2LMIA

Nmr structure of the protein bc040485 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
GSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords G-rich sequence factor 1
publication title NMR structure of the human RNA binding protein BC040485
rcsb
source organism Homo sapiens
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lmiA01
2CPJA 1JMTA 4TU9A 2J76E 1VQOS 2L41A 1UFWA 1U1PA 3RW6A 3CC7S 2D9OA 4UY8T 2MKSA 5FJ4A 2KXNB 2OSRA 1SJQA 2MZQA 1U1KA 2G0CA 1UP1A 2A3JA 4V19X 5D77A 2EK1A 5IFMA 5GVQA 2DHGA 2D3OR 2K3KA 3FEYB 1U1OA 2NLWA 1URNA 1CVJA 2KG1A 4WFAQ 1SJRA 3VALA 1U6FA 1YWXA 2KRRA 2AYGA 1KD1T 1VC5A 2M0GB 3G9CA 2JX2A 2M7SA 1WELA 2DNKA 2RS8A 1VC6A 3THPA 3MUTP 2DB1A 1WHXA 1WHWA 4UQTA 1L3KA 1K9MT 1X4DA 2DHXA 3FEXB 1WF2A 3CCLS 2CPZA 3VF0B 3MURP 1WTBA 3VAMA 2KM8B 1OPIA 2DGTA 1WWHA 1WG4A 2MYFA 2KU7A 2U1AA 2X1GA 2DNYA 3VAJA 2DH8A 1WI6A 2N7CA 5CYJA 2G4BA 1K73T 3PIPQ 4QPTA 4OZ1A 3VAHA 4WKRA 1NO8A 2BZ2A 1VQ9S 3CPWR 4QU6A 3J7ZT 2F9DA 1S72S 1M90T 3MOJB 2DH9A 4W90B 1ZZFA 2JWNA 2M88A 2MJNA 3UCGA 3G4SS 3CCES 2RRAA 1VQMS 1X5SA 4TLQA 1VQLS 3RW7A 3NNCA 5LSOA 4WCEQ 4Y00A 2DITA 1H2VZ 1VC0A 2LXIA 2AYEA 2JRSA 5GAEU 5ITHA 3IWNC 2DGWA 3R27A 3DXBA 2CQ4A 2RNEA 1BY9A 2ADBA 1QVGR 3TP2A 4IUFA 1X4CA 2LMIA 2XB2D 3H2UB 2CQBA 1AUDA 2DNPA 3ZZZA 2RT3A 3HHNB 2EVZA 3CTRA 2YKAA 2CPIA 5HO4A 2J8AA 3V4MA 3CF5Q 4FXWA 2CPDA 2M52A 4LJMA 2DGXA 3UD4P 3CC2S 2OTJS 2DIVA 2DNHA 3MD3A 5JVHQ 1X5PA 2ZJPQ 2PE8A 2MY7A 2VOPA 2DNRA 2GO9A 2CPFA 5DDPC 2AYBA 1X4HA 2DHAA 2JVOA 2LECA 5GADU 2FY1A 2RVJA 1H2UX 3VAFA 1FT8A 2MQMA 5DDOC 2F9JA 1FO1A 2KVIA 2I2YA 3N9UC 2MZSA 2KT5A 1PGZA 2KH9A 2DNLA 2MQPA 3CCRS 4W92B 1JJ4A 1FJCA 4IO9Q 1M5VC 1DHMA 1X4EA 1DRZA 2AYMA 1WG1A 2X1BA 2ERRA 3THTA 2KG0A 5IQQA 2CQ0A 5DDQC 2RUGA 3MUMP 3ULHA 5JVGQ 4LIRA 2YTCA 3K0JA 2OTLS 1WG5A 3R1LA 2LXUA 1NU4A 4QQBA 3SXLA 5H1SV 4Z2XA 1DZ5A 2VOOA 2HGMA 1Q82T 5DDRC 2MPUA 4YB1P 2MQLA 2WBRA 3CD6S 1HA1A 2HGNA 2D9PA 2MMYA 2VONA 2MZTA 2N3LA 1JJHA 4LMZA 1P1TA 1JJ2R 1WHVA 3I55S 2MSTA 1SJFA 4ERDA 1U1LA 2E5HA 2LKZA 1KOOA 4ED5A 2F3JA 1K8AT 1VBZA 2V94A 2LA4A 2SXLA 4C0OC 1X4AA 3LPYA 2J0QD 1NJIT 1G2EA 2MQNA 2ADCA 2MKIA 2DGUA 3CCVS 3UD3P 2DO4A 3J7YU 3H2VE 3CCUS 2DNNA 1S79A 1N88A 2PEHA 1WF1A 1YITS 2L9WA 2CPEA 2DNOA 1X5OA 2DISA 2Q79A 2MZJA 3MD1A 1VQPS 3MDFA 1KOHA 1M5PC 2M8DB 3NNHA 1Q81T 3MXHP 5GAGU 2CPYA 3G8TA 1VQKS 2DNZA 4U67Q 2E5IA 1VQ7S 1A7GE 1KC8T 3G71S 5LJ5Y 2CPHA 5LSLA 5LXYA 2HVZA 4FXVA 4J5OA 4PKDB 2QFJA 2O3DA 2DHSA 2OSQA 3BO4A 1YJ9S 1X0FA 4ZKAA 2KYXA 2LCWA 2QEXS 4WIIA 5BJRA 1PO6A 3PIOQ 2MY8A 3P5TL 3G96A 2CQIA 5DM7Q 2L08A 2XS2A 2MGZA 2DGOA 2M9KA 2CQ2A 3ZZYA 4PR6A 1OWXA 2HZCA 2JVRA 5DM6Q 2VODA 3UCZP 1P27B 3L3CA 2DK2A 4PRFA 3CUNA 3UWTA 2XS5A 2MQOA 2QA4S 1DBDA 1WEZA 3S8SA 1YJWS 2CQ1A 3TYTA 2CQGA 1FHTA 3NNAA 1R8PA 4A8XA 1XN9A 4YUDA 2XNQA 2E44A 2RRBA 3IRWP 3JB9k 1U1RA 2ZJRQ 1R8HA 1HD1A 1QM9A 2CPXA 3CCSS 3OW2R 3BO2A 1A9NB 3BO3A 2X1AA 1Q7YT 1H2TZ 2GHPA 1U1MA 1FNXH 1W2BR 2MZ1A 2M4MA 1VQNS 3NMRA 2KN4A 3NS5A 1FJ7A 5CXTA 1M5OC 1UW4A 2CQCA 2KM8C 2RQ4A 3Q2TC 4IOCQ 2DGVA 1RK8A 4M5DB 2XS7A 2M70A 5LJ3Y 2NZ4A 2MHNA 2YWKA 3UE2A 1FXLA 1D9AA 4P6QA 2LA6A 1U1QA 1Q86T 5CA5A 5EN1A 2DNGA 2FC9A 2MKHA 1WEXA 1YJNS 2EK6A 4CH1A 3B4MA 1N54B 3LQVA 1H6KX 1RKJA 2N3OA 2DNMA 3CC4S 4OZ0A 3NS6A 4WF9Q 1X4FA 3SMZA 1N8RT 1VQ4S 2N82B 2XSFA 5DETA 1U2FA 1M1KT 1WI8A 2X1FA 3P3DA 3CMES 1OO0B 2MXYA 1F9FA 2RQCA 2KXFA 2CQHA 3BS9A 3BEGB 3Q2SC 2MGZB 3MI7X 2HYIB 4CH0S 5HL7Q 5GAHU 2MZRA 1FJEB 2XNRA 2J0SD 2DO0A 3VAIA 5IM0B 2MKKA 2BOPA 2DGQA 1VQ6S 2LEAA 3CCQS 1YHQS 4C4WA 1YI2S 5LXRA 2FHOB 2M2BA 2UP1A 4QU7A 3US5A 2DNQA 1YIJS 2DGSA 2CQ3A 2E5JA 2CQDA 1D8ZA 1YTYA 2MSSA 2U2FA 1ZZNA 1ZH5A 3EGNA 1KQSR 2HGLA 3G6ES 3CCMS 3S7RA 1WF0A 3CXCR 2KRBA 2ZJQQ 3S6EA 2I38A 3VAKA 3CCJS 2KXHA 2YH1A 2KHCA 1OIAA 1X4GA 2RU3A 2G1DA 1M5KC 1HD0A 3EGZA 3SDEB 2DH7A 3U1LA 3EX7B 4EGLA 3UCUP 1VBYA 2MB0B 1WEYA 1WHYA 3TO8A 3CULA 3MUVP 2KFYA 3R1HA 5IM0A 2CJKA 1U6BA 4YOEA 3P49B 1U1NA 2MJUA 2M8HA 1O0PA 2LEBA 4TU8A 4RU2A 2FPHX 2B0GA 3HI9A 4IOAQ 4BS2A 3S01A 3VAGA 1VBXA 4CQ1A 3D2WA 2AD9A 5MLCV 4WFBQ 1VQ8S 2DIUA 1HL6A 5D78A 1IQTA 2OIHA 4F26A 4F02A 2KI2A 4Y0FA 3G8SA 1X4BA 4TU7A 2YH0A 3U1MA 2MKJA 3B4DA 5GMKa 3I56S 2MQQA 3DLLQ 2K8GA 2LYVA 3P6YC 1X5TA 1SJ3P 2OJ3A 1SJ4P 4C7QA 3SDEA 1SXLA 1QVFR 4CIOA 2LQ5A 3CMAS 1UAWA 2RS2A 1B7FA 1N52B 4F25A 4WFNQ 2FC8A 2CQPA 2E5GA 1VQ5S 2MKCA
chains in the Genus database with same CATH superfamily
4CM0A 2K1RB 3EJMA 1VQOS 1M5SA 1VIOA 3CCWA 4KPYA 3UDEA 2IA0A 1TFWA 1BQNA 1XERA 3IAS9 2ZH3A 4KPCA 3A8IA 2E66A 4A46A 1F3VA 5F0WA 4DR1J 5GVQA 5L38A 3RBEA 3RR8A 1N32F 1B64A 2GAHC 3D68A 3AA9A 2AEJA 4KQZA 2B9EA 2CZ4A 4CWBA 4GVBB 2B3TB 1KD1T 4B17A 2M7SA 2HBRB 1CC8A 2BE7D 5F41A 4UQTA 3HVRA 3G6XA 2YKNB 1H0HB 1U24A 1VDHA 4DS5A 2X1GA 1TKTA 3J81j 3DHXA 1PAUB 1U47A 2QMUB 5HQLA 3SQGA 3CCES 2Z4PA 5GADI 3VGVA 2UXCF 3EPIA 2XSJA 1JXEA 1VC0A 2LXIA 1YG0A 3LW5C 4E8UA 1PBUA 3IWNC 2HW3A 3R27A 1BXNA 3TP2A 4IUFA 3ZTRA 1Y3KA 2W9BA 4YP3A 4P7VA 2V8PA 3P96A 3KUHA 2VPWB 1KLNA 2GV1A 2ZBQA 1HFEL 4C8KA 2VOPA 4G1PA 1SI9A 2K06A 3BGRA 4ZOSA 2XZWA 5HVHA 2DNLA 2CNOB 3DHWC 3CDUA 4F67A 3E51A 1H7XA 4G1IA 3ULHA 2HFSA 4MKVA 3KJVB 3N6LA 2MPUA 4MK7A 4FYYB 3FCWA 3MAHA 3NGUA 4BHQA 5RUBA 4J37A 1WHVA 3HHKA 1H3DA 2E5HA 4KC5A 4O0IA 4F7VA 1NHUA 1J5OA 2FHKA 2YPYA 1GMWD 3J7YU 1HWIA 1YJUA 4W4MA 2KKHA 4CLKA 4LFAF 2CPEA 5K5MA 2H9ZA 4B3MF 1IR2A 4PG5A 5ETLA 2VBXA 2HK3A 3WX8A 3QNWB 1BWEA 2P9EA 1S0OA 2CPYA 3AD9C 3UNGC 5M2UA 2B4OA 1JJCB 2ZZTA 4URQU 2A2CA 1LW0A 2X3DA 3BR8A 5LXYA 2Z57B 4A8FA 3KK1B 4J5OA 2VG5A 4WFXA 3R2DJ 3JAMY 5HROB 4DV6J 3QGGA 2M9KA 2ASLA 2V2ZA 4M63A 1P27B 1TMJA 4K4UA 3HKZD 2YX1A 2RF2A 4B9UA 2MQOA 1YJWS 3MTKA 4ID5B 5AE3A 1Y5IB 3IBWA 3OW2R 2YNGB 5H9FJ 1Q7YT 1CC7A 4ZPVR 2QIFA 1GTHA 4DPWA 4YB5A 1T03A 2HS4A 2XYGB 2GVDA 1OPZA 1FRXA 3LP0A 2V2KA 4U9RA 1S12A 2BE2B 4FBTA 2VD3A 4M5DB 1MWYA 4ZIVA 3JQJA 2QV6A 4EBDA 4RW8A 1N54B 1QDUB 3FNNA 2OPPA 1IJEB 2C3PA 3HVAA 1SJ1A 5A0YB 3BH7B 1NPPA 5CHCB 1RWXB 3WQPA 3BEGB 2OMOA 2H65B 2XULA 2O5DA 2PO4A 1U0HA 4OI6A 4O3PA 5HATA 2LQ8A 3H5XA 4F3OA 4ILRA 1BD6A 2UP1A 1XMQJ 4DV7J 1HBNA 2B43A 4ZVHA 5E5NA 4URSA 3I5CA 1JX4A 1IVZA 1N5YA 4A8WA 3I0SB 1K47A 3PEJA 5EX0A 5KTQA 2QYGA 3KJFB 3L7UA 3BGOP 2RDDA 3EX7B 3NMAA 2E7WA 3BGUA 2UVUA 3V81A 4DV0F 3PHTA 3GJTB 4P2XA 3K5PA 2GA7A 5CABA 3ZZOA 2HVHA 1L3UA 3PX0A 1TK8A 3LP1B 4C8ZA 2DIUA 1KKHA 3DGVA 3HFVA 2O66A 2V4JB 2ZFHA 5KFSA 4RBVA 4F02A 1DFDA 2Q43A 4N77A 3A12A 4OI3A 1JLBA 3E8OA 2BABA 1YLXA 2IMOA 3W2WB 5EDWA 2JC1A 1MWQA 1V5IB 1G3OA 1YJ7A 4WYWA 1SL2A 4LF5F 1B7FA 3WHIA 4ZS6A 2FJBB 4DL4A 1HNZJ 1JMTA 3IBCB 5CYQA 4ILLA 1U1PA 1C1BA 3AQPA 2EFVA 4DX6A 1ZAWA 3PG9A 4TQSA 4DCPB 3GG0A 4JI7J 4L3NA 1RAHB 3H5YA 5A8WA 4DR4J 1AA1B 5KFXA 3FBEA 2PA3A 3CCZA 1PYTA 1HLWA 4NYPA 4NRTA 1N5QA 4B3SF 3G8QA 2Z30B 2HFOA 3T3FA 1PJ6A 2B56A 2CFXA 1CS4A 5KFRA 2YQ1A 4MK8A 1WHWA 2Y9HA 4M5MA 4ZVOB 3FEXB 2ZVIA 1PYOB 4EO6A 2Z58B 2FJXA 5F8JA 2N7CA 1LWFA 5BR8F 1HNXF 2G4BA 1K73T 3PIPQ 4X64J 3U7JA 4P75A 2DXDA 2RRAA 3GZ7A 1T9TA 1HR0F 3V2UC 3I9V9 4YN3B 1IBMJ 3GE9A 2FGCA 1IR1A 3PO4A 3TAPA 2IJFA 4F8RA 2ILYA 3UDLA 1HNVB 4NX9A 4YB7A 2DIVA 2E5LJ 1SL0A 4YHHJ 1X4HA 3B78A 2XY5A 1RBOB 2FYXA 1G7CB 4GRSA 4OMFG 1RQ0A 2J9CA 4TLRA 3Q23A 2FUG9 3EVMA 5A2QY 3ILOA 2X51A 2JZ5A 5IQQA 2JJ4D 2DR5A 1SC1B 1Z2ZA 4P52A 2LU1A 4LFCJ 4Z2XA 3R3TA 1VBKA 3VTIA 1YKWA 5KFKA 2W7OA 2IYIA 4HH0A 3HO1A 4ED2A 2JLFA 3UR3C 1RB0A 3CJKB 2V94A 3FEZA 1PBAA 3ET6A 4X4QA 3UD3P 3Q8QB 3M8QB 3M8PA 3FQKA 1PSDA 4L3KA 4DUYJ 2DNOA 2OFGX 3LANA 3M8ZA 4O4RA 3NNHA 1SV5B 5GAGU 1FTRA 2DY9A 2DR9A 4BWJA 2JDJA 3DRYA 3NY0A 5DM7Q 3DRSB 3P8BB 2BJ1A 1K0TA 5H9EJ 3K8VA 2GQ2A 2CQ2A 4ED3A 4OYXA 2FZGB 4K0KF 4DZDA 1V6HA 2ZWPA 1U7LA 2KL8A 4MYTA 4CO0A 2PGCA 1XMBA 2XNQA 1R8HA 3UPFA 2AHOB 3MR6A 2ZH4A 2HFVA 2IRXA 4P9SA 3WX4A 3CT9A 1RDRA 3DLHA 3NMRA 1RXOB 4ETZA 1RTDA 3MEEA 1UEUA 4GO7X 2ACMA 2J7KA 4ZVPB 5L8RC 4G65A 2DJWA 3NOCA 2FLOA 2YNIA 3PYGA 1Q86T 5J2PB 2H3EB 4C3LA 3T5JA 1I6JA 2I1RA 4DHVA 3J81U 5FD1A 3O8WA 2N82B 2BQUA 5DETA 3HCXA 8AT1B 3P3DA 3EE3A 1OO0B 2YPZA 4EYHB 2HQDA 1HHSA 2BR0A 2V63A 2XNRA 2ACYA 2BOPA 3UO0A 1HNIB 2LEAA 4IQMA 1YHQS 1UVJA 4JYAJ 4JV5J 2HHSA 4ECQA 4DL5A 2ZUGA 4DR7J 4AFFA 4LF6F 3L9ZA 5A6WA 5KG0A 3OTCA 2DGSA 3PJ9A 3UVJB 4CT8A 3G6ES 1ZYQA 4LSLA 1OMSA 3UD5A 2KJWA 4EGLA 4DSEA 4N76A 1RTIB 3W60A 3KXDA 5AXKA 1DLOA 4IFVB 1DAXA 1HARA 1O0PA 2LEBA 1T9UA 1SKUB 1C0UB 1RCOB 2OEMA 4NLPA 4ANCA 1N56A 4F26A 1C0TA 3G8SA 3HULA 3NLCA 3KUEA 2C2OB 4OFZA 4V1Ak 1N4LA 1TVRA 2CQPA 3HK2A 4ANDA 4ICLB 1OJ4A 1AROP 3MM5A 1EKSA 1XNRJ 1REVB 4DR2J 3FMWA 2BYCA 4CRJA 3L7PA 4ECTA 1QTMA 1WDTA 3DLKB 3FZBA 4DCOB 5D77A 1KLMA 3MM9A 4NLDA 3LWLA 2K3KA 2ZHBA 1CVJA 2KG1A 1O51A 1U45A 2IVMA 4IG0B 3FSYA 4IDKB 1KQFB 5E3QA 1JXLA 3VV2B 2VIHA 2HIQA 3D0GE 1WG4A 3KOAA 3K7RA 2U1AA 4IQXA 4DMZA 3DI6A 4J9NA 4KBIA 3DGPA 3TZYA 4PPDA 5IT0A 1XR7A 3WBZA 3HSZA 4B02A 1B0VA 1IN0A 3BSOA 3OTOF 4KO0B 4WCEQ 2AYEA 2OFHX 2OPRB 4Y2IA 2V67A 3MMAA 1FE4A 4B9SA 1JIHA 2HHQA 4X4RA 1SB6A 2GS8A 4CTAB 3BYRA 2DR8A 3D5MA 4H4KA 3UI3A 3GFXA 3FK4A 1CG2A 1TL4A 2PE8A 4WKYA 2VFVA 5DDPC 4F4YA 4JI8F 1RTHA 5T7LA 4NI2A 4KKOB 1JLAB 4OJ1A 1FT8A 2F9JA 4TVAB 3H5SA 3DYAA 4U7UK 4W92B 4GC7A 4QPXA 3SYZA 2ERRA 3BH6B 3THTA 3HZGA 2XCPA 3PW7A 1AFIA 2EFOA 1QAIA 5H1SV 3JYTB 3CJSA 2MZTA 3Q0AA 5LMUF 2NREA 2VG6A 4L76A 2QZ8A 1JJ2R 3H4DA 3A8KA 5B0FA 4RUBA 4U8YA 1SJFA 3TZZA 4CLFA 4R0EA 2VPYB 2WTFA 3BPSP 1U2RA 2DGUA 1DURA 1Q8KA 2DEIA 2XTJP 1WF1A 4C9DA 2UUAJ 2MZJA 2HHHF 4TKTA 3OFHA 2R7TA 5IV4A 3TUPA 4NLQA 1IWAA 3QSYB 2WW4A 1RLDA 5IT9Y 1HPZA 2B51A 1QAJA 4J9UE 4ECZA 2ZZMA 2DPJA 3W5ZA 1X0FA 5J2NB 3P5TL 1XMOJ 3BBFA 2A0FB 2RRNA 3VQSA 4NLXA 4WFZA 3MFIA 1HHQA 1MWZA 3DRRA 2WHOA 4A47A 1NMEB 5D4NA 1NDPA 3D3CJ 2ZEJA 2EI5A 4WXWA 4Q2LA 1HD1A 1FFSB 1S49A 2G13A 4HT5A 3CCSS 3AFGA 4NZ0A 1VR6A 2RQKA 3A3PB 2GMHA 4EBCA 3RTVA 4N7TA 1CJKA 1F60B 2KN4A 3SSRA 2HURA 4DS4A 2AJ1A 3CO0P 2ILZA 4EK2A 5AXNA 2MHNA 3A8EA 1NH8A 2V9WA 1LW2A 1YJNS 2K7JA 1T05B 1MN9A 3QYYA 1SH0A 2D3ZA 5HAOA 5ETPA 4LREA 2X3GA 2QLXA 3N0VA 2AZ1A 4OLPA 3SIPB 1S1TA 2QA4G 4BC7A 4GKJF 3QIPB 1TKXA 4CO5A 2K7KA 2BW2A 4I6AA 2UVWA 2J0SD 2OELA 1FDAA 2AU0A 2P6SA 3C16A 5LXRA 3TZWA 5L39A 2GVZB 3VCDA 3CJRA 4EI2A 3OXGA 2GHWA 2COLA 2CQDA 1KVKA 3DOLB 4RBTA 3CCMS 1RT1A 2DRBA 1FKOA 1R89A 4ZLPA 5L9NA 2ASYA 1S5ZA 2G1DA 3C6TA 1X9MA 1TK0A 2C22A 1N48A 2MLXA 4P2MA 4P7TA 3RR7A 4Q7AA 1GXTA 3R5JB 1UJ5A 2JFDA 1UVKA 2FVCA 2FPHX 3BR9A 4NA2A 1IKYB 4ZMMA 3S01A 1FDBA 2CG4A 1WC4A 4LVOP 1VBXA 1L5UA 4U8VA 1NRKA 2ZOMA 1EIYB 4PQAA 1I94F 1IR0A 2WONA 1OYDA 3HHLA 3PKMA 2JEGA 3GR0A 3QT6A 4LIWA 4X4UA 2XBPA 4IFYA 2CNNB 5C25A 4KJIA 2HHUA 4J7CA 3DMJA 2XZTB 2KXNB 3KLVA 4JP8A 4DCJB 3W9IA 1WACA 1R31A 2H5IB 5E0OA 3ENVA 5C42A 4LVNP 2V8HA 2NYIA 2Y8WA 2KDOA 1S9GB 5EHHA 1FVSA 3MHYA 3KLHA 3BSAA 2JX2A 2K1RA 1WELA 2IAJB 3OL7A 2F4FA 4CZCA 1S10A 3CCLS 2D69A 2DGTA 3KFWX 2Y3YA 5IT4A 5IWAJ 3NCQA 4ZLNA 4CNYA 2DH8A 2FLLA 2PMZD 4BDPA 2Z2YB 5HP1B 1E6VB 1KQKA 1ZM3A 5HSPA 4AD6A 2JWNA 3UCGA 4GVBA 2UU9F 1XK8A 3KLIB 3KDOA 4IG3B 3IC1A 5J2QB 1TP7A 1NNDA 3FFIA 1NDKA 3OVSA 1FK9A 2G1HA 2J8AA 2GMJA 4QW9A 1I51B 2V0NA 1HWUA 2VPZB 5GADU 1RAIB 3RYLA 1HWKA 2EFGA 4CO1A 5DDOC 1PCAA 2NQPA 1FRJA 3ZNJ1 2IPOB 3F0NA 5HMWA 2BKNA 4IO9Q 1DHMA 1DRZA 2NXNA 4A8SA 2XYHB 3JS9A 1CJVB 2ZWOA 4F2RA 1J2VA 5JVGQ 2YTCA 1F5CA 4C98A 4PYAA 2W2QP 1RWOB 4PG6A 2M3DA 3MPUB 4OHZA 4NLSA 3OFGA 2VONA 4ES3A 2LKZA 4UOCA 4RW7A 3MCOA 2IJRA 1JQGA 2BJ7A 4DSFA 1X4AA 5EWGA 2RQMA 2XG8A 4JI4F 3MEGB 3KJVA 3MM8B 3IS9B 2EFNA 3PACA 1TL1B 3MXHP 4HT7A 1UA1A 1A7GE 4C8OA 1O5JA 3VGTA 3SV4A 4UZCA 2QEXS 4C8LA 5BJRA 3H4BA 4RLEA 2HNZA 3F56A 4HR2A 4KE5A 4MKAA 3UCZP 5I3UA 2ZH8A 1KONA 1FHTA 3JB9k 4LR9A 3LF0A 3I5AA 2CPXA 5E2QA 3A13A 3BO3A 4Z7CA 3I4PA 3KK1A 1U1MA 4YY3F 2ZOGA 4CLSA 1FXDA 2PT0A 3PW0A 5HROA 3K57A 4B9MA 2NCKL 2CQCA 2RUSA 3GSIA 4PQUA 3W2VB 1IM6A 1NZ8A 4DR6J 3M30A 2IIHA 3ISND 3EDRB 4ID5A 4NYOA 4YS2A 1HQEB 1N32J 2J5AA 2RDIA 3LA0A 3CJ5A 2XQCA 3B4MA 4DV1F 3D6TB 2HFZA 4DU7A 5KFGA 1TUGB 3M6UA 4HTJA 1Y11A 2DRDA 2RIJA 5HL7Q 4L72B 1EP4B 2QLFB 3FZ2A 3TA2A 4M5DA 4USJC 3CCQS 3RJMB 2OD4A 5ETVA 1N36F 3W1YC 4RJVA 4OHXA 4N8NA 2V8DA 4OHWA 4DQSA 2UXCJ 3L95X 2KHCA 1HD0A 2DH7A 1FKAF 4RW4B 4Y34A 2F1FA 5DO2A 1UKUA 4N47A 2YNHB 1F2HA 1FEHA 1LWEB 5FLXY 3Q89A 1X4BA 1T7PA 2BRKA 2MKJA 3B4DA 3I0SA 2RH3A 2XO7A 3I56S 3MFHA 5AJ3J 2H48B 3KG4A 4H4OB 4QYRA 2ZH7A 2V5HG 5D3GB 4FYDA 3CMAS 4LSZB 4TU9A 3LUYA 4CYUB 4EBEA 4MIAA 3AHPA 1CJUA 4DR3F 3IBFB 4WE1B 1TKZB 3M4XA 4I7FA 2V4JA 3GB0A 1T9WA 1UZHA 1CQMA 2J7WA 1RT4A 3W2WA 4C0HA 5K20B 3JSYA 5KFOA 5KFWA 2KFZA 4N8OA 4B3OB 2M0GB 4KHMA 2RS8A 5JXSA 5GAEI 1Q7LB 3THPA 4LFAJ 4LUBA 3GV8B 3N28A 3BF4A 1KN6A 2R7RA 1ZS6A 3W5XA 1NK5A 2KU7A 1L3VA 4JI1J 5FDLB 3TAMA 1YRXA 4DR5F 3M9MB 1FWPA 3VAJA 3CDBA 2BM0A 3M8SA 4IH5A 3DFEA 4CDIA 3PZPA 4OX7A 3T9ZA 2W1BA 1NO8A 4D3HA 2F9DA 5D0RA 2ZBIA 2MJNA 4ZK7M 3T5HA 2HHVA 1FX2A 5LSOA 1QUVA 1RBLA 2AWZA 3UFCX 4UOGA 2QFIA 3AQOA 4OYPA 4NXNF 5HMZA 1XNQF 2DGWA 2EBEA 3OUYA 2E7XA 1VQSA 2YX4A 3C3LA 4O44A 2QT7A 3Q83A 2QJ3A 1LWCA 3THVA 2CPIA 2VFTA 1Q8IA 3CC2S 2R9LA 3R7NB 2DNRA 4BBYA 3FKBA 3O44A 2RVJA 2HQGA 1GK8A 4ANEA 1T9XA 2KVIA 3HKWA 2VC1A 2LQBA 1M5VC 3DDIA 3W8GA 4RUAA 1X4EA 2BDPA 1WG1A 3IMQJ 4ZP6A 1QY7A 5E3RA 1ZM4A 2VB6A 1S0NA 2CQ0A 3DOMA 3IN5A 2W7AA 4XDDA 1HNVA 1NU4A 3KYLA 3LGHA 3AD8C 2QTWA 1NHKL 3KLGB 1R0CB 3KTQA 1VHFA 3C14B 3I32A 3ENAA 3J80U 4DWIA 5F8LA 3HSDA 3FQLA 2EG2A 4UZBA 1G6BA 2G0IA 4OI4A 1CULB 1XJWB 4OV1A 2C2KB 3LWMA 2H51B 2DISA 3QJLA 4L74A 3RB4A 3GFHA 1NEEA 1AUSL 4MJKA 2VA3A 3HVTB 4OZNA 3WZ0A 1M5PC 3TOQA 3KLEB 2HLUA 2AGPA 4I0WA 4C6AA 2MLZA 5ETSA 3MPYA 4FXVA 3CJQA 2AV5A 2WBMA 3LP2B 4ZKAA 2HFUA 4DV0J 1IKWB 2Z2LA 4KHRA 5KFEA 2RU9A 2HZVA 2L08A 2FLPA 3M8QA 1G1XA 1X8DA 3KHLA 4DFJA 4PR6A 3TUZC 1FF2A 4R25A 4FVCA 1UPPA 1ZA2B 3TW0A 3DOKB 2CQGA 2ZHOA 2V2QA 2E44A 2RRBA 3CIZA 1LWXA 3KNGA 3BKFA 3EZUA 5K8PA 4LF5J 1MROA 1W2BR 2XY7A 2R7VA 4K4WA 2OPSA 2DVIA 3NS5A 2BX6A 4KGVB 1VJWA 2W7PA 3GCXP 2XM3A 2YVSA 3T1YF 2B5JB 3RBXA 1Y3JA 1D9AA 4B3TF 5ETRA 4DF8A 3DLGB 4D3GA 2B9YA 1H98A 2CDQA 4OIXA 3T5KA 2XMKA 4JOUA 3B6BA 1B99A 5L1KA 1GXUA 3HD1A 1FDNA 1SQEA 2R7SA 2OD6A 1WI8A 3CMES 2P9CA 4KFBA 2R8HA 2ALZA 1S9EB 3T1HF 3D6HB 2P6TA 2E9ZA 5IM0B 2JFKA 3VR1A 4DPXA 3GV5B 3QLHA 2CDRB 5BR8J 1HNXJ 2IBOA 1F9EB 3PDNA 4KH1B 4PXEA 4E2FB 2ZH9A 2MSSA 1KQSR 1QE1A 4UUXA 2D7SA 2HHPA 2FQQB 3S7RA 5F9NA 2KRBA 5JMNA 2ZJQQ 3FRYA 2CUYA 2KXHA 1LFWA 3M6VA 1AXQA 5EUHA 3PVXA 5B09A 4WP8A 4XPCA 4J9PA 2EXUA 2DCLA 3A4TA 2PMHA 3CIMA 3W66A 4NCBA 3P49B 4OI2A 3EVOA 2EBGA 3AH6A 2IJNA 2XMJA 2Z56B 3UVJA 3MPVA 5HVFA 5C24A 1NZAA 3DN9A 4Y6IA 1X5TA 1RWKB 5F3ZA 4ED4A 2LQ5A 3HHEA 2RS2A 3QWPA 1N52B 1KP6A 2CJAA 4A8KA 4ECXA 3IP0A 4IFVA 2D41A 2J76E 4OLOA 3W61A 4PG4A 4RNHA 1QLNA 5HQ8A 2MEWA 3DLBA 4UY8T 1PKUA 1GXLA 3T1AA 4J9OA 5ETKA 1TR0A 4ATNA 1SH3A 2D3OR 3W3SA 1JLFA 1U6FA 3M2VA 1F5AA 1SQFA 3KMQA 5CCMA 4M5LA 4ICLA 3Q8YA 1UPMB 3W62A 4H4MB 5B0AA 1MU2B 1ZAVA 2PDAA 3RB0A 2BMBA 2CPZA 4X66F 3QATA 4LRDA 4FPIA 1IKXA 1EB0A 5L9XA 2DNYA 1O8BA 1ZA1B 3DRXA 5CYJA 3QMQA 4USKA 1N5SA 1RWVB 2KJVA 4A8QA 2M88A 4IG0A 4YDXA 4QWDA 1YZ7A 3OXFA 2KZMA 1DARA 2RB7A 4K0KJ 3RRKA 2R7UA 3LAKA 2H5EA 4QWEA 3OLBA 2MQ8A 1WJ9A 2XB2D 3ITHA 2HVIA 3ZZZA 2RAQA 5KG3A 3OJUA 4U96A 2YXLA 2E1MC 3U1NA 3UD4P 1Q8LA 1UJ4A 1X5PA 1EZZB 2CPFA 1NUEA 3RUBL 2GGPB 4KGXB 2EC2A 4P10A 2FY1A 1SKSA 6AT1B 2BANB 1WKJA 3VAFA 2FJVA 2OPRA 2R7QA 1KTQA 2YNFB 1RYSA 3QRRA 2X1BA 2QL9B 1RHJB 4CTAA 3QT8A 3DC2A 1UJ6A 4LIRA 2YQ3A 3BDEA 3K59A 2LXUA 3DRPB 3W65A 1FWLA 3CD6S 1KVIA 2VKRA 4NMXA 4U7CA 3I6PA 4KKOA 4C97A 1K8AT 4FF2A 2B7BB 2ADCA 2HAIA 5KT5A 3H2VE 3CJ4A 1Y0HA 4FPRA 3R2CJ 4LF6J 4ZVSB 2R2SA 3CD5A 1MLAA 3AXMA 2WAQD 2HEKA 3HVWA 3M2RB 1SQGA 4OV6A 2CPHA 2VDHA 3NBPB 2XLIA 2LCWA 2F65A 1B4SA 2LEPA 5KG5A 3D66A 2XS2A 3TUIC 2DGOA 1JLEB 3MEDA 4ZPAA 4LF4F 2RJZA 3FJ2A 3KKFA 2HSEB 3S8SA 5K14B 4LF7F 3K8WA 1WUUA 4DLEA 3E01B 1QM9A 4HLBA 2HG4A 2RKIB 2O01C 1S1XB 2X1AA 4I69A 1TL7B 5DZ7A 2CZ9A 3MECB 5J2NA 2PFDA 2MZ1A 3I96A 5C5JA 4ID8A 1WD6A 4I64A 4CP5A 2KM8C 1HQUA 1OQ3A 2DGVA 1RK8A 3MR3A 4ELTA 1Q4RA 3KJQB 3LGNA 1U09A 3SV3A 3BGLA 1LFPA 4DR1F 3PM9A 1XIQA 4ES1A 2WOMB 1S77D 4OYOA 2MXYA 3AAWB 3OPKA 4HVZA 4BCAA 2L3MA 3VAIA 3ZZPA 4B08A 4RNNA 3ETOA 3OL8A 4C4WA 3KK3A 1EQ0A 2AJFE 2M2BA 1WDDA 4QR1A 4WJBA 3VZHA 1GT8A 1T05A 3LOUA 7FDRA 1WF0A 3QAEA 3PR4A 1S4EA 1NK7A 1RAJA 2FJAB 3RZAA 3S1TA 2HPUA 3KG1A 4USTA 3ZNUA 3W64A 4NOHA 1PYSB 2EG1A 1P9YA 1JB0C 8ATCB 2MJUA 4DX8H 2M8HA 2DCUB 1UL3A 4DU8A 3ETMA 2C3MA 2GVZA 1F9HA 1NDCA 3IXQA 2CJBA 3DOLA 1HHTP 1BE4A 2WVCA 2F4VF 4JI8J 3DU5A 2Y0BB 2WZ1A 3HJVA 1SJ3P 2FC8A 3BDPA 4P71A 1NHVA 3NP5A 3GJSB 1UFWA 4X65F 3J81Y 1HYSA 1IKYA 2MKSA 1XBWA 1Z4UA 4ZHRB 2WSFC 1SKRA 4B3RF 2V8VA 4V19X 1RT7A 5LMUJ 2OEJA 4CO2A 1WTFA 3H90A 4ZLLA 2YBVA 4B9VA 1U48A 1URNA 3NCPA 1S4FA 1U26A 4DZ6A 1BC6A 3CVKA 3TA0A 2GJ2A 1D9DA 2GJIA 4GVLA 2VG7B 3QWUA 4QJVA 4TXSA 3NRBA 1YJTA 3BQ1A 4J9SA 3IRXA 2YKOA 3FBFA 4EU0A 2BQ3A 1WI6A 2RILA 5KG1A 3N6NA 3GLJA 3OR1A 1C1CA 2KT2A 4WU2A 2GX8A 3RU0A 4CO3A 3MOJB 2E9TA 1X5SA 5EGYA 2OEKA 2QSWA 2D74B 3M6WA 2AGOA 4HI1A 1EHWA 3RRGA 1IXKA 3W5YA 3OTBA 4PWDA 2ZBCA 4NZ7A 2IM3A 3GFYA 3FSIA 1BQNB 1RHRB 2CPDA 2F5GA 2C2ZB 3E3XA 1SKWA 2V68A 1E6VA 4KTQA 2A2DA 2QYCA 5DQIA 3L4BC 3KLIA 4C2MA 3HFKA 4J9MA 4IG3A 4MFBA 2GNKA 5AE1A 1GH8A 4P2SA 4WYLA 3CCRS 4QIVA 2ABYA 2IDLA 2R8KA 1FDDA 2BKPA 2HNYB 1BQMB 5M2PA 3GYNA 2FTRA 3HP6A 2VOOA 2VF3A 4AXJA 2HGNA 2MMYA 1K0VA 3SQGB 4GKJJ 2B9WA 2L9DA 2W8KA 1FESA 1SH2A 1LNQA 1YJVA 1CJVA 2W9BB 1N88A 3MTJA 4V19J 2ZD1A 1LK7A 4ES2A 2E29A 1H7WA 1GTEA 3LGMA 2RMLA 4AQYF 2DR6A 4EYIB 3BGRB 4NMLA 4PKDB 5ETTA 3ISNC 2OSQA 5J1EA 1YJ9S 1EKRA 5F0UA 5KFDA 2V69A 3O1LA 4MYUA 1PC4A 3QT5A 2J6UA 3TUJC 4OYZA 2VODA 1NXIA 3CO9A 3D3BJ 2PI5A 4OJGA 3HHLD 3MEGA 1FRLA 4DXLA 4AYBD 3HF5A 3IS9A 3GSDA 3V6DB 1I94J 1SBRA 1TL1A 1YJRA 4NRUA 3KDNA 2B9XA 4YFUA 4Z37A 2CAJA 4QWAA 1DQ9A 1J5OB 4K4XA 4I2PA 3OXLA 3PY8A 3NCRA 2R2TA 3NGDA 1HNZF 4AL5A 4DSLA 5B0BA 2AJ0A 5ETNA 3CJ2A 3MOZA 2XS7A 4KHPF 2Y8YA 2E1PA 3TEHB 2XWXA 5KT4A 3HPOA 4DPYA 1LW0B 3QSIA 2N3OA 4I2QB 4Q0BB 3C6UA 2W2MP 3NS6A 3JXOA 1GAOA 2VQFJ 3BS9A 3KK2A 1L3TA 2QLBB 1T3OA 2EC0A 3W2VA 2QG9B 2RF2B 3R5BA 4CLZA 2MKYA 4RPFA 1HQEA 3CJTA 3RGIA 3QQCD 2E5JA 2DRAA 3CNQP 1U02A 1GEHA 2OMLA 1ICEB 1KS2A 2I38A 1TAUA 2YH1A 1T03B 2RU3A 1M5KC 5BYSA 3LP0B 4C8MA 2QMWA 4TNOA 1EP4A 3A8JA 4X62F 3MPDA 1ZETA 1VRUA 1RAAB 1RTZA 4WK3A 2AD9A 2A10A 1S48A 1FNMA 3M8WA 3D1QA 1FJGF 2CJXB 1KFDA 4RR5A 3P6YC 1NJXA 1N6QB 4GKKF 2XMMA 2W24A 3IGNA 1SXLA 2OKQA 1J5EF 2VFUA 3O6QA 3UW1A 1Q5YA 1FI4A 1SPBP 4RW9A 2J7UA 1LWEA 1RJJA 1T8EA 1RGVA 3C15B 2AEFA 2PEBA 1RWPB 3RBDA 2EK1A 4KH0B 1N5YB 2CVIA 1B7YB 4C0BA 3IR7B 5KG6A 1VRQC 2ZC3A 3TA1A 5D3GA 2OGUA 4WFAQ 3V81B 2OH2A 4JI4J 2AYGA 8RUCA 1H72C 2OUGA 2XI3A 4CYUA 4R0JA 9RUBA 4O3SA 2A6MA 4LR7A 4NWBA 1WTBA 3DDKA 1RT2A 1TKZA 4ECUA 2ZBPA 2HWHA 3GV7B 1RAEB 2AX0A 5G4DA 3P5BP 4XTTA 1LK5A 2ASDA 1NH7A 3MMBB 4QU6A 3CSKA 1VGYA 4W90B 4K8RA 3JQMA 4G1QB 1UVNA 3WIVA 4XPEA 3J7Z5 5GAEU 5ITHA 3M05A 4QYZK 5J2MA 4LF8J 1BY9A 3PXGa 2KZZA 7FD1A 2GIQA 5FDLA 2YWFA 1M5HA 1UWBA 2ZKTA 2OO4A 5A8WB 2YKAA 4NE9C 2NPFA 3I82A 2FZCB 4WP3A 1ACMB 4RU9A 2GO9A 3ENWA 1GX5A 4YY3J 2AYBA 2DHAA 4JV0A 2WVBA 4ZPCA 1LV5A 2C28A 4ZVFA 2AMCB 1CS4B 3C8YA 4AT1B 2KT5A 4YR3A 3M9OB 4K5SA 5DDQC 4JI5F 4X4OA 2N7YA 3EM1A 3QGHA 3CDWA 1LWFB 5DDRC 4P72A 3TQ1A 1S6PB 4DV1J 4HHUA 1MMDA 4RL1A 4RUHA 2GO8A 2MSTA 2LDIA 4RW6B 5CYMA 2IY5B 1NCLA 2J0QD 4LF2A 1CJTB 3RG6A 3T5LA 3OV7A 5LT5A 2E1AA 4ZIWA 4JYAF 4JV5F 2LXFA 1KOHA 1Q81T 3FCVA 2E5IA 4XAKA 3C14A 3G71S 4O3OA 1U4BA 3N5BA 1GMVA 4QR2A 2A1BA 4J9LA 4B9NA 1NJZA 4USWA 2KYXA 3BKTA 4Q8FA 3ZZYA 2JVRA 2B4UA 3H42A 1F0XA 1KVJA 1LXNA 3KLEA 3CJ0A 1KQGB 2Q3PA 4ECYA 4ZN1A 1BUXA 2LP4A 3NGTA 3LP2A 5DQHA 1IKWA 4BLGA 3ET6B 4NA3A 1UVLA 1RA7A 3L7OA 2Y1IA 4JI6F 4DFPA 1R6VA 5B0GA 2ZNYA 4X4VA 2UXBF 3N6MA 4DR3J 1XNRF 3GTYX 4F4KA 3PV8A 2PA8D 3DOKA 2MTLA 5EWEA 4B9LA 1EX8A 3QGIA 2DNGA 3OLAA 3ZC4A 4F0MA 1RISA 3OSNA 1RWNB 3X3UA 2WK4A 1AZSB 1F9FA 3M32B 2RQCA 4EZ6A 2ZH5A 4CH0S 3K58A 1RT3A 2R2UA 1KWMA 2DKOB 1FJEB 1RYRA 4RO0A 2OAUA 1S9FA 2JEFA 4DR5J 3DLGA 2C3UA 2JL9A 1VFJA 1YTYA 3I87A 1EARA 3S6EA 4CLUA 4HHHA 5SUHA 1RTDB 1OY9A 4NXNJ 3SDEB 1XNQJ 5DLFA 2GAGC 4KT0C 3MM7A 3KLFB 5IM0A 4PG8A 2XGQA 4K4YA 2B0GA 2HWIA 4WTYA 1Q79A 1QD1A 3GWCA 4OJHA 1QSSA 3GMGA 4WXOA 3MWBA 1R27B 5DG9A 3TEGA 3V5RA 2K8GA 4Y2CA 4C7QA 3F41A 4CIOA 4LQ9A 3FC9A 3ZXWA 4WFNQ 1WC1A 3D7SB 1HI1A 1FXRA 3FGVA 1Q8BA 4X4SA 3BM7A 3H5UA 4TY8A 3Q24A 4M8LA 5CCLA 5DLGA 2HRTA 3EWGA 1U1KA 3WC0A 2A3JA 2BJDA 3IAM9 1FKPB 5IFMA 1FVQA 4LSLB 1TZ0A 3K5MA 3AB4B 3HMJG 4FYXB 2C3OA 5IXUA 3D0IE 3AD7C 5A8RA 1DLOB 4O3RA 5CZVA 3G86A 1L3SA 2UUCF 1IQZA 3FSXA 2IRUA 2ZH6A 5HLFA 2UUAF 3ZFVA 1WWHA 5CZXA 1ZTWA 1R8CA 4L6V3 1JLCA 2ASJA 2I0XA 1VRTB 3GIMA 3ZZRA 3JSMB 1R7IA 1YBUA 3TARA 2R3VA 1TVRB 3GYGA 4CO4A 4XK8C 3MM5B 4H4MA 1YK9A 2CQ4A 4QIGA 5J1NA 4YR0A 3QO9A 2Y0SD 4PWWA 4BWMA 1CSJA 3A1YG 4PEOA 4HTIA 1CBKA 2BVZA 1J27A 4ZP7A 2MQMA 1T3NA 3GG1A 3T1YJ 2UUBF 3N9UC 4LRBA 3MEKA 4FF4A 1HNWJ 1FJCA 3PTWA 4YEAA 2KG0A 5KT7A 4B3TJ 3VGUA 4E98A 3AOAA 2GFFA 3K0JA 1WG5A 3R1LA 1REGX 3DI6B 3DGPB 3PX6A 5L1JA 2ZH1A 1MSWD 2EFQA 2GGPA 1P1TA 1PC5A 2VFSA 3I55S 1HWLA 1GQEA 2BANA 3WDOA 2XMTA 3M9NB 4CLWA 3T1HJ 2SXLA 4OYWA 1HI8A 3LPYA 2YNFA 1RUSA 4KIAA 4KB7A 2DO4A 4NLVA 2IA6A 2KT3A 2DNNA 1YRUA 4L75A 2NXJA 4DV3F 1YITS 3DM2B 1YDLA 5GMEA 5E3CA 3DDNA 1WOPA 3ZTSA 4JI2J 1VQKS 2KB2A 4U67Q 1RT5B 2AT1B 5BYQA 3HM9A 1VQ7S 1RTHB 4PWUA 4NI2B 1P9QC 1T0TV 2Z2MA 1HW9A 4NA1A 2L48A 1NB7A 2CNKB 5I4MA 3G82B 3DYAB 3J7A1 4DV2J 2IFXA 1JLQA 3O5TB 4K5RA 1MW7A 2AGQA 2W9CB 1MN7A 2CYYA 4QBUA 1JKHB 3RRHA 2VG6B 3NWRA 1A9NB 3EMTA 1FNXH 3ZZ0A 3T9NA 1TL5A 3NWGA 1WKLA 3H25A 1TQLA 1OY8A 1SUQB 4ECWA 1C4CA 1K1SA 3BZQA 4F4XA 4Q8EA 4Y2KA 3TVKA 4H4KC 5K14A 5IV3A 3J80Y 1Y10A 3D4JA 2BJEA 2FDNA 2RKIA 2EK6A 2XY6A 4KGKA 1I3OB 4ZPWR 5EX3A 1RZMA 3TJ9A 3LTOA 4DDFA 3SCLE 1IKVA 3SMZA 2XSFA 1U2FA 1M1KT 4F0KA 2AQ4A 3R5GA 4CCHA 1Z1ZA 2JSXA 1PILA 5AT1B 2C2DA 4WIQA 4DQPA 4TYBA 4M5GA 4OX9J 1BQXA 3HZEA 5IWAF 1QAYA 3US5A 3LAMA 3F44A 1RI7A 3POTB 2WOMA 4ZCLA 2VASA 4NLOA 4TY9A 3HSJA 1UTAA 4K2JA 3EGVA 2C3YA 4RNMA 4BS2A 2CVEA 2W8LA 4ELVA 5D78A 2O67A 4TU7A 2YH0A 1QTNB 2RE1A 4IYQA 1X0PA 2HAFA 5F8MA 5HMXA 3OR2A 1S1TB 3G6VA 5L1LA 2LQJA 1JXVA 1RHKB 4ZCIA 2OI2A 5H9EK 4AL7A 4ZP8A 4MTPA 5I3QA 3Q8SB 2YX7A 5FIIA 2KO1A 2KVQE 2UUWA 1CLFA 3R7SB 2J0WA 3GQCA 2OSRA 4F50A 1SJQA 1HBMA 1X9SA 2DYAA 1RT1B 5A8KB 2WSCC 2QE5A 5HBMA 2CG8A 1YWXA 1KRPA 3PKYA 3AT1B 2VH7A 5F9LA 1RLCL 2MHEA 1ZOTA 1X31C 5KFCA 4WZMA 1PJ5A 1S6QA 2G2ZA 3W9JA 4DV5F 1IBKJ 4F3MA 3W9HA 2WONB 4S0MA 4HKQA 1M90T 5I42B 3EGWB 4USHA 3G4SS 2H1YA 1OY6A 2VQEF 1XQIA 2W4PA 2FGOA 1DTTA 2AKWB 1H2VZ 5C25B 2AW0A 3D6FB 3P4UB 5KFUA 4LF4J 1HMVB 1DJ0A 2VG7A 2RDJA 2LMIA 4LF7J 2DNPA 4QW8A 5KFLA 2EVZA 5KFFA 1KSPA 3IM9A 2Y1JA 2DNHA 3CDEA 5JVHQ 4I1TA 4K4ZA 3GIKA 2WVEA 4G3IA 1F2GA 1V5VA 2I5JA 1FD2A 5DRKA 3GU0A 2JLEA 1RWMB 2MZSA 2KH9A 2NXEA 1CQNA 2F8MA 1R43A 1S57A 1Q1KA 4DR6F 4LSNB 4TN2A 4DLGA 1QAXA 3MUMP 4USIA 3B82A 3H7HB 2BRLA 4WWSA 2HGMA 2FJDB 4YB1P 2W4CA 2IHR1 1HA1A 1VLYA 3HHLC 3H2LA 5L46A 2JHEA 4ERDA 4ED5A 1X9WA 5KFPA 1NJWA 3FFIB 3MPWA 2YKMB 3CCUS 1S79A 4MAKA 4FYVB 2HNYA 1BQMA 5K9FA 3KJNB 1FK9B 2UXDF 2GMLA 3BBBA 2HRUA 1DTQA 3OVBA 2VHGA 4ZJLA 4ZVGA 2DNZA 5KFMA 1WOSA 3HXMA 4B9TA 4C11A 3BO4A 2BUNA 4A8MP 4DI6A 4DPTA 1NSKL 4WIIA 1PO6A 2YKPA 3PW5A 4J90A 2VBZA 2MGZA 2YWEA 5KOWA 2Q6BA 4KY3A 4R8UB 5BXIA 2OPQA 2QA4S 1DBDA 4F4ZA 2F4VJ 3IRWP 1VOMA 2LQ9A 4FS2A 4UOHA 5AJ3F 1S1UB 1VISA 4RW7B 2QMXA 4U7UD 1KEKA 1FJ7A 1WSVA 2FIUA 4X65J 1BLUA 4NCGB 5GAHI 2BV3A 2ZE2A 1RT6A 3PFOA 5KFQA 4B3RJ 5LJ3Y 3V6DA 2MKHA 1EETB 1RKIA 1RKJA 2ROEA 4C48A 4ZA1A 1AFJA 2KXFA 2HNZB 2EKNA 4OZLA 1DY3A 5DJBA 4DG1A 5I3UB 2QA1A 3V4IB 3RAMA 3HX9A 1NPKA 2HBYB 3GFZA 4JI1F 4PAAA 1MMLA 2DNQA 2CQ3A 2AJ2A 1NLKL 4I2QA 4Q0BA 1Y7PA 5D4LA 1X7VA 4FS1A 1NJYA 2D3UA 4M5HA 5C2CA 3TNVA 5CH7B 1T11A 2XMVA 5AE2A 1NK8A 4PQUB 1FRHA 3AODA 2CKWA 3QGPA 3R1HA 3M30B 1FRKA 4NLWA 4RU2A 3SI8A 2YKNA 2LU2A 1VQ8S 1YBTA 5E41A 3FBBA 1NBEB 3NEKA 3U1MA 1UCNA 3FRZA 1IBLJ 4XDCA 5LM7E 2DD8S 4FYWB 1JNRB 1ZPWX 4LRAA 3Q8UA 3C19A 2WCXA 2P5VA 3BJYA 1XWLA 2HQIA 4CLTA 2QGFB 2VJVA 4UW2A 1RU1A 2NR0A 5K8OA 4K4SA 3EZOA 3B54A 2GQCA 1I1GA 1LXJA 5M2RA 2HZAA 4QWCA 4LRCA 1N6QA 3GONA 2NLWA 3MMCB 1SJRA 4KSEB 3VALA 2J8SA 2HNDB 1TU0B 3IG1B 5KG4A 1X4DA 3MURP 3DLEB 1VI7A 2FD2A 1S99A 2F63A 3C15A 3JSRA 4AQYJ 2CWKA 3CB4A 2GW8A 1U8WA 4UTGA 2F8HA 4LQ3A 4OZ1A 3TJ8A 3DXSX 2FZKB 3RW7A 3V6HA 3R5CA 1MG7A 1N0VC 5F8HA 2R8GA 3PHEA 2HLTA 3BQ0A 1CJUB 2BOAA 5IZHA 1TK5A 4ENOA 3SQOP 4MT1A 4JB8B 4I7FB 1VK8A 4JV1A 3HHNB 3NL0A 4QR0A 2E9RX 1RT4B 1M0SA 3MMBA 2W4DA 3BREA 4RUCA 4G1QA 3D67A 2HS0A 3W7BA 2W01A 1H2UX 4Y3CA 4YMEA 2XMAA 2I2YA 4LBPA 3KNAA 3SCJE 4DV4F 3R5DA 4NLUA 3QRPA 4KHPJ 2VKZG 3OBIA 3TAMB 5DGAA 4KR0B 3SSSA 3GCWP 1Q82T 1Q16B 5T14A 3FUYA 5IOLA 2N3LA 2YNGA 4LMZA 3Q22A 2Q66A 4I68A 4ED7A 3FMBA 3SFGA 3M7VA 4M95A 1N5TA 2LA4A 1T9YA 4C0OC 3T19A 3OUYB 2MKIA 3CCVS 4HEA9 3QIDA 4O44B 4DQQA 2BE2A 3IA0A 1LWCB 1X5OA 3I0RB 2DT9A 2V4QA 1VQPS 3GIJA 4TQRA 3MDFA 3BN7A 1S6PA 2HQ3A 3EVWA 3G8TA 2BJ9A 1N0UA 2XEXA 2WVDA 4DUZF 2HVZA 5A0YA 4KRWA 4RW6A 1C4AA 4NEZA 3NAIA 3NGRA 2PSZA 3CJ8A 2V4RA 4X62J 1RACB 1HKAA 1YVFA 1CJTA 4CH7A 3DOMB 2HZCA 3RB6A 3DLJA 4LBIA 4FNIA 4J9QA 3CUNA 4F04B 1JNZB 2FLNA 1FJGJ 1XN9A 4MKYA 3EXCX 2APOA 5HJXA 1WC5A 2ZM6F 3F73A 4GKKJ 1H2TZ 2B4VA 2BM1A 2FHJA 2YWWA 2ZNZA 1J5EJ 5CQGA 1B0PA 2HS3A 3VVTA 4UF4A 3OSPA 3K5NA 2BBEA 1UW4A 4FF1A 3FVYA 2EKYA 6FDRA 1RAGB 3D54A 3DU6A 1YZ6A 3HHDA 3P45B 3OQ2A 2L9NA 2V50A 1WEXA 3LP1A 1NB2A 4OZ0A 1ZAXA 4TYAA 1VQ4S 5B0DA 1UA0A 3NGKA 2CQHA 3Q2SC 1S0MA 3MAAB 3PCOB 3OTDA 3PRVA 5I3PA 2UZAA 4CLPA 4B3MJ 4QU7A 3UR0A 3QPIA 1D8ZA 4HDHA 5KOXA 1W25A 1MROB 3CCTA 3Q8RB 3PO5A 3CCJS 2OPSB 1AZSA 1WC3A 1OIAA 3M32A 3IGVA 5B0CA 1V3SA 1RADB 3PNIA 3UCUP 1HBUB 4NXMF 3L09A 3EDQB 3UQSA 3RAQA 5DG7A 5MLCV 3E2EA 3IR5B 2KI2A 2PFFB 1C2PA 2Z2ZA 3U02A 2LYVA 4KFBB 1SJ4P 2XMWA 3SDEA 3QRQA 4WK1A 2FB0A 1UAWA 2FJEB 4F25A 3AJ2A 2MKCA 3KLFA 3T6JA 2CPJA 1NKEA 1N33F 4JI5J 3H20A 3KMSA 2FVPA 4DN0A 3RW6A 5D0HA 1H73A 3QLHB 1FTCA 2EEYA 1MMNA 3ZZTA 5LOQA 1QE1B 4DFMA 1W26A 4W98A 3JTNA 2RD5C 1NPRA 1HI0P 4IH6A 2KHDA 2HVEA 4ZVQB 3M8YA 2JLGA 3G9CA 1VHIA 3QZ7A 2H4WB 3MUTP 4M1KA 2J9DE 2R42A 5IC6B 1QSYA 3OFFA 4PG7A 1Q5VA 1P8GA 2HIYA 1T02A 2IC3B 2QC3A 2ZBRA 1FKPA 4ECVA 5KT3A 5C24B 5HMYA 4OZ2A 1D9FA 3ZZUA 1S72S 4IRCA 1U8SA 1ZZFA 2LFVA 4PXDA 3D6MB 5CD4A 3DKDA 5SZTA 3CJKA 1FE0A 2G2YA 3DXBA 2VBWA 3ISZA 4ECRA 2RNEA 2ADBA 4QIFA 3QFWA 2CQBA 1AUDA 1VRTA 1FX4A 4K7QA 3V4MA 3CF5Q 3JSMA 2DGXA 5D6GA 3RB3A 4X4NA 1K1QA 1SV5A 3SCIE 1D3WA 1JLFB 1S76D 1VS3A 3M2VB 4OZJA 2VZ9A 4JI6J 3BN4A 2UXBJ 4GMKA 1U0SA 2MQPA 2UVRA 3DRSA 2HWTA 1GNKA 1FCAA 4CLLA 4ELUA 1IKXB 3JTOA 2ROGA 3SXLA 1GMUA 3M2UB 5E33A 5T41A 2DHHA 4UUWA 1HQ2A 4OHVA 4B3SJ 5D0EA 3VWSA 4NCAA 2HHWA 5DGBA 1S1WB 3ITHB 1FA0A 4IR1A 2XWYA 4LFBF 2OHDA 1R3NA 4FF3A 1U6ZA 2OLWA 4ER8A 4WPAA 5J2PA 2VUGA 5KFTA 3U27A 2ZC4A 2KFNA 1KC8T 3H40A 4MIWA 3H0PA 1GX6A 2W2PP 5LMNF 2AX1A 1R8AA 3PIOQ 1HR0J 2MY8A 1V9OA 1RSCA 1VQYA 1HWJA 3FCHA 4C8NA 3DM2A 3V6KA 1HNIA 4JI0F 2E1RA 3TYTA 3K89A 3W8PA 5B0EA 1RT5A 5E3AA 4USVA 3BO2A 5C2GA 5IQ6A 3BBCA 3D0HE 1N34F 1S1VB 2W9AA 4ITSA 2FVSA 1Q53A 3G82A 3V6JA 1VQNS 2LLZA 1KFSA 4JI3F 1MNEA 2RQ4A 1RTIA 4FN5A 1TV6B 2YWKA 4PUOB 2W9CA 4P6QA 3M1VB 2IBKA 3T6BA 1C0UA 1JKHA 2BACA 5EN1A 3FBCA 3KG0A 5B08A 1VJQA 2DNMA 4RKUC 2Z0GA 2VICA 2QLJB 3TR5A 2XGPA 1Y5NB 3J7AN 3MM6B 2BA9A 4KYZA 4URGA 3BGFA 2UUCJ 1UW9A 3PYFA 2BQRA 3UNYA 1GFWB 3MEDB 1E6YB 1SUQA 2MZRA 4Y2MA 3QJJA 3CD0A 5ETOA 4HYKA 4LBHA 1REVA 1KR4A 1R0BG 2G0JA 1VLOA 2HMIB 1YIJS 1UZDA 2WVFA 4DJBA 1Q0NA 3DLKA 2HGLA 3TI0A 4Q2MA 5LL6d 2MDAA 2VV5A 3EGZA 3MR7A 1ZTTA 4CM2A 1WEYA 5E3PA 4XIUA 4IDKA 1HQUB 3ADAC 2CJKA 3ICLA 1WKKA 2UV8A 4F4AA 1TFYA 1VMBA 1HBOB 3VAGA 5EWFA 3T41A 2GCFA 1EAYC 4E0DA 3KWMA 3SCKE 5A6PA 3POTA 1OQ6A 3GP9A 3GJQB 1FRIA 1PIEA 4MMOA 1EQMA 2O1PA 2UUBJ 4ETXA 2VL1A 3LH2S 3K5OA 4KO0A 1NK6A 4I6WA 3KK3B 4O4GB 1TL3B 2D9OA 5FJ4A 5F8GA 3IO1A 1S6UA 5KFIA 2DXEA 2FHMA 1SCJB 1AB8A 3W63A 4EZ9A 2IDEA 5D8HB 2NUHA 1WORA 4CNZA 2E7VA 1KHWA 3I9ZA 1JLAA 1VC5A 2V6AA 4I56A 4DV3J 3A3OB 1TAQA 3HSGA 3UN3A 4X4PA 4DF4A 2AIRB 3VF0B 2N4DA 2KM8B 5G0RB 4EMDA 2MYFA 2H5JB 2ZHAA 2ZUAA 3VQTA 3LPEA 5A8KA 3JYTA 4WKRA 4USUA 2P2CB 1UFLA 4MIBA 3NNCA 2NZCA 4A48A 2GIRA 4PXCA 1X60A 2JRSA 1R6YA 4OQJA 1PJ7A 1HYSB 2NSBA 4Z7YA 2GQQA 1RT7B 4ECSA 3CEDA 3JAMU 2DPIA 3TAQA 4WTOB 2HQFA 2MY7A 1P6TA 5BYRA 4GC6A 5I42A 2PMWA 4M5NA 1TTHB 2JVOA 2LECA 2CA9A 5K8MA 4LF9F 1FO1A 1PAEX 4K4VA 1HMVA 1PGZA 1JJ4A 4AXIA 3IRXB 2R2RA 3RAXA 2BKOA 3ZTQA 2MLYA 1LEOA 3OR1B 4KV8B 1C1CB 3BB5A 4HHJA 1M1GA 1RHUB 3TWZA 4CLYA 1U1LA 4Q5VA 1KOOA 1YX2A 2F3JA 2VQFF 2YKQA 2AZ3A 1G2EA 4PWDB 2BJ3A 3JTPA 5DS7A 4LSNA 5DZ6A 3CDAA 3OL6A 4F0HA 4HACB 3CMQA 4Q45A 2KYZA 1JLGB 3TVYA 2XO6A 4NLTA 2PN6A 4NASA 3R9LA 2WW8A 1Q78A 2ATCB 1YQHA 2QFJA 3OTOJ 2RSQA 2I9SA 4MFBB 2Y1LB 3I4HX 2C2MB 1RTJB 4R5PB 2YKMA 1IBCB 3QIPA 3PW4A 1FWKA 3AOCA 4OX8A 3OJSA 3TVZA 2DK2A 2QLWA 5KFNA 4P2FA 1R8PA 2VC0A 1U1RA 1U2CA 3CW2C 3TQEA 2ZZNA 1V3ZA 2CRLA 2EFPA 1Y4ZB 1H74A 4A8OA 4M5KA 2A18A 5C7PA 3NG8A 2NXUA 2ZD1B 4R8UA 3R6LB 4PCQA 2ZOFA 1IM4A 4X2BA 2XZDB 3OT9A 3R8YA 5CA5A 3H59A 1F1BB 2PIIA 2VPXB 2B6AB 2V34A 3HD2A 1XC9A 3CC4S 3UN2A 1S1UA 5J1EB 1KHVA 3IWXA 4F3QA 3OL9A 1S97A 3OTEA 1EJ7L 4NCGA 3DNCA 5GAHU 4OYAA 3DCAA 2MKKA 4DFKA 2DGQA 1VQ6S 2HBQB 1VCTA 4DV5J 4OX6A 2HHHJ 2FHOB 1V3RA 1S6OA 4ZPBA 2AJ4A 1PG5B 1EETA 3ZO7A 1ZH5A 3KHHA 3EGNA 4L73A 1GMWA 1R0AB 2VQEJ 3VAKA 1XR6A 4I2PB 1X4GA 4J9KA 1S9GA 4DBQA 1VBYA 3AJDA 3TO8A 3CULA 3MUVP 3R7BB 1IWGA 3RBZA 2CIMA 2F8EX 1LOUA 4OYBA 4LF8F 3V4IA 4Q43A 4DV6F 1ZBTA 2IAJA 4FDFA 1LQ9A 4FKYA 4ILMA 4JBCA 2CJ9A 3D2WA 1HL6A 2D3O1 3C6UB 2P8IA 2MQQA 4ZLJA 5HP1A 4YQWA 2I8EA 4CT9A 3KK2B 1NSAA 3UDVA 3MCNA 4O23A 4ZJQA 4P73A 3IR6B 2E5GA 1Z2LA 1VQ5S 3HFZB 4DSJA 2JEJA 4DPUA 5J2QA 3JSBA 1OSCA 2MZQA 3MCMA 2G0CA 1TKTB 4QWBA 1UP1A 1RWUA 1ROFA 5ETQA 5ETMA 5A2QU 3FEYB 2XHCA 5KFBA 1URRA 1AW0A 4O0NA 2XSJB 3NKYA 4OHYA 2DNKA 2DB1A 1SC6A 1K9MT 1CPZA 1VRUB 2UXDJ 2DHXA 1WF2A 5F8NA 1ZM2A 3VAMA 1SVDA 4QCLA 4IR9A 2HK2A 5U47A 3PJWA 1VYAA 3GIRA 3N79A 2NPIA 1XMQF 3Q86A 4DV7F 4QPTA 4C8YA 1VQ9S 3CPWR 4YB6A 2DH9A 1U25A 3MMCA 2HVDA 4TLQA 1RHQB 1TKDA 1YSJA 4OZ5A 2WRMA 2DR7A 2HNDA 3IG1A 1RAFB 3TZXA 1QJHA 2EPIA 3DLEA 4ZVRB 4RW9B 1WOOA 2YWGA 4QIEA 3N4WA 4ED0A 4OL8A 3CTRA 5HO4A 2W2OP 3MM8A 2M52A 2H54B 2ROPA 2NS1B 2V2VA 2OTJS 4IRDA 3Q8PB 4I4BA 2ZJPQ 2R8JA 1DQ8A 4UT4A 4P74A 4X84A 3QFHA 3CGIA 1BWVA 2K3IA 5A76A 1UVIA 1QSLA 3J7YI 2X7IA 1RT2B 1RAOA 4HH1A 2IVFB 1ZPVA 4QQBA 3AOBA 3NOGA 1DZ5A 1SIZA 4JI7F 4N41A 2D9PA 4DR4F 3A3NB 2VFRA 3BYPA 2V8GA 3MGJA 2XC9A 1NK4A 4AE5A 3EYZA 2XI2A 1NJIT 2VG5B 3G6YA 2MQNA 5J2MB 2BEFA 4ZCMA 3PX4A 4RBUA 2IVYA 1UWBB 2L9WA 1T95A 3PEHA 3MMJA 1IUJA 5JUMA 2M8DB 4NZ6A 3BKUA 5KG7A 3SBMA 4X64F 2AEMA 1BHNA 4K4TA 2UU9J 4NEYA 1B0TA 4FKXA 3G96A 2GVDB 4OZ3A 1APSA 3C46A 1IBMF 5DM6Q 5KAKA 2QX0A 3I0RA 1TUVA 1YBAA 4PRFA 1G4CA 4EFAC 4U95A 5KFYA 1WC6A 4RW8B 1FFGB 2GHPA 2OPPB 3OHAA 2E5LF 4ED8A 2BJ8A 5CYMB 1W7WA 2ZKUA 1N5VA 4PYDA 4YHHF 4OI0A 1AYEA 1RP5A 1KNZA 1M5OC 3CE8A 4RW4A 4ZP9A 3B8HA 3UN5A 4MKBA 2XCAA 3D1HA 3Q2TC 3G2XA 4IOCQ 4FP9A 1U0HB 4WFYA 2JNJA 2NZ4A 4F36A 1UEVA 2QL7B 1T9VA 2YNHA 2Q6CA 1F5BA 3BPDA 1HBNB 1S7HA 4PZVA 3HT3A 4LFCF 4WF9Q 4K50A 4ZVEA 3HDSA 3AXKA 2C2EA 4H4OA 2YWHA 3G87A 4ALZA 1IJFB 1F3FA 2QSFA 4NLRA 2HYIB 2QL5B 3TX8A 1JK9B 1P1LA 4Y65A 2NUUG 4DUYF 4WE1A 4IRKA 3JQKA 4DEZA 1RA6A 5DG8A 2U2FA 3TX0A 4PABA 2C42A 1JLBB 4NLGA 4RZRA 5L1IA 3GJRB 5HI7A 3QJPA 3QT7A 4FVMA 3U1LA 3MAAA 3WIUA 3GR1A 2XLKA 1NSPA 4B3OA 4DL2A 1U6BA 2UVVA 1D0EA 5CYQB 4TU8A 4DL7A 2ATLA 2HFNA 1C1BB 1RABB 4IOAQ 2JOQA 4HL9A 5KFHA 2EW9A 4JUZA 3OFEA 1IQTA 2OIHA 2PC6A 4Y0FA 3PYEA 3MR2A 4MH8A 3DLLQ 4UQGA 2HQCA 2W25A 3EZ5A 2OJ3A 2BE9B 1I5OB 4OYIA 3D9BA 4DL6A 1QVFR 3MZIA 2WB4A 2RHQB 4DV4J 1HBUA 1RT3B 2JH3A 1M1HA 3VVUA 3TANA 3MAQA 1RCXB 3O2IA 1HNWF 2BW7A 1U49A 4Q44A 1NDLA 3SZ2A 4I6YA 2HKEA 5JJBA 1B3TA 4UY85 3M6XA 3PJXA 1FFWB 5GMDA 1NKBA 5HQMA 1U1OA 1NAQA 1FD8A 1CEZA 3BV8A 2EWHA 4LR8A 2FY8A 5LSRA 2KRRA 3MM7B 5KFVA 1WHXA 4O3NA 2DXFA 1L3KA 3AY0A 4OI1A 2YQ0A 4O3QA 3BQ2A 1NKCA 5D4PA 1OPIA 4USMA 3CWJA 1SC3B 2WB1D 1N36J 4DR7F 4JI2F 4DUZJ 3VGSA 3PRBA 2BZ2A 9ATCB 3J7ZT 3KLGA 2W2NP 2R7WA 1OSDA 1VQMS 2H4YB 4UOFA 4KGZB 4Y00A 3IFEA 4NL5A 4DV2F 2UUTA 1UMJA 1UFKA 3OD2A 1D1UA 2P9GA 1O6XA 5IT9U 4TY8B 4F2SA 2FHJD 1CULA 5HANA 1Y9OA 2KTQA 3H2UB 2IC3A 2RT3A 3PR5B 2GZOA 2ZITA 3GPAA 2ZM6J 2BXJA 3OHBA 3HVTA 2LVWA 1HW8A 4RX6A 2ZVSA 1KBRA 1TMMA 2AP6A 5A8RB 2I6WA 3TRGA 5HLFB 3GYXB 2AYMA 2ZDOA 2D1CA 5F3TA 3M8PB 4IO1A 2B8QA 1LKZA 1JLCB 4DR2F 1UETA 5HVGA 2ALYB 4NYZA 2B4PA 1WSRA 5B7WA 2MQLA 5GAGI 2ZDPA 1ITPA 3EPGA 1TUWA 4QIWD 4U6PA 3KHGA 3NXZA 3VZIA 1WC0A 4ZDNA 4Y28C 3QO9B 2PEHA 1NK9A 2B5JA 4J91A 4OX9F 5HJYA 4RWXA 1A0OB 4ED6A 2OP5A 3BSNA 3M2UA 4A4JA 4CI0B 4BC9A 2J9EA 1R8BA 5HN0A 5LJ5Y 2VA2A 2J6TA 2DHSA 4NLYA 2JC0A 3C2PA 4NXMJ 5D15A 3OVAA 3MEEB 3QAUA 2HBZB 4Y2AA 1S9EA 1OWXA 4KGMA 1S1WA 3SEOA 2GC8A 2N4CA 2B7CB 3ENQA 4EO8A 3PW2A 3NAHA 2XS5A 3D28A 1WEZA 1S7IA 3NNAA 2YNIB 4YUDA 2ZJRQ 4M94A 1FRMA 4K59A 4DSKA 4DSIA 1XR5A 2CADA 4C3MA 2VJUA 2AJQA 2B8PA 2M4MA 3N5FA 1OS5A 2M5YA 1Y5LB 5J1PA 3R5AA 1N33J 4HI2A 1H38A 3EXYA 5MAOA 4M5IA 3BSCA 2CJYB 3UE2A 3K2YA 5DQGA 2LA6A 3EICA 3FDSA 2XHWA 1QUPA 1Q95G 1D09B 2HRYA 2FC9A 2J9DA 2J0XA 4CH1A 3LQVA 4LF1A 2VU5A 5D0GA 5H9FK 2K2PA 3KHRA 3EUNA 5K8NA 1S1VA 1X4FA 4C3KA 4EEYA 2X1FA 1A6LA 4ZJOA 1VIXA 1JLQB 3ILJA 4IKAA 3ILIA 2DTJA 2C2NA 1TV6A 2JEIA 5KFJA 4PUOA 3M1VA 2Z8QA 4H54A 1FEEA 1IBKF 4LT6A 2NYHA 1ULRA 1AT1B 1FERA 1C0TB 3PFEA 3ZTPA 5ADZA 5CAAA 4RWWA 3MM6A 4AL6A 1SC4B 5E7OB 1K44A 4X4TA 1WHYA 1E6YA 2DEJA 1XMOF 1RBAA 3PRDA 4YOEA 1U1NA 3KUGA 3K17A 1NSQA 3LO3A 4FNHA 1MU2A 3GILA 3HI9A 1S0VA 5KT6A 2HMIA 4G6VB 3PYDA 2NXCA 2FVRA 1RWWB 3QBCA 4XO0A 1IKVB 2WSEC 5GMKa 3ONQA 1KLMB 3MM9B 1KDNA 1NK0A 4ED1A 3C66A 4K2XA 5HK4A 5KFAA 2L41A 2V9KA 3CC7S 1HBOA 5CD4H 2R8IA 3HLUA 3ELHA 2DHGA 3Q8VA 3LALA 2F7VA 4ZPDA 2AF6A 2E1CA 5AXLA 4EWTA 3ILLA 4IH7A 3M8RA 1VK3A 5THWA 1VC6A 3MMAB 4O4GA 4LFBJ 4DOZA 1TL3A 2Q1LA 1S59A 1XEZA 4ZVUB 6FD1A 3I31A 4ZVTB 4N5SA 2CZVC 1SIWB 1HIYA 2DBBA 1T94A 3DRPA 2C1EB 2ZH2A 3VAHA 4PPZA 3K5LA 2CXEA 3OR2B 5LMNJ 2PD1A 2QA2A 5T7LB 2R7OA 1VQLS 5KG2A 4FBUA 2DITA 4WBFA 1F6TA 4QOTA 1Y00A 3R6GB 7AT1B 4JI0J 1QVGR 5G0RA 1X4CA 1HBMB 3AA8A 4FXWA 4DL0C 4LJMA 3MD3A 1N34J 3M2RA 5HBMB 3ZTOA 2CNLB 1OYEA 3NBPA 4JI3J 4FZVA 4A8YA 4DX5A 3AB2B 3H8YA 3N01A 1JLEA 2RUGA 4WP9A 1S6QB 4JV2A 2FJWA 2OTLS 2HHXA 4IOBA 2FVQA 1ZM9A 1TELA 2WBRA 1RE1B 3E01A 4M5JA 1HPZB 1JJHA 2IMWP 1S1XA 1TL7A 2IM1A 2UV8G 1DTTB 3MECA 1VBZA 4LRFA 4FXDA 5KT2A 3IM8A 4KAIA 2PI4A 4MK9A 2CJQA 4X66J 2RHSB 2Q79A 3DRRB 3MD1A 4KV8A 1RU2A 1XTZA 4DQRA 4QZVB 1YRTA 1DQAA 2CWXA 2YY3A 2I5JB 5LSLA 2O3DA 1CJKB 2QO3A 4DX7A 2R4FA 4DL3A 4ZCKA 1RHMB 2CQIA 1SL1A 2C2RA 4EUVA 3SFUA 4RNOA 1D8YA 3L3CA 2POKA 4HACA 3UWTA 4N56A 1JLGA 2CQ1A 4OYMA 4A8XA 3IWLA 4HDGA 1LW2B 1W2IA 5KFZA 3O3LA 4GO5X 1FNOA 3GIIA 2J6SA 3MR5A 1IBLF 2F40A 3I5BA 4WZQA 2A6OA 4DPOA 2R7XA 2DY1A 3MCSA 4ZPTR 3HJFA 1RTJA 4R5PA 5FLXU 5CXTA 4J9RA 3VHQA 1TKXB 4F4WA 3MF5A 3NGSA 2IM2A 2G9OA 1NM2A 4ZITA 2M70A 1WNEA 1FXLA 2IYGA 1DTQB 2QN6B 2QRRA 3C16B 1BGXT 1U1QA 2G2OA 2XLJA 3HT0A 1BMQB 4PXBA 1H6KX 3QZ8A 2XYPB 1UVMA 4J9VA 3CJ3A 4C11B 3CD7A 1KTVA 1N8RT 1FKOB 2GHVC 3X1LB 2VDIA 3WC2A 3C6TB 2HHTA 2MGZB 3TJAA 3MI7X 1ELOA 2VBYA 1UWAA 3SSQA 2LDYA 2DO0A 4NPOA 2OPQB 4QYZJ 5IC4B 1YI2S 1B70B 3NS7B 1YGYA 4ZHRA 1JWWA 2B6AA 1ZZNA 1UEKA 4YR2A 3D1OA 3CXCR 3AJ1A 4ZN3A 2XMUA 4YDDB 2GIFA 3HHLB 5F8IA 2Y1RI 2IRYA 2MB0B 3UDCA 4IFYB 2KFYA 2ZE2B 1RT6B 3R97A 4WU3A 5AXMA 3DMJB 4AUKA 4DQIA 4CQ1A 2IM0A 4I67A 4WFBQ 2NSCA 3H98A 2GJFA 4DUTA 5D4OA 1R0AA 5C42B 5IS2A 4OJ3A 4LF9J 4RNFA 4DG1B 3KLHB 4DN9A
chains in the Genus database with same CATH topology
4I6WA 2K1RB 4TU9A 1HI1A 3LUYA 1FXRA 1VQOS 4EBEA 3FGVA 1Q8BA 4MIAA 3KK3B 4X4SA 4O4GB 3BM7A 3H5UA 1M5SA 1VIOA 4TY8A 3Q24A 1TL3B 3AHPA 2D9OA 4M8LA 5CCLA 3CCWA 4DR3F 4KPYA 5FJ4A 2IA0A 1TFWA 5F8GA 4WE1B 5DLGA 3IO1A 1S6UA 1TKZB 1BQNA 1XERA 5KFIA 2FHMA 3M4XA 4I7FA 1U1KA 2V4JA 3IAS9 2ZH3A 3GB0A 3WC0A 2A3JA 2BJDA 2E66A 3IAM9 4A46A 1FKPB 5F0WA 5IFMA 1CQMA 1FVQA 4EZ9A 3RR8A 5GVQA 5L38A 3RBEA 1N32F 1B64A 2J7WA 1RT4A 3W2WA 3AA9A 4C0HA 4LSLB 1TZ0A 3K5MA 3AB4B 5D8HB 2NUHA 3HMJG 4KQZA 4CNZA 2CZ4A 3JSYA 5KFOA 5KFWA 2B3TB 2C3OA 2KFZA 1KHWA 3I9ZA 5IXUA 1JLAA 4N8OA 4B3OB 1KD1T 1VC5A 2M0GB 4KHMA 4B17A 2M7SA 3D0IE 5A8RA 1DLOB 4O3RA 1CC8A 5CZVA 2RS8A 4I56A 5JXSA 5F41A 5GAEI 1Q7LB 1TAQA 3G86A 3THPA 1L3SA 2UUCF 4LUBA 1IQZA 4UQTA 4X4PA 4DF4A 3GV8B 3FSXA 3HVRA 2IRUA 2ZH6A 3G6XA 5HLFA 3VF0B 3N28A 2YKNB 2N4DA 2UUAF 3BF4A 5G0RB 2KM8B 1KN6A 1H0HB 3ZFVA 2R7RA 1WWHA 2MYFA 1NK5A 5CZXA 2KU7A 1R8CA 1U24A 1ZTWA 5FDLB 3TAMA 4DS5A 1L3VA 2X1GA 1YRXA 1TKTA 4L6V3 2ZHAA 4DR5F 3M9MB 1JLCA 3VAJA 2ASJA 3CDBA 2I0XA 1VRTB 3GIMA 2BM0A 3ZZRA 3JSMB 3VQTA 3M8SA 4IH5A 5A8KA 3DFEA 3JYTA 3PZPA 4OX7A 3T9ZA 4WKRA 1NO8A 3DHXA 4D3HA 1R7IA 1U47A 2F9DA 3TARA 2ZBIA 2MJNA 3SQGA 4ZK7M 3CCES 4MIBA 1UFLA 3NNCA 3T5HA 2Z4PA 5GADI 2HHVA 1TVRB 5LSOA 1QUVA 2UXCF 4A48A 3EPIA 2XSJA 2AWZA 2GIRA 4PXCA 3UFCX 1JXEA 1VC0A 4CO4A 2LXIA 1YG0A 3AQOA 4XK8C 3LW5C 4NXNF 5HMZA 2JRSA 3MM5B 4H4MA 4E8UA 1R6YA 3IWNC 4OQJA 1XNQF 2DGWA 2HW3A 2EBEA 3OUYA 2E7XA 3R27A 1HYSB 2CQ4A 1VQSA 2YX4A 4QIGA 5J1NA 3TP2A 1Y3KA 4YR0A 2W9BA 2NSBA 3QO9A 4IUFA 3C3LA 4YP3A 2Y0SD 4O44A 4P7VA 2QT7A 3P96A 2VPWB 1KLNA 2GQQA 1LWCA 2GV1A 1RT7B 3THVA 2CPIA 2VFTA 4ECSA 3CEDA 1HFEL 2DPIA 4C8KA 1Q8IA 4BWMA 3CC2S 1CSJA 2R9LA 3TAQA 2VOPA 2MY7A 3A1YG 1P6TA 2DNRA 4BBYA 5BYRA 4GC6A 4G1PA 5I42A 3O44A 1SI9A 4HTIA 2JVOA 2BVZA 2LECA 3BGRA 4ZOSA 2RVJA 4ZP7A 5K8MA 2MQMA 1T3NA 3GG1A 2XZWA 4LF9F 2UUBF 1FO1A 2KVIA 3N9UC 4K4VA 1HMVA 1PGZA 2DNLA 3HKWA 3MEKA 3DHWC 4FF4A 3CDUA 2VC1A 2LQBA 1JJ4A 1M5VC 1FJCA 4F67A 4RUAA 1X4EA 4YEAA 2BDPA 1WG1A 4ZP6A 4AXIA 2KG0A 1QY7A 5E3RA 1ZM4A 2VB6A 5KT7A 1S0NA 3E51A 2CQ0A 4E98A 3DOMA 1H7XA 4G1IA 3ULHA 2GFFA 3IRXB 3IN5A 2R2RA 2W7AA 3RAXA 4XDDA 3K0JA 1HNVA 1WG5A 3R1LA 3DI6B 3KJVB 1NU4A 3N6LA 3PX6A 3KYLA 3OR1B 2MPUA 4KV8B 1C1CB 5L1JA 4MK7A 2ZH1A 3BB5A 4HHJA 3MAHA 1MSWD 3KLGB 2EFQA 4BHQA 4J37A 3KTQA 1VHFA 2GGPA 1P1TA 1PC5A 1WHVA 2VFSA 3HHKA 3I32A 3I55S 1H3DA 1U1LA 1HWLA 1GQEA 2BANA 2E5HA 4Q5VA 4KC5A 1KOOA 3WDOA 4O0IA 2XMTA 1NHUA 2F3JA 2VQFF 3M9NB 4DWIA 5F8LA 1J5OA 2SXLA 2YKQA 1HI8A 2EG2A 3FQLA 3LPYA 1G6BA 2YNFA 1G2EA 2FHKA 4PWDB 4KIAA 4KB7A 4OI4A 2DO4A 3JTPA 3J7YU 5DS7A 1HWIA 4OV1A 4NLVA 4LSNA 2IA6A 1YJUA 2KT3A 2DNNA 1YRUA 3LWMA 4DV3F 3CDAA 1YITS 2KKHA 4LFAF 3OL6A 2CPEA 2DISA 3QJLA 5K5MA 2H9ZA 3DM2B 3RB4A 3GFHA 4B3MF 4Q45A 1NEEA 4MJKA 5E3CA 4PG5A 2VA3A 2KYZA 1JLGB 2VBXA 3HVTB 4OZNA 3DDNA 3WZ0A 1M5PC 3TOQA 2P9EA 1S0OA 3KLEB 1BWEA 3TVYA 2HLUA 2AGPA 2CPYA 4I0WA 1VQKS 2KB2A 4NLTA 3UNGC 5M2UA 4U67Q 1RT5B 2B4OA 5BYQA 2PN6A 3HM9A 1VQ7S 4URQU 1RTHB 4PWUA 2A2CA 2WW8A 1Q78A 1P9QC 1LW0A 2Z2MA 3BR8A 5LXYA 4A8FA 3MPYA 1HW9A 4FXVA 4J5OA 3KK1B 1YQHA 2QFJA 2AV5A 2WBMA 4NA1A 3LP2B 4ZKAA 2L48A 2RSQA 1NB7A 2I9SA 5I4MA 1IKWB 4MFBB 2Z2LA 4KHRA 5KFEA 3I4HX 2RU9A 3DYAB 3J7A1 2VG5A 4WFXA 3JAMY 1RTJB 2L08A 4R5PB 2IFXA 5HROB 2FLPA 3M8QA 1G1XA 1JLQA 2YKMA 1X8DA 3QGGA 3QIPA 3KHLA 3PW4A 2M9KA 4DFJA 4PR6A 3TUZC 2ASLA 3O5TB 4K5RA 4M63A 1FF2A 4R25A 1P27B 4OX8A 3OJSA 3TVZA 4K4UA 1MW7A 2DK2A 3HKZD 2YX1A 4FVCA 2AGQA 2RF2A 2QLWA 4B9UA 2MQOA 3TW0A 5KFNA 1YJWS 3MTKA 2W9CB 3DOKB 4ID5B 2CQGA 2ZHOA 1R8PA 2VC0A 2CYYA 2RRBA 2E44A 4QBUA 1JKHB 3CIZA 5AE3A 1U1RA 1Y5IB 3KNGA 3IBWA 3OW2R 2YNGB 2VG6B 3EZUA 5K8PA 3RRHA 5H9FJ 1A9NB 1Q7YT 1CC7A 2ZZNA 1FNXH 4ZPVR 1V3ZA 3ZZ0A 2CRLA 2QIFA 3T9NA 1GTHA 1MROA 1TL5A 1W2BR 2XY7A 2EFPA 1Y4ZB 2R7VA 4A8OA 4K4WA 3NWGA 2OPSA 4YB5A 1T03A 2HS4A 2DVIA 3NS5A 2A18A 3H25A 1TQLA 1OPZA 1FRXA 3LP0A 2V2KA 1VJWA 4U9RA 2W7PA 3NG8A 2NXUA 2YVSA 3T1YF 1SUQB 2BE2B 2ZD1B 4R8UA 1C4CA 4ECWA 2B5JB 1K1SA 4FBTA 4PCQA 2VD3A 3BZQA 4M5DB 4F4XA 1MWYA 1Y3JA 4Q8EA 2ZOFA 4Y2KA 3TVKA 4H4KC 1IM4A 5K14A 1D9AA 4B3TF 4DF8A 3DLGB 3J80Y 4X2BA 2QV6A 2BJEA 4D3GA 2B9YA 1H98A 2FDNA 4EBDA 2CDQA 4OIXA 5CA5A 3T5KA 2XMKA 3H59A 2RKIA 2EK6A 4JOUA 4RW8A 2XY6A 2PIIA 2VPXB 1N54B 4KGKA 2B6AB 4ZPWR 5EX3A 1XC9A 3FNNA 5L1KA 2OPPA 1GXUA 1IJEB 2C3PA 4DDFA 3HVAA 1SJ1A 1S1UA 3SCLE 5A0YB 3CC4S 1FDNA 1SQEA 5J1EB 1IKVA 3SMZA 2R7SA 1KHVA 2XSFA 2OD6A 1U2FA 1M1KT 1WI8A 3CMES 3IWXA 2P9CA 5CHCB 4F3QA 2AQ4A 4KFBA 4CCHA 3OL9A 1S97A 1Z1ZA 3BEGB 2JSXA 1PILA 3OTEA 2R8HA 2ALZA 2OMOA 1S9EB 4NCGA 3DNCA 2C2DA 2XULA 5GAHU 3T1HF 2O5DA 2P6TA 2PO4A 3DCAA 2E9ZA 4OI6A 5IM0B 4O3PA 2MKKA 4DFKA 2DGQA 1VQ6S 2JFKA 4DQPA