2LMIA

Nmr structure of the protein bc040485 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
GSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the human RNA binding protein BC040485
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords G-rich sequence factor 1
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lmiA01
2DITA 1PGZA 2M70A 2HYIB 1N88A 2MY8A 2QFJA 5MLCV 2LEAA 5LXRA 2AYGA 3P3DA 3RW7A 1JJ2R 1U1NA 5D77A 1KC8T 5GAEU 1YJWS 3DLLQ 4PRFA 2XB2D 4UQTA 2BZ2A 5IM0B 1YJ9S 4IUFA 2HVZA 3I56S 1X4GA 3EGNA 1VQLS 3CMES 2VONA 2LCWA 1X5OA 2UP1A 2YH1A 1VQOS 2GHPA 2N3LA 4OZ1A 3CPWR 1WI6A 3VALA 2ADBA 2KT5A 1VBXA 1X4AA 4WCEQ 2A3JA 2D9OA 3FEXB 1R8PA 2MMYA 2MJUA 1U1OA 1YTYA 1G2EA 1W2BR 1FNXH 1YHQS 2J0QD 2DHGA 1JJHA 2M7SA 2M88A 1UAWA 1Q7YT 2KH9A 2MSSA 2RRBA 2DGTA 2L9WA 5LSOA 2KG0A 1M1KT 2U1AA 3CCVS 4IOCQ 2DNKA 5GMKa 5DM6Q 3BO3A 3NS5A 3B4MA 1F9FA 4ZKAA 2OTJS 2MQOA 2DNQA 2MYFA 2MQQA 2MQMA 2RQCA 2KFYA 3MURP 2KG1A 2MQLA 1S79A 2XS2A 2HGNA 3CULA 2CPXA 2DISA 1DZ5A 2XNRA 3MUVP 1WI8A 1S72S 3K0JA 4FXWA 1X4DA 1OIAA 3VF0B 3CMAS 1K8AT 2M0GB 1VQMS 2CQCA 1B7FA 1U2FA 5H1SV 1H2VZ 2MSTA 4C7QA 1FXLA 1VBYA 3CCES 2KN4A 2D9PA 4WIIA 3SDEB 3THPA 2XS7A 2DNLA 2HZCA 2G1DA 1WHYA 4YUDA 3R1LA 3UE2A 2ERRA 5HL7Q 2CQPA 2KU7A 2MZSA 2M2BA 4WFNQ 5DDQC 2B0GA 1OO0B 2L08A 1D9AA 3CD6S 3BEGB 3HHNB 1X5TA 2MXYA 4FXVA 3CXCR 5DETA 3BO2A 3VAIA 1X4BA 1N54B 1WF2A 5D78A 2X1AA 1VQ8S 1A7GE 3SMZA 5LJ3Y 5BJRA 3G4SS 5GADU 3VAKA 2MZJA 2LEBA 3MOJB 2KXNB 5CYJA 1O0PA 1SJQA 2ZJQQ 4EGLA 1WHVA 2GO9A 2CQBA 2CQIA 4M5DB 2M52A 2KHCA 4F25A 4ERDA 2KXFA 3MD3A 1U1PA 2DGUA 2FPHX 3NNHA 2OJ3A 3CC2S 3UWTA 2FHOB 4LIRA 1WEYA 1YWXA 2CJKA 1WHWA 2MB0B 2K8GA 5IFMA 1XN9A 2YTCA 1HD1A 2MZTA 2M8DB 5EN1A 1VQ6S 1JMTA 2CQ1A 1CVJA 2CPHA 1WF1A 2DNOA 5IM0A 4WF9Q 3D2WA 1FHTA 3VAMA 2DGXA 1N52B 1VQPS 4W92B 1Q86T 4V19X 1YITS 3TP2A 5GAGU 1FJCA 4QQBA 4CQ1A 3CCLS 3V4MA 1N8RT 2DNNA 1SJFA 2MJNA 2DK2A 4C0OC 2MQPA 3G8TA 4UY8T 1NJIT 3MXHP 3J7YU 2CQHA 5ITHA 2XSFA 2G0CA 1OWXA 3CTRA 3CC7S 4Y00A 2LXUA 2MZ1A 2DH8A 4A8XA 2AYEA 1VQ9S 3UCGA 4WFAQ 4TU8A 2E5GA 2KYXA 3MD1A 1D8ZA 2KI2A 3LQVA 3TO8A 4U67Q 3H2VE 1RK8A 4CH0S 4TU9A 3I55S 4PR6A 2OTLS 2QEXS 2JWNA 1YJNS 3BS9A 3U1MA 1QVFR 2RQ4A 1R8HA 4WFBQ 2CPJA 1AUDA 2DNZA 3U1LA 2YH0A 1X5SA 1OPIA 2LKZA 1FJ7A 2NLWA 1QM9A 1M5KC 3CUNA 5CXTA 3NS6A 3VAJA 3UD4P 2SXLA 3RW6A 3ZZZA 2LYVA 4QPTA 5DM7Q 1U1LA 1U1QA 2DNMA 2N7CA 1QVGR 2X1FA 2DHAA 4ED5A 5HO4A 2DHXA 2DGQA 3OW2R 2OSRA 1P1TA 3BO4A 2OSQA 1DRZA 2AYBA 1WEZA 5GAHU 1X4CA 4W90B 2V94A 2E5IA 2VOOA 2LMIA 2ZJRQ 1X5PA 5GVQA 2U2FA 4LJMA 4OZ0A 4QU6A 2J76E 5JVGQ 1Q81T 2FY1A 3CCSS 2I2YA 2LECA 5LJ5Y 1IQTA 3MUMP 3IRWP 4TLQA 1SJRA 2DHSA 2DGSA 2EK1A 1WG5A 2XS5A 2E5HA 1SJ3P 3G9CA 1SXLA 2LA4A 1HD0A 2PEHA 3Q2SC 3VAFA 1WEXA 5LXYA 2CPZA 2FC9A 1YIJS 2MKCA 1WF0A 2JRSA 4CH1A 1FJEB 2MKIA 5CA5A 3CCJS 1M5PC 1VQKS 4LMZA 2KM8B 3PIOQ 2CQ2A 3B4DA 3P6YC 3VAGA 2ADCA 2CQ4A 2MKHA 2F3JA 2J0SD 3CCUS 4QU7A 1HA1A 2F9JA 1H2TZ 2G4BA 1NO8A 3THTA 2YWKA 3CF5Q 2HGMA 2RVJA 3NNCA 2CQDA 2MKKA 2X1GA 2DB1A 2QA4S 4J5OA 2MY7A 3ULHA 1U1RA 1VQNS 2KXHA 3MUTP 1ZH5A 2M9KA 4P6QA 4F26A 3US5A 2HGLA 3LPYA 1KOHA 3NMRA 1WG1A 2MHNA 2KVIA 3JB9k 1WELA 1UW4A 1PO6A 3Q2TC 1FT8A 2DH9A 2M8HA 2NZ4A 3CCQS 1KOOA 2N82B 2VODA 4C4WA 1U6FA 5DDPC 2RRAA 2PE8A 2MGZB 3ZZYA 3EGZA 2LXIA 2N3OA 4YB1P 2VOPA 3VAHA 4BS2A 3CCRS 2DO0A 3L3CA 1M90T 1DHMA 2DNRA 2JVOA 3R1HA 3SXLA 2DNPA 1VC0A 1A9NB 1NU4A 1VC5A 2CQGA 1DBDA 1UP1A 3CCMS 3MI7X 2CQ0A 3EX7B 2MQNA 3G71S 3S6EA 2MGZA 1WWHA 2K3KA 1L3KA 2YKAA 2RS8A 3S8SA 1K9MT 1KD1T 2DNGA 5IQQA 1VQ4S 3P49B 2FC8A 2X1BA 4RU2A 2MKJA 3NNAA 1WG4A 2CPEA 3HI9A 5JVHQ 2CPYA 2F9DA 1ZZFA 2OIHA 1BY9A 2KRRA 4PKDB 3G96A 1RKJA 3UD3P 3UCZP 2LQ5A 3DXBA 2EVZA 4YOEA 3J7ZT 2RU3A 2AD9A 2XNQA 5LSLA 3G8SA 2CPFA 1M5OC 1Q82T 2DNYA 2L41A 1U6BA 4F02A 3MDFA 2MKSA 1M5VC 3N9UC 1KQSR 1X0FA 1VQ7S 3S01A 1FO1A 2DIVA 3IWNC 5FJ4A 1WTBA 3G6ES 2LA6A 2MZRA 2CQ3A 2ZJPQ 2M4MA 3UCUP 2E44A 3SDEA 2DIUA 3CC4S 1H2UX 1UFWA 3P5TL 4WKRA 3PIPQ 1P27B 2I38A 2J8AA 2KM8C 2E5JA 2WBRA 4TU7A 2JVRA 1H6KX 2DO4A 2EK6A 2CPIA 2DNHA 1VC6A 1VQ5S 1JJ4A 1HL6A 2RT3A 1U1MA 1VBZA 2O3DA 4IOAQ 2RS2A 1URNA 2RNEA 2JX2A 2CPDA 1ZZNA 3S7RA 2DGOA 2KRBA 2DGWA 1K73T 3R27A 1SJ4P 5DDRC 2DH7A 3H2UB 2D3OR 2MPUA 1WHXA 1YI2S 2MZQA 4IO9Q 4Z2XA 4Y0FA 1U1KA 5DDOC 2AYMA 2BOPA 2DGVA 3TYTA 2Q79A 2RUGA 1X4HA 3FEYB 4CIOA 1X4FA 1X4EA
chains in the Genus database with same CATH superfamily
3OHBA 2XO6A 3CDWA 2QLJB 3BN4A 3PRBA 1PGZA 3FMWA 2HEKA 3PZPA 4OYAA 1N88A 2MY8A 2JZ5A 1CLFA 2XEXA 4FN5A 4RNHA 3BB5A 4IRCA 3FQKA 4O4RA 4A48A 4OI4A 2HS3A 2P6TA 4TYAA 5KFDA 3OVAA 1HFEL 2RDIA 2K3IA 4P74A 4ZLNA 3KK2B 2IRXA 4RBVA 2AYGA 3LW5C 4DOZA 2VG6B 4DFMA 1S49A 1KC8T 4DL6A 1YJWS 3EZUA 3DLLQ 4PRFA 1V5IB 3F56A 1IBLJ 2CVIA 2IAJB 4B3SJ 2BW2A 4CLYA 4PWDB 2CJQA 3CIMA 4A8WA 1VQLS 2LCWA 4WYLA 2JH3A 1JLBA 4DFKA 2IMOA 2EFVA 3RAQA 1KVJA 1U0SA 2ZM6F 1FCAA 3RB4A 2RU9A 2V8GA 3D1OA 2VU5A 4Y2MA 3GQCA 3NWRA 4J9RA 5G4DA 1IR1A 3D0HE 4OZ1A 2B7CB 1WI6A 2GHVC 1TK0A 4V1Ak 4IO1A 4OYWA 4HHJA 2AKWB 1VBXA 2R7OA 5CH7B 3ZZTA 2YWGA 2E1CA 3FEXB 3LAKA 2IDEA 5A76A 2ZWOA 1UA1A 4IFVA 1PJ6A 3QWUA 1DQ8A 3EGWB 4OL8A 1Q16B 1JJHA 1S10A 2Q3PA 3KLGA 2OLWA 4DS5A 3MMCA 2A0FB 2H65B 1VISA 1NNDA 2Q43A 4UOCA 1UAWA 1SIZA 1U0HA 2MSSA 2NSCA 2QL5B 2CZ9A 1KR4A 1F5AA 2ZH2A 2CNKB 3CCVS 4LFCF 3MFHA 3M2UB 1WC5A 3BBCA 5GMKa 5KFLA 4DF4A 3BO3A 2H5EA 3ENVA 3C16B 3LWLA 2HAIA 4MMOA 4BC9A 2ZHBA 1ZM2A 3KHHA 3PX0A 2B4OA 2MYFA 2QLFB 4G3IA 1UJ6A 1S77D 4NLVA 3RR7A 4CO2A 3GFZA 2MQMA 4E8UA 4DLGA 1AA1B 3MCMA 2RQCA 5J2MA 2RHSB 2KFYA 5J2PA 2KG1A 4U9RA 4L76A 1UETA 4F50A 2XS2A 2WSFC 2HGNA 4IDKA 3KFWX 2XMAA 4EU0A 1NDCA 2K2PA 3J7Z5 4F3OA 1DZ5A 4ZVGA 3MTJA 3GMGA 3C6TB 3UD5A 4DR2J 2HFUA 3K0JA 2XYGB 3Q22A 1QD1A 1N5YA 1HI0P 4DV3F 4HACA 2WVFA 1NHUA 2KZZA 4GKJJ 2IJNA 2BJ8A 3CMAS 1K8AT 2M0GB 1KKHA 2K7KA 4NRTA 5A2QU 3SV3A 5KG2A 1XNQF 1U2FA 1NM2A 5H1SV 2IC3B 4HH1A 2F1FA 2RE1A 2JSXA 4PG5A 5E5NA 2M3DA 2Y9HA 5DG7A 4OZ2A 4YB5A 2EC2A 2JLFA 1P6TA 4C7QA 1J5OB 3QJPA 4PABA 3CJKB 2ZE2A 2HURA 3QGIA 4G65A 3BN7A 3CCES 2UVVA 1S57A 3HSZA 3SDEB 3SSSA 4YMEA 1DQAA 1O8BA 1TVRB 2DNLA 3HPOA 2JLGA 2JEJA 2AQ4A 2XS7A 4C8YA 2B4VA 2BRKA 4NYZA 4RLEA 2G1DA 4YUDA 3FZ2A 3OVBA 3UE2A 4M5HA 2DXDA 2LDYA 3DRXA 1B0VA 2EFGA 3UDCA 3K89A 3L7UA 3PEJA 2L48A 3DOKB 4TQSA 4FS2A 3PJWA 5F3TA 1HNXJ 3HT3A 3EPIA 2FJWA 1PILA 2KU7A 2NYHA 3TWZA 5J1PA 5IZHA 4ED3A 2BE2B 1GQEA 2JJ4D 4KQZA 3MEDA 4RW4A 2DJWA 4O3PA 4R8UB 4PYDA 4FPRA 1C1CA 3BEGB 5IXUA 2O01C 3MM8A 3HHNB 1BQNB 2R7WA 1IKXB 3FFIB 4FXVA 4IG0B 2MXYA 3CXCR 2UVUA 2KO1A 1KWMA 4NMXA 3T41A 4I4BA 3FEZA 3MM7B 1N54B 2O5DA 4YDXA 1HWJA 3JSYA 5K14B 1WKKA 2X1AA 2UXBF 3PFEA 4IH7A 5M2RA 3NOGA 1TKTA 1LWEB 1ELOA 3DMJA 4A8SA 2PN6A 3N79A 1GFWB 1ICEB 2A1BA 2LEPA 3MR6A 2R7VA 1JIHA 2AU0A 4P75A 3AD8C 4I2QB 3FJ2A 5GAHI 1CJTB 2F8EX 2XMTA 3MOJB 4C0HA 3QO9B 1QY7A 1JLEA 3BGUA 1S1UB 3IG1A 1RT5A 1UPPA 2CQBA 4U8VA 1NKCA 2AGPA 2VA3A 4KH0B 3IFEA 4M5DB 2KHCA 1T05B 1N5SA 3CD7A 3OL9A 4O3RA 4QWCA 1RXOB 4H4OB 2UUWA 4ZPBA 3I4PA 4KHPF 4FF3A 3BKFA 1XR6A 3IS9A 1GMUA 3MD3A 2FVRA 4DV5F 2YPYA 3ZZPA 1U4BA 4DQIA 2OJ3A 4ZVSB 3TJ8A 3CC2S 2AGQA 3NNHA 1YLXA 4LIRA 1U48A 9ATCB 1WHWA 3I0RB 2ZHOA 3AXMA 1X9WA 3QFHA 4X4OA 1H74A 4HDHA 3W2VB 3WIUA 2MZTA 4F2SA 4USJC 3T9NA 5L38A 1HD1A 3F0NA 3M32A 5C42A 4OYIA 2OI2A 1JMTA 5HAOA 5KFSA 2CPHA 1Y3KA 1GMWD 4G1IA 3RG6A 3GFHA 1TKXB 3VCDA 2KFZA 3AJDA 5IM0A 2N4DA 3D2WA 3VAMA 2HK2A 1SQGA 3M4XA 1RT7B 1TUGB 4WP8A 1Q86T 3KUHA 3LF0A 2GIRA 4JI1F 2VFSA 1RU2A 1RP5A 4ALZA 3GR0A 2VJUA 4ECQA 1VFJA 3GYXB 2IYIA 3V81A 4NYOA 2VG5B 2QIFA 5GMEA 4B3OA 3GSIA 3K5OA 5IC4B 4EI2A 3OXFA 2HS4A 3QIPB 2NXJA 4M8LA 5KAKA 2BM1A 4C0OC 3J80U 2IM0A 1LW2A 3V6DA 2VH7A 4JYAF 2PDAA 4YR2A 3M8WA 2IA6A 4DPXA 2AIRB 1NUEA 2V2KA 1OWXA 1KDNA 3PACA 4CO4A 2LXUA 2ZZTA 1HBOB 2DH8A 1VQ9S 1AFJA 3UCGA 5L39A 4WFAQ 2E5GA 3QGGA 4ZLLA 3BQ1A 3MZIA 3GG0A 1TUVA 3D0IE 1MU2A 1ZBTA 2EPIA 4K0KJ 3TJAA 1I5OB 2KI2A 3DOLA 1NJWA 2Y8WA 4DR4J 2B5JA 2LQ9A 3H2VE 4KO0B 4O3QA 1VRTB 4TU9A 4PR6A 1H0HB 2DCUB 3I55S 2OTLS 2PFFB 2BJEA 3BS9A 3U1MA 4DL4A 3UR3C 3C14B 2A6OA 2V68A 3MAHA 2FVPA 3EVOA 5E3QA 2HHHJ 4JI4J 3QAEA 3H5YA 4I1TA 3W60A 4NLOA 1T02A 3OLBA 4Q7AA 2ZH1A 4CZCA 3A8EA 3DRPB 4AUKA 1WC1A 2B56A 1X5SA 1TL7B 2YH0A 3DDIA 1U8WA 1R8CA 1Q8KA 2HNDB 3G82A 3SSRA 5FLXY 3H98A 4RNOA 3RRHA 1X8DA 5CXTA 2MEWA 1N0VC 1XIQA 4HTJA 4PEOA 3J81Y 1CBKA 3KK1A 3C2PA 4KE5A 3ZNJ1 3UD4P 3QIDA 2I6WA 3ZZZA 4EZ6A 2OD6A 5CABA 3M8QB 2AWZA 3M2VA 4KFBB 1U1LA 4DR4F 3K5LA 2DNMA 3TZWA 4B08A 3T1YF 3H90A 1X9MA 2DHXA 4RWWA 3CGIA 4UTGA 4USVA 1WJ9A 5HP1A 3OW2R 4FPIA 1OY6A 2XWYA 1XMOJ 3HHLA 3KDOA 4PQAA 3UPFA 5GAHU 4MTPA 1I94J 1SH3A 3A3PB 5K8PA 4NLTA 2VJVA 2C2KB 1PC5A 5DJBA 4DV2J 4U96A 4PG8A 5L1LA 1SC1B 4DXLA 2VOOA 1R6VA 2G0IA 4I64A 5HQLA 4ELTA 1HWLA 4OZ0A 4DU7A 1SH0A 4QWEA 1U25A 4ZJLA 2J76E 5AJ3J 3NGRA 5I4MA 1KTVA 2GMHA 3FSXA 1XMQF 1Y3JA 3M9NB 1PAEX 2RMLA 2F40A 2YNHB 2Q6BA 3DDKA 2CKWA 4NX9A 4DL2A 2QL9B 3CJ2A 2MLXA 5I3UB 1JKHA 1HPZB 3SYZA 3HM9A 1N4LA 2HMIA 2D3O1 4OYZA 2WW8A 1RTJA 1K1QA 3HSDA 1DTTA 3UN2A 3BV8A 4DUYF 4C8ZA 2RSQA 1U09A 1SJ3P 2A2DA 1PJ5A 1NPKA 1UZHA 4ZVEA 3EUNA 2YX7A 3JS9A 3KLHB 1YBAA 3I9V9 5B7WA 4DR3F 3X3UA 3CCZA 1C4AA 3QRRA 1R0AA 1V3RA 5HROB 2HIQA 4X66F 3MFIA 3BH6B 3EZOA 2XQCA 2FHMA 2UU9J 2BKOA 5KFBA 5CA5A 1GX5A 4LRFA 1PKUA 5LMNF 1VQKS 4BCAA 2Z30B 1FA0A 2W24A 4F0HA 1J2VA 1X9SA 3FCWA 3P6YC 3M6WA 6FDRA 2CQ4A 3R5CA 3LP1A 1YSJA 5HSPA 5IV3A 3PX6A 4ZCIA 4RW9A 4QU7A 3PJ9A 2BE9B 2R3VA 3DOMA 3MCOA 3QT7A 1ZETA 4RL1A 4USWA 5F8JA 2F9JA 4FBTA 1T0TV 2IBKA 3CJ4A 1HBMA 4DPWA 2HMIB 1LWCB 2EFNA 3RYLA 1FRJA 1Y5LB 4TXSA 4DL7A 2Z56B 3KOAA 1KLMA 3HHEA 4DR1F 3THTA 4FKYA 2YWKA 3GFYA 2YY3A 1F5CA 5C2GA 4DL0C 2NR0A 1UWBB 4QYZK 2YWWA 2IHR1 2MKKA 2OH2A 3UDLA 4ZMMA 1IWAA 4CCHA 2EFQA 4NI2A 1IJEB 2QG9B 2IM1A 1U1RA 3H7HB 2YWHA 2HLUA 2Y3YA 3CO9A 1IBCB 4P6QA 3MUTP 4F26A 4LF9J 2J8SA 5J2QA 3US5A 2C2ZB 3LPYA 2MTLA 4OV1A 3O3LA 1AB8A 2MHNA 5KG1A 1GTHA 1NXIA 1UW4A 3OTDA 4ZP7A 1PO6A 3PW7A 1YBTA 1RTHA 2DH9A 3MEKA 2FTRA 4YP3A 2IRYA 3W9JA 1XMBA 4OX8A 5C24A 2EFPA 3V6KA 2V2QA 4ZDNA 5G0RB 2VKRA 1JLAA 1S0MA 3POTB 3PKMA 1TL3B 2QFIA 2VQEF 4C11B 1S6QB 2N3OA 1FXRA 1M5HA 1XTZA 3HVAA 8AT1B 4J9VA 4V19J 5ETPA 4ZHRB 4WK1A 5IS2A 1NJXA 4BS2A 5HBMA 5D3GA 2VOPA 2Z2MA 4F2RA 3C8YA 4JI5F 4N8NA 4ZP8A 5BR8F 1TV6B 2FJAB 1NZ8A 2JVOA 2QJ3A 3D6HB 1HWIA 4C8NA 3AJ2A 1NU4A 2XM3A 2EEYA 1T9WA 4OX9F 1VC5A 4AL7A 1ZPWX 5H9FJ 5KFWA 5KFCA 2W9AA 4NEYA 4DV3J 2UU9F 2CQGA 1XC9A 4ZPWR 1FRLA 3MR3A 1FRMA 3C6UB 2OPSB 4JBCA 3MI7X 1CULB 2CQ0A 3J81U 3R5JB 3G71S 1YJUA 3S6EA 2MGZA 2M5YA 3TEGA 1NKBA 1WWHA 3JQJA 3MM6A 4ZS6A 1SI9A 3ONQA 4Y34A 3A8JA 3UR0A 3GCWP 6AT1B 2J0WA 1YGYA 3PHTA 1KD1T 2DR8A 4L3KA 5IQQA 4CYUB 1IR0A 3HHLC 4QWAA 1BE4A 1F0XA 2R8IA 1VQ4S 2A6MA 2X1BA 1D9DA 1P9YA 5KFAA 4ICLB 1SPBP 2NS1B 4MH8A 1H73A 3UVJB 2YQ3A 2CXEA 1WG4A 2HK3A 1OYDA 2AP6A 3ET6B 3FDSA 3HI9A 1K0VA 4K4WA 2JOQA 4WFXA 3J7YI 1RSCA 4PUOB 3IM8A 3L7PA 4B3MJ 4M5JA 5KG4A 4ZK7M 1EETA 3DLJA 4XTTA 4PKDB 2XYHB 4KSEB 3OL8A 2HW3A 3DRSA 1U49A 1RKJA 3A1YG 2GAHC 3UCZP 4JV2A 4UW2A 3HFVA 1Z4UA 3DXBA 4KRWA 5KFKA 5HN0A 2DPJA 4GVBB 3SV4A 2JHEA 1YJTA 1TK5A 5A0YB 1TZ0A 1EP4A 4LSLB 2BRLA 5KFRA 4X4RA 3LALA 3EMTA 4B02A 1H98A 3ILIA 5BYSA 2CPFA 5LSLA 3G8SA 2DNYA 1IR2A 1RQ0A 5JMNA 3S1TA 2L41A 1S1XA 3ZXWA 1TU0B 4B3SF 1U6BA 1OYEA 2FD2A 2LU1A 7FD1A 2MKSA 2FJDB 4GKKJ 3PG9A 3LP2B 1UKUA 4PCQA 1M5VC 3AOBA 3C15B 3JSBA 5KG5A 1N48A 1A6LA 4RW6A 4KGVB 3S01A 1FO1A 5CYMA 4LF1A 4Z37A 1R3NA 5F9LA 2J7UA 1KONA 1MROB 2MZRA 4O3OA 4DG1B 3V5RA 4X62J 5KG0A 4B17A 5H9FK 3PYEA 1CG2A 5DZ6A 2E44A 4X65F 2JNJA 3IBFB 4R25A 1H2UX 4KHPJ 4WKRA 3ZZRA 4E98A 4TLRA 5CCLA 4TU7A 2D74B 1DARA 3TAMA 4B9SA 2DO4A 2AGOA 2CNNB 2CPIA 2QYCA 5HMYA 3D6MB 3F44A 4ZITA 3FSIA 3R6GB 2V8HA 2AX1A 3I6PA 3TUPA 3D9BA 1HL6A 2RF2A 1U1MA 2C3MA 2O3DA 2HBQB 3WX4A 1V9OA 1URNA 1LKZA 1YQHA 4ED7A 4WTOB 4P72A 1ZAWA 3AA8A 3B78A 3NGTA 3U7JA 1CC8A 1R7IA 2F63A 2W2NP 3DLBA 5KOXA 2HG4A 4WPAA 3MCSA 3I5CA 2WVEA 4KHRA 3NAIA 4NE9C 1B7YB 1CQNA 3KKFA 1NHVA 4ZPAA 1SQEA 2EBGA 3W5ZA 3NL0A 3K5MA 1B64A 4JP8A 2MPUA 4BHQA 1YI2S 2I9SA 1HKAA 3QGHA 3H20A 1CC7A 1LFPA 4Z2XA 2RKIA 5MAOA 2VL1A 3I0SB 1U1KA 3M7VA 4C3KA 2OUGA 3TYTA 2W9BA 1QAXA 2OHDA 3RBZA 4ED2A 2C28A 1RAEB 4F0KA 4PWDA 4YB6A 3G6YA 1H3DA 1RT1B 2OEMA 1JLBB 3CJQA 4L72B 3L09A 1I3OB 4X66J 1WTFA 1PAUB 4WIQA 4CIOA 1N33F 2HSEB 1X4EA 3HDSA 2BJ7A 5B0FA 2ZZMA 5KT5A 1MSWD 4DCJB 1KRPA 2XMKA 2ATLA 4CO1A 4DSIA 2HYIB 4C98A 5D0HA 4EO8A 2R7RA 2WVBA 2QFJA 4I6AA 1JNZB 2MLYA 2FJXA 3IA0A 1HNVB 1TL1A 3G87A 5DG8A 4X64J 1BGXT 3PW0A 4WP3A 3P3DA 3Q86A 4QOTA 5J2NB 4ETZA 4PZVA 1OY8A 1FF2A 3CSKA 4I67A 3QLHA 3VQSA 2XB2D 4UQTA 4CTAB 1U0HB 2QSWA 2BZ2A 3HZGA 2WBMA 3CDAA 3HX9A 2JFDA 1S9GA 3CJ3A 2OKQA 1X4GA 3IAS9 2V4RA 2YKOA 2G2ZA 3CMES 2UP1A 1MNEA 2GHPA 3A8IA 3UN3A 4KKOA 2RD5C 3VV2B 1N34F 2V9WA 2I0XA 4AL6A 5D4NA 4KH1B 4LBIA 3T6BA 3CVKA 2NPFA 2IM3A 4DR5J 3OHAA 1JLGB 3DLKB 1J27A 3GB0A 4WK3A 4WCEQ 3U02A 4PG4A 1VGYA 4RUCA 2MMYA 4B3TF 3M6VA 1U1OA 4LF9F 3KK3B 3FC9A 3VWSA 2JC0A 3BSCA 3IC1A 4HDGA 2BR0A 1WOSA 3PW4A 3MMJA 3W8GA 2F4VF 5EUHA 1U24A 3T19A 2BACA 1FE4A 1NDLA 4JOUA 2CYYA 1LWXA 3KMQA 3IWXA 4I6YA 2AMCB 1NSQA 2HQFA 3KLFA 4JI2F 2RRBA 5HJXA 5DRKA 1SV5A 2KH9A 3EZ5A 5L46A 2GVZA 4K8RA 2XCPA 2X3DA 1NK5A 3O44A 1VLOA 1KHVA 2P9EA 1LXJA 1RBOB 2B9EA 2W9CA 2BJ1A 1EKRA 2IC3A 4K4YA 5KFPA 2YPZA 4ZKAA 1FXDA 4OZJA 2VIHA 3W5XA 4M63A 2MQOA 2DNQA 4MYTA 3RR8A 4OHWA 1QUPA 4ANCA 1B70B 3GIMA 4HI2A 3N5BA 3M8SA 3D3BJ 4P7VA 2R2SA 1MN7A 1N0UA 3EDQB 3M30B 3OTEA 4WU2A 1W25A 5D0GA 4IQXA 1DURA 1BQMA 2HQGA 3GYGA 3ZZUA 2DISA 2OPQB 2XNRA 1LWFB 1Q5YA 2FQQB 1WI8A 4DR7J 1NH7A 2YKNA 2O67A 3QT6A 4WU3A 2XCAA 2IA0A 4UOHA 4UF4A 1DJ0A 3VF0B 2A10A 3O1LA 4G6VB 5HANA 1UEKA 3J80Y 5AT1B 1P8GA 1EKSA 4PXBA 3R9LA 1VRUB 2IPOB 2HIYA 2HRYA 1R89A 4G1QA 4RW4B 4M5LA 5AXLA 3MEEB 2PFDA 2E1MC 3SCJE 3W62A 4RNFA 1BQNA 4QPXA 1HR0J 1QSYA 2DXEA 4MFBB 3IGNA 4LT6A 1VBYA 2WSEC 2HVHA 3ZTOA 4IRKA 4WIIA 3JSMB 3BGRA 2HHVA 2KHDA 2X7IA 2WZ1A 1TL4A 4OX6A 3KMSA 3QGPA 4P9SA 4N56A 1YJRA 5H9EJ 4XPEA 5I3QA 2R7XA 2V2VA 3F41A 3R1LA 2Z2YB 2DT9A 1IKYA 4Y2CA 5DQIA 3MHYA 5A8RA 2GGPA 2HFNA 4DBQA 4DV1J 3T1HF 2VUGA 4OI1A 3TRGA 2PI4A 4NXMJ 4TNOA 2B0GA 3D7SB 5A8WB 2FZKB 4DQPA 3D3CJ 2HFOA 2L08A 2WHOA 3ILJA 3NCQA 2DR9A 4ES1A 2VFRA 4EMDA 2LU2A 4PQUA 1X5TA 1C0TB 1F6TA 2QTWA 3HXMA 1RDRA 4W98A 5GMDA 5DETA 4ECVA 3GZ7A 2YNGA 4Q2MA 5IOLA 4AE5A 1RBAA 1FD8A 1S4FA 1WF2A 2NCKL 3KJFB 1FNMA 3D1HA 4P71A 2ZD1A 1VQ8S 1A7GE 2YX4A 3BKTA 3LOUA 5E3PA 3K59A 1HYSA 4K2JA 2B9YA 4KIAA 1IKVA 2ASLA 2DY9A 5GADU 3VAKA 5E0OA 4J37A 2XC9A 3LUYA 4AQYF 1PYOB 1VK8A 2NUHA 3OSPA 4ILLA 1HNXF 1NK4A 1E6VA 2HRUA 2KXNB 3PYGA 4K50A 2V34A 3B6BA 4MKBA 3MEGB 5CYJA 3AOCA 3A8KA 2ZJQQ 3BQ2A 3QRPA 2P6SA 3PR5B 3LWMA 1HARA 3NWGA 2M52A 1LQ9A 3RU0A 2E9RX 3IAM9 1J5EJ 1JX4A 3OSNA 1AXQA 3M05A 1D09B 2KXFA 4FZVA 2ZVIA 1CJVA 4IFYB 3CDBA 3ZZOA 2D3ZA 4DUZF 3I5BA 2FPHX 4OMFG 2HHUA 1UVLA 2HWTA 3UWTA 2FHOB 2IVYA 1YWXA 5EX0A 2MB0B 1V3SA 2AV5A 1FD2A 2XMUA 5IFMA 3G6XA 2UVWA 3AFGA 3CEDA 3ZC4A 4USKA 3NP5A 2UUCJ 3OV7A 1VQ6S 2FZGB 3PR4A 2CUYA 1NSKL 2ZOMA 4TY8B 1FKPA 3IWNC 2JL9A 2J7KA 4NMLA 4IG3B 4RWXA 2AJ0A 2DR7A 3HHDA 1FHTA 2BANA 2GCFA 1RWKB 1VQPS 1S6PB 4DFJA 4W92B 2Y1LB 2XLIA 3CB4A 3OTCA 3TP2A 3GCXP 1WACA 3Q8VA 3RBDA 2E9TA 2L9DA 2UXCF 1S7IA 1TTHB 2MKYA 2ZEJA 5BR8J 2D69A 4F7VA 3SI8A 2XI3A 2FVSA 2KZMA 3M2RA 4H4MB 2WRMA 4NLDA 1WNEA 2UUTA 3C14A 3MECA 1N8RT 3QJLA 3HFZB 3BPDA 3Q24A 2MJNA 2DK2A 6FD1A 4JI0F 4DPUA 3J7A1 3AB4B 3TVZA 4GO7X 3IBWA 2DHHA 2MQPA 3CJSA 1WC0A 3T1HJ 3FBEA 3IXQA 3G8TA 2G9OA 4NCBA 4Q8FA 4X64F 2UXDJ 4LR7A 3J7YU 5IT9U 2QGFB 4CO3A 3CTRA 4J90A 4FF1A 1RT2A 1RCOB 2UZAA 5U47A 2FHJD 2K1RB 5KFEA 1QSSA 2ZITA 1N5VA 2KYXA 1NK7A 5A2QY 1JLQA 3C16A 3LQVA 1T95A 1NMEB 2QZ8A 3TO8A 4M1KA 3ISZA 4CH0S 2VFVA 4EUVA 1S1TB 4B9VA 1GX6A 1HNWJ 5IT9Y 4C8LA 4CLTA 1YJNS 1JXVA 1BC6A 3OR1A 2H9ZA 3LGHA 4ELUA 1GNKA 1V3ZA 2FGCA 4CLKA 2HLTA 3MGJA 1HBUA 2C3PA 3HJVA 3W9HA 4WFBQ 4DV6F 2JLEA 4FYDA 2P2CB 2DNZA 3BDEA 3FSYA 1P1LA 3U1LA 1QE1B 3TZXA 4P2FA 2LKZA 1WOOA 3E01B 1C0UA 1FVSA 1RT3B 4Y3CA 3KJVA 1M5KC 2FY8A 1NPRA 2ACMA 4A8MP 4RW8B 3VAJA 3TI0A 1D0EA 1N5YB 1QAIA 1RAAB 1PG5B 2SXLA 3RB3A 3RW6A 1MN9A 2LYVA 5DM7Q 2R7QA 1FKOA 2CNLB 2HNYA 2W8KA 3UFCX 2N7CA 2O1PA 1GXLA 4RW7A 1TK8A 1FRKA 1AZSA 2PO4A 2V4JA 2EXUA 4Q43A 3SZ2A 2OSRA 1P1TA 3BO4A 2OSQA 3GR1A 2AYBA 5DQGA 1WEZA 3BH7B 8RUCA 3KLEA 1X4CA 4W90B 5DGBA 2AEFA 1RACB 3PFOA 1I6JA 1KP6A 2ZH9A 2LMIA 1NKEA 2UUBF 3MAAA 3CJRA 3DDNA 4QIWD 4WJBA 1EIYB 1IQZA 2VPYB 3CIZA 4F4KA 4O44A 3DOKA 3M8PB 2ZOGA 1RAOA 5HQ8A 3CCSS 5F8IA 2I2YA 1X0PA 2HNZA 5J1NA 1Y5IB 1RWMB 3I87A 3T5KA 2WAQD 3BBBA 3UW1A 3MR2A 1FDAA 2KTQA 3MUMP 3PX4A 1G3OA 4N7TA 3MEDB 1SJRA 2DHSA 1TL5A 2EK1A 3P4UB 5FDLB 4QWBA 1DLOB 2FB0A 1JLCB 3G8QA 4NRUA 4R8UA 3HKWA 3R7NB 4IG0A 3HCXA 3TR5A 2NXNA 4M5GA 2LA4A 3DM2A 3HVTA 2BEFA 1C4CA 1L3TA 1Q5VA 1XWLA 3ENQA 5LXYA 3TZYA 3L9ZA 4C97A 1MMLA 1ZAVA 1TKTB 1WF0A 2CFXA 2MKCA 3GFXA 2OO4A 3D28A 5AXMA 4DQSA 1RTDB 1HYSB 3VR1A 3MM9B 4RNMA 2EG1A 2H3EB 4FNHA 1M5PC 4ID5B 1RWUA 4X84A 1IKWB 5I3PA 2KM8B 2CQ2A 4I2QA 3V6JA 3TQ1A 2C42A 3B4DA 2LDIA 2J7WA 4AFFA 5F8MA 3HFKA 2P9CA 2MKHA 3BGLA 1DTQA 3QYYA 5THWA 4HTIA 2R2RA 3OTOF 3QT5A 1CS4A 4RUBA 4UOFA 3E8OA 2KB2A 4DPOA 3ILOA 3L7OA 1YZ6A 4DX5A 1YJ7A 2YKMB 1FDDA 3BR9A 4GMKA 1QLNA 2GMLA 2RUSA 1H2TZ 2V69A 4Y6IA 2YX1A 4Q0BB 5D4OA 3O8WA 3CF5Q 3DLGB 4X4SA 4N8OA 2A2CA 1WSVA 1N36F 2KT3A 4NA1A 4OFZA 2CQDA 1REVB 3FCVA 1SVDA 2G1HA 1Y11A 5D4PA 3R97A 4DL5A 3TX0A 3JYTB 2VA2A 4J5OA 3R5GA 4OYOA 2BA9A 2IBOA 3I5AA 4FDFA 4CLPA 4RNNA 1VQNS 1QDUB 2H1YA 4DLEA 3GSDA 2DRBA 3K58A 4N5SA 2POKA 1TV6A 3FBFA 4LQ3A 1KOHA 1WSRA 3HHKA 3R7BB 4LRBA 3RB6A 5K8MA 3JB9k 1HQUA 1ZPVA 3IN5A 4A8OA 5KFZA 2DD8S 4YS2A 4XO0A 4X4QA 4XIUA 5DGAA 2M8HA 1HBNB 2OPPA 1D3WA 5D0EA 1JLFA 3CCQS 5H9EK 2VODA 2BDPA 1S0NA 2AX0A 4EYHB 4Q44A 4LF5F 4DS4A 1WC6A 4J9LA 5I42A 2Z57B 2RRAA 1JXLA 1K0TA 2E66A 2MGZB 2WB4A 1XMQJ 2GA7A 3KG4A 4ZA1A 2V63A 3GV7B 2LXIA 3AD9C 4FYWB 2VBYA 2OELA 4NCAA 5LMNJ 4QIFA 1TFWA 4HR2A 1UVNA 3SFUA 2MDAA 3EYZA 2DO0A 1TAQA 2V9KA 3NCPA 5D15A 2N7YA 5EWEA 2ZWPA 5B0EA 2DEJA 5L9XA 3D68A 3K8VA 4WE1B 1NH8A 1XQIA 2DNRA 2IAJA 5LMUF 4DN0A 3SXLA 2DNPA 5KFGA 5LL6d 2RHQB 4NLRA 1F1BB 1RA6A 3R8YA 4USTA 5CD4A 4FVCA 4PWWA 1FFWB 3DGPA 3OBIA 3OR2B 4QR1A 4U6PA 3W2WB 2WB1D 3CCMS 1UVKA 4UUXA 3W66A 3QBCA 4YDDB 3EICA 2ILZA 4C3LA 4DQQA 3BR8A 1RJJA 4RUAA 4WWSA 4DSKA 4LFAJ 2YNIA 4UQGA 2C2EA 3W7BA 3UI3A 4USHA 4IKAA 4MK9A 1N56A 4JI8F 1L3KA 2V50A 2DVIA 2FJVA 1TL7A 3G82B 3ILLA 3PEHA 1KQGB 1EARA 4K2XA 2BBEA 3MMCB 3OTOJ 3VGTA 2UXCJ 1NDKA 4URQU 1S1XB 2B51A 2EI5A 1RT4A 1PBUA 2RQMA 1HQEB 3KJNB 1LK7A 5KFVA 4ED6A 4KGXB 4RU2A 4JYAJ 4I7FB 1F2GA 5IWAJ 3NNAA 2COLA 2Q6CA 2VBWA 2B6AA 3C15A 1C1BB 1S9EA 3GU0A 4CNYA 4USUA 5E41A 4OYBA 2CPYA 5JVHQ 5HJYA 5CYQA 1ZZFA 4ZIVA 3BQ0A 4AYBD 2R8KA 3ADAC 2E5LJ 1S1VA 2WW4A 3PYDA 3VQTA 2DTJA 4PPDA 4DEZA 3UD3P 3HHLB 2ASYA 3SFGA 3OUYB 4LFBJ 4GO5X 1B4SA 3LP0A 1S6UA 3HLUA 1PSDA 3Q8UA 4LF6F 1FTRA 1RHUB 2XS5A 2RU3A 3K2YA 1G6BA 4N47A 3IRXB 1NSPA 1K44A 5B0CA 4GC6A 5IT0A 1FI4A 3K5NA 2HWIA 2WONB 2AZ1A 3M1VA 1XNRF 4IRDA 4ECSA 4FYVB 1N6QA 4F02A 2KYZA 1RAFB 5A8KB 3ETMA 2B43A 4OJ1A 4JV0A 3N9UC 5KT3A 5T7LB 1KQSR 1F3FA 1X0FA 1VQ7S 5F41A 4DN9A 4D3GA 1N32J 1TELA 1ULRA 4B3MF 2HBZB 4UT4A 5FLXU 1KVIA 3EJMA 1RTIB 3I9ZA 3NRBA 2CVEA 2GVDA 1CQMA 1FRIA 1J5OA 5T14A 2ZJPQ 3BREA 4QR2A 1SL2A 1FFGB 1VK3A 1TUWA 3SDEA 1HLWA 3W63A 3CC4S 4QCLA 4BWJA 2PSZA 4ID8A 1DFDA 1RAJA 1P27B 4RU9A 2E5JA 3JTPA 2XWXA 1KBRA 2XY6A 1I94F 3KLIB 1R31A 2XMVA 5AJ3F 3FCHA 5KFJA 1VC6A 1RHMB 3EPGA 3LANA 4KR0B 1T8EA 4LF8J 3Q8YA 3K8WA 4OHYA 3RTVA 2RT3A 2FVQA 1RU1A 4IOAQ 1KFDA 4KGZB 4M5IA 1AW0A 4P52A 3BKUA 3VTIA 5K20B 1KLNA 3I31A 2OPRB 4EO6A 2DGWA 1K73T 1TAUA 2BJDA 1IM6A 2XHWA 3UDVA 2LQ8A 4C0BA 3ZO7A 5KG7A 3OJUA 4FYXB 4JI6F 1SJ4P 1P9QC 2VG7B 4M5MA 3H2UB 2VKZG 3WDOA 3HSJA 5ETRA 3BGOP 1VHIA 1WHXA 2G2OA 1RLDA 1E6YA 3NBPB 4Y65A 1BMQB 3PYFA 2MZQA 2DCLA 3N6NA 2Q66A 1CJTA 3H2LA 3QLHB 1SQFA 3A3NB 5J1EA 2BM0A 2NYIA 5J2QB 1UEUA 4K59A 2V0NA 1C2PA 1R8BA 3CD5A 5ETVA 3OT9A 2V8VA 1RT5B 4CT9A 4O4GB 3D5MA 4OHXA 3HSGA 2YNFA 4URGA 4LRDA 3CJ5A 1GTEA 4LFBF 2W7AA 1ZM4A 1X4FA 4KKOB 1LW0A 3HT0A 3N6MA 1N5TA 5BYRA 1OMSA 3W1YC 2J6TA 2PI5A 4NLUA 1RT6A 3GJSB 5G0RA 4OI2A 5MLCV 3POTA 4JI1J 3H5XA 1KSPA 2L3MA 3AA9A 2W2OP 1HMVB 3H8YA 2IYGA 2XY5A 3CJTA 4I2PB 3H59A 3GLJA 2JFKA 3RW7A 3KLGB 4DR2F 1U1NA 5D77A 2CAJA 1NBEB 3RGIA 4F0MA 2E7VA 3J81j 5GAEU 4DV1F 1JNRB 2AJ2A 1JQGA 2LQJA 3H4BA 2OGUA 1YJ9S 3I56S 3EGNA 3TEHB 1Q78A 1R0BG 1RT7A 5KT4A 3M2UA 2VONA 1GH8A 2YH1A 4ER8A 1RLCL 2Y8YA 1S7HA 4NLXA 1VQOS 4KV8A 5HATA 2JC1A 3ENAA 2XI2A 3CPWR 3WC0A 2NUUG 3FRZA 2GS8A 4KPCA 2WOMB 4ED8A 1DAXA 1ZM9A 1HNZJ 2KT5A 1X4AA 1IBMF 2A3JA 3NCRA 1ZS6A 4KYZA 1JWWA 4NOHA 9RUBA 1R8PA 4U7CA 5J2PB 4ZOSA 4C6AA 3R7SB 1G2EA 2VQEJ 2ACYA 2VV5A 4ES3A 4B9MA 4A47A 4URSA 4OI0A 3ZTQA 1ZTTA 1L3UA 4YY3J 1U6ZA 2W4CA 1Q7YT 5KFYA 2CG8A 2O66A 3VGUA 3R2DJ 4MYUA 3DLEB 4DI6A 2U1AA 5AXKA 3SCKE 1UVMA 2E7XA 3RUBL 4C9DA 5DM6Q 1F60B 1LK5A 2XG8A 3DOLB 3NS5A 4K5RA 4ZVOB 3B4MA 2B9WA 3PW2A 3GJTB 4ZVFA 2H4WB 3EXYA 3GYNA 3KNGA 2YQ1A 4YR0A 3EWGA 4DX8H 3MF5A 3TUJC 2MQQA 3DYAB 5CZXA 4C2MA 1F9HA 4NZ7A 2W8LA 2IJRA 2QMXA 1UVIA 3IR5B 1S99A 2ZKTA 3NGKA 1REGX 1RUSA 4LSNA 1RZMA 4ZVHA 2DBBA 3MURP 4JI3F 4CLSA 3FKBA 2OEKA 3VGSA 2HZAA 1Q8LA 4HVZA 3G2XA 2IMWP 1T03A 1S72S 3KK1B 2ZKUA 2C2DA 4JI7J 4FXWA 4NLGA 3MMBA 4B9UA 2ZHAA 1OIAA 1RCXB 1RHJB 2ILYA 4JV5J 1BD6A 5HVHA 2HHQA 2B4PA 1UZDA 2CQCA 4RW6B 1KS2A 1B7FA 4HLBA 2CRLA 2ZBRA 2VPZB 4PQUB 2I5JA 3TVYA 4AT1B 1H2VZ 5E7OB 2MSTA 4NASA 2YNGB 1ZA1B 2RJZA 1Q95G 2GV1A 1WC4A 1AT1B 2J9EA 4OZNA 2KN4A 5KFHA 3G6VA 5IV4A 3HULA 4DR5F 1UCNA 3N5FA 4OZLA 2R4FA 3H5SA 5J2MB 3GIIA 4OZ5A 4ZPCA 3NY0A 4ECTA 2BMBA 2HZCA 3LO3A 4QIEA 3QJJA 1NZAA 2RB7A 1LEOA 3OPKA 2R7UA 2ZDPA 1G7CB 2L9NA 4JI7F 2B8QA 4C8KA 2W25A 3PO4A 2KJWA 5HL7Q 2HFSA 3AY0A 3QO9A 2CQPA 1XNRJ 3FZBA 1G1XA 1CSJA 2MZSA 4X2BA 1LXNA 3KHLA 3W61A 5DDQC 1IJFB 4ATNA 1A0OB 2P9GA 3Q23A 2AT1B 1TMMA 4OJHA 5HI7A 3K7RA 4TQRA 4F3QA 3CD6S 1Y7PA 2QT7A 1PJ7A 1ZM3A 2ZM6J 3GG1A 5ETNA 1QTMA 2QX0A 4DZ6A 1Q0NA 2IRUA 2OP5A 3ZTPA 3VAIA 2AW0A 4O0IA 5L1IA 1X4BA 1K1SA 3TNVA 2ZE2B 4C3MA 5D78A 1JXEA 1NDPA 1UFKA 1RAIB 1R0AB 2JEFA 1RHKB 4TN2A 3PO5A 2X3GA 1TKZB 1S5ZA 3SMZA 1TVRA 4X65J 4OX7A 3OXGA 1KQKA 3M32B 2MZJA 3NOCA 4X62F 3O2IA 3I32A 4TY8A 3I0SA 4FS1A 1CJKB 5CAAA 5K5MA 1IWGA 4M5KA 1ROFA 3V6HA 1IN0A 1O0PA 1SJQA 2J9CA 4YHHF 3Q8SB 2UVRA 2ZZNA 1S6PA 2GO9A 2ROPA 3OVSA 4DSLA 4K0KF 1RT1A 5CHCB 1SKRA 5KFNA 2UUAF 5IC6B 3PXGa 4DDFA 5KFOA 4ES2A 3DI6A 5HLFA 2Y1JA 4ERDA 2CDRB 2H51B 2BYCA 2AZ3A 1U1PA 2DGUA 3ELHA 1SJ1A 1U2CA 1YK9A 4AXJA 1NK6A 1M1KT 2CJKA 1S9FA 3I82A 2V2ZA 1XN9A 4WKYA 4NCGB 5A6PA 1LWEA 5ETMA 2YTCA 2E1RA 4HT7A 4PYAA 2M8DB 3KTQA 3NAHA 2VPWB 2HFVA 2CQ1A 1FRXA 3DN9A 4KTQA 2CWXA 2Y0SD 3MTKA 1NRKA 2GJFA 2K1RA 2G13A 3AD7C 3QRQA 3F73A 1YZ7A 2UUAJ 1W2IA 3OXLA 2W7PA 4Y2KA 1MU2B 3OFGA 3AQPA 5DLGA 4RR5A 4DUYJ 1YITS 1JLQB 2BQUA 4V19X 1TQLA 2HVDA 3DRYA 2W2QP 2KVQE 4ZCLA 3MAQA 4KO0A 1MLAA 4GVLA 1S1TA 1B0PA 1GAOA 3CMQA 4RJVA 4QQBA 3IBCB 5IWAF 3GWCA 3OR1B 3FNNA 1SC3B 1W26A 1SJFA 4CLWA 1CPZA 1RWWB 4DV2F 4C11A 4D3HA 1S6OA 1PYTA 2Z58B 3OFEA 2ABYA 4ZHRA 3CJ0A 5D3GB 4MK7A 4NXMF 3MXHP 2CQHA 1BXNA 1C0UB 5ITHA 1YRTA 3KJVB 1G4CA 4ZVPB 3TQEA 4HH0A 4RW8A 4PXDA 4LREA 4Y00A 2MZ1A 1GXTA 4A8XA 2ZH8A 4BDPA 1ZAXA 2GNKA 4RZRA 2PMWA 4ZJOA 1FKOB 2J5AA 4OV6A 1RWOB 2BQ3A 4ETXA 4U7UK 1AZSB 1RK8A 2HQDA 4A8FA 3SQGA 4RPFA 2PMHA 2JWNA 3ZNUA 1QVFR 2OPSA 4MK8A 2RQ4A 5GAEI 4J7CA 1N5QA 1FKAF 1F9EB 1OS5A 1R8HA 4JUZA 4F4AA 4EFAC 3UO0A 5L9NA 5KT6A 3HP6A 4I0WA 1M5SA 3DU5A 3H42A 4U95A 1B0TA 2GJ2A 2CPJA 4B3TJ 1LW2B 1BQMB 1M0SA 3THVA 1AUDA 3MAAB 1XK8A 1WD6A 1OPIA 1RYSA 1FJ7A 4MIAA 2NLWA 2RDJA 2OEJA 3CUNA 3H4DA 4M94A 1UTAA 5BYQA 4ICLA 3P5BP 4UZCA 3MMAA 3I96A 2XBPA 4WP9A 3EM1A 2HQCA 4O3NA 1OJ4A 3M9OB 2DHAA 1QVGR 5HO4A 4PUOA 2YWFA 4ED5A 4LF8F 2DGQA 2PGCA 4HHUA 2EG2A 5DQHA 2JEIA 1VS3A 3KNAA 3MPUB 3CJKA 3DRRA 4K4TA 1DRZA 5HMWA 3QSIA 3SIPB 1UA0A 2HRTA 1L5UA 4A8YA 2P5VA 4WTYA 1U8SA 2I1RA 4GVBA 2E5IA 1RTDA 2ZJRQ 1EP4B 4LSLA 4WYWA 4FKXA 2U2FA 3JAMU 1SUQA 2ASJA 1FJGF 3H5UA 1IKWA 2Z2ZA 3CNQP 1MWYA 3GILA 1Q81T 4OZ3A 4JI5J 3AXKA 7AT1B 4G1PA 3SCLE 2BVZA 2LECA 2AJFE 3PV8A 1IQTA 1AUSL 1JB0C 5B0AA 2B3TB 4DR7F 5A8WA 2HFZA 3M8QA 3IRWP 3C66A 4PXCA 3LA0A 1WG5A 3PCOB 1HNIB 1FK9B 2E5HA 3G9CA 3FMBA 2XY7A 5C2CA 3GV8B 2BV3A 4J9KA 3JTNA 1HD0A 2J9DE 2WVCA 4P2SA 5AE3A 3VAFA 2RRNA 2D41A 3M8YA 5K14A 1BWEA 5LM7E 4LF6J 3D67A 3OLAA 2JRSA 2QA2A 3NGUA 1UW9A 2VF3A 2VPXB 2MKIA 1NJYA 3U27A 4DCPB 3CCJS 2R8GA 1Q8BA 3KYLA 2R7TA 4LMZA 2JDJA 5CCMA 3R5BA 4DHVA 3IR7B 2E29A 2E7WA 3VAGA 1JLEB 3MR7A 1W7WA 4NLYA 3OQ2A 2F3JA 3QMQA 2EKNA 1VYAA 3SEOA 2R8HA 2XSJB 3CCUS 1L3VA 2IVFB 3VHQA 5E33A 4KY3A 1RTJB 1HQUB 2EBEA 4NLWA 4OI6A 1QJHA 1DTTB 2HPUA 3ZTRA 4H4OA 1SL0A 3E2EA 1F2HA 5K8OA 1HBNA 2H54B 1MWZA 2QMWA 5ETLA 3W64A 1H72C 2EC0A 4OHZA 1NJZA 2LQBA 1UMJA 2E1PA 1JLAB 1VIOA 2ZBQA 2ZC3A 3BZQA 4CLFA 2BXJA 3EVMA 4QZVB 1N33J 3PJXA 1UL3A 4CWBA 4O3SA 3W2VA 1RABB 3IMQJ 1WKLA 3RAXA 1HNZF 2NXEA 2DB1A 2QA4S 1Q8IA 2MY7A 1GXUA 2YXLA 2CIMA 4MKYA 1DY3A 2KXHA 4YN3B 1ZH5A 4PWUA 2M9KA 4ZN1A 2AJQA 4RBUA 2W9BB 1QAYA 4NLQA 4QW9A 1NSAA 1OQ3A 2HGLA 3LP1B 3GJQB 5DZ7A 4R5PB 2KVIA 4RW9B 5GADI 3BM7A 4HT5A 3CCWA 3QT8A 1WELA 4DPTA 4MT1A 1FDBA 4N41A 3OR2A 1FDNA 2OAUA 1FT8A 2ZH7A 2W2MP 3UDEA 1KOOA 5C25A 3C6UA 1NB2A 1Q53A 1U6FA 2W7OA 4C4WA 2QA1A 5B0DA 2QLWA 3QPIA 4QR0A 4ZCKA 5DDPC 3BJYA 4DV7F 4CRJA 4ZVUB 1J5EF 4B3OB 4L6V3 3PW5A 3MPWA 1D1UA 1N34J 4ZPDA 3MM6B 5A8KA 4DQRA 2PA8D 1EAYC 1SH2A 3CCRS 2C22A 3GPAA 1T3NA 4NI2B 1ACMB 3TJ9A 2UV8A 1M90T 1RAHB 2ZOFA 1EX8A 2OFHX 5KFMA 1HBOA 2HBRB 2QC3A 1CJUA 2F65A 4PG7A 2FYXA 3QZ8A 1VC0A 1HIYA 1Q1KA 1R27B 1RI7A 3ET6A 1S9EB 1RB0A 2BKNA 4F04B 5M2PA 2J6UA 5T41A 4WXWA 1RWXB 1WKJA 4DPYA 2B5JB 3LGNA 4FF2A 1EETB 4JV5F 1DBDA 2HHXA 4DV7J 3QFWA 3NGSA 3EX7B 3LP0B 2DRAA 2BJ9A 4I56A 3VZHA 4IFVB 1YG0A 1HI8A 2K3KA 3PNIA 3DRPA 3LAMA 1BLUA 2IIHA 5A0YA 2YKAA 2FIUA 4DX7A 5HBMB 1HW9A 3S8SA 3E01A 2BKPA 2DNGA 4J9PA 2NSBA 2E1AA 2HVEA 3KWMA 4DCOB 2ZDOA 3OL7A 1N6QB 4QIGA 1T7PA 1SC6A 3M9MB 2MKJA 2GVZB 2CJXB 4H4KA 2ALZA 4DWIA 4ECZA 2XLKA 2QO3A 5FD1A 4HKQA 1YDLA 3AH6A 3TA2A 3OD2A 3T5HA 3MPDA 2HHSA 1JK9B 3WZ0A 1BY9A 5EHHA 2KRRA 5L8RC 1KEKA 4OYXA 2V4JB 1VIXA 3GP9A 2CJBA 3BSAA 5D4LA 4OHVA 1U02A 3CE8A 3DU6A 1M1GA 2AF6A 1I51B 1OSCA 4DSFA 4RX6A 3KLEB 1QUVA 2EVZA 2H4YB 2GIFA 3R5AA 2AD9A 3TAPA 4CP5A 4JI8J 4IDKB 3CJ8A 1T11A 1FWKA 4MKAA 4A4JA 1SB6A 1X7VA 3HVRA 1MW7A 1M5OC 4NA3A 4EBDA 3V4IA 1B3TA 3M8PA 1FX4A 4DV6J 4DR1J 3RRGA 1KN6A 3PRVA 3MDFA 3VGVA 4HACB 2R7SA 3Q2TC 3UVJA 3Q0AA 3MOZA 1JKHB 1HPZA 4X4NA 1XEZA 2DIVA 1Z2ZA 1DLOA 4JI3J 4P2MA 4FBUA 5FJ4A 1WTBA 1S1WB 4I69A 2NREA 3BSNA 1MMNA 5EGYA 3KLHA 1IBMJ 1QTNB 2PIIA 3AOAA 3SQOP 1APSA 5HROA 2EFOA 3BGRB 3LGMA 4K4XA 2Z4PA 3VVTA 2CZVC 4K4UA 2C2MB 1KTQA 1NK8A 1SIWB 3MWBA 5ADZA 4LFAF 1HQ2A 4P7TA 1RGVA 2J8AA 1VMBA 2KM8C 1E6YB 2WBRA 3CWJA 4Z7YA 5DLFA 3PHEA 1FX2A 1H6KX 2EK6A 2DNHA 1YJVA 5A8RB 5AXNA 5LOQA 1IBLF 3HHLD 1VQ5S 4F4XA 4QW8A 2ZBPA 1X60A 2VC1A 1DTQB 1VBZA 2KKHA 3LP2A 4O4GA 2XYPB 2BE2A 4ILRA 2GQCA 1NK9A 3V2UC 4X4VA 2RNEA 4K4SA 3MM8B 1ZZNA 4YHHJ 3S7RA 1IKXA 1YBUA 1MROA 3FFIA 2KRBA 3W3SA 3MM7A 2Q1LA 4RKUC 1KLMB 2Z8QA 4MIWA 5B0BA 4RBTA 3R27A 3MPYA 4ED0A 3H40A 4LR9A 2WTFA 5DDRC 3DHWC 2DH7A 3DMJB 3PDNA 4J9MA 2F4VJ 3M8ZA 2RDDA 3UN5A 3OL6A 2DXFA 1KFSA 1Y9OA 1KQFB 2F5GA 4PG6A 4GRSA 5HVFA 2DR5A 2BW7A 3TAMB 4HI1A 3JAMY 3QQCD 4NZ0A 4IO9Q 5F3ZA 4OLOA 4ECRA 2DGVA 4ZIWA 2Q79A 4CTAA 4DR6J 2GFFA 3DNCA 3JTOA 2RQKA 1S1UA 3IG1B 2RUGA 4ENOA 1Z2LA 2KT2A 4OYMA 4WZQA 4M5DA 1HWKA 2YKQA 1X4HA 3FEYB 3KUGA 1R43A 2OD4A 4JI0J 1LFWA 2PC6A 2H5IB 2BOAA 3MPVA 4KV8B 2CG4A 2DITA 3UQSA 3IS9B 3GE9A 2ZUAA 2M70A 4B3RF 3KXDA 1S59A 3NS7B 4ECYA 1IM4A 2AJ4A 3MM5A 4CO5A 1OPZA 3TVKA 2MQ8A 4LRAA 3J7AN 3I0RA 2LEAA 3A12A 5LXRA 3E51A 1IXKA 2BX6A 2FVCA 4J9NA 4ANEA 5ETSA 1JJ2R 2AEMA 2HKEA 5IT4A 2Y0BB 4LF7F 1FKPB 4IQMA 4WFYA 7FDRA 1TKXA 4R0EA 2NZCA 2XHCA 2ZFHA 3ETOA 3LTOA 5IM0B 4DV4F 3W5YA 2HVZA 4O0NA 2J6SA 4IUFA 1HNWF 1O51A 4XDDA 4ZP6A 3EVWA 3BBFA 1X5OA 4LFCJ 1VCTA 3ITHA 2FJEB 4X4PA 4EBCA 1VOMA 4KJIA 4UUWA 1QAJA 4B9TA 2N3LA 1H7XA 2R2UA 3LH2S 2GIQA 2KFNA 2Z2LA 3VALA 2IY5B 5GAGI 2VG5A 2ADBA 2CJYB 3DYAA 1YRUA 3KHGA 1IBKJ 3MECB 4JI4F 4PXEA 1XBWA 2GHWA 2D9OA 2QRRA 3BYRA 4E2FB 3QIPA 2MJUA 2ATCB 2YNIB 5F8LA 1YTYA 4F4ZA 1W2BR 1NPPA 5KG6A 1FNXH 4ZVTB 3AAWB 1YHQS 2J0QD 1TMJA 2DHGA 3KK2A 2C1EB 3TUIC 2FZCB 1XERA 2M7SA 2VG6A 2OMLA 2YKNB 4MKVA 4OIXA 2M88A 3WBZA 1ZTWA 4WZMA 4CI0B 2CA9A 4QWDA 2DGTA 3DC2A 2L9WA 2PEBA 1RWPB 5LSOA 2XGQA 2KG0A 2JEGA 1WORA 2GQ2A 4F67A 4IOCQ 3K17A 1S76D 2DNKA 1XJWB 1HHQA 2BE7D 2XMJA 3PTWA 4WFZA 1VRUA 4G1QB 1FE0A 1F9FA 1Q7LB 3CDEA 1O6XA 1WDDA 1VRTA 5KT7A 1PIEA 4DUZJ 1S1VB 4F8RA 2OTJS 1XMOF 2NQPA 1UWAA 4Y28C 1JLGA 3DLKA 4N77A 4FYYB 3ZTSA 3VVUA 4XAKA 3A13A 5C5JA 3QSYB 5HK4A 5D8HB 4DR6F 1ITPA 2MQLA 1S79A 3R6LB 4IOBA 4LIWA 4FP9A 3IRXA 5D0RA 4ZP9A 5DG9A 5EX3A 4XPCA 2R9LA 2C3YA 1QE1A 2G0JA 2CPXA 3N28A 3MUVP 2HNDA 5FIIA 1K47A 2ROGA 3M1VB 2J9DA 1X4DA 5F0UA 1GMVA 4U8YA 4CLUA 1EQMA 3ISNC 4EEYA 4DF8A 2UUBJ 4BLGA 2YVSA 1GEHA 4LSZB 1VQMS 5B09A 1VRQC 3JQMA 3M2VB 4KFBA 2VICA 5CYMB 5DO2A 2K06A 2R2TA 2ZH4A 2V6AA 1XR5A 2FDNA 5HP1B 3PKYA 3TUZC 4MJKA 4DV5J 2GVDB 4DR3J 1FERA 2CJ9A 4HHHA 3CCTA 1FXLA 3TX8A 4ECWA 3D6TB 4JB8B 2DY1A 4LF2A 2VASA 2AHOB 2D9PA 2FLPA 1TKZA 1V6HA 3THPA 2UXDF 4KBIA 1NHKL 3BPSP 3CD0A 2E5LF 2UUCF 3B82A 2GAGC 4R0JA 4S0MA 1WHYA 2OPQA 2KJVA 3C6TA 1KNZA 2ERRA 2HBYB 4ANDA 2CZ4A 4EYIB 1E6VB 3JQKA 2DKOB 4CO0A 2ZH6A 4ITSA 2M2BA 4WFNQ 4TY9A 5I3UA 4ELVA 4JV1A 2DYAA 1DQ9A 2DEIA 2YKPA 1FEHA 1OO0B 4EK2A 1D9AA 1LV5A 3DI6B 1FNOA 5HLFB 4TYBA 5HQMA 4IR1A 2OPRA 4GKKF 3A3OB 4MFBA 3BO2A 4QYZJ 3DM2B 2NXCA 5F8HA 1FTCA 2VHGA 1T9YA 4NXNF 4XDCA 4RUHA 3Q8PB 4KHMA 3ENWA 5LJ3Y 1T9TA 4C48A 5A6WA 5BJRA 3G4SS 3MM9A 3D4JA 1PC4A 1T94A 3EGVA 3NBPA 4ID5A 2LEBA 1IUJA 3B54A 1IKYB 3G86A 1VI7A 2VC0A 4YFUA 4NEZA 2J0XA 3FBCA 4K5SA 3C46A 4NWBA 5CQGA 5AE2A 2BANB 1CEZA 4EGLA 1WHVA 1NAQA 3KUEA 2CQIA 2YNFB 3QAUA 3WQPA 4F25A 4DZDA 3RRKA 5IQ6A 1Y5NB 2YKMA 1C1CB 2ZH5A 1S97A 1Y4ZB 4LUBA 1LWCA 5BXIA 5SUHA 3P45B 1SKSA 1HHTP 2B8PA 4QYRA 3HK2A 2C2OB 3RB0A 5L1KA 4OYPA 4Q0BA 3HMJG 2C2NA 2HHTA 1OQ6A 1WEYA 2IVMA 2QLBB 2K8GA 3RJMB 1NB7A 1UWBA 1YVFA 1HNVA 1TL1B 2P8IA 1KHWA 4OJ3A 3N01A 2D3UA 8ATCB 3BSOA 2VB6A 4LR8A 3KG1A 5J2NA 5EN1A 1S4EA 1UJ4A 3KJQB 4CT8A 1CVJA 3H25A 1MG7A 2EW9A 2PD1A 1WF1A 1OSDA 2DNOA 2VFTA 2YBVA 3HF5A 4LBHA 1ZOTA 5E2QA 4ILMA 2VDHA 3MEGA 3NMAA 1S9GB 4WF9Q 2DGXA 1N52B 2HHPA 4BC7A 1RYRA 1H38A 2XZTB 4IH5A 4OX9J 2HWHA 1T05A 4USIA 2RAQA 4M95A 2GQQA 5GAGU 1UFLA 4AXIA 4X4UA 4NZ6A 2EKYA 3P96A 4CLZA 1H7WA 1HI1A 4ZLPA 1RTHB 3PVXA 2YWEA 3R5DA 3SQGB 1FJCA 1JLFB 1HHSA 3KDNA 5B08A 1GMWA 2WOMA 4CQ1A 5C24B 3V4MA 5M2UA 3CCLS 1FFSB 2DNNA 4OJGA 2RILA 3FBBA 4FNIA 1EZZB 1UJ5A 1TL3A 4ECUA 2CADA 4H4KC 3N0VA 1S6QA 3KK3A 2UV8G 4H54A 3RBEA 4QJVA 1RADB 2FJBB 2HQ3A 5C42B 4A8QA 4L74A 2RH3A 1NJIT 4UY8T 3ICLA 1RHQB 1R8AA 1IVZA 2XSFA 4J9UE 4DFPA 3PM9A 1WDTA 2G0CA 1HW8A 4ECXA 3CC7S 3HO1A 2MLZA 4IG3A 4L75A 3KLFB 3D6FB 2EWHA 3OJSA 2AYEA 5KG3A 4TU8A 3C3LA 1SKUB 2D7SA 2IJFA 3QNWB 2X51A 5F9NA 3MR5A 1UVJA 3HZEA 2W9CB 2A18A 3MD1A 1D8ZA 1RAGB 3VZIA 3D54A 3BGFA 3LPEA 5ETTA 2B7BB 1V5VA 2F7VA 3W9IA 4U67Q 1ZA2B 1BHNA 2YQ0A 2QA4G 4I68A 3V81B 3SCIE 2QEXS 4WBFA 3AJ1A 3M2RB 4H4MA 2ASDA 2AEJA 3TW0A 3AB2B 1CULA 2GW8A 4LF7J 1BWVA 1KVKA 1N36J 2QL7B 4LSNB 2LLZA 4I6WA 2VDIA 5KFUA 5JUMA 3V6DB 1SC4B 4F3MA 3CULA 1LWFA 2ALYB 1RHRB 1QM9A 4B9LA 4O23A 4CYUA 2R8JA 4NXNJ 3HVWA 2F8MA 3NS6A 4NPOA 3DKDA 4DSJA 4HEA9 1RT2B 4PPZA 2H48B 2NXUA 4QPTA 5E3CA 1L3SA 1FRHA 2B6AB 1VLYA 2QYGA 1U1QA 2B9XA 2W4PA 2HHWA 2W01A 3IGVA 3DGVA 4RO0A 2C3OA 2X1FA 5KFTA 1JLCA 4A8KA 3WIVA 3OTBA 4QBUA 3U1NA 4J9OA 4CLLA 3DRSB 4LF5J 2HVIA 2ROEA 1PBAA 3BF4A 3IP0A 3OUYA 4TVAB 5JXSA 3PRDA 2PMZD 2CWKA 1HBUB 4LQ9A 2GMJA 2V94A 2WSCC 1T3OA 3B8HA 2FLLA 1X5PA 4ED1A 5GVQA 4LJMA 4GKJF 5D6GA 2XTJP 4LF4F 3AODA 1RT3A 4KGKA 5JVGQ 2XZWA 2C3UA 4XK8C 4QU6A 2FY1A 4ZN3A 2GGPB 1VJQA 2H5JB 3O5TB 5LMUJ 4DMZA 2NPIA 3N4WA 4AL5A 5LJ5Y 1Q79A 4Q2LA 2V5HG 1U7LA 2BJ3A 1B99A 1VQSA 1X31C 2LVWA 3DFEA 3FUYA 4LVNP 2XSJA 4PAAA 5CD4H 2IFXA 1TP7A 1Q4RA 2HNYB 3KLVA 4KAIA 4TLQA 3T5JA 4EZ9A 2DGSA 3W65A 2Z0GA 4RW7B 1SBRA 4Q5VA 2LFVA 1SXLA 1VQYA 2Y1RI 1RISA 4GC7A 4BBYA 2FLOA 2PEHA 2RIJA 3L95X 3Q2SC 4MIBA 3Q8RB 1TFYA 1WEXA 3DHXA 2CPZA 2PA3A 3T5LA 3RZAA 1I1GA 4DX6A 1U47A 1NCLA 2FC9A 3GJRB 4C8MA 5K8NA 1YIJS 1TKDA 3FK4A 4CH1A 4LRCA 2B4UA 1FJEB 1F5BA 3Q8QB 1FJGJ 1F3VA 4U7UD 4F4WA 5F8NA 3JYTA 3EDRB 1URRA 5B0GA 3PIOQ 1T9UA 4IR9A 4O44B 3TA1A 1XNQJ 4TKTA 1RKIA 5DS7A 1CJKA 3BYPA 4Z7CA 2HNZB 2QV6A 4EBEA 2ADCA 1EQ0A 2YNHA 1RTZA 2RF2B 1NEEA 4R5PA 2AJ1A 5ETKA 4YQWA 2J0SD 3X1LB 1OY9A 1U26A 3WHIA 4NL5A 2KL8A 5FDLA 4P10A 1HA1A 1NLKL 5L1JA 3TARA 3ZFVA 3HJFA 2UXBJ 2OFGX 4BWMA 1SL1A 1AFIA 2OPPB 1CJVB 1FWLA 4IFYA 3PY8A 4CH7A 5C25B 5SZTA 2D1CA 3EE3A 3HVTB 4NA2A 2ZH3A 2G4BA 1NO8A 2CDQA 1VDHA 4DV0F 2GZOA 2HGMA 2VG7A 1O5JA 4QIVA 4NCGA 3I4HX 2RVJA 5LT5A 3TZZA 5AE1A 3GV5B 2MHEA 2ZBIA 3QATA 3NNCA 2X1GA 3NGDA 2K7JA 5KFFA 1IBKF 3IM9A 5F0WA 2F4FA 3ULHA 3K57A 2CNOB 2RKIB 3M6XA 4NYPA 3RAMA 2XO7A 5J1EB 1S0OA 4ZVRB 1CJUB 1YX2A 3A4TA 3AHPA 2VQFF 2DPIA 2FUG9 5JJBA 4IYQA 3NMRA 1WG1A 1RWVB 4B3RJ 3CDUA 1TR0A 3DOMB 3Q83A 2XMMA 4Q8EA 3CW2C 3L4BC 3CO0P 1LW0B 4M5NA 3T1YJ 4K4ZA 2QMUB 2NZ4A 1HBMB 3FGVA 3CT9A 5ETQA 3UNYA 2N82B 1AROP 4DV0J 1RT6B 2LXFA 2XGPA 4ZLJA 1BUXA 1S12A 3AT1B 1RBLA 4LF4J 2PE8A 2XLJA 3ZZYA 3EGZA 2ZUGA 4B9NA 2QE5A 3WX8A 1HMVA 3AQOA 5HMZA 4YB1P 3IWLA 3E3XA 3VAHA 2VBXA 3GIKA 4CDIA 1MWQA 2DR6A 3L3CA 1U45A 2VZ9A 1T9XA 1DHMA 4ZCMA 2VQFJ 5KT2A 2KDOA 2R42A 1HQEA 1EB0A 1RA7A 3O6QA 2WK4A 3R1HA 3HD2A 3H0PA 1A9NB 1N32F 2V8DA 3OFFA 4X4TA 1C1BA 1LOUA 2VFUA 3OFHA 3NXZA 4CM2A 1HR0F 3T6JA 5CYQB 1EHWA 4FXDA 2HQIA 2W2PP 2GO8A 3SBMA 3BDPA 4UZBA 2HZVA 4C8OA 1UP1A 4Y2IA 3SSQA 1R6YA 2XZDB 3R3TA 3T1AA 4ZPTR 2MQNA 4P2XA 5E3AA 4DJBA 4HL9A 5I42B 3GIJA 4DL3A 3DLHA 3UNGC 2GJIA 2ZVSA 4L3NA 4YEAA 4FVMA 3TOQA 5LSRA 1QSLA 4E0DA 4L73A 1T9VA 4CM0A 1NK0A 5KFIA 2RS8A 4P73A 2VBZA 1K9MT 1GT8A 5KTQA 4W4MA 2ZBCA 5ETOA 4OI3A 3M8RA 4DU8A 3V4IB 3P49B 2FGOA 2FC8A 3KG0A 1SV5B 3DCAA 4WE1A 3DLEA 3D1QA 1GK8A 4A46A 3MMAB 5KFXA 1R0CB 3NG8A 2CPEA 1VBKA 3ZZ0A 5HVGA 1VR6A 1JJCB 1Y0HA 4DSEA 2QN6B 2F9DA 3DGPB 3TANA 3IR6B 2CJAA 2W4DA 2OIHA 3P8BB 1S1WA 4J9QA 3W2WA 3G96A 3NKYA 1D9FA 2LQ5A 3DRRB 1VJWA 3M6UA 4KGMA 3D0GE 4JI6J 4IH6A 2FHJA 3MCNA 2XMWA 4J9SA 2QLXA 3M30A 4UY85 4YOEA 3J7ZT 3R2CJ 3QWPA 4HYKA 1PCAA 2G2YA 2XULA 4Y2AA 2HS0A 2FHKA 2WCXA 3D66A 2BABA 2HAFA 1YKWA 3GIRA 5RUBA 3T3FA 1SUQB 2XNQA 2APOA 2V8PA 1FEEA 1S0VA 3TA0A 1Q82T 2E9ZA 4F36A 3KLIA 1T03B 2DRDA 1MMDA 3Q89A 3MMBB 1RT4B 4ZVQB 3W8PA 4USMA 5E3RA 4KB7A 3QZ7A 4DV4J 4FF4A 2VD3A 3T9ZA 3ISND 4I7FA 1VHFA 5KFQA 3JSRA 1S48A 2HHHF 3NEKA 4ZPVR 1UPMB 4YB7A 1HNIA 1FK9A 3MEEA 4DUTA 5F8GA 4YR3A 3IO1A 2GX8A 2BQRA 2I5JB 3G6ES 3HD1A 2LA6A 2PT0A 4UOGA 2CQ3A 4AQYJ 3FQLA 2M4MA 2C2RA 3UCUP 3JSMA 1D8YA 4CNZA 1SKWA 2DIUA 1M1HA 1WC3A 2IDLA 1UFWA 3P5TL 5KOWA 2V4QA 1WUUA 3FRYA 4F4YA 3PIPQ 2I8EA 2I38A 1RE1B 1Y10A 4ZJQA 1FESA 3C19A 2JVRA 2N4CA 4YY3F 2WONA 4KC5A 4OQJA 1JJ4A 3TAQA 1YRXA 1XR7A 1RWNB 2LP4A 1HWUA 5EWGA 3NLCA 1ZYQA 5T7LA 3RBXA 3JXOA 1CS4B 2ZNZA 2RS2A 1FWPA 1WOPA 2OMOA 3FVYA 4EWTA 2F8HA 2JX2A 1PYSB 2CPDA 3GTYX 3GONA 4JI2J 4AD6A 1C0TA 1RTIA 2DGOA 4OLPA 4DG1A 2ZNYA 1LNQA 2Y1IA 1AYEA 1Z1ZA 1BQXA 2IM2A 3DXSX 3MM5B 2GC8A 1Y00A 2ZD1B 4MAKA 4NLSA 5EDWA 3DLGA 4WXOA 1FVQA 4K4VA 4NLPA 1IKVB 3EXCX 3N6LA 4Q45A 1REVA 2D3OR 4I2PA 2QSFA 4KT0C 5HMXA 1U2RA 4LBPA 4Y0FA 5DDOC 2AYMA 2BOPA 5EWFA 3WC2A 4J91A 3HKZD 5K9FA 4K7QA 2BUNA 5CZVA 1UEVA 4ED4A 5C7PA 4KPYA 1SCJB 2FLNA 4N76A 3ITHB 2V67A 2W1BA 2ZC4A 4LVOP 2WVDA 3KHRA 1EJ7L 3K5PA
chains in the Genus database with same CATH topology
3OHBA 3CDWA 1PGZA 3BN4A 3PRBA 3FMWA 3PZPA 1N88A 2MY8A 2JZ5A 2XEXA 4FN5A 4RNHA 3BB5A 4IRCA 3FQKA 4O4RA 4A48A 4OI4A 2HS3A 2P6TA 4TYAA 5KFDA 3OVAA 1HFEL 2RDIA 2K3IA 2AYGA 3KK2B 2IRXA 4RBVA 3LW5C 4DOZA 2VG6B 4DFMA 1S49A 1KC8T 4DL6A 1YJWS 3EZUA 3DLLQ 4PRFA 3F56A 2CVIA 2IAJB 2BW2A 4PWDB 2CJQA 3CIMA 4A8WA 1VQLS 2LCWA 4WYLA 2JH3A 1JLBA 4DFKA 2IMOA 2EFVA 3RAQA 1KVJA 2ZM6F 3RB4A 1FCAA 2RU9A 2V8GA 3D1OA 4Y2MA 3GQCA 4J9RA 5G4DA 3D0HE 4OZ1A 2B7CB 1WI6A 2GHVC 1TK0A 4IO1A 4HHJA 1VBXA 2R7OA 5CH7B 3ZZTA 2YWGA 2E1CA 3FEXB 3LAKA 4IFVA 3QWUA 1DQ8A 3EGWB 1Q16B 1JJHA 1S10A 2Q3PA 3KLGA 2OLWA 4DS5A 3MMCA 1NNDA 2Q43A 4UOCA 1UAWA 1SIZA 2MSSA 2NSCA 1KR4A 1F5AA 2ZH2A 3CCVS 4LFCF 3MFHA 3M2UB 5GMKa 5KFLA 4DF4A 3BO3A 2H5EA 3ENVA 3LWLA 2HAIA 4MMOA 4BC9A 2ZHBA 1ZM2A 3KHHA 3PX0A 2B4OA 2MYFA 4G3IA 1UJ6A 1S77D 4NLVA 4CO2A 3GFZA 2MQMA 4E8UA 4DLGA 2RQCA 5J2MA 2KFYA 5J2PA 2KG1A 4U9RA 1UETA 4F50A 2XS2A 2WSFC 2HGNA 4IDKA 3KFWX 4EU0A 2K2PA 3J7Z5 4F3OA 1DZ5A 4ZVGA 3MTJA 3GMGA 3C6TB 3K0JA 3Q22A 1N5YA 1HI0P 4DV3F 1NHUA 2KZZA 2IJNA 3CMAS 1K8AT 2M0GB 2K7KA 4NRTA 1XNQF 3SV3A 5KG2A 1U2FA 5H1SV 2IC3B 4HH1A 2F1FA 2RE1A 2JSXA 4PG5A 5E5NA 2M3DA 5DG7A 4YB5A 2JLFA 1P6TA 4C7QA 1J5OB 3QJPA 3CJKB 2ZE2A 3CCES 3QGIA 3BN7A 2UVVA 3SDEB 3SSSA 4YMEA 4NCBA 2JLGA 1DQAA 1O8BA 1TVRB 2DNLA 3HPOA 2JEJA 2XS7A 2AQ4A 4C8YA 2B4VA 2BRKA 4NYZA 4RLEA 2G1DA 4YUDA 3FZ2A 3OVBA 3UE2A 2LDYA 3DRXA 1B0VA 2EFGA 3UDCA 3PEJA 4TQSA 2L48A 3DOKB 4FS2A 3PJWA 5F3TA 3HT3A 3EPIA 2FJWA 1PILA 2KU7A 5J1PA 5IZHA 4ED3A 2BE2B 1GQEA 2JJ4D 4KQZA 3MEDA 4RW4A 2DJWA 4O3PA 4R8UB 5IXUA 4FPRA 1C1CA 3BEGB 3HHNB 2O01C 3MM8A 1BQNB 2R7WA 1IKXB 3FFIB 4FXVA 4IG0B 2MXYA 3CXCR 2UVUA 2KO1A 4I4BA 3FEZA 3MM7B 1N54B 2O5DA 4YDXA 1HWJA 3JSYA 5K14B 2X1AA 2UXBF 3PFEA 4IH7A 5M2RA 1TKTA 1LWEB 1ELOA 3DMJA 4A8SA 2PN6A 3N79A 2A1BA 2LEPA 3MR6A 1JIHA 2AU0A 4I2QB 3FJ2A 2XMTA 2F8EX 3MOJB 4C0HA 3QO9B 1QY7A 1JLEA 3BGUA 1S1UB 3IG1A 1RT5A 1NKCA 2CQBA 2VA3A 2AGPA 4M5DB 3IFEA 2KHCA 1T05B 1N5SA 3CD7A 3OL9A 4QWCA 4H4OB 2UUWA 4ZPBA 3I4PA 4KHPF 4FF3A 1XR6A 3IS9A 3MD3A 2FVRA 4DV5F 3NNHA 3ZZPA 1U4BA 4DQIA 2OJ3A 3CC2S 2AGQA 4LIRA 1U48A 1WHWA 3I0RB 2ZHOA 1X9WA 4X4OA 4HDHA 3W2VB 1HD1A 2MZTA 4USJC 3T9NA 5L38A 3M32A 5C42A 1JMTA 5KFSA 2CPHA 1Y3KA 3VCDA 4G1IA 2KFZA 3GFHA 1TKXB 5IM0A 2N4DA 3D2WA 3VAMA 3M4XA 1RT7B 1Q86T 3LF0A 2GIRA 4JI1F 2VFSA 1RP5A 4ALZA 4ECQA 3GR0A 1VFJA 3GYXB 2IYIA 3V81A 4NYOA 2VG5B 2QIFA 4B3OA 3K5OA 3OXFA 2HS4A 3QIPB 4M8LA 5KAKA 2BM1A 4C0OC 2IM0A 1LW2A 3V6DA 2VH7A 4JYAF 2PDAA 4YR2A 2IA6A 2V2KA 1OWXA 3PACA 4CO4A 2LXUA 1HBOB 2DH8A 1VQ9S 1AFJA 3UCGA 5L39A 4WFAQ 2E5GA 3QGGA 3BQ1A 3MZIA 3GG0A 1TUVA 3D0IE 1MU2A 1ZBTA 2EPIA 3DOLA 2KI2A 1NJWA 2B5JA 2LQ9A 3H2VE 4KO0B 4O3QA 1VRTB 4TU9A 4PR6A 1H0HB 2DCUB 3I55S 2OTLS 2PFFB 2BJEA 3BS9A 3U1MA 4DL4A 3UR3C 3MAHA 2FVPA 5E3QA 3QAEA 3H5YA 4I1TA 3OLBA 4NLOA 1T02A 4Q7AA 2ZH1A 4CZCA 3A8EA 3DRPB 4AUKA 2YH0A 1X5SA 2B56A 4F2SA 3GIKA 3SSRA 1R8CA 4RNOA 2HNDB 5FLXY 3H98A 3RRHA 1X8DA 5CXTA 3J81Y 1N0VC 4HTJA 3KK1A 3C2PA 4KE5A 3UD4P 3QIDA 3ZZZA 4EZ6A 2OD6A 3M8QB 2AWZA 3M2VA 4KFBB 1U1LA 4DR4F 3K5LA 2DNMA 4B08A 3T1YF 1X9MA 2DHXA 4RWWA 3CGIA 5HP1A 3OW2R 2XWYA 3HHLA 4PQAA 3UPFA 5GAHU 4MTPA 1SH3A 5K8PA 4NLTA 1PC5A 5DJBA 2VOOA 4PG8A 5L1LA 4I64A 4ELTA 1HWLA 4OZ0A 1SH0A 4QWEA 1U25A 2J76E 5I4MA 1KTVA 2GMHA 3FSXA 1XMQF 1Y3JA 3M9NB 2RMLA 3DDKA 2F40A 2Q6BA 2YNHB 2CKWA 4NX9A 4DL2A 3CJ2A 2HMIA 5I3UB 1JKHA 1HPZB 3SYZA 3HM9A 1N4LA 2WW8A 1RTJA 1K1QA 1DTTA 4DUYF 4C8ZA 2RSQA 1U09A 1SJ3P 2A2DA 4ZVEA 3EUNA 2YX7A 3KLHB 1YBAA 3I9V9 5B7WA 4DR3F 3X3UA 3CCZA 1C4AA 1R0AA 1V3RA 5HROB 2HIQA 4X66F 3MFIA 2FHMA 5KFBA 5CA5A 1GX5A 5LMNF 1VQKS 4BCAA 1FA0A 2W24A 1J2VA 1X9SA 3P6YC 3M6WA 6FDRA 2CQ4A 3R5CA 3LP1A 1YSJA 3PX6A 4ZCIA 4RW9A 4QU7A 3DOMA 5F8JA 1ZETA 2F9JA 4FBTA 4E0DA 2IBKA 3CJ4A 1HBMA 1LWCB 2EFNA 3RYLA 1FRJA 1Y5LB 4TXSA 4DL7A 3KOAA 1KLMA 3HHEA 4DR1F 3THTA 2YWKA 3GFYA 2YY3A 1F5CA 4DL0C 2NR0A 1UWBB 2IHR1 2MKKA 2OH2A 3UDLA 4ZMMA 4CCHA 2EFQA 1IJEB 2IM1A 1U1RA 2YWHA 2HLUA 3CO9A 3MUTP 4P6QA 4F26A 5J2QA 3US5A 3LPYA 4OV1A 3O3LA 2MHNA 5KG1A 1GTHA 1UW4A 3OTDA 4ZP7A 1PO6A 3PW7A 1RTHA 2DH9A 3MEKA 2FTRA 4YP3A 2IRYA 1XMBA 4OX8A 5C24A 2EFPA 3V6KA 4ZDNA 5G0RB 2VKRA 1JLAA 1S0MA 3POTB 3PKMA 1TL3B 2VQEF 4C11B 1S6QB 2N3OA 1FXRA 1M5HA 1XTZA 3HVAA 4V19J 2VOPA 4ZHRB 4WK1A 5IS2A 1NJXA 4BS2A 5HBMA 5D3GA 2Z2MA 4F2RA 3C8YA 4JI5F 4N8NA 4ZP8A 5BR8F 1TV6B 2FJAB 2JVOA 1HWIA 4C8NA 3AJ2A 1NU4A 4OX9F 1VC5A 4AL7A 1ZPWX 5H9FJ 5KFWA 5KFCA 2W9AA 2UU9F 2CQGA 1XC9A 4ZPWR 1FRLA 3MR3A 1FRMA 3C6UB 2OPSB 4JBCA 3MI7X 2CQ0A 3G71S 1YJUA 3S6EA 2MGZA 2M5YA 1NKBA 1WWHA 3MM6A 4ZS6A 1SI9A 3ONQA 4Y34A 3UR0A 2J0WA 1YGYA 1KD1T 2DR8A 5IQQA 1IR0A 3HHLC 4QWAA 1F0XA 2R8IA 1VQ4S 2X1BA 1D9DA 5KFAA 4ICLB 2NS1B 4MH8A 2YQ3