2QLWA

Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
GDMTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTRPKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RhaU of Rhizobium leguminosarum is a rhamnose mutarotase.
pubmed doi rcsb
source organism Rhizobium leguminosarum bv. trifolii
molecule tags Isomerase
molecule keywords RhaU
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qlwA01
3GZ7A 2BJDA 2RSQA 5IXUA 2IFXA 1YJTA 2XMWA 1Y3KA 3HHLB 4NPOA 1VQSA 1N5VA 3DCAA 2GO8A 5B0GA 1X8DA 1TL4A 2N4DA 2BJEA 1ULRA 3HHLC 2W4CA 1RJJA 3E8OA 2QLXA 1TR0A 1OPZA 3FMBA 3HX9A 3WDOA 1IUJA 2HIQA 3KG1A 4HI1A 1Q4RA 2HFOA 3HFKA 1AFJA 1APSA 2HLTA 4U9RA 5F0UA 2GV1A 5F0WA 1S6UA 1GXTA 1SB6A 2EW9A 2KT2A 3BM7A 2JDJA 4OJ1A 2ASYA 1P8GA 3UDCA 3T9NA 2N7YA 3KG0A 2IYGA 2HLUA 3HHLA 1Q53A 2RILA 2AJ0A 2GFFA 1TZ0A 1YG0A 4QOTA 3MCSA 4HH1A 4Y2IA 4OJHA 1R6YA 2RU9A 5KAKA 4F67A 2W4PA 1JWWA 2XMJA 1YRXA 2K2PA 5B09A 2AP6A 4FNIA 3KKFA 3HF5A 1FE0A 1AW0A 3HDSA 4HI2A 4Y2KA 1FD8A 2OD4A 1Y3JA 2L3MA 1GXUA 1SI9A 5B0FA 2GGPA 1S6OA 1W2IA 2K1RB 4HH0A 2ZDOA 1OSDA 2KYZA 3KNGA 2ROEA 1SQEA 3TOQA 2N4CA 1QUPA 4OJ3A 1Q8LA 5B08A 2K7KA 2LQ9A 4OIXA 5T7LA 2LXFA 2OKQA 1MWZA 2QYCA 5B0BA 2BYCA 1KQKA 1FESA 4YDXA 3IWLA 4A46A 4A4JA 4DN9A 2OP5A 3TNVA 2G9OA 1X7VA 1X0PA 2GGPB 3FGVA 2OFGX 3LO3A 2K1RA 1Y0HA 2K7JA 4Y2MA 1CC7A 2W4DA 2RMLA 2AJ1A 2OD6A 4FNHA 2GA7A 1LQ9A 5B0CA 1FVSA 3TRGA 1V3ZA 3QMQA 4NL5A 3VTIA 3DXSX 2OFHX 2XMVA 5T7LB 3BF4A 1N5SA 3HHLD 3LGMA 4A47A 1OQ6A 1Q8BA 1CC8A 1MWYA 4DPOA 4EFAC 3BB5A 4HL9A 1VQYA 1XBWA 1U7LA 2XMUA 2ROGA 1AFIA 5B0EA 1JK9B 4DL0C 2PD1A 4YEAA 2Q3PA 1URRA 1YJRA 2FHMA 4OJGA 1Y9OA 1CPZA 3FRYA 3CJKA 4A48A 5A6PA 5B0DA 3F44A 2KKHA 4ZOSA 1P6TA 3BR8A 3QGPA 2IYIA 2CRLA 5K9FA 3K7RA 1YJUA 1TUVA 2FB0A 2HQIA 2LDIA 2OAUA 2OMOA 2VH7A 2PGCA 2ROPA 3BGUA 1KVJA 4Q2LA 3IWXA 2QIFA 2XMKA 3BDEA 2XMTA 3BN7A 1FVQA 2HFNA 2QLWA 1OQ3A 2BBEA 2GCFA 3MZIA 1FEEA 1WD6A 2BUNA 1YJVA 2ACYA 4Q2MA 2FIUA 3I9ZA 2VV5A 2KT3A 2ZDPA 2XMMA 2LQBA 1K0VA 5B0AA 1TL5A 1FE4A 2FTRA 1N5TA 3LGNA 4ZA1A 2AW0A 5A6WA 1N5QA 1KVIA 3CJKB
chains in the Genus database with same CATH superfamily
4C11B 4DV3F 4B3MF 4ED4A 2E1AA 4I6AA 2HHHJ 2DRBA 4DSIA 3DCAA 1FWLA 5D3GA 2PT0A 2HVIA 4QYRA 2JL9A 3ULHA 3D4JA 1V5IB 2W4CA 1IBLF 4Q0BA 1VRQC 3CJQA 2C3OA 2VZ9A 3VGTA 4K4YA 2F9JA 2GQQA 2J7UA 3DGPB 3IR7B 3KG1A 3R5CA 3THPA 3HJFA 4X4NA 2GV1A 2EG2A 1KOOA 1HQEA 1SC3B 1IKYA 1HLWA 4TXSA 3QWUA 3BM7A 4MYUA 4Y2CA 4KO0B 4EUVA 5E41A 2W9AA 2ZH8A 3THVA 3LPYA 3TUJC 4ZN1A 4QYZJ 4NLUA 4IR9A 1UFLA 1RYRA 1NBEB 4I56A 1NJWA 4LIRA 5E2QA 3HHLA 1T05A 3DLGA 2E5LF 1YG0A 4H4OB 3LOUA 2I38A 1MU2B 2C2NA 1FFGB 5IV3A 2L41A 1ZETA 3M2VA 3MTJA 2SXLA 3US5A 3VHQA 4EO6A 3Q8VA 2P6SA 2EXUA 5J1PA 3B4MA 2U2FA 3QNWB 4DSFA 4ZVUB 1RU2A 1IBKJ 1D9FA 4F8RA 3CB4A 4WZQA 2MJNA 3PCOB 3RRKA 5HP1B 3KHGA 4LF6F 1UPPA 4JI4F 4MFBB 5EN1A 2ALYB 3P5TL 2Q1LA 4OZNA 1OSCA 1FJGJ 1NUEA 1DZ5A 5KFZA 1KLMA 2GNKA 4I7FB 4E8UA 2M9KA 2AQ4A 4BS2A 4X4QA 1BUXA 1VLOA 2CQ4A 2PN6A 2WCXA 4YQWA 4FKXA 3W9JA 3ZNUA 1U1MA 2KHDA 3C6UB 2KXNB 1RWXB 1AUSL 2KH9A 3FGVA 1MSWD 1ZM3A 3M9NB 4Y2MA 3BO4A 4B9TA 5RUBA 3ENQA 4NLSA 4G1PA 1XQIA 5LMUF 4N41A 1R0AA 1IQTA 2GVDB 2HFUA 1WTFA 4C3KA 4F4YA 3V4MA 1F5BA 3IGVA 2K06A 2UUAF 3OVBA 4C6AA 3V6HA 3KLGA 4QPTA 4NASA 3EXCX 2CPFA 1JLGA 4DR1J 1AB8A 2C1EB 1XMOJ 1IJFB 2DHGA 1WWHA 4ILMA 3O5TB 4O4RA 2J5AA 4DSLA 4OI0A 2CPZA 2ZVSA 1WELA 2EPIA 1BGXT 5KG7A 1UKUA 2QN6B 3TYTA 2F5GA 3CGIA 4DI6A 3CDBA 5A6PA 4NYOA 1PYTA 1WEYA 4NA1A 5B0DA 4TQSA 3PYFA 3GG1A 1KQGB 3NAIA 1IM6A 2WOMA 5LL6d 3BR8A 3M8SA 2VQEJ 5D15A 5H9FJ 3IRXB 4DX7A 4DX6A 4G65A 2YPYA 1H2VZ 4DN0A 4DL7A 1NNDA 2AU0A 4Y34A 1FNXH 2BVZA 5DM7Q 4QCLA 1S1UA 5J2MA 3GB0A 3R3TA 1FK9A 2FPHX 4NOHA 3Q8YA 2QA4S 2A2CA 1V5VA 4DX5A 3JTOA 2J6UA 1T7PA 2VIHA 2R7TA 2HBZB 2VBZA 1YDLA 5ETVA 3D2WA 1WHYA 4HHUA 3TZWA 3EMTA 1WDTA 1NDPA 1JJCB 1FE4A 1SUQA 3LGNA 5KFXA 4F0KA 1KSPA 5A2QU 2R8GA 2FJVA 2CJAA 3IP0A 3ET6B 3D66A 5A0YA 1L3TA 1G6BA 2CQBA 2WONA 4UOHA 1UEKA 1VHFA 3KK3B 5HSPA 5B0GA 2QA4G 1X4CA 3B6BA 1CJUB 3KMQA 2Q6CA 3TUPA 5BYRA 4DQIA 2I8EA 4RW9A 4DR2J 3HMJG 2GS8A 2QYGA 5DLFA 3IS9A 2XSJA 1TAUA 1HMVB 1TFWA 3IWNC 3JQMA 4I2QA 2OEMA 4C0OC 1TR0A 2A3JA 4L3KA 4R0EA 4F2RA 1UVLA 3CCLS 1N33J 4LFAJ 1PYSB 1Q4RA 2EFNA 3HFKA 4ZIWA 1VK8A 3R97A 1RTIB 4X84A 2D3OR 2LXIA 5D4LA 1RCXB 1RT7B 1S1TA 2VG5B 1XN9A 4L74A 4TQRA 5D0GA 3I31A 1UA0A 1VR6A 2HMIA 4ID5A 4LFBF 3RW6A 1YJ9S 2B7BB 1YK9A 4GO5X 2YX1A 3EM1A 2V6AA 3P5BP 1S97A 5IS2A 3T1HF 1HIYA 2RQMA 2AJQA 4Y2IA 2MQQA 4KT0C 2ZH2A 3VGSA 2YNIB 5HQMA 2D69A 4ANEA 4QU7A 2BE2A 2IRXA 4USWA 5F8JA 3KXDA 4PRFA 3RAXA 1AW0A 1I51B 1GEHA 1G7CB 1RKIA 3LW5C 3ZC4A 3Q8RB 4USUA 3H5XA 4UOCA 5IT9U 1Y3JA 4ZP7A 1TL7A 2B4OA 1SI9A 2V8GA 3ZZPA 5F3ZA 3KLFA 1U1KA 4CLKA 4N76A 3M32B 3SSQA 2ZHBA 3ENVA 2VFSA 2MZ1A 1SL1A 3QQCD 4DCOB 1KHWA 2CZVC 2AWZA 2ROEA 4ZVEA 2IM2A 2V5HG 4QIFA 1E6YA 3AODA 1RT1A 1RAHB 4ZVFA 2B4UA 2H51B 2H48B 3MAAB 2R8IA 4ZMMA 4M95A 5J1EB 1T9XA 4AXJA 4DSEA 4X4TA 1VHIA 2RDJA 2RDIA 1M5OC 2P9EA 4DL5A 1FESA 2CQDA 3PM9A 3GCWP 4CT9A 4F26A 4RKUC 2F8HA 1FEHA 1LW0B 1QUVA 1IKXA 1VJWA 3W7BA 3I5CA 2DNOA 2WONB 2YPZA 3OFHA 1PO6A 3IG1A 3P49B 2E7WA 4FNHA 2KRRA 3M8QB 3PTWA 1EHWA 2GA7A 5F8HA 1U1OA 3M8YA 2YWEA 3TRGA 5CD4A 1R8BA 2F9DA 1R8HA 1BD6A 6AT1B 2XSJB 4L72B 2ZH1A 3DLLQ 3ZO7A 5CAAA 2GVDA 2QJ3A 2W9CA 2DVIA 1E6VA 4X66F 2AGPA 3IR5B 4A47A 4ZJOA 1VQOS 1K8AT 3DOMA 1VOMA 4A8KA 4DPOA 3MURP 2FZKB 3OLAA 3OPKA 1KTQA 2QL5B 2XMUA 1Z2LA 3CEDA 3WZ0A 5KFDA 3QRPA 1AUDA 4OV1A 3CJTA 1HPZA 1XJWB 5M2UA 5F9LA 4DLGA 3FBBA 4EBEA 2HMIB 4JI1F 2RKIA 1R3NA 2WSCC 2ZUGA 2V68A 1S1VB 3WBZA 3T1HJ 1TKXA 3I5BA 5LM7E 2OAUA 5MLCV 3OL9A 1TMJA 3IR6B 3MR7A 1GX6A 3CCES 4Y0FA 2UP1A 3KK1B 1AA1B 2VJVA 2BEFA 4FYYB 2GCFA 4USMA 2CZ4A 3ISND 3W63A 2ADCA 2GIQA 5J2MB 7AT1B 4Q8FA 2JX2A 3H5SA 3V81A 3JYTB 1QSLA 1QVFR 2VQFJ 1WOSA 2VG7A 3OL8A 4O3OA 2O5DA 2NZ4A 1TL5A 3TX8A 1N5TA 1HNZF 3ZZOA 1U26A 3H4DA 2CXEA 4J9VA 3U27A 3PX4A 3CJKB 2HVHA 4DPUA 1SUQB 4NI2B 1TFYA 3EUNA 2DGUA 2MDAA 4FKYA 1YJTA 2WBMA 4WXWA 5D0RA 3SZ2A 2VA2A 1HD0A 2QA1A 1J5EF 3C3LA 4DR7J 3OUYA 2OEKA 4ZPBA 1WHWA 5K8MA 1LXJA 2C2MB 2IVYA 2WVCA 4RNNA 2J0QD 4JI7F 2HQDA 1VFJA 3HX9A 1XMOF 4NLPA 4Z7YA 4PG7A 2ZZMA 4NE9C 5M2RA 1AFJA 5J2QA 2HEKA 3HSJA 5A8WB 4JI2J 4GKKF 1GMWD 3W60A 2NPFA 1GXTA 2WW8A 4KYZA 2YBVA 1RT3A 4RR5A 3G82B 4L6V3 2KU7A 4YB5A 1BHNA 1WKLA 2ASYA 4CP5A 4ZCMA 4ECVA 1KD1T 4NCBA 2ILZA 4M5GA 2VBXA 5GAEI 3A3NB 1YITS 4IO9Q 4FF1A 3FSYA 2XO7A 4DQSA 3C16A 3Q2SC 2F4FA 1TZ0A 3DOMB 4KPCA 2OPQB 4HH1A 1M90T 3PEJA 4B02A 2VC0A 1GQEA 5DQHA 4DFKA 3E2EA 2IA6A 3EICA 1RAGB 2KFZA 1SKWA 4OZ2A 5ETPA 5KFBA 2FLOA 2NS1B 4LF4F 2HRYA 3I6PA 1S4FA 2RKIB 2HWIA 2FJBB 5L1KA 2F8EX 4TU7A 2FVSA 5FLXU 5EWEA 4G3IA 2G1HA 4CO0A 4RW8B 2DXEA 4R5PB 2AZ1A 3V6KA 5DGAA 3HFVA 5THWA 1URNA 2V67A 1HQ2A 3VQSA 2VKRA 3AHPA 1N52B 5GAGU 4J9SA 4AT1B 2OPSA 2KFNA 1SPBP 4KGXB 3C15B 4PWDB 3DLEB 3N01A 3V81B 3BYRA 1MWZA 3MAAA 3CD5A 4A46A 1Y4ZB 4EBCA 1JQGA 2MQPA 1NJIT 2IHR1 3TNVA 1XMBA 4JI7J 1FRIA 1RWVB 1DJ0A 1X0PA 4ED0A 1FFSB 3GFXA 3LO3A 4UY85 3MOZA 1RHKB 2R4FA 1T9VA 3AAWB 3CNQP 4J9PA 4C8KA 1QE1B 5F3TA 2QX0A 2ZZTA 3TUZC 1J5EJ 4B9SA 2CPYA 3PACA 4I6YA 2XHWA 3GG0A 3I55S 2RQCA 3G71S 2CG4A 2D3UA 5BR8F 1FJ7A 2EVZA 2JVRA 2W8KA 4ZVSB 2JZ5A 3THTA 2AEMA 3MM6A 2LDYA 2WVBA 3FDSA 4KFBB 1NK8A 1K73T 2XO6A 4DL3A 2GHPA 1NM2A 3VF0B 5A8WA 1MLAA 1NHUA 3MMCB 2ZE2B 4U7UD 3J80Y 9RUBA 4KH0B 4YEAA 2DGWA 3G8TA 2VD3A 2ZVIA 3M2RA 2FHMA 2KRBA 1ZOTA 1HR0J 2VPZB 4UOFA 4HEA9 3TQEA 3UW1A 3CCUS 4CNZA 1XR6A 3HHDA 2HKEA 2YKMA 4BBYA 1S6QA 4DR4J 1YZ7A 2AX1A 3J7ZT 3GFHA 3JQKA 1QDUB 3D1OA 3BSNA 2HZAA 4DV2F 2NR0A 3QRRA 4P71A 5DDQC 2GMLA 3EX7B 1RTHB 4O4GA 1SH3A 3SBMA 1I94J 1ZZNA 1PJ5A 2Q6BA 1S49A 3KUGA 5J2NA 3K2YA 5HO4A 1ZM4A 1PJ6A 3I9ZA 4DJBA 3DRXA 3E3XA 3G8SA 4K4WA 3RBEA 4GKJJ 3AA8A 3V5RA 2AMCB 1Q82T 3OV7A 4KKOB 3U1LA 4DR2F 4O3SA 3CO0P 2X1FA 1D8ZA 3N0VA 4USVA 3PIPQ 3GR0A 3OR2A 1PIEA 2RIJA 1NDLA 5IXUA 4EZ6A 2V2QA 1UFKA 1X5TA 2H5JB 4LJMA 3ZZUA 5DDPC 3OW2R 4V19J 4HLBA 4I0WA 3M9MB 1SKRA 5GAGI 1VRUA 2GW8A 4M63A 5L1IA 2IMOA 2F4VF 1UJ5A 3M6UA 3OL6A 1FA0A 1FRJA 4DPXA 2IM0A 1EETA 1HNWF 3NKYA 1EP4A 3IFEA 3N79A 4IKAA 3ETOA 1ZM2A 2B0GA 1TU0B 3I0RA 1REVA 4BWMA 5I42B 2MQOA 2H4WB 4V19X 1APSA 4M5HA 1WHXA 2B9XA 4LFAF 1LK7A 1KR4A 4ZP6A 4JI8F 2ZH6A 4B9UA 2ZD1A 1MN7A 3D0IE 3HVRA 1N0VC 3BGRA 4DQPA 1WI8A 4USKA 3SEOA 4N77A 5LSOA 1HNXF 4BLGA 3HI9A 4DS4A 4FBUA 2G0JA 3BSAA 4KJIA 1TV6A 3GIIA 3I0SB 1FDDA 2V8VA 5B09A 4L75A 3QO9A 4J9RA 3PR4A 2FJWA 2IY5B 3VGUA 3M2RB 3D6HB 3NGUA 4OX9F 6FD1A 5HQ8A 1F2HA 3CMAS 5I3UA 4RUHA 1XERA 1HWKA 2FJDB 4GKKJ 3W5ZA 4Y65A 4C3MA 3VV2B 1OSDA 3VTIA 2WHOA 2LXUA 1RHMB 4C9DA 3IBFB 3B8HA 4ZHRA 2AEFA 3L7OA 1WC1A 4LRFA 3BYPA 4MAKA 3ITHB 2LXFA 2BQ3A 4FPRA 2QYCA 2ZWOA 3HVTB 1TUWA 2BYCA 3R7NB 4P74A 1CJVA 3M8RA 2HBQB 3CCWA 1NO8A 2BANA 3GIMA 4URQU 3DLEA 3ONQA 3KLIB 2KI2A 3UE2A 2MGZB 1WSVA 1FKPA 2ZBIA 3GP9A 2XLJA 2PA3A 4ZCLA 1TK0A 4UY8T 5KOWA 5HLFA 2K1RA 3JTPA 1L5UA 2DNPA 2UUTA 1O0PA 4QWCA 2VDHA 2OELA 4HT5A 3TANA 1SH2A 1S48A 2OD6A 2OSQA 1B4SA 1DY3A 3BV8A 3FK4A 3HULA 3MECA 2M7SA 1BE4A 4KHRA 4NA3A 3BGOP 3NCPA 5K8OA 1NJXA 1VI7A 1HNXJ 2CZ9A 1U2FA 2AIRB 2DIVA 3PYDA 2ZBRA 3B78A 4AXIA 5EWGA 4WCEQ 2W2PP 2DNMA 1W7WA 1H2UX 1X4GA 2CQCA 1OQ6A 2DO4A 1EETB 2G1DA 2YWHA 3CJRA 3KDNA 3NGRA 1FTCA 2PI4A 5KFEA 1ZH5A 4IH7A 1U8WA 4F4XA 2WTFA 4OZLA 3CD6S 4MK8A 5B0EA 4H4MA 3K8WA 3KJNB 2R9LA 4FS1A 3HSZA 3KDOA 4NZ6A 2OTLS 2QZ8A 3PW0A 1VLYA 2OPPB 3DI6A 4ZKAA 4X64F 3AH6A 3BGRB 2F7VA 2B8QA 5JXSA 2CQGA 3FQLA 5GADI 4YR3A 1TKDA 1RT4B 2HVZA 2E5LJ 1X4BA 3G6ES 1X31C 2J9DE 4DFJA 3EDRB 4H4OA 3JAMU 1GMWA 4U7CA 4DUYJ 1B7YB 5HQLA 4X4PA 3PZPA 4JV2A 1XNQJ 4EZ9A 1ZA1B 2GZOA 3O1LA 1FVQA 1Q8KA 4WE1B 3PYEA 5KG3A 3KHLA 2QLWA 5HANA 3MMAB 3L4BC 1XTZA 3FBEA 2ACYA 2XI3A 1F9HA 4Q2MA 3J81U 1T8EA 1C1BA 5KFWA 4QWEA 1TKZA 2MJUA 4K59A 2J7WA 1A0OB 1NB2A 2GX8A 2JSXA 2DHSA 5CXTA 3NXZA 3IRWP 4DF8A 1DFDA 1X4AA 1EKRA 4F4KA 2M8DB 2XS2A 1EZZB 4EMDA 3RB0A 2ASDA 3OTOJ 3S7RA 2N3LA 3GYNA 1KLMB 4DCJB 2DHAA 1KDNA 2GO8A 2Z56B 4TY8B 3C2PA 1Z4UA 3GFYA 3VAJA 2WVEA 3AD8C 3HZGA 2QLXA 3LP1B 1RTZA 3EDQB 5C25A 3UNGC 3U7JA 1ACMB 4DG1B 1M5PC 2DY1A 4ZITA 1HQUB 1XR7A 2YKNB 3NWRA 2AYBA 1CG2A 4EWTA 1RTDA 2BM1A 2EW9A 1EP4B 2WAQD 1JLQA 1N0UA 1Q7LB 4TNOA 5E3QA 3GONA 5HP1A 3KG0A 4HHJA 4KO0A 3HVWA 3R9LA 1GX5A 2V34A 5EGYA 2R2UA 2OH2A 2HBRB 4NZ7A 3GPAA 1SQFA 7FD1A 5KG2A 1N34F 3DHWC 4DWIA 1RQ0A 4WYWA 3NWGA 1V9OA 2FHJD 2R2RA 3HF5A 4OYWA 1VC0A 1IBLJ 2WW4A 2V8PA 3BBBA 3MPDA 4U7UK 2OD4A 4JBCA 5M2PA 1RTIA 4YMEA 4MKYA 1IN0A 2G0CA 1JNRB 2MTLA 4PWWA 5CA5A 5AXMA 3CT9A 1N34J 4O0NA 3TVKA 1NK4A 4HH0A 2YH0A 1WKKA 4PAAA 1H6KX 2KYZA 2PA8D 2QO3A 4O3NA 1F5CA 3HHEA 1RHUB 2QMWA 2RD5C 3ZZ0A 2IDLA 4DUZJ 3AT1B 2HHQA 3NMAA 3J80U 1RBLA 1TELA 2RQKA 3L7UA 4P2MA 4USTA 5ETTA 4K5SA 2D1CA 5DGBA 3HT0A 2MZSA 1HARA 1ROFA 2BE2B 1Z1ZA 4PABA 3TARA 2OSRA 1RT6A 4GVBB 4F0HA 4NLYA 3LGHA 4HVZA 3OLBA 1I94F 4B9MA 2DJWA 4CLSA 1HHQA 3L09A 2GGPB 1TKTA 2B56A 1BMQB 2LKZA 1TP7A 2DNLA 3A8JA 2ABYA 3BSCA 3C8YA 1PAEX 4P10A 5F8GA 3CVKA 4DLEA 2IC3B 2DGQA 3R7BB 4OYAA 2VODA 4PKDB 4EBDA 3LWMA 1SC6A 1UMJA 2CPHA 4Y2AA 4EGLA 3B54A 3WX8A 2DR7A 1AZSB 2YNFA 3OT9A 1RT1B 3POTA 3RZAA 2ZOGA 4TY9A 1DTTB 2HS0A 1V3SA 2BKOA 3C19A 2Z2MA 1JKHA 5T7LB 3LP1A 3LGMA 3PJXA 5KT5A 3MCMA 8RUCA 4JI1J 4USIA 1OY9A 5C25B 5DQIA 3Q2TC 4OZ0A 4UUXA 4LF8F 4ERDA 1UCNA 1UVKA 3T1AA 1QTNB 2ROGA 1S0MA 4K4ZA 2ZZNA 1LW0A 4J9LA 1JLGB 4RW7B 2YX7A 4QZVB 4KHPF 2GO9A 1X5SA 4CYUA 4DV4F 1JXVA 2J0XA 1Y9OA 4OJGA 4IQXA 2C2RA 3KJFB 5IQQA 2MLYA 2VFTA 5HVFA 2BV3A 2W2QP 2DGTA 1KONA 2OPPA 4NWBA 2IYIA 3TA2A 3HT3A 4DV2J 2UU9J 2HQIA 3FRZA 2VF3A 1KVJA 3TX0A 2R7SA 1AYEA 1UPMB 2IA0A 3BSOA 1D3WA 1E6VB 1P9QC 1S79A 4WP3A 4IFYB 4PXEA 1SJQA 4WF9Q 2OHDA 2KZMA 1R8CA 4OYMA 3VVUA 3G86A 2V94A 2DXDA 4F7VA 3HK2A 3M7VA 2NXEA 1KWMA 1VQ9S 2QA2A 2XMMA 1TL1A 2JOQA 1WF2A 1CULA 4NXNJ 5A6WA 4JI5J 2CJQA 4ZA1A 5ETMA 4ZVQB 4B3SJ 2PFFB 2KM8B 1TKZB 2O3DA 4LREA 4KBIA 2AGOA 2DPIA 1X4HA 1PSDA 1NJYA 3PO4A 2KDOA 3MMBA 1PILA 2BZ2A 4NPOA 5KFSA 2E66A 5J1EA 4YR0A 2OLWA 2DB1A 3Q8SB 1X8DA 1VQ5S 3JTNA 4NLRA 1NKEA 4ELVA 1PC5A 2CIMA 4NCGA 1U6BA 4GVBA 4PQUB 3N6NA 1HNVB 2HZCA 5F41A 1RLDA 3D6FB 3OXLA 4ZJQA 5HMXA 3PRDA 2LYVA 4C0BA 4O23A 1PC4A 1SB6A 1N32J 3OSNA 1WORA 3CDAA 1RLCL 2BJ3A 2KJWA 3VAHA 5KFFA 4ZLJA 4IR1A 1TUGB 4YS2A 2NXUA 4M5NA 3LH2S 1RWMB 4P75A 1RT7A 1S1TB 2VG5A 2ZHOA 1JLQB 3EWGA 3V2UC 2UVVA 4ILLA 3ZTSA 5ITHA 2VICA 1NLKL 1H73A 4ID5B 3TJ8A 3R1HA 1SIZA 3CDEA 4LF6J 3GFZA 3HZEA 1J27A 2B43A 5KT3A 2W4PA 3PKYA 3FCHA 1D09B 1RP5A 5BXIA 2PEBA 1NPRA 1L3UA 3DLHA 4DR3F 4KRWA 5ETRA 5ADZA 2JEFA 4J9KA 1N32F 4CYUB 4DOZA 5EX3A 4M94A 1U4BA 3EZ5A 1RHRB 2RF2B 4M5KA 5AXKA 2MB0B 1NU4A 4OLPA 3VZHA 4CQ1A 2MMYA 1S1VA 1IKWA 2M4MA 2NREA 1U0HA 2B4VA 1FWPA 1KVKA 2L48A 2R7OA 2XLKA 1PAUB 3NBPA 4ECZA 5CCMA 2L9WA 3MEEA 4KGKA 2CNKB 1OWXA 4Y00A 1ZYQA 2NSBA 3G6VA 4CO2A 2LQ9A 3DOLB 4OIXA 5CH7B 5H9EK 2JEGA 4I1TA 1B7FA 3DKDA 5C24B 4BHQA 2NPIA 2YQ0A 1D9AA 4QIGA 5IC4B 1WACA 1KKHA 3PRVA 4JI5F 1NRKA 3R2CJ 2DYAA 1Q7YT 1M0SA 2V9KA 3CW2C 3SSRA 3ZFVA 4F4AA 1HNWJ 4K2JA 3LAKA 1FTRA 1KNZA 2CJ9A 4NRTA 1FDBA 2QSFA 3RGIA 3W62A 1RYSA 2KHCA 4MIWA 5KG0A 3QJLA 1RTJB 3LANA 4DSJA 3H5UA 4HR2A 2G2ZA 3FC9A 3OUYB 1CQNA 4PUOB 1YRTA 3AD7C 4LF1A 4LBIA 2P2CB 4MMOA 3AOCA 5CZXA 1RK8A 1RAEB 2XMVA 3JQJA 4I7FA 3TEHB 2I1RA 4U95A 2KB2A 2VFVA 3PJ9A 4OHZA 4RNOA 4DDFA 2HQ3A 1TMMA 3D7SB 2R7VA 3CUNA 4MJKA 3BB5A 1XBWA 2J9EA 2QL9B 1UZDA 1SL0A 2HHPA 4WTOB 2MHNA 2UUCF 1S9EA 2CQ3A 1YVFA 4L73A 2Q3PA 3G82A 5E3PA 4DR3J 1N33F 2L08A 3A3OB 4DU7A 1N54B 2M88A 3UDLA 1FDNA 1UWBB 2XQCA 1XWLA 3G87A 1T9WA 3QGPA 4WFXA 3BREA 2POKA 2QTWA 1N88A 2BJ9A 2V69A 4XIUA 4QJVA 1X9MA 2OO4A 1NEEA 2RE1A 4B3OB 2E29A 3OQ2A 4BWJA 4NLQA 4OZ5A 4DZ6A 2VASA 3R5GA 3Q23A 2CPXA 3H42A 1FX2A 1WC6A 4IG0A 4PCQA 4NEYA 5F8LA 2YNHB 2VV5A 3CMQA 3H7HB 5GAEU 3CCQS 4LFCF 5HK4A 5LJ5Y 4FDFA 5KFTA 2FTRA 1KVIA 2AW0A 5KFAA 1D0EA 4ZPTR 2JLEA 2UXDF 3MEEB 2WOMB 4FYVB 5DG8A 5A76A 2AGQA 1CULB 4DSKA 4RNFA 4U67Q 5LJ3Y 1HW8A 1KOHA 1Y3KA 3AQPA 4NXMJ 3MPYA 1Q78A 2UUWA 4WPAA 2JLFA 1IKVB 1G4CA 4XPCA 4LRAA 1VIXA 4RW4A 3K17A 2P5VA 2CQ2A 2R8KA 4DR6J 4N5SA 4M1KA 2E9TA 3C66A 4LRBA 2D9OA 1MW7A 2R7QA 3FEYB 1PJ7A 3W2WB 1FKAF 3OTBA 4DFMA 2KXHA 3DXBA 1J5OA 2YNGB 2HNYB 2HURA 2CJBA 2RQ4A 4DPYA 3A4TA 1OS5A 4C0HA 2NUHA 3CIMA 3UDEA 1KBRA 5KTQA 1S72S 3U02A 1NH8A 3A8EA 1SKSA 1FJEB 1RZMA 5EX0A 3VGVA 3PR5B 1HR0F 1NDKA 3UVJB 4KFBA 1Q53A 5JMNA 1P27B 2MKJA 2IVMA 4QOTA 2LMIA 2H65B 3I4HX 4OJHA 1J2VA 2HFVA 4DPTA 1U1QA 4B9NA 4J9MA 3NG8A 5C5JA 4IH5A 2PIIA 5FIIA 1VC6A 4K4XA 1N36F 1XEZA 1G3OA 3DRRB 1S76D 1F60B 1BWEA 4F4ZA 1Q5VA 1UWBA 2EFGA 1FI4A 3I32A 1TL3A 4F25A 4TU9A 4M5DB 2ZOMA 5DG7A 1X4DA 1JLEB 4LIWA 2BJ1A 3J7AN 4YP3A 2W7OA 1B0VA 1IM4A 3TOQA 1U48A 4KAIA 2FY1A 4C8YA 1H38A 2CQ1A 2YWWA 4B3OA 4HDGA 3MMJA 1R7IA 4DV5J 3MEGA 4DR5F 1S10A 1HKAA 2DGSA 3ISNC 2DNHA 2MZRA 1N5YA 3UFCX 2ZH4A 1UWAA 2B5JA 2BMBA 2GQCA 3JSYA 5LT5A 2F40A 3GCXP 1HHTP 4P9SA 1TL7B 4JP8A 2R3VA 3PHTA 4UZCA 1S1WB 3A8IA 3AB2B 4ZPAA 3FSIA 1EJ7L 3SQGB 2UUCJ 1JIHA 5I3UB 2ZOFA 5F8IA 1LWEB 3TAMB 5KT2A 3IBWA 3TZYA 4ES3A 2DGXA 1VC5A 3CMES 2I5JA 5A8KA 3N6LA 1HNIB 4UF4A 1FO1A 3W66A 4DEZA 1QE1A 1S1XB 1S9GB 2RS8A 1WJ9A 3DC2A 3I5AA 4P6QA 3WHIA 3QZ8A 2NZCA 2ALZA 2ZBPA 3EZOA 3QPIA 1YHQS 1LOUA 2RB7A 4J9QA 1CC8A 3BDPA 2ERRA 3MEKA 3TVZA 2B9YA 3EVOA 1JNZB 1VQYA 3I87A 2W7PA 1AFIA 4GC7A 1JK9B 2MKHA 4PEOA 2ATLA 3BBCA 5HMYA 1T03A 4NYPA 4F2SA 1OIAA 3TZZA 4QR2A 1PCAA 3MMCA 3OR1B 4WWSA 4WFBQ 1S9EB 2UXCJ 4CLYA 4JYAF 1SJRA 5L1LA 4ELUA 1T94A 3LP2B 5HATA 3MUVP 4NLGA 1YKWA 4CLPA 4R0JA 4TKTA 2XWYA 2W9CB 3UR0A 1N8RT 2B6AA 3DDNA 1N6QA 2IMWP 5KG6A 1HWUA 1U24A 1K0TA 3Q83A 1KC8T 2XZDB 1H7WA 4X4VA 3ADAC 1RTHA 4CLTA 1TL3B 1VQLS 1K44A 4F02A 1KFDA 4RUBA 3NOGA 3RB3A 2Y9HA 3BKFA 2H1YA 2YNHA 2H4YB 1JLAB 1WG1A 3DGVA 3ZTOA 4DUYF 3RW7A 1RT4A 3DDKA 1U0SA 2CVIA 5G4DA 1K47A 2LQ8A 2E1MC 3DRSB 3I96A 3IRXA 4ZPCA 3KK1A 4YY3J 2N7CA 5C2GA 3OR2B 4KE5A 2QE5A 1FK9B 1BC6A 4NEZA 3ZTQA 2B4PA 3CJSA 1ZA2B 3M2UA 5A8RB 4YFUA 2CFXA 2JVOA 1UP1A 2NCKL 4CTAA 3A13A 4RZRA 3QGIA 2MKCA 2W01A 5ETOA 4KV8A 4YB6A 3HJVA 3ICLA 3MTKA 4FXWA 3L95X 1HNIA 1HBNA 2QGFB 4JV5J 4CCHA 3MM8A 2HNZA 3NP5A 4NYZA 3RJMB 2J6TA 3SCKE 1Q8IA 4XDCA 4A8QA 2YY3A 5G0RB 2V4QA 2B3TB 2BOPA 4OI4A 1B70B 5KG4A 5FLXY 2M0GB 2K2PA 2R7XA 1LKZA 4I2QB 4H4MB 4KHPJ 2E7VA 4M5IA 4CT8A 3OXGA 2FD2A 4FNIA 3R2DJ 2X7IA 3O6QA 4WP8A 4Y2KA 2AT1B 3GJSB 3CD7A 3BKUA 3LUYA 3AA9A 2QEXS 4LF5J 2F3JA 2M3DA 4ECQA 3K58A 1FRXA 2FGCA 2LFVA 5E0OA 4B3TJ 4LSNA 4ZLLA 1VK3A 1RE1B 4BDPA 2B6AB 4CO5A 1SQEA 1RWUA 4W90B 5L38A 2HHUA 1CLFA 3QIDA 5KFPA 1UVIA 5B08A 1Q8LA 1HW9A 3DU5A 2H54B 1F5AA 4IOAQ 4TLRA 5BJRA 2CJKA 1RU1A 2IAJB 3K5LA 4KC5A 4ED3A 2CPIA 4ZHRB 4NMXA 2CDQA 2D74B 3MI7X 2CPDA 3ITHA 6FDRA 5HJXA 3M1VA 3FNNA 4FPIA 2KFYA 1X7VA 3CJ2A 1YJNS 1F9EB 1U8SA 2VFUA 4ES2A 2B5JB 3KFWX 2XZWA 2XULA 1VJQA 1Y0HA 3M30B 1H98A 4P7TA 3M32A 3DMJB 3PFOA 3UO0A 4NLDA 1F2GA 4H4KA 1HYSB 3EZUA 2BRKA 2C2ZB 1B0PA 2DR6A 2V63A 4P73A 5HLFB 1VQKS 1S6PA 1JLFB 4RW6B 5CHCB 3OFFA 3QZ7A 4DL4A 4MYTA 2XEXA 3PJWA 3EJMA 2CPJA 1N5SA 3QBCA 1YTYA 4TYBA 1S1XA 4E98A 3M2UB 5A8RA 2QFIA 2Y1JA 5DDRC 1HQUA 2ZNZA 1KQFB 1DARA 1Y7PA 1Y5IB 2PC6A 1OO0B 5KFLA 1FWKA 2G4BA 1RWKB 3VAIA 2LA4A 4D3GA 1HBNB 2MQ8A 3UI3A 3FRYA 3D6MB 3FQKA 3J7A1 2WB1D 1DURA 3TR5A 2IC3A 1O51A 2EFOA 2KG1A 4PYDA 3NS7B 5C42B 1D8YA 1RT2A 2W8LA 1NK9A 3FZBA 1ZAVA 2ZKTA 3OD2A 3L3CA 1C1CA 1JB0C 3IWXA 1RKJA 4KSEB 3DLBA 4GKJF 1M5HA 1JKHB 3OBIA 3QT5A 2M5YA 4CH1A 4OI1A 2AYEA 3C14B 2BE9B 4CLUA 3IAM9 4Q0BB 2DPJA 3LQVA 3PDNA 1FDAA 1U47A 1VYAA 1Q16B 1VQ8S 1HBUB 1HFEL 4LBPA 2C2DA 1C1BB 1N5QA 1BQNB 3FMWA 1VDHA 4TVAB 5AE1A 2ZM6F 3S01A 1ITPA 4HHHA 1HWLA 3NS6A 4Y28C 4EO8A 4UT4A 1KN6A 3IA0A 2BACA 5FD1A 1SJFA 2M52A 1VBKA 4FYXB 1GFWB 5IFMA 3WX4A 1Q79A 1RAJA 2B9WA 4O4GB 3DLKA 2RRNA 1T9UA 4OYPA 2LVWA 1R27B 1UTAA 3M1VB 4CH7A 1Y5LB 3KK2A 2DR5A 2BJ8A 1IUJA 2HIQA 1WUUA 2ZC3A 4RJVA 1N48A 2GJFA 2Y8WA 3JSMB 2VPYB 2AHOB 3CCJS 3GWCA 2VG7B 5F0UA 4EK2A 3DRPA 3VAMA 1S6UA 4IQMA 2KT2A 1GMUA 1QAYA 2XYHB 2FVCA 2GC8A 5KFQA 1VQMS 2Y1RI 2CQHA 3GIRA 4KQZA 4MFBA 3ZTRA 1YIJS 1XNQF 2YNFB 4OYBA 2YQ3A 3EE3A 2W7AA 1GH8A 2IYGA 1IR1A 3Q8QB 2JRSA 4Q7AA 1L3SA 1G2EA 4WP9A 2AKWB 2Y0BB 2AZ3A 1OYEA 3JS9A 2DD8S 2HRTA 4NLXA 3LF0A 2CWKA 4H54A 4IDKA 1QAIA 3ZTPA 4AD6A 1KRPA 3D1HA 1FERA 4LF9J 2Z8QA 5K8NA 5HROB 5J2PA 3TQ1A 2X1GA 2QV6A 2I9SA 5E5NA 3HDSA 1U09A 5GMEA 1I6JA 4ER8A 4JI2F 1UL3A 3PXGa 1IKYB 3QJPA 2E5JA 3E51A 5CYMB 5F8MA 5HMWA 2FHOB 3I4PA 4UQTA 5B0FA 4URGA 4X4OA 1TVRA 2PE8A 3T5LA 2PI5A 1YBTA 2G0IA 2H9ZA 4OYZA 4ES1A 4K2XA 3MM9B 2VKZG 1C1CB 2V50A 1VRTA 4DUTA 1R0AB 1DQ9A 3JB9k 3SCIE 4WU2A 4PXDA 2VONA 4OJ3A 1MU2A 2AJ4A 3C14A 2HQFA 3M8WA 2OPQA 3O2IA 4F0MA 4XO0A 4C8NA 3W5YA 1F1BB 3BR9A 2K8GA 2OJ3A 4OI3A 3G9CA 4DFPA 2O1PA 4LFCJ 3HHKA 1SC4B 4M5MA 3T41A 4CO1A 2PDAA 3OVAA 2X1BA 1B99A 2IAJA 2DCLA 2H5EA 1RSCA 3I9V9 3O44A 5GVQA 5KFYA 4AL5A 1VBXA 2RF2A 1IJEB 1UEUA 1ZTTA 2PO4A 1XMQJ 4AUKA 3AOAA 4LBHA 3U1MA 2RMLA 3MR3A 4ZN3A 1U49A 2UUAJ 2DCUB 3AXMA 3CJ5A 3NBPB 1TKTB 3P3DA 3TUIC 3SMZA 3K89A 3QMQA 1JLBA 2J0WA 3D28A 3DLKB 3NCRA 4NL5A 3MCOA 3H8YA 3G4SS 2OTJS 4B3SF 1S0OA 3BF4A 3KK2B 1U1RA 4ED5A 2IJRA 3DOKA 1SL2A 2XWXA 2IPOB 3CJ8A 4ICLB 4O3QA 3KJQB 5D0EA 5HVHA 2I6WA 5FDLB 3SDEB 3F56A 4CO3A 2PD1A 4UW2A 1M5KC 5F8NA 5AE2A 3CWJA 2D7SA 1UJ4A 2O01C 3ZNJ1 3W9IA 1WOPA 4C7QA 1NSAA 5JVGQ 3RB4A 3GE9A 3F41A 3QGHA 3UCUP 4YR2A 3CTRA 2HHXA 2MKIA 5IT9Y 4X66J 1HWIA 4PG4A 1WDDA 3K7RA 4GMKA 5H1SV 5FJ4A 2ZHAA 1U1NA 5DJBA 2PGCA 3KK3A 3B82A 1R43A 1CJTB 2JJ4D 1CJUA 2XBPA 3BDEA 1A6LA 3BN7A 3JXOA 4KGVB 4ENOA 3CJ4A 2X1AA 1RDRA 5HROA 4QPXA 2J0SD 4M5JA 5KT4A 3BBFA 2FLPA 5I3PA 2OGUA 1K1QA 2JC1A 5GAHU 4F3MA 3BO3A 3EYZA 1RA7A 2J9DA 1IKWB 2ZDPA 2LQBA 2KYXA 1Y5NB 3BH7B 4M5LA 1WG5A 3FCVA 5CYQA 3T1YJ 2UXBJ 1X4EA 5DLGA 3G6XA 1RBAA 1YBAA 3QATA 4LR7A 2Z0GA 2CNOB 1BQNA 4IUFA 4WIIA 1NMEB 1ZTWA 1PBAA 4RX6A 2UVWA 4F50A 1N5VA 4TYAA 2UZAA 3D6TB 3ELHA 3GSDA 1CQMA 2QMUB 2W9BA 1IR0A 1TL4A 2N4DA 2Z2YB 2BJEA 3HHLC 1VQ4S 4I68A 3UCGA 4QIWD 2KG0A 5K20B 1JMTA 4JI8J 2YKQA 5AJ3F 4LR8A 4B08A 2BA9A 4I67A 1X9SA 4X4UA 4DCPB 4Y3CA 2CYYA 1RT5B 2FHJA 3SQOP 3R6GB 5L1JA 2A2DA 2Z30B 3E01B 4PYAA 3KLFB 4NLTA 3H2UB 3H59A 1Q86T 5AT1B 3N6MA 1P8GA 2XTJP 1OJ4A 3T9NA 2A6OA 2QFJA 5L46A 2HHHF 1R8PA 4EYHB 4C48A 4AQYJ 1ELOA 1MWQA 3LALA 1JLCA 2RILA 2Q43A 3CCTA 1KTVA 4TY8A 1PBUA 2E5IA 5GAHI 1HMVA 3MHYA 2DISA 3OFGA 3BN4A 4MKAA 5LMNJ 1JWWA 4K4SA 3FCWA 3ILJA 2JLGA 1YRXA 2X51A 3DYAA 5KFNA 4JI3J 5ETKA 1C0TB 5HI7A 2ASLA 1LWFA 3GV8B 2AJFE 3LA0A 3PNIA 1H3DA 4HI2A 4RBTA 2PEHA 1YSJA 2RHSB 4JB8B 1KLNA 2W2NP 4ED6A 4PG6A 2JFDA 4JUZA 5I42A 1UVMA 1XIQA 1VGYA 3CXCR 2XCAA 2EFVA 3K5NA 3MOJB 1I1GA 1NDCA 2HBYB 1YJWS 3IG1B 1VMBA 4PPZA 3HPOA 3D68A 1TVRB 4MK7A 1Q0NA 1LWCA 4D3HA 1R89A 2KZZA 1LEOA 2ZBQA 2EK6A 1VRTB 1WKJA 3TAQA 2BXJA 2EC2A 1TV6B 4IG0B 2AJ2A 3MM5B 4W4MA 4ZPWR 5KFUA 1D9DA 1KFSA 4FBTA 1P1TA 3T3FA 3DRRA 4S0MA 1NJZA 1DRZA 1B3TA 2XGPA 5CYQB 1RUSA 3RBZA 3UN2A 5C7PA 2DY9A 3IGNA 2J8SA 5KOXA 2XLIA 3VAKA 2WSFC 2KT5A 4GVLA 3MEDB 3NCQA 3W2VA 1LQ9A 4ZVPB 3J7YI 3K0JA 4LT6A 4E2FB 3PV8A 4ZS6A 3QJJA 1T9TA 3N5FA 2IDEA 2V2VA 3PFEA 4LF5F 2FZGB 5GMKa 2MEWA 2E1RA 2LU2A 2NLWA 2DIUA 1XNRJ 1Q8BA 1WC3A 2M70A 2RJZA 3WC0A 1HI0P 2KTQA 1I5OB 1RWNB 3D5MA 3T6BA 3E01A 5I3QA 2FVRA 4FF4A 4UQGA 2IBOA 3AJDA 2KJVA 4O44A 4ILRA 2P9CA 3HSDA 3PW7A 1C4AA 2GJ2A 1LWEA 3TAMA 4ZOSA 2MZQA 4R25A 4ZLNA 3MR2A 1QY7A 1U6FA 1AZSA 2MKYA 2AV5A 2P9GA 1GMVA 2MYFA 4WU3A 3KLHA 1YI2S 4ZVRB 1CVJA 5E3RA 1FRKA 1F6TA 2GAGC 2WZ1A 1HI8A 4BCAA 5KFCA 4F3OA 4N56A 2LCWA 3CJ0A 3D3BJ 1WD6A 1UZHA 3EVWA 3MZIA 3HXMA 4KY3A 4X4RA 3NL0A 1SH0A 2ACMA 2BABA 4RLEA 5KG1A 4ZCIA 4RUCA 2LEBA 1M1KT 1IBMF 2EKYA 2A6MA 3PW4A 1KQSR 1YLXA 3KNAA 3FVYA 3M8PB 4UOGA 3UDVA 4CLLA 4O0IA 2FHKA 3ZZYA 4N8NA 4C8LA 2BOAA 5IWAJ 3H25A 4JI0J 5IV4A 2BRLA 2CG8A 2ZH5A 4TLQA 2QRRA 1YGYA 3MD3A 1Y11A 3HHLB 2JNJA 3O8WA 4J37A 1S0VA 1BQXA 1HL6A 1WF0A 2HVDA 5A8KB 1EQMA 2G13A 3DM2B 2UV8A 2BKPA 3ETMA 3H2VE 4WE1A 1VIOA 1N5YB 1LV5A 1RJJA 5D78A 2HK2A 4XDDA 1RISA 3QSYB 5DETA 1UAWA 4QU6A 4C98A 3R5AA 2VQFF 1R8AA 4IH6A 4DV6J 2KM8C 2LECA 2WK4A 5EUHA 2ILYA 1REGX 2KO1A 3PX0A 2AYGA 1I3OB 2JFKA 4QR0A 1JLAA 2WBRA 4LF9F 2XCPA 2QMXA 1FFWB 1CEZA 4LVOP 3HM9A 3T19A 5HBMA 3D0HE 5DM6Q 3F73A 1NSKL 2IVFB 2VOOA 3I56S 2BQRA 1R6YA 4NCGB 4Q45A 5HJYA 3RAQA 1FRHA 3UCZP 1U45A 3C15A 4PWDA 2ZH9A 3M9OB 5J2QB 1FJCA 4ZDNA 1KS2A 4NLVA 3UWTA 3IO1A 4DG1A 3OTEA 4GO7X 5CCLA 5K8PA 2YH1A 4EYIB 1FNMA 2YKNA 3OXFA 4PXCA 1GXUA 1LWFB 1Z2ZA 2HAIA 1IBMJ 1RTDB 5HN0A 2E9ZA 4C97A 4ED2A 3NGTA 1HHSA 4L3NA 1HWJA 1S6OA 2EFPA 2XS7A 1RWOB 1W25A 2ZDOA 4KGZB 3RAMA 3RYLA 2GVZA 4IO1A 1EKSA 3B4DA 2A1BA 1M1HA 5LXYA 2ZUAA 2DEIA 1QLNA 2AX0A 4C3LA 1WC4A 1QUPA 4LSLB 3BPSP 1N4LA 4N8OA 3KOAA 3NMRA 1DTQA 3D67A 4QIVA 2XMAA 3TI0A 1Y10A 3CD0A 3R27A 3TA0A 2ZJQQ 2ZH7A 4KR0B 1S7HA 2EBEA 2OP5A 1X5PA 3VZIA 4OHWA 5T41A 1H72C 2C2EA 3T9ZA 3MXHP 4ANDA 2FVQA 1U0HB 2HHVA 4RW8A 2Y0SD 4FP9A 3VR1A 3DRSA 2EBGA 1RACB 3C6TA 3AB4B 2DNZA 2YVSA 3BQ0A 3SV4A 3CDWA 3AXKA 2G2YA 4WYLA 4AL6A 2FJAB 3RB6A 1S6QB 1NPKA 1NSPA 3EXYA 3JSRA 4X65J 1SXLA 4PG5A 5E3AA 2YXLA 3FBCA 1K9MT 2HHSA 4J91A 1NHKL 3BGFA 1MWYA 3GU0A 1V3RA 2IIHA 4RPFA 3OHBA 3QWPA 4Q5VA 2Y8YA 3TVYA 1QAXA 2PMZD 3RBXA 4UZBA 1HNZJ 1A9NB 3DDIA 5J2NB 2XM3A 3W9HA 2L9NA 3BPDA 2RHQB 1R6VA 2VBWA 3TO8A 3OSPA 1KEKA 1NK5A 1CPZA 1YJRA 4K7QA 4Q8EA 1F3FA 1P1LA 3QGGA 2OUGA 4A48A 4F04B 1X9WA 1RXOB 1JJ4A 2HQCA 3VALA 2C3PA 3CCMS 3OTCA 5DZ7A 1PG5B 1U25A 4QR1A 4MK9A 4PUOA 4CLZA 2VH7A 1S6PB 1WF1A 4XK8C 1XR5A 4ZLPA 2MY7A 1IWGA 2M2BA 3POTB 4RW9B 1X60A 2H3EB 2QIFA 3BZQA 1YQHA 5D3GB 1RHQB 3IS9B 1PGZA 2R7UA 4C2MA 2HFNA 1U1PA 2DXFA 1DLOA 1OQ3A 4MIBA 1FEEA 4N7TA 2X3GA 5U47A 4QWBA 4ZVOB 3NNHA 5HVGA 3DHXA 3EPGA 2DR8A 2XYPB 3C46A 3FFIA 2ADBA 4J9UE 4YDDB 3PW5A 3SI8A 1VBZA 2NSCA 2FJEB 1FXRA 1GT8A 2YWGA 3G8QA 4BC7A 2XMWA 2E1PA 4URSA 3KUHA 2NXCA 4P7VA 1VQSA 1RCOB 3EGVA 2UVUA 1ZAXA 2PMHA 3QT8A 5EWFA 2BW2A 1SBRA 2HK3A 3LWLA 1C2PA 1SJ1A 2HFZA 4CI0B 1B0TA 1SIWB 4OI6A 2DK2A 4TU8A 3SCJE 3CF5Q 1HBOB 2HZVA 3CC4S 4IRDA 3DM2A 3M2VB 1W26A 5D4NA 2HFOA 3TEGA 3KJVA 1F0XA 3ZZRA 1RAFB 3BGLA 4I64A 1FCAA 2DNYA 4ETXA 1ZBTA 1IR2A 2YWKA 3PVXA 2B7CB 3QT6A 5E33A 2CQ0A 2KVQE 3HCXA 4XPEA 1RHJB 2DHXA 4NXMF 1MROA 1JXLA 1T02A 5BR8J 3EGZA 1NB7A 1VRUB 2EG1A 4FVCA 4DXLA 2RU9A 5KAKA 2EWHA 2HNZB 3BQ2A 1RWWB 1T0TV 1SQGA 2F65A 4DQRA 4JV0A 1Y00A 2C3UA 5HAOA 2IBKA 2AP6A 3W2WA 4HACA 2PMWA 3I0RB 2MKSA 2C22A 1FD8A 2HNYA 2F63A 3H2LA 3DFEA 3GIKA 3TW0A 1X5OA 2A0FB 2A18A 2L3MA 2YWFA 2Z58B 4U8VA 1FKPB 1WHVA 4DR1F 2FJXA 3OL7A 3MFIA 2JHEA 2OPRB 3CE8A 2R8HA 2HYIB 3MM7B 1W2IA 2K1RB 1DBDA 3M8QA 3N4WA 2VL1A 1VQ6S 3UN3A 2ASJA 2RRBA 3KNGA 3OTOF 4R8UA 4I4BA 2N4CA 4YUDA 4ID8A 4LSNB 4LVNP 1X4FA 5KT6A 2GVZB 3L9ZA 3NLCA 2K7KA 2LLZA 3EPIA 3BEGB 4IG3A 4WXOA 4CNYA 2VQEF 2OKQA 4PR6A 4DL2A 4IOBA 3G2XA 3QO9B 4LSLA 4DX8H 3BJYA 3SV3A 1RI7A 5HMZA 4YDXA 1GNKA 3IWLA 3M05A 5J2PB 3KLEA 1DTQB 3T6JA 4Z2XA 4OX7A 3X3UA 2CUYA 2XNQA 1WC0A 1NXIA 1MN9A 1T11A 4M5DA 4RBVA 3H90A 4ZK7M 5KG5A 4K5RA 2AJ1A 5EDWA 4JV5F 1ZZFA 2CVEA 4QW9A 2Z2LA 4ECYA 2E44A 1FVSA 3NRBA 2OIHA 4K0KJ 1V3ZA 5IWAF 1FXLA 4U6PA 3UNYA 1BQMA 1F3VA 2CJYB 2GMJA 3AFGA 2DRDA 2P8IA 1FT8A 4K8RA 1HBOA 2N82B 1JLFA 4RW6A 1S1UB 2XY7A 5GMDA 2MQNA 5LMUJ 1RAAB 3R1LA 1XC9A 1L3VA 5L8RC 2MKKA 4NCAA 5C24A 5KFMA 1H7XA 4PWUA 2Q79A 3MMAA 4MT1A 4AL7A 1JJ2R 5SZTA 3NGSA 4B9LA 5GADU 2DNRA 1URRA 2DBBA 2FDNA 4J9NA 3Q8PB 4WFAQ 4A8YA 2C28A 2YTCA 3IAS9 2KVIA 4G6VB 2XY6A 2V4JB 2V4RA 1VQ7S 2XS5A 4HTIA 1P6TA 3ET6A 1RAOA 1S9GA 3RG6A 2EFQA 2ROPA 3W8GA 1RGVA 5I4MA 1CJKA 1QD1A 4Q2LA 2IJNA 3H0PA 5C42A 1DHMA 2YX4A 2HHTA 2L9DA 4ZP8A 3PY8A 2FZCB 1S5ZA 1WOOA 2BUNA 4O3PA 4ZVGA 4DV4J 2IJFA 4WFYA 1YWXA 1NK0A 1N36J 4USHA 4BC9A 2FUG9 3H5YA 1HBMA 2GHVC 1U6ZA 2KT3A 3CCSS 4C11A 2BQUA 1IBKF 2XNRA 4K4UA 4OHYA 2QL7B 3MPUB 1UVNA 1LWXA 5SUHA 2DRAA 1IVZA 4R8UB 1HBUA 1YRUA 2IM3A 2OEJA 1FNOA 3LP0A 4IRKA 4GRSA 2V8HA 3GSIA 2F8MA 3HKWA 3W1YC 4YN3B 3SSSA 2RRAA 1CJTA 4V1Ak 1RABB 5A2QY 2M8HA 3SXLA 3MFHA 2BJ7A 2C42A 2XY5A 4X2BA 2CQIA 2DTJA 2DNNA 4OZ3A 4RO0A 3E8OA 3FUYA 4DV7F 4DV0J 1HQEB 3D3CJ 3H20A 4HI1A 3OJUA 3IM9A 4LF4J 3QAEA 3RU0A 4K50A 4CIOA 1LW2A 3MAQA 3PW2A 3NAHA 4RU2A 2LQ5A 1PKUA 3OFEA 4OJ1A 4ETZA 5KFIA 2ZWPA 2D3ZA 3QLHB 2UV8G 4R5PA 2FGOA 4LUBA 2D3O1 3Q86A 1U02A 3KHRA 1B64A 3SCLE 5HL7Q 4ED8A 3MPVA 1C0UA 2NXNA 2DHHA 3HLUA 4DMZA 2JH3A 4J9OA 1MNEA 3P96A 4USJC 2ZJRQ 1QJHA 4DUZF 2E1CA 1EQ0A 1C4CA 2AEJA 3M4XA 4DV1F 3MCSA 3M6WA 4ICLA 4DF4A 3ILIA 4PG8A 2O66A 4DV3J 4B3MJ 4EU0A 3SIPB 1GTHA 4CTAB 3A8KA 1WG4A 2QSWA 4WJBA 4CZCA 2HS3A 2AF6A 4ECWA 1QVGR 4JV1A 1NHVA 2HW3A 1D1UA 3GYXB 3SYZA 2YNGA 1IKXB 3BS9A 4HACB 5IM0A 1CS4B 1T3NA 3CCZA 3QSIA 1L3KA 2OI2A 1NK7A 4DR6F 1U2CA 1IXKA 2CNLB 1RADB 3BKTA 3MM8B 3N5BA 4QIEA 5D4PA 4JI6F 4AYBD 4DV1J 1CJKB 4I2PA 4A8SA 1KP6A 3MM7A 2U1AA 2RUGA 2RUSA 1GK8A 2VB6A 4OZJA 4FYWB 3HD1A 1YJ7A 1LK5A 3KYLA 2WVFA 4ZVHA 2Z57B 1FD2A 3C6UA 4UTGA 1C0TA 1H74A 1ZAWA 1WEXA 2I2YA 2MSSA 2HWHA 4IFVA 2DNQA 4DV0F 3SFGA 1A7GE 5L39A 3KLEB 4RU9A 1QM9A 3LP0B 4LF7F 2VDIA 5CD4H 3RRHA 4X62F 2NXJA 4P2FA 4RL1A 3MD1A 5D77A 4ATNA 5B0CA 1WSRA 2UVRA 5KFRA 1FKOB 1KHVA 2G2OA 3GTYX 4AQYF 1TKXB 3HO1A 4MH8A 3OJSA 1O5JA 2R42A 1T05B 1R0BG 3V6DA 5JVHQ 2I0XA 4KGMA 1O6XA 1BQMB 4OZ1A 4B17A 2CADA 4I69A 4HL9A 5F9NA 4LRDA 5AXLA 3KTQA 3HD2A 1ZM9A 4DV6F 3R5DA 4KH1B 5DS7A 1LFPA 4DPWA 4F36A 1S1WA 1LXNA 1SV5A 2KL8A 2ZEJA 1NPPA 1GXLA 1ICEB 3DMJA 3HVAA 5CZVA 5DO2A 5FDLA 3R5JB 3SDEA 3K57A 3CCRS 1HYSA 2BM0A 4RWXA 2EC0A 2NQPA 2KKHA 3R7SB 3FZ2A 3EGNA 4FF3A 3ENWA 4J90A 2I5JB 2CWXA 4WBFA 1TUVA 1DAXA 2CPEA 1DTTA 2FB0A 2HQGA 1S59A 1UEVA 3MMBB 3KMSA 4JI6J 2UXDJ 3VWSA 2P6TA 2FC9A 4LQ3A 2DH8A 4FZVA 3TWZA 2XYGB 3P4UB 1FRMA 4ZVTB 3M6VA 4DV7J 3QAUA 4NZ0A 5CYJA 4PQUA 3GR1A 3ISZA 5DDOC 4RW7A 1P9YA 4CLWA 4CDIA 7FDRA 5IM0B 5KFKA 1TTHB 2Y1LB 3HKZD 2ZH3A 1TK8A 3ZZTA 2VU5A 5D8HB 2UUBF 4O44B 4I2PB 4ED1A 3GZ7A 1RT3B 3OTDA 4OHVA 2QLJB 3NS5A 4IOCQ 4B3RF 3J81j 2RSQA 4OYOA 5CABA 1QSSA 1HI1A 1OY6A 2EI5A 4OL8A 3CC7S 2E7XA 4J7CA 2FY8A 2RT3A 4IFYA 3RTVA 2MLXA 4ECUA 2W9BB 3R5BA 1UA1A 5KT7A 4CWBA 4DS5A 3J7Z5 2YKPA 2BX6A 3A3PB 3SFUA 1TL1B 3GYGA 4E0DA 4FXVA 2HLTA 2HPUA 4JI3F 3QYYA 1UVJA 2D9PA 1RT5A 2ZNYA 2DKOB 4FS2A 2XZTB 3K5PA 3KUEA 4ZJLA 3UDCA 2N7YA 2FC8A 4HYKA 3HHNB 2LQJA 1TAQA 3A12A 3I82A 3QLHA 1R0CB 5IT0A 3V4IA 1N56A 4LR9A 4OLOA 5MAOA 2AJ0A 4H4KC 4YY3F 4JYAJ 3RRGA 3ILLA 3HVTA 1OYDA 2XMJA 1R31A 4OX6A 1HD1A 4FN5A 3ENAA 5BYQA 2VFRA 3D0GE 3VAFA 1FE0A 1SV5B 4OYXA 3DU6A 3DRPB 4OMFG 4ANCA 3PO5A 1TK5A 3PRBA 4KV8B 3AD9C 5DRKA 3QFWA 4Y6IA 4CRJA 3MECB 3KLHB 2KXFA 2CJXB 4WKRA 1MMDA 1DQ8A 2H5IB 2Z4PA 3DN9A 3Q8UA 1RTJA 4IYQA 1SCJB 4MKBA 2J6SA 3BO2A 2XHCA 4KPYA 3BQ1A 2MSTA 3OVSA 3LPEA 4ZIVA 3R6LB 8AT1B 2BE7D 3CULA 1IBCB 4B9VA 5T14A 4YHHJ 2MQLA 2BW7A 3G6YA 1CBKA 1S99A 2W2OP 4YB7A 4QW8A 3T5JA 3M8PA 1FX4A 4YOEA 1S7IA 2G9OA 3MM5A 3NOCA 4HTJA 2DH9A 1SJ3P 4P2SA 2HRUA 2FLNA 4LF8J 3QRQA 4EI2A 2HHWA 4DU8A 5E7OB 2K7JA 3KWMA 2DR9A 1CC7A 2VOPA 4DZDA 4IFVB 4KTQA 3UPFA 5AE3A 4NRUA 2J7KA 3GV5B 2C3YA 3J81Y 2MXYA 2NYHA 4DR7F 4X4SA 3CCVS 2CNNB 5E3CA 2ATCB 4G1QA 2UU9F 2WVDA 2NUUG 2DGOA 2IRUA 1EB0A 3RUBL 2CDRB 1NAQA 3LAMA 3V6DB 2JEJA 4RUAA 2BR0A 4DL0C 4WKYA 2HWTA 2HGMA 4NMLA 4ED7A 5L9XA 2QG9B 3IC1A 4QYZK 3D54A 4L76A 3CDUA 3S1TA 5K5MA 4CM0A 2R7WA 4C4WA 4EEYA 4ECSA 4C8ZA 1NK6A 2HGNA 3FEXB 5A0YB 3V4IB 1SVDA 4KKOA 4Z7CA 3DNCA 2VHGA 3N9UC 3CPWR 1MMLA 1MMNA 4QWDA 2LDIA 2QLFB 1WI6A 4ZPDA 1FHTA 1BLUA 3CIZA 3QIPA 4Z37A 3DOKB 2XMTA 4ZCKA 3VCDA 1E6YB 2C2KB 3M6XA 1NKBA 2WSEC 3H98A 1XMQF 3PIOQ 2ZM6J 3TJ9A 2BBEA 1W2BR 3GILA 5H9FK 2HAFA 2EK1A 3VQTA 3K5MA 4GC6A 2LA6A 5KFGA 2MQMA 4WK1A 1U1LA 3EGWB 2QC3A 3TJAA 3UR3C 3VAGA 1BWVA 3V6JA 2EKNA 2BJDA 1FJGF 2VA3A 3NGKA 1AXQA 2V2ZA 2ZD1B 5DZ6A 5JUMA 1RT2B 1Q5YA 3MPWA 3FSXA 3Q22A 1M1GA 4WFNQ 3K5OA 1UJ6A 2E5GA 4JI4J 1FF2A 2YNIA 2ZBCA 3RR8A 2GQ2A 3PEHA 3FMBA 3KHHA 1BY9A 3G96A 2DT9A 2WRMA 2ZC4A 4NXNF 2VC1A 4RWWA 3GJQB 5B7WA 1M5SA 1RWPB 3H40A 1Q95G 3AQOA 3FKBA 5H9EJ 4XTTA 3PYGA 2W25A 5JJBA 2XGQA 5LMNF 4DV5F 4DR5J 3T5HA 1SKUB 3C6TB 1HPZB 2Q66A 5KFOA 2OMLA 2RVJA 1VS3A 1EARA 2NYIA 5D6GA 2HLUA 4G1QB 4A8OA 1BXNA 1EX8A 2GFFA 4RW4B 3GJTB 4RNMA 4Q44A 4CLFA 3AOBA 2VJUA 4O3RA 4F67A 2J8AA 5HBMB 3W3SA 3MEGB 4K4VA 4C8OA 3UN5A 5DG9A 3KKFA 2JWNA 1RT6B 2Z2ZA 2AYMA 3MR6A 2DNGA 3JYTA 4X65F 3K8VA 2ZKUA 5KFHA 3GLJA 2ZJPQ 4ELTA 3PG9A 3BH6B 2APOA 4XAKA 2X3DA 3PX6A 1MG7A 2B8PA 3QIPB 2HSEB 3Q0AA 1S77D 1JLCB 4J5OA 1VBYA 1FXDA 1RA6A 3M8ZA 2YQ1A 2LEPA 3IN5A 2BDPA 2MLZA 2E5HA 3WIVA 3MUMP 5LOQA 4FYDA 4X64J 1RBOB 1G1XA 3FBFA 4LF7J 2PFDA 4IDKB 2DITA 1XK8A 3RR7A 4WZMA 4P52A 2MY8A 2MZTA 4DN9A 1ZPWX 4DBQA 3FFIB 3KLVA 2FLLA 3NNAA 4HDHA 4FXDA 1QSYA 5LXRA 5CYMA 1LNQA 3IM8A 4W92B 3QT7A 1JLEA 3OR1A 1Q81T 5ETSA 1WEZA 3NY0A 3QFHA 5ETLA 2VBYA 1JJHA 2COLA 1NZ8A 3IBCB 1GAOA 3MM9A 3ZZZA 1WNEA 1LWCB 3J7YU 3W5XA 1AROP 3AJ1A 5K14A 3NEKA 3Q89A 2OFHX 2KN4A 3S8SA 3GIJA 3EVMA 2CQPA 2QT7A 3C16B 1TQLA 5AXNA 2ZE2A 1YX2A 3FEZA 1IQZA 4EFAC 3MR5A 4ITSA 4OFZA 2FYXA 4JI0F 3KJVB 4LMZA 4MKVA 4PZVA 2HG4A 2VPXB 5LSRA 3GQCA 1VQPS 3SQGA 2R8JA 5J1NA 2B9EA 3PHEA 4WIQA 4U96A 1HA1A 3A1YG 3N28A 4OQJA 3CJKA 1NKCA 2XI2A 4ALZA 3T5KA 4NI2A 1FRLA 4A8MP 1SC1B 4RBUA 4W98A 5K9FA 1YZ6A 5D4OA 1S0NA 2E9RX 1YJUA 3DXSX 2B51A 4LF2A 3VVTA 1V6HA 4OI2A 3W8PA 4A8XA 1JLBB 2UXCF 4AFFA 2GJIA 2XMKA 3GMGA 4Q43A 3UD3P 2MHEA 1AT1B 3CSKA 3MGJA 1QAJA 1YBUA 4A8FA 2OPSB 1HNVA 1ZPVA 2XG8A 4MTPA 8ATCB 3RBDA 1S57A 1YJVA 3MDFA 1PYOB 3D9BA 5ETNA 1ZS6A 3JAMY 1X0FA 1T03B 1DLOB 4UUWA 5DQGA 4ECRA 1K0VA 2PSZA 4OV6A 4PXBA 4OX8A 4ECTA 3X1LB 2D41A 3UQSA 1SJ4P 1XNRF 4JOUA 1RAIB 2DNKA 3WC2A 3LP2A 2V4JA 1S12A 3O3LA 5KFJA 2K3KA 4K4TA 2IFXA 4WK3A 4IG3B 1N6QB 2RU3A 3GJRB 1NCLA 1T3OA 3CO9A 3OHAA 4F4WA 1EIYB 4B3RJ 1RB0A 3W65A 1O8BA 2GIRA 5KFVA 2GHWA 5IT4A 4NLWA 4WTYA 1ULRA 4QWAA 1UW4A 4IRCA 2MZJA 3P8BB 3NGDA 2VG6A 1DQAA 1OPZA 3WDOA 4CO4A 2CAJA 4DHVA 2W2MP 3MCNA 3LTOA 1JXEA 2DEJA 3CJ3A 4U9RA 4ZPVR 5F0WA 4YHHF 3HP6A 3NNCA 2VUGA 3DRYA 2JDJA 3Q24A 3CC2S 4KHMA 2FQQB 1NZAA 2V0NA 2CKWA 2Y3YA 3DLGB 5EHHA 3H4BA 1QTMA 4NX9A 3TP2A 5K14B 5CQGA 2HNDB 4OYIA 3MUTP 3I0SA 1OMSA 4KIAA 2K3IA 2YKMB 1CSJA 3DOLA 3JSBA 5L9NA 3PKMA 1GTEA 1MROB 2V8DA 3MF5A 4U8YA 5IOLA 2O67A 2HS4A 4HT7A 4CM2A 2W1BA 1T9YA 2DO0A 1K1SA 4P72A 4FVMA 4ZP9A 3D1QA 3K59A 2UUBJ 3P6YC 1EAYC 4LRCA 3ZXWA 1LW2B 4F3QA 1OPIA 3S6EA 1T95A 1H2TZ 2FVPA 2GGPA 3M30A 2IRYA 2F4VJ 1Q1KA 4DR4F 3TZXA 1F9FA 3WIUA 2RAQA 1C0UB 1S9FA 2JC0A 2OPRA 4PPDA 2CA9A 4K0KF 2YKAA 2MPUA 2LP4A 4I6WA 2Y1IA 5G0RA 4B3TF 1CJVB 4X62J 2DGVA 1H0HB 3MM6B 4ECXA 3IMQJ 2V9WA 2BANB 5T7LA 2HVEA 2ZFHA 3W64A 5B0BA 4OX9J 5LSLA 1KQKA 5BYSA 3DYAB 1HBMB 2RDDA 4A4JA 4DQQA 2AD9A 2XSFA 4AE5A 3MWBA 2C2OB 1OY8A 4LSZB 4A8WA 4OHXA 1VISA 2J9CA 3DGPA 3FJ2A 3AY0A 4CH0S 2OFGX 2VPWB 5IZHA 3MAHA 1CS4A 2XC9A 1REVB 1WTBA 2W4DA 2QLBB 5IC6B 2ZITA 2RS2A 3R8YA 1VQNS 2XB2D 2EEYA 4WFZA 1UETA 2N3OA 5C2CA 1NH7A 2GAHC 3ILOA 2LU1A 2W24A 3DLJA 4KB7A 4MIAA 3KLGB 4DL6A 4FF2A 2DH7A 2VG6B 1S4EA 2V2KA 3HHLD 4P2XA 4QQBA 3T1YF 1M5VC 2UXBF 2R2SA 4C8MA 2HFSA 4HKQA 4LQ9A 1U7LA 2C3MA 3DI6B 5IQ6A 4G1IA 2JEIA 2GMHA 2YKOA 3AJ2A 4NLOA 4PQAA 4YB1P 2HGLA 4QBUA 1LFWA 2WB4A 3F44A 3W61A 2RNEA 3TA1A 2HNDA 2F1FA 3MEDA 3W2VB 1WC5A 4LFBJ 1VCTA 2CRLA 3TAPA 2A10A 1NSQA 1FKOA 2OMOA 3IXQA 4N47A 3BGUA 3HSGA 1IKVA 3HFZB 4RNHA 5D0HA 3WQPA 4NA2A 2RH3A 2R7RA 1JX4A 4TN2A 9ATCB 5AJ3J 2J76E 2GIFA 1UW9A 2FIUA 4M8LA 1UFWA 3P45B 3UD5A 2R2TA 1J5OB 2LEAA 2HIYA 3JSMA 1U2RA 2IM1A 5B0AA 3KLIA 2MGZA 3UVJA 3KG4A 1IWAA 3U1NA 2BKNA 3GV7B 3L7PA 3UD4P 5ETQA 3F0NA
chains in the Genus database with same CATH topology
4C11B 4DV3F 4B3MF 2E1AA 4I6AA 2DRBA 4DSIA 3DCAA 5D3GA 2PT0A 2HVIA 4QYRA 2JL9A 3ULHA 2W4CA 4Q0BA 2C3OA 2VZ9A 4K4YA 2F9JA 2GQQA 2J7UA 3IR7B 3KG1A 3R5CA 3THPA 3HJFA 4X4NA 2GV1A 2EG2A 1KOOA 1HQEA 4Y2CA 1IKYA 4TXSA 3QWUA 3BM7A 4MYUA 2ZH8A 4KO0B 4EUVA 5E41A 2W9AA 3THVA 3LPYA 3TUJC 4QYZJ 4NLUA 4IR9A 1UFLA 1RYRA 4I56A 1NJWA 4LIRA 5E2QA 3HHLA 1T05A 3DLGA 2E5LF 1YG0A 4H4OB 3LOUA 2I38A 1MU2B 1ZETA 2L41A 3M2VA 3MTJA 2SXLA 3US5A 4EO6A 2P6SA 5J1PA 3B4MA 2U2FA 4DSFA 1D9FA 3CB4A 4WZQA 2MJNA 3RRKA 5HP1B 3KHGA 4LF6F 4JI4F 4MFBB 5EN1A 3P5TL 2Q1LA 4OZNA 1OSCA 1DZ5A 5KFZA 1KLMA 2GNKA 4I7FB 4E8UA 2M9KA 2AQ4A 4BS2A 4X4QA 2CQ4A 2WCXA 2PN6A 4YQWA 1U1MA 2KHDA 3C6UB 2KXNB 2KH9A 3FGVA 1MSWD 1ZM3A 3M9NB 4Y2MA 3BO4A 4B9TA 3ENQA 4NLSA 4G1PA 5LMUF 4N41A 1R0AA 1IQTA 1WTFA 4C3KA 4F4YA 3V4MA 1F5BA 3IGVA 2UUAF 3OVBA 3V6HA 3KLGA 4QPTA 3EXCX 2CPFA 1JLGA 1IJFB 2DHGA 1WWHA 4ILMA 3O5TB 4O4RA 2J5AA 4DSLA 4OI0A 2CPZA 2ZVSA 1WELA 2EPIA 1BGXT 5KG7A 1UKUA 3TYTA 3CGIA 3H4DA 3CDBA 5A6PA 4NYOA 5B0DA 1WEYA 4NA1A 4TQSA 3GG1A 1KQGB 3NAIA 5LL6d 2WOMA 3BR8A 3M8SA 5H9FJ 3IRXB 4DL7A 1H2VZ 4DN0A 2AU0A 1NNDA 1FNXH 4Y34A 2BVZA 5DM7Q 4QCLA 1S1UA 5J2MA 3GB0A 3R3TA 1FK9A 2FPHX 4NOHA 2QA4S 2A2CA 3JTOA 2J6UA 1T7PA 2R7TA 2VBZA 3D2WA 1WHYA 1SUQA 1FE4A 3LGNA 5KFXA 1KSPA 2R8GA 2FJVA 2CJAA 5A0YA 1L3TA 1G6BA 2CQBA 2WONA 1VHFA 3KK3B 2QA4G 5B0GA 1X4CA 3KMQA 2Q6CA 5BYRA 4DQIA 2I8EA 4RW9A 3HMJG 5DLFA 3IS9A 2XSJA 1TAUA 1HMVB 1TFWA 3IWNC 4I2QA 4C0OC 4F2RA 1UVLA 1TR0A 2A3JA 4R0EA 3CCLS 1Q4RA 2EFNA 3HFKA 1VK8A 1RTIB 4X84A 2LXIA 5D4LA 1RT7B 1S1TA 2VG5B 1XN9A 4TQRA 3I31A 1UA0A 2HMIA 4ID5A 4LFBF 3RW6A 1YJ9S 2B7BB 4GO5X 2YX1A 1S97A 5IS2A 3T1HF 2RQMA 2AJQA 4Y2IA 2MQQA 4KT0C 2ZH2A 2YNIB 4QU7A 2BE2A 2IRXA 5F8JA 4PRFA 3RAXA 1AW0A 1RKIA 3LW5C 1G7CB 3ZC4A 3Q8RB 3H5XA 4UOCA 1Y3JA 4ZP7A 2B4OA 1SI9A 2V8GA 3ZZPA 5F3ZA 3KLFA 1U1KA 4N76A 3M32B 3SSQA 2ZHBA 3ENVA 2VFSA 2MZ1A 1SL1A 1KHWA 2CZVC 2AWZA 2ROEA 4ZVEA 2IM2A 2V5HG 4QIFA 1E6YA 1RT1A 4ZVFA 2B4UA 2R8IA 4ZMMA 4M95A 5J1EB 4AXJA 4DSEA 4X4TA 2RDJA 2RDIA 1M5OC 2P9EA 4DL5A 1FESA 2CQDA 3PM9A 4CT9A 4F26A 4RKUC 2F8HA 1FEHA 1LW0B 1QUVA 1IKXA 1VJWA 3W7BA 3I5CA 2DNOA 2WONB 3OFHA 1PO6A 3IG1A 3P49B 2E7WA 4FNHA 2KRRA 3M8QB 5F8HA 2GA7A 1U1OA 2YWEA 3TRGA 1R8BA 2F9DA 1R8HA 1BD6A 2XSJB 4L72B 2ZH1A 3DLLQ 2DVIA 2W9CA 1E6VA 4X66F 2AGPA 3IR5B 4A47A 1VQOS 1K8AT 3DOMA 1VOMA 4A8KA 4DPOA 3MURP 3OLAA 3OPKA 1KTQA 2XMUA 3CEDA 1Z2LA 3WZ0A 5KFDA 1AUDA 4OV1A 4DLGA 1HPZA 5M2UA 5F9LA 4EBEA 2HMIB 4JI1F 2RKIA 1R3NA 2WSCC 2ZUGA 1S1VB 3WBZA 1TKXA 3I5BA 2OAUA 5MLCV 3OL9A 3IR6B 1GX6A 3CCES 4Y0FA 2UP1A 3KK1B 2GCFA 2CZ4A 3ISND 2ADCA 2GIQA 5J2MB 1QVFR 4Q8FA 2JX2A 3H5SA 3V81A 3JYTB 1QSLA 2VG7A 3OL8A 4O3OA 2O5DA 2NZ4A 1TL5A 3TX8A 1N5TA 1HNZF 3ZZOA 1U26A 3PX4A 3U27A 3CJKB 2HVHA 1SUQB 1TFYA 3EUNA 2DGUA 2MDAA 4WXWA 1YJTA 2WBMA 3SZ2A 2VA2A 1HD0A 2QA1A 1J5EF 3C3LA 3OUYA 4ZPBA 1WHWA 5K8MA 1LXJA 2IVYA 4RNNA 2J0QD 4JI7F 3HX9A 1VFJA 1XMOF 4NLPA 2ZZMA 4PG7A 5M2RA 1AFJA 5J2QA 5A8WB 2NPFA 1GXTA 2WW8A 1RT3A 4L6V3 4YB5A 2KU7A 1KD1T 2ASYA 4ECVA 4ZCMA 4NCBA 2ILZA 5GAEI 2VBXA 1YITS 4FF1A 4IO9Q 3FSYA 2XO7A 4DQSA 3Q2SC 1TZ0A 1M90T 2OPQB 4HH1A 3PEJA 4B02A 2VC0A 1GQEA 4DFKA 3E2EA 2IA6A 2KFZA 1SKWA 5KFBA 2FLOA 2NS1B 4LF4F 2HRYA 3I6PA 1S4FA 2RKIB 2HWIA 2FJBB 5L1KA 2F8EX 4TU7A 2FVSA 5EWEA 4G3IA 4CO0A 4RW8B 4R5PB 3V6KA 5DGAA 5THWA 1URNA 3VQSA 2VKRA 3AHPA 1N52B 5GAGU 4J9SA 2OPSA 2KFNA 4PWDB 3DLEB 3N01A 3V81B 1MWZA 3CD5A 4A46A 1Y4ZB 4EBCA 2MQPA 1NJIT 2IHR1 3TNVA 1XMBA 1FRIA 1DJ0A 1X0PA 4ED0A 3GFXA 3LO3A 4UY85 3MOZA 2R4FA 3AAWB 4J9PA 4C8KA 1QE1B 5F3TA 3TUZC 2CPYA 3PACA 4I6YA 2XHWA 3GG0A 3I55S 2RQCA 3G71S 2CG4A 2D3UA 5BR8F 1FJ7A 2EVZA 2JVRA 2W8KA 3THTA 2JZ5A 3MM6A 2LDYA 3FDSA 4KFBB 1NK8A 1K73T 4DL3A 2GHPA 3VF0B 5A8WA 1NHUA 3MMCB 2ZE2B 3J80Y 4YEAA 2DGWA 3G8TA 2VD3A 3M2RA 2FHMA 2KRBA 1ZOTA 2VPZB 4HEA9 3UW1A 3CCUS 4CNZA 1XR6A 3HHDA 2YKMA 4BBYA 1S6QA 2AX1A 3J7ZT 3GFHA 3BSNA 2NR0A 3D1OA 4DV2F 3EX7B 5DDQC 2GMLA 1RTHB 4O4GA 1SH3A 1ZZNA 2Q6BA 1S49A 5J2NA 3K2YA 5HO4A 1ZM4A 3I9ZA 4DJBA 3DRXA 3E3XA 3G8SA 3RBEA 3AA8A 3V5RA 1Q82T 3OV7A 4KKOB 3U1LA 4DR2F 4O3SA 2X1FA 1D8ZA 3N0VA 3PIPQ 3GR0A 3OR2A 2RIJA 5IXUA 4EZ6A 1X5TA 4LJMA 3ZZUA 5DDPC 3OW2R 4V19J 4HLBA 4I0WA 3M9MB 1SKRA 5GAGI 1VRUA 2GW8A 4M63A 5L1IA 2IMOA 2F4VF 1UJ5A 3M6UA 3OL6A 1FA0A 1FRJA 1HNWF 2IM0A 1EETA 3NKYA 1EP4A 3IFEA 3N79A 4IKAA 3ETOA 1ZM2A 2B0GA 3I0RA 4BWMA 1REVA 2MQOA 5I42B 3MR2A 4V19X 1APSA 1WHXA 2B9XA 4LFAF 1LK7A 1KR4A 4ZP6A 4JI8F 2ZH6A 4B9UA 2ZD1A 3D0IE 3HVRA 1N0VC 3BGRA 4DQPA 1WI8A 1HNXF 3SEOA 4N77A 5LSOA 3HI9A 4DS4A 4FBUA 3BSAA 4KJIA 1TV6A 3GIIA 3I0SB 1FDDA 2V8VA 5B09A 3QO9A 4J9RA 3PR4A 2FJWA 3M2RB 4OX9F 6FD1A 5HQ8A 3CMAS 5I3UA 4RUHA 1XERA 1HWKA 2FJDB 4Y65A 4C3MA 1OSDA 2WHOA 2LXUA 4C9DA 3B8HA 4ZHRA 3L7OA 4MAKA 3ITHB 2LXFA 2BQ3A 4FPRA 2QYCA 3HVTB 3M8RA 2BYCA 3CCWA 1NO8A 2BANA 3GIMA 4URQU 3DLEA 3ONQA 3KLIB 2KI2A 3UE2A 2MGZB 1FKPA 2ZBIA 2XLJA 1TK0A 2PA3A 4ZCLA 4UY8T 5KOWA 5HLFA 2K1RA 3JTPA 1L5UA 2DNPA 2UUTA 1O0PA 4QWCA 4HT5A 3TANA 1SH2A 1S48A 2OD6A 2OSQA 3MECA 2D3OR 4RNOA 4NA3A 2M7SA 4KHRA 3NCPA 5K8OA 1NJXA 1VI7A 1U2FA 2DIVA 3B78A 4AXIA 5EWGA 4WCEQ 2DNMA 1H2UX 1X4GA 2CQCA 1OQ6A 2DO4A 1EETB 2G1DA 2YWHA 2PI4A 1FTCA 5KFEA 4IH7A 4F4XA 2WTFA 4OZLA 3CD6S 4MK8A 5B0EA 4H4MA 3K8WA 4FS1A 2R9LA 4NZ6A 2OTLS 2QZ8A 3PW0A 1VLYA 2OPPB 3DI6A 4ZKAA 4X64F 3AH6A 3BGRB 2F7VA 5JXSA 5GADI 2CQGA 3FQLA 4YR3A 1TKDA 1RT4B 2HVZA 1X4BA 3G6ES 2J9DE 4DFJA 4H4OA 4U7CA 4X4PA 3PZPA 4JV2A 4EZ9A 3O1LA 1FVQA 4WE1B 3KHLA 5KG3A 2QLWA 3MMAB 1XTZA 2ACYA 2XI3A 4Q2MA 1T8EA 1C1BA 5KFWA 4QWEA 2MJUA 1TKZA 4K59A 2J7WA 2GX8A 2JSXA 2DHSA 5CXTA 3IRWP 4DF8A 1DFDA 1X4AA 4F4KA 2M8DB 2XS2A 3RB0A 2ASDA 3S7RA 2N3LA 3GYNA 1KLMB 2DHAA 2GO8A 4TY8B 3C2PA 1Z4UA 3GFYA 3VAJA 3HZGA 2QLXA 3LP1B 5C25A 3UNGC 3U7JA 4DG1B 1M5PC 1HQUB 1XR7A 2YKNB 2AYBA 1CG2A 4EWTA 1RTDA 2BM1A 2EW9A 1EP4B 2WAQD 1JLQA 1N0UA 1Q7LB 4TNOA 5E3QA 3KG0A 4HHJA 4KO0A 3HVWA 1GX5A 5EGYA 2R2UA 2OH2A 4NZ7A 7FD1A 5KG2A 1N34F 3DHWC 4DWIA 1RQ0A 4WYWA 3NWGA 1V9OA 2FHJD 2R2RA 3HF5A 1VC0A 4U7UK 2OD4A 4JBCA 5M2PA 1RTIA 4YMEA 4MKYA 1IN0A 2G0CA 1JNRB 5CA5A 5AXMA 3CT9A 3TVKA 1NK4A 4HH0A 2YH0A 5HP1A 1H6KX 2KYZA 2PA8D 2QO3A 4O3NA 1F5CA 3HHEA 2QMWA 2RD5C 3ZZ0A 2HHQA 3NMAA 2RQKA 4K5SA 2D1CA 5DGBA 2MZSA 1HARA 1ROFA 2BE2B 1Z1ZA 3TARA 2OSRA 1RT6A 4NLYA 4HVZA 3OLBA 1I94F 4B9MA 2DJWA 3L09A 2GGPB 1TKTA 2B56A 2LKZA 3C8YA 1TP7A 2DNLA 3OVAA 2ABYA 3BSCA 5F8GA 3CVKA 4DLEA 2IC3B 2DGQA 2VODA 4PKDB 4EBDA 3LWMA 1SC6A 1UMJA 2CPHA 4Y2AA 4EGLA 2DR7A 2YNFA 3POTA 1RT1B 3VTIA 3RZAA 2ZOGA 4TY9A 1DTTB 2HS0A 1V3SA 5T7LB 4K4WA 2Z2MA 1JKHA 3LP1A 3LGMA 3PJXA 5KT5A 3Q2TC 4USIA 5C25B 5DQIA 4ERDA 4OZ0A 4UUXA 4LF8F 1UVKA 3T1AA 2ROGA 1S0MA 4K4ZA 2ZZNA 1LW0A 4J9LA 1JLGB 4RW7B 2YX7A 4QZVB 4KHPF 2GO9A 1X5SA 4DV4F 4IQXA 4OJGA 2J0XA 1Y9OA 2C2RA 5IQQA 2VFTA 2BV3A 2DGTA 1KONA 2OPPA 4NWBA 2IYIA 3TA2A 3HT3A 2HQIA 3FRZA 1KVJA 2R7SA 2IA0A 3BSOA 1D3WA 1P9QC 1E6VB 1S79A 4IFYB 4PXEA 1SJQA 4WF9Q 2KZMA 1R8CA 3G86A 2V94A 3HK2A 1VQ9S 2QA2A 2XMMA 1TL1A 2JOQA