4JI1F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji1F00
3ZZPA 4JI3F 1N34F 5BR8F 1XMOF 2J5AA 1HNWF 4B3SF 4JI5F 2HHHF 1HR0F 5LMNF 1G1XA 2E5LF 4OX9F 1XNRF 4X62F 4DV2F 2KJVA 4LF6F 1RISA 1CQNA 4AQYF 4JI1F 2UXBF 4LF9F 4JI8F 2UXDF 2KJWA 4DR6F 4KHPF 4LF8F 4DR5F 1XMQF 4DV1F 4JYAF 1J5EF 4JI4F 2B7BB 4DR4F 1IBLF 1IBMF 4DUYF 1IJEB 4JI2F 4X66F 4DV5F 4YHHF 4JI7F 4LF4F 2UU9F 4LFAF 4B3RF 4B3TF 1IJFB 4JI0F 1I94F 2UUCF 1FKAF 4DV0F 1HNXF 1GH8A 1B64A 4NXNF 3T1YF 4GKJF 4LFBF 2UXCF 1LOUA 3OTOF 1IBKF 1HNZF 4YY3F 3R3TA 4LF7F 4DR7F 4DV7F 4DUZF 4LF5F 4GKKF 4DR3F 4X64F 2VQFF 4NXMF 1G7CB 4JV5F 4LFCF 5IWAF 1QJHA 2VQEF 4JI6F 2RJZA 1F60B 2BXJA 3T1HF 2ZM6F 2F4VF 2B7CB 1CQMA 4K0KF 1FJGF 4DV6F 4DV3F 2YY3A 1N32F 1VMBA 4DV4F 4B3MF 2UUAF 1XNQF 5AJ3F 5LMUF 4X65F 1N36F 4DR2F 2BVZA 1N33F 4DR1F 2UUBF
chains in the Genus database with same CATH superfamily
1N88A 3EVWA 4MIBA 2LXIA 1R43A 3MMBB 1Q1KA 2UVWA 3PX0A 5IFMA 2PEBA 2RQMA 2BJ1A 2ILYA 3T9ZA 5LT5A 3OLAA 2HS4A 1S1TB 1KQGB 4DR1J 4HDGA 4RU2A 1N5VA 3EXCX 4U8VA 4ZDNA 5L1KA 1HR0J 5LMNJ 2XWYA 2MSSA 1V3RA 2N3LA 1VJQA 4B3RF 2EFQA 2BW2A 3M8RA 4KAIA 4LR9A 3EXYA 2CJBA 3KK2B 3W63A 2MY7A 1SL0A 1TK0A 3DM2A 5EGYA 4PWDA 3LGHA 1VLOA 4ZLPA 3PYGA 1N0UA 3TUZC 4KHRA 3G71S 1RT2A 1YZ6A 4X4PA 1HYSB 4QW9A 5DZ7A 2WVFA 1HIYA 2RILA 1HWLA 1HNIA 1PAUB 3PJXA 3FCVA 2YNGB 3CVKA 1UVLA 3F41A 3J7AN 2PO4A 2W7OA 3BBBA 4IQXA 4CH7A 5DDQC 3S7RA 2DKOB 3DLJA 2EFOA 1BMQB 1Z4UA 3ENVA 2ZDOA 1DY3A 5C24A 4K4SA 3NCRA 3QT7A 3PKMA 2VV5A 4W90B 4YHHJ 2CG4A 2ZBPA 3OW2R 3HMJG 3TANA 4TYBA 3TVZA 1X8DA 2RSQA 1U8WA 2CQDA 1IJFB 4X84A 3TEHB 2K7JA 1SQEA 1QAYA 2W9CA 1HL6A 2VG7A 4G3IA 3IS9B 1ZETA 2L9DA 5DG9A 1L3SA 4NXMF 3KJFB 1RU1A 3WX4A 5DQHA 4PQAA 4AL5A 1FT8A 3M6XA 2F4VF 4ED4A 3UR0A 4ZMMA 3TQEA 2BJ8A 2IDLA 1Q0NA 1SKRA 4BCAA 3AD8C 5KFQA 2K1RB 3TZWA 1T3NA 5G4DA 5BYSA 3W64A 1JJ4A 4NRTA 2V63A 3MCMA 2VC0A 5A0YA 3THTA 3TX0A 3BGUA 5DQIA 3FKBA 2YXLA 5KOXA 2DJWA 3ADAC 3D6FB 1S9EB 4DHVA 2M0GB 1I1GA 2V2ZA 5DGAA 2IAJB 3HSDA 3FQLA 4KBIA 4OFZA 2QLBB 4DSKA 2J9CA 3EPIA 4ES2A 1LOUA 4I2PB 2O5DA 2BQRA 4RUCA 2E5JA 1P9YA 2FLLA 2OUGA 4FPRA 1F1BB 4DS5A 3E01A 5E7OB 4QR0A 1HQ2A 2KG0A 1RJJA 4NXMJ 5CA5A 3CF5Q 3UNGC 3IWNC 2XWXA 1R27B 3DDIA 1MLAA 4M5MA 5F3ZA 2F4VJ 5BYQA 3U1MA 2QSWA 4K4VA 1UCNA 1U6ZA 3LPYA 2U1AA 1R8BA 1DTQA 3RAQA 2WSCC 1BQNB 4OHVA 3GIRA 4QPXA 3P4UB 2J0XA 2R7SA 4ZVFA 4R5PA 3VGTA 4ID5B 2W9BB 2HKEA 4C11A 3R6GB 5ETMA 1NRKA 4LFBJ 2BKNA 3KNAA 4NXNF 4L73A 1ZTWA 2XULA 2EBEA 5IV3A 1T05A 2BACA 3BR9A 1L5UA 1K73T 3Q8RB 3MDFA 2KVIA 2CPHA 4JV5F 1S49A 3MEDA 4X4VA 2AV5A 2HIQA 4CIOA 2HPUA 5E3QA 2GQQA 4J9QA 3R2DJ 5CYQA 1DQAA 5ITHA 2IM3A 2HWHA 5D77A 4MKBA 1SIWB 1D9DA 4J9VA 2CDQA 4B9NA 2CQPA 2H1YA 3VV2B 2JFDA 4ANCA 5C25A 2NXNA 4JBCA 4DV2F 1HD1A 3KDNA 2HBQB 4PYDA 1RWOB 3EJMA 2HHUA 2EI5A 3PCOB 5D0HA 1I6JA 1UVIA 3TZXA 2DR9A 1EP4A 4Y6IA 1X5TA 3PRVA 1XIQA 1ZPWX 3K8WA 4USKA 1HPZA 2DH7A 5HAOA 3HI9A 5B08A 1KOHA 1NMEB 3BKTA 4DOZA 5F0UA 2LCWA 1U1NA 1M1GA 4CP5A 3ILOA 4CLLA 1SB6A 2UVUA 1NHKL 4NXNJ 4NI2A 4J9NA 4OYPA 4ZLLA 5F9LA 1UPMB 3FZBA 4I6YA 4BC9A 3SZ2A 2G9OA 1W2IA 2O66A 4EBDA 1N32F 2VASA 2OO4A 4JV5J 4I56A 2ZZTA 5C5JA 1NEEA 1QSSA 4L72B 3ZNUA 4P74A 2MQ8A 3FFIA 4Z37A 4FXVA 2F9JA 3M2UB 5CYJA 4LF9F 2DY1A 4CLPA 3NNCA 3N6MA 2G0JA 4NLOA 1NDPA 3IBCB 3K5NA 2QTWA 3GR1A 1Y3JA 4DU7A 2ZH1A 2CA9A 2FC9A 2ZC4A 1BD6A 2AP6A 2L41A 2WONA 2B9XA 3MF5A 1NZAA 1U1QA 4O0NA 3AODA 2NR0A 1B64A 2PT0A 4LVNP 2YBVA 3C16B 3NGKA 5FLXU 1JKHB 1JLCA 3G6XA 1QTMA 4I68A 2HG4A 5IOLA 2VPYB 4URSA 5ADZA 4ZPDA 1OYEA 1VOMA 2DNLA 3IR5B 2MQNA 4DL2A 4MKVA 2FLOA 4PRFA 1VQLS 3GFZA 3GONA 2HSEB 4L74A 4WE1A 1S0OA 4MTPA 4C48A 2YKOA 1X5OA 4MFBA 2W8LA 2OPQB 2N4DA 3GV5B 4ELUA 1H2UX 4IG0A 1R7IA 2FVQA 4X4SA 2P6SA 3FC9A 1N32J 4AQYJ 3CULA 2GGPB 4PCQA 2PN6A 2FGOA 2HVIA 2P6TA 3Q8PB 1HBUB 3PEHA 3DXSX 2VPZB 2W24A 4DV1F 4URQU 2HGNA 1X4BA 2X1GA 5LJ5Y 4LF9J 4XPEA 1VFJA 3KJQB 3DI6A 5D4NA 4G1QB 3NP5A 3N4WA 3RW7A 3FSXA 2VF3A 2M5YA 1VQOS 2IBOA 5IV4A 8RUCA 3NGSA 1W26A 3LUYA 1UW4A 3CDUA 2OEKA 2ZWPA 2Y1RI 3H8YA 1FFGB 5HP1B 3CJ3A 1VIXA 1ZM3A 2IPOB 3VAJA 4L6V3 4B9LA 3VQSA 2HNDA 2K7KA 3IBWA 3CO9A 4NLSA 3QT6A 4M5DB 1CBKA 2B51A 1V6HA 3MM9A 1YRTA 1JLGB 1TL3B 4NLYA 4DSLA 4ELTA 3ISZA 3EPGA 2AW0A 2KXFA 5HROB 1ULRA 4HVZA 6FDRA 1X5SA 1VQMS 5U47A 2UVVA 3FEZA 1YX2A 3CMQA 3MR2A 1IQTA 3I4PA 2IRUA 1RTDB 2F40A 3AOCA 5A6WA 3I32A 3ET6B 1YZ7A 1NJYA 4IR1A 4DV1J 3L7OA 1JLAB 3M05A 5KFWA 5AE2A 1FD8A 5F8MA 5K5MA 3LTOA 2I1RA 4LF7F 1HI8A 1NHVA 3SV4A 3A4TA 3MMCB 3GG1A 1X5PA 1YJRA 4DX5A 3C46A 4DX6A 2IM0A 4OIXA 3UVJA 1U45A 1Y3KA 5DLGA 4X65J 2V2KA 1H2TZ 4DV4F 3KLVA 3C15A 3J81j 4LSLA 1H74A 3KHLA 4OYWA 3UI3A 1ZAXA 2XZWA 3B4DA 4FF1A 3ZTQA 3DU5A 3QIPA 3IA0A 3MM6A 4B3SF 3W9HA 3VALA 4C8NA 3OUYA 4UTGA 3DRSB 2XCAA 3LWLA 4ZVGA 2DNQA 2IIHA 3J7YI 4WYLA 3PX6A 4ERDA 1VQYA 4MMOA 5LM7E 4KKOA 4XK8C 5A8KA 1X4CA 3OSNA 1WUUA 4OJGA 2JLGA 2E1RA 4HR2A 3QO9A 2I5JA 2GMJA 2A10A 2KT5A 4R25A 2GVZA 3D1HA 3LP2B 2AGOA 1C0UA 2LFVA 3N0VA 2CPEA 4R0EA 3AJ2A 4KGXB 4EK2A 5KFJA 1T9UA 1RT4A 3BO3A 4MAKA 1S6OA 2IVMA 1TKDA 3GFYA 1T11A 4LF7J 2OELA 1H98A 4ECWA 2O1PA 2HNYB 1TUWA 4MK9A 3DLKB 1P1TA 2KG1A 1PKUA 1SC4B 3JQKA 4TQRA 2HFNA 1S9GB 2BJ7A 4YS2A 4DSFA 4DV4J 2Q3PA 1ZTTA 2R7XA 3POTB 1T9TA 1C1BA 4WIQA 3MAAB 3LGNA 3G6VA 4F3MA 3IAM9 2ZOMA 4B3SJ 3RB3A 1FXDA 3ILLA 4I2QA 1OY8A 1UA0A 2OPRA 2R7RA 4PZVA 4NMLA 4I6WA 2D3O1 4K50A 1R8AA 1U2FA 2XMTA 3L09A 2KN4A 3PJWA 3BPSP 4DF4A 2XZDB 2F65A 3CSKA 2GW8A 1C0TB 3BO2A 1JLBB 2MZ1A 2DNZA 4OI4A 2XGQA 2BW7A 1GQEA 3VQTA 1R8CA 1HHSA 1S1WB 3QYYA 2XSJA 1CS4A 2J76E 1P8GA 3MECA 1DBDA 3H2VE 1S1UA 1FHTA 2V67A 3BYRA 2VJUA 3LPEA 3HVTB 4DLGA 2CXEA 4RU9A 2HVEA 1XR6A 3U1NA 3ISND 3IXQA 3RBZA 5HBMA 2LEPA 2DNHA 2Y0SD 1BQXA 2JVOA 2I6WA 4ED2A 4IH6A 2IJRA 5B0DA 2ZZNA 5A8WA 4ENOA 3HLUA 4YB6A 1RWXB 1DURA 2HIYA 2L9NA 1RHRB 5FIIA 1NDLA 3R5GA 2ZNZA 2V34A 4Y2KA 2Q43A 4P2SA 4DS4A 2RH3A 2G4BA 2KTQA 2LXFA 3R5JB 4IR9A 2JSXA 3IRWP 1M0SA 2CPZA 2BEFA 2KVQE 1F2HA 2IM2A 3DRRA 1TTHB 2K3KA 2BUNA 1REVA 1OS5A 2UUBF 2OH2A 2XG8A 1X9MA 3N6LA 1Y0HA 4ZJLA 2BJEA 1JXLA 4ZJOA 2CAJA 3DHXA 3RBDA 1AFJA 4JV1A 4LR7A 4I7FA 3FSIA 4J9LA 2WW8A 1X60A 4USJC 4ZP6A 5DRKA 3J7YU 3MTJA 4I6AA 4KFBB 4CLKA 2PA8D 3HJVA 2DYAA 2FHMA 2J6TA 1NDKA 4HI1A 3Q2SC 2Z30B 1LKZA 1RTJB 2H5JB 1NB7A 4DXLA 3M1VB 2NSCA 3N5FA 4YY3F 3I96A 4NRUA 3D5MA 3NRBA 2V4JB 4ZLNA 4ZKAA 2E1CA 2VJVA 4M5JA 2VZ9A 3V6DB 2W9AA 2ZHBA 2H5EA 4HL9A 4UY8T 3MMAB 1F5BA 5B0BA 1EKSA 3QZ7A 3ETOA 4JUZA 3SCJE 4OLOA 1MMLA 3M2VA 5AJ3F 9ATCB 1X9WA 1MG7A 3IR7B 3JTPA 2W2OP 2WRMA 4K8RA 4A8FA 2R2RA 4IH5A 2W2QP 3T19A 4RW9B 3R27A 4P72A 3FQKA 3MWBA 1XC9A 1IKVB 1FXRA 1RTHB 4MT1A 2UUBJ 2C22A 1RKIA 4FKXA 1XWLA 5JMNA 1K8AT 3VAHA 4ZP8A 1FXLA 1SC6A 3M8QB 2A3JA 2VH7A 2W8KA 2DNOA 3DRXA 1VQ5S 2W25A 3H2LA 4G65A 1TVRB 1DARA 4Q8FA 1PJ7A 2OPPB 4ZCMA 1UMJA 3PO5A 1OPZA 4M94A 4USVA 5FLXY 3ENQA 1WC0A 3TAPA 3R7NB 1N5YA 1FNXH 3H4DA 4P52A 5J1PA 1MWQA 2J8SA 2E1PA 2K2PA 1J5OB 3HHDA 2HFOA 4YY3J 2WK4A 2OEJA 3PJ9A 2ASYA 3DOLB 4OYMA 3MTKA 1Q82T 1Y7PA 1VDHA 4F36A 5BXIA 2CPDA 3QLHA 3ZXWA 3OR1A 4HT5A 2CZ4A 3CCWA 4AD6A 3X1LB 1TK8A 5D3GA 4OI6A 5AJ3J 5HN0A 2MKHA 1BGXT 1O8BA 4K4ZA 2VOPA 1X7VA 5EX3A 1PYSB 2MPUA 1MW7A 2R7UA 3AY0A 3OFFA 3SSRA 1RDRA 4ZIWA 2HQCA 1HMVB 1J2VA 1JNZB 4DL4A 4KYZA 3V81B 4O4RA 4F04B 2AJ2A 2O67A 2J9DE 1QUVA 1U6BA 3GE9A 3KK3B 4NLUA 1PC5A 1UJ6A 3N5BA 3CCSS 4LF5F 1R6VA 1JLEA 1G7CB 2BBEA 4RUBA 2QX0A 4WZQA 3CMES 1IKWB 3ZFVA 5K20B 4GVBA 3LH2S 2DPIA 3MD1A 1TAQA 3W8PA 3BJYA 4OZ3A 4LR8A 3R6LB 4USMA 3H25A 2OMOA 2YKPA 4DJBA 2CRLA 2M4MA 2XO7A 1C1CB 3DYAA 2CQ2A 4KV8A 3AD7C 4WFNQ 2N7CA 4Y0FA 1D9FA 5C42B 1WF2A 3T5LA 3I6PA 1VBYA 5D0GA 2HRUA 1HW8A 3FBFA 2HHQA 3PIPQ 4IQMA 1MROB 5DETA 1OY6A 1RT1A 2MQQA 4X66J 4DU8A 2FZCB 3ZC4A 1T03A 1M5VC 3KLIA 3CJKA 2P9GA 3KG1A 1M5KC 4ED1A 3DLHA 4IG3A 1NH8A 4TKTA 5GADI 3W9JA 1SUQA 3DLGB 4NA1A 2FHOB 3NAIA 4ICLB 3O5TB 3DU6A 4PYAA 1F6TA 4USHA 2XLJA 2IHR1 4RO0A 3GIJA 2X1FA 4C8OA 2OHDA 3D68A 4YMEA 2YY3A 4LF5J 2UUAF 5KT7A 3MCOA 4WTOB 5K8PA 4WKYA 3PRDA 4Q2MA 5SUHA 2HHWA 4F4ZA 3UDLA 2RB7A 2FJAB 4DG1B 4XDDA 2E5GA 3TW0A 3ELHA 4NASA 2AGPA 3CB4A 5A76A 2MZQA 2LA4A 1F2GA 4FYYB 3DRPB 1DJ0A 5A8RB 1CJVB 1KP6A 1RTZA 2CJYB 3MZIA 4JOUA 2DD8S 5KFEA 2MKCA 3MM5A 3GV8B 3SQGB 4CM0A 2KM8B 4CT9A 3OFHA 4PABA 4EBCA 4P6QA 3R5CA 1HD0A 4DDFA 2HK2A 2HMIA 5KFPA 5EHHA 3V4IA 2NXJA 1JK9B 4C8MA 2ALZA 1LWCA 1W2BR 2R7OA 2ZH5A 2XMMA 3CIZA 5B09A 1EX8A 3N01A 1C4CA 1YWXA 2FC8A 4MK7A 5DS7A 1BC6A 2BXJA 4PWDB 1VRUA 1YJ7A 4OL8A 4U6PA 2LU2A 1RT2B 3W5YA 1H3DA 1NSAA 3G8TA 4QU7A 4AXJA 5J2QA 4QYRA 4LMZA 2GO8A 2DNRA 3PKYA 3M2RA 4UOCA 3L7PA 2VOOA 1Q86T 4U67Q 2UUAJ 4JB8B 4CO4A 2MHEA 1X4EA 2EVZA 2QRRA 2PI5A 1Q7YT 1FESA 2ZOFA 4A8QA 2VA3A 3DOKA 3PFEA 4U7UD 4NX9A 5C24B 2MQPA 3JYTB 2FJDB 2RQCA 5JJBA 1RT6B 3BGLA 3JTNA 2VFVA 2ZC3A 1UZHA 3KKFA 2UUWA 4QZVB 1AB8A 1HWIA 5I3PA 1SXLA 3LP1A 2VBWA 1G2EA 5HATA 2FD2A 1EKRA 2QIFA 3IGVA 2Z8QA 2W9CB 3ZO7A 4R8UA 2VG7B 3K5PA 1XBWA 1K47A 1SC1B 3OXGA 2I0XA 3UWTA 4WFZA 3CJ0A 1TKTA 4YN3B 5J1EB 2QFIA 1JWWA 1UETA 2CZ9A 2IM1A 4TY9A 5IQ6A 3CDBA 2LP4A 2XNQA 1Y5NB 1MSWD 3LOUA 3H5YA 3UW1A 1HW9A 2F1FA 4ZPTR 2P5VA 1CQNA 4JI1F 2OAUA 3N6NA 1VQ6S 2R42A 2XMUA 2L48A 4RL1A 3F73A 4Q44A 3LW5C 3J7A1 1Q8BA 4NZ7A 3D6HB 5D15A 1YJTA 1RT7B 2O3DA 4JI0F 4IO9Q 2L9WA 2Q66A 1IKYA 3PO4A 1HARA 1T9WA 4DCJB 2DIVA 5CYMB 2VC1A 3HFZB 4NA3A 3NMRA 1HWUA 1VC6A 2NREA 1TAUA 3KYLA 3ULHA 2QZ8A 5KFCA 2D3OR 1XN9A 1MU2A 4DQPA 1JLFA 1JLQA 4NCGA 3H5XA 2U2FA 4A8OA 2VFUA 3A12A 3E01B 1YGYA 1U1OA 4WP8A 4OX8A 1FEHA 2R2TA 3WBZA 2QJ3A 3HDSA 2AYBA 2JEJA 1U2CA 4F7VA 5IC4B 2J9DA 1GMUA 4B9UA 2Z57B 3ILIA 3H5UA 2IRYA 3UN5A 4F3QA 2RUGA 4NL5A 1U1RA 2HHVA 4LF6F 4HTIA 4M8LA 4EMDA 4TU7A 3MURP 5AT1B 4ZN1A 1EB0A 3NS5A 1RAJA 2BR0A 1DTQB 1LWEB 4ETZA 4Q43A 2LQ5A 1XJWB 5A2QU 1QSYA 2FQQB 5F41A 4JI1J 2ILZA 3H42A 1K9MT 1HFEL 2WVDA 3VGSA 2DT9A 2LDIA 3GB0A 2D7SA 1IM4A 2A1BA 3IR6B 4AYBD 1JXVA 4J9RA 3H5SA 3H2UB 4EO8A 4JI0J 1T05B 4KC5A 3OL7A 2ZBIA 2XS5A 2VFRA 4DEZA 4LRCA 4ILLA 3BBFA 2CQBA 4CO3A 1GFWB 1T8EA 4OI3A 3OTCA 1X0FA 3TVKA 1G6BA 2PMZD 1WHXA 2B3TB 4OYAA 2GIRA 3EUNA 2RRBA 4NLPA 1NJZA 1LK5A 2HRTA 1WG4A 2YNHB 3HD1A 2H65B 2WVEA 3MMJA 2OIHA 4HDHA 2DIUA 1SKSA 4J9OA 1KHWA 1AUDA 1B7YB 1KQKA 3OHAA 2ASDA 2M88A 2VUGA 3Q89A 4KHPF 4IOCQ 1VQ7S 1WI6A 2IJFA 3D6MB 2DB1A 2HEKA 1FTRA 4K4UA 4LF6J 2B6AB 2UP1A 3VAGA 1CJKB 3I55S 4U95A 4LQ3A 1S48A 5B0CA 3OHBA 4ZHRB 1RWUA 3R7SB 4X4UA 4HYKA 3M9OB 5KT2A 5AXKA 1KBRA 2QYCA 4DV7J 1HPZB 2AYEA 1NUEA 1Y11A 3K2YA 1KONA 1TFYA 2IC3A 1FDBA 1OY9A 1URNA 1S1VA 4QOTA 3FNNA 4F0HA 3HHEA 3W2WB 2VB6A 4RW7A 4WFAQ 2AJQA 1D8ZA 5LXRA 1VR6A 4LVOP 2FVRA 2C2MB 1S1XA 1B0PA 3I9V9 3UD4P 3NMAA 3PHTA 4YP3A 3K17A 2LQ8A 2J6SA 1HQEA 3Q22A 4PG4A 4BLGA 3FFIB 4HH0A 3EVMA 2P9EA 1RISA 3A3NB 5EWEA 2AU0A 2CPFA 3NG8A 5FJ4A 1NB2A 3CGIA 2K8GA 5F8GA 3KLGB 1J5EF 2EEYA 3R2CJ 3V6KA 5J2PB 2VFSA 3OBIA 4NZ0A 3T1AA 4KHPJ 1WNEA 1S6PA 5IT4A 1Q5YA 3F0NA 2BX6A 3GQCA 4ECUA 4NYPA 2B4OA 4EUVA 2M8HA 3M8WA 4CZCA 2AJ4A 1YHQS 4ZIVA 5HLFA 4Q0BA 1NPKA 3A13A 1VBXA 2ZH8A 1AYEA 3BBCA 2DGTA 2EC2A 2V4RA 2VD3A 1EETA 4ZCKA 3N28A 1A9NB 2B9WA 2LEBA 2KI2A 4BHQA 1LQ9A 4WE1B 3CCTA 1S7IA 1VIOA 4MFBB 1RWMB 1RT3A 2HWTA 4IFVB 2ZJPQ 3EYZA 3W60A 2KH9A 3E2EA 1L3VA 2V0NA 4HT7A 2I38A 3EGVA 3HCXA 2RRNA 2NXCA 1S59A 3C6TB 2QLXA 1U0HA 2E5IA 4RW8A 2W01A 3UDCA 1YVFA 1RBOB 1FKOB 4RWXA 2YH1A 1VQ8S 4UUWA 1FD2A 1J5EJ 2VBYA 1IBKJ 1U1KA 1HNZF 4HEA9 4KH0B 2BE2A 2CG8A 1O5JA 2OD4A 2MQOA 3MR3A 1KOOA 4DZ6A 5K8OA 1FTCA 2CADA 1S4FA 3UDEA 3DOMA 4IRCA 2H51B 5J1NA 5KAKA 1XNQF 4E0DA 4QW8A 4N41A 3HVRA 3UN2A 4YOEA 4LBPA 3IC1A 3UQSA 3UCUP 3ZNJ1 1DZ5A 1LW2A 3R5AA 3VF0B 2FYXA 2HAIA 4H4OA 4K4WA 1YBUA 1S4EA 3Q23A 1R8HA 3D0HE 5HK4A 2I9SA 4CDIA 2QL9B 3MMBA 4LUBA 4W92B 4UZCA 5BYRA 4O0IA 3D67A 1PCAA 2DRBA 4P9SA 2BRLA 2OD6A 3QJLA 4QYZJ 1RCOB 4DMZA 3OL6A 1CPZA 4RR5A 2ROEA 1ZH5A 3VAMA 2XYGB 3SCIE 4PQUA 2C2EA 2HQFA 2J9EA 2R8GA 2YPYA 5KFFA 2G0IA 2ROGA 2H54B 3GLJA 2VKRA 2MDAA 4WZMA 4YR3A 4F4AA 3LF0A 3HJFA 4U96A 3PW7A 2E7WA 3UVJB 3JB9k 3OSPA 3B6BA 2C3PA 4IO1A 4DSEA 1HYSA 3C15B 1KVIA 4LSLB 5GAHI 5HQ8A 4WPAA 4H4KA 4B9VA 2BJDA 2NXEA 4MIWA 1XNQJ 1AT1B 3QIPB 2KJVA 1LW0A 3W61A 1DLOB 1B70B 1CULB 3MEKA 3QATA 3OUYB 2IYIA 1VQNS 1YJVA 1IR2A 2WTFA 3QFWA 1TMMA 4PWWA 1IJEB 5DM6Q 4LSZB 3G87A 4PUOB 3BGOP 2DNNA 4KKOB 2XGPA 4DPYA 3R97A 3FDSA 1S10A 3L4BC 3HT3A 3PRBA 2ZWOA 1KEKA 1XQIA 2X3GA 4Y3CA 2BE7D 1AZSA 4F02A 3RBXA 3CIMA 4ZPVR 3BSCA 2BKOA 2XS7A 4EI2A 1N4LA 4I4BA 5KG5A 1NH7A 2GVZB 3I0RA 4MKAA 2KU7A 1C0UB 2RNEA 3ZZZA 1V5VA 2XNRA 4FXWA 1UWAA 2QC3A 2UZAA 4LRDA 1U47A 2CQ1A 4FNIA 1RT4B 4DV6F 5K9FA 5L9XA 4DR2F 4OV1A 2HHXA 3OVSA 1FRXA 4K5RA 2EXUA 4XAKA 1NKCA 2HHSA 3BGRB 3BREA 1XMOF 2GVDB 5DG7A 2CDRB 3CCMS 5KG6A 1HHTP 3QFHA 4QYZK 3D3CJ 2K1RA 1GX5A 2PFFB 2ZUGA 4JI8F 1YJ9S 3KLFB 4DF8A 3W7BA 4DI6A 3QIDA 4WCEQ 2DITA 2V8VA 2KRRA 1HBNB 2RUSA 3NNHA 5KOWA 3AD9C 1PSDA 1S9EA 4I2QB 2FDNA 2OPRB 1AFIA 1W25A 2XC9A 4USUA 4HKQA 2AYMA 3BSNA 1X31C 3GSIA 4PG6A 3M4XA 2ZBQA 1KKHA 1XR7A 5CH7B 1KLMB 1WSRA 1F9FA 4I2PA 2OTJS 3EZ5A 2JHEA 2DGSA 2LYVA 4Y00A 2DCUB 3CJ2A 2C2ZB 1SJQA 5CCMA 1IR0A 2VDIA 2Z58B 3PACA 1AROP 3BO4A 4DV6J 4ZPWR 2XSJB 4O3PA 3MFHA 4DR2J 2E7VA 4C0BA 2HGMA 1KQSR 3C19A 4ES3A 3KNGA 2QA4G 5KFYA 3MECB 1XMOJ 2RDIA 2YWGA 2AKWB 3NCQA 2D41A 3TP2A 5A2QY 3Q8SB 4RZRA 3MOJB 4JI8J 2YKMA 4U9RA 4OJ1A 1U1LA 5HBMB 4W98A 3NGUA 3DLEA 3KJVB 1FKAF 2LMIA 7FD1A 4ED7A 2W9BA 2DTJA 2J6UA 3SFUA 3JQJA 2QLFB 3JSMB 3I0SA 5A8WB 1KD1T 2WBMA 1EIYB 4X4TA 2RF2A 1URRA 2C2RA 4LFCF 1RKJA 2NCKL 4D3GA 1PJ6A 1WG1A 2MKJA 3B54A 5I4MA 3VTIA 4XO0A 3THVA 2UUTA 4ETXA 2VA2A 3OR2B 1ZZFA 4B3OB 5EUHA 3CWJA 4OLPA 2KZZA 2LU1A 1NPRA 4TLRA 1O51A 4YR2A 1ITPA 3P49B 3CC2S 1FEEA 5F8LA 3RJMB 5FD1A 4ANDA 2DGQA 3U27A 4KQZA 1SJ1A 3MPDA 1VQKS 4I7FB 4Y2IA 2MGZB 4LBIA 1B0TA 2Y1JA 3MCNA 4C98A 2AEJA 2YKQA 2H48B 3W8GA 4YB7A 2N7YA 2G1DA 1M90T 3PEJA 3B78A 2HLUA 2VDHA 1H7WA 2F5GA 1ZA1B 5GAEI 1TL7B 5H9EJ 2OPSA 3DLBA 4P73A 3W5XA 3AA9A 1DTTB 1F9HA 1VYAA 4NEZA 2Z2YB 4NCBA 5T7LA 1WACA 4LF2A 5DQGA 4ZPBA 2Y1LB 3M8ZA 2MSTA 1GMWD 2R9LA 2NZ4A 3QGGA 2FJVA 5LMUF 4LFCJ 3PM9A 5GVQA 3M2VB 5L9NA 3T6JA 4RNMA 2CQGA 2D1CA 1SCJB 5BR8F 1V3ZA 1SJFA 1SJRA 2J0QD 4A8KA 2HURA 4OX9F 4FXDA 1RWWB 3DDKA 1D9AA 1WTBA 2KRBA 4BWMA 3M6VA 3M2UA 3M6WA 2WSEC 2Q6BA 1MN7A 5F0WA 2MYFA 3K59A 1VBZA 3ZZOA 3UNYA 4QIVA 4F67A 2GJ2A 2FJEB 2QYGA 3IAS9 1TKXB 1HBOB 4BBYA 1WI8A 4ECRA 4ECZA 3MI7X 1UP1A 3QPIA 4DL0C 2GMHA 3C16A 2LEAA 2PFDA 3MGJA 4QWEA 2FY8A 3HF5A 2RAQA 3EVOA 1IUJA 4DL3A 5GAGI 4FF4A 4WXOA 1B7FA 1RU2A 3QLHB 5LMUJ 1NJWA 1KWMA 2OPQA 3BS9A 2FGCA 4ILMA 1X4FA 5D3GB 2XO6A 1NSPA 5BR8J 3CDEA 4DZDA 5RUBA 4B08A 1I51B 4OX9J 1NK8A 2YQ0A 4DV5F 4NLXA 3TOQA 3VHQA 1U7LA 4TN2A 2ALYB 4WF9Q 1CJUA 4B3RJ 2M3DA 4C3LA 1HBUA 3D0GE 1F9EB 2GS8A 4C3KA 2DEJA 3KG4A 2DNYA 5GMKa 4G1IA 4OQJA 2CPIA 1HQUA 5B7WA 4G1QA 3UFCX 4ZVOB 2V9KA 5HO4A 2ZJRQ 5IXUA 3RRGA 2ABYA 5E3PA 3AOAA 3TUJC 4HACB 1P6TA 1VRQC 3JXOA 5HSPA 1XERA 5HL7Q 3OT9A 1U26A 1YRXA 4I64A 3FEYB 2VONA 3O3LA 5HP1A 4MKYA 4Y34A 2D69A 5HQMA 1TL5A 4OZNA 2F8EX 4M5DA 4Y65A 2HFSA 3M9NB 5G0RB 1JLGA 1SPBP 2ZKUA 1FRHA 2Z2LA 1TL3A 5DDPC 4UQGA 2MKKA 4KV8B 3AA8A 4DR6F 4A8MP 3QMQA 5HROA 1SQFA 2DR7A 3AHPA 3TAMB 1FA0A 3HVWA 1IBLF 1RK8A 1RT1B 2CQ0A 3IWXA 4AL7A 2YKAA 1FK9A 5HQLA 3O1LA 4H4KC 5IS2A 4AE5A 2BKPA 5FDLB 4WU3A 1RTDA 2EPIA 4IG3B 3ET6A 5E5NA 3I56S 3MR6A 1XMBA 4DV5J 1SUQB 1GX6A 3PDNA 3AB2B 3QGHA 2MLYA 4GVLA 1SKWA 1JLAA 4KO0B 5DJBA 2DY9A 3BEGB 1S6QB 2YX1A 3ENAA 4ZOSA 2BYCA 1GXTA 2UVRA 4ES1A 1RXOB 2ATLA 1N36F 3PYDA 2BRKA 2CQ4A 1FNOA 2RS8A 4DBQA 3PR5B 2LXUA 1RHUB 2DCLA 1OSDA 4RWWA 1C4AA 1HNVB 3P3DA 2HBRB 5KFBA 1SBRA 2GMLA 3Q83A 2KXHA 2AIRB 2YVSA 3EDRB 3CXCR 4U8YA 1S76D 3I82A 3MEEA 3VZIA 4Q5VA 4ELVA 3DRSA 2DRAA 2DR5A 2JC1A 2DRDA 1SJ3P 1CC8A 3NNAA 2QEXS 4C4WA 4FVCA 4DR6J 1H2VZ 1FFSB 2DK2A 1IBLJ 4QR1A 1P27B 1X0PA 2H9ZA 1PG5B 1S6UA 3M8PB 3GU0A 2HMIB 3JSBA 2E9TA 5DO2A 2W7AA 3V4IB 4X64F 1GTHA 3EE3A 1H0HB 4NLQA 4NCAA 2YNFA 4IFYB 2NUHA 2NUUG 3DC2A 3RAMA 4XIUA 3E8OA 5DZ6A 1VRUB 1ZAWA 4YDDB 2AJFE 4ZA1A 2HHPA 1NLKL 1E6YA 2NYIA 4YUDA 5CD4A 3HM9A 3BGFA 1NK6A 1T3OA 2HNYA 1RLDA 2WVBA 3GYGA 1N36J 3DLKA 4CRJA 1JMTA 4I0WA 1QLNA 1ICEB 4YQWA 3NGTA 1SH0A 3QSIA 4BWJA 1KR4A 3DOKB 2XBPA 3K5OA 4IYQA 2UV8A 2B7BB 2X51A 2VL1A 1KTQA 4DL7A 4B9MA 3MAAA 2C2DA 2BA9A 4DFJA 1AW0A 3VWSA 3BM7A 3HX9A 4F0KA 2ASLA 2H4WB 4FVMA 3H7HB 1NKEA 2W1BA 1Z1ZA 1TFWA 1FWKA 2JWNA 3A3OB 4ZJQA 2DEIA 3WC2A 2BM0A 3TQ1A 1AXQA 1LFWA 1B0VA 1Q16B 2JC0A 2CWKA 4R8UB 2JJ4D 4O44B 2CUYA 2FVCA 1PBAA 3OFGA 3JAMU 2KFYA 2EC0A 2GIFA 2DHSA 1TKTB 2CNLB 2WW4A 4X64J 5AE1A 4DX8H 1KC8T 5HMZA 3DXBA 3OVAA 3ZZPA 4CT8A 2LQ9A 2J0SD 1KNZA 4DV2J 5KFZA 1RBLA 2JZ5A 3CE8A 2HQIA 4IUFA 4AFFA 2YKNB 1S1WA 2GNKA 1F5AA 3RB6A 4F4YA 4YB5A 3PV8A 5J2NA 4A8SA 3TI0A 3MUTP 1HBMB 2KO1A 3KOAA 1WTFA 3C8YA 2EK1A 3Q2TC 5J2MB 3BV8A 1SV5A 2V50A 3I9ZA 3G96A 3TRGA 3KK1B 2EWHA 4KY3A 1Q81T 4KPYA 2QT7A 4GMKA 1I5OB 3TJ8A 4AT1B 3UE2A 2C42A 2HZAA 2JEGA 4IKAA 4AXIA 2BV3A 1JLFB 1Y5LB 5THWA 4J9MA 4ZVTB 2ZITA 1PBUA 2J7WA 3NAHA 2FB0A 1GMVA 4A46A 3OJUA 1D3WA 3WIVA 5EWGA 3HPOA 3NL0A 3M32B 3G82B 4ID8A 3W62A 4NA2A 5LSOA 4RPFA 5D78A 1FE4A 2BZ2A 3CD6S 4OYZA 1Y5IB 4IDKB 4DCOB 1OYDA 5JUMA 1K0TA 1TZ0A 5H1SV 1PGZA 4OX6A 1HWJA 1NM2A 3NOCA 1UVMA 1BQMB 2HW3A 5KFHA 3G9CA 4K7QA 4LREA 2V8HA 2PDAA 4I69A 1FE0A 4MK8A 3BSOA 1RTJA 4PPZA 4TYAA 3M1VA 2OLWA 3NOGA 2C3UA 2RJZA 3G6ES 3SBMA 2V4JA 3CCUS 1WDTA 2CFXA 2VPXB 3CC4S 1Z2LA 3MMAA 3R1HA 3PFOA 4Y2CA 1OJ4A 4P71A 1R0AB 3CO0P 3FBCA 2HHHF 3CCLS 1TR0A 3AXKA 3LWMA 3QGIA 3NEKA 1VCTA 2NPFA 2GCFA 4L3NA 4TXSA 1RSCA 2JVRA 3D1OA 4L76A 2ZZMA 2H5IB 2WB1D 2Q1LA 3EGWB 1NO8A 1RTHA 2WZ1A 1GEHA 4DV0F 3DKDA 3M8QA 1RAIB 1NNDA 1RAGB 2UXCF 1JIHA 4ZCLA 3P96A 3GJTB 1NK7A 2OPPA 3CUNA 3KLHA 3SEOA 1V3SA 2Z0GA 4F8RA 1EQMA 3M7VA 3FBBA 2GHWA 1U0SA 4J91A 2CVEA 4B3MF 1PIEA 3IRXA 4NMXA 2ZUAA 2VG6A 2V9WA 1J5OA 2BANB 2B9EA 1KVKA 2NLWA 2IMOA 2WSFC 1WWHA 2P2CB 2IY5B 4CTAB 3ZTOA 3ITHB 3AAWB 1QSLA 4RJVA 2IDEA 4F4KA 2PD1A 3MPWA 3CD5A 5L38A 2HHHJ 2B0GA 1IBMF 1QVFR 2BM1A 2QG9B 5M2RA 4H4MA 4JI7F 1A6LA 2HRYA 4RW4B 2DNGA 2IVFB 5LOQA 5F8IA 4EZ6A 1PC4A 2M7SA 1HMVA 2HYIB 1GXLA 3G6YA 4TNOA 3V81A 3C6UB 2BABA 4DV0J 1O6XA 1ZYQA 4YB1P 1JX4A 4M5KA 1L3UA 2UXCJ 3BH6B 2A18A 4NLRA 4CWBA 2IRXA 4Q0BB 2Z56B 1TP7A 1VMBA 5D6GA 5CZVA 4DL5A 1IKWA 1N56A 1YIJS 3TVYA 1ZOTA 3US5A 1TKZA 3RGIA 1UVNA 4RW6B 4TY8A 1ZA2B 2JH3A 4ZN3A 2VKZG 3UN3A 1RT3B 2EG2A 5ETRA 2NYHA 3P5BP 1VHFA 2XZTB 2RD5C 3T5JA 1UVJA 3M30A 2JNJA 2BQ3A 1RB0A 3B82A 1MROA 1U0HB 4RW8B 2ZH6A 3MOZA 4EBEA 2UUCF 2FUG9 1TUGB 2PGCA 4URGA 1YJNS 1PILA 1IBMJ 2VODA 2DBBA 2KT3A 1ACMB 2QE5A 2DHHA 1BHNA 1CJTB 2MKSA 1Q53A 2QA1A 2ACMA 2MLXA 4JI7J 4ZCIA 3DLGA 3HSGA 3DMJA 2BE2B 3FVYA 4RBUA 4F4WA 2NSBA 2V94A 2R4FA 3EDQB 4Q8EA 2FJBB 2AD9A 3PYEA 4OJHA 3LGMA 4K0KF 3VR1A 2OFHX 2HQDA 4J9KA 1RHQB 4NLGA 3GIIA 3KMQA 1U09A 5KFOA 4IOAQ 4O4GB 2A6OA 3PX4A 2F8MA 4ZVEA 4NOHA 4EFAC 3QGPA 4KB7A 1WSVA 2CJAA 5KTQA 4Y2MA 3IP0A 2ZE2B 1RHMB 3I31A 3LP0A 4DG1A 2R7WA 4H4OB 1RZMA 2Y0BB 3NLCA 2QN6B 5HMXA 1X4DA 1W7WA 2F9DA 5F8HA 2OGUA 3DRPA 4YHHF 1V9OA 5A8RA 1CJVA 4LF4F 4MH8A 3NBPB 2APOA 3IFEA 4C0OC 4QWDA 3IG1A 1APSA 5M2PA 1Q7LB 1DQ9A 4HH1A 3NWRA 1R8PA 1WDDA 2EW9A 4FYDA 4OYIA 2HFZA 3SQGA 3S6EA 4M5IA 1FJ7A 3KLEA 5ETLA 1ZM9A 2UUCJ 1R89A 2DGOA 3EGZA 1QJHA 4PQUB 3OVBA 1IBCB 3H90A 1RTIA 5JVGQ 1UEUA 2GZOA 1FJGF 5JVHQ 4C7QA 5T14A 2ZH7A 3HKZD 2BVZA 3KJNB 2BE9B 1FVSA 3UCZP 1TV6B 4JI3F 4K0KJ 1SIZA 2CJ9A 4DQQA 2B9YA 1P1LA 2OSRA 2N4CA 2R8KA 4KGVB 3DFEA 1LW0B 4RX6A 1QY7A 4ZVSB 3D28A 2G13A 2NS1B 3JYTA 4G6VB 3HULA 1RT6A 3TA2A 1VRTA 2HGLA 1S99A 4CNYA 1WELA 4FP9A 3U7JA 2VBZA 2YWHA 2XHWA 3O8WA 2W4PA 4QCLA 2WBRA 4LF4J 1AZSB 3MM8A 1VGYA 1ZAVA 2WAQD 4ZVPB 1SH3A 3Q0AA 2CQ3A 3T1HF 5DDOC 1C2PA 3JAMY 3LQVA 1WC1A 3I0RB 1XR5A 2JRSA 2C3MA 3Q86A 2FLNA 1RE1B 2DGVA 2RKIA 4NWBA 4O3QA 1QAIA 4I1TA 2V8GA 5J1EA 2ZH4A 1N5SA 1FJGJ 1MMDA 3EICA 1YJUA 2V2QA 1FJEB 2QMXA 5L39A 3KMSA 5KFMA 1S97A 1NK9A 1GNKA 2XY5A 3T5HA 2C3OA 4X4OA 5K14A 4TQSA 3PNIA 1XEZA 4UF4A 4OHXA 5KG3A 3RR8A 4C6AA 4JI3J 4K5SA 5IM0A 1XMQF 4WJBA 3PVXA 2JOQA 1KS2A 2V5HG 3WIUA 4PXCA 2YWWA 1H73A 5KFLA 9RUBA 5MAOA 3A1YG 4LFBF 1NHUA 1K1QA 3OQ2A 4WP3A 1Q8KA 3QWUA 1RT7A 2RHQB 3C14A 3O2IA 4WK3A 4FYVB 2F8HA 1U25A 4KT0C 4DN9A 2ZJQQ 4E8UA 3K5MA 5CYMA 4GC6A 1UFLA 2GX8A 5ETOA 3B4MA 3LA0A 1IKXB 3NGDA 5ETQA 4PG7A 1WHWA 2IFXA 4DPUA 4F50A 3T1HJ 1VHIA 4OZ2A 3OXLA 1U8SA 1RA6A 1UKUA 2G2OA 2X1AA 3D6TB 5KFDA 1QE1A 3NS7B 3DRYA 3GIKA 1UEKA 1PYTA 4J7CA 2LECA 3OTDA 2XS2A 1JJCB 1VK3A 2WOMB 4ZP7A 3D7SB 4M1KA 1LWEA 1XMQJ 1FDDA 2YKMB 1SQGA 3RU0A 1FF2A 3H40A 4ZK7M 3DLEB 1R31A 1Q79A 4P2FA 4FF3A 1D09B 1IXKA 4QQBA 3ENWA 3IN5A 5DDRC 4FS2A 2MJUA 3I0SB 1WOOA 1EARA 5CQGA 5IWAF 2KFNA 3ICLA 2F7VA 4UOHA 2RF2B 1FKPA 2W7PA 3MR7A 5C2GA 1RWVB 2V8PA 4NPOA 3CCES 4K2JA 1U48A 3AJ1A 4KR0B 1WC5A 2PIIA 4OYOA 2GO9A 5B0AA 1IN0A 4C2MA 4M63A 2MQLA 3TZZA 2I2YA 3IBFB 4F2RA 1RAAB 4O3OA 3VAFA 5KFAA 4FYWB 3QRRA 4CH1A 2YNHA 1LWFB 3DGPB 3IGNA 2A2CA 3HO1A 1FJCA 3RTVA 1N8RT 3FUYA 2FY1A 3UR3C 2KXNB 1S79A 4CYUB 3HXMA 4B3TF 4LSNB 5ETNA 1OQ3A 2KHCA 2DR6A 2B4VA 1HNXF 1RYRA 3Q8YA 3GJSB 3ZZTA 1RWKB 3GILA 2DISA 2B6AA 1D0EA 1CJKA 1N6QB 3J7ZT 1WD6A 4ZHRA 3W5ZA 1VC5A 3W65A 2OPSB 1SC3B 3BQ1A 3T6BA 3FBEA 3MUVP 1BLUA 1MWZA 3HFVA 3SV3A 3CJ4A 5T7LB 3DHWC 1Z2ZA 5E2QA 2MZSA 3GWCA 5IWAJ 3W2WA 2ZFHA 3VVUA 2CZVC 1XK8A 1PAEX 2M2BA 3KHHA 5E3CA 4F2SA 3BN4A 3QWPA 2KHDA 4AQYF 1F3VA 1XTZA 4RUHA 2DGXA 2CVIA 1IR1A 5HVHA 3THPA 4DSIA 2J8AA 1R6YA 2POKA 5KG2A 2LKZA 2GJFA 5HVFA 3KLGA 2L08A 1RT5A 3DM2B 4PAAA 3T9NA 5J2PA 1CSJA 3QT8A 2C2NA 3K7RA 2HBYB 2AJ0A 4B3TJ 1TL1A 3G4SS 1HNXJ 2DVIA 4RNNA 1HNIB 3PIOQ 4U7UK 5D0EA 3KHRA 3SSQA 3AFGA 2RVJA 4EGLA 5BJRA 1RLCL 2D74B 3EMTA 4IOBA 4YDXA 5D0RA 1B3TA 3U1LA 4C8ZA 2ACYA 2HWIA 4XPCA 1O0PA 1YLXA 3FK4A 1YITS 2PEHA 4WTYA 2ZH2A 4DQRA 3Q8VA 2XMJA 2J5AA 1KSPA 4QIFA 4FN5A 3MEGA 1WOSA 1XNRF 3N9UC 3H20A 4PG5A 3KUGA 2YWKA 1FFWB 3IO1A 3I5AA 3KUEA 2ASJA 3WQPA 1DFDA 2CJQA 4HHHA 1RWNB 4IFVA 2HNZA 1NAQA 4OZLA 3I5BA 5I42A 1BUXA 1LEOA 2RDJA 4GO5X 3G8QA 5KFTA 2W2NP 5EDWA 4S0MA 3C6TA 1CJUB 2LQJA 2BQUA 3W2VA 1OO0B 2QL7B 5AXMA 1TUVA 2D9PA 3OTOF 1FKOA 5KFVA 1Q78A 5F9NA 3CNQP 4ZPCA 2D3ZA 1NPPA 3L3CA 4A8WA 2DHXA 1KFSA 2DHAA 4OI1A 1S7HA 1HQUB 1CEZA 3TYTA 4IRKA 1CVJA 2BOAA 3ZZUA 4X65F 4N7TA 5A0YB 3PHEA 1IWAA 1WKLA 2NZCA 1NSQA 4IH7A 1BXNA 2CJKA 4BC7A 2CQIA 2KM8C 1T9VA 4JI5F 1HA1A 3FZ2A 3BKUA 4CLZA 2MKIA 1UJ4A 2OTLS 2FZGB 1HWKA 4RBVA 2LLZA 4EYHB 3KUHA 1KDNA 3FEXB 2GQ2A 2KJWA 4QR2A 2MTLA 5GADU 4LT6A 3BF4A 2OKQA 1M5HA 3CCQS 1XNRJ 1MMNA 1H72C 4YR0A 1F0XA 3A8KA 3CCVS 3ISNC 2MY8A 3LANA 5I3UA 1U4BA 1UJ5A 1NU4A 3DCAA 3SDEA 3DLLQ 3C3LA 2B8PA 4N47A 1RAFB 1FK9B 5B0FA 2AHOB 2YQ1A 4FS1A 1AA1B 5LXYA 3R3TA 1IWGA 2AZ1A 4N5SA 3KTQA 2ZD1A 4OZJA 1WEZA 5DGBA 1X4AA 4NZ6A 5ETPA 5GMDA 3OTOJ 2Y9HA 2XYHB 4RNOA 1RABB 3LALA 4QU6A 3AQOA 2AMCB 2Y8YA 3M8SA 3R5DA 2RIJA 2PA3A 3JQMA 4OZ0A 4R5PB 2NXUA 4M5HA 3OXFA 4C11B 3TZYA 3R9LA 1UA1A 1QM9A 3RUBL 2KZMA 4ECTA 3BPDA 3UDVA 4JI5J 3ZZ0A 3OTEA 3G2XA 3ZZYA 4DUYF 1DLOA 1CULA 3GV7B 2VFTA 2GAGC 2QSFA 3MEEB 3PZPA 3RW6A 3HSJA 3A8JA 2HVDA 2E9ZA 4PUOA 3MEDB 2HZVA 3U02A 4UT4A 2DXFA 4ER8A 4DR7F 1F3FA 1P9QC 5CYQB 4EZ9A 1RACB 4P75A 5F3TA 4WBFA 4QJVA 2KYZA 3CD0A 5ETKA 4LRBA 3PG9A 4ZVHA 2YNFB 4QIWD 5C25B 1UVKA 3Q8UA 4OHYA 2AEFA 2J7UA 2VHGA 1L3TA 2R8HA 1E6YB 3PW5A 2AWZA 3DDNA 2ZDPA 2Z4PA 2DNPA 4OJ3A 3GPAA 3S8SA 3BGRA 1EP4B 1UL3A 4KGMA 5IC6B 2GVDA 1T7PA 2GAHC 4CLUA 4DQSA 1FRJA 3VVTA 4GRSA 3D3BJ 5E0OA 4ECXA 3CJ8A 1JQGA 3KLFA 3G86A 2XB2D 2EKYA 2XY7A 1UWBA 2Q6CA 1S77D 1HBNA 3AH6A 2RMLA 5ETVA 3GCWP 4DUYJ 2YNIA 1WF0A 4NI2B 3FRYA 4DUTA 2E5HA 1ZM4A 2ZBCA 3IWLA 3PY8A 3GZ7A 2VQFF 4KSEB 4P7VA 4H54A 2QO3A 2C2OB 3MPYA 1YBTA 4DR7J 1G4CA 5IZHA 1U49A 4F4XA 5LSRA 1KLMA 3J81U 2QV6A 4CQ1A 3CJSA 2E44A 4KH1B 1GAOA 4WKRA 1F5CA 4CO5A 3HZEA 3G8SA 2Y1IA 1S0NA 2B56A 2FPHX 4X62F 1NXIA 2VU5A 4D3HA 3CCJS 2WONB 2V6AA 3JS9A 3CJRA 4ECVA 2KFZA 2G2YA 4OI2A 5IT9U 3CPWR 1UZDA 3BDEA 2MQMA 5J2NB 3PTWA 1JLCB 1GK8A 4P7TA 1H6KX 3I5CA 6FD1A 3X3UA 3HFKA 1FO1A 3TUPA 3SMZA 2IVYA 2PE8A 3KJVA 2N82B 1SV5B 2OEMA 2B5JA 1HI0P 3HHKA 3TR5A 3WDOA 1LK7A 3JSMA 4EEYA 4ECYA 1KLNA 2NQPA 4IG0B 3FJ2A 4Q2LA 2VQFJ 3I87A 5L1IA 3D0IE 1SH2A 5EWFA 2WB4A 2CQHA 4PKDB 4Y28C 4JV2A 1FX2A 1NKBA 2H3EB 3OR2A 2E5LF 2M70A 3ZTSA 4B3OA 4DX7A 2JFKA 1EAYC 4CI0B 3RG6A 3DI6B 4X62J 3MPVA 3LAKA 3NWGA 2FZKB 3CDAA 5KFUA 3R1LA 4ZVQB 3HHLA 2B8QA 4LFAF 2VG5A 3AQPA 4ZPAA 2MGZA 3RB0A 1E6VA 1RA7A 5DM7Q 2OJ3A 1D1UA 4K2XA 3AB4B 2Y3YA 4O23A 2HNDB 5KG7A 1RQ0A 3SCKE 3A3PB 1TL7A 1QUPA 2M8DB 3MM9B 3LO3A 2MJNA 4F0MA 2DPJA 3MM7A 1REGX 1DTTA 2MZJA 2ZM6F 1FI4A 1CQMA 2E1AA 5CAAA 4P2MA 3CDWA 2KYXA 3HZGA 4PG8A 3QT5A 5KFNA 2XHCA 2C3YA 2C28A 2BOPA 1NJIT 4Z7CA 4DCPB 2MHNA 5C7PA 4TVAB 1S1TA 1LXNA 1NSKL 4BS2A 3L9ZA 3V5RA 2F4FA 2XQCA 2A2DA 4ALZA 4A48A 2M9KA 3QJPA 1A7GE 1GTEA 4LRAA 3CMAS 2E5LJ 2EK6A 4LRFA 5KFXA 4K4YA 2CWXA 1OQ6A 3F56A 4QIGA 4W4MA 1TQLA 3KK2A 1HNZJ 2ZH3A 5IT0A 3P6YC 1HLWA 2V68A 3AJDA 1WOPA 4ED0A 1FRLA 4LFAJ 3H59A 4CO2A 3W9IA 3HK2A 4FYXB 4FBUA 2QFJA 1TKXA 1HBOA 3FGVA 4N76A 5KT4A 3ETMA 3KLHB 2YNGA 3KFWX 2YH0A 1R0CB 3MM6B 3WC0A 3KG0A 5E3AA 1PJ5A 1UTAA 2R8JA 3BN7A 3IRXB 2VG6B 2ZM6J 3AXMA 4XTTA 1NK4A 3EWGA 2J0WA 5KG1A 3HVAA 3BH7B 1ZS6A 5A8KB 2RS2A 1YG0A 2XMAA 3FCWA 3OJSA 2LDYA 4DR4F 1NK0A 4NYOA 7FDRA 2OFGX 2RQKA 4X66F 3QO9B 1LV5A 1IQZA 2I5JB 1UFKA 1U1PA 4X2BA 3DGVA 3UO0A 2Z2ZA 2AX1A 3IS9A 3BQ0A 4J9UE 4H4MB 3OL9A 4GKJF 2YTCA 4DLEA 1Q8IA 4MJKA 5AE3A 2XLIA 2OSQA 1Q5VA 3E3XA 5M2UA 2ZEJA 3TWZA 2XMVA 4DR3F 3SFGA 3CCRS 5L46A 2MLZA 4WK1A 1JJ2R 2GQCA 4ZP9A 2PSZA 5JXSA 2AEMA 2E66A 2R3VA 4DWIA 4DV3F 1QD1A 3TA0A 3C66A 8ATCB 4X4NA 4WP9A 3MXHP 5KG0A 1A0OB 3F44A 4HACA 1IM6A 1K1SA 3V6JA 4RBTA 3QSYB 3TARA 2DNMA 5SZTA 1C1BB 3CJQA 2E9RX 4M5NA 4TLQA 3TEGA 1TKZB 1CG2A 4CCHA 3Q24A 1TELA 2X1BA 3CW2C 4TY8B 5E41A 4USTA 2YX4A 4UOGA 2GA7A 4RNFA 2IAJA 5G0RA 4A4JA 4A47A 2AF6A 4USIA 1KTVA 4FPIA 3GFXA 3K0JA 3MAHA 2HHTA 1K44A 3MAQA 3M30B 3TAMA 2V4QA 3NS6A 3GSDA 4B9TA 4DR4J 3RB4A 4K59A 4V19J 5FDLA 3O6QA 4GKKF 4DFMA 2RT3A 4ZVUB 1ZZNA 2VQEF 4GKJJ 1BWVA 2NPIA 3DMJB 4OZ1A 1CS4B 4OMFG 4KO0A 1L3KA 4DR3J 2YX7A 5ETSA 2MMYA 3SSSA 2DR8A 1S6QA 1S1UB 3NXZA 1N33F 3H0PA 1RAHB 1N34F 1OWXA 1QAXA 2Y8WA 3QQCD 2BJ9A 2DGWA 5HANA 4DV3J 1VI7A 3O44A 2BDPA 4TU8A 3BQ2A 4DPTA 1BQNA 2F63A 5CZXA 1YDLA 1OSCA 4ID5A 4CH0S 4Z7YA 3LP0B 1VS3A 4YFUA 1HNVA 4P2XA 3KHGA 4USWA 2IA0A 4NYZA 1QVGR 1SVDA 4B02A 2RRAA 1K0VA 3QBCA 3L95X 3IG1B 5DG8A 3QAUA 3MHYA 8AT1B 2X7IA 3MFIA 2FVSA 2ROPA 4WFXA 4F3OA 3DRRB 3KLEB 3M9MB 3QJJA 1S0MA 1RBAA 3EGNA 2JLFA 1Y4ZB 3M8PA 3TUIC 2R8IA 5GAHU 4IRDA 1REVB 4C8KA 4P10A 2DGUA 1RTIB 4GKKJ 3QZ8A 4PWUA 3ILJA 2VQEJ 4C97A 1RHJB 1U2RA 4IFYA 3KDOA 4NLTA 3WZ0A 4XDCA 4FBTA 1HHQA 1FRMA 2DO4A 3WX8A 4ZITA 1I3OB 1N33J 3K57A 1N34J 3PYFA 2UV8G 4DR5F 4QWAA 4KE5A 4LJMA 5CHCB 2XEXA 3JTOA 1KVJA 3MCSA 1YSJA 2P8IA 4PPDA 2FHJA 1OMSA 3E51A 3RRHA 4C0HA 3ZZRA 3PW2A 1VRTB 1FERA 2AT1B 2CKWA 4LIWA 1RAOA 3H98A 1SJ4P 1N5QA 1B99A 3CCZA 1M1KT 2HVZA 3MM8B 2MB0B 4I67A 1T9YA 2JEIA 4O3NA 1WC3A 4CLFA 4A8XA 3J81Y 2GC8A 5CD4H 2WCXA 4O44A 1YJWS 1BY9A 4QIEA 2RKIB 4WYWA 3IM8A 2ZVIA 1KHVA 2WVCA 2YWFA 1EZZB 1S12A 3KWMA 4QBUA 3RYLA 1YRUA 3AT1B 1PO6A 2GHVC 2UXBF 1S9FA 3GCXP 2UXDF 5IT9Y 5K14B 5L1LA 4Q45A 3L7UA 1S5ZA 3SIPB 3OPKA 2ZBRA 1VQSA 3VZHA 2YKNA 1UW9A 5IM0B 1CC7A 2PMHA 1NJXA 1KRPA 4M5GA 1TMJA 1N5YB 4J37A 2BMBA 1GXUA 3MR5A 2V69A 3DN9A 1RYSA 4DR5J 3VCDA 4M5LA 1GMWA 1JKHA 1HBMA 2YWEA 3NGRA 5KFGA 3Q8QB 2AX0A 4DUZF 4UW2A 1VQ9S 4A8YA 3C14B 2N3OA 5J2MA 3R5BA 4HLBA 1DRZA 1Y9OA 3D54A 3HHLC 3UPFA 3KK1A 3OR1B 2GV1A 1NCLA 1ELOA 4OZ5A 4KJIA 1TK5A 4J90A 3OLBA 5H9EK 2ZHAA 2CPJA 1VBKA 2MKYA 3QRQA 4RKUC 3K58A 1Q8LA 4HTJA 2XY6A 2V8DA 2HFUA 2OI2A 2GGPA 1Q4RA 2P9CA 1H38A 5H9FJ 4B9SA 2EFGA 2CPYA 1HKAA 2HK3A 3P5TL 1UFWA 1QE1B 3EM1A 4ZS6A 3VAIA 1YBAA 2XMWA 5I3QA 1WKJA 4JI2F 1NBEB 1MWYA 3M32A 3G82A 3CJ5A 1S57A 2MZTA 2UXBJ 4M95A 2UXDJ 3T5KA 4ATNA 1R0BG 1I94F 1KN6A 1UEVA 1FNMA 1JLEB 3FMBA 5HJYA 4IDKA 4C8LA 2DXEA 1N0VC 4WWSA 1DQ8A 1RHKB 4GVBB 4DV7F 4NLWA 1BQMA 2O01C 3TX8A 1ZM2A 1YQHA 1YTYA 4LBHA 2ZOGA 4FF2A 1VJWA 3A8EA 2B7CB 4OHWA 4DUZJ 1FKPB 4QWCA 3DYAB 3RAXA 2VPWB 3FSYA 1DHMA 5L1JA 2XSFA 2QL5B 2D9OA 4CLTA 5E3RA 4CLSA 2B43A 3EX7B 2ZH9A 4HHJA 4CO0A 3GYXB 1WF1A 4C9DA 3D66A 4AUKA 2IA6A 1T03B 2KDOA 3KLIB 5HMYA 3BB5A 3CJKB 4V19X 1R0AA 2RE1A 4DPXA 2EFNA 5A6PA 5GAEU 3J80U 2VICA 4QPTA 2LA6A 3KXDA 2PMWA 2PC6A 2FJXA 5KFIA 3MMCA 4ED6A 4JI2J 4ED3A 3M6UA 1X4GA 3GMGA 2GFFA 2QMWA 3ONQA 1I94J 4DFPA 4WXWA 2QA4S 1M5OC 5H9FK 3P45B 3EZOA 2QA2A 2XTJP 2ATCB 4C3MA 3JSRA 3HHNB 4JV0A 1S0VA 1RADB 1T02A 1HI1A 2DH8A 3OL8A 1WHYA 5KT3A 2FIUA 2W2MP 4J5OA 2C1EB 1OPIA 3S01A 1V5IB 3PR4A 5HMWA 2BANA 4KGKA 3B8HA 2FVPA 4DQIA 3MM5B 7AT1B 2OP5A 1ZBTA 4CTAA 1RUSA 4UOFA 1BE4A 3ITHA 2GJIA 4OYXA 2EFVA 4N8NA 2SXLA 4OYBA 1Y10A 1WEXA 1VQ4S 1BWEA 5LL6d 2HQGA 4ILRA 1LWCB 4LIRA 1YK9A 3LP2A 4TU9A 1IBKF 4UQTA 1RT5B 4V1Ak 5EX0A 2MXYA 2JLEA 1DAXA 4RW4A 3D4JA 3UCGA 2CJXB 3BSAA 5T41A 3T3FA 1N54B 5KFSA 2FTRA 5LJ3Y 1RP5A 4WU2A 2X3DA 4MYTA 3GJQB 4DSJA 1YKWA 4K4XA 1TL1B 3BR8A 3DNCA 2V2VA 4ECQA 5GAGU 5J2QB 3OTBA 3C6UA 3TNVA 2MZRA 3M2RB 3QNWB 5EN1A 3NY0A 1S9GA 4ZLJA 3HHLD 1T94A 2C2KB 4CLYA 3POTA 5GMEA 4PXBA 3EZUA 2IBKA 4HI2A 2EFPA 3TA1A 2EKNA 2HS3A 4Y2AA 3MEGB 4OV6A 4JP8A 3SQOP 2DO0A 1U02A 4RW6A 1SI9A 4JYAF 3P8BB 1YI2S 2CNNB 4JI4F 4N8OA 3GG0A 3LP1B 1H7XA 2HNZB 2HAFA 3HT0A 3FMWA 3MPUB 4CO1A 5I42B 4OHZA 4ZVRB 3QRPA 3BZQA 3M8YA 1IVZA 4LF1A 4OX7A 2ZHOA 2HFVA 2B4UA 1WC4A 1AUSL 2JX2A 4HHUA 3C2PA 1FX4A 2HBZB 3W2VB 3SCLE 3CJTA 1C0TA 1M1HA 4ITSA 1JLBA 2XCPA 2KL8A 4ED5A 3S1TA 3CD7A 1U24A 1CJTA 2QLJB 1N52B 4K4TA 3GJRB 1WORA 3N79A 5K8NA 4KGZB 4PXDA 3UD3P 3HSZA 1KFDA 4Q7AA 4B17A 3RZAA 1HNWF 2HVHA 3GIMA 4FZVA 5KFRA 1CLFA 3HVTA 4O4GA 4J9SA 3TO8A 3ZTPA 1SL1A 3LAMA 3VGUA 1OIAA 3GFHA 2XYPB 1NDCA 3W66A 1IKYB 3K89A 1U6FA 5F8JA 2ZE2A 4CLWA 1NK5A 1PYOB 4KHMA 2D3UA 2GHPA 2DHGA 4PEOA 1WEYA 5I3UB 4UY85 4JYAJ 3WHIA 4JI4J 5D4LA 1EJ7L 3SDEB 1RI7A 5HVGA 4NLVA 2DNKA 5CABA 1MU2B 2QMUB 1WG5A 1JLQB 4EWTA 4NCGB 3W1YC 2ZVSA 3NBPA 2M52A 4X4RA 4OI0A 4O3RA 4UZBA 1RGVA 2Q79A 5B0EA 1JJHA 2E1MC 2ZD1B 2ZKTA 4JI6F 2XI2A 3SI8A 3I4HX 2AQ4A 1QTNB 2VBXA 1FWLA 3RR7A 3VAKA 1UPPA 4RUAA 3HP6A 5KG4A 2CNOB 1UAWA 1TU0B 2R7QA 1FVQA 3TJ9A 3PW0A 4UUXA 2Z2MA 2FLPA 3JSYA 2RDDA 5LSLA 1M5SA 4KTQA 2A6MA 1TV6A 3CTRA 4KFBA 4ECSA 1LNQA 1HNWJ 2XLKA 2FHKA 2AGQA 5MLCV 4GO7X 5D8HB 1T9XA 5CCLA 3V4MA 2G0CA 2J7KA 4E2FB 1VISA 4N77A 3W3SA 3CT9A 3R8YA 3NKYA 4J9PA 1FRIA 3AOBA 1ZPVA 6AT1B 2HZCA 2K3IA 5D4OA 2HQ3A 3V6DA 2FJWA 1WC6A 3PW4A 5KFKA 3OFEA 2W4CA 3FRZA 4NEYA 5K8MA 5DLFA 1KQFB 2PI4A 2DXDA 3GTYX 2A0FB 1VQPS 1QAJA 2QLWA 2F3JA 2AJ1A 5KT5A 2L3MA 4JI6J 4F26A 1MNEA 4X4QA 4RW9A 3OD2A 1S72S 3T41A 1MN9A 1X9SA 1IKVA 3HD2A 3OV7A 2YPZA 1JB0C 4U7CA 1FDAA 5KT6A 1QDUB 4CM2A 1R3NA 4FKYA 1FWPA 4LF8F 1LFPA 1ROFA 1FDNA 1FRKA 2CNKB 3GP9A 5ETTA 3R7BB 1TVRA 3RBEA 3D1QA 2EG1A 2RU3A 2UU9F 4ED8A 2DH9A 4EO6A 2IJNA 2VIHA 2CQCA 2IC3B 2KKHA 4DN0A 1S1VB 2JDJA 3T1YF 1UWBB 2BJ3A 5E33A 3BKFA 2KT2A 4E98A 2CPXA 4RW7B 3K5LA 2YNIB 2XM3A 3V6HA 1NZ8A 3ZTRA 2R7VA 1GT8A 3D9BA 4N56A 2RQ4A 1S1XB 3DOLA 5F8NA 1SL2A 2R7TA 2HLTA 4QWBA 3GYNA 4O3SA 1HQEB 2E29A 2B4PA 2CYYA 4DPOA 2CIMA 3D2WA 3A8IA 4KPCA 4WIIA 2ADBA 5AXNA 1IKXA 1TL4A 4C8YA 2G1HA 1T95A 1G1XA 3MD3A 4L75A 2XI3A 3PXGa 3TAQA 4RLEA 5CXTA 1WJ9A 3CC7S 3IM9A 4KRWA 4LQ9A 5B0GA 2OMLA 4WFYA 4MIAA 1B4SA 3V2UC 1N5TA 4WFBQ 2IMWP 1S6PB 2W2PP 2H4YB 4Z2XA 3CEDA 3VGVA 4LF8J 5IQQA 1GH8A 2JL9A 3KK3A 1D8YA 2WHOA 5HLFB 2WOMA 1JNRB 3NCPA 2RHSB 3J7Z5 5AXLA 3FCHA 1VC0A 5HJXA 2UU9J 3BYPA 1Y00A 3HKWA 3IMQJ 2GIQA 5HI7A 1EQ0A 3UD5A 1EETB 3T1YJ 2B5JB 1N48A 1M5PC 4CNZA 4DL6A 4B3MJ 4L3KA 2LVWA 4EU0A 2RU9A 4YEAA 3QAEA 3RRKA 4NE9C 4R0JA 2EBGA 2AYGA 2LQBA 2AZ3A 2COLA 1C1CA 4DR1F 2FHJD 5C42A 1U1MA 2IYGA 1HR0F 2R2SA 5LMNF 1VLYA 4PXEA 3MUMP 4DFKA 1G3OA 2HS0A 4NLDA 4EYIB 3J80Y 2MEWA 1JXEA 3BDPA 5C2CA 1T0TV 1FCAA 5L8RC 1LWFA 4RNHA 3DGPA 2ERRA 2ZNYA 4AL6A 3HHLB 4ICLA 4ANEA 1X4HA 2VG5B 3TJAA 2W4DA 4PR6A 2K06A 1EHWA 2R2UA 2JEFA 1E6VB 4CYUA 4F25A 2G2ZA 5D4PA 2XMKA 4G1PA 4LSNA 4GC7A 4FDFA 1LWXA 1RAEB 2E7XA 3GR0A 1J27A 3DOMB 2QGFB 1RCXB 1N6QA 1F60B 2KB2A 1VK8A 1WHVA 2ADCA 3SYZA 1RWPB 1Q95G 2YQ3A 3K8VA 4BDPA 3SXLA 4MYUA 1SKUB 3MM7B 4DPWA 1LW2B 2I8EA 1LXJA 4FNHA 3H4BA 1WKKA 4KIAA
chains in the Genus database with same CATH topology
3ZZPA 1N88A 4Y28C 4CT8A 2LQ9A 4JV2A 2J0SD 4LMZA 2GO8A 2DNRA 3PKYA 3M2RA 4UOCA 3L7PA 2VOOA 4MIBA 1Q86T 2LXIA 1R43A 4U67Q 1KNZA 3MMBB 5KFZA 1NKBA 1Q1KA 2UVWA 3PX0A 5IFMA 2JZ5A 3CE8A 2HQIA 3OR2A 2M70A 2E5LF 4IUFA 2RQMA 4CO4A 2MHEA 2ILYA 3T9ZA 5LT5A 1X4EA 2EVZA 2QRRA 3OLAA 4AFFA 2PI5A 1Q7YT 1FESA 2HS4A 2YKNB 2ZOFA 1S1TB 1S1WA 4A8QA 2VA3A 2GNKA 1KQGB 3DOKA 1F5AA 3RB6A 3PFEA 4B3OA 4F4YA 4HDGA 4NX9A 4RU2A 5C24B 2MQPA 1N5VA 3EXCX 2JFKA 4YB5A 3JYTB 3PV8A 2FJDB 2RQCA 5J2NA 5JJBA 4A8SA 4CI0B 1RT6B 3BGLA 3JTNA 3TI0A 4ZDNA 5L1KA 3DI6B 2VFVA 2ZC3A 3MUTP 2XWYA 3MPVA 3LAKA 3KKFA 3NWGA 2MSSA 1V3RA 1HBMB 2KO1A 3CDAA 5KFUA 2N3LA 3R1LA 2UUWA 3HHLA 4QZVB 3KOAA 1HWIA 4LFAF 4B3RF 1WTFA 2EFQA 2VG5A 2BW2A 3AQPA 4ZPAA 5I3PA 2MGZA 1SXLA 3RB0A 3LP1A 1E6VA 2VBWA 3M8RA 1G2EA 3C8YA 4KAIA 2EK1A 1RA7A 2FD2A 5DM7Q 3Q2TC 5J2MB 2OJ3A 2QIFA 3EXYA 3IGVA 1SV5A 1D1UA 2CJBA 2Z8QA 3I9ZA 4K2XA 3KK2B 3AB4B 3G96A 3TRGA 2W9CB 2MY7A 4O23A 2HNDB 1SL0A 4R8UA 2VG7B 5KG7A 3KK1B 3K5PA 1TK0A 3DM2A 1RQ0A 2EWHA 3SCKE 1XBWA 5EGYA 4PWDA 4ZLPA 3OXGA 1Q81T 4KPYA 1QUPA 2I0XA 2QT7A 4GMKA 3UWTA 2M8DB 3MM9B 3LO3A 4WFZA 3CJ0A 1N0UA 3TUZC 2MJNA 1TKTA 4KHRA 3G71S 2DPJA 1RT2A 5J1EB 3MM7A 4X4PA 1DTTA 2MZJA 1HYSB 3UE2A 2ZM6F 1JWWA 2C42A 1CQMA 1UETA 2JEGA 4IKAA 4AXIA 2IM1A 2BV3A 4QW9A 1JLFB 2E1AA 1Y5LB 5THWA 4J9MA 2RILA 4TY9A 3CDWA 1HWLA 1HNIA 3PJXA 2KYXA 3HZGA 2YNGB 3CVKA 4PG8A 5IQ6A 3F41A 2ZITA 3CDBA 1UVLA 2PO4A 2W7OA 5KFNA 2J7WA 2C3YA 2XNQA 2C28A 2BOPA 1NJIT 4IQXA 1Y5NB 1MSWD 3LOUA 3H5YA 4CH7A 5DDQC 3NAHA 3S7RA 2FB0A 2MHNA 3UW1A 1HW9A 2F1FA 4A46A 3DLJA 1S1TA 2EFOA 3OJUA 1D3WA 1Z4UA 3ENVA 1LXNA 2ZDOA 4ZPTR 2P5VA 5EWGA 3HPOA 5C24A 4BS2A 3NL0A 3V5RA 4K4SA 3NCRA 2A2DA 1CQNA 3M32B 4ALZA 4A48A 4JI1F 2M9KA 2OAUA 4ID8A 3N6NA 3QJPA 1VQ6S 3PKMA 4NA2A 1A7GE 5LSOA 1GTEA 2VV5A 4W90B 2XMUA 3CMAS 2L48A 5D78A 2CG4A 3F73A 1FE4A 4Q44A 3LW5C 2EK6A 2BZ2A 3CD6S 3OW2R 3HMJG 3J7A1 1Y5IB 1Q8BA 3TANA 4IDKB 5JUMA 4TYBA 4NZ7A 5KFXA 1K0TA 1TZ0A 5H1SV 1PGZA 4K4YA 4OX6A 1HWJA 3TVZA 1X8DA 1OQ6A 2RSQA 3F56A 1YJTA 1RT7B 2CQDA 1IJFB 2O3DA 4JI0F 4X84A 4IO9Q 4QIGA 2L9WA 2Q66A 2K7JA 1UVMA 1BQMB 1SQEA 2HW3A 1TQLA 1IKYA 1QAYA 3KK2A 2W9CA 5KFHA 3PO4A 1HARA 2ZH3A 3G9CA 5IT0A 1HL6A 2VG7A 4G3IA 3P6YC 3IS9B 1ZETA 2DIVA 5CYMB 4ED0A 2VC1A 2V8HA 1FRLA 2PDAA 4NA3A 2L9DA 4I69A 1FE0A 4MK8A 3NMRA 5DG9A 1HWUA 3BSOA 1RTJA 1VC6A 3H59A 4CO2A 1L3SA 2NREA 1TAUA 3KYLA 3ULHA 2QZ8A 4PPZA 4NXMF 4TYAA 3M1VA 5KFCA 3HK2A 2OLWA 4FBUA 2QFJA 1TKXA 3WX4A 2D3OR 1XN9A 5DQHA 1HBOA 1MU2A 2C3UA 3FGVA 2RJZA 1JLFA 4PQAA 1JLQA 3G6ES 4DQPA 4N76A 4AL5A 4NCGA 3H5XA 1FT8A 2U2FA 4A8OA 3M6XA 5KT4A 3KLHB 2V4JA 2YNGA 2VFUA 3KFWX 2F4VF 3UR0A 3E01B 4ZMMA 3CCUS 1YGYA 2YH0A 1U1OA 2CFXA 3MM6B 3WC0A 3KG0A 2VPXB 4OX8A 3CC4S 1FEHA 5E3AA 2R2TA 4BCAA 1SKRA 3WBZA 1Z2LA 2R8JA 3MMAA 5KFQA 3HDSA 2K1RB 2AYBA 2JEJA 3BN7A 3R1HA 3PFOA 4Y2CA 1T3NA 3IRXB 5G4DA 2VG6B 5BYSA 1R0AB 2J9DA 1JJ4A 4B9UA 3H5UA 4NRTA 2HHHF 2IRYA 3CCLS 2VC0A 5A0YA 3THTA 4F3QA 1TR0A 2RUGA 3LWMA 4NL5A 3BGUA 1NK4A 2J0WA 3QGIA 1U1RA 5DQIA 4LF6F 2HHVA 5KG1A 3HVAA 2NPFA 4HTIA 2GCFA 4L3NA 4M8LA 4TXSA 5KOXA 4TU7A 3MURP 5A8KB 2RS2A 1YG0A 2JVRA 2DJWA 3NS5A 3OJSA 1RAJA 2BR0A 2LDYA 3D1OA 1DTQB 1S9EB 1LWEB 2ZZMA 4DR4F 1NK0A 4NYOA 4DHVA 2M0GB 1I1GA 4ETZA 7FDRA 2LQ5A 2IAJB 2OFGX 2WB1D 2RQKA 2Q1LA 4X66F 3QO9B 4Q43A 3EGWB 5DGAA 1LV5A 1IQZA 1NO8A 1RTHA 1QSYA 2I5JB 4OFZA 3FQLA 4KBIA 1U1PA 5F41A 4X2BA 2ILZA 1K9MT 1HFEL 2AX1A 3IS9A 3BQ0A 4DV0F 4H4MB 3OL9A 4DSKA 3M8QA 2DT9A 2LDIA 2J9CA 3GB0A 4GKJF 1NNDA 2YTCA 3EPIA 4ES2A 1Q8IA 2D7SA 4DLEA 1LOUA 1IM4A 1JIHA 4MJKA 4ZCLA 5AE3A 4I2PB 2UXCF 2A1BA 2O5DA 3IR6B 2XLIA 4AYBD 2OSQA 3E3XA 2BQRA 4RUCA 3P96A 5M2UA 4J9RA 2E5JA 1NK7A 2OPPA 3H5SA 3H2UB 4EO8A 3CUNA 2XMVA 1T05B 4DR3F 2FLLA 4KC5A 3SFGA 3OL7A 2ZBIA 2XS5A 3CCRS 2VFRA 4DEZA 4FPRA 3KLHA 4WK1A 1JJ2R 4DS5A 3E01A 2GQCA 5E7OB 3SEOA 1V3SA 4QR0A 2Z0GA 4ZP9A 4ILLA 2PSZA 2CQBA 5JXSA 4F8RA 2KG0A 4CO3A 2GHWA 1T8EA 2E66A 4OI3A 4DWIA 4DV3F 3TA0A 3OTCA 3C66A 1RJJA 2CVEA 1X0FA 4B3MF 4X4NA 3MXHP 5KG0A 1G6BA 2PMZD 3TVKA 5CA5A 3CF5Q 3IRXA 1WHXA 3UNGC 2VG6A 2V9WA 2B3TB 2BANB 1J5OA 3F44A 1K1SA 3IWNC 2XWXA 1R27B 3V6JA 4RBTA 3TARA 2DNMA 2GIRA 3EUNA 5SZTA 2RRBA 4NLPA 1NJZA 1C1BB 2NLWA 5F3ZA 2IMOA 2E9RX 1LK5A 2WSFC 4TLQA 1WWHA 1WG4A 2YNHB 5BYQA 3U1MA 2QSWA 4CTAB 4K4VA 3MMJA 3ITHB 2OIHA 1TKZB 4HDHA 1CG2A 4CCHA 3Q24A 2DIUA 1U6ZA 1SKSA 2X1BA 3AAWB 4J9OA 3LPYA 1QSLA 1KHWA 1AUDA 4TY8B 5E41A 1KQKA 2U1AA 3OHAA 4F4KA 1R8BA 2PD1A 1DTQA 2YX4A 2WSCC 3MPWA 2GA7A 3RAQA 2ASDA 4RNFA 2M88A 1BQNB 2VUGA 4KHPF 2IAJA 5G0RA 4A4JA 4A47A 4IOCQ 3CD5A 5L38A 2AF6A 4OHVA 1VQ7S 1WI6A 2IJFA 2DB1A 4QPXA 4USIA 1KTVA 2J0XA 3GFXA 1FTRA 3K0JA 2B0GA 3MAHA 1IBMF 2R7SA 4ZVFA 4R5PA 4K4UA 1QVFR 2HHTA 2BM1A 4ID5B 5M2RA 2W9BB 2B6AB 4C11A 2UP1A 3VAGA 4H4MA 4JI7F 3I55S 3MAQA 1A6LA 4LQ3A 1S48A 2HRYA 4RW4B 1NRKA 2DNGA 4ZHRB 5B0CA 3OHBA 3M30B 1RWUA 2IVFB 3TAMA 2V4QA 3NS6A 3GSDA 4B9TA 4X4UA 4HYKA 3KNAA 4NXNF 5F8IA 4EZ6A 1PC4A 2M7SA 3RB4A 1ZTWA 1HMVA 3M9OB 2XULA 2EBEA 2HYIB 5KT2A 1GXLA 5AXKA 2QYCA 3G6YA 1T05A 4K59A 1HPZB 2AYEA 2BACA 4V19J 3BR9A 3K2YA 4TNOA 1KONA 5FDLA 1L5UA 3O6QA 1K73T 1TFYA 3V81A 3Q8RB 3C6UB 4GKKF 2IC3A 2BABA 1FDBA 3MDFA 2KVIA 2CPHA 4DFMA 1URNA 4JV5F 1S1VA 1ZYQA 2RT3A 1ZZNA 1S49A 3MEDA 4QOTA 4X4VA 2VQEF 2AV5A 3FNNA 4YB1P 2HIQA 1JX4A 4CIOA 1L3UA 2HPUA 2A18A 2NPIA 3HHEA 3W2WB 3DMJB 4NLRA 5E3QA 2GQQA 2IRXA 4OZ1A 2VB6A 4RW7A 4WFAQ 4J9QA 1TP7A 4Q0BB 2AJQA 1D8ZA 5CYQA 1DQAA 5LXRA 5ITHA 4OMFG 2IM3A 2HWHA 4KO0A 4LVOP 1VMBA 1L3KA 5D6GA 2FVRA 5D77A 5CZVA 2YX7A 1S1XA 1B0PA 1IKWA 3I9V9 4DL5A 3UD4P 2MMYA 3SSSA 1N56A 3NMAA 2DR8A 4MKBA 1S6QA 4YP3A 1YIJS 1S1UB 1SIWB 1N33F 3TVYA 1D9DA 1ZOTA 2CDQA 4B9NA 3US5A 2J6SA 1HQEA 2CQPA 1N34F 1OWXA 1QAXA 1TKZA 3Q22A 2DGWA 1UVNA 2JFDA 4PG4A 4RW6B 1VI7A 4TY8A 5C25A 3FFIB 3O44A 2BDPA 2JH3A 4HH0A 4TU8A 4JBCA 3BQ2A 2P9EA 4DV2F 1BQNA 2VKZG 1HD1A 1RISA 5EWEA 1RT3B 2AU0A 2EG2A 2CPFA 5CZXA 3NG8A 2HHUA 2EI5A 5FJ4A 1OSCA 4ID5A 3CGIA 2K8GA 5F8GA 3KLGB 1J5EF 1VHFA 1I6JA 4CH0S 1UVIA 2RD5C 3LP0B 1VS3A 4YFUA 3T5JA 1HNVA 1UVJA 3KHGA 3M30A 2DR9A 1EP4A 4Y6IA 1X5TA 2BQ3A 3V6KA 5J2PB 2IA0A 4NYZA 2VFSA 1MROA 3B82A 3OBIA 4NZ0A 1QVGR 1ZPWX 4RW8B 2ZH6A 3T1AA 3MOZA 4EBEA 4B02A 2UUCF 2RRAA 2FUG9 3K8WA 1K0VA 2PGCA 4URGA 1HPZA 1WNEA 2DH7A 3HI9A 5B08A 1KOHA 1PILA 4DOZA 1YJNS 1S6PA 2VODA 2DBBA 2KT3A 5F0UA 5IT4A 2QE5A 3L95X 3IG1B 2LCWA 5DG8A 2MKSA 1U1NA 1Q53A 3GQCA 3QAUA 2QA1A 4ECUA 3MHYA 4NYPA 2B4OA 4EUVA 2M8HA 4ZCIA 4CZCA 2AJ4A 1YHQS 2FVSA 3MFIA 3DLGA 2ROPA 1SB6A 4WFXA 3DMJA 5HLFA 2BE2B 4Q0BA 3FVYA 4F3OA 3DRRB 2UVUA 3KLEB 3M9MB 4RBUA 4F4WA 4J9NA 2NSBA 2V94A 2R4FA 3QJJA 1S0MA 4Q8EA 2FJBB 2AD9A 3EGNA 5F9LA 2JLFA 1Y4ZB 3M8PA 3TUIC 5GAHU 2R8IA 4OJHA 3FZBA 1REVB 4I6YA 3LGMA 4BC9A 2ZH8A 3SZ2A 4C8KA 4K0KF 2G9OA 2DGUA 2DGTA 3VR1A 1W2IA 2O66A 2OFHX 1RTIB 2VASA 4EBDA 1N32F 2V4RA 3QZ8A 2VD3A 2OO4A 4J9KA 4PWUA 4NLGA 3GIIA 1EETA 4I56A 4ZCKA 3KMQA 1U09A 3N28A 1NEEA 4C97A 5C5JA 2B9WA 4L72B 5KFOA 1QSSA 1A9NB 2LEBA 1U2RA 2KI2A 4BHQA 4IFYA 1LQ9A 4IOAQ 4O4GB 4NLTA 4WE1B 3CCTA 3FFIA 3PX4A 1VIOA 4Z37A 2F8MA 4ZVEA 3WZ0A 4MFBB 4XDCA 4FBTA 1FRMA 4NOHA 4FXVA 1RT3A 2DO4A 2HWTA 4IFVB 3QGPA 4EFAC 2ZJPQ 4KB7A 2F9JA 3EYZA 2KH9A 3M2UB 5CYJA 3E2EA 2CJAA 5KTQA 1L3VA 4Y2MA 2V0NA 4LF9F 3K57A 4HT7A 2ZE2B 2I38A 3I31A 3LP0A 4DG1A 2R7WA 3N6MA 3NNCA 4NLOA 4H4OB 2RRNA 2UV8G 4DR5F 3NLCA 4QWAA 3K5NA 5HMXA 1X4DA 3C6TB 4KE5A 4LJMA 2QLXA 3GR1A 5CHCB 1Y3JA 2F9DA 2ZH1A 2E5IA 2XEXA 4RW8A 3JTOA 2FC9A 2ZC4A 1BD6A 3DRPA 5F8HA 4YHHF 1KVJA 2AP6A 2L41A 1V9OA 3MCSA 2WONA 5A8RA 1YSJA 3UDCA 4LF4F 2B9XA 3MF5A 1YVFA 4MH8A 1NZAA 1FKOB 1U1QA 3NBPB 4PPDA 2APOA 3IFEA 2FHJA 4RWXA 4C0OC 2YH1A 4QWDA 1VQ8S 3IG1A 3E51A 4UUWA 1FD2A 5M2PA 2NR0A 1APSA 2VBYA 1Q7LB 1DQ9A 4HH1A 2PT0A 1B64A 4LVNP 3RRHA 1R8PA 2EW9A 4C0HA 4FYDA 1U1KA 3ZZRA 3PW2A 2HFZA 1VRTB 3NGKA 1HNZF 4HEA9 1FERA 3SQGA 2CKWA 3S6EA 2BE2A 4LIWA 1FJ7A 1JKHB 3KLEA 1JLCA 3G6XA 3H98A 1SJ4P 1QTMA 1N5QA 4I68A 1O5JA