1GFWB

The 2.8 angstrom crystal structure of caspase-3 (apopain or cpp32)in complex with an isatin sulfonamide inhibitor.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
HKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 (APOPAIN, P20)
publication title Potent and selective nonpeptide inhibitors of caspases 3 and 7 inhibit apoptosis and maintain cell functionality.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2000-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1gfwB00
3GJTB 2HBRB 3GJQB 4ZVSB 1RWOB 1PAUB 1RWNB 1RWKB 3IBCB 1SC4B 2HBQB 4ZVTB 3KJFB 1RHUB 4ZVPB 1RWXB 1IBCB 2CJYB 2QL9B 3P45B 2HBYB 1QDUB 2XZTB 1BMQB 2Y0BB 2DKOB 1PYOB 2HBZB 3IBFB 2C2ZB 3R7SB 3D6MB 2QL7B 4ZVQB 1ICEB 1RWWB 4ZVRB 4LSZB 2FQQB 2P2CB 3GJRB 3R5JB 1GFWB 3P4UB 1RWVB 2C2OB 5IC4B 2XZDB 1RWMB 2CJXB 3D6FB 2CNLB 2C2KB 3R7BB 3R7NB 1SC1B 2H4WB 3R6GB 4ZVOB 2H5IB 3GJSB 1NMEB 3KJNB 1RHKB 2H54B 1RHQB 1SC3B 2XYHB 3QNWB 4DCOB 2H51B 2CNOB 2C1EB 2H4YB 3SIPB 3RJMB 1RHMB 2CDRB 2QLFB 2CNNB 2XYPB 2CNKB 3NS7B 3R6LB 2H48B 1F9EB 4ZVUB 3D6HB 4JB8B 5K20B 2QLBB 3EDQB 5IC6B 1I3OB 2H5JB 2C2MB 3KJQB 2Y1LB 1I51B 2H65B 2QLJB 1RHRB 4DCPB 1QTNB 2QL5B 1RHJB 3EDRB 4DCJB 1RE1B 1RWPB 2XYGB
chains in the Genus database with same CATH superfamily
4RL1A 1HPZB 1JB0C 2M2BA 4QIFA 5L9XA 3PM9A 1YJWS 4OI4A 1UTAA 1YJVA 2LP4A 1S6OA 3MEDA 4W92B 3R5GA 5IWAJ 4DR1J 2NXEA 3SYZA 3N01A 1DARA 3W9JA 4F4XA 1TL7A 3DOLB 5M2PA 2Q6CA 2F4FA 1UW9A 1GNKA 4HH0A 2ACYA 4LSZB 2PC6A 2WOMB 5E0OA 4U8VA 1JLCB 1FJGF 1RU1A 4NLXA 2BKNA 1UCNA 3GFHA 4DFKA 3H20A 3G96A 1WHXA 1XN9A 1WTFA 2HHPA 4JOUA 1CJVB 4J9QA 5FLXU 4EGLA 6AT1B 3BH6B 3GLJA 3N9UC 2XCPA 1R43A 4C0BA 1NSAA 2F4VF 3UE2A 3N79A 2OELA 4RU9A 1FKAF 5AE2A 4DQIA 5F9LA 1U1QA 4EU0A 2KB2A 3NCQA 2ZDOA 4HTJA 2ROEA 2UUCJ 1WHWA 4GVBA 1DTTB 2F8MA 3AODA 1B7YB 2AYEA 1MLAA 2L48A 2HFVA 4DPOA 2FJEB 1HW9A 2OFHX 2KJVA 4UF4A 4E0DA 2VASA 3R7SB 2XZWA 4ZCIA 3PYGA 4I7FB 4DXLA 3W64A 4ZJLA 3IR5B 2XULA 3SFUA 2B5JA 3CUNA 4KFBB 2RS8A 4BLGA 3LTOA 2YKQA 3DGPA 2ZM6J 5J1PA 4AQYJ 3JTNA 2YXLA 3DDKA 4R5PB 2KI2A 4DSJA 3OTEA 2KM8B 3RB0A 4BS2A 1ZH5A 3HVTB 1S1XB 3CE8A 2JEIA 2XM3A 1XNQF 2IM3A 2K3IA 3PX4A 2P6TA 2PMHA 2V0NA 3PR4A 5J2NB 4F02A 1LKZA 4YY3F 3LWLA 2DGVA 2COLA 5HQMA 5GAHU 1UVMA 2RHQB 3BREA 4Z7CA 3IC1A 2YNHA 3TX0A 1K0VA 3GJQB 4NCAA 5KOXA 1Q4RA 4CO4A 2DR7A 4ZPBA 4L76A 3GIIA 4RNFA 1ZZNA 4C4WA 4Z2XA 4QW9A 5CAAA 3GYNA 3LP0A 4KB7A 5KT2A 4J9NA 2BRLA 1YLXA 1Q5YA 1LW2B 3RR7A 3BO2A 3NLCA 5CD4H 4DV4J 2KL8A 3U02A 2BKOA 4KHMA 2GX8A 2HZVA 3IGNA 3R5DA 1HI1A 1TVRA 1W7WA 4O44B 4HEA9 2IRUA 2R4FA 4ZPTR 1VCTA 2K2PA 3ZZOA 1GMVA 2C3UA 4ED2A 2HFOA 2BEFA 3FFIB 4CDIA 4EYIB 2IBOA 2X3DA 2IBKA 4B3TJ 1I3OB 2DJWA 1JJ4A 1IQZA 3GQCA 2OKQA 1U1PA 4OFZA 3FSYA 4NLSA 2HGLA 2V4RA 2PFFB 3QMQA 1YZ7A 1UWBB 4L3NA 4DX6A 5HVFA 1RBLA 2FHJD 4C11A 2LEBA 1O6XA 1R0BG 2OD4A 2RDDA 4TU9A 1WC1A 1TKZA 1RTIA 3CCMS 3KK3A 3CJ0A 3ISND 3A8IA 3MOJB 4PQAA 1IR1A 4CLWA 3P3DA 1N6QB 1V3RA 2OI2A 1WOOA 1Q86T 2J8AA 3SBMA 4B3RJ 2M9KA 5KG5A 3ENAA 3ETOA 2MXYA 4DQSA 2GHVC 3I0SB 2VFUA 1HBNB 1KLMB 1OMSA 2DR9A 3ILLA 5A0YA 4DV5F 3B8HA 4K4XA 4YDDB 1RACB 3OPKA 5CABA 1KHVA 3IWNC 3PX6A 5AXNA 2Q66A 5HQLA 4BC9A 3US5A 3BB5A 3C8YA 1IWAA 1JKHB 2DNQA 3EWGA 1Q95G 4CZCA 2AX0A 4E2FB 3W3SA 5FD1A 4WFYA 1UZHA 1VQ5S 3PYFA 3TANA 3O1LA 1URNA 3TUZC 2V50A 1PYTA 1JLFA 2AMCB 1S1TA 1JJHA 3EUNA 5K5MA 1R8HA 4FF4A 2DB1A 1S59A 2L08A 4MT1A 2HBQB 4NLRA 5DDOC 2ERRA 3PW5A 2FVQA 2AYMA 2CPEA 4BBYA 2VC0A 1FJGJ 1RT2A 2M3DA 2E5JA 2RSQA 5KFEA 4ZA1A 4WU3A 4I68A 3KG1A 3BH7B 1FNXH 3ICLA 2MKJA 2E9TA 4ZVQB 5C24A 4ZVRB 1T03A 2DGQA 2BX6A 3UN2A 3UCUP 1U1LA 1SUQB 2MHEA 2OSRA 3C14A 4LFBF 2AJ2A 4CP5A 5A8WA 1JNZB 3RYLA 2B4PA 5B0FA 3FRYA 3RW7A 5AJ3F 5H9EK 2BDPA 5A8RA 2B6AB 4DV6J 1VFJA 1TQLA 4DWIA 1HQEA 3SIPB 4L72B 4NRUA 2HQDA 3NGDA 4O0IA 3LP2B 1N5SA 2RQMA 4KQZA 3SSSA 4FDFA 3AJDA 4XIUA 1T05B 2Q6BA 3EZUA 4GMKA 1S0MA 9ATCB 1HLWA 1IKXA 4ILRA 4A46A 4DFJA 2BE9B 2QX0A 5DG8A 5HL7Q 4UOHA 2GIFA 2YKNA 2Q43A 1BY9A 3HD1A 3CJSA 3TO8A 4N8NA 3DCAA 4ECTA 2FLPA 3CCVS 2AGOA 2FY1A 4C8KA 2HNZB 4I2PB 4IH5A 1X5PA 2YWFA 3TUPA 4JV5J 4BC7A 2OSQA 4PG5A 2XS2A 1PILA 2B56A 4CM0A 2YQ0A 2BRKA 4X66F 1NB2A 3PJXA 2DRBA 2D1CA 1X4FA 4ZN3A 3DRPA 2HKEA 4YY3J 1T02A 2H51B 4O3RA 4DQQA 3CT9A 1YJRA 3NS7B 5JUMA 4RBTA 1UKUA 5LSRA 1NPPA 2J9DA 1B0TA 4JI0J 4F0HA 4B3SF 4PPDA 1D09B 2CJ9A 4JI6J 2ZHOA 3LF0A 1SV5A 1PJ6A 1VQLS 3EVOA 1RYSA 4JV0A 2VU5A 2IA6A 3VVTA 1DLOB 5DM7Q 1FEEA 3DLLQ 5E3PA 3AB4B 1RWNB 1XMQJ 1OPZA 5F8IA 3MPDA 3D0IE 2EKYA 4MKAA 2LU1A 1VC5A 2AZ1A 2PDAA 1FKOA 3TUIC 1PYOB 3IBFB 3OHBA 4LF8J 3IG1A 1NO8A 2CVIA 5M2UA 2MLYA 3TJ9A 1S97A 1ZM3A 2VD3A 1X8DA 3BZQA 3BQ0A 2HRUA 1JLGA 3HHKA 4ZLJA 5EGYA 4QCLA 3IWLA 3VGTA 4ED7A 4QWDA 1U0HB 5F9NA 1HBOA 5L8RC 4YB7A 4ECZA 3H8YA 2YKMB 2R2RA 2ZH3A 3QO9A 3OBIA 3EGVA 5LXRA 1QVFR 3UD3P 5M2RA 1SQEA 2CPFA 1OYDA 1AW0A 4V19X 3DRRB 2H65B 4K59A 2M4MA 4X4VA 3A3OB 5CQGA 3JYTA 2M8DB 4WP9A 2W2QP 4UOCA 3L95X 4KH0B 3DLKA 1NZ8A 4GO5X 5KG7A 3ZZ0A 2O1PA 2QIFA 4DLEA 1JLEA 1CQNA 3PW4A 1FDAA 4DN9A 2MJNA 3DOMA 2M52A 2BABA 4OZ0A 3GR1A 3KHGA 1RAFB 3ITHB 3V6KA 1IBCB 3KLHB 3CDEA 3M30A 2VDIA 3GP9A 2HBZB 5HLFA 3EMTA 1SJFA 2KFYA 4DV5J 5EX3A 5U47A 1YRXA 5F8LA 2F40A 1HIYA 3QJPA 1VYAA 4N8OA 4I1TA 2WSEC 5L1IA 4RWWA 3C16B 5E3CA 4Q8EA 3JSRA 2N4CA 1VQ8S 4LF9J 4LSLA 1FJEB 2XYPB 2HGMA 4DX8H 1A9NB 1WSRA 3CJ5A 3VQTA 4OL8A 4OLPA 2GGPA 3SSRA 1XQIA 1UPPA 4EO8A 2D41A 4O3SA 1U2FA 4H4MB 1M5SA 3H90A 1YJUA 2C2DA 1TAUA 4TQRA 5HJXA 2UUBJ 5DLFA 1FXDA 4OI0A 1RISA 4P2MA 5DGAA 5HANA 1KTVA 3ZTRA 3KUEA 5KFGA 3HDSA 1F9HA 3MM8B 2BQRA 4OJ3A 1VQ9S 1ZYQA 3VAJA 3J80Y 1ZS6A 2ZH5A 2NPFA 3CJTA 1UFLA 3LOUA 1M5KC 4LRBA 3VQSA 3RW6A 1HMVB 5IV3A 2ZD1A 1VC0A 1NK5A 3BO4A 4X4TA 4P2SA 3V6DB 3M8QB 1GFWB 5KFZA 1OY6A 2X7IA 3HFKA 1H98A 5L39A 2RAQA 2ZC3A 5T7LB 2GQCA 4USWA 1TKTA 4ED0A 3T9ZA 1N52B 1NCLA 2FJWA 2YH1A 4XTTA 2NR0A 1P6TA 5G0RB 4QPTA 3D6HB 1EKSA 4Q43A 5DDQC 1S1WA 2XG8A 3LW5C 4K5SA 5GAHI 4NXNJ 4PXBA 2VFVA 3OUYA 1VRTB 4QR0A 3SQGA 2B9XA 4WYLA 2K1RB 4PABA 1N54B 4MH8A 4QYRA 4P73A 3L3CA 1NB7A 3GV7B 1RSCA 4WTOB 2VQFF 2CQ0A 2Y9HA 2C2ZB 2D9OA 4X66J 4DF4A 1S5ZA 2HQIA 2P9GA 2IDLA 1UVIA 1Q8LA 4FF1A 1S6QB 4LRAA 4TY9A 1HHSA 1S4EA 2OMOA 3U7JA 4F3OA 2MSTA 2ROGA 3GWCA 3QBCA 3IRWP 2RU3A 4PG8A 2W2PP 4WF9Q 4RBUA 5J1EB 3KTQA 2XMMA 3D67A 1HL6A 3O6QA 5HI7A 4R25A 3M8SA 1CS4A 1F5AA 3MGJA 3OR1A 2C2MB 2LKZA 1GH8A 2YNGB 4J9PA 2I5JA 3AFGA 1X0FA 2MKIA 2DXFA 3KYLA 1JLAA 2VBWA 2BJ7A 1SB6A 1SJ3P 2X1BA 3MAQA 2E5LJ 3UNYA 1FESA 3RUBL 5GMKa 3N28A 2LXIA 3M8PB 1Z4UA 1HBUB 2PA8D 1SBRA 2ZE2A 3TEGA 2XMWA 1RT3B 3V6HA 1T9WA 1VQ4S 1X4CA 3SXLA 5GMDA 3FKBA 3CEDA 2UUAJ 3MM9B 1WACA 2HFZA 3QYYA 4QWEA 2MZTA 3SFGA 4X4OA 3DI6B 4G6VB 3FSXA 4GKJF 1UFKA 4DG1B 2OHDA 3B6BA 1C1CA 4PXCA 4PWDA 1XK8A 3MOZA 3QJJA 2X1FA 2GNKA 3RGIA 2R42A 3QIPA 1RTJA 2LQ8A 3NBPB 2N82B 1HWLA 3DOKB 1BGXT 1UMJA 3BKUA 2VG6A 4WFNQ 4ZVSB 2K06A 3THTA 1DTQA 1TUVA 3TAPA 4K2JA 3R1LA 4P2XA 3M2UB 2YKAA 4IR9A 4DPXA 2G9OA 3PNIA 3MPWA 1Y4ZB 1FEHA 3UCGA 2DVIA 1CC7A 2DEJA 2FJDB 5J2QB 4DU7A 4Q45A 4B9NA 4OI6A 4ZN1A 4AXIA 2FLNA 3BR8A 4LF1A 3MCSA 2BV3A 4LF4F 5SZTA 4TY8A 1TV6A 4IOBA 4B9SA 2Z30B 3CNQP 3H25A 4OJ1A 3DXSX 4ED5A 5JVGQ 4PRFA 2Y1JA 3I5CA 4XAKA 3PCOB 3EVWA 2CQBA 4FPRA 3BYPA 3KK2A 4FYVB 4IKAA 3DLGA 3QJLA 3D5MA 4LFCF 1OYEA 5D0EA 2Z0GA 3CCQS 2J7WA 4DR7J 3PY8A 3HHLC 3HFVA 5HO4A 1KEKA 1GXTA 3ZZTA 4QZVB 1WOSA 4FPIA 3EM1A 1KQFB 4A48A 4C98A 3VALA 2R9LA 4JI3F 1X5OA 2ASDA 1FE0A 4ECXA 5KFPA 1YHQS 4G1QA 1LQ9A 2R8KA 2Y0BB 4X4NA 2AGQA 2BJ8A 4C0HA 2XEXA 2GS8A 3FZ2A 5IT0A 2J0XA 2PI4A 1B7FA 3TZYA 3RZAA 1U6FA 3SV3A 1N88A 1KTQA 1VOMA 1RTDA 3W9IA 3AH6A 5HVGA 4KT0C 3OJUA 4JI4J 4JYAJ 4DX7A 5K8OA 4ZPWR 2FHJA 1AYEA 1JXVA 1GX5A 3UWTA 3OVSA 4M5IA 5D77A 4WFXA 2KHDA 1MU2A 2F3JA 2KJWA 4ZMMA 3UVJA 1C1BA 2VQFJ 1MW7A 3HULA 3ZFVA 5IXUA 2AJ0A 5BXIA 4EZ9A 4CYUB 3GV8B 5HATA 4KKOA 2F8EX 1IBKF 3BF4A 1GTHA 1WG5A 1WD6A 2XHCA 3HI9A 4GC7A 3N5FA 2JEJA 1N5YA 5KFIA 1ZETA 4DS4A 1M0SA 4EO6A 1HPZA 4FXVA 2GW8A 3K8VA 5T14A 3M6UA 3Q8SB 1F9FA 3PW2A 1EIYB 1NDPA 3PACA 3FZBA 5B0GA 2HHHF 3W8PA 5E33A 4TKTA 3ONQA 1LFWA 3DOLA 1RJJA 3TVZA 4K4SA 1VK3A 3O8WA 3K2YA 1NEEA 1RKIA 3ZTPA 2AKWB 2ZEJA 1P27B 1TL5A 2ATCB 3NOCA 3CW2C 4JI5J 1MG7A 2HGNA 1HR0F 3MM7B 4W4MA 2V94A 2VBXA 3S1TA 1RAEB 2J9EA 3AB2B 1FKPA 4CO1A 5LMNF 5KFVA 3BKFA 4DUYJ 1CJVA 4P71A 1VBXA 1VQ7S 3BSOA 1MWQA 4OZ2A 1RCOB 1JJCB 5DO2A 5AXLA 1H72C 3QT6A 3K59A 1KQGB 2Z2YB 3R5JB 1LXJA 1DTTA 3W63A 2FJXA 2HFUA 1C4AA 2DRAA 1TP7A 4EUVA 1FE4A 4GKJJ 5L1LA 4JI2F 3MMAA 2N4DA 3R1HA 4PG7A 1LW0A 3IM9A 2DNLA 3W65A 1SC3B 4I7FA 4KC5A 4YMEA 1KHWA 4G1IA 3QT8A 1IKYB 4DL3A 2V4JA 1RHMB 1NPRA 2W9BA 2LU2A 4FYDA 1RAJA 2G0IA 5KFHA 2ADCA 2XY7A 1TU0B 2A1BA 2OIHA 2Z4PA 1LWXA 5D6GA 4AFFA 3MMBB 1RLDA 5KFDA 1VGYA 5I3UA 3OFFA 7FDRA 4WPAA 3I5AA 3HVTA 3KLFB 4CLPA 3CJKB 1N36F 3N5BA 1YJ9S 3Q8YA 2AX1A 2YX7A 5J2NA 3KJFB 5GAEU 2BM1A 3D66A 2MGZA 3H5SA 1ZPVA 4LF4J 2LLZA 2CQIA 1VS3A 2IM1A 2RT3A 3BPDA 2V8HA 1M90T 2M7SA 3HXMA 1CJUB 3TVKA 1FDBA 1RLCL 4C8NA 1RAOA 2YNHB 1H0HB 1X5TA 4LR8A 2MLXA 3FCHA 4JV2A 2Z58B 3JTOA 4N77A 1TK5A 2VFTA 3LGMA 3WIUA 3WIVA 3GG0A 3SCIE 2Y0SD 3PXGa 4J5OA 1RZMA 3T1AA 1EX8A 1FO1A 3QRPA 3KJQB 3K5PA 2EK6A 1X9WA 1ZA2B 2ZITA 1RHJB 4X62F 1S49A 4UOFA 1U48A 3KFWX 4YUDA 3VVUA 1CPZA 2L9DA 3FFIA 4U9RA 3E51A 3R2CJ 5HN0A 4RX6A 4M5HA 4DN0A 4ZPDA 4RW6B 4G3IA 2MEWA 2M0GB 2AYGA 4DDFA 3VCDA 2DT9A 2APOA 1R8PA 5AE1A 2CKWA 3FQKA 3D2WA 2W7OA 3EGZA 2N3OA 5AE3A 4NLPA 1IR0A 2GV1A 1URRA 1XNRF 3AJ1A 1BWEA 1U45A 2LXFA 3CCES 3HJFA 3HM9A 3G82B 2CYYA 2D3O1 1B70B 3W66A 2E5HA 5L46A 2BACA 3TUJC 1TKZB 2AEMA 4ED8A 1N6QA 5FLXY 4IDKB 4U96A 4YDXA 2C2RA 3H59A 3SDEA 3GFXA 1NJIT 4K4YA 2YWHA 1U09A 2F7VA 4NRTA 3I0SA 1I51B 4ILMA 1HBNA 1KLMA 1XMBA 3MEEB 4HLBA 1IBKJ 1T94A 3GTYX 3OLAA 1U6BA 4XPCA 1AXQA 5A0YB 1SKWA 2HWIA 2ZBQA 4F0KA 3MR2A 1JKHA 2CJKA 5KTQA 2V68A 2MZ1A 1FRKA 1TKXB 2IC3A 1M5HA 3FJ2A 3GONA 4RLEA 3SI8A 1NKBA 2KKHA 2CZ4A 5EWGA 2OO4A 4PQUA 4DZ6A 4NA2A 1S1TB 2KT3A 5A6PA 2VA3A 3IR6B 2IVYA 5DETA 4AL6A 2XWYA 1HYSA 4A8WA 4NWBA 2ZJQQ 1RT2B 3W9HA 2DNNA 1IR2A 1WC5A 3RRGA 3KNAA 2AP6A 1SKRA 1SUQA 2QFIA 5C24B 2BE7D 1T03B 1F60B 2RS2A 3C14B 2B6AA 5A8WB 2RQCA 2R7RA 5F8MA 1S76D 3IGVA 2I38A 1EKRA 1SH3A 3OSNA 3I6PA 1UA1A 2EW9A 3MR6A 3ZXWA 3AT1B 3A3NB 2CIMA 1BE4A 1UEKA 1SJRA 1NSQA 2C2NA 2EFPA 3QIDA 4ZVHA 2IHR1 2D74B 2IRXA 4WBFA 4JI1J 2MY8A 3JS9A 5AT1B 2GHPA 1FJ7A 2RB7A 2RRNA 3ADAC 1W25A 2XO6A 2SXLA 2HWHA 5IC4B 1NAQA 1RUSA 5ADZA 1IKXB 1FX2A 3UR3C 4ECWA 4HDGA 4CI0B 5DLGA 3CMAS 3TJAA 3ZTSA 4KGVB 4P75A 1FTCA 5D8HB 1J5EF 2UVVA 2YKNB 2UZAA 2B4OA 4I2PA 2E1MC 4P52A 3GIKA 4WFAQ 2I0XA 4FZVA 3TARA 3GIJA 4NXMF 4YHHJ 2YBVA 3MM5B 2V8VA 1N0UA 1VR6A 4UTGA 1H6KX 3OTCA 3ULHA 3J80U 4DCJB 3HF5A 4M5DA 4ANCA 4ZK7M 1LNQA 1NRKA 3H40A 3DRPB 2VOOA 3WC0A 4USKA 2KTQA 4K8RA 1NH7A 3HSJA 4NOHA 2D7SA 2VKZG 1I94J 3EGWB 1PKUA 1B3TA 2NXUA 2WVDA 1RA7A 1N48A 2JFDA 1RXOB 3PHTA 3OQ2A 1SV5B 1VQOS 4DR3J 5GADU 2C2KB 4NE9C 2EEYA 1WHVA 3FEXB 2IM2A 1DQ9A 5L1KA 1TL1B 4WK1A 2W9CB 1F3VA 3DMJB 2WAQD 1TL4A 5CZVA 1QSLA 3Q89A 2YWWA 4C48A 4F36A 3FEZA 4LUBA 4CQ1A 1L3UA 4X62J 4USIA 2RH3A 1I6JA 3HKZD 3MD3A 1DQ8A 1JLGB 1U0HA 3LQVA 4M5MA 2JEFA 4Y6IA 3H98A 2RNEA 3Q8QB 1GT8A 3I56S 4ID5B 2F5GA 4JI8J 2YKMA 1HBOB 2DNOA 3TA2A 3PRBA 4USTA 3MAAA 2ASJA 3QO9B 4MJKA 2DISA 3DRRA 3TQEA 2JEGA 2CPXA 3OVAA 4IH7A 3Q8VA 3M9NB 2D3ZA 1SIZA 3AAWB 2R8JA 3R8YA 2KZMA 1BMQB 2CPYA 2MSSA 1CBKA 3GYXB 3NCPA 1H38A 3HSDA 1Q7LB 1AROP 3JYTB 2O01C 3DLKB 3BO3A 2CJXB 2OEJA 2HLUA 1FWKA 1HNVB 4USHA 2O66A 4Y2CA 5KG2A 2QGFB 1JLEB 2NQPA 1UW4A 1X4EA 3KLHA 1HW8A 3CCLS 2RDIA 3CC4S 5IS2A 2YX1A 3N6LA 4NLVA 4EMDA 4OYOA 3OFHA 1PAEX 1F3FA 1S0OA 3OW2R 3SCKE 2F9JA 2KDOA 4N76A 4F4WA 4TU7A 2A10A 2CG8A 4ECUA 4S0MA 1VC6A 3C16A 4ZCMA 3JAMY 1NKCA 1OS5A 2JSXA 4DZDA 1FRMA 3CULA 1C0UA 1WC3A 1DZ5A 3M4XA 4DS5A 2HYIB 1S6UA 2ZC4A 3N6NA 1RADB 1R8BA 3TQ1A 3NL0A 1LWEA 2ZNZA 2ZNYA 4WCEQ 4LSLB 3OL7A 1SKUB 2XHWA 4DL5A 2GMJA 2KH9A 3M32B 4RJVA 3PVXA 4RW9B 3Q2TC 3MM8A 2DXDA 2R7SA 1T9UA 2UXBF 2QC3A 3MMCB 3IM8A 1IM4A 2J9DE 2OH2A 3KG4A 4JUZA 4DV0F 1YGYA 1IBMJ 2ASLA 3V6DA 1OJ4A 3M8QA 4CLLA 3DN9A 2LA6A 2V8PA 5T7LA 4J9UE 1A0OB 4J9SA 1RT4B 4NYOA 5IM0B 1FNOA 5DDPC 2UVWA 5ITHA 2ZH6A 2BZ2A 2ZH8A 2GO9A 4U67Q 3K8WA 4DCPB 1QTNB 4PPZA 4DR5F 3KG0A 2UUTA 2DNHA 2L41A 2C42A 5KT4A 2HW3A 2V5HG 1C2PA 3OL8A 5HQ8A 2UVUA 3OFEA 2V6AA 5G0RA 2B51A 2RQ4A 2V9WA 5GAEI 3JSYA 1U1OA 2QV6A 1MROB 3LWMA 2BA9A 5HBMA 4ECQA 4R0JA 2B9EA 2R8GA 2AJ4A 3RBXA 4CNYA 4KO0A 3UR0A 2K1RA 5KG4A 4IG3B 3FEYB 4FBUA 4C3KA 2OEMA 4B3MF 1N4LA 4DR4F 3MCOA 2LDIA 3TYTA 2H9ZA 5HMXA 4LF5J 2DGTA 3G87A 2HMIB 3PEHA 1BXNA 1NZAA 3GYGA 2G2OA 2E44A 1VBZA 4BWJA 4F50A 4ZVFA 3PEJA 3BBCA 2DNZA 2BJ9A 5J1EA 1KONA 2PGCA 5A6WA 3CF5Q 1IBLJ 2DITA 1Y00A 1VK8A 1XMOF 4ZPCA 2MDAA 2EKNA 2DHXA 1REGX 1HKAA 1CS4B 1FHTA 4IQMA 4J9OA 2YNGA 1KNZA 2E1CA 4DSFA 4R8UA 2L9NA 2WBRA 1RAGB 4WZQA 2I5JB 2VPYB 2POKA 4N56A 3H5XA 3UW1A 4K4UA 2CPIA 1JLAB 2R7VA 5ETMA 2ZH2A 4NZ6A 4O4GB 1N34J 4ERDA 2LEAA 5T41A 3DLHA 3GCXP 2EG1A 2V2VA 3M8PA 3IRXB 2AWZA 1HBUA 3NS5A 2BOPA 4QR2A 4HKQA 1M5OC 1ZA1B 2DO4A 3GMGA 4QU6A 1WEYA 3T6JA 4LR7A 4OZNA 4DLGA 5CZXA 5F0UA 3IR7B 1M5VC 2KN4A 1R7IA 2CG4A 4FYYB 4HDHA 1KC8T 5LMUJ 5CYQB 4DV2J 4FXWA 3DI6A 1NUEA 4USJC 2DY1A 2ASYA 1HNXF 1EAYC 2FZKB 1HHTP 1TTHB 5A2QU 1NJXA 1TK8A 3NBPA 3FSIA 1C1CB 3BS9A 2ZHBA 4DSKA 4PWDB 4ZPVR 1RTJB 2C22A 3IS9B 1K47A 4DL7A 3MPYA 4DV1F 5KG1A 2HHSA 4ZJOA 3P4UB 4IFVA 2FUG9 4CH0S 2VG6B 3M2UA 1FT8A 1S57A 2FJBB 2W4CA 3W5YA 2BANB 3OT9A 4KAIA 2HVEA 1T9TA 3D0HE 2OPSA 3PRDA 3D3BJ 4KYZA 1X60A 2W8KA 4OYBA 2VQEF 1UZDA 4H4KA 5DG9A 1VQNS 5DQIA 3CD0A 5LM7E 1VISA 2VFSA 4RW4B 4FKXA 4ES2A 1XR7A 2M8HA 2HIQA 1U0SA 3DLJA 4E8UA 2DPJA 1FWLA 2DCLA 4P74A 1ZTTA 1S0NA 5KG0A 2RRBA 4USMA 1B0PA 2EC2A 3OHAA 1U8SA 2XB2D 1SL1A 4AT1B 3KK2B 1Y5IB 2HNYB 2XSJB 2I6WA 5K14B 2XZTB 5J2PB 3D6MB 4C6AA 3FDSA 2C3PA 3CD7A 4CM2A 1H2TZ 1M1HA 3HSGA 2FB0A 2AEFA 2HAFA 3Q24A 2P2CB 1VRUA 4F2RA 3C2PA 4K7QA 2NLWA 2UXDF 4DMZA 1WKJA 4ZVOB 3MPUB 2QT7A 4ZP8A 1YX2A 2A2CA 3HZEA 4UT4A 2C1EB 3E01B 5KFUA 2IA0A 4CRJA 1SH0A 3I0RB 1NJYA 4LBIA 3KLVA 3T1YJ 2DNRA 2HHTA 3R3TA 2CQGA 4WZMA 2HVHA 2EWHA 2CQHA 1XIQA 1V9OA 2ADBA 4DR6F 2RE1A 4K2XA 4PAAA 1CJKB 1HBMB 2X51A 3C6TB 1IJFB 2JC1A 3NCRA 2W9AA 2RUGA 2AIRB 1ZM4A 1RT5B 2DGUA 4YP3A 4DR4J 3J81Y 1HNZF 2FQQB 3FRZA 4FNHA 3VHQA 2VB6A 3KUGA 5GADI 1S9EB 2DY9A 1U6ZA 3CC2S 2ZBRA 1C1BB 1D3WA 2RIJA 2HQGA 4QW8A 2ATLA 1U47A 4KKOB 5KFCA 2DR5A 3K89A 2F65A 1TL3A 5BYQA 4A8FA 2YPYA 4OYMA 2H48B 3R27A 2QLBB 2YTCA 3ISZA 2ZH1A 1O5JA 1XMOJ 4OHYA 1U26A 4LF7J 2P9CA 2BJ3A 3GV5B 2DK2A 5B0CA 4E98A 2NCKL 3AA9A 2MZRA 2V4QA 4ECYA 2LYVA 2IMWP 5MLCV 2M88A 3LAMA 1D1UA 2XS7A 4LVOP 3AY0A 2AJQA 3MM7A 2JRSA 4KPCA 3P49B 3EJMA 1VRQC 2ZVIA 1FK9B 1Y3KA 5ETPA 3PIOQ 2VKRA 1RP5A 1U24A 2BYCA 3PYEA 5C25B 2GVZA 4ETZA 3FBCA 3CJ3A 3OVBA 2FHMA 2X1GA 3CCSS 2NUHA 4P2FA 3ELHA 1FKPB 3PV8A 4EBEA 4X4UA 1EQ0A 4K4ZA 1ACMB 4DV7F 3EVMA 3EICA 4NMLA 2FVCA 3RB4A 2O67A 4RW8B 1WI8A 2HWTA 5BJRA 3HFZB 2Y1IA 2EXUA 2R7WA 3BGOP 3N0VA 5K8PA 3PYDA 3ZNUA 3D68A 4AE5A 4RNNA 4ICLA 1KKHA 3WX4A 1VQKS 1PJ5A 2BJEA 2RDJA 1YTYA 3MMAB 2QMXA 1TFYA 1IKYA 3CWJA 1LW0B 3PFOA 3JB9k 3J7AN 1T9XA 3UDCA 2CQ2A 2GFFA 4OI3A 2V4JB 4QIEA 5KFOA 3FBBA 2W9BB 4GC6A 2WVEA 5HMWA 4HT5A 1FFGB 4P10A 4M95A 4YS2A 3TAMA 3Q83A 3MMBA 2KM8C 3J7Z5 3H2LA 4QIWD 3KLFA 3CJKA 1B64A 3KKFA 2FY8A 5I3UB 1D8YA 3QZ8A 5KFFA 4WIIA 5KFRA 4UW2A 3UPFA 4DBQA 2VQEJ 1DY3A 1F0XA 2H5EA 2B9WA 1E6VA 4Q44A 4MTPA 2MGZB 5IFMA 1CJUA 5EN1A 4DI6A 1PIEA 3ET6A 5ETLA 2JOQA 2R8IA 5KG3A 2EFQA 2VODA 1FRHA 3VAKA 2W2NP 2EFOA 4LJMA 1Q1KA 5CCMA 1XJWB 2D9PA 1DAXA 2F63A 4EBCA 1P9YA 2V2ZA 4F04B 1XC9A 3GR0A 1L5UA 2E29A 1O8BA 3GG1A 3THVA 1S1VB 1VDHA 3UNGC 5JJBA 1HWUA 3UDLA 3P8BB 1EARA 2N7CA 2VJVA 4Q2MA 1RAHB 3WHIA 3DRYA 4I6WA 4P7TA 4Z37A 1ZBTA 3RBZA 3AQOA 1RT7A 2HQFA 3MF5A 2MKCA 2GJFA 4URGA 3RBDA 2ZBIA 2VFRA 5CD4A 1A7GE 1TUGB 2MTLA 1KVIA 4QOTA 5CYJA 1VQMS 5DZ7A 2PMZD 4WE1B 4ER8A 4B9LA 5C5JA 4C2MA 4RW6A 1MNEA 3MFHA 4ZIWA 3NNAA 1XR5A 4GKKF 4NLYA 4HL9A 4P72A 4WKRA 4MAKA 5BR8F 1S99A 4OIXA 1F1BB 4KHPF 1XERA 2HSEB 4L3KA 5KFTA 3FMWA 5IT4A 4WFZA 7AT1B 3G82A 2VONA 2KZZA 1KFSA 1U2RA 4QQBA 3EDRB 2DRDA 4ZLPA 5KT7A 3ZTQA 2B3TB 3JQKA 1L3SA 4MKVA 5KFSA 1R8CA 4DL0C 4IDKA 2GCFA 3TR5A 4FP9A 3CCTA 2UVRA 4DUZJ 2J0WA 3KK1B 1DHMA 1KFDA 3FBFA 2W24A 4LRDA 3ZZZA 3MPVA 5JVHQ 2XGQA 3SDEB 1S6PA 4NLGA 3MEEA 4QIGA 5DM6Q 2QFJA 2WW4A 5F3ZA 3BV8A 2MQ8A 5RUBA 4LMZA 1HHQA 3M05A 2UU9F 4FF3A 2I1RA 2LVWA 3DU5A 2WBMA 4LSNB 4IH6A 2NZCA 1EQMA 3MHYA 4TLRA 3TAQA 1U1MA 3BDEA 4NI2A 1L3KA 1TKXA 4WXWA 1HQUB 1NMEB 3K5OA 4LBPA 2MKYA 2D3UA 2A6MA 1H2VZ 1PBUA 2H3EB 2LEPA 3EE3A 1ZM9A 2IC3B 1V5IB 5A76A 4J9RA 3ILOA 4EI2A 1TR0A 1RU2A 4Y2AA 2QYGA 3MR3A 4EZ6A 1RAIB 2KYZA 4PQUB 4LQ9A 1U1NA 2KYXA 3CD5A 4DFMA 2GVDA 3RB6A 4ECRA 3LUYA 1Y11A 1BC6A 3G8SA 1Y5NB 1HYSB 2NS1B 3MECB 3DDNA 3V4IB 3ILIA 2VDHA 4F26A 3DHXA 1VBYA 4C8OA 4KPYA 1G1XA 2PMWA 3UFCX 3R2DJ 2CJYB 3NNCA 2FHKA 2E66A 2V34A 3M8RA 1TK0A 2F4VJ 3H5UA 4LBHA 2E1PA 2YNFB 2FHOB 4RU2A 4CTAB 3LPYA 3G6ES 1SJQA 2G1HA 3E3XA 1RT6B 1RBAA 1WNEA 3R7NB 2MZQA 2IMOA 4LR9A 5B08A 1WF1A 3PRVA 2CZVC 2E1RA 4J9LA 3JAMU 3L7OA 4ZVUB 2H5JB 2XS5A 4CO0A 1SJ4P 3DFEA 1NJZA 4OYAA 2P9EA 4ANDA 4CO5A 3MEGB 3D0GE 3BR9A 3UCZP 1ULRA 4C9DA 1Y5LB 1O0PA 4V1Ak 4I67A 3W7BA 1U4BA 2DTJA 3MM5A 2QSWA 3Q8PB 2AV5A 3CPWR 2WB1D 5DJBA 4H4OB 1WKKA 4DSLA 1XNQJ 2RU9A 1WUUA 3DNCA 2HS3A 3E8OA 2JZ5A 4RBVA 5EWFA 3POTA 1QAYA 2HK3A 3FGVA 2CA9A 4M5DB 1AZSB 3A1YG 3A12A 5KFLA 1Y10A 2W2OP 2WRMA 4MYUA 4ZLNA 3Q8RB 3GCWP 3R7BB 4I6YA 1P8GA 3NRBA 2H54B 4G65A 2VUGA 2PD1A 1F6TA 2QO3A 3MTJA 3DLBA 5KG6A 2LA4A 3JSBA 4XDCA 2P8IA 3KDNA 1F9EB 3FVYA 3Q2SC 5HP1B 1DQAA 1TL1A 2W9CA 3DMJA 1FTRA 3VAGA 5KFBA 1L3VA 2PEHA 4KGKA 4ED1A 2G0CA 4OX9F 4OZ5A 4IQXA 4HHHA 3T41A 5EDWA 3FQLA 1RWKB 3GU0A 5KFKA 3QQCD 3DXBA 4F4AA 2E1AA 4U8YA 4KHRA 2EFGA 5C42B 5J1NA 3OXFA 2KFZA 4ID5A 4GKKJ 2AGPA 4DR2F 1UFWA 3A8EA 4DSEA 3PTWA 2MQQA 1MWZA 2VL1A 3QT7A 5I42B 3A4TA 4AL7A 2WHOA 4ZCLA 4DPUA 4TXSA 1SQGA 1NSKL 3V81A 3MAAB 2XQCA 4OYWA 3J81j 1VMBA 3NEKA 1JK9B 1TFWA 3C6UB 4B9TA 4DR1F 3CIZA 1WDDA 4DPWA 2R7QA 1HNVA 2E5GA 4RZRA 1QAXA 4TVAB 2ZJPQ 4A8QA 3CCUS 2JLFA 3PDNA 4KV8B 2ZWPA 3VR1A 1JIHA 3V5RA 3GB0A 2XC9A 4F3MA 2FD2A 2W7AA 2UU9J 1R0AB 4RUBA 3K17A 4OHVA 4DL4A 2LMIA 4MIBA 3TNVA 2CPHA 4OMFG 2OPPA 3H7HB 5KOWA 2IPOB 2V2QA 2DKOB 3M2RB 3F73A 2N3LA 2P6SA 3CJ2A 1QVGR 2P5VA 3R5BA 1C0UB 2CAJA 1QE1B 1NJWA 4XO0A 4MK8A 1LWEB 2UUCF 3M32A 1UP1A 2LQ9A 4NLWA 3ZZRA 4AD6A 3KMSA 4RW9A 1WEXA 2ZZNA 3QLHA 4DL6A 3WQPA 4NX9A 3Q86A 4C97A 1X9SA 2JFKA 5CYMB 4USVA 4CLZA 3CMES 4JB8B 4Q7AA 1L3TA 1PC5A 1SH2A 3MMCA 3I5BA 4ZCKA 4RPFA 2IJNA 2MZSA 2JNJA 1HD1A 3KLGA 4LFBJ 1OSDA 4DU8A 2NUUG 2QE5A 4AQYF 3RAMA 1IWGA 2HS0A 2ABYA 4MKBA 4O4RA 5AJ3J 4YR3A 2XNRA 1RT4A 1OY9A 5IM0A 1DBDA 1NBEB 2ZUAA 1E6YB 3GIRA 2BKPA 3I32A 3MZIA 2AZ3A 2GO8A 4U95A 2ZHAA 1YK9A 2VG5B 4Q0BB 1PJ7A 1X0PA 2VBZA 4HHJA 3TX8A 3AJ2A 3G9CA 1X4HA 4DEZA 4ECVA 5C7PA 1YSJA 2CNLB 1H74A 3EPGA 1NXIA 2J9CA 4EBDA 5HROB 1MROA 1JXLA 1RT1B 3CJ8A 1SL2A 2E7XA 3MURP 1MSWD 2G4BA 1U1RA 2CDRB 3NWRA 5MAOA 2A3JA 2I8EA 5HBMB 2OLWA 3CCJS 4IG3A 4C3LA 2YWGA 2Z2ZA 4MFBA 4I6AA 4KO0B 4OZLA 4ZP7A 3K5NA 3I4PA 3O2IA 2CVEA 4FKYA 4QPXA 2DH7A 4DV4F 3BN4A 4O3PA 1EETA 2OUGA 5B0EA 2EFNA 2JDJA 4HHUA 2HMIA 2B8QA 3OL9A 3PKYA 1N32F 3TOQA 2CQCA 4KY3A 1X31C 4NCGA 1MMDA 2MMYA 3P45B 2HBYB 4FBTA 2G13A 4TN2A 4M63A 1G7CB 4B3TF 3DRSA 2OP5A 4B3SJ 4UY85 1XTZA 3L09A 3BSCA 2GIRA 3OXGA 1WC4A 2DNMA 2I9SA 1JJ2R 3NGSA 3KHHA 1SKSA 3MR7A 3FMBA 3QGPA 3K5MA 1RHQB 3CB4A 3FK4A 3T5KA 4HTIA 1NU4A 1BD6A 1IKWB 4HACB 1JLBB 4K4VA 2J76E 2UV8G 3VV2B 4FS2A 4R8UB 4W90B 4YFUA 4OX9J 5K20B 4O4GA 2CQDA 2Y1LB 3OJSA 4NA1A 3IRXA 3TA1A 1RHRB 4AXJA 1U49A 2NYIA 2QL5B 2JH3A 3BYRA 4IRCA 4B3RF 2GMHA 3A13A 5LSOA 1F2HA 4MKYA 2V9KA 4EFAC 9RUBA 4DR2J 2BXJA 1OWXA 1JLQB 3J81U 2A0FB 2V63A 3BN7A 1A6LA 3G86A 1CQMA 4ZITA 5CYQA 1V6HA 2VBYA 2C3YA 3O5TB 1KVKA 2HQ3A 2HG4A 5HSPA 1CEZA 2VH7A 2ZBPA 4C7QA 2GJ2A 3BSNA 1WF0A 2CFXA 5ETTA 5K8MA 2DR6A 4M5JA 4DHVA 2B9YA 2NREA 5KFMA 1NDKA 3A8JA 3OR2B 1X4DA 2FC8A 3IS9A 5H1SV 4ELVA 1NK9A 1IN0A 3TJ8A 4UZBA 3B82A 4WYWA 2EC0A 3HZGA 2PA3A 1C4CA 3CXCR 2GMLA 3R6LB 3VZIA 2QG9B 4LRFA 3R5AA 3MXHP 4IFVB 4KE5A 3SV4A 2BANA 4QWAA 2ILYA 1OIAA 2NXCA 2NXJA 2MQLA 1PO6A 5ETNA 4H4KC 4CCHA 4DV6F 1Q7YT 2OPSB 4K4WA 3P5TL 2MYFA 4PCQA 3I87A 4RW4A 3QZ7A 4DPYA 4NEZA 1T8EA 2HHVA 4R0EA 1LK5A 5D0RA 2ZKUA 3OTBA 2LECA 2FDNA 2J0QD 3T6BA 2RMLA 4B3OA 2W25A 4CLSA 3BGRA 4CWBA 2JC0A 3AOBA 2RVJA 4A8SA 1EP4B 3EX7B 4N5SA 2H4WB 2HNYA 2XSJA 4O3NA 4FF2A 5K14A 4J91A 1RHKB 5J2PA 5F3TA 1GX6A 4NLOA 3TZWA 5F8JA 2XMUA 2DYAA 3NXZA 2G1DA 3OV7A 1VRUB 5K9FA 1YG0A 3JXOA 2E7WA 5E7OB 3AD9C 1Q82T 4C8YA 1KS2A 2EPIA 2V67A 4JV5F 1CVJA 3V4MA 1U02A 1UJ5A 4U7UD 2B4VA 3E01A 2OGUA 2CQ1A 1F5BA 3ZZUA 2PE8A 4JV1A 3I0RA 5HMYA 3RAXA 1I1GA 2Z2MA 1D9FA 3UI3A 4F0MA 4ES1A 3IXQA 2O5DA 2JHEA 1KQKA 4JI0F 1CJKA 1HBMA 2DGSA 3GJRB 3C6TA 4JI6F 3TA0A 4IOCQ 2QA4G 2IAJB 1RI7A 2DH9A 1RT5A 4YR2A 4CO3A 2LXUA 2RF2A 1XMQF 2KT5A 1D0EA 1S9EA 2GHWA 4BDPA 4RW7A 4LFAF 4LF8F 4CT8A 1GEHA 1N32J 2RRAA 4Y2IA 2MLZA 1R0CB 2MJUA 1WWHA 1VBKA 2R2SA 5E3RA 5A2QY 3CDWA 2QSFA 4LQ3A 4J9VA 3M1VA 3LAKA 3U27A 1TL3B 3CGIA 2CPJA 2FIUA 4LREA 1X4BA 2EBEA 2BQUA 1RQ0A 3RRHA 5D0GA 2J6UA 1LWCA 2DNYA 3I31A 2GA7A 4NASA 2QL7B 4QR1A 1G3OA 2MB0B 3RU0A 4USUA 2CXEA 4PEOA 1NM2A 1N0VC 1WELA 2MKSA 4HT7A 1FK9A 2XI2A 1HQ2A 1RKJA 2MQOA 2W4PA 1GMWA 4NLDA 5FJ4A 2V69A 1YIJS 2RKIB 5C25A 2XYHB 4NMXA 4F7VA 2OEKA 3MTKA 1FX4A 2GVZB 2QMUB 2LCWA 2MQMA 2CPZA 1AFIA 2DHAA 4OI1A 3O44A 3SZ2A 1WKLA 1AUDA 1HNIB 2FTRA 1YBUA 4KGZB 2E7VA 3A3PB 4CNZA 4RW8A 4EYHB 2XY6A 5ETKA 2Z2LA 5HVHA 3P6YC 3IBCB 1V3SA 1WF2A 2GJIA 4LF9F 2AJ1A 4WXOA 4CH1A 1M1GA 2QL9B 2ROPA 4F4YA 3PO4A 4ICLB 4NZ7A 3C15B 3CDBA 5ETQA 4UUWA 1RYRA 1S9GA 1RWVB 2W1BA 2GQ2A 3EZOA 2KHCA 2HRTA 4ZOSA 2UUBF 2G2YA 2UXCF 5L1JA 2B7CB 3NOGA 4OYZA 1GQEA 2PI5A 3TAMB 2CPDA 1NNDA 3BEGB 1WEZA 2WONB 4OQJA 4P6QA 4ES3A 2D3OR 4YB5A 3MCNA 4DV3F 3EXCX 5B0BA 3R97A 2DHSA 1UA0A 1H2UX 1CSJA 3G6VA 2OTLS 1VLYA 3QFWA 1E6VB 4K50A 2NSCA 4OJGA 2C28A 3ET6B 3QWPA 1T7PA 2BQ3A 3DM2B 4RR5A 2JWNA 1FRJA 2K3KA 1S1VA 2OAUA 4LFCJ 4GRSA 1TKDA 4I56A 4C8LA 2D69A 4NXNF 2VPXB 3K5LA 1KR4A 1VLOA 1PC4A 3Q22A 2O3DA 3LO3A 1SC1B 2DNGA 3I9V9 4OV1A 3RBEA 2RILA 1RT7B 4JI3J 3S01A 4NL5A 3BQ2A 1OPIA 2DEIA 1S0VA 4WE1A 2F1FA 3QGGA 2B7BB 1S77D 5D15A 3MAHA 3H0PA 1R3NA 1BQNB 1H7XA 3KLEB 5CCLA 5ETSA 2YX4A 2OFGX 1N5QA 3NNHA 1YJTA 2ZH4A 5D3GB 3UD4P 2IJRA 1VHIA 1WC0A 2FVRA 4CH7A 2K7JA 1H7WA 2OPRA 4RKUC 1SQFA 3MD1A 4X84A 2HHXA 3QRRA 4O0NA 4LF6F 2ZVSA 3DDIA 2MQPA 2FVPA 2YPZA 2XY5A 3OXLA 4B02A 4L73A 4OX6A 2V2KA 1UVKA 4ZJQA 8ATCB 1T3NA 3THPA 2KXFA 3KK1A 3E2EA 1X7VA 3JQMA 3MUMP 4CO2A 3CDAA 1UAWA 1T95A 2CDQA 3PJ9A 4U7CA 1P9QC 4LFAJ 1BUXA 3OLBA 1S6PB 3AD7C 1UVJA 4L74A 1KP6A 4UQTA 4GO7X 2WVBA 2E5LF 5B0DA 1Y7PA 4EWTA 1J5OB 4LSNA 3KLIB 1FF2A 4CIOA 2C2EA 5E5NA 1N33F 1HQUA 2YNIB 3HX9A 1BHNA 4NI2B 4DL2A 2BJ1A 4B9MA 2XYGB 2HHHJ 1SC6A 4A4JA 2UUAF 3F44A 1Y0HA 1R8AA 1UEVA 4QIVA 1X9MA 2J5AA 4X4RA 3MFIA 1WHYA 1RDRA 1KOOA 3NS6A 5FDLB 3MECA 2GVDB 3EGNA 2PO4A 1HR0J 2R3VA 4FXDA 3V4IA 3B78A 3GILA 4ZDNA 1TZ0A 5LMNJ 2E9RX 5H9FJ 1SL0A 1DURA 4Y0FA 3T5LA 3CTRA 2ZKTA 3BPSP 4LIRA 3D7SB 2A6OA 5CH7B 4OZJA 2YNFA 3PW0A 2RHSB 4ZHRB 4CTAA 3W2WA 4NYPA 1RT6A 1WI6A 5IV4A 4DSIA 4ANEA 1WG1A 2R7OA 2A2DA 4DJBA 1C0TB 2AQ4A 1REVA 3WDOA 4KH1B 2HIYA 2J6TA 4WIQA 2NZ4A 4JI2J 3VAHA 1VJQA 1RWOB 4RUHA 1YITS 1KQSR 1DRZA 4RO0A 3I82A 4OJHA 2Q79A 1IKVA 1K1QA 4YN3B 1I5OB 1RGVA 3MEGA 4IFYB 2UXCJ 1ZM2A 5LJ5Y 2YH0A 3M2VB 3AHPA 4XDDA 4LRCA 3CSKA 4DR7F 1XEZA 4TLQA 3AOAA 3GE9A 1G6BA 2XGPA 3D1HA 3BBFA 3HKWA 4H4OA 4DQPA 4OHXA 5BYRA 5J2MA 1DJ0A 4DV3J 1N36J 4CLYA 3QT5A 1XBWA 3HHDA 3FNNA 5IT9U 3QGIA 2MKHA 1AZSA 2I2YA 3VGSA 3ENQA 3KJVA 4IO1A 3POTB 2YVSA 1QUPA 2EI5A 5FIIA 4NLUA 4FNIA 3UDVA 4PUOB 2DGWA 2IRYA 2MPUA 4O3QA 1RWPB 3GJTB 3HT3A 5KFXA 3BJYA 4K5RA 1WDTA 5HP1A 2Y3YA 1Q5VA 4LIWA 4JI4F 4JYAF 3ZTOA 4HR2A 2MKKA 1Z2ZA 2LDYA 1PSDA 3DYAA 4ZIVA 2DR8A 2WZ1A 5HK4A 4PWUA 5GMEA 3VTIA 2ZH7A 2EG2A 2XBPA 4N41A 5SUHA 5C42A 3Q0AA 2HFSA 2M70A 3LP1B 2XMTA 3GSIA 3C19A 3I96A 2MHNA 2Q3PA 1FDNA 3ZNJ1 4L6V3 3U1NA 3CJQA 1B0VA 3LANA 4KSEB 5I42A 2DO0A 3EZ5A 1FI4A 4Q2LA 3IN5A 2CJBA 5EHHA 5IC6B 4I2QA 4X2BA 3W5XA 4ED6A 1IUJA 4XK8C 1XNRJ 3V81B 3VAFA 3C6UA 4LF6J 2KU7A 1M5PC 1YDLA 2BVZA 5ETRA 2BM0A 2XMKA 3QATA 3B4MA 2B4UA 3TRGA 5LSLA 4O3OA 3M7VA 4Y65A 2PFDA 4TYBA 5THWA 4D3GA 1RHUB 1CJTA 1KWMA 2PIIA 4KV8A 4JI5F 3HVWA 3FCWA 4DPTA 4ZP9A 2K7KA 1YJ7A 5IOLA 3M6WA 4ZVGA 4X4QA 4FN5A 1R0AA 5GAGU 4LVNP 2WCXA 1ROFA 1BQMB 1FD8A 4DUYF 3OSPA 2QLWA 2WVFA 1W2BR 1N33J 3M2RA 2R7XA 1U2CA 2OPPB 1T3OA 1LWFB 1QE1A 1ELOA 2BE2B 2HEKA 2F9DA 4KIAA 5DGBA 1APSA 3V2UC 1G4CA 1FJCA 5I4MA 2HNDA 3G2XA 4IR1A 3MM6B 5D4NA 1QSSA 3NY0A 5CYMA 4I69A 3QLHB 5A8KB 1HWIA 3PJWA 3M6XA 5DS7A 3IA0A 4B08A 4NCBA 3L7UA 2VOPA 4OYXA 5ETVA 1QDUB 3VZHA 1R6YA 1KBRA 1Q8BA 4QU7A 3KLGB 1JNRB 4URSA 2QA1A 1S72S 8RUCA 1ITPA 2J6SA 1PBAA 1E6YA 2CRLA 1S12A 3BDPA 3W2VA 5IQQA 2ZZTA 4QWBA 3KJNB 4F4ZA 1W2IA 2VG5A 4Q0BA 1KN6A 2L9WA 3L4BC 4Y28C 1WJ9A 1WSVA 5I3PA 2HS4A 4DOZA 1YKWA 2R2TA 1VIOA 4QBUA 3B4DA 3PG9A 3T5HA 3PW7A 1N5TA 1AB8A 5CHCB 4C8ZA 2J8SA 1H73A 5HROA 4X64F 3I9ZA 1OQ6A 1RT1A 2Z57B 1NK4A 1W26A 1HNWF 1GAOA 1FD2A 1KSPA 1GXLA 3BSAA 1NH8A 3FBEA 2XCAA 4IUFA 1J5EJ 1RTHA 1QTMA 2W2MP 2X3GA 2H1YA 3SQOP 4A8MP 4JP8A 4MFBB 4NXMJ 2FVSA 1LEOA 3BGFA 3CIMA 3HHLB 3J7YU 1EETB 3VF0B 2WSFC 2BUNA 5KFAA 4OHZA 1FRIA 4F8RA 3HK2A 3NGUA 3QSYB 5E3QA 1Q0NA 4NCGB 5LT5A 4RNOA 2Z56B 3GPAA 2ZOGA 1AT1B 2QLFB 2CJQA 5I3QA 3DRSB 5E2QA 2IM0A 3NG8A 3ENWA 2CQ3A 4RWXA 4C3MA 3OTOF 4W98A 1MWYA 3NAHA 2QJ3A 3T1HF 1T9YA 4O23A 3RTVA 1CULB 2E5IA 4JI7F 3D1QA 3IBWA 1IKWA 4HACA 1JLBA 2AHOB 4Y00A 4ELUA 3NMRA 4A8XA 5CA5A 4ZPAA 1LK7A 3EPIA 2OPQB 3MEKA 3DLEA 3NAIA 2G2ZA 1D9DA 2DGXA 3N6MA 5KFQA 2RJZA 4I0WA 1YBAA 1IJEB 4ED4A 1NLKL 3H4BA 1MN9A 2FGCA 3NP5A 1UETA 5F8HA 1JLQA 1M1KT 4M5KA 1AUSL 3JSMA 2FJVA 1U25A 3G8TA 1VIXA 2H5IB 2GZOA 3HT0A 3W60A 5E3AA 2V8GA 2VG7B 4PZVA 4IG0B 2VICA 1S1UB 3QFHA 2FPHX 1VQSA 5AXKA 4YOEA 3RJMB 4OYIA 3ENVA 4IRKA 2KRBA 1RBOB 3MEDB 1FRLA 1LOUA 2VPZB 3OR2A 1R31A 3BGLA 3CJ4A 2W8LA 1TL7B 1EJ7L 3L7PA 1CLFA 2WOMA 1JLCA 4F4KA 4ETXA 2KXNB 1VQPS 2UP1A 1VQYA 3W5ZA 1FXLA 2ZH9A 3CCRS 3IAS9 3EXYA 4TNOA 4A47A 1WORA 3G71S 2N7YA 3AD8C 4X4SA 2XO7A 2V8DA 1CC8A 3BBBA 3I55S 2WSCC 1QJHA 1ZPWX 2YKOA 5F8GA 2OJ3A 3TWZA 2ALYB 4BHQA 4X65F 4NYZA 2QMWA 3NGKA 2CNOB 2H4YB 4Q5VA 3M9OB 2AYBA 4B3OB 2B8PA 3AXMA 3H4DA 3QGHA 4RUCA 4JI1F 1QAIA 3BGRB 2GIQA 3IFEA 1EP4A 4GVBB 1FVQA 4OZ1A 3OD2A 4HVZA 5G4DA 3DKDA 4KR0B 4ATNA 2XMJA 2R7TA 2PEBA 3MDFA 1Q78A 3I4HX 2UXBJ 1K44A 4A8OA 4KFBA 2HVIA 2XMAA 1HWJA 3TI0A 3M8WA 2YQ1A 2FYXA 3FC9A 2B5JB 4ENOA 4DV0J 1SC4B 1BLUA 1FXRA 4R5PA 1SIWB 3DGPB 3PHEA 4Y2KA 2DHHA 4ID8A 3D6TB 1Z1ZA 4YHHF 4PYAA 1NHKL 1S1XA 4ALZA 1TELA 2JLEA 3G4SS 4LT6A 3HO1A 2FGOA 2KO1A 3HPOA 4QYZJ 2FC9A 2CUYA 2HZCA 4DR5J 3D6FB 5F8NA 3KDOA 5LOQA 2XLIA 3UQSA 2ZZMA 1TMMA 4WP3A 2PSZA 4KJIA 2Y1RI 4DCOB 4UQGA 3RRKA 4X64J 1EZZB 2HHWA 1VHFA 4PXDA 1B4SA 1I94F 1HNWJ 2AD9A 2HLTA 3P5BP 1NKEA 3W62A 3PR5B 2IAJA 3X3UA 1FDDA 2WTFA 3B54A 2YY3A 4KBIA 4DR3F 3LP0B 1K9MT 2GQQA 1HA1A 1LW2A 2RUSA 5K8NA 5AXMA 3Q8UA 2HURA 2FLOA 2RF2B 4EK2A 4B3MJ 3HHLD 1S48A 1PGZA 3PKMA 2A18A 2BBEA 1TMJA 2DGOA 2XI3A 4RW7B 4V19J 3EYZA 4O44A 4Y3CA 1FWPA 2J7KA 3FUYA 3L9ZA 3MUVP 1TVRB 2VZ9A 3K7RA 2HRYA 4PR6A 1HARA 1S10A 1U1KA 4U6PA 3RAQA 2QTWA 4JI8F 3M1VB 4ELTA 2AW0A 4F67A 4J7CA 5B09A 3G6YA 4RNHA 4WKYA 1D9AA 3OTOJ 1OSCA 5H9FK 1UWBA 3H2VE 3PZPA 1KDNA 5C2GA 3T1HJ 1LWCB 1ZOTA 3CC7S 4JI7J 1QM9A 2YWKA 2WW8A 1B99A 2VF3A 4C11B 1V5VA 1F2GA 2QLJB 2RKIA 1PYSB 3CCWA 1RTIB 1Q79A 3KK3B 1BWVA 3KUHA 2R7UA 3UO0A 2IVFB 3T9NA 4D3HA 3D3CJ 4BCAA 1FA0A 5DG7A 5F0WA 2XSFA 1ZAVA 4IO9Q 3D28A 3VGUA 1HNIA 2VA2A 1IQTA 3WBZA 4F2SA 4C0OC 3TEHB 2W01A 4NEYA 3PFEA 1SI9A 1OY8A 2W7PA 1AA1B 5GAGI 1WG4A 2KT2A 1S9FA 3AA8A 2KFNA 4B9UA 3DC2A 2RD5C 3RG6A 2BW7A 1HNXJ 1LV5A 1D8ZA 4MIWA 5EUHA 3C15A 1KD1T 1JLFB 3SSQA 1O51A 2YWEA 1JMTA 2CNKB 3FCVA 3CD6S 2U2FA 5KFNA 4ITSA 1S9GB 4DV1J 1QLNA 3D1OA 4J90A 3AOCA 1UEUA 3W1YC 1NPKA 3DRXA 4UUXA 3T3FA 1ZAWA 2FJAB 2WONA 4ZLLA 1YI2S 4WWSA 3J7ZT 3F41A 1YJNS 2KVIA 1X5SA 3LH2S 4IYQA 4EEYA 4YB1P 1IBMF 2QRRA 4PKDB 2IDEA 3HP6A 2FZGB 2ZWOA 3OTDA 4H54A 3BQ1A 3BM7A 1FVSA 5A8RB 3C3LA 2DIUA 2HQCA 4OHWA 1TUWA 3KWMA 3S7RA 1Q8KA 3CMQA 3LP2A 3F56A 3TZZA 1HQEB 3SEOA 3UD5A 1RTZA 5D4PA 4B17A 3WZ0A 4X65J 4J37A 4FYXB 1XWLA 3DM2A 2PN6A 1K73T 1Z2LA 2HFNA 2MZJA 4CLTA 1T05A 2CWXA 3RB3A 1Q16B 3X1LB 4K4TA 5DDRC 4AYBD 4DQRA 3HD2A 3UDEA 3NGTA 3T5JA 4CT9A 4TQSA 3KHLA 3NWGA 3KMQA 2KVQE 2HNZA 4A8KA 2GAHC 2UXDJ 2ZJRQ 3QPIA 5KT3A 4YEAA 2NPIA 5HJYA 2ZOFA 1TAQA 3MR5A 4TYAA 1HI0P 1BQNA 3KLEA 5IQ6A 4LF5F 2B0GA 1LFPA 1WTBA 4UOGA 1EB0A 3MMJA 4TU8A 2LQ5A 4HH1A 1S79A 5D3GA 3CCZA 1UVNA 2QLXA 4A8YA 3PIPQ 2AEJA 3J7YI 4WU2A 2B43A 3DHWC 3MWBA 4FYWB 5DQHA 3TZXA 3M6VA 4DR6J 1KOHA 3A8KA 2NSBA 2UV8A 2OPRB 1IBLF 2HVZA 1DLOA 3AXKA 5KFWA 2YKPA 3CO9A 1Q53A 4Y34A 1QY7A 1Y3JA 3D9BA 2DPIA 2JVOA 1X4GA 3M9MB 5HAOA 3LGNA 5DZ6A 3S6EA 5L9NA 1HNZJ 1EHWA 4OV6A 4DF8A 3IWXA 1SVDA 1U8WA 1FKOB 1MMNA 4PG4A 2E9ZA 1R89A 3V6JA 4QJVA 2QZ8A 8AT1B 2RQKA 1N34F 1J5OA 1T11A 2HBRB 3IG1B 3IO1A 3R5CA 1KLNA 3KLIA 2ZDPA 1JQGA 2DCUB 3M8YA 1Q81T 3TW0A 1IM6A 2YNIA 4ZVTB 2DHGA 2DIVA 1NDCA 4OYPA 1XR6A 1Q8IA 2EK1A 1WOPA 1RWWB 3HVRA 5LMUF 2ZBCA 2J0SD 2C2OB 4AUKA 1UPMB 3ZZYA 4DV2F 1YRUA 4PYDA 2VHGA 1FCAA 3MI7X 2ZUGA 2IYGA 2Z8QA 4LF2A 3JTPA 3VGVA 1FRXA 5FDLA 4M1KA 4BWMA 1GMWD 2XMVA 2CJAA 4MK7A 4Z7YA 3LPEA 4OI2A 2OD6A 3ITHA 1FFSB 2MY7A 1F5CA 3DOMB 3VAIA 2JX2A 5HMZA 4WP8A 1FFWB 3M30B 1VQ6S 5HLFB 3SMZA 4IOAQ 4ZHRA 3G8QA 4L75A 3HHNB 3HSZA 4MK9A 2XTJP 3HMJG 4DV7J 4I64A 2MQNA 3M8ZA 6FDRA 3W2WB 2GC8A 1VJWA 1YZ6A 1C0TA 5D0HA 1ZZFA 2IFXA 1UJ4A 4GVLA 1SCJB 7FD1A 1REVB 3Q23A 1NDLA 4WK3A 5DQGA 2AT1B 3CVKA 4Y2MA 4H4MA 3QAUA 1WC6A 2GGPB 4FVMA 2NYHA 4IFYA 3LA0A 2AF6A 1K1SA 1IKVB 3M2VA 4P9SA 2DXEA 3GFZA 1R6VA 3NGRA 4MMOA 3F0NA 2ZFHA 3J7A1 3EDQB 1G2EA 1HMVA 3JQJA 4K0KF 4U7UK 2Y8WA 2VIHA 1NK0A 3MCMA 3OFGA 2WK4A 3ZO7A 1RE1B 3W61A 1S7IA 5LXYA 5J2MB 4ZVEA 3PO5A 1NK6A 2QYCA 2CQPA 2ZD1B 1SPBP 2JVRA 3ILJA 3N4WA 3WX8A 4ECSA 1H3DA 2QEXS 2G0JA 3KJVB 3HVAA 4ZVPB 4PUOA 1TKTB 3IAM9 2DH8A 2IY5B 1X4AA 1RCXB 2XWXA 3T1YF 4WJBA 3K58A 2LFVA 3ZC4A 1YQHA 5KAKA 5KFYA 3ZZPA 1RWMB 4DUTA 3IMQJ 4X4PA 3SCJE 5H9EJ 4F25A 3D54A 4ZP6A 2BW2A 3C46A 1S1WB 3HCXA 1HI8A 1MN7A 4YB6A 4KTQA 3AQPA 1GTEA 2KG0A 1VRTA 3OUYB 5CXTA 3DYAB 2W4DA 2CNNB 1OQ3A 5E41A 1SXLA 4MIAA 5EWEA 1Y9OA 3SQGB 3LGHA 3QSIA 1LXNA 1BQXA 3LP1A 2EVZA 3PX0A 3H5YA 2U1AA 4M5LA 3TP2A 1T9VA 2L3MA 1K0TA 1S6QA 3O3LA 2HK2A 3MUTP 5BR8J 4KHPJ 3KXDA 3KHRA 4J9KA 2EFVA 4ED3A 1AFJA 4YR0A 5IZHA 4I2QB 3D4JA 4N47A 4M94A 1HD0A 2AU0A 3CO0P 2JLGA 3KNGA 5IWAF 4LF7F 3W8GA 3DGVA 1IVZA 4MYTA 3KOAA 4WFBQ 5DRKA 4DFPA 2CADA 2XLKA 2KXHA 1S7HA 3G6XA 2HHUA 5D4OA 2K8GA 2IYIA 2HAIA 3OR1B 1IXKA 4ZKAA 3BKTA 1P1TA 1GXUA 1RK8A 1CJTB 3QNWB 2GAGC 1V3ZA 4OLOA 2ACMA 3GSDA 3VAMA 1S4FA 3H42A 2HPUA 5JXSA 4ZS6A 1BQMA 3BGUA 3QRQA 1HFEL 4CLUA 1FNMA 1YRTA 2C3MA 2BJDA 4NLQA 1VI7A 1N8RT 1GK8A 1RT3A 4M8LA 2ZE2B 1LWFA 2YQ3A 4HI1A 4UZCA 1ZTWA 3MM9A 1KVJA 2JL9A 2BE2A 3IP0A 4OX7A 1RAAB 3QAEA 4OX8A 2IJFA 5B0AA 1J2VA 3GIMA 4OZ3A 3ETMA 2DNPA 5LJ3Y 2VV5A 1N56A 1FERA 4KGXB 4DG1A 2VC1A 1RABB 3C66A 3U1LA 3MM6A 1DFDA 2XNQA 2HNDB 2KRRA 2XZDB 5A8KA 1QAJA 5EX0A 4DX5A 1NK7A 4QYZK 1SJ1A 3LALA 4NPOA 3DOKA 4NLTA 2ALZA 1T0TV 2UUWA 5D4LA 1RB0A 3R6GB 3QIPB 4I4BA 5IT9Y 4XPEA 4YQWA 4J9MA 4ILLA 1GMUA 2DBBA 3NMAA 2JJ4D 2ZM6F 1DTQB 2M5YA 3DU6A 4JBCA 3GFYA 4HYKA 2WB4A 2R2UA 3NKYA 1JX4A 4CLFA 2QA4S 3W2VB 3HLUA 5J2QA 5ETOA 4RUAA 5B7WA 1JWWA 3U1MA 4M5NA 1QSYA 5D78A 1PAUB 2BMBA 1QD1A 1UJ6A 2Y8YA 1NHUA 1YVFA 1UWAA 2VJUA 1NSPA 1RWXB 4TY8B 3RR8A 1TV6B 2IIHA 1YWXA 3SCLE 2LQBA 2NXNA 2LQJA 4AL5A 1J27A 1PCAA 2ZOMA 3TVYA 4QWCA 2X1AA 2BR0A 1HWKA 2FZCB 3DLGB 5BYSA 4P7VA 4M5GA 1PG5B 3GJSB 2OMLA 1RTHB 4PG6A 2QA2A 4URQU 5F41A 4K0KJ 5LL6d 3CJRA 2Q1LA 4KRWA 3S8SA 3HHEA 1QUVA 3HHLA 4FS1A 1ZAXA 2BOAA 3R9LA 1NK8A 6FD1A 4B9VA 3K0JA 1MMLA 4G1QB 2ILZA 2PT0A 2AJFE 3WC2A 4KGMA 2KG1A 4RNMA 4FVCA 3K57A 3VWSA 5L38A 1KRPA 1RWUA 3P96A 3OL6A 4UY8T 2CZ9A 3UN3A 1NHVA 5KT5A 4Q8FA 1U7LA 3QWUA 2EBGA 4N7TA 2WVCA 1UVLA 1CULA 1RTDB 4F3QA 4PWWA 1ICEB 4WTYA 4IRDA 2IVMA 3HJVA 2CWKA 2OPQA 5KFJA 1K8AT 1CG2A 1JXEA 3ISNC 2R8HA 2DD8S 2VPWB 1R27B 4HI2A 5GVQA 2HZAA 4PXEA 4NZ0A 3DLEB 2HHQA 4DUZF 4C8MA 1MU2B 4CYUA 2C3OA 5KT6A 4NA3A 3UVJB 5JMNA 4CLKA 2F8HA 2CQ4A 2HVDA 3T19A 1N5VA 1OO0B 2XLJA 2DNKA 2J7UA 3GZ7A 2QN6B 2FLLA 3UN5A 1UL3A 3JSMB 5C2CA 1N5YB 4G1PA 2VG7A 1YBTA 4IG0A 1RA6A 3CDUA 3H2UB 1P1LA 2OTJS 1S1UA
chains in the Genus database with same CATH topology
3GJTB 2HBRB 3GJQB 4ZVSB 1RWOB 1PAUB 1RWNB 1RWKB 3IBCB 1SC4B 2HBQB 4ZVTB 3KJFB 1RHUB 4ZVPB 1RWXB 1IBCB 2CJYB 2QL9B 3P45B 2HBYB 1QDUB 2XZTB 1BMQB 2Y0BB 2DKOB 1PYOB 2HBZB 3IBFB 2C2ZB 3R7SB 3D6MB 2QL7B 4ZVQB 1ICEB 1RWWB 4ZVRB 4LSZB 2FQQB 2P2CB 3GJRB 3R5JB 1GFWB 3P4UB 1RWVB 2C2OB 5IC4B 2XZDB 1RWMB 2CJXB 3D6FB 2CNLB 2C2KB 3R7BB 3R7NB 1SC1B 2H4WB 3R6GB 4ZVOB 2H5IB 3GJSB 1NMEB 3KJNB 1RHKB 2H54B 1RHQB 1SC3B 2XYHB 3QNWB 4DCOB 2H51B 2CNOB 2C1EB 2H4YB 3SIPB 3RJMB 1RHMB 2CDRB 2QLFB 2CNNB 2XYPB 2CNKB 3NS7B 3R6LB 2H48B 1F9EB 4ZVUB 3D6HB 4JB8B 5K20B 2QLBB 3EDQB 5IC6B 1I3OB 2H5JB 2C2MB 3KJQB 2Y1LB 1I51B 2H65B 2QLJB 1RHRB 4DCPB 1QTNB 2QL5B 1RHJB 3EDRB 4DCJB 1RE1B 1RWPB 2XYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJT B;  2HBR B;  3GJQ B;  4ZVS B;  1RWO B;  1PAU B;  1RWN B;  1RWK B;  3IBC B;  1SC4 B;  2HBQ B;  4ZVT B;  3KJF B;  1RHU B;  4ZVP B;  1RWX B;  1IBC B;  2CJY B;  2QL9 B;  3P45 B;  2HBY B;  1QDU B;  2XZT B;  1BMQ B;  2Y0B B;  2DKO B;  1PYO B;  2HBZ B;  3IBF B;  2C2Z B;  3R7S B;  3D6M B;  2QL7 B;  4ZVQ B;  1ICE B;  1RWW B;  4ZVR B;  4LSZ B;  2FQQ B;  2P2C B;  3GJR B;  3R5J B;  1GFW B;  3P4U B;  1RWV B;  2C2O B;  5IC4 B;  2XZD B;  1RWM B;  2CJX B;  3D6F B;  2CNL B;  2C2K B;  3R7B B;  3R7N B;  1SC1 B;  2H4W B;  3R6G B;  4ZVO B;  2H5I B;  3GJS B;  1NME B;  3KJN B;  1RHK B;  2H54 B;  1RHQ B;  1SC3 B;  2XYH B;  3QNW B;  4DCO B;  2H51 B;  2CNO B;  2C1E B;  2H4Y B;  3SIP B;  3RJM B;  1RHM B;  2CDR B;  2QLF B;  2CNN B;  2XYP B;  2CNK B;  3NS7 B;  3R6L B;  2H48 B;  1F9E B;  4ZVU B;  3D6H B;  4JB8 B;  5K20 B;  2QLB B;  3EDQ B;  5IC6 B;  1I3O B;  2H5J B;  2C2M B;  3KJQ B;  2Y1L B;  1I51 B;  2H65 B;  2QLJ B;  1RHR B;  4DCP B;  1QTN B;  2QL5 B;  1RHJ B;  3EDR B;  4DCJ B;  1RE1 B;  1RWP B;  2XYG B; 
#chains in the Genus database with same CATH topology
 4RL1 A;  1HPZ B;  1JB0 C;  2M2B A;  4QIF A;  5L9X A;  3PM9 A;  1YJW S;  4OI4 A;  1UTA A;  1YJV A;  2LP4 A;  1S6O A;  3MED A;  4W92 B;  3R5G A;  5IWA J;  4DR1 J;  2NXE A;  3SYZ A;  3N01 A;  1DAR A;  3W9J A;  4F4X A;  1TL7 A;  3DOL B;  5M2P A;  2Q6C A;  2F4F A;  1UW9 A;  1GNK A;  4HH0 A;  2ACY A;  4LSZ B;  2PC6 A;  2WOM B;  5E0O A;  4U8V A;  1JLC B;  1FJG F;  1RU1 A;  4NLX A;  2BKN A;  1UCN A;  3GFH A;  4DFK A;  3H20 A;  3G96 A;  1WHX A;  1XN9 A;  1WTF A;  2HHP A;  4JOU A;  1CJV B;  4J9Q A;  5FLX U;  4EGL A;  6AT1 B;  3BH6 B;  3GLJ A;  3N9U C;  2XCP A;  1R43 A;  4C0B A;  1NSA A;  2F4V F;  3UE2 A;  3N79 A;  2OEL A;  4RU9 A;  1FKA F;  5AE2 A;  4DQI A;  5F9L A;  1U1Q A;  4EU0 A;  2KB2 A;  3NCQ A;  2ZDO A;  4HTJ A;  2ROE A;  2UUC J;  1WHW A;  4GVB A;  1DTT B;  2F8M A;  3AOD A;  1B7Y B;  2AYE A;  1MLA A;  2L48 A;  2HFV A;  4DPO A;  2FJE B;  1HW9 A;  2OFH X;  2KJV A;  4UF4 A;  4E0D A;  2VAS A;  3R7S B;  2XZW A;  4ZCI A;  3PYG A;  4I7F B;  4DXL A;  3W64 A;  4ZJL A;  3IR5 B;  2XUL A;  3SFU A;  2B5J A;  3CUN A;  4KFB B;  2RS8 A;  4BLG A;  3LTO A;  2YKQ A;  3DGP A;  2ZM6 J;  5J1P A;  4AQY J;  3JTN A;  2YXL A;  3DDK A;  4R5P B;  2KI2 A;  4DSJ A;  3OTE A;  2KM8 B;  3RB0 A;  4BS2 A;  1ZH5 A;  3HVT B;  1S1X B;  3CE8 A;  2JEI A;  2XM3 A;  1XNQ F;  2IM3 A;  2K3I A;  3PX4 A;  2P6T A;  2PMH A;  2V0N A;  3PR4 A;  5J2N B;  4F02 A;  1LKZ A;  4YY3 F;  3LWL A;  2DGV A;  2COL A;  5HQM A;  5GAH U;  1UVM A;  2RHQ B;  3BRE A;  4Z7C A;  3IC1 A;  2YNH A;  3TX0 A;  1K0V A;  3GJQ B;  4NCA A;  5KOX A;  1Q4R A;  4CO4 A;  2DR7 A;  4ZPB A;  4L76 A;  3GII A;  4RNF A;  1ZZN A;  4C4W A;  4Z2X A;  4QW9 A;  5CAA A;  3GYN A;  3LP0 A;  4KB7 A;  5KT2 A;  4J9N A;  2BRL A;  1YLX A;  1Q5Y A;  1LW2 B;  3RR7 A;  3BO2 A;  3NLC A;  5CD4 H;  4DV4 J;  2KL8 A;  3U02 A;  2BKO A;  4KHM A;  2GX8 A;  2HZV A;  3IGN A;  3R5D A;  1HI1 A;  1TVR A;  1W7W A;  4O44 B;  4HEA 9;  2IRU A;  2R4F A;  4ZPT R;  1VCT A;  2K2P A;  3ZZO A;  1GMV A;  2C3U A;  4ED2 A;  2HFO A;  2BEF A;  3FFI B;  4CDI A;  4EYI B;  2IBO A;  2X3D A;  2IBK A;  4B3T J;  1I3O B;  2DJW A;  1JJ4 A;  1IQZ A;  3GQC A;  2OKQ A;  1U1P A;  4OFZ A;  3FSY A;  4NLS A;  2HGL A;  2V4R A;  2PFF B;  3QMQ A;  1YZ7 A;  1UWB B;  4L3N A;  4DX6 A;  5HVF A;  1RBL A;  2FHJ D;  4C11 A;  2LEB A;  1O6X A;  1R0B G;  2OD4 A;  2RDD A;  4TU9 A;  1WC1 A;  1TKZ A;  1RTI A;  3CCM S;  3KK3 A;  3CJ0 A;  3ISN D;  3A8I A;  3MOJ B;  4PQA A;  1IR1 A;  4CLW A;  3P3D A;  1N6Q B;  1V3R A;  2OI2 A;  1WOO A;  1Q86 T;  2J8A A;  3SBM A;  4B3R J;  2M9K A;  5KG5 A;  3ENA A;  3ETO A;  2MXY A;  4DQS A;  2GHV C;  3I0S B;  2VFU A;  1HBN B;  1KLM B;  1OMS A;  2DR9 A;  3ILL A;  5A0Y A;  4DV5 F;  3B8H A;  4K4X A;  4YDD B;  1RAC B;  3OPK A;  5CAB A;  1KHV A;  3IWN C;  3PX6 A;  5AXN A;  2Q66 A;  5HQL A;  4BC9 A;  3US5 A;  3BB5 A;  3C8Y A;  1IWA A;  1JKH B;  2DNQ A;  3EWG A;  1Q95 G;  4CZC A;  2AX0 A;  4E2F B;  3W3S A;  5FD1 A;  4WFY A;  1UZH A;  1VQ5 S;  3PYF A;  3TAN A;  3O1L A;  1URN A;  3TUZ C;  2V50 A;  1PYT A;  1JLF A;  2AMC B;  1S1T A;  1JJH A;  3EUN A;  5K5M A;  1R8H A;  4FF4 A;  2DB1 A;  1S59 A;  2L08 A;  4MT1 A;  2HBQ B;  4NLR A;  5DDO C;  2ERR A;  3PW5 A;  2FVQ A;  2AYM A;  2CPE A;  4BBY A;  2VC0 A;  1FJG J;  1RT2 A;  2M3D A;  2E5J A;  2RSQ A;  5KFE A;  4ZA1 A;  4WU3 A;  4I68 A;  3KG1 A;  3BH7 B;  1FNX H;  3ICL A;  2MKJ A;  2E9T A;  4ZVQ B;  5C24 A;  4ZVR B;  1T03 A;  2DGQ A;  2BX6 A;  3UN2 A;  3UCU P;  1U1L A;  1SUQ B;  2MHE A;  2OSR A;  3C14 A;  4LFB F;  2AJ2 A;  4CP5 A;  5A8W A;  1JNZ B;  3RYL A;  2B4P A;  5B0F A;  3FRY A;  3RW7 A;  5AJ3 F;  5H9E K;  2BDP A;  5A8R A;  2B6A B;  4DV6 J;  1VFJ A;  1TQL A;  4DWI A;  1HQE A;  3SIP B;  4L72 B;  4NRU A;  2HQD A;  3NGD A;  4O0I A;  3LP2 B;  1N5S A;  2RQM A;  4KQZ A;  3SSS A;  4FDF A;  3AJD A;  4XIU A;  1T05 B;  2Q6B A;  3EZU A;  4GMK A;  1S0M A;  9ATC B;  1HLW A;  1IKX A;  4ILR A;  4A46 A;  4DFJ A;  2BE9 B;  2QX0 A;  5DG8 A;  5HL7 Q;  4UOH A;  2GIF A;  2YKN A;  2Q43 A;  1BY9 A;  3HD1 A;  3CJS A;  3TO8 A;  4N8N A;  3DCA A;  4ECT A;  2FLP A;  3CCV S;  2AGO A;  2FY1 A;  4C8K A;  2HNZ B;  4I2P B;  4IH5 A;  1X5P A;  2YWF A;  3TUP A;  4JV5 J;  4BC7 A;  2OSQ A;  4PG5 A;  2XS2 A;  1PIL A;  2B56 A;  4CM0 A;  2YQ0 A;  2BRK A;  4X66 F;  1NB2 A;  3PJX A;  2DRB A;  2D1C A;  1X4F A;  4ZN3 A;  3DRP A;  2HKE A;  4YY3 J;  1T02 A;  2H51 B;  4O3R A;  4DQQ A;  3CT9 A;  1YJR A;  3NS7 B;  5JUM A;  4RBT A;  1UKU A;  5LSR A;  1NPP A;  2J9D A;  1B0T A;  4JI0 J;  4F0H A;  4B3S F;  4PPD A;  1D09 B;  2CJ9 A;  4JI6 J;  2ZHO A;  3LF0 A;  1SV5 A;  1PJ6 A;  1VQL S;  3EVO A;  1RYS A;  4JV0 A;  2VU5 A;  2IA6 A;  3VVT A;  1DLO B;  5DM7 Q;  1FEE A;  3DLL Q;  5E3P A;  3AB4 B;  1RWN B;  1XMQ J;  1OPZ A;  5F8I A;  3MPD A;  3D0I E;  2EKY A;  4MKA A;  2LU1 A;  1VC5 A;  2AZ1 A;  2PDA A;  1FKO A;  3TUI C;  1PYO B;  3IBF B;  3OHB A;  4LF8 J;  3IG1 A;  1NO8 A;  2CVI A;  5M2U A;  2MLY A;  3TJ9 A;  1S97 A;  1ZM3 A;  2VD3 A;  1X8D A;  3BZQ A;  3BQ0 A;  2HRU A;  1JLG A;  3HHK A;  4ZLJ A;  5EGY A;  4QCL A;  3IWL A;  3VGT A;  4ED7 A;  4QWD A;  1U0H B;  5F9N A;  1HBO A;  5L8R C;  4YB7 A;  4ECZ A;  3H8Y A;  2YKM B;  2R2R A;  2ZH3 A;  3QO9 A;  3OBI A;  3EGV A;  5LXR A;  1QVF R;  3UD3 P;  5M2R A;  1SQE A;  2CPF A;  1OYD A;  1AW0 A;  4V19 X;  3DRR B;  2H65 B;  4K59 A;  2M4M A;  4X4V A;  3A3O B;  5CQG A;  3JYT A;  2M8D B;  4WP9 A;  2W2Q P;  4UOC A;  3L95 X;  4KH0 B;  3DLK A;  1NZ8 A;  4GO5 X;  5KG7 A;  3ZZ0 A;  2O1P A;  2QIF A;  4DLE A;  1JLE A;  1CQN A;  3PW4 A;  1FDA A;  4DN9 A;  2MJN A;  3DOM A;  2M52 A;  2BAB A;  4OZ0 A;  3GR1 A;  3KHG A;  1RAF B;  3ITH B;  3V6K A;  1IBC B;  3KLH B;  3CDE A;  3M30 A;  2VDI A;  3GP9 A;  2HBZ B;  5HLF A;  3EMT A;  1SJF A;  2KFY A;  4DV5 J;  5EX3 A;  5U47 A;  1YRX A;  5F8L A;  2F40 A;  1HIY A;  3QJP A;  1VYA A;  4N8O A;  4I1T A;  2WSE C;  5L1I A;  4RWW A;  3C16 B;  5E3C A;  4Q8E A;  3JSR A;  2N4C A;  1VQ8 S;  4LF9 J;  4LSL A;  1FJE B;  2XYP B;  2HGM A;  4DX8 H;  1A9N B;  1WSR A;  3CJ5 A;  3VQT A;  4OL8 A;  4OLP A;  2GGP A;  3SSR A;  1XQI A;  1UPP A;  4EO8 A;  2D41 A;  4O3S A;  1U2F A;  4H4M B;  1M5S A;  3H90 A;  1YJU A;  2C2D A;  1TAU A;  4TQR A;  5HJX A;  2UUB J;  5DLF A;  1FXD A;  4OI0 A;  1RIS A;  4P2M A;  5DGA A;  5HAN A;  1KTV A;  3ZTR A;  3KUE A;  5KFG A;  3HDS A;  1F9H A;  3MM8 B;  2BQR A;  4OJ3 A;  1VQ9 S;  1ZYQ A;  3VAJ A;  3J80 Y;  1ZS6 A;  2ZH5 A;  2NPF A;  3CJT A;  1UFL A;  3LOU A;  1M5K C;  4LRB A;  3VQS A;  3RW6 A;  1HMV B;  5IV3 A;  2ZD1 A;  1VC0 A;  1NK5 A;  3BO4 A;  4X4T A;  4P2S A;  3V6D B;  3M8Q B;  1GFW B;  5KFZ A;  1OY6 A;  2X7I A;  3HFK A;  1H98 A;  5L39 A;  2RAQ A;  2ZC3 A;  5T7L B;  2GQC A;  4USW A;  1TKT A;  4ED0 A;  3T9Z A;  1N52 B;  1NCL A;  2FJW A;  2YH1 A;  4XTT A;  2NR0 A;  1P6T A;  5G0R B;  4QPT A;  3D6H B;  1EKS A;  4Q43 A;  5DDQ C;  1S1W A;  2XG8 A;  3LW5 C;  4K5S A;  5GAH I;  4NXN J;  4PXB A;  2VFV A;  3OUY A;  1VRT B;  4QR0 A;  3SQG A;  2B9X A;  4WYL A;  2K1R B;  4PAB A;  1N54 B;  4MH8 A;  4QYR A;  4P73 A;  3L3C A;  1NB7 A;  3GV7 B;  1RSC A;  4WTO B;  2VQF F;  2CQ0 A;  2Y9H A;  2C2Z B;  2D9O A;  4X66 J;  4DF4 A;  1S5Z A;  2HQI A;  2P9G A;  2IDL A;  1UVI A;  1Q8L A;  4FF1 A;  1S6Q B;  4LRA A;  4TY9 A;  1HHS A;  1S4E A;  2OMO A;  3U7J A;  4F3O A;  2MST A;  2ROG A;  3GWC A;  3QBC A;  3IRW P;  2RU3 A;  4PG8 A;  2W2P P;  4WF9 Q;  4RBU A;  5J1E B;  3KTQ A;  2XMM A;  3D67 A;  1HL6 A;  3O6Q A;  5HI7 A;  4R25 A;  3M8S A;  1CS4 A;  1F5A A;  3MGJ A;  3OR1 A;  2C2M B;  2LKZ A;  1GH8 A;  2YNG B;  4J9P A;  2I5J A;  3AFG A;  1X0F A;  2MKI A;  2DXF A;  3KYL A;  1JLA A;  2VBW A;  2BJ7 A;  1SB6 A;  1SJ3 P;  2X1B A;  3MAQ A;  2E5L J;  3UNY A;  1FES A;  3RUB L;  5GMK a;  3N28 A;  2LXI A;  3M8P B;  1Z4U A;  1HBU B;  2PA8 D;  1SBR A;  2ZE2 A;  3TEG A;  2XMW A;  1RT3 B;  3V6H A;  1T9W A;  1VQ4 S;  1X4C A;  3SXL A;  5GMD A;  3FKB A;  3CED A;  2UUA J;  3MM9 B;  1WAC A;  2HFZ A;  3QYY A;  4QWE A;  2MZT A;  3SFG A;  4X4O A;  3DI6 B;  4G6V B;  3FSX A;  4GKJ F;  1UFK A;  4DG1 B;  2OHD A;  3B6B A;  1C1C A;  4PXC A;  4PWD A;  1XK8 A;  3MOZ A;  3QJJ A;  2X1F A;  2GNK A;  3RGI A;  2R42 A;  3QIP A;  1RTJ A;  2LQ8 A;  3NBP B;  2N82 B;  1HWL A;  3DOK B;  1BGX T;  1UMJ A;  3BKU A;  2VG6 A;  4WFN Q;  4ZVS B;  2K06 A;  3THT A;  1DTQ A;  1TUV A;  3TAP A;  4K2J A;  3R1L A;  4P2X A;  3M2U B;  2YKA A;  4IR9 A;  4DPX A;  2G9O A;  3PNI A;  3MPW A;  1Y4Z B;  1FEH A;  3UCG A;  2DVI A;  1CC7 A;  2DEJ A;  2FJD B;  5J2Q B;  4DU7 A;  4Q45 A;  4B9N A;  4OI6 A;  4ZN1 A;  4AXI A;  2FLN A;  3BR8 A;  4LF1 A;  3MCS A;  2BV3 A;  4LF4 F;  5SZT A;  4TY8 A;  1TV6 A;  4IOB A;  4B9S A;  2Z30 B;  3CNQ P;  3H25 A;  4OJ1 A;  3DXS X;  4ED5 A;  5JVG Q;  4PRF A;  2Y1J A;  3I5C A;  4XAK A;  3PCO B;  3EVW A;  2CQB A;  4FPR A;  3BYP A;  3KK2 A;  4FYV B;  4IKA A;  3DLG A;  3QJL A;  3D5M A;  4LFC F;  1OYE A;  5D0E A;  2Z0G A;  3CCQ S;  2J7W A;  4DR7 J;  3PY8 A;  3HHL C;  3HFV A;  5HO4 A;  1KEK A;  1GXT A;  3ZZT A;  4QZV B;  1WOS A;  4FPI A;  3EM1 A;  1KQF B;  4A48 A;  4C98 A;  3VAL A;  2R9L A;  4JI3 F;  1X5O A;  2ASD A;  1FE0 A;  4ECX A;  5KFP A;  1YHQ S;  4G1Q A;  1LQ9 A;  2R8K A;  2Y0B B;  4X4N A;  2AGQ A;  2BJ8 A;  4C0H A;  2XEX A;  2GS8 A;  3FZ2 A;  5IT0 A;  2J0X A;  2PI4 A;  1B7F A;  3TZY A;  3RZA A;  1U6F A;  3SV3 A;  1N88 A;  1KTQ A;  1VOM A;  1RTD A;  3W9I A;  3AH6 A;  5HVG A;  4KT0 C;  3OJU A;  4JI4 J;  4JYA J;  4DX7 A;  5K8O A;  4ZPW R;  2FHJ A;  1AYE A;  1JXV A;  1GX5 A;  3UWT A;  3OVS A;  4M5I A;  5D77 A;  4WFX A;  2KHD A;  1MU2 A;  2F3J A;  2KJW A;  4ZMM A;  3UVJ A;  1C1B A;  2VQF J;  1MW7 A;  3HUL A;  3ZFV A;  5IXU A;  2AJ0 A;  5BXI A;  4EZ9 A;  4CYU B;  3GV8 B;  5HAT A;  4KKO A;  2F8E X;  1IBK F;  3BF4 A;  1GTH A;  1WG5 A;  1WD6 A;  2XHC A;  3HI9 A;  4GC7 A;  3N5F A;  2JEJ A;  1N5Y A;  5KFI A;  1ZET A;  4DS4 A;  1M0S A;  4EO6 A;  1HPZ A;  4FXV A;  2GW8 A;  3K8V A;  5T14 A;  3M6U A;  3Q8S B;  1F9F A;  3PW2 A;  1EIY B;  1NDP A;  3PAC A;  3FZB A;  5B0G A;  2HHH F;  3W8P A;  5E33 A;  4TKT A;  3ONQ A;  1LFW A;  3DOL A;  1RJJ A;  3TVZ A;  4K4S A;  1VK3 A;  3O8W A;  3K2Y A;  1NEE A;  1RKI A;  3ZTP A;  2AKW B;  2ZEJ A;  1P27 B;  1TL5 A;  2ATC B;  3NOC A;  3CW2 C;  4JI5 J;  1MG7 A;  2HGN A;  1HR0 F;  3MM7 B;  4W4M A;  2V94 A;  2VBX A;  3S1T A;  1RAE B;  2J9E A;  3AB2 B;  1FKP A;  4CO1 A;  5LMN F;  5KFV A;  3BKF A;  4DUY J;  1CJV A;  4P71 A;  1VBX A;  1VQ7 S;  3BSO A;  1MWQ A;  4OZ2 A;  1RCO B;  1JJC B;  5DO2 A;  5AXL A;  1H72 C;  3QT6 A;  3K59 A;  1KQG B;  2Z2Y B;  3R5J B;  1LXJ A;  1DTT A;  3W63 A;  2FJX A;  2HFU A;  1C4A A;  2DRA A;  1TP7 A;  4EUV A;  1FE4 A;  4GKJ J;  5L1L A;  4JI2 F;  3MMA A;  2N4D A;  3R1H A;  4PG7 A;  1LW0 A;  3IM9 A;  2DNL A;  3W65 A;  1SC3 B;  4I7F A;  4KC5 A;  4YME A;  1KHW A;  4G1I A;  3QT8 A;  1IKY B;  4DL3 A;  2V4J A;  1RHM B;  1NPR A;  2W9B A;  2LU2 A;  4FYD A;  1RAJ A;  2G0I A;  5KFH A;  2ADC A;  2XY7 A;  1TU0 B;  2A1B A;  2OIH A;  2Z4P A;  1LWX A;  5D6G A;  4AFF A;  3MMB B;  1RLD A;  5KFD A;  1VGY A;  5I3U A;  3OFF A;  7FDR A;  4WPA A;  3I5A A;  3HVT A;  3KLF B;  4CLP A;  3CJK B;  1N36 F;  3N5B A;  1YJ9 S;  3Q8Y A;  2AX1 A;  2YX7 A;  5J2N A;  3KJF B;  5GAE U;  2BM1 A;  3D66 A;  2MGZ A;  3H5S A;  1ZPV A;  4LF4 J;  2LLZ A;  2CQI A;  1VS3 A;  2IM1 A;  2RT3 A;  3BPD A;  2V8H A;  1M90 T;  2M7S A;  3HXM A;  1CJU B;  3TVK A;  1FDB A;  1RLC L;  4C8N A;  1RAO A;  2YNH B;  1H0H B;  1X5T A;  4LR8 A;  2MLX A;  3FCH A;  4JV2 A;  2Z58 B;  3JTO A;  4N77 A;  1TK5 A;  2VFT A;  3LGM A;  3WIU A;  3WIV A;  3GG0 A;  3SCI E;  2Y0S D;  3PXG a;  4J5O A;  1RZM A;  3T1A A;  1EX8 A;  1FO1 A;  3QRP A;  3KJQ B;  3K5P A;  2EK6 A;  1X9W A;  1ZA2 B;  2ZIT A;  1RHJ B;  4X62 F;  1S49 A;  4UOF A;  1U48 A;  3KFW X;  4YUD A;  3VVU A;  1CPZ A;  2L9D A;  3FFI A;  4U9R A;  3E51 A;  3R2C J;  5HN0 A;  4RX6 A;  4M5H A;  4DN0 A;  4ZPD A;  4RW6 B;  4G3I A;  2MEW A;  2M0G B;  2AYG A;  4DDF A;  3VCD A;  2DT9 A;  2APO A;  1R8P A;  5AE1 A;  2CKW A;  3FQK A;  3D2W A;  2W7O A;  3EGZ A;  2N3O A;  5AE3 A;  4NLP A;  1IR0 A;  2GV1 A;  1URR A;  1XNR F;  3AJ1 A;  1BWE A;  1U45 A;  2LXF A;  3CCE S;  3HJF A;  3HM9 A;  3G82 B;  2CYY A;  2D3O 1;  1B70 B;  3W66 A;  2E5H A;  5L46 A;  2BAC A;  3TUJ C;  1TKZ B;  2AEM A;  4ED8 A;  1N6Q A;  5FLX Y;  4IDK B;  4U96 A;  4YDX A;  2C2R A;  3H59 A;  3SDE A;  3GFX A;  1NJI T;  4K4Y A;  2YWH A;  1U09 A;  2F7V A;  4NRT A;  3I0S A;  1I51 B;  4ILM A;  1HBN A;  1KLM A;  1XMB A;  3MEE B;  4HLB A;  1IBK J;  1T94 A;  3GTY X;  3OLA A;  1U6B A;  4XPC A;  1AXQ A;  5A0Y B;  1SKW A;  2HWI A;  2ZBQ A;  4F0K A;  3MR2 A;  1JKH A;  2CJK A;  5KTQ A;  2V68 A;  2MZ1 A;  1FRK A;  1TKX B;  2IC3 A;  1M5H A;  3FJ2 A;  3GON A;  4RLE A;  3SI8 A;  1NKB A;  2KKH A;  2CZ4 A;  5EWG A;  2OO4 A;  4PQU A;  4DZ6 A;  4NA2 A;  1S1T B;  2KT3 A;  5A6P A;  2VA3 A;  3IR6 B;  2IVY A;  5DET A;  4AL6 A;  2XWY A;  1HYS A;  4A8W A;  4NWB A;  2ZJQ Q;  1RT2 B;  3W9H A;  2DNN A;  1IR2 A;  1WC5 A;  3RRG A;  3KNA A;  2AP6 A;  1SKR A;  1SUQ A;  2QFI A;  5C24 B;  2BE7 D;  1T03 B;  1F60 B;  2RS2 A;  3C14 B;  2B6A A;  5A8W B;  2RQC A;  2R7R A;  5F8M A;  1S76 D;  3IGV A;  2I38 A;  1EKR A;  1SH3 A;  3OSN A;  3I6P A;  1UA1 A;  2EW9 A;  3MR6 A;  3ZXW A;  3AT1 B;  3A3N B;  2CIM A;  1BE4 A;  1UEK A;  1SJR A;  1NSQ A;  2C2N A;  2EFP A;  3QID A;  4ZVH A;  2IHR 1;  2D74 B;  2IRX A;  4WBF A;  4JI1 J;  2MY8 A;  3JS9 A;  5AT1 B;  2GHP A;  1FJ7 A;  2RB7 A;  2RRN A;  3ADA C;  1W25 A;  2XO6 A;  2SXL A;  2HWH A;  5IC4 B;  1NAQ A;  1RUS A;  5ADZ A;  1IKX B;  1FX2 A;  3UR3 C;  4ECW A;  4HDG A;  4CI0 B;  5DLG A;  3CMA S;  3TJA A;  3ZTS A;  4KGV B;  4P75 A;  1FTC A;  5D8H B;  1J5E F;  2UVV A;  2YKN B;  2UZA A;  2B4O A;  4I2P A;  2E1M C;  4P52 A;  3GIK A;  4WFA Q;  2I0X A;  4FZV A;  3TAR A;  3GIJ A;  4NXM F;  4YHH J;  2YBV A;  3MM5 B;  2V8V A;  1N0U A;  1VR6 A;  4UTG A;  1H6K X;  3OTC A;  3ULH A;  3J80 U;  4DCJ B;  3HF5 A;  4M5D A;  4ANC A;  4ZK7 M;  1LNQ A;  1NRK A;  3H40 A;  3DRP B;  2VOO A;  3WC0 A;  4USK A;  2KTQ A;  4K8R A;  1NH7 A;  3HSJ A;  4NOH A;  2D7S A;  2VKZ G;  1I94 J;  3EGW B;  1PKU A;  1B3T A;  2NXU A;  2WVD A;  1RA7 A;  1N48 A;  2JFD A;  1RXO B;  3PHT A;  3OQ2 A;  1SV5 B;  1VQO S;  4DR3 J;  5GAD U;  2C2K B;  4NE9 C;  2EEY A;  1WHV A;  3FEX B;  2IM2 A;  1DQ9 A;  5L1K A;  1TL1 B;  4WK1 A;  2W9C B;  1F3V A;  3DMJ B;  2WAQ D;  1TL4 A;  5CZV A;  1QSL A;  3Q89 A;  2YWW A;  4C48 A;  4F36 A;  3FEZ A;  4LUB A;  4CQ1 A;  1L3U A;  4X62 J;  4USI A;  2RH3 A;  1I6J A;  3HKZ D;  3MD3 A;  1DQ8 A;  1JLG B;  1U0H A;  3LQV A;  4M5M A;  2JEF A;  4Y6I A;  3H98 A;  2RNE A;  3Q8Q B;  1GT8 A;  3I56 S;  4ID5 B;  2F5G A;  4JI8 J;  2YKM A;  1HBO B;  2DNO A;  3TA2 A;  3PRB A;  4UST A;  3MAA A;  2ASJ A;  3QO9 B;  4MJK A;  2DIS A;  3DRR A;  3TQE A;  2JEG A;  2CPX A;  3OVA A;  4IH7 A;  3Q8V A;  3M9N B;  2D3Z A;  1SIZ A;  3AAW B;  2R8J A;  3R8Y A;  2KZM A;  1BMQ B;  2CPY A;  2MSS A;  1CBK A;  3GYX B;  3NCP A;  1H38 A;  3HSD A;  1Q7L B;  1ARO P;  3JYT B;  2O01 C;  3DLK B;  3BO3 A;  2CJX B;  2OEJ A;  2HLU A;  1FWK A;  1HNV B;  4USH A;  2O66 A;  4Y2C A;  5KG2 A;  2QGF B;  1JLE B;  2NQP A;  1UW4 A;  1X4E A;  3KLH A;  1HW8 A;  3CCL S;  2RDI A;  3CC4 S;  5IS2 A;  2YX1 A;  3N6L A;  4NLV A;  4EMD A;  4OYO A;  3OFH A;  1PAE X;  1F3F A;  1S0O A;  3OW2 R;  3SCK E;  2F9J A;  2KDO A;  4N76 A;  4F4W A;  4TU7 A;  2A10 A;  2CG8 A;  4ECU A;  4S0M A;  1VC6 A;  3C16 A;  4ZCM A;  3JAM Y;  1NKC A;  1OS5 A;  2JSX A;  4DZD A;  1FRM A;  3CUL A;  1C0U A;  1WC3 A;  1DZ5 A;  3M4X A;  4DS5 A;  2HYI B;  1S6U A;  2ZC4 A;  3N6N A;  1RAD B;  1R8B A;  3TQ1 A;  3NL0 A;  1LWE A;  2ZNZ A;  2ZNY A;  4WCE Q;  4LSL B;  3OL7 A;  1SKU B;  2XHW A;  4DL5 A;  2GMJ A;  2KH9 A;  3M32 B;  4RJV A;  3PVX A;  4RW9 B;  3Q2T C;  3MM8 A;  2DXD A;  2R7S A;  1T9U A;  2UXB F;  2QC3 A;  3MMC B;  3IM8 A;  1IM4 A;  2J9D E;  2OH2 A;  3KG4 A;  4JUZ A;  4DV0 F;  1YGY A;  1IBM J;  2ASL A;  3V6D A;  1OJ4 A;  3M8Q A;  4CLL A;  3DN9 A;  2LA6 A;  2V8P A;  5T7L A;  4J9U E;  1A0O B;  4J9S A;  1RT4 B;  4NYO A;  5IM0 B;  1FNO A;  5DDP C;  2UVW A;  5ITH A;  2ZH6 A;  2BZ2 A;  2ZH8 A;  2GO9 A;  4U67 Q;  3K8W A;  4DCP B;  1QTN B;  4PPZ A;  4DR5 F;  3KG0 A;  2UUT A;  2DNH A;  2L41 A;  2C42 A;  5KT4 A;  2HW3 A;  2V5H G;  1C2P A;  3OL8 A;  5HQ8 A;  2UVU A;  3OFE A;  2V6A A;  5G0R A;  2B51 A;  2RQ4 A;  2V9W A;  5GAE I;  3JSY A;  1U1O A;  2QV6 A;  1MRO B;  3LWM A;  2BA9 A;  5HBM A;  4ECQ A;  4R0J A;  2B9E A;  2R8G A;  2AJ4 A;  3RBX A;  4CNY A;  4KO0 A;  3UR0 A;  2K1R A;  5KG4 A;  4IG3 B;  3FEY B;  4FBU A;  4C3K A;  2OEM A;  4B3M F;  1N4L A;  4DR4 F;  3MCO A;  2LDI A;  3TYT A;  2H9Z A;  5HMX A;  4LF5 J;  2DGT A;  3G87 A;  2HMI B;  3PEH A;  1BXN A;  1NZA A;  3GYG A;  2G2O A;  2E44 A;  1VBZ A;  4BWJ A;  4F50 A;  4ZVF A;  3PEJ A;  3BBC A;  2DNZ A;  2BJ9 A;  5J1E A;  1KON A;  2PGC A;  5A6W A;  3CF5 Q;  1IBL J;  2DIT A;  1Y00 A;  1VK8 A;  1XMO F;  4ZPC A;  2MDA A;  2EKN A;  2DHX A;  1REG X;  1HKA A;  1CS4 B;  1FHT A;  4IQM A;  4J9O A;  2YNG A;  1KNZ A;  2E1C A;  4DSF A;  4R8U A;  2L9N A;  2WBR A;  1RAG B;  4WZQ A;  2I5J B;  2VPY B;  2POK A;  4N56 A;  3H5X A;  3UW1 A;  4K4U A;  2CPI A;  1JLA B;  2R7V A;  5ETM A;  2ZH2 A;  4NZ6 A;  4O4G B;  1N34 J;  4ERD A;  2LEA A;  5T41 A;  3DLH A;  3GCX P;  2EG1 A;  2V2V A;  3M8P A;  3IRX B;  2AWZ A;  1HBU A;  3NS5 A;  2BOP A;  4QR2 A;  4HKQ A;  1M5O C;  1ZA1 B;  2DO4 A;  3GMG A;  4QU6 A;  1WEY A;  3T6J A;  4LR7 A;  4OZN A;  4DLG A;  5CZX A;  5F0U A;  3IR7 B;  1M5V C;  2KN4 A;  1R7I A;  2CG4 A;  4FYY B;  4HDH A;  1KC8 T;  5LMU J;  5CYQ B;  4DV2 J;  4FXW A;  3DI6 A;  1NUE A;  4USJ C;  2DY1 A;  2ASY A;  1HNX F;  1EAY C;  2FZK B;  1HHT P;  1TTH B;  5A2Q U;  1NJX A;  1TK8 A;  3NBP A;  3FSI A;  1C1C B;  3BS9 A;  2ZHB A;  4DSK A;  4PWD B;  4ZPV R;  1RTJ B;  2C22 A;  3IS9 B;  1K47 A;  4DL7 A;  3MPY A;  4DV1 F;  5KG1 A;  2HHS A;  4ZJO A;  3P4U B;  4IFV A;  2FUG 9;  4CH0 S;  2VG6 B;  3M2U A;  1FT8 A;  1S57 A;  2FJB B;  2W4C A;  3W5Y A;  2BAN B;  3OT9 A;  4KAI A;  2HVE A;  1T9T A;  3D0H E;  2OPS A;  3PRD A;  3D3B J;  4KYZ A;  1X60 A;  2W8K A;  4OYB A;  2VQE F;  1UZD A;  4H4K A;  5DG9 A;  1VQN S;  5DQI A;  3CD0 A;  5LM7 E;  1VIS A;  2VFS A;  4RW4 B;  4FKX A;  4ES2 A;  1XR7 A;  2M8H A;  2HIQ A;  1U0S A;  3DLJ A;  4E8U A;  2DPJ A;  1FWL A;  2DCL A;  4P74 A;  1ZTT A;  1S0N A;  5KG0 A;  2RRB A;  4USM A;  1B0P A;  2EC2 A;  3OHA A;  1U8S A;  2XB2 D;  1SL1 A;  4AT1 B;  3KK2 B;  1Y5I B;  2HNY B;  2XSJ B;  2I6W A;  5K14 B;  2XZT B;  5J2P B;  3D6M B;  4C6A A;  3FDS A;  2C3P A;  3CD7 A;  4CM2 A;  1H2T Z;  1M1H A;  3HSG A;  2FB0 A;  2AEF A;  2HAF A;  3Q24 A;  2P2C B;  1VRU A;  4F2R A;  3C2P A;  4K7Q A;  2NLW A;  2UXD F;  4DMZ A;  1WKJ A;  4ZVO B;  3MPU B;  2QT7 A;  4ZP8 A;  1YX2 A;  2A2C A;  3HZE A;  4UT4 A;  2C1E B;  3E01 B;  5KFU A;  2IA0 A;  4CRJ A;  1SH0 A;  3I0R B;  1NJY A;  4LBI A;  3KLV A;  3T1Y J;  2DNR A;  2HHT A;  3R3T A;  2CQG A;  4WZM A;  2HVH A;  2EWH A;  2CQH A;  1XIQ A;  1V9O A;  2ADB A;  4DR6 F;  2RE1 A;  4K2X A;  4PAA A;  1CJK B;  1HBM B;  2X51 A;  3C6T B;  1IJF B;  2JC1 A;  3NCR A;  2W9A A;  2RUG A;  2AIR B;  1ZM4 A;  1RT5 B;  2DGU A;  4YP3 A;  4DR4 J;  3J81 Y;  1HNZ F;  2FQQ B;  3FRZ A;  4FNH A;  3VHQ A;  2VB6 A;  3KUG A;  5GAD I;  1S9E B;  2DY9 A;  1U6Z A;  3CC2 S;  2ZBR A;  1C1B B;  1D3W A;  2RIJ A;  2HQG A;  4QW8 A;  2ATL A;  1U47 A;  4KKO B;  5KFC A;  2DR5 A;  3K89 A;  2F65 A;  1TL3 A;  5BYQ A;  4A8F A;  2YPY A;  4OYM A;  2H48 B;  3R27 A;  2QLB B;  2YTC A;  3ISZ A;  2ZH1 A;  1O5J A;  1XMO J;  4OHY A;  1U26 A;  4LF7 J;  2P9C A;  2BJ3 A;  3GV5 B;  2DK2 A;  5B0C A;  4E98 A;  2NCK L;  3AA9 A;  2MZR A;  2V4Q A;  4ECY A;  2LYV A;  2IMW P;  5MLC V;  2M88 A;  3LAM A;  1D1U A;  2XS7 A;  4LVO P;  3AY0 A;  2AJQ A;  3MM7 A;  2JRS A;  4KPC A;  3P49 B;  3EJM A;  1VRQ C;  2ZVI A;  1FK9 B;  1Y3K A;  5ETP A;  3PIO Q;  2VKR A;  1RP5 A;  1U24 A;  2BYC A;  3PYE A;  5C25 B;  2GVZ A;  4ETZ A;  3FBC A;  3CJ3 A;  3OVB A;  2FHM A;  2X1G A;  3CCS S;  2NUH A;  4P2F A;  3ELH A;  1FKP B;  3PV8 A;  4EBE A;  4X4U A;  1EQ0 A;  4K4Z A;  1ACM B;  4DV7 F;  3EVM A;  3EIC A;  4NML A;  2FVC A;  3RB4 A;  2O67 A;  4RW8 B;  1WI8 A;  2HWT A;  5BJR A;  3HFZ B;  2Y1I A;  2EXU A;  2R7W A;  3BGO P;  3N0V A;  5K8P A;  3PYD A;  3ZNU A;  3D68 A;  4AE5 A;  4RNN A;  4ICL A;  1KKH A;  3WX4 A;  1VQK S;  1PJ5 A;  2BJE A;  2RDJ A;  1YTY A;  3MMA B;  2QMX A;  1TFY A;  1IKY A;  3CWJ A;  1LW0 B;  3PFO A;  3JB9 k;  3J7A N;  1T9X A;  3UDC A;  2CQ2 A;  2GFF A;  4OI3 A;  2V4J B;  4QIE A;  5KFO A;  3FBB A;  2W9B B;  4GC6 A;  2WVE A;  5HMW A;  4HT5 A;  1FFG B;  4P10 A;  4M95 A;  4YS2 A;  3TAM A;  3Q83 A;  3MMB A;  2KM8 C;  3J7Z 5;  3H2L A;  4QIW D;  3KLF A;  3CJK A;  1B64 A;  3KKF A;  2FY8 A;  5I3U B;  1D8Y A;  3QZ8 A;  5KFF A;  4WII A;  5KFR A;  4UW2 A;  3UPF A;  4DBQ A;  2VQE J;  1DY3 A;  1F0X A;  2H5E A;  2B9W A;  1E6V A;  4Q44 A;  4MTP A;  2MGZ B;  5IFM A;  1CJU A;  5EN1 A;  4DI6 A;  1PIE A;  3ET6 A;  5ETL A;  2JOQ A;  2R8I A;  5KG3 A;  2EFQ A;  2VOD A;  1FRH A;  3VAK A;  2W2N P;  2EFO A;  4LJM A;  1Q1K A;  5CCM A;  1XJW B;  2D9P A;  1DAX A;  2F63 A;  4EBC A;  1P9Y A;  2V2Z A;  4F04 B;  1XC9 A;  3GR0 A;  1L5U A;  2E29 A;  1O8B A;  3GG1 A;  3THV A;  1S1V B;  1VDH A;  3UNG C;  5JJB A;  1HWU A;  3UDL A;  3P8B B;  1EAR A;  2N7C A;  2VJV A;  4Q2M A;  1RAH B;  3WHI A;  3DRY A;  4I6W A;  4P7T A;  4Z37 A;  1ZBT A;  3RBZ A;  3AQO A;  1RT7 A;  2HQF A;  3MF5 A;  2MKC A;  2GJF A;  4URG A;  3RBD A;  2ZBI A;  2VFR A;  5CD4 A;  1A7G E;  1TUG B;  2MTL A;  1KVI A;  4QOT A;  5CYJ A;  1VQM S;  5DZ7 A;  2PMZ D;  4WE1 B;  4ER8 A;  4B9L A;  5C5J A;  4C2M A;  4RW6 A;  1MNE A;  3MFH A;  4ZIW A;  3NNA A;  1XR5 A;  4GKK F;  4NLY A;  4HL9 A;  4P72 A;  4WKR A;  4MAK A;  5BR8 F;  1S99 A;  4OIX A;  1F1B B;  4KHP F;  1XER A;  2HSE B;  4L3K A;  5KFT A;  3FMW A;  5IT4 A;  4WFZ A;  7AT1 B;  3G82 A;  2VON A;  2KZZ A;  1KFS A;  1U2R A;  4QQB A;  3EDR B;  2DRD A;  4ZLP A;  5KT7 A;  3ZTQ A;  2B3T B;  3JQK A;  1L3S A;  4MKV A;  5KFS A;  1R8C A;  4DL0 C;  4IDK A;  2GCF A;  3TR5 A;  4FP9 A;  3CCT A;  2UVR A;  4DUZ J;  2J0W A;  3KK1 B;  1DHM A;  1KFD A;  3FBF A;  2W24 A;  4LRD A;  3ZZZ A;  3MPV A;  5JVH Q;  2XGQ A;  3SDE B;  1S6P A;  4NLG A;  3MEE A;  4QIG A;  5DM6 Q;  2QFJ A;  2WW4 A;  5F3Z A;  3BV8 A;  2MQ8 A;  5RUB A;  4LMZ A;  1HHQ A;  3M05 A;  2UU9 F;  4FF3 A;  2I1R A;  2LVW A;  3DU5 A;  2WBM A;  4LSN B;  4IH6 A;  2NZC A;  1EQM A;  3MHY A;  4TLR A;  3TAQ A;  1U1M A;  3BDE A;  4NI2 A;  1L3K A;  1TKX A;  4WXW A;  1HQU B;  1NME B;  3K5O A;  4LBP A;  2MKY A;  2D3U A;  2A6M A;  1H2V Z;  1PBU A;  2H3E B;  2LEP A;  3EE3 A;  1ZM9 A;  2IC3 B;  1V5I B;  5A76 A;  4J9R A;  3ILO A;  4EI2 A;  1TR0 A;  1RU2 A;  4Y2A A;  2QYG A;  3MR3 A;  4EZ6 A;  1RAI B;  2KYZ A;  4PQU B;  4LQ9 A;  1U1N A;  2KYX A;  3CD5 A;  4DFM A;  2GVD A;  3RB6 A;  4ECR A;  3LUY A;  1Y11 A;  1BC6 A;  3G8S A;  1Y5N B;  1HYS B;  2NS1 B;  3MEC B;  3DDN A;  3V4I B;  3ILI A;  2VDH A;  4F26 A;  3DHX A;  1VBY A;  4C8O A;  4KPY A;  1G1X A;  2PMW A;  3UFC X;  3R2D J;  2CJY B;  3NNC A;  2FHK A;  2E66 A;  2V34 A;  3M8R A;  1TK0 A;  2F4V J;  3H5U A;  4LBH A;  2E1P A;  2YNF B;  2FHO B;  4RU2 A;  4CTA B;  3LPY A;  3G6E S;  1SJQ A;  2G1H A;  3E3X A;  1RT6 B;  1RBA A;  1WNE A;  3R7N B;  2MZQ A;  2IMO A;  4LR9 A;  5B08 A;  1WF1 A;  3PRV A;  2CZV C;  2E1R A;  4J9L A;  3JAM U;  3L7O A;  4ZVU B;  2H5J B;  2XS5 A;  4CO0 A;  1SJ4 P;  3DFE A;  1NJZ A;  4OYA A;  2P9E A;  4AND A;  4CO5 A;  3MEG B;  3D0G E;  3BR9 A;  3UCZ P;  1ULR A;  4C9D A;  1Y5L B;  1O0P A;  4V1A k;  4I67 A;  3W7B A;  1U4B A;  2DTJ A;  3MM5 A;  2QSW A;  3Q8P B;  2AV5 A;  3CPW R;  2WB1 D;  5DJB A;  4H4O B;  1WKK A;  4DSL A;  1XNQ J;  2RU9 A;  1WUU A;  3DNC A;  2HS3 A;  3E8O A;  2JZ5 A;  4RBV A;  5EWF A;  3POT A;  1QAY A;  2HK3 A;  3FGV A;  2CA9 A;  4M5D B;  1AZS B;  3A1Y G;  3A12 A;  5KFL A;  1Y10 A;  2W2O P;  2WRM A;  4MYU A;  4ZLN A;  3Q8R B;  3GCW P;  3R7B B;  4I6Y A;  1P8G A;  3NRB A;  2H54 B;  4G65 A;  2VUG A;  2PD1 A;  1F6T A;  2QO3 A;  3MTJ A;  3DLB A;  5KG6 A;  2LA4 A;  3JSB A;  4XDC A;  2P8I A;  3KDN A;  1F9E B;  3FVY A;  3Q2S C;  5HP1 B;  1DQA A;  1TL1 A;  2W9C A;  3DMJ A;  1FTR A;  3VAG A;  5KFB A;  1L3V A;  2PEH A;  4KGK A;  4ED1 A;  2G0C A;  4OX9 F;  4OZ5 A;  4IQX A;  4HHH A;  3T41 A;  5EDW A;  3FQL A;  1RWK B;  3GU0 A;  5KFK A;  3QQC D;  3DXB A;  4F4A A;  2E1A A;  4U8Y A;  4KHR A;  2EFG A;  5C42 B;  5J1N A;  3OXF A;  2KFZ A;  4ID5 A;  4GKK J;  2AGP A;  4DR2 F;  1UFW A;  3A8E A;  4DSE A;  3PTW A;  2MQQ A;  1MWZ A;  2VL1 A;  3QT7 A;  5I42 B;  3A4T A;  4AL7 A;  2WHO A;  4ZCL A;  4DPU A;  4TXS A;  1SQG A;  1NSK L;  3V81 A;  3MAA B;  2XQC A;  4OYW A;  3J81 j;  1VMB A;  3NEK A;  1JK9 B;  1TFW A;  3C6U B;  4B9T A;  4DR1 F;  3CIZ A;  1WDD A;  4DPW A;  2R7Q A;  1HNV A;  2E5G A;  4RZR A;  1QAX A;  4TVA B;  2ZJP Q;  4A8Q A;  3CCU S;  2JLF A;  3PDN A;  4KV8 B;  2ZWP A;  3VR1 A;  1JIH A;  3V5R A;  3GB0 A;  2XC9 A;  4F3M A;  2FD2 A;  2W7A A;  2UU9 J;  1R0A B;  4RUB A;  3K17 A;  4OHV A;  4DL4 A;  2LMI A;  4MIB A;  3TNV A;  2CPH A;  4OMF G;  2OPP A;  3H7H B;  5KOW A;  2IPO B;  2V2Q A;  2DKO B;  3M2R B;  3F73 A;  2N3L A;  2P6S A;  3CJ2 A;  1QVG R;  2P5V A;  3R5B A;  1C0U B;  2CAJ A;  1QE1 B;  1NJW A;  4XO0 A;  4MK8 A;  1LWE B;  2UUC F;  3M32 A;  1UP1 A;  2LQ9 A;  4NLW A;  3ZZR A;  4AD6 A;  3KMS A;  4RW9 A;  1WEX A;  2ZZN A;  3QLH A;  4DL6 A;  3WQP A;  4NX9 A;  3Q86 A;  4C97 A;  1X9S A;  2JFK A;  5CYM B;  4USV A;  4CLZ A;  3CME S;  4JB8 B;  4Q7A A;  1L3T A;  1PC5 A;  1SH2 A;  3MMC A;  3I5B A;  4ZCK A;  4RPF A;  2IJN A;  2MZS A;  2JNJ A;  1HD1 A;  3KLG A;  4LFB J;  1OSD A;  4DU8 A;  2NUU G;  2QE5 A;  4AQY F;  3RAM A;  1IWG A;  2HS0 A;  2ABY A;  4MKB A;  4O4R A;  5AJ3 J;  4YR3 A;  2XNR A;  1RT4 A;  1OY9 A;  5IM0 A;  1DBD A;  1NBE B;  2ZUA A;  1E6Y B;  3GIR A;  2BKP A;  3I32 A;  3MZI A;  2AZ3 A;  2GO8 A;  4U95 A;  2ZHA A;  1YK9 A;  2VG5 B;  4Q0B B;  1PJ7 A;  1X0P A;  2VBZ A;  4HHJ A;  3TX8 A;  3AJ2 A;  3G9C A;  1X4H A;  4DEZ A;  4ECV A;  5C7P A;  1YSJ A;  2CNL B;  1H74 A;  3EPG A;  1NXI A;  2J9C A;  4EBD A;  5HRO B;  1MRO A;  1JXL A;  1RT1 B;  3CJ8 A;  1SL2 A;  2E7X A;  3MUR P;  1MSW D;  2G4B A;  1U1R A;  2CDR B;  3NWR A;  5MAO A;  2A3J A;  2I8E A;  5HBM B;  2OLW A;  3CCJ S;  4IG3 A;  4C3L A;  2YWG A;  2Z2Z A;  4MFB A;  4I6A A;  4KO0 B;  4OZL A;  4ZP7 A;  3K5N A;  3I4P A;  3O2I A;  2CVE A;  4FKY A;  4QPX A;  2DH7 A;  4DV4 F;  3BN4 A;  4O3P A;  1EET A;  2OUG A;  5B0E A;  2EFN A;  2JDJ A;  4HHU A;  2HMI A;  2B8Q A;  3OL9 A;  3PKY A;  1N32 F;  3TOQ A;  2CQC A;  4KY3 A;  1X31 C;  4NCG A;  1MMD A;  2MMY A;  3P45 B;  2HBY B;  4FBT A;  2G13 A;  4TN2 A;  4M63 A;  1G7C B;  4B3T F;  3DRS A;  2OP5 A;  4B3S J;  4UY8 5;  1XTZ A;  3L09 A;  3BSC A;  2GIR A;  3OXG A;  1WC4 A;  2DNM A;  2I9S A;  1JJ2 R;  3NGS A;  3KHH A;  1SKS A;  3MR7 A;  3FMB A;  3QGP A;  3K5M A;  1RHQ B;  3CB4 A;  3FK4 A;  3T5K A;  4HTI A;  1NU4 A;  1BD6 A;  1IKW B;  4HAC B;  1JLB B;  4K4V A;  2J76 E;  2UV8 G;  3VV2 B;  4FS2 A;  4R8U B;  4W90 B;  4YFU A;  4OX9 J;  5K20 B;  4O4G A;  2CQD A;  2Y1L B;  3OJS A;  4NA1 A;  3IRX A;  3TA1 A;  1RHR B;  4AXJ A;  1U49 A;  2NYI A;  2QL5 B;  2JH3 A;  3BYR A;  4IRC A;  4B3R F;  2GMH A;  3A13 A;  5LSO A;  1F2H A;  4MKY A;  2V9K A;  4EFA C;  9RUB A;  4DR2 J;  2BXJ A;  1OWX A;  1JLQ B;  3J81 U;  2A0F B;  2V63 A;  3BN7 A;  1A6L A;  3G86 A;  1CQM A;  4ZIT A;  5CYQ A;  1V6H A;  2VBY A;  2C3Y A;  3O5T B;  1KVK A;  2HQ3 A;  2HG4 A;  5HSP A;  1CEZ A;  2VH7 A;  2ZBP A;  4C7Q A;  2GJ2 A;  3BSN A;  1WF0 A;  2CFX A;  5ETT A;  5K8M A;  2DR6 A;  4M5J A;  4DHV A;  2B9Y A;  2NRE A;  5KFM A;  1NDK A;  3A8J A;  3OR2 B;  1X4D A;  2FC8 A;  3IS9 A;  5H1S V;  4ELV A;  1NK9 A;  1IN0 A;  3TJ8 A;  4UZB A;  3B82 A;  4WYW A;  2EC0 A;  3HZG A;  2PA3 A;  1C4C A;  3CXC R;  2GML A;  3R6L B;  3VZI A;  2QG9 B;  4LRF A;  3R5A A;  3MXH P;  4IFV B;  4KE5 A;  3SV4 A;  2BAN A;  4QWA A;  2ILY A;  1OIA A;  2NXC A;  2NXJ A;  2MQL A;  1PO6 A;  5ETN A;  4H4K C;  4CCH A;  4DV6 F;  1Q7Y T;  2OPS B;  4K4W A;  3P5T L;  2MYF A;  4PCQ A;  3I87 A;  4RW4 A;  3QZ7 A;  4DPY A;  4NEZ A;  1T8E A;  2HHV A;  4R0E A;  1LK5 A;  5D0R A;  2ZKU A;  3OTB A;  2LEC A;  2FDN A;  2J0Q D;  3T6B A;  2RML A;  4B3O A;  2W25 A;  4CLS A;  3BGR A;  4CWB A;  2JC0 A;  3AOB A;  2RVJ A;  4A8S A;  1EP4 B;  3EX7 B;  4N5S A;  2H4W B;  2HNY A;  2XSJ A;  4O3N A;  4FF2 A;  5K14 A;  4J91 A;  1RHK B;  5J2P A;  5F3T A;  1GX6 A;  4NLO A;  3TZW A;  5F8J A;  2XMU A;  2DYA A;  3NXZ A;  2G1D A;  3OV7 A;  1VRU B;  5K9F A;  1YG0 A;  3JXO A;  2E7W A;  5E7O B;  3AD9 C;  1Q82 T;  4C8Y A;  1KS2 A;  2EPI A;  2V67 A;  4JV5 F;  1CVJ A;  3V4M A;  1U02 A;  1UJ5 A;  4U7U D;  2B4V A;  3E01 A;  2OGU A;  2CQ1 A;  1F5B A;  3ZZU A;  2PE8 A;  4JV1 A;  3I0R A;  5HMY A;  3RAX A;  1I1G A;  2Z2M A;  1D9F A;  3UI3 A;  4F0M A;  4ES1 A;  3IXQ A;  2O5D A;  2JHE A;  1KQK A;  4JI0 F;  1CJK A;  1HBM A;  2DGS A;  3GJR B;  3C6T A;  4JI6 F;  3TA0 A;  4IOC Q;  2QA4 G;  2IAJ B;  1RI7 A;  2DH9 A;  1RT5 A;  4YR2 A;  4CO3 A;  2LXU A;  2RF2 A;  1XMQ F;  2KT5 A;  1D0E A;  1S9E A;  2GHW A;  4BDP A;  4RW7 A;  4LFA F;  4LF8 F;  4CT8 A;  1GEH A;  1N32 J;  2RRA A;  4Y2I A;  2MLZ A;  1R0C B;  2MJU A;  1WWH A;  1VBK A;  2R2S A;  5E3R A;  5A2Q Y;  3CDW A;  2QSF A;  4LQ3 A;  4J9V A;  3M1V A;  3LAK A;  3U27 A;  1TL3 B;  3CGI A;  2CPJ A;  2FIU A;  4LRE A;  1X4B A;  2EBE A;  2BQU A;  1RQ0 A;  3RRH A;  5D0G A;  2J6U A;  1LWC A;  2DNY A;  3I31 A;  2GA7 A;  4NAS A;  2QL7 B;  4QR1 A;  1G3O A;  2MB0 B;  3RU0 A;  4USU A;  2CXE A;  4PEO A;  1NM2 A;  1N0V C;  1WEL A;  2MKS A;  4HT7 A;  1FK9 A;  2XI2 A;  1HQ2 A;  1RKJ A;  2MQO A;  2W4P A;  1GMW A;  4NLD A;  5FJ4 A;  2V69 A;  1YIJ S;  2RKI B;  5C25 A;  2XYH B;  4NMX A;  4F7V A;  2OEK A;  3MTK A;  1FX4 A;  2GVZ B;  2QMU B;  2LCW A;  2MQM A;  2CPZ A;  1AFI A;  2DHA A;  4OI1 A;  3O44 A;  3SZ2 A;  1WKL A;  1AUD A;  1HNI B;  2FTR A;  1YBU A;  4KGZ B;  2E7V A;  3A3P B;  4CNZ A;  4RW8 A;  4EYH B;  2XY6 A;  5ETK A;  2Z2L A;  5HVH A;  3P6Y C;  3IBC B;  1V3S A;  1WF2 A;  2GJI A;  4LF9 F;  2AJ1 A;  4WXO A;  4CH1 A;  1M1G A;  2QL9 B;  2ROP A;  4F4Y A;  3PO4 A;  4ICL B;  4NZ7 A;  3C15 B;  3CDB A;  5ETQ A;  4UUW A;  1RYR A;  1S9G A;  1RWV B;  2W1B A;  2GQ2 A;  3EZO A;  2KHC A;  2HRT A;  4ZOS A;  2UUB F;  2G2Y A;  2UXC F;  5L1J A;  2B7C B;  3NOG A;  4OYZ A;  1GQE A;  2PI5 A;  3TAM B;  2CPD A;  1NND A;  3BEG B;  1WEZ A;  2WON B;  4OQJ A;  4P6Q A;  4ES3 A;  2D3O R;  4YB5 A;  3MCN A;  4DV3 F;  3EXC X;  5B0B A;  3R97 A;  2DHS A;  1UA0 A;  1H2U X;  1CSJ A;  3G6V A;  2OTL S;  1VLY A;  3QFW A;  1E6V B;  4K50 A;  2NSC A;  4OJG A;  2C28 A;  3ET6 B;  3QWP A;  1T7P A;  2BQ3 A;  3DM2 B;  4RR5 A;  2JWN A;  1FRJ A;  2K3K A;  1S1V A;  2OAU A;  4LFC J;  4GRS A;  1TKD A;  4I56 A;  4C8L A;  2D69 A;  4NXN F;  2VPX B;  3K5L A;  1KR4 A;  1VLO A;  1PC4 A;  3Q22 A;  2O3D A;  3LO3 A;  1SC1 B;  2DNG A;  3I9V 9;  4OV1 A;  3RBE A;  2RIL A;  1RT7 B;  4JI3 J;  3S01 A;  4NL5 A;  3BQ2 A;  1OPI A;  2DEI A;  1S0V A;  4WE1 A;  2F1F A;  3QGG A;  2B7B B;  1S77 D;  5D15 A;  3MAH A;  3H0P A;  1R3N A;  1BQN B;  1H7X A;  3KLE B;  5CCL A;  5ETS A;  2YX4 A;  2OFG X;  1N5Q A;  3NNH A;  1YJT A;  2ZH4 A;  5D3G B;  3UD4 P;  2IJR A;  1VHI A;  1WC0 A;  2FVR A;  4CH7 A;  2K7J A;  1H7W A;  2OPR A;  4RKU C;  1SQF A;  3MD1 A;  4X84 A;  2HHX A;  3QRR A;  4O0N A;  4LF6 F;  2ZVS A;  3DDI A;  2MQP A;  2FVP A;  2YPZ A;  2XY5 A;  3OXL A;  4B02 A;  4L73 A;  4OX6 A;  2V2K A;  1UVK A;  4ZJQ A;  8ATC B;  1T3N A;  3THP A;  2KXF A;  3KK1 A;  3E2E A;  1X7V A;  3JQM A;  3MUM P;  4CO2 A;  3CDA A;  1UAW A;  1T95 A;  2CDQ A;  3PJ9 A;  4U7C A;  1P9Q C;  4LFA J;  1BUX A;  3OLB A;  1S6P B;  3AD7 C;  1UVJ A;  4L74 A;  1KP6 A;  4UQT A;  4GO7 X;  2WVB A;  2E5L F;  5B0D A;  1Y7P A;  4EWT A;  1J5O B;  4LSN A;  3KLI B;  1FF2 A;  4CIO A;  2C2E A;  5E5N A;  1N33 F;  1HQU A;  2YNI B;  3HX9 A;  1BHN A;  4NI2 B;  4DL2 A;  2BJ1 A;  4B9M A;  2XYG B;  2HHH J;  1SC6 A;  4A4J A;  2UUA F;  3F44 A;  1Y0H A;  1R8A A;  1UEV A;  4QIV A;  1X9M A;  2J5A A;  4X4R A;  3MFI A;  1WHY A;  1RDR A;  1KOO A;  3NS6 A;  5FDL B;  3MEC A;  2GVD B;  3EGN A;  2PO4 A;  1HR0 J;  2R3V A;  4FXD A;  3V4I A;  3B78 A;  3GIL A;  4ZDN A;  1TZ0 A;  5LMN J;  2E9R X;  5H9F J;  1SL0 A;  1DUR A;  4Y0F A;  3T5L A;  3CTR A;  2ZKT A;  3BPS P;  4LIR A;  3D7S B;  2A6O A;  5CH7 B;  4OZJ A;  2YNF A;  3PW0 A;  2RHS B;  4ZHR B;  4CTA A;  3W2W A;  4NYP A;  1RT6 A;  1WI6 A;  5IV4 A;  4DSI A;  4ANE A;  1WG1 A;  2R7O A;  2A2D A;  4DJB A;  1C0T B;  2AQ4 A;  1REV A;  3WDO A;  4KH1 B;  2HIY A;  2J6T A;  4WIQ A;  2NZ4 A;  4JI2 J;  3VAH A;  1VJQ A;  1RWO B;  4RUH A;  1YIT S;  1KQS R;  1DRZ A;  4RO0 A;  3I82 A;  4OJH A;  2Q79 A;  1IKV A;  1K1Q A;  4YN3 B;  1I5O B;  1RGV A;  3MEG A;  4IFY B;  2UXC J;  1ZM2 A;  5LJ5 Y;  2YH0 A;  3M2V B;  3AHP A;  4XDD A;  4LRC A;  3CSK A;  4DR7 F;  1XEZ A;  4TLQ A;  3AOA A;  3GE9 A;  1G6B A;  2XGP A;  3D1H A;  3BBF A;  3HKW A;  4H4O A;  4DQP A;  4OHX A;  5BYR A;  5J2M A;  1DJ0 A;  4DV3 J;  1N36 J;  4CLY A;  3QT5 A;  1XBW A;  3HHD A;  3FNN A;  5IT9 U;  3QGI A;  2MKH A;  1AZS A;  2I2Y A;  3VGS A;  3ENQ A;  3KJV A;  4IO1 A;  3POT B;  2YVS A;  1QUP A;  2EI5 A;  5FII A;  4NLU A;  4FNI A;  3UDV A;  4PUO B;  2DGW A;  2IRY A;  2MPU A;  4O3Q A;  1RWP B;  3GJT B;  3HT3 A;  5KFX A;  3BJY A;  4K5R A;  1WDT A;  5HP1 A;  2Y3Y A;  1Q5V A;  4LIW A;  4JI4 F;  4JYA F;  3ZTO A;  4HR2 A;  2MKK A;  1Z2Z A;  2LDY A;  1PSD A;  3DYA A;  4ZIV A;  2DR8 A;  2WZ1 A;  5HK4 A;  4PWU A;  5GME A;  3VTI A;  2ZH7 A;  2EG2 A;  2XBP A;  4N41 A;  5SUH A;  5C42 A;  3Q0A A;  2HFS A;  2M70 A;  3LP1 B;  2XMT A;  3GSI A;  3C19 A;  3I96 A;  2MHN A;  2Q3P A;  1FDN A;  3ZNJ 1;  4L6V 3;  3U1N A;  3CJQ A;  1B0V A;  3LAN A;  4KSE B;  5I42 A;  2DO0 A;  3EZ5 A;  1FI4 A;  4Q2L A;  3IN5 A;  2CJB A;  5EHH A;  5IC6 B;  4I2Q A;  4X2B A;  3W5X A;  4ED6 A;  1IUJ A;  4XK8 C;  1XNR J;  3V81 B;  3VAF A;  3C6U A;  4LF6 J;  2KU7 A;  1M5P C;  1YDL A;  2BVZ A;  5ETR A;  2BM0 A;  2XMK A;  3QAT A;  3B4M A;  2B4U A;  3TRG A;  5LSL A;  4O3O A;  3M7V A;  4Y65 A;  2PFD A;  4TYB A;  5THW A;  4D3G A;  1RHU B;  1CJT A;  1KWM A;  2PII A;  4KV8 A;  4JI5 F;  3HVW A;  3FCW A;  4DPT A;  4ZP9 A;  2K7K A;  1YJ7 A;  5IOL A;  3M6W A;  4ZVG A;  4X4Q A;  4FN5 A;  1R0A A;  5GAG U;  4LVN P;  2WCX A;  1ROF A;  1BQM B;  1FD8 A;  4DUY F;  3OSP A;  2QLW A;  2WVF A;  1W2B R;  1N33 J;  3M2R A;  2R7X A;  1U2C A;  2OPP B;  1T3O A;  1LWF B;  1QE1 A;  1ELO A;  2BE2 B;  2HEK A;  2F9D A;  4KIA A;  5DGB A;  1APS A;  3V2U C;  1G4C A;  1FJC A;  5I4M A;  2HND A;  3G2X A;  4IR1 A;  3MM6 B;  5D4N A;  1QSS A;  3NY0 A;  5CYM A;  4I69 A;  3QLH B;  5A8K B;  1HWI A;  3PJW A;  3M6X A;  5DS7 A;  3IA0 A;  4B08 A;  4NCB A;  3L7U A;  2VOP A;  4OYX A;  5ETV A;  1QDU B;  3VZH A;  1R6Y A;  1KBR A;  1Q8B A;  4QU7 A;  3KLG B;  1JNR B;  4URS A;  2QA1 A;  1S72 S;  8RUC A;  1ITP A;  2J6S A;  1PBA A;  1E6Y A;  2CRL A;  1S12 A;  3BDP A;  3W2V A;  5IQQ A;  2ZZT A;  4QWB A;  3KJN B;  4F4Z A;  1W2I A;  2VG5 A;  4Q0B A;  1KN6 A;  2L9W A;  3L4B C;  4Y28 C;  1WJ9 A;  1WSV A;  5I3P A;  2HS4 A;  4DOZ A;  1YKW A;  2R2T A;  1VIO A;  4QBU A;  3B4D A;  3PG9 A;  3T5H A;  3PW7 A;  1N5T A;  1AB8 A;  5CHC B;  4C8Z A;  2J8S A;  1H73 A;  5HRO A;  4X64 F;  3I9Z A;  1OQ6 A;  1RT1 A;  2Z57 B;  1NK4 A;  1W26 A;  1HNW F;  1GAO A;  1FD2 A;  1KSP A;  1GXL A;  3BSA A;  1NH8 A;  3FBE A;  2XCA A;  4IUF A;  1J5E J;  1RTH A;  1QTM A;  2W2M P;  2X3G A;  2H1Y A;  3SQO P;  4A8M P;  4JP8 A;  4MFB B;  4NXM J;  2FVS A;  1LEO A;  3BGF A;  3CIM A;  3HHL B;  3J7Y U;  1EET B;  3VF0 B;  2WSF C;  2BUN A;  5KFA A;  4OHZ A;  1FRI A;  4F8R A;  3HK2 A;  3NGU A;  3QSY B;  5E3Q A;  1Q0N A;  4NCG B;  5LT5 A;  4RNO A;  2Z56 B;  3GPA A;  2ZOG A;  1AT1 B;  2QLF B;  2CJQ A;  5I3Q A;  3DRS B;  5E2Q A;  2IM0 A;  3NG8 A;  3ENW A;  2CQ3 A;  4RWX A;  4C3M A;  3OTO F;  4W98 A;  1MWY A;  3NAH A;  2QJ3 A;  3T1H F;  1T9Y A;  4O23 A;  3RTV A;  1CUL B;  2E5I A;  4JI7 F;  3D1Q A;  3IBW A;  1IKW A;  4HAC A;  1JLB A;  2AHO B;  4Y00 A;  4ELU A;  3NMR A;  4A8X A;  5CA5 A;  4ZPA A;  1LK7 A;  3EPI A;  2OPQ B;  3MEK A;  3DLE A;  3NAI A;  2G2Z A;  1D9D A;  2DGX A;  3N6M A;  5KFQ A;  2RJZ A;  4I0W A;  1YBA A;  1IJE B;  4ED4 A;  1NLK L;  3H4B A;  1MN9 A;  2FGC A;  3NP5 A;  1UET A;  5F8H A;  1JLQ A;  1M1K T;  4M5K A;  1AUS L;  3JSM A;  2FJV A;  1U25 A;  3G8T A;  1VIX A;  2H5I B;  2GZO A;  3HT0 A;  3W60 A;  5E3A A;  2V8G A;  2VG7 B;  4PZV A;  4IG0 B;  2VIC A;  1S1U B;  3QFH A;  2FPH X;  1VQS A;  5AXK A;  4YOE A;  3RJM B;  4OYI A;  3ENV A;  4IRK A;  2KRB A;  1RBO B;  3MED B;  1FRL A;  1LOU A;  2VPZ B;  3OR2 A;  1R31 A;  3BGL A;  3CJ4 A;  2W8L A;  1TL7 B;  1EJ7 L;  3L7P A;  1CLF A;  2WOM A;  1JLC A;  4F4K A;  4ETX A;  2KXN B;  1VQP S;  2UP1 A;  1VQY A;  3W5Z A;  1FXL A;  2ZH9 A;  3CCR S;  3IAS 9;  3EXY A;  4TNO A;  4A47 A;  1WOR A;  3G71 S;  2N7Y A;  3AD8 C;  4X4S A;  2XO7 A;  2V8D A;  1CC8 A;  3BBB A;  3I55 S;  2WSC C;  1QJH A;  1ZPW X;  2YKO A;  5F8G A;  2OJ3 A;  3TWZ A;  2ALY B;  4BHQ A;  4X65 F;  4NYZ A;  2QMW A;  3NGK A;  2CNO B;  2H4Y B;  4Q5V A;  3M9O B;  2AYB A;  4B3O B;  2B8P A;  3AXM A;  3H4D A;  3QGH A;  4RUC A;  4JI1 F;  1QAI A;  3BGR B;  2GIQ A;  3IFE A;  1EP4 A;  4GVB B;  1FVQ A;  4OZ1 A;  3OD2 A;  4HVZ A;  5G4D A;  3DKD A;  4KR0 B;  4ATN A;  2XMJ A;  2R7T A;  2PEB A;  3MDF A;  1Q78 A;  3I4H X;  2UXB J;  1K44 A;  4A8O A;  4KFB A;  2HVI A;  2XMA A;  1HWJ A;  3TI0 A;  3M8W A;  2YQ1 A;  2FYX A;  3FC9 A;  2B5J B;  4ENO A;  4DV0 J;  1SC4 B;  1BLU A;  1FXR A;  4R5P A;  1SIW B;  3DGP B;  3PHE A;  4Y2K A;  2DHH A;  4ID8 A;  3D6T B;  1Z1Z A;  4YHH F;  4PYA A;  1NHK L;  1S1X A;  4ALZ A;  1TEL A;  2JLE A;  3G4S S;  4LT6 A;  3HO1 A;  2FGO A;  2KO1 A;  3HPO A;  4QYZ J;  2FC9 A;  2CUY A;  2HZC A;  4DR5 J;  3D6F B;  5F8N A;  3KDO A;  5LOQ A;  2XLI A;  3UQS A;  2ZZM A;  1TMM A;  4WP3 A;  2PSZ A;  4KJI A;  2Y1R I;  4DCO B;  4UQG A;  3RRK A;  4X64 J;  1EZZ B;  2HHW A;  1VHF A;  4PXD A;  1B4S A;  1I94 F;  1HNW J;  2AD9 A;  2HLT A;  3P5B P;  1NKE A;  3W62 A;  3PR5 B;  2IAJ A;  3X3U A;  1FDD A;  2WTF A;  3B54 A;  2YY3 A;  4KBI A;  4DR3 F;  3LP0 B;  1K9M T;  2GQQ A;  1HA1 A;  1LW2 A;  2RUS A;  5K8N A;  5AXM A;  3Q8U A;  2HUR A;  2FLO A;  2RF2 B;  4EK2 A;  4B3M J;  3HHL D;  1S48 A;  1PGZ A;  3PKM A;  2A18 A;  2BBE A;  1TMJ A;  2DGO A;  2XI3 A;  4RW7 B;  4V19 J;  3EYZ A;  4O44 A;  4Y3C A;  1FWP A;  2J7K A;  3FUY A;  3L9Z A;  3MUV P;  1TVR B;  2VZ9 A;  3K7R A;  2HRY A;  4PR6 A;  1HAR A;  1S10 A;  1U1K A;  4U6P A;  3RAQ A;  2QTW A;  4JI8 F;  3M1V B;  4ELT A;  2AW0 A;  4F67 A;  4J7C A;  5B09 A;  3G6Y A;  4RNH A;  4WKY A;  1D9A A;  3OTO J;  1OSC A;  5H9F K;  1UWB A;  3H2V E;  3PZP A;  1KDN A;  5C2G A;  3T1H J;  1LWC B;  1ZOT A;  3CC7 S;  4JI7 J;  1QM9 A;  2YWK A;  2WW8 A;  1B99 A;  2VF3 A;  4C11 B;  1V5V A;  1F2G A;  2QLJ B;  2RKI A;  1PYS B;  3CCW A;  1RTI B;  1Q79 A;  3KK3 B;  1BWV A;  3KUH A;  2R7U A;  3UO0 A;  2IVF B;  3T9N A;  4D3H A;  3D3C J;  4BCA A;  1FA0 A;  5DG7 A;  5F0W A;  2XSF A;  1ZAV A;  4IO9 Q;  3D28 A;  3VGU A;  1HNI A;  2VA2 A;  1IQT A;  3WBZ A;  4F2S A;  4C0O C;  3TEH B;  2W01 A;  4NEY A;  3PFE A;  1SI9 A;  1OY8 A;  2W7P A;  1AA1 B;  5GAG I;  1WG4 A;  2KT2 A;  1S9F A;  3AA8 A;  2KFN A;  4B9U A;  3DC2 A;  2RD5 C;  3RG6 A;  2BW7 A;  1HNX J;  1LV5 A;  1D8Z A;  4MIW A;  5EUH A;  3C15 A;  1KD1 T;  1JLF B;  3SSQ A;  1O51 A;  2YWE A;  1JMT A;  2CNK B;  3FCV A;  3CD6 S;  2U2F A;  5KFN A;  4ITS A;  1S9G B;  4DV1 J;  1QLN A;  3D1O A;  4J90 A;  3AOC A;  1UEU A;  3W1Y C;  1NPK A;  3DRX A;  4UUX A;  3T3F A;  1ZAW A;  2FJA B;  2WON A;  4ZLL A;  1YI2 S;  4WWS A;  3J7Z T;  3F41 A;  1YJN S;  2KVI A;  1X5S A;  3LH2 S;  4IYQ A;  4EEY A;  4YB1 P;  1IBM F;  2QRR A;  4PKD B;  2IDE A;  3HP6 A;  2FZG B;  2ZWO A;  3OTD A;  4H54 A;  3BQ1 A;  3BM7 A;  1FVS A;  5A8R B;  3C3L A;  2DIU A;  2HQC A;  4OHW A;  1TUW A;  3KWM A;  3S7R A;  1Q8K A;  3CMQ A;  3LP2 A;  3F56 A;  3TZZ A;  1HQE B;  3SEO A;  3UD5 A;  1RTZ A;  5D4P A;  4B17 A;  3WZ0 A;  4X65 J;  4J37 A;  4FYX B;  1XWL A;  3DM2 A;  2PN6 A;  1K73 T;  1Z2L A;  2HFN A;  2MZJ A;  4CLT A;  1T05 A;  2CWX A;  3RB3 A;  1Q16 B;  3X1L B;  4K4T A;  5DDR C;  4AYB D;  4DQR A;  3HD2 A;  3UDE A;  3NGT A;  3T5J A;  4CT9 A;  4TQS A;  3KHL A;  3NWG A;  3KMQ A;  2KVQ E;  2HNZ A;  4A8K A;  2GAH C;  2UXD J;  2ZJR Q;  3QPI A;  5KT3 A;  4YEA A;  2NPI A;  5HJY A;  2ZOF A;  1TAQ A;  3MR5 A;  4TYA A;  1HI0 P;  1BQN A;  3KLE A;  5IQ6 A;  4LF5 F;  2B0G A;  1LFP A;  1WTB A;  4UOG A;  1EB0 A;  3MMJ A;  4TU8 A;  2LQ5 A;  4HH1 A;  1S79 A;  5D3G A;  3CCZ A;  1UVN A;  2QLX A;  4A8Y A;  3PIP Q;  2AEJ A;  3J7Y I;  4WU2 A;  2B43 A;  3DHW C;  3MWB A;  4FYW B;  5DQH A;  3TZX A;  3M6V A;  4DR6 J;  1KOH A;  3A8K A;  2NSB A;  2UV8 A;  2OPR B;  1IBL F;  2HVZ A;  1DLO A;  3AXK A;  5KFW A;  2YKP A;  3CO9 A;  1Q53 A;  4Y34 A;  1QY7 A;  1Y3J A;  3D9B A;  2DPI A;  2JVO A;  1X4G A;  3M9M B;  5HAO A;  3LGN A;  5DZ6 A;  3S6E A;  5L9N A;  1HNZ J;  1EHW A;  4OV6 A;  4DF8 A;  3IWX A;  1SVD A;  1U8W A;  1FKO B;  1MMN A;  4PG4 A;  2E9Z A;  1R89 A;  3V6J A;  4QJV A;  2QZ8 A;  8AT1 B;  2RQK A;  1N34 F;  1J5O A;  1T11 A;  2HBR B;  3IG1 B;  3IO1 A;  3R5C A;  1KLN A;  3KLI A;  2ZDP A;  1JQG A;  2DCU B;  3M8Y A;  1Q81 T;  3TW0 A;  1IM6 A;  2YNI A;  4ZVT B;  2DHG A;  2DIV A;  1NDC A;  4OYP A;  1XR6 A;  1Q8I A;  2EK1 A;  1WOP A;  1RWW B;  3HVR A;  5LMU F;  2ZBC A;  2J0S D;  2C2O B;  4AUK A;  1UPM B;  3ZZY A;  4DV2 F;  1YRU A;  4PYD A;  2VHG A;  1FCA A;  3MI7 X;  2ZUG A;  2IYG A;  2Z8Q A;  4LF2 A;  3JTP A;  3VGV A;  1FRX A;  5FDL A;  4M1K A;  4BWM A;  1GMW D;  2XMV A;  2CJA A;  4MK7 A;  4Z7Y A;  3LPE A;  4OI2 A;  2OD6 A;  3ITH A;  1FFS B;  2MY7 A;  1F5C A;  3DOM B;  3VAI A;  2JX2 A;  5HMZ A;  4WP8 A;  1FFW B;  3M30 B;  1VQ6 S;  5HLF B;  3SMZ A;  4IOA Q;  4ZHR A;  3G8Q A;  4L75 A;  3HHN B;  3HSZ A;  4MK9 A;  2XTJ P;  3HMJ G;  4DV7 J;  4I64 A;  2MQN A;  3M8Z A;  6FDR A;  3W2W B;  2GC8 A;  1VJW A;  1YZ6 A;  1C0T A;  5D0H A;  1ZZF A;  2IFX A;  1UJ4 A;  4GVL A;  1SCJ B;  7FD1 A;  1REV B;  3Q23 A;  1NDL A;  4WK3 A;  5DQG A;  2AT1 B;  3CVK A;  4Y2M A;  4H4M A;  3QAU A;  1WC6 A;  2GGP B;  4FVM A;  2NYH A;  4IFY A;  3LA0 A;  2AF6 A;  1K1S A;  1IKV B;  3M2V A;  4P9S A;  2DXE A;  3GFZ A;  1R6V A;  3NGR A;  4MMO A;  3F0N A;  2ZFH A;  3J7A 1;  3EDQ B;  1G2E A;  1HMV A;  3JQJ A;  4K0K F;  4U7U K;  2Y8W A;  2VIH A;  1NK0 A;  3MCM A;  3OFG A;  2WK4 A;  3ZO7 A;  1RE1 B;  3W61 A;  1S7I A;  5LXY A;  5J2M B;  4ZVE A;  3PO5 A;  1NK6 A;  2QYC A;  2CQP A;  2ZD1 B;  1SPB P;  2JVR A;  3ILJ A;  3N4W A;  3WX8 A;  4ECS A;  1H3D A;  2QEX S;  2G0J A;  3KJV B;  3HVA A;  4ZVP B;  4PUO A;  1TKT B;  3IAM 9;  2DH8 A;  2IY5 B;  1X4A A;  1RCX B;  2XWX A;  3T1Y F;  4WJB A;  3K58 A;  2LFV A;  3ZC4 A;  1YQH A;  5KAK A;  5KFY A;  3ZZP A;  1RWM B;  4DUT A;  3IMQ J;  4X4P A;  3SCJ E;  5H9E J;  4F25 A;  3D54 A;  4ZP6 A;  2BW2 A;  3C46 A;  1S1W B;  3HCX A;  1HI8 A;  1MN7 A;  4YB6 A;  4KTQ A;  3AQP A;  1GTE A;  2KG0 A;  1VRT A;  3OUY B;  5CXT A;  3DYA B;  2W4D A;  2CNN B;  1OQ3 A;  5E41 A;  1SXL A;  4MIA A;  5EWE A;  1Y9O A;  3SQG B;  3LGH A;  3QSI A;  1LXN A;  1BQX A;  3LP1 A;  2EVZ A;  3PX0 A;  3H5Y A;  2U1A A;  4M5L A;  3TP2 A;  1T9V A;  2L3M A;  1K0T A;  1S6Q A;  3O3L A;  2HK2 A;  3MUT P;  5BR8 J;  4KHP J;  3KXD A;  3KHR A;  4J9K A;  2EFV A;  4ED3 A;  1AFJ A;  4YR0 A;  5IZH A;  4I2Q B;  3D4J A;  4N47 A;  4M94 A;  1HD0 A;  2AU0 A;  3CO0 P;  2JLG A;  3KNG A;  5IWA F;  4LF7 F;  3W8G A;  3DGV A;  1IVZ A;  4MYT A;  3KOA A;  4WFB Q;  5DRK A;  4DFP A;  2CAD A;  2XLK A;  2KXH A;  1S7H A;  3G6X A;  2HHU A;  5D4O A;  2K8G A;  2IYI A;  2HAI A;  3OR1 B;  1IXK A;  4ZKA A;  3BKT A;  1P1T A;  1GXU A;  1RK8 A;  1CJT B;  3QNW B;  2GAG C;  1V3Z A;  4OLO A;  2ACM A;  3GSD A;  3VAM A;  1S4F A;  3H42 A;  2HPU A;  5JXS A;  4ZS6 A;  1BQM A;  3BGU A;  3QRQ A;  1HFE L;  4CLU A;  1FNM A;  1YRT A;  2C3M A;  2BJD A;  4NLQ A;  1VI7 A;  1N8R T;  1GK8 A;  1RT3 A;  4M8L A;  2ZE2 B;  1LWF A;  2YQ3 A;  4HI1 A;  4UZC A;  1ZTW A;  3MM9 A;  1KVJ A;  2JL9 A;  2BE2 A;  3IP0 A;  4OX7 A;  1RAA B;  3QAE A;  4OX8 A;  2IJF A;  5B0A A;  1J2V A;  3GIM A;  4OZ3 A;  3ETM A;  2DNP A;  5LJ3 Y;  2VV5 A;  1N56 A;  1FER A;  4KGX B;  4DG1 A;  2VC1 A;  1RAB B;  3C66 A;  3U1L A;  3MM6 A;  1DFD A;  2XNQ A;  2HND B;  2KRR A;  2XZD B;  5A8K A;  1QAJ A;  5EX0 A;  4DX5 A;  1NK7 A;  4QYZ K;  1SJ1 A;  3LAL A;  4NPO A;  3DOK A;  4NLT A;  2ALZ A;  1T0T V;  2UUW A;  5D4L A;  1RB0 A;  3R6G B;  3QIP B;  4I4B A;  5IT9 Y;  4XPE A;  4YQW A;  4J9M A;  4ILL A;  1GMU A;  2DBB A;  3NMA A;  2JJ4 D;  2ZM6 F;  1DTQ B;  2M5Y A;  3DU6 A;  4JBC A;  3GFY A;  4HYK A;  2WB4 A;  2R2U A;  3NKY A;  1JX4 A;  4CLF A;  2QA4 S;  3W2V B;  3HLU A;  5J2Q A;  5ETO A;  4RUA A;  5B7W A;  1JWW A;  3U1M A;  4M5N A;  1QSY A;  5D78 A;  1PAU B;  2BMB A;  1QD1 A;  1UJ6 A;  2Y8Y A;  1NHU A;  1YVF A;  1UWA A;  2VJU A;  1NSP A;  1RWX B;  4TY8 B;  3RR8 A;  1TV6 B;  2IIH A;  1YWX A;  3SCL E;  2LQB A;  2NXN A;  2LQJ A;  4AL5 A;  1J27 A;  1PCA A;  2ZOM A;  3TVY A;  4QWC A;  2X1A A;  2BR0 A;  1HWK A;  2FZC B;  3DLG B;  5BYS A;  4P7V A;  4M5G A;  1PG5 B;  3GJS B;  2OML A;  1RTH B;  4PG6 A;  2QA2 A;  4URQ U;  5F41 A;  4K0K J;  5LL6 d;  3CJR A;  2Q1L A;  4KRW A;  3S8S A;  3HHE A;  1QUV A;  3HHL A;  4FS1 A;  1ZAX A;  2BOA A;  3R9L A;  1NK8 A;  6FD1 A;  4B9V A;  3K0J A;  1MML A;  4G1Q B;  2ILZ A;  2PT0 A;  2AJF E;  3WC2 A;  4KGM A;  2KG1 A;  4RNM A;  4FVC A;  3K57 A;  3VWS A;  5L38 A;  1KRP A;  1RWU A;  3P96 A;  3OL6 A;  4UY8 T;  2CZ9 A;  3UN3 A;  1NHV A;  5KT5 A;  4Q8F A;  1U7L A;  3QWU A;  2EBG A;  4N7T A;  2WVC A;  1UVL A;  1CUL A;  1RTD B;  4F3Q A;  4PWW A;  1ICE B;  4WTY A;  4IRD A;  2IVM A;  3HJV A;  2CWK A;  2OPQ A;  5KFJ A;  1K8A T;  1CG2 A;  1JXE A;  3ISN C;  2R8H A;  2DD8 S;  2VPW B;  1R27 B;  4HI2 A;  5GVQ A;  2HZA A;  4PXE A;  4NZ0 A;  3DLE B;  2HHQ A;  4DUZ F;  4C8M A;  1MU2 B;  4CYU A;  2C3O A;  5KT6 A;  4NA3 A;  3UVJ B;  5JMN A;  4CLK A;  2F8H A;  2CQ4 A;  2HVD A;  3T19 A;  1N5V A;  1OO0 B;  2XLJ A;  2DNK A;  2J7U A;  3GZ7 A;  2QN6 B;  2FLL A;  3UN5 A;  1UL3 A;  3JSM B;  5C2C A;  1N5Y B;  4G1P A;  2VG7 A;  1YBT A;  4IG0 A;  1RA6 A;  3CDU A;  3H2U B;  1P1L A;  2OTJ S;  1S1U A; 
#chains in the Genus database with same CATH homology
 3GJT B;  2HBR B;  3GJQ B;  4ZVS B;  1RWO B;  1PAU B;  1RWN B;  1RWK B;  3IBC B;  1SC4 B;  2HBQ B;  4ZVT B;  3KJF B;  1RHU B;  4ZVP B;  1RWX B;  1IBC B;  2CJY B;  2QL9 B;  3P45 B;  2HBY B;  1QDU B;  2XZT B;  1BMQ B;  2Y0B B;  2DKO B;  1PYO B;  2HBZ B;  3IBF B;  2C2Z B;  3R7S B;  3D6M B;  2QL7 B;  4ZVQ B;  1ICE B;  1RWW B;  4ZVR B;  4LSZ B;  2FQQ B;  2P2C B;  3GJR B;  3R5J B;  1GFW B;  3P4U B;  1RWV B;  2C2O B;  5IC4 B;  2XZD B;  1RWM B;  2CJX B;  3D6F B;  2CNL B;  2C2K B;  3R7B B;  3R7N B;  1SC1 B;  2H4W B;  3R6G B;  4ZVO B;  2H5I B;  3GJS B;  1NME B;  3KJN B;  1RHK B;  2H54 B;  1RHQ B;  1SC3 B;  2XYH B;  3QNW B;  4DCO B;  2H51 B;  2CNO B;  2C1E B;  2H4Y B;  3SIP B;  3RJM B;  1RHM B;  2CDR B;  2QLF B;  2CNN B;  2XYP B;  2CNK B;  3NS7 B;  3R6L B;  2H48 B;  1F9E B;  4ZVU B;  3D6H B;  4JB8 B;  5K20 B;  2QLB B;  3EDQ B;  5IC6 B;  1I3O B;  2H5J B;  2C2M B;  3KJQ B;  2Y1L B;  1I51 B;  2H65 B;  2QLJ B;  1RHR B;  4DCP B;  1QTN B;  2QL5 B;  1RHJ B;  3EDR B;  4DCJ B;  1RE1 B;  1RWP B;  2XYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...