5LJ5Y

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lj5Y00
1YWXA 3NS5A 2BZ2A 3CCQS 1N52B 3VAIA 2G4BA 2MGZA 3BEGB 1FJ7A 5LJ5Y 1HA1A 2F9JA 2MQNA 2DNHA 1X4GA 1FNXH 4WKRA 1O0PA 2CQCA 2YTCA 3CC2S 2E5HA 2HZCA 1JJHA 2MZ1A 1M1KT 2KI2A 3I56S 4CH1A 1VQ7S 2GHPA 2KM8B 3I55S 1M90T 1QM9A 3CC4S 3THPA 2J76E 1DZ5A 4C4WA 2X1BA 2DGOA 3L3CA 2KRRA 1P1TA 1DHMA 1FJCA 2G1DA 4YB1P 5GAGU 2FHOB 4F26A 3TO8A 2J0SD 5EN1A 1P27B 1KD1T 3Q2SC 1KOHA 2AYMA 1ZZFA 3H2UB 1FT8A 2DK2A 1NO8A 3UWTA 2MQQA 1YJ9S 1SJ4P 1S79A 2DNZA 1WG1A 2CPHA 4LIRA 2DNNA 2NLWA 1VC5A 1U2FA 2DHGA 2L9WA 2MZJA 2KT5A 3FEYB 4WFAQ 4CIOA 3CCES 5MLCV 3EGZA 2CQBA 5HL7Q 2CPXA 5FJ4A 1N88A 3R1LA 2KVIA 4TU9A 2M8DB 1X5OA 3EGNA 1X5TA 2V94A 2EK1A 1WF1A 2GO9A 1WEYA 1U1MA 2M4MA 4TU7A 5LSOA 2WBRA 3ZZZA 3NNCA 2KXNB 2I38A 1QVFR 2KH9A 3G8TA 2LMIA 2E5JA 3EX7B 2MZQA 1VQ8S 2E5GA 2MQOA 2UP1A 3THTA 3S8SA 1NU4A 3SMZA 3K0JA 2CPFA 3Q2TC 1ZZNA 1F9FA 1H2UX 1FHTA 2HYIB 2JX2A 2LXIA 1U1QA 1KC8T 1KOOA 3CCUS 4LJMA 5DETA 3NMRA 1VQMS 1VBYA 1UP1A 2L08A 1U1LA 2CPZA 4Y0FA 3CD6S 4CH0S 2X1FA 2XNRA 4OZ0A 3CMES 2MB0B 1BY9A 1WI8A 3P49B 3BS9A 3MOJB 3MI7X 1AUDA 1K8AT 2HGMA 1SXLA 1X4CA 2KM8C 2QFJA 2DHAA 2JVOA 2QEXS 3OW2R 1FXLA 3TP2A 1X4DA 1YTYA 2E5IA 4WIIA 5LSLA 1YHQS 1VQ4S 1VQKS 2LECA 2FC8A 5DDQC 3HHNB 2CQ0A 2RU3A 2CQPA 2DNPA 5LXRA 2MY8A 5HO4A 2O3DA 2JVRA 2MKCA 5GMKa 2DGTA 2N82B 3MUTP 2PEHA 1R8PA 5JVGQ 1CVJA 5H1SV 4WF9Q 2MQMA 1M5PC 1X4AA 3VAMA 2CQ3A 2MHNA 2DGQA 1OPIA 5GVQA 2RQ4A 3BO3A 2MQPA 2XS5A 4RU2A 3IWNC 2YH1A 1VC6A 2ERRA 2CPEA 1JJ2R 3B4DA 2U2FA 2HGLA 5CA5A 3CCLS 3R1HA 1XN9A 2D9PA 2VONA 2XNQA 2LCWA 1X4BA 3MD3A 5DDOC 2RS2A 1X0FA 4F02A 1VQPS 2MJNA 3ZZYA 1N54B 3CMAS 4A8XA 2G0CA 2M52A 3CTRA 2CQ2A 3G96A 1JJ4A 2ADBA 1WG4A 2FY1A 2KRBA 2I2YA 3J7YU 2BOPA 4IO9Q 4PKDB 1W2BR 2DGSA 2MQLA 3PIPQ 2MKIA 2MJUA 2MY7A 3UD3P 1WHVA 2MSSA 1IQTA 3G8SA 3NNHA 2KN4A 2CQIA 5D77A 1ZH5A 1X5PA 2XSFA 3S6EA 3P3DA 2DGWA 3UE2A 2CQHA 1WI6A 1A9NB 2M70A 3UD4P 2J0QD 2LEAA 2MXYA 2DNQA 4LMZA 1N8RT 3VF0B 2DNOA 1HL6A 3G71S 5DM6Q 2LQ5A 4WFBQ 1M5KC 4EGLA 2M8HA 2MMYA 3CCSS 2DO4A 4WFNQ 2DNYA 1VBZA 3RW6A 2DGUA 1YIJS 2DNRA 3UCUP 2CPYA 2K3KA 4ZKAA 4Z2XA 3MD1A 5LXYA 2M0GB 3SDEB 2DITA 4ED5A 5BJRA 3G4SS 1RK8A 2KFYA 2RUGA 1PGZA 4U67Q 3S7RA 1SJFA 1YJNS 2OTJS 1HD0A 4YOEA 2X1AA 3CCRS 2DNGA 2OSRA 5IM0B 4PR6A 1X4EA 2J8AA 4P6QA 4C7QA 1YITS 5LJ3Y 2AYGA 4FXWA 4W90B 3US5A 3BO2A 1VQ5S 2M9KA 3U1LA 3CCMS 1WWHA 4OZ1A 3G6ES 4WCEQ 1VQ9S 3VAJA 2LA6A 3CUNA 2SXLA 1K73T 1KQSR 1OIAA 4PRFA 2KYXA 2M88A 3CCJS 2LXUA 1G2EA 1WF0A 1FO1A 3SDEA 2OTLS 3P5TL 5CYJA 3CF5Q 1RKJA 1VC0A 2MZTA 3MDFA 2KG0A 1YI2S 1Q86T 1DBDA 3IRWP 3U1MA 3CXCR 2LA4A 4CQ1A 1URNA 4QQBA 1U1KA 3DLLQ 2KHCA 2KXHA 1M5OC 2MGZB 4BS2A 1WHYA 1YJWS 1U6FA 5IM0A 2EVZA 2FPHX 2PE8A 2D3OR 2RVJA 5IQQA 3CULA 2F3JA 2VODA 1OWXA 1UW4A 2DH8A 3VAFA 2DNLA 1VQLS 2DHSA 2LEBA 1WELA 2M7SA 1WF2A 2MZSA 3CPWR 4V19X 2VOOA 1H2VZ 1X4FA 2DISA 3FEXB 2YH0A 1U6BA 1UAWA 1WHWA 2DO0A 2N3OA 2HVZA 2B0GA 2DB1A 1Q81T 2NZ4A 2DIVA 2CPJA 1U1PA 2XS2A 4FXVA 3SXLA 2CPDA 4J5OA 2AYBA 3DXBA 2MYFA 2JRSA 1R8HA 1X5SA 2OJ3A 3P6YC 1D9AA 1VQNS 4C0OC 5GAHU 2MKJA 2RRAA 2M2BA 5D78A 1VQOS 3MXHP 1Q82T 2DHXA 2VOPA 2QA4S 4TLQA 2MKHA 3G9CA 4QU7A 1K9MT 2N3LA 5DM7Q 1VBXA 2AD9A 2N7CA 3H2VE 5GADU 1WG5A 2KU7A 2MKSA 1U1RA 3MUMP 1Q7YT 2CQDA 2XS7A 3D2WA 2X1GA 2ADCA 5DDPC 5CXTA 2L41A 1VQ6S 2YWKA 2YKAA 2E44A 2DGXA 1H2TZ 2RT3A 4F25A 3VAKA 2MPUA 2A3JA 2ZJQQ 1U1NA 3R27A 1M5VC 3N9UC 2CJKA 4QPTA 4QU6A 4Y00A 1WEZA 4ERDA 2DH7A 3CCVS 2CQ1A 2FC9A 2RQCA 4YUDA 1FJEB 1HD1A 3V4MA 2MSTA 2LYVA 1DRZA 2Q79A 3VAHA 1H6KX 3LQVA 3VALA 3S01A 3PIOQ 3UCGA 3HI9A 5ITHA 1WEXA 2DIUA 4W92B 2MKKA 2CQ4A 3B4MA 2AYEA 1X4HA 3UCZP 1S72S 2LKZA 2CQGA 2OIHA 1SJ3P 2DNKA 2CPIA 3RW7A 1OO0B 1B7FA 3NS6A 2XB2D 1A7GE 3LPYA 4IOAQ 2EK6A 4UY8T 2RNEA 2OSQA 4IUFA 4M5DB 5IFMA 4TU8A 4IOCQ 1NJIT 2DNMA 5JVHQ 2D9OA 2U1AA 3CC7S 1WHXA 1PO6A 2KXFA 2ZJPQ 2K8GA 3MUVP 2JWNA 4UQTA 2RRBA 2ZJRQ 1L3KA 2DGVA 2DH9A 2MZRA 3MURP 2KG1A 3JB9k 3J7ZT 1WTBA 3NNAA 1JMTA 1QVGR 1SJRA 1UFWA 2RS8A 3VAGA 2HGNA 3ULHA 2F9DA 1SJQA 5GAEU 3BO4A 5DDRC 1U1OA 3TYTA 1D8ZA
chains in the Genus database with same CATH superfamily
4KY3A 5KG2A 3AD9C 5D4PA 2BZ2A 3T5LA 1NSPA 2HS4A 3N5BA 1XWLA 1G7CB 2BEFA 3IS9A 3GG0A 3QIPB 3CSKA 2VG6A 4FYWB 4J37A 2MGZA 1KNZA 1KN6A 3U7JA 3OVAA 1K0TA 2MLXA 1HA1A 5G0RA 2FTRA 2DXDA 4OYAA 2W8KA 4J9QA 2MQNA 2DNHA 3C2PA 4FNHA 1FVSA 1KFSA 4QZVB 1UVIA 2HHTA 2YTCA 3CC2S 1BQXA 4HHJA 1OYEA 3QLHA 2HZVA 3A8IA 3WX4A 2E5HA 3IGNA 1S10A 4N47A 1JJHA 2V4JB 1IM6A 3CVKA 3M6UA 1F6TA 4A8QA 1VCTA 2E66A 3TJ9A 1Q0NA 3DYAB 4LRBA 1L5UA 4ANDA 4KYZA 3DLKB 3PM9A 1IWAA 1MMNA 2ACYA 1VQ7S 4YN3B 3FCHA 3IO1A 3M8QA 5IOLA 3BQ1A 4N41A 4AL5A 2HHHJ 4WFZA 2FLOA 1IBLJ 3I55S 3R9LA 3DOKB 1QM9A 2QGFB 3VGSA 2BJ9A 2XZWA 2ZC3A 4USWA 2R2RA 4DUZJ 5H9FK 2OPRA 4LF5J 3EZ5A 4NXMF 1X9WA 1HNIB 4G3IA 2X1BA 2DGOA 3L3CA 3UR0A 2QFIA 2YNHA 3WX8A 4O0NA 4YY3F 1JLAA 1P1TA 1TELA 4N8OA 6AT1B 4X64J 3HJFA 3CEDA 1FJCA 3GYNA 5ETVA 1SJ1A 3U1NA 2HHUA 1UCNA 4EUVA 1KQGB 4YB1P 5DQGA 5GAGU 1HNXJ 4UUWA 4RBTA 2BANA 2FHOB 2P6TA 2C2EA 3GJSB 3UR3C 3PR4A 2J0SD 5EN1A 1YJVA 4LF1A 4KKOB 3SCKE 2AF6A 1KD1T 4FF3A 2QA4G 1J5EJ 1Y0HA 4X4NA 4PQUA 4XDCA 4OJ1A 3PVXA 1NXIA 1S9EA 4FNIA 4B9MA 3H2UB 1FT8A 3DN9A 1WUUA 4M5LA 5LMUF 1U8SA 2V50A 3DHWC 1IBLF 1TUVA 3ISZA 1VR6A 4WU3A 1EETB 2J7WA 1RJJA 5K8NA 2UUCF 3QRRA 1HNVB 1VRTA 4KPYA 4J9PA 1EQ0A 2DT9A 3TEGA 2NLWA 3WC2A 4LREA 5BXIA 3JAMU 2K1RB 2CADA 3QGIA 4O3QA 1FA0A 3ZZTA 3MCOA 2XWXA 2GX8A 3DRYA 4MKAA 2CQBA 4YQWA 2XYPB 3B78A 2ILZA 3D67A 3TAPA 2XLJA 3TANA 3T1AA 4DF4A 2C22A 2GO8A 1Q4RA 2R7OA 3W9JA 1JWWA 3QT7A 4ED2A 1N33J 1N88A 2BJ8A 5DG8A 1SH0A 3M05A 1UEUA 4ZJLA 1N32F 4OQJA 1JLFA 1G1XA 3BGRA 1X5OA 2VFRA 1FJGF 3I5BA 5C5JA 3DCAA 3BSAA 3SCLE 3I96A 3FVYA 4O3SA 4LF4J 4LFAJ 3KHLA 3TVZA 2NUHA 2GMLA 5L46A 4FBUA 5GMDA 4ZDNA 2XMAA 3OL6A 2VKRA 4TU7A 4EBEA 4K7QA 5LSOA 2Z2MA 3HLUA 1W26A 5KFSA 1N4LA 2YWGA 2KXNB 3R5DA 4OHXA 4X4TA 2YVSA 5AXMA 4BLGA 2I38A 1NMEB 4FS2A 3UO0A 1OPZA 2OHDA 2Y1IA 4B3TF 4OHWA 2WONB 3CDAA 4X4PA 2JC0A 1HR0F 2RUSA 4DR3F 3GFHA 1RAHB 3HHLB 2EEYA 2H1YA 2Z30B 5C24A 2F4FA 3HZEA 2FLNA 4OJGA 2MDAA 4ELVA 1ZZNA 3Q2TC 2C2ZB 4TYAA 3G82B 1H0HB 1R8BA 2GGPA 1XQIA 2LXIA 3DOMA 4WJBA 4A47A 4OHVA 4DCOB 2KTQA 1U1QA 1TKXB 3CCUS 4LJMA 5LL6d 2XEXA 1NK6A 1RISA 3M8PB 2PN6A 2UZAA 4YB5A 1UVLA 2PIIA 3HVTA 2CZ4A 4NMXA 4RU9A 4GC6A 2W4CA 4PYDA 2AZ3A 2Q6CA 1ZA2B 3QYYA 1N5VA 3E01B 5KFDA 3GCWP 4CH0S 4TQSA 1UPPA 4ZJOA 4ATNA 1FKAF 1BY9A 4RWWA 4ZVFA 5CYQA 2R8GA 2OFHX 5C42A 4ECZA 1MW7A 1RT2B 2HWTA 3DRXA 3RBZA 4OZJA 2A2DA 4RUAA 2GJ2A 3OUYB 1REVB 2B4PA 2HGMA 2QFJA 3IWLA 2ZH3A 4J9RA 5E3CA 3QATA 4DV1J 3E2EA 4OI0A 2C42A 2R2UA 2QEXS 4K4VA 4DLEA 2QRRA 3WIUA 5C25A 5HMXA 4P10A 3OW2R 2NPFA 1PJ7A 1JLEB 3MGJA 5HLFA 3T1YJ 4JV5F 1OYDA 3ZZUA 4WIIA 4URSA 2UV8G 4DR2J 4ECXA 2RHQB 1FRJA 2VG5A 1VQ4S 3N01A 1KQFB 1VQKS 4MH8A 1PYTA 2VUGA 5DDQC 2HNYB 3FFIB 3K5OA 3OTOF 5E3PA 4QYZJ 1QDUB 2J7KA 2P9EA 1FE4A 1TKTA 3PHEA 2MY8A 2P9GA 4OV1A 4PWWA 4NXMJ 4U96A 4P74A 3RGIA 3ZFVA 3JAMY 2CIMA 2H5EA 4L74A 1S1UB 4J9KA 4J9MA 2N82B 4M5MA 2IBOA 2PEHA 4KGKA 5JVGQ 4DN0A 4ENOA 3D3BJ 5H1SV 2UXBF 1M5SA 1C4CA 1SC4B 2DY1A 1X8DA 4HACA 4P72A 2B6AA 2XMVA 3HXMA 1NK4A 2VG6B 3M8YA 2ZDOA 3L7UA 2B9YA 4WU2A 2HFZA 2XY7A 1FCAA 1A6LA 5CHCB 4NRUA 4ZLPA 5F8LA 2W9BA 1FFSB 3QT6A 5HQ8A 1KLNA 4RU2A 2DVIA 2GHWA 3PJWA 3D6HB 3CC4S 4YDDB 3CDUA 3MM5A 3G6YA 4RW6B 1N32J 2U2FA 2O67A 4ZVGA 4L76A 4MMOA 4DPTA 5CA5A 3LALA 2WB4A 2PO4A 4FYYB 5EUHA 5A8KB 2V8VA 3K58A 2IRYA 2D9PA 4FN5A 4F4AA 2WZ1A 3I4HX 3MEEA 3BSOA 2JEFA 1UJ6A 1D09B 5CABA 5A8WB 4B9TA 3MD3A 2MJNA 1WKJA 3ZZYA 2Z0GA 4C8OA 3NXZA 2VPWB 4A8XA 3VTIA 3R2CJ 1S57A 3I5CA 1S1VA 3M1VB 4CLPA 3R5GA 2KT2A 1Q79A 1U0SA 2VF3A 3KWMA 2CQ2A 3OTBA 3OTEA 1DTQB 2B7BB 5F8MA 3QJPA 2OELA 2FY1A 2KRBA 3ZTRA 3QT5A 5JXSA 3W64A 2VFVA 1N34F 2BANB 2YNFA 1DQ9A 1U26A 2BKNA 1W2BR 4CLUA 2MKIA 2HBZB 3UD3P 4HR2A 1S6UA 1RAIB 2P5VA 5IT9U 4ICLB 1TL3A 1S9EB 4GRSA 4IG3B 4MYTA 1FWLA 1KLMB 4QR0A 1V3SA 3G8SA 4K4TA 1Y4ZB 4O4GA 1WSVA 5HSPA 2RKIA 1BHNA 3OJSA 1X5PA 4CZCA 2C2NA 2K7KA 4OYIA 1Y5LB 3HSJA 3QRQA 5IXUA 3A12A 3M32A 3PRBA 3P3DA 3RAQA 4DPOA 4K4SA 2PD1A 4ES1A 4YEAA 5KG5A 4KV8A 1RADB 3TVKA 3T1HF 2WVEA 1A9NB 3AQPA 1YDLA 4F36A 4CO3A 5HMWA 1T03A 2J0QD 2J6UA 4Y2AA 1UJ4A 2CWKA 4CYUA 4RUCA 3ZTSA 3KUHA 1YK9A 2IMOA 5E3RA 3EVMA 4W4MA 1U48A 1PAUB 1FXLA 1UZHA 2BQUA 2FZKB 3F56A 1ITPA 2ZD1A 4TVAB 1AUSL 5D15A 2ZH8A 1FRLA 2GVZB 2LQ5A 4F3OA 4IYQA 2GC8A 4EGLA 1HBOB 2M8HA 1NK9A 2ROGA 2UUWA 1JLFB 1EZZB 3JTNA 4DJBA 5L9NA 5H9EJ 3O1LA 2DGUA 2HVDA 1YIJS 2BJ7A 4CLKA 3UCUP 4ZVUB 4GC7A 2ZZNA 1CJVB 5KFWA 2EBGA 5LXYA 3KHHA 3SZ2A 2UVRA 3AAWB 3SDEB 5IT9Y 4M63A 2OO4A 3C6TB 2HHXA 3G4SS 2RF2B 2MHEA 1T9XA 3R5JB 1JLQB 2OPPB 5L9XA 3RR8A 4BWJA 2BM1A 4U67Q 1F60B 1FTRA 1W2IA 2WTFA 3CCZA 1TKZA 3DLEA 1HD0A 5KFGA 3ZZRA 4DL2A 1NSAA 3WIVA 4BHQA 3G6VA 1NK7A 1S6PA 3MAAA 3CCRS 2VH7A 2DNGA 2OSRA 3MMAA 4K8RA 2FHJA 5IM0B 4WZMA 4J9UE 1TK0A 2B4UA 4CLZA 4M5JA 2HFSA 5J2MA 4RUHA 1TFYA 3TX8A 2AYGA 4BCAA 3DNCA 3HHLC 1JLCA 5D4OA 1JJCB 3HVWA 3Q86A 3I9V9 1I3OB 1Q53A 1RBAA 1N56A 1RTDB 4M5HA 4OZ1A 4CLLA 1FDNA 3RB0A 3IC1A 5T41A 3CJKA 4O3OA 5KG0A 2LA6A 3WQPA 1XBWA 5H9EK 4IQXA 3BR9A 4IFVB 1NHUA 4M5NA 4B3OB 4EWTA 3PRDA 2AKWB 2HFVA 1K73T 3VVUA 2QLJB 3JYTB 4P9SA 2C2RA 4P71A 1KQSR 3TR5A 4G1IA 4CM2A 1H7WA 5GAGI 3BJYA 2DR9A 3NKYA 1G2EA 1L3VA 4C9DA 3N4WA 3GQCA 1FO1A 3KKFA 4OYOA 1UEVA 3TJAA 5JJBA 1Z4UA 4C97A 3G86A 1JNZB 4QW9A 2KG0A 1C1BB 1RT1B 3RG6A 4GVLA 5KFTA 4ECTA 3GFXA 2QLXA 1DBDA 3IRWP 4EO6A 3MM7A 1Y7PA 1M1GA 1UZDA 4DV4F 2LA4A 2C28A 1J5OB 4QQBA 2YQ1A 2KJWA 2KXHA 4RL1A 4CNYA 4QCLA 1XMQF 1EKSA 1VOMA 3JSMB 1YJWS 1S49A 1NJXA 4JV1A 4NCAA 3PDNA 4RNHA 2HLTA 1HWIA 2FPHX 2EVZA 3M4XA 4HH1A 4I6WA 1U2CA 4Q2LA 5L1JA 1GAOA 5IQQA 1S77D 4EBDA 1UWBB 3KG1A 4QIGA 3VQSA 2AJ4A 4NEZA 5ETPA 1UW4A 2DH8A 1ZTTA 4ID5A 3VAFA 1R43A 2APOA 3SBMA 3VQTA 2B6AB 2V8GA 2YQ3A 4EFAC 3M2UA 2VDIA 5B0BA 6FDRA 2MZSA 2XO7A 2OPQB 3RB6A 1KDNA 4NZ6A 1H2VZ 1RGVA 2EC0A 2VDHA 3M2VB 4IQMA 4DFPA 1BQNB 3BGFA 4LF6F 1RWVB 4DV3F 1N6QA 1QTMA 3JSYA 5KFJA 2DO0A 3PYDA 1U6BA 2HURA 3QMQA 2HVZA 4RNNA 4UUXA 4I67A 1NBEB 4OFZA 3KJQB 2B0GA 2QC3A 5IT4A 4F0MA 4KJIA 1TUGB 1U1PA 4ILLA 2Q66A 2OD4A 5HQMA 4RO0A 3D6FB 5A8KA 1HPZA 2RSQA 4Q5VA 2VJVA 3DXBA 3AHPA 2MYFA 2V63A 3AH6A 1D9AA 3T9NA 1X60A 4FDFA 4JI7J 2RRAA 2ZOGA 2M2BA 1VJQA 1RT3A 2W2NP 4RNFA 5JMNA 5D78A 3BGOP 3MXHP 1Q82T 3BYRA 3IG1B 1LW2A 1PYSB 4PAAA 3TUZC 3OHAA 4TLQA 5B0CA 1PYOB 1NAQA 2E1MC 2MKHA 3NP5A 4IDKA 2HNDB 3Q8PB 5FLXY 3HFZB 4OL8A 3LANA 4U9RA 4NE9C 2N3LA 4MK8A 5DM7Q 3RYLA 2WCXA 4G1QB 3H2VE 4QYZK 1WG5A 2A0FB 4P2XA 2MKSA 3DGPB 5HK4A 4ETXA 5HVHA 1FWPA 2CQDA 3NGRA 3HMJG 3MUMP 5HMYA 1FF2A 4B9SA 3D2WA 1AFJA 1ZTWA 1HMVA 5DDPC 2YNHB 1CC8A 4OX9F 1VQ6S 1TL3B 4PXBA 3KLGB 3ILOA 1X9SA 1JK9B 3K8WA 1NRKA 2V8PA 4I2QB 4JI3J 4BWMA 5A8RB 3KLVA 3M9OB 1ACMB 1T3NA 1PBUA 4FVCA 3PXGa 2W9AA 1NHKL 3M32B 4KKOA 2CAJA 2QMXA 3J7A1 1R0AB 3FUYA 1DY3A 2CJKA 2UV8A 2IJRA 4DX6A 2HHVA 3ET6B 2YPZA 4C6AA 2V0NA 2CQ1A 2EC2A 5A2QU 3CCVS 1HNXF 1B7YB 4NLUA 3MWBA 4LRFA 3MECB 4FPIA 4CLWA 5IWAF 1EB0A 1TVRA 5T7LB 1EARA 2FJEB 3U27A 2IMWP 4C8YA 4ZPBA 1T9WA 5F8HA 3FSIA 3GE9A 3GONA 3KHGA 4K4YA 3UI3A 3HPOA 1RABB 4O44B 1DLOA 1B4SA 5AXLA 4YUDA 4C98A 1HD1A 3V4MA 5GADI 4USUA 1PSDA 3DKDA 2LYVA 4P7TA 2Q79A 1FD2A 3WHIA 3VAHA 2UUBJ 1RKIA 3LQVA 2H5IB 1W7WA 3S01A 3BF4A 3LP1A 1S6OA 3EPGA 4JYAJ 2VZ9A 2B4OA 2I0XA 2DIUA 2IA6A 3B4MA 5BYSA 1X4HA 3VGUA 2MLYA 4LSLB 2IYGA 1HBNA 4DZ6A 1S72S 2BDPA 4LRCA 3IGVA 4F8RA 1MMDA 1BXNA 3K5NA 4Q8FA 1YJNS 4Z7YA 3FZBA 3L9ZA 1RTIA 2B5JA 2LXFA 4F4ZA 3HHEA 1U09A 4WFYA 4YR3A 4FZVA 1B3TA 1FRKA 1OQ3A 1RT6A 2D69A 1WTFA 3KLIB 4IUFA 1UJ5A 3MEDA 5KFPA 1GXTA 2NYIA 1IVZA 1KTQA 2QL5B 4J9OA 1H74A 5JVHQ 1XK8A 3TRGA 2OAUA 2ZKTA 1TL1A 3C14B 3EMTA 3DXSX 1CQNA 1WHXA 3MM9B 2ACMA 2LU2A 3FDSA 5D0GA 2EKYA 3GWCA 4F67A 1PO6A 4WBFA 4JI5F 1SUQA 4CCHA 2BJ1A 3ONQA 3CO0P 5KAKA 2ZJPQ 2BW7A 3ILIA 1Z2ZA 1WC5A 1TKXA 1HQUA 2ROPA 1F0XA 3TVYA 4DDFA 5KT6A 4C8MA 3QGGA 4WIQA 4GKJF 1V5IB 2BM0A 3GIMA 4G6VB 1RWMB 4KGVB 1WTBA 4BC9A 3OVSA 2ATLA 1X9MA 1RHMB 1S9GA 1T9YA 5HVFA 3JSRA 1QVGR 3PW7A 2R7TA 3AXMA 3ULHA 4HL9A 4MAKA 3AFGA 4RBVA 1EKRA 1OY8A 2NYHA 1RT1A 2R9LA 1TK8A 4EO8A 3T41A 5KFVA 3CE8A 1HYSA 5C42B 1RWWB 2NPIA 3TYTA 2E29A 1SQEA 1D8ZA 2LVWA 1ZM9A 3CCES 4JI8J 3CJ5A 3LGNA 5F8JA 1QAXA 5HBMA 3CCQS 1ZAVA 3I0SB 2L9DA 4U8YA 1CJUB 1SC1B 4ELTA 4NCBA 5HQLA 3LP0B 4DPWA 3SSQA 2R7XA 4OMFG 4EI2A 7FDRA 1RU2A 3T5HA 3HJVA 2VICA 5LMNJ 3HT0A 1X4GA 4WE1B 1RTJB 5ETMA 3EZOA 2VG5B 2NSBA 4NA1A 2CJQA 4J7CA 1RSCA 2LU1A 3BH7B 3IR7B 1DARA 3GCXP 3TA2A 2ZM6F 2WSFC 3GIKA 5HROA 1C0TB 2HZCA 3A8KA 3GU0A 4ZVRB 3PZPA 3BDPA 4ZCIA 1M1KT 4YS2A 1ZAXA 3NWGA 1ROFA 4WWSA 2IM0A 2HQGA 3LH2S 1FDDA 2VBZA 2OP5A 3D0IE 4CNZA 5CCMA 3I56S 2CDRB 2GHPA 4DLGA 1S1UA 2J9DA 3HHDA 1IKWB 4RNOA 3H4BA 2OEKA 4H54A 4CLTA 2X3DA 1VISA 4FVMA 1JQGA 2DYAA 5KG6A 1X31C 3BN7A 2J76E 2F8EX 3K8VA 3THPA 3UDVA 3KJVA 2YNGB 1S76D 1HARA 1FKPB 1RHRB 1VRUA 5IZHA 1EJ7L 1JIHA 1TU0B 3IM9A 3N6NA 4XPEA 1NDLA 1KP6A 4F4YA 1DHMA 2DKOB 2KL8A 2R7UA 3DRPB 3UNYA 1BE4A 2CJ9A 2FVQA 3OD2A 4WYWA 4CH7A 1ZS6A 3BYPA 2W2QP 4NLYA 1LFPA 5LM7E 5LOQA 2IC3B 5GMEA 3OL8A 1SQFA 1T3OA 2QSFA 3TO8A 4AE5A 4A8MP 3H0PA 1H73A 1NH8A 3TOQA 1BUXA 3Q2SC 1HNWF 4FF4A 3V2UC 2I9SA 2R8IA 2HG4A 4UZBA 3OR1B 4IDKB 5G0RB 1QAJA 4ILMA 2Q1LA 1P9QC 1NO8A 5A8WA 2D3UA 2VU5A 4K5RA 4ZK7M 1YJ9S 4PWDA 4DR1J 1HBUA 4I68A 2VD3A 1NK5A 5KT3A 1O8BA 2DNZA 3MR7A 3KK3A 1TMMA 2M3DA 4LIRA 3RAXA 2Z4PA 2CZ9A 5I4MA 1TZ0A 4ED7A 2VOOA 3PKYA 1VC5A 1U2FA 3BZQA 4DQPA 5IWAJ 2ZHOA 4HYKA 1AROP 4PABA 2FB0A 4WFAQ 3KOAA 4GKKJ 2GVDA 2PA3A 4Y28C 1Q5YA 2CPXA 4ZPCA 2UU9F 5HATA 4ZPVR 4U7UK 5FJ4A 2J7UA 1P8GA 4USKA 1CPZA 4DR5F 4DUYF 2QMUB 1HNIA 1RDRA 2F1FA 2BJDA 3A8JA 4ED8A 2AJ1A 3GP9A 3OL9A 1IN0A 4CLYA 2F4VF 1JLAB 2JH3A 2DRAA 2ZOMA 5J2PA 3NBPB 3HT3A 1KLMA 3ISNC 3PJXA 5ETSA 4DSKA 4RKUC 2EFVA 3HF5A 4KO0B 3HFVA 3LP2A 2B3TB 3SYZA 3ZNJ1 2V94A 1FEHA 2GO9A 3I6PA 1WEYA 1VYAA 4A8KA 2I1RA 4WFXA 4AUKA 5B09A 4QIVA 3ZZZA 2IFXA 1HNZF 2FVPA 4NZ0A 2LLZA 4AD6A 2UXCF 4KIAA 2C1EB 2YX7A 4OI2A 4OV6A 4DV6J 3MPVA 4DL4A 2KH9A 4F2SA 5HMZA 1XR7A 1LWFA 2LMIA 5E0OA 2VQFF 4J9SA 2MZQA 4QIWD 5G4DA 2E5GA 3EGWB 4NASA 4URGA 1JXLA 2UP1A 2DPJA 3K0JA 2CPFA 4HI1A 1I1GA 1YBUA 2FY8A 3W5XA 1FHTA 1ULRA 2JX2A 1GH8A 5DGAA 3PFEA 3BR8A 4C48A 2HNZB 1HIYA 4JI1J 2UXDJ 4I0WA 5E7OB 2ZWPA 4Z37A 5DLGA 1SC3B 3QSYB 3QPIA 3DU6A 3NL0A 5HANA 1UP1A 5F0WA 1U1LA 2W2OP 2YWEA 2ATCB 2HSEB 4JI0J 5KFAA 2EXUA 2J0XA 2E1PA 4Y0FA 4WP3A 4ECQA 3KJNB 2W25A 1AZSB 2XNRA 4OZ0A 4DFMA 2MB0B 1RCXB 1WI8A 4DI6A 3D1QA 3BS9A 4ECSA 1PC5A 2BV3A 3LGHA 1SKWA 4YP3A 2G9OA 4LRDA 1D8YA 2ZC4A 2CNLB 3MI7X 3DI6A 4EU0A 3C14A 1K8AT 4X4UA 3MM9A 3MAAB 2DHAA 1ZYQA 1WC3A 5EX0A 4DX5A 4UTGA 5D3GB 4DFJA 3F41A 4RNMA 1X4DA 1CJKA 3O6QA 1YTYA 2AU0A 1EX8A 1UFKA 3EDRB 4NX9A 5J2MB 5LSLA 2WOMA 3MMCB 2OEMA 3P5BP 4R25A 4LSNA 4DR2F 1Q16B 5AXKA 3MR5A 2DNPA 2WRMA 1RTDA 5HO4A 4OZ5A 4CTAB 4IO9Q 1XMQJ 3C46A 2GGPB 3F0NA 4V1Ak 2W7PA 4D3GA 1NLKL 4GO5X 5GMKa 3HM9A 4LF4F 4B3OA 2DGTA 3VV2B 2ALZA 1S1WA 3MUTP 4NLVA 5KG7A 5CYMB 1E6VA 4C8NA 4ED1A 4WF9Q 1M5PC 2W1BA 2EG2A 3TZXA 4ED0A 4I7FA 1F5CA 3TA0A 3UQSA 1H3DA 1I94F 1CJUA 3BGLA 4NLGA 2DGQA 2G13A 1OPIA 2RQ4A 4KAIA 1ZPWX 2W7OA 2KFNA 3O3LA 4RWXA 2MQPA 4QWEA 2HIYA 5B0GA 1U45A 3G2XA 3FK4A 4AT1B 2YH1A 1Y5NB 1RAFB 3MM7B 1R0CB 1FKOB 4B9LA 4I64A 2XMTA 1WACA 5HROB 3M9NB 1REVA 1JJ2R 2DXFA 3KLEB 1LNQA 2K7JA 5KG4A 3CT9A 4PCQA 1B0TA 4H4KC 4FXDA 3ETOA 1RU1A 3CCLS 5EGYA 3R1HA 4OJHA 4IG0A 4DG1B 4A48A 5I3QA 2HVHA 2IA0A 3R2DJ 1IKWA 3FSXA 3VGVA 3VWSA 3PW4A 3GG1A 1IBKJ 4N76A 5F9NA 1X0FA 1VQPS 1RWNB 2BR0A 3OXGA 4QBUA 3RTVA 4DEZA 1KVKA 3QFHA 1SH3A 2G0CA 2OPQA 1NH7A 4TYBA 5KFIA 4DR5J 4NOHA 1VLYA 4NMLA 1C1CB 4ANCA 1BQNA 4YHHJ 2R42A 2G1HA 3NCQA 4HDHA 3CTRA 2RQMA 2EPIA 2YKMA 4AXJA 4DZDA 4EMDA 2OEJA 1LK7A 1Y00A 2UUTA 3IFEA 4CO0A 3KLFA 3LF0A 4LFAF 1T94A 2I2YA 2GS8A 4BDPA 4I6AA 3ILJA 3PIPQ 2A6OA 4ZP7A 2XBPA 3HHKA 1U7LA 1WHVA 2AW0A 3OR1A 3G6XA 1IQTA 2JJ4D 3NNHA 1IKYB 2KN4A 3GLJA 2DXEA 4M5DA 4F3MA 2ZNYA 3QO9B 1RYRA 1TK5A 5D77A 4EZ6A 3Q0AA 3HKWA 2FHKA 2H51B 3IG1A 1SVDA 2YXLA 4YB6A 2H3EB 3HSZA 3J7AN 2CUYA 5LT5A 1WI6A 2UUCJ 2HNDA 5K20B 4ELUA 1VBKA 2R7SA 1UEKA 3PW5A 5IC6B 4IKAA 1O51A 2JLGA 2GVDB 2MXYA 3FJ2A 1F2HA 2L48A 3J81Y 3DGPA 3VF0B 3DFEA 9RUBA 2BYCA 3G71S 4Q8EA 1B64A 4WFBQ 4X4RA 3NS7B 3D4JA 4B02A 2CYYA 1MMLA 1RZMA 1UVKA 2DD8S 3D0GE 1M0SA 3JTPA 2W2MP 4KBIA 1J27A 2VBYA 3ITHA 4ED4A 4H4KA 3KFWX 4JUZA 3UN5A 4L3NA 1CBKA 2H65B 3CDEA 4XO0A 1IKXB 1V5VA 2CDQA 2K3KA 3D28A 3DOKA 5IV3A 5KTQA 4Z2XA 2YNFB 2J5AA 4QWCA 4Y34A 1QUPA 3MD1A 3EE3A 4QR1A 2R7VA 2ZE2B 1GFWB 3CJQA 4HTIA 2DITA 4ZMMA 2XC9A 4P2FA 5D4LA 3H40A 4DR6J 2QYGA 5ETKA 1NB2A 2K06A 1KTVA 4JV0A 3W62A 2FJVA 4MKYA 1RK8A 3ZZ0A 3MM6A 2ZKUA 4O4GB 3AA8A 5KFBA 5ETTA 2ZBRA 1OY6A 1TVRB 3CD7A 1M5HA 5T7LA 3Q8VA 1SIZA 1N5TA 2YWFA 4OYWA 2Y1LB 2HRTA 4D3HA 1HKAA 2IM3A 4FBTA 1TTHB 2LDIA 2F40A 3D1OA 2IY5B 3QBCA 5EWFA 1X4EA 1NM2A 3M6XA 4I2PB 4ID8A 4Y2MA 1S1TA 2NREA 2DCLA 3E3XA 5ETOA 4CYUB 7FD1A 3KNAA 2QMWA 2F7VA 4USVA 1T05A 1GMWA 2LEPA 3LP1B 2NR0A 2M9KA 2ZD1B 3CCMS 2PSZA 1VRTB 2BA9A 1FVQA 2O5DA 2QV6A 2XMUA 4LSLA 2W8LA 3VAJA 4B3SJ 1BQMB 4K50A 2Z56B 4KFBA 2VA3A 3FMBA 4KTQA 1OIAA 2EFQA 5DZ7A 2LXUA 2EWHA 2FZCB 1VS3A 1V3RA 2OLWA 1E6YA 1HHTP 1XERA 3SDEA 4AQYF 3MFHA 1NKCA 3QRPA 3SQGA 1HW8A 3P5TL 5D3GA 1F3VA 3ZNUA 1RT6B 4ZVEA 1CS4B 3CD0A 3ZTOA 3VZHA 3DHXA 1YKWA 4ECWA 4LR9A 1JX4A 1NUEA 3RRGA 1TKZB 3DLEB 4JP8A 1YJ7A 3BPDA 4LRAA 2K2PA 5KFYA 1KHWA 4CQ1A 1P1LA 3BBFA 3NGSA 4IH6A 1S6PB 3UPFA 2I5JA 3BSCA 4I69A 4CTAA 3MMAB 1WHYA 3UDEA 5DG7A 5IM0A 2HBRB 4B3RJ 1SUQB 2QN6B 3BM7A 1GTEA 2RDJA 2D3OR 4DV7J 1RACB 2XMWA 3Q89A 1DJ0A 4IR9A 3CULA 1GK8A 2F3JA 1SV5A 1E6VB 1OWXA 3GV8B 2DNLA 2GCFA 3DGVA 4KR0B 4FS1A 4NYPA 3H98A 4F4WA 4AQYJ 2EG1A 3MPDA 2M7SA 4MK7A 1WF2A 1N36F 2VA2A 2E9RX 2J0WA 5E41A 3CJKB 2RIJA 4ZVSB 4USIA 1TL4A 3ADAC 1U47A 1M90T 1PAEX 2DISA 8AT1B 2D3O1 1VIXA 4JI1F 5HP1A 4JI4F 2YH0A 1HHQA 5DQIA 2N3OA 1HBMB 1UVNA 3CJ4A 2NXNA 1OSDA 1GMUA 4ED3A 3DLHA 3PYFA 3LWMA 2AX1A 3W2WB 2OTJS 2NZ4A 2DIVA 4HDGA 2XS2A 1RHKB 1EHWA 3SXLA 4IH7A 2QL9B 4F4KA 2GIRA 1GTHA 1FRMA 1C1BA 2OFGX 1YGYA 5M2UA 4NYZA 1S0OA 2FGOA 4G1PA 1RTJA 1X5SA 2FVSA 3AJDA 4DSEA 3FQKA 2A10A 2OJ3A 3P6YC 1RHUB 3QWUA 3AD7C 4R0EA 1HI8A 3PTWA 4C0OC 4CO1A 5I42B 5GAHU 3OLAA 2V4RA 1SL2A 1DFDA 4ZP9A 1C0TA 2DHXA 2VOPA 2X7IA 5B0FA 5C25B 2KZZA 1C1CA 1K9MT 1JLEA 1PILA 4C8LA 1RA7A 1RA6A 3UDCA 4DR3J 4Y3CA 2WK4A 3IWXA 2FJWA 5JUMA 2AD9A 4DWIA 4GKJJ 3CDBA 1BWEA 2HNYA 3FFIA 4USHA 3MPUB 1U1RA 3OFHA 1FKPA 5I3UA 3OSNA 2ADCA 1FNMA 2B7CB 1LWXA 4FPRA 2ZH9A 4EYHB 5K5MA 1MLAA 4USMA 4RPFA 2C2KB 3K5PA 1JXEA 4U95A 1WC4A 5L39A 1S7IA 5F3ZA 5F8GA 3J7Z5 1N6QB 3EPIA 3PX6A 2NQPA 1H2TZ 4WPAA 4X4QA 3VGTA 4F25A 4DR4F 1BLUA 4ES3A 3MAHA 2G2YA 3KLHA 4F50A 2MPUA 4NLSA 2Y1JA 3CDWA 5KFNA 1U1NA 1NSQA 4LIWA 4CO2A 4WYLA 1HPZB 2XO6A 2HVEA 4QU6A 4ERDA 3QGHA 3IAS9 3KMSA 2DH7A 1DAXA 2V68A 4HTJA 4CDIA 1BWVA 3MM8B 1MROA 3WDOA 2FC9A 1RT3B 1GQEA 2HS3A 3GB0A 2JFDA 5D4NA 3FKBA 2RQCA 3KK3B 1HLWA 2LDYA 2RJZA 4KHMA 5KFEA 3H20A 3GV7B 2E1CA 1D9FA 4O0IA 4LFBJ 3SQOP 4NI2B 1N48A 3Q22A 1TKDA 1NKBA 2ZBIA 3EDQB 3MEEB 1TMJA 2MSTA 3HSGA 3OPKA 1U25A 3AODA 2H54B 2EI5A 4DV3J 3SFGA 1UA1A 1H6KX 1QD1A 2LP4A 4G1QA 4LUBA 3PX4A 2HS0A 3DLJA 3PIOQ 4FKXA 1IBMJ 2QA1A 3HI9A 4YR2A 3OR2A 4ED6A 2YPYA 3T1HJ 3UN3A 4MKVA 2GQ2A 2MKKA 1S1VB 2BW2A 3D66A 1D3WA 2IM1A 3M1VA 3PHTA 1RE1B 2LKZA 3Q83A 2CQGA 3NBPA 2Y0SD 1FE0A 2OD6A 2XMKA 1DTQA 4RW9B 3MM6B 5KFOA 2DNKA 5SZTA 4DFKA 1TP7A 2MQ8A 3W5ZA 2HVIA 5A8RA 2JFKA 5B0DA 2WBMA 1SKSA 4KHRA 3V6DA 2HQCA 2WVFA 3GSDA 2HQIA 1AT1B 1OO0B 1L3TA 2FJXA 1KS2A 2V2KA 4YY3J 2AJFE 7AT1B 2EK6A 1BD6A 1LWEB 4UY8T 2RNEA 1RLDA 3FCVA 3ET6A 1DTTB 2WSCC 4ES2A 3M8RA 3D3CJ 4IOCQ 1GX6A 2ZH7A 4MKBA 2HBYB 2W01A 1VK3A 3ENQA 4FKYA 4DPXA 4LF9F 2KT3A 1W25A 3IN5A 1OSCA 1Q8IA 1LW0A 1IWGA 1RAAB 2U1AA 5ETNA 5IS2A 2VJUA 1XMOJ 2OKQA 4DXLA 4LBHA 1FK9A 1JLGB 1DQ8A 1BGXT 4ZOSA 4DSJA 4QPXA 2KXFA 5BYRA 2K8GA 3MUVP 2BRLA 3OFGA 2H5JB 1S6QA 3D1HA 2V2VA 2RRBA 3L09A 4UQTA 5KG3A 3UVJB 1U4BA 1I6JA 1T7PA 1IM4A 2UVUA 1OS5A 3GFZA 2DH9A 3MURP 3J7ZT 1K1QA 3X3UA 1FNOA 4KE5A 1O6XA 1HBOA 1YBAA 3M7VA 4KQZA 4OHZA 3KYLA 3IXQA 1YQHA 2G0IA 3C16B 4E98A 2VIHA 1SL1A 2OI2A 3HSDA 1CS4A 2M5YA 3BO4A 5THWA 4AXIA 3O8WA 5DDRC 4LSZB 3PG9A 4BBYA 2CJXB 4JI5J 2HIQA 4KSEB 2ZDPA 3EM1A 1N52B 2J9CA 3J81j 5J2QB 3IA0A 2G4BA 3KK1A 2I5JB 3BEGB 1FJ7A 2E7VA 4ZVPB 3KJFB 3TUJC 5KOWA 2F9JA 2R2SA 2Y8YA 3KLIA 1S0MA 1JLQA 3N79A 4Q7AA 5M2RA 5KG1A 3PY8A 4PWUA 1SV5B 3GIIA 1SL0A 2JC1A 2AHOB 3R6GB 2VG7A 3A8EA 5KFMA 3M9MB 2AGQA 4Y65A 2OMOA 2V9KA 4NCGA 3DOLA 2KI2A 1TV6A 1VQSA 3NWRA 2CWXA 3DU5A 4CH1A 1S59A 1RWUA 4ZITA 3HDSA 3OLBA 2HMIA 1KR4A 5AE3A 4TN2A 5CQGA 4C8KA 1HQUB 3IAM9 2KM8B 3BGUA 5CYMA 3FNNA 4ETZA 1JLCB 4P7VA 5M2PA 5EDWA 2KO1A 1FEEA 3SV4A 1HW9A 1HWKA 4I7FB 1YRUA 2EBEA 2B9XA 4M1KA 1T8EA 2AMCB 2C2OB 3GJQB 2ZFHA 2KRRA 4U7UD 4JYAF 3AB4B 2ZWOA 3R8YA 1R31A 4IFVA 3I87A 3TAMB 5KT4A 3KNGA 2E9ZA 2UXDF 3M30A 5MAOA 4DX7A 1XNQF 5FDLB 2Z57B 4B3SF 2QT7A 1P27B 2EFOA 3I32A 1IXKA 3I0SA 3OXLA 2QTWA 1DURA 2JDJA 2AYMA 2MTLA 2ZEJA 3HVRA 1LOUA 5DLFA 2DR8A 1N5SA 1RP5A 2FD2A 2BMBA 2HPUA 2GMHA 2DK2A 3KTQA 2IHR1 2L3MA 1FX4A 4K2JA 4UY85 4DOZA 2MQQA 2NUUG 3TAQA 2PT0A 1TL7A 3K89A 1WC1A 3ELHA 1RLCL 1MNEA 2AGPA 1WG1A 2CPHA 3SCJE 4O4RA 3HD1A 3G8QA 1AXQA 1B99A 2AT1B 4HT7A 4DX8H 3M8WA 4DV5J 4UOGA 3M8SA 1QSSA 2BRKA 2YKMB 2DHGA 2L9WA 5F3TA 4CIOA 2KT5A 3FEYB 1UWBA 2H9ZA 2ZH5A 5DO2A 5HL7Q 4OX9J 4OYBA 1Y11A 5J1EA 1QLNA 5EWEA 3BKTA 3I31A 1NKEA 1N5YB 1VRUB 2HQFA 4OLOA 5DQHA 2GHVC 1Q5VA 1U02A 2V2QA 3M2VA 4H4OA 2KVIA 4TU9A 1WKKA 3NCPA 4O23A 1FRXA 1IKYA 1EQMA 3DRPA 3GJRB 3QFWA 4KH1B 3EGNA 3QO9A 1CQMA 4RW7A 3UD5A 2XY5A 1EIYB 2YBVA 1X5TA 3MM8A 2IC3A 1WF1A 3TEHB 4ECVA 3V4IA 2GIQA 2M4MA 4P2SA 1RQ0A 4S0MA 2CJAA 1ELOA 3IBWA 3MZIA 4LT6A 4NL5A 4R0JA 4HT5A 1ZBTA 4YDXA 3NNCA 3TARA 3ZXWA 3GFYA 2E1AA 1N33F 1RCOB 1R8CA 3MAQA 3I0RA 3GIRA 1VJWA 1AA1B 1QAIA 4ER8A 1KEKA 1QVFR 2BQRA 3OXFA 3G8TA 4QWBA 4B3MF 1RUSA 2ABYA 3AY0A 1VHIA 3OTDA 1VQ8S 1CSJA 2HWIA 4P52A 3SMZA 1NDPA 3IR6B 1LW2B 3H5SA 1F9FA 3PCOB 3D6MB 3HKZD 4OZNA 3KK2A 2HYIB 2JEIA 3DMJB 2AP6A 2VPXB 1U0HB 2E7XA 5F9LA 2HHHF 2PMHA 5D8HB 2IDLA 4RW9A 1KOOA 4UF4A 1K0VA 4I4BA 5A2QY 5DETA 3NMRA 4DV5F 1VQMS 4WK1A 2L08A 2ZBQA 3PRVA 2BOAA 5LMUJ 2IVMA 5AE1A 2VPZB 4E2FB 1ZM4A 2CPZA 1XNRJ 1EP4B 2XLIA 3CD6S 3W2VB 2E5LJ 2IM2A 5J2PB 3KLGA 3NGDA 4I2QA 4EYIB 1C0UB 5I3PA 3P49B 2XM3A 1VHFA 4J9VA 3KDNA 3LP2B 4ZJQA 3O44A 5BR8J 1Q8LA 1WJ9A 3Q8QB 1AUDA 1PIEA 1X4CA 4QJVA 4TQRA 1R0AA 2BJEA 3JQJA 4FF1A 3EYZA 1XNQJ 3FEZA 1QSYA 3D54A 4Q43A 4I2PA 2DPIA 3C6UA 1Y5IB 1ZETA 1LWFB 3N6MA 2LECA 4CO5A 2CQ0A 2RU3A 2CQPA 2RQKA 2JLFA 2R8KA 5LXRA 2CG4A 3BBBA 4J91A 5CD4A 2JHEA 2VC1A 4O44A 1TQLA 2JVRA 4ZVQB 2XQCA 1KSPA 4B9UA 2MKCA 2W24A 3OV7A 4KFBB 3AQOA 2DEIA 1VRQC 3THVA 4LF7F 5A6PA 1R8PA 4HHUA 3O5TB 4GVBB 1X4AA 4ZIWA 1E6YB 2HBQB 3NEKA 2MHNA 3FC9A 4WP8A 4K2XA 4MYUA 4DR6F 1SB6A 2A6MA 2V34A 3SQGB 5IT0A 2HZAA 2PFDA 5FLXU 1AZSA 1JXVA 1HBNB 3CGIA 3CJ2A 3KMQA 4WZQA 2EKNA 1GX5A 2XS5A 2QLWA 3L4BC 3DLLQ 1R0BG 1Q8BA 2XYHB 3I9ZA 4LR7A 3HK2A 1H98A 1HHSA 3PW2A 4ZCLA 1LXNA 1LKZA 1T11A 3CW2C 3VZIA 3W8GA 3MFIA 1RTIB 2B5JB 1MWQA 2CPEA 2WVDA 2ERRA 4WTYA 2XGPA 3ZZPA 3SCIE 4MTPA 1RTZA 3QZ7A 1LWCA 3KHRA 3W8PA 3V81A 2NZCA 3DC2A 3FRZA 1XN9A 4LVOP 4ZP6A 1G4CA 3LAKA 2HMIB 2XNQA 2VONA 4K4ZA 3PFOA 3MMCA 3HD2A 4LSNB 5DDOC 1D0EA 1LK5A 2K3IA 1PG5B 2EW9A 2YKOA 2ZZTA 3AOCA 4XK8C 4Y2IA 4ZHRB 2ASLA 1Q95G 1AFIA 1IUJA 4WK3A 4DQSA 3BPSP 4Q2MA 1UTAA 2DR7A 3PO4A 4M95A 3MPYA 3QAUA 2ZH6A 5HP1B 2CKWA 2ADBA 4FP9A 3RBDA 4X4VA 4DQIA 4DPUA 3ZC4A 1V9OA 1HFEL 3GIJA 1V6HA 2DGSA 2OH2A 4Y2CA 1X0PA 2MY7A 4WKYA 3OTCA 2XTJP 2MSSA 3SSRA 1K47A 3HVAA 2IBKA 3VCDA 3TQ1A 2CQIA 3DRSB 3IBCB 4PPZA 4DS5A 3CCWA 3B6BA 1HYSB 1XJWB 2NXEA 2XY6A 4F2RA 4X84A 2GAHC 3DM2B 2RDDA 5I42A 3L7OA 4NZ7A 4TNOA 3S1TA 3NGTA 2PA8D 3BKUA 2FZGB 2DGWA 2XMJA 2CQHA 4X62F 2P6SA 3W65A 4DG1A 1Q1KA 3UD4P 4F0KA 3OL7A 2CNNB 4TLRA 1JKHB 1KQKA 2VASA 4KB7A 4TY8B 3X1LB 1REGX 2D74B 2DNQA 4USJC 3MR3A 1N8RT 1SC6A 3MHYA 4WXWA 4LMZA 4Q0BB 4DR7J 4AL7A 1N5YA 1XNRF 5DM6Q 3CB4A 1M5KC 5I3UB 4CI0B 4JI6F 5B0EA 3FCWA 1WC0A 4H4OB 2DO4A 5KFLA 5KFUA 2CA9A 1VBZA 3JXOA 5DZ6A 1Q7LB 3RW6A 2N4DA 4X65F 4Y6IA 1RTHA 2DNRA 2AGOA 2OUGA 3ENVA 1YSJA 2QA2A 4YFUA 2XWYA 3J7YI 3LWLA 4ZKAA 4NLXA 4B3TJ 1ZM3A 4B17A 5K14B 2R7QA 2Z2LA 4XAKA 3BDEA 2YNGA 1CEZA 2BX6A 4ED5A 3LGMA 5KT7A 1UWAA 3DLBA 3I0RB 1RWPB 1NZAA 1WORA 3CJSA 5CZVA 4IFYB 2RUGA 5RUBA 2KFYA 4HVZA 1S9FA 4ZCMA 1CULB 3H5UA 3Q24A 2RAQA 2V5HG 1F5BA 1VI7A 2VFSA 5DS7A 5ETRA 2ROEA 3OBIA 2IVFB 2BBEA 4YOEA 1HQEB 4Q44A 2V4QA 2KJVA 2CXEA 2D1CA 2ZUAA 3ZTQA 2BE2A 1UFLA 2F5GA 2RRNA 2YWWA 4PR6A 4A8WA 2D7SA 2J8AA 1D1UA 3DLKA 4I1TA 1FERA 4C7QA 3H5XA 2AZ1A 9ATCB 3LO3A 4EZ9A 1KBRA 2CVIA 4LF7J 1FWKA 1NHVA 3GR1A 1RHQB 1HBUB 1CC7A 2OPRB 3U1LA 1WWHA 1V3ZA 2HEKA 5B7WA 1EP4A 4LBIA 3EVOA 3CUNA 4YR0A 3ITHB 2Z2YB 1WC6A 2HHPA 2QIFA 4L72B 4RJVA 3WZ0A 3T5KA 1TFWA 1IR0A 3QZ8A 1B70B 2M88A 2X3GA 3B82A 3CCJS 4NLRA 1WF0A 3D5MA 3H7HB 3TZWA 3R7NB 1NPRA 4DCPB 2ZE2A 4F0HA 3OSPA 2JSXA 4I56A 1R6YA 3TWZA 3HP6A 1J5EF 1LWEA 5CYJA 3IMQJ 3CF5Q 4ILRA 1RKJA 1VC0A 2MZTA 1GEHA 4ZS6A 1WNEA 1DTTA 3RUBL 2JOQA 3LW5C 3QT8A 3C6UB 5AT1B 5KFQA 1Q86T 2HAIA 4KGZB 4KO0A 1OJ4A 4MIWA 4MFBB 3U1MA 4CRJA 1ZAWA 5HVGA 2AJ0A 1ICEB 1RT7A 1Y3KA 2YQ0A 1URNA 2CZVC 2P9CA 5D0HA 1HI0P 2R8JA 1M5OC 2E5LF 4KRWA 1HNVA 1G3OA 1MG7A 4HH0A 5DG9A 4IRCA 1U6FA 3W5YA 1T02A 4CT8A 3NLCA 4LF5F 1NEEA 2RVJA 2IPOB 3H42A 3H8YA 3WBZA 3POTA 2QLFB 4ZIVA 5DGBA 1RXOB 4XIUA 4N8NA 3FBCA 3RZAA 2VQEJ 3T5JA 2KYZA 2DHSA 3DRRB 3CNQP 1UMJA 3HCXA 2ZBCA 4NA3A 2POKA 4OYMA 3GV5B 2R2TA 1F9EB 2LEBA 4UOFA 1WELA 4DU8A 2QZ8A 3AJ2A 5KFKA 4DF8A 2ASJA 4V19X 3TUPA 4LFBF 1B0PA 1HNWJ 2FQQB 2ZOFA 4KPCA 4DR1F 3Q8YA 4NXNF 3DDNA 2HFUA 3KUGA 1R6VA 5FD1A 4TY9A 4B3MJ 1APSA 3CCTA 4C11A 4R5PA 1RB0A 2I8EA 4C3KA 3DDIA 4C3MA 3OJUA 1C4AA 2QX0A 4OI4A 2FLPA 4B3RF 1XMOF 1R8AA 1RAGB 2B8PA 2DB1A 1Z2LA 5J2QA 1Q81T 3PV8A 4PXDA 2HW3A 3KK1B 1IKVA 3FZ2A 2CPJA 1K1SA 2KZMA 1HI1A 4J5OA 5CAAA 5T14A 2BE7D 1SQGA 4DL0C 1KWMA 4ZLJA 1S12A 1CJTB 3IR5B 4OI1A 1WOSA 2ZHAA 1QE1A 3FBFA 1S48A 2BABA 2JL9A 3F44A 5C2GA 1GMWD 2B56A 3DOLB 4K59A 2W7AA 4QU7A 1CJKB 3EXYA 4J9LA 2E9TA 4DL5A 2R4FA 1HWJA 6FD1A 4QIEA 5GADU 3M8PA 2KU7A 3MMBA 3HVTB 4P2MA 1S5ZA 2I6WA 4EBCA 5CCLA 3IP0A 2DBBA 4HKQA 2PDAA 8RUCA 4ZPTR 2YKNA 2YX4A 5CXTA 1OMSA 4ZLLA 2CNKB 4HEA9 4ZN1A 3DRSA 2AV5A 2WVCA 2YKAA 3CJ3A 4L3KA 4NXNJ 1N5QA 1HBMA 2DGXA 2YNIB 3BB5A 3MR6A 2AX0A 2RT3A 3NRBA 2COLA 3T19A 3M2RA 3W3SA 3GJTB 1F9HA 1S4FA 2ZJQQ 2QL7B 2OPSA 3R27A 1M5VC 2BKPA 2GV1A 3EWGA 3N9UC 4OZ3A 5HLFB 2IAJB 3MCMA 4LF2A 3P4UB 1RT5B 3TA1A 3ILLA 1FRHA 3V5RA 5GAEI 2R7RA 2FHJD 1IR2A 1FDAA 2V6AA 3D68A 2CJBA 4IH5A 2GMJA 4Q0BA 1FESA 1SCJB 2PMZD 4OI3A 3R6LB 2IDEA 2IJFA 5A76A 1KONA 2RU9A 1GXUA 2FJAB 4DSIA 1AB8A 3AXKA 3B8HA 2FGCA 4HLBA 1U6ZA 4LVNP 4KHPJ 4IG0B 1T0TV 4N7TA 4F4XA 1QJHA 4J90A 3SSSA 4ANEA 2DR5A 2AJQA 3MEGB 2XMMA 4A8YA 3V6JA 2QYCA 5J1EB 4RW8A 3VALA 2PEBA 2Y1RI 5K14A 3P45B 4DV7F 4O3RA 3R7SB 4H4MB 4NLWA 3JQKA 2VB6A 5B08A 5ITHA 1WEXA 1IBMF 2GW8A 1N34J 3MCSA 3TZZA 3PO5A 2OIHA 2VPYB 4N56A 2XHWA 5FIIA 1SJ3P 2HHWA 1PC4A 4IFYA 1IJEB 1NDKA 1YZ6A 3W9IA 4JI2J 3RW7A 2VC0A 4BC7A 4C0BA 4ZLNA 3QIPA 3CO9A 3T9ZA 3KLHB 3ZO7A 3NS6A 4USTA 3ZZOA 1A7GE 1S7HA 4IOAQ 5F8IA 2LFVA 4M5GA 3BH6B 4DSFA 2XZTB 4AFFA 4RLEA 4DUTA 3BKFA 4WTOB 4M5DB 4W98A 4TU8A 2C3PA 3JTOA 2DNMA 3OFFA 3TUIC 2VQEF 1SKRA 4WP9A 4P73A 2BJ3A 4IRDA 3N5FA 2AJ2A 2HQDA 4L75A 4MT1A 3GZ7A 2FUG9 2R8HA 5BYQA 5KFHA 1UVJA 3EUNA 2ALYB 2RHSB 4PZVA 2IIHA 4QWAA 3HO1A 3DYAA 4JI7F 1UVMA 1NSKL 1U0HA 3CJ0A 1VIOA 3D0HE 2F8HA 4X4SA 2HRYA 1RAJA 2JWNA 1R27B 3M8QB 4RX6A 4NEYA 3JYTA 3EVWA 3QAEA 4LQ9A 2VQFJ 5C7PA 2NXUA 1GT8A 4QWDA 2ZJRQ 5L1KA 1U1MA 1KKHA 2B9EA 3EXCX 2MZRA 4XDDA 5F0UA 1YVFA 5DJBA 2GA7A 3RAMA 1JMTA 3OR2B 3P8BB 2J6SA 1SJRA 3FSYA 4CLFA 3NNAA 1LEOA 2RS8A 4JB8B 2HGNA 2Z8QA 3W2VA 2F9DA 1SJQA 4IG3A 4ICLA 4KT0C 4XPCA 5GAEU 3VAKA 1KHVA 4MIAA 1IBKF 2GJIA 1QY7A 3OT9A 2RKIB 1IKXA 1YWXA 4LF6J 3NS5A 3TJ8A 4EK2A 4JI3F 2J9EA 2Q6BA 1FXDA 3F73A 3V6DB 3QWPA 2AEJA 3SEOA 4A46A 2BUNA 2WW4A 4GO7X 4U7CA 2F4VJ 2JLEA 5LJ5Y 2H48B 3P96A 3V6HA 3SFUA 1CG2A 3CD5A 4NLOA 2HHQA 1HQ2A 3PJ9A 4O3NA 2LQ8A 4F3QA 4DR4J 3K2YA 3BV8A 3ISND 1FNXH 4WKRA 1O0PA 2CQCA 3BBCA 3BREA 4LFCJ 2CVEA 1PCAA 1B0VA 2IRXA 4ALZA 5K8OA 3W61A 2LQJA 2QE5A 3E51A 1JLGA 3ENAA 2MZ1A 2ZH1A 5L1IA 4DV1F 2HWHA 2BACA 2WW8A 4CWBA 4DV4J 4ZA1A 3GYGA 1KVJA 4HI2A 1JNRB 3R5BA 3SIPB 1S1TB 1S6QB 5E5NA 1FFWB 3UVJA 3I82A 5D6GA 1CJVA 2QSWA 2ZITA 4FYVB 1S99A 2RDIA 2BE9B 5D0EA 3DLGB 4DPYA 1DZ5A 4C4WA 1GNKA 3L95X 3PKMA 3R3TA 4CM0A 1ZPVA 4DSLA 1DQAA 1LQ9A 4E8UA 1MWYA 1YJTA 2JEGA 1BQMA 1CJTA 5IQ6A 1WOPA 3NOCA 1VFJA 1WDDA 1NB7A 2G1DA 3WC0A 1I51B 2H4YB 3JQMA 2C3UA 1LXJA 4F26A 3C3LA 4L6V3 1TAUA 2VFUA 1IR1A 2ZH2A 1KOHA 5EHHA 3V81B 1SKUB 4V19J 1ZZFA 1KRPA 3TI0A 4YB7A 4ZHRA 5CD4H 1UETA 5J1PA 3Q23A 3RRKA 1HR0J 3T6JA 2ZHBA 1T9TA 3UWTA 2N4CA 2XI3A 3LOUA 1JLBA 3GTYX 4AL6A 4DS4A 2NXJA 1PJ6A 4KGXB 4OZLA 1SJ4P 2MKYA 1S79A 4DBQA 1OQ6A 2DNNA 4NCGB 3DOMB 3V6KA 1ZOTA 2HQ3A 2VV5A 4LF8F 2WHOA 1RAEB 3H59A 4RW4B 2MZJA 3H4DA 5MLCV 3EGZA 5J2NA 2ZUGA 4PG4A 4QOTA 2Y8WA 2XSJB 2C2MB 4DQQA 3M2RB 2FJDB 5AXNA 1NK8A 4PG6A 3MMJA 2W2PP 3VAIA 2E7WA 4JOUA 2XGQA 1A0OB 1FI4A 2O1PA 2ZH4A 3CJ8A 4PQUB 3R1LA 3R5AA 4ZPAA 2VKZG 2M8DB 5EX3A 5A0YA 2NS1B 1RT5A 2W9CB 3TZYA 4ECUA 3M30B 2RB7A 4C0HA 1F1BB 3GSIA 3LAMA 2FLLA 4ZVHA 1P6TA 2EK1A 4U6PA 1WSRA 1J5OA 3GILA 1VLOA 4NLDA 2N7YA 4YMEA 2EFPA 4GMKA 2WBRA 3W2WA 4ZN3A 1AW0A 1HWUA 3RJMB 4DV0J 2NSCA 3LA0A 1NPKA 3CWJA 4DCJB 4UOHA 5HAOA 4F04B 4UT4A 3EICA 3H5YA 3MEGA 2W4DA 4DL6A 1FX2A 1ZM2A 2EFGA 2VFTA 3OFEA 2E5JA 4N77A 3EX7B 3K17A 4ID5B 4X66F 1U49A 2MQOA 5CH7B 3PW0A 4LQ3A 3THTA 3S8SA 1NU4A 1S1XB 2V69A 4H4MA 3M2UB 5H9FJ 3UNGC 4M8LA 1BMQB 5SUHA 5AE2A 1FXRA 1RWOB 4DV2J 3CMQA 1QTNB 1H2UX 2MEWA 5L1LA 3W63A 2D41A 2KHDA 2PMWA 1KC8T 5KT5A 4PUOB 4Q45A 2F65A 4GKKF 2PC6A 2V9WA 2RMLA 3T6BA 4A4JA 3OHBA 1VBYA 2FIUA 5F8NA 2WVBA 1U24A 2FVRA 4JV5J 3RB4A 2Q43A 3MF5A 2YY3A 4DUZF 2Z2ZA 3FRYA 4UW2A 2X1FA 3NAIA 3CMES 2HAFA 1TL5A 2FDNA 1H7XA 3KG0A 2HHSA 2PGCA 3CJRA 3MOJB 3K7RA 3E8OA 1I5OB 1NJWA 2H4WB 4OHYA 1H72C 3HULA 1IJFB 4RW6A 1SXLA 2KM8C 1IBCB 2JVOA 4JI0F 3UDLA 3TP2A 3NCRA 4DMZA 2CRLA 2MLZA 3Q8SB 2E5IA 3C15A 3W1YC 5A6WA 3RBEA 3L7PA 1L3UA 1YHQS 1VMBA 3W7BA 2LQ9A 2YWHA 2QG9B 2FC8A 2IRUA 1MROB 1SBRA 2UUBF 3HHNB 4NA2A 4OX8A 3QLHB 1SH2A 2B9WA 2HKEA 2KKHA 5J1NA 3TQEA 4K4XA 3J81U 4K0KF 2V4JA 1RHJB 1RT4B 1HMVB 4KH0B 4OYPA 2B51A 2O3DA 3KK2B 2R7WA 4NI2A 1K44A 2GIFA 4B9NA 1KFDA 4MJKA 2V67A 4RUBA 3CJTA 3N0VA 2VBWA 3M8ZA 4G65A 4RBUA 4PPDA 5K9FA 5KFRA 5BR8F 2XI2A 1XC9A 3PEJA 2XCAA 1CVJA 1SPBP 2MQMA 3O2IA 1UL3A 2DTJA 3VAMA 4ZPWR 1PBAA 2CQ3A 3GYXB 2EFNA 2Q3PA 3K5MA 5GVQA 2HK3A 2YX1A 4NYOA 2UXCJ 2C3YA 3I5AA 1QUVA 4X66J 3W9HA 3BO3A 4FF2A 1R3NA 2XYGB 5C2CA 1T9UA 4DR7F 4C3LA 2D3ZA 3IM8A 3KG4A 4R8UB 3IWNC 2KFZA 1VC6A 2NCKL 2WB1D 3G87A 4L73A 3PR5B 4K4UA 3AB2B 3B4DA 5IV4A 3UFCX 3PACA 2HGLA 1S4EA 1DLOB 4KV8B 1X7VA 1Q8KA 2DY9A 4Y2KA 3LPEA 3LUYA 1GMVA 2LCWA 2V8DA 2DRDA 3HHLD 2DR6A 3A3NB 2NXCA 3POTB 1X4BA 3VHQA 1EAYC 5ADZA 2RS2A 3T1YF 2C3OA 1UA0A 4F7VA 3BN4A 4F02A 1LW0B 1N54B 2UUAF 2P2CB 3DLGA 3CMAS 2Y9HA 2GJFA 1FK9B 3MCNA 2M52A 5U47A 2FYXA 1G6BA 3BQ0A 4EEYA 2XG8A 5KT2A 3N28A 2A2CA 3G96A 1JJ4A 3MEKA 1RI7A 1WG4A 2ZVSA 2JNJA 2X51A 4R5PB 4LR8A 1NJYA 3K5LA 4OLPA 3J7YU 5IC4B 2BOPA 3RBXA 2Z58B 4GVBA 4PKDB 3EGVA 1FTCA 5LSRA 2MQLA 1JB0C 2Y3YA 3H25A 1N36J 1IKVB 2MJUA 3RRHA 3NAHA 5EWGA 1UW9A 2B8QA 2VHGA 2UVWA 3C6TA 4UOCA 3C16A 3RB3A 4TKTA 2XLKA 3BGRB 3KUEA 2V8HA 1WD6A 3MEDB 3PYGA 4NPOA 2A1BA 2FHMA 4PG7A 5E2QA 4JI2F 1ZH5A 3PNIA 4PXCA 3JS9A 1RBLA 2XSFA 1JLBB 1TL1B 4K5SA 3S6EA 4X65J 3SI8A 3M6WA 5K8MA 4RZRA 1TR0A 4RR5A 4JI6J 1LWCB 3UE2A 2YKQA 3AA9A 4PG5A 4KGMA 1RWKB 1WDTA 2M70A 2B4VA 1F5AA 2LEAA 4RW4A 1RAOA 4NLTA 2WONA 4A8SA 4N5SA 4OJ3A 1OY9A 4Z7CA 2J9DE 3MMBB 3PX0A 2DNOA 1TAQA 2VG7B 3HHLA 1HL6A 2ASDA 4KHPF 4WXOA 3J80U 1S9GB 3TX0A 3CIMA 2QLBB 3G82A 1TV6B 1AYEA 2HFNA 2MMYA 3CCSS 4CP5A 4ZPDA 3PEHA 2DNYA 4WFNQ 1Z1ZA 4NLQA 4PG8A 4DL7A 2A18A 3QIDA 1T9VA 2CPYA 4NLPA 2YNIA 3IBFB 5LMNF 2QJ3A 5F41A 2CG8A 3ENWA 2M0GB 4OZ2A 4DV0F 3OVBA 5BJRA 3E01A 1QSLA 3LP0A 2L9NA 4FYDA 2FVCA 1URRA 4UQGA 1S97A 2AEMA 2GQQA 3TAMA 5CYQB 1PGZA 4B9VA 3S7RA 2DJWA 4PYAA 1SJFA 4JBCA 4OIXA 5FDLA 3A4TA 4DV6F 3IRXB 5E3QA 3CIZA 2O01C 3MPWA 2X1AA 2WAQD 1NJZA 1YRTA 3JSMA 1PKUA 4O3PA 4DHVA 1XEZA 3VR1A 4P75A 2F63A 4P6QA 2ASYA 4URQU 5E3AA 1KVIA 4IR1A 4PUOA 2AQ4A 1JKHA 1YITS 3C19A 5LJ3Y 4FXWA 4PEOA 3FGVA 4TY8A 2XZDB 1NDCA 4W90B 4HHHA 3B54A 3W60A 1TUWA 3US5A 3BO2A 1VQ5S 1TL7B 4LF8J 4ZCKA 3D6TB 4DUYJ 1YJRA 4M5KA 1NK0A 4UZCA 4WCEQ 3G6ES 1VQ9S 1Y3JA 2PFFB 2UU9J 1YG0A 2RILA 4AYBD 2G2OA 2SXLA 1MU2B 3TW0A 2IJNA 4PRFA 3UN2A 3VVTA 1RBOB 1MN9A 4X64F 2CFXA 2KYXA 4HACB 4OX6A 1FJGJ 1Y10A 4IRKA 4K0KJ 3KDOA 2OTLS 5KFZA 5E33A 4NRTA 2PI4A 3A13A 3D9BA 3MDFA 4QYRA 3C15B 5B0AA 2ILYA 2W9BB 4RW7B 1YI2S 2ZBPA 3QQCD 1C2PA 1O5JA 3A1YG 1CULA 1HWLA 3H2LA 3CXCR 2J6TA 3MM5B 3QNWB 3V4IB 4PWDB 1U1KA 4X4OA 1GXLA 3AT1B 2KHCA 3GMGA 3AD8C 3IS9B 1HQEA 3MTKA 2MGZB 1RT4A 2UVVA 4BS2A 3T3FA 1NCLA 2BE2B 2AWZA 4B08A 4MIBA 1XTZA 1FDBA 2PE8A 1N0VC 2QO3A 1L3SA 2ZNZA 4OX7A 2KVQE 4LF9J 2DHHA 4OYZA 2VODA 3NGKA 3C66A 3QSIA 3EJMA 4TXSA 1VQLS 3J80Y 3EZUA 4KC5A 4PQAA 1YLXA 3CPWR 4DL3A 3D7SB 1XMBA 3FBBA 1F2GA 3GPAA 1QAYA 2Y0BB 3DMJA 1X4FA 4C8ZA 3FEXB 2KB2A 1XR5A 4IO1A 4R8UA 1UAWA 1WHWA 3UW1A 4QW8A 4J9NA 4ITSA 5ETQA 4YHHF 3Q8UA 1RWXB 1Q78A 1XIQA 4A8OA 4DV2F 5ETLA 1CLFA 2PI5A 3NY0A 4ZVOB 2HK2A 4FYXB 4FXVA 1RYSA 2CPDA 2VBXA 1PJ5A 2WSEC 2FJBB 2AYBA 1C0UA 1J2VA 2XHCA 2JRSA 1R8HA 3NG8A 2G2ZA 1VQNS 3FMWA 1SIWB 1FRIA 4MFBA 3MECA 1RT7B 2MKJA 5HJXA 1VQOS 4A8FA 3AOBA 3ICLA 2GQCA 5CZXA 2XCPA 3AJ1A 3QGPA 2QA4S 3BSNA 2C2DA 1P9YA 2W4PA 2XULA 5DRKA 4JV2A 3G9CA 1NNDA 4E0DA 1YRXA 1FD8A 1MSWD 2C3MA 3AOAA 3HZGA 5KOXA 2HNZA 1T03B 2GZOA 1N0UA 5KFCA 1VBXA 1BC6A 4NWBA 2N7CA 1MN7A 3FQLA 3DRRA 2IVYA 1Q7YT 1EETA 2XS7A 1YZ7A 2DCUB 5HN0A 1I94J 2GVZA 2CNOB 2X1GA 2JEJA 4K4WA 1VDHA 4OYXA 2L41A 3K59A 2KDOA 4DU7A 3MR2A 1VGYA 2YWKA 1NPPA 2K1RA 1H38A 4JI4J 3ETMA 4LBPA 5L38A 2RH3A 4C11B 3SV3A 2E44A 1M1HA 3MTJA 1XR6A 3DI6B 3RR7A 2HFOA 5HI7A 2F8MA 2GAGC 1WKLA 3R97A 1FFGB 1Y9OA 2A3JA 1U2RA 4QR2A 4MK9A 5AJ3F 4C2MA 4ZP8A 3JSBA 4DN9A 1YBTA 2IYIA 3DDKA 2RF2A 4QPTA 4Y00A 4QIFA 1WEZA 2AEFA 2AIRB 2OPPA 5GAHI 2J8SA 2OGUA 2WOMB 4M94A 2UXBJ 1QE1B 1IQZA 1T05B 1ZA1B 4OI6A 4ECYA 2RD5C 3RU0A 1VK8A 1FJEB 1WOOA 3N6LA 3NGUA 4ECRA 3M6VA 3OTOJ 3A3OB 1DRZA 1S1WB 5J2NB 1SI9A 4U8VA 5D0RA 4I6YA 2XSJA 3I4PA 4CT9A 3UCGA 2LQBA 3U02A 3R7BB 5C24B 2HLUA 4X62J 1MWZA 5HJYA 2DRBA 2VL1A 4W92B 2YKNB 2CQ4A 3UCZP 2AYEA 1U8WA 3ZTPA 1LV5A 3MOZA 8ATCB 2ZM6J 2YKPA 5A0YB 1VQYA 2BKOA 1NZ8A 2W9CA 2B43A 2CPIA 5L8RC 1FKOA 4ZVTB 3W66A 2HRUA 1F3FA 2BXJA 3IRXA 4PXEA 5HBMB 3Q8RB 1R89A 3KLEA 1B7FA 3H90A 3A3PB 3NMAA 2OPSB 1D9DA 3LPYA 2DEJA 1YJUA 2RE1A 2UUAJ 2XB2D 4LFCF 2IAJA 1S0VA 5KFFA 2OSQA 5KFXA 3QJJA 5IFMA 2BQ3A 4WE1A 3C8YA 1NJIT 1UKUA 1RT2A 2BVZA 2G0JA 2O66A 2P8IA 2D9OA 3DM2A 4JI8F 2JZ5A 5K8PA 4DQRA 3CC7S 3OUYA 1R7IA 1S1XA 3FBEA 1HNZJ 1YX2A 1LFWA 4CO4A 3K57A 1T95A 4M5IA 2R3VA 3R5CA 3TNVA 3LTOA 3NOGA 1MU2A 2GNKA 4IOBA 2GFFA 2V2ZA 4CLSA 3KLFB 1S0NA 1L3KA 3HFKA 2DGVA 4RW8B 3QJLA 2KG1A 3KJVB 2E1RA 3JB9k 1TKTB 2CJYB 2OMLA 1UFWA 2ZZMA 3VAGA 5AJ3J 3KXDA 4XTTA 3HX9A 1UPMB 3BQ2A 4X2BA 3OQ2A 3GR0A 1U1OA 1RTHB 2ZVIA 3PYEA
chains in the Genus database with same CATH topology
5KG2A 5D4PA 2BZ2A 3T5LA 2HS4A 3N5BA 1XWLA 1G7CB 3IS9A 3VAIA 3GG0A 3QIPB 3CSKA 2VG6A 4J37A 2MGZA 1KNZA 1KN6A 3U7JA 3OVAA 1K0TA 1HA1A 5G0RA 2FTRA 2W8KA 4J9QA 2MQNA 2DNHA 3C2PA 4FNHA 1FVSA 1KFSA 4QZVB 1UVIA 2HHTA 2YTCA 3CC2S 1BQXA 4HHJA 3QLHA 1S10A 3WX4A 2E5HA 3IGNA 4N47A 1JJHA 2V4JB 3CVKA 3M6UA 4A8QA 2E66A 3DYAB 1L5UA 3DLKB 3PM9A 1VQ7S 1MMNA 2ACYA 3FCHA 3IO1A 3M8QA 3BQ1A 4N41A 4AL5A 4WFZA 2FLOA 3I55S 1M90T 3DOKB 1QM9A 2R2RA 2ZC3A 2XZWA 2OPRA 3EZ5A 4NXMF 1X9WA 1HNIB 4G3IA 2X1BA 2DGOA 3L3CA 3UR0A 2YNHA 3V6HA 4YY3F 1JLAA 1P1TA 4N8OA 3HJFA 3CEDA 1FJCA 3GYNA 1SJ1A 3U1NA 2HHUA 4EUVA 1KQGB 4YB1P 5DQGA 5GAGU 4UUWA 4RBTA 2BANA 2FHOB 2P6TA 2C2EA 3PR4A 3UR3C 2J0SD 5EN1A 1YJVA 1KD1T 4KKOB 3SCKE 2AF6A 4FF3A 2QA4G 1Y0HA 4X4NA 4PQUA 4XDCA 4OJ1A 3PVXA 1S9EA 4FNIA 4B9MA 3H2UB 1FT8A 3DN9A 5LMUF 1U8SA 3DHWC 1IBLF 1TUVA 3ISZA 4WU3A 1EETB 2J7WA 1RJJA 5K8NA 2UUCF 1HNVB 1VRTA 4KPYA 4J9PA 2DT9A 2NLWA 3WC2A 2K1RB 3QGIA 4O3QA 1FA0A 3ZZTA 2XWXA 2GX8A 3DRYA 4MKAA 2CQBA 4YQWA 3TANA 3B78A 2ILZA 3TAPA 2XLJA 3T1AA 4DF4A 2C22A 2GO8A 1Q4RA 2R7OA 1JWWA 4ED2A 1N88A 5DG8A 1SH0A 3M05A 1UEUA 1N32F 4OQJA 1JLFA 1G1XA 3BGRA 1X5OA 2VFRA 1FJGF 3I5BA 5C5JA 3DCAA 3BSAA 3SCLE 3I96A 3FVYA 4O3SA 3KHLA 3TVZA 2NUHA 2GMLA 4FBUA 4ZDNA 4EBEA 3OL6A 1U1MA 2VKRA 4TU7A 1T05A 5LSOA 2Z2MA 3HLUA 1N4LA 5KFSA 2YWGA 2KXNB 3R5DA 4OHXA 4X4TA 2YVSA 5AXMA 2I38A 4FS2A 1OPZA 2Y1IA 4B3TF 4OHWA 2WONB 3CDAA 4X4PA 2JC0A 1HR0F 4DR3F 3GFHA 3HHLB 5C24A 3HZEA 3Q2TC 2FLNA 4OJGA 2MDAA 4ELVA 1ZZNA 4TYAA 4WJBA 1H0HB 1R8BA 2GGPA 3DOMA 2LXIA 4A47A 4OHVA 2KTQA 1U1QA 1TKXB 3CCUS 4LJMA 5LL6d 2XEXA 1NK6A 1RISA 3M8PB 2PN6A 2UZAA 4YB5A 1UVLA 2PIIA 3HVTA 2CZ4A 4RU9A 4GC6A 2W4CA 2Q6CA 3QYYA 1N5VA 3E01B 5KFDA 4CH0S 4TQSA 4ATNA 1FKAF 1BY9A 4RWWA 4ZVFA 5CYQA 2R8GA 2OFHX 5C42A 4ECZA 1MW7A 1RT2B 2HWTA 3DRXA 4OZJA 2A2DA 4RUAA 2GJ2A 3OUYB 1REVB 2B4PA 2HGMA 2QFJA 3IWLA 2ZH3A 4J9RA 5E3CA 3E2EA 4OI0A 2C42A 2R2UA 2QEXS 4K4VA 4DLEA 2QRRA 5C25A 5HMXA 3OW2R 1FXLA 5HLFA 2NPFA 3MGJA 1JLEB 4JV5F 3ZZUA 4WIIA 4URSA 2UV8G 4ECXA 1VQ4S 4C8KA 1FRJA 2VG5A 1VQKS 3N01A 1KQFB 4MH8A 2VUGA 5DDQC 2HNYB 3FFIB 3K5OA 3OTOF 5E3PA 4QYZJ 2J7KA 2P9EA 4OV1A 1FE4A 1TKTA 3PHEA 2MY8A 2P9GA 1NKBA 3ZFVA 3JAMY 2CIMA 2H5EA 1S1UB 4J9MA 2N82B 2IBOA 2PEHA 4KGKA 5JVGQ 4DN0A 5H1SV 2UXBF 1M5SA 1C4CA 1X8DA 2B6AA 2XMVA 3HXMA 1NK4A 2VG6B 2ZDOA 2B9YA 4WU2A 2HFZA 2XY7A 1FCAA 1A6LA 5CHCB 4NRUA 4ZLPA 5F8LA 2W9BA 1KLNA 5HQ8A 4RU2A 2DVIA 2GHWA 3PJWA 4YDDB 3CDUA 3MM5A 3G6YA 4RW6B 2U2FA 2O67A 4ZVGA 4MMOA 5CA5A 3LALA 2WB4A 2PO4A 5EUHA 5A8KB 2V8VA 3K58A 2IRYA 2D9PA 4FN5A 3BSOA 3I4HX 3MEEA 2JEFA 1UJ6A 5A8WB 4B9TA 3MD3A 2MJNA 3ZZYA 2Z0GA 4C8OA 2VPWB 4A8XA 3VTIA 3I5CA 1S1VA 3M1VB 2KT2A 1Q79A 3KWMA 2CQ2A 3OTBA 3OTEA 1DTQB 2B7BB 5F8MA 3QJPA 2FY1A 2KRBA 5JXSA 2VFVA 1N34F 2BANB 2YNFA 1DQ9A 1U26A 1W2BR 2MKIA 3UD3P 1S6UA 2P5VA 4ICLB 1TL3A 1S9EB 4IG3B 4MYTA 4QR0A 1KLMB 3G8SA 4K4TA 1V3SA 1Y4ZB 4O4GA 2RKIA 3OJSA 1X5PA 4CZCA 2K7KA 1Y5LB 5IXUA 3M32A 3PRBA 3P3DA 3RAQA 4DPOA 4K4SA 2PD1A 4ES1A 4YEAA 5KG5A 4KV8A 3TVKA 3T1HF 1A9NB 3AQPA 2J6UA 4CO3A 5HMWA 1T03A 2J0QD 4Y2AA 1UJ4A 4RUCA 2IMOA 5E3RA 1U48A 2BQUA 3F56A 2ZD1A 2ZH8A 1FRLA 2LQ5A 4F3OA 4IYQA 2GC8A 4EGLA 1HBOB 2M8HA 1NK9A 2ROGA 2UUWA 1JLFB 3JTNA 4DJBA 5L9NA 5H9EJ 1SL2A 3O1LA 2DGUA 1YIJS 3UCUP 4GC7A 2ZZNA 5KFWA 2EBGA 5LXYA 3KHHA 3SZ2A 2UVRA 3AAWB 3SDEB 5IT9Y 4M63A 2OO4A 3C6TB 2HHXA 3G4SS 2RF2B 2MHEA 1JLQB 2OPPB 5L9XA 3RR8A 4BWJA 2BM1A 4U67Q 1F60B 1FTRA 1W2IA 2WTFA 3CCZA 1TKZA 3DLEA 1HD0A 5KFGA 3ZZRA 4DL2A 3G6VA 4BHQA 2OTJS 1NK7A 1S6PA 3CCRS 2VH7A 2DNGA 2OSRA 3MMAA 2FHJA 5IM0B 4WZMA 1TK0A 2B4UA 5J2MA 4RUHA 1TFYA 3TX8A 2AYGA 4BCAA 3DNCA 3HHLC 1JLCA 5D4OA 3HVWA 3I9V9 1Q53A 1N56A 1RTDB 4OZ1A 1FDNA 3RB0A 3IC1A 5T41A 3CJKA 4O3OA 5KG0A 2LA6A 1XBWA 4IQXA 3BR9A 4IFVB 1NHUA 4B3OB 4EWTA 3PRDA 1K73T 1KQSR 3JYTB 2C2RA 3TR5A 4G1IA 1H7WA 5GAGI 3BJYA 2DR9A 3NKYA 1G2EA 1L3VA 4C9DA 3N4WA 3GQCA 1FO1A 3KKFA 1UEVA 5JJBA 1Z4UA 4C97A 3G86A 1JNZB 4QW9A 2KG0A 1C1BB 1RT1B 5KFTA 4ECTA 3GFXA 2QLXA 1DBDA 3IRWP 4EO6A 3MM7A 1Y7PA 4DV4F 2LA4A 2C28A 1J5OB 4QQBA 4CNYA 2KJWA 2KXHA 4QCLA 1XMQF 1VOMA 3JSMB 1NJXA 1YJWS 1S49A 4JV1A 4NCAA 3PDNA 4RNHA 2HLTA 1HWIA 2FPHX 2EVZA 3M4XA 4HH1A 4I6WA 4Q2LA 5L1JA 1GAOA 5IQQA 1S77D 4EBDA 1UWBB 3KG1A 4QIGA 3VQSA 2AJ4A 1ZTTA 1UW4A 2DH8A 4ID5A 3VAFA 1R43A 2APOA 3VQTA 2B6AB 2V8GA 2YQ3A 4EFAC 3M2UA 5B0BA 6FDRA 2XO7A 2MZSA 2OPQB 3RB6A 4NZ6A 2EC0A 1H2VZ 1RGVA 2VOOA 4IQMA 3M2VB 4DFPA 1BQNB 3BGFA 4LF6F 4DV3F 1N6QA 1QTMA 3JSYA 5KFJA 2DO0A 1U6BA 3QMQA 4RNNA 2HVZA 4I67A 4UUXA 4OFZA 2B0GA 5IT4A 4KJIA 4ILLA 1U1PA 2Q66A 2OD4A 5A8KA 1HPZA 2RSQA 4Q5VA 3DXBA 3AHPA 2MYFA 3AH6A 1D9AA 3T9NA 2RRAA 2ZOGA 2M2BA 1RT3A 4RNFA 5D78A