2QLWA

Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
b'GDMTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTRPKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RhaU
molecule tags Isomerase
source organism Rhizobium leguminosarum bv. trifolii
publication title RhaU of Rhizobium leguminosarum is a rhamnose mutarotase.
pubmed doi rcsb
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qlwA01
1R6YA 4ZOSA 2ASYA 3DCAA 4OJ1A 2AJ0A 3DXSX 1Y0HA 1N5QA 4QOTA 2K1RA 2OFHX 1TZ0A 1W2IA 3KNGA 4ZA1A 1CC7A 1TL5A 4A4JA 1WD6A 2K7KA 5B0CA 1VQSA 2GGPA 3BGUA 1N5VA 1CC8A 2AJ1A 2OD4A 2OMOA 2ACYA 1Q53A 4Q2MA 1S6OA 2IYGA 4Q2LA 2KT3A 2OFGX 4DL0C 2K1RB 1GXUA 3I9ZA 3TRGA 2K2PA 2RSQA 2OKQA 1QUPA 1SB6A 1TR0A 2QIFA 3BR8A 1P8GA 2OAUA 3KKFA 4DN9A 5B0BA 2EW9A 4HI2A 4Y2MA 1APSA 3TNVA 2VH7A 2HLTA 3HF5A 3FMBA 5IXUA 4YEAA 3BN7A 2BUNA 4Y2IA 3FRYA 4F67A 2RMLA 1X8DA 2JDJA 1FE4A 4HL9A 2XMTA 5B0GA 2PD1A 2XMUA 4A48A 1YJUA 4A46A 4A47A 1FVQA 3HX9A 4EFAC 5A6PA 2IFXA 1SI9A 2L3MA 5T7LB 5B0AA 3CJKB 4FNHA 2ROGA 1URRA 3T9NA 1FEEA 4OJ3A 2FHMA 1MWYA 1JK9B 2VV5A 2XMJA 1OQ3A 5B0FA 3BM7A 5A6WA 4OIXA 4HH1A 1Q8BA 1FE0A 2AP6A 2ROPA 2IYIA 1XBWA 1Y9OA 4NL5A 1RJJA 2GA7A 3MZIA 1KQKA 2K7JA 2HQIA 1Q8LA 4YDXA 1V3ZA 3CJKA 3FGVA 5T7LA 3TOQA 4DPOA 1YJVA 2Q3PA 2HFOA 4HH0A 2BJDA 3GZ7A 2OP5A 2ZDPA 3HHLD 3QMQA 3IWXA 1JWWA 1X7VA 1GXTA 2W4DA 2HLUA 3F44A 3LGMA 2QYCA 1YRXA 2G9OA 3MCSA 3KG1A 2FTRA 1FD8A 2N4DA 4HI1A 2LQBA 2GCFA 2XMWA 5KAKA 2ROEA 1OQ6A 1Q4RA 5B0DA 1FVSA 3HHLA 2KYZA 1N5TA 2RILA 5B08A 1YG0A 2XMKA 5K9FA 2LQ9A 2GFFA 1YJTA 5F0WA 3KG0A 3HHLC 3E8OA 2FIUA 4Y2KA 1KVJA 1U7LA 1VQYA 1SQEA 1X0PA 3HDSA 1MWZA 1TUVA 2BYCA 1ULRA 2QLWA 3HHLB 4OJGA 4U9RA 1IUJA 1P6TA 3BB5A 2XMVA 2W4CA 1S6UA 3WDOA 2ZDOA 1LQ9A 1KVIA 3VTIA 1FESA 2CRLA 1OPZA 2HFNA 2XMMA 2KT2A 2AW0A 4OJHA 2BBEA 3LO3A 2HIQA 2PGCA 3IWLA 3HFKA 2OD6A 3K7RA 2QLXA 1AFIA 1OSDA 3LGNA 2FB0A 1YJRA 2BJEA 2LXFA 2N4CA 2RU9A 1N5SA 2GO8A 3BF4A 3UDCA 1CPZA 5B09A 1Y3JA 4FNIA 2W4PA 1AFJA 2GV1A 3BDEA 2LDIA 2N7YA 1TL4A 3QGPA 1AW0A 1Y3KA 1K0VA 5F0UA 5B0EA 2KKHA 2GGPB 4NPOA
chains in the Genus database with same CATH superfamily
1LOUA 2BABA 4RWWA 5T14A 4YB1P 3G6VA 3G4SS 1N34F 4NXNJ 2C42A 5CYJA 2RS2A 2HFUA 3D6FB 4HHJA 4KIAA 1K47A 4TLRA 1HNVA 1YRUA 4HHHA 5BJRA 2BVZA 4WIIA 3PM9A 4A8OA 1EARA 5DLGA 4P2MA 1N5YB 4PWDB 2AQ4A 2YX4A 1WD6A 5AXNA 4DQIA 2KZZA 2Z2MA 1S6QB 3OL9A 5E3QA 1IQZA 2AV5A 2D3ZA 2XI2A 1IKWB 3CCES 1JLEA 3ZO7A 1VRUA 2AZ1A 2YNHB 2W01A 4OI2A 4ETXA 3GSDA 3BGRA 4ES1A 2F4FA 1S1TA 4QU7A 1S6OA 1U8SA 1UFLA 1JNRB 1UZHA 3HT0A 2DT9A 3W2VA 2J0WA 2KJWA 4Q2LA 1RA6A 1R27B 2HHTA 1NCLA 3TAMA 2W9CA 3I0SA 1XJWB 4CM0A 1EB0A 2YNGA 5KFAA 1UVMA 2KRRA 1Z2LA 2HNDA 2CDRB 4WBFA 2EFGA 2W2QP 3EWGA 4UOHA 3UO0A 4B3RF 1HHQA 3OTDA 5C42B 1J5EF 2KHCA 1BQMB 3CD5A 5ITHA 2KFZA 3CO9A 1H2UX 2BANA 2FJDB 3HF5A 4IDKA 4YEAA 5DQGA 2ZNYA 4NCGB 4QIVA 3MUTP 3B8HA 3CJTA 2XLIA 3CT9A 1X4HA 3TAMB 4X2BA 1EETB 2PDAA 3HHDA 3KLGA 1BGXT 1HPZB 3MMCA 4F2RA 4KKOB 3M2UA 1RB0A 2Z56B 5C42A 5L1LA 2XZDB 2EBGA 4TLQA 1TKXA 3KLEB 1KHVA 4P7VA 2LEBA 2QV6A 3HM9A 2HQFA 4R25A 4QYZJ 4EZ9A 2K3KA 4ZN3A 5C7PA 4DXLA 4C8OA 3ZZZA 1Y9OA 1FTRA 1RCXB 2NSBA 2RHQB 1FI4A 3WX8A 2DRAA 1S77D 3MM7A 4USJC 3BJYA 1HD0A 4NZ0A 2CNNB 1FKPB 1R8BA 3JQKA 5D6GA 1B4SA 4HYKA 1KHWA 1C0TA 2K3IA 4OI3A 4W4MA 2QMUB 4X64J 1VBXA 2MHEA 2CQPA 3NAHA 2UU9J 2XB2D 3M2RB 3J7A1 1MG7A 3M30B 4NOHA 3TWZA 2UVWA 3U1LA 1VC5A 2OGUA 1WACA 2QLJB 1JLBB 2MTLA 4HI1A 4QYRA 1S79A 4DPYA 2FLPA 3GR1A 1H74A 2OPQB 2E1AA 2DH9A 4WE1A 4HDHA 5BYRA 5K8OA 2HGLA 4KGZB 1LW2B 1RWKB 1RT1A 2DEJA 3H25A 1C0TB 2D3UA 2IBOA 1P1LA 2RILA 4UW2A 4J5OA 1EAYC 4ZIWA 3H5SA 3VAIA 3PW5A 1IKXB 1RYSA 3IAM9 5KFEA 1O8BA 4F8RA 4LQ3A 1X0PA 2JWNA 3OUYA 2EWHA 4GKJJ 1GMUA 2FHKA 2HVEA 4DMZA 1MWZA 3A8KA 4DV0J 2QLWA 1ULRA 3M8RA 4GVBA 4NA1A 3BEGB 2EFPA 4J9KA 3P4UB 4IRKA 1RGVA 4PRFA 1KKHA 3LAKA 1TP7A 4LREA 2BKPA 1IR1A 3IG1B 2BDPA 1XIQA 4UOCA 3IBFB 3RW6A 4ILLA 1U25A 2XSJB 4BDPA 2D74B 4O4GA 1Q16B 2HWHA 2VASA 5E41A 2OH2A 5LT5A 1T03A 2WVEA 2ADBA 2QLXA 2DY1A 3VR1A 4DFJA 2R2RA 2DCUB 2MLYA 3MEKA 4IO1A 4WFNQ 2FB0A 2ACMA 2PMHA 3EICA 4DOZA 1RAGB 2Z2LA 3MI7X 4LQ9A 4PXEA 2HVZA 1WC5A 3DOLA 1YWXA 3CO0P 1BQNA 2MZQA 1P9QC 5DDQC 3MAQA 4QQBA 1RTJB 1GX5A 2VOOA 1QM9A 5FLXY 1JLEB 1YJ9S 4DV4F 4FBUA 4N7TA 4CWBA 3B82A 4QR0A 4NLXA 5ETVA 1L3UA 1Y11A 3FDSA 3VAJA 2FQQB 1Y0HA 2WB1D 3OL6A 2QRRA 3MCNA 2RQMA 2DR6A 2JHEA 3RRGA 4LBIA 3PEJA 2HVIA 4X4NA 5KG0A 3US5A 1H6KX 4LR9A 1CC8A 3WIUA 2AJ1A 4YHHF 3QO9B 4OLPA 4OZJA 2HRYA 3CJ3A 3IM9A 1B3TA 4AYBD 2Y1RI 1NK0A 1KNZA 4EO8A 1SKSA 2YNIB 4EBEA 2V68A 4DPTA 4ECVA 1ZPVA 2AGPA 3MGJA 2DB1A 4ANCA 4GKJF 4FYVB 4U7UK 2IA6A 1RADB 2M5YA 4P6QA 2QZ8A 4DUYJ 1HBUA 3CJ4A 3UD4P 2VDIA 2UXCF 1NPKA 3QIPA 4HI2A 2VFUA 2A1BA 5KFMA 4B9MA 2GHVC 1NLKL 3CJ0A 3MEDA 4FZVA 5GAGI 3ZFVA 3OJUA 1N36F 2DJWA 1XK8A 3KMSA 2VG5B 3I55S 4DG1A 1DURA 1RTHA 4F02A 3THPA 2C3UA 1NDLA 5KFWA 2AT1B 2XMAA 2CUYA 4YB5A 1WEXA 2QA1A 4F2SA 2L3MA 1KFSA 1GAOA 4DU8A 3BREA 1B0TA 4WXWA 2MGZA 3BSNA 1VFJA 3FSYA 1QD1A 4J9OA 1H38A 3PY8A 3N5BA 3ZZ0A 5KG5A 1NJZA 3NBPB 1LKZA 4IOCQ 1CS4A 5GAHU 2ROPA 3EVMA 2GNKA 1QVGR 1BY9A 3RB6A 4HKQA 1CSJA 2HZAA 3KUGA 3M1VA 3GP9A 1C1BB 4HLBA 3RUBL 4F4WA 2HQIA 1JJ4A 3I5AA 5T7LA 4F4KA 3KLHB 4PQUA 1YBTA 3HD1A 1M5SA 3KG4A 3HVRA 2GVZB 4Q8FA 2ZDPA 1LWFA 2IDEA 4ZVGA 1RCOB 3C66A 4ED4A 3PR4A 2MDAA 4DQSA 4MH8A 1VIXA 2HLUA 2NXUA 5J2PB 2QYCA 3K5NA 4AQYF 1QTNB 4PWWA 4WK3A 5DRKA 1NKCA 4FYWB 2VC0A 2WSFC 3V81A 2QL9B 3GILA 1NJWA 2QT7A 2XNRA 3P49B 1FVSA 1BHNA 4IG3A 2B0GA 2AX1A 1WF0A 2HHHF 1HHTP 4Q45A 5K9FA 2HZCA 4YOEA 3ZZOA 4B3MJ 2KFNA 3CIZA 4FKYA 1WHYA 2F8EX 3D68A 2A6MA 3CCMS 1Y5NB 2MJNA 2YXLA 1N33F 5KG4A 4QWAA 1W25A 3I5BA 5A8KA 2OPQA 3DYAB 3M6XA 1G6BA 3MDFA 2DXEA 1AYEA 1KR4A 1IJFB 2ZBIA 5HK4A 4JI5F 3G96A 1WWHA 3Q8UA 2OPPA 4WFZA 1OO0B 3M6UA 2F8HA 3BQ0A 3UDEA 3W9IA 3EM1A 3OXFA 4DL2A 3VQSA 4GKKJ 1RKIA 4CO0A 1WDTA 1KLMB 4C4WA 3MM9B 4LIRA 2LQ5A 4K4VA 4CLSA 1FD2A 1FTCA 2PGCA 3BZQA 4CH1A 4GC6A 4QWEA 4CNZA 1VQ6S 5F8NA 4JP8A 5C24A 3PFEA 3GV5B 2OPPB 1G7CB 1YJRA 3NRBA 4ZITA 1L3TA 3DLKB 3TX0A 5D3GA 1N5SA 2ZOMA 3TAPA 3B78A 4V1Ak 3SQGB 2HHXA 2VBZA 4RR5A 2F7VA 1IBLJ 4MTPA 4W92B 5HQMA 4UTGA 4CTAB 2PC6A 2E5JA 1UJ5A 2PEBA 2WVDA 4JI3J 4M8LA 4USUA 4USWA 5H9FJ 5HMWA 2GHPA 1ACMB 3LA0A 1H98A 1NAQA 2LDYA 2P2CB 4JI8J 4QOTA 1N5QA 1F1BB 1UP1A 3K5PA 4KB7A 5F3ZA 4UQGA 3CF5Q 3G6ES 1S0NA 3EXCX 2PE8A 2ATLA 3BYPA 2WBRA 4KSEB 1Q8KA 1SKUB 4C7QA 1RTJA 3Q8SB 3P3DA 3DRXA 4DZ6A 2XM3A 4OI0A 4CLWA 4JI1J 2CPDA 1G4CA 2BX6A 2VPZB 3ISNC 1YIJS 3L7UA 1G2EA 1EP4A 1SL0A 2UUWA 2PEHA 1RP5A 4NLVA 3M6WA 2KT3A 3OBIA 3I0RB 5C5JA 3UDVA 4WFAQ 1D09B 1MW7A 3CEDA 1G1XA 1KRPA 2DRDA 5CABA 4U6PA 4DN9A 3CSKA 4USIA 2FJBB 2XGQA 2B9XA 1C2PA 3LQVA 1NKBA 1IM6A 5HJYA 1KEKA 4ID8A 1AUSL 2RMLA 2I2YA 2VOPA 1XNQF 2EG1A 2JDJA 3AQPA 1DARA 4HL9A 4ECXA 2AD9A 2VPXB 5GAEU 1U2RA 2VD3A 4FPRA 3OLAA 1HW9A 3EVWA 1RUSA 2IFXA 3H5YA 4DV0F 3GLJA 4RUBA 3J80U 2HFSA 4TQSA 2IM0A 3GR0A 3A8IA 1IM4A 4K4UA 1N88A 2VV5A 3C6UA 3PYDA 4KBIA 1S72S 3M4XA 3HHKA 5ETRA 2VC1A 1LWEB 2IYIA 4TKTA 1UEUA 2RD5C 1U1PA 1D9FA 3V6JA 2V2VA 4CLTA 3TAQA 2CFXA 3FKBA 3TOQA 2MKIA 4OHXA 4Y28C 4DR4F 2Y8WA 1HKAA 3IR6B 3M8WA 3DLEB 2HSEB 3SMZA 2JEGA 3UWTA 4V19J 5A8WB 3EJMA 3T1YF 1MROB 2LQJA 3JSBA 1QE1B 4F4AA 1C1CA 2IHR1 2QA2A 4DL4A 2IRXA 5KFJA 1PG5B 1X4AA 1OY6A 2HWIA 2QA4S 3SYZA 4K5RA 1F3VA 5KFZA 4BHQA 2H5IB 4NLRA 4OI1A 4DPWA 1X5PA 2ASJA 2M0GB 3DDNA 5E3RA 3TJAA 4TU7A 2DBBA 2R2TA 3Q83A 4ANDA 3C16B 5HLFA 2QTWA 4DF8A 4DPXA 1UL3A 2EPIA 3GIRA 4RNHA 1QAJA 3LPEA 4OZLA 2C3PA 1KLMA 2P9GA 4AL7A 4PYDA 1KD1T 3B54A 1L3SA 5L39A 4R5PA 3WC2A 1HBOA 4WP8A 5HI7A 4YR0A 2B5JA 5EX0A 3LH2S 2CQ1A 2MHNA 3CW2C 4OQJA 3HMJG 2FPHX 4DI6A 4RUHA 3OHAA 1VQLS 2HS4A 3SDEB 4DFPA 4M63A 4DEZA 4RNFA 5K14A 1U47A 1M90T 4IQXA 3UR3C 2W7OA 2KHDA 3SQGA 1RWNB 4OZ5A 2KVIA 4G1QA 1B0PA 1CJKA 1I6JA 1H0HB 2DO0A 2E9RX 2OPSA 3QGHA 5KG2A 2VONA 1UCNA 3LF0A 1ZS6A 2IJNA 1X4DA 3PX6A 2DGVA 3C14B 4MIWA 1FFSB 2V8HA 3M9OB 4RBVA 2YWKA 3HSGA 3UDCA 1HARA 2Y0BB 2R7WA 2HS3A 1Y3JA 4QYZK 3LGHA 4HEA9 2FVCA 3M8PB 1S6QA 3NG8A 4U7UD 1IWAA 1TL1A 1U24A 2A2DA 3MM5A 3QRPA 1RKJA 2E9TA 3RGIA 3EZOA 7FDRA 2W2NP 3BKFA 4TY9A 1KBRA 1WOSA 1Y5LB 2LEAA 3W9HA 1WTFA 3IAS9 3M8QB 1T9YA 3MMBB 2DR8A 1QAYA 5EUHA 2OFHX 3GIJA 1AZSB 4EYIB 3EE3A 3GIKA 5E0OA 2QO3A 2QJ3A 3MECB 1HI0P 5B0CA 4C8LA 2R7RA 1KN6A 1VQSA 3G2XA 2V69A 4K8RA 1WORA 2GJFA 2VPWB 3MM5B 5IS2A 3T1HF 4UUXA 3DDIA 3OTEA 2K8GA 1VQ7S 2C28A 2J8AA 5CH7B 3NMAA 4IOAQ 2FHJA 3H59A 1WTBA 2HHSA 1SCJB 2MYFA 3GJSB 4LF2A 4O3RA 2AKWB 1LXNA 4HVZA 3SQOP 2Z2ZA 3UD5A 3A1YG 3GFYA 5KOXA 1B0VA 2QE5A 2PFFB 5DS7A 1B70B 2CJQA 2VQFF 1P8GA 2HQGA 4PUOA 2NREA 1SIZA 2EW9A 1N56A 3KMQA 3VZHA 1H73A 2HHHJ 5KFOA 3CJ8A 5EX3A 1T8EA 1R8HA 2CWXA 3ZNUA 3PXGa 2YPZA 1DLOA 3QLHB 4Y2IA 2BQUA 2DITA 2YNFA 1LWEA 4XPCA 3D3CJ 2PD1A 3AD8C 2CJYB 1HBMB 3ONQA 2XHWA 3CC4S 2CQ3A 3BKUA 2D9OA 1WHXA 4WU2A 1O0PA 4OJ3A 5D4OA 2XLJA 4ED3A 1VC6A 1Q8IA 1K44A 3M30A 3KTQA 3M05A 2B7CB 5HN0A 1FKOB 3FEXB 1U1QA 1UVLA 3KLVA 1U1NA 2Z4PA 3DHXA 4RL1A 4URSA 1SJFA 4OYWA 4P74A 4RWXA 4B9UA 5CA5A 1AW0A 3CJKA 1GX6A 2OMLA 4Y3CA 5B7WA 3T6BA 4HH0A 1FWLA 4LF8J 2VBYA 3DU5A 3FRZA 2DHSA 1X7VA 2ZBCA 5HJXA 4K59A 1RWMB 4ZVSB 4TQRA 3K8WA 1IKYB 4ZLNA 3FK4A 2AIRB 2HHPA 5E3CA 3KJVA 3UW1A 1IBLF 4JI7F 4K2JA 2DHHA 1H3DA 4RKUC 3W2WB 2ATCB 1U2CA 1S10A 1RHUB 1NRKA 3J7YI 1PO6A 3ILOA 1I94F 2UV8A 4X4VA 1TFYA 1TL7B 2HFVA 4WFBQ 1VHIA 1S1WB 4J9SA 3RB3A 2HW3A 3TA1A 2LECA 3W3SA 5AE2A 4ED6A 3H98A 1UW9A 1CVJA 2MKKA 5K8MA 4JI0F 2G0IA 2DR7A 4JI2J 4M1KA 5IT4A 4KH0B 3TEGA 4KHPJ 4NLPA 2HFNA 2G1DA 4OZ2A 4RU2A 4E98A 1MMLA 3I82A 4DFMA 2B51A 1SC1B 4MK7A 2VA2A 1KQFB 3QATA 5GAEI 4JV5J 4ZVQB 5RUBA 1RAAB 1OSDA 2NXEA 1FHTA 2J7KA 1ZM3A 2RRBA 4B9TA 1T9TA 3AY0A 2B9EA 1HFEL 2C3YA 3D0HE 5AE1A 2MY7A 5HATA 2DGSA 4LFAF 1F60B 2E1PA 2W4PA 4C11A 4ED8A 1XR6A 5G0RA 1JNZB 2RRNA 5KG3A 3JYTA 1ZH5A 2CJAA 5ETLA 2N82B 2XQCA 2BQRA 1WJ9A 2R7OA 2GAGC 4DSLA 4DX6A 3KXDA 1U8WA 1TAUA 1RT2A 4ZKAA 3C14A 3UVJB 4OYXA 3W1YC 2G2ZA 1X60A 2ZJQQ 1NK9A 2L41A 2K1RA 3RR7A 3EUNA 1TZ0A 4RZRA 1U1OA 3R2CJ 3RB4A 2HQ3A 4OZ1A 1FFGB 3RRHA 2DO4A 4JI6F 4EGLA 3EMTA 3LP1B 3MAHA 2ZUGA 4I2QB 4JV0A 2JJ4D 3ZTRA 5KT2A 1QSLA 4DR4J 2WOMB 2N7CA 3QIDA 2Z30B 3H4BA 4YFUA 2CYYA 4DV4J 3ULHA 2XGPA 1FNXH 2DR5A 3IS9A 2ILZA 4PQAA 1GMWA 5HMYA 1YJ7A 2ZH7A 4CO2A 2G2OA 2ZH9A 4MIAA 3TRGA 3OT9A 2KXFA 2CZ9A 2J5AA 2OKQA 4K7QA 5AXKA 1WKKA 2JFDA 4LF6J 3HO1A 3BR8A 5KFYA 5D15A 3KUEA 3MR7A 4AXIA 3UI3A 1T3OA 2VH7A 2KI2A 1JLCA 1TKTA 4DV5J 3DN9A 2V0NA 5HROB 3RBEA 3PW7A 2L48A 3LP0B 3W2VB 2W9BB 4EZ6A 2GIQA 3HKWA 1S0VA 3I0SB 5FDLB 5B0GA 1PBUA 4A8SA 2OJ3A 2EVZA 1NDKA 1HNIB 3GFXA 1IQTA 1FEEA 2FHMA 2R8KA 3HJVA 1REVA 1RT7B 1JXVA 2NZCA 4PZVA 3SFGA 3HD2A 3R5AA 3BDPA 2HPUA 1AB8A 2X7IA 4I64A 1EKSA 4P10A 1VQ5S 3JSRA 2Q43A 3H2VE 1DTQB 5E5NA 1IKVB 1O6XA 5IM0A 1RI7A 1VDHA 3BBBA 2QN6B 3FC9A 4IG3B 3M2UB 5HQ8A 2HFOA 1FKAF 4RO0A 1S5ZA 3OR2B 2GIFA 4ZJQA 4NA2A 5ETSA 3C6UB 2UXDJ 1UKUA 3K5MA 3QMQA 2RKIB 3EGZA 5D0GA 3TJ8A 4ETZA 3LANA 3JXOA 5EWFA 5H9FK 5BR8F 2DGOA 2FTRA 2ZH8A 2ZHAA 3KJQB 4OYZA 3DRPB 3OVSA 1RISA 5CXTA 5KAKA 2DHAA 1HWKA 1IKVA 5IM0B 1TMMA 4LRFA 4Q7AA 2FLNA 4NI2A 2HG4A 1IJEB 2JVRA 3MMJA 3S1TA 4RNNA 3T5JA 4PQUB 4TVAB 4AL6A 2DNGA 1VQMS 4USVA 1S9GB 3T19A 1HL6A 5KFTA 3Q8RB 2WVCA 1ZOTA 5DDPC 4KGXB 4Y2KA 1DZ5A 2MKCA 4CRJA 2C2ZB 2VG6A 3KFWX 5C25A 2KVQE 1VQ9S 1FJGF 3UCGA 4YMEA 1VRQC 2DGTA 1CJKB 3A13A 4CT8A 3RBXA 1D0EA 3MM6B 2V4RA 3KK1B 3M7VA 1KLNA 4U9RA 2NYIA 3D2WA 2C3OA 3D0IE 4ZVTB 3WX4A 3KK3B 1ZTWA 5K20B 2NUUG 1UVJA 4YQWA 1VMBA 4XPEA 3VAKA 3QJPA 4X4SA 4F0HA 1RT3B 4ZVRB 3DOKA 5LXRA 2W7PA 1SJRA 1N33J 3Q24A 5HP1B 1VYAA 2PA8D 3HHNB 2RIJA 4U96A 1VRTA 3CMES 2C2RA 1PC5A 1RT6B 2CPXA 4ECWA 4Q0BB 3JTPA 5I3UA 5K8PA 5J1EA 3UD3P 4O4RA 3ENVA 4DCOB 1QSYA 4DR7F 1DQ9A 2XZTB 1WC0A 4GC7A 3KJFB 4DSEA 4ZDNA 5SZTA 3OVBA 4OYOA 1RT5B 3D0GE 3TA2A 2GC8A 2FHOB 5F0UA 2ASDA 2NS1B 1X31C 2B4VA 2AJQA 5KFUA 1XMBA 4USHA 1PJ6A 1IKWA 1R8AA 1YKWA 3UN2A 1LWCA 3J81U 1FNMA 4WFXA 3G8SA 2BE9B 2YNHA 2M7SA 5E7OB 1E6YA 2V8PA 2YWHA 3OFEA 2LQ8A 4NRTA 3DCAA 2DNOA 4PPZA 4A8KA 1PJ5A 2DCLA 4MIBA 2R2SA 4A8XA 4A8YA 4YR2A 5F9NA 3H90A 2HAFA 1HWUA 4ICLB 4KFBA 1A7GE 2BW7A 2DEIA 1CC7A 3M8ZA 1GTEA 2GMHA 2DXDA 2VKZG 3O44A 4UZCA 4QWBA 1ZZFA 2XS5A 1RT4A 4RW7A 2GGPA 4CO1A 5EGYA 1EQMA 2RNEA 3J7YU 4DV6J 2FVQA 4ERDA 1LWCB 2N3OA 1RT2B 4E2FB 4ECUA 1TFWA 1FERA 1S1UB 1BE4A 5LM7E 4DPUA 3IR7B 3BBFA 3NS6A 3UVJA 3V4IB 3FBFA 3HK2A 3VHQA 3E01B 4LFCF 3L09A 4NCBA 2UXCJ 3VGUA 2XZWA 2EXUA 1EETA 3NS7B 3W66A 1QUPA 4FKXA 4AUKA 1S0OA 1EX8A 3L95X 3MMAB 4DCJB 4IUFA 4CM2A 2WBMA 5B0BA 1RWWB 1RLCL 2VFTA 2B4UA 2FHJD 3P5BP 4K4ZA 2R3VA 2ZE2B 3FMBA 4WFYA 4BWMA 3IS9B 3V4IA 4NE9C 3FRYA 1CS4B 3ETMA 3W5YA 2JLFA 1NB2A 2IAJA 1SJ1A 1H2VZ 3DLGB 2XG8A 3ILLA 4RW4A 4B9VA 2I1RA 2GW8A 1CJTA 3OL8A 4EFAC 2H54B 4C48A 2HAIA 5IV3A 1S9FA 4Q8EA 4FP9A 1NEEA 2BZ2A 1KWMA 1UJ6A 2W24A 2ROGA 2XSFA 3D1OA 3NGUA 3CMQA 2MXYA 4CLKA 1TL3B 4JI2F 1M1KT 2E66A 2H4YB 4ZLLA 1SJQA 2FGCA 2H5EA 3LTOA 4IG0B 1F9HA 2Q6BA 4J9RA 2W9BA 5F8GA 1XBWA 2OEMA 4CLUA 5KFBA 2D3OR 1I51B 3DRPA 1NKEA 4DR5F 2IBKA 3SIPB 1JQGA 4X4TA 3KLGB 4YY3F 3C2PA 1V3ZA 2W2OP 2XY6A 1RT1B 3K57A 2IM3A 1SVDA 5DQIA 2ZOFA 1Z1ZA 5HAOA 5FLXU 3MCMA 3UQSA 1BUXA 4ED7A 4NLGA 1M1GA 4LT6A 2Q1LA 5HVGA 2AYBA 3H8YA 3RG6A 3CDEA 3D6HB 5A8KB 3BQ1A 5J1PA 3PX0A 2DR9A 2BA9A 3DYAA 4P2FA 2WHOA 4ED1A 1NHUA 1Q4RA 1MMNA 2BOAA 2G13A 3D6TB 4WIQA 3KK1A 3HHLA 5HBMA 2P5VA 1MN7A 3RBZA 2HZVA 4TYAA 1FF2A 5D4PA 3PTWA 2LQ9A 4M5LA 3LPYA 1GQEA 1MROA 2C2NA 2QL5B 1CJVA 4I6WA 4P75A 5ETPA 3E8OA 3H7HB 1R0AB 1VQNS 2FC8A 2UUAJ 5G4DA 5DQHA 3IRXA 4L74A 1XMQJ 2ASLA 3GIIA 1UZDA 1F5BA 2RDJA 4G1PA 4OJGA 4NEYA 4RW8B 2KM8B 3CD0A 2CZ4A 3PR5B 1GEHA 1NPPA 3BB5A 3ETOA 3T41A 5J1EB 4FBTA 2V67A 2XMVA 5CYMB 3NMRA 3N79A 2I0XA 3PRBA 3D4JA 1S6UA 4PG6A 1R7IA 4CYUA 1DQAA 1HBNB 1U4BA 1D8ZA 1IXKA 3H0PA 4BLGA 4C11B 2HHUA 1JKHA 1LFPA 2CJBA 2DTJA 4OYBA 4ZS6A 4CZCA 5HO4A 3V5RA 5KFDA 1XC9A 4FF1A 4K50A 2V4JB 2Y9HA 3KLIB 5IQ6A 2HWTA 2D7SA 4K4WA 4O44A 4ECSA 3K5OA 1KS2A 1NK7A 3MAAB 2OSRA 4MJKA 1RYRA 3PW2A 4LSZB 3PIPQ 2WVBA 5J1NA 1T0TV 1K73T 1ICEB 4X84A 2ZD1B 1T11A 2R7QA 1O5JA 3MM8B 2WZ1A 3RW7A 3RYLA 2HEKA 2VIHA 1XNRF 3AB4B 2XC9A 2LU1A 1FRKA 1OIAA 1XMOJ 3CPWR 1R6YA 2LVWA 3TZZA 5LMNJ 2CNKB 4O44B 1EP4B 1Y4ZB 2V6AA 2AJ0A 1GTHA 3FSIA 2CPYA 5A76A 3V6DB 2ZZNA 4QPTA 1S57A 2DNLA 3QT8A 1D9AA 3L9ZA 4GRSA 5F9LA 3HPOA 2MB0B 3JQJA 1UA0A 4RNMA 5CYQB 1P27B 4K4YA 2G0CA 2GX8A 1ZZNA 1GT8A 2LU2A 4X64F 3QWUA 2RQ4A 1BQMA 4FN5A 4GO7X 2HNZA 2UU9F 1HIYA 1WKJA 4NLTA 8RUCA 2VG7B 4HT5A 2YVSA 2V2QA 4ELUA 5CZXA 3V4MA 4DL0C 4A8QA 1MMDA 3S01A 2ZVIA 3Q86A 2K2PA 2KH9A 4NXMJ 1WELA 3TYTA 3MWBA 2UUBF 1T9XA 2YY3A 5DG8A 1RAEB 1Q78A 4K4XA 2XYHB 1YTYA 2FVRA 4M5HA 3PJ9A 1VRUB 3TNVA 4MFBA 1S7HA 3D1HA 4LSNA 3OJSA 2QSWA 2R7VA 4KPYA 1DAXA 4Y65A 5A0YB 5HMXA 3SZ2A 3U7JA 5GADI 4JYAF 2ZH3A 4YN3B 5IC4B 3E3XA 2CG4A 1YRTA 2XMTA 3CJRA 4ID5A 3WHIA 4A46A 4ATNA 4TY8A 2CAJA 2HKEA 3CCSS 5KT6A 3GG1A 2F9JA 4G1IA 4UY85 1VIOA 3QBCA 4OX6A 1CG2A 5DLFA 2RKIA 2M4MA 3W8PA 3KLFB 2XTJP 1JLBA 2YNFB 2ZH6A 2JEIA 2BKOA 1PYSB 4LRDA 2XS7A 3KJVB 3EX7B 4UT4A 2HMIA 4NCAA 1HYSB 4I56A 3OFHA 3J81Y 2CWKA 2YKPA 3ITHA 1CQNA 2Q3PA 1VR6A 2IVMA 2PN6A 2ZHOA 4P73A 4B9NA 2BJDA 3GZ7A 4RX6A 1TKXB 2B43A 2LP4A 4WJBA 4FYYB 4Y0FA 3KLEA 4EEYA 2EC0A 4XAKA 4BCAA 3GJRB 5L9XA 4B9LA 4LSLA 1AUDA 1OS5A 2DKOB 2ZEJA 1IBCB 2BJ7A 3OUYB 2OPRA 2XMWA 2BACA 3NGRA 4H4OB 1RAHB 1U02A 3MM6A 5D77A 4I0WA 4I2PB 3N01A 5HSPA 1T7PA 2NR0A 2RDIA 1VQ4S 1UJ4A 2GVDB 3MCOA 4LR7A 1U0HA 5A8WA 3SDEA 3C19A 4KY3A 2RAQA 3LWLA 2AYGA 3PKMA 3GWCA 1SQEA 2CJXB 1IR2A 2A18A 2HGNA 2W1BA 4K5SA 4QPXA 4JI7J 3BN4A 3GE9A 1KQGB 1KFDA 1CJUA 1RWVB 2FLOA 1TUVA 1NSPA 4OYPA 1RT6A 3UCUP 1R0AA 1F6TA 5ETOA 4NLWA 4F04B 2AEMA 2Q79A 5I3UB 4YHHJ 3TVZA 4JI4J 2ZZMA 3C15B 1U09A 4KTQA 1S1VB 4CLZA 2CPZA 1I3OB 1T94A 5T41A 2CPIA 2XMMA 1SQGA 3QAEA 3W5ZA 2ZH1A 1WC3A 3I9V9 5D0EA 4YR3A 3I31A 3ZZUA 3FBCA 2BRLA 1TL1B 1NMEB 3K7RA 5LSOA 2ZM6F 5ETTA 1JLQA 1HMVB 3GTYX 3S6EA 4ZCIA 2VPYB 4JUZA 5DG7A 3MXHP 1QDUB 4WF9Q 3O6QA 3DI6B 4E8UA 2RU9A 1S1VA 2WW4A 3CDWA 4MYTA 4WU3A 2VQEJ 3T5HA 1CPZA 2E7VA 1HI1A 5KT5A 3DLLQ 4LF7F 4LFBJ 2M70A 1IWGA 4NLDA 1N5YA 4DQQA 1K0VA 3QGPA 3QFWA 3MECA 2E7XA 3EVOA 3Q8YA 4IFYB 4ZP9A 2E5LJ 3B4MA 3BS9A 2MQPA 3D7SB 3N6MA 4L6V3 4P2XA 1J5OB 1YJWS 3CC7S 3SSRA 3HFZB 4DR6J 3OTCA 3NWGA 1NH8A 3OXLA 3QZ7A 1WC6A 1PSDA 4LVNP 6AT1B 1NSAA 5KFQA 1J27A 1UPMB 2RUSA 5CD4H 2MZRA 5L1KA 2VA3A 3AA8A 2AMCB 4YB6A 4KJIA 3I87A 1V6HA 3BGUA 5BYQA 2DPJA 3P45B 2V8GA 4EU0A 2W8KA 1UAWA 3A3OB 3PJWA 2C2MB 3AOBA 4PYAA 4DL3A 2RVJA 1N34J 3R3TA 2LLZA 3ENQA 4OHWA 4FVCA 4ZVHA 1GXUA 2V9KA 3MR2A 4QU6A 1HQEB 4RUCA 1Q95G 2QIFA 4O3SA 5AT1B 1U6ZA 4OI4A 4J9UE 4IRDA 3LP1A 4ZVOB 8AT1B 1QAXA 2J9EA 4FVMA 1UVNA 2WCXA 1NH7A 1V5IB 1VBKA 4DX5A 5L1IA 3OSNA 4CIOA 3BKTA 2B56A 2RRAA 3MPUB 3FQLA 3QGGA 1EHWA 3CJ5A 3SSQA 3OW2R 2FZGB 5CZVA 1N0VC 2KN4A 2JSXA 2WVFA 3FCWA 3HX9A 2HNDB 3JQMA 4A47A 3JTOA 5A6PA 5KFFA 4WPAA 3KLHA 5LMUJ 2B6AB 4IFVA 2HYIB 4KRWA 8ATCB 3OR2A 4CO4A 2J0SD 1JK9B 4LVOP 1OQ3A 2E1RA 3BM7A 2BANB 3ENWA 1HNWJ 1S0MA 5D0RA 4ZLPA 1JLAA 1FE0A 4LRAA 3DC2A 2GO9A 3NGKA 1PYTA 2HK2A 3GMGA 2GA7A 4ID5B 4KYZA 4DR3J 1R89A 3R5BA 2Z0GA 5ETMA 3BGFA 3D28A 1RTZA 2GIRA 2R4FA 3F56A 3J7AN 2B8PA 4HTIA 4RLEA 1D1UA 1JB0C 2FZCB 1KVKA 1S9GA 1X4EA 1GXTA 4N8NA 1SH2A 1O51A 4PKDB 4KGVB 4CLLA 3MFIA 5GAHI 3M32A 4EWTA 2M2BA 3I56S 4DS4A 1NK6A 1VISA 2LXUA 4F26A 1HYSA 1KTVA 2ROEA 2WK4A 4TU9A 4ZK7M 4JI3F 1Q1KA 2ZHBA 2UXDF 1WSVA 4KR0B 5DETA 1SKWA 4W90B 5IFMA 3HHLC 4K0KF 4P71A 3GSIA 3VGVA 5FJ4A 2P8IA 4NZ6A 3DOKB 2UUCF 1YLXA 4RW9B 4HACA 3W2WA 3FBBA 3PYEA 4ZVUB 4WTOB 5I42B 2FY1A 2YQ1A 3NOGA 2BJ8A 3G82B 1MSWD 2Q6CA 3K59A 2AF6A 4Y2AA 4DX7A 4KC5A 1TKZB 5HLFB 1TVRB 1S76D 2DRBA 2FY8A 3MTKA 4P72A 2MSTA 1CBKA 1C4CA 2FYXA 3MPVA 3M9NB 2EFOA 4HR2A 1FESA 1OWXA 5KFLA 4DHVA 3T5KA 3PVXA 1VC0A 1Y7PA 1BWVA 3HULA 1T9UA 2EC2A 1OSCA 2FJVA 4HACB 1NU4A 1SKRA 2CIMA 4YUDA 4CTAA 1KP6A 5CCLA 1E6VA 2E7WA 4N5SA 1R0BG 4M5IA 3AB2B 4R8UA 2LXFA 4N8OA 2CQ2A 5KFXA 4DV3J 2CQHA 2J6UA 3F0NA 1EKRA 2GO8A 2MLXA 2PO4A 3EGVA 1WG1A 1LWXA 2GQQA 4XDDA 5D78A 3MOZA 4DR2F 1T05B 4FNIA 5HVHA 5L1JA 3RRKA 3DM2A 3HP6A 2CADA 1FRHA 2IMWP 4OX8A 2F3JA 4AFFA 2MKSA 4Z37A 3P6YC 1WHWA 4WYLA 2ALYB 3H4DA 3NNAA 2EEYA 3MF5A 1RU2A 1UEKA 1X4FA 3QO9A 2CVIA 1FX2A 4ITSA 4DL5A 2XY5A 1GK8A 2VBWA 4L73A 2CDQA 4JV2A 4C3KA 4UOGA 3BQ2A 1PGZA 3R6LB 2MZSA 5E3PA 4ZHRA 4WP3A 3CDAA 3P5TL 4KH1B 3K17A 3ZZYA 4N56A 2GZOA 2YBVA 2QA4G 4Y34A 1RQ0A 2ZBRA 4PUOB 3DHWC 4BBYA 9RUBA 4WP9A 3PRVA 4PXDA 1YHQS 1TELA 4G6VB 1FRMA 2ACYA 3MEDB 4NYPA 1RBAA 5AXLA 3CJ2A 1KOHA 1VGYA 2BE7D 4PWDA 3K8VA 2RSQA 2DNQA 4MKAA 4X4PA 2F5GA 4H4MA 3SEOA 4DV6F 2VJUA 3R27A 4I6AA 3M9MB 2V8VA 1JXEA 4ELVA 2HLTA 2H5JB 5IXUA 2C2KB 3TZWA 2VG7A 4NYOA 5IV4A 1D3WA 2YNIA 3CVKA 1S12A 3VWSA 1PIEA 1Q86T 1VLOA 3PKYA 2EBEA 3U02A 4DV7J 2XS2A 1FRLA 2HNYA 2W2MP 3UFCX 9ATCB 4Y2CA 1SQFA 5KFHA 4MT1A 3DLBA 1Q82T 1RXOB 2FVSA 1WC4A 5T7LB 1S48A 2V2KA 2AU0A 4ECTA 3L7OA 1HWIA 1MWYA 2CZVC 1JLFA 2M52A 3OXGA 3HZEA 4I68A 4KPCA 4LSNB 3TR5A 4JI4F 2FDNA 2QX0A 1XTZA 5A2QY 2DISA 1Q8BA 3DXBA 1WHVA 1FNOA 2DHXA 2UZAA 4ZLJA 1LW0A 4RW4B 1IBKF 4DG1B 4A8FA 2VZ9A 1RJJA 2LCWA 1T95A 1IR0A 1VOMA 2DD8S 4NI2B 4WKRA 2H1YA 1DFDA 3CNQP 3OFFA 4UOFA 3CCUS 1JLFB 2YWWA 4UF4A 1F3FA 2RH3A 3LW5C 4C8KA 3ZZPA 2JZ5A 3TVYA 4EUVA 2ZH2A 2VQEF 1F5AA 3KLFA 3KUHA 5IZHA 2KXHA 4ZJLA 3TQEA 3TUZC 1FD8A 4LFBF 3C8YA 1UTAA 5LL6d 4XO0A 4DSJA 2MKYA 1H2TZ 3BR9A 4YY3J 2E5LF 4OL8A 4CLFA 4NYZA 2AWZA 3D67A 1RDRA 2MEWA 2OTLS 2CPFA 1YG0A 2CVEA 2BOPA 1YJTA 1WUUA 1M5HA 2J7UA 3NOCA 3A8EA 2X51A 3M32B 3PW0A 4K4TA 1B7FA 1RU1A 3AAWB 2BE2B 4QW8A 3ZXWA 2IY5B 1TV6B 2GMLA 1KDNA 2CNLB 3ZTQA 3GG0A 1VQ8S 5JUMA 4ES2A 2MZTA 2PFDA 2ZWPA 3N28A 2XO7A 1CJVB 4TN2A 3R1LA 2I8EA 3K5LA 2CRLA 1OPZA 3DKDA 4EBDA 3SI8A 2D3O1 4I67A 1RK8A 4KHMA 5IQQA 5M2PA 3EGWB 4NA3A 2VQFJ 3C3LA 5ETNA 3FNNA 3UNYA 1HBOB 1GFWB 2MSSA 1T02A 3JAMY 3K0JA 2HRUA 4YB7A 4QWDA 1X4CA 4RNOA 5CYMA 3HLUA 1MWQA 1DBDA 2DY9A 2OI2A 1KC8T 4P52A 5D0HA 1HBNA 2BMBA 2OLWA 1U49A 3OTOJ 3N9UC 4KHRA 1RBOB 3R5CA 2GGPB 4NPOA 3KHRA 4I2QA 2UP1A 1XERA 4LMZA 1FA0A 2ZH4A 4ZCLA 5LMUF 4OYMA 4B3OA 2AHOB 2MQOA 2V34A 2P9CA 1T9VA 3DLKA 3NLCA 5KT7A 3RTVA 5D3GB 5FIIA 3MAAA 2GMJA 2QL7B 4IYQA 3DXSX 5KFIA 1ZPWX 2EK6A 5L8RC 2MZ1A 1ITPA 1L5UA 1W2IA 1WOOA 2XHCA 5BYSA 1YX2A 2P6TA 2QLBB 3FCHA 5LMNF 3R1HA 4CO3A 4N41A 3EXYA 1V9OA 1FRXA 1HBUB 4F25A 1XNRJ 5IWAF 2OD4A 4B3RJ 1XMOF 3NCPA 2FVPA 1KONA 2F4VJ 3H42A 1SJ4P 2AEFA 1FJCA 1WOPA 4Q2MA 3OR1B 2IYGA 3B4DA 4PG7A 4URQU 2R9LA 3ILIA 4Y00A 2H65B 4UY8T 5CD4A 5KTQA 1SXLA 2NLWA 1NSKL 4NLQA 3Q23A 5DGAA 2MJUA 2UVUA 4FXDA 2H51B 2YH0A 3EPGA 5KT3A 3PHEA 3A3NB 2WOMA 2EG2A 2BQ3A 3MOJB 1DTTB 1S1TB 2N3LA 1OJ4A 2BUNA 2H9ZA 2HIYA 3CTRA 3OFGA 5DO2A 3GV7B 4K0KJ 1SH0A 3MURP 3PZPA 3LP2B 5HQLA 2E1MC 2WSCC 3D9BA 4DSKA 4M5MA 1UEVA 4NLYA 2P9EA 2V63A 3NY0A 3QWPA 1GXLA 3A3PB 2PT0A 2J0XA 2JVOA 3CWJA 3NKYA 2VFSA 1U2FA 4M5GA 3VQTA 4N47A 5GVQA 5HROA 4ZIVA 2DK2A 1V3RA 3DMJA 3IM8A 1K9MT 2HHWA 1FDNA 3DRRB 2AYMA 5GADU 2IJRA 3AH6A 1XNQJ 3HSJA 3HI9A 3ZTOA 1HBMA 2WONB 2YX1A 1U6FA 3GPAA 1VJWA 3HSZA 1HHSA 3MMCB 2E44A 4QR1A 2H3EB 4ANEA 1M5PC 2A10A 3M8YA 3QAUA 4DN0A 2VUGA 1NZAA 4ZVFA 2ZC4A 3DMJB 4XTTA 2AZ3A 4LFAJ 3IGNA 4DR2J 1LW0B 2DVIA 2LQBA 2V5HG 2E5IA 3IO1A 3ZZTA 3UR0A 3CCTA 3B6BA 1HWJA 3MM7B 3CE8A 4MMOA 4PXCA 4QW9A 3VAHA 2Y1JA 2E1CA 3QYYA 2QMXA 1YQHA 3TO8A 4L3NA 3IWNC 3H40A 3DGPA 3IXQA 4OI6A 1N0UA 1OY9A 4OX9F 3TARA 1ZM9A 2XYPB 3RZAA 3QQCD 4USTA 3IMQJ 2NYHA 4I1TA 3OVAA 4DL6A 4B3SJ 3J81j 3GYGA 1JKHB 3HDSA 1ZBTA 2F8MA 2XBPA 2HVDA 2BYCA 4J91A 5AE3A 1JLQB 3KLIA 3WIVA 1HW8A 5C24B 3GCXP 3AFGA 2OELA 3CCLS 1FEHA 2CJ9A 3QFHA 3CD7A 3T1AA 4D3HA 3V6KA 4DF4A 3D54A 1TL7A 1NB7A 2CQDA 1KVIA 1S6PB 2X1BA 3T5LA 1Q5YA 1RLDA 1SH3A 3QT7A 4KAIA 1LEOA 3KJNB 4NMLA 1HNZF 3FCVA 3TUIC 1ZETA 1K0TA 3THTA 3HJFA 2JEFA 4MKVA 2XI3A 3EZ5A 1FXDA 4IKAA 1M5KC 2LXIA 5L46A 2N4CA 3WC0A 3SFUA 3IG1A 5B09A 4KO0B 1UWBB 3AXKA 1IBMF 3ELHA 4RW6B 1SIWB 3OQ2A 1X0FA 5DJBA 3LWMA 1URNA 3VGTA 5LJ3Y 1N52B 1BXNA 5B0EA 1ZA1B 3ZC4A 5L9NA 4ZJOA 1XR7A 4RU9A 3D1QA 3PHTA 1QVFR 3G9CA 3HT3A 5GMDA 1N4LA 2DGQA 4QIGA 1CQMA 3BSAA 4LF9F 1TUGB 1ELOA 4U8VA 1IBKJ 1Q0NA 1BQNB 3R7BB 5KT4A 2DH8A 4ER8A 4H4MB 4ZPVR 4LRBA 5G0RB 3NXZA 2I6WA 3VZIA 4PR6A 3T3FA 1LK7A 3A12A 1EJ7L 4ZN1A 3AOAA 3NGSA 3PEHA 1VK8A 1ZA2B 3SSSA 3DDKA 2QYGA 2W9AA 1P1TA 4F4ZA 1Q53A 1AT1B 1S7IA 1FDDA 2IPOB 3LP0A 4NMXA 1N36J 2CNOB 1X5SA 2RQKA 3UDLA 1LV5A 4ICLA 4G3IA 2E5GA 1RTHB 4ILMA 2ZH5A 4ECRA 5I3PA 2GQCA 1SB6A 4LR8A 2EFNA 2L9DA 2MQ8A 4S0MA 2J9DE 4RW7B 2BM1A 1QSSA 4C3MA 4I4BA 1Q7LB 1RHQB 1SBRA 3Q8VA 1OPIA 2DNHA 1RT7A 2MPUA 3BGRB 1M0SA 2MZJA 2NQPA 4J9MA 1JLAB 4C8YA 4P9SA 5LJ5Y 4Y6IA 2KFYA 5J2QB 4OZNA 2HMIB 2RDDA 3FJ2A 2MQNA 1MNEA 4IH5A 4ZVEA 4WWSA 2NXNA 3FQKA 4FNHA 3GIMA 2C2DA 1URRA 4NXNF 4DSIA 1C0UB 1GNKA 4FF4A 5F8MA 2MKHA 2YQ0A 5B0FA 2HS0A 3ZTSA 3Q8QB 4HH1A 2IVFB 4NCGA 5H9EJ 4RBUA 4ECYA 2UUTA 2BR0A 4NL5A 3UNGC 3MEEB 4TU8A 2IIHA 4YDXA 5E33A 4OHZA 2NCKL 5I4MA 1S49A 3AD7C 5EDWA 4LBPA 1RAOA 3QPIA 4ZPAA 1XEZA 3DRSA 2H4WB 3ENAA 3DGPB 3HHLD 4DDFA 3K2YA 3NBPA 3G8TA 3KHGA 1RHJB 3TEHB 3R9LA 4B3TF 2PI4A 3HZGA 2R7XA 3PO5A 1OY8A 3OTOF 1SUQB 4UUWA 3K58A 2BE2A 2GCFA 1NNDA 4NLOA 1VCTA 3AJDA 4RW9A 5A8RA 3MUMP 3VAMA 5H9EK 3GJQB 4DV1F 1X9SA 1HWLA 2XULA 4PCQA 2YKNA 2IVYA 1FO1A 3AJ2A 3IA0A 2ZVSA 3U27A 1FJ7A 3JS9A 3C15A 5CCMA 3DLJA 5IT0A 3KG0A 1G3OA 1QLNA 1QJHA 2O66A 2QMWA 2RF2A 3HVTB 4WTYA 3TW0A 4CCHA 1UPPA 2KJVA 2VHGA 1KVJA 4QIEA 2XSJA 4LF9J 2OO4A 4HT7A 1WI8A 4O23A 2CKWA 2B3TB 3LUYA 1WDDA 2V4JA 1I94J 4DR1F 2M9KA 4IR9A 2ZJPQ 2QLFB 2YQ3A 2V9WA 3AQOA 1U0HB 4R8UB 5CHCB 4C6AA 2M8HA 2W4CA 3W7BA 2F4VF 2OHDA 3P96A 3WDOA 4I7FB 4ZMMA 5DGBA 2AW0A 2JLEA 3M8PA 3VF0B 2IRYA 4EMDA 2QSFA 2OD6A 3HFKA 1AROP 3PDNA 4RW8A 4YDDB 1AFIA 4DQPA 1H72C 2Y0SD 4F36A 4JI0J 3I4PA 2BJEA 1E6YB 5D4NA 1RTDB 4DX8H 1JJHA 1VLYA 3R6GB 1VHFA 4ILRA 3W9JA 4BC9A 3D5MA 4PABA 1FT8A 1RHKB 4GMKA 3RAQA 3EDRB 2N7YA 4QR2A 4IQMA 1TK8A 4PXBA 4ES3A 4X65F 2V2ZA 1NDPA 3AD9C 1TTHB 2KO1A 4KV8B 3KHLA 1M5OC 1X5OA 4DV3F 3MEGA 1RHRB 4HDGA 4OJ1A 3E01A 4DLEA 3NAIA 3SCIE 1CULB 4RUAA 1TQLA 4J37A 5A2QU 3GYXB 1DY3A 3MFHA 4J9NA 4EBCA 1T05A 3KNGA 4ZA1A 3R7NB 1PYOB 3VAFA 1K1SA 2FD2A 2VU5A 2R2UA 1S4EA 3PV8A 4DFKA 5AJ3J 4DUZF 3MPYA 2YKQA 3R8YA 2O67A 2APOA 2K06A 3UN5A 3FEZA 3SV3A 2R7SA 5DZ7A 1VQOS 2LYVA 4ECZA 1PAEX 1HQUA 2HRTA 3G8QA 1L3VA 3J7ZT 3E51A 5CQGA 1HNVB 1U1RA 1UWAA 3DLGA 4LBHA 2JLGA 1X4GA 2V50A 5J2QA 1YGYA 1KQSR 1CJTB 2UVRA 4GO5X 3ZTPA 2OIHA 2HHQA 4HTJA 2OAUA 2BM0A 4KKOA 1FXRA 1A0OB 1HLWA 4Y2MA 1NZ8A 4H4KA 5ADZA 3RAXA 2QC3A 4X4RA 3N5FA 3BGLA 4FYDA 3BSOA 3QJLA 1K1QA 3C6TB 2YPYA 2DIUA 4J9QA 2C22A 2UUAF 1X8DA 1FE4A 1S1XB 3ISZA 4QJVA 1JJ2R 2XMUA 5SUHA 2J0QD 1C1BA 4B3SF 4WK1A 4FYXB 3NNCA 2L08A 3NEKA 4K2XA 5B0AA 3G6YA 1HD1A 1NJYA 2F1FA 4B17A 2IJFA 3ZZRA 4MK8A 5A6WA 3T1YJ 4IH7A 1UVIA 2L9NA 2ZZTA 4ZVPB 3LP2A 3L4BC 1ZAWA 1HNZJ 2GAHC 1S99A 4X4OA 1KQKA 1FDBA 3FUYA 1RAIB 4EYHB 1Q8LA 1YDLA 1RZMA 3DU6A 1HNIA 3HSDA 2AYEA 1YJVA 2YKNB 4DBQA 2AX0A 4A8WA 4DUTA 1U0SA 3QNWB 3TUPA 1RWUA 1S4FA 1VJQA 2EI5A 2DGUA 5KG1A 3VVUA 2B9WA 4C98A 1NJXA 1IKXA 2E5HA 2ZKUA 1TUWA 1FKOA 3JSYA 4KGMA 2N4DA 3TA0A 1UFWA 4C8MA 4X62J 3MEEA 4J9LA 2CPHA 3QSYB 1QAIA 4V19X 1X4BA 1HR0J 4QIFA 4QWCA 3M2VA 1A9NB 2CG8A 4M5DB 2KT5A 5L38A 3ITHB 3JB9k 2DNMA 2C3MA 3ET6B 4TYBA 4URGA 2XMKA 3I96A 5F0WA 5MAOA 1X5TA 3GJTB 2VF3A 3OV7A 4C9DA 2FIUA 1U7LA 5BR8J 1DJ0A 1PCAA 1I1GA 1RT3A 1MU2B 1C4AA 4Z7CA 4WE1B 4H4OA 1F2HA 2D69A 1Z4UA 1T03B 3R5DA 4GVLA 4MAKA 5LSRA 4LF4J 3DI6A 2F65A 1R31A 1N6QA 1FX4A 2ZFHA 2MQQA 1TU0B 1YK9A 3UPFA 1WNEA 1FWKA 3CMAS 1S59A 1FJGJ 4Q44A 4O0IA 2BBEA 1NK4A 3ADAC 4LIWA 3PFOA 5I42A 3IWLA 4F3QA 2IM1A 2NXCA 2XWXA 3N0VA 1YBUA 3BSCA 3F73A 1TK0A 2ZWOA 1EZZB 3CULA 2AJ4A 1N6QB 1A6LA 1RWPB 2RE1A 4DQRA 1V5VA 4CYUB 3MMBA 3AOCA 1CULA 4JV1A 2O3DA 1YSJA 3NP5A 4JYAJ 4WXOA 3TZXA 4L72B 1TL4A 3O1LA 5AXMA 5GMEA 3J7Z5 2KKHA 2J7WA 3TANA 4OMFG 1WSRA 3W60A 3SCKE 4XIUA 4B08A 2ASYA 2DNKA 3JAMU 4B3MF 3SXLA 3EZUA 4ED0A 2ADCA 1W26A 1UA1A 2W8LA 1UFKA 2ABYA 1W2BR 5JMNA 2FLLA 2M8DB 2OTJS 1HQEA 2YNGB 2PSZA 2CQ4A 2KYXA 2K7KA 1DHMA 3MM8A 4JBCA 1SV5B 2HBQB 3TUJC 1N5VA 2MQMA 1N32F 2JC1A 4K4SA 3G86A 2KXNB 4B3OB 2KDOA 2ZE2A 5GAGU 2ZNZA 3G6XA 3NNHA 2EKNA 2VJVA 1S97A 1I5OB 4B3TJ 3AXMA 2V4QA 4CI0B 2ZITA 3JTNA 4ZPDA 4ENOA 2IAJB 2K1RB 2MQLA 3GFHA 1AZSA 3I9ZA 5C2CA 3UE2A 1SJ3P 2DXFA 1JWWA 3HXMA 1TR0A 2FJEB 2O01C 2E29A 4NWBA 4XK8C 3HHEA 1HPZA 3KKFA 3S7RA 1W7WA 2HHVA 5IWAJ 2ALZA 2DNZA 4MYUA 5JJBA 2LA4A 1OMSA 3OSPA 4N76A 4CNYA 2ZC3A 2Y3YA 2AGOA 3BN7A 3OR1A 3DLHA 2JX2A 3CDBA 2FJWA 3X1LB 3CDUA 4F67A 5EHHA 3CCZA 4L76A 4N77A 4OHVA 3T9ZA 4U7CA 3M1VB 1DTQA 3F41A 2FGOA 5CAAA 2WONA 3MD3A 4Z2XA 3OTBA 3GCWP 2BRKA 2MLZA 2GJ2A 2GQ2A 4FXWA 3T9NA 2XMJA 2R8HA 4MFBB 1TKDA 4LF8F 4MKYA 2WTFA 1YJNS 2UXBF 2XWYA 3MUVP 4JI8F 4C0BA 5THWA 3ISND 3W5XA 2J6SA 1YI2S 3EYZA 3LALA 4NX9A 1RSCA 4Z7YA 3AHPA 4JI1F 3KYLA 2B6AA 4IFVB 5F41A 3DRYA 3FSXA 2VL1A 2OSQA 1NDCA 3QRRA 2D1CA 2NSCA 1PC4A 2A0FB 2EFQA 2YTCA 4P7TA 2VBXA 3MCSA 3IGVA 2CQCA 1MN9A 3UN3A 4D3GA 4DS5A 1MU2A 4YS2A 2YH1A 4LF7J 2UV8G 3P8BB 2EK1A 5EWEA 4CQ1A 1IVZA 1U45A 1R43A 5HVFA 4R5PB 4X65J 1IN0A 1FKPA 3T6JA 4AL5A 1F0XA 4F0MA 3TQ1A 3PACA 1N5TA 1S9EA 4QCLA 1Q79A 5DZ6A 2F40A 4DR6F 1GMVA 1RAFB 2IMOA 1R0CB 2O1PA 3M2RA 3KK3A 1QUVA 1PKUA 1ZM2A 2HBZB 1NJIT 4KHPF 2YWGA 2L9WA 1IKYA 1YBAA 4JOUA 2KRBA 5HANA 3Q8PB 3M8SA 2HBYB 4O3NA 1WG5A 1LXJA 2B4OA 2OPRB 4CH7A 4BC7A 2ZBPA 2G1HA 5ETKA 2AEJA 2CPEA 2RUGA 5IC6B 5AJ3F 4DUZJ 1VQPS 4ZPWR 4I2PA 4JV5F 2Z58B 4PG8A 3PW4A 3PX4A 3GV8B 3DFEA 4M5KA 4XDCA 1WI6A 4F7VA 2EKYA 5U47A 2ZDOA 1JLGA 4KO0A 3W63A 3CXCR 1KOOA 3BH6B 3PYGA 5ETQA 3RJMB 5J2NA 5J2MA 2GHWA 4AT1B 1KSPA 1RT5A 3N6LA 3A4TA 1XMQF 4FF3A 4USMA 3NL0A 1BLUA 2EFVA 2RS8A 2I5JA 2DNNA 2GJIA 3VVTA 1WEYA 3FFIA 2JEJA 3MPDA 4ED2A 1NSQA 2R7TA 2PMZD 3CCVS 1HNXF 3CJSA 4J7CA 4ED5A 1JIHA 2NXJA 4TNOA 1JLGB 4C0OC 3E2EA 3W62A 4KFBB 1RABB 3SCLE 5J2NB 1SL1A 2GV1A 2G0JA 2JNJA 2LDIA 3BDEA 3CJQA 3R7SB 2KG0A 5HP1A 1HNWF 4LJMA 5CYQA 3A8JA 1RT4B 2P6SA 2OPSB 1Q5VA 1B7YB 4W98A 2DPIA 2C2EA 1U1LA 1NHKL 2BEFA 4J90A 5DM6Q 3OLBA 2J8SA 4ZOSA 2V8DA 2JFKA 4B9SA 1B64A 1UW4A 1RACB 3NS5A 4IR1A 4LRCA 5KFVA 5KG6A 4RW6A 3EGNA 3H20A 3PRDA 4DR3F 1U1MA 4JB8B 4RPFA 2KU7A 2I38A 3EDQB 4R0EA 4ZPBA 5EWGA 3QIPB 2OMOA 4Q5VA 1FFWB 5LXYA 4I69A 4OV6A 2X1AA 2FUG9 4DV5F 3KNAA 2MMYA 4BWJA 3KK2B 2WSEC 1DQ8A 1RTIB 2OFGX 3C6TA 4Q43A 3V6DA 4PEOA 2HNYB 3DOMB 4NLUA 4C97A 3NGDA 1YVFA 4IOBA 3IN5A 1HR0F 3C46A 4ZP7A 4X4QA 3I32A 4PWUA 3EPIA 3LAMA 3TP2A 1M5VC 1BWEA 1ZM4A 1OYDA 1QY7A 1TMJA 2F63A 5F8LA 4DV2F 1RE1B 4ZPCA 5JVHQ 5D4LA 2VKRA 3KK2A 2CQGA 4IG0A 2WAQD 2RU3A 2FJXA 4LF5J 2CA9A 2RB7A 1T3NA 2RT3A 3BBCA 4M94A 1WKLA 3K89A 1YJUA 1F9FA 2ZBQA 5KFRA 2JH3A 3GONA 3WQPA 3CJKB 2R7UA 4MK9A 3CD6S 2NPFA 2RHSB 3RR8A 4DJBA 3MR6A 4LF4F 4NEZA 3AJ1A 1XN9A 4O3OA 4FF2A 4IDKB 1FRJA 4CO5A 1QE1A 4UQTA 1CLFA 1PBAA 1ZYQA 6FD1A 1HI8A 5DM7Q 2R8JA 1S1XA 5FDLA 4OV1A 3MZIA 1TAQA 2K7JA 5FD1A 4F4XA 3M2VB 4KGKA 4DPOA 1SPBP 2A2CA 2BJ3A 4OFZA 3CC2S 5K5MA 1S9EB 3Q22A 1C0UA 1RWXB 4J9PA 1M1HA 2OP5A 2PMWA 4PAAA 3IWXA 4HHUA 1PJ7A 3HKZD 2NZ4A 3F44A 3QZ8A 4E0DA 3DRRA 2OEJA 2J9DA 1NPRA 3HVAA 4OYAA 3NCRA 3IRWP 1Z2ZA 2YKOA 4U67Q 1NK8A 1TV6A 1BMQB 4X66J 5B0DA 3QSIA 4USKA 2M3DA 4PG4A 2KYZA 3DLEA 2XCAA 1TKZA 2MKJA 4OLOA 3OHBA 2R8IA 2HK3A 1C1CB 3CUNA 3Q89A 2ILYA 2ERRA 4LSLB 1U1KA 3BO3A 3V81B 3H2UB 4LUBA 2HVHA 1APSA 1AXQA 1RHMB 1WEZA 2IC3A 4G65A 1TK5A 1HNXJ 1SC6A 3BPDA 3CGIA 1P9YA 4C8NA 4DV1J 1LW2A 2Z8QA 3KWMA 3HHLB 5HBMB 1D8YA 1F5CA 5JXSA 2QGFB 4OX7A 3KOAA 2M88A 4DR7J 2LKZA 1LQ9A 1K8AT 3DOLB 2FJAB 2KT2A 4OHYA 3LO3A 4P2SA 4I6YA 5F3TA 4IFYA 2Q66A 1ROFA 3N6NA 2JL9A 1N48A 1AA1B 2B5JB 3QT6A 4C2MA 2HGMA 3PJXA 2B8QA 4DZDA 4DR1J 1J5OA 4ELTA 1EQ0A 1FK9A 2BJ1A 4FDFA 4DLGA 3M6VA 3FZBA 1HA1A 3WZ0A 4DV7F 2POKA 3IBCB 4OYIA 2PIIA 1R6VA 3POTA 1JMTA 1FDAA 4G1QB 1YITS 2CJKA 4BS2A 3FMWA 4NRUA 3HVWA 3MPWA 4WYWA 7AT1B 3L3CA 3W65A 4EO6A 2ZM6J 1JX4A 1U6BA 2YX7A 3AODA 3RAMA 4FS1A 3Q2TC 4IRCA 4J9VA 1FK9B 3QGIA 2IM2A 2UXBJ 4LFCJ 4O0NA 3SCJE 3O3LA 4ZP6A 1RTIA 5JVGQ 5IT9Y 6FDRA 2X1FA 3V6HA 1Y5IB 1BC6A 3BGOP 3DM2B 4A4JA 4AE5A 3CCRS 2D9PA 2KTQA 1UVKA 5D8HB 2DNYA 3D6MB 2IA0A 4KV8A 4NASA 4KE5A 4M5JA 1D9DA 4AD6A 2W25A 3NGTA 3M8QA 2NPIA 5A0YA 3SBMA 4QBUA 4MKBA 1WC1A 2C2OB 3TZYA 1XR5A 3GU0A 3FEYB 2FC9A 1J2VA 4EK2A 2J6TA 3PNIA 3MR5A 1B99A 2Y8YA 2DH7A 2GS8A 4NLSA 4FXVA 4YP3A 3R5JB 2MGZB 1TL3A 3MR3A 3CCJS 1REVB 1WG4A 1EIYB 3QRQA 2DYAA 2W2PP 4ZCKA 3VV2B 3ZNJ1 1FJEB 1NHVA 2G4BA 5GMKa 3BO2A 4A48A 3DOMA 2CPJA 1VK3A 1H7WA 2DGXA 2DHGA 2G2YA 5BXIA 3IR5B 2QEXS 1Y10A 1XWLA 3OPKA 1SI9A 2QG9B 5KOWA 4OZ0A 4O3PA 1VBYA 2UVVA 4H4KC 1NBEB 2X3DA 5KFKA 1YZ7A 1LWFB 1RBLA 4F3OA 1DTTA 4OIXA 4U8YA 3S8SA 1XQIA 2CQIA 1NM2A 1PILA 2AP6A 2KL8A 2SXLA 3CB4A 4R0JA 2HQDA 1F9EB 1CEZA 4CLYA 5LOQA 3NWRA 5MLCV 4WZMA 4ZCMA 1VS3A 1Q7YT 3BYRA 4LF6F 4TY8B 3KHHA 4JI6J 3FGVA 3GB0A 3W61A 2RQCA 5KFSA 3ET6A 4OZ3A 2GVDA 2R42A 3RU0A 3LGMA 4U95A 5I3QA 2VG6B 4RJVA 3KDOA 2IC3B 2E9ZA 2VDHA 2YWFA 2DNPA 1OQ6A 1RA7A 3THVA 3PCOB 1VI7A 4AXJA 4WKYA 2O5DA 1NO8A 5KFGA 1U48A 1DRZA 4JI5J 4TXSA 4X4UA 1J5EJ 3DRSB 1ZAXA 2GFFA 1F2GA 1ZAVA 4CH0S 2XO6A 1R8CA 2C1EB 3R5GA 1FRIA 5J2PA 2BV3A 2X1GA 1X9MA 1ZTTA 1S6PA 3ILJA 2HBRB 2BJ9A 3VAGA 4IO9Q 1JXLA 2VODA 4GKKF 4X62F 2V94A 2OEKA 2AJFE 3MM9A 3GYNA 2XEXA 4O4GB 3CCQS 2I5JB 4M5DA 1RTDA 1LK5A 3IC1A 3PO4A 3D3BJ 3WBZA 1N8RT 2BXJA 3TVKA 2RF2B 2CQBA 3DNCA 3HVTA 3VTIA 5KG7A 3VCDA 1KTQA 2U1AA 2UUCJ 4O3QA 2HURA 1X9WA 3IRXB 2NUHA 1PAUB 3L7PA 1VQKS 3SV4A 3POTB 5IT9U 3O5TB 5EN1A 4DSFA 3LGNA 1R8PA 4DV2J 3CIMA 1FXLA 2Z57B 4KQZA 2XY7A 4WZQA 1LFWA 4H54A 3UCZP 5K14B 4LF5F 4KT0C 4C3LA 4I7FA 2RJZA 2A3JA 2KB2A 3RBDA 3G87A 3BPSP 2CQ0A 1GMWD 3IP0A 4FS2A 4QZVB 3FVYA 3D66A 3Q2SC 3HCXA 3FFIB 3R97A 5F8IA 1S1UA 4B02A 2X3GA 1R3NA 1WF1A 1WF2A 2J76E 2W9CB 2VICA 3IFEA 4NXMF 2VFRA 1TL5A 3ICLA 2UUBJ 1MLAA 3JYTB 2H48B 1UMJA 2Y1LB 2Y1IA 3FBEA 2Z2YB 1H7XA 3J80Y 4EI2A 5M2UA 3W64A 4M95A 3TI0A 3GQCA 2W7AA 2KZMA 2U2FA 1FCAA 3BV8A 2VG5A 2QFIA 3NCQA 4ZHRB 3BH7B 4M5NA 4CT9A 4ZP8A 1REGX 5K8NA 2J9CA 5H1SV 4X66F 1SV5A 4L3KA 2DIVA 4F50A 1N32J 4DCPB 5KFPA 2QFJA 4A8MP 1NUEA 2HNZB 2BW2A 1HQUB 2WW8A 3AT1B 4ZPTR 3VGSA 3N4WA 4WCEQ 3H5XA 1T9WA 4OX9J 5E2QA 2D41A 4PG5A 3I0RA 2YKMB 1VBZA 2VB6A 2IDLA 1FVQA 3MMAA 4IH6A 2LA6A 5IOLA 3W8GA 3QT5A 4F0KA 1V3SA 3H5UA 1JLCB 1TKTB 2GVZA 1SC4B 3FZ2A 1Q81T 5M2RA 1DLOB 3QLHA 2ZOGA 3O2IA 2B9YA 3KDNA 2R8GA 2YKMA 4LF1A 2F9DA 3U1NA 3PIOQ 1SUQA 2MY8A 3Q0AA 2A6OA 3H2LA 5A8RB 3VALA 1JJCB 2WB4A 4DUYF 2AJ2A 4CLPA 4PPDA 1OYEA 3O8WA 4RBTA 2B4PA 4UZBA 4F3MA 3RB0A 3IBWA 3MTJA 5F8JA 3TJ9A 3AA9A 7FD1A 2W4DA 2B7BB 5F8HA 4FPIA 1LNQA 1YRXA 2G9OA 4CDIA 3KG1A 2LMIA 5C25B 1S1WA 1IBMJ 1RAJA 4L75A 4ALZA 1Y00A 2COLA 3I5CA 2XCPA 1N54B 3HFVA 2HFZA 5C2GA 1CJUB 5E3AA 3JSMA 1UETA 2I9SA 2XYGB 4ECQA 2ZJRQ 5DG9A 4NZ7A 5B08A 5LSLA 3MD1A 2JRSA 2DGWA 2KM8C 1NXIA 1U26A 2AGQA 1NK5A 1VQYA 5HMZA 5J2MB 2PA3A 4C0HA 4DWIA 4CP5A 2CXEA 3BO4A 3JSMB 2IRUA 1BD6A 1E6VB 1BQXA 1HMVA 1SL2A 4DU7A 1IUJA 1P6TA 2VFVA 3C16A 3G71S 2WRMA 3I4HX 3U1MA 1UWBA 2YKAA 2HQCA 3GFZA 3MHYA 5KFNA 4OJHA 5DDOC 2FZKB 5HL7Q 5KFCA 4DR5J 2ZD1A 2HIQA 3PYFA 3X3UA 3LOUA 2XNQA 3G82A 4GVBB 4QIWD 3QJJA 4F4YA 1HQ2A 2DNRA 2JC0A 4C8ZA 4DL7A 1TVRA 2YWEA 3MEGB 1FWPA 3PG9A 1L3KA 2JOQA 2LFVA 3BF4A 3DGVA 2KG1A 4AQYJ 1QTMA 3V2UC 3CCWA 2PI5A 1AFJA 1YZ6A 2BKNA 2ZUAA 2ZKTA 3TX8A 5DDRC 1Y3KA 2OUGA 2XLKA 1VRTB 1SC3B 2LEPA 3I6PA 3OL7A 3T1HJ 3R2DJ 1GH8A 4Q0BA 3OD2A 1RWOB
chains in the Genus database with same CATH topology
1LOUA 2BABA 4RWWA 5T14A 4YB1P 3G6VA 3G4SS 1N34F 2C42A 5CYJA 2RS2A 4HHJA 4KIAA 4TLRA 1HNVA 1YRUA 5BJRA 2BVZA 4WIIA 3PM9A 4A8OA 5DLGA 4PWDB 1N5YB 2AQ4A 2YX4A 1WD6A 5AXNA 4DQIA 2KZZA 2Z2MA 1S6QB 3OL9A 5E3QA 1IQZA 2AV5A 2D3ZA 2XI2A 1IKWB 3CCES 1JLEA 1VRUA 2YNHB 4OI2A 4ETXA 4QU7A 3GSDA 3BGRA 4ES1A 2HHVA 1S1TA 1S6OA 1U8SA 1UFLA 1JNRB 3W2VA 3K5LA 2DT9A 2J0WA 2KJWA 4Q2LA 1RA6A 1R27B 2HHTA 3TAMA 2W9CA 3I0SA 2YNGA 5KFAA 1UVMA 2KRRA 1Z2LA 2HNDA 2EFGA 4B3RF 5C42B 3OTDA 1J5EF 2KHCA 1BQMB 3CD5A 5ITHA 2KFZA 3CO9A 1H2UX 2BANA 2FJDB 3HF5A 4IDKA 4YEAA 5DQGA 2ZNYA 4NCGB 4QIVA 3MUTP 3B8HA 2XLIA 3CT9A 1X4HA 3TAMB 4X2BA 1EETB 2PDAA 3HHDA 3KLGA 1BGXT 1HPZB 3MMCA 4F2RA 4KKOB 3M2UA 5C42A 5L1LA 2EBGA 4TLQA 1TKXA 3KLEB 1KHVA 4P7VA 2LEBA 2QV6A 3HM9A 4R25A 4QYZJ 4EZ9A 2K3KA 4C8OA 3ZZZA 1Y9OA 1FTRA 2NSBA 2DRAA 1S77D 3MM7A 4USJC 3BJYA 1HD0A 4NZ0A 1FKPB 1R8BA 1QVGR 4HYKA 1KHWA 1C0TA 2K3IA 4OI3A 1M5PC 1VBXA 2MHEA 2CQPA 3NAHA 2XB2D 3J7A1 3M2RB 4NOHA 3M30B 2UVWA 3U1LA 1VC5A 2FLPA 1WACA 4QYRA 1JLBB 4HI1A 1S79A 3GR1A 4WE1A 2OPQB 2E1AA 2DH9A 5BYRA 4HDHA 5K8OA 5H9EJ 2HGLA 1LW2B 1RT1A 3H25A 1C0TB 2D3UA 2IBOA 1P1LA 2RILA 4UW2A 4J5OA 3H5SA 3VAIA 3PW5A 1IKXB 1RYSA 3IAM9 5KFEA 1O8BA 4F8RA 4LQ3A 1X0PA 2JWNA 3OUYA 2EWHA 2FHKA 4DMZA 1MWZA 2QLWA 1ULRA 3M8RA 4NA1A 3BEGB 2EFPA 4J9KA 4IRKA 1RGVA 4PRFA 3LAKA 1TP7A 3IG1B 2BDPA 4UOCA 4ILLA 3RW6A 1U25A 2XSJB 2D74B 4O4GA 1Q16B 2HWHA 2VASA 5E41A 2OH2A 5LT5A 1T03A 2ADBA 2QLXA 3VR1A 4DFJA 2R2RA 2DCUB 3MEKA 4IO1A 4WFNQ 2FB0A 2PMHA 4DOZA 2Z2LA 4LQ9A 3MI7X 4PXEA 2HVZA 3DOLA 1YWXA 1BQNA 2MZQA 1P9QC 5DDQC 3MAQA 4QQBA 1RTJB 1GX5A 2VOOA 1QM9A 5FLXY 1JLEB 1YJ9S 4DV4F 4FBUA 3B82A 4QR0A 4NLXA 1L3UA 3FDSA 3VAJA 1Y0HA 2WB1D 3OL6A 2QRRA 2RQMA 2JHEA 3RRGA 2HVIA 3PEJA 4X4NA 5KG0A 3US5A 1H6KX 1CC8A 2AJ1A 4YHHF 3QO9B 4OLPA 4OZJA 2HRYA 3CJ3A 4AYBD 2Y1RI 1NK0A 1KNZA 4EO8A 1SKSA 2YNIB 4EBEA 4ECVA 2AGPA 1ZPVA 3MGJA 2DB1A 4GKJF 4U7UK 2IA6A 2M5YA 4P6QA 2QZ8A 1HBUA 3CJ4A 3UD4P 4HI2A 3QIPA 2VFUA 2A1BA 5KFMA 4B9MA 2GHVC 3CJ0A 3MEDA 4FZVA 5GAGI 3ZFVA 3OJUA 1N36F 2DJWA 1XK8A 3KMSA 2VG5B 3I55S 4DG1A 1DURA 1RTHA 4F02A 3THPA 2C3UA 5KFWA 4F2SA 4YB5A 1WEXA 2QA1A 2L3MA 1KFSA 1GAOA 3BREA 1B0TA 4WXWA 2MGZA 3BSNA 1VFJA 3FSYA 1H38A 4J9OA 3PY8A 3N5BA 3ZZ0A 5KG5A 1NJZA 3NBPB 1LKZA 4IOCQ 5GAHU 2ROPA 2GNKA 1BY9A 3RB6A 4HKQA 1CSJA 3M1VA 1C1BB 4HLBA 4F4WA 2HQIA 1JJ4A 3I5AA 5T7LA 4F4KA 3KLHB 4PQUA 1M5SA 3KG4A 3HVRA 4Q8FA 2ZDPA 1LWFA 4ZVGA 2C28A 3C66A 3PR4A 2MDAA 4DQSA 4MH8A 1VIXA 2HLUA 2NXUA 5J2PB 2QYCA 3K5NA 4AQYF 4WK3A 1NKCA 5DRKA 1NJWA 2VC0A 2WSFC 3V81A 3GILA 2QT7A 2XNRA 3P49B 1FVSA 4IG3A 2B0GA 2AX1A 1WF0A 2HHHF 1HHTP 4Q45A 5K9FA 2HZCA 4YOEA 3ZZOA 2KFNA 3CIZA 1WHYA 2F8EX 3CCMS 1Y5NB 2MJNA 1N33F 5KG4A 4QWAA 1W25A 3I5BA 5A8KA 2OPQA 3DYAB 3M6XA 1G6BA 3MDFA 1KR4A 1IJFB 2ZBIA 4JI5F 3G96A 1WWHA 2OPPA 4WFZA 1OO0B 3M6UA 2F8HA 3BQ0A 4DL2A 3OXFA 3VQSA 1RKIA 4CO0A 4C4WA 1KLMB 3MM9B 4LIRA 2LQ5A 4K4VA 1FD2A 1FTCA 2PGCA 3BZQA 4CH1A 4GC6A 4QWEA 4CNZA 1VQ6S 5F8NA 5C24A 3PFEA 3GV5B 2OPPB 1G7CB 1YJRA 3NRBA 1L3TA 3DLKB 5D3GA 1N5SA 2ZOMA 3TAPA 3B78A 3SQGB 2HHXA 2VBZA 2F7VA 4MTPA 4W92B 4CTAB 2PC6A 2E5JA 1UJ5A 4M8LA 5H9FJ 5HMWA 2GHPA 1H98A 1NAQA 2LDYA 4QOTA 1N5QA 1UP1A 3K5PA 4KB7A 5F3ZA 4UQGA 3CF5Q 3G6ES 1S0NA 3EXCX 2PE8A 2ATLA 3Q8SB 2WBRA 4KSEB 4C7QA 1RTJA 3P3DA 3DRXA 4OI0A 2CPDA 1YIJS 2VPZB 3ISNC 1G2EA 1EP4A 1SL0A 2UUWA 2PEHA 1RP5A 4NLVA 3M6WA 2KT3A 3OBIA 3I0RB 5C5JA 1MW7A 3CEDA 1G1XA 1KRPA 4U6PA 4DN9A 3CSKA 4USIA 2FJBB 2XGQA 1C2PA 2B9XA 3LQVA 1NKBA 1KEKA 4ID8A 2RMLA 2I2YA 2VOPA 1XNQF 2EG1A 2JDJA 3AQPA 1DARA 4HL9A 4ECXA 2AD9A 2VPXB 5GAEU 1U2RA 2VD3A 4FPRA 3OLAA 1HW9A 2IFXA 3H5YA 4DV0F 4TQSA 2IM0A 3GR0A 1IM4A 4K4UA 1N88A 2VV5A 3C6UA 4KBIA 1S72S 3M4XA 3HHKA 2VC1A 1LWEB 2IYIA 4TKTA 1UEUA 2RD5C 1U1PA 1D9FA 3V6JA 3TAQA 2CFXA 3TOQA 2MKIA 4OHXA 4Y28C 4DR4F 3IR6B 3DLEB 3SMZA 2JEGA 3UWTA 4V19J 5A8WB 3T1YF 1MROB 2LQJA 3JSBA 1QE1B 1R0AA 1C1CA 2IHR1 2QA2A 4DL4A 2IRXA 5KFJA 1X4AA 2HWIA 2QA4S 3SYZA 4K5RA 5KFZA 4BHQA 4NLRA 4OI1A 1X5PA 2ASJA 2M0GB 3DDNA 5E3RA 4TU7A 2R2TA 2DBBA 5HLFA 4DF8A 1UL3A 2EPIA 4RNHA 1QAJA 4OZLA 1KD1T 2C3PA 1KLMA 2P9GA 4AL7A 1L3SA 5L39A 4R5PA 3WC2A 1HBOA 5HI7A 4YR0A 2B5JA 5EX0A 3LH2S 2CQ1A 2MHNA 4OQJA 3HMJG 1VQLS 2FPHX 4RUHA 3OHAA 2FVSA 4K50A 2HS4A 3SDEB 4DFPA 4M63A 4DEZA 4RNFA 5K14A 1U47A 1M90T 4IQXA 3UR3C 2W7OA 2KHDA 3SQGA 4OZ5A 2KVIA 4G1QA 1B0PA 1I6JA 2E9RX 1H0HB 2DO0A 2OPSA 3QGHA 5KG2A 2VONA 3LF0A 2IJNA 1X4DA 3PX6A 2DGVA 4MIWA 3M9OB 2V8HA 4RBVA 2YWKA 3UDCA 1HARA 2R7WA 2HS3A 1Y3JA 4HEA9 2FVCA 3M8PB 1S6QA 3NG8A 1TL1A 2A2DA 1U24A 3MM5A 1RKJA 2E9TA 7FDRA 4WFAQ 4TY9A 1Y5LB 2LEAA 1WTFA 3IAS9 3M8QB 3MMBB 2DR8A 1QAYA 5EUHA 2OFHX 3GIJA 4EYIB 3GIKA 5E0OA 2QO3A 3MECB 1HI0P 4C8LA 5B0CA 2R7RA 1KN6A 1VQSA 3T1HF 5IS2A 2VPWB 3MM5B 4UUXA 3OTEA 2K8GA 1VQ7S 2J8AA 5CH7B 3NMAA 4IOAQ 2FHJA 3H59A 1WTBA 2HHSA 2MYFA 4O3RA 1LXNA 4HVZA 3A1YG 3GFYA 5KOXA 1B0VA 2QE5A 2PFFB 5DS7A 2VQFF 2CJQA 1P8GA 4PUOA 2NREA 1SIZA 2EW9A 1N56A 3KMQA 3VZHA 5KFOA 5EX3A 1T8EA 1R8HA 3PXGa 2BQUA 1DLOA 3QLHB 4Y2IA 2DITA 2YNFA 1LWEA 4XPCA 2PD1A 1HBMB 3ONQA 2XHWA 3CC4S 2CQ3A 2D9OA 1WHXA 4WU2A 1O0PA 4OJ3A 5D4OA 2XLJA 4ED3A 1VC6A 1Q8IA 3M30A 3KTQA 3M05A 2B7CB 5HN0A 1FKOB 3FEXB 1U1QA 1UVLA 3KLVA 1U1NA 2Z4PA 3DHXA 4URSA 1SJFA 4RWXA 4B9UA 5CA5A 1AW0A 3CJKA 1GX6A 2OMLA 4Y3CA 5B7WA 3T6BA 4HH0A 2VBYA 3DU5A 3FRZA 1X7VA 2DHSA 2ZBCA 4K59A 4TQRA 3K8WA 1IKYB 2HHPA 5E3CA 3KJVA 3UW1A 1IBLF 4JI7F 1H3DA 4RKUC 3W2WB 1S10A 1NRKA 3J7YI 1PO6A 1I94F 2UV8A 1TFYA 4WFBQ 4J9SA 1S1WB 3RB3A 2HW3A 3TA1A 2LECA 3W3SA 5AE2A 4ED6A 3H98A 1CVJA 2MKKA 5K8MA 4JI0F 2DR7A 4M1KA 5IT4A 4NLPA 2HFNA 2G1DA 4RU2A 4E98A 1MMLA 3I82A 2VA2A 2B51A 4MK7A 1KQFB 5GAEI 1FHTA 1OSDA 2J7KA 1ZM3A 2RRBA 4B9TA 3AY0A 3D0HE 5AE1A 1HFEL 2C3YA 2MY7A 2DGSA 4LFAF 1F60B 2W4PA 4C11A 4ED8A 1XR6A 5G0RA 1JNZB 2RRNA 5KG3A 3JYTA 1ZH5A 2CJAA 2BQRA 2N82B 2R7OA 4DSLA 1TAUA 1RT2A 4ZKAA 2ZJQQ 1NK9A 2L41A 2K1RA 3RR7A 3EUNA 1TZ0A 4RZRA 1U1OA 3RB4A 2HQ3A 4OZ1A 3RRHA 2DO4A 4JI6F 4EGLA 3LP1B 3MAHA 4I2QB 2ZUGA 4JV0A 5KT2A 2JJ4D 1QSLA 2WOMB 2N7CA 3QIDA 3H4BA 2DR5A 4YFUA 2CYYA 3ULHA 2XGPA 1FNXH 3IS9A 2ILZA 4PQAA 2ZH9A 5HMYA 2ZH7A 4CO2A 4MIAA 3TRGA 2KXFA 2J5AA 2OKQA 5AXKA 3HO1A 2JFDA 3BR8A 5KFYA 4AXIA 3UI3A 1T3OA 2VH7A 2KI2A 1JLCA 1TKTA 3DN9A 2V0NA 5HROB 3RBEA 3PW7A 2L48A 3LP0B 3W2VB 2W9BB 4EZ6A 2GIQA 3HKWA 3I0SB 5FDLB 5B0GA 4A8SA 2OJ3A 2EVZA 1HNIB 3GFXA 1IQTA 1FEEA 2FHMA 2R8KA 1REVA 1RT7B 3SFGA 3R5AA 3BDPA 2HPUA 4I64A 1VQ5S 3JSRA 2Q43A 3H2VE 1DTQB 5E5NA 1IKVB 5IM0A 1RI7A 5HQ8A 4IG3B 3M2UB 2HFOA 1FKAF 3OR2B 4NA2A 3C6UB 1UKUA 3K5MA 3QMQA 2RKIB 3EGZA 5EWFA 4ETZA 3LANA 5BR8F 2DGOA 2FTRA 2ZH8A 2ZHAA 3DRPB 3OVSA 1RISA 5CXTA 5KAKA 2DHAA 1HWKA 1IKVA 5IM0B 4Q7AA 2FLNA 2HG4A 1IJEB 2JVRA 3MMJA 3S1TA 4RNNA 3T5JA 4PQUB 4AL6A 2DNGA 1VQMS 1S9GB 3T19A 1HL6A 5KFTA 3Q8RB 5DDPC 1ZOTA 1DZ5A 4Y2KA 2MKCA 5C25A 3KFWX 2VG6A 1VQ9S 1FJGF 3UCGA 4YMEA 2DGTA 4CT8A 1D0EA 3MM6B 2V4RA 3KK1B 1KLNA 4U9RA 2NYIA 3D2WA 2C3OA 3D0IE 3KK3B 3WX4A 1ZTWA 2NUUG 1UVJA 4YQWA