5LJ5Y

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lj5Y00
2MYFA 2MZ1A 4WFNQ 5GADU 2KI2A 3CCRS 1JMTA 2X1FA 2DHXA 1JJ2R 1WI8A 5H1SV 1H6KX 2DNLA 2HGLA 1DHMA 3FEXB 1VQ4S 3MXHP 2DNZA 1FT8A 1VQMS 2AYGA 4WCEQ 3VAMA 3Q2SC 1A9NB 1WEZA 2DNGA 3G71S 3UE2A 1QVGR 4F25A 3MUVP 1HD0A 4TU7A 1SJ4P 2DH7A 3MD1A 3CCJS 3R1HA 3VF0B 3Q2TC 2CPEA 1VQPS 2CQDA 1NU4A 3G6ES 1M5OC 1U1PA 4Z2XA 4A8XA 3EGZA 1U1RA 2UP1A 2MPUA 2MKKA 2E5HA 2MGZB 1FXLA 2MZSA 2E5JA 1HA1A 1X4HA 2QA4S 3CC4S 1Q86T 2MKJA 2RS2A 3UD4P 2CJKA 5LXYA 1X5SA 1KQSR 3EX7B 1H2VZ 1WHWA 1KOHA 3UD3P 2KU7A 2MB0B 1PO6A 1P27B 3LPYA 3HHNB 2CQ0A 1WHXA 4OZ1A 4QQBA 4TLQA 2CQ4A 3V4MA 1M5PC 1WF1A 1IQTA 5DDPC 2CPYA 5GAEU 3K0JA 2RRAA 2J0QD 2L9WA 5GVQA 1U1QA 1AUDA 5DDQC 2MGZA 2YTCA 2OSQA 3VAKA 1QVFR 1WF2A 1RK8A 3B4MA 5CXTA 2M0GB 4ZKAA 2ZJPQ 2DO0A 2CPFA 5LJ5Y 1SJ3P 2KG1A 3PIOQ 4C0OC 4PKDB 2JVRA 3NMRA 5CA5A 2MKSA 4C7QA 2YH1A 1BY9A 1ZH5A 1X5OA 4IOAQ 1YTYA 1YIJS 3CC7S 3EGNA 2N82B 2CQ3A 2DIUA 5D78A 5GAGU 1YJNS 2EVZA 2RRBA 2RUGA 1X4DA 3VALA 1VQNS 1WG4A 5LSOA 2ZJQQ 3CC2S 2MQMA 2LEAA 2FPHX 2LECA 2U1AA 1JJ4A 2G0CA 3TO8A 4ERDA 1WEYA 2XS2A 2XSFA 2RT3A 3CCMS 4TU9A 1VC6A 2B0GA 1WELA 1HD1A 1WG1A 2HYIB 1S79A 2DNQA 2RQ4A 2ERRA 1DBDA 2MMYA 3UCGA 2OJ3A 1X4GA 3VAJA 1O0PA 2A3JA 2O3DA 2CQBA 2I2YA 3BO2A 4Y0FA 1WG5A 2DNHA 3DXBA 3SXLA 2LA6A 4J5OA 2CPDA 2ADBA 1B7FA 2KYXA 2KH9A 1VQ8S 4WFAQ 1U6BA 5ITHA 4V19X 3BEGB 3CCLS 3SDEB 2CPHA 2MZJA 2YKAA 2ADCA 2MKCA 3H2UB 3CF5Q 2DGUA 2DO4A 3P5TL 2LMIA 3G4SS 2HGNA 2WBRA 3D2WA 3VAIA 2OTLS 1YITS 5GMKa 3LQVA 1VQLS 4WFBQ 2E5GA 2X1BA 2KG0A 5DM6Q 2FC9A 1SJQA 4LMZA 1R8PA 2DISA 4TU8A 3PIPQ 1H2TZ 3MUMP 2N7CA 3SMZA 1NO8A 1VC5A 2LXIA 2ZJRQ 2EK6A 2YH0A 5EN1A 2E44A 3SDEA 3TP2A 1F9FA 5BJRA 3ZZYA 2L41A 5IFMA 1ZZNA 1WI6A 1DRZA 1OIAA 1X0FA 2LYVA 1FJCA 1Q81T 3NNAA 2KM8B 2DNOA 3P49B 2XS7A 2DH9A 3J7YU 2AD9A 1G2EA 3CMAS 3G8SA 2AYMA 5DETA 2PEHA 3R27A 4M5DB 1WHYA 2KXFA 1OO0B 2FY1A 2N3OA 2LEBA 5DM7Q 3BS9A 3L3CA 1K8AT 4LJMA 2KVIA 2NZ4A 2MY7A 2J8AA 2D9PA 3I55S 5LXRA 3CMES 3ULHA 2CQCA 4PRFA 2MQQA 2BZ2A 2M7SA 2JX2A 1RKJA 2DNMA 2SXLA 5MLCV 3JB9k 2HZCA 5FJ4A 1FO1A 2MZRA 2DNNA 4IOCQ 2JRSA 2M4MA 2DITA 2DHGA 3HI9A 1X4CA 3N9UC 2F3JA 3CCSS 1H2UX 1VQOS 3CTRA 2KT5A 1VBZA 1VC0A 1Q82T 3S7RA 4QPTA 1VQ6S 1WF0A 3MOJB 1L3KA 3G8TA 3U1LA 1S72S 2FC8A 1UP1A 4FXVA 3OW2R 3DLLQ 1WEXA 3S01A 2F9DA 4CH1A 2MQPA 2DH8A 1U1NA 1M90T 2DK2A 3THTA 2MQOA 2VONA 1YJWS 2V94A 3R1LA 3U1MA 5HL7Q 2MKIA 1N52B 2CQHA 3CXCR 2G1DA 1URNA 4YUDA 1KOOA 4UQTA 2N3LA 4C4WA 1OWXA 2QFJA 1FJ7A 2QEXS 4WF9Q 1VQ9S 2VOPA 1U6FA 4YOEA 3B4DA 2GO9A 2MQNA 1VBYA 2OSRA 1YWXA 5IM0B 3P6YC 1YI2S 2U2FA 2BOPA 1UAWA 2DNYA 2CQ1A 2D3OR 2XNRA 4P6QA 2K8GA 5HO4A 3RW7A 2J0SD 3CUNA 2DHSA 2E5IA 3MI7X 3P3DA 3G96A 3CCQS 2CQGA 1M1KT 1VBXA 2HVZA 2MJNA 2DB1A 1VQ5S 2DGOA 1HL6A 2J76E 2CPZA 2CQPA 4Y00A 4WKRA 2RNEA 4UY8T 2DGSA 2CQIA 4LIRA 1FNXH 2OIHA 4CQ1A 5IM0A 1N88A 5GAHU 2RU3A 5JVHQ 2L08A 3NS5A 2JVOA 1VQ7S 4WIIA 1N8RT 3VAHA 2LQ5A 2DNPA 2DGXA 3CCVS 2DNRA 1PGZA 4YB1P 2XB2D 2DGQA 2KXNB 1QM9A 1JJHA 2F9JA 3NNCA 2M52A 4CIOA 3BO4A 1X4EA 2HGMA 3I56S 2MHNA 1KD1T 5DDRC 5JVGQ 2KM8C 4ED5A 1UW4A 3VAGA 3CPWR 5D77A 5DDOC 1KC8T 3G9CA 2M70A 2VODA 3TYTA 1K73T 4IO9Q 2XS5A 2JWNA 3CCUS 2MKHA 2LA4A 1NJIT 3MUTP 2MSTA 2MJUA 2DNKA 1WTBA 2KRRA 2K3KA 2RVJA 2NLWA 2CPXA 2DIVA 1DZ5A 3CULA 2M88A 5LJ3Y 1D8ZA 2M2BA 4U67Q 1SJFA 2CPJA 1FHTA 3CCES 1D9AA 2XNQA 2GHPA 2LKZA 3MURP 2X1AA 1X5PA 3THPA 2KFYA 2AYEA 4W90B 2DGTA 1P1TA 4QU7A 1X4AA 2M8HA 3MD3A 5CYJA 1X5TA 1U1MA 4PR6A 1K9MT 3VAFA 1U1OA 1ZZFA 2MXYA 1SJRA 3US5A 1A7GE 1XN9A 1X4BA 2MY8A 1OPIA 3BO3A 1Q7YT 2RS8A 4CH0S 3S6EA 2MQLA 1W2BR 4OZ0A 2EK1A 2KN4A 2M8DB 2YWKA 3H2VE 1VQKS 2KXHA 2LXUA 2MSSA 3ZZZA 5LSLA 1WHVA 2PE8A 4F26A 2DGVA 3IRWP 2X1GA 1R8HA 4EGLA 2DHAA 5IQQA 1X4FA 4BS2A 1YJ9S 3IWNC 2DGWA 1SXLA 4IUFA 2KHCA 4F02A 2LCWA 2VOOA 2Q79A 4W92B 3NNHA 1U1LA 1U2FA 3UCZP 4FXWA 3UWTA 1FJEB 1WWHA 2CPIA 1CVJA 3RW6A 2D9OA 2FHOB 3S8SA 1M5VC 2CQ2A 2I38A 2RQCA 1YHQS 2AYBA 2OTJS 3J7ZT 4RU2A 1N54B 1UFWA 3UCUP 3FEYB 2KRBA 2G4BA 1M5KC 4QU6A 2MZQA 3MDFA 2MZTA 2M9KA 3CD6S 1U1KA 3NS6A
chains in the Genus database with same CATH superfamily
1S1WA 4U6PA 2DCUB 2CKWA 3MR3A 5K8NA 3FSIA 2HNDB 2F40A 1FNOA 2ZVSA 2ZM6F 1JLGB 2DNZA 2XMKA 2VF3A 1A9NB 5I3UA 5J2QB 3VF0B 3W62A 3W2WA 2FJXA 4RR5A 5KFZA 2KDOA 2XMJA 4C8OA 2W9CA 4K5SA 2MPUA 3HF5A 4DOZA 3TARA 2E5JA 3WBZA 4O4GB 1PILA 4KC5A 4IQMA 2R2RA 2UXBJ 1HW8A 1X5SA 1U45A 4FF1A 2HHHJ 2RD5C 4P73A 1T03A 1U0HA 5D0RA 1QAIA 2QT7A 2UZAA 4GC6A 1ZA2B 2NUUG 1UA1A 3OTDA 4ZN3A 3BYPA 4PZVA 4KGVB 3GTYX 3QIPB 2QSWA 1SUQB 4CLPA 3PYEA 3GJQB 1YIJS 1I5OB 3F44A 4M63A 5D78A 1HWKA 3H20A 2UVVA 4WU3A 1GNKA 2UVUA 4TXSA 2H5JB 2XS2A 3CCMS 3NCPA 4PXBA 1XMOJ 4OHYA 4TKTA 2FD2A 2XY7A 1U26A 2MMYA 4QJVA 3GILA 2Z2LA 1RAGB 2I2YA 3RAMA 3RB4A 2JDJA 1U6BA 4Q43A 2IDLA 2UUBF 4FS1A 4OHVA 3CF5Q 4EO6A 1O51A 2HS0A 3PX0A 1HFEL 1ACMB 4P72A 5SZTA 3EVOA 5KG0A 3PIPQ 1LFPA 4Y34A 1RSCA 2GMHA 4Y2KA 2EFOA 4JI3F 4ER8A 1UPPA 2W01A 5CYQA 1DQ8A 1GMWA 3HT0A 5C42A 2AD9A 3SIPB 2QO3A 3SEOA 3AJ1A 3LO3A 2OAUA 1VLYA 3PX6A 3QLHB 3V6HA 4U7UD 2FY1A 3C6UA 2C2MB 1NDCA 1BQNB 4NCBA 1RTJB 3IR6B 1LWXA 1FVQA 4YEAA 5L8RC 3TR5A 1VYAA 3UN5A 2NZCA 3Q89A 1IR2A 3FNNA 5B7WA 4ILMA 3MOJB 2AJ1A 3WDOA 3OFFA 2FIUA 2RDIA 4UQGA 4DV2F 3EZUA 5K8MA 4LFCF 5GMDA 2DH8A 2PFDA 2BQ3A 1Q4RA 5L1KA 2HBZB 2GIQA 2GIRA 4CWBA 4KBIA 1OWXA 3G8QA 1CULA 3DDNA 2I9SA 4YB7A 1SKUB 5IM0B 4P74A 1SQFA 3HX9A 3CD7A 4ZCKA 1RAEB 3G96A 5AJ3J 1H0HB 4ZS6A 2RNEA 1LWFB 3ETMA 3UVJB 2I1RA 5ETLA 4MMOA 3IBCB 3LPEA 2LQ5A 3D6MB 3RGIA 2CADA 4JV0A 4LF6J 2HHVA 1DURA 3ZTPA 3CGIA 2CWXA 1UW4A 3RB3A 4J37A 4DSFA 5KFDA 3NGDA 2CJBA 5IC4B 3MR5A 4JI4J 3C46A 3M2RA 2GA7A 5CD4H 2HMIA 4OI6A 1M5HA 3DGPB 3T1YJ 3UR3C 1Q5YA 1BGXT 2CJAA 2J8SA 4ED4A 3DOLA 1OYEA 2EFVA 2A2CA 4A8QA 4DQSA 2OPSB 3CT9A 3GZ7A 2LKZA 1YRXA 5J2MA 4PR6A 2FVCA 2AV5A 3VCDA 3M8PB 3N0VA 3MM5B 3PM9A 1UWAA 1C1CB 2ZWOA 4F4ZA 2CZ9A 2ALYB 2EK1A 2RAQA 2HS4A 2MSSA 1SH2A 4R8UA 2KJVA 2ZDOA 1X4FA 4BS2A 2UXBF 1IUJA 2XI2A 2HHHF 1B0TA 4C11B 4M5GA 1U1LA 3V2UC 1FJEB 1H7XA 3TAQA 3ZXWA 4I4BA 1TL1B 2D9OA 3S8SA 2OTJS 4WXWA 8AT1B 4OI2A 1TL7B 3L7UA 4PWUA 1Q53A 4UOHA 4EI2A 1U4BA 3MEEA 1VQMS 4PXEA 4B3OA 4NA3A 1EZZB 4GO7X 3E01A 3VGSA 1B4SA 1ITPA 1RADB 4FS2A 1XMOF 4ECVA 1C4CA 3QQCD 2MKKA 3MR6A 5DLGA 5HI7A 4ZPCA 4F8RA 1WHWA 5CQGA 2AGQA 4IYQA 2CDQA 1F5BA 4ANEA 3MEGB 4QQBA 2W9BA 1SKRA 1IQTA 4USTA 5KT5A 3BH6B 2ZBCA 2O66A 2CNNB 2E9RX 2VBWA 1KONA 1WF2A 1DTTA 3NAHA 4OV6A 1JLBB 3EPGA 2PI4A 1PCAA 2NR0A 3ZZPA 2YKNA 3GYXB 2FHMA 1YTYA 2C2NA 3KFWX 2QYCA 2CFXA 2EVZA 2H4WB 4CDIA 3PG9A 2VV5A 2ZUGA 2FHJD 2XSFA 1SJ1A 4ZP9A 3U02A 4O23A 3JQKA 4RL1A 2EC0A 1DBDA 3UI3A 1KKHA 2A3JA 1NSKL 2NQPA 3TZZA 2R7WA 3W8GA 1H3DA 3HHEA 5CHCB 3KNAA 4FF4A 1UVMA 3G4SS 2D3UA 1RWVB 3W2VB 3DRPA 2A1BA 1U8WA 3EWGA 4KGMA 3BBCA 2PFFB 3VTIA 3MM9A 3H8YA 4RW6A 2C2OB 3TZYA 4KHRA 3M1VB 1Y5NB 1RT3B 3V6DB 5IOLA 1FEEA 1KHWA 4G3IA 5DG7A 2W8KA 4FPIA 2XS7A 3J7YU 4OZ3A 2AYMA 4GMKA 4DG1B 3R27A 4ZVGA 3L3CA 2V8DA 2AGOA 1XIQA 2YKMA 4IKAA 3HSZA 4BBYA 5AJ3F 3LGNA 3LALA 2W1BA 4HH1A 1LWEA 2IC3A 2IM0A 4M5JA 3BSOA 2CG8A 2F3JA 3H5UA 4ZMMA 1S9EA 4MYUA 4NZ0A 2YBVA 3I4HX 1KR4A 2H51B 3AD9C 1AT1B 3WQPA 4HHHA 3RR8A 5HL7Q 5KFPA 3K8WA 3CXCR 2JFKA 1X9WA 4JI4F 1TK8A 3T1YF 5MAOA 1DQAA 1GXTA 1HQEB 1D0EA 4OQJA 2D3OR 4P6QA 5HO4A 2HHWA 1RDRA 3PYGA 1CBKA 4ZVOB 1VQ5S 4ECXA 1RAIB 3VHQA 5EX3A 5GMEA 2GW8A 4DMZA 1J27A 1FKAF 2NXEA 1N88A 1QD1A 4NMLA 3MGJA 2L3MA 2DGXA 2XB2D 1PC4A 4IFYB 4MKVA 3CJTA 4CIOA 4NA1A 2XSJA 4F3QA 3D3BJ 4LRAA 2W7PA 1XR5A 4HH0A 3K5NA 3PRBA 3PJXA 1WTBA 2ABYA 4RW8A 4GVBB 2JZ5A 2K3KA 3CW2C 5HBMA 2B9XA 4G1IA 2YX4A 2M2BA 1MSWD 1SJFA 5C7PA 3EICA 1NSAA 2Y1RI 3V6KA 5C25A 1P8GA 4KE5A 4M5DA 2J0XA 1P1TA 1ZZFA 4B9NA 3CJQA 4L6V3 4WYWA 1P1LA 3S6EA 2BACA 2G0IA 2XMVA 3SYZA 3KHHA 2EXUA 4B08A 4J9MA 4B3TJ 1NK6A 3JSRA 3IWNC 4UOGA 3T5KA 3UN2A 4X4SA 2UV8A 3O3LA 2B9EA 1U2FA 4Q2LA 2G2ZA 3JTPA 4DN9A 1IQZA 4USUA 2KRBA 3PR4A 1Y7PA 2KJWA 5F41A 1WOPA 3QT5A 2HFUA 1GAOA 3T3FA 3HHKA 4I6YA 1E6VB 5HVHA 3TZWA 4ELUA 3HVWA 4LSNB 3MXHP 2P6TA 1X8DA 2Z8QA 3K89A 2DH7A 1PYSB 5D0HA 2CPEA 1F60B 3C3LA 1F9HA 1JLEA 4OYXA 4X4QA 3NCRA 3M32B 5HMZA 3C14A 1GQEA 2EKYA 4ZJLA 2Y0SD 1VGYA 1FKPB 4NEZA 4OJ3A 2CPYA 5DDPC 3UO0A 4DQQA 1U1QA 1X9SA 1U2CA 1ZYQA 4KFBB 2CPFA 2RSQA 4P9SA 2HHUA 2FLOA 3R6GB 3I31A 4UOCA 4NLUA 2QA4G 5ETVA 2BKNA 3VGUA 4CM0A 1PJ5A 2XC9A 3DLKB 3M9NB 2OI2A 3D6FB 4RJVA 1RI7A 1PYOB 4ZVQB 1S79A 2BMBA 2FDNA 2RRNA 5M2PA 3FQKA 5F8HA 3PX4A 1UEKA 2QA1A 2BJ7A 4X84A 2HWIA 4I6WA 5F8JA 4DV7J 1NK0A 5DQHA 4LVNP 2FJBB 2MQ8A 2DEIA 1TVRA 4FBUA 2WBRA 5BYRA 1YJTA 1S48A 2HQCA 3I5BA 4ANCA 3OR1A 5E0OA 5J2NB 4DR2J 2B9YA 2ZJRQ 2W2PP 2OPPA 5IFMA 1VOMA 4RX6A 2CVEA 3UQSA 2H5EA 2K1RA 5CZVA 4TQRA 1TR0A 2PEHA 2E1CA 1RHJB 2GVZB 2AEJA 2QMXA 1NKEA 1R6VA 3JS9A 5E7OB 4OYAA 1N0UA 4YHHJ 2MQQA 2VPXB 3NLCA 3Q8RB 2M4MA 1B0PA 2DHGA 3TQEA 3EYZA 3CCSS 4NRUA 1OSCA 4PABA 3T5JA 1S6QB 1WACA 1GX5A 3HVTA 3KJFB 2VONA 1VIXA 4X4UA 1T9VA 1N52B 2YQ1A 4FZVA 3OHBA 4H4MB 1TUWA 1AYEA 4K2XA 4WF9Q 1SV5B 4DR5J 2UUAJ 2MQNA 2YNGB 3GR1A 2BA9A 2FVPA 3HD2A 4DV0J 3SSQA 2ZVIA 2AJ0A 3RW7A 2R7RA 2KZMA 2VKRA 2K3IA 2YY3A 3CCQS 1M1KT 1VBXA 2DB1A 1HQ2A 3PCOB 5B09A 3AOAA 2IBOA 5A8WA 4Y00A 5G0RA 4KV8A 3T1AA 1HBNA 4IRKA 5F0WA 3K5LA 4M1KA 3NS5A 3N6LA 4MIWA 3UR0A 1N8RT 3OSNA 2DNPA 1EJ7L 4Y2MA 3DRSB 1TUGB 4AXIA 4B3TF 3NNCA 1CSJA 5C2GA 3I56S 5JVGQ 4OJHA 3G2XA 2DRBA 4JYAJ 3ZZRA 1J5OB 2RKIB 4C8NA 3IS9B 1IR1A 3CULA 3KLEB 3HK2A 1UJ5A 2IHR1 3OT9A 3MECB 2XYPB 4LVOP 2VPWB 3MD3A 4X4RA 3OVAA 2DXFA 1U1MA 3PRVA 2XLKA 1UVJA 3RBXA 5BYSA 5E3PA 3ZO7A 1R89A 1N5QA 3W8PA 5IXUA 1TP7A 2W4DA 1YJ9S 4Q7AA 4J90A 2UUCJ 4QIFA 2H1YA 1RWNB 1OS5A 3EVMA 2HZVA 4HI1A 4CYUB 4YR2A 3RW6A 3TA1A 2OPRA 1HARA 3NGSA 4LR9A 2E5LJ 5M2RA 5C5JA 3W5ZA 1HBMB 3NOGA 2DVIA 2ASYA 3O1LA 2DHXA 4IR1A 1CJTB 3R5JB 4NZ7A 2V4JA 3CJSA 1RAHB 3ENWA 2XQCA 1G6BA 3QIDA 2WZ1A 2JEJA 3JSMA 3RYLA 2IVFB 4DL4A 1BWEA 1MN7A 2BANA 5K8OA 4NASA 4F3MA 5AE2A 1XR7A 3W9JA 3PTWA 4DS4A 1U1RA 5KG7A 5FLXU 4O3PA 2BVZA 2FJVA 2BE2B 3KG4A 4CLUA 2HLTA 4I7FA 3OR2A 1H2VZ 1HBOA 4DU8A 4YFUA 2R3VA 4OZ1A 4DV7F 2Q43A 3ZTRA 3OV7A 2VPZB 1K44A 5F9NA 5DDQC 2IJNA 2NSBA 4U8VA 1TTHB 2JVRA 4ZLLA 4DR2F 1ZM4A 2NCKL 1QUPA 3VALA 3GV7B 5DGAA 3CD5A 3C19A 4WZQA 4RKUC 3JQJA 1CJKB 1VC6A 4B3MJ 1OY9A 1HD1A 4GRSA 4DPTA 2RQ4A 1D1UA 6AT1B 1WSVA 3UCGA 3H59A 4ZHRA 3BO2A 4C48A 4YHHF 2LEPA 3FRZA 2DKOB 3FFIB 1GMWD 1P6TA 1JLFA 3Q8QB 3SDEB 2VQEJ 2GFFA 4HVZA 1IKWB 3M8QA 1TL3A 1IM6A 1FA0A 1XERA 1T9UA 2X1BA 2I0XA 1U09A 2O5DA 2HAIA 3NEKA 1DLOA 1S0NA 1UVIA 3N4WA 4ZJQA 1B64A 2B43A 1BQXA 2NYHA 2AU0A 1SIWB 4MK8A 3AT1B 1WDDA 2KFNA 2ZDPA 2L41A 3TA2A 2CJYB 4ZVTB 2HQGA 2ZH4A 4DR5F 2UUAF 1NHUA 3CMAS 3IGVA 3AD7C 2KXFA 1K8AT 4IDKB 5H9FJ 4DV0F 2V34A 4DPYA 5EGYA 2AZ1A 4A46A 5F9LA 2HNYA 1RT5A 1VK3A 1OSDA 3EE3A 3R6LB 3A8JA 1HMVB 1VQOS 2KT5A 4ES2A 2V50A 4Y6IA 3G8TA 1W2IA 2FC8A 2V2ZA 2RUSA 2W4PA 1SKSA 3IMQJ 4ZLJA 4CH1A 2AQ4A 1S1UA 1NK9A 4HHJA 2YNHA 2ZH6A 1R0CB 1HLWA 2G1DA 2MTLA 4X4TA 1URNA 4UQTA 4C4WA 1VRUA 2WVCA 5ETRA 3BN7A 4JYAF 1XC9A 2NUHA 4H4OA 1B7YB 3A1YG 1YWXA 2XY6A 3IWLA 2K8GA 3AOBA 2DHSA 1S59A 2CQGA 2MJNA 3CD0A 4O0NA 2Z58B 1KHVA 4PG5A 1HL6A 2GGPB 4H4KA 3QRQA 5HJXA 1P9QC 4UF4A 2V9KA 4X2BA 3I0RA 2GQCA 3HD1A 1Q8LA 4WIIA 4ILRA 3CDEA 3Q8SB 4DSJA 4HTJA 2DNRA 3CJRA 1YRTA 2YQ0A 4KPYA 3Q83A 3E3XA 4KGKA 3BN4A 2HGMA 4ZLPA 5DDRC 3CWJA 3DU5A 3PYDA 3TNVA 4C2MA 1T9TA 3CCUS 2MKHA 2MSTA 5CCLA 1XTZA 3PHEA 2E5LF 4ZPTR 2Y3YA 1S10A 2W2NP 3IR5B 2A18A 4KH1B 4K8RA 5HLFA 1FRJA 4M5NA 1LW0A 4CLWA 1X5PA 2V4QA 2ZH3A 3UDCA 1W25A 3OVBA 1KSPA 4FYXB 1RA7A 3D0GE 2EFNA 2GIFA 1FRIA 3HZGA 3QSIA 1IR0A 1IKYA 4M95A 4EBCA 1LEOA 4EBDA 1B99A 2LXUA 3PW7A 4NI2B 2LLZA 1R8HA 4EGLA 2DHAA 3QAUA 3NBPB 3FQLA 2HFVA 3J7A1 1S9FA 3PW4A 1UWBA 2NXUA 3UWTA 2CPIA 5FD1A 3KNGA 2IAJA 4LT6A 4C0HA 1N6QA 1SQEA 4NOHA 1FCAA 2W9CB 3FDSA 2ACMA 2HFNA 3D66A 2MYFA 3ZZUA 3ZZTA 3H42A 2X1FA 2BUNA 1WI8A 2AX0A 2HGLA 4TYAA 5DRKA 1DY3A 2WAQD 1T03B 2B56A 4F25A 3QZ8A 4PUOA 4DX5A 4B9LA 1S4EA 4JI5J 4B3MF 3I5CA 2QA4S 3CC4S 2EPIA 3JAMY 2P5VA 5KFNA 1OQ3A 1T94A 3R9LA 4B9TA 3UD3P 4DN0A 1W26A 2NPIA 1FX2A 1F3FA 2VQEF 1M5PC 3GONA 5GAEU 3ETOA 2ZZTA 1J5EJ 1HI1A 2J0QD 3R97A 4DQIA 4KRWA 2JLEA 1XJWB 2MGZA 2ZHAA 5E33A 2ZBIA 5LJ5Y 4I6AA 2B4PA 3JTOA 1X5OA 1SQGA 3MEDA 4ZVHA 1HBUA 2G0CA 1TZ0A 4F67A 4M94A 2RF2B 5C24B 1NRKA 3N5BA 2HHQA 3FZBA 3MAAA 3DRRA 4P10A 2EG2A 2O3DA 1RBOB 1WG5A 2B7BB 2FVQA 1IBMJ 4HEA9 1YBUA 5HK4A 1FF2A 4JI0F 5JJBA 1X9MA 2FJDB 3CB4A 4AQYJ 2AJQA 2MZJA 2XEXA 4OX9J 2WW8A 3Q0AA 5D15A 4E0DA 4LFBJ 5CYQB 3H5SA 3LQVA 5C42B 1C1BA 4ZLNA 1SJQA 3V6JA 3HFZB 4OJ1A 3TEHB 4NLXA 2EK6A 4M5KA 3BM7A 4FYDA 3TP2A 5CCMA 1CQNA 3I5AA 2XULA 5L1LA 5L9XA 3NNAA 4AUKA 1UFLA 4WWSA 2AWZA 4RW9A 4C8MA 5M2UA 5ETKA 5KTQA 5DETA 1C4AA 1CJVA 2WBMA 2KVIA 2AIRB 2E29A 5IT0A 3I55S 4OYPA 2RH3A 2CZVC 5LXRA 3ULHA 2HIQA 4ZCLA 1D3WA 4A8SA 2IM1A 4GO5X 5DQGA 4I2QA 2AW0A 3LF0A 1NB7A 1CULB 4CP5A 4R5PA 4QPTA 5KFYA 1Y0HA 4O3RA 1WOSA 3SV4A 1GXLA 3OW2R 3GE9A 3TOQA 2OO4A 2F63A 4TVAB 1U1NA 2C3YA 1GT8A 2JC0A 1Q16B 1EETB 1FERA 3WC0A 1SC1B 4B17A 4N8NA 6FD1A 3GIIA 1ZPWX 2B5JA 3K2YA 4DS5A 3D0IE 5F8IA 4OLOA 1PKUA 4OLPA 3NXZA 2OEJA 3T1HF 1I51B 2J0SD 3M8RA 3PJ9A 1JWWA 2WSCC 3RZAA 2AF6A 2DGOA 1EP4A 3R5BA 2J7WA 1RU2A 3W9IA 4A8YA 3DLEA 3ENQA 5DO2A 2FLPA 2ATCB 2B7CB 2HMIB 2VICA 3R7BB 1U8SA 5DLFA 3CCVS 4V1Ak 2IA0A 3MCOA 1QM9A 2VU5A 3MEKA 1ZETA 1VHIA 2UUTA 2OD4A 5J2MB 2VFVA 4DZ6A 3BR9A 2B51A 4ZK7M 1KBRA 3J7AN 2CJ9A 3BV8A 3BQ1A 2A6MA 4FBTA 4KSEB 4AD6A 4HACA 4K50A 1KQGB 3SQGB 4R8UB 2XTJP 4GC7A 4W90B 5D3GA 3QRPA 1F2GA 1TKDA 1SJRA 4L3KA 4P2XA 4HDGA 2FZGB 4JI5F 4UT4A 2MQLA 1OJ4A 2PMHA 3DU6A 3M8WA 1ICEB 2KXHA 1Y9OA 3ZZZA 5LSLA 3FSYA 2GJFA 1RHQB 1NMEB 3J7YI 3BKFA 2KHCA 4MIBA 3POTB 4NZ6A 1APSA 1LWCA 4WK1A 2OLWA 1YHQS 2IM2A 1J5EF 4B3OB 1MWZA 1UFWA 1KEKA 5I42A 4OX6A 1XQIA 2K7KA 3C15A 1TU0B 2DHHA 4L3NA 4YR0A 4DSIA 1DHMA 3FEXB 4JI2J 4WCEQ 3UE2A 1QVGR 3KLGB 5L1JA 3CJ3A 1FRLA 1TL4A 2HBRB 2VQFJ 1CG2A 2OMLA 4DI6A 3O44A 4WPAA 3GLJA 1QE1A 1DTTB 1Q86T 1Q8IA 1EQMA 3C6TA 5F8NA 3KK3A 2V2KA 1IBMF 2VC1A 1RHRB 4F0KA 2ZBRA 3NY0A 4AQYF 5E3AA 5IT9U 4OX9F 1OMSA 4DL0C 1T02A 4LFBF 2L9WA 2UU9J 4MAKA 4YN3B 4D3HA 2RDJA 2A2DA 3H90A 4WKYA 4O0IA 5CXTA 5B0CA 5EWEA 3PV8A 1Z2LA 2ZH9A 1FDDA 3PIOQ 2VPYB 5KAKA 1WC4A 4N47A 2WB1D 1VBKA 1WC1A 5GAGU 2BQUA 1SH0A 2AHOB 3QO9A 1GMVA 1Y10A 5LSOA 2F4VJ 2FPHX 3MM7A 1K0VA 1QSSA 1RT1A 4O3OA 2ZE2A 3HT3A 4NEYA 1ROFA 1D09B 2CUYA 2K06A 3GMGA 3DRPB 1S0VA 1KDNA 4X4OA 3DLJA 3QWUA 4USMA 3DXSX 3KMQA 4Y0FA 2CPDA 2DPIA 2UUWA 3MM9B 3GFHA 4CLSA 2XZTB 2QMUB 1NHKL 2DGUA 3P5TL 2LMIA 5D4LA 4PG7A 2P6SA 1SC6A 5GMKa 5T7LB 2DY9A 5KFWA 2Z4PA 3RJMB 3GFZA 1F0XA 3RR7A 2DXDA 1HKAA 3MFHA 2LXIA 3N79A 2YH0A 1TKZB 5AE1A 4ID5A 2D3ZA 1X0FA 3U1NA 4Q0BA 1Y4ZB 5IV4A 1LWEB 2IC3B 2W4CA 2CAJA 4AL7A 5DG8A 3TUZC 1QAYA 1T0TV 3G8SA 5J2QA 5KFOA 1DTQB 2FTRA 2N3OA 2ZH5A 5DS7A 2NZ4A 4CO2A 1XEZA 3AHPA 3GJTB 2YPYA 2H65B 5MLCV 3J81U 1FE0A 2WVEA 2NREA 2E1PA 5JXSA 5H9FK 1XMBA 5EUHA 1RXOB 1BMQB 4ITSA 4EFAC 3X3UA 1FRHA 3U1LA 3ADAC 3VR1A 2MLXA 2N4CA 2MQPA 1HNXJ 3FGVA 3QFHA 4NLTA 1VDHA 2MKIA 1S97A 2DR8A 4BC7A 3G6YA 4LF2A 3QFWA 9RUBA 3KK1A 4L73A 1AW0A 3F41A 1JLCA 1YI2S 2QLFB 5F8MA 5AXNA 4I68A 1FEHA 2V5HG 3MMAA 1Y11A 2GZOA 3W9HA 5I4MA 2XSJB 1CC8A 3MMBA 2IBKA 4UY8T 1PC5A 2HVDA 2OIHA 4CQ1A 2A10A 1TMMA 2IDEA 2JEFA 2XGPA 4RW8B 5HBMB 3BSCA 2P2CB 3OPKA 3EJMA 2XMWA 2VBYA 3BO4A 1LW2A 1X4EA 4QR1A 4L72B 3FCWA 2DJWA 4HYKA 1MROA 5C25B 4EO8A 3G9CA 2ZOGA 4O44A 2LU1A 4I1TA 2J6UA 4AL6A 3MUTP 2MJUA 3QAEA 1RGVA 3PEJA 1JNRB 2ZOMA 3IFEA 2CYYA 1D8ZA 1Q7LB 2IJFA 2ALZA 3UDVA 2XNQA 3MURP 1XMQJ 4JI2F 4NE9C 1HPZA 4O3NA 3THPA 4K4ZA 5KFFA 3PACA 3CSKA 3PW5A 1X5TA 4PYAA 2EI5A 3BPDA 3C2PA 2VQFF 1X4BA 5DZ6A 4EBEA 1NDKA 1NCLA 2HHTA 2FGCA 1UVNA 3AB2B 4F26A 4C3LA 4WTYA 4F4XA 2RJZA 4PPZA 3AA8A 2LQ9A 4ZP7A 3HO1A 3CCZA 3C16B 4PG6A 2V8GA 5L38A 2UU9F 4LSLA 2AZ3A 5KG6A 3IG1A 4F4KA 3V81B 1JLEB 2D3O1 3GR0A 3T41A 2PA3A 4RW7A 4OI3A 3Q2SC 3C14B 1T11A 1MMDA 1SJ4P 2F4VF 5KFUA 3G82A 5KFKA 2GV1A 4Z2XA 3V4IB 1T7PA 4WU2A 4DSKA 4I69A 2HNZA 3KUGA 3LP1A 1PO6A 3HHNB 3LPYA 5D0EA 4NLGA 1YX2A 2PI5A 4J7CA 2GX8A 1SVDA 2FJWA 3TAMB 3K7RA 3PXGa 3G6XA 3I32A 2AJFE 1CS4B 3VAKA 1QVFR 4TQSA 4BCAA 1WNEA 2KG1A 5ETSA 2C3UA 3NMRA 2YH1A 1ZPVA 3BQ2A 2GQ2A 2DIUA 5T41A 3R5AA 1V5IB 1RT2A 4PWDB 3MM8A 4DBQA 3TEGA 4QR2A 2B0GA 1TVRB 1TUVA 4DCPB 4UUXA 1WD6A 2HYIB 1EQ0A 3GPAA 3MOZA 4NYPA 3KJVA 1B7FA 2H4YB 1Q79A 3K57A 3LUYA 4WFAQ 4JV5J 4YDXA 2BABA 2DTJA 4G1QA 1HNWJ 1VRQC 3PEHA 3O2IA 1VQLS 1E6YA 1NUEA 1S7HA 1NO8A 3I6PA 4FVMA 1WI6A 2VFUA 1Q81T 1IWGA 2QE5A 1PBAA 3SCLE 2WTFA 2Y0BB 4USWA 2HEKA 3HVTB 2K7JA 4O3QA 2OKQA 3DDKA 4QWEA 2DNMA 3QMQA 1HWUA 2HZCA 2J9DE 3L95X 4UTGA 4NL5A 4NXMJ 4NLWA 3H5YA 1LK5A 3MEGA 5A8KB 1WF0A 4USVA 1IKVB 5A2QY 2BW7A 1RTZA 1UP1A 1JLAA 3QT7A 4J9UE 4J9LA 1S7IA 3W1YC 4ECWA 1M1GA 4ZVRB 2EG1A 5A8WB 5G0RB 4KV8B 4XAKA 3AAWB 2J9CA 4IRCA 3NG8A 1SB6A 2CQ1A 5KFQA 1AFJA 4ZVEA 2RHQB 3NP5A 1S57A 3OHAA 3DGVA 4ENOA 2QLXA 3JXOA 3HVRA 1VIOA 4QIEA 5EHHA 1UW9A 3MFIA 1FNXH 2CQIA 2V2QA 2KB2A 5F8LA 5GAHU 5DGBA 3TVZA 4ZITA 3VAHA 1FFWB 1KP6A 1JJHA 4RNMA 3HDSA 2YPZA 4ZVUB 2YNIA 2HG4A 1WC6A 3VAGA 3M8SA 3LH2S 2CZ4A 1S12A 3D54A 3M1VA 4WFXA 1AB8A 2Y8WA 2RVJA 4OYOA 1NM2A 3DLHA 5A76A 2QL9B 4DG1A 3IM8A 4BWJA 2D74B 2DGTA 4QU7A 1CQMA 2ZH2A 1U1OA 5KFBA 1O5JA 1OPIA 1Q7YT 2RS8A 4CO3A 4EK2A 2YWFA 1VMBA 3DYAA 2OPRB 2YWKA 5L39A 2FJEB 3D6TB 2QYGA 2VG5A 3T9ZA 4F02A 3N01A 2V4JB 2Q79A 1DQ9A 3JSMB 2R8IA 2RQMA 2BANB 3LOUA 3HCXA 2BYCA 2MZ1A 3AD8C 1H74A 2D69A 4B9UA 3P5BP 1HQEA 4I7FB 3OR2B 4Y28C 2JSXA 2DR9A 3EGWB 3G71S 1HBOB 2EBEA 2QJ3A 4QZVB 5HATA 2HSEB 1Y5IB 4DR4J 3AODA 1NXIA 4Q2MA 3EVWA 1S4FA 4LF4J 2IMOA 5DZ7A 1JJCB 2MKJA 3V5RA 3EX7B 4AE5A 2F4FA 3GU0A 4JV5F 5KT7A 1N5YA 4KKOA 1WF1A 3K0JA 4M5HA 5HROA 7AT1B 1OY8A 1ZTWA 5B0BA 3DLGB 1S1VB 1T05B 1LXJA 2X3DA 1SJ3P 1NDLA 1W7WA 2EC2A 4PKDB 3BPSP 4C7QA 2I5JA 4BHQA 4RUCA 4ZHRB 2ZBPA 3D1QA 2ZJQQ 2F8HA 2UVRA 1KQKA 2U1AA 4ZIVA 2PN6A 3A3NB 2F5GA 3AFGA 3M8QB 1TAQA 1TL3B 2XHWA 1WG1A 4QW8A 2DNQA 4CNZA 2CQBA 2QL7B 1HHSA 5FDLB 4A48A 5KT6A 1N34J 5LMUJ 3GYGA 4I0WA 4NXMF 2DD8S 2V63A 2OTLS 4ED8A 2VL1A 2C2ZB 2W8LA 4OYWA 2VG6A 1L3SA 3EZ5A 4C8YA 4NLVA 1YJ7A 2FJAB 2DISA 4PPDA 2QX0A 2FHKA 2VDHA 4C3MA 3D3CJ 4KAIA 1Q1KA 1Z1ZA 3CIMA 3W5XA 5KT4A 2NS1B 1GK8A 2HNYB 2KM8B 1RT5B 2HZAA 4FXDA 4F04B 2VA2A 1NK5A 1SCJB 1G2EA 4L74A 1PSDA 3LP0B 3HJVA 3KYLA 4WP9A 3H2LA 2JLFA 1XK8A 4FF3A 1JB0C 1FDAA 4ZA1A 3KLVA 1S1UB 3DI6B 3UDEA 3JB9k 4TY8A 2FZCB 1RT7A 1VRUB 1H2UX 4K4VA 2CNOB 1ZOTA 1KVKA 1KVIA 2BV3A 1GEHA 1MG7A 3BSNA 3R5GA 5KG1A 1OY6A 2BJ3A 1X7VA 2R7SA 3R1LA 1DFDA 2QFJA 4ED0A 2Y8YA 4USIA 1JXEA 1F1BB 2HRUA 1NPRA 4DUZJ 3DLKA 2V8VA 3I0RB 1RP5A 2W2MP 1IN0A 1S49A 3AJ2A 5GAEI 2U2FA 4Q5VA 3R2CJ 2BE9B 3CUNA 2E5IA 1BWVA 4DR3J 1ZBTA 3H98A 1FD2A 3AJDA 4NLSA 2OFGX 3I4PA 4ZPBA 2D7SA 2XI3A 3M6VA 4C3KA 4IG0A 2Q6CA 2KXNB 5E3QA 2XWXA 4DV1J 3P45B 4FN5A 4IFVA 5F8GA 4LF5J 4Z37A 3P4UB 5HLFB 5K14A 1LW0B 2MLYA 2LQJA 5HANA 2VODA 1A0OB 2HQ3A 3Q24A 1HIYA 4JI1J 3MF5A 4TN2A 3GIRA 3T9NA 4XIUA 4OI1A 3KDNA 4WE1A 2ZOFA 2KT3A 1IKYB 5ETPA 1NKBA 5KFLA 2WCXA 2R9LA 3MZIA 3THVA 1QY7A 1KS2A 2GHVC 3BGRB 1UWBB 1XN9A 3RRHA 4CH0S 4DR4F 2IAJB 5KFMA 2V0NA 1X0PA 3QYYA 4QPXA 4LF4F 1RE1B 1N6QB 2V2VA 2PE8A 2ZWPA 2Z56B 3HHLA 5J1EA 4ZPAA 4K4YA 1KN6A 1FRKA 4F7VA 3WHIA 5BR8J 5FLXY 5EWFA 4RLEA 1CVJA 1R0AB 1M5VC 2AYBA 5IS2A 3CDAA 2RQCA 4X66J 2B4OA 4PUOB 5IV3A 4A47A 5JMNA 1KQFB 1ZTTA 4OZ5A 3E2EA 5LL6d 1KLMB 2GHWA 4J9PA 5J1NA 2JNJA 3I96A 4K4UA 4OZLA 2KI2A 3CCRS 2KVQE 1TQLA 2VD3A 2ASLA 2FB0A 2XO6A 1CJUA 3D9BA 3JYTA 2DNGA 1HD0A 3M4XA 2VBXA 4LF1A 2ZKTA 4UZBA 4XDCA 3QGGA 1I6JA 2Q3PA 3C66A 4LRDA 1OPZA 2ZHOA 2MGZB 2MZSA 3ZTOA 2R7TA 2YKPA 3VGTA 2D41A 5H9EK 3K17A 2W2OP 2ACYA 5HSPA 2UXDJ 4AFFA 4CO5A 4ED1A 3MEDB 5B0AA 4RNNA 3Q8UA 1N34F 4X4PA 5LMUF 2Z2MA 2CQ4A 3V4MA 4EZ9A 4DEZA 4CLLA 1F9EB 2N4DA 4J9KA 4USJC 1RTDA 1RK8A 3B4MA 3CO0P 4KO0A 4DFJA 3HFKA 3EMTA 1F5AA 4C0OC 3CCWA 3MAAB 4PQAA 4UZCA 4ED2A 1ZH5A 1KTQA 3KLEA 1FNMA 4HHUA 4YB5A 2RRBA 2RUGA 1VQNS 4WIQA 2HRYA 2R8GA 5IWAJ 2ZHBA 3MECA 4LF6F 3Q8YA 2JEIA 3RAXA 1C1BB 3PFOA 1RAFB 1IM4A 4IQXA 3OTOJ 4J5OA 3HM9A 3O8WA 4E98A 3TUPA 1VQ8S 1PYTA 1N0VC 3IC1A 1CEZA 3MM6B 3DOKB 2Y1IA 4RUHA 3PJWA 4YR3A 4DUYJ 3WX4A 2E1AA 2K2PA 1JKHA 1B70B 3TZXA 4WFBQ 2BM1A 4RW9B 2QIFA 3OJSA 1CJVB 1ZAWA 4ICLA 1HWIA 4N76A 5EN1A 3MPWA 3M6UA 4X65J 4ZCMA 1DRZA 5KOWA 4RNOA 3TQ1A 3IAM9 2HURA 3MAQA 4NXNJ 4I2QB 1S76D 3MCNA 3W64A 1G4CA 4L76A 2FZKB 4DUZF 3HKZD 1WC0A 1WHYA 1WKKA 4RBTA 2LEBA 3KLHA 1FWLA 4MJKA 2GJ2A 1RYRA 1V6HA 2M7SA 4DR3F 2HS3A 1EIYB 2BJ1A 2O01C 3HSDA 3ENAA 4U7UK 1UVKA 4IOCQ 1R8BA 3K5MA 3BKTA 1NDPA 3CVKA 1FD8A 4M5MA 5KG2A 5AXKA 2B5JB 3KLIA 3IP0A 2R42A 5AXMA 2XYHB 4PQUA 1RAOA 3K59A 4DV1F 4LQ3A 3ICLA 5HVGA 4L75A 3BGUA 4LF5F 3OQ2A 3KK2A 1NJZA 1EP4B 2CWKA 4EUVA 5LMNJ 3DKDA 2OSRA 2R8HA 3AXMA 5BXIA 4M5IA 1FDNA 1BE4A 1CJKA 2RMLA 4OYZA 4S0MA 3P3DA 1AUSL 4HLBA 5IC6B 2XCPA 2QFIA 4PXCA 1IBLJ 4FF2A 2CQPA 1T3OA 3AXKA 1L3UA 4CT9A 5GAGI 1F2HA 5JVHQ 1NLKL 1RHUB 4FDFA 2HK2A 1IKWA 4MH8A 4N5SA 4B3RJ 2OPQA 2M52A 3GP9A 2QN6B 1HWJA 4K7QA 2W9AA 5BR8F 2CDRB 2ASJA 1AROP 2BBEA 2BQRA 4MT1A 1RJJA 3QSYB 2A0FB 2QMWA 2FVSA 5D3GB 1R43A 4X66F 1NJIT 1RLCL 3CCTA 4LUBA 1PJ6A 1YZ6A 2LVWA 2VA3A 5EX0A 2BOAA 2J7KA 2RE1A 2BRKA 2PA8D 3JSBA 3FBFA 3SZ2A 2B6AB 2M8HA 3TRGA 1K9MT 3KXDA 1LWCB 1VJWA 4ETZA 4XPCA 4FNHA 2LQBA 5I42B 2RB7A 2V69A 1HMVA 3TJAA 1G7CB 4MKAA 3C15B 1SXLA 1HHTP 2DT9A 2UXDF 2ILYA 4NA2A 4AT1B 5U47A 3RB0A 3FEYB 4NMXA 4PG4A 4QOTA 2AGPA 2VFTA 1BXNA 2BJDA 3LW5C 3IR7B 2C22A 2H3EB 3NS6A 3PO5A 2HBYB 1QE1B 1H6KX 1FT8A 1HR0J 3C6TB 3VAMA 2H5IB 2QL5B 3KK3B 1IJEB 5IWAF 4Q45A 3KJQB 1R7IA 1GH8A 1EKSA 3LWLA 2CQDA 4RW4A 3KDOA 1Y3KA 2YXLA 3EGZA 2GGPA 2UP1A 1RWKB 4Z7CA 1WDTA 4ETXA 3UD4P 3OTOF 4OHZA 5AE3A 3I9V9 1P27B 2R7UA 2HFSA 2CQ0A 2VG7A 1BQMA 2BX6A 3QJJA 6FDRA 4QIWD 4DUYF 3QO9B 4DL3A 3VVUA 4DX7A 3GWCA 2DY1A 1AUDA 2YTCA 2ZE2B 1HNZJ 3MCMA 2M0GB 5J2PA 2W2QP 3DRXA 4QIGA 1NPPA 2WK4A 4C9DA 2E1MC 3SFGA 4KQZA 1IVZA 5HAOA 1SH3A 2CQ3A 4RZRA 1AFIA 2WONA 4X65F 5KFHA 3HMJG 1HNVA 3T5LA 4NXNF 1B3TA 2YWHA 3TUJC 1BLUA 2WSFC 1D9FA 2MKYA 1GTEA 4FVCA 3VAJA 3U7JA 2LA6A 3MR7A 4PEOA 2VASA 3DLBA 4DFPA 3IBFB 4K4WA 2XYGB 3EXYA 4LF7J 4ID5B 2MLZA 3QPIA 4NYZA 1RTIA 4Q0BB 3BGFA 3E8OA 5KG5A 2HVHA 3NGUA 3AOCA 1R8PA 2L9NA 5LT5A 2XO7A 3J81j 4F3OA 1UCNA 2DEJA 1F9FA 3ONQA 2LYVA 4B3SJ 3HVAA 2CNKB 3ZZOA 5LMNF 3JTNA 3O6QA 3CJ8A 4MIAA 4DL2A 3M6XA 3ITHA 3BQ0A 1FWKA 2XMAA 1RT6B 5DM7Q 1RTHA 2COLA 3ILLA 1VJQA 1F5CA 1NZ8A 3TUIC 4XDDA 2GMLA 3DN9A 5A8RB 1QUVA 2DNNA 4KPCA 1IBLF 2WVFA 1S77D 3VQSA 3BR8A 3H4BA 1VQ6S 3OTBA 3F73A 4X4VA 3KK1B 1FTRA 2JH3A 3S01A 2GO8A 1JLCB 2HWHA 4B3RF 2ZFHA 3W3SA 2MQOA 1HNIA 3B82A 4ZDNA 5T14A 4EYIB 2E1RA 3DHWC 3MMAB 4YUDA 3W61A 4ES3A 2V8HA 1JLQA 4OYMA 1BUXA 3LP2A 4LBIA 4CLKA 2QLWA 3MMBB 2X51A 4ED7A 2XZDB 3UDLA 4OHXA 4OZ2A 3DMJA 1RWXB 1RU1A 2RF2A 5C24A 1NPKA 4P2SA 2JC1A 1LW2B 1OYDA 2ZZMA 4WTOB 1MLAA 2DR7A 1MROB 1K0TA 1D8YA 4TLRA 1TMJA 4O44B 2M3DA 2JVOA 1R3NA 1JX4A 5D4NA 2OEKA 1PGZA 2F9JA 5E41A 3N6NA 5KT2A 3VGVA 4KB7A 2BJ9A 1JIHA 5BYQA 2KM8C 2ASDA 3CPWR 1RACB 2QTWA 1HPZB 3R2DJ 3A3OB 3TYTA 3DNCA 2XS5A 5AXLA 3R5DA 4ELTA 2YKQA 2HRTA 2OFHX 5B08A 1AZSA 1GTHA 2WHOA 3L9ZA 2NLWA 2DIVA 3CJ2A 3TWZA 1FHTA 3CCES 2Q66A 2C2KB 1IKXA 1VLOA 1HR0F 1SC4B 4LR8A 5LOQA 2KFYA 3QNWB 3NS7B 2R4FA 3NL0A 3G86A 3VAFA 4HR2A 1UA0A 3I0SA 3H40A 4GKKJ 4DJBA 3BJYA 3Q8PB 3M9OB 3H2VE 4LSLB 5K5MA 4N41A 1AXQA 1UKUA 3IG1B 2VJVA 1RBLA 3B6BA 3IO1A 3GYNA 1Q5VA 3ILOA 2IVMA 3TX0A 4I2PB 4H4KC 1NB2A 4RW7B 4FXWA 3NGKA 4MFBA 3MCSA 1EETA 3BBBA 3G82B 1YZ7A 4PG8A 1HNZF 1RWOB 1YBAA 4EU0A 1FK9A 4XTTA 5IT9Y 5GADU 1JMTA 4DV4J 2HNZB 3D5MA 4CH7A 2CIMA 2KT2A 3LP1B 2WOMB 1RAAB 4C0BA 3MUVP 4F2SA 3M9MB 1S9GB 3R1HA 3L7OA 3TJ8A 3SCKE 4Y65A 2GS8A 1EKRA 4F2RA 3K58A 4DFKA 3ELHA 3PNIA 3ZNJ1 4JI6J 3WC2A 5A6PA 2MB0B 4BLGA 2D1CA 3A12A 2ZKUA 2JOQA 4KTQA 3GQCA 4LF7F 4B9VA 3SBMA 2GVDB 2RRAA 5GVQA 5A0YA 5IQ6A 2GJIA 1RT2B 2OSQA 3MM8B 2H9ZA 3T19A 4ECSA 3ZTQA 2HFZA 5GAHI 1SL1A 4ECYA 3DOMA 3KLFB 4ECUA 3KJVB 2YNFA 3CC7S 3OUYA 3N6MA 2HQIA 4F4YA 4ID8A 1YJNS 3GB0A 2ROEA 3SQGA 2Z2YB 4B3SF 2LECA 1JJ4A 1R8AA 3AY0A 4F4AA 1MNEA 1S6OA 4G1QB 3IAS9 3VZIA 2A6OA 3MPYA 4ZPVR 1QTNB 2DRDA 1YDLA 1RLDA 2OJ3A 1O0PA 3ILJA 4OI0A 4KY3A 2DNHA 4NCGA 3OFGA 4RNFA 1E6YB 5ITHA 2H54B 1H7WA 5KFJA 2PO4A 3CCLS 2V6AA 4LF8J 2ZD1A 1S1TA 1S5ZA 1RT4A 2ADCA 2CXEA 3MMCA 2MKCA 2V4RA 1FXRA 5KFXA 2MHEA 3POTA 3J81Y 2FC9A 4TU8A 4B9MA 2Y1LB 3HPOA 5CYMA 2W25A 1C0UA 3BGOP 4R0JA 1X31C 3KWMA 4RO0A 4URGA 3B54A 1RWMB 1FESA 2VBZA 2UUCF 3KLGA 1UFKA 1RHKB 4KR0B 4ECRA 1UPMB 3VV2B 2RILA 3F0NA 3RU0A 4Q8EA 1JLAB 3AA9A 3VQTA 5FJ4A 2BKPA 1NHVA 3UN3A 2UVWA 2C28A 2EFGA 1S6PB 3GIMA 3SV3A 2LDIA 4FXVA 3DLLQ 3QJLA 1WEXA 2RDDA 2PC6A 2AX1A 3ET6A 2E7WA 3U1MA 1QLNA 5KFCA 2EBGA 4G6VB 4ED3A 3ZC4A 1C0TA 1S1WB 1R6YA 2GO9A 1VQSA 3F56A 3Q8VA 2AT1B 2YWGA 1QAXA 5K20B 1UAWA 2J0WA 4C8LA 1NEEA 4NLOA 4R25A 1JQGA 5I3UB 1YRUA 2X3GA 1HYSA 3TA0A 4DF8A 3W2WB 2B8QA 1TV6A 5RUBA 2YNIB 4KT0C 2IMWP 4C6AA 4M5LA 1DARA 4GKKF 1ZM2A 1VQ7S 4DCJB 4DX8H 1U0HB 5HJYA 1GXUA 3H0PA 5T7LA 3JSYA 4A8MP 2O67A 3BREA 2MDAA 4WJBA 2DRAA 2YWEA 4DQPA 2KL8A 4JV2A 1TKZA 1YJUA 3SI8A 4IH6A 1T95A 3J80U 1TK0A 2CPXA 4LIWA 3DYAB 3HHLD 4PWWA 3WX8A 4XPEA 4DV4F 2IM3A 3HJFA 2GHPA 3PKYA 1DTQA 1VRTA 1SIZA 2VG5B 4WFYA 5B0FA 3LGMA 4DFMA 4JBCA 1T9WA 1W2BR 4OV1A 2ZH8A 2M8DB 3CEDA 3OXLA 5E2QA 4CTAA 2DGVA 1TKTA 4DV5J 4JI6F 2DGWA 4TY9A 4NX9A 2VOOA 2EW9A 3M2UA 1L3VA 3QATA 1WKJA 2VB6A 3K8VA 3ZTSA 3GSDA 2G4BA 2QRRA 5A2QU 2J5AA 2ZC4A 1U1KA 4LREA 1RYSA 3IRXA 3OVSA 2DNLA 5HN0A 3MHYA 4IOBA 4O3SA 4HDHA 3Q23A 4B9SA 4RNHA 4TU7A 3MD1A 2AJ4A 3Q2TC 2ZZNA 1YK9A 1N5YB 4KKOB 4QWBA 3C6UB 2ROGA 1LXNA 1M5OC 5HROB 2P8IA 1R8CA 1ELOA 4AL5A 3PYFA 3RAQA 4I67A 3PKMA 3SSSA 3D0HE 5KFGA 1KQSR 3NOCA 3BBFA 4JOUA 2I5JB 3IWXA 3HLUA 2QGFB 4LF8F 1VFJA 5KFEA 3M7VA 5HMYA 5FIIA 4USHA 4D3GA 3NMAA 3GV5B 1LFWA 2YWWA 3K5OA 1Z4UA 1N4LA 5K8PA 4X4NA 3RB6A 1FE4A 5HP1A 3RRGA 1YLXA 3NWGA 4YS2A 1WOOA 3UFCX 4HTIA 3U27A 2IIHA 1WELA 2CNLB 4FYWB 4NYOA 3GJRB 1RAJA 3DHXA 4OI4A 2B3TB 5CD4A 4CCHA 2VG6B 2G2OA 1XNRJ 3SXLA 3PO4A 2ADBA 1RISA 2HHXA 4DV6J 4CO0A 1HI8A 2AEMA 5KFIA 2CJXB 1VS3A 2UXCJ 1RQ0A 2HGNA 1M1HA 3VAIA 3NAIA 2IFXA 1FKOA 2C3MA 4W4MA 4YY3J 2FVRA 1FVSA 3C16A 2XCAA 1QDUB 5SUHA 3BZQA 1VK8A 2V8PA 4ZPWR 2WSEC 1TKXA 5I3PA 3M2RB 4J9OA 3L7PA 1VCTA 3ZZ0A 3V81A 4WP8A 3OXGA 2W7OA 3IM9A 2LFVA 4TNOA 3R5CA 4TY8B 2DNOA 1KRPA 3P49B 2YX1A 3DOLB 5IZHA 4P52A 2E9ZA 1RT7B 2G1HA 3TI0A 4YDDB 4ECZA 1WC5A 2FYXA 3A8KA 3V4IA 2DBBA 3CMES 2CQCA 3KHRA 2VKZG 3CJKA 1MWYA 3OLAA 1UETA 1GFWB 1VBZA 1Q82T 3PHTA 2ATLA 2CA9A 5KOXA 1YKWA 3QWPA 3TAMA 4OIXA 3W60A 3EGVA 5D6GA 1SI9A 1EHWA 2PIIA 1UTAA 1CS4A 4IRDA 3NRBA 3GFYA 5J1PA 2WVDA 3ISND 1KOOA 4KGXB 2ZC3A 4DF4A 3DDIA 1QTMA 2QEXS 2WVBA 2VOPA 4OX7A 3BB5A 3UW1A 2J7UA 1MU2A 3MEEB 3QGPA 4PWDA 1REVA 1NZAA 3M2VA 2DNYA 3KKFA 2ZH1A 2C2EA 4IG0B 5HQMA 3PVXA 1FRXA 2RHSB 2EWHA 4NLYA 3E01B 3W7BA 5HMXA 1BHNA 4IFVB 2XM3A 3HSGA 2JFDA 1S1XA 4N7TA 1KFSA 5K14B 3RBDA 1NBEB 2L08A 3FMBA 4QBUA 3FZ2A 2R7OA 4USKA 2BM0A 5THWA 4K59A 2VFRA 5EDWA 4WE1B 2W9BB 4DV5F 2O1PA 4LSZB 3CJ4A 2AKWB 4Y3CA 4DR7J 5D77A 1KC8T 4WZMA 4C97A 2AJ2A 1ZAXA 3W65A 4PYDA 2JWNA 3AQOA 4ZVPB 5E5NA 3H5XA 2YKNB 4EWTA 4DPOA 1RA6A 1PAUB 2HQDA 3HHLB 5J1EB 5CYJA 3WZ0A 2MXYA 3US5A 2WRMA 1WUUA 2PMZD 3M30A 4HT5A 4F50A 5HQLA 5KFAA 4F0HA 2HFOA 1U0SA 2CVIA 3PY8A 2F7VA 5A8KA 3IRWP 2EEYA 4WP3A 1IKVA 4K4TA 1HQUA 1VR6A 4KHMA 4PCQA 1CJUB 3JYTB 5D4PA 4C8KA 3IXQA 3H25A 1J2VA 3A4TA 3UCUP 4BC9A 2BRLA 1QSLA 1KLNA 4RW6B 2GAHC 5D8HB 5AT1B 1JJ2R 2XY5A 2E7VA 2GMJA 2AYGA 4K4XA 3KMSA 2KFZA 4HKQA 3CCJS 1XR6A 3RUBL 1M0SA 3DM2A 1VQPS 5HMWA 4KH0B 4IG3A 4J9VA 2YKMB 4WYLA 1S99A 1IBKJ 2HKEA 2HNDA 1FXLA 3NGRA 1JLGA 1RTDB 5CH7B 2CJKA 1XNRF 4OYBA 2QG9B 3TANA 2APOA 3OL7A 2LP4A 4KO0B 4AXJA 4DV6F 4RU9A 4WK3A 2NPFA 2WW4A 3BGLA 1WHXA 1S9EB 1D9DA 4PXDA 3M8YA 4IH5A 1IBCB 3MWBA 2UXCF 4ZOSA 4LRBA 4O4GA 4YY3F 4ZPDA 2RQKA 3QBCA 4ZKAA 4G65A 3HP6A 2ZUAA 3NCQA 4ZN1A 2MKSA 3GV8B 4FKYA 4LF9J 2BR0A 2N82B 1NH7A 3CC2S 2HWTA 2LEAA 3TO8A 1WEYA 5KFVA 1T9YA 3FK4A 3QIPA 1S0MA 3LGHA 1JKHB 3HZEA 1SUQA 1U48A 1X4GA 4FYYB 3QZ7A 2EFPA 2XMTA 3DXBA 2E66A 2IYIA 1UVLA 4RUAA 4A8OA 3BEGB 4ICLB 3MAHA 1U24A 3CIZA 3LANA 2CPHA 3H2UB 1RHMB 2DO4A 3MTJA 1YITS 2KG0A 1TAUA 4ZP6A 5DM6Q 1HI0P 1EB0A 1NNDA 1H2TZ 2LQ8A 3KLHB 3OLBA 2X7IA 1NKCA 4CLYA 4CLZA 1Q8KA 2JHEA 4ILLA 2R2UA 2C3OA 3R7SB 3CE8A 4M5DB 1OO0B 2B9WA 2ILZA 4DLEA 3BS9A 2MY7A 3KLIB 4ZJOA 3LAKA 3OJUA 3EDQB 3D67A 1FDBA 3RBEA 2KTQA 4PQUB 4WBFA 4QYZJ 1Z2ZA 2JL9A 3N5FA 1FTCA 1K1SA 2JRSA 1XWLA 3HI9A 4IH7A 4UW2A 3KK2B 4U95A 1T9XA 3S7RA 4NLDA 4A8KA 3PW2A 1K47A 1LK7A 3QLHA 3DFEA 4ANDA 4CLTA 1BQNA 1RTJA 1M90T 3THTA 7FD1A 4KIAA 3DLGA 1S1VA 1YJWS 1T05A 2V94A 5DJBA 2CQHA 2EFQA 4DR7F 2C2RA 2KKHA 1N36J 4RBVA 1OQ6A 1VQ9S 2OH2A 4EMDA 3IGNA 1U49A 3BDEA 2XNRA 3TAPA 3LAMA 1TELA 3MI7X 3ISZA 2OPQB 1U47A 2KO1A 4V19J 1SPBP 2E7XA 5ETMA 3DCAA 5FDLA 4OZNA 4I56A 4FYVB 5IM0A 2OD6A 2RU3A 2FLNA 5JUMA 3HXMA 3H4DA 5H9EJ 1V5VA 1QAJA 4CLFA 3I87A 2IVYA 1TL5A 4LRCA 3X1LB 4ED5A 2N7YA 4K0KJ 4FPRA 1LWFA 4KHPJ 4ED6A 3GG1A 2R2TA 3UVJA 3KTQA 4U7CA 2LA4A 1YQHA 4CO4A 2ZEJA 2BDPA 2UV8G 4JI0J 4DR1J 3BKUA 1DZ5A 3B8HA 3WIUA 3KG1A 1R0BG 2CG4A 3T5HA 3LP0A 3DRYA 4OHWA 9ATCB 3B78A 2G13A 5CAAA 1VHFA 3LTOA 1I1GA 3D1OA 1Q0NA 2R8KA 3DGPA 3TW0A 4UOFA 3FCHA 4IR9A 4GKJJ 4CT8A 3DI6A 2MY8A 3BF4A 4OZ0A 4H54A 1IBKF 1WHVA 2OPSA 4X64J 2FGOA 1LNQA 2FY8A 4KGZB 3MPDA 4N56A 3M8PA 2Z2ZA 3MM5A 3SSRA 1C1CA 3J7ZT 3CNQP 1RKIA 3OR1B 1RWPB 4RPFA 4RW4B 4ECTA 3CJ0A 2M9KA 3M8ZA 4DL6A 4LBPA 5B0GA 2HQFA 2OPPB 1A6LA 2ZNYA 3MPVA 4C11A 1VQ4S 2K1RB 4LF9F 2QZ8A 2FLLA 1TL1A 1WEZA 1JNZB 1TL7A 2VG7B 1BQMB 1ZM9A 1HNXF 4N77A 4ZIWA 1FFSB 3EZOA 3QJPA 1T8EA 4DUTA 4QWAA 3G6ES 4A8XA 4W98A 2PGCA 5I3QA 2R7VA 1H73A 1HA1A 1QSYA 2RS2A 5J2PB 3QT8A 5LXYA 2KU7A 4QWDA 4M8LA 2F8EX 3ZFVA 2J9DA 3T1HJ 2WONB 3KUHA 4TLQA 1H98A 1RABB 4YP3A 4NCAA 1HNVB 3S1TA 1GX6A 2DYAA 2NXNA 3OBIA 4FNIA 4E2FB 2ZJPQ 2QV6A 3OL8A 2DO0A 3CDUA 2HVEA 2GAGC 3OTEA 1MWQA 5CA5A 1BY9A 2OMOA 5EWGA 4MKBA 3EGNA 4CRJA 2MEWA 1PJ7A 2AMCB 1WG4A 2MQMA 1WJ9A 1R31A 4ERDA 3FKBA 3HULA 1L3TA 4EEYA 1JLBA 3BGRA 1RTIB 4RBUA 1FRMA 2HK3A 1YJVA 1UEVA 3OFEA 4F4WA 2KH9A 4V19X 1HBNB 1Y00A 3EDRB 3SFUA 3N28A 1PAEX 3L09A 3D2WA 2P9EA 3TJ9A 1Y3JA 3W66A 1XMQF 2E5GA 1R0AA 3ITHB 1CPZA 1N48A 1KLMA 1RTHB 4KJIA 4UY85 2E44A 1NJYA 2IRYA 1H38A 1UMJA 1FI4A 4IO1A 1ZZNA 1N36F 3W2VA 3K5PA 3D28A 4HL9A 2IPOB 4HI2A 1O6XA 5L9NA 4MYTA 1QJHA 4LJMA 2IRUA 2D9PA 4G1PA 4PRFA 3V6DA 1RT3A 3FMWA 3UPFA 1RKJA 3FEZA 1HNIB 5GADI 4NRTA 1JLQB 4OMFG 3CTRA 1P9YA 3LP2B 1BD6A 4MK9A 1YSJA 1AA1B 4DPXA 3DMJB 1SL2A 2WB4A 3A13A 2C1EB 1B0VA 2HHSA 2R7XA 1N56A 4K0KF 4KHPF 1FJ7A 3KHGA 1N5TA 4GVLA 4X62J 1RBAA 2VUGA 1KWMA 4NPOA 2DXEA 5L46A 4C98A 1VBYA 5ETQA 1V3ZA 2B8PA 4DR1F 1H72C 3QRRA 5F0UA 2ZBQA 2JJ4D 2HIYA 2J76E 5IT4A 2ZNZA 1R27B 4WKRA 5KFTA 3G6VA 4GKJF 4DWIA 3MM6A 3DOKA 4JUZA 4A8FA 2IY5B 4N8OA 1AZSB 4Y2AA 4FKXA 3KJNB 2DGQA 4X64F 3M6WA 4QR0A 3HSJA 1U7LA 1IKXB 2OGUA 1DAXA 5CABA 4P75A 4DV3J 4CO1A 1KNZA 4LQ9A 3OXFA 2IRXA 4O4RA 3I0SB 1PG5B 3PFEA 5LJ3Y 4IFYA 3FBCA 1HNWF 4OZJA 4URQU 4RWXA 4PAAA 4NLPA 1U02A 1T3NA 4CZCA 2X1AA 2C42A 3D7SB 4MKYA 3CO9A 3P96A 2IYGA 4DR6J 4GVBA 3QT6A 4MFBB 3A8EA 4BDPA 1G3OA 1NK7A 2P9CA 2QLJB 3P8BB 5F3TA 1N5VA 4DDFA 2Q6BA 4F36A 4JI8J 2X1GA 1FK9B 4ATNA 1JLFB 4Q8FA 5IQQA 2PEBA 3GIJA 1NSPA 4K4SA 2BJEA 1JK9B 3W5YA 2LCWA 3UCZP 2CJQA 5C2CA 3OSPA 3A8IA 3FSXA 1DLOB 1N54B 3AH6A 3J7Z5 1BC6A 2MZQA 2RU9A 3MDFA 1NH8A 1IJFB 2BEFA 4WFNQ 1HW9A 3MTKA 1ZA1B 4JP8A 3E51A 4B02A 1FX4A 3HHDA 1URRA 4FP9A 4R0EA 2BKOA 1ZM3A 5ETTA 1U1PA 5A0YB 2AP6A 2E5HA 4Z7YA 2DCLA 2NXJA 1E6VA 3LWMA 1X4HA 1I3OB 4LSNA 4U9RA 4QIVA 3GJSB 3UNGC 3GFXA 1RCXB 4WFZA 1KOHA 2HPUA 3DOMB 5DG9A 2XG8A 3EUNA 2YNFB 4I64A 3OUYB 5DQIA 4C8ZA 5L1IA 5ADZA 1IXKA 1FWPA 1S0OA 1YG0A 2B4VA 2YNHB 3M32A 7FDRA 4DXLA 1Q78A 1FFGB 3HHLC 2VC0A 5D0GA 1X60A 3RBZA 4E8UA 4P7TA 2I8EA 1FKPA 4H4OB 4NCGB 2LDYA 2XMUA 2B4UA 3R8YA 2PMWA 1YVFA 2F1FA 2ZD1B 1K1QA 1S1TB 1RT4B 2AEFA 2B6AA 3MMCB 2W7AA 4TU9A 8RUCA 2RIJA 2XWYA 3NWRA 4KFBA 2ZH7A 1N33J 2ERRA 2XBPA 3TX8A 5A6WA 4CI0B 4DCOB 2C3PA 2PSZA 4K2JA 4RWWA 4WXOA 4DQRA 5CYMB 1C0UB 4A4JA 3EXCX 2YQ3A 2FHJA 1EAYC 1CC7A 5KG3A 5E3RA 4DX6A 2LXFA 2J9EA 1NJXA 4DPWA 2J6TA 3SMZA 2BW2A 1VC5A 4ZP8A 2XMMA 1U2RA 4JI7J 1RWUA 1ZAVA 3PR5B 3MR2A 1FJCA 4X62F 1U25A 3SCJE 2QSFA 3MPUB 4OJGA 1EX8A 1Q95G 4CM2A 3CDBA 4HT7A 4DPUA 2VJUA 1M5SA 3KG0A 5J2NA 2J8AA 2DPJA 3ILIA 3TVYA 1L5UA 5KT3A 2BZ2A 2YVSA 3ET6B 5D4OA 1MMNA 1NSQA 2QLBB 3GG0A 4QW9A 2FUG9 2DITA 3JQMA 2DR6A 4ZCIA 5HVFA 1X4CA 4DL7A 1VC0A 2YX7A 2V9WA 2BJ8A 4QYZK 3NKYA 1C0TB 4P7VA 2GVZA 1UEUA 3MMJA 2F9DA 3NGTA 4LRFA 3BDPA 1FJGJ 1C2PA 2VZ9A 3UNYA 2DK2A 5KFSA 4NLQA 3SCIE 1MW7A 4DZDA 2E9TA 5KFRA 1Q8BA 2HLUA 3D1HA 4Q44A 1HYSB 2G9OA 1KFDA 1XBWA 1TV6B 1S6QA 4NWBA 1KVJA 1U6FA 4YOEA 2H48B 1XNQJ 4DV3F 3B4DA 2G0JA 2XGQA 2HHPA 5KG4A 2V67A 4ECQA 4H4MA 1NJWA 1LQ9A 1REGX 1SBRA 3BYRA 3OFHA 1SV5A 2CPZA 1Y5LB 4YQWA 5HQ8A 4A8WA 2YNGA 4DR6F 3GIKA 3QGHA 4BWMA 3ZNUA 1SC3B 1GMUA 4DSEA 3EM1A 3VZHA 1YJRA 3OD2A 3H7HB 2VH7A 4YB1P 2IJRA 4XO0A 4JI8F 3EPIA 1ULRA 3OL6A 1EARA 1VRTB 5DDOC 1UJ4A 3M05A 1K73T 3GSIA 2OHDA 2L48A 2NYIA 2DNKA 3I82A 1YGYA 3DRSA 1VQYA 5CZXA 4F0MA 1JXLA 2BXJA 1HBUB 4XK8C 2R2SA 2OP5A 4URSA 4P71A 4CTAB 1TKTB 1WC3A 1RT6A 3SQOP 2Z57B 1NK4A 1X4AA 2L9DA 1J5OA 1WKLA 2RKIA 3M2UB 4EZ6A 3IS9A 1A7GE 4U96A 3DRRB 3BO3A 5A8RA 5B0DA 3L4BC 4ZVSB 3Q86A 4IUFA 3IRXB 4J9NA 2HAFA 3NNHA 3ISNC 1WWHA 2Y9HA 2FHOB 2CQ2A 4Y2IA 4LFAJ 4QCLA 1I94J 4RU2A 2DR5A 4Y2CA 1N32J 3T6BA 4QU6A 3FRYA 4UUWA 2MZTA 3FCVA 3VVTA 3D6HB 5K9FA 1JXVA 5H1SV 1UZDA 2EKNA 2GC8A 4CYUA 1LKZA 1VI7A 3Q22A 1NU4A 1HBMA 2VHGA 1N33F 2VFSA 3PZPA 1CJTA 5B0EA 1MMLA 4U8YA 4LR7A 4K5RA 4YMEA 2M5YA 1N5SA 4R5PB 2LU2A 5HP1B 2VDIA 3QGIA 1F3VA 3PRDA 3BH7B 4ES1A 3GCWP 2BE2A 4J9RA 4JV1A 1FXDA 2ZM6J 4IOAQ 3FC9A 4JI7F 1X4DA 3KHLA 3JAMU 2Y1JA 2RT3A 2XHCA 2PDAA 1O8BA 2KHDA 4EYHB 1FKOB 2C2DA 2Z0GA 2F65A 5ETNA 4JI1F 2KYXA 2JEGA 4KYZA 3DLEB 1TKXB 2R7QA 2PT0A 4P2MA 2YKAA 1SKWA 3IBWA 1RCOB 1IWAA 2NSCA 5ETOA 3A3PB 1LV5A 4I2PA 4TYBA 3FBBA 1WSRA 4QWCA 3D4JA 3WIVA 4LMZA 3C8YA 1PIEA 1FJGF 3MUMP 3FFIA 1RZMA 2N7CA 3HFVA 1U6ZA 2POKA 3SDEA 4ELVA 2PD1A 5BJRA 4OFZA 4ZVFA 1NAQA 3ZZYA 1OIAA 2XZWA 3AQPA 2HBQB 2HVIA 1NK8A 4YB6A 3T6JA 1XNQF 2XLJA 2WOMA 2V68A 3OL9A 3IA0A 4HACB 3CJKB 1RUSA 2DH9A 1S9GA 3FBEA 1G1XA 1V3RA 2OELA 1RB0A 3VWSA 5E3CA 3RG6A 4J9QA 3FUYA 2JX2A 2YKOA 1ZS6A 2SXLA 3ENVA 2UUBJ 2FQQB 1FO1A 2MZRA 3N9UC 3O5TB 4P2FA 1L3KA 1S72S 4IDKA 2GVDA 5LM7E 1MU2B 2HW3A 1HWLA 1V3SA 1REVB 1PBUA 3M2VB 2GQQA 4RUBA 4JI3J 4MK7A 1TK5A 2J6SA 3BSAA 3CDWA 2N3LA 3KLFA 3CJ5A 3CMQA 4OYIA 1S1XB 3P6YC 4MTPA 2I6WA 8ATCB 2BOPA 2GCFA 4OX8A 4CNYA 2BE7D 4DL5A 2HVZA 3J80Y 3FJ2A 4DU7A 4JB8B 2OUGA 2DGSA 4LIRA 2IA6A 2KZZA 1UL3A 2ZITA 3GCXP 2R8JA 4DV2J 4LFCJ 3IN5A 3KUEA 2MHNA 1KD1T 4ALZA 2CRLA 2G2YA 1F6TA 3UD5A 3R3TA 1V9OA 2M70A 1TFWA 3RTVA 2QC3A 4IO9Q 1YBTA 4LFAF 1HHQA 1I94F 2GNKA 2KRRA 3DC2A 1S6UA 1N32F 3AB4B 3G87A 4NLRA 1LOUA 3M30B 2M88A 2Q1LA 4U67Q 2CPJA 1KTVA 1D9AA 4AYBD 2VIHA 3MM7B 2Z30B 3PW0A 1RT1B 4J9SA 2AYEA 1WTFA 1HQUB 2ROPA 2F8MA 3PDNA 4J91A 1CLFA 5G4DA 1UJ6A 1WORA 2W24A 2XLIA 2P9GA 3FVYA 4QYRA 4DLGA 1DJ0A 2JLGA 2KN4A 3TVKA 1TFYA 3R7NB 1VQKS 2QA2A 4DSLA 3RRKA 1S6PA 2OEMA 5LSRA 3HKWA 3KOAA 4OL8A 2KYZA 4W92B 1UZHA 3D68A 3OTCA 2I38A 5F3ZA 4DHVA 3LA0A 2NXCA 1SL0A 1RWWB 1VISA 1MN9A 3DM2B 1M5KC 4LBHA 3W63A 4IG3B 4NI2A 3CD6S 3I9ZA 3NBPA
chains in the Genus database with same CATH topology
2HFNA 1S1WA 2MYFA 3ZZUA 3ZZTA 4U6PA 4K4UA 4OZLA 2DCUB 2CKWA 2KI2A 5K8NA 3MR3A 3FSIA 3CCRS 2X1FA 2BUNA 2HNDB 1JJ2R 2F40A 1FNOA 2ZVSA 1TQLA 1WI8A 1JLGB 2AX0A 2ZM6F 2VD3A 2ASLA 2HGLA 2XY5A 2FB0A 2DNZA 2GMJA 4TYAA 2AYGA 4K4XA 2XMKA 3KMSA 1A9NB 3JYTA 2KFZA 2DNGA 5DRKA 2WAQD 1T03B 2B56A 4F25A 3QZ8A 1HD0A 4HKQA 3M4XA 5I3UA 2VBXA 4PUOA 5J2QB 3CCJS 1XR6A 3VF0B 2ZKTA 4XDCA 3W2WA 2FJXA 1M0SA 4B9LA 3DM2A 1VQPS 5KFZA 3QGGA 2KDOA 2XMJA 1I6JA 4C8OA 2Q3PA 5HMWA 3C66A 4IG3A 4B3MF 2W9CA 4K5SA 2YKMB 4WYLA 1S99A 2MPUA 1OPZA 2ZHOA 3HF5A 4DOZA 3I5CA 2MGZB 2HNDA 3TARA 2MZSA 1FXLA 2E5JA 3WBZA 2QA4S 4O4GB 2YKPA 3CC4S 2EPIA 3JAMY 1JLGA 2R7TA 1RTDB 5CH7B 2D41A 2CJKA 1PILA 1XNRF 2P5VA 5KFNA 4KC5A 3TANA 4IQMA 2APOA 2R2RA 1OQ3A 1HW8A 1X5SA 2ACYA 1T94A 3OL7A 4KO0B 4B9TA 4AXJA 4DV6F 1U45A 4RU9A 3UD3P 4FF1A 4DN0A 2RD5C 4WK3A 2NPFA 1T03A 4AFFA 4CO5A 4ED1A 3BGLA 3MEDB 5B0AA 4RNNA 1QAIA 2QT7A 1WHXA 1S9EB 2UZAA 4PXDA 1D9DA 1N34F 4X4PA 5LMUF 2NPIA 2Z2MA 2CQ4A 3V4MA 2VQEF 4GC6A 1M5PC 4IH5A 4EZ9A 2NUUG 4DEZA 5GAEU 3ETOA 1UA1A 3OTDA 1HI1A 2J0QD 3MWBA 4DQIA 2UXCF 4KRWA 2N4DA 2JLEA 4ZOSA 2MGZA 4J9KA 4USJC 2ZHAA 4O4GA 5E33A 4YY3F 1RTDA 4ZPDA 1RK8A 2RQKA 3B4MA 3QIPB 4ZKAA 2ZBIA 2QSWA 1SUQB 3HP6A 5LJ5Y 4KO0A 4DFJA 3NCQA 4I6AA 3HFKA 4C0OC 1F5AA 3CCWA 2B4PA 4PQAA 2MKSA 3JTOA 3GV8B 4ED2A 1ZH5A 1X5OA 1KTQA 3MEDA 3KLEA 2BR0A 4ZVHA 1YIJS 1FNMA 4YB5A 1HBUA 3F44A 2N82B 4M63A 5D78A 1HWKA 2RRBA 2RUGA 1VQNS 3H20A 2UVVA 4WU3A 2HRYA 1GNKA 2R8GA 1NH7A 3CC2S 2UVUA 2HWTA 2LEAA 2ZHBA 4TXSA 2G0CA 3TO8A 1WEYA 1TZ0A 3MECA 2XS2A 4F67A 5KFVA 4LF6F 3CCMS 4M94A 2RF2B 5C24B 3NCPA 3QIPA 4PXBA 1NRKA 1S0MA 1JKHB 3N5BA 3HZEA 1SUQA 3FZBA 4OHYA 1U48A 2HHQA 4TKTA 2FD2A 2JEIA 2XY7A 1U26A 3RAXA 2MMYA 1C1BB 3DRRA 1X4GA 3PFOA 4QJVA 1IM4A 3QZ7A 2Z2LA 3GILA 2EFPA 2EG2A 4IQXA 2O3DA 2XMTA 2I2YA 1WG5A 3DXBA 4J5OA 2B7BB 2E66A 3HM9A 2FVQA 3O8WA 4HEA9 2IYIA 3RAMA 4E98A 3RB4A 2JDJA 1UVLA 1VQ8S 1U6BA 1FF2A 4RUAA 4Q43A 4A8OA 4JI0F 3BEGB 1N0VC 3IC1A 4ICLB 2FJDB 5JJBA 1X9MA 1CEZA 3MM6B 3MAHA 3DOKB 2UUBF 3CB4A 2Y1IA 4RUHA 1U24A 3CIZA 3LANA 2CPHA 2MZJA 2XEXA 3PJWA 4YR3A 2AJQA 4FS1A 3H2UB 3WX4A 4OHVA 2WW8A 3CF5Q 3Q0AA 2E1AA 4E0DA 2K2PA 1JKHA 2DO4A 4EO6A 1O51A 5CYQB 2HS0A 3MTJA 1YITS 3H5SA 3PX0A 3LQVA 5C42B 1HFEL 4WFBQ 1C1BA 2KG0A 2BM1A 4RW9B 1TAUA 5SZTA 2QIFA 4ZP6A 5DM6Q 1HI0P 1SJQA 3V6JA 5KG0A 3OJSA 1NNDA 3PIPQ 1H2TZ 1LFPA 4OJ1A 4Y34A 4NLXA 1ZAWA 4ICLA 3KLHB 3OLBA 2GMHA 1HWIA 4Y2KA 2EK6A 4N76A 5EN1A 3MPWA 2EFOA 3M6UA 3BM7A 4FYDA 3TP2A 5CCMA 1NKCA 4JI3F 1CQNA 4ZCMA 3I5AA 1DRZA 2JHEA 4ILLA 5KOWA 4RNOA 2XULA 5CYQA 1DQ8A 5L9XA 5L1LA 3IAM9 3TQ1A 3NNAA 4AUKA 2R2UA 1UFLA 5C42A 2AWZA 3MAQA 2C3OA 4I2QB 4RW9A 4C8MA 1S76D 2AD9A 5M2UA 2QO3A 3SEOA 4DUZF 3AJ1A 3CE8A 5KTQA 3HKZD 3LO3A 5DETA 1C4AA 2OAUA 1VLYA 4M5DB 3QLHB 1WHYA 3V6HA 2WBMA 1OO0B 2B9WA 2ILZA 4RBTA 3PX6A 2LEBA 4DLEA 3BS9A 2FY1A 2KVIA 3KLHA 3C6UA 2E29A 2MY7A 3KLIB 5IT0A 3I55S 3LAKA 3OJUA 2RH3A 2CZVC 1FDBA 4MJKA 5LXRA 3RBEA 3ULHA 2KTQA 2GJ2A 1BQNB 4NCBA 1RTJB 3IR6B 1RYRA 4PQUB 1V6HA 4QYZJ 2M7SA 4DR3F 1Z2ZA 2HS3A 2JL9A 2HIQA 1FVQA 4YEAA 3N5FA 1FTCA 4ZCLA 5L8RC 3TR5A 2O01C 1K1SA 1D3WA 4U7UK 1UVKA 2IM1A 4GO5X 4IOCQ 2JRSA 4A8SA 5DQGA 4I2QA 1R8BA 2AW0A 3LF0A 3K5MA 1XWLA 3HI9A 4IH7A 4UW2A 1NB7A 3KK2B 3FNNA 5B7WA 3S7RA 4R5PA 4ILMA 4NLDA 3CVKA 4QPTA 4A8KA 3PW2A 1FD8A 1LK7A 5KG2A 5AXKA 3QLHA 2AJ1A 2B5JB 3MOJB 3WDOA 3OFFA 2FIUA 2RDIA 5KFYA 1Y0HA 3DFEA 4O3RA 3KLIA 4UQGA 3SV4A 1GXLA 3OW2R 4DV2F 3GE9A 3EZUA 5AXMA 3TOQA 5K8MA 4LFCF 1BQNA 2OO4A 1RTJA 2DH8A 4PQUA 1U1NA 1M90T 2C3YA 3THTA 7FD1A 4KIAA 1Q4RA 3DLGA 3K59A 2BQ3A 5L1KA 1S1VA 4DV1F 1YJWS 1T05A 2V94A 4LQ3A 2AYBA 3ICLA 5DJBA 3BGUA 2CQHA 2EFQA 2GIQA 4LF5F 2GIRA 1GT8A 2JC0A 1Q16B 1EETB 4KBIA 1OWXA 3G8QA 4DR7F 1FERA 3OQ2A 2C2RA 2KKHA 3KK2A 4RBVA 3WC0A 4B17A 1EP4B 1NJZA 4N8NA 1OQ6A 4EUVA 6FD1A 1VQ9S 3GIIA 1ZPWX 2B5JA 3DDNA 2I9SA 3K2YA 4DS5A 3D0IE 4YB7A 5F8IA 4OLOA 2OSRA 4OLPA 2R8HA 2OH2A 5IM0B 1FDNA 3IGNA 1U49A 2RMLA 3BDEA 3T1HF 3HX9A 2XNRA 3TAPA 3CD7A 2J0SD 3LAMA 3M8RA 4ZCKA 3MI7X 3ISZA 3P3DA 3G96A 4HLBA 1JWWA 2WSCC 2XCPA 2OPQB 3RZAA 1U47A 2KO1A 4V19J 2AF6A 1EP4A 2DGOA 1H0HB 2E7XA 3R5BA 3DCAA 4PXCA 4ZS6A 2J7WA 4FF2A 2CQPA 5FDLA 4OZNA 1T3OA 4I56A 2RNEA 4A8YA 1LWFB 1L3UA 3DLEA 5IM0A 3ENQA 5DO2A 4CT9A 5GAGI 2FLPA 2I1RA 2OD6A 2B7CB 2RU3A 5JVHQ 2HMIB 1U8SA 4MMOA 2FLNA 5DLFA 5JUMA 2LQ5A 3HXMA 1IKWA 4MH8A 3CCVS 4N5SA 2IA0A 1QM9A 4JV0A 2HHVA 2OPQA 3MEKA 2M52A 3H4DA 1DURA 5H9EJ 1HWJA 1QAJA 1ZETA 3I87A 3CGIA 2IVYA 2UUTA 2W9AA 1TL5A 5BR8F 3X1LB 4ED5A 2N7YA 1UW4A 3RB3A 2ASJA 4FPRA 1LWFA 4J37A 4DSFA 1AROP 4ED6A 2BBEA 3GG1A 2OD4A 5KFDA 1RJJA 2CJBA 2VFVA 2QMWA 5J2MB 3NGDA 2R2TA 3MR5A 2FVSA 3KTQA 3BR9A 3C46A 2B51A