4JI1F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji1F00
4X64F 2HHHF 1G7CB 2RJZA 1VMBA 4DR5F 4B3SF 4B3TF 2B7CB 4YY3F 4DR4F 5LMNF 4JI1F 2KJWA 2UUBF 4JI6F 1IBLF 2VQEF 1XMOF 1XMQF 2UXBF 1IBKF 2BXJA 4DV0F 4YHHF 3OTOF 4DV2F 1B64A 1RISA 1FKAF 4GKJF 1F60B 4JV5F 4LF6F 4K0KF 3R3TA 4NXMF 2E5LF 4B3MF 1IJEB 4DV7F 1HR0F 4DR2F 4DUZF 4LFAF 2B7BB 1FJGF 1CQMA 1XNQF 1CQNA 4KHPF 1N34F 4JI5F 3T1YF 1XNRF 4DUYF 4JI4F 4JI2F 4JI8F 4OX9F 4LF8F 1N33F 2ZM6F 4DV5F 4LF9F 5AJ3F 4X65F 1N36F 4LF5F 4X62F 2UUCF 4DV3F 2BVZA 4JI0F 1HNWF 1HNZF 2UXDF 2UUAF 4LFBF 4DV4F 2UU9F 2J5AA 4AQYF 4GKKF 1GH8A 1N32F 4JI3F 1I94F 2VQFF 1HNXF 4LFCF 4DR7F 4X66F 4DV6F 1G1XA 1QJHA 3T1HF 4DV1F 5IWAF 4LF4F 3ZZPA 4DR1F 4DR3F 4JYAF 5LMUF 1IBMF 4DR6F 4NXNF 2KJVA 5BR8F 4B3RF 1J5EF 4LF7F 2F4VF 2UXCF 2YY3A 4JI7F 1IJFB 1LOUA
chains in the Genus database with same CATH superfamily
4C9DA 1NPRA 2JX2A 1KP6A 2O1PA 2QL5B 3H98A 3IP0A 3R7NB 3W62A 3ZTSA 4NYOA 1SIZA 2KXHA 2MMYA 4CYUB 1BWVA 4AQYJ 4QU7A 2PN6A 3F0NA 2CDRB 3ZZTA 2V4RA 2LYVA 2RIJA 1U7LA 4WTYA 2R7WA 2BJ9A 4YB1P 2HWTA 1K73T 2V2ZA 2R7UA 2C2DA 2CQ2A 2GFFA 3NS5A 5GVQA 3ADAC 5J2QB 1T9WA 3BGRB 4OYAA 1RAOA 2B9WA 4P7VA 5EX3A 1XMQF 3NNHA 2Y8WA 3CMAS 4ZLJA 1R6VA 5AE1A 5KT3A 1HW9A 1HKAA 2OEMA 3GYNA 3NGUA 3OTOF 2KM8B 4OZ5A 1X4CA 5LOQA 5K14A 2EG1A 2FUG9 4I6AA 4Q2LA 2RU3A 2XMMA 3TAMA 1FJGJ 3R8YA 1TAUA 5G0RA 2CA9A 3TVYA 4C97A 2YNIA 5GAGI 2YWWA 4FZVA 2DXDA 1VHIA 3HHLD 2YQ0A 3EZUA 4Y34A 1K0VA 5G4DA 4MKVA 1YG0A 4F36A 4NEZA 3EJMA 4DV7F 1RLDA 1Y5NB 4LF8J 1WDDA 3UDCA 2KT2A 3IM8A 1QTMA 1V3ZA 1SC3B 2ALYB 3NGSA 3RU0A 2XS7A 1N5TA 1OQ6A 2VU5A 1RSCA 3GJSB 3PDNA 4IFVB 3SDEA 1TMJA 3G71S 1VC6A 5G0RB 4DV6J 2PI5A 3I5BA 3T5LA 1CC8A 2HRTA 4M5NA 1EKSA 1LXJA 3RW7A 2FJEB 1KDNA 4JI8F 2EKNA 5I42B 3PO4A 4XDDA 4DQIA 1MWYA 1TKDA 1SH2A 1X4FA 3BGRA 4WFBQ 4Q5VA 2ZBRA 1TQLA 1IQTA 4DFMA 4GVBA 4ZLPA 1VLOA 2DB1A 1T02A 3BSNA 2JZ5A 2W01A 4LFCF 2ROEA 4UW2A 1U2CA 5KFHA 1U6ZA 1U1NA 3LPYA 4PXBA 4ZKAA 4GO5X 3R5AA 3IG1B 1UVLA 2LEAA 1RT6B 4ED0A 4JI0F 2YWEA 4ES1A 1UPPA 2DPIA 4C11A 3MPVA 1TKTA 2OLWA 3ILIA 5E7OB 1NJWA 2ACYA 1S6PA 2KT5A 1WHYA 4NA1A 2QMWA 2DEIA 5J1NA 4WYLA 2AX0A 4LFBF 2WCXA 2GIQA 2YKNB 3M32A 4MAKA 4ZPCA 4PWDA 2NR0A 2A18A 3LF0A 2C42A 3R6GB 5M2PA 4JI3F 2WOMA 1QAYA 5AXKA 4M5HA 3ZC4A 1TV6A 4DLEA 4X66F 1TUWA 2A6OA 3N4WA 3M9NB 1X60A 2N7YA 5KFIA 8AT1B 1Q8LA 1UKUA 1W7WA 1Y00A 1U0HA 2MZTA 1UJ6A 1AYEA 3HULA 2KU7A 3ZZPA 1MG7A 1TAQA 3RYLA 2F8EX 2IBOA 4GMKA 4DF8A 2BW2A 1YLXA 5H9FJ 5EHHA 3KK3B 3BR9A 3UO0A 4JI8J 2AEMA 1N88A 3K17A 1N54B 4OI3A 3KK2A 4FXVA 4QR1A 4FPRA 2ZH3A 1JLEA 4UF4A 1RGVA 2WW8A 4J9VA 5KFEA 2R2SA 1M1HA 1HBUA 1ULRA 2UXCJ 3MM6A 4HT7A 3M2RA 1G4CA 2HFSA 3NCPA 1MU2A 2HRUA 3D0GE 2HQGA 1OPIA 2MY7A 1MU2B 1KLMB 1ZPWX 2RQKA 4QR0A 2BDPA 3M2RB 2AX1A 1XMBA 2AGPA 4X4VA 2DRDA 2NZCA 2FLPA 4FF4A 2RVJA 5HQMA 4QPTA 5LMUJ 2F5GA 2C22A 1JLEB 3GLJA 1LOUA 5I4MA 2ZNZA 4USKA 5E2QA 2CJ9A 4F4YA 3C16A 5K8OA 4MKYA 1D0EA 4JI2J 1EIYB 1LWCA 4ZP7A 4F4ZA 3EGZA 1G7CB 4CNYA 2BJEA 2L9DA 1HPZA 4RW8B 4ECWA 4EUVA 1ZM2A 4LUBA 3UI3A 2WVCA 3VWSA 4C8KA 3ZXWA 1NZAA 1P9QC 1AXQA 4DS5A 1ZTWA 1VBZA 1S48A 1LWXA 2J0QD 4DR4F 3R1LA 2NPIA 2CJQA 4PABA 3OVSA 1DTQB 4XPCA 2RS8A 3I0RB 4RW6B 4C7QA 3KHRA 3H4DA 4Q8FA 2RRNA 3UW1A 2FVSA 3BH6B 4DEZA 2Q6CA 3DI6A 3H7HB 5KG6A 3UNGC 4B02A 1N48A 1S9GB 3Q2SC 3W7BA 2YX7A 4CDIA 2GS8A 1N5YA 5E5NA 5D0HA 2W7PA 2BABA 1HBNA 2GMHA 5DGAA 2HHXA 1EHWA 5F0UA 3U1MA 1TKTB 4URQU 1GX6A 4N77A 1U25A 4HL9A 3MEEA 4TY8B 4DMZA 3D0IE 3IFEA 1GMWD 4NMLA 1HR0F 1E6YB 5CZXA 5DG8A 2AP6A 1QVFR 1IWGA 1UWBB 1Q8IA 1X5PA 5F3ZA 4EGLA 2XSJA 3FDSA 4NRUA 4ZPDA 3CCUS 4ICLB 3PEHA 2OD4A 2UUWA 2MKKA 1FWPA 3MTKA 3TQ1A 3PHEA 1TK5A 2F8HA 1DFDA 4DCPB 4TU9A 2FYXA 4U9RA 2OP5A 4WFXA 1PAUB 3AT1B 3IR6B 4O3QA 2D9OA 3TA1A 4AXIA 4YOEA 2HHPA 2V34A 2CZVC 2XWXA 4Q43A 2Y1IA 2YWGA 1GMUA 4MIAA 1EP4A 1M5VC 3B54A 3LANA 5HLFA 5HVFA 4OX9F 4F26A 4C0HA 4DV5F 1D8YA 3BN4A 4UZCA 4F4WA 4UY8T 1MWQA 1TU0B 2P6TA 2EBGA 5KFJA 2OKQA 3CDBA 2CQ4A 1SKRA 2CJBA 2AJFE 1JLFA 2C1EB 1CG2A 3FUYA 2BBEA 2C2KB 3QSIA 3EVMA 4DDFA 3SSRA 4X4OA 2G4BA 4KHPJ 1DQAA 2D3ZA 3AHPA 3M30A 3QFWA 4PG4A 3SSSA 2ZITA 4EFAC 4KFBB 1WG4A 1PBAA 4Y2KA 4N41A 4V19X 5IQ6A 2RS2A 5D15A 2IJRA 4LF1A 2RDDA 3KJFB 4NXMJ 4ZVGA 4H4MB 1KTQA 4WIQA 3MOJB 4AFFA 1RAFB 5T41A 1P9YA 3HVWA 4PYDA 2V4JA 3KUEA 4USHA 2GVDB 5H1SV 3BB5A 2OH2A 1DJ0A 3U27A 1M5OC 3KHGA 1SIWB 1Q53A 1TZ0A 2FHKA 1RT7A 2DGQA 4I2PB 4CTAB 3PR4A 4B9NA 3GONA 3PYEA 3ENVA 4DQPA 4M5JA 5IWAF 1N34J 2VOPA 4AL5A 2N82B 3ENQA 2Q79A 3ILOA 3KG0A 3MZIA 1R8CA 4MK7A 4OZ3A 2KG0A 1CVJA 5C25A 1G6BA 2NXEA 4S0MA 4PPDA 4PYAA 4FKYA 4DR6J 2YNFB 1AA1B 4RX6A 3M7VA 4LSNB 3GYGA 3UNYA 2J6SA 1FEEA 4N8NA 4ANDA 2I6WA 3BPSP 2HHQA 2DVIA 1NSAA 1N8RT 4YS2A 5KFXA 3VZIA 1CJVA 1T9XA 3FRZA 3KDNA 3QAEA 4IG3B 5F8JA 5CYMB 3HHDA 4NZ0A 3P6YC 1FCAA 2GA7A 2H9ZA 3G82B 1J2VA 5J1EB 3KLVA 3KJQB 4H4MA 2MLYA 2V2KA 2V2VA 5D4PA 2F4FA 3AQPA 3TOQA 2GMLA 3SCJE 4DUTA 2ZBPA 3PRDA 4F7VA 5EX0A 3W2WA 1C0TA 5KFVA 4K4YA 1VQLS 2LCWA 5D78A 4ED8A 2DY9A 2C3YA 2FLNA 2LQJA 5F41A 5DDQC 2MQPA 1S76D 2Y0SD 3WIVA 2GO9A 4Y6IA 1VMBA 3N6MA 4B3SF 5A8WB 2F4VJ 2B4OA 4IR9A 4ZCIA 4NLYA 4DQQA 2XMUA 3IC1A 4I1TA 4G1PA 4DU7A 1SJRA 3K0JA 1X0PA 5DLGA 1VHFA 2CQHA 3R5JB 1XMOF 1EP4B 1C4CA 5B0FA 4UQTA 3TUZC 4U67Q 2JLEA 4LJMA 4NYZA 4R0JA 4YHHF 4OJHA 4X4SA 4B9LA 1NDCA 3MM9A 3M2VB 1S4FA 4ECSA 3D1OA 1SJ3P 2A3JA 3MEGB 4Z7YA 2X51A 2R7XA 1H2VZ 5KG2A 4GKJF 4JV5F 2ADBA 3KG4A 3N9UC 1HA1A 4ATNA 1X5OA 3C46A 2Z2MA 2C3PA 1EJ7L 1U6FA 2YKQA 2HNDA 2R3VA 2ZOGA 3B4MA 4I2QA 1Q1KA 2OFGX 4Z37A 3KK1B 1ZH5A 3A3PB 4NLOA 2WSCC 4YMEA 2MGZA 5B0GA 1TKXA 4EO6A 4OHVA 4O4GB 1UA1A 4TY8A 3PJ9A 4ECXA 2QE5A 5HVHA 2BJ7A 2BZ2A 1DZ5A 3MMAB 3PM9A 3C15B 4TQRA 3HCXA 3S6EA 2CNKB 2XI3A 4XDCA 4C98A 4QW9A 3DYAA 3GYXB 1L3KA 2Z57B 1REGX 2M3DA 3WC0A 4PAAA 2U2FA 3DI6B 5EUHA 1FKOA 1GFWB 1YWXA 4ECYA 4L6V3 4Y0FA 1HLWA 2W24A 4BLGA 1N5QA 2JEGA 3VR1A 5L1IA 3OTBA 1NNDA 4DR3J 3OSPA 1C1CA 4LSNA 4MK8A 1N6QA 2A2CA 2BJ1A 4IYQA 4OZ1A 3TEHB 2RF2B 4DPTA 3C15A 2UXBJ 2BMBA 3A3NB 3MMAA 3U1LA 2WTFA 3DLBA 1VCTA 2FQQB 2RH3A 1WACA 1XMOJ 1N0UA 5JVHQ 3SMZA 1ZAXA 2B4UA 2J8SA 1U09A 4UT4A 4YHHJ 4R8UA 2EFPA 2SXLA 1TVRA 3VF0B 3SQGA 4MYUA 4XIUA 2CPJA 2B9YA 4ZPVR 1WKKA 3BKUA 3BYPA 3MDFA 3R5GA 2ZC3A 3BKTA 1YHQS 1RABB 3M2VA 3L7PA 4U7UD 4AE5A 3DRXA 1WI6A 1MWZA 4KO0B 1DLOA 2WONB 1K1QA 1Q79A 2OPSB 3EZOA 1VC0A 1PG5B 1YKWA 3LA0A 4X84A 5KFZA 4X4QA 1YJRA 4MT1A 5B0CA 2GAHC 3R97A 2QRRA 2DIVA 4NA3A 2W9CB 4NLGA 2BKPA 2YX1A 5KG1A 4C8OA 1RWVB 1RHRB 2FHJA 1FTRA 2ZM6J 1CPZA 5DJBA 5GMEA 2V63A 4TXSA 3QT8A 2K1RA 1OWXA 2QLFB 1KOOA 4E8UA 2QEXS 5KFSA 3DLLQ 3TJAA 3UCZP 1TKZA 1BGXT 1U1QA 1JLAA 4KGVB 3OL9A 2MPUA 1WOSA 3Q0AA 2JDJA 3SQGB 1F3FA 1RP5A 2IC3B 3HZGA 1OQ3A 3GCWP 3M8ZA 3W9IA 3NAHA 2NCKL 2BKNA 2BEFA 3EVOA 4ALZA 1IBMF 3MCOA 1VQ6S 1DBDA 1RAGB 5BR8F 1M5PC 1S6PB 5F9LA 5KG5A 3W8PA 1FX2A 4ITSA 2LU2A 2NPFA 2R9LA 5IT0A 4DFKA 3P4UB 4JV0A 4HTJA 4DR5J 3D4JA 2I2YA 3H42A 2CPHA 2KVIA 2G13A 2XLIA 1HNWJ 1GTEA 4KR0B 3TANA 1YJWS 4NLRA 3R6LB 4EBEA 2BQRA 5E41A 2UP1A 4JV2A 3KKFA 1HMVB 3RB6A 4K4SA 4KGZB 4DLGA 1NJYA 3W60A 3TWZA 1BUXA 2CXEA 2DNZA 3PX6A 1FDNA 4M1KA 3A12A 2VHGA 4J9RA 1X9WA 4IO1A 5ETLA 4DX8H 3RAQA 5HBMA 1NZ8A 1SQEA 2OELA 3DXBA 3RB3A 1L3UA 4GVBB 2JSXA 3CJTA 3L9ZA 1IKVA 1RYRA 2KJWA 5BYQA 4LMZA 4I2PA 1Q95G 4CTAA 2Y1RI 2RMLA 2W7AA 2AT1B 2QG9B 4WYWA 4RW9B 3BO4A 1CSJA 2AD9A 4ELTA 1PYSB 1FESA 2V8PA 4C3MA 4BDPA 3K5PA 4RU9A 1RU2A 5F3TA 2GVDA 1X5TA 3BR8A 1YBUA 4CLYA 2OPPB 3FSIA 3T5HA 3BM7A 1VRUA 2UUBJ 5HP1A 3KLGA 3M8QA 8RUCA 4ID5B 4UY85 3Q8YA 2FIUA 1SH0A 2CPYA 2MTLA 4KFBA 2B9EA 3DU5A 1VIXA 4RUCA 2H5EA 2R7RA 5ETMA 1FNXH 3CSKA 1Q7YT 3IGNA 1WKLA 2HPUA 2QL9B 4E2FB 2MY8A 3LGHA 5THWA 2EFVA 3PHTA 3BGFA 3OXGA 2YNIB 5IFMA 1XWLA 1JNRB 4X64J 1FE0A 3IR5B 2CG4A 2XMVA 4J9QA 1ZZFA 3UDLA 2C2ZB 5B0BA 2MSSA 1QLNA 3ICLA 4KPCA 4H4KA 3Q23A 5AJ3F 4DSFA 4M5KA 1WHWA 1SXLA 4X65F 1JNZB 4QIFA 3OTDA 4I6YA 2O3DA 4F3MA 4X62F 2ASJA 4GVLA 3GR0A 1FVQA 1ZBTA 2DO0A 3S7RA 4F3QA 2HNYA 4ANEA 2YKMB 3M6WA 2CIMA 1Q5YA 2WW4A 4UOGA 5D77A 5HROB 4HHJA 1I6JA 2A2DA 4LRDA 3C6TA 3K8VA 2PT0A 3ZZZA 2K2PA 4ZJLA 4M95A 1FDBA 3GG1A 1JLBA 4NL5A 2F63A 2NXNA 3OLBA 1IN0A 3ET6B 1FE4A 3FFIA 3CJKA 1CS4B 2XMTA 4WFAQ 4KHMA 4G1QB 2CVEA 3W9HA 4FYDA 5C25B 1O8BA 4ZVHA 1HNVB 2VQFF 2LA6A 2C2MB 5KT5A 1WTBA 3FZ2A 1VQ8S 3MM5B 2A0FB 4DSKA 1NHUA 1NK0A 4A8KA 2X3GA 4FP9A 4W90B 4CLPA 3GJRB 3L09A 4LQ9A 4QR2A 2R2UA 2B8QA 2Z2YB 2L9NA 2BM1A 2HGNA 3DGPB 1KN6A 2LDIA 4DR1F 3BGUA 4LRBA 4USWA 2HQ3A 4GC7A 1X0FA 2HHSA 1PO6A 1LWCB 2GAGC 2V4JB 1H0HB 5CXTA 2AYBA 3HSZA 4IRCA 2DBBA 2R2RA 2W25A 2OSRA 4LF9J 2QMUB 3HF5A 4OV6A 5HMYA 4ECVA 1WNEA 1KQFB 2DGWA 3TQEA 1RKJA 3F56A 1P1LA 4E0DA 4URGA 3GFHA 3EVWA 4P2XA 1ZOTA 4HH1A 5KFOA 2E1CA 5DGBA 5CH7B 2YNHB 3UD5A 2IM2A 1U1KA 3ZZ0A 2VONA 3D54A 4J7CA 4DV3J 1Q82T 1JLFB 3MM6B 4ECUA 1WC5A 1GMVA 2YQ3A 3K5MA 4LF7F 3OPKA 2ZKUA 4RW7A 2R7QA 1AW0A 3JTOA 1ZPVA 4LIWA 5GADI 1KR4A 1VBKA 2KL8A 1U6BA 2JEJA 4WWSA 3MXHP 1HFEL 2LKZA 4K2JA 2V67A 1RHUB 5F8MA 5D4LA 2F9DA 4TU8A 4J9SA 4OYOA 4DL7A 4AUKA 2KYZA 1HWKA 3HFZB 1RKIA 1TL3B 4CO5A 4XPEA 4C6AA 2V68A 3GPAA 4YY3F 3Q22A 4IUFA 1Q86T 4CNZA 1S59A 2VL1A 1HR0J 1IBLF 3KDOA 2BACA 4X4TA 3HFKA 2HNZB 1U49A 1P8GA 3AA8A 2FVRA 3AXKA 3LW5C 4M5LA 5I3PA 1S10A 4TLRA 3D28A 1S0VA 4O44A 5AXMA 5LJ5Y 4R5PA 3E2EA 5KFGA 1B64A 3NGRA 1QE1A 3MOZA 5KT6A 4F2SA 3QYYA 4F0KA 3R3TA 4K0KF 3CJ4A 4Q0BA 4USUA 4CLKA 2R4FA 3JQKA 4DR2F 1QSLA 1N5YB 3GMGA 3CUNA 4OYMA 2MQOA 4K7QA 4GRSA 1GQEA 1S77D 2PEHA 2VUGA 4FS2A 2LMIA 2CPXA 4ZVTB 2GVZA 3ZNJ1 1LXNA 1D3WA 2HNZA 2XY6A 4J5OA 1UA0A 4RW6A 3C8YA 1H72C 2EFGA 5ETVA 2J7KA 3FZBA 1TL3A 4OI2A 4CRJA 1U1LA 1NDPA 3QSYB 2EK6A 5L46A 2YNGB 4DUYF 2DGSA 1UEKA 1HPZB 2BJ8A 3FRYA 4LRCA 4F50A 3LWLA 3TJ8A 2ZH5A 3WZ0A 3KLHB 3J7YI 3J81Y 1HWLA 5HJYA 3FMWA 3TNVA 1TFWA 1FA0A 3CW2C 1UP1A 3IAS9 4IOBA 5C42B 2CZ4A 3TYTA 3VGVA 2Z30B 3SDEB 2ZHAA 3C14A 3CCTA 1XMQJ 2YNHA 1I51B 4IFYB 3TA0A 3QPIA 3BYRA 4DBQA 4ECQA 4PXDA 3ILLA 1QAJA 2DXFA 2MQNA 3JQJA 4ZPTR 4KYZA 4YN3B 3HP6A 5J2MA 3W9JA 2ATLA 3TR5A 1X4EA 1UEUA 2BJ3A 1NK7A 5AE3A 4ED2A 2DNHA 2WK4A 4ETXA 4KPYA 1IBCB 4OJGA 3RBZA 4ED6A 2AW0A 1RT1A 1S1TA 2J5AA 3H2UB 3ZFVA 2WSEC 1CJUB 2X7IA 1T7PA 1KWMA 1GH8A 4CH7A 2FJDB 1V3RA 5DRKA 2AJQA 2M70A 5CYQA 2HHHJ 2I9SA 3M8PA 4C8MA 2H65B 4OJ3A 3QWUA 3TVKA 3EXYA 2JFKA 2VKZG 4P73A 1URRA 1U0HB 2IFXA 4Z7CA 4DSIA 2K3KA 2CPDA 2P2CB 3I31A 4DV1F 4LFAF 2M88A 4BWMA 4N7TA 1UVJA 2RHSB 1UFWA 3ZTOA 2X1FA 1LK7A 1FRXA 3G2XA 4CYUA 4RPFA 3VHQA 1MSWD 4LR7A 2E1PA 1KVIA 2ZVIA 5BR8J 1MMNA 2VG5B 3ONQA 4NLWA 4PEOA 4RWXA 5I3QA 3GJTB 2QL7B 5J2NA 3SI8A 3FFIB 3AQOA 3A1YG 2XMKA 3G6ES 4PG6A 3DKDA 1C4AA 1VYAA 4BBYA 5EWFA 4ECZA 3DCAA 3DRPA 2XCAA 3BQ2A 1OJ4A 3C6TB 3N79A 3HVTB 2FB0A 2EXUA 2DYAA 5A8RA 1H7WA 2ZDPA 4KE5A 3IN5A 3MMBA 3D1QA 4J91A 3EX7B 4JYAJ 1WKJA 3LGNA 4I68A 4TYBA 2HNYB 2V6AA 2JNJA 5KFYA 3S1TA 3OXLA 3RB0A 1HWIA 1IKWA 2E7VA 4KY3A 4K4XA 2JJ4D 4JI0J 1N5SA 2B5JB 2CRLA 4BHQA 2PI4A 3MPYA 4IG0B 3NKYA 4USJC 4YFUA 1QVGR 2MKYA 5F8LA 3RBEA 2N3OA 1VK8A 3DLHA 1KFDA 3R7BB 1JLGB 4X66J 2Y0BB 1WC1A 3JTPA 4LR8A 3DFEA 3LALA 4O3RA 4CIOA 5A6PA 4DG1B 2XY5A 4JI3J 2M7SA 2R42A 4HACB 3DM2A 3ITHB 5LM7E 4U6PA 1UVMA 3A8KA 3Q2TC 1FKPB 4N5SA 4ZVQB 2QA1A 1RT5B 3J80Y 1TR0A 2UUBF 4JI1F 4IFVA 3GZ7A 2EK1A 1DHMA 1VBXA 4ID8A 2W2MP 3OTCA 5K8MA 3J7ZT 1RCOB 3H5YA 2CNNB 2MEWA 3NP5A 3PRVA 4ZOSA 5DDPC 2D9PA 4Q8EA 5IQQA 1XR6A 4QIGA 4RNNA 3NNCA 1V5VA 4BCAA 2Z2ZA 2W2QP 4DSLA 4OHYA 2OSQA 1C2PA 1S12A 4P74A 1VOMA 2RQMA 3TZXA 3KLGB 3PIOQ 5ETQA 4DV0J 5HP1B 1MW7A 5ETTA 4A8FA 1SKSA 3TAMB 4G3IA 1K0TA 3V4IA 4Y00A 5K14B 2IYGA 3I4HX 3MECA 2NXJA 1X4GA 2GHVC 2UZAA 3GU0A 3HDSA 3EZ5A 4F2RA 1S6QA 2XZTB 4HLBA 3U02A 3TRGA 4A47A 4ZHRA 5KG7A 2BQUA 3PFEA 2BOPA 3TZZA 1JKHA 2DH7A 1Y0HA 5J2QA 2RRAA 4NLUA 2AJ0A 4H4OB 1H3DA 4X65J 1JJCB 4O3SA 1EB0A 5KT4A 4U96A 5HBMB 1C1BB 5E3RA 2DTJA 1UW9A 5SUHA 4JI2F 2N3LA 1XIQA 2D74B 2IRUA 1T9TA 1N33F 2LDYA 2O66A 4J9KA 4CP5A 2FHOB 2VBXA 2MXYA 2K8GA 2PA8D 1HARA 4IO9Q 4P7TA 1X9SA 3D3CJ 5IM0B 3CDEA 4LF5F 1NM2A 3OBIA 3PG9A 2HBYB 2O5DA 1KVJA 2QSFA 4J90A 4MMOA 2LXFA 3RB4A 5CZVA 4FYVB 4JI5J 3D7SB 1RT3B 2FZKB 1WHXA 5I3UB 2BVZA 3DRRA 1SJ4P 4NPOA 3T1AA 3FEZA 2VQFJ 1GEHA 4J9LA 2MB0B 1HNZF 1R3NA 2QA2A 2UXDF 1ACMB 4PRFA 5AXLA 2AQ4A 3EGNA 5CABA 1ZS6A 4ZP8A 3CJRA 2OPRB 1FJEB 3D67A 2L3MA 1K1SA 1LWFA 2HZCA 2OPQB 4P2MA 2VV5A 3HXMA 3DNCA 4UOHA 1BD6A 4DPUA 1NH8A 2DNNA 2F3JA 2PDAA 2K7KA 3H2VE 4KH0B 4PWWA 3VCDA 1WDTA 4DR1J 2CNOB 1NK9A 5L9XA 4IRKA 2ROGA 4FYWB 1SKUB 2HYIB 2VH7A 3KHHA 2VPXB 3RRHA 3T9ZA 3FMBA 3CCQS 3PW7A 2DNMA 4FXDA 5KFRA 4FF3A 1RTDA 3DOMA 4KO0A 2ZH7A 3ZZUA 3LO3A 4KSEB 1RYSA 2FY1A 2DR7A 4CO4A 3ISNC 3T1HJ 1R0AA 1WG1A 2QFJA 3QRPA 4A8WA 4WXOA 2UV8G 2DGVA 4LSLB 4OX8A 2J7WA 3TAQA 4C48A 2BA9A 1HHQA 4X4PA 4LF5J 3W1YC 2AJ1A 4USIA 1VQ7S 1X31C 3BQ0A 1Q0NA 1RXOB 2J0XA 4ZP6A 4QWEA 2BQ3A 4N56A 1D09B 3BDPA 3QMQA 3R7SB 1WG5A 4K50A 2RKIA 5ETPA 2IMOA 3OR1B 4GKKJ 3CD5A 2MZ1A 5D0RA 3JAMY 2W9AA 4NLPA 1U47A 4O3NA 2HBQB 3PRBA 3NBPB 2E1RA 4RU2A 1Y4ZB 3AD7C 5MAOA 2PMWA 1H38A 2MZJA 1AB8A 2ILYA 3N5FA 4DI6A 1FHTA 4WKYA 3KLEA 1J5OA 2EPIA 2BR0A 3TEGA 1Y5IB 4F67A 1NSKL 3IS9B 1APSA 2AIRB 2E66A 1XERA 4JI6F 5IXUA 4PR6A 3V4MA 2KT3A 5L38A 2IYIA 2HAIA 1VQ5S 2XCPA 1VISA 2HG4A 4CLLA 4O4GA 5L39A 4YR3A 2DR9A 1R27B 1RI7A 1TKXB 3CTRA 3FGVA 3W2VA 4OI1A 4AYBD 1O51A 3PKYA 4DV2F 1S5ZA 1N5VA 3BZQA 1CJTA 2ZE2A 4ZCMA 3R2CJ 2BE2B 2XNQA 2N4CA 3V81B 5CYJA 1KKHA 2JFDA 3G86A 4ZVEA 2Q66A 4ERDA 4WK1A 1JLQB 3V6DB 3MEGA 3NOGA 2I5JA 1B0TA 3D9BA 2BRKA 3AAWB 4JBCA 3W64A 1BLUA 4UQGA 3MM9B 1QAIA 4DUZF 2IY5B 2FC8A 3HVAA 2RSQA 5AJ3J 2VD3A 3E8OA 2H48B 4DOZA 2N7CA 4QWAA 2AZ1A 2JL9A 2DO4A 4P75A 1U45A 5DQGA 4PQAA 2UUCJ 3SCIE 6FD1A 1LWEA 4NASA 1D1UA 3FK4A 2GV1A 3MR5A 3KMQA 2GHWA 1U8SA 3ETOA 1SJ1A 1JMTA 3K5NA 4NLXA 2NSBA 2B6AA 2AEFA 3FJ2A 4UUWA 4QWCA 3MGJA 4USTA 4F0MA 1VDHA 2COLA 3VQTA 4ZN3A 2KYXA 1VC5A 4E98A 4FXWA 5LXYA 1HQEB 1HQEA 4CI0B 2D3UA 4OV1A 3Q8SB 3M4XA 3Q86A 1UFKA 2ZNYA 1CULA 1QUVA 4KB7A 3V6JA 1TK0A 2I8EA 5L1KA 2AMCB 4A46A 4Z2XA 5MLCV 4CH1A 3BN7A 3G82A 2XG8A 3QFHA 5EDWA 3VAJA 2ZBCA 1ZYQA 1IKYB 1BWEA 3I56S 3AOBA 1CJVB 2OUGA 3UN2A 5JJBA 2YH0A 4ZIVA 2V0NA 3CWJA 2LU1A 4OZJA 1T3OA 4B3RJ 9RUBA 3GFXA 3D6TB 1FERA 2XI2A 1RUSA 2E29A 3CCRS 3TUPA 3TX8A 3CEDA 1NCLA 1UMJA 1VJQA 1WSVA 1DARA 2KO1A 2QA4G 1I94F 1HNXF 1VIOA 2W7OA 2OTLS 1BQNA 1JLQA 1RU1A 2FPHX 4NLSA 4RUBA 1VRTB 4QIWD 4W98A 3WQPA 3K5OA 1U48A 2CJAA 1YJ9S 5J1PA 4FDFA 3V81A 3RRGA 2WRMA 4NLDA 2VC0A 4OZ2A 1G1XA 1ITPA 1PILA 1RWWB 4H4KC 2XLJA 1RT4A 1JJ4A 1DY3A 4LIRA 4J9MA 2I1RA 4P2FA 3OD2A 1HI8A 3QJPA 2CG8A 1V6HA 5L1LA 1Z1ZA 3JTNA 1EX8A 2H51B 1RHQB 4DR3F 2DHSA 1TL1B 3ISZA 2PA3A 3FQLA 1KQKA 4JYAF 3BPDA 2B0GA 5DDOC 3BH7B 5RUBA 3KLEB 3THTA 2GMJA 1OY8A 2HWHA 2ZZNA 2M8HA 1UZHA 3G87A 5LMUF 4KKOA 1S1WA 3PTWA 2DNYA 3TUJC 3GILA 3M30B 2UVUA 3NBPA 2PMHA 1F9FA 4CLZA 4ZP9A 1D9FA 1RWKB 4IH6A 5LL6d 4F4XA 3TO8A 2D1CA 2ATCB 1HBOB 1RTHB 2IDEA 3HHLB 1IJFB 1ROFA 2DD8S 2Z8QA 3H0PA 1Q7LB 1RTIB 4JI7F 5DO2A 2HMIA 1KHWA 3I96A 3MPDA 2HQIA 5CQGA 1C0UA 3A13A 3UD3P 1I94J 1HNXJ 4LFCJ 3S01A 1WC6A 3LP0A 2VFUA 4K0KJ 2ABYA 1YJ7A 3OHAA 4UTGA 1J5EJ 4NI2A 2DGTA 3R27A 5L9NA 1S1UB 3SEOA 2CQCA 3C66A 1VQ9S 3HD1A 3CMQA 2MHNA 4PXCA 1ZM4A 2WVFA 4NYPA 4DL5A 1BHNA 1TELA 3DOMB 1RTDB 2CZ9A 1KNZA 1NDLA 2IRYA 3N5BA 3SV3A 1CC7A 1UWBA 3T3FA 5GMKa 2XULA 4R0EA 3JSMB 3SV4A 4C8ZA 4I7FA 4UOCA 1XBWA 3KNAA 1RHMB 1Q5VA 4DPXA 3GFYA 3US5A 4MKAA 4A8XA 3PW0A 2WSFC 2XYGB 1JQGA 3MAAB 3AB4B 2NLWA 4QQBA 3PW4A 2E5LF 1F1BB 2IBKA 1K44A 4B3MF 1OO0B 2YPYA 4TQSA 5F8GA 4K5SA 2XC9A 2DNOA 2G0CA 2DH9A 1S9GA 2X1BA 5LSRA 2FZGB 5I42A 2HLUA 1S7IA 1NKBA 1BY9A 4YB6A 1Z2ZA 1QDUB 4B9VA 1YGYA 2C3OA 2XMWA 4EBCA 2ZC4A 2XGPA 1FK9B 2MJNA 4EU0A 3UR0A 1YQHA 3WBZA 3UVJB 4A48A 5I3UA 2ZWPA 2DNKA 4K4UA 2ASYA 2HFOA 3JYTB 2IVYA 3EUNA 3QLHB 2IMWP 4CO3A 1ZZNA 4JI4F 4ZPBA 1UPMB 1L3SA 4ANCA 3BF4A 3CT9A 3IA0A 3B8HA 2AJ4A 2HGMA 3F41A 2MZQA 4PG7A 1KRPA 2BUNA 2Q43A 3QBCA 1D9AA 2HQFA 3NGDA 3RJMB 1N36F 3C2PA 3PVXA 4HKQA 2QLWA 3PR5B 1N0VC 2PGCA 2W9BB 4M5GA 1HYSA 1U2RA 1VRQC 2HVHA 3X1LB 4Q2MA 2E5GA 1EETB 1XNRJ 3M05A 4A8SA 2AJ2A 2HQCA 4NXNJ 1RBOB 1IM6A 3M2UB 3HKZD 2K3IA 1RTJB 4ZHRB 2VOOA 2EEYA 2RAQA 1S6QB 2Z4PA 1M1GA 4D3GA 5ITHA 2F65A 1FDDA 2AYMA 2LECA 1UVNA 5ADZA 3QQCD 3AD8C 1G3OA 2OIHA 4U8VA 1ELOA 1R7IA 3O8WA 2X1GA 1UW4A 4L73A 5DQIA 1E6VA 5LT5A 2G9OA 3FQKA 4MH8A 1SC6A 3POTB 1UAWA 4C8YA 4LF4F 3ELHA 1QSYA 1CJKA 1PAEX 4DWIA 2J0SD 4WFZA 1R43A 4AL7A 4DR7J 1V5IB 2WOMB 2JVOA 1WF0A 1HW8A 3VZHA 2NXCA 3TARA 3SZ2A 4OYXA 1M5HA 2YKNA 3DDKA 3DLGA 5D4NA 4C3LA 4PWDB 3QJJA 6AT1B 3W66A 4X62J 4U95A 2JLFA 1MLAA 2AZ3A 4QYRA 2MQLA 2VPZB 5A2QY 1S0MA 5DM7Q 4B3OA 4J9OA 2DEJA 5BXIA 2HBRB 3GV8B 3EGWB 2LQ5A 3G96A 2JLGA 1S1XB 2G1HA 2RHQB 1VQYA 1UFLA 1RWUA 2LQBA 2OI2A 1HHSA 3DOKA 4IG0A 5KFWA 1VGYA 2Y3YA 3OL8A 4ECTA 2POKA 1HHTP 2DNGA 4CO1A 2IAJB 2M5YA 4B3SJ 2F4VF 1FEHA 2DHHA 4OHXA 4OLPA 3MMJA 3A4TA 2RNEA 4JI6J 2YVSA 1HD0A 2DNLA 2R7TA 5E33A 2EKYA 5D3GA 3CIZA 1J27A 2ZBIA 1T03A 4BC9A 2A6MA 4FNIA 5D4OA 2J7UA 1TUGB 2GGPB 3OQ2A 3RRKA 2DRBA 1PC4A 3MR3A 5LMNF 4KV8A 2NQPA 4WKRA 2ZUGA 4JV5J 1HI1A 3NAIA 4RBVA 1S1VB 5HMZA 1S9EB 1OY9A 1D9DA 4HT5A 4OYIA 4KIAA 4DS4A 1T8EA 3MR7A 2HAFA 1LQ9A 3Q83A 4WPAA 3P3DA 3KLFB 3K58A 4K4VA 1RT2A 4HR2A 2ERRA 4U7UK 1R89A 4DPOA 2VJVA 1E6VB 3GWCA 1WF1A 3KLIB 3RZAA 5ETSA 5KFNA 4DV4J 2KXFA 1H7XA 5IZHA 2IVFB 2XY7A 1VBYA 3A8IA 2CWXA 2PE8A 5CYQB 4O3PA 4ED3A 5DETA 4BWJA 1NPKA 4QPXA 1NJXA 2Z0GA 2DCUB 3AA9A 3AD9C 2KN4A 2B7BB 3I9ZA 4I56A 5E3AA 5ETNA 3CCES 5HANA 2DXEA 5GAEU 3DXSX 2XHWA 5LJ3Y 4TKTA 2XO6A 3Q8UA 1R0BG 3OFHA 1CQNA 2DITA 2WB1D 4QOTA 2YBVA 4KHPF 2GCFA 7AT1B 4JI5F 3RR8A 3MMCB 3O2IA 4QCLA 3C14B 1RAIB 1HYSB 3W5YA 4RUAA 4EYIB 2L41A 5DG9A 1AFJA 4M63A 3D1HA 4F02A 2CPIA 3GG0A 4ZCLA 4RO0A 4DFPA 1QD1A 3CCLS 2CAJA 3KLHA 4HHUA 1T03B 4J37A 3C3LA 1JXEA 4DL0C 2VBZA 1HNIB 2DH8A 2YX4A 3QLHA 3IBFB 1NK8A 2D7SA 2DIUA 1T94A 2IRXA 3FBFA 1Y3KA 2IHR1 3O44A 4PKDB 3KMSA 3L3CA 3CD0A 1SC4B 5J2PA 4I69A 5E3PA 5IWAJ 4M5MA 2HKEA 3I0SA 2VA2A 1Q16B 2MKCA 3RBXA 3UD4P 2GVZB 1JX4A 3P5TL 1S1XA 2B8PA 3SCLE 1XC9A 1FJCA 2ZJQQ 3LP1B 3WHIA 1XN9A 4KJIA 3BJYA 4NCAA 1RJJA 1REVA 2V8VA 1QE1B 3HSGA 2XBPA 4DV6F 3VAGA 5CAAA 3HHNB 4M5IA 4PPZA 2PFDA 3HJFA 4FKXA 4I64A 1HD1A 1SI9A 4X4UA 4ZVSB 1FDAA 3CDUA 1WELA 2GW8A 1LW0B 3CE8A 4P71A 1RBLA 4CLSA 4EWTA 5GAEI 3OUYB 2RDJA 4YDDB 3MM7A 3PX0A 4CCHA 3IRXB 1HBMA 4LRAA 3OL7A 1RDRA 1QTNB 3PW5A 1IQZA 1LW2B 3I6PA 4NLQA 4OJ1A 3KNGA 3NCRA 1Y3JA 4WU2A 2UVRA 5HL7Q 5FJ4A 2W1BA 1IWAA 1SV5B 4JUZA 3ZZRA 2NYIA 4IDKB 4J9PA 1T95A 4MYTA 1WEXA 5KFUA 5B0AA 1HBOA 2VDHA 3F44A 4N47A 2H4WB 4B9UA 2V4QA 2MJUA 3M1VB 2YY3A 2JEFA 1UJ5A 3MEDA 3P96A 3QT6A 3LWMA 3TJ9A 3N0VA 2NSCA 3OLAA 3VAHA 4CLFA 2QA4S 4DN0A 3CPWR 1P6TA 1U0SA 2HVEA 1M0SA 2RJZA 3TVZA 2M4MA 4WFYA 3ULHA 3MM8B 3DRYA 1R8AA 3G8SA 4GKJJ 1FF2A 4OX7A 1X4HA 4WTOB 3BEGB 1AUDA 1F9EB 2B7CB 4K4ZA 3OJUA 1U2FA 1JLCB 3GV7B 1KFSA 1ZM9A 3G9CA 5BJRA 2VQEF 2GJFA 2BXJA 3D6HB 4G1IA 4USVA 1FRHA 1VQMS 1IBKF 5H9FK 1IVZA 1OSCA 4L3KA 3LP1A 3MPUB 1TL7A 1YBAA 5DDRC 4ED4A 1I5OB 2NUUG 3KUHA 5LSOA 3NY0A 3FEXB 2OMLA 2G2ZA 4WP3A 3FBEA 1S79A 1N56A 4IKAA 1GK8A 3BSCA 3MM5A 1DTTA 2EC0A 3GB0A 4NXMF 4G65A 3BV8A 3QRQA 3M8RA 4RUHA 3W5ZA 1KEKA 1YVFA 3L4BC 3NS6A 1UCNA 4NCGA 2CPEA 4WE1A 2BV3A 3MAAA 2QO3A 3RG6A 3SIPB 4ZLNA 2MLZA 2NYHA 1HNIA 1NSQA 5FLXU 2G0IA 2ZD1B 2XO7A 4EZ9A 4JI4J 3CJQA 1FJGF 3ENAA 4ZITA 1FO1A 4RNOA 4KGXB 1UL3A 2Z56B 4DCJB 3NMAA 3GIIA 1N34F 2F1FA 5C24A 1NB7A 3I82A 2P9CA 2W2NP 1TK8A 5K8NA 2C2NA 4LF8F 4YUDA 4WF9Q 2K06A 2KHDA 4HH0A 3F73A 1IR0A 1RHKB 3M6XA 1M90T 1TTHB 1PSDA 5HJXA 3RW6A 1XQIA 1YZ7A 1C0UB 3JSBA 5CD4A 2E9RX 4LT6A 4KC5A 5A0YB 2W2OP 2ACMA 1H6KX 4R25A 3M8SA 1G2EA 1LFPA 4DN9A 5HVGA 4KH1B 1F5CA 1PKUA 2WAQD 3CJ5A 3W3SA 1RCXB 3HLUA 1VR6A 1RADB 1WC0A 2RUGA 2NREA 3B6BA 2L9WA 2BOAA 3QZ8A 3QGGA 3K57A 5C7PA 2ZH2A 1TMMA 3BBCA 4WZQA 1RWPB 2W4DA 3NCQA 4C0BA 2CQDA 1RBAA 2FJAB 1HQUB 2ZOFA 2HHUA 1RT2B 2KFYA 4QU6A 1F9HA 3BBBA 2VC1A 4ZVFA 1EQMA 2GNKA 3HT0A 5ETRA 2CNLB 5IC4B 9ATCB 2UVWA 2DRAA 1N32F 4KKOB 4LVNP 4RKUC 1TL4A 5HK4A 2M8DB 2UUAJ 2YWFA 3QGIA 2PMZD 3N6LA 1BQMB 3BREA 2VG7B 3KXDA 3KHLA 5D0EA 3C6UB 4LBHA 2BANA 1H98A 4MK9A 2RUSA 3PACA 1YJUA 2IDLA 4NA2A 4JOUA 1SPBP 2GGPA 2W4CA 3Q8RB 2R7VA 3D6FB 5KFFA 4KT0C 4RW9A 3EYZA 2HLTA 3CVKA 3DMJA 2XMAA 4DV5J 2XS5A 1RT4B 1WD6A 3KUGA 1U1PA 2LQ9A 2V69A 1NAQA 3C6UA 3WIUA 2W8KA 4JI7J 1FWLA 2VG7A 4FYXB 1KBRA 3OXFA 1T9UA 4AXJA 1VRTA 2AYGA 5HI7A 4PUOB 2W8LA 1BQNB 3MTJA 3E3XA 3MEKA 2E9TA 2HEKA 2OAUA 2YQ1A 3JSYA 3VALA 1UETA 1HMVA 3DOKB 3Q8VA 2Y1JA 3LTOA 4YP3A 1KS2A 4JB8B 1HQUA 1YK9A 4BC7A 3O1LA 2HVDA 2QGFB 4U8YA 1XK8A 5LXRA 1AZSB 3AOCA 4YR0A 1B70B 1Q8BA 4I6WA 1J5EF 2VA3A 3H2LA 3DLEB 4Y3CA 1S0NA 3CCJS 3BGLA 2KXNB 1UVKA 4MTPA 3BBFA 3DC2A 4DFJA 4D3HA 2DT9A 1IBLJ 3X3UA 4QYZJ 5DQHA 2KRBA 3NWGA 4RW4A 5FLXY 1S9FA 2WVBA 3MFIA 1WOOA 4OQJA 2YWKA 4LSLA 4ZDNA 5B08A 5KT2A 4Q45A 4QYZK 3QIDA 1JLAB 1MMLA 3J7YU 1NK5A 5M2UA 4M94A 4O0IA 3RUBL 1YRUA 4AT1B 2GZOA 1PJ5A 3WC2A 4B9SA 2HFNA 3W65A 2UXBF 2HZVA 4HVZA 2VICA 3CMES 5C24B 2BKOA 1IR1A 5EWEA 4DR2J 3UWTA 2XLKA 2GQQA 1U4BA 3FCHA 2E44A 3QIPA 3G4SS 1YJVA 2E1AA 3EXCX 4ILMA 4ZLLA 3TI0A 1RTJA 3EICA 4ZN1A 2VG6B 3IXQA 4DR4J 2VFVA 2X3DA 3WX4A 3LPEA 3NLCA 3TX0A 4WFNQ 3LP2B 3DRSB 3HK2A 3EDQB 1FXLA 1LK5A 1QAXA 1FTCA 3IWLA 1EETA 4A8OA 4GC6A 2ZEJA 1EKRA 3BGOP 4RBTA 4F3OA 1DTTB 3QNWB 3HSJA 2BE2A 1L3VA 1JJ2R 1WSRA 2P9GA 3HX9A 4YB7A 2MZRA 3J7AN 1CQMA 4ZVPB 2AGQA 4X2BA 3IO1A 3N28A 1FRMA 1MROA 3CJSA 2HQDA 4EEYA 4Y2IA 2UVVA 3KWMA 3SBMA 3UQSA 2F9JA 3BQ1A 1B99A 2E7XA 1MROB 4L74A 4DZ6A 2ZZTA 4OI6A 2B4PA 2KZMA 3CDAA 2VASA 4EMDA 1YBTA 4CLTA 2ZVSA 4ZJQA 1B0PA 3PCOB 1HI0P 3GE9A 1TUVA 1FKOB 2ZKTA 4ED5A 5KG3A 2W9BA 4OZ0A 4L72B 4UOFA 1B7FA 1AT1B 4JV1A 4IRDA 4RNHA 2ZJPQ 1NJIT 3DRSA 3T19A 1KONA 2FDNA 4H4OA 2XZDB 3J81j 1UWAA 2V9WA 2L08A 1RA7A 1JKHB 4OYBA 2D3O1 3EGVA 1FWKA 2A10A 4ETZA 2XB2D 2UU9F 3QIPB 1PCAA 2XSFA 2X1AA 1X8DA 2RILA 3MECB 1N4LA 2HHWA 1HNZJ 1TP7A 2QLBB 3PFOA 4NMXA 2HIQA 3IRWP 1EZZB 2MKJA 3QT5A 2VDIA 4OYZA 2VIHA 4ZJOA 4LFBJ 1RAHB 2HVZA 3CO0P 4K4WA 2YH1A 2ZH6A 4P72A 3HM9A 1O5JA 3MUTP 1HBMB 2CDQA 3LP0B 1ZETA 2E9ZA 2R8IA 2VF3A 5T7LA 2JOQA 3UDEA 2BJDA 5B0EA 2HSEB 1SB6A 3THPA 3UN3A 3OW2R 2B3TB 1QSSA 5C2CA 2ZBQA 5K8PA 4RLEA 5FDLA 1U1MA 2HS3A 1K8AT 2J6TA 3QATA 4RR5A 1RB0A 1RTIA 1UEVA 4A8MP 1PJ7A 3KFWX 5A8WA 4AL6A 3D0HE 4TY9A 5CCMA 1SL2A 3DLJA 3DLKA 1BXNA 3K5LA 3CIMA 1AZSA 2QV6A 4K5RA 3GV5B 4HDGA 3OTEA 4WIIA 4IQXA 2KFNA 1PJ6A 1X4AA 2HFUA 2FVQA 4F8RA 4OZLA 2ADCA 3DHXA 4I4BA 4PUOA 1YRXA 3TAPA 4ELUA 3CJ0A 2LEPA 2VBWA 1NUEA 3V6KA 3DRRB 5J1EA 4BS2A 1RHJB 3VGTA 3ZNUA 3CC2S 2RE1A 4X64F 3D68A 3HVTA 5A8RB 3NNAA 2YKPA 2ZDOA 2VQEJ 1VQKS 5FIIA 2KM8C 3DMJB 2AWZA 3T1YJ 4FYYB 1QY7A 1RAAB 2QFIA 2HHTA 1FT8A 2YTCA 2FJWA 3KJVA 2RU9A 1VLYA 3D6MB 3H25A 3LUYA 1FRIA 4QW8A 3J81U 4DL3A 1NK4A 2NXUA 2BANB 4ZCKA 1XEZA 1R6YA 4V1Ak 2ZH4A 2FJVA 2DR6A 3QJLA 4CQ1A 3WX8A 3VQSA 2R8JA 4DV0F 3VV2B 3QO9A 3MMCA 2ZOMA 4QBUA 2IIHA 4P52A 2QSWA 3AH6A 4O23A 2DPJA 2E5HA 2E5JA 3OVBA 2NS1B 3LP2A 4XAKA 1FVSA 3OR2B 2DKOB 3MD1A 1FKAF 2B56A 3EMTA 3D5MA 3DOLA 2F7VA 4PG8A 1SUQB 5GMDA 3PJXA 1OYDA 2J9DA 3AXMA 4YDXA 5KFMA 2B51A 2ASLA 1DRZA 5KAKA 4OHZA 2C2OB 2EFNA 1VQPS 3ETMA 4C2MA 2FD2A 2LA4A 3R5BA 2MQMA 3VVTA 1N33J 3KLIA 4B17A 3UFCX 2VJUA 3MCNA 1VS3A 2OMOA 4L3NA 1JWWA 2EG2A 4FN5A 4KGMA 4RWWA 1A9NB 3PO5A 2NUHA 4C8NA 3MD3A 4EK2A 3BSAA 2VPWB 3RAXA 1VI7A 1RE1B 4RW4B 1RT5A 1FI4A 1F5AA 1XR7A 4OFZA 4QJVA 3GR1A 3SQOP 4CWBA 5IV4A 2JRSA 3H59A 2B4VA 1PYOB 1LWEB 2OHDA 2VFTA 4DG1A 1MN9A 3DLEA 3ILJA 2IVMA 3BDEA 1FFSB 5A2QU 2ZD1A 1SL0A 5KFDA 1LKZA 2XEXA 4MFBA 3OJSA 4CLWA 5SZTA 2HHVA 1DURA 3NOCA 4YB5A 1YRTA 3VTIA 5HO4A 3PKMA 4PQUA 1AFIA 3R5CA 1K47A 1S49A 1IKWB 3V6DA 2KTQA 5CD4H 1Q8KA 3B4DA 4DV1J 2UUAF 2Y9HA 2KZZA 1KQSR 1FRLA 2CPZA 2J9DE 4ICLA 4CM2A 1DQ8A 1JB0C 2HGLA 4C3KA 4AQYF 3G6YA 4X4RA 4FVMA 1R8PA 1YSJA 3KG1A 4IOCQ 2FGCA 2QLJB 2EWHA 1BMQB 2VB6A 3KJNB 1JK9B 4B3OB 4Q0BB 4OIXA 4LSZB 2I38A 3HPOA 2DNQA 3PV8A 4DSJA 2XZWA 4OZNA 5EWGA 4ED1A 3NEKA 1JLCA 1KVKA 1UZDA 1U02A 3NRBA 3T1HF 1CEZA 1ZA2B 3NXZA 2CPFA 1RAJA 1BQMA 1J5OB 5IC6B 3TA2A 1IXKA 1NMEB 4P10A 1CJKB 1PGZA 1UVIA 4OYPA 2DISA 2PO4A 4IQMA 4A8QA 4OI4A 1Z4UA 1WUUA 1S99A 3IR7B 5B0DA 1N36J 2RKIB 3CCWA 1B3TA 2KH9A 2CFXA 3I5AA 3K89A 5CHCB 4CO2A 3M8PB 4LF2A 3TW0A 2QX0A 3MFHA 1D8ZA 4WJBA 2MYFA 2BX6A 1FJ7A 1CJUA 2FC9A 1SBRA 2J8AA 2C3MA 3EPIA 4NXNF 2H1YA 3C16B 4W92B 2CQGA 4A8YA 3TZYA 1KC8T 1RAEB 5DZ6A 4ENOA 3VGSA 2QYCA 2M52A 2DGXA 5J2MB 3T6BA 3G6VA 1KLMA 3VAFA 2Y1LB 1R0AB 4FF1A 3NWRA 3IAM9 3V6HA 3CD6S 5BYSA 4DZDA 2AEJA 4QWBA 1HBUB 3OUYA 1IBMJ 3T6JA 2EFOA 2FY8A 2RRBA 4USMA 2HVIA 5E3CA 4QIEA 5GAGU 3DU6A 1S6UA 1SCJB 1PBUA 5HN0A 3OFFA 4Y2CA 2CJXB 1KHVA 2WVEA 4FVCA 2ALZA 2H5JB 4ZVRB 3QRRA 1A6LA 1P27B 4DJBA 5E0OA 1FNOA 5K5MA 4LF4J 1FD2A 3FBCA 4WE1B 3PYDA 3MR2A 4P6QA 1O0PA 4O4RA 1U1RA 2OPQA 2Y8YA 2P5VA 1X7VA 2OPRA 1T05B 1F60B 7FD1A 3WDOA 2WBRA 3DDIA 2FZCB 3NG8A 4KAIA 2J9CA 4F0HA 3GIMA 1GTHA 3I4PA 2R2TA 1IJEB 2AF6A 4UUXA 2QTWA 5D0GA 4CO0A 2HRYA 3CC4S 1TL7B 5T14A 1CS4A 2CWKA 2GHPA 3B78A 4MIBA 1Y5LB 3IBCB 2V8GA 5KG0A 3CXCR 1GT8A 3HJVA 5KFAA 3OL6A 4DF4A 1TFYA 4R5PB 2MQQA 3P8BB 1H2TZ 1JXLA 2Q6BA 1W2BR 3MM8A 3MR6A 2FVCA 5KG4A 3TUIC 3SSQA 1S0OA 2ZHOA 2V8HA 1CBKA 4KQZA 8ATCB 3J7A1 1RWXB 2KFZA 5AE2A 2CYYA 4C0OC 4YY3J 1C1BA 2DHAA 2C3UA 1X4DA 1JJHA 1WHVA 3VGUA 4I0WA 3ZTRA 5F8IA 1V3SA 3VAKA 3GSDA 3M1VA 3JQMA 4XO0A 5L1JA 1W2IA 2LP4A 3FEYB 1YJNS 4WBFA 1S97A 5DZ7A 3HHEA 1H73A 1X4BA 3PIPQ 3G6XA 3MPWA 4RNFA 2HK2A 3EPGA 2HMIB 3LH2S 2CUYA 2E7WA 2QLXA 2ZFHA 4RW7B 5A6WA 4DPYA 2RB7A 4ES3A 2H4YB 2VPYB 4PCQA 3A8JA 3M9OB 2LXIA 3PJWA 3SCKE 4K4TA 3CJ8A 1VJWA 1R0CB 3FBBA 2FTRA 3JSRA 2F40A 3T5KA 4DV4F 1IM4A 2LEBA 3HT3A 4B3RF 3IRXA 1EAYC 2QIFA 4CLUA 1N52B 1BE4A 2DHGA 4NX9A 3G8TA 2DGOA 4NLVA 4HI1A 5DLFA 2FLLA 3R2DJ 3LAKA 1S1VA 4LFAJ 4NZ7A 1NK6A 4DPWA 3BKFA 5IS2A 4K2XA 3OHBA 3G8QA 2OPPA 1WC3A 3I9V9 1TL1A 3ISND 4KRWA 5CCLA 3CULA 1HQ2A 1WEZA 3TP2A 2WZ1A 3AY0A 2ZWOA 3D66A 3GCXP 3Q8QB 2JEIA 2D69A 1IUJA 2GX8A 2OEKA 1GXUA 2AKWB 2V50A 3UR3C 3W61A 4F25A 3AODA 2HK3A 1IKVB 3E51A 3RAMA 3T41A 1S4EA 3MCSA 1MMDA 3I5CA 1ZAVA 2GJIA 4Y65A 4U7CA 2B5JA 3VAIA 1K9MT 3R9LA 4WK3A 4QWDA 2IAJA 5BYRA 4ZIWA 2FHJD 5J2PB 5C2GA 5KOXA 1ZTTA 4PQUB 4G1QA 2CJYB 1WF2A 3FKBA 3LAMA 3M9MB 2ZHBA 3K8WA 4TYAA 1LV5A 4MFBB 4TLQA 5F8NA 1F3VA 3P49B 2GQ2A 1GNKA 3ET6A 3ZTPA 5KFBA 1KOHA 1S57A 1JLBB 2HS0A 2JC1A 1GAOA 2HW3A 1NSPA 2MDAA 1Q4RA 1IKYA 2JVRA 3KTQA 1U24A 3D2WA 5HROA 2HHHF 5IT9U 1XJWB 1OPZA 2IC3A 4XTTA 1F2GA 1ZAWA 3N6NA 1W26A 3MAHA 2FLOA 4DR5F 5E3QA 4FNHA 1WJ9A 5GADU 2V94A 4ZVOB 3UDVA 2WVDA 1NKEA 5D6GA 1FD8A 2U1AA 1FFGB 5HQ8A 2O01C 2VFRA 1PYTA 3O6QA 2DR5A 3IWNC 3IGVA 1VK3A 3LGMA 2GIRA 2MQ8A 3L7UA 4HDHA 3H90A 3DDNA 3W5XA 4DX7A 1T0TV 2RQ4A 2YPZA 4MKBA 3HD2A 2IM3A 4ZVUB 1EARA 2P6SA 4NLTA 3HHKA 4EYHB 1RISA 1SUQA 3V5RA 4WU3A 3DOLB 4HEA9 2ZH1A 2XNRA 3FC9A 1FX4A 1YX2A 1SKWA 1NH7A 1X5SA 1NHKL 1GXLA 3OR2A 1VQOS 3AJ1A 2PFFB 2IPOB 4ECRA 3KLFA 1OSDA 2LQ8A 2MLXA 3NGTA 1WWHA 4IFYA 2M9KA 2E1MC 1UJ4A 2D41A 2G1DA 2H5IB 1HL6A 2VBYA 2W2PP 1S9EA 3QO9B 4LBIA 3KYLA 4WXWA 3QZ7A 2ZJRQ 1VRUB 2XQCA 1TVRB 3CJ3A 4KV8B 4OYWA 4AD6A 4CH0S 4R8UB 1LEOA 5JMNA 4CM0A 2BYCA 3FCWA 5KFQA 2CQ0A 2W4PA 3KJVB 3CDWA 4Y2MA 2R8KA 3W63A 5EN1A 1GMWA 2AHOB 4FF2A 4ILRA 2MHEA 5GAHU 1GX5A 2V9KA 3JYTA 4V19J 1RWOB 1NBEB 2EI5A 1RTZA 2FGOA 2UU9J 1NLKL 1NO8A 4IH5A 1FK9A 3K7RA 2ZH8A 2KDOA 5FD1A 4FBUA 1XTZA 3GIKA 1BC6A 1RWNB 2XS2A 4P2SA 1IBKJ 1RWMB 4IOAQ 3U1NA 4B9TA 2WBMA 3M6UA 4DUYJ 2XHCA 4KGKA 3KOAA 1OY6A 3OR1A 1LFWA 1Y11A 4P9SA 3HFVA 4RL1A 1URNA 4TNOA 3DLKB 1VFJA 4RBUA 3RGIA 1OS5A 2EBEA 4B9MA 4M5DA 3CD7A 1A7GE 4ER8A 3DLGB 5FDLB 4EO8A 3JSMA 5JVGQ 4GKKF 5H9EK 1B0VA 4J9NA 2GQCA 1F6TA 4ZPWR 4Q44A 4DR7F 3UPFA 5H9EJ 4B3TJ 5T7LB 1BQXA 2APOA 3GFZA 1B7YB 4ILLA 3POTA 3BSOA 1T3NA 2EW9A 1FFWB 2F8MA 2K1RB 3UCUP 4OMFG 4DQRA 2O67A 3L95X 4RNMA 2DNPA 2GC8A 5JUMA 1QUPA 2M2BA 3DHWC 1S6OA 2IA6A 3CCSS 2VODA 5HSPA 2AGOA 1IKXB 4O0NA 4DSEA 1V9OA 4FBTA 1NRKA 2DCLA 4ZPAA 4ZMMA 2G2OA 3CNQP 2AU0A 2FJXA 1M1KT 1DLOB 2WONA 3FVYA 2FVPA 1NEEA 3JS9A 3M2UA 1W25A 1U1OA 1KD1T 2ASDA 2XYPB 5A76A 2J76E 2XTJP 4MIWA 1Y9OA 1ZA1B 5KFKA 1RLCL 3AFGA 4DQSA 1AUSL 2BW7A 2CVIA 1C0TB 2UXDJ 3P5BP 2R8HA 3W8GA 2OGUA 3CCVS 1KSPA 3IWXA 2DJWA 2KRRA 2PSZA 2FJBB 1M5SA 2FHMA 1RT3A 4MJKA 1WTFA 2WB4A 3OFEA 2KI2A 4PXEA 4IG3A 3SXLA 4TU7A 1F0XA 2ZUAA 2JHEA 1N32J 4DX6A 1JIHA 3B82A 4O3OA 1YDLA 1L3TA 1DAXA 2RDIA 4B3TF 3BO3A 4LR9A 3UVJA 2PC6A 2G0JA 2YNFA 2XYHB 4HHHA 3CC7S 4B08A 4DU8A 2HFVA 1YI2S 5AXNA 4I67A 1MNEA 1FNMA 3NMRA 1HNVA 1T05A 3UN5A 2PEBA 2XGQA 1NJZA 2A1BA 2EFQA 5A8KA 1RT7B 2VG6A 1T9VA 2BE9B 5HQLA 2GIFA 3E01A 3HHLC 5L8RC 3CJKB 2AYEA 5JXSA 5K9FA 5D3GB 5AT1B 4I7FB 5HMWA 4A4JA 4CT8A 5LSLA 5KFLA 3OTOJ 2MGZB 4JI1J 1ICEB 3RR7A 3KK1A 2I0XA 2YKAA 2HNDB 4I2QB 5F8HA 4QIVA 3VAMA 4EBDA 1HIYA 2KHCA 2YKMA 4RJVA 4LQ3A 1R31A 1PC5A 4ED7A 2VKRA 1SC1B 1CULB 2ILZA 1Q81T 1S1UA 2LFVA 2CADA 4DXLA 1M5KC 4NI2B 5CA5A 1RZMA 3O3LA 4DV7J 1EQ0A 3PZPA 4OI0A 1FXDA 4LBPA 3LQVA 1Y7PA 3H20A 3OT9A 3CO9A 3GQCA 2OJ3A 1XNRF 4QZVB 3NL0A 2DY1A 2QC3A 2DR8A 3DN9A 5KT7A 1XR5A 2HBZB 3IMQJ 2Z2LA 3RBDA 3ENWA 2ZM6F 5B7WA 3T9NA 3D3BJ 2R8GA 1YJTA 1WC4A 1R8BA 3DM2B 4HACA 3ZO7A 1RTHA 3HHLA 2EVZA 4N8OA 3CCMS 1OIAA 3MCMA 3MUVP 3L7OA 2C2RA 2MKIA 4UZBA 4LRFA 4ELVA 3RTVA 2UUTA 3A3OB 3FSXA 4DV2J 2MSTA 2DK2A 2OEJA 4NCBA 2IA0A 4IR1A 2I5JB 3W2WB 1SL1A 2NZ4A 4OX9J 1A0OB 1S1WB 3AB2B 4ID5A 4WP8A 5C5JA 3PW2A 4F4AA 2OD6A 1KLNA 3M8QB 1HNWF 4F04B 3ZZOA 4YR2A 4J9UE 3MMBB 2XSJB 1OYEA 2DNRA 4NEYA 5CYMA 3NS7B 3W2VB 2CKWA 1E6YA 5ETKA 3IBWA 4OLOA 4HTIA 4PZVA 3Q24A 3CJ2A 2IJFA 1KQGB 2KKHA 2YKOA 3MEEB 5B09A 6FDRA 1T9YA 1KTVA 2H3EB 1YTYA 2JC0A 3C19A 3E01B 3EDRB 5J2NB 5A8KB 2VG5A 5KFPA 3IS9A 3K59A 1OMSA 3A8EA 3GJQB 2PIIA 2L48A 3HZEA 3M8WA 1NDKA 1I3OB 1VQSA 4JP8A 5IV3A 2XMJA 3R5DA 5HLFB 5KTQA 5F9NA 1GXTA 3GSIA 4GO7X 4NRTA 2R7SA 3ZZYA 2RT3A 3PNIA 1DTQA 4CZCA 1P1TA 2G2YA 5HMXA 4DL2A 1SVDA 5GAHI 4URSA 4H54A 1YIJS 3AJDA 2J9EA 4DL4A 1S7HA 3LOUA 1Q78A 3HSDA 2JWNA 4RW8A 4XK8C 4ES2A 3OSNA 2WHOA 1AROP 1H2UX 2M0GB 2KJVA 4LREA 4ZA1A 3I55S 2V5HG 1RT1B 1S1TB 2GJ2A 3MF5A 3PYFA 2HFZA 3N01A 3V2UC 5DM6Q 4DHVA 3JAMU 1RA6A 5A0YA 5IT4A 3GIJA 3I87A 1QM9A 2IM0A 2MKHA 5LMNJ 3TZWA 2UXCF 3PX4A 3CGIA 5IT9Y 4K59A 2N4DA 1TKZB 2HIYA 5DS7A 5KFTA 2J6UA 2BE7D 4X4NA 1PIEA 2DHXA 7FDRA 1F5BA 1DQ9A 2IJNA 2KG1A 4OL8A 1F2HA 3Q89A 5DG7A 2B6AB 3MWBA 3QT7A 5EGYA 4PG5A 2J0WA 5C42A 2E5IA 2OO4A 3J7Z5 2W9CA 4KHRA 1FXRA 1S72S 2QMXA 2RD5C 4ZS6A 3AOAA 1IKXA 5K20B 2Z58B 3I32A 2LLZA 3H5SA 3Q8PB 3JXOA 3K2YA 3VVUA 2OPSA 2QYGA 4WZMA 2YNGA 1U26A 1X9MA 5ETOA 3ZTQA 4NCGB 4K8RA 2CQBA 2CQ1A 4CT9A 4NWBA 4OHWA 2MKSA 2BM0A 1NB2A 4DCOB 2P9EA 2Q1LA 1SQFA 1YITS 4LF6F 1LNQA 1L5UA 2QT7A 4RZRA 3EE3A 4TN2A 4KTQA 1TV6B 1U8WA 4EZ6A 4F4KA 1CJTB 2ZE2B 2UV8A 1YZ6A 1RQ0A 3M32B 1JXVA 1MN7A 3MUMP 3P45B 4M5DB 3MURP 3THVA 5IOLA 3CB4A 5KOWA 2D3OR 3HO1A 4C4WA 5HATA 3H4BA 4Q7AA 2AV5A 3J80U 4NZ6A 2K7JA 5IM0A 2R7OA 2YXLA 1HBNB 1WI8A 2RF2A 1RT6A 3M8YA 4O44B 2QJ3A 4TVAB 1XNQF 1C1CB 1N6QB 2IM1A 2OFHX 3T1YF 3AJ2A 1HWUA 4Y2AA 4G6VB 3SFGA 2CJKA 2C2EA 4FPIA 5U47A 2DGUA 3I0RA 1NKCA 1Z2LA 1TL5A 2MZSA 4HI2A 4DUZJ 4LF9F 3H5XA 3FCVA 3DYAB 3PEJA 3SYZA 4WCEQ 2ZZMA 3MEDB 3R1HA 3BS9A 1NXIA 3PY8A 3EWGA 1WOPA 2UUCF 1WEYA 3HMJG 4DL6A 5F0WA 2HZAA 3OVAA 3GP9A 3UE2A 1VQNS 3DGVA 4HYKA 3QGPA 4IDKA 4DV3F 2LVWA 1FRKA 2XWYA 1I1GA 1SV5A 2Q3PA 2KVQE 2YWHA 5M2RA 4EI2A 3PYGA 4ZK7M 3V4IB 3QWPA 3O5TB 2P8IA 2VZ9A 5HAOA 3FSYA 2B43A 4L75A 3UCGA 2BRLA 1VQ4S 1UTAA 2E5LJ 2GO8A 4B3MJ 4LF7J 3T5JA 3OFGA 1LW2A 4LF6J 2PD1A 2QN6B 3OV7A 2XM3A 1SQGA 4LVOP 3SFUA 4NOHA 1WORA 3MAQA 3MM7B 2CQ3A 1T11A 3IM9A 4YQWA 1LW0A 1SH3A 5KFCA 3FNNA 2CQPA 3QGHA 3KK2B 4C8LA 1IR2A 1QJHA 2JH3A 1FKPA 2V2QA 2EC2A 4KBIA 2ROPA 4Y28C 3KK3A 3ITHA 2HS4A 2RQCA 2ZH9A 3CF5Q 3HKWA 1REVB 2KB2A 4NE9C 1XNQJ 1R8HA 4M8LA 3BO2A 3DGPA 1CLFA 1JLGA 3JB9k 2LXUA 2B9XA 2HURA 3MHYA 1RACB 1H74A 3CCZA 3HI9A 3GIRA 1LWFB 2H54B 1Y10A 4PWUA 3HVRA 4IH7A 4W4MA 2OTJS 3H8YA 4DX5A 3I0SB 3NGKA 4YEAA 1NPPA 1NHVA 2HWIA 1B4SA 2V8DA 3PXGa 2CQIA 5D8HB 3GTYX 4DR6F 3H5UA 4OX6A 4FS1A 1ZM3A 3H40A 3EM1A 3M6VA 2C28A 1HWJA 1RK8A 3MI7X 3DRPB 3S8SA 1FRJA 2QZ8A 4C11B 4N76A 1O6XA 4L76A 1SJFA 3QAUA 3U7JA 4WP9A 1SJQA 3IG1A 2VFSA 1NU4A
chains in the Genus database with same CATH topology
4C9DA 2JX2A 2O1PA 3H98A 5B08A 4NYOA 1SIZA 2KXHA 2MMYA 4QU7A 2PN6A 3ZZTA 2V4RA 2R7WA 2LYVA 2RIJA 1U7LA 4WTYA 5D3GB 1K73T 4YB1P 2HWTA 2R7UA 2C2DA 2CQ2A 2GFFA 3NS5A 5GVQA 5J2QB 3BGRB 3NNHA 5EX3A 2B9WA 4P7VA 1XMQF 3CMAS 5KT3A 5AE1A 1HW9A 3GYNA 3OTOF 2KM8B 4OZ5A 1X4CA 5K14A 2EG1A 2FUG9 4I6AA 4Q2LA 2RU3A 2XMMA 3TAMA 1TAUA 5G0RA 3TVYA 4C97A 2YNIA 5GAGI 4FZVA 3HHLD 3EZUA 4Y34A 1K0VA 5G4DA 1YG0A 4DV7F 1Y5NB 3UDCA 2KT2A 1QTMA 1V3ZA 2XS7A 3RU0A 1N5TA 1OQ6A 3SDEA 3PDNA 4IFVB 3G71S 1VC6A 5G0RB 2PI5A 3I5BA 3T5LA 1CC8A 1LXJA 3RW7A 2FJEB 3PO4A 4JI8F 4DQIA 5I42B 4IR1A 4XDDA 1MWYA 1TKDA 1SH2A 1X4FA 3BGRA 4WFBQ 4Q5VA 1TQLA 1IQTA 4DFMA 4ZLPA 2DB1A 1T02A 3BSNA 2JZ5A 2ROEA 4UW2A 5KFHA 1U6ZA 1U1NA 3LPYA 4PXBA 4ZKAA 4GO5X 3R5AA 3IG1B 1UVLA 2LEAA 1RT6B 4ED0A 4JI0F 2YWEA 4ES1A 2DPIA 4C11A 3MPVA 1TKTA 2OLWA 5E7OB 1NJWA 2ACYA 1S6PA 2KT5A 1WHYA 4NA1A 2QMWA 5J1NA 4LFBF 4WYLA 2AX0A 2WCXA 2GIQA 2YKNB 3M32A 4MAKA 4ZPCA 4PWDA 2NR0A 2A18A 3LF0A 2C42A 4JI3F 5M2PA 2WOMA 1QAYA 5AXKA 3ZC4A 4DLEA 1TV6A 4X66F 3N4WA 3M9NB 2N7YA 5KFIA 1Q8LA 1UKUA 1Y00A 2MZTA 1UJ6A 2KU7A 3ZZPA 1TAQA 3RYLA 2F8EX 2IBOA 4GMKA 4DF8A 2BW2A 5H9FJ 5EHHA 3KK3B 3BR9A 1N88A 1N54B 4OI3A 3KK2A 4FXVA 4QR1A 4FPRA 2ZH3A 1JLEA 1RGVA 2WW8A 2R2SA 5KFEA 1HBUA 1ULRA 3MM6A 4HT7A 3M2RA 3NCPA 1MU2A 2HRUA 3D0GE 2MY7A 1OPIA 1MU2B 1KLMB 1ZPWX 2RQKA 4QR0A 2BDPA 3M2RB 2AX1A 1XMBA 2AGPA 4X4VA 4FF4A 2FLPA 2RVJA 4QPTA 2C22A 1JLEB 1LOUA 5I4MA 2ZNZA 5E2QA 4F4YA 2CJ9A 5K8OA 4MKYA 1D0EA 1LWCA 4ZP7A 4F4ZA 3EGZA 1G7CB 4CNYA 2BJEA 2L9DA 1HPZA 4RW8B 4ECWA 4EUVA 1ZM2A 4LUBA 3UI3A 3VWSA 4C8KA 1NZAA 1P9QC 1AXQA 4DS5A 1ZTWA 1VBZA 1S48A 2J0QD 4DR4F 3R1LA 2NPIA 2CJQA 3OVSA 1DTQB 4XPCA 2RS8A 3I0RB 4RW6B 4C7QA 3KHRA 3H4DA 4Q8FA 2RRNA 3UW1A 2FVSA 4DEZA 2Q6CA 3DI6A 5KG6A 3UNGC 4B02A 1N48A 1S9GB 3Q2SC 3W7BA 2YX7A 1N5YA 5E5NA 2W7PA 2BABA 1HBNA 2GMHA 5DGAA 2HHXA 5F0UA 3U1MA 1TKTB 4URQU 1GX6A 4N77A 1U25A 4HL9A 3MEEA 4TY8B 4DMZA 3D0IE 3IFEA 4NMLA 1HR0F 1E6YB 5CZXA 5DG8A 2AP6A 4YP3A 1UWBB 1Q8IA 1X5PA 5F3ZA 4EGLA 2XSJA 3FDSA 4NRUA 4ZPDA 3CCUS 4ICLB 3PEHA 2OD4A 2UUWA 2MKKA 1TK5A 3MTKA 3TQ1A 3PHEA 2F8HA 1DFDA 4TU9A 4U9RA 2OP5A 4WFXA 3IR6B 4O3QA 3TA1A 4AXIA 2D9OA 4YOEA 2HHPA 2CZVC 2XWXA 4Q43A 2Y1IA 2YWGA 4MIAA 1EP4A 1M5VC 3LANA 5HLFA 4OX9F 4F26A 4C0HA 4DV5F 1D8YA 3BN4A 4UY8T 4F4WA 2P6TA 2EBGA 5KFJA 2OKQA 3CDBA 2CQ4A 1SKRA 2CJBA 2AJFE 1JLFA 1CG2A 2BBEA 4DDFA 2G4BA 4X4OA 3SSRA 1DQAA 2D3ZA 3AHPA 3M30A 4PG4A 3SSSA 2ZITA 4EFAC 4KFBB 1WG4A 4Y2KA 4N41A 4V19X 5IQ6A 2RS2A 4ZVGA 4H4MB 1KTQA 3MOJB 4AFFA 5T41A 3HVWA 5H1SV 2V4JA 4USHA 3BB5A 2OH2A 1DJ0A 3U27A 1M5OC 3KHGA 1SIWB 1Q53A 1TZ0A 2FHKA 1RT7A 2DGQA 4I2PB 4CTAB 3PR4A 4B9NA 3ENVA 4DQPA 5IWAF 2VOPA 4AL5A 2N82B 3ENQA 2Q79A 3KG0A 3MZIA 1R8CA 4MK7A 2KG0A 1CVJA 5C25A 1G6BA 4PPDA 2YNFB 4RX6A 4LSNB 2J6SA 1FEEA 4N8NA 2DVIA 1N8RT 5KFXA 3VZIA 3FRZA 3QAEA 4IG3B 5F8JA 5CYMB 3HHDA 4NZ0A 3P6YC 1FCAA 2GA7A 2H9ZA 3KLVA 1J2VA 5J1EB 4H4MA 2V2KA 5D4PA 3AQPA 3TOQA 2GMLA 3SCJE 3PRDA 5EX0A 3W2WA 1C0TA 5KFVA 4K4YA 1VQLS 2LCWA 5D78A 4ED8A 2C3YA 2FLNA 2LQJA 5F41A 5DDQC 2MQPA 1S76D 2Y0SD 2GO9A 4Y6IA 1VMBA 3N6MA 4B3SF 5A8WB 2B4OA 4IR9A 4ZCIA 4NLYA 4DQQA 2XMUA 3IC1A 4I1TA 4G1PA 1SJRA 3K0JA 1X0PA 5DLGA 1VHFA 2CQHA 1XMOF 1EP4B 1C4CA 5B0FA 4UQTA 3TUZC 4U67Q 2JLEA 4LJMA 4NYZA 4R0JA 4YHHF 4OJHA 4X4SA 4B9LA 3MM9A 3M2VB 1S4FA 4ECSA 3D1OA 1SJ3P 2A3JA 3MEGB 2R7XA 2X51A 1H2VZ 5KG2A 4GKJF 4JV5F 2ADBA 3KG4A 3N9UC 1HA1A 4ATNA 1X5OA 3C46A 2Z2MA 2C3PA 1U6FA 2YKQA 3B4MA 2HNDA 2ZOGA 4I2QA 4Z37A 1ZH5A 1Q1KA 2OFGX 3KK1B 4NLOA 2WSCC 4YMEA 2MGZA 5B0GA 1TKXA 4EO6A 4OHVA 4O4GB 1UA1A 4TY8A 4ECXA 2QE5A 2BZ2A 1DZ5A 3MMAB 3PM9A 4TQRA 3S6EA 2XI3A 4XDCA 4C98A 4QW9A 3DYAA 3GYXB 1L3KA 2W9BB 2M3DA 3WC0A 4ECYA 2U2FA 3DI6B 5EUHA 1FKOA 1YWXA 4L6V3 4Y0FA 2W24A 1N5QA 2JEGA 3VR1A 5L1IA 3OTBA 1NNDA 3OSPA 1C1CA 4LSNA 4MK8A 1N6QA 2A2CA 4IYQA 4OZ1A 2RF2B 3MMAA 3U1LA 2WTFA 3DLBA 2RH3A 1WACA 1N0UA 5JVHQ 3SMZA 1ZAXA 2B4UA 1U09A 4R8UA 2EFPA 2SXLA 1TVRA 3VF0B 3SQGA 4MYUA 4XIUA 2CPJA 2B9YA 4ZPVR 3MDFA 2ZC3A 1YHQS 3M2VA 3L7PA 4AE5A 3DRXA 1WI6A 1MWZA 4KO0B 1DLOA 2WONB 1K1QA 1Q79A 2OPSB 1VC0A 5KFZA 4X84A 4X4QA 1YJRA 5B0CA 2QRRA 2DIVA 4NA3A 2W9CB 4NLGA 2YX1A 5KG1A 4C8OA 2FHJA 1FTRA 5DJBA 4TXSA 2K1RA 1OWXA 2QEXS 1KOOA 4E8UA 5KFSA 3DLLQ 3UCZP 1TKZA 1BGXT 1U1QA 1JLAA 3OL9A 2MPUA 3Q0AA 2JDJA 3SQGB 1RP5A 2IC3B 3HZGA 1OQ3A 3NAHA 4ALZA 1IBMF 1VQ6S 1DBDA 5BR8F 1M5PC 1S6PB 5F9LA 5KG5A 4ITSA 2LU2A 2NPFA 2R9LA 5IT0A 4DFKA 4JV0A 4HTJA 2I2YA 2CPHA 2KVIA 2G13A 2XLIA 1GTEA 4KR0B 3TANA 1YJWS 4NLRA 4EBEA 2UP1A 2BQRA 5E41A 4JV2A 4K4SA 3KKFA 1HMVB 3RB6A 4DLGA 1NJYA 2DNZA 3PX6A 1FDNA 4M1KA 4J9RA 1X9WA 4IO1A 3RAQA 4DX8H 3RB3A 5HBMA 1SQEA 1L3UA 3DXBA 2JSXA 1IKVA 1RYRA 2KJWA 5BYQA 4LMZA 4I2PA 4CTAA 2Y1RI 2RMLA 2W7AA 4WYWA 4RW9B 3BO4A 1CSJA 2AD9A 4ELTA 4BDPA 1FESA 4C3MA 3K5PA 4RU9A 5F3TA 3T5HA 3BR8A 1X5TA 3FSIA 2OPPB 3BM7A 1VRUA 5HP1A 3KLGA 3M8QA 4ID5B 4UY85 2FIUA 1SH0A 2CPYA 4KFBA 3DU5A 1VIXA 4RUCA 2H5EA 2R7RA 1FNXH 3CSKA 1Q7YT 3IGNA 2HPUA 2MY8A 5THWA 2EFVA 3BGFA 3OXGA 2YNIB 5IFMA 1XWLA 1JNRB 1FE0A 3IR5B 2CG4A 2XMVA 4J9QA 1ZZFA 3UDLA 5B0BA 2MSSA 1QLNA 3ICLA 4H4KA 3Q23A 5AJ3F 4DSFA 1WHWA 1SXLA 4X65F 1JNZB 4QIFA 3OTDA 4I6YA 2O3DA 4F3MA 4X62F 2ASJA 3S7RA 3GR0A 1FVQA 1ZBTA 2DO0A 5D3GA 4F3QA 2HNYA 3HT3A 2YKMB 3M6WA 2CIMA 5HROB 5D77A 1I6JA 4HHJA 2A2DA 3C6TA 3K8VA 2PT0A 3ZZZA 2K2PA 4M95A 1FDBA 3GG1A 1JLBA 4NL5A 3OLBA 1IN0A 3FFIA 1FE4A 3CJKA 2XMTA 4WFAQ 4KHMA 4G1QB 2CVEA 4FYDA 5C25B 1O8BA 4ZVHA 1HNVB 2VQFF 2LA6A 5KT5A 1WTBA 3FZ2A 1VQ8S 3MM5B 4DSKA 1NHUA 1NK0A 4A8KA 2X3GA 4FP9A 4W90B 3L09A 4LQ9A 4QR2A 2R2UA 2L9NA 2BM1A 2HGNA 1KN6A 2LDIA 4DR1F 3BGUA 1X0FA 4GC7A 2HQ3A 2HHSA 1PO6A 1LWCB 2V4JB 1H0HB 5CXTA 2AYBA 4IRCA 2DBBA 2R2RA 2W25A 2OSRA 1WNEA 3HF5A 4ECVA 5HMYA 1KQFB 2DGWA 1RKJA 3F56A 1P1LA 4E0DA 4URGA 3GFHA 5KFOA 1ZOTA 4HH1A 2E1CA 5DGBA 5CH7B 2YNHB 2VONA 2IM2A 1U1KA 3ZZ0A 3D54A 1Q82T 1JLFB 3MM6B 4ECUA 3K5MA 2YQ3A 4LF7F 3OPKA 2ZKUA 4RW7A 2R7QA 1AW0A 3JTOA 1ZPVA 4LIWA 5GADI 1KR4A 1U6BA 2JEJA 3MXHP 1HFEL 2LKZA 4TU8A 5F8MA 4J9SA 4DL7A 5D4LA 2F9DA 5HLFB 4AUKA 2KYZA 1HWKA 1RKIA 1TL3B 4CO5A 4XPEA 4YY3F 3Q22A 4IUFA 1Q86T 4CNZA 2VL1A 1IBLF 2BACA 4X4TA 3HFKA 2HNZB 1U49A 1P8GA 3AA8A 2FVRA 3LW5C 5I3PA 1S10A 4TLRA 3D28A 1S0VA 4O44A 5AXMA 5LJ5Y 4R5PA 3E2EA 5KFGA 1B64A 1QE1A 3MOZA 5KT6A 4F2SA 3QYYA 4K0KF 3R3TA 3CJ4A 4Q0BA 2R4FA 4DR2F 1QSLA 1N5YB 3GMGA 3CUNA 2MQOA 1GQEA 1S77D 2PEHA 2VUGA 4FS2A 2LMIA 2CPXA 1LXNA 1D3WA 2HNZA 2XY6A 4J5OA 1UA0A 4RW6A 3C8YA 2EFGA 2J7KA 3FZBA 1TL3A 4OI2A 1U1LA 2EK6A 2YNGB 4DUYF 2DGSA 1HPZB 3FRYA 4F50A 3LWLA 2ZH5A 3WZ0A 3KLHB 3J7YI 3J81Y 1HWLA 3FMWA 3TNVA 1TFWA 1FA0A 4IOBA 1UP1A 3IAS9 5C42B 2CZ4A 3TYTA 3SDEB 2ZHAA 3CCTA 2YNHA 4DBQA 4IFYB 3TA0A 3QPIA 4ECQA 4PXDA 1QAJA 2MQNA 4ZPTR 3HP6A 5J2MA 2ATLA 3TR5A 1X4EA 1UEUA 1NK7A 5AE3A 4ED2A 2DNHA 2WK4A 4ETXA 4KPYA 4OJGA 2AW0A 1RT1A 1S1TA 2J5AA 3H2UB 3ZFVA 2WSEC 1T7PA 1GH8A 4CH7A 2FJDB 1V3RA 5DRKA 2AJQA 2M70A 5CYQA 2I9SA 3M8PA 4C8MA 4OJ3A 3QWUA 3TVKA 3EXYA 2JFKA 2VKZG 1URRA 2IFXA 4DSIA 2K3KA 2CPDA 3I31A 4DV1F 2M88A 4BWMA 1UVJA 1UFWA 2X1FA 1LK7A 1FRXA 1MSWD 1KVIA 1MMNA 2VG5B 3ONQA 4NLWA 4RWXA 5I3QA 1CPZA 5J2NA 3SI8A 3FFIB 3AQOA 3A1YG 2XMKA 3G6ES 4PG6A 1C4AA 4BBYA 4ECZA 5EWFA 3DCAA 3DRPA 2XCAA 3BQ2A 3C6TB 3N79A 3HVTB 2FB0A 5A8RA 3EX7B 1H7WA 2ZDPA 4KE5A 3IN5A 3MMBA 3D1QA 4TYBA 3LGNA 4I68A 2HNYB 5KFYA 3S1TA 3OXLA 3RB0A 1HWIA 1IKWA 4K4XA 2JJ4D 1N5SA 2B5JB 2CRLA 4BHQA 2PI4A 3MPYA 4IG0B 3NKYA 4USJC 4YFUA 1QVGR 5F8LA 3RBEA 2N3OA 1VK8A 3DLHA 1KFDA 5I42A 1JLGB 4O3RA 3JTPA 3DFEA 3LALA 4CIOA 5A6PA 4DG1B 2XY5A 2M7SA 4U6PA 3DM2A 3ITHB 1UVMA 3Q2TC 1FKPB 4N5SA 2QA1A 1RT5B 3J80Y 1TR0A 2UUBF 4JI1F 4IFVA 3GZ7A 2EK1A 1DHMA 1VBXA 4ID8A 3OTCA 3J7ZT 3H5YA 3NP5A 4ZOSA 5DDPC 2D9PA 4Q8EA 5IQQA 1XR6A 4QIGA 4RNNA 3NNCA 4BCAA 4DSLA 4OHYA 2OSQA 1C2PA 3KLGB 1VOMA 2RQMA 5HP1B 3PIOQ 1MW7A 4A8FA 1SKSA 3TAMB 4G3IA 1K0TA 3V4IA 4Y00A 5K14B 2IYGA 3I4HX 3MECA 1X4GA 2GHVC 2UZAA 3HDSA 3EZ5A