5LJ5Y

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
b'NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lj5Y00
4C7QA 2DK2A 1U1NA 2X1FA 2F3JA 3TP2A 2L9WA 3MURP 2DGOA 2DIVA 2X1AA 3ULHA 1YHQS 2KG0A 2OSRA 1WEYA 4QU7A 3CC4S 2GO9A 2VOPA 4F02A 2MY7A 1WG5A 3CULA 2CQHA 3MUMP 2ZJRQ 2MQOA 1X4HA 3G4SS 2XS7A 3G71S 1VBZA 1SJ4P 2LEAA 3S01A 3CCSS 2J0SD 3VAGA 2RS2A 4ED5A 4WFBQ 2VOOA 2LYVA 2MQQA 3H2UB 4M5DB 1JMTA 2CQPA 1U1MA 2E5HA 1S79A 3CXCR 3R1HA 5ITHA 2RS8A 1HD0A 2RVJA 3VF0B 1WF2A 1QVGR 2CQDA 2CPYA 2YWKA 2B0GA 2LEBA 2KU7A 3V4MA 1BY9A 3NS6A 2DGVA 1VQ4S 2MZSA 2CQBA 2J76E 2XB2D 2MGZB 2HGNA 5JVHQ 4IUFA 2EK1A 1VC0A 2MJNA 3G8TA 2KXHA 4QU6A 3CTRA 1KOHA 1W2BR 3LQVA 1M5OC 1FJEB 2BOPA 2CPFA 1WEZA 2G4BA 2X1GA 1S72S 1X4EA 3P49B 3MD1A 2DHSA 3UWTA 3DXBA 3IWNC 1DBDA 1VQ9S 3SMZA 2MJUA 2G1DA 1X4BA 2OIHA 4LIRA 3G9CA 1OWXA 5LJ3Y 2KN4A 2DNOA 2FHOB 1U1RA 1A7GE 1QM9A 1VQ6S 2ADBA 2DGXA 1JJHA 1VBXA 4CH1A 2CPEA 1K8AT 3NMRA 3I55S 1ZZNA 3G6ES 2L08A 4J5OA 3NNAA 1K73T 5FJ4A 3D2WA 1X5SA 4YUDA 4Y0FA 1M1KT 2HVZA 2BZ2A 3EGNA 4RU2A 2HYIB 1WELA 5DM6Q 1YTYA 2DGTA 1VBYA 2FPHX 3FEYB 2MSSA 4CH0S 3N9UC 2KYXA 5GAHU 1U1LA 1YITS 3TO8A 5LSLA 4QPTA 3H2VE 4OZ0A 1U1KA 4YOEA 5H1SV 2KM8C 1VC5A 1FXLA 3EGZA 5D78A 3CUNA 3VAIA 2ERRA 2DGSA 5JVGQ 1M5VC 4TU9A 5D77A 2DNRA 2CPZA 1X5OA 5LXRA 3BEGB 1H2TZ 4F26A 1WTBA 1X0FA 1M90T 2JWNA 3LPYA 4ERDA 1B7FA 2CQ1A 1M5PC 2O3DA 2K8GA 1WG1A 3CCQS 3CD6S 3ZZYA 3TYTA 2EVZA 1WWHA 3RW7A 2KXFA 4F25A 3G96A 1FT8A 1SJFA 1VQPS 1VC6A 2LQ5A 2RRBA 1VQKS 2DO0A 2N82B 2XSFA 3VAMA 1P27B 3UD3P 1HD1A 2MHNA 2MQLA 3HI9A 2RRAA 1N8RT 2YKAA 5DDRC 3PIPQ 1YI2S 1FJCA 1JJ4A 2U2FA 2HGLA 1WG4A 1OIAA 1UFWA 3UCGA 2LA4A 4UY8T 2MKKA 2JRSA 1WHYA 2XNQA 3VAKA 1X5PA 2D9PA 2DNMA 1FHTA 3P3DA 1OPIA 3U1MA 3R27A 1M5KC 3HHNB 3RW6A 2GHPA 1KC8T 1URNA 5GADU 2DNKA 2N7CA 2XNRA 2MZQA 1NJIT 2AYEA 1VQNS 1H6KX 1K9MT 1U2FA 4FXWA 2JVRA 4V19X 4UQTA 3CF5Q 1VQLS 1X4GA 2HGMA 2JVOA 2V94A 4LMZA 5CYJA 2DNLA 2LA6A 1L3KA 3IRWP 2KI2A 3EX7B 2RQ4A 2G0CA 3BS9A 1FO1A 2N3LA 1WHXA 2DHXA 2FC8A 1WF0A 3CCRS 2KXNB 4W92B 2ZJPQ 1X4FA 1HL6A 3P5TL 2RNEA 4WFAQ 4U67Q 2J8AA 3UCZP 2MKCA 4CQ1A 2DH9A 2CQ0A 2AYMA 2AD9A 3BO2A 4CIOA 3B4MA 5HL7Q 1X4CA 2E44A 1SJRA 3CC2S 2M8DB 1D8ZA 1KQSR 1NO8A 2KT5A 2CQ3A 5EN1A 1WEXA 2OSQA 3VALA 2LKZA 1Q7YT 3US5A 2ZJQQ 1Q81T 2CQIA 4W90B 3UD4P 1KD1T 4PR6A 2E5JA 4IOAQ 4IO9Q 3NNHA 4EGLA 1R8HA 3VAJA 3CCMS 5CA5A 1UW4A 3BO3A 3S6EA 1XN9A 1D9AA 2MZRA 2KRBA 2QFJA 1A9NB 1N52B 2E5GA 1FNXH 2DGUA 3UCUP 3THPA 2FC9A 2OJ3A 1SJ3P 2ADCA 1YIJS 1P1TA 1VQ5S 2NZ4A 5GVQA 2PE8A 2MKJA 4C4WA 2DNNA 4TU8A 2CPHA 2QA4S 3J7YU 2MZJA 3SDEA 2DNYA 2QEXS 2VODA 1WHVA 2I2YA 3BO4A 2I38A 3CCLS 2CPDA 5DM7Q 2UP1A 2NLWA 1PO6A 1R8PA 2KVIA 2PEHA 2VONA 3MXHP 5DDOC 4WKRA 2LCWA 1X4DA 2DITA 4WFNQ 3MDFA 2LXUA 5DDQC 2WBRA 1U6FA 3CC7S 2RQCA 2DNGA 3CPWR 1Q82T 1YJ9S 2Q79A 1H2UX 3MUTP 2AYGA 2CQ2A 2KG1A 4BS2A 2CPJA 2RUGA 1FJ7A 2M9KA 2KM8B 2MKHA 3MOJB 2CQCA 2MZ1A 2LXIA 2M7SA 2MQMA 2OTLS 1Q86T 4A8XA 1RK8A 2F9JA 5DETA 5LJ5Y 2D3OR 2JX2A 2J0QD 4LJMA 1NU4A 1WHWA 3CCUS 3U1LA 1YJNS 2HZCA 2D9OA 1U1OA 2DNQA 1X5TA 2RT3A 2DH7A 3Q2SC 3K0JA 1DZ5A 5IM0A 2M70A 1WF1A 2N3OA 1RKJA 3Q2TC 3JB9k 2MPUA 1VQ7S 2MYFA 1N88A 3CMES 2M2BA 3MI7X 1KOOA 1DHMA 2MY8A 1O0PA 3VAFA 3FEXB 3SDEB 4Z2XA 1OO0B 4WF9Q 2YTCA 3MD3A 2LECA 2CQGA 2K3KA 3G8SA 2DNPA 3B4DA 1JJ2R 3S7RA 2MXYA 2CQ4A 2XS5A 5HO4A 2LMIA 5DDPC 3PIOQ 2CPIA 3I56S 2MQPA 1SXLA 4P6QA 3NS5A 4QQBA 3R1LA 2DGQA 5GAEU 1PGZA 5GMKa 2E5IA 2EK6A 1VQOS 2AYBA 4FXVA 3UE2A 2RU3A 4PRFA 2M52A 3CCJS 3VAHA 1WI6A 4TLQA 1X4AA 2M88A 1SJQA 3CMAS 5LXYA 1N54B 5BJRA 1CVJA 1IQTA 1U1QA 4PKDB 3THTA 1F9FA 1H2VZ 2X1BA 5MLCV 1AUDA 2XS2A 3S8SA 3J7ZT 2DHGA 2M4MA 2YH0A 2KFYA 2M0GB 3NNCA 4WCEQ 3CCVS 2M8HA 1UAWA 2DNZA 4ZKAA 2FY1A 2SXLA 2A3JA 4WIIA 2CJKA 5IM0B 1HA1A 2MZTA 3MUVP 2MMYA 3P6YC 1G2EA 2DISA 3ZZZA 2KRRA 2DGWA 4OZ1A 2KH9A 2DH8A 5CXTA 2MKIA 3SXLA 4IOCQ 2YH1A 1QVFR 2DNHA 1UP1A 1DRZA 1YWXA 2DO4A 5IFMA 3L3CA 4C0OC 3OW2R 2MSTA 2DIUA 2KHCA 2MKSA 2MQNA 1U1PA 2MGZA 2L41A 2F9DA 5IQQA 1ZH5A 4TU7A 1VQ8S 2U1AA 5GAGU 1VQMS 1U6BA 3DLLQ 2DHAA 5LSOA 3CCES 2OTJS 1WI8A 1ZZFA 2CPXA 2DB1A 2MB0B 4YB1P 1YJWS 4Y00A
chains in the Genus database with same CATH superfamily
3TP2A 1ICEB 2AV5A 4L74A 1JNZB 4PQUA 3HZEA 1WORA 4PPDA 3FBFA 1JXVA 5FLXY 1RBAA 2CJXB 2IFXA 3DU5A 1PYSB 3IBWA 2YWEA 1CULB 1RZMA 4QW8A 4CYUB 3PW4A 2E5HA 4DV3F 5E3CA 3QWUA 4DLEA 2KU7A 5CYQB 4IUFA 2YPYA 1NPKA 2E1RA 3I4PA 2ATCB 1OSDA 3NGKA 1GNKA 1S6PB 1BQXA 2JSXA 4DR4J 4X65F 4DQRA 4LIRA 2ABYA 3NGDA 5D0HA 3MWBA 3KK2B 3EJMA 5C5JA 4NLXA 2DNOA 1TR0A 2DGXA 1PJ7A 2GNKA 4HACA 3WHIA 1KTQA 5J2MB 2L08A 2P5VA 2HYIB 4HT7A 1SH3A 1WELA 2R7QA 3LP1B 4Y2MA 5EUHA 1HBUB 1F5CA 1YKWA 4OX9J 1RHKB 4HI1A 2DBBA 3RRKA 4R25A 2DR9A 1IBLJ 2YX4A 2Q43A 3EE3A 3SEOA 5AJ3J 1X5OA 2E5LF 4ZJQA 5K14B 1PYTA 2QL5B 4FPIA 3R5JB 2J9DE 5J2NB 1R27B 3MPVA 5B0GA 4N76A 4LF2A 1WWHA 1FT8A 1SJFA 2RRBA 3PACA 3AY0A 4YEAA 1HHSA 3DLGA 4H54A 3RB4A 2KFZA 2Y1JA 5BYSA 5G0RA 3FBCA 4CO4A 1F6TA 1XWLA 2L9NA 3M30B 1FFWB 2MKKA 2JRSA 4QOTA 1TL1B 4Q8EA 1SC4B 2VV5A 2WB4A 1IJEB 1C1BA 4ANEA 1MU2A 1VQNS 1IWAA 3J7A1 1X4GA 1S9GB 3L9ZA 3BPSP 4P7VA 4PYAA 4N7TA 1EX8A 1FKPB 2IM3A 2KXNB 4W92B 3ZFVA 1VRUA 3JAMU 1WC4A 4A8OA 2J8AA 4O3SA 4CQ1A 2DH9A 3GYGA 2EG1A 4RUBA 1S99A 1RBOB 3JSBA 2W1BA 4ELUA 3EVMA 4PWDA 4X4OA 4C8OA 3M8WA 3A8JA 1APSA 2CQIA 4A46A 6FD1A 3M8PA 4L72B 3QATA 3K2YA 5KG0A 3TEGA 5A8RB 2FC9A 1SJ3P 5ETRA 4F4YA 1PBUA 3DFEA 1NB7A 2YPZA 4DPYA 2CJ9A 4F4XA 3D4JA 4X84A 4CDIA 5DQHA 1HNVA 1U6FA 3OPKA 5KFQA 3T6JA 4LUBA 1YJVA 3W9IA 2JDJA 2KG1A 3O6QA 4X62J 5KFIA 2BJ1A 1DY3A 3PHTA 2MZ1A 3ZZPA 2KB2A 4K4VA 2B5JA 1HR0F 1I6JA 3LP0A 1DZ5A 2MLZA 1WF1A 2V67A 3E01B 5DLFA 2APOA 1C2PA 1XNRF 3UDVA 5KT7A 3RU0A 4DMZA 4F0KA 3T1HF 5LMUF 2I8EA 3OLBA 2C3YA 1XMOF 3DLGB 4UTGA 2RHSB 2XZTB 1X4AA 3TA0A 1D1UA 3CMAS 4ZHRB 1R0BG 3U02A 3D67A 1SUQA 5KFLA 3CCVS 1H98A 1UJ6A 1UVLA 2NUUG 1NUEA 2DT9A 2VA2A 1PIEA 4C11A 5DQIA 5CHCB 4JI7F 5DZ7A 1J5OB 2OH2A 4DR6F 2DGWA 1QTMA 2J7UA 2XZWA 5J1PA 1TL5A 1VK3A 4Y2AA 3RB6A 3MM6B 1HWJA 4UOFA 1UVJA 2JEIA 3CJKB 2ZZMA 4PUOB 3C3LA 1Q8KA 3IR7B 2DB1A 3HJFA 4YB1P 2IAJB 5E41A 1SI9A 4IRDA 4DXLA 5GADI 3LO3A 3NCRA 1YHQS 3MPYA 3TEHB 5KFXA 3GE9A 1S0NA 3BDPA 4M5HA 2FGCA 1RT3A 1FRIA 3MUMP 1LWCB 2LLZA 3GIKA 1CJVB 1SJ4P 4J7CA 1CG2A 3AOCA 3PJ9A 2NXNA 5JMNA 3CW2C 4I6AA 4NEZA 3A8EA 1PC4A 4UOGA 4WIQA 7FD1A 1S1XA 1HBNB 2DR7A 1LW0A 2HVIA 2PC6A 2FIUA 4MK7A 2P9CA 1U0HB 3BBCA 1U6ZA 3IWNC 2WTFA 2HHSA 4DV2F 3H4BA 1T9UA 2FHOB 2BUNA 4OI2A 2B6AB 1CEZA 2B5JB 4U6PA 1P6TA 2ZUGA 4OYXA 4AE5A 2W2NP 2F4VJ 3MMBB 3N9UC 3NBPB 2NCKL 3NMAA 3TO8A 3SIPB 2YX7A 1JLGB 2CNLB 2HEKA 4NRTA 1QAIA 2HQGA 4P52A 1IUJA 4DQIA 4USUA 4DU7A 4F26A 2ROGA 3DKDA 3WC0A 1X0FA 3Q8SB 2Q6BA 3CCQS 2W8LA 3OL6A 2KXFA 2HNDB 1FVQA 4DJBA 4DLGA 1PJ5A 4JYAJ 3TQEA 2BACA 3GG0A 4ED2A 3ZTPA 3K5OA 3HI9A 2YKAA 1RADB 4EI2A 3J7AN 1OYEA 3ZZ0A 4WZQA 1KS2A 1UFWA 3H98A 2QL7B 1HBMA 2HAIA 3K5PA 3OV7A 3HVAA 4YQWA 1D9FA 5B09A 4X66J 1HQUA 3DOMA 1KWMA 3T9ZA 1F5AA 2GIQA 4ECWA 1PAUB 3DI6B 1K9MT 2BR0A 4LFBF 4ECQA 4KGVB 4DUYJ 4OYOA 1BC6A 1Q8IA 1K0TA 2Z2ZA 1HL6A 3T41A 4Y28C 3BO2A 5HL7Q 1X4CA 3SBMA 4LFAF 1WEXA 2KKHA 3Q8VA 1Q81T 1J5EJ 1KNZA 2HHWA 2IMOA 3VAJA 1UEVA 4AQYF 1GMWD 3JQJA 2MZRA 1QAJA 4QIWD 1FNXH 1QY7A 2XMTA 1Z4UA 2PFDA 2ADCA 3OR2B 1LW0B 3TVKA 5F8HA 2W9AA 4TU8A 2IDLA 3SYZA 3BO4A 3AJ2A 3EGWB 2HHHJ 4KKOA 2W2QP 1N33F 3RB0A 1FJGF 4O0IA 3QRPA 1FK9A 5HJXA 4QWBA 3IR5B 1FJ7A 1E6YA 3H40A 1N4LA 4FVMA 5H9FJ 2Q66A 4DQQA 2HFOA 4M8LA 2RB7A 1T11A 3H59A 4CO5A 1FDNA 2Q1LA 4FF1A 1EZZB 2FVSA 3TX8A 4NCGA 1LFPA 1NAQA 4DL5A 3M2RA 1TAQA 2C2EA 4DV5J 2YTCA 4N77A 5ETPA 2UZAA 4DG1A 4FF3A 2N7YA 2ZH9A 4DUZJ 2DGQA 2DTJA 4TQRA 3NAHA 2NUHA 2CA9A 4IG3B 3PYGA 2GQQA 1C0UB 1N32F 2N4DA 3HF5A 4P10A 1IQTA 3I4HX 4F36A 3R7BB 2EPIA 3GFHA 1FRXA 2GVZB 1HQUB 1LFWA 4JI5F 3BH7B 1Y9OA 2OLWA 5DGAA 1HA1A 3RAMA 3IMQJ 2XMMA 3C15A 4C8MA 2XM3A 4N8OA 2N4CA 4QWAA 2ZWOA 1KHVA 1DRZA 1YWXA 1NRKA 4UW2A 5ETKA 3NAIA 3POTB 4G1PA 1OYDA 4JI1J 4DL7A 1UCNA 3D3CJ 3W60A 5LT5A 4EBCA 5AXNA 4MH8A 2B4OA 1ZZFA 4KT0C 1N36F 2Y8WA 1IKXB 2PA3A 1L3TA 2UXBJ 2H5IB 4NXMJ 3CULA 3IGNA 4O3OA 2VKRA 1RE1B 3AB4B 4NL5A 3S01A 3VCDA 4LFCJ 2PGCA 1U09A 4ED4A 5MAOA 3O8WA 1YDLA 4I2PB 3PX6A 5IOLA 1NKCA 4V1Ak 2AJ4A 1W2BR 2DY1A 1M5OC 1T03A 1S97A 4B3TF 4XPEA 5GMDA 4KFBA 3DMJA 1VQ9S 4HHUA 3A12A 3ENAA 2W7AA 1E6YB 5L9NA 3ZTQA 3GFZA 1QM9A 2YKPA 4IRCA 4F8RA 3I55S 2JOQA 1X5SA 5F8MA 1F1BB 1KVIA 1ZAVA 1T05B 4KH0B 1VBYA 1JLCA 4Q44A 4B08A 3ILIA 3M2RB 3WQPA 3DLEA 4DV7F 2BANB 4DFPA 1FXLA 4DV3J 4AXJA 5D77A 3BEGB 5A2QY 3HFKA 4P7TA 1V5VA 1Q0NA 1Y00A 4ZJLA 1QSSA 4EUVA 3DGPA 4X65J 3HKWA 1YRUA 2DO0A 2FHKA 3UD3P 4ATNA 3HHKA 1YG0A 2OPRA 1RTIB 1N8RT 5FDLB 5ETOA 1UMJA 5FLXU 3V6KA 3L7OA 1RAOA 4KV8A 2V8HA 2GVDB 4AYBD 2D74B 2QLFB 4F4WA 2GHPA 4KY3A 2VD3A 3IAM9 4HTIA 4FXWA 4OZ5A 1Y5NB 1O51A 4NYPA 2LA6A 2E5LJ 1FO1A 3FZBA 3AA9A 3CO9A 3GPAA 2FJBB 4U96A 1OPZA 3UVJA 5KFAA 2IRYA 3CMQA 2HZVA 4D3HA 2ZBPA 4WFZA 4PZVA 4B3SF 2FLPA 1HW8A 4WK1A 2M8DB 4CT9A 2KT5A 3NOGA 3BBBA 3M32A 2LKZA 4QWCA 5IC6B 2YY3A 1GTEA 4P75A 1UW4A 3EYZA 1D3WA 4O23A 3PY8A 1S1TA 1F9HA 3KLEB 2OJ3A 3UPFA 1XTZA 4C4WA 4FP9A 2IHR1 3PZPA 4OMFG 1IBCB 2HWTA 4KFBB 1CJUA 3NGTA 2HFZA 3SV3A 3FGVA 1WKKA 1PO6A 1K47A 3FBEA 2FHJD 4O44B 4WFNQ 1XBWA 3BYPA 5AXMA 1GXTA 4C8LA 2VASA 2R7TA 4J91A 1Q82T 2ZH1A 4KGKA 2CAJA 4H4MB 5F0WA 4CH7A 3DDKA 4O3NA 3QIDA 3M7VA 3OBIA 3UN5A 3EZOA 2YNGB 4LJMA 4KB7A 3HHDA 4ZP6A 1TK0A 3DGVA 3ONQA 4AUKA 5D4OA 4RBUA 1QSYA 2OUGA 3Q2TC 4M5IA 3KXDA 2M2BA 1NK9A 3GLJA 3R5GA 1RT2A 5KFJA 6FDRA 2HRTA 5DS7A 2W2PP 5L39A 4ED1A 1EKSA 2A6MA 4CO2A 1XNQF 2WSFC 1H73A 1AUSL 4L6V3 3Q89A 3K17A 1SL0A 2W4DA 4A8SA 2ZD1B 2PIIA 3W9HA 1BE4A 2R7VA 2HKEA 2OPRB 2O01C 4NZ7A 4B17A 1PC5A 3CEDA 4P2FA 2VKZG 4TLQA 1FWPA 2E7XA 4DR5F 2B9YA 2ZKUA 5K5MA 1D8YA 1PG5B 2COLA 2J0XA 5E3AA 2UVRA 3QJJA 4DPOA 1S5ZA 3MOZA 1RLCL 3KMQA 1HR0J 1RT6B 4IG0A 3I0SA 3OLAA 1H0HB 4ES3A 2XO6A 3TX0A 1QVFR 2DNHA 1XNRJ 1RI7A 3ICLA 1BGXT 2XULA 3CJ0A 4DQPA 4WYWA 3BDEA 1U6BA 3FMBA 3G6XA 3FQLA 2V4RA 1VIXA 1WI8A 3TJAA 2VFTA 5CZXA 1MN7A 3T1HJ 4XDCA 4LIWA 5LMUJ 3E8OA 1XMOJ 3TZWA 5KFSA 4DSLA 1AA1B 3VGVA 3GONA 2V2QA 2GIRA 5KG5A 2XCAA 2GO8A 2BE7D 1LKZA 2ZFHA 2R7XA 2VOOA 2WW4A 3KJQB 4JI7J 3CXCR 4FS2A 2WHOA 3W5XA 1U7LA 4ID8A 4DR6J 5F9LA 1UL3A 3MGJA 2CPYA 3NWGA 2B0GA 1EQMA 2FQQB 4ID5B 4EEYA 4DN9A 3NS6A 2DGVA 2MZSA 1I94F 3PW0A 3EICA 4QU6A 3RB3A 3DLJA 1FJEB 4YDXA 2X1GA 1S72S 4J9QA 3DRPA 3C16B 3AD8C 4Y34A 2GIFA 2KN4A 2GZOA 4MIWA 2V8DA 2ADBA 3FCVA 2XMWA 2HW3A 5EX0A 2KZMA 2I1RA 1WNEA 1HI8A 3IS9B 1V3RA 1FE0A 3IN5A 1U1LA 5AE1A 2Z2YB 3N01A 3TWZA 4A8KA 3VAIA 2XMAA 4XDDA 2PEBA 4BC7A 2E7VA 3LPYA 1R8BA 2UV8A 4MFBA 4RW6A 1JNRB 2VFUA 3BR8A 2VC0A 3NOCA 4DV2J 3KUEA 2W7PA 1DQ9A 5ETQA 2MQLA 2EXUA 3HVTA 4HL9A 3JTOA 3I0SB 4RLEA 3A13A 3EPIA 3T1YF 1JK9B 2AJQA 1XR7A 4H4OA 2B51A 3IXQA 4EO6A 5CYMB 3KG1A 3FMWA 1L3KA 1NZ8A 1SL2A 4OJGA 2N3LA 4PABA 1N5QA 4U7UD 3QRRA 5IWAF 4ZLLA 3GZ7A 1U26A 1UVMA 3V81A 4OI3A 3MEDA 1S0MA 3G6YA 3HSDA 1E6VA 1Y0HA 1ACMB 2VFVA 3R6LB 3TOQA 2VDHA 1IN0A 4EBEA 1MMNA 2IIHA 1VLOA 2R2TA 4RPFA 2RILA 2ASYA 4I64A 3DCAA 3EDQB 2ZH7A 5L38A 5I42A 3TAQA 3EVWA 3IG1B 2UV8G 3FKBA 3QJLA 4B9MA 1FNMA 3DLKA 3R6GB 4LFBJ 2WOMA 4X4PA 4M95A 3BR9A 3BZQA 3BH6B 2LCWA 1RAIB 3RAXA 3PCOB 1HWLA 4AD6A 2LXUA 4DV4F 3SCIE 2HNYA 3PRDA 1GXUA 2PSZA 2V4JA 2HHTA 1RABB 2Y3YA 2MKHA 1G4CA 5CD4A 1K0VA 4P74A 3W2WB 4LFAJ 3PKYA 4B9TA 1VR6A 3DRYA 2UVUA 5KFCA 4AQYJ 1FDDA 2N3OA 1B64A 3KG4A 2H4WB 4QJVA 1UVIA 1G1XA 4LSLB 2WK4A 1OO0B 4QCLA 3RR7A 1MWQA 3LANA 4YN3B 1JLFB 5DDPC 4RKUC 3D5MA 1IKYB 2WONB 1LXJA 2ZE2A 1N33J 5HI7A 5KT4A 2OO4A 1FJGJ 4M5GA 5U47A 4QWEA 3HT3A 2BABA 1EP4A 2RDIA 2RF2B 2BMBA 2VG7A 2DR8A 3NNCA 2EFOA 1IWGA 3MM8A 2MKYA 5D3GB 4J9PA 4KSEB 2VQFF 4HVZA 4P72A 2QYCA 4H4OB 4IOCQ 3IC1A 3Q86A 3OTEA 3NKYA 3TVZA 1U8WA 4RNOA 1HHQA 2EFNA 5C2CA 3DOKB 2MQNA 4L73A 2B7CB 3KJNB 3C46A 5IQQA 1RBLA 5F41A 5E3RA 1HIYA 1LW2A 2GHWA 5KT2A 1S12A 3W2VA 3T5LA 3G82B 2RKIB 4IOBA 2OSRA 2YQ0A 4JB8B 4K5SA 1N32J 3BGFA 2MY7A 5JJBA 2ZJRQ 5DG8A 2MQOA 4RUCA 2AIRB 3CCTA 1P9QC 1LWXA 4P71A 1EETB 1N34F 3VAGA 4JI5J 4I7FA 2LYVA 1GXLA 4RNMA 4YMEA 1S79A 2POKA 3C8YA 1WDDA 4FBUA 5DRKA 2WOMB 4TYAA 1OY8A 4IRKA 2MGZB 3O2IA 3ISZA 1Q1KA 1UJ4A 4WP3A 1TFYA 3FSIA 4OX6A 1N0UA 2DYAA 3CGIA 3KLFA 4J9RA 1N36J 3M9MB 1TKTB 3BGOP 2VFSA 2V2KA 3M2VA 2HQFA 4CH1A 3EZUA 1K8AT 2YQ3A 4JOUA 4RU2A 1UTAA 4UZCA 4C9DA 2CRLA 4DF8A 1YTYA 1RSCA 4DCJB 1CJTB 3KLHA 3MECA 4P2XA 1R43A 1X0PA 3GIMA 5HJYA 1R31A 3CDUA 5HK4A 4NLOA 1BUXA 2IVYA 5KOWA 1KFDA 1H2TZ 1GMUA 1VIOA 5D0RA 4NEYA 2H48B 3J81Y 3CJTA 4KRWA 3ZZYA 4QW9A 4B3TJ 4OYBA 1T9VA 2BKPA 3KUHA 8ATCB 2ZVSA 3C6TA 5B0BA 1T94A 1FJCA 2WSCC 2U2FA 4C8NA 4ILRA 1UVNA 2XLJA 4MYTA 2HFUA 1RTJA 5GAEI 2GAHC 4GKJF 4AL5A 5J2QA 1RWVB 4ZK7M 2ACYA 2NZCA 4Y3CA 1OSCA 3FVYA 2C22A 1KC8T 4FDFA 2B9XA 3VGTA 1WKJA 3N5BA 1HNZF 4DV7J 5E0OA 4MTPA 3QRQA 4NLDA 3ILLA 4OLOA 4FYVB 5GMEA 5F0UA 2V0NA 2VU5A 3BS9A 4J9VA 4LBIA 1ZA1B 1AT1B 3MEEA 2CZ9A 2OPSA 3RJMB 1HI1A 4KPYA 2ZJPQ 4LF7F 4F4AA 1N56A 3IM8A 3DXSX 4BWMA 4RWXA 2JH3A 1RT5B 3ZTOA 4FYXB 1RA7A 1FXRA 1IQZA 1YGYA 4K4UA 1XN9A 2FHMA 3EWGA 1N52B 3D7SB 4S0MA 2J7KA 3KUGA 3A1YG 2DNNA 5A2QU 4WXOA 4B9UA 3KJFB 3KHLA 1WHVA 1GFWB 3PR5B 2UP1A 1NK5A 4X4RA 4A8YA 1U02A 5DDQC 3M2VB 5A0YB 2XHCA 5L1LA 4URGA 1FX4A 1FD2A 2CPJA 4DL3A 4B3SJ 3BKFA 5BYRA 1Q5YA 2KO1A 2JX2A 2HMIA 2XC9A 2D9OA 2IC3A 3KLGA 1REVA 3ET6A 2LP4A 4AT1B 3H2LA 3PRVA 2HQCA 3ZTRA 5F8NA 3M2UA 1TL3A 2W25A 1EKRA 4QYZJ 4ECXA 4DF4A 1IKWB 2BDPA 2NXJA 4X4SA 2K3KA 1FE4A 4ECZA 4QQBA 2CADA 2LU2A 1HBOA 5GMKa 2EK6A 3E2EA 5GAHI 1OY9A 1RWNB 2YKQA 3C6TB 3M9NB 4KR0B 4O4GA 1JLQB 1BLUA 2ZZTA 1LK7A 3TQ1A 5HN0A 3SCLE 2Z58B 4DL2A 2CFXA 3UFCX 1VISA 3Q83A 1Q95G 5HBMA 3I31A 1AFIA 4FNIA 1BQNA 5IM0B 4I2QA 2K2PA 3CCWA 3JSMA 2ZH3A 5HMWA 4M5DA 2C2KB 3MTJA 2DEJA 2MLYA 2IJNA 3L95X 2OGUA 2Z2MA 3T5KA 3DU6A 4U7UK 4IDKA 2MSTA 1UZHA 2KFNA 4RW7B 1TUWA 4W4MA 1VQ8S 3H90A 2K06A 1XNQJ 4Q7AA 1VRTA 1UWBB 2E7WA 2YWGA 2ZNZA 1W26A 2ZWPA 3I32A 3KHGA 1WEYA 3CC4S 4B3OB 2GMLA 3L7UA 1UJ5A 4DFJA 4DR5J 2LDIA 5KFNA 4NWBA 4IH5A 3MM9A 3ENVA 4WFBQ 2ASJA 5KT6A 1GMWA 3V4IA 4WZMA 1X8DA 4X4NA 2YNFA 3OHAA 1NEEA 2AX0A 1CC8A 3CTRA 2HWIA 4GO5X 5K8PA 4XPCA 1X4EA 3CDEA 2G1DA 2RQKA 5IXUA 1DJ0A 2QV6A 4F67A 1TV6A 3DOLA 4KGMA 4O0NA 2VC1A 2R8IA 3OTOF 3NMRA 4C8ZA 3G6ES 3M2UB 1M1KT 1Y3JA 1RAHB 2DGTA 2ZC3A 1YJUA 4JV0A 3UNGC 5JXSA 4QPTA 4KTQA 2XTJP 2K7JA 5CD4H 5E3QA 1I94J 2YKNB 4IFYA 1VS3A 3W63A 4G65A 3CD6S 3VGUA 2EWHA 1VK8A 2GAGC 2VICA 4O4GB 3W8GA 2ZBQA 4NLGA 3PDNA 4R8UA 3QZ7A 3SSSA 2E1MC 3WDOA 3MTKA 3QLHA 2KT3A 5HBMB 2KHDA 2F8EX 2EG2A 2QO3A 1WG4A 5A8WA 3JSMB 3AOBA 1F9EB 4OZJA 3QO9A 1UKUA 4J90A 1UPMB 3TJ9A 1OPIA 3SFUA 1JLEB 1M5KC 1LK5A 5GADU 1AYEA 2XNRA 2MZQA 5KG2A 4AL7A 4TKTA 2JVRA 2HHVA 3HD1A 2OPQA 4AL6A 3K5NA 2JVOA 4YR3A 3IRWP 1ZAWA 3OD2A 1VDHA 3NLCA 2DHXA 1XJWB 3N5FA 3QGHA 4BCAA 1RHRB 1DTQA 1VLYA 1ZM3A 4Y2CA 2Y9HA 2UUCF 1FX2A 1NDPA 1U24A 2D69A 4YR2A 3VALA 3UDEA 1GH8A 1KD1T 4PR6A 3PR4A 1GX5A 3NNHA 3V4IB 1R8HA 3D6TB 4C48A 2BE2A 3T1YJ 2D3O1 2KRBA 2YNFB 2UXCF 4J9SA 2QMWA 5GVQA 2PE8A 2RUSA 2D3UA 3BF4A 3BQ1A 2R3VA 4J9MA 4LF8F 4FKXA 3WX4A 4CLZA 3SV4A 1F2HA 2AEMA 4NA3A 1RT4A 4GKKJ 4F3QA 1F3VA 1TV6B 1N48A 5IWAJ 1PAEX 5JUMA 4NXNF 2EEYA 2JFDA 2IRXA 3G8QA 1FDBA 2AYGA 1NHVA 2RMLA 1HQEB 2XLIA 3K58A 4ZPCA 2BKNA 1UZDA 3L7PA 2HZCA 5KFVA 1RTDA 2GV1A 2QYGA 5ETLA 1FRKA 4PG7A 3R7NB 1S6QB 3RYLA 1FESA 1PYOB 3OVAA 1FKAF 1N88A 3FEXB 4GRSA 2ZOMA 3NY0A 2HSEB 1LV5A 1NHUA 2R7SA 3D6FB 2LMIA 1Q5VA 2FLOA 5A8KB 3OVSA 3SCJE 1CJKA 1RTHA 4GVBB 4MJKA 5T14A 2V8PA 4DV4J 1RJJA 3BSOA 1Q8LA 3Q8UA 4FPRA 3TAMB 2V2VA 4WK3A 4DV1F 5E2QA 3BGRA 2IYIA 4OQJA 2VPYB 1KQFB 1YBAA 4ZKAA 4HHJA 2UU9F 3FFIA 1RB0A 1S57A 3KLVA 4YB6A 1FEEA 2KRRA 2OEJA 4OZ1A 5CXTA 2MKIA 4OV1A 4DR7F 4FKYA 3GMGA 1AZSA 2YH1A 3TZZA 4DR2F 1UA0A 1WOSA 2V6AA 3NGSA 2YNIA 2MKSA 2C2RA 4RW9A 2F9DA 4TU7A 4DCPB 5LSOA 4KBIA 2WCXA 2HPUA 1R0AB 2G2OA 3LGHA 3T3FA 2JNJA 2VBYA 4GMKA 4M5JA 1MROA 3HZGA 4OZNA 4PXBA 4JI8F 3HM9A 2K1RB 4ZVOB 1YK9A 3O3LA 3HHLB 4O3RA 4B9LA 2Y1IA 3SSRA 2V68A 2VQFJ 2RVJA 1X9SA 4NE9C 3QSYB 1R6YA 1VQSA 2CQBA 3NP5A 3MM7B 1VC0A 2KXHA 1MMDA 1KOHA 3LQVA 1UWAA 4X64F 3D0IE 2HRYA 4DPTA 2WSEC 1NK0A 5F8GA 2FHJA 1UEKA 3K7RA 2DHHA 1CLFA 5HVFA 3PO5A 3U7JA 2XG8A 3H5SA 2KL8A 4DWIA 4A8QA 2V2ZA 3VVTA 5CZVA 1RTDB 3DRSB 1B4SA 3D2WA 4L75A 2XGQA 5HANA 1N34J 4B3MF 1U2CA 1L5UA 2IVFB 2X3DA 1MG7A 1J2VA 3D6MB 4PYDA 4Q5VA 5KG6A 5AXKA 1I51B 3NRBA 5D78A 3N6MA 6AT1B 3HK2A 3MR5A 1NHKL 5SZTA 1C0TA 1NK7A 1UA1A 1ZOTA 2K3IA 1RTHB 2K8GA 1S1VA 3W8PA 4R0JA 4A48A 5IT9Y 2ALYB 1HD1A 1ZS6A 5D15A 4USJC 3AXMA 3KJVA 1SKRA 3FFIB 2XMKA 1OIAA 3UCGA 2LA4A 3K89A 2Z30B 3KHRA 1WHYA 4C3LA 2DCUB 2XCPA 3OFEA 4WYLA 3K5LA 5B0DA 3R27A 1S1UB 4DSFA 4TY8B 3PW5A 2EKNA 2B8PA 4Y65A 4LMZA 2DNLA 4UY85 4RW4A 1QUPA 1FXDA 1UEUA 3FBBA 4LREA 2D3ZA 1TKXA 4I6YA 1WSRA 1NPPA 1CSJA 2QMXA 4EFAC 1LNQA 1S9EB 2AYMA 3K8WA 4CCHA 1LQ9A 1RT7B 2C2ZB 1I1GA 3IGVA 5GAGI 5KG3A 3UD4P 4IOAQ 1FEHA 4GKJJ 3D1QA 4FBTA 2Q3PA 2NREA 5D4PA 2QA4G 2VG5B 1HNZJ 3VVUA 4DS5A 3J81U 1RKIA 2JHEA 4CNYA 3HHLC 4DPUA 5M2PA 1N5SA 1IR2A 4OZ3A 2PEHA 3U27A 1FFSB 1SVDA 1LOUA 2IVMA 5KOXA 4ZA1A 4LF7J 1TKZA 3W9JA 1G3OA 3H5XA 5I3UA 3HD2A 4JV5F 3JTNA 5LJ5Y 1JLAA 1XIQA 4J9UE 3U1LA 2DPIA 3MMCB 2RT3A 4K50A 4DS4A 2A10A 3O1LA 3Q0AA 4MK9A 9ATCB 3MI7X 2DXFA 4OLPA 4NLTA 4ZVEA 3MR6A 3DM2A 4FNHA 4M63A 2LECA 4RZRA 1QJHA 4NLQA 3BBFA 2AHOB 3HHEA 1VQYA 5IV3A 3M1VA 1X60A 4ZDNA 5ADZA 1RQ0A 2E5IA 1VQOS 3FNNA 2DJWA 4FXVA 3UE2A 3ZXWA 1CS4A 4DQSA 1YX2A 1XK8A 3N0VA 3THTA 3AQOA 3S8SA 2XYHB 4O3QA 4B3RF 2PI5A 3I6PA 5E33A 3LWMA 5B7WA 2SXLA 1G2EA 2DXEA 2KH9A 2QGFB 4Q0BA 2Y8YA 4USVA 1Q7LB 3VV2B 4KO0A 2KVQE 4I6WA 3L3CA 3OHBA 3OW2R 2B43A 2DIUA 2HBZB 2BW7A 3UQSA 1KLMA 3I9V9 1RAFB 4BDPA 1TKXB 1S4EA 2NS1B 4OI0A 2MB0B 1WC3A 1REGX 2J6TA 1YJWS 3M8QA 1S76D 5KFWA 2ZHAA 1HNIA 3MURP 2WB1D 4W98A 1X9MA 4NI2B 1NSAA 1Y10A 2EFVA 2HHXA 4NLSA 3G71S 3TUJC 4MMOA 2F7VA 4PG4A 4USMA 4DFKA 3GCXP 2AGOA 2EI5A 1YQHA 1HYSB 2BYCA 2ZH2A 4ZVGA 4WU3A 4LR9A 2BEFA 1QUVA 4QYZK 5ETNA 3KKFA 3LF0A 4OYMA 4ZITA 2O1PA 4WWSA 3ZZRA 1SQFA 1TL7B 4AFFA 3LP2A 4WP9A 5ETSA 5C42B 1DLOB 5KFZA 1X4BA 2AJFE 2JLFA 2H1YA 2YQ1A 3ZZOA 4PQUB 1X9WA 2JEGA 4DX6A 4F50A 3W62A 4DPXA 4NLYA 2OFGX 4BC9A 2AW0A 4UOHA 4DR1F 4Y0FA 4YUDA 2XHWA 5DM6Q 2K7KA 2J9EA 4L3NA 3IR6B 4QIEA 2QIFA 4USWA 3QFHA 3QNWB 3H2VE 4J9KA 4KC5A 4XAKA 1HNWF 3GB0A 4YOEA 1VC5A 2ERRA 1NMEB 4TU9A 1NDLA 3V6HA 2DNRA 2GX8A 3PM9A 3M1VB 4ECRA 3LPEA 3MM5A 4YB7A 3IRXA 3MAAA 3EVOA 1RUSA 2Y0BB 1CS4B 1XMBA 4ZCLA 1H7XA 4EBDA 1KEKA 5K9FA 4X4QA 1NDKA 2N82B 3IO1A 1P27B 2P8IA 2E29A 2YVSA 2DEIA 3T5HA 1QSLA 4G1QA 4HACB 5HATA 3DDIA 3HSJA 2ROEA 4DSJA 3H42A 4WTOB 2HGLA 2BVZA 3OTOJ 2XBPA 4DZ6A 4Q0BB 2WZ1A 3KFWX 4ZCIA 4KO0B 3EZ5A 2QJ3A 2BV3A 1K44A 1KLMB 4V19X 4UT4A 2FJVA 1IXKA 2ASLA 3M8QB 1RAGB 2XMVA 4JUZA 4FZVA 3AT1B 2NR0A 1SQGA 1X4FA 2J9DA 1D09B 4CTAA 1S0VA 4BBYA 1KBRA 4YDDB 4USIA 5G0RB 4RWWA 3HX9A 5C25A 4N47A 2OSQA 2G13A 2BJ9A 5CABA 5B0EA 1KONA 2GQCA 1TVRA 4LSNA 1C1BB 1D9AA 2E5GA 4ES1A 1MU2B 1SJ1A 3UCUP 3CSKA 1RWKB 2AJ1A 1NB2A 2ZEJA 4GC7A 3OR1A 3SDEA 3W3SA 1TELA 2CPDA 3NGRA 4Y6IA 3KYLA 2BW2A 2QA1A 2V50A 1RCOB 4NCAA 4CLUA 3BV8A 1VRUB 2ZVIA 1NKBA 2M9KA 3QYYA 2CQCA 4H4KC 4PWDB 1X7VA 1RK8A 2F9JA 4Y2IA 2UUCJ 2H9ZA 2XO7A 3M8PB 4LBHA 1RWMB 4R5PA 4RW8A 3WC2A 4NLPA 3C6UA 1F0XA 4ECVA 5CH7B 1NH7A 1ZAXA 2BRKA 2HQIA 3FUYA 1VQ7S 4OX8A 2UXCJ 2ATLA 5I4MA 2HNZA 3MMJA 4J9NA 4XO0A 2FJEB 3M8ZA 2Y0SD 4EMDA 4LF8J 1HNVB 4G1QB 5T41A 2Z57B 4PRFA 1HPZA 3W64A 4CM2A 5BYQA 1N5YA 4NXNJ 4FF2A 1IBKF 3TA1A 5MLCV 2BBEA 3QT5A 5E7OB 2FY1A 3LP0B 1S77D 2CVIA 4K0KF 2YNHA 2MMYA 2PI4A 5KFTA 4CLYA 3ZZZA 5HP1A 1KVJA 4ECUA 3TUIC 3KG0A 1BWVA 5CCLA 2GQ2A 2P9GA 2AP6A 3D68A 5HROA 2DRDA 1ZH5A 4DZDA 4ZPWR 2R8JA 2E1AA 1R3NA 1EQ0A 1U49A 5DQGA 4CO0A 1KRPA 1FF2A 1GQEA 2X1AA 2W9CA 2D7SA 3ULHA 2KG0A 2CNOB 4QU7A 3V2UC 4QZVB 1SUQB 4F02A 3F73A 4CT8A 1Y5LB 4LF9F 3NCQA 4KJIA 4LSNB 1O5JA 4DV1J 1RYRA 2XMJA 4C11B 1NSPA 4F2RA 2UU9J 4P9SA 2VJVA 3K57A 3D1HA 3OR1B 3HDSA 3RBEA 2IBKA 5KFOA 4QR1A 3ITHA 7FDRA 4DR7J 1SC1B 3ZO7A 1RHJB 4DR2J 5B08A 1U2RA 2EBGA 4MKAA 1HLWA 3KK3A 3OXFA 1AB8A 3MCMA 3CJSA 3KTQA 2DHSA 1TP7A 3SMZA 4MK8A 4ZLJA 1JQGA 5LJ3Y 3AJDA 4WE1A 1C1CA 4RNFA 2XI3A 3OJUA 3ILOA 3R3TA 1U47A 3QIPA 1RT3B 2AWZA 3J7YI 3DRRA 3BKUA 4OFZA 4U7CA 1SKWA 2ZKTA 1RAEB 5KFMA 4UOCA 2BJ7A 2ZM6F 2ZDOA 3P5BP 4ZN1A 2HNZB 2BKOA 4OHWA 2HLUA 2VBWA 3EMTA 3IP0A 3CUNA 2C3OA 1FWLA 2CZVC 4Q2LA 1S1XB 3GV5B 5LXRA 2GC8A 2FZGB 3JQKA 5M2UA 2YKMA 1YJ7A 4ICLA 4TLRA 3AB2B 3KLIA 4X64J 1JX4A 2P6SA 2Y1LB 1JB0C 5J2PA 1N5YB 3G96A 4U8YA 3JSYA 1W2IA 4B9SA 3QT7A 2C2NA 5HSPA 4EZ6A 5D4LA 1YJRA 3M6VA 2ZH6A 1T9TA 4ER8A 3AA8A 1NCLA 2XNQA 3TA2A 2ZOGA 2IBOA 3PYDA 3HHNB 5F8IA 2RSQA 4B3MJ 4YR0A 2GS8A 3ENWA 3WIUA 4B9NA 1TK5A 5LMNF 3VZIA 1DTTA 2AU0A 3EX7B 2RQ4A 1V6HA 2OPPA 2NXEA 1N6QA 1HWKA 4B9VA 4NX9A 2HS0A 4I1TA 4JBCA 4TYBA 2OD4A 3P5TL 4UZBA 2L48A 5KG1A 4A8WA 3P96A 3OSNA 2GJFA 3UCZP 1LWEA 5KG4A 5IZHA 1OJ4A 4ZN3A 3IBFB 1NH8A 2E44A 4K4WA 4CLWA 1F3FA 1HBMB 5EN1A 1HQ2A 3CJ2A 4DL0C 3KK1A 4EGLA 3DOMB 1B0VA 1SL1A 3SCKE 3LUYA 4F2SA 3NWRA 3IWLA 1V5IB 2DGUA 4RL1A 3EUNA 1FKOA 2QG9B 4MKVA 2PT0A 2JJ4D 5B0FA 3K8VA 2LFVA 3N28A 1A0OB 5A6PA 2MZJA 4ZLPA 2W9BA 3MF5A 3J80Y 3G2XA 3B78A 4OJHA 2CDQA 4IR1A 3MPUB 2R7UA 2DITA 4F4KA 2WBRA 2DRAA 5A76A 2LQJA 5IQ6A 1FDAA 2Q79A 1DQ8A 2YKOA 4ETXA 1KQKA 5D0GA 1F2GA 1FRMA 2KM8B 1OQ6A 4KGZB 2ZH4A 1PSDA 3AOAA 4ES2A 3I0RA 2UXDF 1KHWA 1L3SA 1RT1A 3Q2SC 2BQ3A 2LVWA 2WVBA 2QT7A 1IKVA 3QGIA 4K5RA 5FD1A 1BQMA 1S1WA 2DVIA 4ICLB 3QPIA 5K20B 2I5JA 2ZH5A 3MD3A 3V6DA 4C6AA 2LEPA 4ELTA 2X7IA 2XS5A 4KKOB 3Q8RB 3UI3A 1FD8A 4RUAA 2QN6B 5GAEU 4N8NA 2OEKA 1FK9B 2GMJA 1FRLA 1WI6A 2HZAA 3KWMA 1WJ9A 2EBEA 4HTJA 4PKDB 2FLLA 4PPZA 4JV5J 2X1BA 2DHGA 4WCEQ 2Z4PA 1UAWA 3DRXA 2EFGA 2MZTA 3MUVP 5L1KA 3OFGA 2CXEA 1YLXA 4NCGB 4K59A 4CYUA 5DG9A 4UF4A 1UP1A 3NXZA 4KIAA 4YB5A 1N6QB 1N5TA 4Z7CA 1HARA 1VJWA 4DG1B 2MDAA 5CYQA 4F0MA 3D0HE 2W24A 4ZLNA 2FUG9 1GMVA 3VZHA 1S6PA 2PMHA 4Y00A 3BGUA 4RO0A 4RBVA 4CM0A 2DRBA 1U1NA 2X1FA 2AT1B 3KK2A 1FRHA 2B4UA 3FSXA 2GO9A 3CE8A 2EC0A 1ZYQA 5J2MA 4GC6A 1UW9A 3QT8A 3CCSS 2CNNB 4B3RJ 5HAOA 2RS2A 3GYXB 3LP1A 1NK8A 1HBUA 3N79A 3C15B 1I3OB 4CLKA 2J9CA 3FK4A 5ITHA 2H65B 1HD0A 3VF0B 1QVGR 3V4MA 4PXCA 5J2NA 3MHYA 2VZ9A 1S7IA 4Z7YA 2FZCB 3D1OA 2FYXA 4PQAA 1A7GE 2ZBCA 4DUTA 4OJ1A 2HWHA 1M5SA 1RT1B 4J5OA 1Y3KA 1PJ6A 4G3IA 3CD0A 3A8KA 3BGLA 3M30A 4QIGA 2WVDA 3M8YA 4ZVHA 1S1WB 2KYXA 5GAHU 2E1PA 1TL1A 2I5JB 4LRDA 1U45A 3D9BA 2KM8C 2DGSA 1UVKA 4RR5A 2G0IA 4QWDA 1T03B 2C42A 3EM1A 2MEWA 3PRBA 1KLNA 1S9GA 3ADAC 2ZHOA 4QIFA 3DMJB 1FKPA 3TYTA 5CCMA 4QR0A 5J1EA 5EDWA 1VQKS 4AXIA 1CBKA 3FQKA 3H8YA 2FVQA 1JXEA 5EWEA 2HK3A 1YI2S 1SC6A 2GA7A 1HW9A 1JLCB 1OMSA 4DR1J 3DLEB 4NMXA 1LWFA 4KE5A 3RW6A 4ED6A 3BJYA 2Z56B 1Y7PA 1Q53A 3C14A 3W61A 4DCOB 1TU0B 1XEZA 5A8RA 1B0TA 1HNWJ 4KHPF 2HGMA 4L3KA 5CAAA 3K59A 2EW9A 4OI1A 5EHHA 2IA0A 3DGPB 3Q8YA 3UN3A 4HEA9 3GFXA 2CG4A 4ED0A 2AF6A 1U25A 4C97A 2CQ0A 4KGXB 1RDRA 1SCJB 4ILMA 3B4MA 2R8GA 1D0EA 4KV8B 1AXQA 5HMZA 3R2DJ 3HMJG 4IO9Q 1AROP 2MQ8A 3A3NB 2W2MP 4N41A 4WTYA 4ED7A 2ZC4A 3E01A 2IDEA 2NZ4A 1CC7A 4C3KA 3OVBA 1YSJA 3CCLS 5DM7Q 5F3ZA 1T02A 4LR7A 2BOAA 4J37A 5LOQA 4LRAA 3UVJB 2FTRA 1S10A 4C98A 2NSBA 1H72C 4ALZA 3AD9C 3BKTA 3RRGA 1WC0A 5AXLA 4ZHRA 2IMWP 1FA0A 2MQMA 3GIRA 4C3MA 3M32B 4D3GA 5E3PA 3CDAA 1WHWA 1YJNS 1U1OA 2DNQA 4O4RA 1F5BA 4MIBA 1S1TB 4U8VA 3FCWA 3T5JA 1J5OA 3JB9k 2MYFA 2NSCA 3HO1A 1VI7A 1SPBP 1NNDA 3CJ8A 1CJUB 4YHHF 2CQGA 2AGPA 4OHVA 3MM6A 5J1EB 5D8HB 3CJKA 1K1SA 4PUOA 2VFRA 2RU3A 1TMJA 2IAJA 5IT0A 1Q4RA 4OX7A 1N54B 3NEKA 4ZPAA 4ZVTB 1U1QA 1PKUA 2HS4A 4NMLA 3BSNA 1LWFB 4PEOA 2M0GB 1LWCA 1SV5A 1CJVA 3C14B 3LAMA 4X2BA 1TAUA 1XERA 1LEOA 2PMZD 3U1NA 1ZA2B 1RT2B 3H4DA 1PBAA 4TXSA 4OV6A 1M0SA 3B8HA 3ILJA 2VPXB 2WRMA 2U1AA 1HBNA 2OTJS 5KFPA 3DC2A 1C4CA 5L8RC 1U0HA 1P9YA 3ZTSA 2PDAA 3VQSA 4HR2A 2RE1A 3BPDA 2B6AA 2QMUB 2MTLA 1IBKJ 3ZNUA 1B99A 2QX0A 2O5DA 2QZ8A 2IM1A 1FRJA 3PFEA 2OEMA 4IG0B 2CQPA 3CCZA 2IJFA 2H3EB 4K0KJ 3MMBA 2AEFA 3LGMA 3NBPA 2R7RA 2VUGA 3AH6A 4ZIVA 1JLGA 1BY9A 1S59A 2WW8A 3R5CA 3G8TA 4JV2A 4USTA 3RUBL 1YRTA 3R5DA 1H7WA 5KFYA 2G4BA 2B3TB 1RWXB 3MD1A 3UWTA 4Q8FA 2AMCB 2MJUA 4DX8H 2OIHA 3CB4A 2HNDA 3THVA 3DLHA 2J5AA 2A6OA 5HQLA 4HYKA 1V3SA 4DL6A 3QQCD 2VDIA 1T7PA 3SZ2A 4ENOA 2J0WA 1FVSA 4YY3F 3NNAA 3WZ0A 2Z0GA 3CWJA 2HVZA 4LF9J 2XLKA 2HBRB 4RJVA 4DFMA 3CJ5A 1U1KA 4NOHA 5EGYA 3R5BA 4FN5A 2UUBF 3DI6A 5JVGQ 3RGIA 1NDCA 4URSA 4NASA 1ZTWA 2BRLA 5HQMA 5DG7A 2A18A 4E98A 3DRPB 2HLTA 5AE2A 2H54B 1VQPS 4KHRA 2R2UA 2G2YA 1SV5B 3PIPQ 2PA8D 3MR7A 2AZ3A 4K2JA 2BQUA 3QFWA 4DEZA 1Z1ZA 1Q78A 3RR8A 2VHGA 2QFIA 5I3PA 2ZM6J 4I68A 4ANCA 1M1HA 4URQU 3VGSA 1FFGB 2AYEA 4FS1A 2B56A 1NZAA 3DLBA 1MWYA 3UN2A 3P45B 2PFFB 3OR2A 1VQLS 2HVHA 1M1GA 2NPIA 2EKYA 4MFBB 4RW6B 2G0CA 1Q8BA 3W5YA 4R0EA 5H9EK 1P8GA 2JC0A 1KQGB 4FYWB 2V5HG 4OJ3A 4U67Q 2V9WA 1MSWD 1RAAB 2OELA 4M5MA 2DCLA 3GFYA 4EU0A 3HVTB 5BXIA 3PYEA 3RBZA 2FB0A 1ZBTA 2UUAF 1JJCB 1Q7YT 5D0EA 3US5A 2KT2A 3R7SB 3I96A 1XMQF 3KNAA 1O6XA 3PHEA 3OUYA 5IV4A 1P1TA 3TR5A 2E66A 3FRYA 2GJ2A 5D4NA 3TZYA 5LMNJ 5LL6d 1GEHA 2WVCA 2I38A 3BYRA 3LALA 4F04B 2EC2A 5LSRA 3V81B 3MEDB 1E6VB 4IG3A 4KQZA 3MFHA 2CQ2A 1C0UA 2GMHA 2IYGA 2LXIA 2OTLS 2M7SA 1Q86T 1BWEA 3MEKA 1YRXA 5DETA 1MMLA 2J6SA 2GVZA 2J0QD 1NU4A 2HS3A 3F0NA 1KFSA 3CCUS 3D54A 3I5AA 2DH7A 2GHVC 3Q8QB 4IQXA 1QD1A 1TTHB 3R8YA 2J6UA 3JXOA 4JI2F 4QPXA 2MPUA 4DV6F 1HKAA 4K4XA 4EYHB 4LF6F 5I42B 1DHMA 4RU9A 2MY8A 1O0PA 3RZAA 3NL0A 3DLKB 3G8SA 5DO2A 3POTA 2ZUAA 4UUWA 1JJ2R 3RBXA 4DSIA 3GR1A 4NA2A 3I56S 2OAUA 1SXLA 3OSPA 4P6QA 1GTHA 4DHVA 2HNYB 3VAHA 4JI0F 4LSZB 2DR6A 2V4JB 1H38A 3HXMA 1IKXA 3TAPA 2VBZA 5HMXA 2FVPA 1VOMA 4DSKA 4A8MP 3DYAA 2XS2A 1AUDA 1T95A 2ASDA 1MNEA 4DPWA 1PILA 3SSQA 1OY6A 3BREA 4RUHA 2UXDJ 2CYYA 5I3QA 1R6VA 2QL9B 4ZJOA 5EWFA 5J1NA 3KMSA 2KZZA 4XK8C 4NYOA 1D9DA 3KDOA 4I2PA 4NYZA 2KHCA 1ZETA 1WTFA 3J80U 4USHA 3ISNC 3T6BA 4Z37A 5GAGU 3DLLQ 2ZE2B 2CPXA 4RX6A 1VGYA 4WXWA 4ETZA 2AZ1A 4ED3A 1XR6A 3OXLA 4DN0A 3FZ2A 1EP4B 1RTZA 3R97A 4LR8A 3UR0A 3O5TB 2VG7B 4QBUA 3AHPA 4M5NA 4K2XA 3MM8B 5KT5A 4ED5A 1T05A 3OUYB 2MQQA 2QLWA 2LU1A 3TUZC 2CNKB 2BANA 1T3NA 1HI0P 5G4DA 3QAUA 1B7YB 2MJNA 3DHWC 3RAQA 2DKOB 2BOPA 3ZZTA 3VR1A 3OFFA 3FRZA 3ZZUA 1LW2B 3DDNA 4KPCA 2WVFA 3M6WA 4K4SA 1NJXA 3DXBA 4F3MA 4IYQA 3W2VB 4LRFA 3G9CA 3T19A 4I69A 1RACB 1JJHA 2A2DA 1RTIA 2R7OA 5FDLA 2OHDA 1WSVA 1NKEA 1ZZNA 3F56A 5L46A 2BZ2A 4I7FB 1RCXB 2RQMA 2FPHX 3TZXA 3R5AA 2MSSA 2GVDA 4OHXA 1YITS 1U8SA 2HFNA 4OHYA 3WX8A 2IA6A 4HT5A 1GX6A 4DSEA 2CPZA 3W7BA 1KTVA 1WTBA 1M90T 4CLTA 1EIYB 1M5PC 3O44A 4CLLA 3C19A 3KLFB 4HI2A 4OYWA 2EVZA 4F25A 4LQ3A 1HWIA 1VC6A 3DYAB 1RHMB 2I6WA 2IM2A 1GAOA 3RTVA 4X4UA 1KVKA 3PYFA 2XWXA 1YBTA 2R8KA 1R7IA 2RAQA 3KLHB 3ZNJ1 2F65A 3MECB 2OKQA 2D9PA 2HBQB 3HHLD 2H4YB 2WAQD 3U1MA 1MW7A 2JL9A 3NCPA 5KAKA 3P4UB 4ZS6A 1U2FA 2V63A 1V9OA 5IT4A 3KLEA 3CJ3A 3M9OB 4IH7A 2FJAB 1WHXA 2FC8A 3CCRS 1FERA 1BD6A 3MR3A 1EHWA 4O44A 4M5KA 3GTYX 4ZVSB 3E51A 1G6BA 2RD5C 1W7WA 4HDGA 3HSZA 5KT3A 1WC5A 1SJRA 4H4MA 1TUGB 2VB6A 1EARA 1RTJB 2ZJQQ 2YNGA 3EDRB 2V8VA 5J2QB 2AGQA 3CCMS 3GR0A 5CA5A 4PAAA 2VQEF 2AEJA 1YIJS 1VQ5S 1YJTA 2G9OA 2DY9A 3PKMA 4P2SA 4KHPJ 2VODA 4CP5A 3MEEB 2OPSB 8RUCA 2GGPA 3MXHP 4QIVA 1VMBA 2X51A 4MKBA 4ZPTR 3MCNA 2ZD1A 3MPDA 3QJPA 5KFEA 1H2UX 4KH1B 4PCQA 4BS2A 3CIMA 4PG5A 5L1JA 3HULA 3PJWA 5HLFA 5KTQA 2UVWA 1JKHA 3UR3C 3K0JA 3M4XA 4ECYA 2BX6A 1WD6A 1RT6A 3Q23A 3NG8A 3V6JA 1SBRA 4WKYA 5ETTA 2CQ4A 3PIOQ 3GV7B 3R1LA 3NS5A 3N4WA 2AYBA 1IBMF 1KR4A 2CJAA 3CCJS 3PW2A 2V69A 3TARA 1CVJA 1S6OA 3GJSB 4K4YA 2JEJA 4LRCA 2HMIB 4LF5F 1Q79A 4NPOA 2M4MA 2YH0A 1HNXF 2IC3B 3KLGB 1REVB 3ET6B 4CWBA 1CQMA 5HVGA 2VG6A 1K1QA 2MLXA 3P6YC 1TL3B 3PXGa 3Q22A 2PO4A 2B4PA 3BN7A 1T3OA 3GYNA 3DHXA 1RA6A 4TVAB 3PX4A 4ID5A 1WC6A 2L41A 4YHHJ 2G1HA 4NLVA 1VQMS 1HBOB 3CCES 2F5GA 4IR9A 2A1BA 2HIYA 1YBUA 3CVKA 3PNIA 3C16A 1Z2ZA 5KFKA 2DIVA 1WOPA 3CIZA 4E2FB 4L76A 3PG9A 2E1CA 4TNOA 4IFVA 2FJWA 3PO4A 1BQNB 3NGUA 3D6HB 4I2QB 2F8HA 4M5DB 2VA3A 1TZ0A 3SI8A 3IS9A 4IDKB 3K5MA 1EB0A 4ED8A 2HGNA 2BJDA 2DXDA 2XSJA 2GGPB 2Q6CA 3MFIA 2BJEA 1NSKL 1VRTB 2R42A 1QAXA 1WEZA 4F3OA 4ZPBA 2PMWA 3P49B 3IM9A 1DBDA 4JI3F 1B3TA 1WOOA 3R9LA 1U1RA 2IY5B 4OZLA 1NBEB 3HPOA 5HLFB 2NYIA 1JKHB 5C24A 3AAWB 3MM9B 1BMQB 2B4VA 3PEHA 4JI6F 5KG7A 2LDYA 2C1EB 2AX1A 2FVRA 1U4BA 1S6UA 2XZDB 4UQGA 2RJZA 4A4JA 1L3VA 3EGZA 4ZVRB 2CIMA 1P1LA 2V4QA 5M2RA 2HG4A 2VF3A 3Q8PB 5CYMA 1B7FA 3FSYA 4CLSA 4WFYA 1TFWA 2E9RX 2LQ5A 3N6NA 3DOLB 2XGPA 2RRAA 3TNVA 4ZVUB 2VG6B 4ZVQB 1NJYA 7AT1B 4YY3J 3VAKA 3QMQA 2DNMA 1AFJA 2YWWA 4I4BA 2ILZA 4NRUA 4QR2A 2DNKA 2HAFA 1H6KX 3VHQA 4BHQA 4MYUA 3CF5Q 4ZVFA 2UUBJ 2E9ZA 2F4FA 3EGVA 4IFYB 5CYJA 3IG1A 3FC9A 3A3PB 3D0GE 2R2SA 4CRJA 4P2MA 5ETVA 4R8UB 4P73A 4O3PA 3QLHB 2MKCA 4IFVB 2RDDA 4DU8A 3TJ8A 5A8WB 3QO9B 2CQ3A 4JI4F 5RUBA 3ETMA 3C66A 3W2WA 3THPA 2XSJB 2OPQB 3B6BA 4CZCA 2MKJA 2JLEA 2QC3A 2W2OP 1ZM9A 1YVFA 3J7YU 4LSLA 4HLBA 2NLWA 3MAQA 1R8PA 3JTPA 2KVIA 1JLFA 2ZH8A 4G1IA 1IKYA 2WONA 4OYPA 1RHUB 1RAJA 1R8CA 5C24B 1DTQB 4JV1A 1YJ9S 1ZM4A 1FTRA 1VYAA 3G86A 2J8SA 2ZNYA 2P6TA 1DQAA 1YZ7A 4UUXA 3HSGA 1ZPWX 2D3OR 2RF2A 4QYRA 2UUAJ 2BE2B 3GJTB 2R7WA 4I56A 5D3GA 1XMQJ 3BM7A 3AFGA 3CMES 4Z2XA 1KKHA 1NJZA 4OHZA 4GKKF 4ZPVR 3DOKA 1S9FA 1T0TV 2NXUA 2PN6A 2JZ5A 2MXYA 1RT4B 5HO4A 2MQPA 3TANA 2AJ2A 2UUWA 1Y5IB 4I0WA 1ULRA 2M88A 4K4ZA 4PG6A 1SJQA 2M5YA 3OJSA 2F1FA 5LXYA 3G82A 4LF4F 2CWKA 2RKIA 1WKLA 3H5UA 1VJQA 4TY9A 4EK2A 3ETOA 4DOZA 2P2CB 2KFYA 1M5HA 2BE9B 1EAYC 2M8HA 3GWCA 4NLWA 2DNZA 3D66A 3JQMA 1EETA 5DZ6A 2E9TA 1B0PA 1HFEL 3SXLA 3TRGA 3I87A 4JI2J 1VHIA 5K8OA 4DV6J 3OTBA 5DLGA 2FDNA 4LF6J 5T7LA 1HMVA 3OFHA 2MGZA 4YFUA 3TVYA 4LRBA 2WBMA 1S0OA 2CDRB 1ROFA 1CJKB 3RBDA 5D6GA 2D41A 1SIZA 2HBYB 2A2CA 4C7QA 2F3JA 2L9WA 2DGOA 2MHEA 3HVRA 4JI0J 1SKUB 3GV8B 3GG1A 1RHQB 3GQCA 1TKTA 4M5LA 3BGRB 1F60B 1MN9A 1YZ6A 2HIQA 3G4SS 2ZOFA 2VL1A 1VBZA 2LEAA 4YP3A 2Z2LA 2B8QA 2J0SD 2HQDA 4BWJA 2FJDB 3H2UB 2HFVA 1JMTA 4GO7X 1CJTA 1RP5A 1AZSB 2YWFA 3R1HA 4J9OA 2RS8A 3A8IA 1WF2A 2CQDA 1XC9A 2YNIB 2J76E 4RW9B 2XB2D 2FLNA 2EK1A 3OL9A 2KDOA 1NSQA 3JSRA 5KFGA 4USKA 3X1LB 4OL8A 4ECSA 3D28A 1OWXA 2OFHX 4G6VB 1MROB 1VQ6S 4ELVA 3JS9A 1IR1A 1VBXA 2V34A 2YXLA 1K73T 5FJ4A 4ZVPB 4JP8A 4ZP9A 2HHQA 4CH0S 4CLFA 2PD1A 5BR8F 2H5EA 1DARA 1IJFB 1TMMA 4HHHA 5H1SV 1M5VC 4V19J 2ILYA 4FVCA 4DX5A 4A8FA 1FI4A 4DV0F 2I9SA 4E0DA 1L3UA 2JWNA 4ERDA 2CQ1A 2O3DA 4IKAA 5F9NA 3RW7A 3OL8A 3UDLA 2C2MB 3IWXA 5KFFA 4WBFA 2JC1A 1OS5A 5C2GA 2G2ZA 5H9FK 1RT5A 2BJ3A 4DR3F 3CJ4A 4UY8T 4LF1A 1RLDA 1X5PA 1FHTA 3CJRA 3P3DA 3SQGA 4M1KA 1RWOB 5T7LB 1JWWA 1HMVB 3CO0P 1OQ3A 2ROPA 1C0TB 2UVVA 2EFPA 1NXIA 1ZTTA 2G0JA 1I5OB 1KN6A 3HFVA 3LOUA 4E8UA 1CPZA 3BQ0A 3QSIA 4M94A 3E3XA 5AT1B 2KJWA 3QBCA 3P8BB 1S1VB 3CJQA 3NS7B 2OMOA 4WFAQ 2GCFA 3C2PA 5A0YA 1JIHA 1FNOA 1JLBA 3KJVB 1HWUA 4PG8A 1NO8A 4OIXA 3GCWP 2GJIA 4ILLA 2YWHA 2R4FA 2HRUA 1WUUA 1A9NB 3T1AA 2QFJA 3DNCA 3W5ZA 1RU2A 1S49A 1NK6A 1IKWA 3F44A 4RW4B 2ACMA 4IO1A 2VONA 5DDOC 3TI0A 1NM2A 1PCAA 2RQCA 2ZDPA 5E5NA 2ALZA 1RISA 1RWPB 1JLQA 3RG6A 4NZ6A 5F8LA 2VBXA 1T9YA 5L9XA 3R2CJ 5IM0A 2RRNA 2M3DA 3MCOA 4XTTA 3GIJA 2VPWB 3PVXA 2VQEJ 3OT9A 1XQIA 1XR5A 1RGVA 4XIUA 2DNPA 2VH7A 4WU2A 3CD5A 4RW7A 2ZBIA 3S7RA 2BM0A 4LVNP 3KOAA 1H3DA 2AQ4A 1UFLA 1GK8A 2OP5A 2XI2A 1PGZA 4WP8A 1UWBA 1TKZB 3EXYA 2M52A 1IM4A 3HCXA 2FGOA 5I3UB 2HHUA 1TL4A 1RYSA 2AKWB 2DR5A 5HMYA 4B3OA 1H2VZ 1JLAB 4X4TA 3SQGB 2C2OB 4OYIA 3A4TA 4C8YA 4EYIB 1UETA 2A3JA 5SUHA 2CJKA 2H5JB 3TW0A 2DH8A 2FJXA 3LGNA 2CWXA 2W4CA 3HP6A 2DO4A 3DM2B 2IJRA 2RIJA 4NLUA 4LT6A 4F7VA 4DR4F 3GP9A 1V3ZA 1U0SA 4LVOP 1JLBB 1IBMJ 2BM1A 5KFUA 4NCBA 4ZCKA 1S7HA 2IPOB 2VOPA 2YX1A 4K7QA 1X4HA 2ZZNA 8AT1B 2XS7A 4LF5J 5AE3A 3PW7A 1HNXJ 2F63A 2OD6A 4DX7A 4OX9F 2W7OA 3QGGA 2F8MA 2JEFA 1T9XA 2NYHA 1IBLF 3MR2A 5AJ3F 1S48A 4RNHA 4K4TA 2CUYA 3H0PA 2W01A 2WVEA 5KFHA 2CPFA 2HK2A 2VPZB 4WPAA 1W25A 2YKNA 3BB5A 1HNIB 2R8HA 4FXDA 3KDNA 4PWWA 4PXEA 3JAMY 3MPWA 2RH3A 2CPEA 4EZ9A 4C0HA 4OYZA 4K8RA 1RWWB 1RXOB 2FZKB 3VQTA 1DFDA 1ITPA 2P9EA 5LSLA 1JLEA 1SB6A 3QGPA 3GJQB 5L1IA 3LP2B 1QE1A 3PJXA 2XY6A 4KHMA 1WG1A 2JFKA 2QLXA 3ZC4A 2NQPA 3LAKA 4JI3J 2AJ0A 1FWKA 1Z2LA 2XSFA 3MAHA 2QRRA 2ZITA 2XWYA 2R9LA 5DGBA 5DDRC 2IRUA 4J9LA 4YS2A 3W1YC 3MCSA 4WFXA 3QAEA 1J27A 4HKQA 1TK8A 4JI6J 2DD8S 5FIIA 3N6LA 1URNA 4ZPDA 2N7CA 3ENQA 2V9KA 5K8MA 1NJIT 1Y11A 4FYYB 1CQNA 1IVZA 4UQTA 3IBCB 3MM5B 3IRXB 3MAAB 4F0HA 1UPPA 3A3OB 4ZOSA 1TQLA 2KI2A 2XY5A 4GVLA 3M05A 4TN2A 3MZIA 3T9NA 5THWA 2RDJA 2HURA 4X62F 1WDTA 3LA0A 3PEJA 4PWUA 2AD9A 3BSCA 4CIOA 2FY8A 3RRHA 2LQ9A 5IC4B 1HQEA 3GIIA 1KQSR 3J81j 3D3BJ 4W90B 2E5JA 4HH1A 1LXNA 3BO3A 2UUTA 3S6EA 1ZPVA 3AXKA 5CQGA 2YBVA 1S6QA 2CPHA 2QE5A 2QA4S 3PFOA 3UNYA 2DNYA 1SC3B 5DJBA 2I2YA 1SH2A 4RNNA 2QLBB 1URRA 4B02A 1RWUA 2XY7A 4WKRA 5A8KA 1Q16B 3MDFA 4CTAB 2CVEA 2DNGA 4GVBA 3CPWR 1N5VA 2KJVA 1QAYA 3KNGA 3MUTP 4ZP7A 3S1TA 1R0CB 2ZBRA 4NLRA 4ZP8A 5C25B 4ECTA 3OL7A 3G6VA 3TAMA 1T9WA 5EX3A 4A8XA 3GSIA 3WBZA 4OZ2A 2VJUA 2EFQA 2L3MA 3OQ2A 4JI4J 2W4PA 1X5TA 5ETMA 3BSAA 1TVRB 4FF4A 3CNQP 1DAXA 3OXGA 3EPGA 2M70A 3OTDA 1SH0A 5K8NA 1RKJA 1QE1B 5A6WA 1KOOA 3UDCA 1U48A 3CDBA 3SDEB 1SKSA 4WF9Q 5KFDA 1VBKA 5KFBA 3B4DA 2Y1RI 1O8BA 1NJWA 2CPIA 4U9RA 3LH2S 3V5RA 2J7WA 2HVEA 3MMAA 5H9EJ 1R0AA 1NPRA 5BJRA 2JLGA 3FEZA 2CJQA 3QWPA 1F9FA 3M8SA 2CJYB 3H25A 4R5PB 2LQBA 2V8GA 4RW8B 2K1RA 3C6UB 3SFGA 4JI8J 2KTQA 2CKWA 3HHLA 3L4BC 3L09A 2CZ4A 3H7HB 4ZIWA 3KHHA 4ITSA 4C0BA 4N56A 3MM7A 3F41A 5F3TA 4Y2KA 4ZCMA 2D1CA 3HKZD 5KFRA 1HPZB 2FD2A 3H5YA 2A0FB 4FYDA 2DK2A 4A47A 2B9EA 3I5CA 4TQSA 5B0AA 4LF4J 1WG5A 2CQHA 1ELOA 1GT8A 3PTWA 4DDFA 3W66A 3DN9A 4HDHA 3Q24A 3DRSA 4IH6A 3IAS9 2F4VF 2YNHB 2OI2A 5F8JA 5HP1B 1U1MA 3GU0A 3M6UA 3FJ2A 1EJ7L 2QTWA 4IQMA 2YWKA 2LEBA 1VQ4S 1H74A 5HROB 5JVHQ 2NPFA 5C7PA 3EXCX 3MEGA 4EO8A 4LQ9A 2XEXA 2BQRA 4X4VA 3JYTA 4JYAF 1AW0A 2W9CB 3UW1A 1A6LA 2GFFA 1BHNA 2QSWA 4N5SA 1KSPA 1C4AA 3OTCA 3I82A 4CLPA 2XYGB 3SQOP 1NK4A 3EGNA 5EWGA 4X66F 1IR0A 3FEYB 1R8AA 3M6XA 3GSDA 2BA9A 4WJBA 4EWTA 4C8KA 3ITHB 3LTOA 4OZ0A 2XQCA 2OMLA 1S1UA 2HVDA 4I67A 3PX0A 4TY8A 5HVHA 2X3GA 4MKYA 3CD7A 4DUYF 3KK3B 4Q43A 4Q45A 4DL4A 2W8KA 3MMAB 1NLKL 1HHTP 1R89A 1MLAA 1T8EA 4WE1B 1C1CB 3CDWA 3VAMA 3HFZB 1X31C 3VWSA 3QIPB 5IT9U 3DRRB 2MHNA 4PXDA 1S9EA 4CNZA 2C3PA 1JJ4A 2BXJA 3LW5C 1J5EF 2HQ3A 3BQ2A 1FTCA 2IM0A 1RT7A 3G87A 2F40A 3GILA 3GJRB 2Z8QA 4OI6A 2XMUA 4CO3A 4C2MA 2FVCA 5BR8J 1BXNA 2LXFA 1WACA 4MT1A 1VCTA 2VG5A 1TKDA 3FCHA 3CT9A 3BN4A 1RU1A 2V94A 2YKMB 3KLIB 4DV0J 2HHHF 1B70B 5J2PB 1QTNB 1WF0A 3PV8A 1DURA 1ZM2A 2ZHBA 3X3UA 2VIHA 2RNEA 1VHFA 3ELHA 1FCAA 3HJVA 4NZ0A 1QDUB 2RU9A 3HT0A 3CC2S 1D8ZA 3UO0A 4BLGA 4DR3J 1VRQC 4ZMMA 3MMCA 3UD5A 3IFEA 3AD7C 2C3UA 1IM6A 2CG8A 2XYPB 1CULA 1TUVA 3HVWA 3B82A 5IS2A 3MEGB 4DV5F 1DTTB 4OI4A 1N0VC 4KAIA 5HQ8A 2QEXS 1SQEA 4CI0B 2C3MA 1S4FA 1JXLA 2OPPB 3JYTB 1KP6A 4DUZF 2L9DA 4DBQA 3J7Z5 3I5BA 1X4DA 2BJ8A 3CC7S 1QLNA 1LWEB 2NXCA 4CO1A 2QLJB 3B54A 3M8RA 2RUGA 4F4ZA 3MOJB 4OYAA 5LM7E 3KK1B 3ISND 1WC1A 4MIAA 9RUBA 2HHPA 2QA2A 3I9ZA 1FKOB 3IA0A 2CJBA 2GW8A 2H51B 3VAFA 4HH0A 4JI1F 5B0CA 1UFKA 4MAKA 3TUPA 2W9BB 4LBPA 2C28A 2R2RA 3QZ8A 3AODA 3H20A 5K14A 4KYZA 2RHQB 2UXBF 1KDNA 4NXMF 3QT6A 2O67A 3W65A 3LWLA 2QSFA 3I0RB 3FDSA 4RBTA 4NI2A 3VTIA 3J7ZT 1Y4ZB 4LFCF 4ANDA 2LQ8A 4WIIA 1MWZA 3AJ1A 2DISA 1IKVB 1HYSA 3AQPA 1BQMB 2B7BB 2O66A 2DPJA 1SIWB 4NA1A 2KYZA 5IFMA 3V6DB 4C0OC 1VFJA 4Q2MA 2HFSA 3WIVA 2B9WA 1U1PA 1G7CB 1TL7A 2C2DA 2DHAA 3HLUA 4H4KA 2I0XA 5C42A 1DLOA 4U95A 4DI6A
chains in the Genus database with same CATH topology
1KRPA 1FF2A 1GQEA 3W2VA 3T5LA 3TP2A 1Z2ZA 5KFKA 2DIVA 2X1AA 2W9CA 2RKIB 2D7SA 4IOBA 3ULHA 2KG0A 2OSRA 3CIZA 4QU7A 2AV5A 3V2UC 1JNZB 1SUQB 4QZVB 4PQUA 4K5SA 3HZEA 3BGFA 4F02A 2MY7A 4PPDA 4CT8A 5JJBA 3F73A 1Y5LB 2ZJRQ 2E1CA 4LF9F 3NCQA 4TNOA 5DG8A 2MQOA 4RUCA 4KJIA 4IFVA 5FLXY 3CCTA 2FJWA 1P9QC 4LSNB 1O5JA 1RYRA 2IFXA 3DU5A 3IBWA 3PO4A 1BQNB 2XMJA 4C11B 1EETB 2YWEA 1N34F 4F2RA 3VAGA 4I2QB 2F8HA 4I7FA 2LYVA 4M5DB 2VA3A 4QW8A 1GXLA 4RNMA 1TZ0A 3PW4A 4YMEA 2E5HA 3SI8A 1S79A 3D1HA 3IS9A 3OR1B 3K57A 3HDSA 3RBEA 2POKA 3C8YA 5E3CA 4DV3F 2IBKA 5KFOA 3QWUA 4QR1A 4IDKB 3ITHA 7FDRA 4FBUA 5DRKA 4DLEA 2KU7A 2WOMB 3K5MA 4TYAA 4IRKA 5CYQB 2MGZB 4ED8A 2HGNA 3O2IA 3ISZA 1Q1KA 5B08A 4IUFA 2BJDA 2XSJA 1UJ4A 1U2RA 2GGPB 2EBGA 2Q6CA 4MKAA 3MFIA 3KK3A 2BJEA 2E1RA 3OXFA 1TFYA 3I4PA 1VRTB 1QAXA 1WEZA 1OSDA 3FSIA 3NGKA 4OX6A 1GNKA 4F3OA 1S6PB 1BQXA 2JSXA 4ZPBA 1N0UA 3P49B 3KTQA 2DHSA 1TP7A 4X65F 3CGIA 1DBDA 3KLFA 4DQRA 3SMZA 4MK8A 4JI3F 4J9RA 4LIRA 2ABYA 3NGDA 3MWBA 3KK2B 5LJ3Y 3M9MB 5C5JA 4NLXA 4RNFA 4WE1A 1C1CA 2DNOA 1TR0A 1TKTB 2XI3A 1U1RA 3OJUA 3R3TA 1U47A 4OZLA 3HPOA 5HLFB 2VFSA 2DGXA 2V2KA 3QIPA 1RT3B 2AWZA 3M2VA 2NYIA 3DRRA 4OFZA 2GNKA 3EZUA 1JKHB 1KTQA 4U7CA 4CH1A 5C24A 1SKWA 1K8AT 2ZKTA 3AAWB 2YQ3A 4JOUA 5J2MB 3MM9B 2L08A 2B4VA 3PEHA 2P5VA 4RU2A 4JI6F 5KFMA 2HYIB 4HT7A 4C9DA 1SH3A 2CRLA 1WELA 4DF8A 1YTYA 2R7QA 5KG7A 3LP1B 4UOCA 4Y2MA 2ZM6F 5EUHA 1HBUB 1F5CA 3KLHA 2LDYA 2ZDOA 3MECA 2AX1A 1R43A 2HNZB 1X0PA 2FVRA 4HI1A 2DBBA 3GIMA 4OHWA 1U4BA 1S6UA 2HLUA 4UQGA 3RRKA 1R31A 2VBWA 3CDUA 3J7YI 2RJZA 4R25A 2DR9A 4A4JA 4NLOA 1L3VA 3EGZA 3CUNA 2C3OA 2YX4A 2Q43A 2CIMA 1P1LA 2CZVC 4Q2LA 1S1XB 3SEOA 2IVYA 3GV5B 1X5OA 2E5LF 5KOWA 1KFDA 5LXRA 2V4QA 5K14B 1H2TZ 5M2RA 2HG4A 1VIOA 2GC8A 2J9DE 3Q8PB 5J2NB 3J81Y 1R27B 3MPVA 5CYMA 5M2UA 2YKMA 1B7FA 4ICLA 3FSYA 4TLRA 5B0GA 3AB2B 4N76A 3KLIA 4KRWA 1JX4A 2P6SA 3ZZYA 1JB0C 5J2PA 4QW9A 4WFYA 1N5YB 1TFWA 1WWHA 3G96A 1FT8A 1SJFA 2E9RX 2LQ5A 2RRBA 1W2IA 3JSYA 3N6NA 4B9SA 3PACA 3DOLB 4EZ6A 3AY0A 5D4LA 4YEAA 1HHSA 3DLGA 1YJRA 2XGPA 4H54A 2ZVSA 3M6VA 3C6TA 3TNVA 2RRAA 1KVJA 5B0BA 3RB4A 1T94A 2VG6B 2ZH6A 2KFZA 1NJYA 1FJCA 2Y1JA 5BYSA 2WSCC 2U2FA 5G0RA 4CO4A 4C8NA 1XWLA 3AA8A 4ILRA 1UVNA 2XLJA 2L9NA 3M30B 2MKKA 2JRSA 2XNQA 4MYTA 3TA2A 3VAKA 1RTJA 4QOTA 5GAEI 3QMQA 2DNMA 4GKJF 4AL5A 1TL1B 2ZOGA 5J2QA 2IBOA 1AFJA 4Q8EA 4ZK7M 3HHNB 2ACYA 4I4BA 2ILZA 2VV5A 2WB4A 5F8IA 4NRUA 4Y3CA 1OSCA 2RSQA 3FVYA 4QR2A 1IJEB 2C22A 1KC8T 2DNKA 4YR0A 1C1BA 2B9XA 3ENWA 3N5BA 1HNZF 1MU2A 1VQNS 4B9NA 1H6KX 4BHQA 1TK5A 4MYUA 5E0OA 4MTPA 5LMNF 3CF5Q 4ZVFA 3VZIA 2E9ZA 4NLDA 3J7A1 1DTTA 1X4GA 4OLOA 1S9GB 4IFYB 2AU0A 5F0UA 5CYJA 3IG1A 2V0NA 4P7VA 3EX7B 2RQ4A 1V6HA 3BS9A 2OPPA 1FKPB 1N6QA 1HWKA 4B9VA 3D0GE 4NX9A 2R2SA 2HS0A 3MEEA 2OPSA 4I1TA 4JBCA 2IM3A 1HI1A 2KXNB 4KPYA 4W92B 2ZJPQ 4LF7F 4TYBA 4R8UB 3ZFVA 2OD4A 3P5TL 4O3PA 2L48A 1VRUA 5KG1A 4A8WA 1N56A 4A8OA 3P96A 3QLHB 2J8AA 3OSNA 3UCZP 4O3SA 2MKCA 1LWEA 2DH9A 4CQ1A 4IFVB 5KG4A 3DXSX 4BWMA 5IZHA 2EG1A 4RWXA 2JH3A 1RT5B 1S99A 3JSBA 1NH8A 5A8WB 2E44A 4K4WA 4ELUA 3QO9B 4PWDA 4X4OA 1HBMB 2CQ3A 4JI4F 4C8OA 1RA7A 5EN1A 1APSA 2CQIA 3CJ2A 4A46A 6FD1A 4DL0C 3KK1A 3C66A 1FXRA 3W2WA 4EGLA 3M8PA 1IQZA 1YGYA 4K4UA 1B0VA 1SL1A 3SCKE 4L72B 3LUYA 1XN9A 3K2YA 2FHMA 5KG0A 4F2SA 3IWLA 1N52B 2DGUA 5A8RB 3THPA 2FC9A 2XSJB 1SJ3P 3EUNA 1FKOA 2J7KA 2OPQB 4F4YA 4CZCA 2PT0A 3A1YG 2JJ4D 5B0FA 2MKJA 2DNNA 2JLEA 3DFEA 3K8VA 4WXOA 4B9UA 1ZM9A 3N28A 1YVFA 3J7YU 5A6PA 2MZJA 4ZLPA 3KHLA 4LSLA 1WHVA 3PR5B 4HLBA 1NB7A 2UP1A 2NLWA 2W9BA 3MAQA 1R8PA 3MF5A 3JTPA 3J80Y 1NK5A 2KVIA 3B78A 1JLFA 2CJ9A 2ZH8A 4OJHA 4F4XA 4G1IA 4X4RA 2CDQA 4A8YA 4IR1A 4X84A 2R7UA 1IKYA 2WONA 2DITA 5DQHA 1HNVA 5DDQC 4F4KA 2WBRA 1U6FA 1RAJA 3M2VB 1R8CA 3OPKA 5A0YB 2LQJA 5IQ6A 5L1LA 4URGA 5C24B 5KFQA 1DTQB 3T6JA 1YJ9S 4JV1A 1FDAA 1ZM4A 1FTRA 4LUBA 2Q79A 3G86A 1YJVA 1DQ8A 2JDJA 2KG1A 2YKOA 1FD2A 4ETXA 3O6QA 1KQKA 1F2GA 2CPJA 4DL3A 1FRMA 5KFIA 2KM8B 2ZNYA 2P6TA 1OQ6A 1DQAA 5BYRA 2MZ1A 2ZH4A 3ZZPA 1PSDA 4UUXA 4ES2A 3I0RA 2KB2A 1ZPWX 2UXDF 2KO1A 2JX2A 2D3OR 2HMIA 4K4VA 2RF2A 2B5JA 1KHWA 4QYRA 2XC9A 2D9OA 2IC3A 3KLGA 2BE2B 1L3SA 1REVA 1RT1A 2R7WA 1HR0F 3H2LA 3Q2SC 1I6JA 3LP0A 4I56A 2BQ3A 1DZ5A 2LVWA 3M2UA 5F8NA 2QT7A 5D3GA 1WF1A 1TL3A 2W25A 3E01B 5DLFA 2APOA 1IKVA 3QGIA 3BM7A 4K5RA 4QYZJ 4ECXA 1C2PA 3CMES 4DF4A 5FD1A 1XNRF 1BQMA 1S1WA 2DVIA 1IKWB 2BDPA 4ICLB 4Z2XA 3QPIA 2I5JA 4X4SA 5KT7A 1NJZA 2ZH5A 4OHZA 3MD3A 3V6DA 4GKKF 2K3KA 1FE4A 3RU0A 4ZPVR 3DOKA 1S9FA 4ECZA 2LEPA 2NXUA 2PN6A 2JZ5A 2MXYA 4ELTA 1RT4B 2XS5A 5HO4A 4DMZA 4KKOB 3Q8RB 3T1HF 2MQPA 3UI3A 4QQBA 5LMUF 1FD8A 2LU2A 2I8EA 3OLBA 1HBOA 4RUAA 2C3YA 5GAEU 1XMOF 5GMKa 4N8NA 2EK6A