3LH2S

Crystal structure of hiv epitope-scaffold 4e10_1vi7a_s0_002_n 4e10 fv complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
64
Chain Sequence
HLTEYTLQANWFDITGILWLLGQVDGKIINSDVQAFVLLRVALPAKVEFSAKLADFSGGSLQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4E10_1VI7A_S0_002_N (T88)
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Artificial gene
molecule tags Immune system
total genus 11
structure length 64
sequence length 66
chains with identical sequence T, U, V
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lh2S00
2KDOA 4ES1A 1ZM4A 4ZCMA 2BM0A 1N0UA 3EXCX 1ZM3A 1FNMA 4FN5A 4ZCKA 2IVYA 4QR0A 2EFGA 2J7KA 2ZITA 4QR2A 4QR1A 4ES3A 4ES2A 4MAKA 1N0VC 1P9QC 1U2RA 2I8EA 4MYTA 3ZZUA 1DARA 1ZM9A 4MYUA 4M1KA 4TNOA 1ELOA 2BV3A 1KTVA 2BM1A 2L9NA 4ZCIA 2CVEA 3E3XA 4ZCLA 2E1RA 3UI3A 3B8HA 2NPFA 2XEXA 1ZM2A 2I0XA 3LH2S 5G4DA 3B78A 3ZZTA 1T95A 1VI7A 3OQ2A 3ZZ0A 2WBMA 3B82A 1ZPWX
chains in the Genus database with same CATH superfamily
2FZKB 4K59A 3MM8A 1IBLF 2JL9A 5A8KA 2IRYA 5K8MA 2C2DA 4YOEA 3PFEA 2FB0A 1RK8A 2CQGA 3DLGB 1FVQA 1Q4RA 3HJFA 3OTCA 1WWHA 3A12A 4IH7A 4J9PA 2AF6A 2HWHA 4DV1J 4WFNQ 3CWJA 3QRRA 2HQIA 4N47A 1KP6A 3IR7B 3IA0A 1TMJA 2VG5B 2MY7A 2ZEJA 1SQFA 3AHPA 4U96A 8ATCB 1IKWA 3MECB 3N28A 1NH7A 5CYQA 3TAMA 4Q8EA 2YKNB 3HFVA 4OJHA 5D4NA 1K47A 3KJNB 2ALYB 2GA7A 2R7TA 3GG0A 5FLXU 1VRTA 1HQEA 5JJBA 3MUTP 4UOHA 4LRFA 1EARA 4UZBA 2EBEA 2Z58B 3R6LB 1JNRB 2MKCA 3HF5A 3VCDA 2GIFA 4DQSA 3VZHA 2LEAA 2UVWA 3SI8A 2MQOA 4IR1A 1KONA 1FT8A 2I0XA 2C3OA 3JYTA 4H4KC 1RWNB 1WC0A 4ES2A 4HI1A 4Q45A 3HHLA 4F36A 1C0TB 2IC3A 1UWBA 2MPUA 4CTAB 3LH2S 4NCGB 2XBPA 1RAEB 3A8JA 2AU0A 4DG1A 3CDAA 4JV0A 4Q0BA 1IKYB 3D5MA 4DLGA 3DU6A 2F9DA 4LF7F 5A6WA 4GKKF 2CQ4A 3KJVA 2DGOA 4JI0F 3PY8A 1E6YB 2M8DB 4DU8A 4DV3F 1KQKA 2MY8A 4C8ZA 3QLHA 4Y3CA 3ENWA 1UMJA 2MSSA 3NCPA 4P71A 5LXRA 2H5JB 1DTQA 1FRMA 5LOQA 2ZH2A 1S1VB 1OSCA 3DHXA 2UZAA 1FDNA 1SJ3P 1HNXJ 2AGOA 1OY9A 3RTVA 3QNWB 2CJBA 3H5UA 4ID5A 4B9MA 3WBZA 4LSNB 2WVCA 3V6DA 4CM2A 3MPYA 1S72S 3AD7C 2C22A 2FJAB 4NMLA 1JX4A 2MJUA 4UOCA 3HHEA 2D3ZA 5BYSA 2BBEA 3FZBA 1OO0B 4NLUA 3KMSA 3PYFA 1M90T 4LF8F 2NPIA 1GMWA 3T1HF 1HNZF 1H0HB 1RT3B 4Q8FA 2YKQA 3BS9A 5KFIA 2GC8A 5KG7A 3HVAA 3CDWA 1C0UA 3KK2B 3SDEB 2Y1RI 3C2PA 2OSQA 5IS2A 2G1HA 2B9WA 2IPOB 4XO0A 1RAGB 1HBMA 1MWQA 4A47A 1UEUA 1QM9A 4URSA 1J2VA 1Z2LA 4GC7A 3ZZZA 3WZ0A 3KHHA 1NBEB 1U4BA 1APSA 4Q44A 3NGTA 1AROP 2XGPA 1U1PA 1RT2A 2AJ2A 4MIAA 5J2PB 2VQEF 1RYRA 2Z0GA 2L9DA 2HFVA 1KLNA 3SBMA 4LFBJ 2EC2A 3N6NA 1BXNA 3OHBA 3FC9A 1RHUB 1FO1A 5H9FK 2B43A 4CI0B 3OXFA 2D9OA 2LXFA 2E5HA 4FBTA 4C8LA 1N6QB 1SPBP 5ETNA 3N4WA 4USVA 3NGSA 4LRAA 1FX4A 1C1CA 2BACA 2YPYA 2RUSA 4LR8A 1TAQA 1RB0A 3I9ZA 2VICA 2DGWA 2PEBA 5F41A 2XI2A 1KBRA 3SQOP 3O6QA 1JLEA 3JTOA 1F0XA 2XO7A 1K0TA 4JI4F 7FD1A 3MR3A 4ES3A 4C48A 5BXIA 2VONA 1FDAA 1R6VA 2GHVC 2WOMB 1FVSA 3VAMA 3VGVA 3I31A 2ATLA 3C16A 4K0KJ 2RMLA 4DSLA 3P4UB 2UV8G 3OL7A 4WFXA 1LK5A 2MHEA 2BEFA 5CAAA 4NLOA 1VQMS 2UXDJ 2UXCF 3V6HA 4RL1A 3DRPB 5A2QY 4OZNA 3WQPA 2GJIA 2PD1A 3KK1B 1TKZA 4RW8B 5GAEI 2XY6A 3DC2A 2KXFA 2NYHA 4Z7CA 1TKDA 2YH0A 4F4WA 3SZ2A 2XLKA 2QA2A 3G8QA 3K17A 5KFOA 3CC2S 2VBZA 3NAHA 2G13A 4EO8A 1RKJA 3A8EA 4GVLA 3E01B 4I0WA 2JHEA 3BGOP 3RRGA 3BQ2A 4ZVUB 1TP7A 4TY8A 4OZ2A 3OLAA 2BV3A 2UU9J 3HHKA 4J90A 4B3TJ 2AJFE 3ENQA 1W2BR 2XB2D 3HHLD 3DLLQ 4PQUB 1JNZB 3M2UB 1U48A 4QR0A 4U8YA 3VAGA 3SSQA 4NCBA 2DJWA 4PCQA 3PRDA 1RT4A 2FHKA 1BQMB 2MXYA 2ZDOA 1U1RA 2YKAA 3C6UA 2CJKA 3VVUA 1SC6A 3MHYA 2DB1A 1KQSR 2RAQA 2ILYA 4FVCA 5GVQA 2PFDA 3ENVA 2J0SD 2Q43A 1JLBB 3A13A 1PJ5A 2QMUB 2YQ3A 4NA3A 5ETVA 4O23A 3MTKA 1LQ9A 1MROB 1R43A 1LV5A 2MGZB 4QIVA 2OJ3A 3M7VA 1SB6A 3CMQA 3W2VB 1IBCB 2LU1A 1ZETA 1QSLA 3KHGA 4PPZA 5JVHQ 2J0WA 1SV5B 2MKSA 3OL6A 2X1GA 4KO0A 2ROGA 3BSNA 4DL4A 1NSPA 1YQHA 1WKJA 3A4TA 3OTDA 5IQ6A 3J81U 2POKA 2CQ1A 1O51A 5DM6Q 5LMNJ 4RNOA 2ZZTA 2MQNA 1N5VA 4NRTA 2CNLB 1PGZA 1LW0A 3R2CJ 3I32A 3PRVA 2AEMA 4OYMA 4DSJA 1XMQF 3ZFVA 3DI6A 3LWMA 1UP1A 3CC4S 3PXGa 2HHSA 2JX2A 1KTQA 2MEWA 1H2TZ 1WJ9A 4NOHA 3IGNA 3PR5B 2B5JA 3T5KA 5CQGA 2JEGA 1IKWB 2RJZA 5CYQB 3TAMB 3Q24A 1HYSB 3UCUP 1SC4B 5CCLA 2GQCA 5GMKa 1T94A 1EQ0A 1YTYA 1VRTB 1NZAA 3D1QA 1FJGJ 2PA3A 2BKOA 1XNQF 2J7UA 1UL3A 4X66F 3LWLA 4TU9A 2ZH8A 2DY1A 1AA1B 3NNHA 2MZ1A 3MDFA 3U1MA 3JYTB 2KXNB 2HIQA 1T05A 4EYIB 1NH8A 2HIYA 3D2WA 2E66A 2RKIA 5KT4A 3C66A 1NK7A 3HHLB 3MMAA 4LF4J 2UVRA 2ALZA 2IC3B 4J5OA 3H40A 4RBUA 2DCUB 5FLXY 5F0WA 3DOKA 2IAJB 1PC4A 1ZYQA 4X64J 3GFYA 4DG1B 3QIPB 3I82A 4FZVA 2L9WA 1SUQA 1ULRA 5K14A 1UPMB 1HWKA 1SIWB 2VKZG 3QLHB 2EPIA 3L9ZA 2BM0A 2D1CA 4RW6A 1YIJS 3H90A 4MJKA 1G6BA 1U02A 3LGHA 1H3DA 3T1YJ 3GIMA 4H54A 1SI9A 2E7XA 2GAGC 2E7WA 1X31C 4X65F 1JQGA 1SQGA 2EFPA 1S79A 1GT8A 3V6DB 2HK3A 4L74A 2W9CB 1V9OA 4PR6A 4M5LA 2BQ3A 4NPOA 3KYLA 5KFEA 3PV8A 2X3DA 3I87A 3F73A 3HPOA 4O3OA 1LW2A 2QT7A 8RUCA 4F26A 1YRXA 3BGRA 3OTEA 1B0TA 2AP6A 1HD0A 4QWDA 2JLGA 4HTJA 4CLZA 3M30A 3JAMU 4FXWA 2FLLA 2F4VJ 2ZVIA 4NXMJ 3PW2A 5KG4A 2PA8D 2RF2A 1QAIA 2W8LA 1IUJA 1C0UB 4HACB 1LWCA 4UQGA 4FXDA 2F8MA 1BMQB 3E3XA 2RHSB 2IJNA 1N32J 3D6HB 3CDBA 3EDRB 3SIPB 1HHTP 1Y3KA 3J7ZT 1NDCA 1HBMB 3MGJA 4DSEA 4ZVFA 3W3SA 2JLFA 4G65A 5HBMA 5HVHA 1QVFR 4IFYB 1YJWS 2JDJA 2KI2A 4LRDA 1RT2B 4J9SA 1FI4A 3MWBA 2FIUA 1JLAA 2JC0A 2DGUA 3CCZA 4QWBA 2KZZA 2ZHOA 4Y65A 1DARA 1QD1A 1YJ9S 4P2FA 4URGA 4RWWA 2VFUA 1RYSA 1D09B 1C2PA 3EPIA 2BMBA 2H48B 4C8YA 3D9BA 3QFHA 2ZH4A 2XSJA 4OZJA 2HEKA 4RNHA 3V5RA 4LSLA 1NSKL 2LQ8A 2HFSA 2KVIA 4FF2A 3S1TA 4X4TA 4KGKA 4AUKA 1P9YA 3OQ2A 4USJC 3G87A 2B4UA 2FC8A 3PM9A 4ZPWR 4QYZJ 1X4GA 2LKZA 1YJ7A 1IQTA 1OS5A 2FVSA 2Q6CA 4C8KA 1VK3A 3QT7A 4ZVRB 3PKMA 3G71S 1FF2A 1TMMA 5KFLA 1F9HA 5DO2A 1VCTA 1JJCB 1CSJA 2NXJA 3C16B 4DPWA 4QIFA 2BKNA 2XS7A 5BYRA 1Q8KA 2ZJQQ 1Q8BA 3W1YC 1IVZA 3NL0A 4JYAJ 2DNHA 4P75A 3UVJB 1WI8A 1QUVA 1F2HA 1N5SA 1S6PA 4DV4J 2GQQA 3IR6B 5E3PA 3FQKA 1OMSA 3G6ES 5AXLA 4PKDB 1HW8A 1Y5NB 4DQQA 4IOBA 4WYLA 1TKZB 4LF5J 1DHMA 3A8KA 5IXUA 4C0OC 5K20B 2LLZA 4PWWA 1WORA 2EFVA 2YWGA 4M5JA 4RWXA 4CNYA 2LVWA 4KYZA 1LNQA 5GAGI 3GV5B 1CJVA 5J1NA 3K59A 1AYEA 4WK1A 4C4WA 1RT5B 1TL5A 1NK8A 1RTHA 1HPZA 3AODA 3FSXA 3ZZPA 3UN5A 4DV6F 4TY8B 4WP8A 3EGZA 2CADA 2B6AB 2XMJA 4DR7F 4MK8A 3NGRA 1HQUB 1N5YB 5E41A 5FIIA 4ZN1A 1EKRA 1JLQA 2HFNA 3IO1A 4JI7F 3ZZRA 4PWUA 5C42A 5GADU 1SJ1A 2LQBA 3OL9A 1DQAA 4AE5A 3C6UB 4EEYA 4RW4A 3M6UA 4UOGA 2HMIB 5EWFA 2PSZA 4LFCF 5EN1A 4ZMMA 3NP5A 4DR4F 4EBCA 1VQ9S 1FE4A 1TK0A 2OPSA 3CCLS 3TJ9A 5L39A 4BC7A 3OLBA 3A1YG 4DUTA 1WF1A 4HTIA 4WBFA 1RAHB 4RW7B 1WG5A 1KR4A 1UTAA 4EMDA 1T8EA 1MN7A 3NGKA 3R5GA 2ZC3A 2UUAF 3QJLA 4KO0B 1I5OB 5D4OA 1K44A 2HHQA 1S49A 1VJWA 3GSDA 3MAQA 4UUWA 3JSRA 3R7SB 5GAHI 3IWNC 2GVZB 3TP2A 4AL6A 3BPDA 3TEGA 2HBRB 2M4MA 3DI6B 5EDWA 2EK6A 2O67A 2DIVA 1UVKA 1KOHA 2HHUA 2E5LF 4P73A 4DPXA 1WEZA 4R5PA 3CULA 2VG7A 3T5LA 3I0SA 1WHWA 3BR9A 4WIQA 2B5JB 4A46A 2PMHA 4HEA9 3V81A 5KFPA 2HHWA 4JI8J 4ZPVR 1RCOB 2WCXA 4DPTA 1R0CB 4CLYA 3T6BA 1DRZA 1CJTA 3M8WA 5K8NA 3G8TA 1U1LA 4IYQA 1SIZA 2V63A 4KRWA 4OJGA 2EG1A 5EHHA 4Q2LA 2WSEC 4OHXA 1QAXA 1PYSB 3M6VA 2C3YA 1U1QA 3RRHA 3CCUS 3MMBB 2MZTA 3MM5B 3HVRA 2MZSA 1BC6A 1S9EB 4QYRA 4OX9J 1RT1A 1U6FA 1T05B 3MEEA 2UXBJ 2E9ZA 2ZBCA 2ZNYA 3ZC4A 2DNMA 4C0BA 2RKIB 1IWGA 1GEHA 4DDFA 1EETA 5DG9A 1BLUA 3TX8A 2KDOA 4KIAA 3TUJC 4JV2A 3W64A 3BDPA 3DOKB 5DGBA 3M2RA 4YB5A 2DNNA 2E1MC 1XQIA 1Y9OA 4YB1P 3DM2A 1X4DA 5K14B 1VI7A 1WDTA 2W2QP 1EX8A 2IBKA 4EGLA 4ZJOA 1NJYA 4IQXA 2EFGA 3OVBA 2AQ4A 4KY3A 4RW6B 2P9CA 1GX5A 4DR5F 4M94A 1V6HA 4CH1A 1H6KX 3L4BC 5AXNA 1ZPVA 1RBAA 5KG0A 3DU5A 5A8RB 3RBZA 4WXOA 4AQYF 2GJ2A 2OUGA 1QTNB 4DWIA 1R7IA 3EZOA 2IVMA 2QRRA 5D77A 2MLXA 4QU6A 3KLVA 3IFEA 4YQWA 3RZAA 1T9UA 2HNZB 2X1AA 4DR2F 4LF9F 1RP5A 2VHGA 3HZGA 4NLQA 1LW2B 1S57A 2FJXA 3J81j 5B0DA 4P9SA 4OV6A 1PCAA 2APOA 2RF2B 2Q79A 2GX8A 2EC0A 4F02A 1FDDA 1B7FA 3HVWA 4DPUA 2QV6A 4CH0S 3EX7B 4OMFG 1I94J 5HBMB 2DNZA 4PYDA 1ZH5A 4LF2A 1NAQA 4K5RA 2VKRA 3LTOA 1SJFA 2WZ1A 2DHAA 1K1SA 1WDDA 4DR3J 1JLAB 4FNHA 5B0AA 4WKYA 3JAMY 5HLFA 2F9JA 3MAHA 2DXDA 4MAKA 1KQFB 1BWEA 4I2QA 1VR6A 1Q5YA 3R7NB 2XI3A 2QLXA 2FD2A 1XN9A 4K2JA 2KG1A 1RHJB 2Q66A 1S77D 4U8VA 1X4EA 4BS2A 1TFYA 2FY1A 2EI5A 2W9BA 5ETRA 2XSJB 3W60A 1HI8A 2ABYA 1KHVA 4FYWB 1JXLA 2FY8A 4B3OA 1RU1A 1PBUA 1S7HA 4QR1A 1FX2A 3FEZA 4RW9A 2MZRA 3KLFA 3UCZP 4ZPCA 3BQ0A 2VL1A 1V3RA 1CBKA 3GCXP 1FKPA 2YX4A 1VBXA 4HT5A 1T03A 3CW2C 4DR1J 3FBBA 4I6WA 4ED3A 2OHDA 4ECVA 3AA9A 3OR2A 4RLEA 5KFAA 4DF8A 4OYOA 3KHRA 4N41A 2W25A 1CLFA 1NHKL 4XAKA 4MKVA 1S6PB 3R6GB 1ITPA 4K4VA 2KO1A 4XPEA 3LANA 5DDOC 3ZXWA 3J80Y 5DS7A 3MPDA 5E3AA 3M2VB 4NLRA 1X7VA 3BSAA 3T41A 1SL0A 5EGYA 5I3QA 2DIUA 2WSFC 2UUBJ 2H1YA 4FF3A 3PYDA 1MSWD 1CJVB 2NS1B 1S0MA 1RTJB 4ECUA 3FCVA 3GJSB 4NLSA 2CQDA 3EGWB 4IRCA 4L76A 1U1OA 4JI2J 1AFJA 4AXIA 2HRYA 4LRBA 4DV1F 1WC4A 3MFIA 1N52B 2RDJA 1EP4A 2H5IB 2JLEA 4KC5A 1JK9B 3TX0A 1M5SA 2OD4A 3O44A 3RAMA 4QCLA 4BCAA 2DRAA 3GB0A 4RBVA 2OGUA 4J9MA 4JOUA 1W25A 3Q0AA 2AT1B 1RHRB 2ACYA 1JLQB 2V6AA 1TU0B 3KWMA 1T3OA 5C42B 2V8PA 2MQQA 1HBOA 2ZBRA 3CCVS 1ZOTA 5IQQA 4K4WA 4X4SA 4Y0FA 2BW2A 4UT4A 4YUDA 3F41A 2OPSB 2QIFA 1L3UA 3GJQB 4OI0A 2DO0A 2BVZA 1KVIA 4OIXA 2KVQE 2F4FA 3EXCX 4ZPBA 2BA9A 3TJAA 1WF0A 4ELUA 1NCLA 3SFUA 3PHTA 3V4MA 1NSQA 3H59A 3EYZA 1M5VC 3TUPA 1VQNS 2AHOB 4I1TA 1ZBTA 1UFKA 2H5EA 9ATCB 1TKXA 4U6PA 4BLGA 4TKTA 4I68A 2DHXA 3CC7S 2V69A 1RCXB 2WB1D 4L6V3 3KHLA 1KN6A 4J9RA 4R5PB 3FRZA 4XDDA 4NXNJ 2B7BB 3I0SB 1UFLA 4TLRA 2D69A 2QYCA 2KYZA 5DLFA 3C6TA 5G0RA 1CJTB 4K5SA 1HNXF 3IS9B 3C15A 3FJ2A 3G2XA 2KJVA 2FDNA 4HLBA 4M5NA 2W2OP 3PW7A 3W8PA 3HZEA 4CNZA 2AMCB 4PXCA 3HSGA 2U2FA 1NM2A 1R0BG 5JXSA 1YJUA 4RNFA 2JFDA 3G86A 2HNYA 1RT1B 2KHCA 4F3QA 3R2DJ 2OI2A 4DS5A 1U0HB 2NUHA 3X1LB 1EETB 2NXCA 1TV6A 2DITA 1HFEL 2I38A 4FYYB 4DL5A 1S1WA 4Y2KA 3M2RB 2WK4A 1PIEA 4USIA 5KFDA 2RRAA 3WC0A 4NL5A 4B9NA 4O3PA 5LJ5Y 1GAOA 1UVNA 4NMXA 1MNEA 3D1OA 4PYAA 2HNDA 3FQLA 2YXLA 3MMJA 3BSCA 3T9NA 2X1FA 4LFBF 3DRXA 3THTA 3VHQA 4A48A 3SEOA 1JXVA 2CPHA 2KB2A 1A7GE 4RZRA 2NXNA 1YG0A 5C2CA 2AGQA 4U7UK 4CYUA 4RO0A 4N5SA 1W7WA 5CHCB 2QLBB 2N3LA 3M9OB 4P2XA 4PWDA 2ZH3A 1ZTWA 1TQLA 2DNGA 2CPZA 4KHMA 4TU8A 3EVMA 3HX9A 1VRQC 4JUZA 2K7JA 3TZZA 1FNXH 1JKHA 1WTBA 1IQZA 2RDIA 2QL9B 1TVRA 2MMYA 3D4JA 4ZP9A 3M32B 4I67A 1PYTA 2M70A 5D3GA 1REGX 3BBBA 3HFKA 1MW7A 4K0KF 4HR2A 2P2CB 3PEHA 2EBGA 2KN4A 2GW8A 3GMGA 1U0SA 1OPZA 2OLWA 4ATNA 2QTWA 2R2SA 2KM8C 5K9FA 4ZK7M 5AXKA 3R7BB 2UXDF 5KFWA 5J2NA 4JV1A 5HLFB 1NK5A 3F0NA 3KNAA 1DY3A 4D3HA 4NYOA 4C6AA 2XZWA 3W8GA 3AT1B 4I2QB 3RBEA 2IMWP 1ZA1B 1VQPS 4ED0A 2J0QD 2X51A 2CQPA 5AE3A 3NCRA 4ES1A 2PFFB 2HHHJ 4CLWA 3BV8A 4C0HA 1GH8A 2D9PA 1CPZA 3QGIA 3KLEB 4I4BA 2W9BB 4NASA 4CLUA 1LXJA 4DQIA 3PW4A 3POTA 3MR5A 1VRUB 3K5OA 2VH7A 2FLPA 2C2EA 4B3OB 3LA0A 2UU9F 2L3MA 3OPKA 2CJAA 2FZCB 4RW9B 4BWMA 4B3TF 1Y11A 5KT2A 3EXYA 1JJHA 2ZE2A 4GKJJ 1I1GA 3CDUA 3GQCA 1LEOA 2CDQA 4KPCA 3WX4A 5BJRA 3OR2B 4ZITA 5G4DA 1PG5B 5KTQA 1UFWA 3GILA 3W5XA 2OFGX 1UZHA 2NSCA 1BY9A 2ZBIA 5DQIA 4WP9A 2CJXB 2RQKA 1X5SA 3C14B 1G1XA 3UDEA 2ILZA 3BZQA 4LR7A 2AWZA 2PMWA 3WDOA 2CDRB 4A8QA 3M8PA 4TY9A 5KOXA 3J7AN 1U7LA 5FDLA 1LWXA 4IOCQ 2R2TA 3LAMA 2HQFA 1W26A 1FJ7A 1KWMA 3I5AA 4B3MJ 3CVKA 2FGCA 5LSRA 2C2NA 3IAM9 5LMNF 3JQKA 2W2PP 4P72A 4N77A 1HWLA 1KRPA 1FXRA 3MD1A 2N3OA 3G96A 2PGCA 3P45B 1DAXA 2KT3A 4FKXA 2W7OA 4DR6J 3LQVA 3QMQA 3OXGA 5KFTA 3QGHA 2CA9A 1RAAB 1WOOA 1H2UX 2VG6A 2LDIA 5E2QA 3IR5B 2RD5C 1ACMB 2Z2LA 3QJPA 2LXUA 3SCIE 1SKWA 3CB4A 3UR0A 3VAKA 3QWUA 2VFRA 1KQGB 2C1EB 3EVWA 4FF1A 2LU2A 5K5MA 3HHNB 1FJGF 4YB6A 2E5IA 3AFGA 2A0FB 5L9XA 3RB0A 4X4RA 1PC5A 5MLCV 2Q6BA 5FD1A 1WC3A 3WIVA 3PJXA 4LF6J 1LKZA 1VQOS 1FWLA 2G4BA 4P7TA 1G3OA 3CE8A 3ISNC 2FLOA 1RSCA 4ETXA 4LF4F 4RNMA 5HANA 5MAOA 1SJQA 3OTOJ 4EBEA 4X64F 3KK3A 4NZ7A 2Y0BB 4K4YA 1RISA 3N9UC 4LFAJ 4DSKA 4AXJA 4H4OB 1N0VC 1JJ2R 2CJQA 3OFFA 1DJ0A 1S6QA 1P8GA 3AB4B 3WIUA 1VQKS 5A8WB 5JMNA 3B82A 2I9SA 2Z30B 2KG0A 1DFDA 1M5HA 3FBEA 3T1YF 3TW0A 3H5XA 3BR8A 1FEEA 4UOFA 3GZ7A 3KG4A 4O4GA 5L9NA 1VGYA 2PIIA 5G0RB 4F2SA 1U1MA 1P1LA 3GIJA 3GR0A 5I4MA 1NDKA 2QX0A 2MB0B 1N88A 2JVRA 5KFUA 2P9GA 4B9TA 3EPGA 1TL4A 4QQBA 4ZHRB 3OW2R 2HNYB 3VGTA 4LMZA 5ITHA 3B78A 2F4VF 2KFZA 2BJ8A 3KUGA 2EG2A 3IRWP 3UD5A 4WCEQ 1TV6B 2XYHB 1OJ4A 3CJ5A 1S1UA 4TQSA 2JRSA 3DLKA 1N32F 2DY9A 3IM8A 5LSLA 4ZPDA 5ETTA 4MKBA 3QWPA 2QE5A 3HKWA 5EWEA 4ED8A 2V8GA 1MMLA 3UPFA 2HNDB 3ITHB 4EI2A 1BQNB 1Y10A 1QAJA 4ILRA 2GO9A 4K2XA 4WKRA 4ECRA 1RWOB 3D0GE 1VLOA 1QJHA 1R8HA 3LP0B 2HS4A 4A8FA 5KFBA 2F8HA 3QSYB 1FWKA 3D1HA 4F7VA 4CYUB 1WF2A 2AW0A 1FESA 4A8MP 4HH1A 1FFGB 4PWDB 3D3BJ 3AY0A 3KLIA 4ZPAA 2ZNZA 2RH3A 2DXEA 4P74A 4TYBA 3M8QA 1Q5VA 2P6TA 1V3SA 3DRSA 4GMKA 1VC6A 3OUYB 1FKOA 1RABB 3OL8A 3IWLA 1REVA 1V3ZA 2F40A 1UVLA 2C2ZB 3VVTA 2WHOA 3GU0A 5D3GB 4KKOB 4CLFA 3UQSA 2HRTA 3GYXB 4MKAA 4DPOA 2BE2A 4GO7X 4WP3A 4JYAF 3P6YC 5HMWA 4G1IA 2M0GB 3GG1A 5J2NB 4DV4F 1XMOJ 5KFZA 1UVJA 2IJRA 3EM1A 4CO2A 1KFSA 3UDCA 2E1CA 3QAUA 3QGGA 1KDNA 4ECSA 3W62A 5D4LA 1U6ZA 4LF5F 2LA6A 1EB0A 4CWBA 2HBQB 5C25A 1Q7YT 5D0EA 4DR5J 1QAYA 5H9FJ 4OZ3A 3CCWA 1CS4A 1TL1A 1ZM3A 3S8SA 3DHWC 2A18A 3DFEA 2W4PA 3WC2A 3TAPA 1VQ5S 3NWRA 1K1QA 2COLA 5HN0A 2Q3PA 4U67Q 5HVGA 6AT1B 1V5VA 2ZOGA 2HWIA 2V2KA 2W2NP 3Q8RB 4C3MA 3W5YA 2ZE2B 3TRGA 3N6LA 3Q8SB 5CYJA 2CPJA 4IG3A 3UE2A 3K58A 4ZCIA 2IY5B 1WC6A 2J6UA 1ZTTA 1FXLA 1YJTA 4I2PA 2ZH7A 3I4PA 3SSRA 2WW4A 1CJUA 4PUOA 5KG5A 1PAEX 3VAJA 3DGPA 2DNLA 3PX6A 3CD6S 2DR9A 2CIMA 3ZZOA 2ZUGA 3RB6A 5I42A 2CPYA 2CFXA 1TAUA 5FJ4A 5LL6d 4ITSA 3FFIB 2PI4A 4RU2A 1T9WA 2AX0A 1VC0A 1HI1A 3EGNA 2LQJA 2CPIA 2WW8A 5FDLB 4X84A 4DV2J 2VC1A 1S1TA 2V34A 1IJEB 5ETLA 2PO4A 2DRBA 3SCJE 2IHR1 3H5SA 2HHVA 1GK8A 4ZP6A 3IBFB 2XSFA 2CPDA 1QLNA 3HSZA 4V19J 1FFSB 4IRKA 2FVQA 4J9VA 2DVIA 4NEZA 2A2CA 2DR5A 3U27A 4JI8F 2VG6B 4F50A 5RUBA 1BD6A 2KYXA 1FNOA 4ERDA 5JUMA 4LVOP 2G2YA 3ILIA 2G1DA 3GFZA 4J91A 3K5NA 2PE8A 4BHQA 4FYDA 1RWVB 4CLLA 4ETZA 4UTGA 4J9LA 2LEPA 2DGXA 1NHUA 2B56A 2VUGA 4FNIA 1C1BB 1JJ4A 2DNQA 3V2UC 3OVSA 4OX9F 2UXBF 1JLGA 1AFIA 4LQ9A 4YY3J 4KFBA 2YWHA 1HD1A 2V67A 1Y3JA 5D6GA 4NLPA 3T6JA 1Q79A 2KU7A 4W92B 3KK3B 3S7RA 2ZHBA 2HW3A 5L1JA 2AJ1A 1N5TA 1YKWA 3VGSA 4C7QA 3VTIA 1S6QB 5F8LA 2VJVA 2L48A 2FJBB 2ZH6A 4HHJA 1UW4A 3KOAA 4FVMA 4EO6A 2HZVA 1JLCA 3I56S 3W9HA 2JEFA 1U49A 2UUTA 1S0OA 4L3KA 4IH6A 3NS7B 1D0EA 4P2SA 2AGPA 1VMBA 3BB5A 2CPEA 3NCQA 5IWAJ 4M63A 1CQMA 1FRHA 1NO8A 1HQ2A 1FRXA 4CLSA 1EHWA 1RADB 1FD8A 1CVJA 2ZBQA 4GC6A 2KXHA 4X4OA 3PG9A 3TUZC 2R8GA 4IG0B 1YJVA 1ZM9A 4MYUA 2J7WA 1I6JA 1FRIA 1M5OC 3GONA 1FEHA 1Q7LB 5DETA 1F1BB 2MKHA 3RGIA 3W61A 3OJUA 3WHIA 3ADAC 4EK2A 4R25A 3UN3A 4BC9A 3D0HE 2GNKA 1X4FA 1S1UB 1GTEA 3DLKB 2W7PA 3DYAA 2EVZA 1F5AA 3GJRB 1UVIA 4FPIA 3FMBA 1I94F 3QRQA 1DTTA 2QSWA 1B7YB 5KFYA 3MEDA 3HSDA 3PW5A 4DR3F 1VK8A 3ZZ0A 1D8ZA 1VJQA 4QIEA 3TAQA 5KFMA 1NLKL 4KHPJ 2N7CA 2V68A 4N76A 3ELHA 2UVUA 3RAXA 3Q8PB 4F0HA 2QL7B 2DR6A 3MD3A 2IBOA 3IRXB 5IT9U 1I3OB 4A4JA 1WSVA 3FRYA 2DT9A 3AJ2A 2H65B 3O1LA 3MR7A 2Y1LB 2Y8YA 3HP6A 3TQ1A 3M8QB 2FGOA 3K5MA 2MSTA 3DRSB 4TYAA 1ZA2B 2YWKA 4PG7A 4ZLNA 1REVB 1AUDA 2VFVA 1WEXA 1VYAA 4DR1F 3U7JA 2FJWA 2CWXA 2YKMA 1GX6A 2VB6A 2QC3A 4DU7A 2G2OA 2BQRA 4YFUA 3M1VA 3B54A 4OZ1A 1RT7B 2W24A 4LREA 3HSJA 5J2QB 2VD3A 1ZM2A 1Y7PA 2BJ7A 1SH2A 3LP1A 1LWFA 3BN4A 3NY0A 4Q5VA 3FDSA 3JS9A 2WBRA 4QWEA 3KJFB 3DLBA 1BUXA 4FF4A 3M8ZA 5J2MB 5E7OB 4ZCLA 2RIJA 1RZMA 3MM9B 2QEXS 3L3CA 1HARA 3NWGA 4O44A 5E5NA 2CRLA 4BDPA 3MEGA 2MLYA 3HXMA 1RA6A 3PJ9A 5C25B 2UUBF 1KVJA 3IMQJ 4NLGA 3DLHA 2RT3A 2JWNA 1TL1B 1URRA 4DFPA 4FS1A 4DCPB 3GWCA 3DKDA 1GFWB 4JI2F 2F5GA 4IFVA 3CMES 2YPZA 1VIOA 1N36J 1Q1KA 1HHSA 3CD0A 5B0EA 4KR0B 4CO1A 1S97A 1VQ8S 3PYGA 3OV7A 4DV0J 1S9GB 2YWFA 3DOMA 3QFWA 3GPAA 2R9LA 2LFVA 4PAAA 3PYEA 4LF1A 2MDAA 1XNRJ 2D3UA 2Z57B 1EZZB 1J5OA 4IG3B 4F67A 5ETOA 5LSOA 1NMEB 3E8OA 5JVGQ 3UDLA 4I2PB 4DX8H 1NKEA 2UP1A 1CJUB 1T11A 3VAFA 2MHNA 4PUOB 1N34J 1WACA 4NI2A 4JV5J 3HT0A 1VBZA 1VBKA 3V6JA 1Z2ZA 3D68A 5E3QA 2XS5A 4DXLA 1FE0A 1FA0A 5KFQA 1M1GA 1C4CA 4ZVHA 4K4ZA 5F8JA 5ETQA 1DZ5A 5LMUJ 1PO6A 4E98A 3W63A 4DL2A 1IKXA 1R27B 2J7KA 1S1TB 3BJYA 3JSMA 4CLKA 3U1LA 2DGQA 1KHWA 1A6LA 1NEEA 3ZTSA 2R7SA 5AT1B 5L46A 4DHVA 2NQPA 3D6TB 1TKTB 4OHYA 3UCGA 3R9LA 3BM7A 1SBRA 2AYEA 2W9AA 4ECYA 1RTIA 1P1TA 1XTZA 4NXNF 2O3DA 2HSEB 3KLGA 1R0AB 3R27A 3TZXA 2DXFA 4AL5A 2DNYA 2YQ1A 3NBPB 3M9NB 3QO9A 1T3NA 4OL8A 3DLJA 5HK4A 3J7YI 2C3MA 2R7VA 4KSEB 2XMMA 1CJKA 1K0VA 4WIIA 4ZKAA 1H38A 3PFOA 2P9EA 2PC6A 3M4XA 5KT3A 2P5VA 2H3EB 3P8BB 4JI6J 3DDKA 3PRBA 1Q53A 3BYRA 1JLGB 2ZOMA 3MM6A 2K1RB 2K2PA 1NPKA 2WONB 2HLTA 3ENAA 1K9MT 5KFFA 3VALA 4KFBB 4C3LA 3MM8B 2I6WA 1PYOB 5A8KB 3LP2A 4HHHA 4LQ3A 1SXLA 2G0CA 1VISA 5H1SV 3K0JA 2XG8A 3ULHA 3VR1A 3OD2A 1XR6A 1XC9A 1IWAA 5T7LA 2Z2ZA 4DCJB 1CQNA 3D3CJ 2IVYA 3KFWX 5A76A 1EQMA 1RGVA 3UDVA 2MKKA 2NSBA 4OX7A 1JLCB 3JQJA 3VF0B 3HI9A 2RSQA 1FKAF 1IR0A 1GMWD 1YVFA 2IM3A 5KFVA 4DX7A 3K7RA 2A3JA 3NMAA 3LPYA 5CH7B 3HJVA 3NLCA 2NREA 2IMOA 2BE7D 1Z1ZA 1NK0A 1A9NB 4N8OA 4QPXA 3Q83A 4A8SA 2JSXA 1NJXA 2BQUA 1EIYB 2YKNA 4ZCKA 1X4BA 5AE1A 2B7CB 2QLJB 1YRTA 4FYVB 2LA4A 3H98A 3OTBA 2HK2A 3W9IA 3G9CA 3OR1A 2XS2A 2DHHA 3BDEA 4KB7A 3A3OB 2MYFA 1IBMJ 4H4KA 2XMAA 1HQEB 3VWSA 5C5JA 3NNCA 3TA2A 2N4DA 4WXWA 1IR2A 3ICLA 4ED2A 4Z37A 3N5BA 2J6TA 2E5GA 2RS2A 4CLTA 1LFPA 2HS3A 1C4AA 4YDXA 4Y2MA 4R0JA 5CZXA 4DUYJ 3DYAB 3CD5A 4DPYA 5C24A 5KFKA 1C0TA 4YR3A 1DTTB 2E7VA 4CTAA 3MEDB 2XEXA 1UWBB 1RWPB 4M5MA 4KAIA 2CVIA 1OSDA 4B3RJ 4Q0BB 1HNVA 1RUSA 1E6YA 1E6VA 1HKAA 2DNOA 3NOCA 3KJVB 1EKSA 1GXUA 1TUGB 2BJ9A 5A6PA 4F0KA 2C2MB 1WEYA 3HHLC 2HHHF 1W2IA 3BO2A 4Z7YA 5EX3A 2KH9A 3W65A 1DTQB 1PBAA 3PHEA 5EWGA 2YKOA 2FPHX 2Z4PA 4R8UA 5CD4A 4LSZB 3MI7X 3EVOA 3HULA 4ED1A 3CJ3A 2MLZA 2OKQA 4ID5B 2Y1JA 3TA1A 3AJDA 2RU3A 2DO4A 2O01C 4RBTA 1DBDA 2EKYA 5HMZA 1Q95G 1OYDA 3HK2A 3P3DA 4GKJF 2OFHX 2YKMB 4KQZA 1I51B 1VQSA 2LDYA 4H4MA 1U6BA 2LYVA 5IT9Y 1TZ0A 2A10A 1RT3A 3M1VB 5K8OA 2GS8A 4X2BA 1U1KA 3RW7A 1OY6A 3DN9A 3HLUA 3LP1B 5IZHA 3KK2A 1T9TA 2R2RA 3M6XA 2UV8A 1T9YA 4Y2CA 5F0UA 2AYGA 3PIPQ 3UFCX 4OJ3A 2FQQB 2YNIA 2C2OB 2M52A 4HDGA 2VIHA 2CZVC 2Z8QA 5H9EJ 2HFOA 3PW0A 4O44B 5DDPC 4XDCA 2V4RA 2RNEA 5J2PA 3EDQB 3MEGB 4EYHB 3LALA 4X4QA 5SUHA 1HNIA 4QWAA 1TELA 5GAEU 3RW6A 4B3MF 4X4NA 4KH1B 2AKWB 2YTCA 3HHDA 3HT3A 1D9FA 2W2MP 4IFVB 1D9DA 1X5TA 2QN6B 1Y5IB 5ETPA 3D54A 1QUPA 1XERA 3N6MA 4ZVPB 2KZMA 3S6EA 3QAEA 3CJKA 2CXEA 1C1CB 5E3RA 2IRXA 2XZDB 4M1KA 1RTZA 4QW8A 4DR6F 2OD6A 2IYGA 1RA7A 2XMUA 2ZM6J 2M9KA 1DLOA 1G4CA 1J5OB 3L09A 4DCOB 1JLEB 4O3RA 3T9ZA 1FERA 4F3MA 3DDIA 2DR7A 3R8YA 3MAAA 3QPIA 3D0IE 1HI0P 3J80U 3QT5A 4JI5J 2WOMA 5KFJA 4NI2B 3S01A 4GVBA 4ZCMA 2DPJA 1L3VA 2M88A 1B99A 1H74A 1HWUA 3CPWR 3ISZA 5L8RC 4WFYA 3PTWA 4LF6F 1V5IB 3GFHA 4ED7A 3GFXA 1WHXA 1IKXB 4C9DA 3DRPA 4F0MA 5HAOA 3JSMB 3MURP 4RW8A 1MN9A 3BBFA 2GIQA 5IV3A 3OTOF 2HQ3A 2Y8WA 4CRJA 4OYAA 4F2RA 4ZIWA 4M5KA 4LFAF 2J5AA 4MH8A 1HWIA 2HZAA 2DNRA 2VBWA 2DGSA 4B3SJ 2QSFA 3TYTA 4N56A 1WUUA 3KLGB 3BGFA 1F2GA 5F8NA 4ANDA 1WG1A 4PQUA 3M2UA 3QO9B 1T0TV 2V8DA 3O8WA 4NZ6A 4ZVEA 2B51A 1CJKB 4ICLA 1IBKJ 1RT4B 3T5HA 2IA6A 2E1AA 3CCES 1NDLA 5DG8A 5D78A 1MMDA 3QT8A 4B17A 1JLBA 1XJWB 2EEYA 5HQLA 1IJFB 4P6QA 4C11A 3FNNA 1MROA 2XHWA 2MGZA 4OX8A 4V1Ak 3W2VA 5CCMA 2J76E 2XHCA 1SV5A 3F44A 3LP2B 3TQEA 4RUBA 1YX2A 1RAFB 3H2VE 5DDRC 4YHHJ 5DZ7A 2ZZMA 1Q8LA 2RU9A 5T7LB 4PG4A 1H73A 2O66A 2QMWA 1UJ6A 2R8IA 5L38A 2Z2YB 2R2UA 1LW0B 2R7RA 3VAHA 2DEJA 2XGQA 3PDNA 3EJMA 1NK9A 3OHAA 2QA4G 2UUCJ 2HAFA 3ZZUA 1Q8IA 3OVAA 3RB3A 4A8WA 2H54B 1L3TA 1T02A 2Y0SD 2DPIA 4P7VA 1HYSA 3LO3A 1ZZNA 2DISA 5AE2A 2OMLA 2DH8A 3N5FA 2ZH9A 3CJ0A 3NS6A 3T5JA 3OR1B 3NOGA 4DN0A 6FDRA 5C7PA 4K4UA 1LFWA 3BKUA 4NWBA 4CDIA 3G8SA 5CD4H 4EBDA 2ZJPQ 2NR0A 4LJMA 4DV7J 4DLEA 4OYBA 2Z2MA 1PKUA 2VFSA 1GMUA 4TLQA 3SFGA 2M5YA 5C24B 4OI2A 4QWCA 1U47A 2OIHA 1UWAA 1QY7A 2NZCA 2W01A 3MMAB 3PX4A 2A1BA 2VDHA 2IAJA 4TVAB 4M95A 1IKVA 2CG8A 3QIPA 1PJ6A 3D67A 1XMOF 4YS2A 1RBLA 1HNVB 2Q1LA 4DV5J 1SUQB 1E6VB 2DKOB 3IC1A 4E2FB 3B6BA 1EAYC 4OJ1A 1DQ8A 5B0BA 4OI1A 5KFCA 4ZIVA 1D1UA 1AUSL 4TU7A 5D0HA 2C2KB 1VBYA 4G6VB 4CIOA 3CT9A 3JTPA 2HVHA 2OELA 2ZKTA 1RAIB 3OT9A 2VOPA 2ZWPA 1S48A 4R8UB 3BREA 3EZ5A 4OYPA 3K57A 4KBIA 2W9CA 4IH5A 4ZLPA 2V8VA 3US5A 3EZUA 4ZLLA 3JSBA 3VQSA 3LW5C 3F56A 1AW0A 1TL3A 3JXOA 1SC3B 5KOWA 4H4MB 1KTVA 2IVFB 3BGRB 5B0FA 2KFNA 3J7Z5 3AOBA 2VV5A 2FVPA 1N4LA 2NXUA 3VAIA 3M30B 3LF0A 3R5AA 3TVKA 9RUBA 5J1EA 3KDNA 4HACA 1RLDA 5M2PA 4MK9A 1LWCB 2VPYB 3TO8A 3DLEA 4X4UA 2F1FA 4AYBD 2YNIB 2PEHA 3T1AA 3PJWA 4QR2A 1BWVA 1NJWA 2IDLA 4IFYA 4X62J 4K7QA 1TK5A 4ZVTB 3IXQA 2WVFA 2R8KA 4USHA 2XM3A 2AJQA 4F25A 3BGLA 3NEKA 3IG1A 1HNIB 4DV2F 4DZ6A 3BPSP 4BBYA 2OH2A 4WFAQ 1R8BA 4MFBA 2V8HA 2BOPA 5KFNA 1TFWA 1P9QC 4RKUC 5GAGU 3KNGA 1HNWJ 1JWWA 3VV2B 4F8RA 2D3O1 1KNZA 1ICEB 4EFAC 4ILLA 2VQFJ 3CJKB 4MYTA 4LSLB 1WOSA 4ZVOB 3VQTA 1UJ5A 1DLOB 4JI3J 1WHVA 3QZ8A 2HHXA 4ZLJA 1SCJB 1UEKA 2QMXA 4P2MA 1O8BA 2OMOA 3MAAB 3RYLA 4DF4A 2KTQA 1UW9A 4IUFA 1HBUA 4GVBB 3ET6A 5F3ZA 3E2EA 3L7UA 2FC9A 3FBFA 2DHSA 3OJSA 5KFGA 3CNQP 3K89A 1B70B 3UVJA 1S99A 1CULA 4YN3B 1VS3A 1WD6A 3ILLA 2HHPA 5EX0A 3TI0A 1YHQS 4YY3F 4QBUA 5M2UA 2V2ZA 4LIRA 1PILA 3MR2A 2FLNA 3SV3A 2R7QA 1SQEA 3U1NA 2O5DA 2WB4A 3CD7A 1UJ4A 3PVXA 5GAHU 3ILJA 4LIWA 1SKRA 5CXTA 3UR3C 2WVEA 1SJRA 2VFTA 3P5TL 1RT5A 3HO1A 3WX8A 1L3SA 2ZH5A 4OYZA 3OFHA 1NDPA 2HFUA 4WFBQ 1RTHB 1HPZB 2OPQA 4KPYA 2ZUAA 4PABA 3Q8YA 4O4RA 2B6AA 2FZGB 7FDRA 2MKIA 2EXUA 4LBPA 4OFZA 1H72C 1BQXA 1HQUA 1N5YA 5IWAF 3Q8UA 4DUZJ 3OSNA 2DRDA 2G0IA 4YB7A 3TZWA 3NS5A 2CUYA 4I56A 4ICLB 3SSSA 3M6WA 3LUYA 1ZPWX 4KGZB 2VDIA 2HMIA 4O3QA 3KG0A 4RW4B 2J6SA 1NB7A 5M2RA 4WE1A 1VQ4S 3DCAA 3JTNA 4ED5A 1YJNS 4C11B 4WZMA 3K8VA 4CO4A 4M5HA 1IM6A 2YNFA 2K3KA 4NZ0A 5IC4B 1VC5A 5HROA 1Q81T 4UZCA 4QPTA 4O0NA 2P8IA 5I3UA 1S10A 2VA3A 4RW7A 4I64A 1SJ4P 1VQYA 3OFGA 2YWEA 2XY7A 4P10A 2CQ3A 3TUIC 1XIQA 4LVNP 1F60B 5KG6A 4NCAA 2VASA 1S6UA 2GVZA 3I4HX 2PMZD 4ECQA 4K8RA 4ZVQB 3ZTQA 1B0VA 3Q8VA 3MXHP 2V50A 3PR4A 2KFYA 4KHPF 2XCPA 1WI6A 1T7PA 3KXDA 1FK9A 1SL1A 2VG7B 2C42A 1FRLA 2XNQA 2HKEA 2X7IA 5IOLA 4EWTA 1WHYA 3BH7B 2H4YB 3TZYA 3V81B 1X0PA 1U1NA 2C3UA 2C28A 2V5HG 1RQ0A 2NYIA 1ZM4A 2BX6A 5GADI 3RG6A 5L1IA 1Q86T 1RAJA 2MZJA 2U1AA 3FK4A 3PO4A 2OP5A 4HHUA 2D3OR 1KSPA 3RBXA 3QZ7A 3MPVA 4DL6A 4PXBA 4UUXA 3BYPA 1NB2A 3MMBA 1PSDA 1YGYA 4U95A 3MM5A 1S9EA 2OPRA 2CQBA 3CCQS 5F9LA 3BSOA 2IJFA 4PRFA 2HVIA 2EW9A 4NA2A 4TN2A 2VODA 3MEEB 1FWPA 4K50A 3U02A 2DYAA 1ZAXA 2LCWA 3MUVP 1X4HA 1GNKA 1WOPA 1IKVB 1X4CA 5HQ8A 2B8PA 2ZH1A 1T9XA 1TUVA 2AIRB 4L3NA 3Q2TC 4ENOA 3DM2B 3L7OA 2HYIB 4YMEA 4MIWA 4USKA 4USUA 1M1HA 1RU2A 4HVZA 4YEAA 3RUBL 5F8HA 4DBQA 4EUVA 2Y3YA 2B9XA 2PDAA 5HP1A 2JH3A 2GVDA 2VJUA 3PCOB 2B4PA 3TJ8A 3UN2A 3ZNUA 4KGMA 5A8RA 2ZDPA 1YBUA 4U7UD 1U09A 3CSKA 5BR8J 1N36F 4FYXB 1UZDA 4JBCA 1YBTA 4RPFA 3T3FA 3QT6A 4JI1J 1TR0A 3BO4A 4ECZA 2PI5A 3AXKA 3OSPA 2HNZA 4DV0F 1KLMA 1RAOA 1OY8A 4DEZA 4LUBA 3LGMA 2OTLS 2R7WA 4O3NA 1TL3B 1NSAA 1XNRF 3R3TA 4NYPA 2WVDA 3O5TB 1YDLA 3W9JA 2J0XA 1LK7A 2FHJA 3NG8A 1N34F 5J1EB 3Q2SC 4B08A 1IN0A 2XYGB 4JV5F 2FYXA 3GR1A 5L1LA 2WAQD 4OLPA 3DLEB 3SYZA 2KHDA 3FUYA 1BHNA 2ATCB 3G6VA 3AQPA 2I5JA 3CTRA 2YX7A 3K8WA 4QW9A 2DD8S 4KHRA 2DK2A 2OPPA 5GMDA 2YQ0A 4CO0A 5LMUF 3RB4A 3IG1B 1FXDA 4RUHA 1LWEA 2ZWOA 2V0NA 2VOOA 4MFBB 3GV8B 2DNPA 4IO9Q 2OEKA 1S1XA 3P5BP 1H98A 2CAJA 1XEZA 1B64A 5KG1A 3UD3P 4DJBA 5F9NA 2M8HA 2BKPA 1S0NA 3KKFA 1NUEA 4FKYA 3TANA 3CJTA 1FRKA 1PAUB 2RRNA 2DGVA 1VQLS 3MTJA 2EK1A 4ILMA 3C8YA 3N79A 5LXYA 1HL6A 4M8LA 5SZTA 4ECWA 1U25A 3OFEA 4PXDA 3CIZA 5KFRA 1KKHA 1LXNA 1XBWA 3H2UB 1Y00A 3KLFB 3EICA 3VZIA 4USWA 1O5JA 2RILA 2L41A 1FKPB 1T03B 4XPCA 4G1PA 1WC5A 5F3TA 2B9EA 3AH6A 5HQMA 4G1QA 1HBUB 2EKNA 3ET6B 4DL3A 4WTOB 5ETKA 1LOUA 1SL2A 4J9OA 2ASDA 3I6PA 4FXVA 1S7IA 4JI6F 1N56A 1QDUB 1CULB 1WG4A 5C2GA 1M5KC 3ETOA 5EUHA 2BOAA 2WTFA 2E1RA 2D7SA 1R3NA 2V9KA 4OI3A 3AOAA 1Y5LB 1WKKA 2JVOA 4OHZA 1OYEA 3M2VA 1N33J 3GTYX 4CQ1A 4DX5A 1YBAA 1YK9A 5B0CA 2H9ZA 1TL7A 4HT7A 2QO3A 2H51B 3TOQA 4EU0A 3FEYB 3K5PA 1RTJA 3SQGA 1VLYA 5K8PA 2VPXB 3CJQA 2Y1IA 3LAKA 2CJYB 2OPQB 1HR0J 3QGPA 4QU7A 1WELA 3AOCA 1SKUB 4A8XA 2D74B 4OYWA 3IBCB 1EP4B 2XWYA 3R5JB 4DX6A 3R5BA 1F6TA 4MTPA 3CJ8A 5GMEA 2CPXA 2WRMA 3MCNA 3C46A 2CQIA 5BYQA 2XYPB 5A0YA 1U8WA 1UETA 2AJ0A 1HA1A 2YVSA 3CGIA 4RUAA 4J9NA 1GMVA 4DQPA 3I55S 4PG5A 1HBOB 1IBMF 3MPUB 2JZ5A 3SMZA 4WE1B 3B8HA 5AJ3J 5DM7Q 3RU0A 3TEHB 4M5DA 1KOOA 2XQCA 2GGPA 3EGVA 2YNFB 3MEKA 4L72B 2OSRA 5HROB 2C2RA 2R7OA 3HD1A 1YRUA 5I3UB 2NZ4A 4PPDA 2BUNA 5CZVA 5T41A 4DUYF 3BO3A 2E29A 4UY8T 2W1BA 1URNA 1L3KA 3CCJS 3IGVA 3T19A 3EE3A 3J7A1 4DN9A 2NUUG 4J9KA 1J5EJ 1RWKB 1WKLA 3HDSA 4GO5X 5CYMA 4B3RF 2RHQB 1JB0C 2I1RA 1TKXB 4K4SA 2ZC4A 4FDFA 1OPIA 5IT0A 2FHJD 1FK9B 2DHGA 2XZTB 1WTFA 1ZS6A 3H0PA 1N54B 2XY5A 4HL9A 4ZPTR 2ZD1A 3DDNA 2RQCA 4FS2A 5D8HB 3D66A 5DQHA 3QJJA 4X4PA 1TTHB 3J81Y 3IS9A 3C6TB 1NZ8A 4Y2IA 2QZ8A 2H4WB 3C15B 1S12A 2K06A 4Z2XA 4M5IA 1RBOB 1M1KT 1FJEB 2HGNA 4B9SA 1GTHA 4RUCA 2HVZA 1F9EB 4NEYA 2DTJA 4KTQA 4W4MA 4A8OA 4HKQA 2OPRB 3MPWA 4NE9C 4IRDA 1HLWA 5HJYA 2YH1A 1U0HA 3CXCR 3TVZA 2FUG9 5KAKA 1Q16B 3MFHA 1YZ6A 1IBLJ 5HMXA 3KLHA 4WWSA 1S1WB 2M7SA 2KRBA 3LOUA 3QBCA 4DOZA 1YI2S 4XK8C 4J9UE 3NGDA 1KFDA 5KT6A 5CA5A 1A0OB 4KGVB 4KH0B 2N82B 4CT9A 3THVA 2NCKL 2F3JA 1H2VZ 3R5CA 1N5QA 1U26A 5DGAA 3H4DA 3G82A 5J1PA 4ER8A 1HW9A 2I2YA 5HP1B 3CJ2A 2GVDB 4C3KA 2XLIA 4RR5A 4O0IA 3RR7A 4CP5A 2CG4A 4IDKA 2GHPA 3BN7A 5KFXA 2K8GA 2E9RX 1R8AA 3CO0P 3H20A 3PX0A 1QSYA 4MKYA 2B4OA 1YITS 4ELTA 1KLMB 3ZZYA 3IWXA 4OI4A 2B0GA 3G4SS 2ZM6F 4DFMA 5IV4A 4QIGA 1R31A 2R7UA 2VA2A 5LM7E 1RWUA 4ZP8A 1JKHB 2EFOA 5ADZA 2V4JA 2BANA 3M32A 4JI5F 1TVRB 5DQGA 4PQAA 2AX1A 2MQ8A 1YSJA 2DNKA 1FNMA 5HSPA 3TA0A 1VHFA 4OZLA 3AAWB 4F4XA 3MR6A 2AEJA 2KL8A 2GMLA 1F9FA 3BEGB 3AD9C 3RR8A 2I5JB 3DRRA 3H2LA 4K4TA 2NPFA 1NK6A 2CNOB 5H9EK 2ZVSA 2OPPB 2BJ3A 4YDDB 2V2VA 3P49B 3GIRA 2GAHC 2OEJA 2CQCA 3QQCD 1QE1A 1LWEB 4TQRA 4LF7J 3I0RA 2IA0A 1NHVA 3D6FB 4GKKJ 2BJ1A 5HO4A 5T14A 4Y00A 2F8EX 1U45A 4JI0J 1S1XB 3BGUA 4LR9A 3X3UA 4DV3J 2CKWA 3K2YA 4YR0A 4D3GA 4AT1B 1RDRA 3CJRA 2B3TB 3KLEA 4ZA1A 3ZTOA 3QYYA 1IM4A 2QFIA 3ONQA 1VRUA 2GIRA 3MCSA 2WSCC 2BZ2A 3POTB 3DOLA 4B3SF 3BBCA 3MOJB 1K73T 2MQLA 2XMVA 5KFHA 4ZVGA 1HBNA 2BM1A 5HMYA 4U7CA 4ZDNA 4RX6A 2ZZNA 4QYZK 3W2WA 5L1KA 4OHVA 3CF5Q 4LF8J 3GCWP 3PACA 4DL0C 1IBKF 4G1QB 1M0SA 1UPPA 2HZCA 3T1HJ 2QYGA 1HNZJ 3NGUA 1S5ZA 4NLWA 4NLXA 4LRCA 3AJ1A 1K8AT 4U9RA 4AD6A 4X4VA 4J7CA 2HGMA 4C8MA 3FEXB 3KUEA 3C14A 1WNEA 2GHWA 3MMCA 1VQ7S 4NLVA 2R42A 4QZVB 5B09A 1ROFA 3H25A 2BXJA 4WK3A 1YWXA 3M8PB 3BQ1A 1N48A 2W7AA 5DDQC 5HL7Q 1TL7B 2VQEJ 3DMJA 3L7PA 5IFMA 4YHHF 2EWHA 1YJRA 3SQGB 4DQRA 2LP4A 2ZFHA 2D41A 1RWWB 3R1HA 2L9NA 4PG6A 2GZOA 3PO5A 3JSYA 2HFZA 3SV4A 2W4DA 2CQ0A 4UW2A 2LMIA 4USTA 2B9YA 4NLDA 1RHMB 4FN5A 2JNJA 1M5PC 2UUCF 3W5ZA 3W7BA 1NU4A 1NRKA 5B0GA 3V4IA 3IM9A 1FRJA 2O1PA 1F5BA 5A0YB 1NPRA 2GFFA 1L5UA 4DZDA 2IDEA 4BWJA 1OQ6A 2XMKA 2Y9HA 2GJFA 4JI4J 2HBYB 3UI3A 4OHWA 4UY85 3ZNJ1 2R8JA 4M5DB 2XTJP 2GGPB 3MM7A 2MTLA 4DV7F 3GE9A 3PKYA 2HPUA 4S0MA 3CCSS 4ZP7A 2W8KA 2ASJA 2JEIA 3D28A 4C8NA 4NRUA 3FBCA 3KG1A 3FKBA 1RHKB 2A6MA 2UXCJ 3QATA 2BYCA 2FHOB 2RRBA 2KKHA 4DSIA 3SCKE 1X0FA 1SC1B 2VF3A 3CEDA 4IOAQ 1AZSA 4F4AA 1D8YA 1XR5A 5KG2A 2R4FA 5DJBA 4F3OA 4IKAA 4ZJLA 2DGTA 4H4OA 2CWKA 5CYMB 2HS0A 3GV7B 1OIAA 2KJWA 1RHQB 2HURA 4DV5F 3LPEA 1MU2A 1FHTA 2GQ2A 2DBBA 2RVJA 5A8WA 1NNDA 3FGVA 2WVBA 1FJCA 4PG8A 3H42A 2GO8A 1X5OA 4WU2A 1VDHA 3DGVA 3PIOQ 2ZD1B 5CABA 1P27B 2KT5A 1UA1A 3NXZA 3EMTA 2VC0A 5IM0A 3FCWA 2OO4A 4O4GB 2AZ3A 3CCMS 3UNGC 1JIHA 4RJVA 2L08A 2MJNA 2R3VA 2FHMA 1J27A 4B9LA 1U2CA 3NKYA 2HWTA 3N0VA 3Q22A 2YBVA 2AYBA 3CO9A 4F04B 4OV1A 1S6OA 4KV8A 2V2QA 4EZ9A 3HD2A 1ZAVA 4QIWD 3I5BA 4ZHRA 4ZJQA 3I96A 2B8QA 2XC9A 3QIDA 1KVKA 2X1BA 1UAWA 3KLHB 2HRUA 3UO0A 1WSRA 3Q23A 3PZPA 4ID8A 4ANCA 1U24A 4ANEA 2HVDA 4X62F 1DQ9A 3ITHA 3KUHA 2RQMA 3IBWA 1BQNA 4Q2MA 3K5LA 1JXEA 4E8UA 1EJ7L 5D4PA 4MT1A 2ZHAA 3RAQA 2IM1A 3G82B 3LP0A 4ZN3A 4B9VA 3BKTA 1KC8T 4LBHA 2FJVA 1XMQJ 3FZ2A 2XMWA 3RRKA 3HFZB 4URQU 3FMWA 3GJTB 1HNWF 2J8SA 2BR0A 1FFWB 4IDKB 5B08A 3PEJA 4OQJA 3CCTA 2YWWA 3G6YA 4PXEA 2VQFF 4LT6A 4CO3A 3Q8QB 1U2FA 1T9VA 2VU5A 3KLIB 4PEOA 1X8DA 4KE5A 2ACMA 2F65A 2YNGA 3ZZTA 4JI3F 2VPZB 5KT5A 3OUYA 4Y6IA 1U8SA 4C2MA 3W66A 2E5JA 1XNQJ 2LQ5A 2OAUA 2F63A 2XO6A 1AB8A 3GP9A 1N8RT 2M2BA 1R89A 3BH6B 5LJ3Y 2KM8B 1FKOB 4X66J 2V4JB 5F8MA 2HQDA 2BANB 2QLFB 1Q78A 2OTJS 3HVTA 2ERRA 4KKOA 4OYXA 3FVYA 2N4CA 1H7WA 2HBZB 2HVEA 2ROEA 3EWGA 3UNYA 3O2IA 2BE2B 3DRRB 1S9FA 2JC1A 1S4EA 4J37A 2B4VA 4OX6A 3M8YA 1O0PA 4ZOSA 2QJ3A 1HIYA 2EFNA 2HG4A 4N8NA 4NX9A 4DFKA 2YNHA 4WU3A 2E9TA 3Q89A 1QE1B 1RE1B 2XMTA 3I0RB 2AV5A 3P96A 3AXMA 2BW7A 2CJ9A 4AFFA 2V9WA 4V19X 4CM0A 4A8YA 2ZITA 3R97A 4DMZA 1AXQA 4O3SA 4KJIA 3ISND 1RXOB 3SXLA 2V94A 4Y34A 2XCAA 1CS4B 3FCHA 3DOLB 1CG2A 1MLAA 4X65J 5IT4A 3V6KA 4WF9Q 2HQGA 3E51A 4NLYA 1MWZA 1TUWA 1S76D 1CC7A 1S0VA 3IAS9 2QA4S 1HBNB 1RTDA 2R7XA 4QJVA 3ZTPA 4FBUA 3W2WB 4QOTA 4DUZF 4DI6A 2YY3A 5B7WA 1UVMA 4CO5A 2AD9A 2A6OA 2CVEA 2JJ4D 3O3LA 2E44A 5KG3A 1Q82T 2CYYA 4Q7AA 2MQPA 4A8KA 2JFKA 3KDOA 4W98A 2J9CA 1Z4UA 3C3LA 2IFXA 3DGPB 1QSSA 2E1PA 2R8HA 2RB7A 2CQ2A 1B4SA 1ZZFA 3FFIA 1MWYA 2YKPA 3GLJA 3FSYA 5I42B 1OQ3A 3MMCB 3KTQA 3TARA 2Z56B 3KJQB 3CIMA 2HHTA 2BJEA 1NKBA 6FD1A 4CT8A 2XULA 4KT0C 1Q0NA 3DMJB 4OI6A 1X9SA 4NA1A 1B3TA 2CNKB 4ZS6A 3TNVA 2MQMA 4WPAA 2CNNB 5E33A 2A2DA 3THPA 1B0PA 2GCFA 1RT6A 2ASYA 3MF5A 4F4KA 2ZJRQ 4ED6A 2FVRA 3TWZA 1WC1A 3DNCA 2QLWA 4CH7A 2MZQA 2DH9A 3M9MB 1GQEA 5HI7A 4XTTA 4I7FA 3A3PB 1HMVA 3V4IB 1XR7A 3H5YA 2C3PA 1KEKA 4C8OA 2AYMA 2FTRA 4L75A 2F7VA 2LXIA 2BRLA 1R8PA 2EFQA 2IM0A 2BABA 4HH0A 5LT5A 3RBDA 4K4XA 1Y4ZB 4OLOA 4C98A 3MUMP 1XMBA 1VHIA 4E0DA 2AEFA 4WZQA 3B4DA 2YX1A 2ADCA 3MM7B 3R1LA 4CCHA 5DZ6A 1C1BA 1G2EA 1JLFA 1UCNA 2CPFA 2J9DE 3KMQA 4WJBA 3AD8C 3MZIA 4TNOA 1G7CB 2IRUA 3D6MB 3OBIA 1AZSB 4JB8B 1AT1B 3HKZD 4I6YA 3GSIA 4YP3A 5HATA 2FJDB 1FCAA 4GRSA 3DLGA 1MU2B 1SVDA 1CC8A 3AA8A 2N7YA 3CMAS 3L95X 4P52A 1KD1T 4DV6J 4ALZA 2G2ZA 2VBYA 3NMRA 1DURA 2HQCA 3H7HB 4L73A 5IM0B 4DR7J 1X9WA 3HM9A 3Q86A 5BR8F 3R5DA 2VG5A 4JI1F 1O6XA 3FSIA 3TR5A 3MECA 4UF4A 3GIIA 4JI7J 2AZ1A 4F4YA 2V4QA 2K3IA 4IG0A 4HDHA 2NLWA 4R0EA 4KV8B 3QSIA 4LBIA 4N7TA 4LFCJ 1CEZA 3NAIA 4DR4J 2BJDA 1OWXA 4NXMF 3CJ4A 4RU9A 4MIBA 4ED4A 2QGFB 1X4AA 3M05A 4OZ0A 3DXBA 4M5GA 3IN5A 3CJSA 4CLPA 4EZ6A 2UUWA 2JOQA 4OYIA 3GYNA 4YR2A 2UUAJ 2BDPA 2K7KA 2GV1A 5I3PA 4NLTA 4NCGA 1F3FA 1IKYA 5D0RA 1IXKA 4USMA 3UD4P 2CZ4A 5AXMA 2XNRA 3AQOA 3MCMA 3ZTRA 1PJ7A 1TK8A 1SH3A 2GMHA 3AB2B 2QG9B 4ZVSB 2E5LJ 2HAIA 3IRXA 1HHQA 1GXTA 2LQ9A 2RDDA 4FPRA 4ELVA 4IQMA 1S59A 2IIHA 1S1VA 1X9MA 5D15A 4IO1A 3UW1A 5U47A 3ETMA 2X3GA 1NK4A 2YNGB 2UVVA 1FTCA 4LSNA 1VFJA 4F4ZA 2KT2A 1U2RA 2IYIA 5DRKA 5KFSA 3I5CA 3HVTB 1HWJA 2DR8A 5ETSA 1UKUA 1RT7A 8AT1B 4C97A 2LECA 5J2QA 1YLXA 5F8IA 4OZ5A 2ZOFA 1X60A 5ETMA 2WBMA 2G9OA 3C19A 1N0UA 5E0OA 3SDEA 1LWFB 2MKYA 1UEVA 4Y28C 4MMOA 2HLUA 5J2MA 1FTRA 3CDEA 4NYZA 2CZ9A 2YNHB 3MM9A 3CCRS 3NNAA 2VPWB 4DSFA 1NJIT 4RNNA 5THWA 1Y0HA 2RS8A 3D7SB 3H4BA 1XK8A 1N33F 3IP0A 2RE1A 2FVCA 2I8EA 2QL5B 2NXEA 5DG7A 3ZO7A 1F3VA 4PZVA 4FP9A 3I9V9 4ECXA 2JEJA 3UWTA 4WFZA 5DLGA 3H8YA 2CQHA 1HR0F 1SH0A 3A8IA 1N6QA 2M3DA 4AQYJ 1X5PA 3BF4A 1RTDB 3HMJG 4DS4A 5HJXA 1S9GA 4G3IA 5F8GA 4DR2J 4LF9J 2VZ9A 3DOMB 2DH7A 3OXLA 3BKFA 5D0GA 4CZCA 3RJMB 2IM2A 2PT0A 3SCLE 3J7YU 1D9AA 2DEIA 4B02A 1NPPA 1RJJA 3LGNA 5E3CA 4Q43A 1VOMA 3NRBA 5A2QU 1BGXT 3CUNA 3N01A 1ELOA 5AJ3F 4UQTA 5HVFA 1RKIA 1S4FA 2G0JA 3M8RA 2LEBA 3TVYA 2ROPA 4XIUA 3PNIA 4W90B 2PN6A 4B9UA 4HI2A 1NXIA 3JB9k 2QA1A 3MOZA 3GIKA 1MG7A 1RLCL 4KGXB 1KS2A 1JMTA 2MKJA 4TXSA 1XWLA 1D3WA 2AJ4A 2BRKA 7AT1B 1P6TA 3JQMA 2P6SA 1J5EF 1QVGR 3KK1A 3EUNA 4ECTA 2XWXA 1RT6B 2J9DA 1NKCA 1RI7A 3ILOA 1TKTA 3DRYA 2RUGA 3M8SA 4DL7A 1RWXB 4AL7A 1FD2A 2DCLA 1H7XA 3GYGA 2QFJA 2VBXA 4I7FB 1RWMB 3VGUA 1HMVB 1T95A 1RTIB 3E01A 5KT7A 3B4MA 4I6AA 3DXSX 2BE9B 2ZKUA 1R0AA 4IR9A 2ZBPA 2FJEB 3MCOA 2J8AA 4Y2AA 1NJZA 4WTYA 4DFJA 3NBPA 2J9EA 2RQ4A 4HYKA 4I69A 1MMNA 1VQ6S 4WYWA 5IC6B 1R8CA 1F5CA 2HGLA 3QRPA 4MK7A 1QTMA 3A3NB 2XLJA 3G6XA 1BQMA 4J9QA 1ZAWA 1YZ7A 1BE4A 1SKSA 1JLFB 2W4CA 1VIXA 2GMJA 1UA0A 3HCXA 4JP8A 2OEMA 2K1RA 2KRRA 1RACB 2SXLA 1IR1A 1FDBA 2WONA 2ADBA 3MM6B 1GXLA 2ASLA 1R6YA
chains in the Genus database with same CATH topology
3BO3A 2E29A 4UY8T 4K59A 3MM8A 3EXCX 1IBLF 4C3LA 2JL9A 1URNA 1L3KA 2IRYA 4ZPBA 5A8KA 3CCJS 3MM8B 2BA9A 5K8MA 5A8KB 3IGVA 3T19A 3LP2A 1WF0A 4ELUA 4LQ3A 3SFUA 2C2DA 1SXLA 3J7A1 2G0CA 4DN9A 4YOEA 5H1SV 3K0JA 2XG8A 3ULHA 2NUUG 4J9KA 3PFEA 3V4MA 3VR1A 2FB0A 1RK8A 2CQGA 3H59A 3DLGB 1XR6A 3EYZA 1M5VC 1FVQA 1XC9A 1Q4RA 1VQNS 5T7LA 3HDSA 4I1TA 1CQNA 1ZBTA 4GO5X 3HJFA 2H5EA 5CYMA 1TKXA 3OTCA 4B3RF 1JB0C 4U6PA 2I1RA 2IVYA 3KFWX 4TKTA 1TKXB 4I68A 1RGVA 2DHXA 2MKKA 3CC7S 4K4SA 2ZC4A 2NSBA 4OX7A 1WWHA 4IH7A 1JLCB 3VF0B 2WB1D 4L6V3 4J9PA 3KHLA 1KN6A 1OPIA 5IT0A 3HI9A 2FHJD 2AF6A 2RSQA 2HWHA 4J9RA 1FKAF 4WFNQ 3CWJA 1IR0A 1FK9B 2DHGA 1YVFA 1WTFA 2IM3A 3FRZA 5KFVA 4R5PB 1N54B 2XY5A 4XDDA 3K7RA 4HL9A 4ZPTR 2ZD1A 2A3JA 2B7BB 2HQIA 3I0SB 3DDNA 3NMAA 1UFLA 3LPYA 5CH7B 4N47A 3NLCA 2RQCA 4FS2A 2NREA 3IR7B 4TLRA 3IA0A 2IMOA 5D8HB 1Z1ZA 1NK0A 2QYCA 5DQHA 2KYZA 1A9NB 4N8OA 4QPXA 5DLFA 3QJJA 4X4PA 2VG5B 4A8SA 3C6TA 2JSXA 2MY7A 2BQUA 1NJXA 5G0RA 3J81Y 3AHPA 3IS9A 4K5SA 3C6TB 4Y2IA 1HNXF 1IKWA 2QZ8A 3IS9B 3MECB 3FJ2A 3N28A 1NH7A 5CYQA 2YKNA 2KJVA 4ZCKA 3TAMA 2FDNA 4HLBA 4Q8EA 1X4BA 2YKNB 4Z2XA 5AE1A 2B7CB 1YRTA 3OL8A 4OJHA 5D4NA 2LA4A 2GA7A 3H98A 3OTBA 1M1KT 2R7TA 1FJEB 3GG0A 3G9CA 3OR1A 2XS2A 1VRTA 3BDEA 4KB7A 3HZEA 3PW7A 2MYFA 4H4KA 1HQEA 2HGNA 5JJBA 3MUTP 4B9SA 4CNZA 1HQEB 4PXCA 1GTHA 3VWSA 2U2FA 5C5JA 4RUCA 2EBEA 2HVZA 2DTJA 4KTQA 4A8OA 3NNCA 3TA2A 1JNRB 2MKCA 3HF5A 2N4DA 5JXSA 1YJUA 2OPRB 4HKQA 4WXWA 4RNFA 2JFDA 3MPWA 3VCDA 3ICLA 4ED2A 3G86A 4IRDA 2HNYA 3VZHA 2LEAA 4Z37A 4DQSA 1RT1B 3N5BA 2J6TA 2E5GA 2RS2A 2UVWA 2KHCA 4F3QA 1LFPA 3SI8A 2MQOA 2HS3A 1C4AA 4DS5A 4YDXA 2YH1A 4IR1A 1KONA 1FT8A 2I0XA 4Y2MA 3TVZA 3CXCR 2FUG9 2C3OA 2NUHA 4R0JA 3JYTA 3X1LB 1EETB 5CZXA 1TV6A 3DYAB 5KAKA 3CD5A 1Q16B 2DITA 1HFEL 3MFHA 2I38A 4H4KC 5HMXA 3KLHA 4DL5A 5C24A 5KFKA 1S1WA 4ES2A 4Y2KA 4HI1A 4Q45A 3M2RB 3HHLA 1S1WB 1C0TA 4YR3A 2WK4A 1DTTB 4USIA 1C0TB 2M7SA 5KFDA 2RRAA 4CTAA 3WC0A 2IC3A 1UWBA 2KRBA 2MPUA 3LOUA 4CTAB 3MEDB 2XEXA 4NL5A 3LH2S 1UWBB 4NCGB 4DOZA 4B9NA 2XBPA 1YI2S 4XK8C 4O3PA 1KFDA 5LJ5Y 3NGDA 1GAOA 1UVNA 2AU0A 4DG1A 5KT6A 3CDAA 4JV0A 4KAIA 4Q0BA 1IKYB 3D5MA 2CVIA 5CA5A 4DLGA 1MNEA 1OSDA 3D1OA 3DU6A 2F9DA 4Q0BB 1HNVA 2HNDA 4LF7F 5A6WA 4GKKF 2CQ4A 1E6YA 1E6VA 2N82B 3KJVA 2DGOA 3FQLA 2DNOA 4JI0F 1E6YB 4CT9A 3THVA 3PY8A 3KJVB 2M8DB 4DV3F 1GXUA 1KQKA 2F3JA 1H2VZ 3R5CA 3MMJA 2MY8A 3BSCA 5A6PA 1N5QA 1U26A 3QLHA 3DRXA 3T9NA 5DGAA 3THTA 2X1FA 4C8ZA 4LFBF 1WEYA 3HHLC 3H4DA 4A48A 5J1PA 4Y3CA 3ENWA 3SEOA 2HHHF 1W2IA 1UMJA 2MSSA 3BO2A 3NCPA 2CPHA 1HW9A 2KB2A 5EX3A 5LXRA 2I2YA 5HP1B 3CJ2A 1DTQA 2KH9A 1A7GE 1FRMA 4RZRA 1DTQB 4C3KA 1YG0A 3PHEA 2XLIA 2ZH2A 2AGQA 1S1VB 4O0IA 4U7UK 3RR7A 5EWGA 4N5SA 2CG4A 1OSCA 2YKOA 4IDKA 5CHCB 2FPHX 3DHXA 2UZAA 1FDNA 2GHPA 3BN7A 2Z4PA 1SJ3P 4R8UA 2N3LA 5KFXA 2K8GA 2E9RX 1R8AA 2AGOA 3M9OB 3H20A 3PX0A 3MI7X 3RTVA 1QSYA 4PWDA 4MKYA 2ZH3A 1ZTWA 4ED1A 2B4OA 1YITS 3CJ3A 4ELTA 1KLMB 2CJBA 3H5UA 4ID5A 3ZZYA 3WBZA 4LSNB 3IWXA 4B9MA 2OKQA 1TQLA 2DNGA 2B0GA 4ID5B 4OI4A 3V6DA 3G4SS 3MPYA 2ZM6F 2Y1JA 3TA1A 1S72S 4DFMA 2RU3A 2CPZA 2C22A 2FJAB 2DO4A 4KHMA 4NMLA 2O01C 4RBTA 1JX4A 1DBDA 2EKYA 2MJUA 4TU8A 5HMZA 4UOCA 3HHEA 3HX9A 4QIGA 2D3ZA 5BYSA 3HK2A 2BBEA 3FZBA 1OO0B 1R31A 4NLUA 3P3DA 4JUZA 4GKJF 2K7JA 2R7UA 3KMSA 1M90T 1FNXH 2OFHX 2YKMB 4KQZA 1JKHA 1WTBA 2VA2A 4LF8F 2NPIA 1RWUA 1VQSA 1IQZA 4ZP8A 1JKHB 2EFOA 2LDYA 4H4MA 5ADZA 2RDIA 1U6BA 2V4JA 2LYVA 3T1HF 5IT9Y 1TVRA 2MMYA 1TZ0A 1HNZF 2A10A 2BANA 1RT3A 3M1VB 3M32A 4JI5F 1TVRB 5K8OA 1H0HB 4X2BA 5DQGA 1RT3B 4ZP9A 4Q8FA 3M32B 2YKQA 4I67A 1U1KA 3BS9A 3RW7A 4PQAA 5KFIA 2M70A 2GC8A 5D3GA 5KG7A 3DN9A 2AX1A 3HVAA 3HFKA 1YSJA 1MW7A 2DNKA 3HLUA 3LP1B 5IZHA 4K0KF 1FNMA 3KK2A 3CDWA 3PEHA 3TA0A 2R2RA 1C0UA 1VHFA 3M6XA 2EBGA 3KK2B 2UV8A 4OZLA 2Y1RI 3AAWB 3SDEB 2KN4A 4F4XA 4Y2CA 2OSQA 3C2PA 2GW8A 3MR6A 5F0UA 3GMGA 5IS2A 2AYGA 2GMLA 3PIPQ 1F9FA 3BEGB 1OPZA 3RR8A 2B9WA 2OLWA 2I5JB 3UFCX 3DRRA 3H2LA 4XO0A 4OJ3A 4ATNA 4K4TA 2R2SA 2NPFA 2KM8C 2YNIA 1HBMA 1NK6A 5K9FA 4ZK7M 2ZVSA 2OPPB 4A47A 1UEUA 2M52A 4HDGA 5AXKA 4YDDB 2CZVC 2UXDF 1QM9A 3P49B 4URSA 1J2VA 2Z8QA 1Z2LA 5H9EJ 2HFOA 4GC7A 5KFWA 3ZZZA 5J2NA 3WZ0A 3PW0A 4O44B 5DDPC 2CQCA 4JV1A 3KHHA 4XDCA 1U4BA 1QE1A 1LWEB 4Q44A 4TQRA 5HLFB 1APSA 1AROP 1NK5A 3I0RA 2XGPA 2IA0A 2V4RA 1NHVA 2RNEA 5J2PA 4D3HA 3MEGB 4EYHB 4NYOA 1U1PA 3KNAA 1RT2A 5HO4A 5T14A 3LALA 4MIAA 4Y00A 2F8EX 2XZWA 5J2PB 4X4QA 1U45A 2VQEF 5SUHA 4I2QB 1RYRA 3RBEA 1HNIA 1S1XB 3BGUA 2IMWP 3X3UA 2Z0GA 4QWAA 2L9DA 2CKWA 3K2YA 1VQPS 1KLNA 5GAEU 4ED0A 2J0QD 2X51A 2CQPA 3N6NA 5AE3A 3RW6A 3NCRA 4ES1A 2PFFB 4YR0A 4D3GA 3OHBA 4B3MF 4X4NA 4C0HA 1GH8A 1RDRA 1FO1A 2B3TB 2D9PA 3KLEA 2YTCA 1CPZA 2B43A 4CI0B 4ZA1A 3OXFA 3QGIA 2D9OA 3KLEB 2LXFA 4I4BA 2W9BB 3HHDA 2E5HA 3QYYA 1IM4A 1LXJA 3HT3A 1D9FA 4FBTA 4IFVB 4DQIA 3ONQA 3PW4A 4C8LA 1VRUA 3POTA 2GIRA 3MCSA 1D9DA 2WSCC 2BZ2A 1N6QB 3MR5A 1VRUB 3POTB 1X5TA 3K5OA 3DOLA 2VH7A 1Y5IB 4B3SF 3D54A 1QUPA 2FLPA 1XERA 3N4WA 3N6MA 2C2EA 4B3OB 2KZMA 3MOJB 3S6EA 1K73T 3QAEA 3CJKA 1C1CA 2BACA 2MQLA 2XMVA 1C1CB 5KFHA 4ZVGA 1TAQA 5E3RA 2IRXA 4M1KA 1HBNA 4QW8A 2UU9F 4DR6F 2OD6A 3I9ZA 2BM1A 2L3MA 3OPKA 5HMYA 2CJAA 4U7CA 2IYGA 2DGWA 1RA7A 2XMUA 4RW9B 4BWMA 4ZDNA 4RX6A 4B3TF 2M9KA 1DLOA 2ZZNA 5F41A 2XI2A 5KT2A 3EXYA 3W2WA 1J5OB 5L1KA 3O6QA 1JJHA 1JLEA 3JTOA 3L09A 2ZE2A 1F0XA 2XO7A 4OHVA 1JLEB 4O3RA 3T9ZA 1K0TA 4JI4F 7FD1A 3CF5Q 1FERA 1I1GA 4F3MA 3MR3A 4ES3A 3PACA 2DR7A 2VONA 4DL0C 1IBKF 3CDUA 3QPIA 1M0SA 3D0IE 4G1QB 2HZCA 3GQCA 1FDAA 2CDQA 1HI0P 3WX4A 4NLWA 5BJRA 2GHVC 2WOMA 3OR2B 4NLXA 5G4DA 3AJ1A 5KFJA 2WOMB 1FVSA 3VAMA 5KTQA 1K8AT 1UFWA 4U9RA 3GILA 3I31A 3S01A 4ZCMA 2ATLA 2DPJA 1L3VA 2M88A 1HWUA 2OFGX 3CPWR 4X4VA 2NSCA 1BY9A 3ISZA 2RMLA 2ZBIA 5DQIA 5L8RC 4DSLA 2HGMA 4C8MA 2UV8G 4WFYA 3FEXB 3OL7A 4LF6F 1WNEA 2RQKA 1X5SA 3GFHA 4WFXA 1LK5A 2MHEA 1G1XA 4ED7A 2GHWA 4NLOA 3GFXA 2ILZA 3MMCA 3BZQA 2AWZA 1VQ7S 4NLVA 3WDOA 4QZVB 1WHXA 1ROFA 5B09A 1VQMS 3H25A 4A8QA 2UXCF 3M8PA 2BXJA 4WK3A 1IKXB 1YWXA 3M8PB 3V6HA 3BQ1A 4TY9A 1N48A 4C9DA 3DRPA 5KOXA 3JSMB 3DRPB 1U7LA 5A2QY 2W7AA 4OZNA 5FDLA 5DDQC 5HL7Q 3MURP 2GJIA 3DMJA 4IOCQ 2R2TA 3L7PA 5IFMA 2PD1A 3KK1B 4RW8A 3LAMA 4YHHF 2EWHA 2GIQA 3OTOF 1TKZA 2HQ3A 4RW8B 1YJRA 5GAEI 4F2RA 1FJ7A 2XY6A 3DC2A 4LFAF 3I5AA 3SQGB 2J5AA 4MH8A 3CVKA 1HWIA 2KXFA 2FGCA 5LSRA 4DQRA 2ZFHA 2D41A 1TKDA 3R1HA 3IAM9 2L9NA 5LMNF 2YH0A 4PG6A 4F4WA 3PO5A 3JSYA 2DNRA 2HFZA 3SZ2A 3SV4A 2W4DA 2XLKA 2CQ0A 2VBWA 4N77A 2DGSA 2QA2A 1HWLA 4UW2A 3G8QA 1KRPA 2LMIA 2B9YA 5KFOA 3CC2S 2VBZA 3NAHA 2G13A 4NLDA 4EO8A 1RKJA 3A8EA 1FXRA 3MD1A 4FN5A 2QSFA 3E01B 2N3OA 3G96A 3TYTA 4I0WA 4N56A 1M5PC 2JHEA 2PGCA 2UUCF 3BQ2A 3RRGA 1DAXA 1TP7A 3KLGB 2KT3A 4TY8A 3OLAA 3W7BA 1NU4A 3BGFA 1NRKA 2BV3A 5B0GA 3V4IA 2W7OA 3HHKA 1F2GA 5F8NA 1FRJA 2O1PA 3LQVA 1F5BA 3QMQA 3OXGA 5KFTA 2AJFE 5A0YB 3QGHA 3ENQA 2GFFA 1W2BR 1WG1A 1L5UA 2XB2D 4PQUA 3HHLD 3M2UA 4BWJA 1OQ6A 3QO9B 3DLLQ 4PQUB 1JNZB 1H2UX 2VG6A 2LDIA 2XMKA 3M2UB 5E2QA 2V8DA 3O8WA 4QR0A 3IR5B 1U48A 2RD5C 3VAGA 4NZ6A 2Z2LA 3QJPA 4ZVEA 2LXUA 3SSQA 2B51A 3SCIE 4NCBA 4ICLA 1SKWA 2DJWA 3CB4A 3UR0A 3VAKA 4PCQA 3PRDA 3QWUA 1RT4A 3UI3A 2FHKA 1BQMB 1KQGB 2VFRA 2MXYA 1RT4B 3T5HA 4FF1A 4OHWA 2LU2A 2IA6A 4UY85 2ZDOA 5K5MA 2YKAA 1U1RA 2E1AA 3HHNB 3C6UA 2R8JA 1FJGF 4YB6A 2CJKA 2E5IA 3CCES 1SC6A 5L9XA 5DG8A 5D78A 1MMDA 4M5DB 4X4RA 3MHYA 3RB0A 2DB1A 1KQSR 1PC5A 4B17A 2ILYA 1JLBA 4FVCA 5GVQA 3ENVA 5MLCV 2Q6BA 2J0SD 5FD1A 2GGPB 2Q43A 1JLBB 3MM7A 4DV7F 3GE9A 3PKYA 2HPUA 3CCSS 2YQ3A 3PJXA 1IJFB 4NA3A 4P6QA 4ZP7A 1LKZA 4O23A 4C11A 2W8KA 2ASJA 2JEIA 3D28A 1VQOS 4C8NA 2G4BA 4P7TA 3FNNA 4NRUA 1MROA 3MTKA 2XHWA 1LQ9A 2MGZA 3KG1A 4OX8A 1MROB 1R43A 1LV5A 2MGZB 3W2VA 4QIVA 2OJ3A 1SB6A 5CCMA 3W2VB 2J76E 1G3OA 2BYCA 2LU1A 1ZETA 3CE8A 1QSLA 2FHOB 2RRBA 2KKHA 4DSIA 3ISNC 3KHGA 2FLOA 1SV5A 3F44A 3LP2B 4PPZA 4ETXA 5JVHQ 3SCKE 1X0FA 2J0WA 1SV5B 4LF4F 2MKSA 3CEDA 3OL6A 4IOAQ 2X1GA 3H2VE 1D8YA 1XR5A 5KG2A 4RNMA 5DDRC 4KO0A 2R4FA 2ZZMA 5MAOA 1SJQA 1Q8LA 2RU9A 4EBEA 5T7LB 4X64F 5DJBA 2ROGA 3KK3A 4F3OA 4IKAA 4NZ7A 2DGTA 4H4OA 3BSNA 4K4YA 1RISA 3N9UC 4DL4A 4PG4A 4DSKA 4AXJA 5CYMB 4H4OB 2HS0A 3GV7B 1YQHA 1N0VC 1OIAA 2KJWA 3OTDA 4DV5F 5IQ6A 1JJ2R 1MU2A 2POKA 1FHTA 2CJQA 2GQ2A 2CQ1A 3OFFA 1O51A 1DJ0A 5DM6Q 2O66A 2QMWA 2DBBA 1S6QA 2RVJA 1P8GA 4RNOA 5A8WA 1NNDA