5LJ5Y

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lj5Y00
1Q86T 3HHNB 2DNRA 2NLWA 2MZTA 2DISA 3TYTA 2AYEA 5DDOC 3VALA 3MDFA 5IM0A 1VQ7S 1YJ9S 3S6EA 2MSTA 2M70A 3PIOQ 1KOOA 5DDPC 4QPTA 1FXLA 2CPIA 4QQBA 2MQLA 4F26A 2RRBA 1X4AA 1NO8A 2DGOA 2MQOA 3BO4A 1VQ5S 2MZJA 3CC4S 3CC7S 2LQ5A 1ZZNA 2CPJA 3CC2S 2CQGA 2U2FA 1YHQS 2CPFA 2KT5A 3U1MA 4CQ1A 4YB1P 3RW6A 2DH9A 2KN4A 1KD1T 4PR6A 2MMYA 1X4BA 1KOHA 1CVJA 4W92B 2K8GA 2CQPA 2MSSA 2LA6A 2E5JA 2LEBA 3NNAA 3MUMP 3U1LA 4V19X 2EK1A 4W90B 4WCEQ 5LXYA 1M5KC 5LXRA 5CYJA 3OW2R 1VQMS 2MB0B 2M0GB 3NS6A 1H2VZ 3MURP 4QU6A 3MOJB 2HGMA 1VC6A 1O0PA 2MKCA 1RK8A 1SJRA 2CQBA 1SJ4P 2M8DB 2MZQA 1WG4A 3EGZA 1S79A 1WHVA 2X1FA 3BO2A 2PEHA 1X5PA 3P5TL 5CA5A 4ERDA 3ZZZA 1QVFR 1DZ5A 3IRWP 3CCJS 2DHAA 2KRRA 2U1AA 1R8HA 2JWNA 4TLQA 4TU8A 3MUVP 2MKJA 1M1KT 2VOOA 4ED5A 2K3KA 2YTCA 2DIUA 2DGSA 4UQTA 2E5IA 3ZZYA 2J8AA 4WKRA 2X1AA 1SXLA 3NNHA 1M5VC 2VONA 2LA4A 2DB1A 5IM0B 3UD4P 2MQQA 1R8PA 4P6QA 4A8XA 4PKDB 3H2UB 2KG1A 2MKKA 3CUNA 3K0JA 1OIAA 1G2EA 2DHXA 5JVGQ 3NS5A 3UCGA 5D78A 3JB9k 1HD0A 4WFNQ 3BS9A 1X5SA 1KC8T 1VQNS 2AD9A 1S72S 3LPYA 2KHCA 2CQCA 2O3DA 1WWHA 2CQ3A 1WG5A 3VAFA 3B4MA 1JMTA 2LCWA 2PE8A 2DNOA 2RQCA 2MKIA 2JVRA 2RVJA 4PRFA 3D2WA 5GVQA 3J7ZT 3UD3P 2MY8A 2KYXA 4J5OA 3MI7X 2JRSA 1KQSR 3R27A 4WF9Q 3RW7A 1U1MA 1B7FA 5DM6Q 2EVZA 5ITHA 4YOEA 2KI2A 1FJCA 4OZ0A 2E44A 4TU9A 3FEXB 1VQOS 3MD3A 2DHSA 5IFMA 1QM9A 2CQ4A 2FHOB 2MKHA 1YITS 4LMZA 3HI9A 1U1PA 1VBXA 2VODA 3PIPQ 4M5DB 2L9WA 2I38A 2F9JA 2FPHX 2JX2A 2KVIA 2DNKA 2QEXS 4IO9Q 1FNXH 1WF0A 3VAGA 2DNPA 1PO6A 3V4MA 5DETA 2DO4A 2HGLA 3MUTP 3N9UC 1OPIA 2KRBA 2CPYA 4WIIA 5GMKa 2RUGA 2E5HA 1VBZA 2CQ0A 1JJHA 1WEXA 2DNZA 1YWXA 2HYIB 2DGWA 1HD1A 2CPZA 2LXUA 1U1QA 5H1SV 1NU4A 2KFYA 5GAEU 2FY1A 2DNNA 3IWNC 2G1DA 1X4FA 4Y00A 1K73T 1K8AT 3G71S 3UWTA 1VQ9S 2GHPA 3THPA 1M90T 2D9OA 2CQHA 5FJ4A 3H2VE 2DNGA 1U6FA 2LKZA 3UCZP 4QU7A 2XSFA 4Z2XA 2KH9A 2KM8B 3I55S 3SXLA 1VQ4S 3G8SA 1U1KA 1FO1A 3US5A 2DGQA 1WHXA 2M88A 4F25A 1DRZA 3SDEB 1JJ2R 2RU3A 1FJ7A 1WHYA 1UFWA 5EN1A 4U67Q 2NZ4A 1JJ4A 1VQ8S 4UY8T 3SMZA 1X4EA 2BOPA 2OSQA 2QFJA 2ADCA 2DO0A 4BS2A 1URNA 4C0OC 1K9MT 3TP2A 1UW4A 1FHTA 3CCSS 4EGLA 2MPUA 1UP1A 2E5GA 2FC9A 3G9CA 3CCES 1BY9A 2RS2A 1VQPS 2LYVA 5BJRA 4FXWA 2FC8A 2RQ4A 3VAKA 1X0FA 2MZSA 5IQQA 3VAIA 3CPWR 5HL7Q 1VBYA 2N3OA 3CF5Q 1X4CA 2CPDA 2HVZA 2A3JA 2MYFA 4OZ1A 3CULA 3CTRA 3VAJA 5JVHQ 1P1TA 4CH1A 1H6KX 2DGXA 4IOAQ 3CXCR 1WI6A 4LJMA 1SJ3P 1SJFA 1FT8A 1FJEB 3S01A 2MQMA 5LSLA 2YH0A 3R1LA 3ULHA 1X4HA 1A7GE 3P6YC 5GAHU 3SDEA 4WFBQ 2M2BA 3UCUP 1WTBA 2N82B 2KM8C 2MGZA 3P49B 3G96A 1N88A 2ERRA 1WELA 1N8RT 2D9PA 2KXHA 4WFAQ 2LECA 1YTYA 2X1BA 3G6ES 1AUDA 3P3DA 2MJUA 2X1GA 3L3CA 2DNLA 1ZH5A 3VF0B 3UE2A 3THTA 3CCLS 1M5OC 3NNCA 2ADBA 2CJKA 1P27B 2YKAA 2XS7A 1U1NA 2DGVA 3EGNA 2N3LA 2MZ1A 2WBRA 2KXFA 2J0QD 5MLCV 3CMES 1U6BA 1UAWA 3CMAS 1M5PC 2N7CA 1U1RA 1X4DA 2V94A 3G4SS 1RKJA 3FEYB 2MJNA 2KXNB 2M9KA 2OTJS 1QVGR 3J7YU 2MY7A 3CCMS 1WF1A 2HGNA 1YJNS 1WF2A 1A9NB 1WG1A 5LSOA 2YH1A 2DNMA 2RT3A 2UP1A 3B4DA 5DDQC 1Q7YT 2MKSA 3EX7B 3S7RA 4ZKAA 2LMIA 1L3KA 2M4MA 4F02A 2OSRA 3DLLQ 2CPXA 2DITA 1X5TA 5GADU 1U1OA 5GAGU 1U1LA 2MZRA 2MQNA 4YUDA 2HZCA 1Q82T 1OWXA 2YWKA 1YIJS 2BZ2A 2M52A 1VQLS 2L41A 2L08A 3Q2SC 2J76E 1VC5A 1D9AA 2F3JA 2DNHA 5LJ3Y 1WEZA 4Y0FA 2OIHA 4FXVA 2Q79A 2G4BA 1Q81T 4RU2A 3MXHP 1H2UX 2AYMA 5CXTA 2CPEA 2DHGA 3CCUS 2LXIA 1YI2S 1VQ6S 2CQIA 1H2TZ 1XN9A 1X5OA 3CCQS 1ZZFA 3NMRA 1SJQA 2JVOA 2AYBA 1VQKS 4C4WA 1OO0B 2J0SD 3MD1A 3BEGB 2SXLA 2MHNA 2XNRA 3CCVS 2MGZB 2M7SA 1WEYA 2KU7A 1YJWS 2RNEA 1VC0A 2DH7A 2DK2A 3I56S 1NJIT 2QA4S 3VAHA 2DGTA 3S8SA 1U2FA 2XB2D 2ZJQQ 5DM7Q 3DXBA 1N54B 3LQVA 2OJ3A 2LEAA 3G8TA 2VOPA 2MQPA 4TU7A 2RRAA 2ZJRQ 1X4GA 2D3OR 3R1HA 3BO3A 1DBDA 2B0GA 2CPHA 2G0CA 4C7QA 2OTLS 3VAMA 2CQ2A 1W2BR 2DH8A 1PGZA 1WHWA 2DIVA 2XNQA 3CCRS 5LJ5Y 2XS5A 2RS8A 2I2YA 2CQ1A 2ZJPQ 1F9FA 3TO8A 1WI8A 2DGUA 2F9DA 2MXYA 5D77A 2CQDA 2EK6A 1D8ZA 1N52B 4CIOA 1HL6A 2XS2A 4IUFA 2DNYA 1IQTA 2GO9A 2DNQA 5DDRC 4IOCQ 3CD6S 2KG0A 4CH0S 1DHMA 2AYGA 4LIRA 1HA1A 3Q2TC 5HO4A 2M8HA
chains in the Genus database with same CATH superfamily
1Q86T 4NX9A 3ILIA 3CGIA 1P9QC 3TYTA 4LR9A 3W66A 1FJGF 3W61A 2M70A 2DRBA 2KO1A 4DV3F 3KDOA 3V2UC 2KB2A 2OHDA 1YHQS 3CMQA 4RUCA 4P7TA 4ZA1A 1RWPB 4JP8A 2LVWA 3NNAA 3MUMP 1SKRA 4OZ5A 3U1LA 4V19X 2R8IA 1RBLA 4WCEQ 2GGPA 2HBZB 5CYJA 1EQMA 1W2IA 1RT7B 4GC6A 1RT2B 1H2VZ 2XSJB 1YJUA 1Q79A 1VC6A 1XERA 4JYAF 1ZAVA 1KSPA 4DV2J 2W25A 3BJYA 3OUYA 2UVRA 4JV0A 1HNZF 3TZWA 2YNIB 1YJVA 3FDSA 4XIUA 5B0FA 5L39A 2W2OP 1M1KT 4ED5A 2Q1LA 4B02A 1LFPA 2YTCA 3UR0A 5F9NA 4QCLA 2ZH1A 3NNHA 2VC0A 3CJRA 4NYPA 4OI4A 1Y5NB 1JLEA 3QAUA 1S6UA 3K0JA 2DHXA 3D0GE 2UXCJ 3UQSA 2FLLA 5D4PA 4NA3A 4ED4A 4CLKA 2AJQA 3M1VA 4LIWA 1S72S 4OI0A 1A0OB 3ENAA 4KKOB 2O01C 1FKAF 3IGNA 4NXMF 3IG1A 2EI5A 4PRFA 5K9FA 2ILZA 4WYLA 4J5OA 2YKQA 4TQRA 3LW5C 5HJYA 2PDAA 4KB7A 1Y4ZB 2UVUA 1V6HA 4LF4F 4NI2B 2FGCA 2YXLA 4OMFG 2XCPA 3NGRA 1S9EB 2V8VA 4ED7A 4NLWA 2F9JA 1C0TB 1U7LA 3RZAA 2IIHA 3ETOA 1AXQA 2H4YB 1PO6A 1S7HA 3V4IA 4Y65A 3PYFA 5CZXA 4IYQA 5CYMA 2KKHA 1F3FA 3MGJA 3CWJA 3I0SA 4ZVEA 3D66A 4OJ3A 1N5VA 3R5AA 5HANA 5HMXA 5I3UB 1CULB 4YB5A 4PUOB 3UWTA 1TL3A 2JEIA 5DGBA 1MLAA 3POTB 4BWMA 5FDLB 2LQ8A 2BJ1A 1FEHA 1C1BB 3US5A 4F25A 4O3RA 2E7VA 1UVKA 2XZDB 3C46A 1FTRA 3IBWA 2RF2B 2HS4A 2AWZA 1BQNA 2VG5A 4RUAA 1DAXA 2DCUB 2FC9A 4JV5J 4L3KA 2C3YA 2HS0A 5BJRA 3R5GA 3UPFA 3ZZTA 2KJVA 5A8RA 2MYFA 2ZH5A 3PJXA 1FJEB 3PYDA 3GV7B 4ZMMA 2FVCA 1J5OB 1H38A 3G96A 3V6JA 1S76D 4WFAQ 3AQOA 2FB0A 3OHAA 2GMLA 2CNLB 3Q8QB 3L3CA 4O4GB 4ECTA 1VS3A 4PG4A 1X31C 2CADA 1IKVA 2N3LA 2HW3A 1U1RA 2AF6A 1Q53A 3CDBA 3ZO7A 1SUQB 3AQPA 2BANA 3CCMS 2DTJA 2A18A 2QLFB 1FXDA 1J27A 2MKSA 4LF2A 3DLEB 2VKRA 2ASDA 4OL8A 1NEEA 5A76A 3M2RB 2MZRA 3TVYA 3OR1A 3NS7B 5LL6d 3MAAA 1U26A 1F9EB 1WKLA 5HMYA 4FF4A 3OPKA 2JVOA 2FJVA 3GG0A 1RTHB 4AQYJ 3SI8A 2CA9A 1NHUA 5AE3A 4DUYF 4MT1A 2RNEA 1FE0A 3BBFA 4X62J 3BQ1A 5H9EK 1S1WB 1NDLA 4FBUA 1ZYQA 3BGLA 2GJIA 3QRPA 5DZ6A 1H7XA 4GC7A 3ILLA 3JAMY 1V3RA 1HBOB 5D8HB 3M8PB 4I68A 2GVZA 1QUPA 1NK5A 4M5NA 1BD6A 1RLDA 2MXYA 4WIQA 1Z1ZA 4DPYA 4P74A 4HACB 2HFVA 5DDRC 1QTMA 5CD4A 1JB0C 2CIMA 3HFKA 2VFSA 2KT2A 5EDWA 3GV5B 2O67A 1HYSA 4JI0F 3ZNUA 1QSLA 3QPIA 2FLPA 4PG5A 3PIOQ 3KFWX 4QPTA 1UA0A 3T3FA 1SH3A 3LTOA 3JQMA 4KAIA 5A6PA 2MQOA 1KN6A 2LQ5A 2Y8WA 5HATA 2VA2A 1NXIA 2Q6BA 1X0PA 1ZBTA 1VGYA 4Y2CA 1RZMA 3ZTPA 1E6VB 3ENVA 3OTDA 5K8OA 1PYSB 3QIPA 1GMVA 4NOHA 3G87A 4ICLB 3ILJA 2IDLA 5HMZA 2AIRB 3TNVA 2YWEA 2ALYB 1VCTA 4DS4A 2QA2A 5AT1B 4Y2MA 1DZ5A 1FDDA 2ZNZA 4UTGA 4NLSA 4P2FA 4BC7A 2X1AA 2B4UA 1SXLA 4S0MA 4NLOA 4N8OA 1NSPA 4A8XA 4F3QA 3OTEA 2XM3A 1HBMA 1FTCA 4CTAA 4ZVQB 1KHVA 4DV5J 3LP2A 2PI4A 2PA8D 4F67A 2RVJA 4AL5A 3OVAA 3R27A 1L3UA 4NMXA 4QWDA 1OSDA 4C8NA 1GXLA 4Y28C 2A2CA 3RRGA 1NKEA 1OQ3A 4JUZA 2CDRB 1S99A 4IRKA 5E0OA 1OS5A 1HLWA 4L76A 5CQGA 3IM9A 2PGCA 2BUNA 1XK8A 3CT9A 2HGLA 1TU0B 1VBZA 3Q24A 1YWXA 5A8KA 1WDTA 2B6AB 2KFYA 1F9HA 3J7Z5 4I4BA 3SSSA 2D9OA 4BHQA 3C66A 4DPOA 1ROFA 4NCBA 3SDEB 2J8SA 1XNRF 1VK8A 3D0HE 4J9OA 1FDBA 1LWXA 2H5JB 3PR4A 1VBKA 4CLTA 1FHTA 3MTJA 4EGLA 3H20A 4CYUB 5LSRA 3G9CA 3MM5B 2LDYA 2BQUA 1XMQJ 2D74B 5K14B 3VAKA 2B8QA 3MM6A 4QYZJ 2R8HA 3QYYA 2RKIA 1M1HA 1I51B 1ELOA 1TKTA 3JTPA 1AZSA 1DTQA 2LU2A 3HT0A 2D9PA 3MMCA 4C3KA 2D41A 2X1GA 2XC9A 2HHXA 4F36A 3BSNA 1TAQA 3KUGA 2FYXA 3OXLA 4OJHA 2QE5A 2H51B 1ZA2B 3JAMU 3MM7B 1S4EA 4ED8A 2V94A 2POKA 1T03B 2MJNA 4OZJA 3K58A 2I1RA 3CIMA 3DU5A 4ED2A 2YH1A 3EX7B 3CDUA 3LALA 3C6TA 5U47A 3DDIA 2MQNA 3CJQA 1ZTTA 4MK9A 1YIJS 2L08A 4DCPB 5DG8A 2XO7A 1CG2A 4IH7A 3K5PA 4USTA 1G3OA 2OPPB 3D6TB 3AXMA 4KTQA 2E5LJ 3IFEA 2DXFA 1F3VA 2DGTA 2K06A 3IBFB 2LEAA 5GAEI 2RRAA 1S4FA 1B7YB 2AP6A 2WVBA 5H9FK 1OSCA 2K1RA 3HSZA 1UZHA 1X8DA 2BKPA 1JLQB 5ETRA 3UR3C 3GCWP 3TO8A 4KHPJ 2WOMA 2CQDA 2RDJA 3TA1A 4PQUB 1PCAA 2ZH6A 3FQKA 1N34J 2EXUA 1EETA 2BOPA 2FTRA 3GYNA 5KOXA 1VDHA 3GONA 2NLWA 4UZBA 2ZVSA 2NSCA 4FF1A 2DY9A 3AOBA 1N36F 1UJ4A 3KJFB 5FD1A 4G3IA 3M8QB 3KLFB 2A0FB 2Z57B 1RADB 1HNVA 3CC7S 3K7RA 4MFBB 1ZZNA 1T02A 1VK3A 3RAXA 2VFRA 4I2PB 1FA0A 2R7QA 4PR6A 2MMYA 1CVJA 4USUA 2CVIA 3UI3A 8AT1B 3ENWA 2XMKA 3BKUA 3RU0A 3W1YC 4W90B 3QGIA 5LXYA 2GAHC 2J5AA 3W62A 1RP5A 1I6JA 3R5DA 5J1EB 4YR2A 3RB6A 3LP1B 1RACB 1RHMB 4QYRA 5KFKA 1QUVA 4FPRA 1TVRA 4B3RF 4FZVA 4DLEA 2W9CA 3CCJS 3RBXA 1U25A 4TLQA 5BR8J 4TU8A 2BX6A 4AL7A 1R8CA 2DPIA 5K8MA 1I1GA 2FZGB 4MK8A 1FD2A 4U7CA 1EQ0A 1UEUA 3AXKA 3N6NA 5T41A 4IG0A 3NS5A 3NL0A 2YKNB 4YR3A 3M8RA 3FSXA 4N8NA 4XTTA 3MOZA 1RHKB 2HNZB 4C11B 5BXIA 4J9KA 4QPXA 1K1SA 2Z4PA 4LF7F 2YNGB 5KT5A 4G1QA 4LVNP 5KG1A 4CNYA 3AOCA 3UD3P 2CWXA 1R3NA 4DV7F 3I5CA 3H7HB 1YVFA 2ILYA 1RT3A 1VQSA 4KV8A 5IOLA 2K3IA 5A0YB 3EDRB 1CQNA 1GQEA 3U27A 4M5DB 1RDRA 3BV8A 1V5IB 2DNKA 2IM1A 2ACMA 2PA3A 2FZCB 4CM0A 1HW9A 3MUTP 4A8QA 2D3UA 4UOHA 3M2VA 4KGKA 2CQ0A 1Q8BA 3W9JA 1FDAA 1E6YB 3DLKA 2Q3PA 4L74A 2QJ3A 1HQ2A 1NU4A 3TZYA 4HT7A 2FY1A 2DNNA 3N01A 4EEYA 5FJ4A 1U6FA 3GV8B 2KM8B 5EWEA 3G8SA 3KJVB 4KE5A 2DGQA 1XMOF 3DLHA 4F3OA 3FGVA 2RDIA 3M32A 2R7WA 3QT7A 1VFJA 3R97A 1URNA 1SC3B 4MYTA 2AKWB 3PJWA 3SQOP 2LYVA 4I56A 3CF5Q 4WFXA 2CPDA 4NLPA 3ULHA 3SEOA 3NOCA 1NM2A 3R2CJ 5F0WA 2M2BA 2OFHX 3HZGA 2LQ9A 3FQLA 1KKHA 1WELA 2LECA 2DVIA 2LFVA 3UE2A 2RAQA 1JLCB 4EFAC 1M5OC 4C3LA 4GMKA 1P27B 3OJUA 1LWCB 1KQKA 4OX9F 1SJ1A 2R7XA 4XDCA 4ZVUB 5D15A 3CMAS 1H3DA 1EKSA 4KQZA 2GJ2A 1QVGR 4OYMA 4KPCA 3MHYA 5AXNA 1QAYA 3V81B 5DDQC 1TL1A 1PIEA 2OSRA 3AODA 2CPXA 4A47A 4OJ1A 2D1CA 3VTIA 2BOAA 4DQRA 3H5UA 2V2ZA 4B9SA 4JI5F 4QWEA 4BDPA 2CQIA 1XN9A 1WNEA 4KJIA 4H4OB 2IA0A 1OY9A 1FFGB 1T9XA 3LWLA 1TUWA 1DJ0A 4PYAA 2C42A 2OJ3A 1IKYB 2MQPA 1F5BA 1LWFB 3DC2A 3CB4A 5EHHA 5F3ZA 4EO8A 1BLUA 2MLYA 4F8RA 4LF6J 2ALZA 5KG5A 2P5VA 1KTVA 3NP5A 5G0RA 2HG4A 2CQ2A 1R7IA 1UVJA 4ZVOB 2XS5A 4B3SF 3MM8A 2HMIA 3ZZ0A 4DR5J 3FMBA 5GMEA 1WI8A 5LMNF 4WJBA 1VJWA 4LF5F 1T11A 2CRLA 3MMAA 1ZM3A 2HKEA 1IBKF 1Y10A 2M8HA 4YFUA 1YKWA 4M5MA 4ZPTR 1EAYC 1Y7PA 2DISA 2KTQA 1F0XA 1X7VA 2IYGA 4Q45A 2FY8A 2UU9F 2V8DA 1X4AA 2ZUGA 2ZWOA 4ZJOA 3R5CA 4BBYA 2OO4A 3WC0A 4ELUA 4WTYA 3U1MA 1QSYA 4LFAJ 5CZVA 2DH9A 3A3NB 1Q8IA 3Q8SB 2FUG9 3O5TB 3KMSA 4FYYB 2HLUA 1ZPWX 3NOGA 3TVZA 4OYXA 4U9RA 1KR4A 1ZAXA 3FSYA 4RW8A 1M5KC 4WZMA 3LO3A 1VQMS 2FGOA 3I31A 2D7SA 3NGSA 4CH7A 2RMLA 2MKCA 2CQBA 3CIZA 1KVIA 1N32J 3QGGA 3ZZZA 1DTTB 2ZBCA 5JUMA 2U1AA 1Q5YA 5D3GA 1RAGB 1RWNB 1S1XA 3AD8C 4W4MA 1S6PA 1NBEB 2KT3A 5JJBA 4DV4J 4J37A 4DPWA 5HLFA 2K7JA 3ZXWA 2QGFB 3CDAA 3NG8A 1R8PA 1T05A 3D7SB 1Z2ZA 2HZVA 4IR1A 5JVGQ 1F6TA 3N6MA 3A8JA 4X2BA 2DPJA 1U0SA 3JB9k 2Q6CA 4A8KA 4ZPWR 3GFXA 4RBUA 2WB4A 2ZUAA 3O44A 5KFMA 4GO7X 4IKAA 2ASLA 2J9EA 2UXDF 1UFKA 3I32A 3UN3A 1QSSA 2YNFB 2MY8A 5DG9A 5D4OA 4U7UK 4F2RA 2N4DA 2ATCB 4M1KA 3NLCA 1QM9A 1W26A 2FHOB 3GZ7A 1VIOA 2HFSA 4UOFA 3O3LA 2FPHX 3KHHA 4CRJA 3G6XA 3TAPA 3PRBA 3MCSA 5ETOA 3JTOA 3KLHB 1IKXA 5HSPA 4ZLPA 4DQIA 1NMEB 2XLJA 1KBRA 2QMUB 1SV5A 2LXUA 2CG4A 3NGDA 1CC8A 4QR1A 3FCVA 3CD0A 1LW2A 4DV1F 2NCKL 2E1RA 1FCAA 2M88A 1JJ2R 1FJ7A 1PKUA 4TY8B 2E5GA 2V6AA 4GVBB 1J5EJ 1RT5A 3HZEA 5HL7Q 3CULA 2ROGA 3FKBA 2Y0BB 1HBUA 3F44A 4ECYA 1WI6A 3IS9B 3LOUA 3NWRA 5F8LA 2H5IB 2ERRA 2VZ9A 1N8RT 1TL7B 3PX6A 3PM9A 2MJUA 4J9SA 4RW6A 4WP3A 2QSWA 4H4MA 3CDWA 2JLEA 3PW5A 2ROPA 3K17A 2PMZD 1X4DA 2DD8S 2RH3A 2W24A 4FN5A 2X3GA 2IJNA 4RW9B 2V5HG 1CLFA 2R2TA 4EWTA 3ADAC 2K7KA 5K20B 4TYAA 3LGNA 5F8HA 4EBCA 2WCXA 1GX6A 4WFYA 1MMNA 1R27B 1XBWA 2V34A 3A8EA 3DOLA 5GADU 3T1HF 3QRRA 2GQCA 5DLFA 3EZ5A 2L41A 2I5JA 2R42A 3F73A 5J1PA 1WEZA 3SFGA 2OIHA 1JLAB 1H2UX 4EO6A 1KVKA 3CCUS 5A8WB 4M5KA 1VQ6S 4ZIVA 3QQCD 3PX4A 2KZZA 2VG7B 4C4WA 2XNRA 1MWQA 3IM8A 2JZ5A 1LKZA 2YNHB 1GEHA 2B5JB 3LQVA 2VL1A 1N33F 3DLGA 3R1HA 1R8AA 4PAAA 2GVDB 3MR3A 3OFEA 1Q7LB 1QE1A 4YB7A 1JLFA 2L9NA 4NXNJ 2DGUA 1NKCA 3TUPA 1F2HA 3NAHA 1D8ZA 2DNYA 1NHKL 1UWBB 5E41A 2HSEB 4CLSA 3BF4A 2JEFA 4AUKA 4B3OA 2PIIA 1R0AA 5DDOC 3IAS9 2F5GA 2GIFA 2OELA 2RRBA 4DV5F 2C2NA 5I42A 4ZCKA 1KQFB 4LSNB 4N56A 1QY7A 4YB1P 3TAQA 2W2NP 4RW4B 1HWUA 3DYAA 1EKRA 3LGHA 4LFBF 5EWFA 5KT2A 1AFIA 1N4LA 4WBFA 1XIQA 1JKHB 3D6HB 2QT7A 4YEAA 1Q5VA 3DLBA 5KG7A 1TV6A 4ZVTB 4O44B 1NDPA 2GVZB 4ZPBA 3MPUB 5GAGI 2B9EA 1RWOB 1PJ5A 1DQ9A 1TUGB 1VMBA 1NKBA 4CM2A 2FLOA 1FX4A 1SQFA 3QFWA 1G1XA 1Y0HA 1WSVA 2ACYA 1RT6B 4Q0BA 1TKXB 1NJYA 4KFBA 4DPUA 5T14A 4UW2A 1HWLA 4F4YA 2WAQD 1JNRB 2R2UA 4RNMA 5HP1A 3L7PA 2HRTA 3DGPB 4P10A 5IXUA 4NLYA 3QZ8A 3OL8A 2EFNA 5GMDA 2RQCA 4DPTA 3D1OA 5GVQA 2VPZB 2JRSA 4ZVRB 4L73A 5KOWA 3R8YA 8RUCA 4J9PA 2N4CA 5J2QB 1S1VA 1HHSA 3FRYA 4OZ0A 3UVJA 2HHWA 2UUBJ 1S9GB 2B4PA 2OEKA 1YLXA 3G2XA 1U1PA 1VBXA 2KVIA 2IPOB 3M30B 1VLOA 2RE1A 4HHHA 4K4YA 1NDKA 1RHRB 3W5XA 1RHJB 1RISA 1YZ7A 4R0EA 1WSRA 4CO2A 1PJ7A 3QFHA 5IC6B 2RUGA 4DL5A 3D28A 2BMBA 1HARA 1B0VA 3IR7B 1HD1A 1U1QA 2B56A 3PFEA 1BWEA 2GHPA 5KG2A 2QLXA 2LP4A 2BKNA 3T19A 3I55S 4DSEA 3OVBA 1DARA 3I5BA 4U67Q 4YQWA 2W7AA 2Y3YA 4IH6A 3PRVA 2ZNYA 4WYWA 3MR7A 4KBIA 1V9OA 2VQFJ 3QGPA 5I3PA 4MYUA 4ECRA 5KFWA 3GR1A 1X4CA 3NGTA 4I7FA 3SFUA 3HCXA 2BE7D 3R1LA 1X9MA 5ETPA 3H90A 1T95A 4W98A 5GAHU 1S0MA 3VZHA 3PZPA 4A8SA 3IXQA 4CLZA 2GO8A 2XLKA 3R6GB 2CJKA 4LRBA 2HQCA 1LFWA 4ZHRA 3EWGA 4CLFA 2V50A 1NSKL 1M5PC 2R8JA 3HFZB 4YHHF 4PWUA 4DR4F 3RAQA 2UUAJ 5KT4A 3NY0A 5KFZA 3J7YU 3QLHB 4KHPF 4IQXA 2X3DA 5B0BA 3ISNC 1WDDA 2R8KA 3B4DA 3KLVA 1NAQA 1ZM2A 2XZTB 1FERA 1T9TA 1RSCA 5F41A 2VQEF 4R5PB 4WE1B 2IYIA 3H0PA 5B0GA 1IR1A 3IBCB 4CO5A 2P2CB 5LJ3Y 3IWLA 1Y11A 1Q81T 2IY5B 2CG8A 4TN2A 5CXTA 2CPEA 3O1LA 3JYTA 3AJ2A 3N5BA 3CCQS 1JX4A 3IRXA 4ZIWA 1PYOB 1KLNA 5F3TA 5J1NA 2HQGA 2ZH9A 2DK2A 4PXDA 3DLJA 5L1IA 1UKUA 1D9FA 1MG7A 2UUTA 2ZJQQ 1U45A 5DM7Q 4FNHA 5K8NA 4LT6A 1N56A 2G13A 3S1TA 3R7NB 4X66J 4WP9A 3D68A 3RBEA 1FFSB 2NXUA 4I2QA 5D0GA 3BDEA 2O5DA 3K8WA 2HWTA 2CQ1A 2WTFA 3H5SA 5HAOA 2DBBA 3DRSB 2FJDB 4KYZA 1PG5B 4B9NA 3OD2A 3D3BJ 2ZH8A 2H4WB 4CH0S 4DQQA 3EICA 2XYGB 3B6BA 2NXNA 5KFCA 3L9ZA 4DL0C 1SL0A 5L8RC 3VALA 1RTZA 1LNQA 4NA1A 1CJTA 2MZJA 3W64A 3NEKA 3GSDA 1FKOA 2D3O1 3OSPA 3OR2A 4K50A 2ZBPA 5HI7A 3B78A 5I4MA 1JIHA 1N5YA 1WOSA 4GKKF 2YKMA 3HULA 3PW7A 1BE4A 1M5SA 4A8FA 5FIIA 2Y1LB 1S1TA 1HBNA 4X84A 5DS7A 1YX2A 3AB4B 4DR1F 1RWVB 2BR0A 5CCMA 4R8UB 3W7BA 3P5TL 5CA5A 2WOMB 2HHUA 4Y3CA 1UL3A 1WACA 1X60A 5G4DA 2XI3A 3DU6A 2HBQB 4K4ZA 1RTDA 2J6UA 1SB6A 2MLZA 1IQZA 3FCWA 1KRPA 3D6MB 4ELTA 2J6TA 3QJPA 4WK1A 3GPAA 1HNIB 4ZVPB 3PACA 1CEZA 1BC6A 3BQ2A 2ZBIA 4CNZA 1H7WA 2PSZA 1RU1A 1RAJA 1IBLF 2DYAA 3Q8YA 4N41A 2NUUG 1Q78A 5E3PA 4E0DA 1R43A 2AGOA 1K47A 3M05A 2DNOA 4QWCA 1REVB 1GNKA 4OI1A 2LLZA 4TY9A 4K0KJ 2J7UA 2EVZA 2ROEA 3LPEA 5CYQA 4YOEA 3IN5A 2V69A 2WVDA 2F4VF 4I1TA 4TLRA 1Y00A 4ER8A 4P2SA 1OY8A 2F4FA 4DL7A 1GXUA 3N9UC 2AW0A 2FJXA 4F0KA 1IJFB 1RCOB 5GMKa 3OL9A 2NXCA 4OHYA 3PW4A 1HNWJ 2DGWA 3GFYA 5DQHA 2XI2A 1H72C 3MMBB 2GQ2A 2G1DA 1K8AT 3G71S 4Z37A 3KDNA 1GXTA 4DUZJ 3O8WA 2Z8QA 4Z2XA 3A3OB 4B17A 1DRZA 1D1UA 4G1QB 2QLBB 4OQJA 1QLNA 1CJUA 2NUHA 1UP1A 4WXOA 4NLUA 2V9WA 4DG1A 1RT4B 2CNKB 3AB2B 1JXLA 4OYAA 1HNXJ 4YS2A 1IR0A 2N82B 2KM8C 1MN9A 1DY3A 4CT8A 4TNOA 1YTYA 2C1EB 3I87A 3QT5A 5L9XA 3PXGa 4LF8F 2Z2YB 1RI7A 2HBYB 4DHVA 3HXMA 3MAQA 2P9GA 2QL7B 2MZ1A 2RU9A 1Y5LB 1DQ8A 2EFQA 5HN0A 4F4ZA 2JDJA 3GU0A 3K59A 3SIPB 2Q43A 1G6BA 1WF2A 1DLOA 5ETMA 4L3NA 4MTPA 1ZPVA 4OV1A 3UDEA 5B08A 2DITA 2R9LA 4HDGA 5SZTA 2JC1A 4DV0J 2CJQA 2J76E 2DNHA 1EP4A 4JI2J 3MCMA 3EE3A 5KT7A 2MEWA 5DLGA 1H2TZ 1YZ6A 2BABA 2AYBA 3BGFA 3T6BA 3J7AN 1RTJA 4JI6J 1YJWS 4HTIA 4DS5A 1NJIT 3S8SA 4DI6A 3A13A 3TUIC 2FZKB 2IM3A 1FVSA 3KK2A 1T3OA 1I94F 4F4KA 1T9UA 1X4GA 1JXVA 3VAMA 1QDUB 3UDVA 2XY6A 3PG9A 3KLIB 1N32F 1SBRA 2I2YA 2ZZMA 2ZKTA 1RT1B 2VBYA 1BQMB 1IVZA 2IJRA 4CDIA 4NLRA 5ETQA 1Q4RA 2XS2A 2UZAA 1SL1A 1U2RA 3MR5A 2XG8A 1BMQB 2CZ4A 4DR6J 1LEOA 3PHEA 1C4AA 1VISA 3HVRA 5DO2A 2BACA 4F26A 2V4JA 4URGA 2YBVA 1NRKA 4TQSA 4K4XA 1AFJA 3DM2B 3M2UB 2EWHA 3Q86A 2E1MC 3GYXB 4G1IA 4X64J 1YBUA 2E5JA 5KG6A 1MSWD 3OTBA 5THWA 4P71A 5G0RB 3D4JA 4NLQA 2VF3A 3MURP 1U2CA 1BQXA 2MZQA 3MEEB 4DMZA 1S79A 2C2EA 4LQ9A 4NLTA 2ZM6J 4JI3J 4AD6A 2JHEA 2DHAA 1FNMA 2RB7A 1HIYA 2XWXA 3OXFA 2K3KA 4UQTA 4ANCA 1RT7A 1M5VC 1RT2A 2XSJA 3UD4P 4HHJA 2UUCJ 4P75A 4QIVA 2BM1A 2RHQB 4FDFA 2IBKA 2YNIA 2JH3A 3SZ2A 4J9LA 2VB6A 3JXOA 1NH8A 2UVVA 4NEYA 4B3TF 3U1NA 2HFNA 1KQSR 1YDLA 5KTQA 4ALZA 5EWGA 4ZITA 3HJFA 4PWWA 2V4QA 2QYGA 1VI7A 2VODA 2AEMA 5KFPA 4QWAA 3SSRA 4LREA 3C15A 1KVJA 1GMUA 4X4VA 1S1XB 4QW9A 1I5OB 2OUGA 1Q8LA 4IOBA 3FZ2A 4KY3A 4JI7F 2AJ1A 4WK3A 2WONB 3MPWA 1KNZA 1SC4B 4C9DA 1CS4B 2I6WA 5KFOA 1QAIA 2NR0A 3F0NA 4NI2A 3ZTRA 1O8BA 4MKAA 2QN6B 1S49A 2RJZA 1X4FA 1S9EA 3G6VA 4ZP9A 3B54A 1S6OA 4KGZB 1C0TA 3CJ0A 1TFYA 3OLAA 4QW8A 2KH9A 5DQIA 4OX8A 2ZH7A 3EPIA 2RU3A 3DKDA 4M5HA 1N0UA 1PAUB 5J2MB 2JEGA 3AT1B 5LMUJ 4UY8T 1HR0J 5E3CA 2NSBA 2V2KA 4R25A 4HDHA 2PI5A 2FC8A 5I3UA 4PUOA 1CULA 1FJGJ 2HNYB 2P9EA 1VBYA 2N3OA 3TQEA 3POTA 5FDLA 4DV3J 1WC1A 3PHTA 3C14B 3RBDA 4DQSA 2MQMA 4Q7AA 3OFHA 1C1BA 4RNNA 4WFBQ 1WTBA 4USKA 2RF2A 4F4WA 2FJAB 3EGVA 4J9VA 2XMVA 4H4KA 4NLXA 2YKAA 1IKXB 2IAJB 3NCRA 5DJBA 5C24B 2A6OA 4NLVA 2UXBF 1WC0A 5H9EJ 3PY8A 3TR5A 3BGRB 3P45B 3R5JB 4JI1J 4DWIA 1J5OA 1NPRA 3JSMB 4X65F 2NXEA 2RT3A 1KQGB 1U49A 1HNZJ 2LMIA 2M4MA 3UNYA 1U1OA 4YUDA 2HEKA 2YWKA 2M52A 1FRHA 1HMVB 5CABA 1D9AA 4IDKB 1XEZA 4TYBA 1S6QB 1N5QA 5E3AA 2J9DA 4X4OA 4JI8F 2E9RX 2ZZNA 3DLEA 1FK9B 3KG4A 3DOKB 3VVTA 2MHNA 2IVFB 3SCKE 3M2RA 2DH7A 4I69A 1AT1B 4USHA 2WRMA 4NXMJ 4Q44A 4H4MB 3P8BB 2VA3A 4C98A 1KP6A 2QIFA 3UDCA 5L1KA 5M2UA 4LF4J 2XNQA 1RTHA 5LJ5Y 4ZVSB 3E51A 4LQ3A 2ZJPQ 2VKZG 4I6WA 5KFFA 2XQCA 5D77A 1UPMB 4ED1A 4FVCA 1S1WA 2GC8A 3KKFA 4B9UA 1IQTA 4YY3J 4IOCQ 1OYDA 2KG0A 1KEKA 2J9DE 3GIJA 5HO4A 2K2PA 3ZTSA 2XLIA 2WW4A 3ISND 2OPRB 1HBOA 1JQGA 3M8PA 1R6VA 1SIWB 1RYSA 1VRUB 1U8WA 3DHXA 2MQLA 3H4DA 4KT0C 3SCIE 4UUXA 1O6XA 1VHFA 2B7CB 2W9AA 1TFWA 3CJ2A 4A8OA 4HACA 2KT5A 4HEA9 4DR2J 2KN4A 3EMTA 3TJ9A 4W92B 3EZOA 4USJC 2LEBA 3KMQA 1CBKA 5HQMA 3TUJC 1FRIA 3OTOF 2ZFHA 2Z2ZA 3CDEA 1V3ZA 2V0NA 3D3CJ 4ZJQA 1HFEL 3NS6A 3J7A1 1FRKA 1TMMA 1JLFB 1X5PA 2BJ9A 1RHQB 4P73A 1Y3JA 3H2LA 3HX9A 4DN0A 1E6VA 2F40A 4QR0A 4ICLA 3OL7A 2DIUA 3FC9A 1I3OB 5M2PA 5KFQA 3QAEA 5EUHA 3W5YA 5AJ3F 4NCAA 2G0IA 4U7UD 4B3OB 4YN3B 2G2OA 5E5NA 4ILLA 1VR6A 3W2WB 4C8MA 3UCGA 4A48A 1R89A 3HSGA 5CCLA 1MN7A 3J81j 4WFNQ 3KK1B 4FXDA 4OHVA 3T1AA 2B4OA 4K4SA 2AD9A 1RWXB 2GZOA 3M9OB 1S12A 7FD1A 1IM6A 2QL9B 3PEHA 3HHEA 1ZAWA 3Q22A 2V2QA 4F04B 3CJ5A 2BRKA 2GCFA 5HVGA 5B0EA 3MI7X 1G4CA 4WF9Q 2VG6B 4M94A 2H5EA 2J7WA 1FXRA 3NGUA 1HWJA 3HD2A 3TZXA 1MW7A 1AA1B 4DUYJ 3UNGC 4WXWA 4NASA 2OEMA 2HNDA 2EEYA 2NYHA 1OPIA 2HQFA 3TARA 4DCJB 4WIIA 1MU2B 2E5HA 4DX6A 3QT8A 2DNZA 1XR7A 2CPZA 4OI2A 1K73T 3QSIA 3HO1A 5C42B 3ILOA 4PWDB 4ECUA 3M9NB 3DI6A 4ZJLA 3C2PA 3M6XA 1NK9A 1B64A 4KRWA 3HSDA 2F8HA 3D67A 1U0HB 3TOQA 1VQ8S 1G7CB 3NXZA 2WW8A 3T6JA 2B6AA 4JI0J 4LF1A 2UV8G 3CPWR 1NSQA 2A3JA 3QWPA 1P1TA 2W2PP 4I0WA 4LJMA 2HVHA 4TXSA 3SDEA 5IC4B 2QX0A 5CHCB 2MGZA 1H0HB 4RKUC 1N88A 1K0TA 3G82B 1AUDA 2DNLA 4CYUA 4ZP8A 3MM5A 1U1NA 5K14A 1MROB 4EZ6A 2DGVA 2YQ1A 3AAWB 2B43A 3CMES 3T5KA 1EARA 4UQGA 1GT8A 1L3TA 4DLGA 2R2RA 2XCAA 1RHUB 4XPEA 2D3ZA 4F4XA 2MDAA 4AT1B 4Q2MA 1BWVA 5H9FJ 1HHQA 4ZCLA 3ZC4A 3BGOP 3AD7C 1L3KA 2AZ1A 4F02A 4OFZA 2M5YA 1U1LA 3ZTQA 1K0VA 4ANEA 5ETKA 2GHVC 5AXKA 3MM7A 3NKYA 4DSJA 1SKSA 2FJWA 2C2OB 1T03A 1KONA 2EBEA 2E66A 1DURA 2BV3A 4CP5A 4I7FB 1HQEB 3ZFVA 2LXIA 4O3PA 4FP9A 4NE9C 2W9BB 2PEBA 4DF4A 3GIRA 2JJ4D 4P2MA 1OO0B 1RBOB 2KYZA 3BEGB 1VC0A 4OZ3A 3BREA 1H98A 2RDDA 4ZHRB 2YVSA 4M8LA 4NEZA 5SUHA 3A8IA 2GMHA 3NMAA 3GYGA 5C2GA 4GVLA 2H54B 2OPPA 4L72B 2ATLA 3RYLA 2B7BB 4ILMA 4KO0B 3QATA 3IC1A 1NPKA 3C19A 3JS9A 2GFFA 3OBIA 4IO1A 2ZE2B 2MLXA 2AYGA 1IM4A 3PX0A 4RO0A 4JI4F 4LVOP 5HBMB 1W25A 4NZ7A 3EPGA 2QC3A 1JLQA 1GH8A 3MPDA 2ZBRA 3J80Y 3MCOA 5C25B 1AROP 4I6YA 2CPJA 4PQUA 3CC2S 1UEKA 2B51A 2BE2B 3EZUA 1OJ4A 1XNRJ 2J6SA 1NPPA 3AHPA 1HKAA 4A8WA 2W01A 1HHTP 1T3NA 4G1PA 1N6QA 3OW2R 3MTKA 3M8QA 3KLFA 2C3MA 4MFBA 1TKDA 3QWUA 3NBPB 2D69A 4UF4A 4I2PA 5GADI 4FS2A 4OX6A 3W2VB 2ZWPA 4U6PA 3RAMA 4OYBA 1TUVA 4MKVA 5KFIA 1GX5A 1SKWA 3RB0A 3ZZYA 1SC6A 2NREA 2IJFA 5LM7E 5J1EA 2DB1A 2HAFA 1AW0A 4ECWA 2ZHOA 2KG1A 3LP1A 4ID8A 3MFIA 2CNOB 1YJTA 1HD0A 2DR5A 1NJXA 3W5ZA 3V6HA 4GRSA 1O5JA 2NYIA 4GKJF 1KC8T 2JFDA 2VD3A 2DRDA 4FKYA 1V5VA 3FEZA 2YWFA 2CQCA 3BSAA 3C6UB 2CQ3A 4B9TA 4KC5A 3GJRB 1JMTA 1XTZA 2LCWA 3M8ZA 3GB0A 3GJQB 4OI3A 4DR7F 3J7ZT 3M4XA 4HL9A 3DRYA 1S1TB 1S0OA 5DM6Q 4NRUA 1N5TA 1U4BA 2XMUA 3FK4A 3TAMB 4TU9A 4NZ6A 4M5LA 2YKNA 2DHSA 3TEGA 3HVTB 1UETA 1JWWA 1C0UB 3C16B 4C11A 2QLWA 5KT6A 1BGXT 3Q89A 5T7LB 1WJ9A 3ET6B 3VGSA 3VR1A 3SCLE 4ANDA 4N76A 1CJKB 3V4MA 4PEOA 4YDDB 3T1YF 1UCNA 3DOMB 2CPYA 3LP0B 1JJHA 2V67A 2OPQB 2B3TB 3AY0A 3NGKA 3OFFA 2J0XA 4U96A 2HS3A 3J81Y 1VQ9S 4Y00A 4M5DA 2XHWA 4ZS6A 1EHWA 4PG8A 3DRXA 4RR5A 1XNQF 3BM7A 4CT9A 3PNIA 3HPOA 1SH0A 4RW7B 3UN2A 1T9WA 3I4HX 1E6YA 2GX8A 1UVMA 4X4RA 4L75A 4PG6A 4JI2F 3IA0A 1RA6A 1N36J 5CYQB 3GIIA 4BCAA 1XJWB 3RRKA 1UEVA 4HR2A 3FVYA 2J9CA 5JVHQ 3G6YA 2DCLA 2VFUA 3KJVA 1TR0A 3KLEB 2DT9A 1HI8A 4WFZA 2KXHA 4RX6A 2C2ZB 2HHHF 4LRAA 3VF0B 3CCLS 1AB8A 4PQAA 5D0EA 4ECQA 2KXFA 1IBMJ 3Q8VA 3X3UA 5IWAF 4R0JA 1FWPA 2I9SA 1BXNA 3RJMB 1UJ6A 4B3RJ 2IRUA 2PD1A 3WC2A 1IXKA 2PO4A 5J2PB 2VU5A 3TA2A 4FYDA 3K8VA 3C3LA 3LH2S 1JLCA 3L7UA 4PPDA 1TKZB 3AFGA 4JBCA 1LWCA 4V1Ak 3MCNA 5HQLA 1Q82T 3V6DB 2BZ2A 1VQLS 4ZLLA 3EM1A 4PXBA 2RQMA 2AT1B 4K4TA 2DHGA 3J80U 4OHXA 4QWBA 4FYWB 5IT4A 3V81A 3I0RA 3QO9A 3EGWB 4K8RA 4FYVB 5EX3A 2WK4A 4B3MF 4PXEA 4LF7J 1MMDA 2LU1A 3I56S 1UMJA 3HVAA 5RUBA 3MECB 4CZCA 1CJVB 3G8TA 3RRHA 4LSLB 4DV7J 3EXCX 2D3OR 3BN7A 1HI1A 4DV6F 3MPVA 4OYWA 4H4OA 3ZNJ1 1PGZA 2EPIA 3MZIA 4CI0B 3HHLB 2CXEA 4DL3A 4C48A 1RUSA 5B0DA 2OD6A 2HHTA 2AHOB 2GA7A 3KK3B 1IKYA 5E7OB 1LWFA 1HA1A 3Q2TC 1S5ZA 5HROA 1S57A 3ICLA 2WSCC 5GAHI 3KLGB 2V9KA 2IMWP 4O3SA 1HI0P 2DGOA 3IGVA 3SQGB 2ZVIA 1RB0A 3MR6A 2U2FA 3TA0A 3TWZA 3HHDA 3RW6A 1KD1T 1KOHA 4NCGB 4FVMA 2Z2MA 2LA6A 2BKOA 3LWMA 2DR7A 1IWGA 4E2FB 2QTWA 2CVEA 3J7YI 5A2QY 3MM9B 5LXRA 3DMJB 3BKTA 3ZTOA 3HT3A 3BO2A 2AJ0A 4CO4A 2VFTA 2CFXA 4DFMA 3CJKB 4KGXB 3MEDB 1WKKA 4WU2A 2C2MB 3WBZA 1IJEB 4OX9J 1FWKA 2MQQA 3FBCA 2ZBQA 2QZ8A 3H2UB 3J81U 3CUNA 4DZDA 1S0NA 2EW9A 3CVKA 1DTTA 2FD2A 2BRLA 3KXDA 4J9RA 5LMUF 3R3TA 3VAFA 6FD1A 2ZH2A 2APOA 5HJXA 2E9TA 4LFCF 4FF3A 1RWWB 1RAHB 1U1MA 4LRFA 5ITHA 4JI5J 4LF9J 3MD3A 3NWGA 4KHRA 2IVYA 3PV8A 3RG6A 2I38A 2OPSB 2Z0GA 3BYPA 4KH0B 4USVA 2QEXS 2FQQB 2CYYA 1PBAA 1LWEB 3FFIB 3B82A 2YNFA 2XMAA 4Y2AA 1FF2A 3TZZA 1YBAA 3EYZA 4ZDNA 4ZP7A 3K5LA 4JI1F 3IMQJ 4ZVFA 2Y0SD 4B3SJ 2ZD1B 3JQKA 5K5MA 3WQPA 2C22A 1B4SA 5HVHA 5LMNJ 4K4WA 1VQ4S 1IKWB 1KHWA 4LF5J 1WHYA 3W63A 2MQ8A 3SYZA 3KLHA 2NZ4A 3D1QA 1IBKJ 2B9XA 4B9VA 4DSIA 4I64A 1VQPS 1HQUB 4XO0A 4FXWA 2W1BA 2OMLA 2UU9J 4ZP6A 3FBEA 2FLNA 2B4VA 4DV2F 2RUSA 3T41A 1FRXA 4YMEA 1R8BA 2IC3B 3Q23A 4OHZA 3C15B 4J9QA 2CWKA 4TY8A 3KHLA 3DN9A 4ECSA 3G6ES 3DRRA 2BDPA 2R7OA 3THTA 1LW0A 3R2DJ 4GVBA 4EUVA 2P6SA 3W8GA 3TJ8A 2N7CA 4ECVA 3IS9A 2AGPA 5D0RA 4OI6A 2UXCF 4I67A 1VQYA 4DR3J 1TL7A 5C7PA 4YY3F 1HPZB 2EKYA 1O51A 3KUEA 1NZ8A 1X5TA 3TW0A 3NRBA 1D09B 3PW0A 2B8PA 1VRQC 2XHCA 1VRTB 2EBGA 1PSDA 4RW9A 2AYMA 1C1CB 5KFGA 4ENOA 3L4BC 3D1HA 1ZZFA 1SJQA 2LEPA 3Q8PB 4ECXA 3I6PA 4DR2F 4RJVA 1RWUA 3W9IA 2PMHA 1RTIB 1JLGA 2E1AA 3U7JA 1KWMA 2EC0A 2XB2D 2UXDJ 2R7TA 4ID5B 1XR6A 1NLKL 3QT6A 4DSKA 2VOPA 2HRYA 5A2QU 1JLAA 5A8WA 2H3EB 3OJSA 2CAJA 2F1FA 2DIVA 3CCTA 2VG7A 2XYHB 4Q2LA 2V4RA 2QO3A 4B9LA 4UUWA 1Y3KA 4RNFA 2G9OA 3GILA 2FHJD 2YNHA 3E8OA 1MWYA 2B5JA 4IUFA 2HWIA 1RLCL 5AXMA 5IV3A 1Q0NA 2VICA 1DHMA 1GTEA 4FF2A 4M5JA 4JV5F 2GVDA 2MZTA 2AYEA 5IM0A 2GGPB 3S6EA 5DZ7A 4C8ZA 4QQBA 2C2DA 2GHWA 4ZCMA 3EVWA 2IRXA 4DV1J 2OGUA 1M0SA 5LT5A 3OUYB 4QIFA 1UWBA 3AD9C 4HI1A 1T0TV 1U48A 8ATCB 2HQIA 2EK1A 4IRDA 4KR0B 3RB4A 4J9NA 3LA0A 3DNCA 5KAKA 1IUJA 5IS2A 4X4NA 1JLEB 2X51A 4LSNA 2M8DB 1L3SA 3PJ9A 2GJFA 4RW4A 3QSYB 3M1VB 1JLBA 2B9YA 2BM0A 4KGMA 3TI0A 3ZZRA 1UFLA 2AV5A 4U8YA 1TK0A 3I9V9 1JKHA 1YJ7A 4DFPA 1LQ9A 3IG1B 2E5IA 3PVXA 4WKRA 2CJ9A 1P9YA 3K57A 2VONA 4O44A 4USMA 1SL2A 4C6AA 4KH1B 5D78A 1YRUA 1R31A 1FVQA 3RR7A 4AQYF 3TVKA 4YP3A 2AX1A 4E98A 2NPIA 1OYEA 4P7VA 5L38A 1WWHA 2VJUA 2W4PA 4X62F 4OYPA 2R7RA 2HVIA 2Y8YA 3UW1A 3T1HJ 2JVRA 1RT6A 3V4IB 3M8YA 1TKXA 2HZAA 5E33A 5CYMB 4ATNA 1FJCA 4ETXA 2G1HA 3I0SB 3DGPA 1TL3B 1QD1A 2IM0A 2AJ2A 2JL9A 2VPXB 1FDNA 3U02A 5L1LA 1D0EA 1N33J 4K2JA 5J2QA 1BQNB 3RR8A 2VG5B 5LOQA 1EIYB 4BLGA 2HIYA 1S9GA 3IWNC 5A8RB 3CJSA 3M30A 3H2VE 3UCZP 1KLMA 4IQMA 2BXJA 3B8HA 4RUHA 2QFJA 2W4CA 3TP2A 1BUXA 1CQMA 1TELA 2RHSB 3MPYA 1IKVB 1VOMA 5KFRA 4PCQA 3JSYA 1UJ5A 1KFDA 1N48A 3VZIA 2ASJA 1SJ3P 5LSLA 3HM9A 3VWSA 3T9NA 5KG4A 2BANB 2CJAA 3GG1A 3VQSA 2H65B 2JOQA 2HNDB 3ITHA 3UO0A 2R8GA 3HDSA 1WC5A 4LFBJ 4F7VA 2FHJA 3NNCA 2ADBA 4IG3A 1V3SA 4UT4A 3PKYA 4Q8FA 2XMWA 4EMDA 4RWWA 3TRGA 3OR1B 4KPYA 2ASYA 3HJVA 1TK5A 2VBZA 3A1YG 3NAIA 2M9KA 3MAAB 3DI6B 4DX5A 2F65A 4AXIA 2I8EA 3E01A 5LSOA 3QBCA 4X4PA 1P1LA 5KG3A 1RJJA 3M6WA 1WTFA 3BSOA 4ZKAA 9ATCB 3TQ1A 3CNQP 4DX8H 3QRQA 3D6FB 1T7PA 1N0VC 1OPZA 3Q2SC 1ZOTA 4Y0FA 4XPCA 4FXVA 2Q79A 1S77D 7FDRA 4DSLA 5KFSA 4RLEA 3QLHA 1TL4A 2VIHA 5FLXY 2AEJA 1B0TA 4CO1A 1YRTA 4ZLJA 2HQDA 3PEJA 1U09A 4X4UA 3VV2B 2OEJA 3BDPA 4MKBA 2BW2A 2MGZB 2M7SA 1WEYA 2KU7A 4R5PA 3N4WA 4WE1A 5L46A 1M5HA 4IFVA 4EI2A 1YBTA 4OHWA 1N54B 3PYGA 1EX8A 2YPZA 3D5MA 2NQPA 4HKQA 1R0BG 3PKMA 4F50A 4K4UA 2BW7A 2OH2A 4QIGA 3HHKA 1U24A 1HYSB 4LUBA 1B70B 2C2KB 3MAHA 3X1LB 1ZETA 2BE9B 2C3UA 4OJGA 3BBCA 3VGTA 2HFOA 4DOZA 2ZOMA 4LR7A 5C2CA 3QIPB 4URSA 1P8GA 1XMQF 4PZVA 3HMJG 1WUUA 3OXGA 1NHVA 1VQ7S 2QMWA 2MSTA 1NK6A 1FXLA 1NO8A 3GWCA 2KHDA 1NH7A 2BYCA 1H74A 3TANA 1YG0A 3DRSA 5K8PA 1RAIB 2MSSA 1ITPA 3CJTA 4NRTA 3BN4A 2BA9A 5AXLA 5KFBA 3EVMA 2HGMA 2VPYB 1JK9B 3UFCX 4WPAA 2YWWA 3EGZA 4V19J 1HBMB 2IRYA 4ERDA 4CTAB 3SSQA 3IRWP 1TP7A 2BJEA 3LP2B 3MUVP 3WIUA 2VOOA 3Q0AA 1PJ6A 2KL8A 4XK8C 3ISZA 3SBMA 1RU2A 4RL1A 2LA4A 4YHHJ 4P6QA 1EZZB 3WX4A 4PKDB 2X7IA 4DR4J 2L9DA 4R8UA 2MKKA 1OIAA 2XWYA 2OLWA 2PC6A 3T5HA 5BYSA 2EFGA 2E5LF 3BH7B 4C97A 4YB6A 4DFKA 2KHCA 3BPDA 1Q95G 4QOTA 4ZN3A 2VQEJ 3BR9A 5HQ8A 3CCWA 2MKIA 5L9NA 1HNIA 2W4DA 4CLLA 3OQ2A 3CO9A 1N6QB 4HYKA 3EUNA 2KI2A 3BBBA 5A8KB 4I6AA 4DL4A 2E44A 4IFYA 3GJTB 4H54A 5KFLA 5AE2A 1NNDA 4Q5VA 1SIZA 1PAEX 4Q43A 2Z56B 3R6LB 2ZOFA 1PBUA 3PIPQ 4IO9Q 4KIAA 3E2EA 1REVA 4B9MA 1N34F 2DO4A 5KT3A 4YR0A 2BJDA 2RSQA 1IBMF 4Q8EA 2DR6A 3I4PA 2OKQA 3AOAA 2F8MA 2HIQA 5F8JA 5H1SV 3P96A 2AEFA 2JFKA 2E1PA 3MM6B 4M95A 2CQHA 2UVWA 2LKZA 2RKIB 4QU7A 1RE1B 3VGVA 1K44A 1TKTB 4DEZA 4RUBA 4OV6A 1AZSB 1DTQB 3O2IA 5EN1A 1JJ4A 1RBAA 1X4EA 3MMCB 5KFVA 4LR8A 4J9UE 4EZ9A 2QRRA 4CLPA 3MMBA 4QJVA 4ZLNA 4WWSA 4NWBA 3VAIA 2BJ8A 1UPPA 1GFWB 5FLXU 4CH1A 3EVOA 3CEDA 2DGXA 1CSJA 1SJFA 1NDCA 4ZCIA 3P6YC 4N5SA 1S1UA 4UZCA 4JV1A 4DSFA 5AE1A 4GKKJ 2X1BA 5BR8F 1B99A 2FHKA 2XULA 3C6TB 3GIMA 3R5BA 2XS7A 2OI2A 4EYHB 5HK4A 2WBRA 1RT4A 2J0QD 1U6BA 1UAWA 4ES2A 2NS1B 2MHEA 1XR5A 2W7OA 4DR1J 2QL5B 4CLUA 2YX4A 4WZQA 1Z2LA 4FNIA 3FNNA 2YKOA 4DF8A 4LBHA 5D0HA 1Q7YT 3KWMA 3NCPA 1XQIA 2E29A 2HQ3A 2W8LA 3A4TA 4QYZK 3KG1A 4P2XA 3QNWB 1UA1A 1OWXA 1ZTWA 2QA1A 4USWA 3OV7A 4DU7A 2F3JA 2LXFA 3RTVA 2P6TA 3ONQA 4Y2IA 1YI2S 4EYIB 2HWHA 2K1RB 4DDFA 1X5OA 3GSIA 1IBLJ 1SQEA 1P6TA 2BJ7A 2J0SD 2SXLA 3LUYA 4OZ2A 4F0HA 3W3SA 2OP5A 5I3QA 1WD6A 1UVIA 4ZPVR 2H9ZA 3DXBA 2AZ3A 1SKUB 2PFFB 4EBEA 4ZOSA 3HKWA 2ZJRQ 1EETB 2A2DA 4NA2A 3KJNB 3M7VA 3M8SA 5ETSA 3LAMA 2F4VJ 4NZ0A 3DDKA 3H5XA 1NUEA 2ZZTA 1HNVB 3MEGA 4EK2A 3OHBA 3TX0A 5KG0A 3PR5B 2IBOA 1RABB 1U47A 1PC5A 1VJQA 4MK7A 3HSJA 1TAUA 4RWXA 4DPXA 4OX7A 4RNHA 3NCQA 3KLIA 1KOOA 2CPIA 3H59A 1RT1A 3I0RB 3QO9B 2XBPA 4HHUA 5KFJA 1VQ5S 1BQMA 1NCLA 3HHLC 3BZQA 5ETLA 1TVRB 1X4BA 4RPFA 2W9CB 5JXSA 2V2VA 1CPZA 1VLYA 2DR9A 2JLFA 4NL5A 3GR0A 2GW8A 5D4NA 4ZVHA 2GMJA 3K89A 4LF9F 3MR2A 2MB0B 4N77A 3KJQB 1RK8A 3DM2A 3M2UA 4IG0B 4ZPDA 3IR5B 1D8YA 1B3TA 4LF8J 1YGYA 5HROB 4OYZA 1L3VA 2LQJA 1RT3B 3MEEA 4URQU 1UVNA 5J2NA 4KV8B 4KSEB 1X5SA 1A6LA 4M5IA 3FJ2A 3DFEA 3CO0P 2O3DA 4CLWA 1WG5A 3TJAA 3H4BA 3E3XA 2IDEA 1VYAA 3M2VB 1B7FA 4LF6F 3UD5A 1LXNA 4MJKA 5KFXA 3DLKB 2YWHA 4D3GA 4O0NA 3FEXB 2OMOA 1VQOS 3H42A 3OT9A 2CQ4A 2J7KA 5EGYA 1ZA1B 2MKHA 4DR5F 4F2SA 1R0CB 1WF0A 3DRPA 3QMQA 3UN5A 3G86A 1RGVA 5DETA 3M32B 1I94J 3WHIA 2KRBA 4PYDA 2VBXA 5KFEA 4ED0A 1QTNB 1ULRA 4WKYA 2FVQA 1TL5A 2WSFC 3THPA 6AT1B 4DR3F 2QSFA 3BGUA 3VCDA 4HTJA 2DXDA 3F41A 2IHR1 3HFVA 2XZWA 2W7PA 3BYRA 3BH6B 3WZ0A 1FO1A 4LFAF 1WHXA 1FRLA 2XGQA 2JSXA 1SQGA 2WONA 2I0XA 3H5YA 1CS4A 2VUGA 3CCES 3GTYX 4P52A 4EU0A 2E1CA 3FSIA 3CXCR 2Y1IA 2YH0A 5J2MA 1TL1B 4JOUA 3K5OA 2DR8A 2CUYA 3DCAA 2Y1RI 1ZH5A 1NJZA 2HHSA 3A8KA 4NLGA 3L95X 1S10A 4DV4F 1YJRA 3HP6A 1FKPA 2HNYA 2HPUA 3OTCA 3IO1A 3I5AA 3GCXP 1T94A 3C14A 3G4SS 5MAOA 1FWLA 4MH8A 2WZ1A 1A9NB 2DNMA 4OLOA 2UP1A 1GK8A 4AL6A 3H25A 4FPIA 4ES3A 3K5MA 1FRMA 2IAJA 3KNAA 5C24A 4AE5A 1B0PA 2G0JA 2QV6A 1F1BB 1NSAA 3KG0A 4RU2A 3BGRA 2EFVA 2HK3A 3A3PB 4HT5A 3JSMA 4YDXA 2VBWA 1HWKA 1UTAA 3AA8A 3M9MB 2M3DA 3MM8B 2W8KA 2HMIB 3GE9A 3C8YA 5KFDA 3D0IE 3HK2A 3PRDA 3DRRB 1HW8A 1U2FA 4X4SA 1LW0B 3L09A 3MMAB 2P8IA 3D54A 3R7SB 4B3TJ 1HMVA 4IDKA 5HVFA 1WOPA 3FUYA 3I82A 3CD7A 4E8UA 2B0GA 5ETNA 1S6QA 2CPHA 4NYOA 4MIBA 4OLPA 3CCRS 2RS8A 1FK9A 4J91A 3DOKA 2P9CA 2IFXA 3ZZOA 3OSNA 2R4FA 1RXOB 4HH1A 1URRA 5BYQA 2EG1A 2IVMA 3ETMA 2EK6A 2DNQA 4FKXA 1RAOA 4H4KC 1WORA 4JI7J 4TKTA 1LK7A 4K59A 3MF5A 2KDOA 2YX1A 4OYIA 2QFIA 3M8WA 4USIA 4RW8B 1J5EF 3AA9A 5EX0A 1REGX 1YSJA 2ZEJA 4IRCA 5DDPC 1C2PA 2Y9HA 5KFTA 1LK5A 4MIAA 1Q1KA 2CPFA 3QZ7A 2N7YA 3EJMA 1JLGB 4KKOA 4O4RA 2K8GA 2CQPA 4DXLA 4ETZA 3MFHA 5IZHA 5D3GB 4QR2A 2OPRA 2HFUA 2YX7A 1S6PB 1JJCB 2MKYA 1VRUA 2OAUA 4OYOA 5HLFB 2E9ZA 2YKPA 1NK7A 1T05B 1SJRA 4BC9A 5M2RA 5B09A 4EBDA 1S7IA 1TK8A 4WU3A 1U6ZA 1R8HA 2QLJB 1ZM9A 2HBRB 4PABA 2MTLA 2G2YA 3FRZA 3GQCA 3R7BB 1T9VA 2MKJA 2F63A 2FVSA 2J8AA 5ETTA 2WB1D 4LRDA 2AGQA 2UXBJ 4RU9A 5IM0B 2V8HA 1SC1B 2BEFA 2V8PA 4HVZA 3RGIA 4X65J 2GS8A 1M1GA 3PFOA 1VQNS 4DJBA 4K5RA 2RILA 5F8IA 2C28A 5E2QA 5HMWA 2PE8A 4MIWA 2EC2A 1LV5A 4DUTA 2CNNB 2DJWA 1DFDA 1KFSA 2A6MA 2L3MA 3W2WA 3PO4A 3V6KA 2ZDPA 2DY1A 1SV5B 1S59A 1SH2A 4B08A 3KK1A 3GLJA 4JI8J 1YITS 4JYAJ 5DGAA 2JX2A 2G2ZA 3A12A 4NXNF 1JLBB 1LW2B 3VAGA 2VHGA 3OFGA 2DNPA 3EDQB 3MWBA 2YWGA 2ABYA 4O4GA 3AJDA 4OZNA 2VG6A 1J2VA 4DL6A 4AFFA 3V5RA 1FX2A 2KFZA 4UOGA 4ZK7M 3KHGA 2ZH4A 1XC9A 5GAEU 5KFHA 1RT5B 1D9DA 2AJFE 1SUQA 5F9LA 2HLTA 3LANA 4DCOB 1EJ7L 1HBUB 2XSFA 1F60B 4NYZA 4C3MA 2AMCB 4ZVGA 1MU2A 1WOOA 2WSEC 4QIWD 3HLUA 4RW6B 1PILA 1T9YA 2RQ4A 2ZC4A 5IQQA 1WC6A 1UZDA 5C42A 4PXCA 4PWDA 3LAKA 2H48B 3QJLA 3VVUA 1OQ6A 4MKYA 1D3WA 4IOAQ 2RD5C 1FT8A 1U02A 3CJ3A 3TEHB 4CO3A 1A7GE 3JQJA 3P4UB 3OLBA 3UCUP 1U0HA 4PPZA 2HRUA 3DGVA 2BVZA 2AU0A 5KFUA 1GMWD 3DOLB 3OTOJ 4CO0A 1NK8A 4G65A 1FRJA 4N47A 2I5JB 2GV1A 3FEYB 4Y34A 1TQLA 2W2QP 1YJNS 3UDLA 2WBMA 1F5CA 3G82A 4DZ6A 1N5SA 4HLBA 4ITSA 1KLMB 1YK9A 1SPBP 3DLLQ 1FESA 1MROA 1DQAA 1IN0A 4DX7A 5AJ3J 1RA7A 5CH7B 1VC5A 2RRNA 3DLGB 1FE4A 1SVDA 4M5GA 5B7WA 3N6LA 1IBCB 2UUBF 1RAEB 3NMRA 1QE1B 3MD1A 3H8YA 4D3HA 2VJVA 4K4VA 1NJWA 2Q66A 3ITHB 3W9HA 3VAHA 2CKWA 5KFYA 4ELVA 3PTWA 4IG3B 4TU7A 4OZLA 3MMJA 5IV4A 3KNGA 1HQEA 2G0CA 4X4TA 4Z7YA 2W9BA 4NPOA 1R0AB 1WHWA 4FS1A 2PMWA 5F8NA 3FBBA 3SV4A 2JEJA 3E01B 2DRAA 2C2RA 5I42B 3N79A 3CJ8A 1L5UA 1SI9A 2XO6A 1HL6A 2HHVA 2A1BA 3VQTA 2Y1JA 4LIRA 2UV8A 3DYAB 3N28A 2JNJA 1BHNA 2DNRA 2VQFF 2FJEB 1YJ9S 3LGMA 3VHQA 2YPYA 1TV6B 2B9WA 1CC7A 4PG7A 1TZ0A 1IR2A 4KO0A 1RQ0A 1KDNA 2ZE2A 4CQ1A 3P5BP 4WP8A 2ZH3A 2BQRA 1QJHA 1K1QA 2VV5A 4IFVB 3T9ZA 4MAKA 1FFWB 5DG7A 5HBMA 2XY7A 1H73A 5CD4H 1FI4A 2ZC3A 1S0VA 2EG2A 1XWLA 4ZPCA 1NB7A 3WIVA 1PC4A 1Z4UA 4LSZB 4C0HA 5C25A 2IA6A 4QU6A 4Q0BB 1R6YA 2UUAF 4KFBB 1WG4A 4U95A 3CD5A 2X1FA 1RWMB 2BE2A 2PEHA 4DU8A 4QBUA 2LDIA 5HP1B 2ZDOA 2XGPA 1VIXA 3HD1A 4A4JA 2CJYB 1RAFB 2LQBA 3RB3A 2DGSA 2FJBB 1JNZB 2EFOA 5CAAA 3F56A 3GP9A 1S1VB 3NBPA 1G2EA 3UVJB 2FIUA 4BWJA 3W2VA 3MEKA 2ZITA 3LPYA 2ZHBA 2YY3A 2BJ3A 3WX8A 1X9SA 3BSCA 3BQ0A 2Z30B 4UOCA 3W65A 2O66A 3D2WA 4X66F 2KYXA 5F8MA 3RW7A 3HHLD 3JSBA 1GMWA 5KFAA 5D6GA 1RWKB 4DL2A 2R7SA 5IFMA 4LMZA 3WDOA 4MMOA 2L9WA 2V68A 4JB8B 4K7QA 3C6UA 2AJ4A 3L7OA 5E3QA 3HVWA 5IQ6A 2GIRA 3GFHA 2F7VA 2COLA 1GAOA 1WC4A 4O3OA 4OIXA 3TAMA 1ZS6A 3HVTA 2DEJA 3PDNA 4TVAB 1C0UA 3C16A 2E7XA 1ZM4A 4QZVB 4LRCA 2XYPB 1GTHA 5T7LA 3T5LA 3I9ZA 3SXLA 4CCHA 1U1KA 3ET6A 3KYLA 1CJKA 3PW2A 3DOMA 1Y5IB 5DRKA 3SV3A 2KJWA 1UW9A 3LP0A 2OSQA 3ZZPA 4AYBD 2DO0A 2OPQA 4C0OC 1UW4A 1RKIA 2BQ3A 4JI4J 4FYXB 4Z7CA 2XMJA 4C8YA 1X0FA 1NZAA 3R9LA 2HHPA 3QIDA 2DHHA 3IWXA 4IFYB 4OZ1A 4J9MA 2C3PA 1HWIA 1H6KX 3RBZA 3AJ1A 1NK0A 1W7WA 2HFZA 1S97A 3P49B 4RW7A 2XY5A 3FMWA 3P3DA 3GIKA 1FNOA 3JTNA 3ELHA 1APSA 4CWBA 5IT0A 3K5NA 3T5JA 3BPSP 2XMTA 2FVPA 1OMSA 2KXNB 3JYTB 2MY7A 3KLEA 2RQKA 3S7RA 3IRXB 3Q83A 3THVA 3VGUA 3M6VA 2ZOGA 1LXJA 3KHRA 2QG9B 4CLYA 3GJSB 4K0KF 1TTHB 4ES1A 2QMXA 2G4BA 2XEXA 3OVSA 4I2QB 2XMMA 5J2PA 2VPWB 4GKJJ 2C3OA 1S1UB 4KHMA 1RYRA 2PN6A 5BYRA 4K2XA 2HURA 1TKZA 2QA4S 4U8VA 2VH7A 3V6DA 4DR7J 2AX0A 2HVDA 3BO3A 1HNWF 4C7QA 2OTLS 1W2BR 3H40A 1SCJB 3BB5A 4ED3A 1CJTB 3Q8RB 4G6VB 4DUZF 1F9FA 2GQQA 3BR8A 4LBIA 2CZVC 1FKOB 4RZRA 3OR2B 3MECA 1CJVA 2GO9A 3RUBL 3T1YJ 1N5YB 4LSLA 4IH5A 4J7CA 2YKMB 2NPFA 3HHNB 1Q8KA 2GAGC 4RBVA 2A10A 4JV2A 3MDFA 1MWZA 1HBNB 2WVFA 2V63A 3OL6A 4NMLA 3HHLA 3BO4A 3CC4S 3LF0A 2VC1A 1HNXF 2CQGA 1XNQJ 2HNZA 2KZMA 4ED6A 2R7VA 3GFZA 3KK3A 4XDDA 4ZPAA 2YNGA 1RTDB 4HI2A 2RIJA 4ILRA 1QAJA 2VASA 3W60A 1IWAA 3O6QA 3KLGA 3DDNA 4QIEA 2XTJP 2M0GB 4C2MA 3MOJB 7AT1B 3SQGA 3PCOB 5A0YA 1O0PA 1TMJA 1SJ4P 4ECZA 1WHVA 4Y6IA 3ZZUA 5IT9Y 2EKNA 4J90A 3JSRA 3MEGB 4M63A 2WHOA 1QVFR 4NCGA 2KRRA 2ZHAA 2JWNA 2VDIA 2HHHJ 1RCXB 2YQ3A 4X4QA 4L6V3 1C4CA 3MM9A 1JXEA 5DQGA 1FEEA 4DV0F 2HK2A 2O1PA 3PYEA 5IWAJ 2W2MP 5B0CA 2HVEA 3DMJA 2F8EX 2NXJA 3Q8UA 4GO5X 4DN9A 2CJBA 2BBEA 4A8MP 3BS9A 3KUHA 3CJKA 5F0UA 1U8SA 3MEDA 2FDNA 1Q16B 3KOAA 4RBTA 3PO5A 4O0IA 4FBTA 4JI6F 9RUBA 2CDQA 4IR9A 3FZBA 3DHWC 3B4MA 5F8GA 2CZ9A 2FHMA 3IR6B 2VFVA 1UWAA 2GNKA 2PFDA 1T8EA 4O23A 2R7UA 2WVCA 1VHIA 4WTOB 3HI9A 3CW2C 3FBFA 4B3MJ 3IAM9 4O3QA 1FNXH 2JLGA 4Y2KA 2VDHA 2NZCA 3M6UA 1YQHA 1NK4A 3D9BA 1NB2A 3HKZD 1WEXA 5A6WA 2HYIB 1CJUB 5C5JA 5KFNA 2EFPA 5D4LA 4DV6J 4DR6F 2KFNA 1F2GA 3TUZC 1KTQA 5ETVA 4DG1B 1M90T 5J2NB 4AXJA 2PT0A 2OPSA 2DNGA 4F0MA 5E3RA 1LWEA 3FFIA 3TX8A 1UFWA 3SMZA 2OD4A 4K5SA 4X64F 2ADCA 2Z58B 4BS2A 1RAAB 1K9MT 3CCSS 2MPUA 2DEIA 1BY9A 2RS2A 4C8KA 2QYCA 2H1YA 2MZSA 3GMGA 4HH0A 2ZD1A 2HVZA 3CTRA 3VAJA 1F5AA 3H98A 2R3VA 3S01A 4A46A 1IKWA 3CE8A 1X4HA 2ZM6F 1WKJA 4JI3F 1S48A 3DRPB 4DFJA 1DLOB 2ZKUA 1MNEA 3W8PA 3KTQA 1HQUA 2V8GA 3EGNA 2Z2LA 1AYEA 6FDRA 4XAKA 5MLCV 2UUWA 4O3NA 4UY85 1FD8A 1XMBA 3SCJE 3FCHA 2OFGX 1X9WA 2UUCF 3K2YA 3EXYA 1EP4B 1RKJA 4C8LA 2OTJS 5L1JA 4NLDA 4C8OA 2DXEA 2IC3A 1WC3A 1WF1A 2HGNA 1WG1A 4RNOA 1RTJB 2DKOB 3BKFA 4C0BA 1XMOJ 1Y9OA 2YQ0A 3QGHA 5GAGU 1LOUA 1EB0A 2E7WA 2HZCA 2AQ4A 3KK2B 3CCZA 1KS2A 1UVLA 4LBPA 3ENQA 1AUSL 3MXHP 4ZN1A 1VQKS 2QA4G 1PYTA 2WVEA 1MMLA 1HPZA 2FVRA 3CCVS 3CSKA 4A8YA 3N5FA 1QAXA 4F3MA 4DQPA 4LFCJ 3CJ4A 4P9SA 1YRXA 1VRTA 1FKPB 2HAIA 1C1CA 3IP0A 1OY6A 1DBDA 3AH6A 2L48A 2J0WA 5B0AA 3DXSX 5ADZA 2IM2A 2KVQE 2R2SA 2DH8A 5JMNA 4DBQA 2IMOA 1S9FA 3G8QA 3I96A 1ACMB 2V4JB 4KGVB 1RTIA 4P72A 5IT9U 2F9DA 2JC0A 2CJXB 4F4AA 1N52B 2GIQA 4CIOA 1ICEB 4ID5A 4N7TA 3CD6S 2HHQA 3N0VA 1HR0F 3HF5A 3QJJA
chains in the Genus database with same CATH topology
3PX0A 1Q86T 4JI4F 4NX9A 4LVOP 1U47A 2JEFA 5HBMB 1PC5A 3CGIA 1W25A 4MK7A 4AUKA 1P9QC 4B3OA 1TAUA 2PIIA 4NZ7A 4RWXA 3EPGA 3TYTA 1R0AA 5DDOC 4OX7A 4RNHA 3NCQA 1FJGF 3IAS9 3KLIA 1JLQA 1GH8A 2M70A 1KOOA 2DRBA 2CPIA 3H59A 2RRBA 2KO1A 1RT1A 3J80Y 4DV3F 5C25B 3I0RB 3QO9B 1AROP 2XBPA 5KFJA 1VQ5S 1BQMA 4I6YA 4DV5F 5I42A 2CPJA 4PQUA 3V2UC 2KB2A 3CC2S 4ZCKA 1KQFB 3HHLC 4LSNB 4N56A 1YHQS 3BZQA 2B51A 4RUCA 2BE2B 1QY7A 4P7TA 3EZUA 4YB1P 1TVRB 4ZA1A 3TAQA 1X4BA 2W9CB 5JXSA 4RW4B 1CPZA 1VLYA 2LVWA 2DR9A 1HWUA 3DYAA 2JLFA 2J6SA 4NL5A 3GR0A 2GW8A 3NNAA 4LFBF 5D4NA 5KT2A 4ZVHA 5EWFA 3AHPA 1AFIA 3MUMP 1SKRA 1N4LA 2GMJA 4OZ5A 3U1LA 4V19X 4A8WA 1HHTP 1JKHB 1T3NA 2R8IA 4WCEQ 2QT7A 2GGPA 4G1PA 4YEAA 5CYJA 4LF9F 1N6QA 3DLBA 1W2IA 3MTKA 3MR2A 3M8QA 1RT7B 5KG7A 4GC6A 3OW2R 1TV6A 2MB0B 1RT2B 3KLFA 2C3MA 4N77A 1H2VZ 2XSJB 4O44B 1YJUA 1Q79A 1VC6A 1XERA 4MFBA 1TKDA 4JYAF 1RK8A 3DM2A 4ZPBA 1ZAVA 3QWUA 1KSPA 3NBPB 3M2UA 4IG0B 2W25A 4I2PA 4ZPDA 3CMES 3IR5B 5GADI 5GAGI 3BJYA 3OUYA 4FS2A 2UVRA 4OX6A 4JV0A 3W2VB 1HNZF 2YNIB 1DQ9A 1YJVA 3FDSA 4XIUA 1D8YA 1VMBA 1NKBA 4U6PA 3RAMA 1TUVA 5B0FA 5L39A 2FLOA 1M1KT 4ED5A 2Q1LA 5KFIA 4B02A 1LFPA 1YGYA 2YTCA 1GX5A 3UR0A 5F9NA 1SKWA 1Y0HA 5HROB 4QCLA 2ZH1A 1G1XA 3RB0A 3ZZYA 1SC6A 2NREA 3NNHA 2IJFA 2ACYA 2VC0A 5J1EA 1RT6B 4NYPA 4Q0BA 1TKXB 1L3VA 2DB1A 4OI4A 1Y5NB 1JLEA 1AW0A 3QAUA 4ECWA 2LQJA 1NJYA 1S6UA 2ZHOA 2KG1A 3LP1A 4ID8A 4KFBA 5T14A 3MFIA 3K0JA 1RT3B 4UW2A 1HWLA 3MEEA 2DHXA 4URQU 4F4YA 2WAQD 3D0GE 3UQSA 1UVNA 1YJTA 5J2NA 2FLLA 4KV8B 1HD0A 5D4PA 1JNRB 4NA3A 2DR5A 1NJXA 2R2UA 3V6HA 1O5JA 4KSEB 2AJQA 1X5SA 1A6LA 2NYIA 3M1VA 4RNMA 1KC8T 5HP1A 3L7PA 4GKJF 2JFDA 2VD3A 4LIWA 1S72S 3FJ2A 4OI0A 3DFEA 3FEZA 4KKOB 2YWFA 5IXUA 2CQCA 4NLYA 2O01C 2O3DA 3QZ8A 3OL8A 3BSAA 3C6UB 2CQ3A 1FKAF 1WG5A 4B9TA 4KC5A 2EFNA 3IGNA 1JMTA 4NXMF 1XTZA 2LCWA 2RQCA 3IG1A 3H4BA 2EI5A 3GB0A 3D1OA 4OI3A 4PRFA 4DR7F 5GVQA 2VPZB 3E3XA 5K9FA 3M4XA 3J7ZT 2ILZA 4HL9A 4WYLA 4J5OA 3DRYA 2JRSA 2YKQA 4TQRA 3LW5C 1S1TB 5KOWA 3M2VB 1S0OA 1B7FA 4LF6F 5DM6Q 4J9PA 2PDAA 2N4CA 4KB7A 5J2QB 1LXNA 1S1VA 1N5TA 4NRUA 1HHSA 3FRYA 1Y4ZB 4MJKA 5KFXA 2XMUA 1U4BA 3DLKB 2YWHA 4OZ0A 4D3GA 3TAMB 4TU9A 3FEXB 2OMOA 4NZ6A 1VQOS 2YKNA 2UVUA 2HHWA 1V6HA 4LF4F 2DHSA 2FGCA 1S9GB 3HVTB 2CQ4A 2J7KA 5EGYA 1UETA 2B4PA 4OMFG 2XCPA 1JWWA 2MKHA 1C0UB 4C11A 2QLWA 1S9EB 1U1PA 2V8VA 1VBXA 4ED7A 4NLWA 4DR5F 2F9JA 2KVIA 3M30B 5KT6A 1BGXT 1C0TB 1U7LA 4F2SA 2RE1A 5T7LB 3RZAA 4K4YA 1WF0A 3DRPA 3QMQA 3ETOA 1AXQA 3G86A 3VR1A 3SCLE 4N76A 1PO6A 1RGVA 3V4MA 1RISA 1S7HA 4YDDB 5DETA 4R0EA 3M32B 4CO2A 4Y65A 3T1YF 3V4IA 5CZXA 2KRBA 2CPYA 2VBXA 5KFEA 2RUGA 3LP0B 4ED0A 4IYQA 5CYMA 4DL5A 1JJHA 3D28A 2KKHA 2OPQB 2B3TB 1HARA 3AY0A 3NGKA 1B0VA 3MGJA 3CWJA 3I0SA 3OFFA 3IR7B 2J0XA 1HD1A 2HS3A 1U1QA 4ZVEA 2B56A 1ULRA 4OJ3A 4WKYA 3J81Y 1N5VA 3R5AA 3PFEA 5HMXA 5I3UB 1TL5A 4YB5A 4Y00A 1VQ9S 2FVQA 3UWTA 4PUOB 2GHPA 2WSFC 3THPA 1BWEA 1TL3A 2JEIA 4DR3F 5KG2A 5DGBA 4M5DA 2QSFA 3BGUA 3VCDA 3POTB 2XHWA 4HTJA 4BWMA 3F41A 5FDLB 4ZS6A 2IHR1 2QLXA 3T19A 2XZWA 3DRXA 4PG8A 2W7PA 1XNQF 3I55S 4DSEA 3OVBA 1FEHA 1DARA 3I5BA 3WZ0A 1FO1A 4LFAF 1C1BB 3US5A 1WHXA 1FRLA 3BM7A 4F25A 4O3RA 4CT9A 3PNIA 1UVKA 2XGQA 3HPOA 2JSXA 4U67Q 1SH0A 3C46A 4YQWA 2W7AA 1FTRA 4RW7B 3IBWA 2RF2B 2HS4A 4IH6A 2WONA 2AWZA 1BQNA 2ZNYA 3I4HX 2I0XA 2VG5A 1E6YA 4WYWA 4RUAA 1DAXA 3H5YA 2GX8A 2VUGA 1UVMA 4X4RA 4KBIA 1V9OA 2DCUB 2FC9A 3CCES 4PG6A 2C3YA 2HS0A 4JI2F 5BJRA 3IA0A 1RA6A 3QGPA 5CYQB 3UPFA 5I3PA 3GIIA 4EU0A 3ZZTA 2E1CA 4BCAA 3FSIA 3RRKA 4MYUA 1UEVA 2KJVA 5A8RA 4ECRA 5KFWA 3GR1A 1X4CA 3FVYA 2J9CA 2MYFA 4I7FA 5JVHQ 3G6YA 2DCLA 3SFUA 2ZH5A 2VFUA 3PJXA 3CXCR 2Y1IA 1FJEB 2YH0A 3GV7B 3R1LA 4ZMMA 3KJVA 2FVCA 1TR0A 1X9MA 1J5OB 1S0MA 1T95A 5GAHU 3KLEB 5J2MA 2DT9A 3VZHA 3PZPA 1H38A 3G96A 3V6JA 4A8SA 1S76D 1HI8A 4WFZA 1TL1B 2KXHA 3IXQA 4JOUA 4WFAQ 3K5OA 2DR8A 4RX6A 3AQOA 2GO8A 3DCAA 2XLKA 2FB0A 2Y1RI 2GMLA 3OHAA 2HHHF 3Q8QB 3L3CA 1ZH5A 4O4GB 3VF0B 3CCLS 1NJZA 2CJKA 2HHSA 4NLGA 4PQAA 1LFWA 3L95X 4ZHRA 4ECTA 1VS3A 4DV4F 1YJRA 4PG4A 1S10A 3HP6A 1IKVA 1FKPA 2HNYA 2HPUA 2N3LA 3OTCA 4ECQA 2KXFA 3IO1A 2HW3A 3I5AA 1M5PC 2R8JA 1T94A 3X3UA 4YHHF 1U1RA 5IWAF 3G4SS 4PWUA 2AF6A 4DR4F 1Q53A 3CDBA 5MAOA 4DSJA 3RAQA 4R0JA 1SUQB 5KT4A 3AQPA 2BANA 5KFZA 3J7YU 2I9SA 3QLHB 3CCMS 4IQXA 4KHPF 5B0BA 1UJ6A 2DTJA 2A18A 3ISNC 4MH8A 1A9NB 2IRUA 2PD1A 1FXDA 3WC2A 2DNMA 1IXKA 4OLOA 2UP1A 3B4DA 3KLVA 2R8KA 2PO4A 2MKSA 3DLEB 1NAQA 1ZM2A 5J2PB 4AL6A 3TA2A 2VKRA 2ASDA 4FYDA 3K8VA 1FERA 3C3LA 4OL8A 5F41A 3LH2S 3H25A 1NEEA 2VQEF 4ES3A 1JLCA 4PPDA 4R5PB 3K5MA 3M2RB 1FRMA 1TKZB 2IAJA 4WE1B 3KNAA 4JBCA 1LWCA 2IYIA 2MZRA 5C24A 4AE5A 1B0PA 1Q82T 3V6DB 5B0GA 3TVYA 2BZ2A 3OR1A