1GFWB

The 2.8 angstrom crystal structure of caspase-3 (apopain or cpp32)in complex with an isatin sulfonamide inhibitor.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
b'HKIPVDADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 (APOPAIN, P20)
publication title Potent and selective nonpeptide inhibitors of caspases 3 and 7 inhibit apoptosis and maintain cell functionality.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2000-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1gfwB00
1RHKB 3R7SB 1F9EB 3D6FB 1GFWB 1RHJB 1RHRB 2QL5B 3SIPB 3KJQB 2DKOB 2CNLB 3EDQB 1RWOB 3R6GB 2CJYB 4ZVPB 1QDUB 3GJTB 3GJQB 1ICEB 3GJSB 2H65B 2H4WB 2H4YB 1RHQB 2P2CB 1BMQB 1QTNB 4JB8B 4ZVTB 3KJFB 1RWWB 1RE1B 1RHUB 3R7NB 3P4UB 2QLBB 2QL7B 2H5JB 2XYHB 3QNWB 2HBYB 2FQQB 1RWPB 2CNOB 2HBZB 2CDRB 3R7BB 1RHMB 1I3OB 2C2ZB 1RWMB 1IBCB 2QLJB 2QL9B 4ZVSB 2XZDB 5K20B 4DCOB 2H54B 4LSZB 4DCJB 1NMEB 2C1EB 1SC3B 4DCPB 3KJNB 2CNKB 2HBQB 4ZVUB 2C2OB 2XZTB 3GJRB 2C2MB 2H5IB 2H48B 1SC1B 2Y0BB 4ZVRB 3EDRB 1I51B 3D6HB 1PAUB 3D6MB 1SC4B 3RJMB 1RWNB 2CNNB 3NS7B 2C2KB 1RWVB 3R6LB 3P45B 5IC6B 2Y1LB 1RWKB 1RWXB 4ZVOB 2H51B 2HBRB 2XYPB 1PYOB 4ZVQB 5IC4B 3IBFB 2XYGB 3IBCB 2QLFB 3R5JB 2CJXB
chains in the Genus database with same CATH superfamily
2CPHA 4A48A 2DGXA 5KT6A 2ZDOA 4DV2F 3FDSA 1U24A 1BQNB 2NPFA 1BY9A 1Y4ZB 1QAJA 4TQSA 1S4EA 3DOKB 1WSRA 2PN6A 2VPWB 4C9DA 2WSEC 2WCXA 3CCVS 4LQ3A 2HHPA 3OD2A 1DHMA 4C8KA 3RW7A 2K2PA 2F8HA 3M8RA 3NOGA 4CH1A 4BHQA 2CJ9A 1HI1A 1F5CA 2BJEA 3A3NB 2YKMA 4KGXB 3U1NA 2PT0A 1WF0A 4I2QA 3C14B 4LQ9A 3UCUP 3AFGA 1UL3A 3DCAA 4HLBA 1XN9A 5KFOA 3IAM9 2AYMA 2J76E 4WTOB 1FHTA 2JL9A 3PHTA 3CVKA 2RE1A 4NLDA 4ZN3A 4M5DA 5KOXA 5J2PA 3FCHA 3RB0A 1XMBA 5CCMA 5CA5A 4LSNB 3O44A 3KJQB 2VJUA 1Q8KA 2ILYA 3FUYA 2BW2A 5HSPA 4ZPBA 5KFDA 4MIBA 2EFNA 2QG9B 4YMEA 4IG3A 4G1IA 5DS7A 4FPIA 2PFFB 3U7JA 5HP1B 2IJFA 2I0XA 3OJUA 2V94A 1NB2A 1FXDA 3CD0A 1PBUA 1R89A 3T9ZA 3FEZA 4XDDA 4I64A 4RWWA 4M5KA 2WOMA 3OVSA 3H25A 4IYQA 1HR0J 5E2QA 2D69A 2BRKA 2IBKA 3G82A 1W2IA 2IM1A 1DARA 1GTEA 3GCWP 1SV5A 2KZZA 1QAYA 1LWEA 1G2EA 2R2RA 2HVEA 3H8YA 3UR3C 3ILOA 1U26A 3L4BC 4C8YA 4K4SA 1PKUA 1WKJA 5KFRA 1UP1A 4DS5A 3CEDA 2R42A 4OV1A 4DPXA 7AT1B 4A8KA 2MQOA 3M2UB 3DRSA 4A8XA 1ZZFA 2M3DA 5J2QB 4X4TA 4AFFA 3D66A 4EFAC 4DV3F 1JJCB 3R5DA 3UN3A 2HZVA 1VQ6S 4K4VA 3KMSA 3V6DB 4C4WA 1RTHB 3FNNA 2CPZA 1GH8A 1P9QC 2BJ3A 2HBZB 1D8YA 1HBOA 4NZ7A 4QZVB 1Q0NA 5HAOA 1Y3JA 2O01C 5THWA 2OELA 1Q86T 3ILLA 5FLXY 4PUOB 4IRCA 4DR7F 4NLPA 2EVZA 2M5YA 1M0SA 1HQUA 5E3AA 4DUYJ 1I94J 3O3LA 4KB7A 1RAJA 2C2OB 2QSFA 4JP8A 4UOCA 2R3VA 3PV8A 3M6VA 5SZTA 2DBBA 1EX8A 3I4PA 3OXFA 1D1UA 1UTAA 1T9UA 1WOPA 2CYYA 4ENOA 3OV7A 3TVYA 4LFBF 2AGQA 3T5HA 1RJJA 1TZ0A 3KNAA 1RYRA 1GEHA 3ILJA 2XWXA 1N5YB 5ETVA 4WU2A 1FK9B 4TLRA 2UVVA 4ED3A 2RJZA 5GAHU 4DQPA 3QWUA 2UXCJ 4NMLA 3VAKA 2RDDA 4RUAA 3CO9A 4YHHF 3PEJA 4DR2F 3N5FA 2ZM6F 2E29A 1X4BA 2E7WA 1VGYA 2OPRB 1OY9A 4F0KA 2ALZA 2EEYA 4H4MB 5I3PA 3OFFA 4CQ1A 3M30A 4GVBA 2KO1A 4DR6F 3I4HX 4HR2A 2YQ1A 1VQ7S 1R8CA 3KLFB 4I7FA 4RW9B 3L7UA 2HVDA 4PEOA 4USWA 1FXRA 3CSKA 5ETNA 1RAOA 4RW6A 2BOAA 4RR5A 2CUYA 1RB0A 3CCSS 1JLFB 3M8WA 3AJ2A 4L72B 2DHHA 1Z2ZA 3KK1A 1UWBB 3T3FA 1H7XA 1WF1A 2GIRA 1T02A 1KQGB 4E2FB 2I2YA 2HHHF 2MGZB 3DGPA 2LQJA 4CTAB 4P10A 1IWAA 1SH2A 4P71A 2XLKA 3EVMA 2CQGA 3CJRA 4JI5J 1CS4B 2Z2MA 4U9RA 1PCAA 4C48A 1FKOA 2DRDA 4TYBA 4DLEA 4P9SA 1YQHA 4HDHA 4L3NA 1UVMA 4RO0A 1C2PA 4C0BA 3UFCX 4GC6A 2JX2A 3POTB 1GXUA 2V34A 2JH3A 3H5SA 4CT8A 3JXOA 2GVDA 1YBTA 5CYJA 3CMQA 1L3SA 3QJLA 3MD3A 2PEBA 3E2EA 4LSLA 3OFHA 1HNVB 2DPJA 1NPKA 4CH7A 3TX8A 3BSOA 1IKXB 1S6OA 3NEKA 3NCRA 5EUHA 4J9LA 4A8SA 3KG1A 4JI2F 2DHGA 1RTZA 3OBIA 4ZCLA 4LFAJ 2RKIA 3BBCA 3US5A 1RT3A 3MMJA 1RAIB 4NXMF 3A3OB 1LOUA 3DOLA 4QWEA 3CJQA 5MAOA 3HVTB 8RUCA 2BR0A 3M8SA 2WRMA 4N8NA 2J8SA 4IG0A 2H5JB 3UNGC 1N56A 4CM2A 1JJHA 3MR7A 5KT3A 1F9HA 5LSLA 4HH1A 3Q8PB 2X3DA 1MWZA 3RYLA 3LGMA 1HHSA 2DCUB 2HFVA 3K59A 4NCGB 1REVB 5D6GA 5IQ6A 3CTRA 4DCPB 2FB0A 1ULRA 3MM9B 1S76D 3OVAA 2CJAA 4WK1A 4F4AA 1G6BA 3D1HA 1X5TA 5HANA 2DH9A 4X4SA 2JZ5A 1UJ6A 1R0BG 3KYLA 4TQRA 1CBKA 3G6VA 2AJ2A 3NGDA 3DLKA 4HACA 4XPEA 3CW2C 4HL9A 5C42A 2YX7A 1LW2B 2QA1A 5BYRA 3PX4A 3H5XA 2V8VA 4LR7A 1OPIA 1R31A 4QYRA 1FNOA 4QW8A 4PRFA 3HVRA 1L5UA 4XAKA 5LOQA 4ES1A 1RHQB 4TY8B 1R6YA 5ITHA 4AYBD 3C6TA 1QJHA 3M05A 4NPOA 3A8IA 3RB4A 2MLYA 1Y11A 1UZHA 4Y2MA 5A8RA 3CD5A 4USMA 5E5NA 2PMZD 3LAMA 3MR3A 2W9AA 4ZOSA 2I5JA 2JVOA 1NDKA 5FJ4A 1ZAVA 1R7IA 2V4JB 2PO4A 3AA8A 4S0MA 3ZTQA 1QSYA 2ROPA 3CCLS 1WI8A 4UTGA 4YB5A 1J5EF 5F8LA 3I9V9 3HVAA 1Q82T 4PXEA 1NB7A 3UVJB 5HK4A 3PW7A 2WVEA 2XSJB 4RPFA 1WC4A 4MKVA 1S1TB 4JI6F 2HHVA 3KHGA 4TLQA 4JI7J 4MH8A 3ETOA 4Q5VA 2OFGX 1PC5A 3EICA 4BDPA 4TVAB 1KLNA 3P96A 3HJFA 3SV3A 3DOMB 4OYBA 1RA7A 4DMZA 3QIPB 5FDLB 1IKYA 2QL7B 4JI3J 1KVJA 2F5GA 4QU7A 2D9OA 1EKRA 5J2MA 1URRA 3J80U 4MKYA 2KI2A 3WDOA 4Q7AA 4IOAQ 5A6WA 3SDEB 3ONQA 4X4QA 4ZCKA 3KLEA 1DTTA 3NGSA 5F0WA 5SUHA 2UUBJ 3WHIA 4X4NA 4CO0A 4KO0A 3TR5A 3BGRA 2UUCJ 4DR1J 1JXEA 4IO1A 4X64J 3MUMP 4KFBB 1Q4RA 1X5OA 4JI1J 3PEHA 3WIVA 2VA2A 1WUUA 5A76A 3R5JB 1H7WA 4FNIA 3SI8A 2X1BA 4IO9Q 5H1SV 4CLSA 1ICEB 2H4YB 3O1LA 3PRBA 4RX6A 5DG7A 1IBLF 3MUTP 3K5PA 4TU9A 3FQLA 5A0YA 1NAQA 3LP1A 5BR8F 1FDDA 1RHMB 1EETA 1U2CA 3C15A 4X4PA 1U1OA 1NKBA 3I0SB 3KJVB 2R2SA 1ZZNA 2RUSA 1FRLA 4R0EA 3OSNA 4NYPA 3EGZA 1QTMA 3FFIB 1WG1A 3PW0A 2XMMA 2HMIA 3DRPB 4ZJOA 3C16A 3GFHA 4LRCA 1U09A 1UCNA 5CAAA 3NWGA 4FXWA 4MK9A 4CLFA 2FC8A 3CD7A 2W7OA 2FC9A 4IQMA 2AEFA 5T41A 4CWBA 3TOQA 3MD1A 1KQFB 2XY5A 4LF4J 1T95A 3DLEA 4U7UK 3GJSB 5KFVA 3MECB 4QIWD 1O6XA 5I42A 4JOUA 4DHVA 3LWMA 1DLOA 3BR9A 5HMZA 2ZUAA 3JS9A 2BJ7A 4WF9Q 4DBQA 2B3TB 4FYYB 3G9CA 1Q8BA 2XTJP 3NG8A 2HNYB 4DQQA 2H54B 3GFYA 1KD1T 1NBEB 2P9EA 3ZZPA 3W5ZA 1FT8A 4CLLA 1FTCA 3M8PA 1R3NA 3UNYA 4ICLB 3FK4A 3H7HB 1JLCA 2OEKA 1S99A 4EBCA 3EUNA 1CJVB 5DDQC 3IMQJ 1QSSA 4DV5F 1HWUA 1TKZB 5HQMA 2MZQA 4TYAA 2E7VA 3NXZA 3GIIA 5KG7A 3PZPA 3FBCA 2OI2A 1FO1A 4DSKA 4DDFA 4ECYA 3H2VE 3LP0B 1VQMS 1PYTA 2VG7A 1TMMA 2UUWA 3UDLA 4RUHA 2JC1A 1R8AA 3Q2TC 2BACA 5GAGU 4ZLLA 2E5LF 5U47A 4OLPA 4GKJF 1HBUB 5CXTA 3N5BA 3TVKA 4CLKA 1H98A 1KWMA 3HZGA 2HS3A 2CQ0A 2KXFA 2C3UA 3KLGA 1U2RA 2AMCB 2ZFHA 1S9EA 1MWYA 3MMCB 4C3LA 1JLQB 4E8UA 1O0PA 2KG0A 3LUYA 3FSYA 2OMOA 5FIIA 3C46A 4DN9A 3V5RA 2XY6A 3MAAA 3MCOA 3UI3A 3OFEA 2LQ9A 1B0PA 5IM0A 1NJYA 3JSRA 4ZA1A 3HHNB 1H2TZ 5F0UA 3J7Z5 2DEIA 2PA3A 3HD2A 3SQOP 4AL7A 4K59A 2FHJA 2C2DA 3DI6A 1S6QB 1W25A 3MAHA 4WXOA 2MYFA 1C0TB 2R7UA 5KG1A 3AB2B 1T05B 5GAEI 3BGLA 2EBEA 2RS8A 5AJ3F 1MU2B 6FD1A 4DR5J 3NY0A 4Q2LA 2OPSA 3HHLD 4LF7J 1SL0A 1NDCA 3LGNA 2KU7A 2VOPA 2CZ9A 3VVTA 2BZ2A 1Q16B 1C0UA 1S0VA 4USJC 4IUFA 4PG7A 3FCWA 1N0VC 5C2CA 1A6LA 2UVWA 3PYGA 1S0NA 3QYYA 1TVRA 2AX0A 1YJ7A 3W63A 1YITS 1UPMB 1NXIA 4V19X 4BWMA 1XBWA 3THVA 1WI6A 4DV0F 1GK8A 4FYXB 3CDAA 2H65B 3M1VA 1FVQA 4RU2A 5T7LB 3ZZRA 2ILZA 3SQGB 3HKWA 4KV8B 4C7QA 5DLGA 2OAUA 3HLUA 3IG1B 4N8OA 1O51A 1WF2A 1NSKL 4H4KA 3E51A 2DR5A 1DTQA 1TL3B 4J9QA 2DY1A 2VG5B 2K7JA 5IFMA 4F3OA 4IFYA 4NLXA 6FDRA 2DNKA 3DYAA 2KVIA 2XEXA 5D0EA 4Y34A 2R7SA 4A8OA 4FF1A 2QIFA 2A6OA 2HHWA 4F4KA 2M7SA 2NXCA 1FJGF 1OQ3A 3ZO7A 1CJTA 3G8QA 2R8IA 1YTYA 1JNZB 2YNGA 2IDEA 4ZVQB 5HLFB 1H72C 1T9TA 2BA9A 3VCDA 2QLWA 1NJWA 3CIMA 2VKZG 1RHKB 2CRLA 3R7SB 4RNNA 2XCPA 4QOTA 1ROFA 4O3PA 2B9EA 4I4BA 4LF8F 4X4VA 4YOEA 3GJTB 2GHWA 3H42A 5E0OA 2OEJA 1GMWA 1FRMA 3I5BA 1B64A 1PJ7A 4WE1A 5AXLA 3QLHB 2MKKA 2C28A 4ED1A 3MM5B 4V19J 5KFBA 4FYDA 3R5GA 2COLA 1L3KA 3EM1A 1NSAA 2OJ3A 3QPIA 5L1KA 1T03B 1URNA 3K58A 2W2PP 2BE2A 2W24A 4JI8F 4KGZB 3OUYB 1P9YA 2GMLA 5K8PA 5D3GA 2RQMA 2MDAA 2DTJA 1EB0A 3J7AN 3A1YG 2CPEA 4OYMA 3MPVA 4B9MA 4KRWA 1FJEB 2ASLA 1TL1A 2DXEA 3G6XA 2RDIA 4B02A 5KFPA 1EQMA 3KLIB 2NCKL 1F5AA 1CJKB 1ZA2B 2BBEA 2XI3A 1RT6B 4B08A 5AXMA 2LEBA 2ZD1A 2LECA 1H0HB 1FE0A 4M94A 2HFNA 5G0RA 2IM2A 2GA7A 2BKNA 3HXMA 3TUJC 4WZQA 1XMQJ 2O67A 3I5CA 3QT8A 3J80Y 1N36F 2OTLS 4IDKB 2W9CA 2XGQA 3DDKA 1Q95G 4DU7A 3KTQA 4G65A 5D78A 5DETA 3MEEB 4OX6A 3IFEA 5J1NA 3ULHA 1B0TA 3TAPA 2BKOA 2LCWA 2GC8A 4OJ1A 2K06A 3FMWA 4ZVSB 4HHHA 7FD1A 3QO9B 3X1LB 3LPYA 3TRGA 3RGIA 5D0GA 3KLHB 2ACYA 3IC1A 1S9FA 5KFYA 3TNVA 2L08A 2P6SA 3ZTRA 1WTFA 4L76A 3AXKA 1RAAB 3EMTA 4KSEB 1PG5B 3AHPA 2YKNA 4F8RA 2W4PA 2GAGC 4OZ1A 2BJ8A 4HI2A 4WFBQ 3C2PA 1U8WA 4C11B 1MWQA 4OJ3A 3DHWC 2PI4A 2X51A 1QAXA 2HVHA 2HQIA 3ZZYA 1F9EB 1XK8A 2D3UA 3CDBA 4KC5A 2HWIA 2DNRA 2HHSA 5F3TA 2V68A 3PCOB 2E1MC 1RE1B 1Z2LA 2JEGA 1RSCA 4ANEA 3HJVA 2IBOA 5F3ZA 3LP2A 1NK5A 3SFGA 2E1CA 2NSCA 3VZIA 3MDFA 3RRGA 1K44A 3CUNA 2B9XA 4KKOA 1ZAXA 3CJKB 1RAGB 4PG4A 4OI3A 3HVWA 2MLXA 1HQ2A 3CCRS 4ECTA 1J5OA 4OZNA 2QJ3A 1QE1A 2IMWP 2GHPA 3ET6B 2OPQA 4DUTA 1M1HA 3RU0A 3QGGA 1YG0A 3OTEA 2PI5A 2Y1LB 3BO2A 4NASA 1JLAA 3HT0A 5DDRC 3D5MA 3I0RA 4P7TA 2D3ZA 3EPGA 1MLAA 2KFZA 3D6FB 3GB0A 4UT4A 2Z56B 3D2WA 3NMAA 3TUZC 2CVEA 5D0RA 1YZ7A 5DQIA 2DNYA 3G2XA 4YEAA 2ZH9A 2HNZB 1IBLJ 1RWWB 3W2VA 2VF3A 5M2UA 2EG2A 1D3WA 1RBLA 2Y8YA 3M2VB 1NLKL 1F9FA 4K2JA 3BSNA 4QWDA 5H9EK 3M9NB 3NNHA 3UE2A 4RWXA 3O2IA 4RW7B 1NPRA 2DNGA 4CLUA 2DJWA 2LQ8A 3GIKA 4F2SA 5LL6d 4Y65A 1NEEA 1D0EA 6AT1B 3PX6A 2AGOA 2OPPA 3QATA 5C24A 3PXGa 2ZBRA 3GU0A 4DQIA 1QM9A 2KFNA 1YRUA 3IGVA 1UA1A 3T9NA 2YKQA 2HGLA 3H40A 1AB8A 2BJ1A 3DRXA 5HROA 4DQRA 2HW3A 1T8EA 4I56A 2CJKA 1TAQA 2J0QD 3TQEA 5KFCA 2YQ0A 2QFIA 3TZZA 4F04B 2MQLA 4DL0C 1RHJB 3HPOA 2KL8A 3DMJA 2L41A 1F2GA 2XZWA 2HQDA 1YKWA 1UVJA 3MEDA 1N48A 2NXUA 4DV6F 5KFIA 2VQFF 4Q0BB 1QY7A 1U1KA 4GC7A 4KH1B 4ZP6A 2V8HA 4JV1A 1RABB 3PR4A 2O1PA 3MWBA 5AXNA 2NYHA 4RUCA 3DNCA 3KLVA 2RS2A 3BGUA 1VBZA 2J9DE 2LFVA 3SCKE 3SSSA 2XMWA 2VPXB 3V4IB 1P6TA 1IKVB 5GADU 2JFDA 2CJBA 2HAIA 4KGKA 4X65J 1WG5A 2DIVA 2YPZA 4WP3A 3THPA 3BH6B 3QJPA 1Y7PA 3CB4A 3L7PA 1HD1A 4WFNQ 2K1RA 1MMDA 1UZDA 3GIJA 1BWEA 3BO4A 4PWDA 1EHWA 2CNLB 3Q8VA 2P8IA 3HDSA 1JLEB 2GIQA 1Q78A 3I82A 3OR1B 3NGTA 1SBRA 4AL5A 3IWLA 4B3TJ 1VC5A 1WOSA 3QNWB 1S1UA 3D4JA 3SXLA 2M2BA 4N76A 1X4AA 1S6PA 2W2NP 1EP4B 4K8RA 1X4GA 4R5PA 3K8WA 4QIFA 1BUXA 3BREA 5IXUA 1CJUA 3H5YA 2XULA 5E7OB 2QL9B 2YNIA 2VC1A 4OYIA 2RMLA 1NK8A 3CCJS 2UUAF 2KT5A 1K8AT 2MMYA 4MFBA 4RNMA 3IO1A 4Q2MA 1S4FA 3V6JA 3QWPA 4X66F 4TXSA 2QA4G 4AT1B 2E9ZA 1SIWB 1HLWA 1WEZA 4F4XA 2VKRA 2XYPB 5DZ6A 1BQNA 1FFSB 4NEZA 2YKMB 1N88A 4I6AA 4MIWA 3M7VA 2W01A 2VBYA 1VQNS 4WIQA 3IS9A 3P8BB 3NMRA 1VQLS 3A4TA 1BMQB 3KKFA 1VBXA 2CWXA 2KN4A 1LWXA 4DXLA 1HBNB 4RW8B 4O44B 5GAHI 1T7PA 1GQEA 2DGOA 2JC0A 1FRKA 1VMBA 3R5CA 3T5KA 3C14A 3H98A 3M6WA 5KFFA 4LMZA 1KQSR 3FZBA 4DG1B 1F3VA 1SC6A 4UQTA 1DRZA 2FD2A 3VAIA 4EUVA 3BZQA 1P27B 3R9LA 2HZAA 1PJ5A 4J9OA 5B0AA 4OYXA 5CABA 4FXVA 4ZMMA 3H4DA 4NRUA 3T1YF 4DL3A 3MUVP 5ETPA 5I4MA 2ASDA 4LSNA 4HVZA 3VTIA 4CLZA 3CJ8A 2EFPA 3H4BA 2WOMB 2GO9A 1M5KC 2GVZB 4OQJA 1WD6A 3JQJA 2HK2A 1BD6A 1U6FA 5J2NB 4U95A 3JAMU 5HP1A 3BQ1A 5CYQA 2YWEA 1LWEB 1RWUA 3MM7B 3TWZA 4C3MA 4R0JA 2NYIA 2HHXA 2XSFA 2C2NA 2ZBQA 2ADBA 4ZDNA 1VRUA 2IJNA 3C3LA 2QLJB 1KEKA 1YK9A 2MB0B 2ASYA 2BUNA 4DZ6A 3R1HA 2OFHX 4BC7A 2C2EA 3S6EA 2AV5A 1WACA 3OTOF 2FTRA 3IRXA 1Y9OA 2VDIA 4AXIA 4KHPF 2HYIB 3Q24A 2D9PA 3O8WA 5LMUF 1HBOB 1FA0A 2J9DA 2E44A 2AF6A 3SMZA 3PTWA 5J2QA 3NBPB 2R7OA 3SEOA 4CO1A 4ID8A 2DGUA 4K5SA 3CPWR 3J7YI 2ZOFA 1IKWB 4PQAA 4KYZA 3IN5A 1GMUA 1DBDA 3V6DA 4ZCMA 4ZHRB 4Q8EA 1SL2A 4D3HA 3W2WA 2ZBPA 3A3PB 1KNZA 3DM2B 1YIJS 5KAKA 3L09A 4RBUA 2UU9F 1RK8A 5L8RC 3THTA 2OMLA 3CO0P 1VQKS 4PUOA 1HHQA 1HI8A 2LA4A 2V8PA 3W62A 5EX3A 2RIJA 1R6VA 2R4FA 2DNQA 1X4HA 4GMKA 4YP3A 3KXDA 4DZDA 4ILMA 2D1CA 4KH0B 4Y2AA 2DCLA 5IT4A 4Z37A 4BWJA 4FS2A 4U96A 1RZMA 3J81Y 1NSPA 2Y0BB 3AD7C 5ETQA 4ZITA 2F40A 4XPCA 2YQ3A 4DQSA 1KFDA 2QYCA 1N5YA 1FK9A 1WHVA 2W9BB 3LALA 5IOLA 2KTQA 2IRYA 3I6PA 3TJ9A 2VG6B 4GVBB 3CGIA 4QU6A 4J9MA 2IC3B 5KT4A 2WVFA 3BN4A 1S59A 2Q3PA 1H2UX 3HCXA 2XQCA 2IYIA 4I2PB 2EFVA 3V4MA 2N3LA 4CLTA 5CD4H 4OX9F 5KFQA 4JYAJ 5IQQA 2L3MA 4URGA 3BJYA 4UZBA 4H4MA 4PQUB 4JB8B 4QWAA 1LK5A 1S9GB 3R7NB 2U2FA 3PYFA 3LAKA 2EFGA 1DJ0A 2YPYA 1IWGA 4URQU 1XR7A 3DRYA 2ZNZA 4Q45A 3DGPB 1REGX 1SXLA 2C3MA 5K8MA 1PILA 4WYLA 3FBEA 3AOCA 1YSJA 3AOAA 1JLFA 2AJ1A 5ETKA 1QUPA 4DFMA 1FKOB 4DSJA 2XCAA 4C8LA 4CCHA 2MKCA 5A2QU 2GX8A 3CCUS 3K5NA 4EBEA 4CTAA 1UETA 1VJQA 2W7PA 3NGUA 4OZJA 1WC6A 3T1HF 4LT6A 2VPYB 4DPTA 4DN0A 3UD5A 4JI4F 2VZ9A 4O23A 3IBCB 4J9PA 3MFHA 1N34F 4B17A 2Q79A 1UEUA 4EO8A 3CCTA 1YJTA 2C3YA 2NSBA 2QYGA 3PFOA 1IBMF 3IAS9 3N79A 4WFAQ 1OQ6A 3HHDA 4OI4A 1QUVA 1XNRF 4KGVB 2RT3A 1S5ZA 2FHMA 5HMXA 1HNWF 1HNVA 4DUZJ 4RNHA 1RT3B 5EGYA 2N4CA 1IKXA 9RUBA 4X2BA 2JVRA 4GO7X 1N32J 2N4DA 2XMUA 2EFQA 3SSRA 3L95X 2CNKB 1T11A 2Z4PA 3B8HA 2KJVA 3DGVA 4MT1A 2LEPA 3ZZUA 3PW5A 2F8MA 1SUQA 1L3TA 4F67A 1U1LA 5IC6B 4YR3A 4E98A 1RT4A 3D1OA 5D4NA 1XEZA 1KKHA 2C3OA 1KTQA 4I1TA 2R9LA 2QGFB 4ED7A 2DVIA 1TL4A 2KHDA 4N7TA 4GKKJ 4YDDB 2P2CB 3D0HE 4HTJA 3RUBL 2DNZA 4ETZA 2ATLA 4Y00A 4DV4J 3HKZD 3BBBA 2F4VF 4B3RJ 3HM9A 2MPUA 4NCGA 4HACB 1Y0HA 3QRQA 5C42B 2HQCA 1NJZA 1U8SA 3MM9A 2HG4A 4C97A 3EGVA 2BQRA 4M5GA 5L1IA 4NLTA 2EWHA 4HI1A 4OHVA 3C6TB 3BPSP 1DURA 3B4MA 3M8ZA 2H48B 3C8YA 3MTKA 1LW2A 2Z2ZA 1FKPB 4USUA 2QO3A 1NK4A 2G2YA 2WVBA 2I1RA 2XMAA 2I5JB 1TK5A 2F9JA 1QLNA 2LQ5A 3VZHA 1WELA 2OEMA 1S0MA 2VBZA 4USTA 4WPAA 3KHRA 1YJNS 2BV3A 3EDQB 3GJQB 3OLAA 4FN5A 4A8MP 3JYTA 2KDOA 4J9KA 4KT0C 4G6VB 2HGMA 1RKIA 1HPZB 4NZ6A 4DSIA 1M5HA 1U2FA 4Y3CA 3BKUA 4K50A 4TNOA 3WQPA 2V4JA 2YTCA 4CDIA 1WKKA 1AUDA 2KFYA 2CDRB 2HPUA 4I6WA 1E6YA 1WEXA 4FZVA 3AJ1A 1RYSA 4B3MF 3E3XA 3GWCA 4CZCA 3JTPA 4EU0A 2RQCA 1GAOA 1R27B 3PY8A 2NUUG 4OV6A 4DR3F 4ECUA 5C25B 3OPKA 3UVJA 4P2MA 2XZTB 2XSJA 3PJWA 1S1TA 2H5EA 2AEJA 5G4DA 3KG4A 4BCAA 5J2MB 2I8EA 4P2SA 3QGPA 2MZRA 3X3UA 1ZA1B 1KOHA 3W1YC 3ENAA 4UQGA 3KLEB 1Z4UA 3DOMA 4LBHA 3MPYA 1W26A 1WNEA 2B7BB 2K7KA 3Q23A 3GILA 3QIPA 5FDLA 5I3QA 1A0OB 2DD8S 1UEKA 1S72S 3BN7A 3VHQA 2M8DB 4ZS6A 4TY9A 3BGRB 2E1AA 1X7VA 4Y6IA 3SDEA 3B78A 3M2RB 1WC3A 4WZMA 2RD5C 1AFIA 1U1RA 2LMIA 1FRIA 2EG1A 4HHJA 4LF1A 4ER8A 2ZH3A 2J8AA 3FRZA 4DPYA 2W1BA 4H4OB 3N6LA 4AXJA 2OKQA 3DXBA 2K3KA 1EAYC 4F2RA 4USHA 1ZM2A 1XC9A 4MMOA 3P49B 3FSIA 2PD1A 5KFNA 2XMKA 4DX8H 4K0KJ 4NL5A 4OI0A 3G6YA 4OZ5A 3LP1B 3L9ZA 4QWCA 2J6TA 5K9FA 4WCEQ 1EETB 4NLRA 4YUDA 2EK6A 3L7OA 1NHVA 1NJIT 1HNZJ 1MNEA 1UVNA 1PO6A 2CQBA 4UUWA 4LRBA 3OTCA 4P73A 2LKZA 2XO7A 1T3NA 1Q7YT 3RAQA 4DOZA 2ZE2B 3CC2S 2IVYA 1WG4A 3C16B 4M5HA 2OP5A 5JVHQ 1KVIA 2VQEJ 3V81B 1AUSL 1SPBP 1JX4A 2DR9A 4ECRA 3K2YA 2RU3A 3KJVA 1FRJA 2MKHA 3HSDA 4LF9J 4I0WA 2DRAA 3FFIA 5KFMA 1N6QB 5CH7B 1BLUA 5HVFA 4Y2CA 1AT1B 3DRPA 4ZIWA 3D28A 4KTQA 2AEMA 3NAHA 2WAQD 3HSJA 4QBUA 2X1FA 3MGJA 3LOUA 3HT3A 2HLUA 5B08A 1VYAA 2HFSA 2WZ1A 2EPIA 1NK7A 3WX4A 2ZOMA 4EZ6A 3T1YJ 3ZNUA 4JV5J 2FZGB 3NCQA 2A6MA 3S01A 3AOBA 2UXDF 3EXYA 1Y10A 4DR4J 4QPXA 4ZPTR 2O66A 5ETMA 2XYGB 1SKRA 5RUBA 3MECA 1YJWS 2ZH7A 4JBCA 1WHXA 3W8GA 3JQKA 4B3SJ 1H2VZ 2NLWA 4Z7YA 3W66A 3M8PB 2WK4A 1FERA 1U1QA 3GPAA 3WZ0A 2CQPA 1JLCB 3F56A 2DISA 2VV5A 5AE1A 3TZXA 2J9EA 2HNYA 4RUBA 4DV1F 2GJ2A 1B7YB 2BM1A 1TV6A 2I38A 3AAWB 3ISZA 4ECZA 1T9WA 2R7QA 1N8RT 3O6QA 1OO0B 2V5HG 3E01B 1OSCA 2GZOA 1V6HA 4OX7A 2YNHB 4ELTA 1KDNA 1NCLA 4DV7F 1IR1A 3EX7B 2D74B 1RDRA 4LFCJ 2N7YA 4PZVA 3CT9A 2GCFA 2WTFA 3NGRA 1HARA 1TKZA 3BM7A 1UVLA 1HNXF 3OXGA 2ZVIA 2LLZA 5JXSA 2MZTA 1HA1A 2JJ4D 3A12A 4I67A 1NK9A 1SJ3P 4UZCA 2HRUA 5F8MA 2CKWA 3G87A 4NI2A 3LP0A 2I6WA 2QL5B 3PW4A 5KFJA 3GV7B 1FRXA 5LMNJ 1B7FA 4KPCA 4YFUA 3KLGB 4LBPA 2BANB 3OHBA 5A8WB 1OY6A 4CO2A 3ZTPA 4UW2A 1H38A 3CXCR 5F9LA 3PYEA 2APOA 3PNIA 1KRPA 3CJTA 3CCES 1HBUA 2OSQA 4R8UA 2KM8B 3MAAB 1RLDA 2ZH6A 3TP2A 3W9JA 1N5TA 2M70A 2MEWA 1S1WA 1AYEA 2XNRA 4W92B 3MM6B 2ZZMA 3MMCA 3PRDA 2HS4A 1JLQA 4NXNJ 3C19A 4BLGA 4YY3J 3IBWA 5A2QY 1QSLA 3KJNB 1ZYQA 1GTHA 4AQYJ 5E3QA 2CAJA 3P3DA 4F25A 3D6HB 2BX6A 4OIXA 1SC4B 4K7QA 2DGQA 2CNNB 3GQCA 1ZTWA 5E3PA 4PKDB 3W8PA 3FSXA 2HVZA 1T9VA 4WIIA 2J6SA 1HYSB 3BO3A 2DPIA 4ZLJA 3MOZA 2LU1A 3ZTSA 2G0CA 2LDIA 2OPSB 3AB4B 1NO8A 2YVSA 2IFXA 2AYBA 3HSZA 3TANA 2MY7A 5AXKA 1GFWB 2L9NA 3N6MA 1S6QA 2G13A 2EXUA 2PE8A 5DRKA 3ZTOA 3R6GB 2HHTA 1C0TA 4DPUA 5KTQA 2ZH4A 4J9RA 3M6XA 1WORA 1I5OB 1MROB 2LDYA 1T05A 2XI2A 4ECSA 1C0UB 2ZHAA 3D7SB 1MU2A 2L9WA 1VQSA 2XM3A 3MF5A 2MKJA 4HHUA 1LWFB 1VRTB 5DQHA 2V2QA 3D3BJ 1KBRA 2FZKB 5KFHA 3HFKA 4URSA 4RNOA 3Q8QB 2V50A 3DRRB 1CC8A 1NMEB 3MHYA 4L74A 4OHZA 1D9DA 4C8OA 1I51B 4EWTA 2VOOA 1HR0F 2I9SA 4HYKA 1HQEA 4NYZA 1DTQB 2M9KA 3CDEA 4DL4A 3D6TB 3W5YA 1UJ5A 2D7SA 1RISA 1CVJA 1S1XA 4PG5A 5CQGA 2KT2A 3N28A 1KVKA 4J9VA 3OQ2A 1UEVA 3QT7A 3KK2B 1F6TA 4C8NA 4KQZA 1RTJA 4LR8A 3BEGB 3OW2R 3IG1A 2V9WA 1U6BA 1TL3A 1LNQA 3LTOA 1U1PA 1N33J 2VG5A 5LSOA 5IT9U 4WK3A 1JKHB 2HWHA 2FLPA 4USKA 3IXQA 4DS4A 4U8YA 1OYEA 3MCNA 2FY8A 3FBFA 3J7YU 5L38A 2A3JA 2FVPA 5F8HA 2MHNA 2CQCA 2UZAA 2MQPA 2V0NA 3GJRB 4WE1B 1MMLA 1WSVA 3CIZA 1QVGR 5LXYA 1VISA 5HLFA 4RL1A 2HEKA 1UPPA 4A8FA 1L3VA 1TKXB 1SQGA 1KFSA 3OHAA 2IY5B 3S1TA 5L46A 2H51B 2HBRB 4DUYF 1I94F 4QPTA 2DIUA 2FVSA 4P74A 2YNFB 1M5VC 2Z30B 1XJWB 5D3GB 3QLHA 4OJGA 1NK0A 3FRYA 5DJBA 4L6V3 1S49A 1MMNA 1JLBA 1TL1B 2RUGA 2G1DA 5A8KA 2CZVC 1PJ6A 5CYMA 2F4VJ 1T03A 3UWTA 3VQTA 2ZZNA 1PGZA 2D3O1 3OUYA 2KM8C 2AIRB 3GYNA 1Z1ZA 3S8SA 4DPOA 1W7WA 3T41A 2VIHA 2GQ2A 1HW9A 3DDNA 1IBCB 2ZD1B 4CRJA 4M1KA 2UXCF 3QZ8A 1SQFA 1APSA 3HHLA 4P2FA 5G0RB 1U4BA 2UXBJ 1XMOJ 1LK7A 3KLIA 2HQ3A 2Z2LA 1D9FA 1XNQJ 3DLJA 1CJKA 1GXTA 4ZKAA 3JTOA 3TEGA 2W9CB 4O3OA 3ZZZA 3HHEA 2ZHBA 4BBYA 3H90A 2CFXA 1H73A 1TL5A 3I32A 4ED5A 2G0JA 5IC4B 3QGIA 3C6UB 3BF4A 2VICA 4NLSA 3ZNJ1 5KG2A 3NP5A 3OXLA 2WBRA 1RLCL 2KT3A 1EZZB 1HNIB 3C66A 4QIEA 2QSWA 2DNOA 1EJ7L 3QJJA 4LF6J 4DLGA 2QTWA 3MEEA 5J1EA 2WVDA 5EX0A 4ZVFA 2YKNB 3UN2A 1CQNA 3DFEA 2R7TA 1R0AB 1LFPA 5GMDA 2VUGA 3PX0A 3UCGA 2HK3A 1VJWA 2MTLA 3QO9A 5IWAJ 2DR7A 2F3JA 1SQEA 3KLHA 4JI5F 1I3OB 4F7VA 2VD3A 2KJWA 4ANDA 4A8WA 1JIHA 2OO4A 3JSYA 2AP6A 3SCJE 4ZIVA 2XG8A 1F0XA 4ALZA 1X9SA 2WHOA 1RT2A 2B5JA 3D1QA 3I31A 3QMQA 1JJ4A 3NCPA 3W64A 4JI0J 3CJ4A 4OYPA 4C11A 4J90A 1JNRB 4LVNP 1PC4A 2FLNA 4NA2A 3LP2B 5EDWA 4DSEA 1NKEA 1DQ9A 4H4KC 2W2QP 3BKTA 3VAGA 2V8DA 5IZHA 4KJIA 2YWGA 3SSQA 5GADI 4Z2XA 2BKPA 1JQGA 2MQ8A 1RT1B 1KONA 4F0MA 5ETTA 3U1LA 2ABYA 4L3KA 3V6KA 2X7IA 1X4CA 1JXLA 4F0HA 1LFWA 2OPQB 4LFAF 4N5SA 1C1CB 2RU9A 3TARA 4JV0A 5A6PA 1FD2A 3GZ7A 1P8GA 2ERRA 1YLXA 1JLAB 2LXFA 1BQMA 2J5AA 2C2ZB 5I3UA 2CQ3A 2MJUA 1U1MA 2ZDPA 4XIUA 1SC3B 3KDOA 3HZEA 3W2VB 4ZVRB 4USVA 1LXNA 3SV4A 1PAUB 3N9UC 4PABA 4A47A 2XMTA 2GNKA 4DV2J 2YKPA 3TZYA 2YXLA 5GMEA 1YI2S 3GCXP 2F4FA 1FF2A 3R97A 1HW8A 2CG4A 1CEZA 2V4RA 4PPDA 2J7UA 3SCLE 2HNZA 2RHQB 3TAQA 3RR7A 4ZK7M 1A9NB 1AZSB 2OPPB 5C24B 1RU2A 3M2VA 2RB7A 2OIHA 4ZPAA 4B3OB 2HFOA 3HX9A 4QYZJ 1MN9A 2PMWA 3QSIA 3K17A 2RQKA 7FDRA 1XR5A 2B56A 1LV5A 5LT5A 4FF3A 2VH7A 4F4WA 5EN1A 1C4CA 1XIQA 4YR2A 1TKTA 2E9TA 3BGFA 3T19A 1TFWA 3JB9k 2HRYA 4O4GB 4IQXA 1NJXA 4K4XA 5HMYA 3DMJB 3KG0A 3KMQA 4M5LA 2WVCA 1PSDA 1GT8A 5JJBA 3PHEA 1CULA 4G1QA 4ZJLA 1NH8A 4EMDA 4ZVHA 2LXIA 4L75A 5L9NA 1Q81T 4OYZA 3IR5B 1CG2A 3DU5A 2UXDJ 1ZBTA 3EXCX 3GFXA 3ADAC 2XWYA 3GTYX 2AW0A 4OX8A 2B4OA 3HP6A 2V67A 1TK8A 5DDOC 1ZPWX 3LQVA 1V5VA 1BE4A 1U48A 2J0WA 2PA8D 5DZ7A 2AX1A 5HBMB 2VFRA 4ZVPB 4DFPA 4Q0BA 2B8PA 2DITA 4LR9A 2Y0SD 1FESA 2BVZA 1X9MA 2IAJA 1CQMA 5DGBA 4JI7F 2QLBB 2DYAA 1SKWA 2IRUA 1QAIA 2DR6A 4WKRA 3L3CA 4N47A 1F60B 2AU0A 1IQTA 2K1RB 1R8PA 3AJDA 3GSDA 2EBGA 3N01A 4ZPDA 2VASA 3V4IA 1GX5A 2YKOA 1DQ8A 2G2ZA 4V1Ak 3VR1A 4EO6A 3Q0AA 1HL6A 4JI3F 2RF2A 2Z2YB 5IV3A 3T6JA 2VC0A 5K14B 3U1MA 2W7AA 4EEYA 3MI7X 1WTBA 1S1UB 2CDQA 3DLLQ 4MTPA 2HQFA 2OSRA 1S6PB 4DV3J 2EI5A 4FXDA 2CWKA 3TA0A 2JOQA 2RHSB 5KG3A 2J6UA 2YX1A 1JLEA 2XS2A 2BMBA 3U27A 2YNIB 3OR1A 2UUBF 5ETOA 3GV8B 2UUCF 2C3PA 4DR1F 4X64F 2GHVC 1NHKL 2B6AB 1EP4A 4JI1F 5KFUA 4DR7J 2X1GA 4ED4A 4CIOA 3M8QA 2BXJA 1JLGA 3MR5A 1WHYA 1VQ5S 4W98A 3W5XA 4FDFA 3PIPQ 2B51A 4KHMA 4ZPVR 5E33A 4RJVA 3MM8A 2CQHA 4IFVA 3CC4S 2E1RA 4CO4A 3IS9B 4RKUC 4LFBJ 3VAJA 1VLYA 5ADZA 3UR0A 2ZH1A 4WBFA 2Y9HA 1S1VB 4M5MA 2IMOA 1YHQS 1FD8A 3W60A 3R5BA 5CZVA 3HF5A 3R27A 5BYSA 2XO6A 2VONA 3OTDA 1RWKB 1X8DA 1R0CB 5D77A 4YHHJ 4DR2J 3F0NA 2ZM6J 4Y2KA 3T5JA 2QLFB 2AHOB 2C42A 1KLMB 3I55S 2VB6A 2HFZA 4X84A 3K5MA 1RWOB 3W9IA 1BGXT 1HBNA 1QDUB 4O44A 4RW8A 1K0VA 1RAHB 2MXYA 1OMSA 5IT9Y 4DR6J 2E5HA 2GS8A 2HURA 4RU9A 3Q8SB 2Z58B 2NXNA 3DLGB 4DG1A 1ZAWA 2N3OA 4LF4F 1X4EA 2NXEA 1BC6A 4ED8A 1TTHB 2W25A 2POKA 4FKXA 2FZCB 2HNDB 1VRQC 4A8QA 1RTIB 4PWWA 4DX5A 5CYQB 1VHFA 2X3GA 2ZVSA 2HHHJ 1L3UA 5KFZA 2CPFA 1XQIA 2KG1A 2XB2D 4DI6A 4OHWA 1TAUA 4OZ2A 3GIMA 2GVZA 5HL7Q 5ETLA 3TAMA 2HAFA 5J2NA 1IUJA 1VRUB 2GO8A 5GMKa 1PYOB 3FMBA 3G8SA 3ZXWA 1LW0B 3ISND 3M9MB 3MM7A 4LJMA 1K1QA 5J1PA 4RZRA 3JSBA 4DEZA 3GV5B 3IRXB 3FVYA 1SJ4P 1HMVA 3RBEA 3ELHA 2UP1A 3MMBA 4ECQA 1U0HB 1XTZA 1B99A 3BPDA 4EBDA 3TJAA 3ZZOA 2R7WA 1ELOA 4L73A 4B9SA 1FDNA 1U7LA 1IVZA 1UFKA 3PO4A 1V9OA 4N77A 4OFZA 5DQGA 3J81j 4Z7CA 4IH6A 3NNCA 2UV8A 2F9DA 1EQ0A 4JI2J 1FX4A 2DGTA 3FC9A 4PYDA 4ELVA 3W2WB 3CDWA 3RAMA 4MYTA 4QR0A 3NBPA 2J7KA 1SC1B 4NXMJ 5CZXA 2NQPA 2C2RA 2ZBIA 2F1FA 2V63A 1IKWA 1N54B 2B4UA 3O5TB 2V2VA 2XMVA 2ZJQQ 1R8BA 1UVIA 2VFUA 4ZHRA 3CCQS 1FNXH 2IM0A 3DM2A 5T14A 2IRXA 3TI0A 5KG6A 1ZPVA 3QZ7A 2OLWA 1SB6A 3BQ0A 2J9CA 4J91A 3MEGB 1QTNB 2HQGA 2QMWA 3NS6A 2CA9A 2HS0A 1N52B 1TUGB 3RW6A 4A4JA 2HBYB 2RNEA 3CULA 4QJVA 1FX2A 4DFJA 9ATCB 1FVSA 1HBMB 3A8KA 3AD9C 2A10A 3EZOA 1WOOA 2BJDA 3B4DA 3NLCA 5DLFA 3KWMA 2UV8G 2XZDB 1GX6A 1RT5B 3M6UA 2AD9A 4R25A 2W9BA 1Q7LB 4NLUA 4CNZA 3AA9A 3CF5Q 3R1LA 4CH0S 2CPJA 1KOOA 2VG6A 3QGHA 1IR0A 1C4AA 2IC3A 5L9XA 1O8BA 3UN5A 1EARA 4DR5F 4I2PA 4LF7F 2G2OA 3GR0A 4DFKA 3M32B 5B7WA 4PQUA 2NPIA 4OLOA 1S9GA 4HT5A 4J7CA 3EZUA 5DO2A 2VFTA 4OMFG 3RTVA 4OI6A 1WDTA 2H4WB 2PEHA 2KH9A 2RAQA 1T0TV 4I69A 2W2OP 2NREA 5E3RA 2AJ4A 2XHWA 3WIUA 1YVFA 2QT7A 2GQCA 3GG1A 1TU0B 3TX0A 2R2TA 5HI7A 4FPRA 2GW8A 2QFJA 1J5EJ 4P6QA 1UWAA 3UDEA 1IXKA 4M8LA 1TL7B 2IIHA 1RT7B 2RRBA 4JI6J 4OZLA 2J7WA 1CC7A 3JTNA 3AXMA 2G4BA 1DFDA 2UVUA 2R2UA 3MMAA 1FDBA 5B0EA 4DL7A 1U49A 1RWNB 1FTRA 2ZEJA 2ZKTA 5KT7A 4ES3A 2C2KB 2MSTA 1MSWD 2XS5A 1XR6A 2Z0GA 1JJ2R 3A8JA 3FQKA 4LIRA 3DLHA 1V5IB 3DHXA 3GR1A 3IRWP 4QQBA 4PYAA 4PG8A 1DZ5A 2Q66A 4J9UE 3V2UC 2KVQE 2ZBCA 3Q86A 5JVGQ 4UY85 4KAIA 2CJQA 1SUQB 2DNHA 2MZJA 4F3MA 5HVGA 1WC0A 2FQQB 2CNOB 3DDIA 5E41A 1X0FA 1RT4B 4C6AA 1T9XA 3VQSA 4X4RA 5EHHA 2WW4A 4RW4B 4NE9C 3AD8C 3UQSA 1RTDA 1S7HA 3TYTA 1CSJA 3K0JA 4B9VA 1VC0A 2P5VA 1D9AA 3ITHA 2C2MB 3QRPA 5KG5A 4WWSA 3BBFA 3D6MB 4K4WA 1ZOTA 1TR0A 4MAKA 2B4VA 2WB1D 4EGLA 4F02A 2Y1RI 4OYWA 3TA1A 2GIFA 1ZS6A 4ZVEA 3PFEA 2HHUA 1SCJB 1FI4A 2HHQA 3LPEA 3NL0A 3MPDA 4Y0FA 4BC9A 2HIYA 5BR8J 1V3SA 2DNLA 4UF4A 2FJWA 2FHOB 2ZITA 1KHVA 2XLJA 3VGTA 3S7RA 4DF8A 2BJ9A 3D3CJ 3KFWX 2DT9A 4LRAA 1HIYA 5K8OA 2P6TA 2C22A 4FKYA 4C98A 3BYRA 1XMQF 2FY1A 4NYOA 2BYCA 5D4OA 3ILIA 5L1JA 1FKPA 2CPDA 3JYTB 2F65A 5HN0A 3KK3A 3OR2B 3EDRB 1U6ZA 3HFZB 1OSDA 3TUIC 2DNPA 4P72A 1E6VB 3FZ2A 4HH0A 2ZH8A 1E6YB 2QE5A 4ITSA 4DSLA 1G7CB 3N0VA 1X60A 2W8LA 4WFXA 3QT6A 2M88A 1GNKA 1HPZA 4CYUB 2E5IA 1TQLA 2YY3A 3G6ES 5IT0A 2R8HA 3D54A 1A7GE 3PDNA 3RG6A 2B8QA 1P1LA 3CJ5A 1Y5NB 3SZ2A 2GGPB 4IRDA 3GG0A 3ISNC 2W8KA 2D3OR 1VQ4S 1WC1A 2ZH2A 5D15A 4CI0B 2MZSA 1B3TA 2DXDA 1H74A 3Q8RB 2MKIA 1N5QA 1KHWA 4C8MA 5C25A 2A2CA 2HFUA 4ID5B 1JB0C 1C1BA 4Q43A 4DCOB 4PXBA 8AT1B 3QQCD 4FP9A 4DV5J 2HBQB 3B54A 2DGWA 3DN9A 4ZLNA 2OD4A 5F8IA 4F3QA 4X62F 1LWCB 2HRTA 3RB3A 4F26A 2DRBA 2IHR1 3MAQA 2JHEA 1NRKA 3JSMA 1Y00A 2H1YA 4UY8T 3UD3P 5H9FJ 2XLIA 3N6NA 4ED6A 1TK0A 3VGVA 4HT7A 2WONA 3M2RA 4LBIA 4RLEA 1M1GA 4P7VA 3FBBA 2E5LJ 2HVIA 3CJ0A 2AZ1A 5C5JA 4GKJJ 3AQPA 1Q5YA 1U45A 2P9GA 2BEFA 4H4OA 1FFGB 4U8VA 2JLFA 3Q8YA 2KKHA 1F3FA 4PXDA 2H9ZA 2VFSA 3CD6S 1FWPA 1V3RA 4F36A 1LKZA 5D8HB 4ED2A 3B6BA 5M2PA 4FYWB 1N5VA 4ZP7A 1HHTP 1NUEA 4KR0B 1TUWA 4IRKA 4FBUA 2BQUA 4I2QB 3DOKA 2MHEA 3BYPA 1SKUB 4AE5A 2LP4A 4JUZA 1FWLA 3KUGA 2JEFA 3CMAS 5KT5A 3M8YA 3OSPA 2AYEA 2ZE2A 4J9NA 3R5AA 1YJ9S 4M5DB 4AD6A 4H54A 3V81A 4JV2A 3GYXB 5AJ3J 1HI0P 5J2PB 3H20A 3ZZ0A 1WKLA 2NUHA 4ZVTB 1DAXA 3TO8A 5KFGA 1N6QA 2KYXA 1U0SA 4G1PA 4IG3B 2CQ4A 3ZFVA 1UW4A 4CT9A 1XERA 1VLOA 5B0GA 5IS2A 1H6KX 5ETSA 2NXJA 4ERDA 2AZ3A 2SXLA 2BM0A 2L48A 2RVJA 2ZOGA 5K5MA 4KHRA 4GVLA 4CNYA 5HMWA 1I6JA 5KFEA 4A46A 3LWLA 2EFOA 1WEYA 4XO0A 3VGUA 4DV0J 3G82B 2A2DA 1X5SA 1SV5B 5DM6Q 2QEXS 1J2VA 2ZWOA 1TV6B 3G96A 3PJXA 2WSFC 3NOCA 2FHKA 1BXNA 4HEA9 2CJXB 1VBYA 3MEKA 4C0HA 2CQDA 1AA1B 4CLWA 3SIPB 1YGYA 4UOHA 2DH7A 2DNNA 4X65F 1SKSA 4ZJQA 4LREA 4X4UA 3BKFA 3QAEA 3DRSB 4M5JA 3E01A 3RB6A 3VWSA 1B0VA 2YNHA 3R7BB 3DU6A 4NA3A 1X0PA 2YWKA 2E66A 4NI2B 3R2CJ 1FJGJ 4B9TA 1RUSA 4EI2A 3M2UA 4B3TF 1X9WA 3CNQP 4K4UA 2LQBA 3CMES 4QWBA 3I56S 1ITPA 4UOGA 1HQUB 4LF8J 2DGVA 1RTHA 4R8UB 5F41A 1HWJA 1Q79A 1N0UA 3BS9A 2ZC4A 4FYVB 4LIWA 3ETMA 3GLJA 2BANA 1YZ6A 5HQ8A 3RAXA 5A8WA 1S1WB 4LF5F 5HVHA 5AE2A 2A18A 1VI7A 4PR6A 1YDLA 3ENWA 1TFYA 4DX7A 3K5LA 2R8GA 1KN6A 1S0OA 1AROP 2MSSA 2RDJA 4JI8J 4LUBA 4ELUA 2BOPA 2CPYA 5B0CA 2BE7D 3MM6A 4ED0A 1IM6A 1RXOB 4USIA 1NK6A 4CLPA 2QX0A 3BDPA 3D9BA 2E5GA 3EPIA 4AL6A 3EYZA 2OGUA 4DL2A 2G1HA 2HLTA 3MFIA 4HKQA 1YJUA 3IWNC 3M30B 3LGHA 3HD1A 2OUGA 3GP9A 2BQ3A 1MW7A 4XTTA 1HYSA 1NKCA 4IR9A 3LW5C 4I7FB 5LM7E 1K73T 3PRVA 1F1BB 2WB4A 4RW6B 2OPRA 3MPUB 4GRSA 3P5TL 4F50A 4ZLPA 1N36J 4FVMA 4FBTA 1TMJA 1VFJA 2BRLA 1NSQA 1MROA 2O5DA 2QV6A 2VL1A 3KK1B 2VBXA 2CVIA 5F8NA 1JK9B 3I96A 3KNGA 3KLFA 3E8OA 1UVKA 2AYGA 4RW9A 3A8EA 3QBCA 3KJFB 1LWFA 3FEYB 1VRTA 1RHUB 2FLLA 3P4UB 2RSQA 3KHHA 1HQEB 2CQIA 5DG8A 3I87A 3QT5A 2JWNA 3OFGA 1IBKF 2FYXA 1VS3A 1H3DA 1UWBA 3I5AA 2DY9A 3DRRA 1S1XB 3CCMS 2MGZA 5E3CA 1FWKA 1M1KT 1RTJB 2CXEA 1SJFA 1FDAA 2BW7A 4M5IA 2NZ4A 3G71S 2GVDB 3OL6A 2MY8A 1IN0A 2JNJA 1CS4A 3NAIA 4WU3A 3PG9A 4LSLB 5JMNA 3RRHA 3KK2A 2YWHA 1K9MT 2FUG9 5K8NA 1B70B 1HWIA 3Q8UA 3POTA 2MKSA 2NS1B 4XDCA 1OIAA 4MKAA 3IR7B 2R7VA 3PIOQ 2RKIB 1JKHA 2DB1A 5F8JA 2FVCA 2M0GB 2QA2A 3AH6A 3DOLB 2DNMA 1IR2A 2E7XA 4MK8A 4TN2A 1Q53A 1SJ1A 2Z57B 4ZPWR 2XC9A 1NM2A 1T3OA 3GSIA 4I68A 1VOMA 4WKYA 1NU4A 3OLBA 5B09A 4IG0B 2CPXA 1FNMA 5L1LA 1D09B 2MZ1A 2FJVA 1ZM9A 2MJNA 4UUXA 2DGSA 1JLBB 1TKXA 3HVTA 5A8KB 1U25A 5CYMB 3K7RA 4LRFA 4U67Q 4DWIA 3BSAA 4J37A 2YNFA 1S97A 2L9DA 3RBXA 4MKBA 2UUTA 2Q43A 4J9SA 2R7XA 3J7ZT 2ROGA 3RZAA 5B0FA 3HHLB 1QD1A 2VU5A 4QR2A 4HTIA 2OTJS 2ZWPA 2IJRA 2AKWB 2VA3A 3ICLA 3DLKB 1REVA 2B43A 4HDGA 1JWWA 5KFAA 2R8JA 4O4RA 2WSCC 1RI7A 5DG9A 1T9YA 4DU8A 3PM9A 2JDJA 4F4ZA 3A13A 1S10A 4NEYA 1VIXA 1ZM4A 1PIEA 1DY3A 3QRRA 3IGNA 2MLZA 3VAFA 4NX9A 2KZMA 4JYAF 4ZP9A 3UW1A 5A8RB 4WP9A 2Y8WA 2B7CB 1D8ZA 3MXHP 1G4CA 2AQ4A 4EK2A 4MYUA 4C8ZA 5KFSA 2GJIA 5J1EB 3VV2B 5F9NA 3K89A 2V6AA 4TY8A 4BS2A 1FJCA 3C6UA 5GVQA 4EYIB 1HKAA 2GMHA 3TVZA 5ETRA 1HNIA 2Z8QA 4DJBA 2IVMA 1R43A 4DV6J 2VQFJ 2LVWA 2J0SD 1SVDA 3N4WA 5KFWA 3J81U 4E0DA 2YX4A 1RT2B 2QN6B 2B5JB 1R0AA 1KC8T 2EKNA 1OY8A 2DHXA 2VDHA 3PW2A 4LVOP 2PIIA 4YDXA 1U02A 3CCZA 2CADA 3TJ8A 1YRTA 1ZETA 1RACB 1IKYB 3D0IE 2V9KA 4G3IA 1Q8LA 2YH1A 2AT1B 4LSZB 2FJAB 1VK8A 4IOBA 1IJFB 2KRBA 4GO5X 4M5NA 1SJRA 5DGAA 4X62J 5EWGA 4DUZF 4YB1P 3GYGA 1DTTB 1RQ0A 3CWJA 5LXRA 3NKYA 3SBMA 1UA0A 1RT1A 4EZ9A 2LEAA 3T6BA 2FVRA 1N32F 5M2RA 1S79A 2AJQA 1BQMB 1Y3KA 5KG4A 5I3UB 3CJ2A 1S12A 4KO0B 3M4XA 3G8TA 3BQ2A 3CDUA 3EWGA 2ZH5A 2BDPA 1C1CA 2JFKA 3TUPA 4WFYA 3NRBA 4YR0A 2W4CA 4KE5A 1J27A 1S48A 4DF4A 2KB2A 5BJRA 2UUAJ 2PGCA 1KS2A 1FEEA 4NZ0A 4CO5A 4KFBA 4YN3B 1YRXA 1RBOB 3CE8A 4GKKF 4X66J 2G0IA 4QYZK 1Y5LB 3MCSA 5A0YB 2M52A 2QZ8A 4C0OC 4DV4F 3C15B 1WC5A 4QIGA 5EWFA 2CQ2A 2VHGA 4B3RF 1NZAA 3JAMY 2F8EX 4OZ3A 3QFHA 1TKTB 1AXQA 2MKYA 1VK3A 2HMIB 1AZSA 1VQ9S 1HWLA 2M4MA 3OT9A 4B3OA 1SIZA 1SH0A 1F2HA 1O5JA 3HHLC 5D0HA 1CULB 1X4DA 4G1QB 3I0SA 1PAEX 3OL8A 5MLCV 2H3EB 2KXNB 1M5PC 2FHJD 3ENVA 3K57A 2JSXA 3Q89A 2XHCA 3DLEB 4O4GA 3BR8A 2BABA 5B0BA 1YJVA 2HGNA 2F63A 2EK1A 1U1NA 1LXJA 2QLXA 3CCWA 4RBTA 2EW9A 1NH7A 5EWEA 3UO0A 3EZ5A 4ZN1A 2FJEB 5I42B 4DSFA 4O3RA 1DLOB 4UOFA 4WP8A 3JQMA 3UCZP 2LXUA 4QW9A 2E5JA 2PFDA 4QR1A 2C1EB 4TU7A 3VAMA 2FVQA 3R3TA 1AFJA 5L39A 2G9OA 3FCVA 2IAJB 1OJ4A 3EGWB 4J5OA 2ATCB 3U02A 1ZTTA 5C2GA 3R6LB 4B9UA 2ROEA 4FF2A 2QMUB 3T5LA 5HBMA 2ZZTA 1RAFB 3QFWA 3OJSA 2XS7A 2V8GA 4KIAA 3CJ3A 2FLOA 5CHCB 2RF2B 2EC0A 3G4SS 3Q83A 4ECXA 3OL9A 3RBDA 4A8YA 2ZUGA 2XY7A 4TU8A 2N82B 5KFKA 1SH3A 2VBWA 4ICLA 4AUKA 2XYHB 1UJ4A 3OTOJ 1JXVA 2DR8A 1FXLA 2V69A 1UKUA 3SCIE 1RBAA 4KHPJ 1CJVA 5LMUJ 2FDNA 2VG7B 4P75A 5K14A 1FE4A 3IR6B 2RRAA 2OHDA 2GMJA 2HWTA 3WX8A 1JMTA 4ZVUB 3P6YC 4NLVA 1OYDA 3M8QB 4W4MA 1JLGB 4O3NA 2QRRA 1NZ8A 1B4SA 3TQ1A 2DHSA 1RWVB 1GXLA 3NS5A 2W4DA 8ATCB 1S9EB 1OWXA 2UU9J 2DHAA 2DO4A 3MM8B 4QCLA 4OHXA 3PJ9A 3M9OB 4LF5J 2VODA 2DEJA 3G86A 4IFVB 3BDEA 2B6AA 5D4PA 4Y2IA 3D68A 4ECVA 2CQ1A 1Y5IB 2QC3A 1MN7A 4K0KF 3TZWA 1VDHA 1PBAA 2UVRA 4K4ZA 1M90T 1GMWD 4U7CA 5IM0B 5C7PA 2B4PA 3FKBA 2JRSA 1HNZF 3H5UA 1RWPB 1UW9A 1VQYA 1VQOS 2FJXA 3IWXA 1KP6A 1R8HA 3KDNA 1FRHA 3DI6B 3TA2A 1S6UA 2IYGA 1LQ9A 2GAHC 1N4LA 4PAAA 2Y1IA 1S1VA 4ZCIA 3CC7S 4N56A 2CG8A 2ACMA 3EVOA 3QIDA 4NMXA 1VC6A 4CP5A 2VQEF 1K1SA 1K47A 4OJHA 2FIUA 1U47A 4X4OA 3HK2A 2OD6A 5HATA 2U1AA 4LF9F 1F5BA 4OX9J 3EGNA 3KUEA 3HULA 1N5SA 1KLMA 3Q22A 5KT2A 4C2MA 3LANA 4ZVOB 4B9NA 3HMJG 4ECWA 4NLYA 5BXIA 5KFLA 2F7VA 1WHWA 4ZVGA 1KSPA 1Q1KA 5JUMA 4MK7A 3UDVA 3W65A 3DLGA 4JV5F 1M5OC 1FKAF 4LF2A 3BB5A 1TVRB 5HJXA 1BQXA 2X1AA 2RQ4A 4MIAA 4DL6A 4DR4F 1V3ZA 1S77D 3AY0A 3TAMB 1HFEL 5CD4A 1IBKJ 2B9YA 2N7CA 4NA1A 2HNDA 3M1VB 2KXHA 1RTIA 2RRNA 3BH7B 4B3SF 4Q8FA 4FF4A 4NCBA 3DC2A 4NOHA 3T1HJ 1VQ8S 1NPPA 5DM7Q 4NLWA 5F8GA 1YX2A 1HMVB 1G3OA 4JI4J 3MMBB 4TKTA 4NRTA 1N34J 3VVUA 1X5PA 3HFVA 2ASJA 5T7LA 1VR6A 4IFYB 4Q44A 3DYAB 1LW0A 3ZC4A 2ZJRQ 3SQGA 5LSRA 3P45B 4KV8A 2JEJA 3NGKA 2AJ0A 1IBMJ 1UFLA 4WXWA 3SFUA 4O0NA 1LEOA 1U0HA 1XNRJ 4FS1A 1CJTB 4LFCF 1HNWJ 2CZ4A 3UDCA 3LH2S 4OHYA 4K5RA 2DH8A 2YNGB 1UMJA 3IM8A 1BWVA 1ACMB 2JEIA 2AGPA 4IOCQ 3TEHB 1KR4A 2RILA 1TP7A 4ZP8A 2D41A 4M63A 1XWLA 3MPWA 5LMNF 4P52A 3MZIA 2QA4S 1FEHA 3W61A 3T1AA 5LJ5Y 3EJMA 3NNAA 5BYQA 1ZM3A 1GMVA 1TKDA 1VIOA 1VHIA 4C3KA 3PACA 4N41A 2H5IB 4CM0A 4OYOA 2BE2B 4W90B 1K0TA 4K4TA 2HIQA 2XBPA 2ZC3A 4OZ0A 4B9LA 4ZPCA 3MM5A 1HWKA 2NR0A 3MR2A 3F41A 4NXNF 4CLYA 1Q5VA 4YY3F 2XMJA 4EYHB 4ANCA 2E1PA 2YKAA 4YB7A 3MEGA 4AQYF 2YWFA 3I9ZA 1WWHA 2Q6CA 1RHRB 2ZHOA 1SI9A 2VPZB 2VJVA 3MR6A 3PKMA 2FGCA 1NDPA 4WTYA 4MJKA 1HBMA 5GAEU 1RAEB 2B0GA 1YBAA 3PO5A 2ZNYA 3RRKA 1UFWA 1UAWA 2HSEB 3H0PA 2JLGA 4XK8C 1RT5A 2KYZA 3TW0A 1G1XA 3HI9A 1RT6A 1MG7A 2J0XA 1NHUA 1KTVA 2Y1JA 4F4YA 3FEXB 4PCQA 5FLXU 2PSZA 5DDPC 1QVFR 4OI2A 3MTJA 2ADCA 1NNDA 3PYDA 3LF0A 3IA0A 1BHNA 3M32A 1P1TA 4IDKA 3WC2A 3KHLA 3GONA 3OVBA 2CPIA 3K5OA 4ILRA 4RNFA 2RH3A 4YQWA 3AODA 3F73A 5IV4A 2PC6A 4OL8A 1AW0A 3GMGA 3MMAB 4B3MJ 1RADB 4ES2A 3IM9A 3PR5B 2GV1A 4PXCA 3R8YA 3HSGA 2O3DA 4DX6A 1HD0A 4DR3J 2AWZA 1SJQA 3BV8A 1CLFA 1TL7A 2MQNA 3P5BP 1RT7A 3FGVA 1RGVA 1IM4A 2Q1LA 3W7BA 2ZKUA 1VBKA 4FNHA 3VF0B 2R8KA 1VCTA 3H59A 4OYAA 4ATNA 3KUHA 2MQQA 1PYSB 1N33F 2ALYB 1YWXA 3HHKA 2A0FB 1S7IA 4KKOB 4DL5A 4NLOA 4O0IA 4LRDA 1W2BR 1I1GA 1YBUA 4K4YA 2W2MP 4ILLA 2DXFA 2LYVA 5KG0A 2JLEA 5CCLA 1J5OB 1QE1B 2A1BA 2K3IA 3EE3A 3EVWA 4ETXA 3AQOA 1RTDB 5AE3A 1Q8IA 2IPOB 4I6YA 3GFZA 3ENQA 4NLGA 1RKJA 5KFXA 3CJKA 3MCMA 2VFVA 2CJYB 4P2XA 2P9CA 3ITHB 3FJ2A 3NWRA 1NDLA 3I0RB 3QAUA 2KRRA 3H2LA 3WBZA 2CIMA 4RW4A 2GQQA 2LA6A 3ET6A 2V4QA 4KY3A 1S57A 2WBMA 2ZJPQ 3OL7A 2BE9B 1M5SA 4PG6A 3VAHA 4O3QA 1DQAA 1FFWB 4DCJB 3DLBA 2PMHA 4M95A 3QSYB 2V2KA 1KQKA 2KHCA 3UPFA 2R7RA 1X4FA 3OTBA 3PKYA 4YB6A 1RWXB 4KPYA 2B9WA 5D4LA 3K8VA 1TELA 4RW7A 2IA6A 3IBFB 3PVXA 2UXBF 1XMOF 2EKYA 3KOAA 3F44A 3UD4P 2IVFB 1XNQF 1IJEB 2HKEA 2YH0A 3D67A 3VALA 4OI1A 3V6HA 5HROB 3ZZTA 4U7UD 2EC2A 5H9EJ 2YWWA 2WW8A 3KK3B 4QIVA 3DKDA 2IA0A 2AJFE 1RCOB 2FJDB 2Q6BA 4O3SA 4NCAA 5KFTA 5HO4A 4WYWA 4K2XA 3AT1B 4WFZA 4PWUA 1OS5A 1RCXB 1WJ9A 3HO1A 4NLQA 2K8GA 3MEDB 1RWMB 4NWBA 5HJYA 1TUVA 5B0DA 2OH2A 4LF6F 3OR2A 2FGOA 4D3GA 5K20B 3GIRA 1VQPS 4KBIA 1E6VA 3BSCA 2MQMA 1ZH5A 5IWAF 2QMXA 3GE9A 4DPWA 2XNQA 3R2DJ 2V2ZA 2IDLA 2PDAA 1CPZA 4CO3A 2Y3YA 3RBZA 3LO3A 3W3SA 4CYUA 2FPHX 2GGPA 2HZCA 1C1BB 4JI0F 3WC0A 4U6PA 4DV1J 2DKOB 3IP0A 2FJBB 1FCAA 3D0GE 5H9FK 2GJFA 3BGOP 4WJBA 3H2UB 1RP5A 4PWDB 1YJRA 1IKVA 5FD1A 2DO0A 4ID5A 3JSMB 4IR1A 2E9RX 4DV7J 3W9HA 1IQZA 1RA6A 3CJSA 3SYZA 5AT1B 1EKSA 4PPZA 1SL1A 1HNXJ 2NZCA 2WONB 2YBVA 5HQLA 4IH5A 2M8HA 3VGSA 3Q2SC 1LWCA 3MOJB 4R5PB 1T94A 3LA0A 2LU2A 4IKAA 3DXSX 4FVCA 1CJUB 1FJ7A 1WDDA 4YS2A 2IM3A 3MURP 3RJMB 3NS7B 4IH7A 2GFFA 4MFBB 1X31C 1RU1A 4KGMA 5KOWA 1OPZA 4RBVA 3B82A 2DK2A 5LJ3Y 5GAGI 3J7A1 3RR8A 2XGPA 1EIYB 4Y28C
chains in the Genus database with same CATH topology
1RHKB 3R7SB 1F9EB 3D6FB 1GFWB 1RHJB 1RHRB 2QL5B 3SIPB 3KJQB 2DKOB 2CNLB 3EDQB 1RWOB 3R6GB 2CJYB 4ZVPB 1QDUB 3GJTB 3GJQB 1ICEB 3GJSB 2H65B 2H4WB 2H4YB 1RHQB 2P2CB 1BMQB 1QTNB 4JB8B 4ZVTB 3KJFB 1RWWB 1RE1B 1RHUB 3R7NB 3P4UB 2QLBB 2QL7B 2H5JB 2XYHB 3QNWB 2HBYB 2FQQB 1RWPB 2CNOB 2HBZB 2CDRB 3R7BB 1RHMB 1I3OB 2C2ZB 1RWMB 1IBCB 2QLJB 2QL9B 4ZVSB 2XZDB 5K20B 4DCOB 2H54B 4LSZB 4DCJB 1NMEB 2C1EB 1SC3B 4DCPB 3KJNB 2CNKB 2HBQB 4ZVUB 2C2OB 2XZTB 3GJRB 2C2MB 2H5IB 2H48B 1SC1B 2Y0BB 4ZVRB 3EDRB 1I51B 3D6HB 1PAUB 3D6MB 1SC4B 3RJMB 1RWNB 2CNNB 3NS7B 2C2KB 1RWVB 3R6LB 3P45B 5IC6B 2Y1LB 1RWKB 1RWXB 4ZVOB 2H51B 2HBRB 2XYPB 1PYOB 4ZVQB 5IC4B 3IBFB 2XYGB 3IBCB 2QLFB 3R5JB 2CJXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHK B;  3R7S B;  1F9E B;  3D6F B;  1GFW B;  1RHJ B;  1RHR B;  2QL5 B;  3SIP B;  3KJQ B;  2DKO B;  2CNL B;  3EDQ B;  1RWO B;  3R6G B;  2CJY B;  4ZVP B;  1QDU B;  3GJT B;  3GJQ B;  1ICE B;  3GJS B;  2H65 B;  2H4W B;  2H4Y B;  1RHQ B;  2P2C B;  1BMQ B;  1QTN B;  4JB8 B;  4ZVT B;  3KJF B;  1RWW B;  1RE1 B;  1RHU B;  3R7N B;  3P4U B;  2QLB B;  2QL7 B;  2H5J B;  2XYH B;  3QNW B;  2HBY B;  2FQQ B;  1RWP B;  2CNO B;  2HBZ B;  2CDR B;  3R7B B;  1RHM B;  1I3O B;  2C2Z B;  1RWM B;  1IBC B;  2QLJ B;  2QL9 B;  4ZVS B;  2XZD B;  5K20 B;  4DCO B;  2H54 B;  4LSZ B;  4DCJ B;  1NME B;  2C1E B;  1SC3 B;  4DCP B;  3KJN B;  2CNK B;  2HBQ B;  4ZVU B;  2C2O B;  2XZT B;  3GJR B;  2C2M B;  2H5I B;  2H48 B;  1SC1 B;  2Y0B B;  4ZVR B;  3EDR B;  1I51 B;  3D6H B;  1PAU B;  3D6M B;  1SC4 B;  3RJM B;  1RWN B;  2CNN B;  3NS7 B;  2C2K B;  1RWV B;  3R6L B;  3P45 B;  5IC6 B;  2Y1L B;  1RWK B;  1RWX B;  4ZVO B;  2H51 B;  2HBR B;  2XYP B;  1PYO B;  4ZVQ B;  5IC4 B;  3IBF B;  2XYG B;  3IBC B;  2QLF B;  3R5J B;  2CJX B; 
#chains in the Genus database with same CATH topology
 2CPH A;  4A48 A;  2DGX A;  5KT6 A;  2ZDO A;  4DV2 F;  3FDS A;  1U24 A;  1BQN B;  2NPF A;  1BY9 A;  1Y4Z B;  1QAJ A;  4TQS A;  1S4E A;  3DOK B;  1WSR A;  2PN6 A;  2VPW B;  4C9D A;  2WSE C;  2WCX A;  3CCV S;  4LQ3 A;  2HHP A;  3OD2 A;  1DHM A;  4C8K A;  3RW7 A;  2K2P A;  2F8H A;  3M8R A;  3NOG A;  4CH1 A;  4BHQ A;  2CJ9 A;  1HI1 A;  1F5C A;  2BJE A;  3A3N B;  2YKM A;  4KGX B;  3U1N A;  2PT0 A;  1WF0 A;  4I2Q A;  3C14 B;  4LQ9 A;  3UCU P;  3AFG A;  1UL3 A;  3DCA A;  4HLB A;  1XN9 A;  5KFO A;  3IAM 9;  2AYM A;  2J76 E;  4WTO B;  1FHT A;  2JL9 A;  3PHT A;  3CVK A;  2RE1 A;  4NLD A;  4ZN3 A;  4M5D A;  5KOX A;  5J2P A;  3FCH A;  3RB0 A;  1XMB A;  5CCM A;  5CA5 A;  4LSN B;  3O44 A;  3KJQ B;  2VJU A;  1Q8K A;  2ILY A;  3FUY A;  2BW2 A;  5HSP A;  4ZPB A;  5KFD A;  4MIB A;  2EFN A;  2QG9 B;  4YME A;  4IG3 A;  4G1I A;  5DS7 A;  4FPI A;  2PFF B;  3U7J A;  5HP1 B;  2IJF A;  2I0X A;  3OJU A;  2V94 A;  1NB2 A;  1FXD A;  3CD0 A;  1PBU A;  1R89 A;  3T9Z A;  3FEZ A;  4XDD A;  4I64 A;  4RWW A;  4M5K A;  2WOM A;  3OVS A;  3H25 A;  4IYQ A;  1HR0 J;  5E2Q A;  2D69 A;  2BRK A;  2IBK A;  3G82 A;  1W2I A;  2IM1 A;  1DAR A;  1GTE A;  3GCW P;  1SV5 A;  2KZZ A;  1QAY A;  1LWE A;  1G2E A;  2R2R A;  2HVE A;  3H8Y A;  3UR3 C;  3ILO A;  1U26 A;  3L4B C;  4C8Y A;  4K4S A;  1PKU A;  1WKJ A;  5KFR A;  1UP1 A;  4DS5 A;  3CED A;  2R42 A;  4OV1 A;  4DPX A;  7AT1 B;  4A8K A;  2MQO A;  3M2U B;  3DRS A;  4A8X A;  1ZZF A;  2M3D A;  5J2Q B;  4X4T A;  4AFF A;  3D66 A;  4EFA C;  4DV3 F;  1JJC B;  3R5D A;  3UN3 A;  2HZV A;  1VQ6 S;  4K4V A;  3KMS A;  3V6D B;  4C4W A;  1RTH B;  3FNN A;  2CPZ A;  1GH8 A;  1P9Q C;  2BJ3 A;  2HBZ B;  1D8Y A;  1HBO A;  4NZ7 A;  4QZV B;  1Q0N A;  5HAO A;  1Y3J A;  2O01 C;  5THW A;  2OEL A;  1Q86 T;  3ILL A;  5FLX Y;  4PUO B;  4IRC A;  4DR7 F;  4NLP A;  2EVZ A;  2M5Y A;  1M0S A;  1HQU A;  5E3A A;  4DUY J;  1I94 J;  3O3L A;  4KB7 A;  1RAJ A;  2C2O B;  2QSF A;  4JP8 A;  4UOC A;  2R3V A;  3PV8 A;  3M6V A;  5SZT A;  2DBB A;  1EX8 A;  3I4P A;  3OXF A;  1D1U A;  1UTA A;  1T9U A;  1WOP A;  2CYY A;  4ENO A;  3OV7 A;  3TVY A;  4LFB F;  2AGQ A;  3T5H A;  1RJJ A;  1TZ0 A;  3KNA A;  1RYR A;  1GEH A;  3ILJ A;  2XWX A;  1N5Y B;  5ETV A;  4WU2 A;  1FK9 B;  4TLR A;  2UVV A;  4ED3 A;  2RJZ A;  5GAH U;  4DQP A;  3QWU A;  2UXC J;  4NML A;  3VAK A;  2RDD A;  4RUA A;  3CO9 A;  4YHH F;  3PEJ A;  4DR2 F;  3N5F A;  2ZM6 F;  2E29 A;  1X4B A;  2E7W A;  1VGY A;  2OPR B;  1OY9 A;  4F0K A;  2ALZ A;  2EEY A;  4H4M B;  5I3P A;  3OFF A;  4CQ1 A;  3M30 A;  4GVB A;  2KO1 A;  4DR6 F;  3I4H X;  4HR2 A;  2YQ1 A;  1VQ7 S;  1R8C A;  3KLF B;  4I7F A;  4RW9 B;  3L7U A;  2HVD A;  4PEO A;  4USW A;  1FXR A;  3CSK A;  5ETN A;  1RAO A;  4RW6 A;  2BOA A;  4RR5 A;  2CUY A;  1RB0 A;  3CCS S;  1JLF B;  3M8W A;  3AJ2 A;  4L72 B;  2DHH A;  1Z2Z A;  3KK1 A;  1UWB B;  3T3F A;  1H7X A;  1WF1 A;  2GIR A;  1T02 A;  1KQG B;  4E2F B;  2I2Y A;  2HHH F;  2MGZ B;  3DGP A;  2LQJ A;  4CTA B;  4P10 A;  1IWA A;  1SH2 A;  4P71 A;  2XLK A;  3EVM A;  2CQG A;  3CJR A;  4JI5 J;  1CS4 B;  2Z2M A;  4U9R A;  1PCA A;  4C48 A;  1FKO A;  2DRD A;  4TYB A;  4DLE A;  4P9S A;  1YQH A;  4HDH A;  4L3N A;  1UVM A;  4RO0 A;  1C2P A;  4C0B A;  3UFC X;  4GC6 A;  2JX2 A;  3POT B;  1GXU A;  2V34 A;  2JH3 A;  3H5S A;  4CT8 A;  3JXO A;  2GVD A;  1YBT A;  5CYJ A;  3CMQ A;  1L3S A;  3QJL A;  3MD3 A;  2PEB A;  3E2E A;  4LSL A;  3OFH A;  1HNV B;  2DPJ A;  1NPK A;  4CH7 A;  3TX8 A;  3BSO A;  1IKX B;  1S6O A;  3NEK A;  3NCR A;  5EUH A;  4J9L A;  4A8S A;  3KG1 A;  4JI2 F;  2DHG A;  1RTZ A;  3OBI A;  4ZCL A;  4LFA J;  2RKI A;  3BBC A;  3US5 A;  1RT3 A;  3MMJ A;  1RAI B;  4NXM F;  3A3O B;  1LOU A;  3DOL A;  4QWE A;  3CJQ A;  5MAO A;  3HVT B;  8RUC A;  2BR0 A;  3M8S A;  2WRM A;  4N8N A;  2J8S A;  4IG0 A;  2H5J B;  3UNG C;  1N56 A;  4CM2 A;  1JJH A;  3MR7 A;  5KT3 A;  1F9H A;  5LSL A;  4HH1 A;  3Q8P B;  2X3D A;  1MWZ A;  3RYL A;  3LGM A;  1HHS A;  2DCU B;  2HFV A;  3K59 A;  4NCG B;  1REV B;  5D6G A;  5IQ6 A;  3CTR A;  4DCP B;  2FB0 A;  1ULR A;  3MM9 B;  1S76 D;  3OVA A;  2CJA A;  4WK1 A;  4F4A A;  1G6B A;  3D1H A;  1X5T A;  5HAN A;  2DH9 A;  4X4S A;  2JZ5 A;  1UJ6 A;  1R0B G;  3KYL A;  4TQR A;  1CBK A;  3G6V A;  2AJ2 A;  3NGD A;  3DLK A;  4HAC A;  4XPE A;  3CW2 C;  4HL9 A;  5C42 A;  2YX7 A;  1LW2 B;  2QA1 A;  5BYR A;  3PX4 A;  3H5X A;  2V8V A;  4LR7 A;  1OPI A;  1R31 A;  4QYR A;  1FNO A;  4QW8 A;  4PRF A;  3HVR A;  1L5U A;  4XAK A;  5LOQ A;  4ES1 A;  1RHQ B;  4TY8 B;  1R6Y A;  5ITH A;  4AYB D;  3C6T A;  1QJH A;  3M05 A;  4NPO A;  3A8I A;  3RB4 A;  2MLY A;  1Y11 A;  1UZH A;  4Y2M A;  5A8R A;  3CD5 A;  4USM A;  5E5N A;  2PMZ D;  3LAM A;  3MR3 A;  2W9A A;  4ZOS A;  2I5J A;  2JVO A;  1NDK A;  5FJ4 A;  1ZAV A;  1R7I A;  2V4J B;  2PO4 A;  3AA8 A;  4S0M A;  3ZTQ A;  1QSY A;  2ROP A;  3CCL S;  1WI8 A;  4UTG A;  4YB5 A;  1J5E F;  5F8L A;  3I9V 9;  3HVA A;  1Q82 T;  4PXE A;  1NB7 A;  3UVJ B;  5HK4 A;  3PW7 A;  2WVE A;  2XSJ B;  4RPF A;  1WC4 A;  4MKV A;  1S1T B;  4JI6 F;  2HHV A;  3KHG A;  4TLQ A;  4JI7 J;  4MH8 A;  3ETO A;  4Q5V A;  2OFG X;  1PC5 A;  3EIC A;  4BDP A;  4TVA B;  1KLN A;  3P96 A;  3HJF A;  3SV3 A;  3DOM B;  4OYB A;  1RA7 A;  4DMZ A;  3QIP B;  5FDL B;  1IKY A;  2QL7 B;  4JI3 J;  1KVJ A;  2F5G A;  4QU7 A;  2D9O A;  1EKR A;  5J2M A;  1URR A;  3J80 U;  4MKY A;  2KI2 A;  3WDO A;  4Q7A A;  4IOA Q;  5A6W A;  3SDE B;  3ONQ A;  4X4Q A;  4ZCK A;  3KLE A;  1DTT A;  3NGS A;  5F0W A;  5SUH A;  2UUB J;  3WHI A;  4X4N A;  4CO0 A;  4KO0 A;  3TR5 A;  3BGR A;  2UUC J;  4DR1 J;  1JXE A;  4IO1 A;  4X64 J;  3MUM P;  4KFB B;  1Q4R A;  1X5O A;  4JI1 J;  3PEH A;  3WIV A;  2VA2 A;  1WUU A;  5A76 A;  3R5J B;  1H7W A;  4FNI A;  3SI8 A;  2X1B A;  4IO9 Q;  5H1S V;  4CLS A;  1ICE B;  2H4Y B;  3O1L A;  3PRB A;  4RX6 A;  5DG7 A;  1IBL F;  3MUT P;  3K5P A;  4TU9 A;  3FQL A;  5A0Y A;  1NAQ A;  3LP1 A;  5BR8 F;  1FDD A;  1RHM B;  1EET A;  1U2C A;  3C15 A;  4X4P A;  1U1O A;  1NKB A;  3I0S B;  3KJV B;  2R2S A;  1ZZN A;  2RUS A;  1FRL A;  4R0E A;  3OSN A;  4NYP A;  3EGZ A;  1QTM A;  3FFI B;  1WG1 A;  3PW0 A;  2XMM A;  2HMI A;  3DRP B;  4ZJO A;  3C16 A;  3GFH A;  4LRC A;  1U09 A;  1UCN A;  5CAA A;  3NWG A;  4FXW A;  4MK9 A;  4CLF A;  2FC8 A;  3CD7 A;  2W7O A;  2FC9 A;  4IQM A;  2AEF A;  5T41 A;  4CWB A;  3TOQ A;  3MD1 A;  1KQF B;  2XY5 A;  4LF4 J;  1T95 A;  3DLE A;  4U7U K;  3GJS B;  5KFV A;  3MEC B;  4QIW D;  1O6X A;  5I42 A;  4JOU A;  4DHV A;  3LWM A;  1DLO A;  3BR9 A;  5HMZ A;  2ZUA A;  3JS9 A;  2BJ7 A;  4WF9 Q;  4DBQ A;  2B3T B;  4FYY B;  3G9C A;  1Q8B A;  2XTJ P;  3NG8 A;  2HNY B;  4DQQ A;  2H54 B;  3GFY A;  1KD1 T;  1NBE B;  2P9E A;  3ZZP A;  3W5Z A;  1FT8 A;  4CLL A;  1FTC A;  3M8P A;  1R3N A;  3UNY A;  4ICL B;  3FK4 A;  3H7H B;  1JLC A;  2OEK A;  1S99 A;  4EBC A;  3EUN A;  1CJV B;  5DDQ C;  3IMQ J;  1QSS A;  4DV5 F;  1HWU A;  1TKZ B;  5HQM A;  2MZQ A;  4TYA A;  2E7V A;  3NXZ A;  3GII A;  5KG7 A;  3PZP A;  3FBC A;  2OI2 A;  1FO1 A;  4DSK A;  4DDF A;  4ECY A;  3H2V E;  3LP0 B;  1VQM S;  1PYT A;  2VG7 A;  1TMM A;  2UUW A;  3UDL A;  4RUH A;  2JC1 A;  1R8A A;  3Q2T C;  2BAC A;  5GAG U;  4ZLL A;  2E5L F;  5U47 A;  4OLP A;  4GKJ F;  1HBU B;  5CXT A;  3N5B A;  3TVK A;  4CLK A;  1H98 A;  1KWM A;  3HZG A;  2HS3 A;  2CQ0 A;  2KXF A;  2C3U A;  3KLG A;  1U2R A;  2AMC B;  2ZFH A;  1S9E A;  1MWY A;  3MMC B;  4C3L A;  1JLQ B;  4E8U A;  1O0P A;  2KG0 A;  3LUY A;  3FSY A;  2OMO A;  5FII A;  3C46 A;  4DN9 A;  3V5R A;  2XY6 A;  3MAA A;  3MCO A;  3UI3 A;  3OFE A;  2LQ9 A;  1B0P A;  5IM0 A;  1NJY A;  3JSR A;  4ZA1 A;  3HHN B;  1H2T Z;  5F0U A;  3J7Z 5;  2DEI A;  2PA3 A;  3HD2 A;  3SQO P;  4AL7 A;  4K59 A;  2FHJ A;  2C2D A;  3DI6 A;  1S6Q B;  1W25 A;  3MAH A;  4WXO A;  2MYF A;  1C0T B;  2R7U A;  5KG1 A;  3AB2 B;  1T05 B;  5GAE I;  3BGL A;  2EBE A;  2RS8 A;  5AJ3 F;  1MU2 B;  6FD1 A;  4DR5 J;  3NY0 A;  4Q2L A;  2OPS A;  3HHL D;  4LF7 J;  1SL0 A;  1NDC A;  3LGN A;  2KU7 A;  2VOP A;  2CZ9 A;  3VVT A;  2BZ2 A;  1Q16 B;  1C0U A;  1S0V A;  4USJ C;  4IUF A;  4PG7 A;  3FCW A;  1N0V C;  5C2C A;  1A6L A;  2UVW A;  3PYG A;  1S0N A;  3QYY A;  1TVR A;  2AX0 A;  1YJ7 A;  3W63 A;  1YIT S;  1UPM B;  1NXI A;  4V19 X;  4BWM A;  1XBW A;  3THV A;  1WI6 A;  4DV0 F;  1GK8 A;  4FYX B;  3CDA A;  2H65 B;  3M1V A;  1FVQ A;  4RU2 A;  5T7L B;  3ZZR A;  2ILZ A;  3SQG B;  3HKW A;  4KV8 B;  4C7Q A;  5DLG A;  2OAU A;  3HLU A;  3IG1 B;  4N8O A;  1O51 A;  1WF2 A;  1NSK L;  4H4K A;  3E51 A;  2DR5 A;  1DTQ A;  1TL3 B;  4J9Q A;  2DY1 A;  2VG5 B;  2K7J A;  5IFM A;  4F3O A;  4IFY A;  4NLX A;  6FDR A;  2DNK A;  3DYA A;  2KVI A;  2XEX A;  5D0E A;  4Y34 A;  2R7S A;  4A8O A;  4FF1 A;  2QIF A;  2A6O A;  2HHW A;  4F4K A;  2M7S A;  2NXC A;  1FJG F;  1OQ3 A;  3ZO7 A;  1CJT A;  3G8Q A;  2R8I A;  1YTY A;  1JNZ B;  2YNG A;  2IDE A;  4ZVQ B;  5HLF B;  1H72 C;  1T9T A;  2BA9 A;  3VCD A;  2QLW A;  1NJW A;  3CIM A;  2VKZ G;  1RHK B;  2CRL A;  3R7S B;  4RNN A;  2XCP A;  4QOT A;  1ROF A;  4O3P A;  2B9E A;  4I4B A;  4LF8 F;  4X4V A;  4YOE A;  3GJT B;  2GHW A;  3H42 A;  5E0O A;  2OEJ A;  1GMW A;  1FRM A;  3I5B A;  1B64 A;  1PJ7 A;  4WE1 A;  5AXL A;  3QLH B;  2MKK A;  2C28 A;  4ED1 A;  3MM5 B;  4V19 J;  5KFB A;  4FYD A;  3R5G A;  2COL A;  1L3K A;  3EM1 A;  1NSA A;  2OJ3 A;  3QPI A;  5L1K A;  1T03 B;  1URN A;  3K58 A;  2W2P P;  2BE2 A;  2W24 A;  4JI8 F;  4KGZ B;  3OUY B;  1P9Y A;  2GML A;  5K8P A;  5D3G A;  2RQM A;  2MDA A;  2DTJ A;  1EB0 A;  3J7A N;  3A1Y G;  2CPE A;  4OYM A;  3MPV A;  4B9M A;  4KRW A;  1FJE B;  2ASL A;  1TL1 A;  2DXE A;  3G6X A;  2RDI A;  4B02 A;  5KFP A;  1EQM A;  3KLI B;  2NCK L;  1F5A A;  1CJK B;  1ZA2 B;  2BBE A;  2XI3 A;  1RT6 B;  4B08 A;  5AXM A;  2LEB A;  2ZD1 A;  2LEC A;  1H0H B;  1FE0 A;  4M94 A;  2HFN A;  5G0R A;  2IM2 A;  2GA7 A;  2BKN A;  3HXM A;  3TUJ C;  4WZQ A;  1XMQ J;  2O67 A;  3I5C A;  3QT8 A;  3J80 Y;  1N36 F;  2OTL S;  4IDK B;  2W9C A;  2XGQ A;  3DDK A;  1Q95 G;  4DU7 A;  3KTQ A;  4G65 A;  5D78 A;  5DET A;  3MEE B;  4OX6 A;  3IFE A;  5J1N A;  3ULH A;  1B0T A;  3TAP A;  2BKO A;  2LCW A;  2GC8 A;  4OJ1 A;  2K06 A;  3FMW A;  4ZVS B;  4HHH A;  7FD1 A;  3QO9 B;  3X1L B;  3LPY A;  3TRG A;  3RGI A;  5D0G A;  3KLH B;  2ACY A;  3IC1 A;  1S9F A;  5KFY A;  3TNV A;  2L08 A;  2P6S A;  3ZTR A;  1WTF A;  4L76 A;  3AXK A;  1RAA B;  3EMT A;  4KSE B;  1PG5 B;  3AHP A;  2YKN A;  4F8R A;  2W4P A;  2GAG C;  4OZ1 A;  2BJ8 A;  4HI2 A;  4WFB Q;  3C2P A;  1U8W A;  4C11 B;  1MWQ A;  4OJ3 A;  3DHW C;  2PI4 A;  2X51 A;  1QAX A;  2HVH A;  2HQI A;  3ZZY A;  1F9E B;  1XK8 A;  2D3U A;  3CDB A;  4KC5 A;  2HWI A;  2DNR A;  2HHS A;  5F3T A;  2V68 A;  3PCO B;  2E1M C;  1RE1 B;  1Z2L A;  2JEG A;  1RSC A;  4ANE A;  3HJV A;  2IBO A;  5F3Z A;  3LP2 A;  1NK5 A;  3SFG A;  2E1C A;  2NSC A;  3VZI A;  3MDF A;  3RRG A;  1K44 A;  3CUN A;  2B9X A;  4KKO A;  1ZAX A;  3CJK B;  1RAG B;  4PG4 A;  4OI3 A;  3HVW A;  2MLX A;  1HQ2 A;  3CCR S;  4ECT A;  1J5O A;  4OZN A;  2QJ3 A;  1QE1 A;  2IMW P;  2GHP A;  3ET6 B;  2OPQ A;  4DUT A;  1M1H A;  3RU0 A;  3QGG A;  1YG0 A;  3OTE A;  2PI5 A;  2Y1L B;  3BO2 A;  4NAS A;  1JLA A;  3HT0 A;  5DDR C;  3D5M A;  3I0R A;  4P7T A;  2D3Z A;  3EPG A;  1MLA A;  2KFZ A;  3D6F B;  3GB0 A;  4UT4 A;  2Z56 B;  3D2W A;  3NMA A;  3TUZ C;  2CVE A;  5D0R A;  1YZ7 A;  5DQI A;  2DNY A;  3G2X A;  4YEA A;  2ZH9 A;  2HNZ B;  1IBL J;  1RWW B;  3W2V A;  2VF3 A;  5M2U A;  2EG2 A;  1D3W A;  1RBL A;  2Y8Y A;  3M2V B;  1NLK L;  1F9F A;  4K2J A;  3BSN A;  4QWD A;  5H9E K;  3M9N B;  3NNH A;  3UE2 A;  4RWX A;  3O2I A;  4RW7 B;  1NPR A;  2DNG A;  4CLU A;  2DJW A;  2LQ8 A;  3GIK A;  4F2S A;  5LL6 d;  4Y65 A;  1NEE A;  1D0E A;  6AT1 B;  3PX6 A;  2AGO A;  2OPP A;  3QAT A;  5C24 A;  3PXG a;  2ZBR A;  3GU0 A;  4DQI A;  1QM9 A;  2KFN A;  1YRU A;  3IGV A;  1UA1 A;  3T9N A;  2YKQ A;  2HGL A;  3H40 A;  1AB8 A;  2BJ1 A;  3DRX A;  5HRO A;  4DQR A;  2HW3 A;  1T8E A;  4I56 A;  2CJK A;  1TAQ A;  2J0Q D;  3TQE A;  5KFC A;  2YQ0 A;  2QFI A;  3TZZ A;  4F04 B;  2MQL A;  4DL0 C;  1RHJ B;  3HPO A;  2KL8 A;  3DMJ A;  2L41 A;  1F2G A;  2XZW A;  2HQD A;  1YKW A;  1UVJ A;  3MED A;  1N48 A;  2NXU A;  4DV6 F;  5KFI A;  2VQF F;  4Q0B B;  1QY7 A;  1U1K A;  4GC7 A;  4KH1 B;  4ZP6 A;  2V8H A;  4JV1 A;  1RAB B;  3PR4 A;  2O1P A;  3MWB A;  5AXN A;  2NYH A;  4RUC A;  3DNC A;  3KLV A;  2RS2 A;  3BGU A;  1VBZ A;  2J9D E;  2LFV A;  3SCK E;  3SSS A;  2XMW A;  2VPX B;  3V4I B;  1P6T A;  1IKV B;  5GAD U;  2JFD A;  2CJB A;  2HAI A;  4KGK A;  4X65 J;  1WG5 A;  2DIV A;  2YPZ A;  4WP3 A;  3THP A;  3BH6 B;  3QJP A;  1Y7P A;  3CB4 A;  3L7P A;  1HD1 A;  4WFN Q;  2K1R A;  1MMD A;  1UZD A;  3GIJ A;  1BWE A;  3BO4 A;  4PWD A;  1EHW A;  2CNL B;  3Q8V A;  2P8I A;  3HDS A;  1JLE B;  2GIQ A;  1Q78 A;  3I82 A;  3OR1 B;  3NGT A;  1SBR A;  4AL5 A;  3IWL A;  4B3T J;  1VC5 A;  1WOS A;  3QNW B;  1S1U A;  3D4J A;  3SXL A;  2M2B A;  4N76 A;  1X4A A;  1S6P A;  2W2N P;  1EP4 B;  4K8R A;  1X4G A;  4R5P A;  3K8W A;  4QIF A;  1BUX A;  3BRE A;  5IXU A;  1CJU A;  3H5Y A;  2XUL A;  5E7O B;  2QL9 B;  2YNI A;  2VC1 A;  4OYI A;  2RML A;  1NK8 A;  3CCJ S;  2UUA F;  2KT5 A;  1K8A T;  2MMY A;  4MFB A;  4RNM A;  3IO1 A;  4Q2M A;  1S4F A;  3V6J A;  3QWP A;  4X66 F;  4TXS A;  2QA4 G;  4AT1 B;  2E9Z A;  1SIW B;  1HLW A;  1WEZ A;  4F4X A;  2VKR A;  2XYP B;  5DZ6 A;  1BQN A;  1FFS B;  4NEZ A;  2YKM B;  1N88 A;  4I6A A;  4MIW A;  3M7V A;  2W01 A;  2VBY A;  1VQN S;  4WIQ A;  3IS9 A;  3P8B B;  3NMR A;  1VQL S;  3A4T A;  1BMQ B;  3KKF A;  1VBX A;  2CWX A;  2KN4 A;  1LWX A;  4DXL A;  1HBN B;  4RW8 B;  4O44 B;  5GAH I;  1T7P A;  1GQE A;  2DGO A;  2JC0 A;  1FRK A;  1VMB A;  3R5C A;  3T5K A;  3C14 A;  3H98 A;  3M6W A;  5KFF A;  4LMZ A;  1KQS R;  3FZB A;  4DG1 B;  1F3V A;  1SC6 A;  4UQT A;  1DRZ A;  2FD2 A;  3VAI A;  4EUV A;  3BZQ A;  1P27 B;  3R9L A;  2HZA A;  1PJ5 A;  4J9O A;  5B0A A;  4OYX A;  5CAB A;  4FXV A;  4ZMM A;  3H4D A;  4NRU A;  3T1Y F;  4DL3 A;  3MUV P;  5ETP A;  5I4M A;  2ASD A;  4LSN A;  4HVZ A;  3VTI A;  4CLZ A;  3CJ8 A;  2EFP A;  3H4B A;  2WOM B;  2GO9 A;  1M5K C;  2GVZ B;  4OQJ A;  1WD6 A;  3JQJ A;  2HK2 A;  1BD6 A;  1U6F A;  5J2N B;  4U95 A;  3JAM U;  5HP1 A;  3BQ1 A;  5CYQ A;  2YWE A;  1LWE B;  1RWU A;  3MM7 B;  3TWZ A;  4C3M A;  4R0J A;  2NYI A;  2HHX A;  2XSF A;  2C2N A;  2ZBQ A;  2ADB A;  4ZDN A;  1VRU A;  2IJN A;  3C3L A;  2QLJ B;  1KEK A;  1YK9 A;  2MB0 B;  2ASY A;  2BUN A;  4DZ6 A;  3R1H A;  2OFH X;  4BC7 A;  2C2E A;  3S6E A;  2AV5 A;  1WAC A;  3OTO F;  2FTR A;  3IRX A;  1Y9O A;  2VDI A;  4AXI A;  4KHP F;  2HYI B;  3Q24 A;  2D9P A;  3O8W A;  5LMU F;  1HBO B;  1FA0 A;  2J9D A;  2E44 A;  2AF6 A;  3SMZ A;  3PTW A;  5J2Q A;  3NBP B;  2R7O A;  3SEO A;  4CO1 A;  4ID8 A;  2DGU A;  4K5S A;  3CPW R;  3J7Y I;  2ZOF A;  1IKW B;  4PQA A;  4KYZ A;  3IN5 A;  1GMU A;  1DBD A;  3V6D A;  4ZCM A;  4ZHR B;  4Q8E A;  1SL2 A;  4D3H A;  3W2W A;  2ZBP A;  3A3P B;  1KNZ A;  3DM2 B;  1YIJ S;  5KAK A;  3L09 A;  4RBU A;  2UU9 F;  1RK8 A;  5L8R C;  3THT A;  2OML A;  3CO0 P;  1VQK S;  4PUO A;  1HHQ A;  1HI8 A;  2LA4 A;  2V8P A;  3W62 A;  5EX3 A;  2RIJ A;  1R6V A;  2R4F A;  2DNQ A;  1X4H A;  4GMK A;  4YP3 A;  3KXD A;  4DZD A;  4ILM A;  2D1C A;  4KH0 B;  4Y2A A;  2DCL A;  5IT4 A;  4Z37 A;  4BWJ A;  4FS2 A;  4U96 A;  1RZM A;  3J81 Y;  1NSP A;  2Y0B B;  3AD7 C;  5ETQ A;  4ZIT A;  2F40 A;  4XPC A;  2YQ3 A;  4DQS A;  1KFD A;  2QYC A;  1N5Y A;  1FK9 A;  1WHV A;  2W9B B;  3LAL A;  5IOL A;  2KTQ A;  2IRY A;  3I6P A;  3TJ9 A;  2VG6 B;  4GVB B;  3CGI A;  4QU6 A;  4J9M A;  2IC3 B;  5KT4 A;  2WVF A;  3BN4 A;  1S59 A;  2Q3P A;  1H2U X;  3HCX A;  2XQC A;  2IYI A;  4I2P B;  2EFV A;  3V4M A;  2N3L A;  4CLT A;  5CD4 H;  4OX9 F;  5KFQ A;  4JYA J;  5IQQ A;  2L3M A;  4URG A;  3BJY A;  4UZB A;  4H4M A;  4PQU B;  4JB8 B;  4QWA A;  1LK5 A;  1S9G B;  3R7N B;  2U2F A;  3PYF A;  3LAK A;  2EFG A;  1DJ0 A;  2YPY A;  1IWG A;  4URQ U;  1XR7 A;  3DRY A;  2ZNZ A;  4Q45 A;  3DGP B;  1REG X;  1SXL A;  2C3M A;  5K8M A;  1PIL A;  4WYL A;  3FBE A;  3AOC A;  1YSJ A;  3AOA A;  1JLF A;  2AJ1 A;  5ETK A;  1QUP A;  4DFM A;  1FKO B;  4DSJ A;  2XCA A;  4C8L A;  4CCH A;  2MKC A;  5A2Q U;  2GX8 A;  3CCU S;  3K5N A;  4EBE A;  4CTA A;  1UET A;  1VJQ A;  2W7P A;  3NGU A;  4OZJ A;  1WC6 A;  3T1H F;  4LT6 A;  2VPY B;  4DPT A;  4DN0 A;  3UD5 A;  4JI4 F;  2VZ9 A;  4O23 A;  3IBC B;  4J9P A;  3MFH A;  1N34 F;  4B17 A;  2Q79 A;  1UEU A;  4EO8 A;  3CCT A;  1YJT A;  2C3Y A;  2NSB A;  2QYG A;  3PFO A;  1IBM F;  3IAS 9;  3N79 A;  4WFA Q;  1OQ6 A;  3HHD A;  4OI4 A;  1QUV A;  1XNR F;  4KGV B;  2RT3 A;  1S5Z A;  2FHM A;  5HMX A;  1HNW F;  1HNV A;  4DUZ J;  4RNH A;  1RT3 B;  5EGY A;  2N4C A;  1IKX A;  9RUB A;  4X2B A;  2JVR A;  4GO7 X;  1N32 J;  2N4D A;  2XMU A;  2EFQ A;  3SSR A;  3L95 X;  2CNK B;  1T11 A;  2Z4P A;  3B8H A;  2KJV A;  3DGV A;  4MT1 A;  2LEP A;  3ZZU A;  3PW5 A;  2F8M A;  1SUQ A;  1L3T A;  4F67 A;  1U1L A;  5IC6 B;  4YR3 A;  4E98 A;  1RT4 A;  3D1O A;  5D4N A;  1XEZ A;  1KKH A;  2C3O A;  1KTQ A;  4I1T A;  2R9L A;  2QGF B;  4ED7 A;  2DVI A;  1TL4 A;  2KHD A;  4N7T A;  4GKK J;  4YDD B;  2P2C B;  3D0H E;  4HTJ A;  3RUB L;  2DNZ A;  4ETZ A;  2ATL A;  4Y00 A;  4DV4 J;  3HKZ D;  3BBB A;  2F4V F;  4B3R J;  3HM9 A;  2MPU A;  4NCG A;  4HAC B;  1Y0H A;  3QRQ A;  5C42 B;  2HQC A;  1NJZ A;  1U8S A;  3MM9 A;  2HG4 A;  4C97 A;  3EGV A;  2BQR A;  4M5G A;  5L1I A;  4NLT A;  2EWH A;  4HI1 A;  4OHV A;  3C6T B;  3BPS P;  1DUR A;  3B4M A;  3M8Z A;  2H48 B;  3C8Y A;  3MTK A;  1LW2 A;  2Z2Z A;  1FKP B;  4USU A;  2QO3 A;  1NK4 A;  2G2Y A;  2WVB A;  2I1R A;  2XMA A;  2I5J B;  1TK5 A;  2F9J A;  1QLN A;  2LQ5 A;  3VZH A;  1WEL A;  2OEM A;  1S0M A;  2VBZ A;  4UST A;  4WPA A;  3KHR A;  1YJN S;  2BV3 A;  3EDQ B;  3GJQ B;  3OLA A;  4FN5 A;  4A8M P;  3JYT A;  2KDO A;  4J9K A;  4KT0 C;  4G6V B;  2HGM A;  1RKI A;  1HPZ B;  4NZ6 A;  4DSI A;  1M5H A;  1U2F A;  4Y3C A;  3BKU A;  4K50 A;  4TNO A;  3WQP A;  2V4J A;  2YTC A;  4CDI A;  1WKK A;  1AUD A;  2KFY A;  2CDR B;  2HPU A;  4I6W A;  1E6Y A;  1WEX A;  4FZV A;  3AJ1 A;  1RYS A;  4B3M F;  3E3X A;  3GWC A;  4CZC A;  3JTP A;  4EU0 A;  2RQC A;  1GAO A;  1R27 B;  3PY8 A;  2NUU G;  4OV6 A;  4DR3 F;  4ECU A;  5C25 B;  3OPK A;  3UVJ A;  4P2M A;  2XZT B;  2XSJ A;  3PJW A;  1S1T A;  2H5E A;  2AEJ A;  5G4D A;  3KG4 A;  4BCA A;  5J2M B;  2I8E A;  4P2S A;  3QGP A;  2MZR A;  3X3U A;  1ZA1 B;  1KOH A;  3W1Y C;  3ENA A;  4UQG A;  3KLE B;  1Z4U A;  3DOM A;  4LBH A;  3MPY A;  1W26 A;  1WNE A;  2B7B B;  2K7K A;  3Q23 A;  3GIL A;  3QIP A;  5FDL A;  5I3Q A;  1A0O B;  2DD8 S;  1UEK A;  1S72 S;  3BN7 A;  3VHQ A;  2M8D B;  4ZS6 A;  4TY9 A;  3BGR B;  2E1A A;  1X7V A;  4Y6I A;  3SDE A;  3B78 A;  3M2R B;  1WC3 A;  4WZM A;  2RD5 C;  1AFI A;  1U1R A;  2LMI A;  1FRI A;  2EG1 A;  4HHJ A;  4LF1 A;  4ER8 A;  2ZH3 A;  2J8A A;  3FRZ A;  4DPY A;  2W1B A;  4H4O B;  3N6L A;  4AXJ A;  2OKQ A;  3DXB A;  2K3K A;  1EAY C;  4F2R A;  4USH A;  1ZM2 A;  1XC9 A;  4MMO A;  3P49 B;  3FSI A;  2PD1 A;  5KFN A;  2XMK A;  4DX8 H;  4K0K J;  4NL5 A;  4OI0 A;  3G6Y A;  4OZ5 A;  3LP1 B;  3L9Z A;  4QWC A;  2J6T A;  5K9F A;  4WCE Q;  1EET B;  4NLR A;  4YUD A;  2EK6 A;  3L7O A;  1NHV A;  1NJI T;  1HNZ J;  1MNE A;  1UVN A;  1PO6 A;  2CQB A;  4UUW A;  4LRB A;  3OTC A;  4P73 A;  2LKZ A;  2XO7 A;  1T3N A;  1Q7Y T;  3RAQ A;  4DOZ A;  2ZE2 B;  3CC2 S;  2IVY A;  1WG4 A;  3C16 B;  4M5H A;  2OP5 A;  5JVH Q;  1KVI A;  2VQE J;  3V81 B;  1AUS L;  1SPB P;  1JX4 A;  2DR9 A;  4ECR A;  3K2Y A;  2RU3 A;  3KJV A;  1FRJ A;  2MKH A;  3HSD A;  4LF9 J;  4I0W A;  2DRA A;  3FFI A;  5KFM A;  1N6Q B;  5CH7 B;  1BLU A;  5HVF A;  4Y2C A;  1AT1 B;  3DRP A;  4ZIW A;  3D28 A;  4KTQ A;  2AEM A;  3NAH A;  2WAQ D;  3HSJ A;  4QBU A;  2X1F A;  3MGJ A;  3LOU A;  3HT3 A;  2HLU A;  5B08 A;  1VYA A;  2HFS A;  2WZ1 A;  2EPI A;  1NK7 A;  3WX4 A;  2ZOM A;  4EZ6 A;  3T1Y J;  3ZNU A;  4JV5 J;  2FZG B;  3NCQ A;  2A6M A;  3S01 A;  3AOB A;  2UXD F;  3EXY A;  1Y10 A;  4DR4 J;  4QPX A;  4ZPT R;  2O66 A;  5ETM A;  2XYG B;  1SKR A;  5RUB A;  3MEC A;  1YJW S;  2ZH7 A;  4JBC A;  1WHX A;  3W8G A;  3JQK A;  4B3S J;  1H2V Z;  2NLW A;  4Z7Y A;  3W66 A;  3M8P B;  2WK4 A;  1FER A;  1U1Q A;  3GPA A;  3WZ0 A;  2CQP A;  1JLC B;  3F56 A;  2DIS A;  2VV5 A;  5AE1 A;  3TZX A;  2J9E A;  2HNY A;  4RUB A;  4DV1 F;  2GJ2 A;  1B7Y B;  2BM1 A;  1TV6 A;  2I38 A;  3AAW B;  3ISZ A;  4ECZ A;  1T9W A;  2R7Q A;  1N8R T;  3O6Q A;  1OO0 B;  2V5H G;  3E01 B;  1OSC A;  2GZO A;  1V6H A;  4OX7 A;  2YNH B;  4ELT A;  1KDN A;  1NCL A;  4DV7 F;  1IR1 A;  3EX7 B;  2D74 B;  1RDR A;  4LFC J;  2N7Y A;  4PZV A;  3CT9 A;  2GCF A;  2WTF A;  3NGR A;  1HAR A;  1TKZ A;  3BM7 A;  1UVL A;  1HNX F;  3OXG A;  2ZVI A;  2LLZ A;  5JXS A;  2MZT A;  1HA1 A;  2JJ4 D;  3A12 A;  4I67 A;  1NK9 A;  1SJ3 P;  4UZC A;  2HRU A;  5F8M A;  2CKW A;  3G87 A;  4NI2 A;  3LP0 A;  2I6W A;  2QL5 B;  3PW4 A;  5KFJ A;  3GV7 B;  1FRX A;  5LMN J;  1B7F A;  4KPC A;  4YFU A;  3KLG B;  4LBP A;  2BAN B;  3OHB A;  5A8W B;  1OY6 A;  4CO2 A;  3ZTP A;  4UW2 A;  1H38 A;  3CXC R;  5F9L A;  3PYE A;  2APO A;  3PNI A;  1KRP A;  3CJT A;  3CCE S;  1HBU A;  2OSQ A;  4R8U A;  2KM8 B;  3MAA B;  1RLD A;  2ZH6 A;  3TP2 A;  3W9J A;  1N5T A;  2M70 A;  2MEW A;  1S1W A;  1AYE A;  2XNR A;  4W92 B;  3MM6 B;  2ZZM A;  3MMC A;  3PRD A;  2HS4 A;  1JLQ A;  4NXN J;  3C19 A;  4BLG A;  4YY3 J;  3IBW A;  5A2Q Y;  1QSL A;  3KJN B;  1ZYQ A;  1GTH A;  4AQY J;  5E3Q A;  2CAJ A;  3P3D A;  4F25 A;  3D6H B;  2BX6 A;  4OIX A;  1SC4 B;  4K7Q A;  2DGQ A;  2CNN B;  3GQC A;  1ZTW A;  5E3P A;  4PKD B;  3W8P A;  3FSX A;  2HVZ A;  1T9V A;  4WII A;  2J6S A;  1HYS B;  3BO3 A;  2DPI A;  4ZLJ A;  3MOZ A;  2LU1 A;  3ZTS A;  2G0C A;  2LDI A;  2OPS B;  3AB4 B;  1NO8 A;  2YVS A;  2IFX A;  2AYB A;  3HSZ A;  3TAN A;  2MY7 A;  5AXK A;  1GFW B;  2L9N A;  3N6M A;  1S6Q A;  2G13 A;  2EXU A;  2PE8 A;  5DRK A;  3ZTO A;  3R6G B;  2HHT A;  1C0T A;  4DPU A;  5KTQ A;  2ZH4 A;  4J9R A;  3M6X A;  1WOR A;  1I5O B;  1MRO B;  2LDY A;  1T05 A;  2XI2 A;  4ECS A;  1C0U B;  2ZHA A;  3D7S B;  1MU2 A;  2L9W A;  1VQS A;  2XM3 A;  3MF5 A;  2MKJ A;  4HHU A;  1LWF B;  1VRT B;  5DQH A;  2V2Q A;  3D3B J;  1KBR A;  2FZK B;  5KFH A;  3HFK A;  4URS A;  4RNO A;  3Q8Q B;  2V50 A;  3DRR B;  1CC8 A;  1NME B;  3MHY A;  4L74 A;  4OHZ A;  1D9D A;  4C8O A;  1I51 B;  4EWT A;  2VOO A;  1HR0 F;  2I9S A;  4HYK A;  1HQE A;  4NYZ A;  1DTQ B;  2M9K A;  3CDE A;  4DL4 A;  3D6T B;  3W5Y A;  1UJ5 A;  2D7S A;  1RIS A;  1CVJ A;  1S1X A;  4PG5 A;  5CQG A;  2KT2 A;  3N28 A;  1KVK A;  4J9V A;  3OQ2 A;  1UEV A;  3QT7 A;  3KK2 B;  1F6T A;  4C8N A;  4KQZ A;  1RTJ A;  4LR8 A;  3BEG B;  3OW2 R;  3IG1 A;  2V9W A;  1U6B A;  1TL3 A;  1LNQ A;  3LTO A;  1U1P A;  1N33 J;  2VG5 A;  5LSO A;  5IT9 U;  4WK3 A;  1JKH B;  2HWH A;  2FLP A;  4USK A;  3IXQ A;  4DS4 A;  4U8Y A;  1OYE A;  3MCN A;  2FY8 A;  3FBF A;  3J7Y U;  5L38 A;  2A3J A;  2FVP A;  5F8H A;  2MHN A;  2CQC A;  2UZA A;  2MQP A;  2V0N A;  3GJR B;  4WE1 B;  1MML A;  1WSV A;  3CIZ A;  1QVG R;  5LXY A;  1VIS A;  5HLF A;  4RL1 A;  2HEK A;  1UPP A;  4A8F A;  1L3V A;  1TKX B;  1SQG A;  1KFS A;  3OHA A;  2IY5 B;  3S1T A;  5L46 A;  2H51 B;  2HBR B;  4DUY F;  1I94 F;  4QPT A;  2DIU A;  2FVS A;  4P74 A;  2YNF B;  1M5V C;  2Z30 B;  1XJW B;  5D3G B;  3QLH A;  4OJG A;  1NK0 A;  3FRY A;  5DJB A;  4L6V 3;  1S49 A;  1MMN A;  1JLB A;  1TL1 B;  2RUG A;  2G1D A;  5A8K A;  2CZV C;  1PJ6 A;  5CYM A;  2F4V J;  1T03 A;  3UWT A;  3VQT A;  2ZZN A;  1PGZ A;  2D3O 1;  3OUY A;  2KM8 C;  2AIR B;  3GYN A;  1Z1Z A;  3S8S A;  4DPO A;  1W7W A;  3T41 A;  2VIH A;  2GQ2 A;  1HW9 A;  3DDN A;  1IBC B;  2ZD1 B;  4CRJ A;  4M1K A;  2UXC F;  3QZ8 A;  1SQF A;  1APS A;  3HHL A;  4P2F A;  5G0R B;  1U4B A;  2UXB J;  1XMO J;  1LK7 A;  3KLI A;  2HQ3 A;  2Z2L A;  1D9F A;  1XNQ J;  3DLJ A;  1CJK A;  1GXT A;  4ZKA A;  3JTO A;  3TEG A;  2W9C B;  4O3O A;  3ZZZ A;  3HHE A;  2ZHB A;  4BBY A;  3H90 A;  2CFX A;  1H73 A;  1TL5 A;  3I32 A;  4ED5 A;  2G0J A;  5IC4 B;  3QGI A;  3C6U B;  3BF4 A;  2VIC A;  4NLS A;  3ZNJ 1;  5KG2 A;  3NP5 A;  3OXL A;  2WBR A;  1RLC L;  2KT3 A;  1EZZ B;  1HNI B;  3C66 A;  4QIE A;  2QSW A;  2DNO A;  1EJ7 L;  3QJJ A;  4LF6 J;  4DLG A;  2QTW A;  3MEE A;  5J1E A;  2WVD A;  5EX0 A;  4ZVF A;  2YKN B;  3UN2 A;  1CQN A;  3DFE A;  2R7T A;  1R0A B;  1LFP A;  5GMD A;  2VUG A;  3PX0 A;  3UCG A;  2HK3 A;  1VJW A;  2MTL A;  3QO9 A;  5IWA J;  2DR7 A;  2F3J A;  1SQE A;  3KLH A;  4JI5 F;  1I3O B;  4F7V A;  2VD3 A;  2KJW A;  4AND A;  4A8W A;  1JIH A;  2OO4 A;  3JSY A;  2AP6 A;  3SCJ E;  4ZIV A;  2XG8 A;  1F0X A;  4ALZ A;  1X9S A;  2WHO A;  1RT2 A;  2B5J A;  3D1Q A;  3I31 A;  3QMQ A;  1JJ4 A;  3NCP A;  3W64 A;  4JI0 J;  3CJ4 A;  4OYP A;  4C11 A;  4J90 A;  1JNR B;  4LVN P;  1PC4 A;  2FLN A;  4NA2 A;  3LP2 B;  5EDW A;  4DSE A;  1NKE A;  1DQ9 A;  4H4K C;  2W2Q P;  3BKT A;  3VAG A;  2V8D A;  5IZH A;  4KJI A;  2YWG A;  3SSQ A;  5GAD I;  4Z2X A;  2BKP A;  1JQG A;  2MQ8 A;  1RT1 B;  1KON A;  4F0M A;  5ETT A;  3U1L A;  2ABY A;  4L3K A;  3V6K A;  2X7I A;  1X4C A;  1JXL A;  4F0H A;  1LFW A;  2OPQ B;  4LFA F;  4N5S A;  1C1C B;  2RU9 A;  3TAR A;  4JV0 A;  5A6P A;  1FD2 A;  3GZ7 A;  1P8G A;  2ERR A;  1YLX A;  1JLA B;  2LXF A;  1BQM A;  2J5A A;  2C2Z B;  5I3U A;  2CQ3 A;  2MJU A;  1U1M A;  2ZDP A;  4XIU A;  1SC3 B;  3KDO A;  3HZE A;  3W2V B;  4ZVR B;  4USV A;  1LXN A;  3SV4 A;  1PAU B;  3N9U C;  4PAB A;  4A47 A;  2XMT A;  2GNK A;  4DV2 J;  2YKP A;  3TZY A;  2YXL A;  5GME A;  1YI2 S;  3GCX P;  2F4F A;  1FF2 A;  3R97 A;  1HW8 A;  2CG4 A;  1CEZ A;  2V4R A;  4PPD A;  2J7U A;  3SCL E;  2HNZ A;  2RHQ B;  3TAQ A;  3RR7 A;  4ZK7 M;  1A9N B;  1AZS B;  2OPP B;  5C24 B;  1RU2 A;  3M2V A;  2RB7 A;  2OIH A;  4ZPA A;  4B3O B;  2HFO A;  3HX9 A;  4QYZ J;  1MN9 A;  2PMW A;  3QSI A;  3K17 A;  2RQK A;  7FDR A;  1XR5 A;  2B56 A;  1LV5 A;  5LT5 A;  4FF3 A;  2VH7 A;  4F4W A;  5EN1 A;  1C4C A;  1XIQ A;  4YR2 A;  1TKT A;  2E9T A;  3BGF A;  3T19 A;  1TFW A;  3JB9 k;  2HRY A;  4O4G B;  4IQX A;  1NJX A;  4K4X A;  5HMY A;  3DMJ B;  3KG0 A;  3KMQ A;  4M5L A;  2WVC A;  1PSD A;  1GT8 A;  5JJB A;  3PHE A;  1CUL A;  4G1Q A;  4ZJL A;  1NH8 A;  4EMD A;  4ZVH A;  2LXI A;  4L75 A;  5L9N A;  1Q81 T;  4OYZ A;  3IR5 B;  1CG2 A;  3DU5 A;  2UXD J;  1ZBT A;  3EXC X;  3GFX A;  3ADA C;  2XWY A;  3GTY X;  2AW0 A;  4OX8 A;  2B4O A;  3HP6 A;  2V67 A;  1TK8 A;  5DDO C;  1ZPW X;  3LQV A;  1V5V A;  1BE4 A;  1U48 A;  2J0W A;  2PA8 D;  5DZ7 A;  2AX1 A;  5HBM B;  2VFR A;  4ZVP B;  4DFP A;  4Q0B A;  2B8P A;  2DIT A;  4LR9 A;  2Y0S D;  1FES A;  2BVZ A;  1X9M A;  2IAJ A;  1CQM A;  5DGB A;  4JI7 F;  2QLB B;  2DYA A;  1SKW A;  2IRU A;  1QAI A;  2DR6 A;  4WKR A;  3L3C A;  4N47 A;  1F60 B;  2AU0 A;  1IQT A;  2K1R B;  1R8P A;  3AJD A;  3GSD A;  2EBG A;  3N01 A;  4ZPD A;  2VAS A;  3V4I A;  1GX5 A;  2YKO A;  1DQ8 A;  2G2Z A;  4V1A k;  3VR1 A;  4EO6 A;  3Q0A A;  1HL6 A;  4JI3 F;  2RF2 A;  2Z2Y B;  5IV3 A;  3T6J A;  2VC0 A;  5K14 B;  3U1M A;  2W7A A;  4EEY A;  3MI7 X;  1WTB A;  1S1U B;  2CDQ A;  3DLL Q;  4MTP A;  2HQF A;  2OSR A;  1S6P B;  4DV3 J;  2EI5 A;  4FXD A;  2CWK A;  3TA0 A;  2JOQ A;  2RHS B;  5KG3 A;  2J6U A;  2YX1 A;  1JLE A;  2XS2 A;  2BMB A;  3U27 A;  2YNI B;  3OR1 A;  2UUB F;  5ETO A;  3GV8 B;  2UUC F;  2C3P A;  4DR1 F;  4X64 F;  2GHV C;  1NHK L;  2B6A B;  1EP4 A;  4JI1 F;  5KFU A;  4DR7 J;  2X1G A;  4ED4 A;  4CIO A;  3M8Q A;  2BXJ A;  1JLG A;  3MR5 A;  1WHY A;  1VQ5 S;  4W98 A;  3W5X A;  4FDF A;  3PIP Q;  2B51 A;  4KHM A;  4ZPV R;  5E33 A;  4RJV A;  3MM8 A;  2CQH A;  4IFV A;  3CC4 S;  2E1R A;  4CO4 A;  3IS9 B;  4RKU C;  4LFB J;  3VAJ A;  1VLY A;  5ADZ A;  3UR0 A;  2ZH1 A;  4WBF A;  2Y9H A;  1S1V B;  4M5M A;  2IMO A;  1YHQ S;  1FD8 A;  3W60 A;  3R5B A;  5CZV A;  3HF5 A;  3R27 A;  5BYS A;  2XO6 A;  2VON A;  3OTD A;  1RWK B;  1X8D A;  1R0C B;  5D77 A;  4YHH J;  4DR2 J;  3F0N A;  2ZM6 J;  4Y2K A;  3T5J A;  2QLF B;  2AHO B;  2C42 A;  1KLM B;  3I55 S;  2VB6 A;  2HFZ A;  4X84 A;  3K5M A;  1RWO B;  3W9I A;  1BGX T;  1HBN A;  1QDU B;  4O44 A;  4RW8 A;  1K0V A;  1RAH B;  2MXY A;  1OMS A;  5IT9 Y;  4DR6 J;  2E5H A;  2GS8 A;  2HUR A;  4RU9 A;  3Q8S B;  2Z58 B;  2NXN A;  3DLG B;  4DG1 A;  1ZAW A;  2N3O A;  4LF4 F;  1X4E A;  2NXE A;  1BC6 A;  4ED8 A;  1TTH B;  2W25 A;  2POK A;  4FKX A;  2FZC B;  2HND B;  1VRQ C;  4A8Q A;  1RTI B;  4PWW A;  4DX5 A;  5CYQ B;  1VHF A;  2X3G A;  2ZVS A;  2HHH J;  1L3U A;  5KFZ A;  2CPF A;  1XQI A;  2KG1 A;  2XB2 D;  4DI6 A;  4OHW A;  1TAU A;  4OZ2 A;  3GIM A;  2GVZ A;  5HL7 Q;  5ETL A;  3TAM A;  2HAF A;  5J2N A;  1IUJ A;  1VRU B;  2GO8 A;  5GMK a;  1PYO B;  3FMB A;  3G8S A;  3ZXW A;  1LW0 B;  3ISN D;  3M9M B;  3MM7 A;  4LJM A;  1K1Q A;  5J1P A;  4RZR A;  3JSB A;  4DEZ A;  3GV5 B;  3IRX B;  3FVY A;  1SJ4 P;  1HMV A;  3RBE A;  3ELH A;  2UP1 A;  3MMB A;  4ECQ A;  1U0H B;  1XTZ A;  1B99 A;  3BPD A;  4EBD A;  3TJA A;  3ZZO A;  2R7W A;  1ELO A;  4L73 A;  4B9S A;  1FDN A;  1U7L A;  1IVZ A;  1UFK A;  3PO4 A;  1V9O A;  4N77 A;  4OFZ A;  5DQG A;  3J81 j;  4Z7C A;  4IH6 A;  3NNC A;  2UV8 A;  2F9D A;  1EQ0 A;  4JI2 J;  1FX4 A;  2DGT A;  3FC9 A;  4PYD A;  4ELV A;  3W2W B;  3CDW A;  3RAM A;  4MYT A;  4QR0 A;  3NBP A;  2J7K A;  1SC1 B;  4NXM J;  5CZX A;  2NQP A;  2C2R A;  2ZBI A;  2F1F A;  2V63 A;  1IKW A;  1N54 B;  2B4U A;  3O5T B;  2V2V A;  2XMV A;  2ZJQ Q;  1R8B A;  1UVI A;  2VFU A;  4ZHR A;  3CCQ S;  1FNX H;  2IM0 A;  3DM2 A;  5T14 A;  2IRX A;  3TI0 A;  5KG6 A;  1ZPV A;  3QZ7 A;  2OLW A;  1SB6 A;  3BQ0 A;  2J9C A;  4J91 A;  3MEG B;  1QTN B;  2HQG A;  2QMW A;  3NS6 A;  2CA9 A;  2HS0 A;  1N52 B;  1TUG B;  3RW6 A;  4A4J A;  2HBY B;  2RNE A;  3CUL A;  4QJV A;  1FX2 A;  4DFJ A;  9ATC B;  1FVS A;  1HBM B;  3A8K A;  3AD9 C;  2A10 A;  3EZO A;  1WOO A;  2BJD A;  3B4D A;  3NLC A;  5DLF A;  3KWM A;  2UV8 G;  2XZD B;  1GX6 A;  1RT5 B;  3M6U A;  2AD9 A;  4R25 A;  2W9B A;  1Q7L B;  4NLU A;  4CNZ A;  3AA9 A;  3CF5 Q;  3R1L A;  4CH0 S;  2CPJ A;  1KOO A;  2VG6 A;  3QGH A;  1IR0 A;  1C4A A;  2IC3 A;  5L9X A;  1O8B A;  3UN5 A;  1EAR A;  4DR5 F;  4I2P A;  4LF7 F;  2G2O A;  3GR0 A;  4DFK A;  3M32 B;  5B7W A;  4PQU A;  2NPI A;  4OLO A;  1S9G A;  4HT5 A;  4J7C A;  3EZU A;  5DO2 A;  2VFT A;  4OMF G;  3RTV A;  4OI6 A;  1WDT A;  2H4W B;  2PEH A;  2KH9 A;  2RAQ A;  1T0T V;  4I69 A;  2W2O P;  2NRE A;  5E3R A;  2AJ4 A;  2XHW A;  3WIU A;  1YVF A;  2QT7 A;  2GQC A;  3GG1 A;  1TU0 B;  3TX0 A;  2R2T A;  5HI7 A;  4FPR A;  2GW8 A;  2QFJ A;  1J5E J;  4P6Q A;  1UWA A;  3UDE A;  1IXK A;  4M8L A;  1TL7 B;  2IIH A;  1RT7 B;  2RRB A;  4JI6 J;  4OZL A;  2J7W A;  1CC7 A;  3JTN A;  3AXM A;  2G4B A;  1DFD A;  2UVU A;  2R2U A;  3MMA A;  1FDB A;  5B0E A;  4DL7 A;  1U49 A;  1RWN B;  1FTR A;  2ZEJ A;  2ZKT A;  5KT7 A;  4ES3 A;  2C2K B;  2MST A;  1MSW D;  2XS5 A;  1XR6 A;  2Z0G A;  1JJ2 R;  3A8J A;  3FQK A;  4LIR A;  3DLH A;  1V5I B;  3DHX A;  3GR1 A;  3IRW P;  4QQB A;  4PYA A;  4PG8 A;  1DZ5 A;  2Q66 A;  4J9U E;  3V2U C;  2KVQ E;  2ZBC A;  3Q86 A;  5JVG Q;  4UY8 5;  4KAI A;  2CJQ A;  1SUQ B;  2DNH A;  2MZJ A;  4F3M A;  5HVG A;  1WC0 A;  2FQQ B;  2CNO B;  3DDI A;  5E41 A;  1X0F A;  1RT4 B;  4C6A A;  1T9X A;  3VQS A;  4X4R A;  5EHH A;  2WW4 A;  4RW4 B;  4NE9 C;  3AD8 C;  3UQS A;  1RTD A;  1S7H A;  3TYT A;  1CSJ A;  3K0J A;  4B9V A;  1VC0 A;  2P5V A;  1D9A A;  3ITH A;  2C2M B;  3QRP A;  5KG5 A;  4WWS A;  3BBF A;  3D6M B;  4K4W A;  1ZOT A;  1TR0 A;  4MAK A;  2B4V A;  2WB1 D;  4EGL A;  4F02 A;  2Y1R I;  4OYW A;  3TA1 A;  2GIF A;  1ZS6 A;  4ZVE A;  3PFE A;  2HHU A;  1SCJ B;  1FI4 A;  2HHQ A;  3LPE A;  3NL0 A;  3MPD A;  4Y0F A;  4BC9 A;  2HIY A;  5BR8 J;  1V3S A;  2DNL A;  4UF4 A;  2FJW A;  2FHO B;  2ZIT A;  1KHV A;  2XLJ A;  3VGT A;  3S7R A;  4DF8 A;  2BJ9 A;  3D3C J;  3KFW X;  2DT9 A;  4LRA A;  1HIY A;  5K8O A;  2P6T A;  2C22 A;  4FKY A;  4C98 A;  3BYR A;  1XMQ F;  2FY1 A;  4NYO A;  2BYC A;  5D4O A;  3ILI A;  5L1J A;  1FKP A;  2CPD A;  3JYT B;  2F65 A;  5HN0 A;  3KK3 A;  3OR2 B;  3EDR B;  1U6Z A;  3HFZ B;  1OSD A;  3TUI C;  2DNP A;  4P72 A;  1E6V B;  3FZ2 A;  4HH0 A;  2ZH8 A;  1E6Y B;  2QE5 A;  4ITS A;  4DSL A;  1G7C B;  3N0V A;  1X60 A;  2W8L A;  4WFX A;  3QT6 A;  2M88 A;  1GNK A;  1HPZ A;  4CYU B;  2E5I A;  1TQL A;  2YY3 A;  3G6E S;  5IT0 A;  2R8H A;  3D54 A;  1A7G E;  3PDN A;  3RG6 A;  2B8Q A;  1P1L A;  3CJ5 A;  1Y5N B;  3SZ2 A;  2GGP B;  4IRD A;  3GG0 A;  3ISN C;  2W8K A;  2D3O R;  1VQ4 S;  1WC1 A;  2ZH2 A;  5D15 A;  4CI0 B;  2MZS A;  1B3T A;  2DXD A;  1H74 A;  3Q8R B;  2MKI A;  1N5Q A;  1KHW A;  4C8M A;  5C25 A;  2A2C A;  2HFU A;  4ID5 B;  1JB0 C;  1C1B A;  4Q43 A;  4DCO B;  4PXB A;  8AT1 B;  3QQC D;  4FP9 A;  4DV5 J;  2HBQ B;  3B54 A;  2DGW A;  3DN9 A;  4ZLN A;  2OD4 A;  5F8I A;  4F3Q A;  4X62 F;  1LWC B;  2HRT A;  3RB3 A;  4F26 A;  2DRB A;  2IHR 1;  3MAQ A;  2JHE A;  1NRK A;  3JSM A;  1Y00 A;  2H1Y A;  4UY8 T;  3UD3 P;  5H9F J;  2XLI A;  3N6N A;  4ED6 A;  1TK0 A;  3VGV A;  4HT7 A;  2WON A;  3M2R A;  4LBI A;  4RLE A;  1M1G A;  4P7V A;  3FBB A;  2E5L J;  2HVI A;  3CJ0 A;  2AZ1 A;  5C5J A;  4GKJ J;  3AQP A;  1Q5Y A;  1U45 A;  2P9G A;  2BEF A;  4H4O A;  1FFG B;  4U8V A;  2JLF A;  3Q8Y A;  2KKH A;  1F3F A;  4PXD A;  2H9Z A;  2VFS A;  3CD6 S;  1FWP A;  1V3R A;  4F36 A;  1LKZ A;  5D8H B;  4ED2 A;  3B6B A;  5M2P A;  4FYW B;  1N5V A;  4ZP7 A;  1HHT P;  1NUE A;  4KR0 B;  1TUW A;  4IRK A;  4FBU A;  2BQU A;  4I2Q B;  3DOK A;  2MHE A;  3BYP A;  1SKU B;  4AE5 A;  2LP4 A;  4JUZ A;  1FWL A;  3KUG A;  2JEF A;  3CMA S;  5KT5 A;  3M8Y A;  3OSP A;  2AYE A;  2ZE2 A;  4J9N A;  3R5A A;  1YJ9 S;  4M5D B;  4AD6 A;  4H54 A;  3V81 A;  4JV2 A;  3GYX B;  5AJ3 J;  1HI0 P;  5J2P B;  3H20 A;  3ZZ0 A;  1WKL A;  2NUH A;  4ZVT B;  1DAX A;  3TO8 A;  5KFG A;  1N6Q A;  2KYX A;  1U0S A;  4G1P A;  4IG3 B;  2CQ4 A;  3ZFV A;  1UW4 A;  4CT9 A;  1XER A;  1VLO A;  5B0G A;  5IS2 A;  1H6K X;  5ETS A;  2NXJ A;  4ERD A;  2AZ3 A;  2SXL A;  2BM0 A;  2L48 A;  2RVJ A;  2ZOG A;  5K5M A;  4KHR A;  4GVL A;  4CNY A;  5HMW A;  1I6J A;  5KFE A;  4A46 A;  3LWL A;  2EFO A;  1WEY A;  4XO0 A;  3VGU A;  4DV0 J;  3G82 B;  2A2D A;  1X5S A;  1SV5 B;  5DM6 Q;  2QEX S;  1J2V A;  2ZWO A;  1TV6 B;  3G96 A;  3PJX A;  2WSF C;  3NOC A;  2FHK A;  1BXN A;  4HEA 9;  2CJX B;  1VBY A;  3MEK A;  4C0H A;  2CQD A;  1AA1 B;  4CLW A;  3SIP B;  1YGY A;  4UOH A;  2DH7 A;  2DNN A;  4X65 F;  1SKS A;  4ZJQ A;  4LRE A;  4X4U A;  3BKF A;  3QAE A;  3DRS B;  4M5J A;  3E01 A;  3RB6 A;  3VWS A;  1B0V A;  2YNH A;  3R7B B;  3DU6 A;  4NA3 A;  1X0P A;  2YWK A;  2E66 A;  4NI2 B;  3R2C J;  1FJG J;  4B9T A;  1RUS A;  4EI2 A;  3M2U A;  4B3T F;  1X9W A;  3CNQ P;  4K4U A;  2LQB A;  3CME S;  4QWB A;  3I56 S;  1ITP A;  4UOG A;  1HQU B;  4LF8 J;  2DGV A;  1RTH A;  4R8U B;  5F41 A;  1HWJ A;  1Q79 A;  1N0U A;  3BS9 A;  2ZC4 A;  4FYV B;  4LIW A;  3ETM A;  3GLJ A;  2BAN A;  1YZ6 A;  5HQ8 A;  3RAX A;  5A8W A;  1S1W B;  4LF5 F;  5HVH A;  5AE2 A;  2A18 A;  1VI7 A;  4PR6 A;  1YDL A;  3ENW A;  1TFY A;  4DX7 A;  3K5L A;  2R8G A;  1KN6 A;  1S0O A;  1ARO P;  2MSS A;  2RDJ A;  4JI8 J;  4LUB A;  4ELU A;  2BOP A;  2CPY A;  5B0C A;  2BE7 D;  3MM6 A;  4ED0 A;  1IM6 A;  1RXO B;  4USI A;  1NK6 A;  4CLP A;  2QX0 A;  3BDP A;  3D9B A;  2E5G A;  3EPI A;  4AL6 A;  3EYZ A;  2OGU A;  4DL2 A;  2G1H A;  2HLT A;  3MFI A;  4HKQ A;  1YJU A;  3IWN C;  3M30 B;  3LGH A;  3HD1 A;  2OUG A;  3GP9 A;  2BQ3 A;  1MW7 A;  4XTT A;  1HYS A;  1NKC A;  4IR9 A;  3LW5 C;  4I7F B;  5LM7 E;  1K73 T;  3PRV A;  1F1B B;  2WB4 A;  4RW6 B;  2OPR A;  3MPU B;  4GRS A;  3P5T L;  4F50 A;  4ZLP A;  1N36 J;  4FVM A;  4FBT A;  1TMJ A;  1VFJ A;  2BRL A;  1NSQ A;  1MRO A;  2O5D A;  2QV6 A;  2VL1 A;  3KK1 B;  2VBX A;  2CVI A;  5F8N A;  1JK9 B;  3I96 A;  3KNG A;  3KLF A;  3E8O A;  1UVK A;  2AYG A;  4RW9 A;  3A8E A;  3QBC A;  3KJF B;  1LWF A;  3FEY B;  1VRT A;  1RHU B;  2FLL A;  3P4U B;  2RSQ A;  3KHH A;  1HQE B;  2CQI A;  5DG8 A;  3I87 A;  3QT5 A;  2JWN A;  3OFG A;  1IBK F;  2FYX A;  1VS3 A;  1H3D A;  1UWB A;  3I5A A;  2DY9 A;  3DRR A;  1S1X B;  3CCM S;  2MGZ A;  5E3C A;  1FWK A;  1M1K T;  1RTJ B;  2CXE A;  1SJF A;  1FDA A;  2BW7 A;  4M5I A;  2NZ4 A;  3G71 S;  2GVD B;  3OL6 A;  2MY8 A;  1IN0 A;  2JNJ A;  1CS4 A;  3NAI A;  4WU3 A;  3PG9 A;  4LSL B;  5JMN A;  3RRH A;  3KK2 A;  2YWH A;  1K9M T;  2FUG 9;  5K8N A;  1B70 B;  1HWI A;  3Q8U A;  3POT A;  2MKS A;  2NS1 B;  4XDC A;  1OIA A;  4MKA A;  3IR7 B;  2R7V A;  3PIO Q;  2RKI B;  1JKH A;  2DB1 A;  5F8J A;  2FVC A;  2M0G B;  2QA2 A;  3AH6 A;  3DOL B;  2DNM A;  1IR2 A;  2E7X A;  4MK8 A;  4TN2 A;  1Q53 A;  1SJ1 A;  2Z57 B;  4ZPW R;  2XC9 A;  1NM2 A;  1T3O A;  3GSI A;  4I68 A;  1VOM A;  4WKY A;  1NU4 A;  3OLB A;  5B09 A;  4IG0 B;  2CPX A;  1FNM A;  5L1L A;  1D09 B;  2MZ1 A;  2FJV A;  1ZM9 A;  2MJN A;  4UUX A;  2DGS A;  1JLB B;  1TKX A;  3HVT A;  5A8K B;  1U25 A;  5CYM B;  3K7R A;  4LRF A;  4U67 Q;  4DWI A;  3BSA A;  4J37 A;  2YNF A;  1S97 A;  2L9D A;  3RBX A;  4MKB A;  2UUT A;  2Q43 A;  4J9S A;  2R7X A;  3J7Z T;  2ROG A;  3RZA A;  5B0F A;  3HHL B;  1QD1 A;  2VU5 A;  4QR2 A;  4HTI A;  2OTJ S;  2ZWP A;  2IJR A;  2AKW B;  2VA3 A;  3ICL A;  3DLK B;  1REV A;  2B43 A;  4HDG A;  1JWW A;  5KFA A;  2R8J A;  4O4R A;  2WSC C;  1RI7 A;  5DG9 A;  1T9Y A;  4DU8 A;  3PM9 A;  2JDJ A;  4F4Z A;  3A13 A;  1S10 A;  4NEY A;  1VIX A;  1ZM4 A;  1PIE A;  1DY3 A;  3QRR A;  3IGN A;  2MLZ A;  3VAF A;  4NX9 A;  2KZM A;  4JYA F;  4ZP9 A;  3UW1 A;  5A8R B;  4WP9 A;  2Y8W A;  2B7C B;  1D8Z A;  3MXH P;  1G4C A;  2AQ4 A;  4EK2 A;  4MYU A;  4C8Z A;  5KFS A;  2GJI A;  5J1E B;  3VV2 B;  5F9N A;  3K89 A;  2V6A A;  4TY8 A;  4BS2 A;  1FJC A;  3C6U A;  5GVQ A;  4EYI B;  1HKA A;  2GMH A;  3TVZ A;  5ETR A;  1HNI A;  2Z8Q A;  4DJB A;  2IVM A;  1R43 A;  4DV6 J;  2VQF J;  2LVW A;  2J0S D;  1SVD A;  3N4W A;  5KFW A;  3J81 U;  4E0D A;  2YX4 A;  1RT2 B;  2QN6 B;  2B5J B;  1R0A A;  1KC8 T;  2EKN A;  1OY8 A;  2DHX A;  2VDH A;  3PW2 A;  4LVO P;  2PII A;  4YDX A;  1U02 A;  3CCZ A;  2CAD A;  3TJ8 A;  1YRT A;  1ZET A;  1RAC B;  1IKY B;  3D0I E;  2V9K A;  4G3I A;  1Q8L A;  2YH1 A;  2AT1 B;  4LSZ B;  2FJA B;  1VK8 A;  4IOB A;  1IJF B;  2KRB A;  4GO5 X;  4M5N A;  1SJR A;  5DGA A;  4X62 J;  5EWG A;  4DUZ F;  4YB1 P;  3GYG A;  1DTT B;  1RQ0 A;  3CWJ A;  5LXR A;  3NKY A;  3SBM A;  1UA0 A;  1RT1 A;  4EZ9 A;  2LEA A;  3T6B A;  2FVR A;  1N32 F;  5M2R A;  1S79 A;  2AJQ A;  1BQM B;  1Y3K A;  5KG4 A;  5I3U B;  3CJ2 A;  1S12 A;  4KO0 B;  3M4X A;  3G8T A;  3BQ2 A;  3CDU A;  3EWG A;  2ZH5 A;  2BDP A;  1C1C A;  2JFK A;  3TUP A;  4WFY A;  3NRB A;  4YR0 A;  2W4C A;  4KE5 A;  1J27 A;  1S48 A;  4DF4 A;  2KB2 A;  5BJR A;  2UUA J;  2PGC A;  1KS2 A;  1FEE A;  4NZ0 A;  4CO5 A;  4KFB A;  4YN3 B;  1YRX A;  1RBO B;  3CE8 A;  4GKK F;  4X66 J;  2G0I A;  4QYZ K;  1Y5L B;  3MCS A;  5A0Y B;  2M52 A;  2QZ8 A;  4C0O C;  4DV4 F;  3C15 B;  1WC5 A;  4QIG A;  5EWF A;  2CQ2 A;  2VHG A;  4B3R F;  1NZA A;  3JAM Y;  2F8E X;  4OZ3 A;  3QFH A;  1TKT B;  1AXQ A;  2MKY A;  1VK3 A;  2HMI B;  1AZS A;  1VQ9 S;  1HWL A;  2M4M A;  3OT9 A;  4B3O A;  1SIZ A;  1SH0 A;  1F2H A;  1O5J A;  3HHL C;  5D0H A;  1CUL B;  1X4D A;  4G1Q B;  3I0S A;  1PAE X;  3OL8 A;  5MLC V;  2H3E B;  2KXN B;  1M5P C;  2FHJ D;  3ENV A;  3K57 A;  2JSX A;  3Q89 A;  2XHC A;  3DLE B;  4O4G A;  3BR8 A;  2BAB A;  5B0B A;  1YJV A;  2HGN A;  2F63 A;  2EK1 A;  1U1N A;  1LXJ A;  2QLX A;  3CCW A;  4RBT A;  2EW9 A;  1NH7 A;  5EWE A;  3UO0 A;  3EZ5 A;  4ZN1 A;  2FJE B;  5I42 B;  4DSF A;  4O3R A;  1DLO B;  4UOF A;  4WP8 A;  3JQM A;  3UCZ P;  2LXU A;  4QW9 A;  2E5J A;  2PFD A;  4QR1 A;  2C1E B;  4TU7 A;  3VAM A;  2FVQ A;  3R3T A;  1AFJ A;  5L39 A;  2G9O A;  3FCV A;  2IAJ B;  1OJ4 A;  3EGW B;  4J5O A;  2ATC B;  3U02 A;  1ZTT A;  5C2G A;  3R6L B;  4B9U A;  2ROE A;  4FF2 A;  2QMU B;  3T5L A;  5HBM A;  2ZZT A;  1RAF B;  3QFW A;  3OJS A;  2XS7 A;  2V8G A;  4KIA A;  3CJ3 A;  2FLO A;  5CHC B;  2RF2 B;  2EC0 A;  3G4S S;  3Q83 A;  4ECX A;  3OL9 A;  3RBD A;  4A8Y A;  2ZUG A;  2XY7 A;  4TU8 A;  2N82 B;  5KFK A;  1SH3 A;  2VBW A;  4ICL A;  4AUK A;  2XYH B;  1UJ4 A;  3OTO J;  1JXV A;  2DR8 A;  1FXL A;  2V69 A;  1UKU A;  3SCI E;  1RBA A;  4KHP J;  1CJV A;  5LMU J;  2FDN A;  2VG7 B;  4P75 A;  5K14 A;  1FE4 A;  3IR6 B;  2RRA A;  2OHD A;  2GMJ A;  2HWT A;  3WX8 A;  1JMT A;  4ZVU B;  3P6Y C;  4NLV A;  1OYD A;  3M8Q B;  4W4M A;  1JLG B;  4O3N A;  2QRR A;  1NZ8 A;  1B4S A;  3TQ1 A;  2DHS A;  1RWV B;  1GXL A;  3NS5 A;  2W4D A;  8ATC B;  1S9E B;  1OWX A;  2UU9 J;  2DHA A;  2DO4 A;  3MM8 B;  4QCL A;  4OHX A;  3PJ9 A;  3M9O B;  4LF5 J;  2VOD A;  2DEJ A;  3G86 A;  4IFV B;  3BDE A;  2B6A A;  5D4P A;  4Y2I A;  3D68 A;  4ECV A;  2CQ1 A;  1Y5I B;  2QC3 A;  1MN7 A;  4K0K F;  3TZW A;  1VDH A;  1PBA A;  2UVR A;  4K4Z A;  1M90 T;  1GMW D;  4U7C A;  5IM0 B;  5C7P A;  2B4P A;  3FKB A;  2JRS A;  1HNZ F;  3H5U A;  1RWP B;  1UW9 A;  1VQY A;  1VQO S;  2FJX A;  3IWX A;  1KP6 A;  1R8H A;  3KDN A;  1FRH A;  3DI6 B;  3TA2 A;  1S6U A;  2IYG A;  1LQ9 A;  2GAH C;  1N4L A;  4PAA A;  2Y1I A;  1S1V A;  4ZCI A;  3CC7 S;  4N56 A;  2CG8 A;  2ACM A;  3EVO A;  3QID A;  4NMX A;  1VC6 A;  4CP5 A;  2VQE F;  1K1S A;  1K47 A;  4OJH A;  2FIU A;  1U47 A;  4X4O A;  3HK2 A;  2OD6 A;  5HAT A;  2U1A A;  4LF9 F;  1F5B A;  4OX9 J;  3EGN A;  3KUE A;  3HUL A;  1N5S A;  1KLM A;  3Q22 A;  5KT2 A;  4C2M A;  3LAN A;  4ZVO B;  4B9N A;  3HMJ G;  4ECW A;  4NLY A;  5BXI A;  5KFL A;  2F7V A;  1WHW A;  4ZVG A;  1KSP A;  1Q1K A;  5JUM A;  4MK7 A;  3UDV A;  3W65 A;  3DLG A;  4JV5 F;  1M5O C;  1FKA F;  4LF2 A;  3BB5 A;  1TVR B;  5HJX A;  1BQX A;  2X1A A;  2RQ4 A;  4MIA A;  4DL6 A;  4DR4 F;  1V3Z A;  1S77 D;  3AY0 A;  3TAM B;  1HFE L;  5CD4 A;  1IBK J;  2B9Y A;  2N7C A;  4NA1 A;  2HND A;  3M1V B;  2KXH A;  1RTI A;  2RRN A;  3BH7 B;  4B3S F;  4Q8F A;  4FF4 A;  4NCB A;  3DC2 A;  4NOH A;  3T1H J;  1VQ8 S;  1NPP A;  5DM7 Q;  4NLW A;  5F8G A;  1YX2 A;  1HMV B;  1G3O A;  4JI4 J;  3MMB B;  4TKT A;  4NRT A;  1N34 J;  3VVU A;  1X5P A;  3HFV A;  2ASJ A;  5T7L A;  1VR6 A;  4IFY B;  4Q44 A;  3DYA B;  1LW0 A;  3ZC4 A;  2ZJR Q;  3SQG A;  5LSR A;  3P45 B;  4KV8 A;  2JEJ A;  3NGK A;  2AJ0 A;  1IBM J;  1UFL A;  4WXW A;  3SFU A;  4O0N A;  1LEO A;  1U0H A;  1XNR J;  4FS1 A;  1CJT B;  4LFC F;  1HNW J;  2CZ4 A;  3UDC A;  3LH2 S;  4OHY A;  4K5R A;  2DH8 A;  2YNG B;  1UMJ A;  3IM8 A;  1BWV A;  1ACM B;  2JEI A;  2AGP A;  4IOC Q;  3TEH B;  1KR4 A;  2RIL A;  1TP7 A;  4ZP8 A;  2D41 A;  4M63 A;  1XWL A;  3MPW A;  5LMN F;  4P52 A;  3MZI A;  2QA4 S;  1FEH A;  3W61 A;  3T1A A;  5LJ5 Y;  3EJM A;  3NNA A;  5BYQ A;  1ZM3 A;  1GMV A;  1TKD A;  1VIO A;  1VHI A;  4C3K A;  3PAC A;  4N41 A;  2H5I B;  4CM0 A;  4OYO A;  2BE2 B;  4W90 B;  1K0T A;  4K4T A;  2HIQ A;  2XBP A;  2ZC3 A;  4OZ0 A;  4B9L A;  4ZPC A;  3MM5 A;  1HWK A;  2NR0 A;  3MR2 A;  3F41 A;  4NXN F;  4CLY A;  1Q5V A;  4YY3 F;  2XMJ A;  4EYH B;  4ANC A;  2E1P A;  2YKA A;  4YB7 A;  3MEG A;  4AQY F;  2YWF A;  3I9Z A;  1WWH A;  2Q6C A;  1RHR B;  2ZHO A;  1SI9 A;  2VPZ B;  2VJV A;  3MR6 A;  3PKM A;  2FGC A;  1NDP A;  4WTY A;  4MJK A;  1HBM A;  5GAE U;  1RAE B;  2B0G A;  1YBA A;  3PO5 A;  2ZNY A;  3RRK A;  1UFW A;  1UAW A;  2HSE B;  3H0P A;  2JLG A;  4XK8 C;  1RT5 A;  2KYZ A;  3TW0 A;  1G1X A;  3HI9 A;  1RT6 A;  1MG7 A;  2J0X A;  1NHU A;  1KTV A;  2Y1J A;  4F4Y A;  3FEX B;  4PCQ A;  5FLX U;  2PSZ A;  5DDP C;  1QVF R;  4OI2 A;  3MTJ A;  2ADC A;  1NND A;  3PYD A;  3LF0 A;  3IA0 A;  1BHN A;  3M32 A;  1P1T A;  4IDK A;  3WC2 A;  3KHL A;  3GON A;  3OVB A;  2CPI A;  3K5O A;  4ILR A;  4RNF A;  2RH3 A;  4YQW A;  3AOD A;  3F73 A;  5IV4 A;  2PC6 A;  4OL8 A;  1AW0 A;  3GMG A;  3MMA B;  4B3M J;  1RAD B;  4ES2 A;  3IM9 A;  3PR5 B;  2GV1 A;  4PXC A;  3R8Y A;  3HSG A;  2O3D A;  4DX6 A;  1HD0 A;  4DR3 J;  2AWZ A;  1SJQ A;  3BV8 A;  1CLF A;  1TL7 A;  2MQN A;  3P5B P;  1RT7 A;  3FGV A;  1RGV A;  1IM4 A;  2Q1L A;  3W7B A;  2ZKU A;  1VBK A;  4FNH A;  3VF0 B;  2R8K A;  1VCT A;  3H59 A;  4OYA A;  4ATN A;  3KUH A;  2MQQ A;  1PYS B;  1N33 F;  2ALY B;  1YWX A;  3HHK A;  2A0F B;  1S7I A;  4KKO B;  4DL5 A;  4NLO A;  4O0I A;  4LRD A;  1W2B R;  1I1G A;  1YBU A;  4K4Y A;  2W2M P;  4ILL A;  2DXF A;  2LYV A;  5KG0 A;  2JLE A;  5CCL A;  1J5O B;  1QE1 B;  2A1B A;  2K3I A;  3EE3 A;  3EVW A;  4ETX A;  3AQO A;  1RTD B;  5AE3 A;  1Q8I A;  2IPO B;  4I6Y A;  3GFZ A;  3ENQ A;  4NLG A;  1RKJ A;  5KFX A;  3CJK A;  3MCM A;  2VFV A;  2CJY B;  4P2X A;  2P9C A;  3ITH B;  3FJ2 A;  3NWR A;  1NDL A;  3I0R B;  3QAU A;  2KRR A;  3H2L A;  3WBZ A;  2CIM A;  4RW4 A;  2GQQ A;  2LA6 A;  3ET6 A;  2V4Q A;  4KY3 A;  1S57 A;  2WBM A;  2ZJP Q;  3OL7 A;  2BE9 B;  1M5S A;  4PG6 A;  3VAH A;  4O3Q A;  1DQA A;  1FFW B;  4DCJ B;  3DLB A;  2PMH A;  4M95 A;  3QSY B;  2V2K A;  1KQK A;  2KHC A;  3UPF A;  2R7R A;  1X4F A;  3OTB A;  3PKY A;  4YB6 A;  1RWX B;  4KPY A;  2B9W A;  5D4L A;  3K8V A;  1TEL A;  4RW7 A;  2IA6 A;  3IBF B;  3PVX A;  2UXB F;  1XMO F;  2EKY A;  3KOA A;  3F44 A;  3UD4 P;  2IVF B;  1XNQ F;  1IJE B;  2HKE A;  2YH0 A;  3D67 A;  3VAL A;  4OI1 A;  3V6H A;  5HRO B;  3ZZT A;  4U7U D;  2EC2 A;  5H9E J;  2YWW A;  2WW8 A;  3KK3 B;  4QIV A;  3DKD A;  2IA0 A;  2AJF E;  1RCO B;  2FJD B;  2Q6B A;  4O3S A;  4NCA A;  5KFT A;  5HO4 A;  4WYW A;  4K2X A;  3AT1 B;  4WFZ A;  4PWU A;  1OS5 A;  1RCX B;  1WJ9 A;  3HO1 A;  4NLQ A;  2K8G A;  3MED B;  1RWM B;  4NWB A;  5HJY A;  1TUV A;  5B0D A;  2OH2 A;  4LF6 F;  3OR2 A;  2FGO A;  4D3G A;  5K20 B;  3GIR A;  1VQP S;  4KBI A;  1E6V A;  3BSC A;  2MQM A;  1ZH5 A;  5IWA F;  2QMX A;  3GE9 A;  4DPW A;  2XNQ A;  3R2D J;  2V2Z A;  2IDL A;  2PDA A;  1CPZ A;  4CO3 A;  2Y3Y A;  3RBZ A;  3LO3 A;  3W3S A;  4CYU A;  2FPH X;  2GGP A;  2HZC A;  1C1B B;  4JI0 F;  3WC0 A;  4U6P A;  4DV1 J;  2DKO B;  3IP0 A;  2FJB B;  1FCA A;  3D0G E;  5H9F K;  2GJF A;  3BGO P;  4WJB A;  3H2U B;  1RP5 A;  4PWD B;  1YJR A;  1IKV A;  5FD1 A;  2DO0 A;  4ID5 A;  3JSM B;  4IR1 A;  2E9R X;  4DV7 J;  3W9H A;  1IQZ A;  1RA6 A;  3CJS A;  3SYZ A;  5AT1 B;  1EKS A;  4PPZ A;  1SL1 A;  1HNX J;  2NZC A;  2WON B;  2YBV A;  5HQL A;  4IH5 A;  2M8H A;  3VGS A;  3Q2S C;  1LWC A;  3MOJ B;  4R5P B;  1T94 A;  3LA0 A;  2LU2 A;  4IKA A;  3DXS X;  4FVC A;  1CJU B;  1FJ7 A;  1WDD A;  4YS2 A;  2IM3 A;  3MUR P;  3RJM B;  3NS7 B;  4IH7 A;  2GFF A;  4MFB B;  1X31 C;  1RU1 A;  4KGM A;  5KOW A;  1OPZ A;  4RBV A;  3B82 A;  2DK2 A;  5LJ3 Y;  5GAG I;  3J7A 1;  3RR8 A;  2XGP A;  1EIY B;  4Y28 C; 
#chains in the Genus database with same CATH homology
 1RHK B;  3R7S B;  1F9E B;  3D6F B;  1GFW B;  1RHJ B;  1RHR B;  2QL5 B;  3SIP B;  3KJQ B;  2DKO B;  2CNL B;  3EDQ B;  1RWO B;  3R6G B;  2CJY B;  4ZVP B;  1QDU B;  3GJT B;  3GJQ B;  1ICE B;  3GJS B;  2H65 B;  2H4W B;  2H4Y B;  1RHQ B;  2P2C B;  1BMQ B;  1QTN B;  4JB8 B;  4ZVT B;  3KJF B;  1RWW B;  1RE1 B;  1RHU B;  3R7N B;  3P4U B;  2QLB B;  2QL7 B;  2H5J B;  2XYH B;  3QNW B;  2HBY B;  2FQQ B;  1RWP B;  2CNO B;  2HBZ B;  2CDR B;  3R7B B;  1RHM B;  1I3O B;  2C2Z B;  1RWM B;  1IBC B;  2QLJ B;  2QL9 B;  4ZVS B;  2XZD B;  5K20 B;  4DCO B;  2H54 B;  4LSZ B;  4DCJ B;  1NME B;  2C1E B;  1SC3 B;  4DCP B;  3KJN B;  2CNK B;  2HBQ B;  4ZVU B;  2C2O B;  2XZT B;  3GJR B;  2C2M B;  2H5I B;  2H48 B;  1SC1 B;  2Y0B B;  4ZVR B;  3EDR B;  1I51 B;  3D6H B;  1PAU B;  3D6M B;  1SC4 B;  3RJM B;  1RWN B;  2CNN B;  3NS7 B;  2C2K B;  1RWV B;  3R6L B;  3P45 B;  5IC6 B;  2Y1L B;  1RWK B;  1RWX B;  4ZVO B;  2H51 B;  2HBR B;  2XYP B;  1PYO B;  4ZVQ B;  5IC4 B;  3IBF B;  2XYG B;  3IBC B;  2QLF B;  3R5J B;  2CJX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...