4DV5J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv5J00
4NXMJ 1XNQJ 3W1YC 4K0KJ 2ZM6J 4PWWA 1HNZJ 4DV3J 4JI1J 4X64J 4LF7J 1HNWJ 5LMNJ 4LF4J 4DV2J 4DV5J 2UUAJ 3T1HJ 3R2DJ 5IWAJ 2UU9J 4JI6J 4DR4J 4OX9J 2KVQE 1FJGJ 1HR0J 2E5LJ 5LM7E 1IBLJ 4V1Ak 4NEZA 1HNXJ 1N33J 1N34J 4DV0J 4LF5J 1XMQJ 2VQFJ 4DR5J 5LMUJ 3D3CJ 4LF8J 4JYAJ 1I94J 3R2CJ 1N36J 4KYZA 2UUBJ 4HHUA 3JAMU 3J80U 3T1YJ 4AQYJ 4DV6J 4JI8J 4JI4J 1N32J 4DR2J 3J7AN 2MTLA 4JI0J 2UXBJ 4B3MJ 2KL8A 5A2QU 1J5EJ 4GKJJ 2UXCJ 4B3RJ 4LFBJ 2VQEJ 4YY3J 5BR8J 2UUCJ 4LFCJ 3OTOJ 4X66J 4LF9J 1IBKJ 4JV5J 4DR6J 4DUYJ 5AJ3J 4KY3A 2F4VJ 4LF6J 4DV7J 4KHPJ 1IBMJ 2MEWA 2UXDJ 4NEYA 4DR1J 4RJVA 4DV4J 4JI2J 2MQ8A 3D3BJ 4B3SJ 4GKKJ 4LFAJ 5FLXU 4NXNJ 5IT9U 4B3TJ 4YHHJ 3IMQJ 4DR3J 3J81U 4X62J 1XMOJ 4DUZJ 4JI5J 4JI7J 1XNRJ 4X65J 4JI3J 4DR7J 4DV1J 2HHHJ
chains in the Genus database with same CATH superfamily
3M2RA 1SJ1A 3CMAS 1JNZB 3L7PA 4W90B 4QWBA 1UEVA 3VAJA 2VOOA 2HFNA 4LUBA 1G3OA 2MKIA 3KHRA 2C3PA 3BSNA 3HXMA 1UAWA 1Y3JA 2OTLS 4MYUA 4FYDA 1Z4UA 4P73A 1RHJB 3PKMA 3BGLA 3VAMA 5D4OA 3A13A 3TAMB 2CIMA 4NRTA 5F8HA 2O1PA 3M8YA 5K8NA 5L1JA 3CXCR 2MY7A 2RILA 2VG6B 1ZPVA 3M7VA 2RB7A 3M4XA 2BRKA 5L1KA 3B78A 5DDQC 4OJ1A 2IA0A 1WG4A 1FD8A 2E5IA 4IR9A 4CO5A 1KTVA 2WVCA 2R8KA 4QW9A 2X51A 1NSAA 1UJ4A 4ZLLA 4KHRA 3KWMA 1Q78A 4KE5A 3EPGA 3OFFA 3ZNJ1 3WX8A 4X62J 1MW7A 1RLDA 5HATA 3HT3A 2BYCA 2HVHA 2CPEA 3SCIE 4DS5A 4Q2LA 5KFUA 3ELHA 1S1VB 5B0GA 3TAMA 3MR7A 1JWWA 1SJQA 2KXHA 3PO4A 4DR6F 3PRVA 3GIIA 2VG6A 2H5IB 5HJYA 5AXNA 3HVWA 2UV8G 4Q7AA 4JI2F 1S9GB 1EQ0A 4BC7A 4MK8A 2ZDOA 2R8HA 3I0SB 1U8SA 5HMZA 3L3CA 3PX0A 1UVLA 4QPXA 1X9WA 2MTLA 5IZHA 2L9WA 2DEIA 1VQNS 5ITHA 4AQYF 1SVDA 2I1RA 1U1PA 1K0TA 4LJMA 1SQEA 3UFCX 4DL0C 2RDJA 1S1VA 1HPZA 2UUCF 2B7CB 2MZRA 2RAQA 3OTOF 2VPZB 4F4XA 2XCAA 3I5AA 2WVFA 2R2UA 2D3ZA 4X65J 2VPYB 1LK5A 5LXYA 4G1QA 1S77D 2GIFA 1L3UA 1S9GA 2B43A 3GIKA 5U47A 3WDOA 3I0SA 4FYVB 5A76A 5KFZA 1R8CA 2DXEA 2J7KA 3OQ2A 2HHQA 2ADBA 4TXSA 2DHGA 5F0WA 2BANB 4ZN1A 4NCAA 1TUVA 1O51A 3K2YA 1TR0A 4QWAA 1FFSB 5M2UA 3L95X 1GXLA 2P9CA 2XZWA 4X2BA 4LF5F 2GJFA 1EX8A 1QM9A 2GO8A 1X7VA 1U8WA 3BH6B 2HIQA 3DCAA 2DR7A 4B9UA 3MD3A 1WTFA 1RABB 3RRHA 2ZBCA 4NE9C 1TELA 3D6MB 1BQNB 1S6QB 5FLXY 2MKCA 1OY9A 3DMJB 1R89A 1F9EB 3QBCA 4Z7CA 1IWAA 1WI6A 2BANA 2QE5A 3CB4A 2ACMA 4ZA1A 2OEKA 2VONA 4ECWA 3GPAA 1RA7A 2YWKA 3G2XA 3U02A 2HGNA 2BA9A 2Q6CA 1HI8A 1XIQA 4C98A 3W62A 4N8OA 2EFGA 3IG1B 4ILRA 1QDUB 5KFCA 4KHMA 3BN4A 2AHOB 2VIHA 4NLQA 4ECTA 5G4DA 2DGVA 4O3QA 3RU0A 2BKOA 1P1LA 5JMNA 2CJ9A 1H38A 2AJ2A 2CQPA 3DMJA 2GC8A 2RF2B 4YDDB 1GEHA 2OSQA 2RJZA 3LP2B 3CPWR 3DRSB 1KONA 5DQIA 4TQRA 4A8WA 2F8EX 3M6WA 4F2RA 2YH0A 4DV4F 3Q86A 3EYZA 4RNFA 2LFVA 4A8FA 2BZ2A 3C14B 4U67Q 3C46A 1VQ8S 1M90T 3TA1A 2HZVA 3IG1A 4JI3F 4USHA 1VBZA 2KYZA 2GMLA 3AHPA 3TJ9A 2YWFA 4GRSA 3W63A 4I1TA 1QY7A 3M05A 4FN5A 3EZOA 2DK2A 1RAGB 2KYXA 5L38A 1D8ZA 5CYQA 4PQAA 4HI2A 1WG1A 2UUBJ 2MLZA 3V2UC 3HVRA 2RF2A 3OTEA 5H9EJ 4DQRA 2DR5A 2HVDA 2AV5A 4B3RJ 5AXLA 2NYIA 3KLHB 3N28A 3T1YF 2Q6BA 2ZH4A 1VRQC 1S6OA 2V8HA 2B4VA 3OL6A 1SV5B 2XO6A 1RAEB 2DCUB 3WX4A 4YUDA 2I6WA 1YJUA 2V68A 3NBPB 2OKQA 2ZEJA 3C14A 1OY8A 1PSDA 5DDOC 4FNIA 3MF5A 3EVMA 4IRCA 4R8UB 1WC4A 1Y9OA 3IXQA 1WF1A 1GXTA 4B9LA 1EETB 1R8BA 3BJYA 1VRTB 4OMFG 1TK5A 4ZHRB 2OIHA 4CLSA 3MM8B 3N79A 1IJEB 4K0KF 1CG2A 2L9NA 3DXBA 5KG6A 3KLEA 2BKNA 2R3VA 2XTJP 1Q4RA 2X1BA 3KLHA 1HA1A 2QL9B 2IM1A 2NXEA 3IGNA 2HRUA 4JI4J 1SV5A 1WHVA 2P6SA 3M6XA 4C8LA 1HI1A 2HAIA 3NBPA 1HYSB 1LOUA 2F9JA 3SSSA 2HYIB 2R4FA 4R8UA 3EX7B 3FGVA 4Q2MA 3BKUA 2VB6A 3HFZB 3TJAA 1EETA 1LEOA 2V9WA 2KM8C 3BV8A 1YJRA 2KZMA 2R8GA 2JDJA 3CULA 2ZH3A 2XS2A 3E51A 2HBRB 1RACB 3F73A 2I5JA 3MAQA 3SFUA 4QIVA 4OFZA 4LIRA 3GZ7A 4FP9A 2C3YA 4O3NA 2FYXA 1SC1B 4LF4J 3MZIA 3JSRA 4FPRA 2AZ3A 2XCPA 5H9FK 1MN9A 1WEXA 3R1HA 3IM8A 2FHMA 1S57A 4ZJLA 1ZAVA 2F65A 1S0VA 1HYSA 1S76D 3MOZA 2EFQA 4FXDA 2P5VA 3HULA 2BXJA 1RYSA 3LO3A 3GMGA 5E3PA 2VU5A 1OWXA 4KFBB 4OL8A 2NPFA 2R2TA 1FO1A 3TUJC 2OHDA 3P5BP 1LXNA 2FTRA 1FNXH 2R9LA 4LR8A 3BDPA 4DR2F 4K7QA 2IDEA 2GZOA 3BREA 2QT7A 2G0IA 4XO0A 2V8VA 2QMUB 4YR2A 3Q2TC 3M8RA 5E7OB 1F5AA 1BUXA 4C4WA 3MPYA 2ZC4A 2EWHA 4R5PB 4Y2MA 3CO9A 2C2OB 4DV2J 1HNVB 2ACYA 1C1BA 4A8YA 3ENQA 5KG0A 4USWA 1C1CB 2EFVA 2DHHA 3GJTB 1QTNB 1LV5A 4KFBA 2QTWA 2XLKA 4OZ2A 2F1FA 1U6FA 2IJNA 1Q8LA 4USKA 1FRXA 3DYAB 4JV2A 1N32J 3W9IA 3RBZA 5FIIA 2Y0SD 4OHZA 2KXFA 2NR0A 1FE4A 2VFVA 1T3OA 4L74A 3EVWA 1Y3KA 5F41A 3L7OA 2QLWA 3CVKA 4LVNP 4CH1A 4I64A 2WB1D 4KIAA 4B3MF 4RZRA 1FRLA 1NK6A 4MFBA 2G2YA 3GU0A 4R5PA 4WE1B 4F2SA 1HNVA 5KT3A 4DV7F 2XNQA 4B9TA 1C1CA 2JJ4D 2Y0BB 1Q16B 2LECA 3ZTRA 2HPUA 1XN9A 2KKHA 3CMQA 2F4VF 3VAFA 2W9CB 3DYAA 2OAUA 3AB4B 3D66A 2XM3A 3BQ1A 1B0VA 1Q5YA 1VQ5S 2EBGA 3PXGa 2CNLB 2C42A 4JI6F 1UPPA 1EAYC 1HQEB 1TFYA 1FTRA 1TUGB 1RHMB 1H6KX 2LA4A 3PVXA 2QIFA 1IKWA 3FJ2A 2IAJB 1RAAB 1F9HA 4X66J 3QAEA 3PYEA 4FKYA 1CC8A 2RKIA 2OPPA 4DL3A 2IJRA 4XK8C 1JKHB 3HZEA 3QGGA 3AXKA 3D3BJ 2CKWA 3RB3A 1SL0A 2QJ3A 1VQKS 2W9CA 5D0RA 1HQUB 4B08A 4DCOB 2Z30B 3R9LA 5LJ3Y 3R27A 1ZS6A 5AE3A 4TN2A 2PSZA 2P6TA 1R27B 3OBIA 3GJRB 2FVQA 3H40A 3M8ZA 1U1QA 4K4TA 1M1KT 2XNRA 1JLAB 1HQEA 1N54B 2E5LJ 3F0NA 3DLKB 1NSPA 4C11B 2CQHA 1HMVB 1VQSA 4FVMA 4H4OB 4NYPA 5DDPC 3CIZA 2IAJA 3OSNA 4DR4F 3BR8A 3W2VB 1ZZFA 2RQCA 1JKHA 2F8HA 2CPZA 5J1EB 1G6BA 4HR2A 1EZZB 2YQ0A 5CXTA 3H2VE 4LF9J 1Y10A 3LWMA 1R3NA 5JVGQ 4FYWB 1RWMB 1HQUA 1U0HB 4Z37A 2V2VA 4N56A 3MEGB 3PKYA 3KK1B 1K44A 1FDBA 2VKRA 4B3TJ 1IBKF 2Q79A 4X4OA 4ER8A 1JLAA 3SIPB 1N52B 3DLKA 2JH3A 5KFOA 4C11A 2ASJA 1RTJB 1A7GE 1YJNS 1YK9A 2P9GA 2MZQA 1GMWD 1HMVA 3FSIA 3VALA 3T41A 3MWBA 4AFFA 2FC9A 1Y4ZB 2AJQA 2OEJA 4FF2A 2HNYB 2QX0A 3W2VA 4EZ9A 2ZH1A 4ZPTR 2MGZB 4L6V3 5M2PA 5J1EA 1HNZF 3SSRA 5GAHI 3T5LA 2ZBIA 2W7AA 3Q83A 5ETMA 1S1WB 3C3LA 1IBLF 4CLLA 3DRRB 1U0HA 1RAHB 4EO8A 3MEGA 4FZVA 3CCMS 1N5YB 4PG5A 4Y65A 2C3UA 2AYEA 1P27B 3DNCA 2MKSA 4MYTA 4HYKA 1WEZA 2XULA 1LWCB 4OHXA 4LREA 2K3IA 1SQGA 3KHGA 1RTJA 2V69A 1LFPA 2YQ1A 4H4KA 1TKXB 2BM1A 3UI3A 3AOCA 3ZZYA 1B4SA 4Y2CA 1YHQS 3H2UB 3FVYA 4L73A 2YKPA 2CJKA 1JXVA 1U6BA 3ET6B 2FJEB 1YLXA 2MGZA 2HHXA 3AD9C 3G6YA 1AFIA 1YGYA 1ZA1B 4DN0A 4QPTA 1S1WA 1XMOF 1NK0A 3PYGA 3EMTA 3ZTPA 4QWDA 3DRRA 3OVAA 2KFNA 4LF2A 3HVTA 1U1OA 5HVHA 3CCVS 3TANA 2BJ8A 4NLGA 4WFXA 4Q43A 1N36J 3LUYA 2FUG9 4HTIA 2KVIA 4K4YA 3PCOB 3NNAA 1YBTA 5F9LA 1LWCA 1H72C 2H5EA 3TARA 4O3OA 4YB1P 2O66A 4G1PA 4ZPVR 1S9FA 2E9TA 4P72A 3SCLE 3K57A 4B9NA 4M8LA 1IXKA 2W8KA 1NK7A 1SL1A 3ET6A 2A0FB 3LPEA 4L72B 5KFRA 2J8SA 3OXLA 2YNIB 2WVDA 4F8RA 3CTRA 5HL7Q 2JFDA 2ZBRA 3M8SA 2GAHC 2H65B 3M32B 4DR1F 5CQGA 2K7JA 1U4BA 1M5OC 1G1XA 2LLZA 4M5GA 5A0YB 2DB1A 1X4EA 2V4RA 4DV5J 1T0TV 5K14B 5JUMA 2CPYA 4G1IA 3EICA 3BGRB 3H5SA 1N8RT 3B54A 3CDAA 4F36A 3HCXA 1HD0A 4DR5J 3P6YC 2G1DA 4I6YA 1V5VA 2VJVA 1R6YA 1WI8A 2F8MA 3G86A 5J1NA 3UDLA 2NCKL 1FKPB 2WB4A 2WAQD 1HKAA 2UVUA 2DNKA 2DVIA 1KQSR 2VQFF 4N41A 4KH1B 4LFCJ 2YNIA 1HI0P 5BJRA 2M8DB 3M32A 1RBLA 3LAMA 3M30B 1KQFB 4M5HA 3V6JA 2QC3A 2BR0A 3QIDA 2FQQB 3ZZ0A 1YG0A 3QPIA 3NP5A 4DV6F 1RWWB 3JTPA 3CJ8A 2HWIA 4KGMA 2MKHA 1RKJA 1D9DA 3BGRA 1FDDA 1S9EA 4H4MB 3EM1A 3K5MA 4DG1B 2CWXA 1LW2B 1N5VA 3T1HJ 2KU7A 2LU1A 2BOPA 1FKPA 4D3GA 4YR0A 3N0VA 2RHQB 2WVBA 3QLHB 2QMXA 4F50A 3D3CJ 2HK3A 2E5HA 4O23A 4YDXA 4ECRA 1RWPB 2C2EA 1N56A 3T5JA 4JI8J 3X3UA 3HKZD 1DJ0A 2ZUGA 3M30A 1DY3A 5B0EA 5K8OA 3NWGA 3QGPA 1BMQB 4OYPA 2HHVA 2Z57B 3HDSA 3DN9A 2D3UA 5I4MA 5H9FJ 2LCWA 4NX9A 4W4MA 2CJBA 3CE8A 1U47A 2UZAA 4H4MA 4PR6A 1G4CA 1RDRA 4B3SJ 4DG1A 4JV5F 1LW2A 1EKSA 4OI6A 3WIVA 1YDLA 1Q95G 1BC6A 3I4PA 2CPJA 3CC4S 4O4GA 1VJQA 3G6ES 2DIVA 3B4MA 3P96A 4ZVOB 3MR5A 4DUTA 3QWPA 1R6VA 1IUJA 4QIFA 1HWIA 1H2VZ 2OD4A 4PPZA 4CT8A 1U45A 1DURA 2MKKA 2VICA 5D0EA 1QVGR 4RU9A 4DF4A 3SFGA 5LMNF 4YQWA 3GV5B 3G6XA 4J37A 5A6WA 4JYAJ 4AXJA 3PACA 4JV0A 4GVBB 3MDFA 2ROEA 3KLGB 3CDUA 3HPOA 5F3TA 4ZCKA 2M52A 4DBQA 2VUGA 1S4FA 2X3DA 2CPFA 1X5TA 3VAHA 3Q8SB 3BSAA 3RAQA 2EC2A 3CCRS 2DHSA 3LTOA 1FTCA 2JZ5A 3OXGA 3BO3A 1FJCA 2DH7A 5MAOA 4ECXA 1RT1B 4K4XA 5MLCV 2DO0A 4MK7A 3VZIA 5ETOA 1WC1A 1ULRA 4DR7J 4EZ6A 1M5SA 2VASA 4DZ6A 4XPEA 4LQ9A 2HVIA 2GNKA 2BQ3A 3WQPA 3EE3A 4WP9A 2B8PA 3ILLA 3D0HE 1TL7B 4GVBA 2H3EB 4ZPDA 2FJDB 4O0NA 3KLGA 2XWYA 3W7BA 2CPHA 5LOQA 3NMRA 2Y1IA 4DV0J 1RGVA 5D0HA 3PV8A 2ROPA 3RAMA 1CJVB 3IO1A 4EYHB 3KDNA 4WWSA 1CS4B 3CJ4A 3TUZC 3EXYA 4LRBA 3OHBA 4QYRA 1NJXA 3DLJA 2JNJA 4YY3J 1RT1A 2Z2ZA 3LPYA 1RADB 3BQ0A 2MEWA 2D9OA 1UJ6A 3CC7S 2MB0B 2YH1A 1TKTB 4E98A 3DXSX 3GB0A 4LT6A 4J7CA 2COLA 5AJ3F 2AJ4A 1TUWA 2QL7B 4HL9A 4ZK7M 2GIQA 4OZNA 5ETPA 1TL7A 1JLGA 1SC3B 3S1TA 2NUUG 1TL5A 4NXNF 5F8IA 2AEFA 1S12A 1FK9B 1X5PA 4Y6IA 3ZZZA 1TP7A 5CHCB 1XR7A 1URNA 4OQJA 5KFYA 1CPZA 3CIMA 3DU6A 4C7QA 4LRFA 1D09B 2VBXA 1RT6B 2IVFB 4XDCA 4AL7A 3HHLD 5E3AA 2M0GB 1N34F 2UXBJ 1F2HA 1XWLA 3HHLB 4C0OC 4HH1A 3TQ1A 2CVEA 3IR6B 2ZH6A 1TKTA 5BR8J 1BWEA 4I56A 1LK7A 3S01A 2D7SA 2HVZA 3Q23A 1EB0A 4DX8H 3I55S 4ZLNA 2DH9A 3UD4P 2UVVA 1JLEB 3MOJB 3IN5A 4CM0A 4NI2B 5EDWA 5HROB 2ZJPQ 5HO4A 1RWXB 3K5LA 4P7VA 2V6AA 4X4TA 2V8DA 3T3FA 1ZM9A 1FK9A 2OPSB 2R7SA 2FVCA 3SV3A 1XEZA 3CDWA 1UVNA 3BQ2A 4ANDA 1T9WA 4PRFA 3W5ZA 4LFAF 5GVQA 2QN6B 4F4YA 1SH0A 1Y0HA 2YXLA 2RIJA 1RT6A 5G0RA 3QJJA 2UV8A 4QW8A 1XNQF 3HHDA 2NXJA 2MQMA 4I4BA 1AA1B 3RTVA 1MNEA 3HHLA 3PR5B 2WONB 2ATLA 2GGPB 1NKCA 4OHYA 4NLDA 1ZPWX 4KYZA 4ZVFA 3SSQA 1FJGF 2BX6A 4F3MA 3MUMP 2BVZA 4UY85 3EJMA 2IPOB 2YWGA 1ZZNA 5IT4A 4FBTA 1XC9A 5EUHA 4NI2A 4KQZA 5HROA 2K7KA 5LMUF 4EGLA 1PCAA 1OMSA 1W26A 1GH8A 1TQLA 3IP0A 4MKVA 4USTA 4EBCA 3NS7B 4QZVB 3GIMA 4LQ3A 2OPSA 3PFOA 1IJFB 4OJGA 2QG9B 2RRBA 1S1TB 5KOWA 1K1SA 4MIAA 3AH6A 3K89A 1VQ4S 1Z2ZA 2VPWB 1S1XB 4Q0BA 3EZ5A 3NGUA 3NCPA 2HWTA 1RT5B 2AKWB 3HSGA 2FIUA 4ELTA 1M1HA 3LWLA 1Y11A 2PDAA 4PQUB 3MD1A 2YKNB 1IKXA 3KG0A 4NZ6A 1WG5A 2CPXA 1Q79A 4QIWD 3A3PB 1GT8A 2ZNZA 2DITA 2GGPA 4WFBQ 1PG5B 2AYGA 5J2NB 4TY8B 4IDKB 3GG1A 3TVZA 2KFYA 3S7RA 1UA0A 2QYGA 4JI1F 1F1BB 1JXEA 2Z2YB 3RRKA 2R7WA 4BHQA 1QAJA 2XMUA 4MKBA 1VQ7S 2OJ3A 3OVSA 1S48A 3PM9A 2XMTA 3VR1A 1SB6A 1S99A 2PN6A 4DL5A 1S1TA 4PWDA 2O5DA 1JJ4A 3RBEA 1S1XA 5LSLA 3O2IA 2HVEA 5DGBA 1RT5A 5LSRA 4AL5A 2J0QD 1A9NB 5L46A 4PQUA 2YKNA 4K4SA 1RB0A 2KN4A 2HFSA 2B6AB 2CQBA 4KHPJ 2B8QA 1NJZA 1J5EF 3KLVA 1SUQA 4JOUA 4OZJA 1FX2A 3JXOA 1DLOA 2J0WA 4F67A 3IMQJ 5J2NA 4TY8A 4IDKA 2UXDF 1O8BA 1WORA 2KO1A 1DRZA 4RW4A 3BEGB 1NHUA 2AYBA 1NJYA 4Q45A 5M2RA 4USIA 2HQGA 2QA4G 2G1HA 5F8JA 5GADI 5FD1A 3IRXA 1WNEA 4L75A 5AXMA 1JLFB 4BWJA 3OL9A 4C8ZA 2MHEA 4CTAB 2IM0A 3TO8A 3T6JA 4OYXA 3MHYA 2ASLA 2B6AA 5CZVA 3ZZOA 1UCNA 2EC0A 3FK4A 2D3O1 5C5JA 1TFWA 2YNFB 1I6JA 3KK2A 5KFWA 4NLXA 2MKJA 2WHOA 3FDSA 2GX8A 1ACMB 3CSKA 2ASYA 4DCJB 2ASDA 4RJVA 1RWUA 1B64A 1WC3A 2ZFHA 2LMIA 2BV3A 2H4YB 3JB9k 1HWKA 2N7YA 2ZC3A 2W01A 4RWWA 4HHHA 3VVUA 2AX0A 2NREA 4X4SA 1KVIA 2BBEA 1NKBA 1CLFA 3FCHA 4O4RA 2Z2MA 2OMLA 3RR8A 5I42B 3HP6A 3UR0A 4IO1A 4CTAA 4ZITA 1LXJA 4ZVEA 3MR2A 2UU9J 1TU0B 3OLAA 3HT0A 2BOAA 4WIQA 1RK8A 4OZ1A 1VFJA 3UE2A 4MIBA 2VA3A 2POKA 1Q53A 4DSIA 2YNFA 2QRRA 3OW2R 3NLCA 1GXUA 3B4DA 3D28A 3J80U 3POTB 4HDGA 4O3PA 2R7UA 1LW0B 3W5XA 3J7AN 2IJFA 2M4MA 3D1HA 2GQ2A 1MG7A 5A2QU 3QSYB 4P9SA 4GVLA 4NA3A 2FY1A 1ZETA 2GHWA 3CCES 5HI7A 1G7CB 2DGXA 2ZDPA 1D9FA 2BJ1A 2CDQA 1QAXA 4OI4A 3FMWA 1MMNA 3NCRA 3V6DA 4C9DA 3ZFVA 3R1LA 2QLFB 1U49A 1DQ9A 5I42A 3AJDA 3L09A 3MCMA 3HZGA 4GKKJ 2MLXA 2MQQA 1RXOB 3NAIA 2CJYB 4KTQA 1CEZA 1VCTA 1KP6A 3DM2B 3HHNB 5HP1B 2A6OA 3QRRA 2ZWOA 4PWWA 2W7PA 1TL3B 3DLEA 4OYBA 2GW8A 4DX7A 2J9EA 3K59A 3POTA 1WKLA 4RW6B 3RBXA 3FBFA 2NYHA 1LW0A 4ES1A 3FQLA 1IR0A 2UP1A 3BR9A 1HBNB 2H1YA 4X84A 1M5VC 2IM3A 1RHKB 3PW7A 3S8SA 3NOCA 4OYAA 2HMIB 2ZD1B 3J7Z5 2PI4A 2MYFA 1W2IA 3HD1A 1P9YA 3RZAA 4LF6J 3DM2A 3T9NA 5HANA 3FNNA 3UD3P 1REVA 4DFPA 3M6VA 1HQ2A 5JJBA 2JSXA 1PAEX 1KLMB 3J81U 4MK9A 1FRKA 3PFEA 1N32F 4X4NA 2VG7B 2XQCA 4U7CA 5DZ7A 2E1PA 5B08A 1HNWJ 3QYYA 4O44B 2A6MA 5LXRA 1HBNA 3J80Y 2VFUA 2DY9A 2VF3A 3N9UC 1PGZA 4Y0FA 3O1LA 3RR7A 3DHWC 3CUNA 3I96A 3FEZA 4DV3F 3SCKE 4X4RA 3CC2S 1RSCA 1FKAF 2IBKA 2HMIA 3Q8UA 4LSNB 4I7FA 1PJ7A 4USUA 3EGNA 4DZDA 2CVIA 1RJJA 5E2QA 4DSLA 4ZP6A 4HT7A 1ZOTA 1S59A 2L08A 1X0FA 2VOPA 4YR3A 4M5LA 4IFVA 2RS8A 1KLMA 1NJIT 1PYOB 1SH3A 4DPYA 1DAXA 2XS7A 4DDFA 4JI0F 2VG7A 3ULHA 4IUFA 3OTDA 3MTKA 3PIPQ 2R8JA 5IT9Y 3Q8VA 2FGOA 3VGTA 3MCSA 2FPHX 2FLLA 3PO5A 3V6KA 2MZSA 4M94A 4USVA 3UW1A 1CJKB 5RUBA 3ZZTA 1UVKA 3LGHA 2CG8A 4M95A 4LSNA 1B70B 4DR3F 3R5DA 2U1AA 5IM0B 1RU1A 4NOHA 5GAEI 1D9AA 2ZH2A 1N48A 1RWOB 1NO8A 3N6NA 2N3OA 3FCVA 1M1GA 1IKVB 2RUGA 2LQ8A 2Q66A 3CCQS 5CA5A 5EWGA 2OH2A 4OI1A 4WPAA 2IIHA 4BLGA 3DGPB 2KT5A 4ICLB 4EYIB 3ZZRA 2NSCA 4PXCA 3IM9A 3TYTA 4F4ZA 1UFKA 2PE8A 3J81Y 2R7VA 1IR1A 3K5PA 1NK5A 1U1NA 2Z2LA 1C4AA 1UMJA 2E5LF 2MQLA 1YJ9S 3DHXA 3R7SB 3KLFA 1CJKA 2H54B 3PX4A 2XB2D 5DO2A 3OSPA 2APOA 5IM0A 3DU5A 4Y3CA 4ZVUB 4DV1J 4J9QA 2RU9A 5DDRC 5F9NA 4CO1A 4ED3A 4PYDA 2GQQA 2XSFA 4ZVSB 1YRXA 4M5DA 4P2SA 2KH9A 4PG6A 3I9V9 4P74A 2DO4A 3A8EA 3MMJA 4ICLA 4Y2AA 4DX5A 1NK9A 3H4DA 4BBYA 4H54A 2O67A 1R7IA 1WHXA 3SQGB 4AQYJ 3Q8YA 2YWEA 2CNOB 1MWZA 2J9CA 4HVZA 3ADAC 4ANEA 3OT9A 2UUCJ 2H51B 2FLOA 3OTOJ 3SYZA 2HQ3A 3D5MA 2YY3A 1M0SA 3CNQP 4MMOA 1FDNA 1XBWA 4ED5A 2DNPA 4ED8A 3MXHP 4OYMA 1T94A 2V4JB 4CLUA 2W2MP 5EX3A 2HURA 2RRNA 3PG9A 2CAJA 3M8QB 1BQMA 2MDAA 3DLLQ 3TA0A 1DZ5A 5CH7B 2J76E 2V9KA 1IKYB 4PXDA 1FEEA 3RGIA 3EXCX 4KBIA 1RTDB 5K8PA 4RW8B 2K1RB 3AD8C 4RBUA 2QEXS 3MCNA 3SQGA 2XGQA 3V81A 3D7SB 4WTOB 1VISA 3ISND 1X4CA 3BSOA 4ES2A 4LF5J 1QSSA 4F3OA 4BC9A 1XR5A 2KRRA 5DM7Q 3DLHA 4F25A 5HQMA 5E3CA 1KR4A 2WSFC 3JSYA 1K8AT 4MKYA 3NG8A 2RMLA 4KGKA 4DPXA 3OR1A 4JP8A 1YIJS 4ES3A 1RHRB 2YX7A 2V4JA 4U95A 4I67A 2EG2A 3G87A 1Q8BA 3M8QA 1OSCA 3T5HA 2OSRA 1F5BA 2WTFA 3BGUA 2AJFE 3THPA 3Q0AA 3GV7B 4ILMA 2V63A 4RNHA 4U7UK 5L1IA 2EXUA 1T11A 3R5AA 1VLYA 2K1RA 3D6HB 4ITSA 2V2QA 3PEHA 2Y1RI 4ID8A 3L7UA 4N7TA 5KG5A 2BACA 3Q24A 1KFDA 2C2KB 3CD0A 4OHVA 1NSKL 3QGHA 1QTMA 1M5HA 3P5TL 3PW5A 5D4NA 4U8YA 2GV1A 2DRBA 3RW6A 3AJ1A 3U1LA 5E3QA 5HMYA 3G71S 5KFEA 2EKYA 2HEKA 1SC6A 1DFDA 2LEAA 2CADA 1RWNB 4M5JA 4A8KA 4F0MA 1FVSA 2XMKA 3MR6A 4DOZA 4NLOA 1PILA 3JAMY 2DY1A 5A6PA 4WF9Q 3MUTP 2MJNA 4PG8A 2M3DA 2JVRA 3UN5A 3OFGA 2JEIA 2V8GA 4DI6A 4MKAA 3MPDA 4ERDA 2ZKUA 2EFPA 2VDHA 4NZ0A 2XHCA 1EKRA 3IA0A 3F56A 3CT9A 3K0JA 4DV4J 4NA2A 1V3ZA 1VK8A 4NLSA 4ZVQB 2KJWA 2JRSA 1RA6A 3KLIA 1BLUA 3W5YA 3NGDA 3W64A 3FEYB 3OHAA 2Y8YA 3R3TA 2R42A 1BQXA 4JI3J 4YB6A 3LP0B 4V19X 1TVRA 1T9TA 3DKDA 3FRYA 3DOMA 2AJ1A 3GR1A 1FDAA 1HBMA 2PEBA 3CW2C 2MQNA 4CLWA 1FRMA 3M1VA 3RAXA 3T1YJ 2C28A 5E5NA 1XJWB 2HLTA 1TMMA 1SL2A 1VQYA 1N33F 2B9EA 2FJBB 2QL5B 3D0GE 3KHHA 3BGFA 5GMEA 1TKZB 3RB6A 1RI7A 4ZIVA 3KXDA 4Y00A 3IBCB 1RT7B 3TZZA 3IRWP 2VJUA 1GMVA 3LP0A 2MSSA 1Q0NA 1U7LA 1HPZB 2VQEF 1KNZA 5FLXU 4K4ZA 4KPYA 2W25A 4Q8FA 4J9VA 1FRJA 4ZN3A 3CCWA 4G1QB 3BKFA 3Q8QB 1SBRA 3PW0A 4LBHA 4K0KJ 1ZM2A 4DLEA 3ZO7A 5KFBA 2WZ1A 2MQPA 2R8IA 2AJ0A 2H4WB 4EBDA 3TNVA 1HWJA 7AT1B 5FJ4A 4NMLA 5ETNA 2FJXA 2KB2A 3CF5Q 4NYZA 4URQU 4X64F 3GR0A 2CJXB 3JQKA 2AWZA 1YVFA 3CCZA 1TKZA 1LWFB 2W24A 1R8AA 5KFMA 2WVEA 1H0HB 1RT7A 3CWJA 3OPKA 2BJEA 5KOXA 3MCOA 2KJVA 4TU7A 1OYEA 4UOFA 3F44A 4OV6A 1FWKA 3CCSS 1R0AA 3OFEA 3K17A 1YQHA 2K06A 1NNDA 4YHHJ 1TAUA 1GK8A 2UVWA 5D78A 2E9RX 2PA3A 4U6PA 2GJIA 4IO9Q 2I0XA 2W2QP 1BE4A 1SKSA 2RSQA 3GCXP 4I69A 4Z2XA 3TZYA 1LWFA 3RW7A 4C0BA 4GO5X 4UQTA 4RU2A 2NUHA 5L8RC 4LF7F 2ALZA 1U6ZA 4P6QA 2ATCB 3MM6B 2KHCA 1UWAA 2R7QA 2C3MA 5JVHQ 3I31A 3AQOA 4DR2J 5HLFB 2DBBA 3UWTA 3EDRB 1EJ7L 5EGYA 1L5UA 4NASA 1WDTA 5L39A 4YB7A 1MROB 5L9NA 4OLPA 2JHEA 2EK1A 2IA6A 2Q43A 4YB5A 1NB2A 1KD1T 1VBXA 1OQ6A 1VGYA 2Z8QA 3NEKA 1GMUA 3I32A 2VA2A 4ELVA 1V9OA 1VBYA 2R2RA 1LNQA 4ILLA 2C2NA 3DDKA 1PJ5A 1NRKA 2XMJA 4DQQA 1X31C 2LU2A 3D6TB 5KFJA 3FEXB 2IYIA 3UNYA 5KG4A 4FXVA 2Z58B 3MM6A 2HHHF 2W9BB 2I8EA 5HLFA 1X8DA 2B0GA 4ZP9A 3H0PA 1HNIB 5CYQB 5KAKA 1MROA 1MLAA 1RLCL 2ZVIA 4NLYA 1WSRA 3N5FA 1NBEB 5F0UA 1Y7PA 1FXDA 4B3MJ 1A0OB 3FC9A 4F3QA 2DGUA 1ZAXA 3ILJA 3DDIA 2HLUA 4RPFA 4P2MA 2EK6A 4DV7J 2G13A 2OGUA 4IYQA 4GKJF 4I0WA 1RCXB 4RW9A 1FVQA 1NK4A 2E1AA 2VFRA 4AL6A 3THTA 2ZOFA 4RBVA 4H4KC 1OPIA 2W9BA 3NGTA 5EX0A 4AE5A 1H7XA 3OFHA 4F4KA 1HNIA 2FHOB 1C0TB 2AD9A 1BXNA 4JI6J 3IR7B 3KLEB 2DD8S 3K5OA 4DU8A 2KDOA 1K47A 3AT1B 2HNDA 3R6LB 2YKQA 2CQ0A 1T02A 5IV4A 5GADU 5THWA 3SMZA 4ZVRB 2PA8D 3EGWB 1VQLS 2XLJA 1X4FA 3OTCA 2DNQA 4J9KA 2HQCA 2VC0A 3CDEA 4TVAB 3BZQA 1NPRA 4DEZA 3ZZPA 6FDRA 4ZCLA 3QWUA 4OYOA 2DNMA 3GWCA 3VHQA 2IVMA 3H4BA 1C0TA 2LXUA 1VQOS 2R2SA 4WKRA 2B4UA 2I5JB 4EI2A 4OZ5A 2YKAA 4QR0A 3ICLA 1UW4A 5KFLA 2SXLA 2OFGX 2N4DA 1OO0B 1B7FA 3MEEB 4DR4J 1FFGB 3KKFA 2FVSA 1QUPA 4ZPCA 2V8PA 2ZM6F 4QR2A 2B4PA 2KT3A 5F8GA 1N5TA 1XTZA 1JMTA 3MMBA 4YEAA 3QIPA 3HX9A 2G2OA 4CYUB 3RBDA 3A8IA 3T1AA 1HNXF 3O5TB 1FERA 1RYRA 2O3DA 4GC6A 2GAGC 3MAAA 2XMAA 1YSJA 4DPTA 1IBKJ 2CZVC 4X4PA 2BJDA 1S7IA 4DHVA 5D3GB 1NLKL 2F63A 3ENVA 1HLWA 1TL4A 3D2WA 3MFHA 4LFBF 1IQZA 2E1MC 3HSJA 3H98A 3R7BB 1B7YB 2ZH7A 3MM5B 1JJCB 2DNGA 2OEMA 4DUYF 5D8HB 3W8GA 1KLNA 5CZXA 3MEEA 2B56A 5DM6Q 3NCQA 2RH3A 1OS5A 4Y28C 1HNZJ 2CNNB 3FCWA 4K59A 3TUPA 1C1BB 2DGSA 4NRUA 4J9LA 4PCQA 2IMOA 3W9JA 3PYDA 2C2ZB 4RBTA 4CYUA 5DGAA 2GVZB 1S0OA 5ETRA 2DTJA 1BWVA 2K8GA 4NWBA 1IBLJ 1VBKA 3Q8PB 3UN2A 3FQKA 4J9MA 2YWWA 1JB0C 3N4WA 1IVZA 1ELOA 3VAGA 3OXFA 2H48B 1NB7A 1WSVA 1UVIA 1V6HA 1UFWA 5KG1A 3VAIA 2XBPA 5D3GA 2X1AA 3OL7A 2AU0A 3BO2A 3JTOA 4F0KA 1K73T 1YZ6A 3IWLA 3MM5A 2QFJA 3KHLA 2DHXA 4DL2A 5LJ5Y 2G0JA 2LQ9A 3D9BA 3PIOQ 4MFBB 3MR3A 5KFPA 4LBPA 4LRCA 3GFZA 1XMOJ 2Y9HA 3W9HA 4AYBD 4LR9A 2GVZA 2AF6A 4F0HA 2CJQA 4S0MA 3H90A 1QE1B 4KJIA 1JLCB 4EO6A 3MEDB 1IM4A 4PZVA 1IR2A 1Y00A 5LSOA 3KMQA 1C0UB 1WD6A 2GJ2A 3VCDA 1U0SA 4UZBA 1VQ6S 4WFNQ 5A8WA 3G8QA 3QNWB 2LVWA 2RQKA 3HLUA 2UUAF 5E0OA 3BBCA 1KOHA 3DRYA 2HGMA 1IKWB 3IAS9 1NMEB 2JC1A 4KV8B 1FD2A 1U1RA 2VG5B 5KFGA 5KFTA 4ZVTB 4OI2A 4BCAA 2RKIB 4E8UA 2XMVA 2OPPB 5IQQA 1RHUB 2C22A 4DR1J 3MPWA 2IRUA 2ZZNA 1PYTA 1S10A 1QE1A 3OD2A 5B0DA 1JLCA 1MMLA 3MEDA 1UTAA 1S1UB 4DMZA 2X7IA 5IS2A 4IR1A 2ZH9A 1C0UA 1QAYA 4NCGB 1JX4A 5DLGA 3VAKA 1U2FA 2EFNA 1RCOB 2GMHA 4M5IA 4ED4A 4E0DA 1NK8A 5KT6A 2HHUA 1FX4A 2DGWA 4JI5F 2XMMA 4NXMF 4C8KA 2NXNA 1OSDA 1ITPA 4OJ3A 4ZVPB 4QBUA 2VQFJ 5J2QB 4KV8A 1MWYA 5IWAF 2VG5A 3R97A 4LVOP 3JYTA 1RAOA 4LSZB 3WZ0A 2CQ1A 1XQIA 1WC6A 4PYAA 2YNGA 4IG3B 4OX7A 5A8KB 2F9DA 5GAEU 2VBZA 3BBBA 5DRKA 3LOUA 5CCMA 2A3JA 3FMBA 1I94F 1S1UA 4ELUA 1RTHB 2X3GA 3VGUA 4HI1A 2MZJA 2AT1B 2ROGA 3G82B 4NCGA 4XPCA 5DG9A 1FRHA 5IFMA 1FA0A 2QZ8A 4EWTA 2HQDA 3OLBA 3IC1A 4NYOA 3OL8A 1L3KA 1VI7A 4URSA 2ADCA 4TY9A 1A6LA 4P2XA 1JXLA 1JK9B 4N8NA 3I9ZA 4LBIA 1KC8T 5J2QA 2CQCA 2DISA 3QT7A 5BYRA 4MJKA 2AQ4A 3DOLA 3ZC4A 3IBFB 4IG3A 5A8KA 1WELA 3BN7A 4ZMMA 2J6SA 4K4WA 4WK1A 4B3OB 1RTHA 3UO0A 2V2ZA 2KTQA 3CD5A 1HR0F 3KG4A 3G82A 3U7JA 1ZH5A 3M9NB 4TQSA 4JV5J 3PYFA 3CJ0A 3DGVA 2HNZA 4AXIA 1W7WA 2ABYA 3QT8A 3GG0A 4OYZA 1FT8A 1Q8KA 5I3PA 2DGTA 2UXCF 1XERA 1HIYA 8AT1B 3TWZA 3PNIA 4WU3A 2AP6A 2ZHBA 1U24A 4DSKA 4TYBA 3FKBA 4OV1A 4RNMA 3M8PB 4FXWA 4KSEB 3HJVA 5HMWA 3W8PA 4NLRA 5LMNJ 4FBUA 5L9XA 3H25A 3NKYA 4B3OA 2GVDB 3C6UB 1KQGB 5KT5A 3IWXA 1NKEA 4K4UA 2DJWA 3GQCA 1KS2A 3HVTB 1W2BR 1FNMA 2XG8A 3HHLC 3KUEA 3KNGA 2PMHA 3HD2A 4O0IA 2NLWA 4HHUA 3K8WA 1JJHA 1SJ4P 4GMKA 1F3VA 4RL1A 3OJUA 1Q7YT 4ED1A 4LF8F 1URRA 2B9WA 2YPZA 1GMWA 2XSJB 4TNOA 2B3TB 2CZ4A 4RX6A 3RG6A 4IH5A 3FSYA 3D54A 4YP3A 3M8PA 2P9EA 1OPZA 1YZ7A 4UOCA 2EG1A 3UR3C 1QSLA 4A8QA 4ECZA 2CJAA 1TV6A 4IOBA 3AOAA 3TZXA 3H7HB 3DLGB 2GVDA 4C8YA 3C6UA 1IBMF 1F2GA 2F40A 2YTCA 4C6AA 1NDPA 3DRPB 1RT4B 2FVPA 2QLBB 2VDIA 5C42B 2FD2A 1TMJA 1C2PA 2W2PP 4C3KA 3VGSA 4RWXA 2MQOA 2NZ4A 4I2QB 3U27A 2BUNA 1R0BG 4HLBA 3J7YI 2AEMA 2W4PA 1I51B 4A8XA 2XSJA 5T41A 1HHQA 3N5BA 2ERRA 4DV1F 3MEKA 2NPIA 2HRYA 1YI2S 2R7XA 2HHSA 2CDRB 2DPIA 4AUKA 3LA0A 1T9VA 3I4HX 1F0XA 2A18A 5AJ3J 1S72S 3TOQA 3D68A 3DLGA 1EIYB 3EDQB 2PC6A 2J0SD 3DRPA 1RT4A 3TQEA 5C42A 3FZBA 3LF0A 3B8HA 4NXNJ 4NLVA 4U9RA 1NH7A 5B0AA 3HMJG 3PR4A 4I2QA 1S9EB 3VV2B 2NSBA 2LA6A 4E2FB 1QVFR 1KDNA 3VZHA 5CD4H 4ZCIA 1PO6A 3IS9B 1XNRF 3IBWA 3J81j 2LXIA 1SKRA 1UEKA 1N34J 1VQPS 1NZAA 3PY8A 3M2UB 1APSA 1ZA2B 5CCLA 2AIRB 2W9AA 3VVTA 1SJFA 4CDIA 1DQAA 2YNHB 4CNZA 3LGMA 4HDHA 4J90A 4WYLA 1FI4A 2DH8A 2B51A 2BE2B 3MECB 5J2MB 4KAIA 5IC6B 3W2WB 2KT2A 3OVBA 5KG7A 4QR1A 1S49A 2EFOA 3BGOP 5HVGA 1CSJA 4NEYA 1AUDA 2BE7D 4QCLA 1KWMA 2Z4PA 4USJC 4V19J 4LFAJ 1ZBTA 2DIUA 2B5JB 3IS9A 3OR2B 1SJRA 3AQPA 4O4GB 5IQ6A 1GQEA 1DTQB 2XI3A 1U25A 1XNQJ 5DG7A 1RE1B 4Z7YA 2YKOA 1GAOA 3M2UA 3E3XA 3TX0A 3QSIA 2EKNA 4A47A 1V3RA 3I5BA 3Q2SC 3PHEA 1M5KC 2XLIA 4C3MA 4OX9J 2XS5A 2YNHA 1FJGJ 2CYYA 4F7VA 1XMQJ 3HI9A 2GMJA 5LMUJ 4FKXA 1X9SA 2CA9A 4P10A 2BE2A 3MECA 5J2MA 2LQBA 4KGXB 3W2WA 4RUAA 4DJBA 1B0PA 5H1SV 4DPWA 2HHWA 2BQUA 1WWHA 4IOAQ 1NAQA 1RWVB 2B5JA 1YTYA 8ATCB 3OR2A 4CLTA 3VQTA 5K5MA 1DTQA 1H2UX 4ANCA 1OJ4A 1D1UA 1BQNA 1S6QA 4R0JA 2IDLA 1UWBB 3IWNC 1PIEA 3TI0A 5ETLA 4JI7J 3Q22A 1I1GA 1R0CB 1MU2B 4F4WA 3TVKA 4JI1J 4DQSA 1F6TA 5JXSA 1SC4B 2XGPA 2J6TA 3NGSA 4WZMA 4P2FA 4YOEA 2I2YA 1X0PA 2J9DA 3MM9B 3H5UA 3UCUP 4ZP7A 3IR5B 4HKQA 1GX6A 2E1CA 2IBOA 4ETZA 2M88A 1R43A 4P71A 1VIOA 1NHKL 3GYNA 2GHVC 4Q5VA 1J5EJ 1EHWA 4R25A 1CBKA 1U48A 1K9MT 5SZTA 2HFZA 1UWBA 2F5GA 9RUBA 1WC5A 1T05B 3GIRA 4U7UD 1JIHA 1RWKB 2JEFA 2VPXB 1WHYA 1MU2A 3MGJA 2UXDJ 2ZHOA 3LP2A 3DRSA 5CD4A 2CNKB 3ITHB 2BMBA 4NLWA 4C3LA 1JLGB 2NQPA 1SKUB 4CWBA 3H5YA 5GMKa 4K2JA 3MM9A 1VK3A 4FYXB 4LRAA 5L1LA 4X62F 1KFSA 3US5A 2PMZD 3GYGA 4I6AA 2B9XA 3KUHA 4K50A 1WKJA 2JLGA 3GSDA 1HFEL 4KR0B 1NU4A 3H20A 4NEZA 2RS2A 2MY8A 3WHIA 3TEHB 2YQ3A 1KBRA 2QYCA 2LQJA 4AT1B 3R2CJ 1SCJB 3GFHA 1VLOA 2OLWA 5KFSA 1T05A 1TTHB 2XZDB 2BQRA 4Q8EA 4KT0C 3ITHA 2JLEA 1V5IB 3GLJA 2G0CA 3FZ2A 1YITS 4OI0A 2WW8A 2DR6A 3JS9A 3QO9B 4URGA 1VR6A 4MAKA 1R8PA 1SIWB 4EBEA 4QU6A 2HKEA 1WACA 4ED0A 2WBRA 4OX6A 4USMA 3D1QA 2IRXA 1Q1KA 4N5SA 4ECSA 4PABA 3DFEA 4CO2A 3K5NA 1RBOB 3H59A 1VQMS 5A8RB 2BE9B 4I2PB 2KXNB 1VRTA 2XMWA 2FHKA 5BXIA 5G0RB 3CJ5A 1LWXA 3R2DJ 3V4MA 4X65F 1QUVA 4ZHRA 4J9PA 1NEEA 3MM8A 1CULB 2ZNYA 1EQMA 3U1NA 1HL6A 2DR9A 4YHHF 1PJ6A 3RYLA 3JQJA 4B02A 4CO0A 2N3LA 2IY5B 5HQLA 4RW7B 2FHJD 1X60A 3QO9A 1HW9A 4ECYA 2WW4A 4FF3A 1REGX 1RU2A 4A8SA 2I38A 4Q0BB 2E7XA 3MMCB 3NAHA 5A8RA 3P8BB 5C24B 4I2PA 1N5SA 1UP1A 3WBZA 5K8MA 2E5GA 1IKXB 4FF4A 4DFKA 3I56S 1CULA 4X4UA 4C2MA 3E8OA 4ZLJA 4NLUA 3ZZUA 2HFOA 3CD7A 5E3RA 4ALZA 2DNRA 5I3UB 1QSYA 4FYYB 5ETVA 1GTHA 2VODA 2BRLA 2J6UA 4X4VA 2R7TA 3NS5A 1FJ7A 4CLKA 4RW7A 1VHIA 1HHSA 2UVRA 3VTIA 5J1PA 2B7BB 2FHJA 2HSEB 3NY0A 2QLXA 3WIUA 3LH2S 3QFWA 2CG4A 5KFVA 2ZKTA 3CJQA 4DL4A 4PWDB 3D67A 2KRBA 4C8MA 5C7PA 4ID5B 3MMCA 1H2TZ 1T7PA 4WZQA 5C24A 2WOMB 2ZOMA 3PJXA 2A10A 4ED6A 2PD1A 3CCLS 4K8RA 4DFMA 1SUQB 2YPYA 2LP4A 3FSXA 2MPUA 1UJ5A 1DLOB 5I3UA 2AZ1A 4OZ0A 2A2DA 3C6TB 2L48A 3AA9A 1N0VC 4C8OA 2J7WA 4RW4B 1J2VA 1DARA 1VHFA 3UCZP 4DV3J 3BPDA 4TKTA 3C8YA 2RQMA 1NJWA 2E29A 3IRXB 3T9ZA 2ZH8A 2QO3A 5HSPA 3BS9A 3TW0A 2ZVSA 4ID5A 2HFUA 2M7SA 4M5KA 2X1GA 2WOMA 3BB5A 4QOTA 4RR5A 4YMEA 3HKWA 2AEJA 2JFKA 3X1LB 1I3OB 5F8MA 2DYAA 4TU9A 2YX4A 2HQIA 2HS4A 4JI0J 4UUWA 1IQTA 3A1YG 3KK2B 2UUBF 4P75A 4DS4A 4G3IA 3C6TA 3U1MA 2AX1A 1O0PA 1FJEB 1UETA 5CABA 4F04B 1ZYQA 4B3RF 3UVJB 2LEPA 3IAM9 1T9UA 1M5PC 2M5YA 4QU7A 4WE1A 4DR3J 4I6WA 4QWCA 2WRMA 4DUZJ 1YJTA 2DCLA 2DXFA 4YFUA 2ZH5A 2YVSA 3W1YC 4OI3A 3QRPA 4IH6A 1X4GA 3F41A 5GAGI 3FBCA 4TLRA 2W8LA 1AW0A 3ISNC 2W2NP 2ZITA 4MH8A 2Q3PA 3NS6A 1QJHA 2I9SA 5D15A 2E66A 1TKDA 4WFAQ 8RUCA 4RUBA 3M8WA 3FRZA 4CLPA 3P3DA 2K2PA 2AGQA 1D3WA 1S7HA 1AZSB 2XI2A 1UVMA 2YBVA 2VKZG 5AE2A 4YN3B 3UVJA 4G6VB 1BD6A 4BDPA 4ECUA 3AY0A 4L76A 3GP9A 3W66A 2FZCB 1WC0A 1WEYA 4JI4F 5HBMB 1Q81T 3V6DB 3EVOA 4EU0A 5HAOA 1TK0A 2C2DA 3E01B 2PFFB 3A3NB 2DNOA 2HZCA 1PYSB 1UL3A 1DHMA 1OYDA 3M6UA 5C2GA 3I6PA 5C25B 2JL9A 4B17A 2QA4S 4DX6A 3DLEB 1HBUB 3BPSP 2FZKB 1VYAA 3G96A 5AT1B 4QJVA 1FNOA 2CQIA 2KHDA 1UFLA 1AZSA 4UOHA 1PC4A 2E1RA 2R7OA 4MIWA 4MT1A 5KFFA 1KEKA 2OPQB 2OP5A 3QZ7A 3NNHA 5C2CA 1ZTTA 4LF4F 2H5JB 1SQFA 4H4OA 4PG7A 1Z2LA 1KVJA 4DQPA 5HBMA 3GFXA 2V34A 3KDOA 4ECVA 1KRPA 3HF5A 2R7RA 3BH7B 3C15B 3E01A 3N6MA 5DQHA 3CDBA 3I82A 4XTTA 4RNNA 1UW9A 1REVB 3KK1A 3BKTA 5C25A 4UZCA 5ETQA 5IT9U 3HHKA 1PAUB 1HBUA 1YBAA 3ETOA 3AJ2A 1IN0A 2LDYA 1UPMB 4ZKAA 3ILIA 4FVCA 1JJ2R 2HWHA 3PDNA 2OPQA 2PO4A 3CCTA 1LFWA 3G8TA 3ZNUA 3UCGA 4WXWA 4IKAA 3DOKB 3UNGC 1WF2A 1RHQB 1OIAA 5E33A 3P4UB 2PT0A 2QFIA 1Q8IA 2HNYA 2N4CA 4NL5A 2C1EB 5D4LA 4DF8A 2W4DA 4OZLA 2CQ4A 4K2XA 4QIGA 4I7FB 4DV2F 5F3ZA 3C15A 4ENOA 2CPIA 2E5JA 4CLYA 3VQSA 3O8WA 3L9ZA 1RTIB 2HS3A 4J9UE 5ETSA 2PMWA 2XWXA 3MI7X 1IM6A 2ZWPA 2MSTA 3FFIB 2EBEA 3KK3B 2ILYA 3C19A 2IYGA 1FCAA 1N5YA 2VBYA 4IFVB 1FKOB 3N6LA 4HTJA 2EI5A 1NUEA 4OLOA 5GMDA 3D6FB 1T9XA 1H3DA 3A8JA 4NCBA 2RRAA 3PW2A 3V5RA 5KFIA 1TKXA 4PAAA 2MMYA 3DOKA 3VWSA 1V3SA 1KHVA 3LGNA 4ATNA 4OYWA 6AT1B 2MLYA 3AD7C 2KM8B 1DQ8A 3SEOA 6FD1A 1ZM4A 3OJSA 2WBMA 2RNEA 4HEA9 4WXOA 1WOOA 1RTIA 2V67A 3KNAA 3QMQA 1J27A 1VS3A 1TL1B 1Q5VA 2PI5A 3FFIA 3KK3A 3AAWB 4DCPB 1H98A 3AODA 1S4EA 4D3HA 3PEJA 2DKOB 1FKOA 4UQGA 4DSJA 3I5CA 2V94A 1S79A 4JBCA 3LQVA 4B9SA 4QYZK 2QA2A 1CC7A 3ISZA 3CD6S 3GONA 1S97A 5IC4B 5EHHA 1TAQA 3KG1A 2VD3A 4M5MA 3K8VA 3N01A 2DT9A 3SXLA 1FFWB 2J9DE 2JWNA 4LMZA 3JSBA 1O5JA 4Y34A 2OD6A 1YJVA 1FESA 3KLFB 1D0EA 3K7RA 4DWIA 3SBMA 1EP4B 3CEDA 4X66F 2HRTA 3ZTQA 2IFXA 4WTYA 1ZTWA 4UTGA 1YKWA 4ZVHA 3ZTOA 4DFJA 1GFWB 4X4QA 1TL1A 5SUHA 2XO7A 3IFEA 4K5RA 2EEYA 4ZLPA 3J7A1 1X4AA 5A0YA 4XAKA 2A1BA 4J5OA 4UT4A 4M5DB 1RAJA 3CO0P 4A4JA 4J9RA 5K14A 2QSWA 3P49B 1E6VB 1NCLA 5LM7E 5IV3A 4RO0A 1N33J 3Q8RB 4NLPA 1X9MA 1S6PB 2IC3B 3JTNA 4NA1A 4WJBA 5B0BA 1U2RA 5KG3A 2XYHB 3I0RB 1NDKA 4LR7A 1CJTB 3TVYA 2IVYA 4IQMA 2VQEJ 1EP4A 1JLQB 2HQFA 3J7YU 4DR6J 4DXLA 4F26A 1PKUA 1N88A 2Q1LA 1H7WA 3B82A 4TU8A 4JI2J 3LANA 1YBUA 3M9OB 4N77A 4IH7A 4LF9F 2FJVA 2P2CB 3GJSB 1BQMB 5E41A 3QAUA 4ETXA 2HW3A 1S0MA 1E6VA 5B0FA 1RAIB 5K20B 4DLGA 2MZTA 5HQ8A 4A8MP 4B3TF 5F8LA 3ZXWA 4X64J 1N6QB 3KJVB 1S6PA 2IC3A 2G9OA 3DC2A 1WJ9A 5KT2A 3V81B 3LAKA 3TRGA 2L3MA 1AROP 3I0RA 4QWEA 1CJUB 1NPPA 3VF0B 4C48A 4ED2A 2DRDA 3QLHA 1CJTA 4W98A 7FD1A 1JLQA 4WFYA 3ENWA 2DXDA 3H42A 3A3OB 3JAMU 1NPKA 2Z0GA 2GO9A 3L4BC 3OR1B 4PXBA 4A46A 2MXYA 5DJBA 4NMXA 4CQ1A 5B7WA 4BS2A 3C16B 1KKHA 5LT5A 4PPDA 3LP1B 1YX2A 4EK2A 4OZ3A 2J8AA 1YRTA 1SIZA 5J2PB 5DLFA 1N6QA 4WYWA 3A12A 3KJVA 4UY8T 2BABA 2E7VA 1U09A 5EN1A 1UZHA 4N47A 1CJUA 2IHR1 3QJPA 1CVJA 1NM2A 2BKPA 4LF7J 4AD6A 3KOAA 1R8HA 3UDVA 5D77A 2LQ5A 2HK2A 3ZTSA 2DRAA 3NGKA 4JV1A 2FB0A 9ATCB 1SXLA 2IMWP 1AB8A 4L3NA 4CI0B 2C3OA 2E44A 3QATA 3A8KA 3C16A 2LXFA 5D4PA 1PC5A 2JLFA 3THVA 2FLPA 1Q7LB 3LP1A 2GCFA 2AGOA 2KL8A 1D8YA 1U02A 5J2PA 5KFDA 1VC5A 2M2BA 3Q89A 1H74A 3CJ3A 1N36F 2LEBA 2DNNA 3CGIA 2GIRA 2V50A 2FDNA 3WC2A 2ILZA 1HWUA 3KLIB 2YKMB 1G2EA 2VBWA 2DNYA 3B6BA 2FJWA 1IBCB 4ZP8A 4RUHA 2HHHJ 1TVRB 3RRGA 2NZCA 5LL6d 1WDDA 3RB0A 3DOMB 1XMBA 2W1BA 1N0UA 2VH7A 1B99A 1HBMB 3GYXB 2CWKA 4PXEA 4UW2A 3G4SS 1S5ZA 5DQGA 2N82B 4DV5F 4U96A 2L9DA 3M1VB 1CJVA 2XHWA 1HW8A 3AB2B 1CS4A 1XR6A 4K4VA 4GKJJ 1KTQA 4PG4A 4DR5F 3D0IE 2ZUAA 4WIIA 4IFYB 2YKMA 3ETMA 5IXUA 4O3SA 3FBEA 4J91A 2QA1A 4CLZA 3R7NB 2ZHAA 1F3FA 3QT6A 4QQBA 4PWUA 1U1KA 2RE1A 3NWRA 3MURP 4LFCF 1RT2B 3AA8A 3SI8A 4CT9A 3NRBA 4ZJOA 3OTBA 4ZOSA 3W61A 2RDIA 3RUBL 5CYJA 3BDEA 2QGFB 1KSPA 2HHPA 4OIXA 3MTJA 3BO4A 1JNRB 3T5KA 2D1CA 3D1OA 1F5CA 2Y3YA 2N7CA 2ZOGA 1VJWA 2HS0A 3RJMB 1WUUA 3CJTA 1ZM3A 3BF4A 1VOMA 3GILA 4P7TA 4IOCQ 3HK2A 4IFYA 3KJFB 3T1HF 1CQNA 3OV7A 1MMDA 1S6UA 1WF0A 2XYPB 3NL0A 2AW0A 4B9VA 2FLNA 2GHPA 3W65A 1T03B 3BYPA 1RT2A 4WP8A 1NDCA 2OTJS 1L3SA 4C0HA 3KJNB 2W7OA 4ZVGA 4ZDNA 2NXUA 3JQMA 4JI8F 3GSIA 3AFGA 4OX9F 1R0AB 3KMSA 1JLEA 1FXLA 1XMQF 5KG2A 3PW4A 1OQ3A 3GJQB 3C2PA 2ZBPA 4FNHA 2G2ZA 2AGPA 4CM2A 1UZDA 2FZGB 5DG8A 1UKUA 4KGVB 1FHTA 2ZM6J 4B3SF 2KI2A 3VGVA 1LQ9A 2ZZTA 5IT0A 4HACB 2FJAB 3NXZA 3EGVA 2CRLA 1OY6A 4LF1A 3TR5A 4NZ7A 2XY5A 1HNXJ 4LRDA 1T03A 1WTBA 4GO7X 2WONA 5HMXA 2DNLA 4PEOA 3HFKA 1FE0A 1MSWD 4JI7F 1VMBA 1MN7A 1N4LA 1WOPA 1E6YB 2GQCA 2V4QA 3TUIC 2ZE2B 4LFBJ 3CJRA 4JYAF 2EPIA 2JEJA 3UDCA 3SQOP 4CIOA 2QLJB 4DUYJ 3S6EA 2J0XA 1N5QA 3PHTA 1U26A 3KYLA 2RD5C 2PGCA 1YJ7A 2HBZB 4HACA 4GC7A 4ZPAA 3MM7B 2NXCA 1SKWA 1WKKA 1BHNA 4Q44A 3HO1A 2RHSB 4IRKA 4EFAC 3DDNA 3M2VB 5AXKA 3J7ZT 1X5SA 3KJQB 4KO0B 4HH0A 2HBQB 2VC1A 3PRDA 5ETKA 3MMAB 4O3RA 4DR7F 1T9YA 4J9OA 3TZWA 1AYEA 4EMDA 3O44A 1E6YA 4A48A 2ALYB 1MWQA 5HN0A 1FF2A 3K58A 2ZE2A 3GFYA 2GFFA 3LALA 4FPIA 1GX5A 2D69A 1DTTB 1VRUB 2ZJQQ 5KFQA 3UPFA 1VC0A 4P52A 4XIUA 4DV0F 2VL1A 3BBFA 3I87A 3TAQA 2WSEC 5T14A 2RU3A 1TK8A 5KFNA 3MM7A 4IRDA 1Y5LB 4CNYA 2L41A 1U1MA 3AXMA 3WC0A 2KZZA 4RKUC 3M2VA 3FBBA 4RW9B 4DSFA 3TP2A 2HIYA 4YY3F 2CQGA 4KO0A 3T19A 3M9MB 4UUXA 3SDEB 3MMAA 4C8NA 1FWLA 3KFWX 4F02A 2OELA 3KTQA 4QYZJ 3QZ8A 5K9FA 1GNKA 1Z1ZA 2WK4A 4JUZA 1PBAA 5KFKA 4EEYA 5DS7A 3GCWP 2XEXA 2UUAJ 1DTTA 1VRUA 3TJ8A 3PJWA 2OPRB 3BM7A 1F9FA 2FGCA 3UDEA 2XY7A 1JLFA 2BW2A 1FEHA 3CMES 2DGOA 2HNDB 2OFHX 4ZJQA 1CQMA 2RQ4A 2P8IA 1AFJA 3QRQA 2V5HG 3SCJE 4OX8A 1XK8A 3R5JB 2PFDA 3R6GB 2QSFA 3SDEA 4NLTA 1VC6A 2V2KA 2MJUA 1NSQA 5DETA 2F4VJ 2DPJA 3CJ2A 1NHVA 2PIIA 2UXBF 4PUOB 4QIEA 5EWFA 5BR8F 3O3LA 4DU7A 4I68A 4WBFA 1Q86T 3DRXA 2HZAA 4JI5J 3QT5A 1RBAA 2OPRA 2DR8A 4NXMJ 2HFVA 3MPUB 2BJ3A 3H8YA 1SH2A 3P45B 3D4JA 4FF1A 2CQ2A 2ZJRQ 5IWAJ 3MUVP 3SV4A 4KB7A 2M9KA 2BDPA 1KHWA 3CCJS 2JOQA 1O6XA 3EGZA 2M70A 3MMBB 3QIPB 3DLBA 2DGQA 4FS1A 2HAFA 1I94J 5GAGU 2B9YA 4IQXA 5CYMB 1K1QA 1RP5A 4WCEQ 5BYQA 4CRJA 4DSEA 1UVJA 4PUOA 5I3QA 1F60B 2BEFA 3RB4A 3MAAB 4TYAA 3CJKB 2CUYA 2D74B 4HT5A 2A2CA 3W3SA 1T95A 2F7VA 3IGVA 2MHNA 2HBYB 4DPUA 3A4TA 4KC5A 2DHAA 1B3TA 4TLQA 3PZPA 1KOOA 4RUCA 2CZ9A 2BW7A 1NDLA 2F3JA 3G9CA 4J9NA 4CH0S 3QJLA 4L3KA 2Z56B 5HP1A 5B09A 3G6VA 4OHWA 1H73A 4U8VA 1QAIA 2JX2A 1I5OB 1TL3A 1S0NA 3TX8A 1X4BA 2DNHA 5CYMA 3NGRA 3HSDA 2YX1A 1HR0J 4RW6A 1KVKA 4V1Ak 3HJFA 3H2LA 1NXIA 5KFAA 3FUYA 5KT4A 3CJKA 3UD5A 2BJ7A 1ICEB 2X1FA 1SPBP 1Q82T 4BWMA 3GV8B 1FRIA 4UOGA 3LW5C 2EVZA 4DL7A 2W2OP 1X4HA 2E7WA 5A2QY 1NZ8A 2UXCJ 2ZD1A 3HSZA 1W25A 1RQ0A 4DPOA 1KN6A 2LYVA 2UUWA 1AT1B 2XY6A 4CH7A 2RDDA 1RKIA 4IG0B 2VV5A 5ETTA 1FWPA 3DI6B 3V6HA 1P9QC 5GAHU 3HM9A 4DQIA 4ECQA 1RT3B 2G4BA 3NNCA 2ZBQA 1GTEA 2XC9A 4KHPF 4CP5A 2LKZA 4CO4A 3NOGA 3GIJA 4XDDA 2HG4A 4F4AA 4ZCMA 4O44A 3QFHA 1EARA 1X5OA 4C97A 3ONQA 1JQGA 2WCXA 5A8WB 1AXQA 4NPOA 2BM0A 3BYRA 3MAHA 4LF8J 3HHEA 4N76A 2D9PA 4DUZF 4KH0B 1C4CA 3H5XA 2AMCB 5EWEA 2OI2A 2KG1A 1YJWS 4OYIA 4LSLB 4KKOB 3C66A 4IG0A 7FDRA 2CQDA 1KQKA 1J5OB 3DI6A 1U1LA 2RT3A 3OUYB 2IM2A 4PKDB 5BYSA 4KPCA 1RT3A 2J7UA 1K0VA 4WK3A 3QGIA 4EUVA 3CCUS 1IBMJ 3AOBA 4WU2A 3BSCA 2LDIA 2MQ8A 5ADZA 3O6QA 5CAAA 4W92B 4KRWA 2E9ZA 1FXRA 1QLNA 5H9EK 2KG0A 2D3OR 5FDLB 2W4CA 2QV6A 1L3VA 3EPIA 2FC8A 2OMOA 4RNOA 1VQ9S 4WFZA 2J5AA 2EW9A 1Y5NB 1ZAWA 2QMWA 4LSLA 4KKOA 4JB8B 2O01C 5KFXA 1NH8A 1SI9A 3G8SA 1IKVA 1J5OA 1JLBB 2XYGB 3R5BA 4DL6A 2UU9F 5HK4A 3JYTB 2F4FA 3OUYA 2C2MB 1HHTP 2YNGB 4MTPA 3DGPA 5T7LB 4Y2KA 2AYMA 5D6GA 3KUGA 4ZPBA 1QD1A 3GE9A 3EZUA 4Y2IA 4LIWA 4UF4A 5FDLA 2GA7A 2RUSA 4ED7A 3ENAA 2IRYA 1YRUA 1X4DA 2CFXA 1XNRJ 5KT7A 3NMAA 2C2RA 3UN3A 3QQCD 1L3TA 1T8EA 4OJHA 4ZS6A 2GS8A 2MZ1A 2JEGA 4GKKF 4CLFA 1HARA 5IOLA 1JLBA 1RAFB 4M1KA 1LKZA 5KFHA 2VHGA 3DOLB 4G65A 2PEHA 4RLEA 2KVQE 5T7LA 1HBOB 5B0CA 4ZPWR 2Y8WA 1RUSA 1Y5IB 3R8YA 2OUGA 2NS1B 5D0GA 3W60A 2HGLA 4DV6J 4J9SA 3TA2A 1AUSL 1ROFA 1TZ0A 2B4OA 1LWEB 1U2CA 4KGZB 4M63A 2FVRA 2FY8A 2OO4A 2XZTB 3T6BA 2HNZB 4FS2A 1UA1A 5HJXA 4ZIWA 3JSMB 1B0TA 4WKYA 2DEJA 4CO3A 2JC0A 4R0EA 2Y1JA 1WHWA 4FDFA 2CXEA 4LF6F 3PX6A 3MPVA 4M5NA 1UEUA 1SJ3P 3V4IB 2MKYA 1HBOA 2BJ9A 1IKYA 5F8NA 2UUTA 3TEGA 1RTDA 2CPDA 2VFSA 4RW8A 4B9MA 1DBDA 2VZ9A 1RISA 4HHJA 1R31A 3M2RB 1P6TA 3PRBA 1LWEA 1BGXT 2KFZA 1HNWF 2K3KA 4CCHA 3R5CA 2ZZMA 1RTZA 3EWGA 4DN9A 3PJ9A 3EUNA 4K5SA 4YS2A 1BY9A 2YWHA 3JSMA 5DZ6A 3SZ2A 1T3NA 3TAPA 2DNZA 2RVJA 2WSCC 3HFVA 1P8GA 5HVFA 4A8OA 2HHTA 3MFIA 3GTYX 1RZMA 4KY3A 3UQSA 4WP3A 3V4IA 5KTQA 3E2EA 1PBUA 3ILOA 3CJSA 2Y1LB 2U2FA 4CZCA 1TV6B 3PTWA 1P1TA 1VDHA 3HVAA 2D41A 1HD1A 5AE1A 2JVOA 3R5GA 1YWXA 2VFTA 2CQ3A 1VIXA 1WOSA 2H9ZA 1IWGA 1HWLA 2M8HA 2V0NA
chains in the Genus database with same CATH topology
4NXMJ 1XNQJ 3W1YC 4K0KJ 2ZM6J 4PWWA 1HNZJ 4DV3J 4JI1J 4X64J 4LF7J 1HNWJ 5LMNJ 4LF4J 4DV2J 4DV5J 2UUAJ 3T1HJ 3R2DJ 5IWAJ 2UU9J 4JI6J 4DR4J 4OX9J 2KVQE 1FJGJ 1HR0J 2E5LJ 5LM7E 1IBLJ 4V1Ak 4NEZA 1HNXJ 1N33J 1N34J 4DV0J 4LF5J 1XMQJ 2VQFJ 4DR5J 5LMUJ 3D3CJ 4LF8J 4JYAJ 1I94J 3R2CJ 1N36J 4KYZA 2UUBJ 4HHUA 3JAMU 3J80U 3T1YJ 4AQYJ 4DV6J 4JI8J 4JI4J 1N32J 4DR2J 3J7AN 2MTLA 4JI0J 2UXBJ 4B3MJ 2KL8A 5A2QU 1J5EJ 4GKJJ 2UXCJ 4B3RJ 4LFBJ 2VQEJ 4YY3J 5BR8J 2UUCJ 4LFCJ 3OTOJ 4X66J 4LF9J 1IBKJ 4JV5J 4DR6J 4DUYJ 5AJ3J 4KY3A 2F4VJ 4LF6J 4DV7J 4KHPJ 1IBMJ 2MEWA 2UXDJ 4NEYA 4DR1J 4RJVA 4DV4J 4JI2J 2MQ8A 3D3BJ 4B3SJ 4GKKJ 4LFAJ 5FLXU 4NXNJ 5IT9U 4B3TJ 4YHHJ 3IMQJ 4DR3J 3J81U 4X62J 1XMOJ 4DUZJ 4JI5J 4JI7J 1XNRJ 4X65J 4JI3J 4DR7J 4DV1J 2HHHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM J;  1XNQ J;  3W1Y C;  4K0K J;  2ZM6 J;  4PWW A;  1HNZ J;  4DV3 J;  4JI1 J;  4X64 J;  4LF7 J;  1HNW J;  5LMN J;  4LF4 J;  4DV2 J;  4DV5 J;  2UUA J;  3T1H J;  3R2D J;  5IWA J;  2UU9 J;  4JI6 J;  4DR4 J;  4OX9 J;  2KVQ E;  1FJG J;  1HR0 J;  2E5L J;  5LM7 E;  1IBL J;  4V1A k;  4NEZ A;  1HNX J;  1N33 J;  1N34 J;  4DV0 J;  4LF5 J;  1XMQ J;  2VQF J;  4DR5 J;  5LMU J;  3D3C J;  4LF8 J;  4JYA J;  1I94 J;  3R2C J;  1N36 J;  4KYZ A;  2UUB J;  4HHU A;  3JAM U;  3J80 U;  3T1Y J;  4AQY J;  4DV6 J;  4JI8 J;  4JI4 J;  1N32 J;  4DR2 J;  3J7A N;  2MTL A;  4JI0 J;  2UXB J;  4B3M J;  2KL8 A;  5A2Q U;  1J5E J;  4GKJ J;  2UXC J;  4B3R J;  4LFB J;  2VQE J;  4YY3 J;  5BR8 J;  2UUC J;  4LFC J;  3OTO J;  4X66 J;  4LF9 J;  1IBK J;  4JV5 J;  4DR6 J;  4DUY J;  5AJ3 J;  4KY3 A;  2F4V J;  4LF6 J;  4DV7 J;  4KHP J;  1IBM J;  2MEW A;  2UXD J;  4NEY A;  4DR1 J;  4RJV A;  4DV4 J;  4JI2 J;  2MQ8 A;  3D3B J;  4B3S J;  4GKK J;  4LFA J;  5FLX U;  4NXN J;  5IT9 U;  4B3T J;  4YHH J;  3IMQ J;  4DR3 J;  3J81 U;  4X62 J;  1XMO J;  4DUZ J;  4JI5 J;  4JI7 J;  1XNR J;  4X65 J;  4JI3 J;  4DR7 J;  4DV1 J;  2HHH J; 
#chains in the Genus database with same CATH topology
 3M2R A;  1SJ1 A;  3CMA S;  1JNZ B;  3L7P A;  4W90 B;  4QWB A;  1UEV A;  3VAJ A;  2VOO A;  2HFN A;  4LUB A;  1G3O A;  2MKI A;  3KHR A;  2C3P A;  3BSN A;  3HXM A;  1UAW A;  1Y3J A;  2OTL S;  4MYU A;  4FYD A;  1Z4U A;  4P73 A;  1RHJ B;  3PKM A;  3BGL A;  3VAM A;  5D4O A;  3A13 A;  3TAM B;  2CIM A;  4NRT A;  5F8H A;  2O1P A;  3M8Y A;  5K8N A;  5L1J A;  3CXC R;  2MY7 A;  2RIL A;  2VG6 B;  1ZPV A;  3M7V A;  2RB7 A;  3M4X A;  2BRK A;  5L1K A;  3B78 A;  5DDQ C;  4OJ1 A;  2IA0 A;  1WG4 A;  1FD8 A;  2E5I A;  4IR9 A;  4CO5 A;  1KTV A;  2WVC A;  2R8K A;  4QW9 A;  2X51 A;  1NSA A;  1UJ4 A;  4ZLL A;  4KHR A;  3KWM A;  1Q78 A;  4KE5 A;  3EPG A;  3OFF A;  3ZNJ 1;  3WX8 A;  4X62 J;  1MW7 A;  1RLD A;  5HAT A;  3HT3 A;  2BYC A;  2HVH A;  2CPE A;  3SCI E;  4DS5 A;  4Q2L A;  5KFU A;  3ELH A;  1S1V B;  5B0G A;  3TAM A;  3MR7 A;  1JWW A;  1SJQ A;  2KXH A;  3PO4 A;  4DR6 F;  3PRV A;  3GII A;  2VG6 A;  2H5I B;  5HJY A;  5AXN A;  3HVW A;  2UV8 G;  4Q7A A;  4JI2 F;  1S9G B;  1EQ0 A;  4BC7 A;  4MK8 A;  2ZDO A;  2R8H A;  3I0S B;  1U8S A;  5HMZ A;  3L3C A;  3PX0 A;  1UVL A;  4QPX A;  1X9W A;  2MTL A;  5IZH A;  2L9W A;  2DEI A;  1VQN S;  5ITH A;  4AQY F;  1SVD A;  2I1R A;  1U1P A;  1K0T A;  4LJM A;  1SQE A;  3UFC X;  4DL0 C;  2RDJ A;  1S1V A;  1HPZ A;  2UUC F;  2B7C B;  2MZR A;  2RAQ A;  3OTO F;  2VPZ B;  4F4X A;  2XCA A;  3I5A A;  2WVF A;  2R2U A;  2D3Z A;  4X65 J;  2VPY B;  1LK5 A;  5LXY A;  4G1Q A;  1S77 D;  2GIF A;  1L3U A;  1S9G A;  2B43 A;  3GIK A;  5U47 A;  3WDO A;  3I0S A;  4FYV B;  5A76 A;  5KFZ A;  1R8C A;  2DXE A;  2J7K A;  3OQ2 A;  2HHQ A;  2ADB A;  4TXS A;  2DHG A;  5F0W A;  2BAN B;  4ZN1 A;  4NCA A;  1TUV A;  1O51 A;  3K2Y A;  1TR0 A;  4QWA A;  1FFS B;  5M2U A;  3L95 X;  1GXL A;  2P9C A;  2XZW A;  4X2B A;  4LF5 F;  2GJF A;  1EX8 A;  1QM9 A;  2GO8 A;  1X7V A;  1U8W A;  3BH6 B;  2HIQ A;  3DCA A;  2DR7 A;  4B9U A;  3MD3 A;  1WTF A;  1RAB B;  3RRH A;  2ZBC A;  4NE9 C;  1TEL A;  3D6M B;  1BQN B;  1S6Q B;  5FLX Y;  2MKC A;  1OY9 A;  3DMJ B;  1R89 A;  1F9E B;  3QBC A;  4Z7C A;  1IWA A;  1WI6 A;  2BAN A;  2QE5 A;  3CB4 A;  2ACM A;  4ZA1 A;  2OEK A;  2VON A;  4ECW A;  3GPA A;  1RA7 A;  2YWK A;  3G2X A;  3U02 A;  2HGN A;  2BA9 A;  2Q6C A;  1HI8 A;  1XIQ A;  4C98 A;  3W62 A;  4N8O A;  2EFG A;  3IG1 B;  4ILR A;  1QDU B;  5KFC A;  4KHM A;  3BN4 A;  2AHO B;  2VIH A;  4NLQ A;  4ECT A;  5G4D A;  2DGV A;  4O3Q A;  3RU0 A;  2BKO A;  1P1L A;  5JMN A;  2CJ9 A;  1H38 A;  2AJ2 A;  2CQP A;  3DMJ A;  2GC8 A;  2RF2 B;  4YDD B;  1GEH A;  2OSQ A;  2RJZ A;  3LP2 B;  3CPW R;  3DRS B;  1KON A;  5DQI A;  4TQR A;  4A8W A;  2F8E X;  3M6W A;  4F2R A;  2YH0 A;  4DV4 F;  3Q86 A;  3EYZ A;  4RNF A;  2LFV A;  4A8F A;  2BZ2 A;  3C14 B;  4U67 Q;  3C46 A;  1VQ8 S;  1M90 T;  3TA1 A;  2HZV A;  3IG1 A;  4JI3 F;  4USH A;  1VBZ A;  2KYZ A;  2GML A;  3AHP A;  3TJ9 A;  2YWF A;  4GRS A;  3W63 A;  4I1T A;  1QY7 A;  3M05 A;  4FN5 A;  3EZO A;  2DK2 A;  1RAG B;  2KYX A;  5L38 A;  1D8Z A;  5CYQ A;  4PQA A;  4HI2 A;  1WG1 A;  2UUB J;  2MLZ A;  3V2U C;  3HVR A;  2RF2 A;  3OTE A;  5H9E J;  4DQR A;  2DR5 A;  2HVD A;  2AV5 A;  4B3R J;  5AXL A;  2NYI A;  3KLH B;  3N28 A;  3T1Y F;  2Q6B A;  2ZH4 A;  1VRQ C;  1S6O A;  2V8H A;  2B4V A;  3OL6 A;  1SV5 B;  2XO6 A;  1RAE B;  2DCU B;  3WX4 A;  4YUD A;  2I6W A;  1YJU A;  2V68 A;  3NBP B;  2OKQ A;  2ZEJ A;  3C14 A;  1OY8 A;  1PSD A;  5DDO C;  4FNI A;  3MF5 A;  3EVM A;  4IRC A;  4R8U B;  1WC4 A;  1Y9O A;  3IXQ A;  1WF1 A;  1GXT A;  4B9L A;  1EET B;  1R8B A;  3BJY A;  1VRT B;  4OMF G;  1TK5 A;  4ZHR B;  2OIH A;  4CLS A;  3MM8 B;  3N79 A;  1IJE B;  4K0K F;  1CG2 A;  2L9N A;  3DXB A;  5KG6 A;  3KLE A;  2BKN A;  2R3V A;  2XTJ P;  1Q4R A;  2X1B A;  3KLH A;  1HA1 A;  2QL9 B;  2IM1 A;  2NXE A;  3IGN A;  2HRU A;  4JI4 J;  1SV5 A;  1WHV A;  2P6S A;  3M6X A;  4C8L A;  1HI1 A;  2HAI A;  3NBP A;  1HYS B;  1LOU A;  2F9J A;  3SSS A;  2HYI B;  2R4F A;  4R8U A;  3EX7 B;  3FGV A;  4Q2M A;  3BKU A;  2VB6 A;  3HFZ B;  3TJA A;  1EET A;  1LEO A;  2V9W A;  2KM8 C;  3BV8 A;  1YJR A;  2KZM A;  2R8G A;  2JDJ A;  3CUL A;  2ZH3 A;  2XS2 A;  3E51 A;  2HBR B;  1RAC B;  3F73 A;  2I5J A;  3MAQ A;  3SFU A;  4QIV A;  4OFZ A;  4LIR A;  3GZ7 A;  4FP9 A;  2C3Y A;  4O3N A;  2FYX A;  1SC1 B;  4LF4 J;  3MZI A;  3JSR A;  4FPR A;  2AZ3 A;  2XCP A;  5H9F K;  1MN9 A;  1WEX A;  3R1H A;  3IM8 A;  2FHM A;  1S57 A;  4ZJL A;  1ZAV A;  2F65 A;  1S0V A;  1HYS A;  1S76 D;  3MOZ A;  2EFQ A;  4FXD A;  2P5V A;  3HUL A;  2BXJ A;  1RYS A;  3LO3 A;  3GMG A;  5E3P A;  2VU5 A;  1OWX A;  4KFB B;  4OL8 A;  2NPF A;  2R2T A;  1FO1 A;  3TUJ C;  2OHD A;  3P5B P;  1LXN A;  2FTR A;  1FNX H;  2R9L A;  4LR8 A;  3BDP A;  4DR2 F;  4K7Q A;  2IDE A;  2GZO A;  3BRE A;  2QT7 A;  2G0I A;  4XO0 A;  2V8V A;  2QMU B;  4YR2 A;  3Q2T C;  3M8R A;  5E7O B;  1F5A A;  1BUX A;  4C4W A;  3MPY A;  2ZC4 A;  2EWH A;  4R5P B;  4Y2M A;  3CO9 A;  2C2O B;  4DV2 J;  1HNV B;  2ACY A;  1C1B A;  4A8Y A;  3ENQ A;  5KG0 A;  4USW A;  1C1C B;  2EFV A;  2DHH A;  3GJT B;  1QTN B;  1LV5 A;  4KFB A;  2QTW A;  2XLK A;  4OZ2 A;  2F1F A;  1U6F A;  2IJN A;  1Q8L A;  4USK A;  1FRX A;  3DYA B;  4JV2 A;  1N32 J;  3W9I A;  3RBZ A;  5FII A;  2Y0S D;  4OHZ A;  2KXF A;  2NR0 A;  1FE4 A;  2VFV A;  1T3O A;  4L74 A;  3EVW A;  1Y3K A;  5F41 A;  3L7O A;  2QLW A;  3CVK A;  4LVN P;  4CH1 A;  4I64 A;  2WB1 D;  4KIA A;  4B3M F;  4RZR A;  1FRL A;  1NK6 A;  4MFB A;  2G2Y A;  3GU0 A;  4R5P A;  4WE1 B;  4F2S A;  1HNV A;  5KT3 A;  4DV7 F;  2XNQ A;  4B9T A;  1C1C A;  2JJ4 D;  2Y0B B;  1Q16 B;  2LEC A;  3ZTR A;  2HPU A;  1XN9 A;  2KKH A;  3CMQ A;  2F4V F;  3VAF A;  2W9C B;  3DYA A;  2OAU A;  3AB4 B;  3D66 A;  2XM3 A;  3BQ1 A;  1B0V A;  1Q5Y A;  1VQ5 S;  2EBG A;  3PXG a;  2CNL B;  2C42 A;  4JI6 F;  1UPP A;  1EAY C;  1HQE B;  1TFY A;  1FTR A;  1TUG B;  1RHM B;  1H6K X;  2LA4 A;  3PVX A;  2QIF A;  1IKW A;  3FJ2 A;  2IAJ B;  1RAA B;  1F9H A;  4X66 J;  3QAE A;  3PYE A;  4FKY A;  1CC8 A;  2RKI A;  2OPP A;  4DL3 A;  2IJR A;  4XK8 C;  1JKH B;  3HZE A;  3QGG A;  3AXK A;  3D3B J;  2CKW A;  3RB3 A;  1SL0 A;  2QJ3 A;  1VQK S;  2W9C A;  5D0R A;  1HQU B;  4B08 A;  4DCO B;  2Z30 B;  3R9L A;  5LJ3 Y;  3R27 A;  1ZS6 A;  5AE3 A;  4TN2 A;  2PSZ A;  2P6T A;  1R27 B;  3OBI A;  3GJR B;  2FVQ A;  3H40 A;  3M8Z A;  1U1Q A;  4K4T A;  1M1K T;  2XNR A;  1JLA B;  1HQE A;  1N54 B;  2E5L J;  3F0N A;  3DLK B;  1NSP A;  4C11 B;  2CQH A;  1HMV B;  1VQS A;  4FVM A;  4H4O B;  4NYP A;  5DDP C;  3CIZ A;  2IAJ A;  3OSN A;  4DR4 F;  3BR8 A;  3W2V B;  1ZZF A;  2RQC A;  1JKH A;  2F8H A;  2CPZ A;  5J1E B;  1G6B A;  4HR2 A;  1EZZ B;  2YQ0 A;  5CXT A;  3H2V E;  4LF9 J;  1Y10 A;  3LWM A;  1R3N A;  5JVG Q;  4FYW B;  1RWM B;  1HQU A;  1U0H B;  4Z37 A;  2V2V A;  4N56 A;  3MEG B;  3PKY A;  3KK1 B;  1K44 A;  1FDB A;  2VKR A;  4B3T J;  1IBK F;  2Q79 A;  4X4O A;  4ER8 A;  1JLA A;  3SIP B;  1N52 B;  3DLK A;  2JH3 A;  5KFO A;  4C11 A;  2ASJ A;  1RTJ B;  1A7G E;  1YJN S;  1YK9 A;  2P9G A;  2MZQ A;  1GMW D;  1HMV A;  3FSI A;  3VAL A;  3T41 A;  3MWB A;  4AFF A;  2FC9 A;  1Y4Z B;  2AJQ A;  2OEJ A;  4FF2 A;  2HNY B;  2QX0 A;  3W2V A;  4EZ9 A;  2ZH1 A;  4ZPT R;  2MGZ B;  4L6V 3;  5M2P A;  5J1E A;  1HNZ F;  3SSR A;  5GAH I;  3T5L A;  2ZBI A;  2W7A A;  3Q83 A;  5ETM A;  1S1W B;  3C3L A;  1IBL F;  4CLL A;  3DRR B;  1U0H A;  1RAH B;  4EO8 A;  3MEG A;  4FZV A;  3CCM S;  1N5Y B;  4PG5 A;  4Y65 A;  2C3U A;  2AYE A;  1P27 B;  3DNC A;  2MKS A;  4MYT A;  4HYK A;  1WEZ A;  2XUL A;  1LWC B;  4OHX A;  4LRE A;  2K3I A;  1SQG A;  3KHG A;  1RTJ A;  2V69 A;  1LFP A;  2YQ1 A;  4H4K A;  1TKX B;  2BM1 A;  3UI3 A;  3AOC A;  3ZZY A;  1B4S A;  4Y2C A;  1YHQ S;  3H2U B;  3FVY A;  4L73 A;  2YKP A;  2CJK A;  1JXV A;  1U6B A;  3ET6 B;  2FJE B;  1YLX A;  2MGZ A;  2HHX A;  3AD9 C;  3G6Y A;  1AFI A;  1YGY A;  1ZA1 B;  4DN0 A;  4QPT A;  1S1W A;  1XMO F;  1NK0 A;  3PYG A;  3EMT A;  3ZTP A;  4QWD A;  3DRR A;  3OVA A;  2KFN A;  4LF2 A;  3HVT A;  1U1O A;  5HVH A;  3CCV S;  3TAN A;  2BJ8 A;  4NLG A;  4WFX A;  4Q43 A;  1N36 J;  3LUY A;  2FUG 9;  4HTI A;  2KVI A;  4K4Y A;  3PCO B;  3NNA A;  1YBT A;  5F9L A;  1LWC A;  1H72 C;  2H5E A;  3TAR A;  4O3O A;  4YB1 P;  2O66 A;  4G1P A;  4ZPV R;  1S9F A;  2E9T A;  4P72 A;  3SCL E;  3K57 A;  4B9N A;  4M8L A;  1IXK A;  2W8K A;  1NK7 A;  1SL1 A;  3ET6 A;  2A0F B;  3LPE A;  4L72 B;  5KFR A;  2J8S A;  3OXL A;  2YNI B;  2WVD A;  4F8R A;  3CTR A;  5HL7 Q;  2JFD A;  2ZBR A;  3M8S A;  2GAH C;  2H65 B;  3M32 B;  4DR1 F;  5CQG A;  2K7J A;  1U4B A;  1M5O C;  1G1X A;  2LLZ A;  4M5G A;  5A0Y B;  2DB1 A;  1X4E A;  2V4R A;  4DV5 J;  1T0T V;  5K14 B;  5JUM A;  2CPY A;  4G1I A;  3EIC A;  3BGR B;  3H5S A;  1N8R T;  3B54 A;  3CDA A;  4F36 A;  3HCX A;  1HD0 A;  4DR5 J;  3P6Y C;  2G1D A;  4I6Y A;  1V5V A;  2VJV A;  1R6Y A;  1WI8 A;  2F8M A;  3G86 A;  5J1N A;  3UDL A;  2NCK L;  1FKP B;  2WB4 A;  2WAQ D;  1HKA A;  2UVU A;  2DNK A;  2DVI A;  1KQS R;  2VQF F;  4N41 A;  4KH1 B;  4LFC J;  2YNI A;  1HI0 P;  5BJR A;  2M8D B;  3M32 A;  1RBL A;  3LAM A;  3M30 B;  1KQF B;  4M5H A;  3V6J A;  2QC3 A;  2BR0 A;  3QID A;  2FQQ B;  3ZZ0 A;  1YG0 A;  3QPI A;  3NP5 A;  4DV6 F;  1RWW B;  3JTP A;  3CJ8 A;  2HWI A;  4KGM A;  2MKH A;  1RKJ A;  1D9D A;  3BGR A;  1FDD A;  1S9E A;  4H4M B;  3EM1 A;  3K5M A;  4DG1 B;  2CWX A;  1LW2 B;  1N5V A;  3T1H J;  2KU7 A;  2LU1 A;  2BOP A;  1FKP A;  4D3G A;  4YR0 A;  3N0V A;  2RHQ B;  2WVB A;  3QLH B;  2QMX A;  4F50 A;  3D3C J;  2HK3 A;  2E5H A;  4O23 A;  4YDX A;  4ECR A;  1RWP B;  2C2E A;  1N56 A;  3T5J A;  4JI8 J;  3X3U A;  3HKZ D;  1DJ0 A;  2ZUG A;  3M30 A;  1DY3 A;  5B0E A;  5K8O A;  3NWG A;  3QGP A;  1BMQ B;  4OYP A;  2HHV A;  2Z57 B;  3HDS A;  3DN9 A;  2D3U A;  5I4M A;  5H9F J;  2LCW A;  4NX9 A;  4W4M A;  2CJB A;  3CE8 A;  1U47 A;  2UZA A;  4H4M A;  4PR6 A;  1G4C A;  1RDR A;  4B3S J;  4DG1 A;  4JV5 F;  1LW2 A;  1EKS A;  4OI6 A;  3WIV A;  1YDL A;  1Q95 G;  1BC6 A;  3I4P A;  2CPJ A;  3CC4 S;  4O4G A;  1VJQ A;  3G6E S;  2DIV A;  3B4M A;  3P96 A;  4ZVO B;  3MR5 A;  4DUT A;  3QWP A;  1R6V A;  1IUJ A;  4QIF A;  1HWI A;  1H2V Z;  2OD4 A;  4PPZ A;  4CT8 A;  1U45 A;  1DUR A;  2MKK A;  2VIC A;  5D0E A;  1QVG R;  4RU9 A;  4DF4 A;  3SFG A;  5LMN F;  4YQW A;  3GV5 B;  3G6X A;  4J37 A;  5A6W A;  4JYA J;  4AXJ A;  3PAC A;  4JV0 A;  4GVB B;  3MDF A;  2ROE A;  3KLG B;  3CDU A;  3HPO A;  5F3T A;  4ZCK A;  2M52 A;  4DBQ A;  2VUG A;  1S4F A;  2X3D A;  2CPF A;  1X5T A;  3VAH A;  3Q8S B;  3BSA A;  3RAQ A;  2EC2 A;  3CCR S;  2DHS A;  3LTO A;  1FTC A;  2JZ5 A;  3OXG A;  3BO3 A;  1FJC A;  2DH7 A;  5MAO A;  4ECX A;  1RT1 B;  4K4X A;  5MLC V;  2DO0 A;  4MK7 A;  3VZI A;  5ETO A;  1WC1 A;  1ULR A;  4DR7 J;  4EZ6 A;  1M5S A;  2VAS A;  4DZ6 A;  4XPE A;  4LQ9 A;  2HVI A;  2GNK A;  2BQ3 A;  3WQP A;  3EE3 A;  4WP9 A;  2B8P A;  3ILL A;  3D0H E;  1TL7 B;  4GVB A;  2H3E B;  4ZPD A;  2FJD B;  4O0N A;  3KLG A;  2XWY A;  3W7B A;  2CPH A;  5LOQ A;  3NMR A;  2Y1I A;  4DV0 J;  1RGV A;  5D0H A;  3PV8 A;  2ROP A;  3RAM A;  1CJV B;  3IO1 A;  4EYH B;  3KDN A;  4WWS A;  1CS4 B;  3CJ4 A;  3TUZ C;  3EXY A;  4LRB A;  3OHB A;  4QYR A;  1NJX A;  3DLJ A;  2JNJ A;  4YY3 J;  1RT1 A;  2Z2Z A;  3LPY A;  1RAD B;  3BQ0 A;  2MEW A;  2D9O A;  1UJ6 A;  3CC7 S;  2MB0 B;  2YH1 A;  1TKT B;  4E98 A;  3DXS X;  3GB0 A;  4LT6 A;  4J7C A;  2COL A;  5AJ3 F;  2AJ4 A;  1TUW A;  2QL7 B;  4HL9 A;  4ZK7 M;  2GIQ A;  4OZN A;  5ETP A;  1TL7 A;  1JLG A;  1SC3 B;  3S1T A;  2NUU G;  1TL5 A;  4NXN F;  5F8I A;  2AEF A;  1S12 A;  1FK9 B;  1X5P A;  4Y6I A;  3ZZZ A;  1TP7 A;  5CHC B;  1XR7 A;  1URN A;  4OQJ A;  5KFY A;  1CPZ A;  3CIM A;  3DU6 A;  4C7Q A;  4LRF A;  1D09 B;  2VBX A;  1RT6 B;  2IVF B;  4XDC A;  4AL7 A;  3HHL D;  5E3A A;  2M0G B;  1N34 F;  2UXB J;  1F2H A;  1XWL A;  3HHL B;  4C0O C;  4HH1 A;  3TQ1 A;  2CVE A;  3IR6 B;  2ZH6 A;  1TKT A;  5BR8 J;  1BWE A;  4I56 A;  1LK7 A;  3S01 A;  2D7S A;  2HVZ A;  3Q23 A;  1EB0 A;  4DX8 H;  3I55 S;  4ZLN A;  2DH9 A;  3UD4 P;  2UVV A;  1JLE B;  3MOJ B;  3IN5 A;  4CM0 A;  4NI2 B;  5EDW A;  5HRO B;  2ZJP Q;  5HO4 A;  1RWX B;  3K5L A;  4P7V A;  2V6A A;  4X4T A;  2V8D A;  3T3F A;  1ZM9 A;  1FK9 A;  2OPS B;  2R7S A;  2FVC A;  3SV3 A;  1XEZ A;  3CDW A;  1UVN A;  3BQ2 A;  4AND A;  1T9W A;  4PRF A;  3W5Z A;  4LFA F;  5GVQ A;  2QN6 B;  4F4Y A;  1SH0 A;  1Y0H A;  2YXL A;  2RIJ A;  1RT6 A;  5G0R A;  3QJJ A;  2UV8 A;  4QW8 A;  1XNQ F;  3HHD A;  2NXJ A;  2MQM A;  4I4B A;  1AA1 B;  3RTV A;  1MNE A;  3HHL A;  3PR5 B;  2WON B;  2ATL A;  2GGP B;  1NKC A;  4OHY A;  4NLD A;  1ZPW X;  4KYZ A;  4ZVF A;  3SSQ A;  1FJG F;  2BX6 A;  4F3M A;  3MUM P;  2BVZ A;  4UY8 5;  3EJM A;  2IPO B;  2YWG A;  1ZZN A;  5IT4 A;  4FBT A;  1XC9 A;  5EUH A;  4NI2 A;  4KQZ A;  5HRO A;  2K7K A;  5LMU F;  4EGL A;  1PCA A;  1OMS A;  1W26 A;  1GH8 A;  1TQL A;  3IP0 A;  4MKV A;  4UST A;  4EBC A;  3NS7 B;  4QZV B;  3GIM A;  4LQ3 A;  2OPS A;  3PFO A;  1IJF B;  4OJG A;  2QG9 B;  2RRB A;  1S1T B;  5KOW A;  1K1S A;  4MIA A;  3AH6 A;  3K89 A;  1VQ4 S;  1Z2Z A;  2VPW B;  1S1X B;  4Q0B A;  3EZ5 A;  3NGU A;  3NCP A;  2HWT A;  1RT5 B;  2AKW B;  3HSG A;  2FIU A;  4ELT A;  1M1H A;  3LWL A;  1Y11 A;  2PDA A;  4PQU B;  3MD1 A;  2YKN B;  1IKX A;  3KG0 A;  4NZ6 A;  1WG5 A;  2CPX A;  1Q79 A;  4QIW D;  3A3P B;  1GT8 A;  2ZNZ A;  2DIT A;  2GGP A;  4WFB Q;  1PG5 B;  2AYG A;  5J2N B;  4TY8 B;  4IDK B;  3GG1 A;  3TVZ A;  2KFY A;  3S7R A;  1UA0 A;  2QYG A;  4JI1 F;  1F1B B;  1JXE A;  2Z2Y B;  3RRK A;  2R7W A;  4BHQ A;  1QAJ A;  2XMU A;  4MKB A;  1VQ7 S;  2OJ3 A;  3OVS A;  1S48 A;  3PM9 A;  2XMT A;  3VR1 A;  1SB6 A;  1S99 A;  2PN6 A;  4DL5 A;  1S1T A;  4PWD A;  2O5D A;  1JJ4 A;  3RBE A;  1S1X A;  5LSL A;  3O2I A;  2HVE A;  5DGB A;  1RT5 A;  5LSR A;  4AL5 A;  2J0Q D;  1A9N B;  5L46 A;  4PQU A;  2YKN A;  4K4S A;  1RB0 A;  2KN4 A;  2HFS A;  2B6A B;  2CQB A;  4KHP J;  2B8Q A;  1NJZ A;  1J5E F;  3KLV A;  1SUQ A;  4JOU A;  4OZJ A;  1FX2 A;  3JXO A;  1DLO A;  2J0W A;  4F67 A;  3IMQ J;  5J2N A;  4TY8 A;  4IDK A;  2UXD F;  1O8B A;  1WOR A;  2KO1 A;  1DRZ A;  4RW4 A;  3BEG B;  1NHU A;  2AYB A;  1NJY A;  4Q45 A;  5M2R A;  4USI A;  2HQG A;  2QA4 G;  2G1H A;  5F8J A;  5GAD I;  5FD1 A;  3IRX A;  1WNE A;  4L75 A;  5AXM A;  1JLF B;  4BWJ A;  3OL9 A;  4C8Z A;  2MHE A;  4CTA B;  2IM0 A;  3TO8 A;  3T6J A;  4OYX A;  3MHY A;  2ASL A;  2B6A A;  5CZV A;  3ZZO A;  1UCN A;  2EC0 A;  3FK4 A;  2D3O 1;  5C5J A;  1TFW A;  2YNF B;  1I6J A;  3KK2 A;  5KFW A;  4NLX A;  2MKJ A;  2WHO A;  3FDS A;  2GX8 A;  1ACM B;  3CSK A;  2ASY A;  4DCJ B;  2ASD A;  4RJV A;  1RWU A;  1B64 A;  1WC3 A;  2ZFH A;  2LMI A;  2BV3 A;  2H4Y B;  3JB9 k;  1HWK A;  2N7Y A;  2ZC3 A;  2W01 A;  4RWW A;  4HHH A;  3VVU A;  2AX0 A;  2NRE A;  4X4S A;  1KVI A;  2BBE A;  1NKB A;  1CLF A;  3FCH A;  4O4R A;  2Z2M A;  2OML A;  3RR8 A;  5I42 B;  3HP6 A;  3UR0 A;  4IO1 A;  4CTA A;  4ZIT A;  1LXJ A;  4ZVE A;  3MR2 A;  2UU9 J;  1TU0 B;  3OLA A;  3HT0 A;  2BOA A;  4WIQ A;  1RK8 A;  4OZ1 A;  1VFJ A;  3UE2 A;  4MIB A;  2VA3 A;  2POK A;  1Q53 A;  4DSI A;  2YNF A;  2QRR A;  3OW2 R;  3NLC A;  1GXU A;  3B4D A;  3D28 A;  3J80 U;  3POT B;  4HDG A;  4O3P A;  2R7U A;  1LW0 B;  3W5X A;  3J7A N;  2IJF A;  2M4M A;  3D1H A;  2GQ2 A;  1MG7 A;  5A2Q U;  3QSY B;  4P9S A;  4GVL A;  4NA3 A;  2FY1 A;  1ZET A;  2GHW A;  3CCE S;  5HI7 A;  1G7C B;  2DGX A;  2ZDP A;  1D9F A;  2BJ1 A;  2CDQ A;  1QAX A;  4OI4 A;  3FMW A;  1MMN A;  3NCR A;  3V6D A;  4C9D A;  3ZFV A;  3R1L A;  2QLF B;  1U49 A;  1DQ9 A;  5I42 A;  3AJD A;  3L09 A;  3MCM A;  3HZG A;  4GKK J;  2MLX A;  2MQQ A;  1RXO B;  3NAI A;  2CJY B;  4KTQ A;  1CEZ A;  1VCT A;  1KP6 A;  3DM2 B;  3HHN B;  5HP1 B;  2A6O A;  3QRR A;  2ZWO A;  4PWW A;  2W7P A;  1TL3 B;  3DLE A;  4OYB A;  2GW8 A;  4DX7 A;  2J9E A;  3K59 A;  3POT A;  1WKL A;  4RW6 B;  3RBX A;  3FBF A;  2NYH A;  1LW0 A;  4ES1 A;  3FQL A;  1IR0 A;  2UP1 A;  3BR9 A;  1HBN B;  2H1Y A;  4X84 A;  1M5V C;  2IM3 A;  1RHK B;  3PW7 A;  3S8S A;  3NOC A;  4OYA A;  2HMI B;  2ZD1 B;  3J7Z 5;  2PI4 A;  2MYF A;  1W2I A;  3HD1 A;  1P9Y A;  3RZA A;  4LF6 J;  3DM2 A;  3T9N A;  5HAN A;  3FNN A;  3UD3 P;  1REV A;  4DFP A;  3M6V A;  1HQ2 A;  5JJB A;  2JSX A;  1PAE X;  1KLM B;  3J81 U;  4MK9 A;  1FRK A;  3PFE A;  1N32 F;  4X4N A;  2VG7 B;  2XQC A;  4U7C A;  5DZ7 A;  2E1P A;  5B08 A;  1HNW J;  3QYY A;  4O44 B;  2A6M A;  5LXR A;  1HBN A;  3J80 Y;  2VFU A;  2DY9 A;  2VF3 A;  3N9U C;  1PGZ A;  4Y0F A;  3O1L A;  3RR7 A;  3DHW C;  3CUN A;  3I96 A;  3FEZ A;  4DV3 F;  3SCK E;  4X4R A;  3CC2 S;  1RSC A;  1FKA F;  2IBK A;  2HMI A;  3Q8U A;  4LSN B;  4I7F A;  1PJ7 A;  4USU A;  3EGN A;  4DZD A;  2CVI A;  1RJJ A;  5E2Q A;  4DSL A;  4ZP6 A;  4HT7 A;  1ZOT A;  1S59 A;  2L08 A;  1X0F A;  2VOP A;  4YR3 A;  4M5L A;  4IFV A;  2RS8 A;  1KLM A;  1NJI T;  1PYO B;  1SH3 A;  4DPY A;  1DAX A;  2XS7 A;  4DDF A;  4JI0 F;  2VG7 A;  3ULH A;  4IUF A;  3OTD A;  3MTK A;  3PIP Q;  2R8J A;  5IT9 Y;  3Q8V A;  2FGO A;  3VGT A;  3MCS A;  2FPH X;  2FLL A;  3PO5 A;  3V6K A;  2MZS A;  4M94 A;  4USV A;  3UW1 A;  1CJK B;  5RUB A;  3ZZT A;  1UVK A;  3LGH A;  2CG8 A;  4M95 A;  4LSN A;  1B70 B;  4DR3 F;  3R5D A;  2U1A A;  5IM0 B;  1RU1 A;  4NOH A;  5GAE I;  1D9A A;  2ZH2 A;  1N48 A;  1RWO B;  1NO8 A;  3N6N A;  2N3O A;  3FCV A;  1M1G A;  1IKV B;  2RUG A;  2LQ8 A;  2Q66 A;  3CCQ S;  5CA5 A;  5EWG A;  2OH2 A;  4OI1 A;  4WPA A;  2IIH A;  4BLG A;  3DGP B;  2KT5 A;  4ICL B;  4EYI B;  3ZZR A;  2NSC A;  4PXC A;  3IM9 A;  3TYT A;  4F4Z A;  1UFK A;  2PE8 A;  3J81 Y;  2R7V A;  1IR1 A;  3K5P A;  1NK5 A;  1U1N A;  2Z2L A;  1C4A A;  1UMJ A;  2E5L F;  2MQL A;  1YJ9 S;  3DHX A;  3R7S B;  3KLF A;  1CJK A;  2H54 B;  3PX4 A;  2XB2 D;  5DO2 A;  3OSP A;  2APO A;  5IM0 A;  3DU5 A;  4Y3C A;  4ZVU B;  4DV1 J;  4J9Q A;  2RU9 A;  5DDR C;  5F9N A;  4CO1 A;  4ED3 A;  4PYD A;  2GQQ A;  2XSF A;  4ZVS B;  1YRX A;  4M5D A;  4P2S A;  2KH9 A;  4PG6 A;  3I9V 9;  4P74 A;  2DO4 A;  3A8E A;  3MMJ A;  4ICL A;  4Y2A A;  4DX5 A;  1NK9 A;  3H4D A;  4BBY A;  4H54 A;  2O67 A;  1R7I A;  1WHX A;  3SQG B;  4AQY J;  3Q8Y A;  2YWE A;  2CNO B;  1MWZ A;  2J9C A;  4HVZ A;  3ADA C;  4ANE A;  3OT9 A;  2UUC J;  2H51 B;  2FLO A;  3OTO J;  3SYZ A;  2HQ3 A;  3D5M A;  2YY3 A;  1M0S A;  3CNQ P;  4MMO A;  1FDN A;  1XBW A;  4ED5 A;  2DNP A;  4ED8 A;  3MXH P;  4OYM A;  1T94 A;  2V4J B;  4CLU A;  2W2M P;  5EX3 A;  2HUR A;  2RRN A;  3PG9 A;  2CAJ A;  3M8Q B;  1BQM A;  2MDA A;  3DLL Q;  3TA0 A;  1DZ5 A;  5CH7 B;  2J76 E;  2V9K A;  1IKY B;  4PXD A;  1FEE A;  3RGI A;  3EXC X;  4KBI A;  1RTD B;  5K8P A;  4RW8 B;  2K1R B;  3AD8 C;  4RBU A;  2QEX S;  3MCN A;  3SQG A;  2XGQ A;  3V81 A;  3D7S B;  4WTO B;  1VIS A;  3ISN D;  1X4C A;  3BSO A;  4ES2 A;  4LF5 J;  1QSS A;  4F3O A;  4BC9 A;  1XR5 A;  2KRR A;  5DM7 Q;  3DLH A;  4F25 A;  5HQM A;  5E3C A;  1KR4 A;  2WSF C;  3JSY A;  1K8A T;  4MKY A;  3NG8 A;  2RML A;  4KGK A;  4DPX A;  3OR1 A;  4JP8 A;  1YIJ S;  4ES3 A;  1RHR B;  2YX7 A;  2V4J A;  4U95 A;  4I67 A;  2EG2 A;  3G87 A;  1Q8B A;  3M8Q A;  1OSC A;  3T5H A;  2OSR A;  1F5B A;  2WTF A;  3BGU A;  2AJF E;  3THP A;  3Q0A A;  3GV7 B;  4ILM A;  2V63 A;  4RNH A;  4U7U K;  5L1I A;  2EXU A;  1T11 A;  3R5A A;  1VLY A;  2K1R A;  3D6H B;  4ITS A;  2V2Q A;  3PEH A;  2Y1R I;  4ID8 A;  3L7U A;  4N7T A;  5KG5 A;  2BAC A;  3Q24 A;  1KFD A;  2C2K B;  3CD0 A;  4OHV A;  1NSK L;  3QGH A;  1QTM A;  1M5H A;  3P5T L;  3PW5 A;  5D4N A;  4U8Y A;  2GV1 A;  2DRB A;  3RW6 A;  3AJ1 A;  3U1L A;  5E3Q A;  5HMY A;  3G71 S;  5KFE A;  2EKY A;  2HEK A;  1SC6 A;  1DFD A;  2LEA A;  2CAD A;  1RWN B;  4M5J A;  4A8K A;  4F0M A;  1FVS A;  2XMK A;  3MR6 A;  4DOZ A;  4NLO A;  1PIL A;  3JAM Y;  2DY1 A;  5A6P A;  4WF9 Q;  3MUT P;  2MJN A;  4PG8 A;  2M3D A;  2JVR A;  3UN5 A;  3OFG A;  2JEI A;  2V8G A;  4DI6 A;  4MKA A;  3MPD A;  4ERD A;  2ZKU A;  2EFP A;  2VDH A;  4NZ0 A;  2XHC A;  1EKR A;  3IA0 A;  3F56 A;  3CT9 A;  3K0J A;  4DV4 J;  4NA2 A;  1V3Z A;  1VK8 A;  4NLS A;  4ZVQ B;  2KJW A;  2JRS A;  1RA6 A;  3KLI A;  1BLU A;  3W5Y A;  3NGD A;  3W64 A;  3FEY B;  3OHA A;  2Y8Y A;  3R3T A;  2R42 A;  1BQX A;  4JI3 J;  4YB6 A;  3LP0 B;  4V19 X;  1TVR A;  1T9T A;  3DKD A;  3FRY A;  3DOM A;  2AJ1 A;  3GR1 A;  1FDA A;  1HBM A;  2PEB A;  3CW2 C;  2MQN A;  4CLW A;  1FRM A;  3M1V A;  3RAX A;  3T1Y J;  2C28 A;  5E5N A;  1XJW B;  2HLT A;  1TMM A;  1SL2 A;  1VQY A;  1N33 F;  2B9E A;  2FJB B;  2QL5 B;  3D0G E;  3KHH A;  3BGF A;  5GME A;  1TKZ B;  3RB6 A;  1RI7 A;  4ZIV A;  3KXD A;  4Y00 A;  3IBC B;  1RT7 B;  3TZZ A;  3IRW P;  2VJU A;  1GMV A;  3LP0 A;  2MSS A;  1Q0N A;  1U7L A;  1HPZ B;  2VQE F;  1KNZ A;  5FLX U;  4K4Z A;  4KPY A;  2W25 A;  4Q8F A;  4J9V A;  1FRJ A;  4ZN3 A;  3CCW A;  4G1Q B;  3BKF A;  3Q8Q B;  1SBR A;  3PW0 A;  4LBH A;  4K0K J;  1ZM2 A;  4DLE A;  3ZO7 A;  5KFB A;  2WZ1 A;  2MQP A;  2R8I A;  2AJ0 A;  2H4W B;  4EBD A;  3TNV A;  1HWJ A;  7AT1 B;  5FJ4 A;  4NML A;  5ETN A;  2FJX A;  2KB2 A;  3CF5 Q;  4NYZ A;  4URQ U;  4X64 F;  3GR0 A;  2CJX B;  3JQK A;  2AWZ A;  1YVF A;  3CCZ A;  1TKZ A;  1LWF B;  2W24 A;  1R8A A;  5KFM A;  2WVE A;  1H0H B;  1RT7 A;  3CWJ A;  3OPK A;  2BJE A;  5KOX A;  3MCO A;  2KJV A;  4TU7 A;  1OYE A;  4UOF A;  3F44 A;  4OV6 A;  1FWK A;  3CCS S;  1R0A A;  3OFE A;  3K17 A;  1YQH A;  2K06 A;  1NND A;  4YHH J;  1TAU A;  1GK8 A;  2UVW A;  5D78 A;  2E9R X;  2PA3 A;  4U6P A;  2GJI A;  4IO9 Q;  2I0X A;  2W2Q P;  1BE4 A;  1SKS A;  2RSQ A;  3GCX P;  4I69 A;  4Z2X A;  3TZY A;  1LWF A;  3RW7 A;  4C0B A;  4GO5 X;  4UQT A;  4RU2 A;  2NUH A;  5L8R C;  4LF7 F;  2ALZ A;  1U6Z A;  4P6Q A;  2ATC B;  3MM6 B;  2KHC A;  1UWA A;  2R7Q A;  2C3M A;  5JVH Q;  3I31 A;  3AQO A;  4DR2 J;  5HLF B;  2DBB A;  3UWT A;  3EDR B;  1EJ7 L;  5EGY A;  1L5U A;  4NAS A;  1WDT A;  5L39 A;  4YB7 A;  1MRO B;  5L9N A;  4OLP A;  2JHE A;  2EK1 A;  2IA6 A;  2Q43 A;  4YB5 A;  1NB2 A;  1KD1 T;  1VBX A;  1OQ6 A;  1VGY A;  2Z8Q A;  3NEK A;  1GMU A;  3I32 A;  2VA2 A;  4ELV A;  1V9O A;  1VBY A;  2R2R A;  1LNQ A;  4ILL A;  2C2N A;  3DDK A;  1PJ5 A;  1NRK A;  2XMJ A;  4DQQ A;  1X31 C;  2LU2 A;  3D6T B;  5KFJ A;  3FEX B;  2IYI A;  3UNY A;  5KG4 A;  4FXV A;  2Z58 B;  3MM6 A;  2HHH F;  2W9B B;  2I8E A;  5HLF A;  1X8D A;  2B0G A;  4ZP9 A;  3H0P A;  1HNI B;  5CYQ B;  5KAK A;  1MRO A;  1MLA A;  1RLC L;  2ZVI A;  4NLY A;  1WSR A;  3N5F A;  1NBE B;  5F0U A;  1Y7P A;  1FXD A;  4B3M J;  1A0O B;  3FC9 A;  4F3Q A;  2DGU A;  1ZAX A;  3ILJ A;  3DDI A;  2HLU A;  4RPF A;  4P2M A;  2EK6 A;  4DV7 J;  2G13 A;  2OGU A;  4IYQ A;  4GKJ F;  4I0W A;  1RCX B;  4RW9 A;  1FVQ A;  1NK4 A;  2E1A A;  2VFR A;  4AL6 A;  3THT A;  2ZOF A;  4RBV A;  4H4K C;  1OPI A;  2W9B A;  3NGT A;  5EX0 A;  4AE5 A;  1H7X A;  3OFH A;  4F4K A;  1HNI A;  2FHO B;  1C0T B;  2AD9 A;  1BXN A;  4JI6 J;  3IR7 B;  3KLE B;  2DD8 S;  3K5O A;  4DU8 A;  2KDO A;  1K47 A;  3AT1 B;  2HND A;  3R6L B;  2YKQ A;  2CQ0 A;  1T02 A;  5IV4 A;  5GAD U;  5THW A;  3SMZ A;  4ZVR B;  2PA8 D;  3EGW B;  1VQL S;  2XLJ A;  1X4F A;  3OTC A;  2DNQ A;  4J9K A;  2HQC A;  2VC0 A;  3CDE A;  4TVA B;  3BZQ A;  1NPR A;  4DEZ A;  3ZZP A;  6FDR A;  4ZCL A;  3QWU A;  4OYO A;  2DNM A;  3GWC A;  3VHQ A;  2IVM A;  3H4B A;  1C0T A;  2LXU A;  1VQO S;  2R2S A;  4WKR A;  2B4U A;  2I5J B;  4EI2 A;  4OZ5 A;  2YKA A;  4QR0 A;  3ICL A;  1UW4 A;  5KFL A;  2SXL A;  2OFG X;  2N4D A;  1OO0 B;  1B7F A;  3MEE B;  4DR4 J;  1FFG B;  3KKF A;  2FVS A;  1QUP A;  4ZPC A;  2V8P A;  2ZM6 F;  4QR2 A;  2B4P A;  2KT3 A;  5F8G A;  1N5T A;  1XTZ A;  1JMT A;  3MMB A;  4YEA A;  3QIP A;  3HX9 A;  2G2O A;  4CYU B;  3RBD A;  3A8I A;  3T1A A;  1HNX F;  3O5T B;  1FER A;  1RYR A;  2O3D A;  4GC6 A;  2GAG C;  3MAA A;  2XMA A;  1YSJ A;  4DPT A;  1IBK J;  2CZV C;  4X4P A;  2BJD A;  1S7I A;  4DHV A;  5D3G B;  1NLK L;  2F63 A;  3ENV A;  1HLW A;  1TL4 A;  3D2W A;  3MFH A;  4LFB F;  1IQZ A;  2E1M C;  3HSJ A;  3H98 A;  3R7B B;  1B7Y B;  2ZH7 A;  3MM5 B;  1JJC B;  2DNG A;  2OEM A;  4DUY F;  5D8H B;  3W8G A;  1KLN A;  5CZX A;  3MEE A;  2B56 A;  5DM6 Q;  3NCQ A;  2RH3 A;  1OS5 A;  4Y28 C;  1HNZ J;  2CNN B;  3FCW A;  4K59 A;  3TUP A;  1C1B B;  2DGS A;  4NRU A;  4J9L A;  4PCQ A;  2IMO A;  3W9J A;  3PYD A;  2C2Z B;  4RBT A;  4CYU A;  5DGA A;  2GVZ B;  1S0O A;  5ETR A;  2DTJ A;  1BWV A;  2K8G A;  4NWB A;  1IBL J;  1VBK A;  3Q8P B;  3UN2 A;  3FQK A;  4J9M A;  2YWW A;  1JB0 C;  3N4W A;  1IVZ A;  1ELO A;  3VAG A;  3OXF A;  2H48 B;  1NB7 A;  1WSV A;  1UVI A;  1V6H A;  1UFW A;  5KG1 A;  3VAI A;  2XBP A;  5D3G A;  2X1A A;  3OL7 A;  2AU0 A;  3BO2 A;  3JTO A;  4F0K A;  1K73 T;  1YZ6 A;  3IWL A;  3MM5 A;  2QFJ A;  3KHL A;  2DHX A;  4DL2 A;  5LJ5 Y;  2G0J A;  2LQ9 A;  3D9B A;  3PIO Q;  4MFB B;  3MR3 A;  5KFP A;  4LBP A;  4LRC A;  3GFZ A;  1XMO J;  2Y9H A;  3W9H A;  4AYB D;  4LR9 A;  2GVZ A;  2AF6 A;  4F0H A;  2CJQ A;  4S0M A;  3H90 A;  1QE1 B;  4KJI A;  1JLC B;  4EO6 A;  3MED B;  1IM4 A;  4PZV A;  1IR2 A;  1Y00 A;  5LSO A;  3KMQ A;  1C0U B;  1WD6 A;  2GJ2 A;  3VCD A;  1U0S A;  4UZB A;  1VQ6 S;  4WFN Q;  5A8W A;  3G8Q A;  3QNW B;  2LVW A;  2RQK A;  3HLU A;  2UUA F;  5E0O A;  3BBC A;  1KOH A;  3DRY A;  2HGM A;  1IKW B;  3IAS 9;  1NME B;  2JC1 A;  4KV8 B;  1FD2 A;  1U1R A;  2VG5 B;  5KFG A;  5KFT A;  4ZVT B;  4OI2 A;  4BCA A;  2RKI B;  4E8U A;  2XMV A;  2OPP B;  5IQQ A;  1RHU B;  2C22 A;  4DR1 J;  3MPW A;  2IRU A;  2ZZN A;  1PYT A;  1S10 A;  1QE1 A;  3OD2 A;  5B0D A;  1JLC A;  1MML A;  3MED A;  1UTA A;  1S1U B;  4DMZ A;  2X7I A;  5IS2 A;  4IR1 A;  2ZH9 A;  1C0U A;  1QAY A;  4NCG B;  1JX4 A;  5DLG A;  3VAK A;  1U2F A;  2EFN A;  1RCO B;  2GMH A;  4M5I A;  4ED4 A;  4E0D A;  1NK8 A;  5KT6 A;  2HHU A;  1FX4 A;  2DGW A;  4JI5 F;  2XMM A;  4NXM F;  4C8K A;  2NXN A;  1OSD A;  1ITP A;  4OJ3 A;  4ZVP B;  4QBU A;  2VQF J;  5J2Q B;  4KV8 A;  1MWY A;  5IWA F;  2VG5 A;  3R97 A;  4LVO P;  3JYT A;  1RAO A;  4LSZ B;  3WZ0 A;  2CQ1 A;  1XQI A;  1WC6 A;  4PYA A;  2YNG A;  4IG3 B;  4OX7 A;  5A8K B;  2F9D A;  5GAE U;  2VBZ A;  3BBB A;  5DRK A;  3LOU A;  5CCM A;  2A3J A;  3FMB A;  1I94 F;  1S1U A;  4ELU A;  1RTH B;  2X3G A;  3VGU A;  4HI1 A;  2MZJ A;  2AT1 B;  2ROG A;  3G82 B;  4NCG A;  4XPC A;  5DG9 A;  1FRH A;  5IFM A;  1FA0 A;  2QZ8 A;  4EWT A;  2HQD A;  3OLB A;  3IC1 A;  4NYO A;  3OL8 A;  1L3K A;  1VI7 A;  4URS A;  2ADC A;  4TY9 A;  1A6L A;  4P2X A;  1JXL A;  1JK9 B;  4N8N A;  3I9Z A;  4LBI A;  1KC8 T;  5J2Q A;  2CQC A;  2DIS A;  3QT7 A;  5BYR A;  4MJK A;  2AQ4 A;  3DOL A;  3ZC4 A;  3IBF B;  4IG3 A;  5A8K A;  1WEL A;  3BN7 A;  4ZMM A;  2J6S A;  4K4W A;  4WK1 A;  4B3O B;  1RTH A;  3UO0 A;  2V2Z A;  2KTQ A;  3CD5 A;  1HR0 F;  3KG4 A;  3G82 A;  3U7J A;  1ZH5 A;  3M9N B;  4TQS A;  4JV5 J;  3PYF A;  3CJ0 A;  3DGV A;  2HNZ A;  4AXI A;  1W7W A;  2ABY A;  3QT8 A;  3GG0 A;  4OYZ A;  1FT8 A;  1Q8K A;  5I3P A;  2DGT A;  2UXC F;  1XER A;  1HIY A;  8AT1 B;  3TWZ A;  3PNI A;  4WU3 A;  2AP6 A;  2ZHB A;  1U24 A;  4DSK A;  4TYB A;  3FKB A;  4OV1 A;  4RNM A;  3M8P B;  4FXW A;  4KSE B;  3HJV A;  5HMW A;  3W8P A;  4NLR A;  5LMN J;  4FBU A;  5L9X A;  3H25 A;  3NKY A;  4B3O A;  2GVD B;  3C6U B;  1KQG B;  5KT5 A;  3IWX A;  1NKE A;  4K4U A;  2DJW A;  3GQC A;  1KS2 A;  3HVT B;  1W2B R;  1FNM A;  2XG8 A;  3HHL C;  3KUE A;  3KNG A;  2PMH A;  3HD2 A;  4O0I A;  2NLW A;  4HHU A;  3K8W A;  1JJH A;  1SJ4 P;  4GMK A;  1F3V A;  4RL1 A;  3OJU A;  1Q7Y T;  4ED1 A;  4LF8 F;  1URR A;  2B9W A;  2YPZ A;  1GMW A;  2XSJ B;  4TNO A;  2B3T B;  2CZ4 A;  4RX6 A;  3RG6 A;  4IH5 A;  3FSY A;  3D54 A;  4YP3 A;  3M8P A;  2P9E A;  1OPZ A;  1YZ7 A;  4UOC A;  2EG1 A;  3UR3 C;  1QSL A;  4A8Q A;  4ECZ A;  2CJA A;  1TV6 A;  4IOB A;  3AOA A;  3TZX A;  3H7H B;  3DLG B;  2GVD A;  4C8Y A;  3C6U A;  1IBM F;  1F2G A;  2F40 A;  2YTC A;  4C6A A;  1NDP A;  3DRP B;  1RT4 B;  2FVP A;  2QLB B;  2VDI A;  5C42 B;  2FD2 A;  1TMJ A;  1C2P A;  2W2P P;  4C3K A;  3VGS A;  4RWX A;  2MQO A;  2NZ4 A;  4I2Q B;  3U27 A;  2BUN A;  1R0B G;  4HLB A;  3J7Y I;  2AEM A;  2W4P A;  1I51 B;  4A8X A;  2XSJ A;  5T41 A;  1HHQ A;  3N5B A;  2ERR A;  4DV1 F;  3MEK A;  2NPI A;  2HRY A;  1YI2 S;  2R7X A;  2HHS A;  2CDR B;  2DPI A;  4AUK A;  3LA0 A;  1T9V A;  3I4H X;  1F0X A;  2A18 A;  5AJ3 J;  1S72 S;  3TOQ A;  3D68 A;  3DLG A;  1EIY B;  3EDQ B;  2PC6 A;  2J0S D;  3DRP A;  1RT4 A;  3TQE A;  5C42 A;  3FZB A;  3LF0 A;  3B8H A;  4NXN J;  4NLV A;  4U9R A;  1NH7 A;  5B0A A;  3HMJ G;  3PR4 A;  4I2Q A;  1S9E B;  3VV2 B;  2NSB A;  2LA6 A;  4E2F B;  1QVF R;  1KDN A;  3VZH A;  5CD4 H;  4ZCI A;  1PO6 A;  3IS9 B;  1XNR F;  3IBW A;  3J81 j;  2LXI A;  1SKR A;  1UEK A;  1N34 J;  1VQP S;  1NZA A;  3PY8 A;  3M2U B;  1APS A;  1ZA2 B;  5CCL A;  2AIR B;  2W9A A;  3VVT A;  1SJF A;  4CDI A;  1DQA A;  2YNH B;  4CNZ A;  3LGM A;  4HDH A;  4J90 A;  4WYL A;  1FI4 A;  2DH8 A;  2B51 A;  2BE2 B;  3MEC B;  5J2M B;  4KAI A;  5IC6 B;  3W2W B;  2KT2 A;  3OVB A;  5KG7 A;  4QR1 A;  1S49 A;  2EFO A;  3BGO P;  5HVG A;  1CSJ A;  4NEY A;  1AUD A;  2BE7 D;  4QCL A;  1KWM A;  2Z4P A;  4USJ C;  4V19 J;  4LFA J;  1ZBT A;  2DIU A;  2B5J B;  3IS9 A;  3OR2 B;  1SJR A;  3AQP A;  4O4G B;  5IQ6 A;  1GQE A;  1DTQ B;  2XI3 A;  1U25 A;  1XNQ J;  5DG7 A;  1RE1 B;  4Z7Y A;  2YKO A;  1GAO A;  3M2U A;  3E3X A;  3TX0 A;  3QSI A;  2EKN A;  4A47 A;  1V3R A;  3I5B A;  3Q2S C;  3PHE A;  1M5K C;  2XLI A;  4C3M A;  4OX9 J;  2XS5 A;  2YNH A;  1FJG J;  2CYY A;  4F7V A;  1XMQ J;  3HI9 A;  2GMJ A;  5LMU J;  4FKX A;  1X9S A;  2CA9 A;  4P10 A;  2BE2 A;  3MEC A;  5J2M A;  2LQB A;  4KGX B;  3W2W A;  4RUA A;  4DJB A;  1B0P A;  5H1S V;  4DPW A;  2HHW A;  2BQU A;  1WWH A;  4IOA Q;  1NAQ A;  1RWV B;  2B5J A;  1YTY A;  8ATC B;  3OR2 A;  4CLT A;  3VQT A;  5K5M A;  1DTQ A;  1H2U X;  4ANC A;  1OJ4 A;  1D1U A;  1BQN A;  1S6Q A;  4R0J A;  2IDL A;  1UWB B;  3IWN C;  1PIE A;  3TI0 A;  5ETL A;  4JI7 J;  3Q22 A;  1I1G A;  1R0C B;  1MU2 B;  4F4W A;  3TVK A;  4JI1 J;  4DQS A;  1F6T A;  5JXS A;  1SC4 B;  2XGP A;  2J6T A;  3NGS A;  4WZM A;  4P2F A;  4YOE A;  2I2Y A;  1X0P A;  2J9D A;  3MM9 B;  3H5U A;  3UCU P;  4ZP7 A;  3IR5 B;  4HKQ A;  1GX6 A;  2E1C A;  2IBO A;  4ETZ A;  2M88 A;  1R43 A;  4P71 A;  1VIO A;  1NHK L;  3GYN A;  2GHV C;  4Q5V A;  1J5E J;  1EHW A;  4R25 A;  1CBK A;  1U48 A;  1K9M T;  5SZT A;  2HFZ A;  1UWB A;  2F5G A;  9RUB A;  1WC5 A;  1T05 B;  3GIR A;  4U7U D;  1JIH A;  1RWK B;  2JEF A;  2VPX B;  1WHY A;  1MU2 A;  3MGJ A;  2UXD J;  2ZHO A;  3LP2 A;  3DRS A;  5CD4 A;  2CNK B;  3ITH B;  2BMB A;  4NLW A;  4C3L A;  1JLG B;  2NQP A;  1SKU B;  4CWB A;  3H5Y A;  5GMK a;  4K2J A;  3MM9 A;  1VK3 A;  4FYX B;  4LRA A;  5L1L A;  4X62 F;  1KFS A;  3US5 A;  2PMZ D;  3GYG A;  4I6A A;  2B9X A;  3KUH A;  4K50 A;  1WKJ A;  2JLG A;  3GSD A;  1HFE L;  4KR0 B;  1NU4 A;  3H20 A;  4NEZ A;  2RS2 A;  2MY8 A;  3WHI A;  3TEH B;  2YQ3 A;  1KBR A;  2QYC A;  2LQJ A;  4AT1 B;  3R2C J;  1SCJ B;  3GFH A;  1VLO A;  2OLW A;  5KFS A;  1T05 A;  1TTH B;  2XZD B;  2BQR A;  4Q8E A;  4KT0 C;  3ITH A;  2JLE A;  1V5I B;  3GLJ A;  2G0C A;  3FZ2 A;  1YIT S;  4OI0 A;  2WW8 A;  2DR6 A;  3JS9 A;  3QO9 B;  4URG A;  1VR6 A;  4MAK A;  1R8P A;  1SIW B;  4EBE A;  4QU6 A;  2HKE A;  1WAC A;  4ED0 A;  2WBR A;  4OX6 A;  4USM A;  3D1Q A;  2IRX A;  1Q1K A;  4N5S A;  4ECS A;  4PAB A;  3DFE A;  4CO2 A;  3K5N A;  1RBO B;  3H59 A;  1VQM S;  5A8R B;  2BE9 B;  4I2P B;  2KXN B;  1VRT A;  2XMW A;  2FHK A;  5BXI A;  5G0R B;  3CJ5 A;  1LWX A;  3R2D J;  3V4M A;  4X65 F;  1QUV A;  4ZHR A;  4J9P A;  1NEE A;  3MM8 A;  1CUL B;  2ZNY A;  1EQM A;  3U1N A;  1HL6 A;  2DR9 A;  4YHH F;  1PJ6 A;  3RYL A;  3JQJ A;  4B02 A;  4CO0 A;  2N3L A;  2IY5 B;  5HQL A;  4RW7 B;  2FHJ D;  1X60 A;  3QO9 A;  1HW9 A;  4ECY A;  2WW4 A;  4FF3 A;  1REG X;  1RU2 A;  4A8S A;  2I38 A;  4Q0B B;  2E7X A;  3MMC B;  3NAH A;  5A8R A;  3P8B B;  5C24 B;  4I2P A;  1N5S A;  1UP1 A;  3WBZ A;  5K8M A;  2E5G A;  1IKX B;  4FF4 A;  4DFK A;  3I56 S;  1CUL A;  4X4U A;  4C2M A;  3E8O A;  4ZLJ A;  4NLU A;  3ZZU A;  2HFO A;  3CD7 A;  5E3R A;  4ALZ A;  2DNR A;  5I3U B;  1QSY A;  4FYY B;  5ETV A;  1GTH A;  2VOD A;  2BRL A;  2J6U A;  4X4V A;  2R7T A;  3NS5 A;  1FJ7 A;  4CLK A;  4RW7 A;  1VHI A;  1HHS A;  2UVR A;  3VTI A;  5J1P A;  2B7B B;  2FHJ A;  2HSE B;  3NY0 A;  2QLX A;  3WIU A;  3LH2 S;  3QFW A;  2CG4 A;  5KFV A;  2ZKT A;  3CJQ A;  4DL4 A;  4PWD B;  3D67 A;  2KRB A;  4C8M A;  5C7P A;  4ID5 B;  3MMC A;  1H2T Z;  1T7P A;  4WZQ A;  5C24 A;  2WOM B;  2ZOM A;  3PJX A;  2A10 A;  4ED6 A;  2PD1 A;  3CCL S;  4K8R A;  4DFM A;  1SUQ B;  2YPY A;  2LP4 A;  3FSX A;  2MPU A;  1UJ5 A;  1DLO B;  5I3U A;  2AZ1 A;  4OZ0 A;  2A2D A;  3C6T B;  2L48 A;  3AA9 A;  1N0V C;  4C8O A;  2J7W A;  4RW4 B;  1J2V A;  1DAR A;  1VHF A;  3UCZ P;  4DV3 J;  3BPD A;  4TKT A;  3C8Y A;  2RQM A;  1NJW A;  2E29 A;  3IRX B;  3T9Z A;  2ZH8 A;  2QO3 A;  5HSP A;  3BS9 A;  3TW0 A;  2ZVS A;  4ID5 A;  2HFU A;  2M7S A;  4M5K A;  2X1G A;  2WOM A;  3BB5 A;  4QOT A;  4RR5 A;  4YME A;  3HKW A;  2AEJ A;  2JFK A;  3X1L B;  1I3O B;  5F8M A;  2DYA A;  4TU9 A;  2YX4 A;  2HQI A;  2HS4 A;  4JI0 J;  4UUW A;  1IQT A;  3A1Y G;  3KK2 B;  2UUB F;  4P75 A;  4DS4 A;  4G3I A;  3C6T A;  3U1M A;  2AX1 A;  1O0P A;  1FJE B;  1UET A;  5CAB A;  4F04 B;  1ZYQ A;  4B3R F;  3UVJ B;  2LEP A;  3IAM 9;  1T9U A;  1M5P C;  2M5Y A;  4QU7 A;  4WE1 A;  4DR3 J;  4I6W A;  4QWC A;  2WRM A;  4DUZ J;  1YJT A;  2DCL A;  2DXF A;  4YFU A;  2ZH5 A;  2YVS A;  3W1Y C;  4OI3 A;  3QRP A;  4IH6 A;  1X4G A;  3F41 A;  5GAG I;  3FBC A;  4TLR A;  2W8L A;  1AW0 A;  3ISN C;  2W2N P;  2ZIT A;  4MH8 A;  2Q3P A;  3NS6 A;  1QJH A;  2I9S A;  5D15 A;  2E66 A;  1TKD A;  4WFA Q;  8RUC A;  4RUB A;  3M8W A;  3FRZ A;  4CLP A;  3P3D A;  2K2P A;  2AGQ A;  1D3W A;  1S7H A;  1AZS B;  2XI2 A;  1UVM A;  2YBV A;  2VKZ G;  5AE2 A;  4YN3 B;  3UVJ A;  4G6V B;  1BD6 A;  4BDP A;  4ECU A;  3AY0 A;  4L76 A;  3GP9 A;  3W66 A;  2FZC B;  1WC0 A;  1WEY A;  4JI4 F;  5HBM B;  1Q81 T;  3V6D B;  3EVO A;  4EU0 A;  5HAO A;  1TK0 A;  2C2D A;  3E01 B;  2PFF B;  3A3N B;  2DNO A;  2HZC A;  1PYS B;  1UL3 A;  1DHM A;  1OYD A;  3M6U A;  5C2G A;  3I6P A;  5C25 B;  2JL9 A;  4B17 A;  2QA4 S;  4DX6 A;  3DLE B;  1HBU B;  3BPS P;  2FZK B;  1VYA A;  3G96 A;  5AT1 B;  4QJV A;  1FNO A;  2CQI A;  2KHD A;  1UFL A;  1AZS A;  4UOH A;  1PC4 A;  2E1R A;  2R7O A;  4MIW A;  4MT1 A;  5KFF A;  1KEK A;  2OPQ B;  2OP5 A;  3QZ7 A;  3NNH A;  5C2C A;  1ZTT A;  4LF4 F;  2H5J B;  1SQF A;  4H4O A;  4PG7 A;  1Z2L A;  1KVJ A;  4DQP A;  5HBM A;  3GFX A;  2V34 A;  3KDO A;  4ECV A;  1KRP A;  3HF5 A;  2R7R A;  3BH7 B;  3C15 B;  3E01 A;  3N6M A;  5DQH A;  3CDB A;  3I82 A;  4XTT A;  4RNN A;  1UW9 A;  1REV B;  3KK1 A;  3BKT A;  5C25 A;  4UZC A;  5ETQ A;  5IT9 U;  3HHK A;  1PAU B;  1HBU A;  1YBA A;  3ETO A;  3AJ2 A;  1IN0 A;  2LDY A;  1UPM B;  4ZKA A;  3ILI A;  4FVC A;  1JJ2 R;  2HWH A;  3PDN A;  2OPQ A;  2PO4 A;  3CCT A;  1LFW A;  3G8T A;  3ZNU A;  3UCG A;  4WXW A;  4IKA A;  3DOK B;  3UNG C;  1WF2 A;  1RHQ B;  1OIA A;  5E33 A;  3P4U B;  2PT0 A;  2QFI A;  1Q8I A;  2HNY A;  2N4C A;  4NL5 A;  2C1E B;  5D4L A;  4DF8 A;  2W4D A;  4OZL A;  2CQ4 A;  4K2X A;  4QIG A;  4I7F B;  4DV2 F;  5F3Z A;  3C15 A;  4ENO A;  2CPI A;  2E5J A;  4CLY A;  3VQS A;  3O8W A;  3L9Z A;  1RTI B;  2HS3 A;  4J9U E;  5ETS A;  2PMW A;  2XWX A;  3MI7 X;  1IM6 A;  2ZWP A;  2MST A;  3FFI B;  2EBE A;  3KK3 B;  2ILY A;  3C19 A;  2IYG A;  1FCA A;  1N5Y A;  2VBY A;  4IFV B;  1FKO B;  3N6L A;  4HTJ A;  2EI5 A;  1NUE A;  4OLO A;  5GMD A;  3D6F B;  1T9X A;  1H3D A;  3A8J A;  4NCB A;  2RRA A;  3PW2 A;  3V5R A;  5KFI A;  1TKX A;  4PAA A;  2MMY A;  3DOK A;  3VWS A;  1V3S A;  1KHV A;  3LGN A;  4ATN A;  4OYW A;  6AT1 B;  2MLY A;  3AD7 C;  2KM8 B;  1DQ8 A;  3SEO A;  6FD1 A;  1ZM4 A;  3OJS A;  2WBM A;  2RNE A;  4HEA 9;  4WXO A;  1WOO A;  1RTI A;  2V67 A;  3KNA A;  3QMQ A;  1J27 A;  1VS3 A;  1TL1 B;  1Q5V A;  2PI5 A;  3FFI A;  3KK3 A;  3AAW B;  4DCP B;  1H98 A;  3AOD A;  1S4E A;  4D3H A;  3PEJ A;  2DKO B;  1FKO A;  4UQG A;  4DSJ A;  3I5C A;  2V94 A;  1S79 A;  4JBC A;  3LQV A;  4B9S A;  4QYZ K;  2QA2 A;  1CC7 A;  3ISZ A;  3CD6 S;  3GON A;  1S97 A;  5IC4 B;  5EHH A;  1TAQ A;  3KG1 A;  2VD3 A;  4M5M A;  3K8V A;  3N01 A;  2DT9 A;  3SXL A;  1FFW B;  2J9D E;  2JWN A;  4LMZ A;  3JSB A;  1O5J A;  4Y34 A;  2OD6 A;  1YJV A;  1FES A;  3KLF B;  1D0E A;  3K7R A;  4DWI A;  3SBM A;  1EP4 B;  3CED A;  4X66 F;  2HRT A;  3ZTQ A;  2IFX A;  4WTY A;  1ZTW A;  4UTG A;  1YKW A;  4ZVH A;  3ZTO A;  4DFJ A;  1GFW B;  4X4Q A;  1TL1 A;  5SUH A;  2XO7 A;  3IFE A;  4K5R A;  2EEY A;  4ZLP A;  3J7A 1;  1X4A A;  5A0Y A;  4XAK A;  2A1B A;  4J5O A;  4UT4 A;  4M5D B;  1RAJ A;  3CO0 P;  4A4J A;  4J9R A;  5K14 A;  2QSW A;  3P49 B;  1E6V B;  1NCL A;  5LM7 E;  5IV3 A;  4RO0 A;  1N33 J;  3Q8R B;  4NLP A;  1X9M A;  1S6P B;  2IC3 B;  3JTN A;  4NA1 A;  4WJB A;  5B0B A;  1U2R A;  5KG3 A;  2XYH B;  3I0R B;  1NDK A;  4LR7 A;  1CJT B;  3TVY A;  2IVY A;  4IQM A;  2VQE J;  1EP4 A;  1JLQ B;  2HQF A;  3J7Y U;  4DR6 J;  4DXL A;  4F26 A;  1PKU A;  1N88 A;  2Q1L A;  1H7W A;  3B82 A;  4TU8 A;  4JI2 J;  3LAN A;  1YBU A;  3M9O B;  4N77 A;  4IH7 A;  4LF9 F;  2FJV A;  2P2C B;  3GJS B;  1BQM B;  5E41 A;  3QAU A;  4ETX A;  2HW3 A;  1S0M A;  1E6V A;  5B0F A;  1RAI B;  5K20 B;  4DLG A;  2MZT A;  5HQ8 A;  4A8M P;  4B3T F;  5F8L A;  3ZXW A;  4X64 J;  1N6Q B;  3KJV B;  1S6P A;  2IC3 A;  2G9O A;  3DC2 A;  1WJ9 A;  5KT2 A;  3V81 B;  3LAK A;  3TRG A;  2L3M A;  1ARO P;  3I0R A;  4QWE A;  1CJU B;  1NPP A;  3VF0 B;  4C48 A;  4ED2 A;  2DRD A;  3QLH A;  1CJT A;  4W98 A;  7FD1 A;  1JLQ A;  4WFY A;  3ENW A;  2DXD A;  3H42 A;  3A3O B;  3JAM U;  1NPK A;  2Z0G A;  2GO9 A;  3L4B C;  3OR1 B;  4PXB A;  4A46 A;  2MXY A;  5DJB A;  4NMX A;  4CQ1 A;  5B7W A;  4BS2 A;  3C16 B;  1KKH A;  5LT5 A;  4PPD A;  3LP1 B;  1YX2 A;  4EK2 A;  4OZ3 A;  2J8A A;  1YRT A;  1SIZ A;  5J2P B;  5DLF A;  1N6Q A;  4WYW A;  3A12 A;  3KJV A;  4UY8 T;  2BAB A;  2E7V A;  1U09 A;  5EN1 A;  1UZH A;  4N47 A;  1CJU A;  2IHR 1;  3QJP A;  1CVJ A;  1NM2 A;  2BKP A;  4LF7 J;  4AD6 A;  3KOA A;  1R8H A;  3UDV A;  5D77 A;  2LQ5 A;  2HK2 A;  3ZTS A;  2DRA A;  3NGK A;  4JV1 A;  2FB0 A;  9ATC B;  1SXL A;  2IMW P;  1AB8 A;  4L3N A;  4CI0 B;  2C3O A;  2E44 A;  3QAT A;  3A8K A;  3C16 A;  2LXF A;  5D4P A;  1PC5 A;  2JLF A;  3THV A;  2FLP A;  1Q7L B;  3LP1 A;  2GCF A;  2AGO A;  2KL8 A;  1D8Y A;  1U02 A;  5J2P A;  5KFD A;  1VC5 A;  2M2B A;  3Q89 A;  1H74 A;  3CJ3 A;  1N36 F;  2LEB A;  2DNN A;  3CGI A;  2GIR A;  2V50 A;  2FDN A;  3WC2 A;  2ILZ A;  1HWU A;  3KLI B;  2YKM B;  1G2E A;  2VBW A;  2DNY A;  3B6B A;  2FJW A;  1IBC B;  4ZP8 A;  4RUH A;  2HHH J;  1TVR B;  3RRG A;  2NZC A;  5LL6 d;  1WDD A;  3RB0 A;  3DOM B;  1XMB A;  2W1B A;  1N0U A;  2VH7 A;  1B99 A;  1HBM B;  3GYX B;  2CWK A;  4PXE A;  4UW2 A;  3G4S S;  1S5Z A;  5DQG A;  2N82 B;  4DV5 F;  4U96 A;  2L9D A;  3M1V B;  1CJV A;  2XHW A;  1HW8 A;  3AB2 B;  1CS4 A;  1XR6 A;  4K4V A;  4GKJ J;  1KTQ A;  4PG4 A;  4DR5 F;  3D0I E;  2ZUA A;  4WII A;  4IFY B;  2YKM A;  3ETM A;  5IXU A;  4O3S A;  3FBE A;  4J91 A;  2QA1 A;  4CLZ A;  3R7N B;  2ZHA A;  1F3F A;  3QT6 A;  4QQB A;  4PWU A;  1U1K A;  2RE1 A;  3NWR A;  3MUR P;  4LFC F;  1RT2 B;  3AA8 A;  3SI8 A;  4CT9 A;  3NRB A;  4ZJO A;  3OTB A;  4ZOS A;  3W61 A;  2RDI A;  3RUB L;  5CYJ A;  3BDE A;  2QGF B;  1KSP A;  2HHP A;  4OIX A;  3MTJ A;  3BO4 A;  1JNR B;  3T5K A;  2D1C A;  3D1O A;  1F5C A;  2Y3Y A;  2N7C A;  2ZOG A;  1VJW A;  2HS0 A;  3RJM B;  1WUU A;  3CJT A;  1ZM3 A;  3BF4 A;  1VOM A;  3GIL A;  4P7T A;  4IOC Q;  3HK2 A;  4IFY A;  3KJF B;  3T1H F;  1CQN A;  3OV7 A;  1MMD A;  1S6U A;  1WF0 A;  2XYP B;  3NL0 A;  2AW0 A;  4B9V A;  2FLN A;  2GHP A;  3W65 A;  1T03 B;  3BYP A;  1RT2 A;  4WP8 A;  1NDC A;  2OTJ S;  1L3S A;  4C0H A;  3KJN B;  2W7O A;  4ZVG A;  4ZDN A;  2NXU A;  3JQM A;  4JI8 F;  3GSI A;  3AFG A;  4OX9 F;  1R0A B;  3KMS A;  1JLE A;  1FXL A;  1XMQ F;  5KG2 A;  3PW4 A;  1OQ3 A;  3GJQ B;  3C2P A;  2ZBP A;  4FNH A;  2G2Z A;  2AGP A;  4CM2 A;  1UZD A;  2FZG B;  5DG8 A;  1UKU A;  4KGV B;  1FHT A;  2ZM6 J;  4B3S F;  2KI2 A;  3VGV A;  1LQ9 A;  2ZZT A;  5IT0 A;  4HAC B;  2FJA B;  3NXZ A;  3EGV A;  2CRL A;  1OY6 A;  4LF1 A;  3TR5 A;  4NZ7 A;  2XY5 A;  1HNX J;  4LRD A;  1T03 A;  1WTB A;  4GO7 X;  2WON A;  5HMX A;  2DNL A;  4PEO A;  3HFK A;  1FE0 A;  1MSW D;  4JI7 F;  1VMB A;  1MN7 A;  1N4L A;  1WOP A;  1E6Y B;  2GQC A;  2V4Q A;  3TUI C;  2ZE2 B;  4LFB J;  3CJR A;  4JYA F;  2EPI A;  2JEJ A;  3UDC A;  3SQO P;  4CIO A;  2QLJ B;  4DUY J;  3S6E A;  2J0X A;  1N5Q A;  3PHT A;  1U26 A;  3KYL A;  2RD5 C;  2PGC A;  1YJ7 A;  2HBZ B;  4HAC A;  4GC7 A;  4ZPA A;  3MM7 B;  2NXC A;  1SKW A;  1WKK A;  1BHN A;  4Q44 A;  3HO1 A;  2RHS B;  4IRK A;  4EFA C;  3DDN A;  3M2V B;  5AXK A;  3J7Z T;  1X5S A;  3KJQ B;  4KO0 B;  4HH0 A;  2HBQ B;  2VC1 A;  3PRD A;  5ETK A;  3MMA B;  4O3R A;  4DR7 F;  1T9Y A;  4J9O A;  3TZW A;  1AYE A;  4EMD A;  3O44 A;  1E6Y A;  4A48 A;  2ALY B;  1MWQ A;  5HN0 A;  1FF2 A;  3K58 A;  2ZE2 A;  3GFY A;  2GFF A;  3LAL A;  4FPI A;  1GX5 A;  2D69 A;  1DTT B;  1VRU B;  2ZJQ Q;  5KFQ A;  3UPF A;  1VC0 A;  4P52 A;  4XIU A;  4DV0 F;  2VL1 A;  3BBF A;  3I87 A;  3TAQ A;  2WSE C;  5T14 A;  2RU3 A;  1TK8 A;  5KFN A;  3MM7 A;  4IRD A;  1Y5L B;  4CNY A;  2L41 A;  1U1M A;  3AXM A;  3WC0 A;  2KZZ A;  4RKU C;  3M2V A;  3FBB A;  4RW9 B;  4DSF A;  3TP2 A;  2HIY A;  4YY3 F;  2CQG A;  4KO0 A;  3T19 A;  3M9M B;  4UUX A;  3SDE B;  3MMA A;  4C8N A;  1FWL A;  3KFW X;  4F02 A;  2OEL A;  3KTQ A;  4QYZ J;  3QZ8 A;  5K9F A;  1GNK A;  1Z1Z A;  2WK4 A;  4JUZ A;  1PBA A;  5KFK A;  4EEY A;  5DS7 A;  3GCW P;  2XEX A;  2UUA J;  1DTT A;  1VRU A;  3TJ8 A;  3PJW A;  2OPR B;  3BM7 A;  1F9F A;  2FGC A;  3UDE A;  2XY7 A;  1JLF A;  2BW2 A;  1FEH A;  3CME S;  2DGO A;  2HND B;  2OFH X;  4ZJQ A;  1CQM A;  2RQ4 A;  2P8I A;  1AFJ A;  3QRQ A;  2V5H G;  3SCJ E;  4OX8 A;  1XK8 A;  3R5J B;  2PFD A;  3R6G B;  2QSF A;  3SDE A;  4NLT A;  1VC6 A;  2V2K A;  2MJU A;  1NSQ A;  5DET A;  2F4V J;  2DPJ A;  3CJ2 A;  1NHV A;  2PII A;  2UXB F;  4PUO B;  4QIE A;  5EWF A;  5BR8 F;  3O3L A;  4DU7 A;  4I68 A;  4WBF A;  1Q86 T;  3DRX A;  2HZA A;  4JI5 J;  3QT5 A;  1RBA A;  2OPR A;  2DR8 A;  4NXM J;  2HFV A;  3MPU B;  2BJ3 A;  3H8Y A;  1SH2 A;  3P45 B;  3D4J A;  4FF1 A;  2CQ2 A;  2ZJR Q;  5IWA J;  3MUV P;  3SV4 A;  4KB7 A;  2M9K A;  2BDP A;  1KHW A;  3CCJ S;  2JOQ A;  1O6X A;  3EGZ A;  2M70 A;  3MMB B;  3QIP B;  3DLB A;  2DGQ A;  4FS1 A;  2HAF A;  1I94 J;  5GAG U;  2B9Y A;  4IQX A;  5CYM B;  1K1Q A;  1RP5 A;  4WCE Q;  5BYQ A;  4CRJ A;  4DSE A;  1UVJ A;  4PUO A;  5I3Q A;  1F60 B;  2BEF A;  3RB4 A;  3MAA B;  4TYA A;  3CJK B;  2CUY A;  2D74 B;  4HT5 A;  2A2C A;  3W3S A;  1T95 A;  2F7V A;  3IGV A;  2MHN A;  2HBY B;  4DPU A;  3A4T A;  4KC5 A;  2DHA A;  1B3T A;  4TLQ A;  3PZP A;  1KOO A;  4RUC A;  2CZ9 A;  2BW7 A;  1NDL A;  2F3J A;  3G9C A;  4J9N A;  4CH0 S;  3QJL A;  4L3K A;  2Z56 B;  5HP1 A;  5B09 A;  3G6V A;  4OHW A;  1H73 A;  4U8V A;  1QAI A;  2JX2 A;  1I5O B;  1TL3 A;  1S0N A;  3TX8 A;  1X4B A;  2DNH A;  5CYM A;  3NGR A;  3HSD A;  2YX1 A;  1HR0 J;  4RW6 A;  1KVK A;  4V1A k;  3HJF A;  3H2L A;  1NXI A;  5KFA A;  3FUY A;  5KT4 A;  3CJK A;  3UD5 A;  2BJ7 A;  1ICE B;  2X1F A;  1SPB P;  1Q82 T;  4BWM A;  3GV8 B;  1FRI A;  4UOG A;  3LW5 C;  2EVZ A;  4DL7 A;  2W2O P;  1X4H A;  2E7W A;  5A2Q Y;  1NZ8 A;  2UXC J;  2ZD1 A;  3HSZ A;  1W25 A;  1RQ0 A;  4DPO A;  1KN6 A;  2LYV A;  2UUW A;  1AT1 B;  2XY6 A;  4CH7 A;  2RDD A;  1RKI A;  4IG0 B;  2VV5 A;  5ETT A;  1FWP A;  3DI6 B;  3V6H A;  1P9Q C;  5GAH U;  3HM9 A;  4DQI A;  4ECQ A;  1RT3 B;  2G4B A;  3NNC A;  2ZBQ A;  1GTE A;  2XC9 A;  4KHP F;  4CP5 A;  2LKZ A;  4CO4 A;  3NOG A;  3GIJ A;  4XDD A;  2HG4 A;  4F4A A;  4ZCM A;  4O44 A;  3QFH A;  1EAR A;  1X5O A;  4C97 A;  3ONQ A;  1JQG A;  2WCX A;  5A8W B;  1AXQ A;  4NPO A;  2BM0 A;  3BYR A;  3MAH A;  4LF8 J;  3HHE A;  4N76 A;  2D9P A;  4DUZ F;  4KH0 B;  1C4C A;  3H5X A;  2AMC B;  5EWE A;  2OI2 A;  2KG1 A;  1YJW S;  4OYI A;  4LSL B;  4KKO B;  3C66 A;  4IG0 A;  7FDR A;  2CQD A;  1KQK A;  1J5O B;  3DI6 A;  1U1L A;  2RT3 A;  3OUY B;  2IM2 A;  4PKD B;  5BYS A;  4KPC A;  1RT3 A;  2J7U A;  1K0V A;  4WK3 A;  3QGI A;  4EUV A;  3CCU S;  1IBM J;  3AOB A;  4WU2 A;  3BSC A;  2LDI A;  2MQ8 A;  5ADZ A;  3O6Q A;  5CAA A;  4W92 B;  4KRW A;  2E9Z A;  1FXR A;  1QLN A;  5H9E K;  2KG0 A;  2D3O R;  5FDL B;  2W4C A;  2QV6 A;  1L3V A;  3EPI A;  2FC8 A;  2OMO A;  4RNO A;  1VQ9 S;  4WFZ A;  2J5A A;  2EW9 A;  1Y5N B;  1ZAW A;  2QMW A;  4LSL A;  4KKO A;  4JB8 B;  2O01 C;  5KFX A;  1NH8 A;  1SI9 A;  3G8S A;  1IKV A;  1J5O A;  1JLB B;  2XYG B;  3R5B A;  4DL6 A;  2UU9 F;  5HK4 A;  3JYT B;  2F4F A;  3OUY A;  2C2M B;  1HHT P;  2YNG B;  4MTP A;  3DGP A;  5T7L B;  4Y2K A;  2AYM A;  5D6G A;  3KUG A;  4ZPB A;  1QD1 A;  3GE9 A;  3EZU A;  4Y2I A;  4LIW A;  4UF4 A;  5FDL A;  2GA7 A;  2RUS A;  4ED7 A;  3ENA A;  2IRY A;  1YRU A;  1X4D A;  2CFX A;  1XNR J;  5KT7 A;  3NMA A;  2C2R A;  3UN3 A;  3QQC D;  1L3T A;  1T8E A;  4OJH A;  4ZS6 A;  2GS8 A;  2MZ1 A;  2JEG A;  4GKK F;  4CLF A;  1HAR A;  5IOL A;  1JLB A;  1RAF B;  4M1K A;  1LKZ A;  5KFH A;  2VHG A;  3DOL B;  4G65 A;  2PEH A;  4RLE A;  2KVQ E;  5T7L A;  1HBO B;  5B0C A;  4ZPW R;  2Y8W A;  1RUS A;  1Y5I B;  3R8Y A;  2OUG A;  2NS1 B;  5D0G A;  3W60 A;  2HGL A;  4DV6 J;  4J9S A;  3TA2 A;  1AUS L;  1ROF A;  1TZ0 A;  2B4O A;  1LWE B;  1U2C A;  4KGZ B;  4M63 A;  2FVR A;  2FY8 A;  2OO4 A;  2XZT B;  3T6B A;  2HNZ B;  4FS2 A;  1UA1 A;  5HJX A;  4ZIW A;  3JSM B;  1B0T A;  4WKY A;  2DEJ A;  4CO3 A;  2JC0 A;  4R0E A;  2Y1J A;  1WHW A;  4FDF A;  2CXE A;  4LF6 F;  3PX6 A;  3MPV A;  4M5N A;  1UEU A;  1SJ3 P;  3V4I B;  2MKY A;  1HBO A;  2BJ9 A;  1IKY A;  5F8N A;  2UUT A;  3TEG A;  1RTD A;  2CPD A;  2VFS A;  4RW8 A;  4B9M A;  1DBD A;  2VZ9 A;  1RIS A;  4HHJ A;  1R31 A;  3M2R B;  1P6T A;  3PRB A;  1LWE A;  1BGX T;  2KFZ A;  1HNW F;  2K3K A;  4CCH A;  3R5C A;  2ZZM A;  1RTZ A;  3EWG A;  4DN9 A;  3PJ9 A;  3EUN A;  4K5S A;  4YS2 A;  1BY9 A;  2YWH A;  3JSM A;  5DZ6 A;  3SZ2 A;  1T3N A;  3TAP A;  2DNZ A;  2RVJ A;  2WSC C;  3HFV A;  1P8G A;  5HVF A;  4A8O A;  2HHT A;  3MFI A;  3GTY X;  1RZM A;  4KY3 A;  3UQS A;  4WP3 A;  3V4I A;  5KTQ A;  3E2E A;  1PBU A;  3ILO A;  3CJS A;  2Y1L B;  2U2F A;  4CZC A;  1TV6 B;  3PTW A;  1P1T A;  1VDH A;  3HVA A;  2D41 A;  1HD1 A;  5AE1 A;  2JVO A;  3R5G A;  1YWX A;  2VFT A;  2CQ3 A;  1VIX A;  1WOS A;  2H9Z A;  1IWG A;  1HWL A;  2M8H A;  2V0N A; 
#chains in the Genus database with same CATH homology
 4NXM J;  1XNQ J;  3W1Y C;  4K0K J;  2ZM6 J;  4PWW A;  1HNZ J;  4DV3 J;  4JI1 J;  4X64 J;  4LF7 J;  1HNW J;  5LMN J;  4LF4 J;  4DV2 J;  4DV5 J;  2UUA J;  3T1H J;  3R2D J;  5IWA J;  2UU9 J;  4JI6 J;  4DR4 J;  4OX9 J;  2KVQ E;  1FJG J;  1HR0 J;  2E5L J;  5LM7 E;  1IBL J;  4V1A k;  4NEZ A;  1HNX J;  1N33 J;  1N34 J;  4DV0 J;  4LF5 J;  1XMQ J;  2VQF J;  4DR5 J;  5LMU J;  3D3C J;  4LF8 J;  4JYA J;  1I94 J;  3R2C J;  1N36 J;  4KYZ A;  2UUB J;  4HHU A;  3JAM U;  3J80 U;  3T1Y J;  4AQY J;  4DV6 J;  4JI8 J;  4JI4 J;  1N32 J;  4DR2 J;  3J7A N;  2MTL A;  4JI0 J;  2UXB J;  4B3M J;  2KL8 A;  5A2Q U;  1J5E J;  4GKJ J;  2UXC J;  4B3R J;  4LFB J;  2VQE J;  4YY3 J;  5BR8 J;  2UUC J;  4LFC J;  3OTO J;  4X66 J;  4LF9 J;  1IBK J;  4JV5 J;  4DR6 J;  4DUY J;  5AJ3 J;  4KY3 A;  2F4V J;  4LF6 J;  4DV7 J;  4KHP J;  1IBM J;  2MEW A;  2UXD J;  4NEY A;  4DR1 J;  4RJV A;  4DV4 J;  4JI2 J;  2MQ8 A;  3D3B J;  4B3S J;  4GKK J;  4LFA J;  5FLX U;  4NXN J;  5IT9 U;  4B3T J;  4YHH J;  3IMQ J;  4DR3 J;  3J81 U;  4X62 J;  1XMO J;  4DUZ J;  4JI5 J;  4JI7 J;  1XNR J;  4X65 J;  4JI3 J;  4DR7 J;  4DV1 J;  2HHH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...