4DV5J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv5J00
4B3SJ 4JV5J 4DR6J 4JI7J 4YY3J 4DV3J 1IBLJ 2F4VJ 3D3BJ 4NEZA 1XNQJ 5AJ3J 3R2CJ 5IWAJ 4LFCJ 3D3CJ 4NXNJ 4DR3J 4DV2J 4DUYJ 5BR8J 4YHHJ 4LF5J 4DUZJ 5FLXU 3J81U 1N34J 2E5LJ 4RJVA 4GKJJ 2ZM6J 2UXDJ 2UU9J 5LM7E 5A2QU 1XMOJ 1HNWJ 4PWWA 3T1HJ 2UXBJ 4JI8J 4K0KJ 1J5EJ 1FJGJ 5IT9U 4X66J 4DV4J 3J80U 4DV6J 1IBKJ 4KY3A 4HHUA 4JI2J 4KYZA 4LF9J 1N36J 1IBMJ 2UUBJ 4AQYJ 2MQ8A 3R2DJ 4JI5J 1N32J 3J7AN 4DR4J 4DV7J 4OX9J 4LFBJ 4JI1J 1HR0J 4LFAJ 4X62J 3OTOJ 2HHHJ 4NXMJ 4JI0J 5LMNJ 4LF8J 2UUCJ 1HNXJ 4JI3J 4LF6J 4LF4J 4NEYA 1I94J 4B3MJ 2MEWA 5LMUJ 2UXCJ 4JYAJ 4X64J 3T1YJ 3IMQJ 1HNZJ 4DR2J 4KHPJ 4B3TJ 4DV1J 4DV0J 4DV5J 4JI6J 4JI4J 3JAMU 1XMQJ 4DR7J 2KVQE 1XNRJ 2MTLA 4DR5J 4LF7J 4X65J 4GKKJ 2VQEJ 3W1YC 2KL8A 4B3RJ 1N33J 2UUAJ 4DR1J 4V1Ak 2VQFJ
chains in the Genus database with same CATH superfamily
3U02A 3DOKA 3RJMB 4EGLA 3F73A 4K8RA 3MM9B 2JSXA 2XY5A 2G4BA 2LXIA 3PO5A 2OAUA 2LMIA 2FHKA 4ZCIA 5K8NA 2E66A 4KFBA 4CIOA 5KG4A 4DPUA 2B5JB 4H4MB 1DARA 2X1GA 5F8HA 3Q83A 3PKMA 5DQIA 1X7VA 3NY0A 2NYIA 2JH3A 2M70A 3V2UC 3TR5A 4Y2KA 1YI2S 1L3UA 3Q86A 4OYZA 5FIIA 1NSAA 3DMJA 2DGVA 3AAWB 2MKIA 4ZVEA 4KH0B 5KT6A 3SCKE 1A0OB 1G7CB 3PW0A 3KLFB 5THWA 3D66A 4I2PB 3CCWA 1N6QA 1ZM4A 4TQRA 4B3RF 5L1IA 1XR6A 3D5MA 3RRKA 2WW4A 3TUZC 5J2QA 3QJJA 5KFZA 2XTJP 4GKKJ 2HZCA 3M8YA 4ATNA 2E5HA 3KLGB 1RT3B 2ROGA 2BABA 1J2VA 1HBOA 3DLKB 1IKXA 3SCIE 3CCLS 3M9NB 4F0HA 2KYXA 3QZ8A 2FTRA 3DLJA 2YKMB 4DV4F 2PA8D 4DLEA 2ZDPA 3AD7C 5BJRA 3IC1A 3I87A 1SV5B 1S10A 1IBMF 2FJWA 2HNYB 3BH6B 4DPOA 5A8WA 4NXMF 4RUAA 3CD7A 2CNLB 2DCLA 3A8KA 3M8WA 2ZZTA 2DNZA 2GNKA 3P8BB 5KFFA 3DHWC 4J9UE 4JI6F 2CG8A 2YNGA 2BX6A 1DQAA 2C42A 4B3TJ 3J80Y 3VAGA 2BJ8A 3BSAA 3HZGA 3TNVA 3MR3A 1HQEB 2FZGB 1IN0A 1AROP 1E6YA 4NLQA 2M7SA 3B4DA 3BSNA 2UUAJ 2MMYA 3BF4A 1LQ9A 5G0RB 4B9LA 1UVIA 3AOBA 2AP6A 2DNGA 4PCQA 4OIXA 1XEZA 3DYAB 3CJSA 3F0NA 5HP1B 1CULA 2J8SA 2ZH6A 2J7KA 4A8KA 1VQNS 3VALA 3C15A 2RUGA 2BE9B 3P45B 3D4JA 1EARA 3DRSA 1Z1ZA 4KGXB 2FLNA 2FQQB 4F04B 3OL9A 1S49A 3CJKB 2Z0GA 3GFXA 3C16A 1KRPA 5D0HA 2R7TA 1OMSA 4ITSA 2HHHJ 2GA7A 2QSWA 4RBTA 2VPXB 1VRTA 3KJQB 4FZVA 2AU0A 3MZIA 4Z37A 3WX4A 4Y65A 1HL6A 1QAYA 5J1NA 5J2MA 3AT1B 3P6YC 3CDUA 3DM2B 2KL8A 3ZZZA 3CCSS 2CQ1A 2A10A 2OGUA 1B4SA 2VFSA 5CYQA 2ZH2A 1SKUB 1HMVA 2WK4A 1S1WB 3MM8B 2RD5C 2C2DA 3PY8A 4O44A 1NK7A 2W2PP 4I56A 3DLHA 5B0CA 2QLFB 1HPZA 1UWBA 4LQ9A 1FX4A 2XI2A 1GT8A 3MAQA 3HHLB 1WC6A 4KYZA 2COLA 4F25A 4RW8A 5CZXA 5ETSA 5B0AA 2ZH4A 5HK4A 2B4PA 3D28A 3HX9A 2QRRA 5A2QY 3OBIA 1YX2A 2RJZA 1SIWB 1TKXA 2F1FA 1B99A 3HVWA 3R7BB 4P75A 4DV5J 2X1AA 3L95X 3AHPA 1WACA 3TUIC 2W4DA 2BW2A 1IUJA 2AJ2A 5KFEA 1Q1KA 4UZBA 2QMXA 2VQEJ 3H2LA 2VD3A 2HVIA 2QL5B 4DZ6A 2V4RA 1WKKA 3PW4A 5I4MA 2Z2LA 2JVRA 4I67A 4IRKA 4LR8A 2E7XA 4Z7YA 1ZPWX 1U25A 2RDIA 2YWHA 1SC4B 4RW4B 3EGWB 4JI0F 5C7PA 4YB1P 1LW2B 3J81U 1TZ0A 1RB0A 3FVYA 2WVCA 3EZOA 5J2NA 2HS4A 1WC5A 2WOMA 1T03B 2ZBQA 4QU7A 1JIHA 5CA5A 2ZJRQ 1QSLA 4X66J 1NEEA 3TQ1A 4RPFA 2ALYB 3W60A 3ET6A 5GAEU 2EW9A 1LNQA 5LMUF 4PR6A 2RF2A 1CG2A 3LALA 2OUGA 2DGOA 2BM1A 1KLNA 2YQ0A 2E29A 1QVGR 1RTIB 6AT1B 2PI5A 2VODA 4UOGA 2RIJA 4DXLA 4ER8A 2NYHA 2J6UA 5CAAA 1T05A 3WC0A 4WF9Q 1C4AA 5KT4A 2UVVA 2FY1A 4UQGA 3OJUA 4AFFA 2HFNA 3O5TB 1MU2B 2BR0A 2ZOFA 1IQZA 1NMEB 4DN9A 2ZZNA 3HP6A 4FPRA 2LA4A 1KLMB 4PXDA 4L6V3 4H4KA 1IKWB 3THVA 1F60B 4CQ1A 1X4CA 3DGPB 4RW6B 4W98A 5C25B 4C8ZA 1SQFA 4HYKA 2L48A 3MD3A 3E51A 3U7JA 4QJVA 4OI1A 2FJAB 4FBUA 4TY8A 1EX8A 2XZTB 2MQPA 1T9WA 4OX9F 1BMQB 1N5SA 2HHPA 4X62F 2O1PA 1X0FA 1ZA1B 2J0SD 1RGVA 2MZJA 3HMJG 4CP5A 4CDIA 1Q79A 3H5YA 1PJ6A 4ETXA 4ZKAA 1JLAA 4AYBD 2E9ZA 3RW7A 3HCXA 4TNOA 4F4ZA 1R8HA 3MM6B 3UN3A 1IM4A 4C3LA 4CTAA 1MN9A 3Q0AA 2AJ1A 3PCOB 4OLPA 2F4FA 2BEFA 3SCLE 2KXNB 1YG0A 3PACA 4ZPWR 3EGVA 4P73A 4DR3F 4TQSA 3SSSA 4ZK7M 3M8PB 4EBEA 2FUG9 4FYYB 4PG5A 1TL7B 3CSKA 3ZZTA 1UMJA 1I6JA 4NZ0A 2DXDA 1KD1T 4WP8A 4DUZJ 4QIFA 4L76A 4JI8F 2FHJD 4PAAA 3JXOA 3UQSA 3OXFA 2C2NA 1S5ZA 3ZZPA 1ZAWA 1WD6A 3OVSA 3DFEA 3R7SB 3CJRA 2DR6A 4B3MF 3TRGA 3GV7B 4HTIA 2A6OA 3CJ2A 4JYAF 4TXSA 4PPZA 1KKHA 3NL0A 2Q3PA 1FJEB 4DQRA 1T02A 4F4AA 1XNQF 2WBMA 4LRAA 1L3KA 2BDPA 4HEA9 2XO6A 3HKZD 5IT4A 4IOBA 3AJ2A 4HACA 4W90B 2DNYA 2CZ4A 1XMBA 2CJQA 1DLOB 2MQNA 3VGSA 4J9VA 5KG1A 2XHCA 4PUOA 2HQIA 1M5VC 1JJ2R 4DV3J 4AUKA 3PR5B 1J5OB 1UL3A 4DS4A 4PQUB 3PKYA 1KVIA 4YDDB 3C6TB 3M2RB 4OI2A 4PABA 2R8IA 5B0DA 1VC5A 3M2VA 4ZPCA 2IA6A 4J91A 5DGBA 3CCQS 4OI4A 1TL1A 2YVSA 3OR2B 3ZTQA 1TFYA 1Q8KA 3VTIA 3KLVA 4HHUA 4OZ5A 3D67A 4NL5A 2OPQA 2JRSA 5D4PA 5HVFA 3MM5B 1YIJS 2XMWA 1RYSA 1SVDA 3CJ3A 3TP2A 3AOAA 4DL5A 2PGCA 4GKKF 2HHXA 3AFGA 2FC9A 1W7WA 2XLIA 3W8GA 3DXBA 3L7PA 2HWTA 2YWFA 3PV8A 4DPYA 2HHUA 1OY8A 3NGUA 4F2RA 3DRPA 3IRXB 4CCHA 2MSTA 3V6KA 3L7UA 1MMDA 1X4EA 1B0TA 4O4RA 3HF5A 2VG7B 2A0FB 5EX3A 4PXEA 5L9NA 2CWKA 1TK8A 1EB0A 2DCUB 2B8PA 3FK4A 4QIEA 4WTOB 5M2UA 4CYUB 2QN6B 1F5CA 5K8PA 4DV0F 3TZWA 3CCES 1K44A 5HAOA 4LJMA 5AXMA 2CQ4A 2BANA 4NLPA 2LKZA 3H5SA 4B3TF 4CI0B 4FDFA 1PBUA 2XCAA 3TZYA 2MLZA 2DR5A 1NPPA 1NZ8A 3OHAA 2PA3A 3T5KA 2UUAF 4L3NA 4ZJOA 4C98A 4DR7J 1QM9A 2NLWA 1S7IA 1W2IA 2CADA 1U2CA 3ITHB 3FSXA 3EWGA 3N01A 2R2TA 2QFJA 2WSFC 1SUQB 2WTFA 3RAQA 2HVHA 2NREA 4MYUA 1Q78A 3MAAA 2EKYA 2F9DA 4HKQA 4GVLA 1YZ7A 2Y8YA 1QAIA 1KTQA 1RACB 4U6PA 1NJIT 5IM0B 3X3UA 1HNZF 3TJ8A 5E7OB 2CQCA 2Q66A 1VQ6S 5B0FA 1JLEA 1E6VA 1LV5A 1PG5B 1YJ7A 4IG0A 5AT1B 3DU5A 2KM8B 2I0XA 1R8CA 2HHHF 1R43A 1RT1B 4DLGA 1CJKA 2XY7A 1K0VA 1N0VC 1FRMA 1P1LA 1HFEL 4Z2XA 2MZQA 1EP4A 5IQ6A 4CH7A 3RBDA 2IFXA 3V5RA 3ENQA 1K0TA 3DDKA 3JTNA 1HHSA 1UVKA 4ZS6A 1VIOA 2M4MA 3OFFA 2Y9HA 3M2UB 2GIQA 4WFYA 3SFGA 2VL1A 1FA0A 1NK5A 2AZ1A 4Y6IA 2V34A 2K3IA 3RR7A 2ZVSA 2CZ9A 1WC3A 2Q6CA 1CPZA 3LGMA 4USMA 3EDQB 2NS1B 2FZCB 1HQUB 3G6ES 1G3OA 2ZHBA 3T9ZA 2NR0A 4WK3A 2AWZA 1ZBTA 1D09B 5BYQA 1X31C 3HVTA 1KVJA 2ABYA 1S6UA 4ZVOB 2BXJA 5KFYA 3KHHA 4DPTA 5LM7E 2FHOB 3SV4A 4M5DA 4RWWA 5K8OA 1X4AA 3J80U 3DNCA 4U7UD 4RNNA 1GEHA 2HHSA 4C8NA 3QWPA 1X5SA 2KKHA 2VC1A 3TEHB 1N56A 1EIYB 1OO0B 2FJBB 4DV5F 2IC3A 2UXCJ 1HIYA 4DQIA 4KPCA 4F0MA 1UA0A 1OPIA 3FFIA 3MR5A 3JYTB 2PFDA 2VQEF 1FESA 2V8GA 2N7YA 4OZLA 5ETPA 3EGZA 1TUGB 1SH0A 5F0WA 2AT1B 5KFSA 1GMWA 2HQGA 4X4QA 4I2QA 3WC2A 2AYGA 2KT3A 2MGZB 4GVBA 5BXIA 1U2RA 2IVMA 2CPJA 1CBKA 4XIUA 4DX7A 5GVQA 1LWXA 5K14A 4RBUA 1IJFB 3PX4A 3QATA 4BWJA 1EZZB 1KOOA 2XZWA 2G0CA 3KNGA 1Z2LA 1SC1B 1BHNA 2EK1A 4PG7A 2JHEA 2VUGA 1WI8A 1S6OA 1H3DA 3MEDA 3OFEA 5LOQA 2BRKA 1MMNA 2WZ1A 4I7FA 3TX8A 1UCNA 1SL0A 4Y00A 1IJEB 2Y1RI 4Y34A 5MAOA 3RB4A 1U0SA 5U47A 4OYXA 3J7AN 2F8MA 4EZ6A 1G1XA 4NCGB 2JNJA 2PDAA 5LXRA 2F63A 3GSDA 3EJMA 5JVHQ 2ZOGA 1JKHB 3KFWX 1HBNB 2AQ4A 3KK3B 3OR1A 1ZM3A 4JI4J 4LVNP 5F9LA 1QSYA 1YLXA 1RTJB 2HQFA 2DBBA 2W9BB 4E98A 2VKZG 4KKOB 1DZ5A 2IM1A 5I3QA 1FERA 2RVJA 1B7FA 2HFZA 4HL9A 2XMAA 1FFSB 1X9WA 4R0EA 2RQCA 2DR7A 4X4NA 2VU5A 2HBZB 4QR1A 3CPWR 2AX1A 2QSFA 4WJBA 2BQRA 2R8HA 4F3MA 5I3UA 4OV1A 2OPRA 2FHMA 1FDAA 3D0IE 3V6DA 5A2QU 2CQ2A 5C5JA 2C2MB 3IG1A 3A4TA 4CO5A 2HNDA 1S1VB 2CDRB 4EK2A 4F50A 5CXTA 1FNMA 3QLHB 4FS2A 4CNYA 1HD0A 1FXRA 2RILA 2MEWA 3BGLA 4WFZA 2R8KA 4OQJA 3RTVA 2CPYA 1ZH5A 1XNRJ 1QE1B 1T0TV 2GJ2A 4I1TA 3BQ1A 2DRAA 3R9LA 1S4EA 2R2UA 3HHLC 1CC7A 4OI3A 3R6LB 4NZ7A 4C8OA 3NNAA 5JMNA 3KHLA 3QIDA 4DUZF 1UJ6A 2B9YA 2ZBRA 3VV2B 2HQDA 2ZOMA 1MWQA 1NSKL 4C8KA 1XR5A 3VAKA 2HFOA 3UVJB 1KP6A 2YTCA 2YKNA 7FDRA 4X4UA 2MJUA 1Y0HA 1YZ6A 1SKSA 4NX9A 1OYEA 4DSEA 3K5NA 4CLZA 3JQMA 4DR4J 4P52A 2ZD1B 3O3LA 3MM7B 3OTOJ 4C0BA 4QWDA 1NRKA 4ED8A 3IM8A 3A8JA 4NYZA 1XR7A 2XY6A 3SCJE 1T9TA 3KJNB 1R6YA 1NZAA 3MPVA 3CJ8A 1HNVB 4DX5A 2XBPA 1T11A 3T19A 3QIPB 4ED0A 3HK2A 4DV3F 4P71A 3WIUA 1C1CA 3NRBA 4MK7A 2KTQA 3MDFA 5KG6A 1ZAVA 1O51A 3I5AA 1U4BA 3H2UB 1WEZA 2DJWA 1I3OB 1URNA 1VHIA 5F8MA 4NRUA 1YWXA 3D6TB 1UFKA 2HFUA 1AA1B 3PHEA 1NKBA 2W25A 3C14B 3KK2B 2E1PA 1U6ZA 5CZVA 2NSCA 4B17A 2F8HA 4NLOA 5I42B 3T5LA 4FF3A 1SKRA 5KFIA 1F9HA 2DR8A 2JEJA 5HJYA 4YFUA 1OS5A 2YNHB 3JSMB 4NLSA 1XQIA 2IMOA 3TEGA 1RAJA 4B08A 3AQPA 4NLDA 4YN3B 5GAHI 3FDSA 4IFYB 2MKKA 3EMTA 1N33J 1BY9A 4ED2A 1A9NB 1U0HB 2GMHA 1XERA 3IR6B 1TKZB 1AW0A 4J9MA 4AL7A 3I82A 3K8WA 4IO1A 1M90T 3RG6A 3LAMA 4O4GB 4DBQA 2V4JB 1VJQA 2N3OA 3BR9A 3MCSA 3TZZA 2RHQB 1KS2A 1RU2A 3LP1A 3DGVA 2CQPA 4G65A 2CXEA 2J6TA 1FJGJ 1HBUA 4EYIB 3W5ZA 3IXQA 2C3PA 3Q22A 2BOPA 1F5BA 3F56A 4NI2A 2JZ5A 3C6UB 1H7XA 1N52B 1L5UA 4WU2A 2RU9A 4ICLB 3HJVA 3OV7A 1Y10A 3OHBA 1TMMA 4DJBA 2G1DA 2ALZA 2VOOA 1JXVA 3JS9A 4DR7F 1MMLA 3OD2A 1GXLA 3MMCB 3BPSP 3VQTA 4RW9A 1JJCB 3HSJA 4J9SA 3MMAA 4X4OA 4WP9A 4ZIWA 4ECUA 2H48B 2MQMA 4IQMA 2H54B 4Y28C 5A8RA 4OJ1A 3PO4A 3ILOA 2B4OA 1D8YA 2V67A 2HRUA 4LMZA 2JDJA 2RS8A 2BJ9A 4ZIVA 2DRBA 4WFNQ 4K4VA 1IKVB 4R5PB 2G2YA 2QT7A 2X51A 1UZHA 5IT9Y 2IPOB 3LWMA 1FFGB 2Z4PA 3UFCX 1LWCB 4CO3A 1NDLA 2CPZA 4N8NA 3CCJS 1R8AA 4JP8A 4PXBA 3N5BA 3TVYA 4G6VB 4TKTA 4A8OA 4CRJA 2CIMA 1DQ8A 3B4MA 1UVLA 2FDNA 1X5TA 2LEPA 4X65J 4DFMA 3ILJA 2WVEA 3M05A 1Y3JA 1GMVA 4FNHA 3OLAA 1I51B 4DCJB 3L09A 4A48A 4ID8A 3POTA 3B54A 3DLEB 4NRTA 2XMKA 5C24A 1U1NA 3MHYA 1DAXA 2AKWB 1WG5A 4KR0B 3ENAA 2N3LA 2OPPB 2WONB 2HIYA 3E3XA 4C4WA 4N5SA 4C6AA 4EWTA 2QLBB 2UU9J 3QPIA 2R7UA 3AA8A 1WEYA 3DDIA 5EN1A 3MTJA 1VQ4S 4IUFA 2VV5A 2B8QA 3P96A 1CC8A 1HHTP 4Q45A 3ZZ0A 9RUBA 2R3VA 3ZZOA 2JEIA 4F7VA 2UXCF 3ZZYA 1FWLA 1K1QA 4WIQA 3OTBA 1HNXJ 4LF4J 1C0UA 1VYAA 4YB7A 4X64J 4MJKA 4N56A 2D3O1 5GAGU 1U1PA 2ROEA 1I1GA 2HLTA 1KQSR 3MTKA 2WSCC 3PJ9A 1LWFB 1OQ6A 2LEBA 4OX7A 2DGXA 5CYMB 2H3EB 2ZFHA 2BW7A 3QGPA 1C2PA 2YWEA 4DR1J 1IKYA 2GO9A 3HT0A 4ZHRB 2NUHA 4Q8EA 1HARA 2QO3A 2I9SA 2JLFA 4PXCA 2IDEA 4CH1A 3I5CA 3D3CJ 4TLRA 4NXNJ 3CT9A 5IOLA 3J7Z5 4C8LA 2HVEA 3IFEA 4DQPA 3VZIA 4QWEA 3VF0B 2WAQD 2DEIA 2MHEA 3JQKA 2ZH9A 5E3AA 4ZVGA 4DX6A 2KVIA 5KFAA 3IBWA 4Q8FA 4IDKB 3OSNA 2VA3A 3QRRA 2V0NA 3IN5A 2CQDA 4OX6A 4JI4F 3WX8A 4QW8A 2FVCA 2CWXA 5DZ7A 2H9ZA 3K5LA 5F8IA 1R0AB 2CPIA 3SEOA 1VJWA 2KI2A 2OPSB 4UT4A 3KK1B 4KV8B 4LSNB 3B8HA 2LECA 2K1RB 1T3OA 4G1IA 3GFZA 4XAKA 1TKTA 2J9CA 2W7AA 4HT7A 1RT4B 4HLBA 2ASYA 3MEGA 2YWWA 2UUBF 3P5TL 2D1CA 4KQZA 1ZM2A 4S0MA 4DUYJ 3IM9A 4IQXA 3GYNA 2MSSA 4GKJJ 3OXLA 1K9MT 1K47A 2AJ0A 4QIGA 3GU0A 1GMUA 2LXUA 3H4BA 2F9JA 2W2OP 2OKQA 3U1MA 3MUMP 4G3IA 1WC1A 4ZPBA 4Y2IA 2GGPA 1MSWD 1SJRA 1O5JA 2W7PA 3L7OA 3QT8A 4LSLB 5DGAA 2MZTA 2VDIA 1TK5A 1XNRF 2NXUA 3KXDA 3LGNA 1GAOA 2HNZB 4L3KA 1XBWA 4ED6A 1ZM9A 4DSLA 1PC5A 5EGYA 3OSPA 3CWJA 1REGX 4PYDA 1QY7A 5CD4A 4ZLNA 1H98A 2DR9A 3R2CJ 3EXYA 5L1KA 3RBZA 2P9EA 2ZEJA 3TWZA 1YHQS 4CT8A 4DV2J 3EM1A 2BE2A 1CJVB 4NA1A 1RWKB 3ZTPA 4F0KA 4I0WA 4DR4F 4ZP9A 1BWEA 1FVQA 2ZKTA 3WZ0A 4O23A 4B9MA 1X5OA 2JFDA 2PFFB 5SUHA 1F3FA 3OLBA 5KOWA 2DVIA 2DITA 1XIQA 4R8UB 2UVUA 3UDLA 1YITS 2VBWA 3CJ4A 1QDUB 3SDEA 5KFWA 3MECA 5DLFA 2A2DA 2V2ZA 2QJ3A 1SC3B 4ETZA 4A8FA 1B70B 4KB7A 4MTPA 4ZCLA 2LP4A 2MQLA 1Q8LA 2V4QA 3AY0A 4NA3A 4IG3B 5L38A 4V1Ak 4CLWA 5JUMA 5KFGA 2HG4A 1Y9OA 3H5UA 1S0MA 4B3OB 2YQ3A 2MY8A 1AZSA 5HBMB 5KFNA 3KLEB 5C42B 2DNLA 3KLHA 2VFTA 3OXGA 4LBIA 4WYWA 4QW9A 3AD9C 4K0KJ 5KG2A 1HYSA 4DN0A 2IVYA 1QVFR 4YB5A 3NGRA 3MXHP 2RNEA 5EDWA 3I32A 1RYRA 3SFUA 5BYRA 2XWYA 1W2BR 2LQ8A 2MHNA 3VZHA 4JI1J 2EVZA 1P8GA 3TW0A 6FDRA 2OMOA 1REVB 2VG6B 3UCUP 2IRUA 3CD5A 2O3DA 3DHXA 3M1VA 4EO8A 4NEYA 1T8EA 3BO4A 1FT8A 4OYOA 4MKBA 3PW2A 4K7QA 4ECVA 2GAGC 1N33F 4WE1A 1S9GB 2Q43A 2OTJS 2B6AA 3TZXA 2VH7A 2H5IB 3HJFA 1GK8A 3DRRB 3K2YA 4YS2A 3HVRA 2ZNYA 3QSYB 2KXFA 1JLBB 4ECWA 2FJEB 1MROB 4M1KA 3UNYA 1FDDA 3SQOP 3TAMB 1N48A 4ECSA 1Y00A 3FKBA 4O3OA 3RBXA 1IQTA 4HTJA 5BR8J 2HZAA 2JC0A 3J7YI 1DTQA 2WVBA 3J81Y 2YKPA 4L75A 2F7VA 1JX4A 3FMWA 4C0HA 2AJQA 2FLPA 2HYIB 4LF1A 3EYZA 3FBCA 4K2XA 2EC0A 1QTNB 2OP5A 3MMBB 4WFXA 2HKEA 2V8PA 4ZVUB 1DTTB 3BREA 4KJIA 1WWHA 4OJ3A 4USKA 2MDAA 3GIRA 2BJ3A 3PIPQ 3S1TA 1BWVA 3HULA 3CJ0A 2IJNA 3V81B 1FRIA 2C28A 1LK5A 1HD1A 3D1QA 5GMKa 2EC2A 1RT6A 3R1HA 2K7JA 2UP1A 2DGWA 1YJ9S 1YVFA 1HBMB 4CLUA 3BO2A 4BWMA 5IQQA 3T1AA 5EX0A 2FGOA 2D9PA 3K57A 4ECTA 2RKIA 3N0VA 4ID5B 1S7HA 2WCXA 1CQNA 2XHWA 2P2CB 5IC4B 4U9RA 3W66A 2CJAA 5LT5A 3T9NA 1I94F 3M30A 4F26A 3RAXA 3I4PA 3M9MB 4O3QA 1HWKA 1NKEA 4RZRA 4J7CA 4OJHA 4J90A 5KFDA 3CDAA 4LRFA 4DG1B 4LBPA 1V6HA 1MN7A 4P7TA 2XCPA 4M5GA 1VBKA 4A4JA 3B82A 1UWAA 4ZJQA 1R0BG 3TJ9A 4X65F 4ECZA 3IO1A 3W3SA 4M5KA 8ATCB 2VC0A 3RU0A 2DH7A 4PWUA 3I0RB 2WB4A 3M32B 4OZ2A 3DLGB 3TJAA 4DOZA 1VCTA 1U2FA 3NOCA 3TANA 3R7NB 3P49B 2W01A 1JLGB 3OFHA 3JAMY 4KGMA 3M6VA 2UU9F 1HHQA 1IVZA 1HWJA 1QUPA 2XS7A 2GVDB 1FKPB 1TVRB 4OYBA 2BYCA 4WWSA 2ZJPQ 2Q79A 2OD4A 1J5EJ 4IFVA 4EEYA 3S8SA 2Q6BA 1WEXA 1Q53A 3IWLA 4AQYJ 1HNXF 4LF4F 4G1QB 4X64F 3FEXB 2ZH1A 1S6QA 4WKRA 1TV6A 2I5JB 1APSA 3MCMA 1LWEA 3RAMA 4MFBB 3GV5B 3ZXWA 5CD4H 3DI6A 4DR1F 2DGQA 1RWUA 3JB9k 1YJNS 4J9NA 3UDEA 4FYDA 5LSOA 3UCZP 3RBEA 4DU7A 1RAFB 4NPOA 1N5VA 4QU6A 1X4FA 4OI6A 4XDDA 1RAHB 4NXNF 3VCDA 2PE8A 5FJ4A 1RAOA 4X4SA 4ECXA 2IJRA 2XGQA 3CCMS 2RH3A 2J7UA 3KJFB 1GTHA 1RHRB 5CCMA 1DFDA 1BC6A 1HI0P 1VLYA 4OHVA 1RTDB 4FXWA 1PCAA 3H2VE 3CEDA 2KZMA 5A76A 3GYXB 3LP0A 2J9DE 2HZVA 2NPIA 2B7CB 4H4OA 1S1TA 2QLWA 3GONA 2DD8S 2XSJB 1BQMA 2CA9A 1WHWA 3HFKA 3LP2B 4HHHA 5D78A 1BQNB 3G96A 1QD1A 4UOHA 3V4IA 3Q8UA 2LDIA 3NG8A 3HT3A 2W4CA 5D8HB 1B7YB 2W24A 5D0RA 5ETRA 2IYGA 4V19X 4HH0A 1X8DA 4Q44A 3FBEA 9ATCB 1RKJA 3ILIA 4I68A 4M5LA 5LL6d 4OYIA 4B9TA 4D3HA 4RL1A 3I9V9 3W5XA 1CJUA 4NMLA 3QRQA 1U8WA 2QLXA 4GKJF 4CLKA 2X7IA 4YMEA 2DIUA 5GMDA 3NP5A 1N5YB 3M4XA 2P6TA 2VHGA 1EETA 1S6PA 3AXKA 1RCOB 3KTQA 1FKOA 4J5OA 2VONA 3PG9A 4U8VA 4LRCA 2H5JB 3D1HA 4HI1A 1UJ5A 1VHFA 1FE4A 3LTOA 2IVFB 5J1EB 3BGRB 4DCOB 1LOUA 2MKSA 3ENVA 3W9HA 4H54A 5DDRC 1SL1A 4CLPA 3CO0P 2HMIA 4J9QA 2PI4A 4DMZA 1FKAF 1CJTB 2V2KA 3OW2R 4AE5A 4LREA 4MKYA 3PYGA 3BM7A 4NYOA 5D3GA 1UVMA 3KMQA 2NXCA 4BCAA 5F3ZA 5T7LB 1OYDA 2BOAA 3CCRS 3VAIA 3W1YC 2HQCA 3TUPA 3GQCA 4DL4A 4KO0A 2GCFA 5A6WA 1N54B 5RUBA 2HURA 3DRYA 3CO9A 1T3NA 1JLCB 3MEEB 3I0SB 4IKAA 2L41A 3CIZA 3QO9B 5E3RA 1FK9A 3MF5A 5HANA 1F1BB 3NWGA 5CH7B 3H90A 4DL2A 2FLLA 2FJXA 2OSQA 1RABB 4IH6A 5D6GA 2VPZB 1RT7B 2DKOB 4CO0A 2RQMA 5KFPA 3BO3A 2ZZMA 1RHUB 2EFPA 1RAIB 2ZHAA 5IFMA 1NUEA 4HVZA 3AB4B 5A0YB 5ITHA 1LW0B 4EFAC 5HMXA 2G13A 4X4VA 4LFAJ 3DXSX 4DFJA 5IZHA 4EBDA 2OEMA 2ILZA 3GIIA 2JWNA 2J5AA 2MKJA 3SSQA 5KFOA 1NHKL 4P6QA 1C0TB 1RP5A 1LK7A 3W2WA 5HROB 2VB6A 3KWMA 5M2RA 1SQGA 2Y3YA 3K89A 7FD1A 3MI7X 1RT5B 3T5HA 4DSIA 3WBZA 4P2SA 1RTHA 2BQ3A 3LAKA 2XGPA 4DQSA 3ZNJ1 4CH0S 4RNHA 1Q95G 1TKDA 4ZLJA 1HI1A 4RWXA 2GQQA 3BEGB 2W9CA 3MAHA 2GVZB 2M5YA 5LSRA 1S9EA 4K0KF 4ES1A 3FQLA 5FDLB 4ENOA 1NSQA 1T9UA 3D7SB 4FXVA 2DPIA 3KHGA 1WSVA 2IAJA 2IA0A 1VQ8S 4QZVB 4GC6A 2H1YA 3R5CA 1NXIA 3CE8A 5LJ3Y 2PMHA 1S72S 2KN4A 2DB1A 2ZBCA 4LF6J 3K8VA 4DR2J 4N8OA 2PIIA 1VQOS 4CLSA 4DV1J 4AL6A 2RMLA 5J1PA 1RT2A 2MZ1A 3CJQA 2CPXA 4ZVSB 1WDDA 5DETA 2RDDA 2YNFA 2W8KA 5F9NA 3C19A 1S1XA 1FRKA 1LFPA 3DOLA 5H9EK 2OH2A 2FB0A 4XPCA 2G9OA 1Y4ZB 5F3TA 3CXCR 4LIRA 4EO6A 5K20B 2XMJA 2ASJA 3UW1A 5BR8F 2V50A 5H9EJ 2EFQA 1RWXB 2OEKA 2Y0SD 4PWDA 2H51B 1N34J 1RBAA 2W9AA 1ZAXA 3R5DA 5E3CA 2ROPA 1XWLA 2LLZA 3WHIA 1WHXA 2I6WA 1UP1A 3W8PA 2DRDA 4F67A 1U6FA 1JLFA 3KDNA 4L73A 1HNIB 3THPA 1WHVA 2IIHA 3FJ2A 2CYYA 2C3YA 4NOHA 2VG5A 3NNHA 3FBBA 4JV1A 2CJYB 5HATA 5CABA 1FRXA 3RB6A 1FXLA 4KSEB 3RW6A 3FMBA 4FKXA 3W2VA 1S48A 5HN0A 2V63A 3M8QB 1NPKA 4USVA 1O0PA 2I1RA 3UN5A 1BLUA 3KJVB 2MKCA 1M5HA 2XYHB 2XMUA 1WSRA 3W61A 1JMTA 1YTYA 4Q0BA 2O5DA 1WNEA 2FJDB 2QFIA 3DOKB 2YBVA 5IWAJ 2DNMA 1TELA 4OI0A 2A1BA 2HRTA 4QBUA 2XO7A 3HHLD 1VRUA 2A6MA 4DU8A 2JL9A 3R8YA 4OYAA 2IM2A 4KFBB 3CW2C 2YH0A 3SSRA 2UUTA 3CC7S 1UJ4A 4M5JA 3CD0A 2CQGA 4Q2MA 3HKWA 5A8KA 4O3SA 3RUBL 2C3UA 2KU7A 4DL6A 2V9WA 4USTA 1FRLA 2CUYA 3HD2A 1GMWD 4RUBA 5HQLA 2BMBA 1CS4A 2J0QD 3UO0A 3LF0A 4CM2A 3DMJB 3LANA 1PYSB 1S1UA 4LR7A 5J2PA 1RE1B 4WCEQ 2WVDA 3GCXP 1M1KT 3BGOP 4JOUA 1L3SA 1ITPA 2HK3A 4USHA 1KC8T 5G4DA 2OIHA 1N6QB 3MPDA 3NS6A 3BYPA 1QJHA 4USIA 5AE2A 5J2QB 2EFOA 3QT7A 1CVJA 2YWGA 3M8ZA 1KBRA 2UUWA 3ZZUA 2Y1IA 2HIQA 4M5NA 2HSEB 2B3TB 4UTGA 1S0OA 4YDXA 1HBOB 1SI9A 1IKXB 2CPHA 3Q8RB 3ZNUA 1J5EF 5MLCV 1X9MA 1JXLA 4IRDA 5ETTA 1NH8A 4AQYF 3QBCA 3QAEA 1G6BA 4LSZB 4IH7A 4UY8T 1MLAA 1JLQA 1D1UA 1Q4RA 5KFBA 1DURA 3Q8YA 5A8WB 2A3JA 5DDQC 1S97A 4DL7A 1RK8A 5CCLA 3KLIA 1U1RA 3DOMA 2ZE2A 5DG7A 1RJJA 2YNIA 3TAPA 3EZUA 2R7VA 2YNGB 3BQ0A 3HI9A 2KVQE 3G82A 1U26A 4M63A 8AT1B 3O8WA 2UV8A 4JV5J 1E6YB 4A8MP 3NBPA 4JI7J 1SH2A 2V68A 1RHQB 3A12A 2W4PA 1FD2A 3U1LA 1RHKB 4RNOA 3D0GE 4C11A 3OUYA 3CVKA 5DM7Q 4FS1A 2DH9A 2P5VA 1CULB 2E5LJ 3ISNC 5ETQA 3QFHA 3ILLA 3PYEA 1F5AA 3BPDA 3SQGA 2VDHA 3TO8A 1F9EB 4RW7A 1X9SA 1HNWJ 1V5IB 1GX6A 3C15B 4MK8A 1KVKA 2R7WA 4NMXA 3Q8QB 3W5YA 3R97A 5HLFA 3D6FB 3DRSB 4QCLA 1VMBA 5F0UA 4P72A 1ZOTA 1VQPS 1MG7A 4N77A 3NMRA 4LF2A 1C1BA 3BKTA 3C16B 4WP3A 1WDTA 1QUVA 3E01A 2M8HA 2B9WA 2DNKA 5DG8A 1VRTB 3JAMU 4QYZK 2DGUA 2HBYB 1VQSA 1NK0A 1DBDA 1EQ0A 3G9CA 5J2MB 3IAS9 3JTPA 2OSRA 4WBFA 4QYZJ 1RA7A 5B7WA 1R31A 1PJ5A 5CYQB 3OJSA 1HMVB 2AEMA 3FNNA 1K73T 2UVWA 3EZ5A 4O44B 4EU0A 3UPFA 3HPOA 1N8RT 4J9KA 4BC7A 4RJVA 1R0CB 2XYGB 1HPZB 1UWBB 5L39A 6FD1A 4USUA 5GAHU 3SZ2A 1VK3A 4AD6A 2VIHA 2HFSA 4NLXA 3SV3A 3BBFA 3NEKA 4K4ZA 5DDOC 5GMEA 3OVAA 3UDCA 4WKYA 1Q16B 1NNDA 4RW8B 2QA2A 5ETOA 4E8UA 2HHTA 3SIPB 2K7KA 4K4WA 3MR6A 3ZZRA 2F65A 3IS9A 3QZ7A 2AV5A 4PG8A 4DF8A 2QE5A 3LA0A 1UETA 2B51A 1TL3A 1TKXB 3BKUA 3SXLA 2QC3A 1FCAA 2ZNZA 2XS5A 1OWXA 2QA4S 3MM9A 2VBXA 4RU2A 3PX0A 4DPXA 2DHAA 4K4YA 1FJ7A 5KFTA 4NCAA 3MFIA 5AJ3J 2M9KA 2B5JA 2YX4A 3EX7B 4H4MA 5HSPA 1TL4A 1O8BA 1Q0NA 2C2KB 2KJVA 4RNMA 1TTHB 1F3VA 4QR0A 1BUXA 5DS7A 3WQPA 1VBYA 4RU9A 3G87A 4W92B 5J2NB 1M5SA 5KFRA 4LFAF 4CO2A 3M8SA 4PQAA 2WOMB 4WPAA 3BR8A 3TAQA 3KLFA 3C2PA 5HVGA 4JI0J 2R7SA 3ET6B 4I2PA 3N28A 1TU0B 2RF2B 1TL5A 1P9QC 3T1YJ 1TP7A 2BE7D 2M0GB 4C97A 2CZVC 3JTOA 1UVNA 3GJQB 4DS5A 2MYFA 4FF1A 4F2SA 4CO1A 3GG1A 2LYVA 4F8RA 3HHKA 1LKZA 1XTZA 3KLGA 1T05B 1Q82T 1RT3A 5IV4A 3BSOA 3DLKA 3OQ2A 3DCAA 3E8OA 3KUGA 1GXTA 3KYLA 3MUVP 4P7VA 5L1JA 3D1OA 2FIUA 2FYXA 4WTYA 2YKMA 3GPAA 2WB1D 4NLRA 3GLJA 4KAIA 1SV5A 2VZ9A 3W9JA 2HNYA 2RB7A 1VBXA 5KFKA 3GIJA 2QLJB 2EPIA 3O44A 3IBCB 4HHJA 3T1HJ 3KUHA 2CKWA 1M5KC 1IBCB 2LQBA 4DSFA 4TY8B 2I38A 4JI5J 5D4OA 4JUZA 4LF6F 4JV2A 1YJWS 4DR2F 2NUUG 3BBBA 1TUVA 1SJ1A 4DV1F 5K5MA 1HQEA 4K5RA 1CSJA 1AFIA 1JLAB 1JWWA 3NAHA 3QJPA 2ZC4A 1PO6A 2RS2A 2LFVA 5G0RA 2M8DB 4DR5J 5DM6Q 2LA6A 4CTAB 1KOHA 2R42A 3F41A 3NLCA 3ZC4A 2GHWA 4OLOA 2VQFJ 3DYAA 2ASDA 4LVOP 5HP1A 3PRVA 3N4WA 2PEHA 1BXNA 3EUNA 1N34F 4ZPAA 1GXUA 2FD2A 3NCRA 4LF5J 2AYBA 1XK8A 3H40A 4WZQA 1K1SA 2ZM6J 3HSZA 2K2PA 3R6GB 3CJKA 1KFSA 1FNXH 3TA1A 2H4WB 2VPWB 2IMWP 3BN4A 1VS3A 1W26A 1EJ7L 3R5BA 3QGIA 1F6TA 2W2MP 1M5OC 3G8QA 2E44A 4LF8J 2ASLA 1KNZA 5IC6B 1NHVA 3TQEA 1QTMA 3A3OB 1U6BA 4NYPA 2RRBA 3DM2A 3GJTB 2MQOA 3S7RA 3A1YG 5KOXA 4DX8H 1WTBA 4HACB 2Z57B 1VQYA 4ES2A 1S1WA 5L1LA 3MM8A 4G1PA 5IWAF 1RWNB 1UW4A 1SL2A 3ISZA 1CQMA 3CMES 2PMZD 1U02A 1ZA2B 4PUOB 5AXKA 3GCWP 3T6JA 1XNQJ 1RISA 3TARA 2UV8G 4MYTA 1YSJA 3HSGA 1NHUA 2IRYA 5KFMA 3IGNA 3TVZA 4NA2A 2Z2MA 3D68A 2HFVA 1R3NA 1DHMA 3HHLA 2ERRA 1EKSA 3M2VB 2ZH5A 3HVAA 3NCQA 1NK8A 2OLWA 4B02A 2Z56B 1TL1B 2VASA 4XTTA 5KG0A 2GW8A 2XI3A 3PRBA 2WHOA 1R89A 2OPQB 1HWIA 5F8NA 1T95A 2HGLA 4EUVA 2B4VA 1YRXA 1JNRB 3N9UC 2D41A 3T5JA 3UR3C 3CJ5A 2LXFA 1NJZA 2JX2A 3EDRB 4ZVTB 5SZTA 3CIMA 2KT5A 1N5TA 2POKA 4GMKA 3HHNB 1VQ7S 1NK9A 4X66F 3TX0A 3RZAA 3RRHA 4RW4A 3DRPB 1RWOB 2XQCA 1UKUA 4HH1A 1FEEA 1LW2A 2OHDA 3BB5A 3K5PA 4F02A 1T9XA 2M52A 1T03A 3TA2A 4URGA 3I31A 2UXDJ 3MCOA 1F2GA 3EXCX 5L8RC 1FTRA 2A2CA 3O2IA 2EK6A 2CQ0A 4TYAA 5AE1A 3LOUA 2P9GA 1RTIA 2IDLA 1ZZNA 5D4LA 3K5MA 1C4CA 1VLOA 4C3MA 3QGHA 2BANB 4OZ0A 2JFKA 1AXQA 1EHWA 4DV0J 4M8LA 2E1AA 4KGVB 5D0EA 3MPYA 4JV5F 1MU2A 4JI7F 3K0JA 2DY1A 2ZWPA 3C3LA 4NLUA 4A46A 2AGPA 4YR2A 4M95A 1KLMA 3QQCD 1CLFA 1RUSA 5KG7A 3G8TA 1IKWA 3ENWA 2D69A 3DGPA 4RW6A 2PMWA 4LIWA 5LSLA 5C25A 1ELOA 2E5LF 3PXGa 3VHQA 5C2GA 1HNWF 3MAAB 1F0XA 4ILMA 3RR8A 1O6XA 3CGIA 2X1BA 5KAKA 4WZMA 2E1MC 3UD4P 4ILLA 5H1SV 3US5A 4NCBA 1VQ5S 1SB6A 3UNGC 2B43A 4YP3A 4MMOA 4RUHA 1PILA 4DV6J 3O6QA 4CWBA 1RWVB 2R7QA 3A8EA 1JLEB 1E6VB 2ACYA 4IG0B 3MM6A 4AL5A 1VGYA 1W25A 2KFYA 1CJKB 4F3QA 3KKFA 5B0GA 4Y2MA 1Y3KA 1LXNA 3UI3A 1HNZJ 4IO9Q 4C8YA 1EP4B 2QZ8A 3OL8A 1XJWB 4AXIA 2IHR1 2J76E 3IBFB 2RAQA 4DL3A 1T7PA 1FTCA 1B64A 1RZMA 1KR4A 2CJBA 3M8PA 4L74A 1IXKA 1FRHA 3SYZA 4JBCA 4KTQA 3PEJA 1TL7A 2AGQA 5ETMA 4K4SA 1B0VA 3DRXA 2AJFE 4RX6A 1H2VZ 2NXNA 5A6PA 3PFEA 4PEOA 1X5PA 2X3GA 4F4YA 3HVTB 4UOFA 1ROFA 3I4HX 1IBKJ 3ICLA 4M5DB 2DO0A 4GC7A 3WDOA 3GR0A 2ILYA 4LFBJ 1YK9A 1Q8IA 1ZYQA 1WF2A 2IM3A 1JXEA 1S4FA 2IC3B 1DLOA 3FBFA 3J7YU 4I69A 3FFIB 2OO4A 2L08A 1S79A 2PC6A 2CQIA 4NLGA 4EBCA 1SQEA 2C2RA 4Y2AA 5AJ3F 1J5OA 4PQUA 2J6SA 1UAWA 4NLVA 3I55S 1N88A 1HI8A 3C6TA 3M2RA 4I2QB 2C3OA 1FXDA 2BUNA 3RRGA 4LFCJ 5KT2A 4ERDA 4I64A 4GVBB 4IYQA 3P4UB 2C3MA 3ETMA 5K14B 1SJFA 1NK4A 2FPHX 1RDRA 3OR2A 2VJUA 3LUYA 2LDYA 4BS2A 3W65A 4ZPTR 1H73A 2I8EA 3MEDB 2DY9A 2ATCB 1PGZA 2BKPA 3QAUA 3CD6S 3MM5A 4I7FB 3H0PA 4A47A 3K5OA 2AEJA 3VQSA 3PZPA 4DWIA 3T1YF 4FVCA 2HEKA 1VC6A 2KHDA 1OPZA 1WELA 2LQ9A 5KT3A 3GILA 4ZP7A 4KPYA 2RHSB 4ZLPA 2FJVA 4A8YA 1OIAA 3OR1B 2DPJA 3IRXA 2RRNA 4MH8A 4B3SJ 2VG7A 3T41A 3BGUA 4ZOSA 1GFWB 3NGTA 4DSKA 1JJ4A 3Q24A 4USWA 1PC4A 4C9DA 3KG4A 3D6HB 2ZUAA 4CYUA 3T1HF 4MK9A 4LR9A 5I3UB 4F4XA 2OPRB 5KT5A 4WK1A 4GO5X 2JLGA 2KYZA 4TVAB 3CMAS 4JI5F 3V6DB 3CCTA 1KFDA 3LO3A 2GMJA 3IG1B 3RYLA 3C8YA 2HNDB 2NXJA 3S6EA 1QSSA 1N36J 2FZKB 2J8AA 1ZS6A 2XZDB 2HS3A 2ZVIA 1HR0J 5KFUA 1FDNA 5LMNJ 2HWHA 5DRKA 2HHWA 4MKAA 1PYOB 4Q2LA 3HO1A 3IR7B 4O3NA 3H25A 4DR5F 2XULA 5AE3A 4C3KA 2VQFF 3ITHA 2AMCB 3QT6A 4ECYA 1VC0A 1SUQA 4RLEA 3R1LA 4OFZA 3X1LB 1DQ9A 3V4MA 4LF5F 3B78A 4K5SA 2E5GA 3BN7A 1M5PC 2ZM6F 2XNQA 2XMTA 5IM0A 4FYVB 4NE9C 2HVZA 4KGKA 1RI7A 4D3GA 5KT7A 2MB0B 2CJXB 5HMYA 3PJWA 1RT1A 1KWMA 2KDOA 3PTWA 2J9DA 2H4YB 1WOPA 2KO1A 4P74A 2GJIA 2YKNB 4Z7CA 3PFOA 4FF2A 4LF8F 3PJXA 1WTFA 1VR6A 5DDPC 1RWMB 3NWRA 4QIVA 2MZSA 2AD9A 2HAFA 2XNRA 5E3QA 2RSQA 4OYWA 2Y1JA 2DH8A 4UUXA 4ES3A 2E1RA 4J9RA 2VOPA 3M2UA 5GADI 2YQ1A 3I96A 3MMJA 1P1TA 2QL7B 3D54A 4DCPB 4QQBA 4CZCA 2YX1A 1HQUA 3MD1A 3VAJA 1C1CB 2DGSA 4WFBQ 4LBHA 1WI6A 4K4XA 4NEZA 2QYCA 3UE2A 4IH5A 3OL6A 2E7VA 2DNNA 2DK2A 2FVRA 5ADZA 2E5JA 2HBQB 3AD8C 3DKDA 1Q86T 2R7XA 3OTEA 4KE5A 4ED3A 3Q8PB 3GB0A 5JJBA 3VGTA 3PYDA 2DO4A 4O3PA 3EVOA 1WC0A 4YUDA 3ZFVA 3VVUA 2WW8A 2EI5A 4V19J 1R8PA 4I6AA 4MKVA 3W64A 4MIBA 5FLXY 3MGJA 5K9FA 3BDPA 2J7WA 1WF0A 1P27B 3JYTA 1Y5NB 4OZ3A 2W1BA 3IMQJ 1SH3A 4XO0A 2QA1A 3FCVA 1UW9A 4I6WA 2CFXA 1FE0A 2FVQA 1Q7YT 2UZAA 4OHXA 4H4KC 3W7BA 2OJ3A 4LF7J 3FC9A 1WOSA 3BH7B 2Z30B 2BZ2A 2MGZA 1BD6A 4URQU 1U1QA 4WXOA 4DR6J 1OY6A 1KHVA 4FNIA 2YXLA 2KFZA 1HWLA 3BSCA 2UXDF 2XB2D 8RUCA 4EZ9A 2CNNB 1FD8A 5JVGQ 3HD1A 2D7SA 3GIMA 2DHSA 2Y1LB 3ONQA 3N6NA 3EE3A 2UXBJ 4DF4A 1Q81T 3LP1B 3ZTRA 4HDGA 4NCGA 1FDBA 4AXJA 1ICEB 4MAKA 2AGOA 2MQ8A 1HBUB 2BKOA 4FN5A 3DLLQ 4DV7J 1NU4A 1JKHA 1HBNA 4Q5VA 4N47A 1M0SA 4NI2B 2DNPA 1EQMA 3KK3A 2QX0A 2ATLA 4R25A 3SI8A 2DIVA 2O66A 4KHPJ 3L4BC 2QG9B 1RTJA 2AW0A 2W9BA 2KM8C 1OQ3A 3E2EA 4KKOA 2NQPA 1VISA 5DO2A 3G8SA 4RW9B 4KH1B 1XC9A 4QR2A 5ETVA 1M1HA 4UUWA 3LWLA 1Q5VA 4X4PA 4CO4A 3MMAB 2DNOA 2MXYA 1HKAA 1NM2A 3MR2A 1AYEA 4QYRA 4ZPVR 1UFWA 3GG0A 4WIIA 1RLDA 1QAXA 2NPFA 3DDNA 3CULA 1TMJA 2AIRB 5A8RB 1YQHA 2HHQA 4NLWA 4YB6A 4DEZA 1U1LA 4YR3A 1PIEA 1S1VA 3MUTP 4DV6F 4WYLA 2GQCA 1R7IA 1DJ0A 2HRYA 3P3DA 2D3OR 3PIOQ 3QLHA 3Q23A 2DNQA 2JC1A 2KT2A 2AX0A 4KY3A 3OVBA 2PO4A 1U48A 3G4SS 3N6MA 3NGKA 1TAUA 1QLNA 1JQGA 1RCXB 1Z2ZA 2D74B 2ZWOA 1A6LA 2BVZA 2MLYA 1FI4A 2XSFA 3FSYA 1UEKA 2U1AA 4X84A 3TA0A 2I2YA 1RWPB 5D77A 4P2FA 1QE1A 3PVXA 3KG1A 1EKRA 4U67Q 2XWXA 1N4LA 3UR0A 1IM6A 2XG8A 2FVSA 3PW5A 4K50A 2NZ4A 4QIWD 1RTZA 2NCKL 4DZDA 2N4DA 1NPRA 3D3BJ 5KG5A 3ELHA 1NBEB 3W9IA 3POTB 2HHVA 2EG2A 1D9AA 3UVJA 1VOMA 5C24B 3PYFA 3NS7B 3OTOF 2KG0A 2HGNA 4K2JA 4M94A 1IBKF 2ZBIA 5CQGA 2J9EA 2KZZA 2DISA 3OT9A 3C66A 4LFBF 5E5NA 3GJRB 1LXJA 2ZD1A 3MM7A 1H0HB 4FBTA 5F41A 1RXOB 3BQ2A 1SBRA 1YJTA 4DPWA 4QWAA 3VVTA 2UUCJ 2XMMA 4ANEA 3QGGA 2R9LA 4RKUC 3PDNA 2VBYA 1HNVA 3QIPA 1C0UB 3CDWA 3I6PA 2R7RA 5BYSA 4ELTA 1PKUA 4N76A 2XS2A 1BGXT 2M3DA 3FCWA 1ULRA 1X4BA 3KDOA 4ECRA 1NSPA 2E7WA 2V8VA 4X2BA 4LFCF 5F8JA 1NAQA 2GC8A 1IKYB 3JSRA 1NK6A 3V6JA 4TYBA 2GS8A 2QL9B 4QOTA 3CJTA 3C14A 3KK2A 1NO8A 3CCUS 1FX2A 1L3TA 4WXWA 4B9NA 4PRFA 3IGVA 3UCGA 5I42A 3B6BA 2DTJA 2G2ZA 1VIXA 4J9LA 2OMLA 4OL8A 4E0DA 2YNHA 3JSMA 4ED5A 1FJCA 1X60A 3V6HA 4ZVPB 4J37A 1QAJA 3QJLA 2MLXA 4XK8C 4ZN3A 4HT5A 4C7QA 4IFYA 1R27B 1SXLA 4B3SF 2V94A 3A13A 2BQUA 1U0HA 1RKIA 1TKZA 5E2QA 2C2EA 5KFXA 3EPGA 2E9TA 4O4GA 1UEUA 5L9XA 1FJGF 5KFCA 3KNAA 1IBLJ 2YH1A 2V4JA 4F4WA 5HO4A 1U45A 4ZCMA 1GQEA 3BKFA 4OYMA 3R27A 1KSPA 2HK2A 1TKTB 2JOQA 3CB4A 1UVJA 4KIAA 3MEGB 1KONA 4TLQA 1FVSA 4Y2CA 4BC9A 1V5VA 4KC5A 3MURP 2NSBA 3AJDA 2C22A 4QPTA 1N36F 3QRPA 2XLKA 1RAAB 3C6UA 1HQ2A 1HR0F 3ISND 1JJHA 4ICLA 2HQ3A 2CPDA 5LMNF 3IR5B 4LF9J 2UUBJ 1ZTWA 3NGSA 3I5BA 3T6BA 5EWFA 3H42A 2G0JA 2GIFA 3H8YA 1NDKA 2GGPB 3JSBA 3MMCA 2OFHX 2QV6A 4CNZA 3KHRA 5HI7A 3IWNC 2IBOA 2RUSA 1FRJA 1XMQJ 1U47A 2MY7A 1RLCL 3NCPA 1Q8BA 2BBEA 5K8MA 5DLGA 3AA9A 4C0OC 1H74A 3IA0A 2YKQA 3FUYA 3VAHA 5GAEI 4IOAQ 2F4VJ 2Q1LA 3HHDA 1B3TA 4OHZA 3CCVS 2J0XA 4C8MA 2WVFA 3GWCA 1DY3A 5ETNA 4E2FB 2AYEA 1IKVA 1S59A 4YHHJ 4R5PA 3GZ7A 4N41A 1MW7A 2LU1A 2BE2B 4PG4A 1LWCA 2B7BB 1U1MA 1CEZA 1OY9A 4N7TA 1S99A 3LH2S 1D0EA 4WFAQ 1RADB 3JQJA 4QWBA 3ZO7A 1S76D 2FHJA 2AEFA 1PYTA 2GAHC 3SDEB 2XM3A 3MECB 3SMZA 1U09A 1V3ZA 2L3MA 2XEXA 2N82B 3DLEA 2ZKUA 5T14A 3BYRA 2OPPA 1G4CA 1YJRA 4ZDNA 2WONA 5DQGA 1VK8A 2ZHOA 3G6VA 2XLJA 1WKLA 2YPZA 2LU2A 2YY3A 1RQ0A 4A8WA 1TK0A 4O3RA 1AZSB 1Q5YA 3FZ2A 1FO1A 1YBAA 4HDHA 4KRWA 1RU1A 3CNQP 4I4BA 1NJWA 2KRBA 2HAIA 3KLHB 5D0GA 4Y3CA 1WF1A 3EGNA 3PRDA 2PD1A 3I9ZA 2P8IA 2O67A 1H38A 1HYSB 2CNOB 4LRDA 1FNOA 2V2VA 1H7WA 2O01C 3PEHA 1G2EA 1GTEA 1UA1A 4JI3J 1LWFA 1RAGB 2L9NA 1PJ7A 1TUWA 4ZMMA 5CYMA 4X4RA 4OYPA 3PX6A 5E33A 3M1VB 4LF7F 1R8BA 4F4KA 2BJ1A 2V6AA 4Q43A 2YWKA 2IYIA 2D3UA 3HLUA 3MR7A 4PYAA 2KJWA 2FLOA 3Q89A 4DR6F 1YKWA 3G6XA 4FPIA 4ZHRA 3BV8A 2ZH7A 3GE9A 1A7GE 4WE1B 2ACMA 5KTQA 2B6AB 1KHWA 1SJ4P 3LGHA 4YY3J 3W63A 2RQKA 5LJ5Y 3ETOA 1KN6A 1VQMS 2RQ4A 3H59A 2G2OA 4ELUA 3RB3A 3JSYA 4ZLLA 4OX8A 2KHCA 3DU6A 3CDBA 4CLTA 2QEXS 1U24A 4DHVA 2VKRA 2UXBF 1T94A 2F5GA 4ECQA 2RDJA 5D15A 1NLKL 4U7CA 1DTQB 3SBMA 2QGFB 5IXUA 3IRWP 4DV7F 4USJC 2NZCA 4IDKA 1DRZA 2DXFA 1GX5A 4YOEA 1WKJA 3GFHA 3BGFA 2EBEA 4KHPF 4DFKA 2ADCA 4RUCA 4DFPA 5FD1A 4X4TA 2B56A 1PAUB 2WSEC 1R0AA 4XPEA 3UWTA 3MWBA 2H65B 3J7ZT 1Q7LB 3W62A 3QMQA 2OPSA 2VFVA 3KK1A 4KV8A 4LUBA 1U1OA 2G1HA 4LSNA 1H6KX 4DUYF 2DNRA 2K1RA 4K4UA 2MTLA 4KHRA 4F36A 5HMZA 2G0IA 4A8QA 5M2PA 3U1NA 2BJEA 2PEBA 2PSZA 5EHHA 1RT6B 1RT4A 3GFYA 1JNZB 2C1EB 3R3TA 2GFFA 4J9PA 1LEOA 2ZH3A 3H98A 4OV6A 3GIKA 3CUNA 2R4FA 5KFLA 2RKIB 2R2SA 5FLXU 5F8GA 1D8ZA 2IY5B 2GHVC 4ZVRB 3K17A 3LQVA 3DLBA 4PG6A 3M30B 3MOZA 1HW8A 2HS0A 4JB8B 4EYHB 3NXZA 2Y0BB 2BM0A 4XDCA 4LSLA 3R5JB 3G2XA 2Z58B 4ZPDA 5KFJA 1I94J 3EVWA 1V3RA 2LVWA 2HWIA 2HNZA 2A18A 2N7CA 4BHQA 3GV8B 4DV2F 1FWKA 3GTYX 2KFNA 5D4NA 5HMWA 4FYXB 2LEAA 1NDPA 2VPYB 1CJVA 3J81j 2B9EA 2CJ9A 4OHYA 1HLWA 4KHMA 2WBRA 5LXYA 1Y7PA 1N5QA 1XMOJ 2LCWA 3WIVA 3R5GA 1KDNA 2RE1A 4A8XA 4R8UA 4U8YA 4O0IA 3QT5A 3K7RA 2UUCF 2K3KA 4IFVB 2X1FA 3U27A 1GNKA 3G6YA 2IRXA 3G71S 1I5OB 2D3ZA 3CC2S 1KTVA 3T3FA 3F44A 5B09A 4O0NA 3A3PB 1S6QB 5DQHA 4UZCA 1TV6B 2JEFA 2M2BA 1YJVA 3BBCA 3GP9A 2FY8A 4IG3A 4DSJA 1U8SA 3UD5A 4ZP8A 1LWEB 2HGMA 2E9RX 2DHXA 2MZRA 2UVRA 3DI6B 1AFJA 4UF4A 2HLUA 2VFRA 3EVMA 4K4TA 3D2WA 4BDPA 1VBZA 2CPFA 4YR0A 4P2MA 3ZTSA 2K8GA 3GYGA 3CC4S 2GJFA 1SPBP 3ADAC 3N79A 3QSIA 2CJKA 3MPWA 4B3OA 5HBMA 1H72C 3KLEA 1SKWA 2FGCA 5C42A 2BKNA 4JI1F 1P9YA 2GMLA 1UZDA 4ZN1A 1SJ3P 1HW9A 3M6WA 1BQXA 1YJUA 4EI2A 3K58A 3MCNA 3KOAA 3D0HE 2VJVA 1UTAA 4IR1A 1IR2A 2W8LA 1TR0A 3H20A 4PPDA 3HFZB 1REVA 2VG6A 4ANCA 4YEAA 3LP0B 1H2TZ 2QMWA 2CPEA 4ELVA 1N32J 3R5AA 4WU3A 3HHEA 2IBKA 3LPEA 4H4OB 1S1TB 2EKNA 2R2RA 1BQMB 1WUUA 3Q8VA 1TQLA 4LRBA 4RO0A 3AH6A 1LFWA 1S9GA 2Y8WA 4P2XA 3V4IB 2YKOA 3DRRA 5T41A 5EWEA 4OHWA 4FF4A 2C2ZB 2FC8A 1JK9B 2V69A 1IBLF 2KH9A 2ADBA 4DUTA 1JLBA 3FEYB 3D6MB 4P9SA 1MROA 3TAMA 1KQKA 1RA6A 2APOA 2DGTA 3EICA 4OZJA 4CLLA 1CJUB 3AJ1A 4TU7A 1NDCA 2V8HA 2AJ4A 2L9WA 2R7OA 4LF9F 3MMBA 3ZTOA 3VGUA 1EETB 1S6PB 4BLGA 1DTTA 1Y5IB 1FKOB 4JI2J 3O1LA 1FHTA 1EAYC 1D9FA 4ZVHA 4TN2A 2V5HG 4W4MA 2CNKB 5E41A 3V81A 3A3NB 4B9SA 4CT9A 4KBIA 3I56S 1KEKA 3TVKA 2JJ4D 1XMQF 3BS9A 5DZ6A 2VF3A 2HMIB 2QMUB 2AHOB 5HJXA 4NLYA 2Z2ZA 2EFNA 1HBMA 1RHMB 1S0VA 2ZITA 2M88A 2KG1A 1ZTTA 5B0BA 2F4VF 1OSCA 5D3GB 2XYPB 4B9UA 2HBRB 4ID5A 3UD3P 4L72B 1WJ9A 2V9KA 1MNEA 3AQOA 4YHHF 2MPUA 4KO0B 4TU8A 4NZ6A 4RNFA 1S77D 2CRLA 1RBLA 4KGZB 4MIWA 4DDFA 3QNWB 2PT0A 2F3JA 3BDEA 1FK9B 4ZVQB 2B4UA 2QTWA 2CVEA 5HQMA 4ZJLA 2DXEA 2GX8A 4DG1A 4P10A 1S0NA 3NOGA 2HW3A 1YDLA 3S01A 1UPPA 3LW5C 3GJSB 4UQTA 1FWPA 3R2DJ 2EFGA 3FQKA 2B0GA 4FXDA 1D9DA 3MFHA 3OTDA 1F2HA 5ETKA 3Q2SC 4C48A 2CVIA 1MWZA 1HA1A 3TI0A 1X0PA 2OD6A 3IWXA 1D3WA 1S9FA 2EXUA 3AOCA 3H7HB 2IM0A 2C2OB 4NWBA 2RRAA 1YBTA 3I0RA 2OELA 4FVMA 5HQ8A 3M32A 3DLGA 4URSA 2P6SA 1X4GA 4B3RJ 3W2WB 4AT1B 3MPUB 1B0PA 4OZNA 2ZUGA 3MEKA 2E5IA 3L9ZA 3DN9A 1ZPVA 1JLGA 1YRUA 2CQBA 2YX7A 5AXLA 3TYTA 2MKYA 1RTHB 2GVDA 1FKPA 1TVRA 2Z8QA 2DYAA 1BE4A 2W9CB 4MT1A 3CDEA 1S9EB 2KXHA 3HFVA 5KG3A 3NNCA 1PBAA 3NGDA 4IRCA 4DV4J 1NB2A 4G1QA 5AXNA 2QA4G 1IBMJ 4GRSA 2GV1A 2FVPA 4JI3F 3HXMA 4NLTA 2I5JA 1FEHA 4J9OA 2IAJB 1FFWB 2R8JA 5ETLA 4NXMJ 1T9YA 4OJGA 4MFBA 3P5BP 1UPMB 1YGYA 1J27A 2DHHA 2KB2A 2U2FA 4ALZA 3AODA 4JI6J 4ED4A 1RSCA 3BJYA 1WOOA 4IOCQ 1M1GA 1RT2B 3A8IA 3KG0A 2ZBPA 4YY3F 2OI2A 2YNFB 1S1XB 4ZITA 5JXSA 3ULHA 3DOLB 2GIRA 1S12A 2CQ3A 4OMFG 2X3DA 3IAM9 5KFHA 2J0WA 3TUJC 5KFVA 1ZZFA 4A8SA 4GO7X 2EWHA 1AB8A 1RTDA 1KQFB 4CLYA 3QYYA 2JEGA 4DL0C 5KFQA 4RR5A 3M7VA 3FEZA 1L3VA 4ZVFA 4PWDB 2SXLA 4K59A 4PWWA 2XSJA 3LP2A 1BQNA 4PZVA 5E3PA 1FF2A 3M6XA 2W7OA 1WG1A 1UEVA 1JLFB 1RWWB 1SIZA 1NH7A 2BJDA 4HR2A 1V3SA 3GSIA 4NASA 1URRA 4F3OA 1TAQA 2ZDOA 4Q7AA 3PM9A 2VG5B 2F40A 1WG4A 3M6UA 4TU9A 3LPYA 3M9OB 1NKCA 2BV3A 3W2VB 2OEJA 1VRQC 4ZCKA 3G86A 3GMGA 4Y0FA 3AB2B 3EPIA 3PR4A 1VQKS 2Z2YB 5I3PA 3NKYA 1N5YA 1RHJB 4LT6A 1WORA 3NMAA 4Q0BB 2GO8A 3OTCA 5B08A 3VAMA 1X4DA 3VWSA 1VRUB 5EWGA 5CHCB 1NJXA 4M5HA 1VI7A 2OFGX 5B0EA 5J1EA 2F8EX 1AUDA 3BGRA 2YPYA 2W2QP 2RU3A 2AZ3A 2E1CA 1SC6A 3VR1A 5A8KB 4OZ1A 3OFGA 3FZBA 4I6YA 1F9FA 4HI2A 3N6LA 1CJTA 4CM0A 5H9FK 2DT9A 2HVDA 2BACA 1CS4B 2BRLA 3IP0A 4PKDB 2N4CA 3HM9A 1K8AT 5T7LA 2EBGA 1S1UB 5DG9A 5J2PB 5H9FJ 2H5EA 4UY85 3BZQA 4UW2A 4EMDA 2JLEA 1YRTA 1JLCA 3MEEA 3I0SA 2ZJQQ 3TOQA 3QO9A 2BA9A 3PNIA 1VQ9S 3FSIA 3QFWA 1RAEB 3RB0A 2R8GA 1OJ4A 7AT1B 3AXMA 1X4HA 1JB0C 3GR1A 4FP9A 1NB7A 1XMOF 1N0UA 2L9DA 2MKHA 4QWCA 1RT7A 1SJQA 1NCLA 2LQ5A 1IR1A 4B9VA 2JVOA 5A0YA 1LW0A 2VBZA 1UFLA 2CG4A 1YBUA 2RT3A 4YQWA 3KMSA 3THTA 2EEYA 1IR0A 2ZH8A 3H4DA 2GQ2A 3CTRA 1VQLS 2BJ7A 3DC2A 3MOJB 1JLQB 1AT1B 2D9OA 2VA2A 4M5IA 4CLFA 1C0TA 5LMUJ 3M8RA 4ZP6A 3J7A1 3CCZA 5HROA 3KUEA 3CF5Q 3KLIB 3DOMB 4U7UK 2ZE2B 2YNIB 3C46A 2DHGA 1RT5A 3HZEA 4M5MA 2MQQA 4UOCA 3G82B 1KQGB 4ED7A 3D9BA 1PAEX 2K06A 1AUSL 1RBOB 4ED1A 2DEJA 2XMVA 2CDQA 4FYWB 4DI6A 2CAJA 2P9CA 2MJNA 2EG1A 2GVZA 3FCHA 4U95A 3NBPB 3RGIA 1HWUA 1OSDA 2KRRA 1Z4UA 2V2QA 4ANDA 5FDLA 3OPKA 3FRYA 5IT0A 5EUHA 2LQJA 3FRZA 3OUYB 4C11B 1VDHA 5GADU 5HL7Q 1Y11A 1WC4A 1U7LA 3VGVA 1ZETA 3UN2A 4C2MA 1N32F 5IT9U 3SQGB 1V9OA 4RW7B 2EFVA 2ZC3A 1IWGA 2VFUA 4BBYA 4OX9J 4QPXA 3FGVA 1Y5LB 4X62J 2IJFA 2AF6A 5HLFB 4DQQA 4IR9A 1C1BB 1PSDA 3Q2TC 2GZOA 5DJBA 2XC9A 3E01B 3NS5A 5IV3A 1H2UX 3PW7A 4KT0C 3PHTA 3VAFA 2CQHA 3HDSA 5CYJA 1U49A 4MIAA 2GHPA 4JV0A 2B9XA 3NAIA 1XN9A 5E0OA 3QWUA 4ILRA 1NJYA 2AYMA 4DR3J 5GAGI 1TFWA 3HSDA 1R6VA 2VICA 1SCJB 2NXEA 1S57A 1U1KA 2QIFA 4JI2F 4JI8J 3H5XA 1T9VA 2V8DA 1HNIA 3CMQA 2WRMA 2DNHA 4TY9A 1P6TA 3L3CA 2PN6A 1GH8A 4LQ3A 5L46A 2OTLS 1VFJA 5F8LA 4R0JA 3Q8SB 4B3MJ 1MWYA 4JYAJ 2QYGA 3UDVA 2HPUA 4FKYA 5IS2A 2W2NP 4U96A 5C2CA 3M8QA 3IS9B 3KJVA 4ZA1A 3OL7A 1TL3B 2YKAA 1WHYA 1ACMB 4RBVA 5HVHA 3K59A 1IWAA 3N5FA
chains in the Genus database with same CATH topology
4B3SJ 4JV5J 4DR6J 4JI7J 4YY3J 4DV3J 1IBLJ 2F4VJ 3D3BJ 4NEZA 1XNQJ 5AJ3J 3R2CJ 5IWAJ 4LFCJ 3D3CJ 4NXNJ 4DR3J 4DV2J 4DUYJ 5BR8J 4YHHJ 4LF5J 4DUZJ 5FLXU 3J81U 1N34J 2E5LJ 4RJVA 4GKJJ 2ZM6J 2UXDJ 2UU9J 5LM7E 5A2QU 1XMOJ 1HNWJ 4PWWA 3T1HJ 2UXBJ 4JI8J 4K0KJ 1J5EJ 1FJGJ 5IT9U 4X66J 4DV4J 3J80U 4DV6J 1IBKJ 4KY3A 4HHUA 4JI2J 4KYZA 4LF9J 1N36J 1IBMJ 2UUBJ 4AQYJ 2MQ8A 3R2DJ 4JI5J 1N32J 3J7AN 4DR4J 4DV7J 4OX9J 4LFBJ 4JI1J 1HR0J 4LFAJ 4X62J 3OTOJ 2HHHJ 4NXMJ 4JI0J 5LMNJ 4LF8J 2UUCJ 1HNXJ 4JI3J 4LF6J 4LF4J 4NEYA 1I94J 4B3MJ 2MEWA 5LMUJ 2UXCJ 4JYAJ 4X64J 3T1YJ 3IMQJ 1HNZJ 4DR2J 4KHPJ 4B3TJ 4DV1J 4DV0J 4DV5J 4JI6J 4JI4J 3JAMU 1XMQJ 4DR7J 2KVQE 1XNRJ 2MTLA 4DR5J 4LF7J 4X65J 4GKKJ 2VQEJ 3W1YC 2KL8A 4B3RJ 1N33J 2UUAJ 4DR1J 4V1Ak 2VQFJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S J;  4JV5 J;  4DR6 J;  4JI7 J;  4YY3 J;  4DV3 J;  1IBL J;  2F4V J;  3D3B J;  4NEZ A;  1XNQ J;  5AJ3 J;  3R2C J;  5IWA J;  4LFC J;  3D3C J;  4NXN J;  4DR3 J;  4DV2 J;  4DUY J;  5BR8 J;  4YHH J;  4LF5 J;  4DUZ J;  5FLX U;  3J81 U;  1N34 J;  2E5L J;  4RJV A;  4GKJ J;  2ZM6 J;  2UXD J;  2UU9 J;  5LM7 E;  5A2Q U;  1XMO J;  1HNW J;  4PWW A;  3T1H J;  2UXB J;  4JI8 J;  4K0K J;  1J5E J;  1FJG J;  5IT9 U;  4X66 J;  4DV4 J;  3J80 U;  4DV6 J;  1IBK J;  4KY3 A;  4HHU A;  4JI2 J;  4KYZ A;  4LF9 J;  1N36 J;  1IBM J;  2UUB J;  4AQY J;  2MQ8 A;  3R2D J;  4JI5 J;  1N32 J;  3J7A N;  4DR4 J;  4DV7 J;  4OX9 J;  4LFB J;  4JI1 J;  1HR0 J;  4LFA J;  4X62 J;  3OTO J;  2HHH J;  4NXM J;  4JI0 J;  5LMN J;  4LF8 J;  2UUC J;  1HNX J;  4JI3 J;  4LF6 J;  4LF4 J;  4NEY A;  1I94 J;  4B3M J;  2MEW A;  5LMU J;  2UXC J;  4JYA J;  4X64 J;  3T1Y J;  3IMQ J;  1HNZ J;  4DR2 J;  4KHP J;  4B3T J;  4DV1 J;  4DV0 J;  4DV5 J;  4JI6 J;  4JI4 J;  3JAM U;  1XMQ J;  4DR7 J;  2KVQ E;  1XNR J;  2MTL A;  4DR5 J;  4LF7 J;  4X65 J;  4GKK J;  2VQE J;  3W1Y C;  2KL8 A;  4B3R J;  1N33 J;  2UUA J;  4DR1 J;  4V1A k;  2VQF J; 
#chains in the Genus database with same CATH topology
 3U02 A;  3DOK A;  3RJM B;  4EGL A;  3F73 A;  4K8R A;  3MM9 B;  2JSX A;  2XY5 A;  2G4B A;  2LXI A;  3PO5 A;  2OAU A;  2LMI A;  2FHK A;  4ZCI A;  5K8N A;  2E66 A;  4KFB A;  4CIO A;  5KG4 A;  4DPU A;  2B5J B;  4H4M B;  1DAR A;  2X1G A;  5F8H A;  3Q83 A;  3PKM A;  5DQI A;  1X7V A;  3NY0 A;  2NYI A;  2JH3 A;  2M70 A;  3V2U C;  3TR5 A;  4Y2K A;  1YI2 S;  1L3U A;  3Q86 A;  4OYZ A;  5FII A;  1NSA A;  3DMJ A;  2DGV A;  3AAW B;  2MKI A;  4ZVE A;  4KH0 B;  5KT6 A;  3SCK E;  1A0O B;  1G7C B;  3PW0 A;  3KLF B;  5THW A;  3D66 A;  4I2P B;  3CCW A;  1N6Q A;  1ZM4 A;  4TQR A;  4B3R F;  5L1I A;  1XR6 A;  3D5M A;  3RRK A;  2WW4 A;  3TUZ C;  5J2Q A;  3QJJ A;  5KFZ A;  2XTJ P;  4GKK J;  2HZC A;  3M8Y A;  4ATN A;  2E5H A;  3KLG B;  1RT3 B;  2ROG A;  2BAB A;  1J2V A;  1HBO A;  3DLK B;  1IKX A;  3SCI E;  3CCL S;  3M9N B;  4F0H A;  2KYX A;  3QZ8 A;  2FTR A;  3DLJ A;  2YKM B;  4DV4 F;  2PA8 D;  4DLE A;  2ZDP A;  3AD7 C;  5BJR A;  3IC1 A;  3I87 A;  1SV5 B;  1S10 A;  1IBM F;  2FJW A;  2HNY B;  3BH6 B;  4DPO A;  5A8W A;  4NXM F;  4RUA A;  3CD7 A;  2CNL B;  2DCL A;  3A8K A;  3M8W A;  2ZZT A;  2DNZ A;  2GNK A;  3P8B B;  5KFF A;  3DHW C;  4J9U E;  4JI6 F;  2CG8 A;  2YNG A;  2BX6 A;  1DQA A;  2C42 A;  4B3T J;  3J80 Y;  3VAG A;  2BJ8 A;  3BSA A;  3HZG A;  3TNV A;  3MR3 A;  1HQE B;  2FZG B;  1IN0 A;  1ARO P;  1E6Y A;  4NLQ A;  2M7S A;  3B4D A;  3BSN A;  2UUA J;  2MMY A;  3BF4 A;  1LQ9 A;  5G0R B;  4B9L A;  1UVI A;  3AOB A;  2AP6 A;  2DNG A;  4PCQ A;  4OIX A;  1XEZ A;  3DYA B;  3CJS A;  3F0N A;  5HP1 B;  1CUL A;  2J8S A;  2ZH6 A;  2J7K A;  4A8K A;  1VQN S;  3VAL A;  3C15 A;  2RUG A;  2BE9 B;  3P45 B;  3D4J A;  1EAR A;  3DRS A;  1Z1Z A;  4KGX B;  2FLN A;  2FQQ B;  4F04 B;  3OL9 A;  1S49 A;  3CJK B;  2Z0G A;  3GFX A;  3C16 A;  1KRP A;  5D0H A;  2R7T A;  1OMS A;  4ITS A;  2HHH J;  2GA7 A;  2QSW A;  4RBT A;  2VPX B;  1VRT A;  3KJQ B;  4FZV A;  2AU0 A;  3MZI A;  4Z37 A;  3WX4 A;  4Y65 A;  1HL6 A;  1QAY A;  5J1N A;  5J2M A;  3AT1 B;  3P6Y C;  3CDU A;  3DM2 B;  2KL8 A;  3ZZZ A;  3CCS S;  2CQ1 A;  2A10 A;  2OGU A;  1B4S A;  2VFS A;  5CYQ A;  2ZH2 A;  1SKU B;  1HMV A;  2WK4 A;  1S1W B;  3MM8 B;  2RD5 C;  2C2D A;  3PY8 A;  4O44 A;  1NK7 A;  2W2P P;  4I56 A;  3DLH A;  5B0C A;  2QLF B;  1HPZ A;  1UWB A;  4LQ9 A;  1FX4 A;  2XI2 A;  1GT8 A;  3MAQ A;  3HHL B;  1WC6 A;  4KYZ A;  2COL A;  4F25 A;  4RW8 A;  5CZX A;  5ETS A;  5B0A A;  2ZH4 A;  5HK4 A;  2B4P A;  3D28 A;  3HX9 A;  2QRR A;  5A2Q Y;  3OBI A;  1YX2 A;  2RJZ A;  1SIW B;  1TKX A;  2F1F A;  1B99 A;  3HVW A;  3R7B B;  4P75 A;  4DV5 J;  2X1A A;  3L95 X;  3AHP A;  1WAC A;  3TUI C;  2W4D A;  2BW2 A;  1IUJ A;  2AJ2 A;  5KFE A;  1Q1K A;  4UZB A;  2QMX A;  2VQE J;  3H2L A;  2VD3 A;  2HVI A;  2QL5 B;  4DZ6 A;  2V4R A;  1WKK A;  3PW4 A;  5I4M A;  2Z2L A;  2JVR A;  4I67 A;  4IRK A;  4LR8 A;  2E7X A;  4Z7Y A;  1ZPW X;  1U25 A;  2RDI A;  2YWH A;  1SC4 B;  4RW4 B;  3EGW B;  4JI0 F;  5C7P A;  4YB1 P;  1LW2 B;  3J81 U;  1TZ0 A;  1RB0 A;  3FVY A;  2WVC A;  3EZO A;  5J2N A;  2HS4 A;  1WC5 A;  2WOM A;  1T03 B;  2ZBQ A;  4QU7 A;  1JIH A;  5CA5 A;  2ZJR Q;  1QSL A;  4X66 J;  1NEE A;  3TQ1 A;  4RPF A;  2ALY B;  3W60 A;  3ET6 A;  5GAE U;  2EW9 A;  1LNQ A;  5LMU F;  4PR6 A;  2RF2 A;  1CG2 A;  3LAL A;  2OUG A;  2DGO A;  2BM1 A;  1KLN A;  2YQ0 A;  2E29 A;  1QVG R;  1RTI B;  6AT1 B;  2PI5 A;  2VOD A;  4UOG A;  2RIJ A;  4DXL A;  4ER8 A;  2NYH A;  2J6U A;  5CAA A;  1T05 A;  3WC0 A;  4WF9 Q;  1C4A A;  5KT4 A;  2UVV A;  2FY1 A;  4UQG A;  3OJU A;  4AFF A;  2HFN A;  3O5T B;  1MU2 B;  2BR0 A;  2ZOF A;  1IQZ A;  1NME B;  4DN9 A;  2ZZN A;  3HP6 A;  4FPR A;  2LA4 A;  1KLM B;  4PXD A;  4L6V 3;  4H4K A;  1IKW B;  3THV A;  1F60 B;  4CQ1 A;  1X4C A;  3DGP B;  4RW6 B;  4W98 A;  5C25 B;  4C8Z A;  1SQF A;  4HYK A;  2L48 A;  3MD3 A;  3E51 A;  3U7J A;  4QJV A;  4OI1 A;  2FJA B;  4FBU A;  4TY8 A;  1EX8 A;  2XZT B;  2MQP A;  1T9W A;  4OX9 F;  1BMQ B;  1N5S A;  2HHP A;  4X62 F;  2O1P A;  1X0F A;  1ZA1 B;  2J0S D;  1RGV A;  2MZJ A;  3HMJ G;  4CP5 A;  4CDI A;  1Q79 A;  3H5Y A;  1PJ6 A;  4ETX A;  4ZKA A;  1JLA A;  4AYB D;  2E9Z A;  3RW7 A;  3HCX A;  4TNO A;  4F4Z A;  1R8H A;  3MM6 B;  3UN3 A;  1IM4 A;  4C3L A;  4CTA A;  1MN9 A;  3Q0A A;  2AJ1 A;  3PCO B;  4OLP A;  2F4F A;  2BEF A;  3SCL E;  2KXN B;  1YG0 A;  3PAC A;  4ZPW R;  3EGV A;  4P73 A;  4DR3 F;  4TQS A;  3SSS A;  4ZK7 M;  3M8P B;  4EBE A;  2FUG 9;  4FYY B;  4PG5 A;  1TL7 B;  3CSK A;  3ZZT A;  1UMJ A;  1I6J A;  4NZ0 A;  2DXD A;  1KD1 T;  4WP8 A;  4DUZ J;  4QIF A;  4L76 A;  4JI8 F;  2FHJ D;  4PAA A;  3JXO A;  3UQS A;  3OXF A;  2C2N A;  1S5Z A;  3ZZP A;  1ZAW A;  1WD6 A;  3OVS A;  3DFE A;  3R7S B;  3CJR A;  2DR6 A;  4B3M F;  3TRG A;  3GV7 B;  4HTI A;  2A6O A;  3CJ2 A;  4JYA F;  4TXS A;  4PPZ A;  1KKH A;  3NL0 A;  2Q3P A;  1FJE B;  4DQR A;  1T02 A;  4F4A A;  1XNQ F;  2WBM A;  4LRA A;  1L3K A;  2BDP A;  4HEA 9;  2XO6 A;  3HKZ D;  5IT4 A;  4IOB A;  3AJ2 A;  4HAC A;  4W90 B;  2DNY A;  2CZ4 A;  1XMB A;  2CJQ A;  1DLO B;  2MQN A;  3VGS A;  4J9V A;  5KG1 A;  2XHC A;  4PUO A;  2HQI A;  1M5V C;  1JJ2 R;  4DV3 J;  4AUK A;  3PR5 B;  1J5O B;  1UL3 A;  4DS4 A;  4PQU B;  3PKY A;  1KVI A;  4YDD B;  3C6T B;  3M2R B;  4OI2 A;  4PAB A;  2R8I A;  5B0D A;  1VC5 A;  3M2V A;  4ZPC A;  2IA6 A;  4J91 A;  5DGB A;  3CCQ S;  4OI4 A;  1TL1 A;  2YVS A;  3OR2 B;  3ZTQ A;  1TFY A;  1Q8K A;  3VTI A;  3KLV A;  4HHU A;  4OZ5 A;  3D67 A;  4NL5 A;  2OPQ A;  2JRS A;  5D4P A;  5HVF A;  3MM5 B;  1YIJ S;  2XMW A;  1RYS A;  1SVD A;  3CJ3 A;  3TP2 A;  3AOA A;  4DL5 A;  2PGC A;  4GKK F;  2HHX A;  3AFG A;  2FC9 A;  1W7W A;  2XLI A;  3W8G A;  3DXB A;  3L7P A;  2HWT A;  2YWF A;  3PV8 A;  4DPY A;  2HHU A;  1OY8 A;  3NGU A;  4F2R A;  3DRP A;  3IRX B;  4CCH A;  2MST A;  3V6K A;  3L7U A;  1MMD A;  1X4E A;  1B0T A;  4O4R A;  3HF5 A;  2VG7 B;  2A0F B;  5EX3 A;  4PXE A;  5L9N A;  2CWK A;  1TK8 A;  1EB0 A;  2DCU B;  2B8P A;  3FK4 A;  4QIE A;  4WTO B;  5M2U A;  4CYU B;  2QN6 B;  1F5C A;  5K8P A;  4DV0 F;  3TZW A;  3CCE S;  1K44 A;  5HAO A;  4LJM A;  5AXM A;  2CQ4 A;  2BAN A;  4NLP A;  2LKZ A;  3H5S A;  4B3T F;  4CI0 B;  4FDF A;  1PBU A;  2XCA A;  3TZY A;  2MLZ A;  2DR5 A;  1NPP A;  1NZ8 A;  3OHA A;  2PA3 A;  3T5K A;  2UUA F;  4L3N A;  4ZJO A;  4C98 A;  4DR7 J;  1QM9 A;  2NLW A;  1S7I A;  1W2I A;  2CAD A;  1U2C A;  3ITH B;  3FSX A;  3EWG A;  3N01 A;  2R2T A;  2QFJ A;  2WSF C;  1SUQ B;  2WTF A;  3RAQ A;  2HVH A;  2NRE A;  4MYU A;  1Q78 A;  3MAA A;  2EKY A;  2F9D A;  4HKQ A;  4GVL A;  1YZ7 A;  2Y8Y A;  1QAI A;  1KTQ A;  1RAC B;  4U6P A;  1NJI T;  5IM0 B;  3X3U A;  1HNZ F;  3TJ8 A;  5E7O B;  2CQC A;  2Q66 A;  1VQ6 S;  5B0F A;  1JLE A;  1E6V A;  1LV5 A;  1PG5 B;  1YJ7 A;  4IG0 A;  5AT1 B;  3DU5 A;  2KM8 B;  2I0X A;  1R8C A;  2HHH F;  1R43 A;  1RT1 B;  4DLG A;  1CJK A;  2XY7 A;  1K0V A;  1N0V C;  1FRM A;  1P1L A;  1HFE L;  4Z2X A;  2MZQ A;  1EP4 A;  5IQ6 A;  4CH7 A;  3RBD A;  2IFX A;  3V5R A;  3ENQ A;  1K0T A;  3DDK A;  3JTN A;  1HHS A;  1UVK A;  4ZS6 A;  1VIO A;  2M4M A;  3OFF A;  2Y9H A;  3M2U B;  2GIQ A;  4WFY A;  3SFG A;  2VL1 A;  1FA0 A;  1NK5 A;  2AZ1 A;  4Y6I A;  2V34 A;  2K3I A;  3RR7 A;  2ZVS A;  2CZ9 A;  1WC3 A;  2Q6C A;  1CPZ A;  3LGM A;  4USM A;  3EDQ B;  2NS1 B;  2FZC B;  1HQU B;  3G6E S;  1G3O A;  2ZHB A;  3T9Z A;  2NR0 A;  4WK3 A;  2AWZ A;  1ZBT A;  1D09 B;  5BYQ A;  1X31 C;  3HVT A;  1KVJ A;  2ABY A;  1S6U A;  4ZVO B;  2BXJ A;  5KFY A;  3KHH A;  4DPT A;  5LM7 E;  2FHO B;  3SV4 A;  4M5D A;  4RWW A;  5K8O A;  1X4A A;  3J80 U;  3DNC A;  4U7U D;  4RNN A;  1GEH A;  2HHS A;  4C8N A;  3QWP A;  1X5S A;  2KKH A;  2VC1 A;  3TEH B;  1N56 A;  1EIY B;  1OO0 B;  2FJB B;  4DV5 F;  2IC3 A;  2UXC J;  1HIY A;  4DQI A;  4KPC A;  4F0M A;  1UA0 A;  1OPI A;  3FFI A;  3MR5 A;  3JYT B;  2PFD A;  2VQE F;  1FES A;  2V8G A;  2N7Y A;  4OZL A;  5ETP A;  3EGZ A;  1TUG B;  1SH0 A;  5F0W A;  2AT1 B;  5KFS A;  1GMW A;  2HQG A;  4X4Q A;  4I2Q A;  3WC2 A;  2AYG A;  2KT3 A;  2MGZ B;  4GVB A;  5BXI A;  1U2R A;  2IVM A;  2CPJ A;  1CBK A;  4XIU A;  4DX7 A;  5GVQ A;  1LWX A;  5K14 A;  4RBU A;  1IJF B;  3PX4 A;  3QAT A;  4BWJ A;  1EZZ B;  1KOO A;  2XZW A;  2G0C A;  3KNG A;  1Z2L A;  1SC1 B;  1BHN A;  2EK1 A;  4PG7 A;  2JHE A;  2VUG A;  1WI8 A;  1S6O A;  1H3D A;  3MED A;  3OFE A;  5LOQ A;  2BRK A;  1MMN A;  2WZ1 A;  4I7F A;  3TX8 A;  1UCN A;  1SL0 A;  4Y00 A;  1IJE B;  2Y1R I;  4Y34 A;  5MAO A;  3RB4 A;  1U0S A;  5U47 A;  4OYX A;  3J7A N;  2F8M A;  4EZ6 A;  1G1X A;  4NCG B;  2JNJ A;  2PDA A;  5LXR A;  2F63 A;  3GSD A;  3EJM A;  5JVH Q;  2ZOG A;  1JKH B;  3KFW X;  1HBN B;  2AQ4 A;  3KK3 B;  3OR1 A;  1ZM3 A;  4JI4 J;  4LVN P;  5F9L A;  1QSY A;  1YLX A;  1RTJ B;  2HQF A;  2DBB A;  2W9B B;  4E98 A;  2VKZ G;  4KKO B;  1DZ5 A;  2IM1 A;  5I3Q A;  1FER A;  2RVJ A;  1B7F A;  2HFZ A;  4HL9 A;  2XMA A;  1FFS B;  1X9W A;  4R0E A;  2RQC A;  2DR7 A;  4X4N A;  2VU5 A;  2HBZ B;  4QR1 A;  3CPW R;  2AX1 A;  2QSF A;  4WJB A;  2BQR A;  2R8H A;  4F3M A;  5I3U A;  4OV1 A;  2OPR A;  2FHM A;  1FDA A;  3D0I E;  3V6D A;  5A2Q U;  2CQ2 A;  5C5J A;  2C2M B;  3IG1 A;  3A4T A;  4CO5 A;  2HND A;  1S1V B;  2CDR B;  4EK2 A;  4F50 A;  5CXT A;  1FNM A;  3QLH B;  4FS2 A;  4CNY A;  1HD0 A;  1FXR A;  2RIL A;  2MEW A;  3BGL A;  4WFZ A;  2R8K A;  4OQJ A;  3RTV A;  2CPY A;  1ZH5 A;  1XNR J;  1QE1 B;  1T0T V;  2GJ2 A;  4I1T A;  3BQ1 A;  2DRA A;  3R9L A;  1S4E A;  2R2U A;  3HHL C;  1CC7 A;  4OI3 A;  3R6L B;  4NZ7 A;  4C8O A;  3NNA A;  5JMN A;  3KHL A;  3QID A;  4DUZ F;  1UJ6 A;  2B9Y A;  2ZBR A;  3VV2 B;  2HQD A;  2ZOM A;  1MWQ A;  1NSK L;  4C8K A;  1XR5 A;  3VAK A;  2HFO A;  3UVJ B;  1KP6 A;  2YTC A;  2YKN A;  7FDR A;  4X4U A;  2MJU A;  1Y0H A;  1YZ6 A;  1SKS A;  4NX9 A;  1OYE A;  4DSE A;  3K5N A;  4CLZ A;  3JQM A;  4DR4 J;  4P52 A;  2ZD1 B;  3O3L A;  3MM7 B;  3OTO J;  4C0B A;  4QWD A;  1NRK A;  4ED8 A;  3IM8 A;  3A8J A;  4NYZ A;  1XR7 A;  2XY6 A;  3SCJ E;  1T9T A;  3KJN B;  1R6Y A;  1NZA A;  3MPV A;  3CJ8 A;  1HNV B;  4DX5 A;  2XBP A;  1T11 A;  3T19 A;  3QIP B;  4ED0 A;  3HK2 A;  4DV3 F;  4P71 A;  3WIU A;  1C1C A;  3NRB A;  4MK7 A;  2KTQ A;  3MDF A;  5KG6 A;  1ZAV A;  1O51 A;  3I5A A;  1U4B A;  3H2U B;  1WEZ A;  2DJW A;  1I3O B;  1URN A;  1VHI A;  5F8M A;  4NRU A;  1YWX A;  3D6T B;  1UFK A;  2HFU A;  1AA1 B;  3PHE A;  1NKB A;  2W25 A;  3C14 B;  3KK2 B;  2E1P A;  1U6Z A;  5CZV A;  2NSC A;  4B17 A;  2F8H A;  4NLO A;  5I42 B;  3T5L A;  4FF3 A;  1SKR A;  5KFI A;  1F9H A;  2DR8 A;  2JEJ A;  5HJY A;  4YFU A;  1OS5 A;  2YNH B;  3JSM B;  4NLS A;  1XQI A;  2IMO A;  3TEG A;  1RAJ A;  4B08 A;  3AQP A;  4NLD A;  4YN3 B;  5GAH I;  3FDS A;  4IFY B;  2MKK A;  3EMT A;  1N33 J;  1BY9 A;  4ED2 A;  1A9N B;  1U0H B;  2GMH A;  1XER A;  3IR6 B;  1TKZ B;  1AW0 A;  4J9M A;  4AL7 A;  3I82 A;  3K8W A;  4IO1 A;  1M90 T;  3RG6 A;  3LAM A;  4O4G B;  4DBQ A;  2V4J B;  1VJQ A;  2N3O A;  3BR9 A;  3MCS A;  3TZZ A;  2RHQ B;  1KS2 A;  1RU2 A;  3LP1 A;  3DGV A;  2CQP A;  4G65 A;  2CXE A;  2J6T A;  1FJG J;  1HBU A;  4EYI B;  3W5Z A;  3IXQ A;  2C3P A;  3Q22 A;  2BOP A;  1F5B A;  3F56 A;  4NI2 A;  2JZ5 A;  3C6U B;  1H7X A;  1N52 B;  1L5U A;  4WU2 A;  2RU9 A;  4ICL B;  3HJV A;  3OV7 A;  1Y10 A;  3OHB A;  1TMM A;  4DJB A;  2G1D A;  2ALZ A;  2VOO A;  1JXV A;  3JS9 A;  4DR7 F;  1MML A;  3OD2 A;  1GXL A;  3MMC B;  3BPS P;  3VQT A;  4RW9 A;  1JJC B;  3HSJ A;  4J9S A;  3MMA A;  4X4O A;  4WP9 A;  4ZIW A;  4ECU A;  2H48 B;  2MQM A;  4IQM A;  2H54 B;  4Y28 C;  5A8R A;  4OJ1 A;  3PO4 A;  3ILO A;  2B4O A;  1D8Y A;  2V67 A;  2HRU A;  4LMZ A;  2JDJ A;  2RS8 A;  2BJ9 A;  4ZIV A;  2DRB A;  4WFN Q;  4K4V A;  1IKV B;  4R5P B;  2G2Y A;  2QT7 A;  2X51 A;  1UZH A;  5IT9 Y;  2IPO B;  3LWM A;  1FFG B;  2Z4P A;  3UFC X;  1LWC B;  4CO3 A;  1NDL A;  2CPZ A;  4N8N A;  3CCJ S;  1R8A A;  4JP8 A;  4PXB A;  3N5B A;  3TVY A;  4G6V B;  4TKT A;  4A8O A;  4CRJ A;  2CIM A;  1DQ8 A;  3B4M A;  1UVL A;  2FDN A;  1X5T A;  2LEP A;  4X65 J;  4DFM A;  3ILJ A;  2WVE A;  3M05 A;  1Y3J A;  1GMV A;  4FNH A;  3OLA A;  1I51 B;  4DCJ B;  3L09 A;  4A48 A;  4ID8 A;  3POT A;  3B54 A;  3DLE B;  4NRT A;  2XMK A;  5C24 A;  1U1N A;  3MHY A;  1DAX A;  2AKW B;  1WG5 A;  4KR0 B;  3ENA A;  2N3L A;  2OPP B;  2WON B;  2HIY A;  3E3X A;  4C4W A;  4N5S A;  4C6A A;  4EWT A;  2QLB B;  2UU9 J;  3QPI A;  2R7U A;  3AA8 A;  1WEY A;  3DDI A;  5EN1 A;  3MTJ A;  1VQ4 S;  4IUF A;  2VV5 A;  2B8Q A;  3P96 A;  1CC8 A;  1HHT P;  4Q45 A;  3ZZ0 A;  9RUB A;  2R3V A;  3ZZO A;  2JEI A;  4F7V A;  2UXC F;  3ZZY A;  1FWL A;  1K1Q A;  4WIQ A;  3OTB A;  1HNX J;  4LF4 J;  1C0U A;  1VYA A;  4YB7 A;  4X64 J;  4MJK A;  4N56 A;  2D3O 1;  5GAG U;  1U1P A;  2ROE A;  1I1G A;  2HLT A;  1KQS R;  3MTK A;  2WSC C;  3PJ9 A;  1LWF B;  1OQ6 A;  2LEB A;  4OX7 A;  2DGX A;  5CYM B;  2H3E B;  2ZFH A;  2BW7 A;  3QGP A;  1C2P A;  2YWE A;  4DR1 J;  1IKY A;  2GO9 A;  3HT0 A;  4ZHR B;  2NUH A;  4Q8E A;  1HAR A;  2QO3 A;  2I9S A;  2JLF A;  4PXC A;  2IDE A;  4CH1 A;  3I5C A;  3D3C J;  4TLR A;  4NXN J;  3CT9 A;  5IOL A;  3J7Z 5;  4C8L A;  2HVE A;  3IFE A;  4DQP A;  3VZI A;  4QWE A;  3VF0 B;  2WAQ D;  2DEI A;  2MHE A;  3JQK A;  2ZH9 A;  5E3A A;  4ZVG A;  4DX6 A;  2KVI A;  5KFA A;  3IBW A;  4Q8F A;  4IDK B;  3OSN A;  2VA3 A;  3QRR A;  2V0N A;  3IN5 A;  2CQD A;  4OX6 A;  4JI4 F;  3WX8 A;  4QW8 A;  2FVC A;  2CWX A;  5DZ7 A;  2H9Z A;  3K5L A;  5F8I A;  1R0A B;  2CPI A;  3SEO A;  1VJW A;  2KI2 A;  2OPS B;  4UT4 A;  3KK1 B;  4KV8 B;  4LSN B;  3B8H A;  2LEC A;  2K1R B;  1T3O A;  4G1I A;  3GFZ A;  4XAK A;  1TKT A;  2J9C A;  2W7A A;  4HT7 A;  1RT4 B;  4HLB A;  2ASY A;  3MEG A;  2YWW A;  2UUB F;  3P5T L;  2D1C A;  4KQZ A;  1ZM2 A;  4S0M A;  4DUY J;  3IM9 A;  4IQX A;  3GYN A;  2MSS A;  4GKJ J;  3OXL A;  1K9M T;  1K47 A;  2AJ0 A;  4QIG A;  3GU0 A;  1GMU A;  2LXU A;  3H4B A;  2F9J A;  2W2O P;  2OKQ A;  3U1M A;  3MUM P;  4G3I A;  1WC1 A;  4ZPB A;  4Y2I A;  2GGP A;  1MSW D;  1SJR A;  1O5J A;  2W7P A;  3L7O A;  3QT8 A;  4LSL B;  5DGA A;  2MZT A;  2VDI A;  1TK5 A;  1XNR F;  2NXU A;  3KXD A;  3LGN A;  1GAO A;  2HNZ B;  4L3K A;  1XBW A;  4ED6 A;  1ZM9 A;  4DSL A;  1PC5 A;  5EGY A;  3OSP A;  3CWJ A;  1REG X;  4PYD A;  1QY7 A;  5CD4 A;  4ZLN A;  1H98 A;  2DR9 A;  3R2C J;  3EXY A;  5L1K A;  3RBZ A;  2P9E A;  2ZEJ A;  3TWZ A;  1YHQ S;  4CT8 A;  4DV2 J;  3EM1 A;  2BE2 A;  1CJV B;  4NA1 A;  1RWK B;  3ZTP A;  4F0K A;  4I0W A;  4DR4 F;  4ZP9 A;  1BWE A;  1FVQ A;  2ZKT A;  3WZ0 A;  4O23 A;  4B9M A;  1X5O A;  2JFD A;  2PFF B;  5SUH A;  1F3F A;  3OLB A;  5KOW A;  2DVI A;  2DIT A;  1XIQ A;  4R8U B;  2UVU A;  3UDL A;  1YIT S;  2VBW A;  3CJ4 A;  1QDU B;  3SDE A;  5KFW A;  3MEC A;  5DLF A;  2A2D A;  2V2Z A;  2QJ3 A;  1SC3 B;  4ETZ A;  4A8F A;  1B70 B;  4KB7 A;  4MTP A;  4ZCL A;  2LP4 A;  2MQL A;  1Q8L A;  2V4Q A;  3AY0 A;  4NA3 A;  4IG3 B;  5L38 A;  4V1A k;  4CLW A;  5JUM A;  5KFG A;  2HG4 A;  1Y9O A;  3H5U A;  1S0M A;  4B3O B;  2YQ3 A;  2MY8 A;  1AZS A;  5HBM B;  5KFN A;  3KLE B;  5C42 B;  2DNL A;  3KLH A;  2VFT A;  3OXG A;  4LBI A;  4WYW A;  4QW9 A;  3AD9 C;  4K0K J;  5KG2 A;  1HYS A;  4DN0 A;  2IVY A;  1QVF R;  4YB5 A;  3NGR A;  3MXH P;  2RNE A;  5EDW A;  3I32 A;  1RYR A;  3SFU A;  5BYR A;  2XWY A;  1W2B R;  2LQ8 A;  2MHN A;  3VZH A;  4JI1 J;  2EVZ A;  1P8G A;  3TW0 A;  6FDR A;  2OMO A;  1REV B;  2VG6 B;  3UCU P;  2IRU A;  3CD5 A;  2O3D A;  3DHX A;  3M1V A;  4EO8 A;  4NEY A;  1T8E A;  3BO4 A;  1FT8 A;  4OYO A;  4MKB A;  3PW2 A;  4K7Q A;  4ECV A;  2GAG C;  1N33 F;  4WE1 A;  1S9G B;  2Q43 A;  2OTJ S;  2B6A A;  3TZX A;  2VH7 A;  2H5I B;  3HJF A;  1GK8 A;  3DRR B;  3K2Y A;  4YS2 A;  3HVR A;  2ZNY A;  3QSY B;  2KXF A;  1JLB B;  4ECW A;  2FJE B;  1MRO B;  4M1K A;  3UNY A;  1FDD A;  3SQO P;  3TAM B;  1N48 A;  4ECS A;  1Y00 A;  3FKB A;  4O3O A;  3RBX A;  1IQT A;  4HTJ A;  5BR8 J;  2HZA A;  2JC0 A;  3J7Y I;  1DTQ A;  2WVB A;  3J81 Y;  2YKP A;  4L75 A;  2F7V A;  1JX4 A;  3FMW A;  4C0H A;  2AJQ A;  2FLP A;  2HYI B;  4LF1 A;  3EYZ A;  3FBC A;  4K2X A;  2EC0 A;  1QTN B;  2OP5 A;  3MMB B;  4WFX A;  2HKE A;  2V8P A;  4ZVU B;  1DTT B;  3BRE A;  4KJI A;  1WWH A;  4OJ3 A;  4USK A;  2MDA A;  3GIR A;  2BJ3 A;  3PIP Q;  3S1T A;  1BWV A;  3HUL A;  3CJ0 A;  2IJN A;  3V81 B;  1FRI A;  2C28 A;  1LK5 A;  1HD1 A;  3D1Q A;  5GMK a;  2EC2 A;  1RT6 A;  3R1H A;  2K7J A;  2UP1 A;  2DGW A;  1YJ9 S;  1YVF A;  1HBM B;  4CLU A;  3BO2 A;  4BWM A;  5IQQ A;  3T1A A;  5EX0 A;  2FGO A;  2D9P A;  3K57 A;  4ECT A;  2RKI A;  3N0V A;  4ID5 B;  1S7H A;  2WCX A;  1CQN A;  2XHW A;  2P2C B;  5IC4 B;  4U9R A;  3W66 A;  2CJA A;  5LT5 A;  3T9N A;  1I94 F;  3M30 A;  4F26 A;  3RAX A;  3I4P A;  3M9M B;  4O3Q A;  1HWK A;  1NKE A;  4RZR A;  4J7C A;  4OJH A;  4J90 A;  5KFD A;  3CDA A;  4LRF A;  4DG1 B;  4LBP A;  1V6H A;  1MN7 A;  4P7T A;  2XCP A;  4M5G A;  1VBK A;  4A4J A;  3B82 A;  1UWA A;  4ZJQ A;  1R0B G;  3TJ9 A;  4X65 F;  4ECZ A;  3IO1 A;  3W3S A;  4M5K A;  8ATC B;  2VC0 A;  3RU0 A;  2DH7 A;  4PWU A;  3I0R B;  2WB4 A;  3M32 B;  4OZ2 A;  3DLG B;  3TJA A;  4DOZ A;  1VCT A;  1U2F A;  3NOC A;  3TAN A;  3R7N B;  3P49 B;  2W01 A;  1JLG B;  3OFH A;  3JAM Y;  4KGM A;  3M6V A;  2UU9 F;  1HHQ A;  1IVZ A;  1HWJ A;  1QUP A;  2XS7 A;  2GVD B;  1FKP B;  1TVR B;  4OYB A;  2BYC A;  4WWS A;  2ZJP Q;  2Q79 A;  2OD4 A;  1J5E J;  4IFV A;  4EEY A;  3S8S A;  2Q6B A;  1WEX A;  1Q53 A;  3IWL A;  4AQY J;  1HNX F;  4LF4 F;  4G1Q B;  4X64 F;  3FEX B;  2ZH1 A;  1S6Q A;  4WKR A;  1TV6 A;  2I5J B;  1APS A;  3MCM A;  1LWE A;  3RAM A;  4MFB B;  3GV5 B;  3ZXW A;  5CD4 H;  3DI6 A;  4DR1 F;  2DGQ A;  1RWU A;  3JB9 k;  1YJN S;  4J9N A;  3UDE A;  4FYD A;  5LSO A;  3UCZ P;  3RBE A;  4DU7 A;  1RAF B;  4NPO A;  1N5V A;  4QU6 A;  1X4F A;  4OI6 A;  4XDD A;  1RAH B;  4NXN F;  3VCD A;  2PE8 A;  5FJ4 A;  1RAO A;  4X4S A;  4ECX A;  2IJR A;  2XGQ A;  3CCM S;  2RH3 A;  2J7U A;  3KJF B;  1GTH A;  1RHR B;  5CCM A;  1DFD A;  1BC6 A;  1HI0 P;  1VLY A;  4OHV A;  1RTD B;  4FXW A;  1PCA A;  3H2V E;  3CED A;  2KZM A;  5A76 A;  3GYX B;  3LP0 A;  2J9D E;  2HZV A;  2NPI A;  2B7C B;  4H4O A;  1S1T A;  2QLW A;  3GON A;  2DD8 S;  2XSJ B;  1BQM A;  2CA9 A;  1WHW A;  3HFK A;  3LP2 B;  4HHH A;  5D78 A;  1BQN B;  3G96 A;  1QD1 A;  4UOH A;  3V4I A;  3Q8U A;  2LDI A;  3NG8 A;  3HT3 A;  2W4C A;  5D8H B;  1B7Y B;  2W24 A;  5D0R A;  5ETR A;  2IYG A;  4V19 X;  4HH0 A;  1X8D A;  4Q44 A;  3FBE A;  9ATC B;  1RKJ A;  3ILI A;  4I68 A;  4M5L A;  5LL6 d;  4OYI A;  4B9T A;  4D3H A;  4RL1 A;  3I9V 9;  3W5X A;  1CJU A;  4NML A;  3QRQ A;  1U8W A;  2QLX A;  4GKJ F;  4CLK A;  2X7I A;  4YME A;  2DIU A;  5GMD A;  3NP5 A;  1N5Y B;  3M4X A;  2P6T A;  2VHG A;  1EET A;  1S6P A;  3AXK A;  1RCO B;  3KTQ A;  1FKO A;  4J5O A;  2VON A;  3PG9 A;  4U8V A;  4LRC A;  2H5J B;  3D1H A;  4HI1 A;  1UJ5 A;  1VHF A;  1FE4 A;  3LTO A;  2IVF B;  5J1E B;  3BGR B;  4DCO B;  1LOU A;  2MKS A;  3ENV A;  3W9H A;  4H54 A;  5DDR C;  1SL1 A;  4CLP A;  3CO0 P;  2HMI A;  4J9Q A;  2PI4 A;  4DMZ A;  1FKA F;  1CJT B;  2V2K A;  3OW2 R;  4AE5 A;  4LRE A;  4MKY A;  3PYG A;  3BM7 A;  4NYO A;  5D3G A;  1UVM A;  3KMQ A;  2NXC A;  4BCA A;  5F3Z A;  5T7L B;  1OYD A;  2BOA A;  3CCR S;  3VAI A;  3W1Y C;  2HQC A;  3TUP A;  3GQC A;  4DL4 A;  4KO0 A;  2GCF A;  5A6W A;  1N54 B;  5RUB A;  2HUR A;  3DRY A;  3CO9 A;  1T3N A;  1JLC B;  3MEE B;  3I0S B;  4IKA A;  2L41 A;  3CIZ A;  3QO9 B;  5E3R A;  1FK9 A;  3MF5 A;  5HAN A;  1F1B B;  3NWG A;  5CH7 B;  3H90 A;  4DL2 A;  2FLL A;  2FJX A;  2OSQ A;  1RAB B;  4IH6 A;  5D6G A;  2VPZ B;  1RT7 B;  2DKO B;  4CO0 A;  2RQM A;  5KFP A;  3BO3 A;  2ZZM A;  1RHU B;  2EFP A;  1RAI B;  2ZHA A;  5IFM A;  1NUE A;  4HVZ A;  3AB4 B;  5A0Y B;  5ITH A;  1LW0 B;  4EFA C;  5HMX A;  2G13 A;  4X4V A;  4LFA J;  3DXS X;  4DFJ A;  5IZH A;  4EBD A;  2OEM A;  2ILZ A;  3GII A;  2JWN A;  2J5A A;  2MKJ A;  3SSQ A;  5KFO A;  1NHK L;  4P6Q A;  1C0T B;  1RP5 A;  1LK7 A;  3W2W A;  5HRO B;  2VB6 A;  3KWM A;  5M2R A;  1SQG A;  2Y3Y A;  3K89 A;  7FD1 A;  3MI7 X;  1RT5 B;  3T5H A;  4DSI A;  3WBZ A;  4P2S A;  1RTH A;  2BQ3 A;  3LAK A;  2XGP A;  4DQS A;  3ZNJ 1;  4CH0 S;  4RNH A;  1Q95 G;  1TKD A;  4ZLJ A;  1HI1 A;  4RWX A;  2GQQ A;  3BEG B;  2W9C A;  3MAH A;  2GVZ B;  2M5Y A;  5LSR A;  1S9E A;  4K0K F;  4ES1 A;  3FQL A;  5FDL B;  4ENO A;  1NSQ A;  1T9U A;  3D7S B;  4FXV A;  2DPI A;  3KHG A;  1WSV A;  2IAJ A;  2IA0 A;  1VQ8 S;  4QZV B;  4GC6 A;  2H1Y A;  3R5C A;  1NXI A;  3CE8 A;  5LJ3 Y;  2PMH A;  1S72 S;  2KN4 A;  2DB1 A;  2ZBC A;  4LF6 J;  3K8V A;  4DR2 J;  4N8O A;  2PII A;  1VQO S;  4CLS A;  4DV1 J;  4AL6 A;  2RML A;  5J1P A;  1RT2 A;  2MZ1 A;  3CJQ A;  2CPX A;  4ZVS B;  1WDD A;  5DET A;  2RDD A;  2YNF A;  2W8K A;  5F9N A;  3C19 A;  1S1X A;  1FRK A;  1LFP A;  3DOL A;  5H9E K;  2OH2 A;  2FB0 A;  4XPC A;  2G9O A;  1Y4Z B;  5F3T A;  3CXC R;  4LIR A;  4EO6 A;  5K20 B;  2XMJ A;  2ASJ A;  3UW1 A;  5BR8 F;  2V50 A;  5H9E J;  2EFQ A;  1RWX B;  2OEK A;  2Y0S D;  4PWD A;  2H51 B;  1N34 J;  1RBA A;  2W9A A;  1ZAX A;  3R5D A;  5E3C A;  2ROP A;  1XWL A;  2LLZ A;  3WHI A;  1WHX A;  2I6W A;  1UP1 A;  3W8P A;  2DRD A;  4F67 A;  1U6F A;  1JLF A;  3KDN A;  4L73 A;  1HNI B;  3THP A;  1WHV A;  2IIH A;  3FJ2 A;  2CYY A;  2C3Y A;  4NOH A;  2VG5 A;  3NNH A;  3FBB A;  4JV1 A;  2CJY B;  5HAT A;  5CAB A;  1FRX A;  3RB6 A;  1FXL A;  4KSE B;  3RW6 A;  3FMB A;  4FKX A;  3W2V A;  1S48 A;  5HN0 A;  2V63 A;  3M8Q B;  1NPK A;  4USV A;  1O0P A;  2I1R A;  3UN5 A;  1BLU A;  3KJV B;  2MKC A;  1M5H A;  2XYH B;  2XMU A;  1WSR A;  3W61 A;  1JMT A;  1YTY A;  4Q0B A;  2O5D A;  1WNE A;  2FJD B;  2QFI A;  3DOK B;  2YBV A;  5IWA J;  2DNM A;  1TEL A;  4OI0 A;  2A1B A;  2HRT A;  4QBU A;  2XO7 A;  3HHL D;  1VRU A;  2A6M A;  4DU8 A;  2JL9 A;  3R8Y A;  4OYA A;  2IM2 A;  4KFB B;  3CW2 C;  2YH0 A;  3SSR A;  2UUT A;  3CC7 S;  1UJ4 A;  4M5J A;  3CD0 A;  2CQG A;  4Q2M A;  3HKW A;  5A8K A;  4O3S A;  3RUB L;  2C3U A;  2KU7 A;  4DL6 A;  2V9W A;  4UST A;  1FRL A;  2CUY A;  3HD2 A;  1GMW D;  4RUB A;  5HQL A;  2BMB A;  1CS4 A;  2J0Q D;  3UO0 A;  3LF0 A;  4CM2 A;  3DMJ B;  3LAN A;  1PYS B;  1S1U A;  4LR7 A;  5J2P A;  1RE1 B;  4WCE Q;  2WVD A;  3GCX P;  1M1K T;  3BGO P;  4JOU A;  1L3S A;  1ITP A;  2HK3 A;  4USH A;  1KC8 T;  5G4D A;  2OIH A;  1N6Q B;  3MPD A;  3NS6 A;  3BYP A;  1QJH A;  4USI A;  5AE2 A;  5J2Q B;  2EFO A;  3QT7 A;  1CVJ A;  2YWG A;  3M8Z A;  1KBR A;  2UUW A;  3ZZU A;  2Y1I A;  2HIQ A;  4M5N A;  2HSE B;  2B3T B;  4UTG A;  1S0O A;  4YDX A;  1HBO B;  1SI9 A;  1IKX B;  2CPH A;  3Q8R B;  3ZNU A;  1J5E F;  5MLC V;  1X9M A;  1JXL A;  4IRD A;  5ETT A;  1NH8 A;  4AQY F;  3QBC A;  3QAE A;  1G6B A;  4LSZ B;  4IH7 A;  4UY8 T;  1MLA A;  1JLQ A;  1D1U A;  1Q4R A;  5KFB A;  1DUR A;  3Q8Y A;  5A8W B;  2A3J A;  5DDQ C;  1S97 A;  4DL7 A;  1RK8 A;  5CCL A;  3KLI A;  1U1R A;  3DOM A;  2ZE2 A;  5DG7 A;  1RJJ A;  2YNI A;  3TAP A;  3EZU A;  2R7V A;  2YNG B;  3BQ0 A;  3HI9 A;  2KVQ E;  3G82 A;  1U26 A;  4M63 A;  8AT1 B;  3O8W A;  2UV8 A;  4JV5 J;  1E6Y B;  4A8M P;  3NBP A;  4JI7 J;  1SH2 A;  2V68 A;  1RHQ B;  3A12 A;  2W4P A;  1FD2 A;  3U1L A;  1RHK B;  4RNO A;  3D0G E;  4C11 A;  3OUY A;  3CVK A;  5DM7 Q;  4FS1 A;  2DH9 A;  2P5V A;  1CUL B;  2E5L J;  3ISN C;  5ETQ A;  3QFH A;  3ILL A;  3PYE A;  1F5A A;  3BPD A;  3SQG A;  2VDH A;  3TO8 A;  1F9E B;  4RW7 A;  1X9S A;  1HNW J;  1V5I B;  1GX6 A;  3C15 B;  4MK8 A;  1KVK A;  2R7W A;  4NMX A;  3Q8Q B;  3W5Y A;  3R97 A;  5HLF A;  3D6F B;  3DRS B;  4QCL A;  1VMB A;  5F0U A;  4P72 A;  1ZOT A;  1VQP S;  1MG7 A;  4N77 A;  3NMR A;  4LF2 A;  1C1B A;  3BKT A;  3C16 B;  4WP3 A;  1WDT A;  1QUV A;  3E01 A;  2M8H A;  2B9W A;  2DNK A;  5DG8 A;  1VRT B;  3JAM U;  4QYZ K;  2DGU A;  2HBY B;  1VQS A;  1NK0 A;  1DBD A;  1EQ0 A;  3G9C A;  5J2M B;  3IAS 9;  3JTP A;  2OSR A;  4WBF A;  4QYZ J;  1RA7 A;  5B7W A;  1R31 A;  1PJ5 A;  5CYQ B;  3OJS A;  1HMV B;  2AEM A;  3FNN A;  1K73 T;  2UVW A;  3EZ5 A;  4O44 B;  4EU0 A;  3UPF A;  3HPO A;  1N8R T;  4J9K A;  4BC7 A;  4RJV A;  1R0C B;  2XYG B;  1HPZ B;  1UWB B;  5L39 A;  6FD1 A;  4USU A;  5GAH U;  3SZ2 A;  1VK3 A;  4AD6 A;  2VIH A;  2HFS A;  4NLX A;  3SV3 A;  3BBF A;  3NEK A;  4K4Z A;  5DDO C;  5GME A;  3OVA A;  3UDC A;  4WKY A;  1Q16 B;  1NND A;  4RW8 B;  2QA2 A;  5ETO A;  4E8U A;  2HHT A;  3SIP B;  2K7K A;  4K4W A;  3MR6 A;  3ZZR A;  2F65 A;  3IS9 A;  3QZ7 A;  2AV5 A;  4PG8 A;  4DF8 A;  2QE5 A;  3LA0 A;  1UET A;  2B51 A;  1TL3 A;  1TKX B;  3BKU A;  3SXL A;  2QC3 A;  1FCA A;  2ZNZ A;  2XS5 A;  1OWX A;  2QA4 S;  3MM9 A;  2VBX A;  4RU2 A;  3PX0 A;  4DPX A;  2DHA A;  4K4Y A;  1FJ7 A;  5KFT A;  4NCA A;  3MFI A;  5AJ3 J;  2M9K A;  2B5J A;  2YX4 A;  3EX7 B;  4H4M A;  5HSP A;  1TL4 A;  1O8B A;  1Q0N A;  2C2K B;  2KJV A;  4RNM A;  1TTH B;  1F3V A;  4QR0 A;  1BUX A;  5DS7 A;  3WQP A;  1VBY A;  4RU9 A;  3G87 A;  4W92 B;  5J2N B;  1M5S A;  5KFR A;  4LFA F;  4CO2 A;  3M8S A;  4PQA A;  2WOM B;  4WPA A;  3BR8 A;  3TAQ A;  3KLF A;  3C2P A;  5HVG A;  4JI0 J;  2R7S A;  3ET6 B;  4I2P A;  3N28 A;  1TU0 B;  2RF2 B;  1TL5 A;  1P9Q C;  3T1Y J;  1TP7 A;  2BE7 D;  2M0G B;  4C97 A;  2CZV C;  3JTO A;  1UVN A;  3GJQ B;  4DS5 A;  2MYF A;  4FF1 A;  4F2S A;  4CO1 A;  3GG1 A;  2LYV A;  4F8R A;  3HHK A;  1LKZ A;  1XTZ A;  3KLG A;  1T05 B;  1Q82 T;  1RT3 A;  5IV4 A;  3BSO A;  3DLK A;  3OQ2 A;  3DCA A;  3E8O A;  3KUG A;  1GXT A;  3KYL A;  3MUV P;  4P7V A;  5L1J A;  3D1O A;  2FIU A;  2FYX A;  4WTY A;  2YKM A;  3GPA A;  2WB1 D;  4NLR A;  3GLJ A;  4KAI A;  1SV5 A;  2VZ9 A;  3W9J A;  2HNY A;  2RB7 A;  1VBX A;  5KFK A;  3GIJ A;  2QLJ B;  2EPI A;  3O44 A;  3IBC B;  4HHJ A;  3T1H J;  3KUH A;  2CKW A;  1M5K C;  1IBC B;  2LQB A;  4DSF A;  4TY8 B;  2I38 A;  4JI5 J;  5D4O A;  4JUZ A;  4LF6 F;  4JV2 A;  1YJW S;  4DR2 F;  2NUU G;  3BBB A;  1TUV A;  1SJ1 A;  4DV1 F;  5K5M A;  1HQE A;  4K5R A;  1CSJ A;  1AFI A;  1JLA B;  1JWW A;  3NAH A;  3QJP A;  2ZC4 A;  1PO6 A;  2RS2 A;  2LFV A;  5G0R A;  2M8D B;  4DR5 J;  5DM6 Q;  2LA6 A;  4CTA B;  1KOH A;  2R42 A;  3F41 A;  3NLC A;  3ZC4 A;  2GHW A;  4OLO A;  2VQF J;  3DYA A;  2ASD A;  4LVO P;  5HP1 A;  3PRV A;  3N4W A;  2PEH A;  1BXN A;  3EUN A;  1N34 F;  4ZPA A;  1GXU A;  2FD2 A;  3NCR A;  4LF5 J;  2AYB A;  1XK8 A;  3H40 A;  4WZQ A;  1K1S A;  2ZM6 J;  3HSZ A;  2K2P A;  3R6G B;  3CJK A;  1KFS A;  1FNX H;  3TA1 A;  2H4W B;  2VPW B;  2IMW P;  3BN4 A;  1VS3 A;  1W26 A;  1EJ7 L;  3R5B A;  3QGI A;  1F6T A;  2W2M P;  1M5O C;  3G8Q A;  2E44 A;  4LF8 J;  2ASL A;  1KNZ A;  5IC6 B;  1NHV A;  3TQE A;  1QTM A;  3A3O B;  1U6B A;  4NYP A;  2RRB A;  3DM2 A;  3GJT B;  2MQO A;  3S7R A;  3A1Y G;  5KOX A;  4DX8 H;  1WTB A;  4HAC B;  2Z57 B;  1VQY A;  4ES2 A;  1S1W A;  5L1L A;  3MM8 A;  4G1P A;  5IWA F;  1RWN B;  1UW4 A;  1SL2 A;  3ISZ A;  1CQM A;  3CME S;  2PMZ D;  1U02 A;  1ZA2 B;  4PUO B;  5AXK A;  3GCW P;  3T6J A;  1XNQ J;  1RIS A;  3TAR A;  2UV8 G;  4MYT A;  1YSJ A;  3HSG A;  1NHU A;  2IRY A;  5KFM A;  3IGN A;  3TVZ A;  4NA2 A;  2Z2M A;  3D68 A;  2HFV A;  1R3N A;  1DHM A;  3HHL A;  2ERR A;  1EKS A;  3M2V B;  2ZH5 A;  3HVA A;  3NCQ A;  1NK8 A;  2OLW A;  4B02 A;  2Z56 B;  1TL1 B;  2VAS A;  4XTT A;  5KG0 A;  2GW8 A;  2XI3 A;  3PRB A;  2WHO A;  1R89 A;  2OPQ B;  1HWI A;  5F8N A;  1T95 A;  2HGL A;  4EUV A;  2B4V A;  1YRX A;  1JNR B;  3N9U C;  2D41 A;  3T5J A;  3UR3 C;  3CJ5 A;  2LXF A;  1NJZ A;  2JX2 A;  3EDR B;  4ZVT B;  5SZT A;  3CIM A;  2KT5 A;  1N5T A;  2POK A;  4GMK A;  3HHN B;  1VQ7 S;  1NK9 A;  4X66 F;  3TX0 A;  3RZA A;  3RRH A;  4RW4 A;  3DRP B;  1RWO B;  2XQC A;  1UKU A;  4HH1 A;  1FEE A;  1LW2 A;  2OHD A;  3BB5 A;  3K5P A;  4F02 A;  1T9X A;  2M52 A;  1T03 A;  3TA2 A;  4URG A;  3I31 A;  2UXD J;  3MCO A;  1F2G A;  3EXC X;  5L8R C;  1FTR A;  2A2C A;  3O2I A;  2EK6 A;  2CQ0 A;  4TYA A;  5AE1 A;  3LOU A;  2P9G A;  1RTI A;  2IDL A;  1ZZN A;  5D4L A;  3K5M A;  1C4C A;  1VLO A;  4C3M A;  3QGH A;  2BAN B;  4OZ0 A;  2JFK A;  1AXQ A;  1EHW A;  4DV0 J;  4M8L A;  2E1A A;  4KGV B;  5D0E A;  3MPY A;  4JV5 F;  1MU2 A;  4JI7 F;  3K0J A;  2DY1 A;  2ZWP A;  3C3L A;  4NLU A;  4A46 A;  2AGP A;  4YR2 A;  4M95 A;  1KLM A;  3QQC D;  1CLF A;  1RUS A;  5KG7 A;  3G8T A;  1IKW A;  3ENW A;  2D69 A;  3DGP A;  4RW6 A;  2PMW A;  4LIW A;  5LSL A;  5C25 A;  1ELO A;  2E5L F;  3PXG a;  3VHQ A;  5C2G A;  1HNW F;  3MAA B;  1F0X A;  4ILM A;  3RR8 A;  1O6X A;  3CGI A;  2X1B A;  5KAK A;  4WZM A;  2E1M C;  3UD4 P;  4ILL A;  5H1S V;  3US5 A;  4NCB A;  1VQ5 S;  1SB6 A;  3UNG C;  2B43 A;  4YP3 A;  4MMO A;  4RUH A;  1PIL A;  4DV6 J;  3O6Q A;  4CWB A;  1RWV B;  2R7Q A;  3A8E A;  1JLE B;  1E6V B;  2ACY A;  4IG0 B;  3MM6 A;  4AL5 A;  1VGY A;  1W25 A;  2KFY A;  1CJK B;  4F3Q A;  3KKF A;  5B0G A;  4Y2M A;  1Y3K A;  1LXN A;  3UI3 A;  1HNZ J;  4IO9 Q;  4C8Y A;  1EP4 B;  2QZ8 A;  3OL8 A;  1XJW B;  4AXI A;  2IHR 1;  2J76 E;  3IBF B;  2RAQ A;  4DL3 A;  1T7P A;  1FTC A;  1B64 A;  1RZM A;  1KR4 A;  2CJB A;  3M8P A;  4L74 A;  1IXK A;  1FRH A;  3SYZ A;  4JBC A;  4KTQ A;  3PEJ A;  1TL7 A;  2AGQ A;  5ETM A;  4K4S A;  1B0V A;  3DRX A;  2AJF E;  4RX6 A;  1H2V Z;  2NXN A;  5A6P A;  3PFE A;  4PEO A;  1X5P A;  2X3G A;  4F4Y A;  3HVT B;  4UOF A;  1ROF A;  3I4H X;  1IBK J;  3ICL A;  4M5D B;  2DO0 A;  4GC7 A;  3WDO A;  3GR0 A;  2ILY A;  4LFB J;  1YK9 A;  1Q8I A;  1ZYQ A;  1WF2 A;  2IM3 A;  1JXE A;  1S4F A;  2IC3 B;  1DLO A;  3FBF A;  3J7Y U;  4I69 A;  3FFI B;  2OO4 A;  2L08 A;  1S79 A;  2PC6 A;  2CQI A;  4NLG A;  4EBC A;  1SQE A;  2C2R A;  4Y2A A;  5AJ3 F;  1J5O A;  4PQU A;  2J6S A;  1UAW A;  4NLV A;  3I55 S;  1N88 A;  1HI8 A;  3C6T A;  3M2R A;  4I2Q B;  2C3O A;  1FXD A;  2BUN A;  3RRG A;  4LFC J;  5KT2 A;  4ERD A;  4I64 A;  4GVB B;  4IYQ A;  3P4U B;  2C3M A;  3ETM A;  5K14 B;  1SJF A;  1NK4 A;  2FPH X;  1RDR A;  3OR2 A;  2VJU A;  3LUY A;  2LDY A;  4BS2 A;  3W65 A;  4ZPT R;  1H73 A;  2I8E A;  3MED B;  2DY9 A;  2ATC B;  1PGZ A;  2BKP A;  3QAU A;  3CD6 S;  3MM5 A;  4I7F B;  3H0P A;  4A47 A;  3K5O A;  2AEJ A;  3VQS A;  3PZP A;  4DWI A;  3T1Y F;  4FVC A;  2HEK A;  1VC6 A;  2KHD A;  1OPZ A;  1WEL A;  2LQ9 A;  5KT3 A;  3GIL A;  4ZP7 A;  4KPY A;  2RHS B;  4ZLP A;  2FJV A;  4A8Y A;  1OIA A;  3OR1 B;  2DPJ A;  3IRX A;  2RRN A;  4MH8 A;  4B3S J;  2VG7 A;  3T41 A;  3BGU A;  4ZOS A;  1GFW B;  3NGT A;  4DSK A;  1JJ4 A;  3Q24 A;  4USW A;  1PC4 A;  4C9D A;  3KG4 A;  3D6H B;  2ZUA A;  4CYU A;  3T1H F;  4MK9 A;  4LR9 A;  5I3U B;  4F4X A;  2OPR B;  5KT5 A;  4WK1 A;  4GO5 X;  2JLG A;  2KYZ A;  4TVA B;  3CMA S;  4JI5 F;  3V6D B;  3CCT A;  1KFD A;  3LO3 A;  2GMJ A;  3IG1 B;  3RYL A;  3C8Y A;  2HND B;  2NXJ A;  3S6E A;  1QSS A;  1N36 J;  2FZK B;  2J8A A;  1ZS6 A;  2XZD B;  2HS3 A;  2ZVI A;  1HR0 J;  5KFU A;  1FDN A;  5LMN J;  2HWH A;  5DRK A;  2HHW A;  4MKA A;  1PYO B;  4Q2L A;  3HO1 A;  3IR7 B;  4O3N A;  3H25 A;  4DR5 F;  2XUL A;  5AE3 A;  4C3K A;  2VQF F;  3ITH A;  2AMC B;  3QT6 A;  4ECY A;  1VC0 A;  1SUQ A;  4RLE A;  3R1L A;  4OFZ A;  3X1L B;  1DQ9 A;  3V4M A;  4LF5 F;  3B78 A;  4K5S A;  2E5G A;  3BN7 A;  1M5P C;  2ZM6 F;  2XNQ A;  2XMT A;  5IM0 A;  4FYV B;  4NE9 C;  2HVZ A;  4KGK A;  1RI7 A;  4D3G A;  5KT7 A;  2MB0 B;  2CJX B;  5HMY A;  3PJW A;  1RT1 A;  1KWM A;  2KDO A;  3PTW A;  2J9D A;  2H4Y B;  1WOP A;  2KO1 A;  4P74 A;  2GJI A;  2YKN B;  4Z7C A;  3PFO A;  4FF2 A;  4LF8 F;  3PJX A;  1WTF A;  1VR6 A;  5DDP C;  1RWM B;  3NWR A;  4QIV A;  2MZS A;  2AD9 A;  2HAF A;  2XNR A;  5E3Q A;  2RSQ A;  4OYW A;  2Y1J A;  2DH8 A;  4UUX A;  4ES3 A;  2E1R A;  4J9R A;  2VOP A;  3M2U A;  5GAD I;  2YQ1 A;  3I96 A;  3MMJ A;  1P1T A;  2QL7 B;  3D54 A;  4DCP B;  4QQB A;  4CZC A;  2YX1 A;  1HQU A;  3MD1 A;  3VAJ A;  1C1C B;  2DGS A;  4WFB Q;  4LBH A;  1WI6 A;  4K4X A;  4NEZ A;  2QYC A;  3UE2 A;  4IH5 A;  3OL6 A;  2E7V A;  2DNN A;  2DK2 A;  2FVR A;  5ADZ A;  2E5J A;  2HBQ B;  3AD8 C;  3DKD A;  1Q86 T;  2R7X A;  3OTE A;  4KE5 A;  4ED3 A;  3Q8P B;  3GB0 A;  5JJB A;  3VGT A;  3PYD A;  2DO4 A;  4O3P A;  3EVO A;  1WC0 A;  4YUD A;  3ZFV A;  3VVU A;  2WW8 A;  2EI5 A;  4V19 J;  1R8P A;  4I6A A;  4MKV A;  3W64 A;  4MIB A;  5FLX Y;  3MGJ A;  5K9F A;  3BDP A;  2J7W A;  1WF0 A;  1P27 B;  3JYT A;  1Y5N B;  4OZ3 A;  2W1B A;  3IMQ J;  1SH3 A;  4XO0 A;  2QA1 A;  3FCV A;  1UW9 A;  4I6W A;  2CFX A;  1FE0 A;  2FVQ A;  1Q7Y T;  2UZA A;  4OHX A;  4H4K C;  3W7B A;  2OJ3 A;  4LF7 J;  3FC9 A;  1WOS A;  3BH7 B;  2Z30 B;  2BZ2 A;  2MGZ A;  1BD6 A;  4URQ U;  1U1Q A;  4WXO A;  4DR6 J;  1OY6 A;  1KHV A;  4FNI A;  2YXL A;  2KFZ A;  1HWL A;  3BSC A;  2UXD F;  2XB2 D;  8RUC A;  4EZ9 A;  2CNN B;  1FD8 A;  5JVG Q;  3HD1 A;  2D7S A;  3GIM A;  2DHS A;  2Y1L B;  3ONQ A;  3N6N A;  3EE3 A;  2UXB J;  4DF4 A;  1Q81 T;  3LP1 B;  3ZTR A;  4HDG A;  4NCG A;  1FDB A;  4AXJ A;  1ICE B;  4MAK A;  2AGO A;  2MQ8 A;  1HBU B;  2BKO A;  4FN5 A;  3DLL Q;  4DV7 J;  1NU4 A;  1JKH A;  1HBN A;  4Q5V A;  4N47 A;  1M0S A;  4NI2 B;  2DNP A;  1EQM A;  3KK3 A;  2QX0 A;  2ATL A;  4R25 A;  3SI8 A;  2DIV A;  2O66 A;  4KHP J;  3L4B C;  2QG9 B;  1RTJ A;  2AW0 A;  2W9B A;  2KM8 C;  1OQ3 A;  3E2E A;  4KKO A;  2NQP A;  1VIS A;  5DO2 A;  3G8S A;  4RW9 B;  4KH1 B;  1XC9 A;  4QR2 A;  5ETV A;  1M1H A;  4UUW A;  3LWL A;  1Q5V A;  4X4P A;  4CO4 A;  3MMA B;  2DNO A;  2MXY A;  1HKA A;  1NM2 A;  3MR2 A;  1AYE A;  4QYR A;  4ZPV R;  1UFW A;  3GG0 A;  4WII A;  1RLD A;  1QAX A;  2NPF A;  3DDN A;  3CUL A;  1TMJ A;  2AIR B;  5A8R B;  1YQH A;  2HHQ A;  4NLW A;  4YB6 A;  4DEZ A;  1U1L A;  4YR3 A;  1PIE A;  1S1V A;  3MUT P;  4DV6 F;  4WYL A;  2GQC A;  1R7I A;  1DJ0 A;  2HRY A;  3P3D A;  2D3O R;  3PIO Q;  3QLH A;  3Q23 A;  2DNQ A;  2JC1 A;  2KT2 A;  2AX0 A;  4KY3 A;  3OVB A;  2PO4 A;  1U48 A;  3G4S S;  3N6M A;  3NGK A;  1TAU A;  1QLN A;  1JQG A;  1RCX B;  1Z2Z A;  2D74 B;  2ZWO A;  1A6L A;  2BVZ A;  2MLY A;  1FI4 A;  2XSF A;  3FSY A;  1UEK A;  2U1A A;  4X84 A;  3TA0 A;  2I2Y A;  1RWP B;  5D77 A;  4P2F A;  1QE1 A;  3PVX A;  3KG1 A;  1EKR A;  4U67 Q;  2XWX A;  1N4L A;  3UR0 A;  1IM6 A;  2XG8 A;  2FVS A;  3PW5 A;  4K50 A;  2NZ4 A;  4QIW D;  1RTZ A;  2NCK L;  4DZD A;  2N4D A;  1NPR A;  3D3B J;  5KG5 A;  3ELH A;  1NBE B;  3W9I A;  3POT B;  2HHV A;  2EG2 A;  1D9A A;  3UVJ A;  1VOM A;  5C24 B;  3PYF A;  3NS7 B;  3OTO F;  2KG0 A;  2HGN A;  4K2J A;  4M94 A;  1IBK F;  2ZBI A;  5CQG A;  2J9E A;  2KZZ A;  2DIS A;  3OT9 A;  3C66 A;  4LFB F;  5E5N A;  3GJR B;  1LXJ A;  2ZD1 A;  3MM7 A;  1H0H B;  4FBT A;  5F41 A;  1RXO B;  3BQ2 A;  1SBR A;  1YJT A;  4DPW A;  4QWA A;  3VVT A;  2UUC J;  2XMM A;  4ANE A;  3QGG A;  2R9L A;  4RKU C;  3PDN A;  2VBY A;  1HNV A;  3QIP A;  1C0U B;  3CDW A;  3I6P A;  2R7R A;  5BYS A;  4ELT A;  1PKU A;  4N76 A;  2XS2 A;  1BGX T;  2M3D A;  3FCW A;  1ULR A;  1X4B A;  3KDO A;  4ECR A;  1NSP A;  2E7W A;  2V8V A;  4X2B A;  4LFC F;  5F8J A;  1NAQ A;  2GC8 A;  1IKY B;  3JSR A;  1NK6 A;  3V6J A;  4TYB A;  2GS8 A;  2QL9 B;  4QOT A;  3CJT A;  3C14 A;  3KK2 A;  1NO8 A;  3CCU S;  1FX2 A;  1L3T A;  4WXW A;  4B9N A;  4PRF A;  3IGV A;  3UCG A;  5I42 A;  3B6B A;  2DTJ A;  2G2Z A;  1VIX A;  4J9L A;  2OML A;  4OL8 A;  4E0D A;  2YNH A;  3JSM A;  4ED5 A;  1FJC A;  1X60 A;  3V6H A;  4ZVP B;  4J37 A;  1QAJ A;  3QJL A;  2MLX A;  4XK8 C;  4ZN3 A;  4HT5 A;  4C7Q A;  4IFY A;  1R27 B;  1SXL A;  4B3S F;  2V94 A;  3A13 A;  2BQU A;  1U0H A;  1RKI A;  1TKZ A;  5E2Q A;  2C2E A;  5KFX A;  3EPG A;  2E9T A;  4O4G A;  1UEU A;  5L9X A;  1FJG F;  5KFC A;  3KNA A;  1IBL J;  2YH1 A;  2V4J A;  4F4W A;  5HO4 A;  1U45 A;  4ZCM A;  1GQE A;  3BKF A;  4OYM A;  3R27 A;  1KSP A;  2HK2 A;  1TKT B;  2JOQ A;  3CB4 A;  1UVJ A;  4KIA A;  3MEG B;  1KON A;  4TLQ A;  1FVS A;  4Y2C A;  4BC9 A;  1V5V A;  4KC5 A;  3MUR P;  2NSB A;  3AJD A;  2C22 A;  4QPT A;  1N36 F;  3QRP A;  2XLK A;  1RAA B;  3C6U A;  1HQ2 A;  1HR0 F;  3ISN D;  1JJH A;  4ICL A;  2HQ3 A;  2CPD A;  5LMN F;  3IR5 B;  4LF9 J;  2UUB J;  1ZTW A;  3NGS A;  3I5B A;  3T6B A;  5EWF A;  3H42 A;  2G0J A;  2GIF A;  3H8Y A;  1NDK A;  2GGP B;  3JSB A;  3MMC A;  2OFH X;  2QV6 A;  4CNZ A;  3KHR A;  5HI7 A;  3IWN C;  2IBO A;  2RUS A;  1FRJ A;  1XMQ J;  1U47 A;  2MY7 A;  1RLC L;  3NCP A;  1Q8B A;  2BBE A;  5K8M A;  5DLG A;  3AA9 A;  4C0O C;  1H74 A;  3IA0 A;  2YKQ A;  3FUY A;  3VAH A;  5GAE I;  4IOA Q;  2F4V J;  2Q1L A;  3HHD A;  1B3T A;  4OHZ A;  3CCV S;  2J0X A;  4C8M A;  2WVF A;  3GWC A;  1DY3 A;  5ETN A;  4E2F B;  2AYE A;  1IKV A;  1S59 A;  4YHH J;  4R5P A;  3GZ7 A;  4N41 A;  1MW7 A;  2LU1 A;  2BE2 B;  4PG4 A;  1LWC A;  2B7B B;  1U1M A;  1CEZ A;  1OY9 A;  4N7T A;  1S99 A;  3LH2 S;  1D0E A;  4WFA Q;  1RAD B;  3JQJ A;  4QWB A;  3ZO7 A;  1S76 D;  2FHJ A;  2AEF A;  1PYT A;  2GAH C;  3SDE B;  2XM3 A;  3MEC B;  3SMZ A;  1U09 A;  1V3Z A;  2L3M A;  2XEX A;  2N82 B;  3DLE A;  2ZKU A;  5T14 A;  3BYR A;  2OPP A;  1G4C A;  1YJR A;  4ZDN A;  2WON A;  5DQG A;  1VK8 A;  2ZHO A;  3G6V A;  2XLJ A;  1WKL A;  2YPZ A;  2LU2 A;  2YY3 A;  1RQ0 A;  4A8W A;  1TK0 A;  4O3R A;  1AZS B;  1Q5Y A;  3FZ2 A;  1FO1 A;  1YBA A;  4HDH A;  4KRW A;  1RU1 A;  3CNQ P;  4I4B A;  1NJW A;  2KRB A;  2HAI A;  3KLH B;  5D0G A;  4Y3C A;  1WF1 A;  3EGN A;  3PRD A;  2PD1 A;  3I9Z A;  2P8I A;  2O67 A;  1H38 A;  1HYS B;  2CNO B;  4LRD A;  1FNO A;  2V2V A;  1H7W A;  2O01 C;  3PEH A;  1G2E A;  1GTE A;  1UA1 A;  4JI3 J;  1LWF A;  1RAG B;  2L9N A;  1PJ7 A;  1TUW A;  4ZMM A;  5CYM A;  4X4R A;  4OYP A;  3PX6 A;  5E33 A;  3M1V B;  4LF7 F;  1R8B A;  4F4K A;  2BJ1 A;  2V6A A;  4Q43 A;  2YWK A;  2IYI A;  2D3U A;  3HLU A;  3MR7 A;  4PYA A;  2KJW A;  2FLO A;  3Q89 A;  4DR6 F;  1YKW A;  3G6X A;  4FPI A;  4ZHR A;  3BV8 A;  2ZH7 A;  3GE9 A;  1A7G E;  4WE1 B;  2ACM A;  5KTQ A;  2B6A B;  1KHW A;  1SJ4 P;  3LGH A;  4YY3 J;  3W63 A;  2RQK A;  5LJ5 Y;  3ETO A;  1KN6 A;  1VQM S;  2RQ4 A;  3H59 A;  2G2O A;  4ELU A;  3RB3 A;  3JSY A;  4ZLL A;  4OX8 A;  2KHC A;  3DU6 A;  3CDB A;  4CLT A;  2QEX S;  1U24 A;  4DHV A;  2VKR A;  2UXB F;  1T94 A;  2F5G A;  4ECQ A;  2RDJ A;  5D15 A;  1NLK L;  4U7C A;  1DTQ B;  3SBM A;  2QGF B;  5IXU A;  3IRW P;  4DV7 F;  4USJ C;  2NZC A;  4IDK A;  1DRZ A;  2DXF A;  1GX5 A;  4YOE A;  1WKJ A;  3GFH A;  3BGF A;  2EBE A;  4KHP F;  4DFK A;  2ADC A;  4RUC A;  4DFP A;  5FD1 A;  4X4T A;  2B56 A;  1PAU B;  2WSE C;  1R0A A;  4XPE A;  3UWT A;  3MWB A;  2H65 B;  3J7Z T;  1Q7L B;  3W62 A;  3QMQ A;  2OPS A;  2VFV A;  3KK1 A;  4KV8 A;  4LUB A;  1U1O A;  2G1H A;  4LSN A;  1H6K X;  4DUY F;  2DNR A;  2K1R A;  4K4U A;  2MTL A;  4KHR A;  4F36 A;  5HMZ A;  2G0I A;  4A8Q A;  5M2P A;  3U1N A;  2BJE A;  2PEB A;  2PSZ A;  5EHH A;  1RT6 B;  1RT4 A;  3GFY A;  1JNZ B;  2C1E B;  3R3T A;  2GFF A;  4J9P A;  1LEO A;  2ZH3 A;  3H98 A;  4OV6 A;  3GIK A;  3CUN A;  2R4F A;  5KFL A;  2RKI B;  2R2S A;  5FLX U;  5F8G A;  1D8Z A;  2IY5 B;  2GHV C;  4ZVR B;  3K17 A;  3LQV A;  3DLB A;  4PG6 A;  3M30 B;  3MOZ A;  1HW8 A;  2HS0 A;  4JB8 B;  4EYH B;  3NXZ A;  2Y0B B;  2BM0 A;  4XDC A;  4LSL A;  3R5J B;  3G2X A;  2Z58 B;  4ZPD A;  5KFJ A;  1I94 J;  3EVW A;  1V3R A;  2LVW A;  2HWI A;  2HNZ A;  2A18 A;  2N7C A;  4BHQ A;  3GV8 B;  4DV2 F;  1FWK A;  3GTY X;  2KFN A;  5D4N A;  5HMW A;  4FYX B;  2LEA A;  1NDP A;  2VPY B;  1CJV A;  3J81 j;  2B9E A;  2CJ9 A;  4OHY A;  1HLW A;  4KHM A;  2WBR A;  5LXY A;  1Y7P A;  1N5Q A;  1XMO J;  2LCW A;  3WIV A;  3R5G A;  1KDN A;  2RE1 A;  4A8X A;  4R8U A;  4U8Y A;  4O0I A;  3QT5 A;  3K7R A;  2UUC F;  2K3K A;  4IFV B;  2X1F A;  3U27 A;  1GNK A;  3G6Y A;  2IRX A;  3G71 S;  1I5O B;  2D3Z A;  3CC2 S;  1KTV A;  3T3F A;  3F44 A;  5B09 A;  4O0N A;  3A3P B;  1S6Q B;  5DQH A;  4UZC A;  1TV6 B;  2JEF A;  2M2B A;  1YJV A;  3BBC A;  3GP9 A;  2FY8 A;  4IG3 A;  4DSJ A;  1U8S A;  3UD5 A;  4ZP8 A;  1LWE B;  2HGM A;  2E9R X;  2DHX A;  2MZR A;  2UVR A;  3DI6 B;  1AFJ A;  4UF4 A;  2HLU A;  2VFR A;  3EVM A;  4K4T A;  3D2W A;  4BDP A;  1VBZ A;  2CPF A;  4YR0 A;  4P2M A;  3ZTS A;  2K8G A;  3GYG A;  3CC4 S;  2GJF A;  1SPB P;  3ADA C;  3N79 A;  3QSI A;  2CJK A;  3MPW A;  4B3O A;  5HBM A;  1H72 C;  3KLE A;  1SKW A;  2FGC A;  5C42 A;  2BKN A;  4JI1 F;  1P9Y A;  2GML A;  1UZD A;  4ZN1 A;  1SJ3 P;  1HW9 A;  3M6W A;  1BQX A;  1YJU A;  4EI2 A;  3K58 A;  3MCN A;  3KOA A;  3D0H E;  2VJV A;  1UTA A;  4IR1 A;  1IR2 A;  2W8L A;  1TR0 A;  3H20 A;  4PPD A;  3HFZ B;  1REV A;  2VG6 A;  4ANC A;  4YEA A;  3LP0 B;  1H2T Z;  2QMW A;  2CPE A;  4ELV A;  1N32 J;  3R5A A;  4WU3 A;  3HHE A;  2IBK A;  3LPE A;  4H4O B;  1S1T B;  2EKN A;  2R2R A;  1BQM B;  1WUU A;  3Q8V A;  1TQL A;  4LRB A;  4RO0 A;  3AH6 A;  1LFW A;  1S9G A;  2Y8W A;  4P2X A;  3V4I B;  2YKO A;  3DRR A;  5T41 A;  5EWE A;  4OHW A;  4FF4 A;  2C2Z B;  2FC8 A;  1JK9 B;  2V69 A;  1IBL F;  2KH9 A;  2ADB A;  4DUT A;  1JLB A;  3FEY B;  3D6M B;  4P9S A;  1MRO A;  3TAM A;  1KQK A;  1RA6 A;  2APO A;  2DGT A;  3EIC A;  4OZJ A;  4CLL A;  1CJU B;  3AJ1 A;  4TU7 A;  1NDC A;  2V8H A;  2AJ4 A;  2L9W A;  2R7O A;  4LF9 F;  3MMB A;  3ZTO A;  3VGU A;  1EET B;  1S6P B;  4BLG A;  1DTT A;  1Y5I B;  1FKO B;  4JI2 J;  3O1L A;  1FHT A;  1EAY C;  1D9F A;  4ZVH A;  4TN2 A;  2V5H G;  4W4M A;  2CNK B;  5E41 A;  3V81 A;  3A3N B;  4B9S A;  4CT9 A;  4KBI A;  3I56 S;  1KEK A;  3TVK A;  2JJ4 D;  1XMQ F;  3BS9 A;  5DZ6 A;  2VF3 A;  2HMI B;  2QMU B;  2AHO B;  5HJX A;  4NLY A;  2Z2Z A;  2EFN A;  1HBM A;  1RHM B;  1S0V A;  2ZIT A;  2M88 A;  2KG1 A;  1ZTT A;  5B0B A;  2F4V F;  1OSC A;  5D3G B;  2XYP B;  4B9U A;  2HBR B;  4ID5 A;  3UD3 P;  4L72 B;  1WJ9 A;  2V9K A;  1MNE A;  3AQO A;  4YHH F;  2MPU A;  4KO0 B;  4TU8 A;  4NZ6 A;  4RNF A;  1S77 D;  2CRL A;  1RBL A;  4KGZ B;  4MIW A;  4DDF A;  3QNW B;  2PT0 A;  2F3J A;  3BDE A;  1FK9 B;  4ZVQ B;  2B4U A;  2QTW A;  2CVE A;  5HQM A;  4ZJL A;  2DXE A;  2GX8 A;  4DG1 A;  4P10 A;  1S0N A;  3NOG A;  2HW3 A;  1YDL A;  3S01 A;  1UPP A;  3LW5 C;  3GJS B;  4UQT A;  1FWP A;  3R2D J;  2EFG A;  3FQK A;  2B0G A;  4FXD A;  1D9D A;  3MFH A;  3OTD A;  1F2H A;  5ETK A;  3Q2S C;  4C48 A;  2CVI A;  1MWZ A;  1HA1 A;  3TI0 A;  1X0P A;  2OD6 A;  3IWX A;  1D3W A;  1S9F A;  2EXU A;  3AOC A;  3H7H B;  2IM0 A;  2C2O B;  4NWB A;  2RRA A;  1YBT A;  3I0R A;  2OEL A;  4FVM A;  5HQ8 A;  3M32 A;  3DLG A;  4URS A;  2P6S A;  1X4G A;  4B3R J;  3W2W B;  4AT1 B;  3MPU B;  1B0P A;  4OZN A;  2ZUG A;  3MEK A;  2E5I A;  3L9Z A;  3DN9 A;  1ZPV A;  1JLG A;  1YRU A;  2CQB A;  2YX7 A;  5AXL A;  3TYT A;  2MKY A;  1RTH B;  2GVD A;  1FKP A;  1TVR A;  2Z8Q A;  2DYA A;  1BE4 A;  2W9C B;  4MT1 A;  3CDE A;  1S9E B;  2KXH A;  3HFV A;  5KG3 A;  3NNC A;  1PBA A;  3NGD A;  4IRC A;  4DV4 J;  1NB2 A;  4G1Q A;  5AXN A;  2QA4 G;  1IBM J;  4GRS A;  2GV1 A;  2FVP A;  4JI3 F;  3HXM A;  4NLT A;  2I5J A;  1FEH A;  4J9O A;  2IAJ B;  1FFW B;  2R8J A;  5ETL A;  4NXM J;  1T9Y A;  4OJG A;  4MFB A;  3P5B P;  1UPM B;  1YGY A;  1J27 A;  2DHH A;  2KB2 A;  2U2F A;  4ALZ A;  3AOD A;  4JI6 J;  4ED4 A;  1RSC A;  3BJY A;  1WOO A;  4IOC Q;  1M1G A;  1RT2 B;  3A8I A;  3KG0 A;  2ZBP A;  4YY3 F;  2OI2 A;  2YNF B;  1S1X B;  4ZIT A;  5JXS A;  3ULH A;  3DOL B;  2GIR A;  1S12 A;  2CQ3 A;  4OMF G;  2X3D A;  3IAM 9;  5KFH A;  2J0W A;  3TUJ C;  5KFV A;  1ZZF A;  4A8S A;  4GO7 X;  2EWH A;  1AB8 A;  1RTD A;  1KQF B;  4CLY A;  3QYY A;  2JEG A;  4DL0 C;  5KFQ A;  4RR5 A;  3M7V A;  3FEZ A;  1L3V A;  4ZVF A;  4PWD B;  2SXL A;  4K59 A;  4PWW A;  2XSJ A;  3LP2 A;  1BQN A;  4PZV A;  5E3P A;  1FF2 A;  3M6X A;  2W7O A;  1WG1 A;  1UEV A;  1JLF B;  1RWW B;  1SIZ A;  1NH7 A;  2BJD A;  4HR2 A;  1V3S A;  3GSI A;  4NAS A;  1URR A;  4F3O A;  1TAQ A;  2ZDO A;  4Q7A A;  3PM9 A;  2VG5 B;  2F40 A;  1WG4 A;  3M6U A;  4TU9 A;  3LPY A;  3M9O B;  1NKC A;  2BV3 A;  3W2V B;  2OEJ A;  1VRQ C;  4ZCK A;  3G86 A;  3GMG A;  4Y0F A;  3AB2 B;  3EPI A;  3PR4 A;  1VQK S;  2Z2Y B;  5I3P A;  3NKY A;  1N5Y A;  1RHJ B;  4LT6 A;  1WOR A;  3NMA A;  4Q0B B;  2GO8 A;  3OTC A;  5B08 A;  3VAM A;  1X4D A;  3VWS A;  1VRU B;  5EWG A;  5CHC B;  1NJX A;  4M5H A;  1VI7 A;  2OFG X;  5B0E A;  5J1E A;  2F8E X;  1AUD A;  3BGR A;  2YPY A;  2W2Q P;  2RU3 A;  2AZ3 A;  2E1C A;  1SC6 A;  3VR1 A;  5A8K B;  4OZ1 A;  3OFG A;  3FZB A;  4I6Y A;  1F9F A;  4HI2 A;  3N6L A;  1CJT A;  4CM0 A;  5H9F K;  2DT9 A;  2HVD A;  2BAC A;  1CS4 B;  2BRL A;  3IP0 A;  4PKD B;  2N4C A;  3HM9 A;  1K8A T;  5T7L A;  2EBG A;  1S1U B;  5DG9 A;  5J2P B;  5H9F J;  2H5E A;  4UY8 5;  3BZQ A;  4UW2 A;  4EMD A;  2JLE A;  1YRT A;  1JLC A;  3MEE A;  3I0S A;  2ZJQ Q;  3TOQ A;  3QO9 A;  2BA9 A;  3PNI A;  1VQ9 S;  3FSI A;  3QFW A;  1RAE B;  3RB0 A;  2R8G A;  1OJ4 A;  7AT1 B;  3AXM A;  1X4H A;  1JB0 C;  3GR1 A;  4FP9 A;  1NB7 A;  1XMO F;  1N0U A;  2L9D A;  2MKH A;  4QWC A;  1RT7 A;  1SJQ A;  1NCL A;  2LQ5 A;  1IR1 A;  4B9V A;  2JVO A;  5A0Y A;  1LW0 A;  2VBZ A;  1UFL A;  2CG4 A;  1YBU A;  2RT3 A;  4YQW A;  3KMS A;  3THT A;  2EEY A;  1IR0 A;  2ZH8 A;  3H4D A;  2GQ2 A;  3CTR A;  1VQL S;  2BJ7 A;  3DC2 A;  3MOJ B;  1JLQ B;  1AT1 B;  2D9O A;  2VA2 A;  4M5I A;  4CLF A;  1C0T A;  5LMU J;  3M8R A;  4ZP6 A;  3J7A 1;  3CCZ A;  5HRO A;  3KUE A;  3CF5 Q;  3KLI B;  3DOM B;  4U7U K;  2ZE2 B;  2YNI B;  3C46 A;  2DHG A;  1RT5 A;  3HZE A;  4M5M A;  2MQQ A;  4UOC A;  3G82 B;  1KQG B;  4ED7 A;  3D9B A;  1PAE X;  2K06 A;  1AUS L;  1RBO B;  4ED1 A;  2DEJ A;  2XMV A;  2CDQ A;  4FYW B;  4DI6 A;  2CAJ A;  2P9C A;  2MJN A;  2EG1 A;  2GVZ A;  3FCH A;  4U95 A;  3NBP B;  3RGI A;  1HWU A;  1OSD A;  2KRR A;  1Z4U A;  2V2Q A;  4AND A;  5FDL A;  3OPK A;  3FRY A;  5IT0 A;  5EUH A;  2LQJ A;  3FRZ A;  3OUY B;  4C11 B;  1VDH A;  5GAD U;  5HL7 Q;  1Y11 A;  1WC4 A;  1U7L A;  3VGV A;  1ZET A;  3UN2 A;  4C2M A;  1N32 F;  5IT9 U;  3SQG B;  1V9O A;  4RW7 B;  2EFV A;  2ZC3 A;  1IWG A;  2VFU A;  4BBY A;  4OX9 J;  4QPX A;  3FGV A;  1Y5L B;  4X62 J;  2IJF A;  2AF6 A;  5HLF B;  4DQQ A;  4IR9 A;  1C1B B;  1PSD A;  3Q2T C;  2GZO A;  5DJB A;  2XC9 A;  3E01 B;  3NS5 A;  5IV3 A;  1H2U X;  3PW7 A;  4KT0 C;  3PHT A;  3VAF A;  2CQH A;  3HDS A;  5CYJ A;  1U49 A;  4MIA A;  2GHP A;  4JV0 A;  2B9X A;  3NAI A;  1XN9 A;  5E0O A;  3QWU A;  4ILR A;  1NJY A;  2AYM A;  4DR3 J;  5GAG I;  1TFW A;  3HSD A;  1R6V A;  2VIC A;  1SCJ B;  2NXE A;  1S57 A;  1U1K A;  2QIF A;  4JI2 F;  4JI8 J;  3H5X A;  1T9V A;  2V8D A;  1HNI A;  3CMQ A;  2WRM A;  2DNH A;  4TY9 A;  1P6T A;  3L3C A;  2PN6 A;  1GH8 A;  4LQ3 A;  5L46 A;  2OTL S;  1VFJ A;  5F8L A;  4R0J A;  3Q8S B;  4B3M J;  1MWY A;  4JYA J;  2QYG A;  3UDV A;  2HPU A;  4FKY A;  5IS2 A;  2W2N P;  4U96 A;  5C2C A;  3M8Q A;  3IS9 B;  3KJV A;  4ZA1 A;  3OL7 A;  1TL3 B;  2YKA A;  1WHY A;  1ACM B;  4RBV A;  5HVH A;  3K59 A;  1IWA A;  3N5F A; 
#chains in the Genus database with same CATH homology
 4B3S J;  4JV5 J;  4DR6 J;  4JI7 J;  4YY3 J;  4DV3 J;  1IBL J;  2F4V J;  3D3B J;  4NEZ A;  1XNQ J;  5AJ3 J;  3R2C J;  5IWA J;  4LFC J;  3D3C J;  4NXN J;  4DR3 J;  4DV2 J;  4DUY J;  5BR8 J;  4YHH J;  4LF5 J;  4DUZ J;  5FLX U;  3J81 U;  1N34 J;  2E5L J;  4RJV A;  4GKJ J;  2ZM6 J;  2UXD J;  2UU9 J;  5LM7 E;  5A2Q U;  1XMO J;  1HNW J;  4PWW A;  3T1H J;  2UXB J;  4JI8 J;  4K0K J;  1J5E J;  1FJG J;  5IT9 U;  4X66 J;  4DV4 J;  3J80 U;  4DV6 J;  1IBK J;  4KY3 A;  4HHU A;  4JI2 J;  4KYZ A;  4LF9 J;  1N36 J;  1IBM J;  2UUB J;  4AQY J;  2MQ8 A;  3R2D J;  4JI5 J;  1N32 J;  3J7A N;  4DR4 J;  4DV7 J;  4OX9 J;  4LFB J;  4JI1 J;  1HR0 J;  4LFA J;  4X62 J;  3OTO J;  2HHH J;  4NXM J;  4JI0 J;  5LMN J;  4LF8 J;  2UUC J;  1HNX J;  4JI3 J;  4LF6 J;  4LF4 J;  4NEY A;  1I94 J;  4B3M J;  2MEW A;  5LMU J;  2UXC J;  4JYA J;  4X64 J;  3T1Y J;  3IMQ J;  1HNZ J;  4DR2 J;  4KHP J;  4B3T J;  4DV1 J;  4DV0 J;  4DV5 J;  4JI6 J;  4JI4 J;  3JAM U;  1XMQ J;  4DR7 J;  2KVQ E;  1XNR J;  2MTL A;  4DR5 J;  4LF7 J;  4X65 J;  4GKK J;  2VQE J;  3W1Y C;  2KL8 A;  4B3R J;  1N33 J;  2UUA J;  4DR1 J;  4V1A k;  2VQF J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...