4DV5J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv5J00
4PWWA 4AQYJ 2UUAJ 4NEZA 1N34J 4JI5J 2VQEJ 4RJVA 5A2QU 4JI8J 2UXDJ 4DR2J 3IMQJ 2F4VJ 4LFAJ 4B3TJ 4JYAJ 4DV7J 4YHHJ 4HHUA 4LF4J 4JI2J 1XMQJ 4DR1J 1FJGJ 5LMUJ 4LFCJ 4GKKJ 5AJ3J 2UUBJ 4X62J 1XMOJ 4YY3J 4OX9J 3R2DJ 1XNRJ 4DV0J 2HHHJ 4B3RJ 2UXBJ 4LFBJ 4B3MJ 1N36J 4JI7J 1N33J 2KL8A 3JAMU 2UU9J 1IBLJ 4LF6J 4LF5J 1IBKJ 4NXNJ 2ZM6J 4JI3J 4NXMJ 2UXCJ 3D3BJ 4DV2J 4GKJJ 4KY3A 3D3CJ 1XNQJ 3T1YJ 5IWAJ 4LF8J 3OTOJ 2KVQE 4JI4J 4LF7J 4LF9J 3W1YC 5LM7E 2VQFJ 4NEYA 4V1Ak 1N32J 5FLXU 2UUCJ 4JV5J 4B3SJ 4KYZA 5BR8J 2E5LJ 1HR0J 1HNWJ 4X65J 4JI0J 4X64J 4DR7J 4JI6J 4DV5J 4DV3J 4DV6J 4JI1J 1HNXJ 4DR6J 3T1HJ 4DV1J 4K0KJ 4DUZJ 2MQ8A 4DUYJ 1HNZJ 4DR5J 2MEWA 3J7AN 5IT9U 2MTLA 3J80U 3R2CJ 4X66J 4DR4J 5LMNJ 3J81U 4DR3J 4KHPJ 4DV4J 1J5EJ 1I94J 1IBMJ
chains in the Genus database with same CATH superfamily
1Q4RA 3BKTA 2W9AA 3D1HA 5CAAA 2KKHA 3GE9A 7FD1A 1T94A 5K20B 4F50A 2A6OA 5EWEA 5D3GB 1QVGR 4C4WA 4X4VA 1UPMB 1J2VA 2FZKB 4UZCA 4DI6A 1FEHA 1M5PC 4B9LA 1OS5A 4JI5J 4B3RF 2QLJB 3H7HB 3SDEB 3VCDA 2FDNA 3QO9B 2W7PA 4ZOSA 3IMQJ 3QFWA 4MK9A 3I55S 2YKMB 2Z8QA 3HI9A 3SQGB 4PAAA 3BH6B 4WFYA 4CM2A 2YQ0A 4C2MA 2IJFA 4RU9A 1N54B 1N5VA 2B43A 1SCJB 2MKIA 2HMIA 3GG1A 1MROA 2XS2A 2Q1LA 3THVA 2UUBJ 1TAUA 2QL9B 4OYMA 4ZLLA 2HFOA 2CPDA 1FD8A 3L9ZA 1X4FA 3PHTA 4YY3J 1DRZA 1HI0P 3H5XA 3QGIA 3K59A 2HVZA 4P9SA 5HQLA 4M95A 1JNRB 3C14B 3ENWA 2IJRA 1P6TA 3NKYA 2CZ4A 4NOHA 5KFQA 2LA6A 2H65B 3PNIA 3N01A 4DL5A 1S0NA 4URQU 1N33J 4FS1A 2ZOMA 1HLWA 3M30B 2XMMA 2B7CB 2IPOB 4DCJB 1NU4A 1KQSR 3RR7A 2XB2D 1EB0A 3ZNJ1 2UUWA 3OFEA 2HGMA 3D2WA 3PX6A 1XMBA 4ZVRB 1RSCA 4CDIA 5ETRA 1IBKF 4DL4A 2PA8D 2XZTB 1IBKJ 1WG1A 1VQKS 2PN6A 3C19A 4OI3A 3NP5A 3AY0A 4WFBQ 4KGZB 4OHWA 5D4PA 3GG0A 3D3BJ 4MTPA 1RAJA 4UUWA 4BCAA 4IKAA 4TYBA 1AXQA 2YWGA 1RWVB 3M8YA 4NLWA 5K8PA 1S7HA 1S6PB 5IS2A 3GV5B 2BDPA 1IQZA 2M9KA 3ILOA 4QZVB 3PR4A 1PYSB 3OVSA 3RB6A 2BMBA 2GQQA 4GKJF 3ZZZA 3ZC4A 4U67Q 4E8UA 4PG6A 3GB0A 2A3JA 4GRSA 5C7PA 1KFDA 5C24A 2QV6A 2WONB 2PEHA 1S57A 1IM6A 3CDBA 3L09A 2E9TA 3W2WB 1XBWA 4YR2A 2NYHA 2HK3A 4WXOA 2OPPA 2MKJA 1UMJA 4IH7A 4R0EA 4KYZA 5KFXA 2ACYA 1VK8A 4IOAQ 3K89A 4Y2CA 2JEIA 1SUQA 2ROEA 2LQ5A 4IG0B 3ZXWA 1X0PA 3JYTA 2AGPA 4IRKA 4OJHA 1U26A 4OJ1A 1Q82T 4ERDA 4X64J 2YNHB 3W62A 4B3MF 7FDRA 2DNPA 2BKNA 2H4YB 1KN6A 3GFXA 2BE9B 3AJ2A 1BQNB 2R7QA 1U2RA 4YB7A 1ZTWA 3J81Y 3E01A 4OIXA 2QC3A 4USJC 3AODA 1RT3A 1HNXJ 1UA1A 4M5GA 1C0UA 2JRSA 4HH1A 4DR3J 3M8QB 2R7OA 1X5TA 1T9WA 3R6GB 5A8RB 4DX8H 4AXIA 2MQ8A 2R7SA 4K50A 1CSJA 4ZLJA 4UZBA 4X4UA 3CCUS 3D66A 4NLVA 3UVJA 2DR7A 2RSQA 5IT9U 2IM1A 1SBRA 3SCKE 4XTTA 4X65F 3OUYA 3UDEA 4ECUA 5IC4B 2FLOA 4C8MA 3K5NA 4RUAA 3WZ0A 1TUVA 3MECA 4ZK7M 4USVA 1WDTA 2EK6A 4USTA 2HRYA 3BDPA 4E0DA 2VB6A 4PWWA 1Y5LB 3LP2B 1HBUA 3AH6A 4E2FB 3K5LA 2PMZD 1VBZA 5B0AA 1HW8A 3IA0A 1S79A 3EM1A 2HNYA 2MQLA 2EFNA 2VQEJ 3MEKA 3SV3A 4YB6A 2XY5A 4RJVA 3WIVA 1RHMB 2GAHC 2JL9A 5KFWA 1YJWS 2NR0A 1HNIA 1VC5A 2XG8A 1YX2A 5ETKA 2Y1RI 1H2UX 1VBYA 3CJ3A 3MECB 2CVEA 2ZZTA 3NOGA 2UUBF 3PW5A 1LV5A 2L9WA 1KOHA 1H73A 2CG4A 3CCLS 2VICA 4DG1B 1VLOA 2D9PA 2O5DA 3CT9A 2DNQA 5F8LA 3TANA 4RNNA 4LMZA 4GKKJ 3VZHA 1F5AA 3HHEA 4EEYA 4FF4A 2GGPA 5E41A 2HNYB 4OMFG 3MM7A 1IM4A 2B9EA 3V81B 1TKXB 1LWCB 4G1QA 4CLPA 4B3OA 1VQYA 2XLIA 4P73A 1XNRJ 4CTAA 3WC2A 4K4ZA 4LFBJ 2BA9A 4JI7J 1RTIB 5BJRA 1ICEB 1WUUA 1N34F 1Y9OA 2XC9A 1FTRA 4M5MA 5LXYA 2YH1A 2EFOA 4JI2J 3KK1A 4YOEA 2ZH1A 2XI2A 2GIFA 3EGNA 4HACB 4M5IA 2L48A 3W60A 2FLNA 1MWYA 5G0RB 1DQ8A 4KHPF 2BVZA 4QW9A 2DH9A 4P74A 1I3OB 4DF8A 2BJ8A 2KRBA 1FRMA 3ILIA 3M8QA 4CLLA 4U95A 4CZCA 2YWHA 4IRDA 4ZPDA 3GCWP 1SKRA 1UVJA 2K8GA 2DJWA 5HLFB 5FD1A 4UT4A 1QUPA 1UPPA 3MOJB 2LFVA 5E3AA 3DHWC 3KG0A 1XNQJ 2ACMA 1IKVA 2CA9A 3MR3A 1W25A 1UVMA 1RKIA 4ID8A 4Q0BA 3GYXB 4X62F 2JVOA 3OTOJ 2NYIA 1S1VA 1K0TA 4A47A 1S1VB 2HFVA 4JP8A 3KK3A 2ILZA 3BZQA 1S49A 4L76A 2QFIA 2CQDA 4WWSA 5KFAA 4IRCA 1T0TV 1T9VA 2C3UA 3I5AA 1NH8A 1LW2B 1SB6A 1FCAA 4OJGA 4K5SA 5KT4A 1TL1B 4RNMA 3DRSA 3EVMA 3NWRA 3UCGA 4F25A 2X1AA 1D9DA 3TARA 4DR7F 5KFYA 4ELUA 2B6AA 1HL6A 5G0RA 2OP5A 2HHPA 1D9AA 1RT1A 3BEGB 2QSFA 5FJ4A 3FCHA 3NBPA 1ZH5A 5HP1A 1WEYA 4YY3F 3M1VA 1IKVB 3MEDB 2EFQA 1XMOF 3FSYA 1WC1A 2UVRA 3RBEA 1JJCB 3H42A 3AQOA 1KOOA 1X5SA 1VI7A 2A2DA 1TKXA 4NYOA 4OYZA 4TKTA 2YKPA 1XIQA 3GIIA 2MJUA 2V2VA 3PRDA 4X4QA 2KM8B 1WJ9A 4HI1A 4RU2A 2P6TA 3MR7A 1Q81T 4M5LA 4XDDA 4ZPTR 4NLQA 1QJHA 5ETLA 2A18A 4G3IA 5E33A 5F0WA 4JI5F 4ZVPB 5F8JA 4N5SA 2Y1IA 1UEKA 2YKMA 3I9V9 3HHNB 2HFUA 1Y0HA 1SJ1A 4KHPJ 4PUOB 2EW9A 1FRIA 4KKOB 4F4WA 1WG4A 1EP4B 4PXDA 3UQSA 1VQPS 3PRBA 2GX8A 4WP8A 3S01A 2PT0A 1KTVA 1PSDA 1S1XA 1VLYA 4NRUA 3TEHB 4P2XA 4CLTA 3NS6A 2V0NA 4OYWA 3N79A 3CJKB 2VC1A 1QE1B 1HBUB 1S4FA 1REGX 2UV8G 3N6LA 4DPXA 5L1IA 4LF7F 1JWWA 3K8WA 1GXUA 2GHWA 2ZUAA 4ID5B 4IFVA 1Q7LB 2IM2A 2GMLA 1M1HA 5JXSA 4DR5F 3SQGA 2R8HA 2DBBA 1U1QA 2OPSA 3TX8A 3OBIA 2VPWB 4DHVA 3E2EA 1KD1T 1PCAA 4L72B 2I8EA 3G2XA 5DO2A 5C25B 3IBCB 1YTYA 1RTDA 2MYFA 4IO9Q 4UY85 5DQHA 3IM8A 3MM8B 4WU3A 1CULB 4OI1A 4WYLA 2CJYB 2WZ1A 5J2PA 4WF9Q 2ZM6F 2BE7D 1UCNA 2EG2A 1UA0A 5ETTA 2JZ5A 3LO3A 4JI8F 4ILRA 4EUVA 4ED0A 2JLEA 2LKZA 2W2QP 3QT6A 1LWFA 2OTJS 2ROPA 4QR0A 3HKZD 1LOUA 3DLEB 3TA0A 3OTCA 4RW9B 3CO0P 3FJ2A 3OTDA 2P5VA 2F5GA 4N47A 1PKUA 3PW0A 3IG1A 4IFYA 3UCUP 2UUTA 2GQCA 3MAQA 2A1BA 4NXNJ 1Q95G 2AJQA 1LWEA 1X4HA 4LQ9A 1RLDA 5A8RA 4DOZA 3FNNA 3M2RB 2VHGA 1NMEB 1Y10A 3CJ0A 3D4JA 4HDGA 4K7QA 1RKJA 4C8OA 5CYMB 2VPYB 2DR6A 2KT3A 2ASYA 1A6LA 4J9LA 2I9SA 5C24B 1RWOB 4DX6A 2V2KA 3D5MA 4LR9A 3EE3A 4MKBA 4LRDA 3KG4A 4FBTA 5ETSA 3DYAA 1KVIA 1RWUA 2IA0A 1NJZA 1FKAF 2DNKA 1DQAA 4OZ0A 2BQRA 2ZOFA 1BQXA 2BANA 1S9EA 3ZTQA 3FRYA 2KRRA 3Q23A 1QTMA 1X4AA 1N88A 2ZH7A 3DOKB 3GPAA 1JJHA 2V34A 1TP7A 4DJBA 5K8NA 4BC9A 4K4WA 1OMSA 3SV4A 5IQQA 1UETA 1UP1A 4EBCA 2JEFA 1EAYC 2MZJA 2GJIA 3DLHA 1LFWA 3MUMP 2BRLA 5F0UA 4QYZJ 5A8KA 2D3OR 4F67A 3HPOA 3EWGA 1HNWJ 1ULRA 1Z2LA 3MWBA 4FKXA 4PXEA 1FKOA 3LQVA 2HMIB 2EFGA 1UJ4A 3JAMY 5HMZA 4DV5J 3LP0A 4R8UB 1JLEB 3JXOA 4UOGA 2LP4A 5KTQA 1FNXH 1NJIT 3DHXA 4TVAB 1Y5NB 3US5A 1HQUA 3UO0A 2DCUB 2RKIB 2ADBA 4ZCIA 1NHKL 2BM0A 1NJXA 1F60B 3U1NA 3ILJA 3FEZA 2ZZNA 1NZAA 3VV2B 3OV7A 2CQIA 3MEGB 3SQOP 2GW8A 3DC2A 3I87A 4Z2XA 2DHHA 3NCPA 1CJKA 2C2KB 1NSQA 1KVKA 3QZ8A 1Y3JA 3HFVA 5HP1B 3CO9A 2JWNA 1CS4B 4PEOA 4LSNA 1ZM9A 1Q8LA 5HJXA 1TMJA 2XMWA 4Q5VA 3FC9A 4M5DA 2DEJA 2MPUA 3H59A 4PQUA 2CPHA 4XPEA 3KOAA 1FTCA 1L3KA 3DDKA 4X4RA 3RAXA 4ETZA 1D8YA 1NAQA 2WW8A 2D9OA 3OD2A 2FYXA 3DLGB 2EFVA 2QX0A 3UCZP 1NPRA 3NGTA 3K5PA 4DCPB 5D6GA 2UU9F 3QRRA 2HGNA 4QWCA 4WP3A 5U47A 2GV1A 3B6BA 2FC8A 3NCRA 4JBCA 4B9UA 3KHRA 1WI6A 1NSAA 1WHXA 3TZZA 4N41A 2BRKA 1SPBP 1YGYA 3UW1A 3OVBA 1F9FA 2QN6B 3TZXA 3KK3B 3TO8A 2UP1A 1JLGB 4L73A 3JS9A 5B0FA 2YKNB 1O8BA 2VZ9A 2DNLA 4P2FA 2XTJP 2GVZB 4IG3B 4GMKA 1IKYA 3QJJA 2ATCB 3EDRB 3LPEA 5E0OA 3MUTP 1HQEB 3CJ5A 2E1PA 1RCOB 4BS2A 3VGSA 1NDPA 3A8EA 2VF3A 3DI6B 3BV8A 2LCWA 5KT6A 1R3NA 2GIQA 2YWEA 3GLJA 1WC4A 4MFBA 3UNGC 2JDJA 5E2QA 3UNYA 4C3LA 2UXBJ 4HACA 1VQLS 1C0TA 4ECXA 3IWXA 1MU2A 1NSKL 2O3DA 4URGA 3KK1B 2FY1A 2BUNA 5M2RA 2ZH6A 4O3OA 2DXEA 2VPZB 3AAWB 3SIPB 3MR2A 3EX7B 5HANA 2DNOA 2OO4A 2B9WA 4GC7A 5J1EA 4BC7A 2MXYA 1HD0A 3BB5A 2J8SA 5L38A 5LSRA 1ZM2A 1V5VA 3PYEA 4LF1A 3MM7B 3V6JA 1HYSB 3G9CA 2E44A 1ZAWA 3EZOA 3ZZPA 3G71S 1R89A 1YZ7A 2AV5A 2JJ4D 1M5HA 2VL1A 4ZITA 4DS4A 2N3LA 2H48B 3LP1A 2HWTA 1DHMA 1FWPA 4EGLA 5EN1A 1H3DA 3DFEA 3B54A 3O1LA 1U49A 3T41A 4LVNP 4KO0B 3BQ0A 2PGCA 2G2OA 4QIVA 3UPFA 2NUHA 3X3UA 1B99A 2C2ZB 3B4DA 3LUYA 4WTYA 2WTFA 2RILA 3QT5A 4OZ2A 3O2IA 4PYDA 1Q16B 5DG7A 9RUBA 1CJUA 2PMWA 2HLUA 1RTJB 2WB1D 3W9HA 1H2VZ 4WPAA 5I3PA 3UR0A 3BPSP 3MTJA 1VRTA 3GFZA 2YBVA 3BSAA 1HR0J 3ZTPA 1NSPA 2DGWA 1WF1A 3GJRB 5AXLA 5DQIA 4QU7A 1HQEA 2OPRA 3D7SB 1YIJS 2DRDA 3HHKA 2VBXA 5B0DA 1TVRA 1KWMA 1FVSA 2WRMA 1JNZB 3Q89A 3M6WA 3NAHA 1I94F 2OUGA 2B9XA 3A8IA 5KG4A 2FZGB 4O4GA 3TNVA 4A8XA 1J5EF 4IOCQ 3G87A 2Q6BA 3QJLA 5SZTA 5EWGA 3TUZC 1SH0A 4Q2MA 5L8RC 3IO1A 4YS2A 1N8RT 5H9FJ 3BQ1A 1VQ5S 1ZM4A 4OYBA 3R9LA 2R3VA 3OSNA 3E01B 1KKHA 3HSJA 1P1TA 3PX4A 1S4EA 1WHYA 2IJNA 2RDDA 3HSZA 1YI2S 1QVFR 4DV2F 1UFKA 2RF2A 5M2UA 2VD3A 1RBAA 2XLJA 2RRAA 3IRXB 1DTTB 3CCJS 1UFWA 4NLPA 3MPWA 3OQ2A 2B51A 2LQJA 3LP0B 4RWWA 3D6MB 3DMJB 2NS1B 2Y3YA 3OW2R 3HCXA 4NCAA 2PI4A 1H7XA 1KEKA 2ALZA 3DM2B 4YB5A 1IKXA 3QIPA 5KFBA 5A0YB 4IR9A 1YHQS 3E51A 3TVKA 2G13A 4NA2A 5D4NA 2VFRA 4XO0A 5A2QU 3R1LA 2EBGA 2G2ZA 3DOKA 2X1GA 3EZUA 1VRUA 2YPYA 1U1KA 3O44A 4J9RA 2FVQA 2Z2MA 2NQPA 4K5RA 5KAKA 5CD4H 2HQFA 2F8MA 3DRYA 1D8ZA 1P9QC 5F8HA 1KRPA 4X2BA 1VRUB 2CZ9A 2JLFA 4CLZA 4ZHRB 2CQ3A 1PAEX 1TL5A 2VG6B 3KHGA 2DHGA 3CF5Q 2BOPA 2FVPA 4WP9A 2BX6A 5A8KB 4TQRA 1GQEA 4MAKA 1X5OA 2DH7A 1URRA 2DIVA 3OT9A 4QR2A 2IC3A 4BLGA 2MHEA 3DGPB 1NBEB 2DHAA 2OGUA 3BYRA 3MD1A 3MDFA 4RO0A 1W2BR 1NKCA 2ZVIA 2R8GA 2E5IA 5JVHQ 2W4PA 3AD7C 4DV0J 2KU7A 1X4GA 1HNVB 2JX2A 2A10A 2QTWA 5AXKA 2CQ4A 5L1JA 1YJVA 2LEBA 1T9UA 2KXFA 2XSFA 3CCWA 4Y0FA 4HTJA 1S6QA 1K47A 5SUHA 2R2RA 5F8NA 4CNZA 4DV4F 4DU8A 1IBLF 4DQPA 1JKHB 2CNKB 2E7WA 1DLOB 4J9QA 1L3UA 1MMDA 1KVJA 3L7OA 4NXMJ 2Q3PA 3IGVA 5LL6d 2G2YA 3MXHP 1P9YA 4GVBB 1KFSA 2EG1A 1M90T 4DSEA 1CLFA 1R8CA 1RXOB 3K5OA 4X84A 3DMJA 5AE3A 2VA3A 1CULA 1UJ5A 2CJQA 2MKCA 4ZJOA 4F8RA 1N6QB 3OLBA 2JNJA 1FF2A 2DKOB 3TW0A 5GAEI 2BKPA 3SSRA 1DBDA 3ILLA 3DRXA 3EJMA 3OFGA 4PXCA 4ZVHA 1U1PA 3OXGA 1T7PA 3MEEB 3AT1B 2G0JA 3F41A 3PDNA 3RW7A 2BEFA 2CQ1A 3BSNA 4ID5A 4O4RA 1YITS 1NJYA 1R8PA 5FLXU 2E1CA 5D3GA 4C48A 3RYLA 2UUCJ 3AJ1A 4OQJA 2AKWB 4NL5A 1VQ7S 3P96A 5T7LB 3Q2SC 2YWFA 3DGVA 1U2FA 1U4BA 2ZH3A 2H5JB 2O66A 3NRBA 3T6BA 2H4WB 5HMYA 3CCRS 4DQIA 1HARA 1GX6A 3BO2A 4O3QA 1T02A 3FVYA 4HH0A 4HDHA 2ZEJA 4I1TA 4PQAA 4B3MJ 2ZZMA 2HQ3A 5GMEA 3SSQA 4ICLA 2V8GA 1TL3A 4DSLA 1VMBA 1MLAA 1YJRA 4C0OC 4LBPA 2AQ4A 4Q8EA 3ISND 3GMGA 4CLFA 4DX5A 2VG5B 2C2NA 4X66F 1UEUA 2BZ2A 1QAYA 4NWBA 1YBUA 2MQOA 2LDYA 1RT6A 4I2PB 1VS3A 4DR5J 2MEWA 4Q7AA 2VODA 3J7AN 3IFEA 3F0NA 2KO1A 3DLJA 3R6LB 1IUJA 4OHZA 4OZ5A 4XPCA 4FVCA 3ZZOA 1XQIA 3IR7B 4KBIA 3HM9A 2HRUA 3J81U 1X5PA 1VHFA 4KC5A 4OZ3A 3HVWA 5HATA 4CT8A 4EO8A 1QSLA 2ZKTA 3O8WA 2HHVA 3I4HX 4B9VA 2DGVA 2IVMA 1Q1KA 2OI2A 1RT1B 5HL7Q 2L9DA 3VVTA 1H2TZ 1UW9A 2HWIA 4FXVA 3OFHA 4TN2A 5CXTA 1TL4A 3OJUA 1B0TA 1RWKB 2QT7A 5ETNA 1CQNA 3UI3A 3D0IE 3MM9A 1R0BG 2IIHA 1LFPA 2RAQA 3C6TA 3ETMA 4CNYA 4ZJLA 3GV7B 4OLOA 2EEYA 2C42A 4JI8J 3A3NB 2EVZA 3ZZRA 3VALA 5EGYA 4CH0S 4DSKA 1VGYA 2C3PA 3W2VB 2HNZA 4WE1B 2QMUB 1I6JA 2AGQA 1BQMB 1VJQA 1FRJA 1RT4B 4MKYA 1MSWD 3WX8A 4LF4J 4YMEA 1FRLA 1ZETA 4AFFA 3CMES 2HG4A 3HHDA 1FE4A 2RU3A 4X62J 3OTOF 2MGZA 2SXLA 4KIAA 2JFDA 3OVAA 1XNQF 2DXFA 4J7CA 3R3TA 5I3QA 4K4XA 3V6DB 3Q2TC 4N8OA 2UXDF 3RBZA 3PTWA 3V4IA 2WK4A 3TX0A 2RT3A 1JLFA 3FBFA 2BW7A 3I0RB 1RHUB 1XWLA 1U6FA 2KL8A 4DU7A 1VFJA 1V6HA 3JAMU 3KLIA 2XO7A 2E1MC 1HHTP 2YKOA 3QIDA 1SQFA 2DVIA 2KHCA 5A8WB 2FVCA 2WSCC 2ZNZA 4WFNQ 4AL5A 3NGRA 2OMOA 1MMNA 4U96A 4R5PB 1Q79A 2N4DA 2K7JA 1G6BA 5KFKA 1KNZA 2HS0A 2J0QD 1H98A 3HD1A 3BDEA 1S1WA 2Y0SD 3KUHA 2XULA 1EJ7L 3RUBL 2ASJA 4FKYA 1FI4A 1N4LA 2FUG9 1M5OC 2GJ2A 1JX4A 4OX6A 2PEBA 3NNHA 4W92B 5A2QY 2RDIA 4IR1A 3O5TB 3PW2A 4OI4A 1HQUB 1H74A 2E29A 4PRFA 3AHPA 2M3DA 1WF0A 4C8KA 2AW0A 3PM9A 5B08A 4R8UA 2Z0GA 5KFEA 1TVRB 2GVDA 2DR5A 2HGLA 3TAMA 2JEJA 5KG2A 4TYAA 4WJBA 4ZPCA 2F65A 2KT2A 1PYOB 3RGIA 4WIQA 1N48A 1WORA 4P75A 1R8HA 2XMTA 1RTIA 4KHMA 4CQ1A 1WKKA 4FYDA 1IBMF 4KGKA 2I38A 4OI6A 3JSMA 2C2OB 3I9ZA 2EBEA 1TK0A 1SJQA 2E9RX 1WC0A 2VQEF 2B5JB 3I31A 2GHPA 5HMWA 2ADCA 3CDEA 2VDIA 4TLQA 1WHVA 2J76E 3LP2A 3MMAB 4NPOA 2VONA 3F44A 2XM3A 4DR7J 4OYAA 3HP6A 1C1BA 1UZDA 4MIAA 2ZC4A 3GIKA 3CCMS 1A7GE 3CNQP 3GWCA 1SL1A 3KK2A 1M5VC 3I82A 3T19A 1XJWB 3NGKA 5J1NA 1M1GA 4KO0A 1FXLA 5KFVA 1DJ0A 4ECVA 4ZLNA 3R97A 5GADU 4GKKF 4I69A 4WKYA 4ZP7A 4DR6J 1JK9B 1CC7A 1N52B 3D6HB 4JI4F 2FJBB 4DPUA 3UD3P 2ZBIA 2XY6A 1UAWA 3Q8VA 3NOCA 4L3KA 4YHHF 3NNCA 3E8OA 2YQ1A 2VG7A 4NA3A 1TKDA 1DFDA 4DUYJ 1LWEB 4I7FA 2DH8A 5F9NA 1U02A 3BKFA 4X4PA 1WEXA 4JI6F 2DRBA 3HO1A 1FA0A 3DDIA 3EPGA 2BR0A 3GCXP 3QYYA 3C66A 4PCQA 3T1HF 4KJIA 1XTZA 2J5AA 1IKWB 2LVWA 4NZ6A 3TR5A 2W25A 3JSBA 1T03B 4JI3F 3HHLD 4ZVEA 3RRGA 2IVFB 2YNGA 2ZD1A 3KJVB 2KXNB 3RTVA 3I96A 3H40A 2OSQA 2HZAA 3IS9A 4XDCA 2D3UA 4ETXA 4ZMMA 4FVMA 2XO6A 4U8YA 5J2PB 4H4KA 1PILA 4RL1A 1FFWB 1CJVB 3GIRA 4PG4A 2G4BA 2JVRA 3MPVA 2B0GA 4QBUA 1SJRA 4AYBD 2QFJA 2AGOA 2Y9HA 3FFIA 2WONA 3TA1A 4DQSA 4RW9A 1YSJA 2YKNA 3BR8A 2KXHA 3GTYX 3MCNA 3G6VA 3DOMB 1T03A 2OPSB 4F4KA 3K7RA 4QJVA 2MB0B 4H4OB 4HHUA 1RAHB 4LBHA 1IWGA 2MZQA 5KG0A 2G1HA 5C42B 2I2YA 2HHTA 1FK9A 3GFYA 5B0GA 4F4AA 4DV7F 2E66A 2MSSA 4IG0A 2V68A 3I32A 1S6PA 2WSEC 2AJ0A 4ZP8A 4ZN1A 5KG7A 2Z30B 3VAFA 4A8OA 1NDLA 4LFAF 3MM8A 3DLGA 3GYNA 2QRRA 3R2DJ 1Y11A 4Z7YA 4KKOA 2WVDA 4PUOA 4F3OA 3ULHA 1F3FA 3RRHA 1S1UA 2VFUA 1C4CA 1GMVA 2GC8A 4ES2A 2PMHA 3RZAA 2K3IA 4LF5J 1KQFB 4ZJQA 1FD2A 1FJGJ 2W01A 3U1LA 1QE1A 4TU7A 4XIUA 2MKSA 5EX3A 2B5JA 1O0PA 3FKBA 1YZ6A 1X9SA 1YWXA 1OPIA 1UVLA 1NKBA 1S1XB 3A3PB 3CCVS 4PG8A 2XMAA 4ATNA 1JLCA 3D3CJ 1LEOA 3HDSA 3CWJA 2RKIA 5GAHI 4YQWA 4DF4A 1ZZNA 3DLLQ 1TTHB 2HEKA 1PJ5A 1RABB 2W1BA 2XYPB 3ISZA 3MEDA 1PJ6A 5B0BA 2R7WA 2AEFA 3S7RA 2F9JA 2RQKA 4AD6A 3NBPB 4PPZA 1CVJA 2GVDB 3KYLA 2K1RA 3MMCA 2E7VA 2DEIA 4NXMF 3JSRA 1YLXA 2MMYA 1E6VA 3PFEA 2B6AB 5LXRA 4V1Ak 2BACA 3KXDA 3JQJA 3TAPA 2H51B 2BKOA 4HHHA 3SMZA 2KT5A 2XMKA 4ZCMA 1CG2A 1S1WB 1GX5A 1TMMA 1VR6A 3FEXB 3VF0B 4BBYA 3OJSA 2R2SA 5J2QB 3TJ8A 1SQGA 2QZ8A 3WBZA 5DDRC 2HVDA 3H25A 2ZH9A 2CVIA 4J5OA 5GAGU 1HR0F 3K17A 1OJ4A 1WTBA 1MN9A 3AB2B 4C11A 3P5BP 1HHSA 2FPHX 1Y3KA 3H4DA 4DSIA 1KLNA 4C8NA 4O23A 1S72S 2KN4A 3DYAB 4DBQA 3CTRA 1R6VA 1F3VA 2QIFA 3D6TB 4FYXB 4Q0BB 4MK8A 1FXDA 4YDXA 4QYRA 3UN2A 4FXDA 1RAIB 3DOLB 1V9OA 4OHVA 1BLUA 2MY8A 1L5UA 3MM6B 3KLEA 1BUXA 2CQ2A 2UVVA 4WZQA 6FD1A 2HLTA 1SC6A 2QJ3A 1RWNB 2ZH8A 2DNGA 2G9OA 4ED8A 2YKAA 4A8FA 1TL1A 1D9FA 1YK9A 1NDKA 1LW2A 4DUZJ 2B4UA 1EETB 3MOZA 1H72C 4QWAA 4GVLA 3IG1B 2I1RA 4IFYB 3TRGA 3ONQA 5JUMA 1SXLA 4JI0F 1WEZA 1U7LA 3IP0A 2J0WA 1L3SA 5DETA 1QSSA 3D0GE 4QWDA 3R7BB 1RE1B 4G1PA 4DLGA 4ZA1A 3CC4S 2CQHA 2XGPA 4K4VA 2CZVC 4QPXA 1G7CB 4C9DA 3WDOA 2HAFA 3BGLA 1CJVA 2DO0A 2OFGX 3M6XA 1SV5B 2YKQA 3U7JA 4DSFA 1KLMB 4DL6A 1F2HA 2ZHBA 1D0EA 2HVHA 2EC2A 3IS9B 2MY7A 1R31A 2GA7A 5B0EA 2M7SA 4I56A 3MCOA 1VYAA 5H9EJ 4P71A 1WNEA 3TI0A 2HIYA 2VUGA 2YH0A 4PYAA 2CWXA 2BJEA 5KFMA 2IBKA 3T5JA 4DV7J 1GTHA 1OY8A 2VJUA 3CGIA 4OYPA 4EFAC 3W5ZA 2QA4G 1R27B 2KVIA 2K7KA 1HNIB 3TA2A 5JVGQ 3MMAA 3P5TL 2WOMA 3QGGA 1VQ6S 2EPIA 2B9YA 4G1IA 1A0OB 1NJWA 1ELOA 5K14A 3H5YA 3QT8A 1OO0B 2NSBA 1YG0A 3MD3A 5B0CA 3BR9A 2YPZA 1TKZA 4MYUA 4R0JA 3V4MA 3LA0A 2ERRA 4FN5A 1N0VC 2QG9B 3G82B 3ITHB 1EP4A 2FHOB 4RKUC 5CZXA 3A12A 3W7BA 1TL3B 2VFSA 3GSIA 1EIYB 2VBZA 5HQ8A 4ER8A 5MAOA 1BD6A 2P9GA 1GH8A 2CPFA 1VHIA 3B4MA 5F8MA 5BR8F 2UU9J 4ZP6A 2CPXA 2E9ZA 2D74B 1V3ZA 4N56A 3IR6B 4ED5A 2YNIB 4RR5A 3QMQA 3Q22A 2QL5B 4RW8A 3Q8UA 3QWPA 2HQGA 3PACA 2L9NA 4I0WA 4O44A 5DJBA 5J2NB 2J6TA 3N5FA 4CO3A 2VQFF 1R0AA 2EWHA 1HBMA 3M8PB 3BYPA 5E3RA 5K14B 2OEKA 2JHEA 4J90A 3JSMB 3GQCA 4RLEA 3HLUA 1G3OA 5CQGA 4YR3A 2KZMA 2Q66A 2IMWP 1GEHA 3LOUA 2CFXA 4R5PA 4YFUA 3G6ES 3ZO7A 2C22A 5LOQA 1FHTA 2OLWA 3CW2C 2NZCA 4NCGA 3GIJA 4DUZF 1N0UA 1SH2A 1QD1A 1UWBA 4F0KA 2BJ3A 5DGBA 5KT3A 3M9OB 1Q5VA 2NUUG 3HZEA 4RW4B 3VR1A 4ZLPA 1FFGB 1Q8KA 2XNQA 5KG5A 5EDWA 3I0RA 1HD1A 5CA5A 3D0HE 1GXLA 1FWLA 4C3MA 4K4TA 2Q79A 1KS2A 3VVUA 4AT1B 5LSLA 2KG0A 3MM5B 4KV8A 1KR4A 2BABA 1AW0A 3AA9A 2IAJA 3ICLA 4ZP9A 4DV5F 1QAJA 3C2PA 1WTFA 1XC9A 2FLLA 1BWEA 1XERA 3W2WA 5CYJA 2MQPA 5HSPA 4X65J 3JB9k 3KLFB 1KQKA 1M0SA 3CEDA 2E5GA 2YWKA 3VZIA 3NMAA 1AROP 1RTHA 1GAOA 2DNMA 3C6UA 1HA1A 3MAAA 4L3NA 2RE1A 2DGXA 4O3NA 4X4SA 1YJ9S 5LJ5Y 5KT7A 4A8WA 4F26A 4K4SA 1YRXA 3A4TA 1K1QA 1DARA 4JOUA 3V4IB 3LW5C 4OL8A 1TL7B 2ZKUA 4IOBA 2BBEA 5LT5A 2GIRA 2HURA 2OPQA 2DGQA 2HSEB 3GONA 2BOAA 2R2UA 4M1KA 4LBIA 1J27A 4NZ0A 2CAJA 2F4VF 5C5JA 1S6UA 3EICA 2DNHA 2CJXB 3UN5A 1W7WA 4K2XA 5H1SV 4NZ7A 2MZRA 1TK5A 2OJ3A 2HZCA 4KTQA 4EZ9A 1RBLA 1F5CA 2BYCA 2B7BB 5H9EK 2CNNB 2KFZA 1BQMA 4CCHA 1B7FA 3LTOA 2OH2A 4NCBA 1G1XA 2DO4A 1B0PA 5L46A 2CRLA 3EDQB 1X4DA 1B64A 4CTAB 3GFHA 4OYIA 3M2VA 4F04B 3C14A 5E3PA 1LWCA 2DGUA 4Z37A 2KHDA 1VQ4S 3HT3A 2R7XA 5A0YA 5KFOA 3G6YA 1QM9A 3AOBA 5JMNA 1BWVA 4EBEA 2FGOA 2CPJA 2UXDJ 3MMCB 1IR0A 4Y2MA 2FB0A 3HKWA 1RA7A 1JJ2R 3ENAA 2WHOA 2F8EX 4QIFA 3C15B 4LREA 4M5HA 3EXCX 5KFGA 1SC3B 3SYZA 1CEZA 1OIAA 2KJVA 3IRXA 3NY0A 5K5MA 5F3ZA 1TUGB 2F63A 1FEEA 2OAUA 3QO9A 1WKLA 2XMUA 5HI7A 3THPA 1JLCB 1X9MA 4J9NA 4NRTA 4QIWD 4H4MB 4RW6B 2RQCA 5KFUA 1XMQF 2PFFB 2AU0A 1JXVA 5KFCA 4ECZA 4RUHA 2RU9A 2OEJA 3Q83A 2GZOA 4OJ3A 3CB4A 3EZ5A 4LF5F 2E7XA 2VG5A 3MAHA 1MROB 5A6PA 2DIUA 1R6YA 2HVEA 4EWTA 4CO5A 4RPFA 1JB0C 2P2CB 1VJWA 1CBKA 2R4FA 3NCQA 4WKRA 5KFZA 1AFIA 1U8WA 4CLKA 3CC2S 4PZVA 1BHNA 3LWMA 1Y5IB 2E5LF 3TUJC 1U09A 4ANEA 1HI1A 2DGSA 2FJWA 4FZVA 1KBRA 4ES1A 3OPKA 3NGSA 5AE1A 4ZVFA 3I4PA 3PKYA 2DXDA 1Z4UA 2V8DA 3ADAC 4FDFA 2ZM6J 3CD6S 1RAAB 4HTIA 3W5XA 2B3TB 4D3HA 1OSCA 1WC3A 2NXJA 2V6AA 4JI3J 5G4DA 4IQMA 4W98A 2ZHOA 3CJTA 4YN3B 3KHHA 4GVBA 2QLBB 2BJ9A 3WHIA 2W9CB 5HN0A 1NK8A 3DLKB 5KFDA 3BBCA 5FLXY 5FIIA 3G4SS 2F40A 2Q6CA 5B09A 3QZ7A 5K9FA 1NUEA 4B3TF 3NGUA 1RTJA 4RW6A 4LT6A 1SJ3P 1U0HA 1PYTA 1AA1B 2AJ2A 3MPYA 4LF7J 3W1YC 1FO1A 4DR6F 3UR3C 3UFCX 3MF5A 1IJEB 3ZZUA 1NK4A 1N6QA 1RZMA 4KPCA 5KFFA 4NEYA 3LGMA 2GHVC 2A2CA 2CQBA 1RT5A 3MCSA 4I7FB 1SUQB 3G96A 5HBMA 1RHJB 3JYTB 2QMXA 1EX8A 2ZBCA 3NLCA 1OPZA 4WYWA 1JQGA 1OQ3A 3LP1B 2FHJD 2NPIA 2C3YA 2OPPB 3NS7B 3QAUA 2AHOB 2EK1A 4G6VB 3JTPA 4MKVA 4P2MA 1QDUB 2ALYB 2XI3A 2CUYA 3CJQA 3H5SA 5KOWA 3BQ2A 4EYIB 3RB0A 1CJTA 5CYQA 3NL0A 2CJKA 1KTQA 4WFAQ 1MG7A 1Z2ZA 2CYYA 3FCWA 3SZ2A 2LLZA 5HROA 2XLKA 2WSFC 4OZ1A 2CQPA 3SEOA 1Y4ZB 3FGVA 3RAMA 3S8SA 3TAQA 2M52A 4TY8A 3R7NB 4ZVSB 1KQGB 2WBMA 3F56A 1MU2B 3GZ7A 3M8RA 5HK4A 1AUSL 5LMUF 3LWLA 4JI1J 4Y3CA 1S76D 3P6YC 4LF4F 2W7AA 4Q44A 4CO1A 1IKXB 2M2BA 4JYAF 1SC4B 2H54B 1B3TA 2F8HA 1S12A 4KHRA 2HHQA 1V5IB 3MGJA 1NHVA 4C3KA 3H90A 2H9ZA 4IG3A 2LU2A 3EUNA 4KH0B 4Y34A 2XY7A 2I5JB 4I67A 2XBPA 1HBNA 4IQXA 5F41A 1DTTA 3CCZA 2QGFB 3PYDA 3K0JA 3HT0A 3OL9A 3PEHA 1RTHB 3LF0A 1GFWB 3IWLA 3W5YA 4DSJA 1AT1B 4LSLA 4DV4J 1ITPA 2J8AA 4ZVGA 3POTB 5KFTA 3T3FA 1I94J 1IBMJ 1FDDA 4MIWA 1JLBA 4WIIA 1T9XA 4RNHA 4EK2A 2KFYA 2DPJA 3DM2A 1O6XA 3N6NA 2A6MA 1LXNA 2FJVA 2C3MA 2IAJB 4LIWA 2C2MB 5BYQA 1WF2A 4ED3A 2VBWA 4JV5F 5CABA 1GMUA 2J6UA 1PG5B 5LJ3Y 5DGAA 4B3TJ 3PR5B 4JYAJ 3I6PA 1C4AA 1W26A 3TP2A 3FBEA 1IQTA 1CS4A 2CDRB 3T6JA 1WOPA 2E1RA 2XYHB 2EC0A 2K06A 4ILLA 4KR0B 3IRWP 4DN9A 4DR1F 1REVB 2JSXA 4OHXA 2OD6A 4NA1A 2HQCA 3OFFA 1VQOS 3BSCA 4FPRA 1VISA 1RYRA 3EXYA 1GTEA 4F3MA 4DMZA 4EYHB 2W7OA 4DL7A 3BS9A 2BQ3A 1RUSA 2OELA 2QLXA 4J91A 1Y7PA 4LSLB 2FHJA 5IV4A 5DDOC 2DRAA 2KM8C 1BXNA 1WD6A 1YJUA 2XMJA 3FUYA 4O4GB 1UWAA 3PFOA 1WI8A 1B7YB 2NXCA 3W2VA 1CC8A 4N76A 4DUTA 3BSOA 2FVSA 2RD5C 1IBLJ 4AQYF 1U1RA 2HW3A 1C2PA 3KNGA 4KFBA 4OX9F 4J9UE 4MJKA 4C7QA 5KFPA 3G8TA 3W8GA 1T8EA 1FJ7A 2Z4PA 2NZ4A 2R7VA 2WVFA 3IM9A 2HPUA 3M32A 5GAEU 2GAGC 2ZBRA 3FEYB 1S0OA 1BC6A 4LR8A 2HWHA 5GADI 2MGZB 3IBWA 3S1TA 3G6XA 3OHAA 5J1PA 4DV2J 1IR2A 4HHJA 4ZPWR 3U27A 3MTKA 3TZWA 5F9LA 3IBFB 4LQ3A 4O3RA 2P8IA 3P4UB 1NXIA 4J9VA 5L1LA 2BM1A 2UV8A 3JTNA 5KFIA 5M2PA 2HVIA 3TVYA 1FKPB 3BGRB 4DR2F 3OSPA 1T05B 1VQ8S 1FNOA 1TV6B 3OHBA 1Q7YT 1C1CB 3BN7A 3GR1A 1RK8A 1ZA1B 2MLZA 1C1CA 2M70A 2D3ZA 3JSYA 2FHMA 3QGHA 8ATCB 2RJZA 3CE8A 2V69A 3AD8C 5ETPA 4BWJA 4CYUB 2VQFJ 1HHQA 4ECYA 2UXCF 2LYVA 3R5DA 2YNFB 4KAIA 5GAHU 3HVTB 4CWBA 5CCMA 3H20A 2JFKA 3PJWA 1RT2A 2OHDA 5KFJA 3I56S 4FP9A 2LXIA 1RI7A 4FF3A 4RW7B 4OI2A 1RAEB 1LWXA 3AFGA 3PY8A 3BJYA 3N0VA 3DU6A 2R8IA 1Q86T 5AE2A 4DL2A 5L39A 1KLMA 3GV8B 1SI9A 4QWEA 3KMQA 2XSJA 3PRVA 3QJPA 1OYDA 2W4CA 3D9BA 4IH6A 4ED1A 1U1MA 2UUAF 2I6WA 1IXKA 1TV6A 3AOCA 2CQGA 2V67A 3ZZYA 3SFUA 2DK2A 4N7TA 2K2PA 4X4NA 3AA8A 2OKQA 1UEVA 2CADA 3GYGA 2M8DB 3UDVA 3KDNA 2CWKA 1U25A 5ETQA 1K0VA 4MFBB 2LU1A 4RUBA 3BO4A 3OXLA 2F7VA 4DV1J 2PDAA 1B4SA 3FQKA 3SXLA 4ELTA 2R7UA 1OY9A 4ZPVR 2HIQA 2M0GB 2KG1A 2P6SA 8RUCA 5K8OA 1LXJA 2J0SD 4WFZA 2HBRB 4CH7A 4CT9A 2DISA 5IXUA 5GMKa 2F1FA 3PVXA 3KFWX 3MFIA 1X0FA 2IRYA 1D09B 3CCTA 5C25A 4M5DB 2VU5A 4UOCA 4ZCLA 3PG9A 1ZYQA 1JLGA 1M5SA 2AJ4A 2IRUA 3NWGA 3Q0AA 2Z57B 1XEZA 2FJDB 1S97A 3IWNC 1F2GA 5D77A 4I64A 1SKUB 3A13A 4Q2LA 5IC6B 4AQYJ 4AL7A 4I68A 4DG1A 2UUAJ 2HFSA 2DYAA 1BMQB 1FRXA 2BE2B 1FFSB 4KGMA 4ED7A 3UD4P 3KNAA 1T9YA 2MHNA 1F1BB 3P45B 5ETOA 3QLHA 2AJ1A 1DURA 2VV5A 3MEEA 4B02A 1LKZA 1V3SA 4RZRA 3KJFB 1N5TA 1S6QB 5EWFA 1SJFA 3QWUA 5I42A 1T11A 1YVFA 4IH5A 5E7OB 1LQ9A 3VAMA 4RUCA 2ABYA 2KTQA 2HRTA 1CJKB 3FSIA 5CZVA 5KG3A 1IWAA 1YJTA 2RDJA 3CIZA 2ZE2B 3S6EA 2R8KA 1E6YB 3J7ZT 1FNMA 3IAM9 3MMJA 4J9MA 1IVZA 1XK8A 1JLBB 5HVGA 2PI5A 1N36J 3MMBA 5J2MA 4OZJA 2NXEA 3A3OB 3M2VB 4X64F 4RBTA 3EGVA 2LQ8A 4CRJA 3IAS9 5K8MA 4F4XA 1ZS6A 4PKDB 4O3PA 1U0SA 1FVQA 4UUXA 5HO4A 2G1DA 3PV8A 2QE5A 1UVKA 1JLEA 2HHHF 4MK7A 5HAOA 3O3LA 1U8SA 2XWYA 2R7RA 2DNZA 3KG1A 1HWJA 2O01C 2V9KA 4W4MA 2LXUA 3W64A 2HZVA 4B9MA 2HFZA 3FBCA 4HLBA 4FF1A 2FZCB 2XCPA 1PJ7A 3CD5A 4AE5A 4OZLA 3ZFVA 4FNHA 5CYMA 1MWQA 3P8BB 4Y2IA 5DZ6A 4HYKA 5DLFA 1N33F 3ET6A 2VG6A 2IM3A 4DDFA 2QMWA 2DGTA 4L74A 2W9BA 1X7VA 2DGOA 4CO0A 3T1YF 3T1YJ 1FK9B 4YB1P 3TZYA 2KVQE 3CDWA 2HS4A 3T1AA 1SL2A 2FJAB 3C8YA 3RJMB 3ZTSA 4PWDB 5KOXA 2V2QA 2ATLA 1RHKB 3E3XA 3NS5A 4U6PA 2YX7A 5F3TA 1TUWA 1S1TB 1QY7A 2IFXA 4GC6A 2BW2A 2I0XA 2RVJA 2ZOGA 4LRFA 4JV5J 4MIBA 4L6V3 1JLAA 3BREA 3MPDA 3SI8A 5KFHA 4B9SA 4FXWA 2CJBA 2G0CA 2Z58B 3O6QA 1NLKL 4RW8B 3K8VA 1HW9A 2CNLB 2Z56B 2ZD1B 3EGWB 3SCIE 1RTDB 3OR2A 2ASLA 3DLEA 2VFVA 1UKUA 4O0IA 2JLGA 4N77A 5DG9A 4DV3J 1ZPWX 4NCGB 2YX4A 3CJ4A 4U7UD 2DITA 1LWFB 1M5KC 1S6OA 5F8IA 2MQQA 4NLXA 2HNDB 2IDEA 2V2ZA 3FMWA 1U1OA 3T1HJ 1P1LA 1ZOTA 2AEJA 2DTJA 3M4XA 2OFHX 3CCES 4JV0A 3Q8RB 4J9PA 4QYZK 4WFXA 4HI2A 2YXLA 4O44B 4TNOA 1HNZJ 2RHQB 1A9NB 2H3EB 2WOMB 4K8RA 3BF4A 1S10A 2VJVA 3PZPA 3D54A 3KJNB 1ZM3A 3K58A 2MKHA 2MLYA 2V8VA 1FJEB 1ZA2B 2OPRB 4L75A 3KK2B 1SQEA 5D0HA 2C3OA 2V94A 2DB1A 3MI7X 5IT0A 3KLHA 2R9LA 4OHYA 1WOSA 2PE8A 3HSGA 4S0MA 2EKNA 3H2UB 3T5LA 2YX1A 4A8MP 1NH7A 5H9FK 3CJKA 1R43A 1F9EB 3KKFA 2ZC3A 4HVZA 3DNCA 5HQMA 4OFZA 4B08A 4DQRA 3L3CA 3KLGB 4NEZA 2ZFHA 1QTNB 4IUFA 3BGUA 3EGZA 4OYXA 1RYSA 4A4JA 4DR2J 3R5CA 2W8KA 2UUCF 2KZZA 2ZJQQ 2J7UA 1KDNA 4HT7A 4LFAJ 2V50A 3SCJE 4F0HA 4DL3A 1RJJA 5KG6A 1JMTA 2MJNA 1WSVA 2GS8A 2X1BA 3CDUA 4ANDA 4FBUA 4DPYA 3BKUA 5D4OA 2DNNA 1RHRB 1S9GB 3QATA 1HWKA 2N3OA 1ZPVA 3OR1A 5DLGA 4FS2A 1H6KX 4NI2B 2WBRA 2J9DA 3DI6A 3NMRA 1HFEL 1HBOB 1UFLA 3K57A 3I0SB 4A8QA 2IM0A 1RAFB 4Y2KA 3LGNA 1UZHA 4USMA 1V3RA 1FT8A 3J7YU 2FVRA 4BHQA 4EI2A 2HHHJ 5LSOA 4NYZA 2AYGA 2JH3A 3CPWR 5E3QA 3DOLA 7AT1B 4YEAA 3OXFA 1K8AT 5GVQA 3OLAA 1JXEA 2DT9A 2K3KA 3DXSX 4Q8FA 2IMOA 5ETVA 3LAKA 2EKYA 3HMJG 2AF6A 3EVWA 4QIGA 3CDAA 3FDSA 3PJ9A 4P10A 1FESA 1GMWD 1EQ0A 3VTIA 2QSWA 4O3SA 3GJTB 1TKTB 2LEAA 2D69A 3MR5A 2UXCJ 4A48A 4DR3F 2QA4S 5HLFA 1QSYA 4U7CA 2IYGA 1B0VA 2M4MA 3PCOB 4NYPA 4PG7A 2QA2A 4Y2AA 3QT7A 4LFBF 1X4EA 2VKZG 4CLSA 1TKTA 2X3GA 1WDDA 1TELA 2FJEB 2LA4A 2PO4A 2GVZA 2ZBPA 3MM6A 3P3DA 4HL9A 4LSZB 1AB8A 4NX9A 3ZZ0A 4RW4A 5IV3A 2XZWA 1TK8A 1AFJA 1APSA 2W4DA 5ETMA 2MZ1A 4K0KF 2BJ7A 5AJ3F 1TU0B 2Z2YB 5LM7E 3Q8SB 3OL8A 1NCLA 3EVOA 3PO5A 3RU0A 1KC8T 4BDPA 4KSEB 1H7WA 2HFNA 2ZVSA 3R8YA 2KYZA 2Y0BB 4KRWA 3MPUB 2ZJPQ 1HMVB 4XK8C 4NXNF 4WXWA 4NLOA 5J2QA 2XWXA 2KYXA 5DM7Q 4GO5X 4V19J 3TUPA 4M8LA 1U1LA 4I2QA 1UW4A 3W8PA 4KPYA 5J2NA 1RWXB 2GGPB 1HPZA 3HHLC 4DEZA 4DFPA 3OR1B 1P8GA 3WC0A 4DR4F 5DRKA 1HBNB 3CMQA 2K1RB 3H8YA 4QPTA 4JI6J 3AXKA 3PYFA 1UWBB 3M7VA 4LF2A 3D28A 1PBAA 1NK9A 1S1UB 1N5SA 1YBTA 2BV3A 4H4KC 2DHXA 5JJBA 4WU2A 4NLUA 4F0MA 4BWMA 2ZH2A 1NK0A 3UD5A 5D15A 3SFGA 1RP5A 4G1QB 2FQQB 4TXSA 3FQLA 4K0KJ 5DM6Q 4DV6F 1R0AB 5IQ6A 4KGXB 4UOFA 3HHLB 5IM0A 4FYVB 1S9EB 1WHWA 3GJSB 3NEKA 2EFPA 4CO4A 2VPXB 2XEXA 3J7A1 4X66J 1FE0A 1P27B 4CIOA 3BGOP 3I5CA 5EHHA 5HROB 3HULA 4URSA 3QNWB 1FKOB 3HJVA 3DOMA 2N82B 1PGZA 4W90B 3EPIA 2ASDA 4USKA 1YDLA 4B3SF 4DV3F 1Q8BA 3JQKA 2Y1JA 4KT0C 1SVDA 2HS3A 1RQ0A 4CO2A 4C6AA 2FJXA 1S59A 4X4OA 4QCLA 3DLBA 3VAHA 2AX0A 2Z2LA 4P52A 1S9FA 1EKSA 3IC1A 1N34J 2FD2A 2BANB 2B4PA 3AXMA 3DCAA 3ELHA 1HIYA 3VHQA 5KT5A 3D6FB 4CP5A 1WC6A 5A76A 2DPIA 1S1TA 1Q0NA 3CJ2A 2CQ0A 3HK2A 4PR6A 1U0HB 3EMTA 4H4OA 4NLTA 2AP6A 4C8ZA 1F9HA 3A8KA 3TYTA 1CQMA 2M88A 1RACB 1RWMB 1U6ZA 2IYIA 1XMQJ 1RDRA 1WSRA 3HJFA 1I5OB 2VH7A 3TJAA 1SC1B 5B7WA 5LMUJ 3UVJB 3DLKA 4JI1F 2BJ1A 3FK4A 3PXGa 1XMOJ 2Q43A 1RTZA 4NE9C 1GNKA 1LW0B 2C1EB 4GO7X 4KQZA 4DZDA 3MURP 2GO9A 4LF6F 5A6WA 4YR0A 4OV1A 3D67A 1K73T 3ZNUA 3KLEB 2CDQA 2XMVA 4I6AA 4LUBA 1DY3A 1U2CA 5C2GA 1KSPA 4IO1A 3HD2A 2R8JA 4DCOB 4P6QA 3DXBA 2GCFA 3KJQB 2YNHA 4IFVB 4B3OB 3FZ2A 1FDNA 4NLDA 2XQCA 1EETA 2CIMA 4AL6A 3V6HA 1RB0A 2NXUA 2VG7B 1RWWB 4UOHA 3ET6B 5LMNF 2QA1A 1T95A 3T9ZA 2DY9A 2R2TA 3LGHA 2N7CA 2KFNA 1NM2A 2IC3B 2V5HG 2VDHA 4H4MA 2YQ3A 1B70B 1YRUA 3DU5A 3L7UA 4M5KA 4FF2A 5CCLA 3L4BC 3UE2A 3VGUA 1ZBTA 4ENOA 1NB2A 3MZIA 2E5JA 3JTOA 5IWAJ 4IDKA 3T9NA 1PC5A 3N4WA 1PO6A 4ZVUB 3PX0A 1HNXF 2QL7B 3B78A 3PIOQ 1FJGF 4NLRA 2L3MA 1OY6A 3R27A 1R8AA 5CHCB 5HVHA 2X1FA 1G2EA 1HPZB 1Q8IA 2W8LA 4USWA 1PAUB 3G8QA 3TJ9A 1HWLA 1X9WA 1F5BA 3PYGA 3ZZTA 1WG5A 2U1AA 1VC6A 3FCVA 3PW7A 1QAIA 2PD1A 2E5LJ 2B4VA 4UW2A 1HMVA 1E6VB 2OD4A 2JOQA 2ZE2A 1SIWB 3PHEA 3PIPQ 5HVFA 3M1VB 4ZIVA 2V4QA 3R1HA 1SL0A 2HBYB 2HQDA 1HWUA 2W2MP 1TAQA 2UZAA 3LALA 1R0CB 2DNYA 4Y65A 4ZS6A 3TAMB 4IDKB 1YQHA 5MLCV 1RGVA 4JV1A 3C3LA 2ZHAA 4CLWA 3KLGA 1YRTA 2CJAA 2XZDB 3QPIA 4QQBA 4ZDNA 3Q8PB 5DZ7A 4DV6J 3SDEA 4B9NA 1Z1ZA 4AUKA 1FRKA 2U2FA 2ZUGA 3GR0A 4K2JA 3TWZA 1GT8A 1OQ6A 4O0NA 4WTOB 5DDQC 1ZZFA 4USIA 3TOQA 3VQTA 1NPPA 4MMOA 4YDDB 1MWZA 4P2SA 4Y6IA 4ZKAA 1NK6A 4B9TA 3G8SA 2HBQB 3R5AA 1O51A 4TLRA 5C42A 3R2CJ 3NGDA 4WK3A 2FY8A 4DV1F 4DR4J 2NCKL 1BY9A 2RH3A 5ITHA 2LDIA 3HFZB 1R8BA 1RT4A 4PXBA 1NZ8A 5DS7A 5HMXA 4C97A 3KLFA 2VA2A 4CLYA 1MNEA 4JUZA 2HNZB 2UVUA 2A0FB 1XR5A 2GNKA 3AQPA 1L3TA 3H0PA 4F4YA 2B8QA 2MKYA 4M5NA 3D1QA 3V6KA 1SJ4P 1J5EJ 2DR8A 3V6DA 4H54A 1VIOA 1UTAA 3U02A 4ES3A 4QU6A 2DCLA 1LW0A 4WK1A 1HBOA 1LNQA 4EU0A 4DWIA 2N7YA 1SIZA 3GU0A 1SKWA 2QEXS 1DAXA 2DY1A 3VGTA 4YUDA 5FDLB 3KLVA 2UXBF 1U48A 5IOLA 4ED2A 1QLNA 1VC0A 3PO4A 1R7IA 2R7TA 3MHYA 2RNEA 1UL3A 2CQCA 2RHSB 4TU8A 2F4VJ 3OL6A 1IKWA 2OTLS 4CYUA 4WE1A 2B8PA 2HKEA 3W65A 2XCAA 3RR8A 2J7KA 1AZSB 3G86A 2VIHA 2G0IA 2AX1A 4UQTA 3QAEA 5L9XA 3KMSA 4LFCJ 3GP9A 5I3UA 2MSTA 1X4CA 3CD7A 4QWBA 3OTEA 2IDLA 3QFHA 5DG8A 2YTCA 3QGPA 5E3CA 1RU1A 2X7IA 4RW7A 3Q8QB 4JV2A 4NI2A 1NNDA 2YY3A 3M6VA 1S9GA 4B3RJ 3HVTA 4R25A 5RUBA 2H1YA 2YNFA 4LFCF 4C8LA 2HHXA 4RX6A 3CCSS 2FLPA 1Q5YA 1U6BA 1CPZA 1UJ6A 4NLSA 1UVNA 3MCMA 1FDAA 2VC0A 3Q24A 2IRXA 1NK7A 5IFMA 1SH3A 4PWUA 3HHLA 5IM0B 1L3VA 3QRPA 1WACA 4ECSA 3V81A 5T7LA 1VQ9S 2FHKA 1XR6A 2ZITA 3HX9A 2E5HA 4FYWB 4LRCA 1H0HB 1NDCA 4HR2A 1QAXA 5D0GA 4GKJJ 1NEEA 4AXJA 3GIMA 1TFWA 2HNDA 4QW8A 4RBVA 3AJDA 3HXMA 2MQMA 5BYRA 4HEA9 3M05A 1IN0A 2B4OA 4OZNA 2AYMA 1X60A 3R5GA 5D0RA 1NKEA 4LRBA 1ACMB 4JI4J 1TZ0A 1C1BB 1T3OA 1TR0A 2CKWA 4K4YA 3FRZA 2RS8A 2C2DA 1W2IA 1RAOA 2XNRA 3NXZA 2PC6A 3IXQA 2VFTA 5D0EA 3TUIC 3P49B 2AWZA 1BGXT 2H5EA 3ISNC 3QQCD 4DFKA 1N32J 4PPDA 4I2QB 1AYEA 4D3GA 2GMJA 2AJFE 1F6TA 1Y00A 1JLAB 5KFSA 3CVKA 3CSKA 4FYYB 4I6YA 3WQPA 2OIHA 4M94A 3H4BA 3U1MA 2O67A 4OLPA 1VQSA 4LIRA 3DRPB 4CM0A 3LPYA 1DLOA 1REVA 2XHCA 5A8WA 2J9CA 2LQBA 4JI0J 3FZBA 4FPIA 1BQNA 4N8NA 2J9EA 1VK3A 3DKDA 2PSZA 2RIJA 4RNFA 3H2LA 3OUYB 3BM7A 4J9SA 4PWDA 2V8PA 2F9DA 3CJRA 3A8JA 3KTQA 4DN0A 4ILMA 4LSNB 4M63A 1K44A 2C2RA 1S0MA 1N5YA 1JLFB 1PC4A 1HNVA 3HF5A 5D78A 2RB7A 4ZPAA 1AUDA 3BPDA 1MW7A 2RMLA 2HYIB 3QSYB 2Z2ZA 4UQGA 2HHSA 3SBMA 2X51A 2AD9A 3JQMA 3K2YA 4E98A 1YJ7A 4XAKA 2FGCA 2L41A 1T9TA 4IYQA 3CC7S 1IBCB 2M8HA 2W2PP 2QLWA 4ECRA 3QSIA 3PW4A 3MFHA 2Y8YA 3KLIB 2M5YA 1RADB 4QOTA 4F02A 5LMNJ 2OMLA 1S48A 1IJFB 2I5JA 2LXFA 2ZH5A 5AXMA 4USUA 1KHWA 4C98A 4NLGA 5KG1A 3VAJA 1GXTA 4ED6A 2V4JB 2GQ2A 4P7TA 5EUHA 2ZDOA 2XGQA 2W9BB 4QIEA 4I4BA 2C28A 3C6TB 2O1PA 3I0SA 4K59A 1Q78A 2LQ9A 3M2UA 4ZN3A 4DPWA 4CH1A 3CUNA 2KDOA 1H38A 3W61A 4Y28C 3PKMA 2FTRA 4YP3A 2WAQD 3KHLA 3EYZA 5EX0A 5THWA 2UVWA 1PBUA 2WW4A 3DN9A 1HQ2A 3R5BA 4QR1A 3UDCA 4ZHRA 5HBMB 1XR7A 5IWAF 2MDAA 1X31C 3J7YI 3MR6A 3F73A 2W2OP 3VQSA 5I42B 4X4TA 4YHHJ 4DFMA 2RRNA 4LR7A 3BH7B 4OX8A 4Y00A 4F7VA 1DQ9A 4DR1J 2V9WA 3BBBA 2POKA 1KP6A 3MMBB 2Y8WA 1F0XA 1RLCL 2IVYA 2OEMA 2HK2A 2ZWPA 3IR5B 3MM9B 3QLHB 3J7Z5 4LF8F 1FX4A 4DS5A 3QIPB 1RT7A 1E6YA 4A8KA 2BE2A 2D7SA 2HBZB 2D3O1 2HQIA 2W9CA 4FNIA 3I5BA 4ZVTB 2X3DA 1NO8A 2WVBA 5GAGI 3KLHB 2DHSA 3CCQS 1JLQA 3N9UC 1RCXB 3RBDA 3VAKA 2AIRB 1K1SA 3HFKA 2NXNA 5KT2A 5IZHA 2KJWA 4CLUA 3HSDA 1YBAA 4F4ZA 3T5HA 1N36F 3ENQA 3M30A 4NASA 1VIXA 2RF2B 4DL0C 3KWMA 1RWPB 3RRKA 4DLEA 1FX2A 2FC9A 4PABA 3B82A 4UF4A 1U45A 1RT6B 2RQ4A 4I2PA 3DRPA 3PJXA 4ITSA 1ZTTA 3H2VE 3BGFA 1VRTB 2CPZA 2EXUA 1RU2A 3L7PA 3UN3A 4MYTA 5BYSA 2ZH4A 2LMIA 1I51B 2ZBQA 5CD4A 3Q86A 2ROGA 4JB8B 4TU9A 2NSCA 5F8GA 1OSDA 2KH9A 3IN5A 6AT1B 8AT1B 1BE4A 1CJUB 3HVRA 3RB3A 1JXLA 4LF8J 3OR2B 2LEPA 1ROFA 2P9EA 2COLA 3FFIB 1FXRA 3NNAA 4LF9J 2RUSA 4F36A 2BQUA 2AMCB 4ZCKA 3C15A 4OYOA 1FWKA 1VRQC 4EMDA 2MQNA 2OSRA 4A8SA 5I4MA 4ED4A 3VAIA 3A1YG 2E1AA 3RBXA 3GSDA 1G4CA 2CPYA 1FJCA 2AZ1A 2IA6A 1NHUA 1RT2B 4G65A 1RBOB 4M5JA 5KFLA 1RT7B 4OV6A 2AT1B 5IT4A 4OI0A 3QRQA 2YNGB 3KJVA 3VGVA 1JKHA 4Q43A 1WKJA 3J81j 4OX7A 4U9RA 3CD0A 4UY8T 2V4RA 4HKQA 4DX7A 4KGVB 1UVIA 4J9OA 2VOOA 2YWWA 2IHR1 6FDRA 1O5JA 1JJ4A 1TFYA 2B56A 3M8SA 2XSJB 2ZJRQ 1T05A 3CULA 3D68A 1EHWA 5GMDA 2QO3A 2GFFA 1JLQB 2RQMA 3UWTA 5L1KA 1S77D 4RWXA 1DTQB 1C0TB 1MN7A 2JC0A 3LANA 4LF9F 3CJSA 4F2SA 2CNOB 2J9DE 3AD9C 2P9CA 4MKAA 4Q45A 1VCTA 2OPQB 4NMXA 3HZGA 4WCEQ 3TQEA 2AZ3A 2QYCA 1XN9A 5E5NA 1YJNS 2MTLA 1Q53A 4ZIWA 2V4JA 1WWHA 1EKRA 2JC1A 2PFDA 1IKYB 3M8ZA 2JEGA 3CJ8A 3LH2S 3R5JB 1EQMA 4MH8A 4U7UK 4ECQA 1FKPA 3BGRA 1WOOA 9ATCB 5AXNA 2DD8S 3W9IA 3KUGA 1JIHA 3M6UA 3ENVA 3ZTOA 2NREA 4TY9A 5J2MB 2RRBA 5FDLA 2VBYA 2WVEA 3DGPA 1VQNS 2XHWA 2VKRA 5CH7B 4A46A 1FDBA 3KUEA 3AOAA 2XYGB 3M2UB 4DFJA 1EARA 1GMWA 1QUVA 1S7IA 2DNRA 1URNA 3DRSB 3K5MA 1TL7A 1I1GA 3VAGA 3HVAA 1NRKA 2D1CA 3MM5A 4KB7A 4KV8B 4DV0F 2MZSA 2C2EA 1XNRF 1S0VA 2HHUA 4J37A 4F2RA 3V5RA 2V8HA 3M9NB 3BN4A 3GILA 1N5YB 2NLWA 4P72A 2VOPA 4PQUB 1VBXA 2L08A 2QYGA 3N28A 2D41A 3C6UB 3MAAB 4DQQA 3LAMA 2WCXA 1FRHA 3C16B 2ZWOA 4MT1A 4UTGA 4ANCA 1KONA 2CJ9A 4V19X 4K4UA 2AEMA 3M8WA 2PIIA 1FERA 1U24A 4Z7CA 5C2CA 5AJ3J 2V63A 2BJDA 3SSSA 4OX9J 3ETOA 2ILYA 4DZ6A 3MEGA 2Y1LB 4DXLA 5KFNA 2XS5A 2KB2A 1HBMB 3M8PA 5HJYA 4RNOA 1S99A 3N6MA 3POTA 4U8VA 2N4CA 4ZVOB 4HT5A 1VDHA 1YKWA 1HKAA 3DRRA 1J5OB 1WELA 2NPFA 1HNWF 4J9KA 1OYEA 2VASA 2YNIA 3UDLA 4C0HA 3H5UA 3THTA 4EO6A 1S5ZA 2J7WA 5T14A 4B17A 4C8YA 3RW6A 1LK5A 3OTBA 2MZTA 5T41A 3DRRB 1J5OA 1N5QA 3FSXA 5L9NA 4LF6J 4WZMA 1D3WA 3X1LB 1EZZB 1RAGB 2XS7A 1KHVA 2APOA 4F3QA 1TQLA 3DDNA 3CIMA 1HI8A 2CXEA 4KE5A 4NMLA 4ECWA 3VWSA 4C0BA 1PIEA 1NK5A 1U1NA 3AB4B 3G82A 3ITHA 3PEJA 1M1KT 3W9JA 2CPEA 1GK8A 1TKZB 1WC5A 4DPOA 4KY3A 4ALZA 3BO3A 3C46A 3R7SB 3C16A 4TQSA 2IBOA 1HNZF 3NG8A 3RG6A 5IT9Y 2W2NP 4P7VA 4USHA 2HAIA 3W3SA 3GJQB 3RB4A 1NPKA 2EI5A 5D4LA 2W24A 2CG8A 3B8HA 4JI2F 2F4FA 4ZVQB 2DR9A 1SKSA 4LVOP 3Q8YA 2RS2A 2IY5B 2BXJA 1OWXA 3FBBA 4KH1B 2QLFB 3W63A 4RBUA 3V2UC 4B3SJ 3W66A 5BR8J 3FMBA 3D1OA 1K9MT 2HHWA 4I6WA 3ZTRA 1D1UA 2ZNYA 1RT5B 2GO8A 2WB4A 1T3NA 1NB7A 2YVSA 1SV5A 3TVZA 1IR1A 4TY8B 5BXIA 5I3UB 1RA6A 3M9MB 2LECA 5DQGA 2J6SA 4JI7F 1AZSA 2ZDPA 1HWIA 2R42A 5ADZA 3J80Y 3KDOA 4DUYF 1N32F 3IGNA 3L95X 1CJTB 5CYQB 1N56A 3CMAS 1U47A 4EBDA 4NLYA 3SCLE 1VQMS 4EZ6A 3BBFA 2AYBA 5KFRA 2KI2A 4PG5A 3WIUA 1X4BA 1HYSA 5D8HB 1RHQB 2J0XA 3M32B 1DTQA 1VOMA 1ZAVA 3M2RA 2AYEA 4ICLB 1C0UB 2FIUA 2GJFA 3QBCA 1RISA 3RAQA 2CPIA 4ECTA 3N5BA 2MLXA 3NAIA 4KFBB 1RT3B 1VBKA 1X8DA 2PA3A 3H98A 4ZPBA 3TEGA 5J1EB 5DDPC 3J80U 3CXCR 1ZAXA 2WVCA 2F3JA 2MKKA 1MMLA 3OL7A 3TQ1A 3WX4A 4A8YA 4DPTA 3MUVP 1LK7A 5AT1B 2H5IB 3T5KA 1DZ5A 4LJMA 4CI0B 4ELVA 4LRAA 2GMHA 4WBFA 4C11B 2RUGA
chains in the Genus database with same CATH topology
4PWWA 4AQYJ 2UUAJ 4NEZA 1N34J 4JI5J 2VQEJ 4RJVA 5A2QU 4JI8J 2UXDJ 4DR2J 3IMQJ 2F4VJ 4LFAJ 4B3TJ 4JYAJ 4DV7J 4YHHJ 4HHUA 4LF4J 4JI2J 1XMQJ 4DR1J 1FJGJ 5LMUJ 4LFCJ 4GKKJ 5AJ3J 2UUBJ 4X62J 1XMOJ 4YY3J 4OX9J 3R2DJ 1XNRJ 4DV0J 2HHHJ 4B3RJ 2UXBJ 4LFBJ 4B3MJ 1N36J 4JI7J 1N33J 2KL8A 3JAMU 2UU9J 1IBLJ 4LF6J 4LF5J 1IBKJ 4NXNJ 2ZM6J 4JI3J 4NXMJ 2UXCJ 3D3BJ 4DV2J 4GKJJ 4KY3A 3D3CJ 1XNQJ 3T1YJ 5IWAJ 4LF8J 3OTOJ 2KVQE 4JI4J 4LF7J 4LF9J 3W1YC 5LM7E 2VQFJ 4NEYA 4V1Ak 1N32J 5FLXU 2UUCJ 4JV5J 4B3SJ 4KYZA 5BR8J 2E5LJ 1HR0J 1HNWJ 4X65J 4JI0J 4X64J 4DR7J 4JI6J 4DV5J 4DV3J 4DV6J 4JI1J 1HNXJ 4DR6J 3T1HJ 4DV1J 4K0KJ 4DUZJ 2MQ8A 4DUYJ 1HNZJ 4DR5J 2MEWA 3J7AN 5IT9U 2MTLA 3J80U 3R2CJ 4X66J 4DR4J 5LMNJ 3J81U 4DR3J 4KHPJ 4DV4J 1J5EJ 1I94J 1IBMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWW A;  4AQY J;  2UUA J;  4NEZ A;  1N34 J;  4JI5 J;  2VQE J;  4RJV A;  5A2Q U;  4JI8 J;  2UXD J;  4DR2 J;  3IMQ J;  2F4V J;  4LFA J;  4B3T J;  4JYA J;  4DV7 J;  4YHH J;  4HHU A;  4LF4 J;  4JI2 J;  1XMQ J;  4DR1 J;  1FJG J;  5LMU J;  4LFC J;  4GKK J;  5AJ3 J;  2UUB J;  4X62 J;  1XMO J;  4YY3 J;  4OX9 J;  3R2D J;  1XNR J;  4DV0 J;  2HHH J;  4B3R J;  2UXB J;  4LFB J;  4B3M J;  1N36 J;  4JI7 J;  1N33 J;  2KL8 A;  3JAM U;  2UU9 J;  1IBL J;  4LF6 J;  4LF5 J;  1IBK J;  4NXN J;  2ZM6 J;  4JI3 J;  4NXM J;  2UXC J;  3D3B J;  4DV2 J;  4GKJ J;  4KY3 A;  3D3C J;  1XNQ J;  3T1Y J;  5IWA J;  4LF8 J;  3OTO J;  2KVQ E;  4JI4 J;  4LF7 J;  4LF9 J;  3W1Y C;  5LM7 E;  2VQF J;  4NEY A;  4V1A k;  1N32 J;  5FLX U;  2UUC J;  4JV5 J;  4B3S J;  4KYZ A;  5BR8 J;  2E5L J;  1HR0 J;  1HNW J;  4X65 J;  4JI0 J;  4X64 J;  4DR7 J;  4JI6 J;  4DV5 J;  4DV3 J;  4DV6 J;  4JI1 J;  1HNX J;  4DR6 J;  3T1H J;  4DV1 J;  4K0K J;  4DUZ J;  2MQ8 A;  4DUY J;  1HNZ J;  4DR5 J;  2MEW A;  3J7A N;  5IT9 U;  2MTL A;  3J80 U;  3R2C J;  4X66 J;  4DR4 J;  5LMN J;  3J81 U;  4DR3 J;  4KHP J;  4DV4 J;  1J5E J;  1I94 J;  1IBM J; 
#chains in the Genus database with same CATH topology
 1Q4R A;  3BKT A;  2W9A A;  3D1H A;  5CAA A;  2KKH A;  3GE9 A;  7FD1 A;  1T94 A;  5K20 B;  4F50 A;  2A6O A;  5EWE A;  5D3G B;  1QVG R;  4C4W A;  4X4V A;  1UPM B;  1J2V A;  2FZK B;  4UZC A;  4DI6 A;  1FEH A;  1M5P C;  4B9L A;  1OS5 A;  4JI5 J;  4B3R F;  2QLJ B;  3H7H B;  3SDE B;  3VCD A;  2FDN A;  3QO9 B;  2W7P A;  4ZOS A;  3IMQ J;  3QFW A;  4MK9 A;  3I55 S;  2YKM B;  2Z8Q A;  3HI9 A;  3SQG B;  4PAA A;  3BH6 B;  4WFY A;  4CM2 A;  2YQ0 A;  4C2M A;  2IJF A;  4RU9 A;  1N54 B;  1N5V A;  2B43 A;  1SCJ B;  2MKI A;  2HMI A;  3GG1 A;  1MRO A;  2XS2 A;  2Q1L A;  3THV A;  2UUB J;  1TAU A;  2QL9 B;  4OYM A;  4ZLL A;  2HFO A;  2CPD A;  1FD8 A;  3L9Z A;  1X4F A;  3PHT A;  4YY3 J;  1DRZ A;  1HI0 P;  3H5X A;  3QGI A;  3K59 A;  2HVZ A;  4P9S A;  5HQL A;  4M95 A;  1JNR B;  3C14 B;  3ENW A;  2IJR A;  1P6T A;  3NKY A;  2CZ4 A;  4NOH A;  5KFQ A;  2LA6 A;  2H65 B;  3PNI A;  3N01 A;  4DL5 A;  1S0N A;  4URQ U;  1N33 J;  4FS1 A;  2ZOM A;  1HLW A;  3M30 B;  2XMM A;  2B7C B;  2IPO B;  4DCJ B;  1NU4 A;  1KQS R;  3RR7 A;  2XB2 D;  1EB0 A;  3ZNJ 1;  2UUW A;  3OFE A;  2HGM A;  3D2W A;  3PX6 A;  1XMB A;  4ZVR B;  1RSC A;  4CDI A;  5ETR A;  1IBK F;  4DL4 A;  2PA8 D;  2XZT B;  1IBK J;  1WG1 A;  1VQK S;  2PN6 A;  3C19 A;  4OI3 A;  3NP5 A;  3AY0 A;  4WFB Q;  4KGZ B;  4OHW A;  5D4P A;  3GG0 A;  3D3B J;  4MTP A;  1RAJ A;  4UUW A;  4BCA A;  4IKA A;  4TYB A;  1AXQ A;  2YWG A;  1RWV B;  3M8Y A;  4NLW A;  5K8P A;  1S7H A;  1S6P B;  5IS2 A;  3GV5 B;  2BDP A;  1IQZ A;  2M9K A;  3ILO A;  4QZV B;  3PR4 A;  1PYS B;  3OVS A;  3RB6 A;  2BMB A;  2GQQ A;  4GKJ F;  3ZZZ A;  3ZC4 A;  4U67 Q;  4E8U A;  4PG6 A;  3GB0 A;  2A3J A;  4GRS A;  5C7P A;  1KFD A;  5C24 A;  2QV6 A;  2WON B;  2PEH A;  1S57 A;  1IM6 A;  3CDB A;  3L09 A;  2E9T A;  3W2W B;  1XBW A;  4YR2 A;  2NYH A;  2HK3 A;  4WXO A;  2OPP A;  2MKJ A;  1UMJ A;  4IH7 A;  4R0E A;  4KYZ A;  5KFX A;  2ACY A;  1VK8 A;  4IOA Q;  3K89 A;  4Y2C A;  2JEI A;  1SUQ A;  2ROE A;  2LQ5 A;  4IG0 B;  3ZXW A;  1X0P A;  3JYT A;  2AGP A;  4IRK A;  4OJH A;  1U26 A;  4OJ1 A;  1Q82 T;  4ERD A;  4X64 J;  2YNH B;  3W62 A;  4B3M F;  7FDR A;  2DNP A;  2BKN A;  2H4Y B;  1KN6 A;  3GFX A;  2BE9 B;  3AJ2 A;  1BQN B;  2R7Q A;  1U2R A;  4YB7 A;  1ZTW A;  3J81 Y;  3E01 A;  4OIX A;  2QC3 A;  4USJ C;  3AOD A;  1RT3 A;  1HNX J;  1UA1 A;  4M5G A;  1C0U A;  2JRS A;  4HH1 A;  4DR3 J;  3M8Q B;  2R7O A;  1X5T A;  1T9W A;  3R6G B;  5A8R B;  4DX8 H;  4AXI A;  2MQ8 A;  2R7S A;  4K50 A;  1CSJ A;  4ZLJ A;  4UZB A;  4X4U A;  3CCU S;  3D66 A;  4NLV A;  3UVJ A;  2DR7 A;  2RSQ A;  5IT9 U;  2IM1 A;  1SBR A;  3SCK E;  4XTT A;  4X65 F;  3OUY A;  3UDE A;  4ECU A;  5IC4 B;  2FLO A;  4C8M A;  3K5N A;  4RUA A;  3WZ0 A;  1TUV A;  3MEC A;  4ZK7 M;  4USV A;  1WDT A;  2EK6 A;  4UST A;  2HRY A;  3BDP A;  4E0D A;  2VB6 A;  4PWW A;  1Y5L B;  3LP2 B;  1HBU A;  3AH6 A;  4E2F B;  3K5L A;  2PMZ D;  1VBZ A;  5B0A A;  1HW8 A;  3IA0 A;  1S79 A;  3EM1 A;  2HNY A;  2MQL A;  2EFN A;  2VQE J;  3MEK A;  3SV3 A;  4YB6 A;  2XY5 A;  4RJV A;  3WIV A;  1RHM B;  2GAH C;  2JL9 A;  5KFW A;  1YJW S;  2NR0 A;  1HNI A;  1VC5 A;  2XG8 A;  1YX2 A;  5ETK A;  2Y1R I;  1H2U X;  1VBY A;  3CJ3 A;  3MEC B;  2CVE A;  2ZZT A;  3NOG A;  2UUB F;  3PW5 A;  1LV5 A;  2L9W A;  1KOH A;  1H73 A;  2CG4 A;  3CCL S;  2VIC A;  4DG1 B;  1VLO A;  2D9P A;  2O5D A;  3CT9 A;  2DNQ A;  5F8L A;  3TAN A;  4RNN A;  4LMZ A;  4GKK J;  3VZH A;  1F5A A;  3HHE A;  4EEY A;  4FF4 A;  2GGP A;  5E41 A;  2HNY B;  4OMF G;  3MM7 A;  1IM4 A;  2B9E A;  3V81 B;  1TKX B;  1LWC B;  4G1Q A;  4CLP A;  4B3O A;  1VQY A;  2XLI A;  4P73 A;  1XNR J;  4CTA A;  3WC2 A;  4K4Z A;  4LFB J;  2BA9 A;  4JI7 J;  1RTI B;  5BJR A;  1ICE B;  1WUU A;  1N34 F;  1Y9O A;  2XC9 A;  1FTR A;  4M5M A;  5LXY A;  2YH1 A;  2EFO A;  4JI2 J;  3KK1 A;  4YOE A;  2ZH1 A;  2XI2 A;  2GIF A;  3EGN A;  4HAC B;  4M5I A;  2L48 A;  3W60 A;  2FLN A;  1MWY A;  5G0R B;  1DQ8 A;  4KHP F;  2BVZ A;  4QW9 A;  2DH9 A;  4P74 A;  1I3O B;  4DF8 A;  2BJ8 A;  2KRB A;  1FRM A;  3ILI A;  3M8Q A;  4CLL A;  4U95 A;  4CZC A;  2YWH A;  4IRD A;  4ZPD A;  3GCW P;  1SKR A;  1UVJ A;  2K8G A;  2DJW A;  5HLF B;  5FD1 A;  4UT4 A;  1QUP A;  1UPP A;  3MOJ B;  2LFV A;  5E3A A;  3DHW C;  3KG0 A;  1XNQ J;  2ACM A;  1IKV A;  2CA9 A;  3MR3 A;  1W25 A;  1UVM A;  1RKI A;  4ID8 A;  4Q0B A;  3GYX B;  4X62 F;  2JVO A;  3OTO J;  2NYI A;  1S1V A;  1K0T A;  4A47 A;  1S1V B;  2HFV A;  4JP8 A;  3KK3 A;  2ILZ A;  3BZQ A;  1S49 A;  4L76 A;  2QFI A;  2CQD A;  4WWS A;  5KFA A;  4IRC A;  1T0T V;  1T9V A;  2C3U A;  3I5A A;  1NH8 A;  1LW2 B;  1SB6 A;  1FCA A;  4OJG A;  4K5S A;  5KT4 A;  1TL1 B;  4RNM A;  3DRS A;  3EVM A;  3NWR A;  3UCG A;  4F25 A;  2X1A A;  1D9D A;  3TAR A;  4DR7 F;  5KFY A;  4ELU A;  2B6A A;  1HL6 A;  5G0R A;  2OP5 A;  2HHP A;  1D9A A;  1RT1 A;  3BEG B;  2QSF A;  5FJ4 A;  3FCH A;  3NBP A;  1ZH5 A;  5HP1 A;  1WEY A;  4YY3 F;  3M1V A;  1IKV B;  3MED B;  2EFQ A;  1XMO F;  3FSY A;  1WC1 A;  2UVR A;  3RBE A;  1JJC B;  3H42 A;  3AQO A;  1KOO A;  1X5S A;  1VI7 A;  2A2D A;  1TKX A;  4NYO A;  4OYZ A;  4TKT A;  2YKP A;  1XIQ A;  3GII A;  2MJU A;  2V2V A;  3PRD A;  4X4Q A;  2KM8 B;  1WJ9 A;  4HI1 A;  4RU2 A;  2P6T A;  3MR7 A;  1Q81 T;  4M5L A;  4XDD A;  4ZPT R;  4NLQ A;  1QJH A;  5ETL A;  2A18 A;  4G3I A;  5E33 A;  5F0W A;  4JI5 F;  4ZVP B;  5F8J A;  4N5S A;  2Y1I A;  1UEK A;  2YKM A;  3I9V 9;  3HHN B;  2HFU A;  1Y0H A;  1SJ1 A;  4KHP J;  4PUO B;  2EW9 A;  1FRI A;  4KKO B;  4F4W A;  1WG4 A;  1EP4 B;  4PXD A;  3UQS A;  1VQP S;  3PRB A;  2GX8 A;  4WP8 A;  3S01 A;  2PT0 A;  1KTV A;  1PSD A;  1S1X A;  1VLY A;  4NRU A;  3TEH B;  4P2X A;  4CLT A;  3NS6 A;  2V0N A;  4OYW A;  3N79 A;  3CJK B;  2VC1 A;  1QE1 B;  1HBU B;  1S4F A;  1REG X;  2UV8 G;  3N6L A;  4DPX A;  5L1I A;  4LF7 F;  1JWW A;  3K8W A;  1GXU A;  2GHW A;  2ZUA A;  4ID5 B;  4IFV A;  1Q7L B;  2IM2 A;  2GML A;  1M1H A;  5JXS A;  4DR5 F;  3SQG A;  2R8H A;  2DBB A;  1U1Q A;  2OPS A;  3TX8 A;  3OBI A;  2VPW B;  4DHV A;  3E2E A;  1KD1 T;  1PCA A;  4L72 B;  2I8E A;  3G2X A;  5DO2 A;  5C25 B;  3IBC B;  1YTY A;  1RTD A;  2MYF A;  4IO9 Q;  4UY8 5;  5DQH A;  3IM8 A;  3MM8 B;  4WU3 A;  1CUL B;  4OI1 A;  4WYL A;  2CJY B;  2WZ1 A;  5J2P A;  4WF9 Q;  2ZM6 F;  2BE7 D;  1UCN A;  2EG2 A;  1UA0 A;  5ETT A;  2JZ5 A;  3LO3 A;  4JI8 F;  4ILR A;  4EUV A;  4ED0 A;  2JLE A;  2LKZ A;  2W2Q P;  3QT6 A;  1LWF A;  2OTJ S;  2ROP A;  4QR0 A;  3HKZ D;  1LOU A;  3DLE B;  3TA0 A;  3OTC A;  4RW9 B;  3CO0 P;  3FJ2 A;  3OTD A;  2P5V A;  2F5G A;  4N47 A;  1PKU A;  3PW0 A;  3IG1 A;  4IFY A;  3UCU P;  2UUT A;  2GQC A;  3MAQ A;  2A1B A;  4NXN J;  1Q95 G;  2AJQ A;  1LWE A;  1X4H A;  4LQ9 A;  1RLD A;  5A8R A;  4DOZ A;  3FNN A;  3M2R B;  2VHG A;  1NME B;  1Y10 A;  3CJ0 A;  3D4J A;  4HDG A;  4K7Q A;  1RKJ A;  4C8O A;  5CYM B;  2VPY B;  2DR6 A;  2KT3 A;  2ASY A;  1A6L A;  4J9L A;  2I9S A;  5C24 B;  1RWO B;  4DX6 A;  2V2K A;  3D5M A;  4LR9 A;  3EE3 A;  4MKB A;  4LRD A;  3KG4 A;  4FBT A;  5ETS A;  3DYA A;  1KVI A;  1RWU A;  2IA0 A;  1NJZ A;  1FKA F;  2DNK A;  1DQA A;  4OZ0 A;  2BQR A;  2ZOF A;  1BQX A;  2BAN A;  1S9E A;  3ZTQ A;  3FRY A;  2KRR A;  3Q23 A;  1QTM A;  1X4A A;  1N88 A;  2ZH7 A;  3DOK B;  3GPA A;  1JJH A;  2V34 A;  1TP7 A;  4DJB A;  5K8N A;  4BC9 A;  4K4W A;  1OMS A;  3SV4 A;  5IQQ A;  1UET A;  1UP1 A;  4EBC A;  2JEF A;  1EAY C;  2MZJ A;  2GJI A;  3DLH A;  1LFW A;  3MUM P;  2BRL A;  5F0U A;  4QYZ J;  5A8K A;  2D3O R;  4F67 A;  3HPO A;  3EWG A;  1HNW J;  1ULR A;  1Z2L A;  3MWB A;  4FKX A;  4PXE A;  1FKO A;  3LQV A;  2HMI B;  2EFG A;  1UJ4 A;  3JAM Y;  5HMZ A;  4DV5 J;  3LP0 A;  4R8U B;  1JLE B;  3JXO A;  4UOG A;  2LP4 A;  5KTQ A;  1FNX H;  1NJI T;  3DHX A;  4TVA B;  1Y5N B;  3US5 A;  1HQU A;  3UO0 A;  2DCU B;  2RKI B;  2ADB A;  4ZCI A;  1NHK L;  2BM0 A;  1NJX A;  1F60 B;  3U1N A;  3ILJ A;  3FEZ A;  2ZZN A;  1NZA A;  3VV2 B;  3OV7 A;  2CQI A;  3MEG B;  3SQO P;  2GW8 A;  3DC2 A;  3I87 A;  4Z2X A;  2DHH A;  3NCP A;  1CJK A;  2C2K B;  1NSQ A;  1KVK A;  3QZ8 A;  1Y3J A;  3HFV A;  5HP1 B;  3CO9 A;  2JWN A;  1CS4 B;  4PEO A;  4LSN A;  1ZM9 A;  1Q8L A;  5HJX A;  1TMJ A;  2XMW A;  4Q5V A;  3FC9 A;  4M5D A;  2DEJ A;  2MPU A;  3H59 A;  4PQU A;  2CPH A;  4XPE A;  3KOA A;  1FTC A;  1L3K A;  3DDK A;  4X4R A;  3RAX A;  4ETZ A;  1D8Y A;  1NAQ A;  2WW8 A;  2D9O A;  3OD2 A;  2FYX A;  3DLG B;  2EFV A;  2QX0 A;  3UCZ P;  1NPR A;  3NGT A;  3K5P A;  4DCP B;  5D6G A;  2UU9 F;  3QRR A;  2HGN A;  4QWC A;  4WP3 A;  5U47 A;  2GV1 A;  3B6B A;  2FC8 A;  3NCR A;  4JBC A;  4B9U A;  3KHR A;  1WI6 A;  1NSA A;  1WHX A;  3TZZ A;  4N41 A;  2BRK A;  1SPB P;  1YGY A;  3UW1 A;  3OVB A;  1F9F A;  2QN6 B;  3TZX A;  3KK3 B;  3TO8 A;  2UP1 A;  1JLG B;  4L73 A;  3JS9 A;  5B0F A;  2YKN B;  1O8B A;  2VZ9 A;  2DNL A;  4P2F A;  2XTJ P;  2GVZ B;  4IG3 B;  4GMK A;  1IKY A;  3QJJ A;  2ATC B;  3EDR B;  3LPE A;  5E0O A;  3MUT P;  1HQE B;  3CJ5 A;  2E1P A;  1RCO B;  4BS2 A;  3VGS A;  1NDP A;  3A8E A;  2VF3 A;  3DI6 B;  3BV8 A;  2LCW A;  5KT6 A;  1R3N A;  2GIQ A;  2YWE A;  3GLJ A;  1WC4 A;  4MFB A;  3UNG C;  2JDJ A;  5E2Q A;  3UNY A;  4C3L A;  2UXB J;  4HAC A;  1VQL S;  1C0T A;  4ECX A;  3IWX A;  1MU2 A;  1NSK L;  2O3D A;  4URG A;  3KK1 B;  2FY1 A;  2BUN A;  5M2R A;  2ZH6 A;  4O3O A;  2DXE A;  2VPZ B;  3AAW B;  3SIP B;  3MR2 A;  3EX7 B;  5HAN A;  2DNO A;  2OO4 A;  2B9W A;  4GC7 A;  5J1E A;  4BC7 A;  2MXY A;  1HD0 A;  3BB5 A;  2J8S A;  5L38 A;  5LSR A;  1ZM2 A;  1V5V A;  3PYE A;  4LF1 A;  3MM7 B;  3V6J A;  1HYS B;  3G9C A;  2E44 A;  1ZAW A;  3EZO A;  3ZZP A;  3G71 S;  1R89 A;  1YZ7 A;  2AV5 A;  2JJ4 D;  1M5H A;  2VL1 A;  4ZIT A;  4DS4 A;  2N3L A;  2H48 B;  3LP1 A;  2HWT A;  1DHM A;  1FWP A;  4EGL A;  5EN1 A;  1H3D A;  3DFE A;  3B54 A;  3O1L A;  1U49 A;  3T41 A;  4LVN P;  4KO0 B;  3BQ0 A;  2PGC A;  2G2O A;  4QIV A;  3UPF A;  2NUH A;  3X3U A;  1B99 A;  2C2Z B;  3B4D A;  3LUY A;  4WTY A;  2WTF A;  2RIL A;  3QT5 A;  4OZ2 A;  3O2I A;  4PYD A;  1Q16 B;  5DG7 A;  9RUB A;  1CJU A;  2PMW A;  2HLU A;  1RTJ B;  2WB1 D;  3W9H A;  1H2V Z;  4WPA A;  5I3P A;  3UR0 A;  3BPS P;  3MTJ A;  1VRT A;  3GFZ A;  2YBV A;  3BSA A;  1HR0 J;  3ZTP A;  1NSP A;  2DGW A;  1WF1 A;  3GJR B;  5AXL A;  5DQI A;  4QU7 A;  1HQE A;  2OPR A;  3D7S B;  1YIJ S;  2DRD A;  3HHK A;  2VBX A;  5B0D A;  1TVR A;  1KWM A;  1FVS A;  2WRM A;  1JNZ B;  3Q89 A;  3M6W A;  3NAH A;  1I94 F;  2OUG A;  2B9X A;  3A8I A;  5KG4 A;  2FZG B;  4O4G A;  3TNV A;  4A8X A;  1J5E F;  4IOC Q;  3G87 A;  2Q6B A;  3QJL A;  5SZT A;  5EWG A;  3TUZ C;  1SH0 A;  4Q2M A;  5L8R C;  3IO1 A;  4YS2 A;  1N8R T;  5H9F J;  3BQ1 A;  1VQ5 S;  1ZM4 A;  4OYB A;  3R9L A;  2R3V A;  3OSN A;  3E01 B;  1KKH A;  3HSJ A;  1P1T A;  3PX4 A;  1S4E A;  1WHY A;  2IJN A;  2RDD A;  3HSZ A;  1YI2 S;  1QVF R;  4DV2 F;  1UFK A;  2RF2 A;  5M2U A;  2VD3 A;  1RBA A;  2XLJ A;  2RRA A;  3IRX B;  1DTT B;  3CCJ S;  1UFW A;  4NLP A;  3MPW A;  3OQ2 A;  2B51 A;  2LQJ A;  3LP0 B;  4RWW A;  3D6M B;  3DMJ B;  2NS1 B;  2Y3Y A;  3OW2 R;  3HCX A;  4NCA A;  2PI4 A;  1H7X A;  1KEK A;  2ALZ A;  3DM2 B;  4YB5 A;  1IKX A;  3QIP A;  5KFB A;  5A0Y B;  4IR9 A;  1YHQ S;  3E51 A;  3TVK A;  2G13 A;  4NA2 A;  5D4N A;  2VFR A;  4XO0 A;  5A2Q U;  3R1L A;  2EBG A;  2G2Z A;  3DOK A;  2X1G A;  3EZU A;  1VRU A;  2YPY A;  1U1K A;  3O44 A;  4J9R A;  2FVQ A;  2Z2M A;  2NQP A;  4K5R A;  5KAK A;  5CD4 H;  2HQF A;  2F8M A;  3DRY A;  1D8Z A;  1P9Q C;  5F8H A;  1KRP A;  4X2B A;  1VRU B;  2CZ9 A;  2JLF A;  4CLZ A;  4ZHR B;  2CQ3 A;  1PAE X;  1TL5 A;  2VG6 B;  3KHG A;  2DHG A;  3CF5 Q;  2BOP A;  2FVP A;  4WP9 A;  2BX6 A;  5A8K B;  4TQR A;  1GQE A;  4MAK A;  1X5O A;  2DH7 A;  1URR A;  2DIV A;  3OT9 A;  4QR2 A;  2IC3 A;  4BLG A;  2MHE A;  3DGP B;  1NBE B;  2DHA A;  2OGU A;  3BYR A;  3MD1 A;  3MDF A;  4RO0 A;  1W2B R;  1NKC A;  2ZVI A;  2R8G A;  2E5I A;  5JVH Q;  2W4P A;  3AD7 C;  4DV0 J;  2KU7 A;  1X4G A;  1HNV B;  2JX2 A;  2A10 A;  2QTW A;  5AXK A;  2CQ4 A;  5L1J A;  1YJV A;  2LEB A;  1T9U A;  2KXF A;  2XSF A;  3CCW A;  4Y0F A;  4HTJ A;  1S6Q A;  1K47 A;  5SUH A;  2R2R A;  5F8N A;  4CNZ A;  4DV4 F;  4DU8 A;  1IBL F;  4DQP A;  1JKH B;  2CNK B;  2E7W A;  1DLO B;  4J9Q A;  1L3U A;  1MMD A;  1KVJ A;  3L7O A;  4NXM J;  2Q3P A;  3IGV A;  5LL6 d;  2G2Y A;  3MXH P;  1P9Y A;  4GVB B;  1KFS A;  2EG1 A;  1M90 T;  4DSE A;  1CLF A;  1R8C A;  1RXO B;  3K5O A;  4X84 A;  3DMJ A;  5AE3 A;  2VA3 A;  1CUL A;  1UJ5 A;  2CJQ A;  2MKC A;  4ZJO A;  4F8R A;  1N6Q B;  3OLB A;  2JNJ A;  1FF2 A;  2DKO B;  3TW0 A;  5GAE I;  2BKP A;  3SSR A;  1DBD A;  3ILL A;  3DRX A;  3EJM A;  3OFG A;  4PXC A;  4ZVH A;  1U1P A;  3OXG A;  1T7P A;  3MEE B;  3AT1 B;  2G0J A;  3F41 A;  3PDN A;  3RW7 A;  2BEF A;  2CQ1 A;  3BSN A;  4ID5 A;  4O4R A;  1YIT S;  1NJY A;  1R8P A;  5FLX U;  2E1C A;  5D3G A;  4C48 A;  3RYL A;  2UUC J;  3AJ1 A;  4OQJ A;  2AKW B;  4NL5 A;  1VQ7 S;  3P96 A;  5T7L B;  3Q2S C;  2YWF A;  3DGV A;  1U2F A;  1U4B A;  2ZH3 A;  2H5J B;  2O66 A;  3NRB A;  3T6B A;  2H4W B;  5HMY A;  3CCR S;  4DQI A;  1HAR A;  1GX6 A;  3BO2 A;  4O3Q A;  1T02 A;  3FVY A;  4HH0 A;  4HDH A;  2ZEJ A;  4I1T A;  4PQA A;  4B3M J;  2ZZM A;  2HQ3 A;  5GME A;  3SSQ A;  4ICL A;  2V8G A;  1TL3 A;  4DSL A;  1VMB A;  1MLA A;  1YJR A;  4C0O C;  4LBP A;  2AQ4 A;  4Q8E A;  3ISN D;  3GMG A;  4CLF A;  4DX5 A;  2VG5 B;  2C2N A;  4X66 F;  1UEU A;  2BZ2 A;  1QAY A;  4NWB A;  1YBU A;  2MQO A;  2LDY A;  1RT6 A;  4I2P B;  1VS3 A;  4DR5 J;  2MEW A;  4Q7A A;  2VOD A;  3J7A N;  3IFE A;  3F0N A;  2KO1 A;  3DLJ A;  3R6L B;  1IUJ A;  4OHZ A;  4OZ5 A;  4XPC A;  4FVC A;  3ZZO A;  1XQI A;  3IR7 B;  4KBI A;  3HM9 A;  2HRU A;  3J81 U;  1X5P A;  1VHF A;  4KC5 A;  4OZ3 A;  3HVW A;  5HAT A;  4CT8 A;  4EO8 A;  1QSL A;  2ZKT A;  3O8W A;  2HHV A;  3I4H X;  4B9V A;  2DGV A;  2IVM A;  1Q1K A;  2OI2 A;  1RT1 B;  5HL7 Q;  2L9D A;  3VVT A;  1H2T Z;  1UW9 A;  2HWI A;  4FXV A;  3OFH A;  4TN2 A;  5CXT A;  1TL4 A;  3OJU A;  1B0T A;  1RWK B;  2QT7 A;  5ETN A;  1CQN A;  3UI3 A;  3D0I E;  3MM9 A;  1R0B G;  2IIH A;  1LFP A;  2RAQ A;  3C6T A;  3ETM A;  4CNY A;  4ZJL A;  3GV7 B;  4OLO A;  2EEY A;  2C42 A;  4JI8 J;  3A3N B;  2EVZ A;  3ZZR A;  3VAL A;  5EGY A;  4CH0 S;  4DSK A;  1VGY A;  2C3P A;  3W2V B;  2HNZ A;  4WE1 B;  2QMU B;  1I6J A;  2AGQ A;  1BQM B;  1VJQ A;  1FRJ A;  1RT4 B;  4MKY A;  1MSW D;  3WX8 A;  4LF4 J;  4YME A;  1FRL A;  1ZET A;  4AFF A;  3CME S;  2HG4 A;  3HHD A;  1FE4 A;  2RU3 A;  4X62 J;  3OTO F;  2MGZ A;  2SXL A;  4KIA A;  2JFD A;  3OVA A;  1XNQ F;  2DXF A;  4J7C A;  3R3T A;  5I3Q A;  4K4X A;  3V6D B;  3Q2T C;  4N8O A;  2UXD F;  3RBZ A;  3PTW A;  3V4I A;  2WK4 A;  3TX0 A;  2RT3 A;  1JLF A;  3FBF A;  2BW7 A;  3I0R B;  1RHU B;  1XWL A;  1U6F A;  2KL8 A;  4DU7 A;  1VFJ A;  1V6H A;  3JAM U;  3KLI A;  2XO7 A;  2E1M C;  1HHT P;  2YKO A;  3QID A;  1SQF A;  2DVI A;  2KHC A;  5A8W B;  2FVC A;  2WSC C;  2ZNZ A;  4WFN Q;  4AL5 A;  3NGR A;  2OMO A;  1MMN A;  4U96 A;  4R5P B;  1Q79 A;  2N4D A;  2K7J A;  1G6B A;  5KFK A;  1KNZ A;  2HS0 A;  2J0Q D;  1H98 A;  3HD1 A;  3BDE A;  1S1W A;  2Y0S D;  3KUH A;  2XUL A;  1EJ7 L;  3RUB L;  2ASJ A;  4FKY A;  1FI4 A;  1N4L A;  2FUG 9;  1M5O C;  2GJ2 A;  1JX4 A;  4OX6 A;  2PEB A;  3NNH A;  4W92 B;  5A2Q Y;  2RDI A;  4IR1 A;  3O5T B;  3PW2 A;  4OI4 A;  1HQU B;  1H74 A;  2E29 A;  4PRF A;  3AHP A;  2M3D A;  1WF0 A;  4C8K A;  2AW0 A;  3PM9 A;  5B08 A;  4R8U A;  2Z0G A;  5KFE A;  1TVR B;  2GVD A;  2DR5 A;  2HGL A;  3TAM A;  2JEJ A;  5KG2 A;  4TYA A;  4WJB A;  4ZPC A;  2F65 A;  2KT2 A;  1PYO B;  3RGI A;  4WIQ A;  1N48 A;  1WOR A;  4P75 A;  1R8H A;  2XMT A;  1RTI A;  4KHM A;  4CQ1 A;  1WKK A;  4FYD A;  1IBM F;  4KGK A;  2I38 A;  4OI6 A;  3JSM A;  2C2O B;  3I9Z A;  2EBE A;  1TK0 A;  1SJQ A;  2E9R X;  1WC0 A;  2VQE F;  2B5J B;  3I31 A;  2GHP A;  5HMW A;  2ADC A;  3CDE A;  2VDI A;  4TLQ A;  1WHV A;  2J76 E;  3LP2 A;  3MMA B;  4NPO A;  2VON A;  3F44 A;  2XM3 A;  4DR7 J;  4OYA A;  3HP6 A;  1C1B A;  1UZD A;  4MIA A;  2ZC4 A;  3GIK A;  3CCM S;  1A7G E;  3CNQ P;  3GWC A;  1SL1 A;  3KK2 A;  1M5V C;  3I82 A;  3T19 A;  1XJW B;  3NGK A;  5J1N A;  1M1G A;  4KO0 A;  1FXL A;  5KFV A;  1DJ0 A;  4ECV A;  4ZLN A;  3R97 A;  5GAD U;  4GKK F;  4I69 A;  4WKY A;  4ZP7 A;  4DR6 J;  1JK9 B;  1CC7 A;  1N52 B;  3D6H B;  4JI4 F;  2FJB B;  4DPU A;  3UD3 P;  2ZBI A;  2XY6 A;  1UAW A;  3Q8V A;  3NOC A;  4L3K A;  4YHH F;  3NNC A;  3E8O A;  2YQ1 A;  2VG7 A;  4NA3 A;  1TKD A;  1DFD A;  4DUY J;  1LWE B;  4I7F A;  2DH8 A;  5F9N A;  1U02 A;  3BKF A;  4X4P A;  1WEX A;  4JI6 F;  2DRB A;  3HO1 A;  1FA0 A;  3DDI A;  3EPG A;  2BR0 A;  3GCX P;  3QYY A;  3C66 A;  4PCQ A;  3T1H F;  4KJI A;  1XTZ A;  2J5A A;  1IKW B;  2LVW A;  4NZ6 A;  3TR5 A;  2W25 A;  3JSB A;  1T03 B;  4JI3 F;  3HHL D;  4ZVE A;  3RRG A;  2IVF B;  2YNG A;  2ZD1 A;  3KJV B;  2KXN B;  3RTV A;  3I96 A;  3H40 A;  2OSQ A;  2HZA A;  3IS9 A;  4XDC A;  2D3U A;  4ETX A;  4ZMM A;  4FVM A;  2XO6 A;  4U8Y A;  5J2P B;  4H4K A;  1PIL A;  4RL1 A;  1FFW B;  1CJV B;  3GIR A;  4PG4 A;  2G4B A;  2JVR A;  3MPV A;  2B0G A;  4QBU A;  1SJR A;  4AYB D;  2QFJ A;  2AGO A;  2Y9H A;  3FFI A;  2WON A;  3TA1 A;  4DQS A;  4RW9 A;  1YSJ A;  2YKN A;  3BR8 A;  2KXH A;  3GTY X;  3MCN A;  3G6V A;  3DOM B;  1T03 A;  2OPS B;  4F4K A;  3K7R A;  4QJV A;  2MB0 B;  4H4O B;  4HHU A;  1RAH B;  4LBH A;  1IWG A;  2MZQ A;  5KG0 A;  2G1H A;  5C42 B;  2I2Y A;  2HHT A;  1FK9 A;  3GFY A;  5B0G A;  4F4A A;  4DV7 F;  2E66 A;  2MSS A;  4IG0 A;  2V68 A;  3I32 A;  1S6P A;  2WSE C;  2AJ0 A;  4ZP8 A;  4ZN1 A;  5KG7 A;  2Z30 B;  3VAF A;  4A8O A;  1NDL A;  4LFA F;  3MM8 A;  3DLG A;  3GYN A;  2QRR A;  3R2D J;  1Y11 A;  4Z7Y A;  4KKO A;  2WVD A;  4PUO A;  4F3O A;  3ULH A;  1F3F A;  3RRH A;  1S1U A;  2VFU A;  1C4C A;  1GMV A;  2GC8 A;  4ES2 A;  2PMH A;  3RZA A;  2K3I A;  4LF5 J;  1KQF B;  4ZJQ A;  1FD2 A;  1FJG J;  2W01 A;  3U1L A;  1QE1 A;  4TU7 A;  4XIU A;  2MKS A;  5EX3 A;  2B5J A;  1O0P A;  3FKB A;  1YZ6 A;  1X9S A;  1YWX A;  1OPI A;  1UVL A;  1NKB A;  1S1X B;  3A3P B;  3CCV S;  4PG8 A;  2XMA A;  4ATN A;  1JLC A;  3D3C J;  1LEO A;  3HDS A;  3CWJ A;  2RKI A;  5GAH I;  4YQW A;  4DF4 A;  1ZZN A;  3DLL Q;  1TTH B;  2HEK A;  1PJ5 A;  1RAB B;  2W1B A;  2XYP B;  3ISZ A;  3MED A;  1PJ6 A;  5B0B A;  2R7W A;  2AEF A;  3S7R A;  2F9J A;  2RQK A;  4AD6 A;  3NBP B;  4PPZ A;  1CVJ A;  2GVD B;  3KYL A;  2K1R A;  3MMC A;  2E7V A;  2DEI A;  4NXM F;  3JSR A;  1YLX A;  2MMY A;  1E6V A;  3PFE A;  2B6A B;  5LXR A;  4V1A k;  2BAC A;  3KXD A;  3JQJ A;  3TAP A;  2H51 B;  2BKO A;  4HHH A;  3SMZ A;  2KT5 A;  2XMK A;  4ZCM A;  1CG2 A;  1S1W B;  1GX5 A;  1TMM A;  1VR6 A;  3FEX B;  3VF0 B;  4BBY A;  3OJS A;  2R2S A;  5J2Q B;  3TJ8 A;  1SQG A;  2QZ8 A;  3WBZ A;  5DDR C;  2HVD A;  3H25 A;  2ZH9 A;  2CVI A;  4J5O A;  5GAG U;  1HR0 F;  3K17 A;  1OJ4 A;  1WTB A;  1MN9 A;  3AB2 B;  4C11 A;  3P5B P;  1HHS A;  2FPH X;  1Y3K A;  3H4D A;  4DSI A;  1KLN A;  4C8N A;  4O23 A;  1S72 S;  2KN4 A;  3DYA B;  4DBQ A;  3CTR A;  1R6V A;  1F3V A;  2QIF A;  3D6T B;  4FYX B;  4Q0B B;  4MK8 A;  1FXD A;  4YDX A;  4QYR A;  3UN2 A;  4FXD A;  1RAI B;  3DOL B;  1V9O A;  4OHV A;  1BLU A;  2MY8 A;  1L5U A;  3MM6 B;  3KLE A;  1BUX A;  2CQ2 A;  2UVV A;  4WZQ A;  6FD1 A;  2HLT A;  1SC6 A;  2QJ3 A;  1RWN B;  2ZH8 A;  2DNG A;  2G9O A;  4ED8 A;  2YKA A;  4A8F A;  1TL1 A;  1D9F A;  1YK9 A;  1NDK A;  1LW2 A;  4DUZ J;  2B4U A;  1EET B;  3MOZ A;  1H72 C;  4QWA A;  4GVL A;  3IG1 B;  2I1R A;  4IFY B;  3TRG A;  3ONQ A;  5JUM A;  1SXL A;  4JI0 F;  1WEZ A;  1U7L A;  3IP0 A;  2J0W A;  1L3S A;  5DET A;  1QSS A;  3D0G E;  4QWD A;  3R7B B;  1RE1 B;  4G1P A;  4DLG A;  4ZA1 A;  3CC4 S;  2CQH A;  2XGP A;  4K4V A;  2CZV C;  4QPX A;  1G7C B;  4C9D A;  3WDO A;  2HAF A;  3BGL A;  1CJV A;  2DO0 A;  2OFG X;  3M6X A;  1SV5 B;  2YKQ A;  3U7J A;  4DSF A;  1KLM B;  4DL6 A;  1F2H A;  2ZHB A;  1D0E A;  2HVH A;  2EC2 A;  3IS9 B;  2MY7 A;  1R31 A;  2GA7 A;  5B0E A;  2M7S A;  4I56 A;  3MCO A;  1VYA A;  5H9E J;  4P71 A;  1WNE A;  3TI0 A;  2HIY A;  2VUG A;  2YH0 A;  4PYA A;  2CWX A;  2BJE A;  5KFM A;  2IBK A;  3T5J A;  4DV7 J;  1GTH A;  1OY8 A;  2VJU A;  3CGI A;  4OYP A;  4EFA C;  3W5Z A;  2QA4 G;  1R27 B;  2KVI A;  2K7K A;  1HNI B;  3TA2 A;  5JVG Q;  3MMA A;  3P5T L;  2WOM A;  3QGG A;  1VQ6 S;  2EPI A;  2B9Y A;  4G1I A;  1A0O B;  1NJW A;  1ELO A;  5K14 A;  3H5Y A;  3QT8 A;  1OO0 B;  2NSB A;  1YG0 A;  3MD3 A;  5B0C A;  3BR9 A;  2YPZ A;  1TKZ A;  4MYU A;  4R0J A;  3V4M A;  3LA0 A;  2ERR A;  4FN5 A;  1N0V C;  2QG9 B;  3G82 B;  3ITH B;  1EP4 A;  2FHO B;  4RKU C;  5CZX A;  3A12 A;  3W7B A;  1TL3 B;  2VFS A;  3GSI A;  1EIY B;  2VBZ A;  5HQ8 A;  4ER8 A;  5MAO A;  1BD6 A;  2P9G A;  1GH8 A;  2CPF A;  1VHI A;  3B4M A;  5F8M A;  5BR8 F;  2UU9 J;  4ZP6 A;  2CPX A;  2E9Z A;  2D74 B;  1V3Z A;  4N56 A;  3IR6 B;  4ED5 A;  2YNI B;  4RR5 A;  3QMQ A;  3Q22 A;  2QL5 B;  4RW8 A;  3Q8U A;  3QWP A;  2HQG A;  3PAC A;  2L9N A;  4I0W A;  4O44 A;  5DJB A;  5J2N B;  2J6T A;  3N5F A;  4CO3 A;  2VQF F;  1R0A A;  2EWH A;  1HBM A;  3M8P B;  3BYP A;  5E3R A;  5K14 B;  2OEK A;  2JHE A;  4J90 A;  3JSM B;  3GQC A;  4RLE A;  3HLU A;  1G3O A;  5CQG A;  4YR3 A;  2KZM A;  2Q66 A;  2IMW P;  1GEH A;  3LOU A;  2CFX A;  4R5P A;  4YFU A;  3G6E S;  3ZO7 A;  2C22 A;  5LOQ A;  1FHT A;  2OLW A;  3CW2 C;  2NZC A;  4NCG A;  3GIJ A;  4DUZ F;  1N0U A;  1SH2 A;  1QD1 A;  1UWB A;  4F0K A;  2BJ3 A;  5DGB A;  5KT3 A;  3M9O B;  1Q5V A;  2NUU G;  3HZE A;  4RW4 B;  3VR1 A;  4ZLP A;  1FFG B;  1Q8K A;  2XNQ A;  5KG5 A;  5EDW A;  3I0R A;  1HD1 A;  5CA5 A;  3D0H E;  1GXL A;  1FWL A;  4C3M A;  4K4T A;  2Q79 A;  1KS2 A;  3VVU A;  4AT1 B;  5LSL A;  2KG0 A;  3MM5 B;  4KV8 A;  1KR4 A;  2BAB A;  1AW0 A;  3AA9 A;  2IAJ A;  3ICL A;  4ZP9 A;  4DV5 F;  1QAJ A;  3C2P A;  1WTF A;  1XC9 A;  2FLL A;  1BWE A;  1XER A;  3W2W A;  5CYJ A;  2MQP A;  5HSP A;  4X65 J;  3JB9 k;  3KLF B;  1KQK A;  1M0S A;  3CED A;  2E5G A;  2YWK A;  3VZI A;  3NMA A;  1ARO P;  1RTH A;  1GAO A;  2DNM A;  3C6U A;  1HA1 A;  3MAA A;  4L3N A;  2RE1 A;  2DGX A;  4O3N A;  4X4S A;  1YJ9 S;  5LJ5 Y;  5KT7 A;  4A8W A;  4F26 A;  4K4S A;  1YRX A;  3A4T A;  1K1Q A;  1DAR A;  4JOU A;  3V4I B;  3LW5 C;  4OL8 A;  1TL7 B;  2ZKU A;  4IOB A;  2BBE A;  5LT5 A;  2GIR A;  2HUR A;  2OPQ A;  2DGQ A;  2HSE B;  3GON A;  2BOA A;  2R2U A;  4M1K A;  4LBI A;  1J27 A;  4NZ0 A;  2CAJ A;  2F4V F;  5C5J A;  1S6U A;  3EIC A;  2DNH A;  2CJX B;  3UN5 A;  1W7W A;  4K2X A;  5H1S V;  4NZ7 A;  2MZR A;  1TK5 A;  2OJ3 A;  2HZC A;  4KTQ A;  4EZ9 A;  1RBL A;  1F5C A;  2BYC A;  2B7B B;  5H9E K;  2CNN B;  2KFZ A;  1BQM A;  4CCH A;  1B7F A;  3LTO A;  2OH2 A;  4NCB A;  1G1X A;  2DO4 A;  1B0P A;  5L46 A;  2CRL A;  3EDQ B;  1X4D A;  1B64 A;  4CTA B;  3GFH A;  4OYI A;  3M2V A;  4F04 B;  3C14 A;  5E3P A;  1LWC A;  2DGU A;  4Z37 A;  2KHD A;  1VQ4 S;  3HT3 A;  2R7X A;  5A0Y A;  5KFO A;  3G6Y A;  1QM9 A;  3AOB A;  5JMN A;  1BWV A;  4EBE A;  2FGO A;  2CPJ A;  2UXD J;  3MMC B;  1IR0 A;  4Y2M A;  2FB0 A;  3HKW A;  1RA7 A;  1JJ2 R;  3ENA A;  2WHO A;  2F8E X;  4QIF A;  3C15 B;  4LRE A;  4M5H A;  3EXC X;  5KFG A;  1SC3 B;  3SYZ A;  1CEZ A;  1OIA A;  2KJV A;  3IRX A;  3NY0 A;  5K5M A;  5F3Z A;  1TUG B;  2F63 A;  1FEE A;  2OAU A;  3QO9 A;  1WKL A;  2XMU A;  5HI7 A;  3THP A;  1JLC B;  1X9M A;  4J9N A;  4NRT A;  4QIW D;  4H4M B;  4RW6 B;  2RQC A;  5KFU A;  1XMQ F;  2PFF B;  2AU0 A;  1JXV A;  5KFC A;  4ECZ A;  4RUH A;  2RU9 A;  2OEJ A;  3Q83 A;  2GZO A;  4OJ3 A;  3CB4 A;  3EZ5 A;  4LF5 F;  2E7X A;  2VG5 A;  3MAH A;  1MRO B;  5A6P A;  2DIU A;  1R6Y A;  2HVE A;  4EWT A;  4CO5 A;  4RPF A;  1JB0 C;  2P2C B;  1VJW A;  1CBK A;  2R4F A;  3NCQ A;  4WKR A;  5KFZ A;  1AFI A;  1U8W A;  4CLK A;  3CC2 S;  4PZV A;  1BHN A;  3LWM A;  1Y5I B;  2E5L F;  3TUJ C;  1U09 A;  4ANE A;  1HI1 A;  2DGS A;  2FJW A;  4FZV A;  1KBR A;  4ES1 A;  3OPK A;  3NGS A;  5AE1 A;  4ZVF A;  3I4P A;  3PKY A;  2DXD A;  1Z4U A;  2V8D A;  3ADA C;  4FDF A;  2ZM6 J;  3CD6 S;  1RAA B;  4HTI A;  3W5X A;  2B3T B;  4D3H A;  1OSC A;  1WC3 A;  2NXJ A;  2V6A A;  4JI3 J;  5G4D A;  4IQM A;  4W98 A;  2ZHO A;  3CJT A;  4YN3 B;  3KHH A;  4GVB A;  2QLB B;  2BJ9 A;  3WHI A;  2W9C B;  5HN0 A;  1NK8 A;  3DLK B;  5KFD A;  3BBC A;  5FLX Y;  5FII A;  3G4S S;  2F40 A;  2Q6C A;  5B09 A;  3QZ7 A;  5K9F A;  1NUE A;  4B3T F;  3NGU A;  1RTJ A;  4RW6 A;  4LT6 A;  1SJ3 P;  1U0H A;  1PYT A;  1AA1 B;  2AJ2 A;  3MPY A;  4LF7 J;  3W1Y C;  1FO1 A;  4DR6 F;  3UR3 C;  3UFC X;  3MF5 A;  1IJE B;  3ZZU A;  1NK4 A;  1N6Q A;  1RZM A;  4KPC A;  5KFF A;  4NEY A;  3LGM A;  2GHV C;  2A2C A;  2CQB A;  1RT5 A;  3MCS A;  4I7F B;  1SUQ B;  3G96 A;  5HBM A;  1RHJ B;  3JYT B;  2QMX A;  1EX8 A;  2ZBC A;  3NLC A;  1OPZ A;  4WYW A;  1JQG A;  1OQ3 A;  3LP1 B;  2FHJ D;  2NPI A;  2C3Y A;  2OPP B;  3NS7 B;  3QAU A;  2AHO B;  2EK1 A;  4G6V B;  3JTP A;  4MKV A;  4P2M A;  1QDU B;  2ALY B;  2XI3 A;  2CUY A;  3CJQ A;  3H5S A;  5KOW A;  3BQ2 A;  4EYI B;  3RB0 A;  1CJT A;  5CYQ A;  3NL0 A;  2CJK A;  1KTQ A;  4WFA Q;  1MG7 A;  1Z2Z A;  2CYY A;  3FCW A;  3SZ2 A;  2LLZ A;  5HRO A;  2XLK A;  2WSF C;  4OZ1 A;  2CQP A;  3SEO A;  1Y4Z B;  3FGV A;  3RAM A;  3S8S A;  3TAQ A;  2M52 A;  4TY8 A;  3R7N B;  4ZVS B;  1KQG B;  2WBM A;  3F56 A;  1MU2 B;  3GZ7 A;  3M8R A;  5HK4 A;  1AUS L;  5LMU F;  3LWL A;  4JI1 J;  4Y3C A;  1S76 D;  3P6Y C;  4LF4 F;  2W7A A;  4Q44 A;  4CO1 A;  1IKX B;  2M2B A;  4JYA F;  1SC4 B;  2H54 B;  1B3T A;  2F8H A;  1S12 A;  4KHR A;  2HHQ A;  1V5I B;  3MGJ A;  1NHV A;  4C3K A;  3H90 A;  2H9Z A;  4IG3 A;  2LU2 A;  3EUN A;  4KH0 B;  4Y34 A;  2XY7 A;  2I5J B;  4I67 A;  2XBP A;  1HBN A;  4IQX A;  5F41 A;  1DTT A;  3CCZ A;  2QGF B;  3PYD A;  3K0J A;  3HT0 A;  3OL9 A;  3PEH A;  1RTH B;  3LF0 A;  1GFW B;  3IWL A;  3W5Y A;  4DSJ A;  1AT1 B;  4LSL A;  4DV4 J;  1ITP A;  2J8A A;  4ZVG A;  3POT B;  5KFT A;  3T3F A;  1I94 J;  1IBM J;  1FDD A;  4MIW A;  1JLB A;  4WII A;  1T9X A;  4RNH A;  4EK2 A;  2KFY A;  2DPJ A;  3DM2 A;  1O6X A;  3N6N A;  2A6M A;  1LXN A;  2FJV A;  2C3M A;  2IAJ B;  4LIW A;  2C2M B;  5BYQ A;  1WF2 A;  4ED3 A;  2VBW A;  4JV5 F;  5CAB A;  1GMU A;  2J6U A;  1PG5 B;  5LJ3 Y;  5DGA A;  4B3T J;  3PR5 B;  4JYA J;  3I6P A;  1C4A A;  1W26 A;  3TP2 A;  3FBE A;  1IQT A;  1CS4 A;  2CDR B;  3T6J A;  1WOP A;  2E1R A;  2XYH B;  2EC0 A;  2K06 A;  4ILL A;  4KR0 B;  3IRW P;  4DN9 A;  4DR1 F;  1REV B;  2JSX A;  4OHX A;  2OD6 A;  4NA1 A;  2HQC A;  3OFF A;  1VQO S;  3BSC A;  4FPR A;  1VIS A;  1RYR A;  3EXY A;  1GTE A;  4F3M A;  4DMZ A;  4EYH B;  2W7O A;  4DL7 A;  3BS9 A;  2BQ3 A;  1RUS A;  2OEL A;  2QLX A;  4J91 A;  1Y7P A;  4LSL B;  2FHJ A;  5IV4 A;  5DDO C;  2DRA A;  2KM8 C;  1BXN A;  1WD6 A;  1YJU A;  2XMJ A;  3FUY A;  4O4G B;  1UWA A;  3PFO A;  1WI8 A;  1B7Y B;  2NXC A;  3W2V A;  1CC8 A;  4N76 A;  4DUT A;  3BSO A;  2FVS A;  2RD5 C;  1IBL J;  4AQY F;  1U1R A;  2HW3 A;  1C2P A;  3KNG A;  4KFB A;  4OX9 F;  4J9U E;  4MJK A;  4C7Q A;  5KFP A;  3G8T A;  3W8G A;  1T8E A;  1FJ7 A;  2Z4P A;  2NZ4 A;  2R7V A;  2WVF A;  3IM9 A;  2HPU A;  3M32 A;  5GAE U;  2GAG C;  2ZBR A;  3FEY B;  1S0O A;  1BC6 A;  4LR8 A;  2HWH A;  5GAD I;  2MGZ B;  3IBW A;  3S1T A;  3G6X A;  3OHA A;  5J1P A;  4DV2 J;  1IR2 A;  4HHJ A;  4ZPW R;  3U27 A;  3MTK A;  3TZW A;  5F9L A;  3IBF B;  4LQ3 A;  4O3R A;  2P8I A;  3P4U B;  1NXI A;  4J9V A;  5L1L A;  2BM1 A;  2UV8 A;  3JTN A;  5KFI A;  5M2P A;  2HVI A;  3TVY A;  1FKP B;  3BGR B;  4DR2 F;  3OSP A;  1T05 B;  1VQ8 S;  1FNO A;  1TV6 B;  3OHB A;  1Q7Y T;  1C1C B;  3BN7 A;  3GR1 A;  1RK8 A;  1ZA1 B;  2MLZ A;  1C1C A;  2M70 A;  2D3Z A;  3JSY A;  2FHM A;  3QGH A;  8ATC B;  2RJZ A;  3CE8 A;  2V69 A;  3AD8 C;  5ETP A;  4BWJ A;  4CYU B;  2VQF J;  1HHQ A;  4ECY A;  2UXC F;  2LYV A;  3R5D A;  2YNF B;  4KAI A;  5GAH U;  3HVT B;  4CWB A;  5CCM A;  3H20 A;  2JFK A;  3PJW A;  1RT2 A;  2OHD A;  5KFJ A;  3I56 S;  4FP9 A;  2LXI A;  1RI7 A;  4FF3 A;  4RW7 B;  4OI2 A;  1RAE B;  1LWX A;  3AFG A;  3PY8 A;  3BJY A;  3N0V A;  3DU6 A;  2R8I A;  1Q86 T;  5AE2 A;  4DL2 A;  5L39 A;  1KLM A;  3GV8 B;  1SI9 A;  4QWE A;  3KMQ A;  2XSJ A;  3PRV A;  3QJP A;  1OYD A;  2W4C A;  3D9B A;  4IH6 A;  4ED1 A;  1U1M A;  2UUA F;  2I6W A;  1IXK A;  1TV6 A;  3AOC A;  2CQG A;  2V67 A;  3ZZY A;  3SFU A;  2DK2 A;  4N7T A;  2K2P A;  4X4N A;  3AA8 A;  2OKQ A;  1UEV A;  2CAD A;  3GYG A;  2M8D B;  3UDV A;  3KDN A;  2CWK A;  1U25 A;  5ETQ A;  1K0V A;  4MFB B;  2LU1 A;  4RUB A;  3BO4 A;  3OXL A;  2F7V A;  4DV1 J;  2PDA A;  1B4S A;  3FQK A;  3SXL A;  4ELT A;  2R7U A;  1OY9 A;  4ZPV R;  2HIQ A;  2M0G B;  2KG1 A;  2P6S A;  8RUC A;  5K8O A;  1LXJ A;  2J0S D;  4WFZ A;  2HBR B;  4CH7 A;  4CT9 A;  2DIS A;  5IXU A;  5GMK a;  2F1F A;  3PVX A;  3KFW X;  3MFI A;  1X0F A;  2IRY A;  1D09 B;  3CCT A;  5C25 A;  4M5D B;  2VU5 A;  4UOC A;  4ZCL A;  3PG9 A;  1ZYQ A;  1JLG A;  1M5S A;  2AJ4 A;  2IRU A;  3NWG A;  3Q0A A;  2Z57 B;  1XEZ A;  2FJD B;  1S97 A;  3IWN C;  1F2G A;  5D77 A;  4I64 A;  1SKU B;  3A13 A;  4Q2L A;  5IC6 B;  4AQY J;  4AL7 A;  4I68 A;  4DG1 A;  2UUA J;  2HFS A;  2DYA A;  1BMQ B;  1FRX A;  2BE2 B;  1FFS B;  4KGM A;  4ED7 A;  3UD4 P;  3KNA A;  1T9Y A;  2MHN A;  1F1B B;  3P45 B;  5ETO A;  3QLH A;  2AJ1 A;  1DUR A;  2VV5 A;  3MEE A;  4B02 A;  1LKZ A;  1V3S A;  4RZR A;  3KJF B;  1N5T A;  1S6Q B;  5EWF A;  1SJF A;  3QWU A;  5I42 A;  1T11 A;  1YVF A;  4IH5 A;  5E7O B;  1LQ9 A;  3VAM A;  4RUC A;  2ABY A;  2KTQ A;  2HRT A;  1CJK B;  3FSI A;  5CZV A;  5KG3 A;  1IWA A;  1YJT A;  2RDJ A;  3CIZ A;  2ZE2 B;  3S6E A;  2R8K A;  1E6Y B;  3J7Z T;  1FNM A;  3IAM 9;  3MMJ A;  4J9M A;  1IVZ A;  1XK8 A;  1JLB B;  5HVG A;  2PI5 A;  1N36 J;  3MMB A;  5J2M A;  4OZJ A;  2NXE A;  3A3O B;  3M2V B;  4X64 F;  4RBT A;  3EGV A;  2LQ8 A;  4CRJ A;  3IAS 9;  5K8M A;  4F4X A;  1ZS6 A;  4PKD B;  4O3P A;  1U0S A;  1FVQ A;  4UUX A;  5HO4 A;  2G1D A;  3PV8 A;  2QE5 A;  1UVK A;  1JLE A;  2HHH F;  4MK7 A;  5HAO A;  3O3L A;  1U8S A;  2XWY A;  2R7R A;  2DNZ A;  3KG1 A;  1HWJ A;  2O01 C;  2V9K A;  4W4M A;  2LXU A;  3W64 A;  2HZV A;  4B9M A;  2HFZ A;  3FBC A;  4HLB A;  4FF1 A;  2FZC B;  2XCP A;  1PJ7 A;  3CD5 A;  4AE5 A;  4OZL A;  3ZFV A;  4FNH A;  5CYM A;  1MWQ A;  3P8B B;  4Y2I A;  5DZ6 A;  4HYK A;  5DLF A;  1N33 F;  3ET6 A;  2VG6 A;  2IM3 A;  4DDF A;  2QMW A;  2DGT A;  4L74 A;  2W9B A;  1X7V A;  2DGO A;  4CO0 A;  3T1Y F;  3T1Y J;  1FK9 B;  4YB1 P;  3TZY A;  2KVQ E;  3CDW A;  2HS4 A;  3T1A A;  1SL2 A;  2FJA B;  3C8Y A;  3RJM B;  3ZTS A;  4PWD B;  5KOX A;  2V2Q A;  2ATL A;  1RHK B;  3E3X A;  3NS5 A;  4U6P A;  2YX7 A;  5F3T A;  1TUW A;  1S1T B;  1QY7 A;  2IFX A;  4GC6 A;  2BW2 A;  2I0X A;  2RVJ A;  2ZOG A;  4LRF A;  4JV5 J;  4MIB A;  4L6V 3;  1JLA A;  3BRE A;  3MPD A;  3SI8 A;  5KFH A;  4B9S A;  4FXW A;  2CJB A;  2G0C A;  2Z58 B;  3O6Q A;  1NLK L;  4RW8 B;  3K8V A;  1HW9 A;  2CNL B;  2Z56 B;  2ZD1 B;  3EGW B;  3SCI E;  1RTD B;  3OR2 A;  2ASL A;  3DLE A;  2VFV A;  1UKU A;  4O0I A;  2JLG A;  4N77 A;  5DG9 A;  4DV3 J;  1ZPW X;  4NCG B;  2YX4 A;  3CJ4 A;  4U7U D;  2DIT A;  1LWF B;  1M5K C;  1S6O A;  5F8I A;  2MQQ A;  4NLX A;  2HND B;  2IDE A;  2V2Z A;  3FMW A;  1U1O A;  3T1H J;  1P1L A;  1ZOT A;  2AEJ A;  2DTJ A;  3M4X A;  2OFH X;  3CCE S;  4JV0 A;  3Q8R B;  4J9P A;  4QYZ K;  4WFX A;  4HI2 A;  2YXL A;  4O44 B;  4TNO A;  1HNZ J;  2RHQ B;  1A9N B;  2H3E B;  2WOM B;  4K8R A;  3BF4 A;  1S10 A;  2VJV A;  3PZP A;  3D54 A;  3KJN B;  1ZM3 A;  3K58 A;  2MKH A;  2MLY A;  2V8V A;  1FJE B;  1ZA2 B;  2OPR B;  4L75 A;  3KK2 B;  1SQE A;  5D0H A;  2C3O A;  2V94 A;  2DB1 A;  3MI7 X;  5IT0 A;  3KLH A;  2R9L A;  4OHY A;  1WOS A;  2PE8 A;  3HSG A;  4S0M A;  2EKN A;  3H2U B;  3T5L A;  2YX1 A;  4A8M P;  1NH7 A;  5H9F K;  3CJK A;  1R43 A;  1F9E B;  3KKF A;  2ZC3 A;  4HVZ A;  3DNC A;  5HQM A;  4OFZ A;  4B08 A;  4DQR A;  3L3C A;  3KLG B;  4NEZ A;  2ZFH A;  1QTN B;  4IUF A;  3BGU A;  3EGZ A;  4OYX A;  1RYS A;  4A4J A;  4DR2 J;  3R5C A;  2W8K A;  2UUC F;  2KZZ A;  2ZJQ Q;  2J7U A;  1KDN A;  4HT7 A;  4LFA J;  2V50 A;  3SCJ E;  4F0H A;  4DL3 A;  1RJJ A;  5KG6 A;  1JMT A;  2MJN A;  1WSV A;  2GS8 A;  2X1B A;  3CDU A;  4AND A;  4FBU A;  4DPY A;  3BKU A;  5D4O A;  2DNN A;  1RHR B;  1S9G B;  3QAT A;  1HWK A;  2N3O A;  1ZPV A;  3OR1 A;  5DLG A;  4FS2 A;  1H6K X;  4NI2 B;  2WBR A;  2J9D A;  3DI6 A;  3NMR A;  1HFE L;  1HBO B;  1UFL A;  3K57 A;  3I0S B;  4A8Q A;  2IM0 A;  1RAF B;  4Y2K A;  3LGN A;  1UZH A;  4USM A;  1V3R A;  1FT8 A;  3J7Y U;  2FVR A;  4BHQ A;  4EI2 A;  2HHH J;  5LSO A;  4NYZ A;  2AYG A;  2JH3 A;  3CPW R;  5E3Q A;  3DOL A;  7AT1 B;  4YEA A;  3OXF A;  1K8A T;  5GVQ A;  3OLA A;  1JXE A;  2DT9 A;  2K3K A;  3DXS X;  4Q8F A;  2IMO A;  5ETV A;  3LAK A;  2EKY A;  3HMJ G;  2AF6 A;  3EVW A;  4QIG A;  3CDA A;  3FDS A;  3PJ9 A;  4P10 A;  1FES A;  1GMW D;  1EQ0 A;  3VTI A;  2QSW A;  4O3S A;  3GJT B;  1TKT B;  2LEA A;  2D69 A;  3MR5 A;  2UXC J;  4A48 A;  4DR3 F;  2QA4 S;  5HLF A;  1QSY A;  4U7C A;  2IYG A;  1B0V A;  2M4M A;  3PCO B;  4NYP A;  4PG7 A;  2QA2 A;  4Y2A A;  3QT7 A;  4LFB F;  1X4E A;  2VKZ G;  4CLS A;  1TKT A;  2X3G A;  1WDD A;  1TEL A;  2FJE B;  2LA4 A;  2PO4 A;  2GVZ A;  2ZBP A;  3MM6 A;  3P3D A;  4HL9 A;  4LSZ B;  1AB8 A;  4NX9 A;  3ZZ0 A;  4RW4 A;  5IV3 A;  2XZW A;  1TK8 A;  1AFJ A;  1APS A;  2W4D A;  5ETM A;  2MZ1 A;  4K0K F;  2BJ7 A;  5AJ3 F;  1TU0 B;  2Z2Y B;  5LM7 E;  3Q8S B;  3OL8 A;  1NCL A;  3EVO A;  3PO5 A;  3RU0 A;  1KC8 T;  4BDP A;  4KSE B;  1H7W A;  2HFN A;  2ZVS A;  3R8Y A;  2KYZ A;  2Y0B B;  4KRW A;  3MPU B;  2ZJP Q;  1HMV B;  4XK8 C;  4NXN F;  4WXW A;  4NLO A;  5J2Q A;  2XWX A;  2KYX A;  5DM7 Q;  4GO5 X;  4V19 J;  3TUP A;  4M8L A;  1U1L A;  4I2Q A;  1UW4 A;  3W8P A;  4KPY A;  5J2N A;  1RWX B;  2GGP B;  1HPZ A;  3HHL C;  4DEZ A;  4DFP A;  3OR1 B;  1P8G A;  3WC0 A;  4DR4 F;  5DRK A;  1HBN B;  3CMQ A;  2K1R B;  3H8Y A;  4QPT A;  4JI6 J;  3AXK A;  3PYF A;  1UWB B;  3M7V A;  4LF2 A;  3D28 A;  1PBA A;  1NK9 A;  1S1U B;  1N5S A;  1YBT A;  2BV3 A;  4H4K C;  2DHX A;  5JJB A;  4WU2 A;  4NLU A;  4F0M A;  4BWM A;  2ZH2 A;  1NK0 A;  3UD5 A;  5D15 A;  3SFG A;  1RP5 A;  4G1Q B;  2FQQ B;  4TXS A;  3FQL A;  4K0K J;  5DM6 Q;  4DV6 F;  1R0A B;  5IQ6 A;  4KGX B;  4UOF A;  3HHL B;  5IM0 A;  4FYV B;  1S9E B;  1WHW A;  3GJS B;  3NEK A;  2EFP A;  4CO4 A;  2VPX B;  2XEX A;  3J7A 1;  4X66 J;  1FE0 A;  1P27 B;  4CIO A;  3BGO P;  3I5C A;  5EHH A;  5HRO B;  3HUL A;  4URS A;  3QNW B;  1FKO B;  3HJV A;  3DOM A;  2N82 B;  1PGZ A;  4W90 B;  3EPI A;  2ASD A;  4USK A;  1YDL A;  4B3S F;  4DV3 F;  1Q8B A;  3JQK A;  2Y1J A;  4KT0 C;  1SVD A;  2HS3 A;  1RQ0 A;  4CO2 A;  4C6A A;  2FJX A;  1S59 A;  4X4O A;  4QCL A;  3DLB A;  3VAH A;  2AX0 A;  2Z2L A;  4P52 A;  1S9F A;  1EKS A;  3IC1 A;  1N34 J;  2FD2 A;  2BAN B;  2B4P A;  3AXM A;  3DCA A;  3ELH A;  1HIY A;  3VHQ A;  5KT5 A;  3D6F B;  4CP5 A;  1WC6 A;  5A76 A;  2DPI A;  1S1T A;  1Q0N A;  3CJ2 A;  2CQ0 A;  3HK2 A;  4PR6 A;  1U0H B;  3EMT A;  4H4O A;  4NLT A;  2AP6 A;  4C8Z A;  1F9H A;  3A8K A;  3TYT A;  1CQM A;  2M88 A;  1RAC B;  1RWM B;  1U6Z A;  2IYI A;  1XMQ J;  1RDR A;  1WSR A;  3HJF A;  1I5O B;  2VH7 A;  3TJA A;  1SC1 B;  5B7W A;  5LMU J;  3UVJ B;  3DLK A;  4JI1 F;  2BJ1 A;  3FK4 A;  3PXG a;  1XMO J;  2Q43 A;  1RTZ A;  4NE9 C;  1GNK A;  1LW0 B;  2C1E B;  4GO7 X;  4KQZ A;  4DZD A;  3MUR P;  2GO9 A;  4LF6 F;  5A6W A;  4YR0 A;  4OV1 A;  3D67 A;  1K73 T;  3ZNU A;  3KLE B;  2CDQ A;  2XMV A;  4I6A A;  4LUB A;  1DY3 A;  1U2C A;  5C2G A;  1KSP A;  4IO1 A;  3HD2 A;  2R8J A;  4DCO B;  4P6Q A;  3DXB A;  2GCF A;  3KJQ B;  2YNH A;  4IFV B;  4B3O B;  3FZ2 A;  1FDN A;  4NLD A;  2XQC A;  1EET A;  2CIM A;  4AL6 A;  3V6H A;  1RB0 A;  2NXU A;  2VG7 B;  1RWW B;  4UOH A;  3ET6 B;  5LMN F;  2QA1 A;  1T95 A;  3T9Z A;  2DY9 A;  2R2T A;  3LGH A;  2N7C A;  2KFN A;  1NM2 A;  2IC3 B;  2V5H G;  2VDH A;  4H4M A;  2YQ3 A;  1B70 B;  1YRU A;  3DU5 A;  3L7U A;  4M5K A;  4FF2 A;  5CCL A;  3L4B C;  3UE2 A;  3VGU A;  1ZBT A;  4ENO A;  1NB2 A;  3MZI A;  2E5J A;  3JTO A;  5IWA J;  4IDK A;  3T9N A;  1PC5 A;  3N4W A;  1PO6 A;  4ZVU B;  3PX0 A;  1HNX F;  2QL7 B;  3B78 A;  3PIO Q;  1FJG F;  4NLR A;  2L3M A;  1OY6 A;  3R27 A;  1R8A A;  5CHC B;  5HVH A;  2X1F A;  1G2E A;  1HPZ B;  1Q8I A;  2W8L A;  4USW A;  1PAU B;  3G8Q A;  3TJ9 A;  1HWL A;  1X9W A;  1F5B A;  3PYG A;  3ZZT A;  1WG5 A;  2U1A A;  1VC6 A;  3FCV A;  3PW7 A;  1QAI A;  2PD1 A;  2E5L J;  2B4V A;  4UW2 A;  1HMV A;  1E6V B;  2OD4 A;  2JOQ A;  2ZE2 A;  1SIW B;  3PHE A;  3PIP Q;  5HVF A;  3M1V B;  4ZIV A;  2V4Q A;  3R1H A;  1SL0 A;  2HBY B;  2HQD A;  1HWU A;  2W2M P;  1TAQ A;  2UZA A;  3LAL A;  1R0C B;  2DNY A;  4Y65 A;  4ZS6 A;  3TAM B;  4IDK B;  1YQH A;  5MLC V;  1RGV A;  4JV1 A;  3C3L A;  2ZHA A;  4CLW A;  3KLG A;  1YRT A;  2CJA A;  2XZD B;  3QPI A;  4QQB A;  4ZDN A;  3Q8P B;  5DZ7 A;  4DV6 J;  3SDE A;  4B9N A;  1Z1Z A;  4AUK A;  1FRK A;  2U2F A;  2ZUG A;  3GR0 A;  4K2J A;  3TWZ A;  1GT8 A;  1OQ6 A;  4O0N A;  4WTO B;  5DDQ C;  1ZZF A;  4USI A;  3TOQ A;  3VQT A;  1NPP A;  4MMO A;  4YDD B;  1MWZ A;  4P2S A;  4Y6I A;  4ZKA A;  1NK6 A;  4B9T A;  3G8S A;  2HBQ B;  3R5A A;  1O51 A;  4TLR A;  5C42 A;  3R2C J;  3NGD A;  4WK3 A;  2FY8 A;  4DV1 F;  4DR4 J;  2NCK L;  1BY9 A;  2RH3 A;  5ITH A;  2LDI A;  3HFZ B;  1R8B A;  1RT4 A;  4PXB A;  1NZ8 A;  5DS7 A;  5HMX A;  4C97 A;  3KLF A;  2VA2 A;  4CLY A;  1MNE A;  4JUZ A;  2HNZ B;  2UVU A;  2A0F B;  1XR5 A;  2GNK A;  3AQP A;  1L3T A;  3H0P A;  4F4Y A;  2B8Q A;  2MKY A;  4M5N A;  3D1Q A;  3V6K A;  1SJ4 P;  1J5E J;  2DR8 A;  3V6D A;  4H54 A;  1VIO A;  1UTA A;  3U02 A;  4ES3 A;  4QU6 A;  2DCL A;  1LW0 A;  4WK1 A;  1HBO A;  1LNQ A;  4EU0 A;  4DWI A;  2N7Y A;  1SIZ A;  3GU0 A;  1SKW A;  2QEX S;  1DAX A;  2DY1 A;  3VGT A;  4YUD A;  5FDL B;  3KLV A;  2UXB F;  1U48 A;  5IOL A;  4ED2 A;  1QLN A;  1VC0 A;  3PO4 A;  1R7I A;  2R7T A;  3MHY A;  2RNE A;  1UL3 A;  2CQC A;  2RHS B;  4TU8 A;  2F4V J;  3OL6 A;  1IKW A;  2OTL S;  4CYU A;  4WE1 A;  2B8P A;  2HKE A;  3W65 A;  2XCA A;  3RR8 A;  2J7K A;  1AZS B;  3G86 A;  2VIH A;  2G0I A;  2AX1 A;  4UQT A;  3QAE A;  5L9X A;  3KMS A;  4LFC J;  3GP9 A;  5I3U A;  2MST A;  1X4C A;  3CD7 A;  4QWB A;  3OTE A;  2IDL A;  3QFH A;  5DG8 A;  2YTC A;  3QGP A;  5E3C A;  1RU1 A;  2X7I A;  4RW7 A;  3Q8Q B;  4JV2 A;  4NI2 A;  1NND A;  2YY3 A;  3M6V A;  1S9G A;  4B3R J;  3HVT A;  4R25 A;  5RUB A;  2H1Y A;  2YNF A;  4LFC F;  4C8L A;  2HHX A;  4RX6 A;  3CCS S;  2FLP A;  1Q5Y A;  1U6B A;  1CPZ A;  1UJ6 A;  4NLS A;  1UVN A;  3MCM A;  1FDA A;  2VC0 A;  3Q24 A;  2IRX A;  1NK7 A;  5IFM A;  1SH3 A;  4PWU A;  3HHL A;  5IM0 B;  1L3V A;  3QRP A;  1WAC A;  4ECS A;  3V81 A;  5T7L A;  1VQ9 S;  2FHK A;  1XR6 A;  2ZIT A;  3HX9 A;  2E5H A;  4FYW B;  4LRC A;  1H0H B;  1NDC A;  4HR2 A;  1QAX A;  5D0G A;  4GKJ J;  1NEE A;  4AXJ A;  3GIM A;  1TFW A;  2HND A;  4QW8 A;  4RBV A;  3AJD A;  3HXM A;  2MQM A;  5BYR A;  4HEA 9;  3M05 A;  1IN0 A;  2B4O A;  4OZN A;  2AYM A;  1X60 A;  3R5G A;  5D0R A;  1NKE A;  4LRB A;  1ACM B;  4JI4 J;  1TZ0 A;  1C1B B;  1T3O A;  1TR0 A;  2CKW A;  4K4Y A;  3FRZ A;  2RS8 A;  2C2D A;  1W2I A;  1RAO A;  2XNR A;  3NXZ A;  2PC6 A;  3IXQ A;  2VFT A;  5D0E A;  3TUI C;  3P49 B;  2AWZ A;  1BGX T;  2H5E A;  3ISN C;  3QQC D;  4DFK A;  1N32 J;  4PPD A;  4I2Q B;  1AYE A;  4D3G A;  2GMJ A;  2AJF E;  1F6T A;  1Y00 A;  1JLA B;  5KFS A;  3CVK A;  3CSK A;  4FYY B;  4I6Y A;  3WQP A;  2OIH A;  4M94 A;  3H4B A;  3U1M A;  2O67 A;  4OLP A;  1VQS A;  4LIR A;  3DRP B;  4CM0 A;  3LPY A;  1DLO A;  1REV A;  2XHC A;  5A8W A;  2J9C A;  2LQB A;  4JI0 J;  3FZB A;  4FPI A;  1BQN A;  4N8N A;  2J9E A;  1VK3 A;  3DKD A;  2PSZ A;  2RIJ A;  4RNF A;  3H2L A;  3OUY B;  3BM7 A;  4J9S A;  4PWD A;  2V8P A;  2F9D A;  3CJR A;  3A8J A;  3KTQ A;  4DN0 A;  4ILM A;  4LSN B;  4M63 A;  1K44 A;  2C2R A;  1S0M A;  1N5Y A;  1JLF B;  1PC4 A;  1HNV A;  3HF5 A;  5D78 A;  2RB7 A;  4ZPA A;  1AUD A;  3BPD A;  1MW7 A;  2RML A;  2HYI B;  3QSY B;  2Z2Z A;  4UQG A;  2HHS A;  3SBM A;  2X51 A;  2AD9 A;  3JQM A;  3K2Y A;  4E98 A;  1YJ7 A;  4XAK A;  2FGC A;  2L41 A;  1T9T A;  4IYQ A;  3CC7 S;  1IBC B;  2M8H A;  2W2P P;  2QLW A;  4ECR A;  3QSI A;  3PW4 A;  3MFH A;  2Y8Y A;  3KLI B;  2M5Y A;  1RAD B;  4QOT A;  4F02 A;  5LMN J;  2OML A;  1S48 A;  1IJF B;  2I5J A;  2LXF A;  2ZH5 A;  5AXM A;  4USU A;  1KHW A;  4C98 A;  4NLG A;  5KG1 A;  3VAJ A;  1GXT A;  4ED6 A;  2V4J B;  2GQ2 A;  4P7T A;  5EUH A;  2ZDO A;  2XGQ A;  2W9B B;  4QIE A;  4I4B A;  2C28 A;  3C6T B;  2O1P A;  3I0S A;  4K59 A;  1Q78 A;  2LQ9 A;  3M2U A;  4ZN3 A;  4DPW A;  4CH1 A;  3CUN A;  2KDO A;  1H38 A;  3W61 A;  4Y28 C;  3PKM A;  2FTR A;  4YP3 A;  2WAQ D;  3KHL A;  3EYZ A;  5EX0 A;  5THW A;  2UVW A;  1PBU A;  2WW4 A;  3DN9 A;  1HQ2 A;  3R5B A;  4QR1 A;  3UDC A;  4ZHR A;  5HBM B;  1XR7 A;  5IWA F;  2MDA A;  1X31 C;  3J7Y I;  3MR6 A;  3F73 A;  2W2O P;  3VQS A;  5I42 B;  4X4T A;  4YHH J;  4DFM A;  2RRN A;  4LR7 A;  3BH7 B;  4OX8 A;  4Y00 A;  4F7V A;  1DQ9 A;  4DR1 J;  2V9W A;  3BBB A;  2POK A;  1KP6 A;  3MMB B;  2Y8W A;  1F0X A;  1RLC L;  2IVY A;  2OEM A;  2HK2 A;  2ZWP A;  3IR5 B;  3MM9 B;  3QLH B;  3J7Z 5;  4LF8 F;  1FX4 A;  4DS5 A;  3QIP B;  1RT7 A;  1E6Y A;  4A8K A;  2BE2 A;  2D7S A;  2HBZ B;  2D3O 1;  2HQI A;  2W9C A;  4FNI A;  3I5B A;  4ZVT B;  2X3D A;  1NO8 A;  2WVB A;  5GAG I;  3KLH B;  2DHS A;  3CCQ S;  1JLQ A;  3N9U C;  1RCX B;  3RBD A;  3VAK A;  2AIR B;  1K1S A;  3HFK A;  2NXN A;  5KT2 A;  5IZH A;  2KJW A;  4CLU A;  3HSD A;  1YBA A;  4F4Z A;  3T5H A;  1N36 F;  3ENQ A;  3M30 A;  4NAS A;  1VIX A;  2RF2 B;  4DL0 C;  3KWM A;  1RWP B;  3RRK A;  4DLE A;  1FX2 A;  2FC9 A;  4PAB A;  3B82 A;  4UF4 A;  1U45 A;  1RT6 B;  2RQ4 A;  4I2P A;  3DRP A;  3PJX A;  4ITS A;  1ZTT A;  3H2V E;  3BGF A;  1VRT B;  2CPZ A;  2EXU A;  1RU2 A;  3L7P A;  3UN3 A;  4MYT A;  5BYS A;  2ZH4 A;  2LMI A;  1I51 B;  2ZBQ A;  5CD4 A;  3Q86 A;  2ROG A;  4JB8 B;  4TU9 A;  2NSC A;  5F8G A;  1OSD A;  2KH9 A;  3IN5 A;  6AT1 B;  8AT1 B;  1BE4 A;  1CJU B;  3HVR A;  3RB3 A;  1JXL A;  4LF8 J;  3OR2 B;  2LEP A;  1ROF A;  2P9E A;  2COL A;  3FFI B;  1FXR A;  3NNA A;  4LF9 J;  2RUS A;  4F36 A;  2BQU A;  2AMC B;  4ZCK A;  3C15 A;  4OYO A;  1FWK A;  1VRQ C;  4EMD A;  2MQN A;  2OSR A;  4A8S A;  5I4M A;  4ED4 A;  3VAI A;  3A1Y G;  2E1A A;  3RBX A;  3GSD A;  1G4C A;  2CPY A;  1FJC A;  2AZ1 A;  2IA6 A;  1NHU A;  1RT2 B;  4G65 A;  1RBO B;  4M5J A;  5KFL A;  1RT7 B;  4OV6 A;  2AT1 B;  5IT4 A;  4OI0 A;  3QRQ A;  2YNG B;  3KJV A;  3VGV A;  1JKH A;  4Q43 A;  1WKJ A;  3J81 j;  4OX7 A;  4U9R A;  3CD0 A;  4UY8 T;  2V4R A;  4HKQ A;  4DX7 A;  4KGV B;  1UVI A;  4J9O A;  2VOO A;  2YWW A;  2IHR 1;  6FDR A;  1O5J A;  1JJ4 A;  1TFY A;  2B56 A;  3M8S A;  2XSJ B;  2ZJR Q;  1T05 A;  3CUL A;  3D68 A;  1EHW A;  5GMD A;  2QO3 A;  2GFF A;  1JLQ B;  2RQM A;  3UWT A;  5L1K A;  1S77 D;  4RWX A;  1DTQ B;  1C0T B;  1MN7 A;  2JC0 A;  3LAN A;  4LF9 F;  3CJS A;  4F2S A;  2CNO B;  2J9D E;  3AD9 C;  2P9C A;  4MKA A;  4Q45 A;  1VCT A;  2OPQ B;  4NMX A;  3HZG A;  4WCE Q;  3TQE A;  2AZ3 A;  2QYC A;  1XN9 A;  5E5N A;  1YJN S;  2MTL A;  1Q53 A;  4ZIW A;  2V4J A;  1WWH A;  1EKR A;  2JC1 A;  2PFD A;  1IKY B;  3M8Z A;  2JEG A;  3CJ8 A;  3LH2 S;  3R5J B;  1EQM A;  4MH8 A;  4U7U K;  4ECQ A;  1FKP A;  3BGR A;  1WOO A;  9ATC B;  5AXN A;  2DD8 S;  3W9I A;  3KUG A;  1JIH A;  3M6U A;  3ENV A;  3ZTO A;  2NRE A;  4TY9 A;  5J2M B;  2RRB A;  5FDL A;  2VBY A;  2WVE A;  3DGP A;  1VQN S;  2XHW A;  2VKR A;  5CH7 B;  4A46 A;  1FDB A;  3KUE A;  3AOA A;  2XYG B;  3M2U B;  4DFJ A;  1EAR A;  1GMW A;  1QUV A;  1S7I A;  2DNR A;  1URN A;  3DRS B;  3K5M A;  1TL7 A;  1I1G A;  3VAG A;  3HVA A;  1NRK A;  2D1C A;  3MM5 A;  4KB7 A;  4KV8 B;  4DV0 F;  2MZS A;  2C2E A;  1XNR F;  1S0V A;  2HHU A;  4J37 A;  4F2R A;  3V5R A;  2V8H A;  3M9N B;  3BN4 A;  3GIL A;  1N5Y B;  2NLW A;  4P72 A;  2VOP A;  4PQU B;  1VBX A;  2L08 A;  2QYG A;  3N28 A;  2D41 A;  3C6U B;  3MAA B;  4DQQ A;  3LAM A;  2WCX A;  1FRH A;  3C16 B;  2ZWO A;  4MT1 A;  4UTG A;  4ANC A;  1KON A;  2CJ9 A;  4V19 X;  4K4U A;  2AEM A;  3M8W A;  2PII A;  1FER A;  1U24 A;  4Z7C A;  5C2C A;  5AJ3 J;  2V63 A;  2BJD A;  3SSS A;  4OX9 J;  3ETO A;  2ILY A;  4DZ6 A;  3MEG A;  2Y1L B;  4DXL A;  5KFN A;  2XS5 A;  2KB2 A;  1HBM B;  3M8P A;  5HJY A;  4RNO A;  1S99 A;  3N6M A;  3POT A;  4U8V A;  2N4C A;  4ZVO B;  4HT5 A;  1VDH A;  1YKW A;  1HKA A;  3DRR A;  1J5O B;  1WEL A;  2NPF A;  1HNW F;  4J9K A;  1OYE A;  2VAS A;  2YNI A;  3UDL A;  4C0H A;  3H5U A;  3THT A;  4EO6 A;  1S5Z A;  2J7W A;  5T14 A;  4B17 A;  4C8Y A;  3RW6 A;  1LK5 A;  3OTB A;  2MZT A;  5T41 A;  3DRR B;  1J5O A;  1N5Q A;  3FSX A;  5L9N A;  4LF6 J;  4WZM A;  1D3W A;  3X1L B;  1EZZ B;  1RAG B;  2XS7 A;  1KHV A;  2APO A;  4F3Q A;  1TQL A;  3DDN A;  3CIM A;  1HI8 A;  2CXE A;  4KE5 A;  4NML A;  4ECW A;  3VWS A;  4C0B A;  1PIE A;  1NK5 A;  1U1N A;  3AB4 B;  3G82 A;  3ITH A;  3PEJ A;  1M1K T;  3W9J A;  2CPE A;  1GK8 A;  1TKZ B;  1WC5 A;  4DPO A;  4KY3 A;  4ALZ A;  3BO3 A;  3C46 A;  3R7S B;  3C16 A;  4TQS A;  2IBO A;  1HNZ F;  3NG8 A;  3RG6 A;  5IT9 Y;  2W2N P;  4P7V A;  4USH A;  2HAI A;  3W3S A;  3GJQ B;  3RB4 A;  1NPK A;  2EI5 A;  5D4L A;  2W24 A;  2CG8 A;  3B8H A;  4JI2 F;  2F4F A;  4ZVQ B;  2DR9 A;  1SKS A;  4LVO P;  3Q8Y A;  2RS2 A;  2IY5 B;  2BXJ A;  1OWX A;  3FBB A;  4KH1 B;  2QLF B;  3W63 A;  4RBU A;  3V2U C;  4B3S J;  3W66 A;  5BR8 J;  3FMB A;  3D1O A;  1K9M T;  2HHW A;  4I6W A;  3ZTR A;  1D1U A;  2ZNY A;  1RT5 B;  2GO8 A;  2WB4 A;  1T3N A;  1NB7 A;  2YVS A;  1SV5 A;  3TVZ A;  1IR1 A;  4TY8 B;  5BXI A;  5I3U B;  1RA6 A;  3M9M B;  2LEC A;  5DQG A;  2J6S A;  4JI7 F;  1AZS A;  2ZDP A;  1HWI A;  2R42 A;  5ADZ A;  3J80 Y;  3KDO A;  4DUY F;  1N32 F;  3IGN A;  3L95 X;  1CJT B;  5CYQ B;  1N56 A;  3CMA S;  1U47 A;  4EBD A;  4NLY A;  3SCL E;  1VQM S;  4EZ6 A;  3BBF A;  2AYB A;  5KFR A;  2KI2 A;  4PG5 A;  3WIU A;  1X4B A;  1HYS A;  5D8H B;  1RHQ B;  2J0X A;  3M32 B;  1DTQ A;  1VOM A;  1ZAV A;  3M2R A;  2AYE A;  4ICL B;  1C0U B;  2FIU A;  2GJF A;  3QBC A;  1RIS A;  3RAQ A;  2CPI A;  4ECT A;  3N5B A;  2MLX A;  3NAI A;  4KFB B;  1RT3 B;  1VBK A;  1X8D A;  2PA3 A;  3H98 A;  4ZPB A;  3TEG A;  5J1E B;  5DDP C;  3J80 U;  3CXC R;  1ZAX A;  2WVC A;  2F3J A;  2MKK A;  1MML A;  3OL7 A;  3TQ1 A;  3WX4 A;  4A8Y A;  4DPT A;  3MUV P;  1LK7 A;  5AT1 B;  2H5I B;  3T5K A;  1DZ5 A;  4LJM A;  4CI0 B;  4ELV A;  4LRA A;  2GMH A;  4WBF A;  4C11 B;  2RUG A; 
#chains in the Genus database with same CATH homology
 4PWW A;  4AQY J;  2UUA J;  4NEZ A;  1N34 J;  4JI5 J;  2VQE J;  4RJV A;  5A2Q U;  4JI8 J;  2UXD J;  4DR2 J;  3IMQ J;  2F4V J;  4LFA J;  4B3T J;  4JYA J;  4DV7 J;  4YHH J;  4HHU A;  4LF4 J;  4JI2 J;  1XMQ J;  4DR1 J;  1FJG J;  5LMU J;  4LFC J;  4GKK J;  5AJ3 J;  2UUB J;  4X62 J;  1XMO J;  4YY3 J;  4OX9 J;  3R2D J;  1XNR J;  4DV0 J;  2HHH J;  4B3R J;  2UXB J;  4LFB J;  4B3M J;  1N36 J;  4JI7 J;  1N33 J;  2KL8 A;  3JAM U;  2UU9 J;  1IBL J;  4LF6 J;  4LF5 J;  1IBK J;  4NXN J;  2ZM6 J;  4JI3 J;  4NXM J;  2UXC J;  3D3B J;  4DV2 J;  4GKJ J;  4KY3 A;  3D3C J;  1XNQ J;  3T1Y J;  5IWA J;  4LF8 J;  3OTO J;  2KVQ E;  4JI4 J;  4LF7 J;  4LF9 J;  3W1Y C;  5LM7 E;  2VQF J;  4NEY A;  4V1A k;  1N32 J;  5FLX U;  2UUC J;  4JV5 J;  4B3S J;  4KYZ A;  5BR8 J;  2E5L J;  1HR0 J;  1HNW J;  4X65 J;  4JI0 J;  4X64 J;  4DR7 J;  4JI6 J;  4DV5 J;  4DV3 J;  4DV6 J;  4JI1 J;  1HNX J;  4DR6 J;  3T1H J;  4DV1 J;  4K0K J;  4DUZ J;  2MQ8 A;  4DUY J;  1HNZ J;  4DR5 J;  2MEW A;  3J7A N;  5IT9 U;  2MTL A;  3J80 U;  3R2C J;  4X66 J;  4DR4 J;  5LMN J;  3J81 U;  4DR3 J;  4KHP J;  4DV4 J;  1J5E J;  1I94 J;  1IBM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...