1C1BB

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
432
structure length
415
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYNLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 113
structure length 415
sequence length 432
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bB03
3DOLB 2FVRA 1S48A 1C2PA 1S9EA 1LW2B 2IJFA 2XC9A 5K14B 5K14A 5L1JA 5KFTA 3I5AA 1S9EB 2J6UA 3KHHA 1S9GB 5HBMA 5KT7A 4QWDA 3GIMA 3DYAB 4J9PA 2RKIA 3I5BA 3H5XA 1LWEB 2HAIA 4ZHRB 3MF5A 3MR3A 1JLCB 1TKZB 3G6YA 2HNDB 2UVRA 2C22A 4K4SA 4Q43A 2WK4A 3MR2A 2IJNA 4IR1A 4NLXA 2IM0A 1BQMA 1HQUA 5KFWA 4NYZA 3T5JA 1JLQB 5EDWA 4YR0A 3N6LA 3IGVA 4Q0BB 3KLHB 2WTFA 1RTIA 2RDIA 4LSLB 3KJVA 3T5HA 4IFYB 4Q0BA 2D3ZA 2VG7B 2ASLA 2O5DA 3HVAA 2YNIB 4ZP9A 1S1WB 4I2PA 3IG1B 3QLHA 4PQUB 5JXSA 2HNDA 1IKVA 3MEEA 2BANA 5J2QB 5J2NB 5CYQB 2C2EA 1QAJA 5C24B 3CDWA 5J2MB 3DYAA 4IH6A 3DDKA 3MECB 2OPSB 2FVSA 3FFIB 5KFLA 1S9GA 2B6AA 2DPIA 1S6QB 3DI6A 1VRUA 1T03A 1S0NA 3DLEA 1REVB 3SFUA 3IS9A 2BQ3A 2FLNA 2FVQA 4ECXA 5C25A 5KT3A 4JV2A 1RT4B 3MEGA 3DOKB 1SUQA 1S49A 4ZP6A 5KG0A 2HNZA 4ED0A 3GV7B 5KFXA 4H4MB 1N6QA 2OPSA 4LQ9A 5KFDA 4O4RA 3TVKA 3V81B 4ED1A 3FSIA 5J2MA 3C6TB 3ITHA 3D5MA 3HKWA 4J9SA 4DL4A 2FLLA 4H4OA 2GC8A 2V4RA 2YKMB 4F4YA 1JKHA 3H5SA 1HQEB 2C2DA 3V6DA 2XWYA 3QLHB 4PQUA 5KFHA 3M9NB 2EC0A 5I3UA 4KFBA 4DEZA 4O3OA 1SH3A 4TYAA 4ECUA 2ATLA 2OPPB 3FDSA 5C5JA 1TKXB 3T5LA 3RB6A 2R8JA 4LSLA 2B43A 3T19A 4NLOA 4RNHA 3KLHA 4ZP7A 1GX5A 2XI2A 5KT2A 1JIHA 1RA6A 3Q8QB 5F8NA 3KK2A 3BQ1A 4O3QA 1IM4A 1JKHB 2AGPA 4DL7A 3I0RA 3DRPB 3LP0B 2D7SA 2W8LA 2IMWP 2VA2A 1D1UA 3OL7A 4K4YA 5KFEA 3ISND 2F8EX 3MFIA 3PW5A 3OLAA 1RTHB 2IM2A 4IFVA 1SUQB 3PVXA 4KE5A 2J6SA 3C6UA 1IKWA 1SH2A 4F50A 4MK9A 4DL3A 2D41A 5DQGA 4QWCA 4KB7A 2W7OA 1RTJA 3M8QA 1N56A 2BE2B 3CJ4A 4MIBA 4TQSA 3UPFA 4F4WA 4ECYA 1TP7A 1JXLA 4XPCA 3LALA 3KLFA 5L9XA 4WXWA 5F8MA 3FFIA 2JEJA 4WE1A 2OPRB 3DRRB 4K4ZA 4RW8A 2W7PA 3KLVA 4RW6A 2GIQA 5J2QA 2BANB 1IKVB 2R2SA 5HLFA 1K1SA 2IAJB 1QUVA 3CVKA 3SI8A 3PW0A 2CJQA 4EEYA 3KLFB 4IRDA 4KKOB 2AWZA 2E9TA 4IFYA 5KFBA 1RYSA 3MEDB 4RW4A 1LWFB 4JUZA 2VG6A 2HMIA 3DLGB 3OL8A 2V4QA 2E9RX 3IRXB 3JSMB 2VG5A 1FK9A 3GILA 5CYMB 5D3GA 3FQKA 1S1TA 4EBDA 1RT6B 1RTHA 3KLIA 5HP1B 5KFVA 1NHVA 3KLIB 4O4GB 5HP1A 1FKPB 3DRSA 1MMLA 4ED7A 1RT7B 3QGIA 4RNMA 3RB4A 4Q8EA 5KG1A 3NBPB 4Q44A 3DLGA 4IG3A 4R0EA 1YVFA 2R2UA 4RNNA 4ED8A 1IKYB 3KMQA 3DM2B 3E51A 4RZRA 4WYLA 3N6MA 4K4XA 4HYKA 4ECVA 2XGQA 4RW7B 1R0AA 4KV8A 4ZVFA 4IR9A 1TV6B 5C42B 3PW4A 2IAJA 1SV5A 3BREA 1EETB 5HLFB 1S9FA 3V6DB 4NRTA 1HQEA 2WRMA 4KO0B 3V6JA 3BQ2A 4WYWA 2D3UA 3EPIA 4K50A 5KFCA 1S1VA 4RW8B 4NLQA 3NAIA 2OPQB 4O3RA 2OPRA 3DRRA 2JLEA 3KLGB 3KK3A 4QW9A 3E01A 1HMVA 3ISNC 1LW0A 2WOMB 2R2TA 2UUTA 4Y2AA 1RT4A 3HVWA 4TXSA 1RDRA 4Y34A 2ILZA 4IG0B 2I1RA 2V0NA 1DTTA 4NLTA 1S6PB 4IOBA 3KMSA 1S0OA 2WONB 4ZVEA 1BQNA 4O44B 4J9KA 1T03B 5L1IA 1S6QA 3DI6B 5F8IA 5KFPA 4TYBA 4U6PA 2BRLA 3H40A 3M8PA 3GV5B 2BRKA 1HNIB 1MU2A 4I7FB 1I6JA 5J2PA 4YR2A 4J9QA 4WZMA 5J2NA 1ZTTA 3NAHA 2IC3B 1TL1B 3MEEB 2HWIA 5KFMA 5EWEA 2W9CA 5HROA 2GIRA 2DPJA 1IKXB 4O3PA 1WNEA 4DL6A 5DGAA 4H54A 4YQWA 2I5JA 4PUOA 2R8IA 4K4UA 5DLGA 4ZVGA 5DQHA 3KHLA 2XCPA 3V6KA 4ZVHA 3CJ3A 3OSPA 1S1UA 3Q8SB 1TL3B 1TVRA 4URGA 3IN5A 4F4ZA 4ECQA 4NLSA 1S1UB 2HNYB 1S0MA 3CIZA 2YKNA 4KAIA 4NLDA 4ZMMA 1UWBA 3LP2B 2FJXA 4YP3A 1U09A 4RW9A 5F8HA 3IS9B 1J5OA 1N5YB 3DM2A 3DLEB 3H4DA 3BSAA 5I42B 3QO9B 1R0AB 2IM1A 4ZP8A 2IM3A 1JLBB 3LANA 1TL1A 3DOLA 3OLBA 1JLGB 1RT1A 4B3OB 1T94A 4K4WA 4MK7A 3KHGA 1FKPA 3M8PB 1XR5A 2JEFA 2ZD1B 1LWCB 4IH5A 3PJWA 3FQLA 1FK9B 4QPXA 3FRZA 3JSMA 4ED6A 5F8LA 3IRXA 4NRUA 5J1EB 1DTTB 2R2RA 4MKAA 1RTDA 1RTIB 4FBUA 1S97A 1RTDB 3CWJA 2IA6A 4KBIA 4KSEB 4YMEA 2JEIA 3CJ2A 1BQMB 1HQUB 1RAJA 2WHOA 5DLFA 4F4XA 3T5KA 3PZPA 4XPEA 1LWCA 2HWHA 4NCGB 5EUHA 1TKZA 1DLOB 4ZHRA 3KOAA 4TN2A 5KG7A 4LSNA 1W25A 1ZETA 3QZ8A 4IRCA 4URQU 4R8UB 5F8JA 3VQSA 3DLKB 3PJXA 3M9OB 4DL5A 2UVWA 2FVPA 2QV6A 5KFJA 1EP4A 4FS1A 3GQCA 4NLPA 3NMAA 4JV0A 4IG3B 1DTQA 3M9MB 3NBPA 3HVTA 3EZUA 1RT7A 1UWBB 3LP2A 3RBEA 1TKTA 2RF2B 4IFVB 2AX0A 3H2LA 2C2RA 4MH8A 5KG6A 5KG4A 3G6XA 2HNYA 1JLFA 2AGOA 1RT6A 5D3GB 5CYMA 3UR0A 3PR4A 1TL3A 1TVRB 3I0RB 1HPZA 3T1AA 1NHUA 3V6HA 2VA3A 1JX4A 4PWDB 4FBTA 3BR9A 1C1BA 3MEDA 4RW4B 4ZPBA 4ZPDA 3MR6A 3BQ0A 4PUOB 2I5JB 4DL2A 4KKOA 3CDEA 4GC6A 3DMJB 1JLAB 4YR3A 3JYTB 4NZ0A 4KFBB 5I3UB 4Y3CA 1NNDA 5F9LA 3EPGA 5KT6A 3H5UA 4NLYA 4ECWA 4RUAA 4HKQA 2IBKA 1GX6A 4TY8A 3C6TA 3ITHB 1RT1B 1JLGA 4B3OA 4MFBA 1C0UA 2BQRA 2OH2A 3NL0A 3KNAA 3GIIA 4XO0A 1RT3A 1TKTB 2RF2A 3DOKA 3QO9A 5I42A 5C25B 4ED2A 3BGRB 5L1KA 3CDUA 4ZPCA 3V4IB 3N6NA 2UVUA 2BQUA 1C1CA 1RT2A 4R5PB 3V4IA 4Q8FA 2CKWA 4IG0A 3GIKA 1IKWB 4WZQA 1RT5B 2B5JB 3KLEA 2JC0A 4J9OA 5KT4A 4ECZA 2YKNB 1D0EA 1EP4B 2B6AB 3ICLA 5KFNA 3PW7A 1SH0A 4WFZA 3MECA 4MFBB 1T3NA 1S1VB 3RAQA 3KHRA 2W8KA 4DG1A 5KFFA 3DRPA 4RU9A 4TQRA 5KFZA 4TY9A 4EYIB 4J9RA 1HNVB 1DLOA 5F9NA 4IKAA 1XR7A 4IRKA 4MIAA 1S1WA 3IG1A 4M95A 5KFGA 3G6VA 4KV8B 3JYTA 2AU0A 2JC1A 2FJWA 2XI3A 5KFOA 5KG5A 3MTKA 3MR5A 4K4TA 4J9NA 4U7CA 3KJVB 4O3NA 1N48A 1CSJA 4URSA 5DQIA 5HROB 1C0TB 2JEGA 1C1BB 4RUCA 1XR6A 3OHBA 1HARA 4PWDA 1KHWA 4ICLA 4NLGA 3I0SA 4H4OB 3RB0A 2C28A 3BSCA 2ZE2A 1OS5A 4JV1A 2R8GA 4I7FA 3H59A 2ZD1A 4KHMA 4EO6A 1JLFB 3H5YA 1JLCA 4H4MA 1N6QB 3D28A 4GC7A 2ASJA 2V9WA 2FLPA 3I5CA 1S1TB 5FDLA 4WFXA 5KFQA 2R8HA 2VG5B 4NLVA 2ASDA 3HVTB 2YNHB 2W9BB 4ICLB 2J6TA 5HBMB 1DTQB 3Q8RB 1C0TA 3MFHA 4IQXA 5KFRA 3OL6A 1VRUB 4ID5A 1Z4UA 1N5YA 1J5OB 4Y2CA 3RB3A 3E01B 4RW9B 4ED3A 3DLKA 2W9AA 3BSOA 4R8UA 3QIDA 2WCXA 5KFYA 3G86A 4LSNB 3UQSA 3QIPA 4WFYA 3RBDA 2XCAA 3QIPB 1KLMA 4ZPAA 3Q8PB 1SV5B 1RYRA 1HYSA 2ZKUA 5KFAA 1JLEA 3CO9A 4EO8A 4J9LA 4WE1B 5KT5A 4ID5B 1IKYA 5DGBA 4Q45A 5F8GA 5J1EA 3PHEA 3OHAA 1C1CB 1RT2B 4R5PA 1N4LA 4QW8A 5KFKA 4ECRA 3PR5B 2YNHA 2W9BA 4ECTA 2UVVA 3C6UB 5FDLB 3DRSB 5T14A 3NGDA 1T05A 2FVCA 4O4GA 1RT3B 4TLRA 2WB4A 1S10A 1C0UB 3BSNA 4O3SA 4NLWA 2XGPA 3NKYA 3LP0A 2ZE2B 4EYHB 3H98A 1HNIA 1MU2B 3I0SB 3GYNA 4QWBA 1K1QA 3RAXA 3OSNA 2YNFB 1JLBA 3TAMA 1LWFA 3SFGA 2R8KA 3IGNA 4MKBA 1LW2A 2QE5A 5L1LA 1TKXA 4FS2A 2OPPA 2WONA 4K4VA 1S6PA 3QZ7A 2YNGA 4G1QA 4WXOA 3KK1B 5EWGA 1VRTA 3CJ0A 1FKOA 5KG2A 1HMVB 4X2BA 1HNVA 1RA7A 3KLGA 3KK3B 2YKMA 5JUMA 2OPQA 4IDKB 4DG1B 4RW6B 5EWFA 4ECSA 1ZTWA 3QGHA 3TQ1A 2E9ZA 4IDKA 4MK8A 1QE1B 4KHRA 2FJVA 2HNZB 1EETA 1VRTB 3MEGB 1RT5A 2B5JA 2BE2A 1TV6A 4G1QB 2YNGB 5C42A 3KLEB 1RTJB 3M8QB 1S4FA 3HHKA 4NLUA 4OL8A 3PW2A 4EBEA 2AGQA 2AQ4A 1IKXA 3OL9A 1REVA 4G3IA 3BGRA 4LQ3A 3CJ5A 4J9MA 2YNFA 3TAMB 4M94A 1KHVA 2IC3A 2W9CB 4QWAA 1S1XB 2AX1A 2RDJA 5J2PB 3LP1B 3LP1A 4I2QB 4I2QA 5C24A 4TY8B 5KG3A 1S1XA 3UDLA 5CYQA 3KK2B 4NCGA 3LAMA 1T05B 5KFUA 2UUWA 2BR0A 4I2PB 4RNFA 5DG9A 4IH7A 5DG8A 2YNIA 3LAKA 1BQNB 4O44A 1QAIA 2VG7A 1JLAA 3DMJA 2VG6B 2HMIB 5KFIA 2ALZA 1TQLA 3H4BA 1LW0B 2WOMA 1JLQA 1QE1A 1HPZB 3QYYA 5KFSA 1JLEB 4NLRA 1HYSB 3GV8B 3V81A 1KLMB 3QGGA 3BJYA 4KO0A 4QWEA 1LWEA 1FKOB 2ILYA 2RKIB 4RNOA 5DG7A 3KK1A 4EBCA 3GIJA 4RW7A
chains in the Genus database with same CATH superfamily
2CAJA 2ZZTA 3BH6B 2M88A 5CZXA 1C2PA 1OY8A 4ZJQA 1CVJA 1ZBTA 3N9UC 5K14A 3DHXA 3GMGA 1GK8A 3IMQJ 2CZVC 1K73T 1PAUB 4FNIA 3MMBA 2MGZB 2DNPA 4QWDA 3GIMA 3VHQA 3MUVP 2DRBA 1TL5A 3OFHA 4C11A 4J9PA 4OI1A 2UXBF 1R6VA 1EQ0A 2RSQA 5GAGU 4HDGA 5LXYA 4ER8A 3F44A 4OYWA 2CG8A 1TU0B 2DHGA 2HAIA 2V5HG 3DGPB 1IR1A 3I6PA 2EBEA 1TKZB 1NU4A 4QIWD 4CI0B 1VQKS 2UVRA 4NXNJ 4IR1A 1HR0F 1X5OA 1OSDA 1KKHA 2R7VA 5KFWA 1U49A 2VUGA 1JLQB 4LF8F 3TI0A 4DV7J 3KLHB 2HS0A 2X1BA 3EM1A 4IFYB 4B02A 3EJMA 4ELUA 4DX7A 2JZ5A 4IUFA 5DRKA 2VG7B 4P7TA 5GAHU 1SB6A 4N8OA 4I1TA 4ZP9A 2MKHA 3EGWB 3IG1B 1LEOA 1SQEA 1UPPA 3IWXA 3QLHA 4PQUB 3ZZRA 1KLNA 2PI5A 5AJ3F 3G8QA 2PA8D 3MEEA 4JI2J 2XS5A 3H20A 4NCAA 2ZBPA 2J9CA 1IQTA 4OHZA 1KN6A 3DDKA 1U1OA 5D8HB 4ELVA 3FFIB 2UU9J 3ILJA 4ZLJA 2B6AA 2X3DA 1TTHB 5ETTA 3PRDA 3W5XA 4QZVB 2ZOFA 5CCLA 2VKRA 1REVB 2MQPA 5IM0B 2HRTA 2WVDA 2R7UA 2K1RB 2DCUB 2BABA 4ECXA 3MR7A 4JV2A 2PEHA 2HBQB 1XWLA 2QLJB 2V2ZA 3LF0A 5IFMA 3AJ2A 5KFXA 2UXCF 2NZ4A 4O4RA 2C2ZB 1E6YB 3TVKA 3VAMA 3FSIA 5J2MA 3C6TB 3BPDA 4YB5A 5F3TA 3CCLS 1NK4A 1SKUB 5BR8F 2HQ3A 2GC8A 1F5CA 3HI9A 4JI0F 1JKHA 3D1QA 5LSOA 2V4RA 4DR3F 3QRRA 3QPIA 4GKJJ 3FEZA 2OGUA 4DV7F 2VQEF 4DR7J 3HP6A 4H4KC 2FZCB 5K20B 2VPXB 1SH3A 4QYRA 2AV5A 2FJBB 1ITPA 4X62J 3FKBA 3GLJA 3F56A 3E8OA 3NGKA 5C5JA 3EGZA 3PTWA 3GONA 2XI2A 1JIHA 1FA0A 1RA6A 3LW5C 3UNYA 1FJGJ 2AYMA 4KT0C 1IM4A 1JKHB 5AXNA 4EUVA 3BQ1A 2AEJA 2IPOB 3BV8A 4Z37A 5H9FJ 1QSYA 4ZPVR 3FBCA 1CG2A 3OL7A 2YBVA 4X4RA 1XNQF 3FSYA 3DGPA 2F8EX 3MFIA 1MROB 3OVBA 1RTHB 2IM2A 3A8EA 1SUQB 5CHCB 3KFWX 4KE5A 3C6UA 2F40A 2JHEA 3T1YF 1R0BG 4F02A 2DD8S 5A2QU 1UVLA 1XMBA 1W2IA 2AZ1A 2XMMA 5DQGA 2FPHX 2V34A 1N56A 4LF5F 4J91A 1NEEA 1RCOB 3CJ4A 2QA1A 4F4WA 1FKAF 2PA3A 2U1AA 4UOFA 3JB9k 3FFIA 4P2SA 2OPRB 3DRRB 2BJ7A 1RLCL 2EFPA 2MKSA 3OFFA 2W7PA 2XY5A 2DIVA 1CEZA 3NWGA 1DAXA 2GIQA 1Q8KA 5DDRC 2LXFA 4PEOA 5CAAA 4ITSA 3ZTOA 1YJWS 3PRVA 2GAHC 2R2SA 2CZ9A 8RUCA 5HLFA 1RACB 2D1CA 4OX8A 2FIUA 2RB7A 1JNRB 1N88A 1IWAA 2VJVA 4I64A 3T6BA 4HDHA 4CP5A 4C8MA 4IRDA 1APSA 2E9TA 4IFYA 3KJFB 1YLXA 5KFBA 1IN0A 1CULB 3HULA 3OFGA 4DS5A 4F2SA 2HMIA 2V4QA 3DLGB 4UZBA 3BDEA 3O3LA 2KO1A 4A4JA 1VISA 2CYYA 3NOGA 5CYMB 2KT3A 3FQKA 1S1TA 3L7UA 3R6GB 4LRFA 4DR5J 1RTHA 1YGYA 2YKQA 4USJC 4DMZA 4DLEA 3TJ8A 4ZPWR 4QYZJ 1EX8A 3HHLA 2DY9A 3KLIB 1WACA 1OSCA 4UT4A 1NBEB 1Y4ZB 3PEHA 1YJ7A 4ED7A 4HACA 2OUGA 3M32A 1RWXB 1RAGB 5LMNF 4KR0B 2MHEA 2DGQA 4IG3A 3GU0A 1FRHA 1F3VA 3CC7S 4LR8A 3FBFA 2W01A 2L41A 1IKYB 4ZJOA 1R8CA 4IO9Q 2Q66A 2B4VA 1BMQB 1X4FA 3D1HA 3N6MA 7FD1A 3EXYA 2XGQA 4KH1B 1VOMA 2DO0A 3JTPA 4USHA 4PABA 3PW4A 1G1XA 2MKCA 1S9FA 4IYQA 4C8ZA 2FYXA 4OYIA 2WRMA 3S01A 4PG8A 4OI0A 2FJEB 3TVZA 2R7RA 1FE4A 4YN3B 3V2UC 1UEVA 2HHUA 3JTNA 4ZVSB 3EPIA 4PXBA 5KFCA 1GMVA 3PFEA 4O3RA 2GMJA 3AFGA 5DDOC 9RUBA 3OVAA 4KPYA 1FJCA 2JLEA 3KLGB 3KDOA 3QT8A 4OZLA 1NJXA 1HMVA 3ISNC 3TOQA 3AAWB 2H4WB 2RHQB 5BYRA 4DXLA 1RT4A 3HVWA 4Y34A 2RU9A 2IVYA 4IG0B 4YEAA 1MMDA 1FVSA 4HI2A 1S0OA 4RU2A 2PMWA 3L3CA 3CCSS 2VU5A 2ZVIA 1ZM3A 4DV5J 4WFNQ 2VQFF 3AXMA 3ZZ0A 1N34F 2G0IA 4UUWA 3ZO7A 2ACMA 3BDPA 5KFPA 4LSZB 1XQIA 1Y0HA 1Q5VA 1HNIB 3HX9A 5K8PA 3W1YC 3JSBA 1LFPA 3M2RB 2IRXA 4OHYA 2M2BA 2R7XA 4WZMA 2CJKA 4TLQA 1KS2A 2HK2A 1JXVA 2BMBA 4FN5A 3JQMA 4LIRA 2HK3A 3NXZA 1OY9A 5BYQA 3KNGA 2DPJA 2DY1A 2E5HA 3DDIA 4UOHA 4AQYJ 2Z58B 3OBIA 3RG6A 2D3OR 1WNEA 5A76A 4DR6J 4H54A 1WEYA 2MB0B 4DPUA 5DLGA 4UTGA 3T1HF 4LMZA 2PSZA 3JQKA 5DQHA 2XCPA 2BBEA 2HSEB 3GYXB 4DV6J 5CCMA 4H4KA 3THVA 5H1SV 4ZVHA 4PG4A 2RVJA 3CJ3A 4L73A 2N3OA 4F4ZA 4ETXA 3S8SA 8ATCB 2AJ0A 1AB8A 1PYOB 2J8AA 4CNYA 2ZFHA 1SC3B 1SXLA 2HAFA 5DZ6A 3GYGA 4NA3A 4YP3A 3P5BP 4J7CA 4JI0J 4DJBA 4OFZA 4IQMA 3B4MA 3D0IE 4MIWA 1J5OA 1N5YB 3DM2A 3DLEB 1P9YA 1UW9A 2DNQA 2W7AA 1U0SA 3BSAA 1NH8A 3Q8VA 2IM1A 3AJDA 5I3PA 2UXDF 3UW1A 3J80U 3DOLA 3HSJA 2H54B 4M5JA 4GRSA 1T94A 5B0EA 4PR6A 1YWXA 2K3KA 4MK7A 1FKPA 4RKUC 2ZH1A 5K8MA 2RRNA 2K8GA 2JEFA 2L48A 3P4UB 2BACA 5ETPA 1NPRA 2CQCA 4F2RA 2ZD1B 1LWCB 3PJWA 3BO2A 3C14B 2DVIA 2AJ2A 2BX6A 1ZZNA 2PO4A 3MPWA 4X84A 1FRKA 5F8LA 2XHWA 4TVAB 2VODA 2R2RA 5D77A 2F1FA 5K8OA 4ZS6A 3SMZA 1Y3JA 2V2VA 3MAQA 4B3SJ 3GJRB 1FDBA 4GMKA 2IA6A 3MM9B 3TZYA 1H38A 3CJ2A 1BQMB 1HQUB 2WHOA 3SCKE 5DLFA 2COLA 3T5KA 4DR4J 2EFOA 4MT1A 1LWCA 2IYIA 2HFVA 4MTPA 2ZH4A 1RK8A 4ZA1A 2AJ4A 2KKHA 3PM9A 2Y1LB 1YJRA 3G8TA 4UQGA 5KG7A 2D74B 4KQZA 2J9DA 3ELHA 3PKMA 2BM0A 3NOCA 1SJRA 1EIYB 2ABYA 1RWNB 3M9OB 4DL5A 5RUBA 1BLUA 3AY0A 1EP4A 2UVWA 2CA9A 4FS1A 3AJ1A 3B6BA 2G13A 3K7RA 4NLPA 3GQCA 4DV3J 3TP2A 3NCPA 1WEXA 2Q6BA 3Q0AA 1WC0A 3M1VA 4OZ5A 1TK8A 3SDEA 4USUA 3M32B 2ALYB 5LXRA 3TEHB 1HBMA 4WK1A 3M6UA 4MYTA 4TNOA 5GMEA 1VR6A 4Q5VA 4EI2A 2R7QA 1V9OA 3I87A 1RT6A 2ZHAA 1G6BA 5D3GB 5CYMA 3PR4A 2CQ2A 3I0RB 1HPZA 3T1AA 1NHUA 1Y3KA 3KG4A 4NA1A 2CPDA 2VA3A 1C1BA 1FNXH 4HI1A 2C3UA 4ZPBA 3MR6A 2RNEA 4PUOB 3CCVS 4GC6A 1QTNB 1LNQA 1RWUA 3WIVA 3FC9A 3MMCB 3JYTB 4KFBB 5I3UB 4CDIA 1VRQC 1X4CA 1SBRA 1VS3A 5KT6A 2PE8A 4ECWA 1N0VC 4RUAA 2IBKA 4TY8A 2XZWA 4DZDA 4U96A 2GHPA 4MFBA 3K2YA 3R5CA 4TKTA 3MTJA 3A3NB 2OH2A 2ZZNA 1SI9A 4XO0A 2MZJA 3NL0A 1WF2A 2N7YA 3KNAA 1HKAA 2J5AA 2UUAJ 2RF2A 3DOKA 3NGUA 4P75A 5C25B 2GQCA 3LGMA 4XTTA 4ED2A 2L08A 2XGPA 1CQNA 3N6NA 4LUBA 4PAAA 1H0HB 1RT2A 1B7FA 4NYPA 4RR5A 4FXDA 1Q1KA 4PXEA 4AYBD 1IKWB 4DHVA 5E41A 4I4BA 1KQGB 5HN0A 4WZQA 5LMNJ 3OTOF 1A0OB 2OTJS 5H9FK 2CJBA 2OP5A 5KFNA 4WFZA 5IXUA 1L3SA 3GPAA 1ZYQA 2IA0A 3OTDA 4PWWA 2HEKA 4DQPA 2YH0A 1N5QA 1VQSA 1WG1A 3FZBA 4RJVA 2ADCA 1RSCA 2KXNB 1SKWA 2B56A 5KFZA 5D6GA 5C2CA 2ZH8A 1A9NB 3RU0A 5J1PA 2XMTA 4USTA 3QJJA 4DQSA 1EKRA 1PSDA 1S77D 2VPYB 2AU0A 5BJRA 2GS8A 2MLZA 2Y3YA 3ILIA 2FTRA 2FJWA 5KFOA 4K4TA 2DR8A 3MTKA 2CWKA 2YKPA 2O66A 1NSQA 4O3NA 1X4EA 2CPYA 1KSPA 2JEGA 1XC9A 2LLZA 3THTA 3J7AN 4PWDA 2BJ3A 1KHWA 2GJ2A 2W2PP 4JB8B 4HH1A 4NLGA 1S6OA 2NXJA 2Y0BB 5HO4A 3H59A 4Y2MA 5HI7A 1OYDA 1Y9OA 3D28A 3US5A 3KDNA 4GC7A 4A8YA 4RBUA 2HGMA 2X1GA 5KFQA 4ZDNA 4I67A 2VG5B 3MAAA 2DBBA 1AYEA 2H65B 3ADAC 4L6V3 4ZLNA 4OI2A 3CCJS 4GKKJ 3DU6A 2ZOMA 1DTQB 1U1MA 2JFKA 3PX0A 5IC4B 1U2FA 2CDRB 1CULA 1VRUB 2WVFA 2U2FA 2BOPA 3OXLA 4CO0A 1HWJA 4Z7YA 2W9AA 2A6OA 2NSBA 2WCXA 1AW0A 1WHVA 1X9WA 1B0PA 1RABB 5LMUJ 4ZCLA 3UQSA 3CCRS 1HD0A 2HIYA 2JRSA 5IQQA 4C3LA 5DM7Q 2HRYA 3K89A 5K5MA 4KY3A 2RH3A 4I69A 4PG7A 3ZNJ1 2I38A 2ZKUA 1PKUA 1JLEA 4EO8A 1CC8A 2C2KB 4X4UA 3PYEA 5IS2A 4ID5B 2E1CA 2EI5A 5GADI 1IBMJ 5J1EA 1I3OB 1N4LA 4OZ2A 4QW8A 5KFKA 4ECRA 5HVGA 3GG1A 1U1KA 3C6UB 3RR7A 1T05A 2FVCA 2QJ3A 1ACMB 2Z57B 3VZIA 3VALA 3VF0B 4NL5A 5HMYA 1DARA 2WB4A 3W60A 1T9XA 2B0GA 3ZNUA 4EYHB 2ZE2B 1CBKA 3H98A 1HNIA 3W65A 1K1QA 1KR4A 3OR1A 2XY7A 4LF6F 3SYZA 4X4NA 2QTWA 3PDNA 3LTOA 2R8KA 1TAQA 1LW2A 1O8BA 2BEFA 2LDYA 3M6VA 1NO8A 5GMDA 3B82A 3MM7B 2HQGA 1RAAB 1VIOA 3AD7C 2M9KA 2BJDA 4G1QA 4FYWB 4WXOA 1VJQA 1BUXA 2QL5B 2AW0A 1HNXJ 4N76A 3TEGA 1HMVB 1RCXB 3KLGA 4MJKA 3BN4A 2EG2A 1WELA 3TQ1A 3QGHA 3G71S 1Z2ZA 5AXKA 1Y5LB 1B4SA 1W7WA 1QE1B 2YQ3A 3Q83A 3W61A 4WCEQ 3CXCR 2W24A 2ZZMA 4ED4A 4FF3A 3MEGB 2B5JA 2NCKL 4CWBA 4AD6A 4G1QB 4X65F 1Q86T 3GWCA 5IZHA 3PW2A 3HHKA 1UFWA 1DFDA 4OL8A 2A2DA 4DSKA 3CGIA 5DDPC 3NNCA 1GMWD 2A2CA 4DX8H 4OHWA 4LQ3A 1VQ6S 1RHJB 4J9MA 3KJQB 2J7UA 2YNFA 3TAMB 1HR0J 4IOCQ 2HVDA 2WZ1A 3OR1B 5M2RA 2XLIA 2QMWA 2W9CB 1GH8A 5H9EJ 3CT9A 5ETSA 4I2QB 4M8LA 2KRRA 5C24A 2I6WA 1WOOA 2M52A 4NCGA 3LAMA 1XEZA 2NR0A 2UUWA 5E33A 5B08A 2B9EA 1RAOA 4ZVOB 1X8DA 5DG9A 2Z8QA 5DG8A 2FY1A 1VYAA 3Q86A 2VG7A 1JLAA 1I1GA 1R7IA 5F0UA 3S1TA 1S76D 2HMIB 2H5EA 3G6ES 1TQLA 2NSCA 2DHSA 3H4BA 3MMAB 3AA9A 2CQ3A 1P9QC 2ZJQQ 2EVZA 4X62F 3UCGA 2DGVA 2VPZB 1QE1A 4WBFA 4C8OA 1JLEB 2O3DA 5ETVA 1F0XA 3FCWA 3GV8B 3V81A 1FI4A 4E0DA 5A6PA 3QGGA 4QWEA 2HGLA 2NXNA 3PYDA 2VICA 3NGSA 3KWMA 4ETZA 5DG7A 1D9FA 2NXEA 4C11B 1PC5A 2Z30B 1RTZA 4RW7A 3J7Z5 1PILA 1Q82T 4X4SA 4HT5A 1S48A 2OEKA 1U8WA 3O1LA 4Y2IA 1CJTB 1T02A 1B0VA 1LW2B 1FDDA 2B4UA 5K14B 4DN9A 2XC9A 1KQKA 5KFTA 4EWTA 2DGOA 2J6UA 2XB2D 3AT1B 1S9GB 4B9NA 1NZ8A 2B8PA 1T8EA 2XHCA 4PPZA 4B3MF 2XLJA 3POTA 2ZBIA 4W90B 3HJFA 2W4PA 3H5XA 4B3RJ 3MF5A 4ZHRB 4FPIA 3G6YA 1YJUA 3PNIA 4OQJA 3E3XA 2HURA 4ZOSA 4Q43A 2C22A 4K4SA 3UCUP 2YWHA 2OMOA 3IAS9 1U48A 4NLXA 2IM0A 2XZTB 1HA1A 4LFAJ 1WJ9A 2HQDA 4JI3J 1FEHA 3N6LA 3K5PA 1TMMA 2P9GA 2RDIA 3FNNA 3CJKB 3T9NA 5K8NA 1SL1A 2MQQA 4NEYA 2LKZA 3SIPB 2N82B 1U1LA 5L9NA 2ASLA 1KOHA 2O5DA 3CD7A 5EX3A 4DCPB 3KG1A 1S1WB 1VDHA 2MSTA 2X1AA 1H3DA 4DF4A 2EPIA 4WF9Q 2XSJB 1CJKA 2WAQD 1IJFB 2C42A 5J2NB 3BB5A 1QAJA 5C24B 4KIAA 3O44A 4JI3F 5J2MB 4CCHA 2E1MC 2V2QA 5ETMA 3FJ2A 3S6EA 2OPSB 2B9WA 2BJ9A 2WVBA 2KZMA 1PJ7A 1VRUA 1T03A 2A0FB 4TU7A 1NK6A 3GJSB 2D9OA 2XYGB 3CD5A 2PMZD 3ENWA 4FDFA 1U7LA 4N47A 2VHGA 2FLNA 3CNQP 2J9EA 1UETA 1S49A 3MEGA 3GE9A 1HW9A 3O2IA 5KG0A 4ED0A 5L46A 1X9MA 2CPZA 5T7LA 2J7WA 4N7TA 1YX2A 1QJHA 1ZAXA 2ZH7A 4KJIA 1HBOA 3FRYA 3HKWA 4ED1A 1UJ5A 2JLFA 4J9SA 4JI8F 4F4YA 2YKMB 2YPZA 1R6YA 4M63A 3FBBA 4DR4F 2XWYA 1UKUA 3QLHB 4PQUA 1SIWB 2GZOA 2LA4A 3L09A 5I3UA 2K7KA 2XMJA 3VCDA 3TR5A 3MAHA 1X7VA 1FFGB 3AQOA 1H98A 3UN2A 2R8JA 1TKXB 1KNZA 4ZK7M 1T0TV 4ZVUB 3T19A 4NLOA 1C4AA 3KLHA 1DQ8A 2JDJA 5KT2A 5F8NA 1FHTA 2RHSB 3KK2A 3EVWA 2AGPA 2H48B 1MMNA 4AUKA 3QBCA 3AB2B 3ZFVA 2W8LA 1IBLJ 2W4CA 4DV3F 2VFSA 4K4YA 1LXNA 3JQJA 3ISND 1NPPA 4DU8A 4ZIWA 1R8HA 1QSLA 3QT6A 1IKWA 2C2MB 2RUGA 1YJNS 2E5LJ 4OYPA 2MQMA 4MK9A 2CG4A 2D41A 2DNHA 2EWHA 3MMBB 2MGZA 4DX5A 2W7OA 2XSJA 1RTJA 3M8QA 6AT1B 4FKXA 1QVGR 2LVWA 3UPFA 2Y8YA 1RJJA 2AYBA 1L3KA 3LALA 1R8AA 1WSVA 2OKQA 3EWGA 2JEJA 4HTJA 4LJMA 1KEKA 4W98A 1F1BB 1PBAA 1B7YB 2DNRA 2E5GA 4RW8A 2Q6CA 3G82B 2DGXA 1RBOB 2MSSA 2JNJA 4K5SA 4NOHA 3TO8A 3OV7A 3KLVA 1HBNB 2QZ8A 4K2XA 5AE1A 2DR7A 5J2QA 3EX7B 4LFCF 1PAEX 1F2GA 4C4WA 3C8YA 3BM7A 4O23A 1QUVA 3R7SB 3SCJE 3SI8A 1VBXA 2CRLA 3LO3A 3PW0A 3GTYX 1U1NA 3UFCX 1LKZA 4V19J 3JXOA 4KGKA 1FRJA 3RUBL 2CPIA 5D0EA 3MZIA 4JUZA 3K0JA 5CZVA 5IT9U 1XMOF 1O0PA 1RLDA 1W26A 4CLSA 1Z2LA 3JSMB 3AH6A 1VQ9S 3PO4A 2VG5A 3MM5B 3GILA 2NQPA 5D3GA 4FF2A 1RT6B 1IJEB 5HP1B 5C7PA 4DV4J 2F8MA 2MQOA 4BDPA 5HP1A 2KH9A 4AL5A 1FKPB 4ZN3A 3DRSA 3H2VE 2M7SA 3QGIA 4BC7A 1NHKL 3W63A 2E5JA 4QR0A 5KG1A 1XERA 2GNKA 1TAUA 3QAUA 4L76A 1VBZA 4AL6A 2GJIA 1YVFA 4R0EA 2R2UA 2KFNA 1RWOB 3NGRA 1NB2A 1MW7A 4ZVRB 5GAGI 3E51A 5E3PA 2PGCA 4U9RA 1G2EA 4WYLA 1C4CA 1PYSB 1R89A 1R0AA 2IRUA 1XNQJ 4KV8A 2XMUA 4ERDA 4XDCA 3TZWA 4IR9A 3TYTA 2B4OA 4LFBJ 3M30B 1MLAA 3HSGA 3R5JB 3I9ZA 1HQEA 3CF5Q 3V6JA 2UXBJ 3CJSA 1MWZA 2EK6A 3GZ7A 3C66A 5DJBA 3R7NB 1S1VA 1HWUA 1YBTA 1YZ7A 4NLQA 4O0NA 5IV4A 1S99A 2YKOA 5IC6B 3E01A 4OX7A 4LR7A 4C3KA 2WOMB 3MPYA 1U4BA 3ENVA 4QU7A 2ZH3A 3HJVA 2V0NA 1OPZA 3D54A 2CPJA 1V3ZA 1DTTA 1M5HA 1P27B 1VFJA 1VIXA 2H5IB 1TUWA 1YRTA 4ZVEA 5HK4A 3K5LA 2IDLA 1K0TA 4O44B 3RJMB 4WP8A 4J9KA 4W4MA 4CLUA 3KUHA 4JI7F 2W2MP 3DI6B 1ELOA 3A3OB 1H73A 3CDBA 4TYBA 1ZM4A 3M8PA 4DV4F 4OMFG 4PZVA 2BRKA 1A6LA 1U1QA 1I6JA 3M2RA 3LA0A 2HHSA 1JQGA 4J9QA 3GSIA 1U24A 2Z56B 1VQMS 2PFDA 2M5YA 2IC3B 2FHJA 5F41A 1YSJA 3OW2R 3EXCX 4DR5F 3AHPA 1RADB 2YH1A 4LF9F 3P8BB 1IKXB 3NS6A 4HEA9 4KYZA 1VQYA 5DGAA 3MCOA 3HVRA 3RW6A 2I5JA 4PUOA 3QQCD 4K4UA 5CXTA 4NMLA 4X64F 1X5PA 4ZVGA 1CJVB 2ZKTA 3QSIA 4OJHA 4YY3F 3CDAA 4EZ9A 2Y0SD 2HFSA 4YB6A 2FGOA 3VAHA 4BS2A 4ECQA 2WB1D 4NLSA 4GO5X 4L72B 2HNYB 1S0MA 2FY8A 1LXJA 2DGUA 2RD5C 2VFVA 5T7LB 1Q0NA 1HBUA 3LP2B 3GIRA 4OJ3A 4ZIVA 4D3GA 2LXUA 1P6TA 3VZHA 2E1PA 1FRIA 2G2YA 2H3EB 3FK4A 3OD2A 4C7QA 2CDQA 3IR6B 3H4DA 4CH0S 1Q79A 2QFJA 5JVHQ 1XBWA 2HG4A 4ZP8A 4LF8J 1JLBB 5ADZA 3LANA 2EK1A 4M5GA 4LREA 1ICEB 4I6AA 3P6YC 3CJRA 1WF1A 5CH7B 1JLGB 4B3OB 4K4WA 1PYTA 3CJTA 4IO1A 2Q1LA 2EEYA 1B0TA 4PG6A 3NCRA 5I3QA 5ETLA 3JTOA 4OJ1A 2AEFA 3Q24A 2AEMA 2IBOA 4DFPA 5ETOA 3FQLA 1NKBA 3MM5A 2G1HA 3D0GE 1M90T 4N56A 3JSMA 4ED6A 1UZHA 3M4XA 1FE0A 4XIUA 5U47A 5MLCV 1KD1T 2LQ8A 5HMZA 2I8EA 1VLOA 1D8ZA 3CWJA 4KSEB 3I82A 4HLBA 2BOAA 4F3QA 1Q95G 1SC1B 3R27A 3MM8B 4OJGA 1VHIA 4B9VA 4F4XA 4KRWA 1MWQA 4U7UD 4XPEA 3R2CJ 1WC3A 3VVUA 1OWXA 3PIOQ 1HW8A 3RYLA 2ZWOA 3VTIA 1IM6A 4Y28C 2YWGA 4LVNP 3VAGA 3MD1A 3G9CA 3MOZA 2CJ9A 3IM8A 3M8SA 4IRCA 2JX2A 3G82A 2LQBA 2C3PA 4OI6A 5LJ5Y 2CQ1A 3DLKB 3CIMA 3X1LB 5KFJA 1KWMA 2FLLA 1TR0A 5KOXA 3CMES 4F25A 5FJ4A 2DHHA 3Q2TC 3PIPQ 1RKJA 4IG3B 3ZZOA 4E8UA 4EGLA 3NBPA 2ZEJA 2VBZA 3CCZA 1NDKA 1FXLA 2QIFA 2OTLS 2AJFE 3IFEA 3RGIA 3ZZTA 1BC6A 1UWBB 2LEAA 4A47A 2AX0A 2C2RA 2BJ1A 2F7VA 4P52A 4P71A 3G6XA 2MKJA 2FHMA 4P73A 2A10A 1JLFA 5CD4H 3JS9A 2AGOA 2XMAA 4WFAQ 1TFYA 1JX4A 4HL9A 3ET6B 4JI1J 2LU1A 2G0CA 1LOUA 3D6MB 2AKWB 3HDSA 3MEDA 4RW4B 1BXNA 2VPWB 2MKYA 5AE2A 3BQ0A 2G4BA 4ATNA 1YBUA 2KVQE 2KT5A 3CDEA 4DL2A 1YQHA 3OTOJ 1VQ7S 2CQPA 2NPFA 2HHHF 3SQGB 4Y3CA 4C9DA 1T11A 2GV1A 4QU6A 2CQGA 2O01C 2V4JA 1DBDA 4C8LA 3H5UA 4HKQA 2KYZA 2WW8A 2DNKA 3C6TA 3W8GA 4NXNF 3NWRA 3OR2B 1C0UA 3LUYA 3SSRA 2BQRA 2QYGA 2GMHA 4WP3A 2KM8B 2F4FA 1TKTB 3I55S 3QO9A 5I42A 2FZGB 5L1KA 4B3MJ 4KHPJ 2K1RA 1YHQS 1NK5A 1TFWA 2UVUA 3EZOA 3V4IA 1U2CA 1SKSA 4IG0A 2RIJA 4WP9A 4YHHF 2HVZA 1RWWB 2B5JB 4ECZA 4J9OA 2KG0A 1NK0A 2CQ0A 1D0EA 2QL9B 2N7CA 1DY3A 2OELA 2YTCA 1HL6A 4ALZA 5LSRA 1SH0A 1T3NA 1N34J 3ZC4A 4M5KA 2DISA 4JI7J 2F65A 1G3OA 3N5FA 5HQ8A 3NNHA 2OHDA 3DRPA 4CO5A 4TQRA 3HFKA 3TAPA 4EYIB 3M8WA 1DLOA 3EVMA 3VAKA 3N01A 3VVTA 2IVMA 1S1WA 1EQMA 1VQNS 5E3CA 3J7YI 4K5RA 3IXQA 2OSQA 2XI3A 2GFFA 2Z2YB 5KG5A 3MR5A 4J9NA 1DJ0A 3I4HX 3QWPA 2FDNA 4LRCA 3MDFA 3Q2SC 4RPFA 3OXFA 3CJKA 1CSJA 3RBZA 4JV5F 1U6ZA 3J81U 1Q53A 4DU7A 2PMHA 4ZKAA 3OHBA 3IA0A 2XMKA 5HVFA 3AOAA 2RQCA 4ICLA 1FESA 5DM6Q 3HPOA 4WFBQ 2ZE2A 2M8HA 3ZZZA 2A1BA 2MEWA 3DU5A 2HYIB 4I7FA 4EO6A 1JLFB 3HSZA 2N3LA 1MSWD 3PACA 3TNVA 3EMTA 2MQLA 1I94J 4M5DA 4UW2A 3UVJA 1S1TB 5FDLA 4UUXA 4NLVA 3HK2A 2ASDA 4F8RA 4ILMA 4CO4A 6FDRA 2YVSA 1XN9A 4QQBA 2DGTA 1NB7A 2HZAA 3W2VB 2F4VJ 4JYAF 5IT9Y 2P2CB 1FXDA 5KFRA 2XCAA 4A8KA 2G2ZA 2WVCA 4A8SA 1UVJA 3H25A 1SJFA 4RW9B 3H8YA 3DLKA 2VQFJ 3BSOA 3VAFA 5HJXA 3QIDA 5HL7Q 4YY3J 2ZHOA 3G86A 3L9ZA 4LSNB 4X65J 4LF4J 2PFFB 4OYOA 4X64J 4X4TA 3LPYA 1GAOA 1SV5B 2QLWA 2RRBA 4DQQA 2AP6A 5KFAA 3PKYA 2DYAA 4WE1B 4UZCA 2ZH6A 1WG5A 3IWLA 2VH7A 1ZS6A 3UR3C 4QIVA 1F9HA 2FZKB 4P7VA 5KT5A 3MMAA 6FD1A 2VV5A 2P9EA 4LBHA 2E7WA 2H5JB 3BGFA 2DNZA 4KH0B 5F8GA 3NNAA 3MCSA 2UVVA 3B8HA 3CJ8A 1YK9A 3MAAB 5FDLB 3OT9A 4O4GA 3TUJC 2CIMA 4PRFA 2B8QA 1UVKA 3F41A 1F2HA 3PRBA 1EHWA 4TLRA 3VR1A 4AXJA 1CLFA 4AL7A 4O3SA 2MZQA 1TMJA 1EZZB 4JI5J 4X4VA 3NEKA 5EGYA 1JXEA 4A48A 1UW4A 3QFHA 2J0WA 2YNFB 3TAMA 1UPMB 1LWFA 3SFGA 3ETMA 3TJAA 2E5LF 1UMJA 2BJ8A 5HMXA 1X9SA 1NK8A 1RHUB 5LSLA 2OPPA 2DK2A 5LT5A 2HVHA 1H2UX 3UWTA 2V8GA 3W5YA 2N4CA 3QZ7A 2YNGA 4KGXB 1NZAA 5EWGA 1ZM9A 2FHOB 3CJ0A 2NXCA 2JVOA 2EW9A 4ZCKA 1B3TA 3TUPA 3KK3B 5JUMA 1NAQA 2Q79A 3UI3A 3D7SB 2D69A 2OPQA 1GTHA 3GFHA 1T3OA 4ECSA 1ZTWA 4ED5A 1SQFA 2B4PA 4UOGA 3HM9A 2CWXA 1AT1B 4C2MA 4DL0C 1EKSA 4KHRA 3UDCA 2POKA 1QY7A 3L4BC 1S0VA 3B4DA 1EETA 2MZRA 5HVHA 1FVQA 1TV6A 1M0SA 2QL7B 3MCMA 1WD6A 2BVZA 2AQ4A 3UNGC 4FF1A 1IKXA 2DTJA 5B0BA 1REVA 3W3SA 1FCAA 1WI8A 3FVYA 1KFDA 3E2EA 3J7YU 4M94A 4CO1A 2IC3A 1SJ4P 1URRA 1RWKB 3OPKA 4FYVB 3TA2A 3MURP 2AX1A 4OZ3A 2BA9A 5J2PB 2R7OA 3LP1A 5KG3A 4TY8B 4EMDA 1S1XA 2GCFA 2VONA 1UJ4A 3MI7X 3LWLA 2V4JB 3M05A 1T05B 2DJWA 2P9CA 3DC2A 1JWWA 1BWVA 5DZ7A 4J37A 4RNFA 1XMQF 1QAIA 1BQNB 2LQ5A 2EG1A 3RAMA 3MM6A 4JP8A 1R0CB 1U02A 2VG6B 1UA1A 1X4GA 1B99A 1RWVB 3HF5A 5B0AA 1F5AA 1H6KX 2CNOB 2LYVA 1Q81T 2UUBF 2WOMA 3KUGA 2VZ9A 1JLQA 4LFBF 2APOA 3M2UB 3KYLA 1KQFB 1GMUA 4D3HA 3HT3A 1Q16B 3I32A 4ANCA 3R8YA 3BJYA 4KO0A 2B9XA 2NYIA 2IMOA 2W2OP 1FKOB 1O6XA 2ILYA 1PCAA 5D4PA 1ZOTA 3U7JA 4HTIA 3TANA 2FVRA 3A8KA 4ZVTB 2L9NA 1VC5A 3CB4A 1L5UA 2ASYA 4R0JA 3CD0A 1WEZA 1S9EB 3A1YG 3SV3A 3EDQB 2H9ZA 3KHHA 2Y1JA 2XQCA 3QJPA 2ACYA 2B3TB 3BZQA 3NS7B 4RBVA 5KT7A 2F63A 2HQIA 1GT8A 2LDIA 3DYAB 1UAWA 3Q22A 1HBUB 2RKIA 3I5BA 4TU8A 1LWEB 4I6YA 3MR3A 3AA8A 1QSSA 2DXEA 2HNDB 1WC6A 2RS8A 1RU2A 4FVMA 3MR2A 3DFEA 2IJNA 1HIYA 2LEPA 1SVDA 2XO6A 2DXDA 4NYZA 5A8RA 1N5SA 1KDNA 4OLOA 5A0YB 3J81Y 2GMLA 1TZ0A 2WTFA 4NPOA 3BO4A 4LSLB 4Q0BA 2V8PA 5A0YA 2R9LA 1Q78A 1XNRJ 2XLKA 3CUNA 1H74A 1XK8A 2H51B 3FMWA 3PG9A 1RKIA 1XTZA 1S6UA 2YNIB 3HVAA 4J5OA 1RHMB 4OV6A 1RQ0A 2HQFA 2W25A 4B9SA 4L75A 5JXSA 4BLGA 2HNDA 1IKVA 1TUVA 4JI8J 2LECA 2BANA 3UN3A 5CYQB 3UDVA 5AE3A 3N0VA 1IUJA 1QAXA 1Y7PA 2J0QD 4IH6A 1AROP 3MECB 2JSXA 1GTEA 2AIRB 2L9WA 2FVSA 4QYZK 2BUNA 2LMIA 3NY0A 1S6QB 1RB0A 3ISZA 4PCQA 1S0NA 4DDFA 1IBKJ 1KC8T 4J9VA 1D3WA 2CNNB 3SFUA 4CLTA 1Q8IA 5CQGA 1NKEA 1FJGF 4MKVA 2Z0GA 2FVQA 4FVCA 5C25A 2QX0A 2DHAA 3DOKB 1S7HA 3GJTB 4ZP6A 4JI4J 3R6LB 2X7IA 2VASA 3K59A 5KOWA 4DF8A 5BYSA 2VFTA 5F0WA 1A7GE 1RBLA 2R3VA 3RRKA 2DRAA 3MWBA 4WIQA 1UA0A 3I56S 1ZA2B 1HQEB 3GB0A 3ONQA 2C2DA 3ENQA 2DR9A 4B9MA 3V6DA 2Q3PA 3UDEA 4CRJA 3NS5A 5KFHA 1Y11A 3O5TB 1NJYA 2LU2A 2M4MA 2KRBA 2MZTA 4KFBA 1WC1A 1U26A 4OYAA 4RUBA 3MMCA 2C1EB 4O3OA 4DEZA 1HFEL 4TYAA 2EKYA 4ECUA 1HI0P 4BHQA 3RB6A 2HHWA 3IAM9 4LSLA 4B17A 2O67A 4ZCIA 4RNHA 3Q8QB 1FD2A 1GX5A 2V67A 4DWIA 1P1TA 2XEXA 1J5EJ 1WDDA 3WZ0A 3GG0A 4DV0F 3I0RA 2RQ4A 5HANA 3LP0B 1N54B 1NPKA 2D7SA 2DGSA 3B54A 4AFFA 3BO3A 1HNXF 1D1UA 4B3RF 2QLBB 1UZDA 1SL0A 3BKFA 1HI1A 4LF9J 2XZDB 4WKRA 3U02A 3PW5A 1HBMB 2HPUA 3PVXA 2J6SA 3FMBA 3GR0A 4NLTA 4Q7AA 1NSKL 5GVQA 5DDQC 5A8WA 5H9EK 4F50A 1SL2A 2HZVA 1FRLA 3EZ5A 2FB0A 2QMUB 4CIOA 1K0VA 5AJ3J 4QWCA 4KB7A 1UFLA 5LOQA 2BE2B 4TQSA 1R27B 3PCOB 3PJ9A 1JXLA 2MQ8A 4XPCA 5L9XA 3KLFA 3TW0A 2CXEA 2PI4A 2QRRA 2F4VF 2ROEA 3N28A 3PV8A 4DUZF 3I9V9 4RW6A 3GR1A 4FYDA 4FP9A 4P2MA 3ZTQA 3IM9A 1S72S 2BANB 2OD6A 1T9VA 1IKVB 1U6FA 5KTQA 4CLZA 4CQ1A 3MCNA 1RWMB 1WWHA 2QC3A 3OTEA 3BGOP 4JI4F 1U8SA 4A8MP 2CJQA 4EEYA 3KLFB 4KKOB 3FCHA 3J7ZT 4N77A 1RYSA 4G6VB 5D0HA 5L39A 3CPWR 4NXMF 4O0IA 3BGLA 1LWFB 1WKKA 2DH8A 3OL8A 1YG0A 2E9RX 2PD1A 3QJLA 1BGXT 2HBYB 2HZCA 1CC7A 1YDLA 4OIXA 4EBDA 2E7VA 5A8WB 3KLIA 1VCTA 1HNZJ 3MOJB 1WKJA 2CJYB 2UUCJ 1MN9A 4UF4A 2H4YB 1NHVA 2CQHA 1VHFA 4O4GB 4DPXA 4WK3A 3I96A 4YB1P 4DV2J 1PJ6A 3RB4A 4PXDA 3ZZYA 3MGJA 1YITS 3DGVA 2BDPA 2GAGC 2QG9B 3DLGA 4Q44A 5EX0A 1Y00A 2UV8A 4EFAC 1VQ8S 1M5OC 2XULA 1F60B 3DRXA 3K8WA 3NG8A 3DM2B 1CJTA 4ED8A 3KMQA 1X5SA 4HR2A 4RZRA 1EB0A 2OJ3A 4ECVA 2V8HA 3T1YJ 1KONA 3HCXA 1KTQA 2G1DA 3FUYA 1S59A 5C42B 3OTCA 3OJSA 1HI8A 1SV5A 1GNKA 3N79A 5HLFB 4OX9J 3V6DB 4IOAQ 4CT8A 1UVIA 2P5VA 4KO0B 1FD8A 4ZITA 2D3UA 2BKNA 3M6XA 4GVBB 4RW8B 2GQ2A 3NAIA 2OPQB 1NJWA 1FJ7A 3QAEA 2ZM6J 3G87A 2ZITA 5E3AA 1CJUA 5FLXY 5A2QY 3TA1A 2HFZA 4WPAA 2ZBRA 4EU0A 2GJFA 2HW3A 1S6PB 1U0HA 2WONB 1FNMA 2HVIA 2PDAA 1BQNA 3I31A 1JNZB 2Z2MA 1IVZA 2B9YA 3SCIE 3MXHP 2J0SD 1S6QA 2Z2ZA 4U6PA 2BRLA 4EK2A 5F3ZA 7FDRA 3M8RA 3H40A 2BE7D 3GV5B 1MU2A 1GQEA 2AF6A 1I5OB 2EFQA 4OZ1A 5J2PA 2ZVSA 4JI6J 5J2NA 5KFMA 5EWEA 1TL1B 2HWIA 2VIHA 2MPUA 3DLBA 1D8YA 3J7A1 1F6TA 5HROA 2K2PA 3MHYA 3OJUA 2CVEA 3EGVA 1U6BA 3DHWC 4O3PA 1HD1A 3FEXB 5IWAJ 4YQWA 1T9UA 2R8IA 3PYGA 2NUUG 3U1MA 3KHLA 3V6KA 3G2XA 2VJUA 1NJIT 2CJAA 3OQ2A 2HRUA 3EUNA 1OPIA 3HXMA 2MTLA 1S1UA 3OSPA 4LF4F 3HZGA 3IN5A 4LFCJ 3HD2A 1K9MT 3D4JA 2Y1RI 2LXIA 4X66F 1JJ2R 2YKNA 1OO0B 4LF6J 4NLDA 1TELA 5A8KB 3OTBA 5HSPA 4JYAJ 4K59A 4K7QA 1FRMA 1WC4A 2W2NP 2HIQA 3ULHA 4RW9A 5IM0A 5F8HA 1BE4A 4DFKA 2EFGA 3IWNC 2GO8A 5I42B 3QO9B 3VGVA 4LVOP 1JJ4A 1VGYA 1FT8A 1T95A 2A18A 2IYGA 3QNWB 4Q2MA 1J2VA 1L3VA 1TL1A 4OV1A 1MWYA 1ZPVA 3THPA 4ZLPA 4LRBA 3OLBA 1T9TA 1RT1A 1TL4A 2C3OA 3VV2B 3WC0A 3DCAA 3UVJB 4BBYA 2W4DA 3KHGA 3UCZP 2BKPA 3HHLB 4L3NA 2P6SA 2J76E 1PG5B 1WSRA 2DH7A 2FJAB 4DSIA 5AXMA 2K3IA 1WDTA 4X4OA 1GFWB 2PT0A 4L74A 5EHHA 3SQGA 3FRZA 3ILOA 3M2UA 4B3TJ 3IRXA 3DRYA 3F0NA 4NRUA 2CPEA 1RTDA 4ZN1A 1B70B 1VC6A 4FBUA 5L38A 2KFYA 1S97A 1OMSA 2FC9A 3AOBA 3PX6A 2ADBA 4DR3J 4QCLA 2ZWPA 4KBIA 1FRXA 5D0GA 4DOZA 1UJ6A 2RAQA 4M5LA 2XYPB 2VQEJ 1WHXA 4LF2A 3PZPA 3QWUA 4DR7F 1XNRF 4GKJF 4NCGB 5EUHA 4C0OC 5DETA 1ZA1B 1DLOB 4Y65A 4F4AA 4ZHRA 1HWKA 1S57A 4NYOA 4C8KA 1OJ4A 3JSYA 4TN2A 4LSNA 1ULRA 2CPHA 2PC6A 3MPUB 2JJ4D 4P74A 4XK8C 1QAYA 4YHHJ 3QZ8A 1ZETA 3VGSA 2RQMA 3C2PA 5F8JA 1IR0A 3PJXA 1WG4A 2FVPA 2QSFA 2QV6A 3DN9A 4B9LA 1FWKA 1OYEA 2GVDB 2JVRA 1V6HA 3CW2C 4DS4A 2CADA 2XG8A 1RHKB 2AZ3A 5DO2A 1YIJS 1NJZA 2C2OB 3DOMA 1UEKA 5ETNA 1RT7A 3QSYB 3UD4P 4F3MA 5A8KA 1TKTA 4IFVB 1EAYC 3LOUA 3H2LA 5G4DA 3A4TA 4MH8A 5KG6A 4HHHA 1VI7A 4PWUA 3A12A 1H72C 3CEDA 1NDLA 2M0GB 4ZVPB 2XS7A 2HLTA 1TL3A 1TVRB 1YI2S 4N8NA 1UVNA 1KVKA 1BY9A 3P5TL 1DQ9A 4PWDB 4OZJA 3OVSA 3V6HA 4FBTA 3BR9A 2YY3A 1K44A 3NRBA 2DEIA 1U25A 3TUZC 4L3KA 3TZXA 4CM0A 1YBAA 1JLAB 2F9JA 1RHRB 3DXBA 3I4PA 4OHVA 4J90A 5LJ3Y 2VD3A 4LF5J 3G96A 2F9DA 3K17A 3EYZA 1QLNA 3HZEA 5F9LA 4WTOB 3EPGA 1IBLF 4B3TF 2HBRB 1PBUA 4LBIA 4F4KA 3ITHB 1RT1B 1JLGA 2QMXA 3D67A 3K57A 1D9AA 1BD6A 1FWPA 1HLWA 1AA1B 1YKWA 4RL1A 2QO3A 4CO2A 1XMQJ 1VQLS 5K9FA 2X1FA 3FCVA 2OLWA 2RE1A 4XDDA 2LEBA 5EN1A 1N5TA 4ZPCA 3V4IB 4A8XA 1Q8BA 4Q2LA 1WOSA 4Q8FA 1X5TA 3Q23A 3P96A 2CKWA 2XYHB 1RT5B 3KLEA 1QDUB 3PEJA 3CO0P 4A8QA 2ZUGA 2YKNB 2B6AB 4U95A 9ATCB 1LK7A 2X3GA 4C98A 4DR1J 2HFUA 3C46A 4MFBB 5B09A 4Y0FA 2K7JA 4GVBA 2KL8A 3KHRA 2FLOA 5KFFA 3QRPA 1AXQA 1HNVB 1T9WA 4WU3A 3BN7A 5CYJA 4YFUA 2WVEA 3IG1A 4M95A 5KFGA 3JYTA 3BKUA 4NE9C 4Z7CA 1DRZA 1F9FA 4ES2A 1DQAA 4S0MA 3KJVB 3R5BA 4LR9A 4U7CA 5DQIA 5HROB 2MYFA 4DUTA 3WHIA 5HAOA 3EVOA 1FXRA 5E5NA 2GW8A 1XJWB 3CCES 4H4OB 1KBRA 3BSCA 3HT0A 1L3UA 2R8GA 4KHMA 3UO0A 3QATA 4K8RA 3H5YA 4YUDA 1N36F 4DSJA 1H2VZ 2RJZA 4H4MA 1N6QB 4HH0A 5ETQA 4ZJLA 4ENOA 2BW2A 1N5VA 3T6JA 2HHHJ 2ASJA 3BPSP 2V9WA 5A6WA 1RP5A 4WFXA 2AYGA 3QRQA 4FXVA 2RQKA 4AT1B 2NREA 1P8GA 3ZTPA 4ICLB 4C0BA 5HBMB 2W9BB 1U0HB 2OSRA 3L7OA 4CT9A 1AFIA 3MFHA 2KJVA 2MQNA 4Z2XA 3HHDA 3OL6A 2YWFA 3D9BA 4ANEA 4ID5A 4Y2CA 4LFAF 1GEHA 1X4DA 3PO5A 3E01B 3BKTA 2OD4A 4USVA 4ED3A 1VMBA 3PY8A 5D0RA 1U2RA 4F0MA 3JSRA 4M1KA 4YDXA 1VQOS 3BBCA 3AOCA 2B7BB 1HQ2A 2CQDA 4WFYA 2AD9A 1E6VA 1H7XA 1UL3A 4CLPA 1VBKA 3QIPB 3MD3A 4AXIA 4WKYA 1KLMA 2VC1A 3QMQA 4LRAA 3M30A 4P6QA 3RW7A 4ANDA 3Q8PB 2QT7A 2V94A 3CSKA 1RYRA 4DV6F 2GGPB 3VWSA 3ZXWA 2MMYA 3CCMS 2ZDPA 1CPZA 3BH7B 3W2WB 1K47A 3QFWA 5J1NA 7AT1B 2HVEA 2YPYA 4Q45A 1PC4A 2YX4A 4I0WA 3OHAA 1RT2B 3T9ZA 2UV8G 3HHNB 5A8RB 1R8PA 3PR5B 2YNHA 4ECTA 3N4WA 5ITHA 3DDNA 3NMRA 4C0HA 3NGDA 3ZTSA 1UWAA 2ZJPQ 4DR1F 4PPDA 2J9DE 2KM8C 2GVZA 3SV4A 1S10A 1C0UB 1RE1B 2BJEA 2P8IA 2ZNYA 1SPBP 2QYCA 2YX7A 3NKYA 4F67A 4C48A 5FLXU 1MU2B 3GYNA 3I0SB 4QWBA 5E2QA 4GKKF 1Y5NB 3RR8A 3M8ZA 1JLBA 1R8BA 3SQOP 2L3MA 5MAOA 3IGNA 4R25A 3ZZPA 2KFZA 4OYMA 2QE5A 2DGWA 2JOQA 3AODA 1NH7A 2E1RA 1HHSA 2WONA 4K4VA 3RRHA 1S6PA 4NMXA 3KK1B 2OEJA 3SZ2A 2V50A 1FKOA 1R43A 2OIHA 4X2BA 1CJUB 2WSEC 3ET6A 3M2VB 4QR1A 4OYXA 4CH1A 4IDKB 3FZ2A 4RW6B 1RWPB 3H42A 4C8NA 2ZH5A 1FDNA 1MG7A 1SIZA 1FJEB 4IDKA 4OLPA 4E98A 4OI4A 2ZM6F 3A8JA 2HNZB 2ZDOA 1NSAA 2QA4G 2LQ9A 1VRTB 3Q89A 2BE2A 5C42A 4RUCA 1WI6A 5G0RA 3OSNA 2KB2A 3SDEB 5SUHA 3MM6B 1RHQB 1YZ6A 2NS1B 2XMVA 1TL7B 1D9DA 3BGRA 3HFZB 3O6QA 1NK9A 2E66A 3CJ5A 4DSEA 2GO9A 1PO6A 1N0UA 1KHVA 2F8HA 3HKZD 4NWBA 5CABA 2VDHA 4DV5F 2HS3A 4PKDB 1NMEB 1RAFB 4V1Ak 3W8PA 1VQ4S 1X60A 3LP1B 3NP5A 3WX4A 1SQGA 4P2FA 4KHPF 2GVZB 2YX1A 1UEUA 1WF0A 4P10A 1WC5A 2DB1A 2I0XA 2YWKA 5KFUA 2BR0A 4I2PB 1RAHB 4IH7A 2YNIA 3LAKA 4O44A 2ZJRQ 2HHXA 2HWTA 1RZMA 3EDRB 3DMJA 4USKA 1S4EA 3W9JA 5SZTA 3IBCB 5KFIA 1MN7A 2ALZA 4PG5A 1J5EF 1KQSR 3R2DJ 1WTBA 1GXTA 1REGX 2MDAA 3HHLD 3O8WA 4K2JA 5B0DA 1EARA 1HPZB 5KFSA 4DQRA 3HO1A 1S12A 3IBFB 1HYSB 2FJDB 4NLRA 1HBOB 1KLMB 1V3SA 1M1HA 3M2VA 4CLWA 1LWEA 3W66A 1N33J 2GX8A 2I2YA 1R3NA 1FDAA 4JBCA 3UE2A 5B0FA 3KK1A 1CQMA 2QN6B 2XNQA 3F73A 1N32J 2XS2A 1GXLA 1R0AB 3DOLB 2IRYA 2DITA 1IBMF 1ZAVA 1IBCB 4C8YA 5FIIA 2KZZA 1S9EA 2IJFA 4LIWA 5L1JA 1QTMA 1U45A 3I5AA 3KTQA 1QUPA 3WIUA 2J0XA 2QLXA 2HFOA 5HBMA 4QJVA 3R1HA 1PGZA 5JVGQ 2UUBJ 4FKYA 4G1PA 3K5MA 5IT4A 3NGTA 4DBQA 2VFRA 1N52B 2VKZG 2DEJA 4AQYF 3DLHA 1JLCB 1FEEA 2Y1IA 5GMKa 3IR7B 2UP1A 2WK4A 4U8YA 2XY6A 2P6TA 4UQTA 1NRKA 1BQMA 1HQUA 3RBXA 3T5JA 8AT1B 5EDWA 3UD3P 4YR0A 2DO4A 5CA5A 5ETKA 3HLUA 2HBZB 3C15A 4Q0BB 3IGVA 2QA2A 2EXUA 1RTIA 1N32F 3KJVA 5E7OB 4PYAA 3T5HA 1ZH5A 2UZAA 1M5PC 4BWJA 3WC2A 2F3JA 4YOEA 2D3ZA 4X66J 2E7XA 2GGPA 5B7WA 4A8FA 1KVIA 3TARA 4XAKA 4I2PA 2FQQB 3M7VA 4ES1A 1VBYA 4UY85 3D3CJ 4MYUA 2G0JA 2IJRA 2QSWA 5J2QB 2BKOA 3GP9A 4ZPTR 1U1PA 1HBNA 2C2EA 1ZPWX 3CDWA 4WIIA 1PIEA 3DYAA 2BZ2A 2V8DA 3D6HB 3BYRA 5KFLA 1S9GA 4NA2A 3DI6A 2EKNA 4WWSA 1TK0A 2DPIA 3ENAA 1URNA 4CH7A 2QFIA 4RBTA 1TL7A 3DLEA 3W2VA 2H1YA 3IS9A 2Y8WA 2BQ3A 3U27A 2VF3A 5D4NA 2ERRA 2VOOA 5KT3A 1RT4B 2RS2A 1SUQA 3CD6S 2WSCC 2HNZA 2UXDJ 1J27A 1MROA 2FC8A 4HVZA 3GV7B 4OYZA 4JI5F 4H4MB 1N6QA 2OPSA 2QLFB 2IHR1 3N5BA 4LQ9A 5KFDA 4DUZJ 3V81B 3MPDA 3RTVA 2FHKA 3ITHA 2YXLA 3D5MA 3M8YA 4DL4A 4H4OA 4DUYJ 2EFNA 3H5SA 1IR2A 2ROGA 3SBMA 3R9LA 1SKRA 2VBYA 5GAEI 3BBFA 3M9NB 3GFYA 2EC0A 1QM9A 1KOOA 3GJQB 4USIA 1V5IB 2XSFA 1P1LA 2YWWA 3R5DA 2ATLA 3BYPA 2OPPB 5M2UA 3FDSA 3IC1A 3T5LA 2UXCJ 4LF7F 2B43A 3PXGa 2W1BA 4ZP7A 1GMWA 2ZH9A 1UFKA 2L9DA 4O3QA 2NYHA 2HHQA 2KTQA 2KXHA 4DL7A 2YQ1A 3DRPB 3ILLA 4HACB 1Q7YT 5IT0A 3PHTA 2IMWP 2VA2A 2KU7A 3IP0A 1T7PA 2HLUA 5D78A 2UUAF 2MJUA 3ZTRA 2RDDA 4I56A 1NCLA 4QOTA 5KFEA 4RWXA 3OLAA 2DNLA 4IFVA 2G9OA 1SC4B 2UU9F 1HNWJ 4OX9F 2JLGA 3H0PA 1SH2A 3ETOA 2KXFA 1YJVA 4DL3A 4OX6A 2IIHA 4JI2F 4BWMA 2GVDA 1HWIA 4MIBA 1ZM2A 4Y6IA 4ECYA 2R7WA 3H7HB 1TP7A 2E44A 3KUEA 3BGUA 3GFZA 3W2WA 5F8MA 3G4SS 4WXWA 1RAIB 3SCLE 4WE1A 4U67Q 2UUCF 3OR2A 4K4ZA 3Q8UA 4CYUB 2GIFA 2AJQA 5L8RC 4FYXB 4NI2A 2DRDA 3DLJA 1U47A 1NK7A 1NLKL 4DPYA 5D4LA 4JOUA 1SC6A 2VDIA 2XO7A 4F36A 1YRXA 1K1SA 2IAJB 3CVKA 1NUEA 4P2XA 5LL6d 3IRWP 4JV5J 4ID8A 4HHJA 4CLKA 2G2OA 2XMWA 2AWZA 5DS7A 1IBKF 4DR6F 4QIFA 3TQEA 1KRPA 5IWAF 3K5NA 4DLGA 3MEDB 4RW4A 2IDEA 3TJ9A 1T9YA 2DHXA 2VG6A 1KFSA 2Y9HA 1FX2A 1JMTA 4C97A 3IRXB 1FK9A 2VB6A 2HHPA 3IBWA 5E3RA 4M5DB 3KKFA 2AJ1A 4KGVB 3HHLC 5KFVA 2MKKA 4YS2A 5HQLA 2KHCA 4DCJB 1L3TA 4U8VA 1O5JA 4BC9A 1MMLA 1RISA 4CZCA 1RT7B 4RNMA 2ZHBA 1YJ9S 2J8SA 4Q8EA 3D6TB 1N33F 1NDCA 2QA4S 1WOPA 3NBPB 1HHTP 4DI6A 4K0KF 2FHJD 4FNHA 2KDOA 1NSPA 3W7BA 2N4DA 4FZVA 5I4MA 2DIUA 3W9IA 4OI3A 2RMLA 1WHWA 3A8IA 4RNNA 1X31C 4CLLA 4HYKA 2D9PA 2CPFA 3EE3A 2ZBCA 4K4XA 4RW7B 4WJBA 4ZVFA 1TV6B 2IAJA 4X4PA 3BREA 1EETB 3RZAA 2EFVA 4NRTA 3SXLA 4DV0J 1SJ1A 3ZZUA 3T41A 3CCWA 2X51A 3R7BB 3BQ2A 4RO0A 2CJXB 4WYWA 3AXKA 4F7VA 1IXKA 3GCXP 4NI2B 4OZNA 4C3MA 5LM7E 3X3UA 2OPRA 3DRRA 3KK3A 1CS4A 2LP4A 3EICA 4QW9A 1M5VC 1LW0A 2R2TA 2UUTA 4Y2AA 1RU1A 2AHOB 1RDRA 4TXSA 4JI6F 2ILZA 2I1RA 3KMSA 4IOBA 2KI2A 3MM7A 2YWEA 3W62A 3A13A 1UCNA 4AE5A 2M8DB 4HHUA 1RAEB 4DSLA 1FTRA 1T03B 4CO3A 1FO1A 5L1IA 4NEZA 3WX8A 5F8IA 3LH2S 1KVJA 4UY8T 4ILRA 3K8VA 2HGNA 4N5SA 3U1NA 4I7FB 2RUSA 4FXWA 4DX6A 4F04B 4YR2A 4F0KA 1ZTTA 3NAHA 2W9CA 1I94F 3MEEB 1CJKB 1FERA 2OAUA 2V69A 1HHQA 1WHYA 2DCLA 3D66A 2GQQA 4B08A 4QBUA 1RBAA 3W64A 5GAHI 4DSFA 2GIRA 3P49B 3Q8YA 4RWWA 1LFWA 4OZ0A 4LBPA 3W9HA 1VK3A 2MJNA 4PXCA 3CMQA 3UD5A 4DL6A 1SJ3P 1JJHA 1LK5A 2YQ0A 4N41A 2HHVA 5JMNA 1CS4B 1F3FA 2ZUAA 3R97A 1RGVA 4LF1A 2DT9A 3Q8SB 1TL3B 1TVRA 4URGA 1W2BR 2KT2A 1OQ3A 1E6YA 1S1UB 1OIAA 3CIZA 3BR8A 2MLYA 2DNYA 4I6WA 3WQPA 4EZ6A 1X4HA 4KAIA 1Q7LB 4ZMMA 5HQMA 1UWBA 2FJXA 1YJTA 3TWZA 1M1KT 3DOMB 4PYDA 4PQAA 1U09A 4ZLLA 3IS9B 2WW4A 2GA7A 1PJ5A 3R5GA 3R5AA 3JAMU 3J81j 1WKLA 1M5SA 4A8WA 4ES3A 3LQVA 3L7PA 4QIEA 2EC2A 2XBPA 2C3MA 2IM3A 4DV1J 2XNRA 2R7TA 5AXLA 1FTCA 1U1RA 2MY8A 2IVFB 2GHVC 1HNWF 1V3RA 4K50A 3EGNA 2VOPA 4CLFA 3M8PB 1XR5A 2WSFC 1F5BA 1RXOB 2V2KA 4OHXA 5T41A 3DLLQ 4IH5A 5B0GA 2WBRA 2KN4A 4P72A 1FK9B 1YRUA 4QPXA 2DXFA 3LPEA 2DNGA 2Z2LA 1QD1A 5J1EB 1DTTB 4MKAA 3UN5A 2JWNA 1NDPA 1VK8A 1RTIB 3C3LA 3B78A 1RTDB 4LF7J 3C15B 2JH3A 4YMEA 4LRDA 2JEIA 3PFOA 4DUYF 3CTRA 3VGUA 1RAJA 2V8VA 1JB0C 1Q8LA 2AMCB 5GADU 2HWHA 3FBEA 4KPCA 1TKZA 4HT7A 4TU9A 1BQXA 3MUTP 4DR2J 2M70A 1YTYA 3KOAA 2YKAA 2R7SA 4FF4A 2ZC4A 2LQJA 1XIQA 1GXUA 1W25A 3SSQA 2NUHA 4QIGA 3TAQA 2PN6A 3CE8A 4URQU 4YB7A 4KGMA 4CYUA 4R8UB 3VQSA 2ATCB 3OXGA 1D09B 4LT6A 3IO1A 3TX0A 3L95X 3TVYA 4NX9A 1FFWB 2MZ1A 5KAKA 2FGCA 2W2QP 3NMAA 3IR5B 3LGHA 4JV0A 3D6FB 4FYYB 3CJQA 3P3DA 4DPWA 1AUDA 5E0OA 2MKIA 1DTQA 3M9MB 1VC0A 5THWA 2KJWA 3HVTA 2DR6A 2NPIA 4C6AA 1N8RT 2WBMA 3EZUA 4DQIA 3LP2A 2A3JA 1JJCB 4QPTA 2RF2B 1S5ZA 4DFMA 3RBEA 1ZAWA 3FSXA 1V5VA 2DNNA 3U1LA 5KG4A 2HNYA 4UOCA 3PX4A 2RT3A 1EJ7L 1F9EB 3UR0A 4DV1F 3MPVA 2KHDA 2BE9B 3KJNB 4ILLA 1WORA 3K58A 3H90A 1CJVA 1DHMA 4NZ6A 4CM2A 3MUMP 4ZPDA 3D1OA 1OQ6A 2VBXA 1X0PA 2I9SA 2I5JB 4KGZB 4KKOA 3CCQS 4KTQA 3DMJB 1M1GA 2ZNZA 4BCAA 1QVFR 5HATA 4YR3A 4NZ0A 3R3TA 4DPTA 1NNDA 4QR2A 2ZOGA 5C2GA 3R1LA 5JJBA 4NLYA 1IWGA 1GX6A 2JFDA 1DZ5A 4B3OA 2ROPA 4M5MA 4NXMJ 2XTJP 1Q4RA 5E3QA 3GIIA 2EBGA 3C19A 3QT5A 1RT3A 1SCJB 1VJWA 2F5GA 3BGRB 3GSDA 3CDUA 4RLEA 2HS4A 1AZSB 3SEOA 2A6MA 2BW7A 4A46A 1FWLA 4CLYA 2BV3A 1TKDA 3WDOA 2B7CB 1C1CA 4R5PB 1AZSA 1KP6A 2BQUA 5G0RB 2ZC3A 3GIKA 3JAMY 1UTAA 2JC0A 3A3PB 2DKOB 5KT4A 1EP4B 4NASA 3ICLA 1LQ9A 5BR8J 2QEXS 3PW7A 3MECA 1S1VB 3RAQA 2QGFB 3C16B 3VQTA 2W8KA 4DG1A 4RU9A 4DR2F 3OUYA 2V63A 4TY9A 4J9RA 1Q5YA 2R42A 5F9NA 4IKAA 1XR7A 4IRKA 5HMWA 2CUYA 4MIAA 2OFGX 3HHEA 5M2PA 4KV8B 3G6VA 3MM8A 1JK9B 3QT7A 1B64A 4ZCMA 2JC1A 3MM9A 4GO7X 4M5HA 3HFVA 5ETRA 1I51B 3HD1A 2E5IA 4URSA 1N48A 4MKYA 4V19X 1C0TB 1C1BB 3M6WA 1XR6A 3BF4A 1IQZA 3MEKA 5HJYA 1HARA 3VAIA 4KC5A 3V5RA 3D3BJ 3G8SA 3I0SA 3RB0A 3VGTA 2C28A 1FFSB 1OS5A 1S79A 2LFVA 3C14A 4MMOA 4JV1A 2PIIA 2ZD1A 4F26A 5IV3A 3FGVA 2RRAA 1JLCA 2GHWA 2Z4PA 2CFXA 2E1AA 2MXYA 4OYBA 2FLPA 3I5CA 3KG0A 3TRGA 2R8HA 4P9SA 4USWA 2HQCA 3HVTB 2YNHB 2J6TA 3CCUS 3V4MA 3M1VB 3Q8RB 4DV2F 1C0TA 2CQBA 2NLWA 4IQXA 2KVIA 2V6AA 2C2NA 3S7RA 4NCBA 1Z4UA 1N5YA 1J5OB 3RB3A 4ELTA 3WBZA 3GCWP 3P45B 3VAJA 4R8UA 3DNCA 4G65A 3GFXA 2CNKB 4GVLA 2MHNA 2Q43A 5D15A 2KYXA 5KFYA 3H2UB 4E2FB 3J80Y 2NZCA 3CC2S 1FX4A 3QIPA 4CTAA 3RBDA 3FEYB 1E6VB 1LV5A 4CTAB 3T1HJ 4ZPAA 3C16A 1HYSA 2DNMA 5IQ6A 2PEBA 2AT1B 3CO9A 3K5OA 2CNLB 1Z1ZA 4NZ7A 4J9LA 4RX6A 4JI1F 1KTVA 2DH9A 2OI2A 1IKYA 2HFNA 4F0HA 5DGBA 2DR5A 3BEGB 3NCQA 3CMAS 3PHEA 1C1CB 4R5PA 4ZVQB 1VQ5S 5D4OA 2W9BA 2OMLA 2MLXA 1TUGB 5T14A 3DRSB 1AUSL 4X4QA 4U7UK 1RT3B 1OY6A 2VFUA 2ZH2A 2JL9A 2CVIA 3TA0A 3AD9C 4WTYA 4CNZA 3BSNA 2VBWA 5B0CA 4B9UA 3POTB 4M5NA 4DCOB 4NLWA 2K06A 1HNZF 3LP0A 3HMJG 2RU3A 3DKDA 3QGPA 3RAXA 5IOLA 1S7IA 4MKBA 1MNEA 5CD4A 2J7KA 2BYCA 2D3O1 5L1LA 1TKXA 2KG1A 4FS2A 3RRGA 1G4CA 2XM3A 3TZZA 4B3SF 3CCTA 2FUG9 4DFJA 1XMOJ 4B9TA 1WUUA 1M5KC 1NXIA 1BHNA 2XWXA 1AFJA 1VRTA 2DNOA 2O1PA 2V68A 5KG2A 1UVMA 1HNVA 1RA7A 2YKMA 4WU2A 4USMA 1LWXA 3OUYB 2HHTA 4DG1B 1H7WA 2VL1A 5EWFA 2E29A 5FD1A 3CC4S 2E9ZA 1FNOA 1NM2A 3AQPA 4MK8A 4M5IA 3T3FA 2FJVA 4Y00A 1BWEA 2CQIA 1RT5A 3KLEB 3GIJA 2YNGB 2OO4A 1RTJB 3M8QB 1S4FA 3D2WA 4NLUA 3NLCA 2AGQA 4EBEA 2BXJA 3KXDA 2M3DA 3OL9A 3W5ZA 3LGNA 3D68A 3BBBA 3AB4B 4J9UE 4G3IA 2FD2A 4K0KJ 1X0FA 1VQPS 2HKEA 3HSDA 3TUIC 4DPOA 1HWLA 4QWAA 4FPRA 1S1XB 2IY5B 1FF2A 2RDJA 2CQ4A 4I2QA 1RUSA 1Y5IB 2B51A 2NXUA 3MMJA 3UDLA 4I68A 5CYQA 1O51A 1SJQA 1WTFA 2LCWA 1G7CB 2CPXA 3KK2B 1R31A 2OEMA 3AD8C 3BS9A 4DZ6A 1NKCA 1N36J 1UP1A 2CZ4A 3CULA 2V9KA 4G1IA 4Y2KA 2AYEA 3TX8A 1Y10A 2SXLA 1K8AT 3DXSX 1X4AA 1RI7A 1ROFA 3PYFA 4MAKA 4DN0A 1H2TZ 2LA6A 1LW0B 5LMUF 2VC0A 4A8OA 3OFEA 4RUHA 2MY7A 3QYYA 1X4BA 2IFXA 2RILA 5GAEU 3SSSA 2BM1A 2MZSA 3D0HE 4YDDB 4F3OA 4W92B 2ZBQA 1VLYA 1DURA 5AT1B 2OFHX 5BXIA 1ZZFA 2RKIB 4RNOA 2R4FA 3LWMA 1TK5A 2C3YA 4EBCA
chains in the Genus database with same CATH topology
2M88A 5CZXA 1C2PA 1CVJA 1ZBTA 3N9UC 5K14A 3DHXA 3GMGA 2CZVC 1K73T 4FNIA 3MMBA 2MGZB 2DNPA 4QWDA 3GIMA 2DRBA 3MUVP 1TL5A 3OFHA 4C11A 4J9PA 4OI1A 2UXBF 2RSQA 5GAGU 4HDGA 5LXYA 3F44A 2V5HG 2DHGA 2HAIA 3I6PA 4QIWD 2EBEA 1TKZB 1NU4A 4CI0B 1VQKS 2UVRA 4IR1A 1HR0F 1X5OA 1OSDA 2R7VA 5KFWA 1U49A 2VUGA 1JLQB 3TI0A 3KLHB 2HS0A 2X1BA 4IFYB 4B02A 4ELUA 2JZ5A 4IUFA 5DRKA 2VG7B 4P7TA 5GAHU 1SB6A 4N8OA 4I1TA 4ZP9A 2MKHA 3EGWB 3IG1B 4DDFA 1SQEA 3IWXA 2ZH3A 3QLHA 4PQUB 3ZZRA 1KLNA 2PI5A 5AJ3F 3G8QA 2PA8D 3MEEA 2XS5A 3H20A 4NCAA 2J9CA 1IQTA 4OHZA 1KN6A 3DDKA 1U1OA 5D8HB 4ELVA 3FFIB 2B6AA 3PRDA 4QZVB 2ZOFA 5CCLA 2VKRA 1REVB 2MQPA 5IM0B 2R7UA 2K1RB 2DCUB 2BABA 4ECXA 4JV2A 2PEHA 1XWLA 3LF0A 5IFMA 3AJ2A 5KFXA 2UXCF 2NZ4A 4O4RA 3VAMA 1E6YB 3TVKA 1D9DA 3FSIA 5J2MA 3C6TB 5F3TA 4YB5A 3CCLS 1NK4A 2FLLA 5BR8F 2HQ3A 2GC8A 1F5CA 3HI9A 4JI0F 1JKHA 3D1QA 5LSOA 2V4RA 4DR3F 3QPIA 3FEZA 4DV7F 2VQEF 3HP6A 4H4KC 2VPXB 1SH3A 4QYRA 2AV5A 2FJBB 3F56A 3E8OA 3NGKA 5C5JA 3EGZA 2XI2A 1JIHA 1FA0A 1RA6A 3LW5C 2AYMA 4KT0C 1IM4A 1JKHB 5AXNA 4EUVA 3BQ1A 4Z37A 1QSYA 5H9FJ 4ZPVR 1CG2A 3OL7A 1XNQF 4X4RA 3FSYA 3DGPA 2F8EX 3MFIA 1MROB 3OVBA 1RTHB 2IM2A 3A8EA 1SUQB 5CHCB 3KFWX 4KE5A 3C6UA 2F40A 2JHEA 3T1YF 4F02A 2DD8S 1UVLA 1XMBA 1W2IA 2XMMA 5DQGA 2FPHX 1N56A 4LF5F 1NEEA 3CJ4A 2QA1A 4F4WA 1FKAF 2PA3A 2U1AA 3JB9k 3FFIA 4P2SA 2OPRB 3DRRB 2EFPA 2MKSA 3OFFA 2XY5A 2W7PA 1CEZA 2DIVA 3NWGA 1DAXA 2GIQA 5DDRC 2LXFA 4ITSA 1YJWS 2R2SA 5HLFA 2D1CA 4OX8A 2FIUA 2RB7A 1JNRB 1N88A 4I64A 3T6BA 4HDHA 4IRDA 4C8MA 1APSA 2E9TA 4IFYA 5KFBA 2HHVA 1IN0A 3OFGA 4DS5A 4F2SA 2HMIA 2V4QA 3DLGB 3BDEA 3O3LA 2KO1A 4A4JA 2CYYA 5CYMB 2KT3A 3FQKA 1S1TA 3PO5A 4LF8F 4DLEA 1RTHA 1YGYA 2YKQA 4USJC 4DMZA 4ZPWR 4QYZJ 3HHLA 3KLIB 1WACA 1OSCA 1Y4ZB 3PEHA 4ED7A 3M32A 5LMNF 4KR0B 2MHEA 2DGQA 4IG3A 1FRHA 2L41A 1IKYB 4IO9Q 1R8CA 2Q66A 2B4VA 1X4FA