1RISA

Crystal structure of the ribosomal protein s6 from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S6
publication title Crystal structure of the ribosomal protein S6 from Thermus thermophilus.
pubmed rcsb
source organism Thermus thermophilus
total genus 25
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1risA00
3T1YF 1N32F 4LF6F 1LOUA 4DV7F 4LF5F 4B3MF 5LMUF 2VQFF 1I94F 1XNRF 1CQNA 1XMOF 2ZM6F 4LF8F 4GKJF 1G1XA 1FJGF 1GH8A 2UUAF 5BR8F 4AQYF 2UU9F 4JI1F 4JI4F 3T1HF 4DV5F 4DV3F 1HNZF 1J5EF 2B7BB 4YHHF 2UUCF 4JI6F 4JI3F 3ZZPA 4JI0F 4X66F 1IJEB 1F60B 4JV5F 4LFCF 2UXBF 1CQMA 4B3RF 2F4VF 4GKKF 5LMNF 5IWAF 2J5AA 2YY3A 1N33F 4JI2F 4DV0F 4DR3F 4B3SF 4DR4F 4DV4F 1QJHA 1IBKF 4X65F 3OTOF 4B3TF 4LF7F 5AJ3F 4KHPF 1HNWF 1G7CB 3R3TA 2RJZA 1IJFB 4DV6F 4JI7F 4JI8F 4X64F 2KJWA 1VMBA 4NXNF 1B64A 2HHHF 1HR0F 4DV1F 2B7CB 1HNXF 2UXDF 1XNQF 2E5LF 4DR6F 4LF4F 1N36F 1IBLF 1FKAF 4DR1F 4NXMF 4DR2F 2BVZA 2BXJA 4LF9F 2UXCF 4LFBF 4DUZF 4DR5F 4YY3F 1RISA 4OX9F 4JI5F 4X62F 1N34F 4DR7F 4DV2F 2UUBF 4JYAF 1XMQF 4DUYF 1IBMF 4K0KF 2VQEF 4LFAF 2KJVA
chains in the Genus database with same CATH superfamily
1UEKA 3NOGA 2DT9A 3KKFA 4KIAA 2V2ZA 4LF6F 3ICLA 2EK6A 2QA1A 3LP0B 3H8YA 3ENWA 2DEJA 1EIYB 5IWAJ 1RHKB 1M5OC 3VTIA 3N6NA 4NCBA 2V4QA 3MM9A 2FC8A 3MTKA 4RZRA 1HBMA 3LO3A 2QA4S 5D4NA 4X66F 5KOWA 3CCLS 3O8WA 1RTHA 3QPIA 1TUWA 5HATA 3IGVA 3CC7S 4JV0A 1S9GA 2MSSA 4DEZA 2EXUA 4I68A 4FYYB 4KHMA 4DX7A 5B09A 5HANA 3CJ5A 4YB1P 4Q0BA 2FVQA 3MM9B 1HBMB 2FJVA 4OX9J 1U24A 1N34J 4B9VA 3I9ZA 2AIRB 2DNLA 1FXLA 1RTHB 2G0JA 2N4CA 3DKDA 1PKUA 3ULHA 4KGMA 5IXUA 2M52A 1MWQA 4NWBA 2DHGA 1U1PA 3JB9k 4Q0BB 1T02A 2UU9J 3T5HA 1UJ6A 2MLZA 1M5SA 4CCHA 4DQPA 5F8GA 5HBMA 2XNQA 4DL6A 3V81A 4FXWA 3FBBA 2GHPA 2HLTA 2RB7A 3NNCA 3KLHA 4K4UA 1NPRA 5FJ4A 3NAIA 2JVOA 2MXYA 2M9KA 3QO9A 3ZTPA 1N0VC 5HBMB 2KT2A 4UOCA 4IR1A 3TVKA 3V81B 5JMNA 3NP5A 3JSMA 4ELUA 5A8KA 1Q7LB 3PR4A 1HNWF 2LFVA 2CJKA 2FLOA 2G4BA 2IMWP 3KLHB 4E98A 1IR0A 3FZBA 5L9NA 2MLXA 3W8GA 3OXGA 4MTPA 1KFSA 2W01A 3QO9B 1RWPB 3LP2A 1QD1A 3QFWA 2CPZA 2VH7A 4ILMA 3W7BA 5E3RA 2IVYA 1Q5YA 3G8QA 5A8KB 2E9TA 2PE8A 4KYZA 1KTQA 3Q8RB 1WDTA 1N32F 1U0HA 4B3MF 1UVIA 1WC4A 4OL8A 1SPBP 3F73A 3LP2B 1IWGA 1F5AA 4DV5F 2D9PA 2LU1A 2AX1A 3RBXA 3ZZRA 1U0HB 3ONQA 2M8HA 3IBWA 2BEFA 1H2TZ 2RRAA 2J0SD 4E8UA 2H51B 1O0PA 2IHR1 5KFEA 4B3TF 3P6YC 2UVRA 2F40A 1VR6A 2HKEA 1G3OA 4GMKA 1ZM4A 2JL9A 3Q8SB 3RJMB 1L3KA 1FFGB 4QPXA 5U47A 2V67A 1FRIA 2GGPA 1LWFA 4CO5A 1HNXF 3FKBA 2XZWA 1K44A 1DJ0A 2RHSB 1BGXT 2LU2A 5HQ8A 4PPZA 4AE5A 4OJGA 4CI0B 2VJUA 2IBOA 1MROA 2RDJA 3MMAA 4ZLNA 3VGUA 1Y7PA 3X3UA 2EKNA 3KTQA 4J5OA 1AW0A 2GGPB 1LWFB 2DGQA 2KRRA 1LXJA 2VUGA 4J9KA 4EBDA 2C3UA 4A48A 4BCAA 2E5GA 2APOA 3V4MA 2E5HA 1MROB 5AJ3J 3MMAB 4DWIA 4P7VA 1HWJA 4OFZA 1NXIA 1WDDA 3QNWB 1NDKA 4X4QA 3M9OB 3D4JA 4MK8A 4DCPB 5IQ6A 4IUFA 1N5YB 1WC3A 1JJHA 2JEFA 2MHNA 1HWUA 3TOQA 1RT1B 2V2QA 3KLGA 2ZNYA 4LFBJ 1HPZA 4EZ9A 4DUZJ 2R8KA 5K8MA 3PYGA 4ELTA 5ETKA 1JNZB 4F36A 3C6TA 3WC2A 2ERRA 2BJ1A 1NEEA 1PILA 4Z2XA 5KFQA 2LVWA 3BBFA 2DNOA 2HVHA 4WU3A 5MAOA 3V5RA 3ENQA 2ZM6J 2U2FA 1RISA 2CZVC 2DCLA 5KFZA 4TU7A 4K4VA 4GRSA 2Z56B 2IM0A 3KLGB 2GFFA 1HPZB 5KFLA 2HQIA 4PXEA 1JB0C 3CGIA 3C6TB 2DGTA 1FJCA 3V6HA 2DXDA 2DRDA 3PYFA 2RS8A 4O4RA 1HQEB 3D2WA 4DV3J 2KFYA 3DLKA 3U02A 5J2PA 4NLVA 2HHWA 1KHWA 2X51A 3J7Z5 1Q0NA 4ECXA 1U1MA 1HMVA 3Q8PB 1CSJA 3NS6A 2VC0A 1SB6A 3RUBL 1I6JA 1S77D 5J2MA 4LRBA 4ERDA 2MB0B 3HZEA 1RU2A 2FYXA 2DITA 2B5JA 3TA1A 3DLKB 5J2PB 3A12A 1N5QA 2DHHA 2XGPA 4MK7A 1N36F 3A8IA 3OJSA 2UXDJ 4WU2A 4LF9F 2CQ0A 4WFBQ 1HMVB 3KJFB 4WTOB 3OL7A 1HD1A 4YDDB 2IJNA 4ZN1A 4USMA 5J2MB 4JYAF 4HI2A 3SCJE 1V3RA 1VDHA 4KGVB 4AFFA 1EKRA 4YOEA 4LBIA 1P6TA 2NREA 1OQ6A 1T94A 3EXYA 3CF5Q 5GVQA 3AT1B 4JI2J 3BO4A 2FGCA 3PO5A 2Y3YA 2ASJA 4DPWA 1DTTB 2EFGA 5KFGA 1JJ4A 1KSPA 2PC6A 2ZKUA 1HHSA 2JSXA 2WONA 2LQ8A 4XDCA 1KQKA 3LWMA 3I5AA 1ZTTA 5K8NA 1IQTA 3B54A 3T1AA 5CCLA 2DNGA 2FJAB 1UPMB 3NKYA 4CLFA 2VV5A 1IBKJ 4MH8A 1FRLA 1TKTA 3OLAA 5H9EJ 2ZBCA 2AGPA 1N5VA 2FY8A 3I32A 2WONB 5KFFA 4B17A 4MK9A 4PRFA 1TR0A 1V5IB 4IG3B 2E7XA 4DR2F 2GIFA 4CYUA 3ISNC 4DFMA 1P9QC 1VBYA 2DY1A 2OEKA 3DRXA 5KG0A 1WJ9A 2FJXA 1IM4A 4DSKA 4TQRA 3BDPA 2BX6A 1T11A 2LLZA 1TKTB 3CDUA 4PR6A 2CG8A 2UUCJ 1FE4A 3OXFA 3M8WA 4J9LA 2EC0A 1O51A 1YJ7A 4RW9A 2GJIA 2RILA 4Q45A 3LALA 2XYPB 2XMVA 2Z57B 2BKNA 1NB2A 3D6HB 3VHQA 5KT7A 3CD0A 2U1AA 1R8PA 4KKOB 4X4UA 1S1WA 5K14A 3RYLA 1TMMA 2DIVA 2V2KA 3P49B 4QQBA 1Y5IB 3DHWC 4EK2A 2F65A 4M5DB 5CABA 1WTBA 1GXUA 2YX1A 1TP7A 2UXCJ 3K5NA 2LECA 3NMRA 2HHUA 1B64A 4CLKA 2LCWA 4DV2J 1UKUA 3WIUA 2W2QP 2KT5A 4DV1J 1RAEB 4CIOA 1S1WB 5K14B 1HI8A 4WPAA 2HEKA 1U0SA 1NKEA 1C1BA 2CWKA 1WOSA 1U1KA 1CPZA 4B3OA 4RLEA 1RA7A 4RUCA 2OI2A 2DKOB 3CUNA 3ZFVA 1JJCB 3DU5A 2DNZA 4IOCQ 2YKNA 1RHQB 5JUMA 5EWGA 3CB4A 2P6TA 3HO1A 2C2EA 1AROP 1FJGF 3AD8C 3FRYA 2J8AA 2CPDA 3TX0A 2E5JA 1C1BB 5F9LA 1FVSA 2GX8A 4ZVSB 4DSLA 5KFNA 1S1TA 2KM8B 2XWYA 3EMTA 1RTDA 1KS2A 2P9EA 2CA9A 4B3RJ 2RE1A 3CCRS 1JNRB 1FXDA 2V94A 2W8LA 3H0PA 1V6HA 2IRXA 2V9WA 4FF3A 3W63A 2VDHA 2Q1LA 3DYAA 1H98A 5KTQA 4DU7A 2H5IB 1RACB 2D3ZA 3SBMA 1S1TB 4KGZB 2D3O1 3A1YG 1C1CB 3UE2A 1BXNA 4M5MA 4OHXA 1APSA 2X1AA 2HWTA 4FBUA 3N0VA 3PIOQ 3VAHA 5D3GA 4A8KA 1KONA 4FYWB 4YR3A 1ACMB 4KR0B 2MQQA 3DYAB 3DLBA 5BR8J 2HAFA 2LEBA 4ES1A 2V4RA 2KVIA 1RB0A 2JLFA 2DR7A 1VQNS 5HQMA 2FD2A 2A3JA 3C16A 4LF5J 3SMZA 4FPIA 1GT8A 5D15A 1MMNA 1RADB 2CVIA 5KFVA 2PDAA 5D3GB 2EEYA 1VQLS 2DRAA 3K5MA 2QEXS 5GADI 1Y11A 3EXCX 4RUAA 1W2BR 4N76A 1RT3A 4YP3A 3NS5A 1RHJB 1V9OA 2OMOA 1MMLA 2W7PA 3CJ2A 2Y1RI 3UCZP 3N9UC 4J90A 4MJKA 1VQYA 3P45B 2ALZA 4IH6A 1M90T 2R3VA 4CO4A 1N5TA 4K2JA 3GFHA 4L75A 3FEXB 4ZJQA 3D3BJ 1RT3B 4ZVGA 4I7FA 3IR6B 4HL9A 2DR6A 4Y2AA 2W4CA 4XO0A 5BYQA 4R8UA 4UQTA 2E29A 2CQ1A 3W1YC 1OY9A 2Z0GA 4JI6J 3BR9A 2AV5A 3VAJA 5IM0B 2DY9A 2IJRA 1T7PA 4I7FB 1X5SA 2ZOMA 5J2NB 1DURA 1S6QA 3CCJS 3OSNA 4ZIWA 2ZE2A 1FDAA 1T3NA 2DR9A 3R5AA 5IT0A 2R7VA 3K2YA 3TZYA 2IY5B 3BSOA 3EE3A 3OD2A 2HIQA 2N82B 4FXDA 3CJ0A 3DDKA 2QA2A 1DBDA 4LVOP 2FJEB 1EQMA 1HLWA 4NE9C 1WI8A 1N8RT 2PI4A 1S6QB 2JLEA 4E0DA 4RX6A 2ZE2B 4OYWA 2IYGA 4X64F 2R7XA 2AJFE 1UZHA 8AT1B 2CVEA 4ELVA 2PIIA 5AXKA 2DNKA 1WEZA 2XMWA 1M1HA 3I96A 3H5SA 3CCZA 1T95A 1HNIB 4FP9A 3FEYB 4QIEA 4ITSA 1YKWA 4ZPWR 4J9OA 4I67A 1S1XA 3QAUA 3TP2A 1ZOTA 1DAXA 1J5OA 4EU0A 1RWKB 4PXDA 2R9LA 2C3MA 2KI2A 2KZZA 2IA6A 2ACYA 1B7YB 2MZSA 2CKWA 2M0GB 2NZ4A 2WK4A 1PJ7A 2ADBA 3PDNA 2R7OA 1PG5B 4JI0F 1J5OB 3S8SA 2HIYA 2H48B 5CH7B 4DU8A 1F9FA 1FKOA 2P5VA 3KJVA 3BM7A 1SJ3P 1QAIA 1QM9A 4YB5A 4PWUA 1WOPA 4WFZA 3LUYA 4HT5A 1NDPA 1RWXB 1U45A 3HJFA 2FPHX 1FKOB 3KJVB 5KFBA 3PG9A 1OY8A 4LF4J 1SC1B 1S7HA 2CJAA 3R2CJ 2LA4A 1M1KT 2W2NP 1XMQF 4K0KF 4AQYJ 1SL1A 5F3ZA 4OLOA 3MCOA 4P74A 5KFUA 1JK9B 2ZH6A 5D77A 3CDAA 3BEGB 3GV8B 1YJ9S 4ED2A 4N41A 2XI2A 4USIA 1FVQA 1U26A 2E1AA 1DRZA 3KUEA 4CT8A 1HBOA 1RCXB 3R5CA 4YHHF 3KXDA 1RBLA 1BHNA 2BW7A 2ZH2A 2SXLA 4ZCLA 4OI2A 4CDIA 5THWA 2G2YA 5ETOA 5E41A 2LDYA 4ZHRA 3V6DA 4L6V3 1AXQA 3CCUS 3H25A 2JH3A 3D1HA 4ZOSA 3J81j 3M8YA 1HBOB 2JDJA 5HROA 4Y00A 2AEJA 1NSKL 4C2MA 3MM7A 3HSGA 5D78A 1CS4A 3TVYA 1R0AA 5CXTA 5EDWA 2D1CA 3G82A 1DZ5A 2RKIA 2Q79A 2M88A 2RQMA 2W9AA 3SCLE 1FWPA 2DIUA 4ZHRB 2AEMA 3V6DB 3DFEA 4OIXA 3ZZTA 4I6WA 4DR7F 4OZ1A 2UUBF 4NLSA 3FK4A 2XWXA 4ZCKA 1S4FA 3C66A 5HROB 1HNZJ 4HH1A 4KT0C 4JBCA 2ADCA 1FE0A 3K7RA 1CS4B 3L7OA 4X84A 1R0AB 2F3JA 1HFEL 1UFWA 2YTCA 3G82B 2G2OA 4UF4A 2RKIB 1UA0A 4TXSA 1U2CA 1P1LA 3D1OA 3I56S 4LFCF 4N7TA 3Q2SC 4HH0A 2UVVA 3G6YA 1VRTA 1VS3A 2AYEA 1B7FA 5FIIA 4WXOA 4NZ0A 2UVUA 2FIUA 4NLTA 2WCXA 3CIMA 1B0PA 2L9NA 2IVMA 1EKSA 5DQGA 1VRTB 1UVNA 5DLGA 4GO7X 5F0WA 3KJQB 4GKJJ 3CIZA 3DGVA 2YH0A 1Z1ZA 4DL5A 1M5KC 2XB2D 1Q4RA 2PT0A 3NGRA 3MECB 2ZH4A 5C2GA 3GP9A 1D8YA 1FEHA 4M5KA 2V8VA 2MZJA 4DR4J 3QZ8A 4DN0A 2PN6A 4CLPA 1FRXA 3DNCA 1FTRA 5LSOA 1RBOB 4NCGA 4DV0F 4OV6A 5F9NA 1U49A 1JLGA 1DLOA 2HRTA 3UI3A 1OYDA 4X65F 2NXEA 3GZ7A 2OD4A 2NS1B 3H5UA 1Q1KA 3A4TA 5EN1A 2KG1A 2Q43A 5GMKa 1HA1A 2BOPA 4NCGB 3CTRA 3KK1A 1Q78A 3R5DA 1JLGB 1DLOB 3HSDA 2BJDA 1FRJA 2AJ0A 2LQBA 1H73A 5K20B 3TAQA 3PHEA 4WFNQ 1UEVA 1Y4ZB 3BGFA 1RGVA 4F67A 1ICEB 3MOJB 3FDSA 3JQKA 3CCSS 1ZAVA 3KK3A 3BO3A 2KYZA 4UUXA 4IKAA 1U8SA 2OSRA 2QL7B 3BSAA 1YBUA 4JUZA 4R0JA 2ROGA 2VIHA 3R8YA 2AQ4A 5LSLA 1TL1A 1TAUA 4GVBA 3K57A 5DLFA 4BHQA 2QZ8A 1VOMA 2IDLA 4DQIA 3I0SA 1T9YA 4X4VA 4QWEA 1SKUB 3KK3B 2ZHOA 2HFOA 3BGRB 4NA3A 5L1JA 1Y3KA 3VV2B 4USKA 1I3OB 3LPEA 1RAGB 1TL1B 4IOBA 2KXFA 4GVBB 1RAIB 4C8LA 4X62J 3C19A 5HO4A 2CQIA 1RT4A 2OJ3A 4NLYA 4TY8A 2HMIB 3RBDA 1S76D 2RIJA 1QSYA 3I0SB 4LF6J 4NXMF 4DPXA 3M2VA 2Z2MA 3KFWX 3JSBA 2MY7A 2F9DA 3THVA 2H5JB 3H59A 3OR2A 2AU0A 1P27B 2OELA 1RABB 2ATLA 1RT4B 4X66J 4O3OA 4QIVA 3C15A 1JXLA 2GCFA 4LF8J 4NCAA 1DY3A 3FBFA 2CDRB 3KG0A 3QRPA 3M2VB 3TW0A 3AOAA 1RAOA 1NO8A 2PFDA 3GJRB 4QIFA 4JI3J 1K73T 3QMQA 3CEDA 4JV5F 3OR2B 2DR8A 1N52B 3BB5A 3MPWA 2UXBF 4IQXA 3HI9A 3ENVA 3B82A 4OX6A 3IBCB 4OYOA 3WDOA 3HVTA 2IAJA 5JVHQ 4DX5A 3C15B 2IMOA 2Z2LA 3I55S 5KT4A 5EGYA 2D3OR 4WYWA 3MFIA 3C3LA 3FRZA 1Q16B 2Y1JA 2XMUA 3T41A 2E5LF 1GXLA 3CCES 3HVTB 2IAJB 2YNGA 3PRVA 1VLOA 3E51A 2XG8A 4YY3F 3TNVA 3MR6A 3ET6A 2HRUA 3M6UA 4RU9A 1HBNA 2DPIA 1SJFA 1MN9A 1FERA 3KOAA 1EJ7L 1RP5A 5KFCA 3BREA 1S99A 3QJPA 1FDDA 2YNGB 4QCLA 3CULA 4DV3F 2FHJD 2HK2A 3ET6B 4F3QA 1OY6A 1HBNB 2LEPA 1SCJB 2VPXB 3O5TB 2KT3A 1SC3B 4F26A 1C0TA 5KT2A 3RRGA 4MIAA 4LBPA 4DPOA 2QN6B 5KT6A 1RAFB 1WF2A 1WKLA 2C22A 2DD8S 1FO1A 5HQLA 3P5TL 2YNFB 5J1PA 4P2FA 4O44A 4YB6A 5A76A 4KE5A 2HNYB 5EHHA 3OFFA 1R6YA 4ED7A 3O6QA 4USHA 1ZZNA 2V5HG 2GVDB 2IVFB 2M7SA 2AX0A 2UXDF 1SV5A 1N32J 1FKAF 4B3MJ 1C0TB 1NM2A 3W8PA 1KQSR 4NLOA 5KAKA 3BH7B 2IYIA 5M2UA 3OTEA 4C8OA 2MKCA 2KKHA 1LV5A 4F4XA 2VBYA 1CJTA 4ZPCA 4O44B 1S7IA 2GO9A 1VQ4S 4EGLA 2JWNA 2HVZA 1V3ZA 2N3OA 1G6BA 3W61A 4L74A 4ANDA 4M94A 2CZ4A 2M4MA 1SV5B 1RYRA 2R7WA 3LAMA 2VG6A 1FRMA 3I0RA 4UTGA 1S57A 2R2SA 1JLBA 2OKQA 5E7OB 2NUUG 3ZZPA 4K4WA 1YRTA 1CJTB 2Z8QA 5KFDA 4B3TJ 2VFRA 3DLJA 4X4NA 2VONA 2YPYA 4NLXA 2WSEC 4ZMMA 2EK1A 3U27A 4WIQA 2MMYA 1IBKF 1ZAXA 1HNXJ 3NGSA 2VG6B 4PQUA 5A6PA 3I0RB 1NNDA 1JLBB 2HHQA 4YR2A 4PQAA 2JRSA 2KN4A 4FKXA 1WC6A 1GMVA 4XTTA 2WTFA 4EO8A 2GJ2A 3CE8A 2EFQA 4TU8A 1PJ5A 4DFKA 5HMXA 3CDWA 3O44A 3W62A 3IG1A 4QYZK 2OPPA 2O5DA 1UETA 4PQUB 4HHUA 4IO9Q 2WOMA 1ELOA 4YS2A 1SIZA 2ZUGA 3T9NA 2Y0SD 2RHQB 4ZA1A 3AD7C 5I42B 3C46A 3DM2A 4RW4A 1W25A 4RJVA 5ITHA 4LR9A 1FFSB 4OYZA 4Q8FA 3P3DA 4A8WA 4X4SA 2W7OA 3NS7B 5E3QA 2QLWA 1OJ4A 2OIHA 1F60B 4KRWA 5GMDA 4KFBA 2FDNA 1Q8LA 2VL1A 2YBVA 5LMNF 1IR2A 1ULRA 3CC2S 1NK4A 4DR3F 1R8HA 2YWHA 1OPIA 3DM2B 2QA4G 1X4AA 4RW4B 2OGUA 4WWSA 2JC1A 3FSXA 3D3CJ 3TWZA 1KEKA 1VGYA 4ZVEA 1JJ2R 1RTZA 1M0SA 4JI8F 1GX5A 2QGFB 3D54A 4KFBB 4DV1F 3BH6B 4U96A 3N5FA 2IBKA 2L48A 1XQIA 4WJBA 2DNNA 4YR0A 5GAHU 2NLWA 3RBZA 3R27A 4ECUA 5GAGI 2HQDA 4Q7AA 4LRFA 3MUMP 3M8PA 9ATCB 3AHPA 2Z30B 5K5MA 4MYUA 4O3QA 3HT3A 3QGGA 2HZAA 4M1KA 5ETQA 2HNZA 2VDIA 1SH2A 1HIYA 1F3FA 2GVZA 1VQKS 2GIRA 3CMAS 3BQ2A 4CTAA 1FJ7A 4B3RF 3M8PB 4PWWA 2QLJB 3P5BP 4QIGA 2C2RA 1N6QA 1PC5A 2OTJS 1XEZA 3SZ2A 1N36J 3T9ZA 2YKMB 2C3YA 3HFVA 4BDPA 1Q53A 1QTMA 2GVZB 1RK8A 4IRDA 2E7WA 4CTAB 5DQIA 4JYAJ 3GG1A 2FZKB 3FZ2A 4ZK7M 5DO2A 5D0HA 1N6QB 4Q5VA 1WC0A 1O6XA 1LWCA 2CJBA 4KAIA 2OMLA 2HS4A 1XIQA 4LF5F 4RBTA 1S97A 2AT1B 2WW8A 4DPUA 2GA7A 1VK3A 4NA2A 2XC9A 4DX6A 3AODA 1R8CA 4G6VB 2YNHA 2G9OA 1TUGB 2Z58B 5AE1A 2QL5B 4ANEA 4J37A 3TQ1A 1LWCB 4O3PA 5L46A 3OHAA 1HWIA 4U67Q 1H7WA 2YNHB 4DCOB 2B9YA 4PKDB 4LRCA 1TAQA 3C2PA 1X4DA 4HACA 4DR2J 2WAQD 3SSQA 2DO4A 4YMEA 4DQSA 2G0IA 1CC7A 5DZ6A 2W9BA 2E1PA 5F8IA 2LQ9A 1WEXA 2R8GA 1B70B 2OFGX 3EM1A 2BM1A 1QTNB 2DNYA 1F5CA 4HACB 2OPSA 3WX4A 2CJYB 5HVGA 4ZLPA 3W9IA 3TJAA 2D3UA 3J7AN 5F8NA 1VBKA 3MM6A 3OFHA 4FBTA 3UD4P 2M3DA 2W9BB 4PYDA 3EPGA 2HQFA 3C14A 2GMHA 4M5IA 1IUJA 3IFEA 2W25A 2WVCA 3HKWA 2B8PA 2OPSB 5GADU 3ZXWA 4OZNA 2UP1A 4GKKF 4TLRA 3PRDA 4CNZA 3EGWB 4WP9A 4C8NA 1RT7A 5CYMA 4NLQA 3PZPA 4OJ3A 1QJHA 2RQKA 3D5MA 3FEZA 3C14B 2ZITA 2D74B 5IC6B 3DHXA 4LJMA 2QRRA 2GAHC 4O4GA 3VZHA 4XPCA 4P75A 3S7RA 3B78A 3FSIA 3DXSX 3GPAA 2OHDA 1SQGA 4CP5A 1RT7B 2FVPA 5CYMB 2QLXA 3CCTA 4RNMA 3GMGA 5M2PA 2XZDB 4KH0B 2B0GA 4CLTA 3QLHB 3TAPA 2CQ3A 5L8RC 3QAEA 4O4GB 3R7BB 3KMQA 2BDPA 2FLPA 2Z2ZA 2C2DA 4ZDNA 4U8YA 2V2VA 3TJ8A 5B0BA 2J9DE 3QQCD 3VVTA 5B7WA 4F2RA 3RR7A 5G4DA 2CQ2A 4PPDA 3AA9A 5CYQB 3AJ2A 5IS2A 2PEHA 2YQ0A 1DQ8A 3EJMA 4LMZA 1ZBTA 2X1GA 3MFHA 4OQJA 3UR0A 2F7VA 1SJ1A 4RO0A 4MIBA 3FBCA 3DLEA 2LEAA 2HAIA 4BLGA 3QIDA 4NPOA 3KHRA 2WW4A 2BUNA 1KBRA 4EYHB 4MT1A 1VQ5S 3QT6A 2FHJA 3VAIA 1LFPA 4DUTA 2ZVSA 5A8RA 2G2ZA 2HVDA 2HQGA 4FYXB 4OZ5A 2QYCA 3PYDA 4LF4F 3DLEB 1TVRA 4Y2KA 5HAOA 2WSFC 1X5PA 5CD4A 1RWVB 4LFAF 3LTOA 1FK9A 5D0GA 2ZEJA 1U02A 3ZO7A 1WF0A 1FCAA 3N01A 4WKYA 3JQJA 5L9XA 2IDEA 4XPEA 3CD6S 1GAOA 3N79A 2I1RA 4BC7A 2XO7A 1KKHA 1M5VC 2E1MC 5H9FJ 1TVRB 4TU9A 2OLWA 2MQPA 4PWDA 3HMJG 2XQCA 1QAYA 3PTWA 5LXRA 5LJ3Y 1B4SA 3A8EA 3GCXP 1WHWA 3BDEA 4NMLA 3RB0A 2ILYA 1QVFR 2MKSA 2V6AA 4I2PA 4JV2A 3OFGA 5LL6d 3CO0P 1YJTA 3LP1A 3HK2A 2DNRA 1NPPA 4KHPJ 4PWDB 3ZZYA 3JYTA 3MHYA 4PUOA 4ES3A 2RT3A 2HHHJ 1WD6A 2MZRA 2I5JA 3LF0A 1FX4A 3QWPA 2BVZA 4P2XA 3PY8A 4I2PB 2LXUA 2HFNA 3IC1A 2J9CA 3LP1B 4P10A 1UW9A 3M8RA 1IBMJ 5KFKA 3J7YI 3EGZA 3JYTB 2ZZNA 3R97A 5DG7A 4PUOB 1D09B 2MEWA 3FMWA 3BKTA 3AJ1A 4FF2A 1RHUB 2RDIA 1WSVA 2B51A 2GMJA 4ED8A 2R2RA 2K7JA 2DISA 3RAMA 1BD6A 1EB0A 2VF3A 4C11A 2GQQA 2P6SA 3UPFA 2CQPA 1L3SA 3Q2TC 2MKIA 3CJQA 2EKYA 3KLIA 3AJDA 3CMQA 1KLMA 2KRBA 5CD4H 1D8ZA 3FQKA 1WG4A 3L7UA 4C11B 2QL9B 1QSLA 3JTNA 3K8VA 3JQMA 2BE2A 4CNYA 2O67A 4ZPBA 4QWBA 3A8KA 4EEYA 2RDDA 2R8HA 4TY9A 2GZOA 4OYMA 2O66A 3KLIB 4LIWA 1KLMB 3D6TB 2NPIA 4G1QA 4DX8H 1RLCL 4DUYJ 4CWBA 4JI0J 2J0QD 1CJKA 3CJRA 5HJYA 4DZ6A 2BE2B 3VGVA 2K2PA 2NCKL 4OI3A 2NXNA 4WCEQ 4DI6A 2BOAA 1CC8A 3JS9A 3CC4S 1NHVA 4ID8A 2HWIA 1F2HA 4C9DA 3OBIA 4CZCA 1CJKB 1FDBA 2WB4A 2MTLA 1Q8IA 1EAYC 2R2UA 4RW7A 1WC1A 2DRBA 2ZBIA 3D0GE 4ZP6A 2K7KA 3PXGa 1SBRA 2FVCA 2G0CA 3VF0B 2QC3A 3BZQA 4K0KJ 3Q8YA 2XS7A 1F9HA 3CWJA 1NRKA 1RKIA 5KFXA 2M70A 3IWLA 1K1QA 4JP8A 4H4OA 2CPFA 4ID5A 3F41A 4IO1A 3PKMA 4RW7B 4YHHJ 1UEUA 1FJEB 1N88A 5KG4A 2LXFA 3NL0A 5KG3A 1S6OA 1NJXA 1MWYA 1NBEB 2K06A 2HGMA 3HVRA 3BJYA 2HHSA 4JI4F 1FRKA 5E33A 3NNHA 4H4OB 4ID5B 1B0TA 4NZ7A 4B9UA 5E2QA 1URNA 3K17A 3G6ES 4LIRA 5BYRA 2H54B 1OS5A 4QW8A 2HFSA 1XN9A 1Y9OA 1X8DA 3QATA 1S6UA 2XCAA 3MM5A 3MGJA 1VYAA 4C8ZA 3PEJA 4IDKA 4H4KA 2JLGA 3DRPA 3HFKA 3T6JA 2JEJA 4URQU 1ZPVA 2UUBJ 3DLLQ 2V9KA 3MPYA 4Y2CA 4QBUA 3US5A 1UL3A 1UFLA 4RUBA 3PACA 3W5ZA 1S0MA 3MM5B 4F4ZA 3W5XA 3D0HE 1H6KX 2EWHA 4IDKB 2H9ZA 2ZBRA 1RAAB 3DRPB 4QWAA 2B56A 4N47A 5AE3A 4BS2A 3AQOA 5E3AA 1R43A 1Q5VA 3IP0A 5KFTA 4GC6A 4H4MA 4P71A 2D7SA 3MZIA 4LF8F 4LFCJ 5HSPA 2HZVA 3WX8A 4ZLLA 3T1HF 1QSSA 1OSCA 4JI3F 1EX8A 3ZNJ1 2B4PA 2MLYA 1WSRA 1NMEB 2BJ9A 3M32A 5HLFA 1UZDA 4J9VA 2AZ1A 2OO4A 3IBFB 3OLBA 4I6AA 3M6VA 1VC5A 1C0UA 2W8KA 4U7UD 2VOPA 3NGUA 1DQ9A 1S9GB 3ZZUA 1B99A 1WG1A 2DB1A 5CHCB 1TL5A 4BWMA 1R89A 1S1UA 1HW8A 3W9JA 2GQCA 3M32B 5HLFB 4CLYA 5I3PA 4GO5X 4RNFA 3GTYX 3DRRA 2Y8WA 2ZH1A 1FWKA 1C0UB 3MM8A 5C7PA 3BGOP 3QIPA 5H1SV 4WFXA 2N7CA 3RW6A 5DQHA 2W2MP 1X0FA 2BW2A 2HHTA 1XTZA 3W64A 4URGA 1QAJA 3T1YF 3P8BB 4QIWD 1S1UB 2QFJA 3R6LB 3BPDA 6AT1B 2YNIA 1ZM2A 3DRRB 1WHVA 3W66A 3LOUA 3QJJA 3C6UA 4DV0J 4ZPVR 3MM8B 3QIPB 1FTCA 5KG5A 4X65J 3HJVA 5CCMA 2EBEA 5ETVA 3W9HA 5B0FA 3M8ZA 3CCWA 3B4MA 3CJ3A 2A2CA 3ENAA 1MU2A 2RNEA 4IR9A 2A10A 3C6UB 1RWWB 5ETMA 1SJ4P 4HTJA 2H4YB 4K4SA 3JSMB 3N5BA 3I4PA 3QRRA 2DK2A 4QWDA 2CPHA 2YKAA 2H65B 3LWLA 5SUHA 4ECRA 1EP4A 3FNNA 3ILIA 3U1MA 4CO3A 4MYTA 2LDIA 4DS5A 1VQ8S 1MU2B 4B9SA 4AL5A 2VBXA 4ECSA 2YWFA 4CLZA 2R2TA 3IXQA 3SV3A 4UQGA 1URRA 1VQOS 3A3OB 1NZ8A 2V63A 3QRQA 3Q23A 4R5PA 4Z37A 4ZVRB 1ZZFA 4AYBD 1Q81T 2GW8A 3MWBA 4NLWA 1N56A 2HW3A 3UO0A 4OYAA 2PSZA 1REVA 4O0NA 2R7UA 3PO4A 2XYGB 2LYVA 2AYMA 4ZVUB 2XLKA 1TUVA 3SXLA 1GXTA 2RVJA 1WWHA 3Q89A 1BLUA 4R5PB 1CULA 1HL6A 4MAKA 1WNEA 3O3LA 1IWAA 4NXMJ 4K4ZA 4TLQA 3AAWB 5CA5A 2RRNA 4IQMA 4JI7F 2DO0A 5DDQC 1CEZA 3IA0A 1REVB 1TQLA 2B7CB 2LQJA 3GIRA 1U47A 2UZAA 3D9BA 1HI0P 1IKYA 3BGLA 3SSSA 4WE1A 1S9FA 1W2IA 4ENOA 1SC6A 2RQ4A 1CULB 3EVWA 2OPQA 3W2WA 4ECQA 1P9YA 1MG7A 4QR0A 1HKAA 2DJWA 4KHRA 4OZJA 4C7QA 3K5OA 3LGHA 1L5UA 2WVBA 3OQ2A 4JV5J 3LANA 3G8TA 2UXBJ 2DR5A 4IH7A 3M30A 2GV1A 3F0NA 1TK8A 4U7CA 4WE1B 4ZVFA 4OZLA 1WORA 2OPQB 3W2WB 5HJXA 2CADA 5HVHA 2Z4PA 2EW9A 1PJ6A 2XBPA 4HKQA 4K4XA 1HYSA 1HI1A 4U7UK 3DRYA 1HHQA 3GCWP 1UWBA 4ES2A 2YWKA 1Y3JA 1KLNA 1Q86T 4NYZA 2E5LJ 2HHXA 3BBCA 3I31A 4YY3J 3ZZ0A 2W1BA 4MKAA 1MSWD 5GAEI 5B0DA 4N56A 4XIUA 1YVFA 2YQ1A 3S01A 4NASA 1HYSB 4ED5A 4J9QA 4I56A 1R0CB 3PM9A 1PBUA 1UWBB 3K59A 3MOZA 3HPOA 1FRHA 3GYXB 2FTRA 3JXOA 4F25A 1VC6A 1KWMA 2VHGA 3IR5B 1XNRF 2XGQA 4OYBA 3ITHA 1HNVA 2HSEB 3D28A 2DHXA 4ZLJA 1NDLA 4OI0A 1J5EF 1HWLA 3POTA 3JTPA 1IVZA 3PKYA 1YZ7A 1LXNA 5KFMA 3D67A 3EUNA 3MPVA 4ER8A 2PEBA 1VBXA 1NJYA 3M9MB 3ITHB 3HD2A 2FJBB 1ZTWA 1HNVB 3OTOF 4EUVA 1AUDA 2PA8D 4FF4A 1D0EA 2NYHA 3GB0A 1JQGA 3PCOB 3LAKA 3QWUA 4DN9A 2X1BA 1QVGR 1XERA 4CT9A 4Y0FA 3KYLA 2B5JB 2NZCA 4OI1A 3DDIA 5KFHA 3IR7B 2LP4A 1R3NA 3THTA 3G9CA 4H4KC 3RB4A 4A8FA 1ZH5A 2ROEA 1BWVA 4OJHA 5C25A 1UVLA 1JKHA 2AP6A 2KO1A 4CM0A 1RDRA 2VICA 1I94F 1X5OA 2DH7A 5C24A 2VFVA 5IFMA 1OWXA 3AD9C 3UDEA 4ILLA 3MI7X 2DGWA 5EX3A 5DG9A 1ZYQA 2HNDA 2I0XA 3ILLA 1Y0HA 1BY9A 1SH3A 4X4PA 1RT6A 2I6WA 2VODA 5C25B 2XHCA 4CLUA 4DG1A 3PYEA 4KPYA 4X4RA 2MQMA 3IRXA 4KPCA 2H5EA 5C24B 1UVJA 3GV5B 4I1TA 2A0FB 1CJUA 1VJQA 2HNDB 1NDCA 1A9NB 1C4AA 2DHSA 5B0GA 4Q2MA 1RT6B 4B9NA 4P52A 3BQ0A 2F8EX 3UCGA 4LREA 4DG1B 2J7WA 4RBVA 2AKWB 3IRXB 1KP6A 2PFFB 1C2PA 4DR5J 2CPIA 2IRYA 1CJUB 4CYUB 1NK7A 2GIQA 2B4VA 3VAKA 3ADAC 4ETZA 1S49A 1K47A 3TA2A 1Y10A 2KXHA 2VQFJ 1LWEA 2VPZB 5LMNJ 4HHHA 5LJ5Y 5KFSA 1Q8KA 5DM6Q 3MXHP 4DR3J 1H72C 3QYYA 1N48A 4RW9B 1NB7A 4CRJA 1X31C 3W3SA 2J5AA 3H4DA 1VI7A 1RZMA 3CJ8A 4JI8J 4PG5A 1O8BA 3PX6A 1LWEB 3AB4B 3I6PA 1BC6A 1GMUA 4DOZA 3V2UC 5DGAA 1FNMA 1UMJA 2MKKA 1U25A 3TAMA 1WELA 2KJWA 1VMBA 3PR5B 2KXNB 4DSEA 3I82A 4HDGA 4IRCA 1X4EA 5EUHA 2ZH8A 1TKXA 2ZH7A 2Y8YA 3G86A 4TVAB 4IFVA 3FSYA 4LUBA 4OX7A 4HVZA 3R9LA 4B3OB 3DXBA 5EWEA 5D0RA 2W9CA 1CQNA 1UP1A 5LMUJ 1DTQA 2YKNB 6FD1A 1NLKL 5J2QA 3DOLA 4KV8A 4KC5A 4X2BA 1RQ0A 2NXUA 4IFVB 4N8NA 4QYRA 2RAQA 1Q7YT 3VZIA 3GONA 3KUGA 4NA1A 4ED0A 2P9GA 1F1BB 2W9CB 1RTDB 2BJ3A 1DTQB 5J2QB 1S12A 5ETLA 3FMBA 4KV8B 4CLWA 4FKYA 1QAXA 3Q0AA 2XYHB 2PMWA 4AT1B 1U2RA 1PC4A 3FVYA 1YITS 3GLJA 3KUHA 2MDAA 4Y34A 4DJBA 4JI5J 2J76E 1A6LA 4LQ3A 3VAMA 3T5KA 2J0XA 2F63A 1RUSA 4RW6A 3BPSP 1JLEA 2R42A 3M8QA 2J6UA 1EHWA 1SJQA 2AZ3A 2DNMA 3C16B 5I3UA 3U1LA 3HDSA 4WYLA 2DGSA 4I69A 2DCUB 3HVAA 2L08A 2MZQA 1JXVA 3H42A 2DGVA 1IKXA 2G13A 2V8HA 2BRKA 3ELHA 4RW6B 2QTWA 2V8DA 1JLEB 3J81Y 3M8QB 1FDNA 2QIFA 2CNLB 4FPRA 4MKBA 2HS0A 4LRAA 4KHPF 1U6BA 4LRDA 4MKVA 2QMXA 3UD5A 4RNNA 2N4DA 3OV7A 2HHHF 4NXNJ 1IKXB 1XMBA 3D6FB 4K2XA 4OZ0A 2JNJA 3VR1A 3CCMS 3SIPB 3EZ5A 3QFHA 4RWXA 3TUPA 2DNPA 2BRLA 1IBMF 2KFNA 2GO8A 4R8UB 3IWNC 4OHZA 4L72B 1RBAA 4DZDA 1RYSA 4C8KA 1AA1B 1WOOA 1SKWA 4GKKJ 1GH8A 3GJTB 3PV8A 2A6MA 1K9MT 5F8HA 3R5BA 3MR2A 2MYFA 4HT7A 3E3XA 2C2KB 1X5TA 1BMQB 1S9EA 1RU1A 1ZETA 2F4VF 4I4BA 5CZVA 2F5GA 4LSLA 1N33F 1QLNA 1NJWA 2BJ7A 1RI7A 1CG2A 1U1LA 2EBGA 4HDHA 1R7IA 3E8OA 2X1FA 2PGCA 2VZ9A 1DHMA 3MF5A 4B08A 4DDFA 4ZVTB 2FHMA 1YTYA 1JLCA 3NGTA 4ED1A 4KGKA 4DXLA 3M8SA 4FYVB 2WB1D 3TYTA 1S9EB 1BQXA 4DCJB 3A13A 1AB8A 2OEMA 2AGOA 4LSLB 4AL7A 2GS8A 4FVCA 1J27A 2BM0A 1Z2LA 2WRMA 3ZZOA 4C3LA 1FXRA 1NCLA 3H2VE 4C3KA 1UAWA 3P96A 5B08A 4DUYF 2MJNA 4HYKA 1S1XB 4LR7A 2XMMA 1K8AT 4ALZA 2HPUA 1ZA1B 2XY6A 1YDLA 4K8RA 3MEDA 3CSKA 4DSIA 1YIJS 5D4LA 2L3MA 4M8LA 3RRKA 4J9MA 4GVLA 2CYYA 4P9SA 3CJ4A 2OFHX 2BE7D 6FDRA 2BZ2A 4ICLA 1KHVA 3MEDB 4DV4J 2B9XA 2BKPA 4DF8A 2HQ3A 5A0YA 2HG4A 2WBRA 1VFJA 1HHTP 1YBAA 5AE2A 4ZKAA 3S1TA 2JZ5A 2V34A 3PVXA 3NMAA 1UVKA 1X9WA 4LFAJ 1RXOB 4Y2MA 5EWFA 4ICLB 4DPTA 2ROPA 3GILA 2LXIA 2ZDPA 2XZTB 3L4BC 3SV4A 4AXIA 3IM8A 2R7RA 1RT5A 1RHRB 4R25A 1SI9A 2VQEF 5A0YB 2VKRA 3A8JA 4ZCIA 2FQQB 5M2RA 5HL7Q 1GX6A 5JXSA 3CPWR 1KDNA 2ZFHA 3L95X 1WF1A 2O1PA 2OH2A 1VBZA 1AZSA 1RT5B 2ACMA 4EBEA 4YEAA 4ILRA 2HFUA 4UUWA 1IR1A 3C8YA 3UR3C 3UWTA 5BYSA 4UOFA 4WP8A 3TQEA 1RWUA 4DQQA 2YWWA 2B9EA 5ADZA 2FVSA 1AZSB 3AXMA 4Q43A 2QMWA 1TL7A 1WC5A 1JLQA 4UT4A 3BKFA 3CDEA 1HARA 4CH0S 2VPWB 3S6EA 3OJUA 1NH7A 2ZH5A 3MM7B 2MHEA 2IFXA 3PW0A 5ETSA 5K9FA 5JVGQ 1T8EA 3KJNB 5HN0A 2AW0A 2VFUA 1VHFA 1XK8A 4NOHA 3H4BA 1LOUA 3TZWA 1TL7B 1JLQB 2XY7A 4DV7J 5JJBA 1TMJA 4WZQA 4K59A 2ZOGA 4DL2A 1T0TV 3F56A 4JI1F 5F8JA 1LW0A 4J9UE 8RUCA 1T9TA 5KG7A 4PAAA 2GC8A 2VU5A 4O3RA 3UVJA 2IC3A 3VGTA 2VASA 4F0MA 4IG0A 5D8HB 2VFTA 4I64A 4ECVA 4NRTA 3HT0A 4J91A 2CXEA 3CD5A 3PFEA 2F4FA 3ILOA 3RBEA 2Q3PA 4LF7F 3EICA 3G96A 1LW0B 2MKYA 1D3WA 4F50A 4X4OA 3UVJB 2IC3B 1AUSL 5L38A 3W65A 1NK0A 1YZ6A 2ABYA 4IG0B 4PG4A 1T9XA 3IRWP 4FF1A 3QT8A 1F2GA 5AXMA 3O1LA 1XR6A 4A4JA 2YX4A 2VA2A 4G65A 2QMUB 3BKUA 1U1NA 5IT9Y 1BUXA 2KL8A 7FDRA 2EFVA 5KG1A 1R27B 4OZ2A 3OL8A 1O5JA 2H4WB 2CQGA 3AQPA 3RR8A 2PO4A 3NY0A 3M4XA 3R7SB 1XR7A 1VRUA 3GV7B 2FJDB 2YWEA 4M5JA 3AOBA 3TO8A 4ZITA 2XCPA 1N5YA 2EFPA 1PO6A 1Q95G 1RT1A 2AEFA 4C48A 1QE1A 3BBBA 4D3HA 1LKZA 3ZTOA 1VRUB 4NLRA 3BO2A 4KY3A 3B4DA 3SFUA 1PSDA 4C3MA 5KFAA 1U2FA 5CZXA 1C4CA 1KD1T 4C0OC 4DBQA 3KLEA 2XNRA 4ZP7A 2CWXA 3HHNB 3H2UB 2L41A 2BJEA 4DR1J 4USTA 4J9SA 3UN5A 1QE1B 3I9V9 4LT6A 4B9MA 2C2MB 3KK1B 1WTFA 2JEIA 4L76A 4JI4J 4KQZA 4WBFA 3EWGA 5KT3A 1SUQA 3HHLC 4OV1A 2HWHA 3LA0A 3OTCA 1HQEA 3KLEB 2UUAF 1GQEA 4WK3A 1OYEA 2B4UA 2ZC4A 2L9DA 4IOAQ 1S48A 4H54A 3G8SA 4BBYA 4G1IA 1NUEA 3AOCA 4UZBA 1NZAA 1SUQB 2CNNB 2OAUA 5RUBA 1K0VA 3GE9A 1HD0A 1NK9A 4Y65A 2XSFA 1VIXA 2RUGA 3TI0A 4LSNA 1VQPS 4NX9A 2IA0A 4J7CA 3W2VA 1XNQJ 2HK3A 2K1RA 1P1TA 4TY8B 1DQAA 2YH1A 3UNGC 1YJRA 3GIJA 4ETXA 1UVMA 3OVAA 3T1HJ 1F6TA 4XDDA 3HSZA 2CPXA 2V4JA 3JAMY 1XMOF 2D41A 4LSNB 5SZTA 5G0RA 4QW9A 1K1SA 4KH1B 3W2VB 3PW2A 1DTTA 2CJXB 3M1VA 3LW5C 2K1RB 3T5LA 3HXMA 3NBPA 4M5GA 4QPTA 3BYPA 3G71S 2DEIA 4WFAQ 1A7GE 1VISA 5B0AA 1LW2A 4DSJA 2BABA 2V4JB 2G1HA 2MZ1A 5KG6A 5G0RB 2JFDA 3PW7A 1GNKA 3J7A1 4NRUA 3M1VB 2BQRA 2AJ4A 4CO0A 4QYZJ 5IV4A 3NBPB 4RUHA 1FD2A 4M63A 1SL0A 5T41A 4KSEB 3FJ2A 4YB7A 4IG3A 1U1QA 2NSBA 1LW2B 4CQ1A 2X3DA 3T1YJ 3TUJC 1RWMB 3TEGA 2RH3A 5DDRC 4F04B 3G87A 5AXNA 1HBUA 4ZJOA 1SH0A 3HCXA 5CAAA 2CIMA 2MQNA 3BN7A 5DZ7A 4I0WA 3SCIE 3PNIA 4ZPTR 4F4WA 3J81U 7FD1A 5GAHI 4O23A 4EZ6A 5I4MA 2HBYB 5CYJA 4KBIA 3RTVA 2UV8A 3KMSA 3QZ7A 1NKBA 1HBUB 2ZDOA 1MLAA 1YJNS 1FESA 2Z2YB 4KKOA 3UDLA 2LKZA 3VALA 3PW5A 2J7UA 3CJSA 4FVMA 1M5HA 2WBMA 3VVUA 2FC9A 2FY1A 3DCAA 1PGZA 3IAM9 4ZJLA 4M5DA 3DOKA 1FX2A 4ZPAA 1SQFA 2XMJA 2J6SA 1KOOA 3BN4A 4A8SA 1S1VA 2ATCB 1N5SA 3A3NB 2DVIA 3MEKA 3DOMA 4RW8A 3EZOA 4D3GA 2YKPA 2B6AA 2XLJA 2QG9B 2DXFA 3KK2A 2LA6A 4W98A 5GAEU 1Q8BA 3FBEA 1VQ7S 1YRXA 3MAHA 1AFIA 1IBLF 4Q44A 3OTBA 3UD3P 2KH9A 2NXJA 3DOKB 2QYGA 2ZNZA 1S1VB 2ZVIA 3SDEA 3DOMB 4RW8B 2VFSA 4O3NA 2B6AB 1CVJA 1MMDA 2VC1A 4AD6A 4M5LA 3RAXA 3HP6A 3KK2B 4OZ3A 5KG2A 1A0OB 3WZ0A 4V1Ak 3SYZA 3A3PB 4DQRA 1IBCB 3K8WA 1JXEA 2AYGA 3UCUP 2R8JA 1SC4B 3VQSA 2N7YA 3WHIA 1FD8A 3DGPA 4OHWA 1ROFA 2YQ3A 3SDEB 1VQ6S 3IS9A 5DS7A 5B0CA 4O0IA 3SSRA 1X4HA 1JLAA 2YWGA 4DFPA 3TZZA 4JI7J 3DMJA 2P2CB 5DDPC 3NNAA 4DL4A 2P8IA 1TK0A 5ETPA 1HWKA 3DGPB 4R0EA 1C1CA 4C98A 3H5XA 3IS9B 3CW2C 4U95A 3ISZA 1B3TA 3B8HA 4RNOA 1JLAB 3DMJB 4DR5F 3D6MB 4P6QA 1BE4A 3VGSA 5H9EK 4P72A 3IG1B 1NHUA 4RL1A 2OPPB 2VQFF 2HYIB 3R2DJ 2WOMB 1YJUA 3ZC4A 4YDXA 2GAGC 2A2DA 4JB8B 3UDCA 1S6PA 1TZ0A 2FHOB 3W5YA 4J9NA 4XAKA 1OPZA 2B7BB 1VRQC 1TU0B 5K8OA 1GMWD 3OHBA 4USUA 1FT8A 1FNOA 2EPIA 3GFZA 4A8XA 5L39A 1S6PB 1N54B 1RTJA 2AD9A 2GHWA 2HGNA 2E66A 2JC0A 2QLBB 3IN5A 3GSIA 4YFUA 1X4CA 5KFIA 9RUBA 2P9CA 1YJWS 2CNKB 2HS3A 2V50A 1NJIT 1PAEX 4Y2IA 4B02A 2W2OP 5KFOA 5D4PA 1XNRJ 1X7VA 1ZPWX 3HHKA 2RRBA 3EX7B 4F3OA 3KG4A 4M5NA 3G4SS 1RTJB 2YPZA 3KHGA 1S0OA 1JLFA 5IM0A 4C4WA 3BS9A 1J5EJ 2CJ9A 1P8GA 4MMOA 3BF4A 5LMUF 3V6KA 2EFNA 3K5PA 3X1LB 5J2NA 1TKZA 3LQVA 2BV3A 2XM3A 2J8SA 3IMQJ 2CPEA 1L3UA 3CO9A 2HNZB 2EVZA 4A8OA 3OTOJ 3GIIA 3UW1A 5IT4A 1EARA 1JLFB 4RR5A 2R7QA 1R6VA 3NGDA 2IRUA 4B3SJ 1TKZB 1RAJA 3R5JB 1UCNA 2OP5A 3D1QA 3PX0A 3NRBA 2QJ3A 3EPIA 4LR8A 2QSWA 5KOXA 1FEEA 4WTYA 2F9JA 4FN5A 4ZP8A 3F44A 4B9LA 1ZA2B 1HNIA 2M8DB 2Y0BB 4PYAA 3EGNA 1I94J 2GHVC 3FCHA 3NXZA 3BSNA 2B9WA 1X9SA 2E9RX 4JI5F 2CQHA 2ZC3A 4LQ9A 1TK5A 3MD3A 2GQ2A 2ZKTA 1LNQA 4K4YA 3M2UA 1SVDA 4RPFA 3R1LA 2JFKA 2FLLA 4ZVPB 2I38A 1G2EA 4PXBA 2D9OA 2B43A 2DXEA 4U8VA 4O3SA 1DFDA 1KFDA 4USVA 5CQGA 1SL2A 3M2UB 2DGOA 3PIPQ 1SKSA 5KFPA 1QY7A 1QUPA 1VHIA 4C8MA 1XBWA 5T14A 3MMCA 5LOQA 5IT9U 1KVKA 4F7VA 2O3DA 4J9PA 2D69A 2VBWA 4NXNF 3MDFA 3SQOP 3MEEA 4N8OA 2WSCC 2IM3A 4QU7A 4WIIA 1TELA 4OYIA 2BYCA 4HHJA 4LSZB 4ANCA 3KNGA 2BR0A 3MMCB 5HMZA 1YSJA 2WVFA 2R8IA 2HGLA 2NQPA 1VIOA 3OPKA 3FCWA 4KJIA 2A1BA 5IZHA 1U8WA 2KHDA 2HQCA 1K0TA 1X0PA 3MEEB 5ETNA 4OJ1A 3MM6B 3RW7A 2I8EA 2QE5A 3NCQA 4NYOA 4C97A 1KVIA 3PW4A 4UZCA 1VQMS 2IM1A 3MCNA 2BJ8A 2W7AA 2DHAA 2COLA 1KOHA 2XS2A 1ZM3A 2CJQA 2N3LA 5T7LA 8ATCB 4CM2A 5I3QA 4DL7A 1XWLA 1S0VA 5E5NA 1S72S 1H2UX 1IKVA 1YRUA 1YGYA 1H0HB 3OSPA 3CJKA 4P2SA 2DPJA 4DV6J 1GTHA 5F8MA 3GJQB 3NEKA 1VC0A 1HR0J 4N5SA 5T7LB 4DR6F 4G3IA 2IJFA 3CCVS 1KVJA 1VK8A 2JOQA 3DN9A 1L3VA 2VOOA 2Q6CA 3QT7A 4UY8T 1UJ5A 1IKVB 1SKRA 3EDRB 3NOCA 3RGIA 3CJKB 1H7XA 2ASYA 4E2FB 2A6OA 4FZVA 4WXWA 3BV8A 2M2BA 4OHYA 2MQLA 3MCMA 3O2IA 1XR5A 2A18A 4Z7YA 3HLUA 3TEHB 3BYRA 2AF6A 4DFJA 4A8MP 1U09A 2UUTA 5IWAF 3DLGA 2OD6A 3V4IA 1BQNA 2Q66A 4ECZA 3ZTRA 4ECYA 5A2QY 1U7LA 3J80Y 4DV4F 3TUZC 3IM9A 2KM8C 1AFJA 1G7CB 1TFYA 1Y5LB 2ZUAA 1UW4A 2I2YA 1WHYA 3SCKE 3JAMU 1MWZA 5A6WA 3WC0A 1U4BA 3MAAA 3RB3A 1U6ZA 3DLGB 1YQHA 3V4IB 1BQNB 4KGXB 1DARA 5A8RB 2E7VA 3NAHA 4L3NA 4OX9F 4TNOA 4OYXA 1N34F 2XMKA 4LF1A 3UN2A 2ILZA 3TRGA 3MECA 4QR2A 2GMLA 4NL5A 2MKHA 1R0BG 3LGMA 3NLCA 4ECTA 1VQSA 2CRLA 3DRSA 1FK9B 3MAAB 1LFWA 1Y00A 5J1EA 4Q2LA 4DMZA 3HM9A 2PA3A 1WKKA 3CNQP 1QDUB 2UU9F 2JX2A 4PZVA 2BE9B 1R8BA 2W2PP 1TL3A 2VBZA 3HVWA 1YHQS 1RKJA 5C2CA 2XLIA 1KR4A 2UUWA 3HHDA 3DRSB 4PCQA 2IIHA 2DH9A 3JTOA 5J1EB 5AXLA 1FWLA 5KFYA 5D4OA 2XHWA 1NAQA 1S59A 2RJZA 2OTLS 1TL3B 1CJVA 4OLPA 4Y6IA 3EVMA 2PMZD 3MTJA 3R1HA 1RSCA 4F2SA 3R5GA 2BXJA 2V0NA 2I5JB 4YUDA 3IAS9 2HBZB 4LF2A 3GSDA 4ZVHA 3FUYA 4W4MA 3N28A 3FFIA 1I5OB 4DV7F 1LK7A 3CJTA 1CJVB 3QGPA 2F4VJ 2YXLA 3FGVA 1N33J 1FFWB 3OFEA 4QWCA 1YK9A 4GC7A 2MKJA 4MFBA 5F0UA 4TYBA 1OSDA 1NSQA 2KVQE 3KHLA 1N4LA 4CH7A 1IJEB 3EZUA 4K5SA 1AYEA 2JEGA 3FFIB 2JVRA 3RRHA 3HZGA 1KQGB 3BGRA 5HMYA 1U48A 2XTJP 2QO3A 3NWGA 3H5YA 1UPPA 4MFBB 1IJFB 2HMIA 1X4FA 5K8PA 1GMWA 4ED3A 2HFZA 4FDFA 4HLBA 1NU4A 2C28A 3MEGA 2DGXA 5C5JA 1FHTA 4Q8EA 3EDQB 1LWXA 4JV1A 4YQWA 2ZD1A 3GJSB 3GU0A 2KG0A 4G1QB 2CDQA 2DNHA 2OPRA 3MEGB 2WZ1A 2Y9HA 4KO0A 1GFWB 1RWOB 2WHOA 4ED6A 1RJJA 4S0MA 3Q8QB 3H2LA 2KDOA 2ZD1B 1CQMA 2F8MA 4PEOA 5F41A 5ETTA 5MLCV 3TVZA 4B9TA 1ZAWA 2R7SA 2OPRB 3FC9A 1IQZA 2VPYB 2NR0A 2JHEA 5AJ3F 4A47A 3FQLA 2C2ZB 4BC9A 4ZCMA 4KO0B 3N6LA 4BWJA 5LSRA 1T05A 2VQEJ 3NCRA 3IGNA 1S10A 5KFRA 4DR1F 4JOUA 2CPYA 3HSJA 2DH8A 4LFBF 2PMHA 4DUZF 2XSJA 3GR0A 5J1NA 4WP3A 3EGVA 1RA6A 3CT9A 2MY8A 3AXKA 3UN3A 3PX4A 3DLHA 4M95A 1T05B 2NYIA 2BMBA 1HQ2A 2ZM6F 2CZ9A 4F02A 3KDNA 2QSFA 1NK6A 3HFZB 4U9RA 4K7QA 2HVEA 4ZN3A 1EQ0A 3LPYA 2ZWPA 2XSJB 3VAFA 2XMAA 3UFCX 1UFKA 3CDBA 1W26A 3NG8A 2Q6BA 1LK5A 3TARA 4OI6A 3TUIC 5ETRA 3OL6A 1D1UA 4RU2A 3K5LA 1AT1B 2YNFA 3TR5A 2HNYA 4FNIA 5LT5A 2HVIA 5E3CA 1H3DA 2WVDA 3T19A 2GVDA 1FA0A 1HNWJ 3SI8A 3QT5A 3IWXA 3QJLA 1XNQF 2V8PA 2B4OA 1WUUA 2AJ1A 3Q22A 2AJ2A 5GMEA 1TL4A 2ZH3A 3EVOA 2NUHA 3R6GB 4JI1J 3D66A 2V69A 3KNAA 1HW9A 4C0BA 1NSAA 2O01C 2YVSA 1RTIA 4DSFA 1KTVA 4L73A 1JWWA 4ZPDA 4Y28C 1H2VZ 2W4PA 4P73A 4H4MB 2Y1IA 1EETA 4HR2A 4NLPA 3HULA 2XULA 4DV5J 3AB2B 4LF7J 2AHOB 4HI1A 5L1LA 4CH1A 1PIEA 3R7NB 4JI2F 3TJ9A 4OYPA 1RTIB 1ZM9A 1X60A 1R8AA 3H40A 4ECWA 4HTIA 4ED4A 1EETB 1R31A 2LMIA 4L3KA 4F3MA 1HQUA 3OVBA 4P7TA 3M9NB 4IFYA 4A8QA 3DC2A 1IKWA 3TA0A 1L3TA 4U6PA 3RZAA 1D9AA 4RWWA 3GIMA 3MCSA 2K3IA 4OI4A 3KWMA 5I42A 1MNEA 3HF5A 4X4TA 2BBEA 1FNXH 1HQUB 1JMTA 3D0IE 2MPUA 4IFYB 3ILJA 1IKWB 2XY5A 3LH2S 3MUTP 2BKOA 4EBCA 1JIHA 2YNIB 2UUCF 2DYAA 5KFJA 4W92B 2YY3A 1UTAA 4XK8C 2J6TA 3OR1A 2UVWA 1NKCA 5FLXY 3Q8UA 1T3OA 2Y1LB 3HHEA 1OIAA 4WF9Q 1G4CA 4EO6A 3KHHA 4DL0C 3V6JA 2BANA 2CPJA 3EYZA 3M6XA 1B0VA 3QSYB 2OEJA 3U7JA 3OR1B 2FUG9 2ZZTA 2UXCF 2HHVA 3B6BA 4OHVA 4CO2A 1RCOB 2V68A 2UUAJ 4NEYA 4UY85 4DV2F 1EP4B 3THPA 4C6AA 4QR1A 3CVKA 3N4WA 3MR5A 2DNQA 3HKZD 2BANB 3G6VA 3HHLD 3K58A 3BSCA 1MW7A 5E3PA 4AUKA 3DI6A 2QX0A 5E0OA 2E9ZA 4FS1A 4TYAA 4NI2A 1RHMB 4W90B 2CQDA 1T9WA 2CQ4A 2VB6A 1TV6A 4TQSA 3MR7A 3VCDA 2J9EA 3I87A 1RAHB 3QGHA 3NWRA 4TN2A 4HEA9 4K5RA 3D7SB 3M2RA 5F3TA 3MPDA 2H3EB 2ZWOA 4F0KA 3DI6B 5D6GA 1NSPA 2YKMA 1PCAA 4QZVB 4NI2B 1PYOB 1YLXA 4USWA 5HP1A 2E5IA 1TV6B 1U1OA 1WG5A 2EG2A 2I9SA 1YI2S 2FZGB 1J2VA 1T03A 2XO6A 5DETA 2EC2A 3BGUA 3TZXA 3RB6A 3M2RB 2VG5A 1S4EA 2C3PA 2RMLA 1XMOJ 4DLGA 5A8WA 4LF9J 1YX2A 5DJBA 3GQCA 1IKYB 5F8LA 5HP1B 1TKDA 4F4KA 4N77A 1GEHA 4V19X 1OQ3A 2IM2A 5A2QU 1T03B 3L9ZA 2HBRB 5DGBA 3J80U 5LXYA 2GJFA 3MR3A 5IC4B 1YJVA 3ETOA 2ZZMA 1CBKA 5BR8F 2VG5B 1GTEA 2ZBPA 5A8WB 3BQ1A 1NK5A 4OMFG 3M30B 4J9RA 2MQ8A 2QV6A 2R7TA 1KNZA 3OW2R 2MJUA 2PD1A 2C42A 3CCQS 3MUVP 2J9DA 5HI7A 3BR8A 1Y5NB 3CD7A 3QGIA 4F4AA 5L1KA 1NJZA 2EG1A 2NPFA 1X4BA 4F4YA 1T9VA 3AH6A 1CLFA 1WACA 1WI6A 4EI2A 2HURA 2FHKA 1RLDA 1F0XA 2AGQA 1N0UA 2KB2A 1PYTA 3IO1A 1KRPA 1F9EB 4NLDA 4PG8A 3CMES 4YN3B 1H38A 1NK8A 3KLFA 3MD1A 5LM7E 4A8YA 2F8HA 2F1FA 3L7PA 1WEYA 3I5BA 2J7KA 1XC9A 3DDNA 4CO1A 3L3CA 3MAQA 3PRBA 3WQPA 1KN6A 5B0EA 4RBUA 3GYGA 4EFAC 3ISND 3H20A 3W60A 1NHKL 3GFXA 2W4DA 3MPUB 3VWSA 3KLFB 1Z2ZA 2J0WA 1WKJA 2RSQA 4JI6F 2VJVA 4AL6A 2MZTA 2RU9A 3Q86A 3M7VA 3PHTA 3POTB 3HD1A 5HMWA 2BACA 1VCTA 2CQCA 4B3SF 1YBTA 1NH8A 3M05A 4UOHA 2DTJA 4USJC 2KZMA 2UV8G 2BA9A 4PG7A 1IBLJ 4C8YA 5L1IA 5GAGU 3PJ9A 4Y3CA 2PI5A 4QOTA 5IQQA 4ATNA 2IPOB 2FLNA 4ZS6A 3G6XA 1OMSA 3OUYA 3WBZA 4I6YA 3QLHA 2E1CA 3KG1A 1YWXA 5C42A 4RKUC 3ZNUA 4FS2A 2HZCA 2CFXA 1REGX 2ZHBA 1BQMA 2KJVA 3ZTSA 4IH5A 3MURP 2B8QA 4DPYA 2G1DA 4M5HA 2MQOA 5CYQA 4MKYA 5DM7Q 4NEZA 1JKHB 1W7WA 3Q8VA 3T5JA 2RD5C 1UA1A 4A46A 3OUYB 2R4FA 1FJGJ 5C42B 5FDLA 1T9UA 3GFYA 1X9MA 7AT1B 1OO0B 4WKRA 2CNOB 1KC8T 4EWTA 2ZJQQ 3H7HB 1BQMB 4EMDA 2VKZG 1FF2A 2FJWA 1Q82T 1FKPA 2RF2A 2W24A 3RAQA 4PG6A 2OSQA 3VQTA 1U6FA 2ZJPQ 1S0NA 1BWEA 2E1RA 3R3TA 5FDLB 2XI3A 3N6MA 5EX0A 2NXCA 2YKQA 1UWAA 3FCVA 3QBCA 1V5VA 3ZTQA 3UQSA 4F0HA 1SQEA 4QU6A 1FKPB 3OT9A 1RE1B 1NPKA 1U1RA 2RF2B 1F5BA 2NSCA 3H90A 2CQBA 2X3GA 4LVNP 1YG0A 3K0JA 1V3SA 3Q83A 1KQFB 2EI5A 4WFYA 2KYXA 2V8GA 3JSYA 4C0HA 2HHPA 5HVFA 1UJ4A 4DF4A 5IV3A 2ZOFA 4AQYF 2QFIA 3MMJA 3WIVA 4CLLA 2OUGA 2ZBQA 1RWNB 3GIKA 1VJWA 4NMXA 4I2QA 2L9WA 1LQ9A 2JJ4D 2FGOA 2X7IA 1M5PC 3SQGA 3UDVA 3P4UB 4ZVQB 1JX4A 4AXJA 1RT2A 2KU7A 2C3OA 2HBQB 4ZIVA 1SIWB 1SJRA 4DV6F 2ASLA 2AWZA 1I1GA 4CLSA 1HR0F 3AY0A 4LBHA 4I2QB 1S79A 3TAMB 2FB0A 4DHVA 2AJQA 3GWCA 1M1GA 2BQ3A 3JSRA 2ZH9A 3SQGB 4FNHA 5DRKA 3GR1A 2VD3A 1TKXB 2C2NA 1RT2B 2C1EB 2RU3A 3PEHA 1XJWB 3U1NA 5KFWA 1E6VA 3RU0A 3SEOA 3TX8A 1WHXA 3AA8A 1G1XA 2RQCA 3DU6A 2FZCB 2ALYB 1HNZF 3AFGA 4DS4A 4KTQA 3DOLB 2M5YA 4V19J 2HRYA 1D9DA 2ASDA 2LQ5A 1E6VB 2CG4A 3KDOA 3M6WA 2CUYA 3J7ZT 5DDOC 3Q24A 4WZMA 3ZZZA 1E6YA 4Z7CA 2VA3A 4X64J 5D0EA 1IN0A 2BQUA 4F8RA 1LEOA 2RS2A 1PBAA 2E44A 5BJRA 4DLEA 4MIWA 1E6YB 2WVEA 3GG0A 2H1YA 4NZ6A 2B3TB 2XS5A 2ZJRQ 3KLVA 3T3FA 4GKJF 2DGUA 3RG6A 2XMTA 1X4GA 5I3UB 4URSA 4UOGA 3GYNA 2FVRA 1PYSB 2AMCB 2QT7A 5HK4A 3E01A 1TTHB 3L09A 1IM6A 2VG7A 4DR4F 3HHLA 5H9FK 2EFOA 2HLUA 3NCPA 4FXVA 5FD1A 4K4TA 2POKA 4ZVOB 3OL9A 3D68A 4TKTA 2C2OB 1ITPA 2CAJA 3E01B 3PFOA 3TANA 2VG7B 4P2MA 1GK8A 5KT5A 3HHLB 2RUSA 3CXCR 1SXLA 4NLUA 1EZZB 4NYPA 3OTDA 4KB7A 3QSIA 2KFZA 3PJXA 1XMQJ 3UNYA 5FLXU 3LGNA 2HFVA 1I51B 2ZHAA 4ZP9A 4G1PA 3I5CA 3NGKA 2YX7A 2K8GA 4OX8A 4QJVA 1F3VA 3HX9A 1IXKA 3K89A 1Z4UA 4WK1A 3H98A 4UW2A 1VQ9S 4PXCA 2MSTA 3MMBA 3OXLA 4EYIB 4IRKA 3I4HX 1TFWA 2DBBA 3PJWA 3OVSA 1QUVA 1ZS6A 1Q79A 5AT1B 4NLGA 3VAGA 4DR6J 2MGZA 1MN7A 3G2XA 4PABA 4IYQA 2GNKA 5BXIA 2YKOA 4DL3A 3SFGA 3MMBB 4K50A 2KTQA 3LP0A 1JLCB 3E2EA 3J7YU 1D9FA 2KHCA 2AYBA 2K3KA 1S5ZA 5IOLA 3ETMA 3T6BA 2XEXA 4X62F 1FI4A 4FYDA 5DG8A 2MGZB 1PAUB 4RNHA 2QLFB 4DR7J 1H74A 1VLYA
chains in the Genus database with same CATH topology
1FERA 4OJHA 2A1BA 5C25A 3KOAA 2DT9A 3KKFA 4KIAA 5IZHA 1UVLA 4LF6F 1JKHA 2AP6A 2KO1A 1RDRA 1RP5A 2KHDA 1I94F 3ICLA 1K0TA 5KFCA 2EK6A 2QA1A 1X0PA 3MEEB 3LP0B 1X5OA 3H8YA 2DH7A 3ENWA 5C24A 2VFVA 4OJ1A 5IFMA 3BREA 3MM6B 1OWXA 3RW7A 1S99A 3QJPA 1FDDA 2I8EA 1M5OC 3VTIA 4ILLA 2QE5A 3N6NA 2YNGB 4QCLA 3MI7X 3NCQA 4NYOA 4C97A 2DGWA 3CULA 1KVIA 5EX3A 5DG9A 3PW4A 2V4QA 1ZYQA 4NCBA 4DV3F 3MM9A 2FHJD 1VQMS 2IM1A 2HNDA 2FC8A 3MTKA 4RZRA 1HBMA 2I0XA 3LO3A 2W7AA 2QA4S 1Y0HA 1BY9A 4F3QA 5D4NA 1SH3A 4X66F 2DHAA 1HBNB 5KOWA 4X4PA 3CCLS 1RT6A 2COLA 1KOHA 2LEPA 2XS2A 1ZM3A 2VODA 5C25B 2CJQA 3O8WA 1RTHA 2VPXB 3O5TB 3QPIA 2KT3A 2N3LA 5T7LA 4DG1A 5I3QA 3IGVA 3CC7S 4JV0A 4KPYA 4X4RA 1S9GA 1XWLA 1C0TA 2MSSA 4F26A 4DL7A 2MQMA 4DEZA 5KT2A 3IRXA 4MIAA 3RRGA 1S0VA 5E5NA 2H5EA 4DPOA 4I68A 5C24B 4KHMA 1UVJA 5KT6A 1WF2A 3GV5B 2C22A 1S72S 2DD8S 4I1TA 1H2UX 5B09A 1FO1A 3CJ5A 4YB1P 4Q0BA 3P5TL 1IKVA 1YRUA 2YNFB 1YGYA 5J1PA 2FVQA 4O44A 3MM9B 4YB6A 1H0HB 2HNDB 3OSPA 1A9NB 1HBMB 4KE5A 2HNYB 5EHHA 2FJVA 3CJKA 1C4AA 3OFFA 1U24A 1R6YA 4P2SA 4ED7A 3O6QA 2DPJA 4B9VA 2DHSA 4USHA 1ZZNA 5B0GA 3I9ZA 1GTHA 5F8MA 2V5HG 4Q2MA 1RT6B 4B9NA 2DNLA 1VC0A 1FXLA 2IVFB 2M7SA 3BQ0A 1RTHB 4N5SA 2AX0A 2UXDF 2F8EX 3UCGA 1SV5A 2N4CA 5T7LB 4DR6F 4DG1B 3ULHA 1FKAF 2IJFA 3CCVS 2J7WA 4KGMA 4RBVA 5IXUA 4G3IA 1C0TB 2M52A 1KVJA 1VK8A 3IRXB 1KQSR 4NLOA 2JOQA 3DN9A 4NWBA 5KAKA 2PFFB 1L3VA 2VOOA 2Q6CA 2DHGA 2IYIA 5M2UA 1C2PA 3OTEA 4C8OA 2MKCA 2KKHA 1U1PA 1LV5A 2CPIA 2IRYA 4F4XA 3JB9k 2VBYA 4Q0BB 1T02A 4UY8T 1NK7A 1UJ5A 1IKVB 2GIQA 4ZPCA 1SKRA 4O44B 2B4VA 3VAKA 4ETZA 3T5HA 1UJ6A 1S49A 2GO9A 1M5SA 3CJKB 1H7XA 2ASYA 1VQ4S 4CCHA 4EGLA 2JWNA 2HVZA 4DQPA 3TA2A 1V3ZA 5F8GA 5HBMA 2N3OA 2KXHA 4FZVA 1G6BA 2XNQA 1LWEA 2CZ4A 4WXWA 4M94A 2M4MA 4DL6A 2VPZB 1SV5B 2M2BA 4FXWA 3V81A 5LJ5Y 1RYRA 2R7WA 3LAMA 5KFSA 4OHYA 5DM6Q 2MQLA 2VG6A 3MXHP 1FRMA 2GHPA 2HLTA 2RB7A 3O2IA 1XR5A 3I0RA 2A18A 3QYYA 3NNCA 3HLUA 2R2SA 1N48A 1JLBA 2OKQA 5E7OB 2NUUG 4RW9B 3KLHA 1NB7A 3ZZPA 4K4WA 4K4UA 1YRTA 2Z8QA 5KFDA 2AF6A 4DFJA 5FJ4A 2VFRA 3DLJA 3NAIA 4X4NA 4A8MP 1U09A 2VONA 2JVOA 2UUTA 4NLXA 5IWAF 3W3SA 2WSEC 2J5AA 3DLGA 2MXYA 4ZMMA 3H4DA 2EK1A 2M9KA 1BQNA 2OD6A 3QO9A 3V4IA 2Q66A 1VI7A 3U27A 1N0VC 4ECZA 5HBMB 4PG5A 4ECYA 5A2QY 1O8BA 1U7LA 2KT2A 2MMYA 3PX6A 4UOCA 4IR1A 3TVKA 1LWEB 3J80Y 4DV4F 3AB4B 3I6PA 3TUZC 3V81B 2KM8C 3JSMA 1ZAXA 3NP5A 1IBKF 1BC6A 2VG6B 4ELUA 4PQUA 5A8KA 1Q7LB 5A6PA 4DOZA 3PR4A 1AFJA 3V2UC 1HNWF 5DGAA 1G7CB 1TFYA 3I0RB 1Y5LB 1FNMA 2CJKA 2I2YA 1NNDA 1UW4A 2FLOA 1WHYA 3SCKE 1JLBB 1UMJA 2MKKA 2G4BA 1U25A 3TAMA 3KLHB 2IMWP 2HHQA 1WELA 4E98A 4YR2A 2KJWA 1MWZA 4PQAA 1VMBA 1IR0A 2JRSA 2KN4A 3FZBA 5A6WA 5L9NA 3WC0A 3PR5B 1U4BA 3OXGA 4MTPA 2KXNB 3RB3A 1U6ZA 4DSEA 3I82A 2WTFA 4HDGA 1KFSA 4IRCA 3DLGB 4EO8A 1YQHA 2GJ2A 3CE8A 3V4IB 1BQNB 1X4EA 2EFQA 3QO9B 5EUHA 2ZH8A 3LP2A 4TU8A 1DARA 4DFKA 5HMXA 1TKXA 5A8RB 3CDWA 2ZH7A 3O44A 3IG1A 3NAHA 4L3NA 2CPZA 2VH7A 2OPPA 3G86A 4OX9F 4ILMA 4TNOA 3W7BA 2O5DA 1N34F 4IFVA 5E3RA 1UETA 2XMKA 3FSYA 2IVYA 3G8QA 4LUBA 5A8KB 2E9TA 4PQUB 2PE8A 4OX7A 2ILZA 4HVZA 3TRGA 3MECA 1KTQA 4IO9Q 2WOMA 1ELOA 4QR2A 3Q8RB 1SIZA 4B3OB 3DXBA 5EWEA 2ZUGA 1N32F 3T9NA 2Y0SD 2GMLA 4NL5A 2MKHA 4ZA1A 4B3MF 2W9CA 3LGMA 1CQNA 1UP1A 3NLCA 5I42B 1VQSA 4ECTA 2CRLA 3DRSA 3C46A 1FK9B 1UVIA 3DM2A 4OL8A 1LFWA 1DTQA 4RW4A 2YKNB 6FD1A 1Y00A 1W25A 5J1EA 5J2QA 4Q2LA 3F73A 4DMZA 3HM9A 2PA3A 5ITHA 3LP2B 2UU9F 4Q8FA 1F5AA 3DOLA 2JX2A 3P3DA 4KV8A 4DV5F 4X4SA 4A8WA 2W7OA 1R8BA 2D9PA 4KC5A 4X2BA 5E3QA 1RQ0A 2NXUA 4IFVB 2QLWA 2LU1A 4N8NA 4QYRA 2OIHA 1F60B 1TL3A 2AX1A 2VBZA 4KRWA 1Q7YT 3VZIA 3HVWA 4KFBA 1YHQS 2FDNA 1Q8LA 3ZZRA 2VL1A 1RKJA 5LMNF 4NA1A 4ED0A 3ONQA 2M8HA 1ULRA 2XLIA 2P9GA 3CC2S 1KR4A 2UUWA 3IBWA 2W9CB 1NK4A 3HHDA 4DR3F 3DRSB 1R8HA 2YWHA 1OPIA 4PCQA 1RTDB 3DM2B 2QA4G 1X4AA 1DTQB 4RW4B 2DH9A 3JTOA 1H2TZ 2RRAA 5J1EB 5J2QB 2J0SD 4E8UA 5AXLA 1O0PA 2JC1A 2IHR1 3FSXA 5KFEA 4B3TF 3P6YC 1KEKA 5KFYA 1VGYA 5D4OA 2F40A 2UVRA 3FMBA 1G3OA 4KV8B 2XHWA 4GMKA 1NAQA 1ZM4A 2RJZA 4ZVEA 2OTLS 2JL9A 3Q8SB 1L3KA 1JJ2R 1QAXA 1M0SA 4JI8F 1GX5A 3Q0AA 4QPXA 1TL3B 5U47A 3D54A 4KFBB 4OLPA 4DV1F 1U2RA 1PC4A 3FVYA 1FRIA 2GGPA 1LWFA 4Y6IA 2PMZD 4CO5A 3N5FA 2IBKA 2L48A 1HNXF 3MTJA 3R1HA 2XZWA 1YITS 4WJBA 2DNNA 4YR0A 1DJ0A 4F2SA 5GAHU 2NLWA 2BXJA 3R27A 1BGXT 4ECUA 2LU2A 5HQ8A 5GAGI 2V0NA 2I5JB 4YUDA 2MDAA 4PPZA 4AE5A 4OJGA 3IAS9 2J6SA 4Y34A 4CI0B 4DJBA 2IBOA 3GSDA 4ZVHA 1MROA 2J76E 1A6LA 4Q7AA 2RDJA 3MMAA 3N28A 3MUMP 3VAMA 3FFIA 3T5KA 4LQ3A 2J0XA 3M8PA 4DV7F 3AHPA 1Y7PA 1LK7A 5K5MA 4RW6A 3X3UA 1JLEA 3QGPA 4MYUA 4O3QA 3HT3A 3QGGA 3KTQA 3M8QA 2J6UA 4J5OA 1AW0A 2GGPB 1LWFB 1SJQA 4M1KA 2DNMA 2DGQA 2HNZA 1LXJA 2KRRA 5I3UA 3U1LA 2VUGA 3FGVA 3HDSA 4WYLA 2DGSA 1SH2A 4I69A 3OFEA 4QWCA 4J9KA 4EBDA 4GC7A 2MKJA 2C3UA 4MFBA 4TYBA 5F0UA 2DCUB 3HVAA 4A48A 2L08A 2MZQA 4BCAA 1OSDA 2DGVA 2E5GA 3KHLA 2APOA 1VQKS 1N4LA 3V4MA 1IJEB 2GIRA 4CH7A 3CMAS 2E5HA 1MROB 3EZUA 4K5SA 4CTAA 3BQ2A 2JEGA 1FJ7A 1IKXA 3MMAB 4B3RF 3FFIB 2G13A 2JVRA 4DWIA 3RRHA 3M8PB 3HZGA 4P7VA 2V8HA 1HWJA 4OFZA 2BRKA 4RW6B 2V8DA 4QIGA 1KQGB 3BGRA 5HMYA 1JLEB 3J81Y 2C2RA 1U48A 4X4QA 3M8QB 3M9OB 1FDNA 1N6QA 2QIFA 4MK8A 5IQ6A 1PC5A 2QO3A 4IUFA 4FPRA 2OTJS 1XEZA 4MKBA 2HS0A 3SZ2A 1N5YB 2JEFA 1JJHA 3NWGA 2MHNA 3T9ZA 1HWUA 4KHPF 2YKMB 3TOQA 1RT1B 2C3YA 3H5YA 1U6BA 3KLGA 2ZNYA 4MFBB 4BDPA 1HPZA 4EZ9A 1Q53A 1IJFB 1QTMA 2QMXA 2HMIA 2R8KA 5K8MA 1X4FA 5K8PA 4RNNA 4ELTA 1RK8A 1JNZB 2N4DA 2E7WA 3OV7A 4IRDA 2HHHF 3C6TA 4CTAB 5DQIA 3WC2A 1IKXB 2ERRA 4ED3A 1XMBA 1NEEA 1PILA 3GG1A 4K2XA 2HFZA 4OZ0A 4Z2XA 5KFQA 2LVWA 3FZ2A 4ZK7M 2DNOA 3VR1A 2HVHA 3CCMS 4HLBA 1NU4A 4WU3A 5MAOA 3EZ5A 2C28A 3MEGA 3V5RA 5DO2A 3ENQA 1N6QB 2DGXA 5C5JA 4Q5VA 2U2FA 1FHTA 1RISA 4Q8EA 2CZVC 2DCLA 5KFZA 4TU7A 4RWXA 4K4VA 1LWCA 2CJBA 2DNPA 4KAIA 2BRLA 1IBMF 4JV1A 2KFNA 4YQWA 2IM0A 2OMLA 2GFFA 2HS4A 2GO8A 2ZD1A 4R8UB 1HPZB 4OHZA 5KFLA 4L72B 3KLGB 3IWNC 2HQIA 4PXEA 4LF5F 2KG0A 4RBTA 1JB0C 1S97A 4G1QB 2WW8A 1RYSA 2CDQA 3CGIA 2GA7A 3C6TB 1VK3A 4C8KA 2DGTA 1FJCA 4NA2A 2XC9A 2DNHA 3V6HA 1R8CA 2OPRA 1SKWA 4G6VB 2YNHA 1GH8A 2G9OA 3PV8A 2RS8A 5AE1A 1K9MT 5F8HA 4O4RA 3R5BA 3MEGB 3MR2A 1HQEB 2MYFA 4J37A 3D2WA 4HT7A 4KO0A 3E3XA 1X5TA 3TQ1A 2WHOA 1LWCB 4ED6A 2KFYA 3DLKA 4O3PA 1RJJA 3U02A 1S9EA 3Q8QB 3H2LA 5J2PA 2KDOA 1ZETA 2ZD1B 4NLVA 1CQMA 2F4VF 4I4BA 2F8MA 3OHAA 5CZVA 2HHWA 1HWIA 5F41A 4U67Q 4LSLA 1N33F 1QLNA 1NJWA 1KHWA 5MLCV 2X51A 3J7Z5 4ECXA 3TVZA 1RI7A 4B9TA 1ZAWA 1CG2A 1H7WA 2EBGA 1U1MA 4HDHA 1U1LA 2R7SA 1HMVA 1R7IA 2OPRB 3E8OA 3Q8PB 1CSJA 1IQZA 2YNHB 3NS6A 2VPYB 2VC0A 1SB6A 2PGCA 2NR0A 2VZ9A 1DHMA 2B9YA 2JHEA 3MF5A 1I6JA 4PKDB 1S77D 4B08A 1TAQA 4DDFA 5AJ3F 5J2MA 1X4DA 2FHMA 3C2PA 4ERDA 2MB0B 3HZEA 4A47A 1YTYA 3FQLA 4BC9A 2WAQD 3SSQA 4ZCMA 1JLCA 4KO0B 4ED1A 2DO4A 4KGKA 2DITA 3N6LA 4BWJA 2B5JA 4YMEA 5LSRA 4DQSA 3M8SA 1T05A 3TA1A 3DLKB 2WB1D 3TYTA 1S9EB 1BQXA 1CC7A 5J2PB 1N5QA 2W9BA 3NCRA 3IGNA 5F8IA 2XGPA 2LQ9A 2AGOA 1S10A 4MK7A 5KFRA 1WEXA 4LSLB 1N36F 2R8GA 3OJSA 4AL7A 4DR1F 4JOUA 4WU2A 2OFGX 4LF9F 2CQ0A 2CPYA 2DH8A 4FVCA 4LFBF 4WFBQ 2BM0A 1Z2LA 2WRMA 3ZZOA 2PMHA 4DUZF 1HMVB 4C3LA 1FXRA 2BM1A 2XSJA 3GR0A 5J1NA 3H2VE 4C3KA 3OL7A 1UAWA 1HD1A 1RA6A 3CT9A 3P96A 4YDDB 2DNYA 1F5CA 2IJNA 5J2MB 4JYAF 5B08A 4DUYF 2MJNA 2OPSA 3WX4A 4HI2A 4ZLPA 2MY8A 4HYKA 2D3UA 3SCJE 3PX4A 3DLHA 5F8NA 1V3RA 1S1XB 3MM6A 4M95A 3OFHA 1T05B 4AFFA 4FBTA 4YOEA 3UD4P 2NYIA 2XMMA 1K8AT 2ZM6F 4ALZA 2HPUA 2M3DA 4F02A 2W9BB 2QSFA 1NK6A 1P6TA 2NREA 1OQ6A 3EPGA 2XY6A 1T94A 3MEDA 3EXYA 3CF5Q 3CSKA 4DSIA 5GVQA 2GMHA 4U9RA 3LPYA 1YIJS 3BO4A 2FGCA 3PO5A 5D4LA 2ASJA 2L3MA 1IUJA 4M8LA 2XSJB 3IFEA 2W25A 1DTTB 3RRKA 2EFGA 3VAFA 4J9MA 2CYYA 3HKWA 3CJ4A 3UFCX 3CDBA 5KFGA 1JJ4A 2OFHX 1KSPA 2PC6A 2OPSB 2ZKUA 1HHSA 2JSXA 5GADU 2WONA 3NG8A 4XDCA 1KQKA 3LWMA 3I5AA 2Q6BA 1ZTTA 4OZNA 5K8NA 2UP1A 4GKKF 4TLRA 1LK5A 3PRDA 1IQTA 4CNZA 3TARA 3EGWB 4OI6A 3RAQA 6FDRA 3TUIC 3T1AA 4C8NA 2BZ2A 1RT7A 5CCLA 4ICLA 3OL6A