2QLWA

Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
GDMTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTRPKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords RhaU
publication title RhaU of Rhizobium leguminosarum is a rhamnose mutarotase.
pubmed doi rcsb
source organism Rhizobium leguminosarum bv. trifolii
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qlwA01
1FE4A 1TL4A 1YJRA 3BB5A 2OFGX 1Y9OA 1N5QA 3BGUA 2IFXA 2IYIA 2LQBA 3HHLA 4Y2KA 2XMVA 3TRGA 5B08A 1YRXA 4OJ1A 1U7LA 3FGVA 2FIUA 1ULRA 1S6OA 2QLXA 3BM7A 4U9RA 2RSQA 3DXSX 1AW0A 1MWZA 3UDCA 1OQ6A 2QYCA 3HF5A 3TNVA 5B0DA 3QMQA 3BDEA 2XMUA 5B0AA 1VQSA 2N7YA 2QLWA 2HQIA 1YJUA 1FD8A 1Y3JA 2G9OA 2K1RB 4DN9A 1TUVA 1Y0HA 4NPOA 1Q53A 1YJTA 1X7VA 1N5SA 2JDJA 2LXFA 2HFOA 3DCAA 2PGCA 1Q4RA 1GXTA 2KT3A 1AFIA 3GZ7A 3I9ZA 1FEEA 1APSA 2W4DA 4OIXA 4DL0C 2RU9A 4FNIA 1URRA 2K7JA 2ROEA 3E8OA 2HFNA 2FB0A 4QOTA 3CJKB 2N4CA 1OQ3A 1R6YA 1YJVA 2BJEA 3KNGA 3F44A 1RJJA 1X8DA 2LQ9A 3IWXA 4ZOSA 5F0WA 2IYGA 1P6TA 4Y2MA 4F67A 4Y2IA 1LQ9A 1OSDA 5B0FA 4A47A 2OFHX 2N4DA 2LDIA 1FVQA 1FESA 2OMOA 2AJ1A 2GFFA 3IWLA 3FRYA 2VH7A 3T9NA 2FHMA 1SB6A 2Q3PA 1JK9B 3VTIA 4A48A 1V3ZA 2HLUA 5A6WA 2XMJA 2FTRA 4YEAA 4OJGA 1CPZA 5B0CA 1MWYA 5F0UA 2ZDPA 2KT2A 3HFKA 2K1RA 2VV5A 2OD6A 3BF4A 2XMTA 4HH0A 4A4JA 2CRLA 5B0BA 2K7KA 2W4PA 5A6PA 1K0VA 5B09A 4ZA1A 3HX9A 5K9FA 2XMKA 4OJHA 2AP6A 1OPZA 2GGPB 3KG1A 1N5VA 2EW9A 2HIQA 5B0GA 1KQKA 2OD4A 3CJKA 1S6UA 2OKQA 1QUPA 1P8GA 1SI9A 2PD1A 2XMMA 4Q2MA 2OP5A 1YG0A 1KVIA 3HHLC 3LGNA 2GO8A 1N5TA 4HL9A 1FE0A 1AFJA 2K2PA 4NL5A 1GXUA 1Q8BA 3LO3A 3MCSA 3TOQA 3KKFA 3QGPA 1Q8LA 2RMLA 4EFAC 1FVSA 2XMWA 3KG0A 1Y3KA 1VQYA 4OJ3A 1X0PA 1CC8A 3BR8A 4Q2LA 1JWWA 1W2IA 2W4CA 3FMBA 4A46A 2BJDA 2L3MA 4HI2A 2ACYA 5T7LB 2HLTA 3K7RA 5KAKA 3HDSA 2KYZA 3HHLD 2ROGA 1SQEA 2AJ0A 2GCFA 1TZ0A 3WDOA 2BUNA 2OAUA 2ASYA 1XBWA 5T7LA 2RILA 1TL5A 3MZIA 2ZDOA 3BN7A 4HI1A 4HH1A 1KVJA 1IUJA 1TR0A 2BBEA 2KKHA 2QIFA 4YDXA 3LGMA 4DPOA 2AW0A 1CC7A 3HHLB 4FNHA 5B0EA 2GA7A 2BYCA 2ROPA 1WD6A 2GV1A 5IXUA 2GGPA
chains in the Genus database with same CATH superfamily
4ZIWA 4RW9A 4EYHB 1BWVA 2E5JA 1YZ7A 2FZGB 1IKWA 3TZYA 3DYAB 2MQMA 2POKA 5DM6Q 3QWPA 4NRUA 2GHWA 3CCJS 3Q89A 4YDDB 3E01A 5ETOA 4YB7A 4QOTA 1EX8A 3IWXA 3HPOA 1FNOA 3W2VB 3BH7B 2AD9A 1Q8IA 3VR1A 4CIOA 4JI0J 1N32J 1SJ1A 5CABA 4J7CA 4USKA 3KLEA 2CQ2A 2LMIA 2EXUA 3SFUA 5J1EA 1TAQA 4ZA1A 3ILLA 2HRTA 4M5HA 3JQKA 2WONB 4FYWB 2P8IA 3MTKA 4NOHA 2R8GA 3A13A 3HVTA 2VQFF 3DFEA 3MM8B 1WSVA 3KDNA 4B9MA 1OYDA 4YN3B 2DB1A 5IM0A 4L3KA 2Z57B 3C15B 4B02A 1QLNA 2DH9A 5LMNJ 2H65B 2V2QA 1WF2A 1RLDA 1S7HA 2BV3A 5HN0A 3KK2B 3UPFA 2VF3A 1F9EB 3R6GB 2IY5B 5F8LA 1R8BA 2DT9A 4L72B 5ADZA 2HHXA 3MPYA 3IBFB 5KG3A 4DR2F 3EJMA 1U6BA 4PG4A 3EX7B 2Q1LA 4L3NA 5K14A 1N34J 2QA4G 1FA0A 3FUYA 2XC9A 3KK1A 2FVQA 2DITA 4LFBF 1YJWS 2B9YA 3O3LA 3OFGA 1SV5A 3H59A 3UN3A 1HIYA 1P8GA 5C42A 5IV3A 5D77A 5ETNA 3C66A 1VQ5S 2C2NA 1JLCA 4NYZA 2XI2A 4ZPVR 5RUBA 2KYZA 2DGOA 2I6WA 1Y5LB 3EMTA 3QIDA 1RAGB 2RQMA 3E3XA 1PJ7A 1JMTA 3FEYB 4USIA 3I9V9 2XSJB 1SC4B 3BYPA 3PJWA 3TZWA 3AXKA 3KMSA 5JXSA 2FHKA 4I4BA 2DNZA 2YNHB 1OQ6A 2CADA 2ZH7A 2KHCA 2G1DA 3N6NA 2HGLA 1TUVA 2BEFA 2EFPA 2CQ1A 1O0PA 4ZHRB 2VODA 2AJQA 5ETTA 4F26A 3CD5A 2KJVA 1LEOA 3V4IB 3CJ0A 8ATCB 2Y0SD 2CJBA 3V5RA 1EARA 3MM6B 4KFBB 4WBFA 1RHUB 2KYXA 4JI2F 1F60B 4LVNP 1J2VA 1MMNA 1GTEA 4LIWA 3QGIA 2ADBA 1OY6A 2XS5A 2WVCA 2KRBA 4NYOA 1WKJA 1GXUA 2VG6A 2F5GA 3TUJC 2XHCA 4U7UD 4A8YA 4C8KA 4F50A 1KD1T 2NREA 3KJVA 4D3HA 5C24A 2J0QD 2WB1D 1CC7A 5ITHA 4PQAA 3KHGA 3NNAA 1UA1A 2ACMA 2AJ2A 3HHLA 2ILYA 2C3OA 1D09B 4LF7F 1PGZA 3F73A 4F04B 4EWTA 4OX6A 3G8QA 3PACA 1MSWD 1DLOB 4ES1A 3I55S 2OTLS 5DZ6A 4UW2A 4LFAJ 3THVA 1RTDA 4JI3J 3QPIA 1FWKA 1IBKJ 3KYLA 1IQZA 1FF2A 4QIGA 5DZ7A 3T1AA 4DMZA 2HLUA 3PEHA 2FTRA 4RUAA 3W2VA 4ELVA 3NGSA 2B6AA 5FDLB 5AXKA 4KIAA 3HX9A 1PJ6A 2R8KA 3OTCA 4MFBA 2CJYB 5D0EA 3ZZ0A 4FBTA 1RSCA 2B51A 2QTWA 2CPEA 1FK9A 3TVZA 4PXBA 4YR0A 1FT8A 3KLIB 2OAUA 3MFIA 4QWCA 2UXBF 1S0MA 3DOKA 2ASDA 4DFJA 5HJYA 4O4GA 3BKFA 3KLFB 1KQFB 2E5LJ 1U26A 2C22A 2QSFA 1WC3A 2F4VF 2KDOA 2XY6A 3IFEA 4MKVA 5KFGA 2CPIA 3MDFA 5A8RA 4K4WA 3CJ8A 1T03B 4U95A 1EIYB 4DV5J 2HSEB 4DZ6A 3MMJA 2CZVC 1R3NA 1J5OB 1R0AB 5DG9A 3T5KA 1JXVA 1LFWA 5KG2A 1DQ9A 4RNMA 2NXJA 3TI0A 2H4WB 3VGSA 2DYAA 1WC0A 4B3OA 5C7PA 5GADU 2UUCF 4CNYA 1XERA 4QWEA 4KV8B 1H3DA 4PYDA 1N5YA 1T9WA 2EFQA 1EKRA 2RS8A 2CYYA 1VQYA 1VISA 4OJ3A 3FQLA 3QRPA 4Q43A 1HNWF 2GCFA 3CJ4A 4ED3A 4XO0A 2P6SA 3I0SA 3LGMA 5D4PA 4FPRA 2J0SD 2OSRA 3AB2B 3PW7A 2PI4A 2K8GA 3IP0A 2FLOA 2XSJA 3MM7B 3LTOA 1AUDA 4BLGA 1IBCB 3BDEA 4WFAQ 2VQFJ 2FVCA 1SL1A 4ILLA 4CO4A 4ZCMA 4IG0B 2DRBA 2Y1IA 3WX4A 2HFNA 1RHRB 4HTIA 4DS4A 2ADCA 3MMAA 1CPZA 2DCUB 1YQHA 2F4FA 2BZ2A 3AOAA 1NHKL 1GT8A 3T19A 3HULA 5EWEA 1FWPA 2GS8A 5A0YA 4Q2MA 4DR2J 1TTHB 2HHQA 1X4BA 2IDLA 5A76A 1K8AT 3OVBA 2DGQA 1RABB 1S9EB 1S6PB 3DRXA 2UUWA 3K5LA 4M5DB 3NS6A 4AT1B 1FDBA 2X1FA 3DLEA 5IC6B 2LQBA 1S57A 2XMVA 1NK4A 4J9KA 1Q8KA 1R7IA 3VAFA 1P9YA 4WKRA 4M8LA 1T05B 2DH7A 3OFEA 1KLNA 3B54A 2GC8A 1JLGA 3DMJB 2CZ4A 3QZ7A 3SSQA 3P5BP 1RE1B 4CRJA 2MZTA 2D3ZA 4MIBA 3TJ9A 1XK8A 5L1IA 4ZKAA 4QPTA 4OZ0A 4URGA 1DFDA 2ZBIA 2AT1B 3OBIA 3JAMU 5K5MA 3JYTB 3B82A 1P9QC 4MK7A 3V2UC 4ZPCA 3CJKA 2MQOA 2AMCB 4LIRA 1U1QA 4K50A 4QWBA 3PIOQ 3CC4S 1TFWA 1SBRA 1IBLF 4PPZA 3R7NB 4Q7AA 3EXCX 4HI1A 3DI6B 2D74B 4JI2J 5BR8F 1CQNA 3OFHA 5KT4A 4R0JA 3O5TB 4MT1A 1ZTTA 5LOQA 4IO1A 1PG5B 5HVHA 4U9RA 1SPBP 1FJCA 3KFWX 4CO3A 4PKDB 1TVRA 3IM9A 3OVAA 3ZTOA 1Q7LB 4JI6J 5HATA 1BUXA 3CCTA 4XAKA 4ALZA 1RJJA 3R1LA 1X8DA 4IDKA 2MJNA 2L9NA 1IXKA 3TQ1A 2V67A 2EFOA 4RZRA 4TU7A 1AZSB 4ID5A 2AGQA 2FHOB 2FJVA 5DQGA 4H4KA 5GAHI 1TKDA 5E5NA 4A4JA 5BXIA 1S76D 1Q86T 4DG1B 2UU9F 2JL9A 3HSDA 3VCDA 3VF0B 1ZM2A 2AWZA 1S9FA 4KV8A 1PAEX 1FDDA 4EMDA 2DNRA 3W63A 5G0RB 3CDBA 2CQGA 4KY3A 5LM7E 3DLLQ 2EFVA 4F2SA 1SQFA 5J1PA 5IWAF 3VAJA 3RAXA 3CE8A 4Y0FA 1U49A 4WP3A 2YPYA 4OZ5A 4X66F 3VAKA 2H51B 4P2FA 1SJFA 5B08A 1B64A 2QLXA 1F1BB 3IS9A 4NCAA 2PT0A 3CCVS 5GVQA 2QV6A 1MW7A 2JDJA 4N7TA 3G96A 1QAXA 3HJFA 2Z8QA 2UXBJ 3QSYB 4KGXB 4QYZJ 2J9EA 3VTIA 2EK6A 2E1MC 1U8SA 2HHPA 3M9OB 1F9HA 3OL8A 2VQEF 4NX9A 2F4VJ 1LKZA 2JEIA 3LO3A 3JSMA 3Q8UA 2DNMA 4ELTA 2RKIB 4F4ZA 2DXDA 4FP9A 1TZ0A 1GMWD 4JI8F 2NR0A 5CZXA 3S1TA 4DXLA 4OI0A 1VK8A 3CCMS 1PBAA 4LF5F 2M4MA 2IM3A 1TKTB 4C0BA 2UUCJ 5CA5A 3Q2TC 2YWFA 2K3KA 4LF6J 1TQLA 3HP6A 4F4AA 4UT4A 2GIQA 4CLSA 5AE2A 1U1KA 3P49B 4IG3A 1HNWJ 4CLWA 4I1TA 2ZE2B 3M2RA 2A18A 3AA9A 2ASLA 4RO0A 2VOPA 1V9OA 3MAAA 4PQUB 4DQQA 4Y6IA 3T9NA 5D0HA 2FHMA 1H2TZ 3HHNB 2D9PA 2E1RA 1WSRA 1NPKA 1NHVA 2FLPA 1NH8A 1R8PA 4WFNQ 2RNEA 5D0RA 1N6QB 3JYTA 5A8KB 3FZBA 5K8NA 2GVZA 3K7RA 1HD0A 2U2FA 1C4AA 2J9CA 2M88A 3R9LA 2WW4A 1UVIA 5EGYA 2FGOA 2GV1A 2D9OA 4LRCA 3M8WA 4OMFG 5HMYA 5AE1A 3VV2B 5IC4B 1ZPWX 1ZAVA 2I8EA 3AODA 2NXNA 4O3SA 4FF4A 4RNHA 2RE1A 4WYLA 4LBIA 4USHA 1C1CB 2DGSA 1HYSA 1TKZB 1Y11A 2EVZA 4FNIA 4DN0A 2HPUA 1N56A 3PFEA 4KGVB 3CD6S 3C14B 1KTQA 2PFFB 1HBMA 2W9BB 3BO4A 1R0CB 2OMOA 5EX0A 3BBFA 4AL6A 3M8RA 4HVZA 2JJ4D 2I1RA 2VPZB 2J76E 2CRLA 1NKEA 2A6OA 1FJEB 3W2WB 3AJ2A 1N5VA 2OSQA 2ZBQA 1L3KA 1LW0A 4NZ7A 2MHEA 5ETPA 3GFZA 1Y5IB 1UJ5A 9ATCB 2PE8A 4AYBD 2DNLA 1M1GA 3QJPA 2IM1A 2Z2YB 3OUYA 2JOQA 2R7SA 4QYRA 4IO9Q 2VUGA 1RZMA 3IAM9 4X4VA 5G0RA 5DGBA 4WK3A 4YDXA 3SV4A 4QR0A 3QBCA 2D3O1 1CEZA 1GX5A 1RAHB 1RISA 4FN5A 2BKPA 3UDEA 4JI7J 2ZUGA 1IKVA 1K47A 2W24A 1P1TA 2G0JA 5KFHA 2QJ3A 5KOWA 5DDQC 2GZOA 3KUGA 2VKRA 3PYDA 1JQGA 3SMZA 1TELA 1IBLJ 3RB6A 4FXVA 3GYGA 4DL3A 4A47A 4X64F 1LOUA 4DV4F 1FESA 3OR1B 2BA9A 2N3LA 2RF2B 4EI2A 2CNLB 3K5PA 1CULB 5KFRA 4AXIA 2MQNA 1Q95G 4AD6A 2KO1A 2XWXA 4DX7A 2HIQA 2C2EA 2I2YA 4TVAB 3UVJB 2KFYA 2EK1A 3U1LA 1S5ZA 1Q8LA 1JWWA 1RADB 3OTEA 4F8RA 3B78A 4OYIA 4ZIVA 1XIQA 1HHQA 1UFLA 4UOFA 3A3NB 5GAEU 3VAIA 2OI2A 4YUDA 3UDVA 1O6XA 1B99A 2AIRB 3D0HE 4IRDA 1XMBA 4ZPAA 3TRGA 1XR5A 2IVYA 2B0GA 1U7LA 4L6V3 1FJGJ 2QT7A 3QGGA 3LWMA 1TKTA 2DVIA 1T3OA 1SJQA 1U6ZA 2VPXB 2AYMA 4K5SA 3BSOA 2W7OA 2E1PA 2M3DA 3DM2A 2FB0A 1SUQB 3IR5B 1OQ3A 1UVLA 5HANA 5ETVA 2LEPA 5IWAJ 2VASA 4ECZA 3QFWA 3KHHA 4XK8C 2ZE2A 5E3PA 2BJ9A 4NLRA 2HGNA 4X66J 1AUSL 1NMEB 3QO9B 1X5TA 3ONQA 2BJ8A 2DHHA 5HROB 2L41A 2GQ2A 4WF9Q 3NL0A 4NLGA 3PRDA 2GW8A 3TUPA 2K3IA 4RUHA 3ZZRA 1CVJA 4KYZA 3HSGA 3PY8A 1HI1A 3CJ3A 3WDOA 2J7WA 4PXCA 2E9TA 2B5JA 4F4XA 4U96A 2BBEA 2DCLA 1KWMA 1WD6A 2ZEJA 4ID8A 4ZVUB 4HTJA 2VQEJ 4U7CA 3DU5A 4PG8A 3MM5B 4WIQA 4HDGA 2DD8S 2F7VA 3UWTA 1RTJA 2MZJA 4JI8J 4X84A 1E6VB 5L9XA 1TKZA 1MROB 1JKHA 4WE1A 3PIPQ 2IRYA 4N77A 2A6MA 2I5JB 4KKOB 3RB4A 4XTTA 2VV5A 3VGTA 5F8HA 3FZ2A 2ZZMA 3J81Y 1Q7YT 4DR1F 4DCJB 2W7AA 2YVSA 2ZM6F 4EEYA 1SC3B 1U1PA 4MYUA 3KG0A 1VC6A 1TU0B 1W25A 3GJQB 1T7PA 2YH0A 1B0VA 1EP4B 2YY3A 3Q8PB 2W1BA 3R5CA 5IT9U 4CDIA 3W5XA 2W8LA 3M8QA 4LR9A 3CNQP 3NXZA 3RW6A 3H25A 2HNYA 2V9KA 3G8SA 4ED1A 4OZLA 5KFTA 4JI4J 3KG4A 2ZFHA 5J2NA 3H5XA 1VRTB 2RQKA 2AV5A 2XO7A 3BGRA 5AE3A 3RBDA 2M8DB 2OPSA 2NQPA 2YX1A 3CUNA 1CS4A 3OD2A 1YJVA 3FCVA 2Y1JA 1TUGB 4H54A 4FYVB 2VH7A 2N7CA 4TYBA 4CI0B 3AJ1A 2QLFB 3T3FA 3GIRA 3PX6A 2IJRA 4RW8A 4CT9A 2GJFA 5U47A 1K0VA 1ROFA 1CULA 4DL5A 3T41A 4DUZJ 4DSKA 2DGWA 1F2HA 3D3CJ 2H1YA 4CO5A 3WZ0A 3M4XA 4IKAA 5KFSA 5H9FK 3Q23A 3BN7A 5CYMB 2XZWA 2JNJA 3GSDA 3SQOP 4NLYA 4PRFA 1IWAA 1SL0A 3ENVA 2XEXA 1REVA 1OY9A 4JYAF 2BANB 3ZFVA 1M5OC 3CIZA 2G2ZA 3M32B 3THPA 1VLYA 4AL7A 2HQDA 2CUYA 4B9LA 3VZIA 4CP5A 1S1TB 2HG4A 3SQGB 1UWBA 1T9XA 2KRRA 1VQOS 1R6YA 5J2PB 4B3MF 1FI4A 1EETB 3MM9B 1SUQA 5ETQA 1WHVA 5EN1A 3KUHA 4ES2A 1HQUB 2B8PA 5F3TA 4RX6A 3G2XA 2C42A 4OX8A 3S01A 3MXHP 4OI1A 1QM9A 4NA1A 2BW2A 3NGTA 2HVIA 2MQLA 3BO3A 4ZVHA 4P7TA 2YXLA 3LP1B 2P9EA 4LSNB 1GXLA 1RYRA 5HROA 4LQ3A 1QSSA 2FVPA 3N4WA 4NI2B 1KR4A 4NA2A 4YQWA 3MUMP 4LF9F 2EWHA 3TR5A 3ZZOA 5E0OA 2P6TA 4X64J 4JI1F 3HT0A 3FBFA 3QGHA 2VG7A 3OXFA 3C3LA 2B4VA 1RBOB 2OELA 2DR6A 2FIUA 1YJNS 1VBKA 3DOMB 3MM5A 4NLVA 2AJFE 2PDAA 5HO4A 2VB6A 5E33A 2V68A 2EFGA 3TW0A 1KKHA 4C3KA 4DL7A 5F0WA 3G8TA 4CQ1A 4Y2IA 3ETMA 2HMIA 1H0HB 2J5AA 4ILMA 3A8EA 1T9YA 5B0CA 2X1AA 2K1RA 4CLZA 1AXQA 1HQ2A 3MPVA 2A2CA 4DX5A 4A8MP 5B09A 1AT1B 1C4CA 3KJNB 3UD5A 1RP5A 1FRMA 1FXDA 1UZHA 2AYEA 1S1VA 4M5IA 2DNGA 2AYGA 4DSJA 1WDDA 3W65A 4USUA 1GFWB 2FJWA 3W64A 1HW8A 2I38A 3R97A 2E9RX 1KHWA 1TL7A 1VQPS 2DPJA 2IC3A 3BM7A 1RT6A 3DDIA 1REGX 2V2ZA 4TLQA 1LWFB 2CJKA 4WIIA 5KOXA 4PZVA 4ZP8A 2PMWA 2J8SA 4FXDA 1VBZA 4C11B 2FJBB 1QUVA 2BKNA 5L1KA 2ZDPA 2R7TA 2MLXA 1RACB 3RBEA 4AL5A 2XULA 3DLHA 1U1LA 2F8HA 1V3RA 2OD4A 5IOLA 1EB0A 3TAQA 1EQ0A 4DPTA 1FKPB 2UVUA 4UOCA 2F65A 3AFGA 1RT1B 2FJEB 1Q82T 3ETOA 3HCXA 3LWLA 5H1SV 4ZP7A 2AYBA 1UVKA 1JLFB 1XEZA 1A7GE 3QZ8A 4LRDA 4DR3F 2MEWA 3NY0A 4EYIB 1JLQB 2F9JA 2RB7A 2W9CA 4WTOB 5GMDA 2ZBRA 4DR1J 2MY8A 5HBMA 2CPHA 2J6SA 2ZH1A 2HQIA 1PYOB 2AHOB 2V8GA 5LJ5Y 3FKBA 3TYTA 3OLBA 1WI8A 2V50A 3VGVA 3H98A 2R7QA 3MR2A 4OX9J 3MTJA 3HI9A 1CJVA 2GX8A 2XS2A 3ADAC 5DJBA 1KOOA 3T5JA 3DOLB 1DBDA 3MM9A 4OZ2A 1QAJA 3DRPB 4LF8F 5E7OB 4BHQA 2BOPA 2V94A 1SQGA 4Z37A 4ECQA 5JJBA 2UP1A 3X3UA 1RT2A 4Q0BA 2OKQA 3GFYA 2W2NP 1ZH5A 2M9KA 2YX4A 2V8DA 2UXCJ 3GQCA 3JS9A 2MY7A 1N4LA 4JI5F 4MK9A 5D4NA 4HI2A 1ZS6A 3DRSA 2H4YB 4ED0A 4OZ1A 1YI2S 1ZZNA 1FERA 1D0EA 1OY8A 4H4OB 2YWWA 2ZJRQ 4UZBA 4WZQA 4PUOA 1RWUA 4DOZA 1VBXA 4ECWA 2IFXA 3UD4P 4KH1B 1XR7A 4ZN1A 2NYIA 1IQTA 4W98A 3POTB 3I6PA 3UD3P 1ZETA 1N36J 3LH2S 3ZC4A 2QLWA 5K20B 1S6QB 3MPWA 2AGOA 2P9GA 1RWNB 3A12A 1SJ3P 3K5MA 1CLFA 1SC6A 3IG1B 1MMDA 2ZHOA 1Q78A 3GPAA 3MR6A 3EYZA 1EJ7L 3B8HA 3TANA 4RU9A 4X4UA 1MG7A 4K2JA 1IR1A 2J6TA 3JSYA 4KH0B 3BF4A 2MZSA 2ZD1A 5A8WB 2HRUA 2VBYA 3MR3A 3R5JB 5HJXA 5DM7Q 3IC1A 1KVIA 2MQ8A 4CH1A 4ZN3A 4K4YA 4C8LA 4DV1F 2YWHA 3UNGC 2IAJA 3PV8A 1KOHA 3MF5A 2HBRB 2QMXA 2EKNA 1VQNS 3Q8RB 4ZLLA 1M1KT 1TKXA 4U7UK 1D9DA 3BB5A 1VQ6S 3TZXA 1S0VA 3I5BA 2YWGA 2XYPB 4C7QA 3TARA 4ZVTB 1NB2A 2VOOA 2RRBA 2L9WA 1BGXT 4I6AA 2LKZA 3PCOB 3BV8A 4DFPA 3D6HB 1RT5A 1F3FA 4NCGA 3G87A 2GMJA 2KU7A 2WCXA 4IRKA 4URSA 2O01C 3TAPA 3W8GA 3N5BA 4ANEA 1U0SA 1VDHA 2C2KB 1URNA 3KLGB 4ITSA 1DTQA 3ZZZA 4QIFA 1IN0A 2H3EB 2IMOA 3ET6A 4LQ9A 3RTVA 2ALZA 1C1BB 5KFCA 3MURP 1SL2A 1OJ4A 1YSJA 2L08A 4IR1A 5DETA 2JVOA 1UL3A 1JLAA 3CCZA 1KONA 3GYXB 1NJXA 3UDCA 2MJUA 3OXGA 3QMQA 3W60A 1UKUA 3O8WA 5I42A 3H4BA 1N5SA 1RWOB 2E7XA 2W9AA 2CPJA 2HQ3A 4DPWA 3OL7A 3RBZA 1S9GB 4NASA 3NMRA 3CMAS 1RHMB 2CVEA 5LSRA 2GFFA 4EBEA 3N9UC 3ZO7A 2DIVA 2KHDA 4F4WA 3PEJA 1LWXA 2AZ1A 4X65F 3NS5A 4CLKA 3JB9k 4PWDB 2DHXA 4HH0A 3UNYA 1BQMA 1F5CA 3NNCA 3UI3A 2XQCA 3OL9A 3HJVA 4C8NA 1N48A 1BXNA 4RW7B 2WOMB 1DAXA 1RT7B 2HNDB 4MJKA 4Z7CA 3DDNA 2Q79A 4IOAQ 1S4EA 4ECYA 4FF2A 2OO4A 3FFIB 2GIFA 5IFMA 3L95X 3PKMA 1D8YA 3GR1A 1HBUB 4M5LA 2E5HA 3UW1A 4U6PA 2V9WA 4H4OA 1DRZA 3BBCA 4DFKA 2MKJA 3JTOA 1OSCA 5K8MA 3M05A 4R5PA 4TQSA 2QA2A 4ZS6A 2G1HA 2IDEA 5F8IA 1TL3B 3PRBA 3FRZA 1VRUB 2XZDB 3TX8A 2F9DA 4J9RA 2EC2A 4OX7A 3ISZA 4DR3J 2CAJA 1UWAA 4KO0B 1SCJB 3VQSA 3HFKA 5DG7A 2JRSA 2XMTA 2G4BA 2HWIA 2C3PA 2CQIA 3LP2B 2Q43A 5ETSA 2GGPB 4Q45A 1NZ8A 2DY9A 3HHLC 3ZXWA 2UUBF 2BQUA 3PJ9A 4CM2A 5KAKA 2D41A 1LWCB 2DR9A 5LJ3Y 3PNIA 3CCQS 2NXUA 5C2CA 4UY85 4LF8J 3J81U 4C3LA 2D69A 1R8AA 4LRAA 1ZM3A 3VAMA 3EGNA 4OHXA 3W7BA 1ULRA 1QE1B 3K5OA 2CQHA 4O0NA 2XMUA 1L3SA 1A9NB 3QT8A 3BSAA 5KFVA 3CJ5A 4DV3F 4JI5J 4N56A 3D9BA 1NDKA 3N01A 1XTZA 4PG7A 3T9ZA 1YRTA 2C2MB 2LQ9A 1EHWA 5C2GA 3M2VA 1F0XA 5G4DA 2KM8C 3KHLA 5HP1B 2W2QP 4JV5F 4OI3A 1WTBA 5CD4A 1XC9A 4ZCKA 4O3QA 4OJHA 2WHOA 3Q86A 4TY8B 1U02A 4OYMA 1GNKA 4RW9B 3C6TB 1VQLS 1RI7A 4EFAC 4JV0A 1B0PA 4CLUA 3BR8A 1NK9A 1IKWB 1I94J 2WBRA 4P2XA 4A8FA 2G0CA 5M2RA 5CYJA 2DEJA 4B9VA 3G82A 2HKEA 2X7IA 2HVZA 1HWIA 3BZQA 4J9LA 3HHDA 3E01B 4R8UA 2ZH6A 2MMYA 4X4TA 3R7BB 1FE4A 2MYFA 1U2FA 2DKOB 3C46A 1QJHA 2B4PA 4K5RA 3MWBA 2XM3A 4NLXA 4K8RA 3KUEA 1UPMB 3D3BJ 3KLEB 4DV1J 5J1EB 2ZHBA 3UDLA 2B9WA 1X31C 2Z2ZA 3J7YU 1KC8T 3TJ8A 1URRA 3EICA 2XMAA 1WHXA 5GMKa 1KLMB 4KBIA 4O0IA 4X4NA 1S9GA 1VFJA 5A6WA 4KTQA 4DR7J 2MSTA 2UXDF 4KHPF 2LXUA 4Y28C 2HBYB 4CZCA 3TEGA 4FYYB 1D1UA 3EWGA 3ITHA 1TMMA 2BR0A 1RWPB 2ZVSA 3HD2A 4UF4A 3BS9A 2M5YA 2Z0GA 3G4SS 4P2MA 4MYTA 1MLAA 5F9LA 4FVMA 2WVFA 1CJTB 4A8WA 4DS5A 1S1WA 5K14B 2ZKTA 1KQGB 2CWKA 1QTNB 3FDSA 3CO9A 3KK1B 2M0GB 3J80U 2N7YA 3EGWB 1HWLA 1TV6A 2KB2A 1SV5B 3GZ7A 4ICLA 3R2DJ 2Y8WA 2DO0A 1XNQJ 3PYEA 1JLBA 1F2GA 5C42B 1NK8A 5L1JA 4YHHJ 4FYXB 1JLCB 1WELA 1UTAA 1J5EF 4C6AA 3C6UA 4I2QB 1V3ZA 1MN7A 5HQLA 1YTYA 2KT2A 4OV1A 4GKKJ 5T14A 2FYXA 2ABYA 4M5NA 2RD5C 4Y2CA 2QRRA 5SZTA 1MU2A 5J2QA 4J37A 1SI9A 1VQ8S 4RPFA 4DCOB 4NL5A 2KH9A 4I68A 4J9OA 2QL7B 4LF2A 4C2MA 5KFKA 3PR5B 2E5IA 3SXLA 3HO1A 1HBNA 2DIUA 1LWCA 2MPUA 1OO0B 2YNIB 3CDEA 3KMQA 3MCNA 4X65J 4J9QA 5KFMA 2CQ4A 1H98A 3EDQB 1TFYA 4WU3A 4OYWA 2BE2A 2V8VA 3GIIA 2MZRA 3HHKA 1IBMF 1KQSR 1IKYA 1NDCA 2H5EA 1UFWA 3QAEA 4IRCA 4ELUA 2KXHA 4QJVA 3BPDA 3IO1A 4NLUA 4P2SA 2QC3A 4ED6A 2W01A 5IT4A 1OMSA 4NZ6A 2VG6B 2OPRA 4P6QA 1NO8A 4CTAA 5FJ4A 2CDRB 1NPPA 3ENWA 3CD0A 2IRUA 2B3TB 2XNRA 2JLEA 3H7HB 2DR8A 1HL6A 3SI8A 4ZPBA 3KJVB 1S79A 1R89A 5C24B 4F3OA 2XLIA 1G4CA 3W66A 3QIPA 3M1VB 2QO3A 4GVBB 4IFVA 4ATNA 1NSPA 1Y10A 2HWTA 1C2PA 4NCBA 1Z2LA 3FMBA 3C6TA 2BJDA 2ROGA 5KFUA 4YMEA 3SCIE 2ZH5A 1NRKA 4QW8A 1RB0A 5KFLA 3GJTB 4NEZA 1RTDB 1KRPA 3ICLA 4AXJA 2RU3A 4WFXA 4XPCA 4WPAA 4YY3F 4J9UE 2PA3A 1VQ7S 2YKPA 2LQ5A 3FSYA 2UUBJ 3W5YA 2W8KA 2B6AB 4NPOA 4RNFA 1RCXB 2MKHA 3DGPA 3CCRS 3S6EA 3FSIA 1W2BR 4DL0C 1JLEA 4MFBB 4MTPA 3GG0A 3M30A 3R5GA 1TUWA 1FK9B 5LL6d 2RH3A 2KM8B 1KLMA 2XY5A 3FBCA 3W8PA 1TL1B 4IFYA 1NK7A 4LF1A 4QIEA 1BE4A 2VFSA 4NWBA 1UPPA 2DHSA 2QGFB 4GC6A 4DFMA 5DDPC 2BW7A 3DOKB 2ATLA 1H38A 3BQ1A 3GMGA 4O4GB 3AB4B 1Q1KA 4LFCF 4DV3J 4DSLA 2D1CA 2IPOB 2EG1A 4LMZA 2HLTA 3PW4A 3RW7A 1BD6A 3IXQA 4ZITA 4KJIA 4LBPA 4HKQA 4B9NA 4Z7YA 1JB0C 1E6YB 1X4GA 5A8RB 2Z30B 1IUJA 1HD1A 1O5JA 2VJUA 4C98A 3MHYA 1Y7PA 4ZJQA 4JV5J 4QU6A 3VALA 1HNXF 3PO4A 1CJTA 3CGIA 4USWA 4OJ1A 1VJWA 4L75A 1BQNA 3CJRA 3O6QA 2M7SA 2B7BB 4X4RA 5FLXU 1QAYA 4B3OB 3CC7S 2JLFA 2O1PA 1N5YB 5FIIA 5KG4A 1P27B 5BYQA 3NLCA 1HKAA 1OSDA 3H20A 2XBPA 3HXMA 3PRVA 4MH8A 2HK2A 1S12A 3MMBA 2AF6A 1K73T 4X62J 1NEEA 2VG5A 1T9VA 4I2QA 3I0SB 2LEBA 2Y8YA 4EO6A 2NS1B 3AT1B 2B4OA 3GR0A 1QVFR 1FDNA 3UCGA 4O3PA 4Y34A 2CJAA 4RUCA 1WTFA 4EO8A 2HFZA 5HAOA 2NZ4A 3N6LA 4OYZA 3I32A 1RT4B 1N52B 4PR6A 4I7FA 4RJVA 4DV7J 2UXDJ 4DF4A 2CPXA 2WVDA 2YNIA 4NLDA 5CHCB 1HI0P 4XIUA 5HVGA 1AW0A 1WG1A 3MMAB 1KBRA 1V5IB 4WXOA 1NKBA 4KPYA 1FEEA 2BMBA 3WC2A 3M8ZA 5A0YB 4KC5A 2ASJA 4IH6A 3CCUS 2DNHA 2ZH8A 4C8YA 3HVWA 3MEEA 3BPSP 4CH0S 3PJXA 2R7XA 2M52A 4WXWA 5ETRA 4LRFA 4ZJLA 4ERDA 4YR2A 4O23A 3DN9A 4DX6A 1UZDA 4ZVOB 3DLEB 2Q66A 3C16A 1I6JA 2I9SA 4MKYA 5AXMA 2H5JB 2NUUG 3W3SA 3M1VA 3TEHB 4BDPA 4GVBA 4NLQA 4CO0A 3OSNA 4CWBA 1U1MA 3HDSA 2NPIA 1ZA2B 4B3TF 3TA2A 4ED2A 1WG5A 2VC1A 2IBOA 2DNPA 1HWUA 1JLGB 2CJQA 2MQQA 1DJ0A 3D28A 2PC6A 4RBTA 1VI7A 3HZEA 2YH1A 4Y2KA 2BJ1A 3PZPA 1OYEA 1S6OA 5DLGA 1HHSA 4N47A 4WYWA 1N54B 1RHQB 4K4TA 5DGAA 1H73A 1X7VA 5D6GA 2J7UA 1LW2A 1HNVB 3CJKB 2G2OA 3E51A 4B3RF 4QYZK 4GO5X 2NSCA 3D67A 4N8NA 2DNQA 2G13A 2H5IB 2XTJP 2DR5A 1K0TA 1IBMJ 3P3DA 1S7IA 1TL1A 3LAMA 4D3GA 3M2UA 5SUHA 2QYGA 1OPZA 4I67A 2HFUA 2XI3A 2V69A 4HLBA 3EPIA 2RVJA 4UUXA 3D6FB 3SIPB 2KZMA 2UVWA 1TVRB 5GADI 2RIJA 2LP4A 2XCAA 5D3GA 1R8CA 5MAOA 5KT2A 2QIFA 2P9CA 2C2OB 5EDWA 1E6YA 1S1XA 4IDKB 1N5QA 5BYSA 4WJBA 3HM9A 1GMWA 3DXSX 2C3UA 1BY9A 3G6XA 1HLWA 4AQYF 4ID5B 2DXEA 3T5LA 2U1AA 1WHWA 4XDDA 1FD8A 2QLJB 2UUTA 4LRBA 1Y0HA 1YJTA 1YITS 3IWNC 1AFIA 5IT9Y 4LVOP 2VBZA 3HMJG 1RTZA 2APOA 3AD7C 2XGPA 3TAMA 3UN5A 5C5JA 1A0OB 1M5VC 2CVIA 1UAWA 2YKNA 1UJ6A 1UCNA 4YY3J 1FFSB 2ZZTA 3NCRA 2OEKA 1HBOB 2HQFA 2CQCA 5K8OA 5CYQA 2CG8A 3FVYA 1OS5A 2HGMA 5KTQA 2OEJA 2P2CB 1D9FA 3IS9B 2FZKB 3RR7A 4Y3CA 1X60A 5CCLA 1RGVA 4AFFA 1RT4A 1RK8A 5GAGU 2X51A 5KFJA 1RAEB 2IJFA 4RBUA 3C8YA 4LFCJ 4FZVA 3ISNC 5HLFA 3AD9C 4O4RA 4DN9A 4CYUB 1Q53A 3HZGA 3C2PA 4I6YA 1RUSA 4KGKA 2E66A 4DCPB 4M94A 3GONA 3FSXA 2XO6A 3JSMB 1YJ7A 5B0FA 2AJ1A 4NXMF 3H2UB 3MEDA 1HNXJ 4L76A 4NMXA 5F0UA 3L7PA 1PBUA 3BYRA 3LANA 2FQQB 2AP6A 5B0GA 4MK8A 3K17A 1Q8BA 4LFBJ 3AXMA 3A4TA 5LMUF 4DLGA 2VONA 4IG3B 5KT5A 3MEGB 2VC0A 4HH1A 3DHXA 5B0EA 1KHVA 1VGYA 3M2RB 3EZOA 1NK0A 2V2KA 1NSKL 3MAAB 5JMNA 1CJKA 4P10A 2BRLA 1HMVA 1YLXA 1VHFA 4DF8A 1Q79A 2DEIA 3OTBA 1LXNA 4RW6A 2KT3A 1ZYQA 3H40A 3BKTA 4JI0F 1ZTWA 3BH6B 2RUGA 1HNVA 1UMJA 2GVZB 3NGUA 4RW4A 1V6HA 5HVFA 4USTA 3SCKE 5GMEA 1SXLA 3U27A 3D5MA 7FD1A 1AROP 3HFZB 3KG1A 4G1IA 4G1PA 3CC2S 1SVDA 4QWAA 1FHTA 4ECTA 2DNKA 2E7VA 3BQ0A 4P9SA 4DQSA 1FWLA 2RT3A 2AJ0A 2QA1A 4OZJA 5LSOA 4A8QA 4TQRA 4U67Q 1RAJA 2KXNB 4HHJA 4DWIA 1HYSB 3P8BB 2UZAA 1LWEA 5F8MA 4K4UA 1HQEA 5IXUA 1H7XA 3ENQA 1HBMB 4ZVGA 1YRXA 2YPZA 3OV7A 2PSZA 2Q6BA 2IRXA 2KG0A 8AT1B 1N34F 3HSJA 3DCAA 4RL1A 5D15A 3DRYA 2KT5A 3LP0A 4LF7J 3PVXA 3GIJA 1LW0B 3H5YA 2HEKA 2L9DA 2N4DA 3W5ZA 3OUYB 1H2UX 3R3TA 3MUTP 1WUUA 2XGQA 2QZ8A 1YBTA 5A6PA 2DNNA 2R42A 5ETMA 2EI5A 3UR0A 3IRXA 2BE9B 1RU1A 1HBOA 1N5TA 2KG1A 1FE0A 4A8OA 4M5MA 2ZWPA 3D66A 1U2RA 3M6VA 1IKVB 2MZ1A 2CZ9A 3WX8A 2YQ1A 2R7RA 1H2VZ 4B3RJ 5IQQA 4P72A 1VIOA 1WC5A 2QMUB 2BVZA 2VFUA 2CXEA 5KFXA 3NGKA 2PMHA 5F8JA 3DLJA 2HNZA 1ZOTA 5DDOC 1JIHA 3HFVA 3CVKA 1XJWB 1Z4UA 3MPUB 4DHVA 3GP9A 4O44A 1S0OA 5BYRA 1VQMS 1MNEA 4CYUA 1Q5VA 1I3OB 2BJEA 3IM8A 2HW3A 1RAFB 3NGRA 1WNEA 4WFZA 4OI2A 3HVRA 1NJIT 1FTRA 1DURA 2CPFA 4DDFA 4PXDA 3IAS9 1FKOA 2YKMB 5M2PA 1PYSB 4FF1A 2JVRA 3AH6A 4ECSA 1RTHA 4AQYJ 2WSFC 3BO2A 2RJZA 4YFUA 2AEFA 4DX8H 2PD1A 2DTJA 4I6WA 4ZLJA 4ILRA 2ZWOA 3V6JA 4Q5VA 4DSFA 1C0TA 5A2QU 1LNQA 3L3CA 3PW5A 4RBVA 1HPZA 4CM0A 3T1YF 3DM2B 1VC0A 1Z1ZA 1UEVA 4GKJF 3WQPA 1X5OA 3MEGA 3FEZA 1TL4A 1U25A 5IZHA 4B17A 4CLFA 5HMXA 5D4OA 2FJDB 1YZ6A 2COLA 1LK5A 1VRQC 2QL5B 4DPUA 2WK4A 1YJUA 1IBKF 1RWKB 1I1GA 2J0XA 7AT1B 1NSAA 2IM2A 4U8YA 3E8OA 3NOCA 1RAOA 4ZOSA 1PILA 1UFKA 3BKUA 2OFHX 1HNIB 4S0MA 4FF3A 1JJ4A 1WI6A 1DY3A 4C0OC 5B7WA 4LUBA 2B5JB 3QYYA 3H2LA 1S10A 3A8JA 4RU2A 4PG6A 4IR9A 4J9SA 4NMLA 4FS2A 1RWXB 2V4JA 2K2PA 3GFXA 5KFOA 1OPIA 5EUHA 3FQKA 4ZPDA 1WOSA 5AXLA 1NDLA 1D3WA 3CPWR 5JVHQ 2HQGA 4NXMJ 2XYGB 1HWJA 3HLUA 2CG4A 2I0XA 1RTJB 4LJMA 1HA1A 2ALYB 3I31A 2PEHA 1JKHB 3D1HA 2ZBCA 4WE1B 1IKXA 2UVVA 2JSXA 4LBHA 1Q0NA 5KG7A 2R7OA 4ZVFA 4GRSA 4WP9A 4LF4F 2JZ5A 5LMUJ 4IH7A 3U7JA 3R5BA 3V4MA 3TP2A 5H9EK 3CJTA 1ZPVA 3FK4A 2LCWA 4OJGA 4TLRA 2Y1LB 4UQGA 2Y9HA 2GJ2A 5M2UA 3M8QB 4MIAA 4DUTA 1RT3A 3UFCX 1WEXA 4HACA 2XCPA 2B9EA 2HNYB 2N3OA 3HSZA 3QRRA 1KVKA 4ZVQB 1S6UA 1UW4A 3TZZA 5J2NB 2MKSA 3CW2C 3M9NB 3PO5A 4DR5F 1SJRA 2QLBB 1QDUB 3BGRB 3TX0A 4ER8A 2OPSB 3TO8A 1G1XA 1CS4B 3RZAA 2GA7A 3FCHA 2VJVA 1NU4A 1BQXA 1Q5YA 2MTLA 4DJBA 2Z56B 3P96A 5GAEI 3ZZPA 5BR8J 4KGMA 1Y3JA 1CJUA 1DTTB 1T11A 4RLEA 4JB8B 4RW8B 1FKAF 4FKYA 1RTIA 2K7JA 4DV0F 1RAIB 4TXSA 2J9DE 3OLAA 3GV7B 4I69A 4PXEA 1DARA 4WCEQ 4G1QA 1ZZFA 3TVKA 4FVCA 4JV1A 3U1MA 2YKMA 3SYZA 5EWGA 1N33F 1CQMA 4F0MA 2VPWB 3CTRA 1GH8A 2WVBA 5C25B 3KK3A 4IQMA 1FJ7A 3DLKA 3HKWA 7FDRA 4ED7A 3V81A 2JWNA 4YOEA 1REVB 3QGPA 2O3DA 2UU9J 1QY7A 2ACYA 3PFOA 2JEJA 1SKRA 2ZVIA 1U0HA 1UWBB 4ZDNA 3BSCA 6AT1B 4ENOA 3Q8YA 3RBXA 2E9ZA 4QW9A 3VAHA 2AX1A 2RDDA 5E3QA 4QIVA 1QTMA 3OQ2A 5CAAA 2C1EB 1NJYA 1SKSA 3SDEA 2D3OR 4DZDA 1B4SA 1NCLA 1N88A 1YX2A 1IWGA 3JSBA 3NEKA 1VQ9S 4ZJOA 2JLGA 4WU2A 2XG8A 1FNMA 3J7A1 5EHHA 5IQ6A 1HNZF 3VHQA 1HNIA 1K1QA 2R8HA 2HAFA 3VVTA 1JJ2R 2VG7B 2DO4A 1VK3A 5DQIA 2XMMA 5K8PA 1H72C 1DZ5A 2NPFA 1FRXA 3G86A 4HHUA 3DHWC 3DLGA 3DRRA 1B7YB 3LGHA 3J7ZT 3P4UB 3IRWP 3CXCR 3W9JA 2ROPA 4PABA 2XLKA 2HAIA 1R27B 3ILJA 4BWJA 2HMIB 4JI6F 4OLPA 1MMLA 2R9LA 5CZVA 1X5SA 2B7CB 2LQ8A 3K57A 3QLHA 2ZH4A 4LF5J 5I3UA 4NXNF 1RHJB 2K1RB 2RRNA 4ZP6A 2HRYA 2CQBA 4WFBQ 2D7SA 4F4YA 3T1YJ 4KB7A 1TMJA 3E2EA 1S1VB 4GKJJ 4J9PA 4CLYA 4ECRA 3FRYA 3H5UA 2A2DA 1AA1B 3CT9A 3DYAA 1X9SA 5L39A 4X4SA 2GJIA 3CMQA 3MCOA 2EW9A 4DSEA 2VICA 4KQZA 1TL7B 4HL9A 3OJSA 2IC3B 1WC4A 1Y3KA 1OWXA 4OQJA 3OR2B 1RT6B 2AGPA 3K8VA 2FHJD 4BWMA 3K2YA 3CJ2A 4ED4A 4Q8FA 1EKSA 3D1OA 4I2PB 4UZCA 3KOAA 3T1HF 2VZ9A 3SV3A 1YWXA 2IYIA 2Q6CA 4DR4F 2WONA 4KT0C 3TUZC 4TNOA 3MM8A 3L4BC 1WKKA 2MGZB 2C2DA 2HS0A 5HSPA 2FVRA 1YKWA 5KG1A 3PYGA 3TVYA 2AKWB 2Y0BB 4DBQA 3MFHA 1DTTA 3C15A 3F56A 3R5AA 5F8NA 3GIMA 2ZC3A 4QR2A 3AY0A 3KK2A 1TK8A 4NLWA 2GHVC 2VHGA 3K59A 1JJCB 3KHRA 3KNAA 2FD2A 4NYPA 2W9CB 2F63A 4LF4J 1JNRB 4N8OA 5C25A 3MR7A 2Z2LA 5HBMB 1R43A 2O67A 2GO9A 3BGOP 2MXYA 3M6WA 1SQEA 4I64A 4LF6F 3RUBL 2GMLA 2ZDOA 3N5FA 4GO7X 4NRTA 4KR0B 3RG6A 1XR6A 2CPDA 1CJVB 1O8BA 1KDNA 1UW9A 3H42A 2MQPA 2BX6A 4A8XA 5H9EJ 2W7PA 4M1KA 3L7OA 5B0AA 4B9UA 2ZNYA 3KDOA 3VGUA 3O1LA 4DR5J 1I51B 1RT2B 4Q0BB 3R5DA 3UCUP 1Z2ZA 2JEFA 4V1Ak 2QX0A 3P5TL 4DL6A 4DU7A 2CQ0A 3NBPB 3SCJE 4M5KA 1WOPA 2YNHA 2CQPA 1SB6A 3DRSB 1U6FA 4V19X 2BJ3A 3J80Y 3IN5A 2ZH9A 3V6HA 1Y00A 4F0HA 2AZ3A 4P73A 4ZHRA 4DV4J 3W62A 3BSNA 4PUOB 1LXJA 3G6YA 4UY8T 3TJAA 1KFSA 3BJYA 1M5KC 2ZOMA 2ZOGA 3V4IA 1X5PA 1SKWA 1VC5A 4OL8A 3H2VE 4W4MA 1NM2A 2IIHA 4DV0J 3D7SB 4OI6A 2V34A 3MM6A 4KFBA 3G9CA 2QFJA 2X1GA 2WTFA 3BN4A 1KTVA 3JXOA 1XQIA 2Z58B 2ZKUA 3I87A 1UVMA 2CPZA 3THTA 2RDIA 4BC9A 1N33J 2FY1A 3A8IA 2VL1A 1MWZA 1H74A 2V4RA 4X2BA 3OHAA 2VDHA 4C3MA 2ZD1B 2MZQA 3U1NA 3VZHA 2PA8D 5LSLA 5KFEA 2C3YA 2RQ4A 2M8HA 4TN2A 4TKTA 2IAJB 1TK5A 1YDLA 3J7AN 2YWEA 3R7SB 4YEAA 4H4MB 5L8RC 1GTHA 3VVUA 4ZCLA 1DQAA 1DLOA 4OFZA 3MD3A 2FLLA 1RLCL 1TKXB 4DLEA 4K4VA 1QUPA 1FVSA 1ZAXA 1T3NA 4NZ0A 5HQMA 4W92B 3DU6A 3TWZA 1ZM9A 3OR2A 3PW0A 1UEUA 4JI7F 5FDLA 1WKLA 1HNZJ 2ZNZA 2AU0A 4I2PA 2LA6A 1RT5B 4NCGB 5CD4H 3GJRB 3JTPA 2R7VA 1FRLA 3KLIA 2AX0A 1RA6A 1XNRF 3RB0A 3NRBA 3D4JA 2MGZA 5L9NA 4DR6F 4G65A 1P1LA 3R1HA 3IA0A 2DGUA 3NWGA 4GC7A 3KLFA 1X9MA 2RRAA 1DTQB 2XSFA 4J9NA 1GEHA 1OIAA 2O66A 2A10A 2J9DA 4RUBA 3N28A 3ET6B 2X3GA 5DDRC 3FBBA 1M5PC 4WFYA 3NMAA 5K9FA 3CMES 4NXNJ 1T03A 1JLAB 2GAGC 1W26A 2JC0A 5KFDA 3RAQA 3B4MA 3I5CA 3KWMA 5KFZA 2VFTA 1X0PA 1QD1A 1TK0A 1J5OA 1R6VA 1R0AA 5I42B 3HHLD 3CDWA 1G2EA 2C3MA 4LR8A 4L73A 2ZM6J 1FJGF 2OUGA 1NH7A 1QAIA 1B0TA 4DQIA 2G2YA 2L48A 5E3AA 3RAMA 2CDQA 2DXFA 2B4UA 3QNWB 2JFDA 3A1YG 2PFDA 2B56A 1KN6A 4ANDA 3D2WA 3NWRA 2KJWA 1BQMB 2VA3A 2R2RA 3CDAA 3EZUA 3SZ2A 3H4DA 1APSA 3K58A 5GAHU 1S1UB 4X4QA 4CT8A 1F5AA 5HMWA 2HS3A 2BQ3A 4Q8EA 3EPGA 3T1HJ 4LR7A 3SSRA 1PSDA 5IS2A 2CNKB 3MM7A 4NLPA 1ACMB 3NBPA 4DR4J 1NJWA 1SJ4P 2OD6A 1U48A 2E5GA 5FLXY 4IG0A 1HR0F 2ZHAA 3ZTQA 2IVMA 3RB3A 1KFDA 1U2CA 4OI4A 5E2QA 3LAKA 1KSPA 3D1QA 2GQCA 4M5JA 2XMWA 4EUVA 4R5PB 4NEYA 1NPRA 4EZ6A 4BS2A 2DH8A 5KT7A 2UVRA 5AJ3F 2OEMA 3KLVA 2P5VA 4JOUA 3QQCD 2YKAA 3EGVA 4OHWA 3BQ2A 2FC8A 4QCLA 1B70B 5E3CA 4W90B 2VPYB 3ENAA 2CJXB 4P71A 3BDPA 3I9ZA 3NAIA 3DNCA 1S9EA 2PIIA 1S6PA 2VFRA 1YJ9S 4JYAJ 4P7VA 2EC0A 2RAQA 3RJMB 4M5DA 3R8YA 3AOCA 1FRJA 2QSWA 2GIRA 2EBEA 1YVFA 1BMQB 2WBMA 4KGZB 1NK5A 4IOBA 1Y4ZB 2F8MA 3SCLE 2KVIA 3R27A 3QSIA 1ELOA 3O2IA 4CLTA 4B3MJ 1T05A 3FMWA 2EFNA 1NZAA 4H4MA 3AA8A 3DMJA 2ERRA 3GU0A 2OP5A 1SH0A 4YS2A 3VAGA 1K9MT 3NG8A 4JI4F 1PYTA 2XNQA 2KKHA 4USVA 4MKBA 2BACA 1F9FA 5CCMA 4LF9J 2QN6B 3QJLA 3M2VB 3QT7A 2HIYA 3LW5C 3OPKA 4JI1J 3UCZP 2PO4A 3MAQA 3HT3A 4Q44A 4F3QA 4MKAA 3IMQJ 1S59A 3GG1A 5KFFA 3DC2A 4C8OA 2IA6A 2NSBA 2WSEC 3DI6A 1L3TA 1PKUA 1UETA 2HURA 5DRKA 4AE5A 5LXRA 3GE9A 5KFIA 2LVWA 2IJNA 2V0NA 3CCES 3VWSA 1GAOA 3G82B 3AHPA 2DJWA 4DUZF 1O51A 4R8UB 3M6UA 3A3PB 1MN9A 1N0UA 3MI7X 3MCSA 2RMLA 5KG5A 4FS1A 2IHR1 1FTCA 3NOGA 3PHTA 4OHYA 3SSSA 1AZSA 2VD3A 1NHUA 5BJRA 4E0DA 3QFHA 6FDRA 4DG1A 2BYCA 5L38A 3IBWA 3BGUA 5ETLA 4M95A 2N82B 2DK2A 1ZA1B 4ETXA 4ETZA 4JUZA 4ZLPA 1J27A 3EVMA 1VQSA 1UEKA 4QR1A 3FCWA 2CIMA 3FEXB 1VQ4S 4OIXA 2HBZB 3GIKA 3BGFA 2ZJPQ 3Q24A 2YQ0A 4F67A 3LALA 1S1UA 3ITHB 4PWWA 2M2BA 3L09A 1RKIA 2LFVA 1WJ9A 1RBLA 2EEYA 2HHSA 1S1WB 3Q8SB 3EUNA 1KQKA 1XMQF 3MD1A 1XNRJ 2HHWA 1T0TV 1L3UA 3AQOA 2DGXA 4DR6J 1JJHA 4Q2LA 5IT0A 4PWUA 4K7QA 4LSLB 4UUWA 2DY1A 1F6TA 1TV6B 1MWQA 2RILA 4ICLB 3AAWB 1JLBB 1HI8A 3G6ES 4BC7A 3PR4A 1IM4A 3C6UB 4F25A 1GMVA 2AQ4A 4B9TA 2E1AA 2RKIA 2E29A 4TYAA 1LFPA 3WIUA 4DQPA 4N5SA 2PI5A 2J0WA 2E1CA 1MU2B 5J2QB 3LPYA 2YX7A 1EAYC 4CNZA 2ZJQQ 2BQRA 1B3TA 4WWSA 2H9ZA 1YRUA 3AD8C 3OSPA 1HBNB 2BM0A 1FRIA 1X4DA 2B43A 3CO0P 2XHWA 3I0RB 2XLJA 2LQJA 2BE2B 3GYNA 3N79A 1QSLA 3KLHB 1BWEA 3GV5B 1IKYB 4PQUA 5MLCV 2VDIA 2X1BA 3RU0A 3LPEA 2QL9B 4K59A 1NJZA 2HBQB 4EBDA 1UA0A 2QMWA 2YKQA 4QWDA 2F40A 1N6QA 1RCOB 1X4CA 2DR7A 4OV6A 2HHVA 4NLOA 2OPRB 1U47A 1HR0J 4CTAB 8RUCA 5A8KA 2BABA 1FX2A 2LU2A 3CDUA 3PDNA 3GJSB 1WEZA 3BBBA 2AJ4A 1RWWB 2IM0A 2V4QA 4HHHA 3TNVA 3LOUA 3AJDA 2OH2A 3KJQB 2GNKA 2PGCA 4BBYA 2OMLA 1YGYA 3QIPB 4DV2F 2QE5A 4IFVB 3NS7B 1RAAB 3F44A 2LECA 4Y2AA 5AJ3J 4OYBA 2YBVA 3EVWA 2VFVA 2DRAA 3J7YI 2GHPA 1VMBA 3S8SA 1C1CA 2W4PA 1IVZA 1ZBTA 5KG6A 3D68A 2KL8A 1U8WA 1LK7A 5CQGA 2CQ3A 2IA0A 3TOQA 3C14A 1SIZA 2YNGB 2W9BA 4A46A 1AYEA 4I56A 3H5SA 4EK2A 3DGPB 3W61A 6FD1A 4ZP9A 2UV8G 3L9ZA 1JLEB 2FGCA 3W2WA 2G0IA 4HT5A 3M30B 2CQDA 1M90T 3H0PA 1YJRA 2B9XA 2MLZA 3SFGA 2AEMA 1ZM4A 3B4DA 3D6MB 2ILZA 4K2XA 4C48A 1FRHA 1B7FA 1H6KX 2ZC4A 4IFYB 4F7VA 2R2TA 4OX9F 3NNHA 3KTQA 1S48A 1FD2A 2C2ZB 1G3OA 2EKYA 1SH3A 1FNXH 5F8GA 4M63A 3FJ2A 2CA9A 3QT5A 2V8HA 1T9UA 2C28A 4TU9A 4E8UA 4NLSA 3UE2A 1XMOF 2W2PP 4PPDA 3X1LB 4R25A 1T94A 1KNZA 2RDJA 3CJQA 2XB2D 4WZMA 2R7WA 4I0WA 2UXCF 3G71S 1WEYA 3CD7A 1ITPA 1XWLA 2GQQA 3ZTPA 3NCQA 2F8EX 2QG9B 3QWUA 3HVAA 4KHRA 2J6UA 1BQNB 3PG9A 3OR1A 3M9MB 1CBKA 2RF2A 1FDAA 3F0NA 4FBUA 2HVHA 4LSLA 2YKOA 4DPOA 2AW0A 1N36F 3DXBA 1DHMA 3MOJB 5HL7Q 1L5UA 4C97A 2V63A 4PEOA 3UVJA 2V8PA 2A0FB 2XY7A 3MMBB 1EQMA 3CCSS 2VG5B 1M5HA 1R31A 2CKWA 1JNZB 1CG2A 1M5SA 1VBYA 2C2RA 1D9AA 1PAUB 4J5OA 1U24A 2NCKL 2QA4S 5KT3A 2LDIA 4GVLA 4A8KA 1NB7A 2KTQA 4A48A 4USJC 4I7FB 4MMOA 1GMUA 3MPDA 4FDFA 1QSYA 5AXNA 3EVOA 4QU7A 2H48B 3I0RA 4B9SA 2R2UA 4FYDA 2ZBPA 5KFWA 2L3MA 3KLHA 3OFFA 4P74A 2PN6A 1NBEB 2BUNA 3QO9A 3MUVP 2MDAA 3RR8A 1RXOB 3EM1A 2BXJA 2QEXS 2OHDA 5I4MA 3MEEB 1ICEB 2FZCB 1XMQJ 2HFSA 5HMZA 2PMZD 1S99A 1UVNA 5A2QY 2CJ9A 4JV2A 2KVQE 3K0JA 2NXEA 4RNOA 4CLLA 1YK9A 4K0KF 3C16B 4KSEB 2XS7A 1FXLA 2MKYA 2VBWA 5J1NA 4NLTA 4DI6A 3FC9A 4E98A 3FNNA 3V6DB 4DUYF 3GWCA 3JQMA 4U8VA 3UR3C 4OHZA 4C8MA 1X4AA 2XMKA 4RWWA 3NP5A 1E6VA 3M8YA 3GSIA 1IR2A 1MROA 2HZAA 1WF1A 3Q22A 1V3SA 3RYLA 2I5JA 4PAAA 4KKOA 2YNGA 3NCPA 4YR3A 1LW2B 4H4KC 3MZIA 3OTDA 3P6YC 1GX6A 5CH7B 3LUYA 4RNNA 2BRKA 3NAHA 3K5NA 2BE7D 2FLNA 5HQ8A 1EP4A 1YHQS 3CB4A 1BC6A 3M2UB 4ED5A 4C9DA 3K89A 3ISND 1N8RT 1FFGB 2ROEA 2GMHA 1R0BG 2DPIA 4F4KA 4DL4A 5D0GA 5D8HB 2J8AA 1VRTA 3R2CJ 3P45B 3WHIA 2RS2A 4URQU 2XMJA 5D3GB 2NUHA 4F3MA 2K7KA 3U02A 1PC4A 3ZNJ1 5DS7A 4WKYA 1S1XB 2MKKA 1IM6A 2E7WA 2ZH3A 4DSIA 1RBAA 1FCAA 2HK3A 4C0HA 4DV2J 3UN2A 2HS4A 3L7UA 1JX4A 3R6LB 4PG5A 3BGLA 1WG4A 2FDNA 3IR7B 1FX4A 1X4HA 2W25A 2YWKA 3LA0A 3ZZTA 5IV4A 1PIEA 4ZLNA 2HVDA 2HYIB 4KAIA 5CXTA 1TP7A 1HFEL 3TAMB 5LT5A 2IMWP 2O5DA 1F3VA 1FO1A 1WC1A 4XDCA 2XYHB 2MLYA 2YKNB 3GILA 2LDYA 1EZZB 2MKIA 1T95A 5CYMA 2M70A 5CYQB 1W7WA 5D78A 4Y2MA 2BM1A 3QAUA 1FEHA 1FVQA 3MAHA 3AQPA 2BANA 3UO0A 3CCWA 3RGIA 1WDTA 5KFAA 2JC1A 3M32A 5E3RA 2IVFB 1S1TA 3SQGA 3I56S 3CEDA 3IGNA 1NXIA 5J2PA 3LGNA 3D6TB 4DV6F 2BKOA 1WACA 9RUBA 1EETA 2DISA 1V5VA 4KHPJ 2Z2MA 5DO2A 4YP3A 3DGVA 5HLFB 2MB0B 2JEGA 1HQUA 1DQ8A 4PYAA 1XMOJ 2ASYA 1VIXA 2VBXA 4LSZB 4KRWA 4HEA9 1G6BA 4FNHA 1JXLA 3CJSA 3A8KA 3K8WA 3LP1A 4RKUC 4LSNA 3FBEA 2FJXA 3PX4A 3B6BA 2ZOFA 5L1LA 4NI2A 3HF5A 3MEDB 5B0DA 4DEZA 4A8SA 4Y65A 3CF5Q 4O3NA 2CWXA 1GXTA 4CO1A 1RDRA 2W4DA 1M1HA 4N76A 1VCTA 2MKCA 3M6XA 5ETKA 4ZMMA 3PX0A 3LQVA 3CWJA 4ZPTR 3JSRA 3GB0A 2Q3PA 5EWFA 3DOMA 3V6KA 1BHNA 1XN9A 1HHTP 3V6DA 1IJFB 1I94F 1RKJA 1RYSA 1J5EJ 1JXEA 1YG0A 5FD1A 1CJKB 1S4FA 1RWVB 1HMVB 2ZH2A 3I5AA 2ZITA 2HHTA 2W4CA 1WOOA 2EBGA 4RW6B 5H9FJ 2VKZG 4CH7A 2Y1RI 1IR0A 2K06A 1HW9A 3W9IA 3M8SA 5J2MB 1X4EA 2OFGX 2V5HG 3RRKA 3WBZA 4RW4B 2B8QA 2RSQA 4J90A 3Q2SC 1X4FA 2YNFB 4K4ZA 2DNYA 2FVSA 3OT9A 2VA2A 2OGUA 2R8IA 1U1RA 4ZCIA 2F1FA 2LXFA 1U09A 4KHMA 3M8PB 3EGZA 3I4PA 4DR7F 2W2OP 2DHGA 1VOMA 1FRKA 4HYKA 1UP1A 3J7Z5 3PKYA 2EG2A 3CIMA 3QATA 4IUFA 1T9TA 3WC0A 1LWEB 3MGJA 4OYXA 4YB1P 3OXLA 1HQEB 1LWFA 2NYHA 2FC9A 4ANCA 4F0KA 3KKFA 2CNOB 3MCMA 4K0KJ 2KFNA 4P52A 5HI7A 3QT6A 3ZTRA 3AOBA 1WC6A 4C11A 1SH2A 4X4OA 4K4XA 2F3JA 1F5BA 2RQCA 3LP0B 3ELHA 4EZ9A 1K1SA 2OPQB 4DUYJ 1TAUA 2RHSB 2R2SA 3PM9A 2KI2A 2IBKA 1RHKB 2HZCA 1FKPA 2DRDA 3PTWA 3OTOF 3M7VA 4V19J 4B08A 1RT1A 1YBAA 1XNQF 4G6VB 1AB8A 2LEAA 2GVDB 4HDHA 1GQEA 3OHBA 1HARA 3IBCB 1U1OA 2QFIA 5HK4A 4PCQA 2RHQB 2DNOA 4JP8A 4YHHF 1Q4RA 2A1BA 4USMA 5GAGI 1JLFA 3IRXB 3RRHA 3OJUA 2JHEA 3Q0AA 1JLQA 2WSCC 3NKYA 4GKKF 2HHHF 1GK8A 2MSSA 4JBCA 3T5HA 4IH5A 3IWLA 4ZVPB 4B3SF 1VJQA 4M5GA 1JK9B 4WP8A 2A3JA 2FPHX 1PCAA 2BOAA 1MWYA 5AT1B 3I4HX 1G7CB 1M0SA 5JUMA 3CULA 5F3ZA 2R3VA 4IYQA 4DU8A 3MECB 4KE5A 1N0VC 4MAKA 1WF0A 4OHVA 2D3UA 1U1NA 3IGVA 2HNZB 2OLWA 2WZ1A 4LT6A 2GAHC 3F41A 4DPYA 3EE3A 2OPPB 2JX2A 4CCHA 3DOLA 3DRPA 1D8ZA 2V2VA 4O44B 3ZZUA 4F2RA 4QZVB 1RWMB 4BCAA 4OLOA 2YTCA 3N6MA 3S7RA 2HQCA 2FJAB 2ZZNA 5DQHA 2W2MP 5I3PA 1S72S 1FKOB 1NAQA 3TA1A 1Q81T 4K4SA 5KFYA 1RTHB 2HFOA 2UUAF 3HKZD 3ZTSA 1BLUA 2LYVA 2N4CA 4G3IA 3KNGA 2JH3A 3MMCB 2HVEA 1LQ9A 4ES3A 3A3OB 3GCWP 3SBMA 1C0TB 4HR2A 3POTA 2HFVA 2DHAA 2FY8A 3H8YA 4ED8A 1HPZB 1S6QA 2JFKA 4ZVSB 1S0NA 4C8ZA 1WHYA 3IG1A 4CLPA 1AFJA 3OW2R 1CC8A 1NNDA 2LU1A 4E2FB 3W9HA 3ILIA 4QPXA 2LLZA 2R7UA 1QVGR 2R8JA 2BDPA 2DBBA 5A8WA 3IR6B 1LV5A 2WW8A 4UOHA 3TUIC 4J9MA 3VQTA 3KXDA 1N32F 5T41A 5J2MA 2QYCA 4DV6J 5KT6A 2YQ3A 1C0UB 2YNFA 2HHUA 2VIHA 3DKDA 1NDPA 2UV8A 3ULHA 4DQRA 2V4JB 1K44A 3M8PA 2ATCB 3PHEA 2NZCA 3I96A 3HD1A 3D0IE 5KFBA 1S49A 4R0EA 1WORA 3ZNUA 4TU8A 3G6VA 4AUKA 1PO6A 2Z4PA 1I5OB 3GCXP 4ZVEA 5DLFA 2XZTB 5LMNF 4WTYA 4DPXA 1IKXB 3QRQA 2DGVA 2AEJA 1KEKA 1T02A 5T7LB 3ILOA 4HT7A 1H7WA 3MR5A 2KXFA 1TR0A 5KFQA 5KG0A 3T6BA 4RR5A 4NA3A 3BREA 5KFNA 1KP6A 4B3TJ 1Y9OA 2OPQA 2OIHA 1SKUB 3KLGA 2HZVA 3JQJA 4F02A 2WAQD 3TQEA 3JAMY 1IJEB 2CFXA 2G9OA 1NKCA 2GVDA 1RT3B 4HACB 3LF0A 4OYAA 2E44A 1C1BA 3US5A 2SXLA 4FXWA 4FKXA 4ECUA 4X62F 3GTYX 3Q8QB 4ZPWR 2KZZA 1WWHA 3T6JA 3BR9A 4TY9A 3QJJA 3DDKA 4UQTA 1NSQA 2PEBA 1YBUA 2XWYA 1Y5NB 4F36A 3EZ5A 3EDRB 2WVEA 3D0GE 4XPEA 3HVTB 1FXRA 2HWHA 1VR6A 4YB5A 3O44A 3JTNA 4OZNA 2OTJS 4N41A 1U4BA 2WRMA 3MECA 1S77D 4RWXA 4DV7F 4J91A 5KFPA 3TA0A 1W2IA 5F41A 5IM0B 4FPIA 1CJUB 2KFZA 3GFHA 1T8EA 1XBWA 4PWDA 1VQKS 2LXIA 2OPPA 1TL5A 2Y3YA 1RTIB 4P75A 4OYPA 2H54B 4WK1A 4MIWA 4EGLA 1X9WA 2CPYA 3PYFA 4ECVA 4RW7A 1ZAWA 2WOMA 1RQ0A 1X0FA 2EPIA 1RT7A 2HNDA 2RUSA 4KPCA 4ZK7M 2CNNB 4G1QB 4IQXA 1RU2A 1YIJS 3FFIA 3OVSA 1UJ4A 3SEOA 2VU5A 2RU9A 3BEGB 4J9VA 1HBUA 3KK3B 3OL6A 3GV8B 3DLKB 2IYGA 3V81B 1P6TA 2DGTA 5F9NA 5D4LA 1L3VA 3MMCA 2WB4A 4OZ3A 1U0HB 1U45A 1S97A 3OTOJ 1TL3A 5B0BA 4L74A 3DLBA 5EX3A 4NE9C 4OYOA 1NUEA 2OJ3A 3J81j 1VRUA 2GO8A 5DG8A 2J7KA 3SDEB 2V6AA 3D54A 3W1YC 4Y00A 4KO0A 2FUG9 2HHHJ 3EXYA 4LFAF 3N0VA 4B3SJ 4JI3F 1R8HA 4GMKA 3RRGA 1KVJA 3LP2A 1VLOA 5LXYA 2NXCA 5I3QA 2GGPA 2X3DA 1Q16B 2FHJA 3GLJA 4EU0A 5JVGQ 1FFWB 3FGVA 5THWA 4EBCA 4O3OA 1UVJA 3MEKA 1KS2A 2KN4A 1SC1B 1NK6A 3H90A 1CSJA 1NLKL 3CCLS 4CO2A 1VYAA 4UTGA 5L46A 3ZZYA 1C0UA 1SIWB 2R4FA 5E41A 3PW2A 3C19A 1HWKA 4UOGA 3WIVA 3DLGB 3DRRB 2NLWA 4Z2XA 4ZVRB 3Q83A 4ECXA 1QE1A 4DL2A 3Q8VA 3CSKA 1A6LA 4O3RA 3NGDA 1PJ5A 4YB6A 2E5LF 4IOCQ 3PXGa 1RA7A 1VHIA 2UUAJ 3UQSA 4X4PA 3KJFB 4QQBA 3HHEA 2ZUAA 3I82A 3MOZA 3QLHB 2LA4A 5I3UB 1VS3A 4QBUA 5HP1A 4C4WA 5T7LA 2MHNA 4DV5F 2BJ7A 4QIWD 4LREA 3HHLB 1PC5A 3HK2A 4TY8A
chains in the Genus database with same CATH topology
1RK8A 5GAGU 3BGUA 2X51A 3C3LA 2B4VA 4RW9A 5KFJA 4M95A 4EYHB 2IJFA 4RBUA 2E5JA 2FIUA 1YJNS 2N82B 3C8YA 2DK2A 4ETXA 4ETZA 4JUZA 1IKWA 3DYAB 4FZVA 4ZLPA 2MQMA 3ISNC 5HLFA 2POKA 1VQSA 4O4RA 5DM6Q 4DN9A 3MM5A 4NLVA 3QWPA 1Q53A 2AJFE 2PDAA 4NRUA 4QR1A 2GHWA 3HZGA 5HO4A 3CCJS 2VB6A 4I6YA 4KGKA 3C2PA 5E33A 2CIMA 2E66A 4M94A 3FEXB 1VQ4S 2EFGA 3TW0A 4OIXA 4YDDB 3FSXA 4C3KA 4DL7A 3E01A 4YB7A 3GIKA 3BGFA 4QOTA 2ZJPQ 3Q24A 3IWXA 5F0WA 3JSMB 4F67A 3G8TA 3LALA 4Y2IA 4CQ1A 1S1UA 3ITHB 5B0FA 3HPOA 2HMIA 1FNOA 3W2VB 2M2BA 2AJ1A 4NXMF 2AD9A 3L09A 1Q8IA 3VR1A 1H0HB 3H2UB 2J5AA 3MEDA 4CIOA 4ILMA 1RKIA 3A8EA 5B0CA 5F0UA 1SJ1A 3L7PA 2X1AA 2K1RA 3KLEA 1AXQA 2CQ2A 2LMIA 3MPVA 3SFUA 5J1EA 2A2CA 4A8MP 1TAQA 3LANA 2HHSA 5B09A 4ZA1A 1S1WB 2AP6A 3Q8SB 3EUNA 5B0GA 1C4CA 4MK8A 1KQKA 1XMQF 3MD1A 2HHWA 1L3UA 3AQOA 1RP5A 1FRMA 2WONB 2DGXA 3MTKA 1Q8BA 4NOHA 2R8GA 1FXDA 2AYEA 3HVTA 2VQFF 1JJHA 1S1VA 3DFEA 3MM8B 4Q2LA 5IT0A 4PWUA 4LSLB 4UUWA 2DNGA 2AYGA 4B9MA 5LMUF 4DSJA 1TV6B 4DLGA 2VONA 4IG3B 2DB1A 5KT5A 3MEGB 2VC0A 5IM0A 2RILA 4ICLB 2FJWA 4HH1A 4B02A 1QLNA 1HW8A 3AAWB 3DHXA 5B0EA 2I38A 1KHVA 1VGYA 2DH9A 3M2RB 1JLBB 1HI8A 3G6ES 1KHWA 1NK0A 2E9RX 4BC7A 3PR4A 2V2KA 1VQPS 2DPJA 1WF2A 1S7HA 2BV3A 2IC3A 2BRLA 1HMVA 5HN0A 3KK2B 3UPFA 3BM7A 1IM4A 3C6UB 4F25A 2AQ4A 1RT6A 1VHFA 5F8LA 2E1AA 4DF8A 4B9TA 2RKIA 1Q79A 1R8BA 2E29A 2DT9A 4L72B 5ADZA 4TYAA 3OTBA 1LFPA 2HHXA 1LXNA 4RW6A 4TLQA 4DQPA 3MPYA 4N5SA 2KT3A 1ZYQA 2PI5A 3H40A 5KG3A 4DR2F 2J0WA 1LWFB 2E1CA 1MU2B 2CJKA 5J2QB 4JI0F 3LPYA 1U6BA 1ZTWA 4PG4A 4WIIA 2YX7A 3EX7B 2Q1LA 4L3NA 5KOXA 5K14A 2RUGA 2QA4G 1HNVA 1UMJA 4CNZA 1FA0A 2ZJQQ 2BQRA 2H9ZA 4ZP8A 1YRUA 4RW4A 2XC9A 3KK1A 4FXDA 1VBZA 1V6HA 4C11B 2FJBB 1QUVA 3SCKE 2FVQA 5L1KA 3OSPA 1HBNB 2BM0A 2DITA 2ZDPA 1FRIA 2R7TA 1SXLA 1X4DA 2B43A 1UVJA 4LFBF 3U27A 1YJWS 3D5MA 7FD1A 2B9YA 3O3LA 1AROP 3OFGA 1SV5A 3RBEA 4AL5A 2XULA 3H59A 2XHWA 3DLHA 3I0RB 2XLJA 3KG1A 1U1LA 4G1IA 2F8HA 1V3RA 2OD4A 4G1PA 3CC2S 1P8GA 2LQJA 2BE2B 4QWAA 5C42A 3TAQA 3GYNA 1FHTA 3N79A 1QSLA 1FKPB 3KLHB 4ECTA 5D77A 2UVUA 1BWEA 2DNKA 4UOCA 3BQ0A 1RT1B 3GV5B 1IKYB 4PQUA 2FJEB 3C66A 5MLCV 1VQ5S 1Q82T 1JLCA 3ETOA 2X1BA 3LWLA 4NYZA 2XI2A 4ZPVR 3RU0A 4DQSA 5H1SV 2KYZA 2RT3A 4ZP7A 2DGOA 2AJ0A 2QA1A 2AYBA 4OZJA 5LSOA 4K59A 4TQRA 4U67Q 4A8QA 1RAJA 2KXNB 1NJZA 1UVKA 1JLFB 1XEZA 4HHJA 4DWIA 1Y5LB 1HYSB 1A7GE 3QZ8A 4EBDA 1UA0A 2UZAA 2QMWA 3QIDA 2YKQA 4DR3F 2RQMA 1LWEA 3E3XA 3FEYB 1JMTA 5F8MA 4QWDA 2F40A 1HQEA 5IXUA 4EYIB 1N6QA 4USIA 3I9V9 2XSJB 4K4UA 1H7XA 1JLQB 3ENQA 2F9JA 1X4CA 2RB7A 2DR7A 2HHVA 3PJWA 2W9CA 4NLOA 2OPRB 1U47A 4CTAB 1HBMB 4ZVGA 3KMSA 1YRXA 2BABA 2LU2A 5JXSA 5A8KA 3CDUA 2FHKA 3PDNA 3OV7A 4I4BA 1WEZA 2DNZA 2YNHB 2AJ4A 2IM0A 2V4QA 2PSZA 1OQ6A 2MY8A 5HBMA 3TNVA 2Q6BA 2IRXA 2CPHA 2KG0A 2ZH7A 2KHCA 2G1DA 2J6SA 2ZH1A 2HQIA 1N34F 3LOUA 3N6NA 2HGLA 1TUVA 2OH2A 3DCAA 2EFPA 2CQ1A 2GNKA 2V8GA 3DRYA 2PGCA 1O0PA 4ZHRB 2KT5A 3LP0A 5LJ5Y 3TYTA 4BBYA 2VODA 2AJQA 2OMLA 1YGYA 3CD5A 3QIPB 4F26A 1WI8A 3OLBA 2KJVA 4DV2F 3PVXA 2QE5A 4V19J 4IFVB 3GIJA 3F44A 3H98A 1LW0B 2R7QA 3MR2A 3V4IB 3CJ0A 3MTJA 2LECA 3H5YA 2Y0SD 4Y2AA 2CJBA 3V5RA 3HI9A 2L9DA 2N4DA 3MM6B 2GX8A 2XS2A 2VFVA 4KFBB 3OUYB 1H2UX 3R3TA 5DJBA 1KOOA 3T5JA 2KYXA 3DOLB 1DBDA 3MM9A 3MUTP 2DRAA 3J7YI 1QAJA 3DRPB 4JI2F 4LF8F 1F60B 5E7OB 4BHQA 2BOPA 2V94A 2GHPA 4LVNP 1J2VA 1VMBA 1MMNA 1GTEA 1C1CA 4Z37A 3S8SA 2XGQA 2W4PA 2QZ8A 4LIWA 4ECQA 5A6PA 3QGIA 2DNNA 5JJBA 2ADBA 1ZBTA 2UP1A 3X3UA 5KG6A 2XS5A 1RT2A 2EI5A 3UR0A 4Q0BA 3IRXA 2KRBA 4NYOA 1LK7A 2OKQA 3GFYA 5CQGA 1ZH5A 1HBOA 1N5TA 2KG1A 1FE0A 2M9KA 2CQ3A 4A8OA 2IA0A 1GXUA 3TOQA 1U2RA 2VG6A 2YX4A 2V8DA 3M6VA 1SIZA 2YNGB 1IKVB 2MZ1A 3TUJC 2W9BA 3GQCA 2MY7A 1N4LA 4JI5F 4MK9A 4A46A 5D4NA 4HI2A 4A8YA 4C8KA 3DRSA 2R7RA 4I56A 1H2VZ 4ED0A 3H5SA 4OZ1A 1YI2S 6FD1A 1ZZNA 4F50A 5IQQA 4ZP9A 1FERA 2UV8G 1KD1T 1D0EA 2NREA 1VIOA 4H4OB 1JLEB 3KJVA 2FGCA 5C24A 4D3HA 2WB1D 3W2WA 2ZJRQ 1CC7A 5ITHA 4AFFA 2J0QD 4WZQA 4PQAA 3KHGA 3NNAA 1UA1A 2BVZA 4PUOA 1RWUA 4HT5A 2VFUA 3M30B 2CQDA 5KFXA 1M90T 4DOZA 1YJRA 1VBXA 3NGKA 2B9XA 4ECWA 2PMHA 2IFXA 3UD4P 3HHLA 3SFGA 5F8JA 2ILYA 3DLJA 1ZM4A 3B4DA 2HNZA 1XR7A 1ZOTA 2NYIA 1JIHA 2C3OA 2ILZA 4K2XA 5DDOC 4LF7F 1FRHA 1B7FA 1H6KX 1IQTA 3CVKA 3POTB 1PGZA 2ZC4A 3I6PA 4IFYB 3UD3P 1ZETA 3F73A 3LH2S 2R2TA 3ZC4A 4OX9F 2QLWA 4EWTA 1S48A 3KTQA 1S6QB 3NNHA 1Z4UA 4OX6A 3G8QA 3MPWA 4DHVA 1FD2A 3PACA 1MSWD 1G3OA 1DLOB 4ES1A 2AGOA 2P9GA 4O44A 1S0OA 5BYRA 1VQMS 2EKYA 1SJ3P 1SH3A 3K5MA 1FNXH 3I55S 1CLFA 5F8GA 1MNEA 1SC6A 4M63A 2OTLS 3IG1B 1MMDA 3FJ2A 2ZHOA 4UW2A 2V8HA 2BJEA 2HW3A 1Q78A 3THVA 2C28A 1RTDA 3QPIA 3MR6A 4TU9A 1WNEA 3EYZA 4WFZA 4OI2A 4E8UA 3HVRA 1NJIT 3B8HA 3KYLA 4NLSA 1FTRA 1IQZA 1DURA 2CPFA 3UE2A 4DDFA 1XMOF 1FF2A 4PPDA 3TANA 4R25A 3X1LB 4RU9A 4QIGA 1T94A 4X4UA 3T1AA 4PXDA 4DMZA 1KNZA 3IAS9 1FKOA 2YKMB 5M2PA 2HLUA 3PEHA 2RDJA 2FTRA 4RUAA 2XB2D 2J6TA 3W2VA 4WZMA 4FF1A 3JSYA 4ELVA 2JVRA 2R7WA 3AH6A 2B6AA 3BF4A 5FDLB 4I0WA 2MZSA 2ZD1A 1RTHA 5A8WB 4ECSA 5AXKA 2UXCF 3G71S 4KIAA 1WEYA 2HRUA 3CD7A 3HX9A 2VBYA 3MR3A 2R8KA 1XWLA 2GQQA 2WSFC 3OTCA 3BO2A 4MFBA 2RJZA 5DM7Q 3NCQA 3IC1A 4YFUA 4DX8H 2F8EX 3ZZ0A 2PD1A 2DTJA 4I6WA 4FBTA 1KVIA 4CH1A 4ILRA 2B51A 3V6JA 4K4YA 3QWUA 4C8LA 4DV1F 2CPEA 2YWHA 3HVAA 4KHRA 4Q5VA 4DSFA 2J6UA 1BQNB 1FK9A 2IAJA 3TVZA 3UNGC 3OR1A 1C0TA 3M9MB 3PV8A 4PXBA 4YR0A 1FT8A 2RF2A 1FDAA 1KOHA 4FBUA 3KLIB 3L3CA 2OAUA 3PW5A 3MF5A 4RBVA 1HPZA 2QMXA 3MFIA 2HVHA 4LSLA 4QWCA 2UXBF 1S0MA 3T1YF 2YKOA 3DM2B 4DPOA 3Q8RB 2AW0A 1VC0A 1VQNS 1Z1ZA 1UEVA 4GKJF 3DOKA 1N36F 1X5OA 3MEGA 3FEZA 2ASDA 3DXBA 1DHMA 1M1KT 4DFJA 3MOJB 1TKXA 4O4GA 4U7UK 1D9DA 1TL4A 5HL7Q 3KLFB 1L5UA 1U25A 3BB5A 1KQFB 5IZHA 1VQ6S 1S0VA 4C97A 4B17A 3I5BA 5HMXA 2YWGA 5D4OA 2FJDB 4C7QA 1U26A 2COLA 2C22A 1LK5A 3TARA 2QSFA 2XY7A 3MMBB 2F4VF 2KDOA 2WK4A 1YJUA 2XY6A 3CCSS 2VG5B 1IBKF 1I1GA 1M5HA 2J0XA 3IFEA 1R31A 5KFGA 2CKWA 2CPIA 2VOOA 1JNZB 3MDFA 1CG2A 2IM2A 1M5SA 5A8RA 1VBYA 3E8OA 2C2RA 1D9AA 4K4WA 1T03B 2RRBA 4J5OA 2L9WA 1U24A 1BGXT 4I6AA 2LKZA 4ZOSA 1PILA 2QA4S 3MMJA 4DFPA 2CZVC 2OFHX 5KT3A 1R3NA 1HNIB 2LDIA 1J5OB 4A8KA 1R0AB 1NB7A 2KTQA 5DG9A 3T5KA 4A48A 1LFWA 1RT5A 4NCGA 4FF3A 1JJ4A 1WI6A 5KG2A 2GMJA 2KU7A 4USJC 4C0OC 5B7WA 1DQ9A 4RNMA 4LUBA 2WCXA 2B5JB 4IRKA 4URSA 3TI0A 2O01C 3QYYA 4I7FB 3H2LA 1S10A 4MMOA 4B3OA 3TAPA 4RU2A 5GADU 2UUCF 3N5BA 4PG6A 4CNYA 4IR9A 1XERA 4J9SA 4QWEA 4KV8B 4NMLA 4FS2A 1QSYA 5AXNA 1H3DA 1N5YA 2V4JA 4QU7A 2EFQA 2K2PA 1URNA 3I0RA 2RS8A 2CYYA 3GFXA 3KLGB 4ITSA 4B9SA 1DTQA 2R2UA 1VQYA 4OJ3A 5KFOA 3FQLA 1OPIA 4FYDA 5EUHA 4Q43A 3ZZZA 4QIFA 5KFWA 2L3MA 1HNWF 1IN0A 3FQKA 3KLHA 3OFFA 4ZPDA 2GCFA 2PN6A 2IMOA 5AXLA 2BUNA 3QO9A 1D3WA 3MUVP 3CPWR 3CJ4A 2MDAA 5JVHQ 3RR8A 1HWJA 4LQ9A 3HLUA 3RTVA 4ED3A 2CG4A 2I0XA 2ALZA 4XO0A 1RTJB 2P6SA 4LJMA 3I0SA 1C1BB 1HA1A 3LGMA 5D4PA 5KFCA 3MURP 3R1HA 1SL2A 2BXJA 4FPRA 2J0SD 3I31A 2QEXS 1YSJA 2L08A 4IR1A 5DETA 2OSRA 2PEHA 2JVOA 1UL3A 3AB2B 5I4MA 1JLAA 3MEEB 1JKHB 3D1HA 2ZBCA 4WE1B 3PW7A 2PI4A 2K8GA 2FLOA