4JI1F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ji1F00
1VMBA 2RJZA 4B3RF 4JI6F 4B3SF 4X65F 4DV4F 4JI4F 4YY3F 3OTOF 4X64F 1RISA 2BXJA 2KJWA 4X62F 1I94F 1QJHA 2UXBF 4K0KF 4DR2F 1XNRF 4DR7F 4OX9F 4JI8F 4LFBF 3ZZPA 1HNXF 4DUYF 4LF9F 5LMUF 2KJVA 5LMNF 2UXDF 1IBLF 1XNQF 1IJEB 1HNZF 2VQFF 1N34F 4DUZF 2B7BB 4DV2F 2ZM6F 3T1YF 4GKKF 4JV5F 4LFCF 4JI2F 3T1HF 1GH8A 2HHHF 4KHPF 2VQEF 4LF7F 5IWAF 4DR3F 1XMOF 4B3TF 4B3MF 1IBKF 1IJFB 2UXCF 3R3TA 4LF4F 1G1XA 4DV6F 4JYAF 4LF5F 1HR0F 2UUAF 2UUBF 1N33F 2BVZA 1CQMA 1IBMF 5BR8F 4DV1F 1N36F 4AQYF 4NXMF 1FJGF 4DV0F 1LOUA 2E5LF 4DR4F 4DV5F 1CQNA 1J5EF 1XMQF 4LF8F 1HNWF 4JI1F 1FKAF 4DR6F 1F60B 2J5AA 1G7CB 4YHHF 4JI0F 2UUCF 1B64A 4DV7F 2B7CB 4JI3F 4DR5F 4JI5F 4DV3F 2UU9F 5AJ3F 4DR1F 1N32F 4LFAF 4JI7F 4GKJF 4LF6F 2F4VF 2YY3A 4X66F 4NXNF
chains in the Genus database with same CATH superfamily
1UW4A 1D8ZA 2OPPA 1QUPA 1IQZA 2CDQA 4CO1A 1K73T 2DNKA 2H48B 2ZZTA 5KFHA 2QA2A 1ZM4A 4KR0B 3LWLA 4LBHA 2K1RA 1NSPA 2AWZA 1REVB 1HL6A 2CKWA 2YBVA 1REVA 2OMLA 2QMWA 1VHIA 1WF1A 2G1DA 2JZ5A 5CCLA 3PZPA 2JEJA 4LF6J 1M5KC 3RGIA 3OW2R 3KLHA 1RI7A 4OX9F 3ZNUA 1RWUA 1CJUB 1S59A 1YRTA 4HTIA 2FJVA 4NZ0A 3AY0A 4ED4A 4HT5A 3T5HA 1Q8IA 2B43A 4CNYA 2K2PA 5A76A 2ASJA 1Q53A 1SIZA 2IRYA 2GCFA 3G96A 1RT7B 4K2JA 3THTA 4EZ6A 1L3VA 5KT5A 4DV3J 2XYPB 4L75A 2WVCA 1NKBA 3VAMA 4QYZJ 5CH7B 2DH8A 3AQPA 3K5LA 3R1HA 4BLGA 3ENAA 1MN7A 2DY9A 1C1BA 3J7YU 2VH7A 2VQEJ 3A3OB 3D6HB 2VU5A 3BGUA 1EQ0A 2E7WA 2POKA 4NLWA 2HLTA 2HVDA 4HLBA 3T1YF 1VK3A 2UXDJ 2VFUA 5A2QY 4NI2A 3CCSS 3V4IB 4NMLA 1DTTA 1FX4A 2AEMA 4KHPF 1BY9A 2CZ4A 5KT6A 2W2NP 3DRSB 1N34J 2RU9A 1D3WA 2GV1A 4CO4A 1P1LA 3K5PA 2MLXA 5HI7A 1N36J 1CJKA 1I94J 1U6ZA 2BA9A 4HH1A 4B3TF 4NLGA 2CJXB 3J7YI 3KOAA 1QTNB 2DHHA 5FDLA 3R2DJ 5KT2A 4MH8A 3UN3A 1FKOB 2MQNA 3RU0A 1CS4A 4O3NA 3TUPA 2QA1A 3P8BB 5HQMA 5A6WA 5A8WA 4B9UA 4NEYA 1IWAA 1R3NA 4DLEA 2RRAA 1FT8A 3VGVA 4DV0F 2AZ1A 3BGLA 1X9SA 4IQMA 5KFSA 1IBLJ 1LFPA 1Q79A 3NP5A 4PG7A 3V81A 3B4DA 3I5AA 4M5DB 3UNYA 3GIIA 1AT1B 5IZHA 4K4ZA 2M3DA 4OYBA 1N48A 2HZVA 3MPDA 4FXWA 3HMJG 3N79A 1IKYB 1T94A 1UMJA 1SVDA 1S6OA 1WHYA 1ZAVA 1ELOA 4ZCMA 5T7LB 3MEEA 1GTHA 4K5RA 5HANA 3HLUA 3MEEB 4DZ6A 2KDOA 4JI0F 5C5JA 5GADI 5IM0B 1ICEB 3KHLA 3VAFA 1QM9A 1S7HA 2DEJA 4QIEA 5CD4A 2JX2A 1R43A 2FLPA 2XMUA 4KQZA 4NPOA 4GC6A 3RAXA 1I6JA 1BMQB 3FFIB 1WHWA 1P6TA 4JI3F 3M4XA 1RAFB 3EZOA 2AEJA 4XPCA 2EC2A 1U2CA 2CQGA 2GHWA 2GVZA 1RU1A 2HGNA 4NL5A 4CLYA 2PMHA 2ZDPA 3BQ1A 1U8WA 4HT7A 1HBMA 5C2CA 4OYPA 1RTJA 1YBAA 3THPA 2PN6A 4DX5A 2R2TA 5F8MA 3HFKA 3RB4A 1SKWA 1E6YA 5BYQA 1Q78A 4P71A 2B4OA 2N82B 1VQOS 2NLWA 4USIA 1BC6A 2EG2A 5E2QA 3MUMP 2JVOA 1VK8A 3L7UA 4PXCA 4YB7A 1LW2B 3OXFA 4FS1A 2F1FA 3OSPA 1S9FA 3BO4A 3BDPA 1H3DA 3UDVA 3VF0B 3EJMA 2BRLA 2G0CA 2IA6A 3VGUA 1VBZA 4U67Q 1JLAB 1DAXA 2HFOA 4Y2AA 4NYZA 2KJWA 4TU9A 4CLPA 1R0CB 5DJBA 3SI8A 4HHUA 1X4EA 1FK9B 1T02A 3CDWA 4IFYB 1IQTA 1FK9A 1HQUB 4XTTA 2PIIA 1SJFA 2B9EA 2HURA 1BWVA 2V5HG 1FWPA 5KFUA 2PA3A 3R1LA 3HK2A 1WG5A 2CIMA 3BH6B 3QGIA 3CSKA 2OHDA 3QPIA 2QYCA 3HJFA 3LALA 4ATNA 5BXIA 2PSZA 1EAYC 4LF9F 2QMXA 1AFIA 2HWIA 4O3QA 1FHTA 2EK6A 3K8VA 4EGLA 4RUHA 1BHNA 3I96A 4HH0A 2R7WA 1IBCB 2GIQA 2I9SA 1RGVA 4ZJOA 2H3EB 4HYKA 4F3OA 1JLFA 4DN9A 4FPIA 2R7QA 1IR1A 5MLCV 1VYAA 3T1HJ 4B08A 4XIUA 3NGDA 1UJ5A 1DARA 2B4VA 1MU2A 1WKLA 4HR2A 2KHCA 1SI9A 3DLEA 1SJQA 2Z2ZA 2VBYA 2LQ9A 2B9WA 5IFMA 2VIHA 4O3SA 3GIRA 2YX1A 2VC0A 3HZEA 4X4QA 4ECRA 2PE8A 3CJKB 2DO4A 3GR0A 3BKUA 3N6LA 4UZBA 4OL8A 2YWFA 4Z7CA 2MQPA 1JNRB 4WK1A 3C6UB 3I87A 4CO3A 4OFZA 2VODA 5F8IA 1SH2A 2ZHBA 2DRDA 4LUBA 5KFVA 2BQ3A 3MHYA 4FXVA 4A8XA 3CO0P 1U1QA 4DX6A 4M5NA 3BR9A 4CO2A 1X5SA 1VGYA 2WHOA 3LGMA 4HHHA 3K57A 3KMSA 5JJBA 3HM9A 1MMDA 2RQCA 4OI4A 5IC6B 2DO0A 3EPIA 2HWHA 2NXNA 1DQ9A 1OIAA 3GB0A 4F67A 5CYJA 1YTYA 5HMWA 1SJ3P 4WP8A 1SJ4P 3PFOA 1WC4A 1I3OB 3HHLA 5DZ6A 5HVGA 4WCEQ 3PIPQ 2HBYB 5J2NA 3MPYA 3M8PA 4DFKA 3HHNB 2OD4A 3B54A 3M8PB 4OLPA 4WPAA 4EMDA 9RUBA 4EBDA 1NJXA 4LF8F 3QAUA 4HDHA 3IGVA 1UA1A 3PNIA 4QWEA 2VKRA 3L9ZA 1H74A 3F0NA 4F7VA 2QX0A 4IFVA 5KFCA 3CULA 2J5AA 2F4FA 3BBCA 3CXCR 4U8VA 5J1PA 1WHVA 2XLKA 2DD8S 4DPXA 3C16B 2UUWA 4OV1A 3RAQA 1FD2A 1NZAA 2PA8D 3PYDA 3R2CJ 1YHQS 3SDEA 2J9CA 4AL7A 2CPYA 3C14A 5A8RB 1FO1A 2E29A 3DOLB 1VCTA 1S0MA 4CTAA 5KTQA 3DOLA 4QOTA 5HO4A 2NCKL 2JSXA 1TV6A 3QT5A 3QSIA 1LQ9A 3MMAB 3ETMA 1S4EA 4L3KA 3QJLA 3QAEA 3C8YA 2AHOB 2W8LA 2J0WA 2RH3A 3ICLA 1VRQC 2IJFA 3QT6A 4KV8A 4OYAA 3FSXA 1IKWB 3TJAA 1RBAA 2V4RA 1YJWS 1XR7A 4AL5A 2EPIA 2W2MP 2B4UA 2CQ3A 1EP4A 2XI3A 2WSEC 3TWZA 4A8WA 1S0OA 2KZZA 3LANA 2NQPA 3TVZA 3R9LA 1BQMA 1F5BA 2E66A 5AE1A 4LF2A 2F4VF 4BBYA 4CLKA 2G2ZA 4JI8J 1PSDA 3EUNA 1YWXA 1AROP 3GJSB 4ZVPB 2BX6A 5B0FA 3Q2TC 2L48A 2RSQA 2KZMA 1IXKA 1WACA 4B3SF 1WTFA 3ILJA 2VHGA 2A2DA 4P2FA 1KSPA 4E0DA 2DHSA 1PCAA 3CF5Q 2AIRB 2J0QD 1PJ7A 2CJQA 3GIJA 2IM2A 2GA7A 4ZCKA 3MAQA 1LNQA 1MWZA 4YP3A 2DNOA 2HNDA 1HHSA 3M7VA 3KHHA 4DDFA 4NLTA 3CD7A 4ZVEA 2HHQA 1OS5A 2C2MB 4ZVUB 3TQ1A 2Q1LA 3TQEA 2PI4A 2XMMA 1NSKL 1T9UA 3OPKA 3RJMB 1IKYA 2KJVA 2R7RA 3IWNC 3F56A 4I2QA 2ROGA 3UW1A 4CZCA 2VL1A 1U6BA 2UXDF 3DOMB 3O1LA 4C11B 3JAMY 3AD9C 3DOMA 3JS9A 4DHVA 3UPFA 3G71S 1SKRA 3EGZA 1FXDA 1RAJA 2V9KA 1T9XA 3O6QA 3BGRA 4QR0A 1HNZF 5KFYA 3OL8A 1ZPWX 2FGOA 2OD6A 3ZZRA 2B7BB 3Q89A 1LEOA 1AZSB 3CTRA 3IBCB 4YR3A 3NS7B 3FVYA 2GVZB 4R8UB 1ZM2A 2MKCA 2GQCA 4M8LA 3T1HF 5D0HA 3M2VA 2QEXS 5EDWA 4B3OB 1WSVA 1RTJB 2X51A 4F0KA 3UO0A 1RHKB 4KY3A 4J9VA 1L3SA 1BD6A 2NZCA 3SMZA 2WBMA 2UV8A 4Y3CA 3FEZA 2VOPA 2HNZA 2DB1A 3AD8C 3JSYA 3CCUS 2NZ4A 1WEYA 2A6OA 4K0KJ 1UFWA 2W8KA 2QYGA 3B4MA 1LW2A 1G1XA 2JNJA 3CEDA 3H2UB 3N01A 2PMZD 2AX0A 1OO0B 2RNEA 3UCZP 3C46A 4DG1A 4W90B 4EI2A 1RBLA 2BVZA 1VC6A 2DXDA 5E7OB 1EKSA 1GQEA 2HSEB 4ELUA 4X4RA 3Q8PB 1YJRA 3ULHA 4U95A 2QL9B 2V0NA 4JI0J 3KJVB 2JLFA 2V94A 2D9PA 2B6AA 1SL1A 1CVJA 2B6AB 2W1BA 5JUMA 1KONA 2OJ3A 2W9CB 2ZITA 4V19J 1X5PA 1NZ8A 3TJ8A 3MM6B 1TKTA 3P3DA 5KFGA 2A10A 4NA2A 2HZAA 1FE0A 2FYXA 1WTBA 4DX8H 3HJVA 3M6VA 1RTZA 2A6MA 1VLYA 3AA8A 4UW2A 5J2PA 5BYSA 2VPYB 2ZH1A 5EX0A 1TELA 4NLQA 2VJVA 4ZPBA 1B3TA 2DR6A 2V4QA 1G3OA 2YKNB 1SL0A 4K7QA 3SCKE 4LF8J 4QYRA 4G1QB 4LR7A 1NKEA 3IRXB 4QU7A 4G1QA 3IXQA 2JJ4D 4NLUA 5EX3A 1A9NB 5B0CA 3MR7A 1FDDA 4QR1A 2BACA 1GMVA 2FJAB 2YKMA 1V5IB 4ZS6A 4PWDA 4ZVOB 2EVZA 4H4OB 1RAHB 2OPRB 2EFVA 3JAMU 5CYQB 3ENVA 2HBQB 4WIIA 2OI2A 2RQ4A 5CYQA 2I6WA 2EBGA 1J5OA 2DXFA 1JKHA 1J5OB 4OZLA 4ANEA 3CJ5A 3OTOJ 4P75A 2VF3A 4ZHRA 3A3PB 4ANCA 3CJSA 4ZHRB 3Q8QB 3MCOA 2FZKB 1HWUA 1RABB 1KN6A 2QLWA 3M8WA 5D0EA 1NBEB 2Y0SD 2IC3A 2HFZA 2J7WA 4N8OA 4LFBJ 1NXIA 1YZ7A 3QJPA 2C28A 3MXHP 1LWXA 1FA0A 1N52B 1UJ4A 4DV4F 3R97A 2BM0A 5B0BA 4WP9A 4KGZB 3OR1B 2R2RA 4OYXA 4M1KA 3UFCX 1MN9A 3TVYA 4ZMMA 3D66A 4ECTA 1F9HA 2BANA 2XSJA 1J27A 1QJHA 5FLXY 5A8KB 1HQEA 1PJ5A 1I94F 2AV5A 2WVDA 3AOCA 1UFLA 3GQCA 2JOQA 1TR0A 2NUUG 2QL7B 2RD5C 2YNFB 4DV6J 5AXMA 4H4MB 1UZDA 2CNKB 2YNFA 4G6VB 4LSLA 5CABA 5IS2A 4IOCQ 4FYWB 2MHNA 4RR5A 2CNNB 4DUYF 1VQ9S 2DNGA 1RHRB 5HP1B 1RWVB 2XY5A 3BPDA 3MEDB 2E9RX 3H4BA 1CJUA 2DNYA 1Y5IB 2BKOA 2LEAA 1E6VA 2ZH4A 1O6XA 2J0SD 1ZH5A 2IBOA 3FMWA 3TANA 1UEKA 2J7UA 1ZA1B 3CDAA 3TVKA 5D0RA 1VDHA 1U45A 1NJWA 3KHGA 2E1MC 3W1YC 3K2YA 4J9QA 3NY0A 2EI5A 2VONA 5B0EA 4PRFA 2GGPB 5C24B 2ROPA 4DR3J 1RT3B 3UD5A 1BQXA 3QRPA 4Y65A 2XULA 4YFUA 2B5JB 4ILRA 1S1VB 4KHRA 4K4XA 4G1PA 1C1BB 2NUHA 4LJMA 4ZCLA 2BYCA 4PYAA 5LM7E 2IM3A 2NXEA 4ENOA 5KG7A 3EX7B 1FKPB 2ATCB 5F0WA 4DQPA 3D54A 3FEXB 4MIBA 2ILYA 3ZTQA 1U48A 1C0UB 2FVSA 1W26A 3S6EA 2XY6A 2R7SA 1SKUB 2DGVA 4DV1J 4ED5A 3I0RB 1WDDA 1U0HA 4E98A 1M1KT 4PABA 2UXCF 3MURP 4LF4F 2D69A 3JQJA 1N4LA 1BXNA 1JK9B 4P7TA 1RZMA 1YZ6A 3ZFVA 2K8GA 4PZVA 5IV4A 4ZOSA 5EWEA 2AT1B 2RS8A 2V2VA 2MLYA 3W9IA 1BGXT 2CDRB 1AUSL 2L9DA 2VBWA 1N5YA 2E1CA 1Q8KA 4A8FA 2Y9HA 3ZZYA 3ITHA 1FJGF 2UVVA 3RZAA 4B3MJ 1LOUA 2VA2A 3HVTA 3H25A 2GFFA 1SH0A 4ELTA 4DQQA 1S4FA 4TN2A 1KQFB 1TFYA 1TUVA 4DZDA 2DCUB 3DYAA 2ZH9A 4LRCA 3OR2A 4C0BA 3PX0A 1S6UA 3GMGA 4USTA 3HDSA 5LT5A 2L41A 1FKAF 2JLEA 1D9DA 4AXJA 1U2RA 5FD1A 4ETXA 1KBRA 1TK0A 2N7YA 3PW4A 1QVFR 1CULB 2CQIA 5DS7A 1FJEB 4F2RA 1WG1A 2H5IB 2SXLA 2WCXA 3NOGA 1S77D 3W2WA 3IA0A 1MROB 1UVMA 1R0AB 1TAQA 4EK2A 5KFBA 3CMES 3KUGA 1RDRA 4URSA 7FDRA 4O44B 1XERA 2M8DB 2XLIA 1RLDA 2WB4A 3L3CA 4EWTA 4RNMA 3JB9k 3J80Y 3H2VE 1DY3A 1K1SA 1VRUA 2V8GA 4K59A 4OMFG 5HAOA 2J9DA 3EDRB 3Q8RB 2DHXA 2Z0GA 2OKQA 4DV7J 2R7UA 4WFAQ 1WORA 3DHXA 3P96A 4KFBB 2CQ4A 1M1GA 2IAJB 2DNPA 3CVKA 3TA1A 3UCUP 4OI0A 4GKKJ 3SEOA 2ZFHA 1HMVB 4GRSA 4WE1A 3AT1B 3D3CJ 3MPWA 1X5TA 2QG9B 5IQQA 3OVAA 4OYWA 4DV3F 1Q86T 2CNLB 3BBBA 4YDDB 1JLBB 2QTWA 3BM7A 1H7XA 3I0SB 2IRUA 3W5YA 3VAIA 3A4TA 2A2CA 3I0SA 4QBUA 4X64F 3AJ2A 3DRXA 3PJXA 3OTOF 1JJHA 2Q6CA 2Z56B 2DNHA 4F4ZA 1NH8A 4X4PA 2HFSA 2AF6A 1JJ2R 2D3ZA 2YWGA 4OX7A 2BE2B 1TQLA 2ZNYA 4OHVA 3CC7S 1EARA 1OWXA 1ZA2B 2XNQA 3EICA 3Q8SB 3PO4A 2BKNA 3FSYA 4O4GB 3GV7B 2ADBA 3O44A 1V3SA 3POTA 4RNHA 5KFXA 3MM6A 1WF2A 5LMNF 1P1TA 1XMBA 5F8JA 4KKOB 1NRKA 5E3PA 1R89A 3H2LA 1H0HB 3FC9A 1B4SA 4LRAA 3ZNJ1 2QA4S 2V9WA 2VA3A 3DHWC 3HD1A 4M95A 3I9ZA 2R7VA 1YKWA 1DURA 5D4OA 4DXLA 1HA1A 2AEFA 5E3RA 3W7BA 3H8YA 3OHAA 2WSFC 3W60A 4ZVQB 1H2VZ 4RW6B 2XM3A 4J9RA 1E6YB 1UAWA 3HCXA 1FX2A 3A12A 1HW9A 4USWA 3M8SA 5DZ7A 2DEIA 1HBOB 1VOMA 3CCQS 5D4LA 5DQHA 2AYGA 3FK4A 2LFVA 4K8RA 3UD4P 2HHHF 1GH8A 2AP6A 3EVMA 4OHYA 1U2FA 4CO0A 1JB0C 2CYYA 1UWBA 2GMLA 2MB0B 4ERDA 4WK3A 3IN5A 3SIPB 3MUTP 2ZH6A 2VDHA 2XSFA 3H5SA 1RWOB 5HJXA 4ZPAA 3DLGA 3O8WA 4GVBA 4JV1A 2HS4A 2KFNA 2QMUB 2GS8A 1Q81T 3MOZA 2HGMA 2HRTA 4IFYA 1IWGA 4LFCJ 1HNXJ 2FHJD 1WNEA 5GMKa 3A8EA 2XQCA 2RAQA 3NMAA 4IDKA 3M1VA 4IDKB 3VWSA 3M1VB 2BBEA 3ENQA 4QWDA 2G4BA 1OSDA 5BR8F 4Q8EA 5HMZA 3JSMB 2XGQA 3HXMA 3QO9A 2MEWA 3G87A 4I6WA 3M9NB 3QO9B 3BQ0A 5K8PA 4J9LA 2MZRA 5DG9A 2VV5A 1S1XA 3G82A 4TKTA 1S1XB 3G82B 2A0FB 4YS2A 4ZVGA 2EWHA 3NOCA 2B3TB 3GLJA 3FSIA 4N76A 4M5MA 1SV5A 5KFNA 3VR1A 1F60B 2IVFB 2KG0A 3K5MA 3KK2B 3NWRA 3DLEB 4DR5J 3M8RA 4YHHF 5D3GA 1KQGB 2V2QA 4LF1A 4DR2J 4XK8C 4YR2A 5D3GB 4RJVA 3LP2B 4A8OA 4ZKAA 1TZ0A 4A8QA 2BJ7A 4X84A 1LXJA 2ZWOA 2YXLA 1ZM9A 1YJ9S 1HYSB 4K4SA 1C2PA 3HVRA 1KLMA 5F8HA 2GIRA 2NXUA 2WAQD 3IWXA 3PTWA 5M2PA 2IJRA 4WBFA 3F73A 2CUYA 5AXKA 1NJIT 1N6QB 1DZ5A 1N32J 2AJ2A 3HVWA 4YB6A 1X4CA 2VPXB 3LAMA 4XO0A 3M9MB 4NLDA 3MUVP 4JI6J 2DNMA 2QLBB 2C3PA 3R5BA 4QWAA 1VQKS 4CLUA 3CCMS 3T6JA 5SUHA 2VICA 2RB7A 1PO6A 1D09B 2O66A 3SSSA 1PIEA 5L46A 3I0RA 2P9EA 4NI2B 4Y34A 3OL6A 2ZE2A 4F4KA 2ASYA 4R5PA 4B3RF 2RJZA 4DN0A 4ER8A 2GMHA 3SQOP 2HVZA 1DJ0A 2JDJA 5KFJA 3PFEA 1BQMB 3AOBA 2DRBA 4CYUA 2IYGA 4YHHJ 1R8AA 1IBKJ 3UQSA 4DR2F 3D1OA 3HVTB 3RUBL 4PQUB 2LQBA 2P9GA 2J7KA 2AZ3A 4C3MA 3C15A 3G6XA 2MDAA 3KK1A 1HPZB 1QAYA 5HATA 2Y1RI 1PC4A 3OT9A 4IG0A 4DL2A 3E01A 2WVEA 3FBBA 4KRWA 2EFPA 4UTGA 1SC1B 1JXLA 2RQMA 2DT9A 2WSCC 3BF4A 4Q8FA 4WU2A 3I32A 3OQ2A 2UU9J 4PWWA 4L74A 2R8KA 4RUBA 3ZZUA 1WI6A 4J9MA 3EE3A 3WC2A 1IR2A 4HTJA 4RW9B 1U1PA 1CEZA 4TYAA 1OJ4A 4M5IA 1KTQA 1K47A 1R0AA 1L3UA 4PXEA 4B9SA 3ZXWA 2KFZA 1NB2A 3VAJA 2CAJA 3FBEA 3BO2A 2W4DA 4OV6A 4PG6A 1XEZA 2CG4A 3KK3A 1JX4A 4RW8B 2N7CA 4USJC 2B8PA 4B9LA 4P72A 2HZCA 2MHEA 2XHWA 3MM7A 4JI2F 3Q24A 5FIIA 3US5A 4UOGA 3B8HA 1C0TA 3K17A 5EUHA 3PACA 1U4BA 1UVLA 1JLQA 3GE9A 4ZPTR 3NGKA 2D3UA 2K06A 3CCWA 2G2YA 1VJWA 5K14A 1XMOF 2DVIA 4B3MF 2VBXA 3M8QB 4B02A 2ZZNA 1IJFB 2HS0A 4A8MP 3HZGA 1LWFB 4ZVFA 3K59A 4J9OA 1TK5A 1Q16B 4JYAF 1RT6B 4LVNP 2P6SA 2VG7B 5DGAA 3TI0A 3A13A 2FY1A 4KGMA 2IVYA 2RE1A 3ZTSA 2ZC3A 4MIAA 4ZIVA 2HHUA 1F6TA 3A3NB 2W24A 3EGNA 3E8OA 5DO2A 2R7XA 1M5PC 1UPMB 2R7OA 5KFWA 4K4YA 1KHVA 1XR5A 1J5EF 1Q5YA 2FHMA 1VS3A 1WKKA 3DGVA 5EGYA 1WI8A 5KFRA 4ECXA 4X4UA 1QAJA 5CCMA 1S49A 4DCOB 2QZ8A 1H98A 2HMIB 3K8WA 1EX8A 1S6QA 2RUSA 1S12A 5H1SV 3MMCB 4QPTA 4DSIA 3G2XA 3GFXA 3MMCA 4TYBA 4L73A 4GO7X 4WFNQ 2BJDA 3W65A 3HKWA 3FUYA 1H72C 2HGLA 1RAIB 4ES3A 2CPDA 3OJSA 3E3XA 4IOBA 3SQGA 2H9ZA 2H5JB 2O5DA 2PEHA 5I4MA 3KLFA 1HARA 3HPOA 1KLNA 2DHGA 4WFZA 1XWLA 4Y0FA 2ALYB 2BZ2A 3EVOA 3HX9A 1RA7A 4PCQA 4UF4A 3H40A 3UDEA 2HFVA 1HNWF 2YTCA 3C6TB 3CDEA 1UVJA 3EGWB 4CNZA 1FVSA 4B3OA 3JSBA 1F2GA 2LDIA 1VQ7S 2FB0A 4DS4A 4RPFA 1N32F 4F50A 5HJYA 5CHCB 3CJ2A 1VI7A 1P9QC 2C2NA 3DDNA 4YB1P 3QIDA 1Q1KA 2VZ9A 3NXZA 2XC9A 2ZJRQ 1PGZA 4IQXA 3SCLE 2CPIA 5JVGQ 3AXKA 4RWWA 3V5RA 2H54B 4X66F 3TX0A 3LW5C 2FHJA 4I64A 4C2MA 2C3MA 5ETRA 2HQGA 4NA3A 4JI6F 4UQTA 3OL9A 4MFBB 3NLCA 4A4JA 4QCLA 1R31A 1S1TB 3A8JA 4TU7A 2AYEA 2HNYA 1S1TA 2ZVSA 3L4BC 3T19A 1K0TA 3BYRA 3FQKA 1SJRA 1Y4ZB 2BXJA 1SC3B 3I5BA 1RT4B 3MM8A 1IKVA 3NGUA 3TW0A 4RNOA 4X4VA 2CWXA 4NLRA 4IG3B 2AJFE 2CNOB 1UVNA 3WC0A 4AD6A 1DHMA 2UZAA 3QYYA 4GMKA 3TX8A 1RQ0A 2COLA 3CT9A 5T14A 1N33J 1IR0A 3CCLS 1W2BR 2ZH7A 4NLXA 3UN5A 2BANB 1XN9A 2F8EX 2A1BA 3ZZZA 1OQ6A 4EUVA 1VRTB 1VBYA 1X4AA 1VRTA 3MAAB 4OQJA 1R0BG 5KG5A 4MTPA 1CLFA 3HSDA 3IG1A 4KSEB 5GAGU 2VG5B 2R7TA 2KXFA 3RR8A 1TKZB 1SJ1A 1WG4A 1EKRA 1FTRA 2K3IA 3MPVA 1LV5A 2Q43A 2IA0A 3CCTA 1WEZA 2HFUA 2J9DE 4HACB 4F36A 2BUNA 1LKZA 1KOHA 5A0YB 3GJQB 3J81Y 2QLXA 2HHVA 4DUYJ 5IQ6A 4K2XA 3OHBA 4DFJA 1U1MA 1YRUA 1RHJB 3FCWA 2OTLS 1RP5A 3P5BP 4Z37A 1URNA 3PJ9A 4HHJA 5L38A 2HRYA 2ZHAA 4LRBA 4QR2A 2FZGB 4WIQA 5F3ZA 5JMNA 2F9DA 1EETA 4U96A 1C1CB 2VQEF 2YQ3A 5KFPA 1ITPA 1C1CA 2D41A 3GG1A 2GO9A 5A6PA 3IP0A 5BJRA 5J1EA 1ZTWA 2IPOB 3LQVA 5KFTA 4NZ7A 4DL6A 2MQQA 1FXRA 4D3GA 3TZXA 2MZSA 1EHWA 3N0VA 4H4MA 2RKIB 4KGVB 2DTJA 1U02A 1FDBA 2F7VA 2LXFA 2KT3A 5M2UA 1CC7A 1H73A 3CMQA 3DDIA 5E0OA 1U0HB 3PM9A 1NJYA 1ZPVA 3QQCD 4KPCA 2IIHA 4OZ1A 5KOWA 3F41A 4MT1A 3MM5B 1GEHA 4CYUB 3RYLA 4QYZK 1Z1ZA 2ZKUA 1NEEA 2AW0A 4ILLA 1W7WA 3ET6A 9ATCB 2DNZA 3ET6B 3PKYA 5KFKA 3KFWX 4OZ3A 3TAMA 4BC7A 1HI1A 3BR8A 4MJKA 3DRRA 2NPFA 4G3IA 3ITHB 2D3OR 3NGSA 3DXSX 4WP3A 5A8RA 2KM8B 4NLSA 1CJTB 2YX4A 3SYZA 4UUWA 3OL7A 1RT3A 2Z58B 4PAAA 1RYSA 2FLLA 3PHTA 1OY6A 2LECA 1S10A 3GONA 2EKYA 4JBCA 1BLUA 4NOHA 4KE5A 3V4MA 1F0XA 4NLOA 3UWTA 1IKWA 4GKJJ 1Q8LA 3M8ZA 5L8RC 2ZBCA 6FD1A 1T95A 1TTHB 5DRKA 4X2BA 4QZVB 4A46A 2B9XA 1QE1B 2DK2A 2CVEA 1RT2A 2AJ0A 1MROA 2C3OA 3IBFB 4PPDA 1YJVA 2ZC4A 1S9EA 3SXLA 2KYZA 2ZNZA 3HHKA 4DL0C 4P74A 4GVLA 5I3UA 2FC8A 2ROEA 3GSDA 4BCAA 1RJJA 2XY7A 2I5JA 1FRKA 3AOAA 4I2PB 1U1NA 5KG0A 5GMEA 4UY85 2W2PP 1MMNA 3M8QA 5FDLB 1OY8A 4F3MA 3HFVA 1TP7A 4CIOA 2IYIA 2BKPA 2Y0BB 1K44A 2HHHJ 5A2QU 1K9MT 4JI4F 2CJAA 2WB1D 3KLVA 4DBQA 3TAPA 3UVJB 3BSCA 4FYDA 1RISA 4EFAC 3V6HA 2KL8A 1U6FA 3PRVA 4ID8A 1YDLA 3AA9A 4LVOP 2AJQA 2OTJS 4DG1B 3DLKA 2LYVA 3M30A 4F4XA 3T1YJ 3Q2SC 2W25A 3BBFA 2O67A 2BQRA 4LRDA 3BGRB 1QVGR 3R5GA 1IKXB 2F8MA 1G2EA 2MZJA 3D67A 5T7LA 3BZQA 1B7YB 1RWPB 1Y7PA 3KLEA 3ONQA 5MAOA 4C4WA 2FJBB 1UFKA 3KLEB 1TUWA 4Q5VA 1Z2LA 4Y28C 5J2QA 1MG7A 3M05A 1RCXB 4OJ1A 4A48A 2DGSA 3OFFA 3TP2A 1URRA 5IV3A 4U7UD 2XMKA 3D28A 4RL1A 4X4TA 3SQGB 5LJ5Y 1JXVA 2R42A 4P9SA 3K89A 1NPPA 1KOOA 2J8SA 3TR5A 3MOJB 2KRBA 1XMOJ 2CRLA 2IMOA 4GC7A 1KNZA 3DC2A 2Y3YA 4J5OA 3MEGA 2NXJA 5LSOA 1DQAA 1VQ5S 1PILA 1RXOB 4IO9Q 2CA9A 5J2MA 1UJ6A 2F40A 1X9WA 3AJ1A 4ID5B 5KG6A 1TL1B 2LQ5A 5D4PA 2CQ1A 4H4KA 2G1HA 3RB3A 1DLOB 3P5TL 2MGZB 4O3RA 4H4KC 2OPSB 5F9NA 3ADAC 5KFOA 3C66A 1YBTA 1FFGB 4DEZA 4K4TA 1HWKA 4Q7AA 2LXIA 2E9TA 3FJ2A 4ZITA 3VALA 4ECUA 2QSFA 3HI9A 3Q8VA 4LFAJ 4FDFA 5DG8A 4DSKA 3PVXA 1OSCA 1ULRA 2KN4A 2BW2A 1PAUB 3DLGB 2HVIA 3R5AA 4RBVA 1SQGA 3PY8A 2K3KA 1QY7A 4URGA 1JWWA 2F3JA 1X4BA 2W2QP 3IR7B 3ZZ0A 3RR7A 3NNAA 5E3AA 2D9OA 2FVCA 1HNVA 4CM2A 3MI7X 3S8SA 4ZP8A 1XMQF 1UTAA 2FJEB 2L9WA 2QT7A 4DR6F 3DDKA 3WX8A 2QL5B 2HYIB 2OEKA 4PPZA 4CLTA 5ETKA 5L1JA 5JVHQ 3I6PA 2YNIB 3KLIB 4NASA 3TUJC 1NK0A 4ZVRB 3SFGA 1U7LA 2OH2A 1S6PA 2BQUA 4FP9A 4ED0A 2CPFA 1DTQA 4DV5J 1DTQB 2OPRA 5B0DA 2V69A 2YWKA 4JI1J 1BUXA 4LREA 2B7CB 2MQMA 4EEYA 1M5VC 2ABYA 4ZK7M 2HHXA 3HD2A 2HQIA 2OEMA 4HI2A 3LP2A 4OX8A 4OI1A 4X66J 5L1LA 5ETSA 1FD8A 1OMSA 2KRRA 5K8NA 3MFHA 1SKSA 2HVHA 2C3UA 3CJKA 4FYXB 3R5JB 4ZVHA 3T5JA 5EHHA 4N47A 3K5OA 4FVMA 4GKJF 3KG1A 1OQ3A 4DOZA 1HFEL 2M5YA 3NNCA 1Q7LB 1RB0A 3BSAA 3QFHA 3DRPB 1UW9A 3DI6A 2XSJB 1RBOB 4NXNF 4OJGA 1SIWB 3VVUA 1KQSR 1KP6A 1NHKL 1FNMA 2OPPB 2G13A 1UEVA 2OFGX 2XZDB 3ISZA 4DJBA 1ZAWA 4F26A 4HDGA 2RMLA 1D0EA 4JI7J 1T03A 2LA4A 1T03B 2ZWPA 1EQMA 1SC6A 1TU0B 2EFGA 3PCOB 2Z57B 4F0MA 3KK2A 4C98A 4P2XA 4F04B 5LOQA 2MZQA 1JLEA 3KLHB 3KTQA 2ZOMA 3CJTA 4JI8F 1Q7YT 3CPWR 1WOPA 4W4MA 4WTYA 3G6ES 2FIUA 5DDRC 5GAEI 2CPHA 4FVCA 3TAMB 3H20A 1KD1T 3HSJA 2FVRA 5CZVA 3DRRB 2PEBA 3W64A 1T8EA 2HHTA 1BQNB 1I51B 3P49B 1HI8A 1P8GA 2XWYA 2HFNA 1HBNA 1A0OB 2FTRA 5IC4B 3W9HA 1IBLF 4DWIA 1NUEA 2N4CA 3ZTPA 4JV5J 1IM4A 3MZIA 5GVQA 2M2BA 4IG0B 5ETPA 3C3LA 1OPZA 4OLOA 2RU3A 2C2RA 5ETNA 1J5EJ 2OUGA 3RBZA 5B7WA 3CCRS 2BE9B 3U1MA 5J1NA 5KT7A 3RB6A 2K7JA 2MJUA 3ZO7A 3PKMA 2YQ1A 4RW4A 4FKXA 2AGQA 1HW8A 2GNKA 4DPWA 2DGWA 1HBUA 5LJ3Y 4ECZA 1VBKA 2DISA 2AKWB 1PJ6A 1TUGB 2E5IA 3HVAA 4C8NA 5DDOC 1U47A 1S9EB 1ZOTA 1OYEA 2L9NA 3DRSA 1PBUA 3C19A 3FEYB 4I7FB 2LU1A 5HL7Q 1XK8A 1HKAA 1A7GE 2XG8A 1FNXH 3GCXP 1N5YB 3NNHA 4I2PA 1X0PA 1HIYA 3EXYA 2HG4A 3MAHA 3MM7B 3WIUA 2C2OB 2GHVC 4ZIWA 3OV7A 3PX4A 2HBZB 4U9RA 2RDIA 1RHUB 2J6SA 3IFEA 4I1TA 2QE5A 3C15B 2EG1A 3GJTB 3PR4A 4CCHA 3GTYX 3M2UB 3GYXB 5A8WB 3MR6A 3JYTB 4DPUA 1WC5A 4DQSA 5F8NA 2XMJA 1KHWA 4DU8A 1SQFA 3G6YA 1RHMB 2HK2A 4NXMF 1X4HA 2CQHA 2NPIA 2OELA 4LR9A 2Q3PA 1BWEA 2IY5B 4FNIA 1CSJA 3H59A 3U1NA 1WUUA 2H65B 1FEHA 4M5DA 3KKFA 3TYTA 4ETZA 1K0VA 2ZUGA 1RCOB 1Y3KA 3P4UB 4LBPA 1GT8A 1Y5LB 2A18A 2YPZA 1UP1A 2A3JA 3SSQA 2XLJA 1IBMJ 3LAKA 3GV5B 4G65A 4URQU 2HKEA 2I1RA 3KJVA 4WU3A 2ERRA 3DLLQ 2DR7A 5IM0A 1FWLA 4C8ZA 1GXLA 4X4SA 2EBEA 3CD0A 1Y3JA 4RZRA 2G0JA 2ZD1B 1YIJS 4IH5A 1FFWB 2E7XA 3QIPA 2G2OA 2H4YB 4DPYA 5HMXA 1C0TB 1NLKL 4I6AA 4Q44A 2HQFA 4KKOA 4C8LA 3FFIA 2KFYA 2FQQB 1Z4UA 3C2PA 3D5MA 2FJDB 2YKOA 3K58A 2KVIA 2OLWA 3MEGB 2MPUA 4B9TA 4TQSA 3W3SA 4RX6A 5D0GA 2XBPA 2ZJPQ 3O2IA 5C2GA 3HT3A 4ZN1A 1Y00A 1KC8T 1I5OB 2XCPA 4RW6A 1FESA 4ID5A 1JIHA 3EM1A 3LP0A 2HHPA 4QIFA 1T0TV 3UDLA 2DR9A 2M8HA 2OGUA 4DPTA 3MR3A 2F9JA 1SH3A 1JLCB 3MTJA 2QC3A 4P6QA 2GX8A 2JWNA 1FWKA 1FF2A 2WTFA 4OZ5A 3CC2S 4R0EA 3VV2B 1WJ9A 4YUDA 4O3OA 2P6TA 2VD3A 3DGPA 4KH0B 3UCGA 3DGPB 4Q45A 4BHQA 4AFFA 5H9FK 5GMDA 4X62F 1RUSA 2FJWA 2RQKA 3I4HX 4P52A 3IMQJ 4LFBF 2OMOA 1AW0A 1HQUA 4TLRA 2JC0A 1Y0HA 2ZBPA 4I4BA 4JOUA 5E3CA 7AT1B 3TZWA 3UR0A 4F3QA 3VAGA 1S0NA 1VHFA 2XEXA 3CDBA 4LRFA 2HNYB 4DV4J 1JMTA 4N56A 4ICLB 4AYBD 2QFJA 1RKIA 3MM8B 3KLFB 1C4AA 1IKVB 2XTJP 4RU9A 4JI3J 1QSYA 1NAQA 2CQBA 3TEHB 2KH9A 4ZP7A 2QO3A 5G0RA 1JLFB 1UZHA 1YG0A 3JTNA 1T9TA 3P45B 2IDLA 5F41A 2YKNA 3W9JA 1FDNA 3GWCA 3G8SA 4EBCA 5FLXU 3V6JA 2GVDB 2ASDA 2DKOB 3IRXA 3BYPA 4M5HA 5GADU 3BSNA 3T3FA 2F65A 2HS3A 3MAAA 3VQSA 3DLJA 3ILIA 4HKQA 3GG0A 4KGKA 2LKZA 2HIQA 3THVA 1X5OA 2MXYA 5LL6d 4CI0B 5H9EJ 3NCPA 5EWFA 4GVBB 3GV8B 5K9FA 1XTZA 4DSEA 3D1HA 2BR0A 1HR0J 1FVQA 4HACA 4TXSA 1Z2ZA 4ECWA 3Q22A 1HQ2A 3K7RA 3R7SB 1KWMA 4C97A 3ILLA 2OSQA 3NKYA 1ACMB 4OYIA 2GO8A 2VKZG 4RBUA 2FC9A 3DRPA 4TLQA 4L3NA 2DNLA 4Y00A 1SUQA 3M32B 3MR5A 1JJCB 2LP4A 5BYRA 3M32A 4QWBA 5DQIA 2JEIA 2XI2A 4NYOA 4J9PA 4NLVA 1K8AT 3FZ2A 3SV4A 2EXUA 3OTBA 3A8IA 5HN0A 2VB6A 4LMZA 4ZVTB 2RHSB 1XMQJ 1O5JA 5ETVA 3I5CA 1WOOA 3H4DA 3CJ4A 4A8SA 2K1RB 3GFZA 3DXBA 5HROB 5K8OA 1N36F 3HT0A 2BEFA 4UY8T 1MW7A 1YLXA 3DRYA 1KFDA 3IR5B 3QMQA 2NXCA 3QWPA 4DL5A 1NSQA 3CCJS 3DKDA 2J6TA 1GXUA 2RHQB 3T5KA 1JLEB 4CH0S 4WFBQ 3KMQA 5J2NB 1NSAA 3IG1B 4EBEA 4DV5F 1NDPA 4B3SJ 4NCAA 4JI4J 2UUAJ 3H7HB 2KT5A 3H42A 3MM9A 1Y9OA 3N6MA 3DN9A 3KG4A 3MM9B 4M63A 4WTOB 5IOLA 3MEDA 3RAMA 4UOFA 4NXMJ 2HHWA 1UKUA 4C8KA 4MKBA 1VC5A 1UPPA 2J76E 1UWAA 4ZA1A 2O3DA 1EZZB 4OJ3A 2JEGA 2W7PA 1F2HA 2HQ3A 2LVWA 2J0XA 3EVWA 4PYDA 2R3VA 4WFXA 2CZVC 2W9AA 2V50A 4W98A 1FJCA 2XMAA 2ZHOA 2KU7A 1NCLA 3CD5A 3PEJA 4R0JA 4CTAB 3C14B 1VBXA 5J1EB 3BQ2A 2AD9A 4TY9A 4JI5F 3HKZD 5DETA 1B99A 2V2ZA 3ELHA 1S76D 4KO0B 3D6TB 5IT9Y 3BKFA 2HPUA 2EKNA 3J7Z5 3V4IA 1NMEB 4R5PB 4DR1F 1HNZJ 1WDTA 1UEUA 2ILZA 4ED2A 1JLGB 3QT7A 3W61A 1L5UA 1JLGA 3RBXA 3EMTA 3NGRA 1GMUA 1YITS 2P8IA 3BH7B 4Q0BA 2LLZA 4RW8A 2ZEJA 1VJQA 3A8KA 4BWJA 4YN3B 4ED7A 3BDEA 3HSZA 3D2WA 4NRTA 1M90T 5HLFA 1DRZA 1U09A 2GQ2A 3FBFA 5D4NA 5E41A 4OX9J 4XDCA 1N8RT 4QIVA 3NCRA 4NEZA 1EIYB 2JRSA 2FLNA 3O5TB 2X1AA 5DDPC 2YNGA 5DM7Q 1TFWA 2KT2A 5AE2A 5LSLA 1H2TZ 2MKJA 3JYTA 1Y5NB 1YVFA 4DSJA 4WWSA 5K8MA 1QLNA 2RT3A 4C6AA 2V8VA 4P2SA 2Q66A 1LWFA 4K0KF 2DIVA 1CBKA 4ED6A 2HIYA 1GTEA 2CJKA 4IR1A 1RT6A 1CJTA 2HNDB 2J9EA 1LWCB 2W01A 3HHLD 4O4RA 1W25A 1TL7B 2VG7A 4RWXA 3CW2C 4RW7A 1QTMA 1RU2A 4RW9A 3H98A 2GC8A 4ZPVR 2XYGB 4DSFA 4QIWD 4X64J 2I38A 3FDSA 1ZZNA 2FUG9 2UP1A 4MMOA 3CWJA 4CT8A 2ALZA 2AGPA 3IGNA 4NYPA 4C11A 3W5XA 5HVHA 3G8QA 4KT0C 3T41A 3S7RA 2VG6A 4PUOB 4USVA 1U1RA 1CJVB 2BM1A 2QN6B 4O0NA 4XDDA 2B4PA 4C8OA 1FRIA 3QIPB 6AT1B 3HF5A 3NG8A 3BGOP 1WC6A 4DFMA 1N34F 2DR5A 1KVJA 3RRKA 4I67A 1H2UX 2BJ3A 2VUGA 2ZBQA 2MKYA 4BWMA 5JXSA 5KFMA 4B3TJ 2I5JB 4EYHB 3HFZB 1AZSA 2UVWA 2BOPA 3LP1B 2UXCJ 2FZCB 1GMWD 1LK7A 3GR1A 1RWXB 3KXDA 4ECSA 5H9EK 2FVPA 3HHLC 2FD2A 1QSSA 3G9CA 1HNIB 5CZXA 1ZBTA 4LQ9A 4FBUA 3KJNB 3OJUA 1Q0NA 2C2DA 4U7UK 2MTLA 2H4WB 4LF7F 4OHXA 1B0VA 2XB2D 2XO6A 2U2FA 3OSNA 2C1EB 3H5UA 4CLFA 2IAJA 2V67A 4PEOA 3OFGA 3BKTA 1LWEB 2PMWA 3M2RB 2UXBJ 2KKHA 1RAOA 2JFDA 4JB8B 2XNRA 1TKXA 1NK4A 1TKXB 2GIFA 1KKHA 2NYHA 3KNGA 2Y8YA 2R8IA 3PRBA 3L7OA 4PXDA 1DLOA 4TNOA 2OSRA 3CB4A 4NCGB 1T9YA 2LXUA 3VVTA 1U1LA 4J9NA 3OLAA 1IBMF 2CQCA 5LMUJ 5CAAA 1F3FA 4NZ6A 4AQYF 1S0VA 2J6UA 1V6HA 2RF2A 1WKJA 3JXOA 4KHMA 1GAOA 3DU6A 2Y1JA 1NHVA 1WOSA 3W63A 4MFBA 1X4DA 1X7VA 4OZ2A 5AXNA 3AH6A 1CQNA 1Q5VA 3IWLA 3B78A 4Y2KA 5CQGA 2W9CA 4NCBA 4FXDA 2BMBA 3POTB 2Z2MA 2HEKA 5CD4H 4IRDA 1FRXA 3MDFA 1CC8A 4P73A 5F8GA 2DYAA 2P5VA 1QSLA 1RTDA 3FZBA 3WIVA 4FF2A 2IM1A 2KO1A 3D3BJ 1RTDB 5C7PA 2R8GA 1TL4A 4IYQA 2LU2A 4J37A 1B64A 1YBUA 2CJYB 3GIKA 2CQ2A 2DJWA 2KHDA 2KVQE 2QRRA 3OUYB 2HLUA 1T9WA 1MU2B 2CPJA 2CQDA 3FCHA 3HHDA 1TVRA 1B0TA 2D74B 4KC5A 4QJVA 1SPBP 3OUYA 2WZ1A 1VIXA 1W2IA 4A8YA 4DR5F 1D9AA 3TZZA 3MFIA 2Y1IA 1QDUB 2MKHA 1VQNS 5D8HB 2MMYA 3R5CA 2X1FA 1ZETA 5I42B 4OZNA 1FRJA 2FDNA 4QW9A 5I42A 5L1IA 3ETOA 1N0UA 5A0YA 2IMWP 1WELA 1S9GA 2LQJA 2DBBA 2MQ8A 3RW7A 3KHRA 1B0PA 3U27A 4ITSA 4ZVSB 4W92B 4UUXA 3TEGA 2YY3A 1NNDA 4I6YA 4F8RA 4WKYA 4BS2A 4Y2MA 4ZPCA 3ZTRA 2QV6A 4KHPJ 4C8MA 2CJ9A 2CXEA 3DM2B 4RO0A 1PC5A 4CDIA 3KLGB 4DR1J 4WKRA 1NKCA 5KG3A 2DCLA 1GNKA 4B9VA 2JFKA 4C0HA 3G4SS 2H51B 2ASLA 1NPKA 1Q8BA 1VLOA 5L1KA 3MCNA 2F4VJ 2O1PA 4MIWA 3I82A 3D6FB 5KFIA 2HAIA 3IAS9 1MLAA 2CPZA 2V8DA 2EFOA 2KYXA 1S6PB 3CJRA 1G4CA 3QWUA 4LSLB 3QRRA 4P10A 3PRDA 4FS2A 1SV5B 5HMYA 4PR6A 3PX6A 4IFVB 3E2EA 1RWWB 2DGOA 2CZ9A 1GMWA 2OO4A 1E6VB 3OFEA 3AXMA 1K1QA 1X4FA 3HHEA 4PQAA 5ETMA 1MNEA 1AA1B 1NH7A 1RSCA 2HWTA 3OFHA 4JV0A 1VQPS 4FF3A 3EZUA 4HVZA 4QW8A 1HYSA 3AFGA 5E33A 4DUZF 3DFEA 1F9FA 2V4JB 4JV2A 2OFHX 2V4JA 4TY8A 1JJ4A 2W7AA 3ENWA 4TY8B 2DR8A 1KVIA 1YGYA 5B0AA 1U1OA 4Q2LA 5DLGA 4LQ3A 4CM0A 2B5JA 2RRNA 3M6WA 2L3MA 4MAKA 2JLGA 2MKKA 3AQOA 4WYLA 2JVRA 1RT1A 1TL5A 3O3LA 4IH7A 6FDRA 4KV8B 4EYIB 2E1PA 4JUZA 2W2OP 3FRYA 3M8YA 1ZTTA 1S7IA 2Z8QA 5K20B 3I9V9 5IWAF 2CWKA 2WOMB 3J7AN 4CP5A 2WOMA 1GFWB 1S5ZA 2XMTA 1RT2B 5KFFA 3NEKA 5HLFB 1SBRA 3MM5A 4DV6F 1FRLA 4ZPWR 1FXLA 2NSCA 2IJNA 2M9KA 2E5GA 2DGXA 2UUAF 1RTIA 2FY8A 1N33F 2ZOFA 3OTCA 2HHSA 1R8HA 1TMJA 3M6XA 1CJKB 4FN5A 4IH6A 4RUAA 1NDLA 4J9KA 3GPAA 2OPQB 4DPOA 3RB0A 1RT7A 1SL2A 5KT3A 3DLHA 2FHOB 4KIAA 2LMIA 2Z2YB 1HWLA 4HI1A 3QT8A 4DR3F 1OPIA 1RADB 3UN2A 1RHQB 3BB5A 4KBIA 1TL7A 4RW7B 5AE3A 3DYAB 1L3TA 3UVJA 2IHR1 2MY7A 4DCPB 1WD6A 3L7PA 4IOAQ 2VPZB 3PXGa 5GAGI 1RTHA 3RW6A 5I3QA 4DUTA 1RWKB 4AQYJ 3H0PA 4I68A 1CULA 1PAEX 3WQPA 4C3KA 4RLEA 1EB0A 2N3LA 4A47A 2CPXA 2MKSA 4MKVA 4U7CA 3TZYA 2AGOA 2VOOA 3D0HE 3W2WB 2E1RA 1HHQA 2HVEA 3LOUA 4O0IA 1TKDA 1CJVA 4UOHA 3Q86A 2BJ9A 1IKXA 3BEGB 4OX6A 2YH0A 4LF9J 5I3UB 4O44A 3IS9B 2I0XA 5B0GA 3SSRA 3TA0A 3MECA 2R2UA 1B70B 5J2MB 3IO1A 4MK7A 2ZD1A 4PG4A 3JQKA 4UOCA 3CIMA 4QU6A 1N88A 2CG8A 2V8PA 3DOKA 4YB5A 4O3PA 1FKOA 1HNIA 2XMVA 4ZJQA 2QSWA 3VZHA 4Z7YA 3CMAS 2IBKA 1S1UB 4A8KA 3OVBA 2B0GA 4KH1B 1SXLA 3QSYB 4C8YA 1R7IA 2BV3A 3QGGA 3SBMA 5F3TA 4E2FB 1FJGJ 1MSWD 3QNWB 2X1GA 3PDNA 1Y11A 2YNHB 1HI0P 2PI5A 1HLWA 1LWEA 1XNQJ 3W66A 3A1YG 4F0HA 1FEEA 1VMBA 2NSBA 2LEPA 4IO1A 1H38A 4YY3F 2UVUA 2R4FA 3MWBA 1JLBA 3KDOA 3QGPA 3CD6S 4NCGA 1VISA 2YQ0A 4ZN3A 1A6LA 4OZ0A 4ZJLA 1M5SA 4EO8A 4V1Ak 5D78A 4AUKA 3IRWP 1X0FA 1RYRA 4L72B 2Q79A 3EGVA 5D15A 3ZZPA 5J2QB 1YSJA 4KPYA 1AFJA 2MLZA 5HK4A 2V63A 1RAEB 1VFJA 4B9NA 1YJ7A 4AL6A 4JP8A 4QIGA 2FVQA 4RBTA 2YWEA 1REGX 3T5LA 4NMXA 1VQ8S 3MEKA 1RAGB 2QIFA 5LXRA 3P6YC 1FJ7A 2BABA 4U8YA 4J9UE 4F25A 1XNQF 1N5QA 2Z30B 3R7NB 5J2PB 1D9FA 1IJEB 2V68A 2ZZMA 3PYGA 3FRZA 4FNHA 5HBMA 2CQ0A 4MYUA 3KYLA 3BO3A 4J9SA 3H5YA 2BE7D 4DL4A 1GX6A 3PW7A 2C2ZB 2YNIA 2WVBA 3KLIA 1NB7A 1O51A 2ATLA 4I69A 1V5VA 3LF0A 2ZJQQ 1ROFA 3C6TA 3DCAA 3R6GB 4GKKF 4NWBA 2YKMB 3V6DA 5FJ4A 4OI3A 2F5GA 4KAIA 5D6GA 1YJNS 4YOEA 3N9UC 2XYHB 1R27B 4ED1A 2GVDA 2CPEA 3Q83A 4KTQA 2IM0A 3W8GA 4DF8A 4YY3J 3OVSA 3QRQA 5ETLA 1T11A 1JKHB 2FPHX 1AYEA 1UWBB 2CVIA 2MKIA 4AXIA 3CGIA 3G6VA 4CH1A 4ECVA 2C3YA 3IC1A 3KJFB 3NBPA 1APSA 3NBPB 4DQRA 1IM6A 4JI5J 1R8CA 3QLHA 1QAIA 2XS7A 2E5LJ 1PG5B 3KDNA 1HWIA 2IC3B 4RU2A 2V34A 5E3QA 1UETA 5HQ8A 3OLBA 3PR5B 2ZH3A 2LQ8A 3H5XA 1N5VA 2BJ8A 3T9ZA 4ECQA 1JNZB 4ED8A 5CA5A 2BRKA 3VCDA 2XZWA 1M0SA 4PG5A 3KWMA 2E1AA 4IRCA 4DV1F 3G86A 1UCNA 4N8NA 1RACB 2PFDA 1T9VA 4YR0A 1XIQA 1X8DA 2GJFA 4GO5X 4PXBA 4TU8A 4M94A 2VDIA 2MYFA 3E51A 3N28A 1N56A 5G0RB 4LF4J 4ILMA 1F5AA 2C2KB 2OAUA 2UUBJ 5KG1A 4WYWA 2I8EA 2MZ1A 4UQGA 2G9OA 2HQCA 3D6MB 3S1TA 1SC4B 3PW0A 4MYTA 1JQGA 2XZTB 3CDUA 3WX4A 1TAUA 1U49A 3FMBA 4UT4A 4FZVA 3MCSA 5GAEU 5U47A 4U6PA 5C25A 1TKZA 2ZUAA 3BPSP 5AJ3J 4LBIA 2QA4G 4ZP6A 5E5NA 2QJ3A 2MZTA 1VQ6S 1NJZA 4YQWA 2VFSA 3OXGA 3LGNA 3LGHA 3NRBA 1YQHA 4I0WA 4CLSA 5GAHI 3BS9A 5IXUA 5CXTA 2LCWA 4USMA 1KLMB 2NREA 4ALZA 3KNAA 1XR6A 4C9DA 2RS2A 3HO1A 2UU9F 1WF0A 2RRBA 3HP6A 4LSNB 3ZZOA 1G6BA 5KFLA 4N7TA 1N6QA 2B56A 3ZC4A 4CO5A 2DNNA 4ZLJA 3SDEB 2ZVIA 5LXYA 2UUTA 3PG9A 3VTIA 4X65J 1SB6A 5DLFA 4K5SA 3FKBA 1FKPA 3EXCX 5EWGA 2AJ4A 2H1YA 4RW4B 2MQOA 2MSTA 2P2CB 1KFSA 3PYEA 7FD1A 2AYMA 1KS2A 2E5JA 3FGVA 3MMAA 1GXTA 4DLGA 2ZBRA 5HROA 3CJQA 3B6BA 1DBDA 3VHQA 2IDEA 2EC0A 4M5GA 8ATCB 4PWUA 2WRMA 5KFAA 5LSRA 1U24A 1V3RA 4LF7J 1X60A 3U1LA 2GJIA 2DXEA 5KG2A 2LEBA 1QAXA 3W2VA 3K0JA 2M70A 3NGTA 2DY1A 2OPQA 2MY8A 2RILA 3D7SB 1FI4A 2UXBF 3SZ2A 1HBNB 2CFXA 3GCWP 3RRGA 4L6V3 4L76A 4S0MA 4PQUA 3KK1B 3W62A 2CADA 2KTQA 3TA2A 2GW8A 3KJQB 3T6BA 5SZTA 1HPZA 1N0VC 3N5BA 3TO8A 3LTOA 3U02A 5L9NA 3E01B 3VAHA 1R8PA 2V6AA 3L95X 5LMUF 2LDYA 4G1IA 3TRGA 1O8BA 5K5MA 2N4DA 1UL3A 2W4CA 3FNNA 4Z2XA 2WK4A 3V81B 3LPEA 4ZLLA 3CJ8A 1YK9A 1FTCA 1TV6B 3GP9A 3RG6A 2W7OA 2ZH5A 1T3NA 2R8JA 3I4PA 3UDCA 1TMMA 4ECYA 2R9LA 1DTTB 2XS5A 2YH1A 1ZYQA 2GZOA 2CQPA 2D7SA 4I7FA 5IWAJ 2Y1LB 2WW4A 4I2QB 3AAWB 2IRXA 3KK3B 1EP4B 2QGFB 3LO3A 2ZM6F 4BDPA 3IR6B 3MECB 4F02A 2XS2A 4ZPDA 2RDJA 1KVKA 2KXHA 4P2MA 1Q95G 2YKQA 1VRUB 1XBWA 1AB8A 4OZJA 4R25A 4N77A 3DOKB 1P9YA 4YDXA 2AYBA 1D1UA 2VC1A 2VFTA 4USKA 4CLZA 4F2SA 3M2UA 1JLQB 3OBIA 1HWJA 1LW0B 1PKUA 2DGTA 2XWXA 4DV2J 3PV8A 4OHWA 2WONB 3EDQB 4OYMA 2M0GB 2ZOGA 2YNHA 4R8UA 4DI6A 1NK7A 1IBKF 2DPJA 3M2VB 1FERA 2F63A 2WVFA 4MKAA 1NPRA 2W4PA 1AUDA 1LWCA 3GJRB 5EN1A 3CJ0A 2C42A 3Q8UA 4Y6IA 3LP0B 3MMJA 4ES2A 4QQBA 1MWYA 4WXOA 3JTOA 3WDOA 2QFIA 3DU5A 3M2RA 1GX5A 4I56A 4D3HA 2H5EA 3UI3A 4TQRA 2X7IA 4C0OC 3OTDA 2E5LF 2JL9A 3GFYA 3QATA 4DF4A 1H6KX 3HSGA 1KQKA 1VQMS 2E9ZA 3ILOA 3KUEA 4LF5J 1F9EB 2VG6B 1JLAA 1M1HA 1NU4A 1DQ8A 2N3OA 4ZLPA 1LK5A 1S99A 2BW7A 2RUGA 5AT1B 3R5DA 5BR8J 4RNNA 5KT4A 4OYOA 1GK8A 2IFXA 2JHEA 1CG2A 2EFNA 2MQLA 1JXEA 2PDAA 1S6QB 1I1GA 3X1LB 2Q6BA 4DQIA 4DR4J 1QD1A 1ZS6A 4JI2J 5F8LA 3ZTOA 1N5TA 3QJJA 1RWNB 3Q0AA 1HBMB 1HNWJ 4YEAA 1U0SA 3JSRA 3N6NA 4DR6J 4LR8A 1U1KA 2DH9A 4M5KA 4QPXA 2K7KA 4DV7F 4DL3A 4USHA 3OD2A 5CYMA 2VFVA 5CYMB 3NMRA 2ACYA 2HNZB 2EEYA 1PYOB 1X31C 3V6DB 2X3GA 1JLCA 1HBOA 2FJXA 3GU0A 3KUHA 5AJ3F 2HQDA 1DFDA 3IBWA 1NDKA 2KI2A 3AB2B 2B51A 3ISNC 3AHPA 3PHEA 4ZP9A 3QGHA 2D3O1 3PO5A 4MKYA 2LA6A 2YX7A 5ETQA 3EPGA 4FYVB 4UZCA 2XO7A 4DUZJ 2DPIA 1RKJA 1S72S 1FE4A 3CCVS 4EZ9A 1MMLA 4DR7J 2GQQA 5DG7A 2P9CA 4F4AA 3KG0A 4C3LA 5KOXA 1T05B 1T05A 1KR4A 4RKUC 3CIZA 1HD0A 3R27A 2GMJA 3GFHA 3GYNA 4X65F 3D0IE 4RUCA 2GAHC 2L08A 3UE2A 2HAFA 2YKAA 3PW2A 1SCJB 1AXQA 3BGFA 4EU0A 4X4NA 3D1QA 2HK3A 1FFSB 4OYZA 3JSMA 3PW5A 2ZKTA 2DNRA 2R2SA 2UVRA 4Q0BB 1T7PA 4NXNJ 1YX2A 4EO6A 2ACMA 2AJ1A 1NK6A 4BC9A 4KB7A 1D8YA 1HNVB 4B3RJ 2XGPA 1KRPA 4Y2CA 3CUNA 5KFZA 3ISND 4DSLA 1T3OA 2KM8C 1NK5A 3Q8YA 3R8YA 1R8BA 2DNQA 3MD1A 3LA0A 3AODA 3CJ3A 5THWA 4ZCIA 3VGTA 1WEXA 3LPYA 4CWBA 1M5HA 3J81j 3CCES 3DMJA 1XQIA 2KG1A 3DMJB 1M5OC 1NO8A 1VQ4S 3WZ0A 5HP1A 4CT9A 2VQFF 2W9BA 1ZM3A 2DH7A 1XC9A 3X3UA 3BREA 2M7SA 2GJ2A 1YJTA 1RAAB 3NAIA 2I2YA 3C16A 3C6UA 5KG4A 3TUZC 2UUCJ 1BE4A 1O0PA 4JV5F 1N54B 3JTPA 4LFCF 3I56S 2B9YA 3U7JA 1RE1B 3BJYA 1S1WB 2DGUA 3KLGA 2AX1A 1S1WA 2DHAA 4LIRA 3TNVA 5KFEA 3EZ5A 3JQMA 2BOAA 3T1AA 3DI6B 1VR6A 1S1VA 4HEA9 1QUVA 2ZM6J 2VJUA 1H7WA 5B08A 2C22A 2ADCA 1VQLS 1RT1B 2ZE2B 3D9BA 3HHLB 2RKIA 3VGSA 4N5SA 1L3KA 1TL3A 2ZBIA 3BN7A 1C0UA 2WBRA 1TL3B 3BSOA 3TARA 2UUBF 3NS6A 1CQMA 2M4MA 2AMCB 4Q43A 2RDDA 2X3DA 3W2VB 2X1BA 2Z4PA 4J91A 1NK8A 2G0IA 4WF9Q 2M52A 4USUA 4O23A 3VAKA 1WC3A 3MF5A 3SFUA 4K4WA 3CNQP 3MGJA 3RBEA 1VC0A 5IT0A 4JYAJ 4B9MA 2VASA 2EW9A 3J7ZT 3RTVA 3AJDA 4FBTA 2VQFJ 1EJ7L 2E44A 2KB2A 4JI1F 3CC4S 2AU0A 2HBRB 4K4UA 1BQNA 1RA6A 2NYIA 3GYGA 4DV0J 1IN0A 4NE9C 3D4JA 2GGPA 5C24A 1XNRJ 2ZH2A 2UUCF 4CQ1A 4DCJB 3DLBA 4IRKA 3NL0A 2UV8G 3QBCA 2FHKA 4E8UA 4TVAB 2O01C 2DGQA 3UR3C 2F8HA 1FNOA 5B09A 1Q4RA 4KO0A 4CLWA 1KEKA 4ELVA 1TK8A 1RTHB 1RWMB 2QLJB 2U1AA 1S79A 4K50A 4IR9A 4WXWA 1F3VA 1X9MA 2EK1A 4LIWA 4LSZB 1Y10A 3GIMA 4IUFA 2CJBA 3LWMA 4PG8A 2B8QA 4KYZA 4C48A 5LMNJ 5IT9U 1LXNA 2V8HA 1HBUB 4FKYA 3QFWA 1QE1A 3I55S 4PUOA 2C2EA 1U8SA 2XMWA 3D0GE 4HL9A 2VFRA 4J7CA 8AT1B 3UD3P 3J80U 4NLPA 5T41A 1UVKA 3G8TA 2M88A 3FCVA 4LT6A 4P7VA 5H9FJ 3NS5A 1RTIB 2HRUA 2YNGB 3H90A 1S48A 5DM6Q 4JI7F 4LF6F 1LW0A 5ETTA 1PYTA 5F0UA 5K14B 3IM9A 4MK9A 2WONA 3CCZA 5KFQA 5KFDA 3LUYA 1NDCA 1KDNA 2DIUA 2JC1A 4Q2MA 1CS4B 2DITA 5HVFA 5GAHU 4FF4A 5KAKA 2VBZA 4RNFA 4M5JA 3J81U 2RVJA 4OHZA 4B17A 4ZDNA 5DQGA 3OR2B 4DS5A 2PD1A 2MSSA 3HULA 3NAHA 3SCIE 3V6KA 2EFQA 2YWWA 2ZDOA 1HMVA 4WE1B 5I3PA 4WZMA 4XPEA 2NR0A 3BN4A 1XNRF 2MJNA 5F9LA 2PO4A 3RRHA 4DR7F 1C4CA 1VQYA 4ANDA 3DLKB 3M30B 1HNXF 2ZH8A 1YRXA 3PJWA 3CE8A 1F1BB 3J7A1 2RF2B 2Y8WA 1P27B 2HMIA 2NS1B 1HD1A 1FRHA 3N5FA 2BE2A 3IS9A 2FGCA 2IVMA 4MK8A 3PYFA 3LP1A 3ZZTA 3TJ9A 1Q82T 4KJIA 3QZ7A 1UA0A 2E7VA 3I31A 3FQLA 4O4GA 3WBZA 1B7FA 4M5LA 1IUJA 3SCJE 2PFFB 2YWHA 2HW3A 4Y2IA 1J2VA 1S1UA 5AXLA 2BJ1A 2KXNB 3RBDA 5RUBA 3F44A 3BV8A 4DV2F 2Z2LA 2JEFA 2OIHA 1VQSA 2VPWB 3GSIA 4KFBA 5ETOA 4ED3A 3OTEA 3VQTA 1PYSB 1ZAXA 2YVSA 5HBMB 5HSPA 4X4OA 2GAGC 1NM2A 5L9XA 4AT1B 3K5NA 1WC1A 1OY9A 1RLCL 1TVRB 3MTKA 3R7BB 3TUIC 3EYZA 3AD7C 3MMBA 1TL1A 3MMBB 2OPSA 2XCAA 3GILA 4WZQA 2MGZA 1R6VA 4KGXB 2PT0A 3R6LB 4N41A 4FF1A 2DRAA 3V2UC 1PBAA 3R3TA 1F5CA 2BJEA 1NK9A 1KTVA 3W8PA 4H54A 3M9OB 4PKDB 4LF5F 1HR0F 3EWGA 1S9GB 5D77A 4DX7A 4YMEA 2XHCA 4CLLA 4C7QA 4OIXA 2PGCA 2YKPA 3QLHB 1RK8A 2PC6A 3AB4B 1TKTB 5ITHA 1R6YA 1RT4A 4CRJA 5C42A 3GZ7A 2OP5A 8RUCA 5C42B 3QZ8A 1UVIA 1WWHA 4IG3A 4K4VA 1NHUA 2D1CA 1OYDA 4FPRA 3TAQA 3DM2A 4DR4F 1CPZA 1MWQA 2WW8A 1RT5B 5M2RA 1RT5A 1WSRA 1WC0A 1XJWB 4FYYB 4ICLA 4DFPA 1FDAA 3MD3A 3WHIA 2J8AA 1LFWA 1N5SA 1FCAA 2JH3A 5L39A 1YI2S 4PWDB 2QLFB 3MCMA 1HQEB 2RIJA 5DDQC 1SQEA 4ES1A 5ADZA 4F4YA 1G7CB 3LH2S 4WJBA 2BDPA 2FLOA 4OI2A 3UNGC 3SV3A 3M6UA 4DU7A 3L09A 4WFYA 3W5ZA 4AE5A 1U25A 2VG5A 2YPYA 4OJHA 4H4OA 1U26A 3T9NA 3TOQA 5HQLA 3VZIA 5DGBA 4F4WA 2V2KA 2GHPA 3NWGA 2R8HA 1FRMA 3MPUB 3OXLA 2W9BB 1V9OA 1X4GA 3D68A 3DNCA 3B82A 3CO9A 4NLYA 4NRUA 4DMZA 2APOA 5G4DA 3NCQA 4CH7A 4QWCA 5C25B 4NX9A 3PIOQ 1V3ZA 3IM8A 4ZLNA 2AQ4A 1IVZA 1ZZFA 4J90A 3Q23A 4IKAA 4DL7A 3FBCA 3IAM9 2E5HA 3PEHA 4LFAF 3N4WA 1EETB 3MR2A 4V19X 3S01A 2OEJA 4NA1A 4OI6A 1HHTP 1WHXA 1VIOA 3OR1A 1S57A 4XAKA 4X62J 4LSNA 1SUQB 5IT4A 1S97A 5A8KA 1YJUA
chains in the Genus database with same CATH topology
1UW4A 1D8ZA 2OPPA 1QUPA 1IQZA 2CDQA 4CO1A 1K73T 2DNKA 5KFHA 2QA2A 1ZM4A 4KR0B 3LWLA 2K1RA 2AWZA 1REVB 1HL6A 2CKWA 1REVA 2OMLA 2QMWA 2G1DA 1WF1A 2JZ5A 5CCLA 3PZPA 2JEJA 1M5KC 3OW2R 3KLHA 1RI7A 4OX9F 2FJVA 1RWUA 4HTIA 1YRTA 4NZ0A 3AY0A 3T5HA 4HT5A 1Q8IA 2B43A 4CNYA 2K2PA 2ASJA 1Q53A 1SIZA 2IRYA 2GCFA 3G96A 1RT7B 3THTA 4EZ6A 1L3VA 5KT5A 4QYZJ 1NKBA 3VAMA 5CH7B 2DH8A 3AQPA 3K5LA 3R1HA 3J7YU 1C1BA 2VH7A 3BGUA 2E7WA 2POKA 4NLWA 2HLTA 4HLBA 3T1YF 1VK3A 2VFUA 5A2QY 3CCSS 3V4IB 4NMLA 1DTTA 4KHPF 1BY9A 2CZ4A 5KT6A 3DRSB 2RU9A 1D3WA 2GV1A 4CO4A 1P1LA 3K5PA 5HI7A 1U6ZA 2BA9A 4HH1A 4B3TF 3J7YI 3KOAA 5FDLA 5KT2A 4MH8A 1FKOB 2MQNA 3RU0A 4O3NA 2QA1A 5A6WA 5A8WA 1R3NA 4DLEA 2RRAA 1FT8A 4DV0F 1X9SA 3BGLA 4IQMA 5KFSA 1LFPA 1Q79A 3NP5A 4PG7A 3V81A 3B4DA 3I5AA 4M5DB 3GIIA 5IZHA 4K4ZA 2M3DA 1N48A 3HMJG 4FXWA 3N79A 1IKYB 1T94A 1UMJA 1WHYA 1S6OA 1ZAVA 4ZCMA 1ELOA 4B9UA 5T7LB 3MEEA 1GTHA 4K5RA 5C5JA 3HLUA 3MEEB 3KJVB 2KDOA 4JI0F 5GADI 5IM0B 3KHLA 3VAFA 1QM9A 1S7HA 4QIEA 2JX2A 1R43A 2FLPA 2XMUA 4KQZA 4NPOA 4GC6A 3RAXA 1I6JA 3FFIB 1WHWA 1P6TA 4JI3F 3M4XA 4XPCA 2CQGA 2GHWA 2HGNA 4NL5A 2PMHA 2ZDPA 3BQ1A 4HT7A 1HBMA 2R2TA 3THPA 1RTJA 1YBAA 2PN6A 5F8MA 3HFKA 3RB4A 1SKWA 1E6YA 5BYQA 1Q78A 2B4OA 2N82B 1VQOS 2NLWA 4USIA 1BC6A 2EG2A 5E2QA 3MUMP 2JVOA 1VK8A 4PXCA 4YB7A 4FS1A 1LW2B 3OXFA 3OSPA 2F1FA 1S9FA 3BDPA 3BO4A 1H3DA 3VF0B 2BRLA 2G0CA 2IA6A 1VBZA 4U67Q 1JLAB 1DAXA 2HFOA 4Y2AA 4NYZA 2KJWA 4TU9A 5DJBA 3SI8A 1X4EA 1FK9B 1T02A 3CDWA 4IFYB 1IQTA 1FK9A 1HQUB 2PIIA 1SJFA 2V5HG 5KFUA 2PA3A 3R1LA 3HK2A 1WG5A 2CIMA 3QGIA 3QPIA 3CSKA 2QYCA 3HJFA 3LALA 4ATNA 1AFIA 2PSZA 4LF9F 2QMXA 2HWIA 4O3QA 1FHTA 2EK6A 3K8VA 4EGLA 4RUHA 3I96A 4HH0A 2R7WA 2GIQA 2I9SA 1RGVA 4HYKA 4F3OA 1JLFA 4DN9A 2R7QA 5MLCV 4B08A 4XIUA 3NGDA 1UJ5A 1DARA 2B4VA 1MU2A 2KHCA 1SI9A 3DLEA 1SJQA 2VBYA 2LQ9A 2B9WA 5IFMA 4O3SA 2YX1A 2VC0A 3HZEA 4X4QA 4ECRA 2PE8A 3CJKB 2DO4A 3GR0A 3N6LA 4OL8A 2YWFA 2MQPA 1JNRB 4WK1A 3C6UB 3I87A 4CO3A 4OFZA 2VODA 5F8IA 1SH2A 2ZHBA 4LUBA 5KFVA 2BQ3A 3MHYA 4FXVA 4A8XA 1U1QA 3BR9A 4CO2A 1X5SA 1VGYA 2WHOA 3LGMA 3K57A 3KMSA 5JJBA 3HM9A 1MMDA 2RQCA 4OI4A 2DO0A 3EPIA 2HWHA 1DQ9A 1OIAA 3GB0A 4F67A 5CYJA 1YTYA 5HMWA 1SJ3P 1SJ4P 3PFOA 3HHLA 4WCEQ 3PIPQ 5J2NA 3MPYA 3M8PA 4DFKA 3HHNB 2OD4A 3M8PB 4OLPA 4EBDA 1NJXA 4LF8F 3QAUA 4HDHA 3IGVA 1UA1A 3PNIA 4QWEA 2VKRA 5KFCA 4IFVA 3CULA 2J5AA 3CXCR 5J1PA 1WHVA 2XLKA 2DD8S 2UUWA 4OV1A 3RAQA 1FD2A 1NZAA 2PA8D 1YHQS 3SDEA 2J9CA 4AL7A 2CPYA 5A8RB 1FO1A 2E29A 3DOLB 1S0MA 4CTAA 5KTQA 3DOLA 4QOTA 5HO4A 2JSXA 1TV6A 1LQ9A 3MMAB 3QJLA 3QAEA 3C8YA 2W8LA 2J0WA 2RH3A 3ICLA 2IJFA 4KV8A 3FSXA 1IKWB 2V4RA 1YJWS 1XR7A 4AL5A 2EPIA 4A8WA 2B4UA 2CQ3A 1EP4A 2XI3A 2WSEC 1S0OA 2KZZA 3LANA 2NQPA 3TVZA 5AE1A 1BQMA 1F5BA 2E66A 2F4VF 4BBYA 1YJUA 1PSDA 3EUNA 1YWXA 1AROP 5B0FA 2L48A 2RSQA 2KZMA 1IXKA 1WACA 4B3SF 1WTFA 2A2DA 1KSPA 4E0DA 2DHSA 3CF5Q 2J0QD 2CJQA 3GIJA 2IM2A 2GA7A 4ZCKA 3MAQA 1MWZA 4YP3A 2DNOA 2HNDA 1HHSA 3KHHA 4DDFA 4NLTA 3CD7A 4ZVEA 2HHQA 1OS5A 3TQ1A 2Q1LA 2PI4A 2XMMA 3OPKA 3IWNC 1IKYA 2KJVA 2R7RA 3F56A 4I2QA 2ROGA 3UW1A 4CZCA 2VL1A 1U6BA 2UXDF 3O1LA 4C11B 3JAMY 3G71S 4DHVA 3DOMA 3UPFA 1SKRA 3EGZA 1FXDA 1RAJA 2V9KA 3O6QA 3BGRA 4QR0A 1HNZF 5KFYA 3OL8A 1ZPWX 2FGOA 2OD6A 3ZZRA 2B7BB 3CTRA 4YR3A 3FVYA 4R8UB 1ZM2A 2MKCA 2GQCA 4M8LA 3T1HF 2QEXS 3M2VA 4B3OB 5EDWA 2X51A 1RTJB 1L3SA 1BD6A 3SMZA 2WBMA 2UV8A 4Y3CA 3FEZA 2VOPA 2HNZA 2DB1A 3CCUS 3JSYA 2NZ4A 1WEYA 1UFWA 2W8KA 3B4MA 1LW2A 1G1XA 3CEDA 3H2UB 3N01A 2PMZD 2AX0A 1OO0B 2RNEA 3UCZP 3C46A 4DG1A 4W90B 2BVZA 1VC6A 4ELUA 5E7OB 1GQEA 4X4RA 3Q8PB 1YJRA 3ULHA 2V0NA 2JLFA 2V94A 2D9PA 2B6AA 1SL1A 1CVJA 2B6AB 2OJ3A 5JUMA 1KONA 2W9CB 2ZITA 4V19J 1X5PA 3MM6B 1TKTA 3P3DA 5KFGA 2A10A 4NA2A 1FE0A 1WTBA 4DX8H 3M6VA 1VLYA 3AA8A 4UW2A 5J2PA 5BYSA 2VPYB 2ZH1A 5EX0A 4NLQA 4ZPBA 2V4QA 1G3OA 2YKNB 1SL0A 3SCKE 4QYRA 4G1QB 4QU7A 1NKEA 3IRXB 4G1QA 3IXQA 2JJ4D 4NLUA 5EX3A 1A9NB 5B0CA 4QR1A 1FDDA 2BACA 2YKMA 2FJAB 4ZS6A 2EVZA 4H4OB 2OPRB 2EFVA 5CYQB 3ENVA 4WIIA 2RQ4A 5CYQA 2EBGA 1J5OA 1JKHA 1J5OB 4OZLA 3CJ5A 4ZHRA 4ZHRB 3Q8QB 1HWUA 2QLWA 2Y0SD 2IC3A 2HFZA 2J7WA 4N8OA 3QJPA 2C28A 3MXHP 1FA0A 1N52B 1UJ4A 4DV4F 2BM0A 5B0BA 2R2RA 3OR1B 4M1KA 3UFCX 4ZMMA 3TVYA 4ECTA 2XSJA 2BANA 1I94F 1QJHA 5FLXY 5A8KB 1HQEA 2AV5A 3GQCA 1UFLA 2JOQA 1TR0A 2NUUG 2RD5C 2DR7A 2YNFB 1S10A 5AXMA 4H4MB 4LSLA 2YNFA 4G6VB 3RR8A 5IS2A 4IOCQ 2MHNA 4DUYF 1VQ9S 2DNGA 5HP1B 2XY5A 3MEDB 2E9RX 3H4BA 2DNYA 1Y5IB 2LEAA 1E6VA 2ZH4A 2J0SD 1ZH5A 2IBOA 3FMWA 3TANA 2J7UA 3CDAA 3TVKA 1U45A 1NJWA 3KHGA 2E1MC 4J9QA 3K2YA 2EI5A 2VONA 5B0EA 4PRFA 2GGPB 5C24B 2ROPA 1RT3B 1BQXA 4Y65A 2XULA 4YFUA 2B5JB 4ILRA 1S1VB 4KHRA 4K4XA 4G1PA 1C1BB 2NUHA 4LJMA 4ZCLA 2BYCA 2IM3A 5KG7A 3EX7B 1FKPB 4DQPA 5F0WA 3D54A 3FEXB 4MIBA 2ILYA 1U48A 2FVSA 1C0UB 3S6EA 2XY6A 2R7SA 2DGVA 4ED5A 3I0RB 4E98A 1M1KT 2UXCF 3MURP 4LF4F 1N4LA 1JK9B 4P7TA 3ZFVA 2K8GA 4ZOSA 5EWEA 2RS8A 1BGXT 2VBWA 2L9DA 1N5YA 2E1CA 4A8FA 3ZZYA 3ITHA 1FJGF 2UVVA 3RZAA 1LOUA 2VA2A 3HVTA 2GFFA 1SH0A 4ELTA 4DQQA 1S4FA 4TN2A 1KQFB 1TFYA 1TUVA 2DCUB 3DYAA 2ZH9A 4C0BA 3OR2A 3PX0A 1S6UA 3GMGA 3HDSA 5LT5A 2L41A 1FKAF 2JLEA 1D9DA 4AXJA 1U2RA 5FD1A 4ETXA 1TK0A 2N7YA 3PW4A 1QVFR 2CQIA 5DS7A 1FJEB 4F2RA 1WG1A 2SXLA 2WCXA 1S77D 3W2WA 3IA0A 1MROB 1UVMA 1R0AB 1TAQA 5KFBA 3CMES 4URSA 1RDRA 7FDRA 4O44B 1XERA 2M8DB 2XLIA 2WB4A 3L3CA 4EWTA 4RNMA 3JB9k 3J80Y 3H2VE 1K1SA 1VRUA 2V8GA 4K59A 4OMFG 2J9DA 3Q8RB 2DHXA 2Z0GA 2OKQA 4WFAQ 3DHXA 3P96A 4KFBB 2CQ4A 2IAJB 2DNPA 3CVKA 3TA1A 3UCUP 4OI0A 3SEOA 2ZFHA 1HMVB 4WE1A 3MPWA 1X5TA 5IQQA 3OVAA 1Q86T 4YDDB 1JLBB 3BM7A 1H7XA 3I0SB 2IRUA 3VAIA 3I0SA 2A2CA 4QBUA 4X64F 3OTOF 3AJ2A 3DRXA 3PJXA 1JJHA 2Q6CA 2DNHA 4F4ZA 1NH8A 4X4PA 2AF6A 1JJ2R 2D3ZA 2YWGA 4OX7A 2BE2B 1TQLA 2ZNYA 4OHVA 3CC7S 1OWXA 2XNQA 3Q8SB 3PO4A 3FSYA 4O4GB 3GV7B 2ADBA 3O44A 1V3SA 3POTA 4RNHA 5KFXA 3MM6A 1WF2A 5LMNF 1P1TA 1XMBA 5F8JA 4KKOB 1NRKA 5E3PA 1R89A 3H2LA 1H0HB 2QA4S 2V9WA 2VA3A 3DHWC 4M95A 3I9ZA 2R7VA 1DURA 5D4OA 1HA1A 3OHAA 5E3RA 3W7BA 3H8YA 2WSFC 4J9RA 1H2VZ 4RW6B 1E6YB 1UAWA 1HW9A 3M8SA 1HBOB 1VOMA 3CCQS 5D4LA 5DQHA 2AYGA 3UD4P 1GH8A 2HHHF 2AP6A 4OHYA 1U2FA 4CO0A 1JB0C 2CYYA 1UWBA 2GMLA 2MB0B 4ERDA 4WK3A 3IN5A 3MUTP 2ZH6A 2XSFA 3H5SA 4ZPAA 3DLGA 3O8WA 4JV1A 2HS4A 2KFNA 1Q81T 3MOZA 2HGMA 4IFYA 2FHJD 1WNEA 5GMKa 3A8EA 3NMAA 4IDKA 3M1VA 4IDKB 3VWSA 3M1VB 2BBEA 3ENQA 4QWDA 2G4BA 1OSDA 5BR8F 4Q8EA 5HMZA 3JSMB 2XGQA 3HXMA 3QO9A 3M9NB 4I6WA 3QO9B 3BQ0A 5K8PA 4J9LA 2MZRA 5DG9A 2VV5A 1S1XA 4TKTA 1S1XB 4ZVGA 2EWHA 2B3TB 3FSIA 4N76A 1SV5A 5KFNA 3VR1A 1F60B 2IVFB 2KG0A 3K5MA 3KK2B 3DLEB 3M8RA 4YHHF 5D3GA 1KQGB 4XK8C 4YR2A 5D3GB 3LP2B 4A8OA 4ZKAA 1TZ0A 4A8QA 4X84A 1LXJA 1YJ9S 1ZM9A 1HYSB 4K4SA 1C2PA 3HVRA 1KLMA 5F8HA 2GIRA 2NXUA 2WAQD 3IWXA 5M2PA 3F73A 1NJIT 1N6QB 5AXKA 1DZ5A 3HVWA 4YB6A 1X4CA 2VPXB 3LAMA 4XO0A 3M9MB 4NLDA 3MUVP 2DNMA 4QWAA 2C3PA 3R5BA 1VQKS 3CCMS 3T6JA 5SUHA 2RB7A 1PO6A 2O66A 3SSSA 3I0RA 2P9EA 4Y34A 3OL6A 2ZE2A 4F4KA 2ASYA 4R5PA 4B3RF 2RJZA 4DN0A 2GMHA 2HVZA 1DJ0A 2JDJA 5KFJA 3PFEA 1BQMB 2DRBA 2IYGA 1R8AA 3UQSA 4DR2F 3D1OA 3HVTB 4PQUB 2LQBA 2P9GA 2J7KA 4C3MA 3G6XA 2MDAA 3KK1A 1HPZB 1QAYA 2Y1RI 1PC4A 4IG0A 4DL2A 3E01A 4KRWA 2EFPA 1JXLA 2RQMA 2DT9A 2WSCC 3BF4A 4Q8FA 4WU2A 3I32A 3OQ2A 2R8KA 3ZZUA 1WI6A 4J9MA 3WC2A 4HTJA 4RW9B 1U1PA 1CEZA 4TYAA 1KTQA 1R0AA 1L3UA 4PXEA 4B9SA 2KFZA 3VAJA 3BO2A 2W4DA 4PG6A 1XEZA 2CG4A 3KK3A 1JX4A 4RW8B 2N7CA 4USJC 4B9LA 2HZCA 2MHEA 2XHWA 3MM7A 4JI2F 3Q24A 5FIIA 3US5A 3B8HA 1C0TA 5EUHA 1U4BA 3PACA 1UVLA 1JLQA 3GE9A 4ZPTR 3NGKA 2D3UA 3CCWA 5K14A 1VJWA 1XMOF 2DVIA 4B3MF 2ZZNA 2VBXA 3M8QB 4B02A 1IJFB 2HS0A 4A8MP 3HZGA 1LWFB 4ZVFA 3K59A 4J9OA 1TK5A 1Q16B 4JYAF 1RT6B 4LVNP 2P6SA 2VG7B 5DGAA 3TI0A 2FY1A 4KGMA 2IVYA 2RE1A 2ZC3A 4MIAA 2HHUA 2W24A 3EGNA 3E8OA 5DO2A 2R7XA 1M5PC 2R7OA 5KFWA 4K4YA 1KHVA 1XR5A 1J5EF 2FHMA 1VS3A 5EGYA 1WI8A 5KFRA 4ECXA 4X4UA 1QAJA 5CCMA 1S49A 2HMIB 2QZ8A 1H98A 3K8WA 1S6QA 5H1SV 4DSIA 5D8HB 3MMCB