5IZHA

Lassa virus l protein cap-snatching endonuclease. apo form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
b'GMEEDIACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKTVNISLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
molecule tags Transferase
source organism Lassa mammarenavirus
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5izhA02
5J1PA 4I1TA 3JSBA 5IZHA 4MIWA 5J1NA
chains in the Genus database with same CATH superfamily
4JI6J 3QRRA 3M7VA 1NRKA 1YJVA 4O4RA 3RB6A 2BXJA 3MECA 3R5GA 4CM0A 3GR1A 2KM8C 1XNQJ 1M5OC 2B9YA 5K8PA 4RW7A 4HTJA 4P75A 5DO2A 4NA2A 4CLWA 3J7A1 1S48A 2P5VA 2ERRA 3LGHA 4RUBA 3MPWA 1GQEA 3V6KA 2C2RA 4X4PA 1X4CA 4ZVPB 3K58A 1DHMA 4F4XA 2QL5B 1NCLA 3GIRA 4LBHA 3KK1A 2OSQA 2R7SA 4RW7B 3D3BJ 5EX0A 4XTTA 2A1BA 2RKIA 2IHR1 1U1LA 2C28A 5JJBA 5IWAJ 2FHMA 2OEKA 1XJWB 1CJVB 1K1SA 4F67A 1FDDA 5B0DA 3UR3C 4A4JA 3ADAC 4BLGA 1S1UA 3BN7A 1GXUA 1NUEA 1S76D 2DO0A 1UJ4A 3VQSA 4IOCQ 2G4BA 1FJCA 2HHUA 4RW4B 3MD3A 3HX9A 4DS5A 2VA2A 4DR4F 2R2TA 1HKAA 4X65F 4QU7A 2MZJA 4RUHA 1FDAA 4IQXA 1OWXA 1GTEA 1V3ZA 4C7QA 2KHCA 3NNHA 1JX4A 1HI8A 3R1HA 1B0VA 2F1FA 4KSEB 4Y2MA 1RYSA 2PN6A 4IOBA 1WKJA 2XYHB 2HQFA 4FYVB 4DX6A 2LA4A 3PM9A 4DL5A 2HHWA 2G0IA 3R6GB 3OHAA 3ET6B 3KHGA 2G0JA 4P73A 1TTHB 4ANEA 4JI7J 1S1XB 4JI2J 2CJAA 1JLCA 5GMEA 5IC6B 4PWUA 4OFZA 1UJ6A 4A8FA 1RT4A 5AE1A 1NK6A 2KXFA 2VV5A 4CO0A 2ILZA 5DS7A 3FBBA 5J2MB 1TKTB 2LYVA 1KOHA 4NA1A 2QL9B 5HMWA 2VQFF 2DNPA 1N4LA 2O66A 1NDCA 2HK2A 3H25A 3U27A 4JI1J 3QAUA 2BM0A 2MQLA 1E6YB 2AX1A 4ZPTR 2M8DB 4W92B 3DGVA 2VG5B 2KI2A 2CPFA 1FKOA 1S6OA 2B51A 1AZSB 3D66A 3IRXA 3PYFA 4HACA 1RAAB 4QPTA 5KG4A 4H4OA 2JNJA 4WP3A 4B3OB 1C0UA 5I42B 1RWPB 3M9OB 1UFKA 5M2UA 2A6MA 3ENQA 2XY6A 1RUSA 2HK3A 2VPYB 2BW2A 4MIAA 4WFYA 3TP2A 2E66A 3AH6A 3CXCR 3MAHA 2F40A 4L3KA 4Y2IA 1Y5LB 2UXDJ 5LOQA 1KNZA 1G4CA 3UI3A 2KO1A 3N28A 3C14A 2B5JA 1ULRA 2EWHA 4WFAQ 4DV2J 4LSLA 3BH7B 4USMA 1LWEA 3TYTA 4ZHRA 2HBZB 2DRDA 4O4GA 3ZZOA 4ZITA 1RAJA 2RS2A 4ERDA 2CXEA 1S6UA 1VBZA 1HBOB 2HLTA 2BE7D 2R42A 2Z4PA 1XK8A 4QJVA 5KG0A 2P9CA 5DDPC 4M5DB 3TA1A 4J9RA 1UKUA 2D3O1 4LF1A 2ZZTA 3MEGB 3C6TB 1QVGR 2HGNA 4Y2KA 1MU2A 3MZIA 3NL0A 3TQEA 4U96A 4EZ6A 1R8CA 1X4DA 4WIIA 1FD2A 3C19A 4ZIWA 3AA8A 3QWPA 2V8HA 4IOAQ 2HVEA 4Q45A 2MLXA 3OUYB 1BXNA 3I5BA 4F2SA 4WYWA 4QYRA 4ED3A 4XIUA 3CSKA 3CJ5A 4PG5A 4EK2A 3MR2A 4IRKA 2AQ4A 3ILJA 2K1RB 3QWUA 4FP9A 3N5BA 3DDNA 3M2UA 3O3LA 5HBMA 5THWA 5KG1A 1HBNB 2FHOB 5LSLA 3VTIA 1B64A 2U1AA 1DRZA 2FLNA 3MMBB 2GGPA 3M8WA 3AQPA 1SQGA 4QIVA 3AOBA 1IBMF 2YKNA 2YXLA 1HW9A 2RF2A 4YS2A 3GYGA 1D9FA 3Q86A 4C8OA 1UVMA 1KDNA 1VRQC 2AJFE 2C2KB 5EX3A 3SDEA 1CJTB 1TL4A 3CC7S 2B9XA 3MM7A 5L9NA 1RHMB 2IBOA 4JI5F 2E1CA 3HD2A 1HNVB 5CYQB 4NRTA 3UDLA 3JXOA 1Q81T 1SL2A 3J7AN 3LH2S 1HNWJ 4PPDA 5KOWA 4WFBQ 1CJTA 3OTOF 3QAEA 4G1QA 4DWIA 1JLAB 2ZH5A 2HMIA 4Q2MA 1NH8A 2HNYB 3U7JA 3NNAA 3M2RA 1JJHA 1FWKA 4YR0A 2ADBA 2PDAA 4QCLA 2QA1A 1P27B 1BD6A 1J2VA 3AY0A 2J0QD 2XGPA 1F1BB 2UUBJ 1WWHA 2DNQA 4OYBA 2WVCA 5DGAA 5HLFA 1KTVA 1N48A 3UFCX 2R7OA 2F63A 2IYIA 1U8SA 1KVKA 1FA0A 1ZM3A 4YR3A 3BJYA 3MXHP 5KFQA 1TK8A 4DPYA 3TUZC 1RKIA 1DTTB 1R43A 4DV5F 4QWDA 4OX6A 1K44A 1KQSR 3HF5A 4AE5A 1REVA 3PCOB 5D0GA 2RDDA 4JBCA 4KPCA 3AB4B 3N6LA 2PMWA 4NLOA 1B7YB 3IG1A 2CPZA 1RT5A 4OI1A 2GJIA 3H5UA 1W26A 5IT9U 2EFOA 2CZ9A 3CCWA 3IM8A 4DG1B 3GONA 1OY8A 1U2RA 5HN0A 1WHYA 3D5MA 3MR5A 4K4ZA 4YB1P 2QMWA 3CJ2A 3CMQA 1KP6A 1X9SA 3KYLA 4UW2A 4Z2XA 1FERA 2XMVA 4RX6A 3VQTA 1FNMA 1NZ8A 4DZ6A 2NXUA 5J2PB 2FLLA 5J2NA 1VQ6S 2CPYA 3I32A 1UW9A 3MEEB 4NCGB 4C8MA 3CMAS 2CNOB 4O3NA 2ASLA 2UXBJ 2DNGA 5KFKA 5FLXY 5D4LA 4NMXA 3NWRA 3CC2S 2KG1A 4RBTA 2HHXA 3ILIA 5AT1B 5L1LA 4GO5X 3EXCX 3MEDB 1KLNA 1Y00A 5KFGA 2DK2A 4W90B 3Q8SB 4DR5F 2B6AB 1EX8A 2AWZA 4CNYA 4HH0A 2ZZNA 3W2VA 2CA9A 1ZYQA 2GMLA 4DV4J 4N76A 3DRYA 3CJKA 3BBCA 2Y0SD 1PAEX 3OQ2A 3BGFA 4OMFG 5D4PA 4CLKA 2DR8A 4USUA 2W25A 4ZVSB 2E29A 3GG1A 3MEDA 1C1BA 1GFWB 1NPRA 2R7TA 1NK8A 1FHTA 2BDPA 1JWWA 2JH3A 1X8DA 2H4WB 3MMAB 1IKYA 2D69A 2IJNA 5U47A 2B5JB 5FD1A 4JI6F 4M5JA 1TQLA 1RJJA 2V69A 2RH3A 5IV4A 3LWMA 3DRSB 3ENVA 3HVRA 1SH0A 1U1PA 4KGZB 1IKVB 4DMZA 3KTQA 4UY8T 4I6AA 1CC7A 2CQCA 3A1YG 3G8QA 3KJNB 5BXIA 1U49A 3CULA 2CQHA 3GFYA 3NAIA 3UW1A 4ATNA 4ZKAA 3VGTA 1H72C 1VHIA 1BUXA 2V63A 2Y8YA 2OPRB 1CG2A 2QLXA 4DX5A 4CQ1A 4ZPBA 1RT3A 3UDCA 1CJKB 1S6QA 4KQZA 3MMCB 2XMUA 4PUOB 4OJ1A 2NS1B 4DLGA 2IMOA 3RAXA 2PI5A 1HNIB 3TVZA 4R8UA 3CDBA 4YY3F 2ASYA 2FPHX 2WSEC 1TR0A 2BM1A 2ZBCA 3GYNA 5B0EA 3VGUA 2OKQA 3LP1A 3BSOA 3HP6A 1J5EF 1WD6A 5LXYA 4ECXA 1LXNA 5CXTA 4U7UD 1G7CB 1X4AA 2OPSA 4ZA1A 2V50A 5HVGA 3R2DJ 2LKZA 3N6MA 1I51B 5HAOA 3SCIE 2W01A 4TQRA 2AJ2A 2B56A 1FX2A 2HSEB 4C0OC 3W9IA 4OZLA 5GADI 3H4DA 4ECSA 4X4SA 1N36J 1LEOA 1WSRA 2FZKB 2V4JB 2HVDA 3BGRA 3MAAA 3OTDA 5CZXA 4A8QA 1L5UA 1FNOA 3IAS9 1F5CA 4DJBA 4GVBA 3CCQS 1U48A 4L72B 3HHLA 1FEEA 1WEXA 2MXYA 3OV7A 3H4BA 4QYZK 4LT6A 2RMLA 2FGOA 4Y6IA 3UNYA 2W9BA 4X2BA 1NK9A 1QVFR 1YGYA 2CPDA 3W3SA 1S1VA 3EICA 3IGNA 4USVA 1C4CA 3HHNB 4OZ0A 4K0KF 1VLOA 1AZSA 2F8HA 5E7OB 2BE9B 4M94A 3HKZD 4I1TA 4TLQA 2BZ2A 5A76A 3GE9A 4GKKF 5KFRA 2C2DA 1VRTA 3B54A 1XNRF 3MCOA 4QIFA 4NXMJ 2WTFA 4ECZA 3RGIA 2MB0B 4OZJA 5E0OA 4TU9A 4DR2J 3NAHA 4OYAA 3GQCA 1QE1A 3DN9A 2IM0A 1T9UA 3OXLA 1U7LA 3PX6A 4LF2A 1FF2A 3W65A 4TY8B 2HHPA 1U2CA 2LXIA 4FN5A 1F3VA 1IJEB 5K9FA 4ICLB 3HHKA 4IFYB 2MZSA 1X4GA 4YDXA 2ZHBA 3IGVA 3TAPA 2XY5A 5BR8F 4XO0A 3GG0A 4RU2A 2CJQA 4I56A 4ZVEA 1EB0A 5ETPA 4OZ2A 2R8GA 1CBKA 3SSQA 4EGLA 4DR6F 1B99A 1R6YA 2ZDPA 4ZPDA 4X4RA 1YJ7A 4ICLA 1JJ4A 2MKHA 3FBCA 3IRWP 2IM2A 1RHQB 4V19J 2ZOMA 3IWNC 4EU0A 1FE4A 3AJ2A 1NDLA 3RU0A 3MEEA 3FK4A 1WKKA 2X3DA 2Y0BB 3FFIB 3I82A 2VJVA 2IBKA 2N3OA 2OLWA 2ALZA 2OH2A 2Y9HA 4PWDA 4ILRA 4NWBA 5LSOA 2GJ2A 2VICA 1Q86T 4NLPA 2PD1A 2HAIA 2MJUA 4OJHA 3ZO7A 4NXMF 3QIPA 3DYAA 2JSXA 3R5CA 1Q7YT 2M0GB 2E44A 2JOQA 3SCKE 1NPKA 3X3UA 1NB7A 3MM8A 4F25A 2IPOB 3D0GE 4J9SA 3IAM9 1MU2B 1UP1A 3JS9A 1Z1ZA 1AUSL 3PV8A 2C3YA 3M30A 5A8WB 5F9NA 4TQSA 2WOMB 1CS4A 1YRXA 1EETA 3I0SB 3I0RA 3QGPA 2CADA 2YY3A 4NLQA 5D4NA 5IC4B 4K4XA 1X4HA 4KHRA 4H4MB 3W7BA 2CQIA 2ZWPA 3DOMA 2W8KA 2FVRA 1Y4ZB 2DO4A 4OX8A 3PY8A 4RNOA 3EVOA 3CIZA 3IR6B 4DV6F 1WDDA 4MYTA 1U0HA 3KLIA 4ZP9A 5B0FA 5K8NA 2L3MA 4TN2A 5MAOA 1S9GB 3RRKA 3UN2A 3ETMA 5KFPA 1VQPS 1O6XA 1S0NA 5KFTA 1KFDA 1L3SA 3M6WA 1AXQA 4KTQA 2CJYB 5GAHI 2QLFB 3UCUP 4J9MA 4HHJA 2X51A 2H65B 2DXEA 2DGWA 2JDJA 5HANA 2PA3A 3D1QA 5B0GA 4PXCA 1RLCL 3AD7C 3MWBA 3WC0A 3M9MB 2DB1A 3T1YJ 1B70B 1RGVA 2B9EA 2I5JA 4ENOA 3W61A 1YBUA 5GAEI 2F8MA 3DC2A 3D68A 2EFPA 1S1UB 2V8GA 4JI8F 5CA5A 1NSPA 2DR6A 4DV2F 4DR4J 1SUQA 4N5SA 4IH7A 1HBMB 1RACB 2W9CA 3NKYA 4DBQA 4RW6B 3OVSA 3A3OB 2EBGA 1YI2S 2O01C 1CQNA 3IWXA 2FY1A 2XLIA 1RHUB 1WG5A 4LF7F 5F8GA 2HW3A 1D9AA 2VL1A 1IBLJ 3R5JB 4Z37A 1KOOA 4KYZA 2J7WA 1H2VZ 2QMUB 5C24A 1C4AA 2K3KA 2M52A 5K14B 5J1EA 4DL3A 2RRAA 1TV6B 2F4VF 3K17A 4P2FA 2DHGA 1VMBA 5EWFA 4DPWA 2IA0A 1I1GA 2HG4A 1FWLA 1RTJA 2VJUA 7FD1A 2C2MB 3NCQA 3ETOA 2HS0A 4JV1A 4B3SF 2AZ3A 3CTRA 5KFUA 2Z8QA 4B3TJ 5KFAA 3JSYA 3FRYA 4U8VA 1YZ7A 3B4MA 1NB2A 4NYPA 1U09A 4Q44A 1TK5A 3D6HB 4IH5A 3UD3P 4WXOA 1YHQS 3FNNA 4C9DA 3I5CA 1J5EJ 1URNA 4DCPB 3D54A 1H7XA 4O44B 4WE1B 1F0XA 2HWTA 2OEJA 2LEAA 2ZBRA 4R5PB 1K0VA 1LXJA 4OHVA 3H5SA 5E3QA 4FS1A 1X5SA 1M1GA 1JLFB 4ID5A 3V4MA 1WI6A 4B3OA 2OAUA 1IM4A 2KRRA 3SDEB 2X7IA 3E8OA 1QAYA 3VAGA 3OXFA 2AYGA 2MKKA 1SV5B 1WHXA 4HTIA 3CC4S 2KZMA 1F3FA 3DNCA 4LR8A 4CH1A 1Q16B 2CNLB 4ZP8A 3IWLA 4F7VA 2DGOA 2C2OB 3JSRA 1AB8A 2B7BB 2RKIB 2VF3A 3AJ1A 4DL0C 3HPOA 3UD4P 1K8AT 4WFXA 3NGDA 3PDNA 2P9EA 1GT8A 3ET6A 1DTQA 3ZNUA 2ZH4A 3DOLA 3H2VE 4E2FB 4KPYA 4R25A 1XC9A 1LWFA 2CZVC 1S6PB 4MKAA 4PRFA 2BOAA 4IG3B 5DDRC 2ZNYA 4F0HA 3M8ZA 3I87A 2MDAA 3RR8A 5DJBA 2GHVC 3O8WA 4I2QA 1YRTA 1R7IA 1HR0J 2DGQA 2CPJA 2H5IB 5KFFA 5ETMA 4NLDA 5GAEU 3G6YA 4TNOA 2AT1B 5GAGI 4BC7A 5IM0B 3EWGA 1BQMB 1F9FA 2GQQA 1VCTA 5HBMB 4BDPA 2DD8S 2V2VA 3DLKB 4DR6J 3C16A 1HFEL 2R7UA 1FKAF 3UR0A 2P6TA 2A2DA 3HSDA 2ZC4A 2YKNB 2UUCF 3IR5B 2EFVA 1JLQB 2C3MA 2YBVA 3GV7B 4DFKA 3H7HB 5FJ4A 4DPXA 3J80U 2Q6CA 1TL7B 1WF0A 2XBPA 3CDEA 3FMBA 5LJ3Y 5HP1A 2UVRA 4YB5A 2KYXA 3MM6A 1L3KA 1Y3KA 2MTLA 4WYLA 4NLGA 1AFIA 2GX8A 3LP0A 3LGNA 5G0RB 2BJ1A 3QMQA 1QAJA 3Q8UA 3OL6A 3IP0A 3PW7A 1H6KX 3QZ8A 3DM2B 2ZUAA 3W9HA 1JJCB 1U1RA 1ZZFA 2K06A 2L9NA 3FVYA 2BEFA 2K7JA 5LJ5Y 2FLOA 4P7TA 1H73A 1WDTA 2WW4A 4DX7A 1RU1A 2UUBF 3JSBA 5HJXA 3FJ2A 2ZJRQ 4LQ9A 3WIVA 4J9OA 1JXLA 2PFDA 4X4OA 1YX2A 2AJ4A 2XQCA 2VFTA 4K4VA 1NDPA 4OJGA 2L08A 3W60A 1M5PC 3DLHA 1LWXA 2ZH6A 3OVAA 4DSLA 1SC1B 2HYIB 3NGSA 2MY7A 3UN3A 2XNQA 4CNZA 3KOAA 1ZA1B 1VLYA 2HBYB 2JEGA 4JV2A 1TAUA 2D3ZA 3AD8C 3FCWA 2CWKA 2D3UA 1VQ9S 4ZCLA 2G1HA 1FRXA 1PJ5A 2LDIA 2A18A 1DQ8A 2BUNA 3RBZA 3ZTOA 2D3OR 4DSKA 2AJQA 3NY0A 4FNHA 3W2WA 5A8KB 1IR0A 1RHJB 3N01A 3KDNA 1EQMA 3KLHA 1Y10A 2UXBF 1HYSA 3FQKA 4G65A 3GPAA 3F0NA 4KT0C 4CLTA 4UZBA 1FX4A 2ZBPA 4PWWA 2UUTA 5ETQA 3OUYA 2YKMA 2MSSA 1RISA 4LJMA 2FJXA 5KFZA 2XG8A 1RWKB 2YQ1A 4ANCA 4ZLPA 3AOCA 3J7ZT 3DLLQ 3M8YA 2JFDA 4DV3J 3V4IB 3CMES 1RBLA 3V2UC 2BJDA 1YVFA 4AQYF 3DLEB 1PC5A 1UAWA 2XI2A 3GIMA 2R4FA 1RT6B 3HULA 4PG6A 2E5HA 4DQSA 2UUAF 2QN6B 2CQ0A 4LFCJ 4UQGA 3G96A 4LVNP 2BOPA 4DI6A 1LWCB 1RTHA 1XIQA 3HVTA 3UPFA 3SI8A 4IR9A 4V19X 1KVJA 2DNOA 2H5JB 2BKNA 3V81B 1LW2A 1VQYA 2XMKA 3UE2A 5HL7Q 2J6TA 3R6LB 4HDGA 2F5GA 4B9MA 3GWCA 3G87A 4ANDA 3IMQJ 5KG7A 1UVLA 4F8RA 2FY8A 3P5TL 1TUGB 4P9SA 4QWBA 3KK2A 4DR3J 5DLFA 4TVAB 2WOMA 2GHWA 2QX0A 3UCZP 2PIIA 4RW4A 5M2PA 3SSSA 2XO7A 4MK9A 4F50A 2LEBA 4A8WA 1U1OA 4FYWB 3ZTRA 5KFOA 2VZ9A 1BY9A 1F2HA 4NYZA 4M5HA 5J1PA 4AL6A 4FYDA 4OI0A 1X5PA 1KQFB 3P6YC 4C0HA 2K8GA 3HSJA 3WX4A 2J8SA 2FUG9 4ED0A 2JEJA 4CLYA 5C25B 1R8BA 3FRZA 2OELA 4ZVHA 1RTDA 3SQGA 1N8RT 2JEIA 4JYAF 2ZH3A 1TELA 2XM3A 2BV3A 2W7PA 1WOPA 3ISZA 3SQOP 1BC6A 1NKEA 4ZP7A 2ZOFA 2L9DA 4JI0J 3MPDA 3VAMA 4C0BA 2NSCA 3W63A 4YFUA 1Z4UA 4UT4A 3ZZUA 1Y11A 1F60B 1TMMA 4DDFA 3PO4A 3PTWA 4ID5B 3M1VB 3WX8A 3EUNA 2BKPA 2Z30B 4OLPA 3UNGC 5DLGA 2R2UA 5DM6Q 3PX4A 2DR7A 3ILOA 2VPZB 4PXDA 2CKWA 3OT9A 1FJEB 5E2QA 1KWMA 3P5BP 4HI1A 4B08A 2ZKUA 1FKOB 2RU9A 4O0NA 2RE1A 2UZAA 1K9MT 4OLOA 2ZJQQ 3IN5A 2JVRA 4LF8J 1MW7A 2ZZMA 3ZZRA 4L74A 3KLVA 2EFGA 1N5QA 3DGPA 3MUTP 3HHLB 5KFIA 2GA7A 2UU9F 3BGOP 4J9VA 1WOSA 1SB6A 3ITHB 2ZM6F 1MMDA 2V9KA 1M1HA 3ZZTA 2E7WA 3QZ7A 1RT4B 3HM9A 4MKYA 1AROP 2VKRA 3FC9A 8RUCA 4NASA 4UUXA 3TI0A 2MGZB 4LF8F 2RRBA 1HPZA 1T9YA 3R5AA 2BRKA 2IVMA 2ZITA 3W62A 1XQIA 5HK4A 4EMDA 4DFMA 3QYYA 2KXHA 4C48A 1I94J 5CAAA 1VQLS 2ZH7A 3HSZA 2FHKA 2YWEA 4X66F 1A6LA 4CRJA 2H4YB 3W9JA 3ONQA 3DRPB 2RQ4A 2CVEA 3BDEA 3AODA 2MYFA 1HPZB 5F8NA 2CQBA 2W4PA 1SPBP 4H4KC 3WHIA 1HHTP 3MM9B 2KFYA 1R31A 4I64A 2ZEJA 2CJBA 1GX6A 4CH0S 3SXLA 2KH9A 1CEZA 3RBEA 3DHWC 3FQLA 1ZA2B 2RVJA 2V5HG 1IXKA 1HQEB 1X4FA 2ZE2B 1IJFB 1RWMB 4DCJB 3KJVA 4HKQA 2W7AA 3T9NA 1RTIA 2WZ1A 2RUSA 1DURA 4FNIA 4MKVA 1JIHA 4O23A 3G71S 2H9ZA 2P9GA 2X1GA 3CCLS 4DSFA 1FNXH 4IRCA 1TFWA 1SI9A 1WHWA 2GVZA 2Z57B 2DH8A 1VRUB 4ZHRB 5I4MA 2DR5A 2WRMA 1NNDA 3EZUA 3KLFA 4OZNA 1CVJA 4X4NA 3CJ4A 4KGMA 1VOMA 4WFZA 2LMIA 3E2EA 3OFHA 2CRLA 3A13A 3FKBA 5L1JA 2DPIA 1WI8A 4JI7F 1UWBB 2M5YA 2RHQB 2A2CA 2V8PA 2WBMA 4ZN1A 2OI2A 1VRUA 2U2FA 3CF5Q 4ILLA 3CDAA 1HIYA 1RA6A 1ZM2A 2EBEA 3QSIA 5KG3A 3OSPA 3CW2C 1DTQB 1ZETA 1Y3JA 1HNXF 3J81j 2PE8A 2AGQA 1CJUB 1MROB 1M5VC 3K5LA 5C42B 3QQCD 3PYDA 1E6YA 1R8PA 2JJ4D 1IKWA 2YNGA 1CSJA 1NSAA 2XEXA 2N7CA 1FI4A 2XSJB 4I2QB 4K4YA 2V4QA 4TXSA 3AQOA 3IBFB 2KT2A 1UZDA 3JSMA 4B3MF 4I0WA 1IKXA 1A9NB 2IC3B 4H4MA 1HI0P 5LSRA 2XZTB 5B0AA 1LQ9A 3D1OA 2HHSA 2EPIA 2NCKL 2CYYA 2IM1A 3PFOA 4DL2A 3PVXA 3TAQA 1HQUA 3CJ8A 5AE2A 1NJYA 1FXRA 1VBXA 5B09A 2WVEA 2AU0A 1P9QC 2OPQB 2NYHA 2XHWA 4EWTA 3BKUA 3MR3A 2UXDF 4QYZJ 1LWEB 4ED5A 4NLRA 2W24A 1LOUA 1OJ4A 3W5ZA 2HLUA 1SJRA 4J5OA 4PR6A 3CCZA 1HARA 1MNEA 3DI6A 1OYEA 3MCNA 3TJ9A 1BQNA 3CCVS 4FS2A 1FTRA 4J7CA 3SYZA 1XBWA 4ZVOB 1PIEA 1Y5IB 4DN0A 2OPQA 3PW2A 2J0SD 1HHSA 4PAAA 4BHQA 1GEHA 1NU4A 2HHTA 1TL3A 4MMOA 2BW7A 4DSEA 5IQ6A 2R7RA 3GFHA 3CUNA 1ZZNA 2FTRA 4J9UE 4LSNB 1VDHA 1S57A 1RT6A 3OPKA 3S01A 4Y00A 5H9FJ 4CLFA 2YH0A 8ATCB 4DQPA 1TKXA 1SQFA 2W4DA 1AUDA 1Y5NB 1RADB 1UFLA 2ZWOA 4DOZA 2QA2A 4M8LA 4DUYJ 4DR3F 3BV8A 2CZ4A 2HGLA 4GC7A 1N6QB 1J5OB 2PI4A 4LF7J 4LRCA 3CO9A 4QIGA 1EETB 3I0SA 1C0TA 2ZUGA 3AD9C 2VPWB 3DU6A 3BZQA 1PYTA 2VG7B 3T5KA 3L3CA 4I4BA 2IM3A 1G6BA 2YH1A 3CIMA 1N6QA 1J5OA 3BKFA 2HVZA 2DNNA 2L9WA 2V67A 1HI1A 2J9DE 1RCXB 1RABB 4NLSA 1FKPB 2HBQB 2RQMA 4HH1A 3TA0A 5BJRA 3N9UC 2NLWA 5E5NA 4B3TF 2WSCC 4JI8J 5J2NB 2MSTA 4LIWA 4LREA 1WOOA 3VAIA 3A8JA 2W8LA 1OPZA 3DRRA 3S6EA 1KQGB 1LK5A 1U24A 3OD2A 4LRBA 4PG8A 3THVA 3W5YA 2DR9A 3C3LA 3MUMP 1RWXB 1YZ6A 2LXFA 2ZC3A 3TUPA 5K8OA 2JC0A 2D1CA 4TLRA 5KFVA 4RZRA 5I3UB 1RK8A 4QOTA 4DUZF 1IKVA 3BO2A 4AL7A 2E5JA 2YNIB 2QL7B 1SJ4P 4GMKA 1N52B 4FF3A 4CO4A 4NEZA 2E1PA 4QR1A 3W2VB 4JP8A 3MR6A 3HO1A 3LF0A 3CJKB 4TU8A 2UXCF 4P72A 2LLZA 1TZ0A 2RRNA 3PFEA 5H1SV 5KFMA 1DFDA 1S1TA 1KEKA 2UV8A 1DTTA 3J81U 1VQ4S 2DHHA 1L3VA 3BKTA 1DLOA 3N5FA 1BQXA 4WJBA 1WACA 1T8EA 5SUHA 3Q0AA 1HNIA 4RNMA 1U26A 4WK1A 3MM5B 3PKMA 2HHVA 4C3LA 3LP1B 3DLBA 2IAJB 4ZMMA 3KXDA 2ZH2A 1FJ7A 2QJ3A 1VR6A 3DDIA 2G1DA 3O6QA 1J27A 1QY7A 3H0PA 4ITSA 2PT0A 4HHUA 5KFHA 1RSCA 2R7WA 4LF9F 4W4MA 5KFLA 1H7WA 5J2PA 1HQ2A 4XAKA 3HCXA 3ITHA 4UF4A 3TVYA 3CD6S 4N7TA 3SV4A 4PG4A 1JLBA 3BEGB 1X7VA 2AP6A 1ZAVA 1U0SA 2ACMA 2RAQA 1QJHA 1FRJA 2HZAA 3R7BB 5FDLA 1T11A 1N5VA 4CTAB 1SC3B 2QLWA 3T3FA 4NE9C 3A12A 3LW5C 1QAIA 1UVJA 4RUAA 2P8IA 1S4FA 5DM7Q 1TL5A 1NHUA 3OXGA 3MR7A 4KRWA 4ES2A 1D8ZA 2ROGA 3POTA 3VV2B 2I8EA 2HQDA 2AJ1A 3GJSB 1N0UA 1SL1A 4KIAA 3I96A 2G2ZA 4QWCA 2UP1A 2Y1LB 2R8KA 4EYHB 4OX9F 2HHQA 4OV6A 4K7QA 2UUCJ 1NJWA 5CHCB 2HQ3A 3R2CJ 3FSXA 3OFEA 1MLAA 2XZWA 4J9NA 1XR6A 1NO8A 2M4MA 3PR5B 4O4GB 2KM8B 1T0TV 4DU7A 2EXUA 2V2ZA 1KLMA 4LFBF 1PYSB 3DRXA 3T9ZA 2OSRA 2JLGA 1JLGB 3BQ2A 2JWNA 2W4CA 4NPOA 4DV0F 2QSFA 4I7FA 4J9QA 3TQ1A 4NXNJ 2PFFB 2NZCA 4X66J 3P49B 4ED4A 1X31C 2J6SA 4LFAF 3QGIA 2MZTA 1H0HB 1W2IA 4LIRA 4JV0A 3Q2TC 1ZPWX 3DM2A 2GAGC 5HROB 1GXTA 2YPZA 4O3OA 1SJQA 3K5PA 4OYXA 1LWFB 2E5IA 1R8HA 3KK3A 4PZVA 4NZ6A 2VC1A 1VJQA 1N5YA 4FF4A 4PPZA 2NXEA 5HMZA 1JLFA 3EDQB 4ES1A 2V0NA 2W1BA 3BR9A 4MTPA 4TKTA 5KFWA 1OY6A 1S6QB 2GS8A 3RB4A 2ZD1A 4DEZA 3NMRA 3HSGA 4P52A 3I5AA 2XSFA 4HHHA 2M70A 3MMBA 4L73A 4C98A 5E41A 3PX0A 2I1RA 2MKJA 4QQBA 1NLKL 2B3TB 3K2YA 1S1WA 3N79A 4K5SA 2RSQA 2OPPB 3H5YA 2E1RA 2XZDB 4FDFA 4YY3J 2A6OA 1KR4A 1U47A 2MPUA 2WB1D 2PEHA 3QT5A 4NYOA 4FF2A 5C2GA 1XEZA 1SJ1A 2N4DA 2VG7A 2G9OA 3OW2R 2HRUA 2XMTA 4ZLJA 1SVDA 2H5EA 2O3DA 4N47A 5DETA 4F04B 2DH7A 4YQWA 4DV1J 4YHHJ 3T5HA 1U45A 1CS4B 3IFEA 1HBNA 4G6VB 2XB2D 2HMIB 3KUEA 3U02A 5G0RA 5AXNA 3IBCB 3UVJA 1MN7A 3FEXB 2KYZA 1EHWA 4MK7A 2YNHB 1ROFA 3QJJA 2GMJA 2V2QA 4N8NA 4USTA 3Q8QB 3MD1A 4USHA 5DQHA 1CQMA 5KOXA 3NGTA 4YHHF 3KLFB 3TJ8A 2FZCB 3L7OA 3RAMA 4B3RJ 2FC8A 3GU0A 1WUUA 3C16B 5ETRA 2IJRA 2DIVA 2IVFB 4ELUA 2GV1A 4YEAA 1F2GA 1JNZB 4OI6A 5CYMA 4FPRA 3UD5A 3H90A 1Q82T 1BMQB 2CQ1A 1DQAA 3EDRB 4LSNA 4HI2A 3BO3A 4O3SA 2BJ7A 4ILMA 3GFXA 3VZHA 1Q53A 4LF4F 3D6TB 1HD0A 2FHJA 4BWMA 3UQSA 1LK7A 1Q5VA 1ZM4A 2CQ4A 3CEDA 3M9NB 1S0VA 4UZCA 4OYIA 4FZVA 5ETOA 4CIOA 4RKUC 1YSJA 3DI6B 4IO1A 2Z0GA 3VVTA 3MMJA 3EPGA 1MWYA 1V3SA 3HK2A 2N82B 4IDKA 4I6YA 1S9GA 1KTQA 1T95A 2H48B 1IKXB 1PGZA 3R5DA 2E5LF 3CD5A 2KVQE 1Y7PA 2LQ8A 4M5NA 5AE3A 5D77A 1UA0A 1RDRA 3AT1B 2D41A 3LANA 3SCLE 3VAHA 5C24B 4X4UA 3EGWB 3MEGA 3L7PA 5DQGA 2AYMA 3KJQB 3CJTA 4XDCA 3OJUA 1SJFA 3HLUA 2DGSA 1ITPA 3B4DA 1QAXA 2XC9A 3V6JA 2OMLA 2CQ2A 2BQ3A 3VCDA 2SXLA 3DYAB 3OTOJ 3CB4A 3LQVA 2AEMA 5A0YA 1UFWA 1Q7LB 1S99A 2WB4A 4Y65A 3S8SA 4FVMA 2EW9A 4RW6A 2XS5A 2PEBA 3PACA 3FEZA 3ZC4A 2HZVA 3JYTA 2JVOA 4YDDB 2NPIA 2FC9A 2Z56B 3RBXA 3ZXWA 1REVB 1T9VA 1RT1B 4RL1A 3UDVA 5F8LA 3M8QA 4WBFA 2ZBIA 2NXJA 2AYEA 2PO4A 4QZVB 4Q5VA 4D3GA 2FZGB 4S0MA 1RWWB 2Y8WA 3FBFA 1R0CB 2CQGA 5GAGU 1EAYC 2UVWA 1X5TA 2BVZA 1JLGA 2B8PA 5DG7A 2BJ8A 2V8DA 4OYMA 4RBUA 1WORA 3MI7X 3BDPA 2WSFC 4IKAA 4DQRA 5IWAF 3ZZPA 1RTJB 1SQEA 3I4PA 4FF1A 4BBYA 2ZFHA 2BANB 5T7LA 2DNLA 5IFMA 4X84A 5I3UA 2Q79A 7AT1B 2KXNB 4DSIA 1G1XA 1ZAWA 5HROA 2E9RX 4KKOB 4ZJQA 4KH0B 2YWHA 3HFZB 4CLZA 2MQPA 4G1QB 3RR7A 2HHHF 2ZBQA 3I9ZA 3CCMS 2J8AA 1S10A 4A46A 4WU3A 3SFUA 4DR7F 4IG0B 1PG5B 1XNQF 1ELOA 1H2TZ 3I31A 5A8RB 3MCSA 4OHWA 1OIAA 2DGUA 2Z2MA 5C25A 4U7UK 2JRSA 1IWAA 4YN3B 5L39A 2FJAB 2HQGA 5IZHA 4AXJA 3K57A 1AW0A 3T5JA 4JUZA 1RT7A 2J76E 2POKA 3O5TB 3GV5B 2Y1JA 3POTB 2RDIA 1RE1B 3JQKA 2QZ8A 3OTBA 2J9CA 5A8RA 2GMHA 2WONA 2HNDA 1XMBA 1TAQA 3QO9B 2AZ1A 4OHZA 3GV8B 4DV0J 1YJ9S 3UO0A 4NXNF 1L3TA 2QYCA 2LXUA 3L7UA 1QUPA 4EYIB 4L75A 4OI3A 4WWSA 4QU6A 4Q0BB 2C2NA 3DDKA 4B17A 4V1Ak 5L9XA 2YQ3A 1FTCA 1BQMA 2AJ0A 5CQGA 1U2FA 2C2ZB 5E3CA 2A0FB 1JLEA 2V2KA 1MWQA 3LUYA 2DNYA 3DLGB 4P2MA 5K14A 5J1EB 2XMAA 1HLWA 4KGXB 1KSPA 1RHKB 3BR8A 2HFNA 3DGPB 3ENWA 3G2XA 3WBZA 2GIQA 1B3TA 2YKAA 1FCAA 4FYXB 4CT9A 3ULHA 5DQIA 1T05A 3QIDA 2NUUG 2M7SA 1BWVA 3JQJA 3Q89A 1X4EA 5CD4H 3Q24A 3PRBA 4P6QA 2MKIA 3CT9A 2UUWA 4Q2LA 1YJTA 2V9WA 2DRAA 3DCAA 2D9PA 1S97A 5F0WA 4CO3A 1FESA 4CO2A 2XS2A 4PCQA 3GFZA 2BE2A 2GCFA 2VA3A 3KG0A 4LRDA 3EZOA 2D74B 5BYQA 2DY1A 2F3JA 2HNZB 2Z58B 4B3MJ 4YOEA 1S9EA 3Q8PB 3TWZA 3GIJA 5HVHA 4DS4A 2NYIA 1I3OB 2LDYA 1YLXA 2OPPA 5F8JA 1W7WA 2RT3A 2DBBA 1APSA 1NPPA 1C1BB 4C8YA 1SV5A 4ZVFA 3JTOA 4HEA9 4I69A 4Y3CA 5F3ZA 1KC8T 1Q8KA 2AGPA 2XLJA 1PAUB 2J0XA 1NKBA 1N32J 2IMWP 2E9TA 8AT1B 1N54B 3H42A 1UPPA 5L1IA 3IM9A 3G9CA 5FLXU 3P8BB 1AA1B 4I2PA 4IFVB 1SCJB 4HDHA 3W64A 1B7FA 3MTKA 1DBDA 2K3IA 4WZMA 1GX5A 1QD1A 1S1VB 4FVCA 2DHSA 3HDSA 4CLUA 3PR4A 1NXIA 3UCGA 2GO8A 5IQQA 1NSQA 1IVZA 1OS5A 1IR2A 2NZ4A 5LXRA 2MQMA 4EUVA 4OQJA 4RBVA 2MQNA 4XK8C 2DNRA 1UW4A 1VGYA 2J9DA 4C8LA 3G4SS 2Y1RI 4OZ1A 3D1HA 3CCJS 2HVIA 2HFOA 4ZPWR 3LP2A 4UOGA 2F4FA 4R8UB 2R8JA 3SMZA 2BKOA 1SH3A 2IIHA 5IM0A 3TANA 1JK9B 2HS3A 3CJQA 3PYGA 3RUBL 1RWVB 2ZD1B 4PKDB 4ZLLA 4DSJA 3SEOA 2O1PA 3KLEB 2RQCA 1GMUA 2G2OA 3S7RA 1TFYA 1JLQA 5EN1A 4USIA 1YJWS 2HWIA 1YKWA 1IBCB 4G3IA 2RB7A 3KLHB 3G82A 2GGPB 3QLHB 5KG6A 4U67Q 4AT1B 2AYBA 4DR1F 1OPIA 1NK0A 4LF4J 4AL5A 3M2RB 3FSIA 1LW0B 3HHLC 2VBYA 4U9RA 5K5MA 1MMNA 4QIWD 2XCPA 5ETSA 1IKWB 1YBAA 3GYXB 4LBIA 4NLUA 4DL7A 1X0FA 5HQMA 3RJMB 2DEJA 4K2JA 3NWGA 4PYAA 3TARA 1NHKL 2BJEA 3S1TA 2EEYA 2R7VA 3KNAA 4WP8A 1TUWA 4DPUA 2HFSA 4QR0A 4DR1J 1VQ5S 2CJKA 1FO1A 2OO4A 4RW8A 4CLPA 2B43A 1RAEB 4LUBA 3A8IA 3U1MA 1TKXB 4B9LA 1N34J 2V34A 1QE1B 4K4UA 1O0PA 2VOOA 1V3RA 2I0XA 2VONA 4KR0B 3QJLA 1RAIB 4F4AA 3SQGB 3A3NB 3DOMB 4YUDA 1D1UA 4PQUB 5F9LA 1FDBA 1UEKA 3GLJA 3M8QB 3AB2B 3KHRA 1SUQB 1U4BA 3IR7B 4B9SA 1Q4RA 2DJWA 2M9KA 1FK9B 3T5LA 2XLKA 2JZ5A 4EBCA 4Z7YA 3CCTA 2VFUA 4PQUA 3PIPQ 2W2NP 4M5IA 2W2PP 2VKZG 4DV5J 2ADCA 4RU9A 2Q6BA 2WVDA 2GQCA 3BQ1A 4DR7J 1FXLA 1EP4B 1QSYA 3LPYA 1NH7A 1WEZA 2CWXA 3OFFA 2EC0A 1YWXA 4CWBA 1XERA 1WC5A 4Y2AA 1YJUA 3NOGA 1PO6A 3H2LA 1TV6A 3TW0A 1O51A 2AW0A 3HJVA 2YKQA 5GMDA 1Q8BA 3KDOA 3NCPA 2ATCB 4C11A 3JYTB 3KHLA 2ZJPQ 4K50A 1MMLA 1RBAA 1WSVA 3PW5A 4NI2B 3Q22A 2UVUA 1TKZA 3G6ES 4DFJA 2F4VJ 1X9MA 2J0WA 3DMJA 1Q8LA 3X1LB 3FSYA 2X1AA 3CGIA 4A8YA 1VISA 3JTPA 4DXLA 1Q78A 1LWCA 1RTHB 3PHTA 4B9UA 3R7NB 3AHPA 4C11B 2XY7A 4EI2A 2E7VA 4NLTA 1K73T 1A0OB 1SKWA 2A3JA 4B3SJ 5KT3A 3RRHA 2L48A 1KS2A 3FZ2A 4ZN3A 4EO8A 3H98A 5B08A 2BANA 1CULB 4A48A 3K7RA 3RB3A 5KFXA 5D8HB 5AXLA 3PYEA 1EQ0A 3GJQB 4Q0BA 1UWAA 2FB0A 4LFAJ 4DR5J 1R6VA 2O5DA 4LSLB 1URRA 2ROEA 2OEMA 3TNVA 5D3GB 4C8KA 4TY9A 4O3RA 2LEPA 3QRPA 1N56A 2XMWA 2JLEA 1U1NA 2QFIA 5JMNA 1RT3B 1IQZA 1KHWA 3CNQP 3D4JA 4CO5A 3RZAA 2YNIA 4RLEA 1XMOF 4M5KA 2CPIA 3LTOA 3AXKA 4P10A 3V6DB 2V68A 3TAMA 1S79A 1V6HA 2MMYA 4KO0B 4MIWA 4ZCKA 2R2RA 4ER8A 3DRSA 4U8YA 1IN0A 4ZPVR 1KRPA 1XR5A 3I9V9 5E3RA 3HJFA 2KFZA 1N5TA 2I9SA 1M0SA 3FCVA 4NOHA 4TU7A 4N41A 4R5PA 5JVGQ 1YRUA 2ILYA 2I38A 1SH2A 4ALZA 3VR1A 1TUVA 5HQLA 1RB0A 2EFNA 3M2VB 4MAKA 2V4JA 3BGRB 2OMOA 3MAAB 3NGKA 4FKYA 3SCJE 3MAQA 2X1FA 4JV5F 1K1QA 1C0UB 1JKHB 5LMNJ 5I42A 3KUGA 4KBIA 3MEKA 3W8PA 1LFWA 5KT5A 4RUCA 3RB0A 2OTLS 1PJ6A 1S1XA 1ZPVA 4FBTA 1U1MA 2Y1IA 2I2YA 3OVBA 4C6AA 2J7UA 4MYUA 1BWEA 3OLBA 1NJXA 1BE4A 2DVIA 3VGSA 1NK5A 3LALA 3EE3A 5G4DA 1Y0HA 3DLKA 1UVNA 2VG6B 1VC5A 4JV5J 1ZBTA 1NBEB 2V6AA 3OR2A 5A6PA 2NQPA 4DLEA 3NP5A 2BMBA 1X60A 2VC0A 2F65A 1UWBA 2VFVA 2BJ9A 3F56A 2C1EB 5KT2A 4DV7J 1VFJA 2VFRA 2CNKB 5D78A 2VG5A 3IRXB 1JLAA 3MHYA 1S7IA 4N77A 1S9EB 4OYZA 1JJ2R 1VJWA 2XMMA 5KT4A 3KG4A 2W9BB 3R3TA 3M6VA 4MH8A 4HT7A 3TR5A 3GSIA 2HPUA 2CJ9A 5CYMB 3KMSA 1T02A 2LFVA 4ECTA 4ZJOA 1YJNS 3W66A 2FLPA 2DTJA 1M90T 4Y2CA 4E8UA 3TZZA 4DV7F 4KV8B 2WCXA 1IBMJ 3T1AA 5GMKa 2MEWA 1FFSB 2FJDB 4HYKA 1I94F 4P2XA 3VZIA 5KT7A 3JSMB 2LU2A 1KKHA 1P6TA 1RAHB 4NZ0A 3RW6A 5JVHQ 1ACMB 1S4EA 3IA0A 3D9BA 4LSZB 6AT1B 1Q0NA 4R0EA 1VHFA 3Q8YA 4C3MA 3CWJA 3HHLD 4ECQA 4NLXA 4A8SA 1N33F 4WCEQ 5B0CA 1OY9A 2OJ3A 4C4WA 2ZNZA 2P2CB 3LP0B 4TY8A 5HQ8A 1Q8IA 4X62J 2BQUA 1R0AB 1LV5A 3PEHA 4JI4J 5CH7B 3TUJC 3G6VA 1RLDA 2OFHX 2WW8A 3TO8A 3M6UA 5ETTA 3FCHA 1MG7A 5KFCA 4ECYA 3NMAA 1GH8A 2AF6A 1VIOA 4ID8A 4GO7X 3TEGA 1X9WA 3EM1A 3PRVA 3CJ3A 3C14B 1Q1KA 4WU2A 2APOA 4L3NA 4QW8A 4IG3A 4KFBB 2MY8A 1G3OA 2B4VA 1VQ8S 4ELVA 1WTFA 2GVDA 3ILLA 5A8WA 2LVWA 1D09B 2J7KA 2RIJA 1O5JA 1R27B 2ACYA 1REGX 1HBOA 3H20A 3I0RB 3NGUA 3PKYA 3SZ2A 2DITA 1S77D 2GIRA 4LMZA 4PWDB 5DDQC 3MURP 4F4YA 2VQEF 1HNZF 5J1NA 3GSDA 1HNXJ 5JXSA 2L41A 1RI7A 4ZVGA 2OHDA 1FXDA 1WHVA 3ZTQA 3RBDA 2OD4A 1EIYB 3J7Z5 5EDWA 2QSWA 5KFSA 3KUHA 2NR0A 2EVZA 1UCNA 5LMUF 3VF0B 4OYWA 1H74A 2HWHA 1PILA 1WEYA 4LBPA 1UVKA 4EFAC 1C2PA 1HBUB 3OL8A 5ITHA 3TVKA 4KE5A 1VQ7S 1M5KC 3LO3A 1FJGF 3HVTB 3MECB 3M32B 5HP1B 2BJ3A 1QDUB 2UUAJ 3BH6B 3CD7A 4ED8A 2A10A 5D3GA 3J7YU 3MFHA 4LFCF 3HHEA 1ZAXA 4BWJA 1I5OB 1FK9A 2KKHA 1R8AA 2DNZA 2OFGX 4MFBA 3HT0A 4NEYA 2UVVA 4RW9B 4UUWA 2AMCB 3EYZA 1DZ5A 4C3KA 3PXGa 3MM5A 3NRBA 1FRMA 4OX7A 1VK3A 4Q7AA 4PABA 2Q3PA 3MPVA 4RW8B 2XTJP 5D15A 4DPOA 5JUMA 4J9LA 4DV6J 1NZAA 2YNFA 4P2SA 3GB0A 1CJKA 4FBUA 2E7XA 1TL3B 2IY5B 1IBLF 3IXQA 4CYUA 4ZS6A 5CD4A 3DKDA 1WF2A 2ZHOA 2WVFA 2BRLA 3BB5A 3LA0A 4URSA 4CT8A 1U1KA 1F5BA 3IG1B 3EMTA 2DGTA 3TX8A 3PJ9A 1GK8A 4ED7A 3AAWB 2J6UA 3RW7A 4AQYJ 4X65J 4IUFA 3VAJA 3D0IE 2G2YA 2QYGA 1DQ9A 1OQ6A 2VBXA 3HT3A 5EHHA 1T7PA 4PQAA 2BQRA 2IRYA 4DUYF 1RTDB 2BACA 3R8YA 3BM7A 4R0JA 2OIHA 1WG4A 4NCAA 2KHDA 3IS9A 1RU2A 1T9WA 1VBYA 1YIJS 1EP4A 3MOJB 4JI3J 3PW0A 2ASDA 3BYRA 3FZBA 1HBMA 4P71A 4C8NA 3GILA 1HWUA 2IAJA 4F3OA 2LQ5A 4DF4A 3MUVP 1T9TA 1V9OA 2GHPA 4KHPF 2HAFA 2EC2A 5F8IA 5DGBA 4YR2A 2DHXA 5L46A 1VC0A 4AUKA 1VQMS 2IJFA 2B7CB 3UDEA 2BX6A 5D6GA 1JLCB 1VQSA 3O2IA 4WTYA 4F36A 5DZ7A 1YDLA 3M05A 4ZDNA 4NI2A 3WC2A 2FGCA 3BQ0A 1TKDA 3EGVA 4Y34A 4RJVA 3DRRB 4ES3A 2BABA 2ALYB 4WFNQ 2VQFJ 2HQCA 2MHEA 3KK1B 3R1LA 2FIUA 1RWUA 1UA1A 2F7VA 1RAGB 2EK6A 3P96A 4WXWA 3JQMA 2VPXB 3HVWA 4L76A 4C97A 3HI9A 4F26A 3GR0A 4U95A 2XYGB 4LRFA 3J80Y 1GXLA 1PYOB 4F0MA 4EBDA 1OMSA 1CJVA 4MT1A 3DHXA 5DG8A 5E3PA 2RU3A 2AD9A 2G13A 2CVIA 3K5OA 5DDOC 4F4WA 3SBMA 4ED6A 3K0JA 1S5ZA 2EG1A 2ZM6J 5EUHA 4ED1A 1NJZA 3H40A 3BO4A 2BR0A 1HWLA 2GZOA 3QT6A 3V81A 4O44A 1PC4A 2HNDB 1P1LA 3VVUA 2GVZB 1BLUA 2DGXA 3H59A 4IH6A 5T7LB 3SSRA 1X4BA 5F0UA 4O0IA 1N32F 2QO3A 3DOKB 1OSDA 4LVOP 3DOLB 5HVFA 4IO9Q 1TL1B 1KFSA 3TOQA 4I7FB 2QA4S 2CG4A 3MM9A 2J9EA 1Y9OA 1OYDA 1FRLA 2HFZA 3B78A 1Q95G 3OFGA 4HLBA 4IG0A 4P74A 1HR0F 1F5AA 4O3PA 4AD6A 2E5GA 4E0DA 4U7CA 1MSWD 1SC6A 3D6FB 1LFPA 3T6JA 1NSKL 1T9XA 2YTCA 3M8RA 1IKYB 4U6PA 1TL1A 3F41A 5LMNF 2EI5A 4QW9A 2KN4A 3DXSX 2WBRA 3EGNA 4A47A 3BPDA 3NEKA 3M2VA 4X64F 3CCES 1N36F 3KNGA 1IQTA 1T03A 1WNEA 3U1NA 4ZIVA 4IYQA 5C2CA 3QIPB 1VIXA 1IM6A 3OL7A 4LF6J 4M5LA 3WDOA 4KO0A 4GKJF 5CCLA 2OPRA 3LGMA 3Q83A 3D67A 4DL4A 2NSBA 1HMVB 5BR8J 2W2MP 4ZOSA 4J91A 3MPYA 1DJ0A 3DLGA 1EJ7L 2HFVA 3G86A 2C22A 4AFFA 2ZE2A 2ZDOA 3KJVB 1DAXA 2XS7A 3AXMA 1ZOTA 3CCRS 2KJVA 3NOCA 3PG9A 1SKUB 5GVQA 1T05B 1NEEA 2YNGB 3QGHA 4M1KA 1UPMB 2DCUB 6FDRA 4M95A 1H3DA 3JAMU 1S0OA 1XNRJ 1IR1A 1JKHA 2QTWA 1UMJA 2MKSA 1VS3A 2DGVA 3D7SB 5E3AA 3UWTA 2MZ1A 5J2MA 1R0AA 1VBKA 1WG1A 3M8PA 4B9VA 1EKSA 3LOUA 4IQMA 4IR1A 2IA6A 4ZVQB 1V5IB 1H2UX 4W98A 2P6SA 2QG9B 2C2EA 2VUGA 5EGYA 5KFJA 2BBEA 2VQEJ 1IUJA 1WTBA 1MWZA 3MPUB 1YK9A 1YQHA 2FHJD 3CDWA 2HNYA 4OYPA 5C7PA 3NCRA 2MGZA 3BYPA 4A8KA 1OSCA 2QLJB 3QFHA 5KTQA 3K59A 4O3QA 2NUHA 1JXVA 3O1LA 2FVQA 1K0TA 3BSNA 3QJPA 1FWPA 1C0TB 5LMUJ 2C3OA 2QRRA 5D4OA 4X62F 3ZZZA 3HFVA 3KHHA 4A8MP 1SL0A 2E1AA 4WK3A 3I55S 3GP9A 1QM9A 1S1WB 5HO4A 3ZFVA 1FJGJ 2HRYA 3E3XA 3PJWA 2H3EB 3AOAA 2KJWA 2CQ3A 3BBBA 3BS9A 3M30B 2ZHAA 3OL9A 2M8HA 3A8KA 1UETA 4I2PB 2W9AA 1S72S 2H51B 4DU8A 3C15A 5IXUA 3VALA 1RYRA 5E33A 1HQUB 4NLVA 4CM2A 4K2XA 4OI2A 1W2BR 3PIOQ 3R5BA 3L4BC 4FXDA 3KWMA 4DV3F 4DG1A 1S59A 3M4XA 5HJYA 2FJVA 2IFXA 4KFBA 1HNZJ 4M5GA 2EFQA 1VK8A 3THTA 1GMWD 3T1YF 4ZCMA 3KFWX 1TMJA 3PRDA 1QTNB 3C66A 2FJEB 3EJMA 1HA1A 2GAHC 2H54B 2CPXA 2X1BA 2ABYA 2C3PA 2YNHA 4I68A 3RYLA 3ZTSA 2KU7A 3CE8A 3W2WB 2R8IA 4DUTA 4ZK7M 5KFBA 1LKZA 2DISA 2HGMA 2WHOA 5SZTA 2CPEA 4ETZA 4KGVB 3LWLA 2DEIA 1WC6A 2JL9A 2WAQD 1K47A 1P9YA 2GJFA 5M2RA 4CYUB 1NM2A 4LR9A 3KLGB 2RF2B 2RILA 2RQKA 2ZVSA 3D28A 4EEYA 4JI3F 4K59A 2KZZA 3B6BA 3O44A 4ECRA 1S7HA 1NMEB 2Y3YA 5L8RC 2AV5A 3WQPA 4LF5F 2F9DA 3MF5A 4I6WA 4KC5A 2B4OA 3ICLA 4P7VA 4KHPJ 3H8YA 5LT5A 4AXIA 2Q1LA 2COLA 2ATLA 2OGUA 4MFBB 4HR2A 2MZQA 4ZLNA 4RW9A 5KFNA 1GMVA 2LU1A 2M3DA 2VIHA 4KJIA 1HHQA 1LW2B 3P4UB 2WONB 1JLBB 2MHNA 2HIYA 3D3CJ 1DY3A 1GTHA 3FEYB 3FGVA 3OTCA 1U1QA 2GFFA 1XMOJ 3K5MA 1B0PA 2IDLA 1TU0B 3SIPB 4ECVA 2VU5A 3MOZA 4CTAA 4RR5A 4KKOA 4RNHA 5H9FK 4WKYA 4ZJLA 4CP5A 2CPHA 4FPIA 3A3PB 4F4KA 1S6PA 4CH7A 2MJNA 4CDIA 2HZCA 3LPEA 1C1CA 2C3UA 4CZCA 3QNWB 1D8YA 2GO9A 4USJC 4OYOA 1N88A 2YX4A 2AX0A 3C46A 2XMJA 4HVZA 1M5HA 1SC4B 2FD2A 2VH7A 2HS4A 3D2WA 1DARA 3MMCA 5AXMA 3Q23A 4J9KA 1ZTTA 3M8SA 2MLYA 3IS9B 2R9LA 5ETNA 4ZVUB 4LQ3A 2R2SA 4WE1A 1C1CB 3DMJB 3MTJA 5D0EA 5AXKA 3HZGA 4I67A 1TVRA 1RKJA 1D0EA 5AJ3J 2ZVIA 2J5AA 3NBPB 4USWA 3D6MB 4D3HA 1IBKF 2UU9J 3MDFA 2I5JB 2LA6A 2M2BA 4CO1A 4DPTA 1DLOB 3VGVA 5F8HA 3RTVA 5H9EJ 3QBCA 1JXEA 1V5VA 2DY9A 4FKXA 4G1PA 5CCMA 4JYAJ 1A7GE 4JOUA 2ZH8A 1F6TA 4DL6A 2UXCJ 2DT9A 2FYXA 3MGJA 2PMHA 1H38A 3MMAA 2W2QP 2ZKTA 1QSLA 3LAKA 3EPIA 1D3WA 3PHEA 1FKPA 3Q8VA 5EWGA 5AJ3F 5A2QY 3KG1A 2CFXA 2VBZA 2EG2A 3DU5A 4QWAA 3ZTPA 2JLFA 1RWOB 1SKRA 4X4TA 1P1TA 3HZEA 1NJIT 2B6AA 4FXVA 4F0KA 5A2QU 3PO5A 4GKKJ 4WZQA 1YJRA 3DRPA 1AFJA 2JX2A 3QT8A 2ASJA 2CIMA 1JMTA 4E98A 4LFBJ 2VODA 3NNCA 2R3VA 2KT3A 1FVQA 2D9OA 1HWIA 1R89A 2YVSA 9RUBA 1W25A 1LNQA 2VFSA 2B0GA 4YB6A 4BCAA 2RDJA 1T03B 4CI0B 5T41A 4URGA 1OQ3A 3GCXP 2G0CA 1WELA 3TZYA 4J9PA 1QTMA 3DOKA 4F2RA 1CLFA 1CPZA 2RHSB 1KN6A 1Q79A 2XGQA 3EX7B 2HURA 3ENAA 5GAHU 2KG0A 1PKUA 1JNRB 1KONA 2QC3A 2O67A 2QMXA 1M1KT 1JB0C 1N33J 2IRXA 1GMWA 2OPSB 3CO0P 3K8VA 3R27A 3R9LA 3CJRA 1KLMB 4A8OA 4X64J 2DHAA 2H1YA 4KB7A 4RO0A 3E51A 2VASA 3DFEA 5T14A 3KMQA 1S12A 2KT5A 2WVBA 4LF6F 2MKCA 4N8OA 5LM7E 1G2EA 4OZ3A 4IFVA 1UZHA 5B7WA 3R97A 3CCUS 4B9NA 1AT1B 1U02A 4ZPCA 3T1HF 2DNKA 2WK4A 1U8WA 3L9ZA 3OR2B 4TYBA 3J7YI 4QBUA 3QSYB 4NA3A 2XHCA 4UOHA 2NPFA 3C6TA 3C8YA 2CQPA 4NZ7A 3VAKA 2HVHA 4FYYB 2XNRA 2DXDA 4K5RA 3C2PA 3TA2A 4PUOA 4K0KJ 5FDLB 3DLEA 4FXWA 2D7SA 2VDIA 4DV1F 1XR7A 3P3DA 1KQKA 3JB9k 2IC3A 5ADZA 4DF8A 1L3UA 3NS7B 4H4KA 1U6ZA 3AA9A 5K20B 2Z2YB 3LP2B 5D0HA 1Z2ZA 4RNNA 4DHVA 2HNZA 3EXYA 1WF1A 3HFKA 1NK7A 1QSSA 2EKYA 3V6HA 3BN4A 1HW8A 4KV8A 3ZZ0A 2QA4G 4UY85 4WTOB 5KAKA 1FRKA 4L6V3 2GC8A 1VQNS 3KLEA 3CCSS 2HIQA 2DCLA 3ZZYA 3CJSA 1YBTA 3PZPA 4IFYA 4LRAA 4URQU 2E1MC 4OV1A 1D9DA 3C15B 4CLSA 4C2MA 4N56A 1XMQF 3PNIA 2CJXB 2CUYA 3L95X 4OI4A 2HEKA 4Z7CA 5BYSA 3OR1B 1T3NA 1HNVA 4OL8A 3HKWA 4ED2A 1E6VA 3GIKA 4DFPA 4DQIA 2VOPA 3H5XA 4MK8A 1FFGB 5KFDA 4USKA 1RT5B 1VRTB 4ZVRB 2Z2ZA 3W5XA 2JHEA 5IT4A 4XPCA 5IOLA 3GMGA 2QT7A 1ZH5A 3FFIA 2M88A 5F3TA 3GIIA 1XMQJ 5MLCV 3B8HA 1N5YB 5LL6d 2DIUA 4F02A 3BSCA 5HMYA 1FFWB 2UV8G 2DYAA 2YX1A 4PYDA 4ETXA 1PJ7A 4TYAA 3V5RA 3IBWA 3BBFA 3AFGA 3E01B 5GADU 4C8ZA 2Z2LA 4B3RF 1S49A 1U25A 2KRBA 4DX8H 2K1RA 3N0VA 2LECA 1RXOB 1I6JA 4ECUA 5L38A 1RP5A 1HWKA 2HKEA 4KY3A 2B8QA 1TKZB 1HYSB 1YTYA 2HBRB 2IVYA 3JTNA 2CNNB 1HBUA 3Q2SC 3TRGA 4IDKB 4MKBA 2YKMB 4YMEA 2QIFA 3HXMA 1SKSA 2Q43A 4DZDA 3EGZA 3ELHA 3F73A 2DRBA 1QLNA 1FE0A 2IRUA 4PXEA 2DXFA 2LQ9A 3MM7B 1RT1A 2VBWA 4HL9A 2GVDB 4ZCIA 5B0BA 1NDKA 1PSDA 3CPWR 1X5OA 4K4WA 4DUZJ 4OIXA 2B9WA 5DG9A 1FD8A 3K5NA 3F44A 4JI5J 3R7SB 2MKYA 3BF4A 3MM8B 1XTZA 2KB2A 5KG2A 1HL6A 2NXNA 4Q43A 2E5LJ 3CVKA 1HNWF 2AHOB 3HHDA 3NGRA 1XWLA 1BGXT 1FDNA 1R0BG 1SXLA 4KH1B 2DKOB 4JI0F 4XDDA 3WZ0A 2BYCA 2AEJA 2CQDA 4Q8FA 2V8VA 2QV6A 3QO9A 5HSPA 3OLAA 4WKRA 1SBRA 1HWJA 3CJ0A 3K8WA 1EARA 3LAMA 3VWSA 3V6DA 1RZMA 2KVIA 1RTZA 4KAIA 4JB8B 1VI7A 4F3MA 3M32A 1FT8A 2GIFA 3QPIA 1U0HB 2X3GA 3KLIB 3TJAA 5C5JA 4WF9Q 2ZH1A 2LP4A 4ECWA 4OZ5A 1KHVA 4YB7A 2RD5C 3WIUA 4X4QA 5J2QA 3KLGA 1CULA 4OHXA 2BA9A 3M1VA 2LQJA 5HI7A 1O8BA 1SIZA 4GVLA 4NRUA 3QRQA 3QATA 1U6BA 3HMJG 2B4UA 2XCAA 1NK4A 2JFKA 3NXZA 3G8TA 1S1TB 2R7QA 3PJXA 4PG7A 2MQOA 2FJBB 2YWGA 5J2QB 3KJFB 3HVAA 5CABA 2MQQA 3OJSA 2Q66A 1T3OA 5D0RA 2NXCA 1WC3A 3GJRB 5IV3A 3OHBA 1UEUA 3KK2B 1RBOB 2PA8D 4ELTA 1H98A 2LQBA 1ICEB 3GTYX 1VC6A 4DCOB 3TUIC 1TK0A 3ZNJ1 3TAMB 3BSAA 1T94A 2C42A 1RA7A 1PCAA 3D0HE 2W9CB 1TVRB 5I3QA 2VG6A 2VD3A 5BYRA 2XYPB 3TEHB 4YP3A 2JC1A 2YQ0A 3W1YC 3A8EA 4WIQA 4LF9J 1UEVA 4GKJJ 1X0PA 2GW8A 3RRGA 4H54A 3GCWP 4J90A 1F9HA 5HMXA 2HHHJ 3THPA 5A0YB 4Y28C 1ZTWA 4MJKA 4HT5A 4UQTA 3T41A 2N7YA 5HATA 2ZOGA 3TX0A 9ATCB 2ZH9A 2AGOA 4JI2F 3FBEA 1TKTA 4QIEA 3JAMY 2DNHA 1FRHA 2BE2B 2GQ2A 3I6PA 3FUYA 1RQ0A 4GRSA 4KGKA 4LR7A 4M5MA 4PEOA 4QR2A 4EZ9A 3BGUA 3T6BA 4DV4F 4GC6A 1FVSA 5CYJA 3I4HX 3VHQA 3C6UA 7FDRA 2IDEA 3IC1A 4OJ3A 2GNKA 4XPEA 1VQOS 4M63A 1TL7A 1HQEA 1YG0A 3CDUA 2AEFA 4F3QA 4DN9A 2RJZA 5ETKA 4A8XA 3MM6B 1PBAA 2OP5A 3K89A 2I6WA 4UTGA 4JI1F 2CG8A 2FJWA 4AYBD 5KT6A 4OX9J 2YWKA 2PC6A 3M8PB 5I3PA 3C6UB 2CDRB 4UOFA 1PBUA 1RAFB 4ZPAA 4ZVTB 3MFIA 2V4RA 3J81Y 1HD1A 1M5SA 5IT0A 1BQNB 1FRIA 2DNMA 1BHNA 2LCWA 1IWGA 1FEHA 3QFWA 4WPAA 5DRKA 2F8EX 5DZ6A 3T19A 4RPFA 2YPYA 3QGGA 2PMZD 3EZ5A 3FMWA 4F4ZA 1WKLA 2KL8A 2XO6A 2VB6A 1EKRA 3G6XA 1P8GA 1NHVA 1F9EB 2HRTA 1NAQA 4BC9A 5KFEA 3P45B 4CLLA 3BREA 4DQQA 2QE5A 1UL3A 2MQ8A 4RNFA 3OSNA 3RAQA 3BPSP 3H2UB 1SIWB 1RT7B 3KK3B 3L09A 3TZWA 3T1HJ 1RTIB 2MLZA 3NS5A 3B82A 3I56S 3PEJA 1HMVA 4KHMA 3NS6A 6FD1A 2YWFA 4CCHA 3QT7A 3FDSA 1TP7A 2YKPA 2RNEA 3CD0A 2XWYA 5FIIA 3RG6A 2K7KA 4NLWA 2NREA 1EZZB 1ZS6A 3UVJB 5L1KA 1WJ9A 4ZP6A 2EK1A 3DXBA 2HQIA 4Q8EA 4BS2A 1B0TA 2E9ZA 2PGCA 3M2UB 1JLEB 1WC1A 1MN9A 2CAJA 3N6NA 2F9JA 1R3NA 1U6FA 4GVBB 1UVIA 2OUGA 5F8MA 2OTJS 5IS2A 3AJDA 1QUVA 1CJUA 1MROA 3N4WA 3OBIA 3MCMA 2W7OA 2N4CA 1WC0A 4X4VA 2V94A 2KDOA 5IT9Y 1RWNB 1RCOB 3EVWA 5K8MA 1WC4A 3TZXA 4K4SA 2VDHA 2XWXA 2RS8A 4UOCA 3W8GA 2QFJA 3G82B 3QLHA 5RUBA 4QPXA 3NLCA 5CYQA 4QWEA 2AIRB 3EVMA 2FVPA 1RT2A 1LW0A 2FQQB 2VHGA 3US5A 2W2OP 2XI3A 4NLYA 2DH9A 2ROPA 4LF5J 2CDQA 4HACB 1NKCA 4B9TA 1GNKA 4OHYA 2YNFB 2FDNA 3GJTB 1RAOA 1AYEA 1Q5YA 4H4OB 2FVCA 1RT2B 3OR1A 4DR2F 1UTAA 2B4PA 2QEXS 4RWXA 5KG5A 2QGFB 3DLJA 5HLFB 2EKNA 3PW4A 4K8RA 4J37A 2XSJA 3ISND 3KKFA 4NX9A 4IRDA 2KTQA 2IYGA 2AKWB 3HD1A 1KBRA 2K2PA 5A6WA 5ETVA 4EBEA 1CC8A 2XULA 1S0MA 2OD6A 2PSZA 1OO0B 3ISNC 3UN5A 1N34F 1VQKS 4JI4F 1SJ3P 4PXBA 4M5DA 3NG8A 4K4TA 1Z2LA 2YKOA 4NMLA 5CZVA 4EO6A 3Q8RB 3E01A 4Y0FA 3IO1A 2QLBB 1E6VB 4NL5A 5ETLA 3SV3A 1XN9A 1N0VC 4B02A 3V4IA 1GAOA 1ZM9A 4RWWA 2DPJA 3G8SA 1KVIA 1VYAA 1S9FA 5H9EK 4G1IA 1JQGA 4MIBA 4NCGA 4NCBA 4WP9A 5EWEA 1N5SA 1UJ5A 3VAFA 5F41A 1YITS 1KD1T 3A4TA 1IBKJ 1RHRB 2YWWA 3M6XA 2JEFA 2MZRA 3NBPA 2HFUA 2R7XA 2RUGA 3U1LA 3BGLA 5C42A 2YX7A 2FVSA 2KFNA 3SFGA 5A8KA 2R8HA 3OTEA 3GZ7A 5KFYA 2N3LA 1B4SA
chains in the Genus database with same CATH topology
1NRKA 1YJVA 4O4RA 3RB6A 2BXJA 3MECA 3GR1A 2KM8C 1M5OC 2B9YA 5K8PA 4RW7A 4HTJA 5DO2A 3J7A1 4NA2A 1S48A 2P5VA 2ERRA 3MPWA 1GQEA 3V6KA 2C2RA 4X4PA 1X4CA 4F4XA 3K58A 1DHMA 3KK1A 2OSQA 2R7SA 4RW7B 5EX0A 2A1BA 2RKIA 2IHR1 1U1LA 2C28A 5JJBA 2FHMA 1K1SA 4F67A 1FDDA 5B0DA 3UR3C 4A4JA 1S1UA 3BN7A 1GXUA 1S76D 2DO0A 1UJ4A 3VQSA 4IOCQ 2G4BA 1FJCA 2HHUA 4RW4B 3MD3A 3HX9A 4DS5A 2VA2A 4DR4F 2R2TA 4X65F 4QU7A 2MZJA 4RUHA 1FDAA 4IQXA 1OWXA 1GTEA 1V3ZA 4C7QA 2KHCA 3NNHA 1JX4A 1HI8A 3R1HA 1B0VA 2F1FA 4KSEB 4Y2MA 2PN6A 4IOBA 2HHWA 4DL5A 2LA4A 3PM9A 3OHAA 3KHGA 1S1XB 2CJAA 1JLCA 4PWUA 4OFZA 1UJ6A 4A8FA 1RT4A 5AE1A 1NK6A 2KXFA 2VV5A 4CO0A 2ILZA 5DS7A 5J2MB 1TKTB 2LYVA 1KOHA 4NA1A 5HMWA 2VQFF 2DNPA 1N4LA 2O66A 3H25A 3U27A 3QAUA 2BM0A 2MQLA 1E6YB 2AX1A 4ZPTR 2M8DB 4W92B 3SFUA 2VG5B 2KI2A 2CPFA 1FKOA 1S6OA 2B51A 3IRXA 5KG4A 1NK0A 4QPTA 4H4OA 4B3OB 1C0UA 5I42B 3M9OB 5M2UA 3ENQA 2XY6A 2VPYB 3CXCR 2BW2A 4MIAA 4WFYA 3TP2A 2E66A 3AH6A 3MAHA 2F40A 4Y2IA 1Y5LB 1KNZA 3UI3A 2KO1A 3N28A 2B5JA 1ULRA 2EWHA 4WFAQ 4LSLA 1LWEA 3TYTA 4ZHRA 4O4GA 3ZZOA 2RS2A 1RAJA 4ERDA 1S6UA 1VBZA 1HBOB 2HLTA 4QJVA 2Z4PA 1XK8A 5KG0A 2P9CA 5DDPC 4M5DB 3TA1A 4J9RA 1UKUA 3MEGB 3C6TB 1QVGR 2HGNA 4Y2KA 1MU2A 3MZIA 3NL0A 4EZ6A 1R8CA 1X4DA 4WIIA 1FD2A 3AA8A 3QWPA 2V8HA 4IOAQ 3OUYB 4Q45A 3I5BA 4F2SA 4WYWA 4QYRA 4ED3A 4XIUA 3CSKA 3CJ5A 4PG5A 3MR2A 4IRKA 2AQ4A 2K1RB 3QWUA 4FP9A 3N5BA 3DDNA 3M2UA 3O3LA 5HBMA 5THWA 5KG1A 1HBNB 2FHOB 5LSLA 3VTIA 1B64A 2U1AA 1DRZA 2FLNA 3MMBB 2GGPA 3AQPA 4QIVA 1IBMF 2YKNA 1HW9A 2RF2A 4C8OA 1UVMA 2AJFE 3SDEA 3CC7S 5EX3A 1TL4A 2B9XA 3MM7A 5L9NA 2IBOA 4JI5F 2E1CA 5CYQB 1HNVB 1Q81T 4NRTA 3UDLA 1SL2A 3LH2S 4PPDA 5KOWA 4WFBQ 3OTOF 3QAEA 4G1QA 4DWIA 1JLAB 2ZH5A 2HMIA 4Q2MA 1NH8A 2HNYB 3U7JA 3NNAA 3M2RA 1JJHA 4YR0A 2ADBA 2PDAA 4QCLA 2QA1A 1P27B 1BD6A 1J2VA 3AY0A 2J0QD 2XGPA 1WWHA 2DNQA 5DGAA 5HLFA 1N48A 1KTVA 3UFCX 2R7OA 2IYIA 4YR3A 1U8SA 3BJYA 1FA0A 1ZM3A 3MXHP 5KFQA 1TK8A 3TUZC 4DV5F 1RKIA 1DTTB 1R43A 4QWDA 4OX6A 1KQSR 3HF5A 4AE5A 1REVA 4JBCA 3AB4B 3N6LA 4NLOA 4OI1A 3IG1A 2CPZA 1RT5A 2GJIA 3H5UA 2EFOA 3CCWA 4DG1B 5HN0A 1U2RA 1WHYA 3D5MA 3MR5A 4K4ZA 4YB1P 2QMWA 3CJ2A 1X9SA 3KYLA 4UW2A 4Z2XA 1FERA 2XMVA 4RX6A 3VQTA 1FNMA 5J2PB 2FLLA 2NXUA 5J2NA 1VQ6S 2CPYA 3I32A 3MEEB 4NCGB 4C8MA 3CMAS 4O3NA 2ASLA 2DNGA 5KFKA 5FLXY 5D4LA 3CC2S 2KG1A 4RBTA 2HHXA 5L1LA 4GO5X 3EXCX 3MEDB 1KLNA 1Y00A 5KFGA 2DK2A 4W90B 3Q8SB 4DR5F 2B6AB 2AWZA 4CNYA 4HH0A 2ZZNA 3W2VA 1ZYQA 4N76A 2GMLA 3DRYA 3CJKA 2Y0SD 3OQ2A 4OMFG 3BGFA 5D4PA 2DR8A 2W25A 2E29A 3GG1A 3MEDA 1C1BA 2R7TA 1NK8A 2BDPA 1JWWA 2JH3A 1X8DA 3MMAB 1IKYA 2IJNA 5U47A 2B5JB 5FD1A 4JI6F 1TQLA 1RJJA 2RH3A 3LWMA 3DRSB 3ENVA 3HVRA 1SH0A 1U1PA 3KTQA 1IKVB 4DMZA 4UY8T 4I6AA 1CC7A 2CQCA 3A1YG 3G8QA 1U49A 3CULA 2CQHA 3GFYA 3NAIA 3UW1A 4ATNA 4ZKAA 2OPRB 1CG2A 2QLXA 4CQ1A 4ZPBA 1RT3A 3UDCA 1S6QA 4KQZA 3MMCB 2XMUA 4OJ1A 2NS1B 4DLGA 2IMOA 3RAXA 2PI5A 1HNIB 3TVZA 4R8UA 3CDBA 4YY3F 2ASYA 2FPHX 2WSEC 1TR0A 2BM1A 2ZBCA 3GYNA 5B0EA 3BSOA 2OKQA 3LP1A 1J5EF 3HP6A 1WD6A 5LXYA 4ECXA 1LXNA 5CXTA 1G7CB 1X4AA 2OPSA 4ZA1A 2LKZA 3N6MA 3SCIE 4TQRA 2B56A 4C0OC 3H4DA 4OZLA 5GADI 4ECSA 4X4SA 2V4JB 3BGRA 3OTDA 5CZXA 4A8QA 1L5UA 1FNOA 3IAS9 1F5CA 4DJBA 3CCQS 1U48A 4L72B 3HHLA 1FEEA 1WEXA 2MXYA 3OV7A 3H4BA 4LT6A 2RMLA 2FGOA 4Y6IA 2W9BA 4X2BA 1NK9A 1QVFR 1YGYA 2CPDA 3W3SA 1S1VA 3IGNA 1C4CA 3HHNB 4OZ0A 4K0KF 2F8HA 5E7OB 4M94A 3HKZD 4I1TA 4TLQA 2BZ2A 3GE9A 4GKKF 5KFRA 2C2DA 1VRTA 1XNRF 4QIFA 2WTFA 2MB0B 4OZJA 5E0OA 4TU9A 3NAHA 3GQCA 1QE1A 3DN9A 2IM0A 3OXLA 1U7LA 3PX6A 1FF2A 4TY8B 2HHPA 2LXIA 4FN5A 1IJEB 5K9FA 4ICLB 3HHKA 4IFYB 2MZSA 1X4GA 4YDXA 2ZHBA 3IGVA 3TAPA 2XY5A 5BR8F 4XO0A 3GG0A 4RU2A 2CJQA 4I56A 4ZVEA 2R8GA 3SSQA 4EGLA 4DR6F 1R6YA 2ZDPA 4ZPDA 4X4RA 1JJ4A 4ICLA 2MKHA 3IRWP 2IM2A 4V19J 2ZOMA 3IWNC 4EU0A 1FE4A 3AJ2A 3RU0A 3MEEA 3FFIB 3I82A 2IBKA 2OH2A 4PWDA 2N3OA 2OLWA 2ALZA 4ILRA 4NWBA 5LSOA 2GJ2A 1Q86T 4NLPA 2PD1A 2HAIA 2MJUA 4OJHA 3QIPA 3DYAA 2JSXA 3R5CA 1Q7YT 2M0GB 2E44A 2JOQA 3SCKE 3X3UA 1NB7A 3MM8A 4F25A 3D0GE 4J9SA 3IAM9 1MU2B 1UP1A 1Z1ZA 3PV8A 2C3YA 3M30A 5A8WB 5F9NA 4TQSA 2WOMB 1YRXA 1EETA 3I0SB 3I0RA 3QGPA 4NLQA 2YY3A 5D4NA 4K4XA 1X4HA 4KHRA 4H4MB 3W7BA 2CQIA 3DOMA 2W8KA 2FVRA 1Y4ZB 2DO4A 4OX8A 3PY8A 4RNOA 3IR6B 3CIZA 4PRFA 4DV6F 4MYTA 3KLIA 4ZP9A 5K8NA 5B0FA 2L3MA 4TN2A 5MAOA 1S9GB 3RRKA 5KFPA 1VQPS 1S0NA 5KFTA 1KFDA 1L3SA 3M6WA 1AXQA 5GAHI 3UCUP 4J9MA 4HHJA 2X51A 2DGWA 2JDJA 2PA3A 3D1QA 5B0GA 4PXCA 3MWBA 3WC0A 3M9MB 2DB1A 1RGVA 2I5JA 5GAEI 3DC2A 2F8MA 2EFPA 1S1UB 2V8GA 4JI8F 5CA5A 4DV2F 1SUQA 4N5SA 4IH7A 1HBMB 2W9CA 3NKYA 4DBQA 4RW6B 3OVSA 1YI2S 2EBGA 2O01C 1CQNA 3IWXA 2FY1A 2XLIA 1WG5A 4LF7F 5F8GA 2HW3A 1D9AA 2VL1A 4Z37A 1KOOA 2J7WA 1H2VZ 5C24A 1C4AA 2K3KA 2M52A 5K14B 5J1EA 4DL3A 2RRAA 1TV6B 2F4VF 2DHGA 1VMBA 5EWFA 2IA0A 1I1GA 2HG4A 1RTJA 7FD1A 3NCQA 3ETOA 2HS0A 4JV1A 4B3SF 3CTRA 5KFUA 2Z8QA 5KFAA 3JSYA 3FRYA 3B4MA 4NYPA 1U09A 4Q44A 1TK5A 4IH5A 1FHTA 3UD3P 4WXOA 1YHQS 3FNNA 4C9DA 3I5CA 1URNA 3D54A 1H7XA 4O44B 4WE1B 1F0XA 2HWTA 2LEAA 4R5PB 1K0VA 1LXJA 4OHVA 3H5SA 5E3QA 4FS1A 1X5SA 3V4MA 1JLFB 4ID5A 4B3OA 1WI6A 2OAUA 1IM4A 2KRRA 3E8OA 1QAYA 3VAGA 3OXFA 2AYGA 2MKKA 1SV5B 1WHXA 4HTIA 3CC4S 2KZMA 3DNCA 4CH1A 1Q16B 4ZP8A 3IWLA 2DGOA 3JSRA 2B7BB 2RKIB 3AJ1A 4DL0C 3HPOA 3UD4P 1K8AT 4WFXA 3NGDA 3PDNA 2P9EA 1GT8A 1DTQA 4KPYA 2ZH4A 3DOLA 3H2VE 4R25A 1XC9A 1LWFA 2CZVC 1S6PB 4MKAA 4IG3B 5DDRC 2ZNYA 3RR8A 3I87A 2MDAA 5DJBA 2GHVC 3O8WA 4I2QA 1YRTA 1R7IA 2DGQA 2CPJA 5KFFA 4NLDA 5GAEU 4TNOA 5GAGI 4BC7A 5IM0B 1BQMB 1F9FA 2GQQA 5HBMB 4BDPA 2DD8S 3DLKB 1HFEL 2R7UA 1FKAF 3UR0A 2P6TA 2A2DA 2ZC4A 2YKNB 2UUCF 3IR5B 2EFVA 1JLQB 2C3MA 3GV7B 4DFKA 5FJ4A 2Q6CA 1WF0A 2XBPA 3CDEA 3FMBA 5LJ3Y 5HP1A 2UVRA 4YB5A 2KYXA 3MM6A 1L3KA 1Y3KA 4WYLA 4NLGA 1AFIA 2GX8A 3LP0A 3LGNA 5G0RB 3QMQA 1QAJA 3OL6A 3PW7A 1H6KX 3QZ8A 3DM2B 1U1RA 1ZZFA 2L9NA 3FVYA 2K7JA 5LJ5Y 2FLOA 4P7TA 2UUBF 3JSBA 3FJ2A 2ZJRQ 4LQ9A 4J9OA 1JXLA 4X4OA 2AJ4A 2VFTA 4K4VA 4OJGA 2L08A 1M5PC 3DLHA 2ZH6A 3OVAA 4DSLA 2HYIB 4CNZA 2MY7A 3KOAA 2XNQA 1VLYA 2JEGA 4JV2A 1TAUA 2D3ZA 2D3UA 1VQ9S 4ZCLA 1FRXA 2LDIA 2AJQA 2A18A 1DQ8A 2BUNA 2D3OR 4DSKA 4FNHA 3W2WA 5A8KB 1IR0A 3N01A 3KLHA 2UXBF 1HYSA 3FQKA 4KT0C 2UUTA 3OUYA 2YKMA 2MSSA 1RISA 4LJMA 2FJXA 5KFZA 2XG8A 4ZLPA 3J7ZT 3DLLQ 2JFDA 3V4IB 3CMES 3V2UC 2BJDA 1YVFA 4AQYF 3DLEB 1PC5A 1UAWA 2XI2A 3GIMA 2R4FA 1RT6B 4PG6A 2UUAF 2E5HA 4DQSA 2CQ0A 4UQGA 3G96A 4LVNP 2BOPA 1LWCB 1RTHA 3HVTA 3UPFA 3SI8A 4IR9A 4V19X 1KVJA 2DNOA 3V81B 1LW2A 1VQYA 2XMKA 3UE2A 5HL7Q 2J6TA 4HDGA 4B9MA 3GWCA 5KG7A 1UVLA 4F8RA 3P5TL 4QWBA 3KK2A 5DLFA 2WOMA 2GHWA 3UCZP 2PIIA 4RW4A 5M2PA 3SSSA 2XO7A 4MK9A 4F50A 2LEBA 1U1OA 5KFOA 2VZ9A 1BY9A 4NYZA 5J1PA 4AL6A 4FYDA 4OI0A 1X5PA 1KQFB 3P6YC 4C0HA 2K8GA 3WX4A 2FUG9 4ED0A 2JEJA 5C25B 1R8BA 3FRZA 4ZVHA 1RTDA 3SQGA 2JEIA 4JYAF 2ZH3A 2BV3A 2W7PA 3ISZA 1BC6A 1NKEA 4ZP7A 2ZOFA 2L9DA 3VAMA 4C0BA 2NSCA 4YFUA 1Z4UA 3ZZUA 1F60B 4DDFA 3PO4A 4ID5B 3M1VB 5DLGA 3EUNA 3UNGC 4ECZA 4OLPA 3PX4A 2DR7A 2R2UA 5DM6Q 2VPZB 4PXDA 2CKWA 1FJEB 5E2QA 4B08A 4HI1A 2ZKUA 1FKOB 2RU9A 2RE1A 2UZAA 1K9MT 4OLOA 2ZJQQ 3IN5A 2JVRA 2ZZMA 1MW7A 3ZZRA 3KLVA 2EFGA 1N5QA 3DGPA 3MUTP 3HHLB 5KFIA 2GA7A 2UU9F 1SB6A 3ITHB 2ZM6F 1MMDA 2V9KA 3ZZTA 2E7WA 3QZ7A 1RT4B 3HM9A 4MKYA 1AROP 2VKRA 3TI0A 4UUXA 2MGZB 4LF8F 2RRBA 1HPZA 3R5AA 2BRKA 2IVMA 2ZITA 4DFMA 3QYYA 2KXHA 1VQLS 2ZH7A 2FHKA 2YWEA 4X66F 1A6LA 3ONQA 3DRPB 2RQ4A 3BDEA 2CVEA 2MYFA 1HPZB 5F8NA 2CQBA 2W4PA 1HHTP 4H4KC 3MM9B 2KFYA 1R31A 4I64A 2CJBA 1GX6A 4CH0S 3SXLA 2KH9A 1CEZA 3RBEA 3DHWC 3FQLA 2RVJA 2V5HG 1IXKA 1HQEB 1X4FA 2ZE2B 1IJFB 3KJVA 4HKQA 2W7AA 3T9NA 1RTIA 4FNIA 3G71S 1DURA 4O23A 2ZH8A 1JIHA 4GC7A 4DSFA 2H9ZA 2P9GA 2X1GA 3CCLS 1FNXH 4IRCA 1TFWA 1SI9A 1WHWA 4ZHRB 2DH8A 1VRUB 5I4MA 2DR5A 2WRMA 1NNDA 3EZUA 3KLFA 4OZNA 1CVJA 4X4NA 3CJ4A 4KGMA 1VOMA 2LMIA 3E2EA 3OFHA 2CRLA 5L1JA 4JI7F 2DPIA 1WI8A 1UWBB 2M5YA 2A2CA 2WBMA 3CF5Q 1VRUA 2U2FA 4ILLA 3CDAA 1RA6A 1ZM2A 2EBEA 5KG3A 3OSPA 1DTQB 1ZETA 1Y3JA 1HNXF 2PE8A 2AGQA 1MROB 1M5VC 3K5LA 5C42B 1E6YA 1R8PA 1IKWA 2JJ4D 2YNGA 1CSJA 2N7CA 2XEXA 2XSJB 4I2QB 4K4YA 2V4QA 4TXSA 3AQOA 2KT2A 3JSMA 4B3MF 4I0WA 1IKXA 1A9NB 2IC3B 4H4MA 1HI0P 5LSRA 5B0AA 1LQ9A 3D1OA 2HHSA 2EPIA 2CYYA 2IM1A 3PFOA 4DL2A 3PVXA 3TAQA 1HQUA 5AE2A 1NJYA 1FXRA 1VBXA 5B09A 2AU0A 1P9QC 2OPQB 2XHWA 4EWTA 2UXDF 3MR3A 4QYZJ 1LWEB 4ED5A 4NLRA 2W24A 1LOUA 2HLUA 1SJRA 4J5OA 4PR6A 3CCZA 1HARA 1MNEA 3DI6A 1BQNA 3CCVS 4FS2A 1FTRA 3SYZA 1XBWA 1Y5IB 4DN0A 2OPQA 3PW2A 2J0SD 1HHSA 4BHQA 1NU4A 2HHTA 1TL3A 4MMOA 4DSEA 5IQ6A 2R7RA 3GFHA 1ZZNA 2FTRA 4LSNB 1RT6A 3OPKA 3S01A 4Y00A 5H9FJ 4DQPA 2YH0A 4KTQA 1TKXA 1AUDA 2W4DA 1Y5NB