1C1BB

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
432
structure length
415
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYNLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 113
structure length 415
sequence length 432
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB03
4RW4B 3HKWA 3KLFA 3DLKA 5KT6A 3CWJA 3GYNA 5F8MA 1TV6A 1N4LA 1JLAB 1DLOA 1LW2A 1TVRA 3QO9B 3GIJA 3PZPA 1CSJA 1D1UA 1SV5B 1YVFA 2I5JB 5HLFA 4RW7A 4ZP9A 5C25A 1RT7A 4J9MA 1J5OB 4ZMMA 2FJXA 3KLFB 2ALZA 2I1RA 3DLKB 3MF5A 1TV6B 5KT7A 1DLOB 1LW2B 1DTQA 3M8QA 3JSMA 5KG6A 4IKAA 3BSNA 3BSAA 4F4YA 1RYRA 1TL1A 5C25B 3N6NA 1HMVA 3H2LA 1RT7B 4IR1A 4ECQA 3KOAA 1HARA 4MIAA 4KFBA 4RUCA 2HMIA 4DL6A 1RTIA 2AWZA 4J9KA 4Q8FA 4Q0BA 4RW9A 4NLDA 4MKAA 2B43A 3PR4A 4JV1A 4M94A 2FVPA 4KKOA 1GX6A 3KHGA 2WHOA 4KO0A 2R2SA 1DTQB 2BRKA 3M8QB 5KFXA 4Q44A 2B6AA 4QWAA 2BQRA 1TL1B 3D5MA 1HMVB 2BR0A 5DLFA 5KFPA 2IMWP 1OS5A 4KFBB 4NRUA 3RB3A 1S1WA 2V9WA 5HP1A 4NLGA 2ZE2A 1RTIB 3CJ5A 4IH5A 4Q0BB 4RW9B 4ZP8A 2XI2A 1T05B 2W9AA 3PW5A 3RBDA 3KLEA 4NLWA 4KKOB 4KO0B 4F4XA 3QZ8A 3MECA 2B6AB 3PW4A 2C28A 3DRRA 3OSNA 4URGA 2DPIA 4QPXA 5HP1B 2ZE2B 3DYAA 3E51A 2UUTA 5L1KA 2CJQA 2RKIA 3I5BA 2XI3A 4K4WA 3KLEB 2ASLA 5F8IA 3QZ7A 3MECB 5KFJA 3DRRB 3QIDA 2IA6A 4QWEA 3KK3A 3OHBA 1RT1A 2BE2A 3DDKA 4FS1A 3CDWA 1T94A 3DYAB 2ILYA 4K4ZA 1JLFA 4U6PA 3CJ0A 2RKIB 4IRKA 1C0UB 4J9NA 2IBKA 3M9NB 1LWFA 4NLSA 3DOKA 4IG3A 3KK3B 4IDKA 2BRLA 5T14A 4ED1A 4ED8A 3GILA 2BE2B 2IJFA 2R8JA 3H59A 2JEIA 2J6UA 3EPGA 3TAMB 1RT5A 4IR9A 4RNFA 2IM0A 4ED3A 3I5AA 2XGPA 2D3UA 2WK4A 4HKQA 1LWFB 3IN5A 1TL3A 3DOKB 4IG3B 4ECYA 4NLPA 1TP7A 4IDKB 3CJ4A 3D28A 2V0NA 3MEDA 4NCGA 4RW6A 3IRXA 5KFDA 1RT5B 4IQXA 3DRSA 3E01A 3G6YA 4KE5A 3KK2A 4R8UA 2VA3A 3CJ3A 2V4QA 1TL3B 1IKVA 3MFHA 4EYIB 2C2RA 2FVCA 2R8KA 1JLBA 4IH7A 1HPZA 3KHLA 3MEDB 3BR9A 4QWCA 4NCGB 4RW6B 3IRXB 4TN2A 3H4BA 3DRSB 1SH0A 3E01B 5DG7A 2ATLA 4R8UB 3KK2B 1FKOA 4ZPBA 1RAJA 3M9OB 2AGPA 1JLEA 4QW9A 3SFGA 3H5YA 1NHVA 5DGAA 1RTDA 1IKVB 4ZP6A 1N56A 2FLLA 2AGOA 4MK7A 4KHRA 1HPZB 1REVA 1KHWA 5FDLB 4O3PA 2HNZA 1RTHA 5K14A 4IFVA 1MU2A 4ZPCA 3OL6A 1S9EB 1NHUA 4H54A 2YNFA 1FKOB 1HYSA 4JUZA 3SFUA 4GC7A 3FQLA 1JLEB 4WFXA 5J2NA 5KT3A 2JEGA 2W9BA 1RTDB 3HVWA 3T1AA 4ZPDA 5KFZA 1JLQA 3ISNC 1EP4A 1ZTTA 5KFCA 1REVB 2HNDA 3PJXA 4WZQA 2HNZB 1RTHB 5K14B 1DTTB 1JLAA 1MU2B 4IFVB 2AU0A 3HHKA 2YNFB 1HYSB 4KHMA 4J9OA 5J2NB 1RT2A 3M9MB 2W9BB 4NLTA 3PW0A 1VRUA 1JLQB 3DM2A 1EP4B 4WXOA 5KFMA 2HNDB 3MTKA 4K4YA 1S97A 1N6QA 2IJNA 1S6QB 3ICLA 3GV5B 3KLIA 5HROB 2JC0A 3KJVA 3DLEB 4FS2A 3OLBA 4R5PA 2R8GA 1RT2B 1TKTB 4JV2A 2VA2A 3BSCA 4MK9A 5KT2A 1Z4UA 1VRUB 5DLGA 4Q43A 3DM2B 4ID5B 2FLPA 1N6QB 1S1VA 4ECZA 3KLIB 3KJVB 1S0MA 1JX4A 1S1TA 2IM3A 4WFZA 5J2PA 4KBIA 4J9LA 4R5PB 4K4SA 3BGRA 2BQ3A 3G86A 3C6TA 3MR2A 4HYKA 3NGDA 1K1SA 3BSOA 1QE1A 2HNYA 4KSEB 3NL0A 4EO6A 2C22A 1T05A 1S1VB 4NLXA 5F8LA 2C2DA 4WFYA 4ZVHA 5DG9A 4O4RA 3H98A 5DG8A 5DQHA 1S1TB 3CIZA 2WTFA 5J2PB 4XPEA 1IKXA 1IM4A 1RYSA 4ECWA 3NMAA 3BGRB 3UPFA 3I0RA 3C6TB 4I7FA 3I5CA 4O3RA 3OLAA 4Y2AA 4RNHA 4O3SA 1QE1B 1TKZB 2HNYB 5CYMA 2UVVA 4H4MA 2R2TA 3HVAA 4DL2A 4O44A 2E9RX 4NLYA 4ED6A 1IKXB 4MKBA 3KLVA 4NLRA 4J9PA 3BREA 2CKWA 4RUAA 3OL9A 5KFUA 3I0RB 3LP0A 2JEFA 4I7FB 3ITHA 1XR6A 3I0SB 3G6VA 4H4OA 4IRCA 5CYMB 4XPCA 3DI6A 3UQSA 4H4MB 5F9LA 4ED0A 1C0UA 4O44B 2RDIA 2YNGA 4G3IA 3IS9A 1C0TA 1LWCA 4DG1A 4J9SA 4WXWA 3RB6A 2W9CB 4ECVA 3HVTA 5KFYA 4TYBA 3LP0B 1FK9A 3UDLA 3MR6A 1N48A 3ITHB 3GV7B 2IC3A 3TAMA 4H4OB 5J2QB 1S1XA 1VRTA 3DI6B 2ASJA 4IRDA 4RW8A 2QE5A 2W7OA 2YNGB 3IS9B 1C0TB 1LWCB 4DG1B 4YP3A 2R8HA 4QWBA 4K4XA 3HVTB 4LSLA 4JV0A 3PW7A 1S6PA 5J2MA 2ASDA 1FK9B 2VG6A 4IOBA 4LQ9A 1JXLA 2UVWA 2IC3B 5EWFA 3MEEA 1S1XB 1VRTB 4QW8A 5JXSA 4K50A 4RW8B 5KFHA 2ZD1A 5KFEA 4TLRA 5CYQA 5DQGA 3VQSA 4YMEA 2WRMA 3LALA 3Q8QB 3V6JA 3DMJA 2UVUA 4EBEA 4LSLB 3V6HA 1S6PB 3DOLA 5J2MB 2VG6B 4NLUA 3RB4A 5KFAA 4K4UA 5KT4A 3M8PA 3MEEB 2WCXA 1RA7A 4Y34A 2ZD1B 2VG5A 5D3GA 3GIMA 4LSNA 1IKWA 5CYQB 3LP2A 3LANA 3DMJB 3DOLB 3FFIA 4YR3A 3GV8B 4ZVGA 1HQUA 4WE1A 3Q8PB 5FDLA 3M8PB 2WONA 4O4GA 4G1QA 1S9EA 3BQ0A 2VG5B 5D3GB 4LSNB 2GC8A 1IKWB 3CDUA 4URQU 3EPIA 3RAXA 2YNIB 3LP2B 3KHRA 5C42A 1JIHA 4EO8A 4IH6A 4GC6A 3V6KA 3FFIB 1K1QA 2JEJA 1HQUB 4WE1B 3V6DA 5KG2A 3PVXA 3QGHA 4TY8A 1DTTA 2XGQA 3RAQA 3KNAA 2WONB 4O4GB 4ZHRA 4G1QB 4NRTA 2AQ4A 5C42B 4ECUA 4Y2CA 1N5YA 4I2QA 4ECSA 5KFOA 3V6DB 5J1EA 4TY8B 1S6QA 3C6UA 4F50A 5HROA 4ZHRB 3DLEA 3KMSA 5EUHA 5F8HA 5F8JA 4M95A 5KFBA 3ISND 1TKTA 2O5DA 3OHAA 5I42B 2W8LA 4WYWA 3NKYA 2DPJA 1RT6A 1N5YB 4I2QB 4ID5A 3FSIA 3OL8A 1D0EA 4KB7A 5EWGA 5EWEA 2OPPA 5J1EB 3C6UB 4NYZA 3N6LA 1KLMA 1XR5A 2OPSA 5KFRA 2FJWA 4K4VA 2QV6A 4F4WA 1UWBA 2AGQA 3IGNA 1TKXB 1JLCA 1RT6B 4O3QA 4I2PB 1NNDA 1S9GB 4WYLA 4DEZA 4X2BA 2FVRA 3V81A 3T5LA 2IM1A 2OPPB 3T19A 4IFYB 2HWIA 4DL5A 3DLGA 2XC9A 3IG1A 3RB0A 1KLMB 3Q8RB 1HNIA 2OPSB 1RTJA 4ICLA 1BQMA 2XCAA 2OH2A 3IGVA 4LQ3A 4ZVEA 1UWBB 1R0AA 3QIPA 3NBPA 3KLHB 3PHEA 5KFTA 1JLCB 4TQRA 2XCPA 2IM2A 1TKZA 3V81B 1FKPA 3G6XA 5KFWA 4WZMA 3DLGB 2D3ZA 3IG1B 3QGGA 3GQCA 3QLHA 5L9XA 1HNIB 4NZ0A 2RDJA 1RTJB 4J9QA 4ICLB 1BQMB 4DL4A 4Q45A 1R0AB 3QIPB 3NBPB 2HWHA 1SH2A 4XO0A 5KFIA 2JLEA 3I0SA 4NLQA 4RZRA 2JC1A 4KV8A 2GIQA 4PWDA 3N6MA 1FKPB 2GIRA 1TVRB 2AX1A 2C2EA 2D7SA 1GX5A 2OPRA 5HLFB 1JLGA 4RW7B 3QLHB 2ILZA 2WOMA 1EETA 3V4IA 1C1BA 5I3UA 4PQUA 3CDEA 5KFQA 2W9CA 4Q8EA 3MR3A 4MFBA 3T5HA 3H5XA 4TYAA 4DL3A 1RT4A 4KV8B 1SH3A 3UR0A 5J2QA 4PWDB 1RA6A 5C5JA 3CJ2A 4RNOA 2W8KA 5KG7A 3LAMA 3H40A 3JSMB 2OPRB 4RNNA 1JLGB 1MMLA 4O3OA 1S1UA 3PJWA 2WOMB 1EETB 5I3UB 1C1BB 2YKMA 3V4IB 4PQUB 5KG4A 5KG0A 2HMIB 5KFFA 2UVRA 2ZKUA 4MFBB 4FBUA 3LAKA 5DQIA 3BJYA 3MR5A 2BQUA 1ZTWA 1QUVA 1RT4B 4TY9A 4RU9A 4ECTA 2UUWA 1IKYA 1QAIA 5KG3A 4U7CA 1S1UB 2E9ZA 2YKMB 3NAHA 1RDRA 1S1WB 3MFIA 4KAIA 3FRZA 4NLVA 4URSA 1S0OA 4NLOA 2WB4A 1IKYB 3JYTA 5F8GA 1C1CA 3TQ1A 1T03A 1T3NA 5KT5A 1BQNA 1HQEA 2HAIA 3KLGA 5KFKA 1QAJA 2E9TA 3H4DA 5JUMA 4EYHB 4DL7A 4QWDA 1W25A 3TVKA 3KK1A 4MH8A 5KFSA 3JYTB 2FJVA 4ED7A 1WNEA 3QGIA 2YNIA 1C1CB 1RT1B 2F8EX 5KFNA 2W7PA 1T03B 3RBEA 1BQNB 3OL7A 1HQEB 3KLGB 2RF2A 2J6SA 4MK8A 4F4ZA 1JLFB 1C2PA 1U09A 3PW2A 2AX0A 4TQSA 3EZUA 1JKHA 5L1LA 4ZP7A 3KK1B 2EC0A 2R8IA 2YNHA 3H5SA 3H5UA 3LP1A 5L1IA 1S4FA 4B3OA 4O3NA 5KG1A 2RF2B 4IG0A 5HBMA 3BQ1A 2OPQA 1S10A 3NAIA 5F8NA 1KHVA 3QYYA 2BANA 3OSPA 1JKHB 4OL8A 5KFGA 4EBCA 2XWYA 4TXSA 3SI8A 3KMQA 2YNHB 1ZETA 3LP1B 5I42A 4FBTA 4B3OB 2FLNA 4IG0B 5HBMB 5DGBA 4J9RA 1LWEA 2OPQB 4ECRA 5KG5A 4PUOA 2BANB 2IAJA 3DRPA 2FVSA 3MEGA 2B5JA 1TQLA 4YR0A 4ED2A 1S0NA 1XR7A 2D41A 4K4TA 1JLBB 2R2UA 4RNMA 3GIIA 3BQ2A 1TKXA 1I6JA 1LW0A 4I2PA 1S9GA 1LWEB 3FQKA 1S9FA 2VG7A 4PUOB 3DRPB 2IAJB 4IFYA 4ZVFA 1S48A 1HNVA 3MEGB 3T5JA 2FVQA 2R2RA 3Q8SB 3KHHA 5C24A 2B5JB 1RT3A 5KFVA 3PR5B 2J6TA 2YKNA 2V4RA 1SUQA 3CO9A 4RW4A 4YR2A 4MIBA 4ZPAA 4YQWA 4R0EA 3GIKA 1S49A 3KLHA 5F9NA 3T5KA 1LW0B 3FDSA 5EDWA 3QO9A 2VG7B 5KFLA 4ECXA 1SV5A 1HNVB 2I5JA 5L1JA 5C24B 3CVKA 1RT3B 4EEYA 4Y3CA 2YKNB 1J5OA 4EBDA 1SUQB
chains in the Genus database with same CATH superfamily
4DSJA 5ETRA 3QO9B 1LW2A 1TVRA 1YSJA 2XMAA 3MM9A 1T11A 2CVEA 3EGZA 3KLFB 2OI2A 1WEZA 3KOAA 4RW9A 3TEGA 3ENAA 1DTQB 4YDDB 4X62J 1LQ9A 2QZ8A 2CZ4A 3L9ZA 2XI2A 3HI9A 2FHMA 2OP5A 2R7QA 4A47A 2B6AB 3DRRA 1H98A 5GAHI 4K4WA 1DARA 1SL1A 3QZ7A 4DQPA 3NP5A 3MECB 1HWLA 3DYAB 5HMXA 1FDAA 4OZNA 2MHEA 1PYOB 4F3OA 2JEIA 5CD4H 2V69A 2XGPA 2E66A 3RUBL 4HKQA 3R1LA 2MQMA 3DRSA 1RWOB 1HI8A 2FC9A 4GVBA 2R8KA 5D8HB 2L3MA 1FFWB 1Y3JA 3MM8A 3B54A 1DZ5A 1KHWA 2FLOA 1IN0A 1MU2A 2XMUA 3BGLA 3PIPQ 2W9BA 2I6WA 5M2UA 4TU9A 1REVB 2VICA 4DF8A 4B9LA 5HVFA 5HQ8A 2O1PA 3W2VA 2QSFA 4GMKA 3CJ8A 5IT9Y 1V6HA 9ATCB 2IYGA 1KBRA 3I9V9 1DQ9A 1Z4UA 5DLGA 4L6V3 1FXDA 3KLIB 1S1TA 2Y1IA 2ZBQA 3RRKA 2BQ3A 3G86A 3TARA 2Z0GA 3MAAB 2MKYA 2CPJA 3US5A 1IKXA 3EXCX 4PXDA 3WIUA 3KLVA 3CD6S 1YKWA 1KS2A 4C8YA 2KYZA 4DV4J 1MWQA 4LF8J 3RAMA 1WKJA 1T7PA 3ITHB 1N5SA 3VVTA 1Q8LA 2J9CA 1S6PA 5JXSA 4TLRA 1U0HB 3DMJA 4DU8A 2VG6B 3TX8A 3MEEB 1J27A 1PJ6A 1UZHA 1WACA 1LNQA 3M8YA 4FYWB 1T9UA 3BQ0A 1KFSA 2DH9A 4QR0A 3OXFA 4K0KF 4IH6A 3FFIB 2IVYA 4K59A 3UO0A 4O4GB 5HO4A 4ZHRA 1HD1A 3EXYA 2JX2A 2WVDA 2ZJRQ 1CJTA 2XMWA 4OX9J 1TKTA 2O5DA 1OY6A 3D6HB 2BJEA 3K89A 4G65A 5KAKA 3HHLD 4I2PB 3M8RA 2ZBRA 3I82A 4ICLA 3MZIA 1MROB 3AH6A 3QIPA 2V8VA 4DFJA 1Q5VA 2HWHA 5LMUJ 4PXEA 3I0SA 1YJUA 3N6MA 2NUUG 1RCXB 4Q8EA 4L76A 1G7CB 4B08A 4NWBA 3H2UB 4KV8B 5C5JA 2CDRB 4RNOA 1YITS 3HPOA 3WC2A 2R7RA 3IWNC 1RT4B 1TL4A 4PWWA 1H38A 2GVZB 1KQKA 2GQQA 2OTLS 2PGCA 2HZCA 1K0TA 2HHWA 1RSCA 1U7LA 3NWGA 3L3CA 2VU5A 2HAIA 1YIJS 4YB7A 3C66A 3TVKA 1HW9A 3KJFB 4QR1A 1PYSB 3PW2A 4BBYA 3GSIA 2V2VA 3M1VA 3M05A 3R5BA 1CLFA 1X5SA 3LP1A 3T1HJ 5HBMA 3ZZZA 3AOAA 1QUPA 4HHHA 1IBKF 1N32J 4CCHA 2HLTA 4USMA 4X4QA 3TJ9A 3WZ0A 4P9SA 2EWHA 2FY1A 2GCFA 1IXKA 1GXTA 3CO9A 4MIBA 4ZDNA 1FFSB 3PACA 1NSPA 1Y7PA 3CVKA 3W7BA 3TWZA 4F67A 4PKDB 1F3FA 4JI8J 1YZ6A 3K0JA 1DLOA 1ZM9A 1X0PA 2BE9B 2FJXA 3DLKB 4RR5A 1RWKB 1B70B 1TL1A 1YBAA 4JI4J 4Q0BA 2KT3A 1FO1A 5DM7Q 3ET6B 3RBZA 1ZPVA 2NPIA 1TK0A 5C2CA 2HFVA 3AFGA 3PW4A 2BA9A 2A2DA 1NXIA 4NEYA 1BMQB 3GJQB 3KLEB 2XZDB 2YWGA 4F7VA 1Q1KA 3QIDA 5IWAF 3M2RB 5IT0A 4U6PA 3CJ0A 1C0UB 3M9NB 1LWFA 3KDNA 2AJQA 3KK3B 4I67A 5AXMA 3N9UC 1NBEB 4ECYA 4ERDA 4V1Ak 3AD7C 1TL3B 1IKVA 3Q22A 4EYIB 4IH7A 4TN2A 5IQ6A 3E01B 1M1KT 3EGWB 2LEPA 5ETMA 2AJ2A 3C14A 5K14A 4ZPCA 3BEGB 3I4HX 1S9EB 2EFGA 4WFXA 2HNDA 4WZQA 5CCLA 3HHKA 2F5GA 4Y00A 4RU2A 2PE8A 5HROB 2R4FA 1S6OA 3HT0A 3CXCR 4M5MA 2HRUA 3MCSA 4MAKA 3KJVB 1QD1A 3BGRA 1T9TA 4LR7A 2C22A 5F8LA 2F65A 3UNGC 2O66A 4UOCA 1NDPA 4UZBA 2WVCA 3TA1A 2HNYB 4JP8A 3P8BB 2KJWA 1WWHA 4WK1A 2C3PA 2CG4A 3G6VA 5EGYA 3UQSA 2KDOA 3CTRA 1FFGB 3KUHA 3SQGA 2MKKA 3UDLA 3MR6A 2IC3A 1CULB 3CCQS 3DNCA 4Y0FA 4CLKA 1Q7LB 2MQQA 5CCMA 3NOGA 5LSRA 4EFAC 3Q8QB 4NASA 1XBWA 2JSXA 5KFAA 1REGX 5D0HA 2QFIA 2XG8A 3DDNA 3M8PB 2UP1A 3PXGa 2P9EA 2ALYB 2VG5B 5D3GB 1LWXA 3HHEA 4KH1B 3SCJE 4X4SA 4HEA9 3V6DA 1D09B 1RWMB 1UW9A 3KNAA 2WONB 3K2YA 1D9AA 4ECSA 2YQ0A 5T7LA 3ISND 4OHVA 2E5HA 1LFPA 1UTAA 1TFYA 4ELUA 1VQPS 2IDLA 3DLGA 1CJUA 3EGVA 3HO1A 4WZMA 3IG1B 1YRXA 2RDJA 1RTJB 1H2TZ 2JC1A 4YHHF 1FKPB 3J80Y 1GXLA 3RR8A 3MPVA 3MR3A 3EVMA 3T5HA 1B0VA 1R3NA 4DL3A 4BWMA 1IR2A 4PPDA 5AJ3F 1X9SA 4AL5A 4FP9A 4CO2A 2EEYA 4FXDA 1U1NA 3HT3A 2FJDB 1T02A 2UV8G 1X8DA 2OGUA 2P2CB 4DFMA 2KFZA 2VBZA 5HVGA 2E9TA 2RU3A 2BYCA 2GV1A 2ZZTA 1KLNA 3C46A 1U1LA 4ZLPA 1N0UA 4Q5VA 3OFFA 1JKHA 4FKYA 2E7VA 2YNHA 1JJ4A 2GHPA 5L1IA 2LU1A 4CLLA 4IG0A 1Q95G 2FJAB 4CO5A 3SMZA 2E44A 1HBOA 2B9XA 3AJDA 4DR7J 4CRJA 4EGLA 1LWEA 2V5HG 3W63A 3Q23A 3CEDA 1YQHA 1TQLA 4ED2A 4B9SA 3DLBA 2IAJB 2GS8A 2K1RB 2V4RA 2C42A 2DR9A 3KLHA 5F9NA 3QO9A 4X64J 2RS8A 1PSDA 2N7CA 2M8HA 2Q6CA 3M6VA 4RW4B 3KLFA 3PJ9A 3LO3A 4B9MA 3GJRB 1R8CA 4MYTA 2RAQA 4CTAB 1DTQA 4LF4F 1RHUB 1F1BB 2VPXB 3K7RA 2BZ2A 4W4MA 4DOZA 1UVJA 3QQCD 2NREA 2WHOA 1L5UA 3M8QB 3D0HE 4QWAA 2B6AA 1KTVA 5DLFA 2GFFA 4TKTA 1T05B 3MECA 2WVBA 1WOPA 3UVJB 4FKXA 3DYAA 2OMLA 2AMCB 4QWEA 2LXIA 4YFUA 3TUIC 4K2XA 1B7YB 1PO6A 1JNRB 1RXOB 4L73A 1NB2A 1LK5A 3H59A 1DFDA 3W65A 3B82A 2OD6A 3OTOJ 2L9WA 2CPYA 2BW7A 2C3UA 3EJMA 3CCRS 1RWXB 3MMAB 3DLLQ 1PCAA 1GNKA 2G1HA 2M5YA 2K7KA 3KK2B 5LXYA 3NMRA 3SFGA 1M5PC 1REVA 3OL6A 5CABA 1FKOB 2JEGA 3FQLA 2FHJA 2H4WB 1YI2S 2EBGA 5AE1A 3TYTA 3G2XA 3CDBA 3GYXB 4PR6A 2OD4A 2OMOA 1S6QB 1VBXA 3KLIA 4OYBA 2J9DE 2EKNA 2UUCJ 1SKSA 1S79A 1DAXA 4Q43A 3CCTA 2M8DB 1U26A 4P7VA 3MAAA 3VGUA 2WBMA 4AXJA 1FE0A 1VQ7S 4HYKA 2OHDA 1OIAA 3NL0A 5DG9A 1XIQA 5J2PB 4YY3J 1A9NB 2MJUA 5AJ3J 2NXCA 3E3XA 1FXRA 2IRYA 4LFAF 3ITHA 3VZIA 3G8SA 1U1MA 1UWAA 4UQGA 1HA1A 3GV7B 3TAMA 5J2QB 5H9EK 4QPTA 1U0HA 4ILMA 1NKEA 2K8GA 1K8AT 2VG6A 4LQ9A 4DDFA 3MEEA 3EVOA 2LQ9A 2DGTA 4ES1A 4JI5F 1YDLA 3SXLA 2UVUA 4NZ7A 2QN6B 1N0VC 4Z7YA 2HG4A 3FFIA 4QU7A 1J5EF 1VQ8S 4O4GA 4ZVRB 5K5MA 3HD2A 4LF6J 1HQUB 2QLBB 2IVMA 4NRTA 2Y1JA 2B51A 4KHPF 2OAUA 7FD1A 3K8WA 3GYGA 1HBNB 3SEOA 3KMSA 3HHLB 4NA2A 3HSDA 4DV6F 1R6YA 3NCRA 3JSRA 3V2UC 5KFRA 4WWSA 1MROA 2LFVA 2VQFF 2V50A 3K5OA 2F1FA 3RB0A 3KG1A 3KYLA 2M2BA 4S0MA 1JLCB 2V94A 1JXVA 2D3ZA 2Q79A 3QGGA 1XJWB 1UVMA 3ONQA 1O6XA 2ZH3A 4KV8A 3HHNB 3NGSA 3K59A 1NRKA 3M6WA 2RRNA 4C4WA 1S72S 2O01C 1RT4A 2W8KA 3LAMA 1UW4A 2GVZA 1JLGB 4OQJA 4FBUA 2DHSA 3LAKA 1VQOS 2GQ2A 3QGPA 2HVIA 1LXNA 1I94F 2MKJA 1GTHA 5SUHA 3A8IA 2XMMA 5D4OA 4HTJA 1C2PA 4JV5F 5BJRA 3EZUA 3GONA 2ZH7A 1YBTA 3NAIA 1H3DA 4CDIA 5HQLA 2DNPA 2FLNA 1BWEA 4P2FA 1FT8A 1EQMA 2FVSA 1WF2A 2R3VA 1FXLA 1S9GA 4DR2F 5B0FA 3T5JA 4HT7A 2YX4A 3THVA 1LW0B 2ZH5A 4V19J 4OYZA 1EKSA 4TVAB 4B9NA 3DLKA 1CS4B 1N4LA 2AV5A 1TMJA 3ILOA 2LCWA 4J9MA 2XHWA 4RLEA 2DYAA 2LU2A 5B0BA 3M32A 1RYRA 2IVFB 2CNLB 3ET6A 4MIAA 2Q1LA 1RAIB 4JV1A 1KRPA 3CCZA 4XDCA 3AODA 5D0EA 4QYRA 3SCIE 1HWJA 3H25A 4DSIA 2B8PA 1RHQB 3KLEA 4F4XA 3OSNA 4QPXA 1HI0P 4PG5A 2D3OR 3BBFA 2L48A 2H65B 3KK3A 2XYPB 4Z37A 2VPWB 3R8YA 2ILYA 1WOOA 2RKIB 5E3AA 4F0KA 3VAFA 5T14A 5FLXU 3HP6A 1J5EJ 1TL3A 3RJMB 2ROGA 4IQXA 3E01A 4ED5A 3D1OA 4LF9F 1MSWD 3PYFA 1Q4RA 3KHLA 4WK3A 1AUSL 1UFLA 2YWFA 3ZZTA 3I96A 3H4BA 4NA1A 4R8UB 1UA0A 3R7NB 1R0CB 4LR9A 4F4AA 1F5BA 2ABYA 3PG9A 5KT3A 3A13A 3EE3A 3T1AA 1Y5LB 4BWJA 3GTYX 1GAOA 1NSKL 2JH3A 1AT1B 4PRFA 1VDHA 3KJVA 4FS2A 1KVIA 4X84A 3RGIA 2FLPA 4A8KA 4E8UA 3GFZA 4X4OA 3G96A 3QWUA 5CQGA 3NGDA 4LFCJ 2HNYA 2F9DA 4ZVPB 4XPEA 3PX6A 1FVQA 4PAAA 4OI3A 3UDCA 2XB2D 4DJBA 2HGNA 3C16B 1TAQA 5KFUA 3FCVA 4M5LA 4ED0A 4XPCA 1CULA 2Q3PA 2MSSA 2XLKA 4WXWA 2W9CB 4C8LA 4DV7F 2DRDA 4F8RA 3IS9B 1C0TB 2MKHA 4JV0A 1Q5YA 1CG2A 3LW5C 4A8FA 1B64A 3D7SB 5J2MB 3M8PA 2VG5A 5D3GA 1SKWA 3GV8B 3RRGA 4YDXA 3Q8PB 3W66A 3IAS9 3P49B 3M6UA 4RUHA 2WONA 2HSEB 3HJFA 4DR1F 1N33J 2VFVA 1K73T 2NS1B 4GC6A 1WC1A 4DUZF 3RW6A 4DR2J 2VQEJ 5C42B 2ZJPQ 4Y2CA 3J81Y 4C8NA 5KFBA 3D6MB 3MOZA 1LEOA 5I42B 1GMWD 4ID5A 3UCGA 4KB7A 3QAUA 4LIWA 1RCOB 3SSRA 4J90A 4IOCQ 5LT5A 4AYBD 4YN3B 2D9OA 4JBCA 3WIVA 1R0BG 2PI4A 3IG1A 3U1NA 1KLMB 1RTJA 3FNNA 3PHEA 2XCPA 1FKPA 2V2KA 1UCNA 3BO4A 2CQBA 1HBUA 3EZOA 4Q45A 2CQIA 5KFIA 3I87A 4XO0A 1WSVA 4LF7F 2GIRA 2YTCA 2LDIA 5IV4A 4GKJJ 2DNLA 1ZA1B 4O3OA 5I3UB 5SZTA 4X66J 5B08A 2YKAA 2ZBPA 1Q53A 2YKMB 1WTBA 4NLVA 4FZVA 5DO2A 3JAMU 4LBIA 2WB4A 2CQDA 2JJ4D 5U47A 2ZOMA 1U49A 2IIHA 2MZRA 1QAJA 3H4DA 1G1XA 2RUGA 2CNNB 2GZOA 2N3OA 2CPFA 3K5MA 2M70A 3KUEA 2K3IA 1WHXA 2XWXA 5D78A 2R8IA 4OYMA 2VL1A 1O0PA 2MQ8A 3R97A 8RUCA 2XLIA 3F44A 2HAFA 2OPQB 2IAJA 2CNOB 2FDNA 1SPBP 1HNXF 1XR7A 4ZS6A 5THWA 2K1RA 3EUNA 1BHNA 1TKXA 1I6JA 4TLQA 1VHFA 1S9FA 2CWXA 4PUOB 3UNYA 3Q8SB 3GPAA 4RW4A 1RTZA 1HBMB 4R0EA 2CNKB 2AEJA 4PG7A 4FVMA 5C24B 2AZ3A 3A3NB 1SUQB 2DISA 2L9DA 4CTAA 1FVSA 2VFUA 1KDNA 3CULA 2HHXA 1TTHB 1JNZB 3M8QA 3JSMA 4HL9A 3TW0A 4M1KA 4R25A 2KI2A 3DDIA 1S1WA 4NX9A 1S7HA 5L39A 4N8NA 1RJJA 5CA5A 3FUYA 4BDPA 4N41A 2UUTA 1EZZB 1FEHA 2ASLA 2XULA 1YJ7A 2VB6A 3DDKA 3MM5B 4FS1A 2PA8D 1IR1A 1JJCB 2NCKL 4C8MA 5A76A 1PIEA 3MUVP 3F56A 4OI1A 4ED1A 2R8JA 2J6UA 3EPGA 2WK4A 4DUYF 3MMAA 4N77A 4CP5A 2CAJA 1GT8A 3LGHA 2WSCC 1Q86T 3KK2A 1HNZF 4MTPA 1ULRA 3MFHA 3Q0AA 2YH1A 2Y1LB 1WDTA 3BR9A 3K8VA 2RQKA 3R1HA 1SJ4P 2B4PA 1R89A 1NZ8A 1FKOA 2PT0A 3ZTPA 1VIXA 5JVHQ 5FIIA 3RRHA 2AGOA 3VAJA 3GG1A 2J9EA 3IO1A 1R7IA 1JLEB 1RTDB 3HVWA 5KFZA 2WB1D 1KOHA 2XHCA 1AA1B 2KO1A 4NLTA 4HLBA 1EP4B 2JVOA 1SKRA 2RUSA 2QMUB 3W8GA 3ICLA 4PPZA 2W7AA 1VQKS 3BSCA 2DD8S 2F3JA 3DM2B 1VC6A 5A8KB 2B9YA 4Y2IA 5J2PA 5ETQA 5LJ5Y 2HS0A 4LF7J 2V2ZA 4W98A 4EZ6A 1UJ5A 2E5LJ 2PMHA 1YK9A 1RYSA 5CZXA 1NLKL 2C2MB 2UVVA 3HVAA 3SCKE 3BDEA 4KYZA 1NCLA 4QZVB 1QDUB 1F2HA 3D1HA 3IFEA 4C2MA 4A8MP 3DI6B 2P6SA 1LK7A 2HGLA 4K4XA 3ADAC 1PJ5A 2Z2MA 3ZZPA 2HBYB 3UDEA 3FCWA 4OJHA 1XMOJ 3LANA 1LFWA 3O5TB 1HQUA 1EHWA 4ETZA 3MM7A 2DKOB 4X4TA 3DXBA 4CLZA 3KG4A 2DEJA 2NSCA 4QIEA 1UFKA 2QG9B 1VJWA 3CC7S 4UF4A 1HBNA 3QT6A 2EG1A 2CDQA 3HHLA 5B7WA 2GX8A 3LGMA 3A8JA 4NI2B 4Y2MA 4U67Q 3I32A 1P8GA 3W9JA 3D9BA 2AGQA 3I9ZA 1JLCA 4DR3F 4ZITA 3OQ2A 3ZXWA 2IM1A 4IFYB 4GO5X 4DQRA 2XNQA 4DQIA 2R7VA 4L74A 2IM2A 4OV1A 4PQAA 3JTOA 2HRYA 3W60A 3MXHP 3CMES 2I38A 4OJ1A 2QL5B 3JTNA 3B4DA 1TVRB 1SC6A 2JLFA 1GX5A 1JLGA 5EX3A 3H5XA 4TYAA 2DNQA 3PTWA 2C3OA 3OUYB 4RNNA 3MDFA 1S99A 4F0HA 4ZA1A 2ZHBA 4C8OA 1MW7A 2ZUGA 5CZVA 4NXMJ 4ZPVR 3RTVA 4ZVQB 5F8GA 5AXNA 2KB2A 1CJVA 1GK8A 2DR6A 4GKKJ 3H20A 2H3EB 2X7IA 4JI2F 3T41A 4B3SJ 4ED7A 1P9YA 1FJ7A 3H5UA 4KGXB 3THTA 2RS2A 1SJQA 3ENQA 4K2JA 4AQYF 4FBTA 3CCWA 5DGBA 2DXFA 1FA0A 3CD7A 1IBLJ 5JJBA 1IJEB 1CQMA 2MQNA 1TL5A 4YR0A 1T8EA 3QRRA 2D41A 4ZLNA 3R6GB 1LW0A 2BX6A 3TOQA 3MEKA 2BOPA 3PM9A 2GNKA 2B5JB 5KFVA 1B3TA 3VHQA 2NZ4A 4DPXA 4YQWA 5D0RA 3D66A 5HJYA 4JI6F 1CS4A 2MYFA 1YJRA 3GIRA 3VGTA 1UL3A 5KFLA 3TNVA 1HQ2A 3HFVA 1I51B 4LF2A 4B9VA 3CWJA 2W4PA 4FNHA 2QFJA 4FYXB 3GIJA 1I1GA 1SV5B 4CO3A 2L9NA 3LPEA 4ZMMA 3PIOQ 2FHJD 4XAKA 2UUBJ 1NM2A 1Q82T 3BGOP 5C25B 2PD1A 4IR1A 1HIYA 2EVZA 2HVEA 4F36A 1SJFA 1GX6A 2R2SA 4DV1J 4Q44A 4QIVA 2DO0A 4WKRA 1NDKA 1H2UX 2ADCA 1HMVB 1NJXA 4ELVA 5IS2A 4KFBB 2UV8A 4WTOB 4NPOA 2KH9A 3MTJA 5LOQA 1SQFA 1CPZA 1EKRA 3PYDA 4EU0A 4PG6A 3ILJA 2RKIA 1NMEB 5KFJA 2HHHJ 3FEXB 3TAQA 1WKKA 1X5TA 1VBYA 2ZJQQ 5IC6B 2AF6A 1FJCA 3PO5A 4DPWA 4F26A 2MLZA 3AD8C 2DGSA 5A2QU 3CJ4A 3D28A 4R0JA 2Y3YA 4R8UA 2J0QD 1MWYA 4YOEA 2BVZA 1RK8A 3KTQA 2K06A 2YH0A 2QO3A 4PYDA 2QYCA 3IRWP 4ZCKA 5B0CA 1FD8A 1URNA 2RQCA 4NMLA 2GHVC 1Z2ZA 1OSCA 3A8KA 4KIAA 3CF5Q 3TAPA 4ZPDA 2L08A 1VBZA 4ZJQA 2QA4G 1JLAA 4IFVB 2AU0A 3W9IA 2YNFB 1HYSB 3CNQP 3FGVA 3PW0A 4LJMA 1KP6A 3GB0A 1CJTB 1GH8A 2JC0A 3LF0A 1TKTB 5H9FJ 2IJRA 1KEKA 1NKCA 2DRAA 1Q0NA 4WBFA 1U25A 5HK4A 1KD1T 3W1YC 1EJ7L 1VGYA 4LVOP 1VS3A 2FHOB 4EO6A 4NLXA 3DRYA 1WD6A 3C16A 1X60A 4P75A 1IM4A 2YXLA 3OT9A 3C19A 4BC7A 2G2ZA 1WHWA 4Y2AA 2DHAA 5E3RA 3UWTA 3LH2S 3I0SB 2HFSA 1HWIA 3IS9A 1C0TA 3RB6A 3MWBA 3LP0B 1N48A 1CC7A 2Y8YA 1NH8A 2W7OA 2YNGB 4DSEA 4JI2J 2QT7A 2ZVIA 5J2MA 1C4CA 1RE1B 3KNGA 3G82B 1VRTB 5DZ7A 4DV2J 2K3KA 4D3GA 2UXDF 3QJJA 2M52A 4C3MA 4LSLB 1OYDA 2R7WA 1VQ4S 4NL5A 2DXEA 1Y11A 2MY7A 4H4KA 4IOAQ 1F9EB 3UDVA 2GC8A 4ES2A 1RBOB 5C42A 3QT7A 1DTTA 3J7YU 4G1QB 3M1VB 1IQZA 4UZCA 1UVNA 2HS4A 4J9UE 3CT9A 3FEZA 3DLEA 5EUHA 4ILRA 1VQYA 1D9FA 1KLMA 3R7SB 1FJGF 2C1EB 2HS3A 1Q79A 7FDRA 3VAIA 3IGVA 5BYSA 2V8HA 2FUG9 1I5OB 3MOJB 4BCAA 1RHMB 1JQGA 1U45A 5I3QA 2Q66A 3H7HB 2CWKA 1IBMF 2A2CA 1OJ4A 3EM1A 1Z1ZA 1K0VA 2J0SD 2R7OA 2VBXA 1YX2A 5I3UA 1F5CA 3MHYA 4U8VA 3QAEA 3CO0P 3V4IB 3NS5A 2YKMA 3IM9A 3HZEA 2IA0A 4TY9A 1UZDA 3BO2A 3S01A 3G9CA 3FRZA 2KKHA 2Y8WA 4ZLJA 2CQPA 1IKYB 3CC2S 4OZ0A 4ZLLA 2EFNA 4MH8A 2KFYA 1WNEA 4G1IA 2CQ0A 1C1CB 1WC6A 1U8WA 3IR5B 2CJAA 2AX0A 1XNRF 3KK1B 1DQAA 5GADU 2OPQA 1R8PA 1GMVA 2QL9B 3W3SA 1B7FA 1FDBA 4JYAJ 2P8IA 4DPOA 1TELA 4ECRA 1EX8A 4PUOA 1X4AA 2RILA 1S0NA 1HBMA 3AOBA 5C24A 1VIOA 3AQPA 1SUQA 3GJTB 4DR5F 1G4CA 3OBIA 2P9GA 2G0IA 2YKNB 1XNQJ 4DV3F 3X1LB 4ZN3A 4FYVB 4B9TA 1TAUA 2I5JB 4RW7A 1J2VA 1S5ZA 2VKRA 1M1HA 2ALZA 2VH7A 1RLDA 3BH6B 2JOQA 1YTYA 5AXLA 5IOLA 4DMZA 4M94A 3KHGA 5KFXA 5D4NA 2IMWP 4U7UD 4NRUA 2G0JA 5KTQA 4C48A 4KKOB 1X4GA 4KO0B 3AJ1A 4L72B 3DKDA 3MM5A 1NK6A 2KT5A 3F41A 3IMQJ 4X62F 3DLJA 2V2QA 1WHYA 2A6OA 1T94A 2XYGB 4QJVA 1UPMB 1UMJA 2KVQE 2HFUA 5JVGQ 2FC8A 2PMWA 4RNFA 3CE8A 2XBPA 2IDEA 2FGOA 4IDKB 2V0NA 2KVIA 3NGKA 2ASYA 2ROPA 3PKYA 1BC6A 1I3OB 4ANDA 4ZK7M 2C2RA 1JLBA 3PV8A 4RW6B 4ZPBA 1NPRA 1JLEA 5DGAA 1RTDA 2ZOGA 1GXUA 1HHQA 4F02A 1T9XA 4JUZA 4JI3J 2VC1A 3TO8A 2CPZA 2HRTA 4JI0J 1EP4A 2DH7A 3NNCA 4AUKA 1FJGJ 4LFBJ 4DL0C 1X5OA 1Y3KA 3MMJA 4I69A 3DM2A 2IFXA 5A8KA 3D4JA 1U6BA 4UQTA 1RT2B 3BYPA 3GR0A 4MK9A 1FTRA 3PCOB 4ZVTB 1TUVA 2H5EA 2C2OB 1IBMJ 3TP2A 4Y2KA 1VI7A 4R5PB 4FF3A 3P45B 3BDPA 1KTQA 2MQLA 2PA3A 1R8AA 1CJUB 4ECWA 4ER8A 2Y9HA 2VDHA 2MQPA 3QFWA 1RADB 1FWLA 4NLYA 4MKBA 3BREA 2CKWA 1XR6A 1NU4A 3DI6A 3BR8A 2F8HA 3ZNUA 1M5HA 5KFYA 4TYBA 2LKZA 4NMXA 1QVFR 3X3UA 2VFSA 1KC8T 4DX6A 1VQNS 2HQGA 4GRSA 4X65J 2HBZB 1FK9B 4IOBA 4DV4F 2UVWA 4LF8F 1IR0A 5KFEA 1DHMA 4YMEA 5RUBA 3NOCA 4EBEA 4NLUA 1H0HB 4DV0J 5GMKa 2ZD1B 5CYQB 1KSPA 2F4VJ 1UETA 3IP0A 3LWLA 3GLJA 3KXDA 4JI1F 4F0MA 4LSNB 4CWBA 1SB6A 2DY9A 3V6KA 5KG2A 1TL7A 4OMFG 2CJYB 4NI2A 5KFOA 1N5VA 1U1QA 3EYZA 2BJ9A 1NDCA 1XMQJ 1X7VA 5EWGA 2PC6A 3CCES 3C6UB 1KQSR 1HR0J 3HHDA 4EWTA 4CM2A 2VPYB 1SC1B 1X4HA 4OX9F 3IBFB 1A6LA 2DGQA 3N5BA 4OX6A 3KLHB 3MCMA 4DPYA 4AE5A 1HNIB 3O6QA 3HFKA 1RWNB 3NBPB 1SH2A 1VC0A 5HQMA 3OUYA 1U0SA 4BHQA 2EK1A 4I6YA 2Z30B 2WVFA 2OPRB 3KDOA 5LMUF 5DM6Q 2WOMB 1EETB 1ZBTA 5KFFA 3NRBA 1YJTA 5DQIA 1QUVA 2QLFB 3PEHA 1QAIA 1XC9A 3RR7A 2NZCA 4BS2A 1Y00A 3BF4A 4IYQA 4K5RA 3Q8YA 5E3PA 4U95A 2P6TA 1Q8IA 2ZKTA 3HM9A 1T3NA 2F63A 2OTJS 3SDEB 2HQDA 4QWDA 2KXFA 2H1YA 2FB0A 1B4SA 4ZP7A 2EC0A 3H5SA 1U4BA 2BM1A 1Y9OA 1VFJA 2ZC4A 1ZM3A 3BQ1A 3K58A 2E1CA 3QJLA 3D54A 4DSLA 3TI0A 4B3OB 3VR1A 4LMZA 4QIFA 2GO9A 1KVKA 2KT2A 2B5JA 4NE9C 3T1HF 4NEZA 4L75A 2VBYA 3GIIA 2EPIA 2N7YA 1N32F 2M7SA 1RWWB 5LL6d 1TR0A 2W2NP 1SV5A 5T41A 4Y3CA 4EBDA 1X4BA 1RWPB 5L38A 2E7WA 1V3ZA 4DS4A 2MZQA 2HLUA 1CSJA 1D1UA 5C25A 1J5OB 4E2FB 2D3O1 1TV6B 4Y6IA 1Q8KA 3SBMA 3BSAA 2B4UA 4JI8F 1FWPA 2XZTB 1HMVA 4ECQA 4KFBA 3BKFA 3ILLA 1U6ZA 2QIFA 1SQGA 2MY8A 1FX2A 2QSWA 1ZZFA 4A8OA 4JI4F 5LMNJ 2MZ1A 1FDDA 1NK7A 2B3TB 5HP1B 3G8TA 1QSSA 2JWNA 3MMCB 1FERA 3GU0A 2D74B 1BGXT 3TVZA 3R2DJ 3KKFA 4F2SA 3PYEA 2BM0A 2ACMA 5B0EA 3TAMB 1WG5A 2XM3A 3QJPA 4IG3B 1B0PA 2QYGA 4JI1J 7AT1B 2ERRA 5E3QA 4XTTA 3R27A 2V4QA 1W26A 5LXRA 4NYOA 2LQ8A 1QVGR 4QR2A 2AYBA 1NHVA 2UXCJ 4P2XA 1M5SA 4IFVA 4USTA 2YNFA 1HYSA 5DRKA 4GC7A 4WU3A 3NLCA 5KFCA 3PJXA 1DURA 1S76D 4ZOSA 5DJBA 5KFMA 2DNKA 2OKQA 3POTB 5F41A 4D3HA 2YQ3A 4ECZA 1OWXA 2B7BB 3O8WA 2PEBA 4PEOA 4LRBA 2B56A 1RQ0A 3H98A 5HMYA 5K8MA 3EDQB 2BACA 4HDGA 2RRAA 4I56A 3LP0A 5IV3A 3M6XA 2UUAF 2YNGA 5IC4B 2MDAA 1F9HA 1FDNA 3KJQB 2L41A 1YGYA 1X4CA 2E1RA 3G82A 1VRTA 2CQ4A 3J7YI 2RHQB 4LSLA 3PW7A 5EWFA 3CGIA 1S1XB 3DU6A 4AFFA 2E1AA 1MN9A 2IRXA 3F0NA 2GJIA 2XSJB 5DQGA 1N34J 1F9FA 3Q2SC 1RB0A 2WCXA 1RA7A 3QT5A 1EIYB 2EI5A 1N54B 4USUA 5L9NA 2PEHA 2HHUA 2FGCA 4A8YA 4G1QA 2W4CA 1IKWB 1GMWA 4FXWA 3EPIA 1YG0A 2LYVA 4A8QA 1AZSA 1K1QA 2F7VA 3CCMS 3PYGA 2CJKA 5A8WB 1GMUA 4DR6J 4ECUA 1QJHA 2BKNA 2LP4A 2FPHX 2KXHA 2Y0SD 5ITHA 1MMDA 1W7WA 1SC4B 2B8QA 1FF2A 3NKYA 2ZNZA 3A3OB 5J1EB 2GJFA 2A0FB 3R5GA 4X2BA 2COLA 4CM0A 1NNDA 1S9GB 5HL7Q 1FJEB 2FVRA 3T5LA 3T19A 8ATCB 2ZH9A 3GQCA 2ZEJA 1T9WA 1BQMB 2GIQA 3ISZA 3TX0A 3QLHB 3V4IA 5E41A 2FIUA 3MUMP 3GCWP 2OIHA 3UR0A 3M32B 3BBCA 2HK3A 4MFBB 5GADI 1DJ0A 4ECTA 1IKYA 3T9NA 2J76E 2E9ZA 4B3RJ 1SJ1A 1DQ8A 3MPUB 4OI0A 1RU2A 1XQIA 1P1TA 4OLOA 1HLWA 1C1CA 3L7OA 4NXNJ 2NR0A 3KK1A 1Q81T 3EGNA 3QGIA 5KFNA 2HIQA 2W7PA 4KRWA 3RBEA 1YHQS 1WELA 3AB4B 1F60B 1U09A 2GHWA 4MYUA 1T95A 1K9MT 1VISA 1TZ0A 2M3DA 3C3LA 2ZH8A 3TJAA 4OFZA 1NPPA 1HWKA 2RU9A 4OZ5A 3OTDA 3OXGA 3RBXA 1WDDA 1V5IB 2E5IA 3PR5B 4DR7F 2YKNA 5BYRA 1G6BA 4C6AA 3ZNJ1 3CCUS 3FC9A 1EARA 2I5JA 4A8XA 4LRFA 2W1BA 3HKWA 1V5VA 3SYZA 2DHGA 3AJ2A 4FDFA 4X64F 1PBAA 3UR3C 5G0RB 4OX8A 4RUCA 2C3MA 1T9VA 2RT3A 2KHCA 4KKOA 1YJ9S 4KO0A 2UUAJ 5B0GA 4C98A 2XNRA 2QA1A 3RBDA 4MIWA 5CHCB 4URGA 1RHKB 5AE2A 4RBTA 3P3DA 5L1KA 1BD6A 1PJ7A 2IA6A 2VASA 2DNMA 5LJ3Y 4IDKA 2BRLA 5DDQC 4B3TJ 2KU7A 1LOUA 4CNYA 3I56S 3MCOA 3NEKA 4NLPA 3BN7A 3CJRA 4LF5J 4RW6A 1KONA 2KM8B 3CJ3A 3T1YJ 2LMIA 4KH0B 3OTOF 3L95X 4NCGB 4CO0A 4ZKAA 1RWVB 2CPEA 3M9OB 3A8EA 2HURA 4ZVUB 1HPZB 2XS2A 2DJWA 4P72A 3M8ZA 3HZGA 2POKA 1CJKB 3M4XA 2OSRA 1R43A 1WJ9A 5GAEU 2WSFC 3F73A 2QJ3A 1X9MA 4J9OA 3GG0A 1RT2A 2HGMA 2PO4A 4AL6A 4K7QA 5DZ6A 2PI5A 1HHSA 3MTKA 2Z2ZA 1S97A 3AHPA 2PIIA 2A6MA 2DR5A 2MKCA 4R5PA 2OLWA 2R8GA 5ETTA 3DCAA 4ID5B 3NCQA 4FF2A 4CLWA 2QMXA 3LUYA 4KBIA 3FK4A 2XY7A 5A6WA 2UUCF 1N36J 1VMBA 3AXMA 3CIZA 2VUGA 4RPFA 3I5CA 1QE1B 3Q24A 2R2TA 1HBUB 4UY8T 2XSFA 4YY3F 2DY1A 1N52B 5F9LA 3R9LA 1MWZA 2QMWA 3GR1A 3AQOA 3W62A 1H2VZ 4J9SA 1FK9A 3O44A 2CFXA 2ASJA 2A10A 4YP3A 1OSDA 4MKVA 1PG5B 3ZTQA 3Q89A 2DGUA 2OEJA 1ZH5A 2ZD1A 5CYQA 1QSLA 4DPTA 4WFBQ 4HHUA 4DFKA 3AAWB 2AHOB 2Z56B 3CCVS 3GIMA 4LSNA 1WUUA 3I55S 2SXLA 3AOCA 4DS5A 1UAWA 4USJC 2IBOA 5GMDA 3U7JA 3RYLA 3RAQA 1FRXA 1Q16B 2AQ4A 4DN9A 3O1LA 2AYEA 4NA3A 1D9DA 4L3KA 3ZC4A 2X1FA 3I31A 4TY8B 4ZPWR 3C6UA 4F50A 1ITPA 4LF6F 5F8JA 1ZOTA 1R27B 4WYWA 3RU0A 4KC5A 3B78A 2UU9J 2DITA 1TKXB 1XK8A 2ZM6J 5HAOA 1F5AA 4DL5A 1HNIA 4MT1A 3NBPA 4KR0B 3V81B 4P74A 2BOAA 1R0AB 4RZRA 5BR8J 2MKIA 2OPRA 2WOMA 1EETA 4RKUC 5K9FA 4ES3A 2UXBJ 2XY5A 3H40A 3JSMB 4CLPA 4PABA 1ZAVA 2PDAA 1LV5A 4RU9A 2VONA 2ZH6A 1AW0A 1HI1A 2VIHA 2DT9A 4OX7A 1RDRA 1S1WB 3SDEA 1SJRA 4NLOA 2AYGA 2ACYA 3QNWB 1QTMA 2IHR1 2B9WA 3B6BA 3W5ZA 2BABA 2QRRA 3QMQA 4DQSA 2PSZA 4KY3A 4B3OA 1Q78A 4C11B 3FJ2A 2DNOA 2ZOFA 2XWYA 1FRLA 2O3DA 3OR1B 4C7QA 1BLUA 2U2FA 4UW2A 2F8MA 2N4DA 1S48A 4CT9A 3N28A 2WVEA 4C3KA 4I4BA 4RO0A 3VQTA 1RT3B 1J5OA 1UA1A 5L8RC 5KT6A 2HZAA 1TV6A 5FLXY 1YVFA 2XMJA 1FE4A 1S77D 5KT7A 2BE7D 5ETSA 1M5KC 4NLDA 4OI6A 5J1PA 4MKAA 3PR4A 4OYXA 1WI8A 2CPXA 4LR8A 3GMGA 2G9OA 2BR0A 4CQ1A 1NDLA 3OXLA 5HP1A 1X4EA 4IH5A 2W9AA 3PW5A 2VKZG 3TUPA 3MMCA 4GO7X 2OFHX 4QIWD 2HFZA 1QAXA 2DPIA 2QLXA 2NXJA 2BJ1A 3J7Z5 1OPZA 3AB2B 2YVSA 2XYHB 1SL0A 4BC9A 2ZHAA 3HXMA 4NLSA 1AXQA 1HFEL 4IG3A 3TA0A 3K57A 5AE3A 2BE2B 3W5YA 3OTEA 4FNIA 2WBRA 1YRUA 2YWHA 3DC2A 1XERA 1HNWJ 2EFQA 2HBQB 5D0GA 4ZJOA 4FVCA 4DPUA 3QRQA 2KRBA 1RAJA 2DBBA 1NB7A 2DIUA 4MK7A 3DHWC 4CH1A 2XS7A 4OI4A 4O3PA 3MM7B 2CVIA 1NHUA 3L4BC 2H51B 2RQMA 3POTA 1RTHB 2FJEB 1GFWB 2MLYA 2H4YB 4CLUA 2YX7A 3MAHA 1JLQB 2BJ7A 3HHLC 4DR4J 3EWGA 4AT1B 1WOSA 2WZ1A 3HLUA 2GW8A 3HFZB 5KT2A 2KXNB 3GFYA 3D3BJ 3B8HA 2LA6A 2IM3A 4WFZA 4FXVA 4OYOA 4ZVHA 4U9RA 1D3WA 5DG8A 2FTRA 1NJZA 2H48B 2QTWA 1P27B 3UPFA 3CCJS 4RJVA 3OLAA 2PFFB 4WP3A 4LFCF 5C2GA 4HI2A 1RI7A 2X1GA 2GMHA 2NXNA 2Q6BA 1CVJA 2RIJA 4O44B 3CIMA 4ECVA 4DN0A 3IAM9 1VR6A 4H4OB 1S1XA 2ZVSA 1M1GA 2XSJA 1YBUA 2ASDA 5F0WA 3JSYA 4QW8A 3RZAA 3R7BB 4K8RA 4WKYA 2EFPA 3LWMA 5H9FK 1IKWA 1CJVB 3KWMA 1WEYA 2HQFA 5FDLA 1TKDA 3CDUA 5A8WA 3KHRA 4EO8A 3NS7B 2AJFE 3PVXA 3BBBA 1OQ3A 2LXFA 2OUGA 5J1EA 1N33F 1P6TA 4OZ3A 3HX9A 3FCHA 3OHAA 2W8LA 4QIGA 2MZTA 2VQEF 3J81j 3JAMY 3N6LA 2HZVA 1GQEA 1CC8A 2FD2A 1SBRA 1GTEA 1RT6B 4OJGA 2ZBIA 2HWIA 2NXEA 2BJDA 2OPSB 1UPPA 1BQMA 1X5PA 3PHTA 2HQIA 3RG6A 2ZWOA 3QLHA 2CUYA 3HSGA 3PY8A 4NLQA 4HDHA 2C2EA 2HQCA 3S8SA 1T0TV 1WC0A 3HMJG 4HACB 2JFKA 4MFBA 1AUDA 1SH3A 2HPUA 5FD1A 1VK8A 2GMJA 5D4PA 3U1LA 2KZZA 3M2VB 4HI1A 2DTJA 2E1MC 2ZKUA 3VCDA 6FD1A 2QC3A 1S59A 4GKJF 4U7CA 3DGPB 5ETNA 2N4CA 2GIFA 2HQ3A 4CO4A 3T6BA 3FSXA 2RJZA 1S0OA 2KG0A 4X66F 3PFOA 1HL6A 4RWXA 2W01A 1NHKL 5KFKA 1U2FA 1H7XA 4B3MF 3W64A 2YNIA 2F8EX 2F40A 2VHGA 1HQEB 2VC0A 3OFEA 3HK2A 4V19X 1HKAA 4LRAA 3FMBA 3EICA 4O3NA 4G1PA 1R8BA 4OL8A 5KFGA 4EBCA 3ZFVA 3KMQA 4AD6A 1PAUB 3OFHA 2HHTA 1HHTP 4K4TA 1H73A 1O8BA 3PX4A 1ACMB 1NZAA 1C4AA 4OYPA 5IM0B 2CPDA 3AA9A 3OR2B 1M5OC 2F9JA 2EC2A 1OYEA 2W2QP 2GO8A 1JLAB 2ROEA 2J0WA 4LIRA 5G0RA 4WFNQ 4AXIA 3R2CJ 4IQMA 3S6EA 4DSFA 3GCXP 2ZWPA 2C2NA 4IKAA 4F4YA 3KJNB 2YBVA 2BXJA 4Q8FA 1S7IA 2CG8A 2BRKA 4OHZA 5KFPA 3RB3A 4LT6A 2HVZA 1NAQA 1RTIB 3CJ5A 4ZP8A 2QL7B 2B9EA 1ZAXA 2C28A 4DX8H 2KTQA 1WKLA 1WORA 2CJQA 2VF3A 2BW2A 3AD9C 3D1QA 3WQPA 3NGRA 1VC5A 1Q8BA 2MHNA 1VQLS 1AROP 4NZ6A 3AY0A 5D4LA 4IR9A 2CIMA 5ETVA 2IM0A 4ED3A 2D3UA 4ZJLA 1VYAA 3ETMA 4Q7AA 2B0GA 5GAEI 4CYUB 4NCGA 3L09A 1RT5B 2GVDB 2MGZB 5HATA 4KE5A 2FYXA 2MSTA 2NSBA 2BMBA 2FVCA 1HPZA 4X4PA 1PAEX 1AFJA 1NSAA 1NKBA 2AZ1A 2QX0A 2VDIA 4ZP6A 1CJKA 1UJ6A 5G4DA 4H4KC 5A6PA 3ISNC 1DTTB 3LGNA 2CXEA 3SV3A 2MXYA 4UY85 4KGZB 2M4MA 3MPWA 4LSZB 3THPA 3DLEB 2RSQA 3SSQA 2AEMA 3VTIA 4EZ9A 4P6QA 1S0MA 1JX4A 4K4SA 4CH7A 4CIOA 1LKZA 1QE1A 4KSEB 3UD3P 3BM7A 1X4DA 2O67A 4ZCMA 2KN4A 3A12A 5B0AA 5K20B 2W2OP 4RNHA 3DRXA 1X0FA 2JDJA 3D6FB 5E7OB 2E5LF 1RBAA 4RUAA 2JEFA 2RDDA 5CYMB 4H4MB 2RDIA 3GP9A 4F4KA 2K7JA 4CNZA 3BKUA 1UJ4A 2QE5A 2ZZMA 5IT9U 4DG1B 1JB0C 3HVTB 4B3MJ 2BV3A 1NO8A 3PFEA 2DNHA 4ZCIA 2MKSA 2J7WA 4K4UA 4K0KJ 2XO7A 4Y34A 2W24A 4J37A 2AKWB 3DOLB 4ZVGA 2CADA 4B9UA 3LP2B 4USVA 2JEJA 1XMOF 4TY8A 1RHRB 1U02A 4ANCA 4YS2A 1K47A 3NWRA 3U27A 4DI6A 2Z2YB 2CYYA 4M8LA 2DPJA 1N5YB 2Y0BB 3OL8A 3CSKA 1XR5A 2E29A 2FJWA 2VV5A 2QV6A 1FRJA 1U2RA 3V81A 3GWCA 4FN5A 3S7RA 2WW4A 1R0AA 3P96A 2UVRA 1TKZA 2XLJA 3OVBA 2MTLA 4NZ0A 3PO4A 2I8EA 3KFWX 8AT1B 2LDYA 4FF1A 4M5JA 3MPDA 4RW7B 3TUZC 1RLCL 4DFPA 2RVJA 1RA6A 3NGUA 3FZ2A 5KG7A 2RMLA 4PQUB 5KG0A 1C1BB 1UEKA 2LQBA 3K5NA 4I64A 1OPIA 2Q43A 1E6YB 2NQPA 2NYIA 3NAHA 3HVRA 3MFIA 1VJQA 3N4WA 4URSA 2X1AA 4QYZJ 4C0OC 1RBLA 2CJBA 5KT5A 1XWLA 2DHXA 4WCEQ 1W25A 4OV6A 3JYTB 4NXMF 4M5HA 3H8YA 2MMYA 4F4ZA 4C11A 1IBKJ 1M0SA 5I3PA 3W61A 5CYJA 4GKKF 1U2CA 1S4FA 3DU5A 2RF2B 4B3SF 2GJ2A 1U6FA 3OSPA 3SI8A 1PBUA 3OR1A 3H0PA 2VBWA 5KG5A 2DGWA 2OJ3A 1G3OA 1JLBB 4LREA 3N5FA 3BQ2A 4RX6A 4C0BA 2J6TA 1RT3A 4YR2A 1IBLF 1PILA 1MMNA 1W2BR 4EYHB 3GYNA 3PZPA 5A2QY 5HLFA 1Y10A 3ZO7A 1ZM2A 2Y1RI 3C15B 1Y5IB 4ITSA 3H2LA 1RT7B 1HARA 4DL6A 2HMIA 1U1KA 3O2IA 4J9KA 3MD3A 2B43A 3BN4A 1F3VA 2FVPA 2BQRA 1JJ2R 2QEXS 3ZZRA 2UUBF 1OS5A 2V9WA 1Y5NB 5IWAJ 2JLGA 1U1PA 3BH7B 4ETXA 4DV1F 1V3SA 3HCXA 3I5BA 1FWKA 1RT1A 1TUGB 2BE2A 4RUBA 4C3LA 1JLFA 4NOHA 3C2PA 3WBZA 1IQTA 1NSQA 1YRTA 2HHHF 2E5JA 2W25A 1R8HA 2H9ZA 3S1TA 3TUJC 5I4MA 3NGTA 1TU0B 2NUHA 4WIQA 4QWCA 4AL7A 3IRXB 3OD2A 1SH0A 2AGPA 3H5YA 4KHRA 1RTHA 1L3UA 2H54B 4UTGA 3ZZOA 3GJSB 2OFGX 1JLQA 2XS5A 4HT5A 1ZTTA 5D77A 2HNZB 1TL7B 3TRGA 1RUSA 5J2NB 1B99A 2Z2LA 3EMTA 4PCQA 1BE4A 2ZNYA 5EHHA 2YKPA 1OO0B 3BO3A 2J8AA 4JV2A 2FJBB 1N6QB 1SC3B 1K1SA 1SIWB 3BSOA 1S1VB 2C2DA 2E1PA 1FCAA 2LVWA 1RHJB 3C6TB 4O3RA 1UEVA 4ZPTR 4O44A 1TK5A 2R42A 3LQVA 4NLRA 4OIXA 2DCUB 4I7FB 4H4OA 4IRCA 1KKHA 4G3IA 5HN0A 2BEFA 5F3ZA 1EB0A 1NK5A 3WHIA 3UI3A 2KZMA 1ZZNA 2GMLA 2R9LA 4DWIA 2DNYA 1FRMA 4IUFA 3HJVA 2KFNA 3V6HA 3ZTRA 2WW8A 1VQMS 4X4NA 5DDOC 3QSYB 3UD5A 5A0YB 5GAGU 1RAGB 4DV2F 2J5AA 4P7TA 2ZZNA 3RAXA 3EX7B 2YY3A 5EN1A 3OW2R 3A4TA 4DLEA 3R5JB 4FYDA 2DEIA 4Z2XA 1N8RT 5A8RB 1RT6A 3FSIA 1L3VA 2VFRA 3BS9A 4NYZA 2CRLA 2NPFA 3ZTSA 2OPSA 3IBWA 1KVJA 2DGXA 2A18A 2CPHA 4O3QA 4I6AA 4PWUA 3VALA 5ETLA 4YHHJ 3CUNA 2XCAA 2OH2A 1Q7YT 1UWBB 2LQ5A 2HHPA 2QLWA 1TMMA 1PGZA 4HACA 2LQJA 2D7SA 4EMDA 3M2VA 1RACB 4PWDB 9RUBA 3HD1A 1JXEA 3DGPA 3OJSA 5KG4A 5FJ4A 3CB4A 3MR5A 5E3CA 4USIA 3N0VA 2XQCA 4HVZA 1T3OA 4FYYB 3W5XA 3VWSA 3GFXA 1HQEA 5JUMA 4DL7A 1WC3A 2ZC3A 3OL7A 3KLGB 4MK8A 2AT1B 1S4EA 2HVHA 5L1LA 1A0OB 2QA2A 1M90T 1KOOA 1KHVA 3QYYA 3J80U 3D3CJ 3K5PA 4OHXA 3TVYA 4QU6A 3A3PB 1JK9B 4J9RA 2YWEA 2OELA 1QM9A 2U1AA 3G87A 4I2PA 5IM0A 3VAGA 3OR2A 2MEWA 3MEGB 4JYAF 2J7UA 3FBBA 4J7CA 4M5KA 2JFDA 1VCTA 3TANA 2QLJB 2P5VA 2B7CB 4LF4J 5F8MA 4M5DB 1SIZA 4ZP9A 5GVQA 1RGVA 2MZSA 1U1RA 1XNQF 5ADZA 3V4MA 3AT1B 4QBUA 1RTIA 5D15A 2EXUA 4DF4A 1VOMA 2EFOA 4ANEA 1W2IA 4N5SA 1IBCB 4NLGA 3M8SA 4LRCA 1JMTA 3CJQA 1H7WA 2ZE2B 4X4UA 1VBKA 3HSJA 3K17A 3CDAA 3CD0A 1NJYA 1QTNB 1V3RA 4IRKA 4ZVSB 1NK4A 4CYUA 1N5QA 4IO1A 3GILA 5KOXA 1O51A 2DRBA 2KYXA 1RT5A 2GVDA 2MGZA 3UD4P 1VQ6S 1YZ7A 1WC5A 3TZXA 2JNJA 3K5LA 3BYRA 1S12A 1PC5A 3TEHB 2EG2A 3DXSX 5ETPA 2VOOA 2NLWA 3P4UB 3MEDB 3VF0B 5DG7A 2ATLA 5HVHA 4QW9A 3FBCA 1N56A 1HWUA 1CEZA 3TZWA 3SFUA 3MI7X 3P6YC 4C0HA 1AZSB 2LLZA 3ENVA 5AT1B 4YB6A 4MMOA 3DFEA 4JI3F 1RZMA 1TUWA 3KG0A 4JI0F 4O0NA 1NK9A 5K8OA 1VRUB 4LFBF 4QQBA 4DCOB 2HFOA 3GE9A 2FQQB 4CLYA 3MMBB 6AT1B 1U8SA 3Q8UA 4LFAJ 4DHVA 4N7TA 1MG7A 2DHHA 5CYMA 4H4MA 3R5CA 4ED6A 3JQKA 4YUDA 3NNAA 1JWWA 3I0RB 1RKJA 3Q8VA 3Q2TC 3M2RA 2QA4S 4UOHA 3MUTP 2DNZA 3MCNA 3PDNA 3PX0A 1C0UA 4KJIA 4DG1A 2X1BA 2DR8A 4KPYA 2E7XA 3HVTA 2ZHOA 3BPDA 3IXQA 5H1SV 4JI5J 3NXZA 4IRDA 3L7PA 4HTIA 4QWBA 3PRDA 1OQ6A 3FZBA 4CO1A 2CQHA 4KQZA 4RW8B 3VAMA 4RL1A 3LOUA 1P1LA 1SL2A 3DOLA 3UFCX 1AB8A 2YX1A 3UE2A 4X65F 3G71S 4DX5A 2RQ4A 3DOMB 1MLAA 2CZVC 3P5TL 3LP2A 5E33A 5ETOA 2RE1A 2I9SA 4RWWA 4KHPJ 1S9EA 2QGFB 2JL9A 1NH7A 5L46A 4DV0F 2H5IB 2C2ZB 1FX4A 3P5BP 4CLSA 3DHXA 3G4SS 3QFHA 2F4VF 4DV6J 3HULA 1NK8A 2M9KA 4A48A 4OYAA 1IM6A 4QCLA 1N5YA 3NG8A 4OYWA 2VQFJ 5HROA 3DGVA 5F8HA 4M95A 2CPIA 3CCSS 1WI6A 2PFDA 1KR4A 5JMNA 5EWEA 2RRBA 3TR5A 4YEAA 4G6VB 2XEXA 1SXLA 5IFMA 3PEJA 1WTFA 3VV2B 1DBDA 3IC1A 4WYLA 2Z57B 3DLHA 1XMQF 2OPPB 4E0DA 3O3LA 4USKA 1OMSA 4YB5A 1S57A 1HR0F 3VVUA 2G2YA 3JS9A 4DL4A 2AX1A 2LXUA 2X3DA 4PQUA 1C1BA 5KFQA 4ZVOB 4PYAA 3M2UB 3OVAA 1UKUA 3HSZA 1LXJA 2CQ3A 1E6YA 1MMLA 2NXUA 1I94J 3KUGA 1X31C 5HMWA 1S1UB 2KG1A 4I68A 4NCBA 2HFNA 3R3TA 4M5GA 4DZDA 4KAIA 1XN9A 1PKUA 3H42A 1QLNA 3JYTA 4JV5J 5DDPC 5F0UA 1Y0HA 3D2WA 3CPWR 1A7GE 1FNOA 3QATA 5EX0A 3H90A 2DIVA 2M88A 3UN5A 2FJVA 4LVNP 3PRVA 3M30B 3SSSA 1T03B 3UN2A 2RF2A 4F3MA 4DCPB 2DB1A 4DX7A 2AD9A 5KOWA 4PXCA 1S10A 4IO9Q 3W2WB 2YPZA 5HMZA 2KRRA 2V67A 3FQKA 3N01A 3DRPB 3LTOA 3CJKB 3KHHA 4OZLA 1QAYA 3FDSA 4F2RA 2JVRA 1HNVB 1KQGB 4EEYA 3I6PA 3C15A 1U24A 1HW8A 2IY5B 3LPYA 1U47A 1YJVA 1RT7A 4JI7F 2V8PA 3OTBA 2ZITA 3GZ7A 1RAHB 4WPAA 2ZH2A 3EZ5A 1TFWA 5KG6A 1UP1A 5LM7E 4W92B 3N6NA 1FTCA 2HYIB 5IXUA 1FEEA 4C8KA 2YWWA 3D5MA 1QSYA 2LA4A 3MM6B 5D6GA 2HK2A 4C97A 3QZ8A 2X3GA 2V4JB 3E51A 3MURP 4FF4A 4WP8A 4DQQA 2KL8A 2MZJA 5LMNF 4KGKA 4CLTA 4J9NA 3QWPA 3NY0A 4CI0B 1OY8A 2Z4PA 2B4VA 4LF9J 1BUXA 2ZBCA 4B17A 4ELTA 5K8PA 3IN5A 3DOKB 1TP7A 2JHEA 3IRXA 2MPUA 1RWUA 5CAAA 2VA3A 2DO4A 4C9DA 5M2PA 3W8PA 5MAOA 5ETKA 2XMKA 2V68A 3CCLS 4NYPA 5HSPA 3T9ZA 2HNZA 2CJXB 4TU7A 2CQCA 4B02A 5J2NA 4WIIA 4DSKA 2CA9A 2UXCF 4WF9Q 2AJ4A 3CMAS 3M9MB 5BYQA 3PRBA 1XMBA 4ATNA 4WFAQ 1N6QA 1NJWA 5MLCV 3OLBA 1YJWS 2V6AA 1VQ9S 2HEKA 4F25A 1S1VA 4J9LA 2WSEC 2Z58B 3C6TA 2BUNA 3BPSP 3MR2A 1T05A 1FNMA 4KGVB 3M8WA 4O4RA 3FMWA 2WTFA 4PZVA 3NMAA 3UVJA 4I7FA 4WJBA 4DL2A 3ENWA 2E9RX 4J9PA 4DV7J 1UFWA 5GAGI 4LBHA 2D69A 2W2PP 4HH1A 2GA7A 2RH3A 3TA2A 2CQ2A 4ID8A 2VFTA 2XZWA 2JZ5A 3CC4S 3R6LB 2GGPB 3IR7B 1LWCB 4DZ6A 1JXLA 2V8GA 1WHVA 4P10A 1YWXA 4K50A 5LSLA 2AJ0A 3J7A1 2WRMA 4HR2A 5A0YA 4ALZA 4N76A 2VOPA 4DR1J 1NEEA 4PG4A 5F3TA 4DUZJ 5B0DA 3D0GE 3L7UA 2HHSA 3B4MA 5HANA 1N34F 2DK2A 4URQU 2XMVA 4WE1B 3QGHA 1OY9A 3OFGA 4OI2A 3MR7A 5A8RA 1S6QA 2CJ9A 2V34A 1YJNS 4I2QB 4P73A 4DR6F 4CZCA 4UT4A 2C2KB 4UUWA 2BJ3A 4F4WA 1UWBA 4U8YA 3BB5A 3VZHA 1PC4A 3ETOA 4JI7J 2G0CA 1VQSA 4RBVA 3OVSA 2BJ8A 5KFTA 4EUVA 3G6XA 5CD4A 2AW0A 2EW9A 5L9XA 4J9QA 1R31A 4PWDA 3JSBA 1QY7A 4ENOA 2CZ9A 2M0GB 2HHQA 5J2QA 3Q83A 3CJ2A 1F6TA 5DDRC 3OJUA 3PJWA 3J81U 4GVLA 2FZKB 3BJYA 3DN9A 4UOGA 2XTJP 4XDDA 2YWKA 1NPKA 3KLGA 4WP9A 1NK0A 3D0IE 2J8SA 4U96A 4B3RF 3QRPA 3T6JA 1ZPWX 3MD1A 1ICEB 2J7KA 1FRHA 2LEBA 1BQNB 1IJFB 3N79A 2B4OA 2C3YA 4NXNF 1P9QC 4J91A 5KG1A 2YKOA 1HNXJ 2GAHC 1E6VB 1RAFB 1NJIT 3FBEA 4TXSA 4UOFA 2I0XA 4MJKA 1ZETA 2W2MP 2FY8A 4X4VA 2VODA 4A8SA 2BANB 1ZAWA 3MEGA 3J7ZT 3FSYA 1ZS6A 1ZA2B 1FRIA 4OHWA 4ZVFA 2FVQA 4EK2A 4C8ZA 3U02A 3T5KA 2HHVA 4M5DA 2VG7B 3CMQA 3IWXA 4P2MA 4E98A 2VD3A 2FHKA 4N8OA 2ZUAA 2FZCB 1SQEA 2I1RA 3MF5A 3IWLA 3NCPA 4CH0S 1LW2B 3QBCA 4OZJA 3MM9B 3SCLE 4TU8A 2AWZA 4DLGA 2Z8QA 2V8DA 2ZE2A 4RW9B 2BBEA 2R7SA 2YPYA 3E2EA 2AYMA 2GAGC 2JRSA 1SI9A 5CXTA 4X4RA 3IM8A 2XI3A 5F8IA 3DRRB 2VZ9A 4DUYJ 1FHTA 3CDWA 3ILIA 3WX4A 1XEZA 3WDOA 4Q2LA 1UVLA 5GMEA 2IBKA 2MB0B 3TJ8A 3ZZUA 1HNZJ 4W90B 2ZFHA 2A3JA 2IJFA 1WG1A 2FZGB 5K8NA 2RNEA 1U48A 3MEDA 2YQ1A 1WG4A 4DU7A 5KFDA 2UZAA 3G6YA 1WEXA 4B3TF 3VAKA 4M5IA 4WU2A 1HD0A 5GAHU 4OLPA 1BY9A 3DRSB 2AP6A 3WX8A 4LF5F 1DY3A 2G4BA 4GVBB 3TZYA 5FDLB 3UN3A 3T1YF 4DBQA 1RU1A 4H54A 2DNRA 3GSDA 3MM8B 5H9EJ 3VGVA 4M63A 1M5VC 1MU2B 3I4PA 4KHMA 1F0XA 4ZN1A 5LSOA 2W9BB 4N56A 1VRUA 2DNGA 4WXOA 4KTQA 2IJNA 3GV5B 3W2VB 2VA2A 3MMBA 4JOUA 1MNEA 2ZH4A 3R5DA 4P71A 2HW3A 1VK3A 1X9WA 4WFYA 4DUTA 4F3QA 5DQHA 1S1TB 3I0RA 5IQQA 4O3SA 1BWVA 2OO4A 2P9CA 3CW2C 2ZDPA 1IKXB 1RKIA 3JB9k 1N36F 2HKEA 5M2RA 1SCJB 4K5SA 2H5JB 3ELHA 1H74A 2N3LA 3VAHA 2CQGA 5DS7A 4ED4A 2XY6A 2MLXA 4RW8A 1L3TA 1DRZA 3G8QA 2R8HA 3D68A 3J7AN 2V63A 3DOMA 3BGFA 3VGSA 3VQSA 1S6PB 1KQFB 1RP5A 3DMJB 1ZM4A 4F04B 4MKYA 1H6KX 1TK8A 2YNIB 3NS6A 2LECA 4HHJA 4DV5F 2EFVA 2BDPA 3CD5A 1G2EA 1X4FA 4ZHRB 4DR3J 2F4FA 1S6UA 3D67A 2OPPA 1FNXH 2J0XA 2ADBA 3E8OA 3IGNA 1B0TA 1KFDA 2RHSB 2XC9A 1BQXA 1SVDA 4NCAA 5CH7B 4Y65A 5IT4A 3SV4A 4LQ3A 3OPKA 2UU9F 4ZVEA 1O5JA 3Q86A 5KFWA 1VQ5S 3GFHA 2ZM6F 4ICLB 1APSA 3M2UA 3QIPB 2JLEA 4ZIVA 3U1MA 2IMOA 1NUEA 5BXIA 2W9CA 4Q2MA 4P2SA 4O0IA 2VJVA 3T3FA 5BR8F 1S1UA 2IYIA 4DXLA 1ZTWA 1WSRA 1RAOA 2E5GA 1R6VA 2RD5C 2UXBF 1PYTA 1AYEA 2D1CA 2I2YA 5J1NA 3D6TB 3M30A 1MN7A 1T03A 1VLYA 5KFSA 4LF1A 2AIRB 3SQOP 1KN6A 2KJVA 4O23A 2J6SA 4AQYJ 4XK8C 4TQSA 4BLGA 1EAYC 4KT0C 1FI4A 3TQEA 3W2WA 5F8NA 4PG8A 4JB8B 3SZ2A 2KM8C 1T9YA 2DGVA 3LP1B 5I42A 3WC0A 4CLFA 3EDRB 2V9KA 5HBMB 3DRPA 4Z7CA 5E5NA 2APOA 4JI6J 3CJKA 1KWMA 4RNMA 1JJHA 1HNVA 2R2RA 1IWAA 2EK6A 4ZPAA 3GIKA 3QT8A 1N88A 5L1JA 2VPZB 1KNZA 4QYZK 1U1OA 1SJ3P 3FVYA 2R7UA 1S0VA 1FRKA 4LUBA 3V5RA 2MQOA 1DLOB 1GEHA 2XMTA 3BSNA 2A1BA 4ZIWA 2KHDA 1RISA 4OHYA 3MM6A 4J9VA 2X51A 2IPOB 1TL1B 1YLXA 2HWTA 2V4JA 3RW7A 4Q0BB 4NLWA 4RBUA 4L3NA 3AA8A 4LBPA 1WC4A 3A1YG 3OHBA 1IWGA 1D8YA 1RABB 4K4ZA 3CJSA 3HF5A 3MPYA 3JXOA 4A8WA 1SKUB 3DOKA 3PNIA 4ED8A 2DNNA 3HDSA 3I5AA 1LWFB 3ULHA 1ELOA 3FKBA 4DV5J 3IA0A 4EI2A 3NNHA 1XTZA 4Y28C 3BV8A 2G1DA 4M5NA 1VRQC 4QOTA 1IVZA 2K2PA 3FEYB 5C7PA 1IKVB 2FLLA 1HNWF 2OSQA 2ZH1A 4TNOA 2CQ1A 3C14B 5K14B 1L3SA 2OEKA 1UVIA 5E2QA 1IUJA 2HNDB 4K4YA 4FPIA 4ZCLA 1Z2LA 2ZDOA 1AFIA 3R5AA 3W9HA 1FD2A 3TZZA 2XO6A 4DR4F 4J5OA 2PMZD 2BKPA 1L3KA 3BGRB 5HI7A 1TKZB 2VJUA 2DGOA 2YKQA 2N82B 1H72C 3OL9A 5DETA 3MAQA 2GGPA 1LWCA 2PN6A 4XIUA 4WTYA 5HJXA 2UXDJ 5B09A 3SQGB 3OV7A 5AXKA 2IC3B 1CBKA 2OEMA 1FKAF 4OJ3A 5KFHA 2EBEA 3BZQA 1RAAB 3LALA 3V6JA 4HH0A 3RB4A 4UUXA 4FPRA 5KT4A 3JTPA 4OYIA 2R7XA 4YR3A 4WE1A 3AXKA 2HIYA 1UVKA 2HBRB 4I0WA 3SIPB 1V9OA 1JIHA 2XGQA 3UCZP 2G13A 3JQJA 2HVDA 4I2QA 3V6DB 1UEUA 3UCUP 1BXNA 3JQMA 3FBFA 1D0EA 3OTCA 3G6ES 1VHIA 1RAEB 5T7LB 5E0OA 2ATCB 4K4VA 4USHA 4DEZA 2DR7A 1ZYQA 5IZHA 3Q8RB 4TQRA 2D9PA 2NYHA 4I6WA 3DLGB 4ILLA 3PKMA 2AJ1A 4P52A 3HKZD 5HLFB 2J9DA 2ILZA 4OZ1A 4N47A 3CDEA 3CJTA 2W4DA 2EKYA 2LEAA 3H2VE 2R7TA 1WF1A 4KPCA 3LA0A 2GQCA 2HMIB 1K44A 1ROFA 2BQUA 2UUWA 3ZTOA 1URRA 5KG3A 1VLOA 4I1TA 4CT8A 4LRDA 4USWA 3BKTA 3TQ1A 2DXDA 1BQNA 1XNRJ 1D8ZA 1FESA 4OZ2A 1RT1B 2WAQD 3EVWA 4U7UK 1JLFB 4DCJB 1E6VA 3M7VA 3C8YA 1N5TA 1Y4ZB 2DVIA 3BGUA 2BANA 2BKOA 4A4JA 2DCLA 2IRUA 1JKHB 2YNHB 4KGMA 3ZZ0A 2G2OA 4IG0B 3UW1A 1F2GA 6FDRA 4DR5J 3IR6B 3QSIA 1HBOB 2R2UA 3IBCB 3QPIA 1LWEB 2VG7A 4DV3J 4IFYA 3FRYA 1CQNA 4YB1P 4PXBA 2MJNA 1S49A 2DH8A 1EQ0A 2AEFA 5EDWA 4ECXA 1WF0A 4A46A 2RB7A 3MGJA 3ZZYA
chains in the Genus database with same CATH topology
3HKWA 2DISA 3SYZA 5F8MA 4DSJA 2L9DA 2DHGA 4CTAA 3QO9B 1LW2A 1TVRA 4M5DB 1SIZA 1YSJA 3MM9A 1FVSA 4ZP9A 2VFUA 3AJ2A 2CVEA 5GVQA 3EGZA 1RGVA 3KLFB 3CULA 2MZSA 4X64F 1U1RA 2HHXA 1XNQF 1JNZB 3M8QA 3JSMA 3UR3C 3V4MA 5ADZA 5G0RB 1WEZA 4HL9A 4OX8A 3KOAA 4QBUA 4RUCA 2C3MA 1RTIA 4RW9A 2RT3A 2KHCA 4DF4A 3TW0A 4M1KA 1VOMA 2EFOA 4KKOA 4R25A 1YJ9S 4KO0A 1DTQB 1W2IA 4YDDB 2KI2A 1LQ9A 5B0GA 4N5SA 4C98A 1S1WA 2QZ8A 4NLGA 2CZ4A 3M8SA 2XI2A 3HI9A 2XNRA 2FHMA 4NX9A 1S7HA 2QA1A 2OP5A 5L39A 3RBDA 2R7QA 4MIWA 4N8NA 1RJJA 5CHCB 4A47A 2B6AB 1JMTA 3DRRA 5CA5A 4URGA 4BDPA 4N41A 5AE2A 4RBTA 1H98A 1H7WA 2ZE2B 2UUTA 4X4UA 5GAHI 3P3DA 5L1KA 1BD6A 1FEHA 4K4WA 1DARA 2ASLA 2XULA 1SL1A 3QZ7A 4DQPA 3NP5A 3MECB 2IA6A 3CDAA 2VB6A 1HWLA 2VASA 3DDKA 3MM5B 4FS1A 3CD0A 3DYAB 5HMXA 1NJYA 1FDAA 1V3RA 2DNMA 2PA8D 4IRKA 5LJ3Y 4C8MA 1NK4A 3MUVP 4OZNA 3F56A 1N5QA 2MHEA 4IO1A 4OI1A 4IDKA 2BRLA 4ED1A 3GILA 5DDQC 5KOXA 2R8JA 4F3OA 2JEIA 1O51A 3EPGA 2DRBA 2KU7A 2KYXA 1RT5A 5CD4H 2MGZA 2J6UA 3UD4P 1VQ6S 2XGPA 2E66A 1LOUA 2WK4A 4CNYA 4DUYF 4HKQA 3I56S 3R1LA 3MMAA 3K5LA 4NLPA 4N77A 2MQMA 3BN7A 1GT8A 1PC5A 4RW6A 1KONA 3DRSA 2KM8B 2WSCC 1Q86T 3KK2A 1HNZF 4MTPA 1HI8A 2EG2A 1ULRA 3DXSX 3CJ3A 3MFHA 2LMIA 3Q0AA 2FC9A 2VOOA 2YH1A 2R8KA 3OTOF 2NLWA 3MEDB 3BR9A 3K8VA 2RQKA 4NCGB 3L95X 3R1HA 1SJ4P 4CO0A 2B4PA 5D8HB 2L3MA 3VF0B 5DG7A 1R89A 4ZKAA 2ATLA 2PT0A 1FKOA 2CPEA 3M9OB 3A8EA 1Y3JA 4QW9A 3MM8A 1VIXA 5JVHQ 1N56A 5FIIA 3RRHA 2AGOA 1HPZB 1DZ5A 1HWUA 1KHWA 3VAJA 2XS2A 3GG1A 1CEZA 2J9EA 2FLOA 1IN0A 3IO1A 1MU2A 1R7IA 2XMUA 3SFUA 3MI7X 2DJWA 3BGLA 3PIPQ 1JLEB 2W9BA 1RTDB 3HVWA 3HZGA 5M2UA 2POKA 5KFZA 4TU9A 3P6YC 4C0HA 3M4XA 1REVB 2LLZA 4DF8A 2OSRA 2WB1D 1KOHA 4B9LA 1R43A 5HQ8A 3ENVA 2O1PA 5GAEU 2WSFC 3F73A 1X9MA 4J9OA 2KO1A 3GG0A 4YB6A 1RT2A 3W2VA 2QSFA 4GMKA 2HGMA 2PO4A 4MMOA 4HLBA 4NLTA 4AL6A 3DFEA 5IT9Y 1EP4B