1RWWB

Crystal structure of human caspase-1 in complex with 4-oxo-3-[(6-{[4-(quinoxalin-2-ylamino)-benzoylamino]-methyl}-pyridine-3-carbonyl)-amino]-butyric acid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
publication title Tethering identifies fragment that yields potent inhibitors of human caspase-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwwB00
3GJRB 5IC4B 4ZVTB 2CNKB 1RWXB 3RJMB 1PAUB 2HBQB 3NS7B 2CNOB 3D6MB 2QLJB 3IBFB 1RE1B 1RWMB 2DKOB 2H51B 3EDQB 1RWOB 4JB8B 2XZTB 1RHJB 1PYOB 3R6LB 3GJSB 1SC1B 4ZVUB 1F9EB 2C2KB 2H5JB 2HBZB 3D6FB 1RWNB 2CDRB 3KJQB 2Y1LB 2QLBB 2XYHB 3KJFB 1RHUB 2QL7B 2QL5B 1I51B 1RWVB 2CJYB 4ZVSB 2QLFB 4ZVPB 2H48B 2H65B 3GJTB 1RWWB 2HBYB 2P2CB 2CNLB 3R7SB 2XYPB 1QDUB 1RHRB 2C1EB 1NMEB 4DCOB 2HBRB 2FQQB 3P45B 1RHMB 2CJXB 3IBCB 5K20B 3EDRB 3R7NB 3R5JB 4ZVRB 1GFWB 2H5IB 2CNNB 2C2MB 3KJNB 3D6HB 4LSZB 1RHQB 2QL9B 2C2ZB 4ZVOB 4ZVQB 2H54B 3QNWB 3R6GB 2XZDB 1I3OB 1SC3B 2H4YB 1RWKB 2C2OB 1SC4B 3SIPB 2Y0BB 1ICEB 1BMQB 3R7BB 5IC6B 2XYGB 4DCJB 2H4WB 1RHKB 1QTNB 4DCPB 1RWPB 3P4UB 3GJQB 1IBCB
chains in the Genus database with same CATH superfamily
2FC9A 3SCJE 5I3UA 3NMRA 1GX6A 1HYSA 4M5DA 3DLLQ 3IS9A 1HBMA 2CNOB 2IC3A 2DGTA 3ENAA 1WDTA 2AX1A 2WONB 1QE1A 4PYAA 2HNYB 1X8DA 2ZZMA 4WP9A 3W3SA 4WZMA 4YHHF 3MM9B 4Y0FA 4DQSA 4CH0S 5EHHA 3F56A 2LQ9A 5KFLA 5A8RA 2XMUA 1UA1A 2Z2LA 2KZMA 1HBNB 1GAOA 4DSJA 2DY1A 1HQEB 2CNLB 2WZ1A 2KHCA 4LMZA 4URGA 5K14B 1EQMA 1SCJB 2NXEA 3VAIA 4ECTA 5BR8F 2AP6A 3QBCA 1Q1KA 2VFSA 3HVTA 4DXLA 2Y3YA 3MPVA 2XULA 4EEYA 4ECZA 4B3OA 4AL7A 2V94A 2P9GA 3FUYA 1V3SA 5FDLB 4FPIA 3F73A 2VKRA 3OSPA 2MSSA 3ADAC 2XLJA 3EMTA 5D0GA 2ZUGA 3J81Y 4C0BA 4YS2A 2V50A 2QLJB 3OW2R 1TKTB 3TI0A 4N7TA 1AT1B 4RW4B 2XO7A 4KBIA 3UI3A 3V4IB 2WB1D 1B64A 4H4OB 3GIKA 4H4KC 2MKSA 1ZA2B 3L7OA 5KG3A 2E66A 3BGUA 2CZVC 4IQMA 3T1YF 3VVTA 4DR2F 2MKJA 2QMUB 4DX8H 4B9MA 2XTJP 4J5OA 3OTOF 4RNHA 3Q24A 4DL4A 1KS2A 4OV6A 2ASJA 3P45B 2GJ2A 4M95A 1F5AA 3IM9A 1J5OB 1X9SA 4TYBA 2ZJPQ 4R5PA 3MAQA 1DQ8A 2F4VF 3FSXA 4O23A 2HMIA 2ALZA 1VDHA 1RISA 2MYFA 3GR0A 2G1HA 3GONA 3VQSA 2FJDB 2BJEA 5KFUA 2MZRA 5I3UB 5IC6B 4G1IA 1ITPA 1HYSB 3CW2C 1RHKB 3IS9B 1HBMB 4Q8EA 3GWCA 1Q5VA 2IC3B 3MR7A 4C3LA 3MGJA 1CJUB 1QE1B 4ZVEA 4F2SA 2MQMA 1FD8A 4TLQA 4LF7J 3FSIA 2NPIA 4CO2A 3MWBA 5A8RB 5E3AA 4WFNQ 4F4ZA 1X4BA 1RWNB 1N5QA 4ED8A 3JSMA 1WJ9A 5KFIA 3D6TB 1PILA 1CG2A 1RAOA 3K5MA 5T41A 4P74A 4IDKA 3IFEA 1CULA 3LPYA 2DH7A 3MR2A 1AFJA 2BE9B 3HVTB 3QT5A 2NREA 3MDFA 3IR7B 4QR0A 3V81B 2W2PP 4Y2MA 2AEFA 4FNHA 4WTOB 4RBVA 2KRBA 1SJ3P 5ETRA 4RUHA 4W98A 3NY0A 1KLNA 2IBOA 3L3CA 3PW2A 4NLRA 1Q78A 1X4FA 1XTZA 2FVRA 4MAKA 3J7YU 2R42A 4UT4A 1GMUA 3NCQA 1NK7A 3FSYA 3RAXA 3FRZA 4OX9J 2G9OA 2N7CA 3UD5A 3RGIA 4R25A 1R8PA 4M5NA 3RR8A 3OUYA 2KT2A 1U0SA 4MKYA 8RUCA 1MU2A 3MPDA 4F50A 3BS9A 3K5PA 1OSCA 1SUQA 1PIEA 3J81j 4F3QA 2WVFA 3OFHA 1EP4A 2IMOA 5CHCB 5J2NA 3KG0A 3D5MA 1UW9A 1NMEB 2MKYA 4F67A 4R5PB 3CJRA 4LF7F 1ZZNA 2DY9A 1C1BA 3EWGA 3BB5A 4XDDA 2I5JB 2GVZA 3FEXB 2HIYA 4A8QA 1IKXB 2FJWA 3S7RA 3U7JA 1WNEA 1Y9OA 4WXOA 2MQPA 2PC6A 2ZH4A 3SIPB 2MTLA 3RU0A 3M1VA 2M52A 4QW9A 1RT6A 2RU9A 2IHR1 2NSBA 3OV7A 4ZVTB 5DGBA 3PEHA 4U7UD 5KFYA 5HBMA 1WF0A 5FIIA 4QR1A 5AXLA 3CCQS 3MR5A 1R8AA 3G96A 1P8GA 1F0XA 1FRXA 3HKZD 2BXJA 3J7Z5 2DO4A 2UUBF 1F5CA 2LQJA 1IJEB 4JYAJ 2KDOA 4DX5A 1WG1A 1Q8LA 1CULB 4JBCA 4CO0A 3PIPQ 1V5VA 2ZBPA 4CYUA 3BJYA 1K0TA 7AT1B 1X31C 2B6AA 3RBXA 2P5VA 4OYMA 1H74A 4KGVB 2VQFF 4TQSA 3LGHA 3DNCA 2XMJA 4C11A 2JOQA 3ZO7A 5GAHI 4OX9F 4NLDA 4OMFG 1UJ4A 2HHPA 2VHGA 2CADA 1I5OB 5F3ZA 2Y0SD 2FZKB 2C42A 4DUYF 4CZCA 3CF5Q 2AT1B 3OR1A 2KH9A 2K3KA 2R4FA 4DCJB 2YX4A 2R8KA 5D0HA 3ZZRA 3OD2A 4FF2A 3PX4A 2QA4G 2UV8G 1RKJA 4PG4A 2IJNA 3FKBA 1Y0HA 3K8VA 3LH2S 2AEMA 2FC8A 2G0JA 3K5NA 3OUYB 4JI8J 4MKAA 3HK2A 6FD1A 2DGUA 3IR5B 4KIAA 3WIVA 5LMNF 3S6EA 4K2XA 1U45A 1EP4B 1YSJA 4GKJJ 1ZM3A 3GIJA 2R7WA 4JI2J 4DSEA 4DL2A 2VUGA 1VGYA 4WKRA 3PACA 2XWXA 3HHLD 1C1BB 3NWGA 3H4BA 3NLCA 5LJ5Y 3PW5A 2F65A 3FBFA 4RNFA 2HBRB 2GVZB 1WORA 3HT3A 1CC8A 1UVJA 2E5GA 2GA7A 4ANEA 3C8YA 3QT8A 1NKEA 2I6WA 1QJHA 1YLXA 4NA3A 3BR8A 2IM0A 1RT6B 4JYAF 1UAWA 2F63A 2M8DB 4Q2LA 5JXSA 1ZPVA 2D9OA 1PAEX 1IBCB 1OJ4A 2L3MA 1N36J 1VIOA 1PAUB 1B99A 4X84A 3PJXA 5HATA 3O6QA 2OPPA 3B4DA 2VONA 1WC0A 2KHDA 2GIQA 2UUCJ 1LXJA 3OL6A 3SCLE 3SCKE 3R27A 4MIBA 4CLPA 4P7VA 3JTPA 4GC7A 5BXIA 4DS4A 2VG6A 2NZ4A 4RUCA 3THPA 1Y10A 1AZSA 4CYUB 2GV1A 2HHSA 1LW0A 5HANA 1L3UA 4C11B 3MD1A 2IDEA 3M2VB 4BCAA 3BSAA 2CJXB 1JWWA 1ZM2A 4HT7A 3D66A 2G2ZA 4CCHA 3CMAS 4JI8F 3UWTA 2OPRA 1T03B 4DOZA 2M9KA 4NA1A 2V8GA 1WELA 2KG1A 3MTKA 4Y6IA 1NZ8A 4GKJF 3HCXA 3R2CJ 1G3OA 4M5HA 1RTDB 4I2PB 5DLFA 4DL5A 3NS7B 2V9KA 3BN7A 4RZRA 1OS5A 1WC5A 4FBUA 3L7UA 1ZTWA 4ZPTR 1WACA 1KD1T 2V2VA 1S59A 5A0YA 3RUBL 1S4FA 2NR0A 1T9UA 1CJVA 3FDSA 2GJIA 4XK8C 2EFVA 2QYGA 4ZPAA 2VFUA 4U8YA 1L5UA 1LEOA 4NOHA 3MCMA 1JLCB 3D0IE 1JXEA 1HLWA 5B0FA 5IV3A 3I5BA 4UOFA 2W2QP 1N36F 4DV7J 4ERDA 2XY6A 2V4QA 4RPFA 2RQMA 2JSXA 5DZ7A 4FNIA 4NYOA 2EW9A 5DG7A 5C5JA 3TWZA 3WX8A 4L72B 1FFGB 2Y0BB 1NXIA 1TL3B 1RT4A 3TYTA 4DCPB 3CDAA 4IYQA 4ZPVR 1T9YA 5C24A 3LWLA 5E0OA 2EG2A 5BYSA 2ASYA 1HD1A 2YKOA 4NZ7A 4QIEA 2RQCA 4WFZA 1B70B 1UVMA 3F44A 1M5VC 3GJSB 2DXDA 1JKHA 3UD3P 2VG6B 5IT9Y 1YWXA 3LP2A 5ETMA 2AQ4A 1VC6A 2Z8QA 1LW0B 1Y7PA 3M6VA 4ILRA 2AU0A 4GO5X 2HG4A 1UEUA 3ZTQA 2OD4A 2YWKA 1Z1ZA 4USVA 1VQYA 2XY7A 4KY3A 1FFSB 3J7AN 2DCLA 4J9NA 4ED1A 3FCVA 3JSYA 2M0GB 4NLUA 3MEEA 4OZNA 4A4JA 2PD1A 3D1QA 2Z58B 2GS8A 3MD3A 4DX7A 4OZLA 8ATCB 2GJFA 3HVWA 2MDAA 2J9DA 1WKLA 4D3HA 5CD4A 3T1HJ 2RNEA 4UW2A 3W8GA 1AFIA 2DB1A 2Z0GA 2J8SA 2KM8B 3CCVS 2UV8A 1F9HA 4CI0B 1CJVB 4I64A 4LBHA 3G87A 4NRUA 1HBOA 2BZ2A 3WX4A 2RB7A 4B9LA 4PUOA 4DR5J 1TFYA 3TZYA 4S0MA 3JSRA 2BV3A 4DEZA 4J9SA 4OLPA 1RWVB 4B3TF 1ZETA 2NXCA 3CIMA 2UXCJ 5KFKA 1TAQA 5F8LA 1MSWD 4RW6B 2ILZA 4ED4A 2ACMA 1IWAA 1FDDA 2X1FA 5GADI 1UFLA 1PYTA 1OQ6A 1YJWS 2PE8A 3SDEA 3R1HA 2AHOB 1QD1A 1RT4B 2E5IA 3G6YA 5C24B 4LREA 3ZTSA 5GAGI 3G8QA 3MCNA 4V19J 4QQBA 2PFFB 3IO1A 4YY3J 5D78A 2DGWA 1KWMA 2EBEA 2JEJA 1GMWD 3LQVA 1VOMA 3PKMA 1W2IA 5KFPA 3LP2B 4HLBA 1P6TA 2D41A 4C8ZA 4C8YA 3LA0A 1NNDA 3SFGA 1R6YA 2FIUA 1CJKA 1IBKJ 3LAMA 2FPHX 1HNXF 1HMVA 3RBDA 3PRDA 5C25A 4BWMA 3Q22A 2BKOA 4K4XA 1U1QA 2C3YA 3BSOA 1IR0A 1OYDA 4WYLA 1NSQA 1S0NA 2U2FA 2WBMA 3DXSX 4DF8A 1JLBA 2ZJQQ 3T1HF 4O4RA 5IT0A 4RW9B 3BKUA 2JZ5A 1ZA1B 2XNRA 1CPZA 2VPYB 2J0XA 2XHWA 3MEEB 4ZLPA 2AYEA 3BBCA 1NKCA 4LR9A 3QGHA 1FXLA 5DZ6A 4TU7A 1DRZA 4ZP9A 4E2FB 2CPFA 4JI3F 1SC3B 3I32A 4B02A 3PFEA 4F0MA 5KOXA 4I7FA 1S9EB 5KFJA 5IXUA 4ZDNA 5B0BA 4ED6A 2DBBA 3IRXA 1ZZFA 1S6PB 1GQEA 4YP3A 3PYDA 2VPXB 3W7BA 1HBOB 2PFDA 4X4OA 4IFYA 3TA0A 4PUOB 4CH7A 3VAKA 4ETZA 4HACA 2BACA 2HGNA 2DTJA 4AFFA 1HW8A 5HMWA 2HPUA 3ET6A 1URNA 5D77A 4YB7A 4FP9A 1KKHA 2CJBA 3OFFA 2IM3A 2EKYA 5J1EA 3Q8UA 4NZ6A 1FWKA 1WHXA 5F9NA 1KR4A 4X2BA 1QY7A 1Y5LB 2OSQA 3HDSA 3DRSA 3SDEB 3UNGC 1MROA 2AYMA 2DNZA 1W26A 1IBKF 1I3OB 2C3UA 5GAEU 1VQ5S 4DPTA 1W25A 1BLUA 4J9LA 2QIFA 3GCWP 3OXGA 2HSEB 4LF8J 2BEFA 4D3GA 4QW8A 1S1UB 5KFTA 4E8UA 1FERA 3A13A 3LO3A 1KP6A 4DUTA 4PQUA 1CJKB 4IQXA 2CWKA 1MN7A 4HI1A 4ED7A 4QIFA 1X4DA 1CS4A 3KDNA 4HDGA 4KFBA 4GC6A 1HWUA 1FJEB 1NK6A 4DLGA 2CQ0A 1LW2A 5ETTA 3IMQJ 4WCEQ 1JLBB 1XK8A 1C1CA 1LXNA 1XQIA 2X7IA 3HHEA 3W5ZA 4RW7A 3I5CA 1KOHA 4K0KF 5LOQA 4ZN3A 4PR6A 3G4SS 1CSJA 4DZDA 5KFNA 4RBTA 4XPEA 3MM5A 2ZUAA 4DV5J 2HHUA 2CUYA 5CA5A 5THWA 1XNQJ 2AIRB 3GV5B 3IRXB 3ZNJ1 1OPIA 1RT5A 3J7YI 4PZVA 5I4MA 1P9QC 5CYMA 1NUEA 3CXCR 1R0CB 3S1TA 2QYCA 4DR6F 4IFYB 3KG4A 3HD1A 2W1BA 3AD8C 1WDDA 3K0JA 2F40A 1SL0A 4ZP6A 4OIXA 1LFPA 2CPIA 4FYVB 4HACB 4IOAQ 3BGFA 4U67Q 2DT9A 3CEDA 3DI6A 2Y1LB 4RBUA 4UF4A 3ET6B 1S6UA 3KG1A 3KK3A 3KJFB 3AT1B 2HIQA 2XI2A 4RU2A 3N5BA 4NLOA 4DV0J 2M88A 3SV4A 3D1OA 2P9CA 3GCXP 3CCUS 4LF8F 2VG7A 3SQGA 4NCAA 4HI2A 1U1KA 3DRSB 2VV5A 3DHWC 3MAHA 4ED3A 3D54A 1Q7LB 3TJ8A 2I38A 3DOMA 1SB6A 3PX6A 4Q0BA 3R1LA 4U6PA 1EZZB 4ED5A 2YKPA 2L9WA 3K58A 5GMDA 3ENWA 3GG1A 3KMSA 5H1SV 2AJFE 4IRCA 3O2IA 2D1CA 4K59A 4PQUB 1T0TV 2CIMA 1SVDA 4RNNA 2HNZB 4NX9A 2K7KA 2DGXA 4ILLA 2IA0A 5KG2A 2XBPA 3RW6A 5LM7E 1OQ3A 4MK7A 4KFBB 4BS2A 1VRQC 5EUHA 2MZJA 4ZCMA 1HQ2A 3KHLA 2POKA 4PG8A 2PI4A 3EX7B 3VCDA 1YKWA 2XY5A 2AYBA 3NP5A 4QIGA 4NEZA 1VQ6S 5CCLA 4LFBJ 3VAJA 2F9JA 3DRPA 1RT2A 2M2BA 4EUVA 2KI2A 3UN5A 2GZOA 1N56A 3QGPA 5LSOA 4WPAA 3DLKA 2FGOA 1B0PA 1P1LA 4O44A 1RT5B 3D1HA 3M6WA 2DGVA 1U8SA 5CYMB 1H3DA 1FCAA 2CG8A 2HQIA 3HT0A 3EVWA 4P2FA 2XNQA 2EK6A 2MMYA 2RS2A 1N48A 5G0RA 4DV0F 4JI7J 1BQMB 5HJXA 7FDRA 2BBEA 3BM7A 1N52B 3LP1B 4TU8A 1K44A 1T02A 4X4TA 2ZOMA 1GK8A 5CYJA 1X4AA 3KK3B 3D6FB 1WI6A 2MY8A 3EVOA 2ZBRA 3CSKA 4P72A 2B5JA 1FJGJ 4B9VA 2MJNA 4CO3A 3BDEA 2C2NA 2IRXA 3THTA 3NMAA 2P9EA 3BV8A 4KGZB 2XZWA 2FZCB 3SQGB 2M4MA 3NKYA 2IVFB 4UQGA 1T7PA 2PA3A 1S77D 4OZ2A 1HD0A 3X3UA 4TLRA 3PY8A 2HFOA 5E2QA 2KXHA 3EDRB 3DOMB 2R7TA 1DHMA 2MZSA 1KSPA 2ABYA 1F3FA 4PQAA 2GQ2A 2GW8A 3X1LB 5AE1A 3TJAA 3TNVA 1H2UX 4BBYA 3SZ2A 2OSRA 1NSAA 1FRJA 2CQHA 2ZC3A 1NAQA 3RRKA 3JQKA 4USHA 3K89A 1JB0C 3LALA 2HAFA 4DL0C 4KHPJ 3GJRB 1GXTA 2B4UA 3GLJA 2CQ3A 4ZVGA 4KV8B 3THVA 4LFBF 2NLWA 3H25A 2W9CA 3CD5A 4NL5A 4PCQA 3QIDA 1TMJA 1T8EA 3VGVA 1IN0A 1OIAA 2P6TA 1Z2LA 3IWNC 1YIJS 1RAHB 1RUSA 2FUG9 4J9UE 1FRLA 3V6KA 3CDBA 1XMOJ 4DPXA 3R5DA 5E33A 5E3QA 4PWUA 2OI2A 5J2PA 2JNJA 4LF5J 3KLHA 3DRPB 1DARA 2HBYB 3LP0B 1FX4A 4NEYA 2XS5A 4I56A 2WBRA 3ETOA 2M5YA 2JLGA 2XGPA 1RTHB 3DLKB 2OH2A 4O44B 3HVAA 3SMZA 2E7WA 5CH7B 3QWUA 1RDRA 2YWHA 4L73A 3BPSP 5DDOC 3MEDA 2IVMA 2KRRA 1ZM9A 1WC4A 3EPGA 4Y00A 1HWKA 4X4QA 1TL1A 4KB7A 5G0RB 2KM8C 2CQIA 3ZZPA 4WK3A 4O3SA 4USMA 1T94A 5E3RA 3TVYA 4MIWA 1WG4A 2K8GA 1RT3A 4C97A 3Q8PB 3W9HA 2V63A 4OYOA 2ZVIA 2VIHA 4Q45A 2HLTA 4DQIA 3QSYB 3T5HA 4PXEA 3Q8YA 4CLFA 1NJZA 2FHJA 3RZAA 1LOUA 1T9WA 3I0RA 3H5XA 5IOLA 3EM1A 1VBZA 3Q23A 4C48A 4KHPF 3VALA 1S12A 2CPHA 2E9ZA 4X4SA 4J9OA 4ES2A 2B51A 3G8SA 2EI5A 5KFVA 3J80Y 2HVHA 2R7VA 1RCXB 1NCLA 4ENOA 2UXBJ 1JJ2R 3MECA 2V4RA 1YZ6A 4FDFA 3AY0A 1OPZA 5RUBA 1UJ5A 3CT9A 4F3MA 1C0UA 1RCOB 3C16A 2H4WB 1HL6A 1VI7A 3MMBA 5ETLA 1V3RA 2NQPA 5ETVA 3OL9A 4OX8A 3ETMA 2RF2B 2BJDA 3Q8VA 2AZ3A 4BLGA 1GEHA 2FY8A 4DSFA 1XC9A 1RKIA 4ZN1A 3FCWA 2KN4A 4N76A 1UVIA 5EN1A 3BGOP 2WVCA 5J2PB 4YFUA 4K5SA 3DU5A 2QL7B 5DQGA 1I51B 2HS3A 2AJQA 3H2LA 1HWIA 2JL9A 3A8KA 4CT8A 1REGX 2AZ1A 1R43A 2KT3A 2DIVA 2C2EA 2H65B 1RWWB 1FEHA 3PHEA 4YR3A 2F5GA 1QVGR 3M9OB 4EFAC 4C8OA 4UOCA 4GKKF 1U25A 4DL7A 2CXEA 5J2MA 1IVZA 1HHQA 2HRTA 1RQ0A 1TL1B 1RT1A 1FRKA 3D9BA 1S7HA 3PJ9A 4HR2A 3PJWA 1TL4A 3OBIA 1RT3B 1G6BA 3ENQA 2V68A 4PEOA 3ZTRA 4LF9J 2E1CA 3MCOA 1JLFA 2QLWA 1H72C 1REVB 1PC4A 1S1WA 3IBFB 1ZS6A 2QMWA 1PGZA 1L3KA 4NE9C 1JLAA 5KFCA 3TOQA 2HEKA 1D0EA 1KQKA 2NS1B 1U47A 4LR7A 3I0RB 4ZK7M 1WD6A 2UXBF 3PG9A 3CC2S 2A2DA 1U6ZA 5H9FJ 4DPUA 2PO4A 4WP3A 2V6AA 5AJ3J 4TNOA 3CIZA 5KG0A 4JV5F 2L9NA 3JTOA 2W9BA 4CP5A 2B4VA 2MKHA 3MECB 4MMOA 2GIRA 1Y00A 3I56S 2HQCA 3MUVP 5BJRA 5A8WA 3C16B 3MMBB 4XPCA 3NGRA 3PHTA 1P9YA 4EYHB 4UUXA 4UUWA 4DN9A 1JJCB 2GVDA 2VU5A 2J0QD 4YN3B 2HZCA 1HI0P 3HSJA 4FYXB 3C6TA 4M5LA 2HQGA 1S48A 2YNGA 5LXYA 3T9NA 1IKVB 2KKHA 1HWJA 3C15A 1RTIA 1CBKA 2HFUA 3PYEA 3RRHA 2V8DA 1ZAWA 3T1AA 2HHHF 5HSPA 2VC1A 3HHNB 2C1EB 2DHXA 3G9CA 5J2MB 1IM6A 3BN4A 1PSDA 3NNHA 3G6VA 4F36A 2HGLA 3TAQA 2HFSA 1IQTA 2ZWPA 4DU8A 4QPXA 4Q44A 4BC9A 1Z4UA 5I42A 4K7QA 2CJQA 3CUNA 4LBIA 3C14A 1TELA 2RDIA 4IG0B 2E5HA 3HJVA 1Y4ZB 3JYTA 4LVNP 3RR7A 3OTEA 1EAYC 3I6PA 1GH8A 4OHXA 2DHAA 2EC2A 4Z2XA 5IQ6A 2GGPA 4FF3A 3K8WA 2VB6A 3CWJA 4IO9Q 3LF0A 1YRXA 4LQ9A 3C66A 2LLZA 1UTAA 1JXLA 1H2TZ 3ZTPA 3Q2SC 4ZVPB 3HZEA 3I5AA 5F9LA 1FJCA 2ZH1A 2EFOA 2XYPB 4DSKA 3M7VA 4A8KA 1MLAA 1S4EA 2RSQA 4GMKA 5DDPC 2W2OP 1FVQA 1D09B 2ATCB 1SPBP 1Y3KA 2LQ8A 5GAEI 1H98A 1APSA 1IXKA 4K4VA 1R27B 3QZ7A 1TUWA 1XBWA 2WB4A 1TL7A 2KT5A 2GC8A 3D4JA 2IDLA 2CJ9A 2PMZD 4I67A 3N01A 1IKYA 2B9XA 4FVCA 1VJQA 3D0GE 4LUBA 3RJMB 2GVDB 2FY1A 1RWMB 3C6TB 1XNRJ 3DLEB 3QYYA 3R3TA 2EFGA 3GFYA 4KH1B 4DFPA 3C15B 1SJ4P 1UCNA 2VD3A 3L95X 4K4ZA 2YKMA 4CO4A 2XMVA 3GJTB 4HTIA 4KSEB 2J6TA 3FQLA 3KLIA 2DD8S 1UP1A 2R2UA 4M8LA 2EFNA 3TVZA 4QU7A 3CVKA 3TX8A 2IYIA 5F8HA 2RAQA 3G2XA 5I42B 3E3XA 4K2JA 3VGSA 5DM6Q 3R6GB 3UVJA 3BGRA 4PYDA 4C4WA 5LL6d 4ZKAA 4I6WA 1MNEA 4KPYA 2J9CA 3I4HX 5A8KA 3LUYA 5H9EJ 3JYTB 4J37A 3OJUA 2BUNA 2FJAB 2M7SA 5T7LA 1UWBB 2CPJA 1RWUA 2GGPB 2QSWA 4ZA1A 3CCRS 2CQ4A 3B8HA 1C0TB 4PWWA 3IA0A 1YRUA 1HI1A 2XMWA 1I94J 2KVQE 2CDRB 4NXMF 2QLBB 5AT1B 3W64A 1VK8A 4OX7A 4ZHRA 5KG7A 1WHYA 2B7BB 1BC6A 4M5IA 4CLUA 5F8JA 1KBRA 1U24A 2XG8A 3SQOP 3I0SA 1RAGB 3IBCB 1PJ6A 1VHFA 3OPKA 2F4FA 3SSSA 2OLWA 3UR0A 1TL7B 1K1SA 3M6UA 5M2PA 4UTGA 4HL9A 3C46A 1UMJA 1GTHA 1TK5A 1HI8A 2OEJA 1NSKL 1IKYB 4ZMMA 1BMQB 5L9NA 4JV1A 1WF1A 2XS7A 3FFIA 5HN0A 4DFJA 1B7YB 5IM0A 2UVRA 2HHVA 2OHDA 3HVRA 1LWXA 2CNKB 2DJWA 3IR6B 4P2SA 1YQHA 4J9PA 2D3OR 3LW5C 2GHPA 2RE1A 2BE2A 1GX5A 1NH7A 4KQZA 1Z2ZA 5L9XA 2RUSA 1MWYA 1HHTP 4OL8A 4ECYA 4J7CA 2V2ZA 4MYTA 5C7PA 4ECXA 3KFWX 3TRGA 1NDKA 1DLOA 2R3VA 3DLBA 2Z4PA 3KLIB 5HAOA 4DMZA 3I9V9 3AH6A 3KUEA 1SKWA 1HPZB 3HP6A 2I8EA 1XR6A 2JJ4D 3V6HA 1YBAA 3HI9A 3MM6B 2OP5A 3UVJB 2DK2A 2WOMB 3QNWB 4OQJA 4PPDA 4JI1J 5A8KB 1XJWB 2XCPA 2XEXA 1VJWA 2C2OB 2CWXA 2D3UA 4LFAJ 4Q43A 4JI6F 2MY7A 2WONA 3MTJA 3D67A 1KLMB 1K73T 1KVKA 4I6YA 5T7LB 4Y65A 3A3NB 4IKAA 5KFRA 4RWWA 4ECWA 3MM9A 3IAM9 3BZQA 2DKOB 3BQ1A 5SZTA 1PKUA 3KJVB 5J1PA 4NI2A 3MEGA 3KTQA 2HBZB 3C2PA 1OWXA 1HBNA 4PG6A 2XMMA 2JX2A 3DKDA 1U02A 1HQEA 2CRLA 3NAHA 4O0IA 4J9KA 3FCHA 3EGZA 2O67A 2NXNA 1PJ7A 3OLBA 1YJ7A 3AODA 2J6SA 4LT6A 4HHHA 4MT1A 4J9MA 3FGVA 2K06A 4NYPA 1WOPA 2UUTA 2J0SD 2E1RA 4ELVA 1F2HA 3GV8B 1O8BA 2YPYA 1Q8BA 4DPYA 4M94A 1N54B 4FBTA 1BE4A 1WF2A 5IM0B 2LEPA 4M5JA 4NLXA 2F3JA 2LEAA 3GIRA 1Q82T 4G6VB 4QYRA 4RW8B 4O0NA 1R31A 4K4WA 5CCMA 3L7PA 1U1LA 1ZYQA 2IIHA 2YKNA 2BE2B 2MLYA 4H4OA 4ZITA 2ZBIA 3AA9A 2LECA 2L08A 3ENVA 2CDQA 5FD1A 1DLOB 3UD4P 4FF1A 1H2VZ 3KLVA 2AV5A 1M1HA 1YITS 4TYAA 1KFSA 3RAMA 4M5MA 4LF4J 4ZVFA 3M9MB 4A8YA 4HVZA 4LFAF 3HKWA 4P71A 1QDUB 1V9OA 3R5CA 2R8JA 2Q6CA 2COLA 1WSRA 2YTCA 1G2EA 4WBFA 1FKOA 3AB2B 2OTLS 3EZ5A 3PW7A 4IO1A 1VYAA 4OHVA 3DU6A 1X4HA 2MGZB 1CJUA 4ECVA 1U0HB 3PRBA 2ZEJA 3VF0B 3SI8A 3QSIA 5AXKA 1CC7A 4NI2B 3MEGB 3PR5B 4A8WA 2CAJA 3IWLA 3R6LB 2W2MP 1X0FA 1R0AA 4L74A 1KNZA 1SH0A 4JI4J 2XGQA 4OZJA 3DOLB 4MKBA 1WWHA 3CJ2A 2KB2A 2JH3A 2BJ8A 4X4NA 3CD6S 3DDNA 3FEZA 1RACB 4RWXA 1R6VA 2RILA 1LKZA 3TR5A 4JI5J 4W92B 3V81A 2OGUA 3SFUA 1WUUA 2MQ8A 2BDPA 3AJ1A 2QT7A 1HNZJ 2I9SA 1RHMB 3R5JB 2QRRA 4B3RJ 1YVFA 1S99A 1BUXA 3HPOA 1KN6A 1RHQB 4DR1J 5EGYA 5HK4A 3BSNA 2QTWA 1TFWA 2DNGA 4LF1A 4OYXA 2RS8A 2CVEA 4FS1A 3JAMU 2YKNB 4LF4F 4OZ5A 1MWQA 3GG0A 2WRMA 1IR2A 3GYXB 1NK5A 2VQEF 3M30B 4ZJOA 4NASA 1PYOB 4UY85 1NJYA 2QN6B 2ZH5A 3GSDA 3ISZA 3HFKA 5D4PA 4RJVA 2RHQB 4LRFA 2CVIA 3I4PA 4ECQA 3Q0AA 1U09A 2HS4A 4NXNJ 2I5JA 2AGOA 1FKOB 1ULRA 1IKXA 3MURP 2RH3A 1LWFA 2MEWA 3PYGA 5KFSA 1IJFB 1QSSA 3KJNB 3UN3A 2ZVSA 3M2RA 1VQKS 3NEKA 5KOWA 1U1NA 4JI4F 1YRTA 2NYHA 4OJ1A 4H4KA 3D7SB 4N47A 1HR0J 3JB9k 2XSFA 4RL1A 2FB0A 3MPUB 4FF4A 2LCWA 2YNHB 4IRKA 4EYIB 2CQDA 3U1NA 2CG4A 3POTB 1R0AB 1XMQJ 1JLQA 2WVEA 5E3CA 2CPXA 2GIFA 4B3RF 2EVZA 4F4KA 1TZ0A 5CXTA 1UZHA 4X65J 4RO0A 3CO9A 1UEKA 2JEGA 3J7ZT 3VZHA 2HS0A 5KG6A 1GMVA 2DO0A 3UNYA 2ROGA 4DG1A 3B54A 3DYAA 3T6JA 1RAAB 3DLJA 1KHVA 2FVCA 2HW3A 1HNVA 2E1MC 3MOJB 2ZKUA 4NA2A 5D4LA 3B4MA 1SIWB 4F04B 4ZLJA 1YJNS 2ATLA 2DIUA 1YK9A 2RU3A 2OMOA 3Q8RB 3OVAA 1Q81T 3DDIA 2ZJRQ 4KAIA 4MJKA 3HD2A 4ZCLA 4IUFA 1NJXA 4OHYA 4WZQA 3G82B 5KFQA 4KRWA 3V6JA 3HJFA 4FXVA 1FRHA 2E5LJ 3MMJA 4QIWD 3RB6A 2RJZA 3VGTA 2J9EA 4C98A 3N79A 2CYYA 3BKTA 9RUBA 4I6AA 3TUJC 4CIOA 2E9TA 3JQJA 1IBLJ 2HK3A 5A6PA 3QPIA 4USTA 1G4CA 5HMYA 2YQ3A 2ZOGA 2AKWB 1HR0F 5H9FK 2YY3A 5DRKA 4KHRA 1BY9A 1IWGA 4OI3A 1LWFB 1RHRB 4EO8A 2ZDOA 3M8WA 4EO6A 3ILLA 3MUMP 3M2RB 4FKXA 4Q5VA 3OLAA 4PG5A 3H98A 4AL6A 1GTEA 1F2GA 2AD9A 1S1TA 3U1LA 1A7GE 4F4WA 2LYVA 4F2RA 2QFJA 3BR9A 1WKJA 3IG1A 1P27B 2DH8A 3QIPA 5JVHQ 3N6NA 5KFZA 3R8YA 3M05A 4ZPWR 1SJFA 4F4XA 1JLQB 4IH7A 3KLGB 4HDHA 5B09A 1NDCA 3CJ0A 3BQ2A 2LA6A 4H4MA 4MIAA 1PO6A 2QZ8A 4KO0B 2OMLA 4C3KA 1DAXA 1URRA 1C2PA 3WC2A 5JUMA 1QAYA 4DG1B 3DYAB 1PG5B 5ITHA 1Y5NB 4IH6A 5FLXY 5D0EA 3M2VA 1HNVB 4KGKA 1RTJA 2BKNA 3CJ3A 2E5LF 1B0TA 4PKDB 1T03A 3HHLA 3ZZYA 4IH5A 3QQCD 4PRFA 3I31A 2BANB 2XSJB 4DUZJ 4Z7CA 2CNNB 5HQLA 2RDJA 4KGMA 3E8OA 4OX6A 8AT1B 5D4NA 4OYZA 2PI5A 3GIIA 1CEZA 1RTDA 3NS6A 4I2PA 3B82A 4V1Ak 2C2RA 4EI2A 4EZ9A 3ISNC 2K3IA 3UQSA 4CQ1A 5LT5A 2Y1JA 4LRCA 4ELUA 4QJVA 1BQNA 2KG0A 1TL5A 1B0VA 5GAHU 5CQGA 2Z2YB 3GYNA 2UVVA 2BQUA 1FDNA 1FXRA 3QJJA 3EDQB 5KFWA 2CQCA 2R8IA 1JLEA 3IP0A 5B0EA 3CO0P 5F41A 4AE5A 2B7CB 2C2KB 2XMTA 4WWSA 1JLCA 5D3GA 1X4CA 3ZTOA 2KU7A 4IG3B 2F8EX 5I3QA 1AW0A 2DRAA 2JFDA 2ZHOA 4FYWB 2BR0A 2YXLA 2CJKA 1FHTA 1NEEA 4B3SJ 5M2RA 4P10A 3PO4A 2L48A 4TVAB 2DXEA 2X1BA 2OTJS 1KVIA 2GQQA 3CD7A 1QVFR 3VVUA 1VRUA 4DR3J 1E6VA 3P6YC 2DR5A 1S1TB 2E1AA 2H5EA 4CLKA 1TL3A 4NWBA 3IG1B 3QIPB 5B0DA 1IM4A 1F60B 2HVIA 1RSCA 1RAEB 3HSGA 4HKQA 4CLWA 1DTQA 4J9RA 4ECUA 4B08A 4DR4J 3F0NA 4H4MB 2EG1A 4DR7J 4WE1A 2W9AA 5DQHA 2EC0A 4CTAA 1VK3A 3BH7B 3H5UA 4DBQA 2QMXA 4DUZF 2BABA 2YX1A 3O3LA 2HAIA 3PNIA 4TU9A 1OMSA 5JJBA 1Q4RA 1NKBA 2HLUA 1RTJB 2WVDA 1BWVA 3ISND 3HHLB 1VQNS 3P96A 1BHNA 1UEVA 1NRKA 1DJ0A 3QAEA 4DZ6A 2OPSA 2BW2A 4PPZA 1G1XA 4YR0A 2LKZA 5B7WA 2XHCA 1ZOTA 3PYFA 3H0PA 2FDNA 4B9UA 3G86A 3NBPB 4JI2F 2WTFA 5LSRA 4WK1A 4CLTA 3BDPA 3GU0A 1X4GA 3KWMA 3MZIA 1BQNB 2DHSA 2DNHA 2E7XA 1YJVA 1EX8A 1MN9A 3TO8A 1HNWJ 3OL8A 4B3SF 5H9EK 1N0VC 3KK2A 2QSFA 1JLEB 3H8YA 1TV6A 3US5A 5D3GB 4DR3F 2W4CA 3AD7C 2DHHA 3P5TL 2OUGA 1RTZA 1JXVA 3F41A 4QWAA 2ROEA 4F26A 4LFCJ 2QGFB 4L75A 2VZ9A 2UUWA 1ROFA 2I0XA 4RW6A 2DEIA 4C2MA 4P73A 2UUCF 1U2RA 1RBAA 4HH0A 1VRUB 4BC7A 2MQLA 4JV0A 1E6VB 4OI2A 4RX6A 1MMDA 3VGUA 5ETQA 3PVXA 1T9VA 4DR7F 1H7WA 1VBKA 2W2NP 1S1VA 4DPWA 2C3OA 2DHGA 2ZNYA 1U48A 2H5IB 2QEXS 2DEJA 3OT9A 2A3JA 1XN9A 1DQ9A 3AQPA 3W60A 3BO4A 2XZDB 3TA1A 2V8HA 1VQ7S 2KJVA 2OELA 1Q7YT 1DTQB 1YG0A 3O5TB 1EHWA 3CDUA 3TZZA 1D8YA 4WE1B 4QOTA 4WJBA 4R0EA 1L3TA 4KYZA 4CTAB 1J27A 5F0WA 2FLPA 4N8OA 4Q2MA 2PMWA 4WU3A 2XZTB 4KTQA 1E6YB 3R5GA 4ICLB 3CJ8A 1UZDA 3MXHP 1UWAA 1U2FA 2MSTA 5D15A 1S0OA 4QBUA 2J7WA 1OO0B 4CRJA 4QWBA 2UUAJ 5KT3A 3O44A 4RW9A 3RG6A 3QGIA 2FZGB 3KUHA 2OPSB 3MM8A 4DV6J 3KYLA 2LU2A 3R7SB 3NL0A 2E5JA 3CJQA 1HNWF 2N3LA 3FMWA 2FLLA 5IT9U 2L9DA 3T5JA 2NPFA 2CA9A 3H5SA 1HARA 1Y5IB 1OSDA 2BW7A 1AUDA 1S9EA 2HNDA 1SJ1A 2VJUA 1UJ6A 3UO0A 1TP7A 1QAJA 3L09A 2HHWA 3FRYA 2ZH7A 4DV7F 1S6PA 1HA1A 4K50A 1K1QA 4LFCF 3NGUA 3CNQP 1D9AA 5DLGA 3AD9C 2R7UA 2XYGB 4CLZA 3HM9A 3KK2B 1HBUB 1K0VA 3GJQB 3HXMA 5KFGA 4DV2J 1SQEA 4F4AA 3GMGA 1C4AA 1TV6B 3W66A 1Q0NA 4DV4J 5CAAA 1RE1B 4KC5A 1GMWA 4R8UB 3UDLA 3M2UA 3NOGA 2OAUA 2GO9A 2MZ1A 5HLFA 3AXMA 3P49B 1FE0A 4KR0B 1BWEA 5BR8J 3W8PA 4XTTA 2LXIA 4OI6A 4F0HA 2EKNA 1IR1A 4EBCA 4DX6A 1RGVA 2J8AA 1V5IB 2VC0A 4Q7AA 3GV7B 2Z2ZA 1WOOA 4QU6A 3NNCA 1S1VB 2V8PA 2V2QA 1M5KC 1WTFA 4OYAA 3WZ0A 1KC8T 4XO0A 3RW7A 2BJ3A 4QYZK 1VBXA 2ERRA 1N0UA 4PXDA 3H90A 1DY3A 4C3MA 2XS2A 4YUDA 3KDOA 5E5NA 3HLUA 2DR9A 1S1UA 3N28A 2D3ZA 3A3PB 5IC4B 1GT8A 5L1IA 3AHPA 4DV6F 3BO2A 3GFXA 3CJ5A 2K1RA 3GTYX 2YH0A 3AA8A 2G13A 2VBXA 4JI0J 1RWOB 1VRTB 4DR2J 3RBEA 3FK4A 5KFXA 4A8XA 1ZH5A 1M5SA 1RB0A 5B08A 3LAKA 5GAGU 1QUPA 1TKXA 2XMKA 1OY9A 4FS2A 3R2DJ 3MM8B 3ULHA 2F4VJ 3DRXA 2W8KA 4KKOB 2X3DA 2EWHA 2WSCC 4FXWA 4DV2F 1X0PA 2YWWA 1SH2A 2W01A 3A4TA 4DR5F 4DSLA 2WW8A 4Z37A 5KFEA 2HNDB 4DV4F 2VBYA 2OEKA 1SXLA 5CZXA 2UXCF 1NJWA 1YJ9S 2DRDA 3HFZB 2ADCA 2ALYB 1TKDA 1T95A 3EGWB 1S9FA 5HQMA 2N82B 3JAMY 3DLGB 2R9LA 3QO9B 3CPWR 2GAHC 3T6BA 3VTIA 1IQZA 3S01A 3PW4A 5LJ3Y 4DPOA 1YHQS 2PIIA 3M2UB 4OV1A 1VQOS 5L1KA 4E98A 1OY6A 2FLNA 4L6V3 2DITA 2RIJA 1VQMS 2W24A 1VC5A 3MPWA 3R5BA 5HLFB 1K8AT 4ANDA 4CNYA 3MAAB 2ZHBA 4P7TA 2X1GA 1TVRB 4PG7A 4YY3F 2NXJA 1M5HA 1U6FA 2HVEA 3BSCA 3GB0A 4KE5A 5IV4A 1H0HB 3ZXWA 1TUGB 1X9MA 3RB0A 1UFKA 2HWIA 2LDYA 2IM1A 5F8MA 3TEHB 1X9WA 1YJUA 2GAGC 3MPYA 3NNAA 5ETPA 4JI0F 4Y3CA 1L3VA 3EZUA 4CLYA 2N4CA 4A46A 2VPWB 1HHSA 3FNNA 2WSEC 1ACMB 3HFVA 4CM2A 1AROP 3TUZC 2VL1A 3IWXA 4P9SA 2HNZA 2K1RB 4LSLA 2HFZA 4ZP8A 4WP8A 2AJ0A 4URSA 3NXZA 2VDIA 5KT6A 1B7FA 1DQAA 2IM2A 1HQUA 1S72S 7FD1A 4M5DB 4G1QA 4C8LA 2P8IA 4CO1A 2RQ4A 1TKXB 4USWA 3BGLA 1WG5A 4JOUA 5EWEA 4CNZA 2XYHB 2OEMA 3WHIA 2ASDA 2RRNA 4ZVSB 2XLIA 2Q79A 2H48B 2CPDA 4MK8A 2JLEA 1M5PC 2EK1A 2MQQA 2DH9A 2HURA 3LGNA 2CPZA 4ZVRB 2N4DA 1FESA 4ZVOB 3A8JA 3ZFVA 2H4YB 1PBUA 2E29A 3EE3A 4F25A 1ZTTA 1BQMA 2FJVA 1FO1A 4B3OB 3ELHA 2KJWA 3LP1A 4TQRA 4U9RA 2UUBJ 3QFHA 5KG1A 5L8RC 3TVKA 4FZVA 1M90T 2D69A 4FYYB 1YJTA 2BM0A 2YKQA 4GO7X 4N8NA 2YNIA 1JJHA 2B9WA 2DXFA 2ROPA 3ZC4A 5G4DA 2HFVA 4CLLA 3IGNA 1A0OB 2VQFJ 5HQ8A 3E01A 1HIYA 2CQGA 2B9EA 1RHUB 1UPPA 3VR1A 2O1PA 2DVIA 3GP9A 4HYKA 2YKAA 4NCBA 5HO4A 2AGQA 5IS2A 1LWCA 2DNMA 1P1TA 2C3MA 4IR9A 4OFZA 1N5TA 5DETA 3G8TA 2EFPA 3H59A 4DUYJ 1F6TA 4G65A 3NWRA 2P6SA 1Y3JA 1DFDA 3VQTA 4WYWA 4DLEA 4NZ0A 1NK0A 2B4PA 1H38A 1VQLS 2DNNA 4UQTA 2DPIA 4RU9A 3PO5A 4KV8A 2GNKA 4LSLB 1FTCA 1VQ8S 2HMIB 1RAIB 2B9YA 1RJJA 4WTYA 5KAKA 2XWYA 2RQKA 5IFMA 5CYQA 2HHXA 1OY8A 4K4UA 3L9ZA 4TN2A 2W8LA 3C19A 5A76A 3DXBA 1HQUB 5LMNJ 2CZ4A 4G1QB 4DV5F 1B4SA 2UVUA 2FJXA 5HJYA 3ZZOA 1XNQF 1H7XA 3CTRA 3T19A 1FWPA 2AX0A 3VAGA 1UPMB 4ZJQA 1NJIT 3Q89A 3HHLC 3H7HB 2Q43A 2E44A 1PYSB 3LP0A 1RLCL 5DG9A 2ZZNA 1JNZB 2QLFB 1V3ZA 2W7PA 2V67A 1RTHA 4I69A 3JSMB 2J76E 2PN6A 3UDCA 4DQRA 4OYBA 4A47A 5HVFA 1NDLA 4IDKB 4XAKA 5K20B 2X3GA 1TK8A 2O3DA 4LSZB 1FRMA 3PX0A 3DOKA 1TK0A 2VA3A 2GQCA 5DDQC 2DNQA 3HX9A 3H5YA 3FZBA 3AXKA 1ICEB 3B78A 1S49A 2M8HA 4OLOA 4CM0A 5BYRA 2WVBA 2V2KA 1KEKA 2ZE2A 2DNLA 1LWEA 5HVHA 2KFNA 2YNIB 3D6MB 1NZAA 2Q3PA 4F8RA 2CQBA 1H73A 2BRLA 2MQNA 2MXYA 5AE2A 2BMBA 1O0PA 3E01B 4FVMA 3IM8A 4OI1A 4U7CA 1U8WA 3M8PA 1UA0A 2MLZA 4DSIA 4M5GA 1LWCB 2XCAA 3OJSA 2AGPA 4U8VA 5F0UA 3BQ0A 2C2DA 3LWMA 4M5KA 1FNXH 1MU2B 2HK2A 1AYEA 5I3PA 2HQFA 5L46A 2YPZA 2V8VA 3M8RA 1R7IA 3CC4S 1SUQB 2XI3A 3M4XA 1F9FA 4QZVB 4G3IA 3CCJS 1NK8A 4OZ0A 5J2NB 2KZZA 2YQ0A 1S6OA 4DDFA 4GVLA 2QL9B 1ZAVA 2FLOA 3NGSA 4UZBA 3BEGB 5CYQB 2RF2A 2QFIA 5KT5A 5KFAA 1QTNB 4LQ3A 4ZOSA 4ES1A 3P3DA 1B3TA 4UOGA 4MTPA 4ITSA 2BVZA 1NH8A 3M1VB 3ICLA 3TP2A 3DLHA 3OHAA 4K5RA 1CQNA 1CLFA 1U1PA 3DRRA 3W62A 3MM7A 1BQXA 4K4YA 4JI7F 4CDIA 3KJQB 3QLHA 5HBMB 2R2SA 3IGVA 3A8EA 2MHEA 4AUKA 1ZAXA 4RKUC 3NAIA 5BYQA 4N41A 1N5SA 2XQCA 2KTQA 4DL6A 1FJGF 3QGGA 3QWPA 2B56A 1RLDA 4DS5A 4QIVA 4Y2CA 3DOKB 1WC1A 1D3WA 2B6AB 5U47A 2R7OA 2XC9A 4LBPA 2RUGA 1SL1A 2RDDA 1Q53A 3C6UA 3CMES 3OTCA 1FD2A 2A1BA 1D9DA 1CJTA 3MR3A 2HVZA 2Z56B 2VFTA 5K8OA 3H4DA 1VQ4S 3ILJA 3OXFA 1REVA 2FYXA 3QRRA 5HL7Q 2ZE2B 1LWEB 5DQIA 2I2YA 3W2VA 3KHGA 1NPRA 3OR1B 2HBQB 3CCTA 4ZIWA 5EX0A 2RKIA 2VG5A 3VZIA 4EMDA 4DFMA 2R8GA 3M8PB 1SC1B 2MB0B 3EGNA 2IAJA 4A8OA 2SXLA 3E2EA 4ATNA 2VKZG 5K9FA 1KHWA 3JXOA 2ZH9A 3BBBA 4NLYA 3WIUA 3EPIA 3M8QA 2JVRA 1NHVA 3D3BJ 1XMOF 1SQFA 2Y8WA 4LRDA 4P2XA 3UPFA 4LF5F 5AXMA 2U1AA 2PA8D 1KTVA 2VBWA 1FKPA 2YVSA 2NSCA 2IJFA 2B3TB 3R7BB 2NZCA 3M6XA 1VLYA 3J80U 3JSBA 5KTQA 4UOHA 2ZBCA 4OHZA 4LIRA 2UZAA 5A2QU 3BBFA 3RYLA 3V6DA 2N3OA 4B3TJ 1F3VA 3DRRB 2J5AA 3MM7B 4USUA 1NPPA 3R97A 1IKVA 1RP5A 3QLHB 2H5JB 1GXUA 2OPPB 1PC5A 2ZM6J 4DU7A 2FHMA 2G0IA 4C9DA 3K57A 1T3OA 3IBWA 2B0GA 2LU1A 1AZSB 6AT1B 1AXQA 1TAUA 3C6UB 4AXJA 3AOAA 3RTVA 1CJTB 1U7LA 5K8MA 2KL8A 4ECSA 4HT5A 4O3QA 2LQBA 4F3OA 1U4BA 1YDLA 2BRKA 2MKKA 4IG0A 1K47A 2XMAA 5KFMA 3R5AA 3D68A 2OPRB 3BREA 4TY8A 3W2VB 2C22A 2DR8A 2IVYA 2DPJA 3DGVA 2IPOB 4B9TA 4DF4A 2RKIB 1HNXJ 2VG5B 4WIIA 2I1RA 4MFBA 5E41A 3GSIA 2ZITA 2IAJB 1UETA 4JB8B 5L38A 1TKZA 4ZLNA 1F1BB 1Q16B 3FEYB 3GYGA 1UVLA 1RT7A 1TTHB 1RZMA 1JLGA 1FVSA 2NXUA 3ZZUA 4ZP7A 3M8QB 2G2OA 4DN0A 5A0YB 4WFBQ 2QG9B 4ZIVA 4TXSA 2IRUA 4M63A 5IQQA 2CKWA 4JI3J 2MLXA 1PBAA 1XMBA 1X5PA 1Q8IA 4NLWA 1FKPB 2LP4A 2HHTA 1U1OA 2HZAA 3MFHA 1S0MA 4TY9A 2XB2D 1WHVA 3TUIC 1SH3A 2YX7A 1WKKA 4NLGA 4R0JA 2B8QA 2ZM6F 3AJ2A 2ZKTA 4KHMA 1HW9A 2V5HG 3V6DB 1FTRA 3OQ2A 3DLEA 3D28A 4P75A 1D8ZA 2O5DA 5HI7A 3KHRA 1SI9A 2VDHA 1T11A 1X4EA 2A0FB 2JLFA 5DJBA 2X51A 1VR6A 3VAMA 3A1YG 1WOSA 5JMNA 5HMXA 4LF9F 2OO4A 4YB1P 1Q8KA 1JKHB 2ILYA 4OI0A 1VIXA 4DI6A 3W9IA 3AOCA 3OVBA 4BDPA 2FJEB 5L1JA 4O4GA 1NM2A 4QR2A 4K4SA 3I82A 2WCXA 4NMXA 3FZ2A 2ZFHA 2CFXA 3UW1A 1X7VA 1MMLA 1N32J 4FPRA 2PEBA 5EWFA 1SQGA 2BE7D 5AJ3F 3HSZA 4ZVQB 2RD5C 4TY8B 2AJ2A 1U49A 3QFWA 5KFOA 4F0KA 2W7OA 3M8SA 3N4WA 1RWPB 1UWBA 4AT1B 4MFBB 1FDBA 3JQMA 2OIHA 4OYPA 4FYDA 3ZNUA 3DMJA 4U95A 1C0TA 5LXRA 1WI8A 1TKZB 3I87A 4KPCA 3N5FA 1RT7B 1JLGB 5ETOA 1EKRA 3KLFA 1UKUA 2MPUA 1UVNA 4U7UK 2R2TA 3QJPA 2BQ3A 2HZVA 4K0KJ 2ASLA 4Z7YA 1DZ5A 3LANA 4LR8A 3MFIA 2BQRA 1RABB 1R8CA 2G2YA 3RB3A 4ZLLA 1XIQA 3TAMA 3BKFA 2FJBB 1VQ9S 1QUVA 4L3NA 1NB7A 3AAWB 2A18A 3BO3A 3EICA 2E7VA 2YWEA 2IJRA 3D6HB 2LDIA 4WIQA 4DR6J 5DDRC 1RI7A 1SBRA 2IBKA 3SSRA 2WK4A 3QZ8A 2QA1A 4OZ1A 3ILIA 4ZJLA 2O66A 2E1PA 5KFDA 3PZPA 3TQ1A 3K17A 4AXIA 1I6JA 3P4UB 3WQPA 1N88A 2LMIA 3WDOA 1MW7A 3CB4A 4YDXA 2M70A 4ID5A 4QPTA 4FKYA 2YBVA 1XERA 2R7XA 1RHJB 5KT7A 1N32F 1LFWA 3T41A 2J7UA 3MR6A 1ZM4A 1S76D 2DNYA 1RYSA 2JC0A 3OHBA 3GR1A 4EBDA 1HPZA 4O4GB 1FEEA 1TR0A 3TZWA 2K2PA 5HMZA 2KFZA 1HMVB 2P2CB 3MM6A 2RRAA 2GHVC 1R8HA 5C25B 4EBEA 3GZ7A 3W65A 3QRQA 1U26A 3DC2A 1DTTA 2WOMA 2VOPA 1WC6A 5DS7A 3PW0A 4NLSA 3TX0A 1BXNA 1M1GA 3D2WA 1YJRA 2AJ4A 2H54B 4LRAA 1V6HA 3PFOA 1KLMA 2QV6A 2VH7A 2WSFC 1NHUA 2R2RA 2PGCA 2KXNB 1N34J 3DMJB 2QJ3A 1EKSA 3AJDA 3P8BB 3KJVA 4MYUA 4ID8A 3SV3A 4LJMA 4I7FB 3AOBA 4ZPCA 2JEFA 1NDPA 3NCRA 1MWZA 3T9ZA 2HFNA 3EGVA 1FE4A 2GCFA 4YEAA 3K59A 3KLFB 2GMHA 4DFKA 3L4BC 5MLCV 1HNIA 2KYZA 2IFXA 1M5OC 2W25A 4G1PA 4HHUA 4X64J 4DHVA 1XNRF 3TAMB 2X1AA 1GXLA 1CQMA 2LFVA 3D3CJ 3CC7S 3CCZA 2OKQA 1A9NB 4I2QA 3QJLA 4JV2A 2W4DA 3HSDA 4YOEA 5EDWA 4WF9Q 1SKRA 4RW8A 3UN2A 4CO5A 3IXQA 4DV3J 1MMNA 5J1EB 1LNQA 1J2VA 2H3EB 5SUHA 2GMLA 1M0SA 1N5VA 1MROB 5DG8A 2BYCA 2EXUA 3EZOA 3H2VE 3PXGa 3A8IA 3K7RA 5AXNA 2B8PA 2V9WA 4ID5B 3KK1A 3FC9A 3BYPA 4Y2IA 4MKVA 3DCAA 3W2WA 1WC3A 3AFGA 2Y1IA 3Q83A 4AD6A 2Q66A 2F8MA 1RYRA 4YDDB 4Y28C 5CZVA 1HKAA 1WEXA 4URQU 1WHWA 4PAAA 3QMQA 1QSLA 2QC3A 1VMBA 2JWNA 2BJ7A 3M32A 3IN5A 1FFWB 1CS4B 4HH1A 2NYIA 3CE8A 1N34F 1DTTB 2BOPA 3OTBA 1LW2B 3Q86A 4NLQA 1I94F 3OVSA 4LIWA 5K8NA 3VV2B 2MZTA 2MGZA 4P6QA 1C1CB 2W7AA 2ZOFA 1U0HA 3W9JA 3W61A 2JC1A 3QRPA 1UVKA 4RW7B 4O3NA 4A8FA 1UW4A 2C3PA 3MCSA 4NLTA 4AL5A 2GX8A 4X4RA 1SL2A 4X4VA 1KQFB 3MM5B 4X64F 1QAIA 4Y2KA 2PEHA 2RMLA 2D9PA 2UVWA 3PDNA 1FKAF 1TU0B 2NCKL 2ZZTA 5J1NA 3M8ZA 4B3MJ 3KXDA 4O3RA 1QSYA 3DOLA 1X60A 2D7SA 3CD0A 3OTDA 1HNIB 4ZVUB 2VASA 2NUUG 4ALZA 2VPZB 5MAOA 2CJAA 2DRBA 3LTOA 4EK2A 3SSQA 4DV3F 2PMHA 2KYXA 4Y34A 1FNOA 3DM2A 3CGIA 3DDKA 4YR2A 3Q2TC 3LGMA 1XEZA 2V0NA 1FI4A 1JMTA 2WW4A 1YGYA 3DI6B 1FA0A 3PKYA 2L41A 4F7VA 2DR6A 3FBEA 1NK9A 4I2QB 2DISA 3AQOA 2RVJA 4ZPDA 2G0CA 4DWIA 1SV5A 2MZQA 2J0WA 3R7NB 1DURA 2VG7B 2XO6A 3NGDA 1Q86T 2E9RX 4EWTA 1Y11A 2ZDPA 2MQOA 2V4JA 1RWKB 2OPQA 3M30A 3LPEA 3KK1B 3FBBA 1EJ7L 2FVSA 2ZH2A 4Q0BB 4RNOA 1O6XA 4N77A 3GQCA 3W2WB 4OHWA 4USKA 1FK9A 4JI1F 5B0GA 1UL3A 1J5EJ 2OD6A 2A6MA 4AYBD 2PT0A 1ELOA 1EIYB 5D6GA 4RNMA 2Z2MA 4Y2AA 3WC0A 1T9XA 4UY8T 3M32B 4V19X 2UXDJ 5ETNA 3E51A 3PTWA 5FJ4A 4J9VA 2CJYB 4PXBA 1YZ7A 1TUVA 3EVMA 1XWLA 5GMKa 3RAQA 3VAHA 4Q8FA 1R8BA 4IFVA 5HVGA 4B3MF 3T5KA 2CQ1A 2FGCA 3RB4A 3IAS9 5F3TA 1HFEL 1RT2B 3VHQA 4ELTA 1RU2A 1KVJA 1QLNA 4QWEA 4CWBA 3DRYA 2YH1A 2QA2A 2YNHA 1Q95G 3V2UC 1YX2A 2PSZA 3POTA 3B6BA 3K2YA 3AB4B 4A48A 3IC1A 1CVJA 5KFHA 1N8RT 3UCUP 1X5SA 1TMMA 2HRYA 4C7QA 4GVBA 4J91A 1T3NA 3K5OA 3DM2B 2IY5B 5DO2A 3G6ES 2CPEA 2Y8YA 3CJTA 3TW0A 2CPYA 3O1LA 2XLKA 2AJ1A 2QL5B 4GKKJ 2BOAA 4C8NA 3A3OB 2OFHX 3O8WA 3Q8QB 3DHXA 1UFWA 1RK8A 1JIHA 2B5JB 1FDAA 4PXCA 1YI2S 2ADBA 1SV5B 2UU9J 1Q5YA 1N4LA 1WTBA 1VCTA 4N56A 2QX0A 2KFYA 2DCUB 2VOOA 1J5EF 5B0AA 3GPAA 5GMEA 3UDVA 5KFFA 2V4JB 2OPQB 2C2ZB 3G82A 3VWSA 2RT3A 1VHIA 1R3NA 2UXDF 4C6AA 4K4TA 4IOBA 3ZZ0A 3NRBA 1FK9B 3I55S 1FF2A 5A2QY 3FVYA 2AF6A 1EETA 3M8YA 2Q6BA 3J81U 2B4OA 5KG4A 2LEBA 3PV8A 5JVGQ 2QE5A 2W9CB 3R9LA 2FHJD 3OR2A 4JV5J 4ED2A 1LV5A 3MOZA 3EJMA 2GHWA 4HEA9 4OI4A 2JHEA 2FHKA 4IFVB 4EU0A 3QT6A 4MH8A 2ZH8A 5CABA 2JRSA 1RBOB 4W4MA 3JS9A 2LQ5A 3KLHB 4BWJA 5IZHA 1FXDA 4DV1J 3NS5A 1F5BA 3TUPA 1N5YA 3ITHA 4JI5F 2JVOA 3NGKA 2FTRA 5HP1A 3KNGA 2DGSA 4USIA 2FD2A 3TQEA 4DQQA 2HQ3A 4DJBA 3LOUA 3CMQA 1HNZF 3G71S 4NLVA 3KLGA 3MEDB 2Q1LA 2BM1A 1QAXA 3K5LA 1L3SA 1A6LA 2OJ3A 3HZGA 3HO1A 2AEJA 2W4PA 1RWXB 4KO0A 4DR1F 2LVWA 4GVBB 3TEGA 2JFKA 2UU9F 2J6UA 4ECRA 3MHYA 4EZ6A 1VISA 4X4UA 2HQDA 3MF5A 2HHHJ 1YBUA 1FJ7A 2VA2A 4U96A 3BF4A 3UCZP 1QM9A 1EB0A 3CJKA 2IRYA 1BD6A 1NB2A 3ZZTA 3TARA 4K8RA 1U1RA 3MUTP 3MEKA 2IMWP 4OJHA 2BANA 2XSJA 4ZPBA 3GIMA 1H6KX 1KQSR 2F9DA 1FRIA 1SC6A 1VS3A 4ETXA 3U02A 1R0BG 4I1TA 4E0DA 2H9ZA 2J7KA 1TQLA 4NXNF 3EYZA 3CULA 1JX4A 1RBLA 3PIOQ 3GILA 2RHSB 1YBTA 1RA7A 4YB5A 1EETB 1T05A 4A8MP 3KHHA 5HROA 2C28A 1C0UB 2EFQA 3QAUA 2LXUA 1NO8A 2EPIA 5D8HB 4IG3A 3OR2B 4LF2A 4X4PA 4F4YA 1S5ZA 2K7JA 1X5TA 4DV1F 3CCLS 3BYRA 4XDCA 2BKPA 2Y1RI 3RRGA 4NRTA 2HHQA 5DGAA 1XMQF 4W90B 3H40A 4N5SA 4C8MA 2Y9HA 3QT7A 4X65F 2GMJA 4X66J 5EX3A 2O01C 1N5YB 1LK5A 3ITHB 2G4BA 2JEIA 3JTNA 5HP1B 1NSPA 1SJQA 1S10A 4FXDA 5KG5A 3PCOB 3W5XA 2CQPA 4WXWA 2YNFA 3KUGA 4XIUA 5AE3A 2OFGX 3OL7A 1RT1B 4AQYJ 3HHDA 4C0OC 2D3O1 5L1LA 4B9NA 2BJ9A 1S1XA 1N33J 2CQ2A 3QATA 1S6QA 3DFEA 4KJIA 1DBDA 4WFXA 3H20A 2Z57B 1S79A 3OXLA 2H51B 3TA2A 1VFJA 4JUZA 2R7RA 4NMLA 2PDAA 6FDRA 1JLFB 3CJKB 4LVOP 3HMJG 1U2CA 1S1WB 1SJRA 2BJ1A 4I68A 1C4CA 1JLAB 5J2QA 2YQ1A 3TAPA 3CCMS 2ACYA 2DNKA 1S97A 1AB8A 2B43A 2H1YA 2YWGA 4MK9A 3UE2A 2ZHAA 1IBLF 1SIZA 3NBPA 1O5JA 3N6LA 2KO1A 3ZZZA 1VBYA 5EWGA 4NPOA 1KTQA 3W63A 4ZVHA 4A8SA 3DN9A 4J9QA 3PRVA 4J90A 5FLXU 1JQGA 3I96A 2W9BB 1NHKL 3CDEA 1JK9B 2BA9A 5F8NA 3CDWA 2DGQA 3SYZA 3KLEA 2HYIB 3OFEA 1D9FA 3GE9A 1T05B 4O3OA 3P5BP 3N0VA 1R89A 2QLXA 5HROB 3UDEA 5A8WB 3EUNA 4EGLA 5C42A 4NXMJ 4RLEA 3WBZA 2HRUA 4PWDA 4ER8A 1JNRB 2GFFA 3TANA 4X66F 1VQPS 1N6QA 4M1KA 3TJ9A 3BPDA 1SKUB 4PABA 2MKIA 1VLOA 2A2CA 1S0VA 2ZBQA 1NK4A 1PJ5A 4O3PA 1U6BA 2VODA 1NPKA 4QCLA 4GRSA 2YNGB 2ZNZA 1IUJA 2LXFA 3CCWA 2DNOA 1K9MT 4AQYF 1RTIB 4B17A 1EARA 1N33F 2EBGA 4I0WA 1FX2A 3I9ZA 2WAQD 3N6MA 4KH0B 1GFWB 2C2MB 4NLPA 2VFVA 5T14A 1KQGB 3OFGA 1BGXT 2ZH3A 2YNFB 2DR7A 2F8HA 3HF5A 2BX6A 4NCGA 4JP8A 4WKYA 3H2UB 2A6OA 3MMCA 4P2MA 5A6WA 4QWCA 1S1XB 3GFHA 2ZD1A 2MHNA 3ILOA 1S6QB 2QA4S 3U1MA 3A12A 3UFCX 1NBEB 5LSLA 3M9NB 3W1YC 1E6YA 4CT9A 2IA6A 4ICLA 4TKTA 3C14B 3MI7X 3CCES 4P52A 4WFAQ 1OYEA 4C8KA 2YWFA 4B9SA 4L3KA 4IR1A 2MKCA 2A10A 2AW0A 3HHKA 4LF6J 5CD4H 3UCGA 5J2QB 1KOOA 2EEYA 2HWHA 4WU2A 3OSNA 2IYGA 1VC0A 3KKFA 1ZBTA 1T9TA 4CH1A 4OZ3A 1KONA 5L39A 2FQQB 3S8SA 3CJSA 2DNRA 5KFBA 3ONQA 4JI6J 1W7WA 2HWTA 3G6XA 2DYAA 3KLEB 1XR7A 1S9GA 1WSVA 1HBUA 2F1FA 4WFYA 5IWAJ 2APOA 2ZC4A 2DNPA 1WEYA 4RUAA 4HHJA 3NGTA 1LK7A 3D0HE 1JJ4A 2AYGA 1QTMA 4KT0C 3SBMA 5C42B 1IBMJ 4PWDB 1PCAA 4R8UA 5GVQA 1GNKA 2ZWOA 4OJGA 4ED0A 2MJUA 5KT4A 4QWDA 3GFZA 2QO3A 1N6QB 2DGOA 1NU4A 2R8HA 2AWZA 4RUBA 1KFDA 1M1KT 4DR4F 4IRDA 3PR4A 3MMAA 3CJ4A 1SKSA 3IRWP 2J9DE 3V4MA 2NUHA 4ZCIA 2VF3A 1RADB 2YKMB 2V69A 3FBCA 1MG7A 2N7YA 5M2UA 2FVPA 4OYIA 3RBZA 5C2CA 4H54A 3J7A1 1AUSL 2XM3A 3KMQA 5B0CA 4NCGB 2CZ9A 1G7CB 2RRBA 3MMCB 4LF6F 3KNAA 5LMUJ 4L76A 1IKWA 2ZD1B 3DGPA 1KRPA 1SC4B 4X62J 1KDNA 1AA1B 5IT4A 1I1GA 1S7IA 1XR5A 4LSNA 3BGRB 3N9UC 4RR5A 1VRTA 4ANCA 5D4OA 5KT2A 5K8PA 5E3PA 1FWLA 2Z30B 2UP1A 3CCSS 1F9EB 5ETKA 1D1UA 2HNYA 4KKOA 3FQKA 5IWAF 4ES3A 4USJC 2VFRA 2HVDA 1U1MA 2VBZA 1RAFB 1IBMF 3V5RA 1WEZA 5F8GA 1EQ0A 3SEOA 5DM7Q 4I4BA 3EXCX 4HTJA 2M3DA 4ZHRB 4DQPA 3TZXA 3NCPA 1NLKL 1ZPWX 3KOAA 4UZCA 2R7QA 2HGMA 1S9GB 4YHHJ 4OJ3A 5K14A 4IOCQ 3PEJA 1X5OA 3VAFA 1O51A 3DLGA 3QO9A 9ATCB 4C0HA 1YTYA 3BH6B 1RAJA 3I0SB 3EXYA 3PM9A 4QYZJ 5C2GA 2D74B 2KVIA 4LRBA 2FHOB 2FVQA 2ZH6A 2KXFA 2R7SA 5FDLA 3MAAA 3NG8A 4ILMA 4KGXB 4CLSA 5F8IA 3FFIB 4F02A 4FN5A 1TVRA 1RA6A 2VJVA 3H42A 2V34A 5D0RA 4YQWA 1LQ9A 1TKTA 3FJ2A 3MMAB 3NOCA 3UR3C 1S57A 3SCIE 1HWLA 3W5YA 4YMEA 4ZCKA 4RW4A 3V4IA 3Q8SB 5ADZA 2LA4A 2JDJA 5LMUF 4BHQA 3SXLA 4X62F 1W2BR 1FNMA 2AMCB 4DL3A 1VQSA 1FT8A 2VICA 3T5LA 4DCOB 4ZS6A 4OYWA 2UUAF 4YB6A 3HULA 1IKWB 5GADU 3DGPB 2VQEJ 3T3FA 5E7OB 1J5OA 1RXOB 2F7VA 3C3LA 2G1DA 2WHOA 1Q79A 2GO8A 3T1YJ 2HKEA 4LSNB 4NYZA 3FMBA 5K5MA 1RU1A 3OTOJ 3U27A 5ETSA
chains in the Genus database with same CATH topology
3GJRB 5IC4B 4ZVTB 2CNKB 1RWXB 3RJMB 1PAUB 2HBQB 3NS7B 2CNOB 3D6MB 2QLJB 3IBFB 1RE1B 1RWMB 2DKOB 2H51B 3EDQB 1RWOB 4JB8B 2XZTB 1RHJB 1PYOB 3R6LB 3GJSB 1SC1B 4ZVUB 1F9EB 2C2KB 2H5JB 2HBZB 3D6FB 1RWNB 2CDRB 3KJQB 2Y1LB 2QLBB 2XYHB 3KJFB 1RHUB 2QL7B 2QL5B 1I51B 1RWVB 2CJYB 4ZVSB 2QLFB 4ZVPB 2H48B 2H65B 3GJTB 1RWWB 2HBYB 2P2CB 2CNLB 3R7SB 2XYPB 1QDUB 1RHRB 2C1EB 1NMEB 4DCOB 2HBRB 2FQQB 3P45B 1RHMB 2CJXB 3IBCB 5K20B 3EDRB 3R7NB 3R5JB 4ZVRB 1GFWB 2H5IB 2CNNB 2C2MB 3KJNB 3D6HB 4LSZB 1RHQB 2QL9B 2C2ZB 4ZVOB 4ZVQB 2H54B 3QNWB 3R6GB 2XZDB 1I3OB 1SC3B 2H4YB 1RWKB 2C2OB 1SC4B 3SIPB 2Y0BB 1ICEB 1BMQB 3R7BB 5IC6B 2XYGB 4DCJB 2H4WB 1RHKB 1QTNB 4DCPB 1RWPB 3P4UB 3GJQB 1IBCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJR B;  5IC4 B;  4ZVT B;  2CNK B;  1RWX B;  3RJM B;  1PAU B;  2HBQ B;  3NS7 B;  2CNO B;  3D6M B;  2QLJ B;  3IBF B;  1RE1 B;  1RWM B;  2DKO B;  2H51 B;  3EDQ B;  1RWO B;  4JB8 B;  2XZT B;  1RHJ B;  1PYO B;  3R6L B;  3GJS B;  1SC1 B;  4ZVU B;  1F9E B;  2C2K B;  2H5J B;  2HBZ B;  3D6F B;  1RWN B;  2CDR B;  3KJQ B;  2Y1L B;  2QLB B;  2XYH B;  3KJF B;  1RHU B;  2QL7 B;  2QL5 B;  1I51 B;  1RWV B;  2CJY B;  4ZVS B;  2QLF B;  4ZVP B;  2H48 B;  2H65 B;  3GJT B;  1RWW B;  2HBY B;  2P2C B;  2CNL B;  3R7S B;  2XYP B;  1QDU B;  1RHR B;  2C1E B;  1NME B;  4DCO B;  2HBR B;  2FQQ B;  3P45 B;  1RHM B;  2CJX B;  3IBC B;  5K20 B;  3EDR B;  3R7N B;  3R5J B;  4ZVR B;  1GFW B;  2H5I B;  2CNN B;  2C2M B;  3KJN B;  3D6H B;  4LSZ B;  1RHQ B;  2QL9 B;  2C2Z B;  4ZVO B;  4ZVQ B;  2H54 B;  3QNW B;  3R6G B;  2XZD B;  1I3O B;  1SC3 B;  2H4Y B;  1RWK B;  2C2O B;  1SC4 B;  3SIP B;  2Y0B B;  1ICE B;  1BMQ B;  3R7B B;  5IC6 B;  2XYG B;  4DCJ B;  2H4W B;  1RHK B;  1QTN B;  4DCP B;  1RWP B;  3P4U B;  3GJQ B;  1IBC B; 
#chains in the Genus database with same CATH topology
 2FC9 A;  3SCJ E;  5I3U A;  3NMR A;  1GX6 A;  1HYS A;  4M5D A;  3DLL Q;  3IS9 A;  1HBM A;  2CNO B;  2IC3 A;  2DGT A;  3ENA A;  1WDT A;  2AX1 A;  2WON B;  1QE1 A;  4PYA A;  2HNY B;  1X8D A;  2ZZM A;  4WP9 A;  3W3S A;  4WZM A;  4YHH F;  3MM9 B;  4Y0F A;  4DQS A;  4CH0 S;  5EHH A;  3F56 A;  2LQ9 A;  5KFL A;  5A8R A;  2XMU A;  1UA1 A;  2Z2L A;  2KZM A;  1HBN B;  1GAO A;  4DSJ A;  2DY1 A;  1HQE B;  2CNL B;  2WZ1 A;  2KHC A;  4LMZ A;  4URG A;  5K14 B;  1EQM A;  1SCJ B;  2NXE A;  3VAI A;  4ECT A;  5BR8 F;  2AP6 A;  3QBC A;  1Q1K A;  2VFS A;  3HVT A;  4DXL A;  2Y3Y A;  3MPV A;  2XUL A;  4EEY A;  4ECZ A;  4B3O A;  4AL7 A;  2V94 A;  2P9G A;  3FUY A;  1V3S A;  5FDL B;  4FPI A;  3F73 A;  2VKR A;  3OSP A;  2MSS A;  3ADA C;  2XLJ A;  3EMT A;  5D0G A;  2ZUG A;  3J81 Y;  4C0B A;  4YS2 A;  2V50 A;  2QLJ B;  3OW2 R;  1TKT B;  3TI0 A;  4N7T A;  1AT1 B;  4RW4 B;  2XO7 A;  4KBI A;  3UI3 A;  3V4I B;  2WB1 D;  1B64 A;  4H4O B;  3GIK A;  4H4K C;  2MKS A;  1ZA2 B;  3L7O A;  5KG3 A;  2E66 A;  3BGU A;  2CZV C;  4IQM A;  3T1Y F;  3VVT A;  4DR2 F;  2MKJ A;  2QMU B;  4DX8 H;  4B9M A;  2XTJ P;  4J5O A;  3OTO F;  4RNH A;  3Q24 A;  4DL4 A;  1KS2 A;  4OV6 A;  2ASJ A;  3P45 B;  2GJ2 A;  4M95 A;  1F5A A;  3IM9 A;  1J5O B;  1X9S A;  4TYB A;  2ZJP Q;  4R5P A;  3MAQ A;  1DQ8 A;  2F4V F;  3FSX A;  4O23 A;  2HMI A;  2ALZ A;  1VDH A;  1RIS A;  2MYF A;  3GR0 A;  2G1H A;  3GON A;  3VQS A;  2FJD B;  2BJE A;  5KFU A;  2MZR A;  5I3U B;  5IC6 B;  4G1I A;  1ITP A;  1HYS B;  3CW2 C;  1RHK B;  3IS9 B;  1HBM B;  4Q8E A;  3GWC A;  1Q5V A;  2IC3 B;  3MR7 A;  4C3L A;  3MGJ A;  1CJU B;  1QE1 B;  4ZVE A;  4F2S A;  2MQM A;  1FD8 A;  4TLQ A;  4LF7 J;  3FSI A;  2NPI A;  4CO2 A;  3MWB A;  5A8R B;  5E3A A;  4WFN Q;  4F4Z A;  1X4B A;  1RWN B;  1N5Q A;  4ED8 A;  3JSM A;  1WJ9 A;  5KFI A;  3D6T B;  1PIL A;  1CG2 A;  1RAO A;  3K5M A;  5T41 A;  4P74 A;  4IDK A;  3IFE A;  1CUL A;  3LPY A;  2DH7 A;  3MR2 A;  1AFJ A;  2BE9 B;  3HVT B;  3QT5 A;  2NRE A;  3MDF A;  3IR7 B;  4QR0 A;  3V81 B;  2W2P P;  4Y2M A;  2AEF A;  4FNH A;  4WTO B;  4RBV A;  2KRB A;  1SJ3 P;  5ETR A;  4RUH A;  4W98 A;  3NY0 A;  1KLN A;  2IBO A;  3L3C A;  3PW2 A;  4NLR A;  1Q78 A;  1X4F A;  1XTZ A;  2FVR A;  4MAK A;  3J7Y U;  2R42 A;  4UT4 A;  1GMU A;  3NCQ A;  1NK7 A;  3FSY A;  3RAX A;  3FRZ A;  4OX9 J;  2G9O A;  2N7C A;  3UD5 A;  3RGI A;  4R25 A;  1R8P A;  4M5N A;  3RR8 A;  3OUY A;  2KT2 A;  1U0S A;  4MKY A;  8RUC A;  1MU2 A;  3MPD A;  4F50 A;  3BS9 A;  3K5P A;  1OSC A;  1SUQ A;  1PIE A;  3J81 j;  4F3Q A;  2WVF A;  3OFH A;  1EP4 A;  2IMO A;  5CHC B;  5J2N A;  3KG0 A;  3D5M A;  1UW9 A;  1NME B;  2MKY A;  4F67 A;  4R5P B;  3CJR A;  4LF7 F;  1ZZN A;  2DY9 A;  1C1B A;  3EWG A;  3BB5 A;  4XDD A;  2I5J B;  2GVZ A;  3FEX B;  2HIY A;  4A8Q A;  1IKX B;  2FJW A;  3S7R A;  3U7J A;  1WNE A;  1Y9O A;  4WXO A;  2MQP A;  2PC6 A;  2ZH4 A;  3SIP B;  2MTL A;  3RU0 A;  3M1V A;  2M52 A;  4QW9 A;  1RT6 A;  2RU9 A;  2IHR 1;  2NSB A;  3OV7 A;  4ZVT B;  5DGB A;  3PEH A;  4U7U D;  5KFY A;  5HBM A;  1WF0 A;  5FII A;  4QR1 A;  5AXL A;  3CCQ S;  3MR5 A;  1R8A A;  3G96 A;  1P8G A;  1F0X A;  1FRX A;  3HKZ D;  2BXJ A;  3J7Z 5;  2DO4 A;  2UUB F;  1F5C A;  2LQJ A;  1IJE B;  4JYA J;  2KDO A;  4DX5 A;  1WG1 A;  1Q8L A;  1CUL B;  4JBC A;  4CO0 A;  3PIP Q;  1V5V A;  2ZBP A;  4CYU A;  3BJY A;  1K0T A;  7AT1 B;  1X31 C;  2B6A A;  3RBX A;  2P5V A;  4OYM A;  1H74 A;  4KGV B;  2VQF F;  4TQS A;  3LGH A;  3DNC A;  2XMJ A;  4C11 A;  2JOQ A;  3ZO7 A;  5GAH I;  4OX9 F;  4NLD A;  4OMF G;  1UJ4 A;  2HHP A;  2VHG A;  2CAD A;  1I5O B;  5F3Z A;  2Y0S D;  2FZK B;  2C42 A;  4DUY F;  4CZC A;  3CF5 Q;  2AT1 B;  3OR1 A;  2KH9 A;  2K3K A;  2R4F A;  4DCJ B;  2YX4 A;  2R8K A;  5D0H A;  3ZZR A;  3OD2 A;  4FF2 A;  3PX4 A;  2QA4 G;  2UV8 G;  1RKJ A;  4PG4 A;  2IJN A;  3FKB A;  1Y0H A;  3K8V A;  3LH2 S;  2AEM A;  2FC8 A;  2G0J A;  3K5N A;  3OUY B;  4JI8 J;  4MKA A;  3HK2 A;  6FD1 A;  2DGU A;  3IR5 B;  4KIA A;  3WIV A;  5LMN F;  3S6E A;  4K2X A;  1U45 A;  1EP4 B;  1YSJ A;  4GKJ J;  1ZM3 A;  3GIJ A;  2R7W A;  4JI2 J;  4DSE A;  4DL2 A;  2VUG A;  1VGY A;  4WKR A;  3PAC A;  2XWX A;  3HHL D;  1C1B B;  3NWG A;  3H4B A;  3NLC A;  5LJ5 Y;  3PW5 A;  2F65 A;  3FBF A;  4RNF A;  2HBR B;  2GVZ B;  1WOR A;  3HT3 A;  1CC8 A;  1UVJ A;  2E5G A;  2GA7 A;  4ANE A;  3C8Y A;  3QT8 A;  1NKE A;  2I6W A;  1QJH A;  1YLX A;  4NA3 A;  3BR8 A;  2IM0 A;  1RT6 B;  4JYA F;  1UAW A;  2F63 A;  2M8D B;  4Q2L A;  5JXS A;  1ZPV A;  2D9O A;  1PAE X;  1IBC B;  1OJ4 A;  2L3M A;  1N36 J;  1VIO A;  1PAU B;  1B99 A;  4X84 A;  3PJX A;  5HAT A;  3O6Q A;  2OPP A;  3B4D A;  2VON A;  1WC0 A;  2KHD A;  2GIQ A;  2UUC J;  1LXJ A;  3OL6 A;  3SCL E;  3SCK E;  3R27 A;  4MIB A;  4CLP A;  4P7V A;  3JTP A;  4GC7 A;  5BXI A;  4DS4 A;  2VG6 A;  2NZ4 A;  4RUC A;  3THP A;  1Y10 A;  1AZS A;  4CYU B;  2GV1 A;  2HHS A;  1LW0 A;  5HAN A;  1L3U A;  4C11 B;  3MD1 A;  2IDE A;  3M2V B;  4BCA A;  3BSA A;  2CJX B;  1JWW A;  1ZM2 A;  4HT7 A;  3D66 A;  2G2Z A;  4CCH A;  3CMA S;  4JI8 F;  3UWT A;  2OPR A;  1T03 B;  4DOZ A;  2M9K A;  4NA1 A;  2V8G A;  1WEL A;  2KG1 A;  3MTK A;  4Y6I A;  1NZ8 A;  4GKJ F;  3HCX A;  3R2C J;  1G3O A;  4M5H A;  1RTD B;  4I2P B;  5DLF A;  4DL5 A;  3NS7 B;  2V9K A;  3BN7 A;  4RZR A;  1OS5 A;  1WC5 A;  4FBU A;  3L7U A;  1ZTW A;  4ZPT R;  1WAC A;  1KD1 T;  2V2V A;  1S59 A;  5A0Y A;  3RUB L;  1S4F A;  2NR0 A;  1T9U A;  1CJV A;  3FDS A;  2GJI A;  4XK8 C;  2EFV A;  2QYG A;  4ZPA A;  2VFU A;  4U8Y A;  1L5U A;  1LEO A;  4NOH A;  3MCM A;  1JLC B;  3D0I E;  1JXE A;  1HLW A;  5B0F A;  5IV3 A;  3I5B A;  4UOF A;  2W2Q P;  1N36 F;  4DV7 J;  4ERD A;  2XY6 A;  2V4Q A;  4RPF A;  2RQM A;  2JSX A;  5DZ7 A;  4FNI A;  4NYO A;  2EW9 A;  5DG7 A;  5C5J A;  3TWZ A;  3WX8 A;  4L72 B;  1FFG B;  2Y0B B;  1NXI A;  1TL3 B;  1RT4 A;  3TYT A;  4DCP B;  3CDA A;  4IYQ A;  4ZPV R;  1T9Y A;  5C24 A;  3LWL A;  5E0O A;  2EG2 A;  5BYS A;  2ASY A;  1HD1 A;  2YKO A;  4NZ7 A;  4QIE A;  2RQC A;  4WFZ A;  1B70 B;  1UVM A;  3F44 A;  1M5V C;  3GJS B;  2DXD A;  1JKH A;  3UD3 P;  2VG6 B;  5IT9 Y;  1YWX A;  3LP2 A;  5ETM A;  2AQ4 A;  1VC6 A;  2Z8Q A;  1LW0 B;  1Y7P A;  3M6V A;  4ILR A;  2AU0 A;  4GO5 X;  2HG4 A;  1UEU A;  3ZTQ A;  2OD4 A;  2YWK A;  1Z1Z A;  4USV A;  1VQY A;  2XY7 A;  4KY3 A;  1FFS B;  3J7A N;  2DCL A;  4J9N A;  4ED1 A;  3FCV A;  3JSY A;  2M0G B;  4NLU A;  3MEE A;  4OZN A;  4A4J A;  2PD1 A;  3D1Q A;  2Z58 B;  2GS8 A;  3MD3 A;  4DX7 A;  4OZL A;  8ATC B;  2GJF A;  3HVW A;  2MDA A;  2J9D A;  1WKL A;  4D3H A;  5CD4 A;  3T1H J;  2RNE A;  4UW2 A;  3W8G A;  1AFI A;  2DB1 A;  2Z0G A;  2J8S A;  2KM8 B;  3CCV S;  2UV8 A;  1F9H A;  4CI0 B;  1CJV B;  4I64 A;  4LBH A;  3G87 A;  4NRU A;  1HBO A;  2BZ2 A;  3WX4 A;  2RB7 A;  4B9L A;  4PUO A;  4DR5 J;  1TFY A;  3TZY A;  4S0M A;  3JSR A;  2BV3 A;  4DEZ A;  4J9S A;  4OLP A;  1RWV B;  4B3T F;  1ZET A;  2NXC A;  3CIM A;  2UXC J;  5KFK A;  1TAQ A;  5F8L A;  1MSW D;  4RW6 B;  2ILZ A;  4ED4 A;  2ACM A;  1IWA A;  1FDD A;  2X1F A;  5GAD I;  1UFL A;  1PYT A;  1OQ6 A;  1YJW S;  2PE8 A;  3SDE A;  3R1H A;  2AHO B;  1QD1 A;  1RT4 B;  2E5I A;  3G6Y A;  5C24 B;  4LRE A;  3ZTS A;  5GAG I;  3G8Q A;  3MCN A;  4V19 J;  4QQB A;  2PFF B;  3IO1 A;  4YY3 J;  5D78 A;  2DGW A;  1KWM A;  2EBE A;  2JEJ A;  1GMW D;  3LQV A;  1VOM A;  3PKM A;  1W2I A;  5KFP A;  3LP2 B;  4HLB A;  1P6T A;  2D41 A;  4C8Z A;  4C8Y A;  3LA0 A;  1NND A;  3SFG A;  1R6Y A;  2FIU A;  1CJK A;  1IBK J;  3LAM A;  2FPH X;  1HNX F;  1HMV A;  3RBD A;  3PRD A;  5C25 A;  4BWM A;  3Q22 A;  2BKO A;  4K4X A;  1U1Q A;  2C3Y A;  3BSO A;  1IR0 A;  1OYD A;  4WYL A;  1NSQ A;  1S0N A;  2U2F A;  2WBM A;  3DXS X;  4DF8 A;  1JLB A;  2ZJQ Q;  3T1H F;  4O4R A;  5IT0 A;  4RW9 B;  3BKU A;  2JZ5 A;  1ZA1 B;  2XNR A;  1CPZ A;  2VPY B;  2J0X A;  2XHW A;  3MEE B;  4ZLP A;  2AYE A;  3BBC A;  1NKC A;  4LR9 A;  3QGH A;  1FXL A;  5DZ6 A;  4TU7 A;  1DRZ A;  4ZP9 A;  4E2F B;  2CPF A;  4JI3 F;  1SC3 B;  3I32 A;  4B02 A;  3PFE A;  4F0M A;  5KOX A;  4I7F A;  1S9E B;  5KFJ A;  5IXU A;  4ZDN A;  5B0B A;  4ED6 A;  2DBB A;  3IRX A;  1ZZF A;  1S6P B;  1GQE A;  4YP3 A;  3PYD A;  2VPX B;  3W7B A;  1HBO B;  2PFD A;  4X4O A;  4IFY A;  3TA0 A;  4PUO B;  4CH7 A;  3VAK A;  4ETZ A;  4HAC A;  2BAC A;  2HGN A;  2DTJ A;  4AFF A;  1HW8 A;  5HMW A;  2HPU A;  3ET6 A;  1URN A;  5D77 A;  4YB7 A;  4FP9 A;  1KKH A;  2CJB A;  3OFF A;  2IM3 A;  2EKY A;  5J1E A;  3Q8U A;  4NZ6 A;  1FWK A;  1WHX A;  5F9N A;  1KR4 A;  4X2B A;  1QY7 A;  1Y5L B;  2OSQ A;  3HDS A;  3DRS A;  3SDE B;  3UNG C;  1MRO A;  2AYM A;  2DNZ A;  1W26 A;  1IBK F;  1I3O B;  2C3U A;  5GAE U;  1VQ5 S;  4DPT A;  1W25 A;  1BLU A;  4J9L A;  2QIF A;  3GCW P;  3OXG A;  2HSE B;  4LF8 J;  2BEF A;  4D3G A;  4QW8 A;  1S1U B;  5KFT A;  4E8U A;  1FER A;  3A13 A;  3LO3 A;  1KP6 A;  4DUT A;  4PQU A;  1CJK B;  4IQX A;  2CWK A;  1MN7 A;  4HI1 A;  4ED7 A;  4QIF A;  1X4D A;  1CS4 A;  3KDN A;  4HDG A;  4KFB A;  4GC6 A;  1HWU A;  1FJE B;  1NK6 A;  4DLG A;  2CQ0 A;  1LW2 A;  5ETT A;  3IMQ J;  4WCE Q;  1JLB B;  1XK8 A;  1C1C A;  1LXN A;  1XQI A;  2X7I A;  3HHE A;  3W5Z A;  4RW7 A;  3I5C A;  1KOH A;  4K0K F;  5LOQ A;  4ZN3 A;  4PR6 A;  3G4S S;  1CSJ A;  4DZD A;  5KFN A;  4RBT A;  4XPE A;  3MM5 A;  2ZUA A;  4DV5 J;  2HHU A;  2CUY A;  5CA5 A;  5THW A;  1XNQ J;  2AIR B;  3GV5 B;  3IRX B;  3ZNJ 1;  1OPI A;  1RT5 A;  3J7Y I;  4PZV A;  5I4M A;  1P9Q C;  5CYM A;  1NUE A;  3CXC R;  1R0C B;  3S1T A;  2QYC A;  4DR6 F;  4IFY B;  3KG4 A;  3HD1 A;  2W1B A;  3AD8 C;  1WDD A;  3K0J A;  2F40 A;  1SL0 A;  4ZP6 A;  4OIX A;  1LFP A;  2CPI A;  4FYV B;  4HAC B;  4IOA Q;  3BGF A;  4U67 Q;  2DT9 A;  3CED A;  3DI6 A;  2Y1L B;  4RBU A;  4UF4 A;  3ET6 B;  1S6U A;  3KG1 A;  3KK3 A;  3KJF B;  3AT1 B;  2HIQ A;  2XI2 A;  4RU2 A;  3N5B A;  4NLO A;  4DV0 J;  2M88 A;  3SV4 A;  3D1O A;  2P9C A;  3GCX P;  3CCU S;  4LF8 F;  2VG7 A;  3SQG A;  4NCA A;  4HI2 A;  1U1K A;  3DRS B;  2VV5 A;  3DHW C;  3MAH A;  4ED3 A;  3D54 A;  1Q7L B;  3TJ8 A;  2I38 A;  3DOM A;  1SB6 A;  3PX6 A;  4Q0B A;  3R1L A;  4U6P A;  1EZZ B;  4ED5 A;  2YKP A;  2L9W A;  3K58 A;  5GMD A;  3ENW A;  3GG1 A;  3KMS A;  5H1S V;  2AJF E;  4IRC A;  3O2I A;  2D1C A;  4K59 A;  4PQU B;  1T0T V;  2CIM A;  1SVD A;  4RNN A;  2HNZ B;  4NX9 A;  2K7K A;  2DGX A;  4ILL A;  2IA0 A;  5KG2 A;  2XBP A;  3RW6 A;  5LM7 E;  1OQ3 A;  4MK7 A;  4KFB B;  4BS2 A;  1VRQ C;  5EUH A;  2MZJ A;  4ZCM A;  1HQ2 A;  3KHL A;  2POK A;  4PG8 A;  2PI4 A;  3EX7 B;  3VCD A;  1YKW A;  2XY5 A;  2AYB A;  3NP5 A;  4QIG A;  4NEZ A;  1VQ6 S;  5CCL A;  4LFB J;  3VAJ A;  2F9J A;  3DRP A;  1RT2 A;  2M2B A;  4EUV A;  2KI2 A;  3UN5 A;  2GZO A;  1N56 A;  3QGP A;  5LSO A;  4WPA A;  3DLK A;  2FGO A;  1B0P A;  1P1L A;  4O44 A;  1RT5 B;  3D1H A;  3M6W A;  2DGV A;  1U8S A;  5CYM B;  1H3D A;  1FCA A;  2CG8 A;  2HQI A;  3HT0 A;  3EVW A;  4P2F A;  2XNQ A;  2EK6 A;  2MMY A;  2RS2 A;  1N48 A;  5G0R A;  4DV0 F;  4JI7 J;  1BQM B;  5HJX A;  7FDR A;  2BBE A;  3BM7 A;  1N52 B;  3LP1 B;  4TU8 A;  1K44 A;  1T02 A;  4X4T A;  2ZOM A;  1GK8 A;  5CYJ A;  1X4A A;  3KK3 B;  3D6F B;  1WI6 A;  2MY8 A;  3EVO A;  2ZBR A;  3CSK A;  4P72 A;  2B5J A;  1FJG J;  4B9V A;  2MJN A;  4CO3 A;  3BDE A;  2C2N A;  2IRX A;  3THT A;  3NMA A;  2P9E A;  3BV8 A;  4KGZ B;  2XZW A;  2FZC B;  3SQG B;  2M4M A;  3NKY A;  2IVF B;  4UQG A;  1T7P A;  2PA3 A;  1S77 D;  4OZ2 A;  1HD0 A;  3X3U A;  4TLR A;  3PY8 A;  2HFO A;  5E2Q A;  2KXH A;  3EDR B;  3DOM B;  2R7T A;  1DHM A;  2MZS A;  1KSP A;  2ABY A;  1F3F A;  4PQA A;  2GQ2 A;  2GW8 A;  3X1L B;  5AE1 A;  3TJA A;  3TNV A;  1H2U X;  4BBY A;  3SZ2 A;  2OSR A;  1NSA A;  1FRJ A;  2CQH A;  2ZC3 A;  1NAQ A;  3RRK A;  3JQK A;  4USH A;  3K89 A;  1JB0 C;  3LAL A;  2HAF A;  4DL0 C;  4KHP J;  3GJR B;  1GXT A;  2B4U A;  3GLJ A;  2CQ3 A;  4ZVG A;  4KV8 B;  3THV A;  4LFB F;  2NLW A;  3H25 A;  2W9C A;  3CD5 A;  4NL5 A;  4PCQ A;  3QID A;  1TMJ A;  1T8E A;  3VGV A;  1IN0 A;  1OIA A;  2P6T A;  1Z2L A;  3IWN C;  1YIJ S;  1RAH B;  1RUS A;  2FUG 9;  4J9U E;  1FRL A;  3V6K A;  3CDB A;  1XMO J;  4DPX A;  3R5D A;  5E33 A;  5E3Q A;  4PWU A;  2OI2 A;  5J2P A;  2JNJ A;  4LF5 J;  3KLH A;  3DRP B;  1DAR A;  2HBY B;  3LP0 B;  1FX4 A;  4NEY A;  2XS5 A;  4I56 A;  2WBR A;  3ETO A;  2M5Y A;  2JLG A;  2XGP A;  1RTH B;  3DLK B;  2OH2 A;  4O44 B;  3HVA A;  3SMZ A;  2E7W A;  5CH7 B;  3QWU A;  1RDR A;  2YWH A;  4L73 A;  3BPS P;  5DDO C;  3MED A;  2IVM A;  2KRR A;  1ZM9 A;  1WC4 A;  3EPG A;  4Y00 A;  1HWK A;  4X4Q A;  1TL1 A;  4KB7 A;  5G0R B;  2KM8 C;  2CQI A;  3ZZP A;  4WK3 A;  4O3S A;  4USM A;  1T94 A;  5E3R A;  3TVY A;  4MIW A;  1WG4 A;  2K8G A;  1RT3 A;  4C97 A;  3Q8P B;  3W9H A;  2V63 A;  4OYO A;  2ZVI A;  2VIH A;  4Q45 A;  2HLT A;  4DQI A;  3QSY B;  3T5H A;  4PXE A;  3Q8Y A;  4CLF A;  1NJZ A;  2FHJ A;  3RZA A;  1LOU A;  1T9W A;  3I0R A;  3H5X A;  5IOL A;  3EM1 A;  1VBZ A;  3Q23 A;  4C48 A;  4KHP F;  3VAL A;  1S12 A;  2CPH A;  2E9Z A;  4X4S A;  4J9O A;  4ES2 A;  2B51 A;  3G8S A;  2EI5 A;  5KFV A;  3J80 Y;  2HVH A;  2R7V A;  1RCX B;  1NCL A;  4ENO A;  2UXB J;  1JJ2 R;  3MEC A;  2V4R A;  1YZ6 A;  4FDF A;  3AY0 A;  1OPZ A;  5RUB A;  1UJ5 A;  3CT9 A;  4F3M A;  1C0U A;  1RCO B;  3C16 A;  2H4W B;  1HL6 A;  1VI7 A;  3MMB A;  5ETL A;  1V3R A;  2NQP A;  5ETV A;  3OL9 A;  4OX8 A;  3ETM A;  2RF2 B;  2BJD A;  3Q8V A;  2AZ3 A;  4BLG A;  1GEH A;  2FY8 A;  4DSF A;  1XC9 A;  1RKI A;  4ZN1 A;  3FCW A;  2KN4 A;  4N76 A;  1UVI A;  5EN1 A;  3BGO P;  2WVC A;  5J2P B;  4YFU A;  4K5S A;  3DU5 A;  2QL7 B;  5DQG A;  1I51 B;  2HS3 A;  2AJQ A;  3H2L A;  1HWI A;  2JL9 A;  3A8K A;  4CT8 A;  1REG X;  2AZ1 A;  1R43 A;  2KT3 A;  2DIV A;  2C2E A;  2H65 B;  1RWW B;  1FEH A;  3PHE A;  4YR3 A;  2F5G A;  1QVG R;  3M9O B;  4EFA C;  4C8O A;  4UOC A;  4GKK F;  1U25 A;  4DL7 A;  2CXE A;  5J2M A;  1IVZ A;  1HHQ A;  2HRT A;  1RQ0 A;  1TL1 B;  1RT1 A;  1FRK A;  3D9B A;  1S7H A;  3PJ9 A;  4HR2 A;  3PJW A;  1TL4 A;  3OBI A;  1RT3 B;  1G6B A;  3ENQ A;  2V68 A;  4PEO A;  3ZTR A;  4LF9 J;  2E1C A;  3MCO A;  1JLF A;  2QLW A;  1H72 C;  1REV B;  1PC4 A;  1S1W A;  3IBF B;  1ZS6 A;  2QMW A;  1PGZ A;  1L3K A;  4NE9 C;  1JLA A;  5KFC A;  3TOQ A;  2HEK A;  1D0E A;  1KQK A;  2NS1 B;  1U47 A;  4LR7 A;  3I0R B;  4ZK7 M;  1WD6 A;  2UXB F;  3PG9 A;  3CC2 S;  2A2D A;  1U6Z A;  5H9F J;  4DPU A;  2PO4 A;  4WP3 A;  2V6A A;  5AJ3 J;  4TNO A;  3CIZ A;  5KG0 A;  4JV5 F;  2L9N A;  3JTO A;  2W9B A;  4CP5 A;  2B4V A;  2MKH A;  3MEC B;  4MMO A;  2GIR A;  1Y00 A;  3I56 S;  2HQC A;  3MUV P;  5BJR A;  5A8W A;  3C16 B;  3MMB B;  4XPC A;  3NGR A;  3PHT A;  1P9Y A;  4EYH B;  4UUX A;  4UUW A;  4DN9 A;  1JJC B;  2GVD A;  2VU5 A;  2J0Q D;  4YN3 B;  2HZC A;  1HI0 P;  3HSJ A;  4FYX B;  3C6T A;  4M5L A;  2HQG A;  1S48 A;  2YNG A;  5LXY A;  3T9N A;  1IKV B;  2KKH A;  1HWJ A;  3C15 A;  1RTI A;  1CBK A;  2HFU A;  3PYE A;  3RRH A;  2V8D A;  1ZAW A;  3T1A A;  2HHH F;  5HSP A;  2VC1 A;  3HHN B;  2C1E B;  2DHX A;  3G9C A;  5J2M B;  1IM6 A;  3BN4 A;  1PSD A;  3NNH A;  3G6V A;  4F36 A;  2HGL A;  3TAQ A;  2HFS A;  1IQT A;  2ZWP A;  4DU8 A;  4QPX A;  4Q44 A;  4BC9 A;  1Z4U A;  5I42 A;  4K7Q A;  2CJQ A;  3CUN A;  4LBI A;  3C14 A;  1TEL A;  2RDI A;  4IG0 B;  2E5H A;  3HJV A;  1Y4Z B;  3JYT A;  4LVN P;  3RR7 A;  3OTE A;  1EAY C;  3I6P A;  1GH8 A;  4OHX A;  2DHA A;  2EC2 A;  4Z2X A;  5IQ6 A;  2GGP A;  4FF3 A;  3K8W A;  2VB6 A;  3CWJ A;  4IO9 Q;  3LF0 A;  1YRX A;  4LQ9 A;  3C66 A;  2LLZ A;  1UTA A;  1JXL A;  1H2T Z;  3ZTP A;  3Q2S C;  4ZVP B;  3HZE A;  3I5A A;  5F9L A;  1FJC A;  2ZH1 A;  2EFO A;  2XYP B;  4DSK A;  3M7V A;  4A8K A;  1MLA A;  1S4E A;  2RSQ A;  4GMK A;  5DDP C;  2W2O P;  1FVQ A;  1D09 B;  2ATC B;  1SPB P;  1Y3K A;  2LQ8 A;  5GAE I;  1H98 A;  1APS A;  1IXK A;  4K4V A;  1R27 B;  3QZ7 A;  1TUW A;  1XBW A;  2WB4 A;  1TL7 A;  2KT5 A;  2GC8 A;  3D4J A;  2IDL A;  2CJ9 A;  2PMZ D;  4I67 A;  3N01 A;  1IKY A;  2B9X A;  4FVC A;  1VJQ A;  3D0G E;  4LUB A;  3RJM B;  2GVD B;  2FY1 A;  1RWM B;  3C6T B;  1XNR J;  3DLE B;  3QYY A;  3R3T A;  2EFG A;  3GFY A;  4KH1 B;  4DFP A;  3C15 B;  1SJ4 P;  1UCN A;  2VD3 A;  3L95 X;  4K4Z A;  2YKM A;  4CO4 A;  2XMV A;  3GJT B;  4HTI A;  4KSE B;  2J6T A;  3FQL A;  3KLI A;  2DD8 S;  1UP1 A;  2R2U A;  4M8L A;  2EFN A;  3TVZ A;  4QU7 A;  3CVK A;  3TX8 A;  2IYI A;  5F8H A;  2RAQ A;  3G2X A;  5I42 B;  3E3X A;  4K2J A;  3VGS A;  5DM6 Q;  3R6G B;  3UVJ A;  3BGR A;  4PYD A;  4C4W A;  5LL6 d;  4ZKA A;  4I6W A;  1MNE A;  4KPY A;  2J9C A;  3I4H X;  5A8K A;  3LUY A;  5H9E J;  3JYT B;  4J37 A;  3OJU A;  2BUN A;  2FJA B;  2M7S A;  5T7L A;  1UWB B;  2CPJ A;  1RWU A;  2GGP B;  2QSW A;  4ZA1 A;  3CCR S;  2CQ4 A;  3B8H A;  1C0T B;  4PWW A;  3IA0 A;  1YRU A;  1HI1 A;  2XMW A;  1I94 J;  2KVQ E;  2CDR B;  4NXM F;  2QLB B;  5AT1 B;  3W64 A;  1VK8 A;  4OX7 A;  4ZHR A;  5KG7 A;  1WHY A;  2B7B B;  1BC6 A;  4M5I A;  4CLU A;  5F8J A;  1KBR A;  1U24 A;  2XG8 A;  3SQO P;  3I0S A;  1RAG B;  3IBC B;  1PJ6 A;  1VHF A;  3OPK A;  2F4F A;  3SSS A;  2OLW A;  3UR0 A;  1TL7 B;  1K1S A;  3M6U A;  5M2P A;  4UTG A;  4HL9 A;  3C46 A;  1UMJ A;  1GTH A;  1TK5 A;  1HI8 A;  2OEJ A;  1NSK L;  1IKY B;  4ZMM A;  1BMQ B;  5L9N A;  4JV1 A;  1WF1 A;  2XS7 A;  3FFI A;  5HN0 A;  4DFJ A;  1B7Y B;  5IM0 A;  2UVR A;  2HHV A;  2OHD A;  3HVR A;  1LWX A;  2CNK B;  2DJW A;  3IR6 B;  4P2S A;  1YQH A;  4J9P A;  2D3O R;  3LW5 C;  2GHP A;  2RE1 A;  2BE2 A;  1GX5 A;  1NH7 A;  4KQZ A;  1Z2Z A;  5L9X A;  2RUS A;  1MWY A;  1HHT P;  4OL8 A;  4ECY A;  4J7C A;  2V2Z A;  4MYT A;  5C7P A;  4ECX A;  3KFW X;  3TRG A;  1NDK A;  1DLO A;  2R3V A;  3DLB A;  2Z4P A;  3KLI B;  5HAO A;  4DMZ A;  3I9V 9;  3AH6 A;  3KUE A;  1SKW A;  1HPZ B;  3HP6 A;  2I8E A;  1XR6 A;  2JJ4 D;  3V6H A;  1YBA A;  3HI9 A;  3MM6 B;  2OP5 A;  3UVJ B;  2DK2 A;  2WOM B;  3QNW B;  4OQJ A;  4PPD A;  4JI1 J;  5A8K B;  1XJW B;  2XCP A;  2XEX A;  1VJW A;  2C2O B;  2CWX A;  2D3U A;  4LFA J;  4Q43 A;  4JI6 F;  2MY7 A;  2WON A;  3MTJ A;  3D67 A;  1KLM B;  1K73 T;  1KVK A;  4I6Y A;  5T7L B;  4Y65 A;  3A3N B;  4IKA A;  5KFR A;  4RWW A;  4ECW A;  3MM9 A;  3IAM 9;  3BZQ A;  2DKO B;  3BQ1 A;  5SZT A;  1PKU A;  3KJV B;  5J1P A;  4NI2 A;  3MEG A;  3KTQ A;  2HBZ B;  3C2P A;  1OWX A;  1HBN A;  4PG6 A;  2XMM A;  2JX2 A;  3DKD A;  1U02 A;  1HQE A;  2CRL A;  3NAH A;  4O0I A;  4J9K A;  3FCH A;  3EGZ A;  2O67 A;  2NXN A;  1PJ7 A;  3OLB A;  1YJ7 A;  3AOD A;  2J6S A;  4LT6 A;  4HHH A;  4MT1 A;  4J9M A;  3FGV A;  2K06 A;  4NYP A;  1WOP A;  2UUT A;  2J0S D;  2E1R A;  4ELV A;  1F2H A;  3GV8 B;  1O8B A;  2YPY A;  1Q8B A;  4DPY A;  4M94 A;  1N54 B;  4FBT A;  1BE4 A;  1WF2 A;  5IM0 B;  2LEP A;  4M5J A;  4NLX A;  2F3J A;  2LEA A;  3GIR A;  1Q82 T;  4G6V B;  4QYR A;  4RW8 B;  4O0N A;  1R31 A;  4K4W A;  5CCM A;  3L7P A;  1U1L A;  1ZYQ A;  2IIH A;  2YKN A;  2BE2 B;  2MLY A;  4H4O A;  4ZIT A;  2ZBI A;  3AA9 A;  2LEC A;  2L08 A;  3ENV A;  2CDQ A;  5FD1 A;  1DLO B;  3UD4 P;  4FF1 A;  1H2V Z;  3KLV A;  2AV5 A;  1M1H A;  1YIT S;  4TYA A;  1KFS A;  3RAM A;  4M5M A;  4LF4 J;  4ZVF A;  3M9M B;  4A8Y A;  4HVZ A;  4LFA F;  3HKW A;  4P71 A;  1QDU B;  1V9O A;  3R5C A;  2R8J A;  2Q6C A;  2COL A;  1WSR A;  2YTC A;  1G2E A;  4WBF A;  1FKO A;  3AB2 B;  2OTL S;  3EZ5 A;  3PW7 A;  4IO1 A;  1VYA A;  4OHV A;  3DU6 A;  1X4H A;  2MGZ B;  1CJU A;  4ECV A;  1U0H B;  3PRB A;  2ZEJ A;  3VF0 B;  3SI8 A;  3QSI A;  5AXK A;  1CC7 A;  4NI2 B;  3MEG B;  3PR5 B;  4A8W A;  2CAJ A;  3IWL A;  3R6L B;  2W2M P;  1X0F A;  1R0A A;  4L74 A;  1KNZ A;  1SH0 A;  4JI4 J;  2XGQ A;  4OZJ A;  3DOL B;  4MKB A;  1WWH A;  3CJ2 A;  2KB2 A;  2JH3 A;  2BJ8 A;  4X4N A;  3CD6 S;  3DDN A;  3FEZ A;  1RAC B;  4RWX A;  1R6V A;  2RIL A;  1LKZ A;  3TR5 A;  4JI5 J;  4W92 B;  3V81 A;  2OGU A;  3SFU A;  1WUU A;  2MQ8 A;  2BDP A;  3AJ1 A;  2QT7 A;  1HNZ J;  2I9S A;  1RHM B;  3R5J B;  2QRR A;  4B3R J;  1YVF A;  1S99 A;  1BUX A;  3HPO A;  1KN6 A;  1RHQ B;  4DR1 J;  5EGY A;  5HK4 A;  3BSN A;  2QTW A;  1TFW A;  2DNG A;  4LF1 A;  4OYX A;  2RS8 A;  2CVE A;  4FS1 A;  3JAM U;  2YKN B;  4LF4 F;  4OZ5 A;  1MWQ A;  3GG0 A;  2WRM A;  1IR2 A;  3GYX B;  1NK5 A;  2VQE F;  3M30 B;  4ZJO A;  4NAS A;  1PYO B;  4UY8 5;  1NJY A;  2QN6 B;  2ZH5 A;  3GSD A;  3ISZ A;  3HFK A;  5D4P A;  4RJV A;  2RHQ B;  4LRF A;  2CVI A;  3I4P A;  4ECQ A;  3Q0A A;  1U09 A;  2HS4 A;  4NXN J;  2I5J A;  2AGO A;  1FKO B;  1ULR A;  1IKX A;  3MUR P;  2RH3 A;  1LWF A;  2MEW A;  3PYG A;  5KFS A;  1IJF B;  1QSS A;  3KJN B;  3UN3 A;  2ZVS A;  3M2R A;  1VQK S;  3NEK A;  5KOW A;  1U1N A;  4JI4 F;  1YRT A;  2NYH A;  4OJ1 A;  4H4K A;  3D7S B;  4N47 A;  1HR0 J;  3JB9 k;  2XSF A;  4RL1 A;  2FB0 A;  3MPU B;  4FF4 A;  2LCW A;  2YNH B;  4IRK A;  4EYI B;  2CQD A;  3U1N A;  2CG4 A;  3POT B;  1R0A B;  1XMQ J;  1JLQ A;  2WVE A;  5E3C A;  2CPX A;  2GIF A;  4B3R F;  2EVZ A;  4F4K A;  1TZ0 A;  5CXT A;  1UZH A;  4X65 J;  4RO0 A;  3CO9 A;  1UEK A;  2JEG A;  3J7Z T;  3VZH A;  2HS0 A;  5KG6 A;  1GMV A;  2DO0 A;  3UNY A;  2ROG A;  4DG1 A;  3B54 A;  3DYA A;  3T6J A;  1RAA B;  3DLJ A;  1KHV A;  2FVC A;  2HW3 A;  1HNV A;  2E1M C;  3MOJ B;  2ZKU A;  4NA2 A;  5D4L A;  3B4M A;  1SIW B;  4F04 B;  4ZLJ A;  1YJN S;  2ATL A;  2DIU A;  1YK9 A;  2RU3 A;  2OMO A;  3Q8R B;  3OVA A;  1Q81 T;  3DDI A;  2ZJR Q;  4KAI A;  4MJK A;  3HD2 A;  4ZCL A;  4IUF A;  1NJX A;  4OHY A;  4WZQ A;  3G82 B;  5KFQ A;  4KRW A;  3V6J A;  3HJF A;  4FXV A;  1FRH A;  2E5L J;  3MMJ A;  4QIW D;  3RB6 A;  2RJZ A;  3VGT A;  2J9E A;  4C98 A;  3N79 A;  2CYY A;  3BKT A;  9RUB A;  4I6A A;  3TUJ C;  4CIO A;  2E9T A;  3JQJ A;  1IBL J;  2HK3 A;  5A6P A;  3QPI A;  4UST A;  1G4C A;  5HMY A;  2YQ3 A;  2ZOG A;  2AKW B;  1HR0 F;  5H9F K;  2YY3 A;  5DRK A;  4KHR A;  1BY9 A;  1IWG A;  4OI3 A;  1LWF B;  1RHR B;  4EO8 A;  2ZDO A;  3M8W A;  4EO6 A;  3ILL A;  3MUM P;  3M2R B;  4FKX A;  4Q5V A;  3OLA A;  4PG5 A;  3H98 A;  4AL6 A;  1GTE A;  1F2G A;  2AD9 A;  1S1T A;  3U1L A;  1A7G E;  4F4W A;  2LYV A;  4F2R A;  2QFJ A;  3BR9 A;  1WKJ A;  3IG1 A;  1P27 B;  2DH8 A;  3QIP A;  5JVH Q;  3N6N A;  5KFZ A;  3R8Y A;  3M05 A;  4ZPW R;  1SJF A;  4F4X A;  1JLQ B;  4IH7 A;  3KLG B;  4HDH A;  5B09 A;  1NDC A;  3CJ0 A;  3BQ2 A;  2LA6 A;  4H4M A;  4MIA A;  1PO6 A;  2QZ8 A;  4KO0 B;  2OML A;  4C3K A;  1DAX A;  1URR A;  1C2P A;  3WC2 A;  5JUM A;  1QAY A;  4DG1 B;  3DYA B;  1PG5 B;  5ITH A;  1Y5N B;  4IH6 A;  5FLX Y;  5D0E A;  3M2V A;  1HNV B;  4KGK A;  1RTJ A;  2BKN A;  3CJ3 A;  2E5L F;  1B0T A;  4PKD B;  1T03 A;  3HHL A;  3ZZY A;  4IH5 A;  3QQC D;  4PRF A;  3I31 A;  2BAN B;  2XSJ B;  4DUZ J;  4Z7C A;  2CNN B;  5HQL A;  2RDJ A;  4KGM A;  3E8O A;  4OX6 A;  8AT1 B;  5D4N A;  4OYZ A;  2PI5 A;  3GII A;  1CEZ A;  1RTD A;  3NS6 A;  4I2P A;  3B82 A;  4V1A k;  2C2R A;  4EI2 A;  4EZ9 A;  3ISN C;  2K3I A;  3UQS A;  4CQ1 A;  5LT5 A;  2Y1J A;  4LRC A;  4ELU A;  4QJV A;  1BQN A;  2KG0 A;  1TL5 A;  1B0V A;  5GAH U;  5CQG A;  2Z2Y B;  3GYN A;  2UVV A;  2BQU A;  1FDN A;  1FXR A;  3QJJ A;  3EDQ B;  5KFW A;  2CQC A;  2R8I A;  1JLE A;  3IP0 A;  5B0E A;  3CO0 P;  5F41 A;  4AE5 A;  2B7C B;  2C2K B;  2XMT A;  4WWS A;  1JLC A;  5D3G A;  1X4C A;  3ZTO A;  2KU7 A;  4IG3 B;  2F8E X;  5I3Q A;  1AW0 A;  2DRA A;  2JFD A;  2ZHO A;  4FYW B;  2BR0 A;  2YXL A;  2CJK A;  1FHT A;  1NEE A;  4B3S J;  5M2R A;  4P10 A;  3PO4 A;  2L48 A;  4TVA B;  2DXE A;  2X1B A;  2OTJ S;  1KVI A;  2GQQ A;  3CD7 A;  1QVF R;  3VVU A;  1VRU A;  4DR3 J;  1E6V A;  3P6Y C;  2DR5 A;  1S1T B;  2E1A A;  2H5E A;  4CLK A;  1TL3 A;  4NWB A;  3IG1 B;  3QIP B;  5B0D A;  1IM4 A;  1F60 B;  2HVI A;  1RSC A;  1RAE B;  3HSG A;  4HKQ A;  4CLW A;  1DTQ A;  4J9R A;  4ECU A;  4B08 A;  4DR4 J;  3F0N A;  4H4M B;  2EG1 A;  4DR7 J;  4WE1 A;  2W9A A;  5DQH A;  2EC0 A;  4CTA A;  1VK3 A;  3BH7 B;  3H5U A;  4DBQ A;  2QMX A;  4DUZ F;  2BAB A;  2YX1 A;  3O3L A;  2HAI A;  3PNI A;  4TU9 A;  1OMS A;  5JJB A;  1Q4R A;  1NKB A;  2HLU A;  1RTJ B;  2WVD A;  1BWV A;  3ISN D;  3HHL B;  1VQN S;  3P96 A;  1BHN A;  1UEV A;  1NRK A;  1DJ0 A;  3QAE A;  4DZ6 A;  2OPS A;  2BW2 A;  4PPZ A;  1G1X A;  4YR0 A;  2LKZ A;  5B7W A;  2XHC A;  1ZOT A;  3PYF A;  3H0P A;  2FDN A;  4B9U A;  3G86 A;  3NBP B;  4JI2 F;  2WTF A;  5LSR A;  4WK1 A;  4CLT A;  3BDP A;  3GU0 A;  1X4G A;  3KWM A;  3MZI A;  1BQN B;  2DHS A;  2DNH A;  2E7X A;  1YJV A;  1EX8 A;  1MN9 A;  3TO8 A;  1HNW J;  3OL8 A;  4B3S F;  5H9E K;  1N0V C;  3KK2 A;  2QSF A;  1JLE B;  3H8Y A;  1TV6 A;  3US5 A;  5D3G B;  4DR3 F;  2W4C A;  3AD7 C;  2DHH A;  3P5T L;  2OUG A;  1RTZ A;  1JXV A;  3F41 A;  4QWA A;  2ROE A;  4F26 A;  4LFC J;  2QGF B;  4L75 A;  2VZ9 A;  2UUW A;  1ROF A;  2I0X A;  4RW6 A;  2DEI A;  4C2M A;  4P73 A;  2UUC F;  1U2R A;  1RBA A;  4HH0 A;  1VRU B;  4BC7 A;  2MQL A;  4JV0 A;  1E6V B;  4OI2 A;  4RX6 A;  1MMD A;  3VGU A;  5ETQ A;  3PVX A;  1T9V A;  4DR7 F;  1H7W A;  1VBK A;  2W2N P;  1S1V A;  4DPW A;  2C3O A;  2DHG A;  2ZNY A;  1U48 A;  2H5I B;  2QEX S;  2DEJ A;  3OT9 A;  2A3J A;  1XN9 A;  1DQ9 A;  3AQP A;  3W60 A;  3BO4 A;  2XZD B;  3TA1 A;  2V8H A;  1VQ7 S;  2KJV A;  2OEL A;  1Q7Y T;  1DTQ B;  1YG0 A;  3O5T B;  1EHW A;  3CDU A;  3TZZ A;  1D8Y A;  4WE1 B;  4QOT A;  4WJB A;  4R0E A;  1L3T A;  4KYZ A;  4CTA B;  1J27 A;  5F0W A;  2FLP A;  4N8O A;  4Q2M A;  2PMW A;  4WU3 A;  2XZT B;  4KTQ A;  1E6Y B;  3R5G A;  4ICL B;  3CJ8 A;  1UZD A;  3MXH P;  1UWA A;  1U2F A;  2MST A;  5D15 A;  1S0O A;  4QBU A;  2J7W A;  1OO0 B;  4CRJ A;  4QWB A;  2UUA J;  5KT3 A;  3O44 A;  4RW9 A;  3RG6 A;  3QGI A;  2FZG B;  3KUH A;  2OPS B;  3MM8 A;  4DV6 J;  3KYL A;  2LU2 A;  3R7S B;  3NL0 A;  2E5J A;  3CJQ A;  1HNW F;  2N3L A;  3FMW A;  2FLL A;  5IT9 U;  2L9D A;  3T5J A;  2NPF A;  2CA9 A;  3H5S A;  1HAR A;  1Y5I B;  1OSD A;  2BW7 A;  1AUD A;  1S9E A;  2HND A;  1SJ1 A;  2VJU A;  1UJ6 A;  3UO0 A;  1TP7 A;  1QAJ A;  3L09 A;  2HHW A;  3FRY A;  2ZH7 A;  4DV7 F;  1S6P A;  1HA1 A;  4K50 A;  1K1Q A;  4LFC F;  3NGU A;  3CNQ P;  1D9A A;  5DLG A;  3AD9 C;  2R7U A;  2XYG B;  4CLZ A;  3HM9 A;  3KK2 B;  1HBU B;  1K0V A;  3GJQ B;  3HXM A;  5KFG A;  4DV2 J;  1SQE A;  4F4A A;  3GMG A;  1C4A A;  1TV6 B;  3W66 A;  1Q0N A;  4DV4 J;  5CAA A;  1RE1 B;  4KC5 A;  1GMW A;  4R8U B;  3UDL A;  3M2U A;  3NOG A;  2OAU A;  2GO9 A;  2MZ1 A;  5HLF A;  3AXM A;  3P49 B;  1FE0 A;  4KR0 B;  1BWE A;  5BR8 J;  3W8P A;  4XTT A;  2LXI A;  4OI6 A;  4F0H A;  2EKN A;  1IR1 A;  4EBC A;  4DX6 A;  1RGV A;  2J8A A;  1V5I B;  2VC0 A;  4Q7A A;  3GV7 B;  2Z2Z A;  1WOO A;  4QU6 A;  3NNC A;  1S1V B;  2V8P A;  2V2Q A;  1M5K C;  1WTF A;  4OYA A;  3WZ0 A;  1KC8 T;  4XO0 A;  3RW7 A;  2BJ3 A;  4QYZ K;  1VBX A;  2ERR A;  1N0U A;  4PXD A;  3H90 A;  1DY3 A;  4C3M A;  2XS2 A;  4YUD A;  3KDO A;  5E5N A;  3HLU A;  2DR9 A;  1S1U A;  3N28 A;  2D3Z A;  3A3P B;  5IC4 B;  1GT8 A;  5L1I A;  3AHP A;  4DV6 F;  3BO2 A;  3GFX A;  3CJ5 A;  2K1R A;  3GTY X;  2YH0 A;  3AA8 A;  2G13 A;  2VBX A;  4JI0 J;  1RWO B;  1VRT B;  4DR2 J;  3RBE A;  3FK4 A;  5KFX A;  4A8X A;  1ZH5 A;  1M5S A;  1RB0 A;  5B08 A;  3LAK A;  5GAG U;  1QUP A;  1TKX A;  2XMK A;  1OY9 A;  4FS2 A;  3R2D J;  3MM8 B;  3ULH A;  2F4V J;  3DRX A;  2W8K A;  4KKO B;  2X3D A;  2EWH A;  2WSC C;  4FXW A;  4DV2 F;  1X0P A;  2YWW A;  1SH2 A;  2W01 A;  3A4T A;  4DR5 F;  4DSL A;  2WW8 A;  4Z37 A;  5KFE A;  2HND B;  4DV4 F;  2VBY A;  2OEK A;  1SXL A;  5CZX A;  2UXC F;  1NJW A;  1YJ9 S;  2DRD A;  3HFZ B;  2ADC A;  2ALY B;  1TKD A;  1T95 A;  3EGW B;  1S9F A;  5HQM A;  2N82 B;  3JAM Y;  3DLG B;  2R9L A;  3QO9 B;  3CPW R;  2GAH C;  3T6B A;  3VTI A;  1IQZ A;  3S01 A;  3PW4 A;  5LJ3 Y;  4DPO A;  1YHQ S;  2PII A;  3M2U B;  4OV1 A;  1VQO S;  5L1K A;  4E98 A;  1OY6 A;  2FLN A;  4L6V 3;  2DIT A;  2RIJ A;  1VQM S;  2W24 A;  1VC5 A;  3MPW A;  3R5B A;  5HLF B;  1K8A T;  4AND A;  4CNY A;  3MAA B;  2ZHB A;  4P7T A;  2X1G A;  1TVR B;  4PG7 A;  4YY3 F;  2NXJ A;  1M5H A;  1U6F A;  2HVE A;  3BSC A;  3GB0 A;  4KE5 A;  5IV4 A;  1H0H B;  3ZXW A;  1TUG B;  1X9M A;  3RB0 A;  1UFK A;  2HWI A;  2LDY A;  2IM1 A;  5F8M A;  3TEH B;  1X9W A;  1YJU A;  2GAG C;  3MPY A;  3NNA A;  5ETP A;  4JI0 F;  4Y3C A;  1L3V A;  3EZU A;  4CLY A;  2N4C A;  4A46 A;  2VPW B;  1HHS A;  3FNN A;  2WSE C;  1ACM B;  3HFV A;  4CM2 A;  1ARO P;  3TUZ C;  2VL1 A;  3IWX A;  4P9S A;  2HNZ A;  2K1R B;  4LSL A;  2HFZ A;  4ZP8 A;  4WP8 A;  2AJ0 A;  4URS A;  3NXZ A;  2VDI A;  5KT6 A;  1B7F A;  1DQA A;  2IM2 A;  1HQU A;  1S72 S;  7FD1 A;  4M5D B;  4G1Q A;  4C8L A;  2P8I A;  4CO1 A;  2RQ4 A;  1TKX B;  4USW A;  3BGL A;  1WG5 A;  4JOU A;  5EWE A;  4CNZ A;  2XYH B;  2OEM A;  3WHI A;  2ASD A;  2RRN A;  4ZVS B;  2XLI A;  2Q79 A;  2H48 B;  2CPD A;  4MK8 A;  2JLE A;  1M5P C;  2EK1 A;  2MQQ A;  2DH9 A;  2HUR A;  3LGN A;  2CPZ A;  4ZVR B;  2N4D A;  1FES A;  4ZVO B;  3A8J A;  3ZFV A;  2H4Y B;  1PBU A;  2E29 A;  3EE3 A;  4F25 A;  1ZTT A;  1BQM A;  2FJV A;  1FO1 A;  4B3O B;  3ELH A;  2KJW A;  3LP1 A;  4TQR A;  4U9R A;  2UUB J;  3QFH A;  5KG1 A;  5L8R C;  3TVK A;  4FZV A;  1M90 T;  2D69 A;  4FYY B;  1YJT A;  2BM0 A;  2YKQ A;  4GO7 X;  4N8N A;  2YNI A;  1JJH A;  2B9W A;  2DXF A;  2ROP A;  3ZC4 A;  5G4D A;  2HFV A;  4CLL A;  3IGN A;  1A0O B;  2VQF J;  5HQ8 A;  3E01 A;  1HIY A;  2CQG A;  2B9E A;  1RHU B;  1UPP A;  3VR1 A;  2O1P A;  2DVI A;  3GP9 A;  4HYK A;  2YKA A;  4NCB A;  5HO4 A;  2AGQ A;  5IS2 A;  1LWC A;  2DNM A;  1P1T A;  2C3M A;  4IR9 A;  4OFZ A;  1N5T A;  5DET A;  3G8T A;  2EFP A;  3H59 A;  4DUY J;  1F6T A;  4G65 A;  3NWR A;  2P6S A;  1Y3J A;  1DFD A;  3VQT A;  4WYW A;  4DLE A;  4NZ0 A;  1NK0 A;  2B4P A;  1H38 A;  1VQL S;  2DNN A;  4UQT A;  2DPI A;  4RU9 A;  3PO5 A;  4KV8 A;  2GNK A;  4LSL B;  1FTC A;  1VQ8 S;  2HMI B;  1RAI B;  2B9Y A;  1RJJ A;  4WTY A;  5KAK A;  2XWY A;  2RQK A;  5IFM A;  5CYQ A;  2HHX A;  1OY8 A;  4K4U A;  3L9Z A;  4TN2 A;  2W8L A;  3C19 A;  5A76 A;  3DXB A;  1HQU B;  5LMN J;  2CZ4 A;  4G1Q B;  4DV5 F;  1B4S A;  2UVU A;  2FJX A;  5HJY A;  3ZZO A;  1XNQ F;  1H7X A;  3CTR A;  3T19 A;  1FWP A;  2AX0 A;  3VAG A;  1UPM B;  4ZJQ A;  1NJI T;  3Q89 A;  3HHL C;  3H7H B;  2Q43 A;  2E44 A;  1PYS B;  3LP0 A;  1RLC L;  5DG9 A;  2ZZN A;  1JNZ B;  2QLF B;  1V3Z A;  2W7P A;  2V67 A;  1RTH A;  4I69 A;  3JSM B;  2J76 E;  2PN6 A;  3UDC A;  4DQR A;  4OYB A;  4A47 A;  5HVF A;  1NDL A;  4IDK B;  4XAK A;  5K20 B;  2X3G A;  1TK8 A;  2O3D A;  4LSZ B;  1FRM A;  3PX0 A;  3DOK A;  1TK0 A;  2VA3 A;  2GQC A;  5DDQ C;  2DNQ A;  3HX9 A;  3H5Y A;  3FZB A;  3AXK A;  1ICE B;  3B78 A;  1S49 A;  2M8H A;  4OLO A;  4CM0 A;  5BYR A;  2WVB A;  2V2K A;  1KEK A;  2ZE2 A;  2DNL A;  1LWE A;  5HVH A;  2KFN A;  2YNI B;  3D6M B;  1NZA A;  2Q3P A;  4F8R A;  2CQB A;  1H73 A;  2BRL A;  2MQN A;  2MXY A;  5AE2 A;  2BMB A;  1O0P A;  3E01 B;  4FVM A;  3IM8 A;  4OI1 A;  4U7C A;  1U8W A;  3M8P A;  1UA0 A;  2MLZ A;  4DSI A;  4M5G A;  1LWC B;  2XCA A;  3OJS A;  2AGP A;  4U8V A;  5F0U A;  3BQ0 A;  2C2D A;  3LWM A;  4M5K A;  1FNX H;  1MU2 B;  2HK2 A;  1AYE A;  5I3P A;  2HQF A;  5L46 A;  2YPZ A;  2V8V A;  3M8R A;  1R7I A;  3CC4 S;  1SUQ B;  2XI3 A;  3M4X A;  1F9F A;  4QZV B;  4G3I A;  3CCJ S;  1NK8 A;  4OZ0 A;  5J2N B;  2KZZ A;  2YQ0 A;  1S6O A;  4DDF A;  4GVL A;  2QL9 B;  1ZAV A;  2FLO A;  3NGS A;  4UZB A;  3BEG B;  5CYQ B;  2RF2 A;  2QFI A;  5KT5 A;  5KFA A;  1QTN B;  4LQ3 A;  4ZOS A;  4ES1 A;  3P3D A;  1B3T A;  4UOG A;  4MTP A;  4ITS A;  2BVZ A;  1NH8 A;  3M1V B;  3ICL A;  3TP2 A;  3DLH A;  3OHA A;  4K5R A;  1CQN A;  1CLF A;  1U1P A;  3DRR A;  3W62 A;  3MM7 A;  1BQX A;  4K4Y A;  4JI7 F;  4CDI A;  3KJQ B;  3QLH A;  5HBM B;  2R2S A;  3IGV A;  3A8E A;  2MHE A;  4AUK A;  1ZAX A;  4RKU C;  3NAI A;  5BYQ A;  4N41 A;  1N5S A;  2XQC A;  2KTQ A;  4DL6 A;  1FJG F;  3QGG A;  3QWP A;  2B56 A;  1RLD A;  4DS5 A;  4QIV A;  4Y2C A;  3DOK B;  1WC1 A;  1D3W A;  2B6A B;  5U47 A;  2R7O A;  2XC9 A;  4LBP A;  2RUG A;  1SL1 A;  2RDD A;  1Q53 A;  3C6U A;  3CME S;  3OTC A;  1FD2 A;  2A1B A;  1D9D A;  1CJT A;  3MR3 A;  2HVZ A;  2Z56 B;  2VFT A;  5K8O A;  3H4D A;  1VQ4 S;  3ILJ A;  3OXF A;  1REV A;  2FYX A;  3QRR A;  5HL7 Q;  2ZE2 B;  1LWE B;  5DQI A;  2I2Y A;  3W2V A;  3KHG A;  1NPR A;  3OR1 B;  2HBQ B;  3CCT A;  4ZIW A;  5EX0 A;  2RKI A;  2VG5 A;  3VZI A;  4EMD A;  4DFM A;  2R8G A;  3M8P B;  1SC1 B;  2MB0 B;  3EGN A;  2IAJ A;  4A8O A;  2SXL A;  3E2E A;  4ATN A;  2VKZ G;  5K9F A;  1KHW A;  3JXO A;  2ZH9 A;  3BBB A;  4NLY A;  3WIU A;  3EPI A;  3M8Q A;  2JVR A;  1NHV A;  3D3B J;  1XMO F;  1SQF A;  2Y8W A;  4LRD A;  4P2X A;  3UPF A;  4LF5 F;  5AXM A;  2U1A A;  2PA8 D;  1KTV A;  2VBW A;  1FKP A;  2YVS A;  2NSC A;  2IJF A;  2B3T B;  3R7B B;  2NZC A;  3M6X A;  1VLY A;  3J80 U;  3JSB A;  5KTQ A;  4UOH A;  2ZBC A;  4OHZ A;  4LIR A;  2UZA A;  5A2Q U;  3BBF A;  3RYL A;  3V6D A;  2N3O A;  4B3T J;  1F3V A;  3DRR B;  2J5A A;  3MM7 B;  4USU A;  1NPP A;  3R97 A;  1IKV A;  1RP5 A;  3QLH B;  2H5J B;  1GXU A;  2OPP B;  1PC5 A;  2ZM6 J;  4DU7 A;  2FHM A;  2G0I A;  4C9D A;  3K57 A;  1T3O A;  3IBW A;  2B0G A;  2LU1 A;  1AZS B;  6AT1 B;  1AXQ A;  1TAU A;  3C6U B;  4AXJ A;  3AOA A;  3RTV A;  1CJT B;  1U7L A;  5K8M A;  2KL8 A;  4ECS A;  4HT5 A;  4O3Q A;  2LQB A;  4F3O A;  1U4B A;  1YDL A;  2BRK A;  2MKK A;  4IG0 A;  1K47 A;  2XMA A;  5KFM A;  3R5A A;  3D68 A;  2OPR B;  3BRE A;  4TY8 A;  3W2V B;  2C22 A;  2DR8 A;  2IVY A;  2DPJ A;  3DGV A;  2IPO B;  4B9T A;  4DF4 A;  2RKI B;  1HNX J;  2VG5 B;  4WII A;  2I1R A;  4MFB A;  5E41 A;  3GSI A;  2ZIT A;  2IAJ B;  1UET A;  4JB8 B;  5L38 A;  1TKZ A;  4ZLN A;  1F1B B;  1Q16 B;  3FEY B;  3GYG A;  1UVL A;  1RT7 A;  1TTH B;  1RZM A;  1JLG A;  1FVS A;  2NXU A;  3ZZU A;  4ZP7 A;  3M8Q B;  2G2O A;  4DN0 A;  5A0Y B;  4WFB Q;  2QG9 B;  4ZIV A;  4TXS A;  2IRU A;  4M63 A;  5IQQ A;  2CKW A;  4JI3 J;  2MLX A;  1PBA A;  1XMB A;  1X5P A;  1Q8I A;  4NLW A;  1FKP B;  2LP4 A;  2HHT A;  1U1O A;  2HZA A;  3MFH A;  1S0M A;  4TY9 A;  2XB2 D;  1WHV A;  3TUI C;  1SH3 A;  2YX7 A;  1WKK A;  4NLG A;  4R0J A;  2B8Q A;  2ZM6 F;  3AJ2 A;  2ZKT A;  4KHM A;  1HW9 A;  2V5H G;  3V6D B;  1FTR A;  3OQ2 A;  3DLE A;  3D28 A;  4P75 A;  1D8Z A;  2O5D A;  5HI7 A;  3KHR A;  1SI9 A;  2VDH A;  1T11 A;  1X4E A;  2A0F B;  2JLF A;  5DJB A;  2X51 A;  1VR6 A;  3VAM A;  3A1Y G;  1WOS A;  5JMN A;  5HMX A;  4LF9 F;  2OO4 A;  4YB1 P;  1Q8K A;  1JKH B;  2ILY A;  4OI0 A;  1VIX A;  4DI6 A;  3W9I A;  3AOC A;  3OVB A;  4BDP A;  2FJE B;  5L1J A;  4O4G A;  1NM2 A;  4QR2 A;  4K4S A;  3I82 A;  2WCX A;  4NMX A;  3FZ2 A;  2ZFH A;  2CFX A;  3UW1 A;  1X7V A;  1MML A;  1N32 J;  4FPR A;  2PEB A;  5EWF A;  1SQG A;  2BE7 D;  5AJ3 F;  3HSZ A;  4ZVQ B;  2RD5 C;  4TY8 B;  2AJ2 A;  1U49 A;  3QFW A;  5KFO A;  4F0K A;  2W7O A;  3M8S A;  3N4W A;  1RWP B;  1UWB A;  4AT1 B;  4MFB B;  1FDB A;  3JQM A;  2OIH A;  4OYP A;  4FYD A;  3ZNU A;  3DMJ A;  4U95 A;  1C0T A;  5LXR A;  1WI8 A;  1TKZ B;  3I87 A;  4KPC A;  3N5F A;  1RT7 B;  1JLG B;  5ETO A;  1EKR A;  3KLF A;  1UKU A;  2MPU A;  1UVN A;  4U7U K;  2R2T A;  3QJP A;  2BQ3 A;  2HZV A;  4K0K J;  2ASL A;  4Z7Y A;  1DZ5 A;  3LAN A;  4LR8 A;  3MFI A;  2BQR A;  1RAB B;  1R8C A;  2G2Y A;  3RB3 A;  4ZLL A;  1XIQ A;  3TAM A;  3BKF A;  2FJB B;  1VQ9 S;  1QUV A;  4L3N A;  1NB7 A;  3AAW B;  2A18 A;  3BO3 A;  3EIC A;  2E7V A;  2YWE A;  2IJR A;  3D6H B;  2LDI A;  4WIQ A;  4DR6 J;  5DDR C;  1RI7 A;  1SBR A;  2IBK A;  3SSR A;  2WK4 A;  3QZ8 A;  2QA1 A;  4OZ1 A;  3ILI A;  4ZJL A;  2O66 A;  2E1P A;  5KFD A;  3PZP A;  3TQ1 A;  3K17 A;  4AXI A;  1I6J A;  3P4U B;  3WQP A;  1N88 A;  2LMI A;  3WDO A;  1MW7 A;  3CB4 A;  4YDX A;  2M70 A;  4ID5 A;  4QPT A;  4FKY A;  2YBV A;  1XER A;  2R7X A;  1RHJ B;  5KT7 A;  1N32 F;  1LFW A;  3T41 A;  2J7U A;  3MR6 A;  1ZM4 A;  1S76 D;  2DNY A;  1RYS A;  2JC0 A;  3OHB A;  3GR1 A;  4EBD A;  1HPZ A;  4O4G B;  1FEE A;  1TR0 A;  3TZW A;  2K2P A;  5HMZ A;  2KFZ A;  1HMV B;  2P2C B;  3MM6 A;  2RRA A;  2GHV C;  1R8H A;  5C25 B;  4EBE A;  3GZ7 A;  3W65 A;  3QRQ A;  1U26 A;  3DC2 A;  1DTT A;  2WOM A;  2VOP A;  1WC6 A;  5DS7 A;  3PW0 A;  4NLS A;  3TX0 A;  1BXN A;  1M1G A;  3D2W A;  1YJR A;  2AJ4 A;  2H54 B;  4LRA A;  1V6H A;  3PFO A;  1KLM A;  2QV6 A;  2VH7 A;  2WSF C;  1NHU A;  2R2R A;  2PGC A;  2KXN B;  1N34 J;  3DMJ B;  2QJ3 A;  1EKS A;  3AJD A;  3P8B B;  3KJV A;  4MYU A;  4ID8 A;  3SV3 A;  4LJM A;  4I7F B;  3AOB A;  4ZPC A;  2JEF A;  1NDP A;  3NCR A;  1MWZ A;  3T9Z A;  2HFN A;  3EGV A;  1FE4 A;  2GCF A;  4YEA A;  3K59 A;  3KLF B;  2GMH A;  4DFK A;  3L4B C;  5MLC V;  1HNI A;  2KYZ A;  2IFX A;  1M5O C;  2W25 A;  4G1P A;  4HHU A;  4X64 J;  4DHV A;  1XNR F;  3TAM B;  2X1A A;  1GXL A;  1CQM A;  2LFV A;  3D3C J;  3CC7 S;  3CCZ A;  2OKQ A;  1A9N B;  4I2Q A;  3QJL A;  4JV2 A;  2W4D A;  3HSD A;  4YOE A;  5EDW A;  4WF9 Q;  1SKR A;  4RW8 A;  3UN2 A;  4CO5 A;  3IXQ A;  4DV3 J;  1MMN A;  5J1E B;  1LNQ A;  1J2V A;  2H3E B;  5SUH A;  2GML A;  1M0S A;  1N5V A;  1MRO B;  5DG8 A;  2BYC A;  2EXU A;  3EZO A;  3H2V E;  3PXG a;  3A8I A;  3K7R A;  5AXN A;  2B8P A;  2V9W A;  4ID5 B;  3KK1 A;  3FC9 A;  3BYP A;  4Y2I A;  4MKV A;  3DCA A;  3W2W A;  1WC3 A;  3AFG A;  2Y1I A;  3Q83 A;  4AD6 A;  2Q66 A;  2F8M A;  1RYR A;  4YDD B;  4Y28 C;  5CZV A;  1HKA A;  1WEX A;  4URQ U;  1WHW A;  4PAA A;  3QMQ A;  1QSL A;  2QC3 A;  1VMB A;  2JWN A;  2BJ7 A;  3M32 A;  3IN5 A;  1FFW B;  1CS4 B;  4HH1 A;  2NYI A;  3CE8 A;  1N34 F;  1DTT B;  2BOP A;  3OTB A;  1LW2 B;  3Q86 A;  4NLQ A;  1I94 F;  3OVS A;  4LIW A;  5K8N A;  3VV2 B;  2MZT A;  2MGZ A;  4P6Q A;  1C1C B;  2W7A A;  2ZOF A;  1U0H A;  3W9J A;  3W61 A;  2JC1 A;  3QRP A;  1UVK A;  4RW7 B;  4O3N A;  4A8F A;  1UW4 A;  2C3P A;  3MCS A;  4NLT A;  4AL5 A;  2GX8 A;  4X4R A;  1SL2 A;  4X4V A;  1KQF B;  3MM5 B;  4X64 F;  1QAI A;  4Y2K A;  2PEH A;  2RML A;  2D9P A;  2UVW A;  3PDN A;  1FKA F;  1TU0 B;  2NCK L;  2ZZT A;  5J1N A;  3M8Z A;  4B3M J;  3KXD A;  4O3R A;  1QSY A;  3DOL A;  1X60 A;  2D7S A;  3CD0 A;  3OTD A;  1HNI B;  4ZVU B;  2VAS A;  2NUU G;  4ALZ A;  2VPZ B;  5MAO A;  2CJA A;  2DRB A;  3LTO A;  4EK2 A;  3SSQ A;  4DV3 F;  2PMH A;  2KYX A;  4Y34 A;  1FNO A;  3DM2 A;  3CGI A;  3DDK A;  4YR2 A;  3Q2T C;  3LGM A;  1XEZ A;  2V0N A;  1FI4 A;  1JMT A;  2WW4 A;  1YGY A;  3DI6 B;  1FA0 A;  3PKY A;  2L41 A;  4F7V A;  2DR6 A;  3FBE A;  1NK9 A;  4I2Q B;  2DIS A;  3AQO A;  2RVJ A;  4ZPD A;  2G0C A;  4DWI A;  1SV5 A;  2MZQ A;  2J0W A;  3R7N B;  1DUR A;  2VG7 B;  2XO6 A;  3NGD A;  1Q86 T;  2E9R X;  4EWT A;  1Y11 A;  2ZDP A;  2MQO A;  2V4J A;  1RWK B;  2OPQ A;  3M30 A;  3LPE A;  3KK1 B;  3FBB A;  1EJ7 L;  2FVS A;  2ZH2 A;  4Q0B B;  4RNO A;  1O6X A;  4N77 A;  3GQC A;  3W2W B;  4OHW A;  4USK A;  1FK9 A;  4JI1 F;  5B0G A;  1UL3 A;  1J5E J;  2OD6 A;  2A6M A;  4AYB D;  2PT0 A;  1ELO A;  1EIY B;  5D6G A;  4RNM A;  2Z2M A;  4Y2A A;  3WC0 A;  1T9X A;  4UY8 T;  3M32 B;  4V19 X;  2UXD J;  5ETN A;  3E51 A;  3PTW A;  5FJ4 A;  4J9V A;  2CJY B;  4PXB A;  1YZ7 A;  1TUV A;  3EVM A;  1XWL A;  5GMK a;  3RAQ A;  3VAH A;  4Q8F A;  1R8B A;  4IFV A;  5HVG A;  4B3M F;  3T5K A;  2CQ1 A;  2FGC A;  3RB4 A;  3IAS 9;  5F3T A;  1HFE L;  1RT2 B;  3VHQ A;  4ELT A;  1RU2 A;  1KVJ A;  1QLN A;  4QWE A;  4CWB A;  3DRY A;  2YH1 A;  2QA2 A;  2YNH A;  1Q95 G;  3V2U C;  1YX2 A;  2PSZ A;  3POT A;  3B6B A;  3K2Y A;  3AB4 B;  4A48 A;  3IC1 A;  1CVJ A;  5KFH A;  1N8R T;  3UCU P;  1X5S A;  1TMM A;  2HRY A;  4C7Q A;  4GVB A;  4J91 A;  1T3N A;  3K5O A;  3DM2 B;  2IY5 B;  5DO2 A;  3G6E S;  2CPE A;  2Y8Y A;  3CJT A;  3TW0 A;  2CPY A;  3O1L A;  2XLK A;  2AJ1 A;  2QL5 B;  4GKK J;  2BOA A;  4C8N A;  3A3O B;  2OFH X;  3O8W A;  3Q8Q B;  3DHX A;  1UFW A;  1RK8 A;  1JIH A;  2B5J B;  1FDA A;  4PXC A;  1YI2 S;  2ADB A;  1SV5 B;  2UU9 J;  1Q5Y A;  1N4L A;  1WTB A;  1VCT A;  4N56 A;  2QX0 A;  2KFY A;  2DCU B;  2VOO A;  1J5E F;  5B0A A;  3GPA A;  5GME A;  3UDV A;  5KFF A;  2V4J B;  2OPQ B;  2C2Z B;  3G82 A;  3VWS A;  2RT3 A;  1VHI A;  1R3N A;  2UXD F;  4C6A A;  4K4T A;  4IOB A;  3ZZ0 A;  3NRB A;  1FK9 B;  3I55 S;  1FF2 A;  5A2Q Y;  3FVY A;  2AF6 A;  1EET A;  3M8Y A;  2Q6B A;  3J81 U;  2B4O A;  5KG4 A;  2LEB A;  3PV8 A;  5JVG Q;  2QE5 A;  2W9C B;  3R9L A;  2FHJ D;  3OR2 A;  4JV5 J;  4ED2 A;  1LV5 A;  3MOZ A;  3EJM A;  2GHW A;  4HEA 9;  4OI4 A;  2JHE A;  2FHK A;  4IFV B;  4EU0 A;  3QT6 A;  4MH8 A;  2ZH8 A;  5CAB A;  2JRS A;  1RBO B;  4W4M A;  3JS9 A;  2LQ5 A;  3KLH B;  4BWJ A;  5IZH A;  1FXD A;  4DV1 J;  3NS5 A;  1F5B A;  3TUP A;  1N5Y A;  3ITH A;  4JI5 F;  2JVO A;  3NGK A;  2FTR A;  5HP1 A;  3KNG A;  2DGS A;  4USI A;  2FD2 A;  3TQE A;  4DQQ A;  2HQ3 A;  4DJB A;  3LOU A;  3CMQ A;  1HNZ F;  3G71 S;  4NLV A;  3KLG A;  3MED B;  2Q1L A;  2BM1 A;  1QAX A;  3K5L A;  1L3S A;  1A6L A;  2OJ3 A;  3HZG A;  3HO1 A;  2AEJ A;  2W4P A;  1RWX B;  4KO0 A;  4DR1 F;  2LVW A;  4GVB B;  3TEG A;  2JFK A;  2UU9 F;  2J6U A;  4ECR A;  3MHY A;  4EZ6 A;  1VIS A;  4X4U A;  2HQD A;  3MF5 A;  2HHH J;  1YBU A;  1FJ7 A;  2VA2 A;  4U96 A;  3BF4 A;  3UCZ P;  1QM9 A;  1EB0 A;  3CJK A;  2IRY A;  1BD6 A;  1NB2 A;  3ZZT A;  3TAR A;  4K8R A;  1U1R A;  3MUT P;  3MEK A;  2IMW P;  4OJH A;  2BAN A;  2XSJ A;  4ZPB A;  3GIM A;  1H6K X;  1KQS R;  2F9D A;  1FRI A;  1SC6 A;  1VS3 A;  4ETX A;  3U02 A;  1R0B G;  4I1T A;  4E0D A;  2H9Z A;  2J7K A;  1TQL A;  4NXN F;  3EYZ A;  3CUL A;  1JX4 A;  1RBL A;  3PIO Q;  3GIL A;  2RHS B;  1YBT A;  1RA7 A;  4YB5 A;  1EET B;  1T05 A;  4A8M P;  3KHH A;  5HRO A;  2C28 A;  1C0U B;  2EFQ A;  3QAU A;  2LXU A;  1NO8 A;  2EPI A;  5D8H B;  4IG3 A;  3OR2 B;  4LF2 A;  4X4P A;  4F4Y A;  1S5Z A;  2K7J A;  1X5T A;  4DV1 F;  3CCL S;  3BYR A;  4XDC A;  2BKP A;  2Y1R I;  3RRG A;  4NRT A;  2HHQ A;  5DGA A;  1XMQ F;  4W90 B;  3H40 A;  4N5S A;  4C8M A;  2Y9H A;  3QT7 A;  4X65 F;  2GMJ A;  4X66 J;  5EX3 A;  2O01 C;  1N5Y B;  1LK5 A;  3ITH B;  2G4B A;  2JEI A;  3JTN A;  5HP1 B;  1NSP A;  1SJQ A;  1S10 A;  4FXD A;  5KG5 A;  3PCO B;  3W5X A;  2CQP A;  4WXW A;  2YNF A;  3KUG A;  4XIU A;  5AE3 A;  2OFG X;  3OL7 A;  1RT1 B;  4AQY J;  3HHD A;  4C0O C;  2D3O 1;  5L1L A;  4B9N A;  2BJ9 A;  1S1X A;  1N33 J;  2CQ2 A;  3QAT A;  1S6Q A;  3DFE A;  4KJI A;  1DBD A;  4WFX A;  3H20 A;  2Z57 B;  1S79 A;  3OXL A;  2H51 B;  3TA2 A;  1VFJ A;  4JUZ A;  2R7R A;  4NML A;  2PDA A;  6FDR A;  1JLF B;  3CJK B;  4LVO P;  3HMJ G;  1U2C A;  1S1W B;  1SJR A;  2BJ1 A;  4I68 A;  1C4C A;  1JLA B;  5J2Q A;  2YQ1 A;  3TAP A;  3CCM S;  2ACY A;  2DNK A;  1S97 A;  1AB8 A;  2B43 A;  2H1Y A;  2YWG A;  4MK9 A;  3UE2 A;  2ZHA A;  1IBL F;  1SIZ A;  3NBP A;  1O5J A;  3N6L A;  2KO1 A;  3ZZZ A;  1VBY A;  5EWG A;  4NPO A;  1KTQ A;  3W63 A;  4ZVH A;  4A8S A;  3DN9 A;  4J9Q A;  3PRV A;  4J90 A;  5FLX U;  1JQG A;  3I96 A;  2W9B B;  1NHK L;  3CDE A;  1JK9 B;  2BA9 A;  5F8N A;  3CDW A;  2DGQ A;  3SYZ A;  3KLE A;  2HYI B;  3OFE A;  1D9F A;  3GE9 A;  1T05 B;  4O3O A;  3P5B P;  3N0V A;  1R89 A;  2QLX A;  5HRO B;  3UDE A;  5A8W B;  3EUN A;  4EGL A;  5C42 A;  4NXM J;  4RLE A;  3WBZ A;  2HRU A;  4PWD A;  4ER8 A;  1JNR B;  2GFF A;  3TAN A;  4X66 F;  1VQP S;  1N6Q A;  4M1K A;  3TJ9 A;  3BPD A;  1SKU B;  4PAB A;  2MKI A;  1VLO A;  2A2C A;  1S0V A;  2ZBQ A;  1NK4 A;  1PJ5 A;  4O3P A;  1U6B A;  2VOD A;  1NPK A;  4QCL A;  4GRS A;  2YNG B;  2ZNZ A;  1IUJ A;  2LXF A;  3CCW A;  2DNO A;  1K9M T;  4AQY F;  1RTI B;  4B17 A;  1EAR A;  1N33 F;  2EBG A;  4I0W A;  1FX2 A;  3I9Z A;  2WAQ D;  3N6M A;  4KH0 B;  1GFW B;  2C2M B;  4NLP A;  2VFV A;  5T14 A;  1KQG B;  3OFG A;  1BGX T;  2ZH3 A;  2YNF B;  2DR7 A;  2F8H A;  3HF5 A;  2BX6 A;  4NCG A;  4JP8 A;  4WKY A;  3H2U B;  2A6O A;  3MMC A;  4P2M A;  5A6W A;  4QWC A;  1S1X B;  3GFH A;  2ZD1 A;  2MHN A;  3ILO A;  1S6Q B;  2QA4 S;  3U1M A;  3A12 A;  3UFC X;  1NBE B;  5LSL A;  3M9N B;  3W1Y C;  1E6Y A;  4CT9 A;  2IA6 A;  4ICL A;  4TKT A;  3C14 B;  3MI7 X;  3CCE S;  4P52 A;  4WFA Q;  1OYE A;  4C8K A;  2YWF A;  4B9S A;  4L3K A;  4IR1 A;  2MKC A;  2A10 A;  2AW0 A;  3HHK A;  4LF6 J;  5CD4 H;  3UCG A;  5J2Q B;  1KOO A;  2EEY A;  2HWH A;  4WU2 A;  3OSN A;  2IYG A;  1VC0 A;  3KKF A;  1ZBT A;  1T9T A;  4CH1 A;  4OZ3 A;  1KON A;  5L39 A;  2FQQ B;  3S8S A;  3CJS A;  2DNR A;  5KFB A;  3ONQ A;  4JI6 J;  1W7W A;  2HWT A;  3G6X A;  2DYA A;  3KLE B;  1XR7 A;  1S9G A;  1WSV A;  1HBU A;  2F1F A;  4WFY A;  5IWA J;  2APO A;  2ZC4 A;  2DNP A;  1WEY A;  4RUA A;  4HHJ A;  3NGT A;  1LK7 A;  3D0H E;  1JJ4 A;  2AYG A;  1QTM A;  4KT0 C;  3SBM A;  5C42 B;  1IBM J;  4PWD B;  1PCA A;  4R8U A;  5GVQ A;  1GNK A;  2ZWO A;  4OJG A;  4ED0 A;  2MJU A;  5KT4 A;  4QWD A;  3GFZ A;  2QO3 A;  1N6Q B;  2DGO A;  1NU4 A;  2R8H A;  2AWZ A;  4RUB A;  1KFD A;  1M1K T;  4DR4 F;  4IRD A;  3PR4 A;  3MMA A;  3CJ4 A;  1SKS A;  3IRW P;  2J9D E;  3V4M A;  2NUH A;  4ZCI A;  2VF3 A;  1RAD B;  2YKM B;  2V69 A;  3FBC A;  1MG7 A;  2N7Y A;  5M2U A;  2FVP A;  4OYI A;  3RBZ A;  5C2C A;  4H54 A;  3J7A 1;  1AUS L;  2XM3 A;  3KMQ A;  5B0C A;  4NCG B;  2CZ9 A;  1G7C B;  2RRB A;  3MMC B;  4LF6 F;  3KNA A;  5LMU J;  4L76 A;  1IKW A;  2ZD1 B;  3DGP A;  1KRP A;  1SC4 B;  4X62 J;  1KDN A;  1AA1 B;  5IT4 A;  1I1G A;  1S7I A;  1XR5 A;  4LSN A;  3BGR B;  3N9U C;  4RR5 A;  1VRT A;  4ANC A;  5D4O A;  5KT2 A;  5K8P A;  5E3P A;  1FWL A;  2Z30 B;  2UP1 A;  3CCS S;  1F9E B;  5ETK A;  1D1U A;  2HNY A;  4KKO A;  3FQK A;  5IWA F;  4ES3 A;  4USJ C;  2VFR A;  2HVD A;  1U1M A;  2VBZ A;  1RAF B;  1IBM F;  3V5R A;  1WEZ A;  5F8G A;  1EQ0 A;  3SEO A;  5DM7 Q;  4I4B A;  3EXC X;  4HTJ A;  2M3D A;  4ZHR B;  4DQP A;  3TZX A;  3NCP A;  1NLK L;  1ZPW X;  3KOA A;  4UZC A;  2R7Q A;  2HGM A;  1S9G B;  4YHH J;  4OJ3 A;  5K14 A;  4IOC Q;  3PEJ A;  1X5O A;  3VAF A;  1O51 A;  3DLG A;  3QO9 A;  9ATC B;  4C0H A;  1YTY A;  3BH6 B;  1RAJ A;  3I0S B;  3EXY A;  3PM9 A;  4QYZ J;  5C2G A;  2D74 B;  2KVI A;  4LRB A;  2FHO B;  2FVQ A;  2ZH6 A;  2KXF A;  2R7S A;  5FDL A;  3MAA A;  3NG8 A;  4ILM A;  4KGX B;  4CLS A;  5F8I A;  3FFI B;  4F02 A;  4FN5 A;  1TVR A;  1RA6 A;  2VJV A;  3H42 A;  2V34 A;  5D0R A;  4YQW A;  1LQ9 A;  1TKT A;  3FJ2 A;  3MMA B;  3NOC A;  3UR3 C;  1S57 A;  3SCI E;  1HWL A;  3W5Y A;  4YME A;  4ZCK A;  4RW4 A;  3V4I A;  3Q8S B;  5ADZ A;  2LA4 A;  2JDJ A;  5LMU F;  4BHQ A;  3SXL A;  4X62 F;  1W2B R;  1FNM A;  2AMC B;  4DL3 A;  1VQS A;  1FT8 A;  2VIC A;  3T5L A;  4DCO B;  4ZS6 A;  4OYW A;  2UUA F;  4YB6 A;  3HUL A;  1IKW B;  5GAD U;  3DGP B;  2VQE J;  3T3F A;  5E7O B;  1J5O A;  1RXO B;  2F7V A;  3C3L A;  2G1D A;  2WHO A;  1Q79 A;  2GO8 A;  3T1Y J;  2HKE A;  4LSN B;  4NYZ A;  3FMB A;  5K5M A;  1RU1 A;  3OTO J;  3U27 A;  5ETS A; 
#chains in the Genus database with same CATH homology
 3GJR B;  5IC4 B;  4ZVT B;  2CNK B;  1RWX B;  3RJM B;  1PAU B;  2HBQ B;  3NS7 B;  2CNO B;  3D6M B;  2QLJ B;  3IBF B;  1RE1 B;  1RWM B;  2DKO B;  2H51 B;  3EDQ B;  1RWO B;  4JB8 B;  2XZT B;  1RHJ B;  1PYO B;  3R6L B;  3GJS B;  1SC1 B;  4ZVU B;  1F9E B;  2C2K B;  2H5J B;  2HBZ B;  3D6F B;  1RWN B;  2CDR B;  3KJQ B;  2Y1L B;  2QLB B;  2XYH B;  3KJF B;  1RHU B;  2QL7 B;  2QL5 B;  1I51 B;  1RWV B;  2CJY B;  4ZVS B;  2QLF B;  4ZVP B;  2H48 B;  2H65 B;  3GJT B;  1RWW B;  2HBY B;  2P2C B;  2CNL B;  3R7S B;  2XYP B;  1QDU B;  1RHR B;  2C1E B;  1NME B;  4DCO B;  2HBR B;  2FQQ B;  3P45 B;  1RHM B;  2CJX B;  3IBC B;  5K20 B;  3EDR B;  3R7N B;  3R5J B;  4ZVR B;  1GFW B;  2H5I B;  2CNN B;  2C2M B;  3KJN B;  3D6H B;  4LSZ B;  1RHQ B;  2QL9 B;  2C2Z B;  4ZVO B;  4ZVQ B;  2H54 B;  3QNW B;  3R6G B;  2XZD B;  1I3O B;  1SC3 B;  2H4Y B;  1RWK B;  2C2O B;  1SC4 B;  3SIP B;  2Y0B B;  1ICE B;  1BMQ B;  3R7B B;  5IC6 B;  2XYG B;  4DCJ B;  2H4W B;  1RHK B;  1QTN B;  4DCP B;  1RWP B;  3P4U B;  3GJQ B;  1IBC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...