5ETLA

E. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
155
Chain Sequence
b'SAMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 43
structure length 155
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etlA00
4M5KA 2QX0A 3HSZA 3HSGA 3ILIA 5ETVA 3HSJA 5ETKA 5ETQA 1TMJA 4M5MA 1HQ2A 3HT0A 4M5JA 1RAOA 3UD5A 5ETTA 5ETOA 3ILOA 3HSDA 4CYUB 3HD1A 3MCMA 2BMBA 1KBRA 4CYUA 1RU1A 3KUHA 3HCXA 4M5IA 1RTZA 5ETNA 4CWBA 4M5NA 1Q0NA 3MCOA 3ILJA 4M5HA 1RU2A 1EQ0A 1EX8A 2F65A 3KUEA 5ETLA 3KUGA 5ETMA 1CBKA 1G4CA 5ETRA 4M5LA 2F63A 3UDEA 4PZVA 1RB0A 4AD6A 3HD2A 1EQMA 5ETSA 3ILLA 1F9HA 1HKAA 1DY3A 3MCNA 3QBCA 2CG8A 4M5GA 5ETPA 4F7VA 3UDVA 1TMMA 3IP0A 4CRJA 1IM6A
chains in the Genus database with same CATH superfamily
4DV6F 2VH7A 4UQTA 4OV1A 4DR5J 5C42B 3V81B 1WHVA 1TKXA 3W61A 4XDCA 2JZ5A 1LW2A 3RRHA 1VJWA 1HWIA 1RBLA 1Y9OA 4ZIWA 4NLUA 5KG7A 4M8LA 3FC9A 2N82B 2HFZA 5HJXA 1BQNB 3I4PA 3QYYA 2RS2A 2XM3A 4ZCKA 3KLGB 3DN9A 4E2FB 1MG7A 1TKTA 1RA6A 4W92B 3ENAA 2UXDJ 3DGPB 3SCIE 3ZC4A 3D2WA 3U27A 3CC7S 2KXHA 1DRZA 2CNLB 5H9FK 2H51B 2B9EA 3CUNA 1R8HA 1D3WA 2FD2A 2JEGA 1LWCB 3P49B 2R2UA 4WFNQ 3F0NA 2MGZB 3OHBA 2VQFJ 4AL7A 4NLQA 3D28A 4JI6F 2D69A 3V6KA 5CZVA 4IOCQ 1KHVA 1UEUA 1X9MA 2J8SA 3TZYA 5GMKa 1LXNA 1PCAA 5DLFA 5D3GA 1AUDA 3BYRA 1J2VA 3SCKE 4QIEA 2GX8A 3TVYA 5L1LA 4PXDA 1W2BR 2GFFA 5LJ3Y 4OX6A 1C1CB 4TNOA 5HROB 1KKHA 3R5CA 1NK4A 3PACA 1CSJA 1Q95G 1HWKA 4X65J 1Q8KA 3C16A 1K1SA 1N6QA 4WWSA 1CEZA 3UQSA 3LH2S 1IJFB 1F5AA 3CJQA 3OFGA 2YH1A 2H9ZA 2FPHX 1GEHA 1UKUA 1T7PA 3ILLA 2IMWP 4DL5A 2ASYA 1MMNA 2NXUA 1TL7B 3Q8QB 1RTIA 1FI4A 4B3RJ 2KH9A 5T7LB 3UD5A 1D9AA 3VALA 1YJUA 2XY6A 3CCRS 5CYMB 3OTDA 2RQMA 5KFXA 1RT3A 4F26A 4DSJA 1HBNB 3EDRB 4M5MA 1Q7LB 2GCFA 1C1BB 3IBWA 3FFIB 3MCMA 2CYYA 1UAWA 1GAOA 2HFUA 3M1VA 2QMWA 4O44B 1EHWA 2XTJP 5IOLA 2O1PA 2D9OA 3LAMA 4LF8J 4CO2A 2ZNYA 2D9PA 1JLQB 2VV5A 3CEDA 2HRYA 4B9VA 1RWWB 3I96A 4DL2A 3W65A 2FHOB 2LP4A 2MZQA 2J7WA 4RBUA 2OP5A 2AKWB 1AYEA 3MEGB 2KYZA 3RAQA 4DPWA 4NRUA 3DM2B 5GAEU 4U96A 3MF5A 2ERRA 2YX1A 1LKZA 2RE1A 1HBUA 3LGHA 3FGVA 3P96A 4QIGA 3LUYA 2OIHA 4DV2J 2R8IA 1Q79A 1UMJA 4U67Q 3CE8A 4DR5F 2FVPA 4DSFA 1Y5IB 4KFBB 4O4RA 1CS4A 2ILYA 3C19A 1H38A 4K8RA 4ETXA 4IOAQ 1NSPA 3EDQB 3HHNB 4J9SA 2JNJA 1CJKA 2ZBRA 3PW2A 4QYZK 4PABA 4DFKA 5KG1A 4WU2A 5I42A 3M30A 1M1GA 4G1QB 3H7HB 2AHOB 3OW2R 2ZE2B 3M9MB 4TLRA 2OD6A 1XR6A 4DX6A 3LP0B 4X4TA 4LQ3A 1TL1A 5ADZA 3ZTOA 2XBPA 2UXDF 5KFZA 1TFYA 4O0IA 3J7ZT 4DX7A 5KAKA 1EP4A 2XSJA 1EETA 2KFYA 4JOUA 2W9AA 3R6LB 1H73A 1GMWA 4MIAA 1FJ7A 4NZ0A 2BKOA 5LXRA 3OT9A 5B0FA 4Y0FA 1SIZA 2OPPA 2VQFF 4R5PA 2RVJA 2DRBA 4M95A 4OX9J 3GR1A 3IRXB 2MQQA 1ZPWX 2ZEJA 4WXOA 4ER8A 4BLGA 3W2VA 3GIMA 2BMBA 1TL5A 5HMZA 3RB0A 1SC1B 2DBBA 2GJ2A 3GQCA 3KHLA 2D41A 3TJ8A 1FNXH 1J27A 5KFOA 3SI8A 3SQGB 1NNDA 3OL8A 3FRYA 4X65F 2V8HA 4KO0B 2DGVA 2V8PA 2BBEA 3BKFA 4X62J 3IG1A 2Y9HA 5KFFA 2CJYB 1UVLA 3O1LA 4ZVTB 1VBKA 2P9EA 5DGAA 3CULA 3NGUA 4WJBA 1Y00A 4B3RF 5K8NA 1S48A 4PPZA 4DOZA 3VAKA 3HHLA 3HM9A 4EBEA 2HNZA 3ZFVA 2UXCJ 1B4SA 4AD6A 1T9XA 2CFXA 3TA2A 1S1XA 1Q7YT 2MDAA 4QW8A 3HZGA 1HMVB 1Z2LA 3K7RA 1TK8A 4LSNB 1RAEB 1K73T 1OS5A 4LF8F 5E2QA 1VK3A 4LMZA 4XPEA 1GT8A 5DRKA 4S0MA 3AJDA 3CSKA 4KKOB 2VHGA 3Q22A 3BM7A 5EWFA 2DNKA 1HQUB 1O8BA 1X5PA 2DHXA 4LR9A 5GMDA 3DHXA 3POTB 5T41A 4OZ5A 3UPFA 3VAFA 2Z58B 4DV0J 3MWBA 1HNZJ 2KB2A 3PX6A 3W7BA 2R8JA 4U7UD 2BA9A 2KL8A 4KR0B 3OD2A 1NJXA 1DLOB 3OXFA 2HWTA 3WDOA 2WONB 1RSCA 2XSFA 3V6HA 2V69A 3LWLA 5IC6B 1FHTA 5D4PA 2MLZA 3R97A 3Q2TC 3JQJA 1F9FA 1VDHA 4ZLPA 3SV4A 1X7VA 4F2SA 1JJCB 1G3OA 1N5YB 2U1AA 3HJFA 3OJSA 2H3EB 2ZWPA 2EW9A 2CDQA 1RXOB 1HR0J 1QE1B 2XLKA 4WIQA 3PV8A 2AX0A 5IS2A 2JFDA 2B8PA 1VJQA 3ISZA 3DHWC 1F3VA 1B0PA 5FDLA 5J2PB 4LF4J 1H2VZ 4TYAA 1C0UB 1N88A 4DV5J 4P72A 3NOGA 2PEBA 5EX0A 5F3TA 2W2QP 2KTQA 5H9EK 1YJTA 3DOMB 2X1BA 3WC0A 2LFVA 2CWKA 1LWFA 3M6XA 2P2CB 5A8WA 4PEOA 5E41A 1YI2S 1WJ9A 2P6SA 3PW0A 1M0SA 3CTRA 3NCPA 2BDPA 1S0VA 4DZ6A 3KK3B 3MM6B 1PAEX 2B5JB 3A3NB 4TLQA 3FSXA 1SBRA 5D0EA 3QJJA 2E5JA 4RUBA 3I9V9 2H48B 2Y1JA 1BQMB 2ZH7A 4RBTA 3JSYA 5KFHA 1ULRA 3K2YA 2YKNB 4FYDA 4H4KC 3MCOA 4X62F 1RT4A 5JMNA 1QY7A 3TVZA 2W2NP 2R7TA 3W63A 4LFAJ 1KVIA 2AF6A 2BE7D 3H5SA 1FKOB 5CCLA 3RBZA 1ZM4A 3K5LA 2VICA 1KVJA 3UNGC 2CZVC 1UJ4A 2YNIB 1NXIA 2R7SA 4V19J 4I7FA 3HPOA 1GQEA 2ZH9A 2LQBA 4F4WA 4MK8A 4WP8A 3MEKA 3HSGA 5DDRC 3WZ0A 4DU8A 2HNYA 1HHSA 2UXCF 1NDKA 3S6EA 1N32J 2VC0A 2J9DE 4CIOA 2W4DA 3CJ3A 3KJNB 4F7VA 3IS9B 2PT0A 1C2PA 1HIYA 4C8NA 1S9FA 2E1PA 1NHKL 2Q6CA 4W98A 1RTDA 1XR7A 1K0TA 1YRUA 1YGYA 2CUYA 3A1YG 1VQKS 4RW4B 1U7LA 5AE2A 4K4TA 5ITHA 4NLPA 4UOFA 5C7PA 5JJBA 2QZ8A 2CG4A 4DN0A 5DO2A 1S4FA 1SC6A 4DV0F 1TP7A 2ZH8A 1HNZF 3A8EA 2JH3A 3G4SS 1TL3B 3AOBA 3C6TA 4I2PA 2V34A 4QYZJ 3KHHA 4DUZJ 2N7YA 2RILA 1WHYA 4CM0A 3HK2A 1BQXA 4C0OC 2MKHA 4F8RA 2CRLA 1U0HA 3HP6A 3E51A 4LVNP 4CI0B 2ZD1A 2PIIA 2L3MA 5LT5A 2NYIA 2OEMA 3Q8VA 1C0TA 3TEHB 3R7NB 2M7SA 1NK7A 2GAGC 4JI8J 3MEEA 4QOTA 1JWWA 5HAOA 4M5NA 3TR5A 1S77D 1APSA 3NNCA 4PXEA 4KC5A 2JRSA 1AZSA 3I5AA 4FF2A 2JSXA 4WXWA 3D3CJ 1IKXA 1HR0F 4K4ZA 4Y2IA 1AW0A 3LQVA 1HNVB 2VDIA 2DHAA 4ZHRB 2RMLA 2CPXA 4LF4F 2W8LA 4N8OA 3DRSB 2X7IA 4IFVA 2OTJS 3SDEB 4DV5F 1FTRA 3HLUA 3DI6B 2B9XA 2BOAA 4P73A 4EZ9A 1J5OA 2HMIA 3CMQA 3KK1A 3B8HA 4F36A 3MMBA 2XWYA 1RWMB 1RHMB 4DR3J 1TKXB 3IC1A 4C98A 1UL3A 4W90B 3M6UA 4NLDA 1KTQA 3VZHA 3B82A 5DG8A 3ZZOA 3LALA 4BS2A 2VQEJ 3TP2A 3PO4A 1LW2B 4J9MA 2YWHA 5CXTA 4F3MA 3C2PA 2NR0A 3GP9A 4CO1A 4P2MA 3A3PB 1FWLA 1KOHA 1Y3JA 1PO6A 6AT1B 1FRJA 4DR6J 4DDFA 2DNNA 2A6OA 4FYYB 2DVIA 3K8WA 2VKZG 3BSNA 4RNOA 2GQQA 4C8MA 4LT6A 4LFAF 5F8NA 4NLYA 4PAAA 1RISA 2YY3A 3N9UC 1IM4A 2G2ZA 2XLIA 4OI6A 2BE2B 3IWNC 3NBPA 3R5JB 2P9GA 2BJDA 4KH1B 1V5VA 2FY8A 4BC9A 1WUUA 4B3MJ 5J2NA 2GHPA 4F25A 5D4NA 4K4XA 5ETRA 3KLEB 4PZVA 2H54B 3MPDA 3PRBA 1N32F 4B17A 4UT4A 1RADB 2RQKA 2DPJA 4TU7A 2D3UA 1S9GB 1RAFB 3IR6B 1FWKA 3NGSA 5D3GB 3MXHP 2CQGA 1Y5NB 2C3UA 3D66A 3OPKA 1RQ0A 5A6WA 5E3QA 1REVA 1LXJA 2IC3A 4C8LA 3OXLA 5GAHI 5IT9Y 3CCTA 4X64J 3JYTA 2FLLA 4HACA 3Q0AA 3BREA 2X3DA 2O67A 3DYAA 3CDBA 2BUNA 2BQ3A 2BEFA 3C16B 2W9CB 2D1CA 1CJUA 4YEAA 2RB7A 1SH0A 1VQ9S 4ID5A 3UR3C 4CP5A 1IWAA 2ZJQQ 4DUZF 3LOUA 1ZA2B 1FX4A 3M4XA 4HI2A 3JQMA 4NZ6A 2VDHA 3GZ7A 3HVRA 2ZHAA 3M8ZA 4NCAA 2FZGB 2NPIA 2QE5A 5L39A 7FDRA 4JI8F 3DLKA 3GYGA 3AA8A 3OR1A 1R0AA 2ZOMA 3M1VB 1NHVA 4DG1A 4O3SA 1A6LA 3GV7B 4P2FA 2UVWA 2LEAA 1VRTB 2M5YA 1JLEA 1YZ6A 2QA1A 5G4DA 1EZZB 3ET6A 2ZBPA 2HVEA 2CAJA 1N0UA 2DPIA 4JB8B 1VFJA 2I5JB 3G6VA 4K7QA 3QSIA 1UA1A 3NLCA 3H8YA 1UZHA 1RE1B 2BW7A 3T9ZA 3A4TA 4IQXA 3VAIA 2Z2MA 2HIQA 3DLLQ 1U1OA 1I94J 4RZRA 4DR3F 3BDPA 1RGVA 1KRPA 3TAQA 1OIAA 1CS4B 4CLPA 2QX0A 5KFCA 2KM8B 2FGCA 5IT9U 1PJ6A 4NYPA 3UD3P 1CJKB 3IMQJ 2VQEF 4FKYA 2CQ4A 2G0IA 1FK9A 5I42B 3QZ8A 3TI0A 3TX8A 3FVYA 1KD1T 2HRUA 2HFNA 2YXLA 5LSLA 1XBWA 1OO0B 5L9XA 1IBLJ 4DR6F 1NUEA 1SJQA 4RW7A 1Y4ZB 1RABB 1FE0A 2GGPA 2KRRA 1CC7A 1DFDA 2WB4A 2HW3A 3FBCA 3NRBA 4EYHB 2GV1A 2RDJA 1FTCA 1ZH5A 2AYMA 3SSRA 1VQPS 1NMEB 1H7XA 4PXBA 3MFIA 2JEFA 1U2FA 5CYQA 2KG0A 2E9TA 4B3MF 2BJ3A 2MY8A 1RAHB 1OY9A 4DBQA 1YSJA 2OPPB 4QBUA 4R5PB 2Y3YA 2XY7A 2ZDPA 4LBHA 1S57A 1EJ7L 1NK5A 3M2UA 4QIFA 2O66A 3TZXA 3EMTA 4YP3A 3BR9A 2B6AA 4MAKA 3TA0A 3H40A 2FUG9 4HI1A 2JJ4D 4KJIA 2H5IB 4EGLA 1VQ4S 2MXYA 4NE9C 3B54A 4XTTA 3BKTA 4YFUA 3UR0A 3ULHA 3MR2A 1X0PA 2AJ4A 4X64F 4NCGA 3OSNA 4ZKAA 2JLEA 1V9OA 2BRLA 2NPFA 1GX5A 4WPAA 5K8MA 3GFZA 4NYOA 5LXYA 1SKWA 1NH7A 2OAUA 2BABA 1CULB 3W9IA 2C22A 2K3KA 1XK8A 1AROP 4DL7A 1Z2ZA 1M90T 4L76A 4UZCA 5MAOA 5LMNJ 1RT6A 1JLFB 2CQ2A 2EPIA 1NHUA 1URNA 4NA1A 2LXUA 1VHFA 1I3OB 3H25A 1MMLA 3JXOA 3W60A 5EHHA 2EG1A 3W2WA 4Q2MA 4CTAA 4KV8A 1NDLA 3KNAA 1S1XB 3FEZA 4OI4A 2WVBA 4QWBA 1KP6A 3BPDA 1OSDA 2MSSA 5CHCB 5F8HA 2IA6A 4M5DA 3KDNA 4CDIA 2DNZA 4F4KA 2VC1A 3DGVA 1NPPA 3BGRA 2XHCA 1UPMB 4PXCA 4FVMA 2F7VA 1CQNA 1X8DA 2JEIA 5HLFA 1SJ1A 2NZCA 2EG2A 5AXKA 4MMOA 3BKUA 3EUNA 4EZ6A 3F44A 2VPXB 2W2OP 4LRFA 4M94A 1DBDA 4CCHA 5HJYA 2F4VJ 2EFGA 2QLXA 4MYUA 1IN0A 3T19A 4FBTA 3ZZ0A 1KNZA 1I94F 3KLHA 2ZH1A 3KK2A 3CDWA 2QTWA 1HYSB 3NOCA 3MCNA 4FKXA 1SC3B 3OV7A 5L1IA 3ENVA 2HVHA 4G1IA 2C28A 2OELA 2B3TB 3KFWX 2XY5A 3I82A 3IBFB 4Y2AA 3R9LA 1WKKA 3QT6A 1RWXB 3TAMA 2BVZA 3M8QB 4JV5J 2MLYA 1LQ9A 3CCZA 1RBOB 4D3HA 1IBLF 4UY85 3B4DA 3HT0A 2YTCA 2MQNA 1AXQA 4J37A 2VB6A 5KOXA 3C15A 3H4DA 1N5SA 4PG6A 5FDLB 1DURA 1RWKB 2IVYA 1UEKA 5DQHA 2IYIA 5HANA 2Q43A 2XHWA 4IDKA 1RAJA 4WKYA 3PEJA 1PBUA 3AAWB 4ED0A 3CCWA 4PG4A 3K57A 1LWFB 3N6NA 1DAXA 1SKRA 1NJYA 3IO1A 4KHPJ 5HMWA 5A8WB 3OR2B 3JSRA 4Q45A 3G96A 4DN9A 3WBZA 2LEBA 3BEGB 2MKKA 2QG9B 4XDDA 3DXBA 2L9DA 2VZ9A 4USKA 1D09B 4G65A 3RU0A 5CCMA 5M2PA 1T11A 4EWTA 2MJNA 2YVSA 1SJRA 1T03B 1RWPB 3W5YA 3ENQA 4C0BA 2XULA 1H0HB 2EFVA 2Y1RI 3PYGA 4ZLLA 1RTHB 1XR5A 2J5AA 4X2BA 1X4CA 5KFUA 4X4RA 2KYXA 1XJWB 1JMTA 4IFYA 4J91A 2B9WA 4OHWA 1U45A 3BDEA 2UZAA 1NSAA 2B4OA 2QL9B 5LMNF 5C25B 5ETKA 4AL6A 4GVBA 1WI8A 2QLJB 2VFUA 2QFIA 4I7FB 1ZM9A 4UZBA 1HD1A 4OZ1A 2HNYB 3UDCA 4WIIA 1MLAA 3N28A 3CCLS 1Y11A 2FVCA 2QLFB 2E7WA 2AT1B 3MPYA 4FXVA 1GXUA 4V19X 2QLBB 3PJWA 4QYRA 2W7PA 3VGTA 2NXNA 3QLHB 3PHEA 1S6UA 1RTDB 4ED5A 2EBEA 2FHJD 3IWLA 2DXDA 5KFGA 3MPUB 4ZK7M 4DFPA 2Z2ZA 4C3LA 4ZCIA 1R27B 1FKPA 3R5BA 2CPHA 3PYDA 2MQMA 4EBDA 1JNZB 3NY0A 2XMUA 3JTOA 2EKNA 1KFDA 2F4VF 3G71S 3L9ZA 1VBXA 4LRBA 3FRZA 3T6JA 3QZ7A 1KLNA 4CLSA 4ENOA 5I3UB 1MWZA 4AE5A 3HO1A 3CDEA 3D0IE 1UFWA 2RDIA 1HA1A 2HHHJ 5KFJA 4A4JA 2MZ1A 3T5HA 1UZDA 1U0HB 2ZD1B 4JI2J 2RIJA 1VMBA 2AEFA 4O3NA 4P2XA 3P5TL 3U1LA 4CRJA 4OI2A 2Z2YB 2HURA 2YNFB 4WFZA 1RAGB 2HEKA 1IKVA 2PGCA 2NXJA 1YWXA 2QFJA 3MEEB 3P5BP 3KLFB 4LFBJ 3C6UB 4JV5F 3MPWA 4J9UE 4DJBA 3FMWA 1WELA 1AZSB 3CIMA 5FIIA 3KLIB 3H2LA 2UU9J 2HHPA 4ANDA 2DD8S 2UV8A 3BO3A 2Z0GA 2QL7B 2QYGA 2DXEA 4GKJJ 4IG0A 1QSSA 2IAJA 4IFVB 4KHRA 1WSRA 5HBMB 5IM0B 1KQSR 2XS2A 3K0JA 1VQ5S 3GFHA 4AL5A 1HLWA 1H7WA 5MLCV 1BC6A 2WTFA 2HMIB 3T5JA 3P8BB 2BW2A 2O5DA 2R8KA 2KXFA 3MDFA 5IQ6A 3MMBB 1IUJA 5HATA 4KHPF 1G1XA 1BLUA 4NMLA 2HIYA 3LPEA 2UVUA 2OGUA 3MZIA 1BQNA 3OLAA 3GJSB 4QWAA 3I32A 4WBFA 3I9ZA 4N76A 4FDFA 2CWXA 2BR0A 3AOCA 3Q83A 1P1LA 2ZOGA 3CW2C 1G4CA 2RU3A 3QMQA 2WAQD 2ZH6A 3GIKA 2E7XA 5EX3A 4F4AA 3PX0A 5U47A 1RACB 4GO7X 3EGWB 1LWCA 4P52A 4C8ZA 2MGZA 1RWOB 1IKWB 4CLUA 3MECA 4P7VA 5KFMA 1N5TA 3NBPB 4DPOA 1FDAA 1VISA 3TQEA 3JQKA 5KFAA 1ZBTA 4ED4A 4B9SA 4R0EA 2ALYB 4XAKA 5BYSA 1RP5A 3IFEA 3AJ1A 2XO7A 3D1QA 2XYGB 5LSOA 4GC7A 3I31A 4I69A 2NXCA 5B0CA 1VBZA 2IVFB 1V3ZA 5KG4A 3CPWR 2CPZA 3DRPA 5HO4A 4DSLA 4HHHA 1GH8A 2V2ZA 3H5UA 2MEWA 4OYBA 2J6UA 2R4FA 1MMDA 2K2PA 4O4GA 4N56A 2HVDA 5LL6d 3ADAC 1JJ4A 1SB6A 3QRQA 3JYTB 4X4QA 3IM8A 4NRTA 5ETLA 3HD2A 2VBYA 3QFHA 4DLEA 1CJUB 3O44A 2OHDA 8RUCA 1S12A 4HEA9 5T7LA 1ZM3A 4DV4J 2C2KB 1SC4B 5CYMA 2F8EX 2RHSB 2ADBA 2HHHF 3GFXA 1XERA 1P9YA 4JI2F 2RS8A 2C2OB 3ILOA 3RG6A 2IJNA 3FFIA 2KFZA 3NWGA 4DV7J 1QUPA 4U8YA 3LP2B 3A13A 2DGTA 3R2CJ 3DLKB 1H6KX 3A8JA 3OR1B 1R0AB 1VRQC 1D8ZA 4RO0A 4LFBF 2ZZTA 2P5VA 4DG1B 2YX4A 1YLXA 3W8PA 2QSFA 2UU9F 4YHHF 1WF0A 1FRKA 1JLEB 3LA0A 1MNEA 3R2DJ 4I6YA 3NS6A 2M52A 3GONA 3DM2A 3GIIA 2Z2LA 2DGQA 2D7SA 2D3ZA 1MU2B 4QR0A 2ZKUA 3DRRA 4A8XA 4GKJF 4K4VA 2E5LJ 1ZPVA 3B78A 3CXCR 1Y3KA 4KFBA 1H2TZ 2PA3A 5F0UA 5KG3A 2BRKA 2VPYB 4Q43A 2HHXA 1XQIA 1HQEA 1O6XA 4J7CA 4XO0A 4DCPB 3A8KA 5KFSA 3FCHA 4XK8C 1V6HA 2DGWA 1RK8A 1J5EJ 2VG5A 4G1QA 5KFBA 4NLTA 1KFSA 3D6FB 3PZPA 2JEJA 1ITPA 4TQSA 1X4FA 2UUAJ 4KT0C 1I5OB 1RWVB 2EK6A 3CJKB 3FBBA 1MROB 3L95X 3HHEA 5F0WA 1HQ2A 1HNWJ 4CH1A 4J5OA 2GW8A 3HX9A 2DK2A 2L41A 1KR4A 3S1TA 2GMHA 1NJIT 2CXEA 1S7IA 4LFCJ 1WF1A 5KT2A 2J6SA 2PN6A 2GGPB 5BYQA 3SXLA 3MM7B 2W01A 3SEOA 2EFQA 2UVRA 5CD4A 3HULA 5CYQB 1CG2A 1F2GA 4PQUA 2LEPA 1T3NA 2OO4A 2IJRA 4CT9A 3DKDA 1YJNS 3RBDA 5AJ3J 1U6BA 4IG3A 3BS9A 3M2UB 4YS2A 1LK5A 2RUGA 1YRTA 2DO4A 4A8WA 5LJ5Y 4ED6A 1D0EA 2YKAA 2CA9A 1BGXT 2WB1D 4K4UA 3TJ9A 1Z1ZA 1VBYA 3SQGA 2V63A 4ZPCA 2OPRA 2V50A 1YJVA 4Y00A 3FKBA 1CLFA 4JV1A 2JC1A 1HKAA 3NS5A 1L3SA 4RBVA 4BBYA 1LW0A 4NXMJ 3NL0A 2CNKB 5IT4A 4ZOSA 1FXDA 4USVA 1GK8A 5KG0A 1SUQA 4DV4F 4B3OB 3MM8A 4AUKA 2VIHA 1RT6B 2EKYA 4ZVFA 2C2NA 5CH7B 3CJ8A 4CO4A 3H5XA 4USJC 2DR7A 4OYXA 1U1KA 2QA4S 1NJWA 5GAHU 3GG0A 2XYPB 3RUBL 3QRPA 2QEXS 3DLGB 2AYEA 4JUZA 2HVIA 3OTOJ 1WD6A 3UDEA 1V3SA 1NK6A 4ILRA 3W2WB 1TMJA 4Z37A 4CTAB 1T05A 2WSCC 3BN4A 4H4OA 4WFXA 4WF9Q 1UVIA 1F2HA 4OX7A 5HK4A 4WFBQ 2F9DA 2HQCA 4M5DB 4IKAA 4KQZA 4KKOA 2KRBA 2V4RA 3OJUA 4AQYJ 3HHDA 1HQUA 2DGXA 3CJSA 5L46A 5KT5A 2HPUA 3POTA 1MW7A 2MZSA 2RF2B 4I2QA 4MIWA 4R8UB 1A0OB 5HLFB 2UUBJ 3QATA 2E5LF 2B4PA 1SVDA 2WZ1A 5HQMA 4ECUA 4CNYA 1PAUB 2LYVA 1C4AA 4PCQA 2WONA 3BPSP 8AT1B 2VPWB 2XMMA 4FNHA 3US5A 3M8SA 3KHGA 3KLHB 4USMA 2FJBB 3KK2B 3K17A 3A8IA 2LQJA 1J5EF 4LF5J 1FKAF 1VR6A 5EWEA 3VWSA 4GVLA 3KJQB 3WIUA 2UUAF 3UCGA 2X1GA 4PG5A 5HN0A 4ED7A 3D1HA 4PWDA 5ETNA 2MKYA 4ZP8A 1NEEA 4P75A 1F3FA 2WSEC 3KDOA 1QE1A 3IM9A 3JB9k 1KOOA 4DXLA 4J9VA 3NXZA 2YNHB 4I1TA 2DR9A 3EM1A 2JL9A 3PR5B 5J2PA 1S1TB 2A3JA 4LFCF 5HVFA 2G0CA 5KFNA 2SXLA 1YJWS 4HHUA 5KOWA 2YPYA 2BQUA 5KT7A 3F56A 1RWNB 2CQDA 2FJVA 2HBRB 4WTOB 3PXGa 4DX5A 4JP8A 2DB1A 3BQ0A 1M1HA 4CH7A 3CC4S 2CG8A 3NMRA 2IA0A 2P6TA 1LEOA 3DNCA 5AJ3F 1ZYQA 1OYDA 1TAQA 3OLBA 2YH0A 2I38A 1GXLA 4M5IA 1D8YA 2LKZA 1UVJA 2J7KA 3L7OA 4P2SA 4WFAQ 2R7XA 2VL1A 3UE2A 2I8EA 2A10A 3MUTP 1BQMA 1VHIA 2Q79A 4LR7A 4CQ1A 3RBEA 4P10A 4C0HA 5DDOC 4KBIA 3PJXA 4NXMF 3UDVA 2ZH2A 5I4MA 1M5VC 3JTPA 3QT7A 4IRCA 2PMWA 1FKOA 2AGOA 4IFYB 1XN9A 2YNIA 4KRWA 2VA3A 1BD6A 4Y28C 3QT8A 2IDEA 2DNYA 3SSQA 2V2KA 2PDAA 2AU0A 2AGQA 2YKMB 4X66J 1XC9A 3ENWA 1TR0A 2XMTA 1R31A 2V2QA 4GVBB 2HGMA 4RWWA 4DR1J 3OTOF 1NKBA 3SCJE 1TQLA 4C3KA 1RI7A 3KG0A 4F3OA 3VZIA 2Y0SD 2DCUB 4HT5A 4QWDA 2HNDB 3ZTSA 3QGPA 3H59A 3W1YC 4RW4A 3G6ES 2CJQA 3ETOA 2QGFB 3ELHA 3M8PA 1Q86T 1HD0A 2QMUB 1T94A 4C7QA 4AQYF 3RW6A 3OTBA 3LF0A 3NS7B 1M5HA 1RJJA 3AFGA 3OUYA 5AT1B 2UUBF 2CQ1A 2CQIA 1N48A 2ZM6J 1ZM2A 1B64A 2ZC4A 4LVOP 3ILJA 4E0DA 1NPKA 4MFBA 5C24A 4MKVA 3V6JA 4CO5A 2MTLA 5IQQA 3CJ5A 3T6BA 2L48A 4HLBA 4LF5F 4GRSA 3IBCB 1FDDA 3KJFB 3QO9B 3PEHA 2MKSA 1IKVB 4EO6A 4FF4A 2AW0A 3Q8SB 4QIWD 4ZPBA 3H4BA 3OVBA 1HI1A 5J2MA 3J81j 1X5OA 3CCES 4ECQA 1CJTA 2RUSA 3FDSA 2BJ7A 3D3BJ 1VI7A 4ZHRA 2FC8A 4DCOB 1LFWA 2IBOA 2HBQB 3SDEA 2HAFA 2DCLA 5E3CA 3GYNA 2F8MA 2ACYA 2NCKL 4G1PA 2DR6A 2C2DA 2XI2A 4ED3A 3IAM9 3G2XA 1RKIA 3Q86A 4L6V3 4OYPA 4WYWA 2YWEA 5D15A 1FRMA 3CJ2A 2MZTA 6FD1A 2ZWOA 3QBCA 5ETPA 5IWAJ 1IKYB 3V4MA 4AXIA 3TW0A 1RHUB 1RHKB 2VFVA 1RT7A 4TKTA 1IJEB 2AP6A 2ZC3A 3DOKA 5DS7A 2FB0A 5DDPC 1S97A 4K4YA 2QA2A 4Q44A 2BACA 5KG5A 4KE5A 3L3CA 3GJRB 1RUSA 2NREA 1BHNA 3SFGA 4PKDB 3QT5A 3D68A 2BV3A 3LGNA 4G3IA 1R0CB 5HQ8A 3MI7X 3G6XA 3MMCA 2BE2A 4PYDA 4JYAJ 2ZJPQ 2HS4A 4HL9A 4X66F 2EWHA 4ZVQB 4OJ1A 3KLEA 1G2EA 3MECB 1SXLA 2C2MB 1R3NA 4OYAA 3THTA 4DR1F 3EGZA 2WOMB 2JC0A 4FBUA 1S9GA 2MSTA 3PNIA 3PW5A 2F65A 3C66A 1TK5A 4RPFA 2CZ4A 3NKYA 3ZZRA 4MYTA 3KOAA 4CLLA 3DRPB 4RW6A 4DPTA 2JDJA 4Z7YA 4MKBA 1YK9A 4A8QA 4EFAC 1KTVA 2E9RX 4B9NA 1MSWD 4O3OA 1FNMA 2C42A 4USTA 3AODA 3SSSA 4O4GB 2R2SA 1PYSB 1VQNS 2W9CA 2FJWA 2J9CA 5KFEA 1OPZA 2FJAB 2M2BA 3FSIA 1BWEA 4EMDA 1U09A 4DR2J 4WYLA 2W2MP 5L38A 2ZM6F 4ELTA 1JXVA 4OLOA 2FZKB 1UCNA 1WTBA 3MTJA 3SFUA 3E3XA 2NLWA 4Y2MA 1S1UA 1Q8LA 2OEJA 2HZCA 4WKRA 3ZZPA 3M6VA 4HVZA 3W8GA 4X84A 3H98A 2HHSA 2C2EA 3H2UB 4DF4A 1YBTA 2F1FA 2KDOA 1QAJA 4RW8A 2WSFC 4ED1A 1VRTA 2M8DB 1NSKL 2IRYA 4ZVUB 3FCVA 2E9ZA 2V0NA 4IYQA 2F8HA 3C14B 1UFLA 3J7A1 2CIMA 4LF9J 2I5JA 3HSZA 2NUHA 2CPEA 4OX8A 5E3PA 3DRRB 3OL6A 4NMXA 4F02A 4KHMA 4NXNJ 3NGKA 3QAUA 4CLYA 2VFRA 4BHQA 3CJTA 3UWTA 4C11A 1HQEB 3VQTA 2OSRA 2RRNA 4K0KJ 3TEGA 4QWEA 3EVMA 4NLVA 4FVCA 2OUGA 5IWAF 3VAJA 2GQ2A 1K0VA 2ZH4A 1TFWA 4ZN3A 4Y2KA 2FHMA 3MM5B 1RAIB 3RZAA 2VG5B 1ICEB 3HSJA 3VVTA 3W5ZA 1XMBA 1S4EA 3LTOA 1I51B 1ZAXA 1YZ7A 1TVRA 2GNKA 2LA6A 2MKCA 2Y0BB 4B9UA 3BQ2A 3ILIA 4WK3A 1QSYA 2GIRA 2G2OA 2HBZB 2HS3A 4JYAF 5E5NA 3ZXWA 2R8GA 3FZ2A 3VAMA 4TU9A 1OPIA 1VLYA 2VD3A 3K5MA 1QDUB 5AXMA 3CO9A 2GZOA 2E66A 4P74A 3ITHA 3KHRA 1DTQA 1Q4RA 3GIRA 4OYZA 2QSWA 3CMAS 3CWJA 4QZVB 4ITSA 4PQUB 2R7VA 2HAIA 3VAHA 2AJ2A 2HQDA 5KFTA 4HH1A 3IGVA 2J6TA 4L73A 3M2RB 2B4UA 4IG3B 3MR6A 4DQPA 4NEYA 4OHVA 2LQ9A 3BH6B 2FLPA 3Q8PB 3SMZA 3G86A 2OPRB 1B3TA 2QJ3A 1K9MT 5DGBA 1CULA 1RB0A 4RJVA 4LF7J 3GLJA 2A6MA 7AT1B 3M7VA 1LW0B 3G87A 4DR2F 4WE1A 4PR6A 3THPA 1SJ3P 1RCOB 3NNAA 1JLFA 3GWCA 1XWLA 3EPIA 2GMLA 1UVKA 4U95A 2VKRA 1N54B 1F6TA 3CNQP 4C3MA 1SUQB 2AYGA 3MM8B 1S6PB 4NLOA 3U1MA 5IT0A 1U6FA 1FT8A 1NB7A 5DQGA 2IMOA 1JLGB 1S6QB 1SCJB 3UFCX 4ED8A 1CVJA 2UXBJ 5GAGU 4KPYA 4DF8A 2DT9A 1Y7PA 5KFLA 3EZ5A 1VK8A 1JX4A 1T05B 4QIVA 2OLWA 1RKJA 3JTNA 4ZCMA 1Z4UA 4YR3A 2N4CA 3TYTA 1U0SA 4H4OB 3ZO7A 4MH8A 4L75A 1N4LA 4P71A 4RUAA 4JI3J 4LRCA 4JI0J 2EBGA 3U1NA 4U9RA 2GO9A 2QMXA 1P27B 2B4VA 2XNRA 3M6WA 2K7KA 4LF9F 1KC8T 2GIFA 3ZZTA 4OI3A 4I2QB 1FJCA 4C48A 2UP1A 3VAGA 3BO2A 2W25A 3DCAA 3VCDA 4DV2F 1P6TA 2DYAA 4NXNF 1NK8A 3G8QA 1JIHA 1AT1B 4IO9Q 3I0RA 5CZXA 3CGIA 1XMOJ 2W2PP 1HYSA 2C1EB 3CCMS 3I55S 4FYVB 5CYJA 2X3GA 1SH2A 1JLAB 4K0KF 2GVZB 3MEDA 2DIUA 2VG6A 3BGOP 5I3QA 3BGUA 4MJKA 3QSYB 2IPOB 4C8OA 3M8QA 2MLXA 2OSQA 1H2UX 1JNRB 1PGZA 4RR5A 4QR2A 3TZZA 2CJBA 5H9FJ 4PWDB 4KGZB 4EK2A 3OTEA 1EQ0A 1HBOB 3CO0P 2LA4A 2HK2A 2A1BA 3FZBA 3RB6A 3R3TA 1URRA 5J1NA 3EE3A 1BE4A 2XMJA 4NYZA 4R25A 3GFYA 2X1AA 2JOQA 4I56A 2DGSA 5E0OA 1IQZA 3PTWA 1GTHA 5D78A 2GS8A 3QGIA 5B09A 2N3LA 4OX9F 1H3DA 1U1LA 3OR2A 3FEXB 1SH3A 4DQIA 3Q8YA 2IDLA 2WRMA 4ZP7A 3GV8B 1IXKA 4AFFA 1WKLA 5KFWA 4LF6J 2LQ8A 3HI9A 4ANEA 3RR7A 2WW4A 4U7CA 4Q0BB 1WC0A 2BYCA 1DTTA 2H4YB 1T03A 1R6YA 1WDDA 2MKJA 4NZ7A 1KHWA 2CQ0A 2BANB 5KFYA 4ES2A 1RTHA 4ICLB 4LF7F 4IQMA 4YR0A 2W7AA 3DRYA 2HQFA 3NGDA 5C2CA 3WC2A 1FD8A 5B7WA 5C25A 2HHTA 4P6QA 3CD7A 3D0HE 2KG1A 2OMLA 4L3NA 4ZVGA 4FS1A 2R7QA 4ID8A 3TVKA 2FHKA 2X1FA 4N5SA 1WDTA 1NCLA 4RX6A 3L4BC 3V5RA 3KKFA 4ECXA 2R7UA 2ZNZA 2UXBF 1GMVA 1JQGA 2VOPA 1B0VA 2AGPA 2VUGA 2YQ3A 4ZVPB 4H54A 1X5SA 4UOCA 2AV5A 1NH8A 1YG0A 1RTJA 5HSPA 3QLHA 1X4GA 1PC5A 2RRAA 2FQQB 3QGGA 3ZTPA 2A0FB 2BX6A 2QRRA 4JI3F 1HNIB 3M8PB 1RAAB 4JI0F 4CLTA 3T5KA 4GC6A 1UWAA 5A8KA 1WC3A 3VTIA 2F3JA 2YWGA 1DQ8A 2Z57B 4LRDA 3OUYB 2XQCA 1CC8A 1RZMA 1SIWB 4JI4J 1LWEA 2RAQA 1DJ0A 3DXSX 3GB0A 3VGVA 2OPSB 5I3UA 2G13A 4NX9A 1JLCB 5IV4A 2ABYA 1XMOF 2HG4A 1F60B 4P9SA 4MFBB 5C24B 3O5TB 1FFWB 2L08A 1YITS 3D6HB 2G1HA 1TKZA 2DKOB 2YNFA 3C46A 5KG2A 2E7VA 1FE4A 3HD1A 5KT6A 3KLFA 4DX8H 3C6UA 3GJQB 3CT9A 3IN5A 1YQHA 1VIXA 2UUTA 3KLIA 3R27A 5KFDA 2ZH3A 1VRUB 1SJFA 4OI1A 4BWJA 3M9NB 5J2MB 3AXKA 3BO4A 2IM3A 5HVHA 1CJTB 1TUWA 2CNNB 4ZDNA 5K14B 4CLWA 4OJHA 2Q1LA 5DZ7A 4CO0A 1N5QA 5HBMA 4HR2A 5IM0A 1VC5A 4B02A 3FK4A 3WIVA 2A2CA 4A8KA 2KFNA 4MK9A 2KT5A 1YVFA 5FD1A 4CYUB 3VV2B 4EBCA 4LF6F 3E01B 3HHKA 3IA0A 3AH6A 1MN7A 1XEZA 2XB2D 3TRGA 2W4PA 3CIZA 1Y5LB 1RT7B 4I6AA 1KVKA 2GHWA 3HSDA 4MKAA 1KBRA 2UUWA 3DOKB 3HKZD 1FJGJ 3ZZZA 1F5BA 3B4MA 4V1Ak 1YHQS 2C3OA 4HKQA 3HT3A 4Z2XA 4OHXA 1T95A 3R1HA 1RT5B 2FYXA 1QTNB 2CPJA 3LP1B 2PE8A 5ETSA 3TOQA 2ZFHA 1IKWA 4ES1A 4K4SA 2HHVA 3MMCB 3LO3A 4A47A 3VF0B 4NLRA 4ZJQA 1RYSA 2OFHX 1ROFA 1HBMA 1KQFB 3AB4B 1R43A 4X4VA 4YMEA 2QYCA 4YY3J 1SPBP 3KWMA 2QN6B 4DI6A 3CD5A 2RD5C 1U26A 4X4NA 4PG7A 4Y34A 3C3LA 3HDSA 4M5HA 2JLGA 2M4MA 1YBUA 3KJVB 2YBVA 4RW6B 2Q6BA 2CKWA 2R9LA 3J80Y 4J90A 4NASA 1TUVA 2XEXA 1U1RA 4ECTA 1WC6A 4K59A 4FPRA 2ZUAA 3TUZC 5B0AA 2XGPA 2F40A 3KTQA 1E6VB 1RAOA 1WEZA 3BF4A 3MUMP 3N0VA 4PQAA 1FNOA 4JI4F 1WOPA 5DLGA 2KXNB 4ZIVA 2IHR1 3MMAA 5CAAA 5EGYA 4RUCA 4DV1J 1W7WA 5AXNA 4K50A 1N8RT 1S1UB 1RU2A 4Y2CA 3R1LA 4F4YA 2ZKTA 1U2RA 3LP2A 4DQQA 2Y8YA 5L1KA 4DL6A 3MURP 2WVEA 4I4BA 2EXUA 4U6PA 3D4JA 1FF2A 1RTZA 3EICA 1PIEA 4IH7A 4RW8B 4NEZA 5B0BA 4ECZA 1ZZFA 2MY7A 1JK9B 1CQMA 3WX8A 3JAMY 3RR8A 2F9JA 4TY8B 2Q3PA 5H9EJ 1MU2A 2EI5A 1UVMA 5K5MA 1EIYB 4QWCA 1HI0P 3PX4A 4ZLJA 4FYWB 2FIUA 4ELUA 3F73A 1UPPA 1TK0A 1OYEA 2E5GA 2W9BA 1UETA 1Q5YA 2BQRA 2XS7A 4CNZA 4CWBA 1P9QC 2B43A 2KN4A 1D1UA 2DEJA 3J80U 4C11B 1UTAA 4F0MA 3W3SA 2ZOFA 1GMWD 4F4ZA 3UW1A 1U8SA 4QPTA 1S1WA 2GJIA 5FLXY 1UJ6A 3A3OB 1NB2A 3CJKA 4DEZA 1MROA 2MYFA 2OKQA 4DR7J 1VYAA 1YJ7A 1FJGF 2KJVA 2DY1A 1TVRB 3CB4A 3EXYA 1TL4A 3MCSA 5D4OA 3SYZA 2RT3A 5ETQA 3MM7A 3BV8A 2AYBA 2UUCJ 1FA0A 2F5GA 2HWHA 3UN5A 1Q1KA 1GTEA 4R0JA 1FO1A 1KONA 4UUXA 1A9NB 3IRWP 3M9OB 3NP5A 4RL1A 3DLJA 1HW9A 4RNHA 4YY3F 3ITHB 3KUEA 1DTQB 3D5MA 3R5AA 2H4WB 2XZWA 3NEKA 3SZ2A 2QL5B 3KLVA 3JAMU 3RB3A 3W5XA 1VQYA 3MM9A 5DQIA 4EU0A 4OJ3A 5DM7Q 2Z4PA 1ZS6A 4BWMA 4ATNA 1VQ8S 4KGXB 1QM9A 1B99A 3HKWA 3HHLD 1QTMA 3WHIA 1DZ5A 4IUFA 2AZ1A 3MOJB 1YBAA 2MQ8A 3CCJS 2M9KA 3G8TA 2CPDA 4Q8FA 1BXNA 2V9KA 5L8RC 1AB8A 1I1GA 3I0SA 2DH7A 1PILA 2CNOB 4YOEA 4KTQA 4B3OA 2HKEA 4WE1B 2XCAA 1R89A 3V2UC 4ZN1A 3JS9A 1YJ9S 2KU7A 4A46A 5L1JA 3TUIC 5F41A 3QNWB 5FLXU 3X1LB 2DNLA 4P7TA 2GA7A 3OSPA 2KHCA 3O2IA 3FBFA 4DV1F 3DLGA 1EAYC 3ONQA 1REGX 3LAKA 2V4QA 3DU6A 2IYGA 2B7CB 4F2RA 1WNEA 1VS3A 2KT2A 3NCQA 3VGSA 2XLJA 2I9SA 1KEKA 4M5KA 3M32B 2FZCB 2O01C 2RU9A 1F9EB 1FRIA 4IH5A 4OZNA 1W26A 4WTYA 1VQSA 2RNEA 1NDPA 2K7JA 3ZZUA 2RF2A 4O23A 4GKKJ 4R8UA 4NCBA 1LFPA 1X4DA 4USUA 1LOUA 4HTIA 4C9DA 2HZAA 2RJZA 2BM0A 1WI6A 2LLZA 4C2MA 1NKEA 2ATCB 3GR0A 1SJ4P 3TX0A 1RT1A 4DSIA 2LECA 4Q5VA 1SL2A 3ISND 2AJQA 3I0RB 1WOOA 1QVGR 4Y3CA 4LUBA 2JWNA 2IM2A 1X9WA 4AYBD 5J2QA 3MEDB 3EJMA 2VG6B 1HI8A 3QJLA 1S6OA 1TELA 2M3DA 8ATCB 4DS4A 2ZVIA 4KAIA 4PYAA 3EPGA 6FDRA 1HW8A 2OH2A 1JLBB 4WCEQ 2ZVSA 5G0RA 1YTYA 4F0HA 4DR7F 2M0GB 3RRGA 2Z8QA 1VQ6S 3TUJC 2ROEA 2YNHA 5A8RA 3PY8A 2UV8G 3HFVA 2NUUG 2FJXA 1S1TA 1RLCL 1Q8IA 1UWBB 3IAS9 2ZH5A 3K58A 5GVQA 1DY3A 2L9WA 1D9DA 4F67A 2ROPA 2J9DA 1SL1A 4YDDB 2UUCF 3OTCA 2VJVA 1JKHB 1SKUB 3UN3A 3L7PA 2KM8C 3RB4A 3QQCD 5A2QY 2DNHA 2JVRA 5F8MA 5LM7E 3W66A 3MFHA 1HPZA 3NMAA 1NRKA 3CDUA 2HBYB 5RUBA 2RRBA 1KDNA 3QRRA 4N77A 4JV0A 3U02A 2IRXA 3G82B 2AIRB 3CCQS 3T5LA 4RU2A 5B08A 1IBCB 1CJVB 3G8SA 3H42A 4ZS6A 2BJEA 1OY6A 1M5SA 3NWRA 1DTTB 1FWPA 1YRXA 4J9LA 2LDIA 3M8WA 4LSLA 3MD1A 4XPCA 3QIDA 2XYHB 4PUOB 4DPUA 2FLNA 4DFMA 3UVJA 1UP1A 2OPQB 2VBXA 4K5SA 2CPFA 4Q2LA 2XI3A 2J0SD 2DH8A 3RW7A 1WG1A 4ECWA 1WOSA 4A8OA 2DNMA 2VA2A 2NZ4A 2XGQA 2HFVA 4ZLNA 2YKMA 4OLPA 5L9NA 2DNOA 4ZPTR 3M2VB 4GO5X 4JI5J 1FX2A 1R8PA 2GQCA 4LF1A 2N7CA 3PW7A 5HQLA 3BSAA 1ZTWA 4URQU 1KQKA 1S10A 4U7UK 2HNDA 1X4BA 4I68A 1CPZA 2G9OA 2Z56B 2B9YA 2GMJA 1RTJB 2DY9A 1SV5B 4NOHA 2DRDA 3CDAA 2WK4A 4GKKF 2NS1B 5A8KB 5A2QU 4ECSA 2J0WA 4PWWA 3BR8A 2ATLA 1WHXA 2GAHC 5ETVA 4RNNA 1U47A 4DL3A 1W25A 1TU0B 5SZTA 3GILA 1LWEB 1VC0A 3ZNUA 2V8DA 4WZQA 4ZVOB 5HMXA 1TV6A 4TQRA 3HFKA 4LREA 3AHPA 3MOZA 3N79A 1TKZB 4TY9A 3QO9A 3DDNA 1XMQJ 2GVDA 3SCLE 5ETTA 2VJUA 4FNIA 2QIFA 1S79A 4URSA 1PYTA 2PD1A 1YDLA 1G7CB 2DHSA 3OFEA 4DL0C 3M8YA 4EYIB 1T9TA 4ES3A 3NGTA 1ELOA 2RDDA 3AB2B 4HYKA 1DQ9A 1YJRA 3EGVA 5HMYA 4NA2A 5A0YA 1X4AA 1KSPA 1O51A 1E6YB 4FZVA 3H2VE 1N36J 2E1CA 3EX7B 1PSDA 2KVQE 1NK0A 2AJFE 3I4HX 3VQSA 1IKYA 1DHMA 1FVQA 3KMSA 4K2JA 2HZVA 3D0GE 2CQHA 5F8LA 2EFPA 4J9NA 1GNKA 4OZ2A 2DITA 5DG9A 2HK3A 2W24A 2BKPA 4DPXA 4WP3A 1PYOB 3MAHA 2M88A 2FGOA 2FLOA 1P8GA 1U1PA 4WFYA 2MQOA 4QQBA 4Q8EA 5CA5A 2KVIA 5K20B 1Q0NA 1RT2A 2OTLS 1PG5B 5BJRA 5GMEA 4CLZA 1YIJS 4IR1A 2CQCA 3DRXA 4CT8A 2VONA 4DV3J 3TZWA 4MT1A 3QWPA 1QUVA 3V6DB 5ETMA 1SQGA 2PFDA 3R7BB 2FHJA 4H4MA 2HRTA 1S9EA 1S7HA 5F8GA 4JI5F 2WOMA 1HBMB 1ZAWA 3PYEA 2DNRA 1HL6A 4X4SA 3ETMA 1WORA 2HLUA 1V5IB 2CPYA 4Y65A 3ZTQA 2K1RA 4PG8A 4PWUA 2IIHA 3TANA 1ZZNA 3PIPQ 1VQLS 1FESA 2DNPA 2BJ9A 4EI2A 5GAGI 4KPCA 2DHHA 2QLWA 3CCUS 1HHQA 2VU5A 4B9LA 3TAPA 2CJXB 4FF3A 1RHQB 1T3OA 2IRUA 3EGNA 2IY5B 3PRDA 3NGRA 1FFGB 1X0FA 2KT3A 4DSKA 3D6TB 3HZEA 3PG9A 4OYIA 2DXFA 3BB5A 1HNXJ 1U4BA 5BXIA 2ZBIA 2OD4A 5KG6A 1S59A 3MMAB 2UVVA 2HHWA 1R8CA 1FXRA 1EARA 3N4WA 3LANA 2CVIA 2LQ5A 1Q82T 1XMQF 4DFJA 4LBIA 4BC7A 5IXUA 3UN2A 2FJDB 2E29A 2GJFA 1TKTB 1FJEB 2YKOA 5IV3A 1S0OA 2PC6A 3CJRA 3C14A 2ROGA 5LMUJ 4J9RA 4USHA 4ZITA 4BDPA 3TQ1A 2MQPA 3FSYA 1JJ2R 2EFNA 5DM6Q 1UEVA 4RKUC 4RLEA 1SI9A 1M5OC 3ZZYA 3DLBA 1N56A 3TWZA 4K4WA 2VOOA 3Q2SC 1N36F 1X31C 4JI7J 2W9BB 1R7IA 4RW9A 2CQBA 1UJ5A 3DC2A 3GCXP 4LJMA 3D67A 1VIOA 3TNVA 1N34J 4I67A 4X4PA 2ALZA 4C8YA 2F63A 1K44A 3PKYA 1RWUA 1WC4A 5KT3A 3IP0A 3K5PA 3MM5A 4MK7A 3R6GB 1S1VA 1S1WB 4OZ0A 1TUGB 1SL0A 3ZNJ1 4YB6A 2E1AA 4KB7A 2XMKA 1TMMA 1N6QB 5F8JA 5F9NA 3AD8C 3ZTRA 4FN5A 1EX8A 4KY3A 4DCJB 4LSZB 2VG7A 1RTIB 4DV3F 3W64A 4W4MA 3IGNA 4NI2A 1U2CA 4ZVHA 1YKWA 2PSZA 3PJ9A 1WG5A 3QJPA 2DIVA 2V8VA 1AFIA 2JVOA 5IFMA 1RT3B 3KG1A 2OI2A 4ZVSB 1IR2A 5F9LA 2QO3A 2ADCA 1U1MA 4ZVRB 4KIAA 1UW9A 2AX1A 4D3GA 3M2RA 3DLEA 3PFEA 4IRDA 1T02A 3EWGA 2E1RA 5THWA 1BWVA 4UY8T 3LW5C 3MM9B 2LU2A 2XS5A 5KT4A 2MMYA 2CADA 2OEKA 3PM9A 2WVCA 1WEYA 3T9NA 3KNGA 4DQRA 3S8SA 2EC0A 1HBUB 3WX4A 2E5HA 3BBCA 2PFFB 3BBBA 3I0SB 1HNXF 1VC6A 4TVAB 1FXLA 3HFZB 1S6PA 2B51A 3CVKA 2CDRB 2HSEB 3GMGA 1WWHA 1JLGA 1S6QA 2YNGA 2KZZA 1OJ4A 1EKRA 1N5VA 5D0HA 1FRHA 2RHQB 3M30B 1S0NA 2VBWA 3PKMA 2E44A 2V68A 3V4IA 4DV7F 3OVSA 4A8SA 1TTHB 1RU1A 5F8IA 5AE3A 4ZP9A 1ZTTA 1LV5A 2CQPA 1T9UA 1TL1B 1UW4A 2JHEA 4YB7A 2HGNA 1WF2A 3J7YI 5B0DA 5LMUF 1GX6A 2OJ3A 1WG4A 3HF5A 1EP4B 1JJHA 1IWGA 3RJMB 2XSJB 3SIPB 3CCVS 1EETB 3GU0A 3SV3A 4OMFG 4N41A 4DZDA 4FXDA 3AJ2A 3KUHA 4I0WA 4JI7F 5HI7A 2J7UA 1PJ7A 4LR8A 3JSMA 3MUVP 4USIA 1ZA1B 1RT1B 1JLAA 1N34F 2GVZA 7FD1A 4L74A 3W2VB 1IVZA 4A8MP 2HLTA 1T9VA 2ZHBA 4DU7A 2RKIA 1T8EA 2RH3A 3QGHA 5J2QB 1XNRJ 2LCWA 2YWKA 2N3OA 4TYBA 3E2EA 2DTJA 2EEYA 2E1MC 3CC2S 3CF5Q 3P3DA 2CJKA 3O8WA 5G0RB 4A48A 1HBOA 1HNWF 2B0GA 3FQKA 3MTKA 4Q7AA 3IG1B 5JVGQ 1R0BG 5A8RB 2PI4A 3FNNA 1OWXA 2P8IA 5JUMA 2B56A 2ZDOA 2WBMA 4B3SJ 1KLMA 1FRXA 4ZP6A 2NSCA 1M5PC 2W1BA 4ED2A 3N5BA 9RUBA 2MZRA 3S01A 3BYPA 4X4UA 2QV6A 2FY1A 2MKIA 1Q78A 3HHLB 2FVSA 4HH0A 2HNZB 3HVAA 4I6WA 3MAAA 5EN1A 5JXSA 1KS2A 1N0VC 5GADI 1VQOS 4ZPDA 3AQOA 1F9HA 1XNQJ 4G6VB 3AY0A 1HPZB 3G6YA 4K2XA 3N6LA 1FFSB 4DWIA 4Q0BA 1WEXA 4FPIA 2GIQA 4PRFA 4FF1A 1N52B 3HVTA 3ICLA 1LNQA 1R6VA 5E3RA 2BANA 1VLOA 2PI5A 5SUHA 4C6AA 3NCRA 4LSLB 4ICLA 5KFQA 2WVDA 1WKJA 5K8OA 3CCSS 3OFHA 3OL9A 1Q81T 1G6BA 2PMZD 3UVJB 2DGUA 2B8QA 4ECYA 1VQMS 2O3DA 1LWXA 2R7RA 4J9PA 2PA8D 3R8YA 4KSEB 1S72S 4URGA 3D6MB 4DSEA 4DR4J 2EC2A 4B9TA 3OVAA 1QAXA 1DQAA 2R2TA 1VCTA 5JVHQ 1N33J 4DS5A 4ZPAA 5D0GA 5CD4H 4AXJA 3LPYA 1QD1A 3GYXB 3C8YA 2VODA 5A76A 2RSQA 2RQCA 3I5BA 3DOLA 1NPRA 1X60A 2V67A 3BGFA 2HFSA 4MIBA 1A7GE 2ZUGA 2A18A 3FUYA 4KYZA 1HNIA 4N8NA 1UVNA 5KFIA 2HFOA 2AZ3A 2HVZA 1OQ3A 3W62A 1NDCA 2V4JA 3T1HJ 4WZMA 2CQ3A 3TARA 4DL4A 3E8OA 3FCWA 2OPSA 4E8UA 3UD4P 1JLCA 2H65B 3K59A 1JB0C 1VQ7S 2C3MA 1B7FA 1UA0A 2FC9A 3GSIA 1IQTA 4NL5A 1TV6B 2DNGA 3NAHA 1XNRF 2I6WA 2BJ1A 4CLKA 1RBAA 2ZJRQ 3RBXA 4OI0A 1U1NA 2GVDB 4TU8A 1WSVA 4YB5A 1VRUA 3THVA 3DLHA 4NLGA 2LU1A 1RT4B 5K14A 5KFKA 1EKSA 1MWYA 1HWLA 3FBEA 3D7SB 2DO0A 5CABA 3H0PA 4B3SF 2MB0B 2B7BB 2QT7A 3BSOA 1Q16B 3MR7A 5A0YB 3D54A 3H5YA 2GC8A 5EWGA 4WP9A 1R8AA 1AA1B 1PC4A 4DPYA 1OMSA 1MN9A 3G9CA 4CYUA 3KG4A 3R7SB 1XNQF 1UFKA 5HL7Q 1WTFA 3E01A 5B0EA 4I64A 5F3ZA 3CJ4A 2VFTA 4M5JA 5ETOA 3RGIA 5T14A 4UTGA 2POKA 2I0XA 2R42A 1L3UA 2V9WA 5J1EA 4U8VA 1ZAVA 4ZJOA 3QPIA 4KH0B 4B08A 2VBZA 3AOAA 1S76D 2YPZA 2EVZA 1M1KT 4FS2A 1RT5A 5HVGA 1OSCA 1RT2B 2XCPA 5HP1A 3TO8A 4QCLA 3LP1A 1NO8A 1NU4A 3HXMA 1ACMB 3HHLC 3C6TB 4I2PB 2V8GA 3QIPA 1QSLA 3UI3A 2NSBA 1NZ8A 9ATCB 4LRAA 4YUDA 5GAEI 3BJYA 3RTVA 3UDLA 3AQPA 5DETA 4ETZA 4DR4F 4H4MB 1S9EB 1C0TB 2V5HG 1NJZA 1R8BA 3IXQA 2RQ4A 4OYWA 4FP9A 1N33F 1L3KA 1KN6A 4DLGA 2HYIB 3Q8RB 2CVEA 3Q8UA 2DGOA 3OL7A 3LWMA 3KJVA 4B9MA 4CZCA 2CJ9A 4YHHJ 2K1RB 5AE1A 4UOGA 3MR3A 1IKXB 1NK9A 4O3PA 4ELVA 5BYRA 4L72B 4O3QA 1M5KC 2ZBCA 2PMHA 2M8HA 5A6PA 5M2RA 1X5TA 3DMJA 3BN7A 3T1HF 4WK1A 1E6VA 1RYRA 3RRKA 1RDRA 1VOMA 4NA3A 5C42A 3V81A 1J5OB 4CH0S 3KK1B 2C3PA 2XMWA 4E98A 3K5OA 4DUTA 3WQPA 4CO3A 2XMVA 3GJTB 2XZTB 4M1KA 3RYLA 4LIWA 4ZPVR 1PJ5A 4N7TA 3QFWA 2MZJA 4IO1A 2IM1A 2ZZMA 1Y0HA 2KKHA 3J7AN 3KLGA 5AXLA 1QVFR 4JBCA 3UCUP 2R7WA 3ISNC 2W8KA 3PVXA 3GE9A 4OQJA 2AEJA 1C4CA 2G4BA 5EDWA 4FYXB 4X4OA 3DGPA 1QLNA 3IR7B 2LVWA 4CLFA 3H90A 4TY8A 4K5RA 4OYOA 4ZVEA 1NLKL 2LMIA 3R5DA 3TUPA 1WHWA 4C97A 3NG8A 2DISA 1PKUA 3DDKA 4F4XA 1DARA 1B70B 5BR8J 4NLWA 2MJUA 4J9QA 5J2NB 1TZ0A 4UOHA 1K1QA 2LXFA 2VASA 2BKNA 4ALZA 1FD2A 1IR1A 2PEHA 3J81Y 4RW9B 2ZHOA 4QR1A 1KWMA 1RHRB 2FDNA 4ZA1A 2V6AA 1S49A 3RAXA 1C1CA 3PDNA 5HROA 4BCAA 2E5IA 1REVB 3EVOA 2FVRA 1U8WA 1IBMJ 4LBPA 2IC3B 2KO1A 2BM1A 3BBFA 5E33A 1S1VB 2KI2A 4PPDA 2C2RA 1FEHA 2LDYA 4HACB 2IJFA 3DYAB 3L7UA 2COLA 4UUWA 4LF2A 2ACMA 1LK7A 1NAQA 2AJ1A 1TL7A 1H74A 2XNQA 1I6JA 3S7RA 4ID5B 4XIUA 2DEIA 2HWIA 2R3VA 5DG7A 2Y1LB 4ECRA 3DDIA 1CBKA 4OZLA 2VG7B 1X9SA 4NI2B 2NQPA 2OFGX 5FJ4A 1HBNA 2XMAA 2AWZA 5D0RA 1T0TV 1C1BA 2H5EA 3P4UB 1T9YA 1HWJA 1SKSA 4HT7A 1TKDA 4O44A 2ILZA 3FJ2A 2F4FA 3KYLA 4ZCLA 4EUVA 4OV6A 1JLQA 4RWXA 4OZJA 1JXLA 3BH7B 3DLEB 3OBIA 4YDXA 5K9FA 3T3FA 2G1DA 5M2UA 3AD9C 4TXSA 2ZZNA 3VGUA 3N5FA 3MEGA 2EFOA 3ET6B 2BOPA 2HHQA 1SQFA 1B7YB 2QC3A 2ASDA 2J0XA 4O0NA 4KGMA 4YQWA 3B6BA 4OFZA 3J81U 2C3YA 3T1YJ 1P1TA 4UF4A 1U1QA 4JV2A 3PYFA 2CJAA 2G0JA 2KJWA 1NBEB 4RU9A 3I87A 1OQ6A 3PW4A 2MQLA 4ZJLA 4RNFA 4F3QA 3VR1A 4QU6A 4F0KA 1GMUA 3I5CA 2YNGB 2ZE2A 1IR0A 2CPIA 1NZAA 2XWXA 4IR9A 1FK9B 4HDHA 4B3TJ 2D74B 4Z7CA 1IBKJ 4WU3A 3LP0A 2HS0A 3V4IB 3HJVA 1H72C 3M32A 3P6YC 2MHNA 2AD9A 2IFXA 4M63A 4DMZA 3HCXA 3OHAA 3PFOA 1X4HA 1U49A 4RW7B 3MHYA 3Q24A 4H4KA 3VVUA 3DFEA 1RCXB 1XTZA 3LGMA 2KHDA 4UW2A 2L9NA 1FDNA 5H1SV 3MMJA 1L3TA 3F41A 4L3KA 5BR8F 2N4DA 2AMCB 3M8RA 2YQ1A 3IRXA 3CD6S 4ILLA 5E7OB 2JFKA 3EVWA 4JI1J 5B0GA 3N6MA 3PR4A 4GMKA 3JSMB 5D4LA 2BJ8A 4M5GA 1F1BB 2B6AB 3EXCX 2WCXA 4OL8A 3RAMA 3I56S 2ASJA 2IBKA 2RKIB 2VFSA 2R2RA 1IBMF 2DR8A 1HWUA 3PCOB 1JLBA 4YR2A 5D77A 3DU5A 4KO0A 2DH9A 4NCGB 2K06A 3GV5B 2FJEB 4HDGA 1QJHA 2FVQA 4OZ3A 3BSCA 1Y10A 4ZPWR 2IM0A 3AA9A 1U6ZA 1HARA 1GFWB 1UWBA 1EQMA 4F50A 2HHUA 1YX2A 2Y8WA 2HQGA 3CJ0A 4NLXA 2BXJA 3FQLA 4DHVA 3JSBA 1JKHA 1T9WA 4DUYJ 1KLMB 1FEEA 4C8KA 4N47A 3OXGA 3T41A 2JLFA 2G2YA 2MHEA 3IWXA 1ZETA 3PHTA 3K5NA 1L5UA 1BUXA 1HMVA 2YWWA 4OHYA 5E3AA 1AUSL 3AD7C 4LSNA 2VPZB 3CMES 3MAAB 2K3IA 1GXTA 4KV8B 3AXMA 4USWA 3D1OA 1L3VA 1F0XA 3MGJA 3A12A 2ASLA 3G82A 4NPOA 1BMQB 3UCZP 1CJVA 3W9HA 1NSQA 2YKQA 3BGRB 4J9OA 4NLSA 4AT1B 3HVTB 1XIQA 4KGVB 2U2FA 3SQOP 2AQ4A 4PUOA 4YN3B 2D3OR 5KFPA 2OPQA 1Q8BA 1O0PA 2EK1A 4ECVA 2M70A 3T1YF 3KUGA 2DRAA 1PBAA 3J7Z5 2DHGA 1RA7A 3OFFA 5IC4B 3UNYA 1DLOA 2BE9B 5IZHA 2AJ0A 3SBMA 4IRKA 2VF3A 5C5JA 2K8GA 3M2VA 1BY9A 3NNHA 4ILMA 3QAEA 2HQIA 2I2YA 2WW8A 2J0QD 5D8HB 2H1YA 2YX7A 1D9FA 1IM6A 4MTPA 4O3RA 3IR5B 1K47A 2ZITA 4B3TF 1N5YA 1FRLA 1IBKF 3TAMB 1NKCA 2QA4G 4QPXA 2C2ZB 1U25A 2PO4A 3DOLB 3MD3A 2Q66A 2XC9A 5KFVA 2Y1IA 4Y6IA 3GG1A 1WC5A 1SV5A 1U02A 5K8PA 2APOA 3GTYX 1C0UA 2AEMA 2GO8A 4HTJA 4OHZA 3C15B 3EZOA 2LXIA 2MPUA 1S5ZA 4TN2A 1F5CA 3AT1B 2NXEA 2J8AA 2V4JB 1Q53A 3DOMA 5CQGA 5D6GA 4DV6J 2IVMA 2J9EA 3P45B 3OQ2A 4IDKB 1SQEA 4CM2A 1U24A 2P9CA 2WVFA 3HVWA 4JI1F 3MAQA 3MR5A 3PRVA 3T1AA 3KK3A 1S0MA 1U48A 1AFJA 3EZUA 4LIRA 3MM6A 2B5JA 1KQGB 4RUHA 1X4EA 3J7YU 3PO5A 4J9KA 3R5GA 4OJGA 2YKPA 3N01A 5KTQA 2XG8A 2Z30B 2YKNA 1VGYA 2BZ2A 4UQGA 2HQ3A 2CZ9A 2YWFA 3W9JA 2WHOA 1WACA 2HGLA 3UO0A 4HHJA 5LOQA 1V3RA 3VHQA 1MWQA 3CD0A 4QW9A 3GPAA 3D9BA 2ZBQA 4ZMMA 2DR5A 3Q89A 4DQSA 4DUYF 2JX2A 1E6YA 3MPVA 3TJAA 2V2VA 4IH6A 5DZ6A 4JI6J 5KFRA 3PIOQ 4A8YA 3K89A 3NAIA 3BZQA 4IOBA 4YB1P 4RNMA 3IS9A 3K8VA 3BQ1A 3TA1A 2DNQA 3GSDA 4C4WA 4A8FA 1K8AT 2R8HA 2I1RA 2X51A 4KGKA 3O3LA 1Q5VA 2NYHA 1HHTP 1FVSA 1H98A 3Q23A 3FEYB 2FTRA 5J1EB 2GHVC 1FKPB 4LQ9A 5J1PA 4ANCA 2DJWA 5LSRA 2OMOA 1S99A 4QU7A 1TL3A 2D3O1 1HFEL 5EUHA 5GADU 3L09A 1WC1A 5HP1B 1FERA 5DJBA 3EYZA 5C2GA 4F04B 3BGLA 4MKYA 3V6DA 1QAYA 3H20A 3QIPB 3GIJA 2YQ0A 3HMJG 1EB0A 1O5JA 5I3PA 1NM2A 2XZDB 2W4CA 3U7JA 2XO6A 3O6QA 4EEYA 2J76E 3KMQA 1TAUA 3GCWP 1RLDA 2KZMA 4OYMA 1FDBA 2H5JB 2W7OA 1QAIA 4OIXA 1ZOTA 1B0TA 4M5LA 5DDQC 3QWUA 1HNVA 3FMBA 2A2DA 3KXDA 4FXWA 3X3UA 3M05A 1RHJB 3DRSA 4ERDA 2R7OA 3DI6A 4EO8A 3I6PA 1W2IA 1OY8A 1JXEA 4NWBA 4IG0B 4QJVA 2IAJB 1FCAA 3DMJB 2WBRA 2V94A
chains in the Genus database with same CATH topology
4M5KA 2QX0A 3HSZA 3HSGA 3ILIA 5ETVA 3HSJA 5ETKA 5ETQA 1TMJA 4M5MA 1HQ2A 3HT0A 4M5JA 1RAOA 3UD5A 5ETTA 5ETOA 3ILOA 3HSDA 4CYUB 3HD1A 3MCMA 2BMBA 1KBRA 4CYUA 1RU1A 3KUHA 3HCXA 4M5IA 1RTZA 5ETNA 4CWBA 4M5NA 1Q0NA 3MCOA 3ILJA 4M5HA 1RU2A 1EQ0A 1EX8A 2F65A 3KUEA 5ETLA 3KUGA 5ETMA 1CBKA 1G4CA 5ETRA 4M5LA 2F63A 3UDEA 4PZVA 1RB0A 4AD6A 3HD2A 1EQMA 5ETSA 3ILLA 1F9HA 1HKAA 1DY3A 3MCNA 3QBCA 2CG8A 4M5GA 5ETPA 4F7VA 3UDVA 1TMMA 3IP0A 4CRJA 1IM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5K A;  2QX0 A;  3HSZ A;  3HSG A;  3ILI A;  5ETV A;  3HSJ A;  5ETK A;  5ETQ A;  1TMJ A;  4M5M A;  1HQ2 A;  3HT0 A;  4M5J A;  1RAO A;  3UD5 A;  5ETT A;  5ETO A;  3ILO A;  3HSD A;  4CYU B;  3HD1 A;  3MCM A;  2BMB A;  1KBR A;  4CYU A;  1RU1 A;  3KUH A;  3HCX A;  4M5I A;  1RTZ A;  5ETN A;  4CWB A;  4M5N A;  1Q0N A;  3MCO A;  3ILJ A;  4M5H A;  1RU2 A;  1EQ0 A;  1EX8 A;  2F65 A;  3KUE A;  5ETL A;  3KUG A;  5ETM A;  1CBK A;  1G4C A;  5ETR A;  4M5L A;  2F63 A;  3UDE A;  4PZV A;  1RB0 A;  4AD6 A;  3HD2 A;  1EQM A;  5ETS A;  3ILL A;  1F9H A;  1HKA A;  1DY3 A;  3MCN A;  3QBC A;  2CG8 A;  4M5G A;  5ETP A;  4F7V A;  3UDV A;  1TMM A;  3IP0 A;  4CRJ A;  1IM6 A; 
#chains in the Genus database with same CATH topology
 4DV6 F;  2VH7 A;  4UQT A;  4OV1 A;  4DR5 J;  5C42 B;  3V81 B;  1WHV A;  1TKX A;  3W61 A;  4XDC A;  2JZ5 A;  1LW2 A;  3RRH A;  1VJW A;  1HWI A;  1RBL A;  1Y9O A;  4ZIW A;  4NLU A;  5KG7 A;  4M8L A;  3FC9 A;  2N82 B;  2HFZ A;  5HJX A;  1BQN B;  3I4P A;  3QYY A;  2RS2 A;  2XM3 A;  4ZCK A;  3KLG B;  3DN9 A;  4E2F B;  1MG7 A;  1TKT A;  1RA6 A;  4W92 B;  3ENA A;  2UXD J;  3DGP B;  3SCI E;  3ZC4 A;  3D2W A;  3U27 A;  3CC7 S;  2KXH A;  1DRZ A;  2CNL B;  5H9F K;  2H51 B;  2B9E A;  3CUN A;  1R8H A;  1D3W A;  2FD2 A;  2JEG A;  1LWC B;  3P49 B;  2R2U A;  4WFN Q;  3F0N A;  2MGZ B;  3OHB A;  2VQF J;  4AL7 A;  4NLQ A;  3D28 A;  4JI6 F;  2D69 A;  3V6K A;  5CZV A;  4IOC Q;  1KHV A;  1UEU A;  1X9M A;  2J8S A;  3TZY A;  5GMK a;  1LXN A;  1PCA A;  5DLF A;  5D3G A;  1AUD A;  3BYR A;  1J2V A;  3SCK E;  4QIE A;  2GX8 A;  3TVY A;  5L1L A;  4PXD A;  1W2B R;  2GFF A;  5LJ3 Y;  4OX6 A;  1C1C B;  4TNO A;  5HRO B;  1KKH A;  3R5C A;  1NK4 A;  3PAC A;  1CSJ A;  1Q95 G;  1HWK A;  4X65 J;  1Q8K A;  3C16 A;  1K1S A;  1N6Q A;  4WWS A;  1CEZ A;  3UQS A;  3LH2 S;  1IJF B;  1F5A A;  3CJQ A;  3OFG A;  2YH1 A;  2H9Z A;  2FPH X;  1GEH A;  1UKU A;  1T7P A;  3ILL A;  2IMW P;  4DL5 A;  2ASY A;  1MMN A;  2NXU A;  1TL7 B;  3Q8Q B;  1RTI A;  1FI4 A;  4B3R J;  2KH9 A;  5T7L B;  3UD5 A;  1D9A A;  3VAL A;  1YJU A;  2XY6 A;  3CCR S;  5CYM B;  3OTD A;  2RQM A;  5KFX A;  1RT3 A;  4F26 A;  4DSJ A;  1HBN B;  3EDR B;  4M5M A;  1Q7L B;  2GCF A;  1C1B B;  3IBW A;  3FFI B;  3MCM A;  2CYY A;  1UAW A;  1GAO A;  2HFU A;  3M1V A;  2QMW A;  4O44 B;  1EHW A;  2XTJ P;  5IOL A;  2O1P A;  2D9O A;  3LAM A;  4LF8 J;  4CO2 A;  2ZNY A;  2D9P A;  1JLQ B;  2VV5 A;  3CED A;  2HRY A;  4B9V A;  1RWW B;  3I96 A;  4DL2 A;  3W65 A;  2FHO B;  2LP4 A;  2MZQ A;  2J7W A;  4RBU A;  2OP5 A;  2AKW B;  1AYE A;  3MEG B;  2KYZ A;  3RAQ A;  4DPW A;  4NRU A;  3DM2 B;  5GAE U;  4U96 A;  3MF5 A;  2ERR A;  2YX1 A;  1LKZ A;  2RE1 A;  1HBU A;  3LGH A;  3FGV A;  3P96 A;  4QIG A;  3LUY A;  2OIH A;  4DV2 J;  2R8I A;  1Q79 A;  1UMJ A;  4U67 Q;  3CE8 A;  4DR5 F;  2FVP A;  4DSF A;  1Y5I B;  4KFB B;  4O4R A;  1CS4 A;  2ILY A;  3C19 A;  1H38 A;  4K8R A;  4ETX A;  4IOA Q;  1NSP A;  3EDQ B;  3HHN B;  4J9S A;  2JNJ A;  1CJK A;  2ZBR A;  3PW2 A;  4QYZ K;  4PAB A;  4DFK A;  5KG1 A;  4WU2 A;  5I42 A;  3M30 A;  1M1G A;  4G1Q B;  3H7H B;  2AHO B;  3OW2 R;  2ZE2 B;  3M9M B;  4TLR A;  2OD6 A;  1XR6 A;  4DX6 A;  3LP0 B;  4X4T A;  4LQ3 A;  1TL1 A;  5ADZ A;  3ZTO A;  2XBP A;  2UXD F;  5KFZ A;  1TFY A;  4O0I A;  3J7Z T;  4DX7 A;  5KAK A;  1EP4 A;  2XSJ A;  1EET A;  2KFY A;  4JOU A;  2W9A A;  3R6L B;  1H73 A;  1GMW A;  4MIA A;  1FJ7 A;  4NZ0 A;  2BKO A;  5LXR A;  3OT9 A;  5B0F A;  4Y0F A;  1SIZ A;  2OPP A;  2VQF F;  4R5P A;  2RVJ A;  2DRB A;  4M95 A;  4OX9 J;  3GR1 A;  3IRX B;  2MQQ A;  1ZPW X;  2ZEJ A;  4WXO A;  4ER8 A;  4BLG A;  3W2V A;  3GIM A;  2BMB A;  1TL5 A;  5HMZ A;  3RB0 A;  1SC1 B;  2DBB A;  2GJ2 A;  3GQC A;  3KHL A;  2D41 A;  3TJ8 A;  1FNX H;  1J27 A;  5KFO A;  3SI8 A;  3SQG B;  1NND A;  3OL8 A;  3FRY A;  4X65 F;  2V8H A;  4KO0 B;  2DGV A;  2V8P A;  2BBE A;  3BKF A;  4X62 J;  3IG1 A;  2Y9H A;  5KFF A;  2CJY B;  1UVL A;  3O1L A;  4ZVT B;  1VBK A;  2P9E A;  5DGA A;  3CUL A;  3NGU A;  4WJB A;  1Y00 A;  4B3R F;  5K8N A;  1S48 A;  4PPZ A;  4DOZ A;  3VAK A;  3HHL A;  3HM9 A;  4EBE A;  2HNZ A;  3ZFV A;  2UXC J;  1B4S A;  4AD6 A;  1T9X A;  2CFX A;  3TA2 A;  1S1X A;  1Q7Y T;  2MDA A;  4QW8 A;  3HZG A;  1HMV B;  1Z2L A;  3K7R A;  1TK8 A;  4LSN B;  1RAE B;  1K73 T;  1OS5 A;  4LF8 F;  5E2Q A;  1VK3 A;  4LMZ A;  4XPE A;  1GT8 A;  5DRK A;  4S0M A;  3AJD A;  3CSK A;  4KKO B;  2VHG A;  3Q22 A;  3BM7 A;  5EWF A;  2DNK A;  1HQU B;  1O8B A;  1X5P A;  2DHX A;  4LR9 A;  5GMD A;  3DHX A;  3POT B;  5T41 A;  4OZ5 A;  3UPF A;  3VAF A;  2Z58 B;  4DV0 J;  3MWB A;  1HNZ J;  2KB2 A;  3PX6 A;  3W7B A;  2R8J A;  4U7U D;  2BA9 A;  2KL8 A;  4KR0 B;  3OD2 A;  1NJX A;  1DLO B;  3OXF A;  2HWT A;  3WDO A;  2WON B;  1RSC A;  2XSF A;  3V6H A;  2V69 A;  3LWL A;  5IC6 B;  1FHT A;  5D4P A;  2MLZ A;  3R97 A;  3Q2T C;  3JQJ A;  1F9F A;  1VDH A;  4ZLP A;  3SV4 A;  1X7V A;  4F2S A;  1JJC B;  1G3O A;  1N5Y B;  2U1A A;  3HJF A;  3OJS A;  2H3E B;  2ZWP A;  2EW9 A;  2CDQ A;  1RXO B;  1HR0 J;  1QE1 B;  2XLK A;  4WIQ A;  3PV8 A;  2AX0 A;  5IS2 A;  2JFD A;  2B8P A;  1VJQ A;  3ISZ A;  3DHW C;  1F3V A;  1B0P A;  5FDL A;  5J2P B;  4LF4 J;  1H2V Z;  4TYA A;  1C0U B;  1N88 A;  4DV5 J;  4P72 A;  3NOG A;  2PEB A;  5EX0 A;  5F3T A;  2W2Q P;  2KTQ A;  5H9E K;  1YJT A;  3DOM B;  2X1B A;  3WC0 A;  2LFV A;  2CWK A;  1LWF A;  3M6X A;  2P2C B;  5A8W A;  4PEO A;  5E41 A;  1YI2 S;  1WJ9 A;  2P6S A;  3PW0 A;  1M0S A;  3CTR A;  3NCP A;  2BDP A;  1S0V A;  4DZ6 A;  3KK3 B;  3MM6 B;  1PAE X;  2B5J B;  3A3N B;  4TLQ A;  3FSX A;  1SBR A;  5D0E A;  3QJJ A;  2E5J A;  4RUB A;  3I9V 9;  2H48 B;  2Y1J A;  1BQM B;  2ZH7 A;  4RBT A;  3JSY A;  5KFH A;  1ULR A;  3K2Y A;  2YKN B;  4FYD A;  4H4K C;  3MCO A;  4X62 F;  1RT4 A;  5JMN A;  1QY7 A;  3TVZ A;  2W2N P;  2R7T A;  3W63 A;  4LFA J;  1KVI A;  2AF6 A;  2BE7 D;  3H5S A;  1FKO B;  5CCL A;  3RBZ A;  1ZM4 A;  3K5L A;  2VIC A;  1KVJ A;  3UNG C;  2CZV C;  1UJ4 A;  2YNI B;  1NXI A;  2R7S A;  4V19 J;  4I7F A;  3HPO A;  1GQE A;  2ZH9 A;  2LQB A;  4F4W A;  4MK8 A;  4WP8 A;  3MEK A;  3HSG A;  5DDR C;  3WZ0 A;  4DU8 A;  2HNY A;  1HHS A;  2UXC F;  1NDK A;  3S6E A;  1N32 J;  2VC0 A;  2J9D E;  4CIO A;  2W4D A;  3CJ3 A;  3KJN B;  4F7V A;  3IS9 B;  2PT0 A;  1C2P A;  1HIY A;  4C8N A;  1S9F A;  2E1P A;  1NHK L;  2Q6C A;  4W98 A;  1RTD A;  1XR7 A;  1K0T A;  1YRU A;  1YGY A;  2CUY A;  3A1Y G;  1VQK S;  4RW4 B;  1U7L A;  5AE2 A;  4K4T A;  5ITH A;  4NLP A;  4UOF A;  5C7P A;  5JJB A;  2QZ8 A;  2CG4 A;  4DN0 A;  5DO2 A;  1S4F A;  1SC6 A;  4DV0 F;  1TP7 A;  2ZH8 A;  1HNZ F;  3A8E A;  2JH3 A;  3G4S S;  1TL3 B;  3AOB A;  3C6T A;  4I2P A;  2V34 A;  4QYZ J;  3KHH A;  4DUZ J;  2N7Y A;  2RIL A;  1WHY A;  4CM0 A;  3HK2 A;  1BQX A;  4C0O C;  2MKH A;  4F8R A;  2CRL A;  1U0H A;  3HP6 A;  3E51 A;  4LVN P;  4CI0 B;  2ZD1 A;  2PII A;  2L3M A;  5LT5 A;  2NYI A;  2OEM A;  3Q8V A;  1C0T A;  3TEH B;  3R7N B;  2M7S A;  1NK7 A;  2GAG C;  4JI8 J;  3MEE A;  4QOT A;  1JWW A;  5HAO A;  4M5N A;  3TR5 A;  1S77 D;  1APS A;  3NNC A;  4PXE A;  4KC5 A;  2JRS A;  1AZS A;  3I5A A;  4FF2 A;  2JSX A;  4WXW A;  3D3C J;  1IKX A;  1HR0 F;  4K4Z A;  4Y2I A;  1AW0 A;  3LQV A;  1HNV B;  2VDI A;  2DHA A;  4ZHR B;  2RML A;  2CPX A;  4LF4 F;  2W8L A;  4N8O A;  3DRS B;  2X7I A;  4IFV A;  2OTJ S;  3SDE B;  4DV5 F;  1FTR A;  3HLU A;  3DI6 B;  2B9X A;  2BOA A;  4P73 A;  4EZ9 A;  1J5O A;  2HMI A;  3CMQ A;  3KK1 A;  3B8H A;  4F36 A;  3MMB A;  2XWY A;  1RWM B;  1RHM B;  4DR3 J;  1TKX B;  3IC1 A;  4C98 A;  1UL3 A;  4W90 B;  3M6U A;  4NLD A;  1KTQ A;  3VZH A;  3B82 A;  5DG8 A;  3ZZO A;  3LAL A;  4BS2 A;  2VQE J;  3TP2 A;  3PO4 A;  1LW2 B;  4J9M A;  2YWH A;  5CXT A;  4F3M A;  3C2P A;  2NR0 A;  3GP9 A;  4CO1 A;  4P2M A;  3A3P B;  1FWL A;  1KOH A;  1Y3J A;  1PO6 A;  6AT1 B;  1FRJ A;  4DR6 J;  4DDF A;  2DNN A;  2A6O A;  4FYY B;  2DVI A;  3K8W A;  2VKZ G;  3BSN A;  4RNO A;  2GQQ A;  4C8M A;  4LT6 A;  4LFA F;  5F8N A;  4NLY A;  4PAA A;  1RIS A;  2YY3 A;  3N9U C;  1IM4 A;  2G2Z A;  2XLI A;  4OI6 A;  2BE2 B;  3IWN C;  3NBP A;  3R5J B;  2P9G A;  2BJD A;  4KH1 B;  1V5V A;  2FY8 A;  4BC9 A;  1WUU A;  4B3M J;  5J2N A;  2GHP A;  4F25 A;  5D4N A;  4K4X A;  5ETR A;  3KLE B;  4PZV A;  2H54 B;  3MPD A;  3PRB A;  1N32 F;  4B17 A;  4UT4 A;  1RAD B;  2RQK A;  2DPJ A;  4TU7 A;  2D3U A;  1S9G B;  1RAF B;  3IR6 B;  1FWK A;  3NGS A;  5D3G B;  3MXH P;  2CQG A;  1Y5N B;  2C3U A;  3D66 A;  3OPK A;  1RQ0 A;  5A6W A;  5E3Q A;  1REV A;  1LXJ A;  2IC3 A;  4C8L A;  3OXL A;  5GAH I;  5IT9 Y;  3CCT A;  4X64 J;  3JYT A;  2FLL A;  4HAC A;  3Q0A A;  3BRE A;  2X3D A;  2O67 A;  3DYA A;  3CDB A;  2BUN A;  2BQ3 A;  2BEF A;  3C16 B;  2W9C B;  2D1C A;  1CJU A;  4YEA A;  2RB7 A;  1SH0 A;  1VQ9 S;  4ID5 A;  3UR3 C;  4CP5 A;  1IWA A;  2ZJQ Q;  4DUZ F;  3LOU A;  1ZA2 B;  1FX4 A;  3M4X A;  4HI2 A;  3JQM A;  4NZ6 A;  2VDH A;  3GZ7 A;  3HVR A;  2ZHA A;  3M8Z A;  4NCA A;  2FZG B;  2NPI A;  2QE5 A;  5L39 A;  7FDR A;  4JI8 F;  3DLK A;  3GYG A;  3AA8 A;  3OR1 A;  1R0A A;  2ZOM A;  3M1V B;  1NHV A;  4DG1 A;  4O3S A;  1A6L A;  3GV7 B;  4P2F A;  2UVW A;  2LEA A;  1VRT B;  2M5Y A;  1JLE A;  1YZ6 A;  2QA1 A;  5G4D A;  1EZZ B;  3ET6 A;  2ZBP A;  2HVE A;  2CAJ A;  1N0U A;  2DPI A;  4JB8 B;  1VFJ A;  2I5J B;  3G6V A;  4K7Q A;  3QSI A;  1UA1 A;  3NLC A;  3H8Y A;  1UZH A;  1RE1 B;  2BW7 A;  3T9Z A;  3A4T A;  4IQX A;  3VAI A;  2Z2M A;  2HIQ A;  3DLL Q;  1U1O A;  1I94 J;  4RZR A;  4DR3 F;  3BDP A;  1RGV A;  1KRP A;  3TAQ A;  1OIA A;  1CS4 B;  4CLP A;  2QX0 A;  5KFC A;  2KM8 B;  2FGC A;  5IT9 U;  1PJ6 A;  4NYP A;  3UD3 P;  1CJK B;  3IMQ J;  2VQE F;  4FKY A;  2CQ4 A;  2G0I A;  1FK9 A;  5I42 B;  3QZ8 A;  3TI0 A;  3TX8 A;  3FVY A;  1KD1 T;  2HRU A;  2HFN A;  2YXL A;  5LSL A;  1XBW A;  1OO0 B;  5L9X A;  1IBL J;  4DR6 F;  1NUE A;  1SJQ A;  4RW7 A;  1Y4Z B;  1RAB B;  1FE0 A;  2GGP A;  2KRR A;  1CC7 A;  1DFD A;  2WB4 A;  2HW3 A;  3FBC A;  3NRB A;  4EYH B;  2GV1 A;  2RDJ A;  1FTC A;  1ZH5 A;  2AYM A;  3SSR A;  1VQP S;  1NME B;  1H7X A;  4PXB A;  3MFI A;  2JEF A;  1U2F A;  5CYQ A;  2KG0 A;  2E9T A;  4B3M F;  2BJ3 A;  2MY8 A;  1RAH B;  1OY9 A;  4DBQ A;  1YSJ A;  2OPP B;  4QBU A;  4R5P B;  2Y3Y A;  2XY7 A;  2ZDP A;  4LBH A;  1S57 A;  1EJ7 L;  1NK5 A;  3M2U A;  4QIF A;  2O66 A;  3TZX A;  3EMT A;  4YP3 A;  3BR9 A;  2B6A A;  4MAK A;  3TA0 A;  3H40 A;  2FUG 9;  4HI1 A;  2JJ4 D;  4KJI A;  2H5I B;  4EGL A;  1VQ4 S;  2MXY A;  4NE9 C;  3B54 A;  4XTT A;  3BKT A;  4YFU A;  3UR0 A;  3ULH A;  3MR2 A;  1X0P A;  2AJ4 A;  4X64 F;  4NCG A;  3OSN A;  4ZKA A;  2JLE A;  1V9O A;  2BRL A;  2NPF A;  1GX5 A;  4WPA A;  5K8M A;  3GFZ A;  4NYO A;  5LXY A;  1SKW A;  1NH7 A;  2OAU A;  2BAB A;  1CUL B;  3W9I A;  2C22 A;  2K3K A;  1XK8 A;  1ARO P;  4DL7 A;  1Z2Z A;  1M90 T;  4L76 A;  4UZC A;  5MAO A;  5LMN J;  1RT6 A;  1JLF B;  2CQ2 A;  2EPI A;  1NHU A;  1URN A;  4NA1 A;  2LXU A;  1VHF A;  1I3O B;  3H25 A;  1MML A;  3JXO A;  3W60 A;  5EHH A;  2EG1 A;  3W2W A;  4Q2M A;  4CTA A;  4KV8 A;  1NDL A;  3KNA A;  1S1X B;  3FEZ A;  4OI4 A;  2WVB A;  4QWB A;  1KP6 A;  3BPD A;  1OSD A;  2MSS A;  5CHC B;  5F8H A;  2IA6 A;  4M5D A;  3KDN A;  4CDI A;  2DNZ A;  4F4K A;  2VC1 A;  3DGV A;  1NPP A;  3BGR A;  2XHC A;  1UPM B;  4PXC A;  4FVM A;  2F7V A;  1CQN A;  1X8D A;  2JEI A;  5HLF A;  1SJ1 A;  2NZC A;  2EG2 A;  5AXK A;  4MMO A;  3BKU A;  3EUN A;  4EZ6 A;  3F44 A;  2VPX B;  2W2O P;  4LRF A;  4M94 A;  1DBD A;  4CCH A;  5HJY A;  2F4V J;  2EFG A;  2QLX A;  4MYU A;  1IN0 A;  3T19 A;  4FBT A;  3ZZ0 A;  1KNZ A;  1I94 F;  3KLH A;  2ZH1 A;  3KK2 A;  3CDW A;  2QTW A;  1HYS B;  3NOC A;  3MCN A;  4FKX A;  1SC3 B;  3OV7 A;  5L1I A;  3ENV A;  2HVH A;  4G1I A;  2C28 A;  2OEL A;  2B3T B;  3KFW X;  2XY5 A;  3I82 A;  3IBF B;  4Y2A A;  3R9L A;  1WKK A;  3QT6 A;  1RWX B;  3TAM A;  2BVZ A;  3M8Q B;  4JV5 J;  2MLY A;  1LQ9 A;  3CCZ A;  1RBO B;  4D3H A;  1IBL F;  4UY8 5;  3B4D A;  3HT0 A;  2YTC A;  2MQN A;  1AXQ A;  4J37 A;  2VB6 A;  5KOX A;  3C15 A;  3H4D A;  1N5S A;  4PG6 A;  5FDL B;  1DUR A;  1RWK B;  2IVY A;  1UEK A;  5DQH A;  2IYI A;  5HAN A;  2Q43 A;  2XHW A;  4IDK A;  1RAJ A;  4WKY A;  3PEJ A;  1PBU A;  3AAW B;  4ED0 A;  3CCW A;  4PG4 A;  3K57 A;  1LWF B;  3N6N A;  1DAX A;  1SKR A;  1NJY A;  3IO1 A;  4KHP J;  5HMW A;  5A8W B;  3OR2 B;  3JSR A;  4Q45 A;  3G96 A;  4DN9 A;  3WBZ A;  2LEB A;  3BEG B;  2MKK A;  2QG9 B;  4XDD A;  3DXB A;  2L9D A;  2VZ9 A;  4USK A;  1D09 B;  4G65 A;  3RU0 A;  5CCM A;  5M2P A;  1T11 A;  4EWT A;  2MJN A;  2YVS A;  1SJR A;  1T03 B;  1RWP B;  3W5Y A;  3ENQ A;  4C0B A;  2XUL A;  1H0H B;  2EFV A;  2Y1R I;  3PYG A;  4ZLL A;  1RTH B;  1XR5 A;  2J5A A;  4X2B A;  1X4C A;  5KFU A;  4X4R A;  2KYX A;  1XJW B;  1JMT A;  4IFY A;  4J91 A;  2B9W A;  4OHW A;  1U45 A;  3BDE A;  2UZA A;  1NSA A;  2B4O A;  2QL9 B;  5LMN F;  5C25 B;  5ETK A;  4AL6 A;  4GVB A;  1WI8 A;  2QLJ B;  2VFU A;  2QFI A;  4I7F B;  1ZM9 A;  4UZB A;  1HD1 A;  4OZ1 A;  2HNY B;  3UDC A;  4WII A;  1MLA A;  3N28 A;  3CCL S;  1Y11 A;  2FVC A;  2QLF B;  2E7W A;  2AT1 B;  3MPY A;  4FXV A;  1GXU A;  4V19 X;  2QLB B;  3PJW A;  4QYR A;  2W7P A;  3VGT A;  2NXN A;  3QLH B;  3PHE A;  1S6U A;  1RTD B;  4ED5 A;  2EBE A;  2FHJ D;  3IWL A;  2DXD A;  5KFG A;  3MPU B;  4ZK7 M;  4DFP A;  2Z2Z A;  4C3L A;  4ZCI A;  1R27 B;  1FKP A;  3R5B A;  2CPH A;  3PYD A;  2MQM A;  4EBD A;  1JNZ B;  3NY0 A;  2XMU A;  3JTO A;  2EKN A;  1KFD A;  2F4V F;  3G71 S;  3L9Z A;  1VBX A;  4LRB A;  3FRZ A;  3T6J A;  3QZ7 A;  1KLN A;  4CLS A;  4ENO A;  5I3U B;  1MWZ A;  4AE5 A;  3HO1 A;  3CDE A;  3D0I E;  1UFW A;  2RDI A;  1HA1 A;  2HHH J;  5KFJ A;  4A4J A;  2MZ1 A;  3T5H A;  1UZD A;  1U0H B;  2ZD1 B;  4JI2 J;  2RIJ A;  1VMB A;  2AEF A;  4O3N A;  4P2X A;  3P5T L;  3U1L A;  4CRJ A;  4OI2 A;  2Z2Y B;  2HUR A;  2YNF B;  4WFZ A;  1RAG B;  2HEK A;  1IKV A;  2PGC A;  2NXJ A;  1YWX A;  2QFJ A;  3MEE B;  3P5B P;  3KLF B;  4LFB J;  3C6U B;  4JV5 F;  3MPW A;  4J9U E;  4DJB A;  3FMW A;  1WEL A;  1AZS B;  3CIM A;  5FII A;  3KLI B;  3H2L A;  2UU9 J;  2HHP A;  4AND A;  2DD8 S;  2UV8 A;  3BO3 A;  2Z0G A;  2QL7 B;  2QYG A;  2DXE A;  4GKJ J;  4IG0 A;  1QSS A;  2IAJ A;  4IFV B;  4KHR A;  1WSR A;  5HBM B;  5IM0 B;  1KQS R;  2XS2 A;  3K0J A;  1VQ5 S;  3GFH A;  4AL5 A;  1HLW A;  1H7W A;  5MLC V;  1BC6 A;  2WTF A;  2HMI B;  3T5J A;  3P8B B;  2BW2 A;  2O5D A;  2R8K A;  2KXF A;  3MDF A;  5IQ6 A;  3MMB B;  1IUJ A;  5HAT A;  4KHP F;  1G1X A;  1BLU A;  4NML A;  2HIY A;  3LPE A;  2UVU A;  2OGU A;  3MZI A;  1BQN A;  3OLA A;  3GJS B;  4QWA A;  3I32 A;  4WBF A;  3I9Z A;  4N76 A;  4FDF A;  2CWX A;  2BR0 A;  3AOC A;  3Q83 A;  1P1L A;  2ZOG A;  3CW2 C;  1G4C A;  2RU3 A;  3QMQ A;  2WAQ D;  2ZH6 A;  3GIK A;  2E7X A;  5EX3 A;  4F4A A;  3PX0 A;  5U47 A;  1RAC B;  4GO7 X;  3EGW B;  1LWC A;  4P52 A;  4C8Z A;  2MGZ A;  1RWO B;  1IKW B;  4CLU A;  3MEC A;  4P7V A;  5KFM A;  1N5T A;  3NBP B;  4DPO A;  1FDA A;  1VIS A;  3TQE A;  3JQK A;  5KFA A;  1ZBT A;  4ED4 A;  4B9S A;  4R0E A;  2ALY B;  4XAK A;  5BYS A;  1RP5 A;  3IFE A;  3AJ1 A;  2XO7 A;  3D1Q A;  2XYG B;  5LSO A;  4GC7 A;  3I31 A;  4I69 A;  2NXC A;  5B0C A;  1VBZ A;  2IVF B;  1V3Z A;  5KG4 A;  3CPW R;  2CPZ A;  3DRP A;  5HO4 A;  4DSL A;  4HHH A;  1GH8 A;  2V2Z A;  3H5U A;  2MEW A;  4OYB A;  2J6U A;  2R4F A;  1MMD A;  2K2P A;  4O4G A;  4N56 A;  2HVD A;  5LL6 d;  3ADA C;  1JJ4 A;  1SB6 A;  3QRQ A;  3JYT B;  4X4Q A;  3IM8 A;  4NRT A;  5ETL A;  3HD2 A;  2VBY A;  3QFH A;  4DLE A;  1CJU B;  3O44 A;  2OHD A;  8RUC A;  1S12 A;  4HEA 9;  5T7L A;  1ZM3 A;  4DV4 J;  2C2K B;  1SC4 B;  5CYM A;  2F8E X;  2RHS B;  2ADB A;  2HHH F;  3GFX A;  1XER A;  1P9Y A;  4JI2 F;  2RS8 A;  2C2O B;  3ILO A;  3RG6 A;  2IJN A;  3FFI A;  2KFZ A;  3NWG A;  4DV7 J;  1QUP A;  4U8Y A;  3LP2 B;  3A13 A;  2DGT A;  3R2C J;  3DLK B;  1H6K X;  3A8J A;  3OR1 B;  1R0A B;  1VRQ C;  1D8Z A;  4RO0 A;  4LFB F;  2ZZT A;  2P5V A;  4DG1 B;  2YX4 A;  1YLX A;  3W8P A;  2QSF A;  2UU9 F;  4YHH F;  1WF0 A;  1FRK A;  1JLE B;  3LA0 A;  1MNE A;  3R2D J;  4I6Y A;  3NS6 A;  2M52 A;  3GON A;  3DM2 A;  3GII A;  2Z2L A;  2DGQ A;  2D7S A;  2D3Z A;  1MU2 B;  4QR0 A;  2ZKU A;  3DRR A;  4A8X A;  4GKJ F;  4K4V A;  2E5L J;  1ZPV A;  3B78 A;  3CXC R;  1Y3K A;  4KFB A;  1H2T Z;  2PA3 A;  5F0U A;  5KG3 A;  2BRK A;  2VPY B;  4Q43 A;  2HHX A;  1XQI A;  1HQE A;  1O6X A;  4J7C A;  4XO0 A;  4DCP B;  3A8K A;  5KFS A;  3FCH A;  4XK8 C;  1V6H A;  2DGW A;  1RK8 A;  1J5E J;  2VG5 A;  4G1Q A;  5KFB A;  4NLT A;  1KFS A;  3D6F B;  3PZP A;  2JEJ A;  1ITP A;  4TQS A;  1X4F A;  2UUA J;  4KT0 C;  1I5O B;  1RWV B;  2EK6 A;  3CJK B;  3FBB A;  1MRO B;  3L95 X;  3HHE A;  5F0W A;  1HQ2 A;  1HNW J;  4CH1 A;  4J5O A;  2GW8 A;  3HX9 A;  2DK2 A;  2L41 A;  1KR4 A;  3S1T A;  2GMH A;  1NJI T;  2CXE A;  1S7I A;  4LFC J;  1WF1 A;  5KT2 A;  2J6S A;  2PN6 A;  2GGP B;  5BYQ A;  3SXL A;  3MM7 B;  2W01 A;  3SEO A;  2EFQ A;  2UVR A;  5CD4 A;  3HUL A;  5CYQ B;  1CG2 A;  1F2G A;  4PQU A;  2LEP A;  1T3N A;  2OO4 A;  2IJR A;  4CT9 A;  3DKD A;  1YJN S;  3RBD A;  5AJ3 J;  1U6B A;  4IG3 A;  3BS9 A;  3M2U B;  4YS2 A;  1LK5 A;  2RUG A;  1YRT A;  2DO4 A;  4A8W A;  5LJ5 Y;  4ED6 A;  1D0E A;  2YKA A;  2CA9 A;  1BGX T;  2WB1 D;  4K4U A;  3TJ9 A;  1Z1Z A;  1VBY A;  3SQG A;  2V63 A;  4ZPC A;  2OPR A;  2V50 A;  1YJV A;  4Y00 A;  3FKB A;  1CLF A;  4JV1 A;  2JC1 A;  1HKA A;  3NS5 A;  1L3S A;  4RBV A;  4BBY A;  1LW0 A;  4NXM J;  3NL0 A;  2CNK B;  5IT4 A;  4ZOS A;  1FXD A;  4USV A;  1GK8 A;  5KG0 A;  1SUQ A;  4DV4 F;  4B3O B;  3MM8 A;  4AUK A;  2VIH A;  1RT6 B;  2EKY A;  4ZVF A;  2C2N A;  5CH7 B;  3CJ8 A;  4CO4 A;  3H5X A;  4USJ C;  2DR7 A;  4OYX A;  1U1K A;  2QA4 S;  1NJW A;  5GAH U;  3GG0 A;  2XYP B;  3RUB L;  3QRP A;  2QEX S;  3DLG B;  2AYE A;  4JUZ A;  2HVI A;  3OTO J;  1WD6 A;  3UDE A;  1V3S A;  1NK6 A;  4ILR A;  3W2W B;  1TMJ A;  4Z37 A;  4CTA B;  1T05 A;  2WSC C;  3BN4 A;  4H4O A;  4WFX A;  4WF9 Q;  1UVI A;  1F2H A;  4OX7 A;  5HK4 A;  4WFB Q;  2F9D A;  2HQC A;  4M5D B;  4IKA A;  4KQZ A;  4KKO A;  2KRB A;  2V4R A;  3OJU A;  4AQY J;  3HHD A;  1HQU A;  2DGX A;  3CJS A;  5L46 A;  5KT5 A;  2HPU A;  3POT A;  1MW7 A;  2MZS A;  2RF2 B;  4I2Q A;  4MIW A;  4R8U B;  1A0O B;  5HLF B;  2UUB J;  3QAT A;  2E5L F;  2B4P A;  1SVD A;  2WZ1 A;  5HQM A;  4ECU A;  4CNY A;  1PAU B;  2LYV A;  1C4A A;  4PCQ A;  2WON A;  3BPS P;  8AT1 B;  2VPW B;  2XMM A;  4FNH A;  3US5 A;  3M8S A;  3KHG A;  3KLH B;  4USM A;  2FJB B;  3KK2 B;  3K17 A;  3A8I A;  2LQJ A;  1J5E F;  4LF5 J;  1FKA F;  1VR6 A;  5EWE A;  3VWS A;  4GVL A;  3KJQ B;  3WIU A;  2UUA F;  3UCG A;  2X1G A;  4PG5 A;  5HN0 A;  4ED7 A;  3D1H A;  4PWD A;  5ETN A;  2MKY A;  4ZP8 A;  1NEE A;  4P75 A;  1F3F A;  2WSE C;  3KDO A;  1QE1 A;  3IM9 A;  3JB9 k;  1KOO A;  4DXL A;  4J9V A;  3NXZ A;  2YNH B;  4I1T A;  2DR9 A;  3EM1 A;  2JL9 A;  3PR5 B;  5J2P A;  1S1T B;  2A3J A;  4LFC F;  5HVF A;  2G0C A;  5KFN A;  2SXL A;  1YJW S;  4HHU A;  5KOW A;  2YPY A;  2BQU A;  5KT7 A;  3F56 A;  1RWN B;  2CQD A;  2FJV A;  2HBR B;  4WTO B;  3PXG a;  4DX5 A;  4JP8 A;  2DB1 A;  3BQ0 A;  1M1H A;  4CH7 A;  3CC4 S;  2CG8 A;  3NMR A;  2IA0 A;  2P6T A;  1LEO A;  3DNC A;  5AJ3 F;  1ZYQ A;  1OYD A;  1TAQ A;  3OLB A;  2YH0 A;  2I38 A;  1GXL A;  4M5I A;  1D8Y A;  2LKZ A;  1UVJ A;  2J7K A;  3L7O A;  4P2S A;  4WFA Q;  2R7X A;  2VL1 A;  3UE2 A;  2I8E A;  2A10 A;  3MUT P;  1BQM A;  1VHI A;  2Q79 A;  4LR7 A;  4CQ1 A;  3RBE A;  4P10 A;  4C0H A;  5DDO C;  4KBI A;  3PJX A;  4NXM F;  3UDV A;  2ZH2 A;  5I4M A;  1M5V C;  3JTP A;  3QT7 A;  4IRC A;  2PMW A;  1FKO A;  2AGO A;  4IFY B;  1XN9 A;  2YNI A;  4KRW A;  2VA3 A;  1BD6 A;  4Y28 C;  3QT8 A;  2IDE A;  2DNY A;  3SSQ A;  2V2K A;  2PDA A;  2AU0 A;  2AGQ A;  2YKM B;  4X66 J;  1XC9 A;  3ENW A;  1TR0 A;  2XMT A;  1R31 A;  2V2Q A;  4GVB B;  2HGM A;  4RWW A;  4DR1 J;  3OTO F;  1NKB A;  3SCJ E;  1TQL A;  4C3K A;  1RI7 A;  3KG0 A;  4F3O A;  3VZI A;  2Y0S D;  2DCU B;  4HT5 A;  4QWD A;  2HND B;  3ZTS A;  3QGP A;  3H59 A;  3W1Y C;  4RW4 A;  3G6E S;  2CJQ A;  3ETO A;  2QGF B;  3ELH A;  3M8P A;  1Q86 T;  1HD0 A;  2QMU B;  1T94 A;  4C7Q A;  4AQY F;  3RW6 A;  3OTB A;  3LF0 A;  3NS7 B;  1M5H A;  1RJJ A;  3AFG A;  3OUY A;  5AT1 B;  2UUB F;  2CQ1 A;  2CQI A;  1N48 A;  2ZM6 J;  1ZM2 A;  1B64 A;  2ZC4 A;  4LVO P;  3ILJ A;  4E0D A;  1NPK A;  4MFB A;  5C24 A;  4MKV A;  3V6J A;  4CO5 A;  2MTL A;  5IQQ A;  3CJ5 A;  3T6B A;  2L48 A;  4HLB A;  4LF5 F;  4GRS A;  3IBC B;  1FDD A;  3KJF B;  3QO9 B;  3PEH A;  2MKS A;  1IKV B;  4EO6 A;  4FF4 A;  2AW0 A;  3Q8S B;  4QIW D;  4ZPB A;  3H4B A;  3OVB A;  1HI1 A;  5J2M A;  3J81 j;  1X5O A;  3CCE S;  4ECQ A;  1CJT A;  2RUS A;  3FDS A;  2BJ7 A;  3D3B J;  1VI7 A;  4ZHR A;  2FC8 A;  4DCO B;  1LFW A;  2IBO A;  2HBQ B;  3SDE A;  2HAF A;  2DCL A;  5E3C A;  3GYN A;  2F8M A;  2ACY A;  2NCK L;  4G1P A;  2DR6 A;  2C2D A;  2XI2 A;  4ED3 A;  3IAM 9;  3G2X A;  1RKI A;  3Q86 A;  4L6V 3;  4OYP A;  4WYW A;  2YWE A;  5D15 A;  1FRM A;  3CJ2 A;  2MZT A;  6FD1 A;  2ZWO A;  3QBC A;  5ETP A;  5IWA J;  1IKY B;  3V4M A;  4AXI A;  3TW0 A;  1RHU B;  1RHK B;  2VFV A;  1RT7 A;  4TKT A;  1IJE B;  2AP6 A;  2ZC3 A;  3DOK A;  5DS7 A;  2FB0 A;  5DDP C;  1S97 A;  4K4Y A;  2QA2 A;  4Q44 A;  2BAC A;  5KG5 A;  4KE5 A;  3L3C A;  3GJR B;  1RUS A;  2NRE A;  1BHN A;  3SFG A;  4PKD B;  3QT5 A;  3D68 A;  2BV3 A;  3LGN A;  4G3I A;  1R0C B;  5HQ8 A;  3MI7 X;  3G6X A;  3MMC A;  2BE2 A;  4PYD A;  4JYA J;  2ZJP Q;  2HS4 A;  4HL9 A;  4X66 F;  2EWH A;  4ZVQ B;  4OJ1 A;  3KLE A;  1G2E A;  3MEC B;  1SXL A;  2C2M B;  1R3N A;  4OYA A;  3THT A;  4DR1 F;  3EGZ A;  2WOM B;  2JC0 A;  4FBU A;  1S9G A;  2MST A;  3PNI A;  3PW5 A;  2F65 A;  3C66 A;  1TK5 A;  4RPF A;  2CZ4 A;  3NKY A;  3ZZR A;  4MYT A;  3KOA A;  4CLL A;  3DRP B;  4RW6 A;  4DPT A;  2JDJ A;  4Z7Y A;  4MKB A;  1YK9 A;  4A8Q A;  4EFA C;  1KTV A;  2E9R X;  4B9N A;  1MSW D;  4O3O A;  1FNM A;  2C42 A;  4UST A;  3AOD A;  3SSS A;  4O4G B;  2R2S A;  1PYS B;  1VQN S;  2W9C A;  2FJW A;  2J9C A;  5KFE A;  1OPZ A;  2FJA B;  2M2B A;  3FSI A;  1BWE A;  4EMD A;  1U09 A;  4DR2 J;  4WYL A;  2W2M P;  5L38 A;  2ZM6 F;  4ELT A;  1JXV A;  4OLO A;  2FZK B;  1UCN A;  1WTB A;  3MTJ A;  3SFU A;  3E3X A;  2NLW A;  4Y2M A;  1S1U A;  1Q8L A;  2OEJ A;  2HZC A;  4WKR A;  3ZZP A;  3M6V A;  4HVZ A;  3W8G A;  4X84 A;  3H98 A;  2HHS A;  2C2E A;  3H2U B;  4DF4 A;  1YBT A;  2F1F A;  2KDO A;  1QAJ A;  4RW8 A;  2WSF C;  4ED1 A;  1VRT A;  2M8D B;  1NSK L;  2IRY A;  4ZVU B;  3FCV A;  2E9Z A;  2V0N A;  4IYQ A;  2F8H A;  3C14 B;  1UFL A;  3J7A 1;  2CIM A;  4LF9 J;  2I5J A;  3HSZ A;  2NUH A;  2CPE A;  4OX8 A;  5E3P A;  3DRR B;  3OL6 A;  4NMX A;  4F02 A;  4KHM A;  4NXN J;  3NGK A;  3QAU A;  4CLY A;  2VFR A;  4BHQ A;  3CJT A;  3UWT A;  4C11 A;  1HQE B;  3VQT A;  2OSR A;  2RRN A;  4K0K J;  3TEG A;  4QWE A;  3EVM A;  4NLV A;  4FVC A;  2OUG A;  5IWA F;  3VAJ A;  2GQ2 A;  1K0V A;  2ZH4 A;  1TFW A;  4ZN3 A;  4Y2K A;  2FHM A;  3MM5 B;  1RAI B;  3RZA A;  2VG5 B;  1ICE B;  3HSJ A;  3VVT A;  3W5Z A;  1XMB A;  1S4E A;  3LTO A;  1I51 B;  1ZAX A;  1YZ7 A;  1TVR A;  2GNK A;  2LA6 A;  2MKC A;  2Y0B B;  4B9U A;  3BQ2 A;  3ILI A;  4WK3 A;  1QSY A;  2GIR A;  2G2O A;  2HBZ B;  2HS3 A;  4JYA F;  5E5N A;  3ZXW A;  2R8G A;  3FZ2 A;  3VAM A;  4TU9 A;  1OPI A;  1VLY A;  2VD3 A;  3K5M A;  1QDU B;  5AXM A;  3CO9 A;  2GZO A;  2E66 A;  4P74 A;  3ITH A;  3KHR A;  1DTQ A;  1Q4R A;  3GIR A;  4OYZ A;  2QSW A;  3CMA S;  3CWJ A;  4QZV B;  4ITS A;  4PQU B;  2R7V A;  2HAI A;  3VAH A;  2AJ2 A;  2HQD A;  5KFT A;  4HH1 A;  3IGV A;  2J6T A;  4L73 A;  3M2R B;  2B4U A;  4IG3 B;  3MR6 A;  4DQP A;  4NEY A;  4OHV A;  2LQ9 A;  3BH6 B;  2FLP A;  3Q8P B;  3SMZ A;  3G86 A;  2OPR B;  1B3T A;  2QJ3 A;  1K9M T;  5DGB A;  1CUL A;  1RB0 A;  4RJV A;  4LF7 J;  3GLJ A;  2A6M A;  7AT1 B;  3M7V A;  1LW0 B;  3G87 A;  4DR2 F;  4WE1 A;  4PR6 A;  3THP A;  1SJ3 P;  1RCO B;  3NNA A;  1JLF A;  3GWC A;  1XWL A;  3EPI A;  2GML A;  1UVK A;  4U95 A;  2VKR A;  1N54 B;  1F6T A;  3CNQ P;  4C3M A;  1SUQ B;  2AYG A;  3MM8 B;  1S6P B;  4NLO A;  3U1M A;  5IT0 A;  1U6F A;  1FT8 A;  1NB7 A;  5DQG A;  2IMO A;  1JLG B;  1S6Q B;  1SCJ B;  3UFC X;  4ED8 A;  1CVJ A;  2UXB J;  5GAG U;  4KPY A;  4DF8 A;  2DT9 A;  1Y7P A;  5KFL A;  3EZ5 A;  1VK8 A;  1JX4 A;  1T05 B;  4QIV A;  2OLW A;  1RKJ A;  3JTN A;  4ZCM A;  1Z4U A;  4YR3 A;  2N4C A;  3TYT A;  1U0S A;  4H4O B;  3ZO7 A;  4MH8 A;  4L75 A;  1N4L A;  4P71 A;  4RUA A;  4JI3 J;  4LRC A;  4JI0 J;  2EBG A;  3U1N A;  4U9R A;  2GO9 A;  2QMX A;  1P27 B;  2B4V A;  2XNR A;  3M6W A;  2K7K A;  4LF9 F;  1KC8 T;  2GIF A;  3ZZT A;  4OI3 A;  4I2Q B;  1FJC A;  4C48 A;  2UP1 A;  3VAG A;  3BO2 A;  2W25 A;  3DCA A;  3VCD A;  4DV2 F;  1P6T A;  2DYA A;  4NXN F;  1NK8 A;  3G8Q A;  1JIH A;  1AT1 B;  4IO9 Q;  3I0R A;  5CZX A;  3CGI A;  1XMO J;  2W2P P;  1HYS A;  2C1E B;  3CCM S;  3I55 S;  4FYV B;  5CYJ A;  2X3G A;  1SH2 A;  1JLA B;  4K0K F;  2GVZ B;  3MED A;  2DIU A;  2VG6 A;  3BGO P;  5I3Q A;  3BGU A;  4MJK A;  3QSY B;  2IPO B;  4C8O A;  3M8Q A;  2MLX A;  2OSQ A;  1H2U X;  1JNR B;  1PGZ A;  4RR5 A;  4QR2 A;  3TZZ A;  2CJB A;  5H9F J;  4PWD B;  4KGZ B;  4EK2 A;  3OTE A;  1EQ0 A;  1HBO B;  3CO0 P;  2LA4 A;  2HK2 A;  2A1B A;  3FZB A;  3RB6 A;  3R3T A;  1URR A;  5J1N A;  3EE3 A;  1BE4 A;  2XMJ A;  4NYZ A;  4R25 A;  3GFY A;  2X1A A;  2JOQ A;  4I56 A;  2DGS A;  5E0O A;  1IQZ A;  3PTW A;  1GTH A;  5D78 A;  2GS8 A;  3QGI A;  5B09 A;  2N3L A;  4OX9 F;  1H3D A;  1U1L A;  3OR2 A;  3FEX B;  1SH3 A;  4DQI A;  3Q8Y A;  2IDL A;  2WRM A;  4ZP7 A;  3GV8 B;  1IXK A;  4AFF A;  1WKL A;  5KFW A;  4LF6 J;  2LQ8 A;  3HI9 A;  4ANE A;  3RR7 A;  2WW4 A;  4U7C A;  4Q0B B;  1WC0 A;  2BYC A;  1DTT A;  2H4Y B;  1T03 A;  1R6Y A;  1WDD A;  2MKJ A;  4NZ7 A;  1KHW A;  2CQ0 A;  2BAN B;  5KFY A;  4ES2 A;  1RTH A;  4ICL B;  4LF7 F;  4IQM A;  4YR0 A;  2W7A A;  3DRY A;  2HQF A;  3NGD A;  5C2C A;  3WC2 A;  1FD8 A;  5B7W A;  5C25 A;  2HHT A;  4P6Q A;  3CD7 A;  3D0H E;  2KG1 A;  2OML A;  4L3N A;  4ZVG A;  4FS1 A;  2R7Q A;  4ID8 A;  3TVK A;  2FHK A;  2X1F A;  4N5S A;  1WDT A;  1NCL A;  4RX6 A;  3L4B C;  3V5R A;  3KKF A;  4ECX A;  2R7U A;  2ZNZ A;  2UXB F;  1GMV A;  1JQG A;  2VOP A;  1B0V A;  2AGP A;  2VUG A;  2YQ3 A;  4ZVP B;  4H54 A;  1X5S A;  4UOC A;  2AV5 A;  1NH8 A;  1YG0 A;  1RTJ A;  5HSP A;  3QLH A;  1X4G A;  1PC5 A;  2RRA A;  2FQQ B;  3QGG A;  3ZTP A;  2A0F B;  2BX6 A;  2QRR A;  4JI3 F;  1HNI B;  3M8P B;  1RAA B;  4JI0 F;  4CLT A;  3T5K A;  4GC6 A;  1UWA A;  5A8K A;  1WC3 A;  3VTI A;  2F3J A;  2YWG A;  1DQ8 A;  2Z57 B;  4LRD A;  3OUY B;  2XQC A;  1CC8 A;  1RZM A;  1SIW B;  4JI4 J;  1LWE A;  2RAQ A;  1DJ0 A;  3DXS X;  3GB0 A;  3VGV A;  2OPS B;  5I3U A;  2G13 A;  4NX9 A;  1JLC B;  5IV4 A;  2ABY A;  1XMO F;  2HG4 A;  1F60 B;  4P9S A;  4MFB B;  5C24 B;  3O5T B;  1FFW B;  2L08 A;  1YIT S;  3D6H B;  2G1H A;  1TKZ A;  2DKO B;  2YNF A;  3C46 A;  5KG2 A;  2E7V A;  1FE4 A;  3HD1 A;  5KT6 A;  3KLF A;  4DX8 H;  3C6U A;  3GJQ B;  3CT9 A;  3IN5 A;  1YQH A;  1VIX A;  2UUT A;  3KLI A;  3R27 A;  5KFD A;  2ZH3 A;  1VRU B;  1SJF A;  4OI1 A;  4BWJ A;  3M9N B;  5J2M B;  3AXK A;  3BO4 A;  2IM3 A;  5HVH A;  1CJT B;  1TUW A;  2CNN B;  4ZDN A;  5K14 B;  4CLW A;  4OJH A;  2Q1L A;  5DZ7 A;  4CO0 A;  1N5Q A;  5HBM A;  4HR2 A;  5IM0 A;  1VC5 A;  4B02 A;  3FK4 A;  3WIV A;  2A2C A;  4A8K A;  2KFN A;  4MK9 A;  2KT5 A;  1YVF A;  5FD1 A;  4CYU B;  3VV2 B;  4EBC A;  4LF6 F;  3E01 B;  3HHK A;  3IA0 A;  3AH6 A;  1MN7 A;  1XEZ A;  2XB2 D;  3TRG A;  2W4P A;  3CIZ A;  1Y5L B;  1RT7 B;  4I6A A;  1KVK A;  2GHW A;  3HSD A;  4MKA A;  1KBR A;  2UUW A;  3DOK B;  3HKZ D;  1FJG J;  3ZZZ A;  1F5B A;  3B4M A;  4V1A k;  1YHQ S;  2C3O A;  4HKQ A;  3HT3 A;  4Z2X A;  4OHX A;  1T95 A;  3R1H A;  1RT5 B;  2FYX A;  1QTN B;  2CPJ A;  3LP1 B;  2PE8 A;  5ETS A;  3TOQ A;  2ZFH A;  1IKW A;  4ES1 A;  4K4S A;  2HHV A;  3MMC B;  3LO3 A;  4A47 A;  3VF0 B;  4NLR A;  4ZJQ A;  1RYS A;  2OFH X;  1ROF A;  1HBM A;  1KQF B;  3AB4 B;  1R43 A;  4X4V A;  4YME A;  2QYC A;  4YY3 J;  1SPB P;  3KWM A;  2QN6 B;  4DI6 A;  3CD5 A;  2RD5 C;  1U26 A;  4X4N A;  4PG7 A;  4Y34 A;  3C3L A;  3HDS A;  4M5H A;  2JLG A;  2M4M A;  1YBU A;  3KJV B;  2YBV A;  4RW6 B;  2Q6B A;  2CKW A;  2R9L A;  3J80 Y;  4J90 A;  4NAS A;  1TUV A;  2XEX A;  1U1R A;  4ECT A;  1WC6 A;  4K59 A;  4FPR A;  2ZUA A;  3TUZ C;  5B0A A;  2XGP A;  2F40 A;  3KTQ A;  1E6V B;  1RAO A;  1WEZ A;  3BF4 A;  3MUM P;  3N0V A;  4PQA A;  1FNO A;  4JI4 F;  1WOP A;  5DLG A;  2KXN B;  4ZIV A;  2IHR 1;  3MMA A;  5CAA A;  5EGY A;  4RUC A;  4DV1 J;  1W7W A;  5AXN A;  4K50 A;  1N8R T;  1S1U B;  1RU2 A;  4Y2C A;  3R1L A;  4F4Y A;  2ZKT A;  1U2R A;  3LP2 A;  4DQQ A;  2Y8Y A;  5L1K A;  4DL6 A;  3MUR P;  2WVE A;  4I4B A;  2EXU A;  4U6P A;  3D4J A;  1FF2 A;  1RTZ A;  3EIC A;  1PIE A;  4IH7 A;  4RW8 B;  4NEZ A;  5B0B A;  4ECZ A;  1ZZF A;  2MY7 A;  1JK9 B;  1CQM A;  3WX8 A;  3JAM Y;  3RR8 A;  2F9J A;  4TY8 B;  2Q3P A;  5H9E J;  1MU2 A;  2EI5 A;  1UVM A;  5K5M A;  1EIY B;  4QWC A;  1HI0 P;  3PX4 A;  4ZLJ A;  4FYW B;  2FIU A;  4ELU A;  3F73 A;  1UPP A;  1TK0 A;  1OYE A;  2E5G A;  2W9B A;  1UET A;  1Q5Y A;  2BQR A;  2XS7 A;  4CNZ A;  4CWB A;  1P9Q C;  2B43 A;  2KN4 A;  1D1U A;  2DEJ A;  3J80 U;  4C11 B;  1UTA A;  4F0M A;  3W3S A;  2ZOF A;  1GMW D;  4F4Z A;  3UW1 A;  1U8S A;  4QPT A;  1S1W A;  2GJI A;  5FLX Y;  1UJ6 A;  3A3O B;  1NB2 A;  3CJK A;  4DEZ A;  1MRO A;  2MYF A;  2OKQ A;  4DR7 J;  1VYA A;  1YJ7 A;  1FJG F;  2KJV A;  2DY1 A;  1TVR B;  3CB4 A;  3EXY A;  1TL4 A;  3MCS A;  5D4O A;  3SYZ A;  2RT3 A;  5ETQ A;  3MM7 A;  3BV8 A;  2AYB A;  2UUC J;  1FA0 A;  2F5G A;  2HWH A;  3UN5 A;  1Q1K A;  1GTE A;  4R0J A;  1FO1 A;  1KON A;  4UUX A;  1A9N B;  3IRW P;  3M9O B;  3NP5 A;  4RL1 A;  3DLJ A;  1HW9 A;  4RNH A;  4YY3 F;  3ITH B;  3KUE A;  1DTQ B;  3D5M A;  3R5A A;  2H4W B;  2XZW A;  3NEK A;  3SZ2 A;  2QL5 B;  3KLV A;  3JAM U;  3RB3 A;  3W5X A;  1VQY A;  3MM9 A;  5DQI A;  4EU0 A;  4OJ3 A;  5DM7 Q;  2Z4P A;  1ZS6 A;  4BWM A;  4ATN A;  1VQ8 S;  4KGX B;  1QM9 A;  1B99 A;  3HKW A;  3HHL D;  1QTM A;  3WHI A;  1DZ5 A;  4IUF A;  2AZ1 A;  3MOJ B;  1YBA A;  2MQ8 A;  3CCJ S;  2M9K A;  3G8T A;  2CPD A;  4Q8F A;  1BXN A;  2V9K A;  5L8R C;  1AB8 A;  1I1G A;  3I0S A;  2DH7 A;  1PIL A;  2CNO B;  4YOE A;  4KTQ A;  4B3O A;  2HKE A;  4WE1 B;  2XCA A;  1R89 A;  3V2U C;  4ZN1 A;  3JS9 A;  1YJ9 S;  2KU7 A;  4A46 A;  5L1J A;  3TUI C;  5F41 A;  3QNW B;  5FLX U;  3X1L B;  2DNL A;  4P7T A;  2GA7 A;  3OSP A;  2KHC A;  3O2I A;  3FBF A;  4DV1 F;  3DLG A;  1EAY C;  3ONQ A;  1REG X;  3LAK A;  2V4Q A;  3DU6 A;  2IYG A;  2B7C B;  4F2R A;  1WNE A;  1VS3 A;  2KT2 A;  3NCQ A;  3VGS A;  2XLJ A;  2I9S A;  1KEK A;  4M5K A;  3M32 B;  2FZC B;  2O01 C;  2RU9 A;  1F9E B;  1FRI A;  4IH5 A;  4OZN A;  1W26 A;  4WTY A;  1VQS A;  2RNE A;  1NDP A;  2K7J A;  3ZZU A;  2RF2 A;  4O23 A;  4GKK J;  4R8U A;  4NCB A;  1LFP A;  1X4D A;  4USU A;  1LOU A;  4HTI A;  4C9D A;  2HZA A;  2RJZ A;  2BM0 A;  1WI6 A;  2LLZ A;  4C2M A;  1NKE A;  2ATC B;  3GR0 A;  1SJ4 P;  3TX0 A;  1RT1 A;  4DSI A;  2LEC A;  4Q5V A;  1SL2 A;  3ISN D;  2AJQ A;  3I0R B;  1WOO A;  1QVG R;  4Y3C A;  4LUB A;  2JWN A;  2IM2 A;  1X9W A;  4AYB D;  5J2Q A;  3MED B;  3EJM A;  2VG6 B;  1HI8 A;  3QJL A;  1S6O A;  1TEL A;  2M3D A;  8ATC B;  4DS4 A;  2ZVI A;  4KAI A;  4PYA A;  3EPG A;  6FDR A;  1HW8 A;  2OH2 A;  1JLB B;  4WCE Q;  2ZVS A;  5G0R A;  1YTY A;  4F0H A;  4DR7 F;  2M0G B;  3RRG A;  2Z8Q A;  1VQ6 S;  3TUJ C;  2ROE A;  2YNH A;  5A8R A;  3PY8 A;  2UV8 G;  3HFV A;  2NUU G;  2FJX A;  1S1T A;  1RLC L;  1Q8I A;  1UWB B;  3IAS 9;  2ZH5 A;  3K58 A;  5GVQ A;  1DY3 A;  2L9W A;  1D9D A;  4F67 A;  2ROP A;  2J9D A;  1SL1 A;  4YDD B;  2UUC F;  3OTC A;  2VJV A;  1JKH B;  1SKU B;  3UN3 A;  3L7P A;  2KM8 C;  3RB4 A;  3QQC D;  5A2Q Y;  2DNH A;  2JVR A;  5F8M A;  5LM7 E;  3W66 A;  3MFH A;  1HPZ A;  3NMA A;  1NRK A;  3CDU A;  2HBY B;  5RUB A;  2RRB A;  1KDN A;  3QRR A;  4N77 A;  4JV0 A;  3U02 A;  2IRX A;  3G82 B;  2AIR B;  3CCQ S;  3T5L A;  4RU2 A;  5B08 A;  1IBC B;  1CJV B;  3G8S A;  3H42 A;  4ZS6 A;  2BJE A;  1OY6 A;  1M5S A;  3NWR A;  1DTT B;  1FWP A;  1YRX A;  4J9L A;  2LDI A;  3M8W A;  4LSL A;  3MD1 A;  4XPC A;  3QID A;  2XYH B;  4PUO B;  4DPU A;  2FLN A;  4DFM A;  3UVJ A;  1UP1 A;  2OPQ B;  2VBX A;  4K5S A;  2CPF A;  4Q2L A;  2XI3 A;  2J0S D;  2DH8 A;  3RW7 A;  1WG1 A;  4ECW A;  1WOS A;  4A8O A;  2DNM A;  2VA2 A;  2NZ4 A;  2XGQ A;  2HFV A;  4ZLN A;  2YKM A;  4OLP A;  5L9N A;  2DNO A;  4ZPT R;  3M2V B;  4GO5 X;  4JI5 J;  1FX2 A;  1R8P A;  2GQC A;  4LF1 A;  2N7C A;  3PW7 A;  5HQL A;  3BSA A;  1ZTW A;  4URQ U;  1KQK A;  1S10 A;  4U7U K;  2HND A;  1X4B A;  4I68 A;  1CPZ A;  2G9O A;  2Z56 B;  2B9Y A;  2GMJ A;  1RTJ B;  2DY9 A;  1SV5 B;  4NOH A;  2DRD A;  3CDA A;  2WK4 A;  4GKK F;  2NS1 B;  5A8K B;  5A2Q U;  4ECS A;  2J0W A;  4PWW A;  3BR8 A;  2ATL A;  1WHX A;  2GAH C;  5ETV A;  4RNN A;  1U47 A;  4DL3 A;  1W25 A;  1TU0 B;  5SZT A;  3GIL A;  1LWE B;  1VC0 A;  3ZNU A;  2V8D A;  4WZQ A;  4ZVO B;  5HMX A;  1TV6 A;  4TQR A;  3HFK A;  4LRE A;  3AHP A;  3MOZ A;  3N79 A;  1TKZ B;  4TY9 A;  3QO9 A;  3DDN A;  1XMQ J;  2GVD A;  3SCL E;  5ETT A;  2VJU A;  4FNI A;  2QIF A;  1S79 A;  4URS A;  1PYT A;  2PD1 A;  1YDL A;  1G7C B;  2DHS A;  3OFE A;  4DL0 C;  3M8Y A;  4EYI B;  1T9T A;  4ES3 A;  3NGT A;  1ELO A;  2RDD A;  3AB2 B;  4HYK A;  1DQ9 A;  1YJR A;  3EGV A;  5HMY A;  4NA2 A;  5A0Y A;  1X4A A;  1KSP A;  1O51 A;  1E6Y B;  4FZV A;  3H2V E;  1N36 J;  2E1C A;  3EX7 B;  1PSD A;  2KVQ E;  1NK0 A;  2AJF E;  3I4H X;  3VQS A;  1IKY A;  1DHM A;  1FVQ A;  3KMS A;  4K2J A;  2HZV A;  3D0G E;  2CQH A;  5F8L A;  2EFP A;  4J9N A;  1GNK A;  4OZ2 A;  2DIT A;  5DG9 A;  2HK3 A;  2W24 A;  2BKP A;  4DPX A;  4WP3 A;  1PYO B;  3MAH A;  2M88 A;  2FGO A;  2FLO A;  1P8G A;  1U1P A;  4WFY A;  2MQO A;  4QQB A;  4Q8E A;  5CA5 A;  2KVI A;  5K20 B;  1Q0N A;  1RT2 A;  2OTL S;  1PG5 B;  5BJR A;  5GME A;  4CLZ A;  1YIJ S;  4IR1 A;  2CQC A;  3DRX A;  4CT8 A;  2VON A;  4DV3 J;  3TZW A;  4MT1 A;  3QWP A;  1QUV A;  3V6D B;  5ETM A;  1SQG A;  2PFD A;  3R7B B;  2FHJ A;  4H4M A;  2HRT A;  1S9E A;  1S7H A;  5F8G A;  4JI5 F;  2WOM A;  1HBM B;  1ZAW A;  3PYE A;  2DNR A;  1HL6 A;  4X4S A;  3ETM A;  1WOR A;  2HLU A;  1V5I B;  2CPY A;  4Y65 A;  3ZTQ A;  2K1R A;  4PG8 A;  4PWU A;  2IIH A;  3TAN A;  1ZZN A;  3PIP Q;  1VQL S;  1FES A;  2DNP A;  2BJ9 A;  4EI2 A;  5GAG I;  4KPC A;  2DHH A;  2QLW A;  3CCU S;  1HHQ A;  2VU5 A;  4B9L A;  3TAP A;  2CJX B;  4FF3 A;  1RHQ B;  1T3O A;  2IRU A;  3EGN A;  2IY5 B;  3PRD A;  3NGR A;  1FFG B;  1X0F A;  2KT3 A;  4DSK A;  3D6T B;  3HZE A;  3PG9 A;  4OYI A;  2DXF A;  3BB5 A;  1HNX J;  1U4B A;  5BXI A;  2ZBI A;  2OD4 A;  5KG6 A;  1S59 A;  3MMA B;  2UVV A;  2HHW A;  1R8C A;  1FXR A;  1EAR A;  3N4W A;  3LAN A;  2CVI A;  2LQ5 A;  1Q82 T;  1XMQ F;  4DFJ A;  4LBI A;  4BC7 A;  5IXU A;  3UN2 A;  2FJD B;  2E29 A;  2GJF A;  1TKT B;  1FJE B;  2YKO A;  5IV3 A;  1S0O A;  2PC6 A;  3CJR A;  3C14 A;  2ROG A;  5LMU J;  4J9R A;  4USH A;  4ZIT A;  4BDP A;  3TQ1 A;  2MQP A;  3FSY A;  1JJ2 R;  2EFN A;  5DM6 Q;  1UEV A;  4RKU C;  4RLE A;  1SI9 A;  1M5O C;  3ZZY A;  3DLB A;  1N56 A;  3TWZ A;  4K4W A;  2VOO A;  3Q2S C;  1N36 F;  1X31 C;  4JI7 J;  2W9B B;  1R7I A;  4RW9 A;  2CQB A;  1UJ5 A;  3DC2 A;  3GCX P;  4LJM A;  3D67 A;  1VIO A;  3TNV A;  1N34 J;  4I67 A;  4X4P A;  2ALZ A;  4C8Y A;  2F63 A;  1K44 A;  3PKY A;  1RWU A;  1WC4 A;  5KT3 A;  3IP0 A;  3K5P A;  3MM5 A;  4MK7 A;  3R6G B;  1S1V A;  1S1W B;  4OZ0 A;  1TUG B;  1SL0 A;  3ZNJ 1;  4YB6 A;  2E1A A;  4KB7 A;  2XMK A;  1TMM A;  1N6Q B;  5F8J A;  5F9N A;  3AD8 C;  3ZTR A;  4FN5 A;  1EX8 A;  4KY3 A;  4DCJ B;  4LSZ B;  2VG7 A;  1RTI B;  4DV3 F;  3W64 A;  4W4M A;  3IGN A;  4NI2 A;  1U2C A;  4ZVH A;  1YKW A;  2PSZ A;  3PJ9 A;  1WG5 A;  3QJP A;  2DIV A;  2V8V A;  1AFI A;  2JVO A;  5IFM A;  1RT3 B;  3KG1 A;  2OI2 A;  4ZVS B;  1IR2 A;  5F9L A;  2QO3 A;  2ADC A;  1U1M A;  4ZVR B;  4KIA A;  1UW9 A;  2AX1 A;  4D3G A;  3M2R A;  3DLE A;  3PFE A;  4IRD A;  1T02 A;  3EWG A;  2E1R A;  5THW A;  1BWV A;  4UY8 T;  3LW5 C;  3MM9 B;  2LU2 A;  2XS5 A;  5KT4 A;  2MMY A;  2CAD A;  2OEK A;  3PM9 A;  2WVC A;  1WEY A;  3T9N A;  3KNG A;  4DQR A;  3S8S A;  2EC0 A;  1HBU B;  3WX4 A;  2E5H A;  3BBC A;  2PFF B;  3BBB A;  3I0S B;  1HNX F;  1VC6 A;  4TVA B;  1FXL A;  3HFZ B;  1S6P A;  2B51 A;  3CVK A;  2CDR B;  2HSE B;  3GMG A;  1WWH A;  1JLG A;  1S6Q A;  2YNG A;  2KZZ A;  1OJ4 A;  1EKR A;  1N5V A;  5D0H A;  1FRH A;  2RHQ B;  3M30 B;  1S0N A;  2VBW A;  3PKM A;  2E44 A;  2V68 A;  3V4I A;  4DV7 F;  3OVS A;  4A8S A;  1TTH B;  1RU1 A;  5F8I A;  5AE3 A;  4ZP9 A;  1ZTT A;  1LV5 A;  2CQP A;  1T9U A;  1TL1 B;  1UW4 A;  2JHE A;  4YB7 A;  2HGN A;  1WF2 A;  3J7Y I;  5B0D A;  5LMU F;  1GX6 A;  2OJ3 A;  1WG4 A;  3HF5 A;  1EP4 B;  1JJH A;  1IWG A;  3RJM B;  2XSJ B;  3SIP B;  3CCV S;  1EET B;  3GU0 A;  3SV3 A;  4OMF G;  4N41 A;  4DZD A;  4FXD A;  3AJ2 A;  3KUH A;  4I0W A;  4JI7 F;  5HI7 A;  2J7U A;  1PJ7 A;  4LR8 A;  3JSM A;  3MUV P;  4USI A;  1ZA1 B;  1RT1 B;  1JLA A;  1N34 F;  2GVZ A;  7FD1 A;  4L74 A;  3W2V B;  1IVZ A;  4A8M P;  2HLT A;  1T9V A;  2ZHB A;  4DU7 A;  2RKI A;  1T8E A;  2RH3 A;  3QGH A;  5J2Q B;  1XNR J;  2LCW A;  2YWK A;  2N3O A;  4TYB A;  3E2E A;  2DTJ A;  2EEY A;  2E1M C;  3CC2 S;  3CF5 Q;  3P3D A;  2CJK A;  3O8W A;  5G0R B;  4A48 A;  1HBO A;  1HNW F;  2B0G A;  3FQK A;  3MTK A;  4Q7A A;  3IG1 B;  5JVG Q;  1R0B G;  5A8R B;  2PI4 A;  3FNN A;  1OWX A;  2P8I A;  5JUM A;  2B56 A;  2ZDO A;  2WBM A;  4B3S J;  1KLM A;  1FRX A;  4ZP6 A;  2NSC A;  1M5P C;  2W1B A;  4ED2 A;  3N5B A;  9RUB A;  2MZR A;  3S01 A;  3BYP A;  4X4U A;  2QV6 A;  2FY1 A;  2MKI A;  1Q78 A;  3HHL B;  2FVS A;  4HH0 A;  2HNZ B;  3HVA A;  4I6W A;  3MAA A;  5EN1 A;  5JXS A;  1KS2 A;  1N0V C;  5GAD I;  1VQO S;  4ZPD A;  3AQO A;  1F9H A;  1XNQ J;  4G6V B;  3AY0 A;  1HPZ B;  3G6Y A;  4K2X A;  3N6L A;  1FFS B;  4DWI A;  4Q0B A;  1WEX A;  4FPI A;  2GIQ A;  4PRF A;  4FF1 A;  1N52 B;  3HVT A;  3ICL A;  1LNQ A;  1R6V A;  5E3R A;  2BAN A;  1VLO A;  2PI5 A;  5SUH A;  4C6A A;  3NCR A;  4LSL B;  4ICL A;  5KFQ A;  2WVD A;  1WKJ A;  5K8O A;  3CCS S;  3OFH A;  3OL9 A;  1Q81 T;  1G6B A;  2PMZ D;  3UVJ B;  2DGU A;  2B8Q A;  4ECY A;  1VQM S;  2O3D A;  1LWX A;  2R7R A;  4J9P A;  2PA8 D;  3R8Y A;  4KSE B;  1S72 S;  4URG A;  3D6M B;  4DSE A;  4DR4 J;  2EC2 A;  4B9T A;  3OVA A;  1QAX A;  1DQA A;  2R2T A;  1VCT A;  5JVH Q;  1N33 J;  4DS5 A;  4ZPA A;  5D0G A;  5CD4 H;  4AXJ A;  3LPY A;  1QD1 A;  3GYX B;  3C8Y A;  2VOD A;  5A76 A;  2RSQ A;  2RQC A;  3I5B A;  3DOL A;  1NPR A;  1X60 A;  2V67 A;  3BGF A;  2HFS A;  4MIB A;  1A7G E;  2ZUG A;  2A18 A;  3FUY A;  4KYZ A;  1HNI A;  4N8N A;  1UVN A;  5KFI A;  2HFO A;  2AZ3 A;  2HVZ A;  1OQ3 A;  3W62 A;  1NDC A;  2V4J A;  3T1H J;  4WZM A;  2CQ3 A;  3TAR A;  4DL4 A;  3E8O A;  3FCW A;  2OPS A;  4E8U A;  3UD4 P;  1JLC A;  2H65 B;  3K59 A;  1JB0 C;  1VQ7 S;  2C3M A;  1B7F A;  1UA0 A;  2FC9 A;  3GSI A;  1IQT A;  4NL5 A;  1TV6 B;  2DNG A;  3NAH A;  1XNR F;  2I6W A;  2BJ1 A;  4CLK A;  1RBA A;  2ZJR Q;  3RBX A;  4OI0 A;  1U1N A;  2GVD B;  4TU8 A;  1WSV A;  4YB5 A;  1VRU A;  3THV A;  3DLH A;  4NLG A;  2LU1 A;  1RT4 B;  5K14 A;  5KFK A;  1EKS A;  1MWY A;  1HWL A;  3FBE A;  3D7S B;  2DO0 A;  5CAB A;  3H0P A;  4B3S F;  2MB0 B;  2B7B B;  2QT7 A;  3BSO A;  1Q16 B;  3MR7 A;  5A0Y B;  3D54 A;  3H5Y A;  2GC8 A;  5EWG A;  4WP9 A;  1R8A A;  1AA1 B;  1PC4 A;  4DPY A;  1OMS A;  1MN9 A;  3G9C A;  4CYU A;  3KG4 A;  3R7S B;  1XNQ F;  1UFK A;  5HL7 Q;  1WTF A;  3E01 A;  5B0E A;  4I64 A;  5F3Z A;  3CJ4 A;  2VFT A;  4M5J A;  5ETO A;  3RGI A;  5T14 A;  4UTG A;  2POK A;  2I0X A;  2R42 A;  1L3U A;  2V9W A;  5J1E A;  4U8V A;  1ZAV A;  4ZJO A;  3QPI A;  4KH0 B;  4B08 A;  2VBZ A;  3AOA A;  1S76 D;  2YPZ A;  2EVZ A;  1M1K T;  4FS2 A;  1RT5 A;  5HVG A;  1OSC A;  1RT2 B;  2XCP A;  5HP1 A;  3TO8 A;  4QCL A;  3LP1 A;  1NO8 A;  1NU4 A;  3HXM A;  1ACM B;  3HHL C;  3C6T B;  4I2P B;  2V8G A;  3QIP A;  1QSL A;  3UI3 A;  2NSB A;  1NZ8 A;  9ATC B;  4LRA A;  4YUD A;  5GAE I;  3BJY A;  3RTV A;  3UDL A;  3AQP A;  5DET A;  4ETZ A;  4DR4 F;  4H4M B;  1S9E B;  1C0T B;  2V5H G;  1NJZ A;  1R8B A;  3IXQ A;  2RQ4 A;  4OYW A;  4FP9 A;  1N33 F;  1L3K A;  1KN6 A;  4DLG A;  2HYI B;  3Q8R B;  2CVE A;  3Q8U A;  2DGO A;  3OL7 A;  3LWM A;  3KJV A;  4B9M A;  4CZC A;  2CJ9 A;  4YHH J;  2K1R B;  5AE1 A;  4UOG A;  3MR3 A;  1IKX B;  1NK9 A;  4O3P A;  4ELV A;  5BYR A;  4L72 B;  4O3Q A;  1M5K C;  2ZBC A;  2PMH A;  2M8H A;  5A6P A;  5M2R A;  1X5T A;  3DMJ A;  3BN7 A;  3T1H F;  4WK1 A;  1E6V A;  1RYR A;  3RRK A;  1RDR A;  1VOM A;  4NA3 A;  5C42 A;  3V81 A;  1J5O B;  4CH0 S;  3KK1 B;  2C3P A;  2XMW A;  4E98 A;  3K5O A;  4DUT A;  3WQP A;  4CO3 A;  2XMV A;  3GJT B;  2XZT B;  4M1K A;  3RYL A;  4LIW A;  4ZPV R;  1PJ5 A;  4N7T A;  3QFW A;  2MZJ A;  4IO1 A;  2IM1 A;  2ZZM A;  1Y0H A;  2KKH A;  3J7A N;  3KLG A;  5AXL A;  1QVF R;  4JBC A;  3UCU P;  2R7W A;  3ISN C;  2W8K A;  3PVX A;  3GE9 A;  4OQJ A;  2AEJ A;  1C4C A;  2G4B A;  5EDW A;  4FYX B;  4X4O A;  3DGP A;  1QLN A;  3IR7 B;  2LVW A;  4CLF A;  3H90 A;  4TY8 A;  4K5R A;  4OYO A;  4ZVE A;  1NLK L;  2LMI A;  3R5D A;  3TUP A;  1WHW A;  4C97 A;  3NG8 A;  2DIS A;  1PKU A;  3DDK A;  4F4X A;  1DAR A;  1B70 B;  5BR8 J;  4NLW A;  2MJU A;  4J9Q A;  5J2N B;  1TZ0 A;  4UOH A;  1K1Q A;  2LXF A;  2VAS A;  2BKN A;  4ALZ A;  1FD2 A;  1IR1 A;  2PEH A;  3J81 Y;  4RW9 B;  2ZHO A;  4QR1 A;  1KWM A;  1RHR B;  2FDN A;  4ZA1 A;  2V6A A;  1S49 A;  3RAX A;  1C1C A;  3PDN A;  5HRO A;  4BCA A;  2E5I A;  1REV B;  3EVO A;  2FVR A;  1U8W A;  1IBM J;  4LBP A;  2IC3 B;  2KO1 A;  2BM1 A;  3BBF A;  5E33 A;  1S1V B;  2KI2 A;  4PPD A;  2C2R A;  1FEH A;  2LDY A;  4HAC B;  2IJF A;  3DYA B;  3L7U A;  2COL A;  4UUW A;  4LF2 A;  2ACM A;  1LK7 A;  1NAQ A;  2AJ1 A;  1TL7 A;  1H74 A;  2XNQ A;  1I6J A;  3S7R A;  4ID5 B;  4XIU A;  2DEI A;  2HWI A;  2R3V A;  5DG7 A;  2Y1L B;  4ECR A;  3DDI A;  1CBK A;  4OZL A;  2VG7 B;  1X9S A;  4NI2 B;  2NQP A;  2OFG X;  5FJ4 A;  1HBN A;  2XMA A;  2AWZ A;  5D0R A;  1T0T V;  1C1B A;  2H5E A;  3P4U B;  1T9Y A;  1HWJ A;  1SKS A;  4HT7 A;  1TKD A;  4O44 A;  2ILZ A;  3FJ2 A;  2F4F A;  3KYL A;  4ZCL A;  4EUV A;  4OV6 A;  1JLQ A;  4RWX A;  4OZJ A;  1JXL A;  3BH7 B;  3DLE B;  3OBI A;  4YDX A;  5K9F A;  3T3F A;  2G1D A;  5M2U A;  3AD9 C;  4TXS A;  2ZZN A;  3VGU A;  3N5F A;  3MEG A;  2EFO A;  3ET6 B;  2BOP A;  2HHQ A;  1SQF A;  1B7Y B;  2QC3 A;  2ASD A;  2J0X A;  4O0N A;  4KGM A;  4YQW A;  3B6B A;  4OFZ A;  3J81 U;  2C3Y A;  3T1Y J;  1P1T A;  4UF4 A;  1U1Q A;  4JV2 A;  3PYF A;  2CJA A;  2G0J A;  2KJW A;  1NBE B;  4RU9 A;  3I87 A;  1OQ6 A;  3PW4 A;  2MQL A;  4ZJL A;  4RNF A;  4F3Q A;  3VR1 A;  4QU6 A;  4F0K A;  1GMU A;  3I5C A;  2YNG B;  2ZE2 A;  1IR0 A;  2CPI A;  1NZA A;  2XWX A;  4IR9 A;  1FK9 B;  4HDH A;  4B3T J;  2D74 B;  4Z7C A;  1IBK J;  4WU3 A;  3LP0 A;  2HS0 A;  3V4I B;  3HJV A;  1H72 C;  3M32 A;  3P6Y C;  2MHN A;  2AD9 A;  2IFX A;  4M63 A;  4DMZ A;  3HCX A;  3OHA A;  3PFO A;  1X4H A;  1U49 A;  4RW7 B;  3MHY A;  3Q24 A;  4H4K A;  3VVU A;  3DFE A;  1RCX B;  1XTZ A;  3LGM A;  2KHD A;  4UW2 A;  2L9N A;  1FDN A;  5H1S V;  3MMJ A;  1L3T A;  3F41 A;  4L3K A;  5BR8 F;  2N4D A;  2AMC B;  3M8R A;  2YQ1 A;  3IRX A;  3CD6 S;  4ILL A;  5E7O B;  2JFK A;  3EVW A;  4JI1 J;  5B0G A;  3N6M A;  3PR4 A;  4GMK A;  3JSM B;  5D4L A;  2BJ8 A;  4M5G A;  1F1B B;  2B6A B;  3EXC X;  2WCX A;  4OL8 A;  3RAM A;  3I56 S;  2ASJ A;  2IBK A;  2RKI B;  2VFS A;  2R2R A;  1IBM F;  2DR8 A;  1HWU A;  3PCO B;  1JLB A;  4YR2 A;  5D77 A;  3DU5 A;  4KO0 A;  2DH9 A;  4NCG B;  2K06 A;  3GV5 B;  2FJE B;  4HDG A;  1QJH A;  2FVQ A;  4OZ3 A;  3BSC A;  1Y10 A;  4ZPW R;  2IM0 A;  3AA9 A;  1U6Z A;  1HAR A;  1GFW B;  1UWB A;  1EQM A;  4F50 A;  2HHU A;  1YX2 A;  2Y8W A;  2HQG A;  3CJ0 A;  4NLX A;  2BXJ A;  3FQL A;  4DHV A;  3JSB A;  1JKH A;  1T9W A;  4DUY J;  1KLM B;  1FEE A;  4C8K A;  4N47 A;  3OXG A;  3T41 A;  2JLF A;  2G2Y A;  2MHE A;  3IWX A;  1ZET A;  3PHT A;  3K5N A;  1L5U A;  1BUX A;  1HMV A;  2YWW A;  4OHY A;  5E3A A;  1AUS L;  3AD7 C;  4LSN A;  2VPZ B;  3CME S;  3MAA B;  2K3I A;  1GXT A;  4KV8 B;  3AXM A;  4USW A;  3D1O A;  1L3V A;  1F0X A;  3MGJ A;  3A12 A;  2ASL A;  3G82 A;  4NPO A;  1BMQ B;  3UCZ P;  1CJV A;  3W9H A;  1NSQ A;  2YKQ A;  3BGR B;  4J9O A;  4NLS A;  4AT1 B;  3HVT B;  1XIQ A;  4KGV B;  2U2F A;  3SQO P;  2AQ4 A;  4PUO A;  4YN3 B;  2D3O R;  5KFP A;  2OPQ A;  1Q8B A;  1O0P A;  2EK1 A;  4ECV A;  2M70 A;  3T1Y F;  3KUG A;  2DRA A;  1PBA A;  3J7Z 5;  2DHG A;  1RA7 A;  3OFF A;  5IC4 B;  3UNY A;  1DLO A;  2BE9 B;  5IZH A;  2AJ0 A;  3SBM A;  4IRK A;  2VF3 A;  5C5J A;  2K8G A;  3M2V A;  1BY9 A;  3NNH A;  4ILM A;  3QAE A;  2HQI A;  2I2Y A;  2WW8 A;  2J0Q D;  5D8H B;  2H1Y A;  2YX7 A;  1D9F A;  1IM6 A;  4MTP A;  4O3R A;  3IR5 B;  1K47 A;  2ZIT A;  4B3T F;  1N5Y A;  1FRL A;  1IBK F;  3TAM B;  1NKC A;  2QA4 G;  4QPX A;  2C2Z B;  1U25 A;  2PO4 A;  3DOL B;  3MD3 A;  2Q66 A;  2XC9 A;  5KFV A;  2Y1I A;  4Y6I A;  3GG1 A;  1WC5 A;  1SV5 A;  1U02 A;  5K8P A;  2APO A;  3GTY X;  1C0U A;  2AEM A;  2GO8 A;  4HTJ A;  4OHZ A;  3C15 B;  3EZO A;  2LXI A;  2MPU A;  1S5Z A;  4TN2 A;  1F5C A;  3AT1 B;  2NXE A;  2J8A A;  2V4J B;  1Q53 A;  3DOM A;  5CQG A;  5D6G A;  4DV6 J;  2IVM A;  2J9E A;  3P45 B;  3OQ2 A;  4IDK B;  1SQE A;  4CM2 A;  1U24 A;  2P9C A;  2WVF A;  3HVW A;  4JI1 F;  3MAQ A;  3MR5 A;  3PRV A;  3T1A A;  3KK3 A;  1S0M A;  1U48 A;  1AFJ A;  3EZU A;  4LIR A;  3MM6 A;  2B5J A;  1KQG B;  4RUH A;  1X4E A;  3J7Y U;  3PO5 A;  4J9K A;  3R5G A;  4OJG A;  2YKP A;  3N01 A;  5KTQ A;  2XG8 A;  2Z30 B;  2YKN A;  1VGY A;  2BZ2 A;  4UQG A;  2HQ3 A;  2CZ9 A;  2YWF A;  3W9J A;  2WHO A;  1WAC A;  2HGL A;  3UO0 A;  4HHJ A;  5LOQ A;  1V3R A;  3VHQ A;  1MWQ A;  3CD0 A;  4QW9 A;  3GPA A;  3D9B A;  2ZBQ A;  4ZMM A;  2DR5 A;  3Q89 A;  4DQS A;  4DUY F;  2JX2 A;  1E6Y A;  3MPV A;  3TJA A;  2V2V A;  4IH6 A;  5DZ6 A;  4JI6 J;  5KFR A;  3PIO Q;  4A8Y A;  3K89 A;  3NAI A;  3BZQ A;  4IOB A;  4YB1 P;  4RNM A;  3IS9 A;  3K8V A;  3BQ1 A;  3TA1 A;  2DNQ A;  3GSD A;  4C4W A;  4A8F A;  1K8A T;  2R8H A;  2I1R A;  2X51 A;  4KGK A;  3O3L A;  1Q5V A;  2NYH A;  1HHT P;  1FVS A;  1H98 A;  3Q23 A;  3FEY B;  2FTR A;  5J1E B;  2GHV C;  1FKP B;  4LQ9 A;  5J1P A;  4ANC A;  2DJW A;  5LSR A;  2OMO A;  1S99 A;  4QU7 A;  1TL3 A;  2D3O 1;  1HFE L;  5EUH A;  5GAD U;  3L09 A;  1WC1 A;  5HP1 B;  1FER A;  5DJB A;  3EYZ A;  5C2G A;  4F04 B;  3BGL A;  4MKY A;  3V6D A;  1QAY A;  3H20 A;  3QIP B;  3GIJ A;  2YQ0 A;  3HMJ G;  1EB0 A;  1O5J A;  5I3P A;  1NM2 A;  2XZD B;  2W4C A;  3U7J A;  2XO6 A;  3O6Q A;  4EEY A;  2J76 E;  3KMQ A;  1TAU A;  3GCW P;  1RLD A;  2KZM A;  4OYM A;  1FDB A;  2H5J B;  2W7O A;  1QAI A;  4OIX A;  1ZOT A;  1B0T A;  4M5L A;  5DDQ C;  3QWU A;  1HNV A;  3FMB A;  2A2D A;  3KXD A;  4FXW A;  3X3U A;  3M05 A;  1RHJ B;  3DRS A;  4ERD A;  2R7O A;  3DI6 A;  4EO8 A;  3I6P A;  1W2I A;  1OY8 A;  1JXE A;  4NWB A;  4IG0 B;  4QJV A;  2IAJ B;  1FCA A;  3DMJ B;  2WBR A;  2V94 A; 
#chains in the Genus database with same CATH homology
 4M5K A;  2QX0 A;  3HSZ A;  3HSG A;  3ILI A;  5ETV A;  3HSJ A;  5ETK A;  5ETQ A;  1TMJ A;  4M5M A;  1HQ2 A;  3HT0 A;  4M5J A;  1RAO A;  3UD5 A;  5ETT A;  5ETO A;  3ILO A;  3HSD A;  4CYU B;  3HD1 A;  3MCM A;  2BMB A;  1KBR A;  4CYU A;  1RU1 A;  3KUH A;  3HCX A;  4M5I A;  1RTZ A;  5ETN A;  4CWB A;  4M5N A;  1Q0N A;  3MCO A;  3ILJ A;  4M5H A;  1RU2 A;  1EQ0 A;  1EX8 A;  2F65 A;  3KUE A;  5ETL A;  3KUG A;  5ETM A;  1CBK A;  1G4C A;  5ETR A;  4M5L A;  2F63 A;  3UDE A;  4PZV A;  1RB0 A;  4AD6 A;  3HD2 A;  1EQM A;  5ETS A;  3ILL A;  1F9H A;  1HKA A;  1DY3 A;  3MCN A;  3QBC A;  2CG8 A;  4M5G A;  5ETP A;  4F7V A;  3UDV A;  1TMM A;  3IP0 A;  4CRJ A;  1IM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...