2DGOA

Solution structure of the rna binding domain in cytotoxic granule-associated rna binding protein 1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
115
structure length
115
Chain Sequence
GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain in cytotoxic granule-associated RNA binding protein 1
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Cytotoxic granule-associated RNA binding protein 1
total genus 13
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgoA01
1K73T 1X4AA 1BY9A 2DNLA 2MZ1A 1SJ4P 4WIIA 1P1TA 1M5KC 1U1QA 5D78A 3I55S 3UCGA 1JMTA 2DO4A 2HGNA 3H2UB 2DNPA 2CPXA 3D2WA 4Y00A 2ERRA 5EN1A 1H2TZ 2DH8A 5DM7Q 2UP1A 2HGMA 1F9FA 2LMIA 1WHYA 4FXVA 1VQ5S 2LXIA 1SJ3P 4PKDB 3MUMP 2CQHA 4YB1P 2X1FA 2DITA 2N82B 2RVJA 4CIOA 2X1BA 1N54B 1JJHA 3BS9A 3G6ES 5CYJA 5LSLA 1X4BA 2MKSA 1U1PA 1KQSR 4TU9A 2CJKA 3NMRA 2KI2A 1A7GE 1U2FA 2MXYA 3G71S 1PO6A 1X4EA 3L3CA 2A3JA 2HYIB 3Q2SC 5JVGQ 2KFYA 1P27B 2MKIA 1M1KT 4QU7A 2MKKA 2RS2A 3RW6A 1SJRA 1WHWA 2DGVA 3CCJS 1OWXA 4PR6A 1UAWA 2KXNB 1FJEB 1VBYA 5IQQA 1VQKS 1QVFR 1WEXA 1M5PC 2MKHA 4LJMA 3IRWP 2LCWA 4F26A 3CMES 2JRSA 2U1AA 5IM0A 4V19X 5GVQA 2RRAA 3TYTA 3LPYA 2N3OA 2DNHA 1QM9A 3CXCR 1UP1A 2MQQA 3MOJB 2ADBA 4OZ1A 3THTA 1WF0A 4F25A 1YIJS 1G2EA 1FJ7A 2EK6A 3J7YU 2M8DB 2M52A 2LECA 3HI9A 4YUDA 3CCES 2N7CA 1FNXH 1FO1A 2CPJA 1WWHA 3NNAA 4BS2A 2EK1A 3CD6S 2D3OR 4WCEQ 2MZQA 1R8HA 2DNMA 2XS5A 4RU2A 3CCRS 2LA6A 1SJQA 5JVHQ 4W92B 2OJ3A 1IQTA 1YTYA 1QVGR 1CVJA 3G8SA 1FHTA 1AUDA 2MZTA 2CQ0A 1OPIA 2FY1A 2X1GA 2MQLA 2MZJA 1WI8A 1WF1A 1YJ9S 1DHMA 3NNCA 3CCVS 2MSSA 1N88A 3B4DA 3CCQS 4IUFA 5HL7Q 3P3DA 4YOEA 3SMZA 4IOCQ 3NS5A 1S72S 1N52B 2KXFA 2I2YA 1KOOA 1KOHA 2XS2A 2K3KA 2JVOA 4UQTA 3TP2A 1M5OC 2AYMA 1D8ZA 2E5IA 2CQ2A 1OO0B 2CQDA 2JVRA 1OIAA 1U1KA 2SXLA 2F3JA 1WG5A 2N3LA 1VQPS 1WF2A 1U1OA 2DNQA 3ZZYA 1X4HA 2J0QD 2OTJS 2YH0A 3HHNB 3PIPQ 4A8XA 2DHGA 3CC7S 1NU4A 1HD0A 2MJNA 2ZJRQ 2MKCA 3P49B 2NZ4A 3EGNA 2DISA 1VQ7S 2KT5A 2M0GB 2OTLS 1H2UX 3FEXB 2DIVA 1WELA 4WKRA 2XNQA 4IO9Q 3VAGA 1PGZA 2DGXA 4QPTA 4Z2XA 1WI6A 2LA4A 4C7QA 5CA5A 1NO8A 2EVZA 4WFBQ 2F9DA 2L08A 3G8TA 4W90B 2MZRA 2J76E 1VQMS 1YJWS 1A9NB 3R27A 1U1LA 1WHVA 2FPHX 2LEAA 2MQOA 3CC2S 1VBXA 2XS7A 1WEZA 2HVZA 2B0GA 2CQ1A 2U2FA 1D9AA 1YI2S 2DNYA 2L9WA 2MJUA 2MQNA 3CMAS 2DNNA 2PEHA 2CQ3A 1UW4A 4ZKAA 3DLLQ 2VOOA 1UFWA 4ERDA 2DGQA 3CCUS 1WTBA 1FJCA 1X0FA 3EGZA 4PRFA 3V4MA 2MHNA 1HD1A 2DHAA 1HL6A 2LEBA 1JJ4A 1H2VZ 2YKAA 3UD3P 2DGWA 2OSRA 2MPUA 3H2VE 3JB9k 2OIHA 1DRZA 2M8HA 2BOPA 2DGTA 1YWXA 4LIRA 1M5VC 1ZZFA 1NJIT 3CCLS 4TU8A 2KXHA 2KM8C 3UWTA 2M70A 1VQLS 3TO8A 3OW2R 1RKJA 2QFJA 3S6EA 2CPZA 3VAJA 1Q81T 2G1DA 2YTCA 3VALA 1W2BR 3U1MA 3CF5Q 3UCZP 2KG0A 3P5TL 3UCUP 4CH0S 5DDPC 1WEYA 2DGOA 4U67Q 3MURP 3G4SS 1WHXA 4P6QA 4Y0FA 1YITS 3VAMA 2CQCA 1X5PA 1X4FA 3LQVA 2DIUA 2AYEA 3VAIA 3N9UC 1X5OA 1M90T 1VBZA 1U6FA 4ED5A 2WBRA 2E5GA 4F02A 1Q86T 1YHQS 2RT3A 5LSOA 1H6KX 4WFAQ 1U1NA 2DGUA 1FT8A 2MQMA 1N8RT 5FJ4A 2CQGA 2MY8A 3MDFA 3SDEA 1HA1A 2D9PA 4QQBA 3BO2A 3VAFA 5LJ5Y 2DNKA 4WFNQ 2E44A 2RUGA 3NNHA 3P6YC 2D9OA 2DNOA 2KU7A 3NS6A 1VQ9S 2AYGA 2ZJQQ 3R1LA 2NLWA 2RNEA 1VQ6S 2QA4S 1S79A 3Q2TC 2F9JA 2KM8B 3US5A 1L3KA 2CQIA 5GMKa 4M5DB 5H1SV 5GAHU 2DNGA 1U6BA 2AD9A 3PIOQ 3S01A 2ZJPQ 1XN9A 3CUNA 3ULHA 3FEYB 2M88A 3R1HA 3BO3A 2MSTA 3B4MA 2MB0B 3SXLA 2FC8A 3UE2A 4QU6A 2KYXA 2MZSA 5IM0B 3BO4A 1ZH5A 2CPEA 2MGZA 2JX2A 2MQPA 4TU7A 2RU3A 2DNRA 4CQ1A 2LXUA 5IFMA 3MUVP 4UY8T 2RS8A 2M4MA 2CPFA 5BJRA 2LYVA 1VC0A 1U1RA 2M9KA 1VQ8S 1VC6A 2CQPA 2V94A 3EX7B 1WG4A 2L41A 2YWKA 1VQNS 3S7RA 1RK8A 1DZ5A 1SXLA 2I38A 1YJNS 4WF9Q 3G96A 3MI7X 2DGSA 1VQOS 2G4BA 1DBDA 3THPA 3VAKA 3CCSS 5MLCV 4C4WA 2XSFA 2CPDA 2MYFA 3CPWR 2O3DA 2RQCA 1Q82T 2CQ4A 5DETA 4OZ0A 3CTRA 2LKZA 5DDQC 2E5HA 1K9MT 5GAEU 3MD3A 2GHPA 3I56S 3MD1A 2KHCA 2RQ4A 2G0CA 2VODA 2MY7A 1KD1T 2DO0A 5GAGU 1U1MA 2VONA 3K0JA 2CPYA 4EGLA 2KG1A 5D77A 2KH9A 2X1AA 2MKJA 3CULA 2DH7A 2CPIA 5GADU 2DNZA 2DB1A 2DHXA 2KRRA 5DM6Q 2HGLA 1O0PA 2KN4A 5LXRA 1X4DA 2YH1A 2FC9A 3MUTP 2DH9A 4IOAQ 1FXLA 5HO4A 5LXYA 4CH1A 5DDRC 1K8AT 1VQ4S 2DHSA 4FXWA 1JJ2R 3MXHP 2KVIA 1X5TA 3ZZZA 1X5SA 1X4CA 3RW7A 1URNA 2XB2D 1X4GA 2GO9A 2RRBA 2J8AA 5LJ3Y 2K8GA 2LQ5A 3U1LA 3S8SA 2FHOB 1R8PA 2KRBA 3SDEB 3CC4S 3J7ZT 2CPHA 2JWNA 2BZ2A 2E5JA 2M2BA 3DXBA 3VAHA 2VOPA 2M7SA 3BEGB 1Q7YT 1KC8T 5DDOC 3UD4P 2XNRA 1B7FA 2AYBA 2MMYA 1WG1A 5CXTA 2OSQA 3IWNC 2ADCA 2HZCA 2Q79A 4C0OC 2J0SD 2MGZB 3CCMS 2CQBA 4J5OA 1VC5A 2QEXS 1SJFA 2PE8A 3VF0B 3G9CA 4LMZA 5ITHA 4TLQA 1ZZNA 2DK2A
chains in the Genus database with same CATH superfamily
1KEKA 2FTRA 1BY9A 2DNLA 5CCLA 4ECSA 2QL9B 5J1PA 3G6VA 4DL3A 2AKWB 1X60A 1FWPA 1NLKL 1YZ7A 2FZKB 4P52A 5ETPA 3I55S 5D3GB 1QDUB 5LL6d 2DO4A 2HGNA 3KK2B 1N0VC 2QL5B 2E1PA 2Z2MA 5A2QY 2OMLA 2DNPA 2JHEA 2ZHAA 2AQ4A 1NJYA 2CPXA 3D2WA 2DXFA 4QR0A 2OPPB 2XULA 4K5RA 3LGNA 5KFGA 3NLCA 2V67A 4K2JA 2BDPA 1NHKL 4DV4J 3DLKB 1F9FA 2HQCA 1XR5A 1VJQA 2LMIA 1UA1A 3HVTA 1VK3A 4X4TA 3TUZC 1VQ5S 1RTHB 2LXIA 2GVDB 1IWAA 1RTZA 1MROA 3T6BA 4ZVHA 3MUMP 2X7IA 1S1UB 1VFJA 4I2PB 4ZK7M 4K0KF 2CQHA 4ZPVR 1UJ5A 4ZP6A 3PO5A 4K8RA 4RNFA 2N82B 4ZS6A 1NSPA 4R8UA 2HHVA 4AD6A 4F2SA 1B3TA 3H5UA 3HFVA 2XTJP 3JTNA 1DQ8A 3BS9A 5ADZA 2QTWA 3IG1B 4AL6A 4FZVA 2OH2A 5CYJA 4LIWA 3OTDA 2VQEF 3L7PA 4OX8A 5THWA 4O23A 4C3MA 3M8QA 3OHAA 4X4NA 1HNWF 1HI0P 1U2FA 2HNDA 5T14A 2W8LA 1WC5A 2B5JA 3JYTA 2B9EA 3G71S 4DV7J 1S0MA 3BGOP 2A3JA 4I7FA 1PO6A 2HYIB 3AHPA 1GMUA 5A8RA 4DV3J 4OYIA 3W9JA 2MKIA 4RU9A 1M1KT 4QU7A 2MKKA 2XYPB 4Q5VA 3Q8QB 2RS2A 1T3NA 5J2QA 3RW6A 1IM6A 1WHWA 2BXJA 4M95A 3V6DB 2CG8A 3CCJS 4NYOA 4PR6A 4F4YA 1UAWA 4FF1A 1FJEB 3QJJA 1VBYA 1QVFR 1V5VA 4N77A 3DYAB 4Y2CA 1C0TB 2MKHA 3TZZA 1BMQB 3HKZD 2BANB 2GQQA 1BGXT 1S1WA 1KLMA 4EK2A 3PW4A 4R5PA 1HNVB 3BYPA 4ALZA 1RDRA 2IHR1 2UV8G 5A8WB 5FLXY 4QWDA 1S6QA 1VDHA 2RRAA 3R5DA 2V0NA 3GWCA 2ZC3A 5FLXU 1NJZA 3OT9A 2KVQE 2FVQA 2OUGA 4NYPA 4BLGA 1UEKA 2YWFA 3N6LA 2ADBA 4OZ1A 4TQSA 2PGCA 3MOJB 2PN6A 4FYVB 3GMGA 2KZZA 4O4GA 5A6WA 2XY5A 3FGVA 1UVKA 2M52A 3J81U 2HHXA 4DF8A 4B9UA 3H0PA 2N7CA 4KJIA 3WDOA 1APSA 1RE1B 4OI6A 1TV6A 4DV4F 2MLYA 4KGZB 3ISND 4CLFA 4DX8H 2H5EA 1XBWA 3CD6S 3GPAA 5H9FJ 5IT0A 3T5KA 3PW0A 3K5MA 5ETQA 3VZHA 4DCOB 4RU2A 3OVBA 2B4OA 3FBFA 3FJ2A 4LRCA 3NXZA 1RYRA 4IR9A 3ENQA 1B0PA 4H4MB 1N5YA 4PWDB 1SJQA 4RW4B 3OFFA 3C19A 4AT1B 5JVHQ 4N41A 1A0OB 2HBYB 1DAXA 4UZCA 2UUTA 2NR0A 3GIRA 2F7VA 4JI6F 2HNYB 4H4KA 3ZXWA 2C42A 3D7SB 3P8BB 2RUSA 4ZVFA 1QVGR 4X62J 1CVJA 2PSZA 3J7Z5 3H59A 4PWUA 4C11B 1OYEA 1T0TV 5KOXA 2IMWP 4O3PA 1AUDA 1DURA 2MZTA 3DLEA 5G0RA 5KFBA 5D0GA 2R7VA 1FK9A 4WYLA 1YBTA 3LTOA 2ZBIA 1UVIA 4P75A 1EP4A 2VIHA 2JEJA 2VQEJ 3TNVA 2I8EA 1JNRB 2MZJA 3BGUA 4ICLA 2I5JB 4KGMA 1K44A 1WF1A 2HS4A 8ATCB 3QBCA 3M2UA 1MNEA 4NZ6A 4ECRA 1E6YA 2AGOA 1YJ9S 2VZ9A 2C3OA 1RUSA 2QLBB 2MHEA 3IC1A 2YX1A 3NGUA 4Y2MA 5L1JA 1XC9A 1N88A 3J7YI 5B0EA 3QJPA 4FKXA 4N8OA 4CLPA 3D6HB 5H9FK 4OMFG 4IUFA 4UW2A 2KKHA 3PM9A 3POTB 3B8HA 3P3DA 2AX1A 4UOHA 5HL7Q 3QT7A 3M2RA 4Y2AA 1FDBA 3PYGA 4IO1A 3LAKA 1CC8A 2ZOMA 4DN0A 4U6PA 5LMNJ 4TQRA 1RT4B 2ROGA 2IA0A 2HMIB 2YX7A 1EHWA 1T05B 2BW2A 4CCHA 2ACYA 2P9CA 1YK9A 3KLIB 2WBMA 2Y1IA 2I2YA 1IKVB 2CJQA 1NHUA 2ATLA 4BHQA 2IM0A 1FTRA 1KOHA 2DEIA 5BYRA 5AXKA 3I31A 2K3KA 4MK8A 2ILYA 3CJSA 5DG7A 2XS2A 4M8LA 4P72A 2ACMA 3DDKA 4K2XA 1HR0J 2L48A 2ZITA 3LH2S 3N28A 5F0UA 1NDKA 4JI0F 2VDIA 2OELA 3QFWA 3EWGA 4K4YA 2JVRA 1OIAA 1HQUB 3KK2A 2Q66A 1XMBA 2F3JA 1U0HB 1BWEA 2GQCA 4DUZJ 2N3LA 4YR3A 4DR3J 1H7WA 3NGTA 1Y11A 4DX7A 2HWHA 1GK8A 5F8LA 1X4HA 4X4QA 3ILIA 2WRMA 3D1QA 2JOQA 3GJRB 4HTJA 2FLNA 4A48A 2AT1B 5KFNA 4AE5A 4P73A 2W2MP 4JI8F 3HHNB 1EQ0A 1UVJA 2IVMA 3HVTB 3HJVA 2J0XA 4HVZA 3PIPQ 3IWLA 4P2FA 2DHGA 1CQNA 1TUVA 3AA8A 1X8DA 3BV8A 2MJNA 3QAUA 3HM9A 2GGPA 3PJWA 2K3IA 4ZN3A 3JAMY 2O67A 4TXSA 4C0BA 3HSGA 2OTLS 1H2UX 2LU1A 1TL4A 5HK4A 2RD5C 4X4UA 4YR0A 4DFJA 1HR0F 5A8RB 4IO9Q 3NGRA 2VKZG 3CDUA 2LLZA 2GJ2A 4DV5J 2HVIA 2YVSA 2R7SA 1UW9A 2B51A 2NREA 5F9LA 4GKJF 4LF7F 2V4QA 3Q86A 1B0VA 4CM0A 4LF6J 4LBIA 1QTNB 3MM7B 5F8JA 5E7OB 3DU6A 4DR6J 2QSFA 3H90A 3I5BA 1TV6B 3PYFA 4X64J 4B9TA 4DR3F 4UY85 3IAS9 4TY8A 4LF8J 1ULRA 2XM3A 5K14B 3BSNA 3JTPA 1KN6A 5KG0A 2MQOA 4RNNA 4PUOA 4TY9A 4WK1A 1CBKA 2OI2A 1AA1B 3M8ZA 3VR1A 1EIYB 3I9ZA 1CJTA 2R2TA 4ZCLA 2HVZA 3RAMA 2CQ1A 1Y00A 4MKVA 2UVVA 5KFCA 1KTVA 2HAFA 4ED2A 3AAWB 3CMAS 3DLLQ 1S4EA 4IOBA 2DNNA 5IV3A 4XPEA 3WIVA 5ETRA 3GZ7A 1FJCA 1PJ6A 1KHVA 2V8HA 3W2VB 1J5EF 2V8PA 4J91A 3KG0A 1X0FA 4P2XA 5JMNA 1K47A 1ZS6A 5B08A 2DHAA 1GT8A 4OLOA 1H3DA 4PABA 5F3TA 4ECWA 1L3UA 4DMZA 5HP1B 5J1EA 3UQSA 1H2VZ 2YKAA 1JJ4A 2DGWA 5D3GA 4ELVA 3QYYA 3H2VE 4OI2A 2HQ3A 1DRZA 2FY8A 3ZNJ1 2VFVA 2DGTA 4NLPA 3HFZB 2J5AA 2B7BB 2CUYA 3CE8A 2B9WA 4JI2J 3MEGA 2BABA 4AFFA 2OEJA 3FMBA 4ILMA 1QAXA 4J9QA 3N6MA 3TO8A 2COLA 4OJGA 2C2DA 3N5FA 4IG3B 3S6EA 2JFDA 1C1BA 2AJFE 2J9DA 3OXLA 3BF4A 1Q81T 1MMDA 3EPGA 3SSQA 1W2BR 4CO4A 1LNQA 2OKQA 3KUHA 4IG0B 3RTVA 3UCZP 1RT4A 2G1HA 4RUBA 4PEOA 4CH0S 1WEYA 2DGOA 3KLFA 1S76D 2AU0A 2AZ3A 4KSEB 3IR6B 2W2NP 3HX9A 4U67Q 5HLFA 3AJ2A 1NKCA 3G4SS 2VICA 2J6SA 1WHXA 1N0UA 3VZIA 4Y0FA 1UZHA 3W5YA 4O3NA 3IBCB 2V68A 2LQ9A 3GG0A 3RB3A 4BCAA 1H72C 1X4FA 4A47A 3O5TB 1DARA 4QYRA 2X51A 2CJ9A 2JSXA 2AYEA 3SCJE 3N9UC 1FDDA 3A3PB 2VG7A 3MPYA 1LFPA 3AH6A 5D0EA 2IDLA 3Q22A 1RHKB 2XY7A 2PMZD 4NPOA 3SEOA 1N4LA 3C66A 4WTOB 2HPUA 1R6VA 2YNIA 1BQMB 3D0GE 2YQ1A 7FDRA 4RL1A 3HK2A 4ZJOA 2GZOA 2RT3A 1C4AA 4I1TA 5LSOA 4DR2J 2BKNA 4DR7J 1H6KX 3HMJG 4LRAA 3D6FB 2D74B 1U1NA 2R7OA 4RZRA 3QLHA 3QNWB 3BBFA 3A13A 3SDEA 3A8EA 4B3SF 3TEHB 1ITPA 2CNLB 4YB7A 1S4FA 4B08A 4H54A 4KAIA 2YWHA 5LJ5Y 4B3MJ 2YNFB 2B56A 2H3EB 4LBHA 2D9OA 2X3GA 2YNHA 4NXMJ 2EC2A 2HNYA 3RB0A 1EETB 5KFTA 2QN6B 1KVIA 2E29A 4DL2A 1GEHA 3GYNA 1HQUA 2ZHBA 2QA4S 2JEFA 2F9JA 2KM8B 3US5A 1CJVA 4U7CA 5GMKa 4M5DB 5GAHU 3GIKA 2HHHF 3I0SB 2XLKA 1N33J 2E7XA 3R2DJ 5LM7E 3D9BA 1NRKA 2CA9A 3HF5A 4FF3A 1QE1A 3H8YA 4KRWA 3TW0A 5KFZA 3JSRA 2ZJPQ 2QE5A 1SIWB 3DDNA 2MSTA 3K5OA 3FSYA 2A6OA 3DGPB 1S5ZA 1Q8IA 4Z37A 2FC8A 4ZP8A 1V5IB 1JLEA 1J5OB 1CEZA 1MMNA 2KYXA 4QU6A 3M1VA 2W25A 2W9CA 2WHOA 1PAUB 2FD2A 4KO0B 2JX2A 2RU3A 4O3SA 1T03B 1RT5A 2DNRA 1S1TA 2V8VA 5J2NB 2V9KA 4CLKA 2XMTA 4K7QA 4CQ1A 4DBQA 5HSPA 4EU0A 5IFMA 1LV5A 4J9RA 4N47A 2D3O1 3T19A 5KFEA 4MJKA 5CHCB 1FJGJ 1U1RA 4WFYA 1ZA2B 1Z4UA 3R6LB 2CQPA 5J1EB 5RUBA 4ZCMA 1FWKA 1WG4A 2AF6A 1T05A 2CJBA 2WTFA 5CZXA 2Z0GA 2DRDA 4DFMA 4C8MA 2ZBQA 1HQEA 2BJ3A 3H20A 2CZVC 1DZ5A 2IAJB 1SXLA 3GJSB 3Q8YA 4TY8B 5BYQA 2GVDA 1FRJA 3BKUA 3IM9A 3KG4A 3NGKA 4KY3A 5BXIA 3G82B 3OVAA 1NSQA 3T1HJ 1YJUA 3BJYA 3THPA 2UXCF 5CD4A 1OMSA 1JJCB 5MLCV 1HBNB 4C4WA 2XSFA 2QMWA 3CDAA 3QGGA 4J9VA 3VGTA 5E2QA 2J9CA 1Y0HA 2RQCA 1H74A 2GVZB 4H4OA 1Q82T 3J7AN 1K0TA 1YSJA 3O1LA 4ZHRA 2DXEA 4IH6A 3W60A 4PUOB 2QX0A 2DKOB 4DSFA 3KLEA 1KQFB 2YPZA 5B0DA 4QW8A 1RT6B 3K59A 4GVBA 1R0AA 2FJVA 1Y9OA 2YBVA 1AB8A 1PAEX 2HNDB 1RXOB 2RHSB 2NS1B 3M32A 2P9GA 4RO0A 5HMWA 1S0NA 4M94A 1Q78A 4HEA9 2W7OA 3MD3A 3T9ZA 1FERA 3R7NB 1QLNA 4A8MP 1KFSA 1NB2A 2AV5A 2BJEA 2RQ4A 2HVDA 4KGXB 5J2MB 3BREA 1VK8A 1QAYA 2IVYA 3DLJA 3FRYA 4TKTA 2XLIA 1CJUB 1XTZA 5C2GA 1BD6A 2MY7A 4JI1F 1EKSA 1VI7A 3KMQA 5AT1B 2W9BA 2VONA 1U1MA 3CO0P 3VGVA 3U1NA 2X1AA 4NA2A 2Z4PA 4X84A 4ZDNA 4ID5B 2MKJA 1Z2LA 1S1XA 2K06A 3PDNA 4PPDA 3ZZOA 2GW8A 4XAKA 1SKSA 2UXDJ 1PYSB 2KN4A 3QAEA 2YH1A 3I5CA 4CLTA 4KH0B 1KKHA 5AE3A 1RU1A 4R5PB 3TQ1A 4WYWA 1S12A 3D0IE 3SFUA 4K0KJ 4NCAA 2V5HG 5E3PA 3BR8A 4C97A 1UKUA 2DH9A 3KLHB 1IBKJ 5HBMB 5HJYA 1LWCB 2IBOA 4DDFA 1HNZF 4MKYA 2VFTA 5HO4A 3C16B 3NCRA 1RAJA 2EXUA 3TJAA 3UD5A 5EWEA 4WWSA 5E41A 2DHSA 4O4GB 2OFGX 4ED8A 2HHPA 2KVIA 1S7IA 2BKPA 4HACB 3PEHA 2A6MA 3KDOA 2ALZA 1X5TA 3ZZZA 2E7VA 2PA8D 1X5SA 3MEDA 4V1Ak 5I42B 3KHLA 1HNWJ 1URNA 1FJGF 2CNOB 3WX8A 4EBDA 5E3AA 5LT5A 2RRBA 5HLFB 1HNIB 3HFKA 2LQ5A 2G9OA 4WP8A 2FQQB 3S8SA 3RJMB 2DRBA 5A8KB 3CC4S 1VIXA 4PG6A 3DGVA 3CJTA 1WUUA 2BA9A 4U95A 2FVSA 4RLEA 4EMDA 1VISA 3QZ8A 3PTWA 3SSRA 4X62F 6AT1B 1GXUA 4YP3A 2PDAA 2ZNYA 2M7SA 3BEGB 4L76A 2ZH5A 4PCQA 3ZFVA 1KC8T 3D6MB 4DZ6A 1HI1A 3UD4P 4B9NA 3DRSB 2XNRA 2HBRB 2D7SA 4NEYA 5D6GA 1HNZJ 2FLLA 3W61A 4CT9A 3I5AA 1VRUB 4C0OC 1U48A 3V5RA 3K58A 2FUG9 5L9NA 3R5JB 3CO9A 2CQBA 4J5OA 3CCMS 1IBLJ 1SJFA 4PXEA 6FD1A 1TL1B 2B4VA 2XMMA 2PEBA 4H4KC 2EKYA 3IG1A 3N0VA 1ZAXA 4NCBA 4Q8EA 3D1OA 3UPFA 3GYXB 4Y3CA 2IC3A 1XIQA 2H9ZA 3UR3C 2C3MA 5IZHA 3PKYA 4ECVA 1L3SA 3M8QB 4DHVA 1K73T 4USHA 1AUSL 2RIJA 2MZ1A 3TZXA 1TK8A 4USKA 3OQ2A 5F3ZA 1RAFB 3DRYA 3MAHA 3F73A 4CRJA 4PXDA 4NCGA 3UCGA 4YFUA 1NNDA 1TELA 3OR2B 2QFIA 1W25A 3H2UB 4L75A 1RHJB 3NP5A 2C2MB 4XIUA 1L5UA 1OYDA 4Y34A 4Y00A 3RBXA 4J37A 5MAOA 2ERRA 4FNHA 1H2TZ 1HKAA 2AEJA 1FD2A 1D0EA 3ITHB 2CKWA 5DO2A 3I4PA 2VG7B 3AT1B 3G8QA 4FXVA 4QR2A 4ZOSA 1ZM3A 3A1YG 1AZSB 1UPPA 3FFIB 1RB0A 1SJ3P 3U7JA 5EX3A 3FEZA 1WSRA 4A8QA 1RT2B 3VV2B 1C0UA 2X1FA 5AXMA 2BQ3A 3QPIA 4CZCA 3IO1A 4CIOA 4C3KA 5F8GA 4CM2A 4EO8A 4KO0A 2PI5A 4K59A 1FA0A 3I6PA 1JJHA 3F0NA 4LRFA 4PPZA 4ZP9A 4DUYJ 1NK5A 2B9YA 1S0VA 3QFHA 4OYPA 3TA0A 4LVNP 1X4BA 3ILLA 3A3OB 2J0WA 3NBPB 4IFYB 2V2KA 7AT1B 4TU9A 2MLZA 3NMRA 3EM1A 4K4SA 3E51A 2XO7A 2KFNA 2KI2A 2YKQA 4GO5X 4ER8A 2EEYA 2FJXA 2NXJA 1A7GE 1RT3A 1VIOA 1S99A 2YX4A 1X4EA 3S1TA 5E3QA 4RBUA 2LDIA 4ED6A 2DY9A 1Q8LA 2HFSA 5ETSA 3LP2A 4DX5A 4NOHA 3Q2SC 5JVGQ 4RPFA 2KFYA 1P27B 4OZJA 2R7XA 2XI3A 3OLBA 4K4VA 3C15A 3VVUA 1ZPWX 5J2PB 4Y65A 4YQWA 3ZZRA 4ZJLA 1SJRA 3GIMA 3EJMA 3QO9B 3CDWA 3DNCA 2KXNB 2HKEA 3K17A 3I82A 1X0PA 5JUMA 5HANA 4B9MA 4ZVEA 3HT3A 1WEXA 1T94A 1X7VA 4OHWA 1IBLF 1NJWA 5D8HB 3ENAA 4C8YA 3SSSA 3MM9A 2QC3A 1RT6A 1KQKA 2KT2A 2IDEA 2JRSA 2U1AA 3HSDA 1OPZA 4RNOA 1FEHA 4V19X 5GVQA 4QIFA 2ASJA 4IRDA 2E1AA 2LFVA 3EXCX 3LPYA 3MM7A 4FP9A 4NE9C 2DNHA 4B3TF 1QM9A 4ILRA 2YNFA 1PYOB 3CXCR 4E8UA 1TVRB 1Y5LB 4DV7F 4NMXA 1F3VA 1WC0A 3JSBA 3FZBA 1I6JA 1KLNA 1WF0A 1YIJS 1G2EA 1FJ7A 4KBIA 3MECB 2EK6A 3SIPB 5KTQA 5LSRA 3O2IA 2RDJA 5LMNF 2M8DB 3D6TB 3MPUB 3HI9A 3EXYA 4MK9A 4OQJA 4CO2A 3SV4A 1FNXH 1HQEB 4OYZA 1FRIA 2XHWA 2IYIA 2DCUB 2GS8A 3W64A 4Z7YA 4YN3B 4BS2A 1U8WA 1PBUA 2RSQA 5F8IA 2IRYA 4W4MA 1J27A 3NS7B 1CLFA 3CGIA 2DNMA 2XS5A 3C6TB 2EFNA 1HI8A 3KUGA 2VA2A 1J5OA 2LA6A 3FSXA 1S77D 2OJ3A 2HMIA 3C16A 4M5LA 4MK7A 2V8DA 4RKUC 1QD1A 5SUHA 3OUYA 4P71A 1HW8A 2OD4A 1FXDA 4ANEA 4MIWA 2PO4A 3QGHA 5G4DA 1RBOB 4CO5A 3NL0A 1YKWA 2DR9A 1LWFB 3PKMA 5KOWA 1MW7A 4AUKA 3W8GA 3CDEA 1F0XA 1I3OB 3G8SA 5L9XA 1JLBB 1OQ3A 1KQGB 2OLWA 1JK9B 3A8KA 4NLVA 4C48A 3T5JA 4HTIA 4JI0J 1Q8BA 1IR1A 1GMWA 4M1KA 2XYGB 3FQKA 4ID8A 2BE2B 2JZ5A 1GH8A 4DL5A 4QJVA 2ZD1B 3TAMA 1Y5IB 4PYDA 2PD1A 2WONA 1YG0A 3MM5A 3QT6A 1EX8A 1GQEA 4GKKF 1KWMA 2P9EA 4OL8A 1SCJB 4J9PA 2VB6A 4M63A 4DQRA 1T7PA 1FEEA 4V19J 4C9DA 3KJFB 2XCAA 2I0XA 1T95A 3OXFA 3VQTA 3ZZ0A 1IKYA 1OY8A 1HLWA 2VG5A 1RAHB 4QWAA 3PG9A 2CZ9A 3MM8A 3H4DA 5M2UA 3B4DA 1JIHA 4ZIWA 3CCQS 3EVWA 3Q8VA 1WDDA 3MGJA 2HNZA 3LW5C 3KFWX 3V4IB 4C8ZA 2XWXA 3KLHA 4M5MA 2J7WA 3DDIA 2Q43A 1FRMA 1KVKA 1MG7A 2O66A 4KV8B 4E98A 2OPQB 1RT1A 3CJQA 3PRVA 3AOAA 3V6HA 2KXFA 4MKBA 4U7UK 4CDIA 2EKNA 1UEUA 3CJ8A 2IBKA 4MYUA 2N7YA 2VG6B 1WC3A 2HS0A 1F5CA 4Q7AA 3QRRA 1U45A 4KTQA 2JVOA 4R8UB 1TKXA 5GAHI 1M5OC 4FF2A 5HJXA 3ZZTA 3EYZA 2R7WA 3HDSA 3KDNA 5HN0A 4LQ9A 2CQ2A 4RW6A 2CQDA 4XDDA 2I6WA 3W65A 2GIFA 1M5HA 2ASYA 4ED7A 1WC6A 2CYYA 4ID5A 1NMEB 1WG5A 1FCAA 3MM6A 4FVMA 2ZH6A 4F50A 3ZZYA 2HW3A 2AJ2A 4JI7F 3TOQA 3BBCA 4O0IA 3OL6A 2B6AB 2PMHA 1VGYA 3EUNA 1MWZA 5KFQA 3GCWP 4DFKA 3CC7S 1S0OA 4LR8A 2VD3A 3CCZA 4EBEA 3QIDA 4LR9A 1C0UB 1HD0A 3UVJB 1VHFA 2V63A 3MR7A 4ES1A 1XNRF 3KJQB 3IWXA 3P49B 3KNAA 1FDNA 6FDRA 1HMVB 3HVRA 3N6NA 3W8PA 1SUQA 4KE5A 1VQ7S 1R7IA 1TL1A 3W9IA 3M8PB 2K1RB 3FEXB 2RDIA 3NOCA 1TUGB 3PRBA 4RWWA 3VAGA 5KFLA 3GU0A 2A1BA 3KLVA 1OJ4A 3IBWA 1HNVA 3HZGA 3LP1A 1R8AA 5HQ8A 4ZCKA 1WI6A 4C7QA 1MU2A 2E66A 2EVZA 1HBMA 2OPRB 4WFBQ 2F4VJ 2L08A 3MEGB 4IYQA 4NCGB 3W5XA 4FN5A 3G8TA 4HT7A 2MZRA 4DR4J 4W90B 1CQMA 3AOCA 4DPWA 2XGPA 3QRPA 3AQOA 3LP0A 4LF2A 1RT7B 2BMBA 3M8SA 3CSKA 4DV0J 2WK4A 1A9NB 5D4NA 2FHKA 4QZVB 4O3OA 4ZVQB 2Q3PA 5CH7B 5C7PA 5CCMA 4XO0A 2XO6A 3CC2S 2VFSA 2XYHB 3T5LA 2WVFA 4RW9A 2G2ZA 4Q2LA 1ELOA 1LW0A 4MFBA 5K20B 4B17A 1RYSA 1D9AA 3TJ9A 5C42B 2DNYA 2MQNA 2B7CB 4ZKAA 2H1YA 4RNHA 3G87A 1RP5A 4KIAA 3MR6A 3LOUA 3NY0A 3R5AA 1GXTA 1HQ2A 2DGQA 2MLXA 4DCPB 3T1AA 1D09B 3AD7C 2UUCJ 4PRFA 2ZE2A 2ZZNA 3V4MA 2BBEA 3VWSA 4NWBA 4GKJJ 4FXDA 3SBMA 1DLOB 2LEBA 4LSZB 4F4KA 4HL9A 3TAMB 2HS3A 4ANCA 3Q8UA 4ZITA 2OSRA 5DQGA 2AEFA 1U6ZA 3JB9k 4ZHRB 2OIHA 2UU9J 2I9SA 2DR5A 3N5BA 2AZ1A 1LOUA 5A6PA 2XHCA 2OPPA 5C5JA 4FYXB 3NOGA 1S49A 4DR4F 4L74A 3RU0A 1EJ7L 1TL3B 1SL0A 1NJIT 1FRXA 3MCNA 4LVOP 1EARA 1VYAA 3PW5A 4C2MA 2YNIB 2ZBPA 1QSSA 4J9SA 2J8SA 4LFAJ 1JXEA 2XGQA 1S1UA 2QFJA 1RKJA 2RMLA 1FDAA 4X4OA 3LALA 2CADA 2CPZA 2HSEB 2HNZB 2QT7A 2WZ1A 3Q89A 5L46A 5ETMA 4QWEA 2XQCA 4A4JA 5B09A 4ZPAA 3VALA 1TAUA 4MKAA 3TAPA 1T9VA 1IKWA 2GC8A 2NXEA 3ITHA 2UXDF 3L7UA 1CSJA 1AROP 1FESA 3P5TL 4J90A 4DUZF 1BQXA 1Y7PA 5KFDA 2HWIA 3DM2A 3W2WA 1KDNA 3BGRA 2ZOGA 1RWNB 1RAOA 1WTFA 3AB2B 3BSCA 2NYHA 2UUCF 3KNGA 3JXOA 1UJ6A 4I64A 1NZAA 4DL0C 2VKRA 2W7PA 4UOCA 3HVAA 3RZAA 2CQCA 4HI2A 3KWMA 4DPUA 5B0BA 4ZLNA 2YNGA 1IKXB 3MF5A 4FKYA 2E7WA 2GJFA 4KFBB 3SV3A 3KLGB 4EBCA 1X5OA 1XJWB 3TQEA 4MMOA 4ZA1A 2V8GA 3NRBA 4RW8A 1C0TA 4DG1A 4ES3A 3LP2B 3T1HF 2HZVA 3ELHA 3BBBA 1U6FA 4J9UE 5FDLA 2Y1RI 5KFJA 2VJUA 2ZBCA 2XZDB 1RHQB 3R5GA 2WBRA 3C15B 2F4VF 1RWWB 2E5GA 4F02A 2WVDA 4OI3A 4KPCA 3DC2A 2QMUB 4WIQA 4X66J 2CVEA 3M9NB 1OQ6A 1Q86T 1L3VA 2AEMA 1YHQS 3IAM9 3J81Y 2VG5B 1REVA 1TKTA 1YRTA 3TR5A 2K2PA 3MEEB 4DLGA 2IJRA 3M4XA 2KJWA 1WOOA 4CYUB 3TZYA 4WFAQ 1HNIA 2GMJA 2MEWA 3R5CA 4UTGA 3TZWA 1N8RT 1KRPA 5FJ4A 2CQGA 1T02A 2MY8A 1BHNA 2AJ4A 2Y3YA 4B9SA 2CNKB 5IS2A 1HA1A 3Q23A 3CJ4A 3AD8C 3LGHA 4M5NA 3VAFA 3CWJA 2BQRA 1F9EB 4MIAA 1H38A 2HBZB 3DRRA 4DPXA 2ZJQQ 2J9EA 2NLWA 2FJDB 2Z2ZA 1S79A 5IWAF 2DNGA 2OPRA 1RA7A 3KUEA 3MEKA 4KKOB 1WD6A 1SC3B 3ADAC 3GILA 4ECQA 3ZO7A 2AD9A 1BE4A 2IM2A 4WU2A 5DQHA 1RT7A 1W26A 4GRSA 3OXGA 3GQCA 1U25A 3CUNA 3HULA 5D0RA 4F2RA 1WOSA 3R1HA 5B0AA 4ECUA 3MM5B 3CNQP 3DYAA 3G6YA 3M6WA 3B4MA 4OZ2A 1AT1B 4DR2F 2H4WB 2VPXB 3SXLA 3TX0A 3ZZUA 2JL9A 2NXCA 3OFEA 1M1GA 3VTIA 1F2HA 2VFUA 3FCHA 5KG2A 1XR6A 4C11A 1N32J 1IXKA 2HURA 2NPFA 4TU7A 1RLCL 2YQ3A 2MQPA 3MWBA 4DS5A 4F7VA 1MROB 2LXUA 4D3HA 3MUVP 2FGOA 5HAOA 3RB6A 4JB8B 4UY8T 2EPIA 3Q83A 1R43A 2LYVA 1UA0A 1CJUA 3HCXA 3ETMA 3EVOA 5ETLA 3TARA 2GMHA 1C1CB 4YEAA 3EX7B 1KP6A 1AW0A 1KONA 2ZUAA 3DHWC 2G0IA 3NAHA 4FDFA 4FPRA 3GV8B 2Y1JA 1RSCA 1NK8A 1VQNS 3S7RA 4PQUA 1LWXA 1NPRA 3DRPB 4IDKB 4DXLA 1S97A 4WF9Q 3ET6A 4IKAA 4F0HA 3PACA 4M5DA 1HWJA 2FJAB 3PZPA 4DV1F 3VAKA 4EO6A 2V4JA 4HHHA 3SCIE 1EKRA 4B3OA 1NK9A 3DLKA 5CYQA 5L8RC 1VRTB 2QA1A 3CT9A 4OZ0A 5KG5A 3RBZA 3P96A 3RR8A 1ZOTA 3NAIA 5DDQC 1SB6A 1RCOB 4PYAA 1LK5A 4HACA 2J7KA 3JQKA 4NLTA 3PRDA 4X4SA 4EYIB 5IQ6A 4NA3A 3M6UA 3ZTOA 3MM8B 3R6GB 3RGIA 1U26A 2K7KA 4FF4A 4OX7A 1S1WB 2G0CA 3LO3A 3NGSA 4WXWA 3KTQA 4F4ZA 4Q0BB 1GXLA 2BKOA 2LXFA 2C2ZB 4X66F 5J2PA 1SUQB 1DTQA 3EMTA 3KHHA 4GC6A 2YNGB 3SQOP 4ICLB 3PNIA 1F1BB 1TL7B 2MQ8A 5FD1A 5GAGU 4LUBA 4EGLA 2KG1A 3IS9A 4I6YA 2KH9A 3E2EA 1U0HA 4NEZA 3CULA 1U24A 2DNZA 2DRAA 4E2FB 2HQGA 4O44B 2NCKL 2WVBA 5HQLA 2DB1A 3DFEA 2KRRA 2HGLA 4OHVA 1K1QA 5CQGA 1NH7A 4GVLA 2W24A 1TK0A 3MAQA 4ZVGA 5KT5A 2H51B 1LXNA 2WW4A 4D3GA 2WSCC 3ZTSA 4B9LA 3D68A 1QY7A 1N48A 4K50A 1SIZA 1PYTA 2WCXA 2VQFF 2ABYA 2BJDA 3OBIA 5DGAA 4CH1A 2NZCA 4ANDA 3M8RA 3BKFA 3FUYA 5A0YB 1ICEB 4DV6J 3OJUA 1RBAA 1HBUB 2PT0A 1VQ4S 4DV0F 1JLFB 2CNNB 4DOZA 2YKPA 4AYBD 3TX8A 1LW0B 3GONA 4CO1A 4A8WA 4PG8A 5KFFA 1X4CA 1S6QB 4CI0B 1NZ8A 2K1RA 2JC1A 5B0GA 4HHUA 2J8AA 4ED1A 1JLAA 2K8GA 5LJ3Y 1SKWA 1CG2A 5BYSA 4DG1B 2DJWA 2JDJA 1RHMB 3SDEB 3ICLA 4DU7A 3P4UB 3J7ZT 1N32F 2CPHA 3BN4A 3GYGA 2I5JA 4OIXA 2W9BB 4A8KA 1CJTB 1HWKA 4ATNA 4YB6A 4CNYA 5DZ6A 1OSCA 4NLQA 2OD6A 4DL7A 1G1XA 3H98A 5DDOC 1AZSA 1Z2ZA 2QRRA 2QSWA 4NXNJ 2G2OA 4DX6A 1CULA 4K5SA 3VHQA 1Q0NA 2MMYA 3KOAA 1F5BA 2E5LJ 3K89A 3QWPA 3PCOB 4FBUA 1NDPA 1JLGA 2YKMB 4RW9B 5E0OA 3DU5A 3GJTB 4TN2A 5T7LB 4OX9F 5HMZA 1VC5A 1TMJA 1C2PA 4Q44A 3G9CA 2DXDA 5ETNA 2BE2A 5ITHA 2E9RX 2XSJB 2ZZTA 2O1PA 4DR5F 3T9NA 4K4ZA 3W9HA 2MKYA 3SZ2A 1H98A 5KFAA 5I3PA 1B7YB 3BKTA 1P1TA 4WU3A 3BN7A 5DS7A 1U1QA 2ILZA 3W66A 4LFCF 1M5KC 1RT3B 2D3ZA 5D78A 4DPOA 1T03A 1YDLA 3KLIA 4TVAB 4USIA 1DLOA 1JMTA 4HR2A 4USTA 4ZCIA 3UDCA 4G65A 3GFHA 4ZVPB 2W01A 2UUBJ 2YWEA 2IMOA 3CEDA 3MR3A 3PW2A 4DPYA 4NRTA 1RWXB 1YQHA 4NZ0A 2DH8A 1SH2A 5DM7Q 1RTIB 2BV3A 3G6XA 2UP1A 2E9ZA 4OJHA 2HGMA 1OSDA 2VFRA 3F44A 5KG7A 1WHYA 3QT8A 3T5HA 5HROA 3RUBL 4AXJA 4U7UD 4IFVB 3QGIA 2JEGA 2F4FA 2GFFA 2ZWPA 3IGVA 3WC2A 3K8VA 5IT9U 1SH0A 1CS4B 4DWIA 5IC6B 2HHQA 3AD9C 2DITA 3PEJA 3W2VA 2X3DA 4IR1A 2EWHA 2RVJA 1F6TA 2BM1A 5L38A 1R3NA 2XMUA 3AFGA 3H7HB 1U4BA 4WBFA 4YDXA 4ZJQA 3Q8PB 3G6ES 3ZZPA 4DSJA 4Q0BA 4HDGA 3TVKA 5LSLA 3GR1A 1CPZA 4X4PA 1KQSR 3HHKA 4FVCA 1JLCA 2CJKA 1FFWB 1ZAWA 1Q79A 5D4PA 4NLSA 2V2ZA 1D9FA 1XK8A 2XMKA 3HHLB 3CJ3A 2FZCB 2BX6A 2RRNA 3SFGA 3NGDA 3HJFA 3RYLA 2CDRB 4I4BA 2B6AA 4NLYA 1UCNA 3OLAA 1QUPA 1R0CB 1TAQA 2VF3A 2G2YA 2XEXA 3CMQA 5ETTA 1UZDA 3KYLA 5HI7A 2DGVA 3HZEA 5HMXA 3SQGA 2R7RA 1VHIA 1RTDB 5KG3A 2Y0SD 1T11A 2LDYA 2OGUA 1UPMB 3KLGA 1J2VA 2JLGA 3BSOA 1VQKS 5T41A 1E6VB 4ZPTR 3QSYB 1RWMB 4LJMA 3IRWP 5GAGI 3LWMA 1U2RA 2HLUA 2Z2LA 3D0HE 1GX6A 3E8OA 3CD7A 1TKZB 2DY1A 3EZUA 3OD2A 4F26A 3CMES 4N76A 2KHDA 9ATCB 1YGYA 3DI6B 3FBCA 3GP9A 3TYTA 3I9V9 5B0CA 3H42A 2RH3A 3FC9A 2CG4A 1QAIA 4NXNF 3LP0B 5AE1A 1MWQA 1GMWD 2RB7A 4PAAA 1S9GA 3I0SA 4HHJA 3MFIA 2UXBF 3DMJB 5SZTA 4DZDA 1IQZA 3J7YU 1RAIB 4OX9J 2Z8QA 4C8OA 1Y10A 3NCQA 1TL7A 4YUDA 1GTEA 4DFPA 3D5MA 3CCES 3OR1B 1ROFA 1NKEA 1FO1A 2R42A 3QGPA 4DQIA 3J7A1 1WWHA 4GKKJ 2QLJB 2ZH2A 1HHTP 2NZ4A 2R7UA 5DLGA 1BQMA 3NNAA 4N5SA 4P7TA 4OFZA 3OHBA 2AMCB 2DVIA 5D0HA 2EK1A 5C2CA 4WCEQ 2MZQA 2QO3A 3K7RA 4C6AA 2H54B 3TUIC 1JLEB 1R8HA 5KT4A 4JI7J 2QYCA 2W4CA 4RR5A 3KMSA 3O8WA 5A2QU 3FSIA 3CCRS 2XMJA 1RT5B 2CIMA 1S1TB 1KS2A 2ZHOA 3MMCA 5J2NA 4W92B 3CB4A 1IQTA 2Z56B 2VV5A 3DOMA 4ETXA 1I51B 5I4MA 2FHJA 4OHXA 2DPJA 2YXLA 4TNOA 3AODA 1QJHA 2VJVA 3B78A 2HAIA 3Q24A 4F67A 1KHWA 2F8MA 2VU5A 3FQLA 3UI3A 5DRKA 3H5XA 2NYIA 4LF6F 5D15A 2FY1A 1FFSB 1YBAA 2D69A 5CYMA 4CLSA 2E5LF 4TLRA 2FJBB 3KK1A 2MQLA 3P5BP 3DLGA 2DBBA 3MPWA 1IJFB 2ASLA 1WI8A 3PFEA 4IH5A 4JUZA 1UEVA 4DV3F 4DLEA 1TKDA 3UDLA 3PJ9A 1HNXF 4QIWD 5F8MA 1TUWA 2FZGB 4BBYA 1S6PA 4UQGA 4BC9A 2YKMA 3NNCA 2MSSA 1R27B 5M2RA 3X3UA 2FVRA 4NZ7A 5HMYA 1WACA 4L73A 1CULB 1VRTA 4JBCA 2W1BA 2BW7A 3ZC4A 3H5YA 1IBMJ 3C6TA 3QLHB 2DD8S 4TYAA 5EHHA 3OTOJ 3UW1A 3NS5A 3OTBA 3I96A 3MCSA 4C98A 2NSBA 3BYRA 2ZOFA 4F3QA 1JLCB 1TZ0A 3FFIA 4WTYA 4DSKA 1EETA 1N52B 4QYZK 3M9OB 3EVMA 1HARA 4ED0A 1GNKA 3HHLA 5IOLA 2V69A 4GC7A 1KOOA 1VCTA 4I6AA 1MSWD 4O4RA 4CO3A 4UQTA 4DV6F 1WKJA 1IBCB 1RWKB 1JQGA 1Y5NB 2AYMA 1S7HA 1SH3A 1HYSB 1SI9A 1D8ZA 5F41A 5IT9Y 4CTAB 1OO0B 4JI2F 1U8SA 3OTEA 2V50A 1U1KA 3NWRA 1F3FA 4IRKA 2VBYA 4IFYA 3JS9A 2JEIA 1NSKL 3OSNA 1KBRA 5KFIA 1WF2A 2RJZA 3R9LA 2UU9F 3NMAA 3JQJA 1RTDA 4F3MA 2M5YA 5C24A 4ZLPA 5KFKA 2XMVA 3WBZA 5IWAJ 1P6TA 4N56A 3ISNC 1N5TA 3C8YA 2XWYA 2W9CB 2AX0A 2J0QD 4LQ3A 3IS9B 2P6SA 2YH0A 3HD2A 2PI4A 4KHPJ 2OTJS 2D3UA 2OP5A 2MDAA 3A3NB 3AB4B 2PFDA 1TFWA 1SC6A 1RACB 3M6XA 5A8WA 2H5JB 1B70B 2MKCA 5A0YA 1M5SA 3M1VB 2QGFB 2C2KB 2EC0A 1JLGB 3BH7B 3EGNA 2GJIA 3Q8RB 2KT5A 2M0GB 1SKRA 4QW9A 4F8RA 2DIVA 4FYWB 1FRLA 1T3OA 3JAMU 2WOMB 1H73A 4DSIA 3K57A 1PGZA 4OYAA 2DGXA 2HFZA 3B6BA 5KFSA 4A8OA 1AFIA 5ETKA 3RRHA 3UO0A 4NL5A 5A8KA 2ZH7A 1RTJB 1JLFA 3IR7B 3CJ0A 2QA4G 2AJQA 4URQU 1DY3A 2JLFA 1YZ6A 1BQNA 1TK5A 3JYTB 3X1LB 1NO8A 2IRUA 1TR0A 2F9DA 2F63A 3BGFA 1WORA 2OMOA 4M5GA 2HEKA 3ZTPA 3HSZA 2ZH4A 4USUA 1VQMS 1PJ5A 1RWVB 1LWCA 3R27A 1U1LA 2ZZMA 4RBTA 2DTJA 2XZWA 1S6OA 2FB0A 2B8PA 1WHVA 1XR7A 1S1VB 2FPHX 2LEAA 2RKIA 3PHTA 1SVDA 3LA0A 2KB2A 4YY3J 4JYAF 4FYDA 2XS7A 2HHSA 1RTIA 1WEZA 2F1FA 3IM8A 1EB0A 1HWIA 1S57A 2B0GA 3CJ2A 3ETOA 4OHZA 4Q45A 3DRXA 3J81j 4L3NA 2V2QA 2WB4A 1O5JA 3MEDB 1DQ9A 2R3VA 3HKWA 2L9WA 5T7LA 1WC1A 5A76A 5I42A 3C46A 2PEHA 4Q43A 3IR5B 4OJ1A 3GB0A 1N36F 2VOOA 4M5HA 2J6TA 1MN7A 1RWPB 3GFXA 4ERDA 3CCUS 1WTBA 1S9GB 4YB5A 2E1RA 2PFFB 4DS4A 2HHWA 2YKNB 4AXIA 3BH6B 4C3LA 2MHNA 3K2YA 3QMQA 2FJWA 1T9XA 2QIFA 3DLEB 5G0RB 1HL6A 1N33F 3UD3P 1YBUA 2W7AA 4ED4A 3TEGA 1DJ0A 2V4RA 5J2MA 2MPUA 5F8HA 1Y4ZB 4M5KA 2CJXB 3PJXA 3ONQA 3LP1B 2M8HA 3O3LA 1UJ4A 1UWBB 1YWXA 1M5VC 2EG1A 2VPWB 4KGKA 4NLUA 3RRGA 4LT6A 2KXHA 2LQ8A 2WVCA 4TU8A 2AGPA 4URSA 1FKAF 4HDHA 3UDVA 5DG9A 5L1IA 4H4MA 2VC0A 3UWTA 3OL9A 4PWDA 4YY3F 4JYAJ 5KFHA 5K8OA 3M30B 2GVZA 4H4OB 4KR0B 1UFKA 3W7BA 2G1DA 2YTCA 3CIMA 4YDDB 5L1LA 4DR1F 3BDPA 5CD4H 4OYOA 2OFHX 1GX5A 1NXIA 2KG0A 3CF5Q 1IVZA 4GVBB 2P2CB 3R97A 1R0AB 3MMCB 3UCUP 1XMOJ 1ZYQA 1IKYB 2IA6A 4OHYA 3CD0A 3M32B 3I87A 2R2RA 4MIBA 4DL6A 1ZBTA 3MMAB 1YJTA 5K8PA 5K8NA 1SQFA 2DR6A 3MZIA 3G2XA 3R8YA 1F9HA 2AGQA 4NLXA 1YITS 2GHWA 1UETA 2ZNZA 3VAMA 1LW2A 3A8IA 4OYMA 2FVCA 2DIUA 5KFOA 4F4XA 2C2RA 4JI5J 1RADB 1M90T 1V3ZA 1LWEA 3FKBA 1GMVA 3JTOA 1HIYA 4OJ3A 1VBZA 4WKYA 1FKOB 3HPOA 1JX4A 4QYZJ 2Q1LA 1NM2A 4DN9A 3KK1B 3MM9B 2NXNA 4X65F 2FLPA 2QJ3A 1BLUA 2VASA 4MAKA 2EW9A 2BJ1A 2V6AA 3MMJA 2GO8A 4QWBA 2NUUG 1S6UA 2W2OP 4G1QB 4LF8F 2R8IA 4ETZA 2AJ0A 4NA1A 2W4PA 5KG1A 3MHYA 3JSMA 2D1CA 5KFWA 2DGUA 1FFGB 2GIQA 2MQMA 4PG7A 2DCLA 4ECTA 4F3OA 3GCXP 2V9WA 1T9YA 3WC0A 4QQBA 5KFRA 4OI0A 1JKHB 1SC4B 3CCWA 4MTPA 4FS1A 3IFEA 3RBDA 1Q5YA 2E44A 4KB7A 3NNHA 2KU7A 2DNOA 3BDEA 2R8HA 2AYGA 5GMEA 5KFXA 3PY8A 2W2QP 3BGRB 4HYKA 4PQUB 3R1LA 1I5OB 4MH8A 3UR0A 4LRBA 2CQIA 4LREA 3SCLE 3ZTQA 5H1SV 3BQ2A 2OO4A 1RKIA 3CIZA 1N5QA 4UUWA 1IJEB 2QLXA 2V4JB 3OTCA 3QO9A 4I56A 4IH7A 4KFBA 3QWUA 3EGWB 3FRZA 4KC5A 3S01A 1SC1B 3D1HA 3ULHA 4NLGA 2NQPA 3FEYB 1Q7LB 1RQ0A 1QSYA 2DYAA 2XSJA 4YHHJ 5FIIA 5KAKA 1FVQA 3DRSA 1X9MA 1NJXA 3ZTRA 1E6YB 4OX6A 4USVA 5IM0B 3CVKA 3BO4A 1O51A 2OHDA 2HG4A 2MGZA 4DR1J 1ZH5A 3GE9A 4KPYA 3TANA 4RW4A 4U8VA 4CYUA 1FI4A 4P2SA 1FD8A 3THVA 3OSPA 1ZM2A 4JI4F 1TVRA 2RS8A 4L3KA 2LU2A 5L1KA 1QAJA 2Z30B 3ENWA 1WDTA 2HWTA 1VMBA 2M9KA 1JLBA 3IRXB 1VQ8S 3HHLD 4USWA 3C6UA 1N5YB 2V94A 2R4FA 3T41A 1MWYA 3AOBA 4B02A 5C42A 1PIEA 4M5IA 2YWKA 1RA6A 1V6HA 2HK2A 2KYZA 2NSCA 3B54A 3CCTA 3JSYA 2I38A 1IKVA 3L7OA 1OY6A 3OFGA 4P9SA 3MFHA 3MCMA 1YJNS 2XLJA 2G4BA 2GMLA 2QG9B 2RKIB 1NPPA 2BQUA 2BJ7A 2B3TB 2HIQA 2ZH3A 3CCSS 3D3CJ 4USJC 2CPDA 1PILA 2OEKA 2B8QA 3AJDA 1M0SA 5B7WA 3OFHA 1S6PB 2CQ4A 2ZDPA 2AW0A 2R7QA 4IG3A 4QWCA 4FYYB 2P8IA 5DETA 5CYMB 2LKZA 2JFKA 4QBUA 2VQFJ 1O6XA 2VG6A 2E5HA 3HD1A 3PO4A 2UVRA 4QIVA 3KJVB 5GAEU 2O01C 3EPIA 4I67A 1VOMA 4C8NA 4J9OA 2OPQA 3I56S 1N6QA 4DR5J 3IBFB 4DV2J 3RAXA 3MD1A 4Q8FA 2OAUA 1WJ9A 2EI5A 2CVIA 3GG1A 4ZIVA 1U2CA 3JQMA 3R5BA 1ZA1B 1LKZA 4ZPBA 1I1GA 4F36A 1A6LA 4CLWA 1B99A 3L95X 2B9XA 3R7BB 3BQ1A 2BRKA 1KD1T 4WFZA 3TAQA 2DO0A 4F04B 3K0JA 1SQEA 4F0MA 4NX9A 3F56A 2GV1A 3A12A 2HHHJ 2ZFHA 3PHEA 2BJ9A 1FNOA 1WNEA 3VQSA 4S0MA 3CJKA 1RABB 3OL8A 1TKZA 2FC9A 3OVSA 4Y2KA 4JV5F 1IKXA 4DPTA 4AQYJ 3OJSA 1U02A 3VGUA 4CTAA 3M8PA 3H40A 1N34J 4IOAQ 1FXLA 5U47A 1SQGA 5DJBA 4LFBF 1C1BB 3IGNA 5KG4A 2XCPA 1IR0A 1KVJA 4P10A 4FXWA 4DI6A 2VPZB 5EDWA 4N7TA 3MXHP 5GMDA 2J7UA 4FS2A 1VQYA 4Y6IA 2OPSB 3WZ0A 4RW7A 5I3UA 2LVWA 2GO9A 1V3SA 3MMAA 5IV4A 4X65J 2C28A 3W5ZA 3I0RA 1W2IA 3GSDA 2E1MC 2FHOB 1R8PA 2KRBA 2XMWA 2YKNA 4M5JA 3EICA 1RTJA 4CT8A 1XQIA 1K1SA 4NLDA 3OV7A 2BZ2A 2E5JA 2ATCB 3DXBA 3DXSX 1RLDA 3RR7A 3EDRB 3DHXA 5HVGA 1LXJA 1RZMA 3MOZA 4RX6A 2VHGA 2ZM6F 2GX8A 1Q7YT 1NK0A 4O44A 4BWJA 3QATA 1RTHA 4OLPA 3DGPA 3H2LA 4P74A 2AYBA 4LFBJ 2C2NA 4KHMA 1YJVA 5CXTA 4I2QA 3PFOA 3IWNC 5DG8A 2ALYB 2ADCA 4E0DA 2J0SD 2GAHC 2VBZA 2MGZB 1X31C 3GV5B 2QEXS 5L39A 2ROEA 3T3FA 4LFAF 2FLOA 2VDHA 2PE8A 2JNJA 3D4JA 2FIUA 3D67A 2YWGA 2W9AA 4DSEA 3V6KA 3DN9A 3P45B 1HNXJ 1Q16B 4YR2A 3HHEA 4TLQA 1ZZNA 4O3RA 2UVWA 1BC6A 3MTJA 5LMUF 3M2VA 1IR2A 1H7XA 4HH0A 4BC7A 3GIIA 5I3QA 4AL5A 2EBGA 1X4AA 3C6UB 3VCDA 1SJ4P 2JC0A 4WIIA 4ECZA 1N5VA 2GHVC 3B82A 1U49A 4HLBA 1MU2B 2B5JB 4KV8A 2H48B 1B64A 3GTYX 5F0WA 2NXUA 5DZ7A 3OL7A 1NKBA 5HP1A 4LSLA 2BE9B 2JLEA 2JH3A 4G1IA 4ZMMA 2GNKA 3KK3B 3V81B 4Z7CA 4HI1A 8AT1B 3TA1A 3LUYA 1P9QC 1NAQA 3MCOA 4A8FA 3I4HX 4O3QA 1R31A 3AXKA 5KFYA 5EN1A 2IM3A 1NB7A 2M3DA 2KDOA 2HFOA 2V2VA 2CRLA 4L72B 1J5EJ 3K5LA 1UMJA 3UN3A 5KT3A 1N34F 4PKDB 4FPIA 3EZ5A 3M30A 1UWBA 3M8WA 2QLFB 3LAMA 4YB1P 1YJ7A 3UVJA 1IBMF 3KJVA 5BR8J 1F60B 4F4AA 1TP7A 2X1BA 4NASA 5M2PA 1N54B 2BACA 3W2WB 2NUHA 3FBEA 3VGSA 4LFCJ 2HLTA 1RHRB 3HHLC 2UUWA 2RQMA 2MKSA 1U1PA 4QR1A 1FVSA 4KHPF 1RT1B 1VJWA 2POKA 3BGLA 3G82A 1AFJA 2XI2A 5EWGA 2APOA 3HVWA 2MXYA 2UUBF 2UXBJ 2YNHB 4I69A 1KSPA 3L3CA 1LW2B 3TI0A 2DHHA 5KG6A 3E3XA 3IA0A 2HFNA 3FDSA 1NSAA 4NMLA 4OV1A 2ZH9A 3EDQB 4ZVSB 1XMQF 2Y8WA 3GSIA 5KFMA 4WZMA 1X9WA 4QPXA 3R7SB 1DTTB 2HQDA 3BB5A 3MAAA 2VUGA 3MPDA 4PQAA 2LEPA 2GGPB 1PBAA 1NUEA 1WKKA 2CAJA 2W4DA 1OWXA 4NXMF 2IIHA 1R8CA 1AYEA 3QSIA 2A18A 1IKWB 5IQQA 5BR8F 3C3LA 4CLLA 3SCKE 1M5PC 3C14B 4KYZA 3FBBA 2RAQA 2EFPA 4DCJB 1RU2A 4OZNA 1YRXA 2VH7A 3V2UC 2ZH1A 2LCWA 1D9DA 5CAAA 2AIRB 3PX6A 1PSDA 5IM0A 4KKOA 1V3RA 2OPSA 1LFWA 2ZM6J 2KL8A 4QOTA 4ED3A 2N3OA 1EZZB 1GTHA 4F4WA 2IFXA 4IRCA 1NK7A 4B3RJ 4EUVA 1UP1A 2MQQA 3L9ZA 2C2EA 2HQFA 4NLWA 2N4CA 3THTA 1RI7A 3PYDA 1S1XB 4F25A 1ZM9A 3DOLA 4WP9A 3IRXA 2LQJA 2O5DA 4OZ3A 1RWOB 2LECA 1SV5B 5C25B 2BVZA 2GAGC 1YJRA 2CPJA 2HBQB 4CH7A 2GQ2A 3BR9A 3FVYA 3LGMA 4FNIA 5E33A 5EUHA 5K5MA 3UNGC 3Q8SB 3RRKA 2ZKUA 3W62A 3CJRA 5J1NA 1REVB 1TKTB 2A2DA 4DU8A 2XMAA 2D3OR 2P6TA 2CZ4A 2WVEA 3FNNA 1KFDA 2FHJD 4U8YA 4HT5A 5J2QB 1F5AA 1S9FA 1N56A 2IPOB 4K4XA 3ISZA 1HBNA 1TQLA 1RGVA 3F41A 4WP3A 2IM1A 1NDLA 1XNRJ 1VRQC 2L9NA 5HVHA 1PCAA 2YQ0A 2HRTA 4WFXA 1W7WA 4MT1A 4DV1J 1OY9A 4YS2A 3OTOF 4ELTA 4GO7X 5DLFA 3D3BJ 1P8GA 3GLJA 1XEZA 1Y3KA 1FRKA 1PC4A 2C3YA 3WX4A 4UOGA 1FKPB 2ZWOA 3FMWA 4Y2IA 1YTYA 5F8NA 1PG5B 3BZQA 3AQPA 1CJKA 1RWUA 4ZPDA 5DGBA 4B9VA 1FHTA 4NLRA 1T9WA 3CJ5A 4WZQA 2CQ0A 1OPIA 1T9UA 1VLYA 4CP5A 4OI4A 3ET6B 4JV0A 3MTKA 4RW8B 2IRXA 3I0RB 2ZH8A 1ZTWA 2X1GA 3TA2A 2C3UA 3ZNUA 2RE1A 3MR5A 3MR2A 1DHMA 2F8EX 2XZTB 1TL3A 1WSVA 2NPIA 3E01A 4CLZA 5CYQB 3H5SA 2GIRA 3CCVS 1S9EB 2XC9A 5FDLB 4JV2A 2FGCA 4XTTA 1FE4A 5EGYA 3MEEA 2ZBRA 2QL7B 3CJKB 4DQPA 4EZ9A 4A8SA 3R2CJ 4WE1A 2J6UA 4YOEA 1KR4A 3SMZA 4RWXA 4IOCQ 1XMQJ 1V9OA 1TMMA 2C2OB 1S72S 2WSEC 4ZN1A 5CZVA 1C1CA 1RHUB 1BUXA 2C1EB 4PXBA 4KT0C 3DOMB 1YRUA 2I1RA 1U7LA 4JV5J 4IQMA 1UFLA 2HQIA 2W2PP 3GFYA 1FE0A 3M7VA 2F40A 3DM2B 4ZLLA 2UVUA 4WJBA 1D8YA 3RB4A 4K4TA 1VQSA 5KT7A 3V81A 1FNMA 5KFVA 3NWGA 3TP2A 3HHDA 2RF2A 1BQNB 1JXVA 1S59A 2KFZA 4UOFA 1QUVA 2A2CA 2E5IA 2HK3A 2RDDA 3DRRB 4U96A 4DV5F 4C0HA 1PKUA 4J9NA 1G7CB 2OEMA 4OZ5A 1HBOB 1NK6A 2SXLA 2KT3A 3OR2A 1DFDA 1VQPS 2QV6A 1U1OA 1YX2A 2DNQA 1S1VA 1Y3JA 1O8BA 1S48A 3RBEA 1KNZA 1RT2A 1TFYA 2W8KA 2C22A 2VBXA 4NRUA 3GJQB 5JXSA 2VA3A 3QT5A 4I6WA 2F5GA 2HZAA 4K4WA 9RUBA 1UVLA 4LRDA 1FTCA 1Q5VA 1TU0B 2HFUA 4PWWA 4A8XA 1GAOA 2WAQD 3KKFA 1WOPA 4ZVTB 4CWBA 4DF4A 3DOKA 3ENVA 1NU4A 4I2QB 4MYTA 3DLHA 5E3RA 2HRYA 2ZJRQ 1CJVB 3M2RB 4W98A 3FCWA 2HHTA 2LP4A 4LF5J 2DISA 4LF4J 1URRA 4CLYA 4JV1A 2QZ8A 2DR7A 2VBWA 3PX4A 1WELA 3IN5A 5HQMA 1E6VA 2BRLA 4WK3A 1HHQA 1ACMB 4WKRA 2BUNA 2XNQA 3NBPA 2VL1A 1ZETA 3NEKA 5I3UB 2BANA 2QMXA 3HLUA 2EFGA 4QPTA 4NI2B 3KHRA 1Q95G 3K8WA 4Z2XA 1UL3A 1NK4A 1HPZA 4ILLA 4LF1A 2LA4A 2XG8A 3UN5A 2GA7A 3TVZA 4ES2A 5CA5A 4JI5F 2AJ1A 1JLQB 2BJ8A 3RAQA 2HFVA 2PA3A 3FCVA 3KHGA 3TVYA 2R2SA 1XWLA 4RW7B 2J76E 1GFWB 2AWZA 5H9EK 4UF4A 3DRPA 2RHQB 1LK7A 1RAEB 4IDKA 4O0NA 1YJWS 1NEEA 3QZ7A 4PXCA 1DTTA 1EQMA 2CFXA 3MAAB 4WPAA 2HVEA 2UZAA 1DQAA 2WW8A 3WHIA 3BQ0A 1UVMA 1SL2A 3V6JA 5IC4B 1VBXA 2UUAF 4JI3F 4ZVUB 1RJJA 4KQZA 4DQQA 3BPSP 4IG0A 4B3OB 4J7CA 2U2FA 8RUCA 1NDCA 3M9MB 4KHRA 1NHVA 2J9DE 4RJVA 1YI2S 4LF5F 2MJUA 1FX4A 3CD5A 2CQ3A 1UW4A 1P1LA 2ZVIA 4HH1A 3CDBA 2LQBA 1UFWA 1FKPA 1Q53A 4LF4F 2ROPA 3DLBA 4UT4A 1CJKB 3M2VB 2Q6CA 3EGZA 1YLXA 4R0JA 4TYBA 1NCLA 4F0KA 5AXNA 4EEYA 1HD1A 1ZM4A 1JB0C 1WKLA 3I32A 3QIPA 4BWMA 1SBRA 2F65A 4C8KA 2WOMA 1UTAA 5HROB 1LWEB 1ZPVA 5HATA 4LSLB 3EE3A 2PIIA 1DTQB 4JP8A 4OV6A 4DV2F 2E9TA 2UV8A 2G13A 3KLEB 4ECYA 2BOPA 4WXOA 1SV5A 4LIRA 5D4OA 5EX0A 5C25A 3W3SA 1ZZFA 3T6JA 3CCLS 4J9KA 3NG8A 2K7JA 1S9EA 1YVFA 3CW2C 2KM8C 4G1QA 5H9EJ 4JI3J 1N6QB 2M70A 1HW9A 3MMBA 1VQLS 1U09A 2A10A 2GCFA 5K9FA 3OW2R 1NH8A 3PW7A 3ILJA 4JI8J 1VR6A 2L9DA 3JSMB 3VAJA 2ASDA 3QQCD 1R8BA 1HBUA 3GR0A 5B0FA 4EWTA 2Y0BB 5JJBA 4DL4A 1N36J 3U1MA 2KTQA 4J9MA 3PR5B 2HRUA 4C8LA 1PJ7A 4RNMA 3HT0A 2EFVA 4X4RA 1WC4A 2BM0A 5E5NA 3T1YF 4LSNA 5DDPC 4A8YA 3PX0A 4G1PA 3PR4A 3MURP 3AY0A 3POTA 4ZVOB 3GV7B 4I68A 2H65B 4B3MF 3N79A 4P6QA 2YPYA 1QSLA 2FVPA 4N8NA 3OPKA 5DQIA 1X5PA 1IWGA 3K5PA 1FWLA 3Q0AA 1IM4A 3LQVA 1JXLA 4LR7A 1QE1B 1F2GA 3VAIA 1MN9A 4YMEA 2ZD1A 4DR6F 2B4UA 2DPIA 4OYBA 3PXGa 5D4LA 4ED5A 2H5IB 3UDEA 4ECXA 1RBLA 2HVHA 5KFUA 1TTHB 2YWWA 3N01A 2WSFC 3DI6A 5KFPA 2R8KA 7FD1A 2ZUGA 2F8HA 5ETOA 2DR8A 4DQSA 3SI8A 3IXQA 4EYHB 5AJ3F 3M6VA 1UVNA 2FJEB 3L09A 1N5SA 1FT8A 1SKUB 1G6BA 1VS3A 1HMVA 4WE1B 3MDFA 4JI4J 2L3MA 2CWKA 1PC5A 1JNZB 1REGX 2D9PA 4KGVB 5KT2A 3BO2A 4NYZA 4JI1J 3H4BA 3HO1A 5EWFA 2DNKA 3TJ8A 5K8MA 2RUGA 1FX2A 4WFNQ 3P6YC 2HHUA 3NS6A 1I94F 1VQ9S 1IUJA 3OUYB 1D1UA 1IBKF 3D66A 1QTMA 2R7TA 2RNEA 2H4YB 3BPDA 5ETVA 1VQ6S 2FHMA 1JLAB 3Q2TC 1L3KA 1U6BA 4OZLA 4QCLA 3K5NA 3DOLB 3OR1A 2IJNA 4DEZA 3WQPA 3PIOQ 2EFQA 3V6DA 4DJBA 3BM7A 4JI6J 5KT6A 1XN9A 2G0JA 3A8JA 2ZC4A 3TRGA 2CJAA 4AQYF 2YY3A 2M88A 2CWXA 4P2MA 4IFVA 1FKOA 4RBVA 3BO3A 3MM6B 4ZPWR 2IY5B 3EGVA 2IC3B 3MECA 3TUPA 2YKOA 3UNYA 5LOQA 4ZVRB 2Y8YA 2MB0B 1KLMB 3A4TA 3NCPA 3E01B 3UE2A 5IXUA 4B3TJ 3QRQA 2MZSA 2FYXA 2D41A 2N4DA 3R3TA 3W63A 2CPEA 1U47A 3RG6A 4EI2A 4I0WA 1Q1KA 5GAEI 4L6V3 3LF0A 2AHOB 1MLAA 4B3SJ 5AE2A 1CS4A 1FF2A 2Y1LB 2M4MA 2CPFA 2CXEA 2ZVSA 3AJ1A 3D28A 4ZPCA 3HSJA 2C3PA 2B43A 4ITSA 5BJRA 3V4IA 1VC0A 3WIUA 3DLGB 4G3IA 4X2BA 3KJNB 4RUCA 1JKHA 3UFCX 1VC6A 4EZ6A 1LEOA 2CJYB 1JLQA 4DSLA 2L41A 2EBEA 4BDPA 4LF9F 1RK8A 1HWLA 1EP4B 2DEJA 3J80Y 4NI2A 3QJLA 3G96A 3MI7X 2DGSA 4ENOA 3KXDA 1VQOS 2WB1D 2R9LA 1DBDA 1LWFA 2RU9A 5CABA 1XMOF 1T8EA 1R0BG 3T1YJ 1RCXB 1MMLA 2KJVA 1U0SA 4DUTA 2R8GA 1LQ9A 5E3CA 2E1CA 5AXLA 4QIGA 3MMBB 1XNQJ 2MYFA 3CPWR 2O3DA 3GIJA 1HBOA 2ZDOA 1RISA 2EG2A 3EZOA 4MFBB 2Z58B 3G86A 4NLOA 4PG4A 4USMA 2ZEJA 3CTRA 3H25A 4A46A 1B0TA 3SQGB 3N4WA 3FK4A 4OYWA 4I2PA 5HVFA 3HXMA 1B4SA 4PG5A 3PV8A 4KH1B 2KO1A 4UZBA 4CO0A 2P5VA 1K9MT 2V34A 1EAYC 1UWAA 1HYSA 1BXNA 2GHPA 2RQKA 5LMUJ 2EFOA 3QIPB 4U9RA 3U27A 1FRHA 2KHCA 1HHSA 4URGA 2HIYA 4ZLJA 3VVTA 2BR0A 1FK9B 2VODA 1SPBP 4G6VB 1NBEB 1X9SA 4CLUA 1Q4RA 3DMJA 2BYCA 2MTLA 2Z2YB 2AP6A 4LBPA 2RF2B 2CPYA 4UUXA 1TL5A 5F9NA 2BEFA 5D77A 3KLFB 4I7FB 2DH7A 2IAJA 2CPIA 5GADU 4ZP7A 2VC1A 1D3WA 3D54A 3C14A 3LPEA 4DUYF 1JWWA 1HPZB 4FBTA 1S10A 2DHXA 3UN2A 5DM6Q 2ZKTA 1H0HB 1O0PA 4HKQA 3PVXA 2IJFA 1X4DA 5LXRA 1XNQF 1TKXB 1VLOA 2B4PA 1I94J 3J80U 1VRUA 2VPYB 2Q6BA 2QLWA 3MUTP 4RW6B 1K0VA 1G4CA 3KG1A 4XK8C 1Z1ZA 1BWVA 2XBPA 3LANA 5LXYA 4ELUA 4R0EA 1CC7A 2IYGA 4JOUA 5DDRC 3HP6A 3IMQJ 4R25A 3FZ2A 3SYZA 1K8AT 1OS5A 3M05A 3DOKB 4IQXA 2A0FB 2IVFB 4Q2MA 1JJ2R 1SJ1A 2BE7D 2DT9A 5GADI 2RILA 3TUJC 1R89A 1HFEL 4CNZA 1M1HA 2XY6A 3RW7A 1L3TA 2BOAA 2CDQA 3L4BC 4LSNB 2XB2D 1X4GA 3IP0A 4YHHF 1G3OA 2QA2A 3C2PA 2PC6A 2UUAJ 1HWUA 4K4UA 3AXMA 1C4CA 3U1LA 4GMKA 2ZE2B 4P7VA 3KK3A 2R2UA 4PZVA 4RUHA 2JWNA 1T9TA 1ZTTA 4DR7F 5C24B 4J9LA 2M2BA 3NKYA 4QIEA 3W1YC 5AJ3J 3VAHA 1AXQA 1FXRA 3MPVA 2VOPA 2FDNA 3DKDA 4OYXA 5K14A 1IN0A 3ILOA 4XPCA 1RAAB 1ZAVA 3M8YA 2UXCJ 1Q8KA 1NPKA 3GFZA 2R8JA 1B7FA 2JJ4D 1XERA 1SL1A 1WG1A 2OSQA 3M2UB 2Y9HA 3TWZA 2HZCA 2Q79A 1HBMB 4LF9J 4RUAA 4XDCA 3PYEA 3DCAA 3LWLA 5HBMA 1KTQA 1RAGB 2PMWA 2QYGA 3O44A 3BSAA 3U02A 3VF0B 4LMZA 2KZMA 3AA9A 1VBKA 4Y28C 4OI1A 4EFAC 5IT4A 4LF7J 4X64F 2Z57B 4X4VA 1R6YA 4B3RF 4AL7A 2WONB 1P9YA 3O6QA 2DK2A
chains in the Genus database with same CATH topology
1KEKA 2FTRA 1BY9A 2DNLA 5CCLA 4ECSA 4DL3A 5J1PA 3G6VA 3I55S 5D3GB 5LL6d 2DO4A 2HGNA 3KK2B 1N0VC 1NJYA 2Z2MA 5A2QY 2OMLA 2DNPA 2JHEA 2ZHAA 2AQ4A 2CPXA 3D2WA 4QR0A 2OPPB 2XULA 4K5RA 3LGNA 5KFGA 3NLCA 2BDPA 3DLKB 1F9FA 2LMIA 1XR5A 1UA1A 3HVTA 1VK3A 4X4TA 3TUZC 1VQ5S 1RTHB 2LXIA 1MROA 3T6BA 4ZVHA 3MUMP 4I2PB 1S1UB 1VFJA 4ZK7M 4K0KF 2CQHA 4ZPVR 1UJ5A 4ZP6A 3PO5A 4RNFA 2N82B 4ZS6A 2HHVA 4R8UA 4F2SA 3H5UA 3JTNA 2UU9F 1DQ8A 3BS9A 5ADZA 3IG1B 4AL6A 2OH2A 4FZVA 5CYJA 4LIWA 3OTDA 3L7PA 4OX8A 5THWA 4O23A 4C3MA 3M8QA 3OHAA 4X4NA 1HNWF 1U2FA 2HNDA 5T14A 2W8LA 2B5JA 3JYTA 3G71S 1PO6A 1S0MA 4I7FA 2A3JA 2HYIB 3AHPA 5A8RA 2MKIA 4RU9A 1M1KT 4QU7A 2MKKA 4Q5VA 3Q8QB 2RS2A 1T3NA 5J2QA 3RW6A 1WHWA 2BXJA 4M95A 3V6DB 3CCJS 4F4YA 4NYOA 4PR6A 1UAWA 4FF1A 1FJEB 3QJJA 1VBYA 1QVFR 4N77A 3DYAB 4Y2CA 1C0TB 2MKHA 3HKZD 2BANB 2GQQA 1BGXT 1S1WA 1KLMA 3PW4A 4R5PA 1HNVB 4ALZA 1RDRA 2IHR1 2UV8G 5A8WB 5FLXY 4QWDA 1S6QA 2RRAA 3R5DA 2V0NA 3GWCA 2ZC3A 1NJZA 2FVQA 4NYPA 3MOJB 2YWFA 3N6LA 2ADBA 4OZ1A 4TQSA 2PGCA 2PN6A 3GMGA 2KZZA 4O4GA 5A6WA 2XY5A 3FGVA 1UVKA 2M52A 2HHXA 4DF8A 4B9UA 2N7CA 4KJIA 3WDOA 1APSA 4OI6A 1TV6A 4DV4F 3ISND 4DX8H 3CD6S 2H5EA 1XBWA 5H9FJ 5IT0A 3T5KA 3PW0A 3K5MA 3VZHA 4RU2A 3OVBA 2B4OA 1RYRA 3FJ2A 4IR9A 4NXMF 3ENQA 1B0PA 4H4MB 1N5YA 4PWDB 1SJQA 4RW4B 3OFFA 5JVHQ 4N41A 1DAXA 2UUTA 2NR0A 4JI6F 2F7VA 2HNYB 4H4KA 2C42A 4ZVFA 1QVGR 1CVJA 2PSZA 3J7Z5 3H59A 4PWUA 4C11B 5KOXA 2IMWP 4O3PA 1AUDA 1DURA 2MZTA 3DLEA 5G0RA 5KFBA 2R7VA 1FK9A 4WYLA 1UVIA 2ZBIA 2JEJA 1EP4A 3TNVA 2I8EA 1JNRB 2MZJA 3BGUA 4ICLA 2I5JB 4KGMA 1WF1A 2HS4A 4ECRA 1YJ9S 3M2UA 1MNEA 4NZ6A 2AGOA 1E6YA 2VZ9A 2C3OA 3IC1A 2MHEA 4Y2MA 2YX1A 5L1JA 1XC9A 3QJPA 1N88A 3J7YI 5B0EA 4N8OA 4OMFG 4IUFA 4UW2A 2KKHA 3PM9A 3POTB 3B8HA 3P3DA 2AX1A 5HL7Q 3M2RA 4Y2AA 1FDBA 4IO1A 3LAKA 1CC8A 2ZOMA 4DN0A 4U6PA 4TQRA 1RT4B 2ROGA 2IA0A 2HMIB 2YX7A 1T05B 2BW2A 4CCHA 2P9CA 2ACYA 3KLIB 2WBMA 2Y1IA 2I2YA 1IKVB 2CJQA 1NHUA 2ATLA 4BHQA 2IM0A 1FTRA 1KOHA 5BYRA 2XS2A 5AXKA 3I31A 2K3KA 4MK8A 2ILYA 5DG7A 4M8LA 4K2XA 3DDKA 2L48A 2ZITA 3LH2S 3N28A 5F0UA 4JI0F 4K4YA 2JVRA 1OIAA 1HQUB 3KK2A 2Q66A 1XMBA 2F3JA 1BWEA 2GQCA 2N3LA 4YR3A 1H7WA 2HWHA 5F8LA 1X4HA 4X4QA 2WRMA 3D1QA 2JOQA 4HTJA 2FLNA 4A48A 5KFNA 4AE5A 3HHNB 4JI8F 1UVJA 2IVMA 3HVTB 4HVZA 2J0XA 3PIPQ 3IWLA 2DHGA 1CQNA 1TUVA 3AA8A 1X8DA 2MJNA 3QAUA 3HM9A 2GGPA 3PJWA 2K3IA 3JAMY 2O67A 4TXSA 4C0BA 2OTLS 1H2UX 2LU1A 1TL4A 2RD5C 4X4UA 4YR0A 4DFJA 1HR0F 5A8RB 4IO9Q 2VKZG 3CDUA 2LLZA 2GJ2A 2HVIA 2YVSA 2B51A 2NREA 5F9LA 4GKJF 4LF7F 2V4QA 1B0VA 3MM7B 5F8JA 5E7OB 3DU6A 2QSFA 3I5BA 1TV6B 4UY85 4B9TA 4DR3F 3IAS9 4TY8A 1ULRA 5K14B 3BSNA 3JTPA 1KN6A 5KG0A 2MQOA 4RNNA 4PUOA 4TY9A 4WK1A 3VR1A 3I9ZA 2R2TA 4ZCLA 2HVZA 3RAMA 2CQ1A 1Y00A 2UVVA 5KFCA 1KTVA 4ED2A 3CMAS 3DLLQ 4IOBA 2DNNA 4XPEA 3GZ7A 1FJCA 1KHVA 2V8HA 3W2VB 1J5EF 3KG0A 1X0FA 5B08A 4ECWA 2DHAA 1GT8A 4OLOA 1H3DA 5F3TA 1L3UA 4DMZA 5HP1B 5J1EA 3UQSA 1H2VZ 2YKAA 1JJ4A 2DGWA 5D3GA 4ELVA 3QYYA 3H2VE 4OI2A 2HQ3A 1DRZA 2VFVA 2DGTA 4NLPA 2J5AA 2B7BB 3CE8A 2B9WA 3MEGA 2BABA 4AFFA 3FMBA 4ILMA 1QAXA 4J9QA 3N6MA 3TO8A 2COLA 4OJGA 2C2DA 3N5FA 4IG3B 3S6EA 1C1BA 2AJFE 2J9DA 2JFDA 3OXLA 3BF4A 1Q81T 1MMDA 3EPGA 3SSQA 1W2BR 4CO4A 3UCZP 2OKQA 3RTVA 4IG0B 1RT4A 4CH0S 1WEYA 2DGOA 3KLFA 1S76D 2AU0A 4KSEB 3IR6B 3HX9A 4U67Q 5HLFA 1NKCA 3AJ2A 3G4SS 2J6SA 1WHXA 1N0UA 3VZIA 4Y0FA 4O3NA 3GG0A 2LQ9A 3RB3A 4BCAA 4A47A 1X4FA 3O5TB 1DARA 4QYRA 2X51A 2CJ9A 2JSXA 2AYEA 3SCJE 3N9UC 1FDDA 2VG7A 3MPYA 1LFPA 3AH6A 3Q22A 2XY7A 2PMZD 4NPOA 3SEOA 1N4LA 3C66A 2HPUA 2YNIA 1BQMB 3D0GE 7FDRA 3HK2A 2RT3A 1C4AA 4I1TA 5LSOA 1H6KX 3HMJG 2D74B 1U1NA 2R7OA 4RZRA 3QLHA 4B3SF 3SDEA 3A8EA 4YB7A 1S4FA 4B08A 4H54A 4KAIA 2YWHA 5LJ5Y 2YNFB 2B56A 2D9OA 2X3GA 2YNHA 2HNYA 3RB0A 1EETB 5KFTA 1KVIA 2E29A 4DL2A 2ZHBA 3GYNA 1HQUA 2QA4S 2JEFA 2F9JA 2KM8B 3US5A 4U7CA 2HHHF 5GMKa 4M5DB 5GAHU 3GIKA 3I0SB 2XLKA 2E7XA 1NRKA 3HF5A 4FF3A 1QE1A 3H8YA 4KRWA 3TW0A 5KFZA 3JSRA 2ZJPQ 2QE5A 1SIWB 3DDNA 2MSTA 3K5OA 3FSYA 4Z37A 1Q8IA 2FC8A 4ZP8A 1JLEA 1J5OB 1CEZA 1MMNA 2KYXA 4QU6A 3M1VA 2W25A 2W9CA 2WHOA 2FD2A 4KO0B 2JX2A 2RU3A 4O3SA 1T03B 1RT5A 2DNRA 1S1TA 2V8VA 5J2NB 2V9KA 4CQ1A 2XMTA 4DBQA 5IFMA 2VQEF 1LV5A 4EU0A 4J9RA 4N47A 3T19A 5KFEA 4MJKA 5CHCB 1U1RA 4WFYA 1Z4UA 2CQPA 5J1EB 4ZCMA 1WG4A 1T05A 2AF6A 2CJBA 2WTFA 5CZXA 2Z0GA 4DFMA 4C8MA 3H20A 1HQEA 2CZVC 1DZ5A 2IAJB 1SXLA 4TY8B 5BYQA 2Y1JA 3NGKA 1FRJA 3OVAA 3KG4A 1YJUA 3BJYA 3THPA 2UXCF 5MLCV 1HBNB 4C4WA 2XSFA 2QMWA 3CDAA 3QGGA 5E2QA 2J9CA 1Y0HA 2RQCA 4H4OA 1Q82T 1K0TA 1YSJA 3O1LA 4ZHRA 4IH6A 4PUOB 4DSFA 3KLEA 1KQFB 5B0DA 4QW8A 1RT6B 3K59A 1R0AA 2FJVA 1Y9OA 2HNDB 1S0NA 4M94A 2NS1B 3M32A 2P9GA 5HMWA 1Q78A 4HEA9 2W7OA 3MD3A