2LMIA

Nmr structure of the protein bc040485 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
GSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G-rich sequence factor 1
publication title NMR structure of the human RNA binding protein BC040485
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lmiA01
1X5TA 2VOOA 4CH1A 2CPYA 1PO6A 2ADBA 5ITHA 2FPHX 2M0GB 2LCWA 4IOAQ 4TLQA 1DBDA 2CQDA 2AYBA 2J0QD 3CCLS 2RU3A 2ZJQQ 1VQ7S 1FJCA 3NS5A 1U1PA 2K3KA 1YHQS 1NO8A 3MD1A 2DO4A 2DHAA 3J7ZT 2MKIA 2U2FA 2CQ3A 5IFMA 3UD4P 2MPUA 1M5OC 2D3OR 3L3CA 3VAGA 2CQPA 3H2UB 2MGZB 2AYGA 1QVFR 1OO0B 2E5GA 1RK8A 1VQ5S 1M90T 1AUDA 3RW7A 1X5PA 4OZ1A 5CA5A 3CCUS 2DGVA 2M9KA 2CPHA 2E5JA 2KRBA 4WIIA 4CH0S 4A8XA 2FY1A 1FO1A 2YWKA 3G6ES 2X1FA 1U2FA 1ZZNA 2LKZA 3NS6A 2DGXA 3SMZA 3UCUP 2J8AA 5DDQC 2MYFA 1WI8A 2BZ2A 1URNA 2MZJA 1P27B 4UQTA 1QVGR 1JJ2R 3G96A 1N88A 1VC0A 2QEXS 2GO9A 4YB1P 2DHSA 2AYMA 4ZKAA 2EK6A 2LQ5A 2UP1A 2RQ4A 5DDRC 1U6FA 1FXLA 2D9OA 2CQ1A 3MUMP 1WEYA 1Q86T 1A9NB 2M88A 1SJRA 2FC9A 2RRBA 2PEHA 2M4MA 2HGMA 2DH9A 1N8RT 1B7FA 2MSSA 1UFWA 5LSLA 4QPTA 2JX2A 1VQ8S 2DNZA 1CVJA 1WI6A 2VOPA 4F25A 1F9FA 3P6YC 2LEBA 4CIOA 2DHGA 2J76E 4PRFA 2RS8A 2KT5A 2LYVA 3V4MA 3K0JA 1M5KC 3Q2TC 3ZZZA 2D9PA 2MZRA 5JVHQ 3VALA 1U1MA 1VBZA 3CCRS 1H6KX 2DH8A 3CTRA 2QFJA 4Z2XA 2EK1A 1VQMS 1WHXA 1QM9A 2OSRA 2XS7A 2M7SA 3VAHA 1UP1A 2RRAA 2E44A 2CPZA 2OIHA 3I56S 3G71S 2A3JA 3IWNC 3SXLA 3TO8A 3MDFA 2LEAA 3THPA 3VAFA 2E5HA 2DIUA 3OW2R 1S72S 2MKCA 1XN9A 3CUNA 2DNYA 1JJ4A 1WEXA 1VC6A 3MUTP 5GVQA 2KU7A 2YH1A 1M5PC 1X0FA 1X4BA 2XS5A 4EGLA 4WCEQ 2DIVA 1VQ4S 2LA4A 1WHVA 3N9UC 3CC4S 4WF9Q 3BEGB 2DGOA 1NU4A 1M5VC 4TU8A 1X4GA 1VQOS 2M70A 2CPFA 1R8PA 1WG4A 4YUDA 5FJ4A 3CCES 3R1HA 1VBXA 1Q82T 4YOEA 2MMYA 2DB1A 2JVOA 3CCJS 1FNXH 3NNCA 5DDPC 2G0CA 2XSFA 1DRZA 5BJRA 3G8TA 3ULHA 4W90B 2DGUA 1FJEB 2CQ2A 4V19X 5GAHU 5CYJA 4WFNQ 2MY7A 1X5OA 2DO0A 2KFYA 1SJFA 3VAMA 3CCVS 4QQBA 2MQPA 2F9JA 2N7CA 3H2VE 2CQIA 2FC8A 1L3KA 1YJWS 1K73T 1WG5A 4UY8T 2MQMA 2YKAA 4WFAQ 2CPDA 4RU2A 1WF0A 2ZJRQ 1VQ6S 3G9CA 2CPEA 3BO4A 4Y0FA 1VQLS 2AYEA 3CF5Q 2KXFA 1N54B 1YWXA 2MZTA 3CC7S 2ZJPQ 2XNRA 2DISA 2OTJS 2RUGA 2HGLA 3DXBA 2MQQA 1U1OA 2KG1A 2DNLA 4BS2A 3CMES 2CQCA 1YI2S 3MXHP 2N82B 3NNAA 2RT3A 5LJ5Y 5LSOA 1KD1T 3US5A 2LXUA 1WF1A 3CMAS 2MHNA 1X4AA 1R8HA 3MOJB 2RS2A 1HA1A 2HZCA 4FXWA 2KH9A 2DGTA 2DGSA 5JVGQ 3R27A 3CC2S 1Q81T 2LMIA 3SDEA 1OWXA 5HO4A 5LJ3Y 4W92B 2N3OA 2MXYA 5IQQA 3MURP 3TP2A 2DNOA 3CULA 2O3DA 2F9DA 1U1KA 1FT8A 2CQBA 2KRRA 2KN4A 2KI2A 3BO2A 2AD9A 3S01A 1H2UX 1KC8T 1O0PA 4FXVA 5CXTA 2CQHA 5GMKa 3P3DA 3ZZYA 1P1TA 5D78A 1DZ5A 2KXHA 2YTCA 3B4DA 2J0SD 2X1BA 3Q2SC 1WG1A 1SJQA 2M52A 2B0GA 3HI9A 1H2VZ 4IUFA 1SJ4P 4TU7A 1Q7YT 4WFBQ 2CPJA 4LMZA 3EX7B 1DHMA 2X1GA 3LQVA 2MQOA 4Y00A 2X1AA 1ZH5A 1PGZA 3MUVP 5D77A 1X4HA 2CPIA 3VF0B 5LXYA 2VODA 1OPIA 2G1DA 2U1AA 3MD3A 2KG0A 3UCZP 3G8SA 1U1QA 1U1NA 1KOOA 2MZ1A 3NNHA 2HVZA 2JVRA 2OSQA 2DNPA 4F26A 2MKSA 1OIAA 1YTYA 2CQGA 2KXNB 3J7YU 2CPXA 4TU9A 1HD1A 3SDEB 1N52B 2JWNA 2RQCA 4U67Q 4IOCQ 2XNQA 3JB9k 1W2BR 3FEYB 4OZ0A 3G4SS 2M8DB 5DDOC 2KM8C 1YJ9S 1WF2A 1VQPS 2DNHA 1K8AT 1HL6A 2NLWA 2VONA 2MY8A 3CCQS 2BOPA 2Q79A 1U1RA 5H1SV 3U1MA 3RW6A 3LPYA 5HL7Q 5GAEU 4LIRA 3S6EA 2L08A 2WBRA 3CCSS 3BO3A 1K9MT 2OTLS 3HHNB 2MZQA 2L9WA 2V94A 2DITA 1WWHA 2DNNA 3MI7X 1WHWA 1X5SA 2NZ4A 4J5OA 1UAWA 5IM0A 4QU7A 2I38A 1H2TZ 2RVJA 3S7RA 1YIJS 2MB0B 2XB2D 1VQ9S 3P5TL 3VAJA 2MKKA 2MQLA 2I2YA 2RNEA 3BS9A 3UCGA 3EGZA 2MJUA 4C0OC 1WEZA 3CCMS 4LJMA 2L41A 1SJ3P 4P6QA 4M5DB 4F02A 2DNQA 2MQNA 1KOHA 3THTA 2MZSA 2PE8A 2MKHA 2KHCA 4QU6A 4ERDA 2ADCA 2GHPA 3UE2A 1SXLA 3NMRA 2OJ3A 1JJHA 5LXRA 4WKRA 3TYTA 1WHYA 3I55S 2LXIA 3UD3P 3CPWR 4IO9Q 4C4WA 2DNRA 1ZZFA 1D8ZA 2K8GA 1X4DA 2CQ0A 2CJKA 2HYIB 4PR6A 3PIPQ 2M8HA 4PKDB 1A7GE 1HD0A 2DGWA 2E5IA 3PIOQ 2DNMA 1U6BA 1YITS 1X4CA 2EVZA 2LECA 2G4BA 3S8SA 5MLCV 5DM6Q 1S79A 3IRWP 1NJIT 1D9AA 4CQ1A 2KM8B 2MKJA 1UW4A 2KVIA 2DH7A 1RKJA 5DM7Q 1U1LA 1KQSR 2QA4S 3D2WA 4C7QA 1M1KT 1FJ7A 3U1LA 2MGZA 1FHTA 1JMTA 5GADU 5DETA 3CXCR 2KYXA 3CD6S 2SXLA 3UWTA 3VAKA 1VBYA 5IM0B 3FEXB 2M2BA 3R1LA 1WELA 2JRSA 2MJNA 3B4MA 2F3JA 1VQKS 2XS2A 2YH0A 2HGNA 2DNGA 5GAGU 1WTBA 2FHOB 1G2EA 2DGQA 3VAIA 3P49B 2CQ4A 3DLLQ 1X4FA 2ERRA 2DNKA 4ED5A 2LA6A 2N3LA 1VC5A 1IQTA 2DK2A 1X4EA 1YJNS 1VQNS 5EN1A 2DHXA 2MSTA 1BY9A 3EGNA
chains in the Genus database with same CATH superfamily
1ZA1B 5K14A 3CWJA 1KTVA 3OVAA 3FBEA 1I51B 4ZP6A 1FKOA 1PBAA 2IM2A 2MKIA 4DQPA 2NS1B 2VC1A 1VFJA 1CJTA 3AOBA 3HFZB 1WSVA 2WONB 2VF3A 2AIRB 4OZ1A 1AA1B 3IP0A 2R42A 4CH0S 1MWZA 1RUSA 5A8RA 4O3OA 1S1WA 3EPIA 1SC4B 3O8WA 2AEFA 3M8PA 3QGPA 2V2VA 5E3PA 4K4ZA 4RNNA 1MROA 2KJWA 3LF0A 4B3MJ 1IBKF 3DLGB 2DH9A 3BGRB 2BJ7A 4NLTA 2QL9B 3I9V9 2V9KA 4DUZJ 5KFWA 3AQPA 4ID5A 4UQGA 4CO5A 2D9PA 1PJ7A 5ETVA 4RW6A 4WJBA 4LRCA 4ZOSA 3KUEA 5GADI 4PYDA 2FJAB 5KG7A 1CQNA 4LF5J 2C3YA 2VG5A 2W7OA 3MUTP 3R6LB 1M5PC 5I42B 2HFNA 3UR3C 3CJ3A 3HM9A 5E7OB 2B7BB 2UUTA 5HK4A 3DRSB 2VFVA 3CCES 1FNXH 3QGHA 2XGQA 2ZH1A 1FCAA 4W90B 4OHWA 1D3WA 5LMUF 1PJ5A 1X5OA 3I32A 2HSEB 4QQBA 1WACA 4YB7A 3KOAA 2IA6A 3H2VE 4PWWA 2WRMA 1YJWS 2EXUA 4NEYA 4LBIA 2XWXA 3VVUA 2E29A 4KT0C 4QJVA 1VI7A 2XNRA 5HMYA 3C6TB 1T9XA 2QMWA 1Q5VA 1ULRA 2YNGA 3T41A 3MXHP 3FMWA 3BQ0A 3V81A 1I94F 2KT3A 1FESA 1K1QA 4DLGA 3CC2S 1Q81T 3NAIA 4C8KA 4NZ6A 3VV2B 4OI1A 4KHPF 4ICLA 4NOHA 3RAMA 2VKZG 2ZE2B 2L9NA 1TL3B 3CNQP 1P1TA 2ZC3A 3W9JA 1YBUA 4USHA 3GFXA 4OL8A 2OELA 3VWSA 5DS7A 4DQIA 2KHDA 3W1YC 4Y00A 5IT4A 1ZH5A 1LFWA 2EFQA 4F50A 4AFFA 2IVYA 2R4FA 1XK8A 1E6YB 1QSSA 2EFVA 4ZN3A 2HHTA 2KB2A 4F26A 5EX0A 5A8KB 2BJEA 3BBCA 2XNQA 1U2CA 1R31A 2UXBJ 3T1HJ 3NWRA 3GMGA 1VQPS 4DS5A 4WK1A 3DRPA 5ETTA 1N32J 1S1TB 1LQ9A 3RW6A 2R8HA 2VL1A 1SVDA 3KUHA 2Z30B 3ENWA 5KT3A 4NLYA 4PG5A 4C3KA 5AE3A 2AU0A 2ALZA 1RP5A 3V6DB 2BJ9A 2V2QA 3RU0A 4BBYA 2AEMA 3KK3B 1EARA 4UOHA 6AT1B 3JSRA 4DZ6A 2FJBB 1MWYA 1R3NA 1UKUA 3I5BA 2DBBA 1PAUB 2V8GA 2XSJB 3D0IE 3GR0A 4Y6IA 3EVMA 3SQGB 3QRQA 2DNMA 1V3RA 3OXFA 3DLEB 3M8YA 1G6BA 2RHSB 3KK1A 1S79A 5EDWA 5J2PA 4JI1F 3DOKA 2IAJB 4E8UA 2D74B 4OYXA 1MN9A 2CNOB 1R6VA 2SXLA 2E9TA 2MJNA 2VZ9A 1NJZA 4MK9A 3BGUA 2EFGA 3IN5A 1HNXF 3SSRA 4ED5A 3LUYA 2LA6A 2UVWA 1X4EA 4A47A 1U4BA 2L3MA 3AA8A 3ENVA 3TJ8A 3ZNJ1 2Y1RI 1Y0HA 3CB4A 4V19J 1EZZB 3GG0A 4KYZA 1RA6A 4B3MF 1IXKA 3B8HA 1XNQJ 2RMLA 2WSEC 2HS0A 1R0AA 3ZZTA 3M8QB 1SKUB 2MPUA 1XMOJ 4DUZF 5GAHI 2AYGA 1TKTB 5IWAJ 2DD8S 5L8RC 3NMAA 3QFWA 3AXMA 4C98A 1RE1B 4WIIA 3CIZA 4DFPA 3SMZA 3OJUA 4K4TA 1WI8A 1URNA 1EQMA 1LXJA 1ZTTA 1HWIA 1GFWB 2Q3PA 5HQMA 2Q66A 3PZPA 3ZZRA 5L1JA 2JOQA 4LREA 1SJRA 2IPOB 3KFWX 2PEHA 1UMJA 4ZVOB 3ZZOA 2MSSA 2IDLA 4XDDA 5LSLA 4IQMA 1F9FA 2CRLA 2J76E 5E33A 4F4WA 5KOXA 4DMZA 2ZH5A 1U1MA 4C8YA 1RT2B 1VQMS 1CEZA 2GJ2A 2R7SA 1VDHA 1N5YB 1QLNA 3PW4A 1CULB 4URSA 4JI5F 1IKYB 1WKKA 1RISA 3TUIC 4F4AA 1TQLA 2EW9A 2JLFA 2MKCA 3V4IA 1PBUA 4FNIA 1Z1ZA 1O8BA 2XMTA 3R3TA 4WCEQ 3CC4S 1LK7A 1KVKA 1VQOS 5KFJA 4GKJJ 3I9ZA 4ED1A 5DG8A 2UUWA 1KQFB 4HH1A 1I1GA 4QIVA 5DDPC 2ASDA 2CFXA 1A0OB 3QJLA 1QUPA 2BANA 5HN0A 4UTGA 3Q8RB 4BWJA 3TAMA 2VPYB 1FKAF 1FDDA 2XTJP 4CTAA 4D3GA 2G2YA 3TR5A 5L38A 2UU9J 3EDQB 1NK8A 2L48A 2YNFB 4EBEA 1ZM3A 2GJFA 2RUGA 1S0OA 1ZBTA 2BEFA 2PDAA 1TTHB 2XO7A 3SCLE 4CWBA 5I3UB 1F2GA 1B0PA 1YI2S 4ECYA 3H98A 2VG6A 4IH5A 1R8HA 3AXKA 3VCDA 3MOJB 3FEZA 2IJFA 5KFQA 3T1YF 5D4OA 1ZAVA 4DSEA 1DQ8A 4X4OA 2UXBF 3MCSA 1HYSA 2F4VF 1VIXA 1N32F 4TY8B 1H2UX 4IFVA 3A3NB 5J2MB 4RW7A 4I1TA 4DLEA 2KXHA 1T9UA 2AJ1A 2QLJB 1FRHA 2WOMB 3P45B 1OPZA 4CO0A 4CO1A 2JNJA 3BDEA 4CM2A 4OLPA 2ZDOA 3W63A 1PGZA 5CQGA 1GEHA 3MD3A 5FDLA 1TUWA 3TWZA 2MZ1A 3T5KA 4OYPA 4LRFA 1PIEA 3PRBA 1B0VA 4JV5J 2KXNB 1C2PA 1ACMB 4IYQA 4K2JA 1P8GA 3IM9A 3TUPA 2GCFA 2Q6CA 2YKMA 4MK8A 2AZ1A 4ELTA 3ILIA 2BUNA 4TLRA 3OUYA 1GT8A 1Q53A 1VYAA 5LMNF 2OTLS 4JOUA 3ISND 5IM0A 2I38A 2F8MA 4ATNA 5KT6A 2AF6A 3BR8A 1C4CA 2I2YA 4O3QA 4TXSA 2J9DE 4FVCA 2HHHJ 1F0XA 3F44A 2AX0A 3WIUA 1GTHA 2FHJA 2V8DA 5KFNA 5HVHA 2P5VA 1RBLA 1EJ7L 2FZGB 2JH3A 1S49A 3NMRA 3QIPB 4WKRA 1R89A 3TRGA 3I55S 1CJVA 3HT0A 3R97A 1YZ6A 2UV8A 3PIOQ 5L1LA 3NAHA 1LWEB 3MEDB 2R7RA 3CEDA 1ELOA 2AEJA 4EUVA 1XMOF 1CSJA 1HBUA 1RTDA 5DETA 3W7BA 2JLEA 1WELA 4JI0F 4O3SA 3KHHA 2IA0A 1RHRB 5JJBA 3QSIA 4UOFA 5CYQB 3SV3A 1RHUB 3TX0A 4DPTA 5EN1A 4YR0A 3EXCX 4MT1A 4X4VA 5ETRA 4ECRA 4IH6A 4I7FB 4I6YA 2WB1D 1R8CA 5F8LA 3M2RB 1U1PA 3MM5B 3Q8VA 3LW5C 3WHIA 3FRYA 1KLMB 5CH7B 4RNHA 4LFBJ 4U8VA 4WYWA 2B9XA 4DR4F 1RT1A 3HO1A 2DXEA 2AGQA 3CD7A 2F8HA 1IR2A 5D6GA 2PMZD 5HLFB 3HCXA 2E5JA 1JJCB 1FO1A 2OPSA 5KFAA 1PAEX 3OFEA 3NGRA 3OLAA 1SH3A 4TKTA 5DGBA 4QBUA 1UWBB 4UT4A 2HG4A 2MLXA 4NRTA 3H5XA 4J9LA 1DQAA 4GKKJ 4MIWA 2PFFB 2HWTA 4C9DA 1B7FA 2WZ1A 1C1CA 2JX2A 1YBAA 3DYAA 2VOPA 4K0KF 1HQ2A 5CD4A 1X60A 2P6SA 5JVHQ 1IBLF 4Z2XA 9ATCB 4RX6A 4B3OB 1FVSA 5HMWA 2HNZA 4J91A 4GVBB 2A6MA 1H3DA 1N5VA 1KQGB 4KFBA 1W25A 4FF4A 2WVCA 2CG8A 1S0VA 2ZBRA 2RILA 3V6HA 1L3TA 4JI3J 2O67A 4WF9Q 1S1UB 3W3SA 5M2RA 4FS1A 1R8PA 3PX4A 3ET6A 1K44A 1RLDA 1IKVB 5BYQA 2H4WB 3CT9A 1U0SA 3BREA 4V19X 2BQ3A 4EZ9A 3F56A 4QIEA 2Z2MA 1F2HA 3LGNA 4LFAJ 1ITPA 1HQUA 3I31A 4HYKA 3RAXA 4U6PA 1PC5A 1NHUA 2CPDA 1VLOA 1GH8A 1VQLS 2V8VA 1RB0A 2DISA 3LWMA 1YGYA 4ED7A 4WFYA 1T9YA 4IQXA 4CLZA 2B3TB 4OI4A 4LF9J 4TQRA 2RSQA 4NYOA 4DX6A 3I82A 1KHWA 4USKA 2B6AA 5B7WA 2QA2A 3C15B 1REVA 2HPUA 2ZBPA 5LJ3Y 2I8EA 3M6VA 1G3OA 1JLGB 4CLSA 4DL2A 5IQ6A 1KONA 4Y3CA 4OJGA 2W9AA 1FKPB 1O0PA 3TW0A 4RW9A 1U26A 5KG5A 1Q8BA 1HMVB 3QIDA 3TA0A 2VFTA 2HHHF 4K59A 2X1GA 2DR7A 4X4NA 3SFGA 3UCZP 2AJ2A 2D69A 3IR7B 3ILOA 4ELUA 3ILLA 4USUA 3MEEA 4F3MA 4O4GA 4URQU 5IC4B 5AXLA 1ZM2A 2WVEA 1NSAA 4A8MP 3A8KA 2NYIA 4DR3J 4B9MA 1XNRJ 3CJTA 3FDSA 3KXDA 3NWGA 2ZH4A 3M7VA 1V3ZA 3DXSX 4OZ2A 4NA1A 2MLZA 2BBEA 2V94A 3ISNC 2OPQA 3SCKE 5G4DA 4FKXA 4QPXA 1S9EB 2YWGA 4P6QA 2LQ9A 2XO6A 2CJYB 2RU9A 3N0VA 2VFSA 3LANA 2HWHA 4DPYA 2COLA 4Q0BB 1N4LA 2HLTA 2E5IA 4G65A 1S4FA 3GR1A 5DQIA 1RWOB 3EVOA 2YPZA 4OX9F 5DM7Q 4DHVA 3K5NA 1PYSB 4K7QA 1JMTA 3J7AN 3VAKA 3QT7A 1FRIA 3DLKA 3H42A 4WFZA 1R0CB 5EWFA 2FDNA 3BB5A 3VAIA 1X4FA 3LH2S 4P52A 1S57A 3OR1A 3A1YG 2FPHX 3JQMA 2LCWA 2UUBJ 5D4NA 4UF4A 1YSJA 2HFSA 4GKKF 1QY7A 3JTPA 4ES2A 2HFOA 1XJWB 2Z0GA 3BH6B 4HDGA 3KJVA 1NPKA 2VFRA 5KFKA 2AHOB 1OY6A 2IBKA 1RACB 5CD4H 1MNEA 5KFSA 3PHTA 3PV8A 2BV3A 1DURA 5CA5A 2M9KA 3DRYA 3VR1A 4OX7A 5KFEA 1AFJA 2WK4A 2QN6B 3DCAA 4K4WA 3Q24A 1QVGR 3I0SA 2I5JB 3RG6A 3AODA 3ETOA 2C22A 2AYMA 4P2XA 2FJDB 4NLXA 1HNVA 1VQSA 1WOPA 2XI3A 5AE2A 1IBCB 4B3SJ 1PKUA 3CD5A 2B7CB 3UW1A 1UFWA 3HSGA 2CKWA 2XZWA 4IG3A 1MG7A 3BR9A 1FX4A 5G0RB 1H6KX 2CIMA 1U2RA 4LFAF 3CJKB 2XY7A 1FVQA 1MMNA 1WC4A 5LSRA 1JKHA 1B99A 4CT8A 2DNYA 3I0RA 1N36J 1X4BA 4LF9F 3N9UC 4OIXA 4ED6A 2PT0A 2VBWA 1Y00A 1LW0A 3ZTPA 2GMLA 5KG4A 2MMYA 4D3HA 3GIKA 2G0CA 4MKAA 3CVKA 4R5PB 1CJKA 4ECQA 1TVRB 3D67A 4KKOB 4JI6F 4WFNQ 2V8PA 2W01A 3MEGB 2C2EA 2LDIA 1F5BA 3ZNUA 1TK5A 4NE9C 4ZIWA 1CJUB 2GHWA 2AJFE 4WTYA 4QWCA 3PX6A 4Q43A 1V9OA 4WXWA 3EM1A 1S76D 4CLUA 4JV0A 3Q89A 1XMQF 4U95A 4ELVA 3E01A 2GVZA 4Z7YA 4M8LA 4CYUB 1VHFA 2QT7A 2N3OA 2OH2A 2V68A 3MURP 4URGA 1JLCA 4DR3F 1S6OA 2Y0BB 4Q45A 1UJ4A 2HBRB 3BH7B 1RTIB 4TVAB 4HH0A 3U27A 3OTEA 2CQHA 4I4BA 3RBZA 3E51A 2K1RB 4NI2A 2W9BA 1A6LA 2GGPA 4NLGA 2CDRB 3PCOB 1S59A 3MUVP 3VF0B 5C42A 1EP4A 2U1AA 3BJYA 3OT9A 1N5TA 1EETB 5A8WA 5B0FA 5AE1A 3KLGA 5HP1B 4LRBA 4JBCA 1RI7A 3V6JA 1DY3A 4FBUA 2HK2A 3M30B 4NCAA 1K8AT 2BXJA 4ECWA 4DBQA 5H1SV 3M9NB 1JLQB 4ZLLA 3BGOP 3LPYA 4IG0B 5GAEU 4I56A 4O23A 4CDIA 1C4AA 2BMBA 2QX0A 4CLWA 4Q5VA 2GJIA 4MKYA 3OSNA 1WEZA 1Q16B 4LJMA 3HP6A 1OY9A 4OMFG 1SL1A 3R2CJ 1LFPA 5IXUA 1QAJA 4U8YA 4N5SA 4QW8A 4LF4F 3HT3A 3UD3P 5F41A 2DXDA 5B0CA 3KMQA 4N7TA 1TU0B 2H48B 2UUCF 3X3UA 2AV5A 3MAQA 1URRA 2GQCA 2NXEA 1X9MA 1QE1A 1CG2A 1S12A 2M2BA 3R1LA 2VJVA 3RBXA 5J2NB 3VGSA 3JAMU 3C14B 2FHOB 1JK9B 2HBZB 1G2EA 5HQ8A 3CMQA 1TR0A 4B3TJ 1NLKL 4PG8A 4P9SA 2RE1A 4IOAQ 1ZA2B 4M5HA 1WC1A 3EZOA 2DHAA 2QV6A 2WW4A 2NXUA 3IR6B 3V5RA 1Q1KA 3DLBA 3IRXB 1UZHA 1LW2B 4CLFA 1IR1A 3HFVA 1S9FA 2ZKUA 1FFGB 2FHJD 3ZXWA 5B0EA 2YWKA 3IG1B 4KH0B 5DQGA 1Z2ZA 1WKLA 4O44A 4AQYJ 3TUZC 3BKUA 3NS7B 3FQLA 1WC5A 5CCMA 2K7KA 2GO9A 1UEVA 3GYGA 2DHSA 3M8WA 2YKQA 3OBIA 1HNIA 3K5PA 2P9CA 3MUMP 1A9NB 4DXLA 3CJ0A 1IVZA 4ED2A 2V50A 3MMBA 4C8LA 3HVWA 2BJ1A 5HBMA 1VJQA 3IC1A 1RAOA 2RS8A 2LYVA 3Q2TC 4BDPA 1QM9A 2QL5B 2OEJA 3RTVA 1UP1A 3LP0A 2CPZA 4O0NA 1HWLA 1RT7B 1S0MA 4DSKA 3NGUA 4KHMA 2A10A 1CC7A 5GVQA 3SYZA 2EKNA 1SIWB 4FPIA 4U96A 2OKQA 3P8BB 2W24A 4KRWA 4DV7J 2M70A 2F40A 5FLXU 4ECUA 2IJNA 4DV3F 2OEKA 4GMKA 2FJWA 5AT1B 3NBPB 1S77D 2GAHC 1V6HA 2VQFJ 3E8OA 2R2RA 1GX5A 4U9RA 4ED4A 4L76A 2BE2A 3CCVS 1FA0A 4IRCA 5KFCA 2RJZA 3UD5A 1K73T 1VQYA 2HNYB 2PFDA 1RTJA 3A8EA 1CS4A 4HR2A 3BV8A 2ZWPA 1MSWD 3M8ZA 1RWMB 3PJ9A 2MTLA 4JI8J 2UXDJ 2JEGA 2WAQD 1X0PA 2BKPA 2CQCA 3Q8SB 2EWHA 5LSOA 3DHWC 1N56A 1NRKA 4DG1B 4RUAA 2IM1A 2BE7D 3QO9B 3KLEA 4N41A 2HBQB 2ZOMA 4ZP7A 2ZBCA 2F9DA 5B09A 3HHLA 5KG3A 2YWWA 2VDIA 4ZP9A 1TFYA 3TOQA 3B4DA 3TUJC 5B0GA 4IUFA 3MMJA 4IFYB 4ER8A 3MM7B 2I6WA 2K3IA 5F8NA 3M8PB 2FZKB 3QYYA 4U7UD 2OSQA 4F3OA 8RUCA 1OIAA 2CQGA 4LSNB 2RQCA 3TVZA 2YWHA 1SC3B 3MTJA 4MYUA 3HVRA 3W5ZA 2G0IA 4OX6A 1N0VC 3GIMA 2C2KB 2QTWA 1WHWA 1Q78A 2NZ4A 1UAWA 2PC6A 2ZWOA 1N6QA 2R7WA 3QGGA 2R7QA 3M05A 2OAUA 1RCOB 2BKOA 3D4JA 2MZSA 3HK2A 2QA4G 5J2QB 2PE8A 3DI6B 1ICEB 2GHPA 4X4SA 1Q79A 5J1NA 2HEKA 2Z2YB 4B3TF 1ZPVA 2HAFA 4RW4B 4KO0B 4RUCA 1X4CA 2G4BA 1ZM4A 4EWTA 4DR5J 3MM8B 4RR5A 1RKJA 3AFGA 1U1LA 1KQSR 4U7UK 1YJRA 2WONA 5K8PA 3OR2B 1NDCA 3KKFA 3RRKA 3I6PA 5GAGU 2E9ZA 3N28A 3HXMA 1WDDA 1EKSA 3P49B 1PYTA 3DLLQ 4P75A 2ERRA 4DOZA 1IQTA 1WJ9A 3W66A 3DRXA 1VQNS 4DQQA 5AXKA 4OYBA 4A8QA 3BQ2A 2VHGA 3Q86A 4IDKB 1FFSB 1DBDA 3G86A 1WUUA 1B0TA 2DY9A 2ZVIA 3SSQA 2IRYA 3DLGA 3BGRA 3EMTA 4X64J 1M5HA 2FUG9 3BBFA 4DV1J 3UN5A 1SPBP 2I1RA 2XC9A 3MM9B 2W1BA 4DJBA 4EFAC 3D68A 4TY9A 3T5JA 4IRDA 2NZCA 4XTTA 2OUGA 3MFHA 4DEZA 2FY1A 2H3EB 1U2FA 2DGXA 4W4MA 2JC0A 3GJQB 4EI2A 3QT8A 2CJAA 2Z8QA 3PYGA 2FJXA 4KQZA 4PZVA 1Y11A 2GNKA 4Y2KA 5I42A 1DQ9A 2H5JB 4ES3A 2UP1A 3KJNB 1WEYA 3DRSA 3BN7A 1IM4A 2VC0A 3QPIA 2FVSA 4MIBA 2HHUA 3AOCA 4NYPA 2W8LA 1CVJA 3P6YC 4X4RA 4O0IA 1SB6A 4NLDA 3GV8B 2AGOA 1YG0A 5C2CA 3CCRS 4ZJOA 2DCUB 3EZUA 2G2ZA 2FVCA 2LLZA 1NMEB 5KFPA 1HBOB 1JJ4A 1T11A 2XWYA 2EC0A 2KFNA 3C6TA 3C46A 3FC9A 2QE5A 4J9SA 4NEZA 8ATCB 4B9NA 2BABA 1HBMB 3KK1B 3K5OA 4LQ3A 3R1HA 1RAGB 1OYEA 3UNYA 3CCJS 1AUSL 4S0MA 4QWBA 3SEOA 5C24B 3ULHA 3T5LA 4ECSA 1R8AA 2Y1IA 1T03B 2QYCA 4NLSA 1FX2A 1LWXA 2P6TA 1TL1B 2O1PA 1XC9A 2DPJA 3HJFA 2ZE2A 3M2VB 1UETA 2N7CA 1TL3A 5IV4A 5HVGA 1K47A 4KE5A 4ZPAA 4ZIVA 2EFNA 1WF0A 1RT6B 1U47A 2IRUA 4LR7A 2DEIA 1V5IB 2DNLA 1DTTB 3BSOA 4YHHJ 1H38A 4UZBA 2CJXB 5LJ5Y 2ATCB 3KNGA 4ETZA 1E6YA 1WF1A 5A8KA 4ILRA 3MR5A 4OZNA 3F73A 1YK9A 3SZ2A 4ALZA 3KMSA 2BACA 2WVFA 3JTNA 4H54A 4ZVSB 3JXOA 1HNWJ 4LVNP 4BHQA 5HROB 2M5YA 4PWDB 1KDNA 1S1TA 2AD9A 3KK2B 2FGOA 4BLGA 4LBHA 4BC9A 1AT1B 4FDFA 5D78A 3R9LA 3X1LB 1IQZA 1SJQA 1Y3KA 3PYDA 4I2PB 4TU7A 3V6DA 1REGX 3UN3A 2IM0A 2W7PA 3LQVA 3SSSA 3LA0A 3KK3A 5D77A 4V1Ak 2J9EA 2NUUG 5DGAA 3GTYX 2E1MC 4P10A 4DU8A 4ECXA 4QWDA 1FDAA 3M9OB 1FEEA 3FGVA 2XSJA 5F8GA 1IJFB 3G6VA 3SQGA 4NLPA 4FYWB 2ZKTA 2M8DB 2GQQA 3DLEA 3EWGA 4DL0C 2VONA 2HVDA 2Q79A 3O2IA 4KGMA 1HHTP 4H4KA 2CZ9A 2IAJA 3A13A 1VCTA 2WBRA 4QR1A 3DU6A 2ZOGA 1NSKL 2QSWA 3VAJA 2UXCJ 3GFZA 4I69A 2IDEA 4ZPDA 4M5DB 2I0XA 4H4MB 1S0NA 1KKHA 1SXLA 3GP9A 1JNRB 2JDJA 3RUBL 2GIFA 3M8RA 1A7GE 1HD0A 4QYZK 3GYXB 1N5QA 1NBEB 4ZVQB 4LF1A 2PA3A 3M8QA 2A0FB 4X64F 1FF2A 3KYLA 1TK8A 2B5JB 3AB2B 2Y1JA 3KLFB 4RWXA 2PIIA 3SIPB 3TVYA 4NLQA 1TKTA 5HJXA 1SKSA 4NZ7A 4O3PA 3PO5A 3EGVA 5D0EA 4JI2J 3LGHA 2ATLA 1WTBA 4JI7F 4NZ0A 1HBNB 3EYZA 4BWMA 1FE0A 4DPWA 2JL9A 3QQCD 3PFEA 2XMJA 2BM1A 4P2FA 5HATA 3KHRA 3UO0A 1HPZB 2CJQA 1VRQC 2JJ4D 1RT4B 2K3KA 2J0WA 1Z4UA 3N79A 1IBKJ 3G87A 4N47A 4OI0A 3C19A 2ACYA 2K06A 1IWGA 2B4UA 2M3DA 1FRJA 1UVLA 2DCLA 2NPIA 5EGYA 1S6UA 1IBMJ 4Q8EA 1RT2A 2DYAA 5F0WA 2GO8A 1N5YA 1CULA 3D6TB 1BHNA 3PY8A 3EJMA 1IKYA 3HF5A 1KS2A 5KT7A 1GMWA 4KB7A 1LXNA 2AW0A 5L9XA 3HHKA 1N88A 3N01A 2LQ5A 2CQ1A 3ZZUA 1YRXA 5B08A 4RNMA 4B9LA 4M5MA 1S9GB 4K8RA 4DR2J 1D1UA 4F25A 1FD2A 1D8YA 4IR9A 4PRFA 2HVEA 5E3AA 1M5KC 3ITHB 2KO1A 3PYEA 4OHYA 4DN9A 1G1XA 1XERA 3D3CJ 4TQSA 4DSJA 4PXCA 2OIHA 4KR0B 3OTDA 2NPFA 3MDFA 2OMOA 4PG4A 3LWLA 4OZ5A 4C0HA 3PRDA 2YNFA 2PGCA 3QBCA 3CUNA 5GAGI 2ZUAA 2ABYA 3AD9C 4OZ3A 5I3UA 2DIVA 3NGDA 1FJGF 3BEGB 5A2QU 2DGOA 1RXOB 3IAS9 3T3FA 1Y5NB 2VH7A 4FP9A 1X31C 3ZFVA 1I94J 2DB1A 3AA9A 5J1EB 5IT0A 1TELA 5GAHU 1C0UB 1TL7B 2HMIB 1FD8A 2EG1A 1NZAA 5C5JA 3RGIA 3VAMA 4TY8A 5J2MA 2H9ZA 2Y9HA 5D0RA 3QGIA 2WOMA 1RWWB 3OLBA 4B9SA 1N54B 5ETMA 2LQBA 3CO0P 2DVIA 4R0JA 3WQPA 1E6VB 2RT3A 3UDLA 1AW0A 4A8YA 3FKBA 2RDDA 5C25B 2APOA 2DGSA 2LMIA 5B0AA 5HO4A 3PDNA 2Y8WA 4C3LA 2IVFB 3ICLA 3DRRB 1RT3B 2X51A 1UA0A 3MHYA 2YPYA 4MFBB 2UV8G 2B4OA 2C3MA 3HSDA 1WG1A 3CJ8A 1SJ4P 2HQIA 4Q2MA 5HMZA 4UUXA 4M5JA 4UY85 1UVKA 1PC4A 1YRTA 2CPIA 2YQ0A 5E41A 2KG0A 2WHOA 3RAQA 5F3ZA 4PABA 2AGPA 1SCJB 3NNHA 4B08A 3QIPA 1S4EA 3D1QA 3D54A 3SDEB 4IOCQ 3PW0A 4KGKA 1JLEB 3JB9k 2V0NA 3FEYB 4OZ0A 2Z4PA 4X4PA 2VB6A 1U02A 3C8YA 1LWEA 1YDLA 1ZAXA 4GC6A 2CYYA 3MEDA 1TUGB 3DU5A 2FHKA 4JI1J 3HD2A 4HHJA 3H40A 3S6EA 1KLNA 3BBBA 3CCSS 2GA7A 4QU7A 2V2KA 1YIJS 2OGUA 3D5MA 4JI2F 3BS9A 5H9FK 1WD6A 3F0NA 5CYQA 3FSIA 4Y65A 3ONQA 1J5EF 2XZTB 1F5CA 2V67A 1HNXJ 3LALA 2ZHOA 4YQWA 3T6BA 2EG2A 4RJVA 4K50A 2Z2LA 4I7FA 4LFCF 2YKOA 1LEOA 3MAAB 1X4DA 5D8HB 5IV3A 3M2RA 3CJ2A 3MM5A 3R5AA 5DM6Q 3DLHA 1KLMA 1X8DA 1UW4A 2DH7A 1FXDA 1D9FA 4C7QA 1IBMF 1S6QB 2KYXA 3O44A 1UJ6A 3FEXB 3GIJA 2R7XA 2G1HA 2XHCA 5HLFA 4L74A 1P9YA 2YWEA 2ZBIA 2JEJA 2NXCA 3CDUA 1R7IA 3GYNA 2E66A 2L9DA 2B43A 1KVIA 1U6ZA 5EX3A 1RHQB 3MECB 2FLPA 1UWBA 4WWSA 4ITSA 3MPYA 2J0QD 4ZVRB 3CJ4A 3NS5A 4PXBA 3HPOA 1W2IA 1P6TA 1TZ0A 3LAMA 1VRTB 4DR2F 1KSPA 5ETLA 2CQPA 2MGZB 4M95A 1TKXB 1QVFR 1V3SA 3AD7C 1VQ5S 5C2GA 1RZMA 3HX9A 4KAIA 1QTMA 4B3OA 2CADA 2CPHA 4FVMA 3B54A 2X1FA 2CDQA 2J5AA 3ETMA 4JI5J 4GVBA 4ILMA 4USMA 1VK3A 4J7CA 1OSDA 1O6XA 4IR1A 1S1UA 5DDRC 1K0VA 4QW9A 1U8WA 2PEBA 2RDIA 3J81j 2IVMA 2B51A 2AX1A 4M1KA 1IKVA 4PG7A 4Y2IA 3AJ2A 1U45A 4F0HA 4MK7A 4Z7CA 5ETPA 4M94A 2DH8A 1T05B 3K59A 2OSRA 5L1KA 2RRAA 3I56S 3TAPA 5L46A 3MMCB 2W7AA 4USIA 2LEAA 4NCBA 4DV5J 2C1EB 5ETOA 1VC6A 3MR3A 3Q23A 1HI1A 5EUHA 3Q83A 4EGLA 1RTHB 5A6WA 3MR6A 2J7UA 1RAEB 2LA4A 5KFVA 2V9WA 4TU8A 4XO0A 2CPFA 5THWA 4WU3A 3DFEA 4YUDA 5K8NA 5KT4A 3C15A 3R6GB 1YRUA 2K2PA 5I3QA 3T1YJ 3W8PA 1UFKA 1JLGA 5D3GB 4J9KA 2IYGA 2F4VJ 2MY7A 3MEKA 1JLFB 1MMDA 4M63A 1FKPA 2MQPA 3OJSA 1S97A 3FCHA 1GNKA 2FC8A 1FK9B 1GAOA 4WFAQ 2IMOA 2FHMA 2GFFA 2ZITA 4NXMF 1HMVA 4YY3F 2DY1A 2LXFA 2ZH3A 1U0HB 3EE3A 4DL7A 2J7WA 2IJRA 3IWLA 2N82B 4X62F 3I4PA 2PI5A 1T94A 1FNMA 2DGTA 2NCKL 2GC8A 4W92B 2G2OA 2MXYA 4F7VA 4X84A 2XLIA 5KT5A 4WKYA 2YXLA 2WW8A 5BXIA 3W65A 4USWA 4C2MA 2LVWA 3IAM9 1BQMB 2YTCA 2J0SD 5LMNJ 1FE4A 3T19A 3WX4A 2H54B 4LVOP 2YX7A 1I5OB 4DL5A 2Z58B 4CO4A 2ZH6A 1UZDA 4QOTA 2CWXA 3IGNA 4ZVPB 4MJKA 4KHRA 2HHWA 1U1QA 4DL4A 4TYBA 2P8IA 2HVZA 4Q0BA 2ZVSA 4JP8A 2W2MP 3KJQB 3DOLB 4ILLA 2QMXA 1KWMA 3TI0A 2KM8C 3FJ2A 3G6YA 4XDCA 1UVMA 1T9VA 2J9CA 3Q22A 2GVDB 3BO3A 4JV1A 1WWHA 1Q95G 4J5OA 3KLIB 3DMJB 2CNKB 1H2TZ 5HQLA 2OD6A 4JI0J 2RNEA 4RNOA 2CVEA 2IRXA 3EUNA 1YQHA 1NHKL 1EAYC 4YR3A 4BC7A 4J9QA 3T1AA 4J9NA 1RHJB 2CJKA 1HIYA 1KN6A 3G82B 2EVZA 1FWPA 5MLCV 2C2ZB 2Z2ZA 4L73A 4RLEA 2MKJA 4OJ3A 3KLVA 4DR4J 4OHZA 3U1LA 2YX1A 3CXCR 2JFKA 3L95X 2JRSA 3VGVA 1BMQB 1T95A 1WC0A 1J5OB 3T6JA 3TJ9A 3G6XA 1NB2A 1WF2A 3EGNA 2OMLA 2ADBA 3UDCA 2I5JA 1NB7A 3QLHB 4MH8A 1J27A 1AROP 3CCLS 4PUOB 4PAAA 2O66A 3MD1A 2CJ9A 1D0EA 1ZYQA 4DV6F 4GRSA 1QDUB 4EZ6A 2D3OR 4ED0A 3QFHA 3VAGA 3RB0A 3W64A 4K0KJ 1CLFA 1DARA 3R5CA 5G0RA 4E98A 3ZTOA 3NL0A 1IBLJ 3ZTRA 3PRVA 4FYYB 4OYWA 3CJKA 4F04B 2ZM6J 3RB4A 1LWFB 4P72A 2EPIA 4AD6A 3A12A 2YWFA 1FNOA 2RIJA 4XK8C 3SI8A 4DV5F 1L3SA 2Y3YA 5DG9A 2MZJA 2R9LA 1LV5A 4ZP8A 5L1IA 2F63A 2QEXS 1IKWB 1RAJA 2VDHA 4KSEB 4DR7F 4B17A 5KFBA 4CNZA 4B9UA 5IC6B 3POTB 5IS2A 4I6AA 1Q86T 5AXMA 4C6AA 4DUYF 2ROEA 1N8RT 1XWLA 3PX0A 1L3UA 4RW8B 4EBDA 4K5SA 2ZZMA 2NYHA 4R5PA 2E7WA 1O5JA 3UPFA 1TVRA 3W2WB 2DHGA 4KKOA 3FFIB 3MEGA 3QRPA 3DGPB 2HNDB 5KFLA 2NREA 2QFJA 2YNHB 2EK1A 3VAHA 3DDNA 2E44A 1CJUA 3HKZD 2KTQA 2R7VA 3ISZA 3SV4A 3TO8A 2CUYA 1S72S 5KFMA 1TAQA 5KFDA 2HRTA 4OYAA 1NEEA 2ZBQA 3SFUA 4EYHB 3O3LA 2ZDPA 3A3OB 2B9WA 4C3MA 2CZ4A 1JLBB 2IIHA 2JVOA 4HHHA 4CYUA 1U8SA 2R2TA 2DGUA 3L7OA 5FD1A 1RTIA 1AZSB 3P4UB 4OYMA 4ZITA 1OS5A 2CQIA 1GMWD 4G3IA 4ZHRB 2HKEA 4NCGB 2AP6A 2K1RA 3CF5Q 5KG6A 2KXFA 2ZJPQ 1JX4A 1HHSA 2V34A 3VGUA 3PTWA 5U47A 3C3LA 1N34F 1U7LA 5IZHA 4IOBA 1MU2B 1SQGA 3MCMA 1EETA 3GV7B 3W62A 2ILZA 1X4AA 1JXEA 2W2QP 5HP1A 1RU2A 3KTQA 2J7KA 1OWXA 4AE5A 3CULA 1HI8A 1ZPWX 2CWKA 4K4UA 3M30A 3BYRA 1YJ7A 2H5IB 3BO2A 1WKJA 1JLQA 1MLAA 4FXVA 5CXTA 1OMSA 3IS9B 4IG0A 3P3DA 4UOCA 4CM0A 3RYLA 4I2QB 3A4TA 3BF4A 1KFDA 4ZK7M 4WTOB 2M52A 1H2VZ 3E3XA 2XI2A 3PKMA 3J81U 4ANDA 2F5GA 1X4HA 2VODA 4DSIA 4JYAF 2G1DA 1HQEB 3G8SA 2QIFA 1UPPA 1KOOA 2FLLA 3GPAA 2RQMA 4X66F 2W9CA 2MKSA 4USVA 2JEFA 1WSRA 2XEXA 1W2BR 1JQGA 1YJ9S 2YQ1A 2DNHA 2X7IA 1FXRA 4KIAA 5HANA 2NSBA 1H72C 2HRYA 1W26A 1OY8A 3HHEA 4OX9J 2L08A 1YKWA 3K17A 3PG9A 3R5JB 2MZQA 2V4QA 1RWXB 3MI7X 3IFEA 2MQ8A 3PW2A 3S7RA 2E1PA 4NA3A 3UVJB 5J2NA 1RWVB 4NMLA 3EGZA 5CYMB 3C14A 2L41A 4QWEA 4DZDA 4PEOA 3THTA 4J9OA 4HACB 2GS8A 4XPEA 4QU6A 4DX5A 4DV4J 5ETSA 4FF3A 3MR2A 5F8HA 1GK8A 1HW8A 3H4DA 3PFOA 1VR6A 5DG7A 4F4XA 4YP3A 1VS3A 3SQOP 2KM8B 2KVIA 3Q8QB 3GJSB 2BJ8A 3IRXA 4ZPVR 3DM2B 6FDRA 1LW2A 3TJAA 1UEKA 4RUHA 4N8OA 3BZQA 4BCAA 5F3TA 2F3JA 2XS2A 2ZM6F 1RWPB 3HVTB 5KG1A 3UN2A 1NK6A 3IG1A 2V4JB 3GFYA 1FERA 1JWWA 4G1PA 3QWUA 2ASYA 2N3LA 3C6UB 2DJWA 4KY3A 1X5TA 1IWAA 3CCTA 4CH1A 5D4PA 3AHPA 1S1VB 4PQUB 1JLAB 5KOWA 1F9HA 5J1PA 2NUHA 4F36A 1XEZA 1WORA 1XBWA 3L09A 2JLGA 2V2ZA 1VLYA 3IR5B 2E5LJ 3GFHA 1R6YA 1YZ7A 4MIAA 1OO0B 3L7PA 1RK8A 4ZCMA 4DS4A 2CNNB 1IKXB 3D28A 2CAJA 3RW7A 4LQ9A 3EVWA 2DGVA 3NOGA 4CLYA 4A8XA 1RHMB 1FTRA 1RT7A 4A46A 4WP9A 5CCLA 1APSA 2B8QA 4LSLB 4DF8A 1JJ2R 2XM3A 3OPKA 4YB1P 5HI7A 3C2PA 4OYZA 4ZKAA 1RAHB 2ZH8A 4P7TA 3CCWA 2HWIA 4QZVB 2FC9A 2RRBA 1HKAA 3NBPA 4NLVA 2HGMA 2W2PP 4OZJA 2XMVA 4DSFA 3GWCA 5LL6d 4F3QA 2LEBA 2NR0A 1C1BB 3TEHB 4HT5A 4JI6J 1VBZA 4J9UE 4P74A 2M7SA 2VICA 4LF8F 2HNYA 1RQ0A 3SXLA 1SUQB 5E3QA 3JAMY 1C0TB 3JYTB 3OW2R 1U49A 3G8QA 4KV8B 1GXUA 5HAOA 1X0FA 5KTQA 3JSMB 4F0KA 4N8NA 1S1XB 5BR8F 3W60A 3MPDA 3W5YA 2GMJA 1M5SA 1X4GA 4K4XA 4DG1A 5KFYA 1WG4A 1XMQJ 5DLGA 4HTIA 3Q8PB 3R5GA 2RKIB 3QO9A 4F2RA 3KLHB 3D1OA 5BJRA 4ED3A 4LF7F 2R7OA 3R7NB 2LU2A 5KFHA 2W8KA 4RO0A 1M1GA 3H25A 1SBRA 3D1HA 2WSFC 3WZ0A 1RWNB 1NJXA 1EQ0A 3GE9A 2FYXA 5IOLA 4UW2A 3SCJE 1NK5A 2XMMA 3L9ZA 4IFYA 2AJ0A 2VV5A 2MQQA 3MM7A 3CDAA 5MAOA 4RWWA 2HHPA 1KP6A 5SZTA 2R8JA 1SC6A 2LXUA 4A8OA 2D3ZA 3UDEA 3SCIE 2DRAA 4IKAA 4XIUA 4LSNA 3N5BA 4LUBA 3LP2B 4KPYA 2AKWB 4LF6F 2ASJA 1RYRA 4OHVA 4ECZA 1HLWA 1BLUA 2H1YA 3PHEA 2XQCA 1T02A 4WE1B 2XBPA 2OPRB 1U25A 2RF2B 4CZCA 3IO1A 2K7JA 1VOMA 1U1NA 4DV0F 5J2QA 3DI6A 4DV4F 4DR6F 1QAIA 4LF4J 1YBTA 5T7LB 1RAFB 1YTYA 1OQ6A 4ZLNA 3J7YU 2CPXA 5FLXY 4RW4A 1FRMA 3ZZPA 4KO0A 4RKUC 3WC0A 3BKFA 4ZJQA 4FZVA 1DLOB 2QLBB 1X9WA 1T8EA 3CCQS 3MM8A 3TVKA 2UUCJ 2XMAA 3GV5B 1VRUB 3PEJA 2BE9B 3OR2A 1X5SA 3P5TL 1W7WA 4R8UB 3DOMB 3MMAB 3UCGA 2J6SA 2BOAA 1XR7A 3I5AA 1S7IA 2MQNA 1Z2LA 2FB0A 3AH6A 4WU2A 2WVBA 2X3GA 2QO3A 3VZIA 3J80U 3CPWR 1QAXA 4C4WA 4IDKA 4PR6A 2DGWA 2LQJA 3MM6B 2VJUA 4OQJA 2O01C 4K4SA 3W2VB 1FDNA 1UL3A 3E2EA 2E5LF 2QA4S 3RR7A 5L39A 3MM9A 2O5DA 4YB5A 1WTFA 1XR5A 2D3UA 4EMDA 2YH0A 3NRBA 3HJVA 3C16B 1IR0A 2FGCA 2AT1B 1NJWA 3W9IA 4HTJA 2DNKA 4Y2CA 3ZO7A 1BY9A 4B3RJ 1IUJA 4LIWA 1DFDA 1FEHA 4FXDA 3QRRA 2AYBA 3EICA 2RU3A 3WX8A 3OHBA 2NSCA 2DO4A 3GJRB 5A76A 4DPUA 5LOQA 2CQ3A 2FY8A 4C48A 2LDYA 2J6TA 1S10A 3KG0A 3HZEA 1MW7A 4N56A 1M90T 3TEGA 3DC2A 5I4MA 2IM3A 5DZ6A 3BYPA 1ZZNA 3NS6A 4OI2A 4O3NA 4AYBD 1FRKA 1H73A 2VA2A 2J8AA 4Y28C 1HBOA 5KFGA 2CZVC 2J6UA 4DL6A 2FVQA 3G96A 5KFTA 5C7PA 2GQ2A 2PI4A 5L9NA 1FXLA 2FVPA 3HFKA 1HBMA 2ILYA 4UOGA 4DV3J 1OJ4A 2OPPB 4ZVEA 3IGVA 5C24A 1WI6A 4G1QB 1LWCB 1R8BA 4RU9A 3J7Z5 1T03A 3Q8YA 2KT5A 3V4MA 2ZH9A 3D6HB 1TL1A 3RRGA 5CZVA 4P73A 3CTRA 3LTOA 1KHVA 3M2VA 1WHXA 2D41A 3M32B 2WVDA 1JNZB 2V8HA 3NCPA 2EEYA 2WB4A 3PJWA 2E5HA 4KGZB 1RT6A 4NMXA 4NPOA 4MYTA 4P7VA 1RKIA 2RD5C 1WC6A 4F2SA 1DTTA 3QT6A 1TKZB 1RWUA 2EI5A 2KYZA 3WDOA 3CW2C 3N6NA 2BW2A 2XSFA 1DRZA 2QG9B 4Y34A 2CQ2A 3R8YA 4PWUA 5HROA 4PWDA 3HSJA 1V5VA 3KK2A 4AT1B 5IT9U 1S5ZA 4I0WA 4KPCA 1CQMA 3U02A 5JXSA 4LF5F 4I2PA 1NDKA 3OFGA 2HBYB 2RRNA 2QYGA 4MKVA 4OZLA 2LEPA 2YKNA 5ETNA 2ZH7A 2IC3B 1BQNB 5KFOA 4BS2A 3U7JA 3QZ7A 1BC6A 3BGLA 4CP5A 1UWAA 3A3PB 3CMAS 2FZCB 3FZBA 3R27A 4B9VA 1Y5IB 4C97A 4NLOA 3M1VB 4FYXB 4LR9A 3MOZA 4YN3B 3HVAA 3PNIA 2KRRA 4AUKA 2V6AA 4ANCA 2KI2A 4OV6A 3R7BB 3TZWA 3NEKA 2BR0A 2B0GA 3NKYA 3M8SA 1KEKA 4LMZA 3LP1B 4Q44A 2GX8A 1Q0NA 4QWAA 4M5DA 5LXYA 1OPIA 1Y4ZB 2ACMA 4OYOA 2RAQA 2ZD1B 5DJBA 4H4MA 5BYRA 2ZNYA 3PJXA 1S99A 2JVRA 4KBIA 2DNPA 1I3OB 2UVUA 2BX6A 1HD1A 2JWNA 2DR8A 1RHKB 3RBEA 1FWKA 2ZHBA 1RJJA 1S6PB 4PG6A 3DDIA 3W61A 2YVSA 4DPOA 4OJHA 2FVRA 2XCAA 2HRUA 4P71A 1F3FA 2B5JA 3KLFA 4WFXA 2ZUGA 4Q7AA 2OEMA 1RT5B 1K9MT 2DITA 5A0YB 4PPDA 2MB0B 3GCXP 2VBYA 2H51B 2ZFHA 3CCMS 5HSPA 1HBNA 2HVIA 2D1CA 3NXZA 4B3RF 2KHCA 4DPXA 1NHVA 1DTQB 1WHYA 1SV5B 2DNRA 1ZZFA 1RDRA 1NM2A 2WSCC 1QAYA 4CO3A 3T1HF 1U6BA 1HPZA 1RT4A 4L3KA 1NJIT 3KHLA 3IBWA 2W2OP 2HW3A 2VBXA 2KZZA 4DCOB 3M2UB 3DLJA 3IBCB 1M1KT 3CJRA 4M5NA 1RTZA 3C66A 4QIFA 4J37A 2OI2A 2Y8YA 4C11B 3B4MA 4TN2A 3MFIA 1KVJA 2HGNA 2HS3A 4ZPCA 2DGQA 2ALYB 4FPRA 4NLWA 3ZTSA 3BDPA 5D0GA 1T7PA 3M6XA 4H4OB 1WDTA 2IYIA 3AT1B 4A48A 4C8ZA 1NO8A 1Q8IA 3J7YI 1DAXA 1UJ5A 2GV1A 2HIQA 1BWEA 2YNIB 3ILJA 1TV6B 1S9GA 3UD4P 4K2XA 1WNEA 4N77A 3IBFB 1EHWA 2XLJA 2KFZA 2ZC4A 4A8WA 3ITHA 5M2PA 1X5PA 4WZMA 1TFWA 3RJMB 1NAQA 2XYPB 1FRXA 4TNOA 3IA0A 2ZHAA 2VG7B 2MYFA 1XMBA 4J90A 5K14B 2ZZNA 3T9NA 5ADZA 3G2XA 5EWGA 1FKOB 3MAHA 1R0BG 1XNQF 2OFHX 2QMUB 2A6OA 4QPTA 1BQXA 1CJTB 5J1EA 4U7CA 4HI2A 2C3UA 5D0HA 1KR4A 5IWAF 4ZLJA 2BQRA 1C0UA 1TL7A 2HMIA 3BN4A 1BXNA 1ZAWA 5AJ3J 3EDRB 5K8MA 5KFUA 2VPWB 5E3CA 2KJVA 3I4HX 5A8RB 3P5BP 3K8WA 2HFVA 3VAFA 1TUVA 2A1BA 3S1TA 2R3VA 3HKWA 1S1WB 1WEXA 1TL5A 2JFDA 3BGFA 1E6VA 2LQ8A 2FTRA 2QRRA 4DCPB 1MROB 4Y2MA 2OHDA 5C25A 1YVFA 2MHEA 3TAQA 3FUYA 3RR8A 1RBOB 3KNAA 4DU7A 2OO4A 1FJEB 1L5UA 4ID5B 4CLLA 3TZXA 4OJ1A 2KFYA 3UNGC 3DRRA 4ZVFA 1SJFA 1RT3A 2QLFB 4FF2A 4E2FB 4RW6B 4MFBA 3KWMA 4HVZA 3N4WA 1H0HB 1WG5A 2PN6A 4UY8T 3NGSA 2H4YB 2ZJRQ 3BO4A 4Y0FA 2VG5B 3EGWB 1U1OA 1TMMA 1QSLA 1SL2A 3UQSA 1NKEA 4RBVA 4K4VA 4GKJF 2C2DA 1KD1T 3K2YA 3CIMA 4FXWA 3SDEA 2HLUA 2VD3A 1KNZA 1JLEA 5IQQA 3TP2A 3HD1A 5JUMA 3TA2A 3TQEA 4W98A 4ZVUB 2V69A 3OL7A 1J2VA 3QATA 3D6FB 1S48A 1KC8T 3EZ5A 3AQOA 1GXTA 2PSZA 3ZZYA 3BSAA 3TNVA 2UU9F 1JXVA 1Q7YT 4YR2A 3K89A 2PMHA 1B64A 2B56A 2X1AA 1H7XA 5T41A 1T9WA 4ZVGA 2N4CA 4RNFA 2VA3A 3JS9A 5FIIA 2BJ3A 2YNGB 1HWUA 3V81B 1WC3A 4GO7X 1PILA 5A2QY 3IWXA 2HQ3A 1NNDA 3MAAA 4U67Q 4C0BA 3CD0A 2KL8A 2DPIA 3G4SS 2GMHA 2W2NP 1SI9A 4ICLB 1HL6A 3NG8A 1GXLA 3A8JA 1NK0A 4QCLA 4DX7A 2DRBA 1YLXA 1FRLA 4X4UA 2QJ3A 4C8MA 3HHNB 1S6QA 8AT1B 4L3NA 3K57A 3GLJA 1SJ3P 4B9TA 2UZAA 4JI7J 1KOHA 3GSDA 4C8OA 2OJ3A 4JV5F 3MECA 1HI0P 3PKYA 2EC2A 1D8ZA 5F0UA 4ZDNA 3PIPQ 4CNYA 2HZAA 1X9SA 2LECA 3S8SA 1OQ3A 2OP5A 3VVTA 1OSCA 3DRPB 1D9AA 1RADB 5LT5A 1VRTA 3I5CA 1AYEA 1NK9A 3OTOJ 2MGZA 1TKXA 4ZS6A 3GZ7A 3CD6S 3VQSA 1VQKS 3WIVA 1CPZA 1YJVA 3CGIA 4MMOA 2LFVA 3TZYA 2DK2A 3H20A 1NK4A 2DHXA 3QAUA 2VOOA 2G13A 5ITHA 4I67A 2V4RA 2M0GB 2HZVA 4TLQA 2P9EA 3M9MB 5AXNA 2HK3A 1UVIA 3OFHA 1VQ7S 3BSNA 4YEAA 4ETXA 2XMKA 5J2PB 2U2FA 3CCZA 3DOKB 5IFMA 4ID8A 5HVFA 1SJ1A 4DN0A 2C2NA 2HIYA 4CT9A 2E5GA 3CJSA 4KGXB 1DJ0A 3NLCA 1T05A 3N5FA 3NP5A 1WOSA 3VGTA 5AJ3F 3CCUS 1D9DA 3H5YA 4NWBA 3MMCA 5GMEA 4WBFA 1NXIA 2VU5A 3G6ES 2KKHA 4DL3A 2BZ2A 4WP8A 2R8GA 1RTHA 3HLUA 2PO4A 3R5DA 2RQ4A 1FJGJ 5E5NA 2XG8A 1PG5B 4I64A 1R0AB 1MWQA 7FD1A 1VISA 4LFBF 1FTCA 2Q43A 3IM8A 3HULA 1LOUA 2DNZA 1N5SA 2HURA 1JIHA 3DNCA 5D3GA 2DKOB 3ZZZA 4WPAA 1JLFA 2W25A 3T5HA 5EWEA 2QLXA 4J9RA 2J0XA 4X65J 4F4ZA 3KJFB 1FK9A 4M5GA 3THPA 1SQFA 2OLWA 2DIUA 4KTQA 3RRHA 2A2DA 1RYSA 4EK2A 2ZEJA 3K5LA 1U0HA 2XS5A 1N0UA 1VQ4S 1PCAA 4ZN1A 1UW9A 2QLWA 3OXLA 2VKRA 4PXEA 2DT9A 4F4YA 3QWPA 2J9DA 3MPVA 3PXGa 2DO0A 1XTZA 2CG4A 1NK7A 2YQ3A 3H7HB 3PACA 1BQMA 1L3KA 3K7RA 3AJDA 4RU2A 4CLPA 3MWBA 3PR5B 1YJTA 3CC7S 3V4IB 4DV2J 3DXBA 1IN0A 2C28A 4AXJA 4HL9A 1RGVA 4JI3F 2CA9A 3H59A 3OL8A 2Y1LB 3GU0A 5KT2A 2W4PA 3T9ZA 2RS2A 1HA1A 2BKNA 3LAKA 3PR4A 1TMJA 3DOLA 5JMNA 4ED8A 4NL5A 1SH2A 3CJQA 4UUWA 2BANB 1BWVA 2DRDA 5HMXA 1FT8A 2CQBA 1SKRA 3TAMB 1NZ8A 4CTAB 1LNQA 2GVDA 4X4TA 2X1BA 3Q2SC 3KLIA 3DMJA 3IXQA 2CPJA 4PPZA 3EX7B 4M5LA 4JUZA 3OXGA 2XHWA 1XR6A 1TP7A 4FBTA 1F6TA 1CC8A 2C3PA 3NOCA 1J5EJ 3I96A 4O3RA 1BE4A 2VG6B 2R2UA 1JB0C 2XLKA 4LFCJ 3MTKA 1RCXB 4TYAA 3GIIA 3G82A 5F8JA 4JI4J 3WBZA 1HYSB 3AD8C 4EYIB 4EO6A 3NGTA 2J8SA 4IFVB 1HW9A 1M0SA 4ZPWR 3EXYA 3OTOF 4RW7B 2L9WA 3GIRA 5H9EK 3FMBA 4QIWD 3CDBA 2RVJA 2JZ5A 2YKPA 3RBDA 2XB2D 1RABB 1VIOA 2MKKA 2IBOA 4AXIA 1VK8A 1O51A 4CLKA 1J5OA 1NPRA 2DXFA 1UCNA 2F65A 5FDLB 3O5TB 2IMWP 2AZ3A 1GMVA 3KDOA 4YB6A 4FKYA 4ZPBA 1B4SA 5K9FA 2XY5A 5LXRA 4P2MA 3W8GA 4GO5X 3QLHA 1U48A 2HYIB 2M8HA 3TZZA 2W4CA 4Y2AA 4PUOA 1UFLA 1XNRF 4YMEA 1SIZA 2DTJA 1ZETA 2F7VA 3IRWP 3DKDA 2YKMB 4CQ1A 2P9GA 4OV1A 4ZPTR 3OUYB 2HFUA 3VZHA 3D2WA 2B4PA 1U09A 3OD2A 5CHCB 5CAAA 1VBYA 5IM0B 1H74A 4QR0A 3FBBA 3FZ2A 3VQTA 4Q2LA 1LWFA 5K8OA 3UFCX 2YBVA 5KFXA 3PW5A 4K5RA 2ZOFA 1VC5A 2MSTA 2CPYA 3M6WA 1CJVB 4O4RA 2HHQA 4QR2A 1IKWA 1KRPA 3OFFA 1FJCA 2BW7A 3POTA 3LO3A 5BYSA 6FD1A 4NXNJ 1YHQS 1EIYB 1SKWA 4HKQA 3RB3A 4RW8A 2E7VA 3OV7A 1HBUB 2G0JA 4RL1A 1RTDB 3PO4A 1UEUA 3H2UB 3W2WA 3FFIA 2B4VA 3DGPA 4IO1A 2FIUA 2HNDA 3CDWA 2QGFB 1AUDA 2YNHA 3VTIA 4X65F 4RPFA 3AAWB 2BQUA 1R43A 2Q6BA 4P2SA 2LKZA 5HJYA 3HZGA 5DDQC 3FK4A 1D09B 4EBCA 1RBAA 2W9CB 2UUBF 1VC0A 4CRJA 2E1RA 4YFUA 2XYGB 2EK6A 3MGJA 2Z57B 3TA1A 3DN9A 1KQKA 2ROGA 3HSZA 3BPDA 1JLBA 2NQPA 3EPGA 5CABA 2W4DA 1RT1B 4OFZA 3AB4B 2C2RA 4PCQA 3K0JA 1FWLA 3ENAA 1BD6A 4DF4A 2MZRA 3VALA 1AZSA 4A8FA 3RB6A 3GJTB 1G4CA 2XS7A 2A2CA 4NLUA 1T0TV 5F9LA 3K8VA 4ANEA 4MTPA 1RSCA 4ZHRA 4NCGA 2OPSB 1S7HA 1NH8A 1F60B 4F8RA 4NXMJ 4N76A 4ES1A 4DV2F 4YY3J 1ZS6A 3OTCA 2YH1A 2KDOA 3MR7A 2F1FA 1HWKA 2XMUA 2HFZA 1MU2A 3V2UC 2C2MB 4B3SF 1Q7LB 4X62J 3KDNA 4NASA 3N6MA 1Q82T 4YOEA 1XQIA 5KFFA 3NNCA 3GONA 1C1CB 1Q5YA 1SC1B 1NKCA 1TL4A 3DYAB 3G8TA 3H5UA 2R2SA 3O6QA 4A4JA 1VMBA 5DLFA 4DQRA 3JSBA 3IS9A 2F9JA 5I3PA 3U1NA 4I2QA 4ENOA 2YKAA 5F8MA 3R5BA 2HNZB 4NX9A 2R7UA 2LU1A 4DI6A 3FCVA 3FVYA 2RDJA 1VQ6S 2AYEA 4YDXA 1MN7A 2MKYA 1MMLA 1N36F 4KFBB 4K4YA 2KG1A 3ENQA 3PM9A 2V5HG 5E3RA 1AFIA 3I87A 1HQEA 2WCXA 2C3OA 1Y9OA 3UI3A 4B02A 3US5A 3H8YA 4DDFA 2AMCB 1R27B 9RUBA 3ET6B 5JVGQ 3TQ1A 2PMWA 3HHLD 4JI4F 2EKYA 3NY0A 4YS2A 2O3DA 4RBTA 2BRKA 2ZH2A 2KN4A 2XCPA 1QTNB 4G6VB 2GZOA 1HNZJ 1HQUB 1YJUA 3LGMA 4DFKA 2QZ8A 4OLOA 2B9EA 1RAAB 1UPMB 3SBMA 3UVJA 1F1BB 3BKTA 3Q8UA 5E0OA 5CYMA 2QA1A 4KC5A 4KGVB 1KFSA 2MDAA 3H0PA 2KT2A 4HACA 3LPEA 3W9HA 1IM6A 3JSYA 4NRUA 2B6AB 1EX8A 1Q8KA 2VFUA 4EU0A 3AJ1A 1REVB 4TU9A 3QAEA 4FYVB 4OHXA 5K5MA 3H2LA 3MF5A 3KG1A 2Y0SD 4DX8H 4ECTA 4RZRA 2RH3A 2XULA 1U1RA 3U1MA 5HL7Q 4Q8FA 4JV2A 4LIRA 4RW9B 3D66A 1ZOTA 3DM2A 2RHQB 3GG1A 1VQ9S 2MQLA 2N7YA 5KG2A 2H65B 4A8KA 3HVTA 3QJPA 4WK3A 7AT1B 2V4JA 4ZJLA 1SQEA 1N33J 1VJWA 4L72B 3ZTQA 1L3VA 3C6UA 1EKRA 4ERDA 3GQCA 1NSPA 2OFGX 3MEEB 1S1VA 4IO9Q 4FN5A 4O4GB 3K58A 1H7WA 2CQ0A 2AWZA 3HMJG 4PQUA 1JLAA 4OYIA 4NXNF 3UDVA 4FS2A 4AL6A 3P96A 3FBCA 4DV6J 1FJ7A 4AL5A 2Q1LA 2OPQB 1IKXA 4FNHA 1M1HA 2IFXA 1SH0A 1H98A 5KG0A 3J81Y 2HQDA 5F8IA 1ROFA 4KH1B 4I6WA 5D4LA 2HQFA 4J9VA 5B0DA 2ASLA 4LSLA 1PO6A 2P2CB 5KFIA 1T9TA 4GVLA 2HHSA 2ZJQQ 4LBPA 4DR7J 3ADAC 2JC1A 5KFZA 3L4BC 4DUYJ 3OVSA 4DWIA 2DEJA 3QSYB 3BQ1A 2XY6A 2HVHA 1C1BA 1PSDA 5SUHA 3HHDA 3H90A 2FLOA 3IMQJ 2GW8A 4XPCA 3DLKB 2EFOA 4PXDA 4HLBA 3JQKA 4ZCLA 1SUQA 1I6JA 4X4QA 4ZVTB 3TANA 1C0TA 3UCUP 3JYTA 4KV8A 1UTAA 1P27B 4UQTA 4CH7A 3OR1B 3JSMA 3BSCA 1S1XA 3JQJA 2Z56B 1GMUA 2GIQA 3FQKA 1U6FA 2HHXA 2MLYA 2D3O1 3O1LA 1QUVA 2M88A 3OVBA 1RAIB 2HQGA 2M4MA 3D6MB 2LP4A 2RKIA 4G1IA 3KJVB 3NCRA 3KLHA 2E9RX 1VQ8S 2FJVA 4L6V3 5B0BA 4WYLA 5E2QA 4FF1A 2A3JA 4CO2A 3R2DJ 3IWNC 1F3VA 3GB0A 1NCLA 4AQYF 3KHGA 3N6LA 2XYHB 1FI4A 4XAKA 4FYDA 1S9EA 3I0SB 3QMQA 4DR1J 2WTFA 3CSKA 1WHVA 4F4KA 1HNVB 1N34J 1M5VC 5FJ4A 5EHHA 4I68A 2VUGA 4ECVA 3LP2A 4PQAA 4IH7A 2EFPA 4IG3B 4WXOA 4MAKA 3OHAA 5KAKA 1X7VA 1HNZF 5GAEI 1HWJA 1Q4RA 2FQQB 2CVIA 2MQMA 3OL6A 1JKHB 4LT6A 2CPEA 2A18A 3PVXA 1TK0A 4WE1A 2BJDA 1YWXA 2MZTA 2OPRA 2RF2A 4NYZA 4HDHA 3ELHA 3MZIA 3I0RB 2EBGA 3NGKA 3CE8A 4JYAJ 4QYZJ 4DV7F 5DQHA 1RU1A 3QJJA 1LW0B 2MHNA 5T7LA 4X66J 2VQEJ 1Y7PA 3A8IA 1UVNA 3B78A 1T3NA 1ZTWA 2AJQA 2VQFF 1P9QC 3HHLC 1CJKB 4PYAA 4MKBA 1VHIA 4WZQA 2DR6A 1U1KA 1DLOA 1NKBA 1GX6A 2HAIA 3K5MA 4F67A 5GMKa 3OSPA 2BYCA 1VRUA 3J7A1 4HT7A 3LOUA 4DFMA 3QT5A 2VBZA 1QD1A 3HI9A 1ZM9A 2OD4A 4R8UA 1DHMA 3PW7A 3F41A 2MQOA 3DOMA 4JI8F 3MMAA 2UXDF 4OX8A 2UVRA 7FDRA 1N33F 4AL7A 4USTA 1HFEL 2POKA 2C2OB 4GC7A 3E01B 2GVZB 1TAUA 3QZ8A 2XMWA 1QSYA 1JLCB 1QJHA 2BDPA 3MM6A 5H9EJ 4HI1A 3UR0A 3W2VA 5ETKA 2KVQE 4LRAA 3MCOA 2C42A 3DGVA 4L75A 4NI2B 2DNNA 1OYDA 2KZMA 3FSYA 2W9BB 4E0DA 1B7YB 4ZCIA 1AXQA 3MPUB 2GGPB 2N4DA 3C16A 3FNNA 4KJIA 4F02A 5C42B 1EP4B 3M6UA 4LF2A 2D7SA 4CLTA 4DUTA 5A8WB 3V6KA 1UA1A 1NUEA 2E7XA 3KLGB 2VIHA 2LXIA 1RWKB 3AY0A 3PEHA 4JB8B 4CCHA 1NSQA 3THVA 1YITS 5RUBA 2V63A 2GIRA 2DR9A 5GMDA 1LK5A 5GADU 1F9EB 5KFRA 3UWTA 2R7TA 4EO8A 3PYFA 1RLCL 3GSIA 2YKNB 4M5IA 5A6PA 4LRDA 5T14A 3FBFA 2QL7B 2CQ4A 1N48A 3KG4A 1YJNS 2GHVC 1UVJA 2UUAJ 4NLRA 4C8NA 2CQDA 2BRLA 2GAGC 1VGYA 4ZCKA 3CDEA 5CZXA 4DR5F 1TKDA 3J7ZT 2YX4A 1NDLA 1HR0J 2OPPA 2PA8D 3GCWP 2HHVA 4G1QA 1LWCA 1M5OC 3L3CA 4ZMMA 1FFWB 1QE1B 3M32A 1VBKA 2KRBA 2FLNA 4LF8J 5ETQA 1Y10A 4LSZB 3M4XA 1T3OA 2BA9A 3BM7A 2JEIA 3R7SB 4DR1F 2I9SA 3D0HE 2AJ4A 5BR8J 1SL0A 4J9PA 3AOAA 1TKZA 3J80Y 2D9OA 3D7SB 2B8PA 4WP3A 2XGPA 4DV1F 1IJEB 2RUSA 4CIOA 2UVVA 4LF7J 2R8IA 2DHHA 2WBMA 2XZDB 5LM7E 2EBEA 4R0EA 3OTBA 3G71S 4X2BA 3CJ5A 2RB7A 1Y5LB 2IHR1 4CI0B 4DSLA 3D3BJ 1Q8LA 1XN9A 4O44B 3FCWA 3ZC4A 2KU7A 4RBUA 1HARA 4YDDB 2IC3A 1BQNA 1KTQA 3ZZ0A 4ZA1A 3CO9A 1HHQA 3QNWB 3JTOA 1NDPA 1RA7A 1HNIB 1NU4A 4QIGA 1K1SA 3D0GE 4QYRA 3MCNA 2VQEF 5DRKA 1VBXA 3HDSA 4EEYA 2VASA 2R8KA 3MMBB 4F0MA 3M1VA 1FDBA 3Q0AA 2HS4A 5HBMB 3FRZA 2E1CA 5CYJA 3L7UA 1NH7A 4LF6J 2YY3A 5H9FJ 3LP0B 5DZ7A 3OL9A 1PYOB 2DR5A 3G9CA 3LP1A 2OTJS 1K0TA 2HGLA 3H5SA 2QSFA 3D9BA 1B70B 2JSXA 4WIQA 3CMES 2ZD1A 4LR8A 3NNAA 4DV0J 3VHQA 4DR6J 5D15A 2FD2A 1YX2A 2HZCA 4HEA9 3WC2A 2KH9A 1BUXA 3TX8A 2B9YA 3GILA 1G7CB 1B3TA 1S6PA 2DNOA 2H5EA 5LMUJ 5M2UA 3W5XA 2BM0A 2BE2B 3S01A 4OI3A 1DZ5A 2MEWA 2QFIA 1RT5A 2E1AA 1RTJB 3RZAA 1CS4B 5A0YA 4WFBQ 2PD1A 2ROPA 3DHXA 1JXLA 2F4FA 4USJC 4A8SA 4YHHF 2AQ4A 4J9MA 2CJBA 1KBRA 2QC3A 1BGXT 3MPWA 1NPPA 4UZCA 1AB8A 1DTQA 1F5AA 3H4BA 2ZZTA 1SV5A 3DDKA 3BPSP 1N52B 4RUBA 3KLEB 2CNLB 5DDOC 4ZLPA 4H4KC 1HNWF 2FJEB 4KHPJ 2NLWA 3HHLB 2MY8A 2BOPA 4DFJA 3M2UA 2IY5B 4NA2A 4HHUA 1Y3JA 5IT9Y 4Z37A 2HQCA 4C11A 5F9NA 4M5KA 2MJUA 4C0OC 3KUGA 2DNQA 2NXJA 2X3DA 3OQ2A 2MKHA 3FSXA 3B6BA 2RQKA 2ADCA 5DO2A 3UE2A 2UUAF 1JJHA 2VPZB 3TYTA 2K8GA 4OI6A 4PKDB 4H4OA 1PJ6A 3NCQA 1GTEA 1EB0A 1HR0F 2CXEA 2YNIA 1TV6A 1P1LA 1U24A 2VPXB 4DCJB 2F8EX 3TARA 4ZVHA 1FHTA 2ZNZA 1CBKA 2NXNA 2JHEA 4DQSA 2G9OA 1N6QB 2UXCF 2DNGA 1XIQA 1NJYA 1WOOA 4R25A 2BVZA 1GQEA 4IRKA 1LKZA 3B82A 2VG7A 5K20B
chains in the Genus database with same CATH topology
2OMLA 3QAUA 2VOOA 1TR0A 2G13A 5K14A 2ADBA 5ITHA 3CWJA 1KTVA 4I67A 3UDCA 3OVAA 2V4RA 2M0GB 4PG8A 2I5JA 2RE1A 1NB7A 4IOAQ 4TLQA 3QLHB 2P9EA 4MH8A 3M9MB 5AXNA 1AROP 1UVIA 3CCLS 4ZP6A 1FKOA 4PUOB 3OFHA 1VQ7S 3BSNA 4YEAA 2O66A 4ETXA 2IM2A 3MD1A 2XMKA 2CJ9A 2DHAA 5J2PB 2MKIA 2U2FA 3CCZA 3DOKB 5IFMA 1D0EA 1ZYQA 4DQPA 2QV6A 2NS1B 4DV6F 2VC1A 1VFJA 4ID8A 2NXUA 3IR6B 3V5RA 4EZ6A 1SJ1A 1Q1KA 2D3OR 4ED0A 3DLBA 3VAGA 4DN0A 2WONB 3IRXB 3RB0A 1CLFA 1DARA 4CT9A 2E5GA 3R5CA 1LW2B 5G0RA 1S9FA 2ZKUA 4E98A 1DJ0A 2FHJD 3NLCA 1T05A 3N5FA 3NL0A 3NP5A 5AJ3F 4OZ1A 3CCUS 3RB4A 3CJKA 1D9DA 1LWFB 3H5YA 4NWBA 2EPIA 3MMCA 5B0EA 4CH0S 2YWKA 3IG1B 2YWFA 3G6ES 5DQGA 1FNOA 2RIJA 1MWZA 4XK8C 1Z2ZA 5A8RA 3SI8A 2KKHA 4DV5F 1L3SA 4DL3A 4O3OA 4O44A 1S1WA 2BZ2A 3TUZC 5DG9A 3EPIA 2MZJA 2R9LA 1LV5A 3FQLA 4ZP8A 5L1IA 3O8WA 2R8GA 5CCMA 1RTHA 2K7KA 2QEXS 2GO9A 1IKWB 1RAJA 1UEVA 2DHSA 3M8PA 3QGPA 4KSEB 5E3PA 3HLUA 4DR7F 4B17A 5KFBA 2YKQA 3OBIA 4K4ZA 4CNZA 2PO4A 3R5DA 1HNIA 2RQ4A 3K5PA 4RNNA 4B9UA 3POTB 5E5NA 4I6AA 2P9CA 5IS2A 3MUMP 1MROA 2KJWA 2XG8A 3CJ0A 3LF0A 5AXMA 1Q86T 1IBKF 1A9NB 4DUYF 2ROEA 4I64A 1R0AB 3DLGB 7FD1A 4LFBF 2DH9A 3BGRB 4ED2A 1FTCA 2Q43A 1N8RT 1XWLA 4NLTA 3PX0A 1L3UA 4RW8B 4EBDA 3I9V9 1LOUA 4K5SA 3MMBA 2ZZMA 2DNZA 4C8LA 2V9KA 3HVWA 1N5SA 4R5PA 1JIHA 2E7WA 5HBMA 1O5JA 3UPFA 3DNCA 1TVRA 3IC1A 3W2WB 5D3GA 2DHGA 4KKOA 2RS8A 3FFIB 2LYVA 3AQPA 5KFWA 4ID5A 3Q2TC 3MEGA 3ZZZA 4UQGA 4CO5A 2D9PA 1JLFA 2HNDB 2W25A 5KFLA 2NREA 4BDPA 3T5HA 2QFJA 2YNHB 5EWEA 2QLXA 2EK1A 1QM9A 4RW6A 4J9RA 2J0XA 3VAHA 3DDNA 4WJBA 1UP1A 4F4ZA 3RTVA 2E44A 3LP0A 4ZOSA 2CPZA 3HKZD 2KTQA 2R7VA 5GADI 1FK9A 3ISZA 3SV4A 3TO8A 3THPA 1HWLA 2FJAB 1RT7B 1S0MA 4DSKA 5KG7A 2OLWA 1CQNA 2DIUA 2C3YA 1S72S 4KHMA 5KFMA 1TAQA 4KTQA 2VG5A 3RRHA 2A2DA 2W7OA 1RYSA 2A10A 5KFDA 3MUTP 1CC7A 1NEEA 5GVQA 3SYZA 1M5PC 1SIWB 3SFUA 4EYHB 3O3LA 3K5LA 2XS5A 2OKQA 5I42B 1N0UA 2HFNA 2ZDPA 1VQ4S 3UR3C 3CJ3A 3HM9A 5E7OB 2W24A 2B7BB 4KRWA 2M70A 2F40A 4ECUA 2UUTA 2IJNA 4DV3F 2B9WA 2QLWA 3DRSB 4GMKA 2FJWA 2VFVA 3OXLA 3CCES 3NBPB 2VKRA 4C3MA 2CZ4A 1S77D 1JLBB 1FNXH 2JVOA 4PXEA 3QGHA 2DT9A 1U8SA 2XGQA 2ZH1A 1V6HA 2R2TA 1FCAA 4W90B 4F4YA 3E8OA 2DGUA 3QWPA 4OHWA 1GX5A 2R2RA 1D3WA 5LMUF 2J9DA 4U9RA 3MPVA 3PXGa 1X5OA 3L7OA 2DO0A 5FD1A 1RTIA 1XTZA 3I32A 2BE2A 3CCVS 2CG4A 1FA0A 1NK7A 1OS5A 2YQ3A 4QQBA 1WACA 4IRCA 4YB7A 3KOAA 5KFCA 2RJZA 3H2VE 2IA6A 3PACA 2CQIA 4G3IA 1BQMA 4ZHRB 2WRMA 1L3KA 1YJWS 1K73T 4NCGB 1VQYA 2AP6A 2HNYB 2K1RA 3K7RA 1RTJA 3A8EA 4RU2A 2XWXA 3MWBA 3PR5B 1MSWD 2E29A 3CF5Q 1YJTA 4KT0C 4QJVA 5KG6A 2KXFA 1VI7A 3CC7S 2XNRA 5HMYA 2ZJPQ 3V4IB 3DXBA 1IN0A 2C28A 2JEGA 1JX4A 1HHSA 4AXJA 4HL9A 1RGVA 4JI3F 3C6TB 2WAQD 3H59A 1X0PA 3OL8A 5U47A 3C3LA 2QMWA 1N34F 1U7LA 2CQCA 5IZHA 3Q8SB 1ULRA 2W4PA 2YNGA 4IOBA 1MU2B 3FMWA 5KT2A 3MXHP 2EWHA 5LSOA 3BQ0A 3DHWC 1N56A 3T9ZA 1NRKA 1EETA 4DG1B 3V81A 3GV7B 2ILZA 1X4AA 1JXEA 1I94F 2KT3A 1HA1A 3LAKA 2RS2A 4XO0A 5HP1A 3KTQA 1FESA 4RUAA 2IM1A 1K1QA 3PR4A 4DLGA 3CC2S 1Q81T 2J7KA 1OWXA 3DOLA 3QO9B 3NAIA 4C8KA 4NZ6A 4ED8A 4NL5A 4AE5A 3KLEA 4N41A 1SH2A 3CULA 2ZOMA 4ZP7A 1HI8A 1ZPWX 2ZBCA 4UUWA 4K4UA 4OI1A 3M30A 4KHPF 4ICLA 2BANB 4NOHA 2F9DA 5HMXA 5B09A 1FT8A 3RAMA 3HHLA 2CQBA 2VKZG 1SKRA 3TAMB 3BO2A 2ZE2B 5KG3A 1JLQA 2L9NA 4ZP9A 4FXVA 5CXTA 1TFYA 3IS9B 4IG0A 3P3DA 1TL3B 4UOCA 1P1TA 4CTAB 3RYLA 4I2QB 3TOQA 3BF4A 3B4DA 1KFDA 4ZK7M 2X1BA 2ZC3A 4X4TA 3Q2SC 2M52A 3TUJC 1H2VZ 4USHA 5B0GA 3KLIA 3DMJA 3E3XA 3GFXA 2XI2A 3IXQA 4IUFA 4OL8A 2CPJA 4PPZA 3PKMA 3EX7B 3VWSA 5DS7A 4JUZA 3OXGA 2XHWA 3MMJA 4DQIA 1XR6A 4IFYB 2KHDA 1TP7A 4Y00A 4FBTA 5IT4A 1ZH5A 3MM7B 1LFWA 1CC8A 2K3IA 1X4HA 5F8NA 2VODA 3M8PB 2C3PA 4DSIA 4JYAF 3QYYA 2EFQA 2G1DA 1HQEB 4F50A 4AFFA 3G8SA 2QIFA 2IVYA 2R4FA 1KOOA 3I96A 2FLLA 1XK8A 4O3RA 2RQMA 1E6YB 1QSSA 2VG6B 2EFVA 2OSQA 2R2UA 4F3OA 2HHTA 2KB2A 4X66F 4F26A 2W9CA 5EX0A 2MKSA 5A8KB 1OIAA 2JEFA 2CQGA 4LSNB 1JB0C 2BJEA 2XLKA 2RQCA 3TVZA 3MTKA 2XEXA 2YWHA 2XNQA 1W2BR 3MTJA 4TYAA 3GIIA 4MYUA 3HVRA 1R31A 5F8JA 3WBZA 1HYSB 1YJ9S 3GMGA 1VQPS 4DS5A 2DNHA 4WK1A 4EYIB 3DRPA 1FXRA 4KIAA 2NSBA 4EO6A 2HRYA 1S1TB 1LQ9A 4OX6A 1N0VC 4IFVB 3HHEA 3RW6A 1HW9A 2R8HA 1M0SA 2VL1A 4ZPWR 3EXYA 3OTOF 2L08A 4RW7B 3ENWA 5KT3A 4NLYA 3GIMA 4PG5A 4C3KA 2MZQA 5AE3A 2L9WA 2V4QA 3MI7X 3IFEA 1WHWA 2AU0A 1Q78A 2NZ4A 1UAWA 3FMBA 2PC6A 2ALZA 4QIWD 3CDBA 2RVJA 3PW2A 1RP5A 3S7RA 3V6DB 2JZ5A 2YKPA 4NA3A 3RBDA 3RU0A 2XB2D 1VIOA 1N6QA 2MKKA 2R7WA 5J2NA 2IBOA 4AXIA 1VK8A 3QGGA 1O51A 2R7QA 4BBYA 3M05A 2OAUA 4NMLA 3EGZA 5CYMB 1J5OA 2L41A 3KK3B 4QWEA 3THTA 2MZSA 3HK2A 2QA4G 5FDLB 5J2QB 2PE8A 3O5TB 4J9OA 2IMWP 3DI6B 4XPEA 4QU6A 3JSRA 4YB6A 2GHPA 4ZPBA 2FJBB 1MWYA 1R3NA 1UKUA 1Q79A 3I5BA 5J1NA 5K9FA 4X4SA 2DBBA 2XY5A 5LXRA 4B3TF