2DGOA

Solution structure of the rna binding domain in cytotoxic granule-associated rna binding protein 1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
115
structure length
115
Chain Sequence
GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain in cytotoxic granule-associated RNA binding protein 1
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Cytotoxic granule-associated RNA binding protein 1
total genus 13
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgoA01
2MZTA 3P49B 4TU9A 2OJ3A 4QQBA 1H2VZ 1XN9A 1VQ7S 2MJUA 3MURP 3NS6A 2LA6A 2D3OR 1X5PA 1HL6A 3B4DA 2DGUA 4CH1A 2HYIB 4TU8A 2MHNA 2LA4A 4OZ1A 1VQ6S 2M2BA 5HO4A 4F26A 1WF0A 1H2TZ 3MI7X 2LYVA 3P3DA 4Y0FA 2CPJA 1WHXA 1YJWS 1QVGR 3VAHA 4TU7A 3CC2S 3SDEB 1WG1A 1VQPS 4C4WA 3S6EA 2OIHA 3G4SS 4CQ1A 2E5JA 2DH9A 2DH8A 2M9KA 3UD4P 2FC9A 1M5OC 1M5PC 4QU7A 1VQ8S 2DNRA 2RS2A 3CF5Q 2M8DB 1X4BA 2M8HA 3VAJA 3J7ZT 4ZKAA 1VBXA 3Q2TC 1X5OA 4PR6A 3CCVS 2MGZB 1YHQS 3J7YU 2MY8A 1WG5A 4EGLA 2DO0A 2CQ1A 3UE2A 3D2WA 3EX7B 3ZZYA 3CPWR 2HZCA 1M5VC 3S8SA 3UWTA 1M1KT 2CQBA 5LSLA 5H1SV 1U1KA 1P1TA 2M7SA 2YH0A 2SXLA 4YUDA 1KC8T 1URNA 3VAMA 2J0QD 1U6FA 2DNZA 3CC4S 1U1QA 3HHNB 2BZ2A 3EGNA 3UCUP 4UQTA 2DGOA 2M0GB 3VAKA 4PKDB 2LECA 1A9NB 2D9OA 2RQ4A 1BY9A 2RNEA 5LJ3Y 2GHPA 5GADU 3PIPQ 2CQ2A 2K3KA 1WHWA 1A7GE 1OPIA 2I2YA 1N54B 5JVGQ 3CD6S 2ADCA 2MZQA 3NS5A 2KG1A 2VOPA 2YH1A 2MZJA 1JJHA 2X1BA 1VQ4S 2DIUA 1WF2A 2LQ5A 2DK2A 2X1GA 3US5A 3R1HA 1ZZFA 2KRRA 3V4MA 5IM0B 2LMIA 2UP1A 1SJRA 3I56S 4P6QA 2M52A 5JVHQ 3VAFA 1U2FA 4IOCQ 2VONA 4WF9Q 2XS5A 2KXNB 2X1AA 1YWXA 2PEHA 1KD1T 2MMYA 5GMKa 2JVOA 3MD1A 1RKJA 1S72S 2DNLA 3NNHA 3FEXB 2MY7A 2KM8B 3R1LA 5CXTA 1DRZA 2E5GA 3G6ES 1PGZA 1SJ3P 1N8RT 1FHTA 4CH0S 4WFAQ 2LXIA 3CCQS 3CULA 1YJNS 2XS2A 1N52B 4Y00A 3CCLS 5MLCV 1IQTA 1CVJA 3CCMS 1YI2S 2DGQA 1YIJS 5GAGU 1VBYA 1NO8A 1JJ4A 2G4BA 3CMAS 1G2EA 5D78A 3PIOQ 2DGTA 5CYJA 1VQOS 3S01A 4TLQA 2KM8C 2KG0A 1OO0B 1K9MT 3G9CA 2KXFA 3BO2A 3VAIA 2ERRA 3CCSS 2E5HA 2XNQA 2KH9A 1X0FA 1Q86T 2F9DA 2L08A 2MSSA 3DLLQ 3THPA 4IUFA 3NMRA 4LIRA 1X5TA 3ZZZA 2O3DA 2EVZA 4V19X 1VQKS 1UW4A 4WCEQ 1VC6A 5EN1A 1H6KX 2AYEA 5FJ4A 1FT8A 3CCJS 1B7FA 2MQMA 3VF0B 5LSOA 2AD9A 2RQCA 5DETA 3BO4A 1FNXH 2QFJA 2CPFA 4UY8T 1WG4A 2EK6A 3U1LA 2NLWA 2DNOA 2RT3A 1WI8A 3LPYA 4IO9Q 2MKHA 4WFBQ 5D77A 1VC5A 1SJQA 2LCWA 2RU3A 2U1AA 2DHXA 1WHYA 5IFMA 2KVIA 2MQNA 2FPHX 1KOHA 4PRFA 1QVFR 2E5IA 2MZRA 2MKIA 2DNGA 2J76E 3RW7A 2N82B 1JJ2R 5GAHU 2D9PA 3NNCA 2MJNA 1VBZA 1R8HA 1UFWA 3Q2SC 5DDRC 2HGMA 3CXCR 1DZ5A 3IWNC 2CQ4A 2DNQA 1YTYA 3SMZA 2G0CA 1WEZA 3EGZA 2RRAA 2CQGA 2J0SD 4C7QA 4OZ0A 2LXUA 2DIVA 2MQLA 4QPTA 2CPDA 2BOPA 4LMZA 1X4EA 2NZ4A 3BS9A 2XSFA 3G96A 2KFYA 2DHSA 2MKKA 1WELA 3H2UB 2X1FA 2DNHA 2CPIA 3CCRS 1X4HA 2U2FA 3MUMP 1U6BA 5DDPC 1U1OA 1VQLS 2N7CA 3SXLA 3VAGA 2RVJA 1KQSR 2FY1A 1OWXA 2Q79A 2DH7A 2JWNA 3OW2R 4WFNQ 1U1NA 3UD3P 2M88A 1L3KA 2DGSA 2DNNA 2FC8A 1FXLA 3G8SA 4WIIA 1X4DA 2KI2A 2KHCA 2CQCA 2F3JA 1WHVA 5HL7Q 2DNMA 2MPUA 3UCGA 3G8TA 5IM0A 1U1PA 1VQ9S 1F9FA 2EK1A 3H2VE 3CUNA 3IRWP 2AYGA 2RRBA 3ULHA 1X4AA 3NNAA 1OIAA 4RU2A 5GAEU 2QA4S 1H2UX 2RS8A 5DM7Q 2MKCA 1M5KC 2ADBA 3VALA 2DNYA 5LXRA 5CA5A 2OSQA 1KOOA 2MQOA 2KT5A 2DITA 2MGZA 2CPXA 2J8AA 3L3CA 4FXWA 3BO3A 2DHAA 1X4FA 4F25A 2CQPA 2CPHA 4IOAQ 2DISA 1Q7YT 1FJCA 3P6YC 4FXVA 1X5SA 2N3OA 2XNRA 2VOOA 2L41A 2PE8A 2LEBA 1O0PA 3R27A 2CPEA 4W90B 3CCES 4A8XA 1DHMA 2KYXA 1VQNS 1YITS 3JB9k 2YWKA 4C0OC 2DGVA 3TYTA 1SJFA 2HVZA 1VQ5S 3THTA 2M4MA 4LJMA 1Q82T 2KN4A 2FHOB 2GO9A 4YB1P 2ZJQQ 1N88A 1HA1A 2OSRA 2AYMA 4F02A 3K0JA 2MYFA 1HD1A 2DB1A 3RW6A 3MDFA 3N9UC 1U1MA 1FJEB 2MQPA 3S7RA 1WWHA 2MZ1A 3MUTP 3UCZP 5BJRA 3LQVA 4ED5A 2YTCA 2OTLS 3CCUS 2LEAA 2L9WA 2N3LA 2DNKA 3TO8A 2CQ3A 2V94A 3DXBA 4QU6A 3FEYB 2MZSA 2ZJRQ 1Q81T 2CQHA 3CMES 1WI6A 1QM9A 2CPZA 1S79A 5DM6Q 2MB0B 1SXLA 2RUGA 1W2BR 5GVQA 1YJ9S 2MSTA 2CQIA 3B4MA 3I55S 2OTJS 5LJ5Y 2DHGA 1PO6A 2CQ0A 2E44A 2WBRA 1DBDA 2I38A 3MOJB 5IQQA 2DNPA 2JVRA 2KRBA 1WEYA 1RK8A 2QEXS 1X4GA 2K8GA 2MQQA 1NU4A 1WF1A 2HGNA 4W92B 1K8AT 1K73T 4BS2A 2VODA 2AYBA 2A3JA 2DGXA 1WTBA 2CJKA 1UAWA 2M70A 1SJ4P 1M90T 1WEXA 2XS7A 1D8ZA 3P5TL 2DO4A 2MXYA 1FJ7A 1X4CA 1UP1A 2JRSA 2CQDA 2MKSA 2YKAA 3G71S 1FO1A 4J5OA 3U1MA 3MXHP 3TP2A 2XB2D 1VC0A 1NJIT 1U1RA 4YOEA 4CIOA 3SDEA 2HGLA 1P27B 2JX2A 4ERDA 2LKZA 3CTRA 2F9JA 1U1LA 1ZZNA 4M5DB 4WKRA 2G1DA 1HD0A 1ZH5A 3MD3A 3BEGB 2ZJPQ 5DDQC 1AUDA 2B0GA 3CC7S 5DDOC 1JMTA 3HI9A 4U67Q 5ITHA 5LXYA 1R8PA 2MKJA 4Z2XA 2CPYA 1D9AA 2DGWA 3MUVP 2KXHA 2KU7A 1VQMS
chains in the Genus database with same CATH superfamily
3DYAB 2W9BB 5LMUJ 1FDAA 4JI4J 2OJ3A 3P49B 3OR2B 4FYYB 1S5ZA 4EZ6A 3PW4A 2W1BA 5ETQA 4ZVRB 2D3OR 4KO0A 5IV3A 3MOZA 1X5PA 1OY8A 2YKMA 5KFAA 4JI8J 1HL6A 2Y8YA 2G0JA 5K14A 3C15A 1FKAF 4GKKJ 2BMBA 1NSAA 1HQUA 3B8HA 4OHXA 4DMZA 3JAMU 1AT1B 4K4XA 4YP3A 2GGPB 3HD2A 2HNYA 2BJ8A 3B54A 3KUGA 5IXUA 1S1WA 3LO3A 2HNDB 1RTIB 2LLZA 4B9NA 4C8YA 3MEEA 5J2NB 4N41A 1UCNA 3R97A 2V8HA 1WF0A 5KFGA 4LRFA 3VQSA 1LW2B 1SCJB 3CJTA 1N33F 4DWIA 4M1KA 4OYPA 1H7WA 1BQMB 1RBOB 2BJ7A 2IVMA 2CYYA 2QJ3A 3PG9A 1GXLA 3J7YI 1YJWS 4TU7A 4WP8A 1QVGR 4M5HA 3RGIA 3UVJA 1F9HA 3MMAA 1L3UA 4FYVB 1R8CA 3R9LA 3G4SS 1HMVA 2EXUA 2LU1A 3HFKA 3ZZPA 4CQ1A 2R7XA 4I1TA 4DG1B 4AL6A 1YRTA 2VKRA 1DARA 3QIDA 4YB7A 1XNQF 3DGPA 3R7SB 3MR5A 2GVZB 3HMJG 4Y65A 3SQGA 1VRTA 2R2TA 5HMYA 3NOCA 1M5PC 1PAUB 4ANCA 2DNRA 4DSLA 1LXNA 5ETKA 2C1EB 4NEYA 5J1EB 4DUZJ 4GKKF 2NUUG 3ETMA 2B7BB 3TWZA 3JQKA 4ZKAA 1ZYQA 2HIQA 2XGQA 1YHQS 1RT4B 2O01C 3OXGA 3D7SB 4DPXA 3GZ7A 3D2WA 3EX7B 4JI0J 5F8NA 2VBZA 4AFFA 1C0UA 3QLHA 1CJKB 5IQ6A 2IMWP 1UWBB 1P9YA 3C66A 1XMQF 3EGWB 4KV8A 3MM5A 3CPWR 5LMNJ 2ZBCA 1M5VC 1UVMA 3UWTA 3LGMA 1U49A 2JSXA 2VZ9A 5LSLA 5KFMA 1B0VA 3A4TA 3DRSB 3KNGA 3AH6A 4LR8A 3BSNA 1NJWA 3ZTQA 1RAJA 2EG2A 3CJQA 1U2CA 3ENWA 1U1KA 3H20A 3KLIA 2KHDA 4NZ0A 4OYBA 3ENQA 3LH2S 1WC1A 5HATA 3GYXB 3FCHA 2YH0A 1FF2A 3D0IE 3D4JA 2V69A 3BH7B 3R3TA 4YUDA 2WTFA 2O1PA 1VJWA 4ZCIA 4NMXA 2ROPA 2V2KA 2Z2MA 1PYTA 3NY0A 4PYDA 2QN6B 3ILOA 1WNEA 1KR4A 2MLZA 2WSEC 3VAMA 3ZNJ1 1U6FA 2ZHOA 2BZ2A 5KFWA 3EGNA 3KK2B 2DR5A 2M0GB 3AY0A 2VDIA 2RILA 3HFVA 4UQTA 2V9WA 1HI0P 4WTYA 5K8MA 1DURA 2IRYA 2N7YA 1XMBA 3MMJA 3NGDA 2Q66A 4HKQA 2MDAA 1F9EB 2BANB 1J27A 3OTBA 2FIUA 3UDEA 1LW0A 4CZCA 5L9NA 4NLGA 2OMOA 2UXDJ 1FCAA 5E3AA 3PCOB 5KFIA 4C0BA 1NEEA 5G0RB 3BYRA 4OYWA 5LJ3Y 4K50A 4KO0B 1Q78A 1RHJB 2HS3A 3GIMA 1UFLA 3GV5B 4M95A 2AV5A 4C48A 5DGBA 3M30A 1VISA 4OFZA 2BR0A 1HYSB 3FBBA 3IS9A 2ADCA 2YWGA 4FP9A 5C42B 3NS5A 2KG1A 1RAAB 2PMWA 3KLEA 2XZWA 3RRHA 1WF2A 1NAQA 2GHWA 4JI4F 2LQ5A 4DQSA 3FSYA 2CG8A 4PZVA 2X1GA 3US5A 4DFPA 3TAPA 1OSCA 1VLOA 1S1UB 3G82A 1F1BB 3MCMA 4P6QA 3CO9A 1FE4A 4HT7A 1CULB 2M52A 4XTTA 3W2VA 1XMOF 4CO0A 1SH3A 2VONA 3BQ2A 2KXNB 2XS5A 4WF9Q 1JXEA 2M5YA 3K58A 4LRDA 2K2PA 1H74A 1IJEB 2MMYA 1N5YA 4J9LA 3MD1A 1QLNA 3ITHB 4CLUA 1IM4A 2XZDB 2DNLA 3FEXB 3O6QA 1BMQB 4NI2A 2MY7A 1EETB 4HHHA 1C2PA 4C2MA 1CLFA 3TAQA 5MAOA 3G87A 4CO3A 4F4KA 2IJNA 3DLGB 3EVMA 1N8RT 4CH0S 3PVXA 1AFIA 4AQYF 3KLEB 3DYAA 2W9BA 4ECWA 2J8SA 3JSRA 1XK8A 2IIHA 3D28A 5HROB 2BDPA 2A6MA 5IT0A 1SH0A 3MM7B 5BYRA 1YJNS 2UVVA 3CCLS 1P8GA 1DTQB 1YI2S 4DPTA 3HD1A 1VBYA 2XHCA 4U8YA 5GAGU 1NO8A 1JJ4A 3DU5A 5KFUA 3W63A 4FF2A 2G4BA 3MEGB 3UDLA 1YBAA 4J37A 1AZSA 1T9YA 5CYJA 3JYTA 3CJ3A 3CDWA 2F8MA 3LP1B 4KIAA 4OYXA 5HBMB 3CVKA 2XWYA 1S1TA 4JI3J 4L75A 3R7NB 4J9RA 2QE5A 4KGKA 2AGOA 2KXFA 3E01A 2UXDF 2DXEA 1F5CA 3C6TA 2OFHX 2XEXA 3BM7A 3NGTA 4KSEB 4KYZA 4K4SA 2E5HA 2XNQA 2UUBF 1NDLA 1RLCL 2DY9A 3QSYB 4HACA 4N56A 2NXNA 3T1YF 3LA0A 2Z30B 2MSSA 3TA1A 4LSLB 2B4PA 4MYTA 4IUFA 4K8RA 1S0VA 1F0XA 5F8HA 4F0KA 3KLFA 4LIRA 3F56A 2Z0GA 4ECYA 1SQEA 3DLJA 4V19X 1VQKS 1UW4A 4WCEQ 2VHGA 2VPWB 1VC6A 1IJFB 4ZJLA 7FD1A 5FJ4A 1AYEA 3KJQB 2V50A 1HHQA 2AD9A 3T1HF 1WC6A 3PV8A 3M2RA 2ZNZA 1D09B 2QRRA 2E9RX 3M8WA 2WVDA 5KG3A 2IVFB 4NZ7A 3TJ9A 4E8UA 4B9TA 3MEDA 4H4KA 4P7VA 1T05A 3MM5B 3UNYA 4ILRA 3K57A 3B82A 5EWFA 1KVJA 1HHSA 3TJAA 1C0UB 3QLHB 4UF4A 4ED8A 3AOAA 1VC5A 2K06A 3EICA 2YWEA 2F1FA 4PUOA 2OEJA 5IT9Y 1E6VB 4A8QA 2FPHX 3HHLC 4RX6A 2LQ9A 3H0PA 1FD8A 4DX8H 2C2OB 4RUHA 2VJUA 5T41A 4OLPA 3M9OB 4ALZA 2MZRA 3HKWA 1X9SA 2YNIA 2DNGA 3SQGB 1JJ2R 1YZ6A 3W60A 1NKCA 2NS1B 1R0BG 1B64A 2H3EB 3V6HA 4B3RF 2HVIA 4RBTA 4QIVA 3KTQA 3RB0A 1FX4A 3O3LA 2Y9HA 3W1YC 3FMBA 1WACA 3CXCR 1DLOB 4M8LA 1FRLA 2OLWA 4GKJJ 4NA2A 3I5AA 3LAMA 3VV2B 4L74A 2DT9A 2J0SD 2FHKA 4C7QA 3PHTA 1YJVA 2MQLA 4DUZF 1IQZA 2ACYA 1E6YB 2YNHA 4GVLA 5F9LA 2HRUA 4LMZA 4QU6A 3BPDA 1IBKF 2NZ4A 4L73A 4NLDA 4Q2LA 3BS9A 3BBBA 3G96A 1X9WA 1UVKA 3I96A 1KQKA 2DHSA 1RE1B 3CNQP 3MEEB 2MKKA 4EEYA 1BHNA 2ILZA 4Z37A 1RBLA 2OUGA 3HHEA 3PKYA 2VIHA 4NLPA 1WELA 3EWGA 2G2YA 1TTHB 1TUWA 3H7HB 4OJHA 3CCRS 4RNMA 4I2PB 3MUMP 4QWBA 2VG5B 3AODA 4ZVFA 1K47A 4MKAA 4H4KC 3SI8A 1VQLS 1HARA 2R3VA 4P74A 1FXDA 1SKRA 2UUAF 4K0KF 2N7CA 2Y1IA 1Y5IB 4K59A 3IWLA 1UJ5A 3HVWA 4K5RA 1N5VA 1X60A 4NOHA 1KNZA 1L3TA 4Y28C 1RT1A 4EYHB 3GCWP 1HFEL 1NHUA 2JWNA 3JTPA 4WFNQ 5I4MA 1U1NA 4MKYA 5A8WB 2HW3A 3W8PA 3FSIA 5CZVA 3GWCA 3I82A 2C3UA 4F4WA 2BKNA 4ZVGA 1APSA 4RNHA 1TKXA 1VFJA 3JSBA 4TLRA 5GMDA 2IAJB 2FC8A 3CD5A 1RACB 3HSGA 3G8SA 4YY3F 2ZH8A 1FXLA 2ZUAA 1X4DA 3T1AA 2VQEJ 1QAYA 3MTKA 1SKUB 2DNMA 5HL7Q 1T95A 2YWHA 5IM0A 1U1PA 2J0WA 1D3WA 5AXKA 1KQFB 3MMCA 3IM8A 3U27A 3W66A 1TFWA 1N32F 1IBCB 2EC2A 2OEKA 3AJ2A 4FKYA 3MEDB 5KT5A 2DCLA 2HZVA 4IRCA 3H2VE 2ZHBA 3T5LA 4WK1A 2AYGA 4C6AA 2IC3A 3GIRA 5B0EA 4Y2AA 1REVA 3M7VA 3GV8B 4J9PA 3BDPA 4OZ5A 2OFGX 1RT5B 4HHUA 2W7PA 2HAFA 4RU2A 3MHYA 1SH2A 3FNNA 8RUCA 2R7UA 1LWCB 5DM7Q 1N6QA 2MKCA 4DR4J 1M1GA 1C4CA 4RUCA 4F3OA 1M5KC 3ZTPA 1T9UA 2HQ3A 3FZBA 2DNYA 1BQNB 5LXRA 5CA5A 2ZOMA 4C8OA 4X84A 1XMQJ 5DZ7A 3K5MA 3OL7A 1NHKL 1IM6A 2YX7A 4K5SA 1TVRA 3C2PA 1OQ6A 4JI0F 3ELHA 1RTHA 2V5HG 2Z2ZA 3G8QA 5AXLA 2VQFJ 3G6VA 3QAEA 2VA2A 2NYIA 3CJRA 3M6XA 5K20B 1N33J 2X3GA 4YHHJ 3OJUA 3OLAA 3GMGA 1JLQB 1SJ1A 4BCAA 1ZETA 2LQ8A 2AZ3A 1C0TB 3O1LA 2XYGB 2MHEA 5C2GA 1PJ6A 4F2RA 4M5GA 4DR6F 1B99A 1EKSA 2DY1A 2V68A 4PXCA 4ED7A 1FJCA 3QGGA 4KE5A 2WCXA 2XNRA 3GONA 2D69A 2JC1A 2N3OA 2HHVA 3ET6A 3POTB 4OZLA 2VOOA 3R27A 2R2RA 1HR0J 4BHQA 2VG5A 4JI8F 3DOLB 3I0RB 4A8XA 3OL6A 1TK8A 2DR7A 1HBMB 2V2VA 5F41A 5HI7A 3CB4A 4RNOA 4B9VA 4GKJF 1MWQA 3QAUA 3TAMB 2YX1A 4DFMA 1R43A 4OYAA 4E98A 2JOQA 4LSLA 2QSFA 4OX9F 5IWAF 2V63A 2RDJA 2ZD1A 2YWKA 3HT0A 4C0OC 1OJ4A 3TYTA 4ZP6A 4RU9A 2R7TA 2VF3A 2ACMA 1HWLA 2FY8A 3EDRB 5K14B 3TUPA 4G1IA 3W5YA 4I6YA 4DU8A 1WC4A 3DN9A 4YB1P 1JXLA 1TAUA 1G4CA 1HA1A 2XSJA 4CO4A 4ECSA 2OSRA 4F02A 1GX6A 4ZVHA 3FKBA 4N7TA 3D6HB 2C2EA 4X62F 4TYAA 3RW6A 3B78A 5T7LB 3QATA 3EZ5A 1NDCA 3HVAA 1SI9A 1FJEB 4AQYJ 1ZPVA 1BWVA 3MPDA 1QE1A 1WD6A 1WWHA 3J80Y 3MUTP 3LQVA 3UCZP 4ZVSB 4Y2IA 2AEFA 3M2UB 3W7BA 2HK2A 3ZFVA 1GTEA 2N3LA 4AD6A 2DNKA 1RTJB 2HSEB 3DMJB 3DXBA 4ID8A 4UOHA 2BOAA 3ISZA 4Y2CA 1JLGA 5E0OA 3UN3A 1Q81T 2CQHA 1TL7B 5FD1A 3RJMB 4RR5A 1PAEX 4DV1F 3K7RA 1WI6A 4LR9A 4JI6J 2QYCA 4JI1J 2BW2A 4OHZA 3QNWB 2MB0B 3TZXA 3F0NA 4JI1F 1B0TA 3HHLB 3OTDA 4L76A 4ZIWA 2VUGA 4CLYA 4KTQA 3CMQA 1Z1ZA 3M8PA 3UO0A 3I87A 2C2MB 1Q53A 2EC0A 1LWEA 4NXMJ 1KONA 2HFNA 4OMFG 2GS8A 1IXKA 1M5HA 1XQIA 3EE3A 3LGHA 2I38A 4DV0F 4GO5X 3Q83A 3PW5A 4P7TA 2XM3A 4WKYA 1FTCA 2JVRA 3QIPA 1WC3A 4DS5A 3DRRA 2ZUGA 1WEYA 1RK8A 1S9EB 5M2UA 2Q3PA 3QWUA 1RTDB 2HEKA 5EX0A 3TUZC 4HTJA 5DZ6A 1JLAB 2CJYB 1N56A 1X4GA 2UVWA 5E2QA 5KFZA 4WZMA 1WF1A 2PI4A 4LF4J 1R0CB 2B43A 2R2SA 1ZS6A 3D6MB 1S9GB 3N79A 2HMIA 4XPCA 2AYBA 1R6VA 1WTFA 2CJKA 1T02A 2DGXA 3CDUA 4RL1A 2QL7B 5A8RA 4DN0A 1RLDA 1WEXA 4FNHA 1BGXT 2ALYB 4LRBA 3MM8A 4OX9J 5A8RB 3D66A 3KYLA 5JJBA 2JLFA 5F3TA 4KGXB 2DO4A 3TVKA 1RWUA 1X4CA 3ILJA 3UN2A 2HHXA 1TL5A 3VGUA 2JRSA 2IM0A 3GIIA 2AJFE 4WJBA 2R7WA 3D0HE 2NXUA 4HDHA 2YKNA 2YKAA 2HNZA 2FZGB 2K3IA 4J5OA 4QWCA 3G71S 3K59A 1NJYA 2E9TA 3MXHP 3V81A 4K4UA 1U4BA 2XB2D 1VC0A 3UR0A 2RMLA 3ISND 1FRMA 2I9SA 1VK8A 3RAXA 4F7VA 4JI7F 5ETOA 2EWHA 1HI8A 3DNCA 3TZWA 5L9XA 1P27B 4PPDA 2JX2A 2GVZA 4ELTA 1DTTB 5L8RC 3Q8UA 3MR2A 4K2JA 1SBRA 2F9JA 2R9LA 3TARA 1ZZNA 4PXEA 4UZCA 5AE1A 2ZH5A 1T94A 3TVYA 2A10A 2G1DA 4YMEA 4G3IA 1HD0A 4CLFA 4Y2KA 2HS4A 2YPYA 1C4AA 2BE9B 2JNJA 3BEGB 5FLXY 2BE2A 3LANA 5L1IA 4ECRA 1CEZA 1J5EF 2IM2A 1FRIA 5DDQC 1S1TB 2VASA 5H9EJ 3PHEA 1AUDA 3VVTA 1NLKL 4DQIA 3EJMA 3GILA 1JMTA 1FK9B 1S6UA 5B0FA 4URQU 4U67Q 2JEGA 4ATNA 1NH7A 2QL5B 1HNZJ 3WX8A 4CTAB 2EFNA 2NZCA 3DLEA 4DR5J 2WAQD 4RNNA 1I3OB 4DR4F 3HSZA 2KXHA 5FDLB 2UZAA 4YEAA 1XIQA 2R8KA 1RCOB 5T7LA 2R7OA 4MFBA 3VVUA 3PJWA 1R31A 2H51B 2W25A 2IJRA 3H40A 4J9NA 1CJUA 5DS7A 3M05A 3BQ0A 2DJWA 1HYSA 4R25A 2OPQB 5KFOA 3VZHA 3B4DA 2HVHA 3CE8A 2QMXA 1JLCA 2DGUA 3ONQA 4O3PA 3KK3B 2C2RA 1HHTP 2E1MC 5F0UA 1YG0A 4Y3CA 3ZZ0A 2MHNA 3FZ2A 4OZ1A 3OBIA 1NRKA 4NASA 1VQ6S 3D5MA 2W2PP 2ZD1B 4Y34A 5HO4A 5DQIA 2UVUA 1HNWF 4OZ2A 3V6DB 2EBGA 2YKOA 1N34J 4KRWA 2LYVA 3BB5A 1JLGB 1RAIB 1RWOB 2QLJB 1WHXA 3GSDA 5CCLA 4Y0FA 2V4RA 4C8LA 3D9BA 3DDKA 4EI2A 3DOMA 5K8OA 3VAHA 1KVKA 4LFAJ 4WE1B 3CC2S 1I94F 1S1WB 2FYXA 3E8OA 3KUHA 4O44A 2FVRA 1VQPS 4Y6IA 3AD8C 3BDEA 4RO0A 2OIHA 1QUVA 4QIEA 2DH9A 5JMNA 4J9MA 4GO7X 2DEJA 1QJHA 2IYIA 2PN6A 3F44A 3MZIA 4CDIA 1R89A 1KP6A 4IQMA 1GH8A 4QU7A 1PC5A 1VQ8S 2RS2A 1NK4A 3CF5Q 3OLBA 3C8YA 3EUNA 3VAJA 1F3VA 1NUEA 3J7ZT 3MECB 1RWKB 1X5OA 1HNIB 1RAOA 3H5SA 3HHKA 5KFQA 4M5JA 5D4NA 5FDLA 2MY8A 4DUTA 2F4VJ 1BC6A 4EGLA 2DO0A 2KZMA 1YX2A 3PRVA 2ZBRA 3TQEA 3FRYA 4OI0A 4F3MA 1S9GA 3CCTA 5F8LA 4O3RA 5KOWA 1OPZA 3AQOA 1RA6A 1H72C 2CKWA 2JL9A 2CNKB 3P8BB 2YX4A 2VD3A 2XCAA 3Q24A 3DLBA 4NLXA 1HNIA 3HK2A 3DLKA 2M7SA 1HWJA 2W7OA 5KFCA 3PO4A 1TP7A 4HH1A 4LBIA 2GNKA 5E3PA 3Q22A 1S10A 4I56A 1QTMA 4OV1A 4K4ZA 2SXLA 4JV5J 2AF6A 2D7SA 2V9KA 3CDBA 4QZVB 2PI5A 1KDNA 4AUKA 4L6V3 4RJVA 1XERA 5DRKA 1MWZA 1O8BA 4ZPAA 4USTA 2HFUA 2WBMA 4X4VA 4LF5F 2CZVC 2DHHA 3CC4S 2DNZA 3HHNB 2A18A 2H5JB 1U1QA 5KFYA 2DEIA 2P9GA 2RDIA 4DJBA 1U2RA 2GCFA 4PKDB 3J81Y 4PQUB 3DOKB 3OD2A 4U7UD 2VFRA 7AT1B 2XZTB 2FUG9 3SFGA 1RT7A 1A9NB 1KLMB 1LFWA 1RT4A 2EG1A 2RQ4A 3MEGA 4ED1A 2DTJA 2LDIA 4ZPWR 5I3UA 3FCWA 5B0CA 1BD6A 2GHPA 2UU9F 1FRXA 4ZCKA 4F4AA 2XLJA 4KFBA 4FF1A 3DXSX 5F8IA 3KK1B 2K3KA 4TN2A 3MR3A 2OPRA 4KT0C 1HQEB 1VDHA 2FJEB 3SFUA 4X4NA 1ZPWX 4K4VA 2CXEA 1EB0A 3AJ1A 3DHWC 1OSDA 3QGIA 4OJ3A 2MZQA 2HK3A 2XC9A 4Q8EA 2VOPA 1W26A 2X1BA 4O3QA 1RAFB 4JB8B 1VQ4S 2K7JA 3M32A 3W2WA 4DCJB 2DK2A 4MFBB 4NYOA 3GIKA 3OJSA 1MW7A 3CCVS 1Y00A 2FLOA 5IM0B 4FS1A 2LMIA 2UP1A 4DSIA 2AP6A 3OFGA 1K1QA 4LSNA 4Q43A 5JVHQ 1PJ5A 2V6AA 3NG8A 4IOCQ 3T1YJ 2W4DA 2LEPA 4CTAA 1WUUA 4FN5A 5ETTA 4LSNB 2BQ3A 1QAJA 4DU7A 1KD1T 1SIZA 1FJGF 5SUHA 3BKFA 3MCNA 4LFCJ 5GMKa 1FK9A 2R7RA 4IDKB 2JVOA 2PMHA 1IWGA 3A1YG 1E6YA 2GVDA 2YNHB 1RKJA 1Z4UA 3M8QA 4N8NA 4DV3J 1L3SA 3FGVA 2APOA 4I7FB 1QY7A 1EX8A 3MFHA 2VICA 2CZ9A 1HNVA 2E5GA 4L3KA 1IBMJ 4FVCA 2FJVA 2HHHF 3PFOA 2KTQA 2DR6A 3ZZTA 2OPQA 3W62A 4QR1A 2GIRA 5L1JA 2LXIA 4DV2J 1ZM2A 1LWFA 2BXJA 4PXDA 3R8YA 3KHRA 3V5RA 4KAIA 5MLCV 1IQTA 4EYIB 3CCMS 2W4PA 4A8WA 4U8VA 3OUYB 2V8DA 5CYQB 1YIJS 4CLLA 1H38A 2IM1A 3TRGA 2DGTA 4RW4B 1E6VA 4G6VB 1U0HB 4A8OA 4EUVA 2KM8C 3IBWA 1OO0B 2NPFA 1K9MT 4AYBD 2UU9J 2Z56B 1FRKA 3LUYA 4P52A 4PCQA 4F0MA 4B9SA 2LQJA 4PUOB 1RJJA 3RB4A 1SQFA 4DHVA 3VAIA 1HWIA 2AZ1A 3PX0A 5J2MA 2ERRA 1UZDA 4ZVOB 5AE2A 1SV5A 1JLBB 4C9DA 3MM8B 2KYZA 4K7QA 2F9DA 1X0FA 4JI2F 1EP4B 2DR8A 2W7AA 4DSKA 5FLXU 1A6LA 5IS2A 4ELUA 2HFVA 3NMRA 4PWDA 1NPPA 2HVEA 4FYWB 4KGVB 2G13A 4X65J 2ZH9A 1X5TA 1SL1A 1HNZF 2AGPA 4NLOA 2V2QA 2XWXA 3FJ2A 4R0EA 2DCUB 4BWMA 5J2PA 4A8MP 2VPZB 2YNGA 4M63A 3VGTA 1VJQA 4USKA 4BC9A 4I6AA 5KT2A 2HHQA 3MAAB 3D1HA 3CIMA 3CCJS 3FQLA 2MQMA 5M2RA 1B7FA 2IY5B 3IBFB 4OYIA 3R2DJ 1F6TA 5FIIA 2RQCA 5DETA 1RHRB 3KDNA 1T9VA 4UY8T 2MLXA 2HVDA 1V9OA 3ILLA 3IR5B 2DNOA 4I2QB 1Q8BA 4WWSA 3LPYA 2MKHA 5KT7A 4XIUA 3TUJC 1NK0A 4XK8C 3CJ2A 5D77A 3I4HX 4AXIA 1XEZA 5KG5A 2RRNA 3EPIA 4DZ6A 1V3RA 2HBRB 2CVEA 1WC5A 4KY3A 4F4ZA 1WHYA 5IFMA 5J1EA 2KVIA 1JXVA 4X4PA 4YN3B 4PRFA 4HTIA 2GAGC 2YKPA 2B9WA 3GPAA 3IM9A 2KL8A 3AQPA 3SSQA 2A1BA 5U47A 1VRUB 1TKZA 3AOBA 1PBAA 1NKEA 3RAMA 4FF3A 1F2HA 1SUQA 4ZP8A 4RUBA 3PRBA 4A46A 3KHGA 4ILMA 1PILA 5D4OA 1GT8A 2KDOA 3EVOA 4OI1A 2D9PA 5GAHU 5DLFA 1U48A 5HROA 3NNCA 2A2DA 5C24B 2HS0A 1R0AB 1VBZA 1JLFB 2FB0A 1R8HA 2O67A 1UFWA 4USIA 2OD6A 5ETVA 1ZBTA 2CJAA 1LWCA 4EK2A 5DDRC 1IKWB 3OVBA 2ZH6A 1CC8A 1S0NA 1DZ5A 3IWNC 4O3SA 2CQ4A 3K8WA 3HHLD 2VFUA 2G0CA 3CGIA 4NI2B 3WBZA 1FEEA 4ECTA 1KSPA 4NLWA 2FGCA 3MF5A 4OZ0A 1KKHA 2DIVA 4TXSA 2A0FB 3T5KA 2HLUA 5HVGA 1F5AA 2HFSA 3H2LA 3A8JA 1AA1B 2Q43A 4B3TJ 4CLPA 2L9NA 3A3OB 2BOPA 1X4EA 2FZKB 4OHWA 2PSZA 5DJBA 3OSPA 2BM0A 5BR8F 5EX3A 3IN5A 4O0IA 4LF6F 2BRKA 1Y10A 1Z2ZA 4OI4A 1GAOA 3W8GA 4U6PA 1TL7A 2DNHA 4LQ3A 2BV3A 3DM2B 1JLFA 1X4HA 2J9DE 1TR0A 2U2FA 4UOFA 1U6BA 4WP3A 5DDPC 4A8YA 1DTTA 2MTLA 3MR6A 3M6WA 3I0SB 1QSSA 2YNIB 2IYGA 3ET6B 3POTA 3SXLA 1S6OA 4D3GA 1KQSR 4IRDA 5EUHA 1OWXA 1WSVA 5F9NA 2PO4A 2GIFA 4MKVA 2PEBA 1C0TA 2V4QA 1TMJA 3HM9A 3MPUB 4L72B 5K5MA 2W2QP 4UW2A 1L3KA 4WTOB 1LK5A 4ED6A 3BN4A 3EYZA 2VG7A 5I3PA 2W9CB 1CPZA 2DGSA 3IP0A 1S6QA 4OV6A 2WOMA 3D3CJ 1LW0B 3KWMA 2D3O1 5D15A 2X51A 3EPGA 4C8ZA 2DNNA 3C14B 1NSPA 2ZC4A 3E3XA 1KFDA 4V1Ak 4ZMMA 2QYGA 2F3JA 1WHVA 2B4OA 2H1YA 2MPUA 3TEGA 1S1XB 3G8TA 4DF4A 1O5JA 4F67A 2C2ZB 2DRAA 3PTWA 3TQ1A 4Q44A 2RE1A 1D8YA 1Z2LA 3NGKA 1F9FA 1X9MA 2DPIA 2EK1A 5D0RA 1PYOB 4OYMA 4DV4F 4DV3F 2YNGB 4R8UA 4X4SA 3IRWP 3CUNA 4LUBA 3U7JA 1C1BB 3W9HA 3LWMA 3ZZOA 2E1CA 1CJTA 2G9OA 1Y4ZB 2F8EX 3RU0A 5CZXA 4IFYA 4USJC 3DI6A 2QLWA 2RS8A 3T6BA 5L39A 2XLIA 2E9ZA 3BREA 2CNOB 3SV3A 1JWWA 5E3RA 1RZMA 4UZBA 3VALA 4P72A 2QGFB 4KGMA 4PG5A 3SSRA 4N76A 4KR0B 3GFYA 2C2NA 1DQ8A 4N77A 1BE4A 2KFZA 1TK0A 5CYMA 3LALA 4I2QA 5LM7E 4YDDB 2HHTA 1OY9A 3D67A 2EPIA 3BSAA 6AT1B 1MU2B 2N4DA 5J1NA 1RAHB 4QBUA 4ID5A 2J8AA 2YNFA 2I8EA 5JXSA 3GLJA 4F3QA 3L3CA 4C11B 4QYZK 2XMWA 3QT6A 4USWA 4F25A 1S1VB 1HW9A 3M9NB 3Q23A 1QE1B 1URRA 1Q7YT 3MAHA 3VTIA 4IFYB 3P6YC 5LOQA 2BJ9A 2OD4A 2OPSB 3CSKA 2JEFA 4I7FA 1HMVB 1RT5A 4B08A 2LEBA 2KT3A 4IOBA 5H9EK 1TK5A 3JSMB 2CPEA 2ROGA 1IUJA 2YPZA 4W90B 4CRJA 2RB7A 3UW1A 5HQMA 2VV5A 1V5IB 2HAIA 3BR8A 1DAXA 1KEKA 3MGJA 3HLUA 3N5BA 3M6VA 4LF5J 2HHSA 2XULA 2Y1JA 1N34F 1FDNA 4O44B 1VYAA 1VQNS 2XTJP 2HNDA 1YITS 2YXLA 2AKWB 2QIFA 3E51A 2DGVA 3CJSA 3KNAA 4IH5A 1RABB 1UEVA 4P2MA 1N32J 2Z2LA 1H7XA 1SL2A 4OL8A 3I6PA 2GO9A 2HQDA 2FHOB 1U47A 1I1GA 1T11A 4CLKA 4JOUA 4N47A 2ZJQQ 1N88A 1RWWB 1NDPA 3L7UA 5C42A 2AYMA 1SC4B 1JB0C 2IVYA 1T9WA 1Y5LB 1R7IA 1RB0A 2DB1A 1RT1B 2MYFA 3MDFA 4TNOA 1Q95G 4DG1A 5L46A 1U1MA 3K8VA 1X0PA 2AWZA 2WHOA 2HLTA 2MQPA 1SVDA 1BUXA 3BF4A 2I1RA 2P6TA 4M5IA 5BJRA 3R2CJ 4V19J 2F4VF 2YTCA 3I0SA 4KKOA 3HF5A 4RW8B 4YS2A 4DV7J 2LEAA 3TX8A 3RTVA 4C8MA 3GB0A 3QMQA 3VZIA 2CQ3A 4LF2A 5K8PA 3SCJE 2YNFB 3FEYB 3SCLE 2BKOA 3HPOA 5HN0A 2J7KA 4ZPBA 1TKTB 2GAHC 3RUBL 1N36F 5LMNF 5A0YB 1S79A 1W7WA 5LT5A 3MEKA 1RTIA 3EXCX 4N8OA 1WSRA 3A3NB 2RUGA 1TZ0A 3R5JB 2MSTA 1RTZA 1MMDA 2CQIA 2QTWA 2X7IA 3I55S 3HHDA 1LV5A 1JLEA 2FQQB 3C15B 5LJ5Y 2DHGA 4RPFA 2B6AB 1KS2A 3N6LA 4IH6A 3RG6A 1EZZB 4DSJA 2E7WA 3K2YA 3KKFA 3HSJA 2WBRA 2B5JB 4S0MA 4EO6A 5HSPA 4NXNJ 4AXJA 3MPYA 4CP5A 1RI7A 4I67A 2ASDA 4U95A 4URGA 4W98A 1V3ZA 3KUEA 2VG6A 3CD7A 2NREA 5KFHA 2WW4A 2HBZB 3NEKA 1NU4A 1VQYA 3GP9A 4CNYA 4DV5F 2CDQA 2PC6A 3W61A 2HGNA 2Y1LB 4NWBA 4PG7A 1K8AT 5B0AA 4R0JA 4ZIVA 3N28A 9ATCB 2CWXA 1Y3JA 1LNQA 2EFGA 2QLBB 3KLFB 1WTBA 1UWAA 4OZ3A 3CJKA 4ZCLA 3MM6B 3IFEA 2HQFA 2BJ1A 3JXOA 2HG4A 4HACB 3SV4A 3AJDA 3EMTA 1FDBA 3L7PA 3MM9A 3AXKA 2GIQA 2KJVA 3P5TL 4HR2A 4DPOA 1TQLA 2JFDA 3QGPA 4DX5A 2C22A 1AROP 2P5VA 4NLUA 1YJTA 1T03B 5T14A 4NRTA 5HP1B 4LFAF 4P2FA 2CQDA 4CNZA 2KT2A 2MKSA 1FO1A 2OAUA 4FF4A 4ZVTB 2RUSA 1S7IA 1X8DA 3TP2A 2K1RA 1RHQB 3AXMA 3IR7B 2BX6A 5E3QA 2DR9A 3OFFA 4O23A 2VFSA 4K4YA 2NPIA 3MMBB 4ERDA 1Y3KA 4JV5F 2W8KA 4HEA9 4OJ1A 1GFWB 2B51A 2X3DA 2RHQB 2QA4G 3RBDA 3DRRB 4FYDA 2AT1B 4M5DB 3BV8A 3QGHA 4DX7A 4WKRA 2R4FA 1FRJA 3QO9B 3NGUA 4F04B 2ZBIA 3ZO7A 2OO4A 2XMJA 4XDDA 1YGYA 3A8IA 3CW2C 1PYSB 1KBRA 2P6SA 3BBCA 3UD5A 4A8FA 1VMBA 4Z7YA 1B3TA 1EP4A 2EFQA 1EHWA 4DDFA 2FVCA 3ICLA 1NZAA 3CC7S 1IN0A 1UEKA 2XI2A 1N5YB 2ZVIA 4LBPA 3GR1A 3HI9A 3HZGA 4KGZB 3TUIC 2C42A 3M2VA 3IRXA 4TQRA 2YKMB 3PW7A 3NCPA 1RT3B 3VR1A 2GQCA 2YBVA 4Z2XA 4DUYF 5A0YA 3W3SA 2GMHA 3MUVP 1WOOA 2FDNA 1NJXA 1SIWB 5AXNA 3DFEA 5D0GA 2GX8A 1VQMS 4ED2A 1DLOA 4TU9A 4QQBA 4YR3A 1AB8A 1QAXA 1XN9A 3KK1A 2MJUA 2AIRB 1OYDA 3EGVA 3KOAA 1JIHA 1JK9B 3NS6A 3ENAA 3IG1B 3DGPB 1FESA 2HWIA 3QRQA 1PJ7A 1SC3B 4EWTA 1M5SA 2EFPA 3RZAA 3UNGC 4TU8A 1KHWA 2AEMA 2OGUA 2HYIB 4MAKA 2XMMA 3BJYA 4IH7A 4AT1B 1NKBA 1VIXA 3DOKA 3QT7A 1BLUA 3TW0A 4FBTA 2BE2B 4F26A 2CRLA 2QFIA 1UJ6A 3KG4A 1PIEA 2XBPA 5JUMA 4RBVA 3MI7X 2HHUA 1GMUA 2BABA 2CPJA 1GXTA 3HVTA 4FKXA 3QZ8A 1NK6A 2H4WB 3C16B 3D54A 4DR1J 5HLFA 3BSCA 5A76A 4NXMF 1RQ0A 1HR0F 4K4TA 1WG1A 4C4WA 1RA7A 3S6EA 1IKWA 1NNDA 2FVSA 3TZYA 1HWKA 3CJ5A 4NEZA 3CT9A 4LVOP 3V81B 4RW6A 3M32B 2M9KA 3W2WB 3UD4P 2VBYA 4MMOA 4G1PA 2W9AA 4B3RJ 1M5OC 4NXNF 1QD1A 2VPYB 3GSIA 3ZTOA 5A2QU 5EWEA 1NK8A 1B4SA 2EI5A 4RW7B 2M8HA 1N4LA 3FCVA 3IRXB 2XGPA 1YBUA 1U26A 4MTPA 1SUQB 3Q2TC 4KHPJ 1CQMA 1VRUA 1W25A 3J7YU 3ISNC 5E33A 3WC2A 4LF8J 1WG5A 5E3CA 4KFBB 5B0BA 3QFWA 3UE2A 3JAMY 2Z57B 3KG0A 5RUBA 2GJ2A 4JYAJ 3NAIA 5HJXA 2LU2A 1Q1KA 1SL0A 4JYAF 2RU9A 3ZTRA 2RKIB 4DL0C 4DF8A 1NM2A 2POKA 3FMWA 3PJXA 2HZCA 2HURA 3C6UB 1RWXB 1DQAA 1JLAA 2CQBA 2D74B 3M8YA 4RW9B 3CJKB 3JYTB 2B4VA 3RAQA 3JS9A 1IKXB 5H1SV 1P9QC 1Y7PA 1EAYC 2RJZA 3LF0A 1S77D 2VJVA 1AFJA 1UA0A 4ES2A 4ZLNA 4PPZA 3LP0A 2E5LJ 3ZNUA 1KC8T 1URNA 1HI1A 2CUYA 4M5KA 3TNVA 3E2EA 3D6FB 5F0WA 1MMNA 1XMOJ 4M5MA 4ZPCA 2V34A 3PYGA 4H4OB 3C6UA 3WC0A 2J0QD 5KFTA 1ZM3A 2DXFA 1HIYA 5DO2A 3D1OA 4BLGA 3C46A 4C8KA 1HBOB 4HL9A 3S1TA 2DGOA 3UCUP 3ILIA 2BJEA 3TX0A 1ZA2B 2LECA 3MFIA 1UVNA 1S59A 4YDXA 1TVRB 5BR8J 1XJWB 1RISA 3CD0A 4WK3A 1XBWA 4YB5A 1R6YA 5ETMA 2V8GA 2FZCB 3H5YA 4UOGA 1BY9A 4R5PB 4DV0J 3IWXA 4GRSA 1GX5A 2RNEA 5KG0A 1FFSB 4X4UA 2XMUA 1FX2A 5DGAA 1V6HA 3VWSA 5GADU 1UEUA 2IAJA 2HNYB 4WYLA 2CQ2A 3PIPQ 5IT4A 1VQSA 1TKTA 2F4FA 5ADZA 1RT6A 1DFDA 1MG7A 1WHWA 1A7GE 4CO1A 4EBCA 1WOSA 1NH8A 2A2CA 2QA1A 3TR5A 4ZDNA 3W5ZA 2I2YA 3CD6S 3OTOJ 5I42A 1HNXF 2BJDA 3OTOF 2B8PA 2MZJA 2YH1A 1JJHA 2GQ2A 3NGSA 1VHIA 2DIUA 2HHWA 1JKHB 2B6AA 3I9V9 1YVFA 5EWGA 4UUWA 1VRQC 4RZRA 1NB7A 2OPRB 2RHSB 1N5QA 3JQMA 1TU0B 3IC1A 3V4MA 2XO6A 2IDLA 1KN6A 3UVJB 2BQUA 1VOMA 3N6NA 1U2FA 3VAFA 2ZE2B 3VQTA 4X4QA 4JP8A 1FFGB 1YWXA 1LQ9A 3ETOA 2PEHA 4I6WA 8ATCB 4B3OA 2R2UA 4ZPVR 1LW2A 3KJNB 2ZH1A 1RWMB 5C7PA 4B3OB 4OX6A 2V0NA 2QL9B 3A8KA 3AB2B 4ZJQA 1YQHA 1S72S 4NLSA 1Y0HA 5B09A 5J2NA 3GIJA 3PX4A 3RBEA 1IBMF 1KRPA 3NNHA 2YQ1A 2V8PA 3T9NA 3G6ES 4OYZA 3GU0A 3IS9B 3KK3A 3CEDA 1D9FA 2FJXA 2OELA 1HNXJ 3QT5A 1MLAA 3OVSA 4LIWA 4DFJA 2WVEA 1HKAA 4FDFA 2XS2A 1N52B 3ZZRA 2COLA 3M6UA 4ETZA 2N4CA 1M0SA 1KQGB 4JI5J 3O44A 1CQNA 1CS4A 2C3PA 5G0RA 1G2EA 1U24A 3HULA 1PKUA 1X31C 2QV6A 5DLGA 3PIOQ 5H9FK 1VQOS 1H0HB 4TYBA 4CT8A 3HP6A 3K5OA 4TLQA 1WKJA 1PC4A 5I3UB 1Y11A 4C11A 1RYRA 1DY3A 4OI6A 4ZA1A 1TKZB 5ETPA 2RAQA 4PQAA 3RYLA 5IC4B 4CLSA 3U1NA 3CCSS 1TELA 1HBMA 4KQZA 2EFVA 3RBXA 1BQXA 2PFDA 2G2ZA 1HWUA 3LPEA 3Q8VA 4HI2A 4C98A 1Q86T 3GE9A 2R8GA 4LF8F 4OZNA 3DLLQ 2ZH4A 4WYWA 1M1HA 2VQFF 2Z4PA 2YQ3A 4BBYA 4HYKA 1HBOA 4DV6J 3BQ1A 2EVZA 2BEFA 2W2MP 3RRKA 3UPFA 4DL2A 2OPPA 1WKKA 1YRXA 4J9KA 3NP5A 1H6KX 3RRGA 2HKEA 1LXJA 2Z2YB 1GK8A 1PCAA 2HFZA 2OPPB 2WW8A 5KFFA 2VA3A 1FT8A 4ECXA 4DR6J 3GYGA 3KJVA 1RT2A 3VF0B 1T03A 3LP0B 5J1PA 4ID5B 1EQMA 5KAKA 1C1BA 3BO4A 1FNXH 2B9YA 2CPFA 3DCAA 1LOUA 2RQMA 3R5DA 2EK6A 4DEZA 2WVBA 3NXZA 2NLWA 2VC0A 4ETXA 2HZAA 5HANA 2R42A 2M3DA 4ZPTR 2UXBJ 1EKRA 3M8ZA 3P5BP 2DRBA 3EM1A 4Q8FA 4AL7A 2FHMA 4ED5A 3MPVA 3VCDA 3QWPA 4E2FB 1T7PA 1NPKA 2GMJA 2RU3A 2I0XA 3DRYA 2ZH7A 1VIOA 3BSOA 3CJ4A 1SKWA 4QR2A 4KKOB 1KOHA 1W2IA 4ZS6A 3JTOA 4A8SA 1MNEA 3T5HA 2UXBF 5CABA 1XR5A 1UKUA 1UA1A 4KPCA 4ZITA 1T9TA 3HFZB 3MECA 3IMQJ 3D3BJ 1VHFA 2JLGA 4WFYA 3RW7A 3VGVA 3L9ZA 1NK9A 2NCKL 4PAAA 3GQCA 7FDRA 2BW7A 4I2PA 4RLEA 5D0HA 2HHPA 4DR2J 1R8BA 2CG4A 2HGMA 4I68A 4ZPDA 2ZM6F 3CCZA 1FA0A 4F4XA 2DNQA 2J0XA 1FD2A 1FWPA 2JZ5A 2K7KA 3GFXA 4FPRA 3AD9C 4ZCMA 2WVCA 1U7LA 2ZDPA 1NJZA 2WONB 3EGZA 3HVRA 1I51B 3O2IA 2CVIA 3HVTB 1S0OA 4GVBB 2FLNA 2UUCF 3NCRA 2LXFA 3W9JA 3J80U 2ZZTA 4QPTA 1KHVA 3C14A 2NXCA 2VC1A 5B08A 1NXIA 3V6DA 2CZ4A 2XSFA 3HHLA 3IR6B 2ZZNA 3SCIE 4G1QB 4X66J 4XDCA 5DG9A 3PFEA 4QYZJ 2O5DA 4PEOA 3WX4A 1KWMA 1FWKA 1GQEA 4DPUA 2X1FA 3LGNA 4ZN3A 3GG1A 1G6BA 1K0VA 3EZUA 3HDSA 5I42B 3MM7A 4QWDA 4ED4A 1CJUB 1UZHA 4NA3A 4F36A 3RB6A 3SSSA 1FVSA 2ALZA 4LR7A 4P71A 3VAGA 2RVJA 2FY1A 2R7QA 5LMUF 3KMSA 1U25A 1YJRA 1S4EA 2ZVSA 2XMAA 3K5PA 2Q79A 2XMTA 3HX9A 3W9IA 5IZHA 2DH7A 3ENVA 4CO5A 4Q0BA 4O4GB 2M88A 2NUHA 3LAKA 3V6JA 2QZ8A 3ITHA 1H98A 4ECZA 3DLEB 3OPKA 4USHA 4EFAC 4NL5A 4MH8A 3FRZA 4NLTA 2XCPA 4I69A 1GNKA 1YDLA 1JQGA 1VCTA 3GV7B 4DL5A 4LF7F 3RR8A 2NQPA 2KI2A 2PA8D 5KFPA 5E7OB 2F65A 3ADAC 3UCGA 1S99A 4TY8B 3KLGB 4H4MB 4B3SF 1RWVB 5L38A 1TL4A 5J2QA 1IBLF 2OPSA 2JEJA 3WHIA 4CLWA 2ZWOA 1Q79A 2XO7A 3CWJA 4H54A 4F4YA 1R0AA 3CJ8A 4KHPF 3N4WA 2RRBA 4NE9C 1SQGA 3SEOA 1OIAA 3IGVA 2WB4A 3R6LB 4DXLA 5GAEI 3KJVB 3QJPA 2E5LF 2GJIA 1YBTA 3AHPA 4CWBA 5E41A 5AJ3F 4TQSA 1H2UX 2QA4S 1Y5NB 4DQRA 2Y3YA 1Q0NA 4K2XA 4DR3J 2XMKA 2ZNYA 1ICEB 1JLQA 4ER8A 2CWKA 4LRAA 5AJ3J 2PT0A 1NPRA 1QTNB 3I5BA 3BZQA 2OSQA 2VG7B 2F40A 2V4JA 3PW0A 4OLOA 1T3NA 1NDKA 1N5SA 1QSLA 3HJFA 3A13A 1HD1A 1Q5YA 1WORA 2JHEA 2NXEA 3MM6A 2MQOA 4DL4A 4IO1A 3KK2A 2DITA 2MGZA 4X65F 1IBLJ 3QQCD 4NA1A 2KKHA 3L95X 3CIZA 4FXWA 3TEHB 2C2KB 1O6XA 2OH2A 1JNZB 2BE7D 4IOAQ 1SPBP 3DM2A 4QOTA 5KFNA 4CLZA 1S6PB 4ZK7M 2ATCB 4J7CA 2C28A 1RT2B 1HQ2A 4MK7A 3PACA 1KLNA 1EETA 2PE8A 2J6TA 2P8IA 2JLEA 3IAM9 1SB6A 3C16A 5HLFB 4LQ9A 4DS4A 4NLRA 5GADI 3R5GA 3CCES 4DL7A 1U09A 2IHR1 2R8JA 6FDRA 5IT9U 2KYXA 1JNRB 1UWBA 2DKOB 2QA2A 1RXOB 2HFOA 1S4FA 2E66A 3P4UB 1CULA 1BQMA 2YQ0A 1HPZB 1HBNB 2HVZA 3JTNA 4X64F 4B3TF 1OS5A 4OI2A 1Q8LA 2LQBA 2M4MA 5B0GA 4LJMA 3THTA 1YLXA 2E1AA 4DPWA 1ELOA 2J7UA 1N0VC 2HHHJ 2HMIB 3WZ0A 4YHHF 1DTQA 4ZLLA 2FLLA 2IBKA 3GR0A 2ASJA 2ZBQA 1TL3A 2NSCA 4C3KA 4PG8A 4GMKA 4DN9A 5L1KA 1KTQA 2XI3A 2Y0SD 3KFWX 4D3HA 1BXNA 4QYRA 4ICLB 3MCOA 3N9UC 3W64A 1LKZA 1V5VA 4WU2A 2C3OA 2H65B 5HK4A 4DCPB 1NK7A 3TVZA 2MZ1A 2NR0A 4DV1J 3EDQB 1T0TV 3OFEA 1N36J 2JDJA 1RHUB 1ZAWA 1ROFA 3K5NA 2AMCB 2FTRA 2L9WA 3M8QB 1F5BA 3TO8A 4B3MJ 4X2BA 3G2XA 2BBEA 2ZC3A 4HLBA 3VGSA 2MZSA 3NL0A 1G1XA 2WB1D 3GJTB 3JQJA 1QM9A 3R5BA 3M8SA 3H98A 4J9QA 4ELVA 2VPXB 4LF7J 3QT8A 1UMJA 4A48A 5GVQA 3SQOP 2LP4A 2MLYA 4UQGA 1KLMA 1SC6A 1R3NA 3QZ7A 1J2VA 2OTJS 4MIBA 3AAWB 4IYQA 5GAGI 3H4DA 2XY7A 2VL1A 4KHRA 2CQ0A 2PGCA 1VK3A 1RU2A 3I5CA 2E44A 1Q4RA 4TKTA 5KG6A 2IRXA 2JC0A 4U9RA 1DBDA 4QIGA 2IBOA 5C24A 3CDEA 3JSMA 5B0DA 1YRUA 4IG3B 3MMBA 1VGYA 2QLXA 4GC7A 3OR2A 1K0TA 4H4OA 2DNPA 4WFZA 1J5OA 1FNMA 5KFDA 2CNLB 3T9ZA 2B3TB 4C0HA 4K4WA 2AEJA 2MQQA 2JH3A 1SV5B 2P2CB 4DZDA 1XR7A 4DV5J 2FHJA 4FYXB 3NWGA 2XLKA 2WK4A 3GJQB 1FKPB 3H25A 4BS2A 1FVQA 1XWLA 2HBQB 4YR0A 2A3JA 5A2QY 4FXDA 1UAWA 2G2OA 4EU0A 1U6ZA 2QO3A 2PMZD 1MU2A 1RT7B 2R8HA 1M90T 1IBKJ 2ZFHA 4CH7A 3O5TB 3PW2A 3MWBA 4JV1A 5HAOA 2P9EA 2EEYA 4J9VA 3AA9A 2FVQA 4PQUA 1FKOB 4WP9A 3LP2B 1BQNA 3BH6B 1V3SA 4DV6F 1QAIA 2E1PA 2RIJA 1EIYB 5GAHI 5CAAA 3U02A 3AOCA 3HKZD 4UOCA 1L3VA 2E1RA 4MIWA 5M2PA 3U1MA 1P1LA 2PIIA 3DLHA 2E7XA 4G65A 4DLEA 1S97A 1N6QB 1UL3A 3DLGA 2ZM6J 2QSWA 3BGRB 4OX8A 4NCGB 1ZOTA 2FHJD 3KLIB 4DV4J 1EARA 4PWDB 2F8HA 3VHQA 3IAS9 4U7CA 3CTRA 1U1LA 5KFVA 1UPPA 3L7OA 2OMLA 1JLBA 4B3MF 2J5AA 1ZH5A 2ZZMA 2IRUA 1VR6A 3PYDA 2AGQA 3PEHA 4BC7A 5EDWA 4DI6A 1RSCA 2GHVC 4OJGA 1GEHA 3CDAA 4WXWA 3DRXA 1MN7A 3GTYX 2D1CA 4ZVEA 5IWAJ 5CD4H 1U0HA 2XMVA 3FK4A 1C1CB 3HZEA 5DDOC 3AD7C 1S6QB 2VB6A 3FC9A 5D4LA 2UVRA 3KLHA 5ITHA 4FPIA 4PWWA 5A8WA 4B9UA 5D3GA 3RBZA 1LFPA 4J9SA 2UXCJ 3TA0A 1D9DA 2CPYA 1D9AA 1S12A 2RH3A 1VRTB 2DGWA 4LVNP 1K1SA 3HT3A 4QWEA 4ECQA 1U45A 3HJVA 2KU7A 4IRKA 3X1LB 1AZSB 2L3MA 4I4BA 4LF9J 5EGYA 4ICLA 2MZTA 5CD4A 3THVA 4JI7J 1H2VZ 3ZXWA 1VQ7S 3PM9A 4FS2A 5G4DA 1TL3B 2ROEA 3O8WA 3QBCA 1EJ7L 4Q7AA 3SBMA 2LA6A 3MURP 2D3ZA 3HCXA 5D3GB 1TFYA 3PNIA 1F60B 1T3OA 2QC3A 2AJ0A 1I6JA 2AW0A 4IDKA 5HMWA 4USVA 4CH1A 4EMDA 3PO5A 1QUPA 4EZ9A 2Z8QA 3QRPA 2LA4A 5AE3A 4DR7F 1S76D 1ITPA 2BJ3A 2M2BA 3OTEA 2AJ1A 1OQ3A 2HIYA 3EVWA 4DSEA 1H2TZ 2QG9B 2XY5A 2FLPA 4IG0A 3TA2A 3P3DA 2EKNA 2RDDA 3MPWA 4ZP9A 3OFHA 2H48B 3AT1B 3C19A 5SZTA 1I94J 1SKSA 3SDEB 4ANEA 5IOLA 3LWLA 5D8HB 5KT6A 3EZOA 1NHVA 4B9MA 2NXJA 4QW9A 2J6SA 3OTCA 4WFXA 2E5JA 4IQXA 1FRHA 2ZH3A 4JV2A 2XHWA 4FBUA 1NSKL 2DH8A 2G0IA 3N5FA 3FQKA 4LF1A 2C2DA 2FC9A 4ZVPB 3J7AN 3TANA 3RR7A 4P75A 3A3PB 4J90A 4LFBJ 2I6WA 1MWYA 1S49A 1RBAA 3ZTSA 4CYUB 2ZITA 2F63A 1X4BA 2L9DA 4ZLJA 2M8DB 4JI3F 3F73A 3AA8A 1UJ4A 2WSCC 1XC9A 1VBXA 4PR6A 1DQ9A 2BVZA 3UFCX 2PD1A 2RD5C 5A8KB 4KBIA 4F0HA 2HNZB 2MGZB 1ZTTA 1RU1A 2KVQE 3OHBA 2VQEF 2CQ1A 4ED0A 4NCBA 3Q8QB 1G3OA 2Y0BB 5CYMB 2BM1A 3IGNA 3ZZYA 4NRUA 4IFVB 4RWWA 4URSA 5KG7A 4YQWA 1QDUB 2V8VA 2CJQA 3S8SA 1M1KT 1XNRF 4EO8A 5DQGA 4DR5F 3DI6B 3FBCA 4ES1A 1T05B 1PG5B 1UFKA 2BA9A 3DGVA 1P1TA 3IXQA 2JJ4D 3LW5C 4Q2MA 5ETRA 4ZJOA 2ZOGA 3FVYA 1JJCB 2C3YA 1ZA1B 2H5IB 3NKYA 4IG3A 1L5UA 1F2GA 4WXOA 1YSJA 3MMAB 4ED3A 5HMXA 5THWA 4M5DA 4L3NA 2ASLA 1MROB 5HVFA 4K0KJ 1WC0A 2BUNA 3MAAA 1S9EA 1RTDA 2YKNB 4TVAB 4RW6B 2DPJA 2XQCA 4NCGA 1RKIA 3OL9A 1S1XA 1ZM4A 3JSYA 2B5JA 4NYZA 3H90A 2B8QA 4KHMA 3VAKA 2FVPA 1N0UA 1YZ7A 1ZAXA 2GGPA 4X64J 4CO2A 3PY8A 3BYPA 3E01B 2D9OA 3Q86A 1DJ0A 2Q6BA 2GV1A 4U7UK 4J9OA 3L4BC 2W9CA 3MAQA 3LP2A 1FKOA 1WOPA 3LP1A 2WOMB 1CJKA 3QFHA 5HBMA 2GC8A 3M1VB 4YB6A 2W01A 1AXQA 1IR0A 4O4RA 1Q7LB 1Q5VA 2RF2A 3ZZUA 5C25A 4LF6J 2J9CA 1TKDA 1OPIA 1TUVA 4YR2A 2B4UA 4ZOSA 1RTJA 4P10A 4P73A 4BWJA 1N54B 4M5LA 3IG1A 2NSBA 5KT3A 5JVGQ 3OSNA 5KFKA 2QMUB 4DV2F 2WVFA 1G7CB 4RBUA 5KT4A 3NLCA 2VFTA 3J7A1 4WE1A 1LWFB 1TV6B 1RYSA 1LWEB 3N0VA 1NB2A 2GMLA 4O0NA 2CNNB 4ITSA 3R1HA 1CSJA 1ZZFA 4ZN1A 4YFUA 2CFXA 2KRRA 4PG6A 2RF2B 2YWWA 2R7VA 1SJRA 3I56S 3BR9A 3QYYA 3OL8A 3Q89A 1N5TA 3T3FA 2HRYA 3DC2A 2ZWPA 3AB4B 2AHOB 3J81U 2X1AA 4Y2MA 1FJGJ 2JEIA 4PABA 1RHKB 2KZZA 3NBPA 4ECUA 2O66A 2W2OP 3D1QA 4IG0B 1C1CA 5LL6d 4DSFA 4O3OA 2I5JA 1J5EJ 4MIAA 5HJYA 3G82B 2GW8A 3W2VB 1RAGB 2KM8B 3RB3A 3R1LA 5CXTA 1DRZA 4B3SJ 2NYHA 2HBYB 3DU6A 1HQUB 1KTVA 1SJ3P 1PGZA 1FHTA 3IO1A 9RUBA 2J9DA 1RGVA 1RT6B 3NAHA 4WFAQ 3CCQS 1XNQJ 4KH1B 3CULA 1H73A 2MKYA 2CIMA 4Y00A 3QJLA 1UVIA 1CVJA 1RT3A 5HQLA 4X4OA 4DOZA 5AT1B 1CC7A 2DGQA 3M2VB 1IR2A 2AJ2A 4USUA 1PSDA 3CMAS 3SIPB 4EBDA 2BQRA 2UUTA 2XYHB 4R5PA 3NOGA 5D78A 4UY85 3S01A 4UT4A 3KJFB 4Q5VA 2AU0A 4LFBF 2KG0A 3G9CA 3L09A 2CA9A 4UTGA 5KG1A 5BYSA 3TAMA 3BO2A 4IFVA 1RTHB 1TMMA 1X7VA 2LVWA 2LDYA 4QR0A 2ZH2A 1HLWA 3MM9B 1LEOA 4CT9A 5ETNA 3QPIA 5F8GA 2KH9A 2Q1LA 1HBNA 2L08A 4F2SA 2IM3A 1T8EA 1HBUB 4HH0A 3H59A 1FTRA 3THPA 2D3UA 1UETA 3ZZZA 1GTHA 1YKWA 2O3DA 3BN7A 4KH0B 4DFKA 4DL3A 4RWXA 2CJXB 5EN1A 3GCXP 2DVIA 1KVIA 1RWPB 2UUAJ 2AYEA 2DD8S 1WJ9A 2ASYA 4ZP7A 4DR7J 1H3DA 4KB7A 1UVJA 3PR4A 2XG8A 4DPYA 3DLKB 2EKYA 2IDEA 1P6TA 3H5UA 4KC5A 3W5XA 4H4MA 5LSOA 4WZQA 2QFJA 3Q0AA 1WG4A 3U1LA 2RT3A 5KTQA 1JX4A 1WI8A 5J2MB 4X66F 4IO9Q 4WFBQ 4JI5F 3LOUA 3HO1A 5B7WA 1SJQA 2LCWA 4QW8A 1GMVA 5KFEA 4AL5A 4FZVA 1OY6A 4PWUA 3M4XA 1NZ8A 2DHXA 2U1AA 3GJRB 4HVZA 2MQNA 2YWFA 3GYNA 2Y1RI 3MR7A 1AUSL 2IPOB 1QVFR 1NCLA 3PDNA 3KMQA 1AW0A 1TKXB 2BACA 2E5IA 4NX9A 2J9EA 1NBEB 2QLFB 4LREA 4NLVA 4KPYA 2MKIA 2UXCF 2HWHA 2PFFB 2N82B 2J76E 1IKVA 1IWAA 2AJ4A 3FUYA 2MJNA 1N48A 1NSQA 2IC3B 3H5XA 2IJFA 4DR2F 1GXUA 4KJIA 3Q2SC 2RQKA 1R27B 4HI1A 3N6MA 4QIFA 5AXMA 1HNVB 2OP5A 1UTAA 2GZOA 1J5OB 3QJJA 1YTYA 3SMZA 4HT5A 1RAEB 5KFBA 1WEZA 2HQGA 4B9LA 2OI2A 1HBUA 2CQGA 2HQCA 2ZKTA 5DG8A 4XO0A 4DV7F 2RRAA 2LXUA 5K9FA 3FFIA 2D41A 3IA0A 8AT1B 3SCKE 3R7BB 2DBBA 2YKQA 2CPDA 4C3LA 2CJBA 3H42A 3K89A 3I31A 3MCSA 2B9XA 3R5CA 4NLQA 2R8IA 1YJUA 4LFCF 4TY8A 3TOQA 4ZLPA 3KLGA 3G6YA 1D1UA 4C8NA 2KFYA 3PKMA 1MSWD 2WONA 2ZDOA 3CCWA 2F7VA 3DHXA 3FSXA 1LWXA 1JLCB 3OR1A 3NBPB 4OI3A 4USMA 4OQJA 3H2UB 1FE0A 1S57A 4QJVA 1MMLA 3Q8SB 2CPIA 1WDDA 1WKLA 3UR3C 1TL1B 3DRPA 4O4GA 3UQSA 3K17A 3TI0A 1U1OA 2MEWA 4CLTA 5F3ZA 3OXFA 4FNIA 4A47A 2XSJB 1ULRA 4E0DA 3SZ2A 3BGRA 2GJFA 1YK9A 1TV6A 3QRRA 1MN9A 2FJBB 3H8YA 4DQPA 3KHLA 1UPMB 2E29A 1FEHA 3OR1B 1PBUA 3P45B 3BGOP 4NZ6A 3OW2R 1Q8IA 2UV8A 3UDVA 3UD3P 2AQ4A 2BRLA 3M30B 3Q8RB 2AX1A 1XR6A 4QPXA 2ZKUA 3HXMA 2MQ8A 1D0EA 2HQIA 3BGFA 3A12A 3LTOA 2BKPA 4UUXA 5CH7B 3QO9A 3OVAA 4XAKA 4WIIA 3PRDA 4LRCA 5GMEA 3DOLA 3I0RA 1IVZA 2KHCA 1HPZA 2CQCA 3BPSP 3I32A 5H9FJ 3X3UA 4N5SA 4JBCA 4ZHRA 4ES3A 4F8RA 3HSDA 4M94A 3WIVA 1VQ9S 1FKPA 5DG7A 2VBXA 1RADB 2A6OA 3BGUA 1ZM9A 2GFFA 4C97A 2RSQA 3H4BA 1CG2A 5F8JA 2K1RB 4I64A 1QSYA 5L1LA 2QT7A 3M2RB 2C3MA 1S1VA 1X4AA 3ULHA 4CM0A 4ILLA 2W24A 3NNAA 5HQ8A 5HP1A 4GC6A 2VU5A 3MMCB 4NCAA 3V2UC 1CJTB 3IBCB 5GAEU 1U0SA 2H54B 5KFRA 3PZPA 5C25B 4OHYA 1MROA 1VS3A 4B17A 4OIXA 1O51A 5J2PB 5CHCB 5C2CA 5KFJA 3J7Z5 2ADBA 3F41A 1ZTWA 4BDPA 3M1VA 4DR3F 4RW9A 2HRTA 2V2ZA 2W2NP 3T1HJ 3CJ0A 1RP5A 3PEJA 3PR5B 1EQ0A 1U02A 4OYOA 1VBKA 1B7YB 3D0GE 4X4TA 3AFGA 4ZVUB 5KG2A 4IR9A 2E7VA 3PYEA 4ECVA 1RUSA 2KJWA 2Y8WA 1KOOA 1FFWB 2HPUA 2P9CA 3C6TB 2KT5A 4QIWD 1CS4B 2ILYA 2VH7A 2WZ1A 2PA3A 3MTJA 2CPXA 4MJKA 4Z7CA 1KFSA 2ABYA 3T5JA 1FI4A 2AJQA 3BO3A 4DR1F 2DHAA 2H5EA 2Z58B 4RW7A 1X4FA 4ZVQB 3SYZA 2CQPA 2CPHA 4W4MA 1HNWJ 2QMWA 3QIPB 2DISA 5CYQA 3OHAA 2VDHA 2EBEA 4B02A 4FXVA 1X5SA 3GFZA 3OXLA 4MK8A 4DL6A 2VKZG 4LBHA 1JLEB 3P96A 3DKDA 5ETLA 3EXYA 2H4YB 2L41A 4DQQA 1RCXB 1O0PA 3DOMB 3KXDA 4JV0A 2QX0A 2I5JB 2IA6A 3V4IA 1U8WA 1FNOA 1Q8KA 4MYUA 2LFVA 5A6WA 1DHMA 2FD2A 2JFKA 5ETSA 1NMEB 3TZZA 2XYPB 2FJWA 4G1QA 1Y9OA 3UI3A 2J7WA 4Q45A 3M8PB 2R7SA 3JB9k 2EW9A 1VQ5S 2J6UA 1SJFA 3NGRA 2L48A 1XTZA 5KFLA 1GMWD 2GO8A 4P9SA 3R6GB 3KHHA 1Q82T 5K8NA 5D4PA 1FXRA 2KN4A 4I0WA 1HW8A 1JKHA 1CJVA 1OYEA 2CADA 4CYUA 4DUYJ 3V4IB 4U96A 3M2UA 5E5NA 5DQHA 5BYQA 4FVMA 1S1UA 1TUGB 1IR1A 2H9ZA 3GFHA 3K0JA 4RW4A 2KFNA 5HMZA 1FDDA 4WIQA 2DXDA 3GG0A 1REGX 4X62J 1Q16B 5A6PA 1OMSA 1GMWA 3S7RA 5IV4A 1T9XA 2FGOA 2OKQA 3BKTA 2CDRB 2FJDB 1S7HA 3PJ9A 1RDRA 3BGLA 3R5AA 4JI6F 3TJ8A 3KDOA 4CI0B 3CCUS 2OTLS 1TL1A 1CJVB 3DRPB 4J91A 2ATLA 2UUCJ 4EBEA 2HWTA 2V94A 3KG1A 2ZEJA 3M8RA 4ANDA 3I4PA 2OEMA 2ZHAA 2ZJRQ 1ACMB 1S0MA 1S9FA 3CMES 5D6GA 2YVSA 3G6XA 2CPZA 2B7CB 2UV8G 1RWNB 5IC6B 1F3FA 2IFXA 3DDNA 3G86A 5DM6Q 4NPOA 4A4JA 2DRDA 3OV7A 1FWLA 4J9UE 1SXLA 3NRBA 4MT1A 3KLHB 2V4JB 1W2BR 1YJ9S 3I9ZA 3QSIA 3B4MA 2UUWA 4F50A 4DLGA 3Q8PB 3WIUA 3D68A 3FEZA 1S48A 1S6PA 4X4RA 1FERA 4DBQA 1PO6A 3FBEA 4MK9A 1XNRJ 1IKYA 4GVBA 2GA7A 2WRMA 4LT6A 3WDOA 5KG4A 2IMOA 3DDIA 3PYFA 4PG4A 4CM2A 6FD1A 3KLVA 3MOJB 2W4CA 4P2SA 5IQQA 2KRBA 5EHHA 4PYAA 5D0EA 4RUAA 3T6JA 2ZOFA 1IKXA 1VI7A 4A8KA 1R8AA 2QEXS 2Q6CA 4C3MA 1SC1B 1CBKA 2XY6A 2K8GA 4PXBA 4RKUC 2AX0A 3PX6A 5C5JA 2G1HA 2YY3A 2GQQA 4OX7A 1IKVB 1A0OB 2RKIA 2V67A 4LF4F 4W92B 5J2QB 4ENOA 1K73T 5I3QA 2VODA 1HQEA 2VBWA 1B70B 2M70A 3DRSA 3NWRA 4M5NA 2BANA 4P2XA 4YY3J 3OT9A 1WDTA 1SJ4P 2UUBJ 1K44A 1LK7A 5A8KA 2DYAA 2KO1A 2XS7A 1D8ZA 4WBFA 3BBFA 3UN5A 2MXYA 1FJ7A 2CJ9A 3W65A 4LF9F 5F8MA 1UP1A 3OQ2A 2B9EA 2F5GA 4LSZB 4WPAA 5KFXA 5CCMA 2BYCA 3WQPA 4DCOB 5KFSA 2ZBPA 4Q0BB 5BXIA 5LSRA 4CCHA 4JI2J 3C3LA 4NYPA 3FBFA 3GJSB 1VLYA 4HHJA 4R8UB 3Q8YA 5HVHA 2VG6B 3T41A 1NJIT 3PXGa 3N01A 2B56A 4O3NA 1U1RA 4YOEA 4CIOA 3BKUA 2HGLA 2PDAA 4OHVA 3SDEA 3FDSA 2LKZA 1REVB 2OHDA 1B0PA 1U8SA 3B6BA 1I5OB 2KB2A 3T19A 2WSFC 3M9MB 2EFOA 3A8EA 4KV8B 4RNFA 5KOXA 4JUZA 1RHMB 3J81j 3MD3A 1BWEA 1IKYB 1UW9A 4TY9A 2ZJPQ 3UDCA 4AE5A 4ZHRB 4IR1A 2B0GA 2GVDB 4HDGA 4DX6A 1YJ7A 2IA0A 4QWAA 1TAQA 5CQGA 4WU3A 4MKBA 3D6TB 1NK5A 3OUYA 3ZC4A 2CAJA 4OZJA 1R8PA 3NCQA 2ZE2A 5LXYA 4XPEA 3NMAA 2VFVA 3FFIB 2MKJA 4NMLA 4RW8A 3K5LA 3CO0P 3DMJA 3NS7B 2FJAB 3V6KA 4NLYA 1ZAVA 4QCLA 4IKAA 2W8LA 1UVLA
chains in the Genus database with same CATH topology
3DYAB 2W9BB 1FDAA 3P49B 2OJ3A 3OR2B 4EZ6A 3PW4A 2D3OR 4KO0A 3MOZA 1X5PA 2YKMA 5KFAA 1HL6A 5K14A 1FKAF 3B8HA 1HQUA 4OHXA 4DMZA 4K4XA 4YP3A 2GGPB 2HNYA 5IXUA 1S1WA 3LO3A 2HNDB 1RTIB 2LLZA 4B9NA 4C8YA 3MEEA 5J2NB 4N41A 2V8HA 1WF0A 5KFGA 3VQSA 1LW2B 4DWIA 4M1KA 1H7WA 1BQMB 2IVMA 3J7YI 1YJWS 2CYYA 1QVGR 1N33F 1GXLA 4TU7A 3MMAA 1L3UA 1R8CA 3G4SS 1HMVA 3HFKA 2LU1A 4CQ1A 3ZZPA 2R7XA 4I1TA 4DG1B 4AL6A 1YRTA 2VKRA 1DARA 3QIDA 4YB7A 1XNQF 3DGPA 3MR5A 3HMJG 4Y65A 3SQGA 1VRTA 2R2TA 5HMYA 1M5PC 2DNRA 4DSLA 1LXNA 5J1EB 4GKKF 2NUUG 4ZKAA 2B7BB 1ZYQA 2HIQA 2XGQA 1YHQS 1RT4B 2O01C 3OXGA 3GZ7A 3D2WA 3EX7B 5F8NA 2VBZA 4AFFA 1C0UA 3QLHA 5IQ6A 2IMWP 1UWBB 3C66A 1XMQF 3EGWB 4KV8A 3MM5A 3CPWR 1UVMA 2ZBCA 1M5VC 3UWTA 3LGMA 1U49A 2JSXA 2VZ9A 5LSLA 5KFMA 1B0VA 3DRSB 3KNGA 3AH6A 3BSNA 1NJWA 1N32F 1RAJA 2EG2A 3ENWA 1U1KA 3H20A 3KLIA 2KHDA 4NZ0A 3ENQA 3LH2S 3GYXB 3FCHA 2YH0A 1FF2A 3D0IE 4YUDA 2WTFA 3R3TA 2O1PA 1VJWA 4ZCIA 2ROPA 2V2KA 2Z2MA 1WNEA 1KR4A 2WSEC 3VAMA 1U6FA 2ZHOA 2BZ2A 5KFWA 3EGNA 3KK2B 2DR5A 2M0GB 3AY0A 4UQTA 2RILA 2V9WA 1HI0P 4WTYA 5K8MA 1DURA 2IRYA 2N7YA 1XMBA 3MMJA 3NGDA 2Q66A 4HKQA 2MDAA 2BANB 4CZCA 3OTBA 5L9NA 2FIUA 4NLGA 1LW0A 2OMOA 1FCAA 5E3AA 5KFIA 4C0BA 1NEEA 5G0RB 5LJ3Y 4K50A 4KO0B 1Q78A 2HS3A 3GIMA 1UFLA 3GV5B 4M95A 2AV5A 5DGBA 3M30A 2BR0A 4OFZA 1HYSB 3IS9A 2ADCA 2YWGA 4FP9A 5C42B 3NS5A 2KG1A 3KLEA 2XZWA 3RRHA 1WF2A 1NAQA 2GHWA 4JI4F 2LQ5A 4DQSA 3FSYA 2X1GA 3US5A 4DFPA 3TAPA 1OSCA 1S1UB 2QA4G 4ETZA 4P6QA 3CO9A 1FE4A 4HT7A 2M52A 3W2VA 1XMOF 4CO0A 1SH3A 2VONA 3BQ2A 2KXNB 2XS5A 4WF9Q 1JXEA 2M5YA 3K58A 2K2PA 1IJEB 2MMYA 1N5YA 4J9LA 3MD1A 1QLNA 3ITHB 1IM4A 2DNLA 3FEXB 3O6QA 2MY7A 1EETB 1C2PA 4C2MA 1CLFA 3TAQA 5MAOA 4CO3A 4F4KA 2IJNA 3DLGB 1N8RT 1AFIA 4CH0S 3PVXA 4AQYF 3KLEB 3DYAA 2W9BA 4ECWA 3JSRA 1XK8A 5HROB 3D28A 2BDPA 5IT0A 1YJNS 1SH0A 3MM7B 5BYRA 2UVVA 3CCLS 1P8GA 1DTQB 1YI2S 1VBYA 1JJ4A 5GAGU 4FF2A 1NO8A 2G4BA 3DU5A 5KFUA 3MEGB 3UDLA 1YBAA 4J37A 5CYJA 3JYTA 3CJ3A 3CDWA 2F8MA 3LP1B 4KIAA 5HBMB 3CVKA 2XWYA 1S1TA 4J9RA 2QE5A 4KGKA 2AGOA 2KXFA 3E01A 2UXDF 4K4SA 3C6TA 1F5CA 2OFHX 2XEXA 3BM7A 4KSEB 2E5HA 2XNQA 2UUBF 3T1YF 2MSSA 3TA1A 4LSLB 2B4PA 4MYTA 4IUFA 1S0VA 1F0XA 5F8HA 3KLFA 4LIRA 3F56A 2Z0GA 4ECYA 1SQEA 3DLJA 4V19X 1VQKS 1UW4A 4WCEQ 1VC6A 2VPWB 1IJFB 7FD1A 5FJ4A 2AD9A 3T1HF 3PV8A 3M2RA 2ZNZA 2QRRA 2E9RX 5KG3A 2IVFB 4NZ7A 4B9TA 4E8UA 3MEDA 4H4KA 4P7VA 1T05A 3MM5B 3K57A 4ILRA 3B82A 5EWFA 1KVJA 1HHSA 1C0UB 3QLHB 1VC5A 4ED8A 2YWEA 2F1FA 4PUOA 5IT9Y 1E6VB 4A8QA 2FPHX 3HHLC 4RX6A 2LQ9A 1FD8A 4DX8H 4RUHA 5T41A 4OLPA 3M9OB 4ALZA 2MZRA 3HKWA 1X9SA 2YNIA 2DNGA 3SQGB 1JJ2R 1NKCA 2NS1B 1B64A 3V6HA 4B3RF 2HVIA 4RBTA 4QIVA 3KTQA 3RB0A 3O3LA 3FMBA 1WACA 3CXCR 1DLOB 4M8LA 1FRLA 2OLWA 4NA2A 3I5AA 3LAMA 2DT9A 2J0SD 2FHKA 4C7QA 1YJVA 2MQLA 4DUZF 1IQZA 2ACYA 1E6YB 2YNHA 5F9LA 2HRUA 4LMZA 1IBKF 2NZ4A 4NLDA 4Q2LA 3BS9A 3G96A 1X9WA 1UVKA 3I96A 1KQKA 2DHSA 3MEEB 2MKKA 4EEYA 2ILZA 4Z37A 3HHEA 3PKYA 4NLPA 1WELA 4OJHA 3CCRS 4RNMA 4I2PB 3MUMP 4QWBA 2VG5B 4ZVFA 4MKAA 3SI8A 4H4KC 1VQLS 1HARA 1FXDA 1SKRA 2UUAF 4K0KF 2N7CA 2Y1IA 1Y5IB 4K59A 3IWLA 1UJ5A 3HVWA 4K5RA 1N5VA 4NOHA 1KNZA 1L3TA 4Y28C 1RT1A 4EYHB 1HFEL 1NHUA 2JWNA 3JTPA 4WFNQ 5I4MA 1U1NA 4MKYA 5A8WB 2HW3A 3FSIA 5CZVA 3GWCA 3I82A 2C3UA 4F4WA 4ZVGA 1APSA 4RNHA 1TKXA 1VFJA 3JSBA 4TLRA 2IAJB 2FC8A 3CD5A 3G8SA 1FXLA 4YY3F 2ZH8A 1X4DA 3T1AA 1QAYA 3MTKA 2DNMA 5HL7Q 1T95A 2YWHA 5IM0A 1U1PA 2J0WA 1D3WA 5AXKA 1KQFB 3MMCA 3U27A 1TFWA 3AJ2A 3MEDB 5KT5A 2DCLA 4IRCA 3H2VE 2ZHBA 3T5LA 4WK1A 2AYGA 2IC3A 5B0EA 4Y2AA 1REVA 3GV8B 4J9PA 3BDPA 4OZ5A 2OFGX 1RT5B 2W7PA 4RU2A 3MHYA 1SH2A 3FNNA 2R7UA 1LWCB 5DM7Q 1N6QA 2MKCA 1C4CA 4RUCA 4F3OA 1M5KC 2HQ3A 3FZBA 2DNYA 1BQNB 5LXRA 5CA5A 2ZOMA 4C8OA 4X84A 3K5MA 3OL7A 2YX7A 4K5SA 1TVRA 3C2PA 1OQ6A 4JI0F 1RTHA 2V5HG 3G8QA 5AXLA 2VA2A 3G6VA 3QAEA 2NYIA 3M6XA 2X3GA 3OJUA 3OLAA 3GMGA 1JLQB 1SJ1A 4BCAA 1ZETA 1C0TB 3O1LA 4F2RA 2MHEA 4DR6F 4PXCA 4ED7A 1FJCA 3QGGA 4KE5A 2WCXA 2XNRA 2N3OA 2HHVA 2JC1A 3POTB 2VOOA 4OZLA 3R27A 2R2RA 4BHQA 2VG5A 4JI8F 3DOLB 3I0RB 4A8XA 3OL6A 1TK8A 2DR7A 1HBMB 4RNOA 5F41A 5HI7A 3CB4A 4B9VA 4GKJF 3QAUA 3TAMB 2YX1A 4DFMA 1R43A 4E98A 2JOQA 4LSLA 2QSFA 4OX9F 5IWAF 2RDJA 2R7TA 2ZD1A 2YWKA 4C0OC 3TYTA 4RU9A 4ZP6A 1HWLA 5K14B 4G1IA 4I6YA 4YB1P 3DN9A 1JXLA 1TAUA 1HA1A 2XSJA 4CO4A 4ECSA 2OSRA 4F02A 1GX6A 4ZVHA 2C2EA 4X62F 4TYAA 3RW6A 3B78A 5T7LB 3EZ5A 3HVAA 1SI9A 1FJEB 1ZPVA 1QE1A 1WD6A 1WWHA 3J80Y 3MUTP 3LQVA 3UCZP 4Y2IA 3M2UB 3W7BA 3ZFVA 1GTEA 2N3LA 2DNKA 1RTJB 3DMJB 4ID8A 3DXBA 5E0OA 4QU6A 3ISZA 4Y2CA 1JLGA 1Q81T 2CQHA 5FD1A 4DV1F 3K7RA 1WI6A 2QYCA 2BW2A 4OHZA 2MB0B 4JI1F 1B0TA 3HHLB 3OTDA 2VUGA 4KTQA 3M8PA 1Z1ZA 3I87A 1Q53A 2EC0A