1RISA

Crystal structure of the ribosomal protein s6 from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S6
publication title Crystal structure of the ribosomal protein S6 from Thermus thermophilus.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 25
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1risA00
4DR2F 4LFBF 4DR5F 4X66F 2KJWA 1XNRF 4DV3F 1FKAF 2B7CB 1QJHA 1IBLF 1GH8A 1N33F 4GKJF 1XNQF 1LOUA 4LF4F 1N36F 4K0KF 4B3SF 4B3TF 1HNWF 4LFAF 4X65F 5AJ3F 2HHHF 1HR0F 1RISA 4DV7F 5BR8F 1IBKF 1IJEB 5IWAF 4NXMF 5LMNF 1I94F 4LFCF 2ZM6F 1IBMF 4JV5F 4OX9F 4JYAF 4DV6F 3T1YF 2J5AA 4LF9F 2VQEF 2UXDF 1XMQF 4JI5F 1IJFB 2UUAF 1N32F 1G7CB 4DV4F 4DV1F 4DUZF 2E5LF 2UXBF 4DR4F 4DR3F 4JI1F 4NXNF 4DUYF 1HNZF 2KJVA 4YHHF 4JI4F 1F60B 4LF7F 4GKKF 3T1HF 1XMOF 4JI6F 4JI2F 1HNXF 3R3TA 1G1XA 4DV0F 4B3MF 1N34F 4X62F 1J5EF 4JI8F 4JI7F 1FJGF 2RJZA 4DR7F 4DR6F 1B64A 2UU9F 4JI3F 1CQMA 3OTOF 4DR1F 2UUBF 4LF5F 4B3RF 2UUCF 2B7BB 4JI0F 1CQNA 2BVZA 4LF6F 4X64F 4YY3F 4LF8F 2UXCF 1VMBA 2F4VF 2YY3A 2VQFF 4KHPF 3ZZPA 2BXJA 5LMUF 4DV2F 4DV5F 4AQYF
chains in the Genus database with same CATH superfamily
2A10A 2DYAA 4LFBF 3VR1A 3KUHA 1NB7A 3MR3A 2HHPA 3OL9A 3I56S 2ZBRA 3IRWP 4CZCA 2HQ3A 3CW2C 2CQHA 2YKNA 2BA9A 3HFKA 2EI5A 1HYSA 3T3FA 1A6LA 2VFUA 5HLFB 4UZBA 3P4UB 1ZPVA 2IHR1 4Z2XA 2OPPA 3HO1A 3VGUA 1H2UX 4WF9Q 1NO8A 3M1VB 2HS3A 4DCOB 3S01A 4U7UK 2XG8A 5K14A 2O3DA 3TZYA 1EAYC 3R5CA 4IH7A 1U1MA 1FESA 3Q8UA 4MKBA 4GVBB 1S4EA 1LWFB 3EYZA 2WK4A 4I69A 3LPEA 3RB4A 4WIIA 4C8ZA 3GFHA 2V4JB 5GAEU 3N5BA 3I0SB 1LWCA 2DNQA 1WHYA 4MYUA 5CYMA 3PO4A 2A3JA 3PO5A 4B3TJ 4IUFA 1VC6A 1VRUA 1CULA 1Q8LA 1TKXA 3MMCA 1ZOTA 1KDNA 5IT4A 1SBRA 3MM5A 2MKHA 4WJBA 1UJ6A 2XI2A 4DUTA 2AYEA 4R5PB 1FE0A 2Q1LA 2DBBA 1CJTA 4BC7A 1SUQA 3IG1A 2QV6A 3MAHA 2QYGA 2BV3A 4B17A 3RB6A 1K1QA 3NGSA 2MGZA 3P49B 3H98A 3VAMA 4RUBA 2RRBA 5M2RA 4LF6J 2XGPA 1N5TA 2CZVC 1U6ZA 3MR7A 2EG2A 4O4GB 4B3OA 4OI4A 2X1AA 4KKOA 7AT1B 4F7VA 2ROPA 3ZTOA 1HKAA 3OLBA 2IYIA 3HVTB 1NKBA 4LREA 2PN6A 4HACB 2HHSA 1N5QA 5KT3A 3N6NA 3KLHB 4OHYA 5E3RA 3UDLA 1KS2A 2JHEA 1IBCB 4I67A 1YTYA 2DRAA 4PYAA 1HQEA 1XWLA 1O0PA 1UMJA 4O3NA 3JTOA 2VOOA 2DNLA 5F3ZA 3KLGB 4RNOA 5CHCB 3KNAA 5L9NA 1VISA 3WHIA 5IT9Y 2VPZB 3GJSB 1PJ5A 1RHUB 3HHEA 3ITHA 1NSAA 3BZQA 1O8BA 2KO1A 4EU0A 1RT2B 1S99A 1FXRA 3HPOA 2PFFB 4XIUA 1SKSA 1RAFB 5D4PA 4DFMA 1AT1B 2GNKA 1G1XA 3ZZ0A 1HNIB 2HW3A 5K8OA 4DPUA 2I0XA 3BGLA 1U6BA 2JEIA 3MPWA 4PG7A 1XR5A 2E7XA 3BSCA 4LF1A 1ZA2B 2X3GA 1S6OA 1U1KA 3P3DA 4F4AA 2GO8A 3PW4A 3V6JA 3BO3A 2YKOA 3AAWB 1DARA 3CJ8A 1ZM3A 3F0NA 4ZJLA 2R9LA 3M8SA 4FXDA 5F8GA 1CBKA 5A0YB 2A2CA 2E9ZA 4AT1B 2CQ3A 2EVZA 5HJYA 5HK4A 3RYLA 3NOCA 1S0OA 4JI4J 4C8LA 4Z37A 3GTYX 4A8OA 2VC1A 2ILYA 3FQLA 4DSJA 3ETMA 4ANCA 3M8QB 4DV4F 4CLPA 4WK1A 4DR3F 2P8IA 3R5BA 4FYWB 4FNIA 1RE1B 1FJEB 1CEZA 2J0WA 4KRWA 1G4CA 3HSGA 4NLPA 3DOKB 2FLOA 1TV6A 3BJYA 4DPTA 1T9XA 3ZC4A 3BGRA 1S0NA 2J7UA 4MMOA 3WDOA 2CJAA 4OI3A 4RUCA 2H4WB 2VL1A 3MOZA 3A8JA 2XZDB 2VG5A 2YX7A 4ZJQA 4X65J 3PYFA 1QE1B 5J2MB 2KG1A 4IO1A 4ZP9A 2IM1A 1Q78A 1VQKS 2MXYA 1HBUA 1IBMJ 1IBLJ 2B9WA 1S6QA 2B6AA 2RU9A 1GEHA 4UUXA 5F8LA 2UXBJ 4ICLA 4NXNJ 2IC3B 1I94F 2OMOA 3PNIA 1DBDA 2IPOB 5ETRA 4B9SA 4FXVA 3KLEB 2W9BB 1DLOA 3EDRB 3IXQA 1WOPA 2CFXA 2ZKUA 4C8KA 2GVZB 2GHPA 2LQ5A 4MIBA 3JS9A 2IMOA 4JI1F 3MM6B 2FTRA 1FFGB 2W4CA 5CXTA 2OO4A 3VAFA 2R8KA 1HL6A 5AXNA 3LW5C 2FPHX 4DXLA 4OX7A 4RW7B 1VQNS 1XTZA 3D3BJ 2VB6A 1VOMA 4H4MA 4B9LA 1XNQJ 4RJVA 1MU2A 4LSNB 4L6V3 1EKSA 1N33F 3G82B 2IVFB 1R89A 4TN2A 2GHWA 3HP6A 4RX6A 4JUZA 2HIYA 1MMNA 2K1RA 4L72B 3EVWA 2O01C 3MM9A 3GR1A 1D9FA 4KJIA 5CA5A 2DRBA 4RU2A 4J9VA 4DU8A 4DUYJ 2EC0A 3CIMA 3HDSA 3Q8YA 1FFWB 2IJFA 5GMEA 1FXLA 2G2OA 1S1TB 4KTQA 3CMES 1J5OA 3FCVA 2L48A 4M5DB 2RQ4A 2UUCJ 1DQAA 1HPZB 2HQGA 3IGNA 3PX4A 1W7WA 2EEYA 3SZ2A 4ECYA 1IQZA 2HAFA 1OO0B 5HL7Q 1RTHA 3S6EA 4F4KA 4DV2J 1X4DA 4TLRA 3OTDA 4U9RA 3LP1A 3T5HA 2BVZA 2R42A 4ZVGA 3T9NA 4MT1A 2FJAB 3CJ4A 2BJ7A 2RDIA 4WU3A 3HULA 4H54A 3TZWA 3OVSA 1M90T 3NGRA 2A0FB 4YS2A 2DTJA 4RW4A 2OMLA 2ILZA 4DDFA 1UVIA 3R5GA 2MY7A 3LAMA 2V2ZA 2G1DA 1RAHB 2R2RA 2RKIB 1C2PA 2HURA 1N32J 2VBXA 1GT8A 1NK7A 3ZZZA 3VAKA 1GTEA 1ELOA 3KJQB 4UQGA 5KOWA 2W4DA 5DGAA 3IRXA 1H6KX 4F4XA 1WSRA 3V81A 2HBRB 5J2QB 1XMQJ 3G8QA 1FFSB 1KLMA 1BY9A 1FEHA 5KFEA 4ES2A 3H0PA 1A7GE 5IM0A 2N3LA 5HROA 4PKDB 3X1LB 1RUSA 2MYFA 3GIMA 5KG7A 1KWMA 2LU2A 3CC2S 3NGUA 3MOJB 3OD2A 3J7YI 1UVNA 2W7PA 3MPYA 4ZIWA 4NLWA 2QGFB 1HI1A 1SQFA 4LF8F 2CNOB 3R7BB 3K8VA 2DGQA 3TX8A 4EEYA 5DS7A 2E44A 5K20B 2OGUA 2L9DA 3C16B 1WC6A 3A8KA 2FHOB 3BGFA 2JFDA 3SQGA 1X4CA 3MF5A 2CZ9A 1LWEA 4ZPTR 2ZOGA 4C8YA 2E1AA 2K7JA 3D6TB 4M94A 1UPMB 1TR0A 1S49A 4ZVRB 2RU3A 1FRKA 1CS4A 1SJRA 1JKHA 4F2SA 3BO2A 4ED7A 2ZWOA 5E0OA 4QWBA 1DZ5A 3VVUA 3E3XA 4A8SA 5M2UA 3AOBA 1S5ZA 3CD0A 1WTBA 3FDSA 2QSWA 3HKWA 1R8CA 4DCJB 3QYYA 4NLQA 3KLVA 4NL5A 1VRTA 4DR2J 4R25A 4X66J 2BRKA 2VOPA 4A8XA 1JK9B 1RB0A 2IM2A 1K47A 4PWDA 4OYPA 3RW7A 3D66A 1KOOA 1WHXA 3MEEA 4RWWA 2EWHA 4C8MA 1GQEA 5BYQA 3OUYA 3T9ZA 1OSCA 3DYAB 4IG0B 1H72C 3VAHA 3MTKA 3UDVA 3R7NB 3OR2A 1CJKB 3BDEA 3NP5A 4L74A 3I0RA 1NSQA 2D3O1 2BANA 3OLAA 1T03A 3GFXA 4XPCA 1FRJA 1PC5A 5FJ4A 4ZKAA 5C24A 3L09A 2AEFA 4ALZA 1ZZFA 3T6JA 1ITPA 1NMEB 1R7IA 2B0GA 2YKNB 2DH7A 5J1PA 4X64J 3OQ2A 3GQCA 2OJ3A 1YZ7A 1YQHA 3MD3A 5D0EA 4ILLA 5A76A 2LEBA 3GONA 2OPPB 3NNAA 4PABA 1OY8A 4NOHA 3PY8A 4YY3F 4DL4A 4WKYA 2MLXA 5LSRA 2OELA 1EZZB 4DV7J 4WP8A 2YKMB 1SJ1A 3QATA 3KKFA 3A3NB 5LMNJ 2UZAA 1P27B 2W9CB 3CO0P 2CQ1A 4ES3A 2BJEA 4ZLPA 4RBVA 5MLCV 4YMEA 5KFZA 1LWCB 4DUZJ 2OHDA 1TELA 2J9DE 5DETA 3M32B 4QW8A 3Q89A 2G4BA 1VRUB 2EPIA 2RS2A 1F0XA 1CULB 5A8WB 2IDLA 2UUAF 4KAIA 3BSOA 3IAM9 3MMCB 3HHKA 4DR1J 5BYRA 2V9WA 3SSQA 4RW8A 2H3EB 1MROB 2G1HA 1OY9A 3GCXP 3ZZTA 2J76E 4UUWA 1J5EF 2NUHA 3EGWB 1CJTB 4WU2A 2XZWA 2UU9J 3IG1B 1ULRA 2HKEA 1KR4A 2MGZB 2XMVA 1PAUB 1RAJA 2YNIA 4CO1A 1OMSA 4LRBA 2C2DA 4O4RA 1VCTA 1C0UB 1PYTA 2ZJQQ 1K44A 3OBIA 2CKWA 4FKXA 5D0HA 2GZOA 3HCXA 4KKOB 4Q0BB 5L1KA 3HHLD 1RWNB 4V19J 2YVSA 4CI0B 5DG8A 3R1LA 4TKTA 2MZTA 5HJXA 4A8WA 3TAMA 3DOLA 1T7PA 1S1UB 3TZXA 5IOLA 5HVHA 1F3VA 3IM8A 3TQ1A 1TUVA 1HQEB 2VFRA 3SSRA 1B0TA 4C4WA 1TKDA 1AA1B 5FLXU 3MZIA 2VDIA 1SJQA 1SL1A 2VQFJ 2K3IA 2N7CA 1Q1KA 3QGPA 1UZDA 1JQGA 3ITHB 2ZH9A 3CT9A 4NLRA 3OTOJ 3ISZA 1WG5A 3KG1A 2BQ3A 2J0QD 2GW8A 3AD7C 4NRUA 2B9EA 4LRCA 3FBCA 4RW9A 3CJ3A 1X8DA 3KJVA 1R31A 1VRQC 3DGVA 3T41A 4KR0B 2LMIA 2XMUA 4QIWD 1S1XA 1Y9OA 4URSA 1QUVA 1UCNA 2PIIA 2VPWB 4FNHA 2LQBA 4P2FA 1X5TA 1H3DA 5J2NA 5KT5A 4YB5A 5HBMA 2IJRA 3UN2A 1URRA 3CXCR 1ZA1B 4ZHRA 5DM7Q 2V68A 1OSDA 3HZEA 3KG0A 2PO4A 1QTNB 2MQMA 1YK9A 5KG6A 2YX1A 3I6PA 5C2CA 3J7YU 2C3OA 4DR6J 2QEXS 2CJYB 1ZZNA 3FMBA 3KXDA 4QWDA 1T9VA 3MPUB 1UWBA 2DNPA 3Q8VA 4RWXA 3PIOQ 1TVRA 3R2DJ 3P5TL 4OYXA 3V6KA 4A8FA 4TVAB 2OSRA 2D9PA 2CQ0A 4J90A 1L3VA 3PX0A 2W7OA 5KG2A 1XQIA 2PDAA 1NLKL 3ET6A 3GU0A 1RA7A 4AQYF 1F5CA 1N6QA 5IC4B 3IGVA 4AXIA 2YH1A 2G13A 2N4DA 1N56A 1IBLF 1U1QA 1M5OC 2WOMA 1YZ6A 4HTIA 1Z2ZA 2NXCA 4X4UA 1HNWJ 1NZ8A 2BMBA 1GAOA 3KLFA 1BGXT 5D4LA 4KO0A 4U67Q 3HD2A 3RTVA 4GRSA 5CAAA 4J9SA 2C1EB 4X4RA 3CCUS 4HYKA 2FY1A 3J7AN 4WP9A 1RAIB 5HP1B 4JI5F 2R7VA 2N3OA 4D3GA 2M52A 2MKIA 2HHUA 3THVA 2FY8A 2E1MC 3D6FB 2IDEA 3CJTA 2C2OB 4GC6A 2V8GA 2MLZA 3SXLA 2DGWA 2GIQA 3HJFA 1Y10A 3MURP 1RLDA 1G3OA 1XNRJ 3KWMA 2EFNA 2Q3PA 4WFBQ 2B8PA 2VF3A 2YY3A 2FHKA 5LMUF 5AE3A 2DKOB 4UY8T 1WDTA 2QLFB 4K2XA 2G2ZA 5M2PA 1YBAA 3NAIA 2WB4A 4TY9A 1PILA 1F9EB 2HGMA 5EUHA 3MHYA 1KFDA 2FVSA 2FVCA 4KGXB 2B4OA 3M9MB 3C6UA 2V8PA 4H4MB 1TMMA 4NLUA 3SSSA 3M4XA 1X4BA 1WC5A 1HD1A 4UOGA 1SPBP 1KOHA 3R8YA 4WP3A 4YHHF 2ZNYA 2W2QP 1RT7A 3MM9B 2P5VA 2B3TB 4OFZA 5A2QY 2R2UA 8ATCB 3S7RA 1LEOA 2KRBA 2WRMA 3MI7X 2QT7A 4DL0C 4HTJA 4RUHA 3K5NA 4FS1A 1S72S 1FXDA 5F0UA 3K2YA 3J81U 1ZAXA 4OJ3A 2BXJA 4FF4A 2E1CA 1QM9A 3QJLA 2M3DA 1IKVB 1CG2A 2AGOA 5HQLA 3CCQS 1RTHB 4WTYA 4N56A 1QSYA 4LFCJ 4LR7A 3BEGB 1DJ0A 4LIRA 2IA0A 3D7SB 4K0KF 1IM4A 1TP7A 3EXCX 5JUMA 2V2VA 1RAAB 4UT4A 3G87A 3HHLC 2HWIA 1FT8A 1X60A 4K8RA 2JNJA 1FK9A 3JYTB 1XMQF 2KG0A 1BWEA 4ZJOA 2DHSA 1QLNA 2ACYA 2YX4A 1NHVA 1KHWA 2P2CB 4FYDA 2HRUA 3PKYA 3RBXA 2IVMA 5GAHI 6FDRA 4ZK7M 3J7ZT 1NKEA 1XEZA 4ID8A 1RCOB 2ROEA 1EQMA 3PCOB 5E41A 1KLMB 3PACA 1OPIA 4QYZJ 5F41A 2AHOB 2DEJA 3POTA 3PFEA 1PC4A 6AT1B 1HQUB 4NWBA 3WC0A 2CPEA 3KNGA 4E98A 2F8EX 2JRSA 4NLGA 3N79A 1DTQA 3D67A 5BXIA 1WOSA 3S8SA 2G9OA 1U0HA 1N5YA 1VGYA 3BYPA 4DOZA 1RHKB 5AJ3F 1R8PA 1GTHA 3IWXA 1JLQA 4ZLLA 1NDCA 4TY8A 3H5XA 2LVWA 1RKIA 2PSZA 3H59A 1NHKL 4A4JA 2B4PA 1F3FA 1IKXA 3SQGB 2IA6A 3EXYA 2C2NA 3DLEA 2M4MA 1LWEB 2JH3A 1NPRA 3C8YA 3VVTA 2BDPA 3RAXA 2H1YA 4R8UA 5EDWA 1FX4A 2QLXA 1KLNA 4DR7J 1CS4B 2YWHA 1FRIA 1NK0A 3G6XA 3ZFVA 2ZOFA 3OV7A 2VZ9A 3D3CJ 4N77A 2G2YA 4J7CA 3GILA 1FVSA 4AL7A 1L3KA 4JV0A 4DR5F 1VBKA 3NRBA 4OZNA 1RAEB 2CAJA 1P1TA 3NOGA 4KFBA 2RILA 2E5JA 1Y3KA 3GFYA 2K06A 5IZHA 4F25A 4HI1A 2DGOA 2NYIA 4CO5A 3G9CA 4JI2J 2CADA 3B4MA 4PXCA 3RW6A 1REGX 3VHQA 2JDJA 3KTQA 4DV1F 3H5YA 1YRXA 3L9ZA 4Y2MA 4ZPAA 2IBOA 2AV5A 3ELHA 2XI3A 3L4BC 2OPQA 1WC0A 2E5HA 4EBDA 3LO3A 1T03B 2I2YA 4DV5J 3UQSA 4OV1A 3ISNC 1UFWA 2EFPA 3NS6A 2PA8D 2W2OP 5C24B 4B08A 3CJQA 4PZVA 2EC2A 1VMBA 4KQZA 1S10A 5KT7A 1WORA 1X0FA 5HAOA 2V8VA 5E3CA 6FD1A 4OLOA 1U09A 4JV5J 1RHMB 3SFUA 1WWHA 4ZITA 3ZZRA 3TEHB 2EFGA 1Q8BA 4CO2A 1FNMA 2ZNZA 3QLHA 2EFQA 4RO0A 4HH0A 2EKYA 4WE1A 2B8QA 4C48A 3F56A 5IWAF 1AFJA 2CNNB 4NXMF 3US5A 1UL3A 4ZVFA 4AE5A 1B7FA 2AJ4A 1CJUA 2DY9A 4CH0S 3BQ2A 3EICA 5BYSA 1JLBA 1RT5B 4DEZA 2BZ2A 4WFNQ 1JJ2R 3TARA 2C3YA 4ZCMA 1I3OB 5F8HA 2XMAA 3K17A 3MM8A 5E33A 3HFZB 1Q16B 4LT6A 3BF4A 3M6VA 2UU9F 5IQ6A 3HX9A 2HZCA 3HLUA 3Q8PB 3FEXB 4IH6A 2XY6A 1WKLA 1AUSL 1NJIT 2XNRA 1N5SA 4CLZA 4OI2A 1NSKL 3CO9A 4O44B 4RW8B 1RT4A 3GIKA 3E01A 3V6DA 4KT0C 1ZM9A 3Q2TC 2RNEA 2J6TA 4K4XA 3PJXA 3FKBA 5FDLA 4DL6A 2D41A 3LUYA 3PM9A 1VQOS 2CJKA 1SVDA 4ZCIA 1SC3B 3CCES 4BC9A 3N28A 1YJ7A 2UVWA 3R9LA 4JYAF 1EHWA 4DL5A 1KSPA 3DHXA 1VQPS 4X62J 3KJNB 5IS2A 1S97A 2NCKL 2XQCA 4FZVA 5ETMA 4NI2A 4KSEB 3GP9A 1UA0A 2L9NA 3GB0A 4WPAA 4ECRA 5C2GA 1WEZA 2ZE2A 4C3KA 4OI1A 4B3MJ 2KXNB 2LDIA 4OI6A 1EARA 3OTOF 3AD9C 2OFHX 4LFBJ 4BLGA 1DRZA 1X5PA 2HVIA 3PDNA 1VQSA 2MTLA 4I7FB 4KH0B 1WDDA 4ETZA 3IN5A 2HK3A 2XC9A 4P71A 1V3SA 2HGNA 1T9YA 3J80Y 4PG6A 3PJ9A 3BBFA 1VHIA 3KOAA 2GIFA 3SDEB 3FK4A 2QC3A 2QMXA 1KFSA 5L9XA 2V34A 3PW5A 2P9EA 3QQCD 2KM8B 3W62A 1DQ9A 3EVOA 3FC9A 2JWNA 3HSJA 4K5RA 1PJ7A 5BR8F 1IJEB 1BXNA 2BUNA 3OVAA 1TL1A 2YKAA 3SCIE 5GAHU 3QGHA 1QSLA 2DXDA 1X5SA 4P52A 1YRTA 2BE2A 2J5AA 4RW9B 2RQMA 2JL9A 4QBUA 4I6YA 4P10A 4PYDA 1GXLA 4Z7CA 4YOEA 1VYAA 4USJC 4DN0A 2CQCA 2VC0A 1HD0A 4GKKF 3BR8A 4F02A 1RT1A 1WKJA 3HM9A 5HBMB 4KY3A 2H48B 1R43A 2WB1D 1R8BA 3H42A 2KKHA 1P6TA 3UVJA 2V50A 4ZHRB 2NSBA 1XN9A 2Z58B 2MJNA 3UE2A 4B3RF 3G96A 2V8DA 5G0RA 4P2XA 2C42A 4ZLNA 3QO9B 2CIMA 1VQ6S 2ZEJA 2CPXA 1UEUA 1RBAA 4KGZB 1H38A 1M0SA 1UWBB 3VAJA 1KNZA 3HVWA 1VIOA 1TL7A 2JEGA 3NWRA 3PHEA 3QT8A 2ZVSA 5JMNA 1ZAWA 3JSBA 2BW2A 2DEIA 1T05A 4J9RA 5CD4H 1HNWF 4Y6IA 1RWKB 3Q23A 3Q24A 4AD6A 3AQOA 4IFYA 1IR1A 3H4DA 4GO5X 4N47A 4A8KA 4OZ0A 2GJ2A 1TMJA 4DV6F 4LF9J 1N6QB 3GLJA 4I1TA 2AEJA 4NLDA 3IR7B 3RRKA 2ZH3A 2HNYA 4Y2IA 1HNZF 2UVRA 4LBHA 1PCAA 2J9CA 2N82B 1R0AB 1WHVA 3O3LA 3EM1A 3KLFB 1HNXF 3DRSB 3OR1A 1F1BB 2VUGA 4JI6J 2HVZA 2LQ9A 1YSJA 1NKCA 1GX5A 4JI8F 2RJZA 5EWEA 3W61A 5CYQA 1NJWA 4IH5A 4ELTA 3NWGA 3I4HX 3TA2A 1RT6B 2ASYA 3PZPA 1EIYB 2WAQD 3I32A 3TA1A 2ZZNA 3CJRA 5IT9U 5D4OA 2OLWA 4P75A 4YQWA 2ALZA 2DNMA 2FDNA 3ZZYA 2OPSB 3K5MA 2MKCA 2HNDA 1PJ6A 4PPZA 4ZPCA 1RISA 1XMBA 3MEGA 2R7OA 3M6UA 4HDGA 3AFGA 2XGQA 4PRFA 1RTJA 1SC4B 2CPHA 4EYHB 3B78A 3N6MA 3CJKA 5L1LA 3UN3A 2Y9HA 2E5LF 1KVIA 3FZ2A 3DRRA 3KLIA 4BHQA 4USMA 2QFJA 2YWEA 2ZJRQ 3PKMA 4X4OA 1LQ9A 4M5KA 3R3TA 3DMJA 2SXLA 1Y7PA 4OV6A 5LJ3Y 2ZBIA 1M1KT 2AEMA 1BUXA 1SV5B 1S1VB 2GIRA 2AQ4A 3UR0A 1X9WA 3PW2A 1S9GA 3FBEA 3KK1A 2IMWP 3CMAS 4AL5A 3MECB 1VLYA 3UD4P 3UPFA 4K7QA 2ADBA 1N8RT 2PE8A 2VU5A 3UWTA 4RW6B 2HQCA 1EETB 2HBZB 2WW8A 5DDPC 3KUEA 1Q95G 4QZVB 3CD6S 1S59A 1SXLA 2BKNA 3DC2A 4UQTA 5I3PA 1LFPA 4DV4J 1JLEB 4RBUA 5KFKA 4DR3J 3LP0A 3KHRA 1RABB 4M95A 4XDDA 4CTAB 3GV7B 1QAIA 2XHWA 1YJUA 3NL0A 1TKZA 2G0JA 5KG3A 2DHXA 2O67A 1JLCA 5L8RC 5I42A 4Y0FA 4LSLB 2LEPA 4I6WA 4DCPB 2EK6A 4FF1A 2FLNA 4DI6A 2NXJA 1SIZA 1VDHA 4QIGA 1UETA 2ZBCA 2AF6A 2M0GB 2KT2A 2FUG9 1U48A 3L7OA 1FK9B 3TO8A 4RU9A 2F8HA 2ZITA 2M5YA 3BGUA 2MKKA 1FKPB 4BWJA 3B82A 4P6QA 4PG5A 1NJYA 5DLFA 4F3OA 4N7TA 4TU7A 4JV1A 1I94J 2F8MA 2YNFA 5AXMA 3ILLA 1S0VA 1YIJS 4ANEA 3W60A 3ICLA 4F4ZA 4NA2A 4JI1J 3T1AA 2JC0A 3TJAA 3POTB 1WELA 3AH6A 3QT6A 4DSKA 2K7KA 1LW0A 3NGKA 2Y0BB 4OYWA 5HO4A 5DQHA 4N76A 2FC9A 4WTOB 4NYOA 2H54B 3CSKA 1SC1B 3BREA 1U47A 2HFSA 2E5IA 3I9ZA 4L75A 2V5HG 1BQNB 1WOOA 2W9AA 4DR7F 1N33J 4LF5F 2AMCB 3RU0A 4WZQA 4C3MA 4W4MA 1R0CB 4IR9A 3D2WA 5LSLA 3MCOA 2LCWA 1FERA 5F9NA 2PI5A 1UAWA 1H7XA 5B0FA 3IFEA 4ID5A 4IKAA 4MFBA 3DCAA 2HMIA 3MMAA 3IC1A 5KFQA 3IM9A 1VK8A 2KFYA 5T41A 1C0TA 4CM0A 2IY5B 3MEDA 3EJMA 5SZTA 2BX6A 1NB2A 3S1TA 3BH7B 5ETTA 2NPIA 3LA0A 2DITA 1TFWA 1C1BA 4USVA 4DQSA 2GCFA 3GSDA 2EBGA 4QQBA 2OFGX 1HBOA 3GG0A 5LXRA 3MM7B 2JLGA 3W65A 1RSCA 4KFBB 3CC4S 4FYXB 2ZVIA 5A6PA 1X9MA 4K50A 3CD5A 4PUOB 3QJPA 4UOHA 1NZAA 2J9EA 3ETOA 1D1UA 1H0HB 3RR8A 1QVFR 1YJ9S 3G6ES 3W2VA 1TZ0A 1KVKA 5H9FK 3AJ1A 2DNHA 4K4WA 2MQOA 3LWLA 2BJ3A 2FZKB 1SIWB 5AE1A 3K0JA 3GIIA 1S6PA 5HANA 2E7WA 2OPQB 4QPTA 2MEWA 1N54B 1FRXA 2XLKA 4J37A 4LFAF 1ZTWA 3KFWX 2FZCB 1D09B 2VKZG 1RTDA 3D1HA 2LLZA 5C25B 2HHWA 5F8IA 1IKYA 2Q43A 3MAAB 3R5JB 3Q22A 8AT1B 1Q7LB 2DIVA 1YRUA 2BABA 1ZYQA 3NCPA 4N5SA 1WF0A 3AB2B 3BBBA 4NLTA 3GYGA 3QLHB 3CE8A 1KHVA 1R27B 2MPUA 1M5PC 2CJBA 4BS2A 4LF8J 2J7KA 3CC7S 3FBFA 1PYSB 1FDNA 3C66A 2KT3A 2NSCA 1KKHA 4O3PA 2DR5A 1JLBB 2QZ8A 3OFFA 2B7BB 2CWKA 1PBAA 4LUBA 1F5AA 1UZHA 4USHA 1WUUA 2OD6A 2DCUB 1NXIA 5KFNA 4O0NA 4PXDA 3OSPA 1VQ4S 4ED6A 2E9TA 3BS9A 1HW8A 4MJKA 4PWUA 1H73A 4B9UA 2DXFA 1NK5A 2XS5A 2QL7B 1YJTA 3RGIA 2HVHA 2Z2LA 4P73A 4LMZA 1SH3A 3ZZUA 3JSMB 1RT4B 1IM6A 3TYTA 3TWZA 1RADB 3NNHA 3DI6A 3V6DB 3M30B 4QYRA 3M8WA 3M8RA 4DPOA 5E5NA 3VAIA 2CPFA 2ZDPA 1I6JA 4LQ3A 2HYIB 2WBRA 4KV8A 1RT3B 4DWIA 4B3MF 3AODA 4KHMA 3R7SB 1U4BA 4ZMMA 1X4EA 3I4PA 3UD5A 1GX6A 4F4WA 2PA3A 2ZKTA 2FVRA 3W64A 4YN3B 4XTTA 1RKJA 4IDKA 2E9RX 2ZUGA 3M7VA 4URGA 2ZE2B 4ED4A 1X4GA 1IKWB 3I96A 4YUDA 1M5KC 3QT7A 3BKTA 1BQMA 3CPWR 2EG1A 1APSA 2XS7A 3J7A1 1EP4B 1NK6A 4EZ6A 4P9SA 3LF0A 3QIDA 3NAHA 2V4QA 1JLAA 3QRPA 1VJQA 2VQEF 5E3PA 3ILOA 1E6VB 5LXYA 1YJVA 2E1RA 2C2KB 1YG0A 2XYGB 4BDPA 1Q5VA 5AT1B 2C2MB 3CDUA 1Y00A 1CJVA 1Q0NA 4YY3J 2W8KA 1TL1B 2CVIA 4C97A 4WCEQ 4I56A 4RBTA 3RBZA 1W2IA 1Q7YT 2GC8A 3N6LA 1FRLA 3DM2A 3M05A 2MHEA 2VICA 1NPPA 3IP0A 1T95A 4ED1A 1FVQA 2GGPB 2IAJB 1GNKA 4C11A 1V6HA 3CCTA 2B43A 1FTCA 3W63A 5ETSA 2XCAA 2CPZA 2M70A 3NCRA 1U8WA 3W8PA 2MQQA 2XB2D 5A8KB 2LXFA 5DZ6A 2UUAJ 3HT0A 2X1GA 3LGHA 1VBZA 4NA1A 4NZ7A 4QR0A 5CCLA 4LF9F 4NZ6A 1TK8A 1J5EJ 2VV5A 3A13A 2DGXA 1T05B 2GAGC 5ADZA 3M9NB 3NBPA 4JI6F 4IFYB 4DPWA 2HNZB 3KK3A 2H4YB 2JC1A 1HMVA 3TOQA 4HHJA 2YKQA 3PX6A 1V3RA 2MKYA 1OYDA 2ATLA 2Y1IA 2RMLA 4U6PA 3DLKA 1JIHA 3D68A 4C0BA 4CLSA 3D5MA 2A1BA 3TUZC 3WZ0A 5J1EB 2C3MA 3BN4A 5K8PA 3OR1B 4OQJA 5ITHA 1S7IA 3AJ2A 4DQIA 5IV4A 2H5EA 3PR5B 5B0CA 4DG1B 4IQXA 1GH8A 3CCMS 1WSVA 1X7VA 3Q0AA 1NK8A 2PFDA 1YJRA 5HLFA 3N4WA 2RQKA 1IR0A 3VQSA 2CJXB 4OZLA 5KFCA 1DHMA 5CYQB 1JJCB 4A47A 3VGSA 2XMKA 1S76D 3M1VA 4U7CA 1BE4A 1E6YA 1GXUA 2MQLA 1IR2A 5KFHA 4GVBA 2OTLS 4MKYA 5A6WA 5CZXA 3GMGA 1LWFA 2XWYA 2J0XA 3DDNA 1N0UA 3DNCA 3A12A 3NXZA 2VA3A 4O3OA 1IUJA 3MEGB 1H98A 5JJBA 2W8LA 4ED0A 4ZS6A 3OFHA 2MB0B 4M63A 1NJXA 3CEDA 1SL0A 2V4JA 3FFIB 5T14A 5JVHQ 3FBBA 3I0SA 2HFOA 5D15A 3M2RB 3LGMA 2JSXA 1F9FA 2WVDA 3SFGA 1QAXA 2HFUA 1HBNB 3BO4A 1UPPA 3K5LA 2VFSA 3GYXB 4JB8B 4PQAA 5C42B 2VONA 1P9YA 2ZZMA 4CIOA 1JWWA 3MD1A 4QYZK 1JLGB 4R5PA 7FDRA 1AZSB 2JLEA 1RZMA 1AW0A 5T7LB 3RRHA 3O6QA 1S9GB 5HATA 1FHTA 5I3UB 3KK1B 3G6YA 2BKOA 2ZM6F 2WVBA 3KK2B 3CMQA 3FUYA 1AROP 2BYCA 2C3UA 1QY7A 1K9MT 4C9DA 1SJ3P 3LQVA 1FCAA 1FRHA 3O2IA 3EGZA 5K5MA 5KG5A 3CCRS 1X5OA 4ZPBA 2P6SA 4LR8A 2MQPA 4UZCA 2KTQA 3HVTA 2AZ3A 1GMVA 1IXKA 4AQYJ 4OYOA 1UWAA 4HACA 5E3QA 4UTGA 2YQ0A 3KLHA 1TKZB 4KHPF 4FBTA 1F9HA 2ZD1A 3ZTPA 2D3OR 2CQIA 4P7VA 1H7WA 3BQ0A 1U1LA 3WC2A 3LANA 4AFFA 3QGGA 3RZAA 3QZ7A 1PBUA 3MCNA 3LGNA 4JI5J 3MCMA 3CF5Q 2HHHF 1HR0F 3L7PA 3RUBL 4CNZA 4F0MA 2Q79A 3EZUA 4G65A 1WACA 2DPIA 4DX5A 2Y8YA 1LFWA 2QFIA 3BM7A 1N88A 3NS5A 3W9HA 3GIRA 2YNFB 2CVEA 4M5HA 1M5VC 5DDRC 4Q7AA 4M5NA 4OJHA 3THTA 2DR6A 1MG7A 4I4BA 4MYTA 3NKYA 3R5AA 5E2QA 4ED2A 3JAMU 4ECSA 2L9WA 3MMBA 5L1JA 5LMUJ 3IR6B 2OTJS 4ZCLA 2I1RA 2QA1A 1OWXA 3D6MB 2AJ0A 5A8RB 3DRPA 1S9EA 5AE2A 2FJWA 2L3MA 1NEEA 1DFDA 3BDPA 1RWWB 1MMDA 4YDDB 5D3GA 2ZBQA 2QG9B 5A0YA 5D0GA 1TUWA 5KFAA 4HDHA 1NDPA 3H90A 5KG4A 2EXUA 1N36F 1HWKA 4QIFA 4OI0A 2ZH7A 2ZH5A 1TFYA 1HWLA 2NUUG 1GK8A 2MSSA 2BOAA 4YHHJ 4FS2A 3UW1A 1Q81T 3J81Y 1C1CA 3M8QA 3EPGA 1RBOB 4HEA9 4M8LA 3MEKA 3EZOA 3WBZA 4FVCA 5HI7A 4DPXA 4ELVA 3QT5A 1C0TB 3DOKA 3QFWA 4CO0A 4LF7F 2OKQA 3QRRA 2B56A 2POKA 3DGPA 4EO8A 1MWZA 4LF2A 5B0BA 2UUBF 3DLLQ 1HBOB 1KTVA 1KBRA 2W2MP 2MZ1A 2MZSA 4DSLA 4KGKA 4K0KJ 2RHQB 4H4KA 2CPJA 2KFNA 2Z57B 1WC1A 2FD2A 2DNNA 1FD2A 4J9KA 3H2LA 2ADCA 4WZMA 2OAUA 2IC3A 2Q6BA 3W2VB 5E3AA 2GMJA 3CCVS 2I5JA 3KLEA 3A1YG 2W9BA 2W2NP 2M7SA 3CDAA 4O3RA 1JNZB 1BWVA 3V5RA 2GVZA 1TQLA 5LOQA 4LQ9A 3MM6A 1D8YA 2V2KA 2W7AA 1S6PB 1NPKA 1IJFB 2XO7A 2D1CA 2YNGA 4UY85 1FDBA 2VKRA 1TL3B 2E29A 2AYGA 1HI8A 2R7TA 3CUNA 4RW7A 1RTDB 2ZWPA 3H40A 3U1MA 2VG6A 2ZH4A 1CQMA 2UP1A 1B99A 1OJ4A 2Z8QA 3JB9k 1JMTA 5KFJA 2QA4S 3SV4A 2MJUA 3CWJA 1FKOB 2AIRB 4E0DA 4LSNA 3G82A 1U2CA 4P2SA 2RF2B 2W1BA 3T5JA 2FJVA 5AJ3J 1FEEA 5EX3A 4DN9A 1Y4ZB 5KG0A 4FPIA 3M6WA 4O3QA 3FVYA 2YXLA 3JQMA 4Y34A 4E2FB 3IWLA 4ED8A 4BWMA 4N8NA 4H4OB 4ES1A 1S1TA 3FNNA 5JXSA 1RTIA 2DNRA 4YP3A 1T0TV 3HHLA 1S4FA 5KFVA 3HI9A 3THPA 1LK5A 1YBTA 1UVKA 1DTTA 2KH9A 4JV2A 1RK8A 2Q66A 4IRCA 3P8BB 1YVFA 2CA9A 2WSEC 1N5VA 1VQ9S 4J9PA 1U02A 2OIHA 4QJVA 2UVUA 1FJGF 3V4IA 3DI6B 2YPZA 5DDQC 2OI2A 4DR5J 2HFZA 2WSCC 1SKWA 4IOBA 2CG4A 3KHGA 1NRKA 2CQPA 1KQFB 2VJUA 1RAGB 4YFUA 4NCGB 2HRTA 1MSWD 2J8SA 4F26A 1Z4UA 2ASJA 2RKIA 1F6TA 1U26A 1HHQA 1ZM4A 5F8NA 2HLUA 3PFOA 4OL8A 2XMMA 2RD5C 1ZS6A 2N4CA 2A6MA 4DV1J 5L39A 1BHNA 4C0OC 3UD3P 5GVQA 1J2VA 5J2QA 2JVRA 1HYSB 3T1YF 3EE3A 4K59A 2EW9A 1NCLA 4B9NA 3I5CA 1VK3A 3OJSA 2JZ5A 2OUGA 4NLOA 4G6VB 3U02A 5K14B 3MPVA 1EJ7L 4ZPWR 4J91A 2AYBA 1FNXH 2HHQA 4IG3A 3TP2A 4DQRA 3FQKA 4ZOSA 2A2DA 1JLAB 1O5JA 3I5AA 5C5JA 5D6GA 1ZM2A 1FD8A 5FIIA 4CLLA 3AXKA 3HD1A 1EB0A 2DNOA 1Q4RA 2WHOA 1Q79A 1CJVB 5CYMB 2XMWA 4J9NA 2B51A 5IWAJ 4NXMJ 1RBLA 4M5LA 2KVIA 4GKJF 4IFVA 4DSEA 3WX4A 1DQ8A 3NY0A 4OHZA 1TKXB 1U25A 2MDAA 3HSZA 3RJMB 3MM5B 4QOTA 4UOFA 2GJFA 4DF8A 5K8MA 2VBYA 4DFKA 2UXDF 5I3QA 2QA4G 4ZA1A 1SUQB 3NLCA 2XTJP 4CQ1A 1JXVA 4OYAA 4K4VA 2QMWA 4LBPA 1Y11A 4CYUA 1RGVA 2HRYA 2RIJA 2LA6A 1U1RA 2O1PA 3V6HA 1Q8IA 3M8ZA 4I2QA 5J2PA 1SKUB 2EK1A 2VHGA 4NEZA 1VQMS 2C2RA 1RHRB 2FIUA 1X0PA 3U1LA 4DL7A 2X51A 3SMZA 3UN5A 5KT2A 4B3OB 5KFWA 2W4PA 3V4MA 3AA9A 4ECTA 2WONA 3H5SA 3DYAA 4IG0A 3X3UA 1HMVB 5H9EK 1CJKA 4JYAJ 4RR5A 3ENWA 2HQIA 4F36A 4QIEA 1NDLA 3BB5A 2GQCA 2RQCA 1WG4A 4OX9J 3A4TA 2IRYA 1R6VA 2UV8A 1S1WA 3GWCA 3TNVA 5L38A 3GCWP 4KPYA 3HK2A 4XPEA 3K5OA 3R6LB 1OQ3A 2PMZD 3DFEA 5F0WA 5DDOC 1QTMA 2F1FA 2Z2MA 3ADAC 1JB0C 4A48A 3J80U 1TK0A 4QIVA 5U47A 4C7QA 3PXGa 1VHFA 1E6YB 3P45B 3SYZA 3OW2R 4QWEA 4F4YA 4RUAA 3OL7A 3WIUA 3OT9A 2YKMA 2K2PA 2HFNA 4DLEA 1YI2S 1R3NA 2W9CA 2FVQA 5BR8J 4K4TA 4Q5VA 2PT0A 4PPDA 2UV8G 3DRXA 2AX0A 1VI7A 3CJSA 4B3SF 2AJQA 3M32A 3D6HB 4QU7A 2FJEB 5EN1A 1Z2LA 2FGCA 5A8WA 1VC0A 4GKKJ 1A9NB 1LK7A 3I55S 4ZDNA 3Q8SB 2CXEA 3LPYA 3RG6A 2LU1A 1MROA 4KPCA 4U7UD 4OHVA 2DPJA 3EX7B 3J81j 2UVVA 1B3TA 1HA1A 2LKZA 2R7UA 4B3RJ 2BJ9A 4K4YA 2AGPA 1FO1A 1RCXB 4Y3CA 3QWPA 2DT9A 2WVFA 3ZTQA 5KTQA 1RHQB 4I6AA 3AHPA 2JVOA 1TV6B 1S6UA 3PIPQ 2XMJA 1Z1ZA 4EBCA 1C0UA 3BGRB 1V5VA 4ITSA 5ETKA 1VQLS 4DPYA 3GE9A 2C22A 4HKQA 4Q0BA 3K89A 2QN6B 3W2WA 1GMWD 1AXQA 2VG5B 1YITS 1MW7A 4C8OA 3VQTA 3W8GA 2IIHA 4CH1A 5ETNA 2HZAA 4DV6J 3MR2A 2C28A 1UEKA 1CC7A 2DH8A 1X4FA 2RT3A 3DOMA 4IRDA 1HBUB 4GC7A 1S6QB 3CD7A 1S1UA 2B6AB 1HNZJ 5KT4A 2KZZA 5B0DA 4UOCA 2ZD1B 1HNXJ 4ICLB 4ZN1A 3FEZA 2HBYB 4JI8J 4CO4A 3UNGC 2GVDA 3ZTSA 3UR3C 1HARA 2KXFA 4CM2A 1DLOB 1QAYA 1HHTP 2RDDA 3AY0A 3UCZP 2KYZA 2AT1B 2AD9A 4CLTA 2D9OA 2AJ2A 2IRXA 1SJFA 4H4KC 3HXMA 3W1YC 4YDXA 2CQ4A 4JI3F 2BR0A 2YH0A 5KFFA 5DGBA 3PV8A 3KDNA 4X2BA 2HQFA 1U2FA 2F4VF 2MZQA 2DK2A 4LR9A 4USWA 3W7BA 2D69A 5DQGA 2V67A 2ZHOA 4FN5A 2R2SA 3KHHA 1MU2B 3MMBB 3HVRA 1MWYA 2DGVA 3DLBA 4RNFA 3ENAA 1JX4A 5GAGI 2Z4PA 2K1RB 2Z2ZA 4ECQA 2E5LJ 2VIHA 3DRPB 2DJWA 2AJFE 3EMTA 1QAJA 1C4AA 1S9EB 3PJWA 3BBCA 4HR2A 5D3GB 8RUCA 2BE9B 1RWOB 2ZH2A 3KYLA 4ZPVR 5DLGA 4RNNA 2R3VA 1EKRA 4NX9A 2GA7A 1J5OB 3NG8A 1XMOF 2DD8S 2BM0A 3SCJE 1MN9A 4ERDA 4PQUA 2CQ2A 1VQ7S 1C1CB 1W2BR 1B70B 1U7LA 5CQGA 1T3NA 4ED3A 2RE1A 4RLEA 3CDWA 2DO4A 3HKZD 4FF2A 3LP1B 1N52B 1NK9A 1TTHB 1SQGA 1XJWB 4NMXA 3DGPB 3LH2S 1QJHA 2YBVA 5HMXA 2A6OA 3Q8RB 2AX1A 1LOUA 2FGOA 3VV2B 2NYHA 4RW4B 4IO9Q 2GS8A 3NNCA 2E1PA 4GO7X 2ASDA 5HP1A 3M8YA 3MXHP 2DGSA 5CZVA 5HMZA 3T5KA 3PVXA 1F2GA 4BBYA 1BQXA 3IAS9 4ECXA 9RUBA 1U49A 3TA0A 3OL6A 1LW2A 2GHVC 2JOQA 3NMRA 2DB1A 3M2UA 3IRXB 5CH7B 4ER8A 3V81B 2CZ4A 4X4NA 4ZVSB 2DH9A 5LL6d 2HSEB 1LXJA 4OZJA 3G71S 2I5JB 3JTNA 4DV0F 3UDEA 5IFMA 1N34J 4HVZA 3W9IA 3UCUP 5IM0B 2V9KA 2CNLB 3D1OA 5D0RA 3N9UC 2WVCA 5HROB 4JBCA 3IO1A 1VR6A 3P96A 4TLQA 5KFOA 1FDDA 4JI0F 2HHVA 2YNGB 1Y0HA 4QR1A 4ZVTB 3M9OB 2KHCA 4XK8C 4X4PA 4NLYA 2HHTA 1N48A 2YWWA 1KRPA 4WIQA 2KU7A 3IBCB 2CQDA 4KYZA 1TAQA 2NLWA 2VG6B 3PR4A 4MH8A 1K0VA 3SI8A 3HVAA 1QSSA 3QNWB 2RAQA 7FD1A 4P7TA 3B6BA 2LYVA 4DQPA 3HSDA 3CB4A 4DX7A 1L3SA 3ULHA 2COLA 1HBMA 2V2QA 2X1BA 1JKHB 2BBEA 5DJBA 3PYEA 4LF5J 4WXOA 3GJRB 3BYRA 3T1HJ 1RJJA 2YQ1A 1Q8KA 2MLYA 2FHJA 3Q83A 1RTIB 3AD8C 3HHLB 4IOCQ 2CWXA 1S79A 3TAQA 3BV8A 3D1QA 2YWGA 2NS1B 1DTTB 1S0MA 2F63A 4EI2A 2HFVA 1ZPWX 1IKVA 3NGTA 2UXCF 4OYIA 1VRTB 5LSOA 2E7VA 3NGDA 3VAGA 2HQDA 4PWDB 1JNRB 4EFAC 4J9MA 2Y1JA 2AKWB 2APOA 3PRBA 1S12A 3V4IB 3MUVP 3MEEB 5GMKa 5KFBA 4LF4F 5L46A 4NCAA 1X4AA 3OUYB 3EPIA 1UW4A 2PMHA 1S57A 3JYTA 2QL9B 4J9OA 5ETQA 3OR2B 2H5IB 3I0RB 2BANB 3H25A 2CG8A 4RZRA 4CDIA 4X4QA 1Q86T 2VA2A 3OFGA 3FZBA 3W5YA 1XK8A 1HNVA 4V19X 2V63A 3JQJA 2LQ8A 4P2MA 2YNHA 2K3KA 4JI7F 1SL2A 2DO0A 3IMQJ 4WWSA 3RR7A 1FX2A 2MKJA 4KB7A 1F2HA 2GX8A 3DLHA 1HQUA 2YKPA 4OZ3A 4LFAJ 3R97A 1NDKA 2Z56B 1L3TA 3WIVA 4K4UA 2LXUA 1L3UA 1IN0A 1N0VC 1FJ7A 4IG3B 1RU1A 4DLGA 4NMLA 2FLPA 4ECZA 1HFEL 4PAAA 4FF3A 4FXWA 4CO3A 2C2EA 1RQ0A 5IXUA 3N0VA 2E66A 2P9CA 4X4SA 4TU9A 1ZETA 3AXMA 4DR4F 1YWXA 3UI3A 3CJ0A 4M1KA 4IFVB 2J6SA 4NLXA 3R2CJ 3FSYA 3M2VA 2XY7A 1QD1A 1JJ4A 1H2VZ 4NRTA 1M1HA 1P1LA 3ZNUA 5KFDA 2F5GA 4M5IA 2PI4A 2HBQB 3QAEA 2OSQA 5I4MA 4W90B 3EGVA 2HWHA 4URQU 3OXLA 5GAGU 1AFIA 4X4TA 3FCHA 4LVOP 1LXNA 5BJRA 2MZRA 4CYUB 3HF5A 4O3SA 2O66A 2YNIB 1GMUA 4DSIA 1C4CA 3TAPA 4I2QB 3TX0A 5J2PB 4TQRA 2MHNA 4KBIA 4PR6A 3VGTA 3H20A 3SQOP 1UFKA 2YTCA 2CYYA 1JLFA 4QU6A 1FF2A 4FVMA 2XYHB 2FHJD 4QW9A 3D0GE 4DS4A 1J27A 2JEJA 1KD1T 4OX9F 1T02A 2WONB 1SI9A 3T6BA 1WTFA 4FKYA 1FE4A 3TUPA 5HMWA 2PEHA 3TAMB 3G6VA 3GR0A 3DOLB 3A8EA 2R7XA 4LVNP 9ATCB 2ROGA 4OJ1A 2U2FA 2GQ2A 3MUMP 3AOCA 2HLTA 3KDOA 1Q5YA 3PYGA 1RLCL 3V2UC 2KZMA 1X4HA 4WK3A 1S1WB 3W5XA 3I5BA 2KRRA 2CDQA 3D54A 3BGOP 4BCAA 3A3OB 2J9DA 3PEHA 4MKVA 3W66A 4HI2A 1RDRA 3MMJA 4L73A 1ZH5A 2BJDA 2R4FA 1D9DA 3KJVB 2VQEJ 1G6BA 4B3TF 1FWLA 3CCLS 3DU6A 1S1XB 3DDIA 2ZHBA 3K59A 1H2TZ 4QWCA 4DHVA 1RT5A 3W9JA 2XSJA 2IM0A 2DRDA 5J2NB 3CIZA 4ZVPB 2IYGA 2Y8WA 2FYXA 2F9JA 2W25A 2HWTA 1KQKA 2OPRA 3E2EA 1TK5A 1MMLA 1SB6A 1OPZA 4J5OA 1D9AA 2Y1LB 1WI6A 5F8MA 1NSPA 4CLKA 1T94A 2GMHA 3C15A 4B9VA 4FYVB 3PTWA 1FA0A 2QA2A 2R7QA 4LRAA 2XS2A 2VH7A 2ZH6A 1TVRB 4O44A 2JLFA 4LF6F 4OYBA 5H9FJ 4Q44A 3CJ2A 4W92B 3H2VE 4MK7A 3VALA 1LV5A 2XBPA 4NLSA 2WTFA 2RS8A 1RWUA 4F04B 2J0SD 3TR5A 3RBDA 2RRNA 3LOUA 2CPDA 1RXOB 4ZVUB 3LAKA 1T9UA 2HAIA 2NQPA 3ET6B 4OX6A 1B0PA 1O51A 4OYZA 3SCLE 4HH1A 3OFEA 2V8HA 1NM2A 4P74A 2WOMB 2ASLA 2M8DB 3C6TA 1YJNS 1VQ5S 1K8AT 3TVYA 2M2BA 2WZ1A 1WHWA 4KO0B 3Q8QB 2NREA 4QR2A 2BOPA 3W2WB 4KC5A 5RUBA 1OIAA 1RWPB 3EDQB 4OHXA 1M5HA 2XYPB 2XZTB 3RAMA 4DU7A 2QLWA 4OHWA 2CUYA 3DOMB 5F3TA 5ETPA 3VF0B 5KFIA 1UFLA 5EWFA 4Y00A 2I38A 1IQTA 2B4UA 3AJDA 2J6UA 2VG7A 4I7FA 4Y28C 2QIFA 1HWUA 3W5ZA 3QGIA 5KFMA 3CDBA 2GVDB 2H51B 3RBEA 1NUEA 3SDEA 1HW9A 2L08A 1B0VA 2X1FA 2U1AA 5KFLA 4Q43A 2LQJA 4EBEA 5C7PA 3SIPB 5KFGA 2DHGA 1RACB 3GV5B 3SV3A 3MR6A 1NH8A 4Q2MA 2N7YA 3IS9A 1RU2A 3C46A 3VTIA 1XIQA 2VODA 2BEFA 3BR9A 1TKTA 2IM3A 2ERRA 2F65A 2HPUA 1XERA 3C6UB 3H7HB 4S0MA 3IR5B 1MNEA 4EUVA 4NPOA 1RA6A 5KFPA 4JI4F 1S7HA 3CULA 2DHAA 3UO0A 3OTCA 1TUGB 1RI7A 5KFXA 4J9LA 3LWMA 4OZ2A 1AB8A 1RT7B 1Y5IB 4NYPA 4WFZA 2MSTA 4HL9A 3GPAA 3ZXWA 2A18A 3GV8B 3QO9A 4PWWA 3TQEA 5B09A 4YR2A 3BSAA 4M5MA 1CQNA 3ZZPA 4OZ5A 5L1IA 2MQ8A 4ZPDA 1CSJA 4A8YA 3PRVA 4USUA 4KIAA 2EKNA 4PQUB 4A46A 2K8GA 2ZM6J 3PHTA 2Z0GA 4C8NA 2ZFHA 1PKUA 3DN9A 4X65F 3B8HA 4PXBA 4I2PA 2NR0A 2FJDB 4HLBA 1VIXA 2RB7A 4KH1B 1IBMF 3PRDA 5GMDA 3MAQA 4DZ6A 1YKWA 1R0AA 4MK9A 2CJQA 3K58A 1UEVA 1SKRA 3DRSA 2UXBF 1VLOA 3UFCX 4NXNF 1U1NA 1MWQA 4C6AA 5HQMA 2RDJA 4ENOA 4W98A 1T11A 4IQMA 2V6AA 1FDAA 3L95X 3IA0A 1N34F 4KHPJ 4E8UA 4MKAA 4DF4A 3CGIA 1RT6A 1AYEA 3SEOA 2KI2A 2MZJA 2GV1A 2BQRA 5F9LA 5HMYA 1LW2B 1RP5A 1K73T 3M2UB 1EX8A 4USIA 3TUJC 3ISND 4ECVA 3MGJA 4AYBD 2ZUAA 3GYNA 4DJBA 2HHHJ 1UP1A 1HR0J 2OPSA 2R7RA 2BJ8A 3IWNC 2ACMA 1OYEA 2ZJPQ 1HI0P 1XNQF 3OTEA 2MKSA 4ZCKA 4NA3A 3JAMY 4A8MP 4OYMA 1DTQB 1TU0B 5LM7E 1U0HB 1N5YB 1YDLA 3OXGA 1CPZA 1YBUA 3UDCA 3I82A 4CWBA 4R0EA 2CPIA 2AP6A 4XDCA 3OXFA 5DM6Q 3K7RA 2KDOA 1RHJB 1WJ9A 5EHHA 1LWXA 2BJ1A 5KFUA 1JLQB 3M8PA 3DLJA 3I87A 1DY3A 4TY8B 1PAEX 1X31C 4FP9A 1UVJA 3K5PA 4DUYF 3GJTB 3ONQA 4NCBA 3T1HF 1IKXB 3QIPA 5D8HB 1SV5A 1N4LA 3DLEB 1S1VA 3T5LA 1U24A 4Y2AA 2OEMA 4CP5A 4R8UB 4MTPA 1REVA 1HBMB 2UUCF 2DR7A 3MECA 1U8SA 3H2UB 1UTAA 3U1NA 1N36J 4RW6A 1EETA 2F40A 5KAKA 5EX0A 2GO9A 4DV2F 5B08A 4G1QA 2XSFA 1S48A 2OH2A 3CCSS 2VPYB 4CH7A 1SH2A 3HHNB 2HS4A 1JLEA 4PCQA 1Y5LB 2R7SA 3C2PA 4K5SA 1NAQA 3MDFA 2R8JA 4FPRA 5DQIA 2IBKA 1WG1A 4U8VA 2QMUB 4CTAA 3K8WA 4F50A 2UUTA 4LF7J 2H5JB 3LP2A 3AA8A 4LSLA 3PW0A 1N32F 2JEFA 2CRLA 2QX0A 3VWSA 5B0EA 3VCDA 2V4RA 3QFHA 2UUBJ 1UKUA 1SC6A 4WBFA 3QJJA 2M8HA 4L3NA 2H9ZA 1TL4A 4ZLJA 1ZAVA 3CNQP 1OQ6A 3Q86A 4GMKA 2I6WA 4ZVEA 1FKPA 1T8EA 5B0AA 2AYMA 3GFZA 1UVMA 5D78A 1HNVB 4YR0A 3SCKE 4USKA 2YNHB 1WKKA 3FGVA 2PGCA 2KVQE 1CVJA 5KFSA 3MR5A 4DFPA 1I1GA 2DCLA 2ZH8A 3C14A 1ROFA 5GADI 1WEYA 3D0IE 4WE1B 3F41A 3SBMA 3OVBA 1YLXA 1R8AA 3HJVA 2ZC4A 4G3IA 4I64A 2HS0A 1U0SA 1CJUB 2XWXA 3E51A 3A3PB 1BQNA 4ZVHA 5HVGA 3T19A 4WFAQ 1RTZA 3ILIA 3KJFB 2B5JA 4RNHA 2PC6A 5EWGA 1FNOA 3MM8B 1U45A 3TEGA 2XCPA 1BMQB 3ZNJ1 5K8NA 5KG1A 5ETLA 3GSIA 1BC6A 5KFRA 2VJVA 1KONA 1R8HA 3M2VB 3OTBA 3C3LA 2LDYA 2Z2YB 1P8GA 2HGLA 4DR2F 5LT5A 4X66F 3EUNA 1U1OA 3E01B 2GAHC 2F7VA 4EGLA 2GFFA 2ALYB 5CCMA 5FDLB 1WEXA 2MMYA 4K4ZA 1IBKJ 2LP4A 3DLGA 2ATCB 3VZIA 1KN6A 1XR6A 4LIWA 3AT1B 5IQQA 4TYBA 1K0TA 3MM7A 2BQUA 2IVYA 4MIWA 1QDUB 4M5GA 2DGTA 1UJ5A 5H1SV 3DKDA 2W01A 1FJGJ 4DFJA 3K57A 1W25A 5CABA 4NEYA 1HIYA 2LA4A 4PUOA 1ACMB 2OP5A 4PXEA 4MK8A 2KT5A 2NXEA 1JLFB 3ZO7A 4NI2B 3QAUA 3DU5A 1D3WA 4QCLA 2CNKB 3GZ7A 3QWUA 4K4SA 5IT0A 4YB7A 2YQ3A 5HQ8A 3CDEA 2WW4A 3O1LA 2M88A 4X64F 1GFWB 4NZ0A 4RL1A 1P9QC 2L41A 3N5FA 4OMFG 4ILMA 4TQSA 1T9TA 4DL3A 3G2XA 4IYQA 1A0OB 2AW0A 4MIAA 4DV3J 5EGYA 5B7WA 3T1YJ 4YB6A 2QO3A 1VQYA 2BACA 3DRYA 3ENQA 5C25A 2WVEA 4DV7F 3MAAA 3G86A 5LMNF 3TJ8A 4DX6A 1ICEB 1KTQA 3CTRA 4ZP7A 4F3QA 2IFXA 1WF2A 4ETXA 2FJXA 1CLFA 4AUKA 5DG9A 4DUZF 2BE2B 5DG7A 3IBWA 3TRGA 3PYDA 3EWGA 1OY6A 4F3MA 3E8OA 1RYRA 4CLUA 5MAOA 2Z30B 3KMQA 3FMWA 2XSJB 5HSPA 1RT1B 2KM8C 4DR1F 2FJBB 2B9YA 4IRKA 1TAUA 3UVJB 2OPRB 4GKJJ 2DHHA 1T3OA 3EVMA 2DNZA 5G0RB 3ZTRA 3C15B 2CQGA 3MUTP 4WXWA 2AU0A 3FSXA 2KJWA 1IVZA 4O23A 2G0CA 4ED5A 1TL7B 2UXDJ 3BKFA 3JSMA 2Q6CA 3AOAA 4DSFA 3M30A 2DY1A 1OS5A 3F73A 4USTA 5AXKA 4Q8EA 2HK2A 1G7CB 3JTPA 4RNMA 4K2JA 1RT3A 4P72A 3HFVA 3GIJA 2FVPA 4ZVOB 2HNYB 1MN7A 3KG4A 2NXNA 2PMWA 4ATNA 3C6TB 3DHWC 4OJGA 3EGNA 3B4DA 5IV3A 2XLIA 2RHSB 4F0KA 2KYXA 1FJCA 2LXIA 2VBZA 2FHMA 4ZP6A 4G1IA 5FLXY 4ECUA 4PG8A 2ABYA 2VQFF 4M5JA 1IKWA 4DX8H 1YJWS 4ECWA 5DRKA 2LFVA 5KFYA 2B7CB 4FBUA 2VG7B 1EP4A 3RRGA 2XLJA 4CLWA 4EWTA 5HN0A 1LNQA 2EFVA 2WBMA 2HNDB 4GVLA 1E6VA 3QBCA 4Z7YA 3CVKA 3MTJA 4C0HA 2XNQA 3VZHA 4CT9A 1I5OB 2HVEA 3H4BA 2H65B 1RTJB 2XY5A 2E5GA 2HIQA 2OEJA 2XO6A 4CCHA 2DR9A 3CJKB 2V69A 2HZVA 2DGUA 4ANDA 3IS9B 5B0GA 4DS5A 1NNDA 3DRRB 3KLIB 1X9SA 1FTRA 1UW9A 2WCXA 2RVJA 4IOAQ 1TKTB 1JXLA 4DR6F 1B64A 3DMJB 3TW0A 2PD1A 1ZTTA 4OIXA 4TNOA 2VFTA 2GGPA 2GQQA 1FRMA 2IAJA 4R0JA 5D77A 2VBWA 2VD3A 4DZDA 1Y3JA 3A8IA 3JSYA 3DDKA 4B3SJ 2VASA 5GADU 2JX2A 2CPYA 1WF1A 2IRUA 3U7JA 3WX8A 4CLYA 4WFYA 2Y1RI 4AL6A 1FWPA 5A8KA 1VS3A 2R8IA 2KL8A 1W26A 3QPIA 2XM3A 3W3SA 3QZ8A 1IWAA 1PG5B 3MFIA 1B7YB 2RUSA 2XULA 4LSZB 4FYYB 2UUWA 4O4GA 1KC8T 2GJIA 1F5BA 4G1PA 4ZVQB 1Q53A 3O5TB 3R5DA 3AQPA 5DO2A 3LALA 2BRLA 4TYAA 3LP0B 3DXSX 4AXJA 1D8ZA 4DBQA 3I31A 1PGZA 1BD6A 1RYSA 2HNZA 1NJZA 3OPKA 1SCJB 1WNEA 3JSRA 3BPDA 1JLCB 4KHRA 4Y2CA 5I42B 4I2PB 4EK2A 2DNKA 5CYJA 3FCWA 4YR3A 1VJWA 1GXTA 2V0NA 2J8AA 4B9MA 1RAOA 3KLGA 1PSDA 1VBYA 1HLWA 1O6XA 5J1EA 1V3ZA 2NXUA 5ETVA 2QL5B 4LJMA 3BN7A 3FEYB 4LRDA 2RRAA 4DG1A 3BH6B 4CT8A 2KFZA 2AJ1A 1U6FA 1R6YA 1XNRF 1RT2A 5KOXA 1FKAF 2DNYA 3JXOA 5E7OB 2BM1A 3ENVA 3NCQA 3ILJA 4HT5A 3OHAA 1HNIA 2GMLA 5SUHA 2DXEA 2X7IA 2WSFC 2FZGB 4DL2A 1U2RA 3F44A 4RKUC 3P5BP 1CC8A 2F9DA 3OL8A 3D0HE 4CNYA 2F3JA 4JI3J 3R27A 1ZBTA 1VBXA 1LW0B 2KJVA 3VGVA 1F60B 3FFIA 3M2RA 1KQSR 4X4VA 2F4VJ 2D3ZA 4LRFA 3WQPA 1RWXB 4OZ1A 1HBNA 3KUGA 1KEKA 2DISA 5K9FA 4RPFA 2FC8A 3O44A 5LJ5Y 3M8PB 1NBEB 3JQKA 1S77D 5C42A 1NH7A 4DMZA 1XBWA 3G8TA 3L7UA 4U95A 2XMTA 1JLGA 3QIPB 3TI0A 3QSYB 1K1SA 4OX8A 4U96A 5A2QU 1M1GA 4YB1P 4WYWA 1AZSA 2R2TA 5T7LA 2MY8A 2Y3YA 4ID5B 4MFBB 1L5UA 3NEKA 5I3UA 5H9EJ 2HMIB 1REVB 2BKPA 3MMAB 4N8OA 1B4SA 4NE9C 2RSQA 3TUIC 3KK2A 2OD4A 2PEBA 4QPXA 3MEDB 4LFCF 1BLUA 2EBEA 4I0WA 3C19A 1XMOJ 4QWAA 1UJ4A 4G1QB 1PO6A 4Y2KA 1C1BB 2VPXB 2ZZTA 4TU8A 3NS7B 1LKZA 1U1PA 3FSIA 1IWGA 1QE1A 3BSNA 5J2MA 1NK4A 4B02A 1DURA 2C3PA 4C98A 2OEKA 4JP8A 4MAKA 4J9UE 3QSIA 4YEAA 2HG4A 3LP2B 3EZ5A 1HQ2A 1DAXA 3BPSP 1SJ4P 3MWBA 1QUPA 4KE5A 1RWVB 2MQNA 4OLPA 3O8WA 2DR8A 5THWA 3G8SA 4NASA 1T9WA 2ZDOA 1XC9A 3UCGA 2B9XA 4Y65A 5GAEI 2M9KA 3LTOA 3R6GB 4XO0A 4C3LA 5AXLA 4N41A 4UF4A 4EZ9A 5DZ7A 1VFJA 4Q2LA 2D7SA 4WYLA 4ZP8A 4HHUA 1NHUA 1I51B 4I68A 4DV0J 4WFXA 4PEOA 2R7WA 1IKYB 2I9SA 3KMSA 2NZ4A 2CJ9A 2FQQB 5JVGQ 4JI0J 3C14B 4DQQA 2DVIA 2G0IA 1EQ0A 1H74A 2QYCA 2W2PP 4NYZA 5A8RA 3L3CA 1WI8A 3OJUA 3H8YA 3U27A 2HHXA 3TJ9A 5F8JA 2F4FA 1TL5A 2AZ1A 4HHHA 3D28A 4ELUA 2QSFA 3MPDA 3GG1A 2AGQA 1D0EA 4F2RA 2BW7A 1PYOB 2B5JB 4HT7A 4FDFA 4IR1A 2YPYA 3N01A 3NMAA 3CCWA 4O0IA 2ZBPA 4M5DA 4EMDA 1HPZA 3FRYA 3HMJG 4ZIVA 1IBKF 4WKRA 3B54A 2QLJB 2CQBA 3BKUA 4EYIB 2W24A 4XAKA 3GJQB 4UW2A 2ZHAA 3CCJS 1R0BG 3MFHA 4KGVB 1NU4A 3FJ2A 2VFVA 1WD6A 3HHDA 3KHLA 2ZH1A 1HWJA 3TVKA 4U8YA 1URNA 1KVJA 2J7WA 4CRJA 4JI2F 2KB2A 3D4JA 2UXCJ 3TANA 3DLGB 1XR7A 4Q45A 4KV8B 2QE5A 3RB3A 2R8HA 2C2ZB 2QJ3A 2QRRA 3I9V9 3RB0A 2KHDA 1YGYA 1MLAA 3CCZA 4PG4A 3MCSA 2CDRB 4LF4J 5G4DA 3J7Z5 1SH0A 4Q8FA 1SQEA 4DV5F 3DXBA 4IDKB 4LBIA 4DV3F 2NPFA 5D4NA 4F0HA 5IC6B 1UVLA 1AUDA 1VC5A 1BQMB 2NZCA 2P6TA 3HT3A 2RUGA 1WC4A 2YWKA 3G4SS 4ZN3A 4JV5F 1TL3A 4D3HA 2LECA 4JI7J 1M5SA 2FB0A 1FI4A 4L3KA 2YWFA 1PIEA 1JJHA 3PG9A 3M6XA 3QMQA 3P6YC 2LEAA 5J1NA 3FRZA 4TXSA 1V5IB 3C16A 1FKOA 2AWZA 3UNYA 4A8QA 1WC3A 2EFOA 2RF2A 2R8GA 2FLLA 4J9QA 2QLBB 4JOUA 3PW7A 4CLFA 1S9FA 1HWIA 2I8EA 4KGMA 1Y5NB 3RAQA 2D3UA 2HVDA 3DM2B 2HEKA 4F67A 3R1HA 2B4VA 2ZC3A 2KN4A 2DIUA 3BQ1A 4V1Ak 4C11B 1Q82T 4H4OA 4F8RA 3HZGA 3AB4B 5HVFA 1GMWA 1JXEA 1KP6A 2BE7D 4C2MA 1YHQS 1RWMB 3OSNA 4DR4J 4EO6A 3ZZOA 1YX2A 5FD1A 2O5DA 2V94A 2KXHA 4B9TA 2Y0SD 4ILRA 2XHCA 5ETOA 3CJ5A 3OHBA 1HHSA 2IJNA 3PEJA 2DNGA 2JFKA 1G2EA 2XEXA 4L76A 5KFTA 3QRQA 2JJ4D 3TZZA 1QVGR 1V9OA 2QTWA 3TVZA 3IBFB 4X62F 1FWKA 2VDHA 2ZOMA 2P9GA 3NBPB 3Q2SC 5KT6A 5CD4A 2RH3A 3KK3B 3D9BA 4NCGA 2X3DA 4X84A 1KQGB 1UA1A 4NLVA 3H5UA 1VQ8S 3DLKB 2D74B
chains in the Genus database with same CATH topology
2A10A 4Q43A 4LFBF 4DR5F 2LQJA 5A0YA 4EBEA 3NRBA 4OZNA 3VR1A 1P1TA 5KFAA 5KFGA 4HDHA 1NB7A 2DHGA 3MR3A 2HHPA 4KFBA 3OL9A 2RILA 3I56S 3GV5B 2E5JA 3SV3A 3MR6A 1NH8A 5KG4A 1N36F 1HWKA 3IRWP 4QIFA 4CZCA 2HQ3A 4OI0A 2CQHA 4Q2MA 1Y3KA 2YKNA 2ZH7A 2N7YA 2BA9A 3GFYA 3HFKA 2ZH5A 2EI5A 3IS9A 5IZHA 1TFYA 1HWLA 2NUUG 3C46A 3VTIA 3T3FA 1HYSA 1A6LA 2MSSA 4F25A 2VODA 2VFUA 5HLFB 3BR9A 4HI1A 2DGOA 4FS2A 1TKTA 3UW1A 1ZPVA 1Q81T 2NYIA 3J81Y 2IHR1 2IM3A 4CO5A 1C1CA 3M8QA 4Z2XA 3EPGA 3G9CA 2ERRA 2OPPA 3B4MA 3HO1A 2HPUA 1XERA 4PXCA 3C6UB 3RW6A 1H2UX 4HEA9 4M8LA 4WF9Q 1NO8A 3MEKA 3IR5B 3RBDA 3M1VB 2HS3A 2JDJA 3S01A 4DV1F 4U7UK 3KTQA 5FJ4A 1MNEA 2XG8A 3WBZA 3H5YA 4FVCA 5HI7A 4EUVA 4NPOA 5K14A 2O3DA 1YRXA 1RA6A 5KFPA 4ELVA 4JI4F 1C0TB 3DOKA 4Y2MA 1S7HA 3R5CA 4IH7A 4ZPAA 1FESA 2DHAA 4MKBA 3OTCA 4CO0A 1U1MA 2IBOA 4LF7F 1RI7A 5KFXA 2AV5A 2OKQA 4J9LA 3LWMA 1LWFB 2B56A 2POKA 3DGPA 4EO8A 3EYZA 1RT7B 2XI3A 1Y5IB 2WK4A 4I69A 4NYPA 2OPQA 4WFZA 1MWZA 2MSTA 4HL9A 2E5HA 4EBDA 3RB4A 2A18A 4WIIA 3LO3A 1T03B 2I2YA 3GV8B 3QO9A 4C8ZA 5B0BA 2UUBF 3UQSA 3GFHA 4OV1A 3ISNC 5B09A 4YR2A 3DLLQ 1HBOB 2V4JB 1KTVA 1UFWA 5GAEU 2EFPA 3NS6A 3BSAA 2MZ1A 2MZSA 3N5BA 2PA8D 3I0SB 1CQNA 5C24B 4DSLA 4B08A 1LWCA 2DNQA 1WHYA 4MYUA 4KGKA 5CYMA 3PO4A 1VMBA 4KQZA 2A3JA 1S10A 3PO5A 3ZZPA 4OZ5A 5L1IA 4H4KA 2CPJA 5KT7A 4ZPDA 1CSJA 4A8YA 4IUFA 1X0FA 2KFNA 1VC6A 1VRUA 4KIAA 2V8VA 2FD2A 4PQUB 2DNNA 5E3CA 1FD2A 4A46A 4J9KA 1Q8LA 3H2LA 6FD1A 1TKXA 2K8GA 4OLOA 1U09A 2ADCA 3MMCA 3SFUA 4WZMA 2OAUA 1WWHA 1ZOTA 2Z0GA 3ZZRA 2EFGA 4C8NA 1Q8BA 4CO2A 1FNMA 2ZNZA 3QLHA 2IC3A 2EFQA 5IT4A 4HH0A 2EKYA 2ZFHA 3DN9A 1SBRA 3MM5A 2MKHA 3B8HA 4WE1A 4WJBA 2Q6BA 1UJ6A 3W2VB 5E3AA 4X65F 2XI2A 2GMJA 3CCVS 2AYEA 3F56A 2I5JA 4PXBA 4R5PB 5IWAF 3KLEA 1AFJA 1FE0A 4I2PA 3A1YG 2FJDB 2W9BA 2NR0A 2M7SA 4NXMF 3CDAA 4HLBA 2Q1LA 2DBBA 3US5A 4O3RA 1JNZB 4BC7A 1VIXA 2RB7A 3V5RA 1IBMF 1UL3A 4ZVFA 4AE5A 1TQLA 1SUQA 1B7FA 2AJ4A 3PRDA 4CH0S 4LQ9A 3BQ2A 3IG1A 3MM6A 2QV6A 3MAQA 5BYSA 3MAHA 1D8YA 1JLBA 2BV3A 2V2KA 4B17A 1RT5B 1S6PB 2W7AA 4DEZA 1IJFB 1R0AA 2XO7A 2D1CA 2YNGA 2BZ2A 3RB6A 4MK9A 2CJQA 4UY85 4WFNQ 3K58A 1JJ2R 1UEVA 1K1QA 3DRSA 1FDBA 2MGZA 3TARA 1SKRA 2VKRA 3UFCX 2UXBF 4NXNF 2C3YA 1TL3B 4ZCMA 3P49B 3H98A 5F8HA 1U1NA 3VAMA 2E29A 2RRBA 3MM8A 5M2RA 2RDJA 2AYGA 1HI8A 2R7TA 3CUNA 5E33A 2XGPA 4IQMA 4RW7A 1FDAA 1N5TA 3L95X 3IA0A 1N34F 2CZVC 1U6ZA 1Q16B 1RTDB 2EG2A 4LT6A 4O4GB 4E8UA 3H40A 3BF4A 4B3OA 4OI4A 3M6VA 2X1AA 3U1MA 2VG6A 2UU9F 4MKAA 2ZH4A 1CQMA 4KKOA 5IQ6A 2UP1A 4DF4A 3CGIA 2ROPA 3HX9A 1RT6A 2HZCA 2Z8QA 3JB9k 1JMTA 3HLUA 3Q8PB 5KFJA 3OLBA 3FEXB 3SEOA 2QA4S 2IYIA 4IH6A 3SV4A 2MJUA 2KI2A 3HVTB 2MZJA 2XY6A 3CWJA 2GV1A 1FKOB 2BQRA 1NJIT 5F9LA 4E0DA 4LSNA 5HMYA 1LW2B 1NKBA 2XNRA 1N5SA 4OI2A 1RP5A 1K73T 3M2UB 4P2SA 2PN6A 2RF2B 2HHSA 3T5JA 3CO9A 4O44B 4USIA 4RW8B 1N5QA 1RT4A 3ISND 3TUJC 2FJVA 4ECVA 3MGJA 5KT3A 3N6NA 4AYBD 3GYNA 4DJBA 3KLHB 3GIKA 3E01A 4OHYA 5E3RA 3V6DA 3UDLA 4KT0C 1UP1A 1FEEA 1KS2A 1ZM9A 2JHEA 2OPSA 3Q2TC 5EX3A 4I67A 4DN9A 2RNEA 1Y4ZB 5KG0A 2R7RA 1YTYA 2J6TA 3IWNC 2DRAA 4K4XA 1HQEA 2ZJPQ 3PJXA 3M6WA 1XWLA 1O0PA 4O3QA 1HI0P 5FDLA 3FVYA 4DL6A 1XNQF 4Y34A 1UMJA 2D41A 3OTEA 2MKSA 4O3NA 3JTOA 3LUYA 4ZCKA 4NA3A 3JAMY 4A8MP 2DNLA 5F3ZA 2VOOA 3PM9A 3KLGB 1DTQB 3IWLA 4RNOA 4ED8A 4BWMA 5CHCB 1VQOS 2CJKA 4ZCIA 3KNAA 5L9NA 1N5YB 4N8NA 3OXGA 4H4OB 1CPZA 4ES1A 5IT9Y 3CCES 1S1TA 2VPZB 3UDCA 4BC9A 3I82A 3FNNA 5JXSA 1RTIA 3N28A 4R0EA 2DNRA 2CPIA 2AP6A 4YP3A 4XDCA 3OXFA 3HHLA 3HHEA 5DM6Q 3K7RA 2UVWA 2KDOA 3ITHA 4JYAF 4DL5A 1KSPA 5EHHA 1S4FA 3BZQA 5KFVA 1JLQB 3DHXA 3HI9A 1O8BA 1LK5A 3M8PA 5KFUA 3THPA 1VQPS 3DLJA 2KO1A 3I87A 4EU0A 5IS2A 1RT2B 4TY8B 1UVKA 1DTTA 2KH9A 1S97A 4JV2A 1RK8A 1S99A 2Q66A 1FXRA 4IRCA 4FZVA 4FP9A 3HPOA 1UVJA 3K5PA 4DUYF 4KSEB 1YVFA 3ONQA 4NCBA 2WSEC 2PFFB 4XIUA 1UA0A 1SKSA 2L9NA 1N5VA 3GB0A 5D4PA 4DFMA 3T1HF 1IKXB 4ECRA 3QIPA 1VQ9S 5D8HB 1SV5A 1WEZA 2ZE2A 2GNKA 4J9PA 3ZZ0A 1G1XA 4C3KA 1HNIB 1N4LA 2HW3A 5K8OA 4OI1A 3DLEB 2I0XA 1S1VA 2OIHA 4QJVA 3T5LA 3BGLA 2KXNB 1U6BA 1U24A 2UVUA 1FJGF 4Y2AA 2JEIA 2LDIA 3MPWA 4PG7A 3V4IA 4OI6A 1XR5A 3DI6B 2E7XA 3OTOF 5DDQC 2OFHX 4R8UB 4MTPA 1REVA 3BSCA 1HBMB 2UUCF 2DR7A 3MECA 1DRZA 1X5PA 2HVIA 1U8SA 2HFZA 2WSCC 3H2UB 1SKWA 2X3GA 1S6OA 3PDNA 1VQSA 4IOBA 2CG4A 4I7FB 3KHGA 1U1KA 1NRKA 2CQPA 1KQFB 3U1NA 3P3DA 4ETZA 4RW6A 3IN5A 1EETA 2GO8A 2XC9A 3PW4A 2F40A 4YFUA 3V6JA 1V3SA 4NCGB 2HGNA 5KAKA 2YKOA 3AAWB 3BO3A 1DARA 3J80Y 5EX0A 1ZM3A 2GO9A 4DV2F 5B08A 4G1QA 2XSFA 4PG6A 3KOAA 1S48A 1MSWD 2R9LA 3SDEB 2OH2A 4F26A 1Z4UA 2ASJA 3M8SA 2RKIA 3CCSS 2VPYB 4CH7A 1SH2A 3HHNB 2QMXA 1KFSA 2HS4A 1U26A 4FXDA 5L9XA 1JLEA 1ZM4A 3PW5A 5F8NA 4PCQA 2HLUA 2P9EA 1Y5LB 2R7SA 5F8GA 2KM8B 5A0YB 2A2CA 3PFOA 3C2PA 4K5SA 1NAQA 2E9ZA 4OL8A 1DQ9A 3MDFA 2CQ3A 2EVZA 2XMMA 2RD5C 2JWNA 2N4CA 4FPRA 2R8JA 5DQIA 4K5RA 5L39A 2IBKA 4C0OC 5BR8F 1IJEB 3RYLA 1WG1A 3UD3P 2BUNA 5GVQA 1S0OA 1J2VA 4F50A 4CTAA 3K8WA 4C8LA 3OVAA 4Z37A 4A8OA 5J2QA 1TL1A 2ILYA 2VC1A 2UUTA 2YKAA 3FQLA 4DSJA 3SCIE 5GAHU 3QGHA 1QSLA 3LP2A 1X5SA 1YRTA 2JVRA 1HYSB 3T1YF 2BE2A 2J5AA 4K59A 4RW9B 2RQMA 2EW9A 2JL9A 4QBUA 4I6YA 3AA8A 4LSLA 1GXLA 3PW0A 4YOEA 1N32F 4B9NA 3M8QB 4DV4F 3I5CA 2JEFA 2CRLA 3VWSA 1VK3A 5B0EA 3VCDA 2V4RA 4WK1A 3OJSA 4DR3F 2JZ5A 4USJC 4DN0A 2CQCA 3R5BA 1UKUA 1SC6A 2VC0A 1HD0A 4FNIA 4NLOA 3QJJA 4GKKF 2M8HA 1FJEB 3BR8A 1CEZA 4G6VB 2J0WA 3U02A 4L3NA 4F02A 4KRWA 5K14B 2H9ZA 1TL4A 1RT1A 3MPVA 3HM9A 5HBMB 4ZPWR 4NLPA 3DOKB 1ZAVA 2AYBA 1OQ6A 2FLOA 1R43A 1FNXH 2WB1D 1TV6A 1R8BA 3BJYA 2HHQA 4IG3A 3TP2A 4DQRA 2KKHA 1P6TA 3FQKA 2A2DA 4ZOSA 4ZHRB 4GMKA 3ZC4A 1JLAB 2NSBA 1O5JA 3BGRA 1XN9A 1FKPA 4ZVEA 3I5AA 2MJNA 5C5JA 3UE2A 1T8EA 4B3RF 5D6GA 5B0AA 1ZM2A 1FD8A 5FIIA 3G96A 2V8DA 1S0NA 5G0RA 2J7UA 2AYMA 4MMOA 3GFZA 3WDOA 2CJAA 2C42A 1UVMA 4OI3A 4RUCA 3QO9B 2CIMA 3MOZA 2VL1A 1VQ6S 5D78A 2CPXA 2VG5A 2YX7A 2DNOA 1QE1B 1Q4RA 1UEUA 2WHOA 1HNVB 1Q79A 5J2MB 1H38A 1M0SA 5CYMB 2XMWA 1UWBB 2KG1A 3VAJA 2B51A 4J9NA 4IO1A 1KNZA 4ZP9A 3HVWA 1VIOA 2IM1A 2JEGA 4YR0A 3SCKE 2YNHB 1Q78A 3PHEA 1VQKS 2MXYA 1HBUA 2ZVSA 3FGVA 2PGCA 2KVIA 4GKJF 2B9WA 4IFVA 1S6QA 1ZAWA 1CVJA 4DSEA 3JSBA 2BW2A 5KFSA 1I1GA 3MR5A 4DFPA 2B6AA 2DCLA 1T05A 4J9RA 2RU9A 3WX4A 1DQ8A 5CD4H 1HNWF 4Y6IA 3Q23A 4OHZA 1TKXB 3Q24A 2ZH8A 4UUXA 3AQOA 4IFYA 5F8LA 1U25A 2MDAA 4ICLA 1ROFA 5GADI 3H4DA 2IC3B 1WEYA 1I94F 3MM5B 3D0IE 4WE1B 2OMOA 4GO5X 4N47A 3PNIA 4A8KA 4OZ0A 1DBDA 4QOTA 2GJ2A 3F41A 4B9SA 4DF8A 5K8MA 4DV6F 4FXVA 3KLEB 2VBYA 2W9BB 1DLOA 4DFKA 2UXDF 1N6QB 4I1TA 5I3QA 3OVBA 2QA4G 1R8AA 4NLDA 3IR7B 3IXQA 3RRKA 2ZC4A 2CFXA 2ZKUA 4ZA1A 4G3IA 2HNYA 2HS0A 2LQ5A 2GHPA 4I64A 2ZH3A 1SUQB 3NLCA 4MIBA 4Y2IA 4C8KA 2IMOA 4JI1F 3MM6B 1HNZF 4CQ1A 2FTRA 2XWXA 2UVRA 3E51A 2J9CA 2N82B 1R0AB 2W4CA 2QMWA 4K4VA 5CXTA 1WHVA 1BQNA 3O3LA 4ZVHA 3T19A 2OO4A 4WFAQ 3KLFB 3VAFA 1RGVA 2HRYA 1HNXF 3DRSB 2RIJA 3OR1A 2LA6A 2VUGA 2R8KA 2HVZA 2LQ9A 1YSJA 1U1RA 2B5JA 1NKCA 4RNHA 1GX5A 1HL6A 2O1PA 2PC6A 1Q8IA 3V6HA 4JI8F 5AXNA 5EWGA 3LW5C 4I2QA 5J2PA 1FNOA 2EK1A 3MM8B 2FPHX 2RJZA 1U45A 1VQMS 2C2RA 5EWEA 4OX7A 2XCPA 4RW7B 2FIUA 1VQNS 1X0PA 3U1LA 4DL7A 2X51A 1XTZA 3SMZA 5K8NA 5KG1A 5KT2A 2VB6A 5CYQA 5KFWA 1NJWA 4B3OB 1BC6A 2W4PA 5KFRA 1VOMA 4IH5A 4ELTA 3NWGA 3I4HX 3TA2A 4H4MA 1KONA 1RT6B 2ASYA 3AA9A 3V4MA 3PZPA 4B9LA 1R8HA 2WAQD 4ECTA 3M2VB 3I32A 3OTBA 3TA1A 3C3LA 1MU2A 2WONA 3H5SA 4L6V3 4LSNB 2ZZNA 2LDYA 1N33F 1P8GA 3DYAA 5D4OA 2HGLA 2IVFB 2OLWA 4DR2F 1R89A 4IG0A 4TN2A 2GHWA 3HP6A 5LT5A 4X66F 4YQWA 3X3UA 4RX6A 4JUZA 2ALZA 1HMVB 3EUNA 1U1OA 1MMNA 2DNMA 3E01B 2FDNA 3ZZYA 2K1RA 4L72B 2F7VA 2OPSB 3K5MA 2MKCA 2O01C 3ENWA 2GFFA 2HNDA 4EGLA 3MM9A 5CCMA 3GR1A 2HQIA 1D9FA 4PPZA 4KJIA 5CA5A 2DRBA 4ZPCA 4RU2A 1RISA 1XMBA 3MEGA 1WEXA 5FDLB 2R7OA 4QIEA 2MMYA 4K4ZA 3M6UA 3BB5A 3CIMA 2EC0A 3DLGA 4HDGA 3VZIA 1KN6A 1XR6A 3HDSA 4LIWA 5IQQA 2GQCA 4TYBA 2XGQA 4PRFA 1K0TA 3MM7A 1RTJA 2RQCA 2BQUA 1WG4A 2IVYA 2CPHA 2IRYA 2IJFA 1FXLA 4EYHB 2UV8A 3B78A 4MIWA