2QLWA

Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
GDMTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTRPKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RhaU of Rhizobium leguminosarum is a rhamnose mutarotase.
pubmed doi rcsb
source organism Rhizobium leguminosarum bv. trifolii
molecule tags Isomerase
molecule keywords RhaU
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qlwA01
3LGMA 3GZ7A 5B0CA 4OIXA 2QYCA 2IYGA 3KG1A 4OJ1A 2Q3PA 2XMTA 1TR0A 4YEAA 2AP6A 4QOTA 4DL0C 2BYCA 1X0PA 2AW0A 3HDSA 2G9OA 1Y9OA 1IUJA 5T7LA 4A48A 1KVIA 2N4CA 3BR8A 3F44A 2W4CA 3LO3A 4DN9A 5B09A 3TRGA 2RMLA 2QIFA 4HH0A 1URRA 1YJTA 3HX9A 3DCAA 1JWWA 2LXFA 2OMOA 3E8OA 2L3MA 4OJGA 4Y2IA 2VH7A 1XBWA 2K1RB 2W4DA 1CPZA 2XMKA 3KKFA 1SQEA 1FE0A 1OSDA 4EFAC 3BDEA 3I9ZA 5B08A 1Y3JA 4HL9A 3HHLC 5B0BA 2OD4A 4A47A 5A6PA 3CJKA 5KAKA 2AJ0A 3UDCA 1LQ9A 2ROPA 1FEEA 1R6YA 1YRXA 2KKHA 4HI2A 3TOQA 5F0WA 2PGCA 2KT3A 1Q8BA 2GO8A 2K7JA 3HHLD 1FESA 2HIQA 3HHLB 1VQYA 4F67A 1V3ZA 1MWZA 2FIUA 2HQIA 1OQ3A 3HFKA 1SI9A 2HLTA 5A6WA 1FVSA 3BF4A 3HHLA 4OJHA 1P6TA 2HFOA 4OJ3A 1YJRA 1CC8A 2HFNA 2LQBA 2QLWA 4ZA1A 3VTIA 3KG0A 2K7KA 1S6OA 2EW9A 3QMQA 5F0UA 5T7LB 5B0AA 4NL5A 1K0VA 1Q8LA 1TL5A 1VQSA 2IFXA 1N5VA 1MWYA 1Y3KA 3MCSA 5B0FA 2BJDA 3FRYA 4Q2MA 1YJVA 1TL4A 2GA7A 3IWLA 4Y2MA 1GXUA 1N5SA 3T9NA 1APSA 1OQ6A 2XMUA 4FNIA 2OP5A 2KYZA 2OD6A 3MZIA 1Y0HA 3BGUA 1FE4A 1Q53A 1RJJA 2ASYA 2IYIA 2GCFA 3BM7A 4FNHA 1OPZA 1FD8A 3FMBA 2K1RA 1KVJA 5B0GA 3BN7A 1X8DA 5K9FA 1N5QA 2FB0A 2GGPB 2BUNA 5B0DA 1KQKA 1U7LA 1AFIA 2KT2A 4YDXA 4A46A 3CJKB 3K7RA 2QLXA 1FVQA 3BB5A 2XMWA 1P8GA 1Q4RA 2JDJA 2BJEA 4U9RA 2OAUA 1N5TA 2GGPA 1TZ0A 2XMVA 2GFFA 1YG0A 2N7YA 2OFGX 3FGVA 4Q2LA 4NPOA 2LDIA 1GXTA 1YJUA 2ZDPA 5B0EA 1CC7A 3KNGA 1AW0A 4HH1A 4Y2KA 2CRLA 2ROGA 2FHMA 2LQ9A 2W4PA 4A4JA 2GV1A 2K2PA 3LGNA 2RU9A 1QUPA 1TUVA 2AJ1A 2ACYA 2BBEA 2ZDOA 4DPOA 2PD1A 1SB6A 3IWXA 2OKQA 2ROEA 3QGPA 1JK9B 2HLUA 4HI1A 1W2IA 2XMJA 1X7VA 2RILA 4ZOSA 2FTRA 2VV5A 3WDOA 2RSQA 3TNVA 1WD6A 1S6UA 3HF5A 2OFHX 5IXUA 3DXSX 1AFJA 2XMMA 2N4DA 1ULRA
chains in the Genus database with same CATH superfamily
2V63A 1VIXA 3JTPA 5H9FJ 2R8JA 3FK4A 1TL3A 4LBPA 3SSQA 1N33J 4QOTA 2QEXS 5H9EK 5GAGU 4ZCIA 3QLHA 4PG4A 3HSDA 1HQ2A 5HP1A 5HSPA 2G9OA 2OPSA 4H4MA 4DUZF 4DR7J 5ETVA 4BC7A 2MQQA 1D9FA 1N32F 1QSLA 1VJQA 4M63A 4ELUA 3V6DB 5K5MA 1KONA 1RP5A 5KG5A 4YFUA 3DOMA 1JXLA 4P75A 1VC0A 3HJVA 2VBYA 3HP6A 2Y8WA 3GSDA 2GIQA 1OYEA 1RAGB 1N4LA 4X4OA 3VAFA 4O3RA 3NGTA 2Y1JA 3I9ZA 3TVKA 3BH7B 3AAWB 3QFHA 4WK3A 2D7SA 1KFDA 2FHKA 3S8SA 1UA0A 5J2PA 4ZKAA 4O4RA 1YBUA 1WEYA 2XEXA 3LH2S 4NI2A 1VMBA 4F3MA 4RUHA 2RQCA 3PJWA 3OXGA 2W9AA 2G2YA 5J2QB 2JFDA 4I2PB 2XZTB 1W26A 2WSFC 4D3HA 3V4IA 3CUNA 2XMAA 1U2FA 1RACB 1U6FA 4NEYA 4IRCA 1PBAA 3R7SB 3H7HB 3DRYA 4KC5A 2H5JB 3VVUA 4X4PA 2ZH8A 1S7HA 5E41A 2F9JA 1HBMA 4C9DA 2MB0B 1JXVA 2YPYA 4RU2A 4OJ3A 4ZA1A 2C2EA 2FDNA 1FRXA 4TKTA 7FDRA 4LFBF 3KG0A 4DG1B 2K7KA 4ZJQA 2R7VA 3GLJA 2CG8A 3K59A 5FDLB 4R0JA 3PYDA 3MWBA 4Y65A 2YWEA 4DX5A 1X4FA 2GA7A 2Z58B 2V9WA 1VLOA 1WOOA 2DR6A 3MD1A 4I2PA 4M5NA 3R8YA 1D9DA 2CNLB 2Z4PA 4B9VA 1S77D 4DQSA 2YKMA 1DAXA 3DN9A 3NGRA 3BZQA 1VHIA 1YDLA 1HD1A 1K0TA 3BGUA 2GZOA 1FE4A 1NSAA 4WFXA 1RB0A 5ETQA 1HI8A 1SIWB 4LSNA 1UEKA 1D1UA 1HNIA 3POTB 5JMNA 4DV2F 2G1HA 2M7SA 5E2QA 3QT6A 3VGTA 4ZHRA 1FTCA 4DBQA 5RUBA 2JEFA 2RF2B 1D9AA 2W2PP 4DR7F 2DGWA 2ZEJA 3MF5A 3MPVA 4J5OA 5KFRA 1RAHB 2HK2A 2QLFB 3ZTQA 2ASLA 1CULA 1NDKA 1XWLA 4IFYB 4OZ1A 2E5JA 2QLXA 4RW7B 5HROA 3HKZD 2AWZA 3FEYB 1HARA 2QMXA 2AX1A 2EFNA 3TJ8A 4N7TA 3I5AA 4CIOA 4DV3J 4FXDA 1C4CA 2OFGX 4Q2LA 1IR0A 4JI8F 1M5HA 2UVUA 5JVHQ 3OTOJ 1WDTA 1XN9A 2HS4A 8ATCB 3U7JA 4LF5F 1M90T 4K2XA 3M32A 5CXTA 2Y1LB 1KLMB 5HK4A 4Y34A 3UR0A 1Q81T 1RT2B 3UN5A 2LQ9A 4YR0A 1OJ4A 3GONA 3R1LA 3TX8A 3GR0A 4TN2A 1WHWA 3QT5A 4NMXA 3VGSA 2H48B 4WXWA 4ZK7M 3L4BC 5KT7A 1HWJA 3X3UA 2M0GB 1VQKS 3DHXA 2HQ3A 1YBTA 1X7VA 5BR8J 1OMSA 1IBKJ 4QBUA 2CJKA 3FJ2A 4URSA 4C2MA 3BGRB 2AKWB 5KFFA 1PO6A 4ILMA 3OL9A 1FKPA 2ZUAA 2H5EA 2WK4A 3FFIB 3GTYX 3PRBA 2WSEC 3ZZYA 5I3PA 3T9ZA 1SH0A 1N32J 3CD6S 1Q0NA 1IKWA 2N4DA 2M4MA 2NCKL 4Q2MA 2F4VF 3NOCA 4DR5J 4Q7AA 5B0CA 4DSFA 2CQDA 2A6MA 2EKNA 4J9SA 2XS7A 2Z2MA 3IC1A 2BYCA 3EPIA 4ID5A 4RWXA 1NMEB 1X5OA 2B5JB 4K4ZA 3PYGA 3KK1B 3JSRA 4DEZA 1R89A 1YSJA 2YY3A 1XBWA 5HVGA 2UUBF 3ET6A 2GS8A 3ADAC 2XC9A 3AXMA 5E0OA 4CT9A 5KFEA 1N36F 4I2QB 1FKOA 3SCJE 5EWGA 1YJWS 1FE0A 4KH0B 4DCOB 1IM6A 3MM9B 4ZITA 2RJZA 1S0NA 2B7CB 3D68A 2HQCA 2KVIA 3KHRA 1T8EA 2VQFF 3CJKA 2MTLA 2JLGA 1YJNS 1ZM2A 3QJPA 2GJIA 1NHKL 3FBCA 3PJ9A 4RLEA 3PRDA 4B9NA 4Q8FA 1B99A 5HQ8A 3TA2A 3M8ZA 1CJTB 4JI4J 2UXDF 1C1BB 3EZ5A 4ED1A 2R7QA 2D1CA 3EGVA 4PCQA 3SSSA 3L9ZA 3OHAA 1XNQJ 2FVQA 3BPSP 4HT7A 1A9NB 4MT1A 1FJ7A 4ZVSB 1V3ZA 4RKUC 2G0CA 2DNNA 1VQ8S 2F40A 4RR5A 3SEOA 1LEOA 3DRRA 4LR7A 4DR2F 4DR4J 4H54A 1B7YB 3FEXB 2WONA 1HQEB 2BKOA 3NS6A 1IWGA 3M4XA 4KT0C 2HFOA 1WG1A 2HFNA 2WB4A 1BXNA 4ZVFA 2ZH9A 3Q23A 4F02A 1BLUA 4OZJA 4H4OB 1S1UB 2VONA 2V67A 2BANB 3DGPB 4IH5A 1M1KT 4P7VA 2V2VA 3ETMA 5DGBA 2J8AA 3TQEA 1UW4A 1QJHA 2Z57B 3GJQB 5M2PA 4Y2MA 3KK3A 4YR2A 3MUTP 3T41A 5IQQA 1AA1B 4B3TJ 4GVLA 5GAGI 2X1AA 2GCFA 2BJ7A 2CUYA 1YIJS 3UR3C 4QIEA 3NNHA 2D3UA 1JLBA 3OV7A 4NWBA 1X8DA 2DR8A 2HAIA 1SBRA 3GP9A 1TVRA 3H2VE 5IT9U 2L9DA 3KWMA 2KXNB 2HRUA 4DSJA 1JJHA 2KFNA 2O5DA 2MQMA 2GVZB 4CM2A 2JJ4D 1OS5A 3EICA 4IKAA 4ETZA 2MSSA 1HYSB 4I7FB 4LUBA 1C1CA 5CD4A 2GGPA 3G6YA 1TZ0A 3DRPB 2WCXA 4NZ0A 1XMQF 1WI8A 4LF4F 1AFIA 4CLYA 1GXLA 3RUBL 2ZKUA 4J9NA 2VHGA 4FVCA 1GT8A 4OZ2A 5GMDA 5A0YA 1X9SA 1NO8A 4ED8A 5D0RA 2KN4A 2W4PA 4PYDA 5L46A 4K4YA 2E1CA 2GV1A 1RT5B 4DLEA 4NMLA 2AJ1A 2W7AA 2YKQA 4RW4B 3C6UA 5CAAA 2J0SD 3NNCA 2YKMB 4I0WA 4I68A 4OYIA 2CQHA 2U2FA 3SDEA 4OZNA 2XMJA 2GHPA 3K58A 2UVRA 5ETSA 3BREA 4CLWA 4OZLA 2NXJA 2R2SA 3IAS9 2QX0A 4X62F 5ETOA 3FZBA 3G6VA 4PXDA 3PIPQ 3QRRA 2VJVA 1AFJA 3MMAB 3BH6B 2ZZNA 4CH1A 3NLCA 4KRWA 4K5RA 3BQ2A 4B3RF 2IAJA 2V6AA 2EEYA 2ZHOA 3MM7B 1HHQA 2D9OA 2HIYA 4LREA 1OSCA 4O23A 4C8MA 5J2NB 2J9EA 4AXJA 1ZA1B 5KT2A 3V5RA 4CP5A 3KK2A 3GR1A 3C6UB 2VG5B 4QIVA 4LMZA 3BBFA 5CH7B 5T7LA 4HYKA 4C11B 3QRQA 2MKHA 4OHZA 3U1NA 3ZZTA 1NJXA 1HR0F 5B09A 3CDEA 1XMOJ 1URRA 1AXQA 4RBVA 2XLKA 3VHQA 4LF5J 3T1HF 1V3RA 2ZBIA 4FPRA 4B3MF 3GJSB 3OT9A 2HS0A 3OXLA 1IBMJ 1AUDA 3P5TL 1RAJA 4MFBB 2Q6CA 4JI6F 2RDIA 1RBAA 2ASJA 4U7UK 3KKFA 1RA7A 4USMA 2KFZA 4RWWA 2XI3A 3GPAA 2Z8QA 3I6PA 5B08A 2CQIA 2YKAA 3KNAA 4W90B 1BWEA 4A47A 3AODA 1JLFB 2AJ0A 3ZXWA 4YR3A 5E33A 1FRHA 1WKLA 3L7OA 4XTTA 1KTVA 5DDOC 2Y1RI 4DQPA 3R27A 1S10A 4JV5F 3W66A 2DHHA 2PGCA 3KLEB 4JI7J 3M2UA 2G2ZA 2H5IB 2HVHA 2DBBA 4KV8A 3J81Y 1B3TA 1FJGF 3QZ7A 2UVWA 4UQGA 2VIHA 2FIUA 1RLDA 1TP7A 1JLEA 5A6WA 4X65J 3J7Z5 4WFAQ 2JOQA 1CG2A 1FVSA 3BF4A 3R9LA 4YS2A 4ECTA 4B9TA 3N5FA 3HZEA 3K17A 4RUBA 4L73A 1MU2A 3BPDA 1H7XA 3HCXA 3IGVA 3R7BB 4OV1A 5GMEA 3A8KA 3VTIA 5DG7A 3RRGA 3CC4S 2A2DA 4U6PA 1LW0A 3DYAA 3IXQA 3MHYA 3TA1A 2YH1A 5D0GA 3OTCA 4P71A 3GSIA 1JJ2R 5SZTA 2KRBA 1RSCA 3MCSA 4L74A 1Y3KA 4C98A 2YNIA 1ICEB 5B7WA 4NLDA 4DCPB 3CVKA 2UXDJ 2IBOA 2AYEA 4AT1B 1APSA 4TYAA 2YNFB 5K14A 2XNQA 1YHQS 2OP5A 3A1YG 3O6QA 4IO1A 3C14B 4OYMA 2RIJA 4DHVA 1Q16B 3SZ2A 1KHWA 2U1AA 4M5HA 4N56A 3CD0A 5D78A 3J7YU 2C3UA 1OPZA 1R6VA 4UT4A 2MPUA 4PWDB 3QBCA 2AEMA 3N5BA 3DI6A 3RG6A 3CCRS 1E6VB 2R4FA 3WC0A 1RT3B 3TAMA 3J81U 4RNNA 1U24A 3RAQA 1I5OB 3E3XA 2DO4A 2NXNA 1FT8A 4B9UA 1FEHA 2J7UA 1G4CA 4UOCA 5BJRA 3PYFA 1JJ4A 3DRSB 4NPOA 3PFOA 4IH6A 4CLZA 3QFWA 2VU5A 5B0EA 4RNOA 3NGUA 1LKZA 3DLKB 1F3VA 3B78A 4B3MJ 4OX8A 3DI6B 3BDPA 2HK3A 4OHXA 3VVTA 2GHVC 4UUXA 1I3OB 1TL7A 3KK1A 3IAM9 4EMDA 1S0OA 2M70A 1N5YB 4RBTA 4NCGA 2DGTA 3MURP 1VHFA 3OR2B 4BC9A 2BV3A 2ZDOA 4DPOA 4DR1J 1OO0B 3P8BB 3P4UB 5EHHA 5HL7Q 1TV6A 2NUUG 4GO5X 5IT9Y 5J2QA 1DZ5A 1WTBA 2KHDA 1W2IA 2YVSA 4LF1A 3RU0A 1VRUA 2CQGA 3D7SB 2MQ8A 3CO9A 1WD6A 5J1PA 4CQ1A 3MFIA 3HF5A 1JNRB 2HBRB 5EDWA 1HHTP 2HG4A 2HNYA 2HHPA 1UKUA 2P5VA 2R2TA 2KO1A 1TUGB 2XZWA 3PX6A 1NH8A 5KFTA 5LT5A 3KG1A 3ELHA 3MCNA 1JLGA 4LRDA 3LA0A 1T03B 3L3CA 1X0PA 2DGXA 1SL1A 4B9SA 4Y2CA 4F4KA 1TKXA 1CEZA 1WC1A 2IM2A 5IM0B 2YTCA 3CJ4A 4FF4A 2YNGB 1Q5VA 3LO3A 1SKUB 3ZNJ1 4DN9A 5IV4A 3BJYA 4DL2A 2FJWA 4CO2A 1CJKB 5GADI 3TUJC 4UZBA 1H72C 3R2CJ 1WG4A 3AOCA 4IOAQ 3CCLS 4AL5A 3BSCA 4DPYA 2K1RB 3AXKA 3W9JA 4Q44A 1FA0A 2HRYA 3NL0A 4F36A 3CE8A 1VI7A 3DLHA 4A8XA 1BY9A 5A76A 1LFPA 3AJ2A 1JLFA 4LT6A 3D0IE 4KFBA 2HAFA 2CA9A 3H5UA 2D69A 3EE3A 2LEPA 2PA8D 1S1WB 3E51A 4Y2AA 3AB2B 3RR7A 1ZM4A 4CNYA 2CIMA 3FZ2A 1RWWB 1N56A 5KFZA 3I4HX 4O3NA 2XSFA 3GILA 5C24B 2F4VJ 3UNYA 1S79A 2DH9A 5KFJA 2ZITA 2KKHA 2BW7A 4G65A 3UDEA 2UU9J 4QW9A 4NA1A 1BMQB 3G82A 2ZNYA 4HLBA 2E66A 1JKHB 2DB1A 3M6WA 4XDDA 5E3QA 1IBKF 2E9RX 3UFCX 4DV2J 1P9QC 1LWXA 3I82A 2RRAA 4GKKJ 2DGSA 2HLTA 2K06A 2Q6BA 4NLUA 4RUCA 3VAGA 4ZVGA 3UD3P 1G2EA 2EWHA 2ATCB 4UW2A 4OJHA 2EC0A 2E1MC 2IHR1 3HT0A 3NKYA 4PG6A 4TU9A 1NJYA 1N34F 2ZC3A 1S6OA 2ZJRQ 1PYTA 5E5NA 2VJUA 3MEKA 1WEXA 3QGGA 2AU0A 2IA6A 2HMIA 2IFXA 1VQSA 2PSZA 3M9MB 2ADBA 1IBMF 5C25B 4EZ6A 4M94A 2MGZB 3G96A 1PGZA 1FCAA 4KGVB 4AUKA 1OQ6A 5THWA 5IQ6A 2RNEA 2VC1A 4PAAA 2YWGA 3AD8C 3M1VB 1RHQB 5F8JA 1N6QA 3ZZ0A 4ECWA 3NGKA 1Q53A 3THVA 2PT0A 4X65F 5J2MB 3IM9A 3M05A 3JQKA 1EETB 1P27B 4NYPA 4QR2A 2I5JB 4X66F 1TK8A 2DR7A 2XBPA 3PR5B 4BS2A 4DCJB 5A0YB 5K9FA 4WZQA 1N5QA 5KFLA 1SUQB 1DBDA 4CLLA 1FXRA 4AE5A 3V2UC 4DR2J 4DR4F 2A0FB 2RQMA 2KT2A 2WZ1A 4WIQA 3Q8SB 3KLHA 1FK9A 3W3SA 3SQGA 1FVQA 3F56A 5AE1A 3J81j 3DLGB 4ZN3A 2C28A 2PO4A 2NZ4A 3D54A 3LGNA 1N5TA 3I87A 4RW8B 3IRXA 2ATLA 3K2YA 2P9CA 2LDIA 3KLFB 1SV5B 3EVMA 4CO0A 5ITHA 3MEEA 3OTOF 4LIWA 1O8BA 3Q2TC 3DRXA 5D3GB 2FJVA 5A8RB 3ZTRA 2CRLA 4LJMA 5H9EJ 5I3QA 1LW2A 1UP1A 2DCUB 1AYEA 3GYNA 4ECVA 3NAHA 3G2XA 3FCHA 4LRBA 4PPZA 4WZMA 4EU0A 4OYXA 3MAHA 3T1AA 3CCWA 4F2RA 5H9FK 1IKYB 3IWXA 2OKQA 3LPYA 3KUEA 1S76D 4OHYA 1UWBA 4P2SA 4EI2A 4WE1A 4ATNA 1H73A 1DTQA 3ILOA 4HHUA 4HKQA 4KJIA 1H38A 3A3OB 1S6UA 4MMOA 2HBZB 4P2FA 4USVA 3AD7C 3SBMA 1JLGB 2BOAA 2B9XA 1Y10A 4K8RA 4AXIA 5L38A 2B43A 2CQ1A 5FLXY 1U6ZA 5KT3A 2KH9A 1IWAA 3UDVA 4CO1A 5LMUF 2RHQB 1Q78A 1TR0A 5KOWA 1UTAA 4ZJLA 4LIRA 5A8RA 1VFJA 3K8WA 5AJ3F 4I67A 4IFVA 3JTOA 4YQWA 1AZSA 2HHVA 3CWJA 4MYTA 4HT5A 1NLKL 1QAIA 3F44A 2A6OA 3FVYA 4ALZA 2D9PA 4DV7F 4C3MA 3ETOA 3FBBA 2GHWA 4WTOB 5A2QU 1KRPA 1RHUB 4JI1F 3ILJA 3KJNB 1DRZA 2IMOA 2L3MA 2X1BA 4ZPCA 5DQHA 2HWHA 2IJRA 2K8GA 1LXJA 1WTFA 3EUNA 1VQ9S 4C8ZA 4C0BA 3LUYA 4NXNF 3BGLA 4DL5A 2CNNB 2DEJA 2ZOGA 2DRBA 2OHDA 1P1TA 4X66J 3ZZOA 3GIJA 2ZH5A 1W25A 1Q86T 3D1QA 2G13A 1EKSA 1CQMA 2ZBPA 3H8YA 1UW9A 3HHLC 4ES2A 3P5BP 8RUCA 4B08A 2VPZB 1ZTTA 2AQ4A 2HNDB 1F9FA 3H4DA 3SV3A 2NS1B 2WVBA 3IGNA 2G1DA 4OYBA 3PEHA 4TNOA 2W9BB 1U1RA 2HYIB 4DR6F 3V6DA 3GIMA 2IAJB 3A4TA 1NSQA 4IUFA 2GMLA 2QA4G 2Y1IA 5F0WA 3D1HA 1SKWA 4LBHA 3M9OB 3LGHA 3CJ3A 3R1HA 1ZA2B 2GO8A 2K7JA 1GFWB 1FNMA 1YRUA 2W1BA 5C2CA 1C0UB 2HSEB 3FKBA 2EFOA 3O44A 4AD6A 4DL6A 1VBZA 1L3TA 2R7SA 1RAAB 1VBXA 3JQMA 4DXLA 3D0GE 1Q95G 3R5GA 4B3RJ 2VG7B 2ZBRA 1LWCB 3GCXP 2NQPA 1NRKA 5KG0A 3UN2A 5GAEU 2L08A 2LCWA 2VFSA 1TTHB 1E6VA 2FJAB 2B9YA 1F60B 1A6LA 1B70B 3A8IA 3GE9A 4KKOA 3E01A 4LRAA 2DXFA 3PX4A 2ZJPQ 1GXUA 3GMGA 3T9NA 4ZPDA 5J1EB 3GB0A 3MMBA 4AFFA 1R0AB 3AOAA 1NJIT 3A12A 5IC6B 3H42A 3HXMA 2OEKA 1L3VA 4WXOA 1RT4A 1RGVA 3R6GB 1S5ZA 4JP8A 4DR6J 3IRWP 4JI3F 4F4WA 1NBEB 1NEEA 3FCWA 2P2CB 1S99A 1S12A 1PYOB 4PUOB 2ZOFA 4I2QA 2C2ZB 1ZZNA 1GH8A 1U1LA 4USWA 4RX6A 4TLRA 4DPTA 1V6HA 3PXGa 3KMSA 1U8SA 3M8QB 4K7QA 4YDXA 3SCLE 2F8EX 5JJBA 2QL5B 3LP0B 3MPYA 3CF5Q 4X2BA 2NPFA 2AMCB 4C7QA 4CRJA 1X9MA 5A8KB 5D4PA 4Z7CA 2KYXA 1VIOA 2CYYA 2B3TB 1Q7YT 3N6MA 3EZOA 2GFFA 2N7YA 4G6VB 4ECRA 4DS5A 4WKRA 1IXKA 4GMKA 2BRKA 1FWPA 1XIQA 3MTJA 4ZP8A 2XY5A 5L1JA 1GNKA 1MNEA 4DSLA 3MM8B 4YN3B 4WFNQ 3CJTA 3PKMA 1OIAA 5DDQC 2EXUA 5BYQA 4A4JA 4DPXA 4DUYF 3AJ1A 3DLBA 1S9GB 1WHYA 1WACA 3KXDA 1V5IB 1DQAA 2GQCA 4XK8C 1HMVA 3ZFVA 1QDUB 2NSCA 2ZBQA 4N76A 3OD2A 2ILZA 5H1SV 1SL2A 4GO7X 5CA5A 2CJBA 1NDPA 2B4UA 1SH3A 1LWEB 3RAXA 2VG7A 4ZVQB 1SJ1A 3ZZUA 3CSKA 3D9BA 3M6XA 1FJEB 3MM9A 4NZ6A 5A2QY 4F7VA 2EKYA 3GQCA 1KHVA 1FDNA 3PEJA 2VQFJ 3H25A 3TO8A 2ZZTA 3TUPA 1XQIA 2F65A 2Q79A 2W24A 3MAAB 3FQKA 3JTNA 2QE5A 2V5HG 2VF3A 1TVRB 2NXUA 2V4QA 2NR0A 1UPMB 1KVIA 1EP4B 2XY7A 1CQNA 3QT8A 4EBDA 3AT1B 3IP0A 3LPEA 1S1TB 1YJTA 3Q89A 4LF6J 1DFDA 3B4MA 2E5IA 2UUAF 3V81A 1EX8A 2EVZA 1RUSA 1SJ4P 2E5LF 1A0OB 1HQEA 3CB4A 1QTNB 3TAQA 2KM8B 1Q8IA 4LRCA 1DLOA 3QATA 3G6ES 2FHOB 2UUWA 1U0HB 2C3MA 5F9NA 1JLCB 5LSLA 3VCDA 4J91A 5F8NA 1X0FA 1X4HA 3DDNA 2DXEA 1RT7A 2QFIA 1D3WA 4DF4A 1VOMA 4JI6J 1S1TA 2JL9A 2MHNA 3N01A 2A10A 3HVAA 3BQ0A 3LTOA 4UUWA 4J9PA 4RW9B 2XS5A 1U25A 2BVZA 2DTJA 2HGNA 3OFEA 5DG9A 3ENVA 2BKNA 1GX6A 4ZVEA 3WQPA 2C22A 4IOBA 4F4ZA 2RQ4A 2LU1A 5F8MA 3D28A 2R42A 4C11A 4V19J 1SJFA 5EN1A 3H98A 3RB3A 3OTBA 1IJFB 4F3QA 3D6FB 1U1OA 1RT6B 1G6BA 3I31A 1KSPA 4PKDB 2YBVA 1SQFA 1YWXA 2XSJA 1P1LA 1U2CA 2J0WA 3MM7A 1S6QA 1TAQA 2J8SA 2LYVA 4MYUA 5HJYA 3IS9A 1EKRA 1N5VA 3QLHB 5HP1B 2NSBA 1KTQA 2EFVA 3DMJB 1X4AA 3BKFA 3S6EA 2K3KA 1URNA 2AEFA 2APOA 5HI7A 2IVYA 1OY6A 1K8AT 3CULA 3M8PA 3MZIA 1BC6A 4G1QA 2MQPA 2JVRA 2JC1A 4DV6J 3TX0A 2QTWA 2W9CA 2HGMA 5KG4A 4X84A 3W2VB 1RT5A 2I1RA 5B0GA 1N8RT 2ZM6F 3A8EA 3BN4A 1WC3A 2BANA 1RWNB 3D66A 3TJAA 5C7PA 2HNYB 1T7PA 1F5CA 5HO4A 4ELTA 3DOLB 2O66A 2YNHB 1RHRB 1XJWB 4QCLA 1NJZA 2VD3A 2DITA 2NREA 4EZ9A 3RBDA 3I32A 2V4RA 4B3SJ 1UAWA 2MJNA 3G8QA 5F9LA 1VC5A 2DT9A 2DY9A 2CQ2A 3HHKA 1XK8A 2Z0GA 3BGOP 3RGIA 3RYLA 4C6AA 3OVAA 1VQPS 1TFYA 2IC3A 5KTQA 1L3UA 1FX2A 4PQUA 3EWGA 1NKCA 1WF0A 2M88A 2QO3A 1J5EJ 1YJ7A 2CKWA 3IA0A 4JYAJ 4R25A 2ROGA 4NLVA 3WX8A 4R5PB 1WKJA 3BYRA 2MZ1A 2DVIA 4NRUA 3D6TB 4YB6A 2BXJA 1FRIA 4ZPAA 2B4PA 3DGVA 4ANDA 1NPRA 4BWJA 1U49A 2MKSA 4FYDA 4M5MA 2AJ2A 4KR0B 2W2QP 4YB7A 2ZH7A 2LQJA 3PW7A 3OSPA 3JSMA 1RISA 4K0KF 2WW8A 1U26A 2MZRA 3M7VA 4NCBA 3PYEA 1S6PB 2DGVA 2DR5A 2YWKA 3ZZRA 1ZM3A 2FVPA 3DXSX 2CQ3A 3SQGB 4PG7A 3G82B 5JUMA 3R5AA 4FVMA 1RKIA 4FXVA 5FD1A 2N82B 3M9NB 1S0VA 5MAOA 2L48A 4YEAA 5D4OA 2Q3PA 1SVDA 5EGYA 3CDAA 1WEZA 1REGX 5G0RB 1R0CB 3OFFA 1WUUA 2Y0BB 4F4AA 3HM9A 2AHOB 2YX1A 4QYZK 1Q8KA 1GEHA 1RT1B 2B9WA 3D2WA 3BR8A 4G1IA 2C2RA 2EFGA 5ADZA 4X4TA 1PG5B 5DJBA 4J9MA 3ITHA 2OPRA 1CLFA 1EARA 4ZVPB 4DFJA 1N52B 2FHJA 5KT5A 4KSEB 2DNQA 1UA1A 2IBKA 1UJ4A 5LL6d 2GX8A 2VPYB 2FY1A 3HI9A 1V5VA 3NP5A 3WC2A 1M1GA 4ZDNA 2CJQA 3L7UA 1WC6A 2PFDA 2X7IA 1HNVB 1NCLA 3CJ5A 5KFXA 2VDHA 2Z56B 2Z2ZA 2QMUB 2VBZA 2OPQA 1TQLA 4LF8J 2IRYA 2V68A 1S9FA 1G7CB 3SMZA 1I6JA 3UCUP 3PACA 4PXCA 5KFMA 2KHCA 4OYZA 4K4XA 1S57A 4F0HA 4UY8T 4E2FB 3NS5A 3PHEA 1FESA 1VQYA 1RZMA 4XAKA 2BQUA 1EZZB 4WYLA 4J9RA 3O2IA 4UOFA 5F41A 2EPIA 2I9SA 4ZP6A 2MYFA 4EUVA 1JLAA 2JHEA 1RK8A 3JAMY 2ZH3A 2HPUA 3AH6A 5BXIA 2P8IA 4TVAB 2LFVA 2LXUA 5DZ7A 2KJWA 3QGIA 2DJWA 4OYOA 1RWPB 2W8LA 3KLIB 4NYOA 3CCES 2DHSA 3M30A 1UZHA 2AD9A 5FLXU 3EX7B 1JLEB 1NK4A 2VUGA 2EC2A 4RPFA 4NL5A 2XNRA 3K0JA 2MZQA 3NWRA 2UV8G 3OBIA 3FBEA 3CCSS 1YJVA 2LQ5A 2FZKB 1CJVA 2QN6B 3DDKA 2RS2A 2N3LA 2YQ0A 3DRSA 1DTTB 1LV5A 3FUYA 1HWIA 3TZZA 5HBMB 1T9WA 4Q45A 4EEYA 4J9UE 1OYDA 2HS3A 4QWAA 4P6QA 4YUDA 4QPTA 1RJJA 4ID8A 4ZN1A 2VKZG 1U48A 4OX9J 1HNZJ 2HHHJ 1HBMB 4P2MA 3TUZC 2O1PA 2VFRA 4ED5A 3PTWA 1BQMB 3KTQA 4HACA 2MLYA 4M1KA 4OYWA 2OPRB 4MH8A 5B0DA 4Z37A 5JVGQ 1S97A 1UJ5A 2FHJD 5KG6A 3JB9k 4FYXB 3RRKA 3GIRA 1B64A 2YWFA 3C6TB 5AE2A 2YX7A 3NCQA 2WOMA 5D77A 2CVEA 2JNJA 2Y0SD 4NZ7A 4QYRA 2CXEA 3VR1A 5LMUJ 4L3NA 2XMVA 4H4KA 2H4YB 2UU9F 2YQ1A 3QIDA 3H5SA 5IV3A 2OTJS 3OTDA 4UTGA 3U27A 4DI6A 1RHKB 5GVQA 1FRMA 5IC4B 3VGUA 3GIIA 4I6YA 2P6SA 5L9XA 5C2GA 2XLJA 4DUYJ 2FHMA 3OSNA 2BACA 3FMWA 4IYQA 5E3RA 5KFGA 3OL8A 4IR1A 1NHVA 2PIIA 3FCVA 2CJXB 2WVFA 1JLQA 2WW4A 2GIRA 4MKVA 1TKTB 3V81B 1T9XA 5BYRA 3LW5C 3GG1A 3SFGA 4R8UA 2JLFA 3MDFA 3ENWA 3VF0B 2JC0A 1MROB 3JYTB 2J6UA 2IDEA 3IBFB 2Y8YA 2FTRA 2YXLA 3GV7B 5C25A 2ZZMA 1KN6A 1BHNA 1O5JA 4DMZA 3AA9A 1YKWA 6FD1A 3WZ0A 4DR3F 3LF0A 4IG0A 5J1NA 3S7RA 2R2RA 5FJ4A 1FFWB 3HFZB 2UUCF 5KG7A 1LWFA 1GAOA 2HVEA 4DPUA 4LFCJ 3CIMA 3GZ7A 4ZVUB 1FX4A 2V8VA 4ECXA 4KE5A 3I4PA 1JQGA 2PC6A 1GMWD 2XI2A 3U1LA 3Q8RB 1RT2A 1SQGA 1HLWA 4GVBA 3NAIA 4ZVOB 2E7WA 3KHLA 4CYUB 3TW0A 2FVRA 4RU9A 3TAPA 3U02A 4RBUA 2KI2A 2RMLA 4U7UD 2OUGA 2KVQE 4O44B 3UI3A 4ZLJA 1VRQC 4X4RA 4FZVA 2V4JB 3LWLA 1JWWA 3HK2A 1PYSB 2VH7A 2OPPA 2WHOA 3ILIA 3QSIA 2F5GA 3W60A 1KP6A 5K8OA 2W8KA 3OW2R 1ZETA 3DRRB 1HNIB 4NXMF 3EGZA 4RW6B 3MECA 4NLSA 2QRRA 3DLJA 3RB4A 4NXNJ 2OPQB 2O67A 3NEKA 2VBWA 1ZOTA 2OEMA 5F8HA 3BDEA 1RTDB 2ZBCA 3HVRA 1UETA 3J7A1 1RADB 4L6V3 4ZHRB 3PY8A 3RRHA 4OI4A 3OUYB 1QSSA 1KQSR 5AT1B 1RWVB 1Q1KA 3CEDA 1DTQB 3UDCA 4CO5A 3M2UB 3PO5A 4JI7F 1TKDA 2AJQA 2HGLA 4B3OB 1QE1A 3VAMA 2XHCA 1LK7A 5A8KA 3LP2B 2BZ2A 1VK3A 1Q8BA 1KQFB 1NNDA 1RT6A 2HIQA 4C3KA 3N6NA 3PKYA 3W63A 1CS4A 1DURA 3KMQA 2YNGA 3PDNA 4ZIWA 1WSVA 2R7WA 3SCIE 1Y5NB 3B82A 3FDSA 3MPDA 1P6TA 2IRUA 4IG3B 4EWTA 1JLQB 2XCAA 3GIKA 4JBCA 4DX6A 3ITHB 1UCNA 2E1PA 2HQFA 2RD5C 1ZPWX 2J7KA 4WU3A 5CYMB 1ZH5A 2QL7B 3KFWX 3K5PA 2H1YA 1PIEA 4F8RA 5B0AA 4MTPA 4CM0A 3I0SA 4DQRA 3DLGA 4NOHA 2HNZB 1ZAXA 1TL4A 3IWLA 3BSAA 1I94J 1M5SA 2VC0A 2XMUA 4I7FA 4PWUA 1TMJA 1TMMA 2NZCA 2PEBA 1HMVB 4DV6F 2E5LJ 3BS9A 3BO4A 2ABYA 2GVZA 3GFYA 4DQIA 2ALZA 1D0EA 3CJ8A 4DL7A 3BN7A 2ZVIA 1S9EB 2GGPB 1F2GA 2IM3A 2MKYA 5CHCB 5CYMA 1C0UA 1U7LA 5HQMA 3RBXA 4QIGA 3SDEB 2QYGA 3GJTB 1Z2ZA 3W1YC 4YY3F 2MXYA 2MZJA 3M8SA 4HEA9 1NK7A 3I0RA 4PWWA 1SC3B 5F3TA 2BMBA 1VQOS 3HD1A 3MAQA 4USUA 4U8YA 4FPIA 3T1YJ 2MHEA 4Q0BB 2VA3A 1RTJB 2LP4A 3FEZA 4O4GA 4OV6A 3CJSA 3VAKA 1QD1A 5DM7Q 2ZDPA 4BCAA 4RNHA 2UXBF 2DKOB 3S01A 4USJC 2DNHA 2AYGA 2B8QA 2XO7A 4B3OA 4MIAA 1LNQA 3LAKA 2K2PA 2J9DA 2BJ8A 2RU9A 1X4CA 2C2MB 2WBMA 1YZ6A 1T9YA 4ES3A 1P9YA 3A3NB 2M3DA 2RUGA 3HSJA 4K0KJ 3BGRA 2ROEA 2CQCA 2E9TA 1UWAA 2J9DE 3BV8A 4KTQA 2NYIA 5D3GA 1OWXA 4OI1A 3NOGA 4J9QA 2Q66A 2AGQA 2XQCA 1T94A 3HLUA 3BKUA 2YH0A 3MMBB 4MFBA 2YNIB 2RSQA 3BR9A 5KFVA 4DZDA 4Z2XA 2R8KA 2MKKA 2H54B 2IJFA 2HEKA 2J7WA 1IKXB 2WVDA 5B0BA 4X4VA 1CPZA 1HWUA 4QIWD 2QA1A 1UWBB 2D74B 2DNRA 3K89A 3N9UC 3QGHA 4OJ1A 5DQIA 4W92B 1TFWA 3VALA 1HNXF 4DL0C 4PEOA 2AJFE 2AYMA 1HPZA 3A3PB 2EFPA 3RBEA 2JLEA 3TEGA 2B6AA 2XGPA 3SSRA 4LF7J 3GU0A 4WIIA 2RKIB 1S1VB 3HSZA 4FS1A 4KV8B 2ZJQQ 2ACMA 1Z2LA 2W2OP 4KHMA 3M32B 4OJGA 5CCLA 3RTVA 4M95A 4YHHF 2JH3A 3FRZA 4DV3F 4IO9Q 1WHVA 5JXSA 3CO0P 4DR1F 7AT1B 3I5CA 4A8WA 3KYLA 1I1GA 4MIWA 2P9EA 1XNRJ 1QAJA 4QZVB 4LFCF 2ZD1B 5EUHA 1YLXA 3Q24A 1ZS6A 4DUZJ 4ED6A 3PW4A 3NBPB 1U45A 1FF2A 1I51B 1NDLA 3KHGA 2HW3A 4NYZA 4G1QB 1K47A 1S1XB 3IG1B 1FDAA 3T5HA 3E01B 2HHHF 4MK7A 4QU6A 2WVEA 4DX7A 3ZNUA 2W2NP 1ZZFA 2YNFA 1QAYA 3CW2C 4IFVB 3HHLD 5K14B 1REVB 4QPXA 1YJ9S 2VPWB 4CZCA 4CO3A 3C2PA 4ERDA 1MWZA 3QYYA 3KUHA 4USTA 4HACB 3LP1B 3TJ9A 3V4MA 4JI4F 1G3OA 2R8HA 4QU7A 2BW2A 3V6JA 1SC6A 1FERA 2OJ3A 2FVCA 3BQ1A 2ZD1A 3I96A 3W61A 1BQXA 3CCVS 4DWIA 1OY8A 3KLGB 3EXCX 2DPIA 1IR1A 3O3LA 1X4GA 3RW6A 1S4FA 3CMQA 4QW8A 2IM1A 2CQPA 1RHJB 2JVOA 3MAAA 1WORA 3JSBA 4Y00A 4NXMJ 4DQQA 2VICA 3GFZA 2XO6A 2BABA 1CSJA 2M9KA 3MOZA 4M8LA 4F04B 3DU5A 3KOAA 2RQKA 4U7CA 2VQEF 1H6KX 2B4VA 3H90A 1JLCA 3DOKB 4QYZJ 3J80U 4IQMA 5AE3A 2XG8A 1TKTA 4ZLNA 1U1PA 2JWNA 1DLOB 3HVWA 4DX8H 4YB1P 2VA2A 1UVIA 4DDFA 4TU8A 1S59A 1WC4A 2RH3A 4AYBD 4DS4A 2BUNA 2MEWA 2NPIA 3OTEA 2KJVA 3ZO7A 4DV1J 4ECYA 2FC9A 4LSNB 1VRUB 4O0NA 3UO0A 1NK9A 1KFSA 3ULHA 4K4VA 3T6BA 4ED2A 3KDNA 2L9WA 3T19A 4OHVA 2FYXA 2BJ9A 4JI0F 3CCMS 3OPKA 1FRKA 2HZVA 2AF6A 2MMYA 3M8QA 4RNFA 3W5YA 1M5VC 4QWBA 2KG1A 4EO8A 1UEUA 3DOKA 3CJQA 4C97A 3HMJG 2AJ4A 3PZPA 3HO1A 1WC0A 2EG2A 4K5SA 1F9EB 1Y4ZB 3H2LA 3UE2A 3JAMU 1NXIA 2LECA 4O0IA 4M5IA 3OL7A 2GJ2A 1QUPA 3R5DA 5CQGA 1N48A 3UVJA 5D0HA 2E1AA 3BBBA 3W65A 1SB6A 1HNVA 2DNMA 3QGPA 4JI0J 1MMDA 1RU2A 2O01C 3PX0A 2RF2A 4KPCA 4F4XA 4DV7J 2A2CA 2CNOB 2VG6B 3MMCB 4ZOSA 1EQ0A 4KAIA 1NK0A 1TKXB 1DQ9A 1ZBTA 1HI0P 1MN7A 2BKPA 5HROB 2XMMA 1TU0B 1RU1A 3EM1A 2ZOMA 3W62A 1VQLS 4CLTA 3AA8A 5AXMA 1FKAF 1RAOA 2I0XA 1HBUB 2OELA 5DLGA 2XMTA 3OL6A 1MMNA 1C4AA 4LFAJ 4ED3A 3CGIA 1RWXB 4AL6A 1M5PC 1WHXA 4DFMA 2I5JA 4JOUA 4NCGB 2ZNZA 5I4MA 3PHTA 5K8PA 1N88A 3OJUA 5KG3A 3BSOA 1EIYB 1IBLF 2FVSA 1JMTA 2B51A 2SXLA 1TK0A 4F4YA 1HYSA 2R7OA 1MSWD 3HKWA 3KG4A 1YZ7A 3US5A 4FDFA 4J37A 2X1FA 1H0HB 2B8PA 1UFLA 1IJEB 3UCGA 2HNDA 1SQEA 3D3CJ 5L8RC 2OMLA 4DV0F 4L76A 5A8WB 1CVJA 4USHA 2C3PA 3RBZA 2IC3B 5KAKA 5IZHA 3NNAA 2C3OA 5F3ZA 4CTAB 2W7OA 1J2VA 2ZE2B 3E2EA 3TAMB 1R8HA 2ILYA 1YRXA 2M5YA 1XEZA 3QPIA 2PI4A 4OI6A 1XMQJ 1GMUA 4U96A 4F3OA 4FYWB 5D4LA 1KNZA 4KYZA 2PEHA 3K5OA 4NLPA 2R2UA 5D8HB 1U0HA 2J9CA 3MUMP 3SYZA 1M1HA 3CMES 1HW9A 1OQ3A 3H20A 3MR5A 3F73A 1R8PA 3N4WA 4J9OA 1D8ZA 2C3YA 3A13A 2DHXA 3HHLA 3M8WA 2M8DB 3W2VA 1RT1A 4JI1J 2KZMA 2E5GA 3B6BA 2ZM6J 1BWVA 1KC8T 4WWSA 3TA0A 3H5YA 3G86A 3ILLA 4RO0A 1S1WA 5CYJA 1C1CB 1VJWA 2N3OA 5M2UA 1CJUA 1FO1A 1WG5A 2WSCC 1HBNB 3MEGB 3QMQA 1U47A 2KZZA 1I94F 2HURA 5EX3A 1DARA 2IPOB 3DOMB 4TY8B 3NRBA 3QQCD 5HAOA 2ZH6A 4KPYA 4WTYA 4IG0B 4EK2A 2XWXA 1EQMA 2IY5B 2CPEA 2V8PA 2MQNA 4F2SA 3FMBA 3JYTA 1LW2B 1NK6A 1TUWA 1RT4B 3B54A 4B3SF 2CJ9A 1S6QB 4C8KA 1PJ7A 5KFBA 3NMRA 2DXDA 1IKYA 1CJKA 2E29A 4LR9A 1JNZB 4PABA 4YY3J 1N54B 3CJRA 1F5AA 2V9KA 3KLFA 4DV0J 3K7RA 4DLGA 3OR1A 4XDCA 2NXCA 3KLEA 3CDWA 1IKVA 1P8GA 4JV1A 2EG1A 4U9RA 3P49B 1YG0A 2MLXA 1RTHA 2DIVA 1NB7A 5K8NA 3J7ZT 1N34J 5IWAF 4R0EA 3BGFA 1CC7A 1E6YB 1HNWF 1AW0A 4M5DA 4NLRA 5I42A 3OR2A 5KFHA 5IFMA 1C0TB 1MG7A 2DK2A 3CCQS 1SKSA 2FC8A 2CPXA 2RDDA 2EI5A 3BBCA 1UVJA 2R7TA 1BGXT 3FSYA 1LWCA 3QZ8A 3CXCR 2WVCA 2QMWA 3OVBA 2KT5A 4HI1A 4PQAA 2ASDA 1KWMA 2LA4A 3CJ0A 4LVNP 1WKKA 4RJVA 4ZPWR 3AB4B 4USKA 4R5PA 4KHPJ 3F41A 4Y0FA 2DNPA 1C2PA 2GQQA 2I38A 2DNKA 4JI8J 1TAUA 2CPDA 3LGMA 3MR7A 3MPWA 4WYWA 2YKNA 1EAYC 2FGCA 3MCMA 2IYGA 1IBCB 2GC8A 2V50A 2H4WB 1EP4A 5E3CA 1FRLA 3H40A 2Q43A 1RWOB 1SXLA 5M2RA 4CI0B 4F25A 1VBYA 3IN5A 3G4SS 2MKJA 3CDUA 4M5KA 1X5SA 2GAGC 1HI1A 4OI3A 4OFZA 4YP3A 1PAEX 2KRRA 3M2RB 3P45B 3OLAA 5DLFA 2HNZA 4PUOA 5F8IA 3BEGB 4DV5F 2IM0A 1J5OB 4JV5J 2E9ZA 2EK6A 3I5BA 3V6KA 4URQU 3LAMA 1JB0C 2VKRA 3CD7A 4D3GA 4C8OA 2V8GA 2UXCJ 1RTZA 3W64A 4E98A 1NKBA 1ELOA 3GJRB 2RS8A 1FFSB 3BYPA 1VBKA 2JRSA 4BHQA 4GRSA 1Y3JA 3PW2A 4AQYF 4DN0A 1S48A 3QAUA 2V2ZA 1RAFB 2XWYA 3L95X 1PJ6A 2RB7A 4I64A 4P9SA 1Y5LB 4CLSA 4CNZA 5HVHA 1LQ9A 2EFQA 3GV5B 1XR6A 3TARA 2PE8A 1JLBB 3B4DA 1VR6A 3M2RA 4PG5A 2B9EA 1EB0A 1RHMB 3T5KA 2JEJA 3EGNA 1X31C 4OYPA 4WU2A 5CABA 2VG5A 4DSKA 2OSQA 3HHLB 4ER8A 4DR5F 2PMHA 3RZAA 3K5LA 4Q0BA 4LF4J 2B6AB 2HHUA 4QJVA 1SI9A 4LF9J 3DLEB 4LR8A 4W4MA 1LWFB 1VDHA 1HQUB 4MIBA 3W8PA 1RI7A 1NDCA 4KGKA 3G87A 4A8SA 4GKKF 2O3DA 2AEJA 2BDPA 2MKCA 1VK8A 2NXEA 2CNKB 3OVSA 3W9HA 1Q8LA 3O5TB 3A8JA 2WBRA 2BQRA 4X4UA 2ZWOA 2VZ9A 2L41A 2BJDA 5C42B 4FF2A 1N5SA 4WFZA 3KHHA 4X64J 2JZ5A 1T9UA 1OY9A 1ZM9A 2OPPB 3DU6A 4WPAA 3VZHA 2CQBA 2XTJP 5G4DA 3D6HB 5J1EA 5LJ5Y 2OD6A 3EYZA 2ADCA 2Z2YB 1PKUA 4PXBA 2HZAA 3FSXA 3OXFA 3M2VA 3BM7A 3FNNA 3NXZA 4FNHA 1QVFR 4O3SA 3DDIA 4E8UA 2FZCB 4C48A 4M5JA 3C19A 4YB5A 2FB0A 3KLVA 2XYGB 2XLIA 4IOCQ 1Y5IB 3TANA 1ITPA 1IKVB 1X4DA 5L39A 3NS7B 2BA9A 4LF2A 3CJKB 2F4FA 3MM5A 3R6LB 2GJFA 2KB2A 2LKZA 3GWCA 4L72B 3BO2A 4QR0A 2BJEA 1RLCL 4DSEA 1BQMA 2G0JA 3JQJA 4LQ9A 1NK8A 1CS4B 2XY6A 4A8FA 3Q22A 4I1TA 2E7VA 2VDIA 4LQ3A 3AY0A 4J9LA 4LF8F 4MKAA 2GAHC 3KNGA 3K57A 3NG8A 3HD2A 1GX5A 3MR3A 4N5SA 2HWIA 5HBMA 2UP1A 4O3PA 3BSNA 3ZTPA 1KR4A 2V2QA 2OTLS 4ID5B 2H9ZA 3NGSA 5LM7E 2W9BA 3RR8A 1UL3A 2BBEA 3DC2A 2ZH2A 3KUGA 5T14A 3Q8QB 3T3FA 3IWNC 1IR2A 1QAXA 5HQLA 4DV4F 3DGPA 1UJ6A 1N0VC 3T5LA 1EHWA 3HSGA 2VV5A 4RW6A 2FJEB 3K8VA 2DNOA 1MN9A 3DFEA 2BE2B 2OFHX 5HLFB 4ZCMA 7FD1A 4FF1A 3NGDA 3PG9A 3PM9A 5CD4H 2V94A 1U0SA 1NAQA 3TVYA 3W2WB 1VC6A 4OZ0A 1YTYA 3P6YC 5I3UA 2VFUA 4B02A 3DNCA 1F0XA 2HBQB 3RB0A 4LRFA 5ETKA 3L09A 3I55S 2ZHBA 3G8SA 4EYIB 1KOHA 2OO4A 1B7FA 3FC9A 6FDRA 2KU7A 4ZLLA 2CJAA 1UVLA 1T3NA 2QA2A 3UVJB 3I0RB 4N47A 1UFKA 2PMWA 4ECSA 1HBNA 1FD2A 3Q8UA 5BR8F 2VL1A 4I4BA 4TQSA 1U1KA 4HL9A 2OI2A 1UVMA 1HL6A 3MGJA 3DHWC 1RBOB 3F0NA 4MJKA 3MMJA 4OZ5A 5CZVA 2E1RA 4WCEQ 2QA4S 4X4QA 2LLZA 4CCHA 4IQXA 3ZC4A 3D0HE 2VOPA 4EBCA 2IVMA 4HI2A 3TI0A 4KGMA 5AXLA 1NM2A 5U47A 1ZPVA 1NZAA 4KGXB 3DXBA 2DO0A 2ZVSA 3ET6B 1XMBA 2Z30B 4C0OC 3G6XA 1FHTA 1TKZB 4V19X 4LBIA 3D4JA 1KKHA 5KFUA 5HJXA 3UW1A 1SUQA 1XTZA 3W8GA 2V2KA 4ZJOA 2NUHA 3L7PA 3N28A 1VGYA 2MZTA 5HN0A 2R7RA 1HBOA 3DLKA 4OX7A 4NLWA 4A8KA 3WDOA 1KLNA 3HHEA 1FK9B 5ETPA 2CPZA 3I56S 2UVVA 2KDOA 3EVWA 2DH8A 3W9IA 3GFHA 4AQYJ 1ZYQA 1SIZA 3Q83A 1FNXH 1KS2A 3UD4P 1KVKA 5T7LB 1C1BA 3CT9A 3HFVA 1TL5A 4ILRA 1DY3A 5E7OB 4NRTA 3N6LA 2MSTA 3UNGC 4BLGA 4Q5VA 1VQMS 1EETA 3Q8PB 1Q5YA 2HQDA 5LXRA 4CTAA 1T9TA 1Q79A 3MMCA 1FJCA 3H59A 4WK1A 2FY8A 2V8DA 4TXSA 4P72A 3TP2A 3W2WA 5ETNA 3GV8B 4NLQA 2ASYA 4K4UA 2HFSA 4ETXA 2MDAA 3RB6A 4ECQA 3R2DJ 1U8WA 4PQUB 3LALA 2YKPA 3MEDB 2MGZA 3C14A 4CH0S 2BQ3A 2C2KB 1MW7A 2RDJA 4MKBA 1R8CA 1RWKB 1S4EA 2LVWA 3AQOA 1PILA 1NSPA 1S1XA 2YWWA 3IG1A 4LVOP 4V1Ak 1SPBP 5IM0A 1WELA 4A46A 2QG9B 1KBRA 2BR0A 1K9MT 4FYVB 3KJVA 4DU7A 1TL1A 3OFGA 2CPHA 4ZCKA 4F26A 1C0TA 4P74A 3WX4A 1U1MA 2XS2A 2RRNA 3IM8A 1BQNB 1QTMA 5LSRA 1RTIA 3M6UA 4ZVTB 5KFAA 4YMEA 2CFXA 3FQLA 2HQGA 3G71S 4HH1A 4Y2KA 4DV4J 3IR5B 1W2BR 3PVXA 1J5EF 3PW0A 1LW0B 3DYAB 4K4SA 4C0HA 3RW7A 5CCMA 3JS9A 1TUVA 2ACYA 1IVZA 1RE1B 1QLNA 1O51A 3HJFA 2ZC4A 5D4NA 5HMXA 4DL3A 2X3DA 4GKJF 1PC4A 3DM2A 3OQ2A 4ZLPA 2CPJA 4UOHA 5KFWA 2FLPA 2OPSB 4H4MB 3P96A 3DKDA 2A1BA 4WP9A 1GMWA 3ZZPA 3V6HA 2KXHA 4ZVHA 1K1QA 1H2VZ 4TY9A 1FFGB 4Y3CA 4DJBA 2PDAA 1DHMA 1RTIB 1WWHA 2BJ1A 2F9DA 2XZDB 2CQ0A 3KDOA 5KOXA 1EJ7L 3ENQA 4PPDA 3EJMA 2IA0A 3Q8VA 4U8VA 1NK5A 1UZDA 1GMVA 1RT3A 1Y9OA 2DCLA 3DMJA 2V4JA 3R97A 1KQGB 4ZCLA 3UCZP 1Y7PA 4OL8A 2DRDA 3QO9A 4FKYA 4WP3A 3J7AN 2AX0A 1A7GE 2J5AA 4HH0A 4NI2B 5D6GA 5KFDA 3DCAA 2OMOA 1BD6A 2YKOA 3ENAA 4Y2IA 4JI3J 1RBLA 4I69A 5AXKA 3G8TA 3Q86A 4RL1A 3V4IB 3C16A 3C6TA 2FZGB 3MEDA 4KO0A 4CLKA 2C1EB 2XM3A 2W4DA 2CWKA 4UF4A 1H2UX 5IWAJ 3R5CA 6AT1B 4LF7F 1YVFA 2G2OA 3DLEA 5AJ3J 3LWMA 4DFKA 4NCAA 3SQOP 2B4OA 5KFNA 2HHSA 5C42A 2RAQA 3KLGA 4NA2A 5GAEI 3BKTA 1RYSA 4ANEA 2HKEA 2RHSB 4NASA 4ELVA 3LQVA 1U1NA 1VS3A 1FRJA 2H3EB 4XIUA 1R6YA 5L1KA 1S1VA 1TL7B 2YKNB 1R8AA 2HVDA 2FGOA 4ICLB 2AGPA 4ZMMA 2MY7A 1FXLA 2VFTA 2BX6A 5DM6Q 1LXNA 1HPZB 2EBGA 1FNOA 4KQZA 4NA3A 3G9CA 1QE1B 3QJLA 2H65B 5LXYA 2DH7A 4CWBA 5KFOA 4KBIA 4PR6A 2RKIA 1O0PA 4ZPVR 4H4OA 4N8OA 3HVTB 2UUTA 3UN3A 3RAMA 4BBYA 4OLOA 3EGWB 4A8YA 3AHPA 3HT3A 2QLWA 1CC8A 2JX2A 3MM5B 4RW4A 2LU2A 2X3GA 4ZIVA 1REVA 1RTHB 1U4BA 5HVFA 4B9MA 1SH2A 2QSFA 2VBXA 4WFBQ 1QY7A 5KT4A 4QWCA 5L1IA 4E0DA 2QSWA 4M5DB 1XNQF 3EVOA 3TEHB 4CDIA 4X64F 3FRYA 1WOPA 3KJFB 1IM4A 3K5MA 4LF6F 3JSYA 4EGLA 3QWPA 4ITSA 1KEKA 2QLJB 1YK9A 5EX0A 4RZRA 4DR3J 1PAUB 3B8HA 4NEZA 2RT3A 1YGYA 3PRVA 4ANCA 2BOPA 4F0MA 2DGQA 2KXFA 2P6TA 3WBZA 3UD5A 4JYAF 2K1RA 3THPA 5A8WA 5LSOA 4QQBA 3J80Y 1KLMA 1S7IA 3MI7X 4CLUA 2POKA 1BE4A 4LF9F 4RNMA 3QT7A 3Q8YA 1F1BB 3ONQA 4J9VA 3TYTA 3CCUS 2IMWP 3NMAA 3OUYA 1JXEA 2DD8S 5C5JA 3R7NB 1H3DA 1MROA 4WBFA 2YPZA 2A18A 2DNLA 4R8UB 4HR2A 1NU4A 2GVDB 4NE9C 3CMAS 1VQ7S 1H7WA 3AQPA 2DHAA 4RW9A 4PYAA 2ERRA 4C8NA 4UOGA 3MXHP 1GK8A 1UFWA 4RW8A 5HLFA 2QGFB 3MR6A 4DF8A 4K2JA 1T03A 3H2UB 3VAJA 3POTA 3QSYB 5KG1A 3PW5A 3T6JA 4MAKA 4PWDA 1S72S 1K44A 5HMWA 4WJBA 2J6TA 1AT1B 3M8PB 2E7XA 1JK9B 1Y00A 4Y28C 2ZUGA 5K8MA 1R43A 2GVDA 3QWUA 4KGZB 3VQTA 2RILA 1NB2A 2W25A 3ISNC 3VGVA 3WIUA 1VRTA 2AGOA 1QVGR 1HIYA 5IXUA 1KOOA 2PN6A 2KFYA 1N6QB 2KL8A 4PRFA 3CTRA 2AT1B 2BM1A 1ULRA 3KK2B 1S0MA 2R7UA 1N33F 3U1MA 1CJTA 4HTJA 1IBLJ 3LANA 3SFUA 2V0NA 3OR1B 4DFPA 4B3TF 2ZE2A 2QZ8A 5J2MA 3P3DA 1KD1T 4KIAA 2AW0A 3ISND 4C8YA 4ED4A 2QLBB 2PMZD 4CH7A 2I8EA 3NCPA 4ZS6A 3W5XA 4A48A 1HQUA 4B17A 4TU7A 2M52A 2MJUA 5J2NA 2W4CA 4JV2A 4KHPF 2DEIA 1FKOB 3TRGA 1ZTWA 4C4WA 2LQ8A 5MLCV 2NYHA 2OSRA 4LSLB 4X62J 2HFZA 1T02A 3SV4A 3MCOA 4ZVRB 9ATCB 3CCTA 4HTIA 4ZP9A 3CD5A 3QRPA 3CCJS 3H5XA 4HDGA 2HHTA 2EBEA 5DO2A 2XMKA 4EYHB 2X51A 4L3KA 1IKWB 4P7TA 5I42B 1ACMB 2HFVA 2HZCA 3OLBA 5HMYA 4X4SA 3K5NA 2Y9HA 2A3JA 2ZH4A 2BRLA 5D0EA 4ECUA 1XMOF 2R8GA 4Y6IA 4G1PA 3M2VB 5IT4A 3N79A 2IIHA 4J7CA 3TQ1A 4HHHA 3W5ZA 2QL9B 2F3JA 2JEIA 2F8MA 1Z4UA 2KT3A 3C8YA 3AD9C 1U09A 4LSLA 2WB1D 4F67A 1B0TA 1SJRA 5CYQB 4G3IA 2GIFA 1MU2B 1VISA 1Q7LB 2HQIA 3PJXA 4WE1B 4OX9F 2XCPA 1LK5A 1BUXA 5LMNJ 1ROFA 4OI2A 1AB8A 3M6VA 1D8YA 1YJRA 1B4SA 2GQ2A 4KFBB 1RWUA 4K59A 1RWMB 1RAEB 1RCOB 1RDRA 2DGUA 2EW9A 1FDDA 4USIA 1R31A 4NLTA 4A8OA 4FBUA 3EDRB 4A8QA 1J27A 2MQLA 4B9LA 1K0VA 1GTEA 4CLFA 1WF2A 4I6AA 5B0FA 3PIOQ 1F3FA 1NUEA 4EBEA 2OGUA 1AZSB 4M5GA 5CYQA 2DR9A 4WF9Q 2D3ZA 1R7IA 1JIHA 1O6XA 2R8IA 4FNIA 2V69A 1R27B 2PI5A 5GADU 2KG0A 1FWLA 3HZGA 2N7CA 1VQ5S 3MEEB 3PCOB 2IYIA 3EXYA 5LJ3Y 3EMTA 3KJVB 1FD8A 3EZUA 3HHNB 1UVKA 2AIRB 2OEJA 1FKPB 1NH7A 3FFIA 1HNXJ 2B5JA 2XYPB 1BQNA 1CJUB 2BM0A 2FPHX 3MEGA 3DM2B 1FI4A 2CZ4A 1X5TA 1KQKA 2WOMB 1S1UA 1RTJA 1WDDA 2AV5A 4O4GB 3OHBA 3I9V9 5ETTA 1HNWJ 2DNGA 1JX4A 2XMWA 3HVTA 4ZP7A 4X4NA 5AXNA 4HHJA 1SC1B 5KFSA 3KJQB 2XSJB 5HATA 5HMZA 2IVFB 1QSYA 3EDQB 4WFYA 2DIUA 4DG1A 2FLLA 3VAIA 2HHXA 1CBKA 1XNRF 2GMJA 1VCTA 1GXTA 1YBAA 1YJUA 2JEGA 1WSRA 5ETMA 3CPWR 1RAIB 3JSMB 4HVZA 3LP1A 3FSIA 1B0PA 1RXOB 3VWSA 1Q82T 4OLPA 2VQEJ 3UQSA 1XR5A 3IBCB 1HD0A 1SCJB 3PV8A 5DS7A 1WI6A 5L1LA 1RYRA 2LEAA 2WRMA 2QC3A 3KLHB 1XC9A 1VRTB 2VFVA 1PSDA 2FLOA 2BE7D 3NWGA 1V9OA 1NPPA 2XYHB 1HW8A 2GW8A 4J90A 4EO6A 4P73A 5IT0A 1DTTA 3HPOA 2OLWA 3VV2B 4KY3A 2YNHA 5J2PB 2HWTA 1HA1A 2B0GA 5ETRA 5KFIA 5F8LA 1U6BA 2LA6A 1W7WA 3JXOA 2VODA 5DG8A 4OZ3A 4LFAF 4NX9A 4OIXA 2LMIA 2QYCA 1D09B 2AP6A 2XULA 1NSKL 2HFUA 5FIIA 1LFWA 3NBPA 3CCZA 4NLOA 2FD2A 3GCWP 3O8WA 5D15A 4BDPA 2F8HA 4K50A 2VASA 2WONB 4QR1A 4DOZA 1M0SA 5KFCA 2YX4A 4JI5F 1JLAB 2QIFA 3GYXB 5DZ6A 3LOUA 4IDKA 3TR5A 3M1VA 2LEBA 3DLLQ 4UY85 1HHSA 3M8YA 5KFYA 1U2RA 5CZXA 4O3OA 4ILLA 1FDBA 2CZVC 4L75A 3ISZA 2ZH1A 2UXBJ 5DDPC 2RRBA 2DRAA 2KTQA 1HR0J 2QV6A 1NHUA 1TK5A 1S9EA 1X4BA 2HMIB 5K20B 1T9VA 2CG4A 4EFAC 1Y11A 1MWQA 3VZIA 2DHGA 5A6PA 3C15A 3C46A 1CJVB 3UDLA 2D3O1 1KDNA 4KHRA 3MFHA 2HBYB 3R5BA 4OX6A 1FEEA 4ZPTR 4DU8A 4ENOA 1X9WA 4Q8EA 2G4BA 2HVZA 4DSIA 1RA6A 8AT1B 3TOQA 3H4BA 5KG2A 2V34A 2AZ3A 1XERA 2FUG9 5C24A 5KFKA 1R0AA 3CDBA 4GKJJ 1SV5A 4FYYB 3KLIA 3SIPB 1WOSA 2WTFA 1YI2S 1UVNA 3DOLA 2CWXA 5I3UB 2Y3YA 3ZTSA 1SJQA 1FTRA 4CT8A 1PJ5A 3S1TA 3PR4A 2HHWA 5E3PA 2LDYA 2UXCF 3MPUB 3ICLA 1J5OA 4I6WA 2BE2A 2CDQA 4IFYA 1XR7A 2LQBA 4RW7A 1HWLA 4HDHA 4O44A 4P10A 5DQGA 1SKRA 1M5OC 1IN0A 3T1HJ 2RU3A 2IRXA 4DPWA 5F0UA 4CYUA 4N41A 3HULA 2XGQA 2GO9A 4PXEA 2Q1LA 4WKYA 1MWYA 2K3IA 4QIFA 1U02A 2MLZA 3NCRA 4WP8A 4IRKA 1YQHA 3IS9B 1S6PA 3X1LB 1L5UA 4N8NA 3GFXA 1N5YA 5FDLA 4A8MP 2ALYB 3H0PA 2M2BA 3AOBA 4DZ6A 3PO4A 2C42A 4K4TA 2UV8A 1KVJA 4JI2F 2DISA 5KFPA 1AROP 2C2OB 4FP9A 4N77A 3QIPA 5DDRC 4URGA 2V8HA 1YX2A 4S0MA 3MMAA 4IDKB 1F9HA 1WNEA 5KT6A 2GNKA 4U95A 2EK1A 3AFGA 1M5KC 1TELA 2CVIA 4MK9A 3IRXB 1TL3B 3BB5A 1R0BG 5T41A 1K1SA 1RT7B 4JB8B 4KKOB 1HBOB 1Q4RA 2DNZA 5G0RA 3TUIC 2AZ1A 3SXLA 1E6YA 4F0KA 1X5PA 4NLGA 1YRTA 3QO9B 3D1OA 4TYBA 1F5BA 2PA3A 1CULB 1TV6B 2RVJA 4DL4A 3CIZA 2NLWA 3I0SB 2J0XA 3QIPB 3FBFA 1H98A 5HANA 2JFKA 2RUSA 1VQNS 1HBUA 4ZPBA 4GC6A 4QWDA 2D3OR 2W01A 1NKEA 3TVZA 3Q0AA 4ICLA 4GC7A 1PBUA 3MTKA 4C8LA 1X4EA 1Z1ZA 2F1FA 3D3BJ 4MK8A 2I2YA 2IDLA 3GYGA 2W2MP 3Q2SC 1QUVA 2W7PA 4J9KA 2G0IA 5E3AA 2VB6A 3TNVA 4ES1A 2L9NA 1F2HA 3OJSA 1DJ0A 2E44A 3EPGA 1RABB 2FQQB 3IR6B 3QAEA 5EWFA 4TY8A 3TZYA 4IR9A 1N0UA 5F8GA 4Q43A 1NPKA 1U1QA 4PZVA 5LMNF 2C2DA 2COLA 1B0VA 3D5MA 3HDSA 5ETLA 3ZTOA 1GQEA 4DUTA 4YDDB 1IUJA 2W9CB 2P9GA 4KH1B 3DRPA 2N4CA 1QM9A 4XPCA 3TZXA 2KM8C 4FBTA 2E5HA 2M8HA 4PG8A 1H2TZ 3MOJB 3MD3A 4QWEA 2MZSA 4K4WA 1HWKA 2GMHA 2YWHA 3HX9A 2LXFA 2QT7A 3E8OA 5SUHA 4H4KC 2UUCJ 4GVBB 1TL1B 5IS2A 1R8BA 2C2NA 3CNQP 4ED0A 4U67Q 1PC5A 1FJGJ 3MM6A 3RJMB 3W7BA 3N0VA 1ZAVA 4JI2J 4BWMA 5GAHU 1OSDA 2XHWA 1L3SA 2OIHA 4LFBJ 3MR2A 1SC4B 5BYSA 1G1XA 2RE1A 2OD4A 1WF1A 1JJCB 3LP0A 5DETA 2CPFA 9RUBA 2LXIA 4XPEA 2ROPA 5EWEA 2ZFHA 3T1YF 2CQ4A 2CPIA 2DYAA 3GG0A 4M5LA 3IR7B 3D6MB 1RKJA 1NJWA 3IFEA 4IG3A 1SL0A 1ZAWA 2FJBB 1VYAA 4KB7A 1VQ6S 4FKXA 1OPIA 3QNWB 3UPFA 1RQ0A 3IMQJ 1T3OA 1WC5A 4XO0A 2BEFA 3HFKA 1R3NA 5DGAA 3ZZZA 3BO3A 1T11A 2J6SA 1IQTA 3MM6B 2F7VA 2WAQD 3PFEA 4OYAA 3LP2A 4UZCA 2OH2A 2CAJA 2UZAA 1T05A 4JI5J 2UUAJ 4JV0A 3TZWA 2VOOA 1FWKA 2CDRB 2F63A 1HFEL 4CO4A 3SI8A 4JUZA 4DV1F 1NZ8A 4AL7A 2ZWPA 1DQ8A 2BE9B 1FXDA 1MMLA 1H74A 1GTHA 2VPXB 3AJDA 3C16B 4OHWA 3SCKE 3UWTA 1IQZA 3WIVA 3MUVP 3T5JA 2MKIA 2MY8A 5DRKA 2DY1A 1LWEA 1PCAA 2H51B 1TKZA 4OMFG 3C3LA 4FS2A 3CC7S 1JKHA 4RUAA 2J0QD 2KYZA 4KO0B 3R3TA 2D41A 1Y0HA 5LOQA 3THTA 3J7YI 2I6WA 2CADA 1T05B 2QFJA 2DPJA 2YQ3A 2PFFB 3CJ2A 4IH7A 4NLXA 4CLPA 4IRDA 4UQTA 3HHDA 4F50A 3R5JB 3VAHA 4YOEA 2R3VA 4TQRA 4LSZB 4FF3A 2R7XA 1T0TV 4O3QA 2R9LA 1K73T 2HHQA 4P52A 5KFQA 3OFHA 3IBWA 5IOLA 2JDJA 1VQ4S 2XB2D 3NY0A 3PNIA 3WHIA 2OAUA 2BJ3A 2JSXA 3M8RA 4NLYA 3CC2S 3FGVA 4OQJA 1HKAA 1SJ3P 1UPPA 3QJJA 1YITS 3KK3B 4OI0A 1UEVA 2ZHAA 4FXWA 2CPYA 2FJDB 4MKYA 2QJ3A 3C66A 3VQSA 5L9NA 4FN5A 1RTDA 1L3KA 2CJYB 1VLYA 4I56A 1T95A 3TWZA 1HNZF 2Z2LA 4DV5J 2J76E 3D67A 3M30B 3MECB 4W98A 4C3LA 1N36J 2FLNA 2IJNA 1LOUA 2B56A 3MM8A 3O1LA 4P2XA 2MQOA 2HRTA 4ED7A 2PD1A 1IKXA 1MLAA 2B7BB 2VG6A 4Z7YA 2HVIA 2FJXA 2HLUA 1S9GA 1AUSL 1S49A 3IO1A 2UUBJ 5GMKa 2ZKTA 2CZ9A 2DGOA 4TLQA 2AYBA 1X60A 1V3SA 1WJ9A 3C15B 1RCXB 1F6TA 4ECZA 2X1GA 1UMJA 5GAHI 2DNYA 4YHHJ
chains in the Genus database with same CATH topology
1VIXA 3JTPA 5H9FJ 2R8JA 1TL3A 3SSQA 4QOTA 2QEXS 5GAGU 4ZCIA 3QLHA 4PG4A 5HP1A 2G9OA 2OPSA 4H4MA 4DUZF 4BC7A 2MQQA 1D9FA 1N32F 1QSLA 4M63A 4ELUA 3V6DB 5K5MA 1KONA 1RP5A 5KG5A 4YFUA 3DOMA 1JXLA 1VC0A 2VBYA 3HP6A 3GSDA 2GIQA 1N4LA 4X4OA 3VAFA 4O3RA 2Y1JA 3I9ZA 3TVKA 3S8SA 3AAWB 4WK3A 2D7SA 1KFDA 2FHKA 1UA0A 5J2PA 4ZKAA 4O4RA 1WEYA 2XEXA 3LH2S 1VMBA 4F3MA 4RUHA 2RQCA 3PJWA 3OXGA 2W9AA 5J2QB 2JFDA 4I2PB 2WSFC 4D3HA 3V4IA 3CUNA 1U2FA 1U6FA 4IRCA 3DRYA 4KC5A 4X4PA 2ZH8A 1S7HA 5E41A 2F9JA 1HBMA 4C9DA 2MB0B 4RU2A 4OJ3A 4ZA1A 2C2EA 2FDNA 1FRXA 4TKTA 7FDRA 4LFBF 3KG0A 4DG1B 2K7KA 2R7VA 3K59A 5FDLB 4R0JA 3MWBA 4Y65A 2YWEA 1X4FA 2GA7A 2V9WA 3MD1A 4I2PA 1D9DA 2Z4PA 4B9VA 1S77D 4DQSA 2YKMA 1DAXA 3DN9A 1HD1A 3BZQA 1K0TA 3BGUA 1FE4A 4WFXA 1HI8A 1SIWB 4LSNA 1D1UA 1HNIA 3POTB 4DV2F 2M7SA 5E2QA 4ZHRA 1FTCA 4DBQA 2JEFA 2RF2B 1D9AA 4DR7F 2DGWA 4J5OA 3MF5A 3MPVA 5KFRA 2ASLA 1XWLA 4IFYB 4OZ1A 2E5JA 2QLXA 4RW7B 5HROA 3HKZD 2AWZA 3FEYB 2QMXA 1HARA 2AX1A 2EFNA 3I5AA 4CIOA 4FXDA 1C4CA 2OFGX 4Q2LA 1IR0A 4JI8F 1M5HA 2UVUA 5JVHQ 2HS4A 1XN9A 4LF5F 3U7JA 1M90T 4K2XA 3M32A 1KLMB 3UR0A 4Y34A 1Q81T 1RT2B 2LQ9A 4YR0A 3R1LA 3TX8A 3GR0A 4TN2A 1WHWA 4WXWA 4ZK7M 5KT7A 1HWJA 3X3UA 2M0GB 1VQKS 3DHXA 2HQ3A 1X7VA 4QBUA 2CJKA 3FJ2A 4URSA 4C2MA 3BGRB 4ILMA 5KFFA 1PO6A 3OL9A 1FKPA 3FFIB 2H5EA 2WK4A 3PRBA 2WSEC 3ZZYA 5I3PA 3T9ZA 1SH0A 3CD6S 1IKWA 2N4DA 2M4MA 4Q2MA 2F4VF 4Q7AA 5B0CA 4DSFA 2CQDA 4J9SA 2XS7A 2Z2MA 3IC1A 2BYCA 3EPIA 4ID5A 4RWXA 1X5OA 2B5JB 4K4ZA 3KK1B 3JSRA 4DEZA 1R89A 1YSJA 2YY3A 1XBWA 2UUBF 2XC9A 5E0OA 4CT9A 5KFEA 1N36F 4I2QB 1FKOA 3SCJE 5EWGA 1YJWS 1FE0A 3MM9B 2RJZA 1S0NA 2B7CB 2KVIA 3KHRA 1T8EA 2VQFF 3CJKA 1YJNS 2JLGA 3QJPA 1ZM2A 2GJIA 4RLEA 3PRDA 4Q8FA 5HQ8A 3TA2A 2UXDF 1C1BB 3EZ5A 4ED1A 2R7QA 2D1CA 4PCQA 3SSSA 3OHAA 2FVQA 4HT7A 1A9NB 1FJ7A 1V3ZA 4RKUC 2G0CA 2DNNA 1VQ8S 2F40A 3SEOA 3DRRA 4DR2F 4H54A 3FEXB 3NS6A 2WONA 1HQEB 4KT0C 3M4XA 4ZVFA 3Q23A 2HFOA 1WG1A 2HFNA 2WB4A 2ZH9A 4F02A 1BLUA 4OZJA 4H4OB 1S1UB 2VONA 2BANB 4IH5A 1M1KT 4P7VA 5DGBA 2J8AA 1UW4A 1QJHA 5M2PA 3KK3A 4Y2MA 4YR2A 3MUTP 5IQQA 5GAGI 2X1AA 2GCFA 1YIJS 3UR3C 4QIEA 2D3UA 1JLBA 3OV7A 4NWBA 1X8DA 2DR8A 2HAIA 1SBRA 3H2VE 1TVRA 2L9DA 3KWMA 2KXNB 2HRUA 4DSJA 1JJHA 2KFNA 2O5DA 2MQMA 2JJ4D 1OS5A 4IKAA 4ETZA 2MSSA 1HYSB 4I7FB 4LUBA 1C1CA 2GGPA 3G6YA 1TZ0A 3DRPB 2WCXA 4NZ0A 1XMQF 1WI8A 4LF4F 1GXLA 2ZKUA 4J9NA 4FVCA 1GT8A 5A0YA 1X9SA 1NO8A 4ED8A 2KN4A 2W4PA 4K4YA 2E1CA 2GV1A 1RT5B 4DLEA 4NMLA 2AJ1A 2W7AA 2YKQA 4RW4B 3C6UA 2J0SD 2YKMB 4I0WA 4I68A 2CQHA 2U2FA 3SDEA 4OZNA 2XMJA 2GHPA 3K58A 2UVRA 3BREA 4OZLA 2R2SA 3IAS9 4X62F 3FZBA 3G6VA 4PXDA 3PIPQ 1AFJA 3MMAB 2ZZNA 4CH1A 3NLCA 4KRWA 4K5RA 3BQ2A 4B3RF 2IAJA 2ZHOA 3MM7B 2D9OA 4O23A 4C8MA 1OSCA 4AXJA 5J2NB 2J9EA 3KK2A 5KT2A 4J9LA 3V5RA 3GR1A 3C6UB 2VG5B 4QIVA 4LMZA 5CH7B 5T7LA 4HYKA 4C11B 2MKHA 4OHZA 3U1NA 3ZZTA 1NJXA 1HR0F 5B09A 3CDEA 1URRA 1AXQA 4RBVA 2XLKA 1V3RA 2ZBIA 4FPRA 2HS0A 3OXLA 1AUDA 3P5TL 1RAJA 4MFBB 2Q6CA 4JI6F 2RDIA 2ASJA 4U7UK 3KKFA 1RA7A 2KFZA 4RWWA 2XI3A 2Z8QA 3I6PA 5B08A 2CQIA 2YKAA 3KNAA 4W90B 1BWEA 4A47A 1JLFB 2AJ0A 4YR3A 5E33A 1FRHA 3L7OA 5DDOC 4DQPA 1KTVA 2Y1RI 3R27A 1S10A 4JV5F 2PGCA 3KLEB 3M2UA 2HVHA 2DBBA 4KV8A 3J81Y 1FJGF 3QZ7A 2UVWA 4UQGA 2FIUA 1TP7A 1JLEA 5A6WA 3J7Z5 4WFAQ 2JOQA 1CG2A 1FVSA 3BF4A 4ECTA 4B9TA 3N5FA 3HZEA 1MU2A 3IGVA 1H7XA 4OV1A 5DG7A 3RRGA 3VTIA 3CC4S 2A2DA 4U6PA 1LW0A 3DYAA 3IXQA 3MHYA 3TA1A 2YH1A 3OTCA 1JJ2R 5SZTA 2KRBA 3MCSA 1Y3KA 4C98A 2YNIA 5B7WA 4NLDA 3CVKA 2IBOA 2AYEA 1APSA 4TYAA 2YNFB 5K14A 2XNQA 1YHQS 2OP5A 3A1YG 3O6QA 4IO1A 2RIJA 4DHVA 1Q16B 3SZ2A 1KHWA 2U1AA 4N56A 3CD0A 5D78A 3J7YU 2C3UA 1OPZA 2MPUA 4PWDB 3N5BA 3DI6A 3CCRS 1E6VB 2R4FA 3WC0A 1RT3B 3TAMA 4RNNA 1U24A 3RAQA 3E3XA 2DO4A 1FT8A 4B9UA 1FEHA 2J7UA 4UOCA 5BJRA 1JJ4A 3DRSB 4NPOA 3PFOA 4IH6A 4RNOA 5B0EA 1LKZA 3DLKB 3B78A 4OX8A 3DI6B 4OHXA 3KK1A 2UU9F 2GHVC 4UUXA 1N5YB 3IAM9 1S0OA 2M70A 4RBTA 4NCGA 2DGTA 3MURP 1VHFA 3OR2B 4BC9A 2BV3A 2ZDOA 4DPOA 4A8SA 1OO0B 5EHHA 5HL7Q 1TV6A 2NUUG 4GO5X 5IT9Y 5J2QA 1DZ5A 1WTBA 2KHDA 1W2IA 2YVSA 3RU0A 1VRUA 2CQGA 3CO9A 3MFIA 1WD6A 5J1PA 4CQ1A 3HF5A 1JNRB 5EDWA 1HHTP 2HG4A 2HNYA 2HHPA 1UKUA 2P5VA 2R2TA 2KO1A 3PX6A 2XZWA 1NH8A 5KFTA 5LT5A 3KG1A 1JLGA 4F4KA 1T03B 4B9SA 1X0PA 2DGXA 1SL1A 1CEZA 4Y2CA 1TKXA 2IM2A 5IM0B 2YTCA 3CJ4A 4FF4A 2YNGB 3LO3A 4DN9A 3BJYA 4DL2A 2FJWA 4CO2A 5GADI 3TUJC 1WG4A 4IOAQ 3CCLS 4AL5A 3BSCA 2K1RB 4Q44A 1FA0A 2HRYA 3NL0A 3CE8A 1VI7A 3DLHA 4A8XA 1BY9A 1LFPA 3AJ2A 1JLFA 4LT6A 3D0IE 4KFBA 3H5UA 4Y2AA 2LEPA 2PA8D 1S1WB 3E51A 3RR7A 3AB2B 1ZM4A 4CNYA 2CIMA 3FZ2A 1N56A 5KFZA 3I4HX 4O3NA 2XSFA 3GILA 5C24B 1S79A 2DH9A 5KFJA 2ZITA 2KKHA 4QW9A 4NA1A 2ZNYA 4HLBA 2E66A 1JKHB 2DB1A 3M6WA 4XDDA 5E3QA 1IBKF 2E9RX 3UFCX 1P9QC 3I82A 2RRAA 2DGSA 2HLTA 4NLUA 2Q6BA 3VAGA 4RUCA 4ZVGA 3UD3P 1G2EA 2EWHA 4UW2A 4OJHA 2E1MC 2IHR1 3NKYA 4PG6A 4TU9A 1NJYA 1N34F 2ZC3A 1S6OA 2ZJRQ 5E5NA 3MEKA 1WEXA 3QGGA 2AU0A 2IA6A 2HMIA 2IFXA 1VQSA 2PSZA 3M9MB 2ADBA 1IBMF 5C25B 4EZ6A 4M94A 2MGZB 3G96A 1PGZA 1FCAA 4AUKA 1OQ6A 5THWA 5IQ6A 2RNEA 2VC1A 2YWGA 3M1VB 5F8JA 1N6QA 3ZZ0A 4ECWA 3NGKA 1Q53A 3THVA 2PT0A 4X65F 5J2MB 3M05A 4NYPA 1EETB 1P27B 4X66F 4QR2A 2I5JB 1TK8A 2DR7A 2XBPA 3PR5B 4BS2A 5A0YB 5K9FA 4WZQA 1N5QA 5KFLA 1SUQB 1DBDA 1FXRA 4AE5A 3V2UC 4DR4F 2RQMA 2KT2A 3Q8SB 3KLHA 1FK9A 3W3SA 3SQGA 1FVQA 3F56A 5AE1A 3DLGB 2C28A 2NZ4A 2PO4A 3D54A 3LGNA 1N5TA 3I87A 4RW8B 3IRXA 2ATLA 3K2YA 2P9CA 2LDIA 3KLFB 1SV5B 4CO0A 5ITHA 3MEEA 3OTOF 4LIWA 1O8BA 3Q2TC 3DRXA 5D3GB 2FJVA 5A8RB 2CRLA 4LJMA 5H9EJ 5I3QA 1LW2A 1UP1A 2DCUB 3GYNA 4ECVA 3NAHA 3FCHA 4PPZA 4WZMA 4EU0A 3MAHA 3T1AA 3CCWA 4F2RA 1IKYB 3IWXA 2OKQA 3LPYA 1S76D 4OHYA 1UWBA 4P2SA 4WE1A 4ATNA 4HKQA 1DTQA 4KJIA 1H38A 1S6UA 4MMOA 1JLGB 2B9XA 4AXIA 5L38A 2B43A 2CQ1A 5FLXY 1U6ZA 5KT3A 2KH9A 5LMUF 4DL5A 4CO1A 1Q78A 1TR0A 5KOWA 4LIRA 5A8RA 1VFJA 3K8WA 5AJ3F 4I67A 4IFVA 3JTOA 4YQWA 2HHVA 3CWJA 4MYTA 4HT5A 1QAIA 3F44A 3FVYA 4ALZA 2D9PA 4DV7F 4C3MA 3ETOA 2GHWA 1KRPA 4JI1F 1DRZA 2IMOA 2L3MA 2X1BA 4ZPCA 5DQHA 2HWHA 2K8GA 1LXJA 1WTFA 3EUNA 4C0BA 3LUYA 4NXNF 3BGLA 2ZOGA 2DRBA 3GIJA 1P1TA 3ZZOA 2ZH5A 1Q86T 1W25A 3D1QA 2G13A 1CQMA 3H8YA 4ES2A 3HHLC 1ZTTA 4B08A 2VPZB 2AQ4A 2HNDB 1F9FA 3H4DA 3SV3A 2NS1B 3IGNA 4TNOA 2G1DA 2W9BB 3PEHA 1U1RA 2HYIB 3V6DA 3GIMA 2IAJB 4IUFA 2GMLA 2QA4G 2Y1IA 5F0WA 3D1HA 1SKWA 3M9OB 3CJ3A 3R1HA 2GO8A 2K7JA 1YRUA 1FNMA 1C0UB 2EFOA 3O44A 1VBZA 4DL6A 1L3TA 2R7SA 1VBXA 3D0GE 2VG7B 1LWCB 2NQPA 1NRKA 5KG0A 5GAEU 2L08A 2LCWA 2VFSA 2FJAB 1E6VA 2B9YA 1F60B 1A6LA 4KKOA 3GE9A 3E01A 3PX4A 2ZJPQ 1GXUA 3GMGA 3T9NA 4ZPDA 5J1EB 3GB0A 3MMBA 4AFFA 1R0AB 1NJIT 3HXMA 1L3VA 4WXOA 1RT4A 1RGVA 3IRWP 4JI3F 4F4WA 1NEEA 1S99A 4PUOB 2ZOFA 4I2QA 1ZZNA 1GH8A 1U1LA 4RX6A 4TLRA 1V6HA 3PXGa 3KMSA 1U8SA 3M8QB 4YDXA 3SCLE 2F8EX 5JJBA 3LP0B 3MPYA 3CF5Q 4X2BA 2NPFA 4C7QA 1X9MA 5A8KB 5D4PA 2KYXA 1VIOA 2CYYA 2B3TB 1Q7YT 3N6MA 2GFFA 2N7YA 4G6VB 4ECRA 4DS5A 4WKRA 1IXKA 4GMKA 2BRKA 4ZP8A 3MTJA 2XY5A 5L1JA 1GNKA 1MNEA 4DSLA 3MM8B 4WFNQ