4RR5A

The crystal structure of synechocystis sp. pcc 6803 malonyl-coa: acp transacylase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
293
Chain Sequence
MKTAWVFPGQGSQAVGMGVDLLSTAIAKEKYQQAEEILGWSVVEKCQGDEASLALTQNTQPCLYVIEAILADLLRDKGFQPDYVAGHSLGEYSALYAAGVFDFATGLQLVKQRSEVMASASGGMMAALMKFDQTQLQQALTDNTEVVLANDNSPEQVVISGTVAGVEAILANVKARRAVPLKVSGAFHSSFMAQPSQSFAQTLTACHFNDATVPVLSNVDPSPTQNGDRLKEKLIQQMTGSVRWRETMVNLGEIGATDYWEVGPGKVLTGLCKRTCPDLNLKNIGQLDDLNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of MCAT from photosynthetic microorganism Synechocystis sp. PCC 6803 reveal its stepwise catalytic mechanism
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Transferase
molecule keywords Malonyl CoA-acyl carrier protein transacylase
total genus 110
structure length 293
sequence length 293
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 4rr5A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 4rr5A01
2PFFB 2H1YA 3EZOA 5CZDA 3TQEA 3K89A 1MLAA 3QATA 3CJ8A 2JFKA 2QJ3A 3HHDA 2G1HA 4RR5A 3HJVA 2G2YA 2G2OA 4QBUA 2VKZG 2VZ8A 1NM2A 3HMJG 5DZ6A 3G87A 5DZ7A 3IM9A 3BV8A 2G2ZA 3RGIA 2HG4A 3TZWA 2C2NA 2CUYA 3H0PA 5CZCA 4RL1A 3R8YA 2QC3A 3TZZA 2VZ9A 2JFDA 2QO3A 2UV8G 3R97A 3IM8A 3SBMA 3TZYA 3PTWA 3TZXA
chains in the Genus database with same CATH superfamily
2AGPA 4Y65A 4Z7CA 4CLSA 3WX4A 1Y00A 4HDGA 3FZ2A 5IS2A 2CZ9A 1WTBA 5ETVA 4JI1J 2CQCA 1TL7A 2PEHA 3IRXB 3M1VA 4I6WA 4ZPAA 1DBDA 3RBXA 3V81A 2E5LJ 2J6TA 1DFDA 3HHDA 4J9VA 4Y2KA 2KI2A 7FDRA 1LFPA 4DFKA 4X4SA 1LWCA 4FNIA 4QJVA 4PABA 2XMTA 2BKOA 2EKNA 1U6ZA 3J7AN 2BANB 5ETLA 4WTOB 3PJWA 1UAWA 5D77A 4WFNQ 3N6NA 1RHRB 4ZCIA 3AOAA 3W64A 2J8AA 3F44A 1RBOB 1OQ6A 1VBKA 3SBMA 3EDRB 4EBEA 5KFRA 2HMIA 4DQIA 2BJ7A 1M90T 1KN6A 1TUWA 2VJUA 1C2PA 1K44A 2BZ2A 2CYYA 1YJRA 2K7JA 4I6YA 4PWWA 3VAHA 4PUOB 1RADB 2I0XA 2IVFB 4U67Q 4HT5A 4RWXA 1SL2A 3IR7B 2YX7A 3OFEA 1YBAA 3CDWA 5EHHA 5IWAF 2XLIA 4AMMA 3IM9A 4KO0B 3GILA 1NK9A 1XIQA 3W2VA 2V9WA 2V94A 1YTYA 2ADBA 2UP1A 4B3RJ 4DPUA 1KD1T 1HWKA 3ICLA 4B9SA 4MFBA 3MFHA 1S1XA 2UXBJ 2XHWA 1HNZJ 4OHVA 3OL7A 1HD1A 4DV5F 1ACMB 3D3CJ 3I0RA 4RNHA 1EZZB 3CCJS 4UT4A 4ANEA 2R2SA 4XAKA 3BGLA 5J2NA 1ZTTA 4OYZA 2CQ3A 4HH0A 3HPOA 1N32J 1T0TV 3EMTA 1UEVA 1KTQA 1N6QA 4R8UB 3I5AA 2GHPA 3VVTA 1KVJA 2VF3A 5B7WA 1QD1A 3OR1A 3PRBA 3CCZA 3M8QB 2RKIA 4LJMA 2LQ9A 3UE2A 2JSXA 4JI6J 2DRDA 2D7SA 1LW2B 2V0NA 2DNGA 1NUEA 5K8MA 1DQ9A 3D6HB 3FBFA 2Y3YA 3FEXB 3N28A 1WC1A 4U8YA 4ID5A 3KHLA 3TRGA 1HNXF 4LF7J 3ADAC 1KS2A 4ES3A 1VLOA 3HD1A 1FJEB 2FLNA 3U27A 1RAHB 1IBCB 2OO4A 3OJUA 2MY8A 2QSWA 2MQOA 1JWWA 4DUZJ 5T7LB 2FTRA 3EYZA 1HYSB 2VD3A 4KV8B 5GAHI 5M2UA 5DQHA 4RNOA 2VFTA 3MM7A 4HEA9 4TY8B 2O3DA 1KHWA 1X9MA 2V4JB 4ICLB 1X4HA 4N7TA 1SL0A 3QRRA 2CAJA 3J7Z5 1PG5B 2WSEC 2FHKA 2HHWA 4LBPA 2MDAA 2F65A 1ZAXA 3R5JB 1BXNA 1XBWA 4C3LA 3Q8RB 4FXVA 2UUTA 4DL7A 2X1FA 4KHPJ 5A6PA 1PYOB 3CEDA 3CJQA 3CNQP 3DDKA 2ZHAA 4GC7A 3M32B 1UWBA 2B4OA 1N6QB 2DPIA 4U95A 2R2TA 2HWHA 5D4NA 1ZTWA 4AQYJ 4DF4A 2CQ1A 4OJ1A 2EW9A 3PR5B 2NR0A 1N5QA 2M8HA 3GJTB 5HMWA 3SDEB 1T9UA 4B3TJ 2BV3A 4NEYA 4EGLA 4RW4A 4ZVTB 4ECUA 3Q8PB 1LK5A 5F0UA 3JXOA 4DPWA 2MQLA 1L3VA 4O3SA 4DR7J 1UPPA 3S7RA 3EZOA 5HO4A 4DQQA 1ZZNA 4C9DA 1JLGA 5D4OA 3WHIA 3TARA 4DL3A 4F3MA 1IUJA 1WOPA 3LAKA 2DVIA 2WRMA 3TAMA 4LF6F 2R7XA 1WSVA 4FPIA 4GO7X 5I3PA 4B3OA 1IKXB 4NYOA 3OTOJ 3CGIA 4DR2F 1U47A 2P8IA 5B08A 4X65J 2LP4A 3WC0A 2V8HA 1HFEL 5KFJA 4O0NA 2EC2A 4Q45A 2ASLA 2XULA 1QVGR 2XQCA 2CQIA 5CZVA 3MCOA 2RILA 4B9NA 2OAUA 2ZE2A 3G71S 2I5JA 3GFXA 3I4PA 3VGSA 1LWFA 5L9XA 1ZH5A 2F9DA 2XWYA 2M9KA 5F3TA 3PIPQ 2FJXA 3NGKA 2YBVA 3UVJA 2R7OA 1JLFA 4TQRA 2HAIA 2F8HA 4IH6A 2UXDJ 5LMUF 1F5BA 2YQ3A 4NLGA 2BJ8A 4K4XA 2FC8A 2VG6A 1T05B 1EKRA 1HQEA 2HNZB 1TP7A 2LLZA 1NBEB 2DXDA 4URQU 4Y2CA 5HMZA 1Q8BA 3ZNUA 3DYAB 2KJVA 4LFCJ 4K4VA 1LWFB 3TX0A 1YJWS 2RDDA 4JI7J 3LGMA 2AMCB 3IXQA 1TTHB 2C2NA 3TUZC 3MUTP 3UR3C 3DLGB 1AFJA 3QAEA 1ZM9A 1K73T 2ZD1A 4MIAA 5CYMB 1FJGJ 2HFZA 4OHXA 1VOMA 2QE5A 3H5XA 2LQJA 1Q95G 1ZM3A 2ZUGA 1T9WA 4NI2A 3K5NA 4QYZJ 2E66A 1PJ7A 1U09A 1KEKA 1VFJA 2UUCF 5FDLB 4RX6A 2YPZA 4KGZB 4DSLA 4J9RA 4C4WA 2RNEA 2E29A 1KLMB 2C3PA 1RXOB 4EI2A 2HHSA 1V9OA 3QT7A 2BJ9A 4OLPA 1T94A 3IGVA 5D4LA 4WFYA 1HA1A 1J5EF 1IM6A 2EK6A 2LEAA 3KK3A 3CC7S 2UXCJ 4MKBA 3GV7B 1LEOA 1Q7LB 4RKUC 4U7CA 5J2QA 1VJQA 3PHTA 2PIIA 2MLXA 1SVDA 3DKDA 1ULRA 3KLGA 1Y7PA 3PX6A 2N4DA 2EG2A 1R8BA 3CUNA 3T5JA 4TN2A 4CLTA 1WHYA 2DTJA 3FRZA 2LA4A 3TZWA 5H9EJ 4LF4J 1FX4A 4P73A 4LSNA 1RWMB 1NZAA 2ZNYA 3E8OA 1FERA 3K8WA 4I1TA 3TZZA 3BH7B 2O1PA 3KJQB 3UFCX 2ZH5A 5BXIA 3LQVA 5HSPA 3BPDA 3M30A 1EHWA 4CO2A 1WC5A 2WTFA 5KFFA 3WIUA 2YH1A 2YX4A 4KHMA 2NZCA 3NBPB 2W2NP 3DN9A 3UO0A 2KT2A 3ZTQA 2B6AB 3AXMA 3TVYA 2PMWA 4NI2B 1RE1B 3TEGA 4O44A 5GMKa 3KK2A 2F1FA 2Z0GA 3FK4A 4W92B 1FA0A 1S9GA 1WDDA 2JZ5A 2L9DA 2OEJA 3IS9A 3OD2A 1WORA 2MZJA 4H4OA 4NOHA 1FWPA 3HXMA 1NB2A 1IJFB 3VZIA 4HYKA 4EO6A 4HT7A 1KLNA 4LQ3A 2Y1LB 2EXUA 4H4MA 4PG4A 4XK8C 5E3PA 1S99A 4NRTA 4OZNA 1WC6A 5DGBA 5DM6Q 3V6HA 4LBHA 4ZVPB 2KO1A 3FQLA 2B4VA 2KYZA 3UCGA 5GADU 3ILIA 2XO7A 4FZVA 4DR2J 2HVIA 4JBCA 2F8EX 3VALA 1C0UA 2VC1A 3NGUA 3T5HA 1I3OB 3PG9A 3NAIA 2FUG9 4WCEQ 3PTWA 1S1WA 2C2KB 2J6UA 1F5CA 1SH2A 1OQ3A 2DR6A 3I32A 3OR2A 3PDNA 2W9AA 4JI3J 1FKAF 1S1UA 1TMMA 2EVZA 4QW9A 1NSAA 1RWOB 4I67A 2DXFA 1NHVA 2C22A 2HMIB 1Y5NB 1UEUA 4J7CA 5A8WA 4F50A 3I0SB 1XC9A 3B6BA 3FNNA 2QG9B 3V6JA 1CJKB 1RGVA 3DRSA 2MQQA 1QY7A 2D3UA 2YWKA 5LL6d 4ALZA 5SZTA 4BC9A 5T7LA 1RYRA 1REVA 4DPXA 2L3MA 1JLBA 3B78A 3SEOA 2J0WA 4C3KA 2CNOB 4TY8A 1HBOA 5B09A 4ER8A 2OPPA 3KJFB 4NLYA 3SIPB 4ZLLA 3SV3A 3AJ2A 5HROB 2DNRA 3K59A 4J9NA 1ZYQA 4YB7A 2UZAA 3QGIA 1RKIA 2E44A 4FYYB 1U7LA 2Q6CA 4ILRA 3RRKA 1YJNS 4OZLA 2AU0A 4FVMA 4OYPA 2BDPA 2B8QA 2GC8A 3CC2S 2R42A 1VQ9S 1FEEA 2FJVA 2ZEJA 3FBEA 1WC3A 1LW2A 2YKOA 4OV1A 2IDLA 5C2CA 2VJVA 4LF4F 2MSTA 4OI0A 1E6YA 4OIXA 2BEFA 2IM0A 3J80Y 3KK1B 5F9LA 2O66A 2EBGA 4DSEA 4LRDA 3PYDA 1G1XA 1S49A 1G7CB 2XI3A 3AD7C 4A8YA 1TL3B 2E7WA 4DWIA 5RUBA 1IR1A 4RNMA 4F4XA 4YB1P 4OZ2A 4URSA 1HWUA 2AWZA 4JI2J 5DZ7A 5GAGU 1HQ2A 4I6AA 2MKIA 5DGAA 4FKXA 3BZQA 1L5UA 4LF7F 4QU7A 5FDLA 3FGVA 3OTOF 2AEFA 2DPJA 2GIFA 2W4CA 4WP8A 4EWTA 5BJRA 4DV0J 2GQCA 1M5KC 1DJ0A 1DTTB 3R8YA 1X7VA 2DK2A 2RQKA 4X84A 5L38A 2PC6A 3QYYA 1C1CA 3OFGA 2OPRB 2YWWA 3T3FA 1S97A 2DCUB 3K5LA 4LFAF 4K0KF 4LRCA 2PMHA 2WOMA 1KQFB 3GIKA 2R8GA 2JLGA 8RUCA 4K5SA 4PAAA 1UVIA 2VODA 5J2PA 1DTQB 1DQ8A 1X9SA 2AYMA 2VG5A 2EC0A 1IBKJ 2GIQA 4WFBQ 1QTNB 4DUTA 4TVAB 2AW0A 3HM9A 2CPHA 4EO8A 4F4ZA 2LU2A 2C2OB 3DLLQ 4NA2A 2HQFA 1XEZA 1PCAA 4BWMA 4DR3J 2HVHA 4FDFA 1D8ZA 2MZRA 3THPA 1WACA 4KHPF 1Y9OA 1TKZA 1RTJA 5KFGA 3TNVA 4DOZA 2PSZA 5HBMB 1U1RA 2JFDA 1XR7A 4MK7A 4ZPBA 1JJHA 4HR2A 3BGRB 4ITSA 1FRXA 4JV1A 4KPYA 1TFYA 2XY6A 5KG7A 3H8YA 2HZAA 4ZITA 4YP3A 3BB5A 4AMPA 4N76A 5M2RA 4ED7A 1FO1A 4RUCA 3R5AA 1WI8A 5B0EA 1HI8A 3C66A 3D0IE 3QFHA 3T9ZA 3QIDA 3GONA 4AT1B 1BGXT 2VBYA 3MCMA 3PX4A 1AA1B 4P52A 1UFLA 4HI2A 3NMRA 3RYLA 4NEZA 1Y5IB 2OHDA 2BJ3A 2J7WA 2O01C 2RUSA 4JB8B 4RUBA 2H3EB 3OFHA 5IM0B 2C1EB 1IKVA 3D67A 3MM6A 4YHHJ 4KH0B 4FS1A 2W1BA 4ECQA 2DH9A 5D6GA 1X5SA 2OH2A 3TA1A 1BLUA 3FJ2A 3QO9A 4P9SA 5E3QA 3QFWA 5KT4A 3MECB 3QGPA 2HNZA 4F4AA 1FTCA 3T1YJ 3TAPA 4LVOP 3TEHB 4FF2A 2DNYA 2IMOA 2UXDF 2XI2A 2BKNA 3LP0A 3OPKA 1DQAA 3QLHA 4C0HA 4UOGA 1RBAA 3B54A 1SKSA 3DRYA 3W3SA 4L72B 3SQGA 2I1RA 3BO3A 1RTHB 2YNIA 3AD8C 4U8VA 5KOXA 3HDSA 4USUA 3TUPA 2BA9A 2FY1A 3PCOB 3CJ8A 3AOCA 4MKVA 5IQQA 5H1SV 1R3NA 1Z2LA 5CD4H 2JWNA 4ZDNA 2ZC4A 3M9OB 4DN9A 3DNCA 4NLPA 1HHTP 3QNWB 1VI7A 3DGPA 1FVSA 3ZZYA 4H54A 4JI4F 1XMOJ 3BSOA 2BJEA 4BCAA 4GVLA 5IWAJ 2FHJA 1VRUB 1YBUA 2I9SA 2DH7A 2QLWA 4CZCA 4AL5A 1FRJA 3LTOA 1PSDA 1FKOB 1HQUB 2FHOB 2AJ2A 2MJNA 4U96A 5KG4A 3NP5A 5MAOA 2NSCA 2W7AA 1PKUA 2JEGA 2CNKB 5K9FA 1TL5A 3HI9A 1NB7A 4QIFA 2UUBF 4DCPB 5J1PA 4EYIB 2MJUA 2W9CB 1MROA 4P7VA 5J1EA 2IJRA 4X64J 4QWAA 1M5PC 3H59A 1H38A 2KZZA 2K7KA 5E3RA 4M5GA 2O67A 2RRAA 4C8OA 1RHJB 3F56A 3W9HA 2VL1A 1N5YA 2PA3A 2VZ8A 3UPFA 2NXCA 3NAHA 1OY9A 5A8KB 4G1QB 1N36J 2PI5A 3CCUS 5CCMA 4KTQA 3QJJA 1ZPWX 4X62F 5BR8F 1DRZA 3L09A 2FLPA 2FHJD 1XMBA 3MGJA 4WKRA 2MKSA 4OX9F 1CQNA 5D0RA 4PG6A 3K5PA 4Q44A 3ZFVA 2EEYA 3EJMA 3G6YA 1D9FA 3IM8A 1N56A 3CXCR 3KUHA 2Z57B 3KG0A 1RT3B 2IM3A 1WF0A 3GIIA 1ROFA 2HHUA 3R5BA 1WTFA 4U6PA 9RUBA 3PVXA 1O5JA 2Y8YA 4LFCF 2WVEA 3EGZA 4RU9A 4WTYA 1KDNA 3A8JA 4DPYA 4IRKA 4X65F 3LPEA 3KJVA 1RAEB 3GFHA 5D3GA 3UI3A 2AZ1A 3I96A 1YIJS 4BDPA 1CSJA 2CPYA 3GJRB 5ETOA 2KU7A 2J6SA 2JDJA 3D9BA 5AXKA 4C8NA 4MTPA 4YN3B 1GTHA 4ZLPA 4DX6A 1SC6A 4NCGB 4IDKA 1SB6A 3R3TA 4P2FA 5BYQA 1U1PA 1IQTA 1KONA 1VK3A 3IG1B 1HNIB 1SJ1A 4BBYA 2WW8A 5C24A 1K47A 2DNOA 4ZCMA 3V4IB 1FESA 1H7XA 4UUXA 5EGYA 5KFBA 2QA2A 4D3GA 3KK1A 4F2RA 4MK9A 2VONA 1S79A 3LALA 2A2DA 2IFXA 2F3JA 2E5HA 2FHMA 3SCIE 3CJKB 2C2EA 2CPDA 2UXBF 4A4JA 3GG1A 4Q5VA 3PHEA 1HI1A 1HI0P 5CHCB 1MWQA 1U0SA 2ZFHA 2ZM6J 3RB4A 1TL1A 1FCAA 1PIEA 4WYLA 3E2EA 2OSRA 4Y28C 4OZJA 2CJBA 3CVKA 3QZ7A 2HKEA 4OV6A 3OL6A 2W8LA 3AY0A 1EB0A 2ASYA 4NYPA 3HHLD 1C0TB 3O8WA 2RAQA 3O3LA 3BJYA 1AFIA 2BW7A 5T14A 4DLEA 4ZP7A 2Z2YB 3BYPA 4I2PA 4AFFA 1GMVA 2ZBIA 4O3PA 5BYSA 5B0AA 1NK7A 3KYLA 3N0VA 1S0NA 1XR6A 2FVSA 1WHXA 4F3OA 1HBMA 4KKOB 2KHCA 2YQ0A 5KFTA 1EKSA 3DLBA 2OFGX 4DR6J 1MN9A 1TL3A 2HHHJ 1H2UX 2HEKA 5KFZA 1VQ7S 3DLEB 4P2XA 1P8GA 2DHSA 4CM0A 2Y0BB 1UZHA 4E2FB 3G6VA 4DL2A 1YRTA 3DU5A 5JJBA 4LRAA 2NUHA 3AA9A 1VRUA 4P71A 2IRUA 5CXTA 4ZVFA 2IRXA 2BX6A 3MEGB 3R7SB 1KC8T 1S4EA 5I42B 3OV7A 3JTOA 3QRQA 1ZS6A 3N6MA 5F8GA 4C48A 1BQNA 4DS4A 1UA1A 2QZ8A 4IOAQ 4Q2LA 4ED2A 5FJ4A 1UFWA 2AKWB 2JL9A 3HT0A 5HATA 2MKYA 2XMMA 3SCKE 1RWUA 1Y0HA 5K8OA 4X4RA 1T3NA 1IKYA 3I31A 3WZ0A 1RCOB 3UCUP 2HW3A 3V6DA 2HHVA 4HHUA 3BQ1A 3K17A 2HZCA 4B9LA 3T1HF 1WEYA 2HHQA 3MMBA 5F8NA 4IO1A 1TZ0A 3GTYX 2YNHB 3JSMB 1FVQA 1OWXA 2RQ4A 3DLGA 3R5DA 3PACA 3N01A 2YKMA 2Y1IA 4KR0B 2HS0A 3RAXA 1J5OA 2RQMA 1TL4A 3GYGA 3DOMB 2VPWB 4J9SA 1DURA 5ITHA 4LF8J 5DETA 5FLXY 4B3SF 1I6JA 3LP0B 4MKAA 1ITPA 3VGUA 4ED3A 1MWZA 3M1VB 4FBTA 2U1AA 5AT1B 1HL6A 2P9GA 3FZBA 2D74B 3AQOA 5KFVA 2RS2A 1WSRA 4F25A 4X4OA 2QA4G 4OZ5A 4ZJQA 3MUVP 4DV7J 1RT7B 4DFJA 1XQIA 3OJSA 4YMEA 4B17A 1NAQA 2H48B 2RHQB 3JTPA 5A8WB 4J9LA 1CLFA 5LSRA 5CYQB 4DL0C 4EK2A 2OPSB 5DO2A 4E8UA 2KTQA 2C2RA 1M1KT 4YY3J 3RAQA 1REVB 4DEZA 5HP1B 2MZQA 5F41A 2ZDOA 2BM0A 2LECA 1R43A 1SJ3P 5G0RA 3CJ3A 1LOUA 2I6WA 3RU0A 4ED4A 1SPBP 1UVNA 2DGVA 3BF4A 2M3DA 4KGMA 4GVBA 1RTDA 1S72S 2E5JA 2R8IA 2D1CA 3KUGA 3F73A 4V19J 5EX0A 4EUVA 1WG4A 3MOJB 2R8KA 3LW5C 4LFAJ 3GIJA 1VGYA 1IM4A 3MHYA 3MM8B 3PRVA 2W4PA 1V3ZA 2CQDA 2WSCC 5KG3A 2QL9B 2W8KA 4C8KA 1OSDA 2CPJA 4K2JA 4DV0F 4A8WA 4ED8A 4DF8A 1RDRA 2FIUA 4K4UA 1FT8A 4Q0BB 1B7FA 5IT4A 3R7NB 4ECXA 1VLYA 1YI2S 4RO0A 1X31C 3DGPB 1SUQA 3LP2B 1SXLA 2RU9A 2XCAA 2GVZA 4K0KJ 2Q66A 3TUJC 3L7OA 3LF0A 2VA2A 2L41A 1U6BA 3CMQA 3W66A 4DR5F 2ADCA 3RBZA 3J81U 1X4CA 1XK8A 4J9MA 1JK9B 2JLFA 1TKXA 2VG7B 2VASA 3MI7X 3RAMA 2XS5A 3LOUA 2JEIA 1A7GE 4J9PA 3BDPA 2DO4A 1F3VA 1HWIA 2OPRA 2YTCA 5CH7B 4ELTA 4CH0S 2NYHA 3LWMA 2MZTA 3G2XA 2B7CB 2H54B 1Y5LB 1JNZB 1S1UB 2P9CA 3F0NA 3J7YI 4DFPA 2QYCA 4DHVA 1LW0B 3BDEA 4QIGA 4KSEB 4LIWA 3PX0A 2W2PP 3AAWB 2DR8A 2VBWA 1N32F 2BE2A 2V4QA 4Q8FA 4DBQA 3AB2B 2DNMA 3MMAB 4IOBA 5AJ3F 2QTWA 2Y8WA 3CCMS 1TKTB 3C3LA 2YNGB 5ADZA 1RAOA 4OJ3A 1TMJA 5HMYA 3J7A1 2OPPB 4YHHF 4PQUB 1HBNA 3FSYA 3P49B 3N9UC 1KVIA 1FFWB 1HNVA 4TU7A 3ETMA 1X4DA 3BSAA 3G82B 4P7TA 4USJC 4X64F 4EBCA 2E7XA 1RTIA 2HQ3A 1IBMF 1RAIB 2ILZA 2PA8D 2I8EA 1HHQA 1N54B 1T95A 3CJTA 4TYBA 5F0WA 3FSIA 4C11A 4NLDA 4FYDA 3K2YA 2HRYA 1H7WA 2VG7A 4M5KA 4FBUA 4DSKA 2ZKUA 3NNHA 2CADA 2Q1LA 4KHRA 2C2ZB 3VQSA 1WG1A 2K06A 1HLWA 1LFWA 4RPFA 4USVA 3CDAA 4ES1A 3TZXA 1HNVB 1SIZA 1RACB 1U2RA 2FZGB 3TW0A 6AT1B 3CJ0A 3N5BA 3P5TL 2PFFB 4PR6A 4OZ3A 3LWLA 4OQJA 4B3MF 1QSLA 1S6PA 4BC7A 4WU3A 2I38A 3OFFA 1CVJA 1JIHA 4C8MA 2A18A 1P9QC 1R8AA 2NYIA 3A1YG 2ZBCA 3OTDA 4HACB 4DV2J 2KFNA 4AL7A 5A76A 3MFIA 5C24B 3QT5A 4RUHA 4F4WA 5GMEA 1HBMB 2RH3A 3U1LA 1VQ8S 4NA1A 2KG1A 2KN4A 4JV2A 2H5EA 3LH2S 3A3PB 1KKHA 4DV6J 5HJYA 1JX4A 2GZOA 1W2IA 1FFSB 4JI0F 3VGTA 2GW8A 2HVZA 4CLKA 5JMNA 1SL1A 2OEKA 1NKCA 2UVRA 1KOOA 1Q8KA 2GJIA 1RTIB 2DNLA 3POTA 4FP9A 4G1PA 4IG3A 3TA2A 5KOWA 5A2QY 3VAIA 4DL5A 2OIHA 1W26A 4QWDA 3KHRA 3AQPA 2XEXA 2IDEA 2J9CA 3FBBA 4DX7A 3G6XA 4CQ1A 1F2HA 1RQ0A 2G13A 5C2GA 4NCAA 3R5CA 4KQZA 4XPEA 2GNKA 1HMVA 4I2QA 4ZVRB 4M95A 4W4MA 2DHXA 2K3IA 4S0MA 4DG1A 4WK3A 3IBCB 2ALYB 4DQSA 2PI4A 2FZKB 2C3YA 3PFEA 5EX3A 1LQ9A 4RZRA 1HNWF 1F0XA 2DXEA 1FTRA 1X0PA 3C15B 3V4MA 1T05A 3D6TB 4IKAA 4CI0B 4FPRA 3I55S 3HSGA 4NX9A 1QM9A 3EGNA 3MURP 3DCAA 3HCXA 3UR0A 1H74A 3RW6A 4CCHA 1H6KX 4LIRA 2E9TA 4TKTA 4EMDA 1NSKL 1WG5A 3NCRA 2HVDA 3NGSA 3PYFA 4N8OA 1X4FA 4KIAA 3MEEB 3TOQA 1S57A 3R2CJ 2IAJA 3BREA 4YB5A 1HBUA 3Q0AA 3RR7A 3TAQA 4RW6A 3KLEA 2PT0A 3DDNA 3KLHB 1BQNB 1RHQB 3AD9C 3KMSA 1M5OC 3FDSA 2LYVA 3T5LA 1FD8A 4TU9A 1EIYB 4JI6F 2XS2A 4YEAA 5C25A 3EPGA 1X5TA 1U2CA 3KNGA 2FJBB 3OLAA 1H2VZ 3GIMA 2ZWPA 2W9BB 1GX5A 1U25A 2RIJA 2DR7A 1U6FA 4DUYF 4YS2A 5C42B 1HWLA 5J2MB 2ERRA 2CNNB 5HAOA 3UW1A 1RWWB 2CNLB 2P9EA 3MUMP 3V2UC 2FZCB 3TJ8A 3T1HJ 2CJ9A 2FB0A 2OMLA 2ASJA 1J5OB 4ZP9A 1RAFB 2DEIA 4CLFA 4KGVB 3MWBA 4QIWD 3BN4A 3ZTSA 2DKOB 5C25B 4XO0A 5GAEU 1FX2A 4OZ0A 3TJAA 5KT5A 2CRLA 2HRUA 4NCGA 4ZPCA 4HLBA 1JLCA 4DQRA 2AX1A 2D3ZA 2VPYB 1UVJA 2CG4A 3BGFA 1UJ5A 1DARA 4I4BA 3NBPA 4TNOA 4ED6A 1FNOA 3CO9A 3ZZPA 5LT5A 1S76D 1CJTB 3QGHA 2A3JA 4IR9A 2MQ8A 1Q82T 4DV4F 2UU9F 2VA3A 4NZ7A 2HFSA 1RTZA 4FYXB 5AXNA 3IN5A 2JJ4D 3NOCA 1BD6A 2N82B 5LJ3Y 4X62J 2NLWA 5BR8J 2KYXA 2QO3A 4RWWA 2X1BA 4V19X 1WC0A 3UWTA 1QJHA 4FYVB 5KFCA 3MDFA 4K4SA 4EYHB 4GVBB 1T9TA 5M2PA 1RTDB 2BOPA 3IAM9 3CC4S 2EI5A 2NSBA 2VH7A 1O8BA 4OI6A 4AE5A 3EVMA 3MR3A 1N0UA 1PBAA 3ET6A 3OW2R 2E7VA 5IFMA 1NDLA 3C6UB 3M6WA 2AJQA 2JX2A 2UVWA 4NZ6A 5CYQA 3NY0A 5LSOA 3G87A 3IRXA 2Q79A 4B3TF 2NQPA 1GNKA 1I5OB 2Y1RI 1VC5A 3KG1A 5HI7A 3VTIA 5C5JA 5HP1A 2MKJA 3QQCD 6FDRA 4DN0A 2NUUG 4OJGA 2C42A 2Z4PA 4GMKA 1O6XA 1RT5B 4LF2A 2FJDB 4NZ0A 2LQ5A 3W2WA 3PR4A 1TKTA 1MNEA 2NPIA 3BSCA 1RCXB 2ATCB 2VICA 3W5XA 1ZAVA 4IR1A 5AE2A 1T9VA 5ETSA 4DPOA 2R2RA 4IRDA 4PWDB 3FEYB 1TV6B 1TKXB 3CDBA 1N4LA 1XTZA 1AT1B 1YLXA 4YY3F 4XPCA 4FF4A 3MPWA 3N4WA 3KJNB 4USIA 2F40A 2R7VA 2QMWA 3IGNA 2BQ3A 2H5JB 5GVQA 4DLGA 2KVQE 1B7YB 3G8SA 4GKJF 2YKNB 1UFKA 2ROGA 3CTRA 4WYWA 3VGVA 4C2MA 4ZA1A 3T9NA 1SUQB 3LANA 1JXVA 1OO0B 4JP8A 4RJVA 3JAMY 5E41A 4YFUA 1HYSA 2RD5C 3Q86A 3UN5A 2XGQA 2G0IA 2F9JA 5H9EK 1GXUA 2QSFA 3DRRB 2UUAF 4H4KC 3MXHP 1CEZA 4IFYB 4LFBJ 2GHWA 1X60A 2WHOA 2MKCA 4OI1A 3MEEA 1PYTA 5T41A 3MMBB 1T02A 1NSQA 5KG6A 4N8NA 5CD4A 1S6QA 3BO2A 4RW6B 3KLEB 2L9NA 3M05A 1R6VA 5EDWA 1U1LA 2CQPA 1D8YA 2R7SA 2JH3A 5CCLA 2FLLA 2WZ1A 2VFUA 3SZ2A 1YG0A 1KWMA 4LF9F 2B5JA 5EWEA 3DI6A 1T03B 3I5BA 4CTAA 2JRSA 4R0JA 3DRRA 4ZPWR 1BQMA 4M5IA 3SV4A 1JB0C 3KMQA 4AUKA 2XYPB 2HHPA 2F4VF 4JV5F 4K8RA 3CCSS 1YWXA 2HNYA 3CDEA 2WOMB 4KBIA 1S7HA 1T11A 4P6QA 2D41A 1M0SA 4EFAC 3D2WA 2F8MA 4NA3A 1PO6A 5KT6A 1URNA 2OP5A 4WJBA 4DX5A 1VBYA 3QSIA 3OXLA 1M5VC 4USTA 1PYSB 2MYFA 1PBUA 2GJFA 1RWXB 2OPSA 1U4BA 3M2UB 2VOPA 4GKKF 1KOHA 4B3MJ 1KFDA 3I9ZA 4OYMA 1URRA 3Q8UA 1UJ6A 4K4ZA 4LVNP 4ZCKA 1X4EA 1LWXA 1AZSA 2M4MA 2QMUB 4P72A 5KFXA 1OJ4A 1R8PA 2RU3A 3V4IA 4ZP8A 4OMFG 1Q5YA 2X3GA 3EGVA 5DDPC 2NCKL 2QA1A 4JUZA 1GXLA 3W9IA 3L7UA 1RWNB 3ILOA 2HVEA 3JQKA 4X4PA 2RJZA 1IBMJ 1XR5A 4OHWA 3HFVA 1WF1A 1KVKA 3MM7B 2QMXA 4LREA 2MZSA 2HURA 1ZBTA 3GJSB 3H4DA 3T41A 4OJHA 2OKQA 4ZVGA 1C4AA 4WP9A 5AXMA 4O3OA 1N34J 1WEZA 1N48A 3IBFB 2Z2LA 1GAOA 3GR1A 4K4TA 1RT2B 2V63A 2B9WA 4LF9J 1V3RA 2V6AA 5MLCV 3M2RA 3DGVA 1FRMA 3QWUA 4UOFA 4M63A 2CJKA 4JI0J 3HHLA 3MM5A 4CO0A 2ZH9A 5CZDA 4QW8A 2XMJA 4KYZA 5KG1A 5DG8A 1TVRA 2Y0SD 3ENWA 2JVRA 1ZM4A 4BLGA 3G8QA 4FNHA 4PPZA 2MPUA 3H90A 4KFBA 2QFJA 3QRPA 2V2KA 3FUYA 1EQ0A 3ILLA 3QMQA 1RWPB 1NM2A 3B8HA 4M5NA 4O3QA 3QSYB 2IVMA 1S6OA 2N4CA 4QR1A 1D9AA 2VUGA 3D1HA 5DJBA 4EEYA 1WKKA 4A8KA 2GFFA 1EP4B 4MMOA 4CT8A 3CIZA 4ZIVA 3RBDA 4YOEA 1R8CA 3P96A 2LKZA 3UQSA 3NKYA 3T6BA 2GV1A 4ECWA 1NKEA 2B3TB 3IWNC 1T3OA 2YKNA 3CB4A 3JSBA 3ULHA 3T5KA 2IMWP 2QYGA 4PG5A 3JYTA 1FRLA 1VIOA 1HNZF 4IFVA 2V8DA 3DMJB 1F9HA 2BMBA 1UETA 1YRUA 2J9DE 3Q8VA 1HWJA 2OELA 3VZHA 4M8LA 4FKYA 2I2YA 4E0DA 4K50A 3CDUA 4AMOA 3ILJA 4ECSA 4ECZA 3DLKA 4WE1A 1S4FA 2VQFF 3E01A 4DR4J 2W7PA 4IYQA 4ECVA 4Y2AA 4DR3F 4ZVUB 3HSJA 1S6QB 3MMJA 2DGTA 1QAIA 1NPKA 2B6AA 4WXOA 1FNXH 2OJ3A 5J1EB 1VQLS 2ZHOA 1RHUB 1UL3A 4DCOB 2N3OA 2Q3PA 1U0HB 1U8SA 1F1BB 2GJ2A 2ZNZA 3AT1B 2M5YA 4DS5A 4EZ6A 2G0JA 3NWGA 1SJQA 4PYDA 1JJ2R 1TUGB 4ZLJA 2ZZTA 1JLCB 1S12A 2H4WB 1TK0A 3IFEA 1KP6A 2HRTA 3ENAA 2R7UA 5DQIA 4OHZA 1REGX 2D69A 2WVBA 3MCSA 3S1TA 3DOKB 1D3WA 1VBZA 1WOSA 3KHGA 1RWKB 2DB1A 2FPHX 1TK5A 1BE4A 1EJ7L 2DYAA 3ZZRA 1JLAA 1HW8A 3SMZA 1U1OA 4USHA 3BPSP 2J76E 1LW0A 1OPZA 1YJUA 4M5MA 5D0HA 1TKDA 2GX8A 1Q79A 3MTKA 4RLEA 3UN2A 5I3QA 2HLTA 4KJIA 3U1MA 4DI6A 5KFPA 2AYBA 1PJ5A 3G8TA 4DV3F 3ISZA 3E01B 4U7UK 1MG7A 2B4PA 4KY3A 4ZLNA 3I9V9 2V9KA 2VKRA 4ILLA 2OMOA 3CW2C 2X3DA 4W98A 3ITHB 4ANCA 3GWCA 3R6LB 2WVDA 3KKFA 4F0KA 3RRGA 4PQUA 4B08A 3NXZA 3C6UA 1H3DA 3CJ4A 3M32A 4ANDA 3DFEA 4AD6A 4C7QA 3ZTRA 5I4MA 3LAMA 3CMAS 1S1XB 1W25A 2G1DA 2YQ1A 3D3BJ 3UNGC 4G6VB 2GGPA 3D6FB 4ZJOA 1N5SA 3OHBA 4NLRA 5EWFA 3BSNA 2XLKA 3G9CA 2ZVSA 4PXDA 1PC5A 3EDQB 4RBUA 1XWLA 3R27A 1VK8A 2RF2A 2W2OP 2D9PA 3EXCX 1PC4A 2KXFA 4YDDB 4QYZK 2KRBA 1ZZFA 3PJ9A 1TAQA 1WKJA 3OVAA 2JC0A 2ZVIA 4O44B 3H4BA 2HG4A 1X4GA 3ZTOA 3OUYA 3H40A 3W9JA 2XNQA 1VQSA 2XGPA 3UVJB 1Q4RA 3Q22A 1BQMB 1Q1KA 1T9YA 3AJDA 5ETPA 3T1AA 1HBUB 1H73A 4QIEA 5DS7A 2BR0A 1K9MT 2WB1D 4WZQA 2U2FA 4I68A 2RVJA 2KRRA 4NXNF 3SFGA 1FXRA 2XMKA 4DV7F 4CYUB 2ZH7A 3ZO7A 2R9LA 3EGWB 3CCES 3UD3P 4IRCA 4AMNA 2AQ4A 1Z1ZA 5KG0A 5CQGA 3FMWA 3DC2A 4LQ9A 4LT6A 4IFYA 5KFEA 2ZJPQ 1H0HB 2BXJA 3MR6A 5L46A 3BQ2A 1TELA 3L95X 3J81Y 2HZVA 2ZH4A 3NNCA 5J2NB 2J7UA 2DNHA 2VKZG 1RLDA 2M2BA 1RK8A 2NXNA 5G4DA 2EFVA 3TP2A 3D54A 1CJVA 2JVOA 5KT2A 4JOUA 4X4TA 1X5OA 1HQEB 4OYXA 4PWUA 4ETXA 2MQPA 4MT1A 2KM8C 2OTJS 1QLNA 3ONQA 1KLMA 2RKIB 1DLOB 2DCLA 1BC6A 1JQGA 1RHMB 1TL7B 3V81B 1S7IA 5A8RA 1XN9A 4DV4J 3RB0A 1NDKA 2RRNA 2AGQA 1XNRF 1B64A 4ZKAA 2HNYB 1NDPA 3G6ES 1U2FA 5LMNJ 2KZMA 4NCBA 1EX8A 4HH1A 1YSJA 3A8KA 4I64A 2A2CA 2ACYA 1HW9A 3GG0A 1WEXA 1IWGA 1EETB 2DY1A 2P6TA 3OTCA 1H98A 4KGKA 4NASA 4L74A 2MXYA 4CH1A 4OL8A 1CJUA 2VV5A 2W4DA 1SKRA 5DDRC 3HSDA 1XMOF 4AXIA 4CT9A 1NH7A 1R6YA 2YNFA 3SSSA 1U0HA 4MKYA 2B5JB 2CJXB 1U1KA 2ZE2B 3PNIA 2DGXA 3PRDA 4UF4A 2PMZD 3CMES 3M8RA 1AW0A 1IN0A 2PE8A 3DU6A 5FLXU 3FSXA 3BO4A 1CPZA 2DBBA 3M2RB 4FXDA 2HIQA 2HS3A 2HNDA 2YWEA 3GFYA 4PG8A 1NKBA 7FD1A 3ISNC 2BE7D 1YJVA 2IA0A 4IH7A 5U47A 3J7YU 3LA0A 1G4CA 3HO1A 2VFVA 1ZPVA 1TUVA 3KNAA 5IM0A 3IR6B 1C1BB 4OX9J 2LDYA 2BANA 2H9ZA 4O3NA 4EU0A 3MAAB 1KR4A 4D3HA 1S9GB 1VS3A 1NPRA 1B0VA 2B8PA 4NRUA 3SDEA 4N5SA 3MR2A 5H9FK 2WB4A 1C1CB 2CQGA 1ZAWA 2AHOB 1GMUA 3BBFA 3MOZA 3R2DJ 2HWIA 2FJEB 1Q78A 3DDIA 4KAIA 4PEOA 2EBEA 2QIFA 4A48A 4QWCA 4GC6A 1S0MA 5KG5A 3SQGB 4ECTA 2HYIB 1RTHA 2PGCA 2YNIB 4OFZA 4HTJA 2V2QA 1R8HA 1X4BA 2YKPA 3G96A 4CLZA 5LJ5Y 1PAUB 2MGZA 3BS9A 3OR2B 3W65A 4BS2A 2KFZA 2M88A 3TO8A 1FJCA 2XS7A 3M9MB 3BYRA 3W8PA 4GO5X 9ATCB 3MD1A 3CULA 3L9ZA 5L1LA 2HHTA 3K5OA 1K1QA 1B0PA 1RT6A 2DGSA 1JXEA 2HGLA 3CD5A 1RYSA 3KLIB 2Q43A 3GIRA 4OX8A 5KT3A 3R1LA 2K2PA 3D1QA 2MGZB 1EP4A 2XM3A 3WBZA 2F63A 2CPFA 2GMHA 1U02A 1JLFB 1LXNA 5KFSA 4A8OA 2HSEB 2FJWA 1P6TA 2VG6B 2V8PA 3D7SB 1K0TA 3MF5A 3H5UA 2HQGA 2F4VJ 4JV5J 2OTLS 4LF6J 3A3OB 4KFBB 1TU0B 4UW2A 4EBDA 4XDCA 3MAHA 2R4FA 3ENQA 2IPOB 1AUSL 2COLA 2C3OA 4CTAB 4E98A 1FJ7A 2HIYA 2ZITA 1IWAA 4WKYA 3O2IA 3HF5A 4JI1F 3PW7A 4UY8T 3SSRA 2XMVA 2AYEA 1D1UA 3W62A 3M2VA 3T1YF 2HHXA 4HDHA 2DGUA 2UUCJ 1OY6A 4YQWA 2IYIA 2YXLA 3H2UB 5LM7E 4QCLA 2G2YA 1OYEA 1VBXA 2Z56B 2J8SA 4A8XA 2NXJA 3DMJA 5F3ZA 1VQ6S 4ZIWA 4OI3A 1Q8IA 2G0CA 3H2LA 3TA0A 2I5JB 2LEPA 4TLRA 4RW4B 5L39A 1TV6A 1WJ9A 3D28A 4LSLB 4Y00A 4DZDA 3KK3B 3VAFA 3V6KA 3H0PA 1IKWB 3FCHA 4PXBA 3AHPA 2CPIA 4RW9B 2MKKA 3MPYA 2C2DA 3FQKA 1FWLA 1UMJA 3GV8B 2B9YA 1NK4A 4URGA 2F7VA 2DH8A 2W2MP 3TJ9A 4QQBA 3J81j 3GCWP 4H4MB 1R7IA 3PM9A 4MIWA 3W61A 3I6PA 1P27B 2EFNA 3GU0A 2QLJB 3P45B 1IBLJ 3J7ZT 2G9OA 2XY5A 4JI3F 1P1TA 3CJ5A 2H1YA 4MFBB 1NH8A 4DX8H 1FKPA 1CULA 2AJ4A 3OUYB 3H42A 3KHHA 4JI4J 2V69A 4DZ6A 2XYHB 3O6QA 5GMDA 5HMXA 1SJRA 3JAMU 1T8EA 4WIQA 1VQOS 3M2VB 3HK2A 2JHEA 2HQCA 2C28A 4F8RA 2G4BA 4FXWA 2IA6A 1BHNA 2IRYA 3D66A 3W60A 4WFXA 2VQEJ 3VAKA 1LV5A 1BQXA 2FVQA 3EM1A 2VFSA 4HACA 4L75A 4WU2A 5ETRA 4PCQA 2QN6B 2QL5B 5HL7Q 2L9WA 2YWGA 3CSKA 3H2VE 3THTA 3TQ1A 4PG7A 4C97A 3TZYA 5JVGQ 1PJ6A 2E5LF 2AD9A 3WQPA 1RAAB 4CO1A 2ACMA 4CM2A 3BR8A 3BM7A 3C14B 1Q16B 1UCNA 1JXLA 1XMQF 1WHWA 2NZ4A 1RTJB 5HBMA 3Q8SB 3E3XA 3I4HX 4P74A 2ZJRQ 2IY5B 2JEFA 1IXKA 2G1HA 2CQ0A 4KKOA 2Y1JA 2ZD1B 4ENOA 4FYWB 2GMJA 1R89A 2VQEF 1HR0F 1FRIA 4ZN3A 4R25A 1VHFA 3JB9k 4ID8A 1NSPA 2SXLA 5J2PB 1UPMB 3K0JA 2UV8A 1C4CA 3K7RA 1RT6B 3DLHA 4C6AA 4CO4A 5IZHA 5L1JA 1N36F 1AYEA 2ZBRA 1YKWA 5E0OA 4BHQA 4UQGA 2AYGA 2BRKA 3R97A 1I1GA 4AQYF 3OQ2A 1N34F 1ICEB 2DIVA 2AV5A 5B0DA 4B3RF 2KG0A 4WXWA 5K5MA 4DR4F 1S9EA 2R8HA 1W7WA 3Q89A 3BKTA 2BE9B 1G2EA 1M1GA 2E5IA 2AJFE 5KFIA 2AGOA 3HVTB 4K7QA 4CYUA 4O4GB 3H25A 3V6DB 4PXCA 1FE0A 1KQGB 3D0HE 1U24A 5HJXA 4NLTA 3MR5A 1LNQA 2EKYA 3HVWA 3IO1A 1LKZA 2B9XA 1R31A 4I56A 3C2PA 2Z2ZA 4QZVB 2A6OA 1TL1B 1E6VA 1N5TA 5EN1A 5JVHQ 1SCJB 1N88A 7AT1B 2Z8QA 1YQHA 2C3MA 4WWSA 2ZJQQ 1NHKL 2IHR1 3GJQB 1N33J 4NE9C 5B0CA 3PW5A 5SUHA 4N77A 2V8GA 3CJRA 1CJVB 5E33A 3P3DA 4O4RA 4NLSA 1YX2A 1XNQF 1LWCB 2BJDA 1M5SA 2YKQA 1OPIA 4UQTA 1JKHA 4ECRA 4ZPVR 1DLOA 2J0XA 5GAEI 4BWJA 4GKKJ 1E6VB 4LUBA 2ABYA 2BBEA 5HLFB 2HNDB 3MEKA 3BGRA 2XB2D 4USMA 4X4QA 4B3SJ 2CPEA 5E5NA 3OLBA 5HQLA 4UZBA 4JI7F 2FJAB 1WF2A 1DTQA 3EICA 3WIVA 4PQAA 2GA7A 3ITHA 4UY85 1RA7A 2KDOA 3D4JA 1X4AA 1R0AB 5BYRA 1R27B 5HQ8A 2R7WA 1B3TA 2N7CA 3JSYA 1QAJA 2P2CB 1FDBA 2L08A 5E3CA 1QUPA 1SC1B 1BMQB 1NK8A 4J9OA 3PO4A 1N5YB 2V4JA 4ICLA 4CH7A 2ATLA 2BM1A 1AXQA 4MJKA 3VF0B 6FD1A 1E6YB 4F67A 3UDEA 3BKUA 1UWAA 5K20B 3EVOA 5HVHA 5D78A 3NRBA 2CWKA 2E1AA 3T19A 5FD1A 1F6TA 3W2VB 1KSPA 2ZWOA 4Q8EA 2VPZB 3GE9A 3I87A 2AT1B 1FRKA 3HP6A 3H5YA 3K5MA 2HS4A 1KNZA 5KG2A 4Q0BA 2E9ZA 4QBUA 1CC8A 4Q7AA 2JNJA 2CG8A 2KJWA 2ZDPA 1YITS 5C7PA 5ETMA 4R0EA 2JLEA 5IC4B 1NK5A 2GQQA 3BV8A 2BJ1A 1TQLA 4C0BA 2ZH1A 2Q6BA 3IC1A 4DV1F 4EZ9A 4JYAF 2IJFA 3AJ1A 4Q43A 4LR9A 3TUIC 5J2QB 3CCWA 3OBIA 4LBIA 2OUGA 3BH6B 4ZOSA 4O23A 2CXEA 3CD0A 3W63A 3VV2B 5DQGA 1U48A 4R8UA 1NHUA 4C0OC 2XO6A 4JI8F 5CZXA 3SYZA 3BKFA 3FFIB 4JV0A 5KFMA 3M8QA 2CFXA 3BGOP 4LSNB 3HVRA 4IDKB 1X5PA 4B3OB 1FKOA 1HQUA 4QIVA 4LF8F 1VJWA 4YR3A 4NMXA 3QLHB 1WELA 1CS4B 3Q23A 4XIUA 3DHWC 3MMCB 3M6XA 1C0UB 3Q83A 5F8JA 2YVSA 1RKJA 3MMAA 2C3UA 4ZPDA 2NXUA 2NPFA 2PO4A 1LXJA 3EVWA 2YNGA 3QT8A 3P5BP 1N52B 1YK9A 3HT3A 2ZM6F 2WVFA 4OYAA 3OTBA 3CPWR 1RZMA 1CULB 3DLEA 2WONB 1Q5VA 4JI5F 1Y3JA 3QIPA 5A8KA 3M9NB 2EFPA 4IO9Q 1CS4A 2EFOA 1FHTA 1QE1B 2VDIA 3HHEA 2YH0A 3L7PA 1L3UA 5GAHU 1V5IB 1FXLA 2BW2A 3MCNA 3OL8A 1B99A 4HL9A 4J90A 4LSLA 1UVLA 4ZP6A 3OXFA 5IV4A 1S1WB 2LQBA 3VAMA 2F5GA 4OLOA 1FDNA 2V50A 4AXJA 1RA6A 2WONA 3IP0A 4OYIA 1AROP 3UN3A 1XMQJ 2UU9J 2MKHA 4N56A 1TKZB 3HZGA 5J1NA 5JUMA 5KFKA 2DNZA 4YR2A 2DNQA 2W9CA 3B4MA 2UXCF 4L3NA 1NEEA 1C1BA 1A0OB 2W25A 3JS9A 1WC4A 4H4KA 3TVZA 4C8YA 1S10A 3P4UB 2HWTA 3GP9A 4LR7A 3D0GE 4I69A 1NNDA 1IBLF 3AFGA 2YNHA 3JSMA 2QT7A 2CVEA 2GVDB 5I42A 1T7PA 2HBRB 3UNYA 1RABB 4DQPA 4OYOA 2HFVA 3TYTA 3LO3A 1HBOB 4F3QA 4DL6A 3TI0A 1GEHA 3KLGB 1HNIA 5L9NA 1F9EB 4CIOA 2DHAA 3M7VA 1VQMS 2L48A 2YX1A 3H98A 4RW9A 3HVAA 2ZZNA 1WI6A 5A0YA 3BN7A 5K14A 2IYGA 4XDDA 4I2PB 1O0PA 1QE1A 2M0GB 4ERDA 4M5HA 3ZTPA 4IOCQ 2UUBJ 1VQKS 4QYRA 2QGFB 3GPAA 4UOHA 2G2ZA 2KL8A 1A6LA 1EAYC 2BYCA 2WCXA 3KJVB 2LEBA 1HNXJ 2IVYA 1S9EB 1HBNB 1QAXA 1ZOTA 5LSLA 4M5JA 2LMIA 4NYZA 2VG5B 1WWHA 3K57A 3ZXWA 2IJNA 2MSSA 2P5VA 3KLIA 2J9EA 4I7FB 2UV8G 1S0VA 1FJGF 1RISA 3BR9A 3HFKA 2CDRB 3IR5B 2EPIA 1RHKB 1HPZA 2WAQD 1GT8A 1Q0NA 3A4TA 3CCTA 3PKYA 2RE1A 5A6WA 1DTTA 3EXYA 3PZPA 3QBCA 3DHXA 4WZMA 3JSRA 2KHDA 2MQNA 4M5LA 4RU2A 4B9TA 4OHYA 3MAQA 2GQ2A 1BWVA 1UVMA 5KFHA 3MEDA 4YUDA 5AJ3J 3DXBA 1EQMA 2BVZA 1APSA 2UVVA 2DY9A 1MU2A 1U49A 2DO0A 1ZM2A 5L8RC 2GCFA 3FFIA 1CC7A 2AJ1A 2DD8S 2ILYA 4ZPTR 5K14B 5A0YB 1TK8A 1Z2ZA 2RHSB 5E2QA 2IBKA 3LP2A 1VCTA 1P9YA 2J9DA 3IWLA 3M8SA 2V4RA 3PXGa 3GFZA 5CAAA 4A8QA 4KH1B 3CIMA 4OZ1A 4M94A 3NS5A 4FVCA 4Y2MA 2UVUA 5E3AA 1SC3B 2MQMA 1FE4A 3GZ7A 3MEDB 5FIIA 4WBFA 4DV2F 2FYXA 5D3GB 1Q7YT 2JEJA 1JLEA 2R8JA 3C16A 4J9UE 4NLOA 5D0GA 5D0EA 3NS7B 1SBRA 4G65A 5AE1A 1P1LA 4I7FA 3CD7A 3R6GB 1N8RT 5H9FJ 1U1MA 3HZEA 3ENVA 2HPUA 1JLBB 1YJTA 4MIBA 2HFNA 2FLOA 4DV6F 3NL0A 2EWHA 2E5GA 2YWFA 2ZKTA 3ZZTA 3ETOA 5K8PA 3KLFA 1WD6A 1FFGB 3OXGA 4TY9A 2WW4A 5ETKA 4DUYJ 1FEHA 1HMVB 4M5DA 4DR6F 3HX9A 1NK6A 3OT9A 2CUYA 2DITA 3DXSX 2UUWA 2MHEA 1IR2A 2E1PA 3NLCA 3W1YC 1KHVA 2B51A 3HKWA 5F8LA 5CZCA 1ZA2B 1S6UA 3HLUA 4Y34A 4WK1A 4B02A 1I94J 1S1TB 8AT1B 1Q53A 3LGHA 4IG0B 4L76A 3I82A 2XYGB 4UTGA 3K58A 2ZH8A 1WUUA 2VDHA 3NS6A 3KOAA 5IC6B 5LOQA 1L3SA 3QO9B 1YZ6A 1DAXA 2H51B 3AH6A 3MECA 4OI4A 1RT7A 1MW7A 1UEKA 2RRBA 3RTVA 3PW4A 3B82A 2XWXA 4LF5F 4RW7A 2R7TA 1C0TA 3S6EA 3GR0A 5KFWA 4X4NA 2XBPA 2RQCA 1JKHB 3C16B 3AOBA 2CVIA 5GAGI 3RRHA 1IBKF 2ZC3A 1SIWB 3KLHA 1MN7A 1S1VB 3MPDA 2RDJA 2DNKA 1SKUB 2FD2A 1HNWJ 3U7JA 5GADI 3CCRS 2LDIA 3A3NB 2BQRA 1CG2A 3KUEA 2CJAA 2RT3A 1NMEB 2FQQB 4NPOA 8ATCB 2OLWA 3QWPA 4F02A 1NRKA 3I0SA 4OX6A 3SCJE 3D6MB 4CDIA 2CQ2A 3PW2A 1CJKA 2JOQA 3NGTA 1I51B 2GAHC 4RBTA 3W2WB 5IT9Y 5B0GA 1S1TA 3MR7A 3NCQA 4DR1J 1IKWA 5AXLA 1HR0J 4QWBA 4U7UD 4CRJA 5KFNA 2G2OA 4RUAA 3QIPB 3HJFA 3MD3A 4ZJLA 2X7IA 1JMTA 4NWBA 1RT3A 4NLXA 3RGIA 4USKA 2A6MA 2ZUAA 2DIUA 2R7QA 4OI2A 4TLQA 5ETTA 3W7BA 4ELVA 1XNRJ 2OEMA 2HGMA 2J5AA 3FKBA 4CNZA 3JTNA 2MB0B 4G3IA 2XC9A 5L1KA 2ALZA 3H7HB 1XJWB 2CZVC 4P2SA 3X3UA 1MMDA 2AP6A 3NG8A 4DJBA 4I2QB 3G4SS 3MMCA 4KRWA 5IOLA 4DFMA 1YGYA 2FDNA 4TXSA 1OY8A 1SH3A 4O4GA 2VPXB 3DRXA 4A8MP 2D3OR 3X1LB 3DOMA 4DSIA 5EWGA 4ZK7M 4YDXA 2FC9A 5CA5A 3QATA 2WBRA 4NXMF 3TWZA 2QJ3A 2IC3A 4B9VA 3EX7B 2DNPA 3POTB 2B43A 3MZIA 2OGUA 3GLJA 2E9RX 2V5HG 5A2QU 3SXLA 2DHGA 2KVIA 1QDUB 4Z2XA 3KFWX 4J9KA 2X51A 2Z30B 2HQDA 3CJSA 3D1OA 3C14A 3CJKA 4FS2A 1PILA 1S6PB 3HSZA 2ZH6A 4LR8A 4WF9Q 3DLJA 1F60B 1SJ4P 1R0BG 3TAMB 3THVA 3EZUA 4WPAA 1YDLA 2RSQA 3QT6A 1KBRA 4DXLA 4AL6A 1GK8A 1L3TA 2CPXA 1V3SA 2A1BA 4QOTA 1VQ5S 1S9FA 3L4BC 2F4FA 1JJ4A 2DHHA 1BY9A 5KFYA 4IQXA 1ZETA 4FF1A 3QAUA 4KB7A 5ETNA 3DRPB 3MM9A 4R5PA 3L3CA 4A8FA 4P10A 3R1HA 3MPVA 5CABA 1AZSB 4XTTA 4Z37A 3PEHA 1EETA 2CKWA 2HK3A 2MY7A 3NOGA 4PXEA 5HANA 1SKWA 4O0IA 1IR0A 4WIIA 4CLYA 2ROPA 3G82A 2GVZB 2J0QD 3JQMA 3TVKA 4TYAA 3OVBA 4LMZA 2VZ9A 1MROB 1DZ5A 1N33F 2M7SA 2CIMA 4RW7B 4F04B 1GFWB 4IH5A 3DYAA 5DRKA 1RT4B 3BGUA 3ZZOA 1RWVB 2ZHBA 3NWRA 4FF3A 2ZOMA 1GXTA 1F9FA 1D09B 5J2MA 3ZC4A 3NNAA 4ED5A 3FEZA 3D5MA 1IVZA 4DR7F 1WNEA 2HHHF 2UUAJ 5HQMA 3VAGA 1Q8LA 3TR5A 1R0AA 3HJVA 3PYGA 1DHMA 2NS1B 2HBYB 4DPTA 3PO5A 1T03A 3HHNB 3MM8A 1YZ7A 3DOLA 3LP1B 3HMJG 5DLGA 2WK4A 3RR8A 2V2ZA 1VRTB 2AEJA 2MMYA 1TVRB 2YPYA 3GCXP 3ISND 3TX8A 2ZBPA 1FWKA 5HVGA 1GMWD 3AXKA 4CWBA 2KFYA 3PEJA 4ECYA 2M8DB 2IBOA 3OTEA 4ED0A 2MLZA 1K1SA 3EE3A 3LGNA 3UDLA 4LSZB 5HLFA 4B9MA 1KQKA 2APOA 4HVZA 4LFBF 3SFUA 5F8HA 1X0FA 2BKPA 2HBQB 2AJ0A 3MTJA 2OD4A 3RUBL 1FXDA 2A10A 4CLLA 3EWGA 1MU2B 2HBZB 2IIHA 1GH8A 2H5IB 4UUWA 4CLPA 4LF1A 1M1HA 3A13A 1VRTA 1MLAA 1WDTA 2V8VA 1LWEB 2NXEA 3RB6A 3M2UA 1S0OA 1RUSA 4QWEA 5KFLA 3I5CA 1HPZB 3KG4A 4KT0C 1RT4A 4RR5A 3IAS9 1WOOA 3IG1A 3Q24A 3QGGA 4IG0A 3PJXA 3R9LA 1T9XA 2HFUA 1U26A 1NLKL 2BOAA 2QLXA 2HFOA 3M6UA 2YKMB 3RG6A 1TFWA 4PWDA 1NCLA 4X2BA 2DGWA 4JI2F 1GMWA 4DUZF 4IUFA 2FVPA 3KK2B 5KFOA 2V34A 1SV5A 1SQEA 3FCWA 2Y9HA 2IC3B 2XTJP 1RT1A 3IS9B 3PFOA 4GKJJ 4X4VA 2AF6A 2EFQA 4QU6A 3LUYA 3AA8A 5IXUA 2KB2A 3IMQJ 5F9NA 1NJWA 4M5DB 2B0GA 1RT5A 2B56A 2E1RA 3M8YA 5HK4A 3GV5B 2W7OA 1XNQJ 2H65B 4UZCA 2DGQA 4Z7YA 5AE3A 1QAYA 3WX8A 1YRXA 2PDAA 1FRHA 1B0TA 1H2TZ 3FRYA 4AYBD 1YJ9S 2QV6A 2XSJA 1U1QA 2GVDA 4NLQA 3KDOA 1QSSA 1TR0A 1J27A 2YY3A 4YB6A 2GIRA 1G3OA 1RSCA 2LFVA 2POKA 3OL9A 3CE8A 4Y6IA 2P6SA 4L3KA 2DJWA 3S01A 1RLCL 5DM7Q 3NMAA 2MEWA 4ZCLA 3GSIA 2A0FB 1K8AT 3SQOP 1HIYA 3DRPA 2CZ4A 3DRSB 3MM9B 1UVKA 4WP3A 1UP1A 3DM2A 2K3KA 4Q2MA 1F3FA 2QA4S 1IJEB 3F41A 5D8HB 3JYTB 2ROEA 1HD0A 4PZVA 5E7OB 1QVFR 2KKHA 3RJMB 4N47A 2IM2A 3M4XA 4IG3B 2BE2B 2KH9A 3KTQA 2R2UA 4X4UA 2XMAA 2GGPB 3JQJA 1S77D 3EPIA 3SSQA 1OS5A 2DRAA 1JNRB 4L6V3 3NGRA 2C2MB 2GO9A 3M6VA 5B0FA 2XSJB 4ZHRB 4DV1J 4KO0A 1VDHA 4NL5A 4NLWA 3NEKA 4C3MA 2XZWA 1NO8A 4J9QA 1U45A 4ZVHA 2J0SD 2XMWA 1NU4A 2D9OA 2XG8A 4NLVA 1G6BA 4QR2A 4K5RA 1FD2A 2WBMA 2KM8B 4HHHA 1FNMA 2N3LA 2W9BA 2KT3A 1NK0A 2QEXS 3M8PA 2RB7A 1FF2A 2R3VA 1VRQC 2IM1A 3BBCA 2B9EA 2CDQA 2FGCA 2LXUA 4ZVQB 2D3O1 2DEJA 3G86A 4ZVOB 1PAEX 1QUVA 2CJQA 2W01A 3ZNJ1 4ZMMA 1UA0A 3CD6S 2X1AA 1VC0A 1RAJA 1S59A 1JLEB 1QSYA 1NZ8A 2BACA 2IAJB 2OI2A 1RU2A 1N0VC 2QC3A 3IBWA 4OYBA 1LWEA 2XHCA 4ED1A 1IKXA 2B4UA 3Q2SC 4NMLA 4ILMA 2PD1A 1K0VA 3VAJA 3ELHA 2QLBB 3C15A 4KE5A 5KFUA 4DR5J 5EUHA 4Y0FA 2QX0A 4ID5B 3NGDA 1SC4B 2XZTB 1OIAA 3AODA 3FC9A 1MWYA 1GTEA 4IQMA 4ZHRA 5LXYA 3HKZD 1NJZA 3C46A 3FMBA 2KT5A 3W8GA 3R5GA 4A46A 4X66F 3CWJA 4K59A 2FVCA 3CJ2A 1UZDA 2N7YA 4I0WA 5C42A 3H20A 1U8WA 3MPUB 5LXRA 2FVRA 1OYDA 4MK8A 2X1GA 3C8YA 1VR6A 1IKYB 4LF5J 1HHSA 1WHVA 3W5YA 3OSPA 3ZZUA 4DCJB 1FDAA 5I3UA 3KDNA 2MHNA 2CPZA 2WSFC 1CJUB 5B0BA 1VISA 3M8PB 2XMUA 2QL7B 2GO8A 3LPYA 3HVTA 2XLJA 1JJCB 3PV8A 4IFVB 4JYAJ 1KFSA 2DNNA 3RW7A 2KXHA 4K4YA 2M52A 4KPCA 1UWBB 2Z58B 1YBTA 3BQ0A 4R5PB 4K2XA 2QLFB 4ES2A 4MYUA 1YHQS 4NXMJ 4OYWA 2AEMA 5KT7A 4RW8A 1IKVB 5K8NA 2GAGC 3MM6B 5KTQA 1VMBA 2HLUA 1RI7A 3A8IA 3UDCA 4RNFA 3K8VA 3RZAA 2JFKA 4N41A 1FK9B 1S1VA 4DSFA 3BBBA 3U02A 1NJIT 2V68A 3PYEA 4F0MA 3QZ8A 3EZ5A 3Q2TC 1HKAA 1KRPA 1RT2A 3MAAA 1Y3KA 2J7KA 3NCPA 2VHGA 4A8SA 1RBLA 1NDCA 3E51A 5D4PA 4C8ZA 2OPQA 2YWHA 4OX7A 1S5ZA 1J2VA 1AB8A 4DV5J 3N6LA 1W2BR 2XCPA 3HHKA 1B4SA 5DDQC 1SI9A 2K1RA 3UD4P 2HQIA 3WC2A 2K8GA 3DM2B 1F5AA 4HI1A 5IQ6A 4J5OA 1NJXA 1RJJA 3ET6B 3HULA 2CA9A 5G0RB 1CJTA 1FDDA 4RNNA 3KLFB 2M70A 4HKQA 1JLAB 5KFAA 3DOLB 3LP1A 3OR1B 2HK2A 4U9RA 1SQGA 1VIXA 3B4DA 3R7BB 4ZVEA 2OPQB 3TQEA 4ZN1A 3A12A 5A8RB 2OFHX 4HTIA 3CCQS 3SI8A 3CCVS 1KQSR 2ZBQA 1Q81T 1VQNS 1JLQB 4A47A 1VC6A 2PFDA 4TQSA 2LU1A 4L73A 4PKDB 5KFQA 4WFAQ 2OSQA 5DZ6A 3KLVA 1LK7A 4DU8A 3IRWP 5JXSA 2XY7A 2YNFB 4C98A 4Y2IA 4KC5A 5DLFA 4CLUA 1AUDA 3U1NA 1R0CB 2QFIA 4F4KA 4K4WA 1VQ4S 4CNYA 4DMZA 3CO0P 4H4OB 4RBVA 2BABA 5DG7A 4PRFA 5DG9A 1FI4A 2AX0A 1Y4ZB 5CYMA 4X66J 4ATNA 2VOOA 2MLYA 2K1RB 4GRSA 2WVCA 3M8ZA 3A8EA 4G1QA 4ZVSB 3OSNA 2VQFJ 2BQUA 3O1LA 4DSJA 4W90B 4F26A 4F0HA 2KXNB 4F7VA 2CQ4A 3FBCA 4CO3A 2VBXA 2MZ1A 4HHJA 5KAKA 1Q86T 1H72C 2XSFA 3GSDA 3EUNA 3I0RB 2EK1A 2HAFA 3VWSA 4KV8A 3OHAA 3RBEA 4FN5A 4QR0A 3CT9A 3PY8A 3IWXA 1IQZA 2DR9A 1XERA 1NPPA 3HHLC 1PGZA 1F2GA 2LQ8A 2VFRA 3DLKB 1RAGB 1D9DA 3Q8YA 2FGOA 2V67A 4M1KA 3WDOA 1U1NA 1UW4A 4P2MA 3T6JA 1CQMA 1V5VA 3DI6B 3DOKA 4MH8A 3TANA 3VVUA 2W24A 2AZ3A 5HN0A 2AIRB 2OD6A 5IT0A 3PW0A 3GMGA 3CCLS 1YVFA 4CO5A 3M8WA 4QPXA 2YKAA 4PYAA 1RB0A 5ETQA 3AB4B 3GYXB 2ZH2A 2H4YB 2BUNA 2RUGA 2DGOA 3HFZB 2ZZMA 1ELOA 2DRBA 4O3RA 4ZS6A 2EFGA 2GMLA 2HGNA 2EG1A 2JC1A 2LXFA 3PIOQ 3M30B 4NLUA 5I3UB 1RT1B 1X8DA 4C11B 3KWMA 1OMSA 2DISA 2V2VA 1UJ4A 3FCVA 5HVFA 5L1IA 3VHQA 4DDFA 5DDOC 3ZZ0A 2W2QP 4UOCA 1BUXA 4J37A 4DV3J 3W5ZA 1MMLA 2DT9A 4G1IA 1X9WA 1YJ7A 3QPIA 1EARA 1RP5A 5THWA 3VQTA 1JLGB 1NJYA 2E1CA 4LRBA 1VQYA 4WE1B 5D15A 1UKUA 1SH0A 2ASDA 1B70B 2PEBA 4MAKA 4ETZA 2CQBA 4ELUA 3US5A 4RW8B 3RB3A 1GQEA 3GYNA 3PKMA 1RU1A 1D0EA 2MTLA 3N79A 3UD5A 3C19A 2LXIA 4F36A 1HARA 1FK9A 1TAUA 1UTAA 2VU5A 1WKLA 4DU7A 2RF2B 3O5TB 3I56S 4B9UA 2CJYB 1A9NB 4JI8J 3SCLE 2CQHA 2GHVC 2RMLA 5KFDA 2QRRA 4PPDA 2R7RA 2NREA 4KGXB 2PN6A 3OVSA 3J80U 3HD2A 1N5VA 1KTVA 1V6HA 1VYAA 3C6TA 2E1MC 3D68A 4DL4A 1J5EJ 1QTMA 4F2SA 1L3KA 4V1Ak 3P8BB 3KXDA 4YR0A 4QPTA 1DY3A 4NXNJ 3N5FA 1M5HA 3ZZZA 2LCWA 4F4YA 2VIHA 3HHLB 3MM5B 4C8LA 4RL1A 5F8MA 1SJFA 1S48A 3GB0A 2XNRA 5F8IA 3P6YC 3VCDA 4DG1B 5IV3A 1BWEA 2ZOGA 1I94F 2CWXA 1JLQA 4DR1F 3MEGA 4J91A 3Q8QB 1VQPS 1OSCA 2LA6A 3V5RA 3QJPA 4LRFA 3H5SA 2XZDB 3K89A 5HROA 3QJLA 1UW9A 4WFZA 1Z4UA 5IT9U 3CF5Q 1SQFA 3FVYA 2Z2MA 4P75A 4CLWA 2BRLA 5CYJA 2O5DA 2RS8A 2VC0A 2GS8A 2DR5A 2B7BB 1CBKA 1O51A 1VHIA 4MYTA 1MMNA 4CP5A 1MSWD 1Y11A 1SV5B 3BEGB 1FKPB 3S8SA 2RDIA 1ZA1B 2FY8A 2VBZA 3VR1A 3C6TB 2ZH3A 3O44A 4JI5J 3UDVA 3IA0A 5LMNF 2LVWA 2ZOFA 3GQCA 4TU8A 1GX6A 4USWA 4PUOA 1NXIA 1Y10A 3UCZP 5LMUJ 2VB6A 4Y3CA
chains in the Genus database with same CATH topology
2PFFB 2H1YA 3EZOA 5CZDA 3TQEA 3K89A 1MLAA 3QATA 3CJ8A 2JFKA 2QJ3A 3HHDA 2G1HA 4RR5A 3HJVA 2G2YA 2G2OA 4QBUA 2VKZG 2VZ8A 1NM2A 3HMJG 5DZ6A 3G87A 5DZ7A 3IM9A 3BV8A 2G2ZA 3RGIA 2HG4A 3TZWA 2C2NA 2CUYA 3H0PA 5CZCA 4RL1A 3R8YA 2QC3A 3TZZA 2VZ9A 2JFDA 2QO3A 2UV8G 3R97A 3IM8A 3SBMA 3TZYA 3PTWA 3TZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFF B;  2H1Y A;  3EZO A;  5CZD A;  3TQE A;  3K89 A;  1MLA A;  3QAT A;  3CJ8 A;  2JFK A;  2QJ3 A;  3HHD A;  2G1H A;  4RR5 A;  3HJV A;  2G2Y A;  2G2O A;  4QBU A;  2VKZ G;  2VZ8 A;  1NM2 A;  3HMJ G;  5DZ6 A;  3G87 A;  5DZ7 A;  3IM9 A;  3BV8 A;  2G2Z A;  3RGI A;  2HG4 A;  3TZW A;  2C2N A;  2CUY A;  3H0P A;  5CZC A;  4RL1 A;  3R8Y A;  2QC3 A;  3TZZ A;  2VZ9 A;  2JFD A;  2QO3 A;  2UV8 G;  3R97 A;  3IM8 A;  3SBM A;  3TZY A;  3PTW A;  3TZX A; 
#chains in the Genus database with same CATH topology
 2AGP A;  4Y65 A;  4Z7C A;  4CLS A;  3WX4 A;  1Y00 A;  4HDG A;  3FZ2 A;  5IS2 A;  2CZ9 A;  1WTB A;  5ETV A;  4JI1 J;  2CQC A;  1TL7 A;  2PEH A;  3IRX B;  3M1V A;  4I6W A;  4ZPA A;  1DBD A;  3RBX A;  3V81 A;  2E5L J;  2J6T A;  1DFD A;  3HHD A;  4J9V A;  4Y2K A;  2KI2 A;  7FDR A;  1LFP A;  4DFK A;  4X4S A;  1LWC A;  4FNI A;  4QJV A;  4PAB A;  2XMT A;  2BKO A;  2EKN A;  1U6Z A;  3J7A N;  2BAN B;  5ETL A;  4WTO B;  3PJW A;  1UAW A;  5D77 A;  4WFN Q;  3N6N A;  1RHR B;  4ZCI A;  3AOA A;  3W64 A;  2J8A A;  3F44 A;  1RBO B;  1OQ6 A;  1VBK A;  3SBM A;  3EDR B;  4EBE A;  5KFR A;  2HMI A;  4DQI A;  2BJ7 A;  1M90 T;  1KN6 A;  1TUW A;  2VJU A;  1C2P A;  1K44 A;  2BZ2 A;  2CYY A;  1YJR A;  2K7J A;  4I6Y A;  4PWW A;  3VAH A;  4PUO B;  1RAD B;  2I0X A;  2IVF B;  4U67 Q;  4HT5 A;  4RWX A;  1SL2 A;  3IR7 B;  2YX7 A;  3OFE A;  1YBA A;  3CDW A;  5EHH A;  5IWA F;  2XLI A;  4AMM A;  3IM9 A;  4KO0 B;  3GIL A;  1NK9 A;  1XIQ A;  3W2V A;  2V9W A;  2V94 A;  1YTY A;  2ADB A;  2UP1 A;  4B3R J;  4DPU A;  1KD1 T;  1HWK A;  3ICL A;  4B9S A;  4MFB A;  3MFH A;  1S1X A;  2UXB J;  2XHW A;  1HNZ J;  4OHV A;  3OL7 A;  1HD1 A;  4DV5 F;  1ACM B;  3D3C J;  3I0R A;  4RNH A;  1EZZ B;  3CCJ S;  4UT4 A;  4ANE A;  2R2S A;  4XAK A;  3BGL A;  5J2N A;  1ZTT A;  4OYZ A;  2CQ3 A;  4HH0 A;  3HPO A;  1N32 J;  1T0T V;  3EMT A;  1UEV A;  1KTQ A;  1N6Q A;  4R8U B;  3I5A A;  2GHP A;  3VVT A;  1KVJ A;  2VF3 A;  5B7W A;  1QD1 A;  3OR1 A;  3PRB A;  3CCZ A;  3M8Q B;  2RKI A;  4LJM A;  2LQ9 A;  3UE2 A;  2JSX A;  4JI6 J;  2DRD A;  2D7S A;  1LW2 B;  2V0N A;  2DNG A;  1NUE A;  5K8M A;  1DQ9 A;  3D6H B;  3FBF A;  2Y3Y A;  3FEX B;  3N28 A;  1WC1 A;  4U8Y A;  4ID5 A;  3KHL A;  3TRG A;  1HNX F;  4LF7 J;  3ADA C;  1KS2 A;  4ES3 A;  1VLO A;  3HD1 A;  1FJE B;  2FLN A;  3U27 A;  1RAH B;  1IBC B;  2OO4 A;  3OJU A;  2MY8 A;  2QSW A;  2MQO A;  1JWW A;  4DUZ J;  5T7L B;  2FTR A;  3EYZ A;  1HYS B;  2VD3 A;  4KV8 B;  5GAH I;  5M2U A;  5DQH A;  4RNO A;  2VFT A;  3MM7 A;  4HEA 9;  4TY8 B;  2O3D A;  1KHW A;  1X9M A;  2V4J B;  4ICL B;  1X4H A;  4N7T A;  1SL0 A;  3QRR A;  2CAJ A;  3J7Z 5;  1PG5 B;  2WSE C;  2FHK A;  2HHW A;  4LBP A;  2MDA A;  2F65 A;  1ZAX A;  3R5J B;  1BXN A;  1XBW A;  4C3L A;  3Q8R B;  4FXV A;  2UUT A;  4DL7 A;  2X1F A;  4KHP J;  5A6P A;  1PYO B;  3CED A;  3CJQ A;  3CNQ P;  3DDK A;  2ZHA A;  4GC7 A;  3M32 B;  1UWB A;  2B4O A;  1N6Q B;  2DPI A;  4U95 A;  2R2T A;  2HWH A;  5D4N A;  1ZTW A;  4AQY J;  4DF4 A;  2CQ1 A;  4OJ1 A;  2EW9 A;  3PR5 B;  2NR0 A;  1N5Q A;  2M8H A;  3GJT B;  5HMW A;  3SDE B;  1T9U A;  4B3T J;  2BV3 A;  4NEY A;  4EGL A;  4RW4 A;  4ZVT B;  4ECU A;  3Q8P B;  1LK5 A;  5F0U A;  3JXO A;  4DPW A;  2MQL A;  1L3V A;  4O3S A;  4DR7 J;  1UPP A;  3S7R A;  3EZO A;  5HO4 A;  4DQQ A;  1ZZN A;  4C9D A;  1JLG A;  5D4O A;  3WHI A;  3TAR A;  4DL3 A;  4F3M A;  1IUJ A;  1WOP A;  3LAK A;  2DVI A;  2WRM A;  3TAM A;  4LF6 F;  2R7X A;  1WSV A;  4FPI A;  4GO7 X;  5I3P A;  4B3O A;  1IKX B;  4NYO A;  3OTO J;  3CGI A;  4DR2 F;  1U47 A;  2P8I A;  5B08 A;  4X65 J;  2LP4 A;  3WC0 A;  2V8H A;  1HFE L;  5KFJ A;  4O0N A;  2EC2 A;  4Q45 A;  2ASL A;  2XUL A;  1QVG R;  2XQC A;  2CQI A;  5CZV A;  3MCO A;  2RIL A;  4B9N A;  2OAU A;  2ZE2 A;  3G71 S;  2I5J A;  3GFX A;  3I4P A;  3VGS A;  1LWF A;  5L9X A;  1ZH5 A;  2F9D A;  2XWY A;  2M9K A;  5F3T A;  3PIP Q;  2FJX A;  3NGK A;  2YBV A;  3UVJ A;  2R7O A;  1JLF A;  4TQR A;  2HAI A;  2F8H A;  4IH6 A;  2UXD J;  5LMU F;  1F5B A;  2YQ3 A;  4NLG A;  2BJ8 A;  4K4X A;  2FC8 A;  2VG6 A;  1T05 B;  1EKR A;  1HQE A;  2HNZ B;  1TP7 A;  2LLZ A;  1NBE B;  2DXD A;  4URQ U;  4Y2C A;  5HMZ A;  1Q8B A;  3ZNU A;  3DYA B;  2KJV A;  4LFC J;  4K4V A;  1LWF B;  3TX0 A;  1YJW S;  2RDD A;  4JI7 J;  3LGM A;  2AMC B;  3IXQ A;  1TTH B;  2C2N A;  3TUZ C;  3MUT P;  3UR3 C;  3DLG B;  1AFJ A;  3QAE A;  1ZM9 A;  1K73 T;  2ZD1 A;  4MIA A;  5CYM B;  1FJG J;  2HFZ A;  4OHX A;  1VOM A;  2QE5 A;  3H5X A;  2LQJ A;  1Q95 G;  1ZM3 A;  2ZUG A;  1T9W A;  4NI2 A;  3K5N A;  4QYZ J;  2E66 A;  1PJ7 A;  1U09 A;  1KEK A;  1VFJ A;  2UUC F;  5FDL B;  4RX6 A;  2YPZ A;  4KGZ B;  4DSL A;  4J9R A;  4C4W A;  2RNE A;  2E29 A;  1KLM B;  2C3P A;  1RXO B;  4EI2 A;  2HHS A;  1V9O A;  3QT7 A;  2BJ9 A;  4OLP A;  1T94 A;  3IGV A;  5D4L A;  4WFY A;  1HA1 A;  1J5E F;  1IM6 A;  2EK6 A;  2LEA A;  3KK3 A;  3CC7 S;  2UXC J;  4MKB A;  3GV7 B;  1LEO A;  1Q7L B;  4RKU C;  4U7C A;  5J2Q A;  1VJQ A;  3PHT A;  2PII A;  2MLX A;  1SVD A;  3DKD A;  1ULR A;  3KLG A;  1Y7P A;  3PX6 A;  2N4D A;  2EG2 A;  1R8B A;  3CUN A;  3T5J A;  4TN2 A;  4CLT A;  1WHY A;  2DTJ A;  3FRZ A;  2LA4 A;  3TZW A;  5H9E J;  4LF4 J;  1FX4 A;  4P73 A;  4LSN A;  1RWM B;  1NZA A;  2ZNY A;  3E8O A;  1FER A;  3K8W A;  4I1T A;  3TZZ A;  3BH7 B;  2O1P A;  3KJQ B;  3UFC X;  2ZH5 A;  5BXI A;  3LQV A;  5HSP A;  3BPD A;  3M30 A;  1EHW A;  4CO2 A;  1WC5 A;  2WTF A;  5KFF A;  3WIU A;  2YH1 A;  2YX4 A;  4KHM A;  2NZC A;  3NBP B;  2W2N P;  3DN9 A;  3UO0 A;  2KT2 A;  3ZTQ A;  2B6A B;  3AXM A;  3TVY A;  2PMW A;  4NI2 B;  1RE1 B;  3TEG A;  4O44 A;  5GMK a;  3KK2 A;  2F1F A;  2Z0G A;  3FK4 A;  4W92 B;  1FA0 A;  1S9G A;  1WDD A;  2JZ5 A;  2L9D A;  2OEJ A;  3IS9 A;  3OD2 A;  1WOR A;  2MZJ A;  4H4O A;  4NOH A;  1FWP A;  3HXM A;  1NB2 A;  1IJF B;  3VZI A;  4HYK A;  4EO6 A;  4HT7 A;  1KLN A;  4LQ3 A;  2Y1L B;  2EXU A;  4H4M A;  4PG4 A;  4XK8 C;  5E3P A;  1S99 A;  4NRT A;  4OZN A;  1WC6 A;  5DGB A;  5DM6 Q;  3V6H A;  4LBH A;  4ZVP B;  2KO1 A;  3FQL A;  2B4V A;  2KYZ A;  3UCG A;  5GAD U;  3ILI A;  2XO7 A;  4FZV A;  4DR2 J;  2HVI A;  4JBC A;  2F8E X;  3VAL A;  1C0U A;  2VC1 A;  3NGU A;  3T5H A;  1I3O B;  3PG9 A;  3NAI A;  2FUG 9;  4WCE Q;  3PTW A;  1S1W A;  2C2K B;  2J6U A;  1F5C A;  1SH2 A;  1OQ3 A;  2DR6 A;  3I32 A;  3OR2 A;  3PDN A;  2W9A A;  4JI3 J;  1FKA F;  1S1U A;  1TMM A;  2EVZ A;  4QW9 A;  1NSA A;  1RWO B;  4I67 A;  2DXF A;  1NHV A;  2C22 A;  2HMI B;  1Y5N B;  1UEU A;  4J7C A;  5A8W A;  4F50 A;  3I0S B;  1XC9 A;  3B6B A;  3FNN A;  2QG9 B;  3V6J A;  1CJK B;  1RGV A;  3DRS A;  2MQQ A;  1QY7 A;  2D3U A;  2YWK A;  5LL6 d;  4ALZ A;  5SZT A;  4BC9 A;  5T7L A;  1RYR A;  1REV A;  4DPX A;  2L3M A;  1JLB A;  3B78 A;  3SEO A;  2J0W A;  4C3K A;  2CNO B;  4TY8 A;  1HBO A;  5B09 A;  4ER8 A;  2OPP A;  3KJF B;  4NLY A;  3SIP B;  4ZLL A;  3SV3 A;  3AJ2 A;  5HRO B;  2DNR A;  3K59 A;  4J9N A;  1ZYQ A;  4YB7 A;  2UZA A;  3QGI A;  1RKI A;  2E44 A;  4FYY B;  1U7L A;  2Q6C A;  4ILR A;  3RRK A;  1YJN S;  4OZL A;  2AU0 A;  4FVM A;  4OYP A;  2BDP A;  2B8Q A;  2GC8 A;  3CC2 S;  2R42 A;  1VQ9 S;  1FEE A;  2FJV A;  2ZEJ A;  3FBE A;  1WC3 A;  1LW2 A;  2YKO A;  4OV1 A;  2IDL A;  5C2C A;  2VJV A;  4LF4 F;  2MST A;  4OI0 A;  1E6Y A;  4OIX A;  2BEF A;  2IM0 A;  3J80 Y;  3KK1 B;  5F9L A;  2O66 A;  2EBG A;  4DSE A;  4LRD A;  3PYD A;  1G1X A;  1S49 A;  1G7C B;  2XI3 A;  3AD7 C;  4A8Y A;  1TL3 B;  2E7W A;  4DWI A;  5RUB A;  1IR1 A;  4RNM A;  4F4X A;  4YB1 P;  4OZ2 A;  4URS A;  1HWU A;  2AWZ A;  4JI2 J;  5DZ7 A;  5GAG U;  1HQ2 A;  4I6A A;  2MKI A;  5DGA A;  4FKX A;  3BZQ A;  1L5U A;  4LF7 F;  4QU7 A;  5FDL A;  3FGV A;  3OTO F;  2AEF A;  2DPJ A;  2GIF A;  2W4C A;  4WP8 A;  4EWT A;  5BJR A;  4DV0 J;  2GQC A;  1M5K C;  1DJ0 A;  1DTT B;  3R8Y A;  1X7V A;  2DK2 A;  2RQK A;  4X84 A;  5L38 A;  2PC6 A;  3QYY A;  1C1C A;  3OFG A;  2OPR B;  2YWW A;  3T3F A;  1S97 A;  2DCU B;  3K5L A;  4LFA F;  4K0K F;  4LRC A;  2PMH A;  2WOM A;  1KQF B;  3GIK A;  2R8G A;  2JLG A;  8RUC A;  4K5S A;  4PAA A;  1UVI A;  2VOD A;  5J2P A;  1DTQ B;  1DQ8 A;  1X9S A;  2AYM A;  2VG5 A;  2EC0 A;  1IBK J;  2GIQ A;  4WFB Q;  1QTN B;  4DUT A;  4TVA B;  2AW0 A;  3HM9 A;  2CPH A;  4EO8 A;  4F4Z A;  2LU2 A;  2C2O B;  3DLL Q;  4NA2 A;  2HQF A;  1XEZ A;  1PCA A;  4BWM A;  4DR3 J;  2HVH A;  4FDF A;  1D8Z A;  2MZR A;  3THP A;  1WAC A;  4KHP F;  1Y9O A;  1TKZ A;  1RTJ A;  5KFG A;  3TNV A;  4DOZ A;  2PSZ A;  5HBM B;  1U1R A;  2JFD A;  1XR7 A;  4MK7 A;  4ZPB A;  1JJH A;  4HR2 A;  3BGR B;  4ITS A;  1FRX A;  4JV1 A;  4KPY A;  1TFY A;  2XY6 A;  5KG7 A;  3H8Y A;  2HZA A;  4ZIT A;  4YP3 A;  3BB5 A;  4AMP A;  4N76 A;  5M2R A;  4ED7 A;  1FO1 A;  4RUC A;  3R5A A;  1WI8 A;  5B0E A;  1HI8 A;  3C66 A;  3D0I E;  3QFH A;  3T9Z A;  3QID A;  3GON A;  4AT1 B;  1BGX T;  2VBY A;  3MCM A;  3PX4 A;  1AA1 B;  4P52 A;  1UFL A;  4HI2 A;  3NMR A;  3RYL A;  4NEZ A;  1Y5I B;  2OHD A;  2BJ3 A;  2J7W A;  2O01 C;  2RUS A;  4JB8 B;  4RUB A;  2H3E B;  3OFH A;  5IM0 B;  2C1E B;  1IKV A;  3D67 A;  3MM6 A;  4YHH J;  4KH0 B;  4FS1 A;  2W1B A;  4ECQ A;  2DH9 A;  5D6G A;  1X5S A;  2OH2 A;  3TA1 A;  1BLU A;  3FJ2 A;  3QO9 A;  4P9S A;  5E3Q A;  3QFW A;  5KT4 A;  3MEC B;  3QGP A;  2HNZ A;  4F4A A;  1FTC A;  3T1Y J;  3TAP A;  4LVO P;  3TEH B;  4FF2 A;  2DNY A;  2IMO A;  2UXD F;  2XI2 A;  2BKN A;  3LP0 A;  3OPK A;  1DQA A;  3QLH A;  4C0H A;  4UOG A;  1RBA A;  3B54 A;  1SKS A;  3DRY A;  3W3S A;  4L72 B;  3SQG A;  2I1R A;  3BO3 A;  1RTH B;  2YNI A;  3AD8 C;  4U8V A;  5KOX A;  3HDS A;  4USU A;  3TUP A;  2BA9 A;  2FY1 A;  3PCO B;  3CJ8 A;  3AOC A;  4MKV A;  5IQQ A;  5H1S V;  1R3N A;  1Z2L A;  5CD4 H;  2JWN A;  4ZDN A;  2ZC4 A;  3M9O B;  4DN9 A;  3DNC A;  4NLP A;  1HHT P;  3QNW B;  1VI7 A;  3DGP A;  1FVS A;  3ZZY A;  4H54 A;  4JI4 F;  1XMO J;  3BSO A;  2BJE A;  4BCA A;  4GVL A;  5IWA J;  2FHJ A;  1VRU B;  1YBU A;  2I9S A;  2DH7 A;  2QLW A;  4CZC A;  4AL5 A;  1FRJ A;  3LTO A;  1PSD A;  1FKO B;  1HQU B;  2FHO B;  2AJ2 A;  2MJN A;  4U96 A;  5KG4 A;  3NP5 A;  5MAO A;  2NSC A;  2W7A A;  1PKU A;  2JEG A;  2CNK B;  5K9F A;  1TL5 A;  3HI9 A;  1NB7 A;  4QIF A;  2UUB F;  4DCP B;  5J1P A;  4EYI B;  2MJU A;  2W9C B;  1MRO A;  4P7V A;  5J1E A;  2IJR A;  4X64 J;  4QWA A;  1M5P C;  3H59 A;  1H38 A;  2KZZ A;  2K7K A;  5E3R A;  4M5G A;  2O67 A;  2RRA A;  4C8O A;  1RHJ B;  3F56 A;  3W9H A;  2VL1 A;  1N5Y A;  2PA3 A;  2VZ8 A;  3UPF A;  2NXC A;  3NAH A;  1OY9 A;  5A8K B;  4G1Q B;  1N36 J;  2PI5 A;  3CCU S;  5CCM A;  4KTQ A;  3QJJ A;  1ZPW X;  4X62 F;  5BR8 F;  1DRZ A;  3L09 A;  2FLP A;  2FHJ D;  1XMB A;  3MGJ A;  4WKR A;  2MKS A;  4OX9 F;  1CQN A;  5D0R A;  4PG6 A;  3K5P A;  4Q44 A;  3ZFV A;  2EEY A;  3EJM A;  3G6Y A;  1D9F A;  3IM8 A;  1N56 A;  3CXC R;  3KUH A;  2Z57 B;  3KG0 A;  1RT3 B;  2IM3 A;  1WF0 A;  3GII A;  1ROF A;  2HHU A;  3R5B A;  1WTF A;  4U6P A;  9RUB A;  3PVX A;  1O5J A;  2Y8Y A;  4LFC F;  2WVE A;  3EGZ A;  4RU9 A;  4WTY A;  1KDN A;  3A8J A;  4DPY A;  4IRK A;  4X65 F;  3LPE A;  3KJV A;  1RAE B;  3GFH A;  5D3G A;  3UI3 A;  2AZ1 A;  3I96 A;  1YIJ S;  4BDP A;  1CSJ A;  2CPY A;  3GJR B;  5ETO A;  2KU7 A;  2J6S A;  2JDJ A;  3D9B A;  5AXK A;  4C8N A;  4MTP A;  4YN3 B;  1GTH A;  4ZLP A;  4DX6 A;  1SC6 A;  4NCG B;  4IDK A;  1SB6 A;  3R3T A;  4P2F A;  5BYQ A;  1U1P A;  1IQT A;  1KON A;  1VK3 A;  3IG1 B;  1HNI B;  1SJ1 A;  4BBY A;  2WW8 A;  5C24 A;  1K47 A;  2DNO A;  4ZCM A;  3V4I B;  1FES A;  1H7X A;  4UUX A;  5EGY A;  5KFB A;  2QA2 A;  4D3G A;  3KK1 A;  4F2R A;  4MK9 A;  2VON A;  1S79 A;  3LAL A;  2A2D A;  2IFX A;  2F3J A;  2E5H A;  2FHM A;  3SCI E;  3CJK B;  2C2E A;  2CPD A;  2UXB F;  4A4J A;  3GG1 A;  4Q5V A;  3PHE A;  1HI1 A;  1HI0 P;  5CHC B;  1MWQ A;  1U0S A;  2ZFH A;  2ZM6 J;  3RB4 A;  1TL1 A;  1FCA A;  1PIE A;  4WYL A;  3E2E A;  2OSR A;  4Y28 C;  4OZJ A;  2CJB A;  3CVK A;  3QZ7 A;  2HKE A;  4OV6 A;  3OL6 A;  2W8L A;  3AY0 A;  1EB0 A;  2ASY A;  4NYP A;  3HHL D;  1C0T B;  3O8W A;  2RAQ A;  3O3L A;  3BJY A;  1AFI A;  2BW7 A;  5T14 A;  4DLE A;  4ZP7 A;  2Z2Y B;  3BYP A;  4I2P A;  4AFF A;  1GMV A;  2ZBI A;  4O3P A;  5BYS A;  5B0A A;  1NK7 A;  3KYL A;  3N0V A;  1S0N A;  1XR6 A;  2FVS A;  1WHX A;  4F3O A;  1HBM A;  4KKO B;  2KHC A;  2YQ0 A;  5KFT A;  1EKS A;  3DLB A;  2OFG X;  4DR6 J;  1MN9 A;  1TL3 A;  2HHH J;  1H2U X;  2HEK A;  5KFZ A;  1VQ7 S;  3DLE B;  4P2X A;  1P8G A;  2DHS A;  4CM0 A;  2Y0B B;  1UZH A;  4E2F B;  3G6V A;  4DL2 A;  1YRT A;  3DU5 A;  5JJB A;  4LRA A;  2NUH A;  3AA9 A;  1VRU A;  4P71 A;  2IRU A;  5CXT A;  4ZVF A;  2IRX A;  2BX6 A;  3MEG B;  3R7S B;  1KC8 T;  1S4E A;  5I42 B;  3OV7 A;  3JTO A;  3QRQ A;  1ZS6 A;  3N6M A;  5F8G A;  4C48 A;  1BQN A;  4DS4 A;  1UA1 A;  2QZ8 A;  4IOA Q;  4Q2L A;  4ED2 A;  5FJ4 A;  1UFW A;  2AKW B;  2JL9 A;  3HT0 A;  5HAT A;  2MKY A;  2XMM A;  3SCK E;  1RWU A;  1Y0H A;  5K8O A;  4X4R A;  1T3N A;  1IKY A;  3I31 A;  3WZ0 A;  1RCO B;  3UCU P;  2HW3 A;  3V6D A;  2HHV A;  4HHU A;  3BQ1 A;  3K17 A;  2HZC A;  4B9L A;  3T1H F;  1WEY A;  2HHQ A;  3MMB A;  5F8N A;  4IO1 A;  1TZ0 A;  3GTY X;  2YNH B;  3JSM B;  1FVQ A;  1OWX A;  2RQ4 A;  3DLG A;  3R5D A;  3PAC A;  3N01 A;  2YKM A;  2Y1I A;  4KR0 B;  2HS0 A;  3RAX A;  1J5O A;  2RQM A;  1TL4 A;  3GYG A;  3DOM B;  2VPW B;  4J9S A;  1DUR A;  5ITH A;  4LF8 J;  5DET A;  5FLX Y;  4B3S F;  1I6J A;  3LP0 B;  4MKA A;  1ITP A;  3VGU A;  4ED3 A;  1MWZ A;  3M1V B;  4FBT A;  2U1A A;  5AT1 B;  1HL6 A;  2P9G A;  3FZB A;  2D74 B;  3AQO A;  5KFV A;  2RS2 A;  1WSR A;  4F25 A;  4X4O A;  2QA4 G;  4OZ5 A;  4ZJQ A;  3MUV P;  4DV7 J;  1RT7 B;  4DFJ A;  1XQI A;  3OJS A;  4YME A;  4B17 A;  1NAQ A;  2H48 B;  2RHQ B;  3JTP A;  5A8W B;  4J9L A;  1CLF A;  5LSR A;  5CYQ B;  4DL0 C;  4EK2 A;  2OPS B;  5DO2 A;  4E8U A;  2KTQ A;  2C2R A;  1M1K T;  4YY3 J;  3RAQ A;  1REV B;  4DEZ A;  5HP1 B;  2MZQ A;  5F41 A;  2ZDO A;  2BM0 A;  2LEC A;  1R43 A;  1SJ3 P;  5G0R A;  3CJ3 A;  1LOU A;  2I6W A;  3RU0 A;  4ED4 A;  1SPB P;  1UVN A;  2DGV A;  3BF4 A;  2M3D A;  4KGM A;  4GVB A;  1RTD A;  1S72 S;  2E5J A;  2R8I A;  2D1C A;  3KUG A;  3F73 A;  4V19 J;  5EX0 A;  4EUV A;  1WG4 A;  3MOJ B;  2R8K A;  3LW5 C;  4LFA J;  3GIJ A;  1VGY A;  1IM4 A;  3MHY A;  3MM8 B;  3PRV A;  2W4P A;  1V3Z A;  2CQD A;  2WSC C;  5KG3 A;  2QL9 B;  2W8K A;  4C8K A;  1OSD A;  2CPJ A;  4K2J A;  4DV0 F;  4A8W A;  4ED8 A;  4DF8 A;  1RDR A;  2FIU A;  4K4U A;  1FT8 A;  4Q0B B;  1B7F A;  5IT4 A;  3R7N B;  4ECX A;  1VLY A;  1YI2 S;  4RO0 A;  1X31 C;  3DGP B;  1SUQ A;  3LP2 B;  1SXL A;  2RU9 A;  2XCA A;  2GVZ A;  4K0K J;  2Q66 A;  3TUJ C;  3L7O A;  3LF0 A;  2VA2 A;  2L41 A;  1U6B A;  3CMQ A;  3W66 A;  4DR5 F;  2ADC A;  3RBZ A;  3J81 U;  1X4C A;  1XK8 A;  4J9M A;  1JK9 B;  2JLF A;  1TKX A;  2VG7 B;  2VAS A;  3MI7 X;  3RAM A;  2XS5 A;  3LOU A;  2JEI A;  1A7G E;  4J9P A;  3BDP A;  2DO4 A;  1F3V A;  1HWI A;  2OPR A;  2YTC A;  5CH7 B;  4ELT A;  4CH0 S;  2NYH A;  3LWM A;  2MZT A;  3G2X A;  2B7C B;  2H54 B;  1Y5L B;  1JNZ B;  1S1U B;  2P9C A;  3F0N A;  3J7Y I;  4DFP A;  2QYC A;  4DHV A;  1LW0 B;  3BDE A;  4QIG A;  4KSE B;  4LIW A;  3PX0 A;  2W2P P;  3AAW B;  2DR8 A;  2VBW A;  1N32 F;  2BE2 A;  2V4Q A;  4Q8F A;  4DBQ A;  3AB2 B;  2DNM A;  3MMA B;  4IOB A;  5AJ3 F;  2QTW A;  2Y8W A;  3CCM S;  1TKT B;  3C3L A;  2YNG B;  5ADZ A;  1RAO A;  4OJ3 A;  1TMJ A;  5HMY A;  3J7A 1;  2OPP B;  4YHH F;  4PQU B;  1HBN A;  3FSY A;  3P49 B;  3N9U C;  1KVI A;  1FFW B;  1HNV A;  4TU7 A;  3ETM A;  1X4D A;  3BSA A;  3G82 B;  4P7T A;  4USJ C;  4X64 F;  4EBC A;  2E7X A;  1RTI A;  2HQ3 A;  1IBM F;  1RAI B;  2ILZ A;  2PA8 D;  2I8E A;  1HHQ A;  1N54 B;  1T95 A;  3CJT A;  4TYB A;  5F0W A;  3FSI A;  4C11 A;  4NLD A;  4FYD A;  3K2Y A;  2HRY A;  1H7W A;  2VG7 A;  4M5K A;  4FBU A;  4DSK A;  2ZKU A;  3NNH A;  2CAD A;  2Q1L A;  4KHR A;  2C2Z B;  3VQS A;  1WG1 A;  2K06 A;  1HLW A;  1LFW A;  4RPF A;  4USV A;  3CDA A;  4ES1 A;  3TZX A;  1HNV B;  1SIZ A;  1RAC B;  1U2R A;  2FZG B;  3TW0 A;  6AT1 B;  3CJ0 A;  3N5B A;  3P5T L;  2PFF B;  4PR6 A;  4OZ3 A;  3LWL A;  4OQJ A;  4B3M F;  1QSL A;  1S6P A;  4BC7 A;  4WU3 A;  2I38 A;  3OFF A;  1CVJ A;  1JIH A;  4C8M A;  2A18 A;  1P9Q C;  1R8A A;  2NYI A;  3A1Y G;  2ZBC A;  3OTD A;  4HAC B;  4DV2 J;  2KFN A;  4AL7 A;  5A76 A;  3MFI A;  5C24 B;  3QT5 A;  4RUH A;  4F4W A;  5GME A;  1HBM B;  2RH3 A;  3U1L A;  1VQ8 S;  4NA1 A;  2KG1 A;  2KN4 A;  4JV2 A;  2H5E A;  3LH2 S;  3A3P B;  1KKH A;  4DV6 J;  5HJY A;  1JX4 A;  2GZO A;  1W2I A;  1FFS B;  4JI0 F;  3VGT A;  2GW8 A;  2HVZ A;  4CLK A;  5JMN A;  1SL1 A;  2OEK A;  1NKC A;  2UVR A;  1KOO A;  1Q8K A;  2GJI A;  1RTI B;  2DNL A;  3POT A;  4FP9 A;  4G1P A;  4IG3 A;  3TA2 A;  5KOW A;  5A2Q Y;  3VAI A;  4DL5 A;  2OIH A;  1W26 A;  4QWD A;  3KHR A;  3AQP A;  2XEX A;  2IDE A;  2J9C A;  3FBB A;  4DX7 A;  3G6X A;  4CQ1 A;  1F2H A;  1RQ0 A;  2G13 A;  5C2G A;  4NCA A;  3R5C A;  4KQZ A;  4XPE A;  2GNK A;  1HMV A;  4I2Q A;  4ZVR B;  4M95 A;  4W4M A;  2DHX A;  2K3I A;  4S0M A;  4DG1 A;  4WK3 A;  3IBC B;  2ALY B;  4DQS A;  2PI4 A;  2FZK B;  2C3Y A;  3PFE A;  5EX3 A;  1LQ9 A;  4RZR A;  1HNW F;  1F0X A;  2DXE A;  1FTR A;  1X0P A;  3C15 B;  3V4M A;  1T05 A;  3D6T B;  4IKA A;  4CI0 B;  4FPR A;  3I55 S;  3HSG A;  4NX9 A;  1QM9 A;  3EGN A;  3MUR P;  3DCA A;  3HCX A;  3UR0 A;  1H74 A;  3RW6 A;  4CCH A;  1H6K X;  4LIR A;  2E9T A;  4TKT A;  4EMD A;  1NSK L;  1WG5 A;  3NCR A;  2HVD A;  3NGS A;  3PYF A;  4N8O A;  1X4F A;  4KIA A;  3MEE B;  3TOQ A;  1S57 A;  3R2C J;  2IAJ A;  3BRE A;  4YB5 A;  1HBU A;  3Q0A A;  3RR7 A;  3TAQ A;  4RW6 A;  3KLE A;  2PT0 A;  3DDN A;  3KLH B;  1BQN B;  1RHQ B;  3AD9 C;  3KMS A;  1M5O C;  3FDS A;  2LYV A;  3T5L A;  1FD8 A;  4TU9 A;  1EIY B;  4JI6 F;  2XS2 A;  4YEA A;  5C25 A;  3EPG A;  1X5T A;  1U2C A;  3KNG A;  2FJB B;  3OLA A;  1H2V Z;  3GIM A;  2ZWP A;  2W9B B;  1GX5 A;  1U25 A;  2RIJ A;  2DR7 A;  1U6F A;  4DUY F;  4YS2 A;  5C42 B;  1HWL A;  5J2M B;  2ERR A;  2CNN B;  5HAO A;  3UW1 A;  1RWW B;  2CNL B;  2P9E A;  3MUM P;  3V2U C;  2FZC B;  3TJ8 A;  3T1H J;  2CJ9 A;  2FB0 A;  2OML A;  2ASJ A;  1J5O B;  4ZP9 A;  1RAF B;  2DEI A;  4CLF A;  4KGV B;  3MWB A;  4QIW D;  3BN4 A;  3ZTS A;  2DKO B;  5C25 B;  4XO0 A;  5GAE U;  1FX2 A;  4OZ0 A;  3TJA A;  5KT5 A;  2CRL A;  2HRU A;  4NCG A;  4ZPC A;  4HLB A;  1JLC A;  4DQR A;  2AX1 A;  2D3Z A;  2VPY B;  1UVJ A;  2CG4 A;  3BGF A;  1UJ5 A;  1DAR A;  4I4B A;  3NBP A;  4TNO A;  4ED6 A;  1FNO A;  3CO9 A;  3ZZP A;  5LT5 A;  1S76 D;  1CJT B;  3QGH A;  2A3J A;  4IR9 A;  2MQ8 A;  1Q82 T;  4DV4 F;  2UU9 F;  2VA3 A;  4NZ7 A;  2HFS A;  1RTZ A;  4FYX B;  5AXN A;  3IN5 A;  2JJ4 D;  3NOC A;  1BD6 A;  2N82 B;  5LJ3 Y;  4X62 J;  2NLW A;  5BR8 J;  2KYX A;  2QO3 A;  4RWW A;  2X1B A;  4V19 X;  1WC0 A;  3UWT A;  1QJH A;  4FYV B;  5KFC A;  3MDF A;  4K4S A;  4EYH B;  4GVB B;  1T9T A;  5M2P A;  1RTD B;  2BOP A;  3IAM 9;  3CC4 S;  2EI5 A;  2NSB A;  2VH7 A;  1O8B A;  4OI6 A;  4AE5 A;  3EVM A;  3MR3 A;  1N0U A;  1PBA A;  3ET6 A;  3OW2 R;  2E7V A;  5IFM A;  1NDL A;  3C6U B;  3M6W A;  2AJQ A;  2JX2 A;  2UVW A;  4NZ6 A;  5CYQ A;  3NY0 A;  5LSO A;  3G87 A;  3IRX A;  2Q79 A;  4B3T F;  2NQP A;  1GNK A;  1I5O B;  2Y1R I;  1VC5 A;  3KG1 A;  5HI7 A;  3VTI A;  5C5J A;  5HP1 A;  2MKJ A;  3QQC D;  6FDR A;  4DN0 A;  2NUU G;  4OJG A;  2C42 A;  2Z4P A;  4GMK A;  1O6X A;  1RT5 B;  4LF2 A;  2FJD B;  4NZ0 A;  2LQ5 A;  3W2W A;  3PR4 A;  1TKT A;  1MNE A;  2NPI A;  3BSC A;  1RCX B;  2ATC B;  2VIC A;  3W5X A;  1ZAV A;  4IR1 A;  5AE2 A;  1T9V A;  5ETS A;  4DPO A;  2R2R A;  4IRD A;  4PWD B;  3FEY B;  1TV6 B;  1TKX B;  3CDB A;  1N4L A;  1XTZ A;  1AT1 B;  1YLX A;  4YY3 F;  4XPC A;  4FF4 A;  3MPW A;  3N4W A;  3KJN B;  4USI A;  2F40 A;  2R7V A;  2QMW A;  3IGN A;  2BQ3 A;  2H5J B;  5GVQ A;  4DLG A;  2KVQ E;  1B7Y B;  3G8S A;  4GKJ F;  2YKN B;  1UFK A;  2ROG A;  3CTR A;  4WYW A;  3VGV A;  4C2M A;  4ZA1 A;  3T9N A;  1SUQ B;  3LAN A;  1JXV A;  1OO0 B;  4JP8 A;  4RJV A;  3JAM Y;  5E41 A;  4YFU A;  1HYS A;  2RD5 C;  3Q86 A;  3UN5 A;  2XGQ A;  2G0I A;  2F9J A;  5H9E K;  1GXU A;  2QSF A;  3DRR B;  2UUA F;  4H4K C;  3MXH P;  1CEZ A;  4IFY B;  4LFB J;  2GHW A;  1X60 A;  2WHO A;  2MKC A;  4OI1 A;  3MEE A;  1PYT A;  5T41 A;  3MMB B;  1T02 A;  1NSQ A;  5KG6 A;  4N8N A;  5CD4 A;  1S6Q A;  3BO2 A;  4RW6 B;  3KLE B;  2L9N A;  3M05 A;  1R6V A;  5EDW A;  1U1L A;  2CQP A;  1D8Y A;  2R7S A;  2JH3 A;  5CCL A;  2FLL A;  2WZ1 A;  2VFU A;  3SZ2 A;  1YG0 A;  1KWM A;  4LF9 F;  2B5J A;  5EWE A;  3DI6 A;  1T03 B;  3I5B A;  4CTA A;  2JRS A;  4R0J A;  3DRR A;  4ZPW R;  1BQM A;  4M5I A;  3SV4 A;  1JB0 C;  3KMQ A;  4AUK A;  2XYP B;  2HHP A;  2F4V F;  4JV5 F;  4K8R A;  3CCS S;  1YWX A;  2HNY A;  3CDE A;  2WOM B;  4KBI A;  1S7H A;  1T11 A;  4P6Q A;  2D41 A;  1M0S A;  4EFA C;  3D2W A;  2F8M A;  4NA3 A;  1PO6 A;  5KT6 A;  1URN A;  2OP5 A;  4WJB A;  4DX5 A;  1VBY A;  3QSI A;  3OXL A;  1M5V C;  4UST A;  1PYS B;  2MYF A;  1PBU A;  2GJF A;  1RWX B;  2OPS A;  1U4B A;  3M2U B;  2VOP A;  4GKK F;  1KOH A;  4B3M J;  1KFD A;  3I9Z A;  4OYM A;  1URR A;  3Q8U A;  1UJ6 A;  4K4Z A;  4LVN P;  4ZCK A;  1X4E A;  1LWX A;  1AZS A;  2M4M A;  2QMU B;  4P72 A;  5KFX A;  1OJ4 A;  1R8P A;  2RU3 A;  3V4I A;  4ZP8 A;  4OMF G;  1Q5Y A;  2X3G A;  3EGV A;  5DDP C;  2NCK L;  2QA1 A;  4JUZ A;  1GXL A;  3W9I A;  3L7U A;  1RWN B;  3ILO A;  2HVE A;  3JQK A;  4X4P A;  2RJZ A;  1IBM J;  1XR5 A;  4OHW A;  3HFV A;  1WF1 A;  1KVK A;  3MM7 B;  2QMX A;  4LRE A;  2MZS A;  2HUR A;  1ZBT A;  3GJS B;  3H4D A;  3T41 A;  4OJH A;  2OKQ A;  4ZVG A;  1C4A A;  4WP9 A;  5AXM A;  4O3O A;  1N34 J;  1WEZ A;  1N48 A;  3IBF B;  2Z2L A;  1GAO A;  3GR1 A;  4K4T A;  1RT2 B;  2V63 A;  2B9W A;  4LF9 J;  1V3R A;  2V6A A;  5MLC V;  3M2R A;  3DGV A;  1FRM A;  3QWU A;  4UOF A;  4M63 A;  2CJK A;  4JI0 J;  3HHL A;  3MM5 A;  4CO0 A;  2ZH9 A;  5CZD A;  4QW8 A;  2XMJ A;  4KYZ A;  5KG1 A;  5DG8 A;  1TVR A;  2Y0S D;  3ENW A;  2JVR A;  1ZM4 A;  4BLG A;  3G8Q A;  4FNH A;  4PPZ A;  2MPU A;  3H90 A;  4KFB A;  2QFJ A;  3QRP A;  2V2K A;  3FUY A;  1EQ0 A;  3ILL A;  3QMQ A;  1RWP B;  1NM2 A;  3B8H A;  4M5N A;  4O3Q A;  3QSY B;  2IVM A;  1S6O A;  2N4C A;  4QR1 A;  1D9A A;  2VUG A;  3D1H A;  5DJB A;  4EEY A;  1WKK A;  4A8K A;  2GFF A;  1EP4 B;  4MMO A;  4CT8 A;  3CIZ A;  4ZIV A;  3RBD A;  4YOE A;  1R8C A;  3P96 A;  2LKZ A;  3UQS A;  3NKY A;  3T6B A;  2GV1 A;  4ECW A;  1NKE A;  2B3T B;  3IWN C;  1T3O A;  2YKN A;  3CB4 A;  3JSB A;  3ULH A;  3T5K A;  2IMW P;  2QYG A;  4PG5 A;  3JYT A;  1FRL A;  1VIO A;  1HNZ F;  4IFV A;  2V8D A;  3DMJ B;  1F9H A;  2BMB A;  1UET A;  1YRU A;  2J9D E;  3Q8V A;  1HWJ A;  2OEL A;  3VZH A;  4M8L A;  4FKY A;  2I2Y A;  4E0D A;  4K50 A;  3CDU A;  4AMO A;  3ILJ A;  4ECS A;  4ECZ A;  3DLK A;  4WE1 A;  1S4F A;  2VQF F;  3E01 A;  4DR4 J;  2W7P A;  4IYQ A;  4ECV A;  4Y2A A;  4DR3 F;  4ZVU B;  3HSJ A;  1S6Q B;  3MMJ A;  2DGT A;  1QAI A;  1NPK A;  2B6A A;  4WXO A;  1FNX H;  2OJ3 A;  5J1E B;  1VQL S;  2ZHO A;  1RHU B;  1UL3 A;  4DCO B;  2N3O A;  2Q3P A;  1U0H B;  1U8S A;  1F1B B;  2GJ2 A;  2ZNZ A;  3AT1 B;  2M5Y A;  4DS5 A;  4EZ6 A;  2G0J A;  3NWG A;  1SJQ A;  4PYD A;  1JJ2 R;  1TUG B;  4ZLJ A;  2ZZT A;  1JLC B;  1S12 A;  2H4W B;  1TK0 A;  3IFE A;  1KP6 A;  2HRT A;  3ENA A;  2R7U A;  5DQI A;  4OHZ A;  1REG X;  2D69 A;  2WVB A;  3MCS A;  3S1T A;  3DOK B;  1D3W A;  1VBZ A;  1WOS A;  3KHG A;  1RWK B;  2DB1 A;  2FPH X;  1TK5 A;  1BE4 A;  1EJ7 L;  2DYA A;  3ZZR A;  1JLA A;  1HW8 A;  3SMZ A;  1U1O A;  4USH A;  3BPS P;  2J76 E;  1LW0 A;  1OPZ A;  1YJU A;  4M5M A;  5D0H A;  1TKD A;  2GX8 A;  1Q79 A;  3MTK A;  4RLE A;  3UN2 A;  5I3Q A;  2HLT A;  4KJI A;  3U1M A;  4DI6 A;  5KFP A;  2AYB A;  1PJ5 A;  3G8T A;  4DV3 F;  3ISZ A;  3E01 B;  4U7U K;  1MG7 A;  2B4P A;  4KY3 A;  4ZLN A;  3I9V 9;  2V9K A;  2VKR A;  4ILL A;  2OMO A;  3CW2 C;  2X3D A;  4W98 A;  3ITH B;  4ANC A;  3GWC A;  3R6L B;  2WVD A;  3KKF A;  4F0K A;  3RRG A;  4PQU A;  4B08 A;  3NXZ A;  3C6U A;  1H3D A;  3CJ4 A;  3M32 A;  4AND A;  3DFE A;  4AD6 A;  4C7Q A;  3ZTR A;  5I4M A;  3LAM A;  3CMA S;  1S1X B;  1W25 A;  2G1D A;  2YQ1 A;  3D3B J;  3UNG C;  4G6V B;  2GGP A;  3D6F B;  4ZJO A;  1N5S A;  3OHB A;  4NLR A;  5EWF A;  3BSN A;  2XLK A;  3G9C A;  2ZVS A;  4PXD A;  1PC5 A;  3EDQ B;  4RBU A;  1XWL A;  3R27 A;  1VK8 A;  2RF2 A;  2W2O P;  2D9P A;  3EXC X;  1PC4 A;  2KXF A;  4YDD B;  4QYZ K;  2KRB A;  1ZZF A;  3PJ9 A;  1TAQ A;  1WKJ A;  3OVA A;  2JC0 A;  2ZVI A;  4O44 B;  3H4B A;  2HG4 A;  1X4G A;  3ZTO A;  3OUY A;  3H40 A;  3W9J A;  2XNQ A;  1VQS A;  2XGP A;  3UVJ B;  1Q4R A;  3Q22 A;  1BQM B;  1Q1K A;  1T9Y A;  3AJD A;  5ETP A;  3T1A A;  1HBU B;  1H73 A;  4QIE A;  5DS7 A;  2BR0 A;  1K9M T;  2WB1 D;  4WZQ A;  2U2F A;  4I68 A;  2RVJ A;  2KRR A;  4NXN F;  3SFG A;  1FXR A;  2XMK A;  4DV7 F;  4CYU B;  2ZH7 A;  3ZO7 A;  2R9L A;  3EGW B;  3CCE S;  3UD3 P;  4IRC A;  4AMN A;  2AQ4 A;  1Z1Z A;  5KG0 A;  5CQG A;  3FMW A;  3DC2 A;  4LQ9 A;  4LT6 A;  4IFY A;  5KFE A;  2ZJP Q;  1H0H B;  2BXJ A;  3MR6 A;  5L46 A;  3BQ2 A;  1TEL A;  3L95 X;  3J81 Y;  2HZV A;  2ZH4 A;  3NNC A;  5J2N B;  2J7U A;  2DNH A;  2VKZ G;  1RLD A;  2M2B A;  1RK8 A;  2NXN A;  5G4D A;  2EFV A;  3TP2 A;  3D54 A;  1CJV A;  2JVO A;  5KT2 A;  4JOU A;  4X4T A;  1X5O A;  1HQE B;  4OYX A;  4PWU A;  4ETX A;  2MQP A;  4MT1 A;  2KM8 C;  2OTJ S;  1QLN A;  3ONQ A;  1KLM A;  2RKI B;  1DLO B;  2DCL A;  1BC6 A;  1JQG A;  1RHM B;  1TL7 B;  3V81 B;  1S7I A;  5A8R A;  1XN9 A;  4DV4 J;  3RB0 A;  1NDK A;  2RRN A;  2AGQ A;  1XNR F;  1B64 A;  4ZKA A;  2HNY B;  1NDP A;  3G6E S;  1U2F A;  5LMN J;  2KZM A;  4NCB A;  1EX8 A;  4HH1 A;  1YSJ A;  3A8K A;  4I64 A;  2A2C A;  2ACY A;  1HW9 A;  3GG0 A;  1WEX A;  1IWG A;  1EET B;  2DY1 A;  2P6T A;  3OTC A;  1H98 A;  4KGK A;  4NAS A;  4L74 A;  2MXY A;  4CH1 A;  4OL8 A;  1CJU A;  2VV5 A;  2W4D A;  1SKR A;  5DDR C;  3HSD A;  1XMO F;  4AXI A;  4CT9 A;  1NH7 A;  1R6Y A;  2YNF A;  3SSS A;  1U0H A;  4MKY A;  2B5J B;  2CJX B;  1U1K A;  2ZE2 B;  3PNI A;  2DGX A;  3PRD A;  4UF4 A;  2PMZ D;  3CME S;  3M8R A;  1AW0 A;  1IN0 A;  2PE8 A;  3DU6 A;  5FLX U;  3FSX A;  3BO4 A;  1CPZ A;  2DBB A;  3M2R B;  4FXD A;  2HIQ A;  2HS3 A;  2HND A;  2YWE A;  3GFY A;  4PG8 A;  1NKB A;  7FD1 A;  3ISN C;  2BE7 D;  1YJV A;  2IA0 A;  4IH7 A;  5U47 A;  3J7Y U;  3LA0 A;  1G4C A;  3HO1 A;  2VFV A;  1ZPV A;  1TUV A;  3KNA A;  5IM0 A;  3IR6 B;  1C1B B;  4OX9 J;  2LDY A;  2BAN A;  2H9Z A;  4O3N A;  4EU0 A;  3MAA B;  1KR4 A;  4D3H A;  1S9G B;  1VS3 A;  1NPR A;  1B0V A;  2B8P A;  4NRU A;  3SDE A;  4N5S A;  3MR2 A;  5H9F K;  2WB4 A;  1C1C B;  2CQG A;  1ZAW A;  2AHO B;  1GMU A;  3BBF A;  3MOZ A;  3R2D J;  2HWI A;  2FJE B;  1Q78 A;  3DDI A;  4KAI A;  4PEO A;  2EBE A;  2QIF A;  4A48 A;  4QWC A;  4GC6 A;  1S0M A;  5KG5 A;  3SQG B;  4ECT A;  2HYI B;  1RTH A;  2PGC A;  2YNI B;  4OFZ A;  4HTJ A;  2V2Q A;  1R8H A;  1X4B A;  2YKP A;  3G96 A;  4CLZ A;  5LJ5 Y;  1PAU B;  2MGZ A;  3BS9 A;  3OR2 B;  3W65 A;  4BS2 A;  2KFZ A;  2M88 A;  3TO8 A;  1FJC A;  2XS7 A;  3M9M B;  3BYR A;  3W8P A;  4GO5 X;  9ATC B;  3MD1 A;  3CUL A;  3L9Z A;  5L1L A;  2HHT A;  3K5O A;  1K1Q A;  1B0P A;  1RT6 A;  2DGS A;  1JXE A;  2HGL A;  3CD5 A;  1RYS A;  3KLI B;  2Q43 A;  3GIR A;  4OX8 A;  5KT3 A;  3R1L A;  2K2P A;  3D1Q A;  2MGZ B;  1EP4 A;  2XM3 A;  3WBZ A;  2F63 A;  2CPF A;  2GMH A;  1U02 A;  1JLF B;  1LXN A;  5KFS A;  4A8O A;  2HSE B;  2FJW A;  1P6T A;  2VG6 B;  2V8P A;  3D7S B;  1K0T A;  3MF5 A;  3H5U A;  2HQG A;  2F4V J;  4JV5 J;  2OTL S;  4LF6 J;  3A3O B;  4KFB B;  1TU0 B;  4UW2 A;  4EBD A;  4XDC A;  3MAH A;  2R4F A;  3ENQ A;  2IPO B;  1AUS L;  2COL A;  2C3O A;  4CTA B;  4E98 A;  1FJ7 A;  2HIY A;  2ZIT A;  1IWA A;  4WKY A;  3O2I A;  3HF5 A;  4JI1 F;  3PW7 A;  4UY8 T;  3SSR A;  2XMV A;  2AYE A;  1D1U A;  3W62 A;  3M2V A;  3T1Y F;  2HHX A;  4HDH A;  2DGU A;  2UUC J;  1OY6 A;  4YQW A;  2IYI A;  2YXL A;  3H2U B;  5LM7 E;  4QCL A;  2G2Y A;  1OYE A;  1VBX A;  2Z56 B;  2J8S A;  4A8X A;  2NXJ A;  3DMJ A;  5F3Z A;  1VQ6 S;  4ZIW A;  4OI3 A;  1Q8I A;  2G0C A;  3H2L A;  3TA0 A;  2I5J B;  2LEP A;  4TLR A;  4RW4 B;  5L39 A;  1TV6 A;  1WJ9 A;  3D28 A;  4LSL B;  4Y00 A;  4DZD A;  3KK3 B;  3VAF A;  3V6K A;  3H0P A;  1IKW B;  3FCH A;  4PXB A;  3AHP A;  2CPI A;  4RW9 B;  2MKK A;  3MPY A;  2C2D A;  3FQK A;  1FWL A;  1UMJ A;  3GV8 B;  2B9Y A;  1NK4 A;  4URG A;  2F7V A;  2DH8 A;  2W2M P;  3TJ9 A;  4QQB A;  3J81 j;  3GCW P;  4H4M B;  1R7I A;  3PM9 A;  4MIW A;  3W61 A;  3I6P A;  1P27 B;  2EFN A;  3GU0 A;  2QLJ B;  3P45 B;  1IBL J;  3J7Z T;  2G9O A;  2XY5 A;  4JI3 F;  1P1T A;  3CJ5 A;  2H1Y A;  4MFB B;  1NH8 A;  4DX8 H;  1FKP A;  1CUL A;  2AJ4 A;  3OUY B;  3H42 A;  3KHH A;  4JI4 J;  2V69 A;  4DZ6 A;  2XYH B;  3O6Q A;  5GMD A;  5HMX A;  1SJR A;  3JAM U;  1T8E A;  4WIQ A;  1VQO S;  3M2V B;  3HK2 A;  2JHE A;  2HQC A;  2C28 A;  4F8R A;  2G4B A;  4FXW A;  2IA6 A;  1BHN A;  2IRY A;  3D66 A;  3W60 A;  4WFX A;  2VQE J;  3VAK A;  1LV5 A;  1BQX A;  2FVQ A;  3EM1 A;  2VFS A;  4HAC A;  4L75 A;  4WU2 A;  5ETR A;  4PCQ A;  2QN6 B;  2QL5 B;  5HL7 Q;  2L9W A;  2YWG A;  3CSK A;  3H2V E;  3THT A;  3TQ1 A;  4PG7 A;  4C97 A;  3TZY A;  5JVG Q;  1PJ6 A;  2E5L F;  2AD9 A;  3WQP A;  1RAA B;  4CO1 A;  2ACM A;  4CM2 A;  3BR8 A;  3BM7 A;  3C14 B;  1Q16 B;  1UCN A;  1JXL A;  1XMQ F;  1WHW A;  2NZ4 A;  1RTJ B;  5HBM A;  3Q8S B;  3E3X A;  3I4H X;  4P74 A;  2ZJR Q;  2IY5 B;  2JEF A;  1IXK A;  2G1H A;  2CQ0 A;  4KKO A;  2Y1J A;  2ZD1 B;  4ENO A;  4FYW B;  2GMJ A;  1R89 A;  2VQE F;  1HR0 F;  1FRI A;  4ZN3 A;  4R25 A;  1VHF A;  3JB9 k;  4ID8 A;  1NSP A;  2SXL A;  5J2P B;  1UPM B;  3K0J A;  2UV8 A;  1C4C A;  3K7R A;  1RT6 B;  3DLH A;  4C6A A;  4CO4 A;  5IZH A;  5L1J A;  1N36 F;  1AYE A;  2ZBR A;  1YKW A;  5E0O A;  4BHQ A;  4UQG A;  2AYG A;  2BRK A;  3R97 A;  1I1G A;  4AQY F;  3OQ2 A;  1N34 F;  1ICE B;  2DIV A;  2AV5 A;  5B0D A;  4B3R F;  2KG0 A;  4WXW A;  5K5M A;  4DR4 F;  1S9E A;  2R8H A;  1W7W A;  3Q89 A;  3BKT A;  2BE9 B;  1G2E A;  1M1G A;  2E5I A;  2AJF E;  5KFI A;  2AGO A;  3HVT B;  4K7Q A;  4CYU A;  4O4G B;  3H25 A;  3V6D B;  4PXC A;  1FE0 A;  1KQG B;  3D0H E;  1U24 A;  5HJX A;  4NLT A;  3MR5 A;  1LNQ A;  2EKY A;  3HVW A;  3IO1 A;  1LKZ A;  2B9X A;  1R31 A;  4I56 A;  3C2P A;  2Z2Z A;  4QZV B;  2A6O A;  1TL1 B;  1E6V A;  1N5T A;  5EN1 A;  5JVH Q;  1SCJ B;  1N88 A;  7AT1 B;  2Z8Q A;  1YQH A;  2C3M A;  4WWS A;  2ZJQ Q;  1NHK L;  2IHR 1;  3GJQ B;  1N33 J;  4NE9 C;  5B0C A;  3PW5 A;  5SUH A;  4N77 A;  2V8G A;  3CJR A;  1CJV B;  5E33 A;  3P3D A;  4O4R A;  4NLS A;  1YX2 A;  1XNQ F;  1LWC B;  2BJD A;  1M5S A;  2YKQ A;  1OPI A;  4UQT A;  1JKH A;  4ECR A;  4ZPV R;  1DLO A;  2J0X A;  5GAE I;  4BWJ A;  4GKK J;  1E6V B;  4LUB A;  2ABY A;  2BBE A;  5HLF B;  2HND B;  3MEK A;  3BGR A;  2XB2 D;  4USM A;  4X4Q A;  4B3S J;  2CPE A;  5E5N A;  3OLB A;  5HQL A;  4UZB A;  4JI7 F;  2FJA B;  1WF2 A;  1DTQ A;  3EIC A;  3WIV A;  4PQA A;  2GA7 A;  3ITH A;  4UY8 5;  1RA7 A;  2KDO A;  3D4J A;  1X4A A;  1R0A B;  5BYR A;  1R27 B;  5HQ8 A;  2R7W A;  1B3T A;  2N7C A;  3JSY A;  1QAJ A;  2P2C B;  1FDB A;  2L08 A;  5E3C A;  1QUP A;  1SC1 B;  1BMQ B;  1NK8 A;  4J9O A;  3PO4 A;  1N5Y B;  2V4J A;  4ICL A;  4CH7 A;  2ATL A;  2BM1 A;  1AXQ A;  4MJK A;  3VF0 B;  6FD1 A;  1E6Y B;  4F67 A;  3UDE A;  3BKU A;  1UWA A;  5K20 B;  3EVO A;  5HVH A;  5D78 A;  3NRB A;  2CWK A;  2E1A A;  3T19 A;  5FD1 A;  1F6T A;  3W2V B;  1KSP A;  2ZWO A;  4Q8E A;  2VPZ B;  3GE9 A;  3I87 A;  2AT1 B;  1FRK A;  3HP6 A;  3H5Y A;  3K5M A;  2HS4 A;  1KNZ A;  5KG2 A;  4Q0B A;  2E9Z A;  4QBU A;  1CC8 A;  4Q7A A;  2JNJ A;  2CG8 A;  2KJW A;  2ZDP A;  1YIT S;  5C7P A;  5ETM A;  4R0E A;  2JLE A;  5IC4 B;  1NK5 A;  2GQQ A;  3BV8 A;  2BJ1 A;  1TQL A;  4C0B A;  2ZH1 A;  2Q6B A;  3IC1 A;  4DV1 F;  4EZ9 A;  4JYA F;  2IJF A;  3AJ1 A;  4Q43 A;  4LR9 A;  3TUI C;  5J2Q B;  3CCW A;  3OBI A;  4LBI A;  2OUG A;  3BH6 B;  4ZOS A;  4O23 A;  2CXE A;  3CD0 A;  3W63 A;  3VV2 B;  5DQG A;  1U48 A;  4R8U A;  1NHU A;  4C0O C;  2XO6 A;  4JI8 F;  5CZX A;  3SYZ A;  3BKF A;  3FFI B;  4JV0 A;  5KFM A;  3M8Q A;  2CFX A;  3BGO P;  4LSN B;  3HVR A;  4IDK B;  1X5P A;  4B3O B;  1FKO A;  1HQU A;  4QIV A;  4LF8 F;  1VJW A;  4YR3 A;  4NMX A;  3QLH B;  1WEL A;  1CS4 B;  3Q23 A;  4XIU A;  3DHW C;  3MMC B;  3M6X A;  1C0U B;  3Q83 A;  5F8J A;  2YVS A;  1RKJ A;  3MMA A;  2C3U A;  4ZPD A;  2NXU A;  2NPF A;  2PO4 A;  1LXJ A;  3EVW A;  2YNG A;  3QT8 A;  3P5B P;  1N52 B;  1YK9 A;  3HT3 A;  2ZM6 F;  2WVF A;  4OYA A;  3OTB A;  3CPW R;  1RZM A;  1CUL B;  3DLE A;  2WON B;  1Q5V A;  4JI5 F;  1Y3J A;  3QIP A;  5A8K A;  3M9N B;  2EFP A;  4IO9 Q;  1CS4 A;  2EFO A;  1FHT A;  1QE1 B;  2VDI A;  3HHE A;  2YH0 A;  3L7P A;  1L3U A;  5GAH U;  1V5I B;  1FXL A;  2BW2 A;  3MCN A;  3OL8 A;  1B99 A;  4HL9 A;  4J90 A;  4LSL A;  1UVL A;  4ZP6 A;  3OXF A;  5IV4 A;  1S1W B;  2LQB A;  3VAM A;  2F5G A;  4OLO A;  1FDN A;  2V50 A;  4AXJ A;  1RA6 A;  2WON A;  3IP0 A;  4OYI A;  1ARO P;  3UN3 A;  1XMQ J;  2UU9 J;  2MKH A;  4N56 A;  1TKZ B;  3HZG A;  5J1N A;  5JUM A;  5KFK A;  2DNZ A;  4YR2 A;  2DNQ A;  2W9C A;  3B4M A;  2UXC F;  4L3N A;  1NEE A;  1C1B A;  1A0O B;  2W25 A;  3JS9 A;  1WC4 A;  4H4K A;  3TVZ A;  4C8Y A;  1S10 A;  3P4U B;  2HWT A;  3GP9 A;  4LR7 A;  3D0G E;  4I69 A;  1NND A;  1IBL F;  3AFG A;  2YNH A;  3JSM A;  2QT7 A;  2CVE A;  2GVD B;  5I42 A;  1T7P A;  2HBR B;  3UNY A;  1RAB B;  4DQP A;  4OYO A;  2HFV A;  3TYT A;  3LO3 A;  1HBO B;  4F3Q A;  4DL6 A;  3TI0 A;  1GEH A;  3KLG B;  1HNI A;  5L9N A;  1F9E B;  4CIO A;  2DHA A;  3M7V A;  1VQM S;  2L48 A;  2YX1 A;  3H98 A;  4RW9 A;  3HVA A;  2ZZN A;  1WI6 A;  5A0Y A;  3BN7 A;  5K14 A;  2IYG A;  4XDD A;  4I2P B;  1O0P A;  1QE1 A;  2M0G B;  4ERD A;  4M5H A;  3ZTP A;  4IOC Q;  2UUB J;  1VQK S;  4QYR A;  2QGF B;  3GPA A;  4UOH A;  2G2Z A;  2KL8 A;  1A6L A;  1EAY C;  2BYC A;  2WCX A;  3KJV B;  2LEB A;  1HNX J;  2IVY A;  1S9E B;  1HBN B;  1QAX A;  1ZOT A;  5LSL A;  4M5J A;  2LMI A;  4NYZ A;  2VG5 B;  1WWH A;  3K57 A;  3ZXW A;  2IJN A;  2MSS A;  2P5V A;  3KLI A;  2J9E A;  4I7F B;  2UV8 G;  1S0V A;  1FJG F;  1RIS A;  3BR9 A;  3HFK A;  2CDR B;  3IR5 B;  2EPI A;  1RHK B;  1HPZ A;  2WAQ D;  1GT8 A;  1Q0N A;  3A4T A;  3CCT A;  3PKY A;  2RE1 A;  5A6W A;  1DTT A;  3EXY A;  3PZP A;  3QBC A;  3DHX A;  4WZM A;  3JSR A;  2KHD A;  2MQN A;  4M5L A;  4RU2 A;  4B9T A;  4OHY A;  3MAQ A;  2GQ2 A;  1BWV A;  1UVM A;  5KFH A;  3MED A;  4YUD A;  5AJ3 J;  3DXB A;  1EQM A;  2BVZ A;  1APS A;  2UVV A;  2DY9 A;  1MU2 A;  1U49 A;  2DO0 A;  1ZM2 A;  5L8R C;  2GCF A;  3FFI A;  1CC7 A;  2AJ1 A;  2DD8 S;  2ILY A;  4ZPT R;  5K14 B;  5A0Y B;  1TK8 A;  1Z2Z A;  2RHS B;  5E2Q A;  2IBK A;  3LP2 A;  1VCT A;  1P9Y A;  2J9D A;  3IWL A;  3M8S A;  2V4R A;  3PXG a;  3GFZ A;  5CAA A;  4A8Q A;  4KH1 B;  3CIM A;  4OZ1 A;  4M94 A;  3NS5 A;  4FVC A;  4Y2M A;  2UVU A;  5E3A A;  1SC3 B;  2MQM A;  1FE4 A;  3GZ7 A;  3MED B;  5FII A;  4WBF A;  4DV2 F;  2FYX A;  5D3G B;  1Q7Y T;  2JEJ A;  1JLE A;  2R8J A;  3C16 A;  4J9U E;  4NLO A;  5D0G A;  5D0E A;  3NS7 B;  1SBR A;  4G65 A;  5AE1 A;  1P1L A;  4I7F A;  3CD7 A;  3R6G B;  1N8R T;  5H9F J;  1U1M A;  3HZE A;  3ENV A;  2HPU A;  1JLB B;  1YJT A;  4MIB A;  2HFN A;  2FLO A;  4DV6 F;  3NL0 A;  2EWH A;  2E5G A;  2YWF A;  2ZKT A;  3ZZT A;  3ETO A;  5K8P A;  3KLF A;  1WD6 A;  1FFG B;  3OXG A;  4TY9 A;  2WW4 A;  5ETK A;  4DUY J;  1FEH A;  1HMV B;  4M5D A;  4DR6 F;  3HX9 A;  1NK6 A;  3OT9 A;  2CUY A;  2DIT A;  3DXS X;  2UUW A;  2MHE A;  1IR2 A;  2E1P A;  3NLC A;  3W1Y C;  1KHV A;  2B51 A;  3HKW A;  5F8L A;  5CZC A;  1ZA2 B;  1S6U A;  3HLU A;  4Y34 A;  4WK1 A;  4B02 A;  1I94 J;  1S1T B;  8AT1 B;  1Q53 A;  3LGH A;  4IG0 B;  4L76 A;  3I82 A;  2XYG B;  4UTG A;  3K58 A;  2ZH8 A;  1WUU A;  2VDH A;  3NS6 A;  3KOA A;  5IC6 B;  5LOQ A;  1L3S A;  3QO9 B;  1YZ6 A;  1DAX A;  2H51 B;  3AH6 A;  3MEC A;  4OI4 A;  1RT7 A;  1MW7 A;  1UEK A;  2RRB A;  3RTV A;  3PW4 A;  3B82 A;  2XWX A;  4LF5 F;  4RW7 A;  2R7T A;  1C0T A;  3S6E A;  3GR0 A;  5KFW A;  4X4N A;  2XBP A;  2RQC A;  1JKH B;  3C16 B;  3AOB A;  2CVI A;  5GAG I;  3RRH A;  1IBK F;  2ZC3 A;  1SIW B;  3KLH A;  1MN7 A;  1S1V B;  3MPD A;  2RDJ A;  2DNK A;  1SKU B;  2FD2 A;  1HNW J;  3U7J A;  5GAD I;  3CCR S;  2LDI A;  3A3N B;  2BQR A;  1CG2 A;  3KUE A;  2CJA A;  2RT3 A;  1NME B;  2FQQ B;  4NPO A;  8ATC B;  2OLW A;  3QWP A;  4F02 A;  1NRK A;  3I0S A;  4OX6 A;  3SCJ E;  3D6M B;  4CDI A;  2CQ2 A;  3PW2 A;  1CJK A;  2JOQ A;  3NGT A;  1I51 B;  2GAH C;  4RBT A;  3W2W B;  5IT9 Y;  5B0G A;  1S1T A;  3MR7 A;  3NCQ A;  4DR1 J;  1IKW A;  5AXL A;  1HR0 J;  4QWB A;  4U7U D;  4CRJ A;  5KFN A;  2G2O A;  4RUA A;  3QIP B;  3HJF A;  3MD3 A;  4ZJL A;  2X7I A;  1JMT A;  4NWB A;  1RT3 A;  4NLX A;  3RGI A;  4USK A;  2A6M A;  2ZUA A;  2DIU A;  2R7Q A;  4OI2 A;  4TLQ A;  5ETT A;  3W7B A;  4ELV A;  1XNR J;  2OEM A;  2HGM A;  2J5A A;  3FKB A;  4CNZ A;  3JTN A;  2MB0 B;  4G3I A;  2XC9 A;  5L1K A;  2ALZ A;  3H7H B;  1XJW B;  2CZV C;  4P2S A;  3X3U A;  1MMD A;  2AP6 A;  3NG8 A;  4DJB A;  4I2Q B;  3G4S S;  3MMC A;  4KRW A;  5IOL A;  4DFM A;  1YGY A;  2FDN A;  4TXS A;  1OY8 A;  1SH3 A;  4O4G A;  2VPX B;  3DRX A;  4A8M P;  2D3O R;  3X1L B;  3DOM A;  4DSI A;  5EWG A;  4ZK7 M;  4YDX A;  2FC9 A;  5CA5 A;  3QAT A;  2WBR A;  4NXM F;  3TWZ A;  2QJ3 A;  2IC3 A;  4B9V A;  3EX7 B;  2DNP A;  3POT B;  2B43 A;  3MZI A;  2OGU A;  3GLJ A;  2E9R X;  2V5H G;  5A2Q U;  3SXL A;  2DHG A;  2KVI A;  1QDU B;  4Z2X A;  3KFW X;  4J9K A;  2X51 A;  2Z30 B;  2HQD A;  3CJS A;  3D1O A;  3C14 A;  3CJK A;  4FS2 A;  1PIL A;  1S6P B;  3HSZ A;  2ZH6 A;  4LR8 A;  4WF9 Q;  3DLJ A;  1F60 B;  1SJ4 P;  1R0B G;  3TAM B;  3THV A;  3EZU A;  4WPA A;  1YDL A;  2RSQ A;  3QT6 A;  1KBR A;  4DXL A;  4AL6 A;  1GK8 A;  1L3T A;  2CPX A;  1V3S A;  2A1B A;  4QOT A;  1VQ5 S;  1S9F A;  3L4B C;  2F4F A;  1JJ4 A;  2DHH A;  1BY9 A;  5KFY A;  4IQX A;  1ZET A;  4FF1 A;  3QAU A;  4KB7 A;  5ETN A;  3DRP B;  3MM9 A;  4R5P A;  3L3C A;  4A8F A;  4P10 A;  3R1H A;  3MPV A;  5CAB A;  1AZS B;  4XTT A;  4Z37 A;  3PEH A;  1EET A;  2CKW A;  2HK3 A;  2MY7 A;  3NOG A;  4PXE A;  5HAN A;  1SKW A;  4O0I A;  1IR0 A;  4WII A;  4CLY A;  2ROP A;  3G82 A;  2GVZ B;  2J0Q D;  3JQM A;  3TVK A;  4TYA A;  3OVB A;  4LMZ A;  2VZ9 A;  1MRO B;  1DZ5 A;  1N33 F;  2M7S A;  2CIM A;  4RW7 B;  4F04 B;  1GFW B;  4IH5 A;  3DYA A;  5DRK A;  1RT4 B;  3BGU A;  3ZZO A;  1RWV B;  2ZHB A;  3NWR A;  4FF3 A;  2ZOM A;  1GXT A;  1F9F A;  1D09 B;  5J2M A;  3ZC4 A;  3NNA A;  4ED5 A;  3FEZ A;  3D5M A;  1IVZ A;  4DR7 F;  1WNE A;  2HHH F;  2UUA J;  5HQM A;  3VAG A;  1Q8L A;  3TR5 A;  1R0A A;  3HJV A;  3PYG A;  1DHM A;  2NS1 B;  2HBY B;  4DPT A;  3PO5 A;  1T03 A;  3HHN B;  3MM8 A;  1YZ7 A;  3DOL A;  3LP1 B;  3HMJ G;  5DLG A;  2WK4 A;  3RR8 A;  2V2Z A;  1VRT B;  2AEJ A;  2MMY A;  1TVR B;  2YPY A;  3GCX P;  3ISN D;  3TX8 A;  2ZBP A;  1FWK A;  5HVG A;  1GMW D;  3AXK A;  4CWB A;  2KFY A;  3PEJ A;  4ECY A;  2M8D B;  2IBO A;  3OTE A;  4ED0 A;  2MLZ A;  1K1S A;  3EE3 A;  3LGN A;  3UDL A;  4LSZ B;  5HLF A;  4B9M A;  1KQK A;  2APO A;  4HVZ A;  4LFB F;  3SFU A;  5F8H A;  1X0F A;  2BKP A;  2HBQ B;  2AJ0 A;  3MTJ A;  2OD4 A;  3RUB L;  1FXD A;  2A10 A;  4CLL A;  3EWG A;  1MU2 B;  2HBZ B;  2IIH A;  1GH8 A;  2H5I B;  4UUW A;  4CLP A;  4LF1 A;  1M1H A;  3A13 A;  1VRT A;  1MLA A;  1WDT A;  2V8V A;  1LWE B;  2NXE A;  3RB6 A;  3M2U A;  1S0O A;  1RUS A;  4QWE A;  5KFL A;  3I5C A;  1HPZ B;  3KG4 A;  4KT0 C;  1RT4 A;  4RR5 A;  3IAS 9;  1WOO A;  3IG1 A;  3Q24 A;  3QGG A;  4IG0 A;  3PJX A;  3R9L A;  1T9X A;  2HFU A;  1U26 A;  1NLK L;  2BOA A;  2QLX A;  2HFO A;  3M6U A;  2YKM B;  3RG6 A;  1TFW A;  4PWD A;  1NCL A;  4X2B A;  2DGW A;  4JI2 F;  1GMW A;  4DUZ F;  4IUF A;  2FVP A;  3KK2 B;  5KFO A;  2V34 A;  1SV5 A;  1SQE A;  3FCW A;  2Y9H A;  2IC3 B;  2XTJ P;  1RT1 A;  3IS9 B;  3PFO A;  4GKJ J;  4X4V A;  2AF6 A;  2EFQ A;  4QU6 A;  3LUY A;  3AA8 A;  5IXU A;  2KB2 A;  3IMQ J;  5F9N A;  1NJW A;  4M5D B;  2B0G A;  1RT5 A;  2B56 A;  2E1R A;  3M8Y A;  5HK4 A;  3GV5 B;  2W7O A;  1XNQ J;  2H65 B;  4UZC A;  2DGQ A;  4Z7Y A;  5AE3 A;  1QAY A;  3WX8 A;  1YRX A;  2PDA A;  1FRH A;  1B0T A;  1H2T Z;  3FRY A;  4AYB D;  1YJ9 S;  2QV6 A;  2XSJ A;  1U1Q A;  2GVD A;  4NLQ A;  3KDO A;  1QSS A;  1TR0 A;  1J27 A;  2YY3 A;  4YB6 A;  2GIR A;  1G3O A;  1RSC A;  2LFV A;  2POK A;  3OL9 A;  3CE8 A;  4Y6I A;  2P6S A;  4L3K A;  2DJW A;  3S01 A;  1RLC L;  5DM7 Q;  3NMA A;  2MEW A;  4ZCL A;  3GSI A;  2A0F B;  1K8A T;  3SQO P;  1HIY A;  3DRP A;  2CZ4 A;  3DRS B;  3MM9 B;  1UVK A;  4WP3 A;  1UP1 A;  3DM2 A;  2K3K A;  4Q2M A;  1F3F A;  2QA4 S;  1IJE B;  3F41 A;  5D8H B;  3JYT B;  2ROE A;  1HD0 A;  4PZV A;  5E7O B;  1QVF R;  2KKH A;  3RJM B;  4N47 A;  2IM2 A;  3M4X A;  4IG3 B;  2BE2 B;  2KH9 A;  3KTQ A;  2R2U A;  4X4U A;  2XMA A;  2GGP B;  3JQJ A;  1S77 D;  3EPI A;  3SSQ A;  1OS5 A;  2DRA A;  1JNR B;  4L6V 3;  3NGR A;  2C2M B;  2GO9 A;  3M6V A;  5B0F A;  2XSJ B;  4ZHR B;  4DV1 J;  4KO0 A;  1VDH A;  4NL5 A;  4NLW A;  3NEK A;  4C3M A;  2XZW A;  1NO8 A;  4J9Q A;  1U45 A;  4ZVH A;  2J0S D;  2XMW A;  1NU4 A;  2D9O A;  2XG8 A;  4NLV A;  1G6B A;  4QR2 A;  4K5R A;  1FD2 A;  2WBM A;  2KM8 B;  4HHH A;  1FNM A;  2N3L A;  2W9B A;  2KT3 A;  1NK0 A;  2QEX S;  3M8P A;  2RB7 A;  1FF2 A;  2R3V A;  1VRQ C;  2IM1 A;  3BBC A;  2B9E A;  2CDQ A;  2FGC A;  2LXU A;  4ZVQ B;  2D3O 1;  2DEJ A;  3G86 A;  4ZVO B;  1PAE X;  1QUV A;  2CJQ A;  2W01 A;  3ZNJ 1;  4ZMM A;  1UA0 A;  3CD6 S;  2X1A A;  1VC0 A;  1RAJ A;  1S59 A;  1JLE B;  1QSY A;  1NZ8 A;  2BAC A;  2IAJ B;  2OI2 A;  1RU2 A;  1N0V C;  2QC3 A;  3IBW A;  4OYB A;  1LWE A;  2XHC A;  4ED1 A;  1IKX A;  2B4U A;  3Q2S C;  4NML A;  4ILM A;  2PD1 A;  1K0V A;  3VAJ A;  3ELH A;  2QLB B;  3C15 A;  4KE5 A;  5KFU A;  4DR5 J;  5EUH A;  4Y0F A;  2QX0 A;  4ID5 B;  3NGD A;  1SC4 B;  2XZT B;  1OIA A;  3AOD A;  3FC9 A;  1MWY A;  1GTE A;  4IQM A;  4ZHR A;  5LXY A;  3HKZ D;  1NJZ A;  3C46 A;  3FMB A;  2KT5 A;  3W8G A;  3R5G A;  4A46 A;  4X66 F;  3CWJ A;  4K59 A;  2FVC A;  3CJ2 A;  1UZD A;  2N7Y A;  4I0W A;  5C42 A;  3H20 A;  1U8W A;  3MPU B;  5LXR A;  2FVR A;  1OYD A;  4MK8 A;  2X1G A;  3C8Y A;  1VR6 A;  1IKY B;  4LF5 J;  1HHS A;  1WHV A;  3W5Y A;  3OSP A;  3ZZU A;  4DCJ B;  1FDA A;  5I3U A;  3KDN A;  2MHN A;  2CPZ A;  2WSF C;  1CJU B;  5B0B A;  1VIS A;  3M8P B;  2XMU A;  2QL7 B;  2GO8 A;  3LPY A;  3HVT A;  2XLJ A;  1JJC B;  3PV8 A;  4IFV B;  4JYA J;  1KFS A;  2DNN A;  3RW7 A;  2KXH A;  4K4Y A;  2M52 A;  4KPC A;  1UWB B;  2Z58 B;  1YBT A;  3BQ0 A;  4R5P B;  4K2X A;  2QLF B;  4ES2 A;  4MYU A;  1YHQ S;  4NXM J;  4OYW A;  2AEM A;  5KT7 A;  4RW8 A;  1IKV B;  5K8N A;  2GAG C;  3MM6 B;  5KTQ A;  1VMB A;  2HLU A;  1RI7 A;  3A8I A;  3UDC A;  4RNF A;  3K8V A;  3RZA A;  2JFK A;  4N41 A;  1FK9 B;  1S1V A;  4DSF A;  3BBB A;  3U02 A;  1NJI T;  2V68 A;  3PYE A;  4F0M A;  3QZ8 A;  3EZ5 A;  3Q2T C;  1HKA A;  1KRP A;  1RT2 A;  3MAA A;  1Y3K A;  2J7K A;  3NCP A;  2VHG A;  4A8S A;  1RBL A;  1NDC A;  3E51 A;  5D4P A;  4C8Z A;  2OPQ A;  2YWH A;  4OX7 A;  1S5Z A;  1J2V A;  1AB8 A;  4DV5 J;  3N6L A;  1W2B R;  2XCP A;  3HHK A;  1B4S A;  5DDQ C;  1SI9 A;  2K1R A;  3UD4 P;  2HQI A;  3WC2 A;  2K8G A;  3DM2 B;  1F5A A;  4HI1 A;  5IQ6 A;  4J5O A;  1NJX A;  1RJJ A;  3ET6 B;  3HUL A;  2CA9 A;  5G0R B;  1CJT A;  1FDD A;  4RNN A;  3KLF B;  2M70 A;  4HKQ A;  1JLA B;  5KFA A;  3DOL B;  3LP1 A;  3OR1 B;  2HK2 A;  4U9R A;  1SQG A;  1VIX A;  3B4D A;  3R7B B;  4ZVE A;  2OPQ B;  3TQE A;  4ZN1 A;  3A12 A;  5A8R B;  2OFH X;  4HTI A;  3CCQ S;  3SI8 A;  3CCV S;  1KQS R;  2ZBQ A;  1Q81 T;  1VQN S;  1JLQ B;  4A47 A;  1VC6 A;  2PFD A;  4TQS A;  2LU1 A;  4L73 A;  4PKD B;  5KFQ A;  4WFA Q;  2OSQ A;  5DZ6 A;  3KLV A;  1LK7 A;  4DU8 A;  3IRW P;  5JXS A;  2XY7 A;  2YNF B;  4C98 A;  4Y2I A;  4KC5 A;  5DLF A;  4CLU A;  1AUD A;  3U1N A;  1R0C B;  2QFI A;  4F4K A;  4K4W A;  1VQ4 S;  4CNY A;  4DMZ A;  3CO0 P;  4H4O B;  4RBV A;  2BAB A;  5DG7 A;  4PRF A;  5DG9 A;  1FI4 A;  2AX0 A;  1Y4Z B;  5CYM A;  4X66 J;  4ATN A;  2VOO A;  2MLY A;  2K1R B;  4GRS A;  2WVC A;  3M8Z A;  3A8E A;  4G1Q A;  4ZVS B;  3OSN A;  2VQF J;  2BQU A;  3O1L A;  4DSJ A;  4W90 B;  4F26 A;  4F0H A;  2KXN B;  4F7V A;  2CQ4 A;  3FBC A;  4CO3 A;  2VBX A;  2MZ1 A;  4HHJ A;  5KAK A;  1Q86 T;  1H72 C;  2XSF A;  3GSD A;  3EUN A;  3I0R B;  2EK1 A;  2HAF A;  3VWS A;  4KV8 A;  3OHA A;  3RBE A;  4FN5 A;  4QR0 A;  3CT9 A;  3PY8 A;  3IWX A;  1IQZ A;  2DR9 A;  1XER A;  1NPP A;  3HHL C;  1PGZ A;  1F2G A;  2LQ8 A;  2VFR A;  3DLK B;  1RAG B;  1D9D A;  3Q8Y A;  2FGO A;  2V67 A;  4M1K A;  3WDO A;  1U1N A;  1UW4 A;  4P2M A;  3T6J A;  1CQM A;  1V5V A;  3DI6 B;  3DOK A;  4MH8 A;  3TAN A;  3VVU A;  2W24 A;  2AZ3 A;  5HN0 A;  2AIR B;  2OD6 A;  5IT0 A;  3PW0 A;  3GMG A;  3CCL S;  1YVF A;  4CO5 A;  3M8W A;  4QPX A;  2YKA A;  4PYA A;  1RB0 A;  5ETQ A;  3AB4 B;  3GYX B;  2ZH2 A;  2H4Y B;  2BUN A;  2RUG A;  2DGO A;  3HFZ B;  2ZZM A;  1ELO A;  2DRB A;  4O3R A;  4ZS6 A;  2EFG A;  2GML A;  2HGN A;  2EG1 A;  2JC1 A;  2LXF A;  3PIO Q;  3M30 B;  4NLU A;  5I3U B;  1RT1 B;  1X8D A;  4C11 B;  3KWM A;  1OMS A;  2DIS A;  2V2V A;  1UJ4 A;  3FCV A;  5HVF A;  5L1I A;  3VHQ A;  4DDF A;  5DDO C;  3ZZ0 A;  2W2Q P;  4UOC A;  1BUX A;  4J37 A;  4DV3 J;  3W5Z A;  1MML A;  2DT9 A;  4G1I A;  1X9W A;  1YJ7 A;  3QPI A;  1EAR A;  1RP5 A;  5THW A;  3VQT A;  1JLG B;  1NJY A;  2E1C A;  4LRB A;  1VQY A;  4WE1 B;  5D15 A;  1UKU A;  1SH0 A;  2ASD A;  1B70 B;  2PEB A;  4MAK A;  4ETZ A;  2CQB A;  4ELU A;  3US5 A;  4RW8 B;  3RB3 A;  1GQE A;  3GYN A;  3PKM A;  1RU1 A;  1D0E A;  2MTL A;  3N79 A;  3UD5 A;  3C19 A;  2LXI A;  4F36 A;  1HAR A;  1FK9 A;  1TAU A;  1UTA A;  2VU5 A;  1WKL A;  4DU7 A;  2RF2 B;  3O5T B;  3I56 S;  4B9U A;  2CJY B;  1A9N B;  4JI8 J;  3SCL E;  2CQH A;  2GHV C;  2RML A;  5KFD A;  2QRR A;  4PPD A;  2R7R A;  2NRE A;  4KGX B;  2PN6 A;  3OVS A;  3J80 U;  3HD2 A;  1N5V A;  1KTV A;  1V6H A;  1VYA A;  3C6T A;  2E1M C;  3D68 A;  4DL4 A;  1J5E J;  1QTM A;  4F2S A;  1L3K A;  4V1A k;  3P8B B;  3KXD A;  4YR0 A;  4QPT A;  1DY3 A;  4NXN J;  3N5F A;  1M5H A;  3ZZZ A;  2LCW A;  4F4Y A;  2VIH A;  3HHL B;  3MM5 B;  4C8L A;  4RL1 A;  5F8M A;  1SJF A;  1S48 A;  3GB0 A;  2XNR A;  5F8I A;  3P6Y C;  3VCD A;  4DG1 B;  5IV3 A;  1BWE A;  2ZOG A;  1I94 F;  2CWX A;  1JLQ A;  4DR1 F;  3MEG A;  4J91 A;  3Q8Q B;  1VQP S;  1OSC A;  2LA6 A;  3V5R A;  3QJP A;  4LRF A;  3H5S A;  2XZD B;  3K89 A;  5HRO A;  3QJL A;  1UW9 A;  4WFZ A;  1Z4U A;  5IT9 U;  3CF5 Q;  1SQF A;  3FVY A;  2Z2M A;  4P75 A;  4CLW A;  2BRL A;  5CYJ A;  2O5D A;  2RS8 A;  2VC0 A;  2GS8 A;  2DR5 A;  2B7B B;  1CBK A;  1O51 A;  1VHI A;  4MYT A;  1MMN A;  4CP5 A;  1MSW D;  1Y11 A;  1SV5 B;  3BEG B;  1FKP B;  3S8S A;  2RDI A;  1ZA1 B;  2FY8 A;  2VBZ A;  3VR1 A;  3C6T B;  2ZH3 A;  3O44 A;  4JI5 J;  3UDV A;  3IA0 A;  5LMN F;  2LVW A;  2ZOF A;  3GQC A;  4TU8 A;  1GX6 A;  4USW A;  4PUO A;  1NXI A;  1Y10 A;  3UCZ P;  5LMU J;  2VB6 A;  4Y3C A; 
#chains in the Genus database with same CATH homology
 2PFF B;  2H1Y A;  3EZO A;  5CZD A;  3TQE A;  3K89 A;  1MLA A;  3QAT A;  3CJ8 A;  2JFK A;  2QJ3 A;  3HHD A;  2G1H A;  4RR5 A;  3HJV A;  2G2Y A;  2G2O A;  4QBU A;  2VKZ G;  2VZ8 A;  1NM2 A;  3HMJ G;  5DZ6 A;  3G87 A;  5DZ7 A;  3IM9 A;  3BV8 A;  2G2Z A;  3RGI A;  2HG4 A;  3TZW A;  2C2N A;  2CUY A;  3H0P A;  5CZC A;  4RL1 A;  3R8Y A;  2QC3 A;  3TZZ A;  2VZ9 A;  2JFD A;  2QO3 A;  2UV8 G;  3R97 A;  3IM8 A;  3SBM A;  3TZY A;  3PTW A;  3TZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...