1C1BB

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
432
structure length
415
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYNLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 113
structure length 415
sequence length 432
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB03
1S4FA 3C6TA 3DRRA 2YNFB 3DOLB 2XC9A 4ZPDA 1IM4A 1JLEA 2C2DA 1TKXA 4RW9A 4K4XA 5K14A 1T05B 3BQ1A 4MKAA 3M8PB 4H54A 4NLSA 4WE1A 3UR0A 2DPIA 3OHBA 4KHRA 4DL2A 1ZETA 3OSNA 2RKIB 5F8MA 1TL3B 1S1TA 5KT3A 3DI6A 3MECB 1FK9B 4Q8EA 4QWEA 1WNEA 2RF2B 5C25B 1EP4A 4KV8B 1RT5B 2AX1A 2GC8A 4EO8A 4KSEB 3JYTB 1HPZA 4ED1A 2HNZA 1QAJA 2ZD1A 4RW6A 4Y2AA 2W8LA 4HYKA 2VG6A 2UVWA 4ECWA 2YNHB 4HKQA 3V4IA 2OPRA 4O3PA 3FSIA 3V81B 4LSLA 1D1UA 2E9ZA 4QWBA 1BQNB 4MFBA 2D7SA 2OH2A 4NLGA 1FKPA 1C0TA 1SH2A 3NGDA 3KK2B 1OS5A 4RZRA 4DL4A 1JLCA 1RT4A 3MR2A 3MEEB 2O5DA 2C22A 1QUVA 4O3RA 3CJ5A 2WONB 3DRPB 1JLGA 4RW7B 3I0SA 3KLFB 2D3ZA 1REVA 3CIZA 4K4YA 1TVRA 1HARA 5J1EA 3CWJA 5I42A 5KFZA 5DG9A 2W9CB 4KAIA 5L1KA 2ATLA 1SUQA 3TAMB 2XI2A 4IRDA 1RT7B 3IRXB 5C42B 2YKNB 3LALA 5KT5A 4WFXA 1DTTA 2FJXA 4O3QA 4IFYB 4ZVEA 1RT6A 1R0AA 3BJYA 3BSCA 4IH7A 4O4GB 1JKHB 4MIBA 5KFMA 1S0OA 1HNIA 1QE1B 3RBEA 1LW0B 3DLEA 3TVKA 3GV5B 2C28A 3EPGA 2HMIA 3PJXA 5L1IA 2YNIA 1TKZA 1HQEB 2GIRA 4K4TA 2IAJB 2I5JB 5KG1A 1XR7A 4NLXA 3OSPA 5F8HA 4J9SA 4I2PA 1LWEA 5K14B 1T05A 3H59A 3FQKA 1W25A 4KO0B 5J2MA 3NAIA 5KFAA 3QIPA 4ED7A 2VA2A 1T03B 4R8UB 4WZMA 2HAIA 2ILYA 5KG3A 2RKIA 4ECTA 3C6UB 4B3OB 2VG5A 1N4LA 2ZE2B 3GILA 2OPQB 1IKYA 3HHKA 4WFYA 3QLHB 4O3OA 3QZ8A 3IN5A 4H4MB 3M9OB 4WYLA 1SV5B 1S1XA 1TQLA 2WB4A 2HNZB 4M94A 1HQUA 3OLAA 2WCXA 4DL3A 3I0RA 1I6JA 2R8IA 4RNHA 3D5MA 4IH6A 4K50A 2BE2B 4ED8A 1IKWA 3V6DA 3PJWA 3N6NA 5KG6A 3KJVA 4Q8FA 4QPXA 3KHHA 4TXSA 4EEYA 4Q0BA 3OL7A 5L1LA 2W7PA 3DM2A 5KT2A 4RUCA 4YR2A 1S1WB 4PUOB 1S1UA 3SFUA 4H4OA 2IC3A 2UVUA 5F8NA 3DLKB 3KLHB 5I3UA 3T1AA 3BGRB 4RW7A 1RTDB 1SH3A 1C0UB 3KK1A 1HNVA 3E51A 1N56A 4RW4A 1VRUA 2YNGA 2BRKA 5C24B 3RAQA 3CJ2A 3QZ7A 1MU2A 1RTJA 2HNDB 1RT2B 2V9WA 3CJ3A 4IDKB 4I2QB 2AGOA 1S9GB 4LQ9A 1S9EB 1RT1B 5CYMB 5J2QA 4EO6A 1IKXB 1N5YB 4URGA 4IFVA 3LAKA 2R2TA 2WOMA 3Q8QB 3BQ0A 2B43A 4TY9A 4Y2CA 1S6QB 2ASJA 3DRRB 1KLMA 1RYRA 3LP0A 2XCPA 3FQLA 2CJQA 2QV6A 5KT7A 4J9KA 1JLBB 1RTHA 2YKMA 4ID5A 2C2EA 2BANB 2E9RX 3DMJB 4RNNA 2JEJA 1NNDA 5HROA 1S6PA 5J2MB 2FVPA 3LP2B 2AQ4A 2FVCA 3M8PA 2I1RA 2B5JA 4ICLB 2WHOA 4NLWA 1IKVA 3HKWA 5KFDA 4IRCA 4NLTA 5EUHA 2VA3A 3FDSA 3ITHB 4WXWA 5C5JA 3PR5B 4LQ3A 3H2LA 3JSMA 5FDLA 4YR3A 1N6QB 2OPPA 1S1TB 2R2SA 5DQIA 1FK9A 4G1QA 2R2RA 4ZPAA 5KFYA 5KFCA 4YQWA 1S1XB 1S48A 4NLRA 3KLVA 3MEDA 3QGHA 3IG1B 3G6XA 2FLNA 5KG0A 3H5SA 2WRMA 2BE2A 1S0MA 5F9NA 1MMLA 1RAJA 4NYZA 4F4YA 3V4IB 3KOAA 5CYQA 3FFIB 1XR5A 3LP1B 4XO0A 1S1UB 2IM0A 4O44B 1LWCB 1TV6B 3H4DA 4JV1A 3KK2A 4RW8A 2XGQA 3DOKB 1U09A 1K1SA 4ZPBA 1HNVB 2V4RA 1CSJA 1JLGB 1EETA 1TVRB 2WK4A 2D41A 4NRTA 4F4XA 4ECRA 5DGAA 1LW2A 3Q8PB 4F4ZA 2W9CA 3KK3B 4IDKA 3T5KA 1TKTA 4Y34A 4I7FB 2JLEA 4QW9A 1JLQA 4KKOB 1RA6A 3BQ2A 5F8JA 1RT6B 1R0AB 3SI8A 2F8EX 5KFQA 4EYIB 3PW0A 1JKHA 2BRLA 4NLUA 2ZKUA 1QE1A 3E01B 4MH8A 3KNAA 5L1JA 1S6QA 2HMIB 1TKZB 2UVRA 2FJWA 4GC7A 2AGQA 2IAJA 2FVQA 2JC1A 1T3NA 5HLFA 2W9BA 1RTHB 2YKMB 4YP3A 3JYTA 3DOLA 3DMJA 3I5AA 2FLLA 4URQU 3EPIA 3QO9B 4NCGA 2J6TA 4I2PB 4IR1A 4RW9B 4KFBB 3KMQA 1LWFA 2J6UA 3HVTA 1RYSA 2QE5A 2JEIA 4LSLB 5KFJA 2AWZA 4MFBB 4WE1B 3KLGB 3OL6A 1YVFA 4DL5A 4Y3CA 1C0TB 3PW2A 1S1VB 4K4VA 1N6QA 2GIQA 3M8QA 4NLVA 4NLDA 5KFPA 3DYAB 3H5UA 4PWDB 4ECZA 4ECXA 3NL0A 1RT3B 2HNYB 4WYWA 5DQHA 3V6JA 2AU0A 4MK8A 1REVB 1SV5A 1D0EA 4K4ZA 4IQXA 5D3GA 5KFVA 2XI3A 1HQUB 1EP4B 4KV8A 4ECUA 4TQRA 3T5LA 3V6KA 3TQ1A 2ASDA 2IJFA 4IG3B 1HPZB 3GIIA 4TYAA 1QAIA 5KFLA 4RW6B 3KJVB 2IM3A 3MTKA 4WFZA 4R5PB 3EZUA 4NLOA 3FFIA 3KLEB 4DG1B 4YMEA 5KT6A 4KB7A 4O44A 5KG2A 3V81A 3H5YA 3PW5A 4KBIA 4PUOA 2D3UA 4JV0A 3NMAA 2ASLA 2BQ3A 4ZVFA 4ED2A 1FKOB 3HVWA 5KFNA 4ZVGA 2EC0A 4Q43A 1RT4B 3QGGA 4QWCA 3H40A 2WONA 5KFFA 3PZPA 3PHEA 5KFRA 2YNGB 3MEGA 1LWEB 5DG8A 4TQSA 1C1CB 3OLBA 4M95A 2FVSA 4I7FA 4J9MA 3VQSA 4ED3A 1DTQB 4XPEA 2YKNA 3BSNA 4IFYA 4ZPCA 4RNFA 4WXOA 5KFIA 3OHAA 3C6UA 5DG7A 4O4GA 4KE5A 4ZP7A 3T19A 1VRTA 2OPQA 1HNIB 5T14A 2WOMB 5J2NA 3DI6B 3IS9B 5L9XA 5KG5A 2BQUA 5J2PA 4IR9A 5C25A 4NZ0A 3I0RB 1JLBA 3H5XA 2JEGA 1RA7A 2YNFA 4U6PA 3IGVA 5DLGA 1IKWB 3V6DB 3PW7A 1S6PB 1RTIB 3KLIA 5DLFA 1JLEB 2VG6B 1UWBA 1DLOB 2R8HA 1JXLA 4Q45A 2R8KA 5HBMB 2OPRB 3QIPB 1JIHA 1S49A 5F9LA 5EWEA 5F8IA 1JLFB 3D28A 3M8QB 4FS1A 3QIDA 3QGIA 5EDWA 4ED0A 2ILZA 4RNOA 3GIKA 3DLKA 2UUTA 4G3IA 4QWDA 2ZE2A 3KHLA 3BGRA 3MEEA 2XGPA 3DRPA 1C1BA 2VG7B 1GX5A 3CO9A 3HVAA 2JEFA 4IG0B 4IG3A 1S9FA 4PQUA 1NHUA 5J1EB 3BSAA 4J9PA 5I42B 4IOBA 3BSOA 2J6SA 4EYHB 4ECQA 4ZHRA 4R0EA 3GQCA 1S9GA 1RT7A 3IRXA 2ZD1B 2IMWP 2HWIA 2W8KA 4NLYA 3MFHA 2OPSA 5HP1B 4IH5A 4NLPA 4Q0BB 3I5BA 4TY8A 3CDWA 4LSNA 2YNHA 1N48A 3RBDA 1IKXA 4DL6A 3CDEA 4J9NA 4DEZA 1JLAB 4RW8B 4H4OB 2IC3B 1FKPB 2V0NA 3DOKA 3NBPB 5F8GA 4EBCA 3LAMA 4F50A 2UUWA 5KG7A 2I5JA 4ZP8A 2BANA 3V6HA 1C0UA 3KK1B 1C1CA 1XR6A 4X2BA 1J5OA 1LW2B 5KG4A 3I0SB 3KLFA 1KHVA 4Q44A 4YR0A 3KK3A 1HMVB 3DLGA 1DTQA 5KFUA 2B5JB 4ICLA 1RT2A 3SFGA 1IKVB 3RB6A 4I2QA 3UPFA 5C42A 3GIMA 5F8LA 4EBDA 1VRTB 5J2QB 2B6AA 5FDLB 4KHMA 3KHRA 4QWAA 3PVXA 1BQMB 4EBEA 1JX4A 3Q8SB 4IFVB 3DLEB 1LW0A 3QLHA 1TL3A 1SH0A 5J2PB 3QYYA 4H4MA 4OL8A 2IBKA 5HLFB 4MK7A 5KFSA 5EWGA 2W9BB 3RB3A 2RF2A 5KFEA 3KLIB 3QO9A 3MF5A 3KMSA 3G6YA 1DLOA 3DRSA 5KFHA 1LWFB 5CYQB 3I5CA 4XPCA 3LP1A 3UDLA 4FBUA 2CKWA 4J9LA 1HYSB 2R8JA 1S1VA 1BQNA 2FVRA 4O3NA 3NKYA 4R8UA 1Z4UA 2IJNA 3N6MA 4WZQA 2XWYA 4B3OA 1TL1A 3G86A 1C1BB 2VG7A 4U7CA 2AX0A 3T5JA 4PQUB 4F4WA 3MEDB 2FJVA 5KFGA 4TLRA 2WTFA 3UQSA 4FBTA 2BQRA 1MU2B 1RTJB 2HNDA 3M9NB 1JLQB 4KKOA 4TN2A 1KHWA 4TY8B 2DPJA 3MR5A 3IGNA 4IRKA 4DG1A 5DQGA 1DTTB 1S97A 4K4UA 1RT1A 4ED6A 3RAXA 3E01A 4K4SA 2C2RA 5DGBA 4ZP9A 2ALZA 3KHGA 1TV6A 1N5YA 3NBPA 1FKOA 2RDIA 5KFBA 2AGPA 3ICLA 4RU9A 1KLMB 2YNIB 1ZTWA 4J9QA 1HQEA 4RUAA 2IM2A 5KFWA 2W7OA 5I3UB 1J5OB 1K1QA 3H98A 3C6TB 4DL7A 1EETB 3FRZA 4NCGB 1HMVA 3DLGB 4TYBA 4KFBA 4RW4B 1ZTTA 4IKAA 4QW8A 3HVTB 3GYNA 5C24A 4NLQA 3ISND 3LP2A 1TKXB 5KFXA 2RDJA 4KO0A 1T94A 3DDKA 5JXSA 3GV7B 3KLGA 3G6VA 4ECSA 4ECVA 1C2PA 2B6AB 3ITHA 1T03A 3MR3A 1BQMA 2E9TA 2UVVA 3JSMB 4RNMA 2VG5B 3IS9A 2R2UA 2V4QA 4G1QB 1IKYB 3PW4A 3N6LA 3LANA 1GX6A 1TP7A 3MECA 5KFOA 2XCAA 4J9RA 3LP0B 4URSA 3DRSB 1RT5A 3CJ4A 1RTIA 4MKBA 4ID5B 3PR4A 3MR6A 4ZP6A 1UWBB 4J9OA 5HROB 5HBMA 1S10A 1HYSA 2IM1A 5EWFA 4K4WA 3RB4A 2FLPA 5KFKA 2JC0A 3NAHA 1JLFA 3M9MB 3DM2B 3GV8B 5JUMA 4GC6A 1S1WA 3BR9A 1TL1B 3H4BA 3DYAA 2HWHA 2R8GA 1NHVA 4PWDA 2OPPB 4JV2A 3KLHA 1JLCB 1RT3A 2HNYA 4FS2A 2IA6A 1RTDA 3CVKA 4MIAA 4IG0A 5KT4A 2W9AA 3MEGB 4ZVHA 5D3GB 4ZMMA 3RB0A 3CDUA 3IG1A 5KFTA 1VRUB 4O3SA 4ZHRB 3ISNC 3CJ0A 3T5HA 1TKTB 2BR0A 1RDRA 3OL9A 4O4RA 3BREA 1SUQB 3TAMA 2OPSB 4R5PA 5HP1A 4JUZA 3KLEA 4LSNB 1S9EA 5CYMA 4ECYA 4MK9A 4NRUA 3Q8RB 3MFIA 1JLAA 3GIJA 5J2NB 1LWCA 1S0NA 3OL8A
chains in the Genus database with same CATH superfamily
1S4FA 3UN2A 4ZDNA 3C6TA 1RAAB 3DRRA 2WSCC 4YS2A 5DETA 5JMNA 4JI5J 2E9RX 1MSWD 4F2SA 3D6HB 2EC2A 2EEYA 1BWEA 2LQ9A 2XYGB 1JWWA 2MHEA 2RQKA 2V5HG 1QD1A 3BM7A 3THTA 2KJVA 3A1YG 5I3QA 1QTMA 3P3DA 1FRKA 1T05B 4PYAA 3BQ1A 5KAKA 3VF0B 4BLGA 4C0HA 1YQHA 3UR0A 2DPIA 3ILOA 4DV0J 4KHPJ 4KHRA 1FVSA 3VWSA 2ALYB 4EMDA 3M30B 3W9IA 1ZETA 1SL2A 1T3OA 2RKIB 2HZCA 3OTBA 2H51B 4K2JA 5KT3A 1UL3A 2KM8C 4NCBA 3GJTB 4EO8A 1JNRB 3M32A 2GX8A 1HPZA 2W2NP 2HNZA 3UN5A 1QAJA 2ZD1A 2MZTA 3EJMA 3QPIA 4HYKA 2QL5B 4UQTA 2MJNA 3NXZA 2YH0A 2NUUG 4M5JA 3SCLE 3ZTRA 1DHMA 4C0OC 2Q3PA 4LR9A 4ECWA 2QLBB 1FTRA 3V81B 1RP5A 2J7UA 1VGYA 3IFEA 4K5SA 1BQNB 3HFVA 2OH2A 4W90B 1NB2A 4NLGA 4LUBA 1FKPA 1R7IA 2OI2A 2YX7A 3CCZA 4RZRA 2EFOA 2K7KA 4DL4A 1JLCA 4PR6A 3PO5A 4O3RA 4G1IA 4NASA 2PC6A 2E9ZA 3MM7B 4ZPVR 1TAQA 2BM1A 3EE3A 2NCKL 5CZXA 4JI8F 1IBKJ 1HARA 3L09A 1CC7A 3F44A 3EYZA 2XO7A 2Y1LB 2CQ4A 2GCFA 3HZGA 1TL4A 5L1KA 4DV3F 4DQRA 1RT7B 3GWCA 5C42B 3BDPA 3MDFA 4DLGA 3ZNUA 3BO3A 3RBXA 2ZBCA 2ZH6A 2QN6B 1SL0A 2OFGX 4LF5J 2IA0A 3CCVS 4WP9A 2DR8A 3JTPA 5EX0A 2BKPA 1SC1B 1WC3A 4CLPA 3DHXA 2UZAA 5HI7A 3EPGA 1ACMB 5HANA 4ZLNA 2HMIA 3KG4A 2W1BA 2YNIA 3A8KA 2D9OA 5IQQA 4FF3A 3ILJA 2HFOA 1GMWD 1PYSB 1UFWA 2VKRA 3G6ES 5KG1A 4I69A 2U1AA 1KVIA 5BR8F 4HI2A 4J9SA 4YB6A 5K8MA 3FCVA 4N41A 3WBZA 3NGRA 4I1TA 3OFEA 3CF5Q 2B9XA 5KFAA 4DR5J 1SJ4P 2DR7A 5ETNA 4AQYF 3J81Y 4B3TF 2ROEA 2VA2A 1XBWA 2CPEA 2HAIA 3RJMB 2RKIA 1H74A 1FRMA 3C6UB 4B3OB 2VG5A 1N4LA 4BC9A 4CLKA 1WUUA 4TU8A 4LFCF 2DO0A 3HHKA 2E7VA 3QLHB 2J0WA 3D0HE 4OFZA 3MXHP 2RUGA 4A8OA 1AT1B 3PKMA 4LRCA 4WYLA 3M9OB 1S1XA 3GJQB 4UOCA 1OSCA 2GZOA 1FX4A 3HXMA 2DNZA 4TLQA 3US5A 1F2HA 4DL3A 2K3IA 4IH6A 2UXDJ 3VGTA 3V6DA 4DU7A 2NSBA 3IAM9 1LXJA 3QAUA 4LF1A 4WK1A 4PQAA 3M6WA 4QPXA 3VZHA 1C4AA 4PWWA 1Q5YA 3HLUA 1FXRA 4WU2A 3VHQA 4CYUA 3MUMP 3DDIA 4WJBA 7AT1B 1EX8A 1X60A 2XSJA 4PUOB 3SFUA 1JJCB 1V6HA 2M5YA 4BWJA 3K57A 2HHPA 3NGSA 4H4KC 1KLNA 1Y00A 1SQEA 4BS2A 3A3NB 3O5TB 4B9VA 1X4GA 3JTOA 3LPYA 4OMFG 3W61A 2ZM6J 3CD0A 4HLBA 4Y0FA 3Q0AA 3N28A 4GKKJ 1VS3A 3E51A 4LF7F 1RACB 3CJ2A 2J8AA 1FE4A 5A2QU 3QZ7A 3MM6A 4EK2A 1VQYA 4Y6IA 1X5OA 3TAPA 2ERRA 4IDKB 4A47A 3IO1A 1M5PC 4LQ9A 1YRXA 5IWAJ 3R1HA 5M2PA 1FRIA 3NY0A 4X65F 1HW9A 3MMBA 5J2QA 5DO2A 2FHJD 2QRRA 3T3FA 1U1QA 4KGKA 4QIEA 1Z2LA 2F3JA 2I38A 2PA3A 2XY6A 1NSAA 1QSYA 1HHQA 2J9EA 1S7HA 4CH1A 2R2TA 3ISZA 1X4CA 2ZBIA 2N3OA 3BQ0A 1WOPA 1KLMA 4IOCQ 1R31A 1CG2A 1Y10A 5LSRA 2QV6A 5KT7A 4J9KA 1U2RA 2YKMA 1RWMB 2WB1D 3E2EA 2BANB 2JWNA 3MR7A 2IHR1 1S59A 2VC0A 3N5FA 2AQ4A 1WSVA 2C3OA 2UP1A 3M8PA 4O0NA 3EX7B 5KFDA 3HKWA 4IYQA 1F2GA 4NLTA 5EUHA 4KPYA 4OZ3A 1XNRJ 1GXUA 4WXWA 3H42A 1X4FA 1FEHA 1H72C 3R27A 3PR5B 2BVZA 2J7WA 3H2LA 5FDLA 1QLNA 1U2CA 4DUTA 2AHOB 5DQIA 1FK9A 4G1QA 4KC5A 3VQTA 2CQGA 5U47A 1KS2A 1S1XB 3KLVA 3ZC4A 4GO5X 4V19J 3QGHA 3AD7C 3KG1A 3ZTOA 3G6XA 3H5SA 4WP3A 2DNMA 4NA3A 1YDLA 4F3OA 4X4VA 2Y3YA 1NRKA 1RAJA 3B78A 3A4TA 4TKTA 4JI7F 2HBRB 1PGZA 3Q8UA 3PJ9A 5AXKA 3KOAA 1CLFA 5CYQA 4XDCA 3PFEA 1XR5A 3DC2A 3SSQA 1RU2A 3JSYA 1S1UB 4CTAB 2IM0A 4O44B 1S6UA 2WVBA 1S77D 2DGTA 3ULHA 3LO3A 3H8YA 1YJVA 4RW8A 3Q89A 1AB8A 2M88A 1U8SA 4K7QA 5DS7A 4A48A 1U1KA 1Q81T 2BJ8A 1ZOTA 4LF7J 1T9WA 1CSJA 4DJBA 3K5MA 2ZM6F 3TI0A 2J76E 1Y5IB 3BGUA 1E6YA 2WK4A 3BH6B 3FEXB 1WC4A 2UV8G 3U1NA 4F4XA 4ECRA 5DGAA 3G9CA 2A6MA 3PKYA 4IDKA 3T5KA 3SV3A 1CJTB 3BO2A 2KZMA 4I7FB 2XZDB 3H20A 1RA6A 3MMBB 5GAHI 3OFHA 4DV5F 2BXJA 4EYIB 3JB9k 3UDEA 3MI7X 1U26A 4C3KA 3C16B 3DGPB 4RLEA 5ETMA 1NU4A 2R7XA 3E01B 4MH8A 2IJRA 2EPIA 4WP8A 2WAQD 1M5OC 2QLJB 4MIWA 2UVRA 1RBLA 2IAJA 2JC1A 1S5ZA 2AGQA 5HLFA 1UA0A 2YKMB 1WHWA 3RR8A 1F9EB 2DKOB 2MHNA 3J7A1 1FHTA 3EPIA 5IT0A 1VQ5S 1YSJA 3K0JA 3J80U 2F8MA 2DNRA 1LWFA 3MCNA 3G87A 2EFPA 1BE4A 3OD2A 1FJ7A 1RYSA 2C2OB 2K1RB 1AZSA 2CUYA 3IM9A 4YN3B 4AFFA 2AWZA 1ICEB 4DX5A 2N7CA 3KLGB 4F36A 4DR5F 4LF2A 4M5HA 4N56A 3G2XA 1N88A 4JI2J 2GIQA 2CVIA 3M8QA 5KFPA 3DYAB 1RHUB 1VBKA 4HT5A 4ECZA 3PX6A 3NL0A 4WYWA 1F0XA 3CJRA 3N01A 4MK8A 1V5IB 2PN6A 2DNPA 2F9DA 3K2YA 3RAMA 1K9MT 2OD6A 3C19A 1GT8A 1I1GA 2SXLA 4IG3B 5D4NA 1MWYA 4TYAA 2MQMA 5KOWA 1NJZA 4AE5A 2G0CA 2OD4A 2IM3A 2MY7A 2H48B 1SJFA 2CAJA 4GO7X 4YMEA 4DG1B 1T9UA 2UU9J 1WTFA 2ZOFA 4NL5A 5KG2A 3PW5A 4ILMA 4ENOA 3BZQA 2D3UA 3OPKA 4KBIA 4B9NA 1S57A 3NMAA 4ZVFA 2LYVA 2MPUA 1UA1A 1A9NB 1PYOB 3TA2A 5KFNA 2BKNA 3BGLA 4Q43A 2M0GB 4JI8J 3QGGA 3H40A 3R7NB 3TVYA 3ONQA 2DO4A 2HZAA 3AT1B 2WONA 3UD5A 5KFFA 3C15A 2VUGA 3TZXA 5DZ6A 2ZH1A 4A8YA 2IVFB 4TQSA 3T6BA 2P5VA 3MD1A 3R5GA 4J9MA 4MKYA 2OHDA 4X4UA 1EKRA 4KGXB 4RBVA 4L72B 1ZA2B 3S6EA 4CLYA 4WXOA 2O66A 5DG7A 3C6UA 2E5IA 2XS7A 1M5VC 4KE5A 4ZP7A 4FNIA 1LFPA 3CUNA 5T14A 4FXVA 5IOLA 5CABA 2JFDA 2CDQA 3W8PA 2VFRA 1MLAA 1NDCA 2BQUA 2D3OR 3NCQA 3KNGA 2R7VA 1V5VA 2YNFA 1CQNA 3IGVA 3W2WA 1WWHA 5DLGA 1FESA 1S6PB 1RTIB 4BCAA 5DLFA 4KGMA 4E0DA 1UWBA 1RK8A 3PACA 4QJVA 2QX0A 1XMOF 2OPRB 3QIPB 2IRXA 2I2YA 1WTBA 3JXOA 2FTRA 3QIDA 5EDWA 4K0KJ 4P2MA 4RNOA 1NPKA 4CO4A 2KM8B 2VFTA 1N34F 1YBUA 1KRPA 3DRPA 1RAFB 2IIHA 2C3MA 2ZDOA 4CH0S 4IG0B 2VBYA 4IG3A 1S9FA 4ZIWA 4J9PA 4B3TJ 2ATCB 3MM6B 4EYHB 4DSKA 4ZHRA 1RTZA 2P6SA 3DXSX 3W2VB 1RT7A 3SDEA 2ZD1B 2HWIA 2W8KA 4LBHA 4OYBA 2OPSA 4NLPA 4Q0BB 1KTQA 2G13A 2M2BA 1AUSL 1RHMB 3R5CA 1N32F 1X4BA 1IKXA 2CQ2A 3UCZP 4DL6A 1HFEL 3M05A 3FBBA 4BC7A 1UVIA 1WEZA 2PIIA 1RSCA 4DEZA 2C1EB 3AAWB 3DOKA 2VFUA 3N9UC 5F8GA 4CIOA 3TARA 4F50A 1HR0J 1NUEA 2W24A 5HATA 5KG7A 3S01A 1TUWA 2QA4S 3EVWA 1RWUA 4P74A 4UOGA 1YX2A 2E1MC 1X8DA 4K59A 2P2CB 1MWZA 3RYLA 5KG4A 2PT0A 3PTWA 3KK3A 1HMVB 3DLGA 3AXKA 2CQCA 1NXIA 2W2OP 2DISA 2B5JB 2HHHF 1RT2A 2LECA 1D9DA 4ZCMA 4C8ZA 1FJGJ 4I2QA 3GPAA 2NREA 5C42A 2RD5C 1RBOB 4WTYA 5B0DA 1YITS 2AJ1A 5F8LA 2B6AA 4L74A 2ADCA 4DR2J 4IO1A 4EFAC 3AOAA 3OJUA 5E3RA 2QT7A 2B9EA 1D09B 3MPYA 2LXUA 3N0VA 2ADBA 3DLEB 1LW0A 2FUG9 4DR6F 1X9WA 3GB0A 2PMZD 3HHDA 4MK7A 5E3PA 2RF2A 5B08A 4F04B 2BE7D 5FJ4A 2JH3A 2G2YA 4RO0A 4ANDA 1S6OA 2HQGA 2QEXS 1HIYA 2XHWA 3VR1A 2V6AA 5F0WA 2CXEA 1Q8IA 3MOZA 4KR0B 3LP1A 4P7VA 3UDLA 4HVZA 2CKWA 4ZN3A 5HVGA 1K0TA 3IWNC 2A3JA 2R8JA 1K0VA 2FVRA 5ETPA 1U02A 3M4XA 3EZ5A 1N5SA 1ZH5A 1S79A 1V9OA 1EARA 4Y65A 4ZOSA 4B3OA 5T7LA 4JI1J 2JRSA 4YHHF 3BPDA 3CW2C 2AX0A 2DGVA 4PYDA 2VQEF 2CPJA 4F4WA 2MSTA 4AXIA 1X9SA 1N0UA 3K59A 2FJVA 3JAMU 4DCJB 2HVDA 2EWHA 3UQSA 3W2VA 1F3FA 7FD1A 3M9NB 1S76D 1UW9A 2GQCA 2JFKA 1VQPS 2B7CB 2UXDF 5GMEA 4ZKAA 5DQGA 1DTTB 3AOCA 3NS5A 1TK5A 3MOJB 1GXLA 2DIUA 2C42A 2ZJRQ 3RAXA 3E01A 4WIIA 1CBKA 2LQBA 2W25A 1DARA 4CYUB 2ALZA 1CVJA 1IQTA 1TV6A 2LQ8A 2ZKTA 3P96A 1SL1A 2CNLB 4P7TA 2XNRA 3TUIC 1G1XA 7FDRA 3P45B 5IT9Y 2OTJS 3MMAA 4MT1A 4DR7J 2BJDA 3UE2A 4CO5A 3DN9A 3WIVA 2F63A 3TZYA 1RAEB 3HI9A 1ZTTA 4IKAA 3VGUA 3GYNA 2MKYA 5C24A 3RGIA 3I87A 1FD8A 4KRWA 1AA1B 2RDJA 4KO0A 4CI0B 2V8GA 3NS7B 1M5HA 4TNOA 3KLGA 4DV0F 1L3SA 1F9FA 2DR5A 3DRXA 2B6AB 1QSSA 2DNHA 1NK4A 4JOUA 3JSMB 1ZM4A 3S1TA 3CIMA 2GW8A 4C6AA 2QFIA 3IS9A 3MZIA 4USTA 2MQPA 4G1QB 2V4QA 2DGSA 2RJZA 1RWVB 2MXYA 1VIOA 3LANA 4ZJLA 2V9WA 1LK7A 2OEJA 2PI5A 3MECA 4Y2KA 2OO4A 3N79A 1Q78A 2XCAA 2ZJPQ 3LP0B 2D3O1 3OBIA 3CD6S 2BJEA 4OZJA 2HYIB 1RT5A 1H7WA 3CJ4A 4V1Ak 1VC6A 2ZNZA 4ZP6A 5HROB 1NPPA 3MPWA 4PEOA 1VFJA 1WF1A 8RUCA 4K4WA 2JC0A 2IY5B 5G4DA 3R6GB 2XMAA 1J5EF 2XO6A 1VK8A 5JUMA 4GC6A 2ZHOA 1EB0A 3BR9A 4FYWB 4DX7A 2DY9A 4B9MA 4RWXA 1VJWA 3AXMA 1NHVA 3ZZUA 2OPPB 3R1LA 2R8GA 4C8KA 2DNNA 1RT3A 1JXVA 1RTDA 3CVKA 3PXGa 2W9AA 2KRBA 2HW3A 1NSKL 2K8GA 3CDUA 3OTCA 3MAHA 3IG1A 1WG5A 2FC9A 1XERA 2QC3A 2YPYA 4P9SA 3CJ0A 4U67Q 3T5HA 1OYEA 2QLFB 1GEHA 2OEKA 1SUQB 5LOQA 4R5PA 1KC8T 2FC8A 4ETXA 4K8RA 1S9EA 5CYMA 1T9TA 2DNQA 3BS9A 4ECYA 4NRUA 4UQGA 1FE0A 4X4TA 5ADZA 1S0NA 2DR6A 2YKAA 4M5GA 3OL8A 5HMXA 2VBZA 3LWMA 4LIRA 4DV1J 4M5MA 1Q53A 4X64J 4OYAA 3QWPA 4B02A 2YNFB 4AL5A 1WKJA 5E3QA 4LF6F 4DV5J 2GO8A 1NO8A 1B4SA 5FD1A 2W4DA 2QLXA 5ETSA 3B54A 4KH1B 2RRNA 5LXRA 2IRYA 2GMJA 4Q2LA 3OR2A 4MKAA 3QRQA 1QM9A 4NLSA 2WVDA 2QGFB 2AIRB 1M0SA 5IC4B 3C66A 4CLZA 3QMQA 4DL2A 3OJSA 5G0RB 1RKJA 1VCTA 2FHMA 4AL7A 1TL3B 1S1TA 2CQBA 5HMWA 3DI6A 3IBCB 1IWGA 5B0FA 3VAKA 2GMHA 2OJ3A 4FXDA 4ED4A 1RT5B 3IBWA 1CJUA 1Q95G 3MCSA 4TU7A 4KSEB 4M63A 1UJ6A 3Q8YA 2FY1A 4JI7J 1SJ1A 3HO1A 4RW6A 4M1KA 3QT5A 2PEHA 1X4AA 2V9KA 3N4WA 4XK8C 4OX7A 3V4IA 2O3DA 2RSQA 1NBEB 4LFBJ 1IVZA 1KN6A 1D1UA 3ZZ0A 3J7YU 4F2RA 4LSZB 2W7OA 4ZN1A 3ZZZA 2WVCA 1C0TA 1SH2A 2QA2A 3NGDA 2R7RA 4JI1F 3SCKE 3DKDA 4DX8H 1OY6A 4FKYA 4RL1A 1R3NA 2EK6A 3A8EA 4TVAB 2V2QA 3RW7A 2PDAA 2ASDA 4RW7B 3I0SA 3D66A 1REVA 1LNQA 3PDNA 1TVRA 5BYQA 2ZVIA 2NXJA 3CWJA 4B9UA 5KFZA 5DG9A 2ATLA 3TAMB 2C2MB 1HNXJ 2Z2LA 3IRXB 3PX0A 4DZDA 4C8YA 4WFXA 1HI0P 2FJXA 3F41A 2ZC3A 5CD4H 2DGQA 3FNNA 3BB5A 1WKKA 5CH7B 1HBMB 1YJ7A 3TW0A 4Z37A 2GQ2A 3BF4A 4DI6A 5KFMA 2MQQA 3CCRS 2V69A 1QE1B 2NPFA 1LW0B 3DLEA 2CQ3A 1RADB 3TVKA 1FRXA 3GV5B 1IR0A 3CO0P 1T11A 3LA0A 4X2BA 5L1IA 4ERDA 1HL6A 1X5TA 1TKZA 5LMUJ 1HQEB 2GAGC 2HG4A 2UUCF 5IZHA 2NXEA 3DLJA 2I5JB 2MMYA 1YBAA 3R5AA 5BYSA 2DB1A 2AYEA 2JLGA 1XR7A 4NLXA 3VALA 1TK8A 2IVMA 2CFXA 2NSCA 1T05A 2FHKA 1U47A 3X3UA 3NOCA 1WI8A 5K9FA 1F6TA 3MURP 1JB0C 2QO3A 1UVJA 3QIPA 2GHPA 5E2QA 5IM0A 3FBFA 3D54A 2P9CA 4F4KA 1T03B 1WHVA 2GNKA 3ELHA 2HRYA 4QPTA 1VQOS 4RKUC 2ILYA 2JHEA 2JVRA 4USUA 3DXBA 2I8EA 4LREA 1Q82T 3M8ZA 2XB2D 3GFZA 2KTQA 4FKXA 2YWKA 1IKYA 2QSWA 4RUHA 2XMUA 1XMBA 4P2SA 5D78A 1YGYA 1YG0A 3J7YI 2ZH9A 1TQLA 1PIEA 2HNZB 4DLEA 1HQUA 2D69A 3I0RA 1I6JA 4KYZA 5CAAA 4RNHA 1EJ7L 2VODA 4K50A 2P8IA 4ED8A 4A8WA 2POKA 3SDEB 5BYRA 4OYXA 3D2WA 4DR4F 2NUHA 2AJ2A 1RJJA 2CYYA 2FJDB 2GV1A 2KYZA 4JB8B 4NX9A 4P71A 4M5DB 4PWUA 4UOHA 4DPUA 1ZYQA 2MKKA 2OIHA 1MG7A 5IWAF 2HFSA 4RUCA 2B9YA 3BBCA 2GA7A 4CLWA 1AFJA 1VLYA 2B4UA 1HNZF 3HT3A 2GQQA 2L9DA 2I6WA 1UP1A 5I3PA 4GKKF 2QMUB 4DV2J 4A46A 2WSFC 2H4YB 4CT8A 1XMOJ 5C24B 4ETZA 4LT6A 2Q6CA 2VJVA 2XULA 3JS9A 1RTJA 2HNDB 2EBGA 1RT2B 2DHAA 2MQLA 3BEGB 1FNOA 3CJ3A 1V3ZA 4RR5A 4I2QB 3GYXB 2V34A 2V94A 1TUVA 1RT1B 2QSFA 3POTA 1IKXB 5B0AA 4A4JA 4UT4A 4C9DA 3CULA 4IFVA 4YUDA 3LAKA 1B0TA 1BQXA 1JK9B 2H4WB 2LEPA 4FVMA 2CNOB 4J7CA 2B43A 2OMOA 3CMQA 4I4BA 3Q8QB 3DRRB 2XMVA 1RYRA 3LP0A 2BDPA 3FQLA 2KVIA 2XTJP 2Z2YB 5AE2A 1XK8A 1JLBB 1RTHA 5C2GA 4I67A 5HROA 3GR1A 2VJUA 3SQOP 2FVPA 3TANA 1S4EA 3LP2B 4QQBA 2B9WA 5IM0B 2FVCA 4IRCA 2B5JA 3GZ7A 2EG2A 4KH0B 2RQMA 2FGOA 2VA3A 2GO9A 3FDSA 3THPA 4RU2A 4DMZA 3M30A 4CDIA 2V8VA 3HHLA 1N6QB 2OPPA 2OFHX 5L39A 2VPXB 2COLA 4DV4J 2R2RA 5KFYA 3R6LB 1RISA 2UUBJ 3C2PA 2DRAA 1S48A 4PRFA 3CGIA 3MEDA 3IG1B 4X4SA 4H4KA 2FLNA 2WRMA 1I94F 5CQGA 1FTCA 2C2NA 1S0MA 3T41A 1ZBTA 5F9NA 4N76A 2W7AA 4ANEA 4K5RA 2JVOA 2G0IA 2GJFA 4F4YA 4CNZA 5B0BA 4USMA 5D77A 1TL5A 3FFIB 2CG4A 1VMBA 3AJ2A 3LP1B 2VDIA 2RILA 2W2QP 1KONA 2MZQA 4IQMA 3SSRA 4CQ1A 1LWCB 1JJHA 2B0GA 2AJFE 3G82B 1DRZA 4C11A 3HSGA 2XGQA 2R7OA 4ELVA 1IBLJ 1U7LA 4OI3A 4JI2F 4MJKA 1K1SA 1TFYA 4F02A 1FFSB 1HKAA 3D6FB 1SC3B 2DH9A 3EM1A 4OJ3A 3Q8PB 4F4ZA 2W9CA 3PM9A 3J7Z5 3CCLS 1IR2A 1TKTA 3ET6B 3GG1A 3OR2B 4Y34A 4ZVOB 2AEJA 2BZ2A 3CJKA 1JLQA 4KKOB 3FSXA 2VFSA 4B3MF 2UXCJ 1RT6B 1R0AB 5F8JA 3VAJA 2AMCB 2P9EA 4BHQA 2HWTA 4NLUA 2VHGA 2CJAA 3WC0A 4I6AA 3M6UA 2XY7A 4PG7A 1IN0A 4JI0J 3MAQA 1HD1A 1YWXA 3M2UA 4DWIA 4ZPTR 1NDLA 5ETTA 2HMIB 5L1JA 3A8IA 3FCWA 4PPDA 1YTYA 4OJHA 3I32A 4HI1A 2E7XA 2JJ4D 4P73A 1RTHB 1XMQF 3JYTA 1N54B 3OXGA 2V4JB 3I5AA 5GAGU 1UJ5A 4URQU 4WU3A 1TMMA 4A8SA 2DPJA 1WC1A 4I2PB 4FNHA 4U95A 3KMQA 1X4HA 1KWMA 4GKJF 1FCAA 2XY5A 3AB4B 5J1NA 4JI6J 3M2RA 1U45A 1RGVA 4DPYA 4KHPF 1IR1A 2YKOA 2XMWA 1TTHB 3GJRB 4MFBB 1JXEA 4WE1B 3QGPA 4AXJA 3TRGA 1A0OB 1WHXA 1YVFA 2EK1A 4DL5A 4Y3CA 1C0TB 5K5MA 3PW2A 2BJ3A 1FEEA 1PILA 4MMOA 1Q16B 4NLVA 3ZZYA 2HFNA 2HFVA 3DOMA 2O67A 3GTYX 3H5UA 4OI2A 3ENQA 4UZCA 3UR3C 1SC4B 1RT3B 2YQ3A 3CTRA 4CLTA 5EGYA 5DQHA 3V6JA 1REVB 1SV5A 2ZZMA 4K4ZA 1I51B 5D3GA 2UUCJ 2XI3A 4F3QA 4KV8A 3O2IA 1YKWA 3T5LA 2ZFHA 2ZH5A 3R9LA 2KG1A 2IJFA 2VFVA 5D8HB 1OPZA 2KG0A 1HBNB 1NAQA 4KIAA 3UD4P 2HIQA 3EDQB 3KJVB 3MTKA 4R5PB 1J2VA 4ZJQA 3FFIA 5E7OB 1UVNA 5KT6A 4DR3J 1HQ2A 3RU0A 4O44A 4X65J 3TNVA 4PUOA 1H2UX 1SCJB 2ZBRA 4JV0A 2FZGB 2ASLA 3VV2B 1NB7A 3ZTSA 2HZVA 4DZ6A 4WKRA 2MYFA 1NCLA 3HVWA 4L76A 3S7RA 4ZVGA 2EC0A 2KFNA 3EGVA 2KH9A 2VONA 4OLPA 3HF5A 2CQDA 3VZIA 3NP5A 3W9HA 3G8TA 2YNGB 2PO4A 1X4EA 1APSA 1C1CB 3ET6A 3ENWA 3DGVA 1P8GA 4I7FA 2VDHA 1TELA 2DR9A 3LWLA 1DTQB 4XPEA 2Q66A 1Y5LB 1F9HA 4IFYA 1QUPA 3DNCA 4LFBF 2J0SD 3ADAC 2BW7A 5KFIA 4K4SA 4O4GA 1R8HA 1XNQF 1GFWB 2CNNB 2HS0A 1HNIB 4OX6A 2FJBB 1VBXA 2AZ1A 1YJWS 3ZZPA 1TL7A 3PRBA 1LKZA 2OAUA 1U24A 1WORA 1XIQA 3O44A 4IR9A 4NZ0A 2V4JA 4NXNF 1N32J 3I0RB 2MKSA 3P6YC 4U6PA 1IKWB 2UXCF 1DAXA 1XN9A 4X4QA 3KLIA 3E3XA 1UCNA 2R8HA 2RDDA 4ZVPB 1AZSB 2FHJA 4Q45A 4DQPA 5ETVA 1SKRA 5HBMB 4I68A 1I5OB 3GCXP 3M8SA 1YHQS 3IR7B 5AJ3J 1FWLA 3M8QB 2E1CA 2L08A 2ILZA 2ZUGA 3ENVA 5DDOC 2AV5A 2UUTA 4G3IA 1Q8KA 1HI1A 2ZE2A 1RAGB 3FEYB 3RBZA 3CCQS 5G0RA 1NKCA 2CPXA 2VQFJ 1OMSA 5BJRA 1C1BA 3HVAA 1TAUA 4CLFA 1T0TV 1JNZB 4JV5J 1NHUA 3R7BB 4L3NA 1MW7A 2QIFA 3QFWA 3PYGA 3IRXA 2J5AA 4W98A 3EVOA 1XQIA 3IN5A 5HP1B 4TY8A 4YDXA 5L8RC 3I5BA 5ETRA 3CDWA 4QIWD 5B0EA 3W5YA 2NLWA 3RBDA 2XLKA 3FBEA 1OWXA 3CDEA 1JLAB 5K20B 4H4OB 1Q79A 2IC3B 2HGNA 5FLXY 3BO4A 3L7UA 2CQIA 1HNWJ 3HHLD 2ZWOA 3LAMA 1O5JA 1DQAA 2XYPB 4DUZF 1WG1A 2XYHB 2HS4A 3LGHA 3A3OB 4ZP8A 4M8LA 2ROPA 4DN0A 4ZK7M 3V6HA 3PG9A 1C1CA 1OIAA 1Q0NA 1J5OA 2FZCB 2ZDPA 3JAMY 3I0SB 1WKLA 2YXLA 2HHQA 1SJQA 4U8VA 4NOHA 4CH7A 2HHUA 1R89A 5KFUA 3W9JA 3RRKA 1SJRA 2M7SA 1VQ9S 2L9NA 4I0WA 3T6JA 3CCMS 1J5EJ 4NZ6A 2EFGA 2GVZA 4EBDA 2M8HA 3KHRA 4LBPA 3PVXA 4ELTA 5K8PA 3NCPA 1RAIB 3CMAS 1KNZA 1UZHA 3ZO7A 5ETKA 3QLHA 3GIRA 3PY8A 2EFNA 3QYYA 4NEYA 4UTGA 4E98A 4LF5F 1S0VA 5EN1A 5HLFB 3WIUA 3TUZC 1QVFR 1RHQB 1BLUA 3VVUA 3L7PA 3W2WB 2YWWA 4C48A 2XZTB 5KFEA 3KLIB 3QO9A 2JLFA 3ZNJ1 1BWVA 2KFYA 3DRSA 2Q1LA 2D74B 1LWFB 1ZAWA 2HFZA 4YDDB 1OQ3A 1IWAA 4KQZA 2CNKB 1Q5VA 3NNAA 2EKNA 4XPCA 4JYAF 5A6WA 4DQQA 3TR5A 4X4PA 5ETOA 1S1VA 1KFSA 3UCGA 4O3NA 4DSEA 3W66A 4R8UA 2L41A 2AYGA 1F60B 1HLWA 2LQ5A 2V67A 1TL1A 4NMLA 2XZWA 3TEGA 3U1MA 5JJBA 1Y0HA 2VPYB 3EGZA 4DSJA 4JI5F 5KFGA 2XS5A 4CLSA 1GK8A 3P5BP 1HNWF 2BQRA 1RTJB 2HNDA 4DV7J 2CPYA 3FRYA 2O1PA 1JLQB 4KKOA 1PG5B 1KHWA 1BUXA 3AODA 3R3TA 1P9QC 3IGNA 5F0UA 3S8SA 2M4MA 1BGXT 1PBUA 2RQCA 4FN5A 1U1LA 1S97A 2NZCA 2UUAF 1RT1A 4ED6A 1N8RT 2H54B 3J80Y 2C2RA 5DGBA 2DCLA 2MJUA 1U6ZA 4D3HA 4F0MA 1GQEA 2HK2A 1VDHA 5HQMA 4QU7A 1FKOA 5KFBA 1F1BB 1HWIA 1UEUA 4E2FB 4WIQA 1HHTP 4USIA 1KLMB 2YNIB 3CJSA 9RUBA 2FGCA 4OI6A 3VGVA 3PIOQ 5KFWA 4UUWA 5I3UB 1J5OB 1ULRA 2AJ4A 3DFEA 3TUJC 3LGMA 4KJIA 1LWXA 1HMVA 3DLGB 1CC8A 4TYBA 1X0PA 3K5PA 5AXNA 4U8YA 2RRBA 3HVRA 3K5OA 1QVGR 1WC5A 1AROP 3ISND 3LP2A 1TKXB 4N77A 2CJKA 1RQ0A 5JXSA 3EXCX 2X1FA 4ECSA 4ECVA 2DGUA 2PA8D 2UVVA 2FHOB 1HBOA 3DOMB 4UOFA 3UNYA 2R2UA 4C0BA 3EWGA 3D3CJ 2GFFA 5D4PA 1RI7A 4DUYF 3N6LA 1GX6A 4JI4J 1G2EA 3ZFVA 4GMKA 3TA1A 4YY3J 5KFOA 2VICA 4J9RA 4ZIVA 1R8AA 2FD2A 1GXTA 2DXEA 4URSA 3UVJA 3GMGA 3DRSB 3LOUA 4JI4F 1RTIA 1MN7A 5C7PA 3PR4A 2QA1A 3G8SA 2CG8A 3IC1A 5HQ8A 1HNXF 3OQ2A 1QDUB 3IR6B 2RE1A 2IM1A 2DGOA 4MAKA 3V2UC 1U2FA 4BDPA 3D68A 1JLFA 3M6XA 2MLXA 4ZVQB 4LF6J 3G82A 3DM2B 2G1HA 1NJYA 2XSFA 1YJ9S 1PC4A 3AA9A 3Q83A 3QNWB 5IC6B 2G2OA 2VASA 3MMCA 3H4BA 2JDJA 1M5KC 1FWPA 2QG9B 2R7WA 3KLHA 3EZOA 4W4MA 3MM8B 4FS2A 2IA6A 5KT4A 4IG0A 3HCXA 3PCOB 4ZCLA 3L7OA 4ZMMA 3PYEA 5CA5A 5KFTA 3AOBA 1VRUB 4PXBA 4ZHRB 5D0RA 3SMZA 5K8NA 1TKTB 2BR0A 2B8PA 2Y8WA 1CJTA 3CCUS 3CC4S 3QWUA 3FK4A 3NWGA 2FJAB 4JUZA 4LVOP 4OHWA 1WI6A 3KLEA 5EX3A 4HHJA 5GAEI 3KDOA 2Z2MA 2G2ZA 3ETOA 4DR3F 1VI7A 1UEVA 3GCWP 3GFHA 5CD4A 3FGVA 2VF3A 4ED7A 1Q86T 4MK9A 3GIJA 4DUYJ 1FXLA 5J2NB 2GGPA 1LWCA 4WCEQ 1UVLA 2QFJA 2GJIA 2OTLS 3NWRA 1B0VA 4DPWA 5LT5A 3EGWB 3QJPA 3QQCD 2MLYA 3IAS9 3R7SB 2WSEC 2DHSA 1AXQA 2HKEA 1U1MA 1JLEA 4HHHA 1TKXA 2M9KA 1DY3A 2HURA 2ACYA 4YOEA 4K4XA 2VIHA 1R8CA 2DYAA 2XEXA 5K14A 4A8XA 4K0KF 2BEFA 3FKBA 1UAWA 4WWSA 2AD9A 4HHUA 3NS6A 4WE1A 1OQ6A 2W2PP 3OHBA 1RWPB 1BC6A 3VAGA 4C8OA 4JI3F 3AJDA 5F8MA 5HO4A 5DDPC 3OVBA 8ATCB 3SCIE 3M2UB 3MECB 2J7KA 1FK9B 2LKZA 5F41A 4QWEA 4OX9J 2ZC4A 2VZ9A 1B64A 1DURA 2A0FB 4KV8B 1VQSA 2AX1A 2DEJA 2GC8A 5THWA 3WDOA 4DS5A 3JYTB 2RS2A 3OFGA 4ED1A 2CQ0A 5A6PA 4UY8T 5HMYA 6AT1B 5IT4A 4DV7F 2FDNA 3FZ2A 3G96A 4L75A 3W7BA 2AT1B 2ZBPA 4HKQA 3MCMA 1X5SA 1UVKA 2PMHA 4RJVA 4O3PA 1XWLA 4LSLA 4J9VA 3ZZRA 3A8JA 4F3MA 4QWBA 1NKEA 1T7PA 4MFBA 1GNKA 4CTAA 1H38A 3C14B 1P9YA 4LF4J 3KK2B 1OS5A 2PI4A 1T02A 3CNQP 2QL7B 3MM5B 2HQIA 5A76A 2MZ1A 3SZ2A 2O5DA 2OSQA 2C22A 3CJ5A 4AT1B 2WONB 1VQMS 2KT3A 2R7TA 1JLGA 3CIZA 3KLFB 2D3ZA 3EXYA 4OV1A 1CS4A 3ZTQA 4PAAA 1PO6A 1QJHA 5J1EA 1Y7PA 4I6WA 5GAGI 5I42A 1N36F 1KVJA 1OYDA 2YWGA 1SUQA 5IS2A 5HL7Q 1NSQA 2HBQB 1H0HB 5ITHA 3LALA 4U7UK 4K2XA 1DTTA 1DQ8A 1WJ9A 2FJEB 4IFYB 2GVZB 2AEMA 3AQOA 2B7BB 9ATCB 3BJYA 1U0SA 2OKQA 4HT7A 3H90A 2RHQB 1JKHB 4IH7A 3QRRA 2DRBA 4CLUA 3DLBA 4WPAA 1HNIA 2MDAA 2X1AA 1W7WA 3RBEA 1LXNA 4KY3A 1IBCB 2AF6A 2XQCA 1R8PA 2CWKA 2G9OA 3I6PA 1U8WA 3NOGA 2IAJB 2KB2A 4JV5F 4BBYA 5DM6Q 4I64A 1TKDA 2NQPA 2C3PA 3D7SB 3EVMA 3DU6A 2EKYA 4M5IA 5J2MA 3KJNB 2ZOMA 2IFXA 3I96A 1QSLA 2GHVC 1KVKA 3UO0A 4DL0C 4N5SA 1ELOA 3QBCA 4R8UB 1YBTA 2NYIA 1KKHA 3KUGA 4DQSA 2IVYA 2AKWB 4HR2A 5IQ6A 2M8DB 2G0JA 4B3SF 2ZE2B 3GILA 2WZ1A 4ES3A 1SKSA 4OI1A 4O3OA 2LEBA 2Y8YA 1ZAVA 2KT5A 1BY9A 4FYVB 2BJ9A 4ZVSB 3WX4A 4EUVA 2DGWA 4HL9A 1QAYA 3LQVA 5H9EK 1UPMB 1ZZNA 2V2ZA 2R7SA 3OLAA 2GMLA 4M94A 2RUSA 4NMXA 4DX6A 2R9LA 2XLIA 2R8IA 3W5ZA 2Z30B 1IKWA 2QYGA 1ZM2A 3H2UB 2ZNYA 1UEKA 3N6NA 3PJWA 3QAEA 5KG6A 4ED5A 4USVA 1CEZA 2B4VA 2KU7A 4EEYA 4TXSA 1PSDA 4Q0BA 4Q8FA 2WVFA 3OL7A 4HDGA 2ZZTA 3CJ8A 3D9BA 4EWTA 1UWAA 3PYFA 3QT6A 2XS2A 2QL9B 3BN7A 4CCHA 1S1WB 4YHHJ 2IC3A 1RHRB 2UVUA 1VQ7S 3D1QA 3I9ZA 3PYDA 1M90T 4JI3J 5F8NA 5I3UA 3MUVP 1DQ9A 4RW7A 1D8YA 4LIWA 1VRQC 4DV2F 5A2QY 1N56A 3CCJS 2FY8A 5E41A 1Y3JA 2BRKA 2W01A 4P2FA 4DCOB 4X66F 4A8MP 3RAQA 1K73T 2MLZA 2HHTA 2XG8A 4DSLA 3HFZB 3ILIA 1R0CB 3W8GA 3W5XA 3HX9A 5A8WB 1ZPVA 4WFAQ 2R3VA 2KFZA 3OLBA 1UETA 4UF4A 3GFXA 4KTQA 1MROB 3FSYA 4OI0A 2EW9A 1AUDA 3RTVA 1IBMJ 1VQNS 4LVNP 1N5YB 2V63A 1Z1ZA 4X84A 4URGA 2WOMA 4QYRA 1QTNB 2ASJA 1S6QB 2XMKA 3Q23A 1NPRA 3BYRA 1RBAA 4ZJOA 2C2EA 4JBCA 2HBZB 4ID5A 1AYEA 2VL1A 3I4PA 2APOA 1P6TA 4P75A 3DMJB 2L48A 4RNNA 2JEJA 1FJGF 1REGX 1S6PA 1T95A 3T1HJ 3HULA 3EICA 4QIFA 1ZM3A 5L46A 2HHHJ 3NNHA 1U49A 1RWXB 2WHOA 4J5OA 4JI6F 3K89A 4NLWA 2XLJA 1XNRF 3WC2A 3ITHB 3HMJG 4B3RF 3U7JA 1FX2A 4U9RA 4LQ3A 4C2MA 4YR3A 2YKPA 4USWA 1JMTA 5HJXA 4CO2A 3Q86A 4CWBA 3HSZA 4ZPAA 2ZZNA 4YQWA 1QY7A 2NS1B 1Y4ZB 1L3VA 4OJGA 4OYIA 1G4CA 3MWBA 2KHDA 5KG0A 5B0CA 1R27B 4OLOA 4FF1A 3UDCA 3D6TB 4OQJA 1FFWB 4W92B 3MCOA 4CNYA 1IBMF 4C8LA 1FD2A 1VLOA 2YBVA 4JI0F 4F7VA 2DNOA 1H7XA 1WG4A 3W1YC 4XO0A 4OZ5A 3RRHA 3H4DA 4B3MJ 1R0BG 1TV6B 1RWKB 2CADA 4JV1A 3PRVA 1LFWA 5LMNF 1VHFA 1N34J 2H1YA 2YY3A 3DOKB 1U09A 4ZPBA 2V4RA 2VB6A 2GVDB 1X9MA 4PXDA 1TVRB 5DM7Q 2MB0B 4FPRA 4GVLA 1LW2A 4ALZA 3TEHB 4WFNQ 2NZ4A 5AT1B 3SQGA 1N5VA 4ZLPA 5A8RB 1TFWA 2JLEA 1FDBA 4OZLA 4QW9A 4NCAA 2VPZB 4KGZB 1RLDA 3SI8A 1DZ5A 4ZITA 5KFQA 3M1VA 2BRLA 2HVHA 2A1BA 4FXWA 3F0NA 1S6QA 3MM9A 1TKZB 1FI4A 2HAFA 2LCWA 1RAHB 2E29A 2LXFA 3GU0A 4C8NA 2DY1A 2W9BA 4YP3A 4M5NA 3M8RA 4ZLLA 3DOLA 4A8QA 3DMJA 2Y1RI 1VR6A 5K8OA 1M5SA 2ZHAA 1NH7A 2BA9A 2KKHA 3NCRA 4DF4A 2J6TA 5HSPA 5KOXA 2UUBF 4RW9B 2ZVSA 2QE5A 2JEIA 4LSLB 1Q1KA 4Z7CA 1PJ6A 2GAHC 5KFJA 2A10A 1VC0A 4AQYJ 3OL6A 2MKIA 2LQJA 2JZ5A 1YJUA 1N6QA 3MM5A 3OXFA 4LFAJ 1GMUA 3JQKA 5E33A 4CO3A 5HVFA 3M8YA 3X1LB 2CIMA 4ECXA 2O01C 2VD3A 3MM8A 4DCPB 5BR8J 3JSRA 1V3RA 1Q8BA 4OZNA 2AU0A 1KQGB 1D0EA 1CJVB 2PMWA 4CM0A 5F3ZA 1TZ0A 5KFVA 4Q5VA 1EP4B 4ECUA 4IQXA 2V50A 3Q2SC 4BWMA 1HPZB 3UVJB 3GIIA 1QAIA 5KFLA 2DRDA 2RHSB 2KXHA 4ATNA 2LU1A 3HHEA 2PFFB 4L6V3 4NLOA 3KLEB 2B4PA 4GRSA 3V4MA 5I4MA 3V81A 4USKA 3OUYA 1UW4A 1SQGA 2HRUA 1L5UA 3NGTA 1D3WA 3HZEA 2BQ3A 4P2XA 1Q4RA 3QT8A 4QCLA 1RT4B 2GVDA 1IBKF 1Q8LA 3FEZA 1S72S 1U48A 3D1HA 4QWCA 1H6KX 3CJTA 2DT9A 3HJFA 1WACA 3QRPA 1YLXA 3PHEA 3GSIA 5KFRA 4X62F 1LWEB 4GVBA 1VK3A 5IV3A 1H2TZ 5E0OA 5DG8A 4M95A 1P1TA 4F0KA 1WSRA 2YWEA 3CJKB 4ER8A 2DGXA 3VQSA 2JOQA 4E8UA 4M5LA 4ED3A 1FJEB 3PX4A 2YKNA 1DFDA 3M1VB 1PKUA 4ZPCA 1M1HA 1KD1T 1H73A 1WOOA 1UMJA 5C2CA 4XAKA 3T19A 2OPQA 1PAUB 5DRKA 4DPXA 3MM9B 4F25A 5J2NA 2GGPB 3DI6B 3IS9B 1FRHA 3I31A 3JTNA 3H0PA 3P4UB 4LR8A 3OVSA 5KG5A 1M1KT 1NH8A 2ZH4A 4IO9Q 4HH0A 1D9FA 5FLXU 4F0HA 2B56A 2Q43A 1JLBA 1N5TA 1ZS6A 1RA7A 1RAOA 1IXKA 3ZZOA 5A0YA 3PW7A 2VC1A 4DU8A 1FKAF 4LMZA 5CCMA 3IP0A 1JLEB 1JXLA 2VU5A 4B17A 1JIHA 1S49A 2MKHA 1KQFB 2NXNA 5HQLA 3R5BA 3CSKA 2BW2A 1IM6A 1VOMA 2OELA 1R8BA 4QR0A 5CHCB 3TJ8A 2LMIA 2VQFF 2DHXA 2EFQA 4NXMJ 3GIKA 3DLKA 2H5EA 2J0XA 2M3DA 1RHJB 3R97A 1NDKA 2XGPA 2VG7B 2RH3A 3CO9A 2JEFA 5J1PA 2IYIA 1IQZA 4C98A 2ZH2A 4PQUA 3DLHA 5J1EB 2FQQB 4P72A 4IOBA 3BSOA 3A12A 2OGUA 2N4DA 4HDHA 4R0EA 4U7UD 1S9GA 1HWUA 3F73A 2IMWP 3PEJA 4NLYA 1R43A 2W2MP 3MFHA 4IH5A 1N48A 2VOOA 4OYOA 3R2DJ 1HBMA 4LSNA 2YNHA 1S99A 3WX8A 3MUTP 1A7GE 1BXNA 4EU0A 4C11B 2LFVA 4RW8B 3AD8C 5LL6d 2V0NA 2DNGA 4HACA 4P52A 2I5JA 2CVEA 1FRJA 2LA4A 2F4VJ 4LRBA 2FZKB 1C0UA 3KK1B 2ZITA 2ACMA 1XR6A 3LF0A 3HSJA 1SIWB 2XHCA 3KLFA 1KHVA 3IWXA 2G1DA 1CS4B 4P10A 4PPZA 1FF2A 4Q44A 3OTDA 2XM3A 4LF8J 1DTQA 2HLTA 4ICLA 2OP5A 1IUJA 3R5JB 1IKVB 4OIXA 3UDVA 3DRYA 4YB5A 3UPFA 4QBUA 3PNIA 3DHWC 3GIMA 1OJ4A 2FIUA 2HPUA 5CZVA 4C4WA 1EZZB 2RU3A 4FPIA 2CJBA 4QWAA 3TJ9A 1BQMB 2L9WA 1DBDA 3N5BA 3OXLA 3L3CA 4EBEA 1S7IA 1HW8A 1HWKA 1R6VA 5SZTA 1FDAA 2WVEA 2QZ8A 2IBKA 4OZ1A 5KFSA 5EWGA 3TWZA 4QYZJ 1HD0A 2CPIA 1XTZA 4YY3F 2Y9HA 3MF5A 5GMKa 1SC6A 5KFHA 3MTJA 2F40A 1FWKA 2H5JB 3P5TL 3W62A 1Q7YT 1U6BA 3OFFA 3I5CA 3KUHA 2C2KB 1VQLS 4J9LA 1HYSB 2B51A 2F4FA 2GIFA 5ETQA 1BQNA 3EUNA 1WDDA 1NK0A 1P27B 1SPBP 4QYZK 4WZQA 5GVQA 1X7VA 3NGUA 2AYMA 2OEMA 3C8YA 5HN0A 1Z2ZA 1C1BB 4U7CA 4NXMF 3QSIA 1L3TA 4FYXB 3CT9A 1CJKA 3ENAA 2HQ3A 3B4MA 3K7RA 4PQUB 1FERA 4OYPA 5HK4A 4X4NA 3VGSA 2M70A 5E3AA 2YWFA 2RMLA 2EVZA 1ITPA 1RWOB 5IXUA 4N47A 3FMWA 2C2ZB 3I82A 1VC5A 4TY8B 2EI5A 3WHIA 3I56S 3CEDA 4DG1A 3MR5A 4N8NA 2RT3A 3H25A 2V2KA 2Z58B 3IA0A 1MROA 2KZZA 4FYYB 2QMWA 1NHKL 3POTB 1VBZA 4ES1A 4ILLA 1RHKB 2HGLA 1LV5A 5CCLA 2XMTA 5H1SV 2AGPA 1SQFA 2N4CA 3RUBL 4DXLA 4B3SJ 1Y9OA 3AY0A 3B8HA 4CM2A 1ZTWA 4RU9A 1T8EA 1NK9A 3MGJA 4RUAA 3CMES 4DL7A 1K1QA 3H98A 2DHHA 3OVAA 1O51A 4PG6A 1EETB 3FRZA 4Y2IA 4CRJA 4RW4B 2LA6A 3HVTB 2FYXA 1KR4A 4NLQA 3D1OA 2BM0A 1SB6A 3GV7B 1NZ8A 3G6VA 1NEEA 3AHPA 4OYZA 3CCWA 1TK0A 4ZCKA 3ITHA 4JYAJ 1BQMA 1TU0B 1EQMA 2ZJQQ 2MZSA 1YZ6A 3FBCA 2MEWA 4NA2A 4AL6A 1B0PA 1RKIA 3NLCA 2VG5B 3JSBA 3W63A 2AJQA 2DNYA 2J9CA 4FZVA 1G7CB 3PW4A 1CJVA 2JL9A 1NKBA 3I55S 2H9ZA 3K8VA 1X5PA 2LDYA 1Y3KA 2LLZA 2QTWA 3MEKA 4CLLA 2BBEA 5KTQA 3MR6A 4ID5B 2CPHA 1UWBB 4DV3J 2XNQA 3O8WA 4R25A 4ZPWR 2CJXB 1I94J 5HBMA 2CA9A 3OR1A 1HYSA 1HWJA 2HRTA 3FC9A 1H2VZ 5EWFA 1N36J 1K8AT 3OUYB 2FLPA 4M5DA 4WKYA 1YK9A 1E6VB 2HQCA 3M9MB 4DV4F 2V8HA 3GV8B 1NK8A 1KDNA 3HDSA 1TL1B 4L73A 3DYAA 4LFAF 2HWHA 1NJXA 3DDNA 3NMRA 1HA1A 4PWDA 5LM7E 5HJYA 5H9FK 2Q6BA 2X7IA 2I0XA 2HNYA 3GLJA 3MHYA 4ZCIA 3KKFA 4MIAA 4ZA1A 2LVWA 1SKWA 1UFKA 4WF9Q 3MM7A 4DR7F 2AEFA 4O3SA 4FP9A 2F7VA 5D0GA 5A8RA 3SQGB 4DHVA 4LRFA 2PSZA 1M1GA 2X1BA 3BREA 3GP9A 1YJNS 2OPSB 2IRUA 3TX0A 2UU9F 4HEA9 1YZ7A 5B0GA 5AXMA 4PG8A 3SV4A 4FF2A 2DIVA 4JP8A 3MFIA 2MGZA 3VAHA 4OX9F 2A2DA 1T9YA 1GMWA 1U1RA 4X4RA 4DFMA 4B9SA 4F8RA 4MYUA 3Q24A 3SYZA 1X4DA 4O23A 3PIPQ 3DOLB 2IBOA 2CPZA 3C15B 2DHGA 4OHVA 5A0YB 3TYTA 3KUEA 2XC9A 3DLLQ 1IM4A 2C2DA 1N33F 3J81j 1NLKL 2MKCA 4RW9A 2F9JA 1B3TA 4YB7A 5JVHQ 2LU2A 3M2RB 2H65B 3M8PB 2BKOA 4H54A 3BKTA 1WHYA 3TOQA 3CCES 2EBEA 2CQHA 4A8FA 2BX6A 3IRWP 4V19X 1HBOB 2HGMA 5CYJA 1FNXH 1UPPA 3OSNA 1HNZJ 1SBRA 4B9LA 4QIGA 2RVJA 5LMNJ 4KT0C 1YI2S 1SIZA 4Q8EA 2N3LA 2IDEA 1RUSA 1WF0A 4FVCA 2RF2B 5C25B 1WC6A 1WNEA 1EP4A 1CULA 2DNLA 1DJ0A 2BOAA 2WBMA 2DD8S 2W4PA 3GE9A 3TO8A 4CT9A 5MLCV 2J8SA 4DR4J 4QR1A 4Y2AA 1RZMA 2W8LA 1RLCL 2VG6A 8AT1B 2Z56B 2BABA 2E1AA 2UVWA 2YNHB 1BHNA 1CQMA 2OPRA 5E3CA 4RX6A 3FSIA 2E44A 2VQEJ 2UXBF 2D7SA 1FJCA 3EDRB 1UFLA 2NXCA 3B4DA 2XSJB 4Q2MA 2ZUAA 5AXLA 1RT4A 3G4SS 3MR2A 3MEEB 1U0HA 4C3LA 2J9DE 1QUVA 4OJ1A 4N7TA 2X3GA 3T1YF 1N52B 1P1LA 1RCXB 3DRPB 2OMLA 5HVHA 5F3TA 2IMOA 3H7HB 4ILRA 1NK7A 3VAMA 1E6YB 4DFPA 1U4BA 1HR0F 3GR0A 3LH2S 1OO0B 2WW4A 2W9CB 4KAIA 3THVA 4IRDA 2XI2A 3J81U 1F5CA 2N7YA 2YKNB 4G6VB 3ZZTA 4CO0A 4O3QA 5KT5A 2ZH8A 2BMBA 4ZVEA 3TZZA 3PV8A 3BN4A 1RT6A 1R0AA 1NMEB 1Y11A 3BSCA 1NSPA 4O4GB 4YEAA 4MIBA 4B08A 3UFCX 1S0OA 3HHLC 2DBBA 4DS4A 1GAOA 4NI2B 2B4OA 2F8HA 4DV6F 2C28A 4MKVA 3BYPA 2HVIA 1TL7B 3PJXA 4DR2F 1HI8A 2GIRA 3WQPA 4K4TA 4RPFA 2RB7A 1G3OA 3VVTA 3K58A 5BXIA 5GADI 2NPIA 3OSPA 2VV5A 5F8HA 1RABB 6FDRA 3PO4A 4I2PA 1LWEA 5K14B 3NRBA 3H59A 4GVBB 3CPWR 3BBFA 3FQKA 1W25A 4KO0B 1PC5A 2B8QA 3NAIA 4X66J 2Y1IA 3UCUP 2K1RA 1HBUB 2BJ1A 2EXUA 3KDNA 1UVMA 2QLWA 1KOHA 4Z7YA 2G4BA 3PEHA 3A13A 2HS3A 4ECTA 5KG3A 3D4JA 4WZMA 4GKJJ 1RXOB 1B7FA 2DH8A 4NA1A 5LSLA 2OPQB 3I9V9 1URRA 2JX2A 1CJKB 1TR0A 4WFYA 4L3KA 3QZ8A 2NR0A 5E5NA 2UXBJ 1JQGA 1KQSR 4H4MB 2YVSA 1XMQJ 1SV5B 4RBUA 5IFMA 2WB4A 4DN9A 1A6LA 2WCXA 3EGNA 3L9ZA 3D5MA 1GH8A 2BE2B 2KXFA 4U96A 3W60A 4F26A 1U1NA 3O3LA 1O6XA 4RBTA 1B70B 1FNMA 3KJVA 4A8KA 3TZWA 1FVQA 2KVQE 3LW5C 3KHHA 4FF4A 1KP6A 5D15A 2KHCA 5L1LA 3QSYB 3I4HX 3DM2A 5L9NA 2Z2ZA 5KT2A 4Y28C 4YR2A 2W7PA 3QATA 3AJ1A 1S1UA 3KG0A 4H4OA 2HHVA 4HACB 5MAOA 3DLKB 3KLHB 3B82A 3T1AA 3BGRB 1RTDB 4X62J 3RZAA 3SIPB 1SH3A 1C0UB 3KK1A 1HNVA 1X31C 1XJWB 2KL8A 5DDRC 4RW4A 4FDFA 4HH1A 3UN3A 5EHHA 1VRUA 2YNGA 1IBLF 2ROGA 4UW2A 2MZRA 2KDOA 2ZOGA 1MU2A 2PGCA 2A6OA 2XMMA 3A3PB 4NZ7A 2LP4A 2AGOA 1S9GB 3T1YJ 4N8OA 5DDQC 2AW0A 2V2VA 5H9FJ 2KYXA 1S9EB 5CYMB 1LOUA 1RWWB 4D3GA 4DV1F 1YJTA 2CRLA 4NI2A 4DBQA 4EO6A 2N82B 2E5LF 3ILLA 1MMNA 4ZVRB 2NYHA 3CCSS 3TQ1A 3CXCR 2HK3A 1URNA 1U1OA 5IT9U 2VOPA 4Y2CA 4TY9A 3FZBA 2XCPA 1LK5A 2CJQA 3D6MB 1PAEX 3TX8A 3KWMA 3W65A 1MWQA 2WW8A 4J37A 3BGOP 2OLWA 3GG0A 3VAIA 1NNDA 3AQPA 2FLOA 3CDAA 5J2MB 2B3TB 3KXDA 4CZCA 4OHZA 3TA0A 1HBUA 5LJ3Y 2I1RA 4ICLB 2GJ2A 4PZVA 1IKVA 3M6VA 4Y00A 4R0JA 1E6VA 2R42A 2JNJA 3VAFA 2AZ3A 1OPIA 2ZBQA 3LTOA 4DFKA 2VPWB 5C5JA 2MTLA 4DUZJ 1UZDA 4ELUA 3QJJA 3JSMA 1S1TB 2R2SA 3FJ2A 3R8YA 3CDBA 1KBRA 4OHYA 5KFCA 1ROFA 4NLRA 2E7WA 2CQ1A 1FXDA 1SKUB 2PD1A 1CJUB 2RNEA 1KQKA 3TP2A 2BE2A 4PABA 3ZTPA 2HBYB 3CB4A 2BV3A 4O0IA 2ASYA 1W26A 2HHWA 1MMLA 3W64A 4ZS6A 4NYZA 1KFDA 2ZEJA 1VQ6S 2KN4A 2LDIA 3F56A 3L95X 3V4IB 3U27A 4AUKA 5B7WA 2KI2A 2E5LJ 4KGVB 3QFHA 3R5DA 3M2VA 1B99A 4HTJA 3UI3A 5L38A 2MGZB 3SXLA 2RIJA 1EHWA 3CC7S 3TAQA 2CDRB 4Y2MA 2J9DA 3KK2A 3EMTA 4XDDA 2V68A 4UY85 2K3KA 2H3EB 2EFVA 4J90A 4S0MA 1SXLA 4ANCA 1NZAA 2CZ4A 1SJ3P 3AB2B 1HNVB 3RW6A 4NE9C 3PRDA 1WC0A 1JLGB 4DPOA 1EETA 1VQKS 4NRTA 2D41A 5LXYA 5A8KB 4Z2XA 1VQ8S 1RU1A 3KK3B 4F67A 2DCUB 3T9ZA 4C7QA 3MPUB 2MZJA 2GHWA 4AYBD 3BQ2A 1H3DA 1OY8A 1J27A 2F8EX 1NJWA 4PCQA 1JKHA 2P6TA 2F5GA 3HD1A 1V3SA 4EGLA 3PW0A 1EAYC 2ZKUA 1QE1A 4OV6A 2P9GA 5ETLA 3IMQJ 3IBFB 3KNAA 2XWXA 4NPOA 1BD6A 5D4OA 2NXUA 2FJWA 2X51A 4GC7A 3C3LA 2FVQA 5LSOA 1T3NA 1B7YB 2ZH7A 3M32B 1KOOA 2LXIA 3PHTA 3AFGA 4WK3A 2FLLA 1ZM9A 3QO9B 4NCGA 4EI2A 1CPZA 2VKZG 1NK6A 4IR1A 4KFBB 1ZA1B 2A18A 2J6UA 4DOZA 3HVTA 3OR1B 1ZPWX 2DJWA 1NJIT 4I56A 3AH6A 3IWLA 1F5BA 2HSEB 5T41A 2MSSA 3W3SA 2V8PA 3KJQB 4I6YA 1KEKA 1S1VB 3FUYA 2JSXA 4NLDA 4XTTA 2BYCA 4PG4A 4RUBA 4PWDB 1Q7LB 3HSDA 4PXEA 4TU9A 4QR2A 2Y0BB 2HNYB 3BDEA 3TVZA 1I3OB 4ID8A 2RU9A 1GTEA 4ZLJA 1AW0A 1HQUB 1FA0A 3FCHA 2UV8A 3L4BC 1L3KA 3D3BJ 4TQRA 1RE1B 3V6KA 3O6QA 5LMUF 5B09A 1U1PA 1WEXA 4RW6B 1T9VA 3PFOA 4WFZA 4K4YA 5GMDA 4K4VA 4LF4F 3EZUA 1KTVA 2CZ9A 1RCOB 2I9SA 3M2VB 1WDTA 3CD7A 5D6GA 4KB7A 3H5YA 1IJFB 1MMDA 2IYGA 2YTCA 3SCJE 5JVGQ 3QT7A 1K47A 2E5GA 4PXCA 4DR6J 4OZ0A 4ED2A 1FKOB 4ZVTB 1S12A 2HEKA 2GS8A 3D0GE 4LRAA 3GJSB 3VTIA 2DVIA 4QU6A 5M2RA 1WEYA 3PZPA 2PE8A 2RS8A 3MEGA 3LUYA 3O1LA 3HM9A 3BGFA 2FVSA 4DPTA 2DK2A 4QZVB 3CC2S 2BACA 3T1HF 4LF8F 2YX4A 3K5LA 3KTQA 1FO1A 2A2CA 2DTJA 2IDLA 3E8OA 4M5KA 3BKUA 4PG5A 3BSNA 4YB1P 4DSIA 4RNFA 3OHAA 1YIJS 4J91A 1ZZFA 1G6BA 4WTOB 2FPHX 1F5AA 1EIYB 1VRTA 1HWLA 2FB0A 3HFKA 2HFUA 3BPSP 1PJ5A 2WOMB 1H98A 2D9PA 3HP6A 5L9XA 1U6FA 2E66A 2LEAA 1XC9A 3DU5A 2X3DA 5J2PA 5C25A 1CULB 5RUBA 3H5XA 2CQPA 2HVZA 1JJ4A 2JEGA 3OT9A 2K06A 3D0IE 3NG8A 3V6DB 2KRRA 3FMBA 4RWWA 5AE1A 2RRAA 2C3YA 2VG6B 1DLOB 1XEZA 1PCAA 2DEIA 2R8KA 3JQMA 3SSSA 5F9LA 1EQ0A 1FFGB 1FDNA 5EWEA 5F8IA 1JLFB 3D28A 4FS1A 1VJQA 4ED0A 3QGIA 4DQIA 1N0VC 2BOPA 2J0QD 3C14A 3CJQA 3Q8VA 3HHLB 1O8BA 2E5HA 2L3MA 2KT2A 1PYTA 3K17A 4QWDA 3BGRA 3MEEA 1U0HB 2MQNA 3MMCB 3KHLA 5H9EJ 5T7LB 2E1RA 1N33J 5FIIA 2F65A 2AJ0A 1GX5A 1FRLA 1WF2A 3HJVA 2Z57B 3IR5B 1ZAXA 4X64F 4C3MA 2F1FA 3BSAA 3M7VA 3OTOF 3C46A 5I42B 2J6SA 2HIYA 2CJ9A 2RAQA 4ITSA 3AD9C 4NEZA 4ECQA 2DH7A 3G8QA 3UNGC 3GQCA 1VQ4S 3NGKA 2KJWA 4NYOA 4LBIA 3BKFA 1RWNB 1SI9A 5AE3A 1X0FA 4WBFA 4ZPDA 2XBPA 3LPEA 4CP5A 1UKUA 2V8DA 3ZXWA 1VBYA 1YRTA 4J9NA 2W4CA 3K8WA 4C97A 2Z4PA 4NWBA 4LFCJ 1AFIA 5IV4A 1PJ7A 1FKPB 2VH7A 3KFWX 3UWTA 3NBPB 2MQ8A 3GFYA 4EBCA 4P6QA 3R2CJ 3D67A 2UUWA 3QJLA 4LR7A 1OY9A 3MMAB 2BANA 2YWHA 2HQDA 1LW2B 2BJ7A 3CE8A 4YR0A 2D1CA 4OHXA 2MKJA 3RB6A 3SFGA 3HT0A 3SEOA 1NDPA 1LEOA 3Q22A 4NYPA 4WFBQ 4EZ9A 1VYAA 4C8MA 5D0EA 2ZHBA 1VRTB 5J2QB 4LJMA 5FDLB 3M8WA 4KHMA 4IOAQ 2DNKA 2VBXA 3MAAA 5HAOA 1JX4A 3Q8SB 1GMVA 1Y5NB 4IFVB 3IM8A 1TL3A 1SH0A 5J2PB 3WZ0A 4DR1F 4H4MA 4OL8A 1TMJA 3IXQA 2W9BB 4DDFA 3RB3A 1RB0A 4G1PA 3RG6A 3J7AN 3CD5A 3NEKA 3KMSA 3K5NA 4DR1J 3G6YA 1DLOA 5HMZA 1YJRA 4MTPA 1K44A 1KSPA 3FVYA 2YQ0A 1FT8A 2EG1A 5CYQB 1D9AA 1OSDA 2K7JA 4Q7AA 1C4CA 3OTOJ 2PEBA 4FBUA 1EKSA 3TJAA 3NKYA 4OZ2A 1WD6A 5GADU 1Z4UA 3OW2R 2IJNA 2RQ4A 3N6MA 1JJ2R 3P49B 2XWYA 4G65A 2R7UA 4ES2A 2AYBA 3G86A 1QAXA 2VG7A 3GSDA 1L3UA 4ZVUB 2YQ1A 3U02A 2DXDA 3T5JA 3RR7A 1GTHA 3MEDB 5D0HA 1NK5A 1O0PA 4TLRA 2WTFA 4DSFA 4XIUA 1VHIA 1PBAA 1VIXA 4DFJA 4FBTA 1MU2B 2DXFA 3ETMA 1MN9A 3GYGA 4TN2A 4LF9J 2BUNA 2CJYB 2OUGA 3UW1A 4IRKA 2CPDA 2R4FA 3T9NA 5A8WA 4K4UA 1D8ZA 3C16A 3DGPA 2QYCA 2K2PA 1HHSA 3HKZD 4AD6A 1N5QA 1WELA 1UJ4A 3RRGA 3NNCA 2QJ3A 4ZP9A 3KHGA 4FYDA 3MPDA 1N5YA 3NBPA 2RDIA 3P8BB 2KXNB 2WBRA 3OV7A 2YPZA 3ICLA 4OX8A 2Z0GA 3BR8A 2MQOA 4J9QA 2CPFA 4HTIA 2CZVC 1HQEA 2IM2A 3AA8A 2U2FA 3BV8A 3C6TB 3OTEA 4USJC 5GAEU 3TUPA 4NCGB 6FD1A 4F4AA 4KFBA 4J9UE 4QW8A 3MPVA 2E1PA 4OYMA 5KFXA 2H5IB 4B9TA 2HQFA 3KYLA 1T94A 3DDKA 2HVEA 3U1LA 4CO1A 1U25A 1TUGB 5AJ3F 1C2PA 4PKDB 4DF8A 3SBMA 3HK2A 3J7ZT 1T03A 5D4LA 2Y0SD 3MAAB 3MR3A 1YRUA 2E9TA 1UTAA 1LQ9A 2E5JA 4RNMA 4OYWA 1MNEA 2X1GA 4DV6J 1IKYB 2R7QA 1VISA 3HD2A 1TP7A 2ABYA 2BE9B 2PFDA 5M2UA 1WOSA 2VBWA 4LRDA 4NXNJ 2M52A 4OI4A 2MY8A 5DJBA 4UZBA 1IJEB 1W2BR 4MKBA 3UD3P 2Y1JA 1FDDA 4J9OA 2Z8QA 3HPOA 2IPOB 2DITA 4QIVA 1T9XA 1XNQJ 1S10A 2HHXA 1W2IA 4IUFA 2C3UA 3RB4A 5KFKA 3NAHA 5LJ5Y 3G71S 4YFUA 2Q79A 4QOTA 3HHNB 4USHA 1S1WA 3GONA 2XMJA 2AP6A 1F3VA 1BMQB 4KPCA 4MYTA 5SUHA 2HLUA 2CWXA 2ZH3A 4JV2A 4B3RJ 1JLCB 1SVDA 3KJFB 2F4VF 3MEGB 4ZVHA 5D3GB 3JQJA 2YH1A 4UUXA 1NM2A 3RB0A 3MD3A 5A8KA 3ISNC 2QA4G 1HBNA 3H2VE 3LGNA 3VCDA 1RDRA 3V5RA 3OL9A 2YX1A 4O4RA 3TAMA 5HP1A 3TQEA 3Q2TC 3BBBA 4LSNB 3MMJA 2QMXA 2OSRA 2HHSA 4EZ6A 2UUAJ 4X4OA 5GAHU 3Q8RB 2KO1A 5DZ7A 2YKQA 1JLAA 1R6YA 2ZWPA 3BH7B 5CXTA 3DCAA 4LF9F 3CCTA 3B6BA
chains in the Genus database with same CATH topology
1S4FA 4ZDNA 3C6TA 3DRRA 2WSCC 5DETA 1MSWD 4F2SA 1BWEA 2LQ9A 1JWWA 2MHEA 2RQKA 2V5HG 3BM7A 3THTA 2KJVA 3A1YG 5I3QA 1QTMA 3P3DA 1FRKA 1T05B 3BQ1A 5KAKA 3VF0B 4C0HA 1YQHA 3UR0A 2DPIA 4KHRA 1FVSA 3VWSA 1SL2A 1ZETA 3M30B 1T3OA 2RKIB 2HZCA 3OTBA 5KT3A 1UL3A 2KM8C 4NCBA 4EO8A 1JNRB 3M32A 2GX8A 1HPZA 2HNZA 1QAJA 2ZD1A 2MZTA 3QPIA 4HYKA 4UQTA 2MJNA 2YH0A 2NUUG 3SCLE 4C0OC 1DHMA 4ECWA 2Q3PA 1FTRA 3V81B 1RP5A 2J7UA 1VGYA 3IFEA 4K5SA 1BQNB 2OH2A 4W90B 4NLGA 4LUBA 1FKPA 1R7IA 2YX7A 3CCZA 4RZRA 2EFOA 2K7KA 4DL4A 1JLCA 4PR6A 3PO5A 4O3RA 4G1IA 2PC6A 3MM7B 4ZPVR 1TAQA 2BM1A 5CZXA 4JI8F 1HARA 3L09A 1CC7A 3F44A 3EYZA 2XO7A 2CQ4A 2GCFA 3HZGA 1TL4A 5L1KA 4DV3F 4DQRA 1RT7B 3GWCA 5C42B 3BDPA 3MDFA 4DLGA 3BO3A 2ZBCA 2ZH6A 1SL0A 2OFGX 2IA0A 3CCVS 2DR8A 3JTPA 5EX0A 3DHXA 2UZAA 5HI7A 3EPGA 2HMIA 3KG4A 2YNIA 5IQQA 2D9OA 4FF3A 2HFOA 1UFWA 2VKRA 3G6ES 5KG1A 4I69A 2U1AA 1KVIA 5BR8F 4HI2A 4J9SA 4YB6A 5K8MA 4N41A 3WBZA 4I1TA 3OFEA 3CF5Q 2B9XA 5KFAA 1SJ4P 2DR7A 4AQYF 3J81Y 4B3TF 2ROEA 2VA2A 1XBWA 2CPEA 2HAIA 2RKIA 1FRMA 3C6UB 4B3OB 2VG5A 1N4LA 4BC9A 4TU8A 4LFCF 2DO0A 3HHKA 3QLHB 2J0WA 3D0HE 4OFZA 3MXHP 2RUGA 4A8OA 3PKMA 3M9OB 4WYLA 1S1XA 4UOCA 1OSCA 3HXMA 2DNZA 4TLQA 3US5A 4DL3A 2K3IA 4IH6A 3V6DA 2NSBA 3IAM9 1LXJA 3QAUA 4WK1A 4QPXA 4PQAA 3M6WA 3VZHA 1C4AA 3MUMP 3HLUA 1FXRA 4WU2A 4WJBA 2XSJA 4PUOB 3SFUA 1V6HA 2M5YA 4BWJA 3K57A 2HHPA 4H4KC 1KLNA 4BS2A 1Y00A 1SQEA 3O5TB 4B9VA 1X4GA 3JTOA 3LPYA 4OMFG 3CD0A 4HLBA 4Y0FA 3Q0AA 3N28A 1VS3A 3E51A 4LF7F 3CJ2A 2J8AA 1FE4A 3QZ7A 3MM6A 3TAPA 1VQYA 4Y6IA 1X5OA 2ERRA 4IDKB 4A47A 3IO1A 1M5PC 4LQ9A 1YRXA 3R1HA 5M2PA 1FRIA 4X65F 1HW9A 3MMBA 5J2QA 5DO2A 2FHJD 2QRRA 3T3FA 1U1QA 4KGKA 4QIEA 1Z2LA 2F3JA 2I38A 2PA3A 2XY6A 1QSYA 2J9EA 1S7HA 4CH1A 2R2TA 3ISZA 1X4CA 2ZBIA 2N3OA 3BQ0A 1KLMA 4IOCQ 1R31A 1CG2A 5LSRA 2QV6A 5KT7A 4J9KA 1U2RA 2YKMA 2WB1D 3E2EA