2IYGA

Dark state structure of the bluf domain of the rhodobacterial protein appa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
GSDLVSCSYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction
molecule keywords APPA, ANTIREPRESSOR OF PPSR, SENSOR OF BLUE LIGHT
publication title Crystal Structures of the Appa Bluf Domain Photoreceptor Provide Insights Into Blue Light- Mediated Signal Transduction.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 31
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iygA00
2KT2A 2QYCA 2ACYA 5B0DA 1YJRA 1S6OA 5B0AA 5F0UA 4HI2A 2GFFA 2GGPA 1VQYA 3HHLB 3IWLA 2AJ0A 3HF5A 3TOQA 2OKQA 2RU9A 2N4CA 1IUJA 1LQ9A 4Q2LA 2N7YA 2OFHX 3T9NA 4A47A 1FE0A 2IYGA 2XMUA 3VTIA 3CJKA 2IYIA 2W4PA 1KVJA 2ASYA 1JWWA 2VV5A 2FHMA 1AFJA 2ZDPA 5B0BA 4HH0A 2XMVA 1GXUA 3FGVA 1FVSA 2QLXA 5B08A 2AP6A 1X0PA 1FEEA 4NL5A 2K2PA 3MCSA 2OAUA 3GZ7A 5A6WA 4OJ3A 2BJEA 1AFIA 4OJ1A 2BJDA 1N5SA 2FTRA 4Y2KA 1XBWA 3LGMA 4DL0C 2IFXA 3DCAA 1YJTA 3KKFA 3BR8A 1APSA 2GGPB 4OIXA 1FE4A 5F0WA 1AW0A 2OMOA 1W2IA 1MWYA 2GCFA 1V3ZA 3QMQA 2XMTA 2LQBA 3CJKB 2ROEA 1U7LA 3HDSA 2FB0A 4YDXA 5KAKA 1CC7A 2KKHA 4QOTA 4Y2MA 3WDOA 1TL5A 1K0VA 2GO8A 1OQ6A 5B0EA 2QLWA 1Y0HA 4EFAC 2ZDOA 4U9RA 4ZOSA 1VQSA 2KT3A 3QGPA 2ROGA 1QUPA 2HFOA 2HLUA 1CC8A 2W4CA 2XMMA 3BDEA 5B0FA 4ZA1A 2ROPA 3BF4A 2EW9A 5K9FA 4HL9A 1P8GA 1Q8LA 1Q53A 2W4DA 2XMKA 3FRYA 3LGNA 2AW0A 1SI9A 2K1RA 5A6PA 4OJHA 1CPZA 3HHLD 3IWXA 4NPOA 2PD1A 3DXSX 2OFGX 4A48A 2OP5A 1WD6A 1Q4RA 4FNIA 3KNGA 1TL4A 3BGUA 5B0GA 5B09A 2L3MA 1FESA 2HQIA 3HFKA 1GXTA 2VH7A 3MZIA 1TR0A 4DN9A 2XMJA 3TRGA 1FVQA 1OPZA 1SB6A 3TNVA 3HHLC 3KG1A 2XMWA 3BB5A 4Y2IA 1TZ0A 2PGCA 2HFNA 5T7LA 4DPOA 2HLTA 4HH1A 1X7VA 2K7JA 2G9OA 3K7RA 1FD8A 2GA7A 1R6YA 3E8OA 3F44A 1N5VA 1KQKA 2BUNA 1RJJA 1N5QA 2LXFA 2HIQA 2KYZA 2RMLA 1YJUA 2FIUA 1OQ3A 2AJ1A 2CRLA 2K1RB 1Y3JA 2RILA 3UDCA 3HHLA 1YG0A 1YRXA 1S6UA 2BBEA 2RSQA 4Q2MA 1P6TA 1Y9OA 2Q3PA 4A4JA 1N5TA 4F67A 2QIFA 3BM7A 1X8DA 3HX9A 2K7KA 2JDJA 2OD4A 4HI1A 2GV1A 2OD6A 1KVIA 1JK9B 2N4DA 4A46A 1ULRA 1OSDA 1Y3KA 4YEAA 4FNHA 1URRA 1Q8BA 3FMBA 1SQEA 4OJGA 1MWZA 1YJVA 3I9ZA 5B0CA 2LDIA 3BN7A 3LO3A 5IXUA 3KG0A 5T7LB 1TUVA 2LQ9A 2BYCA
chains in the Genus database with same CATH superfamily
3L7UA 3ZFVA 1XR6A 5F9LA 1I3OB 2C2RA 1X4CA 3IRWP 4QR0A 1P1TA 3DGPB 3AXMA 4YP3A 3R9LA 3M32B 4M5DB 4PXEA 4ED1A 1B7FA 5KFVA 3UFCX 4K8RA 4K5SA 5FD1A 1S9GB 3L4BC 1VIXA 3PV8A 3TAMB 3FDSA 4FPIA 3K5NA 5M2UA 2XY6A 4OZ0A 3R5BA 2HLUA 3R3TA 2NQPA 2H48B 3D3CJ 1URNA 4FNIA 4I2PB 1X4EA 5B09A 5AT1B 2NLWA 4LRCA 5CYQA 3HHLC 4NXNJ 3HD1A 1S9FA 1Y5LB 3QSYB 4JI2J 5CCLA 1PC5A 2GW8A 2ZWOA 2C2MB 2K1RB 1S72S 1NK0A 4KTQA 5GVQA 1R8CA 4RJVA 1V6HA 2GV1A 4DBQA 3PY8A 3ISNC 2Z2LA 2FYXA 3MTJA 4U7CA 1HNIA 2B9XA 2WVBA 1RQ0A 2AQ4A 4DEZA 4IFVA 5A8KA 5F8NA 4J9OA 2GIQA 5KFAA 1M1HA 2OAUA 5HANA 2C2DA 2R7OA 2DBBA 3IMQJ 3W5YA 2VG7B 4XPCA 4DR3F 4JI4F 4ZOSA 1RGVA 3QAEA 1U26A 3UDLA 3UD3P 5KFTA 2KRBA 3KJFB 4A48A 1UVNA 3CE8A 4IFYB 4C8ZA 2FJBB 3PX0A 4I2QB 3M30A 3KJNB 3J7YI 4GC7A 1JLFA 3RB3A 4OI3A 3QQCD 4QYZJ 2V67A 1IWGA 4EMDA 3LP2A 5C24A 4L6V3 3G8QA 4RNFA 4PWDB 1N33F 2YWHA 2Y1JA 2MKJA 5IV3A 1UEVA 3GR1A 2V0NA 1WI6A 1RTZA 4XAKA 2W4PA 3ZC4A 1XNQJ 5KFXA 3DLKB 2DXDA 2L9DA 4B3TJ 2J7UA 1UWBB 1LKZA 4JV5F 2N3LA 2R7WA 3MAHA 2LFVA 2F9DA 1RCOB 3KJQB 1FNXH 3IC1A 2C22A 3KLIB 3GMGA 1T02A 1IR2A 1JLCB 4AT1B 5FIIA 1SL1A 3IWXA 4NPOA 5GAEI 2PIIA 4GMKA 1WF2A 3UDVA 2BR0A 2XMJA 3ZZYA 2KVIA 1ZETA 2E9RX 2NUUG 4DFMA 1RT7B 4WWSA 2XC9A 4L3KA 4IOCQ 4AL7A 2GA7A 2EFOA 1FKPB 3H25A 1UA0A 1R43A 2IA6A 5DDPC 1Z4UA 3SCJE 1X8DA 3HK2A 1HI8A 4FNHA 3TAQA 5KFLA 3PG9A 4Y65A 1CJVA 1D09B 1X4BA 5T7LB 3P3DA 2HFUA 3MMCB 3FFIB 2DNNA 3CEDA 3BPDA 2A3JA 1KBRA 4JOUA 4UT4A 2KT5A 1N34J 2MQNA 1OY8A 2WTFA 1VMBA 1AXQA 4Y2KA 2PMZD 1N0UA 3UN2A 4LFCJ 4LF5F 1UVJA 1HNWJ 4KGZB 1OQ6A 1R27B 3MM5B 3I82A 2SXLA 3IR6B 2QGFB 3TJ8A 4NLXA 4IO1A 1SKSA 2FHKA 5LSOA 1LK5A 4P2XA 1C0TA 2F65A 4ITSA 3M9MB 1NHVA 3HLUA 3ITHB 2B4UA 1RTIB 2E1AA 3VAGA 2EC0A 4I56A 2Q79A 2QYGA 3TUZC 3GG0A 2O5DA 3NWRA 3KLGB 2XNQA 4XDDA 2G0CA 3O5TB 4NLSA 4O0IA 3TARA 3NS7B 3CPWR 2EK1A 2VODA 5I4MA 3CMAS 4RW7A 1F2HA 2I0XA 1QVFR 3WC0A 4ED5A 4LIRA 1FFWB 4LSNA 1R0CB 1OY6A 1EJ7L 2ABYA 5L1IA 3QT8A 2G1HA 1S1WA 3GP9A 5AXKA 5KG0A 1PGZA 2FHJD 5I42A 4HACB 1C4CA 2VOPA 3G87A 2QJ3A 2YX1A 1DARA 1IKXB 4HTJA 1ITPA 1VRUA 1K73T 3GG1A 1V3SA 2DHGA 2IM2A 4DV4J 2V68A 1CVJA 4K4TA 2W2OP 3CD6S 4FYVB 1GQEA 3J7ZT 1X7VA 2QA2A 2Y0BB 3NOGA 2JEIA 1S6PA 1NK7A 2ZUGA 3W2VA 4R5PB 1RHMB 1Y3KA 2RE1A 3H8YA 3T1YF 2IJFA 1LK7A 1A0OB 3M4XA 2XSJA 1RT5B 3GCXP 1FJ7A 3KHHA 2OEKA 4FP9A 2EBEA 2YWFA 2CJYB 4DS5A 2N4CA 3M9OB 2KG1A 4HT7A 1RTDB 2BM0A 4Z7CA 1JJCB 3ILOA 3D6MB 4PQUA 1YHQS 2E66A 3I4PA 2D69A 5KFNA 4EBEA 1PBUA 4KGXB 5K20B 2R8JA 2CPEA 2E29A 3H2LA 5CCMA 2L08A 1GMVA 3PW4A 1RWNB 4Y2MA 4E2FB 3BGLA 1IKYA 4M95A 1S1TB 4OZNA 2HEKA 1HIYA 2AW0A 5HQMA 3PJWA 2PC6A 1E6YB 2GIRA 4M5JA 4NWBA 1HWKA 5T41A 2BDPA 1RTHB 1GFWB 2RRAA 1S1VB 3DOKB 1SJRA 2KZZA 2HQCA 5D0GA 1UJ4A 5CZXA 4LF7J 4OLPA 4V19X 3AQPA 2N82B 1C2PA 1N5TA 4OX8A 4OHYA 4PABA 3CD5A 4HLBA 2MEWA 2ZC4A 3IG1A 5GAHI 1JLGA 4DFKA 3HO1A 3OLAA 1N8RT 4FKYA 3DU6A 5MAOA 4U95A 1S0VA 4A8KA 2ZZTA 1IKVB 2KO1A 3MMBB 3MD3A 1KTQA 4B9LA 2QL7B 4AFFA 2VPZB 1S1UB 3CCTA 2B5JA 4U8VA 3NCRA 2YNFA 3AAWB 4G6VB 2ZD1B 2FJEB 1UVLA 2OTLS 3CCLS 1CJKA 2ZBRA 1RHUB 2LMIA 5D4LA 2X3GA 4JI7F 3KNGA 2COLA 2JNJA 4CIOA 3K17A 2H4YB 3PJXA 4KHPF 1U0HA 5K14B 1NDPA 2O3DA 3A8KA 3CJ2A 5ETMA 1U1NA 1DURA 1KHWA 1HW9A 1QSSA 3THVA 5D0EA 4FS1A 3KLVA 2LVWA 3TZYA 3H5XA 4NYPA 1OIAA 2OKQA 3OFGA 3NKYA 1UW4A 1C1CA 3CB4A 3CCUS 1SKWA 2LEAA 4XO0A 1RAGB 1XR5A 2E1MC 1ZPVA 3PEHA 1AW0A 4O0NA 2QRRA 5KFPA 5J2MA 2BM1A 3Q23A 2CKWA 1NU4A 3I0SA 1RE1B 1XWLA 4DR3J 4JI4J 4P7TA 2DGVA 1TMJA 3UD4P 4HL9A 2CZ4A 2CQCA 3EVMA 4Y28C 1LEOA 4OFZA 1KSPA 3IS9A 4HHUA 2VJVA 4UTGA 4RL1A 3NS5A 1FD8A 3F44A 1YJUA 2M8DB 1VQ7S 1BLUA 1N33J 2DNOA 1TL7A 2OD4A 4C0BA 1P9YA 4JI6F 5IQ6A 4ANEA 5C2CA 2HFVA 2IMWP 4U7UK 3VQTA 2F40A 3OJSA 5G0RA 2YNHA 4TYBA 4IOBA 4J9RA 1NAQA 4LFBF 1BQMB 3QGIA 3GV7B 4S0MA 2DO4A 3CJKA 3D3BJ 1Q0NA 4CLZA 2KG0A 2K2PA 3AQOA 4PXBA 1AZSA 2CPXA 2W9CB 2OPSB 4JV5J 2MLZA 4B9MA 1J5OA 1MWYA 2DB1A 2KL8A 4DV6F 4UQTA 4IYQA 3LOUA 1F2GA 1OY9A 2M3DA 3G6ES 4A8XA 3TUIC 1LW0A 1RHRB 2F4FA 5D15A 1M5SA 4HVZA 3KG4A 1RLDA 2JLEA 3PVXA 1HWUA 5CA5A 1RCXB 5J1PA 2BX6A 3JSBA 4FF4A 3CIMA 2GQCA 1LNQA 4USHA 4KRWA 3ZTOA 4X2BA 1N5QA 4P72A 1XMQF 3F56A 2OELA 1AROP 2AJ4A 2BBEA 5KOWA 3V81A 1VK3A 2JOQA 3PXGa 4UOGA 3MM7A 5CYQB 4NCAA 3D9BA 5KT4A 4IO9Q 2ACYA 3J7Z5 4C8KA 5KG6A 4WFBQ 2P9CA 1F0XA 3U7JA 4EZ6A 3BO4A 2B7CB 3OT9A 1PJ7A 2WVEA 3DRXA 1FVSA 2QLXA 1I5OB 1XIQA 4ZLJA 5J2PA 3GR0A 3CULA 4ICLB 1IKWA 3ICLA 2JL9A 3BSNA 1WNEA 4LF5J 2FHOB 4IFVB 3IR5B 4IH6A 2OHDA 4NLWA 5A8KB 5CQGA 3M1VA 2H54B 2OO4A 2KI2A 2CYYA 3Q2SC 2WSFC 2RVJA 3GQCA 3W64A 2VIHA 4DU8A 1F1BB 2QG9B 1Q1KA 4NE9C 2JLGA 5E3PA 2DIUA 3OFFA 3NL0A 4I6YA 3D0GE 1RI7A 5HL7Q 3A8JA 2ZH6A 3ZTRA 4RWWA 2HIYA 3M30B 2VQEF 1JLFB 3ZZUA 1JQGA 4C4WA 3I9V9 1FHTA 3UCZP 3LP2B 3ZZOA 5C24B 4I6AA 3BSAA 4RUCA 2KHDA 4JI0F 2LXIA 3CSKA 1CLFA 1FERA 3B6BA 3D54A 4MKAA 1QE1A 4OX9F 2GHPA 5KG3A 4NZ0A 2W8LA 3BYPA 3C2PA 1T3OA 5K8PA 1V5VA 3RBXA 3N5FA 4ZPVR 4G1PA 5KFDA 4QQBA 5LMUF 2KH9A 3RBDA 2EG2A 2CQ4A 1RHJB 2KJVA 4JP8A 2ROGA 3TVYA 4U6PA 1G1XA 4ED2A 3KUGA 1CULB 2IPOB 2YWEA 3RAXA 2J6UA 1KWMA 3P6YC 1T94A 1JJHA 5DETA 3T5JA 2MJNA 3A12A 1Z1ZA 3LAMA 2QLJB 2CPYA 3CW2C 4UZBA 2KXHA 2GHVC 4USWA 3A1YG 2NPFA 3UDCA 2A2CA 4KIAA 2A18A 4B3SF 2HAIA 3UD5A 1MU2A 2WVFA 3O1LA 4BS2A 3J7YU 2VBZA 1VQNS 4OZ2A 3IWLA 2AJ0A 2HWTA 2LQ5A 2HZVA 3LPEA 4WU3A 4LVOP 1Z2ZA 4X4SA 1CJVB 3BBFA 1KOHA 1RT1A 1YQHA 3UN5A 3BQ2A 4HR2A 5EX0A 1LW2A 4F8RA 2FC8A 3D6TB 4OYPA 2MQ8A 2LQBA 1K47A 3N79A 4FF3A 3DHXA 2H1YA 1Q5VA 2D3OR 1M5VC 3UNGC 1RU1A 3QT5A 1VISA 4CH1A 1YLXA 3SXLA 1R0AA 3LGNA 1F9HA 3DXSX 3R5JB 4YQWA 2D3ZA 2MYFA 2W9BB 3VAFA 4OL8A 2YVSA 3NGKA 3ZTSA 4WKYA 3E51A 1SC4B 1JJ4A 4KH0B 1JX4A 4K4SA 1K1QA 2NCKL 3OVSA 4K4UA 2RSQA 1Y9OA 3BEGB 5CXTA 1C0TB 1KEKA 2CQIA 4O3QA 3B54A 4LMZA 4M5NA 2X7IA 2XO6A 3LALA 2GC8A 2LDIA 5IXUA 3QIPB 2YNGA 1S6OA 4PAAA 4WK1A 3THPA 1JLQA 2VV5A 1RLCL 1LWXA 2AX1A 1HMVA 1VHIA 1DRZA 2CNOB 2R2TA 1N52B 3UI3A 3V4IA 1YVFA 3BQ0A 4EBCA 1XK8A 2ZITA 2DITA 2UUCF 1WC0A 3CJRA 3K5MA 4LSNB 3BDPA 2WAQD 2E1PA 3H2UB 1HNXF 2VB6A 3QGHA 3Q8PB 1S1WB 3BF4A 2YKMA 3M2VA 2WVDA 5KFGA 2KM8B 4JI7J 2YKAA 2ERRA 5HQLA 5MLCV 7AT1B 5I42B 5KFZA 1BE4A 4KHPJ 1DAXA 2CNKB 3DYAA 4N77A 4JI1F 2W2MP 5HSPA 1Q81T 4O3NA 1KQKA 4DSEA 5A0YA 2EFNA 2W7PA 2V9WA 3RJMB 3WC2A 3I56S 1F9EB 1RWXB 4IQXA 4B9NA 5AXLA 5D0RA 2M7SA 4CLUA 4DLEA 1NSQA 4M5LA 1S6PB 4IR1A 5DO2A 5ETSA 2YPZA 3W2VB 1M1KT 4J9KA 2BMBA 1KOOA 2RQKA 2CG8A 4AL5A 4USIA 4ZJOA 1LWCA 4Y00A 4D3HA 1BY9A 2XSJB 5LOQA 3RBEA 3RTVA 2WONA 1R3NA 4CH7A 1FX2A 2DNKA 2UVUA 2FB0A 3O8WA 1AA1B 3V6HA 4PQUB 4DLGA 4OMFG 3T3FA 1KVKA 4U9RA 4Q2MA 2Y1LB 3CCZA 4M5KA 5C42B 4LSLB 1CSJA 2ZH4A 3UDEA 3HHDA 3DOMA 4X84A 1VIOA 4J9NA 2L3MA 2AZ1A 2RT3A 3TRGA 4E0DA 5AXMA 1IKYB 2CZVC 3DRPA 2JFDA 2A10A 3W65A 3PW0A 1NPRA 2IVFB 4ZCIA 1PC4A 1B99A 5FLXY 3WZ0A 4RPFA 2QIFA 4JI6J 1HR0F 1V3RA 2VZ9A 3MR3A 2QA1A 4K4VA 2XZWA 4DSLA 4LFBJ 4CYUA 3BGRA 4NZ7A 2F63A 4A8SA 2B3TB 1FFSB 2OUGA 2B4VA 1TMMA 2Z57B 1BWEA 1QDUB 1R8HA 3TJ9A 2MZTA 1RZMA 2IIHA 1JLGB 2DJWA 1HBNA 2G2ZA 3FRZA 2B8QA 2HFSA 3NP5A 4DXLA 4N8OA 2X51A 1HFEL 3AOBA 2LKZA 2BJ1A 1O8BA 4BC7A 1MMLA 4DV6J 1U49A 3OL6A 1R8BA 3HDSA 2MB0B 5KAKA 1CC7A 3QZ7A 3CDWA 4NA3A 3WDOA 2H5JB 1Q7LB 5DQIA 3TA1A 3R2CJ 2B5JB 3KOAA 2YWKA 3OSNA 2WBRA 3HULA 2YQ1A 3MXHP 3HXMA 4CI0B 5KG1A 1BHNA 4LR9A 1NK4A 5HQ8A 3VGSA 1XMQJ 2QLBB 2WW8A 1OQ3A 4KSEB 2XBPA 2Q1LA 2ZBQA 4NYOA 5BXIA 9ATCB 5L1LA 2XYGB 1Q8BA 4ID8A 5HROB 2FLNA 2QV6A 2E5HA 4ZS6A 4DV7F 2ADBA 1XR7A 2V5HG 3KJVA 3TQEA 4C8YA 1Y4ZB 4PG5A 4ATNA 3JYTB 1MG7A 3FGVA 1UKUA 2AP6A 5GAHU 2JZ5A 1RWKB 2B9EA 3H20A 4Z2XA 2BKPA 1SV5A 1DLOA 4ZVPB 1C1CB 1QAIA 1H98A 3M8SA 3MECA 2KFNA 1XERA 2BQUA 4UOHA 1WEZA 1NHKL 3E2EA 3U27A 5HO4A 4QPXA 4LIWA 5J2MB 4X4PA 4PPDA 2CIMA 1HHQA 1PYOB 3CD0A 3CJ5A 2B43A 1SH0A 2DNQA 4OI0A 3NMRA 1YK9A 3WX4A 1FK9B 1S59A 4PUOA 4EUVA 2KJWA 2VQEJ 2Z2YB 4CZCA 2POKA 4HI2A 4DCOB 1NEEA 1MMDA 4JI0J 1TL7B 4TVAB 1VRTA 2HVDA 7FD1A 5ETNA 4CLFA 1TFYA 3NY0A 1EQMA 3C3LA 5SUHA 2YNHB 4NI2A 4ECSA 5LMUJ 2OMOA 4LF9F 4J9QA 3HSDA 4DR2F 3EPIA 3R27A 3CJKB 3G8TA 1REGX 1B64A 1WHYA 2FDNA 1AZSB 4YN3B 4WCEQ 4PG4A 2BOAA 1YZ6A 2X1BA 3RU0A 1WORA 4QW9A 2IBKA 5IV4A 5A8WA 2LXUA 3HHNB 2BJ9A 1LW0B 1F9FA 2W7OA 1SIZA 4ANCA 4IOAQ 1NPKA 3G71S 4ZHRA 1B4SA 4B3SJ 1PCAA 4F67A 1IJFB 5KFJA 4PYDA 1H74A 3T41A 4GVBA 1PBAA 2QE5A 4AQYF 3T9ZA 1TAQA 1C1BB 3PW7A 2DHSA 2FJVA 1WF0A 3CJTA 2ILYA 3V81B 3NG8A 2LCWA 4A47A 2IYIA 2B0GA 3OXFA 1T95A 4DQPA 1VK8A 2EK6A 2RQCA 4C11A 1UJ5A 4R0JA 2HBRB 2HHUA 2XMTA 4ZN3A 1H2VZ 4DR7F 4QR1A 4Z7YA 2R7SA 3EGNA 2YH0A 2H5EA 4I6WA 3JTNA 4NLYA 5J2PB 2VKRA 1Y5NB 4CLSA 4QWDA 1VC5A 3TA0A 1FWPA 4C97A 6AT1B 2CQGA 3W9IA 3BH6B 4X65F 2K3IA 2IM0A 3M1VB 3R7BB 4CDIA 4P74A 2W8KA 2FY8A 2Y3YA 1N48A 4X4VA 3CVKA 4F7VA 2O66A 4QWEA 4WIIA 1NNDA 4CCHA 1C4AA 4YS2A 4Y3CA 2VPWB 5DGBA 4QU6A 4TY8A 4FBTA 1TL1B 3FCWA 3CMES 2HKEA 1T03A 5DDRC 5ADZA 4P71A 2ASYA 5HP1A 1L3SA 3GE9A 4YB5A 1SC3B 3OL9A 1FEEA 3RUBL 1I94F 2YBVA 4J9UE 2BJEA 4DPWA 4I0WA 3EXYA 4DUZJ 2UUCJ 2OGUA 1APSA 5C5JA 4UOFA 2UVVA 3L09A 4CWBA 1HNXJ 5J2QA 4KPCA 2PT0A 4W90B 5CABA 1FDNA 4L3NA 1HARA 2FPHX 1ZPWX 3LP0B 4JI1J 1HL6A 1P1LA 2BJ3A 1RT2B 3ET6A 1SL0A 2DR6A 3NBPA 2E7WA 4GKJF 2YPYA 3MFIA 2WOMB 2X1FA 2A0FB 4OHXA 1VFJA 1FD2A 3Q8UA 4G1QA 4KBIA 2MQPA 1MN9A 3D6FB 4RBUA 2C3UA 1VQOS 3VAHA 2XQCA 2LA6A 5C25B 5E7OB 2JHEA 5DQHA 4WYLA 5B0AA 4UW2A 1VDHA 5DM6Q 2EVZA 3D4JA 1HD1A 3KLFA 4PG6A 4M5HA 2C2ZB 2JSXA 1W2BR 2ZC3A 4HHJA 1CEZA 1MU2B 2HQFA 3NNAA 2PI5A 4DR5F 3UO0A 1WEXA 2RJZA 1YTYA 1Q7YT 2KRRA 4OJ3A 3FC9A 2XULA 2AU0A 3MEEA 3DCAA 1YJTA 2CPHA 4N5SA 1FX4A 1U7LA 4CO5A 3H7HB 2GO8A 1T9TA 3W62A 2VFSA 3KK3A 3V6JA 1YRTA 2KT3A 1LW2B 2DRAA 2UUBF 2YKNA 3MM8A 2CAJA 4DG1A 5RUBA 4PG7A 4OZ1A 3QRRA 4B3MF 5C2GA 3KXDA 1FESA 3F41A 2HNYB 3GSIA 1S0NA 4Y2IA 1KLMA 3GFZA 1R0AB 3EGZA 3MOJB 2Z2MA 1NJZA 3BGFA 2KVQE 3SQGA 3AHPA 4MKYA 3P49B 1QVGR 1TUVA 2AJ2A 3TAPA 5H9EJ 5F0UA 1T8EA 2OFHX 2J9EA 1U0SA 2MKIA 3TVKA 2CQPA 2MKKA 1JB0C 4F4YA 4DJBA 3PR4A 4K4YA 2YNGB 4DF4A 2GJFA 4A8YA 5D0HA 2RU3A 1SJFA 4OI1A 2AEMA 2W2NP 1FJEB 4WYWA 2GHWA 4IG3A 4ES1A 1JLAA 3MM9A 1S57A 4EWTA 3I55S 4LQ9A 3V4IB 5D77A 1ZTWA 2R2SA 3OHAA 3FBCA 4ED4A 3D1HA 4NLPA 2B8PA 3BO2A 5LJ5Y 5F8JA 2V4QA 2MHNA 1VLYA 3H5SA 2YKMB 3M2VB 2PMHA 5CD4H 1FXDA 1HWIA 3GJRB 2Q3PA 4QCLA 1GX6A 1LXNA 3DYAB 4RLEA 2Y1IA 3CCVS 1WACA 4DHVA 4DV7J 2BYCA 1M5HA 2KFYA 3H40A 5A0YB 4F4XA 1X9SA 2V8GA 2V2ZA 3W7BA 3LWLA 3BKFA 1U2CA 5B08A 2PN6A 3HSGA 2EFGA 4MK8A 1GX5A 2R7QA 3H4DA 3W2WA 4MKVA 1FXLA 4ZDNA 4U96A 1LWCB 3N6NA 1S4FA 3QATA 3NAHA 1PO6A 5HATA 4HHHA 3R6LB 1QSLA 2VUGA 3PCOB 2NS1B 4QPTA 1SL2A 4RUAA 5CH7B 2R8IA 1SKRA 3VCDA 1UVKA 2MSSA 1YITS 4AXIA 2BV3A 2K7JA 1WEYA 2MQLA 3T6JA 2QX0A 3DOMB 3I5CA 2BQ3A 1U24A 3ONQA 3KK1A 3OTCA 2DGTA 3DRPB 3I4HX 5IS2A 1BQNA 4C3MA 3SIPB 3TI0A 3G6VA 1REVA 1CBKA 3DLGA 2RU9A 4NLVA 4PYAA 2XMUA 5KT2A 4M63A 4HH0A 2QTWA 3T1HJ 1BWVA 2DH9A 2XHCA 2V8VA 1DTQA 4X4OA 2R7VA 4CYUB 1WC6A 4LF9J 4DR2J 3BGRB 2VICA 2QA4G 2XM3A 3JTOA 2HYIB 4F4KA 5BYSA 2PFDA 6FD1A 3ELHA 4TU7A 3OLBA 4B02A 4F3OA 1HBNB 2M5YA 3B4MA 3IBWA 1HA1A 3KUEA 1VQSA 4LR8A 2DNPA 4XPEA 1R8PA 1CJTB 3CMQA 3BGUA 4DUYF 2VH7A 4H4OA 3GIMA 3K5PA 5H9FK 4K59A 2DR7A 2BZ2A 5DG7A 2R9LA 3OQ2A 1DHMA 1WF1A 4PEOA 3KMQA 2DNZA 4CNYA 2E5JA 1V9OA 3EM1A 4O3RA 2HAFA 2AV5A 2KHCA 1KQSR 3LA0A 3DI6A 4AQYJ 3FMBA 3BH7B 3E01A 2NSCA 1SBRA 1YJVA 3UVJA 4Y0FA 5KFUA 4DL5A 3PW2A 3NGSA 3UQSA 3HSZA 1EP4A 1R6VA 1BGXT 4M5IA 2J0SD 1XN9A 3Q8QB 3ENVA 1K9MT 4DMZA 1RACB 3KDNA 4B9VA 3KJVB 1X5PA 2QT7A 3HKWA 2EEYA 2KFZA 3HVTA 1NHUA 3BPSP 3NOCA 1EKSA 5KFKA 4G1IA 4YR2A 1O51A 4QJVA 4TNOA 4IQMA 4B08A 5E2QA 1PILA 1IBMF 5I3UB 3FUYA 4C3LA 2EW9A 3U1MA 2KDOA 1SV5B 1QD1A 1QAYA 1DLOB 5L1JA 4N47A 4X65J 2GMHA 4ZVOB 2MY7A 3GWCA 2R7XA 3MECB 5LMNF 4L76A 3J81U 2HBYB 1XNRF 2MQMA 2XTJP 4J91A 1RJJA 1UL3A 4LF4F 3M05A 3FSIA 4QWBA 1ZM9A 3QWPA 1SJ4P 3CWJA 1S97A 3J81j 5I3QA 3M8RA 2LQJA 2EFVA 2OPQA 1YJRA 3CD7A 4ZVQB 2CQBA 3WIUA 3KNAA 1KRPA 4RNMA 4X4QA 4KFBB 1UZDA 1I94J 2K3KA 4ERDA 3EGWB 2ZH3A 1IBLJ 1VRTB 4ED7A 4ALZA 4KHRA 2DPJA 1VQMS 4WFXA 2IHR1 3SI8A 2F8MA 3CDUA 3TX0A 3W60A 1Q8LA 3FRYA 4OJHA 1T3NA 3GFXA 1GMWD 4NASA 3SCIE 4WFAQ 4ETXA 2CJAA 1ICEB 4ZK7M 4QIVA 4XDCA 4GKJJ 2PGCA 4DQSA 2G9OA 2BKNA 1U1PA 2HBZB 2N4DA 4RW8A 5FJ4A 4A8FA 5B0CA 2F3JA 1RT4A 1U1RA 4ZHRB 3X3UA 3H4BA 4F3QA 2UXDF 3QWUA 1RT3A 3N6MA 4KPYA 3PHEA 1MROB 2CPZA 1CS4A 4DR5J 3DRSB 2I2YA 1E6VB 2KXFA 5ETLA 2B7BB 3T5HA 4FXDA 2CG4A 5CD4A 4FVCA 2JRSA 1GT8A 3L95X 3ZNJ1 4Q45A 4O4GA 5I3PA 4OZJA 1NJWA 2UUBJ 3AFGA 3JXOA 4C11B 5F3TA 4FDFA 3QJPA 1P8GA 1R7IA 4UZCA 4B3MJ 3Q8YA 4TQRA 2HVHA 5J1EB 3Q86A 5DJBA 1X4HA 2GVZB 3I87A 2V8DA 2V69A 2D3UA 3WIVA 3GJQB 2HLTA 1H73A 3TR5A 3OTBA 1YSJA 1S6UA 2PA3A 2JFKA 3HCXA 2VFRA 2HRUA 5DG8A 1TK5A 2YNIA 3DU5A 3JSMA 4DX5A 4H4KC 2GGPA 2MKCA 1F5CA 4N7TA 1NO8A 1JLEA 3U1NA 2HVEA 2J7WA 3BZQA 2JEJA 2C42A 4LF2A 4I67A 1NRKA 2BRLA 4TY8B 1XJWB 3MM6A 3MPWA 4UY8T 3WHIA 1EKRA 2BOPA 1WSVA 3CC7S 1T03B 2AJFE 4RW4A 2CADA 4USUA 2RF2A 3TW0A 3G6YA 4KY3A 4ANDA 3W63A 3ILLA 5BJRA 2XGPA 2HFOA 3H42A 5LJ3Y 4QZVB 5K9FA 1JMTA 3Q8RB 5LXRA 2ZBIA 3R5CA 4NZ6A 3EDRB 2ZZNA 2UVRA 1DTTA 5J2QB 5E3QA 2VF3A 2R7TA 5ETTA 2G2OA 4Q8EA 3TQ1A 2WZ1A 5HN0A 4TQSA 5L8RC 1EHWA 4F50A 4FS2A 3ET6B 5HMWA 4ZP8A 3NBPB 3EVWA 2QYCA 4ILLA 2IM1A 2RB7A 4G1QB 5ETVA 4RWXA 4M5MA 3C14A 4QIEA 3CXCR 3N9UC 1U1QA 2VONA 1BMQB 1AT1B 2FJXA 2XI2A 4MFBA 1HD0A 4OI4A 4DV0J 2VBYA 4DFPA 3KLFB 4LQ3A 4Q0BA 3GFYA 4YDXA 2NREA 2OH2A 1ZA1B 3A3PB 4YR0A 1N6QB 3G96A 4PRFA 4GVLA 3CCRS 2ZDOA 3MEEB 4NXMF 2V4RA 2BEFA 2HPUA 4PCQA 2GMLA 3FQKA 2DO0A 3VQSA 2B51A 1MN7A 3KK3B 3R1LA 3RB0A 1TZ0A 1SJ1A 2YKNB 3MM8B 1TKZA 1N54B 1O6XA 2Z0GA 3P4UB 3QJLA 1IM6A 4NEYA 5L46A 1KLMB 3M6WA 2ZOMA 5JMNA 2CNLB 2IVMA 2MLYA 5LXYA 3Q2TC 3IP0A 1VI7A 2P8IA 3SQGB 3US5A 1SQFA 1TK8A 4RU2A 1SJQA 5DGAA 5FLXU 3MR5A 1OSCA 1S7HA 1CQNA 1AFIA 1X5SA 3OJUA 3C6UA 5F0WA 2DHXA 2VOOA 2QZ8A 3PJ9A 3AJ1A 3HD2A 2VFUA 4L72B 1UVMA 3KYLA 4DZDA 2G2YA 1EZZB 1RT6A 2MQOA 4FPRA 3KLEA 1IBKF 1QUVA 1FWKA 5F8GA 4X62F 1F5AA 3PKMA 4DUYJ 3LTOA 4IG3B 4AUKA 1JLAB 3MM9B 4TN2A 2DGQA 3EX7B 2BXJA 3HJFA 2XB2D 2U2FA 4WIQA 1TVRA 3AB2B 3D68A 3HHLA 4NLUA 5KFIA 4K2XA 1HNVA 2PEHA 1UFKA 4EEYA 3HZGA 3RW6A 2CJ9A 3FEXB 3FSYA 3OV7A 2FJAB 4ID5A 2LP4A 4DX7A 2MLXA 3PW5A 1RAFB 4ZITA 3NS6A 2FVQA 3ULHA 2HVZA 3EWGA 4B3OA 5B0BA 3MR7A 3DGPA 4KGVB 5H9FJ 2BJ8A 2A1BA 2JEFA 4OIXA 3BBBA 3HJVA 1NB2A 3B4DA 2AMCB 3ZXWA 4V19J 2XEXA 4KYZA 1D8YA 4ZVSB 4ED6A 2P5VA 3PYFA 1IBMJ 3EPGA 2QMWA 2MHEA 8AT1B 3ADAC 3C46A 3B82A 3SSSA 1TKTA 1JNRB 4OHZA 3GONA 3MR2A 5LMNJ 6FDRA 2FD2A 4I2PA 1XNRJ 1EX8A 4OYBA 4LF4J 1WELA 4M8LA 3O2IA 5IT9Y 3C8YA 3CT9A 3I31A 3PACA 1U45A 5DZ6A 3R6GB 5HMXA 1UP1A 5IWAF 2QSFA 1TQLA 2ALZA 5L1KA 2IJRA 3W8PA 2M70A 4P75A 2R3VA 2RS2A 2IC3A 5KT6A 3GYGA 1RAJA 1DQ9A 2GJIA 2ZOGA 1T7PA 3KK1B 2C2KB 1WC4A 1HQEB 1BQNB 3M8QA 4OJ1A 2W25A 4NLGA 1REVB 1XQIA 3OSPA 1KC8T 1S0OA 2FUG9 2V94A 2W01A 3G82A 1DTQB 1HWLA 3JQMA 1HPZB 1N32F 4UY85 3KHLA 5H1SV 2GMJA 1NBEB 3WQPA 1F3FA 5B0GA 2LLZA 1KDNA 4FF2A 5EUHA 1O5JA 4WP3A 4F25A 4I2QA 4FN5A 2HNZA 1R6YA 3GYXB 2KYZA 3N6LA 1X4AA 1KS2A 2V2KA 5IOLA 2M4MA 2XI3A 1FTCA 2I38A 3S1TA 2RDDA 2VU5A 5HVFA 4ECUA 4J9LA 2UXDJ 4ZP6A 1AUSL 2VBXA 8RUCA 4C8OA 1GNKA 4C3KA 4ED0A 2ALYB 2CPDA 3DI6B 3RB6A 1KTVA 5DLGA 5J2NB 3E01B 3UVJB 3TO8A 3GZ7A 4BLGA 2XSFA 1B3TA 1NH8A 2DR8A 1WG4A 2CZ9A 3CO0P 1EP4B 1VGYA 1BXNA 4C98A 2ZVSA 2W9AA 2RQMA 4HTIA 1QTMA 3MAQA 4CLKA 3A3OB 3M8ZA 1FO1A 1DQAA 3DGVA 4WZQA 5BR8F 3QFWA 1TTHB 4DQRA 2FVSA 4BC9A 3HVTB 1S6QA 4K5RA 2DNYA 4BBYA 2BE2A 4QWAA 2HFNA 4MYTA 4AXJA 4WZMA 4DPOA 1RT7A 2DNGA 1KQFB 1O0PA 4E98A 4A46A 2HIQA 2R8HA 4OZLA 3BR9A 1IR0A 3LUYA 5KT3A 2GQQA 2VFTA 2XLKA 5GADU 1TKXA 2PEBA 3LO3A 5LSRA 3L9ZA 4IH5A 3ZTQA 1IQZA 3GCWP 3FFIA 3MMCA 3ZO7A 1T9YA 5DZ7A 4B9UA 3D1OA 4RU9A 4MJKA 3GV8B 2XMVA 1T9UA 1YI2S 3OHBA 2OPQB 3NCPA 3QRQA 3SBMA 5KOXA 4TYAA 1UETA 1CQMA 2ZNZA 3L7OA 1FE4A 3OUYA 5A2QY 3MCMA 4JYAF 3RGIA 3R7SB 4UUWA 3K89A 1D9DA 3BKUA 1TL5A 1RWMB 3CJ8A 2CVIA 4FVMA 1W25A 5HAOA 3G9CA 5B0FA 1RKJA 2ROPA 3HVWA 1ZZNA 3NNCA 4NOHA 2FGOA 2H51B 3HFVA 3UNYA 1SB6A 1QTNB 1N4LA 1QAJA 2DEIA 1FRLA 1TV6A 4DX6A 3MGJA 1RSCA 1RABB 2V8HA 4OV1A 1Y3JA 3QIDA 2QL5B 2QLFB 1EAYC 3KLGA 3V5RA 3BKTA 4CT9A 4C48A 2EPIA 2XWYA 3KUHA 4KKOA 5EWEA 4CTAB 1D8ZA 2R7RA 4JI3F 2AZ3A 4ELVA 1Q8KA 1S1XA 3PKYA 3HMJG 2ZJRQ 2ZJQQ 2J5AA 1IN0A 4C6AA 4ZKAA 4RW8B 1XEZA 3PFOA 1L5UA 1RT4B 2CNNB 4TKTA 1SXLA 1KD1T 1RT3B 1Y5IB 2VDHA 1YBTA 1Q79A 5KG7A 1RADB 1CS4B 2V4JA 2XCAA 2RKIA 2MJUA 4FXVA 2H9ZA 5KFHA 1XC9A 4NXMJ 5DG9A 5IT4A 5AJ3F 2GO9A 4MYUA 1TFWA 3CJ4A 4B17A 2IY5B 1K8AT 1X9MA 1IKXA 1H0HB 3CC4S 2HHSA 3VGVA 3PYEA 5E3CA 4IRKA 3M9NB 2FVPA 3ZZTA 2E7VA 3NCQA 5EGYA 2W1BA 2NYIA 1YDLA 3OL7A 1WJ9A 2DXEA 2B6AA 4LR7A 1SCJB 2ZFHA 4AL6A 2K7KA 1KVIA 2GJ2A 4E8UA 4NX9A 4RW6A 4YHHF 1S10A 3H90A 5B0DA 4XIUA 1S77D 1UJ6A 4ZMMA 4JV1A 4F2RA 1T05B 3T9NA 1X31C 2NXJA 4HKQA 2ILZA 1TELA 2ZJPQ 2ATLA 4NA2A 2YNIB 3JSMB 5IM0A 3EZOA 2LEBA 1WTFA 2GGPB 1JLEB 2BJ7A 1G2EA 1NMEB 1RXOB 1UVIA 4LBHA 3MOZA 5HBMA 1IBKJ 3FCVA 2MXYA 1S1TA 3EDQB 4ZA1A 2BRKA 4X62J 2NZCA 3I96A 2D9PA 3HHLD 3UWTA 3T5LA 4RW4B 4ZPWR 4C2MA 3EGVA 5LSLA 2HRYA 1WKKA 2DXFA 1FVQA 1RTHA 1S1VA 4URQU 2OLWA 5CAAA 4HEA9 4C8LA 3MMJA 2Y8YA 2RMLA 3ISND 1WKLA 4OYIA 1RAHB 5GAGI 4ZCMA 1VC6A 2YQ3A 4Q7AA 1DTTB 3OFHA 1YJWS 3OVBA 1R0BG 1B0TA 3J7A1 4ECZA 2LYVA 2Z56B 4QR2A 3CCQS 1FDAA 2MKHA 4DF8A 4N8NA 3K2YA 1X9WA 3PYDA 3MMBA 3GSDA 3A13A 2DR5A 1S1UA 3RRKA 3PZPA 3C14B 2AGQA 3K5LA 2D3O1 2W24A 1DQ8A 2E9TA 1JJ2R 3NLCA 2V63A 3G6XA 1K0VA 1U2RA 2E1RA 4Q43A 4YDDB 4OZ3A 3IXQA 1F60B 3P5TL 1SUQA 2AHOB 2OFGX 4LBPA 4Q0BB 1ZM3A 3ZZRA 3N4WA 1UFLA 3POTA 3MEKA 4KQZA 1OPZA 1ZAVA 3AT1B 3W9HA 5T14A 2MQQA 4QIFA 2HSEB 5IWAJ 3TANA 1HNIB 4MK7A 1FKAF 2WW4A 2AGPA 1GXLA 1RHKB 1TKZB 3SZ2A 3J81Y 4Y2CA 1JIHA 1OMSA 2FVCA 2N3OA 3SV3A 3UW1A 3K5OA 1H38A 3DC2A 2IRUA 3DOLA 2J9DE 1PJ6A 3MI7X 3NXZA 2YX4A 2ASLA 2IFXA 3KKFA 3V6KA 1V3ZA 3HHKA 3I0RA 4YY3F 4RNNA 3GIKA 2F9JA 4EFAC 4RBVA 3PR5B 1N32J 3RYLA 4JUZA 1KR4A 2CDRB 4FZVA 3QBCA 1J27A 1OJ4A 2IA0A 1RT6B 3WX8A 4CO1A 3GIJA 3OXLA 4DPUA 3HM9A 3D6HB 4F02A 3EICA 3SMZA 2IVYA 3OPKA 2DCUB 5HMYA 3KHRA 2J6TA 1R89A 2HW3A 1TVRB 3TX8A 5K8NA 5ETPA 1H7XA 3TP2A 3Q22A 3HHLB 4TXSA 3GV5B 1HNVB 3IRXA 4B3RJ 4I68A 4DV5F 1AFJA 4B9SA 3ZZPA 1RAAB 2RQ4A 5A6WA 1IR1A 4ID5B 2HGNA 2W9CA 2J9CA 1PYSB 1YBUA 1S4EA 2XGQA 2CA9A 4W92B 2YWWA 4DI6A 3OD2A 3QLHA 2MSTA 4B3OB 4OI6A 4TY9A 1D9FA 4YB6A 3RR8A 2DD8S 4J9VA 2G4BA 5CHCB 2HS0A 5BR8J 2HWIA 1G3OA 2YWGA 2E5IA 5M2PA 1YJ9S 4Z37A 4OZ5A 2JEGA 3NNHA 4O3OA 3IBCB 3VR1A 1U02A 1QJHA 3OBIA 4KO0A 3FBEA 1ZBTA 2Y1RI 4YB7A 1TKTB 1IM4A 4ZVUB 1ROFA 1ZAWA 3M6UA 4A4JA 3AXKA 4CLTA 3RW7A 4ECQA 2OMLA 4YUDA 4ELTA 2WHOA 1WC5A 1NZ8A 3DNCA 4NMXA 3ZNUA 2OEJA 2FLLA 1ZA2B 4CO4A 4DPYA 2NYHA 2VQFF 4U8YA 1HHTP 1RU2A 3CCJS 2IC3B 4ICLA 4ZPCA 4JYAJ 4GO5X 4JV2A 4JI5F 1FDDA 3S8SA 4NLDA 1VRQC 2UU9F 2X3DA 2QLWA 2ADCA 2UV8A 3M8QB 4OV6A 1HI1A 3D1QA 4GO7X 3G82B 3UPFA 2KTQA 3DDIA 2XY5A 2RHQB 5HK4A 4AYBD 4JV0A 2YXLA 3G4SS 4PWUA 3QSIA 4RW7B 2DISA 4FYDA 2J0XA 1HQ2A 3AOAA 1VJWA 2BW7A 2AX0A 5U47A 2VC1A 4JI3J 2HNZB 3M7VA 4DUZF 2AYGA 4LRAA 4P7VA 4NEZA 4NRTA 1KQGB 1D3WA 4F4ZA 2HQDA 2YH1A 4M94A 1ZS6A 4NYZA 3CCES 1PKUA 1RWUA 4UQGA 4QW8A 5KFEA 2CJBA 1UW9A 5E5NA 1GK8A 5AJ3J 2FLPA 4JBCA 2AJQA 2W4CA 4USMA 1EARA 3DRYA 5F8MA 1VRUB 2CJKA 4C9DA 1P27B 1CULA 1BD6A 1X4FA 3MWBA 1VHFA 4WFYA 1HWJA 1EIYB 4PZVA 4ILMA 4N56A 5DDQC 3MPYA 1WHXA 3AD9C 1NLKL 3JAMY 2MDAA 2DY1A 1S6QB 1U6FA 2IM3A 1KFSA 3D2WA 4YHHJ 2BE2B 4YFUA 4BCAA 4ES2A 3KLHA 4C8MA 3A3NB 2ASJA 3ETMA 3QNWB 4L75A 7FDRA 2HHXA 3CDBA 4CH0S 5ITHA 1TKXB 3CJ0A 2KM8C 2RHSB 4A8QA 3VWSA 5H9EK 2C3PA 4IH7A 3WBZA 1QSYA 3A8IA 4U7UD 3PX6A 3VVUA 1R31A 4EYIB 4CT8A 3NWGA 3AODA 4IKAA 2ZHOA 3OUYB 2NXNA 4NMLA 3W3SA 4MIWA 3VAMA 2AD9A 4R8UA 2W9BA 2E5LF 3MZIA 2BACA 4MK9A 2FY1A 5JXSA 5F8LA 3K57A 2MZSA 1VBKA 1XMOF 1RISA 3HT3A 4NLTA 3PX4A 4CRJA 3CDAA 1KFDA 3SFUA 3OW2R 1L3UA 1S9EA 2P6SA 3D0HE 1G4CA 3JTPA 4P73A 1IXKA 4ZLLA 3IG1B 3SCLE 1TV6B 5HJYA 2LQ9A 3LWMA 3QIPA 5C7PA 2DNMA 2JJ4D 4ZIWA 2ZH8A 3M6VA 4ZPTR 4EGLA 2HHWA 2MGZA 1OPIA 2ZDPA 4ELUA 3M2RA 4KKOB 1UCNA 3A8EA 4CO3A 1S1XB 1KP6A 2YNFB 2I6WA 2CQ1A 1OYDA 2CQ2A 1S5ZA 1TU0B 4J9SA 2OIHA 3D66A 3RG6A 2PMWA 3BYRA 1NKEA 4TLQA 2BQRA 1CJKB 4NCGA 1A9NB 2FZCB 4LREA 5A6PA 3DRRA 2V4JB 3BREA 2RKIB 3TEGA 2BE9B 1U0HB 5HJXA 3TNVA 1PAEX 2DGOA 4KJIA 1DZ5A 1FFGB 5KFWA 1A7GE 5KFRA 4DN0A 4I7FA 4J9PA 1D1UA 4KH1B 2CXEA 3CJ3A 1OYEA 2KXNB 3OTDA 1Q86T 2JVRA 4EO8A 3IBFB 4F4AA 1YZ7A 1JXEA 1SQGA 1HW8A 5E33A 3OR2A 2DHHA 2HHTA 1IUJA 2B6AB 2IYGA 1S12A 3RRGA 2UUWA 4EYHB 2Q43A 4GKKF 4RW6B 1NSKL 2DHAA 1FRIA 4RKUC 4C0HA 1UWAA 4RNOA 2NUHA 3TZZA 2RUGA 4ZVEA 4YY3J 3G86A 3N28A 1ZH5A 3I0SB 4QOTA 3AB4B 2VKZG 2DNLA 5KFYA 2M8HA 3DKDA 4NCBA 4ED3A 4DL7A 4GC6A 1FDBA 5IM0B 1K0TA 1U47A 1UA1A 5C42A 4LSLA 2BANA 3H2VE 3KK2A 2PI4A 3TVZA 1X5TA 3IS9B 2Z58B 3UCUP 2UV8G 1IJEB 2H65B 4KGKA 5HBMB 1J2VA 3FJ2A 4P10A 3M8PA 1YG0A 3CNQP 3VAIA 3IM9A 2YKQA 1SH2A 2PO4A 1IBCB 3T1HF 3M8YA 5G0RB 5F3ZA 5ETKA 1NJXA 1TAUA 4AD6A 2EI5A 2GFFA 3GJSB 4DV5J 2XZDB 1U4BA 3BO3A 1VJQA 1GAOA 2N7CA 5D8HB 2E44A 1NJYA 1RTJA 3MUVP 3HVAA 1FNOA 5F41A 3TZXA 3OTOF 1N5SA 4JI8F 3LGMA 1J5OB 4V1Ak 4DWIA 4URGA 1SH3A 2OSRA 3DFEA 5IC4B 3SFGA 2K06A 4ECVA 3LAKA 1EETA 2D7SA 2BW2A 3BSCA 4H4MA 2DY9A 1TUWA 1Q53A 1U6ZA 3ENQA 4DQIA 2C2NA 2G13A 3C19A 3W66A 2XHWA 1Q4RA 5JJBA 4LT6A 4DR6F 4DSIA 2JH3A 5E0OA 4J37A 4IG0A 2Y0SD 2XLJA 3FZ2A 3C66A 5GMDA 2LDYA 1RBAA 4NLOA 3AJ2A 3FZBA 3ENWA 2NXCA 5F8IA 5J1NA 2LXFA 1SUQB 1YJ7A 3CJQA 3QZ8A 3POTB 3MM7B 3Q24A 1Y00A 1OSDA 1K1SA 1FCAA 2VC0A 2IDEA 5HROA 1B0PA 5KG4A 5E3RA 1SVDA 5KFSA 2DIVA 1VC0A 5GAGU 4MIBA 1FE0A 4A8OA 1HLWA 2VQFJ 1M0SA 3NMAA 3JYTA 4USVA 4CLYA 3NGTA 3NGDA 5IT9U 4MKBA 1N0VC 2D41A 1VLOA 1IKWB 2JC1A 4JI5J 3B8HA 2HHVA 3H0PA 3FNNA 2V34A 1FT8A 1T11A 4W98A 2UU9J 1YKWA 3V4MA 4OHWA 2LA4A 3MURP 5BYQA 1VQLS 3DOLB 3RAMA 3OR1A 4P6QA 3TA2A 1Y7PA 4YMEA 3BS9A 3CCWA 2J6SA 4TU8A 3I0RB 3T19A 4ER8A 3KG1A 1NKCA 2M88A 3MHYA 4CP5A 3C6TA 4HDHA 2I5JA 3FEZA 1RYRA 1FK9A 3BM7A 1Y11A 2MZ1A 2F5GA 4EO6A 2P9EA 2VPXB 2KN4A 3BQ1A 5KG5A 2DRBA 2QA4S 1IBLF 5E41A 2RRNA 4ILRA 1RWPB 2JC0A 2FHMA 1H3DA 3RZAA 2RD5C 3KFWX 1GH8A 1QE1B 4C0OC 4O44A 1NK6A 2XMAA 5HVHA 4ZLNA 4KT0C 1MMNA 5K5MA 1RAEB 1UTAA 3IRXB 2CQ3A 4OX6A 3MDFA 4LF1A 1VQ6S 4LRFA 2Y9HA 2QSWA 4EZ9A 5CYJA 2NXUA 1HQUA 1WHVA 1SPBP 4F3MA 1NPPA 1GMWA 2VG6A 3HI9A 3T5KA 2ZH9A 3QLHB 1MWQA 4DCJB 4KC5A 3GTYX 2HHPA 2LEPA 1H6KX 1UZHA 3D7SB 3DLEA 2AIRB 4ZIVA 4Q5VA 1DFDA 3JS9A 2WK4A 1RAOA 4DCPB 1U1LA 3BN7A 3O6QA 2XY7A 4KO0B 2FVRA 4MIAA 3FBFA 1S99A 1C1BA 2ZZMA 5L9XA 8ATCB 2VG5A 1MLAA 1WC1A 5EWFA 2V2QA 2L9NA 1RT1B 2NR0A 4M1KA 4OX7A 1FNMA 4WXWA 1Q8IA 1LWEA 2VA2A 3TJAA 3QMQA 1OWXA 4WP8A 2F8HA 2RDIA 4ZVFA 3O3LA 3PYGA 2ZM6F 2XMMA 4DQQA 3BDEA 3W8GA 2R8KA 3QJJA 3A4TA 4WTYA 5CZVA 3L7PA 2ZEJA 4KE5A 3J80Y 3R7NB 2E5LJ 2FC9A 1U8WA 1SC6A 3X1LB 1FKOA 1XMOJ 5A2QU 4X4UA 3PRBA 1KONA 2CWXA 3EZUA 1OS5A 2B9YA 1NSPA 3IGNA 4RZRA 5EN1A 4EI2A 2J7KA 4CM2A 4DZ6A 4CQ1A 1BUXA 3UR0A 5A8RA 3DDKA 3I9ZA 2IDLA 3BSOA 1TL1A 1JLQB 3MPVA 1NK9A 5FDLA 1HKAA 2M0GB 2VBWA 4F2SA 2UUAF 3CC2S 3CDEA 1GXUA 1HMVB 3UN3A 3K58A 3GU0A 3I6PA 5EHHA 2JVOA 2QFJA 1U09A 2APOA 4OLOA 1S7IA 2FQQB 1H7WA 3HPOA 3ILIA 2MPUA 2OI2A 2IBOA 3PHTA 2CQHA 2QFIA 4F0MA 3IA0A 3DXBA 1VBYA 3DLBA 2W2PP 4DL3A 3CTRA 3MEDA 3KWMA 2GVDA 2HS3A 1SI9A 3TEHB 3PTWA 1N5YA 3HFKA 1RB0A 3LP0A 2ZH1A 4R0EA 4DL2A 3AD7C 2WRMA 1RT2A 4ETZA 4LRDA 4HH1A 4FXWA 5KFCA 2AJ1A 2WOMA 4DR1F 2HHHF 5IZHA 1HHSA 1AYEA 3PIPQ 3Q89A 3C16A 5F9NA 2O67A 5K8OA 1W26A 1UFWA 4RW9A 2GAHC 2PE8A 5C25A 4DV0F 1D9AA 3CCMS 2GAGC 2H4WB 3JSYA 1U2FA 2QL9B 2AKWB 3PIOQ 4GKKJ 3T1YJ 3I5BA 3ZZZA 3KLHB 2WONB 4ECTA 2C2OB 3EVOA 4K4XA 3F73A 5D4NA 4K4WA 2HHQA 1YRUA 3HVRA 2LU2A 2HRTA 2GZOA 2XO7A 4MAKA 4P2SA 2M9KA 3MAAA 4KV8A 4ZPDA 4OYWA 4HYKA 3FK4A 2OPRA 4P2FA 2KYXA 3RR7A 4OQJA 2HNYA 1W7WA 5LT5A 1RBOB 4USJC 5DQGA 3PO4A 1WTBA 2ZOFA 4ZP7A 4CM0A 4R8UB 4PPZA 3JB9k 5LL6d 5GAEU 4LRBA 1TL3A 4RNHA 1S9EB 2HG4A 4PR6A 4QBUA 4ZJLA 4LVNP 1B0VA 4KGMA 3OTOJ 4JI8J 3KHGA 4NLRA 3EYZA 1FJGF 5F8HA 3NAIA 3EXCX 3U02A 1HBMA 2W2QP 2ZE2A 2MGZB 1QLNA 4F04B 3M2RB 4G65A 4O23A 5GADI 4DR4F 3NRBA 5B0EA 2HMIA 1CC8A 3QPIA 1U1MA 2DGWA 4BWJA 4DR6J 3TZWA 3BV8A 4DS4A 5L9NA 2WVCA 4W4MA 2VA3A 3DM2A 1YBAA 1WKJA 1GTHA 2MZJA 1HYSA 4NCGB 1NJIT 1IVZA 2H3EB 1QY7A 3DRRB 1NDLA 5IC6B 2K8GA 4WPAA 4OYXA 3RBZA 4IUFA 3FKBA 1NSAA 5D4PA 2CFXA 4DV3F 3DMJA 5BYRA 4DV2F 3T6BA 4WKRA 2NSBA 1P9QC 2B56A 4I7FB 4CLPA 4DSJA 2HQGA 3N01A 4DU7A 2LQ8A 1NM2A 3QT7A 2VDIA 2LU1A 4DDFA 3OR2B 4FYYB 1J5EF 1Q16B 2CQDA 4FKXA 2ACMA 3ZTPA 1TK0A 1M1GA 2DGXA 3MEGA 3AA8A 5ETOA 1B70B 2A6OA 1VQ5S 2YKPA 2MZQA 3T1AA 4WFZA 3DLJA 2ZHAA 4N76A 4P9SA 1YJNS 3KTQA 1C0UA 2YKOA 1ZM4A 4CO0A 4USTA 1OO0B 2QMUB 2J9DA 4QIWD 1JKHA 4CLWA 2BANB 3D67A 2LECA 3KK2B 4MH8A 4PUOB 2OD6A 4YEAA 4XK8C 2GIFA 4J5OA 1VYAA 3PM9A 3KG0A 1LWFA 3M8PB 3RRHA 3ZZ0A 3C15A 2EG1A 3HT0A 3Q0AA 4QWCA 1S49A 3MTKA 4YOEA 2HURA 3AJDA 1CJUA 2L41A 4DSFA 1RHQB 1JLBA 4ZCKA 3MUTP 4NI2B 2E5GA 2IMOA 4G3IA 3R8YA 1KKHA 1W2IA 2GCFA 4GRSA 3EZ5A 2Q6BA 1FJCA 2WBMA 3UCGA 1AUDA 3IO1A 3MMAA 1RTJB 1U1OA 2RAQA 4X4NA 4LF8F 2ZWPA 1RAIB 1CJTA 2Y8WA 1VS3A 2HWHA 3R5GA 4QYRA 5A8WB 1N56A 5HI7A 2FZKB 4ZVGA 1EETB 1V5IB 4IRDA 4H4MB 2P6TA 2F7VA 3D5MA 3DN9A 4HT5A 2IRXA 2OPPA 3E3XA 4FF1A 1NDCA 2HZAA 4IG0B 1NUEA 4C8NA 1JK9B 2AF6A 3MD1A 1FWLA 4GVBB 3M8WA 4OJGA 3K8VA 2AYBA 3GIIA 4ZLPA 4UOCA 1HBUA 1UAWA 2E1CA 4X64F 5KFBA 4BHQA 3VVTA 5JUMA 2DNRA 2MY8A 1XTZA 5M2RA 2EBGA 3FMWA 2QEXS 1JNZB 2R4FA 5IQQA 2CJQA 2HBQB 2DK2A 3LQVA 5DM7Q 1RDRA 3LP1A 3IAM9 1NB7A 4CNZA 2VD3A 5HLFA 1RUSA 1N36F 1S79A 4RR5A 4IDKA 1G6BA 2ZM6J 4O3SA 1S48A 1H2UX 5I3UA 3HP6A 3W5ZA 3IFEA 2UXCF 4ENOA 3W61A 4WBFA 2QMXA 1F6TA 3MPUB 1NK8A 2XCPA 4UUXA 3AOCA 3OR1B 3AY0A 2GX8A 3FEYB 3H98A 3E8OA 1XMBA 4FYXB 2V8PA 2AWZA 2UZAA 4WK3A 2DH8A 3R5DA 2B4OA 1NK5A 4DUTA 2VL1A 4ZPBA 1ZM2A 4J9MA 1VBXA 4BDPA 1URRA 1MW7A 3GILA 1SQEA 2DH7A 3OXGA 1M90T 5AE1A 1M5OC 4LF6F 4JB8B 4USKA 3VF0B 3HKZD 2WSCC 5KFQA 3C6TB 3SSQA 3GFHA 4WE1A 3THTA 4O3PA 2I5JB 4NA1A 2UUAJ 4DL6A 2CUYA 5HP1B 3JQKA 4KFBA 2DKOB 2F1FA 4ZCLA 3W5XA 4PG8A 5AE3A 2ZHBA 4DSKA 1CG2A 2Q66A 4ZVTB 3FBBA 2FLOA 4URSA 2HZCA 4LSZB 1FRHA 4OYZA 1TUGB 2M2BA 2WB1D 4OX9J 4O44B 2IAJA 4Y34A 4O4RA 5CYMA 3VGTA 2ASDA 3M6XA 3MR6A 3PFEA 5B7WA 3CIZA 1ZAXA 3V6DA 3GLJA 1TL4A 3R1HA 4Y2AA 5D3GA 1FRJA 2ZKUA 3Q8VA 2VHGA 1HQUB 2OJ3A 5KFOA 3D28A 3KDOA 4HDGA 4DR1J 3PRVA 2HHHJ 1ELOA 2RRBA 2VG6B 2C3MA 3I32A 2RDJA 2BABA 2HNDA 3P96A 1Q82T 1HNZF 2DT9A 2MZRA 4RO0A 3BGOP 2FGCA 3CO9A 4I69A 3DLEB 4A8MP 1VOMA 2MMYA 4K50A 1H2TZ 2RUSA 2YTCA 5KTQA 1X0FA 3KMSA 2R2UA 2XS7A 1MROA 4I1TA 4H4KA 1U25A 4CO2A 1RA6A 3DRSA 3JAMU 1WUUA 1E6VA 3MCSA 4IR9A 2HK2A 3I5AA 1YIJS 4DL0C 4I4BA 3BR8A 1Y10A 2VG5B 4DPTA 5KG2A 1EQ0A 3LF0A 2DR9A 1I51B 3J7AN 4ZVRB 3MUMP 2FZGB 1VBZA 1LWEB 2X1GA 2YY3A 1U48A 5DS7A 4DG1B 4ZN1A 3IR7B 1T9VA 2H5IB 2AT1B 3MF5A 3HSJA 3QO9A 2HQIA 5J1EA 2C3YA 1G7CB 2GVZA 1WOPA 2KB2A 3SQOP 4WF9Q 1X4GA 1VQ8S 2HGLA 1T9XA 1P6TA 2ZH7A 2AGOA 5D78A 1FKOB 1F5BA 2F4VF 2MTLA 4NRUA 3M2UA 3GYNA 2XS5A 3NGRA 1PIEA 4DX8H 4X66F 3HHEA 2E9ZA 2EC2A 2N7YA 4K0KF 2P2CB 3VTIA 1LFPA 4F26A 1GEHA 2ZUAA 5A8RB 1FF2A 1MSWD 1GTEA 3SDEA 2M52A 2WSEC 2IJNA 2D9OA 4AE5A 1HBOA 9RUBA 1UPMB 2FTRA 1FJGJ 1A6LA 3N0VA 2CPIA 5FDLB 1D0EA 3EE3A 2CJXB 4DR4J 2EWHA 4DV1F 4OYMA 2HVIA 4OYOA 3OL8A 4ECWA 1NDKA 3CJSA 2C3OA 4ZJQA 1U6BA 3IAS9 2ATCB 2XLIA 2FJDB 3P45B 1PSDA 2X1AA 4ED8A 4ECRA 5DRKA 3MEDB 3SSRA 2GVDB 4PKDB 4XTTA 2AEJA 3CGIA 1N5YB 3RAQA 2EKNA 4DV3J 4DV2J 3JQJA 3M32A 2L9WA 4M5DA 1WI8A 1NZAA 3GIRA 5GMKa 1SKUB 1S9GA 1LOUA 3C16B 3TAMA 1RA7A 2R2RA 4RW9B 5AXNA 2DTJA 2DRDA 4L74A 4WFNQ 1J5EJ 1VCTA 3W2WB 5EX3A 5DLFA 1UMJA 1WSRA 3K59A 1N6QA 1KNZA 1YGYA 2NZ4A 2D1CA 2K1RA 2PD1A 2B9WA 1RKIA 3FVYA 2JX2A 3L3CA 4DN9A 3IM8A 3EUNA 2DPIA 3MAAB 4TU9A 1N5VA 4KV8B 4X4RA 2RILA 2XYHB 3SV4A 3OVAA 2OPRB 2J8AA 2L48A 1L3KA 4H54A 2PA8D 2B4PA 4NLQA 3VZIA 4FYWB 2KT2A 3IGVA 2AYMA 3DLGB 1ACMB 4Q2LA 2J76E 2UXBF 1HR0J 1KVJA 2C28A 5JVHQ 4IRCA 3LPYA 2VG7A 5EDWA 1L3TA 2QN6B 5LM7E 1XBWA 4LFAF 2XNRA 1WWHA 4F0KA 3VALA 4KAIA 1TL3B 1Z2LA 2C1EB 2G0IA 3F0NA 1WG5A 1WC3A 1DBDA 1I1GA 2KKHA 5KT5A 3PRDA 4IFYA 1LFWA 4LF8J 2UUTA 2W7AA 1IWAA 4K2JA 5EWGA 2EKYA 3QRPA 4OHVA 2R8GA 1UEKA 2A6MA 4ECXA 2BE7D 1HBMB 2Q6CA 3CCSS 2Z2ZA 2ZE2B 1BQXA 4Q44A 4H4OB 4PWDA 4LBIA 4MT1A 1LV5A 4P2MA 2HMIB 5IT0A 5ETRA 4PXCA 3K7RA 4OI2A 3AH6A 2Z30B 3B78A 2E7XA 4I64A 3MFHA 4B3RF 3OFEA 3JSRA 1ULRA 1S0MA 4QIGA 2GNKA 1KN6A 3R5AA 5G4DA 3DM2B 4KB7A 3FCHA 2I8EA 1PJ5A 1HYSB 3DLKA 1M5KC 3S7RA 3GB0A 3H5UA 4X64J 4J7CA 1UWBA 3TOQA 2XZTB 2O1PA 2VFVA 1JWWA 4EK2A 1Q5YA 3KLIA 5A76A 2ZH5A 4C7QA 4YR3A 1Q78A 3DMJB 1JLCA 1X5OA 5AE2A 3Q83A 5ETQA 3LANA 1N36J 2JWNA 1F3VA 3O44A 2G1DA 1NKBA 2R7UA 3H5YA 1K44A 1Y0HA 1WG1A 2A2DA 4WU2A 1FKPA 2J8SA 2UXCJ 3G8SA 1AB8A 1WD6A 2DEJA 4M5GA 2JLFA 3HZEA 4QU7A 3EMTA 2OEMA 2CPJA 5D4OA 3MEGB 2DGUA 5T7LA 3DDNA 4NXNF 2XS2A 4JI2F 4ZPAA 2JDJA 1C0UB 4K4ZA 5HVGA 4LF6J 3MCOA 1M5PC 2XWXA 1JKHB 1KHVA 3IWNC 5L39A 2CVEA 2ZNYA 2C2EA 2HQ3A 1Q95G 4ECYA 1ZTTA 1VQYA 1NH7A 1LQ9A 3GJTB 2VPYB 3QAUA 2G0JA 1NCLA 4B9TA 1LWFB 3S6EA 1HQEA 3MM5A 4QYZK 3U1LA 3C15B 1FA0A 2EFPA 5SZTA 1FTRA 1CJUB 2R42A 4KR0B 2AEFA 1RWOB 2NXEA 3Q8SB 4PWWA 1JLBB 4DOZA 5L38A 2I9SA 1WDDA 2GS8A 2OSQA 2DGSA 3MPDA 3ITHA 1JXLA 5HMZA 2XG8A 1RTIA 2OTJS 1WHWA 2CPFA 5D6GA 3PDNA 1HPZA 2CWKA 4RBTA 3GPAA 4ZP9A 2OP5A 3MMAB 4WXOA 2BKOA 1TR0A 3D0IE 4BWMA 1UPPA 3ETOA 3QYYA 3S01A 1PYTA 1UEUA 2MKSA 3CUNA 4R25A 3TUJC 2FJWA 1RYSA 2ZBCA 1HNZJ 1B7YB 1RWVB 2HFZA 1T9WA 2PFFB 2KU7A 1I6JA 2UVWA 3K0JA 3DLLQ 4A8WA 1ZZFA 4LJMA 2OPPB 3P8BB 1RBLA 1WOOA 4HACA 3BN4A 5J2NA 3OTEA 4EU0A 2MKYA 1XNQF 3NEKA 1HBUB 4B3TF 3FSXA 3N5BA 1FRKA 3FQLA 4O4GB 1PAUB 2RIJA 1HI0P 2IRYA 2RH3A 1VQ9S 2ZH2A 3TWZA 1U1KA 3PEJA 3EJMA 3LP1B 5KFFA 2XMKA 3LW5C 4RUHA 4WJBA 2NPIA 4K7QA 5HLFB 4DR7J 2KZMA 2Z4PA 2EXUA 4R5PA 4IDKB 2XYPB 1YWXA 2DVIA 3BB5A 1QAXA 4F0HA 3V2UC 2BUNA 3H59A 1RT5A 1SIWB 1DY3A 3VV2B 1YRXA 1FRMA 1RTDA 3ENAA 2J0WA 4Q8FA 2F4VJ 2BA9A 1BC6A 2V6AA 4U67Q 2QC3A 3J80U 1NXIA 2EFQA 4UF4A 5DDOC 4X66J 1H72C 2I1RA 4K0KJ 2VASA 1ZYQA 2P9GA 3LGHA 2ZKTA 1VQPS 1N34F 2Z8QA 4DL4A 5GMEA 3MM6B 4WTOB 3SCKE 1X4DA 4WE1B 1L3VA 2RF2B 1U8SA 2DNHA 4LFCF 1E6YA 2ROEA 4DV1J 1RP5A 3VHQA 3BJYA 1VQ4S 1HNWF 4F4WA 1VQKS 3DOKA 2HGMA 3QGPA 2HS4A 2W4DA 2O01C 4Y6IA 5E3AA 4WP9A 4TLRA 2IAJB 4P52A 5CYMB 4J90A 4RUBA 3TYTA 3VZHA 1GMUA 2FIUA 3V6DB 3SYZA 5D3GB 2ZBPA 3DLHA 2UP1A 1TKDA 1IKVA 2V2VA 3NGUA 3BBCA 4PXDA 1PG5B 4CTAA 1WOSA 3W9JA 3HF5A 2HNDB 2CQ0A 3PNIA 1LXJA 2YX7A 3W1YC 1SC1B 4D3GA 3UE2A 2ZD1A 1JXVA 1X0PA 4MFBB 1SJ3P 1FRXA 4CLLA 3QFHA 2V50A 1WDTA 1FXRA 4X4TA 2VJUA 1IQTA 3MCNA 1T0TV 2PSZA 5K14A 1QUPA 2ZVIA 4ZVHA 2GQ2A 5THWA 4DPXA 1EB0A 2FHJA 5JVGQ 3QGGA 2WB4A 1GXTA 3PO5A 1YX2A 4DV4F 3QT6A 3R2DJ 3K8WA 5KFMA 1VR6A 4MTPA 2CRLA 2QO3A 1N88A 2J0QD 3QO9B 3HX9A 4HI1A 3P5BP 3R97A 2AYEA 1R8AA 1MWZA 3UR3C 5K8MA 2RNEA 4F36A 2D74B 4YB1P 4OYAA 1X60A 2DYAA 2UXBJ 2U1AA 4PQAA 1T05A 1KLNA 2HK3A 4KHMA 3IN5A 4NL5A 4LFAJ 3M2UB 3AD8C 2BJDA 3C6UB 3ILJA 3AA9A 3VAJA 1FI4A 5IFMA 1RWWB 4ES3A 1DJ0A 2PDAA 3RB4A 2V9KA 4MMOA 3VGUA 4N41A 2DCLA 3SDEB 3KLEB 1RK8A 3TUPA 1HBOB 3LH2S 1ZOTA 3G2XA 3ISZA 1CPZA 3VAKA 3CF5Q 2RS8A 2WCXA 1QM9A 1TP7A 3SEOA 4RX6A 5KT7A 2YQ0A 2BVZA 2XMWA 3DHWC 4L73A 1BQMA 2CDQA 4LF7F 1MNEA 1FEHA 3HFZB 2F8EX 4EBDA 4FBUA 4DFJA 4LUBA 2OPSA 1S76D
chains in the Genus database with same CATH topology
2PE8A 4IH5A 2POKA 1IQZA 3MMCA 3FFIA 3ZFVA 5C25A 4DV0F 4HI2A 1D9AA 1NEEA 1MMDA 1XR6A 5F9LA 3CCMS 3JSYA 1U2FA 4B9UA 1VRTA 3D1OA 4RU9A 1X4CA 3IRWP 2C2RA 4QR0A 4MJKA 7FD1A 3GV8B 1P1TA 3PIOQ 2XMVA 4YP3A 1TFYA 1YI2S 3OHBA 3M32B 4M5DB 3C3LA 3I5BA 2OPQB 4PXEA 5SUHA 3NCPA 3ZZZA 2YNHB 4ED1A 3KLHB 1B7FA 2WONB 5KOXA 4ECSA 4TYAA 4ECTA 1UETA 5KFVA 3UFCX 1CQMA 2ZNZA 3L7OA 1FE4A 4K4XA 3F73A 2OMOA 4LF9F 4J9QA 4K5SA 5D4NA 5FD1A 5A2QY 3OUYA 4DR2F 1S9GB 4K4WA 3EPIA 4JYAF 3R27A 3CJKB 2HHQA 1VIXA 3G8TA 3PV8A 1YRUA 3TAMB 3FDSA 3HVRA 4UUWA 1D9DA 2LU2A 3K5NA 1B64A 1TL5A 5M2UA 1WHYA 2XY6A 2FDNA 4OZ0A 2CVIA 4FVMA 2XO7A 4MAKA 4P2SA 1W25A 4WCEQ 3G9CA 3R5BA 5B0FA 2M9KA 1RKJA 2HLUA 4PG4A 2ROPA 2X1BA 4KV8A 3R3TA 3RU0A 4ZPDA 2NQPA 4HYKA 3HVWA 2OPRA 4QW9A 1URNA 4FNIA 2KYXA 2IBKA 4I2PB 3RR7A 1ZZNA 1X4EA 5A8WA 3NNCA 4NOHA 2FGOA 2LXUA 5B09A 2NLWA 3HHNB 4OQJA 2HNYA 1SB6A 5CYQA 3HHLC 1N4LA 1LW0B 1F9FA 1QAJA 2W7OA 1FRLA 1TV6A 1S9FA 1SIZA 1Y5LB 5CCLA 5LT5A 1PC5A 4USJC 4IOAQ 2GW8A 3MGJA 3G71S 5DQGA 4ZHRA 2K1RB 2V8HA 4OV1A 3PO4A 1Y3JA 3QIDA 1S72S 1WTBA 1NK0A 4KTQA 5GVQA 2KZZA 1R8CA 2ZOFA 4ZP7A 4F67A 1IJFB 5KFJA 1V6HA 3KLGA 4R8UB 3V5RA 2GV1A 4DBQA 3PY8A 3ISNC 4PPZA 2Z2LA 3MTJA 4CT9A 4U7CA 3JB9k 2QE5A 4AQYF 1HNIA 2EPIA 2XWYA 3T9ZA 4KKOA 1TAQA 5EWEA 4CTAB 1C1BB 2B9XA 1D8ZA 3PW7A 2DHSA 2R7RA 2FJVA 1WF0A 4JI3F 1RQ0A 5LL6d 2AQ4A 2ILYA 5GAEU 3V81B 3NG8A 1TL3A 4ELVA 1S1XA 2LCWA 3PKYA 4RNHA 4DEZA 1S9EB 4IFVA 4A47A 3HMJG 5A8KA 2ZJRQ 2ZJQQ 2IYIA 2J5AA 1IN0A 2B0GA 5F8NA 4ZKAA 2HG4A 4J9OA 4RW8B 1XEZA 2GIQA 4PR6A 3OXFA 1T95A 3PFOA 4QBUA 1L5UA 5KFAA 4LVNP 1B0VA 4KGMA 1VK8A 4DQPA 2OAUA 1RT4B 2EK6A 2RQCA 4TKTA 1SXLA 4C11A 1UJ5A 1HNWF 3KHGA 4R0JA 1KD1T 4NLRA 3EYZA 1RT3B 2C2DA 1Y5IB 1FJGF 2HHUA 5F8HA 1Q79A 2XMTA 3NAIA 2R7OA 5KG7A 3EXCX 1H2VZ 3U02A 2V4JA 2XCAA 1HBMA 4QR1A 4DR7F 2RKIA 2R7SA 2ZE2A 2MJUA 2MGZB 4FXVA 1QLNA 2DBBA 2H9ZA 3EGNA 3M2RB 2YH0A 2H5EA 4I6WA 2VG7B 3JTNA 4NLYA 4O23A 5KFHA 3NRBA 5GADI 4XPCA 4DR3F 1XC9A 4JI4F 4DR4F 5B0EA 2HMIA 5J2PB 2VKRA 4ZOSA 5DG9A 5IT4A 1Y5NB 1RGVA 3QAEA 4QWDA 1CC8A 1VC5A 1U26A 3QPIA 3TA0A 3UDLA 5AJ3F 2GO9A 3UD3P 4MYUA 1U1MA 5KFTA 2DGWA 2KRBA 4C97A 3CJ4A 1TFWA 4B17A 4BWJA 1K8AT 1X9MA 1IKXA 1H0HB 4A48A 3CC4S 2CQGA 2HHSA 4DS4A 1UVNA 3CE8A 5E3CA 4X65F 2K3IA 4IFYB 4IRKA 2IM0A 3M1VB 4C8ZA 2FJBB 5L9NA 3M9NB 2FVPA 3PX0A 4I2QB 3DM2A 3ZZTA 2VA3A 1YBAA 1GTHA 3M30A 2MZJA 3NCQA 3J7YI 1HYSA 4NCGB 4GC7A 1NJIT 1JLFA 2W8KA 3RB3A 5EGYA 1N48A 4X4VA 4OI3A 2NYIA 3OL7A 1QY7A 4QYZJ 3DRRB 3CVKA 2B6AA 2K8GA 2ZFHA 3LP2A 5C24A 2O66A 4AL6A 4L6V3 3G8QA 4RNFA 2K7KA 4QWEA 4PWDB 4WIIA 1N33F 1KVIA 2GJ2A 4IUFA 1NNDA 2YWHA 4E8UA 4NX9A 5D4PA 1C4AA 2Y1JA 2CFXA 4CCHA 4Y3CA 2MKJA 2VPWB 4RW6A 5DGBA 4DV3F 4YHHF 1S10A 4QU6A 4TY8A 4FBTA 3DMJA 5BYRA 4DV2F 1TL1B 3T6BA 1UEVA 5B0DA 4WKRA 2NSBA 4XIUA 1S77D 1P9QC 3GR1A 3CMES 2B56A 2V0NA 1UJ6A 1T03A 4ZMMA 1WI6A 4F2RA 4JV1A 4I7FB 5DDRC 1T05B 3T9NA 5ADZA 4DSJA 3N01A 4XAKA 2W4PA 4HKQA 2ASYA 2ILZA 3ZC4A 2ZJPQ 5HP1A 2ATLA 3GE9A 4YB5A 1L3SA 4NA2A 1FEEA 3OL9A 1I94F 2LU1A 5KFXA 2YNIB 3DLKB 2BJEA 3JSMB 5IM0A 4I0WA 2L9DA 2LEBA 3EXYA 4DDFA 1WTFA 2J7UA 1APSA 2GGPB 1UWBB 3OR2B 1LKZA 4JV5F 5C5JA 2N3LA 2R7WA 3MAHA 1J5EF 1JLEB 2F9DA 1Q16B 2UVVA 3L09A 2CQDA 1FNXH 3IC1A 2C22A 3KLIB 3GMGA 1TK0A 1G2EA 1UVIA 1T02A 2DGXA 3MOZA 3MEGA 3AA8A 5HBMA 5J2QA 1JLCB 1VQ5S 2YKPA 2MXYA 1S1TA 4ZA1A 2BRKA 2PT0A 2MZQA 5FIIA 3T1AA 1SL1A 4W90B 3I96A 1FDNA 4WFZA 2D9PA 3HHLD 3IWXA 4L3NA 4NPOA 3UWTA 5GAEI 3DLJA 1HARA 2FPHX 2PIIA 4RW4B 1ZPWX 4ZPWR 2ZHAA 4GMKA 1WF2A 4C2MA 4N76A 1YJNS 5LSLA 3LP0B 2HRYA 2BR0A 3KTQA 1C0UA 2YKOA 1HL6A 1P1LA 2XMJA 3ZZYA 2KVIA 1FVQA 1ZM4A 1ZETA 2E9RX 4CO0A 2NUUG 1RT2B 1OO0B 4DFMA 1RT7B 1RTHA 1SL0A 1S1VA 2J9DA 2XC9A 4QIWD 1JKHA 3NBPA 4URQU 4IOCQ 4AL7A 2E7WA 2OLWA 4GKJF 3MFIA 2GA7A 4HEA9 2WOMB 4C8LA 2EFOA 3MMJA 2BANB 2RMLA 1FKPB 3ISND 3H25A 2X1FA 1UA0A 1R43A 4OHXA 1VFJA 1FD2A 4G1QA 3KK2B 2LECA 5GAGI 4ZCMA 4KBIA 1VC6A 2MQPA 4MH8A 2IA6A 5DDPC 1Z4UA 3SCJE 1X8DA 2YQ3A 2OD6A 4PUOB 4Q7AA 4RBUA 2C3UA 4YEAA 3HK2A 1HI8A 4XK8C 1VQOS 1DTTB 4FNHA 4J5OA 3OFHA 3VAHA 3TAQA 1YJWS 5KFLA 3PM9A 4Y65A 3OVBA 3KG0A 1X4BA 2LA6A 5T7LB 1B0TA 3P3DA 1LWFA 3J7A1 3MMCB 3FFIB 3M8PB 5C25B 4ECZA 2DNNA 2LYVA 3CEDA 5E7OB 2JHEA 5DQHA 3ZZ0A 3RRHA 4WYLA 2EG1A 5B0AA 4UW2A 3Q0AA 4QWCA 5DM6Q 1S49A 2EVZA 3MTKA 2A3JA 4YOEA 1HD1A 4QR2A 3KLFA 4PG6A 3CCQS 4JOUA 2KT5A 2JSXA 2L41A 4DSFA 1W2BR 1FDAA 2MKHA 2ZC3A 4HHJA 1CEZA 1JLBA 1MU2B 3NNAA 2PI5A 4DR5F 4ZCKA 3MUTP 4DF8A 1WEXA 4N8NA 2RJZA 1YTYA 1Q7YT 2KRRA 3K2YA 1X9WA 2MQNA 2WTFA 4OJ3A 2AU0A 2XULA 3MMBA 3MEEA 1VMBA 1AXQA 3GSDA 4Y2KA 3DCAA 2E5GA 1YJTA 2IMOA 2PMZD 2DR5A 1N0UA 4G3IA 1S1UA 1W2IA 2GCFA 3RRKA 3PZPA 3EZ5A 2Q6BA 1FJCA 2CPHA 2WBMA 2AGQA 4N5SA 3KHHA 3K5LA 4LF5F 3UCGA 1AUDA 1U7LA 3IO1A 2W24A 3MMAA 1UVJA 1DQ8A 2E9TA 1RTJB 1JJ2R 3NLCA 4CO5A 3G6XA 1K0VA 1U2RA 2GO8A 2E1RA 1U1OA 1OQ6A 2VFSA 3KK3A 4Q43A 3V6JA 1R27B 1YRTA 4X4NA 2KT3A 1LW2B 3MM5B 4LF8F 3I82A 4YDDB 2DRAA 2UUBF 2YKNA 3IXQA 3MM8A 1F60B 2SXLA 4DG1A 3IR6B 1VS3A 2HWHA 3P5TL 4PG7A 4NLXA 4OZ1A 4IO1A 1SUQA 2OFGX 4B3MF 1SKSA 2FHKA 4QYRA 1LK5A 5A8WB 5HI7A 1ZM3A 5LSOA 1N56A 4Q0BB 1C0TA 3ZZRA 1FESA 3F41A 3N4WA 2HNYB 4ITSA 1UFLA 3POTA 4ZVGA 1EETB 3M9MB 3MEKA 4KQZA 1OPZA 1NHVA 3HLUA 3ITHB 2B4UA 4IRDA 1S0NA 1ZAVA 4Y2IA 1RTIB 2E1AA 3VAGA 1KLMA 2EC0A 3GFZA 4H4MB 4I56A 2P6TA 1R0AB 2F7VA 2Q79A 3TUZC 3EGZA 3GG0A 2O5DA 3D5MA 3MOJB 2Z2MA 3DN9A 4HT5A 2IRXA 2OPPA 3KLGB 1NJZA 3E3XA 4FF1A 5T14A 2XNQA 3BGFA 4XDDA 3SQGA 2MQQA 2G0CA 3AHPA 3O5TB 4NLSA 4IG0B 4QIFA 1JK9B 2AF6A 3MD1A 4C8NA 4O0IA 3TARA 3CPWR 4MKYA 2EK1A 2VODA 5I4MA 3CMAS 3TANA 4RW7A 4OJGA 3K8VA 3P49B 1HNIB 4MK7A 1QVGR 3GIIA 2AYBA 1FKAF 4ZLPA 1TUVA 4UOCA 3TAPA 1HBUA 2AGPA 1GXLA 1TKZB 3SZ2A 3J81Y 4Y2CA 1UAWA 5F0UA 1JIHA 5H9EJ 2E1CA 2I0XA 4X64F 1T8EA 5KFBA 4BHQA 2OFHX 5JUMA 1QVFR 2FVCA 2DNRA 2J9EA 2MY8A 2N3OA 3SV3A 2MKIA 3WC0A 3UW1A 1XTZA 3TVKA 2CQPA 5M2RA 1JB0C 2MKKA 4ED5A 2EBGA 4LIRA 3K5OA 3FMWA 4LSNA 4F4YA 1H38A 2QEXS 4DJBA 1JNZB 2ABYA 2R4FA 3DC2A 5IQQA 3PR4A 5L1IA 2IRUA 2CJQA 3DOLA 2J9DE 3MI7X 2YNGB 4K4YA 4DF4A 2DK2A 4A8YA 3LQVA 2YX4A 5DM7Q 1S1WA 2ASLA 2IFXA 1RDRA 3KKFA 3LP1A 3IAM9 2RU3A 3V6KA 1V3ZA 3HHKA 1NB7A 4CNZA 5AXKA 2VD3A 1SJFA 3I0RA 5KG0A 5HLFA 1PGZA 2FHJD 4OI1A 4YY3F 1N36F 1S79A 5I42A 1FJEB 4WYWA 4IDKA 1G6BA 4RNNA 2GHWA 1C4CA 4IG3A 4O3SA 4ES1A 1S48A 1JLAA 3MM9A 3GIKA 2VOPA 2F9JA 4EFAC 4RBVA 4EWTA 3PR5B 3I55S 2YX1A 4LQ9A 3V4IB 1H2UX 5D77A 1DARA 3RYLA 1ZTWA 5I3UA 4JUZA 1KR4A 1IKXB 4HTJA 1VRUA 3HP6A 2R2SA 3OHAA 1K73T 3GG1A 1V3SA 2DHGA 3IFEA 4FZVA 2UXCF 2IM2A 3D1HA 4NLPA 1CVJA 3BO2A 5LJ5Y 4K4TA 2QMXA 2IA0A 1RT6B 5F8JA 2V4QA 2MHNA 1NK8A 1VLYA 2XCPA 4UUXA 3H5SA 3OR1B 4CO1A 3AY0A 3CD6S 2GX8A 1GQEA 3J7ZT 3GIJA 3FEYB 1X7VA 3H98A 2YKMB 3E8OA 2QA2A 3M2VB 3OXLA 2PMHA 1XMBA 5CD4H 2AWZA 2JEIA 1S6PA 1FXDA 3HM9A 1HWIA 4F02A 1NK7A 2UZAA 4WK3A 2ZUGA 2DH8A 2Q3PA 3SMZA 3R5DA 4QCLA 3W2VA 4R5PB 2B4OA 1NK5A 1GX6A 1Y3KA 2VL1A 1ZM2A 4ZPBA 4J9MA 1LXNA 1VBXA 3DYAB 1URRA 1MW7A 2RE1A 4RLEA 4BDPA 3H8YA