5LJ5Y

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lj5Y00
1X4HA 4ED5A 2UP1A 1QVGR 4UQTA 2EK6A 2F9DA 4WCEQ 1N88A 4WFBQ 4Y00A 4IO9Q 3CCJS 3BS9A 3MDFA 1KOOA 2OSRA 2M7SA 2GHPA 3J7YU 1R8HA 2CQ0A 1SXLA 2DIVA 2DGSA 1VQPS 2HVZA 3G8TA 2M0GB 1P27B 1JMTA 2HGNA 3BO4A 2A3JA 1WF1A 2V94A 3EGZA 2BZ2A 4C0OC 1VBZA 2E5HA 2HZCA 2KH9A 1U1LA 1U1MA 3Q2TC 1D9AA 2K3KA 2X1AA 3CD6S 3SMZA 2ADBA 2YTCA 3P3DA 3MOJB 2DNZA 2QFJA 1VBXA 2DGWA 1X4FA 1X5PA 3EX7B 1U1QA 1S79A 2MYFA 3SXLA 4YUDA 3UCGA 1FJ7A 4IOAQ 4WIIA 5LJ5Y 2CQHA 3US5A 5LSOA 2N82B 2MGZA 1Q82T 2B0GA 1YWXA 2XNRA 2CPEA 1WHWA 2J8AA 2Q79A 2LKZA 4Y0FA 1KQSR 4TU7A 1K8AT 2E44A 2D9OA 2SXLA 1K73T 1N54B 2CPXA 2XS7A 4WF9Q 1YJWS 1VC6A 2AYGA 2I2YA 1A9NB 1X4GA 5DDRC 3RW6A 2KM8C 2MQLA 1WG5A 3Q2SC 1S72S 1QM9A 3S6EA 2KM8B 3U1MA 3VAIA 2G0CA 4WFAQ 2N3OA 1Q86T 2YKAA 3IWNC 2DNPA 3VAHA 5IFMA 2LMIA 1U1RA 2E5IA 1KC8T 3NNAA 4W92B 1FO1A 4LJMA 3CCQS 2EVZA 1XN9A 2DISA 3G9CA 1UW4A 2OTJS 2XNQA 3CCUS 2DNQA 2MQQA 2DITA 1A7GE 2OTLS 3THTA 1X4CA 3K0JA 4J5OA 2LA4A 3VAMA 3H2VE 2ZJRQ 3CCSS 2KHCA 4CQ1A 2M2BA 3G6ES 2XS2A 1FHTA 1H6KX 2MKJA 1JJHA 3NS5A 2DGTA 2CQPA 3MD3A 4W90B 2DHGA 4TU8A 1PO6A 2MGZB 3R1LA 2CPHA 4P6QA 1YITS 2MPUA 2LEAA 4C7QA 4OZ1A 5LSLA 3OW2R 2RT3A 5GVQA 2KVIA 4PKDB 2X1FA 2E5JA 1NO8A 1SJRA 2KN4A 2MZ1A 2DNOA 1NJIT 3G8SA 2JRSA 1ZH5A 5GAHU 2VODA 1VQ8S 2F3JA 1YHQS 3G4SS 1IQTA 4A8XA 1WTBA 3NMRA 2DB1A 5DM7Q 2FPHX 2G1DA 2DIUA 2RS8A 2DH9A 2DNYA 2CQIA 1YTYA 3CCVS 1H2TZ 4PRFA 4F26A 1WEYA 1X4DA 2GO9A 1Q7YT 2M9KA 1WHVA 4LIRA 1U1PA 3S01A 2MKIA 3I55S 1M5VC 1OWXA 2KI2A 2M8HA 4Z2XA 1URNA 5GAGU 3UCUP 1X0FA 1DRZA 2U1AA 4TU9A 2D9PA 2DH7A 2FC9A 3FEYB 2KFYA 1KD1T 1D8ZA 1WF0A 5ITHA 2KU7A 2LXIA 2MQPA 1VQKS 2L08A 1WEZA 3TYTA 2I38A 2RUGA 3S7RA 4LMZA 2M52A 2HGMA 2MMYA 2U2FA 1DHMA 3BEGB 1QVFR 1FJCA 2MSTA 2MKKA 5GAEU 1YJ9S 2QEXS 1F9FA 3S8SA 1U2FA 5DM6Q 2MY7A 2CPZA 3CC2S 2G4BA 1VBYA 4BS2A 3VAKA 4QU7A 2ADCA 3CTRA 2OJ3A 1R8PA 3BO2A 2NZ4A 1X4AA 2ZJQQ 1ZZFA 2LXUA 2CQ3A 1WWHA 2MZTA 3VAFA 3CC7S 5DDPC 3B4MA 3FEXB 2NLWA 2CPJA 1N52B 1WHYA 2O3DA 1N8RT 1VQ6S 2LEBA 1M5OC 5H1SV 4F02A 3LPYA 1OO0B 2E5GA 2VONA 2RVJA 4V19X 2HYIB 3ZZYA 1YIJS 2CQ2A 2DNNA 2HGLA 2KXFA 1M1KT 3HHNB 4QPTA 5D77A 1VQ4S 5LXYA 1VC0A 2BOPA 2J0SD 2DGXA 2CPYA 3R27A 2VOOA 2CPFA 2VOPA 4WFNQ 1WF2A 3CF5Q 3H2UB 3U1LA 1H2VZ 2MQOA 2DO4A 2MB0B 1U1NA 2N7CA 2KT5A 2XSFA 1WG4A 4ERDA 3CPWR 3THPA 3G96A 1YJNS 2OSQA 1P1TA 3DXBA 3PIPQ 3B4DA 1PGZA 4YOEA 1RK8A 3MD1A 3I56S 1SJ3P 1JJ2R 1OPIA 3LQVA 2MQMA 3R1HA 5GADU 2M8DB 1DZ5A 3PIOQ 4OZ0A 1U6BA 1FXLA 2DNGA 2LYVA 1K9MT 1B7FA 1VQ9S 2JX2A 3TP2A 3MURP 2K8GA 2KG0A 2DGVA 5LJ3Y 1HL6A 2CQ4A 3CMES 2PEHA 5IM0A 1FNXH 2JWNA 1JJ4A 5HL7Q 1VQMS 3MUVP 2QA4S 5EN1A 2MZSA 3NNCA 1NU4A 2MZJA 4PR6A 2N3LA 4CIOA 2YH0A 4F25A 3D2WA 5CA5A 2DNKA 3BO3A 3VALA 1AUDA 2MJNA 4CH1A 1RKJA 1M5KC 2DNMA 2M88A 2MKCA 2DK2A 3L3CA 3N9UC 1WI8A 2MXYA 2DGOA 2CPIA 2KXNB 3CC4S 3RW7A 3CCMS 1YI2S 3CXCR 1W2BR 1HD0A 3MUTP 2AYMA 1X5TA 2MSSA 2KYXA 2LQ5A 5D78A 2KRRA 2DNLA 2XS5A 2KRBA 3MUMP 2DH8A 3IRWP 1CVJA 1U1KA 1VQ7S 1H2UX 5DDQC 1WI6A 3NNHA 2DHSA 3VAGA 4IUFA 2DO0A 1HA1A 1UFWA 3ZZZA 5CYJA 1VC5A 4M5DB 4FXWA 2J76E 2L41A 2RRBA 3P6YC 1O0PA 2KG1A 3V4MA 1KOHA 1VQLS 2MKHA 1OIAA 2MY8A 3TO8A 3UD3P 5LXRA 3CCRS 5IM0B 1ZZNA 2JVOA 1FJEB 1WELA 3CCES 2RQ4A 3P5TL 2YH1A 5GMKa 4IOCQ 1X4BA 2XB2D 4WKRA 1FT8A 5HO4A 2WBRA 2LA6A 4RU2A 2RQCA 1SJFA 2X1BA 4C4WA 2DHAA 1WG1A 2FY1A 2YWKA 3SDEA 2KXHA 1Q81T 1BY9A 2MKSA 2CQBA 2CQ1A 5JVGQ 1VQOS 2LECA 1VQ5S 2ZJPQ 1DBDA 3CMAS 3ULHA 1VQNS 2MHNA 3CULA 1U6FA 2FC8A 4EGLA 2CQCA 2DGUA 5CXTA 5IQQA 3P49B 4UY8T 2RS2A 3UWTA 3JB9k 2F9JA 5DETA 5JVHQ 2CQDA 2MZQA 5MLCV 3HI9A 1WHXA 3J7ZT 3UCZP 2JVRA 1UP1A 2PE8A 2D3OR 4TLQA 1UAWA 2RU3A 2DNHA 1U1OA 3VAJA 1M90T 2RRAA 1G2EA 3DLLQ 2M4MA 1SJ4P 2OIHA 2L9WA 4QQBA 1X5OA 2M70A 1WEXA 2AYBA 4QU6A 1HD1A 2EK1A 3UE2A 4CH0S 3EGNA 2ERRA 2CPDA 4FXVA 2RNEA 3G71S 3UD4P 2MQNA 3SDEB 4YB1P 4U67Q 3MXHP 3CCLS 1SJQA 1X5SA 2AD9A 2DGQA 3CUNA 1L3KA 2DHXA 3MI7X 2FHOB 5BJRA 3NS6A 3VF0B 2CJKA 5FJ4A 2LCWA 2AYEA 2MZRA 2DNRA 1X4EA 1M5PC 2MJUA 4ZKAA 2X1GA 2CQGA 5DDOC 2J0QD
chains in the Genus database with same CATH superfamily
3MPUB 3TUJC 3MMAB 4WFZA 1PC5A 4WE1B 3B6BA 4ED5A 4UOHA 2UP1A 1KN6A 1VK3A 3I0SB 1QVGR 4ILMA 1H72C 2XMJA 3T1HJ 2F9DA 1NEEA 1KWMA 2AJ1A 2E1RA 2YKQA 4FVCA 3JSBA 4WCEQ 4M5NA 1JLCA 2VICA 1DARA 1GX5A 3CCJS 4M95A 1SC6A 2GAHC 2OSRA 2QLFB 3RZAA 3OQ2A 4YHHJ 1QAIA 1RTDB 3J7YU 3BYRA 5L9XA 4WZQA 3MMBA 5L9NA 1SI9A 4URGA 1RTZA 2DGSA 3G8TA 4UOFA 1UEUA 1W26A 2HGNA 3NG8A 1GXUA 1EZZB 1RT5B 1YBAA 1WF1A 2XMKA 3DOKA 2BZ2A 2QT7A 3WQPA 3EGZA 4ECZA 3QJPA 2XBPA 2KH9A 3MM5B 3QO9A 2AX1A 3QLHB 1H0HB 2LEPA 1Q8IA 1S6PA 2J9CA 5EGYA 1N33F 2XSJA 2QMUB 1SQEA 2K3KA 4FF2A 5KFQA 2NUUG 1G3OA 4IO1A 1N5SA 2YNGB 3DLKB 4QBUA 2HW3A 3P3DA 5BYSA 2C2NA 3IGNA 3MOJB 2OMOA 2BJ3A 2FTRA 1G1XA 3IG1A 2VJUA 2VC0A 2VUGA 2UVUA 1R6YA 1S1TB 3BDEA 1RISA 3PHTA 3KK1B 3CD0A 1S57A 1RT4B 1U25A 3C14B 3G86A 2V8GA 4PEOA 5BYQA 3BR8A 4E98A 3HHLA 2ZH3A 4DHVA 1FJ7A 5J2PB 3HDSA 1Y11A 4DDFA 2XQCA 4L3NA 2EBGA 1FNMA 3J80Y 1S7IA 2BACA 4GRSA 5LSOA 3RAQA 2KZZA 3KK2B 3GILA 5KG5A 2MGZA 1IBLJ 2V2ZA 2VPXB 3NCQA 1GTEA 2B0GA 4DS4A 1XMOJ 2HHXA 3PFEA 4WTYA 3W2VB 3HKWA 1WHWA 3OTDA 4LF9J 2J8AA 2WVCA 5A6PA 5J1NA 4Y0FA 3OVAA 1N36J 1KQSR 4DR1J 3F0NA 4IYQA 4M94A 1CQMA 3VZHA 2E44A 1ZPWX 3RB6A 3UDCA 4FYWB 3DLEA 1K73T 2LFVA 2FJEB 4WF9Q 4EYIB 5F3TA 1YJWS 2NSCA 2HHSA 4DX5A 1C1BA 1X4GA 2HRYA 4JI0J 2OPPB 3SV3A 1LQ9A 2QL5B 5DDRC 3J81j 4IFVA 3J7AN 4G1QA 4N7TA 3QIPB 1JLQA 1MROB 4NXMF 1WJ9A 4UY85 3Q2SC 4ZJOA 4JI8F 1FXDA 3TQEA 2HQGA 3S6EA 3U1MA 2G0CA 1RCXB 2V8VA 2YNGA 3GJRB 4I56A 4RBTA 1KR4A 2BJ9A 2XEXA 5GADI 2JC1A 2C2RA 4RNNA 4K4XA 2N3OA 1Q86T 2Y8WA 3CGIA 1XQIA 3QRQA 2DR7A 1AFIA 2RB7A 5IFMA 1HARA 1KC8T 3N79A 4KBIA 3N6LA 5ETPA 5A0YA 1NHKL 2QFIA 3IRXA 1LK5A 4LJMA 2MEWA 2LDYA 2YNIB 2EVZA 2BR0A 3BJYA 1XN9A 3TW0A 5KFTA 3RBDA 2ASLA 3HVTA 3CMQA 3CCUS 2AGOA 3QSIA 3WIUA 1K0TA 2ACMA 3KDOA 4RUHA 2MQQA 1A7GE 3PTWA 4OX7A 4WK1A 3R8YA 2PIIA 1GMVA 2D74B 4NCGA 3THTA 1RTIB 4E2FB 1B4SA 2ZH1A 4MMOA 2UUCF 1M1GA 1HI8A 3A3NB 4WE1A 4E0DA 3TI0A 1LFPA 3H2VE 3NGDA 2ZJRQ 4U8VA 2W4CA 4DL5A 5CABA 3G6ES 3H8YA 1HNIB 1FHTA 3Q8VA 4HLBA 3OL7A 1JJHA 4DUYJ 1Q79A 4ED3A 3GB0A 3ET6B 4ID5A 2G2YA 4NMXA 1T9VA 2CQPA 3M4XA 2DHGA 3HSDA 1RWNB 5KFXA 1U6ZA 2C2DA 1QD1A 4HVZA 4U9RA 2E1PA 1S59A 5B0BA 4DSFA 2YKNB 1CC8A 4DQIA 4O3SA 2CPHA 2V63A 4P6QA 2AWZA 2LEAA 5HVHA 1Z2LA 3KKFA 4WYLA 3CDWA 1XJWB 3CNQP 2NXUA 5KFBA 1PYOB 2XMVA 1UZDA 2XSJB 3HULA 4KE5A 4L3KA 4NE9C 3CJKB 4PKDB 1JIHA 5IS2A 4DV5J 1T9XA 6FD1A 2JLGA 2EI5A 2HLTA 2X3DA 4I2PB 2B9WA 1Z4UA 1WTFA 4RW6B 4U7UD 3ZTQA 1RABB 1RHUB 1V3ZA 1RT5A 3DOKB 3QBCA 2KDOA 1UWBB 4H4KA 4KPCA 2VODA 1VQ8S 1F6TA 1YHQS 4OFZA 3CEDA 3DGPB 1Z2ZA 4W92B 1KNZA 4KGVB 3FJ2A 4NWBA 4FYVB 1WTBA 4B9MA 3BGOP 2XLKA 2ZZMA 2BV3A 4UUXA 2ZHAA 2G1DA 2DIUA 2DH9A 1RWMB 4EU0A 5K8MA 9RUBA 3ZNUA 4O3QA 2IA0A 3VWSA 2AV5A 1F1BB 4NYZA 3MMCB 5DG9A 2ASJA 1ZTTA 1SC3B 4PXBA 3C46A 1HWUA 4X64J 2R7SA 1RWUA 5SUHA 1FESA 3OXLA 1MU2A 1D1UA 4LQ3A 4MH8A 1JLBB 2FVQA 2IAJA 2BJDA 1RI7A 4C98A 2IMOA 3KLHB 2Q43A 4DR5F 3RB0A 1L3UA 1RBOB 3PY8A 2V8DA 2ZBIA 4OV1A 1N0UA 1P9QC 4M5HA 1U1PA 3S01A 1I6JA 2NREA 3VVUA 4B9LA 3J80U 1CJVA 2Y9HA 2MKIA 4KRWA 3ZC4A 3JYTB 3HHDA 4MYUA 4DV1J 2F65A 4ECRA 4ED6A 1FFGB 1OWXA 1PAUB 2HNYB 2M8HA 4L73A 1URNA 1HBUA 2BANB 3AXKA 4DFKA 4USMA 3ISZA 4M63A 1XR5A 1S97A 2GVDB 4Y6IA 4KAIA 2ILZA 3OUYB 1HR0J 4TU9A 4QW9A 3KHGA 3JQMA 3Q8UA 4PQAA 2CADA 1VJQA 2KFYA 3Q8SB 1GMWA 2KU7A 4FPRA 2MQPA 3VV2B 4ZP9A 4QWBA 1TL1B 3AH6A 1VQKS 1IR1A 5KFLA 1AZSB 2L08A 1ROFA 3D28A 4Y2KA 4YS2A 3K2YA 5L39A 3SIPB 5KFFA 1GX6A 2QRRA 2M52A 1TV6B 1IBCB 1FDBA 2BUNA 1DHMA 2NUHA 2B9YA 2MSTA 3DXSX 3GPAA 3NEKA 3R5BA 1OSDA 4ZP6A 4ECVA 4V1Ak 2DJWA 3ENVA 1N56A 3SQGA 2R7UA 2JFKA 3H98A 3PNIA 1REVA 3GR1A 3T9NA 3ITHA 2DVIA 4AL5A 4M5JA 1U2FA 4EBCA 2YQ1A 2CPZA 4ZPTR 2XCAA 4ED1A 3BN7A 3CC2S 5ETMA 1SJ1A 4WTOB 2GC8A 3HP6A 2B4VA 2CDRB 3E8OA 1C4CA 4NXNF 1RAIB 1YJVA 2BEFA 2HFOA 2HK3A 3CTRA 3ENAA 3V5RA 4DL3A 2OFHX 3DGVA 4RNOA 3HVAA 1S49A 4AFFA 2ZJQQ 2DR8A 1HMVB 2WSEC 1LXNA 2ZH4A 2HHWA 2DR9A 2JEIA 2ZVSA 2XYPB 5KFJA 2HQFA 4A8SA 5KFAA 1CJTA 5KFCA 1PIEA 4KGKA 1YBTA 5D0EA 3UO0A 4ZITA 1R0AA 1N52B 2D3O1 1YGYA 3UDLA 3I82A 2R7VA 2O3DA 1WC1A 1FTRA 4BHQA 1N8RT 1O6XA 3OLAA 2BM0A 1M5OC 5EX0A 2W9CB 3O1LA 3C3LA 3QT5A 3V4IB 3RB3A 1OO0B 1H98A 2C2EA 2VONA 1UJ4A 1HQUA 3H5YA 4J37A 2AQ4A 2GS8A 4MK8A 2CQ2A 1QE1A 4ATNA 3JTOA 2KXFA 3BH6B 2CVIA 2Z4PA 3MM7A 4K2XA 4LR7A 3FRZA 3RR7A 3GU0A 4OYOA 2GX8A 2GGPB 1VC0A 2BOPA 2FHKA 2CPYA 4DN9A 3VGUA 2VOOA 2CPFA 4ZVSB 4CDIA 1TK8A 3LP2A 1HWLA 2IJNA 1UETA 1UKUA 3O8WA 4IQMA 2MQOA 5HP1A 4X4PA 3DLBA 2Z2MA 2FVRA 1T11A 4I6YA 4LBPA 4P7VA 4B3TJ 1U4BA 1UVNA 3QJLA 2Y1RI 2B43A 2FHJA 4USWA 4HHHA 1Q0NA 1RHQB 2ILYA 2UVRA 4LFAF 3FBCA 3MPWA 3DNCA 3DRXA 2N7YA 5D15A 4ERDA 4MT1A 4ZPCA 3CPWR 3GV5B 4B9SA 3WC2A 3G96A 4JI5J 1CJUB 4P2XA 5I3PA 4DS5A 1I51B 3N4WA 1B0VA 5GAEI 5KOWA 4CH7A 4YDDB 2QLXA 3I4HX 1IR2A 4DL7A 3L7UA 3MD1A 1LFWA 1IR0A 1YBUA 2HQCA 7FD1A 3F73A 1OPIA 2HNZA 3EE3A 1B99A 4JI4J 4CO5A 1WNEA 2EG2A 1VDHA 3NP5A 4GC6A 2VC1A 1WACA 3BH7B 5J2MA 2GHWA 1WSRA 2W2MP 3OV7A 4ZVPB 2UXCF 3AJ2A 4K2JA 1SC1B 2B3TB 3MURP 2KG0A 5F8JA 3M2UA 3ET6A 2CNKB 2UXBF 1CJVB 2CQ4A 2W2PP 2X7IA 4PPDA 2J6TA 2JWNA 3T1YF 2E5LJ 2V2VA 1VQMS 2YKNA 3B82A 1S76D 4XO0A 4ZLNA 1NU4A 3NNCA 4X4TA 1Q7LB 3QAEA 2JLEA 3D2WA 2AMCB 2QA2A 3H25A 3U7JA 3LUYA 2DNKA 3VALA 1HHTP 2EG1A 3IAM9 4DUTA 2GMHA 3QT6A 2DY9A 3TUIC 2XLIA 2ZM6F 4P2FA 1M5KC 5DQHA 2DNMA 4DV4F 2MKCA 4RW8B 2DK2A 3L3CA 4UOCA 1TR0A 1EETA 1CQNA 2CPIA 1RTHA 3CCMS 1SH0A 3CXCR 5IWAF 4F36A 2E1CA 1Q8BA 1HD0A 4JV5F 3MUTP 2AYMA 4U8YA 5IV4A 2MSSA 4ECWA 4OLOA 3DGPA 3ZTOA 1WC0A 2LQ5A 4LBHA 5D78A 4XK8C 2XS5A 4K50A 4M5LA 1VHIA 2KRBA 3K5NA 1UJ6A 3IRWP 8ATCB 1H2UX 3A3PB 3D0HE 5DDQC 3Q8PB 1UCNA 1UTAA 2B8PA 2YY3A 3RAXA 3JSMB 3FGVA 1TFWA 2B4PA 4FKYA 3NWRA 3VAGA 3NNHA 1S1VB 2DO0A 3I9V9 2LQ9A 3LTOA 5D8HB 2WW4A 3W5ZA 4YHHF 2W2OP 5IT9U 3VGSA 4XDDA 1S77D 1I3OB 1UVIA 1DLOB 3M2RA 3OD2A 4IRKA 3CO0P 4LF2A 3PM9A 4EFAC 4OLPA 1E6YB 2J0XA 2FGCA 3P6YC 3SCJE 1TUWA 4EEYA 2HEKA 3GV8B 2PFDA 3ISND 2KG1A 2CNLB 5CZVA 4CTAB 3SV4A 5HQ8A 2P9EA 4A8FA 1TKZB 1FERA 2MKHA 2FDNA 5CQGA 4X65J 3KYLA 5EWEA 3EWGA 2GW8A 2AX0A 4C9DA 3L95X 2DKOB 3RAMA 4EK2A 1JK9B 2DCLA 1TK5A 1B3TA 4OMFG 1N33J 2OPRA 2VL1A 4LSZB 1JLAB 5T7LB 4ZPBA 1C1BB 4Q2MA 4DV6F 3NCRA 1GH8A 1WELA 2DEIA 5J2QA 5DLFA 3K58A 5KFSA 4DLEA 2FB0A 3EUNA 1GNKA 1FE0A 3C15B 3SFGA 4ZHRA 1IKXA 1FKPA 2J9DE 4DQQA 3DDIA 3R7NB 1KVJA 4RU2A 3KLFA 2HRTA 2P8IA 1EQ0A 4KJIA 2YNHB 2X1BA 2VG5A 3QGPA 2WW8A 3MAQA 3QRRA 3RBEA 4OI0A 2W4DA 5A2QY 4HT7A 1RLCL 3KJQB 3O2IA 1Q81T 2WB1D 1NK0A 5JVGQ 1MMNA 4LUBA 4PAAA 3DHWC 1U2CA 3TZWA 2W24A 2QA4G 3W3SA 3MEGA 4YB7A 2R2RA 1S6OA 1VQ5S 2NYHA 3WIVA 2YKMA 3MOZA 3NY0A 1MROA 4X62F 3CMAS 1VQNS 4X4UA 1JWWA 3JSMA 3DLKA 4O0NA 1SKUB 3CJ0A 3POTB 4PG8A 4X4SA 2V4QA 4MK9A 2ZH6A 2EFVA 4DV2J 5J2PA 4FXDA 2K7JA 1XR7A 1P1LA 3D6TB 4ILRA 5BR8F 2G2ZA 3V6JA 2KYZA 1V5IB 4LRAA 4R25A 3UWTA 2XO6A 3JSYA 4C0HA 3BGUA 5MLCV 4Q5VA 1L3TA 1F60B 1VQSA 3CJQA 4NA1A 1R7IA 1WHXA 2GZOA 4DF4A 4JI0F 3UCZP 2PE8A 2D3OR 4YFUA 4OYZA 4BWMA 4TLQA 2IYGA 2BVZA 2VFRA 1OS5A 1S1UA 2YNIA 4Y2CA 3MR3A 2DNHA 4KKOB 1CJKB 2C3YA 7AT1B 1YJRA 3ILIA 2RRAA 4CLUA 4JI8J 3SBMA 1HHSA 1G2EA 1KRPA 1FJGJ 4UW2A 2M4MA 2PT0A 4F0MA 5F8MA 2EFQA 3KK1A 2NPIA 1SJ4P 4DMZA 3D5MA 5HQLA 3I96A 1X5OA 3NOCA 4KO0A 1WEXA 3PRDA 2GAGC 3GIIA 4QU6A 1R27B 2HS3A 5B7WA 4CH0S 3EGNA 4C8MA 1RACB 2BMBA 1S6PB 1JJCB 1PBUA 1TL7A 1Y0HA 3BGLA 4IFYB 4RR5A 3D3BJ 1J2VA 2YNFA 1RWXB 4O3RA 4QWEA 2MQNA 3CJ2A 2XC9A 3UDEA 3PRBA 4G3IA 4QOTA 4YB1P 2OAUA 1X5SA 2AD9A 2DRDA 2FHJD 2K2PA 4RO0A 4O3OA 3W7BA 1S1TA 4OYIA 3PV8A 1SKSA 1L3KA 2DHXA 5CHCB 2FHOB 4H4KC 5BJRA 3DU6A 1KEKA 4R5PA 3NGUA 4F4XA 2UUCJ 3KNAA 1AFJA 1FTCA 2CG4A 4KV8B 3G6VA 1IKXB 2AYEA 1VMBA 2DNRA 1LW2A 2ATCB 4P9SA 1REGX 4LSLB 1OY9A 3DMJB 5J2NB 4DUZF 1HNWJ 1YZ7A 2AZ3A 2G2OA 2BOAA 4DSJA 4XIUA 1GFWB 3TA0A 1BQMA 2WVDA 2UUTA 3D1QA 1HBOA 1FD8A 2D1CA 3GJSB 4CO1A 4UQTA 4DZDA 4OHYA 1M0SA 1HFEL 3MM8A 2V4JA 2DRBA 2KO1A 2HQ3A 1N88A 3MM9A 4IKAA 4Y00A 4IO9Q 2J9EA 4K0KF 1V3RA 2BW7A 5E3AA 1U0HA 3MDFA 3OTCA 2K06A 5RUBA 1JLFA 2XI2A 2GHPA 4MIWA 2ZC4A 2F63A 3BQ0A 3PYEA 3N01A 4F2SA 5GMDA 4RWXA 1NK8A 2HVZA 4RUAA 2B56A 1P27B 4OZ3A 2LDIA 4ECQA 4KB7A 4WIQA 2A3JA 3MAAA 3PACA 3FCVA 1R6VA 2MLXA 3GFZA 2HZCA 1RT7A 1U1LA 4DCJB 5GAHI 4RJVA 2HBYB 3TJAA 1RA6A 4JYAF 1MSWD 1VBKA 3Q2TC 4FP9A 4QZVB 4DR6J 3TJ8A 4ZLLA 3H59A 1UPPA 2FUG9 4DL6A 3M32A 1JQGA 3NGKA 2ADBA 1XWLA 1VBXA 3F41A 1VK8A 2RQMA 2IM3A 1RTIA 4J91A 1GT8A 4ZVEA 4X4RA 2EW9A 4ECSA 1TU0B 2XG8A 4IG3A 1U1QA 1IXKA 4EO6A 4X64F 5ETTA 4NA3A 3T3FA 4ANDA 4IOAQ 3GQCA 3RRHA 4ZLJA 4Q44A 3DI6A 4KH0B 4DR5J 3H2LA 4WIIA 4LSLA 5J2NA 3MCMA 3US5A 4NLWA 3EXYA 3PX4A 5E0OA 1ITPA 4Y2MA 3HHEA 2N82B 3RR8A 3H5UA 2AHOB 4FNHA 2IAJB 2ZEJA 3R7SB 3D0IE 5CYMA 1PJ6A 2AZ1A 2RHQB 3PYFA 1YKWA 4DOZA 3QSYB 4OHWA 1ZM2A 2WVFA 3PKYA 4LVOP 2Z0GA 2XNRA 4ED0A 2CPEA 2OLWA 2HBZB 3NAIA 3V6KA 2HHUA 1U8WA 3BYPA 4P72A 2E7XA 4DI6A 4TU7A 1RWOB 2IPOB 3PYGA 3MEDB 1HNZF 2DYAA 2NXJA 4ZPDA 2SXLA 1OPZA 3GJQB 5B0CA 4R0EA 2KL8A 3LGMA 1MW7A 3OR1B 4Z7CA 2AYGA 2YNFB 1IKVB 2V34A 3FSXA 3WZ0A 3QFHA 4ZVGA 1FX4A 2RSQA 4CLYA 1FNOA 3KJVB 1UVKA 1MMLA 2FJDB 2MQ8A 3TEHB 1S0MA 1UPMB 4NCAA 2KM8C 2WCXA 4USVA 2GFFA 3TVZA 4RX6A 1RTJA 3HK2A 3NAHA 3IR6B 4ILLA 2JH3A 1S72S 2JJ4D 3K59A 2FLPA 3KFWX 3AXMA 2QA1A 4TN2A 3VAIA 2DPIA 2R8KA 4FF3A 2XHWA 2QMWA 3MFIA 4RBUA 4ETXA 4WFAQ 3IWNC 4XAKA 4F3MA 5C7PA 3BB5A 3GV7B 2DNPA 3QJJA 1NZ8A 3HT3A 2CJYB 2WOMB 2ZBQA 5JMNA 3C66A 1CULB 2GHVC 3I0SA 4K59A 2DY1A 3ZZTA 5LMNF 1RT3A 4DV0J 2RMLA 4JP8A 4X66F 2IFXA 5FIIA 3ETMA 3PHEA 1NJYA 3I5AA 1HBNA 3PW2A 2DISA 2C42A 1N5YA 3G9CA 3BBBA 2RIJA 2Z2LA 2OP5A 4OYAA 4DPXA 2W9BA 1HBMA 4PPZA 3T6BA 3BBCA 2DNQA 1LEOA 4LT6A 2ASYA 5GMEA 4DL2A 4JI7F 2R7TA 3VAMA 3IG1B 2ZWPA 4H4MB 3ETOA 4NI2B 3UPFA 1T8EA 4OHZA 1HWKA 4KO0B 3EZ5A 1NK9A 1VQYA 2JEGA 1BQNA 2XHCA 1TKXA 1VS3A 1G7CB 2UV8A 2KHCA 4M5KA 3SQOP 1YZ6A 3X3UA 2XS2A 1FWKA 2PEBA 3L09A 3Q8RB 1YG0A 5AXKA 4LFCJ 4WFYA 3NS5A 3VHQA 2E9RX 4W90B 4HH1A 3WDOA 3TAMA 2HMIB 4QR1A 5EUHA 4D3GA 1KTQA 4OHVA 4QJVA 4XPCA 5C25A 2MGZB 1B0TA 1S4FA 2C2ZB 2B5JB 2IJRA 2Z8QA 3BREA 3LP1A 9ATCB 4X4OA 4M5IA 3PW7A 1VRUA 2CNOB 2IIHA 2MPUA 1BWEA 2HIQA 1Y7PA 2OPQB 3A4TA 1IBMF 4HDHA 3CSKA 5A6WA 3MWBA 1VOMA 3IWLA 5GVQA 2KVIA 2HS0A 4UTGA 4OZNA 2C3OA 3HHLB 5C2GA 1RT7B 4DPUA 3W8PA 4WKYA 3A8IA 3HO1A 1LKZA 2LVWA 2ZKTA 3NL0A 2FLLA 2F3JA 4PUOB 3G4SS 5ETQA 4A4JA 2Q6CA 4A8XA 2GGPA 1ZBTA 3PYDA 3H4DA 5M2RA 2DB1A 1PSDA 4ED2A 3MGJA 4NL5A 3GFYA 1I94J 4YP3A 1QJHA 2FPHX 2HHHJ 5J2MB 2BDPA 3A8EA 4BWJA 3ISNC 1FF2A 2QN6B 2CG8A 1GXLA 1RP5A 1X31C 3DYAB 3HPOA 4JI3F 2KZMA 2BM1A 3C6UB 2DNYA 2CQIA 2AGPA 3HD1A 2BA9A 2LXFA 4I68A 4JI6J 2PI5A 3OJUA 2VBXA 4DL0C 1BQMB 1WOPA 2E9ZA 3GG1A 4PRFA 2UXBJ 2AW0A 3MR7A 5J1EB 2GO9A 2OUGA 4DXLA 1X60A 4KR0B 2GIFA 2CJAA 4LIRA 3PO4A 1O51A 3KJVA 4FVMA 4DEZA 4J7CA 4KQZA 2VIHA 4RZRA 3I55S 3PX0A 3OR1A 3W63A 1P6TA 1V6HA 4XPEA 1RB0A 1RT2B 3BV8A 5GAGU 2Q66A 1K0VA 5KFNA 1X0FA 1FDAA 3M6XA 3M9MB 1HBMB 3D1OA 1DRZA 4OJ3A 2D9PA 1S9EB 2BJ7A 4CLKA 4DU7A 2R9LA 2DH7A 3AODA 2VKZG 3V81A 3BDPA 2BRKA 1D8ZA 1KD1T 3N6NA 4JV5J 3DOMA 1N34F 1VYAA 1DJ0A 3EDRB 1QUPA 4V19J 4WK3A 1DTQA 3FZBA 5E3QA 5EWGA 4A8OA 2B8QA 5E2QA 3TYTA 2XZWA 4EMDA 3Q8QB 2LU1A 1KVKA 3GLJA 5DJBA 2CJBA 2ROEA 2HGMA 4F50A 1NUEA 5I3UA 2A6MA 1HYSB 5D3GA 2U2FA 1CS4A 3BEGB 1QVFR 3EPIA 2CWXA 1K47A 4NLYA 1TAUA 1VJWA 3A13A 4NRUA 3U1NA 5GAEU 1KTVA 2QEXS 4JI1F 3RTVA 2QMXA 1FCAA 2XO7A 4Y28C 2J8SA 4QIFA 3JAMU 5H9FJ 4NPOA 1AXQA 1NSPA 1CC7A 2HFZA 3Q8YA 5CYQA 1RAOA 3QQCD 5FLXY 5LMUF 5IC6B 2BXJA 1RTHB 1VBYA 4O44A 1S0OA 3GFXA 4DG1A 4H4MA 2ABYA 1HWJA 4GVBB 5DZ7A 2VHGA 2UUAF 2OJ3A 3NXZA 1TMJA 2JHEA 2VG7A 4CT8A 3HZEA 3BO2A 1VFJA 1DQAA 1NK5A 3NCPA 1NXIA 4OJHA 3UVJA 1PBAA 2FLOA 3UR3C 1WWHA 1Y3KA 2MZTA 1M5HA 2VB6A 4O3PA 3VAFA 3G82A 1HBNB 4YB6A 2C2OB 5DDPC 1S7HA 2OPQA 3B4MA 2H65B 2QLBB 2HS4A 3FQKA 1E6YA 1EP4A 1U09A 2R7OA 5AE3A 1S9GA 2XCPA 1AYEA 1TFYA 5H9FK 2ZVIA 2VFTA 1T9UA 3DCAA 5H1SV 1RA7A 4NCGB 2YWEA 3LPYA 1NHVA 3W65A 4ALZA 3MMCA 5A8KB 4J9RA 2P2CB 4R0JA 2RVJA 4RNFA 2HYIB 4K4VA 2HAIA 3ZZYA 4C11B 2QSFA 1HPZB 4B02A 1IKWA 1KKHA 2PA3A 4Q8FA 1PKUA 3ENQA 3HHNB 2R2UA 2YXLA 1U45A 1BLUA 5LXYA 1RTJB 1S1WA 3CDBA 1NJWA 1UVJA 2IHR1 3OR2B 1YLXA 2ZOGA 3JYTA 1LXJA 1YRUA 2GCFA 1JLGA 2JLFA 4HR2A 1WF2A 4CO2A 3G2XA 5C25B 3U1LA 2FQQB 3CJSA 3MAHA 3BGFA 4USTA 1EETB 2DO4A 5D3GB 3GYNA 3PJXA 3JQKA 4USJC 2GVDA 2MB0B 3SEOA 3W2WA 3QATA 1NDPA 1GTHA 4FYYB 2RU9A 2N7CA 2EC2A 2KT5A 4TVAB 5IZHA 5F8GA 2HRUA 5C24B 2XSFA 3OL6A 3AD8C 2XY7A 4LRCA 1RT3B 3CJ5A 4PCQA 5F8HA 1TKZA 5DRKA 1J27A 1QSYA 2HZVA 1P1TA 4F2RA 1C4AA 1RHMB 3KNGA 4HTIA 4PZVA 2IVFB 4E8UA 3AOBA 4DSKA 3M9NB 2ROPA 3I31A 1JXLA 1FWPA 1H73A 1ZM9A 4RUBA 5F41A 5BYRA 2OEJA 2VG7B 4AE5A 1X9SA 3J7A1 4ZPWR 2WZ1A 3R1HA 4DWIA 3CW2C 1WSVA 4U96A 2MTLA 5KFIA 4R8UB 3TQ1A 1SKWA 4PABA 1R43A 2EXUA 2XLJA 1W25A 4WZMA 1U6BA 4ZHRB 1OYEA 1FXLA 4KT0C 4WWSA 2DNGA 4ELTA 5AT1B 4ZJLA 3TAQA 4DPTA 2Q1LA 1FKOA 1EX8A 4F7VA 4GKKJ 1JXEA 4X4QA 2EC0A 3TX0A 1F5CA 3TP2A 4K4SA 2K8GA 1KQKA 2RRNA 2VQEJ 5LJ3Y 2AJ0A 4ANEA 4MAKA 4TKTA 5A8RB 2VQFJ 1NDKA 5HLFB 4M5GA 4LFBF 5LSRA 2AEJA 3HFZB 2O1PA 1F9HA 2RH3A 4U7UK 4WXOA 3HMJG 4HACB 1LWEA 3MUVP 4LF4J 4LRFA 4P2MA 1SPBP 2MZJA 1G6BA 5GAGI 4C97A 2XY5A 4F25A 3GCXP 5CA5A 1SL2A 3K8VA 1YDLA 1OY8A 5FD1A 1J5OA 2ZITA 1TUGB 1AUDA 4PXEA 3ITHB 4CH1A 2LU2A 4DLGA 2RDDA 4LR8A 1B70B 4LF8J 2X3GA 4KGXB 4ED4A 3N9UC 1WI8A 3M30B 2DGOA 3EZUA 5HP1B 3TZZA 3CC4S 5K20B 1XEZA 1YRXA 2F40A 4XDCA 2AIRB 5E7OB 3UI3A 1YI2S 1HNWF 1JLBA 3Q83A 1X5TA 3QYYA 3AOAA 2KYXA 1RWPB 4OIXA 1DTQB 3UD5A 4BC7A 3GWCA 4ZCKA 5L1IA 1NH7A 1IJFB 1L3VA 1YRTA 1S12A 5M2UA 3KUHA 1U1KA 4K5SA 1HHQA 3BR9A 3GTYX 4NLTA 4K7QA 1MN9A 2ALYB 4MFBB 1WI6A 4QR0A 1NBEB 4K5RA 5IC4B 5M2PA 2DHSA 4G65A 3DN9A 4ZJQA 2F4VJ 2E29A 2ACYA 4OYMA 5I3UB 5CYMB 4DUYF 3OUYA 2IRYA 4J9OA 4F3QA 3ZZZA 3A12A 3GJTB 4DX8H 2GQQA 4J9PA 4X84A 1A6LA 4YQWA 1RBAA 1HKAA 2CJ9A 1OQ3A 3BF4A 3K89A 3M1VB 3QPIA 4G1PA 4OI4A 4EUVA 4U7CA 4DV4J 4WFXA 4DFJA 1KOHA 1VQLS 1SIZA 1BD6A 4GKJF 4CT9A 1BWVA 2VD3A 3M8QA 3X1LB 3QAUA 4S0MA 2E9TA 2QC3A 3CCRS 4DV5F 2IM2A 4C3KA 1DY3A 4DR6F 1CS4B 2H54B 1S48A 3L9ZA 4O4GA 1FJEB 3CCES 5D4NA 1RQ0A 1D8YA 3D1HA 2R7RA 4ICLB 3L4BC 1F5AA 2PMWA 3HZGA 3PDNA 3KHLA 1TP7A 2KHDA 3MCNA 4IOCQ 1FT8A 4DX7A 2IBOA 2WBRA 2XMWA 3CCZA 3DRYA 3GFHA 5C24A 1NSQA 3QZ8A 2JEJA 4KPYA 2K7KA 5CD4A 3W2WB 5K8PA 3KLEB 4Q0BB 4OI1A 3CO9A 2UV8G 1IWGA 1UW9A 1JNZB 2E66A 2YWKA 2ZC3A 4ZK7M 1NJXA 2CRLA 4CCHA 2MKSA 3LP0B 2CQBA 4CLWA 1F3VA 1JLGB 2GJ2A 3UVJB 4K4YA 3MMJA 1VLOA 5C2CA 4U95A 2H3EB 3IBFB 3VZIA 2V6AA 4DV7F 4IG3B 3MM6A 2FJVA 2M3DA 1NH8A 1RT1A 3ILLA 4YR2A 2QYCA 5IOLA 5MAOA 1Y5NB 2CQCA 3VGTA 4DV2F 1TUVA 4RW8A 1GAOA 2DR6A 1Q53A 2DT9A 2WK4A 5IQQA 3TZXA 2RS2A 3KMQA 4C8YA 1HNZJ 3UN3A 2F9JA 1RT4A 2V50A 2CQDA 3C14A 3SCIE 3HVRA 4ZIWA 3HXMA 2GA7A 3T5LA 1NKEA 1HLWA 1BQNB 1HQEB 3J7ZT 2QTWA 3P96A 1CSJA 3FSYA 3ZXWA 4CTAA 1JLCB 3G82B 3I32A 3KHRA 5A0YB 4IFVB 3GR0A 2OHDA 4N56A 3PKMA 1Q1KA 4ZP7A 1H3DA 4DPOA 1Y9OA 3M8SA 4ZS6A 2BE2B 2GVZB 3D9BA 3FVYA 2OTLS 1U1OA 4DR4F 3VAJA 1M90T 1QUVA 2HKEA 2W9BB 2HK2A 2PN6A 2F4FA 3OFEA 1QAYA 3DLHA 2CIMA 1RLDA 2JC0A 4MKVA 2Y8YA 1HW9A 2RHSB 2EPIA 3N6MA 3OL8A 2WHOA 5K5MA 3BSNA 5KFYA 4DFMA 5A76A 5K8OA 5HROB 3KLGA 2M70A 2HURA 3LOUA 3FCHA 3UQSA 3KLFB 1HD1A 4TY9A 3DU5A 2EK1A 3UE2A 2YQ3A 3QGHA 4CLPA 2ERRA 1L3SA 4FXVA 4OJ1A 1T9YA 3BQ2A 4X66J 2A1BA 1FDNA 1TMMA 1NPKA 4HH0A 4CP5A 4ES1A 1PJ7A 1YSJA 3G71S 3PW0A 3FQLA 2VFSA 4JV0A 3QT8A 3TAMB 4HKQA 2CKWA 1FRJA 2HSEB 2YWHA 3ILJA 5DZ6A 1RT6B 3MTJA 2C28A 4NXNJ 4FDFA 3SYZA 3IS9B 2KB2A 3IFEA 3MI7X 1FRMA 4UZCA 1T02A 4D3HA 2H1YA 1KLMB 4UUWA 1NPPA 2MJUA 3TWZA 1RE1B 2X1GA 3FC9A 1YQHA 5DDOC 2OPSB 2RUSA 3OBIA 2J0QD 2HHQA 2OD6A 2ZBRA 3SSRA 4ZMMA 1M5SA 2XZDB 1X4HA 1MU2B 4Z37A 4LFCF 2KKHA 3H20A 4C8KA 1K44A 3KLIB 4MKAA 2NPFA 3SZ2A 4PUOA 2FZKB 4KFBB 3RBZA 2HHTA 2BBEA 2UU9F 1ZM4A 1XBWA 5ETNA 4NLUA 3BS9A 4K4WA 1IBMJ 4N8NA 2M7SA 3M1VA 3VQTA 4DL4A 2IVYA 3JTPA 3MFHA 1N32F 3OSNA 4P74A 1R8HA 5L1LA 1X9WA 4IRCA 3OFHA 3UW1A 3OTEA 3DRPB 1FVSA 2BE7D 1VQPS 2O5DA 2QLWA 4B3OB 2M0GB 1ELOA 3OPKA 3C6TB 3PR5B 1JMTA 4CM2A 1UEKA 1LWEB 3G6YA 1NM2A 1MG7A 1H7WA 2MDAA 2V94A 3PCOB 2ZZTA 4G6VB 3AAWB 1FRXA 1LNQA 4MJKA 2YX7A 5HJXA 3OHAA 4URQU 5L8RC 1W2IA 3D67A 1IM6A 4BCAA 2WTFA 2QIFA 3D6MB 4EYHB 2HWTA 1T0TV 1I94F 1D9AA 1DQ8A 2XMUA 3LP0A 4C6AA 2BE2A 2GVZA 2X1AA 3SMZA 4JI5F 2AJFE 1JLAA 3CD6S 1QAXA 1XMQF 2EFOA 2QFJA 4DSIA 3EYZA 3UR0A 2OELA 2DGWA 4DJBA 4Q43A 3CDAA 5A8WA 1X4FA 1WKLA 1HNVA 2YKMB 1SUQB 1S79A 3CD5A 5DQIA 1T3OA 2MYFA 1RU2A 3SXLA 4YUDA 2HVIA 1I1GA 4M5MA 4HI1A 4ZVRB 4JI4F 1UVLA 1TL3B 3DOMB 4A8QA 4NLXA 4LF6F 4GMKA 1F5BA 1XIQA 2CQHA 3RJMB 4F67A 3BKTA 3DFEA 4EO8A 1JKHB 5F9NA 1S5ZA 2HPUA 3BM7A 3P5BP 4QIVA 1XNQJ 1GK8A 1Q95G 3E01B 4F4KA 5F8NA 2GIRA 4GVLA 3DKDA 1RT2A 2ATLA 4LF5F 1HBOB 1RHKB 4GO5X 2W7AA 1CBKA 4MKBA 3TJ9A 5ETVA 3R2DJ 5KFVA 1RT6A 2ZD1B 4PXDA 3BKUA 2WVBA 3HVWA 2Y1JA 3CJKA 3R5GA 4KHRA 3AT1B 5E5NA 5JUMA 1TKXB 4ANCA 4G1IA 5E3PA 1FWLA 2YPYA 2R7XA 4AL6A 4KV8A 4B3SJ 4IH5A 4NEZA 4TYAA 1K8AT 1XNRF 3KLEA 2GMJA 2E7VA 2B4OA 4TYBA 3KLVA 1L5UA 2HBRB 2YKOA 4OYBA 1S1XB 4I1TA 5D0RA 1BC6A 2H48B 1E6VA 1N54B 1U2RA 2GNKA 2H5JB 4A46A 3KLGB 4DR3F 3NWGA 1VC6A 5HJYA 2I2YA 1A9NB 1FRKA 1LWFA 1ZAWA 4USHA 4OX9J 4ITSA 2WSCC 1IVZA 2H4WB 4RWWA 1T03A 2YPZA 2FY8A 3RW6A 4F04B 1ZPVA 4I7FA 1TL7B 4PXCA 1KHVA 2W7PA 3FEZA 1RWVB 1PJ5A 2MQLA 1V9OA 1REVB 4JI1J 3J81Y 1WG5A 4A8MP 3M8WA 5D0GA 3MECA 4NCBA 1QM9A 3C8YA 4ZP8A 2I0XA 2CFXA 1FEHA 2YVSA 3CCTA 3LANA 4I69A 3T9ZA 5KFHA 1WOSA 5LMUJ 4DU8A 3MF5A 5F0UA 1Q4RA 3BPDA 2AEFA 3V6HA 2YKAA 4IFYA 1SQFA 2HVEA 5EHHA 2PC6A 4JI2J 4RW4A 1Q5YA 3IP0A 2ZDOA 2ZH5A 2H9ZA 2GO8A 1U1RA 4WP9A 2G1HA 1AZSA 2JNJA 3NNAA 2ZHBA 4OX8A 4ZOSA 1XR6A 1FO1A 2MLYA 3QO9B 2V4RA 4DG1B 3W5YA 4ED7A 2V5HG 4JB8B 2VASA 1RT1B 4Q7AA 2MLZA 1TL4A 2OTJS 1EARA 1VR6A 4OQJA 2BE9B 2G0JA 2A6OA 1FRHA 1IM4A 1GMUA 2AJ2A 1LW2B 1LW0A 2C2KB 3DLGA 4X65F 4K4TA 1PCAA 1HYSA 5D4PA 1XERA 3T19A 1RAHB 1RU1A 3P4UB 4J9MA 4J5OA 2LA4A 2OO4A 3KG1A 3K0JA 2N4CA 2ZHOA 1S10A 1EP4B 1VISA 4CZCA 1J5EJ 4DV6J 3M6VA 3CCSS 2F5GA 4PG6A 2EEYA 4HL9A 1QE1B 4ZPAA 4RNMA 2BJ8A 3DRPA 1PAEX 5AXMA 3QMQA 3W1YC 4C3MA 5A8KA 5B09A 4I2QA 4ZA1A 1HQUB 2NXEA 3IA0A 1NAQA 4ZVQB 3RG6A 2DCUB 2DGTA 1HIYA 2KJVA 3MD3A 4TU8A 3PR4A 2Y0SD 1ZA1B 1VRQC 1PO6A 2W8KA 4DQPA 1FI4A 1ZA2B 3LA0A 1LWCA 2EKYA 3QIDA 5CD4H 2NS1B 1YITS 1NB7A 2B4UA 2FD2A 2FJWA 3OW2R 3EJMA 3AJ1A 4B3MF 3R5JB 4ECTA 5KT4A 3GZ7A 3K5PA 1PYSB 4DFPA 1EAYC 2VPWB 5KFMA 2IVMA 2OPSA 1NO8A 1O5JA 1IJEB 2W2QP 3NKYA 4F8RA 1OSCA 2MZ1A 2ALZA 4FF4A 4IH7A 1JLEA 1CPZA 2HWHA 1MWQA 1QY7A 1U7LA 2JRSA 2APOA 3BGRA 2OMLA 2V68A 3HCXA 4LRDA 3TR5A 5GAHU 1T7PA 1X7VA 3MM8B 4IRDA 2B6AB 1Y4ZB 4KFBA 3OTBA 4NLDA 5HMXA 4OYPA 2QYGA 5ETKA 2O66A 4R8UA 5AE1A 1HNXF 3NMRA 4A8WA 3PG9A 1R0AB 1SKRA 4B9TA 1RGVA 4OZLA 5DM7Q 1IN0A 3BBFA 5EDWA 2RJZA 2R8HA 4RLEA 2RS8A 3D7SB 2I5JA 3ZTSA 4HDGA 3HHLD 6AT1B 4B9VA 2VFVA 3OXFA 5B0EA 2UUBJ 4CNZA 2N4DA 1YTYA 5B0DA 3MEDA 1DLOA 4EBEA 2DXEA 2Q3PA 4F26A 4X2BA 1WEYA 3GSIA 1SL1A 1FFWB 2YQ0A 3QNWB 2BQ3A 4QR2A 2D69A 2Q6BA 1WHVA 4KH1B 4F4YA 1QLNA 3IWXA 2ZNYA 4CLLA 4LF4F 1SL0A 3AOCA 2YX1A 4J9VA 4KHPF 3WX4A 3HLUA 3AQPA 1IUJA 1M5VC 5HN0A 4Z2XA 1F2HA 1UJ5A 2D41A 1YVFA 3UCUP 4LF8F 1Y3JA 3DM2B 5B0FA 4A8YA 2J7WA 4Q45A 3G87A 3DRSA 1FK9A 2ZDPA 3TX8A 3H5XA 3JQJA 2XY6A 2F7VA 3FBFA 4DR7F 4P75A 1AUSL 1N4LA 1GMWD 4H54A 1IKVA 2YKPA 2NYIA 3QLHA 2DD8S 1WEZA 2RUGA 3PFOA 3S7RA 2VJVA 2QL7B 1MN7A 1Q5VA 4DUZJ 3J7YI 3GIKA 1BGXT 3CCWA 1S1VA 3IN5A 3OJSA 1U48A 2F4VF 1RBLA 5C42B 4DQRA 1FJCA 1RAGB 2MKKA 2VFUA 1BXNA 4NLPA 4C2MA 1C0UA 3CB4A 3EGVA 4M5DA 3AD9C 3MTKA 1F9FA 3J81U 3BQ1A 2COLA 2ZE2B 3S8SA 3E2EA 5DM6Q 5ETSA 3GIJA 1WOOA 2G4BA 3M30A 5DQGA 4K0KJ 2QE5A 4BS2A 4OI3A 4NLVA 2PA8D 4GKJJ 3PJWA 2J9DA 2OD4A 4YR0A 4RW6A 3LGHA 2MKYA 2ADCA 5H9EJ 4KY3A 4KYZA 4OI6A 3H40A 3OTOF 5J1EA 4WPAA 2HNDA 1X4AA 1VLYA 5DGBA 1WDDA 2LQBA 2J5AA 3B78A 1LW0B 1ZZFA 3DLGB 1X0PA 2LXUA 3GYGA 1AW0A 2BKOA 3BSCA 3CC7S 3UFCX 2FVPA 2G9OA 3I87A 1VHFA 1ACMB 2GJIA 3FEXB 2NLWA 2CPJA 5KFWA 1I5OB 1T9TA 1WD6A 4F4ZA 5HI7A 1R0CB 1ZS6A 2QG9B 1LOUA 3C16A 5U47A 2LEBA 5HBMB 2A2CA 3C6UA 3LAKA 4AXIA 4YMEA 4ZDNA 2B7BB 4RW4B 4V19X 4ID5B 2D3ZA 2XTJP 2XMAA 1YIJS 1O8BA 2WBMA 3M8ZA 4FYXB 5BXIA 2HGLA 3LALA 2OPRB 2UVWA 1ZH5A 3AB2B 1T3NA 2ASDA 2OGUA 4YOEA 3P45B 2FJXA 1VQ4S 1RDRA 4NZ0A 2J0SD 4PQUB 2DGXA 3LF0A 3CDEA 2DR5A 3R27A 3Q0AA 4ZVUB 1TZ0A 2B9EA 4I0WA 4DV7J 4LRBA 3NRBA 3CF5Q 3H2UB 2F1FA 4KHMA 2RDJA 2NSBA 1N5QA 3W60A 2I8EA 4N8OA 2HIYA 5F0WA 3MHYA 3FBEA 1U1NA 1SIWB 1C0UB 1FK9B 4FN5A 3S1TA 4DR4J 4KGZB 1CULA 1V5VA 5HK4A 1KQFB 4FZVA 3RBXA 2CAJA 3THPA 1ZYQA 2FZGB 2HG4A 4TY8B 4CO0A 3G8QA 4DPWA 3G6XA 4DV1F 3PIPQ 4ED8A 3AY0A 1B0PA 4NEYA 1PGZA 5D4OA 2DXDA 5DGAA 3W9IA 2HMIA 2VKRA 2IRUA 3MM6B 4IH6A 1ZAVA 4AXJA 5HSPA 3TARA 3THVA 1RK8A 2LP4A 1CJKA 2P5VA 2WAQD 4ZVTB 4ZPVR 3I56S 1HBUB 2V9KA 1SJ3P 1VBZA 5T41A 1JJ2R 2IC3B 5GADU 4NASA 2KTQA 1KVIA 2AEMA 1UA0A 3OFFA 2HZAA 3DRSB 3L7PA 3KHHA 2BX6A 2BJEA 3FBBA 3I5CA 3R5DA 2VBWA 1BQXA 4RBVA 3W9JA 4KIAA 3TZYA 1VQ9S 1SC4B 1DTTA 3KLHA 2GJFA 3MR5A 2R8IA 5I42B 3KK3A 4IR1A 5D4LA 3BSOA 1HL6A 3E3XA 3TVKA 2XGPA 4NYPA 4OX6A 5IM0A 1TL5A 1C0TB 3NS7B 4YY3F 1FNXH 1XMOF 4JUZA 1WC6A 2G13A 5HL7Q 3RU0A 1JJ4A 3O5TB 2JZ5A 3B54A 2W4PA 1WUUA 2EFNA 2IY5B 5LM7E 2PDAA 2N3LA 1VRUB 1ZM3A 5EX3A 4ZLPA 4DR1F 4QWDA 4IDKA 1VRTA 1PC4A 3BO3A 4IQXA 5IT9Y 4ZCLA 4DR2J 1XK8A 5LMNJ 1D3WA 2MJNA 2NZCA 3D68A 2POKA 4ELUA 2RQKA 1IBKF 2CZ4A 2IJFA 4RW7B 1KLMA 4K8RA 4DF8A 1SB6A 2OFGX 2MXYA 2ZH8A 1LV5A 1SV5A 1W2BR 1S6QB 3BGRB 5AE2A 3M8YA 1H7XA 2RF2B 3C6TA 1Y00A 1GEHA 5KT6A 3H4BA 4NXMJ 4WP3A 1D0EA 2XMTA 1IKWB 4C8OA 1KFSA 1KQGB 4NLGA 2DH8A 4DQSA 1NKCA 1VQ7S 2QV6A 3LWLA 1RAEB 2UU9J 5T14A 3LH2S 1NCLA 4OZ2A 1JKHA 1KBRA 4WU2A 1KLNA 1NDCA 3OT9A 2Z58B 2HLUA 3IBCB 1NMEB 5B0GA 5JXSA 4ENOA 1S0VA 5HAOA 1SCJB 2LLZA 2XWYA 4M5DB 4NLOA 1RHJB 2V69A 4NOHA 4UQGA 4N41A 3CIMA 2IRXA 3KOAA 2UXCJ 2DTJA 3GE9A 1O0PA 3IMQJ 4GO7X 2YWFA 3M8PB 3V4MA 3ILOA 4F0KA 3HSGA 4O44B 4P73A 3AQOA 4MIBA 1OIAA 2YBVA 5ETRA 4FS2A 4CRJA 5I42A 3TO8A 3N5BA 2V2KA 3IBWA 5LXRA 2AJQA 2XMMA 3B8HA 5KG3A 2X51A 2VDIA 3WC0A 1JLFB 4DN0A 4K4UA 1ZZNA 2JVOA 1NK4A 2QSWA 3D54A 1XMQJ 6FDRA 2D3UA 2RQ4A 3MM9B 3MR2A 2XYGB 2DPJA 2NXCA 1F0XA 3KG4A 3MEKA 2WSFC 3P5TL 3PZPA 3T41A 3W2VA 3EM1A 1IQZA 1TKTA 4WKRA 2VPYB 1TL1A 3M32B 2V0NA 3MPVA 2V2QA 3IGVA 4O3NA 3VCDA 4EWTA 2RQCA 3AA9A 5E33A 2UXDF 4QCLA 1NNDA 3T1AA 3R5CA 3M9OB 5KT5A 4LF6J 4NLSA 1HWIA 3N0VA 3SFUA 5KAKA 2HHHF 4UOGA 2ZWOA 1URRA 1WG1A 1SV5B 3LAMA 4UT4A 2WB4A 2QJ3A 2QO3A 2FY1A 3LWMA 1BY9A 2VG6B 2CQ1A 2WONA 2V8PA 1WDTA 2HNDB 3AB4B 3VR1A 2ZBCA 4NX9A 4C3LA 5AXNA 4J9NA 1VQOS 3TUPA 1OY6A 1W7WA 3ELHA 3CIZA 3CDUA 4ZCIA 5L1JA 4LF5J 1VCTA 2LECA 1UA1A 3NGSA 1MWYA 3GP9A 3WHIA 2R7WA 4IG0B 4F0HA 3LW5C 5HATA 3QIPA 2ZJPQ 3AHPA 3C19A 3AA8A 3ULHA 2F8MA 2JFDA 2MHNA 4BLGA 4OYXA 1U47A 1U6FA 2V8HA 2JDJA 4FF1A 1M1HA 4W98A 4EGLA 4C8NA 4ER8A 5CH7B 2BRLA 3P49B 3M2UB 3MMAA 1QTNB 3KUGA 3M6WA 4Y34A 3DLEB 2AKWB 4J9SA 4EZ9A 3R5AA 5DETA 5JVHQ 1EB0A 1VIXA 2I9SA 2ZNZA 5DG7A 5D6GA 4CWBA 4DR3J 3IC1A 3MPYA 1DTTB 1U26A 4AUKA 3MM5A 1LWFB 2IDEA 3HI9A 1FD2A 4N47A 3NBPB 3J7Z5 1B64A 2JVRA 1CJTB 2A0FB 2QZ8A 1S1XA 4FNIA 3IRXB 4ZVHA 3MZIA 4RPFA 2ZH2A 3HM9A 2E1AA 1RAJA 3CJTA 3FRYA 2BKPA 5IT4A 4WJBA 1NRKA 3CJRA 3D6HB 5DS7A 2R2TA 3RUBL 3DLLQ 4IDKB 1R31A 1MNEA 3ZZOA 3LGNA 1H74A 1WKKA 2YWWA 1FFSB 2NXNA 3MAAB 4QQBA 4H4OB 3TA1A 4JI2F 4L74A 3HFKA 4F4AA 3PW5A 2C1EB 2C22A 4N76A 2RILA 3EVWA 3EVMA 2I6WA 2J0WA 2CPDA 2ZBPA 2RNEA 1P8GA 2CA9A 5HQMA 4RL1A 1NPRA 1HR0F 1UWAA 2XI3A 3LP2B 2HQDA 1F3FA 2BQUA 8AT1B 1HI0P 2VG6A 2WONB 3CJ3A 2UZAA 2O67A 3M05A 4AQYJ 3MXHP 5KG0A 1SJQA 3H90A 4N77A 4O4GB 1C1CB 4PYAA 3CCLS 2B5JA 2DGQA 4QWCA 1SUQA 3GG0A 1X9MA 2UUAJ 3M2RB 3RRKA 1KHWA 2I1RA 3NOGA 5KG1A 3NS6A 1CLFA 1JXVA 2CJXB 3VF0B 2LCWA 3A8JA 4NYOA 2XGQA 2JEFA 1YK9A 5ADZA 1M5PC 1J5EF 4ZKAA 3DYAA 3VTIA 5L38A 3OLBA 1YJTA 3I0RA 1AA1B 1YX2A 4LIWA 2E1MC 2K3IA 4LQ9A 1UMJA 4LREA 1KS2A 2EK6A 4YEAA 4ZN1A 2ZUAA 1EKRA 2AP6A 3I4PA 3LP1B 4PG5A 1OYDA 4CLTA 4WFBQ 5J2QB 5HLFA 2J6UA 4HI2A 2G0IA 3GSDA 4Y3CA 4BBYA 3FNNA 4WBFA 1KOOA 2RDIA 3ZTRA 4EZ6A 4OZ5A 1EHWA 4B3RF 4JV1A 4B3MJ 2AJ4A 3NLCA 2QGFB 1SH2A 2CQ0A 3DDKA 3OFGA 2RKIA 4NZ6A 4OZJA 3R1LA 1SXLA 2DIVA 3JAMY 1Y5IB 1FKAF 4USKA 1TVRA 3AD7C 2WOMA 3K7RA 3SSSA 3BO4A 3W66A 2W25A 1NSKL 4B08A 4C0OC 1C2PA 1VGYA 2E5HA 1V3SA 2EFGA 2OPPA 2Z2YB 3O44A 5G0RA 3TUZC 3Q23A 3E51A 2KFNA 1U1MA 2R42A 2ROGA 4YN3B 5HANA 5F9LA 1XC9A 1ULRA 3FMBA 5F3ZA 2C3UA 2V67A 3IXQA 1Q8LA 3BSAA 3N28A 4MTPA 3W5XA 5F8LA 3L7OA 2B6AA 2GIQA 5CCMA 3KG0A 3TVYA 2YTCA 3MEEA 2DXFA 3W64A 5I3QA 2DNZA 5K14B 1S6QA 4EBDA 2FZCB 1X5PA 1JLEB 3R97A 2RE1A 3GYXB 3EX7B 1FKPB 3UCGA 2HFSA 3MCSA 2OKQA 4C0BA 2OEMA 4LBIA 5E3RA 3U27A 2DHHA 3T5JA 3NMAA 2FIUA 2J7UA 5LJ5Y 2VF3A 4FS1A 4MKYA 2WVEA 3W62A 4MFBA 5IV3A 7FDRA 3FKBA 4NMLA 3R3TA 4F4WA 5EWFA 4KHPJ 4O4RA 2A10A 4GKKF 2PGCA 3ZNJ1 1FE4A 3KMSA 1QSLA 5LT5A 2VQEF 1ZTWA 2PD1A 3BZQA 1WORA 2VQFF 4LFBJ 1Q82T 5KT7A 4ES3A 3QZ7A 1NB2A 1YWXA 1XMBA 3SQGB 3LPEA 2PI4A 3EXCX 2HFNA 3V81B 1A0OB 1NHUA 2Q79A 2VA3A 1R8AA 2LKZA 2Y3YA 3AFGA 4H4OA 4DR7J 4ECUA 3R9LA 4X4VA 5SZTA 1HQEA 4DCPB 4OL8A 4RU9A 1DFDA 4I2QB 1U8SA 2D9OA 1D9FA 3WBZA 3FFIA 1PILA 2CPXA 2XS7A 3EGWB 1UVMA 1FDDA 3O6QA 3KJFB 4TQSA 2NCKL 5CCLA 1KSPA 4B9NA 1UL3A 1RYSA 1UFLA 3DM2A 2R7QA 2VA2A 2HQIA 3CD7A 1Q78A 3A3OB 1Y10A 1ZAXA 3DC2A 4L75A 5DO2A 3OHBA 2BANA 3DOLB 2C2MB 3D4JA 4CLSA 2KM8B 3T1YJ 1RTDA 2E5LF 1C1CA 3FZ2A 4I2PA 3HSZA 2XM3A 3C2PA 4L72B 5I4MA 4DV3J 2XZTB 3IR7B 1B7YB 3VAHA 3KDNA 1K1SA 2LMIA 5ETLA 5KFDA 2E5IA 5AJ3F 2PSZA 5E3CA 3OTOJ 1S9FA 3PEJA 2ZM6J 5HMYA 2BQRA 4CNYA 2HWIA 1EQMA 1T9WA 2W1BA 3MM7B 4PYDA 5KG4A 5IT0A 4LSNB 4A48A 5HMZA 4U6PA 3FSIA 3CCQS 2J6SA 1UW4A 3H7HB 1VI7A 4WYWA 2XNQA 5IWAJ 1DURA 2F8HA 4TXSA 4X4NA 1D09B 1RHRB 2DITA 2RKIB 3QGGA 1X4CA 5HBMA 2FVSA 5J1PA 2R8JA 1NZAA 1U0HB 1QSSA 2R3VA 3MCOA 4GVBA 1GQEA 1QDUB 3UNGC 4ECXA 4CQ1A 2M2BA 2JSXA 2VBZA 3OL9A 1EKSA 1H6KX 2MKJA 2P9GA 2Y0BB 3FDSA 3V4IA 2LQ8A 3DDNA 2QL9B 4KKOA 3VGVA 3PW4A 1N5TA 4YDXA 3KK2A 3T1HF 3IR5B 5FLXU 2NQPA 1YJUA 4HACA 3MEEB 3NGTA 4I64A 4NLQA 3UNYA 2KFZA 5CAAA 1RYRA 4ETZA 4LF7J 4OZ1A 4C7QA 1ZOTA 5LSLA 4OJGA 2RT3A 3JS9A 3MR6A 2YWGA 5F8IA 2CJQA 3MMBB 1NKBA 1TL3A 3KJNB 4LR9A 2X1FA 2E5JA 1SJRA 4TLRA 2IMWP 2KN4A 1NJIT 2DNOA 1HNVB 2Z30B 1R0BG 2WRMA 2CVEA 2H5IB 2KT3A 4QYZJ 3KLIA 4ZCMA 3U02A 2W2NP 1IQTA 2KT2A 2HFUA 3QWPA 4PQUA 1FA0A 2PFFB 3ENWA 1WC3A 5KG6A 2HHPA 1G4CA 1J5OB 5L46A 2BYCA 5KG7A 5HVFA 1TK0A 3CWJA 3SCKE 5K8NA 4TQRA 2UVVA 4TY8A 1CJUA 5KFRA 3W8GA 3CCVS 1H2TZ 3T6JA 2EFPA 1S99A 2IM1A 4LVNP 2R8GA 2M5YA 4NI2A 4PWWA 5CZXA 1X4DA 1XTZA 3I9ZA 4YY3J 1YJ7A 4L6V3 5KT2A 4X62J 4N5SA 4OV6A 1Q7YT 2M9KA 4M1KA 4B17A 4F3OA 5H9EK 4Y2AA 4DBQA 4KSEB 3K8WA 2CZ9A 3OR2A 3A8KA 5BR8J 2C3MA 4AL7A 2QLJB 3OXGA 2KI2A 2KJWA 4TNOA 2HAFA 4DR2F 1FKOB 1IBLF 1IKYB 5K14A 4PWDB 1R3NA 5IXUA 1IBKJ 2U1AA 4I7FB 5A8WB 4C8ZA 1KP6A 1JLQB 3KK3B 4LF9F 1CEZA 2BKNA 2FC9A 3FEYB 3H5SA 4QPXA 1NK7A 3Q24A 1N36F 1C0TA 1WF0A 1OQ6A 2C3PA 5ITHA 2LXIA 3ONQA 1R8CA 2CYYA 4RW9B 5KFEA 2IBKA 5EN1A 1U49A 2NR0A 1IWAA 2FGOA 2Y1IA 3P8BB 5E41A 1UZHA 2I38A 2L9DA 3M8QB 3R7BB 4EI2A 4LMZA 2K1RA 1WC5A 1U0SA 4HEA9 1FJGF 2ZFHA 3D0GE 2MMYA 2ZKUA 3Q86A 1T05A 3K17A 3V6DA 4DZ6A 1WKJA 3EPGA 2ZD1A 3I5BA 2CZVC 3K5OA 1YJ9S 4IR9A 5D0HA 3EICA 1S0NA 1F2GA 2IYIA 3F44A 8RUCA 2MY7A 3HX9A 4JBCA 2PMZD 4Q2LA 2HBQB 4A8KA 1RXOB 2VH7A 2R4FA 4I6WA 1N48A 3SCLE 3FMWA 3VAKA 4Q8EA 4QU7A 2JOQA 2XYHB 1H38A 2VV5A 1LWXA 4OYWA 5KFOA 3W61A 1N32J 2HVDA 1WC4A 5C5JA 3RRGA 1R8PA 1RUSA 3DRRA 2ZH9A 2NZ4A 4NRTA 3HF5A 1VRTB 2CQ3A 3K57A 3VVTA 3QWUA 1BHNA 4JV2A 3MECB 1WHYA 3OSPA 3KWMA 3CJ4A 1NSAA 3ICLA 1VQ6S 2H5EA 2VPZB 2W8LA 4F02A 2UXDJ 2HHVA 4FKXA 4ICLA 2CWKA 3M2VB 2E5GA 4USIA 4QW8A 4ECYA 3C15A 2CUYA 4YR3A 1S4EA 1DAXA 1R8BA 1UFKA 3AJDA 3T5KA 1OMSA 2DNNA 3OVBA 4RKUC 1M1KT 4FBUA 1ICEB 1T94A 2L48A 2VG5B 4M8LA 4QPTA 1JB0C 5D77A 3TNVA 4OI2A 1N5VA 1TQLA 1FRLA 1RKIA 4KTQA 1UWBA 3QT7A 4XTTA 3GIMA 2BJ1A 4QWAA 1FVQA 4WFNQ 1N6QA 2VOPA 5DG8A 4K4ZA 1H2VZ 5ETOA 4W4MA 4KC5A 5KFKA 1XNQF 2LQJA 4ZVFA 3PJ9A 3WX8A 1S9EA 2AU0A 4R5PB 4NLRA 3ZO7A 4I6AA 3EVOA 4JYAJ 4CYUB 1WG4A 1KONA 2B7CB 4WP8A 4RW9A 3RB4A 4DSLA 1YJNS 3HHLC 2OSQA 4Q0BA 3DXBA 2FYXA 2XULA 3B4DA 3FCWA 1N5YB 1N0VC 3IM9A 5KFZA 3NGRA 2W7OA 2DRAA 4URSA 3D6FB 4B3SF 2EWHA 1SH3A 1Y5LB 4B9UA 3EMTA 1JX4A 3ZFVA 1XNRJ 3IAS9 3BPSP 4UF4A 1F9EB 3LQVA 3MEGB 4HT5A 1LK7A 1HQ2A 2MQMA 4QIWD 3ZZPA 3W9HA 5C42A 2M8DB 1DZ5A 3PIOQ 2XWXA 4OZ0A 4USUA 2V9WA 5A2QU 2B9XA 1KFDA 4OX9F 2I5JB 2LYVA 4WU3A 1K9MT 2VDHA 4ELVA 1B7FA 5JJBA 2B51A 2IM0A 2JX2A 2YNHA 4MIAA 4ZN3A 5G4DA 2DGVA 4P71A 3KUEA 1MLAA 4ES2A 4AT1B 4HHJA 2P6TA 3ZZUA 2PEHA 1AT1B 1S1UB 2EKNA 1U24A 1EIYB 2PO4A 5HROA 1R89A 5K9FA 3ZTPA 3D66A 3SI8A 1OJ4A 3HHKA 4C11A 2QA4S 2MZSA 1LWCB 1PG5B 4PR6A 2F8EX 1RJJA 2YH0A 4KGMA 4CIOA 4C48A 3G8SA 5KFGA 4AQYF 3PO5A 1TELA 3LO3A 5HVGA 1FXRA 2OEKA 1TKTB 3H0PA 2HNYA 5IQ6A 2ZE2A 1NJZA 1VIOA 1DQ9A 3UDVA 1RKJA 1HW8A 3ZZRA 3V6DB 1S9GB 2M88A 2HVHA 1MMDA 2ZUGA 4CM0A 1AROP 4PWUA 2KXNB 3RW7A 1RADB 1NK6A 2VU5A 4MYTA 2FVCA 3HJVA 1TKDA 4LF7F 4HTJA 3HKZD 2DBBA 3D3CJ 4QIGA 4NA2A 2GQCA 2KRRA 1EJ7L 2UUWA 2DNLA 2OI2A 3FUYA 3CJ8A 3BN4A 4CYUA 2ZH7A 1ZETA 3TA2A 3VQSA 3MUMP 2MHEA 1FX2A 4J9LA 3EDQB 2IA6A 3SSQA 1QTMA 1CVJA 2AT1B 2GMLA 1TV6A 3TAPA 2FHMA 2BW2A 2ZZNA 1APSA 5FDLB 4IUFA 3DRRB 1T05B 3HJFA 1IKYA 4PWDA 1HA1A 4B3RJ 3M7VA 3K5MA 2J7KA 1BMQB 3IS9A 1UFWA 3C16B 5CYJA 1VC5A 4FYDA 1QAJA 2ZOFA 2R2SA 4DV0F 4FXWA 2J76E 2L41A 3I0RB 2Z56B 5B0AA 1Z1ZA 4J90A 2P9CA 2RRBA 1AB8A 4DSEA 2CNNB 4IOBA 1TAQA 3NBPA 1U02A 1Q16B 1NLKL 1HMVA 5G0RB 1FEEA 4LF1A 4Z7YA 2W9CA 2GQ2A 2RAQA 4CO4A 3V2UC 1SQGA 2MY8A 3M2VA 2K1RB 4JI7J 4I67A 1TVRB 2A2DA 3CMES 3UD3P 3EZOA 3TEGA 4P52A 1TTHB 4AD6A 5IM0B 4P2SA 1HPZA 4WXWA 5DLGA 3HT0A 2O01C 3HFVA 3PXGa 4UZBA 4FPIA 3PX6A 1T03B 1BE4A 4FBTA 1RWWB 3KXDA 5KTQA 2YH1A 5LL6d 5GMKa 2XB2D 1X4BA 5HO4A 1D9DA 3T5HA 3GIRA 4PG7A 2LA6A 2GV1A 3PEHA 4ZVOB 4DX6A 2YX4A 1HNXJ 3R2CJ 3R6LB 3QFWA 1BUXA 3I6PA 3GONA 4PG4A 1SJFA 1CG2A 4HHUA 2QX0A 5KFPA 1K1QA 4CO3A 4C4WA 1NDLA 2DHAA 3GMGA 4CLZA 3CT9A 2W01A 5B08A 4O0IA 4HYKA 1X8DA 3SDEA 2KXHA 1T95A 1SVDA 3JSRA 2UUBF 2FJAB 1N6QB 3MPDA 4CLFA 2V4JB 3K5LA 2OH2A 3Q89A 2HNZB 2CDQA 3KTQA 4DCOB 3DHXA 2D7SA 1DBDA 2L3MA 4YB5A 4J9QA 3O3LA 2VZ9A 5CYQB 3HVTB 3CULA 2FC8A 3DMJA 3FK4A 5FDLA 3H42A 3RYLA 4GC7A 2IC3A 3IO1A 2DGUA 3RGIA 5CXTA 4B3TF 4C8LA 4B3OA 2L9NA 4QIEA 5LOQA 4CI0B 4UY8T 4LFAJ 2IDLA 5A8RA 3TRGA 3BKFA 3JB9k 4BDPA 1SBRA 2DEJA 2RD5C 2MZQA 1RWKB 2AF6A 3E01A 3TANA 4DPYA 3JTNA 3M8PA 4RUCA 1UP1A 3ZZ0A 3DLJA 4JI3J 1UAWA 4NZ7A 2ZOMA 1RSCA 1HI1A 2H4YB 1RCOB 4JI6F 3UN2A 2RU3A 1FRIA 1KDNA 3N5FA 3PVXA 2PMHA 2Z57B 4I4BA 4ID8A 3GCWP 4Y2IA 4O23A 3TOQA 1S6UA 3R6GB 4OHXA 3Q22A 4G1QB 4P10A 3UN5A 1RAAB 4RNHA 3QRPA 3CE8A 5AXLA 5KG2A 2HFVA 1JNRB 2EBEA 4AYBD 1MWZA 2OIHA 2L9WA 2E7WA 4ZIVA 5HMWA 1E6VB 4JOUA 2JL9A 3ADAC 3M8RA 4DV3F 2BABA 2AYBA 1UEVA 3DI6B 5KFUA 4QYRA 5AJ3J 1S1WB 4QYZK 5KT3A 2FJBB 4MK7A 2Z2ZA 4L76A 3HD2A 2RF2A 3CVKA 1Q8KA 2AGQA 2H51B 1GXTA 2A18A 2CXEA 1RAFB 3SDEB 5KOXA 2W9AA 3UD4P 1RZMA 1P9YA 4J9UE 3DOLA 4U67Q 3OVSA 4RW7A 4A47A 5T7LA 4Y65A 4BC9A 1N34J 3JXOA 3CUNA 2VBYA 4LSNA 4J9KA 2FLNA 4IG0A 2KVQE 3F56A 2CJKA 5FJ4A 3HSJA 3IM8A 3PRVA 5L1KA 3A1YG 2MZRA 1X4EA 4P7TA 1PYTA 3POTA 3QGIA 3M6UA 2CQGA 1HNIA 2P6SA 3FFIB 2Y1LB 5THWA
chains in the Genus database with same CATH topology
3TUJC 3MMAB 4WFZA 1PC5A 4WE1B 4ED5A 2UP1A 1KN6A 1VK3A 3I0SB 1QVGR 4ILMA 2XMJA 2F9DA 1NEEA 2AJ1A 2E1RA 2YKQA 4FVCA 3JSBA 4WCEQ 1JLCA 1DARA 1GX5A 3CCJS 4M95A 1SC6A 2OSRA 3RZAA 3OQ2A 1QAIA 1RTDB 3J7YU 5L9XA 4WZQA 3MMBA 5L9NA 1SI9A 4URGA 2DGSA 3G8TA 1UEUA 2HGNA 3NG8A 1GXUA 1RT5B 2XMKA 1YBAA 1WF1A 3DOKA 3EGZA 2BZ2A 2QT7A 4ECZA 3QJPA 2XBPA 2KH9A 3MM5B 3QO9A 2AX1A 3QLHB 1H0HB 2LEPA 1Q8IA 1S6PA 2J9CA 5EGYA 1N33F 2XSJA 1SQEA 2K3KA 4FF2A 5KFQA 2NUUG 1G3OA 4IO1A 1N5SA 2YNGB 3DLKB 4QBUA 2HW3A 3P3DA 5BYSA 3IGNA 3MOJB 2OMOA 2FTRA 1G1XA 3IG1A 2VUGA 2VC0A 2UVUA 1R6YA 1S1TB 3BDEA 1RISA 3KK1B 3CD0A 1RT4B 1U25A 3G86A 5BYQA 2V8GA 2ZH3A 1FJ7A 3BR8A 4E98A 3HHLA 4DHVA 5J2PB 3HDSA 4DDFA 4L3NA 2EBGA 1FNMA 3J80Y 2BACA 5LSOA 3RAQA 2KZZA 3KK2B 3GILA 5KG5A 2MGZA 2VPXB 3NCQA 1GTEA 2B0GA 4DS4A 3PFEA 4WTYA 3W2VB 3HKWA 1WHWA 3OTDA 2J8AA 5A6PA 5J1NA 4Y0FA 3OVAA 1KQSR 4IYQA 1CQMA 3VZHA 2E44A 1ZPWX 3RB6A 3UDCA 3DLEA 1K73T 2FJEB 4WF9Q 4EYIB 5F3TA 1YJWS 2NSCA 2HHSA 1C1BA 1X4GA 2HRYA 2OPPB 3SV3A 1LQ9A 5DDRC 4IFVA 4G1QA 3QIPB 1JLQA 1MROB 4NXMF 4UY85 3Q2SC 4JI8F 1FXDA 3S6EA 3U1MA 2G0CA 2V8VA 4I56A 2YNGA 4RBTA 3Q8RB 1KR4A 2XEXA 5GADI 2JC1A 2C2RA 4RNNA 4K4XA 2N3OA 1Q86T 3CGIA 2DR7A 1AFIA 2RB7A 5IFMA 1HARA 1KC8T 3N79A 4KBIA 3N6LA 5A0YA 3IRXA 1LK5A 4LJMA 2YNIB 2LDYA 2BR0A 2EVZA 3BJYA 1XN9A 3TW0A 5KFTA 3RBDA 2ASLA 3HVTA 3CCUS 2AGOA 1K0TA 4RUHA 2MQQA 1A7GE 2OTLS 4OX7A 4WK1A 3THTA 2PIIA 4NCGA 2D74B 2ZH1A 2UUCF 1RTIB 4MMOA 1HI8A 4WE1A 4E0DA 3TI0A 1LFPA 3H2VE 3NGDA 2ZJRQ 4DL5A 2W4CA 3G6ES 3H8YA 1HNIB 1FHTA 4HLBA 3OL7A 1JJHA 4ED3A 1Q79A 3GB0A 4ID5A 2CQPA 3M4XA 2DHGA 5KFXA 1U6ZA 2C2DA 4HVZA 4U9RA 4DSFA 5B0BA 2YKNB 1CC8A 4DQIA 4O3SA 2CPHA 4P6QA 2AWZA 2LEAA 1Z2LA 3KKFA 4WYLA 3CDWA 2NXUA 5KFBA 2XMVA 2XSJB 4KE5A 3CJKB 4PKDB 1JIHA 5IS2A 6FD1A 2JLGA 2EI5A 2HLTA 4I2PB 2B9WA 1Z4UA 1WTFA 4RW6B 3G8SA 1ZH5A 1V3ZA 4H4KA 1RT5A 3DOKB 2KDOA 1UWBB 2VODA 1VQ8S 1YHQS 4OFZA 3CEDA 1Z2ZA 1KNZA 3FJ2A 4NWBA 1WTBA 4B9MA 2XLKA 2ZZMA 2BV3A 4UUXA 2ZHAA 2G1DA 2DIUA 2DH9A 4EU0A 5K8MA 4O3QA 2IA0A 3VWSA 2AV5A 3C46A 4NYZA 3MMCB 5DG9A 2ASJA 1ZTTA 2HHXA 4PXBA 1HWUA 2R7SA 1RWUA 5SUHA 1FESA 3OXLA 1MU2A 1D1UA 4LQ3A 4MH8A 1JLBB 2FVQA 2IAJA 2BJDA 1RI7A 4C98A 2IMOA 3KLHB 2Q43A 4DR5F 3RB0A 1L3UA 3PY8A 2V8DA 2ZBIA 4OV1A 1N0UA 1P9QC 1I6JA 1U1PA 3S01A 4B9LA 2NREA 2MKIA 4KRWA 3ZC4A 3JYTB 3HHDA 4MYUA 4ECRA 4ED6A 1OWXA 2HNYB 2M8HA 1URNA 1HBUA 2BANB 4DFKA 3ISZA 4M63A 1XR5A 1S97A 4Y6IA 4KAIA 2ILZA 3OUYB 4TU9A 4QW9A 3KHGA 4PQAA 2KFYA 3Q8SB 2KU7A 4FPRA 2MQPA 1VQKS 4ZP9A 4QWBA 1TL1B 3AH6A 5KFLA 2L08A 1ROFA 3D28A 4Y2KA 3K2YA 5L39A 5KFFA 1GX6A 2QRRA 2M52A 1TV6B 1FDBA 2BUNA 1DHMA 2NUHA 2B9YA 2MSTA 3DXSX 3R5BA 4ZP6A 1OSDA 4ECVA 2DJWA 3ENVA 1N56A 3SQGA 2R7UA 2JFKA 3H98A 3PNIA 1REVA 3GR1A 3T9NA 3ITHA 2DVIA 4AL5A 1U2FA 4EBCA 2CPZA 4ZPTR 2XCAA 4ED1A 3BN7A 3CC2S 1SJ1A 2GC8A 3HP6A 2B4VA 3E8OA 1C4CA 4NXNF 1YJVA 2HFOA 3CTRA 3V5RA 4DL3A 2OFHX 4RNOA 3HVAA 1S49A 4AFFA 2ZJQQ 2DR8A 1HMVB 2WSEC 1LXNA 2ZH4A 2HHWA 2DR9A 2JEIA 2ZVSA 5KFJA 4A8SA 5KFAA 5KFCA 4KGKA 1R0AA 1N52B 1YGYA 3UDLA 3I82A 2R7VA 2O3DA 1FTRA 4BHQA 1N8RT 3OLAA 2BM0A 1M5OC 5EX0A 2W9CB 3O1LA 3C3LA 3V4IB 3RB3A 1OO0B 1H98A 2C2EA 2VONA 1UJ4A 1HQUA 3H5YA 4J37A 2AQ4A 4MK8A 2CQ2A 1QE1A 4ATNA 3JTOA 2KXFA 2CVIA 2Z4PA 3MM7A 4K2XA 3FRZA 3RR7A 2GX8A 2GGPB 1VC0A 2BOPA 2FHKA 2CPYA 4DN9A 2VOOA 2CPFA 1TK8A 3LP2A 1HWLA 2IJNA 1UETA 1UKUA 3O8WA 4IQMA 2MQOA 5HP1A 4X4PA 3DLBA 2Z2MA 2FVRA 4P7VA 4I6YA 3QJLA 1U4BA 1UVNA 2Y1RI 2B43A 2FHJA 2ILYA 2UVRA 4LFAF 3MPWA 3DNCA 3DRXA 2N7YA 4ERDA 4ZPCA 3CPWR 3GV5B 4B9SA 3WC2A 3G96A 5I3PA 4DS5A 3N4WA 1B0VA 5GAEI 5KOWA 4CH7A 4YDDB 2QLXA 3I4HX 4DL7A 3MD1A 1LFWA 1IR0A 7FD1A 3F73A 1OPIA 2HNZA 4CO5A 1WNEA 2EG2A 3NP5A 4GC6A 2VC1A 1WACA 5J2MA 2GHWA 3OV7A 2UXCF 3AJ2A 2B3TB 3MURP 2KG0A 5F8JA 3M2UA 2UXBF 2CQ4A 4PPDA 2J6TA 2JWNA 3T1YF 1VQMS 2YKNA 3B82A 1S76D 4XO0A 3NNCA 1NU4A 4X4TA 1Q7LB 3QAEA 2JLEA 3D2WA 2QA2A 3H25A 3U7JA 3LUYA 2DNKA 3VALA 1HHTP 2EG1A 3IAM9 2GMHA 3TUIC 2XLIA 2ZM6F 1M5KC 5DQHA 2DNMA 4DV4F 2MKCA 4RW8B 2DK2A 3L3CA 4UOCA 1TR0A 1EETA 1CQNA 2CPIA 1RTHA 3CCMS 1SH0A 3CXCR 5IWAF 2E1CA 1Q8BA 1HD0A 4JV5F 3MUTP 2AYMA 4ECWA 2MSSA 4OLOA 3DGPA 2LQ5A 5D78A 4K50A 4XK8C 2XS5A 2KRBA 3K5NA 1UJ6A 3IRWP 1H2UX 3D0HE 5DDQC 3Q8PB 3RAXA 2YY3A 1TFWA 3JSMB 3FGVA 3NNHA 2B4PA 3VAGA 1S1VB 2DO0A 3I9V9 2LQ9A 5D8HB 4YHHF 4XDDA 1S77D 1UVIA 1DLOB 3M2RA 4IRKA 4EFAC 3PM9A 4OLPA 1E6YB 2J0XA 2FGCA 3P6YC 3SCJE 4EEYA 3GV8B 3ISND 2KG1A 5CZVA 4CTAB 3SV4A 5HQ8A 2P9EA 4A8FA 1TKZB 1FERA 2MKHA 2FDNA 5CQGA 3KYLA 5EWEA 2GW8A 2AX0A 4C9DA 3L95X 3RAMA 1JK9B 2DCLA 1TK5A 4OMFG 2OPRA 2VL1A 5T7LB 1JLAB 4ZPBA 1C1BB 4Q2MA 4DV6F 3NCRA 1GH8A 1WELA 5J2QA 5DLFA 3K58A 5KFSA 4DLEA 2FB0A