1GFWB

The 2.8 angstrom crystal structure of caspase-3 (apopain or cpp32)in complex with an isatin sulfonamide inhibitor.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
HKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CASPASE-3 (APOPAIN, P20)
publication title Potent and selective nonpeptide inhibitors of caspases 3 and 7 inhibit apoptosis and maintain cell functionality.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2000-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1gfwB00
3R5JB 2P2CB 2XYPB 3KJNB 1RWMB 2CDRB 2XYGB 3KJFB 4LSZB 1ICEB 2HBYB 1SC3B 2C2ZB 4DCOB 2QL5B 2CNNB 2H4YB 2H65B 1RHMB 2CJYB 1I3OB 1GFWB 2CNLB 2QLBB 1RHUB 2QLJB 1I51B 1PAUB 2HBZB 3GJTB 3GJSB 4ZVOB 2Y1LB 3D6FB 3IBFB 3SIPB 1NMEB 1QDUB 1SC1B 1SC4B 2HBQB 2QL9B 3EDRB 1RWWB 2C2KB 2CNOB 2C1EB 1PYOB 2C2MB 1RHRB 3GJRB 4JB8B 1RWPB 3P45B 1RHKB 3P4UB 2HBRB 5IC6B 1RWKB 5K20B 2QL7B 1RHJB 5IC4B 3R7BB 4ZVPB 3RJMB 2H54B 1F9EB 3EDQB 3KJQB 2H4WB 2Y0BB 2C2OB 4ZVSB 2H5IB 3IBCB 1RWNB 1IBCB 4ZVTB 1BMQB 3D6MB 3R7SB 3R7NB 3GJQB 1RWXB 4DCPB 2XZDB 2CJXB 2H48B 1RE1B 1RHQB 3QNWB 3D6HB 2XZTB 3NS7B 3R6GB 2XYHB 4DCJB 1QTNB 4ZVRB 2DKOB 1RWVB 2FQQB 2CNKB 1RWOB 2QLFB 2H5JB 4ZVQB 4ZVUB 3R6LB 2H51B
chains in the Genus database with same CATH superfamily
4ZKAA 1VK3A 2ZD1B 1HW8A 1IKWB 1DFDA 2BRLA 1MNEA 2RDDA 3MR6A 1H0HB 5JXSA 1KDNA 2DNZA 1WHXA 4KGKA 2KFNA 3PW5A 2YNIA 2CDQA 1E6VA 1NK7A 4FPIA 3N6MA 3V81A 2KT3A 3CJQA 3CJ4A 4QIFA 3EVMA 4F2SA 3DLKB 4MT1A 4YR2A 4FF1A 1B7YB 1FWPA 4OLOA 2GMLA 2CRLA 3HO1A 3N5BA 1S6PB 3K5OA 3AOCA 4B3SF 5J2MA 4CDIA 3MPUB 2F5GA 3VZHA 1VQNS 5CH7B 1X31C 3HLUA 2LYVA 4OX8A 3OL6A 1HNIA 2ZE2A 3DU5A 1IBLF 1R0CB 1NDPA 3KHRA 4ZPCA 5E33A 1QVFR 4M8LA 5B0AA 4L76A 2ZH4A 4LIWA 3F41A 4TNOA 4PPZA 2KXHA 2AZ1A 1A7GE 3GYXB 2B7CB 1S1VA 5HMYA 2FJXA 5HLFA 3ZNJ1 3U1MA 2HHUA 5DRKA 1U24A 3EUNA 1PJ5A 3CCLS 3MECA 1LK5A 1OO0B 2ZD1A 2RF2B 1T9TA 1IKWA 2KXFA 1S1XB 1YK9A 1HBMB 3PRDA 3JB9k 3B4MA 3FDSA 1H98A 1FRMA 2NSCA 3CMAS 4P7TA 5C2GA 3QT7A 1VDHA 2ATLA 4LQ3A 4DV7F 4RL1A 2LA4A 1BQNB 1ZM2A 3JTNA 2DNGA 3VTIA 3UD4P 4R0EA 3GMGA 3HXMA 1S6PA 1Y3KA 2LXIA 2G1DA 5HMXA 3EZOA 3AQPA 2BBEA 2HFUA 4N8OA 1NB2A 1P1TA 1TMMA 4OV6A 1YJTA 2OELA 1WORA 2A10A 3HT0A 2GJ2A 2KRBA 2XC9A 2JWNA 2Q43A 4DSLA 3LALA 2OFHX 4J7CA 3H90A 3J7YU 4J9MA 2R7WA 1QSYA 3BR8A 1N5TA 3HHDA 4PG4A 2Y8YA 1JLBB 2HNYB 2DXFA 2NSBA 4RO0A 3CXCR 1NKBA 4LBHA 2CIMA 2G4BA 1S1XA 1QAJA 4ZLPA 5I3QA 1HBMA 3HSDA 4TLRA 3JQJA 3PR5B 2GIFA 1AZSA 3LP0A 2Z57B 1YRUA 4P10A 1BQNA 3M9NB 2E44A 5F9LA 3KLIA 4C7QA 2K7KA 1FD8A 2ZJQQ 2FUG9 1WSRA 2SXLA 2CJBA 3M6WA 1RTHB 5HVGA 1M1HA 1PBAA 3N4WA 1TK5A 6FDRA 4U9RA 3G8QA 1KRPA 2DR6A 3SCJE 1UVMA 4X4OA 2ZDOA 3J7AN 3HPOA 4LVNP 3MOZA 3G2XA 1DARA 3QO9B 4EK2A 1LWFB 2BX6A 1P9QC 1R31A 4KB7A 1LXJA 4U7CA 2RRAA 1YJWS 2ZBRA 4WFYA 1KQGB 2HRYA 2EC0A 2BE2B 4H54A 3PRBA 3N9UC 4Y2MA 5JVHQ 5KFQA 3SDEA 3VVUA 2RB7A 4DQIA 3KUEA 1HI8A 3IM8A 3NAIA 1RAJA 5BYSA 4YB6A 3PX4A 2RRNA 1D0EA 3TA0A 3MFIA 5AE1A 3SQGB 1CJTB 5C5JA 2AZ3A 1EIYB 2YKPA 2VH7A 4M5DB 2QV6A 1FKOB 2DBBA 1VQPS 5DDOC 3PIPQ 4ES3A 5LSLA 4F0MA 1WOSA 2QYCA 2W2MP 4DV1F 5G0RB 3QSIA 5B0EA 3LPYA 3CE8A 1X0PA 3TVYA 5A8KB 4H4MB 3D1OA 1IJFB 2NPFA 3L4BC 1NPPA 3VGSA 3PVXA 4FKYA 3G4SS 1KR4A 4OYPA 1LWFA 4UW2A 4FVMA 1RK8A 1RDRA 2NZ4A 4AL7A 4DV5F 1NLKL 3BS9A 2RNEA 3LO3A 4DR5F 2AMCB 2ASDA 2BE2A 3HHKA 4KH0B 2HBZB 2R7XA 3MD1A 5KFTA 4X84A 2BW7A 3R97A 2AD9A 2W9BB 2VPYB 1U45A 5H9FK 1Z4UA 1PILA 2EFNA 2VJVA 1IJEB 1WHWA 2PMHA 1Y9OA 2HYIB 4QJVA 3T1AA 1YG0A 3SQGA 2VOPA 1J5OA 4FXWA 1CJTA 2YX7A 3M8YA 1UFLA 2B6AA 2RQCA 4M5DA 1FKOA 2GHVC 3TX8A 4Q45A 5D6GA 2HS0A 2JH3A 1QY7A 5G0RA 4DF8A 1RTZA 2DHAA 2MMYA 3P6YC 3PYEA 4IFYB 2E5LF 4ZP7A 4LRFA 1HPZB 2CG8A 1U48A 1XQIA 3FK4A 4BC9A 4QWCA 2HG4A 1VC5A 3LGMA 4OZLA 1HD1A 2KRRA 1GNKA 4OX9J 3R5DA 2ZH6A 3I9ZA 4RNFA 2DRBA 1ZAVA 3GJTB 2WW4A 2XHWA 3LH2S 2QFJA 1JLQB 3SSSA 3TJ8A 1XR7A 1RKJA 3HVRA 4NLWA 5LXRA 1S0MA 5LJ3Y 3VAIA 4RLEA 2GVZB 2DGQA 4R5PA 1FDDA 5E41A 2OIHA 2XG8A 2ZUAA 2Q66A 2C28A 1GTHA 4L75A 3N01A 4AQYJ 5L1JA 1QE1B 3KJVB 4IFYA 1RAFB 2HBYB 1SC3B 2E7VA 2DNPA 4NLSA 1MROB 2HVEA 1R8CA 2P5VA 2DGTA 3TAMA 4NLYA 4I68A 3HHLD 1Y0HA 7FD1A 4X65J 2FJDB 4RNOA 4A46A 2LECA 3VQSA 5ETVA 4IO9Q 2CNOB 2VU5A 2AGPA 4AXIA 4Y6IA 1JLQA 1VR6A 4O23A 3RRGA 4C8KA 1FO1A 3MCSA 4EGLA 4LF8F 3VAKA 4L3KA 5KG1A 4DUYJ 1H38A 1Q78A 1VYAA 2GVZA 2IVYA 4PXEA 2E7XA 2XB2D 4EZ6A 3FSXA 2RRBA 3T6BA 1KHWA 2L9WA 1HQ2A 4TLQA 3HSJA 3RBXA 4CM0A 1T03B 5KG4A 2FLOA 1XBWA 1X4DA 4FP9A 1RU1A 3DDKA 1RT4B 1QE1A 3KJVA 4CH7A 5CZVA 4NLVA 2QL5B 2H4YB 4B3RF 3M1VB 1CJVB 4ZP6A 3HJVA 2MKIA 4LF1A 1MROA 1VI7A 3V4MA 3W8PA 4JI1F 2IA6A 3Q2SC 1PC4A 2AYBA 2KKHA 2C3OA 2H9ZA 1RB0A 1WF1A 1FE4A 1J2VA 3IRWP 2CA9A 5A6PA 2K1RB 3WX8A 1RWKB 4CLUA 4UQGA 1JK9B 2BXJA 2R8JA 3A3OB 3TEHB 4QU7A 3IO1A 1VHFA 3FMWA 3OSPA 4ZP9A 2L08A 1D9FA 3MEKA 3CCQS 3DLBA 1HBNB 4M5HA 2YKMA 1U1KA 3NAHA 1REGX 1CQNA 3M8WA 1N32J 1R8HA 3CCWA 3NS5A 1FJCA 2IJRA 1AB8A 3QGPA 2Y1IA 2NXNA 4OZ3A 4Q8FA 2PN6A 5AXKA 1RT4A 2FYXA 4WF9Q 2A18A 1FT8A 4LF4F 3VV2B 3MPVA 1UEKA 2OPQB 3M1VA 1CJVA 2B4OA 2RS8A 1SQFA 2XCPA 2W7PA 2XY6A 4LFBJ 2R8HA 3FQKA 1VQOS 4NLXA 1FJEB 2WTFA 4KH1B 1BY9A 3CNQP 2K1RA 2WVCA 4MFBB 5J2QA 4WP3A 3OFFA 4DPXA 1S6QB 5HI7A 1TL3B 2HHQA 2B43A 3EPIA 3GJQB 4RW9A 5HK4A 2HHXA 1Q79A 3B4DA 3FC9A 3UQSA 2BM0A 4I69A 2LQ9A 3RB3A 1E6YA 1FWLA 3NEKA 3HKWA 1NJZA 2J7UA 4ECQA 4UOGA 4NASA 4BLGA 4USMA 4BWMA 3CD5A 1HBNA 1N54B 5B08A 5D8HB 5KFCA 2GIRA 4I7FB 3RG6A 3K57A 4C11B 3IMQJ 2ZHAA 1FX4A 3OLAA 3HK2A 3TZWA 5LM7E 2I38A 3QRPA 3PY8A 3PX0A 2HNDA 1VLOA 3NCQA 1F6TA 2IBOA 2V50A 1B99A 2ZWPA 3CGIA 3SI8A 2V94A 1SKRA 4PUOB 5E0OA 2W7OA 3P3DA 4FYXB 2CQGA 3LTOA 3AD7C 4P2XA 2UVUA 3Q8VA 2OPQA 1UVIA 3MM8B 1N5VA 3RUBL 4F3QA 5KFVA 4LF9F 2AJFE 5EWEA 1LWEB 3I5AA 4UTGA 1SH2A 4OMFG 3M8PB 1FDBA 4ZP8A 1DY3A 4ECVA 1YJ9S 2X3GA 4MFBA 2DNNA 2LVWA 1Q53A 1S6QA 3Q0AA 2FGCA 1TL3A 4DDFA 1S0VA 4ED3A 3MM7A 1RA6A 3HFZB 2KH9A 2UXCF 3NS6A 4QWDA 1S9EA 4HACB 3R6LB 5T14A 4OJ1A 2JEGA 5AXLA 5E5NA 1FTRA 3AJDA 1WELA 4NMLA 4V1Ak 3VWSA 3PKMA 2V5HG 4O0IA 4N77A 3IS9B 4DR1J 4J9UE 4C11A 2Y8WA 1KOHA 2YX4A 3Q8RB 2W4CA 4OI2A 1RT5B 2NYIA 3UNGC 4C8LA 3KLHB 4K4SA 1UJ4A 2E29A 5EUHA 4DR4F 1S79A 1PC5A 3B8HA 3BSNA 3TEGA 4IR1A 3H5SA 2R7QA 4PUOA 1U2FA 1WI6A 2V68A 1YHQS 4XTTA 4LJMA 1KTQA 2PD1A 4RBTA 5L1IA 2DNHA 4W98A 4OI1A 4FN5A 4DSKA 1TELA 2GQ2A 2D69A 1EZZB 4GO5X 4EBCA 4DV3F 1LWEA 3W2WB 1BUXA 4GMKA 5HQ8A 1B4SA 5I3PA 2FD2A 1UWBB 5KFDA 2AX0A 1HHSA 2JDJA 1NK0A 3GZ7A 2XSJB 5CD4H 2CNKB 3BPDA 4IYQA 3ET6A 1S77D 5ETPA 4NXNF 1NPRA 1C4CA 3CJ5A 1OMSA 5GAHU 2N4CA 1NDLA 2DEIA 3KKFA 1LW2B 2KT2A 3IP0A 2HWTA 4DR2F 2B4PA 3HCXA 4Q44A 3L7UA 1Q8KA 5KFRA 3DGVA 1MU2B 2AP6A 3DRRA 1OY9A 4NLOA 3IS9A 2JLGA 1RT5A 3EMTA 4DFJA 4J9QA 1G6BA 4ZCKA 1NPKA 1S7IA 2OMOA 5DQIA 4Q0BB 4B3MJ 2ZH1A 1FE0A 2IM3A 3EYZA 3ZO7A 1X60A 1Y5IB 2F3JA 3G82B 2H1YA 1SV5B 2GV1A 4KE5A 4C97A 1SL2A 3CF5Q 2QC3A 2WHOA 4I2PA 2FPHX 4B3TJ 3W2WA 5H9FJ 2I0XA 5AJ3J 3OPKA 5C25B 5THWA 1UWBA 2AJ1A 4PEOA 3RR7A 4WPAA 2XSJA 1D1UA 3DDIA 1F9HA 3PHEA 3I87A 3KHGA 2E1CA 4AE5A 1BQMB 2MQOA 3JS9A 2R7SA 2Q3PA 5KFHA 2IIHA 5LSRA 1HQEB 3SV4A 4H4KC 1I51B 4CLSA 1PAUB 3Q23A 4BC7A 2N7CA 2HQ3A 1MU2A 2ZDPA 2RHSB 1S48A 3R5CA 2ZC3A 1KSPA 2GJIA 4O4RA 2G0JA 3BGRA 1X7VA 3D6TB 2JEIA 5DGBA 4P74A 2BEFA 2GX8A 4XO0A 4K0KJ 3AB4B 2XMKA 1V3RA 2X1GA 5KG2A 4X4QA 2AYGA 1CC8A 3G82A 1SV5A 4RR5A 2OUGA 4IFVA 2BABA 2YQ0A 2DJWA 2DGXA 4FKXA 2UXDF 4YHHF 4ES1A 4F3MA 4J91A 4JI8J 3OTBA 1K73T 4CLPA 1N34F 3E01A 5HROA 2FLNA 4NRTA 2JEFA 2QYGA 4Z7CA 5CHCB 2VQFF 2MQLA 4FXDA 3GFHA 2MSTA 3AHPA 3QRRA 2W9CA 1UTAA 1IBMJ 1BQMA 1SI9A 1SJ4P 3PDNA 3FRZA 2DGOA 2UZAA 1QLNA 4F36A 1NHVA 2EKNA 4Q2MA 3E8OA 2MKYA 5KG3A 5IWAF 1N6QA 4QWAA 3C46A 2F63A 1WC3A 3DOKA 3LAMA 5DETA 3KUHA 1R8BA 1HL6A 4YEAA 2ZOMA 4R25A 2LDIA 4OJGA 4CZCA 2LU1A 1FRKA 3MI7X 4KO0B 4XK8C 3WC0A 4RWWA 1H3DA 1F2HA 4CLWA 2DVIA 2DNLA 3HM9A 4DR7J 3HVWA 3OL7A 3DMJB 3BGLA 3M9OB 3MUVP 2X51A 2V6AA 3AH6A 3MCMA 3H5XA 3DRYA 2XI2A 4A8KA 4HH1A 4ECXA 1VQLS 5JMNA 4RBUA 5LMUF 1ZTWA 2V63A 2DNYA 4AYBD 5F8MA 2LFVA 1Q5VA 5DM6Q 3BF4A 5J2PA 1C2PA 1CS4B 3RAQA 5D3GB 1WD6A 2B9YA 4CNYA 2VQEJ 4K2XA 4ZIWA 2DCLA 5ETNA 3LP1B 1NJWA 1VK8A 2MLZA 1JXVA 2IJNA 4IUFA 1RCXB 3JAMY 3X3UA 1JB0C 1RWPB 5ETRA 1JJCB 2VFSA 4CO5A 3RBEA 5GADI 3NNAA 1ACMB 4IKAA 2RILA 3LWMA 3S7RA 2E66A 2VL1A 1T3OA 3VGVA 3M6UA 1NJXA 1CJUB 4NCAA 5ITHA 5JVGQ 5KG5A 2DT9A 2HK2A 4LRBA 4X64J 1APSA 3PR4A 1ZA2B 2H3EB 1Y00A 4KO0A 3OTOF 3IXQA 2Z8QA 2XQCA 3FCHA 2LP4A 4DL5A 4USVA 1BLUA 2DO4A 3NMRA 4XPEA 2CQIA 1SB6A 1QSSA 3RTVA 4F4AA 4M5NA 4C8ZA 2GMHA 2CKWA 1RISA 2P9CA 3TWZA 1FD2A 4WP8A 3QGGA 4OJHA 4NRUA 1KEKA 1MMLA 1NBEB 2AGQA 1FEHA 3HD1A 5D3GA 1TAUA 5F8HA 2Y0SD 1RT2B 3WZ0A 3A1YG 2EC2A 5ETOA 4JV5F 3O3LA 2F40A 2I8EA 3LUYA 4YOEA 3LP1A 2PO4A 3EGWB 3BKFA 4KKOB 4DL7A 4WE1B 4KHMA 3G9CA 2RHQB 1RHJB 3OSNA 1RABB 5KFSA 3IRXA 1KBRA 2W2OP 4GO7X 2YWGA 1HD0A 2YNFB 3FBEA 4LFAJ 2YWEA 4XPCA 1RWXB 2GCFA 2R2TA 3NGDA 1RTJB 2MJUA 4DPUA 9RUBA 1NK5A 2DHSA 1RA7A 3PNIA 5I4MA 4ZJOA 3KK2B 1VQ4S 3K2YA 2AEJA 3AQOA 3BV8A 4A48A 1NSAA 3THTA 3HT3A 2CNNB 2DIVA 4ILLA 1WACA 2B51A 3ELHA 2APOA 1HR0J 3UD5A 1SQGA 2GHWA 1SC4B 3LPEA 1SC1B 1NH7A 4PCQA 3W8GA 1NCLA 5D0RA 2KYXA 1ZZNA 4DEZA 3MDFA 2JVRA 1V5VA 4RUBA 4F25A 3HSZA 2Q1LA 3OJSA 3UN5A 2WRMA 1OWXA 1T7PA 4WE1A 1XMOF 5EHHA 5IS2A 3V6KA 1LOUA 4OYIA 1N52B 5EGYA 4DL6A 1DURA 2MKCA 1R27B 3M2RA 3D4JA 4URQU 4W90B 3CCTA 2FGOA 1HMVA 3SFGA 3ILIA 4NCBA 2CJXB 1RE1B 2XNQA 4KTQA 4MTPA 3K58A 2DH7A 1RTJA 1KLNA 1U8WA 4I6YA 3MMBA 4QWBA 3CPWR 3HHLB 2CQ1A 4FNIA 4Y28C 1UJ5A 2P6SA 3M8QB 1HKAA 4JI7J 4P75A 3WBZA 4YDDB 2BQRA 3JQMA 4N7TA 4NYOA 4L72B 5L46A 5KFMA 2HFNA 5KT2A 1LFPA 1BWVA 4ATNA 2E1MC 3KUGA 2QLWA 2C1EB 4YR0A 1Q8IA 4JV2A 1R89A 5KFIA 5DZ7A 2LLZA 5HBMB 3CDWA 2ZZNA 1K1SA 3H7HB 3TP2A 4OZNA 2I6WA 2KB2A 4ED0A 7AT1B 3DHWC 4LIRA 3MURP 1RTDA 3FCWA 2Y0BB 4JV0A 3PW7A 3NBPB 3AXKA 1YVFA 4OYWA 3DM2B 1SCJB 2AF6A 4R8UA 3FSIA 1VGYA 3UD3P 2CADA 3MR3A 3CO9A 3CCES 4RJVA 3HHLC 1D8YA 4NZ7A 5DG9A 1JMTA 4B3SJ 1X4BA 5KT5A 3BSOA 1H7WA 2DGWA 3T5JA 1M1KT 3W5ZA 4F04B 3H5UA 3HHLA 1V3ZA 2V4JB 3L95X 4ELVA 1IBLJ 3M8QA 2LEBA 2F9DA 4K4WA 1YIJS 2V8VA 4ELTA 3CJ0A 1TV6B 4RUHA 5KG6A 4DFKA 3KLGB 2Y1LB 3GYNA 4LRDA 2ROGA 3R2CJ 3QT8A 4JI4F 3PJXA 4DUTA 4WIQA 2BVZA 2HQGA 3R3TA 3BGOP 4DJBA 3LANA 3WHIA 3D0HE 5B0GA 2KJVA 2HHPA 4IRDA 2M52A 5KT3A 1GAOA 4ZVTB 3K59A 2C22A 4FXVA 2MKHA 5LT5A 4DV7J 1EETB 1FDAA 5GMDA 1UP1A 4WTYA 2ZBQA 3RYLA 5CA5A 2HIQA 2XMVA 3SEOA 3W9HA 2GAHC 3V6DB 2XULA 3GFXA 1RT3A 4X4PA 3J81Y 4ED2A 3O8WA 3I96A 4Y2IA 1IXKA 1VJWA 2ZVSA 5HVFA 2V4JA 3GIKA 1VJQA 1F0XA 4JI3J 1TUVA 2AJQA 5L8RC 4X62F 1F5BA 1VISA 2F4FA 2VBYA 4QOTA 4ZJLA 4EZ9A 2HHTA 1Q95G 4FDFA 5BR8F 3W2VB 2ZNYA 2BR0A 2N3LA 1NKEA 3CC7S 2XSFA 3UFCX 4CYUB 2OEJA 3H2LA 3EXYA 4DPWA 1U2RA 3QGIA 3KJQB 1VQYA 3SCLE 4XDDA 1Z2LA 5B0DA 1H72C 2CQ3A 5L9NA 1KTVA 3I4PA 2LEAA 3NWGA 3I32A 3EGZA 3E51A 2QRRA 2COLA 3WIUA 4N76A 1HHTP 2R42A 3MMCB 4I2QB 1EETA 1NSKL 3MMJA 3MXHP 4YDXA 2OAUA 1RWMB 2M88A 4X4NA 1LWCB 2DNOA 2PC6A 4ZLNA 5A6WA 3V6DA 2OLWA 3T1YF 4WWSA 2KZZA 3H42A 2GJFA 4LFCJ 2JNJA 1KVJA 3MTJA 1AW0A 3T9NA 3CCJS 2AW0A 2HVIA 4G1QB 2HGMA 2Y3YA 1HBOA 2A2DA 2FJWA 1T9UA 4KIAA 5CYQB 2FJAB 3W2VA 2VBZA 5HSPA 4CYUA 1UFWA 2HQFA 5CAAA 2VFUA 3D68A 1HNXF 2A3JA 4FYYB 4F0KA 2YQ1A 1W25A 4DQSA 3OFGA 2PI5A 1RWVB 1W26A 1KOOA 3DOLA 2V9WA 1CSJA 1UVJA 4ZVQB 2HWHA 1C4AA 2VUGA 2P2CB 1AUSL 3JSYA 4ZPWR 3DRXA 4K4YA 2CDRB 1AFIA 2MQQA 3MMCA 4I2QA 1IN0A 3FBFA 5HANA 1TK8A 2EVZA 3BJYA 3C3LA 2KU7A 2HLTA 3DLJA 2CUYA 2QLBB 1AXQA 2IRYA 2BW2A 3T3FA 5DQGA 5GAEU 4DX6A 3H25A 1T9YA 1NJYA 2D3OR 3NP5A 1JIHA 1B7FA 3C6UA 1ZAXA 2V2VA 1AYEA 1GX6A 2R7UA 3TVZA 2YWFA 1FTCA 1GH8A 4N56A 2Q6CA 2EW9A 1VBYA 2BDPA 2KFZA 2ZZMA 3PO4A 4DZDA 3W60A 2UXBF 4W4MA 4OIXA 2J0SD 1RT7A 2IRXA 1WSVA 4CP5A 1I94F 1KWMA 4DV5J 4DR5J 2XWXA 5A8WB 2LQJA 4UUXA 3ETOA 2NXJA 4A8OA 3M05A 1X9WA 2I9SA 4F4ZA 2HAFA 3OUYB 3V6HA 3CJ8A 2HHWA 3OV7A 4KV8B 4IH7A 3K8VA 3ILLA 1TUGB 2ERRA 1SUQB 3ZXWA 2J0XA 4PG5A 3HVAA 1PYSB 1RHUB 3H2UB 1BE4A 3PFEA 4O0NA 4I64A 3GR0A 3WX4A 2QL9B 2F65A 3OFHA 2DPJA 4ER8A 1S1WB 2E5LJ 4CO0A 3HHEA 2E9RX 1GK8A 2A6OA 1EP4B 1AUDA 5IOLA 2HK3A 2GMJA 5IV3A 4EMDA 2M5YA 2R3VA 1PBUA 4C0BA 4TU9A 3TRGA 2H5IB 2KG1A 3C14B 4IOBA 4ZA1A 2PI4A 2GW8A 5ETSA 4OFZA 4QIEA 4ANCA 2P8IA 2AJ2A 2AEMA 1JX4A 1WUUA 3S01A 4B9TA 3GIMA 1HLWA 4P71A 4JP8A 2VB6A 5K14B 1LKZA 1UJ6A 3AA9A 5A8WA 2F8HA 1GMWD 4MIAA 1TL4A 1M5OC 3P49B 1OQ3A 3KLFA 3BM7A 3DLGB 4CIOA 3OUYA 5EN1A 3LW5C 2BQ3A 5DGAA 2RSQA 3SQOP 3TQ1A 1TL7A 3DRSA 1R6YA 1SUQA 3S8SA 1WC6A 4G1IA 2DR5A 2R9LA 2IPOB 1M5SA 3AODA 1FCAA 2RUSA 3SIPB 3D28A 1U2CA 4DBQA 1YI2S 4FYDA 4MK8A 3SZ2A 4ZLLA 2YBVA 3OXGA 1U26A 3VQTA 1O6XA 2DGVA 4M5IA 3M2VA 4EUVA 1S1WA 1Z1ZA 3GFZA 4ILMA 3Q24A 3C16B 3D1QA 2FVSA 3GONA 1EP4A 4HVZA 1G7CB 5A0YB 1VHIA 4MMOA 4NA3A 4WTOB 2DRDA 2DR7A 2CG4A 3UCUP 3DXBA 1JLEB 2IA0A 5J1NA 5HJYA 1S0OA 1N36F 1OY6A 4PG7A 4ZVHA 5FDLB 4HDHA 2CZ9A 1GXTA 5KFLA 1S1TA 3ILOA 1L3KA 2Q6BA 1N5QA 1T9XA 4WBFA 2RT3A 2ILYA 4XDCA 4PZVA 2CPHA 3M30B 1QAYA 3OLBA 5K14A 4OZ0A 4LF8J 3N5FA 1WHYA 1T05B 1TKDA 2MTLA 4DX5A 1PCAA 2F8MA 4URGA 2RAQA 1H2UX 4I0WA 1CLFA 1DTTB 1RKIA 3NWRA 4DL4A 4ECTA 1U6ZA 1UWAA 4LQ9A 3JSMB 1VQMS 1YRXA 3KK1B 1RAAB 1B3TA 1FRJA 3H5YA 4M5MA 2ZH3A 2CQHA 5IC6B 3TA2A 5IC4B 3C19A 2J76E 4Q2LA 3I0RA 4ZVPB 1V3SA 5DO2A 2MHEA 1W2BR 4RZRA 2GGPA 3D3BJ 3J7YI 4PQUB 3C16A 4B3RJ 2FHJD 4ZN3A 4NL5A 1OPZA 3VAHA 3HF5A 4JI1J 3TNVA 3A4TA 4ZVRB 3EXCX 6FD1A 1K8AT 1RWOB 1JLEA 3PX6A 3KG1A 4A8SA 2QA2A 1IUJA 1L3VA 4X4UA 5AT1B 3M4XA 5C42B 1TFYA 3BSAA 3MM5B 3M30A 4WFAQ 1UVLA 1T9VA 1RAHB 4PXDA 1G2EA 2UUCF 1T05A 2O1PA 2VONA 2XMMA 2FJEB 4Y0FA 1Q4RA 1MW7A 1WDDA 4OV1A 3D0GE 2EEYA 1DTTA 1MMDA 3Q8YA 4KRWA 3FBCA 3JSMA 1W2IA 3KK1A 2QA4G 2BJ7A 1Y4ZB 2PMWA 2HVHA 3B54A 3MAHA 1PSDA 5K8NA 5A8RA 2HZVA 2HS3A 4OZ2A 4LF4J 2MKSA 3QJLA 3HMJG 4PQUA 2HQDA 5A2QU 4H4OA 2WBRA 5D4NA 2DCUB 4TU7A 3ICLA 3PXGa 1REVB 4WXWA 2ZH8A 4ED5A 1NH8A 4A4JA 3K5LA 3CCSS 2C2RA 2A0FB 1QSLA 3GG0A 4KSEB 1UFKA 2XO7A 5C42A 3S6EA 1VC6A 1TKTA 1YGYA 3MM5A 4RW7A 5F3ZA 1HHQA 1WOOA 4CO2A 1AROP 3V5RA 3HSGA 5AXNA 1RP5A 5F0WA 4AUKA 1O0PA 3EDRB 4AL6A 3MCNA 3WDOA 4QPTA 1XMQJ 5CQGA 1X5PA 2ZBPA 4Q43A 2NQPA 2J8SA 4F7VA 2GA7A 3DI6A 3J7A1 2DPIA 2NYHA 2YH1A 5EX0A 4P2MA 2D7SA 3PFOA 3CCVS 1I5OB 4OHYA 3KFWX 1OYDA 1ULRA 3TOQA 1HWUA 2OPRA 5CZXA 4X4SA 3WC2A 3SBMA 4ITSA 3TZZA 5FLXU 1GXLA 1A0OB 3I82A 4DZ6A 2VC1A 1FJ7A 5SUHA 5DDPC 4JYAJ 4JI5F 4LF9J 1HQUB 2MSSA 5ETTA 1REVA 3BB5A 3M2UB 1S72S 3VHQA 3Q89A 4A47A 2RQ4A 1OYEA 3GB0A 1ZM9A 4KYZA 3VZIA 2DD8S 2WW8A 1EQ0A 1HWLA 2BKNA 5DDRC 3ISND 2AQ4A 4DN0A 3NGSA 1BXNA 2FB0A 2IY5B 2OI2A 1IVZA 4QBUA 4KPYA 4CLFA 2IVFB 2G0IA 2CPEA 3CO0P 3I0SB 5BYQA 2HRTA 2QIFA 4WZMA 2DB1A 2J6TA 1TKZB 3D9BA 3PYGA 2FTRA 1YITS 1XIQA 2PFDA 4K8RA 3U27A 3UR3C 3IG1B 2XI3A 4OZJA 2RJZA 1U1QA 4DR4J 5KFUA 4URSA 3NL0A 5KFBA 4YB1P 4OLPA 3OR2B 2KDOA 1IBKF 1KS2A 1IWGA 2MLXA 1GMVA 1U1OA 1HFEL 4C6AA 2WSFC 3D3CJ 2LXFA 2ZBIA 1LXNA 2VPZB 1NAQA 1TL1B 4QZVB 4K5RA 1HQUA 3IGNA 1URNA 2V34A 4CO4A 4RU9A 3DLKA 2C3PA 4LFBF 2MQMA 5B0CA 1OSDA 4ZDNA 4B9LA 2XS2A 4ZHRB 3OTCA 5HATA 1QJHA 2J9DE 4IR9A 4TXSA 2E9TA 3OVAA 2DXDA 5IFMA 4L6V3 1URRA 5GMEA 1H2TZ 4NXNJ 4KGMA 2B9EA 2XS5A 2O67A 3AOAA 1SJ3P 3I0SA 5CD4A 3DLLQ 5HP1B 4O3SA 4QU6A 2KN4A 1TKZA 1NXIA 2RQKA 1WHVA 4IH6A 1JKHB 3ZFVA 4ETZA 2VFRA 2VG6B 1IR0A 1C1CB 4RWXA 1LNQA 2H48B 4LF5F 1M5HA 3IG1A 1JJHA 2I5JB 4PXCA 4KAIA 2A6MA 4ZPVR 3OR2A 2A2CA 1VOMA 2RF2A 1Q8BA 4RW8B 4DG1B 3M8SA 4CO1A 5K5MA 4CLZA 1SJQA 3MR7A 3R5GA 4I1TA 4K59A 1EKRA 3RGIA 3CDAA 1J27A 2XM3A 4WYLA 4USJC 2DY9A 3J80Y 1TVRB 2RKIB 3UN2A 1GFWB 5EWFA 2M8HA 2DEJA 2J0QD 4CLLA 1DJ0A 1H74A 2X1BA 2JRSA 4J9NA 4ID8A 3NOGA 2P6TA 4DR3J 4O3QA 2Q79A 1WC4A 5E3RA 4ZHRA 4CQ1A 3KLEB 4LF6J 4NLDA 3CJSA 4AD6A 1RAIB 2UUBJ 3ETMA 3QFHA 1N5YB 2NUUG 4ED4A 2IJFA 1IBCB 3B78A 1HIYA 3CJRA 2PEBA 1JKHA 1FERA 1H6KX 4OYAA 1VFJA 3VCDA 1C1CA 1H7XA 2Z56B 1XJWB 3TA1A 3CMQA 5B0BA 1JLBA 2HNYA 2I5JA 2V69A 2WONB 2Z2MA 2CPXA 4RW6B 2GVDB 3I55S 4YMEA 4QPXA 4Z7YA 1VC0A 4PWWA 2CJYB 1OPIA 3CIMA 4JV1A 2JZ5A 2FZKB 3LAKA 1X4FA 3N79A 2X3DA 4X66F 1TVRA 4YHHJ 2BJ3A 4NWBA 3QWPA 3SYZA 3CCMS 2XO6A 1ZZFA 3IAS9 2YX1A 2DH8A 3CTRA 3ULHA 1H73A 1K44A 1RTHA 3KLEA 1NB7A 3MHYA 1U6BA 2VQFJ 2AGOA 2H54B 2AHOB 3W61A 4YN3B 1V5IB 1X5OA 2V2ZA 5KFXA 4NYZA 2ADCA 2EKYA 2GFFA 3MPDA 4UT4A 4MJKA 1N5YA 4QW8A 3QO9A 2VPWB 2QSFA 3BBCA 3THVA 2V8DA 4HL9A 3UE2A 3MMAB 4ZN1A 2V67A 3L7OA 3MPWA 4EO8A 2VASA 2I2YA 1TU0B 2ZJPQ 2DO0A 1FXRA 1VQ5S 1LFWA 2IDEA 2WONA 3C6TB 3G87A 3HD2A 2GVDA 2MJNA 3VR1A 4RUAA 1XNRF 4HDGA 1Y11A 3OR1B 2CZ4A 3P5BP 1HWIA 4ZVOB 4IG3B 4K50A 4MIWA 4Y3CA 3JXOA 4B3OB 2OPSB 4U7UD 4X4TA 4W92B 3CVKA 5J2NB 2ZHBA 2QMUB 4HI1A 1U6FA 1RADB 4K4ZA 2IBKA 4HHHA 4B3TF 2E1AA 2MDAA 2ILZA 4QIWD 3ILJA 4WU2A 2MB0B 1M0SA 2JOQA 5A8KA 1BMQB 3ISZA 3QAEA 3M6VA 2VA2A 3R1HA 4H4MA 1ZAWA 4OL8A 2RU9A 4MYTA 5KFGA 2Z2LA 3OW2R 2FQQB 2HZAA 4YB7A 1NK6A 2W1BA 3MMAA 1GX5A 3EE3A 5F8JA 4LRAA 2PDAA 4OHZA 1CJKB 3UVJB 3C15B 4WP9A 1NHKL 1R8AA 7FDRA 5LXYA 2XNRA 4UY8T 1I3OB 3C66A 2W9BA 1P6TA 2JHEA 3I6PA 4UOHA 3K5MA 1FFWB 3OR1A 5GAGI 4ECRA 4F50A 2ZC4A 3M6XA 4NA1A 3BH6B 4B3OA 3E3XA 3MAQA 4U8VA 4UOFA 4TQSA 2W8KA 4OYBA 2CYYA 2YKOA 3MZIA 4YY3F 4DPTA 5KFFA 4CH1A 4B02A 5J2NA 2O5DA 1X5TA 4JI8F 1JNRB 3BSCA 3VAFA 1BWEA 4WFZA 1RAOA 3FRYA 2EI5A 4TYAA 1HPZA 1RLCL 2ZKUA 1I6JA 1IQZA 3NNHA 3MOJB 3ZZZA 2P9GA 4WU3A 3MWBA 2BMBA 2CPZA 5DJBA 4OZ1A 1TK0A 2NCKL 1F3VA 3GU0A 2Z2YB 3BZQA 4ZVEA 5HAOA 4DFMA 1T02A 5HMZA 3AAWB 4PYAA 4LT6A 3OD2A 5A2QY 3UVJA 2NXUA 2ALZA 3NMAA 3W5XA 4NE9C 2YKNB 2MZRA 2L9NA 2KHDA 2XCAA 2HBQB 2D3UA 4MH8A 3RRKA 3A8JA 5EDWA 1TP7A 2W01A 5IM0B 3EICA 4J9LA 4WZQA 1TL5A 2EFVA 2EBGA 2FC9A 4DL3A 2ROPA 5H1SV 3T5LA 4ANDA 3BDPA 1WJ9A 4PWDB 3UDEA 2G2ZA 4N5SA 1WF2A 2R7RA 4DR7F 4ELUA 1XNQF 2AU0A 1SXLA 1T94A 2JLEA 5HL7Q 5GAHI 3BO4A 2XMWA 3EJMA 1GTEA 1SKWA 2LEPA 3R6GB 3A8KA 4F4XA 2RS2A 2B8QA 4ID5B 2VBXA 2K7JA 1SJRA 2M70A 4NLUA 4JI6F 2KJWA 3IBWA 1KQSR 4PRFA 4FYVB 1XMOJ 5F41A 3TUJC 3G71S 3GYGA 2MQ8A 2EXUA 5FLXY 2DNMA 1QAXA 3M8RA 5D77A 2U1AA 4DQPA 5LL6d 2P9EA 2Z4PA 4DX7A 1BHNA 1VRUB 2YKNA 5HVHA 1BC6A 1IKVB 3W3SA 1HWKA 2IVMA 4NXMJ 4RKUC 4P2FA 3NNCA 4P72A 1R43A 3N0VA 4DMZA 2HS4A 5IM0A 5KFEA 3CB4A 3KMSA 3KOAA 4X64F 4FZVA 1ZM4A 2DH9A 5LMNF 1TUWA 3H40A 1FX2A 4IO1A 1X0FA 2F1FA 4PWDA 1CG2A 1FRLA 3ONQA 5F3TA 1F3FA 1GMWA 1T03A 3W5YA 3QJPA 2HFZA 1CEZA 3HP6A 2D9OA 4MK7A 1SL0A 4DUZF 1IKYB 1LWXA 2NLWA 1YKWA 3FEZA 3DOMB 4ID5A 1RXOB 1NK8A 2GO9A 3L3CA 3CJTA 2HKEA 4PYDA 3QIPB 3TANA 2WZ1A 1ZS6A 2R7TA 3PIOQ 3CW2C 1T0TV 3GP9A 4PG8A 3I31A 1HNZF 3RRHA 1S12A 4EFAC 1Q16B 1VQ7S 2HPUA 4RPFA 4I56A 2CJAA 2V2QA 1RHRB 4FYWB 2Z2ZA 3MFHA 3V2UC 4WFNQ 4UOCA 4DPYA 2G9OA 1WI8A 1Q7LB 1YRTA 2UV8G 1NZ8A 1RWNB 2ZJRQ 1JLGB 2DR9A 3N6NA 3PW4A 3U1NA 1YQHA 1JJ2R 1HI0P 4EEYA 2XZDB 3UDCA 1EJ7L 2IM0A 4IQXA 2GQCA 4O3RA 4RX6A 4RNHA 4JI4J 5M2UA 2R2RA 2XWYA 1S76D 3CDBA 2IM2A 2CWKA 4DR6F 4KGVB 4WXOA 3R5BA 2MYFA 3HJFA 1NK9A 5KT7A 3UWTA 2OGUA 2UU9J 2VDIA 2ACYA 3QIPA 2BE9B 4DF4A 2ASYA 4DN9A 2DISA 3QBCA 4DV6J 3AJ1A 3IM9A 2HGNA 2YNIB 3TX0A 1T8EA 3TVKA 1Q82T 1DZ5A 3RU0A 2WVBA 3MD3A 3GR1A 4DSIA 1UEUA 3TZXA 3EZ5A 2CQ0A 4E0DA 2DY1A 1R7IA 3T1HF 2MZTA 3CT9A 4C48A 2UUAF 5J2MB 2W7AA 1VBXA 5KT4A 4QWEA 4KBIA 2MZSA 2OH2A 1SPBP 2PSZA 1EAYC 1QUPA 3I5BA 4I7FA 2BKPA 1JLGA 4LR8A 3VGTA 3FEXB 2H5JB 2N7YA 2R8IA 5KFYA 2OJ3A 1XERA 1B0VA 4HHJA 5BR8J 3K0JA 1Y5NB 3OVBA 3W63A 5HN0A 2VZ9A 4OI4A 1ZPVA 2C2ZB 3CMES 3EWGA 1Y10A 3MUMP 3KK3B 2NS1B 2MLYA 1QD1A 2HVZA 3FEYB 3MM8A 3FKBA 2RH3A 2ATCB 1K1QA 4LBPA 3V4IB 3PEHA 4NCGB 3R9LA 4OQJA 1T3NA 3M8PA 1JLCB 2IMOA 4OHWA 1NDCA 2HHVA 4J5OA 1CPZA 4NPOA 2H4WB 5L9XA 2MEWA 2D3ZA 2YH0A 1GXUA 3T1YJ 1HA1A 3GV8B 2QT7A 3KYLA 1HWJA 4HACA 3ENQA 2PIIA 2MY7A 3MUTP 5K8MA 4ZVUB 3DLEB 2HWIA 1B64A 3NGTA 1Q5YA 2CXEA 3KLHA 5B0FA 4FS2A 4PABA 5E3CA 4QR1A 2RDJA 1HNXJ 1S57A 2J7WA 3BO2A 2QLJB 5F8GA 2GAGC 3KK3A 3DU6A 1GQEA 1QDUB 4BDPA 2M3DA 2F4VF 1TZ0A 5H9EJ 2WAQD 3LGNA 3QQCD 4Y00A 4MK9A 3UCGA 5K8PA 4PQAA 1RHKB 4TY8B 3V4IA 4N41A 1YBUA 3FBBA 4KY3A 4NCGA 3IR5B 2RIJA 4U6PA 1F9FA 3G6ES 9ATCB 1S7HA 5IZHA 4KR0B 1AZSB 1JLCA 3LP0B 3HFVA 2BANB 3FGVA 3KLIB 2QA1A 3D7SB 1HNWF 1DQAA 3FMBA 2ZVIA 4MKAA 1YZ6A 4WFXA 2DHXA 3PCOB 4NLRA 2XYHB 1DHMA 4OYZA 2QZ8A 1SIZA 1LW2A 1G4CA 2ZUGA 3ISNC 4I4BA 1U4BA 2QO3A 1R0AB 3J7ZT 1SIWB 3W7BA 4IRKA 2CFXA 4HH0A 2AKWB 3MR2A 3DLEA 3P5TL 4JI3F 2UXBJ 3NY0A 2FIUA 3KHHA 4H4KA 1FDNA 2X1AA 1I94J 2LDYA 5IXUA 4FPRA 2BJEA 2GS8A 3Q8QB 3UPFA 3ZTQA 5IQ6A 4Q0BA 4LF7F 3VAGA 1YWXA 4J9VA 3JTPA 2J8AA 4JI0F 1L5UA 2HFOA 4LR9A 2ZWOA 3H2VE 3GJRB 3SDEB 2OO4A 3MCOA 4A8YA 5AE3A 4DLGA 4LSNB 1CBKA 2LCWA 4NEZA 4TY8A 3W9IA 2BACA 5DS7A 1PAEX 2R4FA 4UY85 4V19X 5C25A 1LW0B 1B0TA 2BANA 3HZGA 3UO0A 1RBLA 1RSCA 2OP5A 4DV0F 5HQLA 3GE9A 3N6LA 1TFWA 3D54A 2C3YA 4Q5VA 4PKDB 3QYYA 4Y2AA 3I56S 3PV8A 2PFFB 1HQEA 2HW3A 3PACA 3IN5A 2E5HA 5DM7Q 1R0AA 4BS2A 2R2UA 1KFDA 4LFCF 2N4DA 3GFYA 1CC7A 1J5EF 1LK7A 3CCRS 3GQCA 1KQKA 4B9VA 3WQPA 1K0TA 2XLIA 1T11A 4TN2A 2RU3A 2YKQA 5AE2A 2G1HA 3Q8UA 2IRUA 3TAPA 3CD6S 5KAKA 3QFWA 3SSQA 1WKLA 4ECUA 4LSNA 1WC0A 1NEEA 2V9KA 4TKTA 4PXBA 2B7BB 4USHA 3HVTB 1WWHA 1J5OB 1RZMA 1GMUA 2O01C 1WC5A 4UZBA 4F67A 3EVOA 2DGUA 2B6AB 1S49A 2B5JB 1LW0A 2RDIA 1O51A 4C8MA 3ZZ0A 1N33F 1X9MA 4GC6A 4C3MA 1G3OA 2FHOB 2M8DB 2XS7A 3Q8PB 4GC7A 2OEMA 3A13A 3M9MB 4A8XA 2V4QA 2AT1B 3M32B 4DSFA 2CQPA 3QZ8A 1F5AA 4J90A 4CNZA 2L48A 2XMTA 3AB2B 3WIVA 2PT0A 4IH5A 1N36J 2HHSA 3HKZD 4O3NA 4AT1B 4UQTA 1R3NA 4QIGA 3ENWA 3DRPB 3F0NA 3CIZA 2DXEA 3FQLA 1EARA 1RJJA 3HZEA 3FZ2A 3F73A 1S0NA 3GG1A 2JLFA 4WK3A 1SL1A 3FUYA 4F0HA 2OEKA 3POTB 2WB4A 2C2OB 1DAXA 2AJ0A 2EWHA 4DV4F 3D0IE 4KHPF 3DMJA 1NSPA 5CYMB 2CWXA 2RE1A 1TTHB 2ROEA 1RBOB 4R5PB 1FNXH 1S4FA 1VBZA 3HVTA 3LF0A 1QTNB 4UF4A 4ZCIA 3IAM9 2CJ9A 3CULA 4IOAQ 3QWUA 2B5JA 1IM6A 4C3KA 2VC0A 2LQ8A 3Q2TC 3CD0A 1CS4A 1RACB 4G65A 3QGHA 2K3KA 4F3OA 2PMZD 3GV5B 4D3GA 2N82B 4NA2A 1EQMA 4FVCA 4O3PA 4NI2B 3QZ7A 3GSIA 4GKKF 2K3IA 2EG2A 2FZCB 2V8HA 4J9RA 3M32A 4EO6A 3TAMB 4MKYA 2J7KA 4CWBA 3MEGB 3BN7A 2OPPB 1XN9A 1SQEA 5LOQA 3K5NA 3DRPA 4A8WA 1KNZA 1CJUA 4D3HA 2YXLA 3GV7B 2UUCJ 4HTIA 2VA3A 4ZVSB 1NHUA 1FK9B 2YNGB 3POTA 4RNNA 2HGLA 3PKYA 1NKCA 5C7PA 1S10A 2VHGA 1TMJA 4Q7AA 2BJ1A 1U1RA 5CYMA 3FJ2A 3QT5A 5D0HA 4KPCA 3KNAA 3K7RA 1X4EA 5D0GA 3BN4A 1M5VC 2D3O1 4GKJJ 2D41A 2XYGB 4TY9A 2VIHA 1XEZA 3G96A 3M7VA 3GIJA 4DV2J 4M63A 1WTBA 3GPAA 4C0HA 2ASLA 1ZM3A 2H65B 2YPYA 2M2BA 1RT2A 1PJ7A 4ZCLA 2BM1A 1SJFA 3RZAA 4KKOA 4NI2A 5KG0A 3D6FB 2HZCA 4OI3A 2Y9HA 3SV3A 3SCIE 5DDQC 5DG8A 1P1LA 4WYWA 4ZOSA 2ACMA 4OYOA 1ITPA 2YNFA 1P9YA 3G86A 3MEGA 2OPPA 1Y3JA 1UVKA 1PKUA 3LP2B 2K2PA 3AFGA 3O5TB 2G2YA 4FBTA 1JLFB 4Y34A 2IC3B 3I5CA 4DCPB 1PJ6A 1FK9A 2YNGA 3BKUA 3SXLA 5E7OB 5L39A 1AT1B 1OJ4A 2XZTB 1GT8A 1N0VC 3KK2A 2HHHF 5GAEI 2YKMB 3QRQA 2MPUA 1JLAB 1VIOA 2MQNA 4HTJA 4JUZA 3IR6B 3HX9A 1FA0A 1DBDA 3DCAA 1X9SA 3PJWA 3Q86A 2QA4S 1XR5A 2W2QP 3T5KA 2NR0A 3JAMU 2QMXA 4RW4B 3SSRA 2VF3A 1DQ9A 4QQBA 4OX7A 4PWUA 2FJVA 4JI5J 3L7PA 4DQRA 1MSWD 2ZEJA 2AWZA 1WG1A 3T19A 1IR2A 4C4WA 1D3WA 2AIRB 1GEHA 3M8ZA 1YX2A 3L09A 3UDLA 1FNOA 4ENOA 3FNNA 3LP2A 4Q8EA 3CJKB 4LF2A 4JI2F 1JLFA 3BO3A 3GCXP 1X8DA 4DL0C 5J2QB 3PW2A 1IQTA 2IC3A 4RW9B 2OHDA 2EBEA 5FIIA 1FJGF 2BOPA 2M0GB 4KGZB 5L1KA 1E6YB 3MM9B 2OTLS 3ZTPA 2E5JA 3B82A 4B17A 4EYHB 1JLAA 1RBAA 3BDEA 5KFKA 2QTWA 4Y65A 5HBMA 3TQEA 2HNDB 1Q1KA 2R8GA 4ES2A 4I6AA 3NCPA 1IBKJ 4F2RA 4RW4A 4F4YA 3L9ZA 1UW9A 3NBPA 1SKUB 4YR3A 4NX9A 2LA6A 4PAAA 3DM2A 2UUWA 2C2DA 4C8NA 1WDTA 2ZM6F 2C2EA 2XTJP 1WG5A 4ETXA 4WKYA 5IT9U 3MEDB 2MZ1A 4TQRA 2Z0GA 3OHBA 3JSRA 3EPGA 2HSEB 1L3UA 3AT1B 2HAIA 3QT6A 4ZJQA 2VODA 2VKRA 3CD7A 3CJKA 4DCJB 4EU0A 4ECWA 3NLCA 3LOUA 2IDLA 1YBTA 1VQKS 2VD3A 3MM7B 3KJFB 3PHTA 3MM9A 1MWZA 1MLAA 1S9EB 3TW0A 1TV6A 2DYAA 4L3NA 4LUBA 3KLGA 2X7IA 1YJ7A 1PG5B 2J9EA 2DTJA 1XMQF 5HMWA 2BJ8A 2KXNB 4IQMA 3DN9A 4X4VA 2POKA 4LF5J 2LXUA 2MXYA 1S5ZA 5AXMA 3UCZP 4HT5A 4WK1A 2KTQA 3J7Z5 2HBRB 1U49A 4Y2KA 2MZQA 4RBVA 5DLFA 4CT8A 2ASJA 2Y1RI 2AYEA 3EDQB 2H5EA 3KLVA 2L41A 3AD9C 3KDNA 4JYAF 2PA8D 2FVRA 5KG7A 1I1GA 4Y2CA 4M5GA 3MEDA 5BJRA 4IDKB 4HKQA 1FFGB 5GAGU 5KOXA 4WCEQ 2YTCA 4KJIA 4ZVGA 3A12A 3QSYB 2WBMA 1IKXB 2WVEA 4WFBQ 4FS1A 2VBWA 4BHQA 3ET6B 1ZOTA 4B9SA 1SH3A 1U0SA 2ZITA 2EFQA 3GIRA 1U1LA 4F02A 4FF4A 2XEXA 4DXLA 2F7VA 4F26A 2M9KA 3G6VA 1F5CA 1UW4A 1WF0A 1FVSA 2BUNA 2KT5A 3ZZUA 3DRRB 1N4LA 5CXTA 4HT7A 2HEKA 3GILA 1YTYA 5F8NA 3HFKA 3P45B 5E3PA 1FNMA 4AL5A 4HLBA 5K20B 1N56A 2HURA 3CCZA 4DFPA 1Z2ZA 3H59A 3D1HA 4QIVA 1NK4A 3NG8A 3W1YC 2Y1JA 3PTWA 1YZ7A 4U96A 5J1EB 4DSEA 1XMBA 2G2OA 1QTMA 4X66J 3IWLA 1YJRA 2BRKA 6AT1B 3G8TA 1O5JA 3TUZC 2FVCA 1PGZA 4DSJA 1RGVA 2CZVC 1TQLA 4I2PB 4Z2XA 4DV1J 3R2DJ 3NGUA 4IDKA 8RUCA 2CVIA 1LWCA 3TUPA 2BZ2A 5KOWA 1LQ9A 3NRBA 2ZHOA 4CLKA 1L3TA 5MAOA 5F9NA 1IKXA 3CSKA 4OYXA 1KVIA 3A3PB 4L74A 1X4AA 3JTOA 3K5PA 4G1QA 3I9V9 3OFEA 3N28A 4IOCQ 1TAQA 2QN6B 1VS3A 2I1RA 1PYOB 4ZVFA 2JJ4D 5CYQA 2E5IA 4NZ0A 4YB5A 4KFBB 4TVAB 1WEYA 1T9WA 5ETQA 2L9DA 1VQ9S 1N5SA 3PM9A 3V6JA 1OS5A 4BCAA 3J81j 3BGRB 1XNRJ 1F1BB 3DC2A 2BJ9A 2F9JA 3OL9A 2OD6A 2B56A 5ADZA 3PW0A 2K06A 2CVEA 2J0WA 2N3OA 5J1EA 1UVNA 4KT0C 1FXDA 2GQQA 1U1NA 1KQFB 2DHHA 4RUCA 5E3AA 2K8GA 4IFVB 2JFKA 1OY8A 3CJ3A 4GRSA 1NDKA 2J5AA 2GO8A 5G4DA 4N47A 5KTQA 3J81U 1M1GA 1ICEB 3IWNC 2VG5B 1NO8A 3E01B 4DCOB 5HROB 4DR3F 3QLHB 1KC8T 1A9NB 4M5JA 1RHMB 4LF6F 4L73A 4NLGA 3ZZTA 2UUBF 1D9AA 3MPYA 1MMNA 4EYIB 2W9CB 3KMQA 5BXIA 3H8YA 3QJJA 5KFJA 2B9WA 3R8YA 4K4UA 5DZ6A 4OZ5A 4IRCA 3OTEA 2YVSA 5T7LB 4BWJA 4KFBA 2LKZA 2UP1A 4M94A 1N6QB 4USTA 4FF2A 3DOKB 1HI1A 1BQXA 5HQMA 1IM4A 3BREA 2CJQA 2FLPA 4J9OA 1YJVA 2B4UA 3C8YA 2XMJA 2QE5A 1U7LA 1FRXA 5D4LA 4KV8A 4AXJA 4U7UK 4CLTA 3EGVA 3T6JA 3UNYA 2XY5A 4YY3J 1RQ0A 1S97A 4ZMMA 1PIEA 1JXLA 4KC5A 5RUBA 1UPPA 2JL9A 2WB1D 4YFUA 3BR9A 2BQUA 4DOZA 2CNLB 2VG5A 1MN7A 3QLHA 3ENVA 3CEDA 4LBIA 1MG7A 1NZAA 1UZDA 5IT0A 2XGQA 2Z30B 3BPSP 3AXMA 4MIBA 5J2PB 4A8MP 2R8KA 2C2MB 2O66A 1OQ6A 3FFIB 1IR1A 1C1BB 1AFJA 2JVOA 2VICA 4K4TA 3C14A 1HYSB 2BE7D 4USWA 4K2JA 5T7LA 3EGNA 1UA0A 1TKXB 2AYMA 3IBCB 4M5KA 4P52A 4U8YA 4C0OC 1EHWA 1SJ1A 1JWWA 2FVQA 1R6VA 3ENAA 4O44B 1RHQB 3LA0A 1VMBA 2W25A 1UKUA 3NGKA 2A1BA 2HFSA 1KP6A 3RW7A 5CABA 2GC8A 2VFVA 4MYUA 2OSQA 3DLGA 4CCHA 1RT6B 2B0GA 2HNZB 2RD5C 4DS5A 1LEOA 2H51B 2JSXA 4LSZB 5GMKa 1NUEA 4G3IA 1XNQJ 2DK2A 3SCKE 1FRHA 3Q83A 1U09A 2XZWA 3PO5A 2OFGX 2XHCA 4YP3A 4E2FB 2NUHA 2HIYA 3GJSB 3KWMA 3KXDA 3ZZOA 1FKAF 2QFIA 1HW9A 4X4RA 2KHCA 3TI0A 1M5KC 2UVVA 1S9GB 2C42A 1K9MT 4F4WA 5A0YA 1JJ4A 3HI9A 4JI6J 3AA8A 3FFIA 1KONA 3TO8A 1VRQC 1C1BA 4DS4A 2JFDA 4FBUA 1HYSA 4DLEA 3BEGB 4CRJA 1ZA1B 5FDLA 1HARA 3IRXB 1WTFA 2R7OA 4OX9F 1XC9A 4QYZK 1WOPA 1TKXA 5D4PA 4C98A 5DQHA 3P8BB 2AX1A 1LV5A 3Q8SB 1VIXA 3BYPA 3OQ2A 2KZMA 4P9SA 4G1PA 4O44A 5C2CA 2YWKA 2VKZG 3AJ2A 1RT6A 2HNZA 3OHAA 4DI6A 3R1LA 5LMNJ 4FF3A 5KFPA 2UVWA 3KDOA 4BBYA 3O1LA 1DRZA 5EWGA 3VAMA 2HVDA 1VQ8S 3D2WA 1WC1A 4TYBA 2B3TB 4DUZJ 4OYMA 4O4GB 2J6UA 2W2NP 1PO6A 4AQYF 1YLXA 3MEEB 1S9GA 4XAKA 3QPIA 2M4MA 3GWCA 3TUIC 2WSCC 3ZZRA 4CH0S 2KFYA 2O3DA 3O44A 4AFFA 2IM1A 1S6OA 2W24A 4X65F 1C0UB 3GIIA 1HNZJ 5CYJA 3RB6A 1UL3A 1U8SA 3M2RB 4ZCMA 2W4PA 1RTIB 3EZUA 4A8FA 2C2NA 5A76A 4OI6A 3IC1A 1XTZA 5IQQA 2QLFB 1HMVB 1V9OA 2XY7A 5BYRA 1KLMB 1NM2A 2W4DA 1RYSA 3H20A 3VVTA 5IT9Y 4NMXA 4WKRA 4C2MA 3BYRA 2KM8B 3MMBB 3H4DA 3G6XA 1U1MA 3A3NB 4DUYF 4EBDA 1Y7PA 1U0HB 2QX0A 2VPXB 5SZTA 3UDVA 3BQ1A 4ED8A 2EK1A 3H0PA 3IBFB 3E2EA 1EKSA 3BQ0A 3RAXA 2RQMA 1RWUA 5F8LA 4N8NA 4DR6J 4CLYA 2CPDA 4NEYA 1P27B 4O4GA 3RAMA 2ZH9A 2OTJS 1YDLA 1SC6A 4P7VA 1D9DA 2EK6A 3MEEA 1AA1B 3K89A 4R0JA 3CUNA 2KYZA 1NJIT 5KFWA 2FY1A 3EVWA 3S1TA 1YJNS 3DDNA 4CTAB 3NGRA 2D1CA 5E3QA 1RTDB 3TJ9A 2NXEA 2JC0A 4WIIA 3TJAA 1C0UA 1KHVA 1VBKA 3G8SA 4LREA 1D09B 2WVFA 1UA1A 4R8UB 1UMJA 1RTIA 3RW6A 2DGSA 2KM8C 3RR8A 1PYTA 1S1UB 2ALYB 1KLMA 3T1HJ 1YJUA 1FXLA 2UXCJ 2UUAJ 2LQ5A 4DL2A 2W2PP 4ICLB 3ITHB 2NXCA 1UZHA 4NXMF 2PGCA 2YPZA 2HQCA 4ED6A 4I6WA 1C0TB 4ANEA 4OJ3A 1U0HA 2QGFB 1SKSA 3PYFA 3UI3A 5L1LA 2CPFA 4PPDA 1ZH5A 3CDEA 5F8IA 3BBBA 2IHR1 2V8GA 1ZYQA 3OXFA 2AJ4A 2F8EX 1N32F 3H98A 3PZPA 4M1KA 3NCRA 1FEEA 3P4UB 2FDNA 4S0MA 4F8RA 2R7VA 4B9MA 4NLTA 1NNDA 3RJMB 2ZH2A 4DQQA 4ECSA 2DNQA 1UCNA 3GTYX 3W62A 3MM6B 1SH0A 5KFOA 2VG7B 5I3UB 1N88A 2AEFA 3FSYA 4CTAA 2MKKA 1ZBTA 2E1RA 3KG0A 1A6LA 3IR7B 2QLXA 3M2UA 2B4VA 4DV3J 2X1FA 2E5GA 5KFZA 1EX8A 1RUSA 3IA0A 5B09A 3BGUA 2BV3A 4C8OA 1RT1B 3ZNUA 2XBPA 4F4KA 5FD1A 4ZLJA 2XLKA 2D9PA 2WSEC 3C2PA 4NLQA 4ZK7M 3F56A 3OL8A 2GHPA 1S1UA 5HJXA 1R8PA 1HBUB 1X4GA 4LSLB 1RT3B 1KD1T 1ZETA 3KHLA 2CPYA 4ICLA 3ITHA 4DR2J 1RWWB 1EB0A 1C0TA 1NRKA 1DTQB 3NXZA 2ZZTA 2V4RA 3TR5A 3T5HA 4EBEA 1XK8A 3SMZA 3VAJA 4LMZA 2HLUA 5DG7A 1U25A 4CI0B 2MQPA 2IMWP 5GADU 4Z37A 2HMIB 3JSBA 3O2IA 3MM6A 3QNWB 2QG9B 2F4VJ 2VG7A 5I3UA 2DNKA 1TL1A 2DKOB 2UU9F 3ZC4A 2XGPA 4USKA 3CC2S 3BH7B 2ABYA 3F44A 4DV6F 1K47A 3DHXA 1RT1A 1NU4A 1B0PA 1X5SA 2UVRA 1Y5LB 2IAJB 1HNWJ 4K4XA 5B7WA 1JQGA 2KI2A 2MHNA 1HBUA 3IWXA 1NMEB 2CQ4A 4LSLA 1VLYA 2VJUA 1Q81T 5HP1A 5MLCV 5LSOA 2KVIA 3RBZA 1DTQA 3NOCA 2LU2A 3UW1A 2FVPA 3D5MA 2JC1A 2GNKA 2VG6A 4DR1F 1HBOB 1W7WA 3CCUS 4ED1A 3EM1A 2C3UA 3R7SB 1FVQA 3KG4A 3SFUA 4LF7J 4RW8A 4DG1A 3TARA 3NS7B 2HMIA 4JI0J 5FJ4A 2NPIA 4USIA 1UEVA 2DHGA 4CM2A 4K7QA 3MTKA 1QM9A 2RKIA 4MKBA 1XWLA 2UXDJ 2XMAA 3DOLB 3QMQA 2D74B 1N34J 3LWLA 2YWHA 1SBRA 1YBAA 3JQKA 1Q8LA 2CPJA 8AT1B 2DNRA 4FNHA 4ECZA 4EWTA 2IAJA 4GVBB 1R0BG 4DV0J 5U47A 3ZTSA 2DRAA 1X4HA 3EX7B 4J9KA 3R27A 2CQ2A 1X4CA 4HR2A 1VQ6S 4MKVA 3C6UB 5DLGA 2HFVA 4DU8A 3AD8C 1J5EJ 3CJ2A 5IWAJ 4C8YA 4RNMA 2XMUA 2FHMA 4X2BA 1OIAA 1ZPWX 5GVQA 5H9EK 4OX6A 1S4EA 4M5LA 1CULB 1RT7B 4V19J 2HQIA 3GCWP 4RW6A 2LQBA 5JJBA 3JYTB 4JOUA 2QEXS 4B3MF 2ZBCA 2RMLA 5D15A 2DITA 3THPA 4P73A 2XYPB 1Q0NA 3FVYA 1U02A 2FC8A 2B9XA 2V2KA 2OMLA 5ETKA 4NOHA 2CQCA 2L3MA 1SVDA 5D4OA 1UAWA 3VGUA 5CCMA 2E1PA 2J9DA 2FY8A 5LMUJ 3ZZYA 2EG1A 5AJ3F 4ILRA 1N33J 1QAIA 4ZITA 4GVBA 3LQVA 1MN9A 4XIUA 5J1PA 2MKJA 4ZPDA 2R2SA 3W66A 1QUVA 2KVQE 4J9PA 1F2GA 3OVSA 4OI0A 3K8WA 2BYCA 1Q7YT 5T41A 2IFXA 2QMWA 4ALZA 1RCOB 3QATA 4C9DA 1K0VA 2Z58B 4U67Q 5ETMA 3D6HB 2KG0A 5IT4A 3ZTRA 5JUMA 3G6YA 2J6SA 2V8PA 4QCLA 1CULA 1M90T 3C6TA 3FZBA 2GZOA 1KFSA 3JYTA 3R5JB 1VRTB 2ZKTA 3J80U 4K0KF 3OTOJ 3US5A 2WVDA 4CT9A 4QYZJ 1RYRA 4IG3A 3KLFB 2BJDA 2PEHA 4DV4J 5KFNA 5ETLA 4KHPJ 2MGZB 2OPSA 4C3LA 2YY3A 1S99A 4E8UA 2NZCA 2WCXA 5L38A 1TL7B 3DRSB 5F0UA 2C2KB 2PA3A 3I4HX 1DQ8A 3HHNB 5KFAA 2ZOGA 3T41A 4B08A 3ZTOA 2YKAA 1UETA 2CQDA 5C24B 1WNEA 2U2FA 3IFEA 3UN3A 3DNCA 2ZH7A 4K5SA 2LMIA 2ADBA 3H4BA 2W8LA 1FKPB 4JV5J 2FHKA 3M2VB 4YS2A 3A8IA 4CO3A 4LRCA 4UZCA 3DXSX 3D6MB 5M2PA 4GKKJ 1IBMF 3DLHA 3U7JA 2FZGB 1ELOA 2E7WA 2MY8A 3KNGA 3AY0A 4P6QA 2YQ3A 3DFEA 4ZPAA 5HO4A 3MAAB 1CJKA 2OKQA 5E2QA 5CCLA 5IV4A 3DGPB 3C15A 1N8RT 1IWAA 1S6UA 5M2RA 2WOMB 1S1TB 4M95A 1P8GA 1FRIA 2J9CA 4KHRA 1VCTA 1VRTA 4KGXB 1V6HA 4ZPBA 4HI2A 4RU2A 4WJBA 2JX2A 1DLOB 2MGZA 2JEJA 3VF0B 3GLJA 1RAEB 2QJ3A 5D0EA 1HNVB 4QYRA 4ZPTR 2YNHB 1TR0A 2YWWA 2OD4A 4JB8B 2ZH5A 4DHVA 4LR7A 3AOBA 4QR0A 4PR6A 2CJKA 3MF5A 4ZIVA 5C24A 2ZOFA 2EFOA 3OXLA 4QW9A 2EFGA 4NYPA 3IGVA 3Q22A 1KN6A 3I0RB 5I42B 1FKPA 2FLLA 1RAGB 2GGPB 1U47A 2VQEF 1WG4A 3DKDA 4O3OA 3D67A 3MGJA 3BGFA 1U1PA 1D8ZA 1JNZB 4A8QA 1ROFA 2G13A 3ZZPA 3TZYA 1XR6A 3PG9A 1FF2A 5K8OA 2NREA 3MAAA 4B9NA 3DGPA 2C3MA 2VOOA 4KQZA 2QSWA 3LGHA 2WOMA 3R5AA 1MWQA 3RB0A 4NLPA 2OSRA 2BOAA 3X1LB 3MR5A 1L3SA 1FI4A 1YSJA 2IYIA 2HRUA 1QVGR 4YQWA 4UUWA 2KO1A 1DLOA 3ADAC 1BGXT 4QR2A 2HHHJ 5LJ5Y 3RBDA 1HNVA 1N48A 2YNHA 1BD6A 4NZ6A 2M7SA 3W65A 2BA9A 3O6QA 4I67A 2RUGA 3KTQA 4JBCA 2CPIA 3K17A 4OHVA 2ZFHA 4P2SA 4GVLA 3R7NB 3PYDA 1ZTTA 1KVKA 3OTDA 5A8RB 4DPOA 5K9FA 1OSCA 5I42A 4HEA9 3QAUA 3T9ZA 1CVJA 2G0CA 8ATCB 1N0UA 3BKTA 4H4OB 1RU2A 3PRVA 1G1XA 1VQSA 1FESA 2CAJA 2DIUA 2EFPA 5EX3A 4IG0B 4PG6A 2KL8A 4ED7A 1WEXA 3PJ9A 2CQBA 4J37A 4LFAF 1VRUA 4JI2J 1IKVA 3BBFA 1TKTB 3CDUA 4RW7B 1S59A 4K4VA 1MWYA 3DYAB 4DU7A 3HULA 3OT9A 1FJGJ 1RI7A 1FWKA 3CC4S 3D66A 3B6BA 3CWJA 2QL7B 2B8PA 4DWIA 5KT6A 1M5PC 1KKHA 1WEZA 3U1LA 1F9EB 3U02A 4ERDA 2ZNZA 2AV5A 2GIQA 1NSQA 3HDSA 4G6VB 3DI6B 2IYGA 1IKYA 2VDHA 4GKJF 1Q86T 2E9ZA 3W64A 1FFSB 2EPIA 3BQ2A 1FHTA 1HR0F 1RLDA 3VALA 5D78A 3DOMA 1CQMA 4B9UA 3OJUA 2UUTA 4DV2F 2OPRB 4U95A 3UR0A 3RB4A 3KJNB 1WKJA 2V0NA 4OHXA 3TAQA 2ZM6J 1E6VB 3QIDA 3V81B 4LVOP 1WKKA 2DR8A 4IG0A 2BKOA 3GSDA 3NKYA 1UPMB 2FJBB 1B70B 4YUDA 2FHJA 4E98A 2VFTA 1F60B 1H2VZ 3P96A 2W9AA 4EI2A 3DYAA 1T95A 4MAKA 2PE8A 4ZS6A 3W9JA 3PEJA 3TYTA 3R7BB 1HNIB 3FCVA 2ZE2B 4HYKA 1JXEA 4X62J 4TU8A 4DX8H 4JI7F 4ECYA 1S9FA 3OBIA 2UV8A 2MZJA 1O8BA 4J9SA 2WK4A 3A8EA 2XLJA 1S1VB 4USUA 5HLFB 4HHUA 2VV5A 2RVJA 3MECB
chains in the Genus database with same CATH topology
3R5JB 2P2CB 2XYPB 3KJNB 1RWMB 2CDRB 2XYGB 3KJFB 4LSZB 1ICEB 2HBYB 1SC3B 2C2ZB 4DCOB 2QL5B 2CNNB 2H4YB 2H65B 1RHMB 2CJYB 1I3OB 1GFWB 2CNLB 2QLBB 1RHUB 2QLJB 1I51B 1PAUB 2HBZB 3GJTB 3GJSB 4ZVOB 2Y1LB 3D6FB 3IBFB 3SIPB 1NMEB 1QDUB 1SC1B 1SC4B 2HBQB 2QL9B 3EDRB 1RWWB 2C2KB 2CNOB 2C1EB 1PYOB 2C2MB 1RHRB 3GJRB 4JB8B 1RWPB 3P45B 1RHKB 3P4UB 2HBRB 5IC6B 1RWKB 5K20B 2QL7B 1RHJB 5IC4B 3R7BB 4ZVPB 3RJMB 2H54B 1F9EB 3EDQB 3KJQB 2H4WB 2Y0BB 2C2OB 4ZVSB 2H5IB 3IBCB 1RWNB 1IBCB 4ZVTB 1BMQB 3D6MB 3R7SB 3R7NB 3GJQB 1RWXB 4DCPB 2XZDB 2CJXB 2H48B 1RE1B 1RHQB 3QNWB 3D6HB 2XZTB 3NS7B 3R6GB 2XYHB 4DCJB 1QTNB 4ZVRB 2DKOB 1RWVB 2FQQB 2CNKB 1RWOB 2QLFB 2H5JB 4ZVQB 4ZVUB 3R6LB 2H51B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5J B;  2P2C B;  2XYP B;  3KJN B;  1RWM B;  2CDR B;  2XYG B;  3KJF B;  4LSZ B;  1ICE B;  2HBY B;  1SC3 B;  2C2Z B;  4DCO B;  2QL5 B;  2CNN B;  2H4Y B;  2H65 B;  1RHM B;  2CJY B;  1I3O B;  1GFW B;  2CNL B;  2QLB B;  1RHU B;  2QLJ B;  1I51 B;  1PAU B;  2HBZ B;  3GJT B;  3GJS B;  4ZVO B;  2Y1L B;  3D6F B;  3IBF B;  3SIP B;  1NME B;  1QDU B;  1SC1 B;  1SC4 B;  2HBQ B;  2QL9 B;  3EDR B;  1RWW B;  2C2K B;  2CNO B;  2C1E B;  1PYO B;  2C2M B;  1RHR B;  3GJR B;  4JB8 B;  1RWP B;  3P45 B;  1RHK B;  3P4U B;  2HBR B;  5IC6 B;  1RWK B;  5K20 B;  2QL7 B;  1RHJ B;  5IC4 B;  3R7B B;  4ZVP B;  3RJM B;  2H54 B;  1F9E B;  3EDQ B;  3KJQ B;  2H4W B;  2Y0B B;  2C2O B;  4ZVS B;  2H5I B;  3IBC B;  1RWN B;  1IBC B;  4ZVT B;  1BMQ B;  3D6M B;  3R7S B;  3R7N B;  3GJQ B;  1RWX B;  4DCP B;  2XZD B;  2CJX B;  2H48 B;  1RE1 B;  1RHQ B;  3QNW B;  3D6H B;  2XZT B;  3NS7 B;  3R6G B;  2XYH B;  4DCJ B;  1QTN B;  4ZVR B;  2DKO B;  1RWV B;  2FQQ B;  2CNK B;  1RWO B;  2QLF B;  2H5J B;  4ZVQ B;  4ZVU B;  3R6L B;  2H51 B; 
#chains in the Genus database with same CATH topology
 4ZKA A;  1VK3 A;  2ZD1 B;  1HW8 A;  1IKW B;  1DFD A;  2BRL A;  1MNE A;  2RDD A;  3MR6 A;  1H0H B;  5JXS A;  1KDN A;  2DNZ A;  1WHX A;  4KGK A;  2KFN A;  3PW5 A;  2YNI A;  2CDQ A;  1E6V A;  1NK7 A;  4FPI A;  3N6M A;  3V81 A;  2KT3 A;  3CJQ A;  3CJ4 A;  4QIF A;  3EVM A;  4F2S A;  3DLK B;  4MT1 A;  4YR2 A;  4FF1 A;  1B7Y B;  1FWP A;  4OLO A;  2GML A;  2CRL A;  3HO1 A;  3N5B A;  1S6P B;  3K5O A;  3AOC A;  4B3S F;  5J2M A;  4CDI A;  3MPU B;  2F5G A;  3VZH A;  1VQN S;  5CH7 B;  1X31 C;  3HLU A;  2LYV A;  4OX8 A;  3OL6 A;  1HNI A;  2ZE2 A;  3DU5 A;  1IBL F;  1R0C B;  1NDP A;  3KHR A;  4ZPC A;  5E33 A;  1QVF R;  4M8L A;  5B0A A;  4L76 A;  2ZH4 A;  4LIW A;  3F41 A;  4TNO A;  4PPZ A;  2KXH A;  2AZ1 A;  1A7G E;  3GYX B;  2B7C B;  1S1V A;  5HMY A;  2FJX A;  5HLF A;  3ZNJ 1;  3U1M A;  2HHU A;  5DRK A;  1U24 A;  3EUN A;  1PJ5 A;  3CCL S;  3MEC A;  1LK5 A;  1OO0 B;  2ZD1 A;  2RF2 B;  1T9T A;  1IKW A;  2KXF A;  1S1X B;  1YK9 A;  1HBM B;  3PRD A;  3JB9 k;  3B4M A;  3FDS A;  1H98 A;  1FRM A;  2NSC A;  3CMA S;  4P7T A;  5C2G A;  3QT7 A;  1VDH A;  2ATL A;  4LQ3 A;  4DV7 F;  4RL1 A;  2LA4 A;  1BQN B;  1ZM2 A;  3JTN A;  2DNG A;  3VTI A;  3UD4 P;  4R0E A;  3GMG A;  3HXM A;  1S6P A;  1Y3K A;  2LXI A;  2G1D A;  5HMX A;  3EZO A;  3AQP A;  2BBE A;  2HFU A;  4N8O A;  1NB2 A;  1P1T A;  1TMM A;  4OV6 A;  1YJT A;  2OEL A;  1WOR A;  2A10 A;  3HT0 A;  2GJ2 A;  2KRB A;  2XC9 A;  2JWN A;  2Q43 A;  4DSL A;  3LAL A;  2OFH X;  4J7C A;  3H90 A;  3J7Y U;  4J9M A;  2R7W A;  1QSY A;  3BR8 A;  1N5T A;  3HHD A;  4PG4 A;  2Y8Y A;  1JLB B;  2HNY B;  2DXF A;  2NSB A;  4RO0 A;  3CXC R;  1NKB A;  4LBH A;  2CIM A;  2G4B A;  1S1X A;  1QAJ A;  4ZLP A;  5I3Q A;  1HBM A;  3HSD A;  4TLR A;  3JQJ A;  3PR5 B;  2GIF A;  1AZS A;  3LP0 A;  2Z57 B;  1YRU A;  4P10 A;  1BQN A;  3M9N B;  2E44 A;  5F9L A;  3KLI A;  4C7Q A;  2K7K A;  1FD8 A;  2ZJQ Q;  2FUG 9;  1WSR A;  2SXL A;  2CJB A;  3M6W A;  1RTH B;  5HVG A;  1M1H A;  1PBA A;  3N4W A;  1TK5 A;  6FDR A;  4U9R A;  3G8Q A;  1KRP A;  2DR6 A;  3SCJ E;  1UVM A;  4X4O A;  2ZDO A;  3J7A N;  3HPO A;  4LVN P;  3MOZ A;  3G2X A;  1DAR A;  3QO9 B;  4EK2 A;  1LWF B;  2BX6 A;  1P9Q C;  1R31 A;  4KB7 A;  1LXJ A;  4U7C A;  2RRA A;  1YJW S;  2ZBR A;  4WFY A;  1KQG B;  2HRY A;  2EC0 A;  2BE2 B;  4H54 A;  3PRB A;  3N9U C;  4Y2M A;  5JVH Q;  5KFQ A;  3SDE A;  3VVU A;  2RB7 A;  4DQI A;  3KUE A;  1HI8 A;  3IM8 A;  3NAI A;  1RAJ A;  5BYS A;  4YB6 A;  3PX4 A;  2RRN A;  1D0E A;  3TA0 A;  3MFI A;  5AE1 A;  3SQG B;  1CJT B;  5C5J A;  2AZ3 A;  1EIY B;  2YKP A;  2VH7 A;  4M5D B;  2QV6 A;  1FKO B;  2DBB A;  1VQP S;  5DDO C;  3PIP Q;  4ES3 A;  5LSL A;  4F0M A;  1WOS A;  2QYC A;  2W2M P;  4DV1 F;  5G0R B;  3QSI A;  5B0E A;  3LPY A;  3CE8 A;  1X0P A;  3TVY A;  5A8K B;  4H4M B;  3D1O A;  1IJF B;  2NPF A;  3L4B C;  1NPP A;  3VGS A;  3PVX A;  4FKY A;  3G4S S;  1KR4 A;  4OYP A;  1LWF A;  4UW2 A;  4FVM A;  1RK8 A;  1RDR A;  2NZ4 A;  4AL7 A;  4DV5 F;  1NLK L;  3BS9 A;  2RNE A;  3LO3 A;  4DR5 F;  2AMC B;  2ASD A;  2BE2 A;  3HHK A;  4KH0 B;  2HBZ B;  2R7X A;  3MD1 A;  5KFT A;  4X84 A;  2BW7 A;  3R97 A;  2AD9 A;  2W9B B;  2VPY B;  1U45 A;  5H9F K;  1Z4U A;  1PIL A;  2EFN A;  2VJV A;  1IJE B;  1WHW A;  2PMH A;  1Y9O A;  2HYI B;  4QJV A;  3T1A A;  1YG0 A;  3SQG A;  2VOP A;  1J5O A;  4FXW A;  1CJT A;  2YX7 A;  3M8Y A;  1UFL A;  2B6A A;  2RQC A;  4M5D A;  1FKO A;  2GHV C;  3TX8 A;  4Q45 A;  5D6G A;  2HS0 A;  2JH3 A;  1QY7 A;  5G0R A;  4DF8 A;  1RTZ A;  2DHA A;  2MMY A;  3P6Y C;  3PYE A;  4IFY B;  2E5L F;  4ZP7 A;  4LRF A;  1HPZ B;  2CG8 A;  1U48 A;  1XQI A;  3FK4 A;  4BC9 A;  4QWC A;  2HG4 A;  1VC5 A;  3LGM A;  4OZL A;  1HD1 A;  2KRR A;  1GNK A;  4OX9 J;  3R5D A;  2ZH6 A;  3I9Z A;  4RNF A;  2DRB A;  1ZAV A;  3GJT B;  2WW4 A;  2XHW A;  3LH2 S;  2QFJ A;  1JLQ B;  3SSS A;  3TJ8 A;  1XR7 A;  1RKJ A;  3HVR A;  4NLW A;  5LXR A;  1S0M A;  5LJ3 Y;  3VAI A;  4RLE A;  2GVZ B;  2DGQ A;  4R5P A;  1FDD A;  5E41 A;  2OIH A;  2XG8 A;  2ZUA A;  2Q66 A;  2C28 A;  1GTH A;  4L75 A;  3N01 A;  4AQY J;  5L1J A;  1QE1 B;  3KJV B;  4IFY A;  1RAF B;  2HBY B;  1SC3 B;  2E7V A;  2DNP A;  4NLS A;  1MRO B;  2HVE A;  1R8C A;  2P5V A;  2DGT A;  3TAM A;  4NLY A;  4I68 A;  3HHL D;  1Y0H A;  7FD1 A;  4X65 J;  2FJD B;  4RNO A;  4A46 A;  2LEC A;  3VQS A;  5ETV A;  4IO9 Q;  2CNO B;  2VU5 A;  2AGP A;  4AXI A;  4Y6I A;  1JLQ A;  1VR6 A;  4O23 A;  3RRG A;  4C8K A;  1FO1 A;  3MCS A;  4EGL A;  4LF8 F;  3VAK A;  4L3K A;  5KG1 A;  4DUY J;  1H38 A;  1Q78 A;  1VYA A;  2GVZ A;  2IVY A;  4PXE A;  2E7X A;  2XB2 D;  4EZ6 A;  3FSX A;  2RRB A;  3T6B A;  1KHW A;  2L9W A;  1HQ2 A;  4TLQ A;  3HSJ A;  3RBX A;  4CM0 A;  1T03 B;  5KG4 A;  2FLO A;  1XBW A;  1X4D A;  4FP9 A;  1RU1 A;  3DDK A;  1RT4 B;  1QE1 A;  3KJV A;  4CH7 A;  5CZV A;  4NLV A;  2QL5 B;  2H4Y B;  4B3R F;  3M1V B;  1CJV B;  4ZP6 A;  3HJV A;  2MKI A;  4LF1 A;  1MRO A;  1VI7 A;  3V4M A;  3W8P A;  4JI1 F;  2IA6 A;  3Q2S C;  1PC4 A;  2AYB A;  2KKH A;  2C3O A;  2H9Z A;  1RB0 A;  1WF1 A;  1FE4 A;  1J2V A;  3IRW P;  2CA9 A;  5A6P A;  2K1R B;  3WX8 A;  1RWK B;  4CLU A;  4UQG A;  1JK9 B;  2BXJ A;  2R8J A;  3A3O B;  3TEH B;  4QU7 A;  3IO1 A;  1VHF A;  3FMW A;  3OSP A;  4ZP9 A;  2L08 A;  1D9F A;  3MEK A;  3CCQ S;  3DLB A;  1HBN B;  4M5H A;  2YKM A;  1U1K A;  3NAH A;  1REG X;  1CQN A;  3M8W A;  1N32 J;  1R8H A;  3CCW A;  3NS5 A;  1FJC A;  2IJR A;  1AB8 A;  3QGP A;  2Y1I A;  2NXN A;  4OZ3 A;  4Q8F A;  2PN6 A;  5AXK A;  1RT4 A;  2FYX A;  4WF9 Q;  2A18 A;  1FT8 A;  4LF4 F;  3VV2 B;  3MPV A;  1UEK A;  2OPQ B;  3M1V A;  1CJV A;  2B4O A;  2RS8 A;  1SQF A;  2XCP A;  2W7P A;  2XY6 A;  4LFB J;  2R8H A;  3FQK A;  1VQO S;  4NLX A;  1FJE B;  2WTF A;  4KH1 B;  1BY9 A;  3CNQ P;  2K1R A;  2WVC A;  4MFB B;  5J2Q A;  4WP3 A;  3OFF A;  4DPX A;  1S6Q B;  5HI7 A;  1TL3 B;  2HHQ A;  2B43 A;  3EPI A;  3GJQ B;  4RW9 A;  5HK4 A;  2HHX A;  1Q79 A;  3B4D A;  3FC9 A;  3UQS A;  2BM0 A;  4I69 A;  2LQ9 A;  3RB3 A;  1E6Y A;  1FWL A;  3NEK A;  3HKW A;  1NJZ A;  2J7U A;  4ECQ A;  4UOG A;  4NAS A;  4BLG A;  4USM A;  4BWM A;  3CD5 A;  1HBN A;  1N54 B;  5B08 A;  5D8H B;  5KFC A;  2GIR A;  4I7F B;  3RG6 A;  3K57 A;  4C11 B;  3IMQ J;  2ZHA A;  1FX4 A;  3OLA A;  3HK2 A;  3TZW A;  5LM7 E;  2I38 A;  3QRP A;  3PY8 A;  3PX0 A;  2HND A;  1VLO A;  3NCQ A;  1F6T A;  2IBO A;  2V50 A;  1B99 A;  2ZWP A;  3CGI A;  3SI8 A;  2V94 A;  1SKR A;  4PUO B;  5E0O A;  2W7O A;  3P3D A;  4FYX B;  2CQG A;  3LTO A;  3AD7 C;  4P2X A;  2UVU A;  3Q8V A;  2OPQ A;  1UVI A;  3MM8 B;  1N5V A;  3RUB L;  4F3Q A;  5KFV A;  4LF9 F;  2AJF E;  5EWE A;  1LWE B;  3I5A A;  4UTG A;  1SH2 A;  4OMF G;  3M8P B;  1FDB A;  4ZP8 A;  1DY3 A;  4ECV A;  1YJ9 S;  2X3G A;  4MFB A;  2DNN A;  2LVW A;  1Q53 A;  1S6Q A;  3Q0A A;  2FGC A;  1TL3 A;  4DDF A;  1S0V A;  4ED3 A;  3MM7 A;  1RA6 A;  3HFZ B;  2KH9 A;  2UXC F;  3NS6 A;  4QWD A;  1S9E A;  4HAC B;  3R6L B;  5T14 A;  4OJ1 A;  2JEG A;  5AXL A;  5E5N A;  1FTR A;  3AJD A;  1WEL A;  4NML A;  4V1A k;  3VWS A;  3PKM A;  2V5H G;  4O0I A;  4N77 A;  3IS9 B;  4DR1 J;  4J9U E;  4C11 A;  2Y8W A;  1KOH A;  2YX4 A;  3Q8R B;  2W4C A;  4OI2 A;  1RT5 B;  2NYI A;  3UNG C;  4C8L A;  3KLH B;  4K4S A;  1UJ4 A;  2E29 A;  5EUH A;  4DR4 F;  1S79 A;  1PC5 A;  3B8H A;  3BSN A;  3TEG A;  4IR1 A;  3H5S A;  2R7Q A;  4PUO A;  1U2F A;  1WI6 A;  2V68 A;  1YHQ S;  4XTT A;  4LJM A;  1KTQ A;  2PD1 A;  4RBT A;  5L1I A;  2DNH A;  4W98 A;  4OI1 A;  4FN5 A;  4DSK A;  1TEL A;  2GQ2 A;  2D69 A;  1EZZ B;  4GO5 X;  4EBC A;  4DV3 F;  1LWE A;  3W2W B;  1BUX A;  4GMK A;  5HQ8 A;  1B4S A;  5I3P A;  2FD2 A;  1UWB B;  5KFD A;  2AX0 A;  1HHS A;  2JDJ A;  1NK0 A;  3GZ7 A;  2XSJ B;  5CD4 H;  2CNK B;  3BPD A;  4IYQ A;  3ET6 A;  1S77 D;  5ETP A;  4NXN F;  1NPR A;  1C4C A;  3CJ5 A;  1OMS A;  5GAH U;  2N4C A;  1NDL A;  2DEI A;  3KKF A;  1LW2 B;  2KT2 A;  3IP0 A;  2HWT A;  4DR2 F;  2B4P A;  3HCX A;  4Q44 A;  3L7U A;  1Q8K A;  5KFR A;  3DGV A;  1MU2 B;  2AP6 A;  3DRR A;  1OY9 A;  4NLO A;  3IS9 A;  2JLG A;  1RT5 A;  3EMT A;  4DFJ A;  4J9Q A;  1G6B A;  4ZCK A;  1NPK A;  1S7I A;  2OMO A;  5DQI A;  4Q0B B;  4B3M J;  2ZH1 A;  1FE0 A;  2IM3 A;  3EYZ A;  3ZO7 A;  1X60 A;  1Y5I B;  2F3J A;  3G82 B;  2H1Y A;  1SV5 B;  2GV1 A;  4KE5 A;  4C97 A;  1SL2 A;  3CF5 Q;  2QC3 A;  2WHO A;  4I2P A;  2FPH X;  4B3T J;  3W2W A;  5H9F J;  2I0X A;  5AJ3 J;  3OPK A;  5C25 B;  5THW A;  1UWB A;  2AJ1 A;  4PEO A;  3RR7 A;  4WPA A;  2XSJ A;  1D1U A;  3DDI A;  1F9H A;  3PHE A;  3I87 A;  3KHG A;  2E1C A;  4AE5 A;  1BQM B;  2MQO A;  3JS9 A;  2R7S A;  2Q3P A;  5KFH A;  2IIH A;  5LSR A;  1HQE B;  3SV4 A;  4H4K C;  1I51 B;  4CLS A;  1PAU B;  3Q23 A;  4BC7 A;  2N7C A;  2HQ3 A;  1MU2 A;  2ZDP A;  2RHS B;  1S48 A;  3R5C A;  2ZC3 A;  1KSP A;  2GJI A;  4O4R A;  2G0J A;  3BGR A;  1X7V A;  3D6T B;  2JEI A;  5DGB A;  4P74 A;  2BEF A;  2GX8 A;  4XO0 A;  4K0K J;  3AB4 B;  2XMK A;  1V3R A;  2X1G A;  5KG2 A;  4X4Q A;  2AYG A;  1CC8 A;  3G82 A;  1SV5 A;  4RR5 A;  2OUG A;  4IFV A;  2BAB A;  2YQ0 A;  2DJW A;  2DGX A;  4FKX A;  2UXD F;  4YHH F;  4ES1 A;  4F3M A;  4J91 A;  4JI8 J;  3OTB A;  1K73 T;  4CLP A;  1N34 F;  3E01 A;  5HRO A;  2FLN A;  4NRT A;  2JEF A;  2QYG A;  4Z7C A;  5CHC B;  2VQF F;  2MQL A;  4FXD A;  3GFH A;  2MST A;  3AHP A;  3QRR A;  2W9C A;  1UTA A;  1IBM J;  1BQM A;  1SI9 A;  1SJ4 P;  3PDN A;  3FRZ A;  2DGO A;  2UZA A;  1QLN A;  4F36 A;  1NHV A;  2EKN A;  4Q2M A;  3E8O A;  2MKY A;  5KG3 A;  5IWA F;  1N6Q A;  4QWA A;  3C46 A;  2F63 A;  1WC3 A;  3DOK A;  3LAM A;  5DET A;  3KUH A;  1R8B A;  1HL6 A;  4YEA A;  2ZOM A;  4R25 A;  2LDI A;  4OJG A;  4CZC A;  2LU1 A;  1FRK A;  3MI7 X;  4KO0 B;  4XK8 C;  3WC0 A;  4RWW A;  1H3D A;  1F2H A;  4CLW A;  2DVI A;  2DNL A;  3HM9 A;  4DR7 J;  3HVW A;  3OL7 A;  3DMJ B;  3BGL A;  3M9O B;  3MUV P;  2X51 A;  2V6A A;  3AH6 A;  3MCM A;  3H5X A;  3DRY A;  2XI2 A;  4A8K A;  4HH1 A;  4ECX A;  1VQL S;  5JMN A;  4RBU A;  5LMU F;  1ZTW A;  2V63 A;  2DNY A;  4AYB D;  5F8M A;  2LFV A;  1Q5V A;  5DM6 Q;  3BF4 A;  5J2P A;  1C2P A;  1CS4 B;  3RAQ A;  5D3G B;  1WD6 A;  2B9Y A;  4CNY A;  2VQE J;  4K2X A;  4ZIW A;  2DCL A;  5ETN A;  3LP1 B;  1NJW A;  1VK8 A;  2MLZ A;  1JXV A;  2IJN A;  4IUF A;  1RCX B;  3JAM Y;  3X3U A;  1JB0 C;  1RWP B;  5ETR A;  1JJC B;  2VFS A;  4CO5 A;  3RBE A;  5GAD I;  3NNA A;  1ACM B;  4IKA A;  2RIL A;  3LWM A;  3S7R A;  2E66 A;  2VL1 A;  1T3O A;  3VGV A;  3M6U A;  1NJX A;  1CJU B;  4NCA A;  5ITH A;  5JVG Q;  5KG5 A;  2DT9 A;  2HK2 A;  4LRB A;  4X64 J;  1APS A;  3PR4 A;  1ZA2 B;  2H3E B;  1Y00 A;  4KO0 A;  3OTO F;  3IXQ A;  2Z8Q A;  2XQC A;  3FCH A;  2LP4 A;  4DL5 A;  4USV A;  1BLU A;  2DO4 A;  3NMR A;  4XPE A;  2CQI A;  1SB6 A;  1QSS A;  3RTV A;  4F4A A;  4M5N A;  4C8Z A;  2GMH A;  2CKW A;  1RIS A;  2P9C A;  3TWZ A;  1FD2 A;  4WP8 A;  3QGG A;  4OJH A;  4NRU A;  1KEK A;  1MML A;  1NBE B;  2AGQ A;  1FEH A;  3HD1 A;  5D3G A;  1TAU A;  5F8H A;  2Y0S D;  1RT2 B;  3WZ0 A;  3A1Y G;  2EC2 A;  5ETO A;  4JV5 F;  3O3L A;  2F40 A;  2I8E A;  3LUY A;  4YOE A;  3LP1 A;  2PO4 A;  3EGW B;  3BKF A;  4KKO B;  4DL7 A;  4WE1 B;  4KHM A;  3G9C A;  2RHQ B;  1RHJ B;  3OSN A;  1RAB B;  5KFS A;  3IRX A;  1KBR A;  2W2O P;  4GO7 X;  2YWG A;  1HD0 A;  2YNF B;  3FBE A;  4LFA J;  2YWE A;  4XPC A;  1RWX B;  2GCF A;  2R2T A;  3NGD A;  1RTJ B;  2MJU A;  4DPU A;  9RUB A;  1NK5 A;  2DHS A;  1RA7 A;  3PNI A;  5I4M A;  4ZJO A;  3KK2 B;  1VQ4 S;  3K2Y A;  2AEJ A;  3AQO A;  3BV8 A;  4A48 A;  1NSA A;  3THT A;  3HT3 A;  2CNN B;  2DIV A;  4ILL A;  1WAC A;  2B51 A;  3ELH A;  2APO A;  1HR0 J;  3UD5 A;  1SQG A;  2GHW A;  1SC4 B;  3LPE A;  1SC1 B;  1NH7 A;  4PCQ A;  3W8G A;  1NCL A;  5D0R A;  2KYX A;  1ZZN A;  4DEZ A;  3MDF A;  2JVR A;  1V5V A;  4RUB A;  4F25 A;  3HSZ A;  2Q1L A;  3OJS A;  3UN5 A;  2WRM A;  1OWX A;  1T7P A;  4WE1 A;  1XMO F;  5EHH A;  5IS2 A;  3V6K A;  1LOU A;  4OYI A;  1N52 B;  5EGY A;  4DL6 A;  1DUR A;  2MKC A;  1R27 B;  3M2R A;  3D4J A;  4URQ U;  4W90 B;  3CCT A;  2FGO A;  1HMV A;  3SFG A;  3ILI A;  4NCB A;  2CJX B;  1RE1 B;  2XNQ A;  4KTQ A;  4MTP A;  3K58 A;  2DH7 A;  1RTJ A;  1KLN A;  1U8W A;  4I6Y A;  3MMB A;  4QWB A;  3CPW R;  3HHL B;  2CQ1 A;  4FNI A;  4Y28 C;  1UJ5 A;  2P6S A;  3M8Q B;  1HKA A;  4JI7 J;  4P75 A;  3WBZ A;  4YDD B;  2BQR A;  3JQM A;  4N7T A;  4NYO A;  4L72 B;  5L46 A;  5KFM A;  2HFN A;  5KT2 A;  1LFP A;  1BWV A;  4ATN A;  2E1M C;  3KUG A;  2QLW A;  2C1E B;  4YR0 A;  1Q8I A;  4JV2 A;  1R89 A;  5KFI A;  5DZ7 A;  2LLZ A;  5HBM B;  3CDW A;  2ZZN A;  1K1S A;  3H7H B;  3TP2 A;  4OZN A;  2I6W A;  2KB2 A;  4ED0 A;  7AT1 B;  3DHW C;  4LIR A;  3MUR P;  1RTD A;  3FCW A;  2Y0B B;  4JV0 A;  3PW7 A;  3NBP B;  3AXK A;  1YVF A;  4OYW A;  3DM2 B;  1SCJ B;  2AF6 A;  4R8U A;  3FSI A;  1VGY A;  3UD3 P;  2CAD A;  3MR3 A;  3CO9 A;  3CCE S;  4RJV A;  3HHL C;  1D8Y A;  4NZ7 A;  5DG9 A;  1JMT A;  4B3S J;  1X4B A;  5KT5 A;  3BSO A;  1H7W A;  2DGW A;  3T5J A;  1M1K T;  3W5Z A;  4F04 B;  3H5U A;  3HHL A;  1V3Z A;  2V4J B;  3L95 X;  4ELV A;  1IBL J;  3M8Q A;  2LEB A;  2F9D A;  4K4W A;  1YIJ S;  2V8V A;  4ELT A;  3CJ0 A;  1TV6 B;  4RUH A;  5KG6 A;  4DFK A;  3KLG B;  2Y1L B;  3GYN A;  4LRD A;  2ROG A;  3R2C J;  3QT8 A;  4JI4 F;  3PJX A;  4DUT A;  4WIQ A;  2BVZ A;  2HQG A;  3R3T A;  3BGO P;  4DJB A;  3LAN A;  3WHI A;  3D0H E;  5B0G A;  2KJV A;  2HHP A;  4IRD A;  2M52 A;  5KT3 A;  1GAO A;  4ZVT B;  3K59 A;  2C22 A;  4FXV A;  2MKH A;  5LT5 A;  4DV7 J;  1EET B;  1FDA A;  5GMD A;  1UP1 A;  4WTY A;  2ZBQ A;  3RYL A;  5CA5 A;  2HIQ A;  2XMV A;  3SEO A;  3W9H A;  2GAH C;  3V6D B;  2XUL A;  3GFX A;  1RT3 A;  4X4P A;  3J81 Y;  4ED2 A;  3O8W A;  3I96 A;  4Y2I A;  1IXK A;  1VJW A;  2ZVS A;  5HVF A;  2V4J A;  3GIK A;  1VJQ A;  1F0X A;  4JI3 J;  1TUV A;  2AJQ A;  5L8R C;  4X62 F;  1F5B A;  1VIS A;  2F4F A;  2VBY A;  4QOT A;  4ZJL A;  4EZ9 A;  2HHT A;  1Q95 G;  4FDF A;  5BR8 F;  3W2V B;  2ZNY A;  2BR0 A;  2N3L A;  1NKE A;  3CC7 S;  2XSF A;  3UFC X;  4CYU B;  2OEJ A;  3H2L A;  3EXY A;  4DPW A;  1U2R A;  3QGI A;  3KJQ B;  1VQY A;  3SCL E;  4XDD A;  1Z2L A;  5B0D A;  1H72 C;  2CQ3 A;  5L9N A;  1KTV A;  3I4P A;  2LEA A;  3NWG A;  3I32 A;  3EGZ A;  3E51 A;  2QRR A;  2COL A;  3WIU A;  4N76 A;  1HHT P;  2R42 A;  3MMC B;  4I2Q B;  1EET A;  1NSK L;  3MMJ A;  3MXH P;  4YDX A;  2OAU A;  1RWM B;  2M88 A;  4X4N A;  1LWC B;  2DNO A;  2PC6 A;  4ZLN A;  5A6W A;  3V6D A;  2OLW A;  3T1Y F;  4WWS A;  2KZZ A;  3H42 A;  2GJF A;  4LFC J;  2JNJ A;  1KVJ A;  3MTJ A;  1AW0 A;  3T9N A;  3CCJ S;  2AW0 A;  2HVI A;  4G1Q B;  2HGM A;  2Y3Y A;  1HBO A;  2A2D A;  2FJW A;  1T9U A;  4KIA A;  5CYQ B;  2FJA B;  3W2V A;  2VBZ A;  5HSP A;  4CYU A;  1UFW A;  2HQF A;  5CAA A;  2VFU A;  3D68 A;  1HNX F;  2A3J A;  4FYY B;  4F0K A;  2YQ1 A;  1W25 A;  4DQS A;  3OFG A;  2PI5 A;  1RWV B;  1W26 A;  1KOO A;  3DOL A;  2V9W A;  1CSJ A;  1UVJ A;  4ZVQ B;  2HWH A;  1C4A A;  2VUG A;  2P2C B;  1AUS L;  3JSY A;  4ZPW R;  3DRX A;  4K4Y A;  2CDR B;  1AFI A;  2MQQ A;  3MMC A;  4I2Q A;  1IN0 A;  3FBF A;  5HAN A;  1TK8 A;  2EVZ A;  3BJY A;  3C3L A;  2KU7 A;  2HLT A;  3DLJ A;  2CUY A;  2QLB B;  1AXQ A;  2IRY A;  2BW2 A;  3T3F A;  5DQG A;  5GAE U;  4DX6 A;  3H25 A;  1T9Y A;  1NJY A;  2D3O R;  3NP5 A;  1JIH A;  1B7F A;  3C6U A;  1ZAX A;  2V2V A;  1AYE A;  1GX6 A;  2R7U A;  3TVZ A;  2YWF A;  1FTC A;  1GH8 A;  4N56 A;  2Q6C A;  2EW9 A;  1VBY A;  2BDP A;  2KFZ A;  2ZZM A;  3PO4 A;  4DZD A;  3W60 A;  2UXB F;  4W4M A;  4OIX A;  2J0S D;  1RT7 A;  2IRX A;  1WSV A;  4CP5 A;  1I94 F;  1KWM A;  4DV5 J;  4DR5 J;  2XWX A;  5A8W B;  2LQJ A;  4UUX A;  3ETO A;  2NXJ A;  4A8O A;  3M05 A;  1X9W A;  2I9S A;  4F4Z A;  2HAF A;  3OUY B;  3V6H A;  3CJ8 A;  2HHW A;  3OV7 A;  4KV8 B;  4IH7 A;  3K8V A;  3ILL A;  1TUG B;  2ERR A;  1SUQ B;  3ZXW A;  2J0X A;  4PG5 A;  3HVA A;  1PYS B;  1RHU B;  3H2U B;  1BE4 A;  3PFE A;  4O0N A;  4I64 A;  3GR0 A;  3WX4 A;  2QL9 B;  2F65 A;  3OFH A;  2DPJ A;  4ER8 A;  1S1W B;  2E5L J;  4CO0 A;  3HHE A;  2E9R X;  1GK8 A;  2A6O A;  1EP4 B;  1AUD A;  5IOL A;  2HK3 A;  2GMJ A;  5IV3 A;  4EMD A;  2M5Y A;  2R3V A;  1PBU A;  4C0B A;  4TU9 A;  3TRG A;  2H5I B;  2KG1 A;  3C14 B;  4IOB A;  4ZA1 A;  2PI4 A;  2GW8 A;  5ETS A;  4OFZ A;  4QIE A;  4ANC A;  2P8I A;  2AJ2 A;  2AEM A;  1JX4 A;  1WUU A;  3S01 A;  4B9T A;  3GIM A;  1HLW A;  4P71 A;  4JP8 A;  2VB6 A;  5K14 B;  1LKZ A;  1UJ6 A;  3AA9 A;  5A8W A;  2F8H A;  1GMW D;  4MIA A;  1TL4 A;  1M5O C;  3P49 B;  1OQ3 A;  3KLF A;  3BM7 A;  3DLG B;  4CIO A;  3OUY A;  5EN1 A;  3LW5 C;  2BQ3 A;  5DGA A;  2RSQ A;  3SQO P;  3TQ1 A;  1TL7 A;  3DRS A;  1R6Y A;  1SUQ A;  3S8S A;  1WC6 A;  4G1I A;  2DR5 A;  2R9L A;  2IPO B;  1M5S A;  3AOD A;  1FCA A;  2RUS A;  3SIP B;  3D28 A;  1U2C A;  4DBQ A;  1YI2 S;  4FYD A;  4MK8 A;  3SZ2 A;  4ZLL A;  2YBV A;  3OXG A;  1U26 A;  3VQT A;  1O6X A;  2DGV A;  4M5I A;  3M2V A;  4EUV A;  1S1W A;  1Z1Z A;  3GFZ A;  4ILM A;  3Q24 A;  3C16 B;  3D1Q A;  2FVS A;  3GON A;  1EP4 A;  4HVZ A;  1G7C B;  5A0Y B;  1VHI A;  4MMO A;  4NA3 A;  4WTO B;  2DRD A;  2DR7 A;  2CG4 A;  3UCU P;  3DXB A;  1JLE B;  2IA0 A;  5J1N A;  5HJY A;  1S0O A;  1N36 F;  1OY6 A;  4PG7 A;  4ZVH A;  5FDL B;  4HDH A;  2CZ9 A;  1GXT A;  5KFL A;  1S1T A;  3ILO A;  1L3K A;  2Q6B A;  1N5Q A;  1T9X A;  4WBF A;  2RT3 A;  2ILY A;  4XDC A;  4PZV A;  2CPH A;  3M30 B;  1QAY A;  3OLB A;  5K14 A;  4OZ0 A;  4LF8 J;  3N5F A;  1WHY A;  1T05 B;  1TKD A;  2MTL A;  4DX5 A;  1PCA A;  2F8M A;  4URG A;  2RAQ A;  1H2U X;  4I0W A;  1CLF A;  1DTT B;  1RKI A;  3NWR A;  4DL4 A;  4ECT A;  1U6Z A;  1UWA A;  4LQ9 A;  3JSM B;  1VQM S;  1YRX A;  3KK1 B;  1RAA B;  1B3T A;  1FRJ A;  3H5Y A;  4M5M A;  2ZH3 A;  2CQH A;  5IC6 B;  3TA2 A;  5IC4 B;  3C19 A;  2J76 E;  4Q2L A;  3I0R A;  4ZVP B;  1V3S A;  5DO2 A;  2MHE A;  1W2B R;  4RZR A;  2GGP A;  3D3B J;  3J7Y I;  4PQU B;  3C16 A;  4B3R J;  2FHJ D;  4ZN3 A;  4NL5 A;  1OPZ A;  3VAH A;  3HF5 A;  4JI1 J;  3TNV A;  3A4T A;  4ZVR B;  3EXC X;  6FD1 A;  1K8A T;  1RWO B;  1JLE A;  3PX6 A;  3KG1 A;  4A8S A;  2QA2 A;  1IUJ A;  1L3V A;  4X4U A;  5AT1 B;  3M4X A;  5C42 B;  1TFY A;  3BSA A;  3MM5 B;  3M30 A;  4WFA Q;  1UVL A;  1T9V A;  1RAH B;  4PXD A;  1G2E A;  2UUC F;  1T05 A;  2O1P A;  2VON A;  2XMM A;  2FJE B;  4Y0F A;  1Q4R A;  1MW7 A;  1WDD A;  4OV1 A;  3D0G E;  2EEY A;  1DTT A;  1MMD A;  3Q8Y A;  4KRW A;  3FBC A;  3JSM A;  1W2I A;  3KK1 A;  2QA4 G;  2BJ7 A;  1Y4Z B;  2PMW A;  2HVH A;  3B54 A;  3MAH A;  1PSD A;  5K8N A;  5A8R A;  2HZV A;  2HS3 A;  4OZ2 A;  4LF4 J;  2MKS A;  3QJL A;  3HMJ G;  4PQU A;  2HQD A;  5A2Q U;  4H4O A;  2WBR A;  5D4N A;  2DCU B;  4TU7 A;  3ICL A;  3PXG a;  1REV B;  4WXW A;  2ZH8 A;  4ED5 A;  1NH8 A;  4A4J A;  3K5L A;  3CCS S;  2C2R A;  2A0F B;  1QSL A;  3GG0 A;  4KSE B;  1UFK A;  2XO7 A;  5C42 A;  3S6E A;  1VC6 A;  1TKT A;  1YGY A;  3MM5 A;  4RW7 A;  5F3Z A;  1HHQ A;  1WOO A;  4CO2 A;  1ARO P;  3V5R A;  3HSG A;  5AXN A;  1RP5 A;  5F0W A;  4AUK A;  1O0P A;  3EDR B;  4AL6 A;  3MCN A;  3WDO A;  4QPT A;  1XMQ J;  5CQG A;  1X5P A;  2ZBP A;  4Q43 A;  2NQP A;  2J8S A;  4F7V A;  2GA7 A;  3DI6 A;  3J7A 1;  2DPI A;  2NYH A;  2YH1 A;  5EX0 A;  4P2M A;  2D7S A;  3PFO A;  3CCV S;  1I5O B;  4OHY A;  3KFW X;  1OYD A;  1ULR A;  3TOQ A;  1HWU A;  2OPR A;  5CZX A;  4X4S A;  3WC2 A;  3SBM A;  4ITS A;  3TZZ A;  5FLX U;  1GXL A;  1A0O B;  3I82 A;  4DZ6 A;  2VC1 A;  1FJ7 A;  5SUH A;  5DDP C;  4JYA J;  4JI5 F;  4LF9 J;  1HQU B;  2MSS A;  5ETT A;  1REV A;  3BB5 A;  3M2U B;  1S72 S;  3VHQ A;  3Q89 A;  4A47 A;  2RQ4 A;  1OYE A;  3GB0 A;  1ZM9 A;  4KYZ A;  3VZI A;  2DD8 S;  2WW8 A;  1EQ0 A;  1HWL A;  2BKN A;  5DDR C;  3ISN D;  2AQ4 A;  4DN0 A;  3NGS A;  1BXN A;  2FB0 A;  2IY5 B;  2OI2 A;  1IVZ A;  4QBU A;  4KPY A;  4CLF A;  2IVF B;  2G0I A;  2CPE A;  3CO0 P;  3I0S B;  5BYQ A;  2HRT A;  2QIF A;  4WZM A;  2DB1 A;  2J6T A;  1TKZ B;  3D9B A;  3PYG A;  2FTR A;  1YIT S;  1XIQ A;  2PFD A;  4K8R A;  3U27 A;  3UR3 C;  3IG1 B;  2XI3 A;  4OZJ A;  2RJZ A;  1U1Q A;  4DR4 J;  5KFU A;  4URS A;  3NL0 A;  5KFB A;  4YB1 P;  4OLP A;  3OR2 B;  2KDO A;  1IBK F;  1KS2 A;  1IWG A;  2MLX A;  1GMV A;  1U1O A;  1HFE L;  4C6A A;  2WSF C;  3D3C J;  2LXF A;  2ZBI A;  1LXN A;  2VPZ B;  1NAQ A;  1TL1 B;  4QZV B;  4K5R A;  1HQU A;  3IGN A;  1URN A;  2V34 A;  4CO4 A;  4RU9 A;  3DLK A;  2C3P A;  4LFB F;  2MQM A;  5B0C A;  1OSD A;  4ZDN A;  4B9L A;  2XS2 A;  4ZHR B;  3OTC A;  5HAT A;  1QJH A;  2J9D E;  4IR9 A;  4TXS A;  2E9T A;  3OVA A;  2DXD A;  5IFM A;  4L6V 3;  1URR A;  5GME A;  1H2T Z;  4NXN J;  4KGM A;  2B9E A;  2XS5 A;  2O67 A;  3AOA A;  1SJ3 P;  3I0S A;  5CD4 A;  3DLL Q;  5HP1 B;  4O3S A;  4QU6 A;  2KN4 A;  1TKZ A;  1NXI A;  2RQK A;  1WHV A;  4IH6 A;  1JKH B;  3ZFV A;  4ETZ A;  2VFR A;  2VG6 B;  1IR0 A;  1C1C B;  4RWX A;  1LNQ A;  2H48 B;  4LF5 F;  1M5H A;  3IG1 A;  1JJH A;  2I5J B;  4PXC A;  4KAI A;  2A6M A;  4ZPV R;  3OR2 A;  2A2C A;  1VOM A;  2RF2 A;  1Q8B A;  4RW8 B;  4DG1 B;  3M8S A;  4CO1 A;  5K5M A;  4CLZ A;  1SJQ A;  3MR7 A;  3R5G A;  4I1T A;  4K59 A;  1EKR A;  3RGI A;  3CDA A;  1J27 A;  2XM3 A;  4WYL A;  4USJ C;  2DY9 A;  3J80 Y;  1TVR B;  2RKI B;  3UN2 A;  1GFW B;  5EWF A;  2M8H A;  2DEJ A;  2J0Q D;  4CLL A;  1DJ0 A;  1H74 A;  2X1B A;  2JRS A;  4J9N A;  4ID8 A;  3NOG A;  2P6T A;  4DR3 J;  4O3Q A;  2Q79 A;  1WC4 A;  5E3R A;  4ZHR A;  4CQ1 A;  3KLE B;  4LF6 J;  4NLD A;  3CJS A;  4AD6 A;  1RAI B;  2UUB J;  3ETM A;  3QFH A;  1N5Y B;  2NUU G;  4ED4 A;  2IJF A;  1IBC B;  3B78 A;  1HIY A;  3CJR A;  2PEB A;  1JKH A;  1FER A;  1H6K X;  4OYA A;  1VFJ A;  3VCD A;  1C1C A;  1H7X A;  2Z56 B;  1XJW B;  3TA1 A;  3CMQ A;  5B0B A;  1JLB A;  2HNY A;  2I5J A;  2V69 A;  2WON B;  2Z2M A;  2CPX A;  4RW6 B;  2GVD B;  3I55 S;  4YME A;  4QPX A;  4Z7Y A;  1VC0 A;  4PWW A;  2CJY B;  1OPI A;  3CIM A;  4JV1 A;  2JZ5 A;  2FZK B;  3LAK A;  1X4F A;  3N79 A;  2X3D A;  4X66 F;  1TVR A;  4YHH J;  2BJ3 A;  4NWB A;  3QWP A;  3SYZ A;  3CCM S;  2XO6 A;  1ZZF A;  3IAS 9;  2YX1 A;  2DH8 A;  3CTR A;  3ULH A;  1H73 A;  1K44 A;  1RTH A;  3KLE A;  1NB7 A;  3MHY A;  1U6B A;  2VQF J;  2AGO A;  2H54 B;  2AHO B;  3W61 A;  4YN3 B;  1V5I B;  1X5O A;  2V2Z A;  5KFX A;  4NYZ A;  2ADC A;  2EKY A;  2GFF A;  3MPD A;  4UT4 A;  4MJK A;  1N5Y A;  4QW8 A;  3QO9 A;  2VPW B;  2QSF A;  3BBC A;  3THV A;  2V8D A;  4HL9 A;  3UE2 A;  3MMA B;  4ZN1 A;  2V67 A;  3L7O A;  3MPW A;  4EO8 A;  2VAS A;  2I2Y A;  1TU0 B;  2ZJP Q;  2DO0 A;  1FXR A;  1VQ5 S;  1LFW A;  2IDE A;  2WON A;  3C6T B;  3G87 A;  3HD2 A;  2GVD A;  2MJN A;  3VR1 A;  4RUA A;  1XNR F;  4HDG A;  1Y11 A;  3OR1 B;  2CZ4 A;  3P5B P;  1HWI A;  4ZVO B;  4IG3 B;  4K50 A;  4MIW A;  4Y3C A;  3JXO A;  4B3O B;  2OPS B;  4U7U D;  4X4T A;  4W92 B;  3CVK A;  5J2N B;  2ZHB A;  2QMU B;  4HI1 A;  1U6F A;  1RAD B;  4K4Z A;  2IBK A;  4HHH A;  4B3T F;  2E1A A;  2MDA A;  2ILZ A;  4QIW D;  3ILJ A;  4WU2 A;  2MB0 B;  1M0S A;  2JOQ A;  5A8K A;  1BMQ B;  3ISZ A;  3QAE A;  3M6V A;  2VA2 A;  3R1H A;  4H4M A;  1ZAW A;  4OL8 A;  2RU9 A;  4MYT A;  5KFG A;  2Z2L A;  3OW2 R;  2FQQ B;  2HZA A;  4YB7 A;  1NK6 A;  2W1B A;  3MMA A;  1GX5 A;  3EE3 A;  5F8J A;  4LRA A;  2PDA A;  4OHZ A;  1CJK B;  3UVJ B;  3C15 B;  4WP9 A;  1NHK L;  1R8A A;  7FDR A;  5LXY A;  2XNR A;  4UY8 T;  1I3O B;  3C66 A;  2W9B A;  1P6T A;  2JHE A;  3I6P A;  4UOH A;  3K5M A;  1FFW B;  3OR1 A;  5GAG I;  4ECR A;  4F50 A;  2ZC4 A;  3M6X A;  4NA1 A;  3BH6 B;  4B3O A;  3E3X A;  3MAQ A;  4U8V A;  4UOF A;  4TQS A;  2W8K A;  4OYB A;  2CYY A;  2YKO A;  3MZI A;  4YY3 F;  4DPT A;  5KFF A;  4CH1 A;  4B02 A;  5J2N A;  2O5D A;  1X5T A;  4JI8 F;  1JNR B;  3BSC A;  3VAF A;  1BWE A;  4WFZ A;  1RAO A;  3FRY A;  2EI5 A;  4TYA A;  1HPZ A;  1RLC L;  2ZKU A;  1I6J A;  1IQZ A;  3NNH A;  3MOJ B;  3ZZZ A;  2P9G A;  4WU3 A;  3MWB A;  2BMB A;  2CPZ A;  5DJB A;  4OZ1 A;  1TK0 A;  2NCK L;  1F3V A;  3GU0 A;  2Z2Y B;  3BZQ A;  4ZVE A;  5HAO A;  4DFM A;  1T02 A;  5HMZ A;  3AAW B;  4PYA A;  4LT6 A;  3OD2 A;  5A2Q Y;  3UVJ A;  2NXU A;  2ALZ A;  3NMA A;  3W5X A;  4NE9 C;  2YKN B;  2MZR A;  2L9N A;  2KHD A;  2XCA A;  2HBQ B;  2D3U A;  4MH8 A;  3RRK A;  3A8J A;  5EDW A;  1TP7 A;  2W01 A;  5IM0 B;  3EIC A;  4J9L A;  4WZQ A;  1TL5 A;  2EFV A;  2EBG A;  2FC9 A;  4DL3 A;  2ROP A;  5H1S V;  3T5L A;  4AND A;  3BDP A;  1WJ9 A;  4PWD B;  3UDE A;  2G2Z A;  4N5S A;  1WF2 A;  2R7R A;  4DR7 F;  4ELU A;  1XNQ F;  2AU0 A;  1SXL A;  1T94 A;  2JLE A;  5HL7 Q;  5GAH I;  3BO4 A;  2XMW A;  3EJM A;  1GTE A;  1SKW A;  2LEP A;  3R6G B;  3A8K A;  4F4X A;  2RS2 A;  2B8Q A;  4ID5 B;  2VBX A;  2K7J A;  1SJR A;  2M70 A;  4NLU A;  4JI6 F;  2KJW A;  3IBW A;  1KQS R;  4PRF A;  4FYV B;  1XMO J;  5F41 A;  3TUJ C;  3G71 S;  3GYG A;  2MQ8 A;  2EXU A;  5FLX Y;  2DNM A;  1QAX A;  3M8R A;  5D77 A;  2U1A A;  4DQP A;  5LL6 d;  2P9E A;  2Z4P A;  4DX7 A;  1BHN A;  1VRU B;  2YKN A;  5HVH A;  1BC6 A;  1IKV B;  3W3S A;  1HWK A;  2IVM A;  4NXM J;  4RKU C;  4P2F A;  3NNC A;  4P72 A;  1R43 A;  3N0V A;  4DMZ A;  2HS4 A;  5IM0 A;  5KFE A;  3CB4 A;  3KMS A;  3KOA A;  4X64 F;  4FZV A;  1ZM4 A;  2DH9 A;  5LMN F;  1TUW A;  3H40 A;  1FX2 A;  4IO1 A;  1X0F A;  2F1F A;  4PWD A;  1CG2 A;  1FRL A;  3ONQ A;  5F3T A;  1F3F A;  1GMW A;  1T03 A;  3W5Y A;  3QJP A;  2HFZ A;  1CEZ A;  3HP6 A;  2D9O A;  4MK7 A;  1SL0 A;  4DUZ F;  1IKY B;  1LWX A;  2NLW A;  1YKW A;  3FEZ A;  3DOM B;  4ID5 A;  1RXO B;  1NK8 A;  2GO9 A;  3L3C A;  3CJT A;  2HKE A;  4PYD A;  3QIP B;  3TAN A;  2WZ1 A;  1ZS6 A;  2R7T A;  3PIO Q;  3CW2 C;  1T0T V;  3GP9 A;  4PG8 A;  3I31 A;  1HNZ F;  3RRH A;  1S12 A;  4EFA C;  1Q16 B;  1VQ7 S;  2HPU A;  4RPF A;  4I56 A;  2CJA A;  2V2Q A;  1RHR B;  4FYW B;  2Z2Z A;  3MFH A;  3V2U C;  4WFN Q;  4UOC A;  4DPY A;  2G9O A;  1WI8 A;  1Q7L B;  1YRT A;  2UV8 G;  1NZ8 A;  1RWN B;  2ZJR Q;  1JLG B;  2DR9 A;  3N6N A;  3PW4 A;  3U1N A;  1YQH A;  1JJ2 R;  1HI0 P;  4EEY A;  2XZD B;  3UDC A;  1EJ7 L;  2IM0 A;  4IQX A;  2GQC A;  4O3R A;  4RX6 A;  4RNH A;  4JI4 J;  5M2U A;  2R2R A;  2XWY A;  1S76 D;  3CDB A;  2IM2 A;  2CWK A;  4DR6 F;  4KGV B;  4WXO A;  3R5B A;  2MYF A;  3HJF A;  1NK9 A;  5KT7 A;  3UWT A;  2OGU A;  2UU9 J;  2VDI A;  2ACY A;  3QIP A;  2BE9 B;  4DF4 A;  2ASY A;  4DN9 A;  2DIS A;  3QBC A;  4DV6 J;  3AJ1 A;  3IM9 A;  2HGN A;  2YNI B;  3TX0 A;  1T8E A;  3TVK A;  1Q82 T;  1DZ5 A;  3RU0 A;  2WVB A;  3MD3 A;  3GR1 A;  4DSI A;  1UEU A;  3TZX A;  3EZ5 A;  2CQ0 A;  4E0D A;  2DY1 A;  1R7I A;  3T1H F;  2MZT A;  3CT9 A;  4C48 A;  2UUA F;  5J2M B;  2W7A A;  1VBX A;  5KT4 A;  4QWE A;  4KBI A;  2MZS A;  2OH2 A;  1SPB P;  2PSZ A;  1EAY C;  1QUP A;  3I5B A;  4I7F A;  2BKP A;  1JLG A;  4LR8 A;  3VGT A;  3FEX B;  2H5J B;  2N7Y A;  2R8I A;  5KFY A;  2OJ3 A;  1XER A;  1B0V A;  4HHJ A;  5BR8 J;  3K0J A;  1Y5N B;  3OVB A;  3W63 A;  5HN0 A;  2VZ9 A;  4OI4 A;  1ZPV A;  2C2Z B;  3CME S;  3EWG A;  1Y10 A;  3MUM P;  3KK3 B;  2NS1 B;  2MLY A;  1QD1 A;  2HVZ A;  3FEY B;  3MM8 A;  3FKB A;  2RH3 A;  2ATC B;  1K1Q A;  4LBP A;  3V4I B;  3PEH A;  4NCG B;  3R9L A;  4OQJ A;  1T3N A;  3M8P A;  1JLC B;  2IMO A;  4OHW A;  1NDC A;  2HHV A;  4J5O A;  1CPZ A;  4NPO A;  2H4W B;  5L9X A;  2MEW A;  2D3Z A;  2YH0 A;  1GXU A;  3T1Y J;  1HA1 A;  3GV8 B;  2QT7 A;  3KYL A;  1HWJ A;  4HAC A;  3ENQ A;  2PII A;  2MY7 A;  3MUT P;  5K8M A;  4ZVU B;  3DLE B;  2HWI A;  1B64 A;  3NGT A;  1Q5Y A;  2CXE A;  3KLH A;  5B0F A;  4FS2 A;  4PAB A;  5E3C A;  4QR1 A;  2RDJ A;  1HNX J;  1S57 A;  2J7W A;  3BO2 A;  2QLJ B;  5F8G A;  2GAG C;  3KK3 A;  3DU6 A;  1GQE A;  1QDU B;  4BDP A;  2M3D A;  2F4V F;  1TZ0 A;  5H9E J;  2WAQ D;  3LGN A;  3QQC D;  4Y00 A;  4MK9 A;  3UCG A;  5K8P A;  4PQA A;  1RHK B;  4TY8 B;  3V4I A;  4N41 A;  1YBU A;  3FBB A;  4KY3 A;  4NCG A;  3IR5 B;  2RIJ A;  4U6P A;  1F9F A;  3G6E S;  9ATC B;  1S7H A;  5IZH A;  4KR0 B;  1AZS B;  1JLC A;  3LP0 B;  3HFV A;  2BAN B;  3FGV A;  3KLI B;  2QA1 A;  3D7S B;  1HNW F;  1DQA A;  3FMB A;  2ZVI A;  4MKA A;  1YZ6 A;  4WFX A;  2DHX A;  3PCO B;  4NLR A;  2XYH B;  1DHM A;  4OYZ A;  2QZ8 A;  1SIZ A;  1LW2 A;  1G4C A;  2ZUG A;  3ISN C;  4I4B A;  1U4B A;  2QO3 A;  1R0A B;  3J7Z T;  1SIW B;  3W7B A;  4IRK A;  2CFX A;  4HH0 A;  2AKW B;  3MR2 A;  3DLE A;  3P5T L;  4JI3 F;  2UXB J;  3NY0 A;  2FIU A;  3KHH A;  4H4K A;  1FDN A;  2X1A A;  1I94 J;  2LDY A;  5IXU A;  4FPR A;  2BJE A;  2GS8 A;  3Q8Q B;  3UPF A;  3ZTQ A;  5IQ6 A;  4Q0B A;  4LF7 F;  3VAG A;  1YWX A;  4J9V A;  3JTP A;  2J8A A;  4JI0 F;  1L5U A;  2HFO A;  4LR9 A;  2ZWO A;  3H2V E;  3GJR B;  3SDE B;  2OO4 A;  3MCO A;  4A8Y A;  5AE3 A;  4DLG A;  4LSN B;  1CBK A;  2LCW A;  4NEZ A;  4TY8 A;  3W9I A;  2BAC A;  5DS7 A;  1PAE X;  2R4F A;  4UY8 5;  4V19 X;  5C25 A;  1LW0 B;  1B0T A;  2BAN A;  3HZG A;  3UO0 A;  1RBL A;  1RSC A;  2OP5 A;  4DV0 F;  5HQL A;  3GE9 A;  3N6L A;  1TFW A;  3D54 A;  2C3Y A;  4Q5V A;  4PKD B;  3QYY A;  4Y2A A;  3I56 S;  3PV8 A;  2PFF B;  1HQE A;  2HW3 A;  3PAC A;  3IN5 A;  2E5H A;  5DM7 Q;  1R0A A;  4BS2 A;  2R2U A;  1KFD A;  4LFC F;  2N4D A;  3GFY A;  1CC7 A;  1J5E F;  1LK7 A;  3CCR S;  3GQC A;  1KQK A;  4B9V A;  3WQP A;  1K0T A;  2XLI A;  1T11 A;  4TN2 A;  2RU3 A;  2YKQ A;  5AE2 A;  2G1H A;  3Q8U A;  2IRU A;  3TAP A;  3CD6 S;  5KAK A;  3QFW A;  3SSQ A;  1WKL A;  4ECU A;  4LSN A;  1WC0 A;  1NEE A;  2V9K A;  4TKT A;  4PXB A;  2B7B B;  4USH A;  3HVT B;  1WWH A;  1J5O B;  1RZM A;  1GMU A;  2O01 C;  1WC5 A;  4UZB A;  4F67 A;  3EVO A;  2DGU A;  2B6A B;  1S49 A;  2B5J B;  1LW0 A;  2RDI A;  1O51 A;  4C8M A;  3ZZ0 A;  1N33 F;  1X9M A;  4GC6 A;  4C3M A;  1G3O A;  2FHO B;  2M8D B;  2XS7 A;  3Q8P B;  4GC7 A;  2OEM A;  3A13 A;  3M9M B;  4A8X A;  2V4Q A;  2AT1 B;  3M32 B;  4DSF A;  2CQP A;  3QZ8 A;  1F5A A;  4J90 A;  4CNZ A;  2L48 A;  2XMT A;  3AB2 B;  3WIV A;  2PT0 A;  4IH5 A;  1N36 J;  2HHS A;  3HKZ D;  4O3N A;  4AT1 B;  4UQT A;  1R3N A;  4QIG A;  3ENW A;  3DRP B;  3F0N A;  3CIZ A;  2DXE A;  3FQL A;  1EAR A;  1RJJ A;  3HZE A;  3FZ2 A;  3F73 A;  1S0N A;  3GG1 A;  2JLF A;  4WK3 A;  1SL1 A;  3FUY A;  4F0H A;  2OEK A;  3POT B;  2WB4 A;  2C2O B;  1DAX A;  2AJ0 A;  2EWH A;  4DV4 F;  3D0I E;  4KHP F;  3DMJ A;  1NSP A;  5CYM B;  2CWX A;  2RE1 A;  1TTH B;  2ROE A;  1RBO B;  4R5P B;  1FNX H;  1S4F A;  1VBZ A;  3HVT A;  3LF0 A;  1QTN B;  4UF4 A;  4ZCI A;  3IAM 9;  2CJ9 A;  3CUL A;  4IOA Q;  3QWU A;  2B5J A;  1IM6 A;  4C3K A;  2VC0 A;  2LQ8 A;  3Q2T C;  3CD0 A;  1CS4 A;  1RAC B;  4G65 A;  3QGH A;  2K3K A;  4F3O A;  2PMZ D;  3GV5 B;  4D3G A;  2N82 B;  4NA2 A;  1EQM A;  4FVC A;  4O3P A;  4NI2 B;  3QZ7 A;  3GSI A;  4GKK F;  2K3I A;  2EG2 A;  2FZC B;  2V8H A;  4J9R A;  3M32 A;  4EO6 A;  3TAM B;  4MKY A;  2J7K A;  4CWB A;  3MEG B;  3BN7 A;  2OPP B;  1XN9 A;  1SQE A;  5LOQ A;  3K5N A;  3DRP A;  4A8W A;  1KNZ A;  1CJU A;  4D3H A;  2YXL A;  3GV7 B;  2UUC J;  4HTI A;  2VA3 A;  4ZVS B;  1NHU A;  1FK9 B;  2YNG B;  3POT A;  4RNN A;  2HGL A;  3PKY A;  1NKC A;  5C7P A;  1S10 A;  2VHG A;  1TMJ A;  4Q7A A;  2BJ1 A;  1U1R A;  5CYM A;  3FJ2 A;  3QT5 A;  5D0H A;  4KPC A;  3KNA A;  3K7R A;  1X4E A;  5D0G A;  3BN4 A;  1M5V C;  2D3O 1;  4GKJ J;  2D41 A;  2XYG B;  4TY9 A;  2VIH A;  1XEZ A;  3G96 A;  3M7V A;  3GIJ A;  4DV2 J;  4M63 A;  1WTB A;  3GPA A;  4C0H A;  2ASL A;  1ZM3 A;  2H65 B;  2YPY A;  2M2B A;  1RT2 A;  1PJ7 A;  4ZCL A;  2BM1 A;  1SJF A;  3RZA A;  4KKO A;  4NI2 A;  5KG0 A;  3D6F B;  2HZC A;  4OI3 A;  2Y9H A;  3SV3 A;  3SCI E;  5DDQ C;  5DG8 A;  1P1L A;  4WYW A;  4ZOS A;  2ACM A;  4OYO A;  1ITP A;  2YNF A;  1P9Y A;  3G86 A;  3MEG A;  2OPP A;  1Y3J A;  1UVK A;  1PKU A;  3LP2 B;  2K2P A;  3AFG A;  3O5T B;  2G2Y A;  4FBT A;  1JLF B;  4Y34 A;  2IC3 B;  3I5C A;  4DCP B;  1PJ6 A;  1FK9 A;  2YNG A;  3BKU A;  3SXL A;  5E7O B;  5L39 A;  1AT1 B;  1OJ4 A;  2XZT B;  1GT8 A;  1N0V C;  3KK2 A;  2HHH F;  5GAE I;  2YKM B;  3QRQ A;  2MPU A;  1JLA B;  1VIO A;  2MQN A;  4HTJ A;  4JUZ A;  3IR6 B;  3HX9 A;  1FA0 A;  1DBD A;  3DCA A;  1X9S A;  3PJW A;  3Q86 A;  2QA4 S;  1XR5 A;  2W2Q P;  3T5K A;  2NR0 A;  3JAM U;  2QMX A;  4RW4 B;  3SSR A;  2VF3 A;  1DQ9 A;  4QQB A;  4OX7 A;  4PWU A;  2FJV A;  4JI5 J;  3L7P A;  4DQR A;  1MSW D;  2ZEJ A;  2AWZ A;  1WG1 A;  3T19 A;  1IR2 A;  4C4W A;  1D3W A;  2AIR B;  1GEH A;  3M8Z A;  1YX2 A;  3L09 A;  3UDL A;  1FNO A;  4ENO A;  3FNN A;  3LP2 A;  4Q8E A;  3CJK B;  4LF2 A;  4JI2 F;  1JLF A;  3BO3 A;  3GCX P;  1X8D A;  4DL0 C;  5J2Q B;  3PW2 A;  1IQT A;  2IC3 A;  4RW9 B;  2OHD A;  2EBE A;  5FII A;  1FJG F;  2BOP A;  2M0G B;  4KGZ B;  5L1K A;  1E6Y B;  3MM9 B;  2OTL S;  3ZTP A;  2E5J A;  3B82 A;  4B17 A;  4EYH B;  1JLA A;  1RBA A;  3BDE A;  5KFK A;  2QTW A;  4Y65 A;  5HBM A;  3TQE A;  2HND B;  1Q1K A;  2R8G A;  4ES2 A;  4I6A A;  3NCP A;  1IBK J;  4F2R A;  4RW4 A;  4F4Y A;  3L9Z A;  1UW9 A;  3NBP A;  1SKU B;  4YR3 A;  4NX9 A;  2LA6 A;  4PAA A;  3DM2 A;  2UUW A;  2C2D A;  4C8N A;  1WDT A;  2ZM6 F;  2C2E A;  2XTJ P;  1WG5 A;  4ETX A;  4WKY A;  5IT9 U;  3MED B;  2MZ1 A;  4TQR A;  2Z0G A;  3OHB A;  3JSR A;  3EPG A;  2HSE B;  1L3U A;  3AT1 B;  2HAI A;  3QT6 A;  4ZJQ A;  2VOD A;  2VKR A;  3CD7 A;  3CJK A;  4DCJ B;  4EU0 A;  4ECW A;  3NLC A;  3LOU A;  2IDL A;  1YBT A;  1VQK S;  2VD3 A;  3MM7 B;  3KJF B;  3PHT A;  3MM9 A;  1MWZ A;  1MLA A;  1S9E B;  3TW0 A;  1TV6 A;  2DYA A;  4L3N A;  4LUB A;  3KLG A;  2X7I A;  1YJ7 A;  1PG5 B;  2J9E A;  2DTJ A;  1XMQ F;  5HMW A;  2BJ8 A;  2KXN B;  4IQM A;  3DN9 A;  4X4V A;  2POK A;  4LF5 J;  2LXU A;  2MXY A;  1S5Z A;  5AXM A;  3UCZ P;  4HT5 A;  4WK1 A;  2KTQ A;  3J7Z 5;  2HBR B;  1U49 A;  4Y2K A;  2MZQ A;  4RBV A;  5DLF A;  4CT8 A;  2ASJ A;  2Y1R I;  2AYE A;  3EDQ B;  2H5E A;  3KLV A;  2L41 A;  3AD9 C;  3KDN A;  4JYA F;  2PA8 D;  2FVR A;  5KG7 A;  1I1G A;  4Y2C A;  4M5G A;  3MED A;  5BJR A;  4IDK B;  4HKQ A;  1FFG B;  5GAG U;  5KOX A;  4WCE Q;  2YTC A;  4KJI A;  4ZVG A;  3A12 A;  3QSY B;  2WBM A;  1IKX B;  2WVE A;  4WFB Q;  4FS1 A;  2VBW A;  4BHQ A;  3ET6 B;  1ZOT A;  4B9S A;  1SH3 A;  1U0S A;  2ZIT A;  2EFQ A;  3GIR A;  1U1L A;  4F02 A;  4FF4 A;  2XEX A;  4DXL A;  2F7V A;  4F26 A;  2M9K A;  3G6V A;  1F5C A;  1UW4 A;  1WF0 A;  1FVS A;  2BUN A;  2KT5 A;  3ZZU A;  3DRR B;  1N4L A;  5CXT A;  4HT7 A;  2HEK A;  3GIL A;  1YTY A;  5F8N A;  3HFK A;  3P45 B;  5E3P A;  1FNM A;  4AL5 A;  4HLB A;  5K20 B;  1N56 A;  2HUR A;  3CCZ A;  4DFP A;  1Z2Z A;  3H59 A;  3D1H A;  4QIV A;  1NK4 A;  3NG8 A;  3W1Y C;  2Y1J A;  3PTW A;  1YZ7 A;  4U96 A;  5J1E B;  4DSE A;  1XMB A;  2G2O A;  1QTM A;  4X66 J;  3IWL A;  1YJR A;  2BRK A;  6AT1 B;  3G8T A;  1O5J A;  3TUZ C;  2FVC A;  1PGZ A;  4DSJ A;  1RGV A;  2CZV C;  1TQL A;  4I2P B;  4Z2X A;  4DV1 J;  3R2D J;  3NGU A;  4IDK A;  8RUC A;  2CVI A;  1LWC A;  3TUP A;  2BZ2 A;  5KOW A;  1LQ9 A;  3NRB A;  2ZHO A;  4CLK A;  1L3T A;  5MAO A;  5F9N A;  1IKX A;  3CSK A;  4OYX A;  1KVI A;  3A3P B;  4L74 A;  1X4A A;  3JTO A;  3K5P A;  4G1Q A;  3I9V 9;  3OFE A;  3N28 A;  4IOC Q;  1TAQ A;  2QN6 B;  1VS3 A;  2I1R A;  1PYO B;  4ZVF A;  2JJ4 D;  5CYQ A;  2E5I A;  4NZ0 A;  4YB5 A;  4KFB B;  4TVA B;  1WEY A;  1T9W A;  5ETQ A;  2L9D A;  1VQ9 S;  1N5S A;  3PM9 A;  3V6J A;  1OS5 A;  4BCA A;  3J81 j;  3BGR B;  1XNR J;  1F1B B;  3DC2 A;  2BJ9 A;  2F9J A;  3OL9 A;  2OD6 A;  2B56 A;  5ADZ A;  3PW0 A;  2K06 A;  2CVE A;  2J0W A;  2N3O A;  5J1E A;  1UVN A;  4KT0 C;  1FXD A;  2GQQ A;  1U1N A;  1KQF B;  2DHH A;  4RUC A;  5E3A A;  2K8G A;  4IFV B;  2JFK A;  1OY8 A;  3CJ3 A;  4GRS A;  1NDK A;  2J5A A;  2GO8 A;  5G4D A;  4N47 A;  5KTQ A;  3J81 U;  1M1G A;  1ICE B;  3IWN C;  2VG5 B;  1NO8 A;  3E01 B;  4DCO B;  5HRO B;  4DR3 F;  3QLH B;  1KC8 T;  1A9N B;  4M5J A;  1RHM B;  4LF6 F;  4L73 A;  4NLG A;  3ZZT A;  2UUB F;  1D9A A;  3MPY A;  1MMN A;  4EYI B;  2W9C B;  3KMQ A;  5BXI A;  3H8Y A;  3QJJ A;  5KFJ A;  2B9W A;  3R8Y A;  4K4U A;  5DZ6 A;  4OZ5 A;  4IRC A;  3OTE A;  2YVS A;  5T7L B;  4BWJ A;  4KFB A;  2LKZ A;  2UP1 A;  4M94 A;  1N6Q B;  4UST A;  4FF2 A;  3DOK B;  1HI1 A;  1BQX A;  5HQM A;  1IM4 A;  3BRE A;  2CJQ A;  2FLP A;  4J9O A;  1YJV A;  2B4U A;  3C8Y A;  2XMJ A;  2QE5 A;  1U7L A;  1FRX A;  5D4L A;  4KV8 A;  4AXJ A;  4U7U K;  4CLT A;  3EGV A;  3T6J A;  3UNY A;  2XY5 A;  4YY3 J;  1RQ0 A;  1S97 A;  4ZMM A;  1PIE A;  1JXL A;  4KC5 A;  5RUB A;  1UPP A;  2JL9 A;  2WB1 D;  4YFU A;  3BR9 A;  2BQU A;  4DOZ A;  2CNL B;  2VG5 A;  1MN7 A;  3QLH A;  3ENV A;  3CED A;  4LBI A;  1MG7 A;  1NZA A;  1UZD A;  5IT0 A;  2XGQ A;  2Z30 B;  3BPS P;  3AXM A;  4MIB A;  5J2P B;  4A8M P;  2R8K A;  2C2M B;  2O66 A;  1OQ6 A;  3FFI B;  1IR1 A;  1C1B B;  1AFJ A;  2JVO A;  2VIC A;  4K4T A;  3C14 A;  1HYS B;  2BE7 D;  4USW A;  4K2J A;  5T7L A;  3EGN A;  1UA0 A;  1TKX B;  2AYM A;  3IBC B;  4M5K A;  4P52 A;  4U8Y A;  4C0O C;  1EHW A;  1SJ1 A;  1JWW A;  2FVQ A;  1R6V A;  3ENA A;  4O44 B;  1RHQ B;  3LA0 A;  1VMB A;  2W25 A;  1UKU A;  3NGK A;  2A1B A;  2HFS A;  1KP6 A;  3RW7 A;  5CAB A;  2GC8 A;  2VFV A;  4MYU A;  2OSQ A;  3DLG A;  4CCH A;  1RT6 B;  2B0G A;  2HNZ B;  2RD5 C;  4DS5 A;  1LEO A;  2H51 B;  2JSX A;  4LSZ B;  5GMK a;  1NUE A;  4G3I A;  1XNQ J;  2DK2 A;  3SCK E;  1FRH A;  3Q83 A;  1U09 A;  2XZW A;  3PO5 A;  2OFG X;  2XHC A;  4YP3 A;  4E2F B;  2NUH A;  2HIY A;  3GJS B;  3KWM A;  3KXD A;  3ZZO A;  1FKA F;  2QFI A;  1HW9 A;  4X4R A;  2KHC A;  3TI0 A;  1M5K C;  2UVV A;  1S9G B;  2C42 A;  1K9M T;  4F4W A;  5A0Y A;  1JJ4 A;  3HI9 A;  4JI6 J;  3AA8 A;  3FFI A;  1KON A;  3TO8 A;  1VRQ C;  1C1B A;  4DS4 A;  2JFD A;  4FBU A;  1HYS A;  4DLE A;  3BEG B;  4CRJ A;  1ZA1 B;  5FDL A;  1HAR A;  3IRX B;  1WTF A;  2R7O A;  4OX9 F;  1XC9 A;  4QYZ K;  1WOP A;  1TKX A;  5D4P A;  4C98 A;  5DQH A;  3P8B B;  2AX1 A;  1LV5 A;  3Q8S B;  1VIX A;  3BYP A;  3OQ2 A;  2KZM A;  4P9S A;  4G1P A;  4O44 A;  5C2C A;  2YWK A;  2VKZ G;  3AJ2 A;  1RT6 A;  2HNZ A;  3OHA A;  4DI6 A;  3R1L A;  5LMN J;  4FF3 A;  5KFP A;  2UVW A;  3KDO A;  4BBY A;  3O1L A;  1DRZ A;  5EWG A;  3VAM A;  2HVD A;  1VQ8 S;  3D2W A;  1WC1 A;  4TYB A;  2B3T B;  4DUZ J;  4OYM A;  4O4G B;  2J6U A;  2W2N P;  1PO6 A;  4AQY F;  1YLX A;  3MEE B;  1S9G A;  4XAK A;  3QPI A;  2M4M A;  3GWC A;  3TUI C;  2WSC C;  3ZZR A;  4CH0 S;  2KFY A;  2O3D A;  3O44 A;  4AFF A;  2IM1 A;  1S6O A;  2W24 A;  4X65 F;  1C0U B;  3GII A;  1HNZ J;  5CYJ A;  3RB6 A;  1UL3 A;  1U8S A;  3M2R B;  4ZCM A;  2W4P A;  1RTI B;  3EZU A;  4A8F A;  2C2N A;  5A76 A;  4OI6 A;  3IC1 A;  1XTZ A;  5IQQ A;  2QLF B;  1HMV B;  1V9O A;  2XY7 A;  5BYR A;  1KLM B;  1NM2 A;  2W4D A;  1RYS A;  3H20 A;  3VVT A;  5IT9 Y;  4NMX A;  4WKR A;  4C2M A;  3BYR A;  2KM8 B;  3MMB B;  3H4D A;  3G6X A;  1U1M A;  3A3N B;  4DUY F;  4EBD A;  1Y7P A;  1U0H B;  2QX0 A;  2VPX B;  5SZT A;  3UDV A;  3BQ1 A;  4ED8 A;  2EK1 A;  3H0P A;  3IBF B;  3E2E A;  1EKS A;  3BQ0 A;  3RAX A;  2RQM A;  1RWU A;  5F8L A;  4N8N A;  4DR6 J;  4CLY A;  2CPD A;  4NEY A;  1P27 B;  4O4G A;  3RAM A;  2ZH9 A;  2OTJ S;  1YDL A;  1SC6 A;  4P7V A;  1D9D A;  2EK6 A;  3MEE A;  1AA1 B;  3K89 A;  4R0J A;  3CUN A;  2KYZ A;  1NJI T;  5KFW A;  2FY1 A;  3EVW A;  3S1T A;  1YJN S;  3DDN A;  4CTA B;  3NGR A;  2D1C A;  5E3Q A;  1RTD B;  3TJ9 A;  2NXE A;  2JC0 A;  4WII A;  3TJA A;  1C0U A;  1KHV A;  1VBK A;  3G8S A;  4LRE A;  1D09 B;  2WVF A;  1UA1 A;  4R8U B;  1UMJ A;  1RTI A;  3RW6 A;  2DGS A;  2KM8 C;  3RR8 A;  1PYT A;  1S1U B;  2ALY B;  1KLM A;  3T1H J;  1YJU A;  1FXL A;  2UXC J;  2UUA J;  2LQ5 A;  4DL2 A;  2W2P P;  4ICL B;  3ITH B;  2NXC A;  1UZH A;  4NXM F;  2PGC A;  2YPZ A;  2HQC A;  4ED6 A;  4I6W A;  1C0T B;  4ANE A;  4OJ3 A;  1U0H A;  2QGF B;  1SKS A;  3PYF A;  3UI3 A;  5L1L A;  2CPF A;  4PPD A;  1ZH5 A;  3CDE A;  5F8I A;  3BBB A;  2IHR 1;  2V8G A;  1ZYQ A;  3OXF A;  2AJ4 A;  2F8E X;  1N32 F;  3H98 A;  3PZP A;  4M1K A;  3NCR A;  1FEE A;  3P4U B;  2FDN A;  4S0M A;  4F8R A;  2R7V A;  4B9M A;  4NLT A;  1NND A;  3RJM B;  2ZH2 A;  4DQQ A;  4ECS A;  2DNQ A;  1UCN A;  3GTY X;  3W62 A;  3MM6 B;  1SH0 A;  5KFO A;  2VG7 B;  5I3U B;  1N88 A;  2AEF A;  3FSY A;  4CTA A;  2MKK A;  1ZBT A;  2E1R A;  3KG0 A;  1A6L A;  3IR7 B;  2QLX A;  3M2U A;  2B4V A;  4DV3 J;  2X1F A;  2E5G A;  5KFZ A;  1EX8 A;  1RUS A;  3IA0 A;  5B09 A;  3BGU A;  2BV3 A;  4C8O A;  1RT1 B;  3ZNU A;  2XBP A;  4F4K A;  5FD1 A;  4ZLJ A;  2XLK A;  2D9P A;  2WSE C;  3C2P A;  4NLQ A;  4ZK7 M;  3F56 A;  3OL8 A;  2GHP A;  1S1U A;  5HJX A;  1R8P A;  1HBU B;  1X4G A;  4LSL B;  1RT3 B;  1KD1 T;  1ZET A;  3KHL A;  2CPY A;  4ICL A;  3ITH A;  4DR2 J;  1RWW B;  1EB0 A;  1C0T A;  1NRK A;  1DTQ B;  3NXZ A;  2ZZT A;  2V4R A;  3TR5 A;  3T5H A;  4EBE A;  1XK8 A;  3SMZ A;  3VAJ A;  4LMZ A;  2HLU A;  5DG7 A;  1U25 A;  4CI0 B;  2MQP A;  2IMW P;  5GAD U;  4Z37 A;  2HMI B;  3JSB A;  3O2I A;  3MM6 A;  3QNW B;  2QG9 B;  2F4V J;  2VG7 A;  5I3U A;  2DNK A;  1TL1 A;  2DKO B;  2UU9 F;  3ZC4 A;  2XGP A;  4USK A;  3CC2 S;  3BH7 B;  2ABY A;  3F44 A;  4DV6 F;  1K47 A;  3DHX A;  1RT1 A;  1NU4 A;  1B0P A;  1X5S A;  2UVR A;  1Y5L B;  2IAJ B;  1HNW J;  4K4X A;  5B7W A;  1JQG A;  2KI2 A;  2MHN A;  1HBU A;  3IWX A;  1NME B;  2CQ4 A;  4LSL A;  1VLY A;  2VJU A;  1Q81 T;  5HP1 A;  5MLC V;  5LSO A;  2KVI A;  3RBZ A;  1DTQ A;  3NOC A;  2LU2 A;  3UW1 A;  2FVP A;  3D5M A;  2JC1 A;  2GNK A;  2VG6 A;  4DR1 F;  1HBO B;  1W7W A;  3CCU S;  4ED1 A;  3EM1 A;  2C3U A;  3R7S B;  1FVQ A;  3KG4 A;  3SFU A;  4LF7 J;  4RW8 A;  4DG1 A;  3TAR A;  3NS7 B;  2HMI A;  4JI0 J;  5FJ4 A;  2NPI A;  4USI A;  1UEV A;  2DHG A;  4CM2 A;  4K7Q A;  3MTK A;  1QM9 A;  2RKI A;  4MKB A;  1XWL A;  2UXD J;  2XMA A;  3DOL B;  3QMQ A;  2D74 B;  1N34 J;  3LWL A;  2YWH A;  1SBR A;  1YBA A;  3JQK A;  1Q8L A;  2CPJ A;  8AT1 B;  2DNR A;  4FNH A;  4ECZ A;  4EWT A;  2IAJ A;  4GVB B;  1R0B G;  4DV0 J;  5U47 A;  3ZTS A;  2DRA A;  1X4H A;  3EX7 B;  4J9K A;  3R27 A;  2CQ2 A;  1X4C A;  4HR2 A;  1VQ6 S;  4MKV A;  3C6U B;  5DLG A;  2HFV A;  4DU8 A;  3AD8 C;  1J5E J;  3CJ2 A;  5IWA J;  4C8Y A;  4RNM A;  2XMU A;  2FHM A;  4X2B A;  1OIA A;  1ZPW X;  5GVQ A;  5H9E K;  4OX6 A;  1S4E A;  4M5L A;  1CUL B;  1RT7 B;  4V19 J;  2HQI A;  3GCW P;  4RW6 A;  2LQB A;  5JJB A;  3JYT B;  4JOU A;  2QEX S;  4B3M F;  2ZBC A;  2RML A;  5D15 A;  2DIT A;  3THP A;  4P73 A;  2XYP B;  1Q0N A;  3FVY A;  1U02 A;  2FC8 A;  2B9X A;  2V2K A;  2OML A;  5ETK A;  4NOH A;  2CQC A;  2L3M A;  1SVD A;  5D4O A;  1UAW A;  3VGU A;  5CCM A;  2E1P A;  2J9D A;  2FY8 A;  5LMU J;  3ZZY A;  2EG1 A;  5AJ3 F;  4ILR A;  1N33 J;  1QAI A;  4ZIT A;  4GVB A;  3LQV A;  1MN9 A;  4XIU A;  5J1P A;  2MKJ A;  4ZPD A;  2R2S A;  3W66 A;  1QUV A;  2KVQ E;  4J9P A;  1F2G A;  3OVS A;  4OI0 A;  3K8W A;  2BYC A;  1Q7Y T;  5T41 A;  2IFX A;  2QMW A;  4ALZ A;  1RCO B;  3QAT A;  4C9D A;  1K0V A;  2Z58 B;  4U67 Q;  5ETM A;  3D6H B;  2KG0 A;  5IT4 A;  3ZTR A;  5JUM A;  3G6Y A;  2J6S A;  2V8P A;  4QCL A;  1CUL A;  1M90 T;  3C6T A;  3FZB A;  2GZO A;  1KFS A;  3JYT A;  3R5J B;  1VRT B;  2ZKT A;  3J80 U;  4K0K F;  3OTO J;  3US5 A;  2WVD A;  4CT9 A;  4QYZ J;  1RYR A;  4IG3 A;  3KLF B;  2BJD A;  2PEH A;  4DV4 J;  5KFN A;  5ETL A;  4KHP J;  2MGZ B;  2OPS A;  4C3L A;  2YY3 A;  1S99 A;  4E8U A;  2NZC A;  2WCX A;  5L38 A;  1TL7 B;  3DRS B;  5F0U A;  2C2K B;  2PA3 A;  3I4H X;  1DQ8 A;  3HHN B;  5KFA A;  2ZOG A;  3T41 A;  4B08 A;  3ZTO A;  2YKA A;  1UET A;  2CQD A;  5C24 B;  1WNE A;  2U2F A;  3IFE A;  3UN3 A;  3DNC A;  2ZH7 A;  4K5S A;  2LMI A;  2ADB A;  3H4B A;  2W8L A;  1FKP B;  4JV5 J;  2FHK A;  3M2V B;  4YS2 A;  3A8I A;  4CO3 A;  4LRC A;  4UZC A;  3DXS X;  3D6M B;  5M2P A;  4GKK J;  1IBM F;  3DLH A;  3U7J A;  2FZG B;  1ELO A;  2E7W A;  2MY8 A;  3KNG A;  3AY0 A;  4P6Q A;  2YQ3 A;  3DFE A;  4ZPA A;  5HO4 A;  3MAA B;  1CJK A;  2OKQ A;  5E2Q A;  5CCL A;  5IV4 A;  3DGP B;  3C15 A;  1N8R T;  1IWA A;  1S6U A;  5M2R A;  2WOM B;  1S1T B;  4M95 A;  1P8G A;  1FRI A;  2J9C A;  4KHR A;  1VCT A;  1VRT A;  4KGX B;  1V6H A;  4ZPB A;  4HI2 A;  4RU2 A;  4WJB A;  2JX2 A;  1DLO B;  2MGZ A;  2JEJ A;  3VF0 B;  3GLJ A;  1RAE B;  2QJ3 A;  5D0E A;  1HNV B;  4QYR A;  4ZPT R;  2YNH B;  1TR0 A;  2YWW A;  2OD4 A;  4JB8 B;  2ZH5 A;  4DHV A;  4LR7 A;  3AOB A;  4QR0 A;  4PR6 A;  2CJK A;  3MF5 A;  4ZIV A;  5C24 A;  2ZOF A;  2EFO A;  3OXL A;  4QW9 A;  2EFG A;  4NYP A;  3IGV A;  3Q22 A;  1KN6 A;  3I0R B;  5I42 B;  1FKP A;  2FLL A;  1RAG B;  2GGP B;  1U47 A;  2VQE F;  1WG4 A;  3DKD A;  4O3O A;  3D67 A;  3MGJ A;  3BGF A;  1U1P A;  1D8Z A;  1JNZ B;  4A8Q A;  1ROF A;  2G13 A;  3ZZP A;  3TZY A;  1XR6 A;  3PG9 A;  1FF2 A;  5K8O A;  2NRE A;  3MAA A;  4B9N A;  3DGP A;  2C3M A;  2VOO A;  4KQZ A;  2QSW A;  3LGH A;  2WOM A;  3R5A A;  1MWQ A;  3RB0 A;  4NLP A;  2OSR A;  2BOA A;  3X1L B;  3MR5 A;  1L3S A;  1FI4 A;  1YSJ A;  2IYI A;  2HRU A;  1QVG R;  4YQW A;  4UUW A;  2KO1 A;  1DLO A;  3ADA C;  1BGX T;  4QR2 A;  2HHH J;  5LJ5 Y;  3RBD A;  1HNV A;  1N48 A;  2YNH A;  1BD6 A;  4NZ6 A;  2M7S A;  3W65 A;  2BA9 A;  3O6Q A;  4I67 A;  2RUG A;  3KTQ A;  4JBC A;  2CPI A;  3K17 A;  4OHV A;  2ZFH A;  4P2S A;  4GVL A;  3R7N B;  3PYD A;  1ZTT A;  1KVK A;  3OTD A;  5A8R B;  4DPO A;  5K9F A;  1OSC A;  5I42 A;  4HEA 9;  3QAU A;  3T9Z A;  1CVJ A;  2G0C A;  8ATC B;  1N0U A;  3BKT A;  4H4O B;  1RU2 A;  3PRV A;  1G1X A;  1VQS A;  1FES A;  2CAJ A;  2DIU A;  2EFP A;  5EX3 A;  4IG0 B;  4PG6 A;  2KL8 A;  4ED7 A;  1WEX A;  3PJ9 A;  2CQB A;  4J37 A;  4LFA F;  1VRU A;  4JI2 J;  1IKV A;  3BBF A;  1TKT B;  3CDU A;  4RW7 B;  1S59 A;  4K4V A;  1MWY A;  3DYA B;  4DU7 A;  3HUL A;  3OT9 A;  1FJG J;  1RI7 A;  1FWK A;  3CC4 S;  3D66 A;  3B6B A;  3CWJ A;  2QL7 B;  2B8P A;  4DWI A;  5KT6 A;  1M5P C;  1KKH A;  1WEZ A;  3U1L A;  1F9E B;  3U02 A;  4ERD A;  2ZNZ A;  2AV5 A;  2GIQ A;  1NSQ A;  3HDS A;  4G6V B;  3DI6 B;  2IYG A;  1IKY A;  2VDH A;  4GKJ F;  1Q86 T;  2E9Z A;  3W64 A;  1FFS B;  2EPI A;  3BQ2 A;  1FHT A;  1HR0 F;  1RLD A;  3VAL A;  5D78 A;  3DOM A;  1CQM A;  4B9U A;  3OJU A;  2UUT A;  4DV2 F;  2OPR B;  4U95 A;  3UR0 A;  3RB4 A;  3KJN B;  1WKJ A;  2V0N A;  4OHX A;  3TAQ A;  2ZM6 J;  1E6V B;  3QID A;  3V81 B;  4LVO P;  1WKK A;  2DR8 A;  4IG0 A;  2BKO A;  3GSD A;  3NKY A;  1UPM B;  2FJB B;  1B70 B;  4YUD A;  2FHJ A;  4E98 A;  2VFT A;  1F60 B;  1H2V Z;  3P96 A;  2W9A A;  4EI2 A;  3DYA A;  1T95 A;  4MAK A;  2PE8 A;  4ZS6 A;  3W9J A;  3PEJ A;  3TYT A;  3R7B B;  1HNI B;  3FCV A;  2ZE2 B;  4HYK A;  1JXE A;  4X62 J;  4TU8 A;  4DX8 H;  4JI7 F;  4ECY A;  1S9F A;  3OBI A;  2UV8 A;  2MZJ A;  1O8B A;  4J9S A;  2WK4 A;  3A8E A;  2XLJ A;  1S1V B;  4USU A;  5HLF B;  4HHU A;  2VV5 A;  2RVJ A;  3MEC B; 
#chains in the Genus database with same CATH homology
 3R5J B;  2P2C B;  2XYP B;  3KJN B;  1RWM B;  2CDR B;  2XYG B;  3KJF B;  4LSZ B;  1ICE B;  2HBY B;  1SC3 B;  2C2Z B;  4DCO B;  2QL5 B;  2CNN B;  2H4Y B;  2H65 B;  1RHM B;  2CJY B;  1I3O B;  1GFW B;  2CNL B;  2QLB B;  1RHU B;  2QLJ B;  1I51 B;  1PAU B;  2HBZ B;  3GJT B;  3GJS B;  4ZVO B;  2Y1L B;  3D6F B;  3IBF B;  3SIP B;  1NME B;  1QDU B;  1SC1 B;  1SC4 B;  2HBQ B;  2QL9 B;  3EDR B;  1RWW B;  2C2K B;  2CNO B;  2C1E B;  1PYO B;  2C2M B;  1RHR B;  3GJR B;  4JB8 B;  1RWP B;  3P45 B;  1RHK B;  3P4U B;  2HBR B;  5IC6 B;  1RWK B;  5K20 B;  2QL7 B;  1RHJ B;  5IC4 B;  3R7B B;  4ZVP B;  3RJM B;  2H54 B;  1F9E B;  3EDQ B;  3KJQ B;  2H4W B;  2Y0B B;  2C2O B;  4ZVS B;  2H5I B;  3IBC B;  1RWN B;  1IBC B;  4ZVT B;  1BMQ B;  3D6M B;  3R7S B;  3R7N B;  3GJQ B;  1RWX B;  4DCP B;  2XZD B;  2CJX B;  2H48 B;  1RE1 B;  1RHQ B;  3QNW B;  3D6H B;  2XZT B;  3NS7 B;  3R6G B;  2XYH B;  4DCJ B;  1QTN B;  4ZVR B;  2DKO B;  1RWV B;  2FQQ B;  2CNK B;  1RWO B;  2QLF B;  2H5J B;  4ZVQ B;  4ZVU B;  3R6L B;  2H51 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...