5LJ5Y

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lj5Y00
3CCSS 1ZH5A 2LKZA 4F02A 2I38A 4QQBA 1A9NB 3G8TA 1S79A 2DNOA 3UCGA 2CQHA 2VODA 2MQOA 3HHNB 2MXYA 5FJ4A 2MB0B 1B7FA 1FT8A 1OPIA 2QFJA 2DGSA 2LCWA 4WIIA 5DETA 3US5A 2CQPA 2E5GA 2MGZB 1VQOS 4A8XA 3BO4A 4RU2A 1VC0A 2DNMA 5H1SV 5GAHU 4EGLA 3NNCA 3VALA 2EVZA 5LXRA 3VAMA 1P27B 1PO6A 5LJ3Y 2DGXA 5IFMA 1VQLS 2G0CA 2U2FA 2DK2A 2J76E 2MY7A 1DZ5A 1X4AA 2MMYA 5DM6Q 1WG5A 3I55S 1YITS 1R8HA 2M8DB 2XS5A 2AYBA 2DGQA 1XN9A 5DDQC 2KM8B 2ZJPQ 3CCRS 4YOEA 2DNHA 4U67Q 1M90T 2K3KA 4WFBQ 1SJ4P 2LQ5A 2CJKA 3VAHA 1YTYA 1N54B 5EN1A 1ZZFA 1WWHA 2M0GB 2EK1A 2DH8A 3CPWR 3CCVS 2AYMA 2DH9A 2DNGA 1QM9A 1H2VZ 1URNA 2HGMA 2MJNA 2KT5A 4W90B 1WI6A 1Q7YT 5JVHQ 1U1RA 2CQIA 4ED5A 2B0GA 4IOCQ 2L08A 3CXCR 2GHPA 1M5VC 1SJRA 3BO2A 4PRFA 2M2BA 3UCZP 4OZ0A 5DDPC 3B4MA 3SXLA 5HL7Q 2KM8C 2LEAA 1O0PA 3ULHA 1WI8A 3NS5A 1JJ4A 2KXNB 2ZJRQ 3BO3A 2G4BA 4LMZA 2KVIA 1M5KC 2F9DA 5GVQA 1WF1A 1S72S 2CPEA 1X5OA 1D8ZA 2FHOB 4C7QA 5LSOA 3G8SA 1VC5A 2QEXS 4W92B 2M52A 2KI2A 2FC8A 4P6QA 4ZKAA 1Q81T 2QA4S 2DHAA 2DNPA 4YB1P 1IQTA 3MI7X 2LYVA 3CMES 3NS6A 1VQ7S 2XS2A 1W2BR 4LIRA 1WHXA 2MZJA 4YUDA 2E5JA 3VAFA 2G1DA 1VBXA 5BJRA 1Q86T 1U1NA 4QPTA 2KYXA 1RKJA 2XNRA 1U1MA 1DRZA 1X4DA 3P3DA 2K8GA 2DGVA 4PR6A 5ITHA 1NJIT 3HI9A 2I2YA 5GAEU 4CIOA 2X1AA 1UP1A 2DGWA 3CCQS 2M70A 3OW2R 1X5TA 2RQ4A 1WF2A 3V4MA 1G2EA 1YJ9S 2YH0A 3EGZA 2DGOA 2CQ3A 1U6FA 2MGZA 1HD0A 2PE8A 4IUFA 2M88A 1BY9A 2MZTA 1VC6A 2L41A 2PEHA 2OIHA 1U1OA 2N3OA 3L3CA 2MQNA 3CUNA 4WFNQ 4PKDB 2JVOA 1SJFA 3EGNA 3SDEA 3TO8A 1OWXA 2KRRA 3VAKA 3H2UB 2CQ2A 3THTA 2DITA 3VF0B 1DHMA 2KG0A 4OZ1A 3U1MA 2DISA 2ADBA 2DNZA 1SJ3P 4IOAQ 1WEZA 2DNRA 5CA5A 1YJNS 2X1BA 2AD9A 3CC4S 1KOHA 1OO0B 3MOJB 3ZZYA 2KXHA 2J0SD 2DO0A 2UP1A 3P49B 3P6YC 2JVRA 1H6KX 2E44A 2MJUA 1WTBA 1VQ9S 1FXLA 3N9UC 3SMZA 1CVJA 3VAIA 2LECA 2CPZA 2D3OR 2OTLS 2MQPA 1N52B 3RW7A 2MHNA 2VONA 1VQ8S 5D77A 5CXTA 2MKSA 4Z2XA 1P1TA 1FJEB 2F3JA 4M5DB 4TU7A 1YIJS 1X4CA 2WBRA 2NLWA 5GMKa 2HZCA 1SXLA 2DHXA 2MQLA 1L3KA 2RUGA 2AYGA 2MKHA 1VQ6S 2X1GA 2VOPA 4TU8A 5LXYA 2MZ1A 2CQGA 1FHTA 5D78A 1VQ5S 4IO9Q 2DNYA 3TYTA 5HO4A 2E5HA 1U1PA 2HVZA 2BZ2A 1K8AT 1VQNS 4LJMA 2OSRA 3CULA 1ZZNA 4F25A 1AUDA 1YI2S 1QVFR 1A7GE 1FO1A 3MDFA 1D9AA 1DBDA 1HA1A 2A3JA 2MPUA 2AYEA 2MZSA 2CQ1A 2Q79A 2M9KA 2MKJA 1WHWA 2CPFA 2DNQA 1X4HA 3G4SS 1FNXH 3LQVA 4CH1A 1YHQS 2MSSA 2LEBA 3UCUP 2HYIB 2X1FA 1FJCA 2DHGA 2MSTA 4BS2A 2MQMA 2N7CA 2RT3A 1JJHA 1K73T 2YH1A 3CCUS 1U6BA 2HGLA 1WF0A 3NMRA 2CPIA 2DH7A 2OSQA 1U1LA 1WEYA 3MUVP 2CPDA 1F9FA 1U1QA 2CPXA 1X5PA 3CCJS 2ERRA 3CD6S 3ZZZA 2ZJQQ 4WF9Q 4WKRA 2D9OA 3FEXB 3NNHA 2FC9A 1Q82T 3CMAS 1KD1T 1UW4A 4UY8T 2RRAA 1N8RT 1PGZA 4CH0S 3DXBA 2DIUA 1X0FA 1N88A 1YJWS 1WG4A 2VOOA 2KG1A 1H2TZ 2BOPA 1VQPS 2FPHX 2GO9A 3SDEB 2RU3A 4Y00A 1X5SA 4J5OA 2YKAA 3U1LA 1X4BA 3PIOQ 2RRBA 3UWTA 2RNEA 2M4MA 3G96A 4F26A 2LA6A 2RS8A 2V94A 2JWNA 2KHCA 1UFWA 4QU7A 5GADU 1VQ4S 1VQMS 3B4DA 3FEYB 1M1KT 1JMTA 1X4EA 2RQCA 4Y0FA 4FXVA 2KH9A 2ADCA 2NZ4A 1HL6A 2MKIA 3DLLQ 2U1AA 2XS7A 2XNQA 3MD3A 2OTJS 2DO4A 2M7SA 2RS2A 1UAWA 5JVGQ 3S7RA 3J7YU 4CQ1A 5DDOC 2CQ0A 2L9WA 1KC8T 2KFYA 2D9PA 3G71S 2FY1A 1NU4A 1VQKS 2DGTA 4UQTA 5DDRC 1X4FA 4C0OC 4TLQA 3MUMP 2DHSA 3R27A 5CYJA 2LXIA 3I56S 4QU6A 2DB1A 2LA4A 5IQQA 3NNAA 3CC7S 3CC2S 3THPA 3CCES 3BEGB 1M5PC 2MKCA 2MZQA 3UE2A 2LMIA 4FXWA 1K9MT 2J8AA 3S8SA 2CQCA 2LXUA 3Q2TC 3R1LA 5MLCV 5IM0B 2SXLA 2CPJA 3UD4P 3UD3P 2JX2A 5GAGU 2M8HA 2N82B 3VAGA 1WEXA 2MKKA 1H2UX 2CQ4A 1SJQA 3BS9A 3Q2SC 1X4GA 1HD1A 3H2VE 2O3DA 2EK6A 2DGUA 2RVJA 2DIVA 3EX7B 3IRWP 2HGNA 3MURP 3S6EA 3LPYA 2DNLA 1WELA 2N3LA 2KU7A 1NO8A 1QVGR 3R1HA 3VAJA 1WHYA 1VBYA 3K0JA 1YWXA 4C4WA 2MQQA 1KOOA 2KXFA 4V19X 1OIAA 1U2FA 3MD1A 3PIPQ 3CCMS 1U1KA 1JJ2R 3J7ZT 2XSFA 1RK8A 2YWKA 2JRSA 2J0QD 1FJ7A 3G6ES 2OJ3A 5LSLA 1WG1A 2F9JA 3G9CA 2KN4A 4ERDA 4TU9A 3CF5Q 2YTCA 1KQSR 2DNKA 3TP2A 5LJ5Y 3CTRA 1M5OC 2MYFA 2MZRA 2CPHA 3IWNC 4WCEQ 4WFAQ 3MUTP 3D2WA 2DNNA 2MY8A 2CPYA 3CCLS 2E5IA 3P5TL 3S01A 3RW6A 1WHVA 2XB2D 1R8PA 3JB9k 2KRBA 5DM7Q 1VBZA 2CQBA 2CQDA 5IM0A 3MXHP
chains in the Genus database with same CATH superfamily
1ZH5A 2V68A 4M5GA 1VYAA 3FCHA 1K0VA 1CJKA 3GONA 3KK3A 3GFYA 2BQRA 3PR4A 1VRTB 2GX8A 3JTOA 4OZ5A 4QR2A 2ACYA 2B5JA 3W8PA 4B08A 3G8TA 1GQEA 2XMJA 3TW0A 4X4OA 1WJ9A 5KT6A 1REGX 1WD6A 2CQHA 2OEMA 3DLKA 3MMBA 1GXLA 3RYLA 3RB4A 3TAPA 2LP4A 5DS7A 4DU7A 1HQEB 2OKQA 5EUHA 5DLGA 1BMQB 3HHLD 3SFGA 1F5CA 2XZDB 3B6BA 4ZCLA 3GIMA 1RAOA 1MMNA 4USHA 1RXOB 5CYQB 5BYSA 4FVCA 3X3UA 4A8KA 3AD9C 5HQMA 4FDFA 4YFUA 4X64J 1MROA 1LW0B 2LDIA 3HCXA 4L75A 2QFJA 2D69A 1PJ7A 3US5A 2DVIA 3GV8B 3GR1A 3TZYA 2CWKA 5GMEA 2E5GA 1N33F 3OTCA 5EGYA 4A8XA 4RU2A 2VZ9A 4UOGA 3AOCA 1U25A 4LR9A 3KLVA 3RR7A 1LWFA 4DF4A 3FVYA 4JV5F 4PUOA 5GAHU 2GS8A 3HP6A 1U0HB 3VAMA 3PHEA 4I6YA 1EJ7L 1Q5YA 3KUGA 2R2UA 1PO6A 4L72B 4NEYA 1N32F 5LJ3Y 2DGXA 1IBMF 1QTNB 1MU2B 2EG1A 2H65B 2VA2A 3OR1B 4CNZA 5A76A 2MY7A 2Z30B 3MECA 5DM6Q 1WG5A 3RAMA 3KK1A 2GIQA 2OPQB 3A8KA 1R8HA 3OVAA 4RJVA 2ZHAA 3H4BA 2O66A 1HNXJ 4K4XA 2AYBA 2M8DB 4A8YA 3POTA 1FRJA 2KB2A 4OI1A 1O8BA 2ZJPQ 3T5LA 4YOEA 4ZMMA 3KWMA 3M32B 1HQUA 3PYEA 1NDLA 1M90T 3IWXA 3AQOA 3MEEA 2K3KA 1DLOA 2WK4A 2LQ5A 2HVDA 2XMKA 2BV3A 2V4JB 3HD2A 3L09A 3Q86A 4NWBA 1KONA 2QL9B 3VAHA 1CPZA 3GPAA 1B0TA 4FBTA 2HFUA 3Q89A 3MMCA 1X9MA 2GHWA 2QA4G 4LFCJ 2HWTA 4DV4F 3R5AA 3CPWR 2AYMA 2DH9A 1Y00A 3FEZA 2I8EA 4KYZA 4E0DA 3RAXA 1Y4ZB 5JVHQ 4QR1A 3N5FA 4CO5A 1I94F 1C1CB 3ZZ0A 4ED5A 2WOMB 3C6UB 5E3AA 1VIOA 2A6OA 4EO6A 3T3FA 1RU1A 2WONB 3WIVA 3B82A 2C28A 2V0NA 2GMJA 3KNAA 5F3ZA 2RQMA 1UWAA 4B3TF 2YNIB 4DV2J 2VC1A 1WI8A 3M8PB 1SB6A 2EFOA 2GW8A 2OFHX 3RZAA 2ASJA 3UR0A 1HQEA 4PG7A 4O3SA 1TK0A 4LMZA 2HHTA 1RHUB 1R0CB 2BJ9A 2KVIA 5ETVA 1M5KC 2C2MB 4HH1A 2BDPA 1U6ZA 5ETRA 1WF1A 1WSVA 2CG8A 2DYAA 4Z7CA 5A8KA 3LF0A 4ICLB 2J9DE 4UTGA 4G65A 3PXGa 1I6JA 2UV8G 2DJWA 3HSJA 4C7QA 1I1GA 1VOMA 1VC5A 1RT4B 1RHKB 1Y0HA 3ITHB 3ISNC 5KFHA 3HT3A 3KK2A 2J6UA 4KQZA 3Q8RB 4WZMA 3TJ8A 4DSFA 1XMBA 4ZKAA 1K47A 2W4PA 2GGPA 3BKTA 3CWJA 3M2UA 4NLPA 3V4IB 1Q81T 4YN3B 1BLUA 2DHAA 3NL0A 4YB1P 3HVTB 3MI7X 3CMES 4DMZA 2VKZG 2E9RX 4RW9B 2O67A 3ICLA 4HL9A 4YR3A 4NMLA 1R8BA 2B4UA 3OXLA 4OI6A 3PKYA 5J2PA 2J7KA 1WHXA 4H4MA 4GKJJ 4YUDA 1YVFA 1MMDA 1GNKA 5L39A 2W8KA 1CJUB 5SZTA 4MIBA 2AKWB 2YKMB 4KPCA 4CO0A 4ED8A 3W1YC 3BYRA 1RWKB 2A0FB 2IMOA 3H98A 4DZDA 4OLPA 3SCIE 3QT8A 4ELTA 3EXCX 1ITPA 1Q7LB 3J7A1 2EKNA 2K8GA 1WUUA 4HDHA 3KJFB 2P9CA 1FKPA 3HI9A 4J9KA 4MT1A 4CIOA 3MEEB 1LQ9A 1DLOB 1TL4A 5BR8F 3OW2R 1X5TA 1YJ9S 1R3NA 2BKOA 1WOSA 3PYGA 3Q8UA 3CCTA 2W2MP 5I42A 2HFZA 2Y0BB 5LMUJ 2G0IA 2PIIA 2CQ3A 1RT6A 2KDOA 4Y2AA 1NHUA 2IJFA 2MGZA 2KVQE 4B3SF 3X1LB 3UNYA 2Z2MA 3LUYA 5HP1A 2IBKA 1JLEA 4K5RA 3ZNUA 2AJ2A 2MZTA 2ROGA 2Z2YB 5KG7A 3PW7A 3TAQA 1VC6A 1U1OA 3KMQA 2LQ9A 3D0IE 3L9ZA 1C1CA 1URRA 3CVKA 4RR5A 4OZLA 3WDOA 2N3OA 4A8QA 3OL7A 4N8NA 1RDRA 2JC1A 3U1NA 1Y10A 4FNIA 3VAFA 2LQJA 3FRYA 4WFNQ 3PX0A 4DR7F 4XDCA 2BM0A 3GV7B 2A1BA 3BBBA 3MM6B 4U95A 4AL6A 3GG1A 3I5BA 3VAKA 4I2PA 3H2UB 2CQ2A 1I94J 2KG0A 4AE5A 4OZ1A 3U1MA 1V5VA 2DNZA 1WEZA 1X60A 5CA5A 1XERA 1YJNS 4B9MA 5HVHA 5CHCB 1KVIA 1KP6A 2AEMA 2WW8A 1JLCB 2QV6A 2W4DA 4FP9A 2MTLA 4HACB 5KG6A 2FB0A 3E01B 5HMZA 3CCQS 2DO0A 3HHKA 4ZVUB 2QG9B 3GQCA 2JVRA 3IS9A 3M05A 4Q8EA 2GVDA 2APOA 4YB7A 4OX9J 4QWAA 1FXLA 3SMZA 5IOLA 3HX9A 4YQWA 2D3OR 4QYRA 2MQPA 4JI8F 3M6XA 3IWLA 4L3KA 4QCLA 1RUSA 2VG7A 3M2UB 5D77A 5CXTA 2VONA 5KFSA 4LQ3A 2QIFA 5I4MA 5A2QY 4DWIA 2ZH2A 1VHFA 2IRUA 2K06A 1Q8LA 2F3JA 2Q3PA 4L6V3 4F04B 4P52A 4TU7A 3QNWB 1OQ3A 2AEJA 2QJ3A 2WBRA 1OY6A 5KFXA 4DHVA 1S76D 2RAQA 3QZ7A 3BKUA 9RUBA 3F44A 2W2QP 1PBAA 3Q8QB 2VQFF 4ED3A 2DHXA 1L3KA 4YR0A 2HS4A 2QYGA 4G1QB 2H3EB 4TU8A 1MW7A 1VRUA 2CQGA 3AAWB 1HYSB 1JLFB 2XWXA 1PC5A 2L3MA 2VA3A 1YGYA 4RZRA 1UVKA 3NAHA 1IM4A 1OYEA 4LIWA 5B0BA 2ZHBA 3EGWB 1CJTA 1HBNB 1FKPB 3A8IA 4LJMA 4Q43A 3RR8A 3VZHA 1TP7A 4MKYA 3EPGA 1S1UB 3ET6B 9ATCB 4F25A 3SI8A 4DL4A 1FK9B 3ZTOA 5L1KA 1YI2S 1AUDA 2BE2A 1C0TB 2A3JA 3KG4A 2ROEA 5D3GA 2AYEA 5LMUF 1IBMJ 2Y1JA 2WW4A 3RUBL 2CQ1A 2Q79A 3A3NB 3MEGA 1RT6B 2MKJA 3M9NB 3K57A 1WHWA 4KC5A 5KFBA 1JLAB 3QZ8A 2IM1A 4O3OA 1AB8A 4IH7A 3MFIA 4LFAF 4NA3A 5ETTA 2HQGA 4PXCA 5HP1B 2XLIA 2V4RA 3TA2A 3RBEA 5B0DA 2MSSA 1TKDA 3OJSA 3TEGA 4LSNA 3SEOA 2Y1IA 2HYIB 4X64F 1S0NA 4K50A 2HNDB 5A6WA 2MSTA 1TKTA 3BV8A 4PWUA 4TXSA 1N0VC 1UA0A 5HQLA 2LDYA 1DAXA 1OMSA 1S7HA 2B9YA 1OY8A 1PBUA 2VG6A 3MM6A 3MPWA 4RWXA 5B0CA 3CCUS 2YH1A 4X2BA 4ZPWR 2XI2A 4MK7A 2J5AA 4MH8A 1F9HA 4U7UD 2DH7A 4MFBB 2OSQA 4M94A 1RTHA 3D68A 1F9FA 1KWMA 1V5IB 3CNQP 2CPXA 3FQKA 1X5PA 1HBOA 3F56A 4OYAA 5T41A 4CRJA 5C42B 3QFWA 2OMLA 3EJMA 5KTQA 1U4BA 4DCJB 1RWOB 3R2CJ 1RT2B 1U2CA 4WTYA 3P45B 3CD6S 2HMIB 1U8WA 3EICA 3A12A 5E3CA 1Q1KA 2HNZA 2ZFHA 3AQPA 1IBLF 4WFZA 4DOZA 4DPXA 1MWQA 4L73A 5KT4A 3PZPA 1OYDA 3FEXB 2XO7A 3NNHA 4HDGA 3ZTPA 2MLXA 1Q82T 3NEKA 2NXJA 3CMAS 4U6PA 3DNCA 1UW4A 1XK8A 2NCKL 2VB6A 4HI1A 3ZTQA 5FLXY 2E7WA 1S57A 4HH0A 1NRKA 1IWAA 2B56A 4ZK7M 4KGZB 1S9EA 1JLGB 2CUYA 3A13A 4CH0S 3K59A 2VF3A 3W9HA 2P2CB 2P5VA 4MKVA 2KG1A 2R8GA 3DLEA 3JSMA 3LWLA 5KFTA 3PG9A 3FSXA 2YQ3A 3IFEA 4F4KA 4Y00A 4O0IA 3T5JA 2NXUA 4N56A 1X5SA 2YKAA 4J5OA 2XGPA 1HWIA 3THVA 1JLFA 3TUPA 2AJFE 3P96A 1VLOA 5KFYA 3LH2S 1HNZJ 5D8HB 1HLWA 3ONQA 1NJZA 2RRBA 1M5SA 4P72A 4NCGA 1FD2A 2BXJA 4B3OA 2XMVA 1VI7A 4YY3F 1RT7A 1TL5A 4LR7A 3G96A 2CNNB 4PZVA 4NYOA 1S1UA 2LA6A 3ET6A 1F3FA 1FK9A 4G1PA 2VQFJ 5LMNJ 2R7SA 2V94A 4IDKB 4YP3A 3TRGA 4I67A 2DBBA 2Q6BA 2XYPB 1HPZA 3VGTA 1AFIA 1YRTA 3DOLB 1VQYA 3DDIA 3ILJA 5GADU 1DTTB 1JXLA 8RUCA 1T05B 2J6TA 1A6LA 1X9SA 4BWJA 2MKYA 1N4LA 1RB0A 4GRSA 1TVRB 3KNGA 3MWBA 2KH9A 4PG4A 1Y5LB 2HNDA 4OL8A 3DLLQ 3C3LA 1MG7A 3N4WA 5AE1A 1WC0A 4DV0J 1U0SA 1Q8IA 1YJRA 4WXOA 2NUHA 5KAKA 1BHNA 1V6HA 1RAHB 2W8LA 1U2RA 4NCBA 2OTJS 4NLUA 4NCAA 2RS2A 1NK0A 3R7SB 3ELHA 4JI5F 1JK9B 4ID5A 5B0FA 3J7YU 4ZPTR 4DV5J 2GV1A 2B5JB 2B8PA 2EW9A 2MEWA 1UVJA 2EFNA 2HQ3A 1TKXB 4PEOA 1XR6A 5C25A 2XGQA 4LRDA 4IFVB 1APSA 2RB7A 4J9UE 4WPAA 2JDJA 4C3MA 1H38A 3UPFA 5IV4A 2B7CB 1F5AA 4F2RA 1T94A 2F4VJ 4RNOA 3G71S 3OL6A 3MR3A 4NE9C 4DR6J 4UQTA 5DDRC 3GYNA 3VV2B 4C0OC 1LW0A 1P9YA 1RWNB 3HSGA 4OFZA 4TLQA 4TLRA 1RHMB 4LT6A 2R8JA 3C6TB 3O6QA 3R27A 1F9EB 4DV2F 4KAIA 2UUBF 2P9EA 4G3IA 3VQTA 2IY5B 2W9AA 1RACB 2LXIA 1XJWB 2DB1A 1HI1A 2CXEA 2YKNA 3G8QA 4I69A 3CC7S 2HHVA 3LALA 3K8WA 4RW6A 1LWFB 5KFUA 3THPA 5M2UA 4PUOB 5ETPA 3BSCA 5D0EA 4DV1J 1M5PC 3DU5A 2Z2LA 5E7OB 4LF1A 4MMOA 2QA2A 4ZVEA 1C2PA 1S9EB 1U0HA 2H48B 3UE2A 2CQCA 4Y3CA 3MPYA 3H40A 3N79A 4TVAB 5MLCV 1RKIA 2PN6A 1VJWA 2O5DA 4I2QB 2DXDA 5FIIA 2IPOB 2JEJA 1CJKB 2CPJA 3UR3C 1XMOF 1QAYA 4C97A 2BE7D 2AW0A 2N82B 3CD5A 4FN5A 3JQKA 4B3MF 3GMGA 3KK1B 2NQPA 3CJ4A 4I0WA 2V8PA 4ZJQA 2CQ4A 2ATCB 2MKKA 2IA6A 1HD1A 3Q2SC 1NH7A 3I96A 4LRFA 3H2VE 4RU9A 4QW9A 3N0VA 2EK6A 5HBMB 1HR0J 3H8YA 2FVQA 3M32A 3AXKA 3KJNB 4F3OA 2ILZA 1N5YB 3IRWP 1BC6A 3NGDA 4Z7YA 1TELA 2V4JA 1S48A 2DCUB 4C2MA 1RBLA 2IM0A 1LWCA 3PACA 3CDEA 4AYBD 4DU8A 1C4AA 5HROA 3LPYA 2DNLA 1DTTA 3LGHA 4C8NA 3AA8A 5KG4A 1GMUA 2BJDA 1U8SA 1TR0A 3KJQB 4FKYA 3AJDA 1EIYB 3R1HA 4ANCA 1H72C 3BF4A 3AH6A 1WHYA 5H9EK 2L9NA 1YWXA 3PJ9A 1KOOA 3V5RA 1J5EJ 1KS2A 2KXFA 1FVSA 2BJ3A 5L38A 2WOMA 3C6UA 3MD1A 4OHVA 2F63A 4FPIA 4OYZA 2AX1A 2DKOB 4MIAA 3ILIA 4TY8A 4KJIA 1I3OB 3GFXA 4ID5B 3SSRA 4NLTA 4XPEA 4DL3A 1JJ2R 1T02A 3DHXA 3NY0A 2MQ8A 1AXQA 4CNYA 1RK8A 2V2VA 2XMAA 3FSYA 1TKXA 2KZZA 2B4PA 4AQYJ 4IFVA 1FJ7A 2UXDF 4W92B 2VPXB 3NG8A 1JJCB 3O44A 4HEA9 4F7VA 4UZBA 3J81Y 3J81U 2HURA 1KQKA 3R5GA 2V8GA 4FS2A 4LF6J 2XSJB 2B4OA 5D15A 2WBMA 2UUAJ 4TU9A 4J9SA 2HK2A 3QLHB 1HQUB 4JI1F 2HVIA 3VWSA 2YTCA 1KQSR 2EG2A 4RW7A 3MCMA 4DV7F 1RBAA 3C6TA 3QO9A 3CJ3A 1R27B 2QTWA 1VIXA 5LM7E 4ELVA 2F4VF 3HULA 2IRXA 1AYEA 2YWFA 4RW6B 4ZA1A 4DUYF 1PAEX 5KFKA 3S01A 4ED6A 4CLUA 3CJ2A 2N4CA 4WYLA 5JUMA 3QPIA 2RDDA 3DCAA 3HDSA 5J2NB 5GAEI 1MMLA 5CD4A 3BBCA 4O23A 4X4PA 1R8PA 4FXDA 4QIVA 4YDXA 3QSYB 2CQDA 1LOUA 4YEAA 4YHHJ 2QFIA 1VISA 1SQGA 5IM0A 3MXHP 1PYOB 3FZ2A 1JX4A 1J2VA 1EKRA 1T9WA 2XWYA 5E0OA 1WKJA 1QLNA 1YSJA 1CJUA 1RT5A 4JI0J 4RBTA 2YKMA 1WC3A 4PPZA 2DNOA 3AD8C 3UCGA 2KFZA 4TQSA 2HVEA 4JUZA 2C22A 2VBYA 3M8PA 5B09A 1FKOA 5F3TA 5F0WA 3VCDA 4F2SA 1TZ0A 2RRNA 5SUHA 4USIA 1H0HB 5FJ4A 3G86A 3TUJC 5IC6B 2VUGA 2E5LJ 1LXNA 2HW3A 1S7IA 1B7FA 3CEDA 3M8RA 4EWTA 3FBBA 1H7WA 2DGSA 4S0MA 5A2QU 2LCWA 2GVZA 3H59A 3Q22A 2NR0A 2CQPA 2GA7A 1FRMA 3CMQA 3OR2A 3IM9A 4ZPCA 3R7NB 3SQOP 3OHBA 4ECQA 1VC0A 4WXWA 2ZOGA 3TR5A 3M6VA 5H1SV 3V4IA 4LF5F 2PA3A 2C3OA 2PFDA 5D4OA 1FF2A 5LXRA 4JI2J 2JC0A 4IYQA 1P27B 4O4GB 4CLFA 4X66J 3L7UA 3I87A 3EGVA 5IFMA 1VQLS 2G0CA 1UTAA 1T0TV 4OX9F 1SV5B 4KB7A 2J76E 2Y1RI 4NXNF 4K7QA 4DDFA 1UJ5A 2UUBJ 1YITS 1TK5A 4NXMF 4OYXA 5F9LA 3Q0AA 1UA1A 4JV1A 4C8MA 3MOZA 3MFHA 2XS5A 1YX2A 1FVQA 2DGQA 1B3TA 4Z37A 2EC0A 4F3MA 1XN9A 1YZ7A 5DDQC 2QN6B 1HARA 4OX7A 3E01A 4MTPA 5KT5A 4U67Q 3FSIA 3QBCA 3MM8A 5BR8J 2VBZA 3EMTA 5L9NA 4WFBQ 2GVDB 1SQEA 1AROP 1CQNA 3D6HB 3FJ2A 3MCNA 4TYBA 3WBZA 4BDPA 4FF4A 1PYSB 2FQQB 3BPDA 4X62F 4OZ3A 3QIPB 3B54A 1Y5IB 3H42A 4RO0A 2H5EA 1T95A 3CCVS 1NHKL 4M5KA 3DRSA 2IYGA 1H2VZ 2WZ1A 2YKPA 4DI6A 1SJ3P 5ETLA 1FEEA 2KT5A 4QR0A 1URNA 4MK9A 2XBPA 4EK2A 4LSZB 1NAQA 1T9UA 1NB2A 1SH2A 2B0GA 4IOCQ 2WB1D 2ZEJA 4KKOA 1PIEA 4X4SA 2ZUAA 1SJRA 4LRAA 3BO2A 4PRFA 1EQ0A 5F8LA 2V6AA 1VS3A 4JI0F 3UCZP 3RBDA 4LQ9A 1R0AA 1RU2A 2UVUA 3B4MA 5CYMA 2YPYA 3SXLA 4DR4J 1ZPVA 1VRUB 1VGYA 2I1RA 3W8GA 3PW0A 1TL3A 1N6QA 3NMAA 4LF4J 1JJ4A 2E1CA 3AOAA 1N56A 2HBZB 3TNVA 4AL5A 3SCJE 3SSSA 4URGA 2ZH7A 2FJDB 3JTNA 1PCAA 3GIRA 3H5SA 3MEKA 2BA9A 4Q0BA 3WZ0A 3OTBA 1TMJA 4DV5F 5BXIA 4KRWA 3D1QA 2BE2B 3K5MA 4ZN3A 5D3GB 2FHOB 1P6TA 2H4WB 1NSQA 5C5JA 3KLIA 5IT0A 2JL9A 3G8SA 2QEXS 1S1TB 3HZGA 4GKJF 2RKIA 2FC8A 3FMWA 3LP0A 2BJ1A 4ZP9A 4OYPA 1Y3JA 1IKVB 1XQIA 2A18A 5KT2A 5IWAF 5HATA 2QA4S 4WU2A 3K5NA 1Q95G 2VG5A 3EUNA 4LVNP 3J7YI 4A47A 2UUAF 5DGAA 3NS6A 4DFJA 4USUA 3PY8A 1JNZB 1W2IA 2F65A 3LGNA 4M5DA 4O4GA 2XM3A 1W2BR 4U96A 4KV8A 4LIRA 1HBUA 3CIMA 2YVSA 1RHRB 2ZITA 1SV5A 1SL2A 2FJBB 3MAHA 2H54B 2F8MA 2WSCC 4QPTA 2Y8WA 2QA1A 1RKJA 3ENAA 4Q5VA 4NX9A 2BOAA 5D4PA 1RTHB 2IJRA 2CWXA 3CCWA 4LREA 3VQSA 1U1MA 2K2PA 4CP5A 2FHJA 3P3DA 4ZP7A 3KLEA 1L3SA 2RDIA 2EI5A 4CLWA 3M8YA 3P4UB 1T03B 4AFFA 1S6QA 1IBCB 4ANDA 4RUAA 3NGTA 3R8YA 2I2YA 2CDQA 2WVBA 3MM8B 4P73A 2RILA 4ZITA 2X1AA 3JQJA 3JSYA 4DS4A 1RAFB 2MLZA 2BM1A 5DQIA 1K0TA 1FDAA 2CJXB 2MHEA 2ZC3A 1RT1B 4DV3J 2DGOA 3EYZA 1E6VB 1M1GA 1U6FA 3TZWA 3BSNA 3TI0A 2DCLA 1CG2A 2ZVSA 2WRMA 4J9OA 2PE8A 3ZXWA 2OMOA 3IO1A 1BE4A 1B7YB 4TN2A 3UVJB 4ZCMA 1U09A 4LSNB 1VQSA 4DCPB 2BMBA 4PG8A 2BW2A 2GAHC 3TX0A 3QT7A 1ZM3A 1IKWA 2CZ4A 2ATLA 1DY3A 2CNOB 1C1BA 3BYPA 5A0YB 4ZVRB 3HFVA 3RJMB 1KLMA 5K8MA 1NBEB 1S59A 4TY9A 1N36J 1N6QB 2DITA 2VKRA 1DHMA 4KT0C 1N34J 2NXNA 3D5MA 4TYAA 3D28A 1IKYA 1FXRA 2CJYB 4WKYA 2K3IA 4RNMA 2MXYA 1SBRA 3W5XA 3PYDA 4JOUA 3QJJA 1JKHA 2LFVA 1A0OB 4FF2A 2OGUA 3CJ8A 3TUZC 3T9NA 2HLUA 3UDVA 1RT7B 3LWMA 1DTQA 3GIKA 2KXHA 2UP1A 4R0JA 1OY9A 4IG3A 3JYTB 1HWLA 2MJUA 1AW0A 2Q6CA 3FKBA 2WHOA 1VQ9S 2LEPA 3HVWA 3H2LA 3B8HA 2FZCB 2LECA 3DOLA 5KFGA 2ASDA 3D1OA 3PHTA 4NASA 4CLSA 2R7RA 1DURA 2CRLA 4X65F 4ECSA 4P7TA 3OSPA 3PX4A 4WE1A 2FY8A 2JH3A 1VQ8S 2EXUA 4DX5A 3JQMA 1D3WA 2OP5A 1KHWA 4DV4J 4DSIA 3HJFA 4M8LA 3CJ0A 3HHLA 1P1TA 4Y2IA 1BGXT 1KQFB 1U48A 3QRRA 3FQLA 2ZBRA 4M5DB 4EBCA 1VRQC 3AJ2A 1YIJS 1FEHA 1JLGA 1X7VA 2C3YA 4ALZA 1SPBP 4DPOA 1YJTA 2JJ4D 3QQCD 1VK3A 4ZJOA 4HHJA 4USVA 1HBUB 2NLWA 3GP9A 4MYUA 5HJXA 3TZZA 1FDBA 2HZCA 2J9CA 2HLTA 4R5PA 2QMXA 2NS1B 3BSAA 3BZQA 1AZSA 3M2RB 1EP4B 4FYXB 4WP9A 3W9JA 2H4YB 4FVMA 5KFMA 1C0UA 4K5SA 2LXFA 5CABA 4LBHA 3TUIC 1JNRB 3DOMB 4K2XA 5F8MA 4AUKA 1U26A 3NOCA 4DL6A 2LQBA 1GH8A 1BUXA 2E5HA 2DY1A 3GYXB 1U1PA 4BCAA 4DQPA 1T03A 4PWDA 1VQNS 4CDIA 1YG0A 4K59A 3O5TB 2QO3A 2OSRA 2BR0A 2NUUG 4JI2F 1TAQA 3CULA 2P6TA 2LLZA 2OPPA 3TQ1A 3I9ZA 1QVFR 1MWYA 1FO1A 1GAOA 1U7LA 4JBCA 3GV5B 5L1LA 1HA1A 2MPUA 3C2PA 2AV5A 2MZSA 3K7RA 3K2YA 4DCOB 2NREA 2UZAA 5LOQA 1T11A 2ASYA 2M9KA 2CPFA 2AWZA 3IR5B 2DNQA 1ELOA 2PMHA 1UEKA 5L1IA 2HZVA 1HQ2A 3LQVA 2YX7A 3UCUP 1ZYQA 1YJUA 5K8NA 2AZ1A 1SUQB 4LF5J 4WK3A 3IN5A 4DPYA 2BX6A 4DLEA 3AB2B 2EWHA 4EMDA 4A8OA 1HNWJ 4QZVB 2HRTA 3AT1B 3WC2A 2OAUA 1JJHA 2HK3A 3CB4A 5M2RA 2OFGX 1QUPA 4D3GA 5K8OA 1K73T 1Q79A 2R7TA 3AODA 1F3VA 2QL5B 4DQRA 5K5MA 3UO0A 3LAKA 1R43A 1NZAA 5HMXA 3T1YJ 1HHTP 2F4FA 5I3PA 1U1LA 3CD7A 1Y3KA 3MM5B 4L74A 2CKWA 4X84A 2QSWA 1U1QA 4M5MA 3J80Y 4QWDA 5CAAA 4ZLLA 3JXOA 1CJVB 3D0GE 2OHDA 3HT0A 4WBFA 4M63A 5E3RA 5LT5A 3HF5A 5GAHI 4PPDA 7FDRA 5HSPA 4YB5A 2E1RA 3H90A 2UVWA 4WF9Q 1LWCB 2I5JA 3RB3A 1PC4A 4WKRA 4ILRA 4HVZA 2DRBA 3MAQA 4CLLA 2FC9A 2Y3YA 4I6WA 1EHWA 1B0PA 2YQ1A 3GTYX 2FUG9 4QPXA 5E3QA 4OI3A 4ZJLA 3H5YA 4DSJA 4UY8T 1SC4B 3HHLB 4JYAF 2RRAA 1QTMA 2PO4A 3M9MB 4JI6F 1N8RT 2QLWA 2Z2ZA 1S4FA 3HJVA 4URQU 1JB0C 1D8YA 1N88A 1YJWS 5CZVA 2LQ8A 2Y8YA 3BH7B 2VOOA 2ZZMA 3IGNA 4C0BA 3PV8A 4NXNJ 2BOPA 1VQPS 4R5PB 3QWUA 2VDHA 1AZSB 1UEVA 3G87A 3SDEB 2BVZA 5D6GA 5KFQA 3GG0A 2XZWA 5D4NA 1KDNA 4P7VA 3W63A 5DG8A 4Y6IA 4LSLB 3TVKA 4CH7A 3U1LA 3H5UA 2WSEC 3DOMA 3QFHA 4ES1A 1RA7A 1GXUA 2BQ3A 4E98A 4F0HA 4KHMA 2DRAA 1REVB 3OTDA 4OJHA 3UWTA 4PQAA 1XNQJ 2R4FA 1RGVA 2ZDPA 4PAAA 4C48A 4F4ZA 2DT9A 4CTAA 2HPUA 5E2QA 2AGQA 2OPPB 2RE1A 4J9LA 1N5YA 3NCRA 4RW7B 3TANA 4DR5J 1FD8A 2DHHA 3DN9A 2HAFA 1OS5A 4XK8C 1X0PA 1TKZB 2W1BA 5KFRA 1UW9A 4C8KA 3GWCA 5KFIA 1TFYA 2HWHA 1HI0P 5CCMA 4NLOA 2IVFB 4CLPA 3L4BC 3ZZUA 4UOCA 3SV4A 2EFVA 3B4DA 3FEYB 3HHLC 1M1KT 4QOTA 4Y0FA 2NZ4A 1F2GA 2ZBQA 4CT8A 5T14A 1IQTA 5KFJA 4NYZA 3OV7A 4DL2A 2AX0A 3MCOA 3D54A 4ZVQB 4DPWA 2E5LF 3PO4A 2XS7A 3KYLA 4DEZA 2M7SA 4DX7A 1SC1B 4DR2F 3DRRB 4TY8B 3DC2A 1Q78A 1UAWA 2N4DA 4FYWB 2X7IA 3S7RA 1VRTA 1YZ6A 5JVGQ 3KMSA 1RT5B 4OX8A 3OJUA 1WC4A 1FNOA 1IUJA 2XZTB 2L9WA 1SIWB 1B64A 3DLKB 2FZKB 1YBUA 3MMBB 2EFPA 2LU2A 3MM5A 1GTEA 1RZMA 3FBCA 1N0UA 3KG1A 2KFYA 3MM7B 3N6MA 2B9XA 1FJGF 2ACMA 1LEOA 1B99A 1IBKJ 1NSAA 1Q8KA 4DF8A 2XSJA 1NJYA 1PYTA 1ZM2A 5IS2A 1IBLJ 4IO1A 3E2EA 5EX0A 2IMWP 1NPRA 2DHSA 4XPCA 2ZNZA 4AD6A 4EO8A 2XCAA 1S5ZA 4J9VA 1HHSA 3MPVA 2ZH4A 1NK9A 2OO4A 4DSLA 1VJQA 1P9QC 1NJWA 4AXIA 3CCES 3BEGB 1WSRA 3GB0A 2MKCA 2BJEA 5J2MA 2LMIA 4FXWA 1L3TA 1K9MT 4C0HA 2W2NP 5J2NA 3IG1B 2BUNA 4O0NA 1HNWF 4ZVOB 2KZMA 2GZOA 2F5GA 4I4BA 4OJGA 3R1LA 2HBQB 4NOHA 5IM0B 2AJ1A 1M1HA 3I31A 2SXLA 3VGSA 4ZS6A 3UD4P 2JNJA 2YWEA 1RA6A 2JX2A 3M8WA 4NLVA 2C2KB 4LSLA 3CSKA 5HI7A 4ANEA 2M8HA 2ZM6J 1HWUA 4U9RA 2ZVIA 3GU0A 5KFDA 3KDOA 1MN9A 1Y9OA 3DGPB 4NZ6A 2HQFA 7AT1B 2XMWA 3A3PB 4LFAJ 4USTA 4DBQA 2EKYA 2G0JA 3N6NA 4UY85 4K0KF 5H9FK 1QJHA 3M1VB 4URSA 3BSOA 2VFRA 4M5IA 2HNYA 4M5NA 2XQCA 2QMWA 5DGBA 2RVJA 3O8WA 3KTQA 3R2DJ 3NXZA 2A2DA 2HSEB 1N33J 2DEIA 3MEDB 3F73A 1TQLA 2HGNA 5A8RB 3E8OA 1T9YA 3S6EA 4IRDA 1HW8A 3A8JA 6FDRA 4M95A 1WACA 4ZN1A 1XC9A 4NYPA 5F8HA 1M0SA 3OR2B 1SKSA 1FE4A 1S6OA 4RBVA 3OTOF 4DUZJ 1QVGR 4KY3A 2AIRB 3TWZA 3K0JA 3HKWA 5DG7A 4B17A 1YDLA 4C4WA 2MQQA 4ZP6A 3QGHA 2RMLA 3C19A 3DDKA 4KFBA 1ZAVA 4YY3J 2AJ0A 5JMNA 1S1WB 1XWLA 3L95X 4IOBA 4PXEA 4DR5F 2DR8A 4JV2A 1ROFA 3W61A 1SC3B 3J7ZT 1NK5A 2RF2B 3BBFA 3M4XA 2OPRA 1YJVA 2XSFA 4X4VA 1G3OA 2CFXA 4O3QA 4DPUA 1HI8A 3Q23A 3G6ES 2XY7A 3NAIA 1V3RA 5JXSA 3M6UA 4EUVA 3PX6A 5KG0A 1HNZF 4XAKA 2F9JA 2QC3A 4RW4B 1RP5A 3TJAA 2KN4A 3LP2B 3IXQA 4C11A 2W9BA 4B3RJ 5B7WA 4QYZK 1YRXA 3N28A 3AD7C 4OYIA 4Q0BB 3IAS9 3OVBA 2DNKA 2QLFB 2OPSA 4GMKA 1HHQA 5LJ5Y 2QSFA 2KO1A 4KH0B 3W5ZA 2MYFA 1V3SA 3KLIB 4K8RA 5CH7B 3GZ7A 2EBGA 2BABA 4WCEQ 2B6AA 2HBRB 4R8UB 4I7FB 4O4RA 3D2WA 2DNNA 1S1XB 1KRPA 1IKVA 2ALYB 3P5TL 4ECRA 3RAQA 2J6SA 2A10A 3HVTA 1HBMA 5BYRA 3R97A 4CO1A 5J2MB 2VPZB 3QMQA 2VICA 3SFUA 3RW6A 2Q66A 3PJWA 3MAAA 4M1KA 2ABYA 4OMFG 1XR5A 3L7OA 3SYZA 5DM7Q 1NZ8A 3DLBA 2CQBA 4KV8B 4KKOB 3A1YG 4DG1A 1PKUA 3CCSS 2Z0GA 2B3TB 2LKZA 5G0RA 2FLOA 4Q45A 1RAJA 1A9NB 3H7HB 4EYHB 2PI4A 1R0AB 4WWSA 5K9FA 3CJKA 4NLXA 4MKAA 1RCXB 4USKA 1TL3B 1HW9A 1F2HA 1X9WA 1OSDA 4HLBA 5J1PA 1YJ7A 3C8YA 2J0XA 2W2OP 2OELA 2MQOA 5HLFB 3HHNB 1FWPA 1IVZA 3FK4A 3KHHA 4ECTA 2MB0B 3EPIA 4KO0A 3W5YA 4EFAC 3MEDA 2HG4A 2YBVA 1VLYA 4DV0F 5A8RA 3EVOA 3NP5A 1FT8A 4P2XA 2C2EA 4PABA 2DXFA 3I0RB 4XTTA 5I42B 5DETA 1NDKA 4Y2CA 2W7OA 4KGMA 2ZKUA 3WX4A 2XMUA 2MGZB 3BR9A 1FRHA 1VQOS 3BO4A 4ZOSA 2K1RA 1X31C 3V2UC 2YPZA 1MSWD 3HFKA 2E7XA 4EGLA 2ALZA 1J5EF 3LA0A 3B78A 4I68A 3MMJA 5MAOA 3VALA 3V81A 2UXCF 3EVWA 5DRKA 2G9OA 2JLFA 2VASA 3JTPA 5LL6d 5AE2A 2XULA 3GIIA 1FTCA 3BQ2A 4DQSA 2NSCA 4JI7F 4DX6A 1IN0A 3CW2C 3UDEA 4FPRA 2CG4A 2U2FA 4J9QA 5D0HA 2DK2A 3SCLE 3MR7A 3KXDA 1X4AA 2F8HA 1JLBA 1NEEA 1H98A 1VK8A 3RB6A 1IKYB 5F8IA 3HHEA 2JSXA 4B9VA 1KQGB 1FCAA 4F4YA 3NBPA 3PRDA 3AXMA 3HPOA 3CCRS 4OHXA 3HLUA 2W7PA 2BRKA 2P6SA 2KT3A 4EZ6A 3DLHA 2DNHA 2R7XA 4IR9A 4Q8FA 2VPWB 1RWVB 4X4QA 2V67A 3SV3A 3PW4A 4DR7J 4ID8A 4L3NA 1W26A 2CJKA 2HRYA 1YKWA 4Y2MA 3M8ZA 2UVVA 1YTYA 1N54B 4NRTA 4GVBB 3AOBA 3MZIA 2B6AB 4R8UA 5EWFA 1WNEA 1E6VA 1FE0A 1WOOA 1WWHA 2M0GB 2HRUA 2V69A 2DH8A 5D0GA 4A48A 3R5JB 4K4ZA 2DNGA 3DYAB 1QAJA 4UQGA 2ZNYA 5J2QA 1XNQF 4DR4F 1UMJA 1WI6A 4QIFA 3QAEA 1U1RA 2CQIA 3OQ2A 2W25A 1K1QA 3VTIA 1FDDA 2FHJD 2RUSA 4E2FB 3D7SB 3K58A 4P75A 3HFZB 4DQQA 3MMAA 1FRLA 2WVDA 4Y2KA 2L08A 3D3CJ 1IKWB 3VVTA 1CC8A 4ECZA 2ZDOA 4TQRA 4X4TA 2IVYA 1QSYA 3NCQA 2G2YA 4DV6J 5DQHA 2VBWA 3VGUA 2QX0A 3CJTA 1KLMB 1SL1A 3DRXA 2KM8C 2LEAA 4N5SA 2JHEA 1T9VA 5ETNA 4JI6J 3W2WA 2ZJRQ 4B9TA 3BO3A 3HXMA 3T5KA 3O2IA 4KIAA 1TK8A 3W2VA 1CJTB 4OI4A 5GVQA 2MDAA 4IQMA 5FD1A 5KOXA 1DTQB 1GMWD 1S72S 5I3UA 4Y65A 3NCPA 2FJVA 4GC7A 4X62J 2E1PA 1UVIA 1X8DA 5FLXU 1IQZA 4A8SA 3GILA 5E3PA 4V1Ak 4LF8F 2ZWPA 3BGRB 1VCTA 5THWA 1NHVA 1R89A 2BE9B 2KJWA 2M52A 1C4CA 5EWGA 1JLAA 4P6QA 2BANB 1U24A 3C46A 1WORA 2C2RA 4NZ7A 4C9DA 2GNKA 3QIDA 2WVFA 4KSEB 5ADZA 4WZQA 2QGFB 3SQGA 3H4DA 2Q43A 3QGPA 4J91A 1QUVA 3DMJA 4CLYA 4B3RF 3EM1A 4IFYB 4X66F 2J8SA 2QT7A 3FCWA 2HFNA 1N32J 5CCLA 3DU6A 2MZJA 2VG6B 3AFGA 3G2XA 2E66A 4OX6A 5BJRA 1RCOB 5AJ3F 2G13A 3MM9A 2KYXA 4BBYA 1T3OA 3DM2B 1F60B 4P9SA 1X4DA 4JV5J 3FBFA 3M2VA 4KE5A 3R7BB 4P2MA 1HBOB 4DLGA 1LKZA 2DGVA 2L9DA 4PR6A 4ZDNA 3QRQA 1PSDA 7FD1A 4U8YA 5CYQA 1ZM4A 1XMQJ 1QY7A 1RT3B 1TL7B 2DGWA 2M70A 2VL1A 3CCZA 3SBMA 4DXLA 2RQ4A 1UZHA 1WF2A 3V4MA 2VFVA 4CM0A 4ZLPA 2AGPA 1TU0B 1B4SA 4OV1A 2ZH3A 3PM9A 1RSCA 3BDEA 4B9LA 5T7LB 3OD2A 1EETB 5K20B 1VFJA 1RWMB 2IRYA 3BH6B 4W4MA 4NL5A 4OI0A 2M88A 4EYIB 3HVAA 2EBEA 2L41A 5L46A 3MPUB 1AUSL 2OIHA 2XYGB 5C2CA 1SUQA 2IHR1 2XHWA 3UDCA 3L3CA 3CJQA 2HS0A 3S1TA 1VR6A 3CUNA 2ZE2A 2GMLA 4KGKA 4PKDB 3JSMB 2DXEA 2HQIA 2W7AA 3R5BA 2XLJA 1S9FA 3EGNA 4HHHA 1SJFA 3D6FB 3TO8A 4C8OA 1OWXA 1UVMA 2OEKA 3JS9A 2BJ7A 3CD0A 1FERA 1CS4A 1R31A 2JLEA 2ZD1B 4RUBA 4B3TJ 4K0KJ 3BR8A 2GJIA 3MCSA 4HTJA 3VF0B 4ER8A 1FWLA 4CCHA 4IQXA 3OFFA 4IOAQ 2DNRA 3M8SA 1RHJB 3CIZA 4A8FA 4N7TA 2AU0A 2X1BA 3POTB 1Q53A 3I5CA 3OFEA 1CJVA 1GMWA 1OO0B 3Q8PB 2QMUB 3MOJB 4ZP8A 3ZZYA 2F1FA 2YY3A 2J0SD 5AXNA 3P6YC 3MTKA 2VV5A 1H6KX 1S1VB 4MYTA 4NLYA 5KFWA 1NDCA 4JI7J 3IAM9 3DHWC 2VQEF 4K2JA 1HPZB 3N9UC 4DN0A 2AQ4A 3ZTSA 3VAIA 1TUVA 2CPZA 2OTLS 4IR1A 4ECXA 1CVJA 5K14B 1N52B 1NNDA 3FRZA 2C2ZB 2MHNA 2CYYA 3MGJA 1R6YA 2PD1A 3RW7A 5F8GA 3G6XA 4KHPF 3I9V9 2MKSA 4Z2XA 1NKEA 3BN4A 2PT0A 3LAMA 5L9XA 1NM2A 4OYWA 1H3DA 1VDHA 5EHHA 3HMJG 1FJEB 2R2SA 4F4WA 2JEFA 2HHWA 4DL5A 4O3RA 2ZKTA 3R5CA 4PG5A 5B0EA 3DLGB 1NKBA 1LXJA 5EDWA 4JV0A 2B7BB 4N76A 4PXDA 2HBYB 3WX8A 2KT2A 3DRRA 2WONA 4ED0A 1S12A 2MQLA 3Q8VA 5E5NA 3BGUA 1VQ6S 2MKHA 3KDNA 2X1GA 3JAMU 4DFKA 1XNRF 5ETQA 3DM2A 3OBIA 2A2CA 5D78A 3GCXP 4IO9Q 2DNYA 2KL8A 4RNFA 5IWAJ 1N5SA 1QD1A 3MM7A 1NMEB 2ZWOA 4GVLA 4IRKA 2D7SA 2BZ2A 2HVZA 1GTHA 1K8AT 1RJJA 1O5JA 2V2QA 3PYFA 1IJFB 5ETKA 3BREA 4CTAB 3PKMA 3H20A 1D09B 5EX3A 1ZZNA 1SL0A 4ICLA 4F3QA 3DRYA 1A7GE 1PILA 3ETOA 1Z2ZA 3PNIA 1D9AA 1DBDA 3DFEA 5IC4B 5AXMA 5BYQA 3U27A 4GC6A 1IR2A 3QJPA 1V9OA 3DRPB 3I0SA 2C2DA 1RTZA 1RT4A 3IC1A 1TKZA 2D3UA 2X3GA 3ITHA 5J1EB 3KK2B 2ZHOA 2UU9F 3C16A 4DX8H 3FZBA 4A46A 1X4HA 2GGPB 1D0EA 1FNXH 4C8LA 2GO8A 2R7UA 2LEBA 1CEZA 5AT1B 2X1FA 4OHYA 1FJCA 3IG1A 4RW9A 2M3DA 2FHMA 4BS2A 4DFMA 2MQMA 5F0UA 4I2QA 1U49A 2AP6A 2K7JA 1LNQA 4H4MB 3TA0A 3UDLA 2RT3A 4U7CA 2D3O1 4EBEA 5C2GA 2NSBA 1F0XA 4JI8J 2V9KA 2JOQA 1WF0A 2JLGA 2R8HA 2ZBPA 3NMRA 2CPIA 2BEFA 3PRVA 3HZEA 1SJ4P 4I6AA 3KLFA 1WEYA 5M2PA 4GKKF 3MUVP 5E41A 1RWUA 3G82A 4YB6A 2Y9HA 2ERRA 1ZAXA 4DFPA 2HQCA 3NKYA 3J80U 2CVIA 5HBMA 2G2ZA 3ENWA 3VR1A 4BC7A 4FBUA 2OEJA 2XEXA 2UUCJ 2F40A 3ZZZA 4DN9A 2W9CB 1RTIA 2VFUA 4F4XA 1KNZA 3M9OB 1ZOTA 1UETA 1R6VA 1ZPWX 3I4HX 1BWEA 1I51B 1FRIA 5DZ6A 2FLPA 1LFWA 1UWBA 2FJAB 3QGGA 1FA0A 2VFTA 3KG0A 3N6LA 1PG5B 5DQGA 1U47A 1N34F 2X3DA 2C2NA 4ZPAA 3UNGC 3LP1A 2WB4A 1T8EA 2YX4A 2RD5C 3EZ5A 1JLEB 1Q0NA 2HFSA 4CYUB 3PVXA 1Q5VA 3GFHA 2C3UA 5KFEA 1SKWA 5K8PA 4CLZA 4PWWA 1PGZA 1HNXF 3HKZD 5B08A 4H4KA 4J9RA 3VZIA 4V19J 5E33A 3UN3A 1RABB 3LGMA 1WG4A 4A4JA 2VU5A 1IR0A 5KFZA 2FJWA 1S99A 2GO9A 4USMA 2KHDA 2RF2A 1FFSB 2RU3A 1WC6A 3QGIA 1GEHA 4QJVA 4JI5J 1CQMA 2RDJA 2FVCA 3H25A 2ADBA 1SIZA 3W66A 3PIOQ 2YWWA 3C15B 5FDLB 2R8KA 1TMMA 4JB8B 1E6YB 4LRBA 3PW5A 3OLBA 3OTEA 4C11B 3BQ0A 4IH5A 2RNEA 3TVZA 4U7UK 2QL7B 2M4MA 2W24A 3PO5A 3QLHA 2J9DA 2I0XA 4FS1A 1RYRA 1I5OB 1JIHA 2P9GA 2DPJA 2ZH8A 2HHHF 4QIGA 2OPSB 3U7JA 2HHXA 2RS8A 3A4TA 3QO9B 2R7QA 1HNVA 4PCQA 1RISA 1UFWA 5J1EA 1BQMA 2YNFB 3F41A 3MTJA 3EDQB 4IKAA 2YWHA 2V8VA 1NK8A 2R2RA 2YX1A 1FDNA 1S1XA 3D6MB 1VQMS 1WC5A 3EE3A 1DJ0A 4FXVA 4L76A 4B9SA 1TL1B 3T9ZA 2MKIA 2FZGB 2KFNA 2U1AA 1S0VA 6AT1B 3CGIA 3HSDA 1S1WA 3MD3A 2ZOFA 3H5XA 5HVGA 1ZA2B 2E29A 1ZETA 4N47A 3DLJA 3HSZA 3F0NA 5IT4A 3TARA 3KUEA 4CQ1A 5DDOC 4ZCKA 4ETXA 2OPRB 2PGCA 5HMYA 5JJBA 3GJTB 2IC3B 1BXNA 2CQ0A 3GJRB 4JYAJ 2XNRA 1WDDA 2PA8D 4J90A 1KC8T 1N36F 4LF7F 3QWPA 4ZPVR 1IJEB 3G82B 2D9PA 4K4WA 2HHUA 2OD4A 4N8OA 2R7OA 4ZPBA 2UXCJ 2FY1A 4ILMA 2K7KA 3ZZOA 2A6MA 2FHKA 2PDAA 2XMMA 1FRXA 2W9BB 2HS3A 1VQKS 2UUCF 4UUWA 2AF6A 1RTIB 2HEKA 2QRRA 2R2TA 5F8NA 1UJ6A 3LANA 4RW8A 3I0RA 3QATA 2HZAA 2RH3A 2GVZB 4AL7A 5AXKA 4YR2A 5ETSA 5CYJA 4K4SA 1G1XA 3MPDA 4IH6A 3I56S 2LA4A 2Z58B 5IQQA 1EQMA 4LBIA 1KLNA 1KR4A 3NNAA 3FMBA 2K1RB 3CC2S 4CYUA 4C98A 2XC9A 3SIPB 4OJ3A 3AHPA 1LWEA 4PQUA 1G4CA 2IIHA 2ZBIA 4HKQA 2C1EB 2J8AA 4QWEA 4LF9F 2PFFB 3MAAB 4DV1F 3TAMA 2VJVA 4WTOB 4Q44A 3KLGB 2IM3A 4I64A 4DPTA 1FX2A 4DG1B 1L3VA 4NMXA 4BC9A 1JXEA 1MWZA 5G0RB 2PMZD 4ZVSB 3UD3P 3TOQA 4NEZA 4LFBF 1NCLA 3PFOA 4OLOA 3CJKB 1WEXA 3J7Z5 2ZH5A 2BW7A 2DY9A 2F8EX 1SJQA 3IRXB 3UN2A 5KT7A 3KHGA 2ZH9A 1T7PA 3NBPB 3MR5A 2FVRA 4ED2A 4R25A 3LTOA 4NLRA 6FD1A 2GJ2A 4OYMA 1IM6A 1S6UA 4KH1B 1KKHA 1P8GA 2DGUA 3GSDA 2DIVA 2QLJB 3HHDA 4CT9A 5HLFA 4MK8A 4WFYA 3CJSA 4F0KA 1NK7A 2FJXA 2KJVA 2AZ3A 3MURP 3J81j 4KTQA 1HNVB 4NLDA 4QIEA 2RSQA 3D4JA 4LVOP 5KFCA 1Q8BA 1PJ6A 3U02A 3BPSP 3QIPA 4NXMJ 4BLGA 4DR6F 2KU7A 1NO8A 5DJBA 3DGVA 2D74B 3DRSB 3ISND 3R9LA 2BQUA 1RWPB 1NKCA 3BQ1A 1S4EA 3CDBA 4DL7A 1VBYA 4E8UA 2E9ZA 3HK2A 4JP8A 4P2SA 1XMQF 4V19X 1QSLA 4EZ9A 1OIAA 3A8EA 1F1BB 3ENVA 3MMAB 3PIPQ 1RAAB 2XLKA 2PC6A 1QE1A 3CCMS 1U1KA 3IBCB 3DLEB 4CZCA 2GC8A 2CJBA 1FRKA 2QE5A 4XO0A 4B3MJ 4ETZA 1J5OA 2YWKA 1RI7A 1HWKA 1Y7PA 2IC3A 2J0QD 4X4NA 4LF4F 1JLBB 1FI4A 1RWWB 2HQDA 4J9PA 2OJ3A 4UOHA 3EZUA 2CA9A 2NXCA 2ZBCA 1ZS6A 5LSLA 4W98A 1NH8A 2EEYA 4QYZJ 4ERDA 3CT9A 3Q8YA 3CE8A 3FBEA 1HNIB 1SVDA 5C24A 2DTJA 1XR7A 3DKDA 5I3UB 2NYHA 1TTHB 1RAEB 2DEJA 1UFLA 1UPMB 4RW8B 3WQPA 4G6VB 4YMEA 4IDKA 3OL8A 2D3ZA 2MZRA 2CPHA 1EKSA 3BGRA 1S1TA 1PJ5A 3DOKA 5IV3A 3KUHA 2RKIB 1IXKA 3KFWX 4H4KC 4M5JA 3IWNC 2HHSA 1JQGA 4Y28C 1W7WA 2E1MC 2MY8A 2CPYA 3VHQA 1T05A 2CZ9A 2E5IA 3DYAA 2QLXA 1KBRA 1S6PB 4PQUB 2VG5B 4KPYA 1TVRA 3D1HA 3DMJB 1LK7A 2W01A 1WHVA 1RQ0A 3OUYA 1VBKA 1VBZA 3QJLA 2KRBA 2ILYA 1FESA 2VC0A 4JI4F 1LW2A 1M5OC 1NJXA 4H54A 2UU9J 4DQIA 1U02A 2I38A 2KKHA 4N77A 1HWJA 1YBTA 4QQBA 4DR2J 4F02A 5HK4A 2PEBA 3MM9B 4HTIA 5KFPA 1AFJA 3IGVA 3TJ9A 1S79A 2RU9A 4ZLJA 2H51B 5C25B 3IRXA 1HKAA 3NGSA 2VODA 4USWA 1VMBA 3LO3A 3QT6A 2C42A 5HAOA 4DR3J 1WOPA 4AXJA 4N41A 2GQQA 2FJEB 2UUWA 3W2VB 3GSIA 1S6QB 2IFXA 2YNGB 1RHQB 5DZ7A 1N5QA 4CLTA 1HR0F 1XNRJ 4NLWA 1RT3A 1TL7A 1G6BA 4QIWD 4EEYA 1DARA 1CLFA 1OPIA 2YNHA 2JEGA 4HI2A 4WIIA 1RT1A 5T7LA 1DFDA 4OZNA 4O44A 1EETA 4QW8A 1XMOJ 1HMVA 4ES2A 2JZ5A 2YKNB 2IAJA 1ZM9A 4J7CA 2AJQA 2VOPA 1J27A 2DNMA 3I32A 4P2FA 4DZ6A 3MHYA 4USJC 4ELUA 3NNCA 3UVJA 2J7WA 2EVZA 2GQCA 4OYBA 4NPOA 3DDNA 1IBKF 2J0WA 2Y1LB 4NLGA 2Z56B 2XTJP 4WYWA 3D0HE 1WKKA 4O3PA 2B4VA 2R7WA 1ZAWA 4OJ1A 4J9MA 4H4OB 3ZZTA 3TVYA 2BKPA 2W4CA 1JLQB 2VQEJ 2FLLA 1LK5A 1DZ5A 4A8MP 1QAIA 2ZD1A 1CS4B 1VHIA 2MMYA 3AJ1A 5F9NA 3I55S 1RYSA 4TKTA 4CO2A 1JWWA 3PW2A 1H7XA 2X51A 2GIFA 4CWBA 2Y0SD 3M2VB 4OHZA 1JKHB 3HVRA 1R0BG 3KKFA 2V5HG 5KOWA 2C2OB 1K1SA 2I9SA 2KM8B 5C24B 1HNIA 3OXGA 3OPKA 1ZTTA 3OHAA 2EC2A 4I1TA 4NZ0A 2R3VA 4OV6A 3RG6A 4IG0B 3KJVB 5IZHA 4ZLNA 1ZBTA 1S1VA 2RHSB 3CJ5A 4IG3B 2YKOA 3JYTA 2VIHA 2ZH1A 4RLEA 5HROB 5A8WA 3T41A 5EN1A 5KG1A 1ZZFA 2CJQA 5K14A 1EARA 1XTZA 2EK1A 3FFIB 4WE1B 2XY6A 3CDUA 2GIRA 1CULB 4RPFA 5ETOA 1QM9A 4ENOA 1S6PA 2FGCA 2UV8A 2HGMA 4WFXA 2MJNA 3UN5A 2D41A 1NPKA 1Q7YT 4W90B 2WSFC 3D67A 3CO9A 3K5LA 2CADA 3CJRA 2CZVC 1QDUB 3UI3A 1D1UA 4JI1J 3CXCR 3MF5A 2GHPA 1M5VC 2ZE2B 4DUTA 1GX6A 2M2BA 4I56A 2AMCB 3M2RA 3I6PA 4OZ0A 4R0EA 2CJ9A 5DDPC 1RTDA 1C0UB 2AJ4A 5L8RC 5U47A 1UKUA 4CO4A 5HL7Q 3Q83A 5B0AA 1O0PA 3ULHA 3NS5A 2QYCA 2KXNB 3W65A 4K4TA 4J9NA 1NUEA 2ZC4A 5HJYA 2G4BA 5D0RA 3T6JA 1T3NA 2GFFA 4LF7J 3SSQA 4PWDB 1OJ4A 3C14A 3TX8A 3PCOB 2OLWA 1TUGB 2F9DA 1H74A 2C3PA 3RU0A 4RUHA 3PTWA 4MAKA 2CPEA 4C8ZA 4G1IA 2B51A 4RUCA 1X5OA 5CD4H 1D8ZA 2XCPA 3DRPA 3I0SB 5LSOA 2V34A 1U45A 1HMVB 2KI2A 4C6AA 1XEZA 2IAJB 3C16B 1FKAF 3EWGA 4DV3F 1UL3A 1SKUB 3GIJA 3W60A 4HR2A 2CNKB 2KYZA 3ADAC 3RGIA 2DNPA 3FNNA 3PJXA 2LYVA 2Z8QA 4DR1F 3PR5B 1VQ7S 2XS2A 3V6DA 4FYDA 1FX4A 2QLBB 2KTQA 3DLGA 1B70B 1AT1B 2VHGA 1MU2A 1R8AA 1S9GA 3OR1A 5DLFA 2E5JA 4RBUA 5F41A 2G1DA 3KHLA 1MN7A 1KHVA 2YKQA 4NA1A 4UF4A 3PEHA 3V6HA 1U1NA 1WTFA 4RKUC 1VBXA 1Z2LA 1Q4RA 1Q86T 2ZZTA 2H9ZA 3NS7B 1S49A 2D1CA 2FYXA 4FYYB 4RNNA 1S77D 3KLFB 4KGVB 3SZ2A 1DRZA 5IXUA 3IMQJ 2OH2A 4K4VA 1FKOB 2L48A 3BM7A 2E9TA 4OYOA 2UXBF 1PAUB 3QAUA 2V2ZA 3NLCA 2G1HA 2H5JB 3NGUA 5ITHA 1NJIT 4YS2A 5LMNF 3NOGA 2DR5A 1FWKA 1OSCA 5GAEU 2V8HA 3KJVA 3TQEA 1UP1A 3DXSX 4B9UA 4LF2A 2W9CA 3LW5C 1MROB 4UZCA 3ZZRA 2ASLA 4LFCF 1G2EA 3EXYA 3R6LB 2I5JB 1NB7A 5A8WB 2YH0A 3EGZA 2H5IB 2BACA 1UFKA 4KHRA 5KG3A 5I3QA 1FXDA 1V3ZA 3FFIA 4ZVHA 4HYKA 3I82A 4LRCA 1HD0A 4C3LA 4IUFA 4XDDA 2POKA 3M6WA 1BY9A 3M8QA 2PEHA 2H1YA 2I6WA 1OPZA 2UVRA 1OQ6A 8AT1B 4WJBA 2MQNA 3I4PA 2ZUGA 2COLA 4HHUA 1TFWA 3V6KA 5IQ6A 2HIQA 3NGRA 3BGOP 1D9DA 4IRCA 2JVOA 4JI4J 2IYIA 2LVWA 5HVFA 3ZO7A 3SDEA 4HT7A 1RTDB 2BJ8A 2BYCA 2KRRA 3CDWA 3HD1A 4MIWA 2IJNA 3W3SA 3MECB 3THTA 1RE1B 4ZVGA 2CIMA 2DISA 4OZJA 3C15A 4PG6A 1ACMB 1KTVA 2GMHA 2VBXA 5FDLA 5G4DA 5HANA 3OVSA 4ECVA 4LF9J 4ZIVA 3ILOA 2AD9A 4F8RA 3C14B 1BWVA 3CC4S 1DQ8A 1KOHA 4GO7X 1S97A 3IA0A 2OI2A 3IR7B 3P49B 1BQNA 2FLNA 4F4AA 2RIJA 1IR1A 2E44A 2HFOA 4BHQA 1WTBA 3J7AN 3P8BB 2AT1B 2HHQA 1B0VA 4BWMA 2XHCA 4CM2A 4QWCA 4LF8J 3L7PA 5AXLA 3GYGA 4DV6F 1R8CA 3UW1A 2UUTA 3ZNJ1 1UWBB 1NK6A 2VPYB 4ZHRB 1IWGA 2HAIA 1Q16B 1SJ1A 1O51A 1RLDA 3LP1B 4F50A 4XIUA 3V6JA 3BDPA 3W9IA 2UXDJ 2R7VA 4KGXB 4ECWA 4B9NA 1TL1A 3H0PA 2ZZNA 4ZVFA 2HHPA 4A8WA 1X4CA 3TZXA 3Q24A 4JI3J 2EFQA 1KVJA 4KR0B 5J2PB 2MLYA 4X4RA 1S9GB 3MR6A 3ZTRA 5GMKa 3T1HF 1SXLA 1CSJA 2AEFA 2DR9A 2RUGA 2AYGA 1KTQA 3CDAA 3ILLA 3QT5A 5D4LA 3JAMY 2DRDA 5CYMB 5LXYA 5DG9A 2MZ1A 1NXIA 5J1NA 2YNIA 4FF3A 4K4YA 1VQ5S 3BJYA 1CC7A 1FHTA 3NGKA 5F8JA 2OD6A 4UW2A 3WIUA 3TYTA 1XIQA 5HO4A 1N48A 1E6YA 2RJZA 2R42A 1S0MA 3UQSA 5RUBA 2GCFA 4C3KA 3JSRA 2Q1LA 2V63A 4AT1B 4WIQA 1IKXB 2GQ2A 5A8KB 3M30A 2NYIA 3W64A 1FFGB 3GFZA 2O01C 4P71A 1ZTWA 1YRUA 3MDFA 2FIUA 3HO1A 3K5OA 4NA2A 1Y11A 1HIYA 1F6TA 2E1AA 2GAGC 2WCXA 3JSBA 1BQMB 2YNFA 3LP0B 1H73A 2B9EA 4ITSA 4F67A 3OT9A 4HT5A 5EWEA 4DJBA 3M8QB 1NSPA 3G4SS 4CH1A 1YHQS 4FKXA 2J7UA 1JXVA 1WDTA 5CQGA 4P10A 1HFEL 1GMVA 4PYAA 1S10A 4X4UA 2DHGA 3TAMB 1QAXA 3KLGA 3AB4B 3RTVA 3TEHB 2N7CA 3PFEA 2JFKA 1RLCL 3T1YF 1U6BA 4X65J 1W25A 2HGLA 3RRHA 3NRBA 2CDRB 2DD8S 5KFAA 2FGOA 3ZZPA 1EX8A 5GADI 4DS5A 1FFWB 2B43A 3DGPA 2JEIA 2CPDA 2B8QA 3O1LA 1F5BA 5KG5A 3KLEB 1L3UA 5KFVA 3CCJS 4NLQA 1KN6A 3M1VA 4MJKA 2VD3A 2AGOA 2HNYB 1CBKA 1Y5NB 2OUGA 2B9WA 4NI2B 2V4QA 3G6VA 2WVCA 4DR1J 3GLJA 1KSPA 2G2OA 1BQNB 2E7VA 5KFFA 3ETMA 2ZJQQ 3CO0P 3FCVA 1BD6A 3GJQB 2D9OA 3MR2A 4P74A 4DUYJ 1FTRA 2QZ8A 4ZHRA 1MNEA 2V2KA 3TA1A 5AJ3J 2VG7B 3OFHA 1KD1T 1D9FA 1TAUA 3T5HA 1N5VA 5HN0A 1TV6A 4ZIWA 1LWEB 1K44A 4NRUA 1ULRA 3DXBA 2DIUA 4KFBB 1R7IA 4OIXA 2XI3A 4NLSA 3VGVA 4CO3A 2XY5A 1X0FA 2FTRA 2XMTA 2XYHB 3W7BA 4LR8A 1RAGB 4RNHA 1H2TZ 3T6BA 5C7PA 1FJGJ 2FPHX 3PDNA 1C1BB 3AA9A 2VH7A 3FDSA 3OFGA 5A0YA 2FDNA 3HM9A 3IBWA 1YLXA 4G1QA 2R8IA 4GO5X 4I2PB 1NDPA 3KLHB 2HIYA 4B3SJ 3RBZA 1RAIB 2IA0A 2WAQD 1X4BA 4KBIA 3LPEA 1AA1B 2IDEA 3RBXA 2PI5A 2HHHJ 4LF6F 4RW4A 1WC1A 4FF1A 4Y34A 5CZXA 3LP2A 1HBNA 1SH0A 2AHOB 4F36A 3KOAA 2HFVA 2UXBJ 1JLCA 1GXTA 4HACA 1IKXA 3BN7A 4WP3A 3R6GB 5KFLA 2P8IA 3M30B 4F26A 1FNMA 2V8DA 2XG8A 2EFGA 1C0TA 3IS9B 2NPIA 1SCJB 2JWNA 2RQKA 3D9BA 3ENQA 2KHCA 4ZVTB 3UD5A 3MEGB 3DOKB 2IDLA 3C66A 2W2PP 4QU7A 5HQ8A 1RBOB 1NPPA 5GAGI 4DSKA 2HVHA 4I7FA 3BGLA 4ED1A 3ISZA 4FYVB 1VQ4S 2CJAA 4C8YA 3OTOJ 4DUZF 3IR6B 2FVSA 1TUWA 1JMTA 1HBMB 1X4EA 2RQCA 4DR3F 2VDIA 3M7VA 2ZH6A 2ADCA 3GJSB 1HL6A 5A6PA 2PMWA 3D6TB 3QSIA 3LOUA 4O3NA 2CAJA 1BQXA 1QSSA 2YXLA 2XNQA 1Z4UA 4MKBA 2RHQB 3IBFB 2DO4A 1QE1B 3IM8A 2Z4PA 1KFSA 3G6YA 2IM2A 4WK1A 4OQJA 1ICEB 1EP4A 1J5OB 2C3MA 5HMWA 2DPIA 3QRPA 4OI2A 3PRBA 4ECUA 2Z57B 4CLKA 1M5HA 4QBUA 4RL1A 5C42A 3FUYA 2XO6A 1KEKA 1KFDA 1RTJB 3DI6A 1GK8A 2GJFA 1YK9A 3P5BP 4NI2A 3GR0A 2NZCA 1RT2A 2YNGA 1NU4A 3NWRA 2BBEA 2DGTA 3N5BA 4KO0B 1EZZB 4YHHF 5DO2A 2HMIA 1SH3A 1X4FA 2HKEA 3T19A 3MUMP 2WTFA 2V50A 3ZC4A 2YNHB 4DV7J 4CI0B 4TNOA 2R9LA 1SC6A 1LV5A 2J9EA 3BKFA 3K5PA 4QU6A 1NLKL 4ZCIA 4GKKJ 3OLAA 3K89A 4QWBA 1TV6B 4EBDA 4ZPDA 4KHPJ 2DR7A 1LFPA 3E3XA 4ED7A 4ECYA 5H9EJ 2MZQA 1EB0A 4LBPA 4UUXA 3E51A 3V81B 1GX5A 3KHRA 2V9WA 3S8SA 1YQHA 2LXUA 3OUYB 3Q2TC 1WKLA 1TKTB 1UVLA 2YWGA 3GCWP 1LW2B 4H4OA 2O1PA 4OZ2A 3KK3B 4WU3A 5KFNA 1SKRA 1T9TA 1S0OA 3D66A 1EAYC 2VFSA 4PYDA 5GAGU 3KLHA 1MLAA 4RWWA 4MFBA 5L1JA 3VAGA 5ETMA 1L5UA 1H2UX 3RB0A 3BS9A 3EDRB 1X4GA 2NPFA 3WC0A 2FVPA 1RWXB 1SI9A 2ZOMA 1O6XA 4NCGB 2O3DA 2HWIA 3NWGA 4Q2MA 3R3TA 1T9XA 3O3LA 3BGFA 4OHWA 1SQFA 3EX7B 4DSEA 4IG0A 2NXEA 2HNZB 3A3OB 3OXFA 2CVEA 4J37A 4Q2LA 1UZDA 3EVMA 3FGVA 4GVBA 4M5HA 4Q7AA 4M5LA 5LSRA 1WELA 2BKNA 2N3LA 4O44B 2VJUA 8ATCB 4PXBA 3Q8SB 5J2QB 2PSZA 3EZOA 1UJ4A 3W62A 2M5YA 3VAJA 2IVMA 3D3BJ 3GE9A 4ILLA 1RADB 4ZVPB 1LWXA 1U2FA 3I5AA 4K4UA 4UT4A 4DL0C 5B0GA 1DQ9A 1KVKA 3N01A 3ZFVA 4LUBA 4EI2A 4ATNA 2F7VA 1NSKL 4ES3A 3WHIA 5AE3A 4JI3F 4FZVA 4AQYF 4LFBJ 1GT8A 2DR6A 2GHVC 2ZM6F 1JLQA 2EPIA 2YQ0A 4ED4A 1DQAA 2N7YA 2JRSA 3PEJA 3R5DA 3AY0A 5KG2A 5GMDA 1UVNA 3W2WB 1NK4A 2OPQA 1WG1A 2CNLB 1RTJA 3DI6B 4EU0A 1REVA 1N5TA 3K8VA 4FNHA 3G9CA 3IP0A 4D3HA 1UPPA 3QYYA 4B3OB 1HYSA 3CF5Q 2IBOA 3FC9A 1P1LA 3VVUA 3K17A 3TP2A 2JFDA 2WVEA 3CTRA 2FD2A 2LU1A 3T1AA 1UCNA 5IT9U 3SCKE 2ROPA 1UEUA 1ZA1B 5IT9Y 3MMCB 4WFAQ 2BANA 4U8VA 3MUTP 3OL9A 5KT3A 3CCLS 1Z1ZA 1YBAA 2BRLA 4RX6A 1CULA 1GFWB 3RRKA 3SQGB 4YDDB 3V6DB 2XB2D 4IFYA 1G7CB 4WP8A 4UOFA 4B02A 1XBWA 4F0MA 3BB5A 3OSNA 3T1HJ 3JB9k 5KFOA 5H9FJ 3RRGA 3UFCX
chains in the Genus database with same CATH topology
1ZH5A 3FCHA 1K0VA 3KK3A 3GFYA 2BQRA 3PR4A 1VRTB 2GX8A 3JTOA 4OZ5A 4QR2A 2ACYA 2B5JA 4B08A 3G8TA 1GQEA 2XMJA 3TW0A 4X4OA 5KT6A 3RB4A 1WD6A 2CQHA 3DLKA 3MMBA 3RYLA 1GXLA 3TAPA 5DS7A 1HQEB 2OKQA 5EUHA 5DLGA 3HHLD 3SFGA 1F5CA 4ZCLA 3GIMA 1MMNA 4USHA 5CYQB 4A8KA 5BYSA 4FVCA 3X3UA 4YFUA 1MROA 1LW0B 2LDIA 2QFJA 3US5A 2DVIA 3GV8B 3GR1A 1N33F 2E5GA 3OTCA 5EGYA 4A8XA 4RU2A 2VZ9A 3RR7A 3OVBA 1U25A 3KLVA 4JV5F 1LWFA 4DF4A 3FVYA 4PUOA 5GAHU 3HP6A 3VAMA 3PHEA 4I6YA 2R2UA 1PO6A 4L72B 1N32F 5LJ3Y 2DGXA 1IBMF 1MU2B 2EG1A 2VA2A 3OR1B 4CNZA 2MY7A 3MECA 5DM6Q 1WG5A 3RAMA 3KK1A 2GIQA 2OPQB 3OVAA 1R8HA 2ZHAA 2M8DB 3H4BA 2O66A 2AYBA 4K4XA 4A8YA 3POTA 1FRJA 2KB2A 4OI1A 1O8BA 2ZJPQ 3T5LA 4YOEA 4ZMMA 3KWMA 3M32B 1HQUA 1M90T 3IWXA 3AQOA 3MEEA 2K3KA 1DLOA 2WK4A 2LQ5A 1SJ4P 2XMKA 2BV3A 2V4JB 3L09A 4NWBA 3VAHA 1KONA 1B0TA 4FBTA 3MMCA 1X9MA 2GHWA 2HWTA 4DV4F 3R5AA 3CPWR 2AYMA 2DH9A 1Y00A 3FEZA 2I8EA 4E0DA 3RAXA 1Y4ZB 5JVHQ 4QR1A 3N5FA 4CO5A 1C1CB 3ZZ0A 4ED5A 2WOMB 3C6UB 5E3AA 1VIOA 4EO6A 3T3FA 2C28A 2WONB 3B82A 2V0NA 2GMJA 3KNAA 5F3ZA 2RQMA 4B3TF 2YNIB 2VC1A 1WI8A 3M8PB 1SB6A 2EFOA 2GW8A 2OFHX 3RZAA 2ASJA 3UR0A 1HQEA 4PG7A 4O3SA 1TK0A 4LMZA 2HHTA 2KVIA 1M5KC 4HH1A 2BDPA 1U6ZA 1WF1A 1XC9A 5A8KA 3LF0A 4ICLB 2J9DE 3PXGa 1I6JA 2UV8G 2DJWA 4C7QA 1I1GA 1VOMA 1VC5A 1RT4B 3ITHB 1Y0HA 5KFHA 3ISNC 3HT3A 3KK2A 2J6UA 4KQZA 3Q8RB 4WZMA 4DSFA 1XMBA 4ZKAA 2W4PA 3CWJA 2GGPA 4NLPA 3V4IB 3M2UA 1Q81T 1BLUA 2DHAA 3NL0A 4YB1P 3HVTB 3MI7X 3CMES 4DMZA 2VKZG 2E9RX 4RW9B 2O67A 3ICLA 4HL9A 4YR3A 4NMLA 1R8BA 2B4UA 3OXLA 4OI6A 3PKYA 5J2PA 2J7KA 1WHXA 4H4MA 4YUDA 1YVFA 1MMDA 1GNKA 5L39A 2W8KA 5SZTA 4MIBA 2YKMB 4CO0A 4ED8A 2IMOA 3H98A 4OLPA 3SCIE 4ELTA 3EXCX 1Q7LB 3J7A1 2K8GA 4HDHA 2P9CA 1FKPA 3HI9A 4J9KA 4CIOA 3MEEB 1LQ9A 1DLOB 1TL4A 5BR8F 3OW2R 1X5TA 1YJ9S 1R3NA 5I42A 3CCTA 2HFZA 4X4UA 2PIIA 2CQ3A 1RT6A 2KDOA 4Y2AA 1NHUA 2IJFA 2MGZA 3X1LB 4B3SF 2Z2MA 3LUYA 5HP1A 2IBKA 1JLEA 4K5RA 5KG7A 2ROGA 2MZTA 3PW7A 3TAQA 1VC6A 3KMQA 1U1OA 2LQ9A 3D0IE 4DR6F 1C1CA 1URRA 3CVKA 3WDOA 4OZLA 2N3OA 4A8QA 3OL7A 4N8NA 1RDRA 2JC1A 3U1NA 4FNIA 2LQJA 3FRYA 4WFNQ 3PX0A 4DR7F 4XDCA 2BM0A 3GV7B 2A1BA 3MM6B 4AL6A 3GG1A 3I5BA 3VAKA 4I2PA 3H2UB 2CQ2A 2KG0A 4AE5A 4OZ1A 3U1MA 2DNZA 1WEZA 5CA5A 1YJNS 1XERA 4B9MA 5CHCB 1KVIA 2WW8A 5KG6A 1JLCB 2QV6A 2W4DA 4FP9A 5HMZA 2C22A 2FB0A 3E01B 2DO0A 3HHKA 3GQCA 2JVRA 3IS9A 3M05A 4Q8EA 2APOA 4YB7A 1FXLA 4QWAA 3SMZA 3HX9A 4YQWA 2D3OR 4QYRA 2MQPA 4JI8F 3M6XA 3IWLA 4QCLA 2VONA 2VG7A 3M2UB 5D77A 5CXTA 5KFSA 4LQ3A 2QIFA 5I4MA 5A2QY 4DWIA 2ZH2A 1VHFA 2IRUA 2Q3PA 1Q8LA 2F3JA 4L6V3 4TU7A 1OQ3A 2WBRA 5KFXA 4DHVA 3QZ7A 3F44A 3Q8QB 2VQFF 4ED3A 2DHXA 1L3KA 4YR0A 2HS4A 4G1QB 4TU8A 1MW7A 1VRUA 2CQGA 3AAWB 1HYSB 1JLFB 2XWXA 1PC5A 2L3MA 2VA3A 1YGYA 4RZRA 1UVKA 3NAHA 1IM4A 4LIWA 5B0BA 2ZHBA 3EGWB 3RR8A 1HBNB 1FKPB 4LJMA 4Q43A 3VZHA 1TP7A 4MKYA 3EPGA 1S1UB 4M95A 4F25A 3SI8A 4DL4A 1FK9B 5L1KA 1YI2S 1AUDA 2BE2A 1C0TB 2A3JA 3KG4A 2ROEA 5D3GA 2AYEA 5LMUF 2Y1JA 2CQ1A 2Q79A 3MEGA 1RT6B 2MKJA 3M9NB 3K57A 1WHWA 4KC5A 5KFBA 1JLAB 3QZ8A 2IM1A 4O3OA 4IH7A 3MFIA 4LFAF 4NA3A 5HP1B 4PXCA 2XLIA 2V4RA 3TA2A 3RBEA 5B0DA 2MSSA 1TKDA 3OJSA 2Y1IA 4LSNA 3SEOA 2HYIB 4X64F 1S0NA 4K50A 2HNDB 5A6WA 2MSTA 1TKTA 4PWUA 4TXSA 1N0VC 1UA0A 2LDYA 1DAXA 1S7HA 2B9YA 2VG6A 3MM6A 4RWXA 3MPWA 5B0CA 2YH1A 3CCUS 4X2BA 4ZPWR 2XI2A 4MK7A 2J5AA 4MH8A 2DH7A 4MFBB 2OSQA 4M94A 1RTHA 1F9FA 3FQKA 5T41A 2CPXA 1X5PA 1HBOA 3F56A 5C42B 5KTQA 1U4BA 2OMLA 1RT2B 4WTYA 3CD6S 2HMIB 5E3CA 1Q1KA 2HNZA 2ZFHA 3AQPA 1IBLF 4WFZA 4DOZA 5KT4A 3PZPA 3FEXB 2XO7A 3NNHA 4HDGA 1Q82T 3CMAS 4U6PA 3DNCA 1UW4A 1XK8A 2VB6A 4HI1A 5FLXY 2E7WA 4HH0A 1NRKA 2B56A 4ZK7M 1S9EA 1JLGB 4CH0S 3K59A 2P5VA 2KG1A 2R8GA 3DLEA 3JSMA 3LWLA 5KFTA 3FSXA 2YQ3A 3IFEA 4F4KA 4Y00A 4O0IA 3T5JA 2NXUA 4N56A 1X5SA 2YKAA 4J5OA 2XGPA 1HWIA 3THVA 1JLFA 2AJFE 3P96A 5KFYA 3LH2S 5D8HB 3ONQA 1NJZA 2RRBA 1M5SA 4NCGA 1FD2A 2BXJA 4B3OA 2XMVA 1VI7A 4YY3F 1RT7A 1TL5A 3G96A 4NYOA 1S1UA 2LA6A 1FK9A 4G1PA 2R7SA 2V94A 4IDKB 4YP3A 3TRGA 4I67A 2DBBA 2Q6BA 1AFIA 1HPZA 1YRTA 3DOLB 1VQYA 5GADU 1DTTB 1JXLA 1T05B 2J6TA 1A6LA 1X9SA 4BWJA 1N4LA 1TVRB 3KNGA 3MWBA 2KH9A 4PG4A 1Y5LB 2HNDA 4OL8A 3DLLQ 3C3LA 3N4WA 5AE1A 5KAKA 1Q8IA 1YJRA 4WXOA 2NUHA 2W8LA 1FJGF 1V6HA 1U2RA 4NCBA 2OTJS 4NLUA 4NCAA 2RS2A 1NK0A 4JI5F 1JK9B 4ID5A 5B0FA 3J7YU 4ZPTR 2B5JB 2GV1A 2EW9A 1UVJA 2EFNA 2HQ3A 1TKXB 2XGQA 1XR6A 5C25A 4IFVB 1APSA 2RB7A 2JDJA 4C3MA 1H38A 3UPFA 2B7CB 1F5AA 4F2RA 1T94A 4RNOA 3G71S 3OL6A 3MR3A 4UQTA 5DDRC 3GYNA 4C0OC 1LW0A 4OFZA 4TLQA 4TLRA 4LT6A 3C6TB 3O6QA 3R27A 4DV2F 4KAIA 2UUBF 2P9EA 4G3IA 3VQTA 2W9AA 2LXIA 2DB1A 1HI1A 2YKNA 3G8QA 4I69A 3CC7S 2HHVA 3LALA 3K8WA 4RW6A 1LWFB 5KFUA 3THPA