5ETLA

E. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
161
structure length
155
Chain Sequence
SAMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 155
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etlA00
4CYUA 3HSJA 2CG8A 4M5LA 1F9HA 3HD2A 3ILJA 4M5NA 4CRJA 5ETNA 4M5JA 1IM6A 3HD1A 3HSGA 1KBRA 1G4CA 3MCMA 4M5KA 1Q0NA 3KUGA 3UD5A 3KUEA 4M5GA 4F7VA 1HKAA 3ILOA 3KUHA 5ETRA 3HSZA 5ETVA 5ETMA 5ETLA 4CWBA 1RTZA 1TMJA 3MCOA 3UDEA 1TMMA 1EQMA 2QX0A 1EX8A 4M5MA 4PZVA 2F63A 3IP0A 1RU1A 3UDVA 5ETSA 3ILLA 5ETTA 5ETOA 1RU2A 2BMBA 2F65A 3HT0A 5ETPA 5ETQA 4AD6A 4CYUB 1EQ0A 4M5HA 3ILIA 3MCNA 1RAOA 3HCXA 4M5IA 1CBKA 5ETKA 3HSDA 3QBCA 1RB0A 1DY3A 1HQ2A
chains in the Genus database with same CATH superfamily
1IBCB 1H74A 2XHWA 2MLYA 3J7YU 3D3CJ 4TLRA 1KHWA 2NSBA 2H54B 3LP2B 4B3RJ 3G8SA 4JI1J 3EGVA 2RS2A 3GIMA 1VQ9S 3TUZC 4M5HA 1XNQF 2HIQA 3NGUA 4CLZA 2D69A 3SDEA 4NI2A 4J90A 1N34J 4ES2A 3V5RA 2PI4A 2V0NA 3JS9A 3EICA 4FYXB 2QEXS 2B8QA 2ZH1A 4GRSA 2LQBA 3OBIA 3M8PB 2C28A 2MQPA 4V19J 1REVB 2GJ2A 1JLFB 3UN3A 3W2WA 2R8GA 4F4WA 1T3NA 5KFXA 4CRJA 4IG0B 5F0WA 1URRA 4JI5J 1L3UA 4DL0C 4F3QA 1NAQA 3I0SA 1XIQA 2AGOA 2Z58B 2UUCJ 4ZPVR 4X4TA 4KKOA 1IJEB 1Q86T 3AB4B 2DHGA 4NOHA 1QSSA 2BRKA 4FKYA 2YKNB 2YWWA 2OKQA 3GPAA 1TK5A 4HYKA 4IDKB 2ALZA 5IC6B 2QL9B 2YY3A 4FVCA 2VU5A 1WUUA 3BKTA 4OV6A 2RIJA 2BE9B 4IH7A 4KGKA 4NLWA 2FJAB 3R7SB 1HBNB 2AEFA 4QU6A 3BO4A 1RTIA 4X4VA 5A2QU 2V2ZA 4USHA 4P71A 4UUXA 1IXKA 4EWTA 1U1LA 4MTPA 1Q81T 3CCVS 4DV6F 1NDLA 3RAQA 3IWLA 1XMOJ 3FEYB 1TV6A 2CQGA 5IS2A 1IM6A 1SKUB 4ILMA 5HK4A 3LH2S 2A18A 4ZHRB 3N0VA 1LWCB 4UZCA 2KM8C 1DLOA 2J9DA 4B3RF 2MKSA 1S4FA 4WJBA 3MCMA 3P3DA 4CI0B 2X1AA 3K8WA 2RUSA 1GTHA 1YLXA 2QLFB 2V9KA 5J2QB 1N34F 5LSLA 1E6YA 5C24B 3H90A 3N5BA 1B64A 2Y0SD 4WFYA 2HQCA 4X66F 1NMEB 1HARA 3EVMA 2GAGC 2VA3A 3TEGA 4RW4B 1FO1A 3H2VE 1KDNA 2QSFA 3MEKA 2YWHA 5EHHA 4CLYA 4PXCA 4DSJA 4ETXA 4LF7F 3HD1A 2UV8G 1X5OA 2OPSA 1RT1A 1NKEA 2DRBA 4Y0FA 3HKZD 1Q79A 4B3OB 3D2WA 2V2QA 4FNIA 1L3VA 1U1MA 4DL2A 2UUCF 5BJRA 3D28A 2CQDA 4LSNA 3CD0A 4YHHF 4X62F 3RRHA 3HXMA 1R89A 4X65J 3NCPA 2DNKA 1RT2B 3UFCX 2DISA 4B08A 2JSXA 4K4UA 2FC9A 3W5XA 4AXJA 3HX9A 1LWXA 3QFWA 4AQYF 4CO2A 4S0MA 4CLTA 5F3ZA 4C8LA 4CLKA 2W9BA 2VFVA 4NX9A 5H9FJ 5ETNA 2BW2A 3HFVA 4P2XA 1N0UA 1XMOF 4A8OA 2RS8A 2UXCJ 1LWFB 4RJVA 3IO1A 2DGWA 1Q4RA 3HVRA 5ETKA 3UD4P 1KSPA 2E9RX 1TZ0A 1FDNA 3UN2A 5KT5A 4NI2B 4MIBA 3NGSA 2LDIA 2PMZD 3H40A 4RW8A 1R27B 3B78A 2YKQA 1DURA 1S0OA 4FP9A 4KBIA 5CHCB 2HBYB 3DYAA 1CSJA 2CUYA 3PY8A 1H2UX 5CYQA 2M3DA 2FD2A 2B56A 2KI2A 5B0GA 3J80Y 3W2WB 1EJ7L 3N79A 3NY0A 2ZM6J 2KKHA 2OAUA 3EXYA 4NLGA 3HD2A 5B0BA 2KL8A 1R6VA 4OZ0A 2FVCA 3G87A 3PFOA 1J2VA 3L7PA 3IR7B 1DARA 4UT4A 4DCOB 1JQGA 4DZ6A 1Y7PA 3LUYA 1VHIA 2XYGB 4ZVTB 4YDDB 2GHWA 2NZ4A 3DM2A 2UUBJ 4ECRA 4RW6A 1NZAA 1PKUA 1Y00A 4OHXA 2RDJA 5LSRA 3KYLA 2YKMA 2IFXA 2KB2A 1K8AT 4OI6A 1RTIB 4X65F 4DMZA 1SC1B 3D6FB 4OX7A 4DPUA 3V2UC 1P1LA 4U9RA 2LEAA 3QAEA 4YR0A 1WNEA 1TV6B 2XNQA 3CWJA 5KFNA 1WG4A 5IWAF 2V94A 2OTLS 3EJMA 4DSKA 4WFNQ 1PYOB 3A12A 5D4LA 2H4YB 3T1YJ 3CJ2A 2DY9A 3J81Y 1DTTA 4R8UA 1U6BA 1CEZA 1IUJA 2HK2A 2OHDA 1DLOB 1VHFA 2CG4A 2IA6A 1QDUB 3SV4A 4PQAA 5C2CA 1T8EA 1KLMA 1O51A 4ZVUB 2VOOA 2GGPA 4LBPA 3C3LA 3NGDA 1HWLA 5K14A 4C3LA 3QJPA 2VJUA 3H2LA 3W63A 2DNRA 5H1SV 3D0HE 5LXRA 3UR3C 1VRUA 2G2ZA 4DV7F 4DXLA 5AT1B 4L74A 2NUUG 1GMWD 4GKJJ 1ROFA 4RNOA 4YQWA 1CJKA 1ZM2A 1G3OA 5EX0A 3LGMA 4A47A 3IA0A 2JEFA 3FMWA 5D4PA 3JQMA 4O3RA 2CWKA 2QJ3A 5D6GA 1V3ZA 1FTCA 1M1GA 1RHQB 4OJHA 1AUSL 1PAEX 2LMIA 2MEWA 4OI2A 2VOPA 4N8OA 4LSNB 2EG1A 2X51A 2BW7A 3EX7B 5DDRC 5B0CA 2ZEJA 5H9FK 2Z56B 1T11A 1JLAA 2UUBF 5LL6d 5IOLA 9ATCB 1FD2A 3DDKA 3TNVA 4ANEA 2EFNA 4JI4J 3OT9A 2DY1A 2W01A 3A8EA 5KG3A 1HBOA 3CSKA 2NLWA 4WP8A 2B8PA 3VAGA 2XM3A 3AJ2A 2W9BB 3LGHA 3R5GA 2ATCB 5GAGU 3KUHA 2O66A 5EN1A 1TVRA 2DNLA 2KM8B 2W4CA 5HANA 3M8WA 1NDPA 1VS3A 4LSLA 3AHPA 1FEHA 4N7TA 1M0SA 2VZ9A 3R2CJ 1T05A 1YDLA 3R2DJ 3G2XA 5FDLA 3ILIA 4OZ2A 4RW8B 3T1YF 4DV1F 3UO0A 1DY3A 1JXLA 2Z0GA 4IG3B 4X4PA 3D5MA 5EX3A 3ZZRA 1LWEB 4ECYA 5AJ3J 4TU9A 1GMUA 1VQKS 1RAFB 2VUGA 5CYQB 5KG0A 3H4BA 2AJ0A 2V2KA 4NRUA 1WC3A 4LVNP 3CD5A 1KP6A 1S48A 1SKSA 1P9QC 3I4HX 4KH0B 4GVBA 4CO3A 1F1BB 2E44A 3VALA 1BC6A 1ZZFA 4GKJF 4KIAA 2YPZA 4WTYA 4F0KA 1U2CA 2BANB 1FXRA 1JKHB 1JLCA 5HP1A 1OJ4A 3Q8YA 3OXLA 5EWFA 3BPDA 3DM2B 3BH7B 1VBKA 4RW6B 3CGIA 2IM3A 3UD5A 4QJVA 2XYHB 2VBWA 1L3TA 1SC3B 8RUCA 3MCNA 2ZBPA 4DL5A 3W2VB 1VISA 4Y6IA 4QWCA 3IM9A 3GIJA 2DGOA 3TA1A 1Y5LB 3AXKA 4JI4F 5KFYA 2NZCA 2LFVA 3CIZA 2RF2A 2OUGA 4Y2MA 4NE9C 1YG0A 2HVDA 4R8UB 8ATCB 1NHVA 2Y1RI 2DEIA 1SB6A 1SI9A 2VBXA 1IKYA 1KLMB 2GNKA 2Y1LB 2J0WA 2GGPB 2YH0A 3H5YA 3NOCA 2R3VA 2BRLA 4DL6A 1PCAA 5CAAA 2NR0A 1VRUB 1RAIB 3SQGA 2VFUA 3RGIA 1QTMA 4NCAA 4C11B 1UZHA 1TL1A 4ZOSA 4BWJA 5L1IA 4LF4F 4HH0A 1X5TA 3CMAS 4LF9F 1Q7LB 5B0AA 2IJRA 2H5JB 4NLXA 1AROP 3KLFA 1CJKB 3BEGB 4ATNA 2C2EA 3EWGA 5C42A 4RW9B 4WE1B 4B9UA 1UPMB 4KH1B 4C98A 1HBMA 4ECSA 1N8RT 2VC1A 2GX8A 3NGRA 3NMRA 4ENOA 4UOHA 1F3VA 3TOQA 1W7WA 2V8VA 2HMIA 1BQNB 1RKIA 2UXDJ 1JLAB 1D1UA 1S9GA 2FHJA 3PJ9A 5E3QA 3A1YG 1JJ4A 1VIXA 4N41A 2DNQA 3FVYA 4ES3A 1WG5A 2YKPA 1ICEB 4EZ9A 2CQ0A 2XMUA 3CJ3A 4HDHA 3HLUA 3L3CA 3OFHA 4MKVA 2CPHA 3BKFA 2G2OA 4P75A 2KFNA 2ZE2A 2IC3B 2WVCA 2CJ9A 3UD3P 3G6ES 1TVRB 2DO4A 4DOZA 4PKDB 2B9WA 4F04B 5E3RA 3DRRA 3D7SB 4EGLA 1KQKA 4LRBA 2NPIA 1VQPS 3H5XA 3FMBA 1H73A 1T05B 4ED7A 1VQ7S 2PA3A 2J7KA 5FDLB 2MLZA 3BO3A 3HK2A 1P27B 5L1KA 4JI0J 3S6EA 2EPIA 2LEPA 2FHOB 3DRSA 4LRDA 1J5EJ 1U1QA 4OFZA 3V81A 1RTJA 3PW2A 2DHHA 2Z2ZA 3M1VB 3T1HJ 1A7GE 5LXYA 2JHEA 1L3KA 5KFCA 3E8OA 4F02A 4X4QA 2YQ1A 3CUNA 4USTA 1RQ0A 4QYZJ 3SCLE 1JLCB 4ELVA 2GA7A 3HF5A 5LMNJ 5HP1B 3DC2A 3BSAA 2A0FB 1WF0A 5A2QY 2HVZA 3B6BA 2HAIA 1AYEA 1S1XB 3PRDA 2ALYB 3G71S 4QU7A 2DJWA 3N6MA 3Q8PB 3Q2TC 2BJ8A 2C22A 4DR6J 1JNZB 2UXDF 2GJIA 2K3IA 2GC8A 2EFQA 4C3MA 1F3FA 4OYWA 3T19A 3ITHA 2VASA 3J7A1 3IR5B 5F8IA 1RK8A 1BD6A 1VQOS 5CABA 3JAMU 3POTB 4KY3A 4ZK7M 1HD0A 2RF2B 3J7YI 4Y28C 2FUG9 2C3OA 3CC4S 1Y10A 2DITA 1EHWA 1YZ6A 1ITPA 1VC6A 5EWGA 5CQGA 3ENQA 2P6SA 2RT3A 1IKYB 1IBKJ 3OLBA 1M1HA 2IPOB 3NWGA 2MB0B 3MPVA 1VCTA 2N3LA 3MPUB 2NXEA 4KHRA 4L72B 1QAXA 1S6OA 2PDAA 3DOLA 1SIZA 1N56A 3ILLA 3JSMB 2BE2A 5D4NA 4DQQA 2HHVA 3H42A 2M70A 1Q1KA 1UEVA 2ZVSA 1KLNA 4ZVGA 1RTHA 1IR1A 4M5DA 1HBMB 2EK6A 5ETOA 1JLBB 3CCMS 3THPA 2ZVIA 5KT3A 4NZ0A 3BZQA 3PIOQ 4ZVQB 1OPIA 3O2IA 3IG1A 4WFXA 3H8YA 1KKHA 2GO9A 2H51B 4RUCA 5LMNF 4P7VA 3R27A 2HMIB 3HCXA 4X2BA 3ADAC 2PI5A 2X1FA 1F9HA 1X4AA 4ED4A 1KBRA 4KGZB 3OR2A 1U48A 3EDRB 2ZH3A 1Y11A 2V5HG 4P10A 2BKNA 2EKNA 3I5BA 3R5DA 2ZOFA 4DR6F 3EUNA 1H3DA 3QJLA 2CQ3A 1F9FA 1S10A 2I5JA 1XERA 2XY7A 3AA8A 2CRLA 3DRRB 3ZZUA 3KK3A 1RKJA 4M5JA 3UCZP 1UW4A 4H4OB 1FVQA 4TXSA 4ZPCA 3CTRA 2JL9A 4CIOA 2WVFA 5E7OB 3QRQA 2B9EA 1RA7A 5ETQA 5U47A 5F8GA 2QTWA 2R7SA 1VFJA 3DRSB 2QIFA 1WC0A 4JBCA 1BQMA 4QYZK 4QWEA 3QQCD 1U2RA 3V81B 1EQMA 4CQ1A 1U0SA 1RTJB 1OMSA 5J2PA 2J6SA 2AWZA 3PNIA 2FLPA 5D3GA 3Q0AA 3BREA 4B02A 3RR7A 4AXIA 5D15A 1Q78A 4LQ9A 5J1EB 3NS5A 2KVIA 2Z2MA 2KG0A 2CPXA 4OYIA 3G6VA 4LFAJ 2ILZA 2VPZB 2JLFA 3FZ2A 1YJWS 3W1YC 2DHSA 5FLXU 4NCGA 1ULRA 2AGPA 4MKAA 3ZTQA 1MN7A 3PACA 3FCVA 3SYZA 2A6MA 2MZQA 2WBRA 2KTQA 3GCWP 4WFZA 4ZLJA 1TU0B 2JEJA 1ZAVA 2E5JA 2M9KA 1EKRA 4LF5J 1RADB 1RACB 4HHUA 3DOKA 1RWOB 4I7FB 1S12A 3A4TA 1JLEA 3G9CA 4NXNJ 2OIHA 3RG6A 4L76A 4DV0J 1X8DA 2QYGA 5GAEI 3I6PA 4YB7A 2ZZMA 1UJ5A 1WDTA 3ITHB 2Y8YA 2MXYA 2DR7A 3HM9A 4ANCA 2YNGA 4O3NA 4R0EA 3PIPQ 3KJFB 5DM7Q 2I8EA 1S97A 1X9SA 2UXBF 2AEJA 1XMBA 2XMWA 4DPXA 2WK4A 1UVKA 2J76E 3UI3A 1SKWA 2CVIA 4QQBA 3IM8A 4N47A 2N82B 3MFIA 3W60A 2XI3A 2W2PP 1W2IA 4TQRA 5KT2A 3FBCA 1YITS 2GQQA 2LU1A 3NNCA 3MM9A 1UWBA 2LA4A 3DOLB 5L9XA 5ETMA 1MWZA 1TUVA 1YIJS 3GSIA 4HKQA 1S59A 4EK2A 4OV1A 3N28A 2ZBCA 3CJTA 4E2FB 1RTHB 3MUTP 2OP5A 2CDRB 1UWAA 1T9WA 4FYYB 2IVMA 4P73A 4PWWA 2KT2A 1P9YA 2YX7A 3CJKA 3UCUP 4HH1A 2OEJA 4NA1A 3IG1B 1X4FA 3PG9A 1X7VA 1SPBP 1BWEA 1NSPA 4OI3A 1RT6A 2HQDA 3CCJS 1S0VA 1RAHB 2GVDA 3DRYA 4G6VB 4F2RA 3OR2B 2R7UA 1YBUA 1DZ5A 4YY3J 4F4KA 4K5RA 1CC7A 4NXNF 2I2YA 1CJVB 1B0VA 2DB1A 4G1IA 2LXFA 2B9XA 3CCSS 2E5LF 2XCPA 2FVPA 4BDPA 2QMXA 2DYAA 1ZTWA 2I5JB 4CP5A 4C2MA 3KK3B 4UOGA 1GNKA 2ERRA 1RT3A 4F25A 3I87A 1N5QA 2OD4A 3S01A 3NGTA 1K47A 2B4OA 1S4EA 4B9LA 1HR0J 3KFWX 4OJGA 4J9MA 3MR7A 4KV8A 4KHPF 2IVYA 3DFEA 2OPPA 1BLUA 3WDOA 1DJ0A 3KWMA 2QFJA 4FF1A 4U7UK 3ILJA 3ETMA 2MKJA 4MYUA 5KFBA 2OLWA 4G65A 2GAHC 3TX8A 5J2PB 5D3GB 1T9XA 2F8HA 4LBIA 3LP1A 3OHAA 3G86A 3W5YA 5GAHI 4XIUA 1H2VZ 1MWQA 4NCGB 1RXOB 2HZCA 2YPYA 2XEXA 5E3PA 4KPCA 3UWTA 3QWUA 3SEOA 2R9LA 1M5HA 4OHZA 2MQQA 3DOMA 1A0OB 3BBFA 2LEBA 4WFAQ 4NZ7A 3UDEA 2IJNA 4CLFA 3MM6A 2VG5A 3QAUA 3WBZA 3GU0A 5A6PA 2Q1LA 2MHEA 1PYSB 3DOKB 3FSXA 1OIAA 4LREA 2IVFB 2HURA 4IR1A 1S79A 1YJRA 1U4BA 1T94A 2FGCA 3LWMA 5KFPA 4OZ1A 2M8HA 4DZDA 2AYBA 3CD6S 7FD1A 1NSQA 2XSFA 2YNGB 4E0DA 4DUZF 2FZGB 2J5AA 3D67A 1W26A 5L1JA 4J9PA 4DFKA 5GAGI 1IJFB 1S1TA 4ZCIA 4K7QA 4BS2A 3A3OB 4DBQA 2HBZB 4PUOA 3M2UA 3IAS9 3GONA 3K5LA 4MIAA 2HPUA 4WKRA 3QT8A 2HLTA 3KG4A 1RHKB 1YHQS 2O01C 2VDIA 1K0TA 2IM2A 2NXUA 5LT5A 1SVDA 3B4MA 4RWXA 2JVRA 1UWBB 3CJQA 4Z7YA 3VAHA 1E6VA 4QW9A 4G3IA 2CNKB 4NLUA 5L39A 2G1DA 3NXZA 5IXUA 3DKDA 2BJ3A 2L9WA 4X64J 4F0HA 1WF2A 4A8QA 2Q79A 1S49A 3R5CA 3BGFA 3NBPA 2RAQA 4YB1P 3EVOA 5B0FA 3RRKA 5B7WA 5KFOA 1I6JA 2GO8A 5HI7A 1R8PA 3T41A 4KAIA 3OTDA 1XWLA 3CJKB 5KFKA 1TAQA 4Y3CA 2DGUA 2GW8A 4DX5A 4L6V3 3T9ZA 1XK8A 1TKDA 2E5HA 3QLHA 1RT6B 3TZYA 2GVDB 5ETPA 5DDQC 3SZ2A 3MPDA 5F9NA 3HVTB 4ZMMA 1FRMA 2PFFB 1IBLF 2P9EA 3G6XA 3AFGA 1NJXA 5ADZA 4ZVFA 4Y2IA 3FCHA 1F6TA 2BKPA 1AZSB 1F9EB 3H5SA 3KK2A 4QPXA 1Q7YT 1CC8A 3N4WA 3JTPA 3KLIA 1SJ1A 4B9MA 2IRYA 3MMAA 3FSYA 4DUYJ 3BBCA 1JMTA 1NLKL 2I9SA 4NLSA 3OJSA 2ZHBA 3M2RA 3HHLC 2NXJA 2BOAA 3T1AA 1FJEB 4PXEA 3SCJE 3BS9A 2OPPB 1U1KA 3BO2A 1U49A 4Q43A 4MKYA 1UW9A 1R8AA 1Y3KA 2ZKTA 2FPHX 2R8KA 2CPJA 3TEHB 3PO5A 2L9DA 3SSRA 1N5YA 3GV7B 4NASA 3VZHA 1T9VA 2FHMA 1M5VC 3LP1B 3EZUA 3GJSB 4DFMA 1M5PC 4UY8T 3HSJA 2D3OR 5B0DA 2I0XA 5G4DA 4EBEA 5D8HB 5G0RB 1QUPA 3S7RA 1NO8A 3ENAA 3DOMB 1VBXA 5K8NA 1HNVA 2G2YA 3IWNC 2WB1D 1XNRJ 4F2SA 3GG0A 2VG5B 3MD3A 4DU8A 3ET6B 2PD1A 3BYRA 1IM4A 5JVGQ 4IFYA 4AL7A 1NDCA 1VLYA 1SQGA 2XZWA 2W2NP 4DR2J 2ZJRQ 4HR2A 2AT1B 1NK8A 5KG2A 1S1UA 4Q8FA 2APOA 1C1CA 1K1QA 2DNGA 4KSEB 1D09B 2GIRA 4WIQA 5DM6Q 3VGSA 4FF3A 3SSSA 2LYVA 1T03A 1S1TB 4WPAA 3THTA 2OFHX 4PUOB 3M2UB 3VWSA 1AFJA 3HHLA 1Z2LA 2BM1A 1GMVA 3CCQS 2OPRA 1C2PA 1WWHA 2JLGA 1WEXA 5KFRA 3PW7A 1MG7A 4OHYA 3BSOA 3IS9A 1OSCA 3CC2S 2DCUB 3RBDA 4JOUA 1E6VB 5IM0A 5IZHA 2E1AA 4JI2J 2W8KA 4ECVA 5EDWA 2RH3A 4KR0B 4ALZA 3WC0A 3DLKA 4KTQA 2LQ8A 3E2EA 3ZZTA 2FLNA 5CA5A 2BJ1A 4V1Ak 2ZD1A 3CDUA 3NBPB 2F9JA 2RQ4A 1N88A 1C4AA 3K89A 2D3UA 2WTFA 5JJBA 3W8GA 4K4WA 2VFSA 2DGVA 2MDAA 3SMZA 2WONB 4FPIA 3ENWA 4LUBA 1C0UB 1VBZA 5IV3A 3CT9A 4ETZA 2HNZB 5D0GA 4DX6A 4ZJLA 3MCSA 3ULHA 1TUGB 3C6TA 4DR2F 1DTQA 2NPFA 4M5GA 2CAJA 4OMFG 5F41A 5J2NA 2KVQE 3KK2B 5KG7A 4X4OA 2UVWA 4TQSA 1F2GA 1FRXA 1OYEA 1C1BB 4P2SA 3OL8A 4RPFA 2MKYA 1HQEA 4J9VA 3DNCA 3VHQA 3OJUA 3RYLA 3KLIB 3ILOA 4DV4J 1JXVA 2VHGA 4LF8F 1PJ5A 2UVRA 2ZZTA 1DBDA 3M2RB 1LW2B 1RHUB 5DRKA 5KOXA 3PJWA 5J1PA 2HBQB 1Q0NA 4J37A 3GTYX 2P6TA 2HW3A 3KDOA 2CYYA 3HVWA 2MGZA 4LIWA 3FBEA 2R2UA 3S8SA 5FLXY 2J9DE 4Q5VA 5I3QA 3CJSA 4ZVRB 2CWXA 3D1QA 3TJAA 1TELA 4R5PA 2UP1A 4NWBA 3RZAA 3AT1B 2CPZA 3MECA 3DXBA 4FVMA 3TO8A 4MJKA 1N32J 1T9YA 5CD4A 1GX5A 3A8JA 3FFIA 3MURP 2B5JA 2FTRA 2X1GA 2MKHA 1MLAA 2IRUA 4USVA 3I56S 2EK1A 3SFUA 5CYJA 3NS7B 4IFYB 3PR5B 1C4CA 4WIIA 2CKWA 2CNNB 1GXUA 2PEBA 1Z1ZA 2ZBRA 1YSJA 1S1UB 3MUMP 3TZZA 5I4MA 1JJCB 1C1CB 2G13A 3UDLA 1TL3A 1J5OB 2ACYA 2V34A 4F3MA 2C2KB 5KT7A 4JYAJ 3M05A 4ECTA 3AA9A 1WC1A 4DJBA 1X31C 4JI6F 2KZZA 2UUWA 3MTKA 1WEYA 3HHLB 3KHGA 5HBMA 1H7WA 4N8NA 1RT7B 4D3GA 3VQSA 3CB4A 1UJ6A 1YZ7A 3R6GB 3C16B 1Z4UA 1TL5A 2K8GA 2O1PA 5I3UA 2IMOA 2JH3A 3W8PA 4FNHA 3IS9B 3IBFB 1X5PA 3HPOA 5HROB 4ZPTR 3QT6A 2J9CA 3B8HA 5IM0B 3PX6A 1ZAWA 2CQ2A 1FE4A 3HJFA 3DLKB 3J7Z5 5IQQA 2CQPA 2PO4A 4MK7A 3MF5A 2ZD1B 1HL6A 4TLQA 3N6NA 4QPTA 3MR2A 2BUNA 3CE8A 5JVHQ 4WCEQ 2OJ3A 2ZC4A 4OYBA 3KJVA 1WC6A 2H4WB 4OYMA 4WU3A 1SBRA 3QFHA 2KH9A 2CQHA 1S77D 5I42A 2WBMA 2LLZA 3LW5C 5KFUA 2PSZA 4IOAQ 1TFYA 3MDFA 1GT8A 2IDLA 4DR5J 2XMVA 1JLQA 1TAUA 3V6DA 1FDAA 3QJJA 3C6TB 4LR7A 5K9FA 3HMJG 4HI2A 1DTQB 4HACB 1JXEA 4EFAC 2EC0A 5J2NB 3HFZB 1T02A 2QX0A 2JOQA 4O4RA 4I69A 2HRTA 3D6TB 2BJ7A 3CF5Q 3LAKA 4QWAA 1EP4A 4NEYA 2WVDA 2R4FA 1SH3A 2HVIA 1HYSA 4YEAA 3OVAA 1G7CB 1XR6A 5KFEA 3G82A 5L46A 1UMJA 2ZUAA 2CQ1A 3BJYA 3IRXA 4ECQA 3MXHP 2VG7A 1HWKA 1VQ8S 4X4SA 4EZ6A 3MMCA 2WRMA 1P6TA 3VF0B 1GXTA 1UETA 2GCFA 2MGZB 3JQKA 1HFEL 1WOOA 1YJNS 3ICLA 2V4QA 5EGYA 1HNWF 3M6UA 4XK8C 3F73A 1U24A 1Q5VA 5T7LA 2B7BB 1VQNS 3BKUA 2GIFA 3NS6A 2E7XA 1VK3A 1HBUA 1I5OB 3BB5A 1X4GA 1B70B 5EUHA 2RKIA 4FS2A 5D0EA 2OGUA 5J2MB 3M32A 1BXNA 2VD3A 3GJQB 3R1LA 1B7YB 1RJJA 2DGXA 2VQEF 2L08A 3N5FA 1I51B 1U0HA 1R31A 5M2RA 4DV2J 3SBMA 4PQUA 3GIKA 3OL9A 3SI8A 6FD1A 2ADCA 1RBAA 4DR5F 2V67A 4N5SA 1TL7A 2G0CA 1N36J 4PG7A 3TAMA 1HKAA 2GQCA 4DPOA 2QLJB 3PHEA 3P96A 3EPGA 3UDCA 3KOAA 4Z37A 3D0GE 5CZXA 1Q95G 1UFWA 2C2NA 3ZZYA 1FRJA 1TKTB 1R0AA 5KFZA 5HBMB 2EBEA 3N9UC 4O4GB 5BR8J 1XNQJ 1RTZA 3X3UA 1EX8A 3H4DA 3DCAA 1KVIA 5I3UB 3K5NA 3V6HA 1ZETA 3RR8A 3PVXA 3SCKE 2NYHA 2J6UA 1F5AA 2AYMA 3JSRA 1KEKA 1RI7A 2Z30B 1UTAA 2DK2A 2KDOA 4ZA1A 4FZVA 3R6LB 1SUQA 1UFLA 3I0RA 2ZDPA 3DLEA 4OI1A 3VAIA 1ZA1B 1G4CA 2CPYA 1HMVA 2PE8A 1SIWB 4R0JA 3VR1A 3ZZPA 4WZMA 2R8HA 2RQMA 2G4BA 4YR2A 3RU0A 1OYDA 2Z57B 2OMOA 2NUHA 4X4RA 3M8QA 4CZCA 3LANA 4DN0A 1T9UA 2KYZA 4F36A 1U09A 3BGOP 3FC9A 3BPSP 2JRSA 1MWYA 2CJBA 3I31A 3V6DB 4KQZA 4YS2A 1S6PA 3OXFA 1SJ4P 4KFBA 3B54A 2JVOA 1SKRA 4I2PA 4M5KA 3M9MB 2LECA 3FBBA 4DV6J 4ZPWR 3AOAA 4EUVA 2HWTA 2BQUA 5HLFA 4LFBF 1VDHA 3KHLA 2DH9A 3F56A 1N36F 2FIUA 4O3PA 2X1BA 1EP4B 4DX7A 2W7PA 3D9BA 2EBGA 2VH7A 1LNQA 3QGGA 2DXEA 2WCXA 2VONA 4ZPDA 2XWYA 1KS2A 2N7YA 1HYSB 3T9NA 4RL1A 1X4EA 3G82B 3IRXB 2VG7B 4OZNA 3BR9A 4EU0A 2ASDA 2YKAA 5BR8F 2DH8A 4XTTA 2IY5B 1QM9A 4Y2CA 1G1XA 5DS7A 5BYRA 3TW0A 4OX9J 2EEYA 3PKYA 3DGVA 4PG6A 2Y1IA 4X66J 1QAYA 3MM5A 5DLGA 2UUAF 1QSLA 4J9QA 3RB0A 1MMDA 1AUDA 1RWPB 3TVKA 4LF7J 1FX4A 2CQCA 4C8MA 1XMQF 2U2FA 2NQPA 1Q16B 1FJ7A 2RKIB 3D54A 3L4BC 2DNPA 3KXDA 5LM7E 2YWKA 3P4UB 4KGMA 1P1TA 2GVZA 4WKYA 3CO9A 2XYPB 2MSTA 1D8YA 3O44A 4YHHJ 4X62J 1U0HB 3GP9A 3UNGC 2MQLA 2XMMA 3DLGA 5IV4A 1EZZB 2N3OA 4DLGA 4PQUB 4ZN3A 1TP7A 3CDWA 2LKZA 4OJ3A 1NU4A 1CVJA 2G1HA 3TQEA 5LSOA 3LAMA 5F8NA 1VC0A 2DD8S 3D66A 4PYDA 4ANDA 1NHUA 4AQYJ 2EFPA 2AHOB 1HHQA 3TAMB 2ZKUA 4J91A 2KFZA 4JI3F 2OI2A 2D1CA 4URSA 2YXLA 1S1WA 1VK8A 1WEZA 3KLGA 2FVSA 4LQ3A 2B9YA 1RWXB 1R0AB 1KTVA 3W9JA 2HSEB 3EVWA 1WKJA 4NEZA 2R2TA 1V3SA 5LJ3Y 2RRBA 3VAMA 2HS4A 2BQ3A 2FVQA 2V9WA 2PT0A 4F67A 2BE7D 2HQFA 1UEUA 1URNA 1SUQB 3H5UA 4QIFA 4OX9F 4RLEA 2F65A 4ILLA 2YX4A 4M5IA 3FEXB 4DPWA 3DLEB 3EE3A 2A3JA 2WHOA 1HMVB 1NH7A 2EKYA 3W66A 1TMMA 4B17A 2Z4PA 1CJTA 1WKKA 1TK0A 4CM2A 1YJVA 1PBUA 1N5TA 1S72S 2CZ9A 3DU6A 4DSLA 4CLSA 1H72C 4ZCLA 5IT9U 1FE0A 4C8NA 4HI1A 4DQPA 4EBDA 2VKZG 3DRPA 3OSPA 4OYPA 2O3DA 5CH7B 3NCQA 1BY9A 1FKAF 1MW7A 1S6PB 3BF4A 1R43A 4G1PA 3HDSA 4KFBB 4M8LA 3FSIA 1R0BG 1TR0A 2MQNA 1NK6A 5GADI 5A0YA 2GMJA 4HL9A 1MU2A 4KHMA 5GAEU 1RAJA 5HLFB 4W92B 3W5ZA 5GMEA 3KDNA 2FJEB 3LP0A 2ZFHA 1FXDA 5IWAJ 3HHKA 2W2OP 2IRXA 3Q83A 4O44A 4M95A 2VFTA 2JFDA 2AGQA 4ZKAA 1IKWA 4FKXA 3OFGA 4C0OC 3M9OB 1F0XA 5FIIA 3ZXWA 2LQ5A 3Q89A 2FZCB 2GV1A 4E8UA 1S76D 3SDEB 1KOOA 5KFLA 3RB3A 2K2PA 1TFWA 4A8YA 3CJRA 2LDYA 3PXGa 4GVLA 2VPWB 2QLBB 1HPZA 1RCXB 1NK7A 4GO7X 3HP6A 4DV7J 1UVLA 4FYVB 4OI4A 1NM2A 2AEMA 2L9NA 5HMWA 3RRGA 4USIA 4RUAA 4DQRA 3H98A 5AXNA 4R25A 2QFIA 5AXMA 4USUA 2AV5A 4NLVA 4P7TA 4WYWA 1SL1A 4ID5A 2K7JA 1RYSA 1FNMA 4LVOP 2KT5A 3G6YA 3KMSA 2VB6A 3I0SB 1H38A 5DLFA 1REGX 5HMZA 4G1QA 4KKOB 4ZVOB 2QA1A 3O1LA 2Y8WA 2FY8A 3DLGB 2WB4A 3N01A 3RAMA 3PEHA 3HHLD 3F41A 2IDEA 2HS3A 3CVKA 2LXIA 5IT0A 2W7OA 2RHSB 2P8IA 2YVSA 1X0PA 1HNXJ 3MCOA 1Q8IA 4B3MF 1C0TA 3BGUA 3SXLA 4QYRA 1QAIA 5F3TA 2XS7A 3GFZA 2YNHA 1WG1A 4BHQA 4J9RA 2XLKA 1S1WB 5J1NA 3MHYA 2MQMA 2CDQA 1PIEA 4ZN1A 3UR0A 1KVKA 3R5AA 3GFXA 2X7IA 2AJQA 5L9NA 4QWBA 1SJFA 2DGQA 1F5BA 1UA0A 4DV1J 4N77A 1FTRA 1FT8A 4QZVB 1YRTA 3ZZ0A 4PR6A 1NKBA 1RDRA 4OYOA 2ZHOA 3LO3A 2QSWA 2HQ3A 1S9EA 2AJFE 2B4PA 1VQSA 3VGVA 4H4MA 4O0IA 1KONA 2AYGA 5FJ4A 3V4IA 4B9SA 3DI6A 1E6YB 3WX8A 2I38A 2WSCC 1CJUA 1FFSB 2A10A 2IHR1 1CJTB 7AT1B 2VPXB 3Q8UA 2DR6A 1IQTA 5GAHU 3SCIE 1LFWA 4MIWA 1R8HA 4ITSA 4U7CA 2OPSB 1FJGJ 1FWKA 2ZH9A 1RT1B 4A4JA 5M2UA 1G6BA 4RNMA 2XLIA 5LOQA 3MD1A 4F4XA 2PMWA 4TYBA 4A46A 2QT7A 4U95A 4NA3A 4TY8A 4ZP9A 3G8TA 3DRPB 1YTYA 1KQSR 1U7LA 5KFIA 4UQGA 1I94F 1RLCL 1N6QA 2E9ZA 2FQQB 4IKAA 3MR6A 2RQCA 5HVGA 5A0YB 1MU2B 5I3PA 1OO0B 2CJXB 4Q8EA 1NHKL 1HNXF 3P5TL 1WHXA 4DCPB 4E98A 3CDAA 3LP0B 3MEEA 4U67Q 3H0PA 5B09A 4O44B 1RP5A 2HIYA 1BE4A 1HD1A 2HHQA 3BN4A 2BM0A 1HIYA 2H5IB 3NG8A 1EARA 3PYFA 2G0IA 2GS8A 3AODA 1U1PA 3JTNA 3RJMB 4FXVA 2XMKA 2ZC3A 1RLDA 4CLWA 5KFJA 1TMJA 3MFHA 4DR4F 4I0WA 2XNRA 2XCAA 4NA2A 2HHHF 4C8YA 3TUIC 2HVHA 4A8XA 3VAKA 1HPZB 1XR7A 2XS2A 2DRDA 5KFAA 4ZP8A 3DYAB 5AE1A 1KC8T 4LF4J 2QV6A 2EG2A 3GFHA 4DFPA 4LF9J 2JDJA 2KN4A 4KB7A 4CH7A 3M2VA 2LQJA 4C9DA 2O67A 4UOFA 3R5JB 1VYAA 2ZNYA 4ID5B 2W8LA 2A2DA 4URGA 2KXHA 2CZVC 2MLXA 3OSNA 5HQ8A 2RSQA 5F8MA 1AA1B 1VLOA 5BYQA 2GHVC 4LMZA 3MM8A 1IBMJ 4G1QB 3LGNA 1LOUA 1FJGF 2QA4S 2WW8A 4TVAB 4K59A 2ZJQQ 4KT0C 2J7UA 2CIMA 4RR5A 4LT6A 2A1BA 3GG1A 4IO9Q 2YKMB 3CCZA 1L3SA 2MKIA 1C0TB 1NJWA 4DR3F 2CJYB 3QRRA 2YNHB 3AAWB 4U6PA 4Q2LA 2CJQA 2V4RA 4QIVA 8AT1B 2Y0BB 3DDNA 4K4SA 1O8BA 4HT5A 2M52A 1JLGA 3W9HA 2HFVA 4YR3A 4RNNA 3DMJA 1RWWB 2E7WA 3CCLS 3PFEA 1K0VA 1DTTB 4FXDA 1OQ3A 3KUEA 2WVEA 1ELOA 2DIVA 1IVZA 2EFVA 1WTFA 1S9EB 3NOGA 1PC5A 3ZTRA 4EI2A 2HHXA 4H4MB 4MT1A 1LEOA 5K14B 3V4IB 1NSKL 3DI6B 2GIQA 4F4AA 2MZSA 4M1KA 3K17A 1CJUB 2DNHA 1PAUB 3CDBA 3JXOA 4FYWB 3KUGA 4CM0A 2VQFJ 1XC9A 2B6AA 2EI5A 3M8PA 1FFGB 1X60A 1REVA 4DSEA 3OL7A 1FRHA 5ITHA 3IFEA 2DNNA 4JV5F 1XJWB 1U6FA 1JB0C 4IG0A 3TA0A 1IBMF 1A9NB 4TY8B 4WP3A 4B3SF 2KRBA 2HHUA 4NLTA 4ICLA 3PR4A 3BGLA 1N6QB 3Q22A 2IYIA 3SQOP 2GQ2A 3G8QA 1QE1A 2R8IA 2XS5A 3MEEB 2AJ4A 1HBOB 4USWA 1KWMA 4LFCF 1HBNA 3ISNC 3OLAA 2CPFA 1NXIA 4ECXA 1LXNA 4A8KA 1RSCA 3FNNA 4FF4A 4DF4A 4LR8A 1BGXT 4LSLB 2R7XA 2Y3YA 1RAEB 4HVZA 2ZH7A 2A6OA 1SC6A 2WVBA 4DHVA 1X4BA 4ZHRA 3IC1A 5T14A 2ABYA 5KFWA 4XDCA 3US5A 1LWCA 5HATA 1ZAXA 2UU9F 1ZBTA 5C25A 3K2YA 4PEOA 2LA6A 1CQNA 1OPZA 3M2VB 3R8YA 3HSZA 2E1RA 2OEMA 5J2QA 2BJ9A 4GVBB 1DHMA 1LK7A 1ZH5A 2MQOA 1T9TA 4C8KA 1FVSA 1ZPVA 2BDPA 2WW4A 2E5GA 2VQFF 4RW4A 4CH0S 3MM8B 3HZEA 4YB6A 1KR4A 2E1PA 1RAAB 4X84A 4PG5A 3ENVA 3U7JA 1PILA 1RCOB 4YMEA 1B7FA 3D0IE 5SZTA 3OR1A 1UVNA 2HHPA 4DR7F 3MTJA 2VA2A 1RUSA 3T3FA 3GFYA 4F4YA 2W1BA 3J81j 1ZM4A 3EM1A 3MEDA 1D3WA 1RAOA 3O3LA 3TAPA 1HQ2A 4M5NA 4Y2AA 2W9AA 4QR0A 2HNDA 3PX0A 1JLGB 2ASJA 2NS1B 2AJ1A 3RW7A 3DMJB 2BR0A 4QIGA 3M8YA 4ED6A 3GR0A 3JYTA 1FNXH 3CMQA 1EAYC 1CS4A 4UY85 1LWFA 2IYGA 2DNMA 2MHNA 1NRKA 3VQTA 5AE3A 2ROPA 3RB4A 1WHVA 1S7IA 1U8WA 3SQGB 4K0KF 3LA0A 1QAJA 4C0BA 2GZOA 2J0QD 5K8MA 3U1NA 1TL1B 4RU9A 1FCAA 4OX8A 3L09A 1YBAA 5D4OA 3I5AA 5DQIA 5IT9Y 2CG8A 4K4ZA 3KLFB 1VI7A 4PWDA 5C42B 2EFOA 2B6AB 4QBUA 3IP0A 1RU1A 4XO0A 3QPIA 2MMYA 2D3O1 3C66A 1FRIA 4ZPBA 4JI8J 2RUGA 2IAJA 4QWDA 3K5PA 3FEZA 2WAQD 2B0GA 4ICLB 4OLPA 2DVIA 2RVJA 3NRBA 3PCOB 1S9GB 3THVA 2VICA 1HI8A 2H5EA 4MK8A 2VFRA 4RBVA 1QE1B 4DV3F 1W2BR 4IRKA 2AQ4A 3KNAA 2UXBJ 2R7VA 4NYPA 1SQFA 1W25A 3W61A 4P74A 1GAOA 2W24A 5HQMA 2ZE2B 5ETVA 2YNFA 4ED8A 1NH8A 3DHWC 1UAWA 1M5OC 4LF6F 2HS0A 2XZDB 3PYEA 2YTCA 2XQCA 5AXLA 2PMHA 1XTZA 4PPZA 4PPDA 3GYXB 3W3SA 1RT5A 3TZXA 2IM0A 1WKLA 3HSDA 4Q45A 4JI1F 5C25B 4RZRA 3HKWA 4O3OA 4PXDA 1DRZA 2GMHA 3RUBL 3P6YC 5BXIA 3IXQA 4Y00A 1LQ9A 5E5NA 3R3TA 3H59A 1Y3JA 4ID8A 3CCWA 4HHHA 2N4DA 3EPIA 4DFJA 1IQZA 3QZ8A 3ZTPA 4XPEA 3WC2A 2HLUA 2EXUA 4LRCA 4O0NA 1JJ2R 1PG5B 4RO0A 4J9KA 2HFOA 4BC9A 2J0SD 2BYCA 1DFDA 4JI8F 3WIUA 4MFBA 4BC7A 2AJ2A 4JI5F 3IBWA 3OR1B 2KHCA 3D1HA 3QIDA 3O8WA 2B43A 2WSFC 1SQEA 4DU7A 4KGXB 2XY6A 1R0CB 2XULA 2PGCA 2ZWOA 4PXBA 2ZBIA 2DHAA 2HZVA 4F7VA 1AFIA 2Z8QA 1HHTP 3MEDB 2DGTA 2E5LJ 5KFTA 3DHXA 2I1RA 3M8RA 4N76A 1YRUA 4XDDA 2P2CB 2HNDB 1KD1T 3MAHA 3TYTA 3BYPA 4TN2A 5JUMA 3TVZA 3Q2SC 4ILRA 1CPZA 3JYTB 2W7AA 4BCAA 2RB7A 1S9FA 4KHPJ 3CJ8A 2OD6A 2ZWPA 3DLJA 5JXSA 3PTWA 1CS4B 5HO4A 1NB2A 5D77A 2OPQA 4I56A 1D9FA 2JJ4D 4Y65A 4XAKA 1UEKA 4IG3A 2VC0A 4WXWA 5KFSA 1QLNA 1TQLA 2BE2B 1N5SA 2IIHA 3K7RA 1SL0A 5JMNA 4IH6A 1HWUA 1LWEA 2QZ8A 1TUWA 2QN6B 3H2UB 5CD4H 4PWDB 4EBCA 2ZH4A 2OSQA 1UVMA 4UF4A 3ZNUA 2HVEA 4M5DB 2CQBA 1X9WA 2YNIA 3DLHA 3R7NB 1SCJB 1RE1B 3KNGA 3IMQJ 3CJ5A 1RBOB 2FDNA 3TAQA 4Q2MA 1MMNA 3RW6A 2IAJB 2HFZA 3J7ZT 2BANA 1NK0A 2HZAA 1DAXA 1JKHA 2OO4A 2Z2LA 1KN6A 2HKEA 4YN3B 2MQ8A 3VVUA 4ZCKA 3GJRB 1S0MA 4KO0A 2J8AA 5E3CA 4YOEA 3OFFA 4ECUA 2RMLA 4DUZJ 1S7HA 1QD1A 1U8SA 3K0JA 4GC7A 3FK4A 3W2VA 4TYAA 2V63A 2YNFB 1OSDA 5D78A 4NLPA 4AT1B 4M5MA 3KK1A 1M90T 2VBYA 1VRTA 1CBKA 1MMLA 1FESA 3ZZOA 2V68A 3UN5A 2FY1A 5HVFA 1OY6A 4ZDNA 3AD8C 3U1LA 1EKSA 4WBFA 1VJWA 4CLPA 4WFBQ 2HWHA 3IN5A 1RT5B 5ETSA 2Y9HA 4LF1A 1BQMB 2UXCF 2PN6A 2HHSA 2F9DA 5DG8A 2FJVA 5KFMA 4IFVA 4AE5A 3BV8A 2AD9A 3IRWP 1HI0P 2JC1A 3W65A 3M6VA 4DEZA 1M5KC 4BBYA 3LQVA 2L3MA 4C11A 3QATA 5DDOC 1QVGR 2EFGA 4OI0A 2GMLA 4HDGA 1VQYA 4B9VA 2D7SA 1XEZA 1CG2A 2GJFA 3T5KA 4RW9A 4WE1A 3EGNA 3MM7A 4C8ZA 3BGRA 3CJ4A 5DZ6A 2ZM6F 3DGPA 1FF2A 4P52A 4MFBB 3PRBA 3CEDA 4P2FA 4RBUA 1IBLJ 1APSA 4QOTA 4K50A 1PSDA 1JLEB 4WZQA 4A48A 3KMQA 2H3EB 4CYUA 5DDPC 4M5LA 3A3PB 3E01A 2ZH8A 1WOSA 2V8DA 4O3QA 2G9OA 4PG8A 3LPYA 1BQNA 3ISZA 5C5JA 3CCES 4LJMA 1YK9A 3CXCR 2XMAA 2DPIA 2OSRA 5D0HA 3SSQA 3ONQA 4IQMA 1L5UA 3Q8VA 2AW0A 5H9EJ 3R97A 4F3OA 1PYTA 1N52B 7FDRA 1QUVA 3E51A 3GWCA 2IC3A 4DQIA 2R7TA 1V9OA 1YJ9S 5GVQA 1RYRA 1TTHB 2OPQB 4EO8A 1KQFB 3QGPA 2YWGA 1R3NA 2CPIA 3QT7A 3MM9B 3C46A 1KOHA 2MZJA 1VQLS 1ZM9A 1FRKA 4BLGA 5DG7A 4HTIA 1YQHA 4C0HA 4NMXA 2JX2A 3HT0A 2F40A 1RWKB 3AOBA 1HNZJ 4IO1A 4ZP6A 4KYZA 2P5VA 3M1VA 2YNIB 2MY7A 1V6HA 1NJIT 5CXTA 2PIIA 3MMJA 3PRVA 1B0TA 4YDXA 5MLCV 4KPYA 3QO9A 1GQEA 3TX0A 4QIWD 1OY8A 1TKZA 4DDFA 4NLOA 1WI6A 4CO5A 1IKXA 4ELTA 4KO0B 1FNOA 1N33J 1EQ0A 4PABA 1FI4A 1LV5A 4DF8A 1FERA 1RISA 1FRLA 2FJDB 4ZLLA 4RW7A 4U7UD 1S1XA 1NPKA 1FXLA 2RQKA 4HLBA 2KO1A 5KFFA 3C14A 1KFSA 4U8VA 1LXJA 4ECZA 4I67A 3M30A 4C6AA 4FS1A 2RU3A 2CZ4A 2LCWA 1YJ7A 3WQPA 3KK1B 5HQLA 1IWAA 1VRTB 1NCLA 1RT3B 1HW9A 3GV5B 4IYQA 3KTQA 1UJ4A 1ZPWX 3POTA 4I2QA 3CC7S 1B4SA 2B7CB 4FDFA 4KV8B 4B9TA 2FHKA 4JV0A 4ZVHA 1EIYB 3IBCB 2P9CA 4P2MA 2KXFA 3OVSA 3GYGA 4OHWA 3S1TA 3DN9A 3CJ0A 1SC4B 1H6KX 2J7WA 4QR1A 3ZTOA 5F9LA 3MMBA 2XY5A 2IBOA 2R7OA 1ZTTA 3W62A 5SUHA 4GC6A 5AE2A 1PGZA 4IFVB 3CULA 4YP3A 3VV2B 1VOMA 1XBWA 5B0EA 3FZBA 3JSMA 5AJ3F 5BYSA 2F5GA 5K8OA 4NYZA 1HNZF 1N0VC 5CCMA 4CT8A 3TR5A 3BBBA 1U1RA 3MM7B 2DR5A 3BGRB 5HVHA 3WIVA 1JLBA 3DGPB 1T0TV 4FPRA 2QRRA 5CZVA 2MKCA 3MM6B 3RBXA 5KFVA 3BM7A 1YGYA 5HMXA 1XQIA 5H9EK 5HSPA 2B4VA 1SH0A 3MZIA 4RUBA 4CYUB 4I64A 3E01B 3E3XA 4RKUC 3MR3A 2CJAA 2V2VA 5L1LA 4JB8B 1N33F 5GADU 2QL7B 4Y2KA 3HHNB 4A8MP 4NLQA 4W90B 4J5OA 3DLLQ 2AX0A 3B4DA 1U2FA 1ZZNA 4WU2A 4KGVB 1JK9B 4ZJQA 3EYZA 3TRGA 5A8KA 4YB5A 4LF8J 3TJ9A 2BV3A 4FXWA 3HO1A 2AX1A 5DQHA 4TKTA 3GLJA 3NMAA 4A8FA 3DLBA 2FJWA 2FJBB 1NPRA 1OS5A 2V4JA 2UV8A 1H7XA 3I4PA 1PJ7A 4WYLA 4H4OA 3CIMA 3KJQB 3OQ2A 3T6JA 3ELHA 3ZFVA 1TL4A 5CCLA 3U27A 2Q6BA 1N5VA 2HG4A 2BA9A 1X9MA 2BXJA 2DGSA 4DS4A 2DT9A 2HFSA 5E41A 2F7VA 1YKWA 4K8RA 2FHJD 1SJ3P 5T41A 2R7QA 1D0EA 4EMDA 5KT6A 1I3OB 2DEJA 4MAKA 3PX4A 1X4HA 5DZ7A 5J1EA 5DGBA 1WHYA 3QGIA 3QO9B 4OHVA 3UPFA 2FJXA 1TKZB 1GX6A 1X0FA 3ETOA 3HSGA 2HFNA 3QLHB 1IKXB 1RTDA 1O6XA 1KTQA 3EMTA 2JNJA 2MTLA 2IJFA 4F4ZA 3Q23A 4PCQA 4I7FA 4RW7B 4L73A 5KG4A 3L9ZA 2YKOA 2E9TA 3UVJA 4K4XA 4JI6J 3C14B 4DG1A 4OYXA 5KG5A 3M30B 3A8KA 4ELUA 2QE5A 2HBRB 5K20B 5FD1A 1HHSA 1R7IA 3RAXA 4WXOA 2GHPA 1M1KT 2HHWA 2XB2D 3MMAB 2D41A 3I9ZA 4U8YA 4CT9A 1U26A 1AB8A 2VF3A 1QTNB 2QO3A 4I2QB 3JB9k 3CNQP 3M9NB 3TP2A 1PO6A 2D74B 3VGUA 2ZDOA 1JX4A 4J9SA 4K4VA 4RWWA 4JUZA 4J9NA 1JIHA 2L48A 3MMBB 1S1VA 2QYCA 4DWIA 1FKOA 5HL7Q 1N5YB 4F8RA 2Q6CA 2B51A 4UOCA 3OUYA 1D8ZA 4PRFA 4CCHA 3NNAA 4JI0F 2JZ5A 1RGVA 4NYOA 4LF2A 1RZMA 1NB7A 4ZITA 2MZTA 1J5EF 2RU9A 3HULA 3ISND 2XTJP 4UW2A 3TVYA 2DNZA 4EO6A 3P49B 4AFFA 3T1HF 3R9LA 4F50A 3EGWB 3PHTA 2AIRB 3P8BB 3M6XA 1HNVB 5A6WA 3NGKA 2DO0A 2F8EX 3CO0P 4EYHB 5ETRA 3QSYB 4FBTA 1O0PA 4CH1A 3GZ7A 1HQUA 3KLEA 2CJKA 4AYBD 4X4NA 1XN9A 2F4VJ 1PC4A 3MPWA 4NXMJ 1S6QA 3FQKA 1WACA 1Q5YA 1WORA 4IRDA 2ZJPQ 4URQU 1ACMB 2ZH6A 1LFPA 2IMWP 4IUFA 2HHTA 1UP1A 1VR6A 3OTOJ 4ER8A 3VAFA 1NDKA 1HW8A 2JC0A 2W2MP 3I82A 1T03B 3PDNA 2KU7A 4NZ6A 5A8KB 2HFUA 3MI7X 4J7CA 4CLLA 1CJVA 2W25A 2VG6A 4ZVEA 3HJVA 3TANA 2H65B 2BEFA 2OPRB 4ZVSB 1N54B 2V4JB 4NLDA 1HNWJ 2W4PA 1B99A 1NUEA 1KNZA 2DIUA 4LBHA 2XHCA 1RU2A 2U1AA 4IOBA 4L3KA 2KJWA 3GCXP 2J8SA 2AZ1A 1D9AA 4RUHA 2D9OA 1IBKF 1BMQB 2MKKA 1HWIA 4DQSA 2BX6A 1BUXA 2AP6A 3CDEA 4OL8A 3IAM9 2C2ZB 3LTOA 3QWPA 5RUBA 1AW0A 4UQTA 2NXCA 1IN0A 1X4DA 2C3UA 1EETA 1NJZA 2UUTA 2OEKA 4DPYA 2OTJS 2VQEJ 3X1LB 1DQ8A 1WELA 4DCJB 2VJVA 3DRXA 3GIIA 2F3JA 1Q82T 2RNEA 3D68A 2O5DA 1MSWD 1RTDB 4ED1A 2KXNB 3D4JA 2FZKB 4ES1A 2R7RA 3DU5A 2QA4G 1RBLA 1T95A 3M4XA 5DETA 2V8HA 4I4BA 2KFYA 3C6UA 3I5CA 4DR1J 3GJTB 3GR1A 3UVJB 3OHBA 1U1NA 2F4VF 3BQ0A 3W9IA 4NXMF 1NEEA 4DG1B 2YWFA 2LXUA 1V3RA 3EDQB 5HJYA 3BDPA 2C2MB 1HQEB 2PC6A 2Q66A 3HT3A 3NLCA 2XMTA 3MEGA 4DV5J 3ZZZA 1BHNA 3OTOF 4ED2A 3AY0A 1KQGB 3P5BP 4AUKA 1CULA 4W98A 2M4MA 2NXNA 4ZIVA 3LF0A 2RHQB 1QVFR 3SIPB 1ZA2B 2H1YA 1NNDA 2ZUGA 4ED3A 5L38A 2JFKA 3I55S 4DSIA 3UCGA 1AT1B 3H20A 1KRPA 1MNEA 3BSCA 3GE9A 1S1VB 1NZ8A 5IFMA 4AD6A 1FKOB 2BOPA 3IGVA 3TWZA 3OUYB 1WSRA 4DLEA 1IKVA 2MYFA 4ZLNA 4R5PB 2DXFA 3C2PA 2SXLA 3MECB 2AKWB 5KAKA 2QA2A 4N56A 1S57A 3FFIB 2V8GA 2B5JB 1SV5A 3QNWB 4JV1A 4FYDA 1BWVA 2M7SA 3CCUS 4KE5A 4V19X 2W4DA 1NKCA 1ZM3A 4LFAF 1U47A 3GQCA 1H98A 2N7CA 3QIPA 1WSVA 1HQUB 4HHJA 3BDEA 3KLEB 5GMDA 4TU8A 2IM1A 3KHRA 3WZ0A 3AJDA 1S6QB 4LF5F 4LFBJ 4EEYA 1TL3B 2AMCB 2WOMA 5KTQA 3HVTA 2J9EA 3MPYA 3K5MA 3PW0A 4K4TA 1HNIA 2ROGA 3WX4A 4DR1F 3TUPA 3AXMA 4DV0F 2VG6B 5THWA 1SH2A 3MOZA 3LWLA 1AZSA 1X5SA 4DV5F 2CPEA 1IWGA 4F0MA 1DQAA 2HRUA 1RWMB 2HYIB 3V4MA 4QW8A 1UCNA 4CWBA 2DHXA 1WDDA 3FBFA 1GXLA 1VQ5S 3BQ2A 3AH6A 2K7KA 4Q7AA 1J27A 3QRPA 1WOPA 2UUAJ 1FHTA 3L7OA 5F8HA 2J6TA 2R8JA 1FFWB 4UZBA 1FX2A 4FBUA 3M7VA 2AZ3A 3ZNJ1 4O23A 2XSJA 1XMQJ 3PO4A 3NAIA 3AD7C 3EGZA 2VPYB 1RWVB 2K3KA 2C3PA 2X3DA 1FKPA 3UW1A 1K9MT 5ETLA 1VQ4S 3KJVB 3K59A 3FDSA 4CDIA 2CNLB 1EETB 5C7PA 5KOWA 3K5OA 4A8SA 5I42B 3T6BA 2H9ZA 1RAGB 2C3MA 2BMBA 3JTOA 3C8YA 5G0RA 4IOCQ 3BR8A 1NK9A 2YX1A 4O3SA 4W4MA 1JLQB 1ZS6A 5LJ5Y 4P6QA 3TA2A 1NK5A 3ET6A 4RNFA 2M0GB 4JI3J 4TU7A 4I6AA 3C6UB 3Q8SB 3IR6B 1VQMS 5A8WA 5M2PA 1FA0A 4ZCMA 2EWHA 3A8IA 2HGLA 2HAFA 3HFKA 3W7BA 4ZJOA 3MEGB 3MOJB 4YY3F 3NWRA 5HJXA 1O5JA 1M5SA 1CULB 3WHIA 1RWUA 5DQGA 4DL3A 4LIRA 3M8SA 1SXLA 1LW0A 1HWJA 1Y5IB 1F2HA 2JWNA 2VV5A 1WD6A 4RNHA 2CQ4A 3MMCB 4DS5A 4MKBA 2C2RA 3SV3A 4PAAA 4YUDA 3QT5A 1K1SA 3L95X 4DUTA 2L41A 1HR0F 3I9V9 3T5HA 4XPCA 1KHVA 4ZIWA 5T7LB 1IKVB 2YBVA 4M63A 2HQIA 5KG1A 2DNOA 1IR2A 2LU2A 3GIRA 3BN7A 4CLUA 2CA9A 2ILYA 3ZTSA 2IA0A 3MWBA 3P45B 1HBUB 4C97A 3K8VA 4HTJA 5DJBA 4NMLA 2ZITA 3N6LA 1RT4A 5KFHA 2DBBA 5EWEA 2HEKA 1SV5B 5AXKA 1MROA 3VTIA 3M32B 2E5IA 2QGFB 2OELA 2CXEA 4DPTA 1CLFA 3QIPB 2WONA 1C0UA 2FC8A 3KLVA 4ZP7A 3IWXA 1TL7B 2QMWA 2HNZA 2WOMB 6FDRA 2DKOB 1HNIB 2KT3A 1B0PA 4QIEA 4YFUA 1S99A 5ETTA 1N4LA 2RRNA 4KJIA 4WK3A 3EZOA 2Q43A 3PZPA 1F5CA 1C1BA 3RTVA 1CQMA 3I96A 3GILA 2QLXA 1UVIA 2X3GA 2MJNA 4H4KC 1Q8KA 1ZYQA 1XR5A 4B9NA 4NPOA 4F26A 2J0XA 1Y0HA 3Q86A 1LW2A 4NLYA 4MK9A 5F0UA 3TUJC 2ZOGA 3O5TB 2P9GA 4CO1A 4K5SA 3I32A 2C3YA 1YRXA 3I0RB 3PJXA 1QJHA 1V5IB 6AT1B 3Q8QB 1AXQA 2QG9B 3AJ1A 5KFGA 1WI8A 2R7WA 4OQJA 2XSJB 1VBYA 2K06A 3HI9A 3F44A 4WWSA 1FKPB 4X4UA 1YX2A 1RHRB 4NL5A 4USKA 3LOUA 1VC5A 2VODA 4U96A 3M6WA 1SJQA 1R8BA 3M8QB 4X64F 5CYMA 1DQ9A 2ACMA 2KHDA 1Z2ZA 1FD8A 2BQRA 4UUWA 5A8RA 2ATLA 1NBEB 3GMGA 1YJTA 1R6YA 4DL4A 4PZVA 4ED5A 2NREA 3KG0A 2BACA 4DSFA 2R2RA 5F8LA 2CFXA 4B3MJ 3FQLA 2MY8A 2BVZA 4J9LA 2LVWA 4I2PB 1RA6A 5MAOA 1I1GA 1HI1A 5F8JA 4I6WA 5A8WB 3BQ1A 3FJ2A 3OFEA 3RBEA 3JAMY 2CQIA 2Z2YB 4USJC 2LQ9A 3MUVP 3KLHA 2DR8A 3HVAA 4Z2XA 4KRWA 1J5OA 2VKRA 4H4KA 1KFDA 4ZLPA 3FRYA 4TY9A 1F60B 1X4CA 3HHDA 3OVBA 1JJHA 2ZZNA 1LW0B 1NSAA 5HMYA 2CADA 2HNYA 4BWMA 4UTGA 5KT4A 3QYYA 4DI6A 4RU2A 1RT7A 3GSDA 3K58A 4OZ3A 3MGJA 3C16A 4DUYF 4ZPAA 4JI7J 2YQ3A 3PKMA 2ZHAA 3MM5B 4IR9A 1QY7A 3B82A 2GFFA 4OZ5A 4MMOA 1Y9OA 5HROA 4L75A 3V6JA 5K5MA 2D9PA 5C2GA 2JEGA 3AB2B 5HAOA 3VCDA 4EYIB 1ZOTA 1U25A 1IR0A 2C2DA 1RT4B 1EB0A 2OFGX 3EXCX 4ZVPB 1FK9A 1K44A 4DN9A 1WF1A 1MROB 4C7QA 5LMUJ 1SJRA 2GVZB 2YQ0A 4IRCA 5DGAA 1H0HB 3MR5A 1I94J 1Y4ZB 3TARA 2V69A 3NL0A 1YWXA 1NPPA 2FLOA 3D6MB 2G0JA 4LRAA 3NNHA 3HHEA 4GMKA 2KRRA 1T3OA 1FDDA 3FRZA 2ZH2A 3NEKA 4Z7CA 3UQSA 3U02A 1XNRF 3C19A 2UVVA 2E29A 4LRFA 2XGPA 2ZH5A 1GFWB 1GMWA 4HACA 3KLGB 9RUBA 1GH8A 2C42A 3KG1A 4GKKJ 2WSEC 3FCWA 3M8ZA 4OX6A 4DR4J 3RB6A 3CPWR 3DXSX 5A76A 1HLWA 4CNYA 2HHHJ 1S0NA 2K1RA 3QMQA 4AL5A 3AD9C 4QR2A 4J9UE 2EC2A 4NCBA 4I68A 4MYTA 4JI7F 3R1HA 2BJDA 1D9DA 5L8RC 2F4FA 2C2OB 3OD2A 2B3TB 3OPKA 4OYZA 3A13A 4JI2F 2BBEA 1UFKA 1WHWA 5CYMB 3Q8RB 1UA1A 2R2SA 5E33A 3OV7A 1S5ZA 5A8RB 3OXGA 4HEA9 3O6QA 3W64A 2V8PA 2LP4A 1HA1A 1U6ZA 5LMUF 4AL6A 2PEHA 2VDHA 5J2MA 2DTJA 4PYAA 3MAAA 2MZ1A 1U1OA 3J80U 1WC5A 5KFDA 4K2JA 4DR3J 1GK8A 4DX8H 2XI2A 4Q0BA 2DRAA 1RHJB 4C4WA 2BABA 2XLJA 3UDVA 2OMLA 4IQXA 1FEEA 2XZTB 4I1TA 1OY9A 2UVUA 4LR9A 3OTBA 2CVEA 1RABB 3KLHB 2FLLA 2M88A 3A3NB 1A6LA 2BKOA 2JEIA 1VQ6S 1Q8BA 2XO6A 1IKWB 2XBPA 1TK8A 4IH5A 2I6WA 1VIOA 3VGTA 5E3AA 1PJ6A 2RRAA 2QMUB 3PW5A 4GKKF 3OTCA 2HNYB 4LSZB 3T5JA 2M2BA 2H48B 4OLOA 5E0OA 3J7AN 1TKTA 5HN0A 3TQ1A 2MSSA 4O4GA 3EZ5A 2VIHA 2POKA 4DV4F 2EVZA 4C8OA 2RJZA 4ERDA 1LK5A 2B4UA 1Q53A 3R7BB 4CTAA 1V5VA 2YWEA 1NJYA 1JNRB 1G2EA 2E7VA 2V6AA 1GEHA 5E2QA 3K57A 4C48A 1QSYA 3GB0A 3PEJA 2QLWA 3J81U 3TJ8A 2C1EB 2V50A 4RBTA 2WZ1A 4TNOA 4CNZA 1VGYA 3G96A 3IGNA 3KHHA 4JV5J 1FK9B 3KKFA 4FF2A 4ED0A 1UPPA 2XC9A 5GMKa 4B3SJ 3D1OA 3U1MA 2DR9A 2AU0A 4Q44A 1YI2S 1N32F 2KYXA 3CD7A 3QGHA 1VRQC 2W9CA 3CW2C 1BQXA 4L3NA 4P72A 2IBKA 3QSIA 2KJVA 2F63A 2M5YA 2F1FA 1TKXA 4LFCJ 2NCKL 5IC4B 2HQGA 2HGMA 2FB0A 1OQ6A 3FUYA 3TZWA 1VMBA 1R8CA 1YBTA 2E66A 3CCTA 3T5LA 4B3TJ 1FJCA 3D6HB 3PYGA 4I6YA 1WJ9A 2MJUA 3C15A 1T7PA 2VBZA 2AF6A 2PA8D 5DG9A 2K1RB 1YJUA 2CNOB 4KC5A 4JYAF 1UL3A 2D3ZA 4ECWA 4FN5A 2NYIA 1FDBA 2PFDA 3LP2A 3QZ7A 3RBZA 2Q3PA 2UU9J 1UVJA 4CO4A 3PYDA 4WF9Q 2OH2A 3OW2R 5D0RA 1VJQA 3PW4A 1N48A 1RB0A 2RDIA 1FWLA 4D3HA 4OYAA 3BH6B 4JV2A 1S6UA 4H54A 2RDDA 1JLFA 1Y5NB 5KG6A 1UKUA 3ZC4A 4OZLA 4OZJA 1K73T 1MN9A 1UZDA 2HWIA 2RE1A 2FGOA 1NK4A 1RHMB 2DCLA 1RWNB 3MAAB 4DR7J 3BSNA 2DPJA 3PM9A 3AQOA 1OWXA 4K2XA 3KJNB 2YKNA 3NP5A 5IQ6A 4Q0BB 4IDKA 3D3BJ 3OTEA 1WTBA 2XMJA 4K4YA 5K8PA 1WC4A 3R5BA 4DL7A 1P8GA 3AOCA 1JWWA 2NSCA 4C3KA 2W2QP 4B3TF 1FWPA 3FGVA 3LALA 4USMA 4NRTA 2A2CA 4Y34A 3HZGA 2HRYA 4WK1A 3VAJA 1LKZA 3GV8B 2QL5B 5KFQA 3F0NA 2DH7A 4M94A 2ADBA 2DNYA 3JSYA 3QBCA 4J9OA 4CTAB 4K0KJ 5B08A 2ZNZA 2AYEA 3UNYA 2ZOMA 2YH1A 2EW9A 2QC3A 3NAHA 1GTEA 3CCRS 2N4CA 2FVRA 4QCLA 3L7UA 3NKYA 4ZS6A 2MPUA 2RILA 2XG8A 1Q8LA 2XWXA 2COLA 1U02A 3VVTA 3CMES 3H7HB 4PG4A 5C24A 2VL1A 3VZIA 2MZRA 3MAQA 3V6KA 4HT7A 4MH8A 1B3TA 3ZO7A 2M8DB 5DO2A 1SL2A 4WTOB 3NCRA 2CPDA 2E1MC 2E1CA 3Q24A 2UZAA 2KZMA 1H2TZ 4A8WA 5IT4A 3UE2A 4B3OA 2W9CB 3PV8A 2ASLA 2JLEA 3OL6A 3LPEA 2ROEA 4DV3J 2ASYA 1U45A 3H25A 2RD5C 3JSBA 2HGNA 3FKBA 1TKXB 3SFGA 4CO0A 2DXDA 4DV2F 3DDIA 1RT2A 4GO5X 2F8MA 3AQPA 3G4SS 4OIXA 2KG1A 4WP9A 2R42A 3JQJA 4PWUA 4P9SA 1YVFA 1KVJA 2ZBQA 4NLRA 4OJ1A 2XO7A 2Y1JA 2BZ2A 1PBAA 2BJEA 3GYNA 2XGQA 4JP8A 3C15B 4LF6J 4RX6A 2FYXA 3TI0A 2HK3A
chains in the Genus database with same CATH topology
4CYUA 3HSJA 2CG8A 4M5LA 1F9HA 3HD2A 3ILJA 4M5NA 4CRJA 5ETNA 4M5JA 1IM6A 3HD1A 3HSGA 1KBRA 1G4CA 3MCMA 4M5KA 1Q0NA 3KUGA 3UD5A 3KUEA 4M5GA 4F7VA 1HKAA 3ILOA 3KUHA 5ETRA 3HSZA 5ETVA 5ETMA 5ETLA 4CWBA 1RTZA 1TMJA 3MCOA 3UDEA 1TMMA 1EQMA 2QX0A 1EX8A 4M5MA 4PZVA 2F63A 3IP0A 1RU1A 3UDVA 5ETSA 3ILLA 5ETTA 5ETOA 1RU2A 2BMBA 2F65A 3HT0A 5ETPA 5ETQA 4AD6A 4CYUB 1EQ0A 4M5HA 3ILIA 3MCNA 1RAOA 3HCXA 4M5IA 1CBKA 5ETKA 3HSDA 3QBCA 1RB0A 1DY3A 1HQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYU A;  3HSJ A;  2CG8 A;  4M5L A;  1F9H A;  3HD2 A;  3ILJ A;  4M5N A;  4CRJ A;  5ETN A;  4M5J A;  1IM6 A;  3HD1 A;  3HSG A;  1KBR A;  1G4C A;  3MCM A;  4M5K A;  1Q0N A;  3KUG A;  3UD5 A;  3KUE A;  4M5G A;  4F7V A;  1HKA A;  3ILO A;  3KUH A;  5ETR A;  3HSZ A;  5ETV A;  5ETM A;  5ETL A;  4CWB A;  1RTZ A;  1TMJ A;  3MCO A;  3UDE A;  1TMM A;  1EQM A;  2QX0 A;  1EX8 A;  4M5M A;  4PZV A;  2F63 A;  3IP0 A;  1RU1 A;  3UDV A;  5ETS A;  3ILL A;  5ETT A;  5ETO A;  1RU2 A;  2BMB A;  2F65 A;  3HT0 A;  5ETP A;  5ETQ A;  4AD6 A;  4CYU B;  1EQ0 A;  4M5H A;  3ILI A;  3MCN A;  1RAO A;  3HCX A;  4M5I A;  1CBK A;  5ETK A;  3HSD A;  3QBC A;  1RB0 A;  1DY3 A;  1HQ2 A; 
#chains in the Genus database with same CATH topology
 1IBC B;  1H74 A;  2XHW A;  2MLY A;  3J7Y U;  3D3C J;  4TLR A;  1KHW A;  2NSB A;  2H54 B;  3LP2 B;  4B3R J;  3G8S A;  4JI1 J;  3EGV A;  2RS2 A;  3GIM A;  1VQ9 S;  3TUZ C;  4M5H A;  1XNQ F;  2HIQ A;  3NGU A;  4CLZ A;  2D69 A;  3SDE A;  4NI2 A;  4J90 A;  1N34 J;  4ES2 A;  3V5R A;  2PI4 A;  2V0N A;  3JS9 A;  3EIC A;  4FYX B;  2QEX S;  2B8Q A;  2ZH1 A;  4GRS A;  2LQB A;  3OBI A;  3M8P B;  2C28 A;  2MQP A;  4V19 J;  1REV B;  2GJ2 A;  1JLF B;  3UN3 A;  3W2W A;  2R8G A;  4F4W A;  1T3N A;  5KFX A;  4CRJ A;  4IG0 B;  5F0W A;  1URR A;  4JI5 J;  1L3U A;  4DL0 C;  4F3Q A;  1NAQ A;  3I0S A;  1XIQ A;  2AGO A;  2Z58 B;  2UUC J;  4ZPV R;  4X4T A;  4KKO A;  1IJE B;  1Q86 T;  3AB4 B;  2DHG A;  4NOH A;  1QSS A;  2BRK A;  4FKY A;  2YKN B;  2YWW A;  2OKQ A;  3GPA A;  1TK5 A;  4HYK A;  4IDK B;  2ALZ A;  5IC6 B;  2QL9 B;  2YY3 A;  4FVC A;  2VU5 A;  1WUU A;  3BKT A;  4OV6 A;  2RIJ A;  2BE9 B;  4IH7 A;  4KGK A;  4NLW A;  2FJA B;  3R7S B;  1HBN B;  2AEF A;  4QU6 A;  3BO4 A;  1RTI A;  4X4V A;  5A2Q U;  2V2Z A;  4USH A;  4P71 A;  4UUX A;  1IXK A;  4EWT A;  1U1L A;  4MTP A;  1Q81 T;  3CCV S;  4DV6 F;  1NDL A;  3RAQ A;  3IWL A;  1XMO J;  3FEY B;  1TV6 A;  2CQG A;  5IS2 A;  1IM6 A;  1SKU B;  4ILM A;  5HK4 A;  3LH2 S;  2A18 A;  4ZHR B;  3N0V A;  1LWC B;  4UZC A;  2KM8 C;  1DLO A;  2J9D A;  4B3R F;  2MKS A;  1S4F A;  4WJB A;  3MCM A;  3P3D A;  4CI0 B;  2X1A A;  3K8W A;  2RUS A;  1GTH A;  1YLX A;  2QLF B;  2V9K A;  5J2Q B;  1N34 F;  5LSL A;  1E6Y A;  5C24 B;  3H90 A;  3N5B A;  1B64 A;  2Y0S D;  4WFY A;  2HQC A;  4X66 F;  1NME B;  1HAR A;  3EVM A;  2GAG C;  2VA3 A;  3TEG A;  4RW4 B;  1FO1 A;  3H2V E;  1KDN A;  2QSF A;  3MEK A;  2YWH A;  5EHH A;  4CLY A;  4PXC A;  4DSJ A;  4ETX A;  4LF7 F;  3HD1 A;  2UV8 G;  1X5O A;  2OPS A;  1RT1 A;  1NKE A;  2DRB A;  4Y0F A;  3HKZ D;  1Q79 A;  4B3O B;  3D2W A;  2V2Q A;  4FNI A;  1L3V A;  1U1M A;  4DL2 A;  2UUC F;  5BJR A;  3D28 A;  2CQD A;  4LSN A;  3CD0 A;  4YHH F;  4X62 F;  3RRH A;  3HXM A;  1R89 A;  4X65 J;  3NCP A;  2DNK A;  1RT2 B;  3UFC X;  2DIS A;  4B08 A;  2JSX A;  4K4U A;  2FC9 A;  3W5X A;  4AXJ A;  3HX9 A;  1LWX A;  3QFW A;  4AQY F;  4CO2 A;  4S0M A;  4CLT A;  5F3Z A;  4C8L A;  4CLK A;  2W9B A;  2VFV A;  4NX9 A;  5H9F J;  5ETN A;  2BW2 A;  3HFV A;  4P2X A;  1N0U A;  1XMO F;  4A8O A;  2RS8 A;  2UXC J;  1LWF B;  4RJV A;  3IO1 A;  2DGW A;  1Q4R A;  3HVR A;  5ETK A;  3UD4 P;  1KSP A;  2E9R X;  1TZ0 A;  1FDN A;  3UN2 A;  5KT5 A;  4NI2 B;  4MIB A;  3NGS A;  2LDI A;  2PMZ D;  3H40 A;  4RW8 A;  1R27 B;  3B78 A;  2YKQ A;  1DUR A;  1S0O A;  4FP9 A;  4KBI A;  5CHC B;  2HBY B;  3DYA A;  1CSJ A;  2CUY A;  3PY8 A;  1H2U X;  5CYQ A;  2M3D A;  2FD2 A;  2B56 A;  2KI2 A;  5B0G A;  3J80 Y;  3W2W B;  1EJ7 L;  3N79 A;  3NY0 A;  2ZM6 J;  2KKH A;  2OAU A;  3EXY A;  4NLG A;  3HD2 A;  5B0B A;  2KL8 A;  1R6V A;  4OZ0 A;  2FVC A;  3G87 A;  3PFO A;  1J2V A;  3L7P A;  3IR7 B;  1DAR A;  4UT4 A;  4DCO B;  1JQG A;  4DZ6 A;  1Y7P A;  3LUY A;  1VHI A;  2XYG B;  4ZVT B;  4YDD B;  2GHW A;  2NZ4 A;  3DM2 A;  2UUB J;  4ECR A;  4RW6 A;  1NZA A;  1PKU A;  1Y00 A;  4OHX A;  2RDJ A;  5LSR A;  3KYL A;  2YKM A;  2IFX A;  2KB2 A;  1K8A T;  4OI6 A;  1RTI B;  4X65 F;  4DMZ A;  1SC1 B;  3D6F B;  4OX7 A;  4DPU A;  3V2U C;  1P1L A;  4U9R A;  2LEA A;  3QAE A;  4YR0 A;  1WNE A;  1TV6 B;  2XNQ A;  3CWJ A;  5KFN A;  1WG4 A;  5IWA F;  2V94 A;  2OTL S;  3EJM A;  4DSK A;  4WFN Q;  1PYO B;  3A12 A;  5D4L A;  2H4Y B;  3T1Y J;  3CJ2 A;  2DY9 A;  3J81 Y;  1DTT A;  4R8U A;  1U6B A;  1CEZ A;  1IUJ A;  2HK2 A;  2OHD A;  1DLO B;  1VHF A;  2CG4 A;  2IA6 A;  1QDU B;  3SV4 A;  4PQA A;  5C2C A;  1T8E A;  1KLM A;  1O51 A;  4ZVU B;  2VOO A;  2GGP A;  4LBP A;  3C3L A;  3NGD A;  1HWL A;  5K14 A;  4C3L A;  3QJP A;  2VJU A;  3H2L A;  3W63 A;  2DNR A;  5H1S V;  3D0H E;  5LXR A;  3UR3 C;  1VRU A;  2G2Z A;  4DV7 F;  4DXL A;  5AT1 B;  4L74 A;  2NUU G;  1GMW D;  4GKJ J;  1ROF A;  4RNO A;  4YQW A;  1CJK A;  1ZM2 A;  1G3O A;  5EX0 A;  3LGM A;  4A47 A;  3IA0 A;  2JEF A;  3FMW A;  5D4P A;  3JQM A;  4O3R A;  2CWK A;  2QJ3 A;  5D6G A;  1V3Z A;  1FTC A;  1M1G A;  1RHQ B;  4OJH A;  1AUS L;  1PAE X;  2LMI A;  2MEW A;  4OI2 A;  2VOP A;  4N8O A;  4LSN B;  2EG1 A;  2X51 A;  2BW7 A;  3EX7 B;  5DDR C;  5B0C A;  2ZEJ A;  5H9F K;  2Z56 B;  1T11 A;  1JLA A;  2UUB F;  5LL6 d;  5IOL A;  9ATC B;  1FD2 A;  3DDK A;  3TNV A;  4ANE A;  2EFN A;  4JI4 J;  3OT9 A;  2DY1 A;  2W01 A;  3A8E A;  5KG3 A;  1HBO A;  3CSK A;  2NLW A;  4WP8 A;  2B8P A;  3VAG A;  2XM3 A;  3AJ2 A;  2W9B B;  3LGH A;  3R5G A;  2ATC B;  5GAG U;  3KUH A;  2O66 A;  5EN1 A;  1TVR A;  2DNL A;  2KM8 B;  2W4C A;  5HAN A;  3M8W A;  1NDP A;  1VS3 A;  4LSL A;  3AHP A;  1FEH A;  4N7T A;  1M0S A;  2VZ9 A;  3R2C J;  1T05 A;  1YDL A;  3R2D J;  3G2X A;  5FDL A;  3ILI A;  4OZ2 A;  4RW8 B;  3T1Y F;  4DV1 F;  3UO0 A;  1DY3 A;  1JXL A;  2Z0G A;  4IG3 B;  4X4P A;  3D5M A;  5EX3 A;  3ZZR A;  1LWE B;  4ECY A;  5AJ3 J;  4TU9 A;  1GMU A;  1VQK S;  1RAF B;  2VUG A;  5CYQ B;  5KG0 A;  3H4B A;  2AJ0 A;  2V2K A;  4NRU A;  1WC3 A;  4LVN P;  3CD5 A;  1KP6 A;  1S48 A;  1SKS A;  1P9Q C;  3I4H X;  4KH0 B;  4GVB A;  4CO3 A;  1F1B B;  2E44 A;  3VAL A;  1BC6 A;  1ZZF A;  4GKJ F;  4KIA A;  2YPZ A;  4WTY A;  4F0K A;  1U2C A;  2BAN B;  1FXR A;  1JKH B;  1JLC A;  5HP1 A;  1OJ4 A;  3Q8Y A;  3OXL A;  5EWF A;  3BPD A;  3DM2 B;  3BH7 B;  1VBK A;  4RW6 B;  3CGI A;  2IM3 A;  3UD5 A;  4QJV A;  2XYH B;  2VBW A;  1L3T A;  1SC3 B;  8RUC A;  3MCN A;  2ZBP A;  4DL5 A;  3W2V B;  1VIS A;  4Y6I A;  4QWC A;  3IM9 A;  3GIJ A;  2DGO A;  3TA1 A;  1Y5L B;  3AXK A;  4JI4 F;  5KFY A;  2NZC A;  2LFV A;  3CIZ A;  2RF2 A;  2OUG A;  4Y2M A;  4NE9 C;  1YG0 A;  2HVD A;  4R8U B;  8ATC B;  1NHV A;  2Y1R I;  2DEI A;  1SB6 A;  1SI9 A;  2VBX A;  1IKY A;  1KLM B;  2GNK A;  2Y1L B;  2J0W A;  2GGP B;  2YH0 A;  3H5Y A;  3NOC A;  2R3V A;  2BRL A;  4DL6 A;  1PCA A;  5CAA A;  2NR0 A;  1VRU B;  1RAI B;  3SQG A;  2VFU A;  3RGI A;  1QTM A;  4NCA A;  4C11 B;  1UZH A;  1TL1 A;  4ZOS A;  4BWJ A;  5L1I A;  4LF4 F;  4HH0 A;  1X5T A;  3CMA S;  4LF9 F;  1Q7L B;  5B0A A;  2IJR A;  2H5J B;  4NLX A;  1ARO P;  3KLF A;  1CJK B;  3BEG B;  4ATN A;  2C2E A;  3EWG A;  5C42 A;  4RW9 B;  4WE1 B;  4B9U A;  1UPM B;  4KH1 B;  4C98 A;  1HBM A;  4ECS A;  1N8R T;  2VC1 A;  2GX8 A;  3NGR A;  3NMR A;  4ENO A;  4UOH A;  1F3V A;  3TOQ A;  1W7W A;  2V8V A;  2HMI A;  1BQN B;  1RKI A;  2UXD J;  1JLA B;  1D1U A;  1S9G A;  2FHJ A;  3PJ9 A;  5E3Q A;  3A1Y G;  1JJ4 A;  1VIX A;  4N41 A;  2DNQ A;  3FVY A;  4ES3 A;  1WG5 A;  2YKP A;  1ICE B;  4EZ9 A;  2CQ0 A;  2XMU A;  3CJ3 A;  4HDH A;  3HLU A;  3L3C A;  3OFH A;  4MKV A;  2CPH A;  3BKF A;  2G2O A;  4P75 A;  2KFN A;  2ZE2 A;  2IC3 B;  2WVC A;  2CJ9 A;  3UD3 P;  3G6E S;  1TVR B;  2DO4 A;  4DOZ A;  4PKD B;  2B9W A;  4F04 B;  5E3R A;  3DRR A;  3D7S B;  4EGL A;  1KQK A;  4LRB A;  2NPI A;  1VQP S;  3H5X A;  3FMB A;  1H73 A;  1T05 B;  4ED7 A;  1VQ7 S;  2PA3 A;  2J7K A;  5FDL B;  2MLZ A;  3BO3 A;  3HK2 A;  1P27 B;  5L1K A;  4JI0 J;  3S6E A;  2EPI A;  2LEP A;  2FHO B;  3DRS A;  4LRD A;  1J5E J;  1U1Q A;  4OFZ A;  3V81 A;  1RTJ A;  3PW2 A;  2DHH A;  2Z2Z A;  3M1V B;  3T1H J;  1A7G E;  5LXY A;  2JHE A;  1L3K A;  5KFC A;  3E8O A;  4F02 A;  4X4Q A;  2YQ1 A;  3CUN A;  4UST A;  1RQ0 A;  4QYZ J;  3SCL E;  1JLC B;  4ELV A;  2GA7 A;  3HF5 A;  5LMN J;  5HP1 B;  3DC2 A;  3BSA A;  2A0F B;  1WF0 A;  5A2Q Y;  2HVZ A;  3B6B A;  2HAI A;  1AYE A;  1S1X B;  3PRD A;  2ALY B;  3G71 S;  4QU7 A;  2DJW A;  3N6M A;  3Q8P B;  3Q2T C;  2BJ8 A;  2C22 A;  4DR6 J;  1JNZ B;  2UXD F;  2GJI A;  2K3I A;  2GC8 A;  2EFQ A;  4C3M A;  1F3F A;  4OYW A;  3T19 A;  3ITH A;  2VAS A;  3J7A 1;  3IR5 B;  5F8I A;  1RK8 A;  1BD6 A;  1VQO S;  5CAB A;  3JAM U;  3POT B;  4KY3 A;  4ZK7 M;  1HD0 A;  2RF2 B;  3J7Y I;  4Y28 C;  2FUG 9;  2C3O A;  3CC4 S;  1Y10 A;  2DIT A;  1EHW A;  1YZ6 A;  1ITP A;  1VC6 A;  5EWG A;  5CQG A;  3ENQ A;  2P6S A;  2RT3 A;  1IKY B;  1IBK J;  3OLB A;  1M1H A;  2IPO B;  3NWG A;  2MB0 B;  3MPV A;  1VCT A;  2N3L A;  3MPU B;  2NXE A;  4KHR A;  4L72 B;  1QAX A;  1S6O A;  2PDA A;  3DOL A;  1SIZ A;  1N56 A;  3ILL A;  3JSM B;  2BE2 A;  5D4N A;  4DQQ A;  2HHV A;  3H42 A;  2M70 A;  1Q1K A;  1UEV A;  2ZVS A;  1KLN A;  4ZVG A;  1RTH A;  1IR1 A;  4M5D A;  1HBM B;  2EK6 A;  5ETO A;  1JLB B;  3CCM S;  3THP A;  2ZVI A;  5KT3 A;  4NZ0 A;  3BZQ A;  3PIO Q;  4ZVQ B;  1OPI A;  3O2I A;  3IG1 A;  4WFX A;  3H8Y A;  1KKH A;  2GO9 A;  2H51 B;  4RUC A;  5LMN F;  4P7V A;  3R27 A;  2HMI B;  3HCX A;  4X2B A;  3ADA C;  2PI5 A;  2X1F A;  1F9H A;  1X4A A;  4ED4 A;  1KBR A;  4KGZ B;  3OR2 A;  1U48 A;  3EDR B;  2ZH3 A;  1Y11 A;  2V5H G;  4P10 A;  2BKN A;  2EKN A;  3I5B A;  3R5D A;  2ZOF A;  4DR6 F;  3EUN A;  1H3D A;  3QJL A;  2CQ3 A;  1F9F A;  1S10 A;  2I5J A;  1XER A;  2XY7 A;  3AA8 A;  2CRL A;  3DRR B;  3ZZU A;  3KK3 A;  1RKJ A;  4M5J A;  3UCZ P;  1UW4 A;  4H4O B;  1FVQ A;  4TXS A;  4ZPC A;  3CTR A;  2JL9 A;  4CIO A;  2WVF A;  5E7O B;  3QRQ A;  2B9E A;  1RA7 A;  5ETQ A;  5U47 A;  5F8G A;  2QTW A;  2R7S A;  1VFJ A;  3DRS B;  2QIF A;  1WC0 A;  4JBC A;  1BQM A;  4QYZ K;  4QWE A;  3QQC D;  1U2R A;  3V81 B;  1EQM A;  4CQ1 A;  1U0S A;  1RTJ B;  1OMS A;  5J2P A;  2J6S A;  2AWZ A;  3PNI A;  2FLP A;  5D3G A;  3Q0A A;  3BRE A;  4B02 A;  3RR7 A;  4AXI A;  5D15 A;  1Q78 A;  4LQ9 A;  5J1E B;  3NS5 A;  2KVI A;  2Z2M A;  2KG0 A;  2CPX A;  4OYI A;  3G6V A;  4LFA J;  2ILZ A;  2VPZ B;  2JLF A;  3FZ2 A;  1YJW S;  3W1Y C;  2DHS A;  5FLX U;  4NCG A;  1ULR A;  2AGP A;  4MKA A;  3ZTQ A;  1MN7 A;  3PAC A;  3FCV A;  3SYZ A;  2A6M A;  2MZQ A;  2WBR A;  2KTQ A;  3GCW P;  4WFZ A;  4ZLJ A;  1TU0 B;  2JEJ A;  1ZAV A;  2E5J A;  2M9K A;  1EKR A;  4LF5 J;  1RAD B;  1RAC B;  4HHU A;  3DOK A;  1RWO B;  4I7F B;  1S12 A;  3A4T A;  1JLE A;  3G9C A;  4NXN J;  2OIH A;  3RG6 A;  4L76 A;  4DV0 J;  1X8D A;  2QYG A;  5GAE I;  3I6P A;  4YB7 A;  2ZZM A;  1UJ5 A;  1WDT A;  3ITH B;  2Y8Y A;  2MXY A;  2DR7 A;  3HM9 A;  4ANC A;  2YNG A;  4O3N A;  4R0E A;  3PIP Q;  3KJF B;  5DM7 Q;  2I8E A;  1S97 A;  1X9S A;  2UXB F;  2AEJ A;  1XMB A;  2XMW A;  4DPX A;  2WK4 A;  1UVK A;  2J76 E;  3UI3 A;  1SKW A;  2CVI A;  4QQB A;  3IM8 A;  4N47 A;  2N82 B;  3MFI A;  3W60 A;  2XI3 A;  2W2P P;  1W2I A;  4TQR A;  5KT2 A;  3FBC A;  1YIT S;  2GQQ A;  2LU1 A;  3NNC A;  3MM9 A;  1UWB A;  2LA4 A;  3DOL B;  5L9X A;  5ETM A;  1MWZ A;  1TUV A;  1YIJ S;  3GSI A;  4HKQ A;  1S59 A;  4EK2 A;  4OV1 A;  3N28 A;  2ZBC A;  3CJT A;  4E2F B;  1RTH B;  3MUT P;  2OP5 A;  2CDR B;  1UWA A;  1T9W A;  4FYY B;  2IVM A;  4P73 A;  4PWW A;  2KT2 A;  1P9Y A;  2YX7 A;  3CJK A;  3UCU P;  4HH1 A;  2OEJ A;  4NA1 A;  3IG1 B;  1X4F A;  3PG9 A;  1X7V A;  1SPB P;  1BWE A;  1NSP A;  4OI3 A;  1RT6 A;  2HQD A;  3CCJ S;  1S0V A;  1RAH B;  2GVD A;  3DRY A;  4G6V B;  4F2R A;  3OR2 B;  2R7U A;  1YBU A;  1DZ5 A;  4YY3 J;  4F4K A;  4K5R A;  1CC7 A;  4NXN F;  2I2Y A;  1CJV B;  1B0V A;  2DB1 A;  4G1I A;  2LXF A;  2B9X A;  3CCS S;  2E5L F;  2XCP A;  2FVP A;  4BDP A;  2QMX A;  2DYA A;  1ZTW A;  2I5J B;  4CP5 A;  4C2M A;  3KK3 B;  4UOG A;  1GNK A;  2ERR A;  1RT3 A;  4F25 A;  3I87 A;  1N5Q A;  2OD4 A;  3S01 A;  3NGT A;  1K47 A;  2B4O A;  1S4E A;  4B9L A;  1HR0 J;  3KFW X;  4OJG A;  4J9M A;  3MR7 A;  4KV8 A;  4KHP F;  2IVY A;  3DFE A;  2OPP A;  1BLU A;  3WDO A;  1DJ0 A;  3KWM A;  2QFJ A;  4FF1 A;  4U7U K;  3ILJ A;  3ETM A;  2MKJ A;  4MYU A;  5KFB A;  2OLW A;  4G65 A;  2GAH C;  3TX8 A;  5J2P B;  5D3G B;  1T9X A;  2F8H A;  4LBI A;  3LP1 A;  3OHA A;  3G86 A;  3W5Y A;  5GAH I;  4XIU A;  1H2V Z;  1MWQ A;  4NCG B;  1RXO B;  2HZC A;  2YPY A;  2XEX A;  5E3P A;  4KPC A;  3UWT A;  3QWU A;  3SEO A;  2R9L A;  1M5H A;  4OHZ A;  2MQQ A;  3DOM A;  1A0O B;  3BBF A;  2LEB A;  4WFA Q;  4NZ7 A;  3UDE A;  2IJN A;  4CLF A;  3MM6 A;  2VG5 A;  3QAU A;  3WBZ A;  3GU0 A;  5A6P A;  2Q1L A;  2MHE A;  1PYS B;  3DOK B;  3FSX A;  1OIA A;  4LRE A;  2IVF B;  2HUR A;  4IR1 A;  1S79 A;  1YJR A;  1U4B A;  1T94 A;  2FGC A;  3LWM A;  5KFP A;  4OZ1 A;  2M8H A;  4DZD A;  2AYB A;  3CD6 S;  7FD1 A;  1NSQ A;  2XSF A;  2YNG B;  4E0D A;  4DUZ F;  2FZG B;  2J5A A;  3D67 A;  1W26 A;  5L1J A;  4J9P A;  4DFK A;  5GAG I;  1IJF B;  1S1T A;  4ZCI A;  4K7Q A;  4BS2 A;  3A3O B;  4DBQ A;  2HBZ B;  4PUO A;  3M2U A;  3IAS 9;  3GON A;  3K5L A;  4MIA A;  2HPU A;  4WKR A;  3QT8 A;  2HLT A;  3KG4 A;  1RHK B;  1YHQ S;  2O01 C;  2VDI A;  1K0T A;  2IM2 A;  2NXU A;  5LT5 A;  1SVD A;  3B4M A;  4RWX A;  2JVR A;  1UWB B;  3CJQ A;  4Z7Y A;  3VAH A;  1E6V A;  4QW9 A;  4G3I A;  2CNK B;  4NLU A;  5L39 A;  2G1D A;  3NXZ A;  5IXU A;  3DKD A;  2BJ3 A;  2L9W A;  4X64 J;  4F0H A;  1WF2 A;  4A8Q A;  2Q79 A;  1S49 A;  3R5C A;  3BGF A;  3NBP A;  2RAQ A;  4YB1 P;  3EVO A;  5B0F A;  3RRK A;  5B7W A;  5KFO A;  1I6J A;  2GO8 A;  5HI7 A;  1R8P A;  3T41 A;  4KAI A;  3OTD A;  1XWL A;  3CJK B;  5KFK A;  1TAQ A;  4Y3C A;  2DGU A;  2GW8 A;  4DX5 A;  4L6V 3;  3T9Z A;  1XK8 A;  1TKD A;  2E5H A;  3QLH A;  1RT6 B;  3TZY A;  2GVD B;  5ETP A;  5DDQ C;  3SZ2 A;  3MPD A;  5F9N A;  3HVT B;  4ZMM A;  1FRM A;  2PFF B;  1IBL F;  2P9E A;  3G6X A;  3AFG A;  1NJX A;  5ADZ A;  4ZVF A;  4Y2I A;  3FCH A;  1F6T A;  2BKP A;  1AZS B;  1F9E B;  3H5S A;  3KK2 A;  4QPX A;  1Q7Y T;  1CC8 A;  3N4W A;  3JTP A;  3KLI A;  1SJ1 A;  4B9M A;  2IRY A;  3MMA A;  3FSY A;  4DUY J;  3BBC A;  1JMT A;  1NLK L;  2I9S A;  4NLS A;  3OJS A;  2ZHB A;  3M2R A;  3HHL C;  2NXJ A;  2BOA A;  3T1A A;  1FJE B;  4PXE A;  3SCJ E;  3BS9 A;  2OPP B;  1U1K A;  3BO2 A;  1U49 A;  4Q43 A;  4MKY A;  1UW9 A;  1R8A A;  1Y3K A;  2ZKT A;  2FPH X;  2R8K A;  2CPJ A;  3TEH B;  3PO5 A;  2L9D A;  3SSR A;  1N5Y A;  3GV7 B;  4NAS A;  3VZH A;  1T9V A;  2FHM A;  1M5V C;  3LP1 B;  3EZU A;  3GJS B;  4DFM A;  1M5P C;  4UY8 T;  3HSJ A;  2D3O R;  5B0D A;  2I0X A;  5G4D A;  4EBE A;  5D8H B;  5G0R B;  1QUP A;  3S7R A;  1NO8 A;  3ENA A;  3DOM B;  1VBX A;  5K8N A;  1HNV A;  2G2Y A;  3IWN C;  2WB1 D;  1XNR J;  4F2S A;  3GG0 A;  2VG5 B;  3MD3 A;  4DU8 A;  3ET6 B;  2PD1 A;  3BYR A;  1IM4 A;  5JVG Q;  4IFY A;  4AL7 A;  1NDC A;  1VLY A;  1SQG A;  2XZW A;  2W2N P;  4DR2 J;  2ZJR Q;  4HR2 A;  2AT1 B;  1NK8 A;  5KG2 A;  1S1U A;  4Q8F A;  2APO A;  1C1C A;  1K1Q A;  2DNG A;  4KSE B;  1D09 B;  2GIR A;  4WIQ A;  5DM6 Q;  3VGS A;  4FF3 A;  3SSS A;  2LYV A;  1T03 A;  1S1T B;  4WPA A;  3THT A;  2OFH X;  4PUO B;  3M2U B;  3VWS A;  1AFJ A;  3HHL A;  1Z2L A;  2BM1 A;  1GMV A;  3CCQ S;  2OPR A;  1C2P A;  1WWH A;  2JLG A;  1WEX A;  5KFR A;  3PW7 A;  1MG7 A;  4OHY A;  3BSO A;  3IS9 A;  1OSC A;  3CC2 S;  2DCU B;  3RBD A;  4JOU A;  1E6V B;  5IM0 A;  5IZH A;  2E1A A;  4JI2 J;  2W8K A;  4ECV A;  5EDW A;  2RH3 A;  4KR0 B;  4ALZ A;  3WC0 A;  3DLK A;  4KTQ A;  2LQ8 A;  3E2E A;  3ZZT A;  2FLN A;  5CA5 A;  2BJ1 A;  4V1A k;  2ZD1 A;  3CDU A;  3NBP B;  2F9J A;  2RQ4 A;  1N88 A;  1C4A A;  3K89 A;  2D3U A;  2WTF A;  5JJB A;  3W8G A;  4K4W A;  2VFS A;  2DGV A;  2MDA A;  3SMZ A;  2WON B;  4FPI A;  3ENW A;  4LUB A;  1C0U B;  1VBZ A;  5IV3 A;  3CT9 A;  4ETZ A;  2HNZ B;  5D0G A;  4DX6 A;  4ZJL A;  3MCS A;  3ULH A;  1TUG B;  3C6T A;  4DR2 F;  1DTQ A;  2NPF A;  4M5G A;  2CAJ A;  4OMF G;  5F41 A;  5J2N A;  2KVQ E;  3KK2 B;  5KG7 A;  4X4O A;  2UVW A;  4TQS A;  1F2G A;  1FRX A;  1OYE A;  1C1B B;  4P2S A;  3OL8 A;  4RPF A;  2MKY A;  1HQE A;  4J9V A;  3DNC A;  3VHQ A;  3OJU A;  3RYL A;  3KLI B;  3ILO A;  4DV4 J;  1JXV A;  2VHG A;  4LF8 F;  1PJ5 A;  2UVR A;  2ZZT A;  1DBD A;  3M2R B;  1LW2 B;  1RHU B;  5DRK A;  5KOX A;  3PJW A;  5J1P A;  2HBQ B;  1Q0N A;  4J37 A;  3GTY X;  2P6T A;  2HW3 A;  3KDO A;  2CYY A;  3HVW A;  2MGZ A;  4LIW A;  3FBE A;  2R2U A;  3S8S A;  5FLX Y;  2J9D E;  4Q5V A;  5I3Q A;  3CJS A;  4ZVR B;  2CWX A;  3D1Q A;  3TJA A;  1TEL A;  4R5P A;  2UP1 A;  4NWB A;  3RZA A;  3AT1 B;  2CPZ A;  3MEC A;  3DXB A;  4FVM A;  3TO8 A;  4MJK A;  1N32 J;  1T9Y A;  5CD4 A;  1GX5 A;  3A8J A;  3FFI A;  3MUR P;  2B5J A;  2FTR A;  2X1G A;  2MKH A;  1MLA A;  2IRU A;  4USV A;  3I56 S;  2EK1 A;  3SFU A;  5CYJ A;  3NS7 B;  4IFY B;  3PR5 B;  1C4C A;  4WII A;  2CKW A;  2CNN B;  1GXU A;  2PEB A;  1Z1Z A;  2ZBR A;  1YSJ A;  1S1U B;  3MUM P;  3TZZ A;  5I4M A;  1JJC B;  1C1C B;  2G13 A;  3UDL A;  1TL3 A;  1J5O B;  2ACY A;  2V34 A;  4F3M A;  2C2K B;  5KT7 A;  4JYA J;  3M05 A;  4ECT A;  3AA9 A;  1WC1 A;  4DJB A;  1X31 C;  4JI6 F;  2KZZ A;  2UUW A;  3MTK A;  1WEY A;  3HHL B;  3KHG A;  5HBM A;  1H7W A;  4N8N A;  1RT7 B;  4D3G A;  3VQS A;  3CB4 A;  1UJ6 A;  1YZ7 A;  3R6G B;  3C16 B;  1Z4U A;  1TL5 A;  2K8G A;  2O1P A;  5I3U A;  2IMO A;  2JH3 A;  3W8P A;  4FNH A;  3IS9 B;  3IBF B;  1X5P A;  3HPO A;  5HRO B;  4ZPT R;  3QT6 A;  2J9C A;  3B8H A;  5IM0 B;  3PX6 A;  1ZAW A;  2CQ2 A;  1FE4 A;  3HJF A;  3DLK B;  3J7Z 5;  5IQQ A;  2CQP A;  2PO4 A;  4MK7 A;  3MF5 A;  2ZD1 B;  1HL6 A;  4TLQ A;  3N6N A;  4QPT A;  3MR2 A;  2BUN A;  3CE8 A;  5JVH Q;  4WCE Q;  2OJ3 A;  2ZC4 A;  4OYB A;  3KJV A;  1WC6 A;  2H4W B;  4OYM A;  4WU3 A;  1SBR A;  3QFH A;  2KH9 A;  2CQH A;  1S77 D;  5I42 A;  2WBM A;  2LLZ A;  3LW5 C;  5KFU A;  2PSZ A;  4IOA Q;  1TFY A;  3MDF A;  1GT8 A;  2IDL A;  4DR5 J;  2XMV A;  1JLQ A;  1TAU A;  3V6D A;  1FDA A;  3QJJ A;  3C6T B;  4LR7 A;  5K9F A;  3HMJ G;  4HI2 A;  1DTQ B;  4HAC B;  1JXE A;  4EFA C;  2EC0 A;  5J2N B;  3HFZ B;  1T02 A;  2QX0 A;  2JOQ A;  4O4R A;  4I69 A;  2HRT A;  3D6T B;  2BJ7 A;  3CF5 Q;  3LAK A;  4QWA A;  1EP4 A;  4NEY A;  2WVD A;  2R4F A;  1SH3 A;  2HVI A;  1HYS A;  4YEA A;  3OVA A;  1G7C B;  1XR6 A;  5KFE A;  3G82 A;  5L46 A;  1UMJ A;  2ZUA A;  2CQ1 A;  3BJY A;  3IRX A;  4ECQ A;  3MXH P;  2VG7 A;  1HWK A;  1VQ8 S;  4X4S A;  4EZ6 A;  3MMC A;  2WRM A;  1P6T A;  3VF0 B;  1GXT A;  1UET A;  2GCF A;  2MGZ B;  3JQK A;  1HFE L;  1WOO A;  1YJN S;  3ICL A;  2V4Q A;  5EGY A;  1HNW F;  3M6U A;  4XK8 C;  3F73 A;  1U24 A;  1Q5V A;  5T7L A;  2B7B B;  1VQN S;  3BKU A;  2GIF A;  3NS6 A;  2E7X A;  1VK3 A;  1HBU A;  1I5O B;  3BB5 A;  1X4G A;  1B70 B;  5EUH A;  2RKI A;  4FS2 A;  5D0E A;  2OGU A;  5J2M B;  3M32 A;  1BXN A;  2VD3 A;  3GJQ B;  3R1L A;  1B7Y B;  1RJJ A;  2DGX A;  2VQE F;  2L08 A;  3N5F A;  1I51 B;  1U0H A;  1R31 A;  5M2R A;  4DV2 J;  3SBM A;  4PQU A;  3GIK A;  3OL9 A;  3SI8 A;  6FD1 A;  2ADC A;  1RBA A;  4DR5 F;  2V67 A;  4N5S A;  1TL7 A;  2G0C A;  1N36 J;  4PG7 A;  3TAM A;  1HKA A;  2GQC A;  4DPO A;  2QLJ B;  3PHE A;  3P96 A;  3EPG A;  3UDC A;  3KOA A;  4Z37 A;  3D0G E;  5CZX A;  1Q95 G;  1UFW A;  2C2N A;  3ZZY A;  1FRJ A;  1TKT B;  1R0A A;  5KFZ A;  5HBM B;  2EBE A;  3N9U C;  4O4G B;  5BR8 J;  1XNQ J;  1RTZ A;  3X3U A;  1EX8 A;  3H4D A;  3DCA A;  1KVI A;  5I3U B;  3K5N A;  3V6H A;  1ZET A;  3RR8 A;  3PVX A;  3SCK E;  2NYH A;  2J6U A;  1F5A A;  2AYM A;  3JSR A;  1KEK A;  1RI7 A;  2Z30 B;  1UTA A;  2DK2 A;  2KDO A;  4ZA1 A;  4FZV A;  3R6L B;  1SUQ A;  1UFL A;  3I0R A;  2ZDP A;  3DLE A;  4OI1 A;  3VAI A;  1ZA1 B;  1G4C A;  2CPY A;  1HMV A;  2PE8 A;  1SIW B;  4R0J A;  3VR1 A;  3ZZP A;  4WZM A;  2R8H A;  2RQM A;  2G4B A;  4YR2 A;  3RU0 A;  1OYD A;  2Z57 B;  2OMO A;  2NUH A;  4X4R A;  3M8Q A;  4CZC A;  3LAN A;  4DN0 A;  1T9U A;  2KYZ A;  4F36 A;  1U09 A;  3BGO P;  3FC9 A;  3BPS P;  2JRS A;  1MWY A;  2CJB A;  3I31 A;  3V6D B;  4KQZ A;  4YS2 A;  1S6P A;  3OXF A;  1SJ4 P;  4KFB A;  3B54 A;  2JVO A;  1SKR A;  4I2P A;  4M5K A;  3M9M B;  2LEC A;  3FBB A;  4DV6 J;  4ZPW R;  3AOA A;  4EUV A;  2HWT A;  2BQU A;  5HLF A;  4LFB F;  1VDH A;  3KHL A;  2DH9 A;  3F56 A;  1N36 F;  2FIU A;  4O3P A;  2X1B A;  1EP4 B;  4DX7 A;  2W7P A;  3D9B A;  2EBG A;  2VH7 A;  1LNQ A;  3QGG A;  2DXE A;  2WCX A;  2VON A;  4ZPD A;  2XWY A;  1KS2 A;  2N7Y A;  1HYS B;  3T9N A;  4RL1 A;  1X4E A;  3G82 B;  3IRX B;  2VG7 B;  4OZN A;  3BR9 A;  4EU0 A;  2ASD A;  2YKA A;  5BR8 F;  2DH8 A;  4XTT A;  2IY5 B;  1QM9 A;  4Y2C A;  1G1X A;  5DS7 A;  5BYR A;  3TW0 A;  4OX9 J;  2EEY A;  3PKY A;  3DGV A;  4PG6 A;  2Y1I A;  4X66 J;  1QAY A;  3MM5 A;  5DLG A;  2UUA F;  1QSL A;  4J9Q A;  3RB0 A;  1MMD A;  1AUD A;  1RWP B;  3TVK A;  4LF7 J;  1FX4 A;  2CQC A;  4C8M A;  1XMQ F;  2U2F A;  2NQP A;  1Q16 B;  1FJ7 A;  2RKI B;  3D54 A;  3L4B C;  2DNP A;  3KXD A;  5LM7 E;  2YWK A;  3P4U B;  4KGM A;  1P1T A;  2GVZ A;  4WKY A;  3CO9 A;  2XYP B;  2MST A;  1D8Y A;  3O44 A;  4YHH J;  4X62 J;  1U0H B;  3GP9 A;  3UNG C;  2MQL A;  2XMM A;  3DLG A;  5IV4 A;  1EZZ B;  2N3O A;  4DLG A;  4PQU B;  4ZN3 A;  1TP7 A;  3CDW A;  2LKZ A;  4OJ3 A;  1NU4 A;  1CVJ A;  2G1H A;  3TQE A;  5LSO A;  3LAM A;  5F8N A;  1VC0 A;  2DD8 S;  3D66 A;  4PYD A;  4AND A;  1NHU A;  4AQY J;  2EFP A;  2AHO B;  1HHQ A;  3TAM B;  2ZKU A;  4J91 A;  2KFZ A;  4JI3 F;  2OI2 A;  2D1C A;  4URS A;  2YXL A;  1S1W A;  1VK8 A;  1WEZ A;  3KLG A;  2FVS A;  4LQ3 A;  2B9Y A;  1RWX B;  1R0A B;  1KTV A;  3W9J A;  2HSE B;  3EVW A;  1WKJ A;  4NEZ A;  2R2T A;  1V3S A;  5LJ3 Y;  2RRB A;  3VAM A;  2HS4 A;  2BQ3 A;  2FVQ A;  2V9W A;  2PT0 A;  4F67 A;  2BE7 D;  2HQF A;  1UEU A;  1URN A;  1SUQ B;  3H5U A;  4QIF A;  4OX9 F;  4RLE A;  2F65 A;  4ILL A;  2YX4 A;  4M5I A;  3FEX B;  4DPW A;  3DLE B;  3EE3 A;  2A3J A;  2WHO A;  1HMV B;  1NH7 A;  2EKY A;  3W66 A;  1TMM A;  4B17 A;  2Z4P A;  1CJT A;  1WKK A;  1TK0 A;  4CM2 A;  1YJV A;  1PBU A;  1N5T A;  1S72 S;  2CZ9 A;  3DU6 A;  4DSL A;  4CLS A;  1H72 C;  4ZCL A;  5IT9 U;  1FE0 A;  4C8N A;  4HI1 A;  4DQP A;  4EBD A;  2VKZ G;  3DRP A;  3OSP A;  4OYP A;  2O3D A;  5CH7 B;  3NCQ A;  1BY9 A;  1FKA F;  1MW7 A;  1S6P B;  3BF4 A;  1R43 A;  4G1P A;  3HDS A;  4KFB B;  4M8L A;  3FSI A;  1R0B G;  1TR0 A;  2MQN A;  1NK6 A;  5GAD I;  5A0Y A;  2GMJ A;  4HL9 A;  1MU2 A;  4KHM A;  5GAE U;  1RAJ A;  5HLF B;  4W92 B;  3W5Z A;  5GME A;  3KDN A;  2FJE B;  3LP0 A;  2ZFH A;  1FXD A;  5IWA J;  3HHK A;  2W2O P;  2IRX A;  3Q83 A;  4O44 A;  4M95 A;  2VFT A;  2JFD A;  2AGQ A;  4ZKA A;  1IKW A;  4FKX A;  3OFG A;  4C0O C;  3M9O B;  1F0X A;  5FII A;  3ZXW A;  2LQ5 A;  3Q89 A;  2FZC B;  2GV1 A;  4E8U A;  1S76 D;  3SDE B;  1KOO A;  5KFL A;  3RB3 A;  2K2P A;  1TFW A;  4A8Y A;  3CJR A;  2LDY A;  3PXG a;  4GVL A;  2VPW B;  2QLB B;  1HPZ A;  1RCX B;  1NK7 A;  4GO7 X;  3HP6 A;  4DV7 J;  1UVL A;  4FYV B;  4OI4 A;  1NM2 A;  2AEM A;  2L9N A;  5HMW A;  3RRG A;  4USI A;  4RUA A;  4DQR A;  3H98 A;  5AXN A;  4R25 A;  2QFI A;  5AXM A;  4USU A;  2AV5 A;  4NLV A;  4P7T A;  4WYW A;  1SL1 A;  4ID5 A;  2K7J A;  1RYS A;  1FNM A;  4LVO P;  2KT5 A;  3G6Y A;  3KMS A;  2VB6 A;  3I0S B;  1H38 A;  5DLF A;  1REG X;  5HMZ A;  4G1Q A;  4KKO B;  4ZVO B;  2QA1 A;  3O1L A;  2Y8W A;  2FY8 A;  3DLG B;  2WB4 A;  3N01 A;  3RAM A;  3PEH A;  3HHL D;  3F41 A;  2IDE A;  2HS3 A;  3CVK A;  2LXI A;  5IT0 A;  2W7O A;  2RHS B;  2P8I A;  2YVS A;  1X0P A;  1HNX J;  3MCO A;  1Q8I A;  4B3M F;  1C0T A;  3BGU A;  3SXL A;  4QYR A;  1QAI A;  5F3T A;  2XS7 A;  3GFZ A;  2YNH A;  1WG1 A;  4BHQ A;  4J9R A;  2XLK A;  1S1W B;  5J1N A;  3MHY A;  2MQM A;  2CDQ A;  1PIE A;  4ZN1 A;  3UR0 A;  1KVK A;  3R5A A;  3GFX A;  2X7I A;  2AJQ A;  5L9N A;  4QWB A;  1SJF A;  2DGQ A;  1F5B A;  1UA0 A;  4DV1 J;  4N77 A;  1FTR A;  1FT8 A;  4QZV B;  1YRT A;  3ZZ0 A;  4PR6 A;  1NKB A;  1RDR A;  4OYO A;  2ZHO A;  3LO3 A;  2QSW A;  2HQ3 A;  1S9E A;  2AJF E;  2B4P A;  1VQS A;  3VGV A;  4H4M A;  4O0I A;  1KON A;  2AYG A;  5FJ4 A;  3V4I A;  4B9S A;  3DI6 A;  1E6Y B;  3WX8 A;  2I38 A;  2WSC C;  1CJU A;  1FFS B;  2A10 A;  2IHR 1;  1CJT B;  7AT1 B;  2VPX B;  3Q8U A;  2DR6 A;  1IQT A;  5GAH U;  3SCI E;  1LFW A;  4MIW A;  1R8H A;  4ITS A;  4U7C A;  2OPS B;  1FJG J;  1FWK A;  2ZH9 A;  1RT1 B;  4A4J A;  5M2U A;  1G6B A;  4RNM A;  2XLI A;  5LOQ A;  3MD1 A;  4F4X A;  2PMW A;  4TYB A;  4A46 A;  2QT7 A;  4U95 A;  4NA3 A;  4TY8 A;  4ZP9 A;  3G8T A;  3DRP B;  1YTY A;  1KQS R;  1U7L A;  5KFI A;  4UQG A;  1I94 F;  1RLC L;  1N6Q A;  2E9Z A;  2FQQ B;  4IKA A;  3MR6 A;  2RQC A;  5HVG A;  5A0Y B;  1MU2 B;  5I3P A;  1OO0 B;  2CJX B;  4Q8E A;  1NHK L;  1HNX F;  3P5T L;  1WHX A;  4DCP B;  4E98 A;  3CDA A;  3LP0 B;  3MEE A;  4U67 Q;  3H0P A;  5B09 A;  4O44 B;  1RP5 A;  2HIY A;  1BE4 A;  1HD1 A;  2HHQ A;  3BN4 A;  2BM0 A;  1HIY A;  2H5I B;  3NG8 A;  1EAR A;  3PYF A;  2G0I A;  2GS8 A;  3AOD A;  1U1P A;  3JTN A;  3RJM B;  4FXV A;  2XMK A;  2ZC3 A;  1RLD A;  4CLW A;  5KFJ A;  1TMJ A;  3MFH A;  4DR4 F;  4I0W A;  2XNR A;  2XCA A;  4NA2 A;  2HHH F;  4C8Y A;  3TUI C;  2HVH A;  4A8X A;  3VAK A;  1HPZ B;  1XR7 A;  2XS2 A;  2DRD A;  5KFA A;  4ZP8 A;  3DYA B;  5AE1 A;  1KC8 T;  4LF4 J;  2QV6 A;  2EG2 A;  3GFH A;  4DFP A;  4LF9 J;  2JDJ A;  2KN4 A;  4KB7 A;  4CH7 A;  3M2V A;  2LQJ A;  4C9D A;  2O67 A;  4UOF A;  3R5J B;  1VYA A;  2ZNY A;  4ID5 B;  2W8L A;  2A2D A;  4URG A;  2KXH A;  2CZV C;  2MLX A;  3OSN A;  5HQ8 A;  2RSQ A;  5F8M A;  1AA1 B;  1VLO A;  5BYQ A;  2GHV C;  4LMZ A;  3MM8 A;  1IBM J;  4G1Q B;  3LGN A;  1LOU A;  1FJG F;  2QA4 S;  2WW8 A;  4TVA B;  4K59 A;  2ZJQ Q;  4KT0 C;  2J7U A;  2CIM A;  4RR5 A;  4LT6 A;  2A1B A;  3GG1 A;  4IO9 Q;  2YKM B;  3CCZ A;  1L3S A;  2MKI A;  1C0T B;  1NJW A;  4DR3 F;  2CJY B;  3QRR A;  2YNH B;  3AAW B;  4U6P A;  4Q2L A;  2CJQ A;  2V4R A;  4QIV A;  8AT1 B;  2Y0B B;  3DDN A;  4K4S A;  1O8B A;  4HT5 A;  2M52 A;  1JLG A;  3W9H A;  2HFV A;  4YR3 A;  4RNN A;  3DMJ A;  1RWW B;  2E7W A;  3CCL S;  3PFE A;  1K0V A;  1DTT B;  4FXD A;  1OQ3 A;  3KUE A;  2WVE A;  1ELO A;  2DIV A;  1IVZ A;  2EFV A;  1WTF A;  1S9E B;  3NOG A;  1PC5 A;  3ZTR A;  4EI2 A;  2HHX A;  4H4M B;  4MT1 A;  1LEO A;  5K14 B;  3V4I B;  1NSK L;  3DI6 B;  2GIQ A;  4F4A A;  2MZS A;  4M1K A;  3K17 A;  1CJU B;  2DNH A;  1PAU B;  3CDB A;  3JXO A;  4FYW B;  3KUG A;  4CM0 A;  2VQF J;  1XC9 A;  2B6A A;  2EI5 A;  3M8P A;  1FFG B;  1X60 A;  1REV A;  4DSE A;  3OL7 A;  1FRH A;  5ITH A;  3IFE A;  2DNN A;  4JV5 F;  1XJW B;  1U6F A;  1JB0 C;  4IG0 A;  3TA0 A;  1IBM F;  1A9N B;  4TY8 B;  4WP3 A;  4B3S F;  2KRB A;  2HHU A;  4NLT A;  4ICL A;  3PR4 A;  3BGL A;  1N6Q B;  3Q22 A;  2IYI A;  3SQO P;  2GQ2 A;  3G8Q A;  1QE1 A;  2R8I A;  2XS5 A;  3MEE B;  2AJ4 A;  1HBO B;  4USW A;  1KWM A;  4LFC F;  1HBN A;  3ISN C;  3OLA A;  2CPF A;  1NXI A;  4ECX A;  1LXN A;  4A8K A;  1RSC A;  3FNN A;  4FF4 A;  4DF4 A;  4LR8 A;  1BGX T;  4LSL B;  2R7X A;  2Y3Y A;  1RAE B;  4HVZ A;  2ZH7 A;  2A6O A;  1SC6 A;  2WVB A;  4DHV A;  1X4B A;  4ZHR A;  3IC1 A;  5T14 A;  2ABY A;  5KFW A;  4XDC A;  3US5 A;  1LWC A;  5HAT A;  1ZAX A;  2UU9 F;  1ZBT A;  5C25 A;  3K2Y A;  4PEO A;  2LA6 A;  1CQN A;  1OPZ A;  3M2V B;  3R8Y A;  3HSZ A;  2E1R A;  2OEM A;  5J2Q A;  2BJ9 A;  4GVB B;  1DHM A;  1LK7 A;  1ZH5 A;  2MQO A;  1T9T A;  4C8K A;  1FVS A;  1ZPV A;  2BDP A;  2WW4 A;  2E5G A;  2VQF F;  4RW4 A;  4CH0 S;  3MM8 B;  3HZE A;  4YB6 A;  1KR4 A;  2E1P A;  1RAA B;  4X84 A;  4PG5 A;  3ENV A;  3U7J A;  1PIL A;  1RCO B;  4YME A;  1B7F A;  3D0I E;  5SZT A;  3OR1 A;  1UVN A;  2HHP A;  4DR7 F;  3MTJ A;  2VA2 A;  1RUS A;  3T3F A;  3GFY A;  4F4Y A;  2W1B A;  3J81 j;  1ZM4 A;  3EM1 A;  3MED A;  1D3W A;  1RAO A;  3O3L A;  3TAP A;  1HQ2 A;  4M5N A;  4Y2A A;  2W9A A;  4QR0 A;  2HND A;  3PX0 A;  1JLG B;  2ASJ A;  2NS1 B;  2AJ1 A;  3RW7 A;  3DMJ B;  2BR0 A;  4QIG A;  3M8Y A;  4ED6 A;  3GR0 A;  3JYT A;  1FNX H;  3CMQ A;  1EAY C;  1CS4 A;  4UY8 5;  1LWF A;  2IYG A;  2DNM A;  2MHN A;  1NRK A;  3VQT A;  5AE3 A;  2ROP A;  3RB4 A;  1WHV A;  1S7I A;  1U8W A;  3SQG B;  4K0K F;  3LA0 A;  1QAJ A;  4C0B A;  2GZO A;  2J0Q D;  5K8M A;  3U1N A;  1TL1 B;  4RU9 A;  1FCA A;  4OX8 A;  3L09 A;  1YBA A;  5D4O A;  3I5A A;  5DQI A;  5IT9 Y;  2CG8 A;  4K4Z A;  3KLF B;  1VI7 A;  4PWD A;  5C42 B;  2EFO A;  2B6A B;  4QBU A;  3IP0 A;  1RU1 A;  4XO0 A;  3QPI A;  2MMY A;  2D3O 1;  3C66 A;  1FRI A;  4ZPB A;  4JI8 J;  2RUG A;  2IAJ A;  4QWD A;  3K5P A;  3FEZ A;  2WAQ D;  2B0G A;  4ICL B;  4OLP A;  2DVI A;  2RVJ A;  3NRB A;  3PCO B;  1S9G B;  3THV A;  2VIC A;  1HI8 A;  2H5E A;  4MK8 A;  2VFR A;  4RBV A;  1QE1 B;  4DV3 F;  1W2B R;  4IRK A;  2AQ4 A;  3KNA A;  2UXB J;  2R7V A;  4NYP A;  1SQF A;  1W25 A;  3W61 A;  4P74 A;  1GAO A;  2W24 A;  5HQM A;  2ZE2 B;  5ETV A;  2YNF A;  4ED8 A;  1NH8 A;  3DHW C;  1UAW A;  1M5O C;  4LF6 F;  2HS0 A;  2XZD B;  3PYE A;  2YTC A;  2XQC A;  5AXL A;  2PMH A;  1XTZ A;  4PPZ A;  4PPD A;  3GYX B;  3W3S A;  1RT5 A;  3TZX A;  2IM0 A;  1WKL A;  3HSD A;  4Q45 A;  4JI1 F;  5C25 B;  4RZR A;  3HKW A;  4O3O A;  4PXD A;  1DRZ A;  2GMH A;  3RUB L;  3P6Y C;  5BXI A;  3IXQ A;  4Y00 A;  1LQ9 A;  5E5N A;  3R3T A;  3H59 A;  1Y3J A;  4ID8 A;  3CCW A;  4HHH A;  2N4D A;  3EPI A;  4DFJ A;  1IQZ A;  3QZ8 A;  3ZTP A;  4XPE A;  3WC2 A;  2HLU A;  2EXU A;  4LRC A;  4O0N A;  1JJ2 R;  1PG5 B;  4RO0 A;  4J9K A;  2HFO A;  4BC9 A;  2J0S D;  2BYC A;  1DFD A;  4JI8 F;  3WIU A;  4MFB A;  4BC7 A;  2AJ2 A;  4JI5 F;  3IBW A;  3OR1 B;  2KHC A;  3D1H A;  3QID A;  3O8W A;  2B43 A;  2WSF C;  1SQE A;  4DU7 A;  4KGX B;  2XY6 A;  1R0C B;  2XUL A;  2PGC A;  2ZWO A;  4PXB A;  2ZBI A;  2DHA A;  2HZV A;  4F7V A;  1AFI A;  2Z8Q A;  1HHT P;  3MED B;  2DGT A;  2E5L J;  5KFT A;  3DHX A;  2I1R A;  3M8R A;  4N76 A;  1YRU A;  4XDD A;  2P2C B;  2HND B;  1KD1 T;  3MAH A;  3TYT A;  3BYP A;  4TN2 A;  5JUM A;  3TVZ A;  3Q2S C;  4ILR A;  1CPZ A;  3JYT B;  2W7A A;  4BCA A;  2RB7 A;  1S9F A;  4KHP J;  3CJ8 A;  2OD6 A;  2ZWP A;  3DLJ A;  5JXS A;  3PTW A;  1CS4 B;  5HO4 A;  1NB2 A;  5D77 A;  2OPQ A;  4I56 A;  1D9F A;  2JJ4 D;  4Y65 A;  4XAK A;  1UEK A;  4IG3 A;  2VC0 A;  4WXW A;  5KFS A;  1QLN A;  1TQL A;  2BE2 B;  1N5S A;  2IIH A;  3K7R A;  1SL0 A;  5JMN A;  4IH6 A;  1HWU A;  1LWE A;  2QZ8 A;  1TUW A;  2QN6 B;  3H2U B;  5CD4 H;  4PWD B;  4EBC A;  2ZH4 A;  2OSQ A;  1UVM A;  4UF4 A;  3ZNU A;  2HVE A;  4M5D B;  2CQB A;  1X9W A;  2YNI A;  3DLH A;  3R7N B;  1SCJ B;  1RE1 B;  3KNG A;  3IMQ J;  3CJ5 A;  1RBO B;  2FDN A;  3TAQ A;  4Q2M A;  1MMN A;  3RW6 A;  2IAJ B;  2HFZ A;  3J7Z T;  2BAN A;  1NK0 A;  2HZA A;  1DAX A;  1JKH A;  2OO4 A;  2Z2L A;  1KN6 A;  2HKE A;  4YN3 B;  2MQ8 A;  3VVU A;  4ZCK A;  3GJR B;  1S0M A;  4KO0 A;  2J8A A;  5E3C A;  4YOE A;  3OFF A;  4ECU A;  2RML A;  4DUZ J;  1S7H A;  1QD1 A;  1U8S A;  3K0J A;  4GC7 A;  3FK4 A;  3W2V A;  4TYA A;  2V63 A;  2YNF B;  1OSD A;  5D78 A;  4NLP A;  4AT1 B;  4M5M A;  3KK1 A;  1M90 T;  2VBY A;  1VRT A;  1CBK A;  1MML A;  1FES A;  3ZZO A;  2V68 A;  3UN5 A;  2FY1 A;  5HVF A;  1OY6 A;  4ZDN A;  3AD8 C;  3U1L A;  1EKS A;  4WBF A;  1VJW A;  4CLP A;  4WFB Q;  2HWH A;  3IN5 A;  1RT5 B;  5ETS A;  2Y9H A;  4LF1 A;  1BQM B;  2UXC F;  2PN6 A;  2HHS A;  2F9D A;  5DG8 A;  2FJV A;  5KFM A;  4IFV A;  4AE5 A;  3BV8 A;  2AD9 A;  3IRW P;  1HI0 P;  2JC1 A;  3W65 A;  3M6V A;  4DEZ A;  1M5K C;  4BBY A;  3LQV A;  2L3M A;  4C11 A;  3QAT A;  5DDO C;  1QVG R;  2EFG A;  4OI0 A;  2GML A;  4HDG A;  1VQY A;  4B9V A;  2D7S A;  1XEZ A;  1CG2 A;  2GJF A;  3T5K A;  4RW9 A;  4WE1 A;  3EGN A;  3MM7 A;  4C8Z A;  3BGR A;  3CJ4 A;  5DZ6 A;  2ZM6 F;  3DGP A;  1FF2 A;  4P52 A;  4MFB B;  3PRB A;  3CED A;  4P2F A;  4RBU A;  1IBL J;  1APS A;  4QOT A;  4K50 A;  1PSD A;  1JLE B;  4WZQ A;  4A48 A;  3KMQ A;  2H3E B;  4CYU A;  5DDP C;  4M5L A;  3A3P B;  3E01 A;  2ZH8 A;  1WOS A;  2V8D A;  4O3Q A;  2G9O A;  4PG8 A;  3LPY A;  1BQN A;  3ISZ A;  5C5J A;  3CCE S;  4LJM A;  1YK9 A;  3CXC R;  2XMA A;  2DPI A;  2OSR A;  5D0H A;  3SSQ A;  3ONQ A;  4IQM A;  1L5U A;  3Q8V A;  2AW0 A;  5H9E J;  3R97 A;  4F3O A;  1PYT A;  1N52 B;  7FDR A;  1QUV A;  3E51 A;  3GWC A;  2IC3 A;  4DQI A;  2R7T A;  1V9O A;  1YJ9 S;  5GVQ A;  1RYR A;  1TTH B;  2OPQ B;  4EO8 A;  1KQF B;  3QGP A;  2YWG A;  1R3N A;  2CPI A;  3QT7 A;  3MM9 B;  3C46 A;  1KOH A;  2MZJ A;  1VQL S;  1ZM9 A;  1FRK A;  4BLG A;  5DG7 A;  4HTI A;  1YQH A;  4C0H A;  4NMX A;  2JX2 A;  3HT0 A;  2F40 A;  1RWK B;  3AOB A;  1HNZ J;  4IO1 A;  4ZP6 A;  4KYZ A;  2P5V A;  3M1V A;  2YNI B;  2MY7 A;  1V6H A;  1NJI T;  5CXT A;  2PII A;  3MMJ A;  3PRV A;  1B0T A;  4YDX A;  5MLC V;  4KPY A;  3QO9 A;  1GQE A;  3TX0 A;  4QIW D;  1OY8 A;  1TKZ A;  4DDF A;  4NLO A;  1WI6 A;  4CO5 A;  1IKX A;  4ELT A;  4KO0 B;  1FNO A;  1N33 J;  1EQ0 A;  4PAB A;  1FI4 A;  1LV5 A;  4DF8 A;  1FER A;  1RIS A;  1FRL A;  2FJD B;  4ZLL A;  4RW7 A;  4U7U D;  1S1X A;  1NPK A;  1FXL A;  2RQK A;  4HLB A;  2KO1 A;  5KFF A;  3C14 A;  1KFS A;  4U8V A;  1LXJ A;  4ECZ A;  4I67 A;  3M30 A;  4C6A A;  4FS1 A;  2RU3 A;  2CZ4 A;  2LCW A;  1YJ7 A;  3WQP A;  3KK1 B;  5HQL A;  1IWA A;  1VRT B;  1NCL A;  1RT3 B;  1HW9 A;  3GV5 B;  4IYQ A;  3KTQ A;  1UJ4 A;  1ZPW X;  3POT A;  4I2Q A;  3CC7 S;  1B4S A;  2B7C B;  4FDF A;  4KV8 B;  4B9T A;  2FHK A;  4JV0 A;  4ZVH A;  1EIY B;  3IBC B;  2P9C A;  4P2M A;  2KXF A;  3OVS A;  3GYG A;  4OHW A;  3S1T A;  3DN9 A;  3CJ0 A;  1SC4 B;  1H6K X;  2J7W A;  4QR1 A;  3ZTO A;  5F9L A;  3MMB A;  2XY5 A;  2IBO A;  2R7O A;  1ZTT A;  3W62 A;  5SUH A;  4GC6 A;  5AE2 A;  1PGZ A;  4IFV B;  3CUL A;  4YP3 A;  3VV2 B;  1VOM A;  1XBW A;  5B0E A;  3FZB A;  3JSM A;  5AJ3 F;  5BYS A;  2F5G A;  5K8O A;  4NYZ A;  1HNZ F;  1N0V C;  5CCM A;  4CT8 A;  3TR5 A;  3BBB A;  1U1R A;  3MM7 B;  2DR5 A;  3BGR B;  5HVH A;  3WIV A;  1JLB A;  3DGP B;  1T0T V;  4FPR A;  2QRR A;  5CZV A;  2MKC A;  3MM6 B;  3RBX A;  5KFV A;  3BM7 A;  1YGY A;  5HMX A;  1XQI A;  5H9E K;  5HSP A;  2B4V A;  1SH0 A;  3MZI A;  4RUB A;  4CYU B;  4I64 A;  3E01 B;  3E3X A;  4RKU C;  3MR3 A;  2CJA A;  2V2V A;  5L1L A;  4JB8 B;  1N33 F;  5GAD U;  2QL7 B;  4Y2K A;  3HHN B;  4A8M P;  4NLQ A;  4W90 B;  4J5O A;  3DLL Q;  2AX0 A;  3B4D A;  1U2F A;  1ZZN A;  4WU2 A;  4KGV B;  1JK9 B;  4ZJQ A;  3EYZ A;  3TRG A;  5A8K A;  4YB5 A;  4LF8 J;  3TJ9 A;  2BV3 A;  4FXW A;  3HO1 A;  2AX1 A;  5DQH A;  4TKT A;  3GLJ A;  3NMA A;  4A8F A;  3DLB A;  2FJW A;  2FJB B;  1NPR A;  1OS5 A;  2V4J A;  2UV8 A;  1H7X A;  3I4P A;  1PJ7 A;  4WYL A;  4H4O A;  3CIM A;  3KJQ B;  3OQ2 A;  3T6J A;  3ELH A;  3ZFV A;  1TL4 A;  5CCL A;  3U27 A;  2Q6B A;  1N5V A;  2HG4 A;  2BA9 A;  1X9M A;  2BXJ A;  2DGS A;  4DS4 A;  2DT9 A;  2HFS A;  5E41 A;  2F7V A;  1YKW A;  4K8R A;  2FHJ D;  1SJ3 P;  5T41 A;  2R7Q A;  1D0E A;  4EMD A;  5KT6 A;  1I3O B;  2DEJ A;  4MAK A;  3PX4 A;  1X4H A;  5DZ7 A;  5J1E A;  5DGB A;  1WHY A;  3QGI A;  3QO9 B;  4OHV A;  3UPF A;  2FJX A;  1TKZ B;  1GX6 A;  1X0F A;  3ETO A;  3HSG A;  2HFN A;  3QLH B;  1IKX B;  1RTD A;  1O6X A;  1KTQ A;  3EMT A;  2JNJ A;  2MTL A;  2IJF A;  4F4Z A;  3Q23 A;  4PCQ A;  4I7F A;  4RW7 B;  4L73 A;  5KG4 A;  3L9Z A;  2YKO A;  2E9T A;  3UVJ A;  4K4X A;  4JI6 J;  3C14 B;  4DG1 A;  4OYX A;  5KG5 A;  3M30 B;  3A8K A;  4ELU A;  2QE5 A;  2HBR B;  5K20 B;  5FD1 A;  1HHS A;  1R7I A;  3RAX A;  4WXO A;  2GHP A;  1M1K T;  2HHW A;  2XB2 D;  3MMA B;  2D41 A;  3I9Z A;  4U8Y A;  4CT9 A;  1U26 A;  1AB8 A;  2VF3 A;  1QTN B;  2QO3 A;  4I2Q B;  3JB9 k;  3CNQ P;  3M9N B;  3TP2 A;  1PO6 A;  2D74 B;  3VGU A;  2ZDO A;  1JX4 A;  4J9S A;  4K4V A;  4RWW A;  4JUZ A;  4J9N A;  1JIH A;  2L48 A;  3MMB B;  1S1V A;  2QYC A;  4DWI A;  1FKO A;  5HL7 Q;  1N5Y B;  4F8R A;  2Q6C A;  2B51 A;  4UOC A;  3OUY A;  1D8Z A;  4PRF A;  4CCH A;  3NNA A;  4JI0 F;  2JZ5 A;  1RGV A;  4NYO A;  4LF2 A;  1RZM A;  1NB7 A;  4ZIT A;  2MZT A;  1J5E F;  2RU9 A;  3HUL A;  3ISN D;  2XTJ P;  4UW2 A;  3TVY A;  2DNZ A;  4EO6 A;  3P49 B;  4AFF A;  3T1H F;  3R9L A;  4F50 A;  3EGW B;  3PHT A;  2AIR B;  3P8B B;  3M6X A;  1HNV B;  5A6W A;  3NGK A;  2DO0 A;  2F8E X;  3CO0 P;  4EYH B;  5ETR A;  3QSY B;  4FBT A;  1O0P A;  4CH1 A;  3GZ7 A;  1HQU A;  3KLE A;  2CJK A;  4AYB D;  4X4N A;  1XN9 A;  2F4V J;  1PC4 A;  3MPW A;  4NXM J;  1S6Q A;  3FQK A;  1WAC A;  1Q5Y A;  1WOR A;  4IRD A;  2ZJP Q;  4URQ U;  1ACM B;  2ZH6 A;  1LFP A;  2IMW P;  4IUF A;  2HHT A;  1UP1 A;  1VR6 A;  3OTO J;  4ER8 A;  3VAF A;  1NDK A;  1HW8 A;  2JC0 A;  2W2M P;  3I82 A;  1T03 B;  3PDN A;  2KU7 A;  4NZ6 A;  5A8K B;  2HFU A;  3MI7 X;  4J7C A;  4CLL A;  1CJV A;  2W25 A;  2VG6 A;  4ZVE A;  3HJV A;  3TAN A;  2H65 B;  2BEF A;  2OPR B;  4ZVS B;  1N54 B;  2V4J B;  4NLD A;  1HNW J;  2W4P A;  1B99 A;  1NUE A;  1KNZ A;  2DIU A;  4LBH A;  2XHC A;  1RU2 A;  2U1A A;  4IOB A;  4L3K A;  2KJW A;  3GCX P;  2J8S A;  2AZ1 A;  1D9A A;  4RUH A;  2D9O A;  1IBK F;  1BMQ B;  2MKK A;  1HWI A;  4DQS A;  2BX6 A;  1BUX A;  2AP6 A;  3CDE A;  4OL8 A;  3IAM 9;  2C2Z B;  3LTO A;  3QWP A;  5RUB A;  1AW0 A;  4UQT A;  2NXC A;  1IN0 A;  1X4D A;  2C3U A;  1EET A;  1NJZ A;  2UUT A;  2OEK A;  4DPY A;  2OTJ S;  2VQE J;  3X1L B;  1DQ8 A;  1WEL A;  4DCJ B;  2VJV A;  3DRX A;  3GII A;  2F3J A;  1Q82 T;  2RNE A;  3D68 A;  2O5D A;  1MSW D;  1RTD B;  4ED1 A;  2KXN B;  3D4J A;  2FZK B;  4ES1 A;  2R7R A;  3DU5 A;  2QA4 G;  1RBL A;  1T95 A;  3M4X A;  5DET A;  2V8H A;  4I4B A;  2KFY A;  3C6U A;  3I5C A;  4DR1 J;  3GJT B;  3GR1 A;  3UVJ B;  3OHB A;  1U1N A;  2F4V F;  3BQ0 A;  3W9I A;  4NXM F;  1NEE A;  4DG1 B;  2YWF A;  2LXU A;  1V3R A;  3EDQ B;  5HJY A;  3BDP A;  2C2M B;  1HQE B;  2PC6 A;  2Q66 A;  3HT3 A;  3NLC A;  2XMT A;  3MEG A;  4DV5 J;  3ZZZ A;  1BHN A;  3OTO F;  4ED2 A;  3AY0 A;  1KQG B;  3P5B P;  4AUK A;  1CUL A;  4W98 A;  2M4M A;  2NXN A;  4ZIV A;  3LF0 A;  2RHQ B;  1QVF R;  3SIP B;  1ZA2 B;  2H1Y A;  1NND A;  2ZUG A;  4ED3 A;  5L38 A;  2JFK A;  3I55 S;  4DSI A;  3UCG A;  1AT1 B;  3H20 A;  1KRP A;  1MNE A;  3BSC A;  3GE9 A;  1S1V B;  1NZ8 A;  5IFM A;  4AD6 A;  1FKO B;  2BOP A;  3IGV A;  3TWZ A;  3OUY B;  1WSR A;  4DLE A;  1IKV A;  2MYF A;  4ZLN A;  4R5P B;  2DXF A;  3C2P A;  2SXL A;  3MEC B;  2AKW B;  5KAK A;  2QA2 A;  4N56 A;  1S57 A;  3FFI B;  2V8G A;  2B5J B;  1SV5 A;  3QNW B;  4JV1 A;  4FYD A;  1BWV A;  2M7S A;  3CCU S;  4KE5 A;  4V19 X;  2W4D A;  1NKC A;  1ZM3 A;  4LFA F;  1U47 A;  3GQC A;  1H98 A;  2N7C A;  3QIP A;  1WSV A;  1HQU B;  4HHJ A;  3BDE A;  3KLE B;  5GMD A;  4TU8 A;  2IM1 A;  3KHR A;  3WZ0 A;  3AJD A;  1S6Q B;  4LF5 F;  4LFB J;  4EEY A;  1TL3 B;  2AMC B;  2WOM A;  5KTQ A;  3HVT A;  2J9E A;  3MPY A;  3K5M A;  3PW0 A;  4K4T A;  1HNI A;  2ROG A;  3WX4 A;  4DR1 F;  3TUP A;  3AXM A;  4DV0 F;  2VG6 B;  5THW A;  1SH2 A;  3MOZ A;  3LWL A;  1AZS A;  1X5S A;  4DV5 F;  2CPE A;  1IWG A;  4F0M A;  1DQA A;  2HRU A;  1RWM B;  2HYI B;  3V4M A;  4QW8 A;  1UCN A;  4CWB A;  2DHX A;  1WDD A;  3FBF A;  1GXL A;  1VQ5 S;  3BQ2 A;  3AH6 A;  2K7K A;  4Q7A A;  1J27 A;  3QRP A;  1WOP A;  2UUA J;  1FHT A;  3L7O A;  5F8H A;  2J6T A;  2R8J A;  1FFW B;  4UZB A;  1FX2 A;  4FBU A;  3M7V A;  2AZ3 A;  3ZNJ 1;  4O23 A;  2XSJ A;  1XMQ J;  3PO4 A;  3NAI A;  3AD7 C;  3EGZ A;  2VPY B;  1RWV B;  2K3K A;  2C3P A;  2X3D A;  1FKP A;  3UW1 A;  1K9M T;  5ETL A;  1VQ4 S;  3KJV B;  3K59 A;  3FDS A;  4CDI A;  2CNL B;  1EET B;  5C7P A;  5KOW A;  3K5O A;  4A8S A;  5I42 B;  3T6B A;  2H9Z A;  1RAG B;  2C3M A;  2BMB A;  3JTO A;  3C8Y A;  5G0R A;  4IOC Q;  3BR8 A;  1NK9 A;  2YX1 A;  4O3S A;  4W4M A;  1JLQ B;  1ZS6 A;  5LJ5 Y;  4P6Q A;  3TA2 A;  1NK5 A;  3ET6 A;  4RNF A;  2M0G B;  4JI3 J;  4TU7 A;  4I6A A;  3C6U B;  3Q8S B;  3IR6 B;  1VQM S;  5A8W A;  5M2P A;  1FA0 A;  4ZCM A;  2EWH A;  3A8I A;  2HGL A;  2HAF A;  3HFK A;  3W7B A;  4ZJO A;  3MEG B;  3MOJ B;  4YY3 F;  3NWR A;  5HJX A;  1O5J A;  1M5S A;  1CUL B;  3WHI A;  1RWU A;  5DQG A;  4DL3 A;  4LIR A;  3M8S A;  1SXL A;  1LW0 A;  1HWJ A;  1Y5I B;  1F2H A;  2JWN A;  2VV5 A;  1WD6 A;  4RNH A;  2CQ4 A;  3MMC B;  4DS5 A;  4MKB A;  2C2R A;  3SV3 A;  4PAA A;  4YUD A;  3QT5 A;  1K1S A;  3L95 X;  4DUT A;  2L41 A;  1HR0 F;  3I9V 9;  3T5H A;  4XPC A;  1KHV A;  4ZIW A;  5T7L B;  1IKV B;  2YBV A;  4M63 A;  2HQI A;  5KG1 A;  2DNO A;  1IR2 A;  2LU2 A;  3GIR A;  3BN7 A;  4CLU A;  2CA9 A;  2ILY A;  3ZTS A;  2IA0 A;  3MWB A;  3P45 B;  1HBU B;  4C97 A;  3K8V A;  4HTJ A;  5DJB A;  4NML A;  2ZIT A;  3N6L A;  1RT4 A;  5KFH A;  2DBB A;  5EWE A;  2HEK A;  1SV5 B;  5AXK A;  1MRO A;  3VTI A;  3M32 B;  2E5I A;  2QGF B;  2OEL A;  2CXE A;  4DPT A;  1CLF A;  3QIP B;  2WON A;  1C0U A;  2FC8 A;  3KLV A;  4ZP7 A;  3IWX A;  1TL7 B;  2QMW A;  2HNZ A;  2WOM B;  6FDR A;  2DKO B;  1HNI B;  2KT3 A;  1B0P A;  4QIE A;  4YFU A;  1S99 A;  5ETT A;  1N4L A;  2RRN A;  4KJI A;  4WK3 A;  3EZO A;  2Q43 A;  3PZP A;  1F5C A;  1C1B A;  3RTV A;  1CQM A;  3I96 A;  3GIL A;  2QLX A;  1UVI A;  2X3G A;  2MJN A;  4H4K C;  1Q8K A;  1ZYQ A;  1XR5 A;  4B9N A;  4NPO A;  4F26 A;  2J0X A;  1Y0H A;  3Q86 A;  1LW2 A;  4NLY A;  4MK9 A;  5F0U A;  3TUJ C;  2ZOG A;  3O5T B;  2P9G A;  4CO1 A;  4K5S A;  3I32 A;  2C3Y A;  1YRX A;  3I0R B;  3PJX A;  1QJH A;  1V5I B;  6AT1 B;  3Q8Q B;  1AXQ A;  2QG9 B;  3AJ1 A;  5KFG A;  1WI8 A;  2R7W A;  4OQJ A;  2XSJ B;  1VBY A;  2K06 A;  3HI9 A;  3F44 A;  4WWS A;  1FKP B;  4X4U A;  1YX2 A;  1RHR B;  4NL5 A;  4USK A;  3LOU A;  1VC5 A;  2VOD A;  4U96 A;  3M6W A;  1SJQ A;  1R8B A;  3M8Q B;  4X64 F;  5CYM A;  1DQ9 A;  2ACM A;  2KHD A;  1Z2Z A;  1FD8 A;  2BQR A;  4UUW A;  5A8R A;  2ATL A;  1NBE B;  3GMG A;  1YJT A;  1R6Y A;  4DL4 A;  4PZV A;  4ED5 A;  2NRE A;  3KG0 A;  2BAC A;  4DSF A;  2R2R A;  5F8L A;  2CFX A;  4B3M J;  3FQL A;  2MY8 A;  2BVZ A;  4J9L A;  2LVW A;  4I2P B;  1RA6 A;  5MAO A;  1I1G A;  1HI1 A;  5F8J A;  4I6W A;  5A8W B;  3BQ1 A;  3FJ2 A;  3OFE A;  3RBE A;  3JAM Y;  2CQI A;  2Z2Y B;  4USJ C;  2LQ9 A;  3MUV P;  3KLH A;  2DR8 A;  3HVA A;  4Z2X A;  4KRW A;  1J5O A;  2VKR A;  4H4K A;  1KFD A;  4ZLP A;  3FRY A;  4TY9 A;  1F60 B;  1X4C A;  3HHD A;  3OVB A;  1JJH A;  2ZZN A;  1LW0 B;  1NSA A;  5HMY A;  2CAD A;  2HNY A;  4BWM A;  4UTG A;  5KT4 A;  3QYY A;  4DI6 A;  4RU2 A;  1RT7 A;  3GSD A;  3K58 A;  4OZ3 A;  3MGJ A;  3C16 A;  4DUY F;  4ZPA A;  4JI7 J;  2YQ3 A;  3PKM A;  2ZHA A;  3MM5 B;  4IR9 A;  1QY7 A;  3B82 A;  2GFF A;  4OZ5 A;  4MMO A;  1Y9O A;  5HRO A;  4L75 A;  3V6J A;  5K5M A;  2D9P A;  5C2G A;  2JEG A;  3AB2 B;  5HAO A;  3VCD A;  4EYI B;  1ZOT A;  1U25 A;  1IR0 A;  2C2D A;  1RT4 B;  1EB0 A;  2OFG X;  3EXC X;  4ZVP B;  1FK9 A;  1K44 A;  4DN9 A;  1WF1 A;  1MRO B;  4C7Q A;  5LMU J;  1SJR A;  2GVZ B;  2YQ0 A;  4IRC A;  5DGA A;  1H0H B;  3MR5 A;  1I94 J;  1Y4Z B;  3TAR A;  2V69 A;  3NL0 A;  1YWX A;  1NPP A;  2FLO A;  3D6M B;  2G0J A;  4LRA A;  3NNH A;  3HHE A;  4GMK A;  2KRR A;  1T3O A;  1FDD A;  3FRZ A;  2ZH2 A;  3NEK A;  4Z7C A;  3UQS A;  3U02 A;  1XNR F;  3C19 A;  2UVV A;  2E29 A;  4LRF A;  2XGP A;  2ZH5 A;  1GFW B;  1GMW A;  4HAC A;  3KLG B;  9RUB A;  1GH8 A;  2C42 A;  3KG1 A;  4GKK J;  2WSE C;  3FCW A;  3M8Z A;  4OX6 A;  4DR4 J;  3RB6 A;  3CPW R;  3DXS X;  5A76 A;  1HLW A;  4CNY A;  2HHH J;  1S0N A;  2K1R A;  3QMQ A;  4AL5 A;  3AD9 C;  4QR2 A;  4J9U E;  2EC2 A;  4NCB A;  4I68 A;  4MYT A;  4JI7 F;  3R1H A;  2BJD A;  1D9D A;  5L8R C;  2F4F A;  2C2O B;  3OD2 A;  2B3T B;  3OPK A;  4OYZ A;  3A13 A;  4JI2 F;  2BBE A;  1UFK A;  1WHW A;  5CYM B;  3Q8R B;  1UA1 A;  2R2S A;  5E33 A;  3OV7 A;  1S5Z A;  5A8R B;  3OXG A;  4HEA 9;  3O6Q A;  3W64 A;  2V8P A;  2LP4 A;  1HA1 A;  1U6Z A;  5LMU F;  4AL6 A;  2PEH A;  2VDH A;  5J2M A;  2DTJ A;  4PYA A;  3MAA A;  2MZ1 A;  1U1O A;  3J80 U;  1WC5 A;  5KFD A;  4K2J A;  4DR3 J;  1GK8 A;  4DX8 H;  2XI2 A;  4Q0B A;  2DRA A;  1RHJ B;  4C4W A;  2BAB A;  2XLJ A;  3UDV A;  2OML A;  4IQX A;  1FEE A;  2XZT B;  4I1T A;  1OY9 A;  2UVU A;  4LR9 A;  3OTB A;  2CVE A;  1RAB B;  3KLH B;  2FLL A;  2M88 A;  3A3N B;  1A6L A;  2BKO A;  2JEI A;  1VQ6 S;  1Q8B A;  2XO6 A;  1IKW B;  2XBP A;  1TK8 A;  4IH5 A;  2I6W A;  1VIO A;  3VGT A;  5E3A A;  1PJ6 A;  2RRA A;  2QMU B;  3PW5 A;  4GKK F;  3OTC A;  2HNY B;  4LSZ B;  3T5J A;  2M2B A;  2H48 B;  4OLO A;  5E0O A;  3J7A N;  1TKT A;  5HN0 A;  3TQ1 A;  2MSS A;  4O4G A;  3EZ5 A;  2VIH A;  2POK A;  4DV4 F;  2EVZ A;  4C8O A;  2RJZ A;  4ERD A;  1LK5 A;  2B4U A;  1Q53 A;  3R7B B;  4CTA A;  1V5V A;  2YWE A;  1NJY A;  1JNR B;  1G2E A;  2E7V A;  2V6A A;  1GEH A;  5E2Q A;  3K57 A;  4C48 A;  1QSY A;  3GB0 A;  3PEJ A;  2QLW A;  3J81 U;  3TJ8 A;  2C1E B;  2V50 A;  4RBT A;  2WZ1 A;  4TNO A;  4CNZ A;  1VGY A;  3G96 A;  3IGN A;  3KHH A;  4JV5 J;  1FK9 B;  3KKF A;  4FF2 A;  4ED0 A;  1UPP A;  2XC9 A;  5GMK a;  4B3S J;  3D1O A;  3U1M A;  2DR9 A;  2AU0 A;  4Q44 A;  1YI2 S;  1N32 F;  2KYX A;  3CD7 A;  3QGH A;  1VRQ C;  2W9C A;  3CW2 C;  1BQX A;  4L3N A;  4P72 A;  2IBK A;  3QSI A;  2KJV A;  2F63 A;  2M5Y A;  2F1F A;  1TKX A;  4LFC J;  2NCK L;  5IC4 B;  2HQG A;  2HGM A;  2FB0 A;  1OQ6 A;  3FUY A;  3TZW A;  1VMB A;  1R8C A;  1YBT A;  2E66 A;  3CCT A;  3T5L A;  4B3T J;  1FJC A;  3D6H B;  3PYG A;  4I6Y A;  1WJ9 A;  2MJU A;  3C15 A;  1T7P A;  2VBZ A;  2AF6 A;  2PA8 D;  5DG9 A;  2K1R B;  1YJU A;  2CNO B;  4KC5 A;  4JYA F;  1UL3 A;  2D3Z A;  4ECW A;  4FN5 A;  2NYI A;  1FDB A;  2PFD A;  3LP2 A;  3QZ7 A;  3RBZ A;  2Q3P A;  2UU9 J;  1UVJ A;  4CO4 A;  3PYD A;  4WF9 Q;  2OH2 A;  3OW2 R;  5D0R A;  1VJQ A;  3PW4 A;  1N48 A;  1RB0 A;  2RDI A;  1FWL A;  4D3H A;  4OYA A;  3BH6 B;  4JV2 A;  1S6U A;  4H54 A;  2RDD A;  1JLF A;  1Y5N B;  5KG6 A;  1UKU A;  3ZC4 A;  4OZL A;  4OZJ A;  1K73 T;  1MN9 A;  1UZD A;  2HWI A;  2RE1 A;  2FGO A;  1NK4 A;  1RHM B;  2DCL A;  1RWN B;  3MAA B;  4DR7 J;  3BSN A;  2DPJ A;  3PM9 A;  3AQO A;  1OWX A;  4K2X A;  3KJN B;  2YKN A;  3NP5 A;  5IQ6 A;  4Q0B B;  4IDK A;  3D3B J;  3OTE A;  1WTB A;  2XMJ A;  4K4Y A;  5K8P A;  1WC4 A;  3R5B A;  4DL7 A;  1P8G A;  3AOC A;  1JWW A;  2NSC A;  4C3K A;  2W2Q P;  4B3T F;  1FWP A;  3FGV A;  3LAL A;  4USM A;  4NRT A;  2A2C A;  4Y34 A;  3HZG A;  2HRY A;  4WK1 A;  3VAJ A;  1LKZ A;  3GV8 B;  2QL5 B;  5KFQ A;  3F0N A;  2DH7 A;  4M94 A;  2ADB A;  2DNY A;  3JSY A;  3QBC A;  4J9O A;  4CTA B;  4K0K J;  5B08 A;  2ZNZ A;  2AYE A;  3UNY A;  2ZOM A;  2YH1 A;  2EW9 A;  2QC3 A;  3NAH A;  1GTE A;  3CCR S;  2N4C A;  2FVR A;  4QCL A;  3L7U A;  3NKY A;  4ZS6 A;  2MPU A;  2RIL A;  2XG8 A;  1Q8L A;  2XWX A;  2COL A;  1U02 A;  3VVT A;  3CME S;  3H7H B;  4PG4 A;  5C24 A;  2VL1 A;  3VZI A;  2MZR A;  3MAQ A;  3V6K A;  4HT7 A;  4MH8 A;  1B3T A;  3ZO7 A;  2M8D B;  5DO2 A;  1SL2 A;  4WTO B;  3NCR A;  2CPD A;  2E1M C;  2E1C A;  3Q24 A;  2UZA A;  2KZM A;  1H2T Z;  4A8W A;  5IT4 A;  3UE2 A;  4B3O A;  2W9C B;  3PV8 A;  2ASL A;  2JLE A;  3OL6 A;  3LPE A;  2ROE A;  4DV3 J;  2ASY A;  1U45 A;  3H25 A;  2RD5 C;  3JSB A;  2HGN A;  3FKB A;  1TKX B;  3SFG A;  4CO0 A;  2DXD A;  4DV2 F;  3DDI A;  1RT2 A;  4GO5 X;  2F8M A;  3AQP A;  3G4S S;  4OIX A;  2KG1 A;  4WP9 A;  2R42 A;  3JQJ A;  4PWU A;  4P9S A;  1YVF A;  1KVJ A;  2ZBQ A;  4NLR A;  4OJ1 A;  2XO7 A;  2Y1J A;  2BZ2 A;  1PBA A;  2BJE A;  3GYN A;  2XGQ A;  4JP8 A;  3C15 B;  4LF6 J;  4RX6 A;  2FYX A;  3TI0 A;  2HK3 A; 
#chains in the Genus database with same CATH homology
 4CYU A;  3HSJ A;  2CG8 A;  4M5L A;  1F9H A;  3HD2 A;  3ILJ A;  4M5N A;  4CRJ A;  5ETN A;  4M5J A;  1IM6 A;  3HD1 A;  3HSG A;  1KBR A;  1G4C A;  3MCM A;  4M5K A;  1Q0N A;  3KUG A;  3UD5 A;  3KUE A;  4M5G A;  4F7V A;  1HKA A;  3ILO A;  3KUH A;  5ETR A;  3HSZ A;  5ETV A;  5ETM A;  5ETL A;  4CWB A;  1RTZ A;  1TMJ A;  3MCO A;  3UDE A;  1TMM A;  1EQM A;  2QX0 A;  1EX8 A;  4M5M A;  4PZV A;  2F63 A;  3IP0 A;  1RU1 A;  3UDV A;  5ETS A;  3ILL A;  5ETT A;  5ETO A;  1RU2 A;  2BMB A;  2F65 A;  3HT0 A;  5ETP A;  5ETQ A;  4AD6 A;  4CYU B;  1EQ0 A;  4M5H A;  3ILI A;  3MCN A;  1RAO A;  3HCX A;  4M5I A;  1CBK A;  5ETK A;  3HSD A;  3QBC A;  1RB0 A;  1DY3 A;  1HQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...