2DGOA

Solution structure of the rna binding domain in cytotoxic granule-associated rna binding protein 1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
115
structure length
115
Chain Sequence
GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Cytotoxic granule-associated RNA binding protein 1
publication title Solution structure of the RNA binding domain in cytotoxic granule-associated RNA binding protein 1
rcsb
source organism Mus musculus
total genus 13
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgoA01
2MSSA 2JWNA 1RK8A 4V19X 4LIRA 2CJKA 1WEXA 2CPJA 3D2WA 3IWNC 4ED5A 1HA1A 2DNOA 3G4SS 2YKAA 2RU3A 2AYGA 2BZ2A 1W2BR 1K73T 2RVJA 1X4BA 1X4AA 5DM6Q 3PIPQ 2CPIA 3EX7B 2LECA 1R8PA 3J7ZT 3CCES 1VBZA 4IOAQ 1WTBA 1YI2S 2J0QD 3EGZA 1JJ4A 1JJ2R 2YH1A 4RU2A 5D78A 2AD9A 3G8TA 2N3LA 2VOPA 1B7FA 1U6BA 1U1KA 2MHNA 1UP1A 3Q2SC 1O0PA 3VF0B 2LXUA 1WG4A 1YJ9S 4YUDA 5D77A 5BJRA 1K8AT 2MGZA 2FHOB 3UWTA 4C7QA 1JMTA 4WKRA 4YOEA 2DB1A 3RW6A 3MOJB 2M9KA 2WBRA 4J5OA 4QU6A 3HHNB 1VC5A 3UE2A 1N88A 4LJMA 3U1MA 3CC2S 2VONA 2U1AA 2X1AA 1YWXA 1VQMS 3P6YC 3S01A 1HD0A 3S7RA 2OJ3A 3S8SA 2CQDA 1SXLA 5GAHU 3L3CA 1URNA 2XS5A 2NZ4A 3MD1A 2CPFA 3VAFA 1VC6A 3UD4P 1CVJA 5GADU 4QQBA 2MB0B 5H1SV 3NNHA 4TLQA 2MMYA 3UCGA 2DHSA 2CPEA 2I2YA 1Q81T 1X4HA 2MJNA 3BO2A 4Z2XA 3MDFA 1H2UX 1KOOA 2GO9A 2KVIA 1VQLS 2MQMA 1X5OA 1U1QA 2AYMA 2DO0A 1WG5A 3VAKA 2ADBA 3V4MA 4BS2A 4UY8T 1WF2A 1WEYA 1H2TZ 1DZ5A 2KU7A 2CQCA 4CH0S 2MQPA 3VAHA 2X1FA 2CQ4A 2OSRA 3CCVS 2DGUA 5GAGU 3U1LA 2YTCA 1PO6A 1AUDA 1DBDA 2EK6A 1R8HA 2D9PA 2M2BA 3SDEA 3UCZP 1VQ7S 5ITHA 3J7YU 3B4MA 3CCSS 1N52B 1WWHA 4YB1P 3MXHP 2G1DA 2L41A 3S6EA 3FEYB 1Q82T 1Q7YT 2CQ1A 1FHTA 2MKHA 3CTRA 2CPDA 3P5TL 2N82B 2KM8B 2CQGA 2HVZA 2KFYA 3NMRA 2MKSA 3SXLA 5LXYA 3MUMP 2M4MA 3R1LA 3P49B 2FC9A 2U2FA 5IM0B 1U1RA 3US5A 2MZJA 2G4BA 2CQ0A 3G71S 2MKJA 1N54B 4F26A 1FO1A 2HGLA 1D9AA 2KXFA 1VQKS 2KG1A 5LSOA 1WELA 1U2FA 2RT3A 2X1BA 3VALA 3NS5A 3MUVP 2L08A 2M70A 1SJFA 4CQ1A 3CC4S 2RQCA 2SXLA 1SJRA 1X4CA 3DXBA 1WI8A 4M5DB 2DIVA 1M5KC 2ZJRQ 2CQ3A 4PKDB 2DHAA 4C0OC 4Y00A 1VQ8S 5IFMA 2RS8A 1JJHA 2M52A 5GAEU 1X0FA 2I38A 3Q2TC 2X1GA 4F25A 3CCMS 3CMAS 2F3JA 2LMIA 2ZJPQ 1M5VC 2KG0A 5DDQC 2G0CA 1P27B 4WF9Q 2JVOA 2D9OA 4FXVA 1OPIA 2VODA 4IO9Q 3CXCR 2GHPA 5JVHQ 1DRZA 2MZRA 5CA5A 1X4DA 1WEZA 2KXHA 2ADCA 1X5SA 3CCRS 2F9DA 3CCLS 1FJCA 2DNYA 1KOHA 3H2UB 5CYJA 1VQNS 3NNCA 2YH0A 3MD3A 1M90T 2F9JA 2YWKA 3BO3A 1U1PA 3VAJA 1VQPS 3P3DA 4CH1A 1FNXH 4QPTA 1X4GA 3I56S 1WHYA 2K8GA 2MZSA 1H6KX 1X4EA 2DNKA 2N7CA 3OW2R 1VQOS 3G8SA 3MUTP 3G6ES 2KYXA 2A3JA 4F02A 2EK1A 2MQQA 1ZZFA 3LPYA 4TU7A 2CQBA 3CF5Q 2RRAA 1YJNS 3RW7A 3I55S 4Y0FA 1ZH5A 2XNQA 2OTJS 1IQTA 2ERRA 1X5PA 2UP1A 2M8DB 3CMES 2CPHA 3CCUS 2KI2A 2DNGA 4OZ1A 3JB9k 1NU4A 2LA6A 5LJ5Y 2XS7A 1ZZNA 3B4DA 2DNHA 3TP2A 2MKIA 3PIOQ 1XN9A 2JRSA 1FJEB 2DNRA 1VQ4S 2RQ4A 2E5JA 5DDOC 1VQ5S 1OIAA 1KC8T 2OSQA 3BS9A 3G9CA 4IOCQ 1YTYA 2V94A 3EGNA 1OWXA 1U6FA 2KXNB 2XNRA 3VAMA 1U1LA 1UAWA 5GVQA 2LCWA 2O3DA 2MKCA 3VAIA 2CPZA 1RKJA 1UFWA 2KT5A 3N9UC 1VBYA 2PEHA 2DIUA 4TU9A 1P1TA 2MPUA 3FEXB 2DITA 4ZKAA 2E5GA 3HI9A 2DNPA 2OTLS 2RS2A 4C4WA 1WG1A 1SJ3P 3K0JA 2DGQA 3BO4A 2MY7A 1X4FA 2XSFA 3H2VE 1VQ6S 2DNMA 5LXRA 5IM0A 2MZTA 1YHQS 2DK2A 3THTA 1D8ZA 4UQTA 2BOPA 2MY8A 2CPXA 2DNQA 3G96A 2KHCA 4OZ0A 1QM9A 1KD1T 4P6QA 1FJ7A 2RUGA 3DLLQ 1DHMA 3UCUP 4EGLA 4TU8A 2DGOA 2CQIA 2FPHX 2DHXA 2QFJA 1A9NB 2LQ5A 3NS6A 4WFNQ 1U1MA 4ERDA 2KRRA 2KRBA 1WHWA 2LEAA 2MZ1A 2DO4A 2LYVA 4WIIA 1YJWS 2DGSA 2ZJQQ 1N8RT 2LXIA 2DH9A 2K3KA 2MQLA 3MI7X 2DNZA 3THPA 3R1HA 2LA4A 4A8XA 1QVGR 2B0GA 2MYFA 3LQVA 5LJ3Y 4U67Q 1YIJS 1FXLA 2KH9A 2CQ2A 2DISA 3ZZZA 2M88A 3MURP 3CPWR 1M1KT 2MQOA 2JX2A 4LMZA 2HYIB 2JVRA 1HD1A 2MJUA 2QA4S 2E5IA 4W90B 2DGXA 2FC8A 2MGZB 4CIOA 5DETA 2CPYA 2M7SA 2J0SD 2XB2D 1M5OC 2E44A 1X5TA 1UW4A 1K9MT 2J8AA 2PE8A 2DGVA 3CD6S 2HZCA 1WF0A 2HGMA 1H2VZ 1U1OA 1A7GE 2L9WA 4WCEQ 2DHGA 2AYBA 3IRWP 5CXTA 5DDRC 1BY9A 1S72S 3SMZA 1PGZA 5LSLA 2MKKA 4W92B 2OIHA 3BEGB 2AYEA 2RNEA 1S79A 4IUFA 2MSTA 2D3OR 2MQNA 1WHVA 1OO0B 2CQPA 5DM7Q 4FXWA 3CC7S 5HL7Q 3CCQS 2DGWA 5GMKa 3R27A 2E5HA 2HGNA 4WFAQ 1KQSR 1VBXA 4WFBQ 2KN4A 5HO4A 2FY1A 1QVFR 1VC0A 2J76E 1WF1A 3ZZYA 5JVGQ 2LEBA 4QU7A 1FT8A 3TO8A 2DGTA 2DNLA 1WHXA 1YITS 3ULHA 5IQQA 2RRBA 2XS2A 3TYTA 2QEXS 4PR6A 1SJQA 3SDEB 3CUNA 5MLCV 1U1NA 3NNAA 2M0GB 2DH8A 2NLWA 1F9FA 3VAGA 2VOOA 3CCJS 2MXYA 2DNNA 2M8HA 2MZQA 5FJ4A 1SJ4P 5EN1A 1NO8A 5DDPC 1NJIT 2CQHA 2N3OA 2Q79A 2DH7A 1WI6A 2KM8C 1HL6A 1VQ9S 3CULA 3UD3P 2EVZA 1M5PC 4PRFA 1G2EA 1Q86T 1L3KA 2LKZA
chains in the Genus database with same CATH superfamily
2XGPA 5J1NA 4J90A 1JK9B 3W66A 4RW6A 1IR0A 1J5EJ 3DU5A 1I51B 4CO3A 5C2CA 3MPYA 3TVZA 3FJ2A 3EDQB 1FFSB 2C2RA 1UVKA 3FZBA 4DG1A 3VF0B 3SCKE 2ACMA 2HMIA 4ZCIA 1RT2B 2FHOB 2BJ8A 1W7WA 4HYKA 4J5OA 1AYEA 3CD5A 1HLWA 3DLKB 4K5SA 4DSLA 1FWPA 5KFAA 1RLDA 1YGYA 4HH1A 4JI3F 4LF4J 3GQCA 3MWBA 1GXTA 2CPEA 5DQIA 1S97A 2EG2A 4C3MA 1MROA 4MH8A 1TK8A 1KOOA 3I96A 4FYWB 1FDAA 2IM1A 4Y6IA 2AJ2A 4UY8T 1JLEA 2YQ3A 3CCWA 5J2NB 2E1CA 2OSRA 2V4QA 1QDUB 3TR5A 3W2WB 1PO6A 1T9VA 4J9RA 2CDRB 1S6UA 2FZGB 2AU0A 1OSCA 1B0PA 1Q82T 2MKHA 2W2MP 4F26A 2QE5A 4C48A 3HVTB 4RNFA 3M9OB 1WELA 1YJTA 1DTTB 4CQ1A 3UDVA 1F5BA 4I7FB 2ABYA 1U48A 3OXGA 5IT9U 2RS8A 5B0DA 4ED4A 5DG7A 4F25A 2K3IA 1C2PA 2ZZMA 4NA3A 5JVHQ 3UW1A 4OZNA 3FCWA 3MFIA 3QIDA 4MK7A 3MD3A 1M90T 2H3EB 3IXQA 5DG9A 2ZC3A 1HNXJ 3TZYA 3VAJA 4CH1A 3SI8A 2J7UA 2XWXA 2OPPB 3P8BB 4NLOA 5AXMA 2MZSA 3W9JA 1TKTB 1H72C 3KLFB 2CVIA 2WONA 1XEZA 4DX6A 1RHQB 4JV5J 1YJNS 3RW7A 3W8GA 2C2MB 3I5BA 1V3RA 4MKVA 3R5AA 3DGPB 5D4OA 3ZZPA 3B4DA 2DR9A 4WU3A 2DY1A 3P45B 4L6V3 2AX0A 3CVKA 2YNFB 4ZLPA 3SQGB 2XEXA 3K5PA 3NGTA 4MKYA 1U1LA 1PYSB 4JI6J 2FYXA 3R2DJ 4MTPA 4USIA 1UFWA 1TL7B 1Y3JA 1RT6A 2DIUA 2VDHA 4NLWA 3CIZA 1U6ZA 3FBCA 1V5VA 3OPKA 3FC9A 3MEKA 4IG3A 1T9UA 3PHTA 3Q8YA 3IBWA 4I6WA 2P9CA 3G96A 4C8ZA 3W5ZA 4I64A 1OY9A 4EGLA 2FPHX 4L75A 5D4LA 1IBCB 1NK5A 3D7SB 4RO0A 4DV2F 4BBYA 2XY7A 1W26A 1TUVA 3M2UB 1UZHA 3QAEA 2DGSA 4C98A 2JJ4D 1QVGR 3ILLA 5LJ3Y 3MR6A 4FKXA 2HQ3A 2F8EX 1XK8A 4USJC 3HLUA 2WOMB 4ZVTB 2YNHB 3CPWR 1IKYA 3FSIA 1HD1A 3JS9A 4RW8A 1P6TA 1HNXF 3K89A 2UXCJ 4FPIA 3GIIA 3KK3A 1GX6A 3RRHA 4WFXA 4JV5F 5CHCB 5KFUA 3V81A 4ID5A 3E51A 3N6LA 1YSJA 2LQJA 4ZN3A 2HNZA 4XDDA 5J2MA 2RNEA 4C8KA 4CCHA 2E9ZA 1AT1B 3FQLA 2B5JB 3GWCA 2BXJA 2E5HA 2J76E 3KYLA 1OY8A 2OMOA 4K0KJ 2DNLA 4DPOA 3RBDA 3QATA 4DI6A 2HIYA 1SQGA 4OYIA 3VAGA 3PYGA 2OEKA 3CCJS 1MG7A 2JHEA 4EYHB 1CULB 4NYZA 1ROFA 4B9TA 2FVPA 3NCQA 1D0EA 3T1AA 3SFGA 1OMSA 2A10A 3TX0A 3R5BA 1R89A 3UD3P 2B6AB 1KQFB 4E98A 3NGDA 2OMLA 1DLOA 1ZA2B 4DXLA 2ZFHA 3DOLA 1FRKA 5DM6Q 3J7ZT 3FRYA 3BN4A 1JJ2R 4ED8A 4RWWA 2OPRA 1B7FA 1TKZB 2UXCF 1N0UA 1GMWA 4C7QA 4ZPVR 2XLJA 4IR9A 2VF3A 2VONA 2EEYA 4WYLA 2VG5A 2Z0GA 2G9OA 1JLCA 1SL2A 3AQOA 1P8GA 3GR0A 2IRXA 3QT6A 4A8FA 3OHBA 4Q2LA 1Q81T 1X4HA 4UZCA 4ZVRB 2B7CB 1S1VA 4OX6A 3EWGA 1SV5B 2ZZNA 4FVMA 3CW2C 2B51A 4P72A 4A8YA 4K0KF 3GMGA 3CCVS 1EAYC 5KAKA 5HAOA 3LWMA 2XO7A 4NXMJ 1HNZF 1RTIA 2BKNA 3T9ZA 1NAQA 1XWLA 1R8CA 1B3TA 3RZAA 3G71S 1RTHB 1L3SA 2NPIA 1RT5B 1U0HB 4KKOB 4L3KA 4N77A 1WD6A 4QBUA 1M5KC 4PKDB 3M9MB 2VFRA 5H9FJ 4I68A 2GS8A 1S57A 4H4KA 2ZE2B 2F3JA 3GLJA 3TI0A 3M05A 5F3ZA 2D9OA 5E5NA 5IT9Y 1OPIA 4IO9Q 2C42A 3R5DA 5IOLA 2HRYA 3Q8PB 1WEZA 1RBLA 3HHKA 1TL4A 1RT2A 4C6AA 1FJCA 1KOHA 3CJ3A 1QE1B 2XMAA 1FD8A 4LVNP 4QPTA 3ZXWA 3NOGA 3M8WA 1FXRA 3MTJA 1YK9A 3SZ2A 3DFEA 3MUTP 4TNOA 2P9EA 4K8RA 3CF5Q 3NOCA 1LQ9A 4DCPB 1HBOB 2IM0A 1FRXA 1NU4A 2HQFA 2BQRA 4KIAA 4CO1A 1ZPWX 3TP2A 2JH3A 2MEWA 1HW8A 2HHPA 1UZDA 3AHPA 4CM0A 3IA0A 2BR0A 3EGNA 2VU5A 2KKHA 1FRMA 4Y65A 5J2NA 3LAKA 3W2WA 2KT5A 3HZEA 4DF4A 2UXDF 1B0VA 2R7SA 3TAQA 1P1TA 2RS2A 3C6TB 2DGQA 2YWHA 2MY8A 2DNQA 2V2KA 4I2QB 3HVTA 1FJ7A 5CCLA 3RB3A 1DTTA 3T5JA 4B3OB 1A9NB 5HQMA 4X4SA 3ZTPA 1NZ8A 5KFGA 2MHEA 3RG6A 3PR4A 4I7FA 3R7BB 3Q8QB 1R6YA 2FUG9 5LMUJ 3D0HE 2ROGA 5B0AA 1Q8KA 1N48A 4DSEA 3I5AA 3PKYA 3MURP 1M0SA 4BWJA 4D3HA 3OLAA 1R3NA 2QSFA 1VBKA 4RUBA 3JXOA 4W90B 1RWVB 5DETA 4CLFA 2ZM6J 4YDXA 2OPPA 2J0SD 1M5OC 2E44A 2ZVIA 1TKTA 1T9XA 5HMXA 3KLFA 2HZCA 4NI2B 4QIGA 4J9MA 1S72S 3CWJA 1WOPA 3PX4A 4LR9A 2AYEA 3DGPA 3V6JA 1S79A 5CYMB 1RWUA 1WHVA 4ZJOA 1FTRA 1YZ6A 3OSPA 2LEPA 2YNFA 2F4VJ 5GMKa 2ZWPA 1FJGF 1FA0A 2CZ4A 3ZZYA 5JVGQ 4PUOB 1X31C 1FDBA 1WHXA 3G6VA 1TL7A 2IC3B 4OJ1A 4CO2A 1K0VA 4YR2A 4X84A 1G6BA 2H5EA 4K4ZA 3L7PA 1K44A 4LSZB 3HULA 1NO8A 1KONA 2CA9A 1NJIT 3RU0A 1GT8A 3CB4A 1HWKA 2GNKA 1N5QA 5SUHA 1MSWD 2ZWOA 3IRXB 3M2UA 4CLUA 3KK1B 2VPYB 2AYGA 4P52A 3NGRA 1YJ7A 2B8QA 1TK0A 4P2MA 2YH1A 1DFDA 3ETMA 2YNHA 4LSNB 2UV8A 2MHNA 2FVSA 1D9DA 2ZM6F 1JMTA 3X3UA 3D54A 1RACB 2LP4A 2QL5B 2WBRA 2F65A 2FLPA 2ATCB 1NK8A 2KJWA 2GHVC 3MTKA 2OJ3A 4N41A 3GFYA 4OHXA 1BQXA 3OJUA 1U8SA 1FRJA 1FF2A 4P9SA 2MB0B 2XQCA 5H1SV 3JQMA 2IVFB 4PWUA 3OVSA 2DPJA 3C6UB 4YHHJ 1UMJA 4GKJJ 2F4VF 3ZTRA 2B5JA 8AT1B 3HMJG 2AMCB 5KFJA 4Q8FA 4TXSA 3NXZA 2HQDA 1RWPB 1RZMA 2KU7A 4V19J 1R27B 3DU6A 4CH0S 1S77D 4KC5A 3CJ2A 4DV7J 2E66A 2NR0A 3MXHP 5D4PA 3I82A 3BSOA 3AD7C 3P49B 3MPUB 4F04B 3BREA 1RT7B 4MIAA 2FLLA 2B6AA 1NPKA 1PJ7A 2ROEA 4OQJA 3QLHA 1LWEB 1OYDA 2HBQB 5F8IA 4M5DB 2RILA 3KHHA 4IH6A 3O5TB 4UQGA 3CJ5A 2XG8A 1S48A 5L1KA 3Q22A 3GG0A 1H3DA 3UNGC 2YBVA 4JYAF 1X9WA 1TKZA 4B08A 1LW2B 3BYPA 3HXMA 1HMVB 5H9FK 4O3NA 3JQKA 3PNIA 4DR1J 4FYXB 3I56S 1EKRA 1VQOS 3G6ES 4WTYA 2C3UA 2MQQA 3ZZUA 2OTJS 1SBRA 3Q8SB 5L1LA 4J9SA 3Q24A 4GC6A 2CPHA 2AP6A 2DCLA 4YHHF 4M63A 1VR6A 4ZN1A 3GJRB 3PIOQ 4OI6A 4RWXA 2IA6A 1RAEB 1SV5A 2E5JA 3J81j 4IOCQ 5AE2A 3I0SB 1YZ7A 2PEBA 1J27A 4ZK7M 3CDEA 3CJ0A 4OYMA 3G8QA 3WDOA 4N76A 4WZMA 2K7JA 1E6VB 3PRDA 1PSDA 4LRFA 5DZ6A 3MFHA 1QM9A 2NXCA 1RTHA 2BJ1A 1U0HA 4KKOA 2DEJA 3DRYA 2HZVA 1WTFA 4UTGA 2XLIA 4L74A 1FCAA 3BGOP 3MM5B 1Y00A 1EQMA 2DNZA 5J1EB 2B9EA 2ZE2A 1RKIA 2V8DA 5DG8A 5HROB 2MLXA 3C19A 4MK9A 3QT7A 3BPSP 2QA4S 4CH7A 2FJEB 2ACYA 5I42B 1OS5A 1QE1A 5CYQB 4NWBA 4QIWD 4DR1F 2J0WA 4MYTA 3M32B 3PACA 1YX2A 5HVHA 4ZJLA 1KEKA 3OV7A 2FD2A 4DQQA 4IQMA 4M5MA 1NRKA 2BKOA 3FKBA 3CIMA 1HBOA 1UJ5A 3JSYA 4ED2A 3CGIA 1OO0B 4DL0C 2DGWA 2KN4A 1NHUA 1GEHA 1QVFR 4C9DA 4ECZA 1G4CA 4U7UK 1WOOA 4GO5X 1HQ2A 2NSBA 3N5FA 2H4YB 4FPRA 3FFIB 2UVVA 2GA7A 3SSRA 2HEKA 1VK8A 3C6TA 2HZAA 3KG4A 2UUAJ 3LP1B 1FTCA 4YS2A 3GYNA 2N3OA 2BMBA 1VQ9S 4I2QA 1L3KA 2ZH7A 2C2OB 2CJKA 1QJHA 4EEYA 1M5HA 1Q79A 4ED5A 1HA1A 3G4SS 4RLEA 3RGIA 3BGFA 3PO4A 2RDJA 1K73T 3CDAA 4OHWA 3M4XA 5KFVA 4WZQA 2R2UA 1YI2S 2J0QD 3KHRA 4KO0A 4RW7A 4OX9J 1QLNA 1LFWA 5C7PA 3AOBA 1O0PA 4X65J 4ENOA 1SH2A 3AODA 2W2NP 2R8HA 5CH7B 2X1AA 3GSIA 4NI2A 1NK6A 3FRZA 3FSXA 3KMSA 2XI2A 1FI4A 3QFWA 5CYMA 2MJNA 4Z2XA 4AE5A 2HFVA 5I3UB 4LF1A 2VQFF 1NUEA 3QAUA 4TQRA 5GADI 4C8NA 3N6NA 3PJ9A 3V5RA 1DZ5A 3POTB 2CQ4A 5HQ8A 2IC3A 2YTCA 2RKIB 1AUDA 2EK6A 3QWUA 5KG3A 1UVLA 4YB1P 1FNMA 4LFCJ 2ZH2A 2RF2B 2UUAF 5B0FA 3CTRA 1NDKA 2ZD1B 2F4FA 4X64F 2KM8B 3B82A 2XO6A 1XTZA 3D1HA 1UW9A 1JX4A 3W2VB 2KXFA 4OYZA 2RQCA 2VA3A 3IRXA 5D15A 2G2OA 3KK1A 2DHAA 3GCWP 2OP5A 1IBKJ 2R8KA 4KR0B 1KHVA 1TR0A 2K7KA 3L9ZA 4JI5J 2PSZA 3NWRA 1RAHB 2GC8A 1Y7PA 1WC5A 2JVOA 4LSNA 2QMXA 3GU0A 5CA5A 4OZ2A 1X5SA 2UU9J 1S5ZA 5GAEI 1D9FA 4QCLA 3HM9A 1APSA 5D8HB 1EJ7L 2HW3A 2KZMA 3UNYA 4URSA 2NXNA 2QG9B 5CQGA 3MMJA 1PCAA 2UUBJ 2A3JA 4G1IA 3UDLA 4QZVB 3H0PA 3MCNA 2EK1A 1VCTA 3B8HA 1FEHA 2M8DB 1SC4B 1R0AB 3C6UA 2KI2A 3TANA 3K5OA 3D66A 5KFQA 9RUBA 2DNRA 3DMJB 3JSRA 2GVDB 1E6YB 2XTJP 3R9LA 4ZITA 2LXFA 2R2RA 2LQBA 3TA1A 1FDDA 3DM2B 4OZJA 2DNPA 4QR2A 1HHQA 4UUXA 2MY7A 3H2VE 4GVBB 1XMQJ 4OLPA 1RT7A 4NL5A 3PZPA 2VPXB 2KHCA 4NLDA 3H4BA 3IM8A 1DHMA 2B9YA 5EHHA 3UCUP 2OO4A 3D1OA 4NZ0A 1YQHA 2GFFA 1LWEA 1ZTTA 4M5DA 1P9YA 2VQEJ 4FF3A 1IBKF 4IFYB 4PEOA 4B3MJ 4YN3B 2CWXA 4X4NA 2K3KA 5IT4A 4JI5F 3QT5A 4ZP8A 1FX2A 1KLNA 2EFPA 4Y2CA 4XPEA 5A0YB 5AE1A 4QIVA 2YKPA 3KG0A 1PKUA 1JB0C 4KH1B 4YB5A 1N56A 1EKSA 2NSCA 3NMAA 1HMVA 3EXCX 4CIOA 4FDFA 3CE8A 1U02A 3W5XA 1UKUA 2UUBF 3B78A 3QGHA 3M7VA 4FYVB 3EVMA 1VYAA 4ECYA 4ZVGA 2MSTA 2D3OR 5JMNA 1YLXA 2CQPA 4FXWA 1F3VA 4OV6A 4CLSA 3VGSA 1SKWA 1UEUA 3I0SA 4RX6A 5F41A 1LOUA 2XS2A 2HFOA 2FTRA 4WPAA 4ZA1A 3WX8A 3MZIA 1U1NA 5CABA 2M0GB 2Y8WA 1FK9B 2I5JB 1E6VA 2NLWA 1KHWA 1XMQF 4I69A 3Q89A 3D6MB 3SYZA 2L3MA 2DH7A 5M2RA 5U47A 4AL5A 4C11B 3KUHA 2VQEF 3GP9A 2AZ3A 3OL6A 2DNOA 4B3MF 4L72B 3ZZTA 3MM5A 3NGUA 4LUBA 4X66J 1W2BR 1RTZA 3PIPQ 5J1EA 2OKQA 1VOMA 4B9NA 2I9SA 1L3UA 1H7WA 1FRHA 5HROA 1FKAF 2HNYB 1ZS6A 2AEMA 2BJEA 1MMNA 3Q8UA 1OQ6A 1BHNA 4KPYA 5I42A 4ED7A 5CYQA 4WKRA 3MF5A 4IRDA 3M32A 5DGAA 3CJKB 1DQAA 2D41A 5LM7E 5KT2A 5KFYA 3S7RA 2JNJA 3A8KA 4F4ZA 3MM9B 5GADU 4TLQA 4A8OA 2EKNA 3K17A 2GIQA 4YDDB 1LXNA 2VL1A 1IXKA 1BWVA 2MQMA 1X5OA 2DO0A 1O8BA 1UEVA 4U8YA 1LXJA 4ED0A 1KS2A 4YEAA 2RHQB 4NLPA 3FFIA 1YRXA 2DJWA 5ITHA 2WBMA 1WWHA 4C0BA 2V5HG 3IWLA 3LP1A 3SXLA 5GAGI 2HHHJ 2IMWP 4QR1A 1HWJA 3GZ7A 1TKXB 2IVMA 5LSOA 4DU8A 3NS5A 3MCOA 2L08A 1SJFA 5J2PB 4DR3F 1F1BB 1WI8A 3BZQA 5IC4B 4DR5J 1KFDA 4MK8A 1DURA 4EYIB 1S1TB 5GAEU 2X1GA 1Y5LB 4DBQA 1MWZA 2UVUA 1LWCB 3CJ4A 3CCRS 5CYJA 1NJWA 1VQNS 5F8MA 2C2NA 2KZZA 1TMMA 3UN2A 2K8GA 3GE9A 4I56A 2DNKA 2Q6BA 2ZDPA 3TJ9A 4ANCA 1T3NA 2FJXA 1S6OA 3KUGA 4O4GB 5KFDA 2Z57B 3VQSA 3EVOA 3OHAA 1S9EB 2DNGA 3JB9k 2GGPB 3L7UA 2QT7A 2LFVA 2GQCA 1XMOJ 5I3UA 3NCPA 4NCBA 1HHTP 1X9MA 2XMKA 4DL4A 2G0JA 3HPOA 1NB7A 3M30B 2V94A 2NXEA 4ZVFA 5F8NA 3VAMA 2K06A 2X51A 2CPZA 3QO9B 4JUZA 1WC4A 1VBYA 2O1PA 1AW0A 2BOAA 2V67A 2RF2A 2ZD1A 1L3TA 2GMJA 3MAHA 3C15B 2CPXA 2VPZB 2E1MC 5E41A 1JXEA 3W2VA 1AFJA 4R0EA 1F2HA 1RAIB 1V5IB 4DR5F 4E8UA 2R4FA 2LU1A 4ZVEA 1TVRB 2C2ZB 5KFIA 2Y1LB 2AGOA 3D0IE 2D69A 3OTOJ 4Y2MA 2WZ1A 2LA4A 2B4PA 5E3PA 5B08A 3TEHB 3FBFA 4A48A 4J91A 1WKKA 5A6WA 4KGMA 2FC8A 3NP5A 2Y9HA 1RWOB 5HSPA 2PE8A 4DV1J 3QMQA 2L9WA 2AYBA 4B3TF 5KG6A 3R5CA 2QLWA 1BE4A 2B43A 2OIHA 1R0AA 2UUCJ 2C2KB 4DFMA 4DR2J 1XMOF 3SEOA 3MHYA 2R2TA 2B9XA 3DMJA 2VG6B 3RUBL 2W2QP 2DR7A 2GVDA 4IKAA 1E6YA 1GXLA 1KQSR 3K8VA 4U9RA 2ZDOA 4XPCA 1RHMB 2W8KA 4DFJA 4YR3A 5BR8J 3DC2A 2RRBA 3DM2A 3QWPA 3BYRA 2DXEA 2XHWA 3IS9B 3MMCA 3KUEA 1MW7A 4A8SA 5KFLA 3BN7A 2VOOA 2CXEA 4GVBA 3TAMB 4O3RA 4P7VA 3CD0A 4RUHA 5DDPC 2ZH5A 5KFCA 1RXOB 3PG9A 1PG5B 2R7VA 1HL6A 3CULA 1U26A 1CEZA 2HFSA 2E7VA 3M8SA 1WEXA 2XMUA 5KFTA 2V50A 3OXLA 2ZHAA 4NZ7A 4K4SA 3BKUA 2PI4A 1PBUA 3TAPA 3CCES 1K1SA 1UVNA 3A3NB 1TK5A 5B0CA 4O44B 5D78A 4CI0B 3T41A 3QSYB 5FLXU 4OJ3A 4TLRA 4F4WA 4DZ6A 1SVDA 2VOPA 4H54A 1NHVA 4MKAA 2CG4A 4QU6A 4FKYA 2DXDA 4WTOB 1TL5A 2VB6A 1XBWA 1AA1B 4PG8A 2Y8YA 1QSLA 4LSLB 3MD1A 2RAQA 2QYGA 1NKBA 3M2VB 3UCGA 3J7A1 1SKSA 2EFVA 4ECRA 3M8ZA 3V4IB 2NZCA 2ADBA 2HFUA 1F5CA 1ZAXA 1WEYA 4QR0A 4QWDA 1QTMA 5KG2A 5GAGU 1RSCA 5K20B 1VQ7S 4LR7A 1HYSB 3D68A 2I5JA 3GJSB 4FF4A 3CJRA 2AQ4A 4KV8B 4DSIA 4B3RF 1IBMJ 3DLBA 2V2ZA 3G6YA 4P2FA 1NSPA 4ILRA 4NLTA 1VQKS 3OTDA 4C11A 4RNMA 3AXKA 3HSDA 2VUGA 3RTVA 1T95A 2IVYA 1BUXA 2BBEA 2B4VA 5KG4A 2X7IA 2ZJRQ 4WJBA 2HHTA 2UZAA 3DLEB 2ZBCA 4Y00A 3MR2A 2M52A 2I38A 3M6UA 1IBLJ 3Q2TC 4FF1A 3PXGa 2KG0A 4USVA 2HNYA 3MCSA 4BCAA 4PXBA 3CCLS 1NEEA 2YH0A 3WIVA 1FWLA 3CJSA 5I3PA 4ZVHA 4LBIA 3CJKA 2O01C 3PVXA 3PYFA 3JAMU 4LRBA 2N7CA 4RNOA 1U7LA 5T7LB 1DQ9A 3AXMA 2VFTA 1REVB 4ZJQA 3KOAA 1FVSA 2DVIA 4F2RA 2XMVA 2E7XA 5KOXA 4J9OA 1ZZNA 1VIOA 1XN9A 4P71A 1TQLA 1HI8A 2WK4A 3NS7B 1ICEB 4CLTA 4NXNF 3QT8A 4LR8A 1N5YB 3I31A 3BJYA 2W8LA 4DR6F 5JJBA 1RKJA 2Y0SD 3OD2A 2DITA 4ZKAA 3D3BJ 3H7HB 5H9EK 1IBMF 4I4BA 4F36A 1HNWF 2D3O1 3P4UB 3QRRA 4DX5A 1TKXA 5E7OB 1ELOA 2QA2A 2RDDA 1NZAA 4MAKA 1LV5A 4DSKA 4OL8A 2ASYA 2ZH6A 4DR4J 1VFJA 3TX8A 1W25A 5J2PA 4WFNQ 4B02A 3K5NA 4NLVA 3KJNB 1Q5YA 3RBXA 1IN0A 4N5SA 2ZJQQ 1DARA 1IBLF 2PO4A 2WRMA 1TFYA 1WSVA 1I5OB 1LWCA 1U45A 4IH5A 3BSCA 2MJUA 4J9KA 4I67A 2R7UA 3RR8A 4ES1A 2MGZB 4PQUB 2QMWA 4ZPBA 4AXIA 1VJWA 1JKHA 3QQCD 1AB8A 5DLFA 3AA9A 1HR0F 2BE7D 1IKWB 4O4GA 5DQGA 1PGZA 5LSLA 3K2YA 4F0KA 1S9EA 5LMNJ 2GGPA 3TRGA 2DKOB 2EFNA 4R8UB 2ZKUA 2CJYB 4NLQA 1YDLA 2V4RA 3M30A 2HFZA 2G0IA 1MN9A 3T1HJ 2VD3A 3TVKA 2V0NA 1JJCB 3RB6A 3TZZA 1FE4A 5T41A 3TO8A 1RT4B 3MPWA 2Z30B 3AD9C 2KDOA 3EZUA 4ECQA 1F5AA 1H7XA 3K8WA 2BVZA 4DFPA 3VCDA 4NRUA 2GMHA 2DNNA 2VG7B 5FJ4A 2MZQA 3C15A 4RU9A 4WK1A 3GG1A 4AQYF 2KM8C 5ETOA 4UT4A 5AJ3F 5EX0A 1M5PC 4CLYA 5A8KB 1G2EA 4UUWA 2BV3A 1RHUB 4LRAA 1J5OB 3U1NA 2FHMA 4YQWA 2CNLB 4TN2A 4PG6A 1ZM4A 1U24A 2EG1A 4ID8A 1TVRA 1G1XA 4WXWA 3EX7B 3IAM9 3PHEA 4CLKA 1C1CA 3DKDA 2OHDA 3QJLA 5MAOA 3Q2SC 1VI7A 1DAXA 4M5NA 5HK4A 1NHKL 5FLXY 1T3OA 3R8YA 5DRKA 1GK8A 4ANEA 4X4VA 5HMZA 1YWXA 1UPMB 4NPOA 2CJQA 5GAHU 2Q6CA 3HCXA 4XTTA 4ID5B 4QQBA 3UR3C 2YKNB 4LF9J 4IO1A 4YFUA 2IYGA 1MWQA 4X62J 1S10A 2HHXA 1NPPA 3BO2A 2HNZB 2VG6A 1VQLS 3IC1A 2JSXA 3T1HF 3F41A 2XZTB 2QTWA 2RE1A 3SCJE 3KMQA 3RAQA 1W2IA 3KJQB 3QZ7A 3L09A 1CJUB 3R5JB 3OSNA 4TQSA 3TVYA 3IS9A 2OH2A 2ASDA 4NCGB 1N52B 2G1DA 4ZVUB 3S6EA 4Q5VA 1Q7YT 3TAMA 2FHJA 2RSQA 2G4BA 3TJAA 3KK2B 1N36F 1WKLA 2CZ9A 3A3OB 4PWWA 1T02A 1N54B 4LFBF 4DCJB 1R7IA 2HGLA 3UI3A 3THVA 4WE1B 2AEFA 4XAKA 2FZKB 3IBCB 2BUNA 2XCAA 2COLA 4MKBA 4DV0J 1VJQA 2PMHA 4IH7A 3IR6B 3KHLA 2WHOA 3CDUA 1M1HA 1UEKA 1U2CA 2VA2A 5DDQC 4O44A 4RJVA 1BGXT 2VODA 2MZRA 3WQPA 2OPRB 1UA1A 3PJWA 4LFAF 4LQ9A 1X4EA 1RBOB 2VV5A 4K4TA 2DHHA 4OHYA 2Z4PA 2PFDA 3ETOA 2BJDA 3IG1A 3SV3A 4LSLA 4WFYA 3VGUA 3JAMY 4LF9F 5AXLA 4X62F 1VK3A 3M2VA 3TARA 4ETZA 1MU2B 2DNHA 4JI3J 4XO0A 3V4IA 2QYCA 4TYBA 5DDOC 4X4RA 2B4OA 2AW0A 2DTJA 2PT0A 4Y2KA 2V4JB 4KGZB 1U6FA 1PBAA 2PMWA 4FBTA 6FDRA 4PQAA 4DV3J 4JI1F 3VAIA 2HPUA 1WC0A 2WVDA 1KQGB 1RABB 2POKA 4MIWA 3HI9A 2H51B 4KV8A 1G7CB 1LEOA 5ETSA 2AWZA 2ALZA 1LK5A 2Y1JA 4OV1A 1VQ6S 3AJ2A 2NCKL 3BH7B 4MJKA 5KFKA 1Q8LA 1TV6B 1KD1T 3TEGA 4DS5A 1HW9A 4QIEA 2E1AA 2CADA 2NPFA 4FXDA 3IN5A 1WC1A 1WSRA 2CWKA 4DV0F 3C3LA 3DLEA 1HPZB 2LYVA 1FKOA 2V2VA 2DH9A 2FDNA 5D0EA 2DR8A 3LQVA 1SJ1A 4WU2A 1HBNA 4MT1A 2JX2A 4Y28C 3LUYA 4AT1B 4M8LA 4V1Ak 5E3RA 5HMWA 1S1WB 1VS3A 5T7LA 2JC0A 1REVA 3NAIA 3VVTA 3EM1A 3QJJA 4ZPCA 2L9NA 2VJVA 3J80U 4W92B 1P1LA 1HBMB 1J2VA 1FNOA 5DM7Q 3Q23A 2BJ9A 3CCQS 3BR9A 2ZBIA 2AJFE 3WC0A 5HO4A 2FY1A 4HACB 4DV3F 3ELHA 3BGUA 1N5YA 3R7NB 3DOKB 3OFFA 1D09B 2G13A 4CT8A 4FBUA 5HI7A 5ETTA 3WC2A 1HARA 4JV2A 2HWIA 3CEDA 1NSQA 3PO5A 2M8HA 1XC9A 2FJVA 3D67A 1H0HB 8ATCB 5C24A 1HNVA 2G2ZA 4X4TA 1DTQB 2H4WB 4Z37A 1Q8IA 2JEIA 2CPJA 3D2WA 2XY6A 3G87A 4K2XA 2N4DA 1TTHB 4DV2J 1X4BA 1X4AA 3W7BA 1Q4RA 3TW0A 3T6JA 4IOAQ 3EGZA 1JJ4A 1EP4B 3ENQA 2IA0A 3BKTA 2QV6A 3EMTA 4I6YA 2E7WA 1KQKA 1K8AT 1Q53A 5BXIA 2MGZA 4RW9B 1MNEA 4PQUA 3EZ5A 4FN5A 1F6TA 4DJBA 1XNRF 1UVIA 3AA8A 2XBPA 2PA3A 4UOGA 3U1MA 4EZ9A 5AXNA 3TQEA 4IQXA 1IKWA 3OVAA 3S8SA 5DJBA 4OMFG 4G3IA 1H98A 5E3QA 3OL7A 2WVFA 3N0VA 2MKYA 4R8UA 4E2FB 4OYOA 1NM2A 1T05A 1H2TZ 4X4QA 2MQPA 1RT4A 1LKZA 5J2QB 1Q0NA 3G2XA 4PAAA 1N32F 1NK0A 5J1PA 2L41A 4ER8A 2VG7A 2MKSA 5LXYA 3MUMP 3R1LA 4L3NA 1N5TA 4EZ6A 2CJAA 5A8KA 3DRSA 3NLCA 1ACMB 1J5OA 2ALYB 2V2QA 2BKPA 3PCOB 1X4CA 5AXKA 2DIVA 1ZBTA 5HATA 2GMLA 4C0OC 5LT5A 1HIYA 3LTOA 2GCFA 1YVFA 2WW8A 5L8RC 3IAS9 4CLZA 3JTPA 1C0TB 2NXJA 1IR1A 4B17A 3EPGA 4JV0A 1YRTA 5B09A 3HFZB 1Q95G 2J8SA 1WHYA 5A8RB 1UVJA 2IYIA 2V8HA 3M8QB 2LU2A 4ELTA 1WDTA 1NDLA 3RB4A 2XNQA 4BLGA 2CAJA 2RJZA 2YKNA 3UDCA 1JXVA 1X5PA 4Q44A 1TL1B 3PKMA 1FJEB 1RWWB 2E5LF 2EFGA 2WVBA 2HK2A 4DX7A 2V6AA 1QSYA 3AB2B 2XNRA 3UFCX 4F0HA 3MM6B 4PYDA 2MKCA 3CCTA 1CJUA 4IOBA 3W61A 3LGMA 4FNHA 2ZOFA 4NCGA 1TAQA 3QGGA 5HANA 2XYHB 2X3DA 4EK2A 2XSFA 3R6LB 2V69A 1GX5A 4Z7CA 1HNZJ 3MAQA 3KK2A 3THTA 3C2PA 4DL3A 2YNGB 1T9TA 3CMQA 4WE1A 4B9MA 3TZWA 4RUAA 2YNIB 2P6SA 3QLHB 2LXIA 3VVUA 2QGFB 3SBMA 3M6WA 2J0XA 3AH6A 3M8YA 4NLXA 2KVQE 4U67Q 4HHHA 2QLFB 1ZOTA 1M1KT 1RBAA 4KRWA 2D74B 5HVFA 3BQ2A 1FESA 5FD1A 2HQCA 2BACA 4G1PA 3M8PB 3LAMA 2XSJB 2XM3A 1YBAA 2IPOB 5CXTA 3VGVA 1ZTWA 4DL5A 2XY5A 1MU2A 4IUFA 2WSFC 2VBZA 3J80Y 1TKDA 2V4JA 5GMEA 3HFVA 1QTNB 4ECUA 4ZP6A 1GQEA 4ZPAA 1BQNB 3E3XA 3BQ1A 3FEZA 1NH7A 3KJVB 3HSJA 1XIQA 3HHDA 3W5YA 1K1QA 3MOZA 1M1GA 4F2SA 2KTQA 2EPIA 2UXDJ 1TFWA 4N7TA 1JLFB 3Q83A 1ITPA 4ZP7A 3KWMA 2J7WA 3OFHA 1TV6A 1Z2ZA 3GYXB 3A1YG 1KTQA 2HG4A 4G1QB 1RK8A 3TZXA 4U6PA 3DNCA 4HEA9 4ED6A 1HPZA 3J81U 3H4DA 2WVEA 3EGVA 5C25B 5D4NA 1WC6A 2CPIA 5HLFB 2IAJB 1VMBA 4DQPA 3N6MA 3ADAC 4EUVA 2ZOMA 1UTAA 3E2EA 4DZDA 5BJRA 1TMJA 2HBRB 1V3ZA 1S1WA 3PEJA 2O67A 4LJMA 2C3MA 2VFVA 1HD0A 1GAOA 2ZOGA 3BQ0A 3HT3A 1YJRA 2EXUA 2VBWA 2A1BA 5CD4A 1HBMA 3W3SA 4GKKF 3H5SA 3GFXA 3LOUA 1RHJB 2XC9A 1Y4ZB 5KT7A 4ECSA 4RL1A 4DV5J 1RAFB 2LQ8A 1O5JA 2A2DA 4HACA 1N0VC 3DOKA 3U02A 4RUCA 2CQCA 1FJGJ 1T03B 2DGUA 1DJ0A 5FDLB 2Z58B 2HURA 3CCSS 4ILMA 1GMUA 2C2EA 4ZLNA 4C8OA 4DQRA 3EICA 3TNVA 4P7TA 1OPZA 2CQ0A 3VZIA 2H65B 4YB7A 1SQEA 5A2QU 2JEFA 1FKPB 1TELA 1DTQA 3LPEA 3MUVP 1S9FA 4NLGA 4N56A 2JEJA 3WX4A 3OR1B 2WCXA 4G6VB 4NX9A 3H90A 1Y9OA 3T5LA 4J9NA 1AFIA 3ITHB 2Z56B 3MCMA 2ZUGA 4UOCA 2MLYA 2LMIA 4EBCA 2ZHBA 1IKVB 1EP4A 4CLLA 4J9QA 4DL7A 4I2PB 4DL2A 4WFZA 3W9HA 4KO0B 4RW7B 4B9UA 2RD5C 4RW9A 4W98A 1RHKB 4DPYA 2W9CB 2KFNA 2DPIA 4OZLA 4TYAA 1X4GA 3MR5A 3GIJA 4PXEA 2HKEA 1RT1B 3HT0A 1KVKA 3I55S 2EI5A 4LF6F 4JI2F 1ZM2A 4OYBA 2H1YA 2MKIA 1NPRA 3ILIA 1RGVA 2RQ4A 1S0NA 3U27A 4DV5F 3GV7B 5JXSA 3HJFA 4HT5A 2JLGA 5J2QA 4MFBB 3LH2S 4F0MA 1WKJA 5L46A 2MPUA 2B4UA 3CJTA 4B9LA 1SJ3P 2PN6A 3K0JA 4H4OB 1GXUA 2MZTA 2OPQB 3NBPB 4XDCA 3DLLQ 1LWXA 1MWYA 1LK7A 2KRRA 2GJFA 3SCLE 2LEAA 2MQLA 4ANDA 4O3QA 4HDGA 3M6VA 4B9VA 5EWFA 1C0TA 4ECWA 3PEHA 1FRIA 4JYAJ 2XMJA 5EDWA 1I6JA 3IR7B 3BSNA 2XB2D 5KFFA 1FD2A 5A8RA 4LVOP 3M8QA 4N47A 1F9EB 1NB2A 3QSIA 1H2VZ 4KGKA 4NYPA 2HAFA 3BEGB 1X8DA 1KKHA 1QAIA 1TL1A 2AIRB 3GB0A 1TP7A 3CC7S 4ZPDA 2C28A 3CDBA 2BJ3A 3N79A 3R27A 5KFOA 5EX3A 4M5GA 3FGVA 4EO8A 4HTIA 1BXNA 4J37A 3MM6A 1RU1A 2RU9A 3QGPA 5HMYA 4F50A 3ISNC 5HJXA 1NBEB 3D5MA 1SI9A 2A6MA 2WAQD 2XULA 2ZITA 1F9FA 2R9LA 2ILYA 1FEEA 2YNGA 3QRPA 4WWSA 1N6QB 2HNDB 3PW4A 2W4DA 2VC1A 3LALA 1R8AA 3GR1A 1B4SA 2YNIA 2ZVSA 2W4PA 3DGVA 1SH0A 4DEZA 1BWEA 3EXYA 1YBTA 3TUJC 1RWXB 3VGTA 4R0JA 1KVIA 3T5KA 3J81Y 3HSGA 5IT0A 3CNQP 1U6BA 4EBEA 2APOA 1S9GA 1YJ9S 4KHPF 4YUDA 2YWEA 1X0PA 2M9KA 3NCRA 3HD1A 2OI2A 3M8PA 2XSJA 1BMQB 3CC2S 1Y5NB 3ENVA 1KSPA 6FD1A 3BGRB 1S99A 1WORA 4X2BA 3VAFA 4HL9A 1WUUA 2OELA 2C1EB 2IFXA 4A8MP 2F8MA 1RJJA 3MDFA 1TZ0A 2GO9A 2V63A 4LRDA 5B0BA 5AE3A 2ZNYA 4CYUA 4ILLA 2W4CA 3LO3A 5CD4H 1BQNA 3OFEA 1MN7A 3KJVA 1RISA 7FDRA 1DBDA 1C4CA 4FP9A 4F3MA 3UCZP 2UXBJ 3P5TL 1JLFA 4MIBA 2AHOB 4RBVA 3HVAA 2XYPB 1R0BG 4YR0A 4DPUA 4I6AA 2IDEA 2GZOA 1FO1A 3J7YI 1CBKA 2RT3A 3BDPA 3HD2A 4G1QA 3HHLB 1I94F 2SXLA 3DXBA 5A2QY 4DUYF 3K59A 2ZH1A 5C25A 3PW7A 3A8JA 5HLFA 2J6UA 3IFEA 2IAJA 5CZVA 3W62A 2A0FB 3FSYA 3GYGA 3GPAA 3V2UC 2AGQA 1X4DA 4LF5F 1XQIA 4WBFA 1UJ6A 3I4PA 2WB4A 3NNCA 1B70B 3QBCA 1FNXH 2CNOB 4HHJA 1T11A 2GW8A 3VHQA 1FX4A 2J9EA 1PILA 3A8EA 1NJXA 3PJXA 1ZZFA 1NKEA 2IJNA 2YY3A 2C3YA 1SC6A 3OTEA 4OZ1A 5LJ5Y 1LWFB 2PGCA 3Q86A 1JLQB 4DQSA 2O5DA 1S49A 1VHIA 4DN0A 2FHJD 2VQFJ 4YY3F 1UCNA 1T03A 3EDRB 2LCWA 3KDNA 5FDLA 2PEHA 3FDSA 1YJUA 1WNEA 2UXBF 4Z7YA 3LWLA 3KXDA 1N5SA 4I1TA 1VRQC 5D0GA 2VFSA 4Y3CA 4NLRA 2V8VA 2ZZTA 4PPDA 4KHMA 2YX7A 1YHQS 1D8ZA 4UQTA 2W7PA 2GIRA 4X64J 4OZ0A 1FKPA 1XERA 2RQKA 4TU8A 2DHXA 1J5EF 3NS6A 1CG2A 4ERDA 2YKOA 3OR1A 5IQ6A 5G4DA 2I1RA 5EGYA 5A6PA 2DRAA 5F0UA 2B8PA 1N8RT 2EFOA 3R1HA 3ITHA 3ZZ0A 3TJ8A 2J9DA 4K4VA 1KRPA 3QGIA 4IYQA 1IKVA 3H2LA 1QD1A 2CQ2A 2R3VA 3ZZZA 4I2PA 2YWGA 1ZAWA 1RHRB 4ZVSB 2FGCA 3C14B 1ZYQA 2JVRA 4ICLB 2E5IA 3HK2A 2W9CA 1GNKA 2HVDA 4J9PA 1GMVA 3A3PB 3MECA 3M6XA 4B3SJ 3BBFA 1PAEX 2DGVA 4HI2A 4LF4F 1RT1A 4DN9A 3MR7A 3DYAB 4WCEQ 3PW0A 5L38A 3FUYA 3ZC4A 2VPWB 1CPZA 3JSMB 4DF8A 4QJVA 3CD7A 2YPYA 3TUPA 4C8YA 1VGYA 1V6HA 2GVZB 4DSJA 2WTFA 3F0NA 5DLGA 3CDWA 4M5KA 5ETKA 4MFBA 4USKA 3UN5A 2HQIA 3FCVA 4D3GA 4A46A 3A13A 1VISA 5MLCV 1EHWA 2AKWB 3ONQA 5ETVA 5L9NA 4H4OA 4RW4A 1RQ0A 2QZ8A 1H73A 2OPQA 2KT3A 1S59A 2CQHA 4AXJA 3W9IA 1VIXA 1WI6A 3NBPA 4P74A 3H5XA 4OIXA 2OD6A 3T1YJ 5G0RB 4AYBD 4YB6A 5KFBA 3QFHA 2WVCA 1GTHA 5F8JA 3G6XA 3D4JA 5KT4A 3FBEA 4ZIWA 5HN0A 5BYQA 1ZAVA 1WTBA 1SKUB 3WZ0A 5HVGA 1RADB 1U1KA 5AT1B 4BC7A 1SKRA 2E9RX 2LXUA 2FGOA 3VTIA 3DN9A 2NREA 3BKFA 1B64A 3DHXA 3O2IA 2A6OA 2DB1A 1HHSA 4B3SF 3PFEA 4WP9A 4YMEA 1JQGA 2DR5A 4FNIA 1CJVB 1IM6A 3S01A 4J9UE 2I0XA 3CO0P 2FLNA 1EZZB 2NZ4A 4PPZA 4KQZA 2QL9B 2C3PA 1HNIB 2E29A 4RKUC 3R3TA 3KLGB 4J9VA 2BW2A 3A12A 2KVIA 4CT9A 1XMBA 2L9DA 1U1QA 1WG5A 2ZBPA 4JI6F 2H9ZA 3OBIA 5KFPA 3MAAB 3CJQA 1UWBB 4DPTA 3FK4A 1RT3B 4M5JA 4PZVA 1HBUB 5IV4A 2F5GA 2D1CA 3AY0A 4ZP9A 3J7YU 4CM2A 5E2QA 3MMCB 1RYRA 2FC9A 2U2FA 1U1RA 2HLUA 4IDKB 4QWBA 3ENWA 1N6QA 2QA4G 2FHKA 2HNDA 3OL8A 1UPPA 2KG1A 3T1YF 2M70A 4A8QA 1SJRA 4WP8A 2XMMA 1CQMA 2QLXA 1S76D 3AD8C 4ELUA 4UY85 3B54A 1S6QB 2GHPA 5E3CA 2HHVA 2KXHA 5D6GA 4QW8A 3EPIA 3FQKA 1IWAA 3F56A 2VJUA 1U1PA 3P3DA 1CQNA 3JTNA 2AT1B 2HBZB 3OW2R 4NE9C 4QWCA 2I8EA 2KYXA 3BGRA 3D9BA 2FIUA 3LPYA 4DUTA 1CS4B 1UFLA 4OLOA 2WB1D 2ZH4A 4MMOA 3W65A 1IKXA 3ZTQA 4UOHA 2LA6A 3K57A 4C2MA 4NOHA 2HLTA 2OSQA 1I3OB 4ZMMA 1SL0A 4KAIA 3I9V9 1RP5A 3R2CJ 4NRTA 2OEMA 2GJ2A 5CCMA 5KFNA 2QJ3A 4NEZA 4RBUA 2W9BB 2BEFA 3DDIA 2EBGA 1X4FA 5KFEA 3IO1A 4DL6A 1S4FA 1B99A 2FJDB 3FBBA 4NEYA 1RWNB 4DCOB 5F8GA 2QFJA 3HHLA 4O4RA 2LQ5A 2R42A 1Y3KA 3ISZA 3P96A 2KRBA 4Q43A 4ZS6A 4F3OA 1WHWA 5KG0A 4DR3J 4ALZA 3ET6B 4U7CA 3BGLA 4M5IA 5EWGA 4P10A 5T14A 2B3TB 2W2PP 4A8WA 2QX0A 1PYOB 2UVWA 5KT3A 3KLIB 2M88A 5E33A 5C42B 1UA0A 2HYIB 1RCXB 4LT6A 2CNKB 1S6PB 3I87A 2FVRA 2ATLA 3OTCA 3DLKA 4OHVA 1NSKL 4UZBA 1NCLA 1VHFA 4R25A 2IJFA 2HGMA 1A7GE 4F4AA 4DUZJ 2XHCA 3ISND 1Q78A 4CTAB 2IY5B 4TVAB 3PRVA 1LWFA 5KT5A 4PXCA 1JLQA 1CSJA 3MM7B 1U0SA 4Y34A 4WFAQ 4WFBQ 1VC0A 1ZM9A 4HR2A 1UFKA 2B56A 4NXMF 3ULHA 1F3FA 3DI6B 1OY6A 4KE5A 1RA7A 3SDEB 3H40A 1Q1KA 3MGJA 2KT2A 3AOAA 5EN1A 4QW9A 4ZVQB 3JYTB 2XI3A 1JNRB 4Q0BB 2P5VA 4PRFA 5C5JA 2YX1A 2MSSA 4V19X 4HI1A 3RAXA 1QAYA 3IGNA 1UJ4A 1R0CB 5LSRA 4PCQA 5F3TA 4RZRA 1RWKB 2JC1A 3R7SB 1R8PA 2FZCB 3W1YC 3TA0A 4TY8B 4OJHA 3C14A 1HWIA 4ICLA 2CNNB 2QFIA 1WG4A 4K2JA 2BE2B 4N8NA 2HS3A 2WSCC 1EIYB 3MPDA 5E3AA 3UE2A 4JI7J 2U1AA 1S7HA 4RR5A 3P6YC 1JKHB 3DYAA 4DUZF 2GJIA 2CPFA 1T9YA 1M5SA 2CYYA 3R97A 3OLBA 1N34J 4YP3A 3JSMA 2IM3A 1ULRA 4B3TJ 3PYEA 1NJYA 2Y0BB 1NMEB 3SQGA 3X1LB 2GVZA 2XZWA 2FJBB 1NKCA 4QIFA 3N4WA 2H5IB 2UV8G 4USMA 4KSEB 1L3VA 5H9EJ 4HTJA 2HHQA 1WF2A 3QJPA 4USUA 3J7Z5 5EWEA 3E01B 2ZKTA 3E8OA 2X1FA 4HVZA 2JFDA 3U1LA 3RBZA 2R7WA 3BPDA 2JLFA 1JLAB 5KFHA 1FFGB 1QAXA 1VRTB 2PD1A 4CLWA 3RRGA 4RPFA 2BJ7A 4DOZA 2KFYA 2M4MA 2YX4A 4NZ6A 2MKJA 4ZOSA 4QWEA 4M5HA 5KFRA 5G0RA 3U7JA 2IM2A 4KY3A 4X4PA 5LMUF 2YKMB 1ZPVA 1IVZA 1IR2A 3D6HB 2DRDA 1VQ8S 1CC8A 2YVSA 1AUSL 5M2PA 1OJ4A 3I6PA 1H38A 5IV3A 1FVQA 3CMAS 2WOMA 1P27B 4AD6A 4FXVA 3IP0A 1LNQA 1C1BB 2J6TA 3O6QA 1C1CB 1K47A 2F40A 4FS1A 3T6BA 2F9DA 4C3LA 2X3GA 2KJVA 2F9JA 3GILA 3IWXA 4NA1A 4JI7F 1MMDA 1H6KX 2C3OA 5DQHA 1CJVA 3UN3A 5K14B 2XLKA 2W24A 2ZBQA 4Q45A 4FF2A 4DQIA 5DGBA 4TY9A 3OXFA 1N34F 1IQTA 1HNIA 2PIIA 3MEGB 3KLGA 2G2YA 1VQ4S 1B0TA 1VQ5S 2Y1RI 3G9CA 3MAAA 1UWBA 1RT3A 1Q5VA 1V9OA 1X60A 3BF4A 1HBUA 2R7RA 3H25A 1SH3A 1YG0A 3FEXB 5ETMA 1VRUB 1N33J 1CULA 3Q8VA 2OTLS 2RMLA 2PI5A 1Y5IB 3MEDB 5LXRA 2AF6A 2DK2A 4ELVA 3VWSA 2BOPA 4IDKA 1NLKL 3NEKA 4B3RJ 4P6QA 3LGHA 3HJVA 4NLYA 4OX8A 2OUGA 1UL3A 5IC6B 4ATNA 5I4MA 4LF2A 2BRKA 1NK9A 2OPSB 2BW7A 3C8YA 2L48A 3V6DB 2ZNZA 3H98A 5KG7A 1IM4A 2W1BA 5ETNA 3V6KA 3KLVA 3FCHA 2KH9A 3VR1A 1RAJA 2H54B 4OYPA 4LF8J 3DLGB 1S6QA 2NYIA 2VKRA 3H5UA 4K4WA 4QYRA 3D1QA 2MQOA 1YBUA 4FYDA 3GIRA 3H20A 2CG8A 2F1FA 5K8MA 3KLHB 1BLUA 1EETB 2M7SA 1X5TA 2BQUA 4C8MA 2E1RA 4GO7X 2KL8A 4PABA 3VQTA 4CO5A 1U25A 1CS4A 1SB6A 4GKJF 1V3SA 1URRA 3IG1B 2KHDA 2ILZA 2UUTA 2VC0A 4ZCMA 3BH6B 3DRRB 5HL7Q 2AX1A 1CJKB 3QPIA 5GAHI 3MEEB 3W8PA 4DV7F 2J5AA 4NXNJ 4GVLA 5IQQA 3OQ2A 3TYTA 3WIUA 2Q43A 4PR6A 1N33F 4DR6J 5F9LA 2W9BA 4GMKA 1WDDA 4OFZA 2QA1A 1I1GA 1R6VA 3QIPB 5L1IA 2YQ0A 4ED1A 4RBTA 1Q8BA 1RT5A 1TL3B 4OI3A 1HNWJ 4N8OA 2EC2A 1RU2A 1KBRA 3SIPB 3TUIC 1SUQB 4LBPA 4ITSA 1RCOB 1CLFA 2W7OA 4DU7A 4KGXB 4URGA 3NGSA 2YKAA 3HHLC 2UUWA 2RU3A 3VV2B 1KWMA 2AJ0A 4C97A 2RVJA 3ET6A 1EQ0A 3PM9A 3HO1A 1FDNA 1FKOB 1VBZA 4DMZA 4LF8F 4H4KC 5IWAJ 4K50A 4O3PA 3KLIA 3S1TA 1RI7A 5C42A 4FS2A 5D77A 3ZZOA 1S6PA 1HBNB 5B7WA 3EJMA 3N01A 2FLOA 3LA0A 1T8EA 3Q8RB 1PJ6A 1JNZB 1PJ5A 2JZ5A 3N5BA 3ILJA 3L3CA 1KVJA 1JXLA 1Y0HA 4CTAA 3UD4P 4JV1A 4LQ3A 1CVJA 2V68A 5IXUA 1HR0J 2HVIA 3NNHA 1S1UB 2MMYA 3R6GB 5ETPA 3R5GA 2WW4A 1PYTA 2PFFB 2I6WA 3KHGA 1WACA 3KFWX 1HFEL 4S0MA 2NXUA 3MM7A 4JB8B 3VAKA 3UVJB 3DLJA 3VZHA 3EUNA 4ZVOB 4JOUA 3PY8A 4C3KA 3VAHA 2AJQA 2HRUA 3DI6A 1RB0A 3SDEA 3D3CJ 2DEIA 3P5BP 3BDEA 3UDEA 3AOCA 1VQSA 2B7BB 4ZDNA 3JYTA 2LVWA 2P2CB 4Q0BA 1JLBB 3PRBA 1AROP 4B3OA 3H5YA 4USHA 1VDHA 3CCZA 1D9AA 4ECXA 2Z8QA 2R8GA 4BDPA 4AQYJ 1U2FA 3PDNA 3G82B 5AJ3J 4DV4J 3CC4S 5C24B 1HNVB 5F8HA 2DXFA 4F8RA 2CZVC 2WSEC 3IR5B 3MM8B 2Z2MA 5IWAF 2ZJPQ 2VDIA 3AQPA 4BC9A 3NAHA 4TY8A 4WF9Q 2FY8A 4WKYA 1ZETA 2CRLA 5LOQA 1CJTB 2R7XA 2HIQA 2IBKA 1GH8A 3GTYX 4OI2A 3OR2B 2BE2A 2YWKA 3PFOA 3ZFVA 2R8IA 4ZLLA 2W01A 1U4BA 1KFSA 7AT1B 3SSSA 1S0OA 4F02A 3OL9A 2RRAA 4Y0FA 1ZH5A 2OD4A 3NY0A 3CMES 1S0MA 2XS7A 4DX8H 5HJYA 2JRSA 4WP3A 4DS4A 3NL0A 4BHQA 4HT7A 2HBYB 3T3FA 3OT9A 3BS9A 1S0VA 1VLOA 1FWKA 4PUOA 3JTOA 1WOSA 1PAUB 4IG0B 5L9XA 4ZCKA 3E01A 1RLCL 4HLBA 3QNWB 2HFNA 1T05B 1JLAA 1VRTA 3DRXA 2GQ2A 2JEGA 1C0UB 3GJQB 2V8PA 4KB7A 1JIHA 1Y11A 2LDYA 1F9HA 2AZ1A 3KNAA 1MLAA 2F63A 5THWA 4NLUA 2ROPA 1BQMB 4KHRA 2EW9A 3IMQJ 5CZXA 1HI0P 2RUGA 1N36J 3BBBA 4DV4F 2DGOA 2CQIA 2V9WA 1U09A 2JLEA 4LFBJ 2YKMA 3DRSB 2JL9A 2VBYA 3DCAA 3KTQA 1D1UA 1H74A 4O3SA 3MI7X 4OX9F 1WJ9A 2XYGB 3AT1B 1NJZA 1AZSB 2B0GA 2BANB 1S7IA 3M2RB 4X65F 1C1BA 2PC6A 4RNNA 4QYZJ 3CT9A 5LL6d 1HQEB 4EWTA 5CAAA 5I3QA 1FRLA 4QOTA 4CO0A 1QAJA 2CKWA 4PWDB 2J8AA 5KTQA 2BQ3A 2VZ9A 1KLMB 5K14A 2KB2A 4LFAJ 1NXIA 3SSQA 2CJBA 2F8HA 2E1PA 3O44A 1HKAA 4ZCLA 3MEGA 4DFKA 1HWLA 4DR7J 3BM7A 1RAAB 5L1JA 4KFBB 2QC3A 3I32A 3O1LA 3M8RA 3QRQA 4J7CA 2D3ZA 4P2XA 3I5CA 2HSEB 1T0TV 4LFCF 2C22A 2EBEA 1SJQA 1VRUA 3W63A 4JI1J 3CUNA 3UR0A 2V9KA 2QLJB 4HKQA 1R43A 3MEDA 4LRCA 1TU0B 1Q16B 1TUWA 1TAUA 2FJWA 4CP5A 1Q86T 4OX7A 1CC7A 3FZ2A 2R7TA 2OPSA 1Z1ZA 3IWNC 2LLZA 3FNNA 3LANA 3SV4A 4HH0A 3V6DA 1JLGB 4OJGA 4USTA 2HHSA 1O51A 3ZNJ1 2LECA 3HHEA 3DLGA 4I0WA 2UU9F 3G8TA 1LW2A 3NWGA 3LW5C 5EUHA 3GCXP 3EZOA 5FIIA 3KLHA 1FE0A 3RW6A 1EETA 1SIZA 3I0RB 1RUSA 4F67A 1SC3B 1HWUA 3H42A 4CNZA 2HVEA 2NS1B 1VQMS 4X4OA 2QN6B 2CQDA 1S12A 4A8KA 4WIQA 1URNA 3M1VB 2FVQA 1IUJA 3RJMB 5A8WB 4A47A 4DR7F 5KOWA 5IS2A 4K4XA 3NGKA 2VKZG 3DRRA 1QSSA 2K2PA 1N4LA 3EE3A 1CJKA 3UQSA 2M3DA 3UO0A 2AJ4A 2A2CA 1REGX 3MEEA 2ZH8A 5ETRA 1P9QC 5F9NA 2R8JA 1NDCA 1ZM3A 2D9PA 2M2BA 1ZA1B 4ETXA 2QL7B 4Q8EA 4L76A 2YKQA 2N7YA 3B4MA 3LP0B 3HSZA 2W25A 2BYCA 2N82B 1R31A 3QIPA 3HX9A 1TL3A 1UWAA 2CFXA 4IFVB 3CSKA 2IJRA 1SUQA 1RE1B 4P75A 2DR6A 3SQOP 3A4TA 2DYAA 1RAGB 2VIHA 1X9SA 3ZTOA 2MTLA 2ZH3A 4BWMA 1X0FA 3PYDA 4PYAA 3ZO7A 4Q2MA 3CXCR 2IRUA 1DRZA 2Q66A 2D7SA 9ATCB 2ADCA 5SZTA 4JP8A 2Z2LA 4PXDA 5E0OA 2JOQA 1EX8A 3F44A 1U49A 3BO3A 1VQPS 2HHWA 2GQQA 1SPBP 4O3OA 1KR4A 5KFMA 4K59A 3G8SA 1D3WA 3N28A 1F0XA 4FVCA 1U47A 1RA6A 2EFQA 1XNRJ 4U8VA 3IM9A 2W9AA 4UOFA 4TU7A 2CIMA 5ETLA 2GHWA 1U8WA 1S1UA 2KYZA 3HZGA 3WBZA 4F7VA 1OIAA 1KC8T 2DD8S 2CJXB 4F4XA 3UVJA 1YTYA 3FMWA 4KH0B 2HRTA 1EARA 1DY3A 1PC5A 1SL1A 2J7KA 3C66A 5K8OA 3ILOA 2E5GA 2EWHA 2IRYA 2HS4A 4AFFA 5KFXA 1N32J 2FQQB 4KBIA 1JLBA 3SFUA 2MQ8A 2QO3A 3G82A 3UPFA 4ZPTR 1NK7A 1DQ8A 2VFUA 4X66F 1GMWD 2H5JB 3OFGA 1KTVA 2XCPA 2MZ1A 4GC7A 2GV1A 2HS0A 1YJWS 1NH8A 3MM8A 1Z4UA 3PX6A 4K7QA 1KNZA 1EB0A 3AFGA 1CJTA 2H48B 2QIFA 5D0HA 4G65A 3RYLA 1KN6A 4LMZA 3OR2A 3BB5A 2HVHA 3RAMA 2N4CA 3WHIA 4WXOA 4CLPA 3K58A 4KTQA 3DDKA 2OGUA 3C16B 1HQUB 1K9MT 1RYSA 4ES3A 1RTJB 1IWGA 1A0OB 3CD6S 5KFWA 2AEJA 3OUYB 2BABA 5DDRC 3LP2B 4QYZK 2RHSB 4ES2A 2MKKA 2P9GA 3GFZA 2CJ9A 1QUVA 4DV6J 2VICA 3SCIE 1G3OA 1O6XA 3ZTSA 1MMLA 3K5MA 1B7YB 3JSBA 1XR6A 4KPCA 4C8LA 1SIWB 3AJ1A 3POTA 1VBXA 1YJVA 4IG0A 2E5LJ 2ZEJA 1WF1A 2RKIA 4QU7A 4JI0J 3GV8B 2DGTA 2QEXS 2VBXA 1C0UA 2DH8A 3HHLD 2HHHF 3CJ8A 2DCUB 2R7QA 3CO9A 2OAUA 3K5LA 3KNGA 3T5HA 1L5UA 1QUPA 2XWYA 1BQMA 1UVMA 2RDIA 3D28A 3MMBB 1TUGB 3RRKA 4PG5A 4M5LA 2LKZA 3I4HX 2IBOA 2BM1A 4FZVA 4OI4A 5DZ7A 5F8LA 2BX6A 2Q1LA 2PDAA 1AZSA 2BANA 1SQFA 2YXLA 2KO1A 3M2RA 4RU2A 2K1RB 4K4UA 1UP1A 4PG7A 3L95X 2ZH9A 5C2GA 1HQEA 4CNYA 3MOJB 2LQ9A 3HHNB 4PWDA 1KLMA 2W7AA 3AB4B 1FERA 3TOQA 2CUYA 1SXLA 2XS5A 4HDHA 1VC6A 3GFHA 4DV6F 1LFPA 2OLWA 2I2YA 1NNDA 5D3GB 2C2DA 3MMAB 4KFBA 2DBBA 4OYWA 4F4YA 2GIFA 4M95A 2O66A 5KFZA 4JI0F 2GAGC 2QSWA 4J9LA 2BM0A 4OHZA 4UF4A 1GFWB 3Q0AA 3KLEB 3FEYB 2CPDA 1UETA 2HVZA 1RTDB 5IM0B 4NCAA 3LF0A 3US5A 2ZC4A 4W4MA 3PW2A 3L4BC 5HBMB 1PIEA 4A4JA 4F3QA 3BR8A 4USWA 1XNQJ 2X1BA 3VALA 3I9ZA 5HP1B 2KFZA 4IFYA 3NG8A 1S1XB 4ZPWR 3OTOF 2A18A 2CQ3A 1JLGA 5A0YA 4K4YA 2HHUA 3IBFB 3AJDA 5L39A 2Z2YB 3D6TB 5ETQA 4QWAA 4PG4A 1F2GA 5JUMA 2ZUAA 3H2UB 4DDFA 1S9GB 3I0RA 4DV1F 4ZHRB 4IR1A 4EMDA 4NLSA 2QRRA 4P2SA 3DRPB 2UUCF 4DLGA 2CQBA 3GJTB 4U7UD 4DR2F 1FXDA 3M1VA 3ZZRA 2ERRA 2UP1A 5A8WA 2YPZA 3CCUS 2HK3A 3TQ1A 2BE9B 2PMZD 3GIMA 4R5PB 4NMLA 1XR5A 1Y10A 2R7OA 4GKKJ 1KP6A 3RBEA 4RNHA 5BR8F 3DOMB 1N5VA 2J9CA 2KXNB 4CYUB 1UAWA 4OI0A 1YKWA 4AL6A 2JDJA 3TUZC 2AJ1A 4CO4A 2DT9A 3N9UC 1FK9A 4ECTA 1LW0B 4L73A 3QZ8A 3TWZA 3KKFA 1OSDA 3LP0A 4H4MB 4C4WA 1WG1A 1Z2LA 4X4UA 2GX8A 2OFHX 2B9WA 2RUSA 4IFVA 1XNQF 1FFWB 1OQ3A 2BRLA 3G86A 1BD6A 4Q7AA 2UVRA 5ADZA 1U1MA 4NASA 3RB0A 4RW6B 1NSAA 2NUUG 3HFKA 4LREA 4WIIA 4ZLJA 3PV8A 3DDNA 3THPA 3ENAA 3T9NA 1VQYA 5M2UA 2RRNA 4E0DA 3EGWB 1FXLA 1Q7LB 3BV8A 1IQZA 5KFSA 1JWWA 3PW5A 4DG1B 1T94A 2HMIB 2ASLA 2DGXA 1NK4A 1SC1B 3EYZA 4IRKA 1UW4A 4OYXA 5K9FA 2P8IA 1RAOA 2P6TA 2FVCA 3MM9A 2V34A 1WF0A 2CDQA 1U1OA 1BY9A 4URQU 2XZDB 4XIUA 2HWTA 2RIJA 3LGNA 4LBHA 2NUHA 2LDIA 2MQNA 4LF6J 4JI2J 3C46A 1MROB 3GONA 2HGNA 3O8WA 1JLEB 1BC6A 3B6BA 1FT8A 4AUKA 4LIWA 1T7PA 2XMTA 5F0WA 4JI8J 3NNAA 4IRCA 4KT0C 4Y2IA 2CVEA 2MXYA 2YWFA 7FD1A 1SJ4P 4ED3A 4HHUA 2YWWA 2Q79A 3ICLA 2HAIA 1QY7A 2EVZA 1R8BA 4FYYB 4B9SA 4CDIA 2JWNA 4LIRA 1VLYA 2HQGA 4CRJA 3KDOA 2F7VA 5RUBA 1S1TA 2ASJA 3BBCA 2BZ2A 2MDAA 1A6LA 3OJSA 4U96A 3ZNUA 3M9NB 3GV5B 3KG1A 1K0TA 2AD9A 4O23A 2GAHC 3HP6A 2N3LA 5K8PA 5A76A 2NYHA 2QMUB 3HF5A 4O0IA 2DRBA 3UWTA 4YOEA 2VASA 5DS7A 3C16A 4NMXA 1HQUA 2GO8A 1VC5A 4LF7J 4XK8C 3OTBA 1RTJA 1IJEB 1N88A 1T9WA 4DHVA 3MECB 2WONB 3OUYA 2ZBRA 3H8YA 5K5MA 2EKYA 3LP2A 1GTEA 3HVWA 2R2SA 4F4KA 4ZVPB 3HKWA 4DLEA 2FB0A 2J6SA 3HDSA 8RUCA 5D0RA 2DHSA 4UW2A 1H2UX 1RDRA 4AL7A 2AYMA 3V4MA 2JFKA 4BS2A 2HWHA 4OZ3A 3FVYA 3QO9A 5K8NA 4JI4J 4DPXA 4JI8F 1R8HA 1RT6B 5KT6A 2OEJA 2CQ1A 1FHTA 4IG3B 3NKYA 2CQGA 3MPVA 4U95A 3NMRA 4OZ5A 4ECVA 2MZJA 4DR4F 3MMBA 3H59A 4RW4B 2OFGX 2VHGA 4NYOA 3PR5B 2BA9A 3W60A 3D0GE 3GSDA 2QLBB 4QPXA 4KGVB 5IFMA 3J7AN 1JJHA 4EI2A 4WYWA 4O0NA 3CCMS 3IGVA 3GIKA 1M5VC 2G0CA 2AV5A 2K1RA 2ZHOA 4K5RA 3HVRA 2IHR1 4GRSA 1IKYB 2FJAB 2DNYA 4RW8B 3W64A 4LF7F 1NDPA 1U2RA 3NRBA 4KHPJ 4MYUA 3KK3B 5KG5A 2YQ1A 2Q3PA 2E9TA 3V81B 5LMNF 1C4AA 2RH3A 1XR7A 3L7OA 4EU0A 5J2MB 3D6FB 5D3GA 3HKZD 3MMAA 2Z2ZA 2Y3YA 3KJFB 1OWXA 4NA2A 4JI4F 5GVQA 3OVBA 2O3DA 3DHWC 1PC4A 4TU9A 4CWBA 4OYAA 3EVWA 1YRUA 3KLEA 3MR3A 3UD5A 3A8IA 1XJWB 1RTDA 3BO4A 4CZCA 2DNMA 5IM0A 3BSAA 3PX0A 5HBMA 4C0HA 2G1HA 1WC3A 4M1KA 4WK3A 2EC0A 4M94A 5HP1A 2PA8D 3JQJA 1S1XA 3K7RA 1S4EA 1DLOB 3RR7A 1I94J 6AT1B 4EBDA 2DO4A 4JBCA 4EO6A 3DOLB 4KYZA 1D8YA 4DUYJ 3TA2A 3T19A 4A8XA 2MYFA 1AXQA 1YIJS 1RWMB 2DISA 4KJIA 2IDLA 2M5YA 2J9DE 1HI1A 5B0EA 3O3LA 2V8GA 4P73A 1SCJB 2CPYA 4LF5J 1OYEA 4ZHRA 3DLHA 2IMOA 4DWIA 2IIHA 5KG1A 4DSFA 2BDPA 2VG5B 3DRPA 2DHGA 2Y1IA 3IRWP 3SMZA 5GMDA 3F73A 5B0GA 1JLCB 1IJFB 5BYSA 2W2OP 1F60B 4EFAC 4R5PA 3QYYA 1IKXB 2XMWA 4TKTA 3V6HA 2RB7A 1S1VB 4Y2AA 5DO2A 4ZIVA 4OI1A 3DOMA 5HQLA 3AAWB 2RQMA 2NQPA 2LEBA 1X7VA 5BYRA 1HYSA 1YITS 2D3UA 1LW0A 3DXSX 4YY3J 4DPWA 2XGQA 4H4MA 2VH7A 1RTIB 2AGPA 3FMBA 5IZHA 2MLZA 2DY9A 3PTWA 1KDNA
chains in the Genus database with same CATH topology
3TUIC 1SUQB 2HG4A 4G1QB 1RK8A 2XGPA 5J1NA 4ITSA 2VQEF 1JK9B 1CLFA 4RW6A 3OL6A 2W7OA 4U6PA 1IR0A 3DNCA 4HEA9 4ED6A 4URGA 2DNOA 4B3MF 2YKAA 3HHLC 1HPZA 2UUWA 4L72B 2RU3A 3ZZTA 3H4DA 2AJ0A 3MM5A 3DU5A 4LUBA 4C97A 5C25B 1W2BR 5D4NA 2RVJA 3PIPQ 2CPIA 5J1EA 4CO3A 2OKQA 1VOMA 4B9NA 5HLFB 3MPYA 3PM9A 2I9SA 1L3UA 3HO1A 1FDNA 1H7WA 1FKOB 2IAJB 3TVZA 1VBZA 1VMBA 1FRHA 4DMZA 4LF8F 4H4KC 3FJ2A 4DQPA 4K50A 4O3PA 2C2RA 5HROA 3N6MA 1FKAF 4EUVA 3KLIA 3S1TA 2HNYB 1RI7A 5C42A 4FS2A 1UVKA 3FZBA 2BJEA 2ZOMA 4DG1A 3VF0B 1MMNA 3SCKE 1OQ6A 2HMIA 3E2EA 4ZCIA 5D77A 3ZZOA 1RT2B 1S6PA 5BJRA 1HBNB 5I42A 4KPYA 2FHOB 4ED7A 5CYQA 5B7WA 4WKRA 3MF5A 4IRDA 3N01A 2FLOA 3M32A 4HYKA 5DGAA 1V3ZA 4J5OA 1T8EA 1S1WA 3CJKB 1DQAA 3PEJA 3Q8RB 3CD5A 2O67A 4LJMA 2D41A 3DLKB 4K5SA 5KT2A 2C3MA 4DSLA 1JNZB 2VFVA 2JZ5A 5KFAA 1HD0A 1GAOA 2ZOGA 3N5BA 5KFYA 3BQ0A 3S7RA 1YGYA 3L3CA 4F4ZA 3HT3A 1YJRA 3MM9B 1KVJA 2VBWA 2A1BA 4HH1A 1JXLA 4JI3F 1Y0HA 4CTAA 3UD4P 4JV1A 5GADU 4LQ3A 1CVJA 5IXUA 3GQCA 3MWBA 3NNHA 1HBMA 3W3SA 4TLQA 2HVIA 1S1UB 4A8OA 1GXTA 2MMYA 4GKKF 2CPEA 5DQIA 3H5SA 1S97A 2EG2A 3GFXA 3LOUA 2XC9A 4C3MA 2PFFB 1MROA 1Y4ZB 2GIQA 4MH8A 3KHGA 4YDDB 1KOOA 5KT7A 1TK8A 3I96A 1LXNA 2VL1A 1WACA 1HFEL 3KFWX 1IXKA 2NXUA 3MM7A 2MQMA 1X5OA 2DO0A 3VAKA 4ECSA 1FDAA 2IM1A 1O8BA 4Y6IA 3DLJA 1O5JA 3VZHA 3EUNA 2A2DA 1UEVA 4JOUA 4UY8T 1JLEA 2YQ3A 1N0VC 3PY8A 3DOKA 3CCWA 5J2NB 3U02A 4RUCA 2CQCA 4C3KA 3VAHA 2E1CA 2OSRA 2V4QA 1LXJA 4ED0A 1T03B 1KS2A 2DGUA 3TR5A 3W2WB 4YEAA 1PO6A 2AJQA 1DJ0A 4NLPA 5FDLB 4J9RA 2HRUA 1S6UA 3DI6A 3SDEA 3FFIA 1YRXA 1OSCA 2DJWA 2AU0A 5ITHA 2WBMA 3CCSS 1B0PA 4ILMA 1WWHA 4C0BA 1Q82T 2V5HG 3BDEA 2C2EA 4C8OA 2MKHA 1VQSA 3IWLA 4DQRA 3LP1A 3TNVA 4P7TA 3SXLA 2B7BB 4ZDNA 5GAGI 3JYTA 2LVWA 2IMWP 1OPZA 4QR1A 2CQ0A 4Q0BA 1JLBB 1HWJA 3GZ7A 3VZIA 1TKXB 2IVMA 2QE5A 3PRBA 1AROP 4F26A 3H5YA 4B3OA 4USHA 1SQEA 4YB7A 2JEFA 3CCZA 1D9AA 4ECXA 2Z8QA 1FKPB 3HVTB 2R8GA 4BDPA 4RNFA 5LSOA 3M9OB 1WELA 1YJTA 1DTQA 1U2FA 3PDNA 3NS5A 3MUVP 1DTTB 2L08A 1S9FA 1SJFA 4NLGA 4N56A 4CQ1A 5J2PB 4DR3F 3CC4S 2JEJA 5C24B 1HNVB 3WX4A 3OR1B 5F8HA 1WI8A 2WCXA 3BZQA 1F5BA 4G6VB 1KFDA 4I7FB 4NX9A 4F8RA 2ABYA 1Y9OA 1U48A 3OXGA 4MK8A 4J9NA 3T5LA 1DURA 2RS8A 1AFIA 5B0DA 4EYIB 2CZVC 5DG7A 1S1TB 2WSEC 3ITHB 3IR5B 5GAEU 3MM8B 2Z2MA 2ZUGA 2X1GA 1Y5LB 4UOCA 4F25A 5IWAF 2LMIA 2K3IA 2ZJPQ 4EBCA 1C2PA 2ZZMA 3AQPA 2ZHBA 4DBQA 1IKVB 1EP4A 4BC9A 3NAHA 4TY8A 4WF9Q 1ZETA 4WKYA 4J9QA 2CRLA 1MWZA 4DL7A 2UVUA 4NA3A 5JVHQ 2R7XA 4I2PB 1LWCB 2HIQA 3UW1A 3CJ4A 4WFZA 4DL2A 2IBKA 1GH8A 4OI2A 4KO0B 4RW7B 3CCRS 3OR2B 4B9UA 2BE2A 2RD5C 4OZNA 3MFIA 5CYJA 3QIDA 1NJWA 1VQNS 4MK7A 4RW9A 3MD3A 1M90T 2YWKA 3IXQA 5F8MA 5DG9A 2ZC3A 3VAJA 2W9CB 4CH1A 3SI8A 2J7UA 3PFOA 2KFNA 2XWXA 3ZFVA 2R8IA 2DPIA 4OZLA 2KZZA 2OPPB 4TYAA 4NLOA 1X4GA 5AXMA 2K8GA 3GE9A 2MZSA 1TKTB 4I56A 3MR5A 2DNKA 2Q6BA 1U4BA 2ZDPA 1KFSA 3GIJA 3SSSA 1S0OA 4PXEA 3KLFB 2CVIA 2WONA 4F02A 1XEZA 1T3NA 1RT1B 2FJXA 3OL9A 1S6OA 2RRAA 4O4GB 1YJNS 5KFDA 3RW7A 3I55S 4Y0FA 1ZH5A 3I5BA 2EI5A 1V3RA 4LF6F 2OD4A 4JI2F 3VQSA 1ZM2A 3OHAA 3CMES 1S9EB 3R5AA 5D4OA 2DNGA 3JB9k 1S0MA 3ZZPA 2GGPB 2XS7A 2QT7A 3B4DA 4WU3A 4DX8H 2DR9A 2MKIA 2GQCA 2JRSA 4L6V3 5I3UA 3NCPA 4DS4A 1RGVA 2AX0A 1HHTP 4NCBA 1X9MA 3NL0A 2RQ4A 3CVKA 4BHQA 1S0NA 2YNFB 4HT7A 4ZLPA 2XMKA 3U27A 4DV5F 3T3FA 4DL4A 3HPOA 3BS9A 1S0VA 3SQGB 1NB7A 4PUOA 3M30B 2V94A 2XEXA 3JTOA 3GV7B 4ZVFA 5JXSA 3K5PA 5F8NA 4IG0B 5L9XA 4MKYA 3VAMA 3HJFA 1U1LA 4ZCKA 4HT5A 2JLGA 3E01A 4HLBA 5J2QA 4MFBB 2X51A 2HFNA 2CPZA 3LH2S 4MTPA 4USIA 1T05B 1UFWA 3QO9B 4JUZA 1JLAA 1Y3JA 1VBYA 1RT6A 2DIUA 4NLWA 2MPUA 2O1PA 1VRTA 2B4UA 3CIZA 3DRXA 2GQ2A 1U6ZA 1AW0A 2JEGA 3OPKA 1C0UB 4B9LA 2RF2A 3MEKA 4IG3A 2ZD1A 1SJ3P 2PN6A 3K0JA 4H4OB 4KB7A 1JIHA 2LDYA 1GXUA 1L3TA 3KNAA 2GMJA 2MZTA 3MAHA 2OPQB 3IBWA 4I6WA 5THWA 2CPXA 2P9CA 2VPZB 2ROPA 1BQMB 4NLUA 2E1MC 4KHRA 3G96A 4C8ZA 2EW9A 5E41A 1JXEA 4I64A 5CZXA 3W2VA 1HI0P 3NBPB 1AFJA 2RUGA 4R0EA 4XDCA 3DLLQ 4DV4F 4EGLA 2DGOA 2CQIA 1MWYA 1U09A 2FPHX 2V9WA 2JLEA 2YKMA 3DRSB 2JL9A 1LK7A 2VBYA 5D4LA 1NK5A 2KRRA 4DR5F 4E8UA 4DV2F 2R4FA 3DCAA 4BBYA 3KTQA 2LU1A 3SCLE 1TUVA 2XY7A 1D1UA 3M2UB 4ZVEA 1TVRB 2LEAA 5KFIA 3QAEA 2AGOA 3D0IE 2DGSA 4C98A 4O3SA 2MQLA 3MI7X 4OX9F 4Y2MA 1NJZA 2LA4A 4O3QA 2JJ4D 2B0GA 4HDGA 1QVGR 3M6VA 4B9VA 2BANB 5LJ3Y 2B4PA 3MR6A 5EWFA 2HQ3A 2F8EX 5E3PA 3M2RB 4X65F 1C0TA 1XK8A 1C1BA 4USJC 5B08A 2PC6A 3HLUA 2WOMB 2YNHB 3CPWR 4A48A 4ECWA 4RNNA 4QYZJ 1IKYA 3PEHA 3FSIA 1HD1A 1FRIA 4RW8A 1P6TA 1HNXF 5A6WA 3CT9A 2XMJA 5LL6d 5EDWA 4KGMA 2FC8A 1I6JA 3NP5A 1HQEB 3IR7B 4EWTA 5I3QA 3GIIA 1FRLA 4QOTA 3BSNA 2XB2D 4CO0A 5KFFA 3KK3A 1FD2A 1GX6A 5A8RA 1QAJA 2CKWA 4PWDB 2J8AA 3RRHA 4WFXA 5KTQA 2PE8A