2MKIA

Solution structure of tandem rrm domains of cytoplasmic polyadenylation element binding protein 4 (cpeb4) in complex with rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
203
structure length
203
Chain Sequence
SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator/rna
molecule keywords Cytoplasmic polyadenylation element-binding protein 4
total genus 25
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mkiA02
1M90T 1PGZA 2CQPA 3NS6A 4TU9A 1VQ9S 3I55S 2M8HA 2OTJS 2D9OA 2HGLA 2MSSA 5GAGU 2MXYA 2RQ4A 2DK2A 3G8SA 1Q86T 4QU6A 5IM0B 1UW4A 2VOPA 3UD3P 2DGXA 1WTBA 2EVZA 1WHXA 2LEAA 2CPDA 2K8GA 2L9WA 2M8DB 1N88A 2M70A 3UCZP 5D78A 1K9MT 2M2BA 3R27A 1JJ2R 1VQ5S 1FHTA 2XB2D 5LXRA 3CULA 2MHNA 1G2EA 4IOCQ 2MQNA 3UCUP 1X0FA 1K8AT 2DNOA 2DNLA 2JWNA 1R8HA 2MQLA 3B4MA 2MPUA 3UE2A 1R8PA 5HL7Q 2QFJA 2DH7A 2MQQA 4IUFA 2MZRA 3HHNB 2MSTA 2HZCA 2KRBA 2WBRA 2AYBA 1YITS 1DBDA 3SDEB 4ERDA 2CQIA 1S79A 3MXHP 1DHMA 5D77A 2CQBA 2DGSA 1VQLS 2U1AA 1U6FA 4WIIA 3TP2A 1U1OA 1X5OA 5GVQA 1JJHA 2MKIA 4W90B 2MZTA 4QPTA 3V4MA 3NNCA 1HL6A 2DNZA 1X4EA 3CCES 4PRFA 3CD6S 3VAIA 1WI8A 1WF1A 2DHGA 2F9DA 1U1MA 1FT8A 1WF2A 1QVGR 3L3CA 2GHPA 2OTLS 3TYTA 2MQPA 3S6EA 2KM8C 2QA4S 4WFAQ 2KN4A 5DETA 2DITA 5CYJA 3VF0B 3VAKA 3S01A 3BO4A 2CQ1A 2LYVA 5CXTA 3S7RA 2LA6A 1URNA 2YWKA 3MD3A 1DRZA 2MJUA 2M7SA 1WI6A 2B0GA 3SXLA 2MYFA 1H2TZ 2CQHA 1X4GA 4LIRA 3D2WA 1ZZNA 5EN1A 1HD0A 1S72S 1SJ4P 2CPJA 4IO9Q 4YOEA 1OIAA 3U1LA 1H6KX 4FXWA 2ZJQQ 4UQTA 2XS7A 2DNKA 2GO9A 2DB1A 2E5HA 4WF9Q 1VC0A 3VAMA 3CCJS 3EX7B 2DIUA 2CQ2A 3CCVS 3J7ZT 2OSQA 2MZSA 2AYEA 2FY1A 2MY8A 1VQNS 2FHOB 3THPA 2LXUA 1YWXA 2RQCA 2HVZA 1VQ4S 1X4BA 2DNYA 2RRBA 2CQDA 2KH9A 2I2YA 2M4MA 2VONA 2CJKA 1WHVA 1X5SA 1OO0B 3H2VE 1WHWA 1X4AA 1OWXA 3H2UB 2J8AA 1Q81T 2JRSA 2KG0A 1RK8A 1WG1A 5DM6Q 4IOAQ 1WF0A 1CVJA 1W2BR 1VBXA 4OZ0A 2X1BA 3G4SS 2DNNA 2QEXS 1D8ZA 2J76E 1FJ7A 2KI2A 2CPHA 2DGQA 2MZQA 3US5A 1VQ7S 3VALA 1P1TA 3ZZYA 2DGUA 3HI9A 2KXFA 3G71S 5LJ3Y 4WKRA 2KU7A 4F25A 3R1HA 2FC8A 2MMYA 1QM9A 2KT5A 3LQVA 2NLWA 2HGMA 4M5DB 2EK6A 2LECA 3CUNA 1FO1A 2L41A 3K0JA 2X1AA 4OZ1A 2YH1A 4UY8T 5MLCV 2PE8A 1A7GE 1KOHA 1K73T 3NMRA 2LKZA 2K3KA 1U1QA 3G6ES 1YIJS 2FPHX 4YUDA 4ZKAA 3FEXB 3G9CA 3BO3A 2N82B 1QVFR 1DZ5A 3CC7S 5JVHQ 2J0QD 1WG5A 2KYXA 2BZ2A 3CCMS 2DHXA 2DISA 2KG1A 1X5TA 2N7CA 2LMIA 4BS2A 4J5OA 2KM8B 1KC8T 3VAGA 1X4FA 2MY7A 3OW2R 3FEYB 4W92B 2AYGA 1P27B 2UP1A 4WFBQ 1NJIT 2CPXA 3MUMP 2NZ4A 4P6QA 3VAJA 1N54B 5CA5A 4QQBA 2X1GA 3N9UC 3UWTA 3MOJB 3B4DA 1VQ8S 2KHCA 2Q79A 2VODA 2HYIB 2CQ3A 4C7QA 2MQOA 2D9PA 2VOOA 2KVIA 1U2FA 4C4WA 2SXLA 2JVRA 4CQ1A 3P49B 1M1KT 3ULHA 3P3DA 2CQ0A 2MZJA 1VQKS 2DGTA 2KXHA 3SDEA 3DLLQ 2DGOA 1U1KA 1HD1A 1U1NA 3LPYA 4C0OC 2CPZA 2DNRA 4PR6A 2DNGA 4A8XA 2DHAA 1F9FA 2DH8A 1WEYA 1WELA 2CQ4A 1U6BA 3CPWR 1M5PC 2OIHA 3MI7X 3PIOQ 3CC4S 5ITHA 4U67Q 3CMES 4Y0FA 3PIPQ 2MB0B 3MUTP 2MKHA 2F9JA 3Q2SC 1UFWA 1OPIA 5DDPC 2MKSA 2XNQA 1XN9A 1VBZA 2ADBA 1PO6A 2KXNB 2O3DA 1D9AA 2ERRA 1FXLA 2E5JA 4CH1A 2XSFA 1KQSR 4WFNQ 2JVOA 1Q82T 2DNHA 3CCQS 1U1RA 2YH0A 2KRRA 2MZ1A 1M5KC 5LXYA 5LSLA 2E5IA 3MDFA 4CH0S 1VC6A 2CPIA 4Y00A 4PKDB 1L3KA 3ZZZA 2ADCA 2OJ3A 5IFMA 1N8RT 2CQCA 2M9KA 1ZZFA 2DNQA 2DO0A 2MKJA 5DM7Q 1U1LA 5LJ5Y 1YJNS 1FJEB 1U1PA 2DNPA 3BEGB 2DGWA 2DIVA 3CCRS 1H2UX 2G1DA 5H1SV 1RKJA 2MJNA 1VC5A 1HA1A 1FNXH 5GAHU 3CCUS 1NO8A 3NS5A 2MGZA 3BS9A 2RRAA 3RW7A 3IRWP 1WG4A 2L08A 5DDRC 5GAEU 2G4BA 3NNHA 4F02A 1WEZA 4V19X 2M52A 1BY9A 3BO2A 3IWNC 3CMAS 4LMZA 2DO4A 2F3JA 3CCSS 1WEXA 2JX2A 3DXBA 5BJRA 2KFYA 2ZJRQ 1SXLA 2RT3A 1M5VC 2D3OR 4WCEQ 2RNEA 2HGNA 1SJQA 1ZH5A 2N3OA 2YTCA 1X4HA 3Q2TC 2BOPA 3G96A 4QU7A 3CTRA 1WHYA 3CCLS 1SJRA 2MGZB 1UAWA 2OSRA 2CPFA 5FJ4A 4YB1P 2LCWA 2LQ5A 3P5TL 3P6YC 2AYMA 1YI2S 3MURP 4RU2A 2ZJPQ 2DHSA 3THTA 1IQTA 2RU3A 2RS8A 2MKKA 3UCGA 1FJCA 3R1LA 5DDOC 4FXVA 2LXIA 1YTYA 1JMTA 3TO8A 2A3JA 3CXCR 1X5PA 1SJFA 3G8TA 3NNAA 1SJ3P 3EGNA 2MKCA 1B7FA 2CPYA 2AD9A 2EK1A 3JB9k 1WWHA 5JVGQ 2X1FA 2LEBA 1O0PA 2YKAA 3MD1A 2U2FA 1JJ4A 5DDQC 5IM0A 1A9NB 1X4DA 3VAHA 2XS5A 4TU8A 4CIOA 3J7YU 3CC2S 3UD4P 2DGVA 3I56S 1VBYA 3VAFA 2M88A 2RVJA 3U1MA 4TLQA 5HO4A 4LJMA 2FC9A 1VQ6S 2CQGA 2PEHA 1KOOA 2RS2A 3EGZA 2MQMA 1YJ9S 1X4CA 4EGLA 2I38A 2E44A 2RUGA 3RW6A 1AUDA 4TU7A 4ED5A 5IQQA 2J0SD 1UP1A 1Q7YT 1YHQS 2XS2A 3S8SA 1VQOS 2E5GA 2N3LA 4Z2XA 3MUVP 2CPEA 2DH9A 2DNMA 2V94A 1YJWS 5GMKa 1M5OC 1N52B 2M0GB 2LA4A 5LSOA 1KD1T 3CF5Q 1VQMS 2G0CA 3SMZA 1H2VZ 4F26A 1VQPS 5GADU 1NU4A 2XNRA
chains in the Genus database with same CATH superfamily
4ZPBA 5A8WA 3VZHA 1DJ0A 1PGZA 2KTQA 2PDAA 3LP0B 4FN5A 2IC3A 5D4OA 3NS6A 4DL4A 2UUWA 4TU9A 1HNVB 1U24A 2DXFA 2WONA 2BOAA 2VG6A 2IDLA 3F44A 3R5GA 4MK7A 1MN9A 4NX9A 5CZVA 1XNQF 2ZKTA 1NSPA 1EX8A 2HGLA 4WWSA 4Q0BA 2RQ4A 3IG1A 5F8LA 4QU6A 1RKIA 1YVFA 3EPIA 1UW4A 3OSPA 1VIXA 2JEJA 2XGQA 3D9BA 3RBZA 1VRTA 3OPKA 4X64F 4N76A 3C6UA 2C42A 4NXMF 1LW0A 1HBOA 2I5JB 1F5BA 4O44B 2QA4G 1DLOB 4K4SA 2LEAA 4NOHA 2V8VA 1TL1A 1RISA 2K8GA 5GMDA 2VQFF 3NBPA 1FRMA 2M8DB 1N88A 2M70A 1JWWA 2RMLA 1K9MT 2XZTB 2ZM6F 2XB2D 4KT0C 4YFUA 1NSAA 2MQNA 2O67A 2UV8G 3P8BB 3Q8UA 1ZETA 2HHPA 4OJHA 1SIZA 2XM3A 4RNHA 2WBMA 4IUFA 3LP2B 2MZRA 2XTJP 1NEEA 1XR6A 2HZCA 2MSTA 2OEKA 2WBRA 4DHVA 5KG2A 4OI3A 1YITS 4DR7J 1DBDA 3D4JA 4WP9A 5D4PA 3SDEB 3NCQA 4I1TA 4ERDA 2J9EA 2LU2A 5D77A 5K14A 2DRAA 4TYBA 2DGSA 5HJXA 1BC6A 3MEGB 1U1OA 1NJYA 4UT4A 2AZ3A 3OR2B 2MKIA 3W9IA 5B0BA 1NKCA 4ETZA 4OYBA 1EB0A 1EIYB 3BJYA 3V4MA 4FYVB 1Q95G 2K2PA 3NNCA 1HL6A 4WYWA 1TU0B 1T9TA 2BE9B 4QW8A 4GKKF 2PIIA 3MAAA 3VAIA 3GYGA 2DHGA 1VRUB 1Y7PA 5F41A 3N6MA 1FT8A 4BWJA 1U1MA 5A0YA 5F9LA 3L3CA 4M5MA 2YNHA 1QVGR 2OTLS 4C98A 3TYTA 4DN0A 4ZA1A 1VGYA 3LH2S 3T1YJ 2AJ0A 1PSDA 1TKXB 3N6NA 4DR5F 1RXOB 3HKWA 3MPUB 3S6EA 1IBKJ 3CJ8A 2A6MA 4OYXA 3SFGA 2DITA 2JSXA 3ENQA 4TN2A 3G86A 4G1QA 3VF0B 4DDFA 1D9DA 2PFFB 4K2XA 1U0HA 4KO0B 3S01A 5G0RA 4JYAJ 1UTAA 3DGVA 3J7AN 2LYVA 1RT3A 5B0EA 5I3UA 2Q1LA 5GAEI 2YX1A 2UV8A 5CXTA 1UEUA 3I82A 1D9FA 5FDLB 2PI4A 2E7XA 2YWKA 2AGOA 3UD5A 4OIXA 4MAKA 1WI6A 2Y3YA 4I56A 4ZS6A 1QSSA 1NZAA 4DR4F 7FD1A 5HANA 3K8WA 4OZJA 3A3PB 3GE9A 5B0CA 1JB0C 4B3RF 3K57A 2HNYA 4HACB 3OFEA 4LIRA 1RWNB 4OHWA 3I5AA 2ZOFA 4MT1A 4PWUA 4EK2A 1RWPB 2HHWA 1REVB 4F4WA 1SJ4P 2IA0A 1UWBA 3TWZA 4EBDA 4W98A 3GJSB 4USVA 1RSCA 1PC5A 4U7CA 4ZP7A 1Q5YA 1FTRA 5DRKA 2E9ZA 2CJQA 2VPYB 3CSKA 4DPXA 3DOKB 1K0VA 2V2ZA 3MZIA 2ZJQQ 3LF0A 4WFYA 4I69A 1KP6A 9ATCB 1ICEB 3HHLC 2RILA 5E7OB 1Y10A 2VZ9A 4Y28C 2XS7A 3PACA 4NLSA 2EPIA 2PC6A 2OPQB 1MU2A 1R7IA 2H54B 3PYGA 3ISZA 3OFHA 1VC0A 5KTQA 3E51A 4LFAF 3ENWA 4B9TA 1Q0NA 1RAOA 3CCJS 4F7VA 3VGTA 1RTJB 2CQ2A 2GMJA 3CCVS 2OSQA 2VICA 1T8EA 3WIVA 4DSIA 3J7YI 3HSGA 1YGYA 2PO4A 2YKQA 1IQZA 2ZE2A 3FCWA 1RBOB 2LXUA 3HHKA 3OR1B 2VG7B 3W62A 1F2GA 2WVFA 1U6ZA 2ZZMA 2R42A 4O4GB 2ZH3A 1TQLA 1B70B 3JSBA 2DNYA 1REVA 1XQIA 3FBEA 4ED7A 4NLWA 2WOMB 3GYXB 2KH9A 2NUUG 3SEOA 5KFDA 1GH8A 4KYZA 2IVMA 4XDDA 1PJ5A 2HBRB 3LGHA 1WHVA 2NXCA 3EWGA 1RAJA 2Y1RI 2A2DA 3BN7A 1P8GA 1WHWA 1X4AA 3CMQA 2BABA 2J8AA 2QLJB 1VDHA 3DYAB 3MM7A 4LVOP 1RK8A 4CLFA 3H90A 2KG0A 3EM1A 3G2XA 3HT3A 4FF2A 5AXMA 3BBBA 1EJ7L 4P71A 4R8UA 4IOAQ 3PG9A 4CO4A 1NMEB 2APOA 2OLWA 3MEGA 4IQXA 1XNRJ 1UFLA 2AT1B 2DNNA 2DRBA 1D8ZA 3KUEA 3QATA 2DGQA 2MZQA 5T7LA 3NOCA 2AEMA 1KBRA 1H3DA 2BRKA 2JHEA 4NLXA 1RHMB 3VALA 2EKNA 1Y5NB 3M6UA 3M8PA 3OL9A 3IA0A 3W2WA 3OBIA 3IWLA 3R5BA 3O2IA 4ETXA 2CJYB 1SL0A 4DR3F 2KT5A 3OJUA 2NLWA 3VGVA 4HKQA 3D3BJ 1S1VA 3NGUA 4M5DB 1S72S 5SUHA 2HQIA 1WC3A 1S10A 3O6QA 2G0JA 2DEIA 4AFFA 3AH6A 1TELA 4I67A 3AB4B 2QO3A 5DO2A 3J80U 2FTRA 2OKQA 5MLCV 3T19A 8ATCB 1RT2B 4LRCA 2AEJA 3RR7A 1CJKA 1N0VC 5CCMA 2LKZA 1OMSA 1YIJS 1UA1A 4DF8A 2BW2A 2VG5B 4ZKAA 3G9CA 2VBZA 4OZLA 3TEHB 4D3GA 3BO3A 1TK8A 1IBLJ 4ZN1A 4UW2A 4PXBA 3AXKA 4IRKA 2PEBA 1VLOA 3FBCA 1O5JA 2BZ2A 2DHXA 2GX8A 3BGRB 4NA1A 2ZH2A 1RHJB 2HNYB 3PNIA 2K1RA 4HACA 2LMIA 5KAKA 1TL3B 1MN7A 1DTQB 4CT9A 5CD4A 2VC1A 3H25A 4DXLA 1CC7A 1FJGJ 2HFVA 1NH7A 2DXEA 4DV1J 1KNZA 2IC3B 4LR9A 2X7IA 3TA1A 2EFQA 1U45A 4W92B 1JLGA 2AYGA 3VTIA 2RSQA 3GTYX 4RNNA 1TMMA 4KY3A 4ZPVR 2YPYA 3D6HB 2IAJA 2OI2A 5IOLA 3OTOF 1IWGA 2WZ1A 1KQGB 4P6QA 4PEOA 5B0DA 3TAQA 5D8HB 5CA5A 1VK3A 4NXMJ 4C8ZA 3N9UC 3UWTA 3MOJB 2W2QP 5DS7A 1GNKA 3B4DA 4MTPA 3I31A 1YKWA 1HMVA 2ILYA 2KHCA 1MMNA 4KKOB 2GGPA 4DQPA 2RHQB 2VODA 4R0EA 2HYIB 2CVIA 2FGCA 2AV5A 3AQOA 3D67A 3OHAA 2R7UA 2CQ3A 2B4OA 4HHHA 2OFGX 4NYZA 5JJBA 3SYZA 1N56A 3R7NB 2A2CA 1R0BG 4A46A 1CQMA 2G1HA 2GJFA 2O01C 3ETOA 4K4WA 1HPZA 2D9PA 2ACYA 3MECA 4WTOB 4ECZA 1L3VA 4PCQA 2NUHA 5CYMB 2GIFA 2BQRA 1VBKA 5H9EJ 2CQ0A 3GFXA 1J5EF 1OYEA 2I0XA 2J6TA 2DGTA 1HYSA 3KMSA 1R89A 1RWKB 1ZAXA 2KXHA 3BV8A 5ETSA 3SDEA 1WNEA 3JSMB 2D3OR 4O4GA 3LP1A 4NLDA 2W7OA 3Q22A 4QPXA 1FD8A 1RADB 3BSOA 4NCBA 1RDRA 4WJBA 1U1NA 4PPZA 4NASA 5HSPA 2BJ1A 4EYIB 2FHMA 3TZZA 2W7AA 1NPRA 4OYWA 4CO1A 1VQYA 3V4IA 5KFTA 3VVUA 2ZWOA 4DF4A 2E1RA 1X8DA 3CB4A 1FFWB 4QBUA 1SQFA 3IP0A 1U6BA 1R0AB 1TMJA 3IM9A 1RA7A 1ZM4A 2R8IA 5THWA 5J2PA 2OIHA 1RBLA 2YNIB 3LTOA 3R5DA 4Q8FA 2FZKB 5KFFA 1IBLF 3IR7B 1UEKA 5DZ6A 1AT1B 1F9EB 3IAM9 3IRXB 4OLOA 4ELTA 4OJ1A 3DOKA 3PIPQ 2I8EA 2B7CB 4UZBA 1B99A 1GAOA 4ZN3A 2UUAJ 4ICLB 5L9XA 1E6VA 4KBIA 3ZTQA 4EI2A 3IS9A 3Q2SC 4RX6A 4B3TF 4UOCA 3KUGA 4JP8A 1S0MA 4GKKJ 4YY3F 1UVIA 2JEIA 4ZP6A 2D41A 4M95A 4DV6J 3C66A 2H4WB 3EMTA 1TL7A 2OEMA 3QIPB 2O3DA 2JL9A 3LOUA 4B3SJ 1SC1B 4YN3B 3L7UA 2LDIA 1YRTA 2VF3A 2XMKA 4MIWA 1N8RT 4JI8J 4U7UD 4WFNQ 1NSQA 1QD1A 4KH0B 1SL1A 4G6VB 4XDCA 4QR1A 2XMVA 3SCIE 4MK8A 2KHDA 4J91A 1T9YA 2DNHA 3L7OA 1GQEA 2RKIA 3H59A 3M2UB 3UR3C 2KRRA 5C24B 4X4TA 1S99A 2WCXA 3BKFA 3ITHA 4MYUA 1JLFA 1RT6A 4WIQA 4DCJB 5LSLA 3K8VA 4WK1A 1VC6A 3C8YA 4M5HA 4Y00A 4Z7CA 3LUYA 4Q2LA 1ZTWA 1HBMA 1EP4A 1Y0HA 2ROPA 2XEXA 3VQSA 2IVYA 2M9KA 5IFMA 3QSYB 2CWXA 3HT0A 2DNQA 5DM7Q 4GVLA 3W1YC 1U1LA 3TJ8A 1IKVB 3W65A 1AW0A 2BJEA 2FYXA 4LRBA 5J1PA 2YWFA 4IFVA 4ZCMA 5HMWA 3LO3A 3LP0A 4DSFA 3VVTA 3QFHA 2W9CA 3KHLA 1YJNS 4I64A 1HNXJ 1QLNA 3TX0A 1FVSA 3A8KA 1U1PA 1CJTA 2B9WA 3PRVA 1CSJA 4Y2CA 1KTQA 2ZUAA 4M1KA 5E5NA 3H2LA 3CJSA 2V68A 3MPVA 1RLDA 3CCRS 2C3MA 2XMJA 2YNGB 4WE1A 5U47A 1XR5A 3CJKB 2MJNA 2BE2B 3M8ZA 3UI3A 4XIUA 1HA1A 2MEWA 5I42B 2GC8A 5KFUA 1HI8A 1NO8A 1SKWA 3KJNB 3QJJA 3J7A1 4RBVA 3LP2A 3RRHA 3L9ZA 2QV6A 3R2CJ 2RD5C 3IRWP 4ZHRB 1WG4A 1BQXA 5M2PA 4LR7A 3BQ0A 4DOZA 1RTDA 1NK7A 4ZLNA 3A12A 2BKOA 3NNHA 4F02A 1QE1A 2CUYA 1VISA 3K17A 1X0PA 2A1BA 2M52A 4IFYA 4LBIA 4ZPAA 5C24A 3TZYA 4OYOA 3K58A 1HKAA 1ZTTA 1IKWA 2DO4A 2P8IA 3CCSS 2JX2A 4CP5A 5K8NA 4ILRA 3GSIA 2ZJRQ 1VOMA 2YBVA 1TL4A 1J5OB 2IM3A 2NXJA 4RPFA 1PYTA 2C2OB 2RNEA 4X66F 4CH7A 4LRAA 3ZTPA 3JTOA 4LF5F 3CE8A 3CJ3A 3WDOA 4UF4A 2J8SA 2EC2A 4P74A 1Q8LA 2YTCA 2FVRA 1OY9A 1DQAA 1NK6A 1AROP 1O6XA 2WVCA 6FDRA 1VQ9S 4OV1A 4QYZK 1T02A 2ZH4A 1DQ9A 1SJRA 3KXDA 2MGZB 1YLXA 1RAAB 4IO1A 2CPFA 5FJ4A 4HLBA 1I1GA 3NP5A 3CJKA 1DFDA 4JB8B 1S0VA 4F3MA 2ZVIA 1HBUA 4P7VA 4RU2A 1P1LA 1EZZB 1GX5A 2HBYB 2AP6A 3KUHA 2J7KA 3JQKA 5E3CA 2DHSA 1CJUB 3KK2B 4KH1B 1OQ6A 2VC0A 1JLAB 4MIBA 4OI1A 2MKKA 3O44A 4PZVA 4YEAA 3CJ2A 1TAQA 1OY8A 3R1LA 1LXJA 4N5SA 2CZ9A 1ZM2A 2QLWA 5DG9A 2B6AB 2VFVA 2CDQA 4Y3CA 1X5PA 3CXCR 2GZOA 3GU0A 3V5RA 2R7SA 2XMUA 3PVXA 1SJ3P 2DPJA 4NZ0A 3MPDA 2HWIA 1TVRB 4RL1A 1B7FA 1P9YA 5EWGA 2CPYA 3GLJA 2EK1A 4RKUC 3JB9k 2RHSB 2VKZG 1K0TA 1K47A 1R8AA 3O5TB 3FBFA 1JLFB 1RT6B 1SVDA 4KFBB 3FRYA 3VGSA 4B3RJ 2YKAA 2J5AA 3OXLA 1EKRA 1FDNA 1RHQB 1Z2LA 1FXRA 3Q8SB 2B4UA 5IM0A 3BR8A 2UXDJ 1U0HB 1X4DA 2L3MA 3HDSA 2HNDA 4K8RA 4KO0A 1O8BA 4NCGB 3UPFA 2VASA 3M8SA 1J2VA 2ZD1B 4CIOA 3TUPA 4H4OB 2Y1LB 3KLGA 4I6WA 1U02A 4CLZA 2QFIA 2R7WA 1VBYA 5DQHA 3H7HB 3QZ7A 2VV5A 4TLQA 5A2QY 1KEKA 2EC0A 3UW1A 2AJQA 1QDUB 4BC9A 2XO7A 4FBTA 3H5SA 2CQGA 1G4CA 1TFYA 1RWOB 3D66A 3NG8A 3QRPA 1S57A 1FEHA 3GR0A 3MMBA 4EUVA 5IV3A 2YNHB 2K1RB 3RR8A 3EGZA 3D0GE 1SH2A 2QE5A 1X4CA 4H54A 4WK3A 4Y2IA 4TVAB 3D6TB 1ACMB 3E8OA 5KFQA 4ZCKA 1N5QA 2WW8A 1KFSA 2Q6CA 5KT7A 1HWLA 3TRGA 3HSDA 3QGGA 4G65A 3BGFA 3OTDA 4DPTA 1WORA 4RW6B 3VR1A 4K0KJ 3H5UA 3CD5A 1YJRA 3MMAB 3G82A 4TQSA 3MUVP 2DNMA 2DH9A 2V94A 3HHLD 4EU0A 5F8NA 1ZA1B 1RT4B 1M5OC 1HQUA 3PKYA 2P6TA 1V3RA 2M0GB 2LA4A 3I9ZA 3FSXA 2EFNA 2L9NA 3AJ2A 3POTB 4EZ9A 2IVFB 1FRJA 4N56A 2ASDA 2MLYA 5GMEA 1FD2A 4K7QA 4F3OA 2XNRA 4A8QA 2Y8WA 1CJVB 3M2RA 2HS0A 3I87A 3RB0A 4YB6A 3U02A 1MSWD 1HR0F 4QWBA 3WX8A 2R7XA 1S1UA 2C22A 1OSDA 2BKNA 2D9OA 2DXDA 2ZBCA 2XLKA 3RJMB 2OTJS 2HPUA 2MSSA 2JZ5A 3AT1B 3G8SA 5L1LA 2BQUA 2FLLA 3ZZUA 2YNIA 4FYYB 1SL2A 2VOPA 4LF4J 4IR9A 4ZIVA 2D74B 4IDKB 1APSA 1NH8A 2VQFJ 2ZWPA 5J2MA 2YWGA 1L3UA 1RAGB 3K5MA 3ILIA 1TVRA 2CPDA 3K7RA 4UUWA 2BJDA 4C8KA 4LF5J 1FX4A 2EW9A 1FFGB 1RTZA 4XK8C 4JI5F 3DRRB 3IBWA 2Y1JA 4ILLA 3AB2B 4NA2A 5KFBA 1ITPA 3PYDA 3L95X 2LQ9A 2HHVA 1FHTA 1H73A 1RWUA 3CULA 2GV1A 2MHNA 2RDDA 1YJUA 2OPRA 1X7VA 2G2ZA 2VFSA 5E3PA 3KLGB 4IOCQ 4WE1B 1X0FA 4K2JA 3GIMA 2GMHA 4DV7F 1R8HA 3ELHA 4QOTA 3MR3A 3UE2A 2LQJA 1JX4A 1NDPA 3IR5B 5M2UA 2DH7A 1RTJA 1GXUA 2CJBA 2MQQA 1GMWA 2AYBA 4ZJQA 4LFBJ 2JC0A 1LK7A 2QLXA 1JLEA 1GK8A 4I2QB 4YHHF 3SI8A 4WYLA 3UDCA 5EWEA 4PXDA 5DG7A 1VQLS 2ZITA 2AX0A 1YRXA 4KB7A 2AJ1A 3JTPA 1X5OA 1PG5B 4YDDB 3BSAA 2A6OA 2E7VA 2HFNA 3AY0A 2FDNA 3DU6A 2MZTA 1KR4A 2BM0A 4LSZB 4QPTA 2V5HG 4CYUA 1BQMB 3D54A 4ZLLA 1S6PB 4CLPA 1RT1B 1RQ0A 2AJ4A 3I32A 4OI2A 1NK5A 2CDRB 3KK2A 1PYOB 1SC3B 5AJ3J 2VPZB 2ZH1A 1HNXF 3D68A 3OXGA 4HI1A 1NJXA 3ZZPA 3K5NA 3PX6A 1RT5A 4KPYA 2P2CB 1HQEA 2J9DE 2IFXA 2D7SA 2LQ8A 4ED4A 4XO0A 4LFCJ 4RW4A 1QAXA 2RQMA 2J7WA 1AUSL 3GB0A 5D0GA 3AOAA 4WTYA 5ETMA 4CNYA 3ISNC 1YZ6A 2QA4S 4LF8F 5DETA 1IR0A 2VBXA 2LXFA 1Q7LB 1XEZA 5JUMA 4X62F 3VAKA 4C9DA 1WDTA 3CDBA 4CI0B 1S12A 2FJAB 3TOQA 1A6LA 1SKUB 2O5DA 4PG5A 3T9NA 2W8KA 3OXFA 3M8PB 3S7RA 1Q4RA 3BQ2A 3GYNA 5EX0A 3EVOA 4YB7A 1Y3KA 3M30B 4O23A 3W63A 1URNA 4ITSA 5J2QA 2MYFA 2DPIA 3AJDA 4KV8A 1H2TZ 3PW2A 4NLUA 4HDHA 4J9KA 4B3OB 2QL9B 1X4GA 2FLNA 3ILLA 2AZ1A 2E66A 2HQFA 3FJ2A 3M8QB 4ZOSA 5B0GA 5FIIA 3R7SB 3D2WA 4ZJOA 2QT7A 2CPJA 2IPOB 4NWBA 1OIAA 3HD1A 3NAIA 3KOAA 3OTCA 3U1LA 4HH1A 4QYRA 2HRTA 2CJAA 3D7SB 4LSLA 4L75A 3RRGA 4B3TJ 2XG8A 1IM4A 5G0RB 2IJNA 2Q3PA 4KIAA 2I1RA 3IGNA 3NWGA 4DZDA 2E5HA 3DI6A 5KFCA 1VS3A 4NXNJ 3V6JA 1VIOA 1XNRF 1B0VA 2PD1A 4LSNB 5M2RA 1RYRA 3M2RB 1TK0A 1WTFA 3D28A 3MEEA 4DV7J 1L3TA 2BRLA 1KSPA 3EX7B 3QGIA 2DIUA 2VA2A 4DUYJ 3J7ZT 3OVSA 2FY1A 5DLGA 1XMOF 1NK4A 1SKSA 1VQNS 4WZMA 1CJTB 2FJDB 4NL5A 4QR0A 2UZAA 4X65F 3EVMA 4FKXA 5KFAA 4L73A 2RQCA 2HVZA 3IR6B 2ZH8A 3ZTSA 1VQ4S 1WKLA 1WSRA 4JI4F 1X4BA 3CIZA 4CLTA 3JYTA 4IRCA 2UXBJ 3I0SA 1SJ1A 5D3GB 3H20A 3MM9A 1R43A 2CQDA 2H1YA 5KFLA 4NRUA 2FVPA 2IMOA 2M4MA 2MLXA 1S97A 3MCSA 1HI0P 2NSCA 2CJKA 2O66A 1R6YA 1AZSB 4P75A 3JAMY 4N8NA 2MTLA 1OO0B 5IWAJ 2Z2ZA 1M5KC 3H2UB 5L9NA 2W9AA 2JRSA 4ICLA 3H40A 3F73A 4OX9J 1WG1A 2BACA 4G1PA 5DM6Q 2JLFA 3A3OB 4LF8J 2V6AA 1NKBA 1VBXA 3M32A 5IT9Y 3RUBL 3KK1A 2CZVC 2HFOA 3OFGA 4OZ0A 2X1BA 1EARA 4OI6A 3J81U 4DV2J 4JI6J 4NXNF 2C2EA 2HAFA 4RW8B 1FJ7A 3QGHA 4HH0A 3DC2A 2ZEJA 4F4ZA 4DQRA 4WZQA 3PHEA 2DY1A 2C28A 2CG4A 1Q1KA 4AL6A 5KG7A 2OD4A 3I4HX 4YR2A 2B3TB 3DM2B 1S7IA 1X9MA 2HZAA 1V6HA 3KKFA 4TLRA 3UO0A 1M5SA 5LJ3Y 2FC8A 3FMWA 5DG8A 4DV5J 1HWJA 1QM9A 2ZZTA 4FXDA 4MIAA 3WX4A 1OS5A 2CADA 1HBOB 3C14B 4DPUA 4K4XA 1S6PA 4ENOA 1S49A 2EK6A 2VG5A 3DHXA 4NLOA 2HLTA 4DV4J 1FO1A 2L41A 3K0JA 1F0XA 3D5MA 2XY5A 2YH1A 2RRNA 1RHUB 3VCDA 4F4YA 2VQEF 3Q8PB 1S1XB 4MFBA 3BQ1A 3QPIA 3B82A 5CHCB 2VG6B 3G6ES 4I2QA 2GQQA 3KHGA 2FPHX 4YUDA 1RAFB 3FEXB 2JLEA 5DQGA 3K89A 4HTIA 3KG4A 4AT1B 2HHQA 2XO6A 1HARA 1X60A 2WVBA 3MCOA 4M8LA 3HO1A 4C3LA 3J81Y 3HM9A 2HW3A 2RJZA 2PA8D 4DG1B 1OYDA 4BS2A 3DLGA 4NEZA 4IG3B 1XMQJ 1X4FA 3I6PA 3OW2R 2FLPA 3FEYB 4PABA 2DJWA 4RU9A 3T1HJ 1KHWA 3PO4A 2BANB 5T41A 8AT1B 5IT4A 1ZOTA 2YNFB 5K20B 2ZDPA 3AAWB 1HNWJ 4FF1A 4MYTA 3W2VB 4ED1A 4DSJA 5D0RA 2EWHA 3MAAB 1H7WA 1KQKA 3M8RA 2OPSB 1TUGB 5KFIA 1RI7A 1PKUA 1RT4A 1UVKA 2GIRA 3SQGA 1N54B 2IHR1 3P5BP 2B5JB 1FERA 1FWKA 1DY3A 2QZ8A 2W2OP 3KDOA 1MWYA 1VQ8S 4DJBA 1DTQA 1V5IB 1HR0J 4NZ7A 4RBTA 3GIJA 4EBEA 5DLFA 3BKUA 2XWYA 1BUXA 3BB5A 1T03B 2F8HA 1VLYA 1IR2A 4DV2F 1RT1A 4JV5J 1NB7A 3SZ2A 1CJVA 3C6UB 3DRYA 1IBMJ 4PWWA 3DHWC 2KVIA 2R3VA 3QMQA 2HAIA 5DGBA 2QMXA 3VV2B 4A8KA 1CC8A 3DRPA 2D3ZA 4EO8A 4ZCLA 2SXLA 1B64A 3IN5A 1XWLA 1IVZA 1VMBA 1DURA 2XSJA 1SH3A 2VJUA 2ZDOA 4ID5B 2MZJA 2X51A 2UU9F 3TAMB 4WXWA 4EZ6A 2K06A 1C0UB 2IIHA 1M5VC 2R7RA 3NKYA 2D3O1 2G2OA 2GVDB 3MAQA 3G82B 5HATA 3DLLQ 2BE2A 1RT5B 1U1KA 1HD1A 2UXBF 1GFWB 1KWMA 1OPZA 1Y11A 2D3UA 3HCXA 1RWWB 3M1VA 3DLEA 2EFOA 4HT5A 4PR6A 4A8XA 4ANCA 3KLFA 4FF4A 4PWDA 1V5VA 3CDUA 5A76A 4ZLJA 4HHJA 4FYDA 3L4BC 1IN0A 1F9FA 5HI7A 3PW7A 1FK9A 1WEYA 3EGWB 2OPRB 1X31C 2F7VA 2FZGB 2F8EX 2R7QA 1N34F 2HZVA 3BH6B 1T03A 2F40A 2KT3A 3TANA 5IV4A 2GAGC 1OSCA 5ITHA 5IS2A 2COLA 4IG0A 2Z58B 2DR8A 5D4NA 3QQCD 4U67Q 2GS8A 1VRUA 4LSLB 4ZPWR 3JYTB 1HNVA 2AHOB 2B5JA 1JJCB 2MB0B 3MUTP 3AQPA 4ZVEA 2VQEJ 5AE1A 1UFWA 1OPIA 4JI7F 3SSSA 3D1OA 1BGXT 3T5HA 4ZVFA 4ECVA 3QT7A 4Q2MA 3BZQA 2JFDA 3AFGA 3W66A 1W25A 5J2NA 2ADBA 3IBFB 4B3SF 4G1QB 2HHTA 2HFSA 1QY7A 1YBTA 4JUZA 4P9SA 2NREA 5LMNJ 4RNOA 3D6FB 4YY3J 2KZZA 2HG4A 1RWXB 5HK4A 1FRXA 3DNCA 3PTWA 4RZRA 1QJHA 1XR7A 4Q44A 4CH1A 3OVBA 2HRUA 1F1BB 2YKOA 1KQSR 4A8FA 2ZC3A 2HNZB 2XBPA 3RAQA 1M1GA 1Q82T 4FYWB 1NDLA 2N7YA 3ZNJ1 4USJC 3G87A 4DL2A 5A2QU 2YH0A 4M5JA 1NZ8A 3I5CA 5J1NA 5EGYA 4C8OA 5A6WA 4JYAF 2E5IA 3MDFA 3PDNA 4O3PA 3VWSA 4B9MA 2CVEA 3MWBA 1L3KA 5B09A 3EGVA 4M63A 2ADCA 3KNAA 2OJ3A 4C3MA 1DAXA 2CQCA 3NWRA 3GR1A 3M6XA 4I0WA 1ZZFA 1WJ9A 1VJWA 3D0IE 4RO0A 3Q0AA 3B78A 2XQCA 4C8NA 4ZK7M 2HK2A 2WVDA 1N5SA 3CO0P 2XCAA 2UVRA 4GC6A 1R0AA 4AUKA 4DZ6A 3FK4A 2OGUA 4BHQA 1Y3JA 3M30A 1LOUA 1VRTB 2AGPA 2FJBB 4P10A 3TZXA 2DNPA 3BEGB 1H98A 2HQ3A 2DIVA 1CBKA 3IMQJ 1LWEA 4ZJLA 4PYAA 4J7CA 5H1SV 2QN6B 4DCOB 1RKJA 1SIWB 1BWEA 4ER8A 3I5BA 1JIHA 1UW9A 3EVWA 5GAHU 1RT7A 1XMOJ 1FNXH 5SZTA 4CLSA 4F4AA 4YQWA 3HHDA 3NS5A 1HQEB 2KVQE 3HZEA 2R2TA 4YHHJ 3QAEA 3JTNA 3BS9A 9RUBA 1N48A 1IKWB 3DOMB 1HWIA 3KJQB 4USTA 3RW7A 3W5YA 1I51B 4ZP9A 3OJSA 4X4RA 3V6DA 4Y65A 5DDRC 3GFZA 3C16A 5GAEU 4BDPA 2G4BA 5AE2A 1Y9OA 1YK9A 2CFXA 4F50A 1WEZA 3U7JA 5H9EK 4DUZF 4NRTA 4LF7F 4V19X 2CKWA 1T11A 1Y5IB 4NYOA 4Q7AA 2QC3A 3IWNC 3CMAS 1RLCL 4LMZA 2OELA 3KDNA 5KT2A 1HNIA 2HQDA 4OYIA 4Q5VA 3FBBA 5BJRA 3IFEA 1C1CB 2ZM6J 5H9FK 1SXLA 4LF9J 2RT3A 3BM7A 3B6BA 4O3NA 3RAMA 2HGNA 3FNNA 1LWFB 3FGVA 2RIJA 3PCOB 4ZVGA 3E2EA 4YR3A 2ILZA 5A8RA 4CM2A 5I3UB 3KLHA 3RB3A 4IYQA 4RJVA 3UDLA 1QUVA 1L3SA 4X66J 1FTCA 1HBUB 3BF4A 2LP4A 2QA2A 3W61A 3G96A 4TY8B 2ZH6A 4DS5A 3CTRA 4LF2A 2YKMB 2FD2A 1NUEA 3RBXA 3CCLS 4A8OA 1U8SA 1UAWA 4U8YA 4RNFA 5BR8J 1TKXA 1Z4UA 3Q8YA 4CT8A 3DI6B 3LWMA 3MR6A 3DOLA 3Q89A 1OQ3A 2AYMA 4DR1J 3I0RB 4NE9C 2XLJA 5L38A 2VFTA 5KG1A 4MMOA 4X4OA 4JI1F 4K4UA 1VFJA 4RLEA 1ROFA 2RF2B 1YSJA 4ILMA 1FJCA 1AYEA 2FB0A 4MKBA 1RZMA 3F41A 2XZWA 5DDOC 4QW9A 2R2UA 1RP5A 1CEZA 4JI8F 1JMTA 3M8QA 1B7YB 2A3JA 1NK8A 4D3HA 2F4FA 1E6YB 3RBEA 2H5IB 3DLEB 3NXZA 3G8TA 1H0HB 1S1TA 4DV4F 4UQGA 1MNEA 5FD1A 2Y8YA 2MKCA 1SUQB 2YWEA 3RBDA 3Q86A 3Q8RB 2CIMA 3DMJA 4KHMA 3W8PA 5KOWA 3OHBA 1F3FA 1AFJA 2J6UA 4FPRA 2X1FA 1RABB 2LEBA 3UDVA 5ETNA 3OV7A 1UVLA 1GX6A 2QMUB 2U2FA 2ZHOA 5HQ8A 1N0UA 3WC2A 2F5GA 3T1HF 4UUXA 4E2FB 4DV1F 1U48A 2BYCA 2KO1A 3FDSA 2EFGA 3PJWA 4TU8A 3J7YU 2EBEA 3CC2S 3SCLE 3GZ7A 1WC6A 1SKRA 2M88A 1F3VA 2HWTA 4C2MA 5HO4A 2ZKUA 4LJMA 4F67A 5CCLA 2FC9A 4OI0A 1RAIB 2YWHA 2GNKA 2ZNZA 3MR5A 3MTKA 4FKYA 2B56A 3DDKA 4DFKA 2QIFA 4X2BA 3NOGA 3V6KA 2RS2A 5J2NB 2OUGA 4J9SA 2MQMA 2HRYA 1WKJA 1YJ9S 4EGLA 2CNOB 1SB6A 2Y0BB 3CGIA 1QSLA 1EQ0A 1SPBP 3MMCB 3MPYA 3E01B 4DUTA 5EHHA 4DPYA 2RUGA 2XULA 3MCNA 1AUDA 4J9NA 3SSRA 2ZBQA 2J0SD 2W01A 3QIDA 4LF6F 1YJTA 4ZIWA 1MWQA 3W2VA 2YQ1A 1U2RA 4OYZA 1IKXA 3BH7B 5LMNF 3OD2A 3OFFA 4NLGA 3SFUA 1VQOS 3T3FA 2B6AA 3NY0A 2CPEA 1HWKA 2XYHB 3QFWA 3LANA 3D0HE 2GA7A 1YJWS 5HP1B 3FVYA 3BSCA 5KFRA 4CZCA 4K4VA 1CULA 4L3NA 1N52B 2P9CA 1GXTA 2X3GA 2CA9A 2POKA 3UVJA 2P5VA 3BGUA 3R9LA 3CF5Q 2G0CA 1F5CA 4USHA 4NEYA 1NJZA 2QYGA 2B9YA 4N7TA 2XY7A 1D1UA 4PWDB 3CNQP 4C97A 2LQBA 1VQPS 2AGQA 1NU4A 3MCMA 1N5VA 4PQAA 4JI1J 3RAXA 2XMTA 5HP1A 3DDNA 2CQPA 4HTJA 5KFGA 4LBHA 1C0TA 1FKOB 2V4JB 4C0HA 5L1JA 1TL3A 2FHKA 2EG1A 2RH3A 3MTJA 4KKOA 4DL0C 3TAPA 5GAGU 3W3SA 1C4CA 3MR7A 1Q86T 1LWCB 2CG8A 2Q6BA 5D15A 2B8PA 3UD3P 1QUPA 4TXSA 1JLQB 2DGXA 1YZ7A 2N4DA 3W5ZA 1E6VB 1S0OA 2UXCF 2HBQB 4CLLA 3DMJB 3NGTA 3KLVA 1UJ6A 1WHXA 4NA3A 5IT9U 2F65A 4OZ3A 3GG0A 1FRHA 4KPCA 4DLEA 2FIUA 4DR4J 4I4BA 5CABA 5L1IA 2BKPA 1LFWA 3HHLA 2AIRB 2CXEA 3NCPA 4DEZA 3UCZP 2ACMA 3AODA 2V34A 1GXLA 2M2BA 4IFYB 1VQ5S 3HPOA 2E9RX 4KAIA 4MK9A 4AQYJ 3MR2A 4KE5A 1G2EA 3PXGa 3UCUP 1TL7B 1K8AT 4DWIA 1T9VA 2X3DA 4QWCA 1RYSA 5C25A 1LWEB 4ZHRA 3GFHA 3GP9A 3OLBA 1R8PA 5HL7Q 4C3KA 3C3LA 2EKYA 3HHNB 2YNFA 2F4VF 1NLKL 1MWZA 1GTEA 3ZC4A 1CLFA 5AT1B 3W5XA 2OO4A 3PV8A 2VDIA 2JEFA 1JLBA 2CQIA 2BJ7A 5KFHA 1NHUA 1S79A 3TVYA 1DHMA 2AWZA 2BMBA 4AYBD 2CQBA 2VD3A 3AHPA 4TY8A 2U1AA 4DX8H 1U6FA 2XLIA 4DR6J 1RU1A 1VK8A 1E6YA 4GVBA 1A0OB 2C2DA 4FNIA 3PRDA 3FQLA 1FKPA 3I0SB 4CTAB 1JNZB 3MFIA 2P9EA 3FSIA 4LQ3A 2DKOB 3CWJA 3P96A 3WQPA 1ZYQA 2DNZA 2HS3A 2IYGA 2V9KA 3CCES 4KC5A 5KT4A 3CD6S 5GAGI 1TL5A 4DI6A 3ZZYA 1C1CA 1WF2A 4R5PA 1UFKA 3I0RA 4GVBB 1T0TV 3M9NB 4USWA 4ID8A 3NGDA 1YRUA 2WOMA 5C2GA 1H74A 3TA2A 5HMYA 2E1PA 1NDKA 2YXLA 4LRDA 4RWWA 4DCPB 4ED0A 1HNZF 4J37A 4Y2AA 4WFAQ 4GKJJ 2OAUA 2PT0A 3H4DA 5CYJA 1DTTA 4F0HA 2HHSA 4NCAA 3MF5A 3HZGA 3BO4A 2LDYA 5GADI 3J80Y 3JXOA 4N8OA 1IXKA 1RTHB 3M1VB 4DR5J 3DM2A 2V8DA 1S9FA 4DSKA 2LA6A 1VQSA 1PBAA 2M5YA 3DYAA 2WVEA 1DRZA 2E7WA 2M7SA 2XHCA 1MMDA 2ATCB 1WKKA 4DV3J 2OPQA 1UETA 3QIPA 4RW8A 3GV5B 4R25A 3R97A 1U49A 1HNIB 4K50A 5HQMA 3HHEA 5KG3A 5EDWA 2W4DA 3FZBA 1U09A 1H7XA 3CJ0A 4A48A 2FVSA 2A10A 3IS9B 4ANDA 3OT9A 1XBWA 2CJXB 3I9V9 3PKMA 5C7PA 3JSRA 2WK4A 2VA3A 1H6KX 5LL6d 2V8GA 2RKIB 3L09A 4FPIA 4OX7A 4P52A 2BJ8A 4DV0J 5EWFA 3AJ1A 4F4KA 2DR6A 4C48A 4DUZJ 2YX4A 3M4XA 1S4EA 4YB5A 5E2QA 1IJEB 3KLFB 4UQTA 3RYLA 1WSVA 4DR7F 2E29A 5CZXA 1HHQA 2GO9A 3C6TB 2W8LA 4ECWA 2LVWA 4ECSA 1JLGB 5J2PB 2IRYA 4WF9Q 5ETQA 2UVVA 4QR2A 5JMNA 4KGKA 4Q45A 4GC7A 1U2CA 3VAMA 2HMIA 1F2HA 4CO0A 5DQIA 3QT6A 1MG7A 3QZ8A 1UZDA 2MZSA 2AYEA 1BXNA 2AKWB 5F3TA 5BR8F 2MY8A 1D0EA 1HW8A 1FNOA 2HNZA 2HWHA 1ZPVA 2FHOB 4PG6A 3W2WB 1DTTB 4L74A 1YWXA 3OL8A 4K0KF 2BANA 5HBMA 1LFPA 2JOQA 2C1EB 4FF3A 2NYHA 3AD7C 4H4KC 3TJAA 4IG3A 4RNMA 4F2SA 2B9EA 5KFJA 2I2YA 3PZPA 1X9SA 1RCXB 4DU8A 5L46A 1XMQF 3QYYA 3EJMA 5F8GA 3DLBA 1J5EJ 3VZIA 3H2VE 3G6XA 2E1AA 3MM7B 3R6GB 3EZOA 1KHVA 2VBYA 2E5LF 3NGRA 4N47A 2BDPA 5B0AA 4ZVSB 1NK0A 2L48A 2CRLA 5HQLA 1W2BR 1IBKF 1IBMF 3QRRA 1URRA 1N5YA 5LM7E 1VR6A 1RWVB 4USKA 2ZFHA 3PR5B 3FMBA 3ISND 1VCTA 2CPHA 2CYYA 2KI2A 1JLBB 1WDDA 2JH3A 2DTJA 3MHYA 3W9JA 5HN0A 1VQ7S 1XIQA 1BQNA 4WP8A 3GV7B 4YDXA 4PXCA 4ATNA 2DGUA 4DG1A 3DRRA 4HI2A 4KGZB 2GO8A 1M0SA 1FDAA 4C8MA 2KU7A 4F25A 1BMQB 2HVEA 4L3KA 4UOHA 3W9HA 4PG8A 3M6VA 4DR2F 4IR1A 5J2MB 2HGMA 5DJBA 2HMIB 2ZH9A 1XC9A 2ASYA 3SIPB 3CUNA 1UEVA 4K4ZA 4LBPA 2X1AA 4OZ1A 3MM8B 2VDHA 2EXUA 3AA8A 4UY8T 2ZC4A 2MLZA 2Z2YB 4ZP8A 5JXSA 3M32B 1KOHA 1UWAA 4URGA 3NMRA 2K3KA 3ONQA 3MEDB 1N6QB 1AB8A 3OL7A 2JDJA 2FJWA 1VI7A 2QA1A 2YX7A 2N82B 3PW4A 1DZ5A 5KFYA 1FKAF 3CC7S 1UWBB 1QVFR 1KVIA 1AZSA 1K1SA 1UVNA 2J0QD 3QJPA 1TP7A 3T9ZA 5I3QA 3HK2A 1S0NA 2GVZA 3CCMS 1S1WB 2DISA 1TKZB 2V8PA 2KG1A 1X5TA 3MFHA 2N7CA 2UUCJ 1AFIA 1S5ZA 4Q0BB 4KHPJ 2GJIA 4J5OA 1RU2A 3MM5A 4K4YA 3X3UA 1KC8T 3VAGA 2MY7A 4JI3F 4LVNP 4JI2F 1HLWA 2C2MB 2M3DA 4HL9A 5LSRA 4RUBA 2ZH7A 2R9LA 4X4VA 1KVKA 1P27B 1PBUA 2XSJB 1G1XA 4DX6A 1QSYA 4WFBQ 3IM8A 4UOGA 3KK1B 3V81B 1FXDA 1NJIT 3NLCA 1S6QB 2VFRA 1AA1B 1NSKL 1SBRA 3IWXA 4LF4F 2NZ4A 1WC1A 1BQNB 5KG0A 5H9FJ 2FVQA 3W8GA 3T5LA 4CLKA 2RDJA 2XMAA 4NLQA 2HHHF 1NM2A 1S9EA 2KT2A 1B0PA 1Q16B 1S59A 1RTIB 2R8GA 4FS2A 4NMXA 2KJVA 4E98A 2Q79A 4JV5F 4PUOA 5D3GA 4U6PA 2IM0A 2QRRA 7FDRA 3VGUA 3E3XA 1BE4A 1RHRB 2H5JB 2MQOA 4LIWA 2VOOA 3LGNA 3HJFA 4PQUA 3HULA 5F8IA 2HNDB 4NCGA 5KT5A 1PILA 3TARA 4MJKA 4C4WA 4F3QA 5C2CA 2A18A 4HVZA 2JVRA 4BLGA 3PY8A 1M1KT 3P49B 3ULHA 4P2FA 1H38A 3P3DA 1KLNA 3A13A 1I6JA 3R2DJ 1GEHA 3KJVA 1TKDA 1FEEA 4OYAA 5K14B 1KFDA 3H8YA 3ZO7A 2Y0SD 4IOBA 4IH7A 4PG4A 3OTOJ 2VIHA 2IMWP 3K5OA 2V2KA 2DGOA 2FLOA 3Q24A 3DLGB 4ED3A 2ZZNA 7AT1B 3CVKA 2C3PA 1NPPA 3TW0A 1X9WA 4OHZA 2CPZA 2DNRA 2IYIA 3MM6B 3QWUA 4OYPA 4ZPTR 4ECUA 4DL7A 2R7OA 3ET6A 4USMA 4X84A 5B08A 2GFFA 2VHGA 4CLWA 4LF9F 4JI0J 4MKAA 1HPZB 4DSEA 1WELA 1WACA 1N4LA 4E8UA 1ZAWA 4CLUA 2UUCF 1SQGA 3BYPA 4A8YA 1ULRA 4FBUA 4ZMMA 1TKTB 1ZA2B 5J1EA 4JBCA 1B0TA 3MPWA 3UDEA 3DU5A 1YQHA 2KKHA 3CMES 4XTTA 4OHVA 4M5NA 4Z7YA 4P7TA 2H4YB 2DCLA 4NI2A 1BQMA 2R4FA 1KLMA 3EXYA 4Y34A 3OR1A 3TQEA 4G1IA 5ETRA 4A47A 4OZNA 4AXIA 3KK3B 1RTDB 2R7VA 3TA0A 5DDPC 2J9DA 1UJ4A 2XNQA 1IWAA 3GWCA 2IM2A 2QTWA 4CM0A 4KSEB 3CJTA 3BSNA 1VBZA 1UPPA 2L9DA 3DKDA 4K59A 5E3AA 3SQOP 1PO6A 2PFDA 4EBCA 2R8HA 2G0IA 1F60B 1FE4A 5HVHA 5KT3A 2ERRA 3A4TA 2E5JA 3CCZA 3PJ9A 3LPEA 1MU2B 3QO9A 5KFPA 1FXLA 1IBCB 1GMVA 2YKMA 3BR9A 4DQQA 3N6LA 2J0XA 3HHLB 3DN9A 3Q83A 2Z4PA 3O1LA 1S1TB 1N5TA 1R31A 5CYQB 4FDFA 2XGPA 5A6PA 4P2XA 3TVKA 2JVOA 4CCHA 1S76D 1PCAA 2BXJA 4QIFA 4Y6IA 3CCQS 3SV4A 1U1RA 2EFPA 4YR0A 1LWFA 1NCLA 3MAHA 2W2MP 5LXYA 3OL6A 4CH0S 1SC4B 3DLJA 2FGOA 2CPIA 1MLAA 3ILOA 4HDGA 3HXMA 2HEKA 2ZUGA 2J9CA 4A8SA 5HLFA 3TZWA 5KG6A 1LXNA 2Z0GA 2XMMA 4U96A 4Q43A 2E5LJ 2DO0A 2MKJA 3MM9B 2XC9A 3K5PA 2HURA 4J9RA 2V2VA 3OTBA 1JLEB 2DBBA 3LAKA 4LRFA 3NL0A 4KGXB 5EX3A 5LJ5Y 5A8WB 2R7TA 1NHKL 4QIEA 2CZ4A 1KKHA 3GFYA 3HP6A 3T5JA 3ICLA 4CTAA 2DGWA 5BYQA 4U8VA 1FA0A 3DLHA 3D6MB 4X4NA 3T6BA 1CG2A 1XK8A 4ED8A 1UZHA 1VJQA 1H2UX 5A8RB 2HVIA 4KQZA 3U1NA 4DV6F 4CRJA 4DQSA 3MMJA 1R6VA 1D3WA 3FKBA 1RT7B 4BC7A 2WSFC 5F9NA 2MGZA 2XI2A 2ZVSA 3J7Z5 3LWLA 1NHVA 5KFZA 3R5AA 1IKVA 3KLIA 4DL5A 4B9NA 2LU1A 3FCVA 2XZDB 3PJXA 2P9GA 1N32J 2RRAA 1ZM9A 4H4MA 4V19J 4LUBA 3CW2C 3H5YA 2G2YA 2L08A 3LAMA 4QZVB 5HLFB 3QWPA 4LF1A 2VKRA 3BBCA 3CCTA 4JI6F 5E41A 4IDKA 4OMFG 2LFVA 5K8PA 1JLAA 3C15B 2Z8QA 3NGKA 5K9FA 2PMZD 1G3OA 3MGJA 5HJYA 5IXUA 1XMBA 4CO3A 3D3CJ 3NEKA 4OQJA 2HSEB 4QJVA 3IC1A 4I2PA 4M5IA 2GQCA 1WEXA 3T41A 4AQYF 2KFYA 2DYAA 5FLXY 1ZAVA 4A8WA 1T94A 3KNGA 1S6OA 3WZ0A 1LW0B 2I5JA 4WCEQ 2NQPA 3PFEA 1RWMB 5HBMB 1ZH5A 1JKHB 5EUHA 1V3SA 2WHOA 2XCPA 3ZZRA 3EDQB 4P72A 3GJQB 2V4RA 2CNKB 2DR7A 5BXIA 3H5XA 3OTEA 5KFOA 1PJ7A 2NZCA 2F1FA 4FYXB 4X4UA 4NPOA 2BOPA 1HHSA 4B02A 3KLIB 2DRDA 1RB0A 5HMZA 1RAHB 3FCHA 1MW7A 2WONB 2PN6A 3HSZA 4ZVQB 2QSWA 5K8MA 2WTFA 3JSMA 1BWVA 4NLTA 1KDNA 1SC6A 4YB1P 2WSCC 4DUYF 3MMAA 4O3SA 1LQ9A 1TZ0A 2LQ5A 2MDAA 1LNQA 3LALA 3N5BA 3P5TL 4RW6A 4O3OA 4CDIA 3PX4A 2E1CA 3P6YC 1JXVA 1SQEA 4I7FB 1GMWD 2Z30B 3THTA 4ES1A 1WC0A 4DX7A 1GTHA 2ZBIA 1DARA 1KTVA 2Z2LA 1CULB 3G8QA 5KFVA 3UCGA 4WKYA 2B7BB 3TJ9A 2OPPA 2LXIA 4USIA 4J9UE 1BD6A 2HHHJ 2GCFA 3ET6B 2VL1A 1LWCA 4J90A 1N36J 2IA6A 1SJFA 4PUOB 4NYPA 1YDLA 3NNAA 4DFJA 1HMVB 1LKZA 3RTVA 1EP4B 1C0TB 3HD2A 2OP5A 2J6SA 1FNMA 3LP1B 1LK5A 3CCWA 3DLKA 1FE0A 3M2VB 4WBFA 4Y2KA 3PM9A 2B51A 2Z57B 1T05A 4QYZJ 3KJVB 1FK9B 1JJ4A 4DSLA 5DDQC 1CJUA 2UVWA 3IGVA 3R6LB 1L5UA 4JI2J 2LEPA 2HKEA 3BDEA 4GO5X 2XS5A 5DGAA 3HVWA 3UVJB 4HYKA 4B9LA 3TUIC 2W9BA 5AXNA 3GIKA 4PQUB 1F9HA 5GAHI 1MROB 2BEFA 4A4JA 3VAFA 2GIQA 1IR1A 2RVJA 3B54A 1SCJB 1I3OB 1VQ6S 2NXEA 3I96A 3N79A 1JLCA 3HFZB 3ZTOA 4ID5A 4ZVPB 1R0CB 2HFUA 2J0WA 2BV3A 3FZ2A 4DMZA 5KT6A 3KYLA 3GPAA 3HFVA 2GVZB 2WSEC 3C46A 1S9EB 3SCKE 1KN6A 2NPIA 2G9OA 4PPDA 3RB6A 1VHFA 2H65B 2E44A 2UXDF 1RBAA 4J9PA 4TU7A 4ED5A 3V6DB 1EAYC 5IQQA 4OZ5A 1Z2ZA 1I5OB 1Q7YT 2XS2A 1EKSA 1S6QA 3QLHA 2EBGA 3V81A 2XYPB 1DQ8A 4F4XA 5C42A 3DDIA 2N3LA 3UQSA 4Z2XA 1C2PA 1TKTA 3G6VA 2UU9J 2Q43A 4O0IA 1IM6A 1C0UA 1U4BA 3HVTA 6FD1A 2IBOA 2CNNB 5ETTA 1C1BA 2W2NP 3U27A 5LSOA 5T14A 5CH7B 1KD1T 1Q8IA 3CEDA 1VQMS 2H5EA 3RB4A 3BGRA 3PRBA 3DRPB 1H2VZ 3N0VA 3BPDA 4F26A 5KFEA 2H51B 3V2UC 5GADU 3KK3A 1FVQA 3NAHA 2HS4A 1T7PA 2C2NA 1M90T 3O8WA 1NJWA 4F2RA 2HIQA 3DGPA 1TV6A 3I55S 2M8HA 2VBWA 2H3EB 1CJKB 3CO9A 1HHTP 5G4DA 2LLZA 2MXYA 4HR2A 2DK2A 5IM0B 4F8RA 1HFEL 3ILJA 3L7PA 2QLBB 1LV5A 4OV6A 1WD6A 4NLRA 3S1TA 3OUYA 1MMLA 3HVRA 4JI5J 3KHRA 1T3NA 4WU3A 4DFPA 1JLQA 4G3IA 2V8HA 3T6JA 2FQQB 3EZ5A 1WTBA 2OPSA 2DVIA 2EVZA 2KB2A 1R8BA 3OLAA 2L9WA 4H4MB 4WFXA 2GGPB 2Q66A 3HX9A 2UXCJ 1UMJA 1WOOA 2EEYA 3D1HA 5LMUF 2HQCA 3WBZA 5D78A 5A8KB 1JJ2R 3Q8VA 3LA0A 3R27A 5J2QB 5LXRA 1REGX 3JAMU 1UVJA 1UJ5A 3EYZA 1MROA 1U0SA 4JV2A 1RJJA 4AL7A 5KFSA 2DNOA 1UPMB 2DNLA 4PAAA 1OJ4A 2JWNA 2MQLA 3CJRA 2W9BB 2R2SA 4NMLA 4I7FA 4GKJF 2P6SA 2JC1A 2EG2A 2MPUA 3B4MA 2RE1A 3F56A 1TUVA 4MH8A 4O4RA 1NPKA 2DHHA 2YY3A 2QFJA 2NYIA 3KG0A 3N4WA 2V4QA 4GMKA 3T1YF 2KRBA 1Y5LB 2QGFB 4KJIA 1PYSB 1ZBTA 3DLKB 3M05A 1O51A 3MXHP 4AD6A 2GQ2A 2ROGA 3N28A 3TAMA 3M8YA 4NLVA 1RE1B 4WIIA 1HI1A 3TP2A 2PGCA 1S1XA 1S1WA 2W24A 4MFBB 1JJHA 1XTZA 5AXLA 5GVQA 4RUCA 1IKYB 2QL5B 2D69A 3NGSA 3OSNA 1KS2A 1PIEA 1Z1ZA 4RW7A 4ZLPA 4DR2J 4DR3J 4DQIA 3OVAA 3Q23A 3E01A 4QWEA 3ITHB 4DR6F 1HNWF 1X4EA 3C16B 4CYUB 1FF2A 1K1QA 2WW4A 3MMCA 4FNHA 4PRFA 4O0NA 3QNWB 4ELVA 1WI8A 1FI4A 1WF1A 2F9DA 2KL8A 2XHWA 3FRZA 3P4UB 4ES2A 2VJVA 3V6HA 2GHPA 3HF5A 4C8YA 1EHWA 4LFBF 1VRQC 2C3YA 2ASLA 1VYAA 2MQPA 3R7BB 5J1EB 4OJGA 4YS2A 3JQJA 4EWTA 4DPWA 3ZFVA 5HVGA 2KM8C 4J9QA 3DXSX 2GJ2A 3FQKA 4C11B 3THVA 1QTMA 2KN4A 4X62J 2NR0A 3C6TA 1YX2A 2WB1D 4HHUA 2ZNYA 2HK3A 1RT3B 2GHWA 4U95A 1SH0A 4OI4A 4C8LA 2ZH5A 3KMQA 2CQ1A 4OHXA 4LFCF 1FX2A 2YQ3A 5F3ZA 2MKYA 4Q8EA 3T1AA 3QT8A 1KLMB 2GMLA 3IAS9 3MD3A 3NRBA 4K5SA 2MJUA 4LSNA 4W4MA 3VHQA 4DX5A 2B0GA 3SXLA 4RUHA 5D4LA 5I42A 1HYSB 2EFVA 1WC5A 1FWLA 4ZVOB 2HVHA 1BHNA 2CQHA 2GW8A 3FSYA 4HEA9 4ZDNA 1S77D 5F8JA 4X64J 4X65J 3MM8A 2QLFB 1HBNB 1ZZNA 1IUJA 1HD0A 4DU7A 5EN1A 1RUSA 3PYEA 3DRSB 4IO9Q 1R3NA 2K7KA 4YOEA 4CO5A 4TQRA 2W9CB 4DV5F 1XNQJ 2B9XA 4FXWA 2HIYA 3V4IB 2V9WA 2B43A 1RTHA 2RDIA 4RW9A 5K8OA 2HFZA 3MM6A 2DY9A 5IT0A 1ZS6A 2AMCB 3PO5A 2DNKA 5D0EA 3TR5A 3PW5A 2DB1A 2QMWA 2B8QA 1TV6B 4H4KA 5F0WA 1KVJA 5ETLA 1EQMA 3CJQA 5L39A 1YG0A 1EETB 3CDEA 4U9RA 2ZHBA 3M2UA 2AU0A 3M7VA 2YNGA 1HIYA 3HVAA 2JJ4D 4AXJA 2ZOMA 3POTA 3B8HA 2MHEA 2PSZA 2BW7A 2IM1A 3GJRB 3THPA 2BA9A 3ZZTA 4CO2A 5C25B 1PAEX 1SV5B 2W1BA 1C1BB 4OX8A 1TR0A 4KR0B 2N4CA 5ETPA 3QGPA 2OEJA 1IJFB 1FDBA 4RW4B 3KLEB 1T9UA 2RRBA 3MM5B 4EYHB 1B3TA 4B9VA 1F5AA 2H9ZA 3ETMA 3PFOA 4FP9A 3ADAC 5F8HA 2V67A 4HT7A 2NCKL 3JS9A 4Y2MA 4ZVRB 2VONA 1W7WA 1LEOA 4MKVA 1CPZA 1FESA 1X5SA 5B0FA 5KFXA 2BX6A 1OWXA 1Q81T 2BJ3A 1Q5VA 3C14A 2IJRA 3CJ4A 2OMOA 4GO7X 3W64A 1U8WA 1NNDA 4LREA 2Y9HA 1WF0A 1CVJA 4FVMA 3FUYA 3IG1B 4RR5A 3UFCX 5E3RA 3UNGC 2W7PA 2QX0A 3G4SS 2DR5A 2QEXS 2GVDA 2J76E 2V63A 2IDEA 3R5CA 3US5A 4CWBA 4ECQA 2DR9A 2I9SA 3R8YA 5FDLA 3SBMA 4F36A 1P1TA 1SV5A 1W2IA 3HI9A 3M6WA 2VUGA 5K5MA 2AEFA 2CAJA 2KXFA 3UN2A 3G71S 4WKRA 3NBPB 4K5RA 3R1HA 4B17A 1I94J 2MMYA 4USUA 2CWKA 4URSA 2V0NA 3LQVA 4DS4A 4RWXA 2ASJA 3BGLA 5HMXA 4X4PA 2F63A 4I68A 2LECA 4X4QA 5ADZA 1CS4B 4QWAA 2NS1B 1LWXA 4LF6J 3A3NB 1UKUA 3IRXA 2KDOA 2PE8A 4OFZA 4JI7J 3BYRA 1A7GE 3JQMA 4EFAC 1IKXB 4ZPCA 1K73T 3K2YA 4ANEA 4R5PB 2WB4A 5CYMA 2UUAF 2IY5B 2Z56B 2JNJA 3BBFA 1U1QA 4KHPF 2GHVC 3A8IA 1WOPA 2QYCA 3GILA 3BPSP 4C6AA 2VFUA 5BYSA 2RQKA 5FLXU 3W60A 4TYAA 5JVHQ 1WOSA 1WG5A 5DZ7A 1FKPB 4IRDA 2XWXA 3O3LA 2KYXA 4BCAA 3AXMA 1N34J 3OR2A 5LT5A 5B7WA 3NMAA 1TTHB 2IJFA 2V69A 5KG5A 4L6V3 1JK9B 3HLUA 4UOFA 3TNVA 4WPAA 1PAUB 2WAQD 2O1PA 2KM8B 2XY6A 3KFWX 1FRIA 3EZUA 5IC6B 2HVDA 2KFNA 2R8JA 1P6TA 2UP1A 4YP3A 3PEJA 2J7UA 1S4FA 2IAJB 2AW0A 2CPXA 4RW9B 1S6UA 3DCAA 2KYZA 1RHKB 2QG9B 3PYFA 5BYRA 3MUMP 2B4VA 4F04B 4RUAA 2JFKA 1AXQA 1WC4A 3HVTB 3VAJA 3DRSA 3MOZA 2X1GA 4KRWA 4QQBA 4R0JA 1QAIA 2UUBF 2ZBPA 1FWPA 2A0FB 3IXQA 2XMWA 4URQU 2F8MA 1TKZA 4OX6A 1P9QC 1RTIA 4I2PB 3D1QA 3RU0A 4DN9A 2VU5A 4QIWD 1C4AA 2Z2MA 5HAOA 4IH5A 4FZVA 1N33F 4C7QA 2BVZA 1R8CA 6AT1B 4DR1F 1QE1B 1ELOA 4OHYA 2RF2A 4IQMA 2AF6A 1U2FA 4Z37A 3HMJG 3MEDA 1N6QA 1N32F 2NXNA 5I4MA 2FZCB 4EEYA 1WUUA 4ZVHA 2W4CA 1R27B 3H0PA 3RZAA 1HWUA 4CQ1A 3QJLA 1RT2A 4NLYA 2ROEA 3FFIB 3TX8A 5IWAF 1HQ2A 1HQUB 1VQKS 3P45B 4C11A 1NB2A 5LMUJ 5L1KA 2C3OA 1Y4ZB 2K3IA 3ZXWA 3PX0A 4TNOA 5F8MA 4E0DA 2ZBRA 1SUQA 4J9LA 1TAUA 4OYMA 5C42B 1T9WA 3HKZD 3EE3A 3KG1A 3LPYA 4ZVUB 3BGOP 4C0OC 4DPOA 2DNGA 3BREA 2BE7D 2AX1A 4NLPA 2KZMA 4ZPDA 2DHAA 2FVCA 2BQ3A 4GRSA 4DLGA 2DH8A 1EETA 2IRUA 3CD0A 5MAOA 3F0NA 2OMLA 3QRQA 1HW9A 2FJEB 3M2VA 4L76A 5T7LB 2CQ4A 4F0MA 4RBUA 2HHXA 3CPWR 1M5PC 4ELUA 3EXCX 4W90B 2I6WA 3I4PA 3MI7X 5I3PA 1F6TA 3AD9C 3PIOQ 3AOCA 4DL6A 4LFAJ 3CC4S 4S0MA 1NKEA 3GONA 4QIVA 5C5JA 1S9GA 3MMBB 3KHHA 1FKOA 2V4JA 5KFWA 2YKNB 3JSYA 4Y0FA 3KLEA 1V3ZA 2RAQA 3QBCA 2W25A 3MEKA 1S1VB 4M5DA 2MKHA 2PI5A 2F9JA 2FHJD 3TUJC 3A1YG 3OUYB 2C2KB 4N77A 2MKSA 2NSBA 4KGMA 5AE3A 3K59A 1NAQA 1XN9A 4P2MA 5CYQA 4ED2A 2DEJA 4B3OA 4B9UA 1SI9A 2V50A 4KV8B 3HJVA 3GSDA 3N5FA 5KOXA 4KFBA 1D9AA 2KXNB 2V2QA 2PMWA 2QJ3A 2AJFE 2BM1A 2R2RA 1D09B 1Q79A 3M9OB 3M8WA 1S48A 5A8KA 4J9OA 2R8KA 2VG7A 2XSFA 2ZE2B 1U7LA 5HROA 5IC4B 4ED6A 4OJ3A 4B08A 2UVUA 3C2PA 4IKAA 4OZ2A 4ZCIA 2FJXA 2DD8S 2VH7A 3NS7B 2MZ1A 3R3TA 3RG6A 1T3OA 3AD8C 4NI2B 4O3QA 4ZVTB 3ZTRA 4PKDB 3ZZZA 2C2RA 3CIMA 1LW2B 4CLYA 4KTQA 3WC0A 1FRLA 4LT6A 2NXUA 8RUCA 2PA3A 3HSJA 4ECTA 1M5HA 1S1UB 2HQGA 2BBEA 4UZCA 4P2SA 3CDAA 4DFMA 1CS4A 4KGVB 4BWMA 4WFZA 3BDPA 3KWMA 5F0UA 2OD6A 1FJEB 2YPZA 5D6GA 1CQNA 2VPWB 4ES3A 4ECYA 4B3MF 1IKYA 1FFSB 3CJ5A 1KQFB 2YWWA 4C0BA 4X4SA 3TUZC 1VHIA 4B9SA 2W4PA 2KFZA 4XAKA 3UN5A 4AE5A 2G1DA 4XPCA 1VC5A 4OL8A 1RAEB 2YKPA 5ETKA 3UR0A 3N01A 3CCUS 1I94F 3PHTA 4L72B 3UN3A 4OLPA 3VQTA 4K4TA 1N36F 1B4SA 1GMUA 3PR4A 4QIGA 4LF7J 2YVSA 3CD7A 4O3RA 1QAJA 2EI5A 3Q8QB 1J27A 3W7BA 1N33J 3GV8B 1UA0A 4MKYA 1LW2A 5KG4A 3KLHB 1M1HA 1V9OA 2QSFA 4TKTA 2YQ0A 3LGMA 2DCUB 2UUTA 2AJ2A 2KJWA 1Q78A 4UY85 2IBKA 2C2ZB 1YBAA 3GCXP 2BUNA 3TEGA 4QWDA 3ZNUA 3HFKA 3R5JB 3H4BA 1BY9A 3BO2A 2UUBJ 1JXEA 1U25A 2YKNA 4OX9F 4M94A 1ZPWX 3PEHA 3BKTA 3EUNA 2F3JA 1QAYA 4IG0B 3DXBA 3GIRA 4M5GA 3DOLB 1UCNA 1JLCB 4JI0F 5IQ6A 4KHRA 3EDRB 3M9MB 3CDWA 2PMHA 3DFEA 3DRXA 3J81j 4DBQA 4ECXA 3A8EA 3GG1A 1K44A 4LQ9A 4DL3A 1SJQA 3ZZ0A 3PW0A 1FRKA 5E3QA 3ENAA 4M5LA 3UNYA 3G6YA 2D1CA 2ZD1A 3TVZA 2N3OA 4JV0A 1TUWA 1ZM3A 4DV3F 3RGIA 2FHJA 1G7CB 1X4HA 2BJ9A 2QL7B 3DOMA 2WRMA 2BR0A 5AXKA 1T95A 3IBCB 3Q2TC 1FJGF 4WXOA 4JV1A 4QU7A 1WHYA 2K7JA 1T05B 3MEEB 4ZITA 3EPGA 2AQ4A 2JEGA 3SV3A 1KRPA 1FDDA 1Q53A 4A8MP 3QT5A 2OSRA 3QO9B 4TY9A 4IFVB 5D0HA 2LCWA 1QTNB 5CAAA 3AOBA 2FY8A 3FFIA 1S9GB 2VB6A 5CQGA 5CD4H 3T5KA 1YI2S 5A0YB 3MURP 3A8JA 3ENVA 2OHDA 3GCWP 3WIUA 1HBMB 1RGVA 2ZJPQ 3RRKA 2ATLA 1HNZJ 4P73A 1IQTA 2RU3A 1Y00A 2B4PA 1GT8A 1Q8KA 2RS8A 1H72C 3GJTB 4PG7A 4WU2A 2ZHAA 4ECRA 3GMGA 1RACB 2MQ8A 2OFHX 2ALYB 5AJ3F 1YBUA 4FXVA 2JLGA 4J9MA 1YTYA 1HBNA 3TO8A 3KJFB 4DV0F 3GQCA 2Y1IA 2ALZA 4F0KA 2GAHC 3ZZOA 1NXIA 1U26A 2CNLB 2HHUA 3EGNA 1S7HA 1OY6A 5KFNA 1W26A 2AD9A 3DGPB 4O44A 1WWHA 3C15A 3EICA 4J9VA 3IO1A 4IH6A 4EMDA 3GIIA 5JVGQ 1JQGA 3KTQA 5RUBA 1O0PA 1UVMA 3FC9A 3QAUA 4B3MJ 2G13A 3MD1A 3QSIA 1PC4A 2CJ9A 1A9NB 4M5KA 3VAHA 4JI3J 5HROB 3FEZA 3UD4P 3TQ1A 2DGVA 1JKHA 1YJ7A 2RUSA 4WP3A 3U1MA 4EO6A 3I56S 1D8YA 2ZOGA 1J5OA 1UL3A 1RA6A 1XJWB 5E33A 2PEHA 1NRKA 2FUG9 2XI3A 3H98A 1N5YB 1KOOA 4U7UK 5KFMA 1NDCA 3QLHB 4FS1A 3C19A 5IZHA 1TL1B 5HVFA 2IRXA 5LOQA 2FJVA 2RU9A 2W2PP 1DLOA 2DT9A 4YMEA 4R8UB 3MECB 2RB7A 2I38A 4NZ6A 1NBEB 2E1MC 4PYDA 3SQGB 3LW5C 3TI0A 4LR8A 3NCRA 3RW6A 3CT9A 4PXEA 4RW7B 4N41A 4AL5A 1UP1A 2XYGB 3AA9A 3BN4A 2HBZB 3H42A 4JOUA 2NPFA 3SSQA 1BLUA 4BBYA 4XPEA 5KFKA 3S8SA 1YHQS 4JI4J 5L8RC 1U47A 3K5LA 2E5GA 1PJ6A 3X1LB 1KONA 1TK5A 2H48B 2OPPB 4ALZA 1XERA 2C3UA 4I6AA 1NK9A 5E0OA 4V1Ak 1YJVA 5ETVA 5GMKa 2VPXB 4H4OA 4UTGA 5ETOA 2E9TA 1FCAA 1G6BA 2HLUA 1T9XA 4QCLA 3OQ2A 4FVCA 1JNRB 2ABYA 3WHIA 3SCJE 3SMZA 2OH2A 1Q8BA 4I6YA 1TFWA 2F4VJ 1RCOB 1JXLA 4CNZA
chains in the Genus database with same CATH topology
4ZPBA 5A8WA 3VZHA 1DJ0A 1PGZA 2KTQA 2PDAA 3LP0B 4FN5A 2IC3A 5D4OA 3NS6A 4DL4A 2UUWA 4TU9A 1HNVB 1U24A 1VQ9S 2WONA 2VG6A 3F44A 4MK7A 4NX9A 5CZVA 4YMEA 1XNQF 2ZKTA 2HGLA 4Q0BA 2RQ4A 3IG1A 5F8LA 4QU6A 1RKIA 1YVFA 3EPIA 1UW4A 3OSPA 1VIXA 2JEJA 2XGQA 1VRTA 3OPKA 4X64F 4N76A 3C6UA 2C42A 1LW0A 1HBOA 2I5JB 1F5BA 4O44B 2QA4G 1DLOB 2LEAA 4NOHA 2V8VA 1TL1A 1RISA 2K8GA 2VQFF 3NBPA 1FRMA 2M8DB 1N88A 2M70A 1JWWA 2RMLA 1K9MT 2ZM6F 2XB2D 4KT0C 4YFUA 2MQNA 2O67A 2UV8G 1ZETA 2HHPA 4OJHA 1SIZA 4RNHA 2WBMA 4IUFA 3LP2B 2MZRA 4DHVA 1NEEA 1XR6A 2HZCA 2MSTA 2WBRA 5KG2A 1YITS 1CLFA 4OI3A 1DBDA 5D4PA 3SDEB 4ERDA 3NCQA 4I1TA 2J9EA 2LU2A 5D77A 5K14A 2DRAA 4TYBA 2DGSA 1BC6A 3MEGB 1U1OA 1NJYA 3OR2B 2MKIA 5B0BA 1NKCA 4ETZA 3BJYA 3V4MA 2K2PA 3NNCA 1HL6A 4WYWA 4QW8A 4GKKF 2PIIA 3VAIA 2DHGA 1VRUB 1Y7PA 5F41A 3N6MA 1FT8A 4BWJA 1U1MA 5A0YA 5F9LA 3L3CA 1QVGR 2YNHA 2OTLS 4C98A 3TYTA 4DN0A 4ZA1A 1VGYA 3LH2S 2AJ0A 1PSDA 1TKXB 3N6NA 4DR5F 3HKWA 3S6EA 3SFGA 2DITA 2JSXA 3ENQA 4TN2A 3G86A 4G1QA 3VF0B 4DDFA 1D9DA 2PFFB 4K2XA 4KO0B 3S01A 5G0RA 2LYVA 1RT3A 5B0EA 5I3UA 2Q1LA 5GAEI 2YX1A 2UV8A 5CXTA 1UEUA 3I82A 1D9FA 5FDLB 2PI4A 2E7XA 2YWKA 2AGOA 4OIXA 4MAKA 1WI6A 4I56A 4ZS6A 1QSSA 4DR4F 1NZAA 7FD1A 3K8WA 4OZJA 3GE9A 5B0CA 1JB0C 4B3RF 3K57A 2HNYA 3OFEA 4LIRA 4OHWA 3I5AA 2ZOFA 4PWUA 2HHWA 1REVB 4F4WA 1SJ4P 2IA0A 1UWBA 4EBDA 1PC5A 4U7CA 4ZP7A 5DRKA 1FTRA 2E9ZA 2CJQA 2VPYB 3CSKA 3DOKB 1K0VA 3MZIA 2ZJQQ 3LF0A 4WFYA 4I69A 3HHLC 2RILA 5E7OB 2VZ9A 4Y28C 2XS7A 3PACA 4NLSA 2EPIA 2PC6A 2OPQB 1MU2A 1R7IA 3ISZA 3OFHA 1VC0A 5KTQA 3E51A 4LFAF 3ENWA 4B9TA 3CCJS 3CCVS 1RTJB 2CQ2A 2GMJA 1T8EA 2OSQA 4DSIA 3J7YI 2PO4A 1YGYA 2YKQA 2ZE2A 1IQZA 2LXUA 3HHKA 3OR1B 2VG7B 1F2GA 1U6ZA 2ZZMA 4O4GB 2ZH3A 1TQLA 3JSBA 2DNYA 1REVA 4ED7A 4NLWA 2WOMB 3GYXB 2KH9A 2NUUG 3SEOA 5KFDA 1GH8A 2IVMA 4XDDA 1WHVA 1RAJA 2Y1RI 2A2DA 3BN7A 1P8GA 1WHWA 1X4AA 2BABA 2J8AA 4LVOP 3DYAB 3MM7A 2KG0A 1RK8A 3HT3A 4FF2A 5AXMA 4R8UA 4IOAQ 4CO4A 2APOA 2OLWA 4IQXA 3MEGA 1UFLA 2DNNA 2DRBA 1D8ZA 2DGQA 2MZQA 5T7LA 1H3DA 2BRKA 2JHEA 4NLXA 3VALA 1Y5NB 3M6UA 3M8PA 3OL9A 3IA0A 3W2WA 3OBIA 3IWLA 3R5BA 3O2IA 4ETXA 1SL0A 4DR3F 2KT5A 3OJUA 2NLWA 1S1VA 4M5DB 5SUHA 2HQIA 1S10A 3O6QA 4AFFA 3AH6A 4I67A 3AB4B 2QO3A 5DO2A 2FTRA 2OKQA 5MLCV 3T19A 1RT2B 3RR7A 1N0VC 5CCMA 2LKZA 1YIJS 1UA1A 4DF8A 2BW2A 2VG5B 4ZKAA 3G9CA 2VBZA 4OZLA 4D3GA 3BO3A 1TK8A 4UW2A 4PXBA 4IRKA 1O5JA 2BZ2A 2DHXA 3BGRB 2GX8A 4NA1A 2ZH2A 2HNYB 3PNIA 2K1RA 5KAKA 2LMIA 3H25A 1TL3B 1FKAF 1DTQB 4CT9A 2VC1A 1CC7A 1NH7A 1KNZA 2IC3B 3TA1A 1U45A 2EFQA 4W92B 1JLGA 2AYGA 3VTIA 2RSQA 4RNNA 4ZPVR 2IAJA 3OTOF 5B0DA 5D8HB 1KQGB 4P6QA 3TAQA 5CA5A 1VK3A 4C8ZA 3N9UC 3UWTA 3MOJB 5DS7A 3B4DA 1GNKA 4MTPA 3I31A 1HMVA 2ILYA 2KHCA 1MMNA 4KKOB 2GGPA 4DQPA 2VODA 4R0EA 2HYIB 2CVIA 2FGCA 2AV5A 3AQOA 3OHAA 2R7UA 2CQ3A 2B4OA 2OFGX 4NYZA 5JJBA 3SYZA 1N56A 4A46A 2A2CA 4K4WA 1CQMA 2O01C 3ETOA 1HPZA 2D9PA 2ACYA 3MECA 4ECZA 1L3VA 4PCQA 2NUHA 5CYMB 2BQRA 5H9EJ 2CQ0A 3GFXA 1J5EF 2I0XA 2J6TA 2DGTA 1HYSA 3KMSA 1R89A 2KXHA 1ZAXA 3SDEA 1WNEA 3JSMB 4O4GA 3LP1A 4NLDA 2W7OA 3Q22A 4QPXA 1FD8A 3BSOA 4NCBA 1RDRA 4WJBA 1U1NA 4PPZA 4EYIB 2FHMA 2W7AA 4CO1A 1VQYA 3V4IA 5KFTA 4DF4A 2E1RA 1X8DA 3CB4A 4QBUA 1U6BA 1R0AB 1RA7A 1ZM4A 2R8IA 5THWA 5J2PA 2OIHA 2YNIB 4Q8FA 3R5DA 5KFFA 1IBLF 3IR7B 3IAM9 3IRXB 4OLOA 4ELTA 4OJ1A 3DOKA 3PIPQ 2I8EA 2B7CB 1GAOA 4ICLB 5L9XA 1E6VA 4KBIA 3IS9A 3Q2SC 4RX6A 4B3TF 4UOCA 1S0MA 4YY3F 1UVIA 2JEIA 4ZP6A 2D41A 4M95A 3C66A 3QIPB 2O3DA 2JL9A 3LOUA 2LDIA 1YRTA 2XMKA 4MIWA 4WFNQ 1SL1A 4G6VB 4XDCA 4QR1A 2XMVA 3SCIE 4MK8A 2KHDA 3UR3C 2DNHA 3L7OA 5A6PA 1GQEA 2RKIA 3H59A 3M2UB 5C24B 2KRRA 4X4TA 1S99A 2WCXA 3ITHA 4MYUA 1M5KC 1JLFA 1RT6A 5LSLA 3K8VA 4WK1A 1VC6A 3C8YA 4Y00A 3LUYA 4Q2LA 1ZTWA 1HBMA 1EP4A 1Y0HA 2ROPA 2XEXA 5IFMA 2IVYA 2M9KA 1N8RT 2R7XA 2DNQA 5DM7Q 1U1LA 1IKVB 1AW0A 2BJEA 5J1PA 2YWFA 4IFVA 4ZCMA 5HMWA 3LO3A 3LP0A 4DSFA 2W9CA 3KHLA 1YJNS 4I64A 1QLNA 1FVSA 1U1PA 2B9WA 1CSJA 4Y2CA 1KTQA 5E5NA 4M1KA 3H2LA 3MPVA 3CCRS 2C3MA 2XMJA 2YNGB 4WE1A 5U47A 1XR5A 3CJKB 2MJNA 2BE2B 3UI3A 4XIUA 1HA1A 5I42B 2GC8A 5KFUA 1HI8A 1NO8A 1SKWA 3QJJA 3J7A1 4RBVA 3LP2A 3RRHA 2QV6A 2RD5C 3IRWP 4ZHRB 1WG4A 1BQXA 5M2PA 3BQ0A 4DOZA 1RTDA 1NK7A 3NNHA 4F02A 1QE1A 1X0PA 2A1BA 2M52A 4IFYA 4ZPAA 5C24A 3K58A 1ZTTA 1IKWA 2DO4A 3CCSS 2JX2A 5K8NA 4ILRA 2ZJRQ 1VOMA 1TL4A 1J5OB 2IM3A 2RNEA 4X66F 4CH7A 3JTOA 4LF5F 3CE8A 3CJ3A 3WDOA 1Q8LA 2YTCA 2FVRA 1DQAA 1NK6A 1AROP 6FDRA 4OV1A 1T02A 2ZH4A 1DQ9A 1SJRA 2MGZB 4IO1A 2CPFA 5FJ4A 4HLBA 1I1GA 3NP5A 3CJKA 1DFDA 1S0VA 4F3MA 1HBUA 4P7VA 4RU2A 1P1LA 1GX5A 5E3CA 2AP6A 2J7KA 3KK2B 2DHSA 2VC0A 1OQ6A 1JLAB 4MIBA 4OI1A 2MKKA 3O44A 4YEAA 3CJ2A 1TAQA 3R1LA