 2AEFA 4U7UD 4M1KA 4JI5J 5GADI 4M5HA 3OJSA 4MIAA 2RAQA 1LFPA 1AZSB 2MY8A 4ZIWA 1X0PA 3HI9A 5KFEA 3MMCB 2FGOA 2CPJA 3VAHA 1DURA 4O23A 4RR5A 5L39A 1JKHB 5IM0B 4I4BA 3CULA 1CC8A 3VAMA 2DR9A 3KUEA 5K9FA 3H59A 2B3TB 2HHPA 1Q1KA 2ZOGA 2CJKA 2MQOA 2E9RX 1V3ZA 3NNHA 5L9XA 3GILA 3K8WA 3A3PB 3UD4P 4M5DA 1PGZA 3RR8A 1M90T 5J2PA 2GA7A 3T5KA 4B3SF 1VBXA 3P45B 1RWWB 2QEXS 2K8GA 3W2VB 3UPFA 2KI2A 2KJWA 2BKNA 4LBHA 4EYHB 2BMBA 2W2QP 2B5JA 4C8LA 5JMNA 1UVMA 5JVHQ 1IQTA 4L73A 1F9FA 1KSPA 4JI1J 1YG0A 1H72C 4RL1A 2PGCA 1RKJA 2N7YA 3MF5A 1K0VA 3HHEA 3M8QA 2NS1B 2K06A 2R8KA 3ZC4A 4M5DB 3W61A 2ZNZA 5J2PB 1QAIA 2DNRA 1WC3A 4OYOA 1UVNA 3TUZC 4YR0A 4HHUA 2GS8A 3DXSX 2QLWA 4LFCF 2UU9J 1XIQA 1Q53A 2ALZA 4OI2A 3W62A 2HRYA 1LW0A 2OIHA 3OR1A 5KFHA 3K59A 4DR5J 2HWTA 2HIYA 2J9DE 3VVUA 2L3MA 1MG7A 4JV1A 4OYMA 4NRUA 4DF4A 8AT1B 3JAMU 4A8XA 1M0SA 3Q8YA 3V81A 1W2IA 3EVOA 4O3NA 1CEZA 1WHYA 4ID5B 4KSEB 3HULA 2PE8A 2W1BA 3ITHA 1AUSL 2DNGA 1LW0B 2YKMA 1S1TA 1F1BB 2BQUA 3OR1B 2LLZA 2IM1A 2OAUA 3OXFA 2KFZA 2C28A 3H2UB 4JI0F 1X4AA 1S6QA 1KN6A 5F8HA 4FZVA 4E8UA 3HVTA 3HD2A 4X2BA 3G9CA 3V81B 2OO4A 1RA6A 1B0TA 3ULHA 1NNDA 4PZVA 3PW2A 3ITHB 2R7UA 4Z7CA 2YKMB 1S1TB 1KS2A 1H2TZ 4K4SA 4B3SJ 1FT8A 2R7QA 5H1SV 3CIZA 3SFUA 2GO8A 1U1PA 2NSCA 5GAGI 2NREA 4NE9C 4YB6A 1FNMA 1IR2A 1XQIA 5E3CA 2DT9A 2J7UA 1FRHA 1J27A 4LF6F 2GNKA 4N41A 1WSVA 2OPQA 1S6QB 2X1GA 2E1AA 4TY9A 2RDJA 1NUEA 2EFOA 3HVTB 5J2NA 1CJTA 2DO0A 2CQCA 4YMEA 2DYAA 4UF4A 2JL9A 5E33A 1H6KX 2CG4A 1HW9A 3BB5A 2R2RA 3US5A 4DL7A 1KQSR 4JV5F 2A2DA 3FVYA 1V6HA 1S6UA 1JQGA 4C98A 1YDLA 2LQBA 4LFCJ 3W9HA 2KT5A 3N6LA 2PO4A 3N5BA 3SQGA 4W4MA 4WZMA 4YEAA 4DG1A 2V50A 4EEYA 2ZZMA 4ICLA 4C2MA 5DGBA 5HMWA 3R3TA 2ZEJA 5J2NB 1CJTB 3LPEA 4QWEA 3CMAS 2W2NP 2HQCA 3KK1A 2R8HA 2FQQB 3LP2A 3R7SB 4CH7A 3ZZOA 3PX4A 2F9DA 2FB0A 2XMKA 4KV8A 2UV8G 2VIHA 4WU3A 4LREA 2E29A 3QAEA 4ED6A 1AT1B 4F36A 5C2GA 3ZZUA 3CCWA 3CCTA 3ILJA 4F3QA 5ETSA 1NJIT 5E3RA 2COLA 2PI5A 2BW7A 3RW6A 1XMOF 1K9MT 3FCWA 4OYZA 4PCQA 3DLHA
chains in the Genus database with same CATH topology
2LEPA 1JJ2R 1JLGA 5EX3A 3UQSA 2KHDA 2DCLA 1KVJA 2DITA 3VCDA 3GFXA 1HQEA 4CO4A 4RUAA 2AQ4A 1N33F 1B64A 4DG1B 1HWKA 1S10A 1VS3A 4ICLB 3RBEA 4IOAQ 3H5YA 4I56A 2YKQA 3H98A 1ZAXA 4JUZA 5HMZA 1IKXB 1NRKA 4IG3B 4J9MA 3BSNA 2DNOA 4YUDA 4MKAA 3HHLA 2F8MA 4PUOA 4C8OA 2APOA 3GWCA 3KK1B 2XLJA 3JB9k 3CD0A 2G1DA 1M1KT 4C0BA 1OPZA 1RA7A 3DOMA 4ZCKA 3UCGA 4NCAA 2I5JB 4OHXA 3QLHA 2KT3A 2ASJA 1NK7A 2VD3A 1SJFA 4WYWA 3EPIA 4ZK7M 4KV8B 1SQEA 1U1LA 4KO0A 1X5TA 1Q79A 3HPOA 4DSIA 3I56S 3KOAA 1VQ7S 2HNDA 4LFBF 4X4PA 1Q86T 4KRWA 1C0TA 4H4KC 1DRZA 3I0SB 2UXBF 1N6QA 3AJ2A 2OPSB 2ZBCA 3E3XA 1HWUA 2L9NA 5IZHA 2J0XA 4OJHA 4AQYF 2VPWB 1S1WA 5I3UA 2BBEA 5F0WA 1N0UA 2CQIA 4DMZA 4QWDA 4MFBA 1KFSA 1X5SA 1UVIA 2OPRA 2C2DA 3I0RA 4Y6IA 1SJQA 5KFQA 1L3KA 3T3FA 2CVIA 5DG7A 2W9BA 1S48A 2LA4A 1ZZFA 2E5IA 3TO8A 1YBAA 2FHJD 3MCSA 2IRYA 2EFVA 1IQZA 2F1FA 4ETZA 4EZ9A 4KBIA 2WONB 1NK6A 2XNQA 1VHFA 1MROB 3RAQA 4OZJA 4PPDA 1TVRB 1DAXA 3C66A 4NLRA 3PO5A 5HI7A 3BGLA 2YNHA 1JLGB 3GZ7A 5KFXA 4M95A 2YX7A 1HQEB 3DU6A 1S1XB 4WKRA 3PRBA 1IBLF 4EYIB 4N76A 2VOOA 3NMAA 4ZVHA 4HLBA 2XY6A 4X4QA 4OJ1A 2GQQA 2EKYA 5I4MA 2EK1A 3OLAA 3LP0A 5BYSA 5IS2A 2GQ2A 3M9OB 3EYZA 1S0MA 4ZPWR 2LYVA 3V6DA 1JXEA 1UMJA 5EHHA 3G6ES 2R8IA 4RZRA 3HHLB 2YWKA 4OI4A 4PUOB 2OJ3A 1YJWS 4DR3F 2GIQA 2XMUA 4AXJA 2CQHA 1U1RA 3CXCR 4ED8A 3QLHB 4FNIA 2O5DA 1VQ6S 4IOBA 3M32A 4X65F 2HNDB 2PN6A 4DL4A 3CSKA 5HO4A 2DNLA 1C0TB 2DH7A 4ECQA 2FC8A 2DHAA 4U67Q 1N6QB 2VBYA 1U49A 2GV1A 1RGVA 1FKAF 1S1WB 5I3UB 4IQMA 3QJPA 2J9EA 4FS2A 1UJ5A 5F8GA 5K8NA 4MFBB 5E41A 1XBWA 1OIAA 1W25A 2GJIA 3EGWB 4PWUA 3DXBA 2CKWA 4EZ6A 2DH9A 1E6VB 3I0RB 4IO9Q 1AUDA 2FDNA 1NAQA 2I8EA 4CH0S 3W2VA 2CPFA 2W9BB 1S97A 2ZE2A 4RUCA 3E01A 3S8SA 1TL5A 2G4BA 2DR7A 5KFNA 1KEKA 2CDQA 4R8UA 1JX4A 1VRTA 4I0WA 5CH7B 2YNIA 1FXRA 2QRRA 4NLOA 5A8KA 5K5MA 3BQ2A 1DQAA 4DUYF 1CSJA 4OQJA 2ATLA