4RR5A

The crystal structure of synechocystis sp. pcc 6803 malonyl-coa: acp transacylase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
293
Chain Sequence
MKTAWVFPGQGSQAVGMGVDLLSTAIAKEKYQQAEEILGWSVVEKCQGDEASLALTQNTQPCLYVIEAILADLLRDKGFQPDYVAGHSLGEYSALYAAGVFDFATGLQLVKQRSEVMASASGGMMAALMKFDQTQLQQALTDNTEVVLANDNSPEQVVISGTVAGVEAILANVKARRAVPLKVSGAFHSSFMAQPSQSFAQTLTACHFNDATVPVLSNVDPSPTQNGDRLKEKLIQQMTGSVRWRETMVNLGEIGATDYWEVGPGKVLTGLCKRTCPDLNLKNIGQLDDLNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of MCAT from photosynthetic microorganism Synechocystis sp. PCC 6803 reveal its stepwise catalytic mechanism
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Transferase
molecule keywords Malonyl CoA-acyl carrier protein transacylase
total genus 110
structure length 293
sequence length 293
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 4rr5A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 4rr5A01
2H1YA 3G87A 3RGIA 5DZ6A 3TZWA 2QO3A 5CZCA 3R97A 2CUYA 2QC3A 2JFDA 3IM9A 3R8YA 2QJ3A 3PTWA 3H0PA 3IM8A 1NM2A 2G2ZA 3HJVA 3K89A 2VZ9A 4RR5A 5CZDA 3BV8A 2G2YA 4RL1A 2PFFB 2JFKA 3SBMA 4QBUA 5DZ7A 3HHDA 2UV8G 2VKZG 3TZXA 3EZOA 3TZYA 2HG4A 2VZ8A 2C2NA 3TZZA 3CJ8A 3QATA 2G2OA 2G1HA 3TQEA 1MLAA 3HMJG
chains in the Genus database with same CATH superfamily
1UVLA 2QMXA 3ENAA 2GQQA 4NL5A 4YS2A 1X5SA 1PJ5A 4UOCA 5H9FJ 3ENQA 1S9EB 1M5HA 2JSXA 3N5BA 3PEJA 4IOAQ 2XSJB 2ZBRA 1DHMA 1SC3B 2DBBA 2IRXA 3DC2A 2WZ1A 1RWWB 1TUVA 2NUHA 5A6WA 3QJJA 4CT8A 1N56A 1AB8A 2QLBB 3VALA 1AW0A 2VZ9A 4M5NA 1P9YA 4RR5A 5ITHA 3UWTA 4ZPCA 1R8AA 3EX7B 4KR0B 4LQ3A 3JSMA 4AL7A 1Q8KA 1S1XB 1FA0A 4P52A 2I0XA 1HNVA 2XZWA 4EYHB 1Y00A 2KZZA 1SV5A 1N0VC 1FI4A 5LSLA 2B4VA 4A46A 5DQHA 3KG4A 2BVZA 2RAQA 4CH7A 3SSQA 3ZTPA 2RRNA 5J1NA 2MKCA 1Z2LA 3CJ8A 2Q1LA 4KIAA 2MZTA 3H25A 2CJKA 3KTQA 3C14A 1JXEA 2DHGA 4O4GA 3FQKA 3ZZZA 3NMRA 1RCXB 1BQMA 1FX4A 3BQ0A 3AT1B 2VG7A 4DV3J 1VQPS 1RT5A 4H4OB 5CZCA 3UCGA 1IBLJ 1XBWA 4EI2A 4BDPA 3BZQA 4LF7F 4JI2J 4LMZA 2E5JA 2DGSA 4A47A 1QDUB 4OZ5A 1MN7A 7FD1A 2AGOA 2FJWA 5EHHA 3J81Y 2PMZD 2JX2A 3X1LB 3MM8A 4B9MA 1HARA 2WVEA 1TTHB 4Q0BA 4HHUA 4GVBA 2E1CA 2YWKA 3DLGA 2E9TA 2ZH9A 3J7AN 1EB0A 2WSEC 4UUWA 2V63A 1GMWD 5CHCB 4YHHJ 1WOSA 2IDLA 1ZOTA 2MKSA 2GO9A 2ZHBA 4F02A 2DY9A 3NGSA 3QLHB 3KMQA 1RT2B 3CCZA 1MROA 2OPSB 1PKUA 3B54A 3CO0P 4OX9F 5FD1A 2IRYA 4CO5A 1KSPA 4V19J 3JB9k 1JLCB 1VBYA 2IA0A 5D6GA 2BABA 1RHMB 2L08A 2R2SA 2V9WA 1NSAA 1XN9A 3BYRA 3D9BA 2RILA 2SXLA 4IO9Q 2JDJA 3LGMA 3FBFA 4I64A 2KJVA 2WOMA 3FZ2A 2WSCC 5IFMA 4LF4F 4UZCA 4RU9A 4KGZB 4FYYB 5LMUJ 3CSKA 2HG4A 4NCGB 2CDRB 2FJDB 5IWAF 4K4XA 1DBDA 3H7HB 3V6KA 3A3NB 5C42B 4OYZA 4B3OB 3H5YA 5K20B 1EETA 1E6YA 1HA1A 1WSRA 3C15B 4MTPA 4ZMMA 3T1YJ 4JI7F 1S76D 4WKRA 4WJBA 2YNFA 3MM5B 4U7CA 3DRYA 2HQDA 2AJ4A 1YJVA 2LXUA 2Q6CA 1G6BA 2YWEA 1VHIA 3MCOA 5GMDA 1FXRA 1SV5B 1KRPA 4LQ9A 2JEJA 3I32A 2QGFB 3M9NB 2XY5A 5KG0A 3HVTA 9ATCB 3R7SB 1LQ9A 1CC8A 1XK8A 1Y5LB 3D5MA 3VGUA 4B3TJ 2GO8A 2GGPA 4DG1B 5CQGA 5H1SV 3FDSA 2UXBF 4DV2F 3NGUA 1HHSA 4YB1P 1IBLF 4LF7J 2RMLA 2EPIA 3W65A 3M8RA 5K14B 3GIIA 4L74A 3H5XA 3SDEA 4ZP8A 2B5JA 3PKMA 4IFYB 4URGA 3ZTRA 2A2DA 4DR1J 1YI2S 4U67Q 1OIAA 3GMGA 3DLBA 4QR1A 2QO3A 2IMWP 2OJ3A 1KNZA 4HH1A 4PWDA 1FXLA 4RWXA 2LA6A 4QWDA 1X5PA 3H5UA 1NKEA 1BWEA 2NLWA 3D0HE 4F3MA 1IWAA 4J9UE 1DURA 5EGYA 3IXQA 4ALZA 4DDFA 3MI7X 4EBDA 1CULA 1FE4A 2XMWA 1TELA 3LGHA 4UTGA 4ZCLA 3D6HB 1JJ4A 2FY8A 4OLPA 5D15A 3RUBL 3SIPB 4DQQA 1LW2B 3F44A 2AX1A 3V81B 1XTZA 2GVDA 4HKQA 2QIFA 2OTJS 1KD1T 2HZCA 4I2QB 2GMLA 2WW8A 1IQZA 3O8WA 3MURP 3D3CJ 2F63A 1AUDA 4DUZF 4DR4J 2VZ8A 4AQYJ 2IA6A 1WHXA 2QSFA 2IDEA 3MUVP 1M5KC 2GX8A 2ZOMA 2W4PA 1RT1B 2ZBCA 3R1HA 4L76A 2HK2A 3BN4A 2A1BA 2F40A 1QUPA 3OXLA 4IH5A 2AZ3A 4C7QA 3BSNA 2V69A 4KSEB 4XDDA 2QYCA 1WG1A 2N3OA 4ECYA 1KOHA 2RQMA 3W8GA 5M2PA 4DUZJ 4DR4F 3W5YA 4N56A 4DR6J 5AXNA 3FSIA 3PDNA 2KG1A 2FLPA 2XNQA 3H8YA 1HBMA 4Y2AA 4WP3A 4UOGA 5THWA 5IXUA 1FJGJ 5A6PA 4C9DA 1NHVA 2BW2A 1F5AA 1U1NA 1LWFA 3EM1A 4ETXA 4ZCIA 1NJYA 5IZHA 4RW8A 2D3ZA 4WPAA 1YX2A 2GJIA 4OJ3A 4USJC 5DGAA 4MMOA 1RQ0A 5ETTA 1T9YA 3K59A 5CA5A 2DRDA 1YZ7A 2GHWA 2W7AA 1QAJA 2DNMA 2G9OA 4PABA 2HMIA 1U1MA 1C1BA 1PYSB 2WVBA 5HBMA 3Q8SB 5D3GA 3UD3P 2BR0A 2PI4A 5L46A 3UD4P 2V2ZA 3NGKA 2A6OA 2KTQA 3ZZ0A 1NZ8A 2P2CB 4FBUA 1WWHA 3MTKA 2DPJA 3TVZA 3VWSA 5KT7A 3T1HF 2BMBA 1H6KX 2JRSA 4QIEA 5D4LA 4I7FA 1FD2A 5AT1B 4JI8F 1N34J 2CNOB 4B9VA 5CCMA 1PYOB 3HHDA 3S7RA 5KFHA 4NA2A 4RNNA 1TR0A 2KI2A 4JI2F 3RYLA 2HW3A 2C2KB 2HGNA 1X7VA 2OPRA 3ILOA 3PCOB 4CQ1A 1NK6A 3HHNB 2J9CA 1NK4A 4HYKA 1FKAF 1C4CA 4UQTA 1ACMB 2A2CA 2OUGA 3AAWB 2H4YB 4C6AA 3HPOA 3OW2R 2I2YA 1CULB 4FKXA 1WEXA 1UJ4A 4DF8A 1N34F 1BE4A 2N3LA 4YB7A 3OTOJ 5EN1A 4KGVB 2H65B 2VC1A 2ZKTA 3QGIA 2ZH7A 2PC6A 4NCBA 2C3YA 1FRMA 2NXCA 3GQCA 2X1AA 3DLEB 3TAMA 5F8IA 1OQ6A 1WTBA 3Q83A 4MFBA 2EBEA 2GHPA 1B7YB 3MM6A 3N01A 4F0HA 3QWUA 4X62J 1R0CB 2EEYA 2I5JB 3DHXA 3HHLA 3LANA 4WYWA 3CXCR 5J2PA 1RWVB 1ZTWA 4X66F 1X9MA 3R5BA 3PX0A 4ZP9A 5AXMA 4R5PA 1VRQC 4PCQA 2GIQA 1IKVB 3LPEA 3AFGA 1C0TA 1SJ1A 2E1PA 4OZJA 1X4DA 5K5MA 3W60A 4LF8F 5HQMA 1LW0B 5E2QA 1XNQF 4B9UA 4RBVA 5ETLA 2C2MB 1APSA 3RW6A 2RDIA 2RF2B 2NREA 1X5OA 1FJGF 3UO0A 5A8RB 4F50A 3OFEA 3RG6A 3WC0A 4K2XA 4YUDA 4Q7AA 3NBPA 3D3BJ 4U8VA 5D0EA 3HFVA 1SL0A 4K5SA 1RJJA 3MM5A 9RUBA 2XZTB 2E5LJ 4JI6J 1FRHA 2CZ9A 2VFUA 3PNIA 4I6AA 2O3DA 3GCWP 1QSLA 1KFSA 1EETB 3V6DA 4TU8A 2ALYB 1RAGB 2H4WB 4WFBQ 5IT0A 1NO8A 1K47A 3PYEA 4JI5J 4U7UD 2IC3A 2PN6A 5BYRA 2GC8A 3R27A 1OPIA 5B0GA 4DSFA 5DM7Q 4O3PA 3I0SB 4KRWA 1D9FA 2HHSA 1N4LA 2QFIA 4Z7CA 2HHHJ 4ICLA 3UCZP 2M3DA 4J9RA 2NYIA 2MZ1A 4HDGA 3IR6B 1RI7A 1CVJA 2LU1A 4DSKA 1QM9A 2UUWA 2RB7A 2RHSB 1HQ2A 2BANB 1DLOB 4GVLA 3G4SS 3TA1A 2IC3B 3MTJA 3CGIA 3MMBB 3UDLA 4X4QA 4KFBB 5CYQA 3IGNA 3BKFA 2BJDA 3OPKA 3IMQJ 4TLRA 1U6FA 3BKUA 1R6VA 2QLWA 3GSIA 4O0NA 5C2CA 1XQIA 3CT9A 4A4JA 4I2PA 4RZRA 2ZH4A 2HQCA 3U1LA 4DL6A 2OLWA 1I6JA 2OPSA 4YB6A 2LEBA 6AT1B 2C22A 4ZHRA 2MQQA 3C8YA 4HL9A 3PKYA 1Q8LA 2DEIA 3TR5A 2XMMA 4ES3A 2DNRA 3IN5A 3D68A 2AP6A 1Q5YA 3AJDA 3NGTA 2GHVC 4AMOA 1S4FA 1KR4A 1NDPA 3QIDA 3LP2A 3HSZA 3M8QB 5DJBA 4F2RA 3CWJA 4B3SF 4LRAA 3BEGB 3FC9A 1R0AA 1RT4A 3TZZA 1IKVA 1HR0F 3HK2A 3NOGA 1JB0C 2FHOB 3IRXB 3UNYA 3KJVA 3C16B 2N7YA 2VPZB 4UW2A 4NXMJ 1NJWA 3TUPA 1H72C 1S9EA 4RO0A 3TW0A 4F25A 5LT5A 2D9OA 1TU0B 3VHQA 3TUZC 2U2FA 1HQEB 3PJ9A 4P2XA 2I5JA 3TP2A 5HLFA 1YHQS 2B0GA 1GNKA 5CD4A 5AJ3F 4C3MA 1S0OA 3L3CA 1DQAA 1KFDA 1WG5A 4IG0B 5D78A 3AOAA 3KG1A 3G8TA 3C6TA 4WFAQ 4RW9B 1BQMB 1CBKA 1KTVA 5EWEA 2DHHA 2X7IA 3HSGA 4MK8A 3W9JA 4QWBA 1IQTA 2YKMA 1L3UA 1JX4A 5KFXA 2O5DA 1V5VA 4KO0A 1S6PA 2C1EB 2N4CA 3THTA 1HNVB 2KT5A 4B3MJ 2XY7A 1BMQB 2WRMA 2YNGA 2AD9A 2MQ8A 3JSMB 4KFBA 5KOXA 4JI4J 2W8LA 4NX9A 2F5GA 2L41A 4H54A 4K50A 1NU4A 1Y11A 2CG4A 5D77A 5F8GA 3AY0A 5DQIA 1Q78A 4Y3CA 2D69A 1HLWA 4MKBA 1UETA 1MMNA 4TKTA 2H51B 2YTCA 2FJAB 3MUTP 3A8IA 1RWMB 1RWKB 1UW9A 4DPUA 4IG3B 4HHJA 2QX0A 2V94A 2ZHOA 3C16A 5KFGA 4C8KA 2CPFA 4CDIA 2ERRA 3J81U 4OHZA 2V8HA 4CYUB 3PZPA 1K73T 1R8CA 4M5LA 1VLOA 1C1BB 1PJ6A 1SJRA 3V6DB 3KKFA 1Y4ZB 2DT9A 3MMJA 3J80Y 4DPOA 2B4OA 4DR3F 2OEKA 3OL8A 2J8AA 2CNKB 2CNLB 1URRA 2FZGB 4LF1A 4C3KA 4A48A 1X4GA 4OJHA 5HO4A 1LXNA 1IR0A 4TY9A 7FDRA 4YR0A 2C28A 5DG7A 1V5IB 4Y28C 3WDOA 1WI8A 2AJFE 1LW0A 2LEAA 1RDRA 2R3VA 2IAJB 3QMQA 3WX4A 1S7HA 4Q5VA 4J9QA 1RWUA 2DHAA 4DL2A 1J2VA 2HK3A 3K2YA 5CYQB 2XMVA 1FRIA 3EGWB 3FGVA 4RJVA 1NEEA 3THPA 4DCJB 5G0RB 2BM1A 3EZ5A 2M52A 3Q89A 4R5PB 4AMNA 4CTAB 4DMZA 2J0QD 1N5VA 5J2PB 3NGDA 4P75A 1HL6A 4M5DA 4ZOSA 4P72A 3GJRB 4ZP7A 4P7VA 1Y9OA 2AJQA 5KG4A 3G2XA 3HHKA 5C24A 3HSDA 4RUCA 2IM0A 2DXDA 4J37A 2DNYA 3CJ2A 2QYGA 3H4DA 1JIHA 1S9GB 4C8ZA 2HS4A 2M88A 4OI3A 1IKYB 3RBXA 5L1IA 3KNGA 4OYPA 1ZAXA 3SCJE 1UWBB 2DGXA 3MHYA 2DEJA 2DGQA 2HVEA 3MFIA 2RU9A 1UZDA 4Q2LA 3BBBA 1ZTTA 3M8WA 4O3OA 4KGMA 4ETZA 2MPUA 1F9EB 1SQFA 4ZVUB 5HP1A 1T7PA 2G0JA 1YJUA 4E0DA 1Q7LB 2OPRB 4QIWD 4PXDA 2RF2A 4C8LA 4MKYA 4O44A 5F3ZA 4QYZK 5A8KB 3DOKB 2J9EA 4I4BA 2ASYA 3QRPA 1F3VA 2XYGB 2POKA 3OXGA 4LF6J 3UFCX 3VGVA 2DH7A 3IAS9 1S0VA 3L09A 2HQ3A 2J9DE 4KYZA 4F4AA 3OJSA 1VQKS 1F2GA 1KVIA 4JI5F 1RBLA 2HBQB 2HNZB 2L9NA 1GMVA 2M8HA 5IQ6A 4OX7A 4NLGA 3OTBA 3OSPA 3BO4A 1SC4B 4UF4A 4O23A 1PC4A 3W66A 4DR6F 3FZBA 4NLSA 2E5LF 5GADI 2FY1A 3BGRB 4WFZA 3IBFB 3CCSS 3DLLQ 1ZH5A 3IR7B 4L3KA 4WK1A 1VDHA 3MEDA 4DG1A 4IQMA 3UPFA 1RLCL 2MQPA 1B0VA 1RBOB 3O5TB 4NE9C 4A8MP 3AHPA 1SJ3P 2Y9HA 3BBFA 4NLPA 5A8KA 4O44B 2HFVA 1WDTA 2HWIA 1S6QB 1WEYA 4USKA 2MSTA 5L9NA 1RAIB 5FDLB 5I3UB 1AZSB 2BACA 1WSVA 4DQPA 3JQKA 3VAFA 5L9XA 2Z30B 5IS2A 1U6ZA 4RL1A 2LFVA 3DMJB 1RTDB 3JS9A 2F8MA 2DNZA 3IG1B 5B0CA 5BYSA 3QAUA 1ROFA 5LMNF 2B4UA 1FESA 1OQ3A 4A8YA 2MZQA 3KJQB 4HH0A 1KQSR 2OELA 3EDRB 4QIGA 4WTOB 3OVAA 4ZPAA 1GT8A 1FKPA 2JEFA 2YH1A 4EZ9A 1NPRA 2AHOB 2CKWA 2CIMA 4LSZB 4BWMA 4DPTA 2VFRA 2IBOA 3SQGB 2VKRA 4KY3A 2UXCJ 2WVFA 3OUYA 4EO8A 3BSAA 5G0RA 3QT5A 4P71A 2QC3A 4PXCA 3M1VA 3Q2TC 2NQPA 4YDXA 4X65F 3CVKA 2RVJA 4I2QA 1QVFR 4ZVPB 1F2HA 3D66A 5FJ4A 2WAQD 1RHUB 4IH7A 3E2EA 3HFKA 4CWBA 2CJXB 1MROB 3ZTOA 4B3TF 2R7XA 5E0OA 1S48A 4RW8B 4N47A 4BCAA 1HWIA 5C25A 2DR6A 1Z2ZA 1ZA1B 2QA1A 3DXBA 3BH6B 3QIPB 3PIOQ 2E5IA 2UV8G 2MKIA 4Y2CA 3M8PB 5BXIA 5KFLA 2QLXA 2UUCJ 4J90A 3KUEA 1ZM4A 3WZ0A 2LP4A 4DZDA 4ED3A 3CDAA 4A8SA 3OUYB 4ZIWA 3O44A 3SV3A 1SL1A 1HNXJ 3GIMA 3BYPA 4LRBA 1V3SA 4EWTA 2OI2A 4NZ6A 3B8HA 1VGYA 1ZA2B 2VQFF 1U6BA 2UXBJ 1TAUA 4XAKA 4OJ1A 1RT3A 4C0BA 2XULA 3C19A 3EXCX 4FYXB 5GMKa 1TL7A 4Q44A 1TVRA 3O1LA 5T41A 2LVWA 2VOOA 4N77A 2CPHA 2EKYA 5KG5A 4O4RA 2VPXB 1QSYA 5LJ3Y 3VF0B 2VQFJ 5AE3A 4ECUA 2VF3A 4DFKA 4N8NA 2GVDB 1CEZA 2KDOA 3TVKA 2OMLA 2O1PA 3PHTA 4K5RA 2B8QA 4ZVQB 4JV0A 3NNHA 2NXNA 1JNRB 1S6QA 3NL0A 1HMVB 3NWGA 2LECA 1GMUA 4Q8EA 2C2DA 5FLXU 3QPIA 4C3LA 4WXOA 1UFLA 2MQNA 3FJ2A 3MEDB 2DIUA 3N9UC 1IR1A 1SJFA 4ZS6A 1CG2A 3POTA 3HKZD 3MMCA 3EYZA 2OGUA 2ZNYA 1IVZA 2KFZA 1R27B 4C98A 1JJ2R 3KUGA 1KBRA 1C2PA 3PRBA 2WOMB 3DRPA 3CULA 2HNZA 3SSSA 3FVYA 1T03B 4Y34A 2GJFA 4JB8B 1PYTA 3PY8A 4FKYA 3IP0A 3TAQA 2XI3A 1VMBA 2JC0A 5DDPC 2NXEA 2FHMA 3PIPQ 1VQLS 3KK3A 2UXCF 2EFOA 2PEHA 1IBCB 4JI3F 1JLCA 4NRUA 7AT1B 4X4SA 1YTYA 5KFAA 5J2MA 4KB7A 4ED4A 2I9SA 2G1DA 3VR1A 1K1QA 2F1FA 2UUCF 4R0JA 4NXNJ 4L6V3 1B0TA 4ILRA 2AEMA 2W2PP 1RZMA 3MPWA 1PG5B 5LXRA 3BQ1A 3CCRS 4NI2A 1SKUB 2DHSA 4Y0FA 4GKJJ 1HFEL 3DGPA 3N6NA 3PG9A 1UFKA 3H2LA 2HAIA 2PIIA 5I42B 3H0PA 3NAIA 5C42A 2VFVA 1VQOS 4G1QB 3ULHA 1DY3A 2IVFB 3GJSB 1RKIA 1DQ9A 2GFFA 4K4SA 2G0CA 3CDWA 4C11B 3BO2A 4JV5J 1I1GA 2MXYA 1FTRA 4PG7A 2FHJA 4ZITA 1NHKL 3OHBA 1IKXB 1HD1A 5M2UA 3K5LA 4LT6A 1HBOA 4IDKB 4PG4A 3BO3A 3EZOA 3KLEA 1FJ7A 2B51A 2K2PA 1XC9A 3WC2A 2X1BA 1L5UA 5D4NA 1UVJA 3LUYA 2HVIA 3HJFA 3W2VB 1FX2A 2DHXA 4QYZJ 2WSFC 3CDUA 4DSJA 5IT4A 1NJZA 4OHYA 5I3QA 4NI2B 1NZAA 3G87A 1H98A 2CRLA 3I4PA 2HFOA 3DKDA 1RT2A 4CLSA 2FZCB 2BXJA 4QIVA 4GRSA 3G6ES 1OJ4A 2NZCA 4I56A 1NM2A 2B9YA 2OAUA 3KDOA 5KFPA 3KJFB 4NEZA 3JYTB 4FXDA 5CZDA 4PKDB 1DQ8A 2ZC4A 3CJRA 3FBBA 2HRTA 4M5MA 5B7WA 4X4TA 4F4WA 2D7SA 3TAPA 2YWFA 3EWGA 3HX9A 4CCHA 1FD8A 2COLA 2XLIA 2W2NP 4K4TA 3D1OA 2HZVA 2MMYA 2QFJA 5KG1A 4ED1A 3JTOA 1JJCB 2UP1A 3F0NA 2EVZA 4JP8A 1WC1A 2AGQA 3VCDA 3GILA 1KVJA 1NAQA 2ZOGA 5KFIA 2RS8A 4QWCA 3CTRA 2YKPA 5KT2A 4ILMA 1ZM9A 2K1RB 3DYAB 1ZM3A 3D6FB 4OMFG 1FFSB 1RKJA 2XZDB 1T9UA 1HPZB 2OTLS 5HK4A 1G1XA 5A76A 1HBUB 4YOEA 2HS3A 1REVB 1SI9A 1IJFB 1Z4UA 2NCKL 3WIUA 3UDEA 5LSOA 1S12A 3SI8A 2BQUA 4GKKJ 3R5DA 2EXUA 2P6TA 2CJBA 1RWXB 1SH0A 1WI6A 1GH8A 2RHQB 1LOUA 3MECB 4LF9F 1YVFA 2DNNA 5I4MA 1N6QB 3GONA 2HURA 4LBPA 5BR8F 3UDCA 3D2WA 3EPGA 3R5AA 2YX1A 3ZNJ1 4ZVGA 2G1HA 4I0WA 4NXMF 1N54B 4USTA 3UD5A 4B9SA 1GK8A 5MLCV 2M5YA 2RH3A 1ZPVA 1VQ7S 4NYOA 4P7TA 1SJQA 4LF9J 2P5VA 3HHLC 2V34A 2B9XA 4R25A 2OSRA 3DXSX 3AD9C 4JYAJ 2ALZA 4F3QA 1PJ7A 2OPQA 3LP2B 2WB4A 3M8QA 1WNEA 3NMAA 1LWCB 1SQGA 1YQHA 2QT7A 3P3DA 2RIJA 3OXFA 4ZN3A 2YKAA 2XWXA 4CP5A 4DV4F 1R8PA 1D9DA 1UEVA 4HVZA 2AYGA 1X4EA 2DNGA 2N7CA 1JK9B 5C25B 1VQMS 3BH7B 2ZBPA 1CJTA 4FVMA 3PHEA 3U27A 2OP5A 1IN0A 5T14A 4JYAF 3G71S 5CAAA 3RB6A 4LF8J 1T9XA 1NDKA 1KKHA 2V8PA 4ELVA 4LRDA 3D1HA 4AYBD 4NCAA 4AMMA 2WHOA 3LAMA 5EUHA 4MIWA 4ZVEA 1RAAB 2BANA 1T3NA 3PR5B 2G13A 1WC3A 1S5ZA 4L73A 5CZVA 2CQCA 5L38A 3EDQB 3EGVA 4ZKAA 2KXNB 3NNAA 2GVZB 3PVXA 3PYGA 3NKYA 4F04B 2G2ZA 3K89A 4WE1A 4CT9A 5HVHA 1CS4B 1JLFA 1KQGB 4YR2A 1S72S 2R7RA 4BS2A 4USMA 2ROPA 1BD6A 4RW7B 3SCLE 1NRKA 5HVFA 2XCAA 4K4WA 4X4UA 2W7PA 2JFKA 2PFFB 2YKNA 5DG8A 2LDIA 4DOZA 1H2UX 1H3DA 1HHQA 1T02A 3PRDA 2WTFA 3QRQA 3RBDA 3CCWA 2EK1A 1CPZA 1EP4A 2V50A 1P9QC 2XMJA 2OD4A 3NBPB 2M2BA 3MEGA 3V81A 2UUBF 1HNIB 3WIVA 1XNQJ 3HFZB 1IKWA 3MOJB 1NPPA 2MZSA 2CYYA 3W7BA 1YK9A 2FGOA 3UVJA 4EK2A 1MNEA 3TZWA 1FRLA 2KHDA 3GP9A 3PYDA 5AE1A 2VA2A 2CZ4A 2BZ2A 1X4CA 3E3XA 5G4DA 3NS7B 3EGZA 5D8HB 3TNVA 2XEXA 4XDCA 5CH7B 3W2WA 1JNZB 1H2TZ 2MLYA 3SQGA 1GTEA 1PBAA 2B5JB 3DOMA 4M1KA 5KFCA 1X9WA 2O66A 2LXFA 1PC5A 1R8BA 4FF1A 4DQRA 1T9TA 1UVIA 3ZTSA 2HPUA 3MWBA 3C66A 3QFWA 4FF4A 3DMJA 2CADA 3L7OA 4TXSA 5F8HA 2ZM6F 2FIUA 2XS7A 4W90B 4QCLA 3GCXP 3M6WA 2DR8A 3IAM9 1RACB 3C6UB 4URQU 5I3UA 1Q81T 3M9OB 1RYSA 3I0RA 1UPPA 4MIAA 5HANA 4OYXA 3MAAA 4WTYA 3IRWP 4KKOA 1KLMB 1RHRB 3K17A 3D6TB 4HI1A 4M5KA 4NLDA 4DFPA 1FWLA 1TKXA 1RADB 3GFYA 2KT3A 4PYDA 3S1TA 3TEHB 2Y0BB 4OI6A 2ADCA 5HQLA 1T8EA 1CLFA 1MG7A 1AUSL 1H73A 1XR5A 3MPVA 1G4CA 2ZD1B 2RKIA 4NCGA 2R2TA 1RBAA 2C2RA 3H5SA 3WBZA 1RWOB 1Y5NB 2Y8WA 1XWLA 5IC4B 3OFGA 1KVKA 4WBFA 5L1LA 3PXGa 5B0AA 3SZ2A 2HAFA 2Y1IA 1NK8A 4A8FA 3HO1A 4HR2A 4DPYA 1BC6A 2YX7A 3EJMA 1F5CA 3L95X 4EZ6A 2J5AA 4P6QA 2D1CA 2GMHA 3BR8A 2KRRA 1Y3KA 4WK3A 1RCOB 2VB6A 3FRZA 6FDRA 4KTQA 3FSXA 3PTWA 1MMLA 3W5XA 2FVSA 1S79A 1O6XA 1SQEA 1WJ9A 2V8VA 3HVWA 3CJQA 2CWXA 5CABA 1SL2A 1QLNA 1W7WA 3QLHA 3ENVA 5HP1B 1U2FA 3CIMA 1UJ6A 2W9BB 2R8HA 3AB4B 3JAMU 4ZK7M 2F7VA 4OYIA 1VJWA 4QZVB 1QE1B 1SCJB 3QFHA 2HGLA 3QO9B 4NLYA 4RNMA 3H40A 1UWBA 2OH2A 1C4AA 2YKNB 2ZH6A 1M5PC 3DLKA 1IXKA 1S49A 1EAYC 1HD0A 1VRUB 2ZDPA 1BQNB 2BE9B 2C2NA 2ZJRQ 2FVCA 1QVGR 2KT2A 2QEXS 1HI0P 1GX5A 2UXDF 1UCNA 3Q24A 3L9ZA 1M5SA 2ZVIA 3DM2A 4DWIA 3H2VE 4M5DB 4KJIA 1N8RT 4YQWA 1OYDA 1F0XA 2IFXA 1RSCA 4NYZA 2O67A 3BJYA 1IBKF 3J7A1 3M2RB 3R8YA 1RAEB 2QJ3A 4PQUB 4ZPDA 2B8PA 3K5MA 4H4OA 4J9SA 4KV8A 4FYWB 1ZPWX 5HN0A 2XO6A 3LA0A 2J6TA 2UUAF 2ZDOA 2W4CA 4YP3A 1U8SA 2XYPB 4DV1J 2C2EA 5CYMA 3EVWA 3HVAA 3OD2A 5KG6A 3KMSA 4CLFA 3Q86A 4J9KA 1OPZA 1UAWA 2C3MA 4NLRA 3MR3A 2PEBA 1MU2A 2XM3A 1F1BB 1FVSA 2IYIA 1HYSA 3OV7A 4FS2A 2E9RX 1PSDA 2W4DA 2LEPA 2KL8A 1VQ4S 1SH3A 3JTPA 2YNIA 5E33A 3KLHA 2LCWA 1RA6A 4LVOP 1S57A 4OI1A 1IM4A 1OS5A 1Y10A 4V19X 1G2EA 2E29A 2HGMA 2GS8A 5A0YA 4EGLA 2YKOA 2D9PA 4WFXA 2CG8A 3VGSA 4QOTA 3MR6A 4E98A 2ABYA 3DI6A 3I31A 5HQ8A 3TI0A 4QU7A 2C42A 2QA4S 3MMAB 1XMQJ 1S0NA 4OV6A 3KLGA 2JJ4D 2O01C 4V1Ak 1TL1B 2HHQA 1Y7PA 1HWUA 5I3PA 1RT4B 5E5NA 5J2QA 5KFEA 2GGPB 5H9FK 2XHWA 3RB4A 4LF2A 3AOBA 3DRRB 4UT4A 2KFYA 2HKEA 2VG6B 5DRKA 5KFZA 1TKDA 3KWMA 1YRXA 2AIRB 1MWZA 4BBYA 3J80U 5KG7A 2GQCA 4FF3A 1XMOF 3ZZUA 1X8DA 2H3EB 3A1YG 2EW9A 1HYSB 4B3MF 4H4MB 5ETVA 3ET6A 3CCMS 1L3TA 3IFEA 5HI7A 4RLEA 3TQEA 1N0UA 3I56S 1J5OA 1I3OB 2OEJA 2Y1RI 4IR1A 1K0TA 3GE9A 1PAEX 4LR7A 2BX6A 4Q2MA 5JVHQ 3BF4A 2Z8QA 1RB0A 3UN2A 3BBCA 4F8RA 2BKNA 4RW4B 4RW6A 3QJLA 1HQEA 1JJHA 2BJ8A 3CJ3A 4UZBA 3FMWA 4ECZA 2BJ9A 3CJ5A 3FCVA 3Q2SC 2BE2B 5ETRA 2D3OR 4JV1A 1FJCA 3BR9A 2DRBA 3ZNUA 3DRSB 4TY8A 2EBGA 1WKLA 2AT1B 4QWEA 1VRUA 3OLBA 4LFCJ 4I1TA 1FK9A 2LU2A 4YN3B 4R0EA 2DJWA 3NG8A 4ZPBA 1HNZF 4PUOB 2DGUA 3L4BC 2K3KA 1ZETA 4DX7A 2Z56B 3VAKA 4C8OA 3PO4A 4ECTA 3GSDA 2VBZA 4USHA 4XTTA 3T1HJ 3HF5A 4F67A 3LTOA 1QD1A 4I67A 4M5JA 3M30B 3MD3A 4O0IA 2B9WA 1HQUB 2BKOA 3CJ0A 1DFDA 1YDLA 4QR2A 5A8WA 3UR0A 3W9HA 4C0HA 4PUOA 3IA0A 1H38A 2H54B 2HFUA 2FB0A 1C0TB 1HIYA 2HVDA 1QJHA 3D6MB 3CCUS 1NDLA 2R7OA 4J9MA 2DR5A 2Q3PA 4WU2A 2JWNA 4NPOA 1CJUB 2BOPA 2MY8A 2HLUA 5J1EB 2Y1LB 2KVQE 3N0VA 5CD4H 5KFRA 2F4VJ 4RW4A 4A8OA 1UPMB 3T6JA 3FK4A 2GIRA 2K06A 3P96A 4GC7A 1FO1A 2MYFA 4KHMA 4DX8H 1XNRF 1FT8A 2QN6B 2HNDB 3ISNC 3JSYA 3NAHA 3DNCA 1VK8A 3DLEA 3DDIA 2JEGA 5JXSA 4DR1F 1U1PA 2IIHA 3AD8C 4DV4J 1M0SA 1LWXA 5KFFA 1YJTA 3DGPB 3OL9A 3KHRA 5LL6d 5E7OB 1B0PA 3GR1A 3MAAB 4TQSA 5B08A 1KEKA 1AA1B 1UP1A 1LFPA 3GU0A 4OZ2A 2AZ1A 1XMOJ 4ZJQA 4M8LA 2MSSA 5CCLA 1NH8A 2CPJA 1M1KT 3KLFB 2AQ4A 4ZCKA 4KE5A 1S1XA 4DU7A 1U0HA 3Q23A 2EWHA 2CFXA 2YY3A 2FVRA 2YPYA 3EICA 2PA3A 3DRRA 2ZZTA 3LOUA 4GC6A 3T5JA 3CPWR 1O5JA 2CAJA 2F8EX 1FRJA 1SKWA 1TVRB 2GA7A 2MJUA 3WHIA 4AQYF 5L1JA 3FFIB 3EVOA 1FEHA 4JI4F 1VIOA 2D3UA 2HWHA 5HVGA 1DJ0A 5GVQA 1NKCA 4KGKA 2QLJB 4TYBA 5IM0B 1EKSA 3GFHA 2AV5A 3C3LA 5F8LA 3D4JA 3UR3C 3NWRA 2VDIA 4QIFA 2ASJA 1VBXA 4PWWA 1SKRA 1ZAWA 3RU0A 4PG8A 2CQPA 3FEZA 3BV8A 3EE3A 2ILZA 1O0PA 1HMVA 1ELOA 1C0UB 1EKRA 2MHEA 2AJ1A 4DI6A 4RNFA 3KHGA 3BSCA 4K4YA 4DV7F 1IKWB 1FDAA 4OL8A 2QL9B 5DLGA 1NCLA 1ZBTA 3KDNA 5CYMB 1T05A 1S0MA 2LLZA 2ZH3A 4FXVA 3VZIA 2XMAA 4BWJA 2FLLA 5B0FA 2FC9A 4ZLLA 4N76A 2KM8B 3GYNA 3M1VB 3DU5A 3GV5B 2UUTA 2YWWA 3GFXA 3M4XA 3VTIA 2ZZNA 4HI2A 4LRCA 4TLQA 4AXJA 1YGYA 2GAHC 4KPYA 5U47A 1GXLA 1Q82T 2KYXA 2IJFA 1N48A 2V67A 2VONA 2FYXA 3DN9A 2VFSA 3I55S 2MJNA 3HSJA 3FCHA 4U9RA 2B7CB 4QW8A 1N32J 3GR0A 2RQCA 3C46A 1UVMA 1RT1A 2DNLA 4IYQA 4PWUA 1LWEB 4CLWA 5KG2A 2XQCA 3HM9A 3U02A 2Z2ZA 1VC5A 3FNNA 4LF5F 3W3SA 2XS5A 1Z1ZA 4Q45A 1N5YB 3Q8YA 2MKKA 4XPCA 1AFIA 3SMZA 1Q4RA 2IY5B 1RTZA 2W9BA 2YQ0A 5FDLA 2DTJA 5D0HA 2VC0A 2W7OA 3E8OA 4RBTA 3HT3A 5KFNA 3BGFA 2YH0A 2U1AA 1X4BA 5ETMA 3OR2A 3AJ2A 3TA0A 4DSEA 4DF4A 2B7BB 2XMKA 1FWPA 1AT1B 1MN9A 1JXLA 4X66J 4MK7A 3JSRA 2R7QA 3QNWB 3U7JA 3EUNA 2OPQB 3MR5A 5M2RA 4ZVRB 1LWEA 1CJVA 1MWYA 3GTYX 5K8PA 3QZ8A 3RBZA 2VJVA 4NYPA 3AXMA 3QAEA 5B0EA 1FXDA 2VU5A 2F65A 1Q0NA 2NXJA 4P73A 3GV7B 1LK7A 1JKHA 2QRRA 1XEZA 4X84A 4Y65A 4DPWA 3NNCA 1FDBA 3PRVA 4ZJLA 3H2UB 2LQ9A 3D7SB 3V2UC 1V3RA 5AJ3J 4DU8A 2PE8A 2VKZG 1TKTA 3TZXA 4UY85 3DOKA 2R7UA 2AMCB 1RP5A 1RTDA 4KKOB 3BN7A 3KK1B 3TVYA 4DS5A 1YJWS 1AYEA 4FZVA 2YNHA 4IH6A 3JXOA 1IJEB 4WXWA 4CLLA 1AZSA 3FEXB 2X51A 3OBIA 5KFKA 1Q86T 4ED5A 4DL0C 1YZ6A 3CO9A 3FKBA 3CJKA 1Y3JA 2QLFB 5B09A 3HD2A 4JI1F 3RBEA 1JLQA 2OPPA 2MQLA 3C15A 3MOZA 5E41A 4DR2F 1YBUA 3UDVA 3W5ZA 4JI6F 5K8NA 3BREA 1S9GA 2NUUG 3TX0A 5DM6Q 5GAHI 1IUJA 3QJPA 3BGLA 5C24B 4P2FA 2VG5B 1OY6A 2V8DA 1NXIA 1W25A 3LP0B 1JXVA 4KC5A 4DV0F 3OR1B 4IFYA 4MAKA 3DLJA 4Y2IA 3DOMB 2KU7A 3B6BA 3I9ZA 4HT7A 4MIBA 4IRCA 4ED0A 2JVRA 2M4MA 4LFCF 4QU6A 1K0VA 3FFIA 4LBHA 2BA9A 4JBCA 1DTTA 2L3MA 3GZ7A 4TVAB 4D3GA 3CJ4A 4Q8FA 1UTAA 3I82A 2XMUA 3W1YC 3DGVA 5LJ5Y 5J2NA 2OHDA 4OJGA 3UNGC 4NZ0A 1JLBA 2DGTA 2BJ7A 2HZAA 3OR2B 4ECWA 3M6XA 1J5EJ 1RT6B 3FSYA 4IUFA 2AJ0A 1DARA 3V5RA 4DR3J 2K7JA 3MEGB 1TKZA 4AE5A 2B3TB 3PFEA 2ACYA 4OX8A 1S10A 5GAEU 1RXOB 4AUKA 1N5YA 2LYVA 5EX3A 3GJQB 4PPZA 4DR5F 1HI8A 2KB2A 2EC0A 2E5GA 1WHVA 4CI0B 3VAIA 8ATCB 2BKPA 4ELTA 3GG1A 4RUHA 1R0BG 4Q0BB 1I5OB 3EGNA 1ICEB 5E3CA 2LDYA 2R4FA 3QBCA 1CS4A 1JLFB 1OY8A 2J8SA 2V4JA 2H5IB 2HSEB 3EVMA 4DHVA 4KBIA 5IV4A 2HEKA 5DQGA 2RS2A 3PW5A 2ASDA 1RABB 5KFOA 1N33J 3P45B 1YITS 4K4ZA 3RR8A 1RU1A 1B64A 2C2OB 2DNKA 2IVMA 3D0GE 3LQVA 4OZNA 4W4MA 5F0WA 3G82A 3PW7A 3MPYA 1TFWA 2VG7B 1NJXA 2HNYB 2M70A 4F26A 2V9KA 3Q8PB 1VR6A 1VI7A 4P10A 2VQEJ 1BHNA 4EBCA 1HHTP 3K0JA 2MEWA 4GO5X 2HYIB 4F2SA 4TU7A 4WCEQ 4F7VA 1WHYA 1VQ9S 2V68A 2ILYA 4H4MA 3M30A 4LJMA 1ZM2A 4P2SA 4BC9A 2FPHX 4OZLA 1S1TA 1D8YA 1TV6A 1VCTA 4QBUA 2QG9B 4CZCA 1AXQA 2CQ4A 2K8GA 2RJZA 3LAKA 1FCAA 3MM9B 5LSRA 4KGXB 5J2MB 4JI0F 1D1UA 3US5A 3G6YA 2QSWA 3M32A 3M2VB 4CLKA 1U45A 1OMSA 1U1LA 5KTQA 1R31A 5HLFB 3P5BP 4WKYA 5E3PA 3TA2A 2XSJA 4AL5A 1T03A 3DRPB 3KUHA 3MMAA 2W1BA 2XGPA 4NA3A 1R89A 2BQ3A 4K4UA 2AU0A 2MZRA 1BXNA 4K0KJ 3DCAA 2RRAA 3M2VA 3HT0A 3TO8A 4LSLB 3POTB 4RBUA 2J6UA 3JTNA 1O51A 3JQMA 2NPFA 1Y0HA 4UUXA 4DLEA 5CXTA 3RB0A 1FWKA 1HI1A 2YNGB 4FYVB 2YNIB 3KLHB 4EUVA 4GKKF 4O3RA 3C14B 2N4DA 4DPXA 1FKOA 2R8JA 2KYZA 2VIHA 4QR0A 1MU2B 2BRLA 3ET6B 4CLYA 4DR2J 1LV5A 4B9TA 3CIZA 2R9LA 3PX6A 2W24A 4IKAA 5ETSA 5HMYA 1NK7A 3OFHA 2GMJA 2RRBA 3TEGA 2DR9A 2YBVA 1FNOA 5ETOA 3QQCD 2HHWA 2AEJA 4G65A 3RAMA 2KJWA 1N36J 4P2MA 2XHCA 2FQQB 3M2RA 3PW4A 5RUBA 2GQ2A 2DXEA 5LMNJ 2BW7A 1RHKB 3PJWA 2VODA 4Z37A 2YPZA 3RJMB 4ES2A 3G9CA 4DLGA 2DRAA 1VS3A 2HWTA 1RTJA 4LSNA 1AFJA 5F41A 4AT1B 3H98A 2Q6BA 3NLCA 4RNHA 5IOLA 1BQNA 1TL5A 1YWXA 3NRBA 2YWHA 4U96A 1T9WA 3LWLA 3VGTA 4A8QA 1OSDA 3CF5Q 1YRTA 3A13A 4USUA 4G6VB 2XTJP 2MTLA 4BC7A 4X4PA 4FPRA 4OX6A 3JYTA 3MM9A 5K9FA 4C8MA 3M8PA 1S1VB 5DDRC 3SFUA 2HHUA 2RUGA 4F4ZA 2BJEA 2HS0A 1URNA 4WFNQ 2D74B 3PFOA 1IBMJ 4I2PB 1SC1B 1JLBB 3R97A 1H2VZ 1K1SA 1XR6A 4ZLPA 3AH6A 2V2QA 4U6PA 3PW2A 1QAIA 5T7LA 4LRFA 2AF6A 1NK5A 1HR0J 1EQMA 2QV6A 2W2QP 2FLOA 1VK3A 4DS4A 4DSLA 2CJAA 1R43A 1VRTB 3KLIB 4DZ6A 2CPEA 2IYGA 3ISND 4DL7A 1JWWA 1BQXA 2DR7A 3D67A 1U24A 1FDDA 1WOOA 3DM2B 1U48A 1NSQA 2MB0B 2DGWA 3U1MA 2CQ3A 4J9NA 1ZYQA 3TJAA 2QA4G 1KHVA 2CQDA 3MFHA 3AXKA 3OL7A 1GQEA 3DLKB 1TKXB 3PX4A 2EG1A 4RWWA 1TMJA 3HZGA 4LUBA 1J5OB 3DOLB 4B3RF 1R6YA 2IM1A 4FN5A 1JLQB 2DCLA 2MY7A 5GMEA 5HAOA 3R7NB 3LO3A 5F3TA 2CQ0A 4E2FB 2MKHA 1S1WA 4NA1A 2XO7A 2RDJA 1NMEB 3B78A 1Q8BA 3ICLA 2YNHB 1RLDA 5E3QA 3RRKA 4DFJA 1X0FA 3R5JB 2AJ2A 3CE8A 3T5HA 1SB6A 2NXUA 2VG6A 1FDNA 4OI2A 5ETNA 4DV7J 3V4MA 4FXWA 2WVDA 2R42A 2NR0A 1U26A 3M8YA 2DCUB 2E66A 3NCRA 5ETQA 2FUG9 5DS7A 3GB0A 5DZ7A 1VIXA 4DEZA 2DY1A 3E01A 1SH2A 1NH7A 2VPYB 4NLOA 3UE2A 4MKVA 3DI6B 5K8OA 3T6BA 3CCVS 2J76E 1V6HA 2J7UA 2XGQA 1SBRA 3SV4A 3W2WB 1MLAA 2OEMA 1U1RA 1WF2A 4DV0J 3A8JA 3VAJA 1F5BA 3N6LA 4KH0B 2E1RA 5L39A 4M94A 1IWGA 4JV2A 2HHHF 2R8GA 3DLHA 1ITPA 5F9NA 3I0RB 4KPCA 1VFJA 5F8MA 2AKWB 3N5FA 4ECRA 2IM3A 3MPUB 4TNOA 1A7GE 2W2MP 1REGX 2C3UA 3GYGA 3LW5C 4X4VA 3IGVA 3ONQA 4IFVA 1NSPA 4ZA1A 4NLUA 4NLTA 4KHRA 4MYUA 2JOQA 4C97A 5BJRA 4KV8B 4YY3F 2CQGA 1SUQA 2OO4A 3W63A 5ETKA 4MKAA 3PEHA 3ITHB 2QL7B 3D54A 3JQJA 1QAXA 2H5EA 5H9EJ 4LFBJ 4JV5F 1F60B 2KH9A 5DGBA 3QT8A 4NLXA 4AXIA 2ASLA 2NPIA 1HNXF 4NRTA 1I94F 4X2BA 1G7CB 3AB2B 3G86A 5D3GB 2VH7A 4YY3J 1N5QA 3RR7A 1CJVB 2V2VA 5KT5A 4CTAA 2JFDA 4ZPWR 2V5HG 2F4VF 3SCKE 4Q43A 3PW0A 1FERA 4ANDA 3QO9A 2NSBA 4DUYJ 2CZVC 2J9DA 5KFVA 1Q5VA 4M5IA 1VQ6S 1IM6A 1WHWA 4F3OA 3QIPA 2AWZA 2IVYA 2ZVSA 4XPEA 3LWMA 4C2MA 4B02A 3M9MB 1QTNB 1CJTB 4MH8A 4ZDNA 2R7SA 3SCIE 4OYAA 3V6HA 2WONB 2W9CB 2FJXA 1LWFB 2F4FA 5KFDA 4JI0J 3AQPA 4K0KF 2XB2D 3DFEA 4QWAA 1TP7A 3ZFVA 3AA8A 2X1FA 2ZH1A 2EFNA 1VC0A 3K58A 2P6SA 2MHNA 2UZAA 5EWFA 1A9NB 3P8BB 1UEKA 4ECXA 3T1YF 1OYEA 2JLFA 3CMAS 1WDDA 2BE7D 4DCPB 4DX5A 4CIOA 3NY0A 4J9PA 1VBKA 5K14A 1HNWJ 3IWXA 4WZQA 5D4OA 3HP6A 1KN6A 2DITA 5IWAJ 1VHFA 4OHWA 5L1KA 3ITHA 2G2YA 2R2UA 2LQJA 3CNQP 5KFQA 3IG1A 1RE1B 4AD6A 3ADAC 4YB5A 4ZPVR 1ZAVA 5DG9A 1TK8A 1KS2A 2BV3A 4P74A 4USVA 1N6QA 1J5EF 4DJBA 2DXFA 4IFVB 2LKZA 1NLKL 4ANCA 4EFAC 1T05B 3C6UA 4HEA9 4X65J 2RE1A 2KM8C 1S6PB 3QT7A 2QTWA 4D3HA 3E51A 1U2RA 2FZKB 4EMDA 1YIJS 1WELA 2YKMB 2HLTA 3KHLA 1FKOB 1M1GA 4J9LA 2PMHA 1UFWA 3R9LA 2CA9A 2DO4A 5SZTA 3DDNA 4PG5A 2I1RA 1RA7A 5KFBA 1VQNS 4OHXA 2ZE2B 5KAKA 5LMUF 4PWDB 5HMWA 3PACA 1RT7A 1FVQA 1Y5IB 1UKUA 3IWLA 4PPDA 4DV5F 2DD8S 1E6VB 2RNEA 3BPDA 3VVUA 5L8RC 4U7UK 1QSSA 2ZWOA 1CJUA 3O3LA 3E01B 1UVNA 3FQLA 4FPIA 1WEZA 2MKJA 5C7PA 5A2QU 3VQSA 1X9SA 1R0AB 2ZZMA 1S6UA 3R5CA 2DNOA 3T9ZA 3AQOA 1KWMA 1EX8A 4B9NA 2HVZA 3HVTB 3T9NA 2CQHA 2I38A 2OSQA 4M63A 5A8WB 2ZM6J 4FBTA 2MLXA 2Q79A 3NXZA 1BLUA 1U09A 1DZ5A 3HI9A 1TV6B 3KLFA 2WW4A 3R2DJ 2ZBIA 1T3OA 2A18A 1DTQB 2J0WA 1S6OA 2XG8A 4DV3F 3M8ZA 4DXLA 1SVDA 8RUCA 4M5HA 2N82B 2XBPA 4FS1A 3J7ZT 3D0IE 1RHQB 4DX6A 2R7WA 3UCUP 2Y0SD 1S59A 4KH1B 1MW7A 2CPZA 2Y3YA 5AE2A 5EWGA 1LFWA 3PO5A 4JOUA 6FD1A 4HLBA 2B4PA 2AYBA 2F9DA 4F0MA 1F9FA 2CJ9A 2ZC3A 3RRHA 3VV2B 2IRUA 2E1MC 1RU2A 1S1UB 3UN5A 1IKXA 5E3RA 4F36A 1UWAA 2G4BA 1VRTA 3KLIA 3I0SA 4S0MA 5H9EK 4Z2XA 5HL7Q 2IPOB 5HROB 1RT5B 2RUSA 4G1QA 2UXDJ 2DB1A 1O8BA 4OYMA 1H7XA 1RTIA 5I42A 1GEHA 4PAAA 2HRUA 3TYTA 1RTHA 1KTQA 2XNRA 1UA0A 5FIIA 2HFNA 4IQXA 2EC2A 1YJ9S 4C8YA 1TKZB 5LXYA 1N88A 2JZ5A 4F0KA 2F8HA 1RT6A 3HZEA 2JL9A 3W64A 4PG6A 5KFWA 1UW4A 1Q95G 2BUNA 2MLZA 2XI2A 4ES1A 3SYZA 5F0UA 4LF4J 4IOBA 4LSLA 2V4QA 1LKZA 2VUGA 3MEKA 2ZWPA 4GVBB 4CO4A 1XMQF 1U1KA 2FVQA 3MM7B 4ZCMA 3MM8B 2FJEB 2I8EA 3VAGA 3KLGB 2BE2A 5LOQA 2CPXA 1PIEA 3U1NA 4ID5B 4N8OA 3WQPA 1U4BA 1YLXA 1QTMA 4I69A 1GXUA 4M95A 2KKHA 4ZJOA 2W9AA 3M2UA 1XR7A 2ROGA 3MM6B 3MMCB 1FRXA 5A0YB 5B0BA 8AT1B 5KT6A 1KC8T 1RT7B 1TUGB 3J7YU 1SJ4P 1N32F 1EZZB 3OTDA 3KYLA 3M6VA 2ZE2A 3LALA 4ECQA 3T3FA 4ER8A 2MQOA 1Q7YT 5B0DA 3LH2S 2VDHA 4OZ0A 1B3TA 4C0OC 1YG0A 4WFYA 1GAOA 3AD7C 4M5GA 1D3WA 2CPIA 2CQBA 2P8IA 4JI7J 2JH3A 3M05A 2ZH2A 1REVA 1UL3A 3F41A 3ILLA 3GIKA 3QT6A 4GKJF 1D9AA 3ZZYA 3QRRA 1VJQA 3K7RA 3KXDA 2JLEA 5KFTA 2XS2A 3BSOA 1IR2A 1F9HA 2K1RA 2AEFA 1JLEB 1MMDA 1HWJA 1TUWA 1WD6A 2PD1A 4AFFA 4XO0A 1ZZFA 4PQUA 4LFBF 1LK5A 1Q1KA 2DYAA 2FGCA 4I7FB 3M2UB 3F73A 3MXHP 1T0TV 1JQGA 4JI8J 4ANEA 1RT3B 5K8MA 3CJSA 3DDKA 2VPWB 3HHLD 2VA3A 4E8UA 3A12A 2MKYA 2VL1A 4URSA 2E7VA 5D4PA 5AXLA 4OZ1A 2MGZA 4X62F 3G96A 2FJBB 1K8AT 1QE1A 3CJTA 2QZ8A 4J9VA 2HQFA 3T19A 3V4IB 3T5LA 3L7UA 4NLQA 2X3GA 1S1TB 1K9MT 3I5AA 3MCNA 3M8SA 3HHEA 1XMBA 1F6TA 5HATA 1H7WA 4DV6J 1NJIT 1A6LA 2ROEA 3NS5A 4WP8A 3TUJC 3LP1A 3IO1A 1B70B 4CNZA 3GWCA 3W2VA 1HBMB 4TU9A 5F8NA 3OSNA 3TARA 2MDAA 3MMBA 3AA9A 4PXEA 3EMTA 4PXBA 1DTTB 1EIYB 4O3QA 3H20A 4KHPF 2ZBQA 4TN2A 2VFTA 3IM8A 4Y2MA 5BR8J 3KK2A 2RQ4A 2GAGC 2XMTA 4ICLB 3SQOP 5CYJA 4CLUA 3J7YI 2XC9A 2LQ8A 3LP0A 2QE5A 4CO2A 4QYRA 2MQMA 3RAXA 2OFHX 2ZH8A 4FYDA 5MAOA 4C11A 3Q8RB 3ZXWA 3HXMA 1R3NA 1TL3B 2X3DA 3H42A 4OYBA 4IOCQ 2HFZA 3BDPA 1HNWF 4TYAA 2OPPB 3MPDA 1HWKA 4KQZA 2V4RA 1HNZJ 2W2OP 2CJQA 1UJ5A 4W98A 3CJKB 2G2OA 2K3IA 1YRUA 2DH8A 4HACB 3CC4S 1NB7A 1FE0A 4Y2KA 2DNPA 1LNQA 4NMLA 3OVBA 2ZOFA 3R3TA 3RB3A 1C0UA 1IBMF 4CO0A 4JI3J 1SXLA 2CUYA 2KHCA 2I6WA 3NS6A 3GV8B 3P6YC 2CPDA 2AX0A 3FCWA 2QL5B 4FDFA 5J2NB 4DL5A 4DL4A 5HJYA 4IO1A 3KNAA 4LVNP 3K5OA 4IR9A 1CC7A 1RAJA 3DHWC 2H5JB 4OZ3A 4H4KA 1RWNB 4ZVTB 3GJTB 3HHLB 1D0EA 1GTHA 2D3O1 3TWZA 3W9IA 3CMES 4F4XA 3I6PA 5F9LA 1E6VA 5GADU 2JEIA 2YXLA 2KRBA 2ZD1A 3MAQA 3CC7S 1TZ0A 1KDNA 2B6AA 3CDBA 4OI4A 5LM7E 1S4EA 4DN9A 3VAHA 1WC0A 4UQGA 3NCPA 4ZVFA 4R8UB 2HIYA 1D09B 2L9WA 3LGNA 1U0HB 5DZ6A 2OD6A 3CD7A 3K8VA 4NLWA 3VVTA 3ZZPA 4K4VA 5E3AA 3N4WA 4QPXA 1U7LA 2C2ZB 2HHPA 1PILA 2V6AA 1LEOA 3OT9A 2CXEA 4HACA 2VHGA 4CM2A 2OIHA 4I6YA 3RZAA 4KT0C 4ERDA 3O2IA 4HHHA 4LIWA 4A8WA 2XWYA 1PAUB 4U8YA 1NBEB 1TMMA 3FBCA 1VC6A 3R5GA 3R6LB 1IKYA 3RRGA 3A8EA 4ZLJA 1PO6A 1Q16B 4N5SA 1TL7B 4F4YA 4CO1A 2H48B 4QPTA 5IQQA 2YQ1A 3TX8A 4WE1B 1R8HA 2XY6A 5J1PA 1NB2A 2EKNA 4PZVA 3B4MA 1A0OB 3A3OB 2GZOA 3DU6A 3TJ9A 1TQLA 4XIUA 2IHR1 4I68A 4WIIA 1XIQA 4X4RA 5KFUA 1X4HA 4KAIA 3R2CJ 1VYAA 3A4TA 4ENOA 5KOWA 3B82A 4H4KC 4PEOA 1XERA 2IAJA 1J27A 2VBWA 1HWLA 2WK4A 3GYXB 1WC5A 2M7SA 3H90A 4ITSA 3IS9A 1ZZNA 1B4SA 3KFWX 1YBAA 3SXLA 3ZZTA 4F4KA 2J0SD 1NNDA 4HDHA 2Z0GA 1M5OC 3BM7A 1M1HA 5JUMA 3G6VA 2R7VA 1KONA 1RWPB 1B99A 1M90T 1HW8A 4FNHA 3GIRA 3FEYB 3LF0A 3CDEA 4ZP6A 3J81j 3V4IA 4AL6A 1UMJA 1TK0A 4IRDA 4LR8A 3K57A 3PM9A 1M5VC 3N6MA 3OTEA 1WTFA 1GMWA 2A3JA 1RAOA 3I96A 1SIWB 3B4DA 4RW7A 3I4HX 4CM0A 4CLPA 3OVSA 4DV1F 2RSQA 2RD5C 1FF2A 1FEEA 4EYIB 2XCPA 2P9GA 1U02A 1RISA 3BS9A 4YR3A 1WG4A 2A10A 1RAFB 2KN4A 1AROP 2L48A 4CLTA 2Y1JA 1FNXH 3G6XA 4B17A 1C1CA 3K8WA 3CMQA 4MJKA 2HBZB 3MZIA 1WOPA 1FRKA 1SPBP 3HDSA 2ZUAA 1WUUA 1FFWB 3KG0A 2APOA 2E1AA 4O4GB 2PA8D 3SBMA 4EO6A 2ZKUA 2CQ2A 2Z2LA 4ED8A 4BHQA 3BGOP 2NS1B 2ZUGA 2UV8A 3RTVA 1NK9A 4C4WA 3ILIA 5IT9U 2CVIA 4DR7F 3LPYA 3CCJS 3F56A 2B43A 4WU3A 3I5BA 2VBYA 1X5TA 4ZIVA 1BUXA 3C6TB 3QWPA 3S01A 3MUMP 3DYAA 1VQSA 2FHKA 2HRYA 3H59A 3M7VA 1R7IA 2HFSA 4B08A 3ZZRA 5FLXY 2MGZB 2UVVA 4WZMA 2ZJQQ 1F3FA 4WP9A 5IM0A 4OQJA 3CC2S 3OTCA 2K7KA 2VJUA 3RAQA 2BQRA 3SDEB 1TL1A 2Z2YB 2ACMA 4ID5A 4EEYA 3QZ7A 1S77D 2QA2A 4O3NA 4LF6F 2HIQA 1BWVA 1P1TA 1P8GA 5HSPA 3QYYA 2HVHA 4RNOA 3S6EA 2VD3A 4ATNA 4NASA 4RUBA 1D8ZA 1OY9A 2GJ2A 5DETA 3W8PA 1WF0A 3ZTQA 1YJNS 1H74A 1HQUA 1TL4A 2M0GB 2H9ZA 3ETOA 1IBKJ 2DGOA 4DUYF 4OFZA 2V0NA 2XYHB 2Z57B 4ZVSB 5KFSA 4B3RJ 2PDAA 1CSJA 5ETPA 2DH9A 3GPAA 4ZHRB 2AGPA 4LF5J 2L9DA 4DR5J 2P9EA 4A8XA 2CWKA 2X1GA 4CH0S 4K8RA 4OYWA 1E6YB 2YWGA 3CD5A 1S9FA 2ZNZA 1NUEA 1FK9B 2V8GA 2WVCA 4HTIA 4J5OA 4K59A 3A3PB 3FMBA 3QGHA 2KZMA 4NWBA 3G82B 2EFPA 4DV5J 5HROA 2KXFA 4GO7X 3HJVA 1DLOA 4RKUC 3KLEB 2IMOA 4NZ7A 2DPIA 5C5JA 2LQ5A 2NYHA 3I9V9 4IDKA 1BY9A 5A2QY 3MCSA 4RW6B 5J1EA 2ZITA 3R7BB 1KQKA 2FTRA 4DSIA 4OHVA 4N41A 2FHJD 1VLYA 2V4JB 3I87A 1JLGB 5BYQA 3MM7A 3TQ1A 3OQ2A 3IBCB 1OSCA 4DL3A 2UVRA 4RX6A 2ADBA 1X31C 1TFYA 4MYTA 4A8KA 1EHWA 4NXNF 3MR2A 3MF5A 3MR7A 2H1YA 3NP5A 3MEEA 5AXKA 2BJ3A 1WC6A 2BOAA 2JC1A 3SFGA 4BLGA 1DTQA 1UA1A 2EG2A 4L3NA 5A8RA 4YHHF 5DO2A 4CO3A 1PBUA 1CQNA 3EXYA 5IV3A 1RTHB 3OLAA 2DK2A 4P9SA 2E5HA 4PR6A 3BGUA 1RTIB 1U0SA 4FP9A 2F9JA 3KLVA 1DAXA 2HHVA 5JMNA 1DRZA 3ZC4A 5J2QB 4UY8T 2CPYA 2YVSA 1LXJA 1V3ZA 1T9VA 5KT3A 4DV2J 1NKBA 1W2IA 1CJKB 1MSWD 1RTJB 2WB1D 4LSNB 2GV1A 2HBYB 4C48A 4B3SJ 5IT9Y 1NK0A 4YDDB 1S1UA 3NOCA 3T5KA 1NPKA 3TUIC 3ILJA 3EZUA 4MFBB 4CH1A 1I94J 1FJEB 2HHXA 2PSZA 3KJNB 3HULA 1RAHB 2M8DB 5KFYA 2P9CA 2LXIA 3N28A 4G1PA 4L72B 1NDCA 3FRYA 3TJ8A 1YJRA 2BM0A 1KLMA 1KLNA 4ZLNA 2ZHAA 1HKAA 1RHJB 4KO0B 4G3IA 2E9ZA 4KHPJ 3IC1A 1EJ7L 2E44A 3TOQA 4YMEA 4QW9A 4QJVA 3NCQA 3TANA 1RYRA 1VQ8S 3A8KA 4DFMA 4G1IA 4PQAA 3JAMY 3CCLS 3HVRA 3Q8UA 3P49B 1P27B 4LFAF 1Q53A 2BEFA 5EDWA 2PFDA 3Q8QB 3KK1A 4IG0A 3EPIA 4ILLA 2HHTA 1X0PA 3MCMA 3FBEA 1H0HB 2A6MA 3GIJA 2IBKA 3S8SA 3CD6S 1FNMA 2PO4A 2E7WA 3PV8A 2RU3A 5C2GA 2DNQA 4RU2A 1VQ5S 4WYLA 4DQIA 3Q8VA 1QY7A 3IRXA 3KJVB 4ED2A 4OV1A 2D41A 4UOFA 4DR7J 1FTCA 1ULRA 2LQBA 3G8QA 5HBMB 4DQSA 3QSYB 2FJVA 4X4NA 2HQIA 2R8KA 2G0IA 1SC6A 3CD0A 3M32B 5KFJA 2VICA 1K44A 1KHWA 5F8JA 3L7PA 3UW1A 4W92B 2EFVA 2RQKA 1S97A 1BGXT 1JLAA 4HT5A 1PCAA 2EFQA 2W01A 2XLJA 4C8NA 4NLVA 3I5CA 2DVIA 4OI0A 3PYFA 4ZVOB 2B9EA 2WONA 4X4OA 2W9CA 2EI5A 3NGRA 3JSBA 2DNHA 3MDFA 1TAQA 1U2CA 3OTOF 1S99A 2ZFHA 3X3UA 4OLOA 4EBEA 4ECVA 2W25A 3IS9B 1KOOA 3TZYA 1G3OA 3QGPA 3BB5A 1HW9A 2OMOA 3RW7A 1WC4A 4ID8A 2VOPA 2HNYA 2J0XA 2ZEJA 2KO1A 3BDEA 4CNYA 5KFMA 1X4AA 1YJ7A 4GMKA 1C1CB 4MT1A 3W61A 1N33F 4I6WA 1S7IA 3K5PA 3QGGA 4CRJA 3SEOA 3PR4A 4WIQA 1EARA 4LREA 4LBIA 4J7CA 4UOHA 2FVPA 4AMPA 4LR9A 5GAHU 3OL6A 1FKPB 3UN3A 2FC8A 2XSFA 2RKIB 1GX6A 3ISZA 2F3JA 2VV5A 4U95A 5DDOC 1W2BR 1Q8IA 1XNRJ 3AODA 2GVZA 4OIXA 1TK5A 2C3OA 1Q79A 4ZN1A 2VASA 4FNIA 5HMZA 3OJUA 1W26A 2DKOB 1ZS6A 1N5TA 3IR5B 4JI1J 1RGVA 1JMTA 2BYCA 2CVEA 3T41A 5JJBA 2GNKA 1L3SA 2HMIB 1B7FA 3ZZOA 2IJRA 1P6TA 2BRKA 2DO0A 1T11A 2AW0A 3AJ1A 2Q43A 5HJXA 3VZHA 5HMXA 5GAGI 1XJWB 3D1QA 3H4BA 1KP6A 3PJXA 3BQ2A 1U1QA 1SKSA 2J6SA 4J91A 2PMWA 4ZPTR 2V2KA 2JNJA 3ENWA 1GFWB 4YEAA 3VQTA 3CW2C 3CCTA 2QMWA 3CEDA 2M9KA 4R8UA 3RGIA 1WACA 3CUNA 3HKWA 4RUAA 1OWXA 2UU9F 1CQMA 4FF2A 1FHTA 2C3PA 2B6AB 1LWCA 3UI3A 2J7WA 3BKTA 3M6UA 3BGRA 1EQ0A 2KG0A 1WORA 3MD1A 1U1OA 4O3SA 1UEUA 2KXHA 3R6GB 3DRXA 1YSJA 2GIFA 3OR1A 2R7TA 4ZVHA 1X4FA 2VG5A 3IBWA 2W8KA 1YKWA 5D0RA 1HBNB 3TAMB 4WWSA 3Q0AA 2BBEA 5JVGQ 2LMIA 5DDQC 5SUHA 3ELHA 2Z58B 2JLGA 1SUQB 4LIRA 1I51B 2EFGA 2UUBJ 2RDDA 1NSKL 4Y00A 3KOAA 4DN0A 1T94A 3QSIA 4Z7YA 3J7Z5 2AYMA 3HMJG 2CJYB 1HNIA 2RT3A 4J9OA 2XLKA 1N5SA 1VISA 1GXTA 1PGZA 3IWNC 1WKKA 3C2PA 3IM9A 5GAEI 1UVKA 3KHHA 2CQ1A 2OKQA 2YNFB 4ECSA 4ED7A 1U49A 1HBUA 3AOCA 4OYOA 1U47A 4DV6F 2MZJA 1TKTB 5DLFA 2Z4PA 2FDNA 1L3VA 1VOMA 2OFGX 4DCOB 3Q22A 1U8WA 1HBNA 2CDQA 2HNDA 2PGCA 5CZXA 1N36F 2JHEA 2BJ1A 1YBTA 3BPSP 1JKHB 4K7QA 2Q66A 5KG3A 2KVIA 3HCXA 3WX8A 1RK8A 3KK2B 2CNNB 1L3KA 3OFFA 3VAMA 4B9LA 1CJKA 1RUSA 3ETMA 4DUTA 1SIZA 1N52B 1QAYA 3N79A 4N7TA 3T1AA 2R2RA 2NSCA 1NHUA 3V6JA 1WF1A 5IC6B 1KQFB 4HTJA 4JUZA 3GG0A 3UQSA 3LP1B 3G8SA 4CLZA 1OO0B 4QQBA 3GFZA 3UVJB 3SSRA 3W62A 4YFUA 4NMXA 4XK8C 4WF9Q 2DISA 3MAHA 1S1WB 2UVUA 2FD2A 2LA4A 2BDPA 2Y8YA 2DIVA 1EP4B 3MEEB 3THVA 3HD1A 3O6QA 5D0GA 2B56A 3DOLA 3K5NA 4RPFA 2A0FB 2ATLA 4B3OA 2VBXA 3NEKA 1FFGB 2DGVA 2JVOA 3DLGB 4PRFA 1TL3A 1UZHA 4CYUA 2VQEF 2ATCB 4ED6A 3DRSA 2J7KA 4FVCA 2GW8A 4TY8B 5ADZA 1JLGA 2UVWA 2YX4A 2EK6A 4IG3A 2E7XA 1MWQA 3QATA 2Z2MA 4ELUA 2KFNA 5KT4A 1QUVA 2FLNA 2WBMA 1HBOB 5EX0A 2WBRA 1X60A 1T95A 4X64F 4LFAJ 2QMUB 1V9OA 2R8IA 3CCES 5GAGU 3GLJA 5T7LB 1JLEA 3P5TL 2ZJPQ 3CB4A 2YKQA 3CCQS 3MGJA 1VQYA 3MECA 2HBRB 3ZO7A 3D28A 2NZ4A 2PT0A 2UUAJ 4L75A 1LW2A 2HQGA 4Y6IA 2PI5A 3HLUA 3TRGA 3FUYA 4USWA 4X64J 4NEYA 1VBZA 4K2JA 4OX9J 2IM2A 3P4UB 2UU9J 1HPZA 1S1VA 2CQIA 1U25A 2YQ3A 3OHAA 2IJNA 4RW9A 1JLAB 4TQRA 2AYEA 2ZH5A 4EU0A 4MK9A 3R1LA 2WCXA 4NOHA 4PYAA 4USIA 2GCFA 4DBQA 4IRKA 3KK3B 1P1LA 1WKJA
chains in the Genus database with same CATH topology
2H1YA 3G87A 3RGIA 5DZ6A 3TZWA 2QO3A 5CZCA 3R97A 2CUYA 2QC3A 2JFDA 3IM9A 3R8YA 2QJ3A 3PTWA 3H0PA 3IM8A 1NM2A 2G2ZA 3HJVA 3K89A 2VZ9A 4RR5A 5CZDA 3BV8A 2G2YA 4RL1A 2PFFB 2JFKA 3SBMA 4QBUA 5DZ7A 3HHDA 2UV8G 2VKZG 3TZXA 3EZOA 3TZYA 2HG4A 2VZ8A 2C2NA 3TZZA 3CJ8A 3QATA 2G2OA 2G1HA 3TQEA 1MLAA 3HMJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1Y A;  3G87 A;  3RGI A;  5DZ6 A;  3TZW A;  2QO3 A;  5CZC A;  3R97 A;  2CUY A;  2QC3 A;  2JFD A;  3IM9 A;  3R8Y A;  2QJ3 A;  3PTW A;  3H0P A;  3IM8 A;  1NM2 A;  2G2Z A;  3HJV A;  3K89 A;  2VZ9 A;  4RR5 A;  5CZD A;  3BV8 A;  2G2Y A;  4RL1 A;  2PFF B;  2JFK A;  3SBM A;  4QBU A;  5DZ7 A;  3HHD A;  2UV8 G;  2VKZ G;  3TZX A;  3EZO A;  3TZY A;  2HG4 A;  2VZ8 A;  2C2N A;  3TZZ A;  3CJ8 A;  3QAT A;  2G2O A;  2G1H A;  3TQE A;  1MLA A;  3HMJ G; 
#chains in the Genus database with same CATH topology
 1UVL A;  2QMX A;  3ENA A;  2GQQ A;  4NL5 A;  4YS2 A;  1X5S A;  1PJ5 A;  4UOC A;  5H9F J;  3ENQ A;  1S9E B;  1M5H A;  2JSX A;  3N5B A;  3PEJ A;  4IOA Q;  2XSJ B;  2ZBR A;  1DHM A;  1SC3 B;  2DBB A;  2IRX A;  3DC2 A;  2WZ1 A;  1RWW B;  1TUV A;  2NUH A;  5A6W A;  3QJJ A;  4CT8 A;  1N56 A;  1AB8 A;  2QLB B;  3VAL A;  1AW0 A;  2VZ9 A;  4M5N A;  1P9Y A;  4RR5 A;  5ITH A;  3UWT A;  4ZPC A;  1R8A A;  3EX7 B;  4KR0 B;  4LQ3 A;  3JSM A;  4AL7 A;  1Q8K A;  1S1X B;  1FA0 A;  4P52 A;  2I0X A;  1HNV A;  2XZW A;  4EYH B;  1Y00 A;  2KZZ A;  1SV5 A;  1N0V C;  1FI4 A;  5LSL A;  2B4V A;  4A46 A;  5DQH A;  3KG4 A;  2BVZ A;  2RAQ A;  4CH7 A;  3SSQ A;  3ZTP A;  2RRN A;  5J1N A;  2MKC A;  1Z2L A;  3CJ8 A;  2Q1L A;  4KIA A;  2MZT A;  3H25 A;  2CJK A;  3KTQ A;  3C14 A;  1JXE A;  2DHG A;  4O4G A;  3FQK A;  3ZZZ A;  3NMR A;  1RCX B;  1BQM A;  1FX4 A;  3BQ0 A;  3AT1 B;  2VG7 A;  4DV3 J;  1VQP S;  1RT5 A;  4H4O B;  5CZC A;  3UCG A;  1IBL J;  1XBW A;  4EI2 A;  4BDP A;  3BZQ A;  4LF7 F;  4JI2 J;  4LMZ A;  2E5J A;  2DGS A;  4A47 A;  1QDU B;  4OZ5 A;  1MN7 A;  7FD1 A;  2AGO A;  2FJW A;  5EHH A;  3J81 Y;  2PMZ D;  2JX2 A;  3X1L B;  3MM8 A;  4B9M A;  1HAR A;  2WVE A;  1TTH B;  4Q0B A;  4HHU A;  4GVB A;  2E1C A;  2YWK A;  3DLG A;  2E9T A;  2ZH9 A;  3J7A N;  1EB0 A;  2WSE C;  4UUW A;  2V63 A;  1GMW D;  5CHC B;  4YHH J;  1WOS A;  2IDL A;  1ZOT A;  2MKS A;  2GO9 A;  2ZHB A;  4F02 A;  2DY9 A;  3NGS A;  3QLH B;  3KMQ A;  1RT2 B;  3CCZ A;  1MRO A;  2OPS B;  1PKU A;  3B54 A;  3CO0 P;  4OX9 F;  5FD1 A;  2IRY A;  4CO5 A;  1KSP A;  4V19 J;  3JB9 k;  1JLC B;  1VBY A;  2IA0 A;  5D6G A;  2BAB A;  1RHM B;  2L08 A;  2R2S A;  2V9W A;  1NSA A;  1XN9 A;  3BYR A;  3D9B A;  2RIL A;  2SXL A;  4IO9 Q;  2JDJ A;  3LGM A;  3FBF A;  4I64 A;  2KJV A;  2WOM A;  3FZ2 A;  2WSC C;  5IFM A;  4LF4 F;  4UZC A;  4RU9 A;  4KGZ B;  4FYY B;  5LMU J;  3CSK A;  2HG4 A;  4NCG B;  2CDR B;  2FJD B;  5IWA F;  4K4X A;  1DBD A;  3H7H B;  3V6K A;  3A3N B;  5C42 B;  4OYZ A;  4B3O B;  3H5Y A;  5K20 B;  1EET A;  1E6Y A;  1HA1 A;  1WSR A;  3C15 B;  4MTP A;  4ZMM A;  3T1Y J;  4JI7 F;  1S76 D;  4WKR A;  4WJB A;  2YNF A;  3MM5 B;  4U7C A;  3DRY A;  2HQD A;  2AJ4 A;  1YJV A;  2LXU A;  2Q6C A;  1G6B A;  2YWE A;  1VHI A;  3MCO A;  5GMD A;  1FXR A;  1SV5 B;  1KRP A;  4LQ9 A;  2JEJ A;  3I32 A;  2QGF B;  3M9N B;  2XY5 A;  5KG0 A;  3HVT A;  9ATC B;  3R7S B;  1LQ9 A;  1CC8 A;  1XK8 A;  1Y5L B;  3D5M A;  3VGU A;  4B3T J;  2GO8 A;  2GGP A;  4DG1 B;  5CQG A;  5H1S V;  3FDS A;  2UXB F;  4DV2 F;  3NGU A;  1HHS A;  4YB1 P;  1IBL F;  4LF7 J;  2RML A;  2EPI A;  3W65 A;  3M8R A;  5K14 B;  3GII A;  4L74 A;  3H5X A;  3SDE A;  4ZP8 A;  2B5J A;  3PKM A;  4IFY B;  4URG A;  3ZTR A;  2A2D A;  4DR1 J;  1YI2 S;  4U67 Q;  1OIA A;  3GMG A;  3DLB A;  4QR1 A;  2QO3 A;  2IMW P;  2OJ3 A;  1KNZ A;  4HH1 A;  4PWD A;  1FXL A;  4RWX A;  2LA6 A;  4QWD A;  1X5P A;  3H5U A;  1NKE A;  1BWE A;  2NLW A;  3D0H E;  4F3M A;  1IWA A;  4J9U E;  1DUR A;  5EGY A;  3IXQ A;  4ALZ A;  4DDF A;  3MI7 X;  4EBD A;  1CUL A;  1FE4 A;  2XMW A;  1TEL A;  3LGH A;  4UTG A;  4ZCL A;  3D6H B;  1JJ4 A;  2FY8 A;  4OLP A;  5D15 A;  3RUB L;  3SIP B;  4DQQ A;  1LW2 B;  3F44 A;  2AX1 A;  3V81 B;  1XTZ A;  2GVD A;  4HKQ A;  2QIF A;  2OTJ S;  1KD1 T;  2HZC A;  4I2Q B;  2GML A;  2WW8 A;  1IQZ A;  3O8W A;  3MUR P;  3D3C J;  2F63 A;  1AUD A;  4DUZ F;  4DR4 J;  2VZ8 A;  4AQY J;  2IA6 A;  1WHX A;  2QSF A;  2IDE A;  3MUV P;  1M5K C;  2GX8 A;  2ZOM A;  2W4P A;  1RT1 B;  2ZBC A;  3R1H A;  4L76 A;  2HK2 A;  3BN4 A;  2A1B A;  2F40 A;  1QUP A;  3OXL A;  4IH5 A;  2AZ3 A;  4C7Q A;  3BSN A;  2V69 A;  4KSE B;  4XDD A;  2QYC A;  1WG1 A;  2N3O A;  4ECY A;  1KOH A;  2RQM A;  3W8G A;  5M2P A;  4DUZ J;  4DR4 F;  3W5Y A;  4N56 A;  4DR6 J;  5AXN A;  3FSI A;  3PDN A;  2KG1 A;  2FLP A;  2XNQ A;  3H8Y A;  1HBM A;  4Y2A A;  4WP3 A;  4UOG A;  5THW A;  5IXU A;  1FJG J;  5A6P A;  4C9D A;  1NHV A;  2BW2 A;  1F5A A;  1U1N A;  1LWF A;  3EM1 A;  4ETX A;  4ZCI A;  1NJY A;  5IZH A;  4RW8 A;  2D3Z A;  4WPA A;  1YX2 A;  2GJI A;  4OJ3 A;  4USJ C;  5DGA A;  4MMO A;  1RQ0 A;  5ETT A;  1T9Y A;  3K59 A;  5CA5 A;  2DRD A;  1YZ7 A;  2GHW A;  2W7A A;  1QAJ A;  2DNM A;  2G9O A;  4PAB A;  2HMI A;  1U1M A;  1C1B A;  1PYS B;  2WVB A;  5HBM A;  3Q8S B;  5D3G A;  3UD3 P;  2BR0 A;  2PI4 A;  5L46 A;  3UD4 P;  2V2Z A;  3NGK A;  2A6O A;  2KTQ A;  3ZZ0 A;  1NZ8 A;  2P2C B;  4FBU A;  1WWH A;  3MTK A;  2DPJ A;  3TVZ A;  3VWS A;  5KT7 A;  3T1H F;  2BMB A;  1H6K X;  2JRS A;  4QIE A;  5D4L A;  4I7F A;  1FD2 A;  5AT1 B;  4JI8 F;  1N34 J;  2CNO B;  4B9V A;  5CCM A;  1PYO B;  3HHD A;  3S7R A;  5KFH A;  4NA2 A;  4RNN A;  1TR0 A;  2KI2 A;  4JI2 F;  3RYL A;  2HW3 A;  2C2K B;  2HGN A;  1X7V A;  2OPR A;  3ILO A;  3PCO B;  4CQ1 A;  1NK6 A;  3HHN B;  2J9C A;  1NK4 A;  4HYK A;  1FKA F;  1C4C A;  4UQT A;  1ACM B;  2A2C A;  2OUG A;  3AAW B;  2H4Y B;  4C6A A;  3HPO A;  3OW2 R;  2I2Y A;  1CUL B;  4FKX A;  1WEX A;  1UJ4 A;  4DF8 A;  1N34 F;  1BE4 A;  2N3L A;  4YB7 A;  3OTO J;  5EN1 A;  4KGV B;  2H65 B;  2VC1 A;  2ZKT A;  3QGI A;  2ZH7 A;  2PC6 A;  4NCB A;  2C3Y A;  1FRM A;  2NXC A;  3GQC A;  2X1A A;  3DLE B;  3TAM A;  5F8I A;  1OQ6 A;  1WTB A;  3Q83 A;  4MFB A;  2EBE A;  2GHP A;  1B7Y B;  3MM6 A;  3N01 A;  4F0H A;  3QWU A;  4X62 J;  1R0C B;  2EEY A;  2I5J B;  3DHX A;  3HHL A;  3LAN A;  4WYW A;  3CXC R;  5J2P A;  1RWV B;  1ZTW A;  4X66 F;  1X9M A;  3R5B A;  3PX0 A;  4ZP9 A;  5AXM A;  4R5P A;  1VRQ C;  4PCQ A;  2GIQ A;  1IKV B;  3LPE A;  3AFG A;  1C0T A;  1SJ1 A;  2E1P A;  4OZJ A;  1X4D A;  5K5M A;  3W60 A;  4LF8 F;  5HQM A;  1LW0 B;  5E2Q A;  1XNQ F;  4B9U A;  4RBV A;  5ETL A;  2C2M B;  1APS A;  3RW6 A;  2RDI A;  2RF2 B;  2NRE A;  1X5O A;  1FJG F;  3UO0 A;  5A8R B;  4F50 A;  3OFE A;  3RG6 A;  3WC0 A;  4K2X A;  4YUD A;  4Q7A A;  3NBP A;  3D3B J;  4U8V A;  5D0E A;  3HFV A;  1SL0 A;  4K5S A;  1RJJ A;  3MM5 A;  9RUB A;  2XZT B;  2E5L J;  4JI6 J;  1FRH A;  2CZ9 A;  2VFU A;  3PNI A;  4I6A A;  2O3D A;  3GCW P;  1QSL A;  1KFS A;  1EET B;  3V6D A;  4TU8 A;  2ALY B;  1RAG B;  2H4W B;  4WFB Q;  5IT0 A;  1NO8 A;  1K47 A;  3PYE A;  4JI5 J;  4U7U D;  2IC3 A;  2PN6 A;  5BYR A;  2GC8 A;  3R27 A;  1OPI A;  5B0G A;  4DSF A;  5DM7 Q;  4O3P A;  3I0S B;  4KRW A;  1D9F A;  2HHS A;  1N4L A;  2QFI A;  4Z7C A;  2HHH J;  4ICL A;  3UCZ P;  2M3D A;  4J9R A;  2NYI A;  2MZ1 A;  4HDG A;  3IR6 B;  1RI7 A;  1CVJ A;  2LU1 A;  4DSK A;  1QM9 A;  2UUW A;  2RB7 A;  2RHS B;  1HQ2 A;  2BAN B;  1DLO B;  4GVL A;  3G4S S;  3TA1 A;  2IC3 B;  3MTJ A;  3CGI A;  3MMB B;  3UDL A;  4X4Q A;  4KFB B;  5CYQ A;  3IGN A;  3BKF A;  2BJD A;  3OPK A;  3IMQ J;  4TLR A;  1U6F A;  3BKU A;  1R6V A;  2QLW A;  3GSI A;  4O0N A;  5C2C A;  1XQI A;  3CT9 A;  4A4J A;  4I2P A;  4RZR A;  2ZH4 A;  2HQC A;  3U1L A;  4DL6 A;  2OLW A;  1I6J A;  2OPS A;  4YB6 A;  2LEB A;  6AT1 B;  2C22 A;  4ZHR A;  2MQQ A;  3C8Y A;  4HL9 A;  3PKY A;  1Q8L A;  2DEI A;  3TR5 A;  2XMM A;  4ES3 A;  2DNR A;  3IN5 A;  3D68 A;  2AP6 A;  1Q5Y A;  3AJD A;  3NGT A;  2GHV C;  4AMO A;  1S4F A;  1KR4 A;  1NDP A;  3QID A;  3LP2 A;  3HSZ A;  3M8Q B;  5DJB A;  4F2R A;  3CWJ A;  4B3S F;  4LRA A;  3BEG B;  3FC9 A;  1R0A A;  1RT4 A;  3TZZ A;  1IKV A;  1HR0 F;  3HK2 A;  3NOG A;  1JB0 C;  2FHO B;  3IRX B;  3UNY A;  3KJV A;  3C16 B;  2N7Y A;  2VPZ B;  4UW2 A;  4NXM J;  1NJW A;  3TUP A;  1H72 C;  1S9E A;  4RO0 A;  3TW0 A;  4F25 A;  5LT5 A;  2D9O A;  1TU0 B;  3VHQ A;  3TUZ C;  2U2F A;  1HQE B;  3PJ9 A;  4P2X A;  2I5J A;  3TP2 A;  5HLF A;  1YHQ S;  2B0G A;  1GNK A;  5CD4 A;  5AJ3 F;  4C3M A;  1S0O A;  3L3C A;  1DQA A;  1KFD A;  1WG5 A;  4IG0 B;  5D78 A;  3AOA A;  3KG1 A;  3G8T A;  3C6T A;  4WFA Q;  4RW9 B;  1BQM B;  1CBK A;  1KTV A;  5EWE A;  2DHH A;  2X7I A;  3HSG A;  4MK8 A;  3W9J A;  4QWB A;  1IQT A;  2YKM A;  1L3U A;  1JX4 A;  5KFX A;  2O5D A;  1V5V A;  4KO0 A;  1S6P A;  2C1E B;  2N4C A;  3THT A;  1HNV B;  2KT5 A;  4B3M J;  2XY7 A;  1BMQ B;  2WRM A;  2YNG A;  2AD9 A;  2MQ8 A;  3JSM B;  4KFB A;  5KOX A;  4JI4 J;  2W8L A;  4NX9 A;  2F5G A;  2L41 A;  4H54 A;  4K50 A;  1NU4 A;  1Y11 A;  2CG4 A;  5D77 A;  5F8G A;  3AY0 A;  5DQI A;  1Q78 A;  4Y3C A;  2D69 A;  1HLW A;  4MKB A;  1UET A;  1MMN A;  4TKT A;  2H51 B;  2YTC A;  2FJA B;  3MUT P;  3A8I A;  1RWM B;  1RWK B;  1UW9 A;  4DPU A;  4IG3 B;  4HHJ A;  2QX0 A;  2V94 A;  2ZHO A;  3C16 A;  5KFG A;  4C8K A;  2CPF A;  4CDI A;  2ERR A;  3J81 U;  4OHZ A;  2V8H A;  4CYU B;  3PZP A;  1K73 T;  1R8C A;  4M5L A;  1VLO A;  1C1B B;  1PJ6 A;  1SJR A;  3V6D B;  3KKF A;  1Y4Z B;  2DT9 A;  3MMJ A;  3J80 Y;  4DPO A;  2B4O A;  4DR3 F;  2OEK A;  3OL8 A;  2J8A A;  2CNK B;  2CNL B;  1URR A;  2FZG B;  4LF1 A;  4C3K A;  4A48 A;  1X4G A;  4OJH A;  5HO4 A;  1LXN A;  1IR0 A;  4TY9 A;  7FDR A;  4YR0 A;  2C28 A;  5DG7 A;  1V5I B;  4Y28 C;  3WDO A;  1WI8 A;  2AJF E;  1LW0 A;  2LEA A;  1RDR A;  2R3V A;  2IAJ B;  3QMQ A;  3WX4 A;  1S7H A;  4Q5V A;  4J9Q A;  1RWU A;  2DHA A;  4DL2 A;  1J2V A;  2HK3 A;  3K2Y A;  5CYQ B;  2XMV A;  1FRI A;  3EGW B;  3FGV A;  4RJV A;  1NEE A;  3THP A;  4DCJ B;  5G0R B;  2BM1 A;  3EZ5 A;  2M52 A;  3Q89 A;  4R5P B;  4AMN A;  4CTA B;  4DMZ A;  2J0Q D;  1N5V A;  5J2P B;  3NGD A;  4P75 A;  1HL6 A;  4M5D A;  4ZOS A;  4P72 A;  3GJR B;  4ZP7 A;  4P7V A;  1Y9O A;  2AJQ A;  5KG4 A;  3G2X A;  3HHK A;  5C24 A;  3HSD A;  4RUC A;  2IM0 A;  2DXD A;  4J37 A;  2DNY A;  3CJ2 A;  2QYG A;  3H4D A;  1JIH A;  1S9G B;  4C8Z A;  2HS4 A;  2M88 A;  4OI3 A;  1IKY B;  3RBX A;  5L1I A;  3KNG A;  4OYP A;  1ZAX A;  3SCJ E;  1UWB B;  2DGX A;  3MHY A;  2DEJ A;  2DGQ A;  2HVE A;  3MFI A;  2RU9 A;  1UZD A;  4Q2L A;  3BBB A;  1ZTT A;  3M8W A;  4O3O A;  4KGM A;  4ETZ A;  2MPU A;  1F9E B;  1SQF A;  4ZVU B;  5HP1 A;  1T7P A;  2G0J A;  1YJU A;  4E0D A;  1Q7L B;  2OPR B;  4QIW D;  4PXD A;  2RF2 A;  4C8L A;  4MKY A;  4O44 A;  5F3Z A;  4QYZ K;  5A8K B;  3DOK B;  2J9E A;  4I4B A;  2ASY A;  3QRP A;  1F3V A;  2XYG B;  2POK A;  3OXG A;  4LF6 J;  3UFC X;  3VGV A;  2DH7 A;  3IAS 9;  1S0V A;  3L09 A;  2HQ3 A;  2J9D E;  4KYZ A;  4F4A A;  3OJS A;  1VQK S;  1F2G A;  1KVI A;  4JI5 F;  1RBL A;  2HBQ B;  2HNZ B;  2L9N A;  1GMV A;  2M8H A;  5IQ6 A;  4OX7 A;  4NLG A;  3OTB A;  3OSP A;  3BO4 A;  1SC4 B;  4UF4 A;  4O23 A;  1PC4 A;  3W66 A;  4DR6 F;  3FZB A;  4NLS A;  2E5L F;  5GAD I;  2FY1 A;  3BGR B;  4WFZ A;  3IBF B;  3CCS S;  3DLL Q;  1ZH5 A;  3IR7 B;  4L3K A;  4WK1 A;  1VDH A;  3MED A;  4DG1 A;  4IQM A;  3UPF A;  1RLC L;  2MQP A;  1B0V A;  1RBO B;  3O5T B;  4NE9 C;  4A8M P;  3AHP A;  1SJ3 P;  2Y9H A;  3BBF A;  4NLP A;  5A8K A;  4O44 B;  2HFV A;  1WDT A;  2HWI A;  1S6Q B;  1WEY A;  4USK A;  2MST A;  5L9N A;  1RAI B;  5FDL B;  5I3U B;  1AZS B;  2BAC A;  1WSV A;  4DQP A;  3JQK A;  3VAF A;  5L9X A;  2Z30 B;  5IS2 A;  1U6Z A;  4RL1 A;  2LFV A;  3DMJ B;  1RTD B;  3JS9 A;  2F8M A;  2DNZ A;  3IG1 B;  5B0C A;  5BYS A;  3QAU A;  1ROF A;  5LMN F;  2B4U A;  1FES A;  1OQ3 A;  4A8Y A;  2MZQ A;  3KJQ B;  4HH0 A;  1KQS R;  2OEL A;  3EDR B;  4QIG A;  4WTO B;  3OVA A;  4ZPA A;  1GT8 A;  1FKP A;  2JEF A;  2YH1 A;  4EZ9 A;  1NPR A;  2AHO B;  2CKW A;  2CIM A;  4LSZ B;  4BWM A;  4DPT A;  2VFR A;  2IBO A;  3SQG B;  2VKR A;  4KY3 A;  2UXC J;  2WVF A;  3OUY A;  4EO8 A;  3BSA A;  5G0R A;  3QT5 A;  4P71 A;  2QC3 A;  4PXC A;  3M1V A;  3Q2T C;  2NQP A;  4YDX A;  4X65 F;  3CVK A;  2RVJ A;  4I2Q A;  1QVF R;  4ZVP B;  1F2H A;  3D66 A;  5FJ4 A;  2WAQ D;  1RHU B;  4IH7 A;  3E2E A;  3HFK A;  4CWB A;  2CJX B;  1MRO B;  3ZTO A;  4B3T F;  2R7X A;  5E0O A;  1S48 A;  4RW8 B;  4N47 A;  4BCA A;  1HWI A;  5C25 A;  2DR6 A;  1Z2Z A;  1ZA1 B;  2QA1 A;  3DXB A;  3BH6 B;  3QIP B;  3PIO Q;  2E5I A;  2UV8 G;  2MKI A;  4Y2C A;  3M8P B;  5BXI A;  5KFL A;  2QLX A;  2UUC J;  4J90 A;  3KUE A;  1ZM4 A;  3WZ0 A;  2LP4 A;  4DZD A;  4ED3 A;  3CDA A;  4A8S A;  3OUY B;  4ZIW A;  3O44 A;  3SV3 A;  1SL1 A;  1HNX J;  3GIM A;  3BYP A;  4LRB A;  1V3S A;  4EWT A;  2OI2 A;  4NZ6 A;  3B8H A;  1VGY A;  1ZA2 B;  2VQF F;  1U6B A;  2UXB J;  1TAU A;  4XAK A;  4OJ1 A;  1RT3 A;  4C0B A;  2XUL A;  3C19 A;  3EXC X;  4FYX B;  5GMK a;  1TL7 A;  4Q44 A;  1TVR A;  3O1L A;  5T41 A;  2LVW A;  2VOO A;  4N77 A;  2CPH A;  2EKY A;  5KG5 A;  4O4R A;  2VPX B;  1QSY A;  5LJ3 Y;  3VF0 B;  2VQF J;  5AE3 A;  4ECU A;  2VF3 A;  4DFK A;  4N8N A;  2GVD B;  1CEZ A;  2KDO A;  3TVK A;  2OML A;  2O1P A;  3PHT A;  4K5R A;  2B8Q A;  4ZVQ B;  4JV0 A;  3NNH A;  2NXN A;  1JNR B;  1S6Q A;  3NL0 A;  1HMV B;  3NWG A;  2LEC A;  1GMU A;  4Q8E A;  2C2D A;  5FLX U;  3QPI A;  4C3L A;  4WXO A;  1UFL A;  2MQN A;  3FJ2 A;  3MED B;  2DIU A;  3N9U C;  1IR1 A;  1SJF A;  4ZS6 A;  1CG2 A;  3POT A;  3HKZ D;  3MMC A;  3EYZ A;  2OGU A;  2ZNY A;  1IVZ A;  2KFZ A;  1R27 B;  4C98 A;  1JJ2 R;  3KUG A;  1KBR A;  1C2P A;  3PRB A;  2WOM B;  3DRP A;  3CUL A;  2HNZ A;  3SSS A;  3FVY A;  1T03 B;  4Y34 A;  2GJF A;  4JB8 B;  1PYT A;  3PY8 A;  4FKY A;  3IP0 A;  3TAQ A;  2XI3 A;  1VMB A;  2JC0 A;  5DDP C;  2NXE A;  2FHM A;  3PIP Q;  1VQL S;  3KK3 A;  2UXC F;  2EFO A;  2PEH A;  1IBC B;  4JI3 F;  1JLC A;  4NRU A;  7AT1 B;  4X4S A;  1YTY A;  5KFA A;  5J2M A;  4KB7 A;  4ED4 A;  2I9S A;  2G1D A;  3VR1 A;  1K1Q A;  2F1F A;  2UUC F;  4R0J A;  4NXN J;  4L6V 3;  1B0T A;  4ILR A;  2AEM A;  2W2P P;  1RZM A;  3MPW A;  1PG5 B;  5LXR A;  3BQ1 A;  3CCR S;  4NI2 A;  1SKU B;  2DHS A;  4Y0F A;  4GKJ J;  1HFE L;  3DGP A;  3N6N A;  3PG9 A;  1UFK A;  3H2L A;  2HAI A;  2PII A;  5I42 B;  3H0P A;  3NAI A;  5C42 A;  2VFV A;  1VQO S;  4G1Q B;  3ULH A;  1DY3 A;  2IVF B;  3GJS B;  1RKI A;  1DQ9 A;  2GFF A;  4K4S A;  2G0C A;  3CDW A;  4C11 B;  3BO2 A;  4JV5 J;  1I1G A;  2MXY A;  1FTR A;  4PG7 A;  2FHJ A;  4ZIT A;  1NHK L;  3OHB A;  1IKX B;  1HD1 A;  5M2U A;  3K5L A;  4LT6 A;  1HBO A;  4IDK B;  4PG4 A;  3BO3 A;  3EZO A;  3KLE A;  1FJ7 A;  2B51 A;  2K2P A;  1XC9 A;  3WC2 A;  2X1B A;  1L5U A;  5D4N A;  1UVJ A;  3LUY A;  2HVI A;  3HJF A;  3W2V B;  1FX2 A;  2DHX A;  4QYZ J;  2WSF C;  3CDU A;  4DSJ A;  5IT4 A;  1NJZ A;  4OHY A;  5I3Q A;  4NI2 B;  1NZA A;  3G87 A;  1H98 A;  2CRL A;  3I4P A;  2HFO A;  3DKD A;  1RT2 A;  4CLS A;  2FZC B;  2BXJ A;  4QIV A;  4GRS A;  3G6E S;  1OJ4 A;  2NZC A;  4I56 A;  1NM2 A;  2B9Y A;  2OAU A;  3KDO A;  5KFP A;  3KJF B;  4NEZ A;  3JYT B;  4FXD A;  5CZD A;  4PKD B;  1DQ8 A;  2ZC4 A;  3CJR A;  3FBB A;  2HRT A;  4M5M A;  5B7W A;  4X4T A;  4F4W A;  2D7S A;  3TAP A;  2YWF A;  3EWG A;  3HX9 A;  4CCH A;  1FD8 A;  2COL A;  2XLI A;  2W2N P;  4K4T A;  3D1O A;  2HZV A;  2MMY A;  2QFJ A;  5KG1 A;  4ED1 A;  3JTO A;  1JJC B;  2UP1 A;  3F0N A;  2EVZ A;  4JP8 A;  1WC1 A;  2AGQ A;  3VCD A;  3GIL A;  1KVJ A;  1NAQ A;  2ZOG A;  5KFI A;  2RS8 A;  4QWC A;  3CTR A;  2YKP A;  5KT2 A;  4ILM A;  1ZM9 A;  2K1R B;  3DYA B;  1ZM3 A;  3D6F B;  4OMF G;  1FFS B;  1RKJ A;  2XZD B;  1T9U A;  1HPZ B;  2OTL S;  5HK4 A;  1G1X A;  5A76 A;  1HBU B;  4YOE A;  2HS3 A;  1REV B;  1SI9 A;  1IJF B;  1Z4U A;  2NCK L;  3WIU A;  3UDE A;  5LSO A;  1S12 A;  3SI8 A;  2BQU A;  4GKK J;  3R5D A;  2EXU A;  2P6T A;  2CJB A;  1RWX B;  1SH0 A;  1WI6 A;  1GH8 A;  2RHQ B;  1LOU A;  3MEC B;  4LF9 F;  1YVF A;  2DNN A;  5I4M A;  1N6Q B;  3GON A;  2HUR A;  4LBP A;  5BR8 F;  3UDC A;  3D2W A;  3EPG A;  3R5A A;  2YX1 A;  3ZNJ 1;  4ZVG A;  2G1H A;  4I0W A;  4NXM F;  1N54 B;  4UST A;  3UD5 A;  4B9S A;  1GK8 A;  5MLC V;  2M5Y A;  2RH3 A;  1ZPV A;  1VQ7 S;  4NYO A;  4P7T A;  1SJQ A;  4LF9 J;  2P5V A;  3HHL C;  2V34 A;  2B9X A;  4R25 A;  2OSR A;  3DXS X;  3AD9 C;  4JYA J;  2ALZ A;  4F3Q A;  1PJ7 A;  2OPQ A;  3LP2 B;  2WB4 A;  3M8Q A;  1WNE A;  3NMA A;  1LWC B;  1SQG A;  1YQH A;  2QT7 A;  3P3D A;  2RIJ A;  3OXF A;  4ZN3 A;  2YKA A;  2XWX A;  4CP5 A;  4DV4 F;  1R8P A;  1D9D A;  1UEV A;  4HVZ A;  2AYG A;  1X4E A;  2DNG A;  2N7C A;  1JK9 B;  5C25 B;  1VQM S;  3BH7 B;  2ZBP A;  1CJT A;  4FVM A;  3PHE A;  3U27 A;  2OP5 A;  1IN0 A;  5T14 A;  4JYA F;  3G71 S;  5CAA A;  3RB6 A;  4LF8 J;  1T9X A;  1NDK A;  1KKH A;  2V8P A;  4ELV A;  4LRD A;  3D1H A;  4AYB D;  4NCA A;  4AMM A;  2WHO A;  3LAM A;  5EUH A;  4MIW A;  4ZVE A;  1RAA B;  2BAN A;  1T3N A;  3PR5 B;  2G13 A;  1WC3 A;  1S5Z A;  4L73 A;  5CZV A;  2CQC A;  5L38 A;  3EDQ B;  3EGV A;  4ZKA A;  2KXN B;  3NNA A;  2GVZ B;  3PVX A;  3PYG A;  3NKY A;  4F04 B;  2G2Z A;  3K89 A;  4WE1 A;  4CT9 A;  5HVH A;  1CS4 B;  1JLF A;  1KQG B;  4YR2 A;  1S72 S;  2R7R A;  4BS2 A;  4USM A;  2ROP A;  1BD6 A;  4RW7 B;  3SCL E;  1NRK A;  5HVF A;  2XCA A;  4K4W A;  4X4U A;  2W7P A;  2JFK A;  2PFF B;  2YKN A;  5DG8 A;  2LDI A;  4DOZ A;  1H2U X;  1H3D A;  1HHQ A;  1T02 A;  3PRD A;  2WTF A;  3QRQ A;  3RBD A;  3CCW A;  2EK1 A;  1CPZ A;  1EP4 A;  2V50 A;  1P9Q C;  2XMJ A;  2OD4 A;  3NBP B;  2M2B A;  3MEG A;  3V81 A;  2UUB F;  1HNI B;  3WIV A;  1XNQ J;  3HFZ B;  1IKW A;  3MOJ B;  1NPP A;  2MZS A;  2CYY A;  3W7B A;  1YK9 A;  2FGO A;  3UVJ A;  4EK2 A;  1MNE A;  3TZW A;  1FRL A;  2KHD A;  3GP9 A;  3PYD A;  5AE1 A;  2VA2 A;  2CZ4 A;  2BZ2 A;  1X4C A;  3E3X A;  5G4D A;  3NS7 B;  3EGZ A;  5D8H B;  3TNV A;  2XEX A;  4XDC A;  5CH7 B;  3W2W A;  1JNZ B;  1H2T Z;  2MLY A;  3SQG A;  1GTE A;  1PBA A;  2B5J B;  3DOM A;  4M1K A;  5KFC A;  1X9W A;  2O66 A;  2LXF A;  1PC5 A;  1R8B A;  4FF1 A;  4DQR A;  1T9T A;  1UVI A;  3ZTS A;  2HPU A;  3MWB A;  3C66 A;  3QFW A;  4FF4 A;  3DMJ A;  2CAD A;  3L7O A;  4TXS A;  5F8H A;  2ZM6 F;  2FIU A;  2XS7 A;  4W90 B;  4QCL A;  3GCX P;  3M6W A;  2DR8 A;  3IAM 9;  1RAC B;  3C6U B;  4URQ U;  5I3U A;  1Q81 T;  3M9O B;  1RYS A;  3I0R A;  1UPP A;  4MIA A;  5HAN A;  4OYX A;  3MAA A;  4WTY A;  3IRW P;  4KKO A;  1KLM B;  1RHR B;  3K17 A;  3D6T B;  4HI1 A;  4M5K A;  4NLD A;  4DFP A;  1FWL A;  1TKX A;  1RAD B;  3GFY A;  2KT3 A;  4PYD A;  3S1T A;  3TEH B;  2Y0B B;  4OI6 A;  2ADC A;  5HQL A;  1T8E A;  1CLF A;  1MG7 A;  1AUS L;  1H73 A;  1XR5 A;  3MPV A;  1G4C A;  2ZD1 B;  2RKI A;  4NCG A;  2R2T A;  1RBA A;  2C2R A;  3H5S A;  3WBZ A;  1RWO B;  1Y5N B;  2Y8W A;  1XWL A;  5IC4 B;  3OFG A;  1KVK A;  4WBF A;  5L1L A;  3PXG a;  5B0A A;  3SZ2 A;  2HAF A;  2Y1I A;  1NK8 A;  4A8F A;  3HO1 A;  4HR2 A;  4DPY A;  1BC6 A;  2YX7 A;  3EJM A;  1F5C A;  3L95 X;  4EZ6 A;  2J5A A;  4P6Q A;  2D1C A;  2GMH A;  3BR8 A;  2KRR A;  1Y3K A;  4WK3 A;  1RCO B;  2VB6 A;  3FRZ A;  6FDR A;  4KTQ A;  3FSX A;  3PTW A;  1MML A;  3W5X A;  2FVS A;  1S79 A;  1O6X A;  1SQE A;  1WJ9 A;  2V8V A;  3HVW A;  3CJQ A;  2CWX A;  5CAB A;  1SL2 A;  1QLN A;  1W7W A;  3QLH A;  3ENV A;  5HP1 B;  1U2F A;  3CIM A;  1UJ6 A;  2W9B B;  2R8H A;  3AB4 B;  3JAM U;  4ZK7 M;  2F7V A;  4OYI A;  1VJW A;  4QZV B;  1QE1 B;  1SCJ B;  3QFH A;  2HGL A;  3QO9 B;  4NLY A;  4RNM A;  3H40 A;  1UWB A;  2OH2 A;  1C4A A;  2YKN B;  2ZH6 A;  1M5P C;  3DLK A;  1IXK A;  1S49 A;  1EAY C;  1HD0 A;  1VRU B;  2ZDP A;  1BQN B;  2BE9 B;  2C2N A;  2ZJR Q;  2FVC A;  1QVG R;  2KT2 A;  2QEX S;  1HI0 P;  1GX5 A;  2UXD F;  1UCN A;  3Q24 A;  3L9Z A;  1M5S A;  2ZVI A;  3DM2 A;  4DWI A;  3H2V E;  4M5D B;  4KJI A;  1N8R T;  4YQW A;  1OYD A;  1F0X A;  2IFX A;  1RSC A;  4NYZ A;  2O67 A;  3BJY A;  1IBK F;  3J7A 1;  3M2R B;  3R8Y A;  1RAE B;  2QJ3 A;  4PQU B;  4ZPD A;  2B8P A;  3K5M A;  4H4O A;  4J9S A;  4KV8 A;  4FYW B;  1ZPW X;  5HN0 A;  2XO6 A;  3LA0 A;  2J6T A;  2UUA F;  2ZDO A;  2W4C A;  4YP3 A;  1U8S A;  2XYP B;  4DV1 J;  2C2E A;  5CYM A;  3EVW A;  3HVA A;  3OD2 A;  5KG6 A;  3KMS A;  4CLF A;  3Q86 A;  4J9K A;  1OPZ A;  1UAW A;  2C3M A;  4NLR A;  3MR3 A;  2PEB A;  1MU2 A;  2XM3 A;  1F1B B;  1FVS A;  2IYI A;  1HYS A;  3OV7 A;  4FS2 A;  2E9R X;  1PSD A;  2W4D A;  2LEP A;  2KL8 A;  1VQ4 S;  1SH3 A;  3JTP A;  2YNI A;  5E33 A;  3KLH A;  2LCW A;  1RA6 A;  4LVO P;  1S57 A;  4OI1 A;  1IM4 A;  1OS5 A;  1Y10 A;  4V19 X;  1G2E A;  2E29 A;  2HGM A;  2GS8 A;  5A0Y A;  4EGL A;  2YKO A;  2D9P A;  4WFX A;  2CG8 A;  3VGS A;  4QOT A;  3MR6 A;  4E98 A;  2ABY A;  3DI6 A;  3I31 A;  5HQ8 A;  3TI0 A;  4QU7 A;  2C42 A;  2QA4 S;  3MMA B;  1XMQ J;  1S0N A;  4OV6 A;  3KLG A;  2JJ4 D;  2O01 C;  4V1A k;  1TL1 B;  2HHQ A;  1Y7P A;  1HWU A;  5I3P A;  1RT4 B;  5E5N A;  5J2Q A;  5KFE A;  2GGP B;  5H9F K;  2XHW A;  3RB4 A;  4LF2 A;  3AOB A;  3DRR B;  4UT4 A;  2KFY A;  2HKE A;  2VG6 B;  5DRK A;  5KFZ A;  1TKD A;  3KWM A;  1YRX A;  2AIR B;  1MWZ A;  4BBY A;  3J80 U;  5KG7 A;  2GQC A;  4FF3 A;  1XMO F;  3ZZU A;  1X8D A;  2H3E B;  3A1Y G;  2EW9 A;  1HYS B;  4B3M F;  4H4M B;  5ETV A;  3ET6 A;  3CCM S;  1L3T A;  3IFE A;  5HI7 A;  4RLE A;  3TQE A;  1N0U A;  3I56 S;  1J5O A;  1I3O B;  2OEJ A;  2Y1R I;  4IR1 A;  1K0T A;  3GE9 A;  1PAE X;  4LR7 A;  2BX6 A;  4Q2M A;  5JVH Q;  3BF4 A;  2Z8Q A;  1RB0 A;  3UN2 A;  3BBC A;  4F8R A;  2BKN A;  4RW4 B;  4RW6 A;  3QJL A;  1HQE A;  1JJH A;  2BJ8 A;  3CJ3 A;  4UZB A;  3FMW A;  4ECZ A;  2BJ9 A;  3CJ5 A;  3FCV A;  3Q2S C;  2BE2 B;  5ETR A;  2D3O R;  4JV1 A;  1FJC A;  3BR9 A;  2DRB A;  3ZNU A;  3DRS B;  4TY8 A;  2EBG A;  1WKL A;  2AT1 B;  4QWE A;  1VRU A;  3OLB A;  4LFC J;  4I1T A;  1FK9 A;  2LU2 A;  4YN3 B;  4R0E A;  2DJW A;  3NG8 A;  4ZPB A;  1HNZ F;  4PUO B;  2DGU A;  3L4B C;  2K3K A;  1ZET A;  4DX7 A;  2Z56 B;  3VAK A;  4C8O A;  3PO4 A;  4ECT A;  3GSD A;  2VBZ A;  4USH A;  4XTT A;  3T1H J;  3HF5 A;  4F67 A;  3LTO A;  1QD1 A;  4I67 A;  4M5J A;  3M30 B;  3MD3 A;  4O0I A;  2B9W A;  1HQU B;  2BKO A;  3CJ0 A;  1DFD A;  1YDL A;  4QR2 A;  5A8W A;  3UR0 A;  3W9H A;  4C0H A;  4PUO A;  3IA0 A;  1H38 A;  2H54 B;  2HFU A;  2FB0 A;  1C0T B;  1HIY A;  2HVD A;  1QJH A;  3D6M B;  3CCU S;  1NDL A;  2R7O A;  4J9M A;  2DR5 A;  2Q3P A;  4WU2 A;  2JWN A;  4NPO A;  1CJU B;  2BOP A;  2MY8 A;  2HLU A;  5J1E B;  2Y1L B;  2KVQ E;  3N0V A;  5CD4 H;  5KFR A;  2F4V J;  4RW4 A;  4A8O A;  1UPM B;  3T6J A;  3FK4 A;  2GIR A;  2K06 A;  3P96 A;  4GC7 A;  1FO1 A;  2MYF A;  4KHM A;  4DX8 H;  1XNR F;  1FT8 A;  2QN6 B;  2HND B;  3ISN C;  3JSY A;  3NAH A;  3DNC A;  1VK8 A;  3DLE A;  3DDI A;  2JEG A;  5JXS A;  4DR1 F;  1U1P A;  2IIH A;  3AD8 C;  4DV4 J;  1M0S A;  1LWX A;  5KFF A;  1YJT A;  3DGP B;  3OL9 A;  3KHR A;  5LL6 d;  5E7O B;  1B0P A;  3GR1 A;  3MAA B;  4TQS A;  5B08 A;  1KEK A;  1AA1 B;  1UP1 A;  1LFP A;  3GU0 A;  4OZ2 A;  2AZ1 A;  1XMO J;  4ZJQ A;  4M8L A;  2MSS A;  5CCL A;  1NH8 A;  2CPJ A;  1M1K T;  3KLF B;  2AQ4 A;  4ZCK A;  4KE5 A;  1S1X A;  4DU7 A;  1U0H A;  3Q23 A;  2EWH A;  2CFX A;  2YY3 A;  2FVR A;  2YPY A;  3EIC A;  2PA3 A;  3DRR A;  2ZZT A;  3LOU A;  4GC6 A;  3T5J A;  3CPW R;  1O5J A;  2CAJ A;  2F8E X;  1FRJ A;  1SKW A;  1TVR B;  2GA7 A;  2MJU A;  3WHI A;  4AQY F;  5L1J A;  3FFI B;  3EVO A;  1FEH A;  4JI4 F;  1VIO A;  2D3U A;  2HWH A;  5HVG A;  1DJ0 A;  5GVQ A;  1NKC A;  4KGK A;  2QLJ B;  4TYB A;  5IM0 B;  1EKS A;  3GFH A;  2AV5 A;  3C3L A;  5F8L A;  3D4J A;  3UR3 C;  3NWR A;  2VDI A;  4QIF A;  2ASJ A;  1VBX A;  4PWW A;  1SKR A;  1ZAW A;  3RU0 A;  4PG8 A;  2CQP A;  3FEZ A;  3BV8 A;  3EE3 A;  2ILZ A;  1O0P A;  1HMV A;  1ELO A;  1C0U B;  1EKR A;  2MHE A;  2AJ1 A;  4DI6 A;  4RNF A;  3KHG A;  3BSC A;  4K4Y A;  4DV7 F;  1IKW B;  1FDA A;  4OL8 A;  2QL9 B;  5DLG A;  1NCL A;  1ZBT A;  3KDN A;  5CYM B;  1T05 A;  1S0M A;  2LLZ A;  2ZH3 A;  4FXV A;  3VZI A;  2XMA A;  4BWJ A;  2FLL A;  5B0F A;  2FC9 A;  4ZLL A;  4N76 A;  2KM8 B;  3GYN A;  3M1V B;  3DU5 A;  3GV5 B;  2UUT A;  2YWW A;  3GFX A;  3M4X A;  3VTI A;  2ZZN A;  4HI2 A;  4LRC A;  4TLQ A;  4AXJ A;  1YGY A;  2GAH C;  4KPY A;  5U47 A;  1GXL A;  1Q82 T;  2KYX A;  2IJF A;  1N48 A;  2V67 A;  2VON A;  2FYX A;  3DN9 A;  2VFS A;  3I55 S;  2MJN A;  3HSJ A;  3FCH A;  4U9R A;  2B7C B;  4QW8 A;  1N32 J;  3GR0 A;  2RQC A;  3C46 A;  1UVM A;  1RT1 A;  2DNL A;  4IYQ A;  4PWU A;  1LWE B;  4CLW A;  5KG2 A;  2XQC A;  3HM9 A;  3U02 A;  2Z2Z A;  1VC5 A;  3FNN A;  4LF5 F;  3W3S A;  2XS5 A;  1Z1Z A;  4Q45 A;  1N5Y B;  3Q8Y A;  2MKK A;  4XPC A;  1AFI A;  3SMZ A;  1Q4R A;  2IY5 B;  1RTZ A;  2W9B A;  2YQ0 A;  5FDL A;  2DTJ A;  5D0H A;  2VC0 A;  2W7O A;  3E8O A;  4RBT A;  3HT3 A;  5KFN A;  3BGF A;  2YH0 A;  2U1A A;  1X4B A;  5ETM A;  3OR2 A;  3AJ2 A;  3TA0 A;  4DSE A;  4DF4 A;  2B7B B;  2XMK A;  1FWP A;  1AT1 B;  1MN9 A;  1JXL A;  4X66 J;  4MK7 A;  3JSR A;  2R7Q A;  3QNW B;  3U7J A;  3EUN A;  2OPQ B;  3MR5 A;  5M2R A;  4ZVR B;  1LWE A;  1CJV A;  1MWY A;  3GTY X;  5K8P A;  3QZ8 A;  3RBZ A;  2VJV A;  4NYP A;  3AXM A;  3QAE A;  5B0E A;  1FXD A;  2VU5 A;  2F65 A;  1Q0N A;  2NXJ A;  4P73 A;  3GV7 B;  1LK7 A;  1JKH A;  2QRR A;  1XEZ A;  4X84 A;  4Y65 A;  4DPW A;  3NNC A;  1FDB A;  3PRV A;  4ZJL A;  3H2U B;  2LQ9 A;  3D7S B;  3V2U C;  1V3R A;  5AJ3 J;  4DU8 A;  2PE8 A;  2VKZ G;  1TKT A;  3TZX A;  4UY8 5;  3DOK A;  2R7U A;  2AMC B;  1RP5 A;  1RTD A;  4KKO B;  3BN7 A;  3KK1 B;  3TVY A;  4DS5 A;  1YJW S;  1AYE A;  4FZV A;  2YNH A;  4IH6 A;  3JXO A;  1IJE B;  4WXW A;  4CLL A;  1AZS A;  3FEX B;  2X51 A;  3OBI A;  5KFK A;  1Q86 T;  4ED5 A;  4DL0 C;  1YZ6 A;  3CO9 A;  3FKB A;  3CJK A;  1Y3J A;  2QLF B;  5B09 A;  3HD2 A;  4JI1 F;  3RBE A;  1JLQ A;  2OPP A;  2MQL A;  3C15 A;  3MOZ A;  5E41 A;  4DR2 F;  1YBU A;  3UDV A;  3W5Z A;  4JI6 F;  5K8N A;  3BRE A;  1S9G A;  2NUU G;  3TX0 A;  5DM6 Q;  5GAH I;  1IUJ A;  3QJP A;  3BGL A;  5C24 B;  4P2F A;  2VG5 B;  1OY6 A;  2V8D A;  1NXI A;  1W25 A;  3LP0 B;  1JXV A;  4KC5 A;  4DV0 F;  3OR1 B;  4IFY A;  4MAK A;  3DLJ A;  4Y2I A;  3DOM B;  2KU7 A;  3B6B A;  3I9Z A;  4HT7 A;  4MIB A;  4IRC A;  4ED0 A;  2JVR A;  2M4M A;  4LFC F;  4QU6 A;  1K0V A;  3FFI A;  4LBH A;  2BA9 A;  4JBC A;  1DTT A;  2L3M A;  3GZ7 A;  4TVA B;  4D3G A;  3CJ4 A;  4Q8F A;  1UTA A;  3I82 A;  2XMU A;  3W1Y C;  3DGV A;  5LJ5 Y;  5J2N A;  2OHD A;  4OJG A;  3UNG C;  4NZ0 A;  1JLB A;  2DGT A;  2BJ7 A;  2HZA A;  3OR2 B;  4ECW A;  3M6X A;  1J5E J;  1RT6 B;  3FSY A;  4IUF A;  2AJ0 A;  1DAR A;  3V5R A;  4DR3 J;  2K7J A;  3MEG B;  1TKZ A;  4AE5 A;  2B3T B;  3PFE A;  2ACY A;  4OX8 A;  1S10 A;  5GAE U;  1RXO B;  4AUK A;  1N5Y A;  2LYV A;  5EX3 A;  3GJQ B;  4PPZ A;  4DR5 F;  1HI8 A;  2KB2 A;  2EC0 A;  2E5G A;  1WHV A;  4CI0 B;  3VAI A;  8ATC B;  2BKP A;  4ELT A;  3GG1 A;  4RUH A;  1R0B G;  4Q0B B;  1I5O B;  3EGN A;  1ICE B;  5E3C A;  2LDY A;  2R4F A;  3QBC A;  1CS4 A;  1JLF B;  1OY8 A;  2J8S A;  2V4J A;  2H5I B;  2HSE B;  3EVM A;  4DHV A;  4KBI A;  5IV4 A;  2HEK A;  5DQG A;  2RS2 A;  3PW5 A;  2ASD A;  1RAB B;  5KFO A;  1N33 J;  3P45 B;  1YIT S;  4K4Z A;  3RR8 A;  1RU1 A;  1B64 A;  2C2O B;  2DNK A;  2IVM A;  3D0G E;  3LQV A;  4OZN A;  4W4M A;  5F0W A;  3G82 A;  3PW7 A;  3MPY A;  1TFW A;  2VG7 B;  1NJX A;  2HNY B;  2M70 A;  4F26 A;  2V9K A;  3Q8P B;  1VR6 A;  1VI7 A;  4P10 A;  2VQE J;  1BHN A;  4EBC A;  1HHT P;  3K0J A;  2MEW A;  4GO5 X;  2HYI B;  4F2S A;  4TU7 A;  4WCE Q;  4F7V A;  1WHY A;  1VQ9 S;  2V68 A;  2ILY A;  4H4M A;  3M30 A;  4LJM A;  1ZM2 A;  4P2S A;  4BC9 A;  2FPH X;  4OZL A;  1S1T A;  1D8Y A;  1TV6 A;  1VCT A;  4QBU A;  2QG9 B;  4CZC A;  1AXQ A;  2CQ4 A;  2K8G A;  2RJZ A;  3LAK A;  1FCA A;  3MM9 B;  5LSR A;  4KGX B;  5J2M B;  4JI0 F;  1D1U A;  3US5 A;  3G6Y A;  2QSW A;  3M32 A;  3M2V B;  4CLK A;  1U45 A;  1OMS A;  1U1L A;  5KTQ A;  1R31 A;  5HLF B;  3P5B P;  4WKY A;  5E3P A;  3TA2 A;  2XSJ A;  4AL5 A;  1T03 A;  3DRP B;  3KUH A;  3MMA A;  2W1B A;  2XGP A;  4NA3 A;  1R89 A;  2BQ3 A;  4K4U A;  2AU0 A;  2MZR A;  1BXN A;  4K0K J;  3DCA A;  2RRA A;  3M2V A;  3HT0 A;  3TO8 A;  4LSL B;  3POT B;  4RBU A;  2J6U A;  3JTN A;  1O51 A;  3JQM A;  2NPF A;  1Y0H A;  4UUX A;  4DLE A;  5CXT A;  3RB0 A;  1FWK A;  1HI1 A;  2YNG B;  4FYV B;  2YNI B;  3KLH B;  4EUV A;  4GKK F;  4O3R A;  3C14 B;  2N4D A;  4DPX A;  1FKO A;  2R8J A;  2KYZ A;  2VIH A;  4QR0 A;  1MU2 B;  2BRL A;  3ET6 B;  4CLY A;  4DR2 J;  1LV5 A;  4B9T A;  3CIZ A;  2R9L A;  3PX6 A;  2W24 A;  4IKA A;  5ETS A;  5HMY A;  1NK7 A;  3OFH A;  2GMJ A;  2RRB A;  3TEG A;  2DR9 A;  2YBV A;  1FNO A;  5ETO A;  3QQC D;  2HHW A;  2AEJ A;  4G65 A;  3RAM A;  2KJW A;  1N36 J;  4P2M A;  2XHC A;  2FQQ B;  3M2R A;  3PW4 A;  5RUB A;  2GQ2 A;  2DXE A;  5LMN J;  2BW7 A;  1RHK B;  3PJW A;  2VOD A;  4Z37 A;  2YPZ A;  3RJM B;  4ES2 A;  3G9C A;  4DLG A;  2DRA A;  1VS3 A;  2HWT A;  1RTJ A;  4LSN A;  1AFJ A;  5F41 A;  4AT1 B;  3H98 A;  2Q6B A;  3NLC A;  4RNH A;  5IOL A;  1BQN A;  1TL5 A;  1YWX A;  3NRB A;  2YWH A;  4U96 A;  1T9W A;  3LWL A;  3VGT A;  4A8Q A;  1OSD A;  3CF5 Q;  1YRT A;  3A13 A;  4USU A;  4G6V B;  2XTJ P;  2MTL A;  4BC7 A;  4X4P A;  4FPR A;  4OX6 A;  3JYT A;  3MM9 A;  5K9F A;  4C8M A;  3M8P A;  1S1V B;  5DDR C;  3SFU A;  2HHU A;  2RUG A;  4F4Z A;  2BJE A;  2HS0 A;  1URN A;  4WFN Q;  2D74 B;  3PFO A;  1IBM J;  4I2P B;  1SC1 B;  1JLB B;  3R97 A;  1H2V Z;  1K1S A;  1XR6 A;  4ZLP A;  3AH6 A;  2V2Q A;  4U6P A;  3PW2 A;  1QAI A;  5T7L A;  4LRF A;  2AF6 A;  1NK5 A;  1HR0 J;  1EQM A;  2QV6 A;  2W2Q P;  2FLO A;  1VK3 A;  4DS4 A;  4DSL A;  2CJA A;  1R43 A;  1VRT B;  3KLI B;  4DZ6 A;  2CPE A;  2IYG A;  3ISN D;  4DL7 A;  1JWW A;  1BQX A;  2DR7 A;  3D67 A;  1U24 A;  1FDD A;  1WOO A;  3DM2 B;  1U48 A;  1NSQ A;  2MB0 B;  2DGW A;  3U1M A;  2CQ3 A;  4J9N A;  1ZYQ A;  3TJA A;  2QA4 G;  1KHV A;  2CQD A;  3MFH A;  3AXK A;  3OL7 A;  1GQE A;  3DLK B;  1TKX B;  3PX4 A;  2EG1 A;  4RWW A;  1TMJ A;  3HZG A;  4LUB A;  1J5O B;  3DOL B;  4B3R F;  1R6Y A;  2IM1 A;  4FN5 A;  1JLQ B;  2DCL A;  2MY7 A;  5GME A;  5HAO A;  3R7N B;  3LO3 A;  5F3T A;  2CQ0 A;  4E2F B;  2MKH A;  1S1W A;  4NA1 A;  2XO7 A;  2RDJ A;  1NME B;  3B78 A;  1Q8B A;  3ICL A;  2YNH B;  1RLD A;  5E3Q A;  3RRK A;  4DFJ A;  1X0F A;  3R5J B;  2AJ2 A;  3CE8 A;  3T5H A;  1SB6 A;  2NXU A;  2VG6 A;  1FDN A;  4OI2 A;  5ETN A;  4DV7 J;  3V4M A;  4FXW A;  2WVD A;  2R42 A;  2NR0 A;  1U26 A;  3M8Y A;  2DCU B;  2E66 A;  3NCR A;  5ETQ A;  2FUG 9;  5DS7 A;  3GB0 A;  5DZ7 A;  1VIX A;  4DEZ A;  2DY1 A;  3E01 A;  1SH2 A;  1NH7 A;  2VPY B;  4NLO A;  3UE2 A;  4MKV A;  3DI6 B;  5K8O A;  3T6B A;  3CCV S;  2J76 E;  1V6H A;  2J7U A;  2XGQ A;  1SBR A;  3SV4 A;  3W2W B;  1MLA A;  2OEM A;  1U1R A;  1WF2 A;  4DV0 J;  3A8J A;  3VAJ A;  1F5B A;  3N6L A;  4KH0 B;  2E1R A;  5L39 A;  4M94 A;  1IWG A;  4JV2 A;  2HHH F;  2R8G A;  3DLH A;  1ITP A;  5F9N A;  3I0R B;  4KPC A;  1VFJ A;  5F8M A;  2AKW B;  3N5F A;  4ECR A;  2IM3 A;  3MPU B;  4TNO A;  1A7G E;  2W2M P;  1REG X;  2C3U A;  3GYG A;  3LW5 C;  4X4V A;  3IGV A;  3ONQ A;  4IFV A;  1NSP A;  4ZA1 A;  4NLU A;  4NLT A;  4KHR A;  4MYU A;  2JOQ A;  4C97 A;  5BJR A;  4KV8 B;  4YY3 F;  2CQG A;  1SUQ A;  2OO4 A;  3W63 A;  5ETK A;  4MKA A;  3PEH A;  3ITH B;  2QL7 B;  3D54 A;  3JQJ A;  1QAX A;  2H5E A;  5H9E J;  4LFB J;  4JV5 F;  1F60 B;  2KH9 A;  5DGB A;  3QT8 A;  4NLX A;  4AXI A;  2ASL A;  2NPI A;  1HNX F;  4NRT A;  1I94 F;  4X2B A;  1G7C B;  3AB2 B;  3G86 A;  5D3G B;  2VH7 A;  4YY3 J;  1N5Q A;  3RR7 A;  1CJV B;  2V2V A;  5KT5 A;  4CTA A;  2JFD A;  4ZPW R;  2V5H G;  2F4V F;  3SCK E;  4Q43 A;  3PW0 A;  1FER A;  4AND A;  3QO9 A;  2NSB A;  4DUY J;  2CZV C;  2J9D A;  5KFV A;  1Q5V A;  4M5I A;  1VQ6 S;  1IM6 A;  1WHW A;  4F3O A;  3QIP A;  2AWZ A;  2IVY A;  2ZVS A;  4XPE A;  3LWM A;  4C2M A;  4B02 A;  3M9M B;  1QTN B;  1CJT B;  4MH8 A;  4ZDN A;  2R7S A;  3SCI E;  4OYA A;  3V6H A;  2WON B;  2W9C B;  2FJX A;  1LWF B;  2F4F A;  5KFD A;  4JI0 J;  3AQP A;  4K0K F;  2XB2 D;  3DFE A;  4QWA A;  1TP7 A;  3ZFV A;  3AA8 A;  2X1F A;  2ZH1 A;  2EFN A;  1VC0 A;  3K58 A;  2P6S A;  2MHN A;  2UZA A;  5EWF A;  1A9N B;  3P8B B;  1UEK A;  4ECX A;  3T1Y F;  1OYE A;  2JLF A;  3CMA S;  1WDD A;  2BE7 D;  4DCP B;  4DX5 A;  4CIO A;  3NY0 A;  4J9P A;  1VBK A;  5K14 A;  1HNW J;  3IWX A;  4WZQ A;  5D4O A;  3HP6 A;  1KN6 A;  2DIT A;  5IWA J;  1VHF A;  4OHW A;  5L1K A;  3ITH A;  2G2Y A;  2R2U A;  2LQJ A;  3CNQ P;  5KFQ A;  3IG1 A;  1RE1 B;  4AD6 A;  3ADA C;  4YB5 A;  4ZPV R;  1ZAV A;  5DG9 A;  1TK8 A;  1KS2 A;  2BV3 A;  4P74 A;  4USV A;  1N6Q A;  1J5E F;  4DJB A;  2DXF A;  4IFV B;  2LKZ A;  1NLK L;  4ANC A;  4EFA C;  1T05 B;  3C6U A;  4HEA 9;  4X65 J;  2RE1 A;  2KM8 C;  1S6P B;  3QT7 A;  2QTW A;  4D3H A;  3E51 A;  1U2R A;  2FZK B;  4EMD A;  1YIJ S;  1WEL A;  2YKM B;  2HLT A;  3KHL A;  1FKO B;  1M1G A;  4J9L A;  2PMH A;  1UFW A;  3R9L A;  2CA9 A;  2DO4 A;  5SZT A;  3DDN A;  4PG5 A;  2I1R A;  1RA7 A;  5KFB A;  1VQN S;  4OHX A;  2ZE2 B;  5KAK A;  5LMU F;  4PWD B;  5HMW A;  3PAC A;  1RT7 A;  1FVQ A;  1Y5I B;  1UKU A;  3IWL A;  4PPD A;  4DV5 F;  2DD8 S;  1E6V B;  2RNE A;  3BPD A;  3VVU A;  5L8R C;  4U7U K;  1QSS A;  2ZWO A;  1CJU A;  3O3L A;  3E01 B;  1UVN A;  3FQL A;  4FPI A;  1WEZ A;  2MKJ A;  5C7P A;  5A2Q U;  3VQS A;  1X9S A;  1R0A B;  2ZZM A;  1S6U A;  3R5C A;  2DNO A;  3T9Z A;  3AQO A;  1KWM A;  1EX8 A;  4B9N A;  2HVZ A;  3HVT B;  3T9N A;  2CQH A;  2I38 A;  2OSQ A;  4M63 A;  5A8W B;  2ZM6 J;  4FBT A;  2MLX A;  2Q79 A;  3NXZ A;  1BLU A;  1U09 A;  1DZ5 A;  3HI9 A;  1TV6 B;  3KLF A;  2WW4 A;  3R2D J;  2ZBI A;  1T3O A;  2A18 A;  1DTQ B;  2J0W A;  1S6O A;  2XG8 A;  4DV3 F;  3M8Z A;  4DXL A;  1SVD A;  8RUC A;  4M5H A;  2N82 B;  2XBP A;  4FS1 A;  3J7Z T;  3D0I E;  1RHQ B;  4DX6 A;  2R7W A;  3UCU P;  2Y0S D;  1S59 A;  4KH1 B;  1MW7 A;  2CPZ A;  2Y3Y A;  5AE2 A;  5EWG A;  1LFW A;  3PO5 A;  4JOU A;  6FD1 A;  4HLB A;  2B4P A;  2AYB A;  2F9D A;  4F0M A;  1F9F A;  2CJ9 A;  2ZC3 A;  3RRH A;  3VV2 B;  2IRU A;  2E1M C;  1RU2 A;  1S1U B;  3UN5 A;  1IKX A;  5E3R A;  4F36 A;  1UWA A;  2G4B A;  1VRT A;  3KLI A;  3I0S A;  4S0M A;  5H9E K;  4Z2X A;  5HL7 Q;  2IPO B;  5HRO B;  1RT5 B;  2RUS A;  4G1Q A;  2UXD J;  2DB1 A;  1O8B A;  4OYM A;  1H7X A;  1RTI A;  5I42 A;  1GEH A;  4PAA A;  2HRU A;  3TYT A;  1RTH A;  1KTQ A;  2XNR A;  1UA0 A;  5FII A;  2HFN A;  4IQX A;  2EC2 A;  1YJ9 S;  4C8Y A;  1TKZ B;  5LXY A;  1N88 A;  2JZ5 A;  4F0K A;  2F8H A;  1RT6 A;  3HZE A;  2JL9 A;  3W64 A;  4PG6 A;  5KFW A;  1UW4 A;  1Q95 G;  2BUN A;  2MLZ A;  2XI2 A;  4ES1 A;  3SYZ A;  5F0U A;  4LF4 J;  4IOB A;  4LSL A;  2V4Q A;  1LKZ A;  2VUG A;  3MEK A;  2ZWP A;  4GVB B;  4CO4 A;  1XMQ F;  1U1K A;  2FVQ A;  3MM7 B;  4ZCM A;  3MM8 B;  2FJE B;  2I8E A;  3VAG A;  3KLG B;  2BE2 A;  5LOQ A;  2CPX A;  1PIE A;  3U1N A;  4ID5 B;  4N8O A;  3WQP A;  1U4B A;  1YLX A;  1QTM A;  4I69 A;  1GXU A;  4M95 A;  2KKH A;  4ZJO A;  2W9A A;  3M2U A;  1XR7 A;  2ROG A;  3MM6 B;  3MMC B;  1FRX A;  5A0Y B;  5B0B A;  8AT1 B;  5KT6 A;  1KC8 T;  1RT7 B;  1TUG B;  3J7Y U;  1SJ4 P;  1N32 F;  1EZZ B;  3OTD A;  3KYL A;  3M6V A;  2ZE2 A;  3LAL A;  4ECQ A;  3T3F A;  4ER8 A;  2MQO A;  1Q7Y T;  5B0D A;  3LH2 S;  2VDH A;  4OZ0 A;  1B3T A;  4C0O C;  1YG0 A;  4WFY A;  1GAO A;  3AD7 C;  4M5G A;  1D3W A;  2CPI A;  2CQB A;  2P8I A;  4JI7 J;  2JH3 A;  3M05 A;  2ZH2 A;  1REV A;  1UL3 A;  3F41 A;  3ILL A;  3GIK A;  3QT6 A;  4GKJ F;  1D9A A;  3ZZY A;  3QRR A;  1VJQ A;  3K7R A;  3KXD A;  2JLE A;  5KFT A;  2XS2 A;  3BSO A;  1IR2 A;  1F9H A;  2K1R A;  2AEF A;  1JLE B;  1MMD A;  1HWJ A;  1TUW A;  1WD6 A;  2PD1 A;  4AFF A;  4XO0 A;  1ZZF A;  4PQU A;  4LFB F;  1LK5 A;  1Q1K A;  2DYA A;  2FGC A;  4I7F B;  3M2U B;  3F73 A;  3MXH P;  1T0T V;  1JQG A;  4JI8 J;  4ANE A;  1RT3 B;  5K8M A;  3CJS A;  3DDK A;  2VPW B;  3HHL D;  2VA3 A;  4E8U A;  3A12 A;  2MKY A;  2VL1 A;  4URS A;  2E7V A;  5D4P A;  5AXL A;  4OZ1 A;  2MGZ A;  4X62 F;  3G96 A;  2FJB B;  1K8A T;  1QE1 A;  3CJT A;  2QZ8 A;  4J9V A;  2HQF A;  3T19 A;  3V4I B;  3T5L A;  3L7U A;  4NLQ A;  2X3G A;  1S1T B;  1K9M T;  3I5A A;  3MCN A;  3M8S A;  3HHE A;  1XMB A;  1F6T A;  5HAT A;  1H7W A;  4DV6 J;  1NJI T;  1A6L A;  2ROE A;  3NS5 A;  4WP8 A;  3TUJ C;  3LP1 A;  3IO1 A;  1B70 B;  4CNZ A;  3GWC A;  3W2V A;  1HBM B;  4TU9 A;  5F8N A;  3OSN A;  3TAR A;  2MDA A;  3MMB A;  3AA9 A;  4PXE A;  3EMT A;  4PXB A;  1DTT B;  1EIY B;  4O3Q A;  3H20 A;  4KHP F;  2ZBQ A;  4TN2 A;  2VFT A;  3IM8 A;  4Y2M A;  5BR8 J;  3KK2 A;  2RQ4 A;  2GAG C;  2XMT A;  4ICL B;  3SQO P;  5CYJ A;  4CLU A;  3J7Y I;  2XC9 A;  2LQ8 A;  3LP0 A;  2QE5 A;  4CO2 A;  4QYR A;  2MQM A;  3RAX A;  2OFH X;  2ZH8 A;  4FYD A;  5MAO A;  4C11 A;  3Q8R B;  3ZXW A;  3HXM A;  1R3N A;  1TL3 B;  2X3D A;  3H42 A;  4OYB A;  4IOC Q;  2HFZ A;  3BDP A;  1HNW F;  4TYA A;  2OPP B;  3MPD A;  1HWK A;  4KQZ A;  2V4R A;  1HNZ J;  2W2O P;  2CJQ A;  1UJ5 A;  4W98 A;  3CJK B;  2G2O A;  2K3I A;  1YRU A;  2DH8 A;  4HAC B;  3CC4 S;  1NB7 A;  1FE0 A;  4Y2K A;  2DNP A;  1LNQ A;  4NML A;  3OVB A;  2ZOF A;  3R3T A;  3RB3 A;  1C0U A;  1IBM F;  4CO0 A;  4JI3 J;  1SXL A;  2CUY A;  2KHC A;  2I6W A;  3NS6 A;  3GV8 B;  3P6Y C;  2CPD A;  2AX0 A;  3FCW A;  2QL5 B;  4FDF A;  5J2N B;  4DL5 A;  4DL4 A;  5HJY A;  4IO1 A;  3KNA A;  4LVN P;  3K5O A;  4IR9 A;  1CC7 A;  1RAJ A;  3DHW C;  2H5J B;  4OZ3 A;  4H4K A;  1RWN B;  4ZVT B;  3GJT B;  3HHL B;  1D0E A;  1GTH A;  2D3O 1;  3TWZ A;  3W9I A;  3CME S;  4F4X A;  3I6P A;  5F9L A;  1E6V A;  5GAD U;  2JEI A;  2YXL A;  2KRB A;  2ZD1 A;  3MAQ A;  3CC7 S;  1TZ0 A;  1KDN A;  2B6A A;  3CDB A;  4OI4 A;  5LM7 E;  1S4E A;  4DN9 A;  3VAH A;  1WC0 A;  4UQG A;  3NCP A;  4ZVF A;  4R8U B;  2HIY A;  1D09 B;  2L9W A;  3LGN A;  1U0H B;  5DZ6 A;  2OD6 A;  3CD7 A;  3K8V A;  4NLW A;  3VVT A;  3ZZP A;  4K4V A;  5E3A A;  3N4W A;  4QPX A;  1U7L A;  2C2Z B;  2HHP A;  1PIL A;  2V6A A;  1LEO A;  3OT9 A;  2CXE A;  4HAC A;  2VHG A;  4CM2 A;  2OIH A;  4I6Y A;  3RZA A;  4KT0 C;  4ERD A;  3O2I A;  4HHH A;  4LIW A;  4A8W A;  2XWY A;  1PAU B;  4U8Y A;  1NBE B;  1TMM A;  3FBC A;  1VC6 A;  3R5G A;  3R6L B;  1IKY A;  3RRG A;  3A8E A;  4ZLJ A;  1PO6 A;  1Q16 B;  4N5S A;  1TL7 B;  4F4Y A;  4CO1 A;  2H48 B;  4QPT A;  5IQQ A;  2YQ1 A;  3TX8 A;  4WE1 B;  1R8H A;  2XY6 A;  5J1P A;  1NB2 A;  2EKN A;  4PZV A;  3B4M A;  1A0O B;  3A3O B;  2GZO A;  3DU6 A;  3TJ9 A;  1TQL A;  4XIU A;  2IHR 1;  4I68 A;  4WII A;  1XIQ A;  4X4R A;  5KFU A;  1X4H A;  4KAI A;  3R2C J;  1VYA A;  3A4T A;  4ENO A;  5KOW A;  3B82 A;  4H4K C;  4PEO A;  1XER A;  2IAJ A;  1J27 A;  2VBW A;  1HWL A;  2WK4 A;  3GYX B;  1WC5 A;  2M7S A;  3H90 A;  4ITS A;  3IS9 A;  1ZZN A;  1B4S A;  3KFW X;  1YBA A;  3SXL A;  3ZZT A;  4F4K A;  2J0S D;  1NND A;  4HDH A;  2Z0G A;  1M5O C;  3BM7 A;  1M1H A;  5JUM A;  3G6V A;  2R7V A;  1KON A;  1RWP B;  1B99 A;  1M90 T;  1HW8 A;  4FNH A;  3GIR A;  3FEY B;  3LF0 A;  3CDE A;  4ZP6 A;  3J81 j;  3V4I A;  4AL6 A;  1UMJ A;  1TK0 A;  4IRD A;  4LR8 A;  3K57 A;  3PM9 A;  1M5V C;  3N6M A;  3OTE A;  1WTF A;  1GMW A;  2A3J A;  1RAO A;  3I96 A;  1SIW B;  3B4D A;  4RW7 A;  3I4H X;  4CM0 A;  4CLP A;  3OVS A;  4DV1 F;  2RSQ A;  2RD5 C;  1FF2 A;  1FEE A;  4EYI B;  2XCP A;  2P9G A;  1U02 A;  1RIS A;  3BS9 A;  4YR3 A;  1WG4 A;  2A10 A;  1RAF B;  2KN4 A;  1ARO P;  2L48 A;  4CLT A;  2Y1J A;  1FNX H;  3G6X A;  4B17 A;  1C1C A;  3K8W A;  3CMQ A;  4MJK A;  2HBZ B;  3MZI A;  1WOP A;  1FRK A;  1SPB P;  3HDS A;  2ZUA A;  1WUU A;  1FFW B;  3KG0 A;  2APO A;  2E1A A;  4O4G B;  2PA8 D;  3SBM A;  4EO6 A;  2ZKU A;  2CQ2 A;  2Z2L A;  4ED8 A;  4BHQ A;  3BGO P;  2NS1 B;  2ZUG A;  2UV8 A;  3RTV A;  1NK9 A;  4C4W A;  3ILI A;  5IT9 U;  2CVI A;  4DR7 F;  3LPY A;  3CCJ S;  3F56 A;  2B43 A;  4WU3 A;  3I5B A;  2VBY A;  1X5T A;  4ZIV A;  1BUX A;  3C6T B;  3QWP A;  3S01 A;  3MUM P;  3DYA A;  1VQS A;  2FHK A;  2HRY A;  3H59 A;  3M7V A;  1R7I A;  2HFS A;  4B08 A;  3ZZR A;  5FLX Y;  2MGZ B;  2UVV A;  4WZM A;  2ZJQ Q;  1F3F A;  4WP9 A;  5IM0 A;  4OQJ A;  3CC2 S;  3OTC A;  2K7K A;  2VJU A;  3RAQ A;  2BQR A;  3SDE B;  1TL1 A;  2Z2Y B;  2ACM A;  4ID5 A;  4EEY A;  3QZ7 A;  1S77 D;  2QA2 A;  4O3N A;  4LF6 F;  2HIQ A;  1BWV A;  1P1T A;  1P8G A;  5HSP A;  3QYY A;  2HVH A;  4RNO A;  3S6E A;  2VD3 A;  4ATN A;  4NAS A;  4RUB A;  1D8Z A;  1OY9 A;  2GJ2 A;  5DET A;  3W8P A;  1WF0 A;  3ZTQ A;  1YJN S;  1H74 A;  1HQU A;  1TL4 A;  2M0G B;  2H9Z A;  3ETO A;  1IBK J;  2DGO A;  4DUY F;  4OFZ A;  2V0N A;  2XYH B;  2Z57 B;  4ZVS B;  5KFS A;  4B3R J;  2PDA A;  1CSJ A;  5ETP A;  2DH9 A;  3GPA A;  4ZHR B;  2AGP A;  4LF5 J;  2L9D A;  4DR5 J;  2P9E A;  4A8X A;  2CWK A;  2X1G A;  4CH0 S;  4K8R A;  4OYW A;  1E6Y B;  2YWG A;  3CD5 A;  1S9F A;  2ZNZ A;  1NUE A;  1FK9 B;  2V8G A;  2WVC A;  4HTI A;  4J5O A;  4K59 A;  3A3P B;  3FMB A;  3QGH A;  2KZM A;  4NWB A;  3G82 B;  2EFP A;  4DV5 J;  5HRO A;  2KXF A;  4GO7 X;  3HJV A;  1DLO A;  4RKU C;  3KLE B;  2IMO A;  4NZ7 A;  2DPI A;  5C5J A;  2LQ5 A;  2NYH A;  3I9V 9;  4IDK A;  1BY9 A;  5A2Q Y;  3MCS A;  4RW6 B;  5J1E A;  2ZIT A;  3R7B B;  1KQK A;  2FTR A;  4DSI A;  4OHV A;  4N41 A;  2FHJ D;  1VLY A;  2V4J B;  3I87 A;  1JLG B;  5BYQ A;  3MM7 A;  3TQ1 A;  3OQ2 A;  3IBC B;  1OSC A;  4DL3 A;  2UVR A;  4RX6 A;  2ADB A;  1X31 C;  1TFY A;  4MYT A;  4A8K A;  1EHW A;  4NXN F;  3MR2 A;  3MF5 A;  3MR7 A;  2H1Y A;  3NP5 A;  3MEE A;  5AXK A;  2BJ3 A;  1WC6 A;  2BOA A;  2JC1 A;  3SFG A;  4BLG A;  1DTQ A;  1UA1 A;  2EG2 A;  4L3N A;  5A8R A;  4YHH F;  5DO2 A;  4CO3 A;  1PBU A;  1CQN A;  3EXY A;  5IV3 A;  1RTH B;  3OLA A;  2DK2 A;  4P9S A;  2E5H A;  4PR6 A;  3BGU A;  1RTI B;  1U0S A;  4FP9 A;  2F9J A;  3KLV A;  1DAX A;  2HHV A;  5JMN A;  1DRZ A;  3ZC4 A;  5J2Q B;  4UY8 T;  2CPY A;  2YVS A;  1LXJ A;  1V3Z A;  1T9V A;  5KT3 A;  4DV2 J;  1NKB A;  1W2I A;  1CJK B;  1MSW D;  1RTJ B;  2WB1 D;  4LSN B;  2GV1 A;  2HBY B;  4C48 A;  4B3S J;  5IT9 Y;  1NK0 A;  4YDD B;  1S1U A;  3NOC A;  3T5K A;  1NPK A;  3TUI C;  3ILJ A;  3EZU A;  4MFB B;  4CH1 A;  1I94 J;  1FJE B;  2HHX A;  2PSZ A;  3KJN B;  3HUL A;  1RAH B;  2M8D B;  5KFY A;  2P9C A;  2LXI A;  3N28 A;  4G1P A;  4L72 B;  1NDC A;  3FRY A;  3TJ8 A;  1YJR A;  2BM0 A;  1KLM A;  1KLN A;  4ZLN A;  2ZHA A;  1HKA A;  1RHJ B;  4KO0 B;  4G3I A;  2E9Z A;  4KHP J;  3IC1 A;  1EJ7 L;  2E44 A;  3TOQ A;  4YME A;  4QW9 A;  4QJV A;  3NCQ A;  3TAN A;  1RYR A;  1VQ8 S;  3A8K A;  4DFM A;  4G1I A;  4PQA A;  3JAM Y;  3CCL S;  3HVR A;  3Q8U A;  3P49 B;  1P27 B;  4LFA F;  1Q53 A;  2BEF A;  5EDW A;  2PFD A;  3Q8Q B;  3KK1 A;  4IG0 A;  3EPI A;  4ILL A;  2HHT A;  1X0P A;  3MCM A;  3FBE A;  1H0H B;  2A6M A;  3GIJ A;  2IBK A;  3S8S A;  3CD6 S;  1FNM A;  2PO4 A;  2E7W A;  3PV8 A;  2RU3 A;  5C2G A;  2DNQ A;  4RU2 A;  1VQ5 S;  4WYL A;  4DQI A;  3Q8V A;  1QY7 A;  3IRX A;  3KJV B;  4ED2 A;  4OV1 A;  2D41 A;  4UOF A;  4DR7 J;  1FTC A;  1ULR A;  2LQB A;  3G8Q A;  5HBM B;  4DQS A;  3QSY B;  2FJV A;  4X4N A;  2HQI A;  2R8K A;  2G0I A;  1SC6 A;  3CD0 A;  3M32 B;  5KFJ A;  2VIC A;  1K44 A;  1KHW A;  5F8J A;  3L7P A;  3UW1 A;  4W92 B;  2EFV A;  2RQK A;  1S97 A;  1BGX T;  1JLA A;  4HT5 A;  1PCA A;  2EFQ A;  2W01 A;  2XLJ A;  4C8N A;  4NLV A;  3I5C A;  2DVI A;  4OI0 A;  3PYF A;  4ZVO B;  2B9E A;  2WON A;  4X4O A;  2W9C A;  2EI5 A;  3NGR A;  3JSB A;  2DNH A;  3MDF A;  1TAQ A;  1U2C A;  3OTO F;  1S99 A;  2ZFH A;  3X3U A;  4OLO A;  4EBE A;  4ECV A;  2W25 A;  3IS9 B;  1KOO A;  3TZY A;  1G3O A;  3QGP A;  3BB5 A;  1HW9 A;  2OMO A;  3RW7 A;  1WC4 A;  4ID8 A;  2VOP A;  2HNY A;  2J0X A;  2ZEJ A;  2KO1 A;  3BDE A;  4CNY A;  5KFM A;  1X4A A;  1YJ7 A;  4GMK A;  1C1C B;  4MT1 A;  3W61 A;  1N33 F;  4I6W A;  1S7I A;  3K5P A;  3QGG A;  4CRJ A;  3SEO A;  3PR4 A;  4WIQ A;  1EAR A;  4LRE A;  4LBI A;  4J7C A;  4UOH A;  2FVP A;  4AMP A;  4LR9 A;  5GAH U;  3OL6 A;  1FKP B;  3UN3 A;  2FC8 A;  2XSF A;  2RKI B;  1GX6 A;  3ISZ A;  2F3J A;  2VV5 A;  4U95 A;  5DDO C;  1W2B R;  1Q8I A;  1XNR J;  3AOD A;  2GVZ A;  4OIX A;  1TK5 A;  2C3O A;  1Q79 A;  4ZN1 A;  2VAS A;  4FNI A;  5HMZ A;  3OJU A;  1W26 A;  2DKO B;  1ZS6 A;  1N5T A;  3IR5 B;  4JI1 J;  1RGV A;  1JMT A;  2BYC A;  2CVE A;  3T41 A;  5JJB A;  2GNK A;  1L3S A;  2HMI B;  1B7F A;  3ZZO A;  2IJR A;  1P6T A;  2BRK A;  2DO0 A;  1T11 A;  2AW0 A;  3AJ1 A;  2Q43 A;  5HJX A;  3VZH A;  5HMX A;  5GAG I;  1XJW B;  3D1Q A;  3H4B A;  1KP6 A;  3PJX A;  3BQ2 A;  1U1Q A;  1SKS A;  2J6S A;  4J91 A;  2PMW A;  4ZPT R;  2V2K A;  2JNJ A;  3ENW A;  1GFW B;  4YEA A;  3VQT A;  3CW2 C;  3CCT A;  2QMW A;  3CED A;  2M9K A;  4R8U A;  3RGI A;  1WAC A;  3CUN A;  3HKW A;  4RUA A;  1OWX A;  2UU9 F;  1CQM A;  4FF2 A;  1FHT A;  2C3P A;  2B6A B;  1LWC A;  3UI3 A;  2J7W A;  3BKT A;  3M6U A;  3BGR A;  1EQ0 A;  2KG0 A;  1WOR A;  3MD1 A;  1U1O A;  4O3S A;  1UEU A;  2KXH A;  3R6G B;  3DRX A;  1YSJ A;  2GIF A;  3OR1 A;  2R7T A;  4ZVH A;  1X4F A;  2VG5 A;  3IBW A;  2W8K A;  1YKW A;  5D0R A;  1HBN B;  3TAM B;  4WWS A;  3Q0A A;  2BBE A;  5JVG Q;  2LMI A;  5DDQ C;  5SUH A;  3ELH A;  2Z58 B;  2JLG A;  1SUQ B;  4LIR A;  1I51 B;  2EFG A;  2UUB J;  2RDD A;  1NSK L;  4Y00 A;  3KOA A;  4DN0 A;  1T94 A;  3QSI A;  4Z7Y A;  3J7Z 5;  2AYM A;  3HMJ G;  2CJY B;  1HNI A;  2RT3 A;  4J9O A;  2XLK A;  1N5S A;  1VIS A;  1GXT A;  1PGZ A;  3IWN C;  1WKK A;  3C2P A;  3IM9 A;  5GAE I;  1UVK A;  3KHH A;  2CQ1 A;  2OKQ A;  2YNF B;  4ECS A;  4ED7 A;  1U49 A;  1HBU A;  3AOC A;  4OYO A;  1U47 A;  4DV6 F;  2MZJ A;  1TKT B;  5DLF A;  2Z4P A;  2FDN A;  1L3V A;  1VOM A;  2OFG X;  4DCO B;  3Q22 A;  1U8W A;  1HBN A;  2CDQ A;  2HND A;  2PGC A;  5CZX A;  1N36 F;  2JHE A;  2BJ1 A;  1YBT A;  3BPS P;  1JKH B;  4K7Q A;  2Q66 A;  5KG3 A;  2KVI A;  3HCX A;  3WX8 A;  1RK8 A;  3KK2 B;  2CNN B;  1L3K A;  3OFF A;  3VAM A;  4B9L A;  1CJK A;  1RUS A;  3ETM A;  4DUT A;  1SIZ A;  1N52 B;  1QAY A;  3N79 A;  4N7T A;  3T1A A;  2R2R A;  2NSC A;  1NHU A;  3V6J A;  1WF1 A;  5IC6 B;  1KQF B;  4HTJ A;  4JUZ A;  3GG0 A;  3UQS A;  3LP1 B;  3G8S A;  4CLZ A;  1OO0 B;  4QQB A;  3GFZ A;  3UVJ B;  3SSR A;  3W62 A;  4YFU A;  4NMX A;  4XK8 C;  4WF9 Q;  2DIS A;  3MAH A;  1S1W B;  2UVU A;  2FD2 A;  2LA4 A;  2BDP A;  2Y8Y A;  2DIV A;  1EP4 B;  3MEE B;  3THV A;  3HD1 A;  3O6Q A;  5D0G A;  2B56 A;  3DOL A;  3K5N A;  4RPF A;  2A0F B;  2ATL A;  4B3O A;  2VBX A;  3NEK A;  1FFG B;  2DGV A;  2JVO A;  3DLG B;  4PRF A;  1TL3 A;  1UZH A;  4CYU A;  2VQE F;  2ATC B;  4ED6 A;  3DRS A;  2J7K A;  4FVC A;  2GW8 A;  4TY8 B;  5ADZ A;  1JLG A;  2UVW A;  2YX4 A;  2EK6 A;  4IG3 A;  2E7X A;  1MWQ A;  3QAT A;  2Z2M A;  4ELU A;  2KFN A;  5KT4 A;  1QUV A;  2FLN A;  2WBM A;  1HBO B;  5EX0 A;  2WBR A;  1X60 A;  1T95 A;  4X64 F;  4LFA J;  2QMU B;  1V9O A;  2R8I A;  3CCE S;  5GAG U;  3GLJ A;  5T7L B;  1JLE A;  3P5T L;  2ZJP Q;  3CB4 A;  2YKQ A;  3CCQ S;  3MGJ A;  1VQY A;  3MEC A;  2HBR B;  3ZO7 A;  3D28 A;  2NZ4 A;  2PT0 A;  2UUA J;  4L75 A;  1LW2 A;  2HQG A;  4Y6I A;  2PI5 A;  3HLU A;  3TRG A;  3FUY A;  4USW A;  4X64 J;  4NEY A;  1VBZ A;  4K2J A;  4OX9 J;  2IM2 A;  3P4U B;  2UU9 J;  1HPZ A;  1S1V A;  2CQI A;  1U25 A;  2YQ3 A;  3OHA A;  2IJN A;  4RW9 A;  1JLA B;  4TQR A;  2AYE A;  2ZH5 A;  4EU0 A;  4MK9 A;  3R1L A;  2WCX A;  4NOH A;  4PYA A;  4USI A;  2GCF A;  4DBQ A;  4IRK A;  3KK3 B;  1P1L A;  1WKJ A; 
#chains in the Genus database with same CATH homology
 2H1Y A;  3G87 A;  3RGI A;  5DZ6 A;  3TZW A;  2QO3 A;  5CZC A;  3R97 A;  2CUY A;  2QC3 A;  2JFD A;  3IM9 A;  3R8Y A;  2QJ3 A;  3PTW A;  3H0P A;  3IM8 A;  1NM2 A;  2G2Z A;  3HJV A;  3K89 A;  2VZ9 A;  4RR5 A;  5CZD A;  3BV8 A;  2G2Y A;  4RL1 A;  2PFF B;  2JFK A;  3SBM A;  4QBU A;  5DZ7 A;  3HHD A;  2UV8 G;  2VKZ G;  3TZX A;  3EZO A;  3TZY A;  2HG4 A;  2VZ8 A;  2C2N A;  3TZZ A;  3CJ8 A;  3QAT A;  2G2O A;  2G1H A;  3TQE A;  1MLA A;  3HMJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...