2MKIA

Solution structure of tandem rrm domains of cytoplasmic polyadenylation element binding protein 4 (cpeb4) in complex with rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
203
structure length
203
Chain Sequence
b'SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic polyadenylation element-binding protein 4
publication title A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator/rna
total genus 25
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mkiA02
2CQ3A 1U6FA 2MQQA 3CC4S 4QPTA 1O0PA 2J8AA 3MDFA 1VQNS 2F9DA 2D9PA 1Q82T 1JMTA 2DGVA 3K0JA 2DIVA 2VOOA 5GMKa 1VQKS 1UAWA 5DDQC 2FC8A 1Q7YT 2XS7A 2L9WA 2JVOA 2N82B 4ERDA 2DO4A 5GAGU 3EX7B 2KXHA 1U1OA 3THTA 1FXLA 2DNHA 2X1AA 1RKJA 2DNPA 3G6ES 2CQ2A 2I38A 3VAMA 3VALA 3OW2R 2MZ1A 4PR6A 3TYTA 2DK2A 2U2FA 3CF5Q 1K8AT 1M5PC 1QVGR 2G4BA 2MZSA 4UY8T 1URNA 4LMZA 4Y00A 3H2VE 2MY8A 5CXTA 3RW7A 2U1AA 3CXCR 4UQTA 2CQDA 2DH7A 2MQNA 2MSSA 1HL6A 3NMRA 4LIRA 1VQ6S 2RNEA 3CCVS 5FJ4A 3UD4P 3ZZZA 1X4EA 1WF2A 5IM0B 2LQ5A 1R8PA 1X5OA 4YB1P 3UD3P 3R1HA 2N7CA 5IFMA 1WHWA 1H6KX 1M90T 2WBRA 1WEXA 2QFJA 3CCES 3ULHA 1P27B 3CD6S 3HI9A 2DHXA 1YJ9S 3IRWP 1FNXH 2J0QD 3SXLA 3G8TA 4CQ1A 3VF0B 4Y0FA 2VONA 1SXLA 2M52A 2AYGA 1N88A 1JJ4A 2OTJS 1U6BA 5EN1A 3NNAA 2D3OR 3SMZA 1S79A 4A8XA 2KVIA 1VC0A 3R27A 3DXBA 1XN9A 2KU7A 3Q2TC 2KN4A 2KHCA 3V4MA 2RT3A 4YUDA 1X4GA 2CQGA 2KM8B 2LXUA 2RS2A 2KXNB 3UE2A 1X5SA 5GVQA 2EK6A 2MJNA 5CA5A 1VQMS 4QU7A 3J7YU 3CMES 2K8GA 2DHGA 4IUFA 2LEAA 3NS5A 4FXWA 3U1LA 4W90B 4YOEA 5JVHQ 1WHVA 1YI2S 3N9UC 2MQPA 5GAEU 2ZJQQ 2MKJA 1OPIA 3UCZP 1X4FA 2MQMA 3BO3A 2XB2D 4U67Q 2M7SA 4QU6A 2DGWA 2DGQA 4RU2A 2LKZA 3BO2A 1FJCA 1H2TZ 1WG4A 2CJKA 3BEGB 4IOCQ 1YTYA 1FT8A 5BJRA 2VODA 2DNMA 3SDEA 2AYBA 3PIOQ 1F9FA 3UCUP 1VQ7S 3MUVP 5D77A 1U1QA 2DNYA 2ADBA 1AUDA 1VC6A 2JRSA 1VQ9S 1H2UX 1N54B 2G1DA 2HGLA 1WTBA 4M5DB 2N3OA 1SJQA 2L08A 1KD1T 3MURP 1R8HA 1VBZA 3LQVA 2LMIA 2ZJRQ 1D8ZA 4PKDB 3CCLS 2XNQA 3S8SA 3IWNC 2RQCA 5LXRA 2MKSA 2MKHA 2DB1A 3B4MA 2JWNA 4CH0S 1P1TA 1M5OC 3I56S 2DGOA 2GHPA 3CMAS 2MQOA 1WG1A 1M5KC 1G2EA 1VQ4S 1S72S 2J0SD 3VAGA 2KI2A 3U1MA 4TU7A 1RK8A 2DNLA 3Q2SC 5DDPC 1ZZNA 2ERRA 1DBDA 2JVRA 3BO4A 2MYFA 4C4WA 2CQHA 1OIAA 2RVJA 2CQ1A 2DNOA 5DETA 2HGNA 5ITHA 1WF0A 2DNNA 2CPDA 3MD1A 1FO1A 2DGSA 2DISA 3UWTA 4OZ1A 2CQBA 1U1MA 2OSQA 2MZTA 2E5HA 5DM7Q 2M88A 2V94A 2DNGA 1VBXA 2LCWA 2KH9A 2NZ4A 1H2VZ 3VAJA 1VQOS 5GAHU 2E5GA 4W92B 4WFAQ 2EVZA 5D78A 1WG5A 2RRBA 1WHYA 4TU8A 5LSOA 2HGMA 2I2YA 2MZQA 3CULA 2KM8C 3P3DA 4F26A 2FY1A 3B4DA 1A9NB 3NS6A 4PRFA 2CPFA 3G71S 2XS2A 2CQCA 4C7QA 4ED5A 1X5PA 5H1SV 3D2WA 2YH1A 1HA1A 2DNKA 3CUNA 4BS2A 1ZZFA 1KC8T 3P5TL 5IQQA 3H2UB 5GADU 2KG0A 4C0OC 2CPJA 2BZ2A 2HYIB 5HL7Q 3VAFA 4F02A 3MUTP 2D9OA 1YJNS 4WFNQ 4WFBQ 2MGZA 1VQLS 1KQSR 1A7GE 2MKCA 2SXLA 3VAKA 2MKIA 1WF1A 3VAIA 1K73T 3DLLQ 1FHTA 5LSLA 1W2BR 2X1FA 2M4MA 2CPXA 2DITA 1VBYA 2ZJPQ 1KOOA 1QVFR 2KYXA 4WCEQ 2KFYA 2CQ0A 2F9JA 2CPYA 3NNHA 1UFWA 1U1PA 2GO9A 1SJFA 2OTLS 1UW4A 2PE8A 3CCUS 1DZ5A 2J76E 2OIHA 2RU3A 1N52B 2DNQA 2DNRA 1VQPS 3SDEB 3BS9A 2M0GB 1N8RT 2MB0B 3MXHP 2MZJA 2X1BA 3J7ZT 3G9CA 2MPUA 2DNZA 3P49B 5HO4A 2CQ4A 1X4BA 3FEXB 1M5VC 2N3LA 3LPYA 3R1LA 3MI7X 2MMYA 3VAHA 2A3JA 4CH1A 2RS8A 5CYJA 2DGTA 2AYEA 5DM6Q 2MKKA 2OJ3A 4F25A 1HD0A 2OSRA 1U1NA 2FC9A 3EGNA 2CPZA 2UP1A 1NJIT 2YTCA 1SJRA 1X4AA 5DDRC 1OWXA 2E44A 2G0CA 2M9KA 3THPA 4WF9Q 4WKRA 3S7RA 3CC2S 3HHNB 1UP1A 1WI6A 2LYVA 4TU9A 3PIPQ 3CPWR 3RW6A 2KRBA 1X4HA 2YKAA 2XSFA 2DHSA 2QEXS 3L3CA 1JJHA 1FJEB 3ZZYA 3CCRS 1WEZA 2RQ4A 1VC5A 2VOPA 5LJ5Y 1VQ8S 1M1KT 1HD1A 1WI8A 2F3JA 2DH9A 1B7FA 2B0GA 1YITS 3G96A 1SJ3P 3S01A 1QM9A 3UCGA 1X5TA 4IOAQ 2DO0A 4Z2XA 2KRRA 3US5A 3G8SA 5IM0A 2HZCA 3CTRA 1U1RA 1PO6A 5JVGQ 1IQTA 1U2FA 2MY7A 3CCQS 2JX2A 2MXYA 2ADCA 3TO8A 2BOPA 1D9AA 2CPIA 1VQ5S 3NNCA 1X4CA 2MHNA 2YH0A 1X4DA 2L41A 1YHQS 2DHAA 4IO9Q 1DHMA 1JJ2R 2QA4S 4TLQA 3S6EA 2XS5A 2FHOB 1WEYA 2XNRA 2LECA 2MSTA 4QQBA 3CC7S 2M70A 2Q79A 3TP2A 2M8HA 2NLWA 3CCSS 2CQIA 3I55S 5MLCV 2FPHX 2LXIA 4P6QA 2LA4A 2M2BA 2MGZB 3MD3A 1SJ4P 4V19X 4OZ0A 4ZKAA 1YWXA 2KT5A 1PGZA 1K9MT 2DIUA 2KXFA 1DRZA 3P6YC 2MQLA 2AD9A 1WWHA 2E5IA 2MJUA 2X1GA 2KG1A 5DDOC 2PEHA 2RUGA 1CVJA 1FJ7A 2YWKA 1U1LA 1Q86T 5LJ3Y 1NO8A 4J5OA 4LJMA 2HVZA 1X0FA 2K3KA 4FXVA 4EGLA 2M8DB 2DGUA 1L3KA 3CCMS 1WHXA 1U1KA 4CIOA 1NU4A 3MOJB 2O3DA 1KOHA 5LXYA 3JB9k 1Q81T 1YIJS 3G4SS 1BY9A 2CQPA 2LA6A 1OO0B 2LEBA 2E5JA 2EK1A 2AYMA 2CPEA 1ZH5A 3CCJS 3EGZA 2RRAA 2DGXA 3FEYB 2DH8A 2MZRA 1YJWS 2CPHA 4WIIA 3MUMP 1WELA
chains in the Genus database with same CATH superfamily
3CC4S 4DL3A 3K0JA 4XO0A 2YWEA 1C0TA 3KYLA 4DG1A 4CLUA 2ZWPA 2JNJA 3FUYA 3OR2A 1GFWB 2IMWP 1QSSA 3BJYA 3T1YJ 5KFFA 4HLBA 3SCJE 4LRAA 3LWMA 1SC1B 4P71A 1C1CA 2O1PA 2L3MA 1Y3JA 2U1AA 4UQTA 5E0OA 2C3UA 4IR1A 3CCVS 2V9WA 1HBNA 1N56A 1LXJA 2YWFA 3T6BA 4OHWA 3C14A 2YY3A 1IBLJ 4E2FB 1H6KX 4EYHB 3KLFA 4LF2A 2XYGB 3TAMB 1KVIA 3BGRA 1UCNA 3IS9A 4CQ1A 4J9SA 2ZHOA 3DI6A 4DSJA 1JKHA 3K5MA 4JV5J 2XI2A 5KG1A 2KVIA 3F56A 4NPOA 2QMXA 1XEZA 3T1YF 2LXUA 1ZYQA 2UUAF 1AZSB 4IUFA 2X7IA 1NK8A 4KBIA 2VPXB 2C22A 8RUCA 2G1HA 1IM6A 4OIXA 1X4FA 2MQMA 3HHLB 4DCJB 1WOSA 5I3PA 1S1XB 1RT6B 1ZAXA 2CA9A 3MAQA 1IBLF 4RW8B 5T41A 4NCBA 1KLMB 2DT9A 3EJMA 1VC6A 4PG5A 2ZITA 4J90A 2AEFA 1N48A 4PG6A 1VDHA 4JV5F 4UOFA 1XQIA 2FZKB 2GHPA 3CMAS 4XTTA 4TQSA 2ZBCA 4M63A 1RK8A 3O2IA 4F3OA 1S6QB 4FBTA 4KIAA 1MU2B 4CO1A 1RWOB 1CS4A 2M88A 2V94A 1X31C 1SL1A 4F3MA 5HQMA 1WG5A 3OSNA 5LSOA 4NLYA 4ZVFA 4F67A 1R27B 2CPFA 3G71S 1SJ1A 2Y0BB 4MK9A 4O3QA 4DQRA 2BJ8A 1U45A 5EWFA 1C4AA 3ZNJ1 2D9OA 3CDEA 4KC5A 3S1TA 1UA0A 1YK9A 4RW7B 3OFHA 5KFVA 1WF1A 1NCLA 2L9DA 1MG7A 5KFKA 3ITHB 3LP1B 3AQPA 3J81U 3RZAA 2CPYA 4CLSA 2W4PA 5A8WB 1OQ3A 1OY8A 1UW4A 5DO2A 2AGPA 2HNZA 4EBEA 4I2PA 2MPUA 2ZVIA 4LVNP 3DYAA 2D41A 4ENOA 3M32B 2C2RA 4DR5J 5IWAF 1H7XA 1FDAA 4L6V3 2XMUA 2FC9A 5A2QY 3QRQA 3EGNA 5ETSA 1DTQB 3WX4A 4DL4A 4AT1B 4H4MB 4C97A 2EW9A 5HVFA 1BWEA 1FD2A 3RAMA 5DZ7A 2KRBA 5D15A 2VFSA 3GR0A 1FCAA 4Q2LA 2RQ4A 4OX7A 4DV6J 3DM2A 1FKOA 1TMJA 1IR2A 4ZVOB 1OS5A 4YR3A 4DUYJ 4C8ZA 4D3GA 1N33J 2ROPA 3MEKA 4Z2XA 4UQGA 3GZ7A 2OP5A 2OPQA 4DX7A 5D0RA 1RBAA 3O6QA 4X4OA 1XNRJ 4OZJA 3PO5A 1AFIA 2ZM6J 4TXSA 3GIKA 4L72B 5M2RA 3DRSB 2VQFJ 1NNDA 3RG6A 2KDOA 4MKYA 2OO4A 3H2LA 1SKUB 2E5IA 3NEKA 4EBDA 3OHBA 1H0HB 2GAGC 1KOHA 2UXCJ 3JB9k 5J2QB 5HROA 3FSIA 1FXDA 4J9OA 1LK7A 4DUYF 3EGZA 1N33F 3OJSA 1T03B 1A6LA 2DH8A 1O8BA 1LK5A 5IZHA 1WELA 1HYSA 3PX6A 2CQ3A 1U6FA 4YR0A 4IG0A 3BR9A 1VQNS 2NYHA 2FUG9 2DIVA 1QSLA 2ZOGA 1KNZA 1CG2A 1LWEB 3QJLA 4A8MP 2XS7A 3SI8A 2W2OP 4NCGA 2FHMA 2H65B 1U1OA 3M8SA 2JLGA 3M8RA 4LRFA 4NRUA 3DGPB 2VQFF 3TJ8A 4CLKA 3QT6A 3LOUA 3D4JA 2Y9HA 3CXCR 4RNHA 5DGAA 3DKDA 2NZCA 4NLPA 3UI3A 2R7OA 4QYZK 3ZZZA 2UXCF 1S1TA 2W9BA 2ASYA 3BSCA 2E1CA 1ZA2B 2XULA 2HWIA 4KYZA 3KHHA 2DHXA 2IBKA 3SXLA 2R7XA 1RKIA 3TZZA 1JLEB 4ID5A 3T9NA 3ZZPA 1TUWA 4Y65A 2OEJA 3IG1B 3VGVA 1H3DA 3TJ9A 4ZVQB 2D3OR 2AEJA 2B4OA 3I4PA 3V4MA 3NCPA 2CJYB 3AOBA 2WB1D 1ROFA 1HNIA 3K57A 5KFHA 4A8YA 3UDLA 3CDUA 3D3CJ 1R6YA 2EFVA 2HWTA 2BKNA 4ZVGA 3RUBL 3DXSX 4N56A 2B7BB 1WHVA 4J9PA 2V8PA 3KLGA 2XMVA 2XY7A 1JLGB 3RBZA 3H4DA 1FT8A 2VG6B 3D28A 2JHEA 1EIYB 5HANA 2YNGA 4K0KJ 2ZE2B 3DLJA 2VHGA 1XIQA 1MWQA 1WNEA 1R8HA 1VBZA 5T7LB 4H4OA 3TAPA 4NYZA 5KG7A 1Y11A 3SCIE 2H5EA 5EWGA 1UW9A 1HQUA 1M5OC 5G0RA 4A4JA 1I5OB 1VQ4S 1S72S 1FXRA 5IT9U 1ZZNA 2JVRA 4QW9A 3M30B 4LQ9A 4DZ6A 1RADB 3Q86A 4P2MA 2K7KA 2C2ZB 3CSKA 2XMJA 1VBXA 1VLOA 4WFAQ 1WHYA 2C2EA 4B3RF 1RTDA 4K4VA 3OTBA 4ZPWR 4PRFA 4IRCA 4K0KF 5IXUA 3PRVA 4DQQA 5E3AA 5A0YB 3W9IA 4RL1A 4XDCA 1S9EB 3PW7A 1PYOB 1K44A 4PWWA 4WFNQ 4WFBQ 2MGZA 4Y28C 1S7IA 4WZQA 4O3RA 2DRBA 4TY8A 2YX4A 4A8KA 4DR7F 4DL7A 4DLEA 3W65A 4LF8J 1O51A 4EU0A 2Z2ZA 4UUXA 2HHVA 5HAOA 1DLOA 4CT8A 4M5JA 3EDQB 1WDTA 2DNZA 2XCPA 2ZH3A 2W7AA 2MTLA 4NLOA 2C1EB 2V8DA 4OX9J 2OSRA 1U1NA 4GC7A 5LOQA 3SV4A 2BJ7A 2G0CA 2M9KA 3RBXA 2BV3A 3HHNB 3CC2S 1RT1B 5KTQA 4IH7A 3FVYA 4EO6A 1HPZB 3CCRS 4DFMA 2IC3B 5KG6A 3ADAC 1HMVA 2XHWA 3UFCX 1VQ8S 2QA2A 1JJCB 2BYCA 2V8GA 4LF6J 4LF8F 1N5QA 1S6UA 3S01A 3US5A 4P7TA 1NJWA 5IM0A 4TN2A 4Q5VA 5E33A 2NREA 1YRUA 4LR8A 4F4ZA 1DURA 3NAIA 2DR7A 2VJVA 2M70A 3FGVA 3TP2A 5A6WA 2HFZA 4OX9F 4ECTA 2B9WA 2K3IA 4V19X 3K2YA 3DOLB 3MEDB 3R5BA 1B99A 3TEHB 4IO1A 4B9NA 3TZYA 2XLJA 2H4YB 1Y0HA 2FZCB 1VMBA 1LW2B 4DSLA 5CABA 1U48A 2Q43A 1U1LA 3MMCA 4L73A 4KGXB 4FXVA 4EGLA 4WBFA 1WHXA 1NU4A 4WU3A 4G1PA 2NXCA 5KFUA 1MLAA 4P2FA 2Y0SD 4EWTA 3EUNA 3NRBA 2E5JA 1RZMA 1HNVA 3W7BA 3V6JA 2E9TA 3DNCA 1KBRA 1PBUA 1V3RA 3BDPA 2HQGA 5HN0A 2FGOA 2MQQA 5CD4A 2MLZA 4AQYJ 1VRUB 1UZHA 1Q82T 1YRXA 3L7OA 4DU8A 1TVRA 3JSBA 1UAWA 3OHAA 2XSJA 4Y2KA 2WCXA 2N82B 3BKUA 3OTCA 3QT7A 3KKFA 1GTHA 2V4JA 5GAGU 4NLQA 2J8SA 2X1AA 2DNPA 1NK9A 3A8JA 4FF1A 3TYTA 4RLEA 6FDRA 1JNZB 2NUHA 4S0MA 4FBUA 2J6UA 4G3IA 3V5RA 4WU2A 3POTA 2VA3A 2CQDA 3DN9A 2AJQA 3FCWA 2RNEA 3V81A 1KQKA 3NGDA 4P9SA 3CIMA 4ZP7A 1UJ6A 3CCES 5BR8J 2QX0A 3TQEA 4USUA 1NKEA 4MFBB 3BPDA 1U26A 2JC0A 3QFHA 3DOKA 2CJQA 3G82A 3TVKA 3NBPA 3Q2TC 3GSIA 4X4QA 2DR6A 5HJYA 1T3OA 1D8YA 2YNFA 4GRSA 3GV8B 3GQCA 1FRXA 4DR3J 1S97A 5KT5A 4YN3B 3D0IE 3KDOA 3DLHA 1CULA 4M8LA 2M7SA 3ISNC 2ZZNA 3BBBA 4CI0B 3MM8B 1RJJA 4U8YA 3MCSA 2AWZA 2V67A 4O3OA 4NZ0A 4DS5A 2UVUA 2RJZA 4F0MA 1NPRA 2D3O1 2GQ2A 2G1DA 3M1VA 5C24A 2XLKA 3NGKA 4X64J 1MN9A 2HAIA 1JWWA 3B4MA 3A4TA 1ZM3A 3VGSA 5HMWA 2J0SD 2VC0A 4C8LA 2C3YA 4I2QA 3J7Z5 2RVJA 4ZMMA 4U8VA 1JLFB 1RTIB 5CYQA 3PEJA 4KRWA 3UVJA 5DM7Q 2YPZA 3AFGA 2GFFA 3MMJA 2NZ4A 1H2VZ 2BW7A 1WKKA 3D1QA 4TU8A 3FSXA 6AT1B 2NXJA 4ZCLA 4NI2A 3U1NA 1NJXA 3P5TL 5IQQA 3VZIA 3MPWA 3MFHA 4K8RA 3GJRB 4FYDA 4ZITA 2XEXA 2ZH8A 3EE3A 1ITPA 5C5JA 4CO0A 2BE2B 2FLLA 4ATNA 3PYDA 4QR1A 3ENAA 1RDRA 2MDAA 5DG8A 1T3NA 4PCQA 4M5LA 3AD8C 2KYZA 3HSGA 1T05B 3NCQA 4I6YA 2HMIB 4LF9J 4GO7X 1OY9A 4K5RA 3J7ZT 5CD4H 2PN6A 3SYZA 2GMLA 5IT4A 2VFUA 3QBCA 3KHRA 4CH1A 5K8PA 2AYEA 2MKKA 1HBMB 1PSDA 3W5YA 1SJRA 2E44A 4GVLA 4WF9Q 4OYBA 1QSYA 4WKYA 2YKAA 1F5AA 1FJEB 2R7QA 4R8UB 1XR5A 3I82A 3H98A 1WEZA 5C7PA 3DOMB 1M1KT 1HWIA 3MM6B 4Y2CA 1ICEB 1Q4RA 5K8MA 1SJ3P 2YWWA 4YDXA 2R8JA 1RT3B 2VFTA 2MY7A 4LF9F 3TX8A 2QLJB 5BXIA 3TX0A 2NR0A 3TAMA 3S6EA 2QLFB 1FKPB 2BKPA 3AXKA 1GMUA 1RHJB 4I6WA 3BBFA 4K4YA 1NK7A 2Q79A 4P6QA 1FERA 4CLFA 1JB0C 2BACA 3PYEA 3HF5A 4P2XA 2XMWA 1LW0B 5ETOA 1JLBB 2KG1A 4DPWA 2Q6CA 3HVAA 1Q86T 4ZP8A 3VCDA 3DLGB 1AZSA 4K50A 3IM8A 3MFIA 1YIJS 1OQ6A 2G2OA 4ETZA 2LEBA 2E9ZA 3NOCA 3IM9A 2RU9A 4ZN3A 1ZH5A 3HHLA 3IR7B 3CJTA 2A2CA 5CQGA 1S1XA 4EEYA 1RT6A 3HMJG 2J8AA 3WHIA 3R2CJ 4RW8A 1KLMA 4GMKA 4C48A 1TK8A 3JAMU 4MIBA 5GMDA 2AJFE 2J9EA 4LF7J 3OTOJ 1RKJA 1RTJB 4ED7A 4C8OA 1RWVB 3BKFA 2U2FA 5HK4A 2G4BA 1URNA 4IDKB 4LSLA 2XHCA 5IV3A 1JQGA 2RB7A 4O3PA 3K89A 3Q8SB 1ZS6A 3Q8UA 4DBQA 4WP3A 5FJ4A 2HHSA 1EKSA 3H8YA 2BJDA 4KAIA 1RCXB 3DHXA 3R1HA 2N7CA 3CJ5A 5H9EJ 1MU2A 1RTHB 3HHEA 3BB5A 3ULHA 2XMAA 4MTPA 3UPFA 1RHMB 2V8HA 1F60B 1BQNB 1IBMJ 2CYYA 2F8MA 4WPAA 1GMWA 4HH1A 2G13A 1URRA 1S6OA 1TKXB 2FLNA 4J9UE 4USJC 2FZGB 4C3MA 4LF7F 3OTOF 3QO9B 5GVQA 3SEOA 3HDSA 2XLIA 3BF4A 4RW7A 1TP7A 2H4WB 2K8GA 4FXWA 1F3VA 1JNRB 1TELA 3TUIC 3R5JB 1I6JA 3LH2S 2ZJQQ 4Z7YA 2MKJA 3LP1A 2KTQA 2RSQA 4K4XA 4J9KA 4RBTA 3EWGA 5F41A 5A8WA 5CAAA 4RU2A 1IJFB 3KG1A 4AUKA 5I3UB 3A1YG 1REGX 1IR1A 1BE4A 2NSBA 2VODA 3MM9B 5CHCB 4MYTA 3SBMA 1WTBA 2ZBQA 4M5DB 2GJ2A 1YJTA 3M32A 5AT1B 4ZVSB 2HHHJ 3RGIA 4ED3A 1YRTA 1DTTB 3H40A 2DB1A 3NWGA 1DTQA 1S0OA 2FYXA 4H4MA 3SFUA 1SQFA 4NXMF 5KFDA 2CQHA 4C8YA 4O44B 4XIUA 4RW6B 4YHHJ 3TZWA 4DCOB 3M9MB 2MLYA 4DN9A 1ZM4A 3N6MA 3H5XA 3VAJA 1SKRA 2LQ9A 2HLTA 1CLFA 3QIDA 4TYAA 5K8NA 3P96A 3M8PB 3AB4B 3P3DA 1SB6A 3CJ2A 2G9OA 1S12A 2PA3A 1TK5A 4C7QA 5H1SV 4Y2MA 2YH1A 3ZO7A 1IWGA 3BQ1A 5K9FA 4DSKA 4YMEA 2HHHF 1LNQA 1PYTA 4RUCA 4F0KA 4I56A 1UKUA 3DRSA 1YJNS 3CJ0A 4K2XA 4RUAA 3VAIA 1W2BR 4A8QA 2AKWB 2F9JA 1QE1B 1TQLA 1X0PA 1GT8A 1EJ7L 3R6LB 4YHHF 4PQAA 5J2QA 4QW8A 1DARA 4ITSA 1J27A 4CLZA 5HO4A 1T03A 3GV5B 4K4UA 4W4MA 3KJVA 4V1Ak 2CRLA 4ZLJA 5CYJA 5ETMA 1SBRA 2I0XA 1HI0P 1LWEA 4HHHA 3KFWX 5DDRC 3THPA 4WKRA 1GX6A 4ZLPA 3BGOP 1WI6A 4P75A 5L1JA 4URQU 3DGPA 2BM1A 2W9CA 2XSFA 2DHSA 3BKTA 4KT0C 1YG0A 1NK0A 2AJ0A 4R25A 1LQ9A 4QIFA 2UV8A 5KFBA 1HNWJ 2FLOA 1YITS 3MPYA 3IWLA 2Z58B 2MXYA 2ADCA 1T9UA 4DN0A 1L3UA 3J80Y 3Q8VA 4EUVA 2XS5A 1U6ZA 1Q1KA 2XNRA 2HVEA 2MHEA 1IN0A 1JLEA 3QSIA 1RT7B 1FFWB 2AJ1A 1SJ4P 3C6TB 2R8IA 1K9MT 4BWJA 3D66A 2MQLA 4IOBA 2GNKA 4NLTA 5DDOC 5AXKA 2PEHA 4B3OB 2FJVA 4QIGA 2GO8A 1X7VA 5LJ3Y 1ELOA 2KZMA 3H42A 2DGUA 3V4IA 3I5AA 1UMJA 1XTZA 2PFFB 4JI1J 4Q8FA 3QNWB 1F9EB 1BGXT 1HNWF 2IAJB 2OPRB 1Z4UA 2R7TA 2BANB 5ETVA 2E66A 1UZDA 1Q78A 4OV6A 1JLGA 2M3DA 2D9PA 2HSEB 2XZWA 4USWA 1C0TB 2VG6A 3GFXA 5ETRA 3K8WA 2IY5B 2ZE2A 4AFFA 3CVKA 3CMQA 2UUTA 1FXLA 1HBUB 5T7LA 2QT7A 3KJFB 4CO3A 2LU1A 2RRNA 3VALA 4LRDA 4DZDA 1QY7A 3LPEA 2OD6A 3MWBA 3VZHA 2K06A 3JSMB 2F40A 4X4NA 3M30A 2KB2A 5HJXA 1R8PA 3HJVA 3KLIA 3OFFA 2QC3A 3MHYA 3KLFB 1WEXA 5T14A 4ES1A 5KFEA 3BGRB 1VLYA 2HURA 1RAAB 4JUZA 4CM2A 2HIQA 2H48B 2AYGA 2ABYA 4NASA 2FVPA 3DI6B 2FVCA 3AA8A 3SMZA 2AHOB 2KU7A 1R0CB 5A0YA 2IBOA 1S9EA 1JLQB 1MMDA 2Z30B 1FNMA 4W90B 5KFRA 4BC9A 5AE1A 1TFWA 4PQUB 3UCZP 3BO3A 4NLSA 2XB2D 4U67Q 3PX4A 3BO2A 2CJKA 4ZOSA 2QL9B 3OL8A 4X65J 2F1FA 4QYRA 1AUDA 3E8OA 4X4SA 3B82A 1S10A 3GYXB 2LMIA 3HO1A 4I67A 3U02A 3IC1A 2LLZA 3GJQB 3M6VA 3ZZRA 2XCAA 4J9LA 1LWFB 1WG1A 4ECQA 1RT1A 3AODA 5LSRA 5DDPC 5KG4A 5ETPA 4C4WA 2B43A 3FMWA 4PWDB 1HPZA 1FRMA 2F63A 1N0UA 4P72A 3TA0A 2OPSB 5ITHA 2IC3A 3MPDA 3O44A 4HDHA 4DV0J 4WK1A 2BQRA 3BGFA 1Z2ZA 3T3FA 2XYHB 1OYEA 5KG5A 4DV2J 2DNGA 2GIRA 2ROEA 2KH9A 2PIIA 4YB5A 4W92B 2EFGA 3CWJA 3RRKA 1NK5A 3QQCD 4X65F 5E3PA 2FY1A 3NS6A 4I7FB 3CT9A 4LSNB 5GAGI 1UPMB 1I94F 4HYKA 3RB6A 4GO5X 1SH2A 3H2UB 3QZ7A 5GADU 3D68A 3BYPA 5IC6B 2GAHC 3K5LA 3BZQA 4A46A 3FDSA 3PFOA 3DOLA 3MEDA 1A7GE 4YB7A 4NA3A 2RILA 3OSPA 1LW2A 4F2SA 2KFYA 1U4BA 4JV2A 4NOHA 2B4UA 1CJUB 4OYZA 2AZ1A 3Q23A 2OTLS 4GKKF 3QGPA 2F4FA 2IM2A 5KOWA 4DV0F 2V0NA 5FLXY 2E7XA 5LL6d 1U2CA 3MXHP 4DV2F 2B56A 4DL2A 2E9RX 3BN4A 2CZ4A 2V2KA 3TVYA 1MMLA 1VRUA 5KT2A 4ED0A 4WE1B 4DQSA 2P9CA 4LBIA 2J7KA 3GP9A 1JXVA 1X9MA 2UP1A 4ZPBA 1GK8A 4LBPA 2KHDA 2VQEF 3S7RA 4E0DA 4FKYA 4AL5A 3RW6A 3CDWA 5A8KB 1OJ4A 4ED4A 2P6TA 1LOUA 1M1GA 3PW2A 4M5KA 2ZBPA 2WBMA 4NE9C 3LUYA 3G96A 1QM9A 4IOAQ 2HZCA 3NMAA 2CKWA 1U2FA 2Y8YA 1VJWA 2JX2A 2CPIA 1HBOB 4KGVB 4BDPA 4Z7CA 2FHOB 5EX0A 4OL8A 4GVBB 3HKZD 1N4LA 4JI2J 4MFBA 3K5PA 4IYQA 2V34A 3CCSS 2CQIA 3I55S 5L1IA 2A1BA 4OZ0A 3MR5A 3W3SA 2CIMA 2AF6A 1Z1ZA 2RUGA 1RYSA 1B0PA 3OL6A 5F8JA 2W8LA 5B0CA 5IQ6A 2YX7A 3MOJB 2OPPB 3DRXA 5HROB 3EVOA 2DRDA 4B3MJ 3H59A 4WIIA 2JEGA 1U7LA 2QG9B 4IG0B 1UWBB 3MM8A 4MT1A 2CZVC 3W9JA 1S57A 1NSQA 8AT1B 4I0WA 1KDNA 3HLUA 4NCGB 5HMXA 4JI2F 1PC5A 4HKQA 2PC6A 4HT5A 3I0SB 4CYUB 4ANEA 2PFDA 2DKOB 5B08A 1C1BB 1IR0A 2OH2A 4F04B 2ACYA 2X3GA 1N36F 4JI4J 2HS0A 2WVCA 2Q1LA 3NMRA 2ALZA 4DMZA 1FWKA 1UL3A 1S1TB 1JLFA 1RTIA 4HEA9 3T1AA 2EPIA 1D09B 2WBRA 4C2MA 4FF4A 3GYGA 4B3MF 3M05A 4KV8B 1Q8LA 4IFVB 1OSDA 1LWXA 2J0WA 1F3FA 3PZPA 3W60A 5E3CA 4ID5B 4RUHA 3KMSA 4G1QB 1FK9B 3KXDA 3PKMA 5JJBA 2J7WA 4DSIA 3N0VA 2CG8A 3BM7A 2WTFA 5AJ3F 4MKVA 3AB2B 4YQWA 1D9DA 3ENQA 2HHQA 3RBDA 1L5UA 4KY3A 2W7OA 3AAWB 3HHLC 4PXEA 4CLYA 3R97A 2H1YA 2BE2A 1HI1A 5KFCA 3MF5A 4Q0BB 2VPWB 1RAFB 2B51A 3KLGB 4DR4J 3CJKB 1WG4A 4WYLA 1T05A 3PTWA 4ILRA 4O0IA 2BXJA 4C8KA 3MR7A 2LQBA 1H2UX 2HLUA 2VBXA 4YFUA 4OZ2A 2D3ZA 3M2UB 2C42A 3PJXA 3MEEB 3CCLS 4JI3J 1HBMA 1HWUA 5LXRA 4OYXA 4QIWD 3H5UA 3DMJB 3DDNA 2UUWA 7AT1B 4IR9A 1BQMA 1Q8IA 1FDBA 4R8UA 2AT1B 2HGNA 2ZKUA 2BUNA 4NLGA 2WZ1A 4NMXA 3PM9A 3DOMA 5L1LA 4RU9A 2I6WA 3PRDA 2OSQA 2ZNYA 2YNHB 3C15B 3W9HA 1S59A 4AXIA 3KK2A 1RAOA 3QWUA 5EUHA 4CM0A 1RT3A 3PVXA 1WC0A 2UVRA 4X4RA 4JI7J 2GC8A 3MCMA 4ZLLA 3D3BJ 1FKPA 4ZVPB 1ZZFA 1C2PA 5JUMA 1NXIA 2HHUA 2PMWA 3C46A 3D5MA 4HTJA 3UDEA 2WOMB 1RP5A 1UVNA 1LW0A 3DLEB 1JLBA 4PEOA 2KYXA 3TANA 3LP2B 1SCJB 2HK3A 2DTJA 3DLGA 4PUOA 2VF3A 2NSCA 4DUZJ 5HP1B 3I32A 1WSVA 3QYYA 5E3RA 3ZTQA 1RWWB 4UW2A 2QJ3A 3DRRA 4B02A 1KVJA 2GGPB 1M5VC 4ZVHA 3MMBB 5DG9A 1TAUA 3JQJA 2YKNB 2QYCA 3VGTA 1N6QB 4QOTA 3IRXA 2YTCA 2JLEA 1IXKA 4KFBB 2R2SA 4LF5J 1RTJA 2QRRA 2A10A 1JJHA 1BXNA 4OI2A 4KKOB 5B0AA 1VC5A 5HBMA 1H38A 4IDKA 2WW8A 2Y3YA 1J2VA 2HFSA 1BD6A 1LFWA 3M8YA 4HI2A 2HRUA 2D74B 1F2HA 3G8SA 2AIRB 4B9MA 4DUZF 1UFLA 3VHQA 2HHTA 2OMLA 2HHXA 1RTHA 2YPYA 1WORA 2G0JA 2CVIA 4F2RA 2R8HA 5A2QU 2XI3A 2GVDA 2ZKTA 2FHKA 4DLGA 1S9GB 1BQNA 5EX3A 5MLCV 2CVEA 5CCMA 4K7QA 3MD3A 1YWXA 1RWNB 1TKXA 5FD1A 3NGSA 3O3LA 4ICLB 4CRJA 3PY8A 3GB0A 3M8ZA 4NCAA 4LF5F 4M1KA 3QO9A 3MMCB 1I1GA 2OKQA 2K3KA 1CEZA 3M8QB 1U1KA 1Q81T 3G4SS 1ZPVA 2W01A 2EC0A 3WX8A 3QGGA 2B7CB 3MM7B 4F4WA 4LFCJ 2HVIA 5I3UA 2FVQA 3LP0B 5CYMA 4N5SA 2GHVC 1TVRB 1PC4A 5GMKa 4HL9A 3MM9A 1DFDA 5EGYA 4XK8C 2FVSA 4M5DA 4ECRA 4DF4A 3THTA 3M6UA 1DTTA 4JV1A 4HHJA 1UFKA 4Y00A 5KG3A 2ACMA 4KSEB 1Q0NA 2MSSA 2A6OA 2R9LA 3EPGA 4AYBD 1R8BA 1TKZB 4O44A 4C0BA 1AYEA 4RW6A 1U8SA 3AA9A 3F44A 4JOUA 1WHWA 4OLOA 2BVZA 4ECVA 4LF4J 2J0QD 4LFCF 3HHLD 2OEMA 3M8PA 1MNEA 3KHGA 1N88A 3R3TA 5E7OB 1YDLA 1NH7A 3G82B 4F4XA 3CJRA 1FX2A 3R7BB 3HD1A 4OZ5A 5DZ6A 3Q8YA 1KQFB 4NX9A 3UO0A 2Y8WA 2OFHX 4DS4A 4A47A 1NZ8A 3N9UC 4URGA 3TW0A 1CULB 4QU6A 1QE1A 3ZTOA 4F36A 2HFVA 2LKZA 2DBBA 3A8KA 3VQTA 2AYBA 1NRKA 4FYXB 2JRSA 4QYZJ 2R2RA 2CJAA 2L08A 1NKCA 3AH6A 2ZBRA 1KD1T 1XMQJ 4ED2A 1HHQA 1HQEB 3KWMA 4ER8A 3IWNC 1GMWD 5C2GA 2MKSA 2MKHA 5F8HA 1SH0A 4N76A 3D1OA 1MSWD 2O5DA 5IV4A 1JLAB 3KNGA 1N0VC 2DNLA 2YBVA 2VICA 4KE5A 1T95A 1FRHA 3QFWA 2QTWA 3PHEA 1P6TA 3MD1A 4ZPCA 1XMOJ 2DISA 2W2MP 2FJXA 3UWTA 4LFAJ 3UVJB 4OI3A 3ZTPA 1H72C 2MZQA 3B4DA 4Y2IA 3ZZOA 1J5EF 3RB3A 4FKXA 3D2WA 2CZ9A 4BS2A 4LR7A 2ZHBA 1S7HA 5HL7Q 1RT7A 3MUTP 3C6TA 1GXTA 1TL1B 1KTVA 2SXLA 1T11A 1FRKA 3GJTB 1FHTA 3PO4A 1HLWA 1DJ0A 1R0BG 4ECSA 4M5GA 4B3OA 1HHTP 1QVFR 4WCEQ 3BREA 5LMUJ 3BV8A 2UVWA 2RU3A 3BS9A 1PKUA 4LFAF 2IAJA 2OPRA 1SL2A 4GKJF 3GSDA 2BANA 3I4HX 4HACB 2EI5A 4DX6A 1QD1A 3C66A 5HLFA 2BJ1A 2N3LA 1F2GA 2MMYA 4HTIA 1C0UA 3AY0A 3BYRA 3I9V9 4RR5A 1M0SA 4O23A 4JBCA 3I96A 2DEJA 3IA0A 1HBUA 1UP1A 3W8GA 5KT6A 2QFIA 1SC3B 1U0HB 2XTJP 4WP8A 5KFAA 2RDDA 2L48A 3W61A 3OL7A 1AROP 3JSMA 3FJ2A 5D6GA 4LBHA 3UCGA 3RR8A 2LXFA 3TRGA 4ZVRB 2MHNA 3V6DB 4C9DA 1GXUA 4IO9Q 3M8WA 3V2UC 2YQ3A 3GIIA 1IM4A 5KFYA 1LFPA 2V69A 2FPHX 4OJ1A 3C16B 2EWHA 2X1GA 3D6FB 2YX1A 5KFTA 3CJ8A 3B78A 4Q43A 1FDNA 2HKEA 4NA1A 1FA0A 1NM2A 4AL7A 3D6TB 3W1YC 1HNXJ 1JLQA 2E1AA 1RT2B 1ZM9A 3L7UA 1JX4A 3GLJA 1ZOTA 1BY9A 2ASLA 2LA6A 2VFRA 4PQUA 3CCJS 4IH5A 4QWBA 4G6VB 4C8NA 2HBQB 4MK7A 3EMTA 4LVOP 2BR0A 5J1NA 3UN5A 4H4KC 1Q7YT 3HVWA 1MWYA 1ACMB 4Y6IA 5GADI 2IVYA 3GTYX 2IFXA 3KTQA 4P10A 3C2PA 1TL3B 2CJBA 2I38A 3OW2R 5HVGA 3T5LA 2ZH6A 4LSLB 1LWFA 4EO8A 1R7IA 2DXEA 1KWMA 3JS9A 2ZEJA 5L8RC 1XBWA 2H9ZA 2CADA 3ICLA 4PWDA 4Q44A 4YB1P 3UD3P 2OPSA 1F1BB 2XC9A 3GIMA 5KFMA 1NZAA 1M90T 1SI9A 3IRWP 1XC9A 2WSFC 4LFBJ 3LGHA 2VL1A 1U6BA 5EN1A 4I7FA 3T5HA 2R7UA 3N6LA 3A13A 4LSNA 2ASJA 1VC0A 3DXBA 1XN9A 3MR6A 2RT3A 5H9EK 1T94A 3D6HB 4XDDA 1LKZA 1KKHA 4FZVA 5CA5A 3JYTB 4DUTA 1ZETA 3CMES 1MW7A 3BN7A 4RW4B 2V9KA 4OZNA 3HFVA 1PAEX 1KN6A 2GZOA 2P6SA 4A8FA 4ZIWA 4OI1A 1CJUA 3VWSA 5BJRA 4WXWA 4WXOA 1R8AA 5THWA 2N3OA 4LFBF 3OXFA 1LWCB 3GU0A 4TLRA 4WE1A 4KH1B 2QSWA 4PKDB 2AX0A 4I1TA 2RQCA 1MMNA 4HR2A 2QLXA 3QIPA 2NCKL 2ZUAA 1P1TA 1O6XA 2HRYA 3NP5A 5M2UA 1VQSA 2Z8QA 2KI2A 2V2QA 2O67A 4TQRA 4DPUA 5A8KA 2MYFA 3WIUA 4XPCA 2DNNA 4A48A 2CDRB 3EXCX 3P5BP 2DGSA 3PR5B 2H5JB 4NLDA 3OL9A 4USKA 2HBRB 4BCAA 2OELA 1TKTB 3CNQP 3GCWP 2I2YA 5L9NA 1K0VA 2HQIA 1OPZA 1HBOA 1E6YB 2XS2A 2ZDOA 3LO3A 2OMOA 2FD2A 4JI6J 5HVHA 4IRKA 4GVBA 4DR5F 5F8LA 1RA7A 3TWZA 4ECWA 1PJ6A 1BQXA 3FQLA 4DFPA 3DLLQ 4QZVB 5LSLA 4C11B 3BQ2A 3H7HB 1IKWB 3GONA 2P9EA 1D0EA 2A18A 5KT3A 1FJGJ 3NNHA 4J37A 2OPPA 1X9WA 4DV6F 1N52B 2RH3A 2MQ8A 1J5OB 1WJ9A 2MB0B 2QE5A 2ZC4A 3P49B 1TKDA 2DJWA 1X4BA 4ECXA 5KFOA 1H7WA 3KJVB 5CH7B 3BDEA 3HJFA 4Q45A 1UWBA 1XNRF 4UZBA 3FBFA 1EP4B 4ZLNA 1VGYA 2ZM6F 4JI6F 3FNNA 4FS2A 1I3OB 4CLLA 3IP0A 3FMBA 3I0SA 1H73A 4CYUA 1T7PA 2W9CB 2PEBA 3EM1A 3L3CA 3ZZYA 1IKXB 2WRMA 4OX6A 1C1BA 1YJVA 3CCWA 1CJVB 3ZFVA 4CDIA 2OLWA 2OFGX 1FJGF 1OSCA 3HSJA 2WVEA 1SKWA 1V6HA 2IJRA 5AXMA 4OQJA 5DS7A 2QV6A 1RAGB 5E41A 4RW9B 2R2TA 1XK8A 4RNMA 2A2DA 1UWAA 4FPRA 1CJKB 4KV8A 4IFVA 3C6UB 1H98A 4PZVA 3WQPA 4NA2A 2NLWA 4G1QA 3HHDA 4ZPAA 4QR2A 1FK9A 2CDQA 4NLUA 4K59A 1FFSB 3SQOP 1IKVB 2M8DB 3V4IB 2OUGA 1RHQB 1RLDA 5D0GA 1OO0B 4K2JA 2VG7B 3ILJA 4Q0BA 3A12A 1Q5YA 2DCLA 1FRJA 5D0HA 3CJKA 3ZZ0A 1ZTWA 4X62J 3OXGA 3IAM9 2VOOA 5DDQC 1B4SA 3N4WA 4IFYB 3H5SA 3EX7B 4P52A 2JH3A 3M2UA 2XQCA 2HHWA 3P45B 3MEEA 5EDWA 4DPXA 2H3EB 2R3VA 3CF5Q 3PW4A 4EZ6A 4FDFA 4HT7A 3DMJA 2KFNA 1TL7B 2GQQA 2MEWA 2B9YA 3JSRA 1VRQC 2ILZA 1HL6A 4WIQA 2DHHA 1RSCA 1X4EA 4KTQA 3GFHA 1TUVA 3W62A 2V4RA 3KLIB 3N79A 2VKZG 1K1SA 3HULA 3L7PA 1G6BA 2YNHA 3C15A 5KFGA 2XZDB 3NGTA 3IN5A 2EBEA 5HATA 4USIA 4FNHA 4X62F 3UN2A 3D0HE 4H54A 4NXNJ 5KFJA 3IWXA 1JLCB 3Q8RB 3PW5A 1V3ZA 4A8XA 1RHRB 3R27A 4TNOA 5FIIA 1XNQJ 2BDPA 4HDGA 2QA1A 3DHWC 2EK6A 5HMYA 4ID8A 2UV8G 1QDUB 2WOMA 2WK4A 2DHGA 1HWLA 2IYIA 2FHJA 4YR2A 3DLEA 2NPIA 5JVHQ 1T02A 3DLKB 3LP2A 2HVDA 3GIRA 1TL5A 2J9DA 1VYAA 1YTYA 4Q7AA 3UCUP 5HP1A 4P2SA 3EGVA 3KUEA 5C42B 2EKYA 3RAQA 1N54B 4JI0J 2GGPA 3SSRA 3HP6A 2BOAA 1PAUB 4F4AA 3CEDA 3MMBA 3MURP 2R8KA 2YKNA 4NXNF 4B3SJ 3EDRB 2VUGA 1N6QA 1RHKB 1UVMA 4ANDA 3NLCA 3PG9A 1XNQF 3AQOA 4KFBA 4ED8A 4ZJLA 3FBEA 4TU7A 3Q2SC 2WONB 3EPIA 1CC8A 3I9ZA 3NG8A 4KKOA 1MROA 4QCLA 1S1VB 2CPDA 3IMQJ 2AEMA 5J2MB 4PG8A 1KLNA 1B3TA 1RTZA 1L3TA 2E5GA 1BC6A 3IBCB 2VBWA 2XWYA 2HQCA 2YKOA 3NY0A 4J91A 2VKRA 1G4CA 3H4BA 1X8DA 1APSA 1HW8A 4QJVA 3MAAB 5F0WA 1ULRA 1KC8T 5DQHA 3NXZA 4OJGA 2BZ2A 1QAJA 1S9GA 2EFOA 4B3SF 5EWEA 2P9GA 3WZ0A 2V4QA 2AW0A 2IVMA 2MKIA 3I87A 2M4MA 3PYFA 2JEFA 4ICLA 2KO1A 1VR6A 1S5ZA 4OYPA 3JQMA 2XZTB 1SV5B 3W2WB 1RT4B 3M8QA 2PE8A 4ELTA 2B6AB 2IRUA 4LF6F 1QJHA 4CH7A 2X1BA 3MM7A 3IBWA 3GMGA 3EVWA 2XY6A 3R5CA 3KK1B 2V50A 1M1HA 3MI7X 3LP0A 1REVB 4UUWA 1RA6A 1YZ6A 1XWLA 2BW2A 3GV7B 4OI6A 1NJIT 1WOPA 4IG3A 2OD4A 3BGLA 4QWDA 1FFGB 3PFEA 4KHMA 5KFIA 2Y1JA 2DPJA 1HD1A 1RYRA 2HAFA 3FRYA 3JTOA 2DH9A 1CBKA 4LSZB 1IQZA 4OZ3A 1TKZA 5JVGQ 3QGIA 3UDCA 3CCQS 3UDVA 2HBZB 2L41A 3DC2A 1DHMA 2Q6BA 1IKYB 3N6NA 4AQYF 3RJMB 2PSZA 2ROGA 2MSTA 5H9FK 3I0RB 3M7VA 2LXIA 3QMQA 3ILOA 1FTCA 4ZKAA 1PGZA 3KJNB 3HFKA 5AXNA 3P6YC 2WAQD 1QAYA 1CPZA 1WWHA 4DR2J 5L46A 2LFVA 2PI5A 4ZK7M 2K7JA 1CC7A 4O3SA 2GA7A 4UOGA 4K4ZA 4F4YA 2GHWA 3KLVA 1LEOA 4NYPA 3OD2A 3UN3A 2CPEA 1P1LA 5HMZA 3AOAA 3N28A 2Z2MA 2DGXA 2ZH5A 4MJKA 1UETA 4CTAA 3IR5B 1TMMA 2DCUB 1AB8A 3J80U 2VB6A 2F9DA 4USHA 4PYAA 1SUQB 4ZVEA 1T9VA 5BR8F 3OVAA 1YZ7A 2XY5A 4AXJA 2YKMB 1HQ2A 3OLAA 2BX6A 2PDAA 1HQEA 3FC9A 3H90A 1FX4A 2CJXB 5AXLA 2DK2A 1M5PC 2KT3A 5CZVA 3QJPA 3T5JA 2MZSA 1JLAA 2E5LJ 4M5IA 4DR3F 3DCAA 3DRPB 1U47A 3ZXWA 4JI8J 3NAHA 2MKYA 3JQKA 4X84A 2ASDA 2QFJA 2AJ4A 3HI9A 4DR1J 2HNYB 3HFZB 1YJUA 3F73A 3HPOA 5DRKA 1JJ4A 3D9BA 2IM1A 1S1UB 5K8OA 1S4FA 1UVKA 5F8NA 2Q3PA 4X64F 3TI0A 3UE2A 4PG4A 1TL1A 3VV2B 3UW1A 2FLPA 1N5YB 1RACB 2GIFA 2EG1A 2BE9B 4FXDA 4LF1A 4ECUA 2GV1A 2GW8A 3G2XA 3VVUA 5ETKA 2E5LF 1S1WB 3AT1B 4WK3A 2JDJA 3TARA 4JI8F 2HFOA 1H2TZ 2EKNA 4K4WA 3BQ0A 4JB8B 4HACA 4DR1F 4NWBA 5B0EA 2COLA 4NLWA 2V2VA 3Q83A 3AJDA 5M2PA 3LQVA 1JIHA 1R6VA 5JMNA 2UUAJ 2D7SA 3RRGA 4J7CA 5IS2A 2NYIA 3CJQA 2JWNA 1HI8A 3R6GB 4NEZA 3R5AA 4B17A 2PD1A 1M5KC 3C19A 3X1LB 2PA8D 3VGUA 2ERRA 1L3SA 5KT4A 1FE4A 1BQMB 2D69A 2GIQA 2HWHA 4KH0B 1NKBA 1U0HA 3I31A 3GR1A 3TA2A 4RO0A 4DOZA 2VDIA 1U1MA 2MZTA 3W2VB 1W2IA 1BHNA 3TNVA 2D3UA 1S99A 3MTKA 2EC2A 1VQOS 3KK2B 2RHQB 4DX8H 4O3NA 3EVMA 2KM8C 1WKJA 2VA2A 3V6DA 3HHKA 1X5PA 5DLFA 5J2PB 4TY9A 2F8EX 1KQSR 3C16A 3KLEB 3Q22A 2X1FA 3LAMA 2ZVSA 2HS3A 3CJ4A 2UUBJ 1S6PB 2R7WA 4ZIVA 4M95A 3BBCA 4PUOB 2C3OA 1SQGA 1RT2A 1NHKL 5ETLA 3SDEB 1YBTA 1Y7PA 3G6XA 2MZJA 4FVMA 3DRRB 3FEXB 1RBLA 3VAHA 2XGQA 2VG5B 3NOGA 4CNYA 4U7UK 1SIWB 3IRXB 2I9SA 2BABA 1DY3A 3R5GA 1TL3A 3DU5A 3WIVA 4QBUA 5HBMB 3E01B 4ZVTB 3ILLA 2EFPA 1VIXA 1FTRA 1GTEA 4WFYA 1R0AB 1WI8A 2B0GA 2UUBF 5LMNJ 5FLXU 4M5NA 4EK2A 3MPVA 3ET6A 3CTRA 1U1RA 4AL6A 2LVWA 5IWAJ 2FGCA 4CO4A 5D4OA 5D4NA 3SQGB 2PMZD 1WC3A 1R89A 2LECA 2GVDB 1AXQA 3HZEA 2KJWA 1NLKL 4ZCIA 2QN6B 2KXFA 5ETNA 2CFXA 2BJEA 4ELUA 2VV5A 3ISND 2DR5A 4FF2A 3G6VA 1XR7A 4KO0B 4MAKA 3JYTA 3CCMS 5LXYA 3HSDA 4RW4A 3QATA 3K7RA 2H54B 2CQPA 1UEUA 5LMNF 2PT0A 3FEYB 1YJWS 3RAXA 4ZPTR 3Q8PB 3T9ZA 5CYMB 4BHQA 1GMVA 3M2VB 1VQKS 2CJ9A 2JOQA 3MM5B 1IBKJ 2VC1A 4J9MA 4OJ3A 5DQIA 2L9WA 2E29A 4AD6A 3QZ8A 2DO4A 2HQDA 4NLXA 5C2CA 1RT5B 1LWCA 1IBMF 4C0HA 2FJWA 3M6WA 1T0TV 4E98A 4M5HA 2MZ1A 2HRTA 1QVGR 2OEKA 2WSCC 4P7VA 3DU6A 1V5VA 1F6TA 4RNFA 3H2VE 1SVDA 3G6YA 4D3HA 2QO3A 4RWXA 4LIRA 2RIJA 2NXNA 1T9TA 4DV7J 2OAUA 5ETQA 5IFMA 5DLGA 4RNNA 4B9UA 2ZZTA 1KVKA 1Q95G 3Q0AA 2IYGA 4OHXA 4NEYA 1TKTA 3ZZTA 1CJTB 1ZM2A 5I42B 4ETXA 3I6PA 4MH8A 1IBKF 1E6YA 1S79A 2V6AA 3OXLA 2KHCA 4CLPA 1HR0J 2UUCJ 5L38A 2O01C 2MJNA 3MGJA 1VQMS 1UJ5A 4QIEA 3E51A 4CCHA 5DJBA 3HVTA 2F7VA 2QLBB 5D3GB 2ZZMA 4C11A 3U1LA 1IKWA 2C3MA 1OPIA 1UEVA 2C3PA 2AJ2A 2HIYA 4OLPA 4YP3A 4DV7F 1TL4A 3WC2A 2AZ3A 1R3NA 2CAJA 3BEGB 1J5OA 5D77A 3SIPB 3PJWA 2WSEC 2WB4A 5D4LA 2D1CA 3D0GE 2FJAB 2ZH9A 1Q8BA 4DHVA 2BQUA 1EP4A 1YGYA 4O0NA 4OHVA 2E7VA 3T5KA 3I56S 1HR0F 2RUSA 1G2EA 1L3VA 2DYAA 3VAGA 2UUCF 2VBZA 4DR6J 2CNKB 4ZHRA 1OMSA 1OIAA 1IKXA 4HI1A 4DF8A 3KK3B 5F0UA 1CJVA 2K1RB 2BKOA 2VIHA 3TUPA 2NXUA 3CJ3A 2KKHA 1R43A 5D78A 1UEKA 2C28A 2N4CA 4DL6A 2EBGA 3B8HA 1KR4A 1FESA 1A9NB 3O5TB 4RW9A 2CQCA 1CJKA 3C6UA 4DDFA 2RQKA 2KG0A 5K20B 1UTAA 3GCXP 3W66A 3CB4A 1VQLS 2XMTA 1Q5VA 1QAXA 5ADZA 1WSRA 1VJQA 2X51A 3KOAA 2CPXA 2GMJA 4DQPA 3AJ1A 1KOOA 1IKVA 3FBCA 4DR6F 2BJ3A 1YSJA 2YKPA 2VBYA 4KHPJ 3C8YA 2GO9A 1SJFA 1VRTA 3SSQA 4B3RJ 3GE9A 5J1EB 3KG4A 4LRCA 2VG7A 4L75A 4I68A 2JC1A 5HLFB 4DPTA 4KPYA 1EETB 3ONQA 4MIAA 1C0UB 2DGTA 5DM6Q 3I5CA 1RE1B 1TU0B 4IFYA 3K5OA 3GPAA 4FP9A 4ZCMA 4DV3J 1YBUA 2BA9A 2R42A 3J7AN 1QTMA 4DR7J 2KT2A 2WVFA 3CPWR 2V68A 1BMQB 1X4HA 1B7YB 2DPIA 3OFGA 2LDIA 3CO0P 3U27A 1TL7A 3T19A 3MPUB 3W8PA 1IVZA 4KGKA 1X60A 4FPIA 5FDLB 2F3JA 3LF0A 3RTVA 4KHPF 2PI4A 5I3QA 3GWCA 1CQMA 4JI1F 4A8SA 5MAOA 1X4CA 1RU1A 2IRYA 2C2KB 3ZZUA 3ZTSA 1GXLA 4PXCA 1PBAA 4GC6A 3CC7S 4UY85 2R7RA 4QWAA 2LA4A 4F50A 1JLCA 1D1UA 9ATCB 2AD9A 3FCVA 1KQGB 3CIZA 4DV3F 3BSOA 4Y3CA 4I6AA 1P9YA 3W5ZA 1L3KA 2O3DA 4G65A 3OTDA 2LU2A 3Q89A 4LQ3A 4Y34A 1EQ0A 2EK1A 3IAS9 3DLKA 2R8GA 4ECZA 4IH6A 2A6MA 3MOZA 1RAIB 1NK4A 3OBIA 4QPTA 3W63A 1RAJA 4Y2AA 5F9NA 2ZUGA 3TR5A 4YB6A 4RBVA 2QSFA 5C42A 4FYVB 1DQ9A 4F4KA 3GFZA 1NDPA 1WACA 4C8MA 1AFJA 3RR7A 2I5JB 4ZN1A 2EEYA 4B9TA 3PCOB 3LWLA 3PW0A 2CQ2A 3VTIA 2FVRA 2JFDA 3OUYB 3PACA 5LT5A 4UY8T 2ZH4A 3FCHA 2DH7A 2WONA 4J9NA 3QWPA 1EX8A 5C25B 1FEEA 1S1VA 1K47A 3LAKA 1NPPA 5J2MA 1S4EA 2GQCA 3A3NB 5DGBA 3Q24A 2DR9A 1VHIA 2DY1A 2YQ0A 1SXLA 2R7VA 3H0PA 3NNAA 2IHR1 3NGRA 2A0FB 2B4PA 3MAAA 4DPYA 1X4GA 2IDLA 2ZFHA 2KM8B 1WKLA 3CW2C 2KXNB 1X5SA 1NHUA 4RZRA 3BR8A 4DSEA 1NDLA 3VVTA 3TQ1A 5D8HB 4F0HA 2DEIA 3F0NA 2MQPA 2CNOB 3FK4A 2N7YA 2HEKA 2HS4A 1VISA 1SV5A 3W2WA 1RT4A 3T6JA 3KLHB 2EFNA 1VOMA 5KAKA 2OI2A 3CD0A 2FY8A 2DNMA 2B6AA 1S49A 3D54A 5KFSA 3KHLA 2X3DA 4CNZA 1XR6A 1TK0A 2ALYB 3KK1A 2Y1IA 2KVQE 1REVA 1D8ZA 3O1LA 3EGWB 3NS7B 5HSPA 4V19J 1LXNA 3S8SA 3QIPB 3OV7A 3TEGA 5I4MA 4CH0S 4N8NA 2MQOA 3U1MA 4K4TA 4KGZB 2Z0GA 1DBDA 4R5PA 2GJIA 4H4KA 3CGIA 1YKWA 3J81Y 5A6PA 3QRRA 2BRKA 2FHJD 1W26A 1F5CA 1SQEA 3CD7A 3RYLA 2G0IA 3TUJC 2EVZA 4X4TA 3OFEA 2HGMA 1VS3A 2HBYB 4O4RA 2VFVA 4L76A 4QR0A 1TV6B 1KFDA 4DEZA 2AV5A 4ILLA 3TUZC 1IKYA 3CUNA 1RU2A 2XMMA 3I0RA 1TTHB 5KFXA 1MN7A 3M9OB 4PXBA 4UTGA 3FRZA 2IMOA 1U1PA 4N77A 4KB7A 1Y5LB 2ZWOA 3FBBA 1VQPS 1RWPB 5KG2A 1WC4A 6FD1A 4U7UD 2EXUA 1JK9B 1DQ8A 2CQ4A 4KHRA 3DGVA 4PABA 3HD2A 3LPYA 4NZ7A 3R1LA 2I1RA 2A3JA 4QPXA 4JYAJ 4WJBA 4F3QA 2JEJA 2UVVA 1SUQA 1RHUB 3IGVA 4BLGA 4OYAA 2YKMA 2LQJA 4WYWA 3KMQA 5HI7A 5IT0A 2J9DE 4OI4A 5KFWA 2J0XA 3M2RB 1UVLA 3QLHB 4HH0A 3MR3A 3BGUA 1B7FA 2RDIA 1RAEB 3MZIA 2POKA 4QWEA 4WTOB 3DRPA 1PO6A 4A8OA 3CCTA 2YH0A 4U6PA 1Q7LB 1D9FA 2Z56B 5KOXA 1WTFA 1S77D 1NHVA 2HNYA 1OY6A 2Y1LB 2C2MB 2JSXA 4ALZA 1V9OA 4FF3A 4JYAF 4PPDA 1HFEL 3FZ2A 1UVJA 4Q8EA 3QAUA 2DIUA 5A8RB 1S1UA 1QTNB 1FJ7A 2YWKA 1NO8A 3THVA 1X0FA 1ZBTA 4NLRA 3RBEA 2DXDA 1N5YA 4PAAA 4JI4F 1NK6A 1FD8A 2AU0A 1I51B 2IJFA 3IR6B 3AD9C 2RRAA 4MYUA 1S1WA 2JZ5A 3MUMP 4L3NA 2C2NA 5F3ZA 1RWMB 5E2QA 1JMTA 2JL9A 4DL5A 2V8VA 1RBOB 1VIOA 4ERDA 3HT3A 3C3LA 2KXHA 2YNIB 3ISZA 1SKSA 3NKYA 4F8RA 1TUGB 2V2ZA 4F7VA 7FD1A 3DDIA 1S76D 1YBAA 5B7WA 2CNLB 1HHSA 4LMZA 2FB0A 2MY8A 5CXTA 2XO7A 2FQQB 4ZS6A 1XERA 4QWCA 1AT1B 2RDJA 4MKBA 2QIFA 5BYQA 3UD4P 4I69A 3LA0A 1WF2A 1T9WA 1U25A 2IPOB 1X5OA 4ZA1A 4JV0A 2VH7A 2F4VJ 2WVBA 3W2VA 3O8WA 1RI7A 1KRPA 1OYDA 1FNXH 2ZOMA 5E5NA 4DR4F 2FJBB 2M52A 3KG0A 4OZLA 2HVHA 1Y9OA 4M94A 4O4GB 4EZ9A 5J2PA 3QAEA 1HW9A 4OHYA 3ZTRA 1PJ7A 2W1BA 4JI3F 1KTQA 4QU7A 3LTOA 2BBEA 3J7YU 5IT9Y 4TKTA 1WC6A 3TVZA 3KLEA 1YI2S 3J7A1 5F8IA 5GAEU 2R7SA 3K58A 3HZGA 2NS1B 2EG2A 4EMDA 3CO9A 1S6PA 2DGQA 2RE1A 1GEHA 4IOCQ 4KJIA 7FDRA 3CD5A 4ZP6A 2R4FA 3SDEA 2F4VF 3H5YA 2DNYA 2IVFB 4NL5A 1KEKA 3IO1A 2B8PA 2ZH7A 3L9ZA 3PYGA 3PEHA 1U24A 2VG5A 5LM7E 2BE7D 2XNQA 4JI7F 2KFZA 3L4BC 4DFKA 2DGOA 1A0OB 4X4UA 3HXMA 3KUHA 5AE3A 1GH8A 1Y00A 1T9YA 2R2UA 3MMAB 2XBPA 3RRHA 3QSYB 2GJFA 1S6QA 4A8WA 1E6VB 4C98A 1MROB 3PR4A 3E01A 4PYDA 2CQBA 1QLNA 1R0AA 1XJWB 4LREA 1LV5A 2J5AA 5GAHU 4B9LA 1VK3A 1W25A 4K5SA 1Z2LA 4M5MA 3SQGA 2RD5C 4DWIA 1U0SA 2G2YA 3H20A 2CPJA 4NXMJ 3VAFA 4F02A 4DPOA 2E1PA 3FFIB 1FNOA 5SUHA 4B9SA 3QRPA 1K73T 2OGUA 4R0EA 3DDKA 2GVZB 2AQ4A 3ITHA 3R7NB 2XGPA 3WBZA 2CQ0A 3OJUA 3N01A 4KO0A 1UFWA 1WUUA 5CCLA 5KFNA 5L39A 2IM0A 2XMKA 3ELHA 3EZUA 2DNQA 1UPPA 1PJ5A 2M0GB 3PXGa 2LDYA 4DI6A 3M6XA 5J2NB 4DX5A 3KDNA 3HM9A 4ES2A 3M2VA 2ZD1B 3MM5A 3JTNA 2HNDB 3D67A 2RMLA 1X4AA 4IG3B 4BBYA 1Y10A 1RT5A 2VPYB 2E1MC 4PG7A 4TU9A 3V6KA 2ZH2A 1KHVA 4AE5A 2QEXS 1IJEB 3GILA 1RUSA 4LRBA 1YX2A 4CO2A 2PO4A 2KZZA 2QGFB 4B9VA 4Z37A 4KQZA 1X5TA 2RF2B 2KRRA 3MCNA 3MEGB 1RAHB 3CDAA 5JXSA 1VQ5S 1AW0A 3P4UB 4QIVA 2DHAA 1YHQS 1NDCA 2QYGA 5GMEA 2W2PP 3FKBA 4KPCA 1CJTA 2M8HA 5I42A 1FVSA 2W24A 5F3TA 1Q8KA 1K1QA 3AJ2A 3D7SB 3LGMA 2CXEA 4ILMA 1DRZA 1YVFA 2MJUA 1CVJA 3SCKE 1NEEA 3FSYA 4UOHA 4WFXA 3A8IA 3VQSA 4CIOA 1FE0A 5D3GA 3H25A 1X9SA 1UJ4A 2K2PA 1U09A 4CTAB 2PMHA 3OTEA 1RLCL 5K14B 2ZHAA 2HHPA 4OYOA 3W5XA 4CT9A 4FN5A 4KGMA 2JEIA 2FC8A 2V5HG 4LF4F 5DG7A 4PWUA 1HIYA 1UVIA 2DNHA 1K0TA 3UR0A 2WVDA 2F5GA 3L95X 5KG0A 1ZAVA 2HPUA 2ATLA 1F9HA 1Y3KA 3AD7C 3NCRA 1NMEB 4BWMA 1RISA 1PIEA 2B5JB 2MQNA 3MECB 1S48A 1VQ6S 2XWXA 2RKIB 1IBCB 3T41A 3KK3A 2K1RA 1P27B 1YJRA 3CD6S 1XMBA 3QJJA 3QPIA 3G8TA 3BPSP 4MMOA 2NXEA 4Y0FA 1IWAA 2VONA 4OV1A 2DD8S 4NMLA 1S0MA 3IG1A 3Q8QB 1AUSL 2OTJS 1NSKL 2O66A 3OR1B 1Y4ZB 2BM0A 3OQ2A 2G2ZA 2M5YA 3CE8A 4IKAA 4YY3J 4YUDA 1W7WA 3GJSB 2QMWA 1XMQF 4MIWA 3PV8A 3TOQA 2RAQA 1QAIA 3ILIA 1WDDA 4OYMA 2P5VA 2BQ3A 2V63A 2IM3A 4OYWA 3MR2A 4LUBA 4U95A 4ZP9A 2CG4A 2NQPA 4U9RA 1JXLA 1FJCA 3AXMA 1U02A 1XMOF 1VFJA 5J1EA 4DG1B 3MUVP 2HQ3A 4CO5A 3G8QA 2ADBA 1PILA 1VQ9S 3OT9A 3OR2B 1G1XA 2VZ9A 2Z2LA 1SJQA 1EETA 4ED1A 4LT6A 4FYWB 4ZDNA 2XYPB 4HHUA 1JXEA 1NH8A 4USVA 1C1CB 1H74A 2AP6A 3IGNA 1M5HA 3LANA 4YY3F 3PX0A 4U7CA 4C3KA 3ZC4A 1G7CB 1HBNB 4RKUC 2DNOA 1HKAA 4OMFG 3HCXA 9RUBA 1FO1A 3C14B 1R31A 5LMUF 5FDLA 2E5HA 1ZPWX 1FDDA 2W25A 2FJEB 3IS9B 2RRBA 1NSPA 4J9RA 3B54A 4ZCKA 4ZPDA 1JKHB 4L74A 4DJBA 4YS2A 2HZVA 4ED5A 3JXOA 1RWXB 1KS2A 4C0OC 1BLUA 2HYIB 2XO6A 4CP5A 3SCLE 3ENVA 2IIHA 4B08A 2ZJPQ 3EYZA 3R9LA 1KFSA 3K8VA 4MK8A 1Q79A 1DZ5A 2J76E 3W64A 2HG4A 3DRYA 4N47A 1N8RT 2BEFA 2GMHA 2HW3A 1I94J 5U47A 3PNIA 2OJ3A 4F25A 4XAKA 1HD0A 4EFAC 4I4BA 1QUVA 1R8CA 2QA4G 5IC4B 4IQXA 3L09A 5KFPA 1OWXA 2I5JA 2ZNZA 4FVCA 2LYVA 1RCOB 2ZBIA 3TAQA 4GKKJ 3OUYA 3SV3A 1CSJA 4RPFA 2VDHA 3LALA 1CS4B 5KT7A 1FVQA 4LR9A 2CWKA 1HNXF 2DO0A 4UT4A 3ET6B 5C25A 1WOOA 3QGHA 3BH6B 3TO8A 1N34J 1D9AA 1X4DA 4ZPVR 2KL8A 1DQAA 2VQEJ 2VU5A 1BUXA 4PXDA 4QQBA 3JAMY 3GG1A 2KT5A 2VD3A 1YQHA 4EBCA 3KJQB 1PCAA 4CZCA 2HVZA 4JI5J 2YWHA 1HARA 3SSSA 3MCOA 4DL0C 2P2CB 3TJAA 1FF2A 4TVAB 2HNZB 1T9XA 2AYMA 2YVSA 4I2PB 2Z57B 4ANCA 1SC6A 2FJDB 3DYAB 5B0FA 4BC7A 2HFUA 3KLHA 3FEZA 3AOCA 4X2BA 1N34F 2DGVA 4U96A 1FI4A 5SZTA 1U49A 3HK2A 4CWBA 1U8WA 1B0VA 2WW4A 1NSAA 1TFYA 3IBFB 1KSPA 3G6ES 1TAQA 2BRLA 1K8AT 1TR0A 4NYOA 3DM2B 1FKOB 3RW7A 5H9FJ 4UZCA 2FDNA 8ATCB 4JI5F 5L1KA 2OPQB 4L3KA 2LQ5A 1RQ0A 5IOLA 2P8IA 2AGOA 1YJ9S 4J9VA 3VF0B 2Y1RI 1N32J 2OHDA 1TV6A 5B0BA 1VHFA 4P74A 2KN4A 1N36J 4ELVA 3OLBA 3G86A 5KFQA 2RS2A 3GIJA 2CNNB 3V6HA 2DRAA 2HFNA 3HVTB 1M5SA 4UOCA 2LEAA 2ATCB 3EXYA 4YOEA 2VPZB 1RWUA 1ZAWA 1EZZB 3FQKA 2PGCA 1G3OA 1QUPA 2DGWA 1ZTTA 1HYSB 1HWKA 3NWRA 2B4VA 5ETTA 4FYYB 1F9FA 1VQ7S 2VJUA 1SC4B 4DV5J 1SH3A 1U1QA 2Z2YB 4IQMA 1EQMA 2ZJRQ 5AJ3J 4C3LA 1N32F 3BSNA 1NAQA 1S9FA 4C6AA 1F0XA 2DR8A 2W7PA 4ZHRB 3M2RA 4DU7A 3BO4A 3UNGC 2CQ1A 2W9BB 3QLHA 4HVZA 1WF0A 2WHOA 1FRIA 4OZ1A 4W98A 3N5BA 3OVSA 1O5JA 2I8EA 2LQ8A 1U2RA 4F26A 2ZC3A 3A3OB 4DV5F 2YWGA 1ZA1B 1BWVA 1DAXA 4YEAA 4DXLA 2E7WA 4IRDA 5EHHA 2NUUG 1RABB 1C4CA 1D3WA 1MWZA 1VI7A 1HNIB 5L9XA 4G1IA 2ZH1A 4DQIA 3BH7B 3F41A 5A8RA 3PKYA 3T1HJ 2DITA 3PRBA 3GG0A 2NPFA 2YXLA 1FWLA 1VRTB 3CCUS 2OIHA 2APOA 3R2DJ 1HNZJ 2HMIA 2GX8A 3UQSA 2F65A 2YNGB 3RB4A 1IUJA 5D0EA 4OX8A 2QL7B 4WP9A 2F8HA 4H4OB 2DY9A 2QL5B 2CPZA 2ZOFA 2ZDPA 4CLWA 1HQUB 1F5BA 1V3SA 2J9CA 3KNAA 5G0RB 2XM3A 4DV4J 2YNIA 1WC5A 4X4PA 3SFGA 2W8KA 3J7YI 1FWPA 2RQMA 3R7SB 1EHWA 3T1HF 2W2NP 2VOPA 5GAEI 5LJ5Y 4ZJOA 3MM6A 1YJ7A 4WWSA 2Q66A 3CCZA 1VQYA 1PG5B 3LGNA 2JLFA 5DQGA 1RTDB 1S0VA 1HNZF 3NNCA 3NL0A 4WZMA 1NBEB 3K17A 3RU0A 4UF4A 2AGQA 2QA4S 4TLQA 3AHPA 1WEYA 1RGVA 4JP8A 4DSFA 3D1HA 2M2BA 2MGZB 3DFEA 5HQ8A 1WC1A 4RX6A 4X66J 1NDKA 3CDBA 1VBKA 4DV4F 2IRXA 1EARA 4TY8B 2Z4PA 4O4GA 3E3XA 4CLTA 1NPKA 2YKQA 3ENWA 4LJMA 4RUBA 4R0JA 1NB2A 3M4XA 1N5TA 3TZXA 4MKAA 3IXQA 1DLOB 3ETMA 4ECYA 4DCPB 3LW5C 4N41A 2MLXA 1P8GA 5GAHI 2CPHA 1GNKA 1O0PA 3MDFA 1RB0A 3DLBA 2VASA 5KFLA 3WC0A 1GX5A 4PPZA 4I64A 2JVOA 1VK8A 4XPEA 4URSA 3EZ5A 4KR0B 3U7JA 3K5NA 3VAMA 4ED6A 3HVRA 2FTRA 4PR6A 4X66F 2IA0A 2AMCB 1S0NA 2JFKA 1HMVB 3FZBA 4K4SA 5BYSA 3QT5A 1Q53A 1Y5NB 3MMAA 3NGUA 5IM0B 1E6VA 2UZAA 2JJ4D 4OHZA 1KONA 2QZ8A 2EFQA 2AX1A 3P8BB 3CJSA 2W2QP 1T8EA 1V5IB 4WTYA 1N5VA 4DV1J 1FKAF 3X3UA 4JI0F 3B6BA 1B0TA 2E1RA 3M9NB 2IA6A 2CQGA 4OI0A 4J9QA 3J81j 3PJ9A 4NLVA 1GQEA 4X4VA 3FFIA 3A8EA 1PYSB 5J1PA 4N8OA 3SZ2A 3NS5A 1NB7A 1HNVB 2GVZA 3D6MB 2DXFA 5BYRA 2LP4A 1KP6A 4USTA 4B3TJ 4RBUA 4DFJA 5K5MA 1Q16B 2B9EA 2KJVA 3A3PB 3PIOQ 3UR3C 2XSJB 4EI2A 3HT0A 2HGLA 1CQNA 5J2NA 2V4JB 3HKWA 2J6SA 2H5IB 5F8MA 4DV1F 1UA1A 3OPKA 2ZD1A 2HNDA 4ZVUB 3RB0A 3WDOA 1AA1B 2B3TB 1TZ0A 3R5DA 3POTB 2J6TA 5D4PA 1FRLA 3EICA 4R5PB 5AE2A 3V81B 1B70B 3GYNA 5DETA 5F8GA 5CZXA 5B0GA 5B0DA 1WD6A 2LEPA 3GFYA 2LCWA 1Y5IB 4B3TF 2B9XA 4ZJQA 2RF2A 2L9NA 3MEGA 2W4CA 3G87A 3CULA 2W4DA 1N5SA 2W9AA 2XG8A 2N4DA 4OJHA 3ZNUA 3DOKB 2C2OB 1NJYA 3NBPB 2IJNA 1HA1A 2DNKA 2B8QA 2C2DA 1NJZA 1EAYC 2HZAA 2HQFA 2H51B 2YNFB 3UNYA 1P9QC 2MKCA 3VAKA 1B64A 2ILYA 3KUGA 3JSYA 1NUEA 2RHSB 1SPBP 5A76A 3MTJA 4NZ6A 1VBYA 2UXDJ 4TYBA 1SIZA 3PDNA 3VR1A 2UU9J 3QT8A 2GS8A 3HSZA 1VCTA 3I5BA 2DNRA 5HQLA 1SL0A 3G9CA 4EYIB 1J5EJ 3M1VB 2BMBA 2QMUB 5C24B 3PHTA 4RNOA 5K14A 4P73A 2RS8A 4USMA 2DVIA 5G4DA 2BJ9A 2J7UA 1YLXA 3UD5A 3PIPQ 4YDDB 4LIWA 2UXBJ 4I2QB 3EZOA 3JTPA 4DR2F 4Q2MA 5CYQB 1GAOA 2UXDF 4E8UA 4FNIA 2UU9F 3E2EA 2B5JA 4GKJJ 3MECA 4OYIA 3BSAA 2RKIA 1RWKB 1IQTA 5B09A 5E3QA 2BOPA 1JJ2R 4NI2B 4N7TA 3OVBA 1KHWA 2GCFA 5F9LA 3R8YA 1EKRA 4RWWA 2FIUA 3OR1A 3IFEA 2HK2A 4WFZA 4RJVA 4OFZA 3MAHA 2CUYA 2IDEA 4NRTA 1FEHA 2YQ1A 4J5OA 5KFZA 2UXBF 2CWXA 1HWJA 3HX9A 3N5FA 3TA1A 4ES3A 5RUBA 3K59A 1EB0A 2QLWA 1RXOB 4FS1A 2MZRA 3ETOA
chains in the Genus database with same CATH topology
1Q78A 3CC4S 4L3NA 3CJKA 1JLGA 5F3ZA 3ZZ0A 4DL3A 2M3DA 1ZTWA 5E2QA 2D9PA 1JMTA 4XO0A 2XZWA 3K0JA 2JL9A 2YWEA 3OXGA 3IAM9 4DL5A 1C0TB 1C0TA 3KYLA 2VG6A 3GFXA 2VOOA 2V8VA 4DG1A 3K8WA 5DDQC 3N4WA 1VIOA 4IFYB 3OR2A 2ZE2A 4ERDA 2IMWP 4AFFA 3HT3A 3C3LA 3H5SA 3EX7B 2KXHA 1QSSA 3CVKA 3BJYA 2JH3A 2UUTA 5KFFA 4HLBA 2YNIB 3ISZA 3M2UA 1HBUB 5T7LA 1SKSA 1FXLA 2QT7A 2HHWA 3SCJE 3MEEA 4CO3A 5EDWA 3NKYA 4F8RA 2LU1A 2RRNA 3VALA 7FD1A 1QY7A 3LWMA 3CF5Q 3PW4A 1S76D 1YBAA 5B7WA 1C1CA 2OD6A 2O1PA 4EZ6A 2L3MA 3MWBA 1HHSA 4HT7A 1Y3JA 3VZHA 3DMJA 4LMZA 2KFNA 2FB0A 2GQQA 2MY8A 5CXTA 2B9YA 3JSRA 2XO7A 2U1AA 4ZS6A 1XERA 4UQTA 4QWCA 5E0OA 3JSMB 2F40A 2C3UA 2ILZA 1HL6A 2RDJA 4X4NA 4IR1A 4MKBA 3CCVS 2QIFA 5BYQA 2V9WA 3M30A 3UD4P 4I69A 1HBNA 1X4EA 1WF2A 2KB2A 1N56A 4KTQA 3GFHA 1TUVA 1U25A 1LXJA 1R8PA 1X5OA 4ZA1A 3KLIB 3N79A 2YWFA 2VH7A 3KLIA 4JV0A 3T6BA 4OHWA 2V4RA 2VKZG 3OFFA 2YY3A 1H6KX 4EYHB 3MHYA 3KLFB 1K1SA 1WEXA 5T14A 3KLFA 3W2VA 3O8WA 1RI7A 3TAMB 4ES1A 3L7PA 5KFEA 1G6BA 2YNHA 1KVIA 5KFGA 3BGRB 1KRPA 3BGRA 1FNXH 1VLYA 2ZOMA 5E5NA 4DR4F 3IN5A 2EBEA 3IS9A 4USIA 4FNHA 4CQ1A 4X62F 3D0HE 4JUZA 4H54A 2FJBB 4J9SA 2HIQA 2M52A 2AYGA 2ABYA 5KFJA 2ZHOA 3KG0A 2FVPA 4OZLA 3DI6B 3DI6A 4DSJA 3IWXA 2HVHA 2FVCA 1JKHA 3AA8A 3K5MA 1JLCB 3Q8RB 3PW5A 1V3ZA 3SMZA 2XI2A 5KG1A 4A8XA 2KVIA 1Y9OA 3F56A 3R27A 4TNOA 4NPOA 2KU7A 4M94A 2QMXA 1XEZA 5FIIA 3T1YF 4O4GB 4EZ9A 5A0YA 2BDPA 5J2PA 2LXUA 2IBOA 3QAEA 4HDGA 1ZYQA 1HW9A 2QA1A 3DHWC 4OHYA 1S9EA 2UUAF 2EK6A 4JI3F 5HMYA 4ID8A 1KTQA 2UV8G 4QU7A 2BBEA 3J7YU 1JLQB 1MMDA 5IT9Y 2WOMA 2WK4A 2DHGA 4IUFA 1HWLA 2IYIA 2FHJA 4TKTA 4YR2A 3DLEA 3TVZA 2NPIA 1FNMA 3KLEA 4W90B 5KFRA 5JVHQ 1NK8A 4KBIA 2VPXB 4BC9A 5AE1A 2C22A 1YI2S 5F8IA 5GAEU 1TFWA 3J7A1 3K58A 2R7SA 4PQUB 1T02A 3HZGA 3DLKB 4OIXA 3UCZP 1X4FA 2MQMA 2NS1B 3HHLB 3LP2A 3BO3A 2EG2A 4NLSA 2XB2D 3CO9A 1S6PA 4U67Q 3PX4A 2DGQA 2RE1A 5I3PA 1S1XB 1RT6B 3BO2A 2CJKA 1TL5A 2J9DA 4ZOSA 3OL8A 4IOCQ 1ZAXA 1YTYA 4KJIA 7FDRA 3CD5A 4ZP6A 2R4FA 2F1FA 4Q7AA 3SDEA 3MAQA 3UCUP 1IBLF 5HP1A 4P2SA 2F4VF 4QYRA 3H5YA 4RW8B 5T41A 4NCBA 2DNYA 1KLMB 2DT9A 3E8OA 2IVFB 4X4SA 1VC6A 1AUDA 4NL5A 4PG5A 5C42B 2EKYA 3RAQA 1N54B 1KEKA 2GGPA 2ZITA 3IO1A 3SSRA 3HP6A 2ZH7A 3CEDA 3B82A 3MMBA 1S10A 3GYXB 3MURP 2LMIA 2R8KA 2YKNA 3HO1A 4I67A 3PEHA 3U02A 1U24A 4NXNF 2VG5A 4PG6A 1N48A 2VUGA 1N6QA 1UVMA 2XNQA 4JI7F 3IC1A 2LLZA 2KFZA 3M6VA 4JV5F 3ZZRA 2XCAA 4J9LA 4DFKA 3NLCA 1XNQF 2DGOA 3AQOA 1LWFB 2GHPA 3CMAS 4TQSA 1WG1A 2ZBCA 4X4UA 4KFBA 4ED8A 4M63A 3HXMA 5AE3A 1GH8A 4TU7A 1RK8A 3O2IA 1RT1A 1Y00A 3Q2SC 5LSRA 5KG4A 2WONB 5DDPC 4ECQA 2R2UA 4F3OA 3EPIA 3MMAB 2XBPA 3RRHA 4C4WA 1S6QB 2B43A 1S6QA 4A8WA 1E6VB 3FMWA 1CC8A 4C98A 3I9ZA 1HPZA 4PWDB 1FRMA 3NG8A 1MROB 1N0UA 1MROA 4KKOA 2OPSB 4KIAA 3TA0A 5ITHA 2IC3A 1S1VB 2CPDA 3PR4A 3O44A 3E01A 4HDHA 4QCLA 4WK1A 2BQRA 3BGFA 1Z2ZA 1MU2B 2CQBA 4CO1A 1QLNA 1R0AA 5J2MB 3T3FA 4PG8A 2M88A 5KG5A 2V94A 2DNGA 1KLNA 2GIRA 2ROEA 2KH9A 1L3TA 1LV5A 2J5AA 1SL1A 2PIIA 4F3MA 5GAHU 2E5GA 4B9LA 4YB5A 4W92B 2EFGA 3CWJA 1BC6A 1VK3A 1WG5A 3RRKA 3OSNA 5LSOA 1W25A 1NK5A 4X65F 4NLYA 5E3PA 4ZVFA 4F67A 2VBWA 2XWYA 2YKOA 2FY1A 1R27B 4K5SA 3NS6A 4I7FB 1Z2LA 2CPFA 2VKRA 3G71S 3H4BA 1SJ1A 3CT9A 4LSNB 5GAGI 1X8DA 1APSA 3SQGA 1HW8A 4MK9A 4QJVA 1I94F 4O3QA 5F0WA 4HYKA 4DQRA 1ULRA 3RB6A 4GO5X 2RD5C 5DQHA 1KC8T 4DWIA 1SH2A 1U45A 3H2UB 3QZ7A 5GADU 5EWFA 4OJGA 3H20A 1C4AA 2CPJA 2BZ2A 1QAJA 3K5LA 1S9GA 2EFOA 4B3SF 3BZQA 4A46A 3VAFA 5EWEA 4F02A 4DPOA 2D9OA 3CDEA 2P9GA 1FNOA 3FFIB 3FDSA 4KC5A 5SUHA 3PFOA 3S1TA 1UA0A 3DOLA 3MEDA 1A7GE 3WZ0A 2AW0A 4RW7B 2V4QA 4B9SA 2IVMA 3OFHA 2MKIA 5KFVA 1WF1A 1K73T 4YB7A 2L9DA 4R0EA 4NA3A 2RILA 3OSPA 3I87A 2M4MA 2JEFA 4ICLA 2KO1A 3DDKA 2AQ4A 1LW2A 5KFKA 3ITHB 3ITHA 3LP1B 2XGPA 3WBZA 3AQPA 4F2SA 2KFYA 2CQ0A 3RZAA 3OJUA 2CPYA 3N01A 2W4PA 1U4BA 4JV2A 4KO0A 1UFWA 5CCLA 1SV5B 3W2WB 4NOHA 5KFNA 5A8WB 5L39A 2B4UA 1RT4B 3M8QA 1OQ3A 3Q23A 2IM0A 1UW4A 2OTLS 2XMKA 5DO2A 4GKKF 3QGPA 2PE8A 2IM2A 3EZUA 5KOWA 2DNQA 2V0NA 4DV0F 5FLXY 4ELTA 2E7XA 2B6AB 5LL6d 2M0GB 2IRUA 2AGPA 3PXGa 2HNZA 4EBEA 1QJHA 4LF6F 3MXHP 4CH7A 4DV2F 4I2PA 2X1BA 2MPUA 2B56A 2LDYA 3MM7A 4DL2A 3BN4A 2E9RX 3M6XA 4LVNP 3DYAA 3IBWA 3GMGA 2D41A 5J2NB 2XY6A 3R5CA 2CZ4A 2V2KA 3M32B 1MMLA 3TVYA 3KK1B 2C2RA 3HM9A 3MI7X 3LP0A 1VRUA 5IWAF 1H7XA 5KT2A 1REVB 4ED0A 4UUWA 4WE1B 1FDAA 1RA6A 4ES2A 4DQSA 2P9CA 4L6V3 2XMUA 3M2VA 2ZD1B 2J7KA 2FC9A 3MM5A 5A2QY 3JTNA 2HNDB 3EGNA 1XWLA 1X9MA 2UP1A 2BW2A 4ZPBA 3GV7B 4OI6A 1NJIT 2RMLA 1DTQB 1X4AA 4IG3B 4IG3A 3WX4A 4DL4A 2KHDA 2OD4A 4H4MB 2VQEF 4BBYA 4C97A 3BGLA 1RT5A 3S7RA 2VPYB 2EW9A 4QWDA 4E0DA 2E1MC 4PG7A 1BWEA 1FD2A 3RAMA 4AL5A 4TU9A 3RW6A 3V6KA 2KRBA