3LH2S

Crystal structure of hiv epitope-scaffold 4e10_1vi7a_s0_002_n 4e10 fv complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
64
Chain Sequence
HLTEYTLQANWFDITGILWLLGQVDGKIINSDVQAFVLLRVALPAKVEFSAKLADFSGGSLQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 4E10_1VI7A_S0_002_N (T88)
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Artificial gene
total genus 11
structure length 64
sequence length 66
chains with identical sequence T, U, V
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lh2S00
1ZM4A 4ZCMA 4QR1A 3B8HA 4TNOA 5G4DA 4ZCIA 1ZPWX 4ES2A 4QR0A 2NPFA 3ZZUA 2KDOA 1VI7A 4QR2A 1U2RA 4ES3A 2CVEA 2IVYA 3B82A 4ZCLA 1ZM3A 2BV3A 2I0XA 2WBMA 3LH2S 1T95A 1KTVA 2BM1A 1N0VC 3OQ2A 1P9QC 2I8EA 1ZM2A 3B78A 1N0UA 4FN5A 1FNMA 2E1RA 4M1KA 4MYUA 4MAKA 4MYTA 3EXCX 1ZM9A 1DARA 1ELOA 2ZITA 3ZZ0A 4ES1A 3UI3A 2XEXA 2EFGA 3ZZTA 2J7KA 2L9NA 2BM0A 4ZCKA 3E3XA
chains in the Genus database with same CATH superfamily
2OPRB 2HHUA 3GFHA 3PVXA 5IQ6A 2L3MA 4B3TJ 2GCFA 2W9AA 2VPYB 3KUGA 3R2DJ 4RW7B 1RT4A 4P2FA 1HMVB 4PYAA 1UZDA 1C0TA 1SJRA 1IKVA 2KDOA 1SV5A 2F8HA 3WC2A 4OI4A 1FKOA 4Q0BA 3EMTA 3SEOA 3MCOA 4W92B 1SJ1A 1FA0A 3POTB 1VQPS 3GFZA 2DPIA 5IFMA 2C3PA 1S7HA 1IJEB 1S0MA 3B4DA 3M2VA 4BWMA 3K0JA 5BYQA 4F04B 4DX6A 1S0OA 4NLGA 2V8HA 4DZ6A 5KFCA 2VFRA 1X0FA 1REGX 2V94A 1AA1B 5D3GA 2E5JA 2RMLA 2WSCC 2GS8A 4Q2LA 5T7LA 3KMQA 4DLEA 2DT9A 2AU0A 1UPMB 1Q1KA 3AB4B 3AFGA 3B54A 5GMKa 4QBUA 3IBCB 2B3TB 4CDIA 1SKRA 4MK9A 4HVZA 3P8BB 2V4JA 3FCHA 4FPRA 5K5MA 3MGJA 4C8MA 3G9CA 2UUCJ 2O67A 1U1RA 1S4EA 2XHCA 1MWYA 2XS2A 1NJWA 2L9NA 1B0VA 4DLGA 5HLFB 2IAJA 2MQPA 4C48A 3AD7C 4Z7YA 5F8HA 1HHTP 5EN1A 4ZVRB 1A0OB 4MYTA 3C3LA 2W24A 2B4OA 2R2TA 1HBNA 1UZHA 1FEHA 4XDDA 1UKUA 3CW2C 2DH8A 3FK4A 2DNYA 5FDLB 1WF2A 5C25A 1BQXA 3HJFA 2YWHA 1WEZA 1TKZB 2RQ4A 3ENAA 3ZNUA 4DV6F 3RBDA 4CYUB 2LDYA 3DLEB 4EMDA 1PKUA 2FHMA 1W25A 5MLCV 2E1AA 2CPIA 1FE0A 1OSDA 3SSRA 3UO0A 2XLIA 4KSEB 1RLDA 3RJMB 3BN4A 2BJEA 2EG1A 2VG6A 3SFUA 4ER8A 1RCOB 1JLFB 2ZH4A 1REVB 3RU0A 2CVIA 2KH9A 4OZ1A 3D0IE 1FNOA 1RWNB 1S9EB 3NAIA 3IO1A 3KMSA 1JLQB 5CZXA 3DU6A 1RWPB 3HHLC 1PILA 2MB0B 3FVYA 2IYIA 1IQZA 1NXIA 2UXDF 1BHNA 2HHWA 1DLOB 5D0EA 4RW9B 3ZTOA 7AT1B 4JI2J 1KTQA 2H51B 2Y0BB 4FYXB 4DF8A 4ES1A 1U8WA 3VGUA 1R8PA 1V3RA 3ZZPA 4LFAJ 3S7RA 4O23A 4QYZJ 1CJUB 5A0YB 4B3RF 1K0TA 2E66A 2PA3A 4IUFA 3OJSA 3MUTP 1N52B 2BYCA 4E0DA 2K2PA 1Z4UA 2JFKA 3TA2A 1F6TA 1JLEB 1DTQA 3DCAA 1M1KT 4PWWA 1Q78A 4Y00A 1T3NA 2EPIA 4EBDA 2C2DA 1RKIA 3CIMA 3P5BP 1JJCB 1SH3A 1YX2A 5DM7Q 4RWWA 3R6GB 4WK1A 1BWVA 1S9FA 2JL9A 4Y0FA 4OI3A 2UXCF 1JKHB 3OL8A 1V6HA 1DTTB 3SQOP 2RS8A 1IBMJ 1N32F 4EBCA 2W9BA 4DV3J 2DCUB 4DN9A 2Z2MA 2CPFA 3NBPB 4ELTA 4F25A 3SFGA 2ZHAA 4BDPA 2YWKA 2XCAA 3GV8B 2ATCB 2DHXA 2NXJA 3TOQA 4NCGA 1XMOF 1M0SA 3BO4A 2CQ0A 2XMUA 3GJTB 2HVIA 3P45B 2DR6A 2BQRA 1KQKA 4OHYA 3ZTRA 4JOUA 3EICA 4OYWA 1N4LA 3RTVA 2AGOA 2ZOGA 1YJRA 1GXUA 2CKWA 3W66A 4A8WA 3GZ7A 4OQJA 2QYGA 3GSDA 3C46A 2VDHA 3DMJB 5D0HA 2VBYA 3Q24A 1CULB 4I6YA 3IRXB 4RW7A 4J7CA 1HMVA 1CS4B 4ANCA 2MJNA 5KFJA 2XULA 1D8YA 5K20B 2KM8C 2FJEB 1NZAA 4FPIA 3FJ2A 5EWEA 4UY85 3K2YA 5JMNA 4DV0F 2PE8A 1LKZA 4CO1A 2WHOA 4B9VA 4D3HA 4ERDA 4JI8F 1AROP 1N33F 1S1VB 1LK7A 1HIYA 3AOBA 2Z58B 1O6XA 3BYRA 1CJTB 2QA4S 2Q3PA 2J0QD 3PDNA 3H90A 2BE7D 2YH1A 4Q5VA 1ACMB 2K3KA 3Q8YA 4K2JA 4PQAA 1DRZA 3NOGA 3CCUS 4JYAJ 2VFSA 1NZ8A 1NDPA 4C2MA 2RUGA 1H3DA 4NASA 4FKYA 4DSFA 4WZMA 4RWXA 2GZOA 3H5UA 2M3DA 3HM9A 2W8LA 2F4FA 1X7VA 3WX4A 2BACA 1VR6A 4WU2A 1U6BA 1NDKA 2UZAA 4Q45A 1RT5B 4E98A 4PYDA 3P5TL 3GILA 2BDPA 1N88A 2WB1D 4XTTA 4NLOA 2YNGA 3DFEA 1RISA 4MIBA 3MM9B 4JI1J 4G65A 1YRXA 4QWEA 2V8DA 3LH2S 4Y2IA 4JBCA 2WCXA 3D9BA 2HQFA 1RT2B 4UTGA 5FDLA 2CJKA 4G1QB 3I0SB 1PGZA 3AH6A 4ZLNA 3LGHA 5KFZA 3DLEA 5FIIA 3QZ7A 2DYAA 3PHTA 3P4UB 4BWJA 1VFJA 2B43A 4RBTA 1YJWS 3K58A 5LJ5Y 1TUVA 3CJ0A 1S1XA 4TNOA 2MKKA 4IOBA 2BJ3A 3NNHA 4DX5A 4NLYA 5GAHU 1T7PA 1WI6A 5HJYA 2DO0A 1HARA 4NCAA 1JLFA 4DL4A 1REVA 2EFNA 3D4JA 1N8RT 1BXNA 1U45A 1JLBB 3B8HA 3M4XA 2MTLA 4OHXA 1YKWA 5D0RA 1S9EA 4PWDB 5A2QY 3VAIA 1W2IA 1FEEA 4HH1A 2D41A 4J9SA 5IXUA 1KS2A 1JJ2R 5ETVA 1FRJA 2WOMB 1HFEL 2KT2A 2R8HA 3L7UA 1CVJA 1NM2A 3OFGA 3GONA 2ZNYA 2KFYA 4GKJF 4UF4A 2RAQA 3TO8A 2RRBA 1R8CA 4RW8B 1N54B 2FVRA 3ILJA 4EYIB 3BO2A 3HHDA 2VBZA 3N0VA 2RILA 3VR1A 4DPYA 4YDDB 3ZZ0A 3QRRA 4QWCA 3M8YA 1VQ9S 2FHOB 2OEKA 3F44A 1APSA 3H2VE 2E44A 3BQ1A 3J80U 5A0YA 5CH7B 4CO5A 3CJSA 5EGYA 2DXEA 5HMWA 3K8WA 1JJHA 1LOUA 2CNNB 5A6WA 3JSMB 4KO0A 3NCPA 2NQPA 2FY1A 4TY8B 3BR9A 1KOHA 1ZPVA 2Y1RI 4IFVB 2R7SA 1X60A 1X4CA 1H2UX 2EFPA 2BQUA 4Q8EA 1JKHA 4OX7A 5I3QA 1KQSR 4JV2A 1XC9A 1DTTA 2Q6CA 2Y1JA 4UOFA 2UXBF 4DR3F 3GB0A 3GIJA 4CQ1A 3M6UA 1R6VA 2V4RA 1AXQA 4OL8A 2R7UA 5D4LA 2PA8D 2ZJRQ 5GAGI 5CYJA 1VQSA 2ABYA 4JV5F 4CO4A 2ZEJA 1VC0A 2Y9HA 1PAUB 4M5DB 4LFCF 3IN5A 2DD8S 2H5EA 2PI4A 1WDTA 2N82B 2FD2A 1QSYA 1FRKA 3SV3A 3SV4A 1TMJA 4F50A 3DDNA 4ED5A 3NGTA 1XQIA 3D5MA 1SQGA 3PJWA 3NAHA 3J81U 3BZQA 3Q8RB 3NGUA 3FUYA 3UQSA 4NXMJ 1TK8A 3BSOA 1NSPA 2GHVC 3ZFVA 1U2RA 2ZFHA 2GQ2A 1XN9A 2FJDB 1CULA 2ALYB 3IRXA 2HFSA 3FQLA 5H9EK 3K59A 3M30B 3PW0A 1CS4A 1FXDA 2ATLA 4FYWB 3DLKB 1Q5VA 2MYFA 3RR7A 4GVBB 1SQFA 1RT3B 4DF4A 2QV6A 3M6WA 3BBBA 3QJJA 1KTVA 2I8EA 1HNWJ 4Q7AA 2ZITA 4Y2AA 3N6NA 3C2PA 1CBKA 3OXGA 3N79A 1O5JA 2IRYA 2QE5A 2EG2A 2YWEA 1A6LA 2MZJA 5M2UA 4LFBF 3MFHA 2Z2LA 1FWKA 3NGRA 4WFZA 4FF4A 1X4GA 2BW2A 3SMZA 3E3XA 4V1Ak 5EX0A 4E2FB 1KNZA 1U02A 1CQNA 1QE1B 2KVIA 8ATCB 4K5RA 1SH0A 3M05A 2GGPA 5G0RB 1F9HA 1RABB 2VQEJ 2RRAA 1QSSA 4YY3J 4DV7J 1NK0A 2YXLA 3FEYB 4CT8A 1C1BB 3CDUA 2J0SD 3QBCA 2MXYA 4ILLA 3CDBA 3RB6A 2VG5B 3CE8A 2EK1A 1CC7A 2CQPA 1SJ4P 4AL6A 5HVHA 1SL1A 3JYTB 3L09A 2QJ3A 1RT6B 1SKSA 1WF0A 3C6UB 1S1UB 2J0WA 1Y11A 3MURP 3BGRB 2CNLB 3RAMA 1U8SA 4JV0A 4XDCA 1YBUA 4MTPA 3MM9A 4B9TA 4CH7A 4OYBA 3KLFB 3FEXB 1S0VA 4KKOB 3Q2SC 2LQJA 4U8VA 1RT2A 2YWFA 3R5DA 3W60A 4LF6F 4TLRA 5AXMA 2DNQA 1TFWA 3K8VA 3LAMA 4G1QA 3I0SA 3O2IA 1WORA 2L9WA 1QVGR 4FKXA 1MNEA 2H5IB 3D3CJ 2X3DA 1RI7A 5EX3A 4TQSA 1GMWA 1IBLJ 2CIMA 2LQ5A 3D6FB 3MM7B 1FX2A 3R7BB 2C2KB 1UVNA 4NLRA 5A8KB 2Z2ZA 2J9EA 2WRMA 1TK5A 2CDRB 2E7WA 1F3FA 4PEOA 4QYRA 1WC5A 3D1HA 1JLBA 2FJXA 3CTRA 1H7WA 3AD9C 4PWDA 1N5YA 2YKPA 1NHUA 1VJQA 4AXIA 2NUHA 1VRQC 2DXFA 2I38A 2ZH5A 2NREA 5JJBA 2QLFB 5HJXA 4DV1F 4F4XA 2KM8B 2WOMA 1M5VC 2HS4A 5L1JA 1RAHB 9ATCB 1PBAA 4CLLA 2QFJA 1D3WA 2YKMB 2KN4A 1GXTA 3VGTA 4RW8A 5B0CA 3W9HA 3M2UB 3UCZP 2YVSA 1CQMA 2I1RA 4DDFA 1PAEX 4ED1A 2E5LJ 2IRXA 1UJ5A 1YJ7A 3OVAA 4JV1A 3UN5A 4YR0A 4N7TA 4TN2A 2IYGA 2YPZA 4DR4J 2OFHX 1I51B 2XYPB 3J7AN 4WXOA 3CNQP 5F8LA 2XLKA 3IRWP 2EKNA 2JZ5A 2NS1B 3T3FA 3TJ8A 2UUAF 2O3DA 2FZCB 1PG5B 3FGVA 2DB1A 3TRGA 4R8UB 4ELVA 4DFPA 4YOEA 3JSMA 3ETMA 3I87A 1N36F 2U1AA 5CYQB 3VQSA 2LQBA 5F8JA 2FUG9 1RU1A 4TY8A 2D9OA 4IFVA 1WSVA 2ZM6J 1EB0A 5IQQA 3D6HB 5LXRA 1FESA 1OY9A 5CHCB 1S49A 3EGVA 4DV5J 4K50A 2JEFA 4OX9J 4JI5J 3MPVA 2Z30B 3IA0A 2FVQA 1V5VA 1JX4A 3EGNA 3N5BA 3NEKA 1BLUA 1S48A 3I4PA 5KFNA 3T9ZA 3E01A 4ZKAA 3N6LA 1SC1B 2YKOA 1X5OA 1X9WA 4KY3A 2HS3A 2PDAA 1YG0A 4A46A 1P1LA 1LWCA 1KSPA 3HSDA 4ECVA 4FVCA 3L7OA 1BD6A 3NGDA 2ZH1A 1KP6A 5KG0A 3H4DA 1BE4A 4WP9A 4LUBA 2B51A 2J9DA 4DR5F 1CSJA 5KG7A 1X9SA 1K0VA 2FZKB 2HFVA 4FF2A 5KG5A 3BQ0A 1VBKA 2B7CB 3BGOP 4YHHF 3CD6S 1YGYA 2HVZA 4PXBA 1XBWA 3IR7B 1T0TV 3KTQA 2RT3A 3N6MA 2BOAA 2WSEC 5J2MB 2K1RB 1SIWB 4DXLA 2RF2B 3DOMB 2JFDA 4LT6A 1UP1A 3AJ2A 2HZAA 1BQNA 3OTEA 1RSCA 3M30A 3BO3A 1GXLA 1M1HA 3DLKA 4EI2A 4GVBA 1TKXB 3VTIA 4NLSA 2XNQA 4PG7A 1DHMA 4QIFA 1FFSB 4OI0A 1OMSA 1OYDA 1MU2B 3VAGA 3HMJG 2UVUA 2Q1LA 1N34F 1VIOA 3EWGA 4NZ0A 1YDLA 2FQQB 4XPEA 4OHWA 1IM6A 1VRUB 2M8DB 5L8RC 3HKWA 1B99A 2DGWA 3FBEA 5IT9U 1JLCA 2D3OR 1UFKA 5CAAA 1UCNA 1ULRA 4UUWA 3O44A 3FDSA 1QE1A 2GX8A 5CYMB 3O3LA 4Y6IA 4L6V3 3RGIA 2DR9A 4MKYA 2D3ZA 1FFGB 2PSZA 3KG0A 2J8SA 1L3SA 1NK9A 3GFXA 2VG5A 2DR7A 3ELHA 1YHQS 3JTNA 3C6UA 1S1UA 2GQQA 1FRIA 2BE9B 3BGRA 4DR7F 3O6QA 4PPDA 1X4DA 3HHEA 4CP5A 1U47A 2CQBA 4KKOA 4C0HA 1JK9B 5GMDA 4USHA 4LF5J 5DGBA 2BKNA 4USMA 5DO2A 1OQ6A 2V5HG 4HH0A 3CJ3A 3QGGA 3JTOA 2MQLA 4USJC 3T6BA 5K8PA 3R5JB 4X65J 2V2ZA 3AD8C 2XZTB 3OT9A 3OV7A 4RNHA 4DS4A 3HHLD 3QJPA 3D0GE 4F0KA 1LWXA 1T94A 5F9NA 4ZVTB 5A8KA 4R5PB 2PN6A 3DC2A 3PO4A 2KKHA 4RBVA 2DHAA 1IWGA 4AQYF 3JQJA 3MMCA 1T03B 3FRYA 5LSRA 3MOJB 4DN0A 2HS0A 3R27A 2VBWA 4NRUA 5KFHA 5A76A 4FXWA 2ZH2A 3W3SA 3KK1B 3MCSA 2R7QA 1F3VA 1MMDA 5IS2A 1S59A 4QW8A 3EVOA 2KG0A 1UVJA 1FTRA 1TL1B 3MEEB 4WIQA 9RUBA 4OI6A 4OZNA 4P2SA 5IV4A 4BC7A 1U24A 1LQ9A 3CC4S 1HWUA 4NOHA 2YKMA 2AHOB 3X1LB 3R5CA 4ECZA 3M2UA 3FSYA 2VICA 1WTFA 1UVIA 1NCLA 3KOAA 1VI7A 2DPJA 2F9DA 1S1WA 4DX7A 2ZWOA 5LOQA 4F2SA 1HWKA 4V19X 1WKJA 1BGXT 2B56A 2F65A 1TU0B 1XIQA 3SCLE 1RZMA 4ZDNA 1RAEB 4X4OA 2KXNB 3ZTSA 1NB7A 1PBUA 1B70B 1ZAVA 2G9OA 1H72C 1UW9A 2R7VA 4C3LA 3D0HE 1UVKA 4QWAA 1LWFB 5HANA 3MD3A 4R8UA 1FHTA 3V2UC 1VK8A 3X3UA 2ZZNA 3EZUA 1RT7B 2F40A 1SQEA 3I4HX 5CYQA 4CO0A 3M8SA 1RTHA 2ASJA 4C8YA 2V8PA 2OPQB 4DUZJ 2AJQA 1N6QB 2HAIA 2E5HA 4LJMA 3I5AA 1Q4RA 4NLDA 3RB4A 4P74A 2WVBA 4YUDA 2DNKA 2M7SA 1S6QA 4BBYA 5EUHA 5CA5A 4DV4F 2FVSA 3BBFA 3GIKA 1OY6A 2W9CB 3M9MB 1Y3JA 4ZJQA 2BANB 4X64F 4P10A 2JDJA 3H2UB 1MW7A 3DDKA 4RL1A 3R7NB 1GAOA 2BKPA 4OZJA 1SL2A 5FJ4A 3A8JA 4P72A 1SJQA 3FCVA 2LA4A 1HNXJ 1P6TA 4RW4B 4FF1A 2IVYA 4DWIA 4NZ7A 4L3KA 1VQ4S 5DJBA 3PY8A 5DS7A 3HXMA 4TQRA 4W98A 1ITPA 3EZ5A 2F8EX 4HT5A 4C98A 3J81Y 4PUOA 4KB7A 2Q6BA 3ZXWA 2MZRA 5B08A 2VQFJ 2MKSA 4O44B 3TW0A 2HHHJ 4CO3A 2AGPA 3F41A 1RT1B 1HI8A 3KJNB 2KB2A 3ILIA 3IAS9 3PYEA 3KNGA 1U0SA 4NLXA 3MAQA 3ICLA 2F1FA 2CVEA 1FTCA 2M88A 4Z37A 2GIFA 4EWTA 4C3KA 3DOMA 4QOTA 4RW6B 1U26A 2DNPA 1X4BA 3I56S 5C7PA 2P6SA 2YY3A 1EETB 1NPRA 1S79A 2UUWA 2ZBRA 5D0GA 4HR2A 3OTOF 2MEWA 3KJVB 1EHWA 3GJRB 3NKYA 4QYZK 1PIEA 4U7CA 4OYOA 1KFDA 1T02A 4ECWA 4QIVA 3E8OA 1OIAA 3CGIA 1UEKA 1VRUA 3PR4A 5LMUF 2ZE2A 3IG1B 3C15A 1WC1A 4K0KJ 4GKKJ 1QUPA 3OJUA 3WC0A 3LA0A 1XR6A 4KTQA 4LREA 1GMUA 1UEUA 1QUVA 1MSWD 2Z4PA 2XQCA 1DURA 4PABA 3A13A 4LF7J 2AJFE 4MK7A 3NY0A 3AOCA 5F8NA 2FJAB 4DL5A 3SDEB 2WBRA 3VGSA 2R7OA 3S8SA 2XMKA 2G2OA 1YJTA 3KUHA 2W2QP 3TZZA 5J1PA 2EXUA 1FNXH 1IKXA 2P9CA 2K8GA 4ZVGA 2FGCA 3W64A 1XR7A 3I0RB 4KT0C 2CQDA 1TV6B 2XZWA 3JAMU 4LIWA 2H48B 3ZZYA 1FXRA 4JI7F 2CXEA 2XI3A 1J2VA 2HLTA 1UL3A 5LSLA 3PFEA 3ZZRA 1YK9A 2FVPA 2HIQA 2YNFA 5DG7A 2UU9F 3KLGB 3PACA 2CZ4A 1FJGJ 1RXOB 4M5HA 2YKNB 3TX0A 4IRCA 3H5XA 4NI2B 1QVFR 4H4KC 3Q89A 2ZD1B 2HWTA 1U1MA 2ZDPA 3BB5A 3NWGA 4R5PA 1BC6A 3MI7X 1F5BA 4JI6F 2ZC4A 3VZHA 3ZZOA 5M2RA 3THTA 4LRAA 3DLHA 5DG8A 3G8TA 1MLAA 4RX6A 1VOMA 2AW0A 3DI6B 2DVIA 1J5OA 2YKAA 3SQGB 3ISNC 4JI0J 3MUMP 5E3RA 4CLPA 2IA0A 1IR1A 3MHYA 3PW7A 3B6BA 4J9LA 4C3MA 4RUCA 3G6XA 2ZBIA 1EQMA 3GSIA 4DL0C 3KHGA 3C19A 1DBDA 3BREA 5GAEU 4A8FA 3MEDB 1RTDB 4CM0A 3LUYA 5F41A 2KXFA 2FLPA 3W2WB 3D28A 2KI2A 4DV2J 4KR0B 3CD0A 3ET6B 5A8RA 2RIJA 3NGSA 2OLWA 3DGVA 2MQMA 4QW9A 4X66F 3VZIA 1WG4A 2V67A 3I5BA 3NL0A 2X1AA 3EDRB 5K8NA 4IRDA 4BCAA 1LWFA 1CJKB 5CD4A 4A8OA 2B9WA 4TXSA 3GTYX 4N47A 2E5IA 4YN3B 2H1YA 5CD4H 2GMHA 3EZOA 2QGFB 2QG9B 1LEOA 3TNVA 3BSNA 2FLOA 4MFBB 3V6JA 1N6QA 5A8WB 2K7JA 2VUGA 3LPYA 4LSLA 4QU6A 1QAIA 4X62J 5MAOA 2KG1A 1NUEA 2HVDA 2IM1A 1Q8LA 1FERA 2OEJA 4YP3A 3RB3A 2HFOA 4NA2A 1PJ5A 2ROEA 2W9CA 1CC8A 2GJIA 3GR0A 2BANA 2QA2A 2B7BB 3EPIA 2FY8A 1T3OA 1FRXA 2NXUA 4DFMA 2EWHA 3J7Z5 4RW4A 5E7OB 4WK3A 1C1CB 2BXJA 2F8MA 2M52A 3DRSB 1YVFA 5CXTA 2U2FA 4I7FB 4ZN1A 5E3PA 1C4CA 1HNZF 3J7A1 5F9LA 4X84A 1GEHA 2H9ZA 3QIDA 4ECXA 1QJHA 1IKWA 4J9KA 4O44A 4I67A 4DUYF 2VJVA 3GQCA 1RT1A 5KAKA 1OPZA 2RU3A 1FJEB 2CYYA 3LP0B 1IR0A 4J9RA 3RW7A 1SH2A 4DMZA 5B0DA 1X9MA 3M8WA 4MKBA 4OZ5A 4RW6A 5THWA 3BPDA 3I55S 3BJYA 2PEHA 3GYNA 1S4FA 1EX8A 3AA9A 1HKAA 3VAFA 3IAM9 2GMLA 4JI4F 3CD5A 2DRBA 1EETA 2PMHA 1CPZA 4ED8A 2HHTA 5HMXA 3KJVA 3OLBA 4N8NA 2ZHOA 2VH7A 3N5FA 1FFWB 3TAQA 2KT3A 3TA0A 1VDHA 3CC2S 4WTYA 2KL8A 3G8SA 1H2TZ 4IQXA 1U1PA 1N0UA 1RHUB 2ADCA 1RADB 3WBZA 2J5AA 3IG1A 3BM7A 3G82B 1HBOB 1XNRJ 1SPBP 1XMBA 2V2QA 4LR7A 3CCLS 3N01A 3HF5A 1C0TB 1ROFA 1IKVB 3J7YI 1SV5B 1U4BA 1RAGB 4DEZA 1U48A 1VQKS 3TUZC 1N56A 4B3MF 1H74A 3SDEA 4N41A 4DCOB 2W01A 3IP0A 3CCWA 4NX9A 3OTCA 1R8AA 4C0BA 3ZTQA 1V9OA 2A0FB 2UUBF 4IR1A 3W8PA 1U6FA 1TL3B 3WQPA 3I0RA 1TV6A 3MXHP 4RLEA 5T7LB 4DFKA 2G1DA 4FDFA 4WYLA 2Y8WA 3DGPB 2AYBA 4EK2A 3BV8A 1RWOB 3MZIA 3MMBB 2V2KA 1YJVA 3KLGA 2M8HA 3PW5A 2CG4A 1OYEA 2EK6A 4WF9Q 2F3JA 3EE3A 3LAKA 1VBZA 2MJUA 4Y65A 1RA7A 4ES2A 2ZZTA 1B0PA 1LXJA 3M9OB 1QSLA 1IM4A 4LRFA 4NEYA 4NI2A 1OY8A 2E1MC 2LYVA 1F5CA 4HT7A 4E8UA 2DH7A 1TQLA 5IM0A 1WWHA 3OTBA 2I5JB 4ED4A 2XMJA 4DR1F 2KYXA 1NAQA 1KFSA 1EP4B 2HVHA 1PCAA 2HHSA 4NLPA 2CDQA 2KZZA 3MTJA 4G1PA 3TUJC 2BJ7A 3LWLA 2OTJS 1SI9A 3ZNJ1 4NYPA 1D9FA 5C25B 3HT0A 3NP5A 4M5NA 3DI6A 2EVZA 3OL7A 1KDNA 3MM5B 3MMJA 4A8QA 2IMOA 3SCJE 4AL7A 1L3TA 3Q22A 3FCWA 2GC8A 2KT5A 2HG4A 3CDAA 4LF8J 1FK9A 2CPJA 1RWMB 4URGA 4AUKA 4LRCA 4LF4J 1KN6A 1K8AT 3PYGA 5KFMA 2PMZD 2GJFA 2H5JB 4FNIA 2VV5A 4F67A 1KVJA 1TUGB 4DHVA 4GO5X 3MEDA 4A8SA 4OX6A 2C1EB 3R3TA 3KLHB 2ZH7A 1I94J 1RTDA 1JXLA 1RWUA 2HQ3A 4Y2MA 5F0UA 3GCWP 3OFEA 2ACYA 2WSFC 3W2WA 1H98A 3HVWA 4OZ0A 5DZ6A 2MY7A 4ZP8A 5DG9A 3Q8VA 3ZZTA 3IGVA 5D15A 3AB2B 1JQGA 1FKAF 1WG5A 2HNDA 3KG1A 4LSNA 5LSOA 2QLXA 5J2NB 4B3SF 4RJVA 3DRPA 2XMMA 2BRLA 2VG7A 4DR6J 3QT6A 5KFGA 1CJKA 2X3GA 2KTQA 1S72S 2GAHC 1MROA 2F4VJ 4B9LA 1S0NA 2YPYA 5BR8J 3P96A 2R8KA 4OYIA 3JQKA 2RE1A 3S6EA 5IT0A 3O1LA 3MECB 4LBHA 5K8OA 3TARA 4MFBA 4DR2J 3GYGA 4DL7A 5GADU 1PC5A 2CPHA 1NNDA 5E41A 1J5EJ 3ENVA 2DNLA 2J7WA 1S76D 2NXEA 3A8KA 1MWQA 2P6TA 4K4TA 2DISA 3C66A 2MY8A 4OIXA 2CA9A 2R8GA 3GV5B 1D1UA 1RA6A 1DTQB 4O3PA 2ZVIA 2XS7A 3GG1A 3LO3A 3ILOA 4FVMA 1SC4B 1C1CA 3BN7A 1WNEA 5I42B 4LR9A 4PXCA 4ZVHA 1MN7A 2KVQE 2W7OA 3KLVA 3MPUB 4RPFA 4KJIA 3DRSA 2CQ4A 4DPUA 5F8GA 2DRAA 4KGZB 1M5HA 2DIUA 3KLEB 3BPSP 4QIWD 3D54A 3LOUA 4PAAA 4Q8FA 4ICLA 5KFAA 5ETOA 4J9UE 2HURA 1RBLA 3LP0A 4JI3F 2VF3A 1IWAA 1RAIB 1Z2LA 4KHPF 2GVZB 4QIGA 1EZZB 1KD1T 3SZ2A 3G96A 1VGYA 2AZ3A 1U2CA 4M63A 1UWBB 5AT1B 1X4EA 3UDLA 3HFKA 3TJ9A 1AYEA 1F1BB 1HA1A 2HHQA 4F0HA 2XY7A 5CCMA 3JSBA 5J1NA 3MCNA 5ETSA 1H7XA 4F4YA 1IBKF 2QLWA 3OL6A 2BZ2A 3T5KA 3W65A 4HI2A 4BS2A 3CJKA 2B4UA 4B3OB 2NLWA 3BYPA 3NNAA 1FXLA 3PIOQ 4NE9C 2XS5A 4PR6A 1Z2ZA 3G82A 1HBOA 2DIVA 2CNOB 3DN9A 2XMWA 5F3TA 2LMIA 2E1RA 4MYUA 4KHMA 1LWEB 4ZS6A 2AJ0A 1YJNS 3PJ9A 1RHMB 5HSPA 4H4MB 5FLXU 2Y1IA 3OSNA 1AUDA 2WTFA 1HHSA 2MZQA 3MAAB 5KOWA 1A9NB 5E2QA 2OEMA 3MD1A 2GNKA 1VISA 2FJWA 3LPEA 2LDIA 3VF0B 3PXGa 3GYXB 1J27A 5BYRA 3PKYA 2O1PA 3WIUA 2QMWA 3BKTA 2JHEA 3JAMY 3HK2A 1TL3A 2V4QA 1YTYA 4WP3A 2CAJA 2QZ8A 3BH6B 3TVYA 5D6GA 2CQHA 4NLWA 5F0WA 5DZ7A 3CEDA 4DV6J 5M2PA 1RAAB 5IV3A 2GQCA 4DSKA 3DGPA 2WZ1A 3HD2A 3MMBA 2CJXB 2VKZG 5HATA 4ENOA 2HQGA 3K5OA 3KWMA 1N5TA 2B4PA 1SJFA 1NEEA 3CJ5A 2G2ZA 4KH1B 1WSRA 1S5ZA 1RWVB 4A8KA 4OI2A 1ICEB 3QT7A 4YB1P 2I5JA 2YNGB 4YB6A 1LW0B 2NYIA 4PCQA 5KFVA 5IT4A 1EP4A 2B5JB 3CDWA 4J9NA 2MHEA 2MKCA 1YSJA 3H7HB 2HK2A 5LJ3Y 1HHQA 4ITSA 4KQZA 2A6MA 3HT3A 2N3LA 2E7XA 1QY7A 5IOLA 1X8DA 4DU7A 2UXDJ 2YNHB 4UQTA 4O4RA 3DLBA 5L9XA 3MM5A 2C2ZB 3LALA 1UJ4A 2QRRA 1WELA 2HBYB 4A48A 3MM8B 5HMZA 3V6DB 1F0XA 1NH7A 1TVRA 1S1XB 2H65B 4IYQA 5KG3A 2FHJA 2ILYA 1RTIB 4C6AA 3NS7B 3GU0A 1KRPA 1DQ9A 3TAMB 4ZLJA 4ZVPB 1HR0J 2NCKL 3KXDA 1S7IA 4R25A 1Q8KA 1M5OC 2HFUA 4FN5A 4L76A 3KLHA 2FVCA 1QAJA 3EYZA 4ED3A 2RHSB 3UDCA 1S1TA 1RWXB 5KTQA 4RU9A 5DDOC 1BUXA 4B3RJ 4N76A 5B09A 4QIEA 4IFYB 2ASLA 2DKOB 1VRTB 1BWEA 5J2NA 1RWKB 1R0BG 4LQ3A 4UQGA 2WVFA 4WFBQ 4RNFA 1JWWA 2D9PA 2HQCA 2BABA 2K06A 4USUA 2VL1A 3MFIA 1GTEA 2DNZA 3PRDA 4Q43A 4YR2A 1GT8A 1X31C 2AT1B 1VQYA 2EEYA 4IH7A 3WHIA 4ED6A 2DJWA 2CQ3A 4AFFA 2UXCJ 4ALZA 4ZPWR 3LTOA 3MECA 5B0BA 3K5MA 1M5SA 1HR0F 3EJMA 1P27B 4UUXA 3HVTB 1N32J 2VFVA 5DRKA 4PPZA 1FD2A 3VGVA 4L75A 2LXFA 3M8PB 1B0TA 1UVLA 2ZDOA 2FTRA 2ZH8A 2JLGA 3L3CA 1KLNA 4ZOSA 5C2CA 1XMOJ 3CIZA 3J81j 5LMNF 4FYVB 3CMAS 4DG1A 2BMBA 4KO0B 2DNNA 3R97A 4H4KA 1WACA 4X4TA 2JRSA 5HN0A 2HMIB 3QO9A 3V4IB 2ZWPA 3IGNA 2JVOA 5I42A 4I64A 4KRWA 3PRBA 1S77D 1IVZA 5KG1A 5KFUA 1NMEB 3KHRA 3KLEA 2YKQA 2V9KA 3GIIA 3TA1A 2R8JA 4UW2A 2MKHA 2QT7A 2J7KA 4LRDA 4TYAA 2IBOA 2DHSA 4LBPA 5SUHA 2R2RA 1LFWA 1NSAA 4D3GA 2DITA 3NNCA 1SC3B 2EFVA 2YBVA 2GVZA 2DY9A 3NCRA 1FE4A 3B4MA 5ETKA 3G71S 3PEJA 2AYMA 5AE3A 3LW5C 4M5JA 1Q81T 4USIA 1UWBA 3GCXP 3QNWB 4GRSA 5KT6A 4DV0J 1D9DA 4I56A 2VPWB 4JI8J 4HDGA 1N33J 2PGCA 1Q82T 2IM0A 2IVFB 3KHLA 2G1HA 4J9VA 2B9YA 4B3OA 1HQEB 3RAXA 4DJBA 2MLYA 3UNYA 2MZ1A 2ZBQA 3MR2A 1FRHA 1FT8A 4C8NA 2VFUA 1RB0A 2DCLA 2IA6A 1LWEA 1YIJS 2XWXA 2MSTA 2BE2B 3EXYA 7FD1A 2A6OA 4H4MA 1XNQF 2N4CA 2VB6A 1VJWA 1Q95G 2ZBPA 5EWFA 4ZPTR 3MAAA 3QLHA 4ECTA 2HHPA 2ZVSA 1JLGB 1X5PA 2RD5C 1HI0P 3TUIC 4CNZA 3DXBA 4P9SA 4ZHRA 3QSIA 3VAJA 3MOZA 1N48A 1Q0NA 4OV1A 1HWLA 1NJIT 2PIIA 5IWAJ 4N8OA 3H5YA 5GMEA 4TYBA 3UDEA 2HQIA 2GGPB 4ILRA 3DNCA 2J76E 3WX8A 3THVA 2VODA 4ZCLA 1GK8A 2K3IA 2W2MP 4ZVFA 2XGPA 3K5PA 3CCZA 3PYFA 3CCES 2ZOFA 1NRKA 3DLJA 1MMNA 2NPFA 3LWMA 2W7PA 1RAOA 3VAHA 3CCTA 1KR4A 1ZAXA 5B0GA 2ERRA 1EKSA 1Y5NB 5J2QA 1LW0A 1AW0A 3DXSX 1PC4A 2G0IA 2B5JA 5IZHA 1FJ7A 1RBOB 2C3OA 4HLBA 4CLTA 3OPKA 2A1BA 3HD1A 2X51A 4K5SA 1UFLA 2B4VA 5CQGA 5IWAF 2YNHA 1XEZA 2M5YA 2OMLA 4GKJJ 5ETQA 5B7WA 1H2VZ 3DHWC 2HRUA 5ADZA 3UVJA 3MMAA 4YB5A 2N3OA 4ZLLA 2HRYA 3MM8A 3V6DA 1WJ9A 1YZ7A 2EI5A 8AT1B 2VJUA 3AQPA 3IS9A 1HNVB 2Q79A 3M6VA 3PG9A 4X4NA 2IVMA 1RTIA 1M5PC 5KG4A 4U95A 3TAMA 4ZN3A 4M94A 3OR1B 2VFTA 5JXSA 1O8BA 4OLOA 2QSWA 4F02A 2QC3A 1N5YB 1QTNB 4CH0S 1RAFB 1NKCA 1OPIA 4LBIA 2KFZA 4DQSA 2DTJA 1JLAA 2DGVA 2OI2A 4IFYA 4YMEA 1VRTA 1H73A 2CG8A 3KG4A 2V68A 2E1CA 2XTJP 2MQOA 2DNHA 4YS2A 1K1SA 4DSEA 3CJTA 4Z7CA 1HD0A 5C42A 2DR8A 3CSKA 2W2NP 4KV8B 2IJNA 4ZVQB 4CRJA 1DQ8A 4CI0B 3SSSA 2NXCA 1SL0A 4FF3A 4J9PA 4URQU 2VPXB 2LXIA 3GJQB 2KU7A 2UXBJ 3D1OA 1NO8A 4DR3J 3GWCA 3VWSA 1JXEA 2ZKTA 3HVTA 5KG2A 3NOCA 4MT1A 2RUSA 1YJUA 3M32B 4DOZA 4IG3B 2PD1A 3L9ZA 3M8PA 2HGMA 2MMYA 3QT5A 1X5TA 3CMES 4UOGA 3CDEA 3IMQJ 3Q83A 4C11B 3Q8PB 4JV5J 5FD1A 2UVVA 4LFCJ 2GJ2A 4QWBA 2O5DA 4OZ3A 3DYAB 4UY8T 1UEVA 4JB8B 1Y7PA 2HMIA 3IWNC 1D9AA 3DLGB 2FJVA 1I5OB 3A3PB 4ZCIA 3V4IA 5KFOA 3MPYA 1FX4A 3VCDA 2BQ3A 2WVCA 2BX6A 1R89A 2J7UA 4ZPVR 4ID8A 4M5LA 4P6QA 2HBQB 3IXQA 3CO0P 4GMKA 3BS9A 1H6KX 4IG0B 3E01B 5D4PA 4NXNF 1RLCL 3M8RA 4H54A 2BR0A 1L3UA 5H1SV 3S01A 3PX6A 3O5TB 3KK3A 2VA2A 1XERA 1LWCB 4AYBD 1VC6A 4TU7A 3PM9A 4XIUA 2ZC3A 2W7AA 2W4DA 5AJ3F 2FIUA 1Q5YA 1D8ZA 2N7YA 3VAKA 3BGUA 2OPPB 1FJCA 1P9YA 4I6AA 3T1YF 3UDVA 2BJ1A 1U1LA 4LFBJ 2RSQA 5H9FJ 2NXNA 2EFQA 1NHKL 3SCIE 3HZGA 1M5KC 2KHDA 2KFNA 3CULA 3A8IA 1HQEA 4A47A 1I3OB 3NCQA 4EZ6A 2OUGA 3DOLA 3TZXA 1Y3KA 1BMQB 1FI4A 4QJVA 1BQNB 1V5IB 5C5JA 2R42A 5FLXY 4NA1A 1URRA 2IJFA 1M90T 3KKFA 2BE2A 2L48A 3CPWR 4DU8A 1NDLA 3EXCX 3HLUA 1NJXA 1T9XA 3HJVA 3QWPA 1IKYA 1JLGA 2DGUA 4HDHA 4F4KA 1S6PA 2ZOMA 3I5CA 2RQKA 1RTZA 3CO9A 4B08A 5HQ8A 1JLCB 1VQ8S 5GVQA 4L73A 2AZ1A 2D3UA 4DL3A 1ZA1B 4ZVSB 1T9YA 4LF6J 3N4WA 3M2RB 2I6WA 4CLSA 4KPYA 3W2VA 5F8IA 2XEXA 2EW9A 3C14B 3EUNA 2ZZMA 3KUEA 2RDJA 3G6ES 1WC3A 2ZHBA 1CEZA 2GW8A 4LF1A 2OD4A 1T9VA 1VIXA 1M1GA 2KJWA 3EGWB 1E6YA 4LF9F 2P8IA 2UP1A 2XGQA 2RRNA 3AT1B 5KFPA 4H4OA 1HW9A 2L08A 4X4QA 4G3IA 2JLEA 4WFYA 3UWTA 2QA4G 3GG0A 2L9DA 4URSA 3HZEA 2OKQA 2V8GA 4KAIA 5AE1A 4DV1J 5F3ZA 5KFLA 2M70A 2YWGA 2G4BA 1NB2A 3HDSA 5T41A 3W62A 2ZH3A 3T41A 3BBCA 1FKPB 2HIYA 2QTWA 3W5XA 2XC9A 1HNVA 2CZVC 4LIRA 4K4SA 2OELA 4ZIWA 2JEGA 5HP1B 1XMQF 3UPFA 1UPPA 2I9SA 3MMCB 3OR1A 3KYLA 3HVRA 4NYOA 3PO5A 4ZPDA 2AEJA 1T11A 1D0EA 3SCKE 5E3AA 3JQMA 2ZBCA 8RUCA 2UUAJ 5LM7E 3NMRA 2D74B 3FBBA 2LECA 1X4AA 4BC9A 3T9NA 2QMXA 2J6SA 3T1HF 3V6KA 4EZ9A 1N36J 2R2UA 1Q8IA 2EBEA 3R2CJ 5LXYA 1U1NA 1VQ7S 1RACB 3VV2B 2B9EA 4EO6A 2HK3A 5KT4A 3CT9A 2AIRB 2A2CA 3QWUA 4KV8A 4B3TF 1WHXA 3T5HA 2CPDA 3NS6A 1S1WB 3I6PA 1FVQA 2CJ9A 2JJ4D 1YQHA 3FC9A 4I6WA 2XWYA 1EAYC 3WDOA 2LLZA 2L41A 4DZDA 5DQGA 3M32A 2DEJA 4IG3A 2AJ4A 2CRLA 4ETZA 4I2PA 4U7UK 1VHIA 5BYSA 1T8EA 4KHRA 1RK8A 4C11A 3TP2A 2OP5A 1GQEA 3QGPA 3C16B 3Q0AA 2KXHA 1RJJA 2C2EA 3BSCA 3DYAA 4O3NA 4F0MA 4USWA 1N5VA 2ZKUA 3GJSB 3DRYA 3CVKA 4DR5J 1RTHB 1FCAA 3DRRB 1Q7LB 3DLGA 5HROB 4YHHJ 3PIPQ 4I0WA 4DPOA 4M5KA 4PXEA 4EBEA 5T14A 4N5SA 1SIZA 2O66A 4Q44A 1S6QB 1GMWD 3B82A 1UW4A 3BH7B 1WOPA 5DLGA 1NJYA 3BGLA 2C2OB 2UUCF 2JC0A 3PR5B 1YWXA 1S9GB 4K4XA 2DGOA 4IG0A 1U1QA 1B7YB 2FHKA 1NJZA 1G2EA 1T95A 2JH3A 4ZP9A 3QSYB 3QAEA 4NLTA 3TVZA 2XCPA 2X1GA 3PX4A 3VAMA 4PQUA 1N34J 1HYSB 1TFYA 2XM3A 1F5AA 1AFIA 2OPPA 3S1TA 4PUOB 2LEBA 3NRBA 2AJ1A 3IBWA 2R7XA 4X4RA 3OBIA 1WC0A 1NU4A 2F9JA 4FYYB 3NS5A 3K7RA 2VKRA 2QL7B 4I4BA 4KFBA 4PKDB 4CT9A 1R27B 3QFWA 5J1EB 2XMAA 3LGNA 4WFAQ 2G13A 3QFHA 4P52A 4ZMMA 2C28A 5IC6B 2IFXA 2W25A 4PXDA 4F4AA 3FFIB 4U7UD 2AV5A 1ZA2B 3RG6A 3QZ8A 1HBUA 1Q53A 1FWLA 3KJQB 4A8XA 5KFFA 3OLAA 4RUHA 4DR7J 4MIAA 1WHVA 3VQTA 1C0UB 2ZE2B 3C15B 1B3TA 1AZSB 3A1YG 1YI2S 2MQ8A 5L38A 2ALZA 2R3VA 4LVOP 2HHXA 3ENWA 2VOOA 2UUTA 2DNOA 3M2RA 1V3ZA 4DL6A 4A4JA 4JI2F 2X7IA 2AQ4A 4B9NA 3N28A 4DSIA 1VK3A 2MLZA 3C14A 2I0XA 3A8EA 3JSYA 3B78A 2ZNZA 3TEHB 2KHCA 4EU0A 4XK8C 4LFAF 3NMAA 4O0NA 3ZTPA 1L5UA 3OD2A 4AQYJ 1RUSA 3K89A 1IKXB 1GNKA 2C3YA 3UE2A 3U7JA 4WJBA 4KH0B 4ELUA 3T19A 1AFJA 2NZCA 4PG4A 2ZH6A 3MR7A 4G1IA 2B9XA 4TLQA 4R0JA 4CCHA 2XY5A 5KT3A 4WE1A 4JP8A 3AJDA 1U6ZA 3FRZA 5KFXA 5C24A 2C3UA 1YJ9S 2YNFB 5HO4A 2PFDA 1VMBA 4XPCA 1OWXA 2CADA 2QL5B 4O3OA 4P7TA 4LSZB 3DU5A 2OPSA 4HEA9 1FDAA 3T5JA 3DM2A 2DBBA 2OPRA 1QTMA 3AA8A 2W2OP 3QGHA 1HPZB 2DO4A 4ED7A 1FKPA 4F3QA 4WCEQ 1Q86T 1W26A 1R0CB 3UR0A 1IBMF 2E9RX 3A4TA 1YZ6A 5HP1A 4DV3F 1CG2A 3NG8A 4C8OA 5F8MA 2DR5A 3IBFB 3AXMA 2JLFA 5HQMA 1J5OB 4GVLA 3POTA 2P2CB 3AY0A 3Q23A 1MG7A 2XMVA 4C97A 4QQBA 2JNJA 2HBRB 2IC3B 6AT1B 3QIPB 2Z56B 4J91A 2WONB 3KJFB 4C8ZA 2OAUA 2WBMA 2BBEA 2BM1A 3OSPA 2BJ9A 5ETRA 4WKRA 1PJ6A 2HFNA 2C42A 1SC6A 4RNMA 3DHXA 2HGNA 3R6LB 4G6VB 4O3RA 3UCGA 2DNMA 3MWBA 2C2RA 1JXVA 2NUUG 5J2PB 4DV4J 4QZVB 1WOSA 5A8RB 4X64J 2AMCB 3J80Y 3MPWA 5U47A 2DY1A 4C4WA 5KFQA 1Y00A 2YTCA 3LF0A 2Q43A 5HLFA 1RAJA 1K47A 2CUYA 3EX7B 1O0PA 2KO1A 1OQ3A 4JUZA 4YFUA 5DGAA 3C16A 2DK2A 1YITS 2BRKA 1G3OA 3H59A 5E3QA 1HI1A 1EARA 2RKIB 4EGLA 3CCJS 5KFEA 2Z2YB 3W7BA 4M8LA 3CCSS 4U6PA 3JB9k 3DRRA 5HL7Q 1R8HA 5HROA 3CMQA 1TKZA 4RUBA 4J37A 4RR5A 4Y2CA 1FDNA 4CYUA 4LSLB 3D66A 4JYAF 2WK4A 1NH8A 3CCMS 1GFWB 3H40A 5KFTA 3QAUA 1HW8A 1UTAA 3RBXA 2IMWP 3U27A 3D6TB 2XZDB 2FYXA 1JNRB 1ZZFA 4XAKA 1X4HA 1S9GA 2UV8G 5HBMB 2B6AB 1QM9A 2CPYA 4FS2A 5HAOA 4DCPB 4OV6A 2MPUA 4OX8A 1WHWA 4K2XA 5DQIA 4NLVA 2HBZB 2VHGA 3OTOJ 1JJ4A 4A8YA 4EYHB 4KGKA 4JI1F 3BQ2A 3H98A 1W7WA 1JLQA 3PNIA 5D78A 4RZRA 4CIOA 1HYSA 1KVIA 3HCXA 4CLUA 2QA1A 1FVSA 1BY9A 5LMUJ 1IKWB 2LQ8A 3A12A 2HLUA 5D4OA 4PG8A 1S12A 1PYSB 1DLOA 3SIPB 4RW9A 2AYGA 2JX2A 4ZK7M 5L1KA 4IRKA 4P2XA 3A3OB 5J1EA 2H3EB 4B9UA 1U7LA 1S97A 2AF6A 4WYWA 1F60B 1IBCB 2H4WB 5EDWA 4RUAA 4CLYA 4TU8A 3FFIA 2P5VA 2V69A 2A10A 3SBMA 1NDCA 2ZUAA 2M4MA 1CJUA 1SKWA 4C8LA 3PTWA 4C9DA 4USVA 5EHHA 3V4MA 4JI7J 4LQ9A 1C0UA 3D1QA 1AZSA 2A3JA 1S6UA 1JLEA 4ID5B 4TVAB 2WW8A 2UU9J 3UW1A 3CJ4A 2CQIA 3FZBA 5KFIA 2CPEA 3M7VA 2NYHA 1VQ6S 4OZLA 2AWZA 4ZVEA 3TX8A 2A2DA 1TKTB 2OD6A 3G86A 3HFVA 2DGSA 2J0XA 1K44A 5CZVA 3ULHA 2VU5A 2NZ4A 5DLFA 1WEXA 3KDOA 4F4ZA 4O4GB 3MUVP 2QO3A 5CCLA 2IM2A 4WP8A 2QLBB 2G0JA 2C3MA 1UWAA 4NCBA 2IDLA 4JI6J 1FDBA 1G7CB 2BA9A 2HSEB 4W4MA 3UI3A 1X0PA 4YEAA 1Y5LB 2R7TA 4DQRA 1S6OA 1YBAA 5GAGU 2XYGB 1B4SA 3NBPA 2ILZA 2IIHA 1MN9A 2V8VA 2DXDA 1IN0A 4CWBA 2N7CA 3CCRS 5BXIA 4CZCA 4WXWA 1JMTA 3TQEA 3BEGB 2KRBA 3D6MB 1HQ2A 1XR5A 1HPZA 2IY5B 4C0OC 1VS3A 5CABA 2RQCA 5B0EA 3Q2TC 1C4AA 3HHLB 5IM0B 2XO6A 3F0NA 3DMJA 2MKIA 3BF4A 4QU7A 2YNIB 2IHR1 2BEFA 4KBIA 1R7IA 3OR2B 3AJ1A 4O3SA 4S0MA 2GHPA 1FD8A 4NWBA 2CQ2A 2LA6A 4FP9A 5ETLA 3VHQA 4O0IA 2XI2A 2LXUA 3D7SB 4X66J 3WIVA 2J6TA 4PZVA 2M9KA 3QQCD 4X4UA 1HQUB 1LV5A 1Y0HA 2IC3A 1U1OA 1FK9B 1NPPA 1S1VA 1ZBTA 2YX1A 3QIPA 4A8MP 2Y1LB 2WONA 4L74A 3TZWA 1CJTA 2GHWA 1P1TA 4NXMF 2CZ9A 4M5GA 4Y2KA 3RB0A 3D3BJ 6FD1A 3N9UC 5GAEI 4F2RA 1X5SA 3H20A 3Q8UA 2GAGC 1U1KA 4ED0A 3MDFA 4CLKA 1Y10A 5J2PA 1IJFB 2MDAA 3MM6B 1R6YA 4DSLA 2HNDB 1PJ7A 4UOHA 2VDIA 4LSNB 1Q16B 2E1PA 1HNWF 1RT5A 3DRPB 3MAHA 1S10A 2VG7B 1A7GE 3R1LA 2QEXS 2GO9A 3HP6A 2GFFA 1MROB 1PSDA 3TUPA 4K4VA 3HSGA 2RKIA 1SCJB 1E6VB 1RHJB 4ZIVA 3IC1A 2RJZA 4DUTA 1TL4A 1HNZJ 4QCLA 1W2BR 1F9FA 1AT1B 1TR0A 3K17A 2J6UA 3P3DA 4DUYJ 4MMOA 1K1QA 2FJBB 3MR3A 3CXCR 2VQEF 1UA0A 4YY3F 4DV7F 2BW7A 1MMLA 2E5GA 3HVAA 4GC7A 3C8YA 1WF1A 2NR0A 4OYPA 4YDXA 2FZGB 4IH5A 3FMWA 1NK7A 4UZBA 5HBMA 3RUBL 4WFNQ 3ILLA 2B6AA 1ZTWA 1GH8A 4F3MA 4JI4J 4F26A 2H4YB 3TVKA 4NLUA 4K59A 2ROPA 5I4MA 4CH1A 1KC8T 3I96A 1PO6A 2ACMA 2V50A 2F63A 2Z57B 1WDDA 1S99A 3EVMA 1HL6A 2HQDA 2LFVA 4FXVA 4RKUC 1HBMB 4ICLB 1EIYB 2QYCA 3M8QB 3IR6B 2Z0GA 4ZA1A 4AE5A 4F36A 1VC5A 3PZPA 4J9QA 1NK4A 3PW2A 1IBLF 1IR2A 2PI5A 1RDRA 4OZ2A 4B3MJ 3U1LA 1IXKA 2OH2A 3SXLA 4RU2A 1KHWA 2DGQA 1TMMA 3HKZD 4OJHA 2XBPA 5ETNA 3HHKA 1Y5IB 5KFSA 4WFXA 2RU9A 2UUBJ 3OXLA 3GMGA 3PEHA 4OJ3A 1SVDA 5HI7A 2CWKA 4CLFA 3CJKB 3KHHA 3NXZA 3VVTA 1NPKA 3KFWX 4KPCA 2YX7A 1TL7B 4HHJA 5IT9Y 1TL5A 2RQMA 3LP2B 2C2NA 3CCQS 3TZYA 1TP7A 4NMXA 1SJ3P 4ID5A 2XY6A 1VCTA 2JC1A 2FPHX 2D69A 3ZZUA 4ZJOA 3DRXA 3I82A 3RRGA 3E51A 2AJ2A 2Y3YA 3CJ2A 1FDDA 1MWZA 3F73A 2DNRA 3LGMA 1NK6A 2MQQA 1WTBA 1TKTA 2R8IA 2A18A 1KOOA 1RE1B 4Q2MA 3M1VB 1RBAA 2IM3A 3PYDA 1XK8A 1F2GA 2E5LF 4MKVA 4P73A 2QSFA 1RU2A 5K14B 2GO8A 1KONA 3U1MA 4O4GA 2CQCA 3MCMA 4ZP7A 1DARA 1ELOA 4DR1J 4DR4F 1VLOA 4I1TA 5KFWA 4PG5A 1S57A 2FB0A 5ETMA 1SB6A 2DH9A 2EC0A 4MH8A 4Y28C 1VHFA 4MJKA 2OO4A 3UFCX 2N4DA 2VC0A 2RVJA 4K4ZA 2DGTA 1RWWB 3W1YC 4B9SA 3R9LA 4M5DA 1H0HB 5E3CA 3GV7B 1LNQA 3DLLQ 1UETA 2FLLA 2XMTA 4K8RA 3G2XA 3BDEA 2UVWA 4QWDA 5H9FK 2QX0A 2OSRA 3US5A 5SZTA 2RS2A 3QATA 4U9RA 2NSCA 2ZM6F 3LQVA 3GFYA 4ECSA 1ZETA 1ZPWX 2MHNA 4QR2A 3HHNB 4ZLPA 1P9QC 1IUJA 4DV5F 3UCUP 1ZM9A 2YQ0A 4OX9F 4JI5F 3HHLA 3PFOA 2FC8A 1DFDA 1HD1A 2CJQA 2YNIA 4F3OA 4OLPA 3OTDA 4I2QB 5L39A 3OR2A 1N5SA 2O01C 1DQAA 1LW2B 1GX5A 3FSXA 1XWLA 1RT3A 2HWIA 4IO1A 2HNYB 2MSSA 4B3SJ 5B0AA 3MEGB 4KC5A 4DX8H 3FKBA 3RAQA 1B7FA 3T6JA 4XO0A 1HQUA 3HULA 4Y34A 2OTLS 4Z2XA 3J7ZT 2CJYB 5D8HB 3F56A 1TVRB 3PJXA 4X4SA 1ZYQA 2M2BA 5KFDA 1T9WA 2POKA 1WC4A 1NLKL 4M1KA 1ZTTA 3I32A 1HNIB 3C6TB 5E0OA 3W5YA 3LANA 3OHAA 3Q86A 4TKTA 2PT0A 4GC6A 5G0RA 2VPZB 3R5BA 1WC6A 3IM9A 1VQOS 4OJ1A 3NWRA 3SI8A 1S1TB 1C1BA 4UZCA 3MR6A 3CJRA 4L3NA 2EKYA 2F7VA 4M95A 3MM6A 2LQ9A 3KK2B 3JYTA 4ECYA 2KYZA 4K4YA 3BGFA 3CJQA 1NK8A 1RT6A 4OYZA 3R5GA 4ED2A 3P6YC 2WW4A 2UV8A 3IFEA 4USTA 3DKDA 3FSIA 4CM2A 3A3NB 4QPXA 2R7WA 5HK4A 1XTZA 3VALA 1E6VA 3FMBA 3OVBA 3KLFA 1YRTA 3AODA 2LCWA 4F7VA 3RRKA 4ZPBA 4FZVA 4NPOA 2FC9A 1QAXA 4FNHA 2V2VA 1V3SA 3WZ0A 3FZ2A 2J9DE 1ZM3A 4LRBA 5GADI 4JI3J 3JS9A 2C22A 2PC6A 2VC1A 4P2MA 3BSAA 5AXKA 4KHPJ 1H38A 3W61A 6FDRA 2XG8A 2ADBA 3AXKA 2HKEA 3UNGC 3MM7A 1Q8BA 1KHVA 3PX0A 2V63A 2RHQB 2AD9A 4I69A 4DG1B 1JIHA 2M0GB 2W4PA 2LEAA 3CCVS 2VBXA 4O3QA 2BOPA 4ATNA 3GLJA 3QO9B 4AL5A 2BUNA 1IBKJ 4HTJA 3TI0A 1XJWB 1KEKA 3ONQA 1LK5A 2ZH9A 1KLMB 5DM6Q 2CPXA 4B17A 3BKUA 1VQNS 3MR5A 4PRFA 3G6VA 4DQQA 3QRQA 4LF5F 1TTHB 3ZC4A 4DI6A 1HBMA 2FDNA 1GTHA 1X4FA 3IR5B 2WVDA 3M8QA 3Q8QB 2BVZA 3H5SA 4DBQA 2HW3A 4KGMA 1QLNA 4X65F 1T05B 4FXDA 4HTIA 5DQHA 5DDRC 3K5NA 4IKAA 1QDUB 4NL5A 2OFGX 1Y9OA 4IDKB 4NMLA 3PRVA 3H2LA 2OHDA 7FDRA 4IOCQ 4BHQA 2HPUA 3V6HA 5KOXA 3UD5A 1TKDA 3T1AA 1CLFA 2K7KA 2J9CA 4L72B 3SSQA 3U02A 4OYXA 5IC4B 3TANA 1TL7A 4DQPA 3VVUA 3NLCA 3LP2A 3HFZB 3R7SB 4EEYA 1U0HB 1UJ6A 5DDQC 4CTAB 2R4FA 4P75A 2DNGA 4ZJLA 4LF2A 1KBRA 2IDEA 3OW2R 3GIRA 3OL9A 3M6XA 3M1VA 1OJ4A 2MKYA 4EFAC 1UMJA 1FRMA 1Q7YT 1DZ5A 3QLHB 1Q79A 5K14A 2ROGA 4WU3A 3MPDA 4CNYA 4DL2A 2DHHA 1WKKA 2H54B 3I9V9 2GVDB 3IWXA 4OMFG 4DPXA 5HVFA 4ZHRB 2CQ1A 5AXNA 1WG1A 2GIQA 3R5AA 2HHVA 2IRUA 5KFKA 3TYTA 1HWJA 3W5ZA 4RBUA 4K4WA 5K9FA 3P49B 2JEJA 5I3UB 4CO2A 5G4DA 1EKRA 3UD4P 4MK8A 3CB4A 3GR1A 4DUZF 2GIRA 2ASDA 4P71A 3QMQA 1F2HA 5KG6A 3OVSA 2EFGA 3UN3A 2YH0A 5J2MA 3ISZA 2K1RA 2CWXA 4NEZA 2PEBA 2JOQA 4WBFA 3RRHA 2MGZB 5J2QB 2RF2A 1WI8A 5D77A 4U8YA 4J9OA 1WHYA 4I2QA 4ZP6A 3ETOA 4GO7X 1RYRA 1AB8A 1LW2A 3OXFA 3L7PA 4W90B 4UOCA 1TKXA 2HNYA 4HHHA 1SUQB 4HACB 1HNXF 4KGVB 3MEGA 3OFHA 3RR8A 1MU2A 1LFPA 4HHUA 3QPIA 2JWNA 3O8WA 4NYZA 4LR8A 4OHVA 3JTPA 3UVJB 3MMAB 3OUYB 4AXJA 3ADAC 1URNA 3FBFA 4WZQA 2W2PP 1NKEA 4X4PA 2VQFF 1T9TA 2FLNA 1RP5A 2YQ1A 2HHHF 1U09A 2HYIB 3IS9B 4N77A 4NRTA 3RYLA 1KQGB 4FBTA 3HO1A 1HNIA 5RUBA 3C6TA 1YRUA 2QN6B 1N0VC 5CYMA 2MZTA 3TAPA 4ECRA 2B0GA 1JLAB 1TK0A 1PYOB 5LMNJ 3KK2A 1RTJB 1TUWA 3GP9A 1L3KA 2AGQA 2IBKA 1R31A 2QIFA 3HSJA 2XHWA 1PYTA 3MF5A 4DCJB 2KRRA 4HL9A 2RDIA 5C42B 2XNRA 2PFFB 5K8MA 2RB7A 1R0AB 4F8RA 4DS5A 2HNZB 2QLJB 2HRTA 5KFBA 2WVEA 4GKKF 4K0KF 4DFJA 3G87A 2YX4A 4ES3A 5ETTA 3QGIA 1O51A 3PCOB 3FNNA 1I6JA 2LVWA 3AHPA 4NZ6A 4LF7F 2HEKA 3H8YA 4IH6A 3CUNA 2GMJA 2GA7A 3I9ZA 3K5LA 4HYKA 4NA3A 3G8QA 1P8GA 4UT4A 4KYZA 3V81B 2R9LA 4MAKA 5HVGA 1HLWA 3G4SS 2VZ9A 4J9MA 2E7VA 2BJDA 1OS5A 2XSFA 2RH3A 4AT1B 2BJ8A 4P7VA 4OI1A 1T03A 3W9IA 2IJRA 2D1CA 2B8PA 2E9TA 3KK1A 1U49A 4ZCMA 1KLMA 4WIIA 1N5QA 1EQ0A 1TL1A 3MEEA 1OSCA 1CJVB 2YQ3A 3G6YA 1FJGF 2WAQD 5JVHQ 4HI1A 4YQWA 2FHJD 4OYMA 4TY9A 1F9EB 2G0CA 1T05A 3OQ2A 2VIHA 3KK3B 2X1FA 4OYAA 1XNQJ 2KZMA 4YR3A 3KDNA 1RHRB 5LL6d 4EUVA 3H25A 1SBRA 4IDKA 1GX6A 2SXLA 2RDDA 4B02A 2G2YA 3IM8A 1K9MT 1RGVA 3BR8A 5ETPA 4USKA 3LP1B 3ZZZA 4ETXA 2W1BA 4J90A 3L95X 3EVWA 4C7QA 2AX0A 2YWWA 5KT7A 2XB2D 2WB4A 4IR9A 4JI0F 2D3O1 2UVRA 3KLIB 4FS1A 4DSJA 1U0HA 2LU1A 3DOLB 3NGKA 4ZCKA 2Z8QA 1RT7A 2V0NA 1ZOTA 4CTAA 4CLWA 3PHEA 1ZAWA 3HX9A 1RCXB 5H9EJ 2OPQA 3BKFA 2OGUA 2R2SA 3U1NA 1B64A 4I68A 1VYAA 4MIWA 4U67Q 2GV1A 5AXLA 5C2GA 2IPOB 2MKJA 5L1IA 4M5MA 3QRPA 1G6BA 3W8GA 1IKYB 4DV2F 4OJGA 3M9NB 5L9NA 3E2EA 2KJVA 1S6PB 1BQMB 1FRLA 2GVDA 5KFYA 2OSQA 3HPOA 1VQ5S 1NSKL 1VLYA 3EGZA 2RNEA 2CNKB 4ZPAA 2XSJB 3FQKA 1DJ0A 1JB0C 3D68A 1Z1ZA 1EJ7L 3W2VB 4K4UA 5I3UA 1AUSL 1I1GA 2VONA 2R7RA 4RNNA 1NBEB 2F5GA 1LXNA 3TQ1A 3ISND 3DOKB 2MQNA 2BKOA 4X62F 1E6YB 5I3PA 2HWHA 1VBYA 2LP4A 5ITHA 2HFZA 3CF5Q 3THPA 3JSRA 1DAXA 4H4OB 1TELA 2MGZA 1UVMA 2HAFA 2HVEA 3ITHB 1C2PA 1JNZB 2AEMA 4ZVOB 2HGLA 1WOOA 2EFOA 4OFZA 2DHGA 5HMYA 2VD3A 2EC2A 1YBTA 1NKBA 1SUQA 4HACA 4ZITA 4QPTA 1NK5A 3T5LA 4FYDA 1R43A 1RHQB 3OUYA 4R0EA 2E9ZA 3TJAA 3RBEA 2FGOA 3GPAA 3RW6A 1ZS6A 3J7YU 1RT4B 5GAHI 2COLA 3RZAA 4IOAQ 3EPGA 1RQ0A 2LKZA 2CQGA 2OMOA 1FKOB 1WEYA 5DDPC 3I31A 4Q0BB 1FO1A 4IQMA 2BV3A 2J8AA 4ZVUB 3AQOA 3M2VB 1ZH5A 4EO8A 5DETA 1RTJA 2OIHA 2PO4A 3QJLA 5BJRA 5LT5A 3DDIA 2DRDA 4LVNP 5D3GB 1GMVA 2APOA 2W8KA 4KGXB 1R0AA 2HNZA 4QR0A 5B0FA 2V6AA 3GE9A 1XNRF 5HQLA 4ECUA 2NPIA 2V4JB 3GIMA 3RBZA 2AX1A 2CJBA 1ZM4A 2YKNA 2X1BA 3ENQA 4RO0A 1L3VA 2DEIA 2ZJPQ 4NXNJ 1QAYA 1KQFB 3QYYA 1K73T 4I2PB 4WWSA 2IAJB 4RNOA 2Y0SD 2LU2A 2ZD1A 2C2MB 2D7SA 3EM1A 3V81A 4NLQA 3CJ8A 1UFWA 2NSBA 2AKWB 5D4NA 5AJ3J 1SKUB 4ECQA 5E33A 1QD1A 1HBNB 1D09B 5L46A 3T1YJ 3PV8A 4WTOB 4N56A 3Q8SB 3EDQB 2V34A 3SQGA 4WKYA 1UAWA 5AE2A 1TAQA 2V9WA 2LEPA 1KVKA 2HZCA 1CJVA 3AOAA 1WKLA 3SYZA 4DQIA 1RYSA 3QT8A 2ZJQQ 2VG6B 2ZUGA 1VQLS 3OHBA 2PMWA 2HZVA 3OFFA 2MZSA 3IWLA 3H0PA 3CD7A 3H42A 3H4BA 1R3NA 3FEZA 2ASYA 4PQUB 3JXOA 5A2QU 3ET6A 2JSXA 4X2BA 4C8KA 3LP1A 3MTKA 3BDPA 3V5RA 4FBUA 2JVRA 1WUUA 4AD6A 4CLZA 3R1HA 2AYEA 1NSQA 5JUMA 2Q66A 2DGXA 2AP6A 3KLIA 2QMUB 1UA1A 1U2FA 2CPZA 3UD3P 4LMZA 2VA3A 4KFBB 3HI9A 4LF8F 4M5IA 5L1LA 4LF4F 3W9JA 1TZ0A 4Y3CA 3PW4A 1T9UA 2I2YA 1G1XA 3W63A 2CFXA 1KWMA 1U25A 2QL9B 1FF2A 5A8WA 3UN2A 2MLXA 3CWJA 1I94F 4LF9J 4YB7A 2XLJA 1HBUB 1YLXA 3TR5A 2B8QA 3PKMA 1RKJA 1HWIA 4ANDA 5JVGQ 5EWGA 2QFIA 4QR1A 2E29A 4J5OA 4TU9A 4ANEA 1VQMS 1BQMA 1RHKB 1FWPA 4F4WA 3K57A 1OO0B 1ZZNA 3MEKA 1DY3A 4HKQA 2CJAA 4BLGA 4DR6F 1SXLA 1NHVA 2XSJA 1VBXA 2F4VF 3HSZA 4WPAA 3TEGA 3KNAA 5E5NA 4MKAA 4DPWA 5BR8F 3CC7S 4I7FA 1KKHA 1R8BA 4PG6A 1Y4ZB 3FBCA 3L4BC 4DR2F 2AEFA 2XYHB 4DPTA 3DOKA 2EBGA 1ZM2A 4X4VA 4KIAA 1FNMA 1XMQJ 1J5EF 2W9BB 5A6PA 3TWZA 2W4CA 5KT5A 4U96A 3D2WA 3ZO7A 3R8YA 4OHZA 3ITHA 4PWUA 3D67A 4ILMA 4NCGB 2VOPA 1IQTA 3M8ZA 4ZPCA 4WE1B 2VASA 2BM0A 3AAWB 5C24B 2P9GA 3UR3C 2P9EA 1G4CA 4K7QA 4KE5A 5KFRA 3T1HJ 4B9MA 4IO9Q 1WD6A 2JEIA 2XO7A 2OPSB 5KT2A 2OJ3A 4V19J 1TAUA 2Y8YA 3DM2B
chains in the Genus database with same CATH topology
2OPRB 2GGPB 1ZTWA 4ILRA 1GH8A 3DNCA 2HHUA 2J76E 3GFHA 4F3MA 3PVXA 1ZAVA 3THVA 2VODA 2G9OA 5IQ6A 4ZCLA 2L3MA 4F26A 3TVKA 2K3IA 4NLUA 2GCFA 4ZVFA 2XGPA 4K59A 2ROPA 2R7VA 5I4MA 4CH1A 4C3LA 2W9AA 3D0HE 1KC8T 2VPYB 3I96A 3K5PA 3CCZA 4RW7B 3CCES 1UVKA 4QWAA 1RT4A 1LWFB 1NRKA 2ZOFA 1PO6A 1HMVB 3DLJA 1MMNA 3MD3A 4R8UA 2NPFA 1FHTA 1C0TA 1SJRA 1IKVA 2KDOA 3V2UC 1VK8A 1SV5A 2F8HA 3LWMA 2W7PA 3X3UA 2ZZNA 3WC2A 3EZUA 4OI4A 1FKOA 1S99A 1HL6A 1RT7B 3VAHA 2F40A 1KR4A 1ZAXA 3CCTA 5B0GA 2ERRA 4Q0BA 1SQEA 3I4HX 3SEOA 5CYQA 4FXVA 4CO0A 3M8SA 4W92B 1SJ1A 4RKUC 1HBMB 4ICLB 1Y5NB 1FA0A 5J2QA 1RTHA 1LW0A 3POTB 2ASJA 4C8YA 1VQPS 1AW0A 3DXSX 1PC4A 2QYCA 3M8QB 3GFZA 2DPIA 2OPQB 3IR6B 5IFMA 2AJQA 2C3PA 2Z0GA 4ZA1A 1N6QB 2HAIA 2B5JA 1S7HA 1IJEB 5IZHA 4AE5A 1VC5A 1S0MA 3PZPA 1FJ7A 2E5HA 3B4DA 4LJMA 3I5AA 4J9QA 1Q4RA 3M2VA 4BWMA 2C3OA 4HLBA 4NLDA 3PW2A 3RB4A 5BYQA 1NK4A 3K0JA 1IBLF 1S0OA 4NLGA 4YUDA 2DNKA 2V8HA 3OPKA 2A1BA 2M7SA 5KFCA 1S6QA 2PI5A 4BBYA 2X51A 1RDRA 5EUHA 5CA5A 2VFRA 4K5SA 1X0FA 1UFLA 2B4VA 3U1LA 1IXKA 5CQGA 4DV4F 2OH2A 5IWAF 2V94A 2FVSA 3SXLA 3GIKA 2YNHA 4RU2A 1KHWA 1XEZA 2M5YA 2OMLA 2W9CB 2DGQA 2E5JA 5D3GA 2RMLA 2WSCC 3M9MB 1Y3JA 3HKZD 4Q2LA 4OJHA 5T7LA 2BANB 5B7WA 4X64F 4DLEA 1H2VZ 3DHWC 2HRUA 5ADZA 3KMQA 3MMAA 2XBPA 2DT9A 4YB5A 2AU0A 2HYIB 3HHKA 1Y5IB 2N3OA 1Q1KA 2JDJA 3H2UB 1MW7A 3AB4B 5GMKa 5KFSA 3DDKA 2HRYA 4QBUA 3MM8A 4WFXA 2B3TB 1GAOA 4OZJA 3V6DA 1SL2A 2RU9A 5FJ4A 3OXLA 3GMGA 1SKRA 4MK9A 4HVZA 2EI5A 3PEHA 4OJ3A 1SJQA 5HI7A 2LA4A 2V4JA 1P6TA 3AQPA 4RW4B 4FF1A 3FCHA 3IS9A 1HNVB 4FPRA 3MGJA 5K5MA 3CJKB 4C8MA 2Q79A 2IVYA 4DWIA 3KHHA 4NZ7A 3M6VA 4X4NA 3G9CA 2IVMA 1RTIA 3KFWX 2O67A 1VQ4S 5DJBA 2YX7A 5KG4A 1U1RA 1M5PC 3PY8A 3TAMA 4HHJA 4M94A 1MWYA 5IT9Y 5DS7A 3HXMA 2XS2A 1TL5A 3OR1B 4TQRA 3EZ5A 2RQMA 2VFTA 2F8EX 5JXSA 3LP2B 4HT5A 1O8BA 1NJWA 2L9NA 4C98A 3J81Y 4OLOA 3CCQS 1B0VA 1TP7A 1SJ3P 4PUOA 2QSWA 4DLGA 4ID5A 4KB7A 5HLFB 2XY6A 2Q6BA 4F02A 2IAJA 2FPHX 2JC1A 2MQPA 1N5YB 2MZRA 3ZZUA 5B08A 2MKSA 3DRXA 3I82A 3RRGA 3E51A 3CJ2A 4O44B 3TW0A 1FDDA 1MWZA 4CH0S 5F8HA 1NKCA 1HHTP 3F73A 2DNRA 1OPIA 4CO3A 5EN1A 2AGPA 3F41A 4MYTA 1RT1B 3LGMA 3C3LA 2KFZA 4DQSA 1HI8A 2DTJA 1JLAA 2DGVA 1NK6A 2MQQA 4IFYA 4YMEA 2W24A 2B4OA 1WTBA 2KB2A 1TKTA 2R8IA 2A18A 1KOOA 1VRTA 1HBNA 3IAS9 2R2TA 3KNGA 4Q2MA 3M1VB 1FEHA 2IM3A 3KG4A 4NLXA 3MAQA 3ICLA 4XDDA 1XK8A 1F2GA 2F1FA 1UKUA 1FTCA 2CVEA 2M88A 4Z37A 2E5LF 2DH8A 4EWTA 4C3KA 3DOMA 2DNYA 2QSFA 2E1CA 2MQOA 2DNHA 5FDLB 5K14B 1WF2A 2GO8A 1BQXA 4QOTA 1K1SA 4RW6B 2YWHA 5C25A 1KONA 3HJFA 1WEZA 1TKZB 1U26A 3U1MA 4DSEA 2RQ4A 4O4GA 2CQCA 2DNPA 4DV6F 1X4BA 1DARA 1ELOA 4ZP7A 3I56S 3RBDA 4DR4F 2LDYA 4I1TA 3DLEB 5KFWA 4PG5A 1HD0A 5C42A 2DR8A 2FB0A 2P6SA 1SB6A 3CSKA 2YY3A 2DH9A 2EC0A 1EETB 1S79A 2UUWA 4MH8A 2FHMA 4Y28C 4KV8B 1VHFA 1W25A 2IJNA 4MJKA 2OO4A 5MLCV 3OTOF 2E1AA 3KJVB 2CPIA 1DQ8A 3UFCX 3NKYA 4CI0B 2N4DA 2VC0A 3SSSA 1SL0A 2RVJA 4U7CA 4FF3A 4J9PA 4URQU 1KFDA 1T02A 2VPXB 2LXIA 1FE0A 4K4ZA 1OSDA 3SSRA 2XLIA 4KSEB 2KU7A 2DGTA 3BN4A 3D1OA 4B9SA 1NO8A 4ECWA 2BJEA 3GWCA 2EG1A 3VWSA 1JXEA 2ZKTA 2VG6A 3HVTA 4M5DA 4QIVA 5KG2A 3E8OA 1H0HB 3SFUA 5E3CA 3GV7B 1JLFB 2ZH4A 3DLLQ 1OIAA 1UETA 3CGIA 1REVB 1VRUA 1YJUA 2CVIA 3RU0A 2KH9A 2XMTA 3PR4A 3M32B 4DOZA 2FLLA 5LMUF 2ZE2A 3IG1B 4IG3B 4OZ1A 3D0IE 3BDEA 1FNOA 1QUPA 4QWDA 2UVWA 3OJUA 3WC0A 2PD1A 2OSRA 3US5A 1S9EB 3NAIA 3M8PA 5SZTA 2RS2A 4U9RA 2HGMA 2MMYA 2NSCA 1XR6A 3IO1A 4KTQA 2ZM6F 1X5TA 3LQVA 3KMSA 1JLQB 3CMES 3GFYA 4ECSA 1ZETA 3CDEA 3Q8PB 4C11B 1UEUA 1ZPWX 5FD1A 2MHNA 1QUVA 4QR2A 2UVVA 3HHNB 1MSWD 2Z4PA 5CZXA 2GJ2A 4QWBA 4ZLPA 2O5DA 3DU6A 3DYAB 1DURA 1P9QC 2AJFE 4MK7A 1IUJA 4DV5F 4UY8T 3UCUP 3HHLC 1PILA 1ZM9A 4OX9F 2MB0B 2FJAB 3FVYA 5F8NA 4DL5A 4JI5F 3HHLA 1UEVA 3SDEB 2IYIA 1IQZA 1Y7PA 2UXDF 3PFOA 2FC8A 1DFDA 2WBRA 2HMIA 3IWNC 1HD1A 1D9AA 3DLGB 2HHWA 2CJQA 2YNIA 2R7OA 2FJVA 3S8SA 4F3OA 2XMKA 4ZCIA 1DLOB 4OLPA 3V4IA 3OTDA 4I2QB 3MPYA 5L39A 3OR2A 5KFOA 1N5SA 3VCDA 4RW9B 2O01C 2BQ3A 1DQAA 1LW2B 1KTQA 1R89A 1YJTA 2J7UA 4DF8A 1GX5A 3FSXA 1XWLA 4ES1A 4ZPVR 1RT3A 2HWIA 4ID8A 4IO1A 2HNYB 5J1PA 4P6QA 2MSSA 1FNXH 1R8PA 1IKXA 2P9CA 3IXQA 5B0AA 3MEGB 2K8GA 4ZVGA 2FGCA 4KC5A 4GMKA 1XR7A 3I0RB 4KT0C 2CQDA 4DX8H 3BS9A 1TV6B 1H6KX 2XZWA 3RAQA 4LIWA 1B7FA 3T6JA 3ZZYA 4XO0A 1HQUA 1FXRA 4Y34A 1V3RA 2OTLS 3ZZPA 4Z2XA 2XI3A 4JI7F 1J2VA 2HLTA 1UL3A 3E01B 4IG0B 5D4PA 3J7ZT 4NXNF 5LSLA 3M8RA 5D8HB 4H54A 2BR0A 1L3UA 3S7RA 3PFEA 3ZZRA 5H1SV 3S01A 3PX6A 3O5TB 3F56A 1TVRB 3PJXA 3KK3A 2FVPA 2VA2A 1XERA 4X4SA 1ZYQA 2HIQA 2YNFA 4O23A 5DG7A 2UU9F 1LWCB 2M2BA 5KFDA 3KLGB 4QYZJ 3PACA 2CZ4A 4AYBD 2POKA 5A0YB 4B3RF 1VC6A 4TU7A 2YKNB 3PM9A 4XIUA 1K0TA 2E66A 4M1KA 2PA3A 2ZC3A 1ZTTA 4IUFA 2W7AA 3OJSA 2W4DA 1HNIB 3I32A 5AJ3F 2FIUA 3C6TB 3MUTP 1N52B 2BYCA 5E0OA 4E0DA 4IRCA 2K2PA 3LANA 3H5XA 1D8ZA 2N7YA 3OHAA 3VAKA 3BGUA 4TKTA 1Z4UA 2JFKA 2OPPB 3TA2A 1FJCA 1QVFR 2PT0A 4I6AA 4GC6A 1JLEB 3T1YF 5G0RA 4H4KC 2VPZB 3R5BA 1DTQA 3DCAA 1U1LA 1M1KT 1Q78A 2ZD1B 1VQOS 4Y00A 4OJ1A 3SI8A 1T3NA 1S1TB 2EPIA 2RSQA 5H9FJ 2HWTA 1U1MA 2EFQA 1C1BA 4EBDA 2C2DA 2ZDPA 1RKIA 3SCIE 3MR6A 3CIMA 3HZGA 1M5KC 3BB5A 4L3NA 2KHDA 2EKYA 2KFNA 3CULA 2F7VA 3NWGA 1SH3A 4R5PA 5DM7Q 1BC6A 3MI7X 1HQEA 1F5BA 4JI6F 4M95A 2ZC4A 4RWWA 3VZHA 4A47A 3MM6A 2LQ9A 4WK1A 3NCQA 3ZZOA 1S9FA 5M2RA 3THTA 3KK2B 3JYTA 4EZ6A 2JL9A 3DLHA 4ECYA 2KYZA 5DG8A 4Y0FA 4K4YA 4OI3A 3DOLA 2UXCF 3BGFA 3G8TA 1Y3KA 1JKHB 3OL8A 1NK8A 1V6HA 1RT6A 4RX6A 4QJVA 1VOMA 2AW0A 3DI6B 4ED2A 1DTTB 2DVIA 1J5OA 2YKAA 3SQGB 1BQNB 3P6YC 3ISNC 2UV8A 2RS8A 5C5JA 3IFEA 3FSIA 1N32F 5FLXY 4EBCA 4NA1A 4QPXA 3MUMP 1URRA 2IJFA 2R7WA 1M90T 2W9BA 5E3RA 2DCUB 2IA0A 3KKFA 1XTZA 2BE2A 3MHYA 2L48A 3PW7A 3CPWR 3VALA 1E6VA 4J9LA 4C3MA 4DN9A 3FMBA 3OVBA 3KLFA 1YRTA 2Z2MA 2LCWA 4RUCA 2CPFA 3NBPB 4ELTA 3G6XA 2ZBIA 3EXCX 4F25A 3SFGA 2ZHAA 4BDPA 3RRKA 3HLUA 4ZPBA 2YWKA 4FZVA 4NPOA 2XCAA 3GV8B 1NJXA 2FC9A 3QWPA 1QAXA 1IKYA 2DHXA 4FNHA 4DL0C 3TOQA 1V3SA 4NCGA 1XMOF 3KHGA 1M0SA 1JLGA 3BO4A 3WZ0A 3FZ2A 2CQ0A 2DGUA 1DBDA 3BREA 4HDHA 2XMUA 4F4KA 5GAEU 4A8FA 2J9DE 1S6PA 1ZM3A 2ZOMA 2HVIA 5GADI 3MEDB 2BQRA 1KQKA 4OHYA 2C22A 2PC6A 3I5CA 2VC1A 5AXKA 3BSAA 2RQKA 3CO9A 4B08A 1H38A 1RTDB 6FDRA 4JOUA 5HQ8A 2XG8A 1JLCB 3LUYA 2ADBA 1VQ8S 5GVQA 5F41A 3MM7A 3UNGC 1N4LA 2D3UA 2KXFA 3RTVA 2AGOA 2ZOGA 1Q8BA 4DL3A 3W2WB 2FLPA 1YJRA 3D28A 1GXUA 1KHVA 2KI2A 3N4WA 3M2RB 3PX0A 4KR0B 3CD0A 2CKWA 2AD9A 4I69A 5A8RA 4DG1B 1JIHA 2M0GB 2W4PA 4A8WA 2LEAA 2RIJA 3GZ7A 4OQJA 4KPYA 3CCVS 2OLWA 2VBXA 4O3QA 3GSDA 2MQMA 3W2VA 5F8IA 4QW9A 2BOPA 2XEXA 3C46A 2EW9A 4X66F 3VZIA 1WG4A 3DMJB 4ATNA 3I5BA 2VBYA 3EUNA 3QO9B 3Q24A 4AL5A 2BUNA 4I6YA 3NL0A 2ZZMA 2X1AA 2RDJA 3IRXB 4HTJA 3G6ES 3TI0A 5K8NA 4RW7A 2ZHBA 4IRDA 1CEZA 4BCAA 2GW8A 1LWFA 1HMVA 2OD4A 1KEKA 3ONQA 4A8OA 2B9WA 1LK5A 2ZH9A 1VIXA 2MJNA 1KLMB 2KJWA 3EGWB 1E6YA 5DM6Q 4LF9F 4TXSA 2CPXA 5KFJA 4B17A 1VQNS 3MR5A 4PRFA 2XULA 1D8YA 2UP1A 3G6VA 2KM8C 2XGQA 4N47A 4DQQA 2RRNA 2E5IA 5KFPA 4LF5F 3ZC4A 2FJEB 1NZAA 3FJ2A 4H4OA 5CD4H 1HBMA 1HW9A 2L08A 2GMHA 4X4QA 4G3IA 2FDNA 2JLEA 4WFYA 1GTHA 5EWEA 4UY85 3K2YA 1X4FA 3IR5B 3TNVA 3BSNA 4DV0F 2FLOA 2PE8A 3M8QA 1LKZA 4MFBB 3UWTA 3Q8QB 2BVZA 3V6JA 3H5SA 4CO1A 2QA4G 2WHOA 1N6QA 3GG0A 5A8WB 2K7JA 2VUGA 2L9DA 3LPYA 4DBQA 4KGMA 4B9VA 2HW3A 1QLNA 4D3HA 4ERDA 4LSLA 4X65F 4QU6A 1QAIA 4URSA 3HZEA 4JI8F 2OKQA 1T05B 5MAOA 2KG1A 1AROP 2V8GA 2IM1A 4KAIA 1Q8LA 1FERA 1N33F 4YP3A 1S1VB 3RB3A 1LK7A 2HFOA 5AE1A 5F3ZA 4FXDA 4HTIA 5DQHA 5KFLA 2QA4S 2Q3PA 2M70A 3PDNA 4IKAA 4NA2A 5DDRC 3K5NA 2J0QD 4NL5A 2ROEA 2YWGA 2W9CA 2G4BA 1CC8A 2GJIA 2OFGX 1Y9OA 3GR0A 2YH1A 4IDKB 3HDSA 4NMLA 4Q5VA 2BANA 2K3KA 3H2LA 5T41A 4PQAA 1DRZA 7FDRA 2QA2A 2B7BB 3EPIA 3CCUS 4IOCQ 2VFSA 4BHQA 1T3OA 2HPUA 1FRXA 2ZH3A 4C2MA 3V6HA 2NXUA 5KOXA 4DFMA 1TKDA 1FKPB 2EWHA 2RUGA 1H3DA 3J7Z5 3T1AA 1CLFA 4DSFA 4WZMA 2XC9A 2K7KA 4RW4A 2J9CA 5E7OB 4WK3A 4L72B 1HNVA 4RWXA 3SSQA 1C1CB 2CZVC 3U02A 4LIRA 4K4SA 2BXJA 2F8MA 3H5UA 2M3DA 3HM9A 2JEGA 5HP1B 1XMQF 3TANA 3UPFA 2W8LA 2M52A 2I9SA 3MMCB 1X7VA 3DRSB 3NLCA 4DQPA 3WX4A 2BACA 1YVFA 3OR1A 5CXTA 3KYLA 3HVRA 4NYOA 2U2FA 4I7FB 3LP2A 4WU2A 5E3PA 4EEYA 1C4CA 1HNZF 3PO5A 5F9LA 1U6BA 2UZAA 4X84A 4Q45A 1RT5B 3J7A1 4ZPDA 1UJ6A 4E98A 2H9ZA 3P5TL 5DDQC 3QIDA 3GILA 4ECXA 1D0EA 2BDPA 1QJHA 3SCKE 1N88A 1IKWA 5E3AA 4CTAB 2WB1D 4J9KA 2R4FA 4O44A 4NLOA 2ZBCA