5IZHA

Lassa virus l protein cap-snatching endonuclease. apo form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
GMEEDIACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKTVNISLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase L
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
source organism Lassa mammarenavirus
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5izhA02
4I1TA 5J1NA 3JSBA 4MIWA 5J1PA 5IZHA
chains in the Genus database with same CATH superfamily
2V2KA 1JJ4A 4O3PA 5HATA 3MUVP 3OFGA 1YI2S 2YNGA 4NLXA 3M32A 5E3AA 3ZC4A 3SCJE 2Y8WA 1SC3B 2L9DA 2W9CA 2DHGA 4X65J 2QSWA 3IGNA 4DL3A 1GXLA 2FPHX 3MPDA 4P7VA 4CT8A 4CO5A 3D3CJ 2HHWA 2IMWP 3QIPB 2EFPA 2XMWA 2CQ0A 1CSJA 1FO1A 4CYUA 3PNIA 3J81Y 3C66A 1Q16B 2UU9F 2HLUA 2Z2YB 4ZVFA 1RB0A 1DJ0A 3KHRA 1ROFA 2RU3A 1KDNA 5KFXA 1VBKA 2LA4A 2XMJA 3RAMA 3V81B 3VR1A 4DPOA 3ENWA 2MZTA 3JSMB 1AT1B 4CP5A 2XMMA 3B78A 5LSRA 3IWXA 4NLYA 2DJWA 2ZE2B 3HSJA 2EG2A 2KN4A 4OV1A 2HS4A 3J7YI 1YJNS 2CZ9A 1K44A 1RAEB 3HHNB 4ECWA 1R8CA 3G71S 1SKSA 2UV8A 3G82B 4CIOA 3HSDA 1CJVB 2LLZA 1UEUA 4OYBA 1KQKA 2OEJA 1KVJA 4IKAA 2JJ4D 3US5A 3WC2A 1HHQA 2X1GA 1EAYC 3GLJA 1ZETA 3G6ES 2Y3YA 4A8XA 4DF8A 4DN0A 1TKTB 2QLBB 1KLMA 3FSXA 2K1RA 1QUVA 1HYSB 2ZITA 4X62F 2YKOA 2OPPA 4UW2A 1SH3A 1S59A 2XY5A 1DQ9A 5A0YB 5BR8F 3GPAA 5F0WA 1EP4B 3N6NA 3ZZYA 1TL7B 3PR4A 3P96A 1RAGB 1WDDA 2RB7A 3ISND 4ELTA 1RWWB 4LR7A 3CIMA 1H38A 4AUKA 1XK8A 3K2YA 3GIIA 3M2RB 1OSDA 1YGYA 2VBXA 1C1BB 3P3DA 2LXIA 4DFMA 3UN5A 3AAWB 3EDQB 4KE5A 2MQPA 1MN9A 1VRTA 2XSJB 4OYZA 4R0JA 1LOUA 3A8KA 3M2RA 3S1TA 1QUPA 3ICLA 1RWKB 3ISZA 1VBXA 2KM8C 1EQ0A 2E5LF 4UOHA 3KK2B 1GH8A 3HCXA 1XMOJ 2JWNA 2FIUA 5J1EB 4MTPA 4TU7A 4HR2A 2G13A 5KFJA 2R2TA 4ZVRB 4CLSA 2HNZA 3K5LA 3D5MA 4RO0A 1FE4A 1CJKB 5E3RA 3NG8A 4DR7J 2G0CA 3EVMA 4RNNA 4GKJJ 5E7OB 3CJSA 2BE2B 3CD5A 2PT0A 4M5HA 3L7OA 4OYOA 3TAMB 1T7PA 4A8KA 4H4OA 2YPYA 1OY8A 4FS2A 3DOMB 1UVIA 2ZJPQ 1RT6B 1VQ5S 3MMJA 5GAGI 2XHWA 5CCMA 2H54B 4F7VA 2MB0B 1N5YA 2CQIA 2ZOGA 2D3O1 3RR7A 3LF0A 3PRVA 4UZCA 4WYWA 1SUQA 3I32A 2W9AA 2B9EA 2IY5B 4ZMMA 1XERA 4CH7A 4DV0J 1S6QA 5SZTA 2RH3A 3AJ2A 2I6WA 1NPKA 3SDEA 2CJXB 5J2PB 3R5BA 1X0PA 2HFUA 2N3OA 3HFZB 1EZZB 2AV5A 3UW1A 2JOQA 1HBOA 2VQFJ 1VJWA 1VC6A 2DGTA 4QJVA 5J2PA 1SL0A 3JQKA 3RG6A 3C15A 1TP7A 5E41A 4EO6A 3DYAB 1FT8A 2AQ4A 3TAPA 2GVDA 2GIQA 1V5IB 3M1VB 2C2EA 2CPIA 5L9XA 2W2MP 3JSYA 2V8VA 1CJUA 3V6KA 3R7NB 3PW2A 2RQCA 1V9OA 4TNOA 2VH7A 4RW4B 5JVGQ 1RWVB 3ENVA 1NZAA 2B7BB 3MTJA 4PQAA 4I2QB 2GQCA 3VV2B 3TVZA 1RT7B 4L3KA 2IDEA 3KDOA 1FKPA 2M3DA 1EETA 4WTOB 5F8MA 1NKEA 3I9ZA 2PMWA 1Q7YT 2F1FA 5K8NA 1TL4A 1VK3A 3U02A 2B8QA 3I0SA 3OJSA 4WZQA 4U67Q 1IUJA 2QMWA 2AP6A 4P2MA 5KFDA 2FLPA 2O1PA 3QBCA 2OH2A 2ZOMA 4LF6J 2OAUA 4KH1B 3ILJA 2BJDA 3MPYA 3R5CA 1QE1A 2CKWA 4CH0S 1SKUB 4WFBQ 1XMOF 4RLEA 4KR0B 4EO8A 2W24A 3U27A 1N32J 3C46A 2C3MA 3UNYA 1VLYA 3EZOA 1RU2A 4N5SA 3FZBA 5GAEU 5HK4A 1G1XA 4QYRA 3LANA 4FBTA 3K7RA 4DR7F 2FUG9 1DAXA 4KPYA 4ES3A 4GKJF 4OIXA 3PM9A 5KOWA 3QJJA 4C48A 3TRGA 1T03A 3MAHA 4B3SJ 2P9GA 5C7PA 4DSIA 3EM1A 5HLFB 1JJHA 5LT5A 1IKYB 3KLHB 1SJ3P 2C3UA 2OPSB 4P72A 2D9PA 1FRHA 3K5MA 2B43A 2IYGA 2OJ3A 2XZDB 1MU2A 3H98A 4F02A 2NZ4A 2XMUA 1EARA 5D77A 1P1LA 4L72B 3TX0A 3BB5A 5AXNA 2KVQE 3D9BA 2COLA 4M5MA 4IR9A 3T5HA 4N56A 1NHKL 1AB8A 3PW7A 2GHWA 4DXLA 4P10A 3RBDA 3TA2A 4YR2A 3RUBL 3IXQA 4KSEB 3MFHA 4L75A 1QY7A 3ZZ0A 4ZVGA 5AE1A 5DGBA 3H5UA 1WI6A 3MCSA 4QR0A 4RU9A 3KJFB 2RSQA 2EXUA 2C2DA 3OTEA 2MHEA 2CQ4A 1X5SA 2R2RA 3DC2A 2VQFF 4WE1A 1S77D 4LFBF 4QWBA 1KN6A 4YHHF 2KT5A 2MTLA 4MJKA 4L76A 2KYXA 2DHAA 3BQ2A 3M8ZA 4HHJA 2OPRA 2QA1A 3FDSA 4NI2B 3R1HA 2WCXA 3IRXB 3DRPB 3K58A 4L3NA 2YVSA 1J5EF 1HIYA 4Y2AA 2CRLA 3BQ1A 3I96A 2GV1A 2VPWB 1U24A 3MAAB 3KHHA 2XI3A 4DV3F 4WK1A 5KT7A 1IR1A 4J9PA 1IKXB 3HDSA 2FHKA 3NLCA 2RKIA 3BO3A 3SQGA 3OUYA 4U95A 2ZM6F 1BQMB 2MQ8A 1JLGB 2CADA 4TY8B 3AOCA 3DRRB 4QOTA 4U6PA 3MAAA 1C4CA 4C11B 5E5NA 1BXNA 1IKWB 3LGNA 1WG1A 4DG1A 4GKKJ 3CCRS 4PQUB 4IDKB 2BDPA 1HWUA 1AFJA 1CQMA 5IOLA 3H2LA 5ETSA 1BE4A 3FBCA 4TLRA 3S01A 3FRYA 3W1YC 2HFSA 3T41A 4U7UK 4O23A 2J7UA 4ZVSB 2VC1A 4BS2A 3DLKA 3CJ8A 2M8DB 3RR8A 2K06A 4X4TA 1SJRA 4MYUA 2M88A 4DN9A 1JKHB 2UXDJ 4FXVA 1NK4A 3LO3A 1T0TV 4L73A 4RBUA 5AT1B 2HFOA 2H65B 1S1WB 1VC5A 3Q22A 3SV4A 1JKHA 4LF4F 4KRWA 3BH6B 4K7QA 3CD7A 1ZAXA 2KKHA 5D3GA 2HWHA 1U6FA 1VISA 3R3TA 4G6VB 3PR5B 2B5JA 2AIRB 3MEDA 4EU0A 2JVRA 2AX1A 3U1MA 1WELA 3SSSA 5KFZA 1UL3A 1S7HA 1EKRA 3W65A 4DR2J 4NYOA 1N6QA 3OTBA 3I4HX 3DRSB 3ZZUA 3SXLA 3TUIC 3PYEA 1U09A 3VZIA 1DZ5A 5DLFA 4WP3A 3KMQA 2QFIA 3BYPA 2H5EA 1RWPB 1L3TA 3P6YC 1HNVA 1T3OA 4YOEA 4P2FA 4NZ0A 3NOCA 2IC3A 4G1PA 2MPUA 3X3UA 5GAEI 1C0UA 1QVGR 4WU2A 2DY1A 5IT9U 1RBOB 2HQIA 3ENAA 3MM7A 2RU9A 1RYSA 4E8UA 1OJ4A 1K0VA 4CNZA 2DGQA 4P75A 3NNAA 3HSGA 5I3QA 5IWAF 4ZP7A 1BWEA 4FZVA 5DDRC 1LK7A 3D28A 4QIVA 1LNQA 3GV5B 2ZH4A 4ZPBA 4GO5X 3RRGA 1GT8A 4EZ6A 1B0PA 2GIFA 4A47A 1YX2A 4ZPAA 2VG6B 1E6YA 2YKNA 3RBZA 3IA0A 1T05A 2ZH1A 1LWCA 3NP5A 4WCEQ 4ZLLA 4CZCA 3U1NA 3GB0A 2DNMA 3DDIA 1U0HA 4LF9J 1S0NA 1HI1A 2AYEA 5D4PA 3UI3A 3MECA 2FTRA 1FWLA 2J0QD 5KG2A 4B3MF 2FC8A 2GO8A 3THVA 4DV2F 4NXMJ 1AZSB 1F1BB 3MCNA 2W01A 3G6YA 1HR0F 5D6GA 4A8WA 3PXGa 3HFKA 2E5GA 4DR5J 1VJQA 4ID5B 5KAKA 3NCPA 3AJDA 1IBKJ 4M8LA 1WG5A 5BYSA 2I0XA 2HGLA 5H9FJ 4W98A 2HLTA 1VQOS 4MMOA 3FEXB 3BGOP 4F2RA 2B4VA 2MZ1A 4URGA 4O4RA 4Z37A 5DO2A 1S6OA 3UR3C 2VZ9A 4C8YA 4QW8A 1JLAB 3I4PA 3EVWA 2CNOB 2HK2A 3NXZA 2ZBPA 2KO1A 3BGRB 2ILYA 4MK8A 2DGWA 3OHBA 3C6UB 3HKZD 2Z2ZA 4A8SA 2DR6A 1I1GA 3GJTB 3D4JA 2Q79A 1R8PA 4PR6A 3V2UC 2XB2D 4DUZF 1D9DA 5DDPC 3HO1A 2VJVA 1RT3B 5CZVA 2HRTA 3NGKA 2HNDB 4KO0A 3M9NB 1RWXB 4DHVA 5LMNJ 5F8IA 3IAS9 1CPZA 3D1OA 4OZ1A 1NXIA 5HROB 1O5JA 4NA3A 3KMSA 4WFNQ 3GSIA 3WHIA 3T5LA 2F7VA 4X64J 4NLPA 1V5VA 3GU0A 4HTJA 4CLZA 4HH0A 5B0CA 3ILLA 4ED5A 2YTCA 1U1QA 1UVKA 3MEGB 2DH8A 2IBOA 1U02A 3D6HB 4I7FB 4HT7A 2CJAA 4G3IA 4XK8C 4OV6A 1RT5A 4ELVA 4NEYA 3THTA 1LW2A 3W2WB 4ED0A 1TKDA 2BABA 4Y2CA 3MR3A 3TJ8A 3M6WA 4OYIA 1H2TZ 3MMCB 3QQCD 1NSPA 1UVMA 4XPCA 1RAJA 5EHHA 5L1LA 3H59A 4I7FA 3OSNA 3D1HA 1GMUA 3TWZA 3N6LA 4U8YA 4DL4A 5KFUA 1HARA 2JH3A 4PWUA 2X51A 4DPXA 2XC9A 2Q66A 1EIYB 2B6AA 2AZ3A 3WX4A 3OBIA 4Y2KA 3MUTP 4DEZA 2UVUA 4HDHA 1HBNB 3W2VB 4TY9A 4KKOB 2WONB 2H48B 1RAIB 3MM8A 1TTHB 2J0WA 1LW0A 5F9NA 4DV7J 3GIRA 2F40A 3D67A 1YVFA 7FDRA 1WF0A 2PDAA 2XCAA 1KQGB 1HNWF 3F56A 1FTCA 2UUTA 3C19A 4MK9A 4MH8A 2FY8A 3TI0A 1TQLA 3TX8A 1H7XA 2R7QA 3FBFA 3ZFVA 5HBMA 1N48A 4NXNJ 3RB0A 5C25B 3EJMA 5H9FK 2R8JA 1Y00A 2DXDA 3DOLA 3DRYA 1N8RT 4DV6F 5A6PA 4ED4A 5J2MA 4B17A 3GFZA 2RDJA 5C25A 3TJAA 2Y8YA 1X4GA 1FWKA 5F0UA 2R7WA 1Z2ZA 3VCDA 3E01B 4LF1A 4IOCQ 2HHHJ 3SSQA 3CCSS 5H9EK 3O1LA 2KI2A 4NLVA 1Q8IA 4RUHA 5AJ3J 3CCWA 1VQ8S 3TZZA 3IAM9 2N82B 3RW6A 2EC0A 4GVBA 2BJ7A 2BOAA 2LDYA 1GTHA 3M9OB 4USUA 3H2VE 2CPEA 3SIPB 3M2UA 1Q53A 1Z1ZA 1NPPA 1Q5YA 2CWXA 2IRYA 1D8YA 1F2HA 3HHLC 3DN9A 5DQGA 3MOJB 4PWDB 1WHXA 2DR7A 3N6MA 4B9UA 1JLFB 1WC6A 4XIUA 4K4VA 4DR1J 3P45B 3DLLQ 3FMWA 3NNHA 2JVOA 2CQGA 2GNKA 3NEKA 4OX9F 2JEIA 4PWDA 1SL2A 2DCLA 4OHWA 5ETVA 3GYGA 2FVCA 2OPQB 2F9DA 1RT2B 1VOMA 2HNYA 1TKXA 2B4OA 2H9ZA 4X4PA 1CULB 3JAMU 2L9WA 1VBZA 2W7AA 2XS5A 4LFCJ 1RTIB 5KTQA 2P9EA 1TUGB 2EFGA 2R7VA 3DU5A 2CA9A 1TL1B 5KG6A 3BV8A 4KY3A 2DEJA 1S1XA 4ZN1A 3LOUA 1XNQF 3UDEA 2CJKA 2ADCA 2YKMA 3CDAA 2J76E 4FPIA 4TQRA 1Q8BA 4ICLB 4LF5J 2DCUB 4WP9A 1WNEA 2KVIA 2ZZMA 4CLTA 3NBPA 1SIWB 2E1RA 3KJVA 3AXKA 4M5DA 3MAQA 4KHMA 4DJBA 3QNWB 5A8WA 3TQ1A 3CJQA 3GV8B 3OTOJ 4DUYF 4LF8J 4ZJLA 3V4MA 2MKJA 2GMHA 3A8IA 4UOFA 5J2NB 3ZXWA 1N34J 1U2CA 4RL1A 4G1QB 1JLEB 2I2YA 2GVZB 2E1MC 2CPJA 4AE5A 2UUBJ 1IKVA 1CC8A 2MKSA 1UWBB 1KLNA 3KG4A 4ZLNA 4NXNF 1RBLA 2QMUB 2E9TA 1KNZA 3CUNA 4K4TA 2WVEA 5J2NA 1AROP 1CBKA 5DZ6A 2FJAB 2JNJA 4EK2A 3TUPA 2HBQB 1TUWA 3BSCA 3DDKA 1YRXA 1MW7A 3IO1A 2D41A 3FFIA 3HXMA 3IC1A 1N0VC 4RW9B 3GTYX 2ZH3A 4YFUA 2HS3A 4AL6A 4OYAA 4IOBA 2HHHF 3DLEA 1VHIA 1T9VA 5KFYA 5AJ3F 1HQEA 4YS2A 2ROEA 3FSIA 2BX6A 2ALYB 2QIFA 3CMES 3CNQP 1JXVA 4F4YA 2RVJA 1P1TA 4LBIA 4DOZA 1WC4A 3CC7S 2R7RA 4K5RA 3AD9C 3MUMP 4DZ6A 3K17A 4CT9A 4F4AA 3MM5A 5C2GA 2G0IA 1U1RA 2QYGA 4B3OB 2HHPA 4HACB 5KFMA 4CNYA 4ECRA 3PACA 3CE8A 3DI6A 1R6VA 6AT1B 2RRAA 2BQ3A 1N36F 3OVSA 1NDCA 2CDRB 2DR5A 1R8BA 1ZA1B 3T5KA 3MGJA 4OJ1A 1KKHA 1NK8A 3PFEA 2QMXA 4DR1F 3QO9B 1LWXA 1IBLJ 3BSNA 3Q89A 1F9FA 1F9EB 1YJ9S 3MI7X 4B3OA 1FRIA 3TARA 2ZUGA 2CYYA 1U1NA 1TAUA 2VBWA 1REVA 2EI5A 4NLOA 2AJ4A 1JWWA 4PG8A 4X4SA 4O3RA 2K3KA 4DX8H 3EPIA 3KDNA 3KHLA 3J7AN 4OZ3A 4WBFA 2UXBJ 1F3VA 5D15A 1A6LA 4ED2A 2R8KA 3WZ0A 3V6JA 3M6UA 3MWBA 1DQAA 4OHVA 4RX6A 5KG3A 1VFJA 3L09A 2V0NA 3VF0B 3J80Y 3CVKA 4DR6J 2IBKA 4OJHA 2XMTA 2VDHA 4RKUC 3NGDA 2DITA 4OZ5A 3TUZC 5I3PA 2HHSA 2LMIA 3KLIB 1FE0A 4LF5F 3ISNC 3QYYA 2XCPA 3HM9A 2F9JA 1EKSA 2C3YA 1HNXF 2E1PA 4WTYA 3VHQA 4NLQA 4QCLA 4RWWA 1JJCB 1PBAA 2GO9A 4R5PA 2YQ1A 2Y9HA 2QFJA 4KJIA 1PAUB 4DI6A 4HYKA 7AT1B 3O2IA 4RW7B 3UN2A 3OXFA 1JIHA 3LP0B 1RLDA 1NHUA 1RAAB 1GMWA 5F8JA 1KFSA 3M8PA 2XM3A 2NYHA 3BDEA 5D0EA 1YBAA 2XS2A 2BANB 2EW9A 2XS7A 3LTOA 4H54A 3HHLB 1CS4B 3NRBA 4J5OA 1KEKA 1VQ6S 4RJVA 5GMKa 5HMWA 2YKAA 3GYXB 1KHVA 2DHHA 1NK9A 5KFWA 3KK1A 4KQZA 4F67A 4OYMA 2UUAJ 3W5XA 5CYMB 1VQNS 3TW0A 3HHLA 1CS4A 4J7CA 4ECTA 4C8NA 3H42A 1ICEB 2ZHAA 2CJBA 2MZQA 5D4LA 1HLWA 1H6KX 2IJRA 4PG5A 2VG7A 3ULHA 1D0EA 3W9IA 1FJCA 4QIEA 3K8VA 5C2CA 1PYSB 3TR5A 2MY7A 3M2VA 2NCKL 4X4UA 2Z30B 1UFLA 1LK5A 4Y2IA 1GNKA 1KQFB 3PW0A 4RBVA 4PEOA 4B02A 3AXMA 3BPSP 2RF2A 4X4VA 1AA1B 3MM9A 1Q4RA 3QATA 2EEYA 3HJFA 3K5PA 4DL7A 4OL8A 4F50A 4ED3A 2BJ3A 1HNZF 5CD4A 1IM6A 1YJUA 2CG8A 2BXJA 2HQCA 3W9HA 1DTQB 4ID8A 3MD3A 3NS7B 5I3UA 3I5BA 3RU0A 1SBRA 2GCFA 1YJVA 1UVLA 2JX2A 3GG0A 2D69A 2VOOA 2YKQA 2VFVA 4KV8B 1UJ4A 2KU7A 5DDQC 5BJRA 2WBRA 1W26A 2EBEA 5IZHA 1LWEB 4JI6F 1WKKA 3CD0A 1N5VA 2MGZA 4RR5A 4O44A 1U47A 3SBMA 2UXCJ 5B0FA 4KV8A 4OJGA 3T9NA 4DV1F 3NS5A 4P52A 3EICA 3NKYA 3HULA 2JLEA 3IN5A 5K8OA 2QC3A 3EGVA 3CJ3A 3HZGA 3V5RA 2DNKA 1QSYA 1S10A 2V94A 2P9CA 2LCWA 2AX0A 1OYEA 3DOKB 4CI0B 2WHOA 2HMIB 1NMEB 2LEAA 4NEZA 2ZH9A 2IM1A 2MKCA 1AYEA 4J9RA 2V5HG 4B3RF 1VQ7S 4HKQA 1QM9A 5CAAA 1O51A 4JI1F 4USMA 1NSKL 4J9VA 3SMZA 2KXFA 1N5SA 1Y5LB 3BBBA 1DLOB 2V4JB 1T3NA 4ZVOB 1FKOB 1I6JA 2EG1A 1RADB 4WWSA 2GX8A 3O3LA 2N7YA 3Q24A 2AJ0A 1P8GA 1SC4B 3CGIA 3AB2B 3R7SB 3CPWR 1FXLA 2FD2A 1R3NA 2E9ZA 4W90B 1RGVA 1TK0A 3UDLA 1WACA 1QLNA 1RTJB 5AE2A 4PABA 2HZAA 1YRUA 1FDAA 3A1YG 2CNKB 2WVBA 4QIFA 1QAJA 1WOPA 4I2PB 2R3VA 3QWUA 3FSYA 2A2CA 4P2XA 5DS7A 5EN1A 4I6YA 1NDPA 3C8YA 1HWLA 1PSDA 1R27B 4X66F 1FRJA 2FGCA 2V63A 4ER8A 1TKZA 2BKNA 4I2PA 3A8JA 4ALZA 2ZEJA 2UUWA 3OT9A 1UEVA 5DG9A 1VK8A 1GK8A 3EWGA 3MR5A 4ECUA 3GP9A 2W2PP 4JI8J 3IS9B 2G4BA 4I0WA 5IXUA 3BZQA 3O6QA 2IVFB 4JYAF 5KFLA 4EGLA 1YLXA 1RT4A 3MEEA 4CDIA 2CPFA 1RTDB 4KC5A 1G4CA 4IG0B 1EX8A 1P9QC 3C6TB 5U47A 4OFZA 2B9WA 4DBQA 1WSRA 4TU9A 3AJ1A 4OYWA 4AYBD 4JI7F 3LAKA 3Q8RB 3BDPA 5HP1A 5AXMA 5KFHA 5HAOA 2CUYA 3DLGB 3N4WA 4I64A 1RTDA 1V3RA 2B51A 1RJJA 1XNRJ 5EDWA 2DIUA 3R6GB 1DTTA 1NRKA 3POTA 4I56A 1K1SA 3FUYA 4AL5A 3CJRA 3EGWB 3BF4A 1N33J 3PIOQ 2QO3A 4NMLA 5KFTA 5HMYA 3UPFA 3AY0A 1UPPA 4DX6A 3HPOA 1IQZA 2E1CA 1WEXA 1UPMB 1FDBA 5EWEA 1LKZA 6FDRA 2UXCF 2MKKA 4PPDA 4BC7A 3EXYA 3HX9A 1BQNB 2CQBA 5CYQB 4DSJA 2MKYA 4DSFA 3MMBA 4MIBA 2QA4S 3OFFA 3BGFA 4QWAA 2AYGA 1VQPS 3QZ7A 3G6VA 4ECQA 1KTQA 1S7IA 1SH0A 2ZC3A 2P6TA 2XO6A 2FVSA 4IFYB 1HBUB 2BMBA 3JYTB 4ETXA 4FBUA 5F3TA 4KFBB 1NJXA 3KLFA 4MAKA 2QL7B 3W60A 2YNHA 3MM6B 4ZPCA 1HNIB 2BUNA 2X1AA 3A8EA 4F36A 4DZDA 1ZH5A 1U8WA 4WXOA 4YB6A 2FHJA 4B9MA 3ZNJ1 1C2PA 4CO3A 4OHZA 2ZBIA 2NQPA 1L3UA 1R0AB 4LBPA 4URSA 2EWHA 2XWXA 2KJWA 5EX0A 2K8GA 4LIRA 2KDOA 5DRKA 4NASA 4F4WA 4RNOA 5T41A 3C16B 3ITHB 4MFBA 4C9DA 3T9ZA 1SVDA 3MOZA 4JI0J 4O4GB 2QLWA 3PDNA 4KIAA 5CQGA 1SCJB 2H5IB 3BYRA 5G0RB 2WVFA 2XMAA 2V2ZA 1SB6A 4AFFA 3ITHA 4Y28C 2RNEA 4JI5J 2GFFA 4O4GA 2ATLA 2HRUA 4DCPB 3UO0A 4CTAA 2V6AA 5C42B 4OI3A 1GXUA 3AA8A 3X1LB 3CSKA 3MPUB 2ZWPA 4IFVA 3KWMA 4JI8F 2KJVA 4RWXA 4U7UD 5J2QB 2HQGA 2KXHA 2E5JA 2O01C 3H5XA 1Y7PA 4QWDA 2ALZA 2FHMA 5KFQA 4WIIA 4DWIA 2XZWA 3A13A 4DS4A 1BHNA 3UD3P 5AE3A 2B7CB 4DQSA 4MIWA 1KSPA 2W9BA 2CVEA 2YNFB 4IQMA 1JLBA 4UZBA 3HVTA 4OI0A 1QSSA 1XR6A 3QZ8A 3JSRA 1MWZA 4PG4A 3IMQJ 2WB1D 2B4UA 2DRDA 2KHCA 5THWA 4CLLA 2HQ3A 4ES2A 1REGX 1W25A 2N4DA 1W2IA 4N8OA 1LXJA 1TV6B 1FEEA 2YH0A 3HD1A 4EMDA 2FJDB 3PY8A 2MDAA 3GR0A 4WFZA 2MXYA 4LSNB 2R7XA 1S0VA 2Y1LB 3RBXA 1TV6A 5DJBA 3KJNB 4M5KA 4K8RA 2AYMA 3F0NA 1F3FA 3BKUA 2PEHA 1ZM9A 4DQQA 4DFKA 4USWA 5DGAA 4WYLA 1TVRA 3MPVA 1H2UX 4JI4J 1YG0A 2HW3A 2D3ZA 3NL0A 3G4SS 4P71A 1GAOA 5KG1A 1NH7A 1UVNA 1NHVA 2C1EB 1ZPWX 3F73A 2YY3A 1P9YA 3G2XA 5IC6B 2UU9J 3KNGA 3HK2A 1UFWA 2CJYB 2R7UA 2I5JA 2WOMA 1W7WA 2CQ1A 4OLOA 4LRBA 5L39A 3WQPA 1Q8KA 1X9SA 2UZAA 3RTVA 2WSCC 2IJFA 2KYZA 2ZH6A 3K57A 2XHCA 3PVXA 4LF7J 2QT7A 2A10A 3QFWA 1ZZFA 3LPYA 1X9MA 2FQQB 3IG1B 4Y6IA 4PYDA 3M8QA 1URNA 2KG0A 1S6PA 3IWNC 4K4ZA 3Q8YA 4IH7A 2JFKA 2I1RA 1JLCA 4FYDA 1PJ6A 4H4MA 4J9SA 5DQIA 1H2VZ 4AT1B 2QX0A 3KK3B 3V6DA 1YRTA 4DLEA 3KKFA 3MCOA 2GQ2A 4RW6A 3QT7A 3CCTA 3R2DJ 4G1IA 3QGGA 1NK0A 3ZTQA 1S1VB 3T3FA 3W64A 1OIAA 4YN3B 2IDLA 1MMNA 2VOPA 4DQPA 3OFEA 2CVIA 2DGSA 3GWCA 5B0DA 4J90A 3BKFA 4X62J 3KNAA 3EYZA 3ZTPA 2O5DA 1HMVA 3VGUA 3UVJA 2W4DA 4K4SA 1FI4A 5BR8J 2HHQA 1NDLA 3EUNA 3IBFB 3C14A 1S1UB 2LXFA 2PGCA 3CW2C 5CCLA 4ANEA 1JLQA 1HBMA 2QL5B 4DU8A 3V4IB 4ZJOA 4DFPA 1LFPA 3QT6A 4F3MA 3OFHA 4NYPA 4X84A 3UE2A 2A18A 3UQSA 2ZD1A 4OQJA 1FFSB 4AQYF 3GJSB 2R9LA 2OD4A 2IVYA 2R8HA 3V4IA 3CDWA 2HAIA 3MZIA 2OSQA 4USIA 3KLVA 3DHWC 2K2PA 5C24A 3AD8C 1GX6A 1RXOB 3TOQA 4P6QA 1SH2A 2A2DA 2DY9A 3B4DA 5KFSA 3OR1B 3JTPA 3DGPB 1QVFR 4NLWA 2ZH8A 1H7WA 1KVIA 2Q6CA 3JSBA 1X5OA 5HI7A 4CO4A 3GCWP 4UUWA 3KLGB 4X4QA 4JI4F 3R1LA 5EX3A 2ZHBA 1UCNA 3P4UB 2I38A 1KHWA 5A2QY 1S72S 3A12A 3I0RB 1B7YB 2PD1A 4N41A 1ACMB 2A6OA 7FD1A 2MQNA 1FESA 2B9XA 1WKLA 2MZSA 1ZTTA 2IAJB 1LXNA 3HD2A 2Z4PA 3QIPA 4K4WA 2RIJA 2VASA 1NJIT 3K5NA 1NSQA 4NA1A 2VU5A 4LRAA 4LF7F 3VWSA 2PE8A 5LSOA 1VC0A 2XNRA 3CJTA 2KB2A 1J27A 3QLHB 1YITS 3BREA 5IQQA 2GQQA 3CCZA 3V81A 2RDIA 1FK9B 1NB2A 1BWVA 2QTWA 3MHYA 2MQOA 5KFIA 3JSMA 3CD6S 2Z2LA 3OL9A 4WFXA 3ELHA 2ZE2A 2HZVA 2OEKA 4F3QA 3CJ2A 2NREA 3ZZRA 2ZBQA 3GFHA 4Q2MA 1F6TA 4MT1A 3RYLA 3DM2B 3N5BA 3HKWA 3G82A 1CJVA 4BCAA 1H0HB 2HIQA 2M4MA 3NGSA 1QJHA 4GMKA 2DO0A 3OW2R 4OHXA 2EC2A 3LQVA 2DK2A 4PAAA 1X7VA 1YBTA 5EUHA 3DM2A 2ZC4A 1FF2A 4YQWA 3B6BA 4KPCA 3CCES 1TKTA 3Q8PB 1HYSA 1M5PC 1S97A 3M8SA 1MMLA 1CQNA 2ZH2A 2HGMA 3KG0A 2CPXA 2BBEA 1YJWS 3F41A 5A0YA 1C0TB 4F26A 4C6AA 3LWMA 3Q23A 1EP4A 4DX7A 2AYBA 2HAFA 5A76A 1TL7A 2JEJA 2AGQA 3OHAA 1WC0A 3CDEA 4KBIA 1WTBA 4IO9Q 2M5YA 3CJ5A 1C1BA 1CJTB 2E1AA 5DETA 1T9TA 4QWEA 1QAXA 1C0TA 3VAJA 5JVHQ 4S0MA 5EGYA 1GXTA 2DTJA 2JSXA 2XSJA 4ZP8A 5GMEA 2YNIB 2C2KB 2OMLA 3I5CA 3W9JA 4C4WA 3OD2A 3KK2A 1X4BA 2J9DA 4FVMA 5J1EA 5HQ8A 4NZ6A 5K14B 4Q0BB 1X4AA 1F2GA 2ASDA 3JXOA 2RRNA 4GVLA 1B99A 1KVKA 1HQUB 1CJKA 3AHPA 3HJVA 4Q45A 1NO8A 2KFZA 3Q83A 2BE2A 4CLPA 3TAMA 2H1YA 4NCGB 3TEGA 3QSYB 1PC5A 4ZVTB 3B82A 3M30B 3VAKA 1T11A 3DOMA 3GZ7A 3HVAA 1VQ4S 1RT6A 1ZM4A 2F4VF 1T9WA 3AH6A 4DV5F 4OLPA 3Q2SC 2MMYA 3GJRB 3FCHA 4ZIVA 4YR0A 2KH9A 2IM2A 1RTHB 1SJQA 2VV5A 2KRBA 1IM4A 4M95A 4WKYA 1M5VC 3BSAA 5EWGA 3GFYA 4RNFA 4J9NA 4YDXA 1OMSA 2XY7A 3FJ2A 4IRCA 1FERA 3S7RA 3MEKA 3PFOA 2H3EB 3EX7B 2CJ9A 4ZPVR 2RUSA 4NYZA 3N9UC 4LFBJ 1U26A 4ILRA 4YHHJ 4LBHA 2A3JA 2QLXA 4UY85 1H74A 2Z0GA 4FF3A 1VI7A 1SL1A 1J5EJ 2M2BA 3IM8A 1BGXT 2BQUA 3HI9A 3DYAA 2JEGA 4DV3J 4IRDA 2BRKA 4PXBA 4YY3F 1ZS6A 3V6HA 2X3DA 3M1VA 2R4FA 2XO7A 3VAHA 1XTZA 3A3PB 1LWFB 1X4HA 2ZM6J 2G1HA 2XLIA 2OELA 5GAHU 2V8HA 3IP0A 4RW4A 1Q0NA 2K7KA 2XYPB 4ZA1A 2H51B 2VFUA 3CJKB 4I2QA 2MEWA 2NS1B 1UA0A 4R8UB 5LSLA 3D3BJ 2VPZB 2VB6A 1RT7A 1F5BA 1Y3KA 1H72C 2SXLA 1F60B 4V19J 1FRLA 2KT3A 3RRHA 3QGPA 5KG7A 2GAGC 3CJKA 3I87A 4IUFA 3C3LA 3OR2B 3OTDA 4NLGA 2DR9A 3T1YF 3QAUA 2IRXA 2LA6A 2MY8A 2R42A 3AD7C 3G8SA 2GS8A 3D68A 5ETMA 1LQ9A 1K1QA 1H98A 1NKCA 2AJFE 2LU2A 3ENQA 4DPUA 3BBFA 3OR2A 1UFKA 2XWYA 3PJWA 5A6WA 1MWQA 2V69A 2CNNB 4LUBA 1Q8LA 5A8RB 1VRUB 3W8GA 4LF4J 4ZP6A 2ZDOA 5D4OA 1VQLS 4NCAA 3M05A 1VIOA 1PIEA 3J7A1 2BM1A 1N4LA 2ZKUA 2HVZA 2F8EX 3H5YA 4ECYA 4CM0A 4LRFA 2Q43A 3CJ4A 1NEEA 1LFWA 2VFSA 2XYGB 5HLFA 3KUGA 1V3ZA 2DHSA 1HPZB 2KT2A 3D0HE 1IKYA 3KLHA 2OPSA 1UP1A 1UZDA 1Q78A 5ETPA 1NU4A 1O6XA 1S9GB 2C2MB 4HHUA 1VQYA 2MLZA 1FNXH 4OZ2A 2EK6A 2Y1RI 2AJQA 2F65A 1SQEA 2MQMA 2WAQD 3JS9A 3G96A 5E3QA 2V4RA 1XR7A 1HI8A 1ZM2A 2BM0A 3GILA 3JB9k 3BEGB 4Y65A 2HPUA 2QJ3A 2XQCA 2Q3PA 4DR3F 4KH0B 4DUTA 4QIGA 5IWAJ 4M5JA 2ATCB 3IR5B 5JXSA 4C3MA 2C3PA 4IO1A 4LFAF 1S1TB 3EZUA 4N8NA 3FMBA 2DB1A 5KFVA 4DCJB 5I4MA 2PFFB 2OSRA 4ETZA 8ATCB 2BKOA 4PKDB 1KOOA 4QR2A 4USJC 3UR0A 1MROB 4X4NA 4NX9A 1TL3B 4WP8A 2YQ3A 5LM7E 1JNRB 4NI2A 1OPIA 2E66A 3IRXA 3DRPA 1QTMA 5L46A 1U1PA 2PEBA 2OKQA 1D8ZA 3C2PA 3FBBA 4FKYA 9ATCB 4HDGA 4F04B 1JB0C 2Y1IA 9RUBA 2PA8D 3DDNA 4B3MJ 1HWIA 2OEMA 4OMFG 1G7CB 2VG5B 4JBCA 3PJXA 4DV2J 1IKXA 2ABYA 5K5MA 1D9FA 3MPWA 1UJ6A 3QSIA 1BQMA 5KFGA 1HR0J 2VFTA 1JLGA 3RZAA 3FGVA 2ZVIA 4TY8A 3DRRA 4OX6A 4C11A 3RAQA 2OFGX 4ANCA 2K3IA 1IKWA 2GHPA 1XN9A 4NE9C 3LPEA 4PQUA 4IDKA 1M1GA 2CQDA 2Q6BA 4DV4F 1RWNB 2VJUA 1DY3A 4FN5A 2VFRA 2LVWA 1BC6A 3EMTA 4Y3CA 5E0OA 1T9YA 5ETQA 4HTIA 1FFGB 3TZYA 4MIAA 5FDLB 3L4BC 4IG3B 3CDBA 1WSVA 1U48A 2I9SA 4GC7A 4ECXA 1XEZA 1HA1A 2LXUA 2HHUA 3TANA 3Q8VA 4UF4A 2RQMA 5HQMA 2X3GA 5GAHI 4TLQA 1OQ3A 1XMQF 4RUCA 1S1WA 5B0EA 4F8RA 4DUZJ 3FZ2A 2ZNZA 1WJ9A 1QDUB 4HI1A 5BXIA 3EXCX 1A9NB 4IG3A 2YKPA 3MCMA 2R2UA 4JV5J 1FCAA 2UVVA 3J7YU 1YTYA 1H73A 3HT3A 1KC8T 1QAIA 2KXNB 4FF4A 4CWBA 5A8KB 2LEPA 4OJ3A 2FHOB 3TVKA 4A8OA 4DDFA 5KFOA 4K50A 1U4BA 1RHKB 1N52B 3HMJG 1GMWD 2B56A 1ELOA 4UOGA 1IXKA 3DRSA 4PUOB 2E9RX 4X4OA 3QAEA 2LKZA 3DLJA 3CTRA 3PX6A 1HD1A 1K8AT 1NJWA 1X4CA 2W25A 1X4EA 2NPFA 2D9OA 5IV4A 2AKWB 3ZTOA 3EVOA 3PEJA 4QU7A 2JHEA 5HMZA 3WDOA 1R0BG 2XEXA 3AQPA 1YHQS 2JL9A 2DNOA 4PUOA 1T95A 3DU6A 1YZ7A 5I42B 1PYOB 3P49B 1RAHB 1RHMB 3I9V9 2LQJA 1PAEX 1R8AA 2W8LA 2GGPB 1QAYA 1NAQA 4K0KF 1RKIA 3MR7A 3MF5A 2ASYA 3I56S 1JX4A 3JTOA 4RBTA 4EYHB 5I42A 3VAGA 4P73A 2K7JA 4B9VA 1IQTA 3S8SA 2VG6A 2M70A 3T1HF 3GG1A 3UCZP 2DH9A 4K2JA 4LR8A 1SC1B 1KS2A 1FXDA 5GVQA 2QYCA 4F0KA 1RT1B 1YQHA 3ET6B 4UTGA 1U2FA 3P5TL 4JI2F 1HNWJ 2KRRA 3PJ9A 4AL7A 2FJBB 2HFVA 2FVRA 3W3SA 2YWWA 3D0IE 3NAIA 4RW8B 3QGIA 2UUCF 3T5JA 1K9MT 3RGIA 3W5ZA 4CQ1A 2X1FA 4Z7YA 4Y34A 4DX5A 2ACYA 4YP3A 1M1HA 5M2UA 4B9LA 3GJQB 4FPRA 1AZSA 5FLXU 2YH1A 3TP2A 5T7LB 1XWLA 3DLBA 4ID5A 4NWBA 2NXEA 4DV6J 3QRQA 3N0VA 3L9ZA 2V4QA 4J9OA 2JC1A 2H4YB 2JDJA 3R5JB 1VHFA 1RACB 1V6HA 4J9LA 5F8LA 4M5IA 4JOUA 4WKRA 2HFNA 2UVRA 1PJ7A 4M5LA 1I94F 2YNGB 3M32B 2JRSA 3R2CJ 2W9CB 3FEYB 2G2OA 3TVYA 1JLAA 1C4AA 1Y11A 3ZZTA 2MSTA 4WF9Q 2XLJA 1C1CB 2C2RA 3BGRA 2V2QA 4JV5F 3C6UA 4F4ZA 3M4XA 4ZK7M 5CHCB 1OS5A 3AA9A 2DD8S 4IR1A 2VD3A 2AT1B 4CYUB 3CF5Q 1JNZB 1RT3A 4EBDA 3BPDA 2HNDA 3GV7B 1C1CA 2J5AA 1ITPA 3Q8SB 3M6XA 3K0JA 2E7VA 4J91A 1RSCA 4USHA 4USVA 3SCKE 4NLUA 3KYLA 2YX1A 2G2ZA 3CC2S 3JQMA 1FJGF 1KD1T 4KHRA 1V3SA 4MKBA 2C42A 4OX9J 2BW7A 5HROA 3PZPA 1TK5A 2HVHA 2I8EA 2HBYB 5KFKA 1TUVA 2O3DA 2NPIA 1NDKA 3R97A 2LQ8A 2C2OB 1U2RA 2DGUA 4IRKA 2OTLS 4LIWA 1VMBA 5KFNA 3MEGA 2ERRA 5CH7B 1WTFA 4M5GA 4X2BA 1YIJS 3FKBA 3BQ0A 4YDDB 3W2WA 3G6XA 3PKMA 5HJXA 3BGUA 1Q82T 2XYHB 3MMCA 1BY9A 2GW8A 3RAXA 1XNQJ 2DNQA 2R8IA 2M9KA 4LVOP 1U25A 2HRYA 4Q7AA 1X60A 1KP6A 3K8WA 2NYIA 1KLMB 1WHWA 3ILOA 2K1RB 3G87A 4L6V3 2OPPB 2HBRB 1U6ZA 3PYGA 2KZMA 5L1IA 4FVCA 2NXJA 2ZJRQ 1S99A 1WI8A 1HBNA 3TA1A 1VCTA 3W2VA 4MKYA 4KKOA 2AEFA 5GADU 2WONA 5L1KA 2V8PA 3CO0P 2YQ0A 1IJFB 2HG4A 4M94A 2W1BA 4DUYJ 4E98A 2UV8G 4I69A 1B4SA 1U7LA 4U8VA 5LXYA 5T14A 4ILLA 2CNLB 3MD1A 1NNDA 4DL6A 3QIDA 1RHQB 4FNHA 3FBEA 1VRTB 5LMUJ 5KG0A 1B3TA 1FWPA 1Y0HA 4JI3F 3QFHA 1GQEA 2HHXA 3NGUA 3PHTA 2W2NP 2M8HA 3T6BA 5HVGA 3M7VA 3FQKA 5DQHA 5J1NA 3NCRA 4CO1A 3GMGA 3IR6B 2BKPA 3WC0A 4RU2A 1SIZA 3E2EA 4ZCKA 3UFCX 2HNZB 1FNMA 1LV5A 4ZVUB 3BN4A 4ZP9A 5DG7A 4ZCMA 2APOA 2P6SA 2GMLA 4XTTA 4YEAA 2CQHA 1DARA 4H4OB 4J9MA 5IV3A 3E01A 2GA7A 2XZTB 1M90T 2R2SA 1S76D 4QYZJ 2W4PA 4X65F 2FLNA 3AOAA 3CEDA 1N5YB 3Q8UA 2YBVA 1N36J 2B8PA 4JUZA 2GAHC 4K4UA 1SUQB 3U1LA 4ZOSA 3NMAA 3VGVA 1FEHA 3KUHA 3KOAA 1S6QB 4TQSA 2FHJD 5HVHA 2F5GA 1JLFA 3SDEB 1DHMA 4NOHA 1VQ9S 2OMOA 2FZGB 3SYZA 2DPIA 3TZXA 4CLFA 3BM7A 2FB0A 2MZRA 2VIHA 1ZPVA 2RJZA 1JQGA 5B7WA 1KRPA 1HBOB 2LFVA 5HJYA 4MKVA 2OPQA 3BR9A 1RT2A 4C3KA 4EYIB 2QG9B 3VVUA 2DXFA 4ZVHA 1R7IA 3C15B 4DLGA 2QA2A 2UVWA 1CULA 2VPXB 2F63A 2GVDB 2V8GA 1RTIA 5FIIA 4NLDA 4QQBA 3FNNA 1CJUB 5F41A 4TN2A 1WDTA 1HD0A 1TL1A 2EFVA 4ILMA 3PRBA 3BGLA 5CYJA 5L8RC 1HNXJ 4UY8T 4QWCA 1ZZNA 1URRA 4USTA 2DNYA 4CO2A 1IBCB 4ICLA 4K59A 1FKPB 3J80U 1EETB 2U1AA 3EE3A 1FKAF 5LJ5Y 2HVDA 3MMAB 1SJ4P 3OLBA 3I0SB 2WRMA 3NOGA 2PO4A 4EBEA 1PBUA 3MR6A 3NWGA 1KFDA 2O66A 2FGOA 2NSBA 2ADBA 5LMUF 1NK5A 1NUEA 3MMAA 2R7OA 1UMJA 4F3OA 1QE1B 4ECVA 2G0JA 5KT3A 4G1QA 1TELA 1JLEA 2GVZA 2Z57B 4B9NA 1UWBA 1S79A 3LGMA 2M7SA 2RHSB 4WPAA 2MHNA 3Q0AA 1YWXA 1Q1KA 1I5OB 2DHXA 1X0FA 1B70B 2GJ2A 4OHYA 5E33A 2RD5C 2ZBCA 2QRRA 1S9FA 3AB4B 2A6MA 1TMJA 3FEZA 1GMVA 1T03B 2PMHA 1AW0A 5GADI 1ZA2B 3E3XA 4RW9A 2HEKA 4B9SA 4I1TA 2KZZA 3IBWA 2PMZD 2PN6A 2DNPA 2BVZA 2BYCA 5E2QA 4QYZK 4ED7A 3R8YA 3CCUS 1MU2B 1S6UA 4UQTA 3PYFA 2ZZNA 3UDCA 2ZUAA 2ZJQQ 2E7XA 1HNZJ 3PX0A 1OWXA 2B0GA 3DHXA 1HL6A 2WK4A 4C0OC 4ZKAA 3SV3A 3B4MA 2DH7A 4HACA 3H2UB 5KFPA 4L74A 3GIKA 5ADZA 4LF2A 1RP5A 3PTWA 2W7PA 1RKJA 1HW8A 1MSWD 3CMAS 3QO9A 3LW5C 3MTKA 4D3GA 4LMZA 2BACA 1T02A 5FJ4A 4DV0F 4P7TA 1Z2LA 4PCQA 3R5DA 4DU7A 3MR2A 4IOAQ 1YSJA 2OUGA 2XBPA 3OVBA 4WE1B 1EJ7L 1ZBTA 2F8HA 4BLGA 4JI6J 5E3PA 2J6UA 2EK1A 4A8YA 2OIHA 2ASJA 1HKAA 2OPRB 1TK8A 2MQLA 4DV1J 1NBEB 3G8QA 2AMCB 1U45A 1JK9B 2HS0A 2HURA 3MFIA 1BQXA 1RLCL 1X4FA 4UT4A 4AD6A 2KM8B 2NZCA 2N7CA 5LJ3Y 1FX2A 3L7PA 4A8MP 3SZ2A 1UW9A 3KLIA 2Y0SD 2RKIB 1R89A 3SQGB 3OUYB 2WW8A 3P8BB 1JXLA 2FLLA 4ERDA 4DL0C 4A4JA 4I68A 4TVAB 4B3RJ 2AZ1A 1Y3JA 4DG1B 5B0AA 4DSKA 4DMZA 4JI1J 4CLYA 3UWTA 2KFYA 1ZTWA 2ASLA 2DNLA 4RW7A 1S0MA 2XNQA 1U1KA 3LP0A 1XMBA 3KHGA 2ZH7A 3DLKB 2CJQA 3GONA 3NGRA 2BANA 1S48A 1VYAA 3VZHA 1KBRA 4ELUA 4RPFA 1RQ0A 3LP1B 1IVZA 1Q86T 4LF6F 3EDRB 4ZVEA 1AUSL 5RUBA 4V1Ak 4QPXA 3O8WA 3EGZA 1DQ8A 1L3KA 4JV1A 2CWKA 3KJQB 1IJEB 1XIQA 3SCLE 2BJ9A 3VQTA 2XG8A 5IQ6A 1WUUA 3ILIA 5CYMA 1XQIA 2L48A 3I31A 3TO8A 1N32F 5K8MA 3LP1A 4NZ7A 3ZNUA 3W5YA 1NK6A 4X66J 1MN7A 1HWJA 1OSCA 2QGFB 2LQBA 3DFEA 4AXJA 2FC9A 2FJXA 2FVPA 4WFYA 5D3GB 4TKTA 4CM2A 1DURA 1YK9A 2DT9A 5LL6d 4A46A 5DM6Q 1M5KC 2B5JB 3LP2B 3MEDB 2LECA 1DBDA 3W8PA 1IWGA 2N4CA 4B3SF 2H4WB 4CCHA 2W7OA 4JYAJ 2RHQB 2J9DE 1N6QB 2NLWA 2WVCA 3QJLA 4QU6A 4M63A 2D1CA 1Y9OA 3G8TA 1L3SA 1ZM3A 4NLRA 3LP2A 4MK7A 3SFGA 1R43A 2FDNA 4HI2A 4J9QA 2D3OR 2RS8A 1HNVB 3RB6A 4P9SA 4JI7J 4F4XA 2IC3B 2CQPA 3VQSA 1NKBA 1GFWB 1MNEA 5H1SV 1C0UB 2YX7A 2HYIB 4ITSA 4BHQA 1AFIA 2IIHA 2MKHA 2QLJB 3MM7B 4N76A 3T19A 1DTQA 1RAFB 2HWIA 1FD2A 1PYTA 3D1QA 2PIIA 1UKUA 2VQEJ 3TA0A 2V2VA 3HP6A 1IN0A 2HWTA 4ANDA 2LP4A 3OQ2A 2F4FA 1FVQA 1N54B 2D74B 3MURP 1NH8A 2AEJA 4O3QA 1TFYA 4C2MA 4CRJA 1E6YB 2E5HA 2YKNB 3IBCB 1LWEA 1T05B 4OI6A 3ADAC 2JZ5A 1LWCB 5KFAA 2W2OP 1TFWA 4OZLA 3L95X 2OHDA 1XBWA 4ZJQA 4HH1A 1U0HB 2V9KA 2GZOA 2VODA 5D0RA 4KTQA 4N47A 4C8KA 2KG1A 1B7FA 5D0HA 3MECB 2AU0A 1R31A 2ZKTA 2ZFHA 2LU1A 2U2FA 1YDLA 4P2SA 1FDDA 3DOKA 2C2NA 1F9HA 2HMIA 2ZHOA 2IM3A 2L3MA 2QL9B 2PI5A 2EVZA 4Q44A 2P5VA 1ZAVA 3NS6A 2GC8A 3UNGC 2HVIA 2J9EA 2AGPA 2IMOA 3HVWA 3OL7A 2C22A 2C28A 4GKKF 2AGOA 1XC9A 3OL8A 1KR4A 1DLOA 2V4JA 1FKOA 3K89A 3LALA 4WJBA 4NRUA 4GC6A 2FYXA 1HHSA 1PG5B 4HLBA 2DNRA 1QTNB 4MKAA 4E2FB 2LQ5A 1WHYA 2KFNA 1RU1A 3Q8QB 3LA0A 2A0FB 2UXDF 1WC1A 1MLAA 5ETTA 4YB1P 4DR4J 1RTJA 4IQXA 2MLXA 2CQ2A 2WVDA 2FZKB 1Z4UA 4FDFA 4HT5A 4PWWA 5F8HA 4WK3A 2GIRA 5K9FA 1RWMB 4KO0B 4W92B 3H90A 3A3OB 3GR1A 1F5CA 5H9EJ 2ILZA 4NA2A 2EBGA 2BJ8A 3PYDA 1OY9A 2VC0A 2CG4A 4LRDA 3PKYA 1CC7A 1Y5NB 1FD8A 3KTQA 2ROPA 2QZ8A 1U1OA 2F8MA 5IT9Y 3WIUA 5KFBA 1IBMJ 3IS9A 2VHGA 1AUDA 4DR2F 4URQU 4O3SA 2J8AA 2BR0A 3N28A 4O0NA 4D3HA 3TJ9A 4LJMA 2AD9A 1RAOA 2V9WA 2XTJP 4IG0A 1KOHA 1RT5B 3NCQA 3C6TA 2ZH5A 1X5PA 2CFXA 2LYVA 1LW2B 5MAOA 3A3NB 5B0GA 5L38A 5HSPA 4PYAA 1YBUA 2Y1JA 3DLGA 2VQEF 1HHTP 2AJ1A 5DG8A 2W8KA 5BYRA 3OSPA 3OXLA 4IYQA 3DKDA 1RHUB 2ACMA 4DPTA 2NSCA 5AXLA 1FFWB 3H20A 1RDRA 1WF2A 4Z7CA 2B6AB 4PXCA 3PEHA 4ZPTR 4V19X 2OO4A 3KXDA 3AQOA 2V34A 3TEHB 3N79A 2OP5A 3MM8B 2FJEB 3SI8A 1JMTA 2DNHA 1BQNA 1LW0B 5CYQA 4Q8FA 4DQIA 2XY6A 2J0SD 4ES1A 4WXWA 1K47A 1TMMA 2POKA 2DGVA 2L08A 1S4EA 4LF9F 4ED8A 2ROGA 5SUHA 2IA6A 3R5AA 4IFYA 3IGVA 3LWLA 1HBUA 1HW9A 1UEKA 1I51B 3JYTA 1FNOA 4O3OA 4WFAQ 5FLXY 2H5JB 4OZ0A 4KFBA 2DEIA 1MWYA 3MM6A 3D66A 4JP8A 1HNIA 1PCAA 1SI9A 2RRBA 3HHDA 5K8PA 1TAQA 4NXMF 5HBMB 3Q2TC 3M9MB 4ZPDA 2PFDA 1SJ1A 2YWHA 1UZHA 4DR5F 4LSLB 3IFEA 4BC9A 2J7WA 3DOLB 2DR8A 1R0AA 2M0GB 4FYWB 4Q43A 5J2MB 1IBKF 4ZVPB 4KT0C 2DRAA 3K5OA 3VAFA 4TXSA 2YPZA 1Q79A 3BS9A 3I5AA 3C16A 4LSLA 4DR4F 3SCIE 2RQKA 3KG1A 1PGZA 4B08A 1RWUA 4UUXA 2JC0A 4W4MA 2XMKA 4KGZB 3BN7A 2X7IA 4DF4A 2NXCA 4ECSA 4EFAC 1UETA 4C8LA 5G0RA 2XLKA 1RE1B 3CCLS 2GHVC 4ZIWA 4GVBB 3G86A 8RUCA 5E3CA 5LOQA 3M2UB 2PA3A 4DSEA 4CH1A 3UD4P 1VQMS 3GFXA 3QRRA 1UW4A 5C42A 5B08A 2VUGA 2HQFA 1WORA 1UAWA 2OI2A 4QPTA 1ZAWA 2JLGA 5LMNF 1IBMF 4ZPWR 4LQ9A 3VAMA 5J2QA 5KFEA 3R7BB 5G4DA 4YMEA 3PRDA 4KYZA 2IM0A 4ZVQB 3VVTA 2P2CB 2Z56B 4X64F 5CABA 3R6LB 4AQYJ 3IWLA 2IYIA 4U7CA 1BUXA 1VR6A 2YNFA 3FCWA 4NCBA 1SQGA 2HNYB 1TKXB 3J7Z5 4JV0A 3GIJA 3D6FB 3RBEA 3OV7A 3ZTSA 2PSZA 2EKNA 1NB7A 3GIMA 2YWFA 2RS2A 4NRTA 1CEZA 1X31C 4O3NA 2XSFA 2OLWA 1TZ0A 4CO0A 1S1XB 4ED1A 1R8HA 1U8SA 4C3LA 2YKMB 4LSNA 4LQ3A 4DQRA 4FKXA 2J0XA 4Y00A 1FXRA 1IR0A 2HVEA 4C8MA 3NBPB 4PPZA 4HVZA 1FRKA 2YWEA 3W66A 1J2VA 1B0TA 5D78A 1FHTA 2R7TA 2MZJA 3KJVB 1Y4ZB 2DVIA 3FVYA 4M5DB 1PO6A 2MKIA 1K73T 1E6VB 1YJTA 4PXEA 5A8WB 4OYXA 2Y0BB 2ZWOA 4DV7F 2DIVA 2B3TB 2DNGA 2BZ2A 1WOSA 3LGHA 1ZOTA 3B54A 2FJVA 3FQLA 4DCOB 5F8GA 2WSFC 2WW4A 1IKVB 1NZ8A 1E6VA 5A2QU 4UQGA 3IM9A 4EBCA 4Q5VA 1RUSA 1UVJA 2VONA 4OYPA 4CLWA 3J81U 1VBYA 1MMDA 3B8HA 4LRCA 1NCLA 2HZCA 4JB8B 3F44A 3SEOA 3DRXA 3FFIB 3BR8A 2D7SA 3IG1A 2LEBA 4PG6A 2AJ2A 1FTRA 1CG2A 5GMDA 3DLEB 5BYQA 4FXDA 3W63A 2EFQA 1FRMA 3PO5A 1HQEB 5KFRA 2XULA 3KK3A 2VKZG 1UA1A 2RMLA 4DFJA 3AOBA 4FYVB 2MYFA 1EQMA 4F25A 3UCUP 4X4RA 1WOOA 2VICA 1XR5A 1KTVA 3EPGA 3QMQA 3MM5B 1S1VA 5IFMA 1GEHA 5L1JA 4KB7A 1Q81T 2QA4G 3DI6B 5CD4H 1VDHA 2BJEA 2QLFB 5CXTA 3GCXP 3KUEA 1S1UA 4ZLJA 4MYTA 4ECZA 3JAMY 2Q1LA 2AHOB 3LH2S 2HHVA 4RZRA 4ENOA 3QWPA 1APSA 4DL5A 3CCVS 1REVB 2VA2A 1PJ5A 3JQJA 5DLGA 3HT0A 4ZDNA 4F0HA 3H0PA 4KHPJ 4I4BA 1U0SA 2BA9A 2FVQA 3WBZA 4LVNP 1GTEA 3SQOP 1SKWA 3QT8A 2RUGA 4O0IA 4Y0FA 4RUAA 3PO4A 1VLOA 1YZ6A 1RCXB 4EUVA 5ETRA 5KT5A 2HQDA 3QPIA 4LT6A 4LFCF 1S57A 3QT5A 4FF1A 2DISA 4B9TA 3TUJC 3OR1A 3DGPA 2E5IA 1PKUA 4YUDA 4PXDA 3HZEA 5ETOA 1EB0A 4YB7A 3NMRA 3H7HB 1K0TA 2BE9B 4R5PB 3MXHP 4OI1A 1YJ7A 3KLGA 2HBZB 1OQ6A 3CB4A 4PZVA 5HQLA 2PC6A 2VDIA 3I0RA 2HK3A 1RHRB 1RCOB 2CPDA 1Y5IB 2WTFA 2F4VJ 3M8PB 4DV5J 3CJ0A 1WKJA 1LEOA 3CULA 2ZBRA 5KFFA 2Z58B 2VBYA 2E7WA 2IAJA 4DSLA 1A7GE 3KK1B 3BJYA 4FYXB 3M6VA 3OTOF 5HMXA 4LF8F 3THPA 1SKRA 5DDOC 1N34F 4OX8A 3ZO7A 2CXEA 2UUBF 3BSOA 1M5HA 3TNVA 4R25A 2JLFA 2C2ZB 1EHWA 6FD1A 3HFVA 3QLHA 2VG7B 3N5FA 1PC4A 1FK9A 3OTCA 3QRPA 1N56A 2WSEC 3M2VB 5D0GA 1ULRA 1F5AA 1S0OA 1X4DA 1D1UA 2KL8A 3A4TA 3RB4A 3PW4A 3D54A 1A0OB 5DM7Q 2FY1A 2IPOB 3D6TB 2J8SA 2B9YA 3H4DA 2DGXA 1SPBP 2CQ3A 4A48A 4DS5A 5M2RA 1WHVA 4YY3J 2F3JA 3T6JA 2IJNA 3DXSX 1VQKS 4XDCA 2RF2B 3MM9B 3KLEB 4OZNA 1TR0A 4F4KA 3BO4A 4N7TA 3LUYA 4M1KA 2DO4A 3BO2A 2B4PA 3R9LA 1WC5A 5D4NA 2J6SA 3DGVA 4K4YA 1M0SA 1HQ2A 3KLEA 1ZYQA 2XGQA 2FZCB 4DL2A 4OX7A 4A8QA 2VA3A 2G2YA 3VGSA 3HVRA 1S9EB 4M5NA 2G1DA 5I3UB 1YJRA 2N3LA 2VBZA 3ONQA 1IBLF 4FF2A 3P5BP 2OFHX 4KHPF 3T1YJ 4JV2A 1RA7A 2V8DA 3BH7B 4TU8A 4XO0A 2RILA 1TL5A 1S9EA 4LREA 4ZN3A 3DCAA 4C8OA 1CJTA 2BJ1A 2MGZB 3GQCA 2ZOFA 1U49A 5B0BA 3NNCA 2RQ4A 1RABB 2UXBF 3D7SB 4O44B 1WF1A 2E44A 4NPOA 3L3CA 2ZNYA 3VALA 2L9NA 4LSZB 2QV6A 1WEYA 2BOPA 2YNIA 5IS2A 2VL1A 2RT3A 1AXQA 1WD6A 4EWTA 3CDUA 1M5SA 1U6BA 4KGVB 4DR6F 2DRBA 4GRSA 1OPZA 1N0UA 3D6MB 4Q8EA 2QSFA 2QN6B 5K14A 4Q0BA 1IR2A 3CWJA 3SSRA 2A1BA 5IT0A 2KTQA 2AW0A 1QD1A 8AT1B 1RA6A 1UTAA 2DYAA 2NR0A 3I55S 1HQUA 2D3UA 2CQCA 4EI2A 4TYBA 2CZ4A 2MQQA 1HWKA 1N5QA 2RDDA 4RNHA 2ZZTA 2DPJA 4R0EA 4C0HA 3UDVA 4NCGA 4K2XA 1T9XA 2NXUA 3RRKA 1UWAA 5F9LA 2E29A 3WIVA 3M30A 5L9NA 1RWOB 3RW7A 3O44A 3W7BA 4H4KC 2CIMA 4DR3J 3M8WA 1RTHA 2ZDPA 1WG4A 4J9KA 2YWGA 4K4XA 2V68A 3QJPA 4I6WA 4LFAJ 2UUAF 4ATNA 1NK7A 1S5ZA 4KGMA 1Q5VA 4C97A 4USKA 4OZJA 4UOCA 1VS3A 3PW5A 4PRFA 1D3WA 5HL7Q 1TKZB 3CXCR 2NUUG 5DZ7A 3W62A 3EGNA 1F0XA 4HEA9 3CMQA 2HHTA 1T9UA 3CO9A 2WZ1A 4FNIA 4U9RA 1OY6A 3OJUA 2DXEA 1SQFA 2OD6A 1X8DA 1RT4B 3MEEB 5F8NA 2OGUA 2KHDA 5IM0B 1LWFA 1MG7A 3HHEA 4WZMA 3OL6A 4U96A 5KOXA 2YX4A 5HP1B 3GYNA 4NL5A 3TYTA 1KONA 2CPYA 2EKYA 2J6TA 5JMNA 5HN0A 1WEZA 4R8UA 5CZXA 5IM0A 2DBBA 1DTTB 4DV4J 1WWHA 1FJ7A 3POTB 4WU3A 5KG5A 3LAMA 5KT4A 2HIYA 5ETNA 2RAQA 2DNZA 5B09A 3CIZA 2WBMA 1J5OB 1NPRA 3FRZA 1N88A 5ITHA 2ZVSA 1T8EA 4QZVB 3UN3A 3KFWX 4YB5A 3PIPQ 2BQRA 5IC4B 5MLCV 5KG4A 1J5OA 5K20B 3CC4S 1XMQJ 2HGNA 4KGXB 5HVFA 1I3OB 3MMBB 1GX5A 2FJWA 1FA0A 1BD6A 3VTIA 5AXKA 1FRXA 5JJBA 4E0DA 1FVSA 1VRUA 5A8RA 1NSAA 5J1PA 5ETKA 3OPKA 4J9UE 2BV3A 2EPIA 4OI2A 3ZZPA 3FC9A 4TYAA 2NUHA 4Z2XA 4QW9A 1FX4A 3NWRA 3KLFB 3AFGA 3VAIA 2CPHA 1RTZA 1P27B 2YNHB 3IR7B 1IWAA 4EZ9A 3ZTRA 2CPZA 1B64A 1U1LA 2JEFA 2P8IA 3D2WA 1OYDA 3M8RA 1NM2A 1HPZA 3ETMA 3R27A 1TU0B 2BE7D 1S9GA 3PG9A 3TAQA 3S6EA 1CLFA 2NXNA 3DLHA 4MFBB 1G3OA 5EWFA 2PI4A 4OI4A 2WB4A 3CT9A 1BMQB 3IRWP 3I6PA 2QEXS 3PV8A 3PX4A 4ZS6A 4XPEA 5D8HB 4Q2LA 4K0KJ 3RJMB 3T1AA 5ETLA 3GSDA 3MDFA 3NAHA 1W2BR 1U1MA 4CTAB 3DNCA 1S1TA 2GJIA 1WC3A 1QSLA 2YWKA 4DPWA 4FXWA 2R8GA 5HO4A 3J81j 1H3DA 3T1HJ 4B3TJ 1UJ5A 3E51A 4IFVB 1R0CB 3RB3A 4I67A 2FLOA 2AF6A 2Z2MA 3H4BA 2W4CA 1SJFA 5JUMA 1MROA 1TL3A 2IHR1 4Y2MA 1RK8A 5C5JA 4JI2J 3JTNA 1FJEB 4QR1A 4C8ZA 1VRQC 2XGPA 3L7UA 2W9BB 3UCGA 2XI2A 1JLBB 4FP9A 2UUCJ 3HVTB 2GJFA 1NJZA 4BWMA 1HFEL 1N5TA 4C98A 3O5TB 1NJYA 3H5SA 2VG5A 2DGOA 5M2PA 1G2EA 2QE5A 4QBUA 2Z8QA 4FYYB 3TQEA 3HLUA 5IT4A 2V67A 4P74A 1RHJB 2DNNA 4CLUA 3I82A 4RNMA 3PCOB 4NMXA 4IH5A 3SFUA 4J37A 1T94A 5KFCA 1XNRF 4IH6A 3N01A 1HI0P 3EZ5A 3BBCA 4HL9A 4A8FA 3K59A 4EEYA 4XAKA 2HSEB 1I94J 4AXIA 1N33F 3NY0A 1DFDA 4F0MA 2HFZA 3J7ZT 2MJNA 3D0GE 5FDLA 1PILA 4G65A 4YR3A 1S12A 1TVRB 4H4KA 4N77A 3PHEA 2EFOA 4KAIA 2CAJA 1VGYA 5LXRA 4ZCIA 2OTJS 2X1BA 2L41A 1NLKL 1Q7LB 3TZWA 1BLUA 2W2QP 4I6AA 1S49A 2AWZA 2J7KA 4PG7A 2C3OA 5F3ZA 4NLTA 4F2SA 1O0PA 4WIQA 2I5JB 2WOMB 2VF3A 3VGTA 1Q95G 1FJGJ 3BKTA 1X5TA 4ED6A 4RUBA 3ZZZA 1KQSR 4ZITA 5A8KA 5KT2A 2GMJA 1KWMA 3CCQS 2IRUA 2BRLA 2R7SA 2AEMA 2BEFA 1G6BA 2LDIA 4BDPA 3M8QB 4C7QA 4BWJA 1S6PB 4XDDA 4BBYA 3W61A 1JLCB 1SC6A 1RYRA 4GO7X 3HHLD 3FCVA 1SXLA 4H4MB 2HKEA 2CDQA 3V6DB 1D09B 3OLAA 4C0BA 3HF5A 1X9WA 4K5SA 2YXLA 1M1KT 4RW6B 3E8OA 1D9AA 4JI0F 4ZLPA 1L5UA 1Y10A 3WX8A 3ETOA 2LQ9A 3H40A 2IFXA 3NGTA 2EFNA 3G9CA 2O67A 3DXBA 5KT6A 2VKRA 2RE1A 3H8YA 2GGPA 2JFDA 4B3TF 4JI5F 1HMVB 2M52A 4QIWD 3UVJB 3M8YA 1RI7A 3CCMS 3C14B 1SV5B 1JLQB 3Q86A 5CA5A 1HBMB 4ZHRB 3UD5A 2BW2A 2IVMA 2CZVC 4FS1A 3ZZOA 1O8BA 3R5GA 4NLSA 3OXGA 2V50A 3AT1B 1RT1A 1YKWA 1CVJA 4CLKA 3AODA 1P6TA 3ET6A 4KGKA 1DRZA 1SV5A 3HSZA 2G9OA 1B0VA 1XJWB 3HHKA 1S4FA 2ZD1B 4ZHRA 3FK4A 5FD1A 4HHHA 2IA0A 4JI3J 2J9CA 4RW8A 1FDNA 3DMJB 1L3VA 5GAGU 2XMVA 5C24B 2MLYA 1RZMA 1M5OC 3CCJS 1VQSA 1JXEA 5T7LA 3QGHA 1OO0B 1RBAA 5HANA 3GE9A 2MJUA 3DMJA 1RISA 2E5LJ 2DKOB 4DPYA 4LR9A 3H25A 1R6YA 4ZCLA 3OVAA 1VIXA 3U7JA 2UP1A 2MSSA 1JJ2R 2VPYB
chains in the Genus database with same CATH topology
3BSNA 2V2KA 2BR0A 1F9FA 1JJ4A 3N28A 4ZP6A 1YJ9S 2ZDOA 4O3PA 3MI7X 4D3HA 5D4OA 1VQLS 4NCAA 3MUVP 4LJMA 3M05A 4B3OA 3OFGA 1VIOA 2AD9A 1YI2S 1FRIA 2YNGA 2V9WA 4NLXA 3M32A 5E3AA 4IG0A 1KOHA 1RT5B 3NCQA 3C6TA 3ZC4A 3J7A1 3SCJE 2BM1A 2ZH5A 2ZUGA 3TARA 2CYYA 1X5PA 2CFXA 2LYVA 1LW2B 5MAOA 1U1NA 1N4LA 1TAUA 2L9DA 2ZKUA 2HVZA 2W9CA 2F8EX 2DHGA 2VBWA 5B0GA 1REVA 2EI5A 5L38A 2QSWA 3H5YA 4NLOA 4ECYA 2AJ4A 1JWWA 3IGNA 4PG8A 4DL3A 4X4SA 1GXLA 4O3RA 2FPHX 2K3KA 4DX8H 2Q43A 3EPIA 2Y1JA 3DLGA 3CJ4A 3KHLA 2VQEF 4P7VA 2AJ1A 1HHTP 4CT8A 5DG8A 4CO5A 1NEEA 5BYRA 2W8KA 3OSPA 3OXLA 1LFWA 2VFSA 4IYQA 1A6LA 5HLFA 2HHWA 2IMWP 3QIPB 2EFPA 2XMWA 4ED2A 2R8KA 3WZ0A 1V3ZA 2DHSA 1HPZB 2KT2A 3D0HE 1IKYA 3M6UA 3MWBA 3KLHA 3V6JA 1DQAA 4OHVA 2CQ0A 2NSCA 1CSJA 2OPSA 1FO1A 4RX6A 5AXLA 5KG3A 1UP1A 1Q78A 1VFJA 3H20A 3L09A 3PNIA 3J81Y 1RDRA 3C66A 1NU4A 1Q16B 2V0NA 1S9GB 3VF0B 1WF2A 3J80Y 2UU9F 2B6AB 2HLUA 3CVKA 4PXCA 2IBKA 3PEHA 1VQYA 4ZVFA 4OJHA 2XMTA 1DJ0A 3KHRA 4RKUC 1FNXH 3NGDA 4ZPTR 4V19X 2OO4A 1ROFA 2EK6A 2DITA 2RU3A 5KFXA 4OZ5A 3TUZC 2Y1RI 5I3PA 3AQOA 2LMIA 2HHSA 2LA4A 3KLIB 2XMJA 2AJQA 1SQEA 2MQMA 3RAMA 3V81B 3N79A 2OP5A 3MM8B 2FJEB 2WAQD 3SI8A 1FE0A 1JMTA 3G96A 5E3QA 4LF5F 3ISNC 2DNHA 3QYYA 1BQNA 1LW0B 3VR1A 2V4RA 1XR7A 4DPOA 2XCPA 1HI8A 1ZM2A 2BM0A 3ENWA 3GILA 5CYQA 3HM9A 4DQIA 4Q8FA 2MZTA 2XY6A 3JSMB 2F9JA 3BEGB 4Y65A 2HPUA 3JB9k 2J0SD 2XMMA 2C3YA 2Q3PA 3B78A 4ES1A 5LSRA 4DR3F 1HNXF 3IWXA 4NLYA 4WXWA 4WTYA 2DJWA 4NLQA 4QCLA 4QIGA 2POKA 4RWWA 2ZE2B 2DGVA 2L08A 2EG2A 4LF9F 2KN4A 2GO9A 4R5PA 2QFJA 3IR5B 4KJIA 4ED8A 2ROGA 5SUHA 5JXSA 2IA6A 4OV1A 4HYKA 3R5AA 2C3PA 4C3MA 2HS4A 3J7YI 1YJNS 3O2IA 4IFYA 3IGVA 4IO1A 4RW7B 1S1TB 1HBUA 1HW9A 3EZUA 4N8NA 3LWLA 4LFAF 3JYTA 3OXFA 3FMBA 2DB1A 5KFVA 1FNOA 4O3OA 4WFAQ 1JIHA 5FLXY 3HHNB 4OZ0A 3LP0B 5I4MA 4ECWA 1R8CA 1NHUA 4KFBA 3G71S 1SKSA 2PFFB 2UV8A 2OSRA 5F8JA 4CIOA 1KFSA 4ETZA 1MWYA 2LLZA 3M8PA 3MM6A 1HNIA 3BDEA 1YBAA 2XS2A 1SI9A 2BANB 2EW9A 2XS7A 1UEUA 4PKDB 1KOOA 4H54A 2RRBA 3HHLB 3HHDA 3NRBA 4J5OA 1KQKA 5K8PA 4QR2A 1KVJA 4IKAA 1TAQA 2JJ4D 4NXMF 4USJC 3US5A 5HBMB 1KEKA 1VQ6S 3UR0A 5GMKa 5HMWA 2YKAA 3WC2A 3Q2TC 3M9MB 4ZPDA 1MROB 3GYXB 1KHVA 4NX9A 1TL3B 2X1GA 2YQ3A 4X4NA 1SJ1A 1JNRB 1NK9A 2YWHA 5KFWA 3KK1A 1OPIA 2E66A 4DR5F 4LSLB 3IFEA 3DRPA 3IRXA 4BC9A 1ZETA 3G6ES 2J7WA 3DOLB 4KQZA 4F67A 1QTMA 2DR8A 1U1PA 1R0AA 2M0GB 4A8XA 4DF8A 2OKQA 4DN0A 1TKTB 1D8ZA 1KLMA 3FSXA 4Q43A 2K1RA 3C2PA 5J2MB 1QUVA 1IBKF 1HYSB 2DRAA 4KT0C 2ZITA 5CYMB 3TW0A 4X62F 2YKOA 3HHLA 1VQNS 4ECTA 3K5OA 3VAFA 4HDGA 4C8NA 1JB0C 2Y1IA 2OPPA 4UW2A 1SH3A 4TXSA 2PA8D 3DDNA 1Q79A 1HWIA 2XY5A 1DQ9A 3BS9A 5A0YB 5BR8F 5F0WA 3I5AA 2CJBA 4OMFG 2ZHAA 2MZQA 5D4LA 1G7CB 2VG5B 1EP4B 3PJXA 3N6NA 4JBCA 3ZZYA 4LSLA 4DR4F 1IKXA 1H6KX 2ABYA 3SCIE 5K5MA 2RQKA 4PG5A 3PR4A 1D9FA 3KG1A 1PGZA 3MPWA 4B08A 1RWUA 3P96A 2VG7A 4UUXA 2JC0A 1UJ6A 3ULHA 1D0EA 2RB7A 3ISND 4ELTA 1FJCA 4QIEA 1BQMA 3CIMA 5KFGA 2XMKA 1H38A 4AUKA 1XK8A 2VFTA 3BN7A 1JLGA 3K2YA 3K8VA 3RZAA 3FGVA 3M2RB 3GIIA 1OSDA 4TY8A 3TR5A 2MY7A 1YGYA 3DRRA 2VBXA 3M2VA 4ECSA 4DF4A 4EFAC 4X4UA 4OX6A 4C11A 1UETA 3RAQA 4C8LA 1C1BB 5G0RA 2XLKA 2OFGX 3P3DA 3CCLS 2GHVC 2LXIA 2K3IA 1IKWA 1UFLA 4DFMA 2GHPA 1LK5A 1XN9A 3AAWB 4Y2IA 1GNKA 4KE5A 2MQPA 4PQUA 3G86A 5E3CA 1KQFB 4IDKA 3M2UB 2CQDA 2PA3A 2Q6BA 3PW0A 4RBVA 4DV4F 1VRTA 2XSJB 4DSEA 4B02A 4CH1A 3UD4P 4FN5A 1VQMS 4R0JA 1LOUA 3M2RA 3GFXA 3S1TA 1QUPA 1UW4A 2VFRA 3ICLA 2LVWA 5C42A 1BC6A 5B08A 3ISZA 2VUGA 2RF2A 4Y3CA 1UAWA 5E0OA 1VBXA 4X4VA 3MM9A 4QPTA 2KM8C 1ZAWA 1Q4RA 2E5LF 4HTIA 3KK2B 2JLGA 5LMNF 1GH8A 4MIAA 2JWNA 5FDLB 1IBMF 2FIUA 4ZPWR 5J1EB 3HJFA 3K5PA 4LQ9A 3VAMA 4MTPA 4DL7A 5J2QA 4OL8A 5KFEA 4TU7A 4F50A 5G4DA 2G13A 4ED3A 4YMEA 3PRDA 5KFJA 4IG3B 3CDBA 1HNZF 2R2TA 1U48A 2IM0A 2I9SA 4GC7A 1YJUA 4ECXA 2HNZA 1XEZA 1HA1A 2LXUA 3K5LA 2HHUA 3D5MA 4X64F 3TANA 2BXJA 1FE4A 2RQMA 2X3GA 5GAHI 3IWLA 4TLQA 1OQ3A 1XMQF 5E3RA 3NG8A 4RUCA 2IYIA 2G0CA 1S1WA 1DTQB 5B0EA 4U7CA 4F8RA 4RNNA 2YNFA 4ID8A 3FZ2A 2ZNZA 5E7OB 4NCBA 3MD3A 2BE2B 4HI1A 3CD5A 5I3UA 3I5BA 2PT0A 2HNYB 3L7OA 3EXCX 1TKXB 1A9NB 3J7Z5 3RU0A 3TAMB 4IG3A 1SBRA 4JV0A 2GCFA 1YJVA 3GIJA 1T7PA 3RBEA 1UVLA 2YKPA 2R2UA 3OV7A 4A8KA 1FCAA 2JX2A 4H4OA 2UVVA 3GG0A 3J7YU 2PSZA 1YTYA 3HT3A 1KC8T 2VOOA 2YKQA 2KXNB 1QAIA 4FF4A 2VFVA 4FS2A 1NB7A 4KV8B 5A8KB 1UVIA 3GIMA 1UJ4A 2KU7A 5DDQC 5BJRA 2YWFA 2RS2A 4NRTA 2LEPA 2ZJPQ 2WBRA 1RT6B 1CEZA 4OJ3A 2FHOB 1VQ5S 2EBEA 3MMJA 5GAGI 3TVKA 4O3NA 4A8OA 2XSFA 1LWEB 2OLWA 2XHWA 4JI6F 5IZHA 4DDFA 5CCMA 3CD0A 1N5VA 5KFOA 4K50A 2MGZA 2MB0B 1N5YA 2CQIA 1TZ0A 4CO0A 1U4BA 1S1XB 2ZOGA 4ED1A 1R8HA 1N52B 1U8SA 4C3LA 3HMJG 4O44A 2B56A 2YKMB 3RR7A 1U47A 1ELOA 4LSNA 3LF0A 4LQ3A 5B0FA 4KV8A 4OJGA 3T9NA 4DQRA 4WYWA 4DV1F 1IXKA 3DRSA 3NS5A 1SUQA 3I32A 2J0XA 4Y00A 1FXRA 3NKYA 1IR0A 2W9AA 4C8MA 4PUOB 2E9RX 2JLEA 3NBPB 3QAEA 4X4OA 2LKZA 3DLJA 4PPZA 3CTRA 4HVZA 3IN5A 3PX6A 1HD1A 5K8OA 4ZMMA 1FRKA 1XERA 2YWEA 3CJ3A 4CH7A 3HZGA 1K8AT 3V5RA 1NJWA 1S6QA 1X4CA 2W25A 1J2VA 1B0TA 5SZTA 2DNKA 1X4EA 1QSYA 2NPFA 2RH3A 5D78A 2D9OA 3AJ2A 1S10A 3SDEA 2R7TA 1FHTA 2MZJA 3KJVB 5J2PB 2V94A 3PEJA 4QU7A 2JHEA 2P9CA 5HMZA 2LCWA 3WDOA 1Y4ZB 2AX0A 2DVIA 3FVYA 2XEXA 3AQPA 4M5DB 3DOKB 3R5BA 1PO6A 4CI0B 2MKIA 2WHOA 2HMIB 1X0PA 1YHQS 1K73T 2JL9A 2DNOA 4PUOA 1E6VB 2N3OA 1YJTA 4PXEA 5A8WB 1T95A 3DU6A 2AV5A 3UW1A 2LEAA 2JOQA 4DV7F 5I42B 3P49B 2ZH9A 2DIVA 1HBOA 2B3TB 2DNGA 2MKCA 2BZ2A 2IM1A 1VJWA 1VC6A 2DGTA 4J9RA 4QJVA 2V5HG 1ZOTA 4B3RF 1VQ7S 3I9V9 2LQJA 5J2PA 2FJVA 4HKQA 1SL0A 3FQLA 1QM9A 1R8AA 2W8LA 2GGPB 1O51A 5F8GA 4JI1F 1QAYA 1NAQA 2WSFC 1RKIA 4K0KF 1TP7A 3SMZA 5E41A 1IKVB 3MF5A 4EO6A 3DYAB 2KXFA 1E6VA 1FT8A 2AQ4A 4UQGA 1N5SA 2ASYA 3TAPA 1Y5LB 3I56S 1JX4A 4EBCA 2GIQA 4Q5VA 1DLOB 3JTOA 2V4JB 3M1VB 4RBTA 1T3NA 2C2EA 1UVJA 2VONA 1FKOB 4EYHB 5I42A 2CPIA 5L9XA 1I6JA 2EG1A 3JSYA 2V8VA 2GX8A 3VAGA 3V6KA 2K7JA 3O3LA 4B9VA 1IQTA 3S8SA 2N7YA 2VG6A 3Q24A 3PW2A 2RQCA 1VBYA 2AJ0A 1P8GA 1V9OA 2M70A 4TNOA 3T1HF 3GG1A 3CGIA 1MMDA 2VH7A 3AB2B 4RW4B 3UCZP 3B8HA 2DH9A 5JVGQ 3CPWR 1KS2A 1FXLA 1FXDA 2HZCA 2FD2A 1R3NA 3ENVA 5GVQA 2E9ZA 1NZAA 2QYCA 3F44A 2B7BB 4W90B 3MTJA 4PQAA 1RGVA 3SEOA 1RT1B 4I2QB 1TK0A 3DRXA 3FFIB 3BR8A 2D7SA 3IG1A 3UDLA 2GQCA 2LEBA 1YQHA 1WACA 4PG6A 1QLNA 1RTJB 5AE2A 3TVZA 1U2FA 1RT7B 1YRUA 3P5TL 4JI2F 1FDAA 1FKPA 1FTRA 2M3DA 3A1YG 1QAJA 4QIFA 1CG2A 1EETA 2KRRA 4I2PB 4AL7A 2FJBB 3DLEB 2FVRA 5BYQA 3W3SA 4FXDA 1F2GA 2EFQA 1FRMA 3QWUA 3PO5A 3FSYA 3D0IE 1HQEB 5KFRA 2A2CA 3NAIA 2XULA 5F8MA 1NKEA 3I9ZA 3QGIA 2VKZG 4RW8B 3KK3A 2UUCF 3T5JA 1UA1A 2RMLA 2F1FA 1Q7YT 1K9MT 5K8NA 5DS7A 1TL4A 1VK3A 4DFJA 4CQ1A 3U02A 2MYFA 2X1FA 5EN1A 3I0SA 4Y34A 4I6YA 3C8YA 2ACYA 4YP3A 4F25A 3OJSA 3UCUP 4WZQA 4U67Q 1IUJA 2QMWA 1HWLA 4X4RA 1PSDA 1R27B 4X66F 2AP6A 5KFDA 1FRJA 2FLPA 5M2UA 1XR5A 2FGCA 4B9LA 1TKZA 1KTVA 4I2PA 3EPGA 4FPRA 4ALZA 2O1PA 2OH2A 3QMQA 2UUWA 3MM5B 2ZOMA 1S1VA 2YH1A 2OAUA 3TP2A 5T7LB 5IFMA 1UEVA 2BJDA 1XWLA 3MPYA 3R5CA 5DG9A 3DLBA 4ID5A 4NWBA 5L1JA 1VK8A 1QE1A 2CKWA 4KB7A 1Q81T 3N0VA 4CH0S 3MR5A 2QA4G 4ECUA 3DI6B 5CD4H 2V4QA 4J9OA 2JC1A 4WFBQ 1XMOF 4RLEA 2JDJA 3IS9B 1VHFA 4KR0B 1V6HA 2G4BA 4I0WA 4EO8A 4J9LA 5IXUA 2W24A 3BZQA 3O6QA 2IVFB 3U27A 5F8LA 4JYAF 2BJEA 3C46A 4JOUA 5KFLA 4EGLA 4WKRA 2HFNA 5CXTA 2UVRA 1RT4A 3MEEA 2C3MA 2CPFA 1VLYA 1RTDB 1S1UA 4N5SA 3FZBA 4MYTA 4KC5A 4ECZA 2YNGB 1I94F 5GAEU 3JAMY 2Q1LA 3M32B 3LH2S 2HHVA 2JRSA 4IG0B 1P9QC 3C6TB 1G1XA 5U47A 4OFZA 2B9WA 4QYRA 3LANA 4DBQA 4RZRA 4FBTA 3QWPA 4TU9A 1APSA 2W9CB 4DL5A 3AJ1A 3FEYB 3CCVS 3TVYA 1JLAA 1C4AA 3K7RA 1REVB 2VA2A 5DLGA 4DR7F 2FUG9 1DAXA 4AYBD 4JI7F 3LAKA 4ES3A 3ZZTA 4KPYA 4GKJF 3Q8RB 4OIXA 3PM9A 5KOWA 5HP1A 3BDPA 4ZDNA 2MSTA 4WF9Q 2XLJA 5AXMA 3QJJA 5KFHA 1C1CB 3DLGB 3TRGA 3N4WA 2C2RA 3BGRA 1T03A 4I64A 1RTDA 1V3RA 2B51A 1RJJA 4I4BA 3MAHA 4JV5F 2BA9A 2P9GA 2FVQA 4DSIA 3C6UA 3WBZA 5EDWA 4F4ZA 1JJHA 5HLFB 2DIUA 1DTTA 3M4XA 4LVNP 1GTEA 1NRKA 4ZK7M 5CHCB 5LT5A 3POTA 1OS5A 3AA9A 1IKYB 2DD8S 3KLHB 1SJ3P 2C3UA 1SKWA 2OPSB 4IR1A 2VD3A 2RUGA 1K1SA 4I56A 2D9PA 4AL5A 4O0IA 3EGWB 3CF5Q 4Y0FA 1JNZB 3BF4A 1RT3A 4RUAA 3PIOQ 1FRHA 2QO3A 4NMLA 5KFTA 5HMYA 4EBDA 3PO4A 2HNDA 3K5MA 2B43A 2IYGA 3UPFA 2OJ3A 3GV7B 1C1CA 2J5AA 3Q8SB 1MU2A 3AY0A 3HPOA 3M6XA 3H98A 4F02A 2NZ4A 2XMUA 4EUVA 3K0JA 4USHA 3SCKE 1IQZA 2E1CA 5D77A 4NLUA 5KT5A 3KYLA 1P1LA 3QPIA 4L72B 4LT6A 2YX1A 4LFCF 3CC2S 1WEXA 3BB5A 1FJGF 5AXNA 4FF1A 1FDBA 4KHRA 1V3SA 1LKZA 5EWEA 1KD1T 2DISA 6FDRA 4MKBA 4B9TA 2C42A 2UXCF 2COLA 3TUJC 2MKKA 4PPDA 5HROA 4BC7A 3OR1A 3PZPA 3DGPA 4IR9A 3EXYA 1TK5A 2HVHA 3HX9A 1BQNB 2I8EA 2CQBA 3T5HA 4N56A 3PW7A 2GHWA 5CYQB 2E5IA 4DSJA 5KFKA 4YUDA 3RBDA 1TUVA 2O3DA 2NPIA