4RR5A

The crystal structure of synechocystis sp. pcc 6803 malonyl-coa: acp transacylase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
293
Chain Sequence
MKTAWVFPGQGSQAVGMGVDLLSTAIAKEKYQQAEEILGWSVVEKCQGDEASLALTQNTQPCLYVIEAILADLLRDKGFQPDYVAGHSLGEYSALYAAGVFDFATGLQLVKQRSEVMASASGGMMAALMKFDQTQLQQALTDNTEVVLANDNSPEQVVISGTVAGVEAILANVKARRAVPLKVSGAFHSSFMAQPSQSFAQTLTACHFNDATVPVLSNVDPSPTQNGDRLKEKLIQQMTGSVRWRETMVNLGEIGATDYWEVGPGKVLTGLCKRTCPDLNLKNIGQLDDLNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Malonyl CoA-acyl carrier protein transacylase
publication title Structural and biochemical characterization of MCAT from photosynthetic microorganism Synechocystis sp. PCC 6803 reveal its stepwise catalytic mechanism
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
total genus 110
structure length 293
sequence length 293
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 4rr5A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 4rr5A01
3EZOA 3HHDA 3TZXA 2HG4A 2VKZG 2QC3A 3H0PA 2QO3A 3RGIA 2G2OA 3QATA 3TZYA 3TZWA 4RL1A 3K89A 4RR5A 2C2NA 2UV8G 5CZCA 3HMJG 3SBMA 2VZ8A 2JFDA 3G87A 5CZDA 2QJ3A 3CJ8A 2G2ZA 2H1YA 3R8YA 3HJVA 1NM2A 3PTWA 2PFFB 5DZ6A 2CUYA 4QBUA 3TZZA 2JFKA 3TQEA 5DZ7A 3IM9A 3BV8A 2G1HA 2VZ9A 1MLAA 2G2YA 3R97A 3IM8A
chains in the Genus database with same CATH superfamily
2JVRA 3DCAA 3NOCA 4M5GA 4RUHA 3V4MA 1GFWB 1NDLA 2MB0B 5D15A 3DU5A 3OTCA 1HBUA 4KYZA 3BBCA 1K0TA 5D0HA 2QZ8A 1D09B 4M5HA 3IS9B 3A8IA 2AGQA 4ETZA 2RF2B 1B7FA 2VV5A 1ULRA 3OR2A 3KMSA 2BM0A 1TFYA 3GTYX 3DLEA 3M8ZA 2XZWA 2VPYB 1DTQA 1A6LA 3DLKB 2MTLA 1VRUB 2FZKB 4NCGA 2P5VA 1S9EB 1L3TA 2PI5A 2WCXA 3NXZA 1XIQA 1SJFA 1SC3B 1ZA2B 2CFXA 4FPRA 3UDVA 3VGUA 2WOMB 4NLYA 1YJVA 4UY85 1H74A 3BSCA 3QFHA 4I2PA 3AQPA 4I6AA 3ENQA 5DO2A 2BKOA 3SYZA 2MKSA 1TUWA 3GFXA 4N8OA 2MZSA 1RACB 4J5OA 1T3OA 4P2FA 3DLJA 4QW9A 1ZAXA 2QLFB 4RW9B 5GMEA 3V4IA 4ICLB 2ZH3A 3P96A 3DOMA 1N5QA 4TN2A 2MKIA 2MXYA 2VA2A 4ZJOA 1RAFB 4LBPA 3VV2B 5DDRC 3MM6B 2Y9HA 4QWBA 4B02A 1LWCB 2FVSA 1FVQA 2IPOB 1CQNA 4DR3F 1IBKJ 3CT9A 3HPOA 3QNWB 3UR0A 3I6PA 3AOAA 3U7JA 1IVZA 3EXYA 3VCDA 4XO0A 1B99A 5HLFB 2AYBA 4PWDA 5DJBA 2X51A 4W4MA 1TK5A 2UUAJ 1N54B 3POTA 4Q7AA 3Q8SB 1FNOA 4J90A 1SJ3P 1IJEB 5GAGU 2XLKA 1U8SA 3IBWA 3HULA 4NASA 4QPXA 4JI0F 1XNRF 2R42A 3KLVA 4C8ZA 3D9BA 2CPZA 1RAIB 2FY1A 1XR6A 5C7PA 5JJBA 1VQMS 3BQ1A 1U24A 3L7PA 3OL9A 4GO7X 4ZS6A 2J5AA 1SJ4P 4IG3B 1E6YB 3ZZYA 1YJWS 1C1CB 4ER8A 3D1OA 4OYXA 5KFDA 2DIUA 4IH6A 4OZ2A 3MPVA 1HWJA 3MEEA 2P2CB 4ZCMA 3AODA 2X3DA 1P9QC 3IXQA 1FEEA 5KFBA 4OZ1A 2V2VA 4DSEA 5ETRA 3LP2B 3OPKA 5J1EB 4Q8EA 2J0WA 2IMOA 3BSNA 1NEEA 1DQ9A 4K4XA 2E1CA 4QOTA 1OPZA 1KDNA 4P6QA 3ET6B 3OFHA 1VQYA 3MD3A 3A8KA 2KM8B 2E66A 1RTDA 3IWXA 4KFBB 3PW7A 1BHNA 4YB5A 4DV2J 4R5PB 1MSWD 1FDBA 2NXJA 1P9YA 4LSNB 1EX8A 4AXJA 2BJ3A 3RGIA 1N36F 1T94A 1HQEA 1JLAA 1S6UA 4CP5A 2I2YA 1LOUA 4EWTA 3ILOA 2P9CA 1Y5LB 2OSQA 1PBUA 5C24B 2KU7A 4J9RA 1UETA 3VALA 4OYAA 2LQJA 1T8EA 1UVMA 3G2XA 2HVZA 4RJVA 4B3SJ 4M5MA 4LFBF 2BE9B 1TVRB 2B7BB 3I4PA 2VPXB 1T05A 1FI4A 4MFBB 1KVJA 3W63A 2WSEC 1FK9B 1UJ5A 1RT5A 4OZ5A 5GVQA 1FRIA 2UVUA 2GHPA 4ZPTR 2YNGB 3FSXA 1KRPA 3FCVA 4ZA1A 4K0KJ 2HPUA 4Y2CA 1S59A 2D3O1 2L48A 4L76A 2PD1A 1MU2B 4WFAQ 3BGRA 2VFTA 5FIIA 1NCLA 3MMBB 4KHPJ 2OP5A 4MIBA 2H65B 2KXNB 1F1BB 4ZPBA 2W7PA 2MDAA 2C3UA 1O51A 2ZUAA 2VKRA 5ETPA 1VHFA 2MQMA 3W65A 4WK3A 3HKZD 3KKFA 4ITSA 2WK4A 3H7HB 3EE3A 3IS9A 2D74B 4DV4F 4DL2A 3CCMS 1VC5A 3JSMB 3T5HA 1WD6A 4PABA 3B8HA 3HFKA 3BDEA 1O6XA 2CPIA 4YHHF 3DGPA 2GO8A 2C3YA 5DLGA 2JZ5A 1REGX 4OZNA 2UV8G 1FERA 3KJVA 3NS7B 3WQPA 1IKVB 2Q66A 5C2GA 2N3OA 4ECTA 1CJTA 3B4DA 2WW4A 3P3DA 1TV6B 2ZWOA 4PQAA 1S9EA 4CLTA 5KFVA 2CZ9A 3U02A 2QMUB 5EWFA 1WG5A 2V2ZA 3M32A 3SSQA 3V5RA 3DMJA 1LNQA 4M1KA 1FE0A 2BACA 3NAHA 3CDBA 4C0OC 2AGOA 4K50A 3EMTA 3KYLA 1TL4A 3MCNA 3M8RA 2FLLA 1GQEA 5FDLB 3D67A 3HD1A 2B4UA 1NB7A 4DR1F 2AJ0A 2ZH4A 4DUYJ 3BDPA 4LRFA 2DHSA 1HBOB 4ICLA 4DV6J 2GNKA 3SCLE 2OO4A 5D3GB 3MTJA 2EBGA 4CT9A 1OMSA 4MT1A 3GR0A 4MJKA 2X1AA 3WC0A 1HNZF 4JP8A 3MM6A 2QGFB 4CYUB 1LWCA 1JNRB 2V69A 1RWWB 2GC8A 4K2JA 4C8NA 3W8GA 3W5YA 4RBVA 2R7TA 3W64A 1TKXB 3N6LA 1S6PA 2HYIB 2QYGA 2KT2A 2ZH6A 1FO1A 2X3GA 3PW5A 3F56A 3MR2A 1A0OB 3RR8A 1Y00A 2BV3A 1YJ7A 3LAMA 4GKJF 4DS4A 2QL7B 3QJPA 2KXHA 1H0HB 4P72A 5CCLA 2ATCB 3N9UC 3DNCA 1S1VB 4P75A 3EZ5A 5E41A 1UFKA 4ZPAA 3KK2A 2WAQD 3LPYA 3PX4A 2VBZA 1ZM4A 3CCRS 1WDDA 2I1RA 4TY8B 2OFHX 1H3DA 4DBQA 4H4OB 1S0OA 3OFFA 1BQXA 3A13A 1X5SA 2GS8A 2E5JA 2E1RA 1KFSA 3NAIA 1E6YA 3JQJA 2XSFA 2B0GA 3R3TA 3IAM9 2J8SA 4AXIA 3M05A 3FK4A 4PAAA 2DXFA 3HX9A 2KJWA 3BS9A 4NE9C 2FC9A 3TQEA 3KG4A 3D1QA 3BKFA 1N33J 5J2QB 3V6HA 4QWAA 1SC4B 2XWXA 1YBAA 3AT1B 1TKZA 2VBXA 2ZWPA 1IBCB 3UE2A 3EX7B 3I4HX 3GIIA 1RAEB 4Y3CA 2U2FA 2ILZA 1RT7A 3ET6A 4Y2IA 1WHWA 4X4UA 2OPQA 1SH2A 4U8VA 4KH1B 2BJ1A 3MEKA 3D6FB 2ROPA 2VQEJ 4R5PA 5GAGI 3W2WB 2Z56B 1UPMB 2F7VA 2M5YA 1S1XB 1X4DA 4DL3A 4UT4A 1AFJA 4OZ0A 4IO9Q 4UY8T 1BGXT 4LQ9A 5HANA 4NZ7A 1D8ZA 3SSRA 3QFWA 4DG1B 4ZLJA 4U6PA 2KB2A 4XIUA 3PZPA 4F4KA 1OS5A 1RT4B 4NCAA 1TVRA 2W4CA 5KFXA 4MFBA 4F3QA 5IWAF 3UDEA 1KSPA 2ZD1A 4NLUA 2FDNA 2L9NA 1WKJA 1HWIA 4EFAC 2H5IB 3MR6A 4PCQA 1NZ8A 2VJUA 1WHVA 2BJ9A 1F2GA 4LIRA 1RAOA 4OYPA 4LRAA 2CQPA 1HHQA 3MMBA 2JEFA 3K89A 4ECUA 2BBEA 2XZDB 2GMHA 2W2QP 1AYEA 5D4LA 3DLHA 1F3FA 2KTQA 3N01A 4K8RA 4HVZA 1KQGB 1IWGA 4NYPA 3IA0A 2CG8A 2PT0A 2MPUA 2E29A 4RW4A 5HROA 4C48A 2XMJA 4CLYA 3MCOA 2C2NA 3R5AA 2RQCA 3PX0A 2DHHA 1Q1KA 4DV5F 5H9EJ 2QA2A 4QIFA 4ZLLA 2H9ZA 1SJ1A 3T41A 2XCAA 1FXRA 3GE9A 1HI0P 1PG5B 2ZNYA 5EDWA 2E7VA 1UVLA 4H54A 2BYCA 3CDUA 3Q8VA 2C42A 5KFIA 4DQRA 1LW2A 2LXIA 3UDCA 3E8OA 5F3ZA 4FYWB 4F0MA 4OX6A 3PKYA 3EPGA 5AE1A 2ALZA 3GIMA 1RISA 3EUNA 1WC3A 2F4VF 1XBWA 2H4YB 3F0NA 2XBPA 3KLHB 5C5JA 3FJ2A 1WTBA 2V4JB 3PJWA 3TANA 2GA7A 1AT1B 1GMWA 1YWXA 2O01C 5G0RA 2PI4A 2HQCA 2CQIA 2CQ4A 5KOWA 2FJVA 1Q8BA 2F1FA 3DI6B 2NQPA 4URQU 2HHQA 3MMAB 2ZITA 2CJ9A 3EXCX 1M1GA 4ELTA 2FYXA 4J9KA 3AA8A 3J81j 2ZM6F 4YB7A 4QPTA 2BJ8A 3THPA 3OFEA 1TAUA 1VIOA 2X1BA 2GAHC 1C4CA 1S1VA 2I5JA 3OLAA 3MI7X 1Q78A 4QIVA 2ZBPA 3H5UA 2FLPA 3DRSB 2ACYA 1WF2A 2R7XA 4P2XA 1NSAA 1FHTA 4TY8A 2HGNA 1VMBA 3FZ2A 4OI3A 2C1EB 3QWUA 4LR7A 2JFDA 4A8KA 2OLWA 2WVFA 3DU6A 1RGVA 2GMJA 1FA0A 3PRBA 2C2EA 3V81B 4Y2AA 1RYSA 2XLJA 3H98A 2KZMA 3GPAA 2W4DA 1V5IB 1MWQA 4K4SA 1Y9OA 4CI0B 3W9JA 2GIQA 1QVGR 3R5GA 3QIPB 3NGTA 1N0VC 2EFPA 4ED5A 5A8RB 5F8GA 2VASA 2E9ZA 5C2CA 5J2QA 1HNWJ 2OEMA 4YY3J 2H54B 1WC1A 3A8JA 4PWUA 2RUGA 2EKNA 2LVWA 3P5BP 1XMQF 1RHJB 2O3DA 2AJFE 3DM2B 3W2VB 1JLFA 3D3BJ 2YKOA 5I4MA 1NJIT 5BYQA 2UXDF 2V8DA 2OPRA 2WTFA 3DOKB 3PFOA 1FCAA 2QLXA 2U1AA 3OTOJ 2HWHA 1VRQC 3NLCA 2JLFA 3VZHA 1N5YB 4MK9A 1G3OA 3MCMA 4DZ6A 3TNVA 4ED4A 2OPPB 1S1XA 4OL8A 1WG1A 3QRPA 3RU0A 1D9AA 2P9EA 4F25A 1FFGB 2ASLA 4DG1A 3G6VA 2QYCA 4ENOA 2E7WA 3NMAA 5KT3A 3BBBA 3SCIE 2V9WA 4ECYA 2XMVA 1KOHA 1I1GA 5B0DA 4Q0BB 2ALYB 5HN0A 2CQ0A 1QM9A 2UUBF 1TL7B 1YI2S 3D6MB 1FWPA 4JI3J 4I0WA 4NL5A 4XPEA 5GAHI 1RI7A 1OQ3A 4K59A 2GGPB 1VI7A 3MFIA 2IY5B 3M30B 1JLEB 2Z2LA 1LWXA 3LANA 1PAUB 1C4AA 1KHWA 1X9WA 4ECXA 3QIDA 2OAUA 5IC4B 5A0YB 5B08A 3C6UB 2HAFA 8AT1B 1KVKA 1IKWB 4YEAA 3RW7A 1Q95G 4BLGA 3NWGA 3A3OB 1RHUB 4ZPWR 3IP0A 4DFPA 3KDNA 1OIAA 3LPEA 1NKCA 1OY9A 3CXCR 5L8RC 2MHNA 3ZZ0A 3MEGA 4CO4A 1FRHA 2PN6A 3JTPA 3A3PB 2J6SA 2ZC4A 3PHTA 3QAUA 2DR9A 2M7SA 4ZITA 1GH8A 3MMJA 4LIWA 3AD7C 1S6OA 2NSBA 2YX1A 3HVRA 3LP0A 2KRBA 1A7GE 2X1FA 3WHIA 4W98A 2FZCB 2XB2D 3K57A 2CJKA 3KG0A 1L3VA 5KFOA 1WDTA 4HHHA 2ZKTA 1V6HA 4ID5B 4QBUA 3T5KA 3VQSA 3MMCB 2UU9F 3SQGB 4DQIA 1N5VA 2GHVC 3PYFA 3HHLC 1CC8A 3GJQB 1TQLA 3UD5A 3P49B 1IBKF 2B6AB 1IUJA 5IZHA 3HSGA 1N32J 1VHIA 2WSFC 5F0UA 1RK8A 2JOQA 4UW2A 1KBRA 3DI6A 2EFNA 8RUCA 3MMAA 1LK7A 5HP1A 2W2NP 4DQQA 4ECZA 1Z1ZA 2R2RA 3TAMB 4MIWA 1F6TA 4C8MA 2ACMA 4ZK7M 2VU5A 1S0MA 1TKDA 4RW6A 2ZH5A 1YHQS 1NH8A 4WBFA 5H1SV 4PXCA 2YBVA 5HQ8A 3M2RA 2CXEA 5AE2A 2AX1A 3T9NA 1DZ5A 3AFGA 3PRDA 1MN7A 5CQGA 2DGXA 5KFPA 3TAQA 2XNRA 5L9NA 2PO4A 5F8IA 3RB6A 3LW5C 2Z2YB 4Y34A 2Z2MA 4TYAA 3QZ7A 3NWRA 3HDSA 2W9BB 1UVNA 1RSCA 5KG6A 4ES2A 2J9DE 4CZCA 1T9VA 3T1YJ 1H7WA 4USUA 3GCWP 4KSEB 3PIOQ 1NK7A 3QIPA 1HARA 4C11A 1Q7YT 4OYMA 5A8RA 4NA2A 2ZOGA 1DLOA 4I7FB 2R7VA 3VGTA 4F04B 1QAJA 1JMTA 4KY3A 2QA4S 3JTNA 4Z7YA 5HK4A 4WIQA 4ZPDA 4YB6A 1DHMA 1RXOB 4DV2F 2CNOB 3UNGC 2H1YA 3H5YA 2Y1RI 3T19A 3HZGA 2J9CA 4K7QA 1KTQA 3NGRA 2GVDB 2W01A 3UN2A 4FN5A 1RQ0A 1SC1B 4BWJA 3SXLA 5K8PA 4F02A 1N5YA 4LF7F 5ETSA 1AA1B 2BABA 1WHXA 2OPPA 2DR8A 4DXLA 5DGAA 1AUDA 4IOCQ 2AF6A 4B3SF 2BE2B 3TJ9A 2JX2A 2DK2A 2YNIB 4MKAA 4MKVA 3CIMA 5DM7Q 2VBWA 1XMBA 3LP1A 3H2UB 2CJXB 1KLNA 4QR0A 4LSLA 2V4RA 2N4CA 5KFMA 1AXQA 2H4WB 4Q0BA 1LK5A 2P8IA 3IGVA 3ZZPA 2GQQA 4P10A 4KHPF 2VHGA 2KJVA 3HHKA 2IDLA 2IVMA 4KHRA 2BEFA 2JDJA 4M5JA 3M6UA 2GGPA 5HMYA 3BYPA 1UJ6A 2PIIA 8ATCB 3FUYA 4OX7A 2HGLA 1JLEA 3TUIC 4X66J 4YR2A 3BO3A 2IM0A 3J80U 2RHSB 1XN9A 2R2SA 4X84A 5IQ6A 2HNYA 3A1YG 1Q5YA 1UZHA 1Q86T 1RBOB 5A0YA 2DGTA 3G6ES 3F73A 3R27A 2HHSA 1IKWA 1N56A 2ERRA 1U1KA 1YBUA 5K20B 3MF5A 1RT3B 1EZZB 2JC0A 5C42B 2BQRA 1NMEB 5C25A 4B3TJ 3QSYB 2HBZB 4F3MA 3IWLA 4F2SA 3OUYA 5IT9Y 1KFDA 2MZRA 2BW2A 2HK2A 2BJ7A 1QE1A 2NUHA 3OR1B 1UZDA 1FJGJ 2OGUA 2FVCA 3FFIB 1NK0A 3K5LA 2GV1A 4TLQA 4TKTA 2ROEA 1RU1A 4LFCJ 1TR0A 2DIVA 3MUTP 3G96A 1IBMJ 1OY8A 1VDHA 4EYIB 1APSA 3MECA 4JI6F 4PUOB 2F3JA 3IR6B 2B8QA 2UVVA 1ZA1B 4PXDA 1LWEB 4CRJA 2V8VA 3CULA 3K8VA 1BY9A 4LR9A 4DV6F 4ID5A 1F5AA 3DFEA 4WWSA 1T9XA 4DHVA 3SQGA 1VBXA 1XK8A 1RTZA 2HMIA 2WVEA 5KFSA 3H2LA 3HHLB 3CWJA 3B78A 4EMDA 1XEZA 4FVCA 1H7XA 3JB9k 3P6YC 1UAWA 1HPZB 1MMNA 1WKLA 2RDJA 3FEYB 2HIYA 2IRUA 1UMJA 3UW1A 2VFVA 3OTBA 3TJ8A 4OJHA 5A6WA 2HW3A 3PW4A 2YNHA 4DEZA 4FKXA 2YKQA 4F0HA 4GC7A 1T02A 3N0VA 1VLOA 4R25A 4NX9A 4ALZA 5HVGA 4Q43A 2BOPA 4OYOA 4RW8B 2RDDA 2G1HA 1QY7A 2IM3A 1KQFB 3A4TA 1IXKA 2HBQB 3R9LA 4NEYA 2OSRA 1NSKL 1IKXB 4DR3J 1JXLA 2JL9A 3TARA 5F3TA 2VG6B 2K1RB 2DITA 4PR6A 2M52A 3HVTB 4ZP9A 1U4BA 1XNQJ 2QSFA 2HWIA 3ZXWA 2NXCA 3AB4B 5IM0B 1UL3A 3ILLA 3ADAC 5HI7A 4KH0B 1N33F 1R8CA 3AOBA 3BPDA 5A8WB 1XNRJ 3OXLA 1BUXA 1FFWB 1QSSA 1OY6A 4DCJB 4EEYA 5AXLA 1X7VA 4RLEA 4HR2A 3EPIA 2LYVA 4M5DA 3MDFA 2CQHA 2QIFA 2XM3A 1G7CB 2HK3A 2LU2A 4HLBA 4Y2MA 3HKWA 2QMXA 3KJFB 4LRCA 2XC9A 5L46A 3KLIB 2VQEF 3W60A 4WFYA 1CSJA 1WHYA 1NSPA 3PFEA 2GVDA 5HO4A 4I67A 2ZZNA 1N6QA 2FJEB 1YJNS 1PYOB 1S9FA 4G1PA 3BM7A 2N82B 3I9V9 2BE2A 4R0EA 5L1KA 4CNZA 5CZVA 3TQ1A 3C16B 2MQ8A 2D1CA 3QT6A 5DDPC 3PIPQ 2B4OA 4PG7A 3C6TA 4ID8A 5E2QA 4O4GB 4B08A 4C8YA 3BGFA 5F41A 2F9DA 2FTRA 1Y5NB 5SUHA 4XTTA 1TL3A 1WOPA 2B9WA 2WVBA 2COLA 2XMKA 2R7UA 3G4SS 2HFSA 2A2CA 1LXJA 1VQ8S 1JB0C 3CCVS 2K3KA 3NMRA 3CD5A 1YDLA 1IWAA 2XO6A 1F5BA 1IQTA 4NXNF 2XGQA 3ENWA 2WRMA 2DRDA 1HD0A 1CJVB 2B56A 2DTJA 3HHDA 1F9HA 2YKMB 3EYZA 1ZTWA 3ILIA 2DNMA 4G1QA 2NXUA 2HRUA 3QWPA 4NXMJ 1H2VZ 4RNFA 3NEKA 4UQTA 3PVXA 3Q83A 3FGVA 2BOAA 4ETXA 1SL0A 2H5JB 4RWWA 3S1TA 3KK1B 1RT3A 2RS8A 2FJBB 3ZTPA 3OVAA 2E9TA 3JAMY 1SKSA 3MM8B 4P73A 1J5EJ 1S0NA 4DL0C 3GLJA 1EKRA 1W7WA 2W2OP 2LP4A 4N47A 1IJFB 1OPIA 3QJLA 2O67A 1IM6A 3Q8YA 2XY7A 2AEFA 3OR1A 4ECQA 2XMUA 3SMZA 4YMEA 2IIHA 1T9WA 4HTJA 1S79A 3OTDA 2M8DB 1U0HB 4ZOSA 3OW2R 5JMNA 1Q7LB 1RT6A 4UOGA 1X4GA 1I94J 3G8TA 4KGMA 3U27A 1LWEA 1I5OB 4GVBB 4Q2LA 2YNFA 2DR5A 4HHUA 4BBYA 2D41A 1X4HA 2EEYA 2HAIA 5EHHA 4QYRA 4K4ZA 3DDNA 3PEHA 1FXDA 2HNZB 1KR4A 2XS7A 1NKEA 2KYZA 1DJ0A 3A12A 1YRTA 2FJAB 2ZNZA 3HT3A 4KKOA 4DR6J 4WFZA 3HHLA 5HQLA 2DB1A 2DT9A 4FPIA 4P52A 2RSQA 2E1PA 3NS5A 5EUHA 3SDEB 2QN6B 1MROA 3ZZOA 5DM6Q 4OQJA 1M1KT 3S7RA 1C1BA 4B3MF 2YH1A 2YQ3A 2HHUA 4KGXB 3LH2S 2NREA 3VAKA 2W4PA 3D3CJ 4L74A 1PJ7A 5E0OA 4FYXB 1N0UA 1FJ7A 4USVA 4FP9A 5T7LB 3K0JA 5IT9U 4DR2J 4EO6A 4NMXA 4DFKA 3CO9A 4GKKJ 1AUSL 1X4EA 1HNZJ 4V19X 3K58A 2ZUGA 1RWPB 3CIZA 3IBFB 4J9SA 1IKXA 2IC3B 2VUGA 1JJ4A 1Y10A 2IRXA 2K1RA 2CRLA 2C28A 3EZOA 4JYAJ 1U2RA 1CQMA 1YG0A 2EFOA 4B9LA 4C8LA 4PKDB 4F50A 2Z58B 4J9NA 5HBMB 4MK8A 4USIA 5A8WA 1HNWF 4YY3F 2BR0A 3IR5B 3AJ1A 2I8EA 4DSKA 2AIRB 3EZUA 2EFVA 4OYBA 3HT0A 4CLWA 2RILA 2RNEA 4RU9A 1Q79A 2V50A 1G2EA 2JEGA 4A46A 3OTOF 4OHYA 4ZPCA 1S0VA 2AJQA 2CZ4A 3PR4A 1RWOB 4R0JA 1RHKB 3HJVA 3VQTA 2DXEA 3HO1A 1NHKL 1J2VA 1JXEA 4JI8J 3AXMA 5K8MA 4BCAA 1Q8KA 4PXEA 1S49A 1FDNA 3M8QA 4ZPVR 1ACMB 1HNVB 3FQLA 1Y5IB 5KFAA 1C2PA 4F4ZA 3CCTA 2KXFA 1VQ9S 1K44A 2ZC3A 1NK6A 4U7UD 4Q5VA 3FBBA 1O5JA 5AXMA 3ISNC 2DGWA 2HQDA 2HHHJ 1VQ6S 3I56S 1YSJA 5I3PA 3SFGA 3TA2A 4EZ9A 2XI2A 1H72C 1U2CA 1R8BA 5KFFA 3BZQA 2J7UA 1R0AB 2RRNA 3WIUA 2JH3A 2UVWA 4RUAA 1JLCB 3O5TB 4C2MA 4DX5A 1VC6A 5G4DA 5KOXA 4BS2A 4RW7A 1U25A 2BANB 5HQMA 2IYGA 4CH1A 1HQUB 2YKMA 3WDOA 2HURA 4FDFA 5IWAJ 2HS4A 3GG1A 1C0TA 3AA9A 1RHMB 2BMBA 4OMFG 5E3PA 7FDRA 3LOUA 1AROP 1K47A 2ZZTA 4LF6F 4DX6A 2BM1A 3M6XA 4CTAB 3MM8A 1CJUB 3TUJC 3VHQA 4P71A 1R6YA 3JS9A 3EWGA 2ZBCA 4LVNP 2A1BA 5BR8J 2EVZA 3FC9A 2HFZA 1RTIB 3PEJA 1Z2ZA 2IA0A 1HBMB 1HHSA 4LQ3A 3N5BA 4CO1A 3KWMA 3HZEA 3NGDA 2V5HG 5DG8A 4X2BA 2OD6A 1GNKA 1H2UX 2V2KA 2W2MP 2Y8YA 3B82A 3MM7B 4GVBA 3NRBA 2VFSA 3BKUA 1AB8A 4ECSA 4L3KA 4I69A 4V19J 3EGVA 2V8PA 4X4QA 4IRCA 2V8GA 2HBYB 1CEZA 1N32F 4KHMA 1T7PA 5K9FA 1Q4RA 2W8KA 4IR1A 1L3KA 3NGUA 1OQ6A 1UJ4A 3T5LA 3Q8PB 3SDEA 2I38A 1S10A 1U47A 2ZH9A 4DS5A 3E2EA 5FLXY 1JLGB 2F4VJ 3JAMU 2VD3A 2M3DA 1QDUB 4C4WA 3I55S 3LAKA 2OHDA 3Q86A 5LT5A 1CLFA 4CLLA 2L3MA 3D7SB 2B4VA 1RCOB 2GJIA 3EICA 1YVFA 5T7LA 1DQ8A 1SVDA 2HZVA 4LF8J 2HVDA 3QGHA 4UOFA 3KUEA 5MLCV 4FF1A 2DNNA 2QX0A 2PA3A 1VQNS 4M95A 1NLKL 4KBIA 5KFKA 2ZJPQ 2RS2A 3ZC4A 2FJWA 2XEXA 1MNEA 3CC4S 4ZVPB 4I6YA 2GQ2A 2XSJB 3CCQS 4ECWA 3T1YF 4OJ1A 2V0NA 2N4DA 3M1VB 3HVWA 3W7BA 4LJMA 4ECVA 3RAQA 4ILLA 1VRTB 5HBMA 3GSDA 4NLOA 3MPWA 2LCWA 3H40A 3FBEA 5DG9A 1NSQA 3NOGA 5IQQA 2AJ1A 1PC5A 1MG7A 4KQZA 3KOAA 3TI0A 3D2WA 4O4RA 1JNZB 3DOLB 5DQGA 1RTJB 1I6JA 2GIRA 3FZBA 1ZAWA 1IR2A 4QQBA 2Z57B 4OHXA 1ITPA 1Q8IA 4YFUA 1TL1B 1PJ6A 4XDDA 3BN4A 4WYWA 1VK8A 2C2RA 3R6GB 1UA1A 2LEBA 3G82A 4DL4A 3PTWA 2KM8C 1TMJA 4NCBA 3D28A 5DZ7A 2D7SA 3I0RA 2CPDA 3CGIA 2Q1LA 3LALA 2A3JA 1Z2LA 2HWTA 2MGZB 1ZAVA 2MY7A 4FKYA 3M8PA 4G65A 5ETVA 3EDRB 1LV5A 1FRKA 4YQWA 4NOHA 3CJTA 4U9RA 4N77A 3PX6A 3AD8C 4BHQA 3V6KA 3M6VA 2AYEA 2DCUB 4J9OA 1NBEB 3CJRA 1TTHB 2FPHX 2YQ1A 3K8WA 3BQ2A 2PMWA 5E7OB 4ANDA 1U6FA 1FVSA 3FQKA 1EIYB 4DX7A 2ZVIA 3PHEA 2D3OR 3IBCB 3PYDA 5KFGA 4X66F 1NJZA 4PQUA 3TVYA 2QJ3A 2L41A 1FWKA 4M5IA 4OV6A 3GILA 1LW0B 1KOOA 1N48A 3Q8QB 5J1PA 4H4MB 2RMLA 5E3RA 5IT0A 2N7CA 4FS2A 3SBMA 4ZLNA 2CG4A 2QFJA 4DPYA 1SKUB 1ZH5A 3MR3A 4UTGA 2ZBIA 5F8NA 2UUBJ 4KO0A 3MM9B 3RBZA 4B3TF 1PSDA 1UEKA 1UCNA 2IAJB 1JJ2R 5KFYA 2HHXA 2G0IA 1FWLA 3C15B 1EETA 1LKZA 1EQ0A 1R27B 4CTAA 3RRKA 3FVYA 1CJUA 1GK8A 1FJGF 4DSLA 2PA8D 3LGHA 3ZZRA 3HHEA 3CF5Q 1ZM3A 4C97A 2KHDA 4LFCF 2CJAA 1RKIA 5DS7A 1ZYQA 3CCSS 3UVJA 1IBMF 2HHTA 3SSSA 2EXUA 1TU0B 1Q81T 3W1YC 4OYZA 3UNYA 3DHXA 4F4AA 4USKA 4OI0A 4CM0A 4DN0A 5CYQB 1Y7PA 4CO2A 3IWNC 4KC5A 3GJRB 5KT2A 5RUBA 5L9XA 3K5OA 1XTZA 3KNAA 4I68A 4XAKA 4D3GA 2HHVA 2B5JB 3H42A 3SQOP 2HQFA 2J0SD 3Q0AA 3BH6B 3G86A 2E5IA 2Z0GA 3NBPB 1E6VA 1KN6A 4DFJA 3D6TB 2NLWA 1WACA 2FJDB 4CLZA 4CWBA 3L4BC 3ENAA 4TQSA 3FSIA 7AT1B 4HT5A 5THWA 4HKQA 1U49A 3ETOA 4JV2A 3PR5B 2XYHB 4QU6A 2UU9J 1HW9A 1CBKA 4F4YA 5CHCB 1NPPA 2E9RX 2EI5A 2XS2A 4D3HA 2CIMA 1FRJA 2DH7A 3D0GE 4IFYB 4Z2XA 2RD5C 2UXCJ 4J91A 1GMWD 2ABYA 2J8AA 4ZMMA 5KT4A 2DNHA 3CW2C 1XNQF 1S1TA 3MAHA 3ITHA 3BYRA 2F5GA 1TK0A 1C0UA 2ASJA 2AKWB 1SH0A 1WUUA 2WVDA 4U7CA 2XSJA 2YPYA 2YX7A 3V6JA 4IH7A 4B9VA 3M1VA 4O44B 4CLKA 1Y4ZB 2XY5A 2VICA 2VG7B 3FCWA 5HJYA 2IYIA 3QRRA 5DDQC 1JLBA 4O3NA 5KFCA 2OFGX 1WF0A 4LF1A 4DWIA 1IR0A 3NCQA 2FB0A 4J7CA 2C3OA 5CABA 5J2MA 2LXUA 2BQUA 2RAQA 5IV4A 2DNYA 4LF9F 2DEJA 2W7AA 4TU8A 4K5RA 1RADB 1JQGA 2Q79A 4FYVB 2MHEA 5FLXU 5B09A 2RKIA 3P8BB 2CUYA 1RT1B 5CYMA 3G8QA 2KFYA 4I6WA 4O0NA 4EBDA 4QIEA 4DF8A 5ADZA 1RWKB 3QAEA 5J2PB 2G1DA 4DJBA 3DRPB 2MKHA 2WBMA 5T14A 1X9SA 2LEPA 4WP9A 3W8PA 3D1HA 5M2RA 3L7OA 4DV7J 2CQ1A 2OELA 3T3FA 4YR3A 4HH1A 1WJ9A 5IT4A 1UA0A 3QLHB 4DU8A 3W62A 2DNQA 3CJ2A 5JVHQ 4NEZA 3NCRA 3DRXA 3WX8A 2XNQA 3T6JA 3WX4A 3DDIA 3FCHA 2E5LF 3C46A 2M0GB 3KLEB 2HRTA 1M5SA 3CJ8A 1IBLF 4LF7J 2YPZA 3RUBL 1YITS 3QBCA 2CVEA 2LKZA 2HFVA 1VC0A 2KDOA 1UEVA 2B3TB 2ZHBA 4FBTA 2DPIA 1YRUA 2ZVSA 1U1QA 3LQVA 1XJWB 1HWKA 3OT9A 4PPZA 3I5BA 2CQCA 2A10A 4NXMF 1LW0A 3NS6A 4H4MA 3BBFA 1FKOB 1NXIA 3H4DA 2VONA 5KT6A 1JK9B 2AT1B 7FD1A 4ZCIA 1FKPA 2RQMA 4EUVA 4DN9A 2HS0A 3CD7A 4DPOA 2V9KA 1RWMB 1R6VA 3M8WA 5A2QY 3J7YU 3KHHA 1K73T 1J5EF 3TYTA 5GMKa 1ZS6A 1CG2A 4Q44A 2WONB 1S48A 4UZBA 2UVRA 2F40A 1SV5B 2CQDA 1KP6A 1T9UA 4Q45A 5LJ5Y 4C3KA 3CCES 4OHVA 3UO0A 3OXFA 2KG0A 1X60A 2D69A 3DYAB 2RF2A 3R2DJ 5D77A 2IBKA 4ZHRB 3BREA 3BO4A 3ILJA 1I94F 5HATA 4KGZB 3BGLA 3H5SA 4P7TA 5D8HB 2DEIA 2HBRB 6FDRA 2R7OA 3DLKA 5CYQA 4JOUA 1VRUA 4Y00A 1SIWB 2HEKA 3UCUP 1M5HA 5E5NA 4X4OA 1B0VA 1NU4A 2WOMA 1DQAA 4DR6F 3UQSA 3NY0A 4EBCA 3BEGB 4AQYJ 1K8AT 1X0PA 1B3TA 3HCXA 2CADA 1NK4A 3F41A 2WW8A 2UUTA 4JI6J 4MKYA 3PRVA 1M0SA 5K14B 4RW9A 1XWLA 4CO3A 2HFUA 2C2OB 2W9CB 5B0GA 3CUNA 1GTHA 1XR5A 5U47A 2XMTA 2PGCA 2QA4G 1WI8A 4DR2F 2C2MB 1RT2B 3DLLQ 1R43A 4X4VA 4GKKF 4RNNA 3R5JB 2HVHA 1PYSB 1PC4A 1QTNB 3FBCA 2R4FA 4W90B 1JLQB 4K2XA 4DOZA 2E44A 2CVIA 4OHZA 5HLFA 1ZM9A 2FVRA 2MQOA 2CDRB 4JYAF 2HQ3A 3VR1A 3C19A 5BXIA 1R7IA 5DQHA 2VQFJ 1T0TV 1HI8A 5KFQA 1AFIA 2GFFA 4O44A 4HYKA 2IA6A 4KV8B 2VG7A 3V6DB 3CD6S 2H3EB 3CJQA 3MR7A 2XS5A 2F8HA 1VJWA 2DBBA 2VG5B 4B3OB 1ZOTA 4IG3A 4B3RJ 1C1CA 3H59A 4ZVUB 1RE1B 2XYPB 5F8HA 1TZ0A 1BMQB 1VQPS 2NR0A 3PW0A 1KS2A 3IR7B 1FX4A 1X5OA 4NPOA 1WOSA 5EX0A 2W2PP 3R8YA 5A76A 4JI8F 1P1LA 4ATNA 1RT1A 4CO5A 3CO0P 2L08A 1OJ4A 3D54A 4PYDA 4WP8A 3LP2A 2VC0A 3AAWB 5J1EA 1YTYA 4UZCA 4QR1A 1SJRA 3KFWX 4FNIA 1G6BA 5LJ3Y 4OIXA 1B0TA 4M8LA 4C7QA 3EGWB 2YXLA 1K9MT 3ZTQA 1WC0A 5K8NA 5HSPA 1Y3KA 2UZAA 3FRZA 1SKRA 2HHHF 3DLGB 4KFBA 4RUBA 2KFZA 1YIJS 3VAHA 1Y3JA 3PG9A 2JVOA 2HS3A 3W3SA 2JLEA 1RAHB 4LSNA 1B70B 3U1MA 3RTVA 2M4MA 4IRDA 4C0BA 3E01B 1V9OA 2G9OA 1NKBA 2XMAA 1W2IA 5KFZA 1HR0J 4FXVA 3UN3A 2AEJA 5ETTA 5C24A 4NMLA 2OKQA 2QRRA 1GX6A 3PW2A 4RBTA 4ED1A 1P27B 3IMQJ 2QLJB 1W26A 4JI1F 2KI2A 2UUWA 2KO1A 4OX9F 2GJFA 2DRAA 3VVUA 1KEKA 1FK9A 1TP7A 4LRDA 3DLEB 2AJ2A 2E5GA 3T5JA 2VA3A 5LM7E 1DTQB 4JI4J 1QAXA 1VQOS 2YNGA 4LREA 2GZOA 4WP3A 2J76E 2G13A 4C8OA 1FFSB 4MAKA 2F4FA 1MU2A 5D6GA 4YB1P 2BUNA 1JKHB 4I2PB 3ICLA 2NYIA 3J7Z5 1U26A 3BKTA 3FNNA 2VDIA 1J5OB 5BR8F 2M2BA 2RQKA 2XQCA 2OUGA 3OXGA 3R7NB 2OTJS 4NXNJ 2KYXA 2HG4A 4DR4J 1FKAF 1WTFA 4RUCA 2F8EX 3GZ7A 1RJJA 1LFPA 4IUFA 1H38A 4IOBA 3D0IE 4KAIA 3DYAA 2HIQA 3DOMB 3JSMA 2RDIA 4F3OA 5CD4H 5L1IA 1S97A 1RA6A 4JI5J 3MAQA 3N5FA 3CJSA 5LMUJ 1IKVA 4K4VA 1S4EA 1NK8A 1U6ZA 3DRRB 1TV6A 1GX5A 3N28A 1RBLA 4A8OA 3C66A 2R8KA 4DQSA 4PWDB 1LXNA 4ES1A 3MXHP 1VBYA 5I42B 2FHJA 3DHWC 1S6QB 2XZTB 3M2UB 3QGPA 4F4XA 1L5UA 3M8YA 2E5HA 2XMMA 4A8MP 1IM4A 2MKCA 1SL1A 5FDLA 1UWBB 1D9FA 3L7UA 1GXLA 5CD4A 4PG8A 1SPBP 2GO9A 3GONA 2H48B 5A2QU 3JSBA 1D0EA 3J7YI 1HBOA 2QLWA 3BPSP 4YS2A 2CJBA 1SC6A 5F9NA 4RKUC 2R2TA 4KGKA 3M9NB 5D3GA 4OJ3A 3U1LA 4ELUA 4LF8F 4AUKA 3MEEB 1WORA 4OI4A 4CYUA 4A8QA 5HL7Q 3WBZA 1F60B 5B0EA 1T03B 2ADBA 2IRYA 1VGYA 3Q2TC 1TKXA 2CAJA 1WKKA 3G6YA 3MEDB 2O1PA 3AHPA 3OJUA 2MJUA 4ECRA 4B3MJ 3GG0A 6AT1B 1NNDA 1T9TA 2DHGA 1JX4A 2BJEA 3T1AA 1VLYA 2F9JA 3KXDA 1SH3A 4OI1A 6FD1A 5KFWA 1VQ4S 2VPWB 1TKTB 4H4OA 2VG5A 4NYOA 4KT0C 1B64A 3LWMA 4B3OA 1HWUA 4XK8C 4JV0A 4ED8A 5AT1B 3NGKA 1UVJA 4O3QA 3GU0A 4WTOB 2EBEA 4PEOA 3TVZA 3TZXA 4WJBA 1HQEB 1TMMA 2YQ0A 3H8YA 2JEIA 2RU9A 2JWNA 1NDCA 1P6TA 4ZIWA 5HAOA 4LF4J 2CPYA 2DNKA 4C98A 2DD8S 4DCOB 3JQMA 2HFOA 3N4WA 1KHVA 3G8SA 4ELVA 2HKEA 1NB2A 2R7SA 1T05B 2DPJA 4GVLA 4OFZA 1UW4A 3CJ4A 3JXOA 4ZN3A 4I2QB 4DV1J 1BE4A 1HL6A 1GAOA 3PJ9A 4S0MA 2JHEA 2LA4A 3TZWA 1FNXH 1X4AA 5IFMA 1RWNB 4RNOA 2IFXA 1FEHA 3TX0A 3FMBA 5E33A 2B43A 4YDDB 1DAXA 3N79A 2J0XA 4GC6A 3W2WA 2HZAA 2GW8A 3UD3P 4CCHA 1T11A 3SI8A 2MEWA 3E01A 1NPRA 2CWXA 3FRYA 4PG4A 4ED7A 1SUQB 2VBYA 5KG3A 3TA1A 2ZHAA 3R7BB 3PYGA 3H90A 4KPCA 3I5AA 4WFXA 2DGOA 2AW0A 1TELA 3I9ZA 5KFNA 3I32A 1RT4A 2W8LA 2AWZA 3NCPA 2V6AA 1S57A 4IFVB 3QT8A 2YWEA 1FD2A 3C3LA 3DGPB 1Q53A 3PM9A 5KFUA 3KJVB 5CZCA 4USJC 3CCJS 1CJTB 4A48A 1X4FA 4KPYA 1DARA 2J9EA 3UWTA 4F36A 3X3UA 2BVZA 1HMVB 3OQ2A 1HW8A 3M32B 3CC7S 2UUCJ 4QIGA 2XI3A 3DMJB 2WB4A 1JKHA 2FY8A 3UI3A 1QTMA 1J5OA 4OYIA 1YBTA 4OZLA 4A8WA 2G2YA 3CPWR 3T1HJ 1HNXJ 2WZ1A 4G6VB 2ZH7A 2BA9A 3GV8B 1JXVA 2HFNA 4GO5X 1Q0NA 3S8SA 2EK6A 3KK3B 1H73A 4NZ0A 4C3LA 1HA1A 1RZMA 3RB4A 1VYAA 4OZJA 1UKUA 4I1TA 1OYEA 2VFRA 4LF6J 3OBIA 3KUGA 4DU7A 1S5ZA 4Y2KA 1NK9A 2A2DA 1N5SA 3DRRA 1EQMA 3LA0A 3CDWA 3R5CA 1S6PB 5ETNA 1HIYA 2XHCA 1ICEB 5BYRA 4X62J 5HVHA 4CH7A 2ZZMA 5I42A 2W25A 2DXDA 2UXBJ 3FDSA 4U8YA 1S6QA 3MM5B 2EK1A 3M2UA 2YWKA 4ILMA 5EWEA 1FT8A 2IJNA 3SCKE 3KK2B 4M5LA 1UWBA 4FVMA 4ZCLA 3DKDA 3IRXB 5J1NA 1QUVA 3KLHA 3LWLA 2BKNA 2M70A 3R1LA 4EGLA 1RWUA 2V4JA 1S76D 2R3VA 1M5OC 3HJFA 3IRWP 4TLRA 4XDCA 1D3WA 2UXCF 2KFNA 3OLBA 1CVJA 4X4RA 2B9XA 1XR7A 2Q6CA 1RB0A 1SL2A 4DF4A 1Z4UA 3NG8A 3CNQP 3IN5A 4V1Ak 2LXFA 1T03A 4R8UB 2EC0A 1NPKA 2GQCA 2RRAA 2BKPA 1S1WB 3HHLD 2PSZA 2PEHA 3MEDA 5HVFA 2Z4PA 1TFWA 2R7WA 2KRRA 5I3UB 1M90T 1TKZB 5HMZA 4USWA 2DO0A 2UV8A 3WC2A 2YY3A 5LOQA 2G4BA 4UUXA 1FESA 2HHPA 1BQMB 3DRSA 1RT7B 5LSRA 1TKTA 3Q2SC 2OPQB 4N76A 1QUPA 2XYGB 4PG6A 2QTWA 1U8WA 3ENVA 3HK2A 1S77D 3V81A 4JI2J 1YRXA 4TQRA 2ZDOA 2HVIA 2MQPA 4DR5F 3G87A 4DLGA 3VAFA 4WPAA 4DZDA 1VISA 2CYYA 2LLZA 4Y0FA 3K17A 2MZTA 3J7ZT 2MLYA 4X4SA 2HVEA 2CNLB 2NXEA 4DDFA 2VOPA 1PJ5A 1NRKA 2OMLA 4I4BA 2CNKB 4L3NA 4DV7F 4LT6A 3GV5B 4MYUA 3RZAA 2AGPA 3DM2A 4I2QA 2ZD1B 3W2VA 1VOMA 1SI9A 2C3PA 2DR6A 1U48A 1BQNB 4DV3J 3DOKA 2M9KA 1U45A 2JLGA 4EI2A 2QFIA 1RHQB 4E98A 3GP9A 2RQ4A 3Q8UA 2KG1A 4JI7F 3NKYA 3QYYA 3MAAB 4PXBA 1IQZA 3US5A 1IR1A 5ETOA 3RR7A 1N8RT 4QYZK 2ASYA 3QMQA 4DV0J 1SUQA 2IMWP 3C14B 3BF4A 3GSIA 2E1MC 4O23A 2FGCA 2X7IA 4RO0A 1ZPVA 3HI9A 2CQGA 4H4KC 1WC5A 3ZZUA 2CJYB 1R8HA 2BXJA 4MK7A 4AMNA 1V3RA 4RW4B 4IFVA 2FQQB 4LF5J 5HROB 3W9IA 2X1GA 3ZZTA 2A6OA 2FIUA 1WOOA 1TL7A 5FD1A 3AOCA 4IKAA 4DUZJ 1DBDA 2MZJA 1FJCA 2EW9A 4WE1B 1NJXA 3GFHA 1FXLA 4WZMA 2ZJQQ 3CMES 4OJGA 1F9FA 3X1LB 1HMVA 2J7WA 4A4JA 3VGVA 3ISZA 1LW2B 3M30A 3M9OB 1MMDA 4HACB 1WELA 4WFNQ 3KHRA 3MFHA 3DLBA 4F7VA 1U0SA 5HMWA 2QT7A 3K5MA 3C6UA 2DNLA 3MD1A 5L1LA 3KK3A 3GYXB 4YP3A 1ZZNA 2K8GA 2C2ZB 2C3MA 1VQ5S 2DJWA 4RZRA 5B0FA 3ZTSA 3J81Y 5G0RB 2J0QD 5AJ3J 1F9EB 4KIAA 3L3CA 4QIWD 4ZJLA 4NLDA 3R2CJ 2VKZG 2PC6A 5KG2A 4LFAJ 2MJNA 1Y11A 1V3ZA 3SIPB 1YQHA 4AQYF 4MH8A 3UCZP 3OVSA 3TEGA 4MYTA 4DPUA 3I0SB 4RNMA 4QYZJ 4WCEQ 1UWAA 2F8MA 3FSYA 3MM5A 1GT8A 3QGIA 5IXUA 3EVWA 3IC1A 3OV7A 3U1NA 2I5JB 3Q23A 3TUPA 3NL0A 1EARA 4L75A 2BJDA 2ROGA 5E3QA 1QSYA 2W9AA 3D6HB 3SV3A 3HF5A 3IRXA 3MMCA 1VS3A 4ED2A 5B0CA 1S4FA 1FDAA 2QV6A 3AJ2A 5H9FK 4X65J 1QVFR 2B6AA 4A8YA 3QGGA 2Y1IA 2NUUG 1LEOA 4NLGA 3Q89A 2XY6A 2DNGA 1WC6A 4R8UA 5KFRA 5CYJA 4UOCA 3RB0A 2IBOA 2V94A 1S1WA 3TAMA 1S7HA 2YWGA 2VQFF 4HDHA 2I9SA 5GAHU 2AU0A 2QLBB 3K5NA 5I3UA 1X5PA 2P6TA 1WEXA 4QWDA 1URRA 2XTJP 1U7LA 1K1QA 3R1HA 1ZM2A 1BQMA 4GRSA 1JLFB 4B3RF 4AL6A 4WXOA 3TOQA 1VQSA 3SEOA 2OPRB 2LDYA 4P7VA 3VTIA 3EJMA 5H9EK 1EKSA 2KZZA 2K06A 4FYYB 2BZ2A 4CLPA 2V4QA 4A47A 2R8HA 2OD4A 2W9BA 1RYRA 1RWVB 4ZVFA 4A8SA 2FVPA 4AMOA 2Y1LB 3DN9A 4L73A 3MGJA 3OL8A 5E3AA 1SQFA 4NA3A 1F5CA 3DRYA 4HEA9 2ZOMA 1SBRA 2PFDA 4I7FA 3I96A 2MQLA 2DGUA 2CPFA 4OLOA 1S72S 1R3NA 3N6NA 3M6WA 4TU9A 5EN1A 2UP1A 2XG8A 1I3OB 4LF9J 3KLGB 4TY9A 3V2UC 4M94A 5F8LA 2XO7A 1BQNA 1NAQA 1JJHA 2VZ9A 3EVMA 5H9FJ 9RUBA 4P2SA 5CCMA 1FF2A 2G2OA 3T6BA 3W5XA 1KQSR 1F3VA 3D4JA 3MAAA 3EGZA 4LVOP 1HR0F 3QO9B 5LMNJ 3MPUB 3I87A 2R7RA 4B9UA 2ATLA 2XGPA 3GYNA 3IO1A 2YNIA 3C14A 3VAIA 2ADCA 2Y8WA 4ZP8A 2E1AA 3ZZZA 3RW6A 4JI4F 3BV8A 4HH0A 4P2MA 5DDOC 2L9DA 4LRBA 2VDHA 1YJ9S 3HFVA 3MEGB 1R8AA 1R8PA 1YJTA 2E5LJ 2VB6A 3EDQB 2WHOA 4WZQA 1ZTTA 1IBLJ 4AFFA 4WE1A 4HI2A 3RB3A 3HHNB 4DLEA 2MMYA 3KG1A 3EM1A 5LL6d 3VZIA 4RNHA 1M1HA 4X64J 5KG1A 2APOA 3LP0B 3S01A 2W7OA 3K7RA 2KH9A 3OL7A 4J9UE 3ZNJ1 4DR4F 2DNRA 4HACA 1NO8A 2GHWA 2AV5A 4AT1B 1N34F 3C2PA 3ELHA 2DKOB 3J7A1 3CDAA 2NZ4A 4OX8A 4ZVQB 4JI5F 5C42A 4MTPA 1UTAA 4MMOA 1PAEX 4OI6A 4RWXA 4B9TA 4GMKA 4EK2A 5LMUF 4QWEA 3PO4A 4URSA 4Q8FA 4ZVEA 4HI1A 2QSWA 1WF1A 2NZCA 5KT7A 1H2TZ 3GFYA 2CJQA 3O3LA 1RKJA 2Q6BA 5HP1B 2JRSA 3FFIA 1ZPWX 3TRGA 2FJXA 2IM2A 1EP4B 4DL6A 3I0SA 5KAKA 4RW6B 2GVZB 2A6MA 1MMLA 2CQ3A 2HLUA 4PUOA 3TX8A 3D66A 1H6KX 3E51A 3M2RB 1OYDA 3MCSA 4N56A 4B9NA 3AD9C 2AJ4A 3FKBA 2ZHOA 2DNZA 3EGNA 3DC2A 1UFWA 4DQPA 3HM9A 2LQ9A 4O3OA 4PWWA 4OV1A 1QAYA 4B9SA 3PNIA 1HPZA 1PGZA 3BO2A 3G9CA 3VAMA 4NI2B 1R0BG 5ETMA 1Q16B 3JSRA 4QJVA 2G0CA 3GQCA 4C11B 1G1XA 1DTTB 3CJKB 3JSYA 3RRGA 3J81U 4ZJQA 4C3MA 1DLOB 2MLXA 4RL1A 2R8JA 4E0DA 1FJEB 3HFZB 2OI2A 3GB0A 4PRFA 3H20A 3CB4A 4CO0A 3KLFB 4RW8A 1QJHA 3R5BA 2ZKUA 3H0PA 3J80Y 3H5XA 2BX6A 2ZDPA 2VG6A 3RBEA 5HMXA 1NJYA 5IOLA 1VBZA 3HVTA 5D4PA 3FEZA 1VJQA 4RBUA 1ZETA 2HZCA 5EX3A 2BDPA 5IM0A 2QEXS 2PMZD 1X4CA 2K3IA 3KNGA 4LF4F 2RVJA 5EWGA 3M9MB 2CZVC 1S1UB 1VQKS 2YVSA 2FHKA 3GIKA 2I6WA 4AMPA 3RAMA 3J7AN 1ZBTA 3AY0A 1DURA 3L9ZA 1H98A 1WNEA 3KHGA 1NZAA 4B17A 3IG1B 4DV1F 3VAJA 4Y6IA 4U67Q 3FMWA 3LP1B 2MKJA 1VR6A 1RAAB 3ETMA 2DHXA 4LSLB 3QT5A 4YN3B 3KLGA 3KLIA 4NLQA 2EPIA 3UFCX 4F4WA 4DR7J 3TVKA 2JSXA 1CPZA 2YKNB 2OPSB 2D3UA 4K4WA 1DY3A 4DSJA 2RH3A 1FRXA 3G6XA 4C8KA 2POKA 4ZVOB 1FDDA 3QO9A 1FTCA 1V5VA 2HNYB 4YUDA 3AH6A 2KVIA 4ANCA 1L3UA 2OH2A 2YKAA 3C16A 1REVB 2K7KA 4O3RA 5IC6B 4H4KA 2R8IA 4BDPA 5C25B 2O5DA 4O4GA 1FRMA 2RHQB 1S12A 3DDKA 4USMA 3P5TL 1NDPA 1W25A 2VH7A 2OIHA 3OUYB 4WYLA 1GEHA 1NHUA 1GTEA 2VPZB 2EG2A 4FXDA 1U1PA 4G3IA 4P9SA 1QE1B 2GAGC 2UUCF 4X4TA 3SZ2A 2GCFA 1BC6A 1VFJA 3ISND 3KJNB 2FGOA 1QAIA 3CMAS 1HFEL 4ZLPA 5JUMA 2RRBA 3T1HF 3CCLS 4DSIA 1HNXF 1AZSB 4JI1J 1YZ6A 5KG4A 2YKPA 3MECB 2HNDB 4OX9J 2B9EA 1CJVA 2V8HA 2W1BA 2KVQE 4OHWA 3MR5A 3LGMA 2Y1JA 1D8YA 1P1TA 2JJ4D 1RHRB 4WTYA 4KR0B 4DPXA 2IVYA 3KK1A 1MLAA 4UF4A 5K8OA 4G1IA 2HMIB 2IM1A 3BB5A 2B8PA 4WF9Q 2ZOFA 2JFKA 1VBKA 4KB7A 4FXWA 2NCKL 4DPWA 3ZNUA 4X62F 4QWCA 2CPHA 4FNHA 5F9LA 5BJRA 2RE1A 2UXBF 4U96A 3TW0A 2UUAF 2R7QA 1FRLA 5F8MA 4EZ6A 1RAGB 3HSDA 1EP4A 2YNHB 1U0HA 3RYLA 1YJRA 3HP6A 2Q3PA 2GVZA 2R8GA 1M5VC 1BD6A 4IQXA 1SQGA 4F67A 1XMOJ 2F63A 2XULA 3MPDA 3QSIA 3KJQB 3W9HA 4M5KA 2D3ZA 5A8KB 5KG5A 1JWWA 2V34A 3RG6A 1WEYA 9ATCB 4NZ6A 2HNZA 1X5TA 2VODA 2C2KB 4MKBA 3KUHA 5KFTA 1FE4A 1RAJA 1RA7A 4DSFA 2EFGA 4ILRA 2QA1A 1RUSA 4IG0B 3MZIA 3GJSB 4NLPA 3JYTB 4NI2A 4LBIA 5L1JA 2WVCA 4B9MA 1DTTA 2Q43A 3CJKA 4AD6A 2C22A 5GMDA 2MZQA 1N5TA 4M5DB 1K0VA 2XWYA 5GAEU 3G71S 3KLFA 2O66A 3TR5A 2DH8A 1RLCL 2YWWA 4QU7A 1UW9A 3BGUA 3WZ0A 2IC3A 3GIJA 2ZH8A 4PYAA 3OVBA 3M8SA 3VAGA 4KE5A 4JV5J 4HDGA 4JI2F 3IM9A 5L39A 1VQLS 4E2FB 4M63A 3R5DA 3HSZA 1YZ7A 1PO6A 1N6QB 1EAYC 2NS1B 3OJSA 1S1UA 2BRKA 2E7XA 3DXSX 1X0FA 1X31C 1U02A 2SXLA 2XLIA 3O44A 1U1RA 5CZDA 4IO1A 1D9DA 2FHOB 1HHTP 3IG1A 2QE5A 3C6TB 2IJRA 4NLSA 4JB8B 3A3NB 2JEJA 3QATA 4DV3F 4K0KF 5D0GA 3ONQA 1TL3B 3W61A 4RU2A 2G0JA 4LUBA 3BGOP 3N6MA 2VIHA 4C0HA 3AXKA 2YH0A 1W2BR 2YKNA 2OPSA 2RT3A 3GCXP 1SQEA 3K2YA 4DV0F 3PO5A 1HNVA 4BC9A 1U2FA 2I0XA 4USHA 1RBAA 1V3SA 2M8HA 2VJVA 4KTQA 4G1QB 5D4NA 5AE3A 5AXNA 2QG9B 4O0IA 3D68A 3IFEA 1T95A 1VIXA 4J9QA 2PFFB 4LF5F 1SIZA 2FLNA 1REVA 3CJ3A 1GMUA 2RUSA 4PZVA 4WK1A 1HD1A 3O6QA 1UFLA 1KLMB 4N7TA 5HJXA 2A0FB 2MLZA 1YKWA 3D5MA 1KKHA 4DUZF 1WSVA 4HHJA 4ZDNA 1HYSB 1LQ9A 2DYAA 2DGQA 2ZBRA 4Z7CA 5D0EA 1R0AA 1Q5VA 3CJ0A 3CE8A 4AL7A 2AP6A 4DCPB 1JLCA 3K5PA 2VL1A 4F0KA 1LFWA 2LQ5A 5AXKA 1AZSA 4TU7A 3QJJA 2HNDA 1RT6B 4IDKB 2BANA 5EGYA 1HQUA 3CTRA 3GR1A 4DUYF 2VZ8A 4A8XA 2YNFB 4QR2A 1OSDA 1RCXB 2FUG9 4UUWA 4WU2A 3ZFVA 2CWKA 2RIJA 5GADU 2KT5A 5AJ3F 1FNMA 4YOEA 1FTRA 2C2DA 4UOHA 4KKOB 2Y0BB 2PEBA 2VOOA 2OEJA 3W5ZA 4LFAF 1B7YB 1RTHB 4QW8A 3BR8A 2PMHA 1HNIB 1JIHA 1MROB 3CSKA 1NH7A 1RTIA 1ROFA 4TXSA 1U1OA 1C1BB 1P8GA 1RABB 2BE7D 4LMZA 4AL5A 4DFMA 5F8JA 4OZ3A 1HBMA 2M88A 4WKRA 4YR0A 5DQIA 2RU3A 4A8FA 3I31A 1PBAA 3KTQA 2DGSA 4N41A 1U09A 2DRBA 2ZJRQ 4JV1A 1RU2A 3MM7A 2NSCA 3GFZA 2P6SA 5A8KA 3CD0A 2IHR1 4CQ1A 1MWYA 3VWSA 4X65F 2JC1A 5JXSA 5LXRA 4ZVSB 2LDIA 2GX8A 4ZVRB 5B0AA 2IVFB 3H25A 1TAQA 1N4LA 1U6BA 2Z2ZA 2FHJD 4ZCKA 4DL5A 3D0HE 4P74A 2WBRA 4IG0A 4NYZA 4C9DA 2DCLA 2ZE2B 2OJ3A 3JYTA 4HL9A 4URGA 4JI0J 1JLGA 4IR9A 1URNA 1G4CA 3RBDA 5CZXA 1QLNA 3RJMB 3PY8A 4L6V3 1KD1T 5JVGQ 4DMZA 3QQCD 2ZBQA 4NLVA 3OSNA 1KONA 3H4BA 2HRYA 1R0CB 3UPFA 3OHBA 5KT5A 2B4PA 1NK5A 4PPDA 3JTOA 1WG4A 2NYHA 1XQIA 2KHCA 5DG7A 1SXLA 4LR8A 2H5EA 2FLOA 3JQKA 3K59A 4ED3A 1HWLA 3M8QB 3TWZA 2CPEA 3DGVA 2HQGA 1VRTA 2HHWA 1UVKA 1YX2A 5T41A 5KFEA 2PE8A 4FS1A 4F2RA 1RDRA 4Q2MA 3RBXA 1U1MA 3SFUA 1BWEA 1CULB 5KFJA 4AMMA 5IS2A 2LECA 2B7CB 5L38A 3DOLA 1RTJA 1VQ7S 3GV7B 4IRKA 4ERDA 3PJXA 1N52B 2DVIA 1AW0A 1OWXA 1X8DA 1N36J 4K4TA 4DR5J 3Q8RB 3I82A 1TL1A 2AZ1A 5DLFA 3HSJA 2MKKA 5GAEI 5LMNF 1HKAA 5FJ4A 1WWHA 1DRZA 2R2UA 2Z8QA 4LFBJ 1R89A 2V67A 4RW7B 2DY9A 4WKYA 3CVKA 2BRLA 3CCUS 2MGZA 3PDNA 4Z37A 3HD2A 3ULHA 3HMJG 1C0TB 2NXNA 4J9PA 2AZ3A 4NLRA 2BQ3A 5MAOA 5LSOA 1CC7A 5F0WA 4NRTA 2AD9A 3CCWA 1U1NA 2QO3A 3ZTRA 4DUTA 1KLMA 2MQQA 4C6AA 4JI7J 4Y65A 2MYFA 4CDIA 2NPFA 2VF3A 5D78A 4EO8A 3UN5A 2MZ1A 4RPFA 1HYSA 4X64F 1CS4B 2B51A 4U95A 3FBFA 3R6LB 2DNPA 3QPIA 3T9ZA 1RP5A 2RB7A 1IKYB 4DV4J 4OYWA 1KC8T 4IDKA 4J9LA 3NNHA 4YHHJ 4CLUA 3GIRA 2KT3A 3VVTA 3DXBA 1OSCA 2Y0SD 3WIVA 3PACA 3MM9A 2OTLS 1RLDA 2IDEA 2DH9A 3MURP 2IAJA 3M2VB 4ZVTB 1B4SA 4F8RA 2AEMA 4J9MA 3C15A 5DETA 5KTQA 1S9GB 2QL9B 1TUVA 5CA5A 4IYQA 1RTHA 5M2PA 2ZEJA 4ZIVA 1HBNB 1HNIA 4DI6A 3MUVP 3BR9A 3R7SB 4J9VA 1BXNA 1QD1A 1SB6A 4IQMA 2KN4A 4NLXA 2J6TA 2MQNA 3CJ5A 4DR1J 4X4PA 2QMWA 2FHMA 2WB1D 5KG0A 1S7IA 1GMVA 4KRWA 2AHOB 2OEKA 3BH7B 1MW7A 4JUZA 3TO8A 1SKWA 2H51B 2WSCC 1NM2A 3O8WA 3QRQA 4WXWA 5ETKA 3TJAA 5D4OA 3IM8A 4CIOA 1DFDA 2NPIA 3LTOA 2K2PA 3UDLA 1FX2A 2KL8A 3MHYA 1HI1A 2B5JA 1U1LA 1KWMA 3UR3C 4LF2A 4RX6A 3Q22A 2XMWA 3ZTOA 4OI2A 5K5MA 3OTEA 3NBPA 4AE5A 4ZKAA 3NP5A 1GXTA 1SJQA 4GKJJ 1EHWA 1YK9A 4DL7A 3PYEA 4J37A 2ZE2A 5GADI 4ZP7A 4U7UK 4NRUA 3TA0A 2AX0A 2ZFHA 1VCTA 2EFQA 5J2NB 4K5SA 3B4MA 3C8YA 5KFHA 2ZH1A 4K4YA 1LWFB 5BYSA 4IFYA 3A8EA 4TYBA 3PV8A 4TNOA 3SV4A 5A6PA 4N5SA 1QSLA 2LFVA 2R9LA 3CCZA 1OO0B 3L95X 2CDQA 2YX4A 4CH0S 2D9OA 1PYTA 3THVA 1R31A 4AYBD 2LEAA 3LF0A 3MWBA 2VC1A 1Q82T 4NLTA 2GJ2A 3H2VE 3FEXB 3MPYA 1GXUA 3G82B 4K4UA 1XERA 1NDKA 2D9PA 4NLWA 3MUMP 1UPPA 1KVIA 4QZVB 3I0RB 3I5CA 2J7KA 4LBHA 4EBEA 2QL5B 4UQGA 3M8PB 3TZYA 2K7JA 1T3NA 4FF2A 3CMQA 3P4UB 4ZVHA 1CJKB 3SCJE 2ZH2A 1CULA 1YJUA 1IN0A 4CLSA 4ANEA 3ZO7A 2HLTA 4TVAB 3VGSA 1D1UA 1M5PC 4X4NA 2DHAA 4WIIA 4JI3F 4DR7F 2LA6A 4OLPA 3MOJB 4NA1A 1UVIA 1Y0HA 1EJ7L 5DGBA 1PCAA 5J2PA 1JJCB 3PCOB 1Q8LA 2Y3YA 4PQUB 3DRPA 2XHWA 4KGVB 3TUZC 1EB0A 1KQKA 2MSSA 4FZVA 4IOAQ 4WU3A 3LGNA 3TEHB 3QT7A 3B54A 1FD8A 4HT7A 2N3LA 3AQOA 4PG5A 2EWHA 4FF4A 1WI6A 4YDXA 1KTVA 4KO0B 2FD2A 3QLHA 4W92B 1K1SA 4ED6A 3RAXA 1EETB 5CH7B 1NUEA 3KLEA 3NNAA 1UEUA 5CXTA 1HBUB 2DNOA 4LSZB 3R97A 5CAAA 4L72B 3QZ8A 2CQ2A 2DR7A 3UVJB 1BLUA 2CPXA 2W24A 1CS4A 1PKUA 3OR2B 1HLWA 1YGYA 5B7WA 2LMIA 2A18A 1IKYA 1NJWA 2P9GA 2YWHA 4USTA 3OL6A 4ZVGA 2LQBA 4I64A 4CT8A 3KHLA 1FKOA 2KKHA 2FZGB 4NCGB 1VK3A 3Q24A 3PKMA 2F65A 3CC2S 4O3SA 4HTIA 4DV5J 5KG7A 2MSTA 2V68A 2ILYA 2DY1A 4ZN1A 2DISA 3OD2A 5LSLA 3GJTB 3M2VA 1SCJB 3RRHA 1T9YA 4M5NA 3O1LA 2FVQA 2WONA 1S9GA 4EU0A 1E6VB 3THTA 1WC4A 2CA9A 1WSRA 3E3XA 2RJZA 1SV5A 3KMQA 2L9WA 2AMCB 2B9YA 2HSEB 1HBNA 2CPJA 2YWFA 3V4IB 1N34J 1ELOA 2VFUA 1YLXA 3TAPA 3CDEA 2AYMA 2HGMA 4ZHRA 2QC3A 3AJDA 1S99A 1XMOF 3GMGA 5LXYA 1RWXB 3EVOA 3OSPA 3S6EA 2LU1A 4E8UA 2DO4A 3P45B 3UCGA 2JNJA 5IV3A 3BSAA 1S1TB 4IH5A 1HQ2A 3IGNA 3M7VA 2Z30B 3ITHB 2V63A 2BW7A 5ITHA 2CNNB 2PDAA 3POTB 1C0UB 4CNYA 1O0PA 1NHVA 3NNCA 1TUGB 2ZM6J 3MOZA 2EKYA 5DRKA 1F0XA 4ZP6A 4BC7A 2V2QA 1TK8A 3B6BA 2MKYA 1X9MA 5K14A 4KJIA 1JLBB 3BN7A 2ASDA 1A9NB 3OFGA 2W9CA 2YTCA 3W66A 1N88A 4DX8H 2FC8A 2HQIA 1RT2A 5D0RA 5J2MB 5J2NA 1XC9A 1UP1A 1I51B 4NWBA 2CQBA 1LWFA 5KFLA 3O2IA 4QCLA 1JLQA 1ZZFA 3PXGa 3MTKA 3HVAA 2EG1A 1X4BA 4JV5F 3LUYA 2RKIB 3CEDA 2LQ8A 5CYMB 2CKWA 5I3QA 2XCPA 3BSOA 5ETLA 4ED0A 3LO3A 2OMOA 2G2ZA 2AQ4A 2J9DA 4CM2A 4FF3A 1TL5A 1PIEA 4Y28C 5DZ6A 4ES3A 4KV8A 4EYHB 2GIFA 3V6DA 3NGSA 4CLFA 1B0PA 2J6UA 1XMQJ 1RTDB 1O8BA 1F2HA 1MWZA 3GWCA 1WEZA 4XPCA 3OHAA 3VF0B 4FBUA 1CJKA 2UXDJ 5E3CA 4F26A 4DPTA 2MY8A 4O3PA 3BQ0A 5B0BA 4JBCA 4I56A 1JLAB 3F44A 2N7YA 4RR5A 3M4XA 3HXMA 3TZZA 3IAS9 5ETQA 4WFBQ 4FYDA 1PILA 1M5KC 2AYGA 4MIAA 1L3SA 2IJFA 5M2UA 3TP2A 1RT5B 2DGVA 3BJYA 3UD4P 1MN9A 3HLUA 3L09A 1KNZA 2EC2A 4N8NA 3KDOA 3AB2B 1J27A 3GYGA 1FKPB 2GMLA 5SZTA 3DLGA 1BWVA 3BGRB 4BWMA
chains in the Genus database with same CATH topology
3EZOA 3HHDA 3TZXA 2HG4A 2VKZG 2QC3A 3H0PA 2QO3A 3RGIA 2G2OA 3QATA 3TZYA 3TZWA 4RL1A 3K89A 4RR5A 2C2NA 2UV8G 5CZCA 3HMJG 3SBMA 2VZ8A 2JFDA 3G87A 5CZDA 2QJ3A 3CJ8A 2G2ZA 2H1YA 3R8YA 3HJVA 1NM2A 3PTWA 2PFFB 5DZ6A 2CUYA 4QBUA 3TZZA 2JFKA 3TQEA 5DZ7A 3IM9A 3BV8A 2G1HA 2VZ9A 1MLAA 2G2YA 3R97A 3IM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZO A;  3HHD A;  3TZX A;  2HG4 A;  2VKZ G;  2QC3 A;  3H0P A;  2QO3 A;  3RGI A;  2G2O A;  3QAT A;  3TZY A;  3TZW A;  4RL1 A;  3K89 A;  4RR5 A;  2C2N A;  2UV8 G;  5CZC A;  3HMJ G;  3SBM A;  2VZ8 A;  2JFD A;  3G87 A;  5CZD A;  2QJ3 A;  3CJ8 A;  2G2Z A;  2H1Y A;  3R8Y A;  3HJV A;  1NM2 A;  3PTW A;  2PFF B;  5DZ6 A;  2CUY A;  4QBU A;  3TZZ A;  2JFK A;  3TQE A;  5DZ7 A;  3IM9 A;  3BV8 A;  2G1H A;  2VZ9 A;  1MLA A;  2G2Y A;  3R97 A;  3IM8 A; 
#chains in the Genus database with same CATH topology
 2JVR A;  3DCA A;  3NOC A;  4M5G A;  4RUH A;  3V4M A;  1GFW B;  1NDL A;  2MB0 B;  5D15 A;  3DU5 A;  3OTC A;  1HBU A;  4KYZ A;  3BBC A;  1K0T A;  5D0H A;  2QZ8 A;  1D09 B;  4M5H A;  3IS9 B;  3A8I A;  2AGQ A;  4ETZ A;  2RF2 B;  1B7F A;  2VV5 A;  1ULR A;  3OR2 A;  3KMS A;  2BM0 A;  1TFY A;  3GTY X;  3DLE A;  3M8Z A;  2XZW A;  2VPY B;  1DTQ A;  1A6L A;  3DLK B;  2MTL A;  1VRU B;  2FZK B;  4NCG A;  2P5V A;  1S9E B;  1L3T A;  2PI5 A;  2WCX A;  3NXZ A;  1XIQ A;  1SJF A;  1SC3 B;  1ZA2 B;  2CFX A;  4FPR A;  3UDV A;  3VGU A;  2WOM B;  4NLY A;  1YJV A;  4UY8 5;  1H74 A;  3BSC A;  3QFH A;  4I2P A;  3AQP A;  4I6A A;  3ENQ A;  5DO2 A;  2BKO A;  3SYZ A;  2MKS A;  1TUW A;  3GFX A;  4N8O A;  2MZS A;  1RAC B;  4J5O A;  1T3O A;  4P2F A;  3DLJ A;  4QW9 A;  1ZAX A;  2QLF B;  4RW9 B;  5GME A;  3V4I A;  4ICL B;  2ZH3 A;  3P96 A;  3DOM A;  1N5Q A;  4TN2 A;  2MKI A;  2MXY A;  2VA2 A;  4ZJO A;  1RAF B;  4LBP A;  3VV2 B;  5DDR C;  3MM6 B;  2Y9H A;  4QWB A;  4B02 A;  1LWC B;  2FVS A;  1FVQ A;  2IPO B;  1CQN A;  4DR3 F;  1IBK J;  3CT9 A;  3HPO A;  3QNW B;  3UR0 A;  3I6P A;  3AOA A;  3U7J A;  1IVZ A;  3EXY A;  3VCD A;  4XO0 A;  1B99 A;  5HLF B;  2AYB A;  4PWD A;  5DJB A;  2X51 A;  4W4M A;  1TK5 A;  2UUA J;  1N54 B;  3POT A;  4Q7A A;  3Q8S B;  1FNO A;  4J90 A;  1SJ3 P;  1IJE B;  5GAG U;  2XLK A;  1U8S A;  3IBW A;  3HUL A;  4NAS A;  4QPX A;  4JI0 F;  1XNR F;  2R42 A;  3KLV A;  4C8Z A;  3D9B A;  2CPZ A;  1RAI B;  2FY1 A;  1XR6 A;  5C7P A;  5JJB A;  1VQM S;  3BQ1 A;  1U24 A;  3L7P A;  3OL9 A;  4GO7 X;  4ZS6 A;  2J5A A;  1SJ4 P;  4IG3 B;  1E6Y B;  3ZZY A;  1YJW S;  1C1C B;  4ER8 A;  3D1O A;  4OYX A;  5KFD A;  2DIU A;  4IH6 A;  4OZ2 A;  3MPV A;  1HWJ A;  3MEE A;  2P2C B;  4ZCM A;  3AOD A;  2X3D A;  1P9Q C;  3IXQ A;  1FEE A;  5KFB A;  4OZ1 A;  2V2V A;  4DSE A;  5ETR A;  3LP2 B;  3OPK A;  5J1E B;  4Q8E A;  2J0W A;  2IMO A;  3BSN A;  1NEE A;  1DQ9 A;  4K4X A;  2E1C A;  4QOT A;  1OPZ A;  1KDN A;  4P6Q A;  3ET6 B;  3OFH A;  1VQY A;  3MD3 A;  3A8K A;  2KM8 B;  2E66 A;  1RTD A;  3IWX A;  4KFB B;  3PW7 A;  1BHN A;  4YB5 A;  4DV2 J;  4R5P B;  1MSW D;  1FDB A;  2NXJ A;  1P9Y A;  4LSN B;  1EX8 A;  4AXJ A;  2BJ3 A;  3RGI A;  1N36 F;  1T94 A;  1HQE A;  1JLA A;  1S6U A;  4CP5 A;  2I2Y A;  1LOU A;  4EWT A;  3ILO A;  2P9C A;  1Y5L B;  2OSQ A;  1PBU A;  5C24 B;  2KU7 A;  4J9R A;  1UET A;  3VAL A;  4OYA A;  2LQJ A;  1T8E A;  1UVM A;  3G2X A;  2HVZ A;  4RJV A;  4B3S J;  4M5M A;  4LFB F;  2BE9 B;  1TVR B;  2B7B B;  3I4P A;  2VPX B;  1T05 A;  1FI4 A;  4MFB B;  1KVJ A;  3W63 A;  2WSE C;  1FK9 B;  1UJ5 A;  1RT5 A;  4OZ5 A;  5GVQ A;  1FRI A;  2UVU A;  2GHP A;  4ZPT R;  2YNG B;  3FSX A;  1KRP A;  3FCV A;  4ZA1 A;  4K0K J;  2HPU A;  4Y2C A;  1S59 A;  2D3O 1;  2L48 A;  4L76 A;  2PD1 A;  1MU2 B;  4WFA Q;  3BGR A;  2VFT A;  5FII A;  1NCL A;  3MMB B;  4KHP J;  2OP5 A;  4MIB A;  2H65 B;  2KXN B;  1F1B B;  4ZPB A;  2W7P A;  2MDA A;  2C3U A;  1O51 A;  2ZUA A;  2VKR A;  5ETP A;  1VHF A;  2MQM A;  3W65 A;  4WK3 A;  3HKZ D;  3KKF A;  4ITS A;  2WK4 A;  3H7H B;  3EE3 A;  3IS9 A;  2D74 B;  4DV4 F;  4DL2 A;  3CCM S;  1VC5 A;  3JSM B;  3T5H A;  1WD6 A;  4PAB A;  3B8H A;  3HFK A;  3BDE A;  1O6X A;  2CPI A;  4YHH F;  3DGP A;  2GO8 A;  2C3Y A;  5DLG A;  2JZ5 A;  1REG X;  4OZN A;  2UV8 G;  1FER A;  3KJV A;  3NS7 B;  3WQP A;  1IKV B;  2Q66 A;  5C2G A;  2N3O A;  4ECT A;  1CJT A;  3B4D A;  2WW4 A;  3P3D A;  1TV6 B;  2ZWO A;  4PQA A;  1S9E A;  4CLT A;  5KFV A;  2CZ9 A;  3U02 A;  2QMU B;  5EWF A;  1WG5 A;  2V2Z A;  3M32 A;  3SSQ A;  3V5R A;  3DMJ A;  1LNQ A;  4M1K A;  1FE0 A;  2BAC A;  3NAH A;  3CDB A;  4C0O C;  2AGO A;  4K50 A;  3EMT A;  3KYL A;  1TL4 A;  3MCN A;  3M8R A;  2FLL A;  1GQE A;  5FDL B;  3D67 A;  3HD1 A;  2B4U A;  1NB7 A;  4DR1 F;  2AJ0 A;  2ZH4 A;  4DUY J;  3BDP A;  4LRF A;  2DHS A;  1HBO B;  4ICL A;  4DV6 J;  2GNK A;  3SCL E;  2OO4 A;  5D3G B;  3MTJ A;  2EBG A;  4CT9 A;  1OMS A;  4MT1 A;  3GR0 A;  4MJK A;  2X1A A;  3WC0 A;  1HNZ F;  4JP8 A;  3MM6 A;  2QGF B;  4CYU B;  1LWC A;  1JNR B;  2V69 A;  1RWW B;  2GC8 A;  4K2J A;  4C8N A;  3W8G A;  3W5Y A;  4RBV A;  2R7T A;  3W64 A;  1TKX B;  3N6L A;  1S6P A;  2HYI B;  2QYG A;  2KT2 A;  2ZH6 A;  1FO1 A;  2X3G A;  3PW5 A;  3F56 A;  3MR2 A;  1A0O B;  3RR8 A;  1Y00 A;  2BV3 A;  1YJ7 A;  3LAM A;  4GKJ F;  4DS4 A;  2QL7 B;  3QJP A;  2KXH A;  1H0H B;  4P72 A;  5CCL A;  2ATC B;  3N9U C;  3DNC A;  1S1V B;  4P75 A;  3EZ5 A;  5E41 A;  1UFK A;  4ZPA A;  3KK2 A;  2WAQ D;  3LPY A;  3PX4 A;  2VBZ A;  1ZM4 A;  3CCR S;  1WDD A;  2I1R A;  4TY8 B;  2OFH X;  1H3D A;  4DBQ A;  4H4O B;  1S0O A;  3OFF A;  1BQX A;  3A13 A;  1X5S A;  2GS8 A;  2E5J A;  2E1R A;  1KFS A;  3NAI A;  1E6Y A;  3JQJ A;  2XSF A;  2B0G A;  3R3T A;  3IAM 9;  2J8S A;  4AXI A;  3M05 A;  3FK4 A;  4PAA A;  2DXF A;  3HX9 A;  2KJW A;  3BS9 A;  4NE9 C;  2FC9 A;  3TQE A;  3KG4 A;  3D1Q A;  3BKF A;  1N33 J;  5J2Q B;  3V6H A;  4QWA A;  1SC4 B;  2XWX A;  1YBA A;  3AT1 B;  1TKZ A;  2VBX A;  2ZWP A;  1IBC B;  3UE2 A;  3EX7 B;  3I4H X;  3GII A;  1RAE B;  4Y3C A;  2U2F A;  2ILZ A;  1RT7 A;  3ET6 A;  4Y2I A;  1WHW A;  4X4U A;  2OPQ A;  1SH2 A;  4U8V A;  4KH1 B;  2BJ1 A;  3MEK A;  3D6F B;  2ROP A;  2VQE J;  4R5P A;  5GAG I;  3W2W B;  2Z56 B;  1UPM B;  2F7V A;  2M5Y A;  1S1X B;  1X4D A;  4DL3 A;  4UT4 A;  1AFJ A;  4OZ0 A;  4IO9 Q;  4UY8 T;  1BGX T;  4LQ9 A;  5HAN A;  4NZ7 A;  1D8Z A;  3SSR A;  3QFW A;  4DG1 B;  4ZLJ A;  4U6P A;  2KB2 A;  4XIU A;  3PZP A;  4F4K A;  1OS5 A;  1RT4 B;  4NCA A;  1TVR A;  2W4C A;  5KFX A;  4MFB A;  4F3Q A;  5IWA F;  3UDE A;  1KSP A;  2ZD1 A;  4NLU A;  2FDN A;  2L9N A;  1WKJ A;  1HWI A;  4EFA C;  2H5I B;  3MR6 A;  4PCQ A;  1NZ8 A;  2VJU A;  1WHV A;  2BJ9 A;  1F2G A;  4LIR A;  1RAO A;  4OYP A;  4LRA A;  2CQP A;  1HHQ A;  3MMB A;  2JEF A;  3K89 A;  4ECU A;  2BBE A;  2XZD B;  2GMH A;  2W2Q P;  1AYE A;  5D4L A;  3DLH A;  1F3F A;  2KTQ A;  3N01 A;  4K8R A;  4HVZ A;  1KQG B;  1IWG A;  4NYP A;  3IA0 A;  2CG8 A;  2PT0 A;  2MPU A;  2E29 A;  4RW4 A;  5HRO A;  4C48 A;  2XMJ A;  4CLY A;  3MCO A;  2C2N A;  3R5A A;  2RQC A;  3PX0 A;  2DHH A;  1Q1K A;  4DV5 F;  5H9E J;  2QA2 A;  4QIF A;  4ZLL A;  2H9Z A;  1SJ1 A;  3T41 A;  2XCA A;  1FXR A;  3GE9 A;  1HI0 P;  1PG5 B;  2ZNY A;  5EDW A;  2E7V A;  1UVL A;  4H54 A;  2BYC A;  3CDU A;  3Q8V A;  2C42 A;  5KFI A;  4DQR A;  1LW2 A;  2LXI A;  3UDC A;  3E8O A;  5F3Z A;  4FYW B;  4F0M A;  4OX6 A;  3PKY A;  3EPG A;  5AE1 A;  2ALZ A;  3GIM A;  1RIS A;  3EUN A;  1WC3 A;  2F4V F;  1XBW A;  2H4Y B;  3F0N A;  2XBP A;  3KLH B;  5C5J A;  3FJ2 A;  1WTB A;  2V4J B;  3PJW A;  3TAN A;  2GA7 A;  1AT1 B;  1GMW A;  1YWX A;  2O01 C;  5G0R A;  2PI4 A;  2HQC A;  2CQI A;  2CQ4 A;  5KOW A;  2FJV A;  1Q8B A;  2F1F A;  3DI6 B;  2NQP A;  4URQ U;  2HHQ A;  3MMA B;  2ZIT A;  2CJ9 A;  3EXC X;  1M1G A;  4ELT A;  2FYX A;  4J9K A;  3AA8 A;  3J81 j;  2ZM6 F;  4YB7 A;  4QPT A;  2BJ8 A;  3THP A;  3OFE A;  1TAU A;  1VIO A;  2X1B A;  2GAH C;  1C4C A;  1S1V A;  2I5J A;  3OLA A;  3MI7 X;  1Q78 A;  4QIV A;  2ZBP A;  3H5U A;  2FLP A;  3DRS B;  2ACY A;  1WF2 A;  2R7X A;  4P2X A;  1NSA A;  1FHT A;  4TY8 A;  2HGN A;  1VMB A;  3FZ2 A;  4OI3 A;  2C1E B;  3QWU A;  4LR7 A;  2JFD A;  4A8K A;  2OLW A;  2WVF A;  3DU6 A;  1RGV A;  2GMJ A;  1FA0 A;  3PRB A;  2C2E A;  3V81 B;  4Y2A A;  1RYS A;  2XLJ A;  3H98 A;  2KZM A;  3GPA A;  2W4D A;  1V5I B;  1MWQ A;  4K4S A;  1Y9O A;  4CI0 B;  3W9J A;  2GIQ A;  1QVG R;  3R5G A;  3QIP B;  3NGT A;  1N0V C;  2EFP A;  4ED5 A;  5A8R B;  5F8G A;  2VAS A;  2E9Z A;  5C2C A;  5J2Q A;  1HNW J;  2OEM A;  4YY3 J;  2H54 B;  1WC1 A;  3A8J A;  4PWU A;  2RUG A;  2EKN A;  2LVW A;  3P5B P;  1XMQ F;  1RHJ B;  2O3D A;  2AJF E;  3DM2 B;  3W2V B;  1JLF A;  3D3B J;  2YKO A;  5I4M A;  1NJI T;  5BYQ A;  2UXD F;  2V8D A;  2OPR A;  2WTF A;  3DOK B;  3PFO A;  1FCA A;  2QLX A;  2U1A A;  3OTO J;  2HWH A;  1VRQ C;  3NLC A;  2JLF A;  3VZH A;  1N5Y B;  4MK9 A;  1G3O A;  3MCM A;  4DZ6 A;  3TNV A;  4ED4 A;  2OPP B;  1S1X A;  4OL8 A;  1WG1 A;  3QRP A;  3RU0 A;  1D9A A;  2P9E A;  4F25 A;  1FFG B;  2ASL A;  4DG1 A;  3G6V A;  2QYC A;  4ENO A;  2E7W A;  3NMA A;  5KT3 A;  3BBB A;  3SCI E;  2V9W A;  4ECY A;  2XMV A;  1KOH A;  1I1G A;  5B0D A;  4Q0B B;  2ALY B;  5HN0 A;  2CQ0 A;  1QM9 A;  2UUB F;  1TL7 B;  1YI2 S;  3D6M B;  1FWP A;  4JI3 J;  4I0W A;  4NL5 A;  4XPE A;  5GAH I;  1RI7 A;  1OQ3 A;  4K59 A;  2GGP B;  1VI7 A;  3MFI A;  2IY5 B;  3M30 B;  1JLE B;  2Z2L A;  1LWX A;  3LAN A;  1PAU B;  1C4A A;  1KHW A;  1X9W A;  4ECX A;  3QID A;  2OAU A;  5IC4 B;  5A0Y B;  5B08 A;  3C6U B;  2HAF A;  8AT1 B;  1KVK A;  1IKW B;  4YEA A;  3RW7 A;  1Q95 G;  4BLG A;  3NWG A;  3A3O B;  1RHU B;  4ZPW R;  3IP0 A;  4DFP A;  3KDN A;  1OIA A;  3LPE A;  1NKC A;  1OY9 A;  3CXC R;  5L8R C;  2MHN A;  3ZZ0 A;  3MEG A;  4CO4 A;  1FRH A;  2PN6 A;  3JTP A;  3A3P B;  2J6S A;  2ZC4 A;  3PHT A;  3QAU A;  2DR9 A;  2M7S A;  4ZIT A;  1GH8 A;  3MMJ A;  4LIW A;  3AD7 C;  1S6O A;  2NSB A;  2YX1 A;  3HVR A;  3LP0 A;  2KRB A;  1A7G E;  2X1F A;  3WHI A;  4W98 A;  2FZC B;  2XB2 D;  3K57 A;  2CJK A;  3KG0 A;  1L3V A;  5KFO A;  1WDT A;  4HHH A;  2ZKT A;  1V6H A;  4ID5 B;  4QBU A;  3T5K A;  3VQS A;  3MMC B;  2UU9 F;  3SQG B;  4DQI A;  1N5V A;  2GHV C;  3PYF A;  3HHL C;  1CC8 A;  3GJQ B;  1TQL A;  3UD5 A;  3P49 B;  1IBK F;  2B6A B;  1IUJ A;  5IZH A;  3HSG A;  1N32 J;  1VHI A;  2WSF C;  5F0U A;  1RK8 A;  2JOQ A;  4UW2 A;  1KBR A;  3DI6 A;  2EFN A;  8RUC A;  3MMA A;  1LK7 A;  5HP1 A;  2W2N P;  4DQQ A;  4ECZ A;  1Z1Z A;  2R2R A;  3TAM B;  4MIW A;  1F6T A;  4C8M A;  2ACM A;  4ZK7 M;  2VU5 A;  1S0M A;  1TKD A;  4RW6 A;  2ZH5 A;  1YHQ S;  1NH8 A;  4WBF A;  5H1S V;  4PXC A;  2YBV A;  5HQ8 A;  3M2R A;  2CXE A;  5AE2 A;  2AX1 A;  3T9N A;  1DZ5 A;  3AFG A;  3PRD A;  1MN7 A;  5CQG A;  2DGX A;  5KFP A;  3TAQ A;  2XNR A;  5L9N A;  2PO4 A;  5F8I A;  3RB6 A;  3LW5 C;  2Z2Y B;  4Y34 A;  2Z2M A;  4TYA A;  3QZ7 A;  3NWR A;  3HDS A;  2W9B B;  1UVN A;  1RSC A;  5KG6 A;  4ES2 A;  2J9D E;  4CZC A;  1T9V A;  3T1Y J;  1H7W A;  4USU A;  3GCW P;  4KSE B;  3PIO Q;  1NK7 A;  3QIP A;  1HAR A;  4C11 A;  1Q7Y T;  4OYM A;  5A8R A;  4NA2 A;  2ZOG A;  1DLO A;  4I7F B;  2R7V A;  3VGT A;  4F04 B;  1QAJ A;  1JMT A;  4KY3 A;  2QA4 S;  3JTN A;  4Z7Y A;  5HK4 A;  4WIQ A;  4ZPD A;  4YB6 A;  1DHM A;  1RXO B;  4DV2 F;  2CNO B;  3UNG C;  2H1Y A;  3H5Y A;  2Y1R I;  3T19 A;  3HZG A;  2J9C A;  4K7Q A;  1KTQ A;  3NGR A;  2GVD B;  2W01 A;  3UN2 A;  4FN5 A;  1RQ0 A;  1SC1 B;  4BWJ A;  3SXL A;  5K8P A;  4F02 A;  1N5Y A;  4LF7 F;  5ETS A;  1AA1 B;  2BAB A;  1WHX A;  2OPP A;  2DR8 A;  4DXL A;  5DGA A;  1AUD A;  4IOC Q;  2AF6 A;  4B3S F;  2BE2 B;  3TJ9 A;  2JX2 A;  2DK2 A;  2YNI B;  4MKA A;  4MKV A;  3CIM A;  5DM7 Q;  2VBW A;  1XMB A;  3LP1 A;  3H2U B;  2CJX B;  1KLN A;  4QR0 A;  4LSL A;  2V4R A;  2N4C A;  5KFM A;  1AXQ A;  2H4W B;  4Q0B A;  1LK5 A;  2P8I A;  3IGV A;  3ZZP A;  2GQQ A;  4P10 A;  4KHP F;  2VHG A;  2KJV A;  3HHK A;  2IDL A;  2IVM A;  4KHR A;  2BEF A;  2JDJ A;  4M5J A;  3M6U A;  2GGP A;  5HMY A;  3BYP A;  1UJ6 A;  2PII A;  8ATC B;  3FUY A;  4OX7 A;  2HGL A;  1JLE A;  3TUI C;  4X66 J;  4YR2 A;  3BO3 A;  2IM0 A;  3J80 U;  2RHS B;  1XN9 A;  2R2S A;  4X84 A;  5IQ6 A;  2HNY A;  3A1Y G;  1Q5Y A;  1UZH A;  1Q86 T;  1RBO B;  5A0Y A;  2DGT A;  3G6E S;  3F73 A;  3R27 A;  2HHS A;  1IKW A;  1N56 A;  2ERR A;  1U1K A;  1YBU A;  5K20 B;  3MF5 A;  1RT3 B;  1EZZ B;  2JC0 A;  5C42 B;  2BQR A;  1NME B;  5C25 A;  4B3T J;  3QSY B;  2HBZ B;  4F3M A;  3IWL A;  4F2S A;  3OUY A;  5IT9 Y;  1KFD A;  2MZR A;  2BW2 A;  2HK2 A;  2BJ7 A;  1QE1 A;  2NUH A;  3OR1 B;  1UZD A;  1FJG J;  2OGU A;  2FVC A;  3FFI B;  1NK0 A;  3K5L A;  2GV1 A;  4TLQ A;  4TKT A;  2ROE A;  1RU1 A;  4LFC J;  1TR0 A;  2DIV A;  3MUT P;  3G96 A;  1IBM J;  1OY8 A;  1VDH A;  4EYI B;  1APS A;  3MEC A;  4JI6 F;  4PUO B;  2F3J A;  3IR6 B;  2B8Q A;  2UVV A;  1ZA1 B;  4PXD A;  1LWE B;  4CRJ A;  2V8V A;  3CUL A;  3K8V A;  1BY9 A;  4LR9 A;  4DV6 F;  4ID5 A;  1F5A A;  3DFE A;  4WWS A;  1T9X A;  4DHV A;  3SQG A;  1VBX A;  1XK8 A;  1RTZ A;  2HMI A;  2WVE A;  5KFS A;  3H2L A;  3HHL B;  3CWJ A;  3B78 A;  4EMD A;  1XEZ A;  4FVC A;  1H7X A;  3JB9 k;  3P6Y C;  1UAW A;  1HPZ B;  1MMN A;  1WKL A;  2RDJ A;  3FEY B;  2HIY A;  2IRU A;  1UMJ A;  3UW1 A;  2VFV A;  3OTB A;  3TJ8 A;  4OJH A;  5A6W A;  2HW3 A;  3PW4 A;  2YNH A;  4DEZ A;  4FKX A;  2YKQ A;  4F0H A;  4GC7 A;  1T02 A;  3N0V A;  1VLO A;  4R25 A;  4NX9 A;  4ALZ A;  5HVG A;  4Q43 A;  2BOP A;  4OYO A;  4RW8 B;  2RDD A;  2G1H A;  1QY7 A;  2IM3 A;  1KQF B;  3A4T A;  1IXK A;  2HBQ B;  3R9L A;  4NEY A;  2OSR A;  1NSK L;  1IKX B;  4DR3 J;  1JXL A;  2JL9 A;  3TAR A;  5F3T A;  2VG6 B;  2K1R B;  2DIT A;  4PR6 A;  2M52 A;  3HVT B;  4ZP9 A;  1U4B A;  1XNQ J;  2QSF A;  2HWI A;  3ZXW A;  2NXC A;  3AB4 B;  5IM0 B;  1UL3 A;  3ILL A;  3ADA C;  5HI7 A;  4KH0 B;  1N33 F;  1R8C A;  3AOB A;  3BPD A;  5A8W B;  1XNR J;  3OXL A;  1BUX A;  1FFW B;  1QSS A;  1OY6 A;  4DCJ B;  4EEY A;  5AXL A;  1X7V A;  4RLE A;  4HR2 A;  3EPI A;  2LYV A;  4M5D A;  3MDF A;  2CQH A;  2QIF A;  2XM3 A;  1G7C B;  2HK3 A;  2LU2 A;  4HLB A;  4Y2M A;  3HKW A;  2QMX A;  3KJF B;  4LRC A;  2XC9 A;  5L46 A;  3KLI B;  2VQE F;  3W60 A;  4WFY A;  1CSJ A;  1WHY A;  1NSP A;  3PFE A;  2GVD A;  5HO4 A;  4I67 A;  2ZZN A;  1N6Q A;  2FJE B;  1YJN S;  1PYO B;  1S9F A;  4G1P A;  3BM7 A;  2N82 B;  3I9V 9;  2BE2 A;  4R0E A;  5L1K A;  4CNZ A;  5CZV A;  3TQ1 A;  3C16 B;  2MQ8 A;  2D1C A;  3QT6 A;  5DDP C;  3PIP Q;  2B4O A;  4PG7 A;  3C6T A;  4ID8 A;  5E2Q A;  4O4G B;  4B08 A;  4C8Y A;  3BGF A;  5F41 A;  2F9D A;  2FTR A;  1Y5N B;  5SUH A;  4XTT A;  1TL3 A;  1WOP A;  2B9W A;  2WVB A;  2COL A;  2XMK A;  2R7U A;  3G4S S;  2HFS A;  2A2C A;  1LXJ A;  1VQ8 S;  1JB0 C;  3CCV S;  2K3K A;  3NMR A;  3CD5 A;  1YDL A;  1IWA A;  2XO6 A;  1F5B A;  1IQT A;  4NXN F;  2XGQ A;  3ENW A;  2WRM A;  2DRD A;  1HD0 A;  1CJV B;  2B56 A;  2DTJ A;  3HHD A;  1F9H A;  2YKM B;  3EYZ A;  1ZTW A;  3ILI A;  2DNM A;  4G1Q A;  2NXU A;  2HRU A;  3QWP A;  4NXM J;  1H2V Z;  4RNF A;  3NEK A;  4UQT A;  3PVX A;  3Q83 A;  3FGV A;  2BOA A;  4ETX A;  1SL0 A;  2H5J B;  4RWW A;  3S1T A;  3KK1 B;  1RT3 A;  2RS8 A;  2FJB B;  3ZTP A;  3OVA A;  2E9T A;  3JAM Y;  1SKS A;  3MM8 B;  4P73 A;  1J5E J;  1S0N A;  4DL0 C;  3GLJ A;  1EKR A;  1W7W A;  2W2O P;  2LP4 A;  4N47 A;  1IJF B;  1OPI A;  3QJL A;  2O67 A;  1IM6 A;  3Q8Y A;  2XY7 A;  2AEF A;  3OR1 A;  4ECQ A;  2XMU A;  3SMZ A;  4YME A;  2IIH A;  1T9W A;  4HTJ A;  1S79 A;  3OTD A;  2M8D B;  1U0H B;  4ZOS A;  3OW2 R;  5JMN A;  1Q7L B;  1RT6 A;  4UOG A;  1X4G A;  1I94 J;  3G8T A;  4KGM A;  3U27 A;  1LWE A;  1I5O B;  4GVB B;  4Q2L A;  2YNF A;  2DR5 A;  4HHU A;  4BBY A;  2D41 A;  1X4H A;  2EEY A;  2HAI A;  5EHH A;  4QYR A;  4K4Z A;  3DDN A;  3PEH A;  1FXD A;  2HNZ B;  1KR4 A;  2XS7 A;  1NKE A;  2KYZ A;  1DJ0 A;  3A12 A;  1YRT A;  2FJA B;  2ZNZ A;  3HT3 A;  4KKO A;  4DR6 J;  4WFZ A;  3HHL A;  5HQL A;  2DB1 A;  2DT9 A;  4FPI A;  4P52 A;  2RSQ A;  2E1P A;  3NS5 A;  5EUH A;  3SDE B;  2QN6 B;  1MRO A;  3ZZO A;  5DM6 Q;  4OQJ A;  1M1K T;  3S7R A;  1C1B A;  4B3M F;  2YH1 A;  2YQ3 A;  2HHU A;  4KGX B;  3LH2 S;  2NRE A;  3VAK A;  2W4P A;  3D3C J;  4L74 A;  1PJ7 A;  5E0O A;  4FYX B;  1N0U A;  1FJ7 A;  4USV A;  4FP9 A;  5T7L B;  3K0J A;  5IT9 U;  4DR2 J;  4EO6 A;  4NMX A;  4DFK A;  3CO9 A;  4GKK J;  1AUS L;  1X4E A;  1HNZ J;  4V19 X;  3K58 A;  2ZUG A;  1RWP B;  3CIZ A;  3IBF B;  4J9S A;  1IKX A;  2IC3 B;  2VUG A;  1JJ4 A;  1Y10 A;  2IRX A;  2K1R A;  2CRL A;  2C28 A;  3EZO A;  4JYA J;  1U2R A;  1CQM A;  1YG0 A;  2EFO A;  4B9L A;  4C8L A;  4PKD B;  4F50 A;  2Z58 B;  4J9N A;  5HBM B;  4MK8 A;  4USI A;  5A8W A;  1HNW F;  4YY3 F;  2BR0 A;  3IR5 B;  3AJ1 A;  2I8E A;  4DSK A;  2AIR B;  3EZU A;  2EFV A;  4OYB A;  3HT0 A;  4CLW A;  2RIL A;  2RNE A;  4RU9 A;  1Q79 A;  2V50 A;  1G2E A;  2JEG A;  4A46 A;  3OTO F;  4OHY A;  4ZPC A;  1S0V A;  2AJQ A;  2CZ4 A;  3PR4 A;  1RWO B;  4R0J A;  1RHK B;  3HJV A;  3VQT A;  2DXE A;  3HO1 A;  1NHK L;  1J2V A;  1JXE A;  4JI8 J;  3AXM A;  5K8M A;  4BCA A;  1Q8K A;  4PXE A;  1S49 A;  1FDN A;  3M8Q A;  4ZPV R;  1ACM B;  1HNV B;  3FQL A;  1Y5I B;  5KFA A;  1C2P A;  4F4Z A;  3CCT A;  2KXF A;  1VQ9 S;  1K44 A;  2ZC3 A;  1NK6 A;  4U7U D;  4Q5V A;  3FBB A;  1O5J A;  5AXM A;  3ISN C;  2DGW A;  2HQD A;  2HHH J;  1VQ6 S;  3I56 S;  1YSJ A;  5I3P A;  3SFG A;  3TA2 A;  4EZ9 A;  2XI2 A;  1H72 C;  1U2C A;  1R8B A;  5KFF A;  3BZQ A;  2J7U A;  1R0A B;  2RRN A;  3WIU A;  2JH3 A;  2UVW A;  4RUA A;  1JLC B;  3O5T B;  4C2M A;  4DX5 A;  1VC6 A;  5G4D A;  5KOX A;  4BS2 A;  4RW7 A;  1U25 A;  2BAN B;  5HQM A;  2IYG A;  4CH1 A;  1HQU B;  2YKM A;  3WDO A;  2HUR A;  4FDF A;  5IWA J;  2HS4 A;  3GG1 A;  1C0T A;  3AA9 A;  1RHM B;  2BMB A;  4OMF G;  5E3P A;  7FDR A;  3LOU A;  1ARO P;  1K47 A;  2ZZT A;  4LF6 F;  4DX6 A;  2BM1 A;  3M6X A;  4CTA B;  3MM8 A;  1CJU B;  3TUJ C;  3VHQ A;  4P71 A;  1R6Y A;  3JS9 A;  3EWG A;  2ZBC A;  4LVN P;  2A1B A;  5BR8 J;  2EVZ A;  3FC9 A;  2HFZ A;  1RTI B;  3PEJ A;  1Z2Z A;  2IA0 A;  1HBM B;  1HHS A;  4LQ3 A;  3N5B A;  4CO1 A;  3KWM A;  3HZE A;  3NGD A;  2V5H G;  5DG8 A;  4X2B A;  2OD6 A;  1GNK A;  1H2U X;  2V2K A;  2W2M P;  2Y8Y A;  3B82 A;  3MM7 B;  4GVB A;  3NRB A;  2VFS A;  3BKU A;  1AB8 A;  4ECS A;  4L3K A;  4I69 A;  4V19 J;  3EGV A;  2V8P A;  4X4Q A;  4IRC A;  2V8G A;  2HBY B;  1CEZ A;  1N32 F;  4KHM A;  1T7P A;  5K9F A;  1Q4R A;  2W8K A;  4IR1 A;  1L3K A;  3NGU A;  1OQ6 A;  1UJ4 A;  3T5L A;  3Q8P B;  3SDE A;  2I38 A;  1S10 A;  1U47 A;  2ZH9 A;  4DS5 A;  3E2E A;  5FLX Y;  1JLG B;  2F4V J;  3JAM U;  2VD3 A;  2M3D A;  1QDU B;  4C4W A;  3I55 S;  3LAK A;  2OHD A;  3Q86 A;  5LT5 A;  1CLF A;  4CLL A;  2L3M A;  3D7S B;  2B4V A;  1RCO B;  2GJI A;  3EIC A;  1YVF A;  5T7L A;  1DQ8 A;  1SVD A;  2HZV A;  4LF8 J;  2HVD A;  3QGH A;  4UOF A;  3KUE A;  5MLC V;  4FF1 A;  2DNN A;  2QX0 A;  2PA3 A;  1VQN S;  4M95 A;  1NLK L;  4KBI A;  5KFK A;  2ZJP Q;  2RS2 A;  3ZC4 A;  2FJW A;  2XEX A;  1MNE A;  3CC4 S;  4ZVP B;  4I6Y A;  2GQ2 A;  2XSJ B;  3CCQ S;  4ECW A;  3T1Y F;  4OJ1 A;  2V0N A;  2N4D A;  3M1V B;  3HVW A;  3W7B A;  4LJM A;  4ECV A;  3RAQ A;  4ILL A;  1VRT B;  5HBM A;  3GSD A;  4NLO A;  3MPW A;  2LCW A;  3H40 A;  3FBE A;  5DG9 A;  1NSQ A;  3NOG A;  5IQQ A;  2AJ1 A;  1PC5 A;  1MG7 A;  4KQZ A;  3KOA A;  3TI0 A;  3D2W A;  4O4R A;  1JNZ B;  3DOL B;  5DQG A;  1RTJ B;  1I6J A;  2GIR A;  3FZB A;  1ZAW A;  1IR2 A;  4QQB A;  2Z57 B;  4OHX A;  1ITP A;  1Q8I A;  4YFU A;  1TL1 B;  1PJ6 A;  4XDD A;  3BN4 A;  4WYW A;  1VK8 A;  2C2R A;  3R6G B;  1UA1 A;  2LEB A;  3G82 A;  4DL4 A;  3PTW A;  2KM8 C;  1TMJ A;  4NCB A;  3D28 A;  5DZ7 A;  2D7S A;  3I0R A;  2CPD A;  3CGI A;  2Q1L A;  3LAL A;  2A3J A;  1Z2L A;  2HWT A;  2MGZ B;  1ZAV A;  2MY7 A;  4FKY A;  3M8P A;  4G65 A;  5ETV A;  3EDR B;  1LV5 A;  1FRK A;  4YQW A;  4NOH A;  3CJT A;  4U9R A;  4N77 A;  3PX6 A;  3AD8 C;  4BHQ A;  3V6K A;  3M6V A;  2AYE A;  2DCU B;  4J9O A;  1NBE B;  3CJR A;  1TTH B;  2FPH X;  2YQ1 A;  3K8W A;  3BQ2 A;  2PMW A;  5E7O B;  4AND A;  1U6F A;  1FVS A;  3FQK A;  1EIY B;  4DX7 A;  2ZVI A;  3PHE A;  2D3O R;  3IBC B;  3PYD A;  5KFG A;  4X66 F;  1NJZ A;  4PQU A;  3TVY A;  2QJ3 A;  2L41 A;  1FWK A;  4M5I A;  4OV6 A;  3GIL A;  1LW0 B;  1KOO A;  1N48 A;  3Q8Q B;  5J1P A;  4H4M B;  2RML A;  5E3R A;  5IT0 A;  2N7C A;  4FS2 A;  3SBM A;  4ZLN A;  2CG4 A;  2QFJ A;  4DPY A;  1SKU B;  1ZH5 A;  3MR3 A;  4UTG A;  2ZBI A;  5F8N A;  2UUB J;  4KO0 A;  3MM9 B;  3RBZ A;  4B3T F;  1PSD A;  1UEK A;  1UCN A;  2IAJ B;  1JJ2 R;  5KFY A;  2HHX A;  2G0I A;  1FWL A;  3C15 B;  1EET A;  1LKZ A;  1EQ0 A;  1R27 B;  4CTA A;  3RRK A;  3FVY A;  1CJU A;  1GK8 A;  1FJG F;  4DSL A;  2PA8 D;  3LGH A;  3ZZR A;  3HHE A;  3CF5 Q;  1ZM3 A;  4C97 A;  2KHD A;  4LFC F;  2CJA A;  1RKI A;  5DS7 A;  1ZYQ A;  3CCS S;  3UVJ A;  1IBM F;  2HHT A;  3SSS A;  2EXU A;  1TU0 B;  1Q81 T;  3W1Y C;  4OYZ A;  3UNY A;  3DHX A;  4F4A A;  4USK A;  4OI0 A;  4CM0 A;  4DN0 A;  5CYQ B;  1Y7P A;  4CO2 A;  3IWN C;  4KC5 A;  3GJR B;  5KT2 A;  5RUB A;  5L9X A;  3K5O A;  1XTZ A;  3KNA A;  4I68 A;  4XAK A;  4D3G A;  2HHV A;  2B5J B;  3H42 A;  3SQO P;  2HQF A;  2J0S D;  3Q0A A;  3BH6 B;  3G86 A;  2E5I A;  2Z0G A;  3NBP B;  1E6V A;  1KN6 A;  4DFJ A;  3D6T B;  2NLW A;  1WAC A;  2FJD B;  4CLZ A;  4CWB A;  3L4B C;  3ENA A;  4TQS A;  3FSI A;  7AT1 B;  4HT5 A;  5THW A;  4HKQ A;  1U49 A;  3ETO A;  4JV2 A;  3PR5 B;  2XYH B;  4QU6 A;  2UU9 J;  1HW9 A;  1CBK A;  4F4Y A;  5CHC B;  1NPP A;  2E9R X;  2EI5 A;  2XS2 A;  4D3H A;  2CIM A;  1FRJ A;  2DH7 A;  3D0G E;  4IFY B;  4Z2X A;  2RD5 C;  2UXC J;  4J91 A;  1GMW D;  2ABY A;  2J8A A;  4ZMM A;  5KT4 A;  2DNH A;  3CW2 C;  1XNQ F;  1S1T A;  3MAH A;  3ITH A;  3BYR A;  2F5G A;  1TK0 A;  1C0U A;  2ASJ A;  2AKW B;  1SH0 A;  1WUU A;  2WVD A;  4U7C A;  2XSJ A;  2YPY A;  2YX7 A;  3V6J A;  4IH7 A;  4B9V A;  3M1V A;  4O44 B;  4CLK A;  1Y4Z B;  2XY5 A;  2VIC A;  2VG7 B;  3FCW A;  5HJY A;  2IYI A;  3QRR A;  5DDQ C;  1JLB A;  4O3N A;  5KFC A;  2OFG X;  1WF0 A;  4LF1 A;  4DWI A;  1IR0 A;  3NCQ A;  2FB0 A;  4J7C A;  2C3O A;  5CAB A;  5J2M A;  2LXU A;  2BQU A;  2RAQ A;  5IV4 A;  2DNY A;  4LF9 F;  2DEJ A;  2W7A A;  4TU8 A;  4K5R A;  1RAD B;  1JQG A;  2Q79 A;  4FYV B;  2MHE A;  5FLX U;  5B09 A;  2RKI A;  3P8B B;  2CUY A;  1RT1 B;  5CYM A;  3G8Q A;  2KFY A;  4I6W A;  4O0N A;  4EBD A;  4QIE A;  4DF8 A;  5ADZ A;  1RWK B;  3QAE A;  5J2P B;  2G1D A;  4DJB A;  3DRP B;  2MKH A;  2WBM A;  5T14 A;  1X9S A;  2LEP A;  4WP9 A;  3W8P A;  3D1H A;  5M2R A;  3L7O A;  4DV7 J;  2CQ1 A;  2OEL A;  3T3F A;  4YR3 A;  4HH1 A;  1WJ9 A;  5IT4 A;  1UA0 A;  3QLH B;  4DU8 A;  3W62 A;  2DNQ A;  3CJ2 A;  5JVH Q;  4NEZ A;  3NCR A;  3DRX A;  3WX8 A;  2XNQ A;  3T6J A;  3WX4 A;  3DDI A;  3FCH A;  2E5L F;  3C46 A;  2M0G B;  3KLE B;  2HRT A;  1M5S A;  3CJ8 A;  1IBL F;  4LF7 J;  2YPZ A;  3RUB L;  1YIT S;  3QBC A;  2CVE A;  2LKZ A;  2HFV A;  1VC0 A;  2KDO A;  1UEV A;  2B3T B;  2ZHB A;  4FBT A;  2DPI A;  1YRU A;  2ZVS A;  1U1Q A;  3LQV A;  1XJW B;  1HWK A;  3OT9 A;  4PPZ A;  3I5B A;  2CQC A;  2A10 A;  4NXM F;  1LW0 A;  3NS6 A;  4H4M A;  3BBF A;  1FKO B;  1NXI A;  3H4D A;  2VON A;  5KT6 A;  1JK9 B;  2AT1 B;  7FD1 A;  4ZCI A;  1FKP A;  2RQM A;  4EUV A;  4DN9 A;  2HS0 A;  3CD7 A;  4DPO A;  2V9K A;  1RWM B;  1R6V A;  3M8W A;  5A2Q Y;  3J7Y U;  3KHH A;  1K73 T;  1J5E F;  3TYT A;  5GMK a;  1ZS6 A;  1CG2 A;  4Q44 A;  2WON B;  1S48 A;  4UZB A;  2UVR A;  2F40 A;  1SV5 B;  2CQD A;  1KP6 A;  1T9U A;  4Q45 A;  5LJ5 Y;  4C3K A;  3CCE S;  4OHV A;  3UO0 A;  3OXF A;  2KG0 A;  1X60 A;  2D69 A;  3DYA B;  2RF2 A;  3R2D J;  5D77 A;  2IBK A;  4ZHR B;  3BRE A;  3BO4 A;  3ILJ A;  1I94 F;  5HAT A;  4KGZ B;  3BGL A;  3H5S A;  4P7T A;  5D8H B;  2DEI A;  2HBR B;  6FDR A;  2R7O A;  3DLK A;  5CYQ A;  4JOU A;  1VRU A;  4Y00 A;  1SIW B;  2HEK A;  3UCU P;  1M5H A;  5E5N A;  4X4O A;  1B0V A;  1NU4 A;  2WOM A;  1DQA A;  4DR6 F;  3UQS A;  3NY0 A;  4EBC A;  3BEG B;  4AQY J;  1K8A T;  1X0P A;  1B3T A;  3HCX A;  2CAD A;  1NK4 A;  3F41 A;  2WW8 A;  2UUT A;  4JI6 J;  4MKY A;  3PRV A;  1M0S A;  5K14 B;  4RW9 A;  1XWL A;  4CO3 A;  2HFU A;  2C2O B;  2W9C B;  5B0G A;  3CUN A;  1GTH A;  1XR5 A;  5U47 A;  2XMT A;  2PGC A;  2QA4 G;  1WI8 A;  4DR2 F;  2C2M B;  1RT2 B;  3DLL Q;  1R43 A;  4X4V A;  4GKK F;  4RNN A;  3R5J B;  2HVH A;  1PYS B;  1PC4 A;  1QTN B;  3FBC A;  2R4F A;  4W90 B;  1JLQ B;  4K2X A;  4DOZ A;  2E44 A;  2CVI A;  4OHZ A;  5HLF A;  1ZM9 A;  2FVR A;  2MQO A;  2CDR B;  4JYA F;  2HQ3 A;  3VR1 A;  3C19 A;  5BXI A;  1R7I A;  5DQH A;  2VQF J;  1T0T V;  1HI8 A;  5KFQ A;  1AFI A;  2GFF A;  4O44 A;  4HYK A;  2IA6 A;  4KV8 B;  2VG7 A;  3V6D B;  3CD6 S;  2H3E B;  3CJQ A;  3MR7 A;  2XS5 A;  2F8H A;  1VJW A;  2DBB A;  2VG5 B;  4B3O B;  1ZOT A;  4IG3 A;  4B3R J;  1C1C A;  3H59 A;  4ZVU B;  1RE1 B;  2XYP B;  5F8H A;  1TZ0 A;  1BMQ B;  1VQP S;  2NR0 A;  3PW0 A;  1KS2 A;  3IR7 B;  1FX4 A;  1X5O A;  4NPO A;  1WOS A;  5EX0 A;  2W2P P;  3R8Y A;  5A76 A;  4JI8 F;  1P1L A;  4ATN A;  1RT1 A;  4CO5 A;  3CO0 P;  2L08 A;  1OJ4 A;  3D54 A;  4PYD A;  4WP8 A;  3LP2 A;  2VC0 A;  3AAW B;  5J1E A;  1YTY A;  4UZC A;  4QR1 A;  1SJR A;  3KFW X;  4FNI A;  1G6B A;  5LJ3 Y;  4OIX A;  1B0T A;  4M8L A;  4C7Q A;  3EGW B;  2YXL A;  1K9M T;  3ZTQ A;  1WC0 A;  5K8N A;  5HSP A;  1Y3K A;  2UZA A;  3FRZ A;  1SKR A;  2HHH F;  3DLG B;  4KFB A;  4RUB A;  2KFZ A;  1YIJ S;  3VAH A;  1Y3J A;  3PG9 A;  2JVO A;  2HS3 A;  3W3S A;  2JLE A;  1RAH B;  4LSN A;  1B70 B;  3U1M A;  3RTV A;  2M4M A;  4IRD A;  4C0B A;  3E01 B;  1V9O A;  2G9O A;  1NKB A;  2XMA A;  1W2I A;  5KFZ A;  1HR0 J;  4FXV A;  3UN3 A;  2AEJ A;  5ETT A;  5C24 A;  4NML A;  2OKQ A;  2QRR A;  1GX6 A;  3PW2 A;  4RBT A;  4ED1 A;  1P27 B;  3IMQ J;  2QLJ B;  1W26 A;  4JI1 F;  2KI2 A;  2UUW A;  2KO1 A;  4OX9 F;  2GJF A;  2DRA A;  3VVU A;  1KEK A;  1FK9 A;  1TP7 A;  4LRD A;  3DLE B;  2AJ2 A;  2E5G A;  3T5J A;  2VA3 A;  5LM7 E;  1DTQ B;  4JI4 J;  1QAX A;  1VQO S;  2YNG A;  4LRE A;  2GZO A;  4WP3 A;  2J76 E;  2G13 A;  4C8O A;  1FFS B;  4MAK A;  2F4F A;  1MU2 A;  5D6G A;  4YB1 P;  2BUN A;  1JKH B;  4I2P B;  3ICL A;  2NYI A;  3J7Z 5;  1U26 A;  3BKT A;  3FNN A;  2VDI A;  1J5O B;  5BR8 F;  2M2B A;  2RQK A;  2XQC A;  2OUG A;  3OXG A;  3R7N B;  2OTJ S;  4NXN J;  2KYX A;  2HG4 A;  4DR4 J;  1FKA F;  1WTF A;  4RUC A;  2F8E X;  3GZ7 A;  1RJJ A;  1LFP A;  4IUF A;  1H38 A;  4IOB A;  3D0I E;  4KAI A;  3DYA A;  2HIQ A;  3DOM B;  3JSM A;  2RDI A;  4F3O A;  5CD4 H;  5L1I A;  1S97 A;  1RA6 A;  4JI5 J;  3MAQ A;  3N5F A;  3CJS A;  5LMU J;  1IKV A;  4K4V A;  1S4E A;  1NK8 A;  1U6Z A;  3DRR B;  1TV6 A;  1GX5 A;  3N28 A;  1RBL A;  4A8O A;  3C66 A;  2R8K A;  4DQS A;  4PWD B;  1LXN A;  4ES1 A;  3MXH P;  1VBY A;  5I42 B;  2FHJ A;  3DHW C;  1S6Q B;  2XZT B;  3M2U B;  3QGP A;  4F4X A;  1L5U A;  3M8Y A;  2E5H A;  2XMM A;  4A8M P;  1IM4 A;  2MKC A;  1SL1 A;  5FDL A;  1UWB B;  1D9F A;  3L7U A;  1GXL A;  5CD4 A;  4PG8 A;  1SPB P;  2GO9 A;  3GON A;  2H48 B;  5A2Q U;  3JSB A;  1D0E A;  3J7Y I;  1HBO A;  2QLW A;  3BPS P;  4YS2 A;  2CJB A;  1SC6 A;  5F9N A;  4RKU C;  2R2T A;  4KGK A;  3M9N B;  5D3G A;  4OJ3 A;  3U1L A;  4ELU A;  4LF8 F;  4AUK A;  3MEE B;  1WOR A;  4OI4 A;  4CYU A;  4A8Q A;  5HL7 Q;  3WBZ A;  1F60 B;  5B0E A;  1T03 B;  2ADB A;  2IRY A;  1VGY A;  3Q2T C;  1TKX A;  2CAJ A;  1WKK A;  3G6Y A;  3MED B;  2O1P A;  3AHP A;  3OJU A;  2MJU A;  4ECR A;  4B3M J;  3GG0 A;  6AT1 B;  1NND A;  1T9T A;  2DHG A;  1JX4 A;  2BJE A;  3T1A A;  1VLY A;  2F9J A;  3KXD A;  1SH3 A;  4OI1 A;  6FD1 A;  5KFW A;  1VQ4 S;  2VPW B;  1TKT B;  4H4O A;  2VG5 A;  4NYO A;  4KT0 C;  1B64 A;  3LWM A;  4B3O A;  1HWU A;  4XK8 C;  4JV0 A;  4ED8 A;  5AT1 B;  3NGK A;  1UVJ A;  4O3Q A;  3GU0 A;  4WTO B;  2EBE A;  4PEO A;  3TVZ A;  3TZX A;  4WJB A;  1HQE B;  1TMM A;  2YQ0 A;  3H8Y A;  2JEI A;  2RU9 A;  2JWN A;  1NDC A;  1P6T A;  4ZIW A;  5HAO A;  4LF4 J;  2CPY A;  2DNK A;  4C98 A;  2DD8 S;  4DCO B;  3JQM A;  2HFO A;  3N4W A;  1KHV A;  3G8S A;  4ELV A;  2HKE A;  1NB2 A;  2R7S A;  1T05 B;  2DPJ A;  4GVL A;  4OFZ A;  1UW4 A;  3CJ4 A;  3JXO A;  4ZN3 A;  4I2Q B;  4DV1 J;  1BE4 A;  1HL6 A;  1GAO A;  3PJ9 A;  4S0M A;  2JHE A;  2LA4 A;  3TZW A;  1FNX H;  1X4A A;  5IFM A;  1RWN B;  4RNO A;  2IFX A;  1FEH A;  3TX0 A;  3FMB A;  5E33 A;  2B43 A;  4YDD B;  1DAX A;  3N79 A;  2J0X A;  4GC6 A;  3W2W A;  2HZA A;  2GW8 A;  3UD3 P;  4CCH A;  1T11 A;  3SI8 A;  2MEW A;  3E01 A;  1NPR A;  2CWX A;  3FRY A;  4PG4 A;  4ED7 A;  1SUQ B;  2VBY A;  5KG3 A;  3TA1 A;  2ZHA A;  3R7B B;  3PYG A;  3H90 A;  4KPC A;  3I5A A;  4WFX A;  2DGO A;  2AW0 A;  1TEL A;  3I9Z A;  5KFN A;  3I32 A;  1RT4 A;  2W8L A;  2AWZ A;  3NCP A;  2V6A A;  1S57 A;  4IFV B;  3QT8 A;  2YWE A;  1FD2 A;  3C3L A;  3DGP B;  1Q53 A;  3PM9 A;  5KFU A;  3KJV B;  5CZC A;  4USJ C;  3CCJ S;  1CJT B;  4A48 A;  1X4F A;  4KPY A;  1DAR A;  2J9E A;  3UWT A;  4F36 A;  3X3U A;  2BVZ A;  1HMV B;  3OQ2 A;  1HW8 A;  3M32 B;  3CC7 S;  2UUC J;  4QIG A;  2XI3 A;  3DMJ B;  2WB4 A;  1JKH A;  2FY8 A;  3UI3 A;  1QTM A;  1J5O A;  4OYI A;  1YBT A;  4OZL A;  4A8W A;  2G2Y A;  3CPW R;  3T1H J;  1HNX J;  2WZ1 A;  4G6V B;  2ZH7 A;  2BA9 A;  3GV8 B;  1JXV A;  2HFN A;  4GO5 X;  1Q0N A;  3S8S A;  2EK6 A;  3KK3 B;  1H73 A;  4NZ0 A;  4C3L A;  1HA1 A;  1RZM A;  3RB4 A;  1VYA A;  4OZJ A;  1UKU A;  4I1T A;  1OYE A;  2VFR A;  4LF6 J;  3OBI A;  3KUG A;  4DU7 A;  1S5Z A;  4Y2K A;  1NK9 A;  2A2D A;  1N5S A;  3DRR A;  1EQM A;  3LA0 A;  3CDW A;  3R5C A;  1S6P B;  5ETN A;  1HIY A;  2XHC A;  1ICE B;  5BYR A;  4X62 J;  5HVH A;  4CH7 A;  2ZZM A;  5I42 A;  2W25 A;  2DXD A;  2UXB J;  3FDS A;  4U8Y A;  1S6Q A;  3MM5 B;  2EK1 A;  3M2U A;  2YWK A;  4ILM A;  5EWE A;  1FT8 A;  2IJN A;  3SCK E;  3KK2 B;  4M5L A;  1UWB A;  4FVM A;  4ZCL A;  3DKD A;  3IRX B;  5J1N A;  1QUV A;  3KLH A;  3LWL A;  2BKN A;  2M70 A;  3R1L A;  4EGL A;  1RWU A;  2V4J A;  1S76 D;  2R3V A;  1M5O C;  3HJF A;  3IRW P;  4TLR A;  4XDC A;  1D3W A;  2UXC F;  2KFN A;  3OLB A;  1CVJ A;  4X4R A;  2B9X A;  1XR7 A;  2Q6C A;  1RB0 A;  1SL2 A;  4DF4 A;  1Z4U A;  3NG8 A;  3CNQ P;  3IN5 A;  4V1A k;  2LXF A;  1T03 A;  4R8U B;  2EC0 A;  1NPK A;  2GQC A;  2RRA A;  2BKP A;  1S1W B;  3HHL D;  2PSZ A;  2PEH A;  3MED A;  5HVF A;  2Z4P A;  1TFW A;  2R7W A;  2KRR A;  5I3U B;  1M90 T;  1TKZ B;  5HMZ A;  4USW A;  2DO0 A;  2UV8 A;  3WC2 A;  2YY3 A;  5LOQ A;  2G4B A;  4UUX A;  1FES A;  2HHP A;  1BQM B;  3DRS A;  1RT7 B;  5LSR A;  1TKT A;  3Q2S C;  2OPQ B;  4N76 A;  1QUP A;  2XYG B;  4PG6 A;  2QTW A;  1U8W A;  3ENV A;  3HK2 A;  1S77 D;  3V81 A;  4JI2 J;  1YRX A;  4TQR A;  2ZDO A;  2HVI A;  2MQP A;  4DR5 F;  3G87 A;  4DLG A;  3VAF A;  4WPA A;  4DZD A;  1VIS A;  2CYY A;  2LLZ A;  4Y0F A;  3K17 A;  2MZT A;  3J7Z T;  2MLY A;  4X4S A;  2HVE A;  2CNL B;  2NXE A;  4DDF A;  2VOP A;  1PJ5 A;  1NRK A;  2OML A;  4I4B A;  2CNK B;  4L3N A;  4DV7 F;  4LT6 A;  3GV5 B;  4MYU A;  3RZA A;  2AGP A;  3DM2 A;  4I2Q A;  2ZD1 B;  3W2V A;  1VOM A;  1SI9 A;  2C3P A;  2DR6 A;  1U48 A;  1BQN B;  4DV3 J;  3DOK A;  2M9K A;  1U45 A;  2JLG A;  4EI2 A;  2QFI A;  1RHQ B;  4E98 A;  3GP9 A;  2RQ4 A;  3Q8U A;  2KG1 A;  4JI7 F;  3NKY A;  3QYY A;  3MAA B;  4PXB A;  1IQZ A;  3US5 A;  1IR1 A;  5ETO A;  3RR7 A;  1N8R T;  4QYZ K;  2ASY A;  3QMQ A;  4DV0 J;  1SUQ A;  2IMW P;  3C14 B;  3BF4 A;  3GSI A;  2E1M C;  4O23 A;  2FGC A;  2X7I A;  4RO0 A;  1ZPV A;  3HI9 A;  2CQG A;  4H4K C;  1WC5 A;  3ZZU A;  2CJY B;  1R8H A;  2BXJ A;  4MK7 A;  4AMN A;  1V3R A;  4RW4 B;  4IFV A;  2FQQ B;  4LF5 J;  5HRO B;  3W9I A;  2X1G A;  3ZZT A;  2A6O A;  2FIU A;  1WOO A;  1TL7 A;  5FD1 A;  3AOC A;  4IKA A;  4DUZ J;  1DBD A;  2MZJ A;  1FJC A;  2EW9 A;  4WE1 B;  1NJX A;  3GFH A;  1FXL A;  4WZM A;  2ZJQ Q;  3CME S;  4OJG A;  1F9F A;  3X1L B;  1HMV A;  2J7W A;  4A4J A;  3VGV A;  3ISZ A;  1LW2 B;  3M30 A;  3M9O B;  1MMD A;  4HAC B;  1WEL A;  4WFN Q;  3KHR A;  3MFH A;  3DLB A;  4F7V A;  1U0S A;  5HMW A;  2QT7 A;  3K5M A;  3C6U A;  2DNL A;  3MD1 A;  5L1L A;  3KK3 A;  3GYX B;  4YP3 A;  1ZZN A;  2K8G A;  2C2Z B;  2C3M A;  1VQ5 S;  2DJW A;  4RZR A;  5B0F A;  3ZTS A;  3J81 Y;  5G0R B;  2J0Q D;  5AJ3 J;  1F9E B;  4KIA A;  3L3C A;  4QIW D;  4ZJL A;  4NLD A;  3R2C J;  2VKZ G;  2PC6 A;  5KG2 A;  4LFA J;  2MJN A;  1Y11 A;  1V3Z A;  3SIP B;  1YQH A;  4AQY F;  4MH8 A;  3UCZ P;  3OVS A;  3TEG A;  4MYT A;  4DPU A;  3I0S B;  4RNM A;  4QYZ J;  4WCE Q;  1UWA A;  2F8M A;  3FSY A;  3MM5 A;  1GT8 A;  3QGI A;  5IXU A;  3EVW A;  3IC1 A;  3OV7 A;  3U1N A;  2I5J B;  3Q23 A;  3TUP A;  3NL0 A;  1EAR A;  4L75 A;  2BJD A;  2ROG A;  5E3Q A;  1QSY A;  2W9A A;  3D6H B;  3SV3 A;  3HF5 A;  3IRX A;  3MMC A;  1VS3 A;  4ED2 A;  5B0C A;  1S4F A;  1FDA A;  2QV6 A;  3AJ2 A;  5H9F K;  4X65 J;  1QVF R;  2B6A A;  4A8Y A;  3QGG A;  2Y1I A;  2NUU G;  1LEO A;  4NLG A;  3Q89 A;  2XY6 A;  2DNG A;  1WC6 A;  4R8U A;  5KFR A;  5CYJ A;  4UOC A;  3RB0 A;  2IBO A;  2V94 A;  1S1W A;  3TAM A;  1S7H A;  2YWG A;  2VQF F;  4HDH A;  2I9S A;  5GAH U;  2AU0 A;  2QLB B;  3K5N A;  5I3U A;  1X5P A;  2P6T A;  1WEX A;  4QWD A;  1URR A;  2XTJ P;  1U7L A;  1K1Q A;  3R1H A;  1ZM2 A;  1BQM A;  4GRS A;  1JLF B;  4B3R F;  4AL6 A;  4WXO A;  3TOQ A;  1VQS A;  3SEO A;  2OPR B;  2LDY A;  4P7V A;  3VTI A;  3EJM A;  5H9E K;  1EKS A;  2KZZ A;  2K06 A;  4FYY B;  2BZ2 A;  4CLP A;  2V4Q A;  4A47 A;  2R8H A;  2OD4 A;  2W9B A;  1RYR A;  1RWV B;  4ZVF A;  4A8S A;  2FVP A;  4AMO A;  2Y1L B;  3DN9 A;  4L73 A;  3MGJ A;  3OL8 A;  5E3A A;  1SQF A;  4NA3 A;  1F5C A;  3DRY A;  4HEA 9;  2ZOM A;  1SBR A;  2PFD A;  4I7F A;  3I96 A;  2MQL A;  2DGU A;  2CPF A;  4OLO A;  1S72 S;  1R3N A;  3N6N A;  3M6W A;  4TU9 A;  5EN1 A;  2UP1 A;  2XG8 A;  1I3O B;  4LF9 J;  3KLG B;  4TY9 A;  3V2U C;  4M94 A;  5F8L A;  2XO7 A;  1BQN A;  1NAQ A;  1JJH A;  2VZ9 A;  3EVM A;  5H9F J;  9RUB A;  4P2S A;  5CCM A;  1FF2 A;  2G2O A;  3T6B A;  3W5X A;  1KQS R;  1F3V A;  3D4J A;  3MAA A;  3EGZ A;  4LVO P;  1HR0 F;  3QO9 B;  5LMN J;  3MPU B;  3I87 A;  2R7R A;  4B9U A;  2ATL A;  2XGP A;  3GYN A;  3IO1 A;  2YNI A;  3C14 A;  3VAI A;  2ADC A;  2Y8W A;  4ZP8 A;  2E1A A;  3ZZZ A;  3RW6 A;  4JI4 F;  3BV8 A;  4HH0 A;  4P2M A;  5DDO C;  2L9D A;  4LRB A;  2VDH A;  1YJ9 S;  3HFV A;  3MEG B;  1R8A A;  1R8P A;  1YJT A;  2E5L J;  2VB6 A;  3EDQ B;  2WHO A;  4WZQ A;  1ZTT A;  1IBL J;  4AFF A;  4WE1 A;  4HI2 A;  3RB3 A;  3HHN B;  4DLE A;  2MMY A;  3KG1 A;  3EM1 A;  5LL6 d;  3VZI A;  4RNH A;  1M1H A;  4X64 J;  5KG1 A;  2APO A;  3LP0 B;  3S01 A;  2W7O A;  3K7R A;  2KH9 A;  3OL7 A;  4J9U E;  3ZNJ 1;  4DR4 F;  2DNR A;  4HAC A;  1NO8 A;  2GHW A;  2AV5 A;  4AT1 B;  1N34 F;  3C2P A;  3ELH A;  2DKO B;  3J7A 1;  3CDA A;  2NZ4 A;  4OX8 A;  4ZVQ B;  4JI5 F;  5C42 A;  4MTP A;  1UTA A;  4MMO A;  1PAE X;  4OI6 A;  4RWX A;  4B9T A;  4GMK A;  4EK2 A;  5LMU F;  4QWE A;  3PO4 A;  4URS A;  4Q8F A;  4ZVE A;  4HI1 A;  2QSW A;  1WF1 A;  2NZC A;  5KT7 A;  1H2T Z;  3GFY A;  2CJQ A;  3O3L A;  1RKJ A;  2Q6B A;  5HP1 B;  2JRS A;  3FFI A;  1ZPW X;  3TRG A;  2FJX A;  2IM2 A;  1EP4 B;  4DL6 A;  3I0S A;  5KAK A;  4RW6 B;  2GVZ B;  2A6M A;  1MML A;  2CQ3 A;  2HLU A;  4PUO A;  3TX8 A;  3D66 A;  1H6K X;  3E51 A;  3M2R B;  1OYD A;  3MCS A;  4N56 A;  4B9N A;  3AD9 C;  2AJ4 A;  3FKB A;  2ZHO A;  2DNZ A;  3EGN A;  3DC2 A;  1UFW A;  4DQP A;  3HM9 A;  2LQ9 A;  4O3O A;  4PWW A;  4OV1 A;  1QAY A;  4B9S A;  3PNI A;  1HPZ A;  1PGZ A;  3BO2 A;  3G9C A;  3VAM A;  4NI2 B;  1R0B G;  5ETM A;  1Q16 B;  3JSR A;  4QJV A;  2G0C A;  3GQC A;  4C11 B;  1G1X A;  1DTT B;  3CJK B;  3JSY A;  3RRG A;  3J81 U;  4ZJQ A;  4C3M A;  1DLO B;  2MLX A;  4RL1 A;  2R8J A;  4E0D A;  1FJE B;  3HFZ B;  2OI2 A;  3GB0 A;  4PRF A;  3H20 A;  3CB4 A;  4CO0 A;  3KLF B;  4RW8 A;  1QJH A;  3R5B A;  2ZKU A;  3H0P A;  3J80 Y;  3H5X A;  2BX6 A;  2ZDP A;  2VG6 A;  3RBE A;  5HMX A;  1NJY A;  5IOL A;  1VBZ A;  3HVT A;  5D4P A;  3FEZ A;  1VJQ A;  4RBU A;  1ZET A;  2HZC A;  5EX3 A;  2BDP A;  5IM0 A;  2QEX S;  2PMZ D;  1X4C A;  2K3I A;  3KNG A;  4LF4 F;  2RVJ A;  5EWG A;  3M9M B;  2CZV C;  1S1U B;  1VQK S;  2YVS A;  2FHK A;  3GIK A;  2I6W A;  4AMP A;  3RAM A;  3J7A N;  1ZBT A;  3AY0 A;  1DUR A;  3L9Z A;  1H98 A;  1WNE A;  3KHG A;  1NZA A;  4B17 A;  3IG1 B;  4DV1 F;  3VAJ A;  4Y6I A;  4U67 Q;  3FMW A;  3LP1 B;  2MKJ A;  1VR6 A;  1RAA B;  3ETM A;  2DHX A;  4LSL B;  3QT5 A;  4YN3 B;  3KLG A;  3KLI A;  4NLQ A;  2EPI A;  3UFC X;  4F4W A;  4DR7 J;  3TVK A;  2JSX A;  1CPZ A;  2YKN B;  2OPS B;  2D3U A;  4K4W A;  1DY3 A;  4DSJ A;  2RH3 A;  1FRX A;  3G6X A;  4C8K A;  2POK A;  4ZVO B;  1FDD A;  3QO9 A;  1FTC A;  1V5V A;  2HNY B;  4YUD A;  3AH6 A;  2KVI A;  4ANC A;  1L3U A;  2OH2 A;  2YKA A;  3C16 A;  1REV B;  2K7K A;  4O3R A;  5IC6 B;  4H4K A;  2R8I A;  4BDP A;  5C25 B;  2O5D A;  4O4G A;  1FRM A;  2RHQ B;  1S12 A;  3DDK A;  4USM A;  3P5T L;  1NDP A;  1W25 A;  2VH7 A;  2OIH A;  3OUY B;  4WYL A;  1GEH A;  1NHU A;  1GTE A;  2VPZ B;  2EG2 A;  4FXD A;  1U1P A;  4G3I A;  4P9S A;  1QE1 B;  2GAG C;  2UUC F;  4X4T A;  3SZ2 A;  2GCF A;  1BC6 A;  1VFJ A;  3ISN D;  3KJN B;  2FGO A;  1QAI A;  3CMA S;  1HFE L;  4ZLP A;  5JUM A;  2RRB A;  3T1H F;  3CCL S;  4DSI A;  1HNX F;  1AZS B;  4JI1 J;  1YZ6 A;  5KG4 A;  2YKP A;  3MEC B;  2HND B;  4OX9 J;  2B9E A;  1CJV A;  2V8H A;  2W1B A;  2KVQ E;  4OHW A;  3MR5 A;  3LGM A;  2Y1J A;  1D8Y A;  1P1T A;  2JJ4 D;  1RHR B;  4WTY A;  4KR0 B;  4DPX A;  2IVY A;  3KK1 A;  1MLA A;  4UF4 A;  5K8O A;  4G1I A;  2HMI B;  2IM1 A;  3BB5 A;  2B8P A;  4WF9 Q;  2ZOF A;  2JFK A;  1VBK A;  4KB7 A;  4FXW A;  2NCK L;  4DPW A;  3ZNU A;  4X62 F;  4QWC A;  2CPH A;  4FNH A;  5F9L A;  5BJR A;  2RE1 A;  2UXB F;  4U96 A;  3TW0 A;  2UUA F;  2R7Q A;  1FRL A;  5F8M A;  4EZ6 A;  1RAG B;  3HSD A;  1EP4 A;  2YNH B;  1U0H A;  3RYL A;  1YJR A;  3HP6 A;  2Q3P A;  2GVZ A;  2R8G A;  1M5V C;  1BD6 A;  4IQX A;  1SQG A;  4F67 A;  1XMO J;  2F63 A;  2XUL A;  3MPD A;  3QSI A;  3KJQ B;  3W9H A;  4M5K A;  2D3Z A;  5A8K B;  5KG5 A;  1JWW A;  2V34 A;  3RG6 A;  1WEY A;  9ATC B;  4NZ6 A;  2HNZ A;  1X5T A;  2VOD A;  2C2K B;  4MKB A;  3KUH A;  5KFT A;  1FE4 A;  1RAJ A;  1RA7 A;  4DSF A;  2EFG A;  4ILR A;  2QA1 A;  1RUS A;  4IG0 B;  3MZI A;  3GJS B;  4NLP A;  3JYT B;  4NI2 A;  4LBI A;  5L1J A;  2WVC A;  4B9M A;  1DTT A;  2Q43 A;  3CJK A;  4AD6 A;  2C22 A;  5GMD A;  2MZQ A;  1N5T A;  4M5D B;  1K0V A;  2XWY A;  5GAE U;  3G71 S;  3KLF A;  2O66 A;  3TR5 A;  2DH8 A;  1RLC L;  2YWW A;  4QU7 A;  1UW9 A;  3BGU A;  3WZ0 A;  2IC3 A;  3GIJ A;  2ZH8 A;  4PYA A;  3OVB A;  3M8S A;  3VAG A;  4KE5 A;  4JV5 J;  4HDG A;  4JI2 F;  3IM9 A;  5L39 A;  1VQL S;  4E2F B;  4M63 A;  3R5D A;  3HSZ A;  1YZ7 A;  1PO6 A;  1N6Q B;  1EAY C;  2NS1 B;  3OJS A;  1S1U A;  2BRK A;  2E7X A;  3DXS X;  1X0F A;  1X31 C;  1U02 A;  2SXL A;  2XLI A;  3O44 A;  1U1R A;  5CZD A;  4IO1 A;  1D9D A;  2FHO B;  1HHT P;  3IG1 A;  2QE5 A;  3C6T B;  2IJR A;  4NLS A;  4JB8 B;  3A3N B;  2JEJ A;  3QAT A;  4DV3 F;  4K0K F;  5D0G A;  3ONQ A;  1TL3 B;  3W61 A;  4RU2 A;  2G0J A;  4LUB A;  3BGO P;  3N6M A;  2VIH A;  4C0H A;  3AXK A;  2YH0 A;  1W2B R;  2YKN A;  2OPS A;  2RT3 A;  3GCX P;  1SQE A;  3K2Y A;  4DV0 F;  3PO5 A;  1HNV A;  4BC9 A;  1U2F A;  2I0X A;  4USH A;  1RBA A;  1V3S A;  2M8H A;  2VJV A;  4KTQ A;  4G1Q B;  5D4N A;  5AE3 A;  5AXN A;  2QG9 B;  4O0I A;  3D68 A;  3IFE A;  1T95 A;  1VIX A;  4J9Q A;  2PFF B;  4LF5 F;  1SIZ A;  2FLN A;  1REV A;  3CJ3 A;  1GMU A;  2RUS A;  4PZV A;  4WK1 A;  1HD1 A;  3O6Q A;  1UFL A;  1KLM B;  4N7T A;  5HJX A;  2A0F B;  2MLZ A;  1YKW A;  3D5M A;  1KKH A;  4DUZ F;  1WSV A;  4HHJ A;  4ZDN A;  1HYS B;  1LQ9 A;  2DYA A;  2DGQ A;  2ZBR A;  4Z7C A;  5D0E A;  1R0A A;  1Q5V A;  3CJ0 A;  3CE8 A;  4AL7 A;  2AP6 A;  4DCP B;  1JLC A;  3K5P A;  2VL1 A;  4F0K A;  1LFW A;  2LQ5 A;  5AXK A;  1AZS A;  4TU7 A;  3QJJ A;  2HND A;  1RT6 B;  4IDK B;  2BAN A;  5EGY A;  1HQU A;  3CTR A;  3GR1 A;  4DUY F;  2VZ8 A;  4A8X A;  2YNF B;  4QR2 A;  1OSD A;  1RCX B;  2FUG 9;  4UUW A;  4WU2 A;  3ZFV A;  2CWK A;  2RIJ A;  5GAD U;  2KT5 A;  5AJ3 F;  1FNM A;  4YOE A;  1FTR A;  2C2D A;  4UOH A;  4KKO B;  2Y0B B;  2PEB A;  2VOO A;  2OEJ A;  3W5Z A;  4LFA F;  1B7Y B;  1RTH B;  4QW8 A;  3BR8 A;  2PMH A;  1HNI B;  1JIH A;  1MRO B;  3CSK A;  1NH7 A;  1RTI A;  1ROF A;  4TXS A;  1U1O A;  1C1B B;  1P8G A;  1RAB B;  2BE7 D;  4LMZ A;  4AL5 A;  4DFM A;  5F8J A;  4OZ3 A;  1HBM A;  2M88 A;  4WKR A;  4YR0 A;  5DQI A;  2RU3 A;  4A8F A;  3I31 A;  1PBA A;  3KTQ A;  2DGS A;  4N41 A;  1U09 A;  2DRB A;  2ZJR Q;  4JV1 A;  1RU2 A;  3MM7 A;  2NSC A;  3GFZ A;  2P6S A;  5A8K A;  3CD0 A;  2IHR 1;  4CQ1 A;  1MWY A;  3VWS A;  4X65 F;  2JC1 A;  5JXS A;  5LXR A;  4ZVS B;  2LDI A;  2GX8 A;  4ZVR B;  5B0A A;  2IVF B;  3H25 A;  1TAQ A;  1N4L A;  1U6B A;  2Z2Z A;  2FHJ D;  4ZCK A;  4DL5 A;  3D0H E;  4P74 A;  2WBR A;  4IG0 A;  4NYZ A;  4C9D A;  2DCL A;  2ZE2 B;  2OJ3 A;  3JYT A;  4HL9 A;  4URG A;  4JI0 J;  1JLG A;  4IR9 A;  1URN A;  1G4C A;  3RBD A;  5CZX A;  1QLN A;  3RJM B;  3PY8 A;  4L6V 3;  1KD1 T;  5JVG Q;  4DMZ A;  3QQC D;  2ZBQ A;  4NLV A;  3OSN A;  1KON A;  3H4B A;  2HRY A;  1R0C B;  3UPF A;  3OHB A;  5KT5 A;  2B4P A;  1NK5 A;  4PPD A;  3JTO A;  1WG4 A;  2NYH A;  1XQI A;  2KHC A;  5DG7 A;  1SXL A;  4LR8 A;  2H5E A;  2FLO A;  3JQK A;  3K59 A;  4ED3 A;  1HWL A;  3M8Q B;  3TWZ A;  2CPE A;  3DGV A;  2HQG A;  1VRT A;  2HHW A;  1UVK A;  1YX2 A;  5T41 A;  5KFE A;  2PE8 A;  4FS1 A;  4F2R A;  1RDR A;  4Q2M A;  3RBX A;  1U1M A;  3SFU A;  1BWE A;  1CUL B;  5KFJ A;  4AMM A;  5IS2 A;  2LEC A;  2B7C B;  5L38 A;  3DOL A;  1RTJ A;  1VQ7 S;  3GV7 B;  4IRK A;  4ERD A;  3PJX A;  1N52 B;  2DVI A;  1AW0 A;  1OWX A;  1X8D A;  1N36 J;  4K4T A;  4DR5 J;  3Q8R B;  3I82 A;  1TL1 A;  2AZ1 A;  5DLF A;  3HSJ A;  2MKK A;  5GAE I;  5LMN F;  1HKA A;  5FJ4 A;  1WWH A;  1DRZ A;  2R2U A;  2Z8Q A;  4LFB J;  1R89 A;  2V67 A;  4RW7 B;  2DY9 A;  4WKY A;  3CVK A;  2BRL A;  3CCU S;  2MGZ A;  3PDN A;  4Z37 A;  3HD2 A;  3ULH A;  3HMJ G;  1C0T B;  2NXN A;  4J9P A;  2AZ3 A;  4NLR A;  2BQ3 A;  5MAO A;  5LSO A;  1CC7 A;  5F0W A;  4NRT A;  2AD9 A;  3CCW A;  1U1N A;  2QO3 A;  3ZTR A;  4DUT A;  1KLM A;  2MQQ A;  4C6A A;  4JI7 J;  4Y65 A;  2MYF A;  4CDI A;  2NPF A;  2VF3 A;  5D78 A;  4EO8 A;  3UN5 A;  2MZ1 A;  4RPF A;  1HYS A;  4X64 F;  1CS4 B;  2B51 A;  4U95 A;  3FBF A;  3R6L B;  2DNP A;  3QPI A;  3T9Z A;  1RP5 A;  2RB7 A;  1IKY B;  4DV4 J;  4OYW A;  1KC8 T;  4IDK A;  4J9L A;  3NNH A;  4YHH J;  4CLU A;  3GIR A;  2KT3 A;  3VVT A;  3DXB A;  1OSC A;  2Y0S D;  3WIV A;  3PAC A;  3MM9 A;  2OTL S;  1RLD A;  2IDE A;  2DH9 A;  3MUR P;  2IAJ A;  3M2V B;  4ZVT B;  1B4S A;  4F8R A;  2AEM A;  4J9M A;  3C15 A;  5DET A;  5KTQ A;  1S9G B;  2QL9 B;  1TUV A;  5CA5 A;  4IYQ A;  1RTH A;  5M2P A;  2ZEJ A;  4ZIV A;  1HBN B;  1HNI A;  4DI6 A;  3MUV P;  3BR9 A;  3R7S B;  4J9V A;  1BXN A;  1QD1 A;  1SB6 A;  4IQM A;  2KN4 A;  4NLX A;  2J6T A;  2MQN A;  3CJ5 A;  4DR1 J;  4X4P A;  2QMW A;  2FHM A;  2WB1 D;  5KG0 A;  1S7I A;  1GMV A;  4KRW A;  2AHO B;  2OEK A;  3BH7 B;  1MW7 A;  4JUZ A;  3TO8 A;  1SKW A;  2H51 B;  2WSC C;  1NM2 A;  3O8W A;  3QRQ A;  4WXW A;  5ETK A;  3TJA A;  5D4O A;  3IM8 A;  4CIO A;  1DFD A;  2NPI A;  3LTO A;  2K2P A;  3UDL A;  1FX2 A;  2KL8 A;  3MHY A;  1HI1 A;  2B5J A;  1U1L A;  1KWM A;  3UR3 C;  4LF2 A;  4RX6 A;  3Q22 A;  2XMW A;  3ZTO A;  4OI2 A;  5K5M A;  3OTE A;  3NBP A;  4AE5 A;  4ZKA A;  3NP5 A;  1GXT A;  1SJQ A;  4GKJ J;  1EHW A;  1YK9 A;  4DL7 A;  3PYE A;  4J37 A;  2ZE2 A;  5GAD I;  4ZP7 A;  4U7U K;  4NRU A;  3TA0 A;  2AX0 A;  2ZFH A;  1VCT A;  2EFQ A;  5J2N B;  4K5S A;  3B4M A;  3C8Y A;  5KFH A;  2ZH1 A;  4K4Y A;  1LWF B;  5BYS A;  4IFY A;  3A8E A;  4TYB A;  3PV8 A;  4TNO A;  3SV4 A;  5A6P A;  4N5S A;  1QSL A;  2LFV A;  2R9L A;  3CCZ A;  1OO0 B;  3L95 X;  2CDQ A;  2YX4 A;  4CH0 S;  2D9O A;  1PYT A;  3THV A;  1R31 A;  4AYB D;  2LEA A;  3LF0 A;  3MWB A;  2VC1 A;  1Q82 T;  4NLT A;  2GJ2 A;  3H2V E;  3FEX B;  3MPY A;  1GXU A;  3G82 B;  4K4U A;  1XER A;  1NDK A;  2D9P A;  4NLW A;  3MUM P;  1UPP A;  1KVI A;  4QZV B;  3I0R B;  3I5C A;  2J7K A;  4LBH A;  4EBE A;  2QL5 B;  4UQG A;  3M8P B;  3TZY A;  2K7J A;  1T3N A;  4FF2 A;  3CMQ A;  3P4U B;  4ZVH A;  1CJK B;  3SCJ E;  2ZH2 A;  1CUL A;  1YJU A;  1IN0 A;  4CLS A;  4ANE A;  3ZO7 A;  2HLT A;  4TVA B;  3VGS A;  1D1U A;  1M5P C;  4X4N A;  2DHA A;  4WII A;  4JI3 F;  4DR7 F;  2LA6 A;  4OLP A;  3MOJ B;  4NA1 A;  1UVI A;  1Y0H A;  1EJ7 L;  5DGB A;  1PCA A;  5J2P A;  1JJC B;  3PCO B;  1Q8L A;  2Y3Y A;  4PQU B;  3DRP A;  2XHW A;  4KGV B;  3TUZ C;  1EB0 A;  1KQK A;  2MSS A;  4FZV A;  4IOA Q;  4WU3 A;  3LGN A;  3TEH B;  3QT7 A;  3B54 A;  1FD8 A;  4HT7 A;  2N3L A;  3AQO A;  4PG5 A;  2EWH A;  4FF4 A;  1WI6 A;  4YDX A;  1KTV A;  4KO0 B;  2FD2 A;  3QLH A;  4W92 B;  1K1S A;  4ED6 A;  3RAX A;  1EET B;  5CH7 B;  1NUE A;  3KLE A;  3NNA A;  1UEU A;  5CXT A;  1HBU B;  2DNO A;  4LSZ B;  3R97 A;  5CAA A;  4L72 B;  3QZ8 A;  2CQ2 A;  2DR7 A;  3UVJ B;  1BLU A;  2CPX A;  2W24 A;  1CS4 A;  1PKU A;  3OR2 B;  1HLW A;  1YGY A;  5B7W A;  2LMI A;  2A18 A;  1IKY A;  1NJW A;  2P9G A;  2YWH A;  4UST A;  3OL6 A;  4ZVG A;  2LQB A;  4I64 A;  4CT8 A;  3KHL A;  1FKO A;  2KKH A;  2FZG B;  4NCG B;  1VK3 A;  3Q24 A;  3PKM A;  2F65 A;  3CC2 S;  4O3S A;  4HTI A;  4DV5 J;  5KG7 A;  2MST A;  2V68 A;  2ILY A;  2DY1 A;  4ZN1 A;  2DIS A;  3OD2 A;  5LSL A;  3GJT B;  3M2V A;  1SCJ B;  3RRH A;  1T9Y A;  4M5N A;  3O1L A;  2FVQ A;  2WON A;  1S9G A;  4EU0 A;  1E6V B;  3THT A;  1WC4 A;  2CA9 A;  1WSR A;  3E3X A;  2RJZ A;  1SV5 A;  3KMQ A;  2L9W A;  2AMC B;  2B9Y A;  2HSE B;  1HBN A;  2CPJ A;  2YWF A;  3V4I B;  1N34 J;  1ELO A;  2VFU A;  1YLX A;  3TAP A;  3CDE A;  2AYM A;  2HGM A;  4ZHR A;  2QC3 A;  3AJD A;  1S99 A;  1XMO F;  3GMG A;  5LXY A;  1RWX B;  3EVO A;  3OSP A;  3S6E A;  2LU1 A;  4E8U A;  2DO4 A;  3P45 B;  3UCG A;  2JNJ A;  5IV3 A;  3BSA A;  1S1T B;  4IH5 A;  1HQ2 A;  3IGN A;  3M7V A;  2Z30 B;  3ITH B;  2V63 A;  2BW7 A;  5ITH A;  2CNN B;  2PDA A;  3POT B;  1C0U B;  4CNY A;  1O0P A;  1NHV A;  3NNC A;  1TUG B;  2ZM6 J;  3MOZ A;  2EKY A;  5DRK A;  1F0X A;  4ZP6 A;  4BC7 A;  2V2Q A;  1TK8 A;  3B6B A;  2MKY A;  1X9M A;  5K14 A;  4KJI A;  1JLB B;  3BN7 A;  2ASD A;  1A9N B;  3OFG A;  2W9C A;  2YTC A;  3W66 A;  1N88 A;  4DX8 H;  2FC8 A;  2HQI A;  1RT2 A;  5D0R A;  5J2M B;  5J2N A;  1XC9 A;  1UP1 A;  1I51 B;  4NWB A;  2CQB A;  1LWF A;  5KFL A;  3O2I A;  4QCL A;  1JLQ A;  1ZZF A;  3PXG a;  3MTK A;  3HVA A;  2EG1 A;  1X4B A;  4JV5 F;  3LUY A;  2RKI B;  3CED A;  2LQ8 A;  5CYM B;  2CKW A;  5I3Q A;  2XCP A;  3BSO A;  5ETL A;  4ED0 A;  3LO3 A;  2OMO A;  2G2Z A;  2AQ4 A;  2J9D A;  4CM2 A;  4FF3 A;  1TL5 A;  1PIE A;  4Y28 C;  5DZ6 A;  4ES3 A;  4KV8 A;  4EYH B;  2GIF A;  3V6D A;  3NGS A;  4CLF A;  1B0P A;  2J6U A;  1XMQ J;  1RTD B;  1O8B A;  1F2H A;  1MWZ A;  3GWC A;  1WEZ A;  4XPC A;  3OHA A;  3VF0 B;  4FBU A;  1CJK A;  2UXD J;  5E3C A;  4F26 A;  4DPT A;  2MY8 A;  4O3P A;  3BQ0 A;  5B0B A;  4JBC A;  4I56 A;  1JLA B;  3F44 A;  2N7Y A;  4RR5 A;  3M4X A;  3HXM A;  3TZZ A;  3IAS 9;  5ETQ A;  4WFB Q;  4FYD A;  1PIL A;  1M5K C;  2AYG A;  4MIA A;  1L3S A;  2IJF A;  5M2U A;  3TP2 A;  1RT5 B;  2DGV A;  3BJY A;  3UD4 P;  1MN9 A;  3HLU A;  3L09 A;  1KNZ A;  2EC2 A;  4N8N A;  3KDO A;  3AB2 B;  1J27 A;  3GYG A;  1FKP B;  2GML A;  5SZT A;  3DLG A;  1BWV A;  3BGR B;  4BWM A; 
#chains in the Genus database with same CATH homology
 3EZO A;  3HHD A;  3TZX A;  2HG4 A;  2VKZ G;  2QC3 A;  3H0P A;  2QO3 A;  3RGI A;  2G2O A;  3QAT A;  3TZY A;  3TZW A;  4RL1 A;  3K89 A;  4RR5 A;  2C2N A;  2UV8 G;  5CZC A;  3HMJ G;  3SBM A;  2VZ8 A;  2JFD A;  3G87 A;  5CZD A;  2QJ3 A;  3CJ8 A;  2G2Z A;  2H1Y A;  3R8Y A;  3HJV A;  1NM2 A;  3PTW A;  2PFF B;  5DZ6 A;  2CUY A;  4QBU A;  3TZZ A;  2JFK A;  3TQE A;  5DZ7 A;  3IM9 A;  3BV8 A;  2G1H A;  2VZ9 A;  1MLA A;  2G2Y A;  3R97 A;  3IM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...