2LMIA

Nmr structure of the protein bc040485 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
b'GSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G-rich sequence factor 1
molecule tags Rna binding protein
source organism Homo sapiens
publication title NMR structure of the human RNA binding protein BC040485
rcsb
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lmiA01
2AYEA 1FJCA 4WIIA 1YJ9S 4QU7A 2ADCA 2MMYA 4QPTA 3UCGA 1WF1A 2L9WA 2GO9A 2MKHA 5BJRA 1H2VZ 4OZ0A 2DB1A 1DBDA 2U2FA 1WG4A 1VBYA 4IOAQ 5IM0B 2MXYA 2YKAA 4YUDA 1YI2S 2MB0B 2KXHA 2OTJS 5CA5A 2KFYA 3G6ES 1YITS 2M8HA 1SJ3P 3EGZA 3G8SA 2LA6A 3CCRS 1U6BA 2CPYA 2MZJA 4TU7A 1JJ4A 5D78A 1WF0A 3CCES 1WF2A 5LSOA 1VQLS 2ERRA 2XSFA 4U67Q 4F25A 1ZZNA 3MOJB 1OIAA 2CPFA 2EVZA 2ZJPQ 2D9PA 2G1DA 2JWNA 2VONA 2KXNB 4C7QA 2DNHA 3D2WA 1KQSR 3UD3P 4CH1A 2FHOB 2DO0A 1Q81T 2DNPA 3B4DA 2CQPA 1M5VC 2N3OA 1SXLA 2CPJA 1H2TZ 1WG1A 2XB2D 2CPIA 1X4AA 1P1TA 2VOPA 1U1NA 5CYJA 1X4EA 2MKKA 3UE2A 3NNHA 3TP2A 2L41A 2QFJA 2CQ4A 5DDOC 2AYGA 2KG1A 5JVGQ 3S6EA 1VQNS 3K0JA 5FJ4A 1WTBA 4PRFA 2M4MA 2X1BA 1W2BR 2MYFA 1WG5A 1KOOA 2JRSA 3U1LA 2M0GB 1U1KA 2CPZA 2F9DA 2J76E 3NS5A 2CQ0A 3Q2TC 5LJ5Y 3G8TA 4IUFA 2KYXA 1RKJA 2LXIA 1SJFA 2CPDA 2OJ3A 2DO4A 3IRWP 4F26A 2J8AA 2DH7A 2MGZA 3US5A 1O0PA 4Y0FA 1KD1T 1IQTA 2MKSA 3VAKA 2AYBA 4PKDB 2KRRA 5GAGU 5LXYA 3CC4S 1N88A 3S01A 2RVJA 2VODA 1H6KX 2XS5A 1X4DA 2MZSA 2DH8A 2M70A 2DHSA 2OSRA 4OZ1A 4Z2XA 2HYIB 2DGTA 5DM6Q 2B0GA 3BO3A 2FC9A 1M5PC 3JB9k 3S8SA 1VQ7S 2X1GA 4TU8A 2MZQA 1M90T 3DXBA 1SJ4P 5IM0A 1WI8A 2NLWA 3B4MA 1U1QA 3I56S 3N9UC 2HGLA 4FXVA 1WEYA 3CCSS 3CMES 1B7FA 3NNCA 2X1AA 1X4BA 2RRAA 2MSSA 2DISA 2DHAA 2KM8B 1Q7YT 1HA1A 1XN9A 3OW2R 5DDQC 1URNA 2MKCA 1VQ8S 2DNMA 2KI2A 4FXWA 2K3KA 4YOEA 2ZJQQ 3SDEA 1N52B 2EK6A 4M5DB 3P6YC 3EX7B 1FNXH 2I38A 3ULHA 1QVGR 2RU3A 2MZRA 3TO8A 2LECA 2DNGA 3CULA 2MQNA 2HGMA 1KOHA 2CQHA 2FY1A 4P6QA 3S7RA 1RK8A 3I55S 1R8HA 1X0FA 1QVFR 1WELA 4WFAQ 2KRBA 3CXCR 2A3JA 5GAEU 2QA4S 3THPA 5HL7Q 3CCJS 3CUNA 2DNNA 2NZ4A 2VOOA 3RW6A 2MY7A 2XS2A 1VQ6S 1VQ5S 1H2UX 3VAIA 1ZH5A 2DH9A 3R1LA 1WEXA 2MY8A 2X1FA 5DM7Q 1WI6A 2E5JA 2RQCA 4EGLA 1PO6A 2LCWA 1Q86T 3MD1A 1YHQS 3HHNB 1WWHA 2F9JA 1OWXA 2DGXA 2M9KA 2OSQA 1JMTA 2MZTA 3G9CA 4WF9Q 1X4CA 1UP1A 2KN4A 2MQLA 4V19X 2FC8A 4CIOA 1KC8T 2CQ2A 3IWNC 1SJQA 2PE8A 4BS2A 1WEZA 2LYVA 3NNAA 2MZ1A 2O3DA 2XNQA 2DGUA 3P49B 2D3OR 2RQ4A 2MGZB 2KT5A 1VQPS 2EK1A 3MDFA 1X5SA 3LQVA 1VBXA 5GADU 1NO8A 3U1MA 3MI7X 4W92B 1VQOS 1UAWA 2AYMA 5MLCV 1VQ9S 1D9AA 1DHMA 3VAJA 2CJKA 1Q82T 2DNKA 1OO0B 1A9NB 2HGNA 1YWXA 2KG0A 2RS2A 5CXTA 1FT8A 2MHNA 1VQ4S 1VC6A 2M2BA 2KU7A 3VALA 1N54B 3H2VE 2LQ5A 1M1KT 1AUDA 2DHGA 3CCLS 1S72S 2E5IA 3CMAS 2U1AA 1U1PA 5LJ3Y 3FEYB 2DITA 1VC5A 3J7ZT 1G2EA 2D9OA 3CTRA 4QQBA 1QM9A 1FHTA 1S79A 4TU9A 3THTA 1FJEB 3MD3A 2LXUA 3G96A 4WFNQ 1ZZFA 2F3JA 3CC7S 2XNRA 1HL6A 3G71S 3CPWR 2K8GA 5JVHQ 1U1OA 5GVQA 4C4WA 4LIRA 2MQOA 2G0CA 5IFMA 2CPHA 2Q79A 2JVRA 2QEXS 4UQTA 4ERDA 1JJ2R 1X5OA 2DNQA 2FPHX 3HI9A 2YTCA 2CQDA 2DGWA 3VF0B 4UY8T 4J5OA 2MKJA 3VAHA 1F9FA 1UFWA 3NMRA 3CF5Q 4ED5A 2CQ1A 1OPIA 2DGQA 4CH0S 3CCMS 3DLLQ 4WCEQ 2ADBA 2LKZA 2RT3A 2MQPA 2DNRA 4CQ1A 2GHPA 3P3DA 4Y00A 1X4HA 2CPEA 1JJHA 2DGSA 2KM8C 2MQQA 1X5PA 2UP1A 3CCVS 1P27B 2CQGA 2MQMA 2DK2A 3P5TL 3LPYA 2I2YA 5LXRA 5DETA 2JVOA 2BZ2A 1N8RT 4IO9Q 3BO4A 3MUMP 4WKRA 2N82B 4IOCQ 2E5GA 4TLQA 3CC2S 2MJUA 1WHYA 1X5TA 2LMIA 3CCQS 1U1MA 1WHXA 2DGVA 1R8PA 5GAHU 4W90B 2AD9A 4C0OC 3SDEB 2YH0A 2CQBA 3MXHP 2DIVA 2M8DB 1YJWS 1YTYA 1VC0A 5DDPC 1BY9A 2L08A 2KVIA 1U2FA 1DRZA 2DNZA 3NS6A 2JX2A 3CCUS 1YIJS 5DDRC 2RS8A 2KHCA 2DGOA 3PIOQ 3BEGB 2MSTA 1FO1A 2N3LA 4LJMA 5EN1A 2LEBA 2M88A 3ZZZA 3Q2SC 5GMKa 2PEHA 2RUGA 5LSLA 1K8AT 2N7CA 3MUVP 3H2UB 1L3KA 5ITHA 1K9MT 3BO2A 1VQMS 3MURP 3SXLA 4QU6A 2DNLA 1VQKS 2CPXA 3VAGA 2DIUA 1M5KC 1PGZA 3CD6S 1UW4A 1D8ZA 2V94A 1U6FA 4YB1P 4ZKAA 2M52A 3FEXB 1VBZA 5HO4A 2MPUA 1DZ5A 1CVJA 1YJNS 2DNYA 3G4SS 3TYTA 2RRBA 2DNOA 2J0QD 3UCZP 3V4MA 4F02A 1A7GE 2BOPA 2CQ3A 2J0SD 1U1RA 1WHVA 2LA4A 3VAMA 3UD4P 3L3CA 3VAFA 1X4GA 2YWKA 5IQQA 2E44A 2CQCA 3R27A 4A8XA 4LMZA 3EGNA 2M7SA 1FJ7A 2CQIA 3SMZA 2KXFA 4RU2A 1SJRA 4PR6A 2DHXA 2KH9A 3R1HA 3ZZYA 3BS9A 5H1SV 1NJIT 1FXLA 2HVZA 2E5HA 2OTLS 1M5OC 1WHWA 3UWTA 3UCUP 2YH1A 1K73T 2XS7A 1HD1A 1U1LA 1X4FA 1NU4A 2SXLA 3PIPQ 2ZJRQ 2LEAA 2OIHA 3J7YU 2HZCA 5D77A 4WFBQ 1HD0A 2MJNA 3MUTP 3RW7A 2MKIA 2G4BA 2WBRA 2RNEA
chains in the Genus database with same CATH superfamily
2AYEA 2ZVSA 1FJCA 1WACA 4CM0A 2BW2A 5HVFA 2AHOB 5KFHA 2ADCA 4PWDB 4U8VA 1G7CB 1RDRA 3RBEA 1UWBA 4TVAB 3RAQA 3HX9A 1HKAA 3QGIA 2XZWA 1ZYQA 1J5OB 2HNDA 1PYOB 4A4JA 1SL0A 4JI6J 1WF1A 1K0VA 2HQGA 2MKHA 5BJRA 1RT4B 4OI2A 1FDNA 4Q8FA 1HNZF 2EC2A 4OZ0A 1RTJA 2CZ4A 1DBDA 1YZ7A 1R89A 3M2RA 1Q0NA 4LSLB 1T94A 3HHLD 2LU1A 4C0HA 3M9MB 2FJXA 1S59A 4KGXB 1SQGA 4IOAQ 2ZOFA 3W9HA 5IM0B 1GX6A 1RHRB 2ILYA 2YKAA 4YUDA 4USWA 2HK3A 1XWLA 2WRMA 5HBMA 1Z4UA 3IBCB 3TJAA 3W5ZA 4DX7A 4OZ3A 3TA2A 2DEIA 3MEKA 4CLWA 2KFYA 4FXDA 4KTQA 3VTIA 3W63A 1SJ3P 4IOBA 2IRYA 3CJ4A 3EGZA 2COLA 3WHIA 4ETZA 4UOGA 1S0OA 4C8MA 2MZJA 5M2UA 3KK3A 3ELHA 1UEVA 3GJQB 5EWFA 2CJQA 3ITHA 2VG5A 1JWWA 2L9DA 4IRDA 1FTCA 1CJKB 2ZH1A 2PDAA 4ED3A 3N6NA 5BR8J 3GFYA 1C1BB 1S57A 4U67Q 2RF2A 1XR6A 3EGVA 2CPFA 2Z4PA 4RKUC 3V2UC 4PG5A 4LF2A 2GQQA 1QSLA 2EBGA 2H51B 2ZH3A 3GB0A 2G1DA 3H5UA 3JSYA 4RNNA 1TL3B 2HFVA 5DLFA 3J81U 2AKWB 2AJ1A 3HKZD 2Z56B 4RNFA 2NYIA 5T41A 5J2NB 3F56A 2IJFA 4ZLNA 4K4WA 2OPQA 4ER8A 1G1XA 3ZNJ1 1WKJA 2VG7A 1HWLA 5G0RB 5HMXA 1I5OB 3UD3P 1SJFA 2DO0A 6AT1B 3M8YA 3PW4A 4B9UA 2LQBA 3GJRB 4HLBA 3KMQA 4GO7X 1UW9A 3RB4A 4LVOP 4KAIA 1M5VC 4ANDA 2CNLB 3H8YA 3I6PA 4X84A 2QN6B 5F41A 1CJVA 1DY3A 1Y11A 2ZDOA 2CPJA 1U7LA 3LAMA 5FDLB 1PILA 1H2TZ 5HMZA 3KLHB 4X4SA 4N8NA 2Z30B 2G2YA 4OYOA 1X4AA 4C3MA 2W25A 3NY0A 3PRDA 3CJTA 2R8HA 3GR0A 3GIIA 2W4CA 1ZAXA 4JI7J 5D3GA 2XMVA 3OSPA 1RU2A 2WK4A 4WYWA 2C2KB 3UE2A 3TP2A 2KDOA 1CC8A 4L73A 1MU2B 3PX0A 5C25A 3AH6A 3QAEA 5RUBA 2KG1A 5FJ4A 5KFVA 4Y2CA 3T19A 4DSJA 4B3OA 3PW0A 1GAOA 2I9SA 2M4MA 2DY9A 3TA0A 1PJ7A 1VRUA 2HNYA 1WG5A 2O66A 5B7WA 1W2BR 3U1LA 3EUNA 3KUEA 5F8GA 3HD1A 2E1CA 2F9DA 4DV3F 2XZTB 1T11A 5IC6B 1ICEB 5F0WA 1E6VA 2EFGA 4J9LA 3KUGA 2LXIA 1NB7A 3FFIA 2OJ3A 2HW3A 3UI3A 2HVIA 1VLYA 3AJ2A 3CD7A 1HFEL 3E3XA 3DOMB 4LF1A 5HMYA 4U6PA 3AA8A 1UL3A 2YPZA 3ENAA 1RQ0A 3LOUA 3GZ7A 1UZDA 2VG7B 4F26A 4Z7CA 1S1UB 4F2RA 2ZE2B 4CO3A 5SZTA 1XMQF 3H2LA 4Y0FA 4DF8A 2WBMA 3TAQA 2MKSA 3DRPB 2FJDB 2FHMA 1SKWA 4ILLA 4PWDA 2BJ8A 4PKDB 3CO0P 5LXYA 4IFYA 3DLKA 3M9OB 2XTJP 3S01A 3MEGA 1Q4RA 4YQWA 3OR2A 5LMNJ 1EIYB 2BEFA 1SKRA 2HHQA 4C8KA 4C8YA 1X4DA 3VGTA 4JI1J 4LIWA 3TUJC 5B0EA 5EWGA 2UUCJ 1S6UA 2DHSA 2GHWA 4OZ1A 3C15A 4OYZA 1SI9A 5IT4A 1RT3A 2PI4A 4Y28C 5GAEI 2FC9A 4JYAF 1M5PC 2QFIA 4KC5A 5A2QU 2X1GA 4IR1A 2M5YA 2MZQA 3KHHA 1UFKA 3PEHA 4KHMA 1RWXB 4RPFA 3VGUA 2CWKA 3G82B 2Y1LB 3W2VB 1SJ4P 4I7FB 4EEYA 4F36A 2CG4A 4R5PA 4WK1A 1WI8A 6FD1A 3MTJA 5K9FA 3HDSA 3ZO7A 3SI8A 2PA3A 1WEYA 1WD6A 4RR5A 5E41A 2BDPA 1SV5A 2F8MA 3QZ8A 4DR1J 3IXQA 2AWZA 3NAHA 1FEHA 4CO4A 5J2MB 2DISA 2G2OA 2HVEA 1VI7A 1RXOB 1XERA 1HA1A 2V67A 2B9YA 1SH3A 1CQMA 3T9ZA 2NUUG 3LO3A 2DNMA 2J7WA 1TKTA 2WOMA 3CIZA 1VQ8S 1S1UA 2RF2B 4YOEA 1WSRA 4Z7YA 4PYDA 3RU0A 3TOQA 2EK6A 5L1KA 2WAQD 3P6YC 3CJ8A 2OLWA 4DV3J 3T5JA 2MZRA 2GNKA 2VDHA 5IXUA 3U27A 1KOHA 3DLKB 2XHCA 4P6QA 3RR8A 4URGA 1RHMB 1IJEB 3HZGA 3J7Z5 4DSFA 5K5MA 3LH2S 5DZ7A 4J7CA 3CXCR 4X62F 1TKDA 3OLAA 4X4UA 4KHPJ 2A3JA 1S1WB 5KFIA 5CD4H 1M5HA 1R8AA 4RO0A 2FJBB 2FJAB 4DV0F 3K5PA 5I42A 3FZBA 2QA4S 4DR7F 5F8JA 1KVIA 3NBPA 3THPA 4DQRA 2DNNA 4I2PA 3GP9A 3Q8PB 2AJ2A 2QLWA 4RNOA 2NXJA 3H7HB 2XYPB 1WKLA 3IG1A 2MY7A 4OYAA 3W8GA 2XS2A 4ZP8A 2PO4A 2WHOA 4DV7J 2YNHA 4LF8J 4WXWA 1S6PB 4UOFA 4USHA 2ASJA 3IMQJ 1FJGF 2DH9A 3Q24A 2R7UA 2MY8A 2WSEC 1OY8A 3QT8A 1OJ4A 4OZLA 4RUAA 1B70B 2BABA 1NH8A 3IRXA 3TZYA 2RQCA 5KFJA 4ZVRB 3BKFA 5H9EK 4ZHRA 5I3QA 1NM2A 4U7UD 2I6WA 2DGXA 4ZCIA 1RWVB 3I87A 4FKYA 4ITSA 4Q7AA 2W2NP 1TUGB 1U0HA 1UP1A 1UEKA 3FQKA 3M9NB 1U48A 1IVZA 2MQLA 2ZBIA 2CG8A 3LW5C 1RAFB 3D6TB 5B0DA 1NK6A 3FFIB 5DG9A 3IWNC 4BS2A 4B9MA 1BD6A 1WEZA 3WX4A 2DYAA 4BWMA 2R8JA 2ZH5A 5L39A 2XNQA 4O4GB 1RWKB 5KT4A 2YWWA 3ZFVA 2WB4A 3GPAA 5ETOA 4J9MA 4NMXA 2EK1A 1QSYA 1RAEB 2VA3A 4KE5A 1DLOB 2HQDA 2DPJA 4ZITA 1LXNA 3NOCA 2B4VA 2XG8A 2RQMA 4P71A 5DGAA 2V8VA 3J7AN 1VK3A 1RWNB 1ZM2A 2XULA 4EO6A 3NBPB 1VBXA 1GMVA 3OR2B 3NCQA 1SKSA 4OI3A 4F3MA 1S12A 1P9QC 1VQOS 1IM4A 2AYMA 4YB5A 1FKOA 1D9AA 1DHMA 4F7VA 1IBKJ 2H3EB 2WW4A 4XDDA 4ZVHA 4CLYA 4ZOSA 1QAJA 5ETNA 3D6FB 1OO0B 1U8WA 2HGNA 3AA9A 4ATNA 1Y5LB 4KHPF 3HHLB 3HULA 4LQ9A 2MHNA 2UXCJ 3QT5A 1LK7A 3OL7A 3R5JB 3ENVA 2BE2A 1SIWB 4ECQA 3S1TA 2V50A 1CULA 3A3NB 1B0VA 4KY3A 2DITA 2YVSA 4I2QA 3KHGA 2C2ZB 4WTYA 2CXEA 1VC5A 1U0HB 2VC0A 1OY9A 1V3ZA 4WWSA 5IQ6A 2YNIB 3QSYB 1G2EA 1QUVA 3OTOJ 1MNEA 5DQGA 4K4YA 1GQEA 6FDRA 3A8JA 3I96A 3CTRA 4LREA 2CJBA 3KDOA 3FJ2A 1F9EB 4XPEA 4DR5F 3TUPA 1NPPA 4B9LA 1S6QA 1IJFB 4DHVA 1U24A 3HF5A 2AJFE 3DDKA 3H5SA 1L3VA 1WJ9A 3LP1A 1FJEB 4QW9A 4ZVPB 1T7PA 5HLFB 3FSXA 1Z2LA 4TKTA 3WX8A 4Q2LA 4ZPTR 4CLUA 5A0YA 2DRBA 4HH1A 2GV1A 1HL6A 3G71S 1ZOTA 2V6AA 2XEXA 2A1BA 2D1CA 3KKFA 4ID8A 2R7RA 1GX5A 3C46A 2YKNA 4DR6F 2I5JB 3KG1A 1ULRA 1WDTA 3POTB 4UF4A 3DI6A 2E1PA 1EKSA 2MQOA 1C4AA 1F5BA 1RT2B 2GMHA 4CLZA 2Q79A 1LW2B 2D7SA 1WC6A 2JVRA 4UQTA 1AW0A 1VHIA 1NK9A 2B4UA 4U7CA 1YLXA 1CJUB 2F8EX 2ZWPA 1RISA 2R3VA 4QR1A 4JI4F 3HHLC 1JKHB 2BJ3A 3A3PB 1NK4A 3HVTA 2VDIA 1HNWJ 1KHVA 3T6JA 9RUBA 3EVWA 4DV7F 1S5ZA 4EWTA 1TZ0A 3DKDA 5KFKA 2FZGB 3H5YA 2MKJA 1IKVB 2CYYA 1GMWD 1F9FA 2HWIA 2WZ1A 4BWJA 1B0PA 2J8SA 4M5GA 4HACB 1RTIA 1YX2A 2B5JA 4Q0BB 2CAJA 3K5MA 1UWBB 2EI5A 5T7LA 3MHYA 2RT3A 2LQ9A 3HSGA 4ED4A 4O3RA 4NXMJ 4WZQA 3SQGB 2GHPA 5D8HB 5H9FK 3THVA 4GRSA 4Y00A 2WVBA 1LFWA 2DGSA 2KM8C 2JDJA 3QGPA 4DMZA 4B3SJ 1X5PA 2XYGB 2UP1A 2QLXA 4KKOA 1F0XA 1XNQF 1H72C 2L3MA 1RT1A 4PXEA 4YFUA 3VWSA 3M32A 3BF4A 1IKYB 5LXRA 5DETA 2JVOA 3N5BA 2BZ2A 2DCLA 3GU0A 1N8RT 2JEIA 4M5LA 1PAEX 3BO4A 2C28A 2AW0A 5C2GA 3MMAA 4GVLA 5J1PA 1LWCB 2QL9B 4IOCQ 1YRUA 1AFJA 4EI2A 4ZMMA 2GW8A 5FLXY 1RCXB 2J9EA 2E7WA 2J9DA 2NXCA 2FY8A 4TLQA 5KT2A 5DG7A 1Y10A 3R6GB 1WHYA 3HP6A 3CCQS 1DLOA 2V2ZA 2C3OA 4A46A 4OL8A 3CNQP 4MIWA 5GAHU 3NAIA 4YS2A 1QAYA 1MLAA 1KS2A 1K1QA 4CTAA 2HSEB 2YH0A 2GIQA 3FZ2A 1BWVA 2HZAA 2KVQE 2AEFA 1JLEB 1NSPA 1T0TV 3MM7A 5DDPC 2HQIA 3BQ0A 1C0UB 4F4YA 2KVIA 1FX2A 4RW9A 1U2FA 1SB6A 3RTVA 3SCLE 4C3KA 2A0FB 4NI2B 4R8UB 3OL9A 2GHVC 1KRPA 4U7UK 2OPQB 3RJMB 3MAAB 1S97A 2AV5A 1AB8A 3D5MA 2RS8A 5DDRC 4CLFA 2HS4A 2KHCA 2WCXA 3PIOQ 1UVNA 3BEGB 1S7HA 2MSTA 1ZS6A 4JI2J 1WNEA 1IBLF 4LJMA 4URSA 4ZPWR 1YJ7A 2BUNA 4UOCA 2WVEA 2HRUA 4LBPA 2BV3A 2CNNB 2VPWB 1Q5YA 3D7SB 3ADAC 4C0BA 5AJ3J 3KLHA 3T1YJ 1KKHA 5ETMA 5GMKa 2PEHA 2F7VA 1LWEA 5LSLA 4C8ZA 2B56A 2BMBA 3EWGA 1TV6A 3JAMY 2NR0A 2N7CA 1BQMB 3R7SB 4USMA 3HCXA 5KG4A 2MLZA 2BR0A 4IFVB 5D3GB 5J2QB 5DJBA 2FVCA 5GADI 2KZZA 5AXLA 4OYWA 3IO1A 4JI3F 3LF0A 4N76A 4F4KA 4EK2A 1RU1A 2JZ5A 1XNQJ 1ZA2B 3DU5A 3SXLA 3TX8A 4ED6A 2DNLA 3QRPA 1ZA1B 1ZBTA 1VIOA 3KYLA 3PR5B 4Y2AA 1Q78A 2CPXA 4KYZA 3NWGA 4OYMA 3T5LA 1VQKS 5ETTA 3CGIA 2R42A 1BQXA 1M5KC 3CD6S 3CJKB 1SL1A 2HFNA 4B3MJ 3MR2A 4ED1A 3GFHA 4ALZA 4L3NA 1JLFA 1RA6A 3CSKA 1DZ5A 1FWLA 3GQCA 3QT6A 1CVJA 2DBBA 3EM1A 3K7RA 2DNYA 2HVDA 4NPOA 4WFXA 4DS4A 4BC9A 3UCZP 3R6LB 4W4MA 4C97A 4LFCF 1XJWB 3D6HB 1XC9A 1I6JA 2AF6A 3KXDA 4MYUA 4LF5F 4QBUA 2CQ3A 4OHVA 1VJWA 4OV1A 3W2WA 3WBZA 1EJ7L 1RAHB 1FEEA 1VR6A 3EE3A 1EB0A 2QLJB 3LUYA 4B3TJ 2CUYA 2FUG9 2AEJA 3OXLA 4P73A 3MEGB 7FD1A 2DPIA 5E0OA 4EU0A 5HP1B 1X4GA 2YWKA 3EVMA 4ZIWA 2HBZB 4I2PB 5IQQA 2ZBQA 1FKAF 3M30B 2V2KA 4JI6F 1BQMA 4I68A 1ITPA 4L3KA 2IDEA 3I0SA 4A8XA 1C1CA 2PA8D 4K7QA 4ECRA 1F5AA 3UNYA 1HNZJ 4DQQA 4A47A 1TP7A 4E8UA 4WU3A 1S9GB 2BKPA 1QD1A 2M7SA 3M6XA 4CO0A 3UR0A 5I3UB 3D28A 2GMJA 1ZPVA 4TYAA 5J2PA 2E66A 2HQCA 5IV4A 3IRXB 3G6YA 3VAGA 3BPDA 2PFFB 1FNOA 3D3CJ 3BH7B 2HEKA 2DHXA 1IKWB 4PR6A 4DG1B 1DQ9A 3JYTA 4USVA 3BN4A 3BS9A 5K8OA 3KK2A 2VQEJ 4A8QA 4M5DA 3R1HA 1PYSB 4ZJQA 1NJIT 4UUXA 5CQGA 2E9ZA 1FXLA 3MMAB 2E5HA 2OTLS 3UWTA 4H4KC 2P9CA 2L9NA 3M6UA 5FD1A 3UCUP 2YH1A 1K73T 1I94J 1NK8A 1U1LA 3HPOA 2J6UA 4K0KF 1TL3A 4DUYF 2KFNA 4NOHA 1FWPA 2GCFA 3J7YU 1J27A 2LQJA 3DOLA 5IT9U 4DV1F 1UETA 2W2PP 4KPCA 4CDIA 3W60A 3MWBA 3GILA 5DG8A 4FF2A 2WONB 3RW7A 1OSDA 1JLEA 1YGYA 1GNKA 2YWEA 2ZBRA 3MEEA 2RNEA 3H59A 2XM3A 1H98A 4NLXA 2CJ9A 2XMKA 1V3SA 1KN6A 2OPRA 4WIIA 4DV5F 4NZ7A 1RWWB 3W1YC 1FRMA 1N4LA 2AJQA 2K06A 5E3CA 2L9WA 3W5YA 2OI2A 5SUHA 1BMQB 2XWXA 5MAOA 4N56A 4K4ZA 1NNDA 2IRXA 4DDFA 1NXIA 3TEGA 4WE1B 2FVRA 1FXDA 3NOGA 2RIJA 3BH6B 5DGBA 1MMDA 1RHJB 1VBYA 2XLKA 4YY3J 1EQMA 4AYBD 2MB0B 2KXHA 3DMJB 3HLUA 4XPCA 2OTJS 5ETVA 2O1PA 4ZCKA 2KJVA 4ZJLA 2JEFA 2CADA 5DQIA 2XI3A 3L09A 2K2PA 2CVIA 3VQTA 3J80Y 3I82A 1U6BA 2HKEA 1H0HB 2OO4A 2IPOB 3N0VA 1YK9A 4MH8A 5EHHA 4TU7A 5D78A 3MPUB 4FKXA 2JLEA 1WF2A 3DOMA 1HBUB 4OZ2A 1MN9A 4ZVSB 2ZBCA 3C6UA 2J9CA 3J80U 3GV7B 3LANA 2ERRA 3BN7A 3MR6A 1F9HA 2BE9B 2DR6A 3KK1B 4WYLA 1U4BA 1TK5A 1OIAA 1I94F 1R43A 4IDKA 1Y5NB 1FCAA 3NGUA 3NRBA 4PQUA 2I5JA 2I8EA 2AGQA 4TQRA 3M8ZA 2EKYA 1SJ1A 1RLCL 4Y6IA 4I1TA 4QR0A 1JLBB 1KLMA 2NZCA 2F1FA 1P6TA 5KFMA 2VPYB 5AJ3F 1QDUB 4PUOA 4CH1A 1PSDA 5ETKA 2VA2A 2JSXA 5E2QA 2VIHA 2HHSA 2CQPA 1HHQA 3BGLA 1TUVA 2NSBA 1HI0P 3MR5A 4FDFA 4M63A 1O5JA 2V8HA 3IGVA 1IKVA 2JEJA 4R5PB 3G6XA 4ELVA 2KO1A 1GK8A 2RB7A 3JAMU 1JLGA 2JH3A 1P1TA 1AFIA 1HPZB 1QTMA 1DQ8A 2ZNZA 1DTTA 2PSZA 3HHKA 1X4EA 3P45B 4RWWA 3SQGA 3H5XA 4NLPA 2RD5C 3TVZA 2CNOB 4Y34A 4NLRA 4NLWA 1TELA 2BE2B 1HYSA 1VQNS 1HBUA 3K0JA 1YBTA 3CDBA 3SSSA 1N0UA 4PRFA 4CZCA 3M7VA 1N36J 2XI2A 2X1BA 4KKOB 3HJFA 3HSDA 4MKYA 4FF3A 3DFEA 2IDLA 2V5HG 2DKOB 4ZPDA 1JJCB 1IKXA 3RYLA 2E9RX 3BKUA 1YBUA 3R5CA 5I4MA 1Q1KA 2CQ0A 3NLCA 5U47A 1IUJA 2XSJB 5LJ5Y 4J9KA 1F3FA 2IMWP 4IUFA 2KYXA 1RE1B 2HLUA 4LR8A 3AB2B 3N28A 4OZNA 4O3OA 3GIMA 4ZVTB 3D4JA 3F41A 2VJUA 4LF5J 2V4JB 1JLBA 4G1PA 5DO2A 3JXOA 4J9VA 2J8AA 3CVKA 2HPUA 1WORA 3KJQB 4JV1A 5IS2A 1PC5A 1ZAWA 3CJ0A 3V6DA 4DSEA 3DGPB 2MGZA 4PG6A 1IQTA 3BSAA 1KVJA 2F4FA 4AXIA 3QZ7A 3M1VA 3VAKA 4DF4A 3PJXA 2FVSA 4XDCA 3IS9A 3MMCA 1LOUA 4CWBA 1FRLA 2DEJA 4DL0C 4WU2A 1GTHA 5GAGU 5K8PA 1NDPA 5LT5A 4AL6A 1WOOA 1R6YA 4I67A 2BRKA 5EWEA 2XS5A 5HROA 1YBAA 4KR0B 4RW9B 3RUBL 4LSZB 1CJUA 2DH8A 4KJIA 2V8PA 2J6TA 2HVHA 3HVTB 3BKTA 2F63A 4RL1A 3H4DA 2HYIB 3BGRA 2B0GA 1UVJA 5L38A 3W62A 2RJZA 3ZTQA 3ZC4A 2JNJA 1HWUA 1E6YB 2OD6A 5A76A 2NUHA 3DXBA 3DMJA 3GYGA 4JBCA 1HQ2A 4ZP7A 5KG1A 1OPZA 4ENOA 2AQ4A 4ELUA 1UTAA 2UVVA 5IM0A 3NS7B 3B4MA 5A8WA 3I56S 1JXEA 1W25A 3SFGA 1TV6B 3HM9A 3NNCA 2X1AA 2LVWA 4K50A 1ZM9A 1X4BA 2BJDA 2V68A 3BBFA 2BANB 2DT9A 3GE9A 4ZVUB 4YMEA 1G4CA 2KM8B 3OUYA 3M8SA 2C1EB 1Q7YT 2VH7A 3M2UA 4ZLPA 1LW0A 4M5NA 1PCAA 2YNGA 3BPSP 5C42A 1T3OA 2FJEB 2MKCA 4N8OA 5F0UA 3UFCX 4Q5VA 1URNA 4FXWA 2V2QA 3GJSB 5KFUA 4DV5J 2K3KA 3KK1A 3SDEA 1N52B 4F0KA 5E3AA 2VQFF 2QTWA 1XMQJ 4DSLA 2YWFA 1QVGR 4PQUB 2RU3A 2AIRB 4ETXA 2LECA 2FB0A 1MROA 2HK2A 3CJKA 2MQNA 3QAUA 3K2YA 1IQZA 5A8RB 2IA0A 5CYMB 4NYPA 3MM5A 2CQHA 2EFVA 3H25A 3FGVA 4DFJA 2R2SA 2YKPA 1IBCB 3I55S 4ES3A 1R8HA 2AP6A 3U1NA 4NEZA 3QIPB 5F9LA 2XC9A 3KLIA 3AXKA 5KFDA 1LFPA 5KT7A 2C2RA 4FBUA 3PVXA 2ZDPA 3HHLA 1S49A 2YWGA 1FRIA 4RW8A 4YR0A 1RA7A 2OMOA 3I9ZA 3ZTOA 4JV0A 4AFFA 4X65J 3CCJS 1FKPB 1RBOB 3CUNA 4CLSA 1SC3B 4ZPBA 3T1AA 3W2WB 2E9TA 1TR0A 4O3QA 5HVGA 3J7A1 2EBEA 3IM8A 1PKUA 2ZH2A 3V6HA 3FEZA 4J91A 1VQ5S 3VAIA 3P5BP 3BM7A 5AXMA 2BM0A 3SSRA 3OTCA 3VGSA 3KLVA 2X1FA 5ETQA 3PYEA 2IBOA 4WIQA 2M3DA 4LSLA 1UFLA 3MAQA 2NREA 3MCNA 5L9NA 2BM1A 5A6WA 1LWXA 2RU9A 4EGLA 1SIZA 2FIUA 1QAIA 1Q86T 3WC2A 1OWXA 2M9KA 2RE1A 2W2OP 4V1Ak 3TX0A 5C25B 4A8YA 2JLFA 1TK8A 4FYDA 1IKXB 1T9VA 4DX6A 1S76D 1X4CA 2XZDB 2YKMB 2KN4A 1O51A 2K1RA 2XSJA 1RTZA 3KK2B 2IJNA 4DN0A 3EPGA 1SCJB 4K5SA 1B4SA 2PC6A 1M1HA 1U26A 2FC8A 3NG8A 2CQ2A 2O01C 1SJQA 2PE8A 3NP5A 3OTEA 3Q8VA 4NLOA 4O3SA 3C8YA 2H54B 4ID5B 3PFOA 1S9EA 3H98A 3NNAA 2I0XA 3OV7A 1U47A 4NCBA 1C0TA 1JLCA 4LR9A 3MPDA 3P49B 3L7PA 2MGZB 2KT5A 4X62J 2OPPA 4CNYA 1X9MA 5B09A 2XCPA 1FERA 5L1IA 4LSNB 4LF4J 2JL9A 3FDSA 2QIFA 3MDFA 4HTIA 3TUZC 4F3OA 4S0MA 3AQOA 1NO8A 3NGDA 4DQIA 1JLFB 3PYFA 2Y8WA 1RTIB 2B5JB 1UAWA 3ZTPA 1VQ9S 1EETA 1LEOA 1SQEA 2GQ2A 3OQ2A 4RUBA 3QJJA 4OJ1A 4LF8F 4L74A 2DNKA 2ATCB 3BGRB 4HR2A 1BC6A 2XO7A 2DXFA 4WP9A 3MM6A 5HK4A 1HNWF 5CXTA 2CRLA 3PZPA 2CNKB 2CVEA 5HANA 2M2BA 3BSNA 1WDDA 3CE8A 3LA0A 2LQ5A 1RT3B 3FNNA 3ILOA 4ILRA 2DHGA 3TWZA 4X65F 2E5IA 3CMAS 4R0JA 4WE1A 4C3LA 4QIFA 1S72S 1YJUA 2Y0SD 1UZHA 2IIHA 3P4UB 4DCPB 2HHUA 2RMLA 3UO0A 1T05A 1TK0A 5HAOA 4KPYA 4XIUA 3ZZTA 4X4VA 3G87A 2H5EA 3CJ2A 2B8QA 2KJWA 2FD2A 3EGWB 3ILLA 4Y3CA 4UZBA 2DXDA 4J9SA 1HHSA 3AOAA 4LRDA 1Q16B 3K59A 1FHTA 4WP8A 3AQPA 2DRAA 2FGOA 1CBKA 3BR8A 4DUZF 3NKYA 4ECUA 3CWJA 2FJWA 2E7VA 3THTA 1B0TA 2AX1A 1RAOA 2ACYA 2GX8A 2KB2A 4YDXA 5AT1B 1TAQA 1YG0A 3G96A 2FLNA 4WFNQ 4NZ6A 1RP5A 3HFVA 2XHWA 3CPWR 4EYIB 4CTAB 4FF4A 3NL0A 1TKTB 1U1OA 1UJ6A 1DFDA 2AJ4A 2FLOA 4RLEA 5HVHA 3NCPA 4MT1A 2QYGA 4LF9J 2C2OB 4LIRA 3R3TA 3W7BA 5IFMA 2CPHA 3KLIB 2IM2A 5KFYA 1RT7A 2QEXS 5KG5A 5K8MA 2MKYA 3LP2B 4NI2A 4USUA 5E7OB 4R8UA 3TJ9A 4RW6A 1RT5B 5KFWA 3Q8UA 2Z8QA 2BX6A 3PHTA 4WTOB 1HI8A 4HDGA 4LF4F 3QO9B 3PTWA 4NCGB 4UY8T 4LFBF 3GONA 4J5OA 1S1WA 1D0EA 4MK7A 1Q8IA 4IYQA 3I0RA 3IP0A 4MKVA 2CQ1A 3CCMS 1VHFA 2DGQA 3GYXB 3DLLQ 4GKKJ 4MJKA 2R4FA 2G1HA 4PPZA 3M8QB 4DV6J 4CQ1A 2C3PA 3OL6A 4A8WA 2FYXA 3PXGa 4NWBA 2B9XA 2W01A 1MWYA 3KLEA 4EZ6A 2CPEA 1JLQA 1TL1B 1HWJA 4DX8H 2GJIA 4KQZA 4JI2F 5HQ8A 2MQQA 1DQAA 4LRFA 1VFJA 4NXNF 3D66A 2MQMA 4PG4A 3DOKB 2DK2A 3CDUA 3G82A 3P5TL 3ZZOA 5AE1A 4GC6A 2X7IA 2IYGA 4KSEB 3GSIA 2XMJA 3RGIA 2I2YA 1EZZB 4NLDA 7AT1B 3R7NB 3O8WA 3GIJA 4X66F 1QAXA 2OEMA 1JQGA 4P7VA 2K7KA 4TYBA 3OJSA 1X8DA 3OVSA 5KG0A 4CYUB 3MUMP 2XY5A 2UU9J 1Y5IB 1B3TA 1TKZA 1RHKB 2KYZA 2OFHX 3C14A 4DV4J 5J2MA 1UPPA 2KKHA 2ROPA 3ICLA 3LP2A 5LSRA 5FLXU 1SKUB 2DGVA 2QRRA 3GV8B 3SZ2A 2N4CA 4O4GA 1JK9B 1SC1B 2HIQA 4C0OC 2MQ8A 4YEAA 4WKYA 2Q6BA 2Z2LA 4KGVB 3R7BB 2EFQA 4QWDA 4DL2A 4CI0B 1R8CA 2ALYB 2NS1B 3BZQA 4UUWA 4K4UA 2O5DA 3DGPA 4RNMA 2B7BB 1YJWS 4IDKB 1NKCA 4FBTA 4JV2A 1LKZA 3N5FA 1BY9A 5F8MA 2L08A 1NSQA 1RAJA 2P8IA 3M8WA 3EJMA 4DFPA 4DR3J 3MMBB 5D0HA 3HO1A 2DNZA 3NS6A 2JX2A 3MM6B 4FNIA 1T9XA 4C8OA 2ROGA 2H4YB 1JNZB 1R6VA 4N47A 5KFLA 4PPDA 4FYWB 1RZMA 2ZKUA 4C9DA 4Y2KA 1NDKA 5I3UA 2LXFA 2DGOA 3W9JA 4U9RA 1RABB 3OFEA 4B3TF 1H3DA 1S1VA 3C3LA 2LEBA 2HWTA 1ZAVA 4NASA 2YX1A 1F1BB 1YRXA 2BYCA 4X4QA 2RUGA 3KOAA 3BR9A 3MUVP 2HURA 3V6JA 2GGPB 1F2GA 3I5BA 2BA9A 5A8WB 1DJ0A 3W9IA 4JI5F 1L3KA 4V19J 3CJSA 2YBVA 2ZUGA 1NBEB 2ZH7A 4E98A 2Q3PA 4JV5J 4IG3A 4EZ9A 1CQNA 2O67A 5HN0A 1R31A 5K14B 3KJVB 3HT0A 5CCLA 4F4AA 1MW7A 4QWBA 4C8NA 4QU6A 1EQ0A 2IY5B 2JLGA 2DIUA 4DPWA 5T14A 1PGZA 3KDNA 2LP4A 2XMAA 4OMFG 2ZHBA 5IWAF 4YHHF 3GG1A 4HT5A 1U6FA 5IC4B 3SCIE 3TEHB 4BLGA 2J6SA 4X4RA 3JTOA 2OMLA 3FEXB 4NYOA 2JC1A 5HO4A 1RAGB 3T1HJ 1VBZA 2NXUA 1U0SA 4CLLA 3OFGA 3RG6A 3M05A 1RT5A 3M2VA 2HZVA 2VU5A 2DNOA 3SFUA 1RADB 4NX9A 3Q8YA 3DDNA 1JXVA 5CHCB 2ALZA 3OTBA 3PNIA 4NCGA 4LBHA 4TQSA 3V6DB 3Q22A 3PO4A 2BOPA 5BXIA 1FRJA 2IRUA 3EVOA 3W5XA 3OHBA 3T6BA 3SV4A 3QFHA 2QLFB 3TQ1A 1RWMB 3NWRA 3TNVA 2LA4A 1CJTA 4M5IA 1WC3A 3U7JA 1A0OB 2UUWA 5AXKA 1DARA 1XR5A 2N7YA 2ZD1A 2UXDF 3DYAB 2DVIA 1N32F 3W64A 3SCJE 2CQCA 2W9CA 5T7LB 2H5IB 2VBXA 3CDAA 2XLJA 4CLPA 3IN5A 1PJ5A 2UXBJ 4LMZA 1RT6A 3KJNB 3PHEA 5D4NA 2R7TA 1UJ4A 2B6AA 3KJVA 5B0AA 1Q8BA 4FYXB 1AZSA 2JFDA 4AUKA 1CULB 3Q8QB 3K5NA 3DXSX 2E7XA 1I51B 3FRZA 4I2QB 5H1SV 2HS3A 4LFAF 3FRYA 4FS1A 1NK5A 3MEDA 5D0GA 4CYUA 3HD2A 3JSMA 1KFSA 1W7WA 2HS0A 1X4FA 3DM2B 4TY8A 2ZOGA 5EDWA 5JUMA 3I5CA 1RBAA 2DRDA 1NU4A 3CMQA 4OX7A 1ZPWX 2W9BB 2C2EA 2D41A 1REVA 3M2VB 4RBTA 2HRYA 5D77A 2AX0A 5C42B 2EFPA 2XO6A 3SYZA 2VFSA 1D9DA 3R5GA 4WFBQ 3MTKA 3W8PA 5A0YB 4NMLA 3TRGA 1UVLA 3LPEA 1CPZA 2E29A 1GXLA 1WEXA 2WBRA 2G4BA 3P8BB 4KFBB 2LFVA 1ACMB 2K7JA 2E5LF 3MM5B 4ZVFA 1H74A 2R8IA 3PW2A 2HNDB 2D74B 2MMYA 3V5RA 4CLKA 2GO9A 3K5OA 1UA0A 4HKQA 3ET6B 2AYGA 1H2VZ 1DTTB 1T9UA 2V0NA 4FNHA 3HSZA 2U2FA 1FFGB 1HARA 3GTYX 4Q45A 3KHLA 4MKAA 2FHKA 1Q8KA 1WG4A 2Y1RI 4MK9A 2GC8A 3BQ1A 1RAIB 1S0NA 2Q43A 2PT0A 3LWLA 2XGQA 2MXYA 1RKIA 4CCHA 3CIMA 2EFNA 1BWEA 2VQEF 2RHSB 4KRWA 3O2IA 5GMEA 2J7KA 5BYSA 5CA5A 4DV0J 4DR7J 4EUVA 2VG6A 1NB2A 5L8RC 4QWEA 1R0BG 5B0GA 3G6ES 2M8HA 3O44A 2A6OA 2P2CB 3ENWA 4MK8A 4IO1A 1YITS 1I3OB 2IYIA 2LA6A 3CCRS 2VJVA 1HQEB 2CPYA 5D6GA 5KFFA 4DUYJ 4L76A 4FPIA 5IT0A 5J2QA 1FVSA 1JJ4A 4WPAA 1WF0A 4N41A 3CCES 4E0DA 4ED8A 2BQRA 1VS3A 1YRTA 3KK3B 1FJGJ 3T5KA 1KWMA 1NZ8A 1N36F 3BREA 3D1HA 2ZC3A 4DL4A 3R5DA 2CDRB 4ZVEA 4LFAJ 4X4OA 1CG2A 1BUXA 1GFWB 4P2MA 3VALA 3MOJB 1VBKA 2V8GA 3M1VB 4AQYJ 2DR9A 2EVZA 4RU9A 3QNWB 3PACA 4X64J 4NLYA 1NK7A 2XQCA 4ZPVR 1Y7PA 4QWAA 1S9EB 2C2NA 5HROB 5B0BA 3OBIA 2KXNB 4C7QA 2GIRA 4OI0A 2DNHA 2BQUA 2UUCF 2H65B 4JUZA 2VF3A 4K4XA 2CZ9A 4RW6B 4JYAJ 3HJVA 2H5JB 1EP4A 3IAM9 2DNPA 2G9OA 2NYHA 2W24A 3L4BC 5G0RA 1Q81T 3FC9A 3W66A 2V63A 4C48A 3PX4A 5KFXA 1C0UA 3RBZA 5M2RA 3JQMA 1RSCA 1WG1A 1U49A 4K8RA 3ZZUA 2XB2D 1CJVB 3DGVA 2CPIA 1NHUA 1F60B 5HP1A 1ZTTA 4F2SA 5DRKA 4LT6A 3DRYA 4LF7F 4A8FA 1TL7B 1QUPA 5A6PA 5CYJA 2VHGA 4H4OA 4KGZB 4DXLA 2MKKA 3V81B 4HEA9 3ISND 3MAHA 4NLSA 2L41A 4P2XA 3NNHA 2QFJA 1IBKF 4YHHJ 1U2CA 3F73A 2HHHJ 1K0TA 5JVGQ 4NRTA 3S6EA 2J5AA 2QSFA 1S4EA 1S6OA 2QO3A 4P10A 1BLUA 3TUIC 5KFBA 1WTBA 2IC3A 2MYFA 5L9XA 4B3OB 1KOOA 2JRSA 3PG9A 2VPXB 1U1KA 1VRUB 2HNYB 2CPZA 2J76E 2BKOA 3D6MB 1O8BA 4U96A 3UDVA 1S48A 4CO1A 4Q44A 4NEYA 1VYAA 3LP0A 4IFVA 5B0CA 3TVKA 3G8TA 3Q2TC 1SUQA 4I6AA 1RKJA 4PZVA 4ECVA 4QYRA 2UVRA 1XIQA 2DO4A 4OQJA 3RB0A 3DHXA 1PIEA 2ATLA 2B4PA 4ILMA 3GCXP 3IRWP 4O0NA 5FIIA 2H1YA 2RHQB 4XTTA 4I56A 3LTOA 5I3PA 5KOWA 1QSSA 2UU9F 2EPIA 2KHDA 3DOLB 3DRPA 2HWHA 4C11B 3SV3A 4QCLA 1EHWA 2AYBA 5CYQB 2PN6A 3DLBA 2KRRA 1VRQC 1FE4A 2WVFA 2ZITA 1OS5A 4IKAA 1N88A 3CC4S 3MEEB 1RYSA 2UXBF 1YJVA 1KBRA 3M8PB 2RVJA 2VODA 1H6KX 1RT7B 5CAAA 2OPRB 2DY1A 2VBZA 4H4MA 4E2FB 2R2UA 4DSKA 3R9LA 1YQHA 4WZMA 5JXSA 2R7SA 1TL7A 4JI5J 4HHJA 4Z2XA 2DGTA 2AZ3A 5KG3A 3V81A 5J1NA 1FI4A 3VVTA 2V2VA 5DLGA 3JB9k 3ZNUA 1FRHA 3UR3C 4TU8A 3MECA 4I7FA 4B3RF 4DU7A 2J7UA 4ANEA 1CC7A 5KFRA 5KG6A 2A6MA 4WBFA 4KH1B 2VICA 2VG6B 4DV2F 1ROFA 4UOHA 1OYEA 2BJ9A 2VV5A 2QMXA 2D3O1 1FE0A 2K1RB 1SV5B 2NXEA 2VKRA 3FCVA 2B3TB 1C1CB 2GO8A 3CJQA 1HBMB 3ZZPA 2HGLA 4FXVA 3CMES 3CCSS 3WC0A 1A9NB 1B7FA 3OXGA 5KFZA 1TKXA 1SUQB 4K4VA 4DR2F 9ATCB 4ED0A 2MSSA 4HHHA 5DZ6A 4BHQA 5H9FJ 3U02A 5J2PB 4B9NA 3T3FA 1AA1B 1XN9A 3OD2A 2WOMB 3LALA 4HVZA 5DDQC 3OW2R 2E5LJ 4DQPA 4IG3B 2D69A 1UVKA 3CD5A 3DOKA 2HIYA 2KI2A 2P9EA 1RTDB 3HXMA 1MMNA 3FVYA 4IG0B 2LLZA 4I6YA 4M5DB 2VFTA 2H48B 1XEZA 3GFXA 3UD5A 5LOQA 3EX7B 2ASDA 4UT4A 2QGFB 1KQFB 1FESA 3TO8A 3AODA 1RACB 3DC2A 4B02A 2HGMA 2ZFHA 4X64F 2XGPA 2ZHAA 1T9TA 2FY1A 5KFSA 1KC8T 3C14B 3DN9A 1C4CA 3PDNA 4FP9A 5D0RA 2W7PA 2ASLA 1EETB 4ECXA 1WELA 3WIVA 1WKKA 4WFAQ 4DPUA 5B0FA 1LWFB 1N6QB 4DL7A 3C66A 1M5SA 4PQAA 3V4IB 1T3NA 3LGHA 3C19A 1T03A 2AZ1A 1R0AA 2R7VA 1EP4B 2EG2A 1BE4A 5KFEA 3EDRB 4OI4A 4L6V3 4JI0J 3HK2A 2YKQA 1BQNA 3D67A 3TW0A 4Q43A 3OR1A 5HL7Q 3E2EA 3IG1B 3O1LA 3GV5B 4D3GA 2NZ4A 1T02A 2VOOA 5HMWA 2YNHB 5D4LA 3QATA 4PWWA 1HNIA 3BV8A 1CJTB 1R0CB 3PJ9A 1UEUA 3QYYA 4FPRA 3BSOA 1H2UX 5GAGI 3GIKA 2HG4A 2GFFA 2G0JA 1JNRB 1MMLA 1KQKA 4IH6A 3AD7C 5KFTA 3UDLA 4DEZA 3R1LA 5DM7Q 1JLGB 3PY8A 1WI6A 3QSIA 2NPFA 4B08A 3QGHA 2IJRA 1S1XA 5ETLA 1T9WA 2EXUA 5C24B 2VC1A 3SQOP 2LCWA 5DQHA 2VZ9A 4LRCA 1YHQS 5J1EB 2V9WA 4QOTA 3QJLA 2F9JA 3ZXWA 1IM6A 1ELOA 1JMTA 2MZTA 3CT9A 4N5SA 1R3NA 2XMTA 3G9CA 2JFKA 2VQFJ 2IVFB 2RQKA 3OJUA 4F0MA 3AD8C 1D9FA 3HSJA 4V19X 2C3UA 1Q8LA 1X9SA 1N34J 3CW2C 3QWPA 1XK8A 1HNXJ 1T8EA 1RYRA 1RAAB 3JQKA 1TMMA 1N5SA 2LYVA 4AL5A 2N4DA 3HVWA 2O3DA 2W9BA 3TARA 1UCNA 2QJ3A 1XNRF 3LGNA 1AUSL 3B8HA 3TQEA 3V4IA 5LMUJ 1BHNA 2FZCB 4ANCA 4C11A 1VQPS 2D3OR 1T03B 4BC7A 1AXQA 4BBYA 3LWMA 5F3ZA 4KIAA 3FMBA 1DURA 4HT7A 4KBIA 4P2SA 5KFPA 1S1TA 1B99A 2PMHA 3PM9A 4J90A 3LAKA 4KO0A 4J9NA 1VLOA 3LQVA 3OR1B 4JI7F 5GADU 4AT1B 2V4RA 3C16A 3U1MA 4OX9J 4FVMA 4F4ZA 4ECZA 1X60A 2ZZNA 2IHR1 3MI7X 4W92B 4LRAA 3MGJA 2ZM6J 3JTNA 4ZN3A 3M8QA 4B3MF 2EWHA 1XMOF 1Q82T 1JLAB 2ABYA 4NXMF 1KHWA 1PBAA 1RTHB 4DCOB 4DSIA 2BRLA 4LVNP 1FF2A 3O5TB 4P9SA 2GJFA 4NLQA 5KFNA 1U25A 4PUOB 1D3WA 3KLEB 3PYDA 1FT8A 4P7TA 1VQ4S 4JI0F 4G1IA 1FK9A 1N54B 5D4PA 2NXNA 3IWLA 3H0PA 5C24A 3UN2A 5A8KB 4CM2A 3MR3A 3CCLS 2U1AA 1U1PA 3D54A 4I0WA 2HQ3A 3FEYB 3PR4A 2YNIA 2OP5A 2GJ2A 2ZVIA 4CO2A 2YNFB 3HHDA 1NLKL 3R5BA 2W8KA 1TKXB 2WW8A 2D9OA 5IOLA 4DU8A 3TVYA 1QE1B 4QQBA 2Z58B 1KQGB 2MLXA 4F3QA 3GMGA 4Z37A 3AHPA 1S79A 3NEKA 2PMZD 2UV8G 1HR0J 2ASYA 1HQEA 5C2CA 2F5GA 3MD3A 1H7XA 3OUYB 5L1LA 3OVBA 5KTQA 3CC7S 2XNRA 1J2VA 2B7CB 2HHVA 2QV6A 4NLUA 4FZVA 3DI6B 4H54A 4P72A 5JVHQ 4ECYA 4DPTA 2OGUA 2ZH8A 2XWYA 1S0VA 1RT2A 3TJ8A 3I4PA 1RHQB 5L1JA 2YXLA 3DM2A 2VD3A 4TY8B 2H4WB 1AROP 1NKBA 1N34F 1SC6A 1HNXF 1VISA 4USIA 1N6QA 4YP3A 5CYMA 2QMWA 3MZIA 3RZAA 1N33J 4I64A 3B6BA 3BGFA 3L7OA 3ETMA 2N3OA 1OYDA 3NGSA 2DR8A 4BDPA 2Y9HA 1TFYA 1JJ2R 4PYAA 1X5OA 2FPHX 3HFKA 3HI9A 4EYHB 3DRRA 2YTCA 2P9GA 4G65A 1BQNB 2OKQA 1FDAA 1JX4A 2CQDA 1JKHA 3VF0B 1H38A 4A48A 3L9ZA 3V6KA 3MCSA 4QIVA 4RW8B 2QLBB 2UV8A 3NMRA 4DV1J 3CF5Q 4ED5A 3TI0A 1Y9OA 4X4NA 1HIYA 3IBFB 1ZTWA 5JMNA 4WCEQ 2ADBA 2Y1JA 3CCTA 1MG7A 3BYPA 3M8RA 2NQPA 1FVQA 4EBCA 3P3DA 1HW9A 1URRA 3MPYA 3RBDA 2RAQA 1IBMF 2OELA 1M0SA 2R2TA 3DRSA 3TR5A 4GKJJ 3Q83A 4RNHA 2HAIA 2BKNA 1E6YA 3CEDA 2CQGA 3GSDA 2IAJA 4DZ6A 5CABA 1IKYA 4LF9F 2EG1A 4KH0B 2FLPA 3LPYA 5GMDA 1FNMA 3BSCA 2HHXA 1U6ZA 1C1BA 4DFMA 3OTOF 2UUAJ 4OFZA 3NGTA 4MIBA 1XMBA 2NPIA 4HH0A 4OJHA 3K57A 4QJVA 3DLEB 4P75A 3DLGB 3QIDA 4O44B 4OHWA 4M5MA 1G3OA 2A2DA 2E5GA 4LFBJ 2A10A 2MJUA 4GC7A 2LMIA 3KLFB 4DUTA 1KEKA 2ZC4A 3WDOA 3I4HX 1R8PA 4W90B 5BYQA 3VCDA 2AD9A 1KLNA 1S1TB 1JLCB 1H73A 1K47A 4ZJOA 2HRTA 3SDEB 2FVPA 1TAUA 2XBPA 2BXJA 4IRKA 3QPIA 2CQBA 3MFHA 2OPPB 2OHDA 2DIVA 2IFXA 3KG4A 2AGOA 2FHJD 4UQGA 1EAYC 4OJGA 4RW4B 1DTQB 4A8KA 5CYQA 2R7XA 1N5VA 4X4TA 3RB6A 3T5HA 1X9WA 2FLLA 2ZD1B 2ZUAA 3AOCA 2VFVA 3GLJA 2X3GA 3GWCA 3MAAA 3QIPA 2GVDA 4F04B 3M8PA 4C6AA 5HI7A 3CCUS 1NPKA 1YIJS 4GO5X 1W26A 2FGCA 3JS9A 1FXRA 1CSJA 5HATA 1RT6B 2G0IA 2WB1D 3AB4B 3HKWA 3OSNA 1UVMA 2N3LA 3PV8A 2IAJB 2YNFA 1XBWA 2DJWA 2HLTA 5CD4A 3ZZZA 4ZCLA 3Q2SC 3BYRA 4KB7A 4NA3A 5E3QA 3A1YG 3KMSA 1K8AT 3MEDB 5IT9Y 3JSMB 3NGKA 2GS8A 2YPYA 2GVZB 5LMUF 1TU0B 3TZZA 1E6VB 3PCOB 3WZ0A 4RUCA 3K8VA 4QR2A 4O44A 1N5YB 1VJQA 4EO8A 2DD8S 1HBMA 4QIEA 7FDRA 3BO2A 1UA1A 2VG5B 1FFWB 2FVQA 1REVB 3SEOA 1D8YA 1VQSA 2WSFC 2LQ8A 3N79A 4CRJA 3CJ5A 3FBEA 4OX9F 1NJXA 4JI8J 4DJBA 1VQYA 2QYCA 2VBYA 3B54A 3Q8SB 2OFGX 2FQQB 1HI1A 4DR3F 2GAGC 2XY7A 1HWKA 4OZJA 1UW4A 2P5VA 4L75A 1D8ZA 1WSVA 2BBEA 1X0PA 4ZKAA 4WFZA 2BVZA 3LP0B 5ETSA 2M52A 3AXMA 2MLYA 4O3NA 2QA4G 1DTQA 1TTHB 2GZOA 2VBWA 1P8GA 1VIXA 4H4KA 1YVFA 4ID5A 4IH5A 4XK8C 4ES2A 5J2NA 3TYTA 1GEHA 2RRBA 1YJNS 2FJVA 1C0TB 3QBCA 2J0QD 1NDCA 3DNCA 1FRKA 2JJ4D 4M94A 3V4MA 1LWFA 1NPRA 1BXNA 3CJRA 3IC1A 4TNOA 4K5RA 1A7GE 1A6LA 4OZ5A 1U1RA 2J0SD 3BGUA 3MCOA 1HLWA 3J81j 1WC0A 3RR7A 3VAMA 1N48A 1UPMB 3L3CA 2C22A 1AT1B 1T95A 4H4MB 4O4RA 2E44A 4DX5A 1N5TA 1I1GA 1KFDA 1YDLA 3FCHA 4MYTA 4MIAA 4OYPA 3FK4A 1OY6A 4HHUA 1KONA 4OI6A 2XCAA 1NEEA 3ILIA 3SMZA 1C2PA 1F5CA 4QIGA 4JV5F 2KXFA 3OVAA 4RU2A 4DG1A 1YJTA 1TL5A 3M6WA 1SJRA 3T1HF 1TMJA 1EKRA 1QY7A 3J81Y 3ZZYA 4LR7A 2L48A 2LDYA 4B9TA 4DS5A 3K89A 1IKWA 2HVZA 2V8DA 5HQLA 1FWKA 3DLGA 2IVMA 3KJFB 1NAQA 4OV6A 4DL5A 1Z1ZA 3BBBA 2PGCA 2W7OA 4DR4J 4ZVOB 1HD1A 3TAPA 1GTEA 4QIWD 1U45A 4PG7A 2SXLA 2RUSA 4M5JA 2LEAA 2OIHA 1NSKL 4QWCA 2ZE2A 4HDHA 1UVIA 4JB8B 3SIPB 3Q89A 3Q0AA 3PW5A 4NCAA 1HD0A 2R8KA 5G4DA 2C3MA 3CDWA 2MJNA 2KZMA 1S99A 4CT9A 3WQPA 2MKIA 3VV2B 2UXDJ 4RW4A 1Q53A 2H9ZA 1JIHA 2WONA 1U8SA 2LU2A 4PXDA 2W1BA 3IFEA 4RW7A 2OH2A 4OIXA 2ZBPA 1YJ9S 4KGMA 5KAKA 2DTJA 4NL5A 2AEMA 1IBMJ 4DLEA 2W7AA 1R7IA 4QPTA 3KLGB 1O6XA 4ZA1A 3UCGA 1N32J 4QYZK 3IR5B 3C15B 2CJYB 2EFOA 3QLHA 4QZVB 2GAHC 2Z57B 2EEYA 4LFCJ 3R2CJ 1RHUB 2JC0A 2DB1A 3A8IA 4H4OB 5AXNA 3OTDA 3QO9A 3N01A 4TXSA 4ED2A 4IR9A 1S77D 4ICLB 3DCAA 4F67A 1HQUA 2OEJA 3E01B 1FK9B 2J0WA 3TZWA 3UDCA 1R27B 3J7YI 3W65A 2X3DA 2P6TA 5A8KA 1PG5B 5GAHI 3BQ2A 2DXEA 1YI2S 5F8NA 1LK5A 4K4TA 3X1LB 4NLTA 3H20A 2CIMA 4F0HA 3KNGA 1VOMA 1HBOA 2CJAA 3R2DJ 3G8SA 4PABA 2RDIA 5HSPA 4DPYA 4CNZA 4K4SA 2HFOA 1UJ5A 3C6UB 3IR7B 3ZTSA 4U8YA 2MDAA 3B78A 1MWZA 2BQ3A 5KFCA 2JEGA 2AMCB 5LSOA 4TN2A 3NCRA 2FDNA 1NCLA 5THWA 1VQLS 1F6TA 2XSFA 4K2XA 4F25A 1ZZNA 4HI2A 2OUGA 3I31A 2QE5A 2HBQB 1YZ6A 4WXOA 1JXLA 4RW7B 2ZJPQ 3TZXA 2D9PA 5K8NA 1GXUA 5D4OA 1NK0A 5E3PA 2NCKL 3D1OA 1HWIA 1IWGA 4ECTA 1SVDA 1FKOB 2JWNA 1HBNA 1NUEA 2V9KA 3JTPA 5A2QY 1WTFA 5E5NA 5M2PA 2VONA 1VRTA 4RBUA 3QQCD 1M1GA 3EZOA 4MFBB 4PAAA 5ADZA 3H40A 3D2WA 2ZH4A 4MTPA 2Y0BB 1KQSR 5I42B 1DAXA 2CJXB 4A8MP 4OX8A 1L3UA 2BW7A 1B64A 2FHOB 4DQSA 3IGNA 1HW8A 4WFYA 4ICLA 3B4DA 2CWXA 4ZS6A 4J9RA 4QPXA 3ETOA 1N56A 1L3TA 3G2XA 1GMWA 4R0EA 1SXLA 4LBIA 5IV3A 1RLDA 4MAKA 2R7OA 4OHXA 2MHEA 4WK3A 4NA1A 2RRNA 1GH8A 1NRKA 1TVRB 2ZH9A 3CCWA 4G1QA 3H90A 3QRRA 3EXYA 4N7TA 3AJDA 3OT9A 1K1SA 1Q5VA 3F0NA 2Q1LA 1U1NA 4G3IA 1RTJB 3M2RB 1LV5A 1FD2A 2IA6A 1S6QB 1HPZA 5BR8F 2W2MP 4A8SA 4USTA 1FA0A 5K20B 4F4XA 2CQ4A 2C42A 2B8PA 3LP1B 3DRXA 1RWUA 3H42A 5DDOC 5KFGA 3X3UA 1ZM4A 1TQLA 5CZVA 2GQCA 1KVKA 4YY3F 2AT1B 2B6AB 1UKUA 4OYXA 3NXZA 3D0IE 1IR0A 3VR1A 4C2MA 3HT3A 1NZAA 2ZOMA 5KFQA 4NE9C 1KP6A 3EPIA 2YKNB 2M0GB 2PFDA 2YQ1A 4I69A 1PC4A 5D15A 2EW9A 1NH7A 2XYHB 3NS5A 3UVJB 3RB3A 1FDDA 2V34A 4RZRA 3HVAA 1WC1A 2V4JA 2CPDA 4OX6A 4ED7A 3QMQA 1YJRA 3KG0A 1VRTB 2VL1A 2Z0GA 3ITHB 4O0IA 2W4PA 4UY85 2ROEA 4RJVA 2DH7A 3K17A 4Y2MA 1R0AB 1SQFA 4DR1F 4FYYB 3DDIA 5LL6d 2YQ3A 3US5A 1O0PA 1WUUA 3R5AA 1KD1T 3MMCB 1HHTP 2R8GA 2ILZA 1RGVA 4W98A 4DOZA 4CO5A 1J5EF 3D68A 3Q8RB 1ZETA 1RI7A 3EZUA 5IZHA 3AOBA 4HACA 1HNIB 1WOSA 1RTDA 1K44A 2RILA 4DZDA 2HHHF 1TVRA 2AJ0A 3A8EA 4NRUA 2MZSA 1MN7A 5BYRA 3ZZRA 4LF7J 1OQ3A 2M70A 3ISNC 1PYTA 2OSRA 4OI1A 3MOZA 3DRRB 2IM1A 5F9NA 5DM6Q 3DLHA 4B9SA 2R9LA 2W4DA 2XLIA 2HBRB 3BO3A 2B9EA 3S8SA 1OSCA 3D0HE 3HFZB 4NYZA 1VQ7S 4NLGA 2W8LA 1M90T 5EGYA 4DR4F 3D3BJ 4JP8A 1RT1B 4K0KJ 1Q79A 4J9PA 2PIIA 2C2MB 1L3SA 2B4OA 2NLWA 4D3HA 3DYAA 1U1QA 2MTLA 3N9UC 2CA9A 3A3OB 5AE3A 5KT6A 4PXBA 4PG8A 1Q95G 1LXJA 3AFGA 5HQMA 2Q66A 2A2CA 2RRAA 1SL2A 4GKKF 2P6SA 2HFZA 2ZEJA 1TL4A 2DHAA 5KG2A 2UUBF 4QYZJ 4WP3A 2BANA 3VZHA 1AZSB 3MCMA 2BJEA 2OD4A 3M2UB 1LW0B 1VMBA 2HFSA 3D0GE 2ZJQQ 3KFWX 5LMNF 2WTFA 2OPSB 1FNXH 1FDBA 2I38A 3TAMB 2D3ZA 2ZHOA 1FTRA 3ULHA 5CCMA 2DR7A 2E1MC 2DNGA 3I5AA 2HMIB 2CDQA 3CULA 2KTQA 3DLEA 4DL3A 1LW2A 2B43A 4FVCA 2Y3YA 3NGRA 3S7RA 1X7VA 1RK8A 5A8RA 3KNAA 3IM9A 1X0FA 4DBQA 1QVFR 2C2DA 1U09A 4X66J 1J5OA 2KRBA 1HMVA 1GT8A 1RTHA 1Y3KA 1RT4A 1KTVA 2K3IA 2LEPA 3C6TB 2VUGA 3G86A 3MPWA 4K2JA 5EX3A 1RWPB 5GAEU 4O3PA 2BOAA 3VGVA 5KG7A 2VPZB 3UW1A 4WJBA 4A8OA 1XNRJ 5EUHA 2PEBA 2PI5A 4IFYB 4P52A 1NJYA 1RBLA 3D1QA 3RW6A 1FKPA 1VGYA 1P9YA 3QJPA 1VQ6S 4JI1F 1XMOJ 4IQMA 1G6BA 3FCWA 3FQLA 3Q86A 3PO5A 1MSWD 1ZH5A 2F65A 4Y2IA 3ET6A 4HTJA 2I1RA 4L72B 2C3YA 4IQXA 2RSQA 2E5JA 1Y00A 5F3TA 3RRGA 3ZTRA 1PO6A 1KSPA 3MD1A 3HHNB 3E8OA 1WWHA 3ENQA 3OFHA 2OSQA 1AYEA 2YKMA 1P1LA 2G2ZA 2POKA 3UVJA 3I32A 4WF9Q 2MEWA 3O6QA 3F44A 3TAMA 2IC3B 2GVZA 1RCOB 5ETPA 3VQSA 2QSWA 4N77A 4OLPA 1HNVB 4LF6J 1RJJA 2BE7D 4CIOA 3JSRA 2W2QP 4CT8A 2HAFA 2F40A 3RBXA 5KT3A 2MZ1A 3A8KA 2IM0A 2DGUA 4UZCA 1FX4A 3EDQB 2RQ4A 3QT7A 1NSAA 4AD6A 4USKA 3EMTA 5HJXA 3UPFA 2X51A 2WVDA 5D0EA 3PKMA 3MF5A 4KV8B 3RAMA 4CH7A 2VASA 4ELTA 4IH7A 1YSJA 2UVWA 2GMLA 3W61A 4R25A 1HR0F 1X5SA 1XQIA 2A18A 4LSNA 4Q2MA 2E1RA 5E33A 3FBCA 3E51A 1YKWA 2BJ7A 3HZEA 1PJ6A 5MLCV 1N33F 1LNQA 4J9UE 2CJKA 3VAJA 3M6VA 1T9YA 1S0MA 3M30A 4CP5A 5F8IA 5IWAJ 5CH7B 3QGGA 3K58A 3KLGA 1YWXA 2KG0A 2RS2A 2VFUA 4YR3A 3PKYA 2UVUA 3N6MA 1DRZA 1S9GA 1SH2A 1VC6A 3MM9A 2KU7A 3DRSB 3H2VE 4TY9A 3PRVA 1M1KT 4KGKA 2KT2A 1MU2A 1AUDA 4DCJB 1NDLA 3UDEA 3T9NA 4XAKA 1LWEB 1NHKL 2VFRA 2G13A 5LJ3Y 1U2RA 3PJWA 1HQUB 3E01A 2B51A 1W2IA 3CB4A 3IBWA 3OFFA 3VVUA 1PBUA 1XR7A 3FBBA 3JYTB 1TFWA 2FTRA 1F3VA 2QG9B 2VOPA 3J7ZT 1T05B 3M4XA 1S6PA 2D3UA 1L5UA 2GA7A 2WSCC 4ZPAA 1V3RA 2V4QA 2B9WA 4MKBA 1HNVA 3HHEA 3KTQA 4B9VA 1QM9A 2YWHA 1REGX 3FBFA 3KWMA 4DV4F 4GKJF 4TU9A 3SBMA 4YB6A 1FRXA 1CJKA 3IA0A 4OHYA 2HNZB 1Y3JA 3KLFA 4F50A 3EXCX 2LXUA 3L95X 3PFEA 4M1KA 4P2FA 5AE2A 1J5EJ 4C8LA 2OPSA 2HFUA 3EZ5A 1ZZFA 2F3JA 4ZPCA 2QA1A 4J37A 4KV8A 4OHZA 1N0VC 4RUHA 2ZM6F 2K8GA 3WIUA 1KTQA 3JSBA 4PEOA 5GVQA 4C98A 2Y1IA 4B3SF 1RUSA 2RKIA 5KFAA 3GG0A 4C4WA 3CD0A 4M8LA 1IWAA 5DS7A 4X4PA 2G0CA 3QRQA 3UN3A 2Z2ZA 2YQ0A 4ERDA 4LQ3A 2GVDB 2EKNA 3C6TA 2R7QA 2CZVC 2XMMA 2DNQA 2OAUA 2W9AA 2KT3A 3BDEA 3OLBA 4EMDA 1V5VA 2VB6A 2UXCF 4M5KA 2DGWA 4QW8A 1VDHA 4UTGA 2ZZMA 3GCWP 3UQSA 3VAHA 5FDLA 2EC0A 2ACMA 1UFWA 1X31C 3ZZ0A 4YR2A 4FYVB 3IWXA 1OPIA 3B82A 4PXCA 2HHPA 4CH0S 5C5JA 3BB5A 1NKEA 3I0SB 3I0RB 2F4VJ 4X2BA 2UUBJ 1VCTA 2LKZA 5F8HA 2MQPA 2DNRA 3FSIA 4I4BA 3HMJG 3MM8A 4LUBA 4ZLJA 3CDEA 4ZN1A 1D1UA 1JLQB 1TL1A 2R7WA 3AJ1A 4DR5J 1X4HA 3GYNA 2ZKTA 1JJHA 4G1QB 1N5YA 4DI6A 1FD8A 4DR6J 4I6WA 3MECB 1LQ9A 3CCVS 1P27B 2OEKA 2HNZA 3EICA 3MPVA 4PCQA 5C7PA 1GMUA 2Y8YA 3A13A 1CEZA 5HJYA 2YX4A 1EARA 2YX7A 3ISZA 4HI1A 1VK8A 4Q0BA 1SPBP 2QC3A 3D9BA 3I9V9 4ZCMA 5J1EA 1QLNA 2RDDA 3GJTB 1MWQA 1CLFA 2PD1A 2FHJA 2F8HA 3O3LA 4PWUA 4IO9Q 2RKIB 3BDPA 2ZZTA 4JI4J 1TKZB 3IAS9 4EBDA 3A12A 3PW7A 4WKRA 4U95A 3TANA 2DCUB 2N82B 3T1YF 4DUZJ 4GVBB 4ZP6A 1S9FA 1K9MT 3CC2S 4ECWA 1KNZA 1X5TA 3OXFA 1KDNA 4FN5A 3OL8A 4YDDB 5HLFA 1U1MA 1WHXA 1V5IB 1IN0A 2CFXA 3AT1B 4IG0A 1SC4B 4Q8EA 4DL6A 4YB7A 3MXHP 4USJC 2IVYA 2VKZG 3POTA 2M8DB 1YTYA 3MR7A 1VC0A 1KR4A 1RB0A 2Z2YB 4KO0B 1NMEB 4FS2A 4OYBA 3SCKE 1Y0HA 4ZP9A 4M95A 1HBNB 4OLOA 1IR1A 4AXJA 2IMOA 1SH0A 4DLGA 2DHHA 4MFBA 4AQYF 2WVCA 3MMBA 3H4BA 3VZIA 1OQ6A 2BJ1A 1JLAA 3MM9B 4OYIA 3QWUA 4B17A 3NMAA 3KUHA 3PRBA 1D09B 1PAUB 2Z2MA 3RRHA 1S1VB 2XY6A 4NA2A 3FUYA 4P74A 2QT7A 3W2VA 5L46A 1FO1A 3ONQA 5H9EJ 2UUAF 1HYSB 4NZ0A 5EN1A 3OHAA 2UZAA 4JOUA 2YKOA 4K59A 3FKBA 4LF6F 3K5LA 3R97A 2M88A 8ATCB 4IRCA 1QJHA 2KL8A 3EYZA 5KFOA 2QX0A 4EBEA 4CLTA 4DV6F 2IBKA 4OJ3A 1WC5A 3H2UB 2XMWA 2UUTA 3PEJA 2ZWOA 4MMOA 3R8YA 4EFAC 2GGPA 4ZVQB 4ES1A 8RUCA 5ITHA 3HVRA 1NJZA 4RX6A 1SBRA 1QE1A 4AL7A 1B7YB 4HL9A 1S1XB 3K8WA 3TA1A 5F8LA 1VQMS 3MURP 4F8RA 3W3SA 5KOXA 4GMKA 3C2PA 4NXNJ 4ZDNA 1S10A 4ECSA 3BGOP 3RRKA 5LM7E 3GIRA 5K14A 1S7IA 3DU6A 3FMWA 3G8QA 1EX8A 1N5QA 1IR2A 2GIFA 2PMWA 3M32B 2QL7B 3LGMA 3N6LA 3CCZA 1RWOB 2J9DE 4NLVA 4YN3B 1OMSA 4DPOA 2LDIA 1JB0C 1Z2ZA 2V94A 3UNGC 3KHRA 4UW2A 4YB1P 1CS4B 3IS9B 2NSCA 2CKWA 2QMUB 1LWCA 2MPUA 1H7WA 1NJWA 1KLMB 2FZKB 2KFZA 3G4SS 4LRBA 1APSA 2BACA 3QFWA 5B08A 3QLHB 3GFZA 4ZK7M 4URQU 3BBCA 1HMVB 4F02A 2RDJA 1QTNB 4G6VB 4BCAA 4Y65A 4J9OA 5EX0A 4ZIVA 2HHWA 4RBVA 2RH3A 1IBLJ 4ZLLA 1V9OA 1WHVA 1TUWA 1WC4A 4KHRA 1Q7LB 3C16B 2YY3A 3MM7B 1FFSB 4DWIA 3CJ3A 3G6VA 4O23A 1S4FA 3UD4P 3VAFA 1ZM3A 3MM8B 2HQFA 3IR6B 2AGPA 3Q23A 4QU7A 3OPKA 4DFKA 5KT5A 3R27A 1XTZA 4JI8F 3SSQA 4FF1A 5E3RA 1HBOB 5JJBA 3MMJA 1WOPA 2W9CB 3EGNA 3ILJA 2XMUA 4ZHRB 2CQIA 2IM3A 4J9QA 1FJ7A 2QZ8A 4JI3J 3PX6A 3DHWC 4XO0A 1GXTA 2YNGB 4M5HA 1F2HA 3MFIA 1BGXT 3RAXA 2DR5A 3AAWB 3AY0A 2KH9A 1NHVA 4HYKA 3VHQA 2HHTA 5HBMB 3P96A 2ZNYA 4AE5A 2ZH6A 1M5OC 2APOA 1MROB 1WHWA 3FSYA 3BJYA 4B3RJ 2Q6CA 1CS4A 3A4TA 3GR1A 3JQJA 1V6HA 3L7UA 4GVBA 2XS7A 3N4WA 2E1AA 2QA2A 1UMJA 2AU0A 2QL5B 3AD9C 3PIPQ 2ZJRQ 4DV2J 3PYGA 4KT0C 4RWXA 1R8BA 2V69A 2HZCA 4TLRA 3CO9A 4ZVGA 1U02A 3T41A 4F4WA 2HBYB 2J0XA 4DPXA 2JHEA 3UN5A 4DN9A 2F4VF 2JOQA 4DR2J 4KFBA 3MUTP 5ETRA 1UWAA 1Y4ZB 5CZXA 3DLJA 2HMIA 1IXKA 8AT1B 2R2RA
chains in the Genus database with same CATH topology
2AYEA 2ZVSA 1FJCA 1WACA 5KFHA 2BW2A 2ADCA 4PWDB 4QU7A 1G7CB 1RDRA 3RBEA 1UWBA 3RAQA 3HX9A 3QGIA 2XZWA 1ZYQA 1J5OB 2HNDA 4A4JA 1WF1A 1K0VA 2MKHA 5BJRA 1RT4B 4OI2A 1FDNA 4Q8FA 1HNZF 4OZ0A 1RTJA 2CZ4A 1DBDA 3M2RA 1R89A 4LSLB 1T94A 3HHLD 2LU1A 4C0HA 3M9MB 2FJXA 4IOAQ 2ZOFA 5IM0B 1GX6A 2ILYA 2YKAA 4YUDA 1XWLA 2WRMA 5HBMA 1Z4UA 3TA2A 2KFYA 3MEKA 3VTIA 1SJ3P 4IOBA 2IRYA 3CJ4A 3EGZA 2COLA 4ETZA 1S0OA 4C8MA 2MZJA 5M2UA 3KK3A 1UEVA 5EWFA 2CJQA 3ITHA 2VG5A 1JWWA 2L9DA 4IRDA 1FTCA 2ZH1A 2PDAA 4ED3A 3N6NA 3GFYA 1C1BB 4U67Q 2RF2A 1XR6A 2CPFA 2Z4PA 4RKUC 3V2UC 4PG5A 2GQQA 1QSLA 2EBGA 3GB0A 2G1DA 3H5UA 3JSYA 4RNNA 1TL3B 5DLFA 3HKZD 2AJ1A 4RNFA 2NYIA 5T41A 5J2NB 3F56A 2IJFA 4K4WA 2OPQA 1G1XA 2VG7A 1HWLA 5G0RB 5HMXA 3UD3P 2DO0A 3PW4A 4B9UA 2LQBA 3KMQA 4HLBA 4GO7X 3RB4A 4LVOP 4KAIA 1M5VC 2N3OA 3H8YA 3I6PA 4X84A 5F41A 5KAKA 2ZDOA 4DSFA 3KLHB 5HMZA 2CPJA 1U7LA 3LAMA 5FDLB 1PILA 1H2TZ 4X4SA 4N8NA 4C3MA 1X4AA 2W25A 3PRDA 2R8HA 3GR0A 3GIIA 2W4CA 1ZAXA 5D3GA 2XMVA 3OSPA 2WK4A 4WYWA 3UE2A 3TP2A 2KDOA 1CC8A 1MU2B 3PX0A 5C25A 3AH6A 3QAEA 2KG1A 5FJ4A 5KFVA 4Y2CA 3T19A 4DSJA 4B3OA 3PW0A 1GAOA 2I9SA 2M4MA 3TA0A 4F2RA 1VRUA 2HNYA 2O66A 1WG5A 5B7WA 1W2BR 3U1LA 3EUNA 5F8GA 2E1CA 2F9DA 4DV3F 5F0WA 1E6VA 2EFGA 4J9LA 2LXIA 1NB7A 3FFIA 2OJ3A 2HW3A 3UI3A 2HVIA 1VLYA 3AJ2A 3CD7A 1HFEL 3E3XA 5HMYA 4U6PA 3AA8A 1UL3A 3LOUA 4F26A 1RQ0A 3GZ7A 2VG7B 1S1UB 2ZE2B 4CO3A 5SZTA 1XMQF 3H2LA 4Y0FA 4DF8A 2WBMA 3TAQA 2MKSA 3DRPB 2FJDB 2FHMA 1SKWA 4ILLA 4PWDA 4PKDB 5LXYA 4IFYA 3DLKA 3M9OB 3S01A 3MEGA 1Q4RA 4YQWA 3OR2A 1SKRA 2HHQA 4C8KA 4C8YA 1X4DA 4LIWA 3TUJC 5B0EA 5EWGA 1S6UA 2DHSA 2GHWA 4OZ1A 5IT4A 1SI9A 1RT3A 2PI4A 4Y28C 5GAEI 2FC9A 4JYAF 1M5PC 4KC5A 4IR1A 2X1GA 2M5YA 2MZQA 3KHHA 3PEHA 4KHMA 3W2VB 1SJ4P 4I7FB 4EEYA 2CG4A 4R5PA 4WK1A 1WI8A 6FD1A 3MTJA 5K9FA 3HDSA 3SI8A 2PA3A 1WEYA 1WD6A 5E41A 2BDPA 1SV5A 2F8MA 3QZ8A 3IXQA 2AWZA 3NAHA 1FEHA 4CO4A 5J2MB 2DISA 1VI7A 1XERA 1HA1A 2B9YA 1SH3A 1CQMA 3T9ZA 2NUUG 3LO3A 3CIZA 2DNMA 1TKTA 2J7WA 2WOMA 1VQ8S 1S1UA 2RF2B 4YOEA 3RU0A 5L1KA 3TOQA 2EK6A 3P6YC 2WAQD 2OLWA 3T5JA 2MZRA 2GNKA 5IXUA 3U27A 1KOHA 3DLKB 4P6QA 3RR8A 4URGA 1IJEB 3HZGA 5K5MA 3LH2S 1TKDA 3CXCR 4X62F 3OLAA 4X4UA 2A3JA 1S1WB 5KFIA 5CD4H 1M5HA 1R8AA 2FJBB 2FJAB 4DV0F 3K5PA 5I42A 3FZBA 2QA4S 4DR7F 5F8JA 1KVIA 3NBPA 3THPA 4DQRA 2DNNA 4I2PA 3Q8PB 2QLWA 4RNOA 3IG1A 2MY7A 2XS2A 4ZP8A 2PO4A 2WHOA 2YNHA 4WXWA 1S6PB 4USHA 2ASJA 1FJGF 2DH9A 3Q24A 2R7UA 2MY8A 2WSEC 4OZLA 4RUAA 2BABA 1NH8A 3IRXA 2RQCA 5KFJA 4ZHRA 5I3QA 2DGXA 4ZCIA 3I87A 4ITSA 4Q7AA 1UP1A 3FQKA 3M9NB 1U48A 2MQLA 2ZBIA 3LW5C 5B0DA 1NK6A 3FFIB 5DG9A 3IWNC 4BS2A 4B9MA 1BD6A 1WEZA 3WX4A 4BWMA 2R8JA 2ZH5A 5L39A 2XNQA 4O4GB 5KT4A 3ZFVA 2WB4A 4J9MA 2VA3A 2EK1A 1QSYA 4KE5A 1DLOB 2DPJA 1LXNA 2B4VA 2XG8A 2RQMA 5DGAA 2V8VA 1VK3A 1ZM2A 2XULA 4EO6A 3NBPB 1VBXA 3OR2B 3NCQA 4OI3A 4F3MA 1P9QC 1VQOS 1IM4A 2AYMA 4YB5A 1FKOA 1D9AA 1DHMA 4XDDA 4ZVHA 4ZOSA 1QAJA 1OO0B 2HGNA 3AA9A 4ATNA 1Y5LB 4KHPF 3HHLB 4LQ9A 2MHNA 1LK7A 3ENVA 2BE2A 1SIWB 4ECQA 3S1TA 1B0VA 2DITA 2YVSA 4I2QA 3KHGA 4WTYA 1VC5A 2VC0A 1V3ZA 5IQ6A 2YNIB 1G2EA 1QUVA 1MNEA 5DQGA 4K4YA 1GQEA 6FDRA 4DR5F 3I96A 3CTRA 4XPEA 2CJBA 3FJ2A 4B9LA 1S6QA 1IJFB 4DHVA 1U24A 3HF5A 2AJFE 3DDKA 3H5SA 1L3VA 1FJEB 3LP1A 4QW9A 1T7PA 5HLFB 3FSXA 1Z2LA 4TKTA 4Q2LA 4ZPTR 2DRBA 5A0YA 4HH1A 2GV1A 1HL6A 3G71S 1ZOTA 2XEXA 3KKFA 2A1BA 2D1CA 4ID8A 2R7RA 3C46A 1GX5A 2YKNA 4DR6F 2I5JB 3KG1A 1ULRA 3POTB 3DI6A 2MQOA 1C4AA 1F5BA 1RT2B 2GMHA 2Q79A 1LW2B 2D7SA 2JVRA 1AW0A 4UQTA 1NK9A 2B4UA 4U7CA 4QR1A 2F8EX 4JI4F 1RISA 3HHLC 1JKHB 1NK4A 3HVTA 1KHVA 3T6JA 4DV7F 4EWTA 1TZ0A 5KFKA 3H5YA 2MKJA 1IKVB 2CYYA 1F9FA 2HWIA 4BWJA 1B0PA 1RTIA 2B5JA 4Q0BB 3K5MA 1UWBB 2EI5A 5T7LA 3MHYA 2RT3A 2LQ9A 4O3RA 4WZQA 3SQGB 2GHPA 5D8HB 3THVA 4Y00A 1LFWA 2DGSA 2KM8C 2JDJA 3QGPA 4DMZA 1X5PA 2UP1A 1XNQF 2QLXA 4KKOA 1F0XA 2L3MA 1RT1A 4PXEA 4YFUA 3VWSA 3M32A 3BF4A 1IKYB 5LXRA 5DETA 2JVOA 3N5BA 2BZ2A 2DCLA 1N8RT 2JEIA 3BO4A 2C28A 2AW0A 3MMAA 5J1PA 1LWCB 4IOCQ 1YRUA 1AFJA 4ZMMA 5FLXY 2GW8A 2J9EA 1SKSA 2E7WA 2J9DA 4TLQA 5KT2A 5DG7A 1WHYA 3HP6A 3CCQS 1DLOA 4A46A 2C3OA 4OL8A 4MIWA 5GAHU 3NAIA 1QAYA 1KS2A 1K1QA 4CTAA 2YH0A 2GIQA 3FZ2A 1JLEB 3MM7A 5DDPC 2HQIA 3BQ0A 1C0UB 4F4YA 2KVIA 4RW9A 1U2FA 1SB6A 3RTVA 3SCLE 4C3KA 4R8UB 3OL9A 2GHVC 1KRPA 4U7UK 2OPQB 1S97A 2AV5A 3D5MA 2RS8A 5DDRC 2HS4A 2KHCA 2WCXA 3PIOQ 1UVNA 3BEGB 1S7HA 2MSTA 1WNEA 1IBLF 4LJMA 4URSA 4ZPWR 2BUNA 4UOCA 2HRUA 2BV3A 2VPWB 3KLHA 4C0BA 5GMKa 2PEHA 2F7VA 1LWEA 5LSLA 4C8ZA 2B56A 1TV6A 3JAMY 2NR0A 2N7CA 1BQMB 5KG4A 2BR0A 4IFVB 5D3GB 5J2QB 5DJBA 2FVCA 5GADI 2KZZA 5AXLA 3IO1A 4JI3F 3LF0A 4N76A 4F4KA 2JZ5A 3DU5A 3SXLA 3TX8A 4ED6A 2DNLA 1ZBTA 1VIOA 3KYLA 3PR5B 4Y2AA 1Q78A 2CPXA 1VQKS