5IZHA

Lassa virus l protein cap-snatching endonuclease. apo form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
171
structure length
171
Chain Sequence
GMEEDIACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKTVNISLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
source organism Lassa mammarenavirus
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase L
total genus 63
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5izhA02
5J1NA 4MIWA 4I1TA 5J1PA 5IZHA 3JSBA
chains in the Genus database with same CATH superfamily
1IUJA 4ELVA 3MAAB 3FQLA 2RS8A 3PDNA 2CJBA 2CQCA 1VHFA 1YBUA 3MHYA 1JLEB 3QGGA 4ZVTB 2W9CB 4DR3F 1H38A 2WSEC 1CJKB 4QZVB 5HQMA 2AEMA 1I5OB 3CD6S 4LSNB 1VLYA 4K7QA 5KFDA 4E8UA 3DOKA 4HKQA 1UVNA 4W90B 4P2SA 2COLA 2L08A 3LAMA 1RT5B 2NXCA 2PT0A 5J1EA 4OYXA 3KLVA 4NXNJ 4FF3A 2WVFA 3PM9A 4OZ0A 4UQGA 1VQOS 2HFVA 4U7CA 1RABB 5T41A 2PMZD 2BR0A 4YUDA 3NY0A 5E41A 3BO2A 3HD1A 2MHNA 2YWGA 1X0PA 2ABYA 2D1CA 1AZSA 4OZNA 2D69A 3NLCA 3SV4A 2BW2A 2AYBA 3H5XA 3IWLA 3IRXB 4Y00A 2HPUA 2HURA 3B82A 5LJ3Y 4YP3A 2VFVA 2X1GA 1IBKF 4DR3J 1HQ2A 2QGFB 2VZ9A 1F3VA 1RI7A 3CCRS 2VIHA 2BXJA 3JQJA 1FERA 3MEGB 4I68A 4QR2A 1N0VC 4ZLNA 4IFVA 1RT4A 2YWEA 3FSIA 4TYAA 3IGVA 3CMES 4PQUA 3SSRA 1F5BA 2ZBCA 3MEGA 1HMVB 5CHCB 5KG1A 5LMUF 3J80U 1VOMA 2BQUA 2Z30B 4XAKA 4CM0A 4EZ9A 1HBUA 4KGKA 2E5GA 4NEYA 1BQMB 3SMZA 1PJ6A 4RW7B 1RLDA 5F0WA 3U1NA 1CQNA 3ULHA 3M8PB 2F9JA 3T6JA 3K58A 4ZVSB 2I1RA 3TJAA 1V3RA 2CPHA 2HNYA 2F40A 4RW8B 5HANA 3DCAA 4YQWA 4PRFA 1YRUA 3M8QB 1FRHA 5KFAA 2HGNA 4USTA 1RAOA 2I0XA 5AXLA 3CJSA 3FSXA 5KFRA 2ALYB 3UD3P 2CPZA 5E3CA 5BYRA 3HHNB 1BD6A 3LWMA 1MROB 2GHWA 3RBXA 1OWXA 2EK1A 2CNNB 1BC6A 3HSZA 3QMQA 2YNHB 4ILRA 2WAQD 1X4HA 2ZBQA 3DXSX 3TZWA 1TUVA 4TKTA 5CAAA 3HXMA 1U1PA 1L3VA 4YR0A 2KFNA 3HO1A 2BKNA 5G0RB 1UEVA 1WOOA 2YNHA 3EDQB 5KFXA 3QGIA 1MMDA 3MF5A 3OW2R 4K50A 1H7WA 1DQ8A 1Y5LB 4O3OA 4GC7A 1CG2A 4FDFA 1P6TA 4WFAQ 3B78A 2LA4A 2OLWA 2RRNA 3W66A 2UXCF 1ZTTA 1B70B 1JLAA 4KC5A 3PJ9A 1WEXA 3AJ2A 2EWHA 2KZZA 4K4UA 4KH1B 4M1KA 3M8ZA 2V69A 2Q43A 1YRTA 2VPZB 3H8YA 1R6YA 3TP2A 3CCVS 4EYIB 4DL3A 2DVIA 3MPDA 2DRAA 2YX7A 3BPSP 1WORA 4ZPCA 1FKOB 1NH7A 2OELA 3CSKA 5K14A 3Q24A 3T3FA 1UVMA 1S9GA 3TJ9A 1RB0A 3H2VE 1KFSA 4C48A 1RTDB 4FXWA 3C16B 1HBMA 1Y4ZB 2C42A 2KYXA 4RNOA 2E1CA 1YZ7A 4YFUA 1R7IA 1NLKL 2D3ZA 1TL3B 2W24A 4M5NA 3M9MB 3BQ1A 4NXMJ 1VRUA 2AYEA 1Q8KA 2LQ9A 1MN9A 3TNVA 3W2WB 1WC6A 1HPZA 7AT1B 3HM9A 3UDEA 5G4DA 4ZP8A 3BR8A 1U2FA 1NO8A 1TL3A 5E33A 3ZZZA 2ZH5A 5EDWA 3VGTA 4DUTA 2RKIA 3FJ2A 4F25A 2MGZA 1PBAA 4AL7A 4ECRA 4K8RA 2C2DA 4ED7A 4RKUC 4MIAA 4ILMA 4USKA 4DLEA 1L3KA 5IS2A 1OMSA 1ZAWA 3QIDA 4EGLA 2MGZB 3BQ0A 3G2XA 2XCPA 4N56A 3FRYA 3HKZD 1GH8A 2XBPA 3QO9B 2M9KA 5CZVA 4KPCA 5E3AA 5FLXY 4LF4F 2AMCB 4ES3A 3QJJA 2CQ4A 3D2WA 2J8SA 3AT1B 4IH5A 1Y0HA 2J9DA 5IFMA 1S6PA 3MAQA 2C3YA 2AJ2A 2VFTA 3AB4B 2HFOA 5KFTA 1BXNA 3DI6A 4KY3A 3CDWA 3GJRB 1HARA 4YR3A 1Y3KA 2DK2A 4WKRA 2B8PA 1C1CB 4WCEQ 2DHGA 2PO4A 4WWSA 4M5LA 5B7WA 4DS4A 3GR0A 1VBYA 4I6WA 2NXEA 4KQZA 5E7OB 5I3QA 2AKWB 4NMXA 3H98A 2LQBA 1VC0A 1NSPA 2PN6A 1CS4A 4NL5A 4C8KA 5GAEI 1QAIA 1VHIA 4I2PA 2LKZA 4MKBA 1KTVA 4DBQA 5IV4A 3MEEA 3R5JB 4MAKA 3W61A 1HL6A 2YH1A 1K8AT 4QWAA 1NJYA 3NL0A 4ICLA 3AY0A 2G0JA 1BWVA 3A8EA 1FD2A 4RO0A 4UTGA 5F8GA 1N56A 1CLFA 3MECB 4OV6A 1KP6A 2J9DE 2JEIA 2ZVSA 4WU2A 3W63A 4ICLB 2FVPA 2CJAA 1ZPWX 2YKMB 2N82B 2AWZA 1UJ5A 4J9PA 1RT3B 4LBPA 2BJ8A 2CQ0A 3CD7A 1J5OB 2HVHA 4J90A 3GYGA 1KQKA 4GKKJ 2HHSA 4K4ZA 4ENOA 5F8NA 3BGUA 2ZITA 2CNOB 2CVIA 3IBWA 4P2XA 5I4MA 1KD1T 2FJXA 2XS7A 3AOAA 1RLCL 4B3RF 4J9SA 2W01A 2ZBIA 2DY1A 1PSDA 5A76A 2JZ5A 3ZZTA 4YS2A 3PX0A 1ZM2A 2V2ZA 3KLGA 4WIIA 3M2UA 1H0HB 3WIUA 1VBZA 4QWEA 3GCXP 4L3KA 2HSEB 1SL2A 2J0WA 4MKAA 1J5EF 1YWXA 1MWQA 3RAMA 2HVZA 5L46A 2R7RA 4DUYJ 2EC2A 4LIRA 1P27B 2DBBA 1CJVA 2R7OA 5CA5A 2C1EB 4URGA 1TK5A 3DMJB 5KFPA 1NH8A 4IO9Q 3BN7A 1HNWJ 2VPWB 5DDOC 3DU6A 2E7WA 3H2LA 3BGRA 3OR1A 3U7JA 4AXIA 4KV8B 1I94F 3RR8A 5J2QB 3MMAB 2Y1IA 1T05A 3Q86A 1X4EA 2AYGA 4R5PA 4KPYA 3EGZA 1UEKA 5J2MA 3D6TB 2K7KA 3JYTA 1HW9A 3BBFA 2XWYA 3N79A 3PNIA 4LF2A 1HNXJ 1REGX 3BKUA 3A3PB 3H25A 5J2QA 2DNLA 1UETA 4Z7CA 1UEUA 4FPRA 3VGSA 1S76D 1RBOB 2EEYA 2LDYA 1FDAA 2V68A 1W26A 2W2MP 3Q8QB 3ZZ0A 1G2EA 1FNMA 2H4WB 3GJSB 4C6AA 5KG2A 4CIOA 3HT3A 1TFWA 4A48A 3FDSA 5JUMA 5HSPA 4RJVA 1F60B 1NHVA 3A8JA 3HJVA 2IVYA 2Z4PA 1N36F 3I9ZA 1LV5A 1U7LA 2E5JA 1Q7YT 3CD0A 4JBCA 4F02A 1ZS6A 3CO9A 2LP4A 3MPWA 3IR7B 4DPXA 3BKFA 5HJYA 4F2RA 1FJGJ 3DLEB 2W2QP 1PILA 2UU9F 2XGPA 3R2CJ 4Y2KA 1EAYC 1SPBP 3V4MA 1BMQB 1K1SA 5J1PA 2KH9A 4RNHA 5GMKa 3VZHA 1RSCA 1LW2A 1SB6A 1HBOB 2VG5A 5DGBA 3H42A 2MSTA 4MMOA 2XYGB 3EGWB 1TKZB 1BQXA 1XR6A 2V2KA 3GFHA 3I55S 4DV2F 1ZZNA 3QATA 2PI4A 1NJZA 1EKRA 2PE8A 1LW2B 3TYTA 1N0UA 2ILYA 3UDCA 5KFCA 2VQEJ 4DPWA 3THVA 1UA0A 3POTA 4HHUA 3L7OA 4ZJLA 1TVRB 4IH7A 1Q8IA 3IM8A 1OSCA 3M6XA 5RUBA 1NK6A 1WWHA 2HQIA 3Q8UA 5H9EJ 3RW6A 4WPAA 4B9UA 2DY9A 1FWPA 4OYPA 3MOJB 2WW4A 1BE4A 1TL1B 3QYYA 4WTOB 1T03B 3B54A 3VAMA 3VF0B 2OMLA 3WX4A 5K8OA 2B4UA 2BJ7A 1LXNA 1X5PA 4Y2AA 1WKKA 2R7SA 2HQCA 4CLUA 2P9CA 5EGYA 1FD8A 3GFXA 3GJTB 4PWWA 4CRJA 3NS5A 1TL4A 3H40A 4DV1J 1WC4A 1PJ5A 1IQTA 1VJWA 2DGQA 3MUTP 1NK8A 3IAM9 3PRVA 1LQ9A 4ECYA 3T5JA 2J7KA 1HNWF 4J9UE 4RZRA 4W98A 4MTPA 4H54A 2MQMA 3T9NA 4KV8A 4NA2A 1GXTA 2R7QA 2JSXA 2GNKA 5D3GA 1TKDA 4K59A 2FGOA 3CB4A 3J7YI 4WP8A 2JDJA 2U2FA 3R27A 4NLVA 3V6HA 1ZPVA 2VA3A 2YQ3A 4I2QB 1RAIB 4FS2A 4I69A 1OPIA 3QRRA 4P6QA 2W9BA 1S1XB 2X3DA 4QR0A 3KK3A 2FLOA 3AXMA 4WU3A 3UVJB 1ZTWA 3D67A 4NCGA 2BQRA 2JOQA 3W8PA 1WSVA 4YHHJ 1FI4A 3PX6A 3MMBA 9RUBA 5F9LA 2HVDA 2OJ3A 1VRTA 4J91A 1N48A 3CCMS 4KE5A 3QJLA 4OFZA 1ZYQA 4X4QA 4B9LA 4P74A 2UUBF 3HF5A 4ATNA 1PYOB 4NLOA 3AD9C 4KAIA 1D9DA 4NMLA 1MG7A 2MKKA 4NXMF 2HQ3A 2W8LA 5F9NA 4ELUA 1WEZA 4IDKB 2DNPA 4QPTA 1JLQA 4DV2J 4KRWA 5ETMA 4CM2A 4X4NA 4OZ3A 5HROA 3OSPA 4C4WA 1HQUB 2QT7A 2P6TA 1XMQJ 3KLIA 2F9DA 2NXNA 1FRJA 2XS2A 3GMGA 4H4OA 2EW9A 2EG2A 5KFEA 1UWBA 3N5FA 1WOSA 2DNQA 1IXKA 1LW0B 3FZBA 5H1SV 4YHHF 1T9VA 1WHWA 2VBWA 4WE1A 3J81j 2DTJA 1HNIB 5LSOA 1FJGF 3T41A 1U8SA 1V3SA 1LWFB 1MLAA 1RTHA 3D1HA 4P10A 2E9ZA 3DGPA 2B56A 1JMTA 1RACB 3HMJG 2RHQB 3V81B 2YWKA 4DV1F 3VV2B 2VA2A 3QRPA 2UUBJ 5KFLA 2XYPB 4JYAJ 4TQRA 4ED4A 2Z58B 4BBYA 3ADAC 3QLHB 2ZHAA 2ZH2A 4B9MA 4U6PA 5DM6Q 3CPWR 1SJ4P 1U48A 5KFVA 3H0PA 3LOUA 3ZO7A 5KG7A 2APOA 2BMBA 3IRWP 2RU3A 3LWLA 3GV8B 5DLFA 2UUAF 4NPOA 1N32J 4ETXA 4F7VA 2W7PA 4JI0J 3DYAA 3T9ZA 3VVUA 1CJUB 1SKWA 3P49B 1I51B 2FZKB 4AL5A 4B3OB 1Z1ZA 2LFVA 1RWNB 4O4RA 3CJ4A 1EETA 2IPOB 4NASA 1CULA 1RAEB 4DN9A 5I42B 5D3GB 3C19A 2OSRA 1YKWA 1SKUB 3TUIC 3DM2B 4S0MA 5SUHA 1K9MT 3AD7C 3MM9B 3PJWA 5HQLA 3SI8A 1JNZB 1S97A 3DLBA 2UVVA 4Q0BA 1CULB 1DLOA 4JI3J 1VQ7S 4AL6A 1DTQB 3GTYX 4NOHA 3KHLA 1FRKA 1HBNB 2FUG9 2HS4A 4YB1P 4CLKA 1E6VB 1IBCB 5KG5A 1U1LA 2BDPA 2PFFB 2JEGA 2RQMA 3GIIA 2DPJA 3P8BB 3KMSA 1IR1A 1FJCA 1WG1A 1AB8A 1JQGA 2GHVC 3DRSA 3IMQJ 3NAHA 4UT4A 1M1HA 2XMTA 2Y0SD 4DV5J 2IYIA 1DQAA 4F4KA 3LQVA 3A8KA 3O5TB 4HH0A 2YY3A 5LM7E 4DV7J 1N5YB 2DR5A 1P1TA 3MM6B 4CTAB 2W7OA 4K4WA 4ED5A 2R7UA 1TV6A 1RUSA 3KJNB 3MTKA 3PXGa 3HI9A 4XDDA 3KLEB 3VWSA 4N76A 1N33J 4G1QA 4QW9A 1TKXA 2K1RB 4QW8A 1YJ9S 3X3UA 2ZKTA 4MT1A 2GA7A 3OJSA 2ZE2A 4HDHA 2KHDA 1VIOA 3BBBA 1CQMA 3SEOA 1UJ4A 2AGOA 1H7XA 2U1AA 4IRKA 2C2KB 3IA0A 3G96A 4LUBA 4FNHA 4H4MA 4DR7F 1YGYA 2CJQA 1EHWA 1RT6A 2CDQA 5HBMA 2JEJA 1BLUA 1TL7B 2P8IA 3GG0A 3L7UA 4MYTA 2VD3A 2GVZA 2H4YB 3EXYA 2VKZG 1NK7A 3HVTA 4HTIA 3ET6A 2JX2A 2CA9A 3GFYA 4OYZA 1F3FA 1GTEA 3M1VB 3S01A 3U1MA 4F0HA 5B0CA 5G0RA 3S1TA 5MAOA 1TL7A 2Y1JA 3HHLB 2BEFA 1LWFA 1B0TA 2IC3A 1HWKA 1RTHB 1RXOB 4Y34A 3BO4A 2HWTA 1IKXB 5HP1B 3J7A1 3KWMA 2HWHA 3FGVA 2DGOA 4ZPBA 3MGJA 2UUAJ 2LQJA 1N32F 3I31A 3KUEA 4DQQA 3O3LA 5EWEA 3T1HJ 2I5JA 3FFIA 2YX4A 3D3CJ 2C3PA 4XTTA 2W4CA 2N4DA 2ZJQQ 2DXEA 3VZIA 4J9QA 1GQEA 2ADCA 1SJ3P 4Q43A 3R9LA 4BCAA 4Y3CA 3AOCA 2OPRB 4ZIVA 4RUAA 4J9RA 2PMHA 2YNIB 4ZCKA 3UD5A 2JLGA 4ECXA 3V6JA 4ED0A 4MIWA 1RT2A 2GGPB 2YX1A 1PGZA 2QO3A 2YKOA 2QL5B 2F65A 2XY5A 4K2XA 2IVMA 1QSSA 2IM1A 2YNIA 4UUXA 5FJ4A 2E7VA 2YNGB 5BYQA 2QMUB 2IMWP 2PEHA 4PEOA 2J6SA 5AXNA 1UP1A 4JI3F 3R6LB 2WRMA 4TYBA 2RJZA 3FMWA 3W2WA 4Z7YA 3CDBA 1REVA 5GADI 1GX6A 2DGSA 4UOCA 1P9YA 3MFHA 1AUSL 3RJMB 3F41A 3DN9A 2BYCA 1IBMJ 1URNA 2XB2D 2EPIA 1Q82T 1T11A 2X1FA 2QV6A 2W1BA 4PCQA 4JI5J 1LWCA 3QWPA 5FD1A 1RISA 2CJ9A 3BREA 2HNDA 2R2TA 2CJYB 3TVYA 3MZIA 3M32A 4TLQA 3IR5B 2GIQA 3H90A 4CO4A 2BM0A 4P71A 1U2RA 1X4AA 2HNDB 2FHOB 3O2IA 1TKXB 2FHMA 1WDTA 3B8HA 5EX0A 1SIWB 1IKYA 1VQ8S 5KG4A 3PW5A 1C1BB 4DQRA 5C7PA 3KNGA 3RR7A 3M8YA 1KTQA 4MFBA 3VAFA 2V8VA 1ZA1B 2VF3A 2JHEA 4HI2A 3S7RA 1KQGB 3Q2TC 5KFHA 2MY8A 4DJBA 3PW7A 1O8BA 3M30B 2A1BA 3QQCD 2BOPA 1WF1A 1B64A 3ZC4A 3FNNA 1YHQS 2J5AA 5J1NA 3M4XA 4PPZA 1RHJB 5D8HB 5IT9U 3DC2A 4IKAA 2FTRA 3T1YJ 4OX7A 1FCAA 1T0TV 4L6V3 2BRLA 2ZHOA 3R5GA 5IQQA 5K5MA 1WDDA 1SL1A 5CQGA 2GO8A 2IC3B 4CO0A 2LXIA 2DR9A 4ZN3A 1KFDA 3OTBA 4ZVUB 3RAXA 3GONA 4DSLA 3GZ7A 3MECA 4A4JA 4NA1A 4ZKAA 1JB0C 3FRZA 4M5JA 5C2CA 3VAKA 1T3NA 2E1PA 2OIHA 2VU5A 4U95A 4DZ6A 3P4UB 1OQ3A 4DR7J 3QWUA 4AD6A 1RT3A 4X2BA 4EI2A 5KFOA 5A8RB 1QAJA 1PCAA 2UVUA 2BE2B 1ELOA 2B43A 2ZEJA 1G4CA 4FYWB 4LT6A 2Q79A 5DZ7A 2CADA 4MKVA 3FZ2A 3WBZA 5I3PA 2GAGC 4UOFA 4X4PA 3KLHB 3H4BA 4DFPA 2HHWA 2NSCA 1IR2A 1WC5A 2CIMA 4M5DB 3DDIA 2QFIA 2YWHA 1XMOJ 2HQDA 2MDAA 3TZYA 3TI0A 5M2PA 1VC5A 4KYZA 2B3TB 5DJBA 3OVAA 2GZOA 1FA0A 1K47A 3SBMA 2Q6CA 5AJ3F 1IBMF 1XNQJ 1S7HA 2HNZA 1IKWA 3C16A 3EGNA 1SQFA 4DHVA 2VFRA 3OVBA 3CDEA 1NB7A 1REVB 4EMDA 2B6AA 5ETSA 2KVQE 3PEHA 1NSKL 3E3XA 5L8RC 5HMYA 2J8AA 4FVCA 4RU2A 1VRUB 2C2MB 5ETPA 4NYZA 4DV6F 1DZ5A 1JLBB 2OTJS 2YKQA 4AE5A 4HL9A 1RT4B 5L39A 2FZCB 3MUVP 1Q86T 2HHHF 1PG5B 1GK8A 4K5SA 2XMUA 1N5TA 4GC6A 1BUXA 2V8HA 5GMDA 2DITA 1OYEA 3JYTB 4YDDB 4X66J 3EVOA 1EIYB 3IAS9 3SQGA 4JYAF 1GEHA 3MCOA 4OZ1A 3N01A 4TQSA 5F3TA 3DKDA 5L38A 5KAKA 3CVKA 3ILOA 4QJVA 2WB1D 2WW8A 1M1KT 2YPZA 1FVQA 2HRUA 2RUSA 4FNIA 4DUYF 5KFMA 3CO0P 5E3QA 4AQYF 3IP0A 3MUMP 1KLMA 2V4JA 4OJ3A 4Y28C 5D78A 3OSNA 4DR2J 5B0FA 5DM7Q 4M95A 4DUZF 1N5VA 2RDJA 4B3SF 2DNNA 5HVHA 3W5YA 1M5KC 1RCOB 3CC4S 5IV3A 3ISNC 2Q1LA 3JAMY 1V5VA 1FTRA 2NLWA 4RBTA 5D4PA 4ER8A 3HHLC 3ZTQA 4DV6J 1NRKA 5HMWA 2E5LF 4OJ1A 1U6ZA 3WX8A 3OL7A 2XMWA 4F4AA 1T9WA 4XIUA 1ZBTA 3D54A 4UUWA 1H2VZ 4OLPA 3ZTOA 2IDEA 1VK8A 2CRLA 5LJ5Y 3DOMB 1FDNA 1S6QB 5HL7Q 3MMCB 3PCOB 2I9SA 1X5OA 2CQBA 3NWGA 4G6VB 4CQ1A 2ZM6F 2FLNA 4MKYA 5KT6A 2E9RX 3LH2S 2V5HG 3HHLD 1X4BA 2DNOA 2RQ4A 1AFIA 4KKOA 2FJVA 4ECQA 4O4GB 1N36J 1LXJA 2BACA 4DS5A 1M90T 3CC7S 3FVYA 4OHZA 3OL9A 2IY5B 3CJ3A 4FYVB 1SQEA 3UCUP 5DETA 1SH3A 1H98A 3LANA 3J80Y 1RT5A 3IGNA 5HAOA 3TVZA 5J1EB 1YIJS 5KFJA 4FKXA 4CNZA 4H4KC 4K0KJ 2XI3A 1U1MA 1B0VA 2VKRA 2Z8QA 2B0GA 5CD4H 1SCJB 4K4TA 3DNCA 4J9LA 2OEKA 3RW7A 3OQ2A 2F4VJ 1TZ0A 4OHVA 4DLGA 1BHNA 1HPZB 2LU1A 2Y1RI 2C3OA 4JI6F 5J2PA 3N6LA 2J0QD 3JS9A 2GCFA 2GO9A 2HHUA 2CYYA 4ALZA 2J9EA 4KO0A 4W92B 1SBRA 1HWLA 2OD4A 4A8KA 5HMZA 4PXEA 5KT4A 4F4YA 5LOQA 1TMMA 4OHXA 3RRHA 5DDQC 1JLGB 2EC0A 4OZJA 1UL3A 1UTAA 2MLYA 3WQPA 4O0NA 2FY1A 2RQCA 4CYUA 3QT8A 1XMOF 1S0OA 4LF4J 5E3RA 1N5SA 3DMJA 2QLWA 3OXLA 1VC6A 1N34F 1A7GE 1XEZA 2D3O1 3OR1B 2N4CA 3I0RB 4LR8A 5U47A 3EM1A 2E5IA 4CYUB 1R31A 1YQHA 3PR5B 4R5PB 2DPIA 5ETQA 1S6PB 1DJ0A 3KDNA 4PXBA 4FBUA 3E01A 1HBUB 4NA3A 1KEKA 1D9AA 1OS5A 1U47A 4WYWA 3FEYB 3UE2A 3ZZOA 3OUYB 1WNEA 3R7NB 1KKHA 4ZP6A 1RADB 3G82A 3TX8A 5A8KA 3E01B 4P75A 2RS2A 1AFJA 3NCQA 3LP1B 1RHQB 2XMJA 3EICA 4N8OA 2CPDA 4DQIA 1EQMA 3JXOA 1QUVA 2DD8S 3PKYA 1MMNA 2YQ0A 1S1VB 1FK9A 5A8KB 3CE8A 2MKSA 1RE1B 4RW6B 5D0GA 2VPYB 2QMXA 1FDDA 3D6MB 4NZ6A 4TLRA 2ZM6J 3G4SS 1RTJB 3I0SA 3GE9A 2DH8A 5DDRC 1N6QA 2FVSA 1S1VA 3PJXA 2CJXB 2D7SA 3DHXA 3N4WA 4IRDA 1T3OA 4NYOA 1J2VA 3PO4A 2P9GA 1S6QA 2WVCA 4CI0B 3PY8A 2V6AA 4LSZB 3A12A 4ZJOA 1T02A 2E5HA 2LQ5A 1S59A 4DR2F 1TR0A 2GQQA 2VQFF 5LXRA 5KFSA 1HQUA 2VUGA 2IMOA 3QAEA 2BJ1A 4LFCF 4Y2CA 3R1LA 3A3OB 1RWPB 3KLIB 2V8PA 5B0GA 4E0DA 2DB1A 5B0EA 1B7FA 3DFEA 2YNFB 4PXDA 3AJ1A 4YB6A 1FX4A 3E51A 1Q1KA 2HZVA 3EYZA 5EWFA 3BQ2A 5CD4A 4JV2A 4ERDA 3LW5C 4GVBB 4LQ3A 2QA1A 3TANA 2MJNA 2YXLA 1W25A 2G2ZA 5E2QA 3F0NA 3WIVA 1RBAA 3HCXA 4HI1A 1RHKB 3WDOA 2WVEA 3ILJA 3CJ0A 4AUKA 2HLUA 3RYLA 2VPXB 2MQPA 2MY7A 2R7VA 4OV1A 1TL1A 2RB7A 3C6UA 5JVHQ 1P8GA 1GMVA 1Y11A 2LLZA 2MZTA 2ZDPA 3M2UB 5J2PB 3MM5A 4LF5J 2YVSA 4BS2A 1CJTA 1OY8A 2IM3A 3HPOA 4ELTA 4O3RA 5KFYA 4KO0B 5C24B 2R2UA 2UUCF 4PUOB 2K7JA 4DCJB 4EBCA 5IZHA 2WSCC 2XLJA 2BKOA 4DV5F 3AJDA 2JVRA 2YKPA 3KK1A 3T1YF 4MK7A 3THPA 4OYAA 1BY9A 1WKLA 4NCBA 1RT1B 1QJHA 2E1RA 4O44B 1IN0A 2W9AA 4C8YA 1HNVA 2VB6A 2M8DB 2ZZNA 2H5IB 3ENWA 3R7BB 1HNXF 4M5KA 3J7YU 3MM8B 1X9MA 2ROPA 1D09B 2MXYA 2D3UA 2NS1B 2PDAA 5A8WA 1XK8A 2K06A 3UNYA 1S57A 2OTLS 4DSIA 4GVLA 3TOQA 2PA8D 2V4QA 4OZ5A 2MQQA 4V19X 3X1LB 4X62J 2ZC3A 4YEAA 2ZD1B 1XN9A 3G82B 2RH3A 4XPCA 1YVFA 1DURA 2F1FA 2AJ0A 1ZETA 1DAXA 3UVJA 3LP1A 3LO3A 3I4HX 1SV5B 2FY8A 1EX8A 2FJAB 2Z2ZA 4N7TA 1FFWB 3L7PA 5GAHU 2UU9J 2AQ4A 3ELHA 5LSRA 4RWWA 2XMMA 3UN5A 1N34J 5D15A 4J9NA 1SKSA 2DT9A 4EBEA 3CF5Q 1U0SA 4OX9F 3PYDA 4YY3F 5BR8J 2KO1A 3DLEA 5AJ3J 5D0RA 2ZH3A 4ED2A 2GJFA 3TAPA 3RB0A 2ALZA 3MDFA 4B3SJ 2GVDA 3L3CA 2BQ3A 3MEKA 3TW0A 3OXFA 3BV8A 3EZUA 3MEEB 2BJDA 2ZE2B 2HYIB 4Q7AA 1FEEA 4PYDA 1CSJA 2V8GA 2VG7B 1RTIB 3D9BA 3FQKA 3QIPA 1RAAB 4IDKA 1Y5IB 4NLSA 5HVGA 1HWJA 3N9UC 4DEZA 1S7IA 4X64J 1YI2S 2GX8A 1UFWA 2K2PA 2NCKL 5EHHA 1WC0A 2Y1LB 2ZH9A 2QE5A 4C11B 2YWWA 2J6TA 2XWXA 5I3UA 3M2RB 3POTB 1N33F 3HVTB 2PEBA 3ET6B 5B08A 2KM8B 3LPYA 3D28A 5KFKA 2HAIA 1HQEA 1VQ5S 4KTQA 1QSLA 2AD9A 2LXUA 2N7YA 5HP1A 1PJ7A 4ANEA 3GQCA 1U02A 1UVJA 3AAWB 3VALA 3MPUB 4X66F 4F4ZA 1HIYA 3GSIA 2FPHX 2ZNYA 2ASYA 2QL7B 4PXCA 4R0EA 1U0HB 1URRA 1RWKB 3BR9A 1RQ0A 2GS8A 4JI4J 5LMNF 4JV5J 2GQCA 4OHWA 4F3MA 3Q8PB 4URSA 4DUZJ 4PYAA 2QX0A 2CPFA 1X4GA 2CG8A 1PC5A 4ZLLA 4YMEA 1V9OA 4PUOA 2KFZA 3GFZA 3QSYB 4WFYA 2VG6A 4NLTA 3V6DB 1YTYA 5E5NA 4N47A 4CLFA 4JI8F 1SJFA 2GGPA 3CIMA 4LVOP 1I1GA 1VQ9S 4I4BA 4KGZB 3SQOP 5KG6A 3RB4A 3ITHA 2C28A 3NGRA 2AJQA 2AP6A 2HS0A 5GMEA 3UDVA 1DARA 2AF6A 2DHSA 3QFWA 1WJ9A 2L3MA 3KXDA 1EARA 1YJVA 3CIZA 1VIXA 3EZOA 4CLYA 5C25A 5AXKA 1Q7LB 5C42B 4W4MA 2DEIA 4HT7A 2KRBA 3G86A 4PG7A 2PGCA 4I6AA 4RUBA 3U1LA 2XCAA 4Q0BB 2KXNB 4CO5A 1GMWA 3PYGA 2RD5C 3HFZB 1NPRA 1FXDA 3W9IA 1QDUB 1SJ1A 4G3IA 1E6VA 3O1LA 4IO1A 5F8HA 1NPKA 3MCSA 1WG4A 3DRRB 4NRTA 5AE1A 3GB0A 4YY3J 2R42A 5HJXA 1V6HA 1FFGB 3DRSB 1KQFB 5BR8F 4DV0J 2IJRA 4XPEA 1KSPA 1VBKA 3BO3A 2J6UA 1VISA 2Z0GA 1MU2A 1XC9A 1FX2A 3DRRA 4L73A 1JX4A 4QOTA 3FCWA 3MM6A 2E1MC 3BZQA 2FIUA 2ZDOA 3SCIE 4CTAA 4RW4B 3RG6A 4FP9A 4LF9J 4C8MA 1Q0NA 1SH2A 1M5SA 1ZOTA 1VQPS 5A0YB 2GVDB 2FDNA 3QZ8A 1U1OA 1F5AA 1PKUA 4OYOA 4HHHA 2DNGA 2A6MA 5A0YA 3UR0A 2W8KA 2A0FB 1GTHA 5KT3A 3T5LA 1Q8LA 3NGSA 5FDLA 2PA3A 3E2EA 3ZTSA 1NBEB 3M05A 2VBZA 1CEZA 4IOBA 4ECVA 4EU0A 3PKMA 2KYZA 5DGAA 1LW0A 2EBGA 2GFFA 1S1TB 3CCUS 4LRFA 2JVOA 1RBLA 5KFUA 4RX6A 2C3UA 3E8OA 2O1PA 4Q45A 4LVNP 1PIEA 4USUA 4C98A 2EI5A 4C3LA 4TY8B 4NLQA 1ZM4A 1EZZB 3GIRA 3MFIA 2HHXA 4DV4J 4PQAA 2B7CB 3OFFA 3PIOQ 4ED1A 2XM3A 4XK8C 5B0DA 4DR4J 5DG7A 3ETOA 2ATLA 4A8OA 1JLFB 3MR3A 1PO6A 2UUWA 4ZVRB 3BN4A 2XC9A 4DPTA 1AXQA 1WI8A 2MQ8A 2RDIA 3AXKA 2VDHA 4RPFA 2RDDA 3NOGA 3FCVA 3VCDA 1NHUA 1XWLA 2BE2A 4TU8A 2QYGA 4ED8A 4R0JA 1ZM3A 3JSYA 2KTQA 2QEXS 1MWZA 4CT9A 3SV3A 4ZPWR 2HS3A 1W7WA 2M7SA 3MEDB 1XR7A 2QJ3A 3NKYA 1WACA 1WF2A 2MKJA 5A2QU 2DEJA 3TUZC 4BC7A 2OSQA 4GO5X 1KVJA 2R8JA 1T9XA 2V0NA 3EDRB 4F0KA 3DM2A 2IRUA 4OIXA 3M9NB 1HHQA 2Z56B 5C5JA 3UN3A 2MLZA 3OFHA 2VONA 3THTA 3D4JA 5T7LB 3OL6A 4ZP7A 3T5HA 1A0OB 2OD6A 2PSZA 5CYMB 4FF2A 3IRXA 1SJRA 4LF7F 1B4SA 5DG9A 1NZ8A 3DRPB 1JLBA 2XMVA 3ZZUA 4NLPA 4U96A 1QAYA 2HZCA 1NAQA 2YQ1A 1F6TA 1NMEB 3HVAA 4NI2A 4OLOA 5CYMA 3J7AN 1HHTP 2ASLA 1N5YA 1JWWA 3W1YC 3KG1A 2VJUA 1GNKA 4A8QA 1VI7A 1QTNB 4CNYA 1QTMA 1DY3A 2KG1A 5CCMA 1HMVA 3PTWA 2ZOFA 2MMYA 3BEGB 3M32B 1VQMS 4OL8A 4ZVHA 1SC1B 1Y5NB 2J7WA 3W60A 2RE1A 2QSWA 1U26A 2KJWA 2YKNA 1D1UA 1KHWA 3HK2A 1S72S 4RW7A 5GVQA 3ETMA 4URQU 3I56S 2RAQA 2G9OA 1U45A 4KB7A 1SC6A 2XZTB 1H6KX 1VGYA 1XJWB 2LECA 1RWVB 4CH0S 5D0HA 3QT6A 2OFGX 4WKYA 2IA6A 1KVIA 1GX5A 5FDLB 2NYIA 4X4VA 1YJ7A 1Z2ZA 2J7UA 3MM7B 5JJBA 2ZH8A 2M8HA 3QT5A 3LALA 4DFJA 2DNYA 1TKTB 4IR9A 1RAJA 3OTDA 3BGLA 3NOCA 3MM7A 1D8YA 3C46A 4USWA 3EJMA 3HHKA 2W9CA 1I3OB 1IKXA 3TQ1A 1S99A 2JC1A 3BGFA 2LEPA 4PG5A 3MD3A 4EEYA 1HYSA 2ZOMA 4ILLA 2XMKA 4B17A 1XBWA 3NBPB 3PFEA 1NSQA 1KLNA 3RBEA 1JLFA 4JV1A 4OYWA 4RNNA 4FS1A 4PKDB 1K0TA 2KT2A 7FDRA 4ZCMA 1L5UA 5DO2A 3J7Z5 3HDSA 2HQGA 1YBAA 3ZNJ1 2WB4A 2XLIA 2KT5A 1KBRA 2XHCA 2R7WA 3TAMA 1R8PA 2CAJA 1RT2B 4ZPAA 5A8RA 1OY9A 2EFQA 8ATCB 3D6HB 2W2PP 4RU9A 2Y0BB 3NP5A 3DOKB 4YB7A 5HO4A 4B9SA 5BJRA 5DRKA 5CXTA 2BKPA 3HFVA 4OX9J 4I7FA 1RU1A 4M5DA 1UVIA 4EBDA 5ETKA 2EG1A 1VCTA 4DX7A 2CQ2A 3KJVB 4PWDB 4GKKF 3P45B 4L76A 2VHGA 2AIRB 3PEJA 5CABA 1RZMA 3R7SB 3EWGA 2IVFB 2ZC4A 4HH1A 3UNGC 3OLAA 2MKIA 3M8SA 1Q79A 2GV1A 1F9HA 2DHHA 2YKAA 2FHKA 3JTPA 4G65A 2ROGA 3TUJC 4U8YA 1FKPB 3B4DA 4PQUB 4ZS6A 3UI3A 3D0IE 3ZZRA 3DRYA 4Q5VA 4X4UA 2KVIA 1TU0B 2H5EA 4OI4A 2R7TA 1FKPA 5F0UA 2FVQA 3QJPA 2VFUA 4NRUA 4F36A 1BQMA 4B9TA 2R3VA 4JI6J 3G8TA 1Q16B 2CPYA 2Z57B 2DGUA 3Q83A 2OUGA 4O3PA 3EX7B 4IR1A 1DRZA 2DR8A 1IKYB 3EVMA 3KLEA 3IC1A 2AJFE 3I82A 1UW4A 4IUFA 1ZA2B 3R97A 2UP1A 1SQGA 5MLCV 1FESA 2I8EA 3GYXB 2L48A 3NS7B 1W2IA 4O3SA 3FBEA 3CCQS 3QZ7A 1I94J 2L41A 2YBVA 4WYLA 3JQMA 4CO3A 2R9LA 4X4SA 4DN0A 2CJKA 4EUVA 2AGPA 6FD1A 4QIEA 3I4PA 1AUDA 2D9OA 4USHA 2OPQA 2HBRB 4U8VA 1FWKA 1UZHA 4PG8A 2KL8A 2XQCA 1CS4B 1T94A 2ZZMA 2KXFA 3MAHA 1RAHB 1YX2A 3KUHA 4LBIA 1FRIA 3C6TA 3NGTA 1YJNS 1RWUA 2W7AA 2Z2LA 1KRPA 4ZLJA 2QA4S 1LFWA 4ID5B 1OJ4A 2C22A 4C8OA 3RAQA 1IJEB 1O51A 1JLEA 1APSA 3ISND 4CLLA 4WFXA 3VTIA 5DG8A 3BPDA 1TFYA 4G1IA 2YPYA 2X1AA 1GFWB 2DNMA 3AQPA 5IWAJ 1ITPA 1YSJA 1FKOA 5K14B 3GV5B 3Q2SC 4ZVOB 2JEFA 1S9GB 1S10A 4ZPDA 1XNRF 1U49A 2CQ3A 2LA6A 4RL1A 2KI2A 5C25B 2UVRA 4LMZA 3R1HA 5ETVA 1UKUA 4F26A 2JH3A 1Y10A 2HBZB 3PRBA 4K0KF 4WZMA 2A18A 4I7FB 3Q0AA 1F5CA 1XIQA 5KT5A 2BE9B 4LF9F 3C15A 1VFJA 4CLWA 4ZCIA 4DFMA 4B3MF 4DSJA 4LFBJ 1EB0A 5EUHA 2CNLB 3KJVA 4LF1A 5A2QY 4PWDA 1WELA 2BM1A 2VBYA 3BF4A 1J27A 3DLGA 1PBUA 1SIZA 4DU8A 2F4FA 5K20B 3R6GB 1JJHA 5EWGA 2HRYA 1PC4A 2RKIB 4DV3J 1KN6A 3Q8RB 4FN5A 2HHHJ 4IRCA 2MQLA 3DLGB 3G6YA 3I96A 3VQSA 3G8QA 2OPPA 4DG1A 1YG0A 2DR7A 3DHWC 4U67Q 1HW8A 2ZH6A 1X9WA 3AA9A 3PV8A 4DV4F 4FYXB 4FPIA 4QYRA 3K0JA 2DXFA 3K7RA 2DRDA 1VMBA 2OPPB 3MMAA 4LREA 5K9FA 2FB0A 3OR2B 3P5BP 1JLCA 2XI2A 4JI7J 1TL5A 1D8ZA 5GAGI 3KFWX 1WHXA 3H20A 3FEXB 1GXUA 1C1CA 5HN0A 1XNQF 1FE4A 1CC7A 2B8QA 3OUYA 1E6YB 1S79A 4KGXB 3M8QA 5AT1B 4ECZA 1UW9A 2FGCA 2QLJB 4KR0B 2M70A 3L09A 1R3NA 2LQ8A 4N8NA 2ZUAA 4BWMA 1RWWB 2G2YA 1NJXA 3I9V9 4DWIA 1FWLA 4DL7A 3I5AA 2CZVC 2ERRA 3RTVA 4J9VA 4JI1J 2J9CA 3GLJA 2CQIA 1FT8A 3CCTA 1IBLJ 2ZUGA 3AODA 3HHEA 5D0EA 4Q2LA 2BV3A 4QIWD 1S9FA 3A1YG 1LFPA 2VV5A 2AJ1A 4P2FA 2FD2A 2HAFA 3IFEA 3RZAA 4DXLA 1X0FA 5A6WA 2MQOA 1C0UA 4O4GA 1N5QA 4R8UB 3W3SA 4Y6IA 3CDAA 3B4MA 2C2OB 5DDPC 4V1Ak 2QSFA 2XGQA 1X31C 3TX0A 4DR4F 5CZXA 1XNRJ 3NAIA 3EE3A 3UW1A 3LGNA 4ANCA 3CJKA 4LF6J 1UFLA 3KTQA 1S6UA 2ASDA 2KZMA 1SUQB 4NLGA 4OYBA 3SSSA 2GMHA 3IG1B 3CTRA 3PZPA 1YJTA 2MLXA 4LF8F 4M63A 1PAEX 1KWMA 2E5LJ 3DLKA 5F8LA 2IM2A 3HX9A 1QY7A 1YLXA 3GWCA 4JI1F 2FC8A 4KGVB 1HR0F 1ZAXA 5ETOA 1X7VA 2D74B 2L9WA 3DLKB 4OX8A 3W5ZA 4F3QA 5IT4A 1IKWB 4C0BA 3KDOA 3C6UB 3NGKA 5DZ6A 4DOZA 1FXRA 3KNAA 2VG6B 1TMJA 2XY6A 1RHRB 4IQXA 3MM5B 4UY85 3CMAS 4AFFA 3AB2B 4M94A 4LIWA 2R8GA 3W62A 2CUYA 3DDKA 4DX6A 3W2VB 1KOOA 4ZN1A 1WTBA 3KJFB 4U9RA 1BWEA 4DCOB 4FXVA 2HBYB 2DHXA 4ZHRA 3OV7A 2FVRA 3R5AA 1Y9OA 4KIAA 3LP2B 4F4WA 2IYGA 1S9EB 1FNXH 2HHVA 3L95X 3AA8A 5LXYA 2XO6A 4JI7F 1PYSB 2ZBRA 2BJ3A 4R25A 1KQSR 3T1HF 1TTHB 2DNRA 1FEHA 2G2OA 2IAJA 3BGRB 4USMA 4X4TA 1LOUA 1S9EA 1DBDA 2JFDA 1WSRA 2ROEA 4IG3A 4FZVA 1KHVA 2ADBA 1SC4B 1VYAA 1R8HA 2XNQA 1WTFA 4HACB 4ZVFA 3MPVA 1HHSA 5HI7A 5BXIA 3KK3B 2XLKA 2RNEA 1FE0A 2KFYA 1R8BA 4J7CA 4IH6A 1RAFB 1RP5A 4HACA 2VQEF 1NHKL 3BDPA 4UZBA 5F41A 3G6XA 2BABA 3GCWP 1QSYA 3R2DJ 1RTJA 3I0SB 2CZ9A 2V2QA 1UA1A 3JB9k 2OP5A 2CXEA 5L9XA 3G9CA 1T9TA 3NMAA 4LFCJ 3NGDA 2XO7A 3BBCA 4I2PB 2CPXA 1R0BG 2L9DA 4OJHA 2H1YA 1Q5VA 4DL0C 4NE9C 2K3IA 4CO2A 2UZAA 4NLWA 1LWEB 3WHIA 2R2RA 3H4DA 2FZGB 1IWGA 2NUHA 2F8MA 3MCNA 4P2MA 2ZH7A 5H9EK 2MPUA 4WK3A 1C0TA 4Z37A 3FUYA 3J81Y 4KHPJ 1SI9A 2YNFA 1R27B 3T5KA 1U24A 2X7IA 3AD8C 2DGWA 3DXBA 5HLFB 2YKMA 3BGOP 2RT3A 4MJKA 4ZMMA 3TEGA 4YR2A 1RKJA 2QLBB 2JNJA 1WOPA 1IM4A 1SXLA 4LF6F 3AQOA 3M6VA 4RW9B 4UOHA 5I3UB 2GW8A 1DTTA 2AYMA 2V8DA 3P3DA 5CH7B 4YB5A 3PX4A 3K89A 2XZWA 3IG1A 2HWIA 3MR6A 3RB6A 3CD5A 3NNCA 2M4MA 1QVGR 4USVA 4LR7A 3Q8VA 3RBZA 3PIPQ 4HYKA 3DOLB 3C3LA 4Q8FA 4CCHA 2VC1A 2QZ8A 4ANDA 4WIQA 2P6SA 3Q23A 3QLHA 4ZK7M 2UUCJ 3CCLS 4LF7J 2IRYA 3DOLA 3VR1A 2VOPA 2HMIB 4NZ0A 3C14A 4UW2A 4CO1A 3KLFA 2A2DA 1YRXA 3BYRA 1K1QA 3K5OA 2HGLA 4P7TA 4DF4A 1M5OC 4Y65A 2AW0A 1B7YB 1CJUA 4Q2MA 3W8GA 4X65J 1SC3B 3H59A 1NKBA 3TUPA 3HZEA 1X4DA 2EFOA 3GIMA 3SDEA 4ZA1A 3TO8A 2ZZTA 1BQNA 4ZIWA 3NWRA 2QL9B 2MKYA 3UR3C 4DPUA 3CDUA 1JJ2R 5SZTA 2E44A 2BE7D 4ZVQB 2BRKA 4NLUA 5KFNA 4X62F 3W9HA 1QVFR 3MI7X 1QUPA 3NCRA 3IM9A 3Q89A 3OTOF 3I0RA 3KK2B 3DRPA 2RF2A 1DLOB 3CNQP 4IG3B 4ED3A 1LWXA 2MZJA 1H72C 2BOAA 2F7VA 4TVAB 4ZVGA 5H9FJ 2JLEA 3GYNA 2NPFA 1S12A 3CJ5A 3OBIA 4USIA 1SV5A 4DQSA 2NYHA 4UQTA 1F2GA 4P9SA 2DHAA 2MZSA 4MK9A 1H2UX 2A2CA 4I64A 1RKIA 2W9BB 4WFNQ 5IXUA 4O3QA 2OPSB 1T95A 3BKTA 1FRXA 3F56A 3PACA 2VOOA 1VQNS 3PR4A 1OQ6A 3A3NB 2XS5A 4OI3A 3JAMU 1F9EB 1L3UA 2HEKA 1VRTB 2NXJA 4K4XA 1PYTA 5H9FK 4FYDA 4GO7X 3B6BA 3D3BJ 4ID8A 4LFAF 1Y3JA 4WJBA 2OEMA 3H5YA 2NQPA 2FHJA 2CG4A 4DSEA 2B9XA 3BH7B 2D41A 5KFIA 4U7UD 2W2OP 2DO0A 1JIHA 3ISZA 4Q8EA 3TEHB 2K8GA 3A4TA 4RUHA 3M2RA 4J9MA 1ROFA 3P5TL 4OYIA 1ULRA 3OXGA 1X60A 2XULA 2H65B 3UCGA 2FJWA 2OI2A 2DJWA 2EK6A 4L3NA 2W2NP 2E66A 3LA0A 5FLXU 5GAEU 3LGHA 4RW9A 3VGUA 2WVBA 5F8JA 2HGMA 2JL9A 3DGPB 1IKVA 1TP7A 5LMNJ 2CDRB 4JV5F 4M5IA 3DLLQ 1RT7B 1H3DA 5CYQA 4DL4A 1A6LA 4WTYA 3K5PA 3BDEA 2Q66A 3UPFA 3V5RA 2H3EB 4WP9A 4XDCA 5ITHA 1CJKA 3K57A 1RTZA 1ZZFA 2CVEA 5L9NA 1NK0A 3TVKA 3R5DA 1NSAA 3P96A 5GADU 4IG0B 1NK9A 5HQ8A 4JI8J 4DX5A 4OZ2A 2HMIA 1N4LA 1LK5A 4ES2A 1BGXT 1NNDA 2ZKUA 3CMQA 5D77A 3V6DA 4B9VA 3Q22A 2FLLA 3W64A 4DZDA 4X64F 3BJYA 2IIHA 4X65F 1MSWD 5BYSA 2B4OA 3QRQA 2GIFA 2DGXA 2LXFA 2XTJP 3KK1B 3SXLA 3W7BA 3W9JA 4BDPA 2MKHA 3DYAB 2Y3YA 2FC9A 4HTJA 5L1JA 1U4BA 1NJWA 3Q8SB 1IBLF 1T9UA 3G87A 3QFHA 2F5GA 4UZCA 1TAUA 5K8NA 1F1BB 3LUYA 4AXJA 1QD1A 5C42A 3PFOA 5HMXA 2Q3PA 3SIPB 4XO0A 4L75A 4C8LA 1RHMB 5KFBA 2G0CA 5DQIA 4C7QA 1S1XA 1VBXA 5J2NA 3H2UB 3C2PA 4JI4F 2OFHX 1X5SA 2QMWA 4B9NA 3CCZA 1DTQA 3MMBB 2OH2A 4DSKA 1LWCB 2ZWOA 1RHUB 3S8SA 3OJUA 4ITSA 1UZDA 4LR9A 1AT1B 2ZFHA 2UV8A 3QSIA 4BHQA 2C3MA 3OT9A 1MW7A 4EK2A 5LT5A 4RNMA 4LF8J 4RBVA 2HW3A 1NUEA 2EXUA 2QG9B 4RW4A 1Y7PA 2QTWA 1JJ4A 1HNZJ 4F3OA 1IM6A 3KG4A 1UPPA 4EZ6A 4JI2J 5D4OA 2ZH4A 5ETNA 3I5BA 3TAQA 3R8YA 1HKAA 2ZWPA 5CYJA 2DRBA 2C2RA 2Q6BA 5IT0A 1NM2A 2DIUA 2HHPA 4CT8A 1JLQB 1V5IB 2V50A 3D66A 1NB2A 7FD1A 1JJCB 2KG0A 2K1RA 2KHCA 2PIIA 2AJ4A 3DU5A 5IM0A 5HROB 2WSFC 3GG1A 1VS3A 2NSBA 2RMLA 2VG7A 4M5GA 1UVLA 2LU2A 4Z2XA 2BW7A 1ZH5A 1NXIA 2RUGA 2E7XA 1FNOA 4C11A 3ZFVA 1EJ7L 3J81U 3K2YA 4DV7F 3CXCR 4TY8A 1D3WA 1WD6A 2DH9A 2AV5A 6FDRA 5D4LA 3T19A 4DV0F 1RAGB 1HNIA 4ID5A 1T9YA 5HBMB 1TK8A 5L1LA 4RLEA 2E29A 3D68A 1TELA 4LFAJ 4DI6A 5KFFA 2I5JB 3FFIB 3I87A 1OYDA 1B3TA 4B3MJ 4LFBF 2QIFA 1CPZA 4UF4A 1R8CA 2QRRA 4F2SA 1WUUA 4DX8H 4C3KA 4DFKA 3HHLA 2B5JA 4IG0A 3TARA 2IBKA 4Y2MA 2A6OA 5KOXA 2M3DA 4M8LA 4Q44A 4BLGA 5FIIA 1KVKA 3JSMB 2XYHB 1D9FA 4QU7A 3WC0A 3MEDA 1G1XA 2VJVA 5KFGA 1JXVA 1X5TA 2JC0A 2VC0A 1RCXB 5JXSA 4LF5F 3MMJA 2ZH1A 1U1QA 4P7VA 1MNEA 2VDIA 1R89A 4CWBA 5B09A 1QE1A 2R8IA 1XTZA 4H4KA 4KSEB 1MWYA 2FJEB 3C15B 2LYVA 1XERA 1HBMB 2V4RA 2OPRA 1RA7A 5I42A 1FJEB 4I56A 3EGVA 1T05B 4ZP9A 4UY8T 1U2CA 3EVWA 1G7CB 4KBIA 5HK4A 4DR5F 3JQKA 8RUCA 3QGPA 2F3JA 4KGMA 4TY9A 1HD0A 4I0WA 3D1QA 4LSLA 2DO4A 5IOLA 4DPOA 3PW0A 2V9WA 1MN7A 5K8PA 3NCPA 2I38A 1YZ6A 3EUNA 3HULA 5CYQB 1G3OA 1FFSB 1HBNA 1UPMB 4OJGA 4EO6A 1WC3A 3RBDA 1P1LA 4UOGA 4QYZK 1SH0A 3AOBA 1AA1B 4C8ZA 3OFEA 3ENVA 3FBCA 4QIVA 2BANB 5KTQA 1L3TA 2B51A 2IM0A 2ZVIA 2UXBF 3HVRA 4PG4A 4P52A 2Y8WA 3GJQB 3K8WA 3EZ5A 4IFVB 2SXLA 4K4YA 4OI6A 1RA6A 1C1BA 4NLYA 3WZ0A 3CT9A 4DR6J 1IWAA 4G1QB 4HLBA 4QBUA 4MFBB 1TAQA 2IJFA 3EXCX 2EFVA 3US5A 4M5MA 1U1KA 1C2PA 3DI6B 4RNFA 2FYXA 3MPYA 4LRDA 3SSQA 2M52A 2DXDA 3IR6B 3L9ZA 1FXLA 2ILZA 2V63A 3HD2A 1B0PA 1TKTA 2IFXA 3HVWA 1HD1A 2HNYB 1X8DA 2D3OR 1WC1A 2QA2A 1RT6B 2OEJA 3KUGA 3UO0A 3OTOJ 1V3ZA 2GMJA 3D7SB 1WG5A 1M5HA 4OQJA 1GAOA 1KDNA 4PABA 5DQHA 3KOAA 2G1HA 1S1TA 1IVZA 3OLBA 2OPQB 1MROA 3ONQA 4PAAA 4P72A 5F8IA 2HFUA 3ILIA 2UXBJ 2B9YA 4NX9A 1P9QC 3FBFA 4F04B 3MMCA 3N6MA 2BJ9A 4C3MA 4OHYA 3K5LA 2GHPA 1C0UB 1K73T 4R8UA 3TZXA 3K5NA 2AZ3A 3MXHP 4LSNA 2HIYA 2DNHA 1H74A 3IO1A 5K8MA 4WK1A 3KLHA 2NR0A 2R8KA 3TAMB 1NDCA 2A3JA 2JJ4D 3V2UC 1J5OA 1YK9A 2VL1A 3SZ2A 1VDHA 2P9EA 1NDPA 1WI6A 3FKBA 4OI2A 4F67A 2ACMA 4CH1A 2EFGA 4OX6A 3MR5A 3KYLA 1W2BR 1EQ0A 4A8YA 4ECTA 1CC8A 5IT9Y 5ETLA 1LEOA 2GC8A 2ACYA 3KG0A 2A10A 3IXQA 1S77D 4WF9Q 2ZNZA 2E1AA 2W4PA 1NU4A 2KXHA 3VVTA 2B6AB 1S1UB 3L4BC 3UQSA 4JOUA 4E2FB 1RK8A 5HVFA 4K2JA 4DL6A 3LP0B 2NZCA 1SVDA 2VICA 2ASJA 5EN1A 3EPGA 3IS9B 5E0OA 4MIBA 2POKA 5D6GA 4TXSA 4WFZA 1S4EA 2AHOB 2WK4A 5ETTA 3W2VA 3GIKA 2OGUA 3GV7B 1CJVB 1S6OA 3N6NA 4OYMA 2H48B 2OMOA 1WEYA 3N5BA 3PHTA 4DR6F 2BANA 1UAWA 2HFSA 3NRBA 4IFYA 2V2VA 3QGHA 3UN2A 3CW2C 2IBOA 1QAXA 3QT7A 1CBKA 4LJMA 3AHPA 1B99A 4B3TF 3IWNC 2OHDA 4MK8A 4ZOSA 1T7PA 2CPIA 1Q53A 2X1BA 2BA9A 4QPXA 3ILLA 3QO9A 2CZ4A 2MYFA 1NCLA 2DYAA 2HVEA 4OMFG 2YKNB 2LDIA 3W5XA 2G4BA 1SJQA 5IQ6A 3S6EA 4A8SA 4LQ9A 3EMTA 4FXDA 3CUNA 2UUTA 2JFKA 1E6YA 1UJ6A 2KRRA 3A13A 3SFUA 3PO5A 3M8RA 1KLMB 2V4JB 3TZZA 2XY7A 1KR4A 5AE2A 1FK9B 2AU0A 4ZDNA 3MWBA 1X9SA 4WZQA 1X4FA 2JWNA 5JVGQ 2UXDF 4KFBB 1UMJA 2FJBB 3TJ8A 3ZXWA 3V4IB 1N8RT 4U7UK 4I67A 2DGTA 1NDKA 3SFGA 1YJWS 1Q81T 2DCLA 5IWAF 2FQQB 2XSJB 4MYUA 2AZ1A 2GIRA 5AXMA 3VHQA 4Y0FA 2IHR1 4KKOB 3KHGA 4DR1F 2F4VF 1HI0P 1C0TB 4J37A 4QYZJ 2HBQB 1JK9B 9ATCB 3CJ8A 4GKJJ 2EKYA 1XMBA 2G0IA 5DQGA 4AQYJ 5HLFA 4NLXA 2N3OA 1IJFB 1UFKA 4LBHA 2VH7A 5KG0A 4C0OC 1TK0A 4ZVPB 4HDGA 4RBUA 2X51A 5E3PA 3TA0A 1VQ6S 2PFDA 5GAHI 1TUWA 3GIJA 1VQKS 2CWXA 3K5MA 2R2SA 4CH7A 3QAUA 4RWXA 3PHEA 4GVBA 4A8FA 2AGQA 3JTOA 4KH0B 3W65A 1FHTA 4QU6A 1Q8BA 3CJKB 1VRQC 4OZLA 1SKRA 2GAHC 4ZJQA 1RTDA 2HRTA 1SUQA 2H51B 2PD1A 4A46A 4WFBQ 1NK5A 3OL8A 4WXWA 1Q5YA 1JKHB 3ENQA 1S1UA 1H73A 4HT5A 5DS7A 1OPZA 1UCNA 2I2YA 4ES1A 2RRBA 4OI1A 2DNZA 3SCKE 4ZPVR 1AZSB 3G8SA 3KLFB 3M2VB 2MHEA 3ZTPA 4YN3B 3IS9A 3UWTA 1S0NA 4I1TA 4DR1J 4PPDA 3FSYA 2V34A 1S1WA 4B3RJ 4DG1B 2P5VA 4FKYA 3KLGB 1M5VC 2CQDA 4AYBD 3CC2S 2N7CA 2HKEA 2CFXA 1ZM9A 4N77A 3AFGA 3MTJA 4JUZA 1HFEL 2UV8G 4IFYB 4EWTA 1S0VA 2LEAA 1HNVB 2MEWA 2QC3A 3OD2A 3ZZPA 1X4CA 3BSCA 4FF1A 2HLTA 1JLCB 2KM8C 2R8HA 4KHPF 2MZ1A 1NDLA 5IC4B 3UDLA 3SQGB 6AT1B 3RRGA 5A8WB 2AX1A 4DQPA 2XNRA 1FRMA 2ZOGA 3ZNUA 3J7ZT 2YWFA 3H7HB 3MR2A 5GAGU 1N88A 2V94A 4C97A 2UVWA 3KHRA 2IAJB 3I5CA 2CNKB 2H5JB 4LRCA 2BBEA 2PC6A 3OHAA 1GMWD 1RGVA 4B02A 2W25A 3QNWB 1UVKA 4OI0A 3UD4P 3M8PA 2L9NA 1RYRA 1VQSA 3RRKA 2MQNA 3MR7A 4IQMA 3GP9A 4DV3F 1Y00A 3OTEA 4RW8A 1NK4A 1Q95G 1U25A 2MJUA 1R8AA 4E98A 2RHSB 2IJNA 3C66A 3UCZP 4K4SA 2C2NA 4ECSA 1U1RA 4TU9A 1GT8A 1S5ZA 3BS9A 2XHWA 2FVCA 4RW6A 2CQPA 3DOMA 4D3HA 2XSJA 3GU0A 3HSGA 3ZZYA 4DU7A 1NJIT 1VQ4S 4GKJF 2AT1B 3JSBA 4Y2IA 3GR1A 4DF8A 1RJJA 1R6VA 2KKHA 4AT1B 2NREA 2GQ2A 2F8HA 1KNZA 2EFPA 4C8NA 1NKCA 2RSQA 3D0GE 3R5BA 4DDFA 4EYHB 1U6BA 1HBOA 2VG5B 1WF0A 2XG8A 3MCMA 1RYSA 1FRLA 2RIJA 1JLAB 1IKVB 4JV0A 1VR6A 4KHRA 2LCWA 3DDNA 5ETRA 1F2HA 4CLZA 1HA1A 1AROP 2WHOA 3MURP 4NEZA 5C2GA 1HR0J 2VBXA 4ZPTR 4NZ7A 3CCSS 3BYPA 2HIQA 3IN5A 3CCES 3V81A 2BX6A 2C2EA 5THWA 3ICLA 2ZHBA 1FVSA 1JKHA 3BB5A 4DSFA 1CJTB 4FVMA 2DR6A 1RWMB 4JB8B 1YJRA 2HZAA 2F8EX 2JRSA 5D4NA 3TWZA 3M2VA 3QPIA 2VQFJ 4QWCA 2EBEA 4G1PA 3BH6B 3VAIA 3CGIA 1RU2A 2UXCJ 1DQ9A 1DFDA 1UWAA 1S1WB 1RT1A 2WCXA 3FEZA 2RRAA 2CQ1A 5KFZA 3BSOA 4WBFA 4NLDA 3VGVA 4ECUA 3H5UA 3PW4A 1JLGA 2Z2YB 3HLUA 3MM8A 3OHBA 3HHDA 5C24A 2WZ1A 4N41A 3R5CA 3IWXA 5J2MB 3KHHA 1L3SA 1M5PC 1C4AA 1S49A 3T1AA 2CPEA 5LL6d 1GMUA 2H54B 2WTFA 2V67A 2QN6B 1FF2A 3OTCA 4I6YA 2ZD1A 2ATCB 3KKFA 3OR2A 3PYEA 4GMKA 1R0CB 3OFGA 5J2NB 2C2ZB 4O0IA 3KK2A 3TRGA 3HP6A 3MD1A 2XZDB 3SCLE 2Y9HA 2XEXA 4DL2A 4EFAC 2B9EA 2RU9A 3RB3A 1S0MA 3VAHA 1NPPA 3M6UA 3OVSA 2DGVA 1R0AA 2H9ZA 1JXEA 2IDLA 4ZITA 4J9OA 3K17A 3NG8A 4J9KA 4M5HA 3HZGA 1N6QB 4CP5A 1HI8A 4ZVEA 1R0AB 1LWEA 5L1KA 1U6FA 4FF4A 1RTIA 2FHJD 3CJQA 3M7VA 3JTNA 3QIPB 2MZQA 3RGIA 1HWUA 2OO4A 2QLXA 2VFSA 3ENAA 1JXLA 2CQHA 4CDIA 5IM0B 4HVZA 1TUGB 4CLPA 1RWXB 3M8WA 4CLSA 4JI0F 1U09A 2MZRA 1VQYA 1IBKJ 4HEA9 2DKOB 4USJC 4QQBA 1OSDA 1HQEB 2WBMA 3CULA 1XQIA 2VASA 1JNRB 3F44A 2MKCA 5HATA 1KONA 5AE3A 5M2UA 1N54B 2O5DA 2EKNA 2GJ2A 2GVZB 1DTTB 2CKWA 3IBCB 4TN2A 2PMWA 4JI2F 4ETZA 3LTOA 4FYYB 4CZCA 2MSSA 1XMQF 1CVJA 2HHQA 1OO0B 3CEDA 1M1GA 1U0HA 2AEJA 3NNAA 1YBTA 1LNQA 2DCUB 3N28A 1S48A 4NWBA 1T03A 4B3TJ 4DCPB 2HHTA 3PRDA 2O66A 2O3DA 4DR5J 3G6VA 3GILA 2NUUG 3H5SA 1YJUA 4RUCA 4QCLA 1PAUB 4F50A 3PVXA 3C14B 3JSMA 4X4OA 2ZJRQ 2OAUA 4ZCLA 1WHVA 5F3ZA 2NXUA 4BC9A 1VQLS 2I6WA 2D9PA 4WP3A 1IQZA 1EKSA 3DLJA 4QWBA 2WONB 4A8MP 2LMIA 3NS6A 3D6FB 3FCHA 2KJVA 1QE1B 2KB2A 8AT1B 1NKEA 3I6PA 1WHYA 3SDEB 2MB0B 4FBTA 1HLWA 3G71S 2O67A 4O44A 2CWKA 2J0SD 3BM7A 2UXDJ 2YNGA 5L1IA 2EVZA 4ZHRB 3VAGA 2GJIA 3HSJA 1T8EA 1VJQA 2YTCA 4F4XA 3LP2A 1TQLA 2RF2B 4N5SA 1YDLA 3ITHB 1M0SA 4A8XA 2O01C 3O6QA 4LRAA 4NCGB 3PW2A 4QIFA 1IR0A 5B0AA 3P6YC 1FO1A 4NI2B 4BWJA 2IRXA 3M6WA 4NYPA 4DPYA 3SYZA 1FKAF 5JMNA 2WOMA 1O5JA 3FK4A 3DGVA 5KOWA 2OPSA 5KT7A 1ACMB 2R7XA 1F9FA 2EFNA 3U27A 5DLGA 4A8WA 3C8YA 2R4FA 1SL0A 1FJ7A 3CJRA 3TA2A 3ZTRA 1AYEA 4CLTA 3F73A 3R3TA 1TV6B 3KMQA 2N3LA 2QA4G 1Z4UA 1F0XA 4KHMA 4O3NA 3BSNA 1MU2B 2DH7A 1Z2LA 1XR5A 5F8MA 4C0HA 2RQKA 1VLOA 1ZAVA 2HG4A 1D0EA 1MMLA 1Q4RA 5KFQA 1O0PA 3G6ES 1HI1A 2BVZA 2B7BB 3A8IA 4H4OB 3HKWA 3K59A 2FLPA 2CPJA 4WXOA 4K5RA 4C9DA 3LF0A 1TKZA 5LSLA 3QBCA 3FMBA 4H4MB 2X3GA 4WE1B 2AX0A 4QR1A 3NNHA 3NGUA 2HFZA 4B08A 4PWUA 5B0BA 3HT0A 1TVRA 3I32A 2V9KA 4PR6A 3DLHA 1HYSB 4D3GA 1U1NA 1O6XA 1A9NB 5CCLA 1YITS 3RUBL 4KJIA 3PG9A 2M2BA 1GXLA 3TR5A 4QIGA 4IOCQ 2JLFA 2PI5A 4JI5F 2B5JB 2W4DA 1EP4B 2KT3A 3O44A 4A47A 5EX3A 1K0VA 1Q78A 3RU0A 4YDXA 3WC2A 3FBBA 1OY6A 2J0XA 2WONA 4HHJA 2Y8YA 4NCAA 2FJDB 4LRBA 1FDBA 4B3OA 4K4VA 1EP4A 3D0HE 4C2MA 4ED6A 1C4CA 2DNKA 2KDOA 3CWJA 2HK2A 1EETB 1WKJA 3LAKA 4TNOA 1G6BA 3Q8YA 2KU7A 3OPKA 4DMZA 3NEKA 4IOAQ 1H2TZ 1NEEA 3TQEA 2KN4A 4P73A 3MM9A 1BQNB 2OKQA 4V19J 2HNZB 3CCJS 5LMUJ 4X4RA 5KG3A 3LP0A 5IC6B 5KT2A 2LVWA 4O23A 2B4PA 4ZLPA 2GMLA 2BZ2A 2IA0A 2M0GB 2HFNA 3D5MA 3LGMA 4HR2A 2F63A 4F0MA 3AH6A 3HFKA 2K3KA 2CQGA 2M88A 3MOZA 4TU7A 4LSLB 2J76E 4I2QA 5KFWA 2M5YA 2B4VA 3CJ2A 1HNZF 1ICEB 3O8WA 3BSAA 5T7LA 3M9OB 2HK3A 1HWIA 3CJTA 5A6PA 2XMAA 4L74A 1I6JA 2ZBPA 3LPEA 2WOMB 3NXZA 3NMRA 5ADZA 1AW0A 4KT0C 1OIAA 3N0VA 3TA1A 2NZ4A 3FC9A 2DIVA 1LK7A 2MTLA 2RVJA 2BJEA 1DHMA 1FTCA 2BUNA 4IYQA 4F8RA 2AEFA 4J5OA 2ZJPQ 3U02A 4ECWA 3GSDA 2XSFA 3V6KA 3JSRA 4YOEA 2QYCA 1U8WA 2LEBA 3HSDA 4RR5A 2E9TA 2WVDA 5M2RA 4L72B 3SCJE 1NZAA 2QLFB 4NLRA 2P2CB 4PZVA 2QFJA 2B9WA 5T14A 2HQFA 3EPIA 1N52B 2G13A 4PG6A 2G1DA 3D1OA 3CCWA 3T6BA 3IBFB 1J5EJ 4JP8A 4NXNF 1KC8T 3DRXA 4X84A 2VODA 1LKZA 4QWDA 3KJQB 2HVIA 2DISA 3HJFA 3UFCX 1KOHA 2WBRA 1QLNA 1QM9A 4KFBA 3M30A 3V4IA 1S4FA 2NPIA 4GRSA 3M1VA 3K8VA 4DL5A 1RDRA 1RWOB 3GPAA 3VQTA 3MAAA 3PYFA 4EO8A 3NBPA 4MH8A 1UWBB 3VAJA 2Z2MA 2YH0A 3C6TB 1VK3A 2RILA 1KS2A 1RT7A 1R43A 1K44A
chains in the Genus database with same CATH topology
1IUJA 4ELVA 3FQLA 2RS8A 3PDNA 2CJBA 2CQCA 1VHFA 2W9CB 3MHYA 1JLEB 3QGGA 4DR3F 2ZZNA 1H38A 2WSEC 4QZVB 4LSNB 1VLYA 5KFDA 4E8UA 3DOKA 4HKQA 1UVNA 4W90B 4P2SA 2COLA 2L08A 3LAMA 1RT5B 2PT0A 5J1EA 3KLVA 4FF3A 3PM9A 4OZ0A 4UQGA 1VQOS 4U7CA 5T41A 2PMZD 2BR0A 4YUDA 5E41A 3BO2A 2YWGA 2MHNA 1X0PA 2ABYA 2D1CA 4OZNA 3NLCA 3SV4A 2BW2A 2AYBA 3H5XA 3IWLA 3IRXB 4Y00A 2HPUA 3B82A 5LJ3Y 4YP3A 2VFVA 2X1GA 1IBKF 2VZ9A 1RI7A 3CCRS 2BXJA 4QR2A 1FERA 3MEGB 4I68A 1N0VC 4IFVA 1RT4A 2YWEA 3FSIA 4TYAA 3IGVA 3CMES 4PQUA 3SSRA 1F5BA 2ZBCA 3MEGA 1HMVB 5CHCB 5KG1A 5LMUF 2BQUA 1VOMA 4EZ9A 4XAKA 1HBUA 4KGKA 2E5GA 1BQMB 3SMZA 4RW7B 5F0WA 3U1NA 1CQNA 3ULHA 3M8PB 2F9JA 3T6JA 3K58A 2I1RA 1V3RA 2CPHA 2HNYA 2F40A 4RW8B 3DCAA 4YQWA 4PRFA 1YRUA 3M8QB 1FRHA 5KFAA 2HGNA 2I0XA 5AXLA 3FSXA 5KFRA 3UD3P 2CPZA 5E3CA 5BYRA 3HHNB 1BD6A 3LWMA 1MROB 2GHWA 1OWXA 2EK1A 3QMQA 2YNHB 4ILRA 2WAQD 1X4HA 3EGZA 3DXSX 1L3VA 1TUVA 4TKTA 3HXMA 1U1PA 2KFNA 4YR0A 3HO1A 5G0RB 1UEVA 2YNHA 5KFXA 3OW2R 3QGIA 1MMDA 3MF5A 4K50A 1H7WA 1DQ8A 1Y5LB 4O3OA 4GC7A 1CG2A 4WFAQ 1P6TA 3B78A 2LA4A 2OLWA 2RRNA 2UXCF 1ZTTA 1JLAA 4KC5A 1WEXA 3AJ2A 2EWHA 2KZZA 4K4UA 4M1KA 2Q43A 1YRTA 2VPZB 3H8YA 1R6YA 3TP2A 3CCVS 4EYIB 4DL3A 2DVIA 2DRAA 2YX7A 4ZPCA 1FKOB 1NH7A 3CSKA 5K14A 3Q24A 3T3FA 1UVMA 1S9GA 3H2VE 1KFSA 1RTDB 4FXWA 1HBMA 1Y4ZB 2C42A 2KYXA 4RNOA 2E1CA 4YFUA 1R7IA 2D3ZA 1TL3B 2W24A 3M9MB 3BQ1A 1VRUA 2AYEA 2LQ9A 3HM9A 3TNVA 3W2WB 1HPZA 5G4DA 4ZP8A 3BR8A 1U2FA 1NO8A 1TL3A 5E33A 3ZZZA 2ZH5A 2RKIA 3FJ2A 4F25A 2MGZA 4AL7A 4ECRA 2C2DA 4ED7A 4RKUC 4MIAA 4ILMA 4DLEA 1L3KA 5IS2A 4EGLA 1ZAWA 3QIDA 2MGZB 3BQ0A 1GH8A 2XCPA 4N56A 3FRYA 3HKZD 2XBPA 3QO9B 2M9KA 5CZVA 5FLXY 5E3AA 4LF4F 4ES3A 3QJJA 2CQ4A 3D2WA 4IH5A 1Y0HA 2J9DA 5IFMA 1S6PA 3MAQA 2C3YA 2VFTA 3AB4B 2HFOA 5KFTA 3DI6A 3CDWA 1HARA 4YR3A 1Y3KA 2DK2A 4WKRA 1C1CB 4WCEQ 2DHGA 2PO4A 4DS4A 1VBYA 5B7WA 3GR0A 4I6WA 4KQZA 5I3QA 5E7OB 3H98A 2LQBA 1VC0A 2PN6A 4NL5A 4C8KA 5GAEI 1QAIA 4I2PA 2LKZA 4MKBA 1KTVA 4DBQA 3MEEA 4MAKA 1HL6A 2YH1A 1K8AT 4QWAA 1NJYA 3NL0A 4ICLA 3AY0A 3A8EA 1FD2A 5F8GA 1N56A 1CLFA 3MECB 2J9DE 2JEIA 2ZVSA 4WU2A 4ICLB 2FVPA 2CJAA 1ZPWX 2YKMB 2N82B 2AWZA 1UJ5A 4J9PA 1RT3B 2CQ0A 3CD7A 1J5OB 2HVHA 2HHSA 1KQKA 4K4ZA 5F8NA 3BGUA 2ZITA 3IBWA 2CVIA 5I4MA 2FJXA 1KD1T 2XS7A 4B3RF 4J9SA 2ZBIA 1PSDA 2JZ5A 3ZZTA 3PX0A 1ZM2A 3KLGA 4WIIA 3M2UA 1H0HB 1VBZA 1J5EF 4QWEA 1SL2A 2J0WA 4MKAA 1YWXA 3RAMA 2HVZA 2R7RA 4LIRA 1P27B 2DBBA 2R7OA 5CA5A 4URGA 1TK5A 3DMJB 5KFPA 1NH8A 4IO9Q 3BN7A 2VPWB 5DDOC 3DU6A 2E7WA 3H2LA 3BGRA 3OR1A 3U7JA 4AXIA 4KV8B 1I94F 3RR8A 5J2QB 3MMAB 2Y1IA 1T05A 2AYGA 1X4EA 4KPYA 4R5PA 5J2MA 2K7KA 3JYTA 1HW9A 2XWYA 3N79A 3PNIA 5J2QA 1T05B 3H25A 1S76D 4K0KF 2DNLA 1UETA 1UEUA 4FPRA 1G2EA 2LDYA 1FDAA 3Q8QB 3ZZ0A 1FNMA 4CIOA 3HT3A 5KG2A 1TFWA 4A48A 3FDSA 5JUMA 1F60B 1NHVA 2IVYA 2Z4PA 1N36F 3I9ZA 1LV5A 1U7LA 2E5JA 1Q7YT 3CD0A 4JBCA 4F02A 3CO9A 3MPWA 3IR7B 4F2RA 3DLEB 2UU9F 1PILA 2XGPA 4Y2KA 3V4MA 1K1SA 5J1PA 2KH9A 4RNHA 5GMKa 3VZHA 1LW2A 1SB6A 1HBOB 2VG5A 5DGBA 2MSTA 4MMOA 3EGWB 1TKZB 1BQXA 1XR6A 2V2KA 3GFHA 3I55S 4DV2F 1ZZNA 2PI4A 1NJZA 2PE8A 1LW2B 3TYTA 1N0UA 2ILYA 3UDCA 5KFCA 3THVA 1UA0A 3POTA 3L7OA 1TVRB 4IH7A 1Q8IA 3M6XA 1OSCA 1NK6A 1WWHA 2HQIA 5H9EJ 3RW6A 4B9UA 3MOJB 1TL1B 3QYYA 1T03B 3VAMA 3VF0B 2OMLA 3WX4A 5K8OA 2B4UA 1LXNA 1X5PA 4Y2AA 2R7SA 2P9CA 5EGYA 1FD8A 3GFXA 3H40A 3NS5A 1TL4A 1IQTA 1VJWA 2DGQA 3MUTP 1NK8A 3IAM9 1LQ9A 4ECYA 3T5JA 2J7KA 1HNWF 4RZRA 4MTPA 4H54A 2MQMA 3T9NA 4KV8A 4NA2A 1GXTA 2R7QA 2GNKA 2JSXA 5D3GA 1TKDA 4K59A 2FGOA 3CB4A 3J7YI 2JDJA 2U2FA 3R27A 4NLVA 3V6HA 1ZPVA 2VA3A 2YQ3A 4I2QB 4FS2A 4I69A 1OPIA 4P6QA 2W9BA 1S1XB 4QR0A 3KK3A 2FLOA 4WU3A 1ZTWA 4NCGA 2BQRA 2JOQA 3PX6A 3MMBA 5F9LA 2OJ3A 1VRTA 1N48A 3CCMS 4KE5A 3QJLA 4OFZA 1ZYQA 4X4QA 4B9LA 2UUBF 3HF5A 4ATNA 4NLOA 4KAIA 1D9DA 4NMLA 2MKKA 4NXMF 2HQ3A 2W8LA 5F9NA 4ELUA 1WEZA 4IDKB 2DNPA 4QPTA 1JLQA 4KRWA 4X4NA 5HROA 3OSPA 4C4WA 1HQUB 2QT7A 2P6TA 3KLIA 2F9DA 1FRJA 2XS2A 3GMGA 4H4OA 2EW9A 2EG2A 5KFEA 1UWBA 3N5FA 2DNQA 1IXKA 1LW0B 3FZBA 5H1SV 4YHHF 1WHWA 2VBWA 4WE1A 2DTJA 1HNIB 5LSOA 1FJGF 2E9ZA 1U8SA 1V3SA 1LWFB 1RTHA 3D1HA 3DGPA 2B56A 1JMTA 3HMJG 3V81B 2YWKA 4DV1F 2VA2A 5KFLA 4TQRA 2ZHAA 4BBYA 2ZH2A 3QLHB 4B9MA 4U6PA 5DM6Q 3CPWR 1SJ4P 1U48A 5KFVA 3T1HF 3LOUA 5KG7A 2APOA 3IRWP 3LWLA 2RU3A 3GV8B 5DLFA 2UUAF 4NPOA 4ETXA 2W7PA 3DYAA 3T9ZA 1SKWA 3P49B 4AL5A 4B3OB 1Z1ZA 4O4RA 3CJ4A 1EETA 4DN9A 5I42B 5D3GB 2OSRA 3TUIC 3DM2B 5SUHA 1K9MT 3PJWA 3MM9B 1TAUA 3SI8A 1JNZB 1S97A 3DLBA 2UVVA 4Q0BA 1DLOA 1VQ7S 4AL6A 1DTQB 4NOHA 3KHLA 1FRKA 1HBNB 2FUG9 2HS4A 4YB1P 5KG5A 1E6VB 1U1LA 2BDPA 2PFFB 2JEGA 2RQMA 3GIIA 2DPJA 3KMSA 1FJCA 1WG1A 2GHVC 3DRSA 3NAHA 2XMTA 2Y0SD 2IYIA 1DQAA 4F4KA 3LQVA 3O5TB 4HH0A 1N5YB 2YY3A 2DR5A 1P1TA 3MM6B 4CTAB 2W7OA 4K4WA 4ED5A 2R7UA 1TV6A 3MTKA 3PXGa 3HI9A 4XDDA 3KLEB 3VWSA 4N76A 4G1QA 4QW9A 1TKXA 2K1RB 4QW8A 1YJ9S 3X3UA 2ZKTA 2GA7A 2ZE2A 4HDHA 2KHDA 1VIOA 1CQMA 3SEOA 1UJ4A 2AGOA 1H7XA 2U1AA 4IRKA 3IA0A 3G96A 4LUBA 4FNHA 4H4MA 4DR7F 1YGYA 2CJQA 1RT6A 2CDQA 5HBMA 2JEJA 1BLUA 3GG0A 4MYTA 2VD3A 3EXYA 2VKZG 1NK7A 3HVTA 4HTIA 2JX2A 3GFYA 3S01A 1GTEA 3M1VB 5B0CA 3U1MA 5MAOA 5G0RA 3S1TA 2Y1JA 3DLHA 3HHLB 1LWFA 1RTHB 1B0TA 1HWKA 2IC3A 4Y34A 3BO4A 5HP1B 3J7A1 2HWTA 1IKXB 3KWMA 2HWHA 3FGVA 2DGOA 4ZPBA 3MGJA 1N32F 2LQJA 3I31A 4DQQA 3O3LA 5EWEA 2I5JA 3FFIA 2YX4A 2C3PA 2W4CA 2N4DA 2ZJQQ 3VZIA 4J9QA 2ADCA 1GQEA 1SJ3P 4Q43A 4BCAA 4Y3CA 4RUAA 2OPRB 4J9RA 2PMHA 2YNIB 4ZCKA 2JLGA 3V6JA 4ECXA 4ED0A 4MIWA 1RT2A 2GGPB 2YX1A 1PGZA 2QO3A 2YKOA 2XY5A 4K2XA 2IVMA 1QSSA 2IM1A 2YNIA 4UUXA 5FJ4A 2YNGB 5BYQA 2IMWP 2PEHA 2J6SA 5AXNA 1UP1A 4JI3F 2WRMA 4TYBA 2RJZA 3FMWA 3W2WA 3CDBA 1REVA 5GADI 1GX6A 2DGSA 4UOCA 3MFHA 3F41A 3DN9A 2BYCA 1URNA 2XB2D 2EPIA 1Q82T 2X1FA 2QV6A 4PCQA 1LWCA 3QWPA 5FD1A 1RISA 2CJ9A 3BREA 2HNDA 2R2TA 3TVYA 3MZIA 3M32A 4TLQA 3IR5B 2GIQA 4CO4A 2BM0A 1U2RA 1X4AA 2HNDB 2FHOB 3O2IA 1TKXB 2FHMA 3B8HA 5EX0A 1SIWB 1IKYA 1VQ8S 5KG4A 3PW5A 1C1BB 4DQRA 3KNGA 3RR7A 1KTQA 4MFBA 3VAFA 2V8VA 2JHEA 4HI2A 3S7RA 1KQGB 3Q2TC 5KFHA 2MY8A 4DJBA 3PW7A 1O8BA 3M30B 2A1BA 2BOPA 1WF1A 1B64A 3ZC4A 3FNNA 1YHQS 2J5AA 5J1NA 3M4XA 4PPZA 5D8HB 3DC2A 4IKAA 2FTRA 4OX7A 1FCAA 4L6V3 2BRLA 2ZHOA 5K5MA 5IQQA 1SL1A 5CQGA 2GO8A 2IC3B 4CO0A 2LXIA 2DR9A 1KFDA 3OTBA 3RAXA 3GZ7A 3MECA 4A4JA 4NA1A 4ZKAA 1JB0C 3FRZA 3VAKA 1T3NA 2OIHA 1OQ3A 3QWUA 1RT3A 4X2BA 5KFOA 5A8RB 1QAJA 2UVUA 2BE2B 1ELOA 2B43A 4LT6A 2Q79A 5EDWA 3BSOA 3KLHB 3FZ2A 3WBZA 5I3PA 4X4PA 3H4BA 4DFPA 3TI0A 2HHWA 2NSCA 2CIMA 4M5DB 2YWHA 2MDAA 5M2PA 1VC5A 2B3TB 5DJBA 3OVAA 1FA0A 5AJ3F 1IBMF 2Q6CA 1S7HA 2HNZA 1IKWA 3EGNA 4DHVA 2VFRA 3CDEA 1NB7A 1REVB 2B6AA 3PEHA 3E3XA 5L8RC 5HMYA 2J8AA 4FVCA 4RU2A 1VRUB 4DV6F 4NYZA 1DZ5A 1JLBB 2YKQA 4AE5A 4HL9A 1RT4B 5L39A 3MUVP 1Q86T 2HHHF 4K5SA 2XMUA 1N5TA 4GC6A 2V8HA 2DITA 3JYTB 4YDDB 3IAS9 3SQGA 4JYAF 4TQSA 4OZ1A 3N01A 5F3TA 5L38A 5KAKA 3CVKA 4QJVA 2WB1D 2WW8A 1M1KT 1FVQA 2HRUA 4FNIA 4DUYF 5KFMA 4AQYF 5E3QA 3PW0A 3MUMP 1KLMA 2V4JA 4OJ3A 4Y28C 5D78A 3OSNA 5B0FA 5DM7Q 4M95A 4DUZF 1N5VA 2RDJA 2DNNA 1M5KC 3CC4S 3ISNC 2Q1LA 3JAMY 4RBTA 1FTRA 2NLWA 5D4PA 3HHLC 1NRKA 5HMWA 2E5LF 4OJ1A 1U6ZA 3OL7A 2XMWA 4XIUA 1ZBTA 3D54A 4UUWA 1H2VZ 4OLPA 4K4TA 1VK8A 2CRLA 5LJ5Y 5HL7Q 1FDNA 1S6QB 3MMCB 4CQ1A 2I9SA 1X5OA 2CQBA 3NWGA 4G6VB 2ZM6F 2FLNA 4MKYA 5KT6A 2E9RX 3LH2S 2V5HG 3HHLD 1X4BA 2DNOA 2RQ4A 1AFIA 4KKOA 2FJVA 4ECQA 4O4GB 1LXJA 2BACA 4DS5A 1M90T 3CC7S 3FVYA 4OHZA 3OL9A 3CJ3A 1SQEA 3UCUP 5DETA 1SH3A 1H98A 3LANA 3J80Y 1RT5A 3IGNA 3TVZA 5J1EB 1YIJS 5KFJA 4CNZA 4H4KC 2XI3A 1U1MA 1B0VA 2VKRA 2Z8QA 2B0GA 5CD4H 3DNCA 4J9LA 3RW7A 3OQ2A 1TZ0A 4OHVA 4DLGA 2Y1RI 1HPZB 2LU1A 4JI6F 2C3OA 5J2PA 3N6LA 2J0QD 2HHUA 2GCFA 2GO9A 2CYYA 4ALZA 2J9EA 4KO0A 4W92B 1SBRA 1HWLA 2OD4A 4A8KA 5HMZA 4PXEA 5KT4A 4F4YA 3RRHA 4OHXA 5DDQC 1JLGB 2EC0A 4OZJA 1UL3A 2FY1A 2RQCA 1XMOF 1S0OA 5E3RA 1N5SA 3DMJA 2QLWA 3OXLA 1VC6A 1N34F 1A7GE 1XEZA 3OR1B 2N4CA 3I0RB 3PR5B 5U47A 2E5IA 1R31A 1YQHA 2DPIA 4R5PB 4FBUA 1S6PB 1DJ0A 4PXBA 3E01A 1HBUB 4NA3A 1KEKA 1D9AA 1OS5A 1U47A 4WYWA 3FEYB 3UE2A 3ZZOA 3OUYB 1WNEA 4ZP6A 5A8KA 3TX8A 3E01B 2RS2A 1AFJA 3NCQA 3LP1B 2XMJA 4N8OA 2CPDA 4DQIA 1QUVA 2DD8S 3PKYA 1MMNA 1S1VB 1FK9A 5A8KB 3CE8A 2MKSA 4RW6B 2VPYB 2QMXA 1FDDA 4TLRA 4NZ6A 3G4SS 1N6QA 1RTJB 3I0SA 3GE9A 2DH8A 5DDRC 2FVSA 1CVJA 1S1VA 3PJXA 3N4WA 2D7SA 3DHXA 4IRDA 1T3OA 4NYOA 1J2VA 2P9GA 1S6QA 4CI0B 3PY8A 4B3SF 1T02A 2E5HA 2LQ5A 4DR2F 2V9WA 1TR0A 2GQQA 2VQFF 5LXRA 5KFSA 1HQUA 2VUGA 2IMOA 3QAEA 4LFCF 4Y2CA 3R1LA 3KLIB 5B0GA 4E0DA 2DB1A 5B0EA 1B7FA 3DFEA 2YNFB 4PXDA 3AJ1A 4YB6A 3E51A 1Q1KA 3EYZA 5EWFA 3BQ2A 4JV2A 4ERDA 3LW5C 4LQ3A 2QA1A 3TANA 2MJNA