3LH2S

Crystal structure of hiv epitope-scaffold 4e10_1vi7a_s0_002_n 4e10 fv complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
64
Chain Sequence
HLTEYTLQANWFDITGILWLLGQVDGKIINSDVQAFVLLRVALPAKVEFSAKLADFSGGSLQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope.
pubmed doi rcsb
source organism Artificial gene
molecule tags Immune system
molecule keywords 4E10_1VI7A_S0_002_N (T88)
total genus 11
structure length 64
sequence length 66
chains with identical sequence T, U, V
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lh2S00
3B8HA 2BM1A 4MYUA 3UI3A 1KTVA 1N0UA 3EXCX 2I8EA 2IVYA 2XEXA 4QR2A 3LH2S 4FN5A 1P9QC 4ZCKA 2I0XA 4ES3A 1DARA 4ZCLA 1ELOA 4QR1A 2NPFA 4ES1A 4TNOA 2E1RA 2WBMA 4ES2A 5G4DA 3ZZ0A 1N0VC 1VI7A 1ZM9A 4MYTA 4ZCIA 3OQ2A 2BV3A 4QR0A 1FNMA 4ZCMA 1U2RA 2CVEA 1ZPWX 3ZZTA 4M1KA 3ZZUA 2ZITA 1ZM3A 1ZM2A 3B78A 2KDOA 1T95A 2L9NA 3B82A 1ZM4A 2EFGA 2J7KA 3E3XA 2BM0A 4MAKA
chains in the Genus database with same CATH superfamily
1UFLA 1CJKA 4QPXA 2DNPA 3JTOA 1IUJA 4JBCA 4HT7A 4PKDB 4BWJA 4LSZB 3BR8A 2WW4A 4MTPA 2RSQA 5B0GA 1SXLA 3TUPA 2PE8A 2E9RX 3K0JA 1O6XA 1YRXA 3T5JA 2GJ2A 2WVEA 5JMNA 3H5YA 2DY9A 3SDEA 1S5ZA 5AXLA 2CZ4A 2XG8A 5GMDA 3SDEB 2QA2A 1GNKA 1FNMA 2VPZB 4O3OA 4PWDB 2J9EA 4MKVA 4ZP6A 2XNRA 4QYRA 1OY8A 3D1QA 3KNAA 3L3CA 1SCJB 1FXDA 2HVHA 1J27A 1XQIA 2OSRA 1KVKA 1HLWA 3GYGA 1UAWA 3AD8C 4NLTA 4OQJA 4ZVFA 2MSTA 3RW7A 1WEYA 3K8WA 5GVQA 4BWMA 9RUBA 5HVGA 4YP3A 3PKYA 5B08A 1FT8A 1WG4A 1BWVA 1S4FA 2NUHA 1VLYA 3POTA 2AYGA 3CDEA 4LREA 4MT1A 3R2DJ 2HVDA 4NLWA 4WK3A 3KLFA 2HHSA 1RHKB 4I6YA 4P2SA 1Q0NA 4USVA 4O3QA 4K2XA 3VQTA 4X2BA 5LOQA 1HHTP 3MZIA 4ED8A 2C28A 4DSIA 2VL1A 1VRTA 4TU8A 1MW7A 1S7IA 3GIMA 3N9UC 3PG9A 3QQCD 1YJ9S 2C2KB 4RUAA 2VZ9A 3HT3A 2J9DA 3L09A 4DQPA 4W90B 3AXMA 4KV8B 2YKMB 4TY8A 5B0BA 1LQ9A 2ZKTA 1VC5A 3JYTA 4WYWA 2ZD1B 5HROA 4L74A 2QRRA 1AFJA 2H3EB 1WI6A 3R2CJ 2WBRA 4CIOA 3D6TB 2KYZA 4J9LA 4IFVB 3ZFVA 1JLFB 3JTNA 4M5DB 4X62F 1FRIA 4Y65A 4KB7A 4C48A 3QO9A 3OHBA 1X9MA 3R5DA 3D2WA 2D3ZA 5HI7A 4O3SA 5D3GA 3CD0A 3BO2A 3P5TL 5DGBA 5EGYA 1FVSA 4NL5A 2Z2LA 5KG5A 4YQWA 4Y6IA 2HIQA 2RUGA 4FPRA 4G1QB 4ZVEA 4RNOA 1RXOB 1G3OA 1RT4A 1S6PB 1Y3KA 4L73A 4DPXA 1QTMA 1DLOB 2CPDA 2OLWA 2LLZA 3CCWA 3H59A 5L9XA 4I2PA 1OQ3A 4O4GA 3P5BP 2KO1A 2QTWA 2RIJA 2XHWA 5HMYA 2NSCA 3CMAS 2F40A 1UEVA 1YX2A 4YB6A 4PZVA 3G8TA 3TJ8A 3HSGA 2GAHC 3U1MA 4Q7AA 1JLFA 4M5DA 3VCDA 4C8YA 1N52B 3CJQA 3EPGA 1KLMB 1KKHA 4DR5F 3AD7C 2MZJA 3W5YA 4FS1A 1N6QB 1C4AA 2XMKA 1RU2A 3V81B 4AD6A 4DR3F 2JWNA 2ASDA 1P6TA 3D28A 3J80Y 1KP6A 3TZZA 4C8NA 2BX6A 1DY3A 1PCAA 1RJJA 4YB5A 5KFYA 1QAIA 3PKMA 2PEHA 4CCHA 5F8NA 2A18A 2E1RA 4X65J 2FHJA 3AOCA 2UUTA 5D0HA 2LDIA 1ZA1B 1Y10A 4MJKA 1X4BA 4J9KA 2DPJA 2DIVA 1IKYB 4LBIA 1NK4A 1U2RA 3QATA 1U6ZA 1RYSA 3LGHA 4LRAA 3QRRA 4QU7A 3V5RA 1RLCL 4ZVQB 2CG4A 1IKXB 2ZH6A 1U48A 1GEHA 2IC3A 3KLIA 3MM6A 1NH7A 3NOGA 2CQ4A 1U1PA 4OZ3A 2VASA 3F41A 1DHMA 4NYZA 4Q0BB 4X64F 3CCVS 2IBKA 1SJ4P 1FJCA 4TQSA 5HO4A 3HFVA 2DRAA 1RE1B 2BE9B 1RT7A 3UD5A 4I2PB 4O4GB 4OYXA 1IJFB 2ZVIA 1HNZJ 2G4BA 2DK2A 5T7LB 2MZ1A 2B9XA 2F8MA 2G1DA 3H42A 2BUNA 3VQSA 4PQUA 2CQPA 2FZGB 1Q8BA 2E1AA 2Z2MA 4FBUA 4XPCA 2YX7A 4F4ZA 1HI1A 3OVBA 4NZ7A 2LQ5A 2OPSB 3Q86A 5ETNA 5KFOA 3MEKA 3DRSA 1S0VA 2H48B 1W2IA 3P3DA 2H5JB 4MAKA 2I6WA 1YSJA 4Q44A 4KPCA 4IO9Q 2FVQA 2IJNA 2G2OA 2XTJP 1NK8A 1SKSA 4PWWA 4FF2A 4C0HA 4RL1A 2KVQE 4ED3A 3GV7B 3TOQA 2HMIB 1CEZA 1BGXT 1HWKA 6FD1A 3R7BB 3H2VE 4C7QA 3BQ0A 2I38A 1QSLA 2WK4A 3AOAA 4PYAA 4MK9A 4FXWA 5IC4B 4U8VA 2F63A 4HDGA 2Y1JA 4DN9A 4NX9A 2W8LA 1E6YA 2HWTA 3HLUA 4OX8A 3N6MA 4KT0C 4DL4A 1M0SA 1Q78A 3EGWB 4N8OA 3CSKA 5DDQC 5LMNF 4KIAA 3H0PA 2J9CA 3GCXP 1C0TA 3SXLA 2BJ8A 2CQHA 1T95A 2KDOA 2L9NA 2GO8A 2QLFB 3K8VA 5CZVA 4ZHRA 4IUFA 1OMSA 5CA5A 4DR7F 1MWQA 4DCPB 3EM1A 1EJ7L 3MR6A 1IBCB 3C6UA 2J8AA 3I4HX 4IH5A 4JP8A 3S8SA 1CG2A 3VZHA 3BGFA 4F2SA 2CKWA 3TP2A 1BQXA 4PPDA 4WP9A 4ZIVA 3RBXA 1CJUA 3W62A 4CLPA 3AD9C 3OL7A 2XC9A 1S9EA 1V3ZA 3DLEB 1I51B 2CJXB 2DH7A 3GYNA 2CQ2A 3IM8A 3TA1A 9ATCB 3FJ2A 5EWGA 4QR1A 3Q24A 4JV1A 3FBFA 2ZWPA 1FWKA 1I94F 2UU9J 5AT1B 4RO0A 3ENVA 3TZYA 3RGIA 3HDSA 3UD4P 2FC9A 1RTJA 1RT7B 1S10A 3PDNA 3G6YA 1S9GB 1TL5A 4I0WA 4DBQA 4X4OA 2VQEF 1ZM2A 4ECYA 2AD9A 2XCAA 4ZJQA 4UY85 5B0AA 1NPPA 4RW6A 4V1Ak 5DLGA 2EFGA 2OEKA 5KFRA 3BKUA 4UZCA 3SCKE 3ETOA 5IT0A 2QN6B 4C8OA 1KEKA 4ZS6A 2DO4A 4ECWA 5LL6d 2GIFA 1FDNA 4I69A 4P52A 3G9CA 4LRDA 2RD5C 1RT6B 2WONA 3VV2B 2V2VA 4ZN3A 2UXDJ 4HR2A 3K5NA 2JHEA 4PQAA 1RWVB 2CZVC 2WSCC 4EBCA 1U8SA 3W5ZA 2I5JA 1PBAA 1Q4RA 2EC2A 1VK8A 4NRUA 3GSDA 3PHTA 4WXWA 2BANA 3WDOA 2M8DB 3CB4A 3OQ2A 1NPKA 3CDWA 3ENWA 5DZ6A 1N33J 4FYVB 5IC6B 2E5LJ 4DR6F 1KVIA 2CNLB 3A4TA 3PNIA 4FNIA 5KFBA 1NH8A 4KYZA 4F04B 1QVGR 2AWZA 4O3PA 1HI0P 3HFZB 5L39A 5E3RA 4QOTA 3PO5A 4X4UA 3I32A 2N3LA 4RLEA 3MUMP 1NPRA 2DCUB 5ETKA 4K4YA 1N6QA 3GFXA 3RR8A 1K0TA 2V8PA 1SH0A 4P7TA 3QFHA 3SQGA 1HPZB 3CCUS 3MR2A 1YHQS 2V8GA 2UUCF 3W8PA 4J9UE 5HBMB 5IM0A 2ZFHA 2IDLA 3I87A 2F4VF 1QY7A 2MQ8A 3KDNA 5J2NB 1TKXB 4QWBA 4E8UA 4ES3A 1BWEA 1WOSA 5LT5A 3UN2A 1CULA 1OS5A 1REVB 2VC1A 1WKKA 2BOAA 4P2FA 1N34J 1A7GE 2AX0A 4TLQA 4WFYA 5I4MA 2E1CA 4FDFA 5DRKA 2Z30B 2R7VA 2ZBQA 1TFWA 4ICLB 1EIYB 5BYRA 1VC0A 2WTFA 1R89A 3FMBA 2J9DE 4F50A 4O4RA 3K5OA 3QT6A 1LW0A 1UJ4A 2BW7A 1F6TA 2OJ3A 1UVMA 1NAQA 1T3OA 2BVZA 2KH9A 1PIEA 1KQSR 1ZBTA 2B5JA 1KOOA 2VG7B 3D67A 3OPKA 3PJXA 4M5KA 3PXGa 5L1LA 4K0KJ 4JV5F 2HAFA 4ZPTR 3PW7A 2G2YA 2WZ1A 3BH6B 1T7PA 4BC7A 1RKIA 3HULA 3M8RA 4KHMA 2Z2YB 5KT4A 1D0EA 2HHHF 2Y0SD 4FF3A 2BBEA 3M8YA 2YKOA 3NGTA 2MJUA 1EQ0A 5LMUF 5E41A 1DAXA 2B0GA 2QMUB 1RBOB 3BN7A 1NK7A 2NXEA 2PDAA 1HR0J 4DSJA 2LDYA 4CT9A 2EFOA 2YNGA 3VF0B 4DPYA 3IWNC 2AJ0A 1S12A 4HI1A 1K47A 3M6VA 3TRGA 4JI6J 2X1GA 4N41A 1HL6A 3ENQA 5CYJA 4AL5A 1FA0A 5CYMA 4ZVTB 3ULHA 4NOHA 4FF1A 1RT1A 1F5BA 1P1LA 4NLUA 4UOCA 3CC7S 2QFJA 3O2IA 4KO0A 4D3GA 5I42B 2CZ9A 3W1YC 4MKBA 4OHZA 1AB8A 3RBZA 1U26A 3UR3C 5C2CA 3QGIA 3CCRS 3T5KA 1X7VA 3MEDA 5HJYA 3PEHA 2OMOA 4OFZA 4GKKF 1C0UA 4DV3F 1HQ2A 3OJSA 3AH6A 5J2QB 3GIJA 2IPOB 4HHJA 1B0VA 2K3IA 1NJXA 2QGFB 2YWKA 2OO4A 3QSIA 5KG1A 3CJ4A 2W01A 3KMSA 3FFIB 4WFZA 5ETOA 4J9OA 4YN3B 5HMZA 4Q43A 1NK0A 4DSLA 4ICLA 2QG9B 4PQUB 2O01C 4P9SA 4U8YA 2EKYA 3BYRA 1RTIB 1PGZA 4CRJA 2VA2A 4DPTA 2KFZA 2EXUA 1HARA 3O1LA 3GPAA 4ZP9A 4TVAB 1TK8A 2PIIA 3DDIA 3TW0A 4YY3F 1NJYA 3DDKA 3V81A 2BKPA 4PABA 1FEHA 1RI7A 3GU0A 3GV5B 2BYCA 2OGUA 3KK3B 1VK3A 3DLKB 2VKZG 2F8HA 3T1HJ 1RTZA 2MZTA 1N0VC 1SC4B 4RR5A 2E1MC 3MGJA 2FVPA 2RKIA 1M1HA 2DR7A 4OI0A 2XLJA 4DL5A 4PYDA 2YXLA 1C1CA 3W2WB 3MUTP 4MKYA 3ZO7A 1X4CA 3DFEA 3P96A 4AUKA 1JLAA 4B3SJ 1N56A 2BJDA 2YNGB 2BA9A 1P9YA 3OXLA 4TLRA 1S1TB 2V69A 2ZDPA 1E6VB 4K4TA 3HM9A 1TKZB 1TV6B 1YLXA 4P72A 3KXDA 3PW0A 2MY7A 3Q83A 2N7YA 4DL3A 1HBNA 3OL6A 5IM0B 3GONA 3KHGA 1RAJA 1FJEB 4DQQA 3MPVA 2IVFB 1U1NA 1NCLA 4FXVA 4DV0J 2RU3A 3KG0A 3PRBA 2CRLA 3FEZA 4BCAA 1R0AA 3MPDA 4C8LA 3CJ0A 2CPEA 2ZH5A 1ROFA 2PN6A 3VAIA 2Z8QA 5HP1B 4QU6A 5DZ7A 4LFAF 1GMVA 3LP2B 3TUJC 2E7WA 1TAUA 3ZTRA 3ZZTA 2XMTA 2XZDB 3ZXWA 4DG1A 4QWDA 1K9MT 4Q8EA 1NDKA 1RWUA 3QIDA 5A6PA 4LF4J 2XSJA 3GFZA 1SJQA 1KC8T 2ZZMA 2AGQA 2UXBF 1S1UA 1SUQB 1IWGA 1RTJB 1U24A 3LAKA 3FK4A 3V6HA 2HHQA 3J81U 1G4CA 1LW2B 2BJ1A 3MR7A 4NE9C 1F3FA 5GADU 3OW2R 3TNVA 4C9DA 1KHVA 2B4UA 2CQDA 2V2ZA 2VDIA 2E7VA 3TAMA 5FLXY 3CO0P 3M30B 1Y11A 1MG7A 1NB7A 1XMQF 4L72B 3NGKA 3NWGA 3W65A 3GQCA 1QJHA 4JYAJ 3D3CJ 1Z2ZA 1HWIA 2GHWA 2KRRA 3GJTB 2A1BA 4MIWA 4NEZA 4O0NA 3CGIA 3N28A 1BLUA 3TJ9A 1Y5IB 1GAOA 2HFUA 3HHDA 3CEDA 3MR3A 1U1QA 1KLNA 3U7JA 1HD1A 4WP3A 2OAUA 3OR2B 1U1OA 4ZPWR 5J1NA 2WOMA 1BQNB 1ZAWA 2KT3A 3OV7A 4R8UA 4CO3A 3H25A 2E5HA 3I5AA 2F9JA 1IWAA 3KJQB 4ZJOA 1S57A 1NSQA 1SL2A 3N6NA 3OJUA 1S9GA 1IXKA 4DPUA 2KG1A 3M6UA 4PWUA 4OV6A 4DSEA 3CWJA 4Q8FA 3LW5C 2KFYA 1IBKJ 5J2PB 1B0TA 4HT5A 5CD4H 2KTQA 1NDCA 2WB1D 1K0VA 2DEJA 4B9TA 1IKWA 1EKSA 3FBCA 3MAAA 4ECTA 4FXDA 2PMWA 1XTZA 4OYIA 1APSA 1FDAA 1NUEA 2ILYA 4QR2A 1VQMS 2JX2A 1J5OB 2AEFA 2BACA 3E51A 3MDFA 1XBWA 3QO9B 1R8CA 3PYGA 2XMJA 3FMWA 4YB7A 2FVCA 3SIPB 1RHUB 5CCLA 2YY3A 1DTQB 3QT5A 4LT6A 3FQKA 6AT1B 3HVRA 2D9PA 2HVIA 1UWBB 1JLEA 3WIUA 2L9DA 2Y8WA 2HHUA 3GE9A 4UF4A 4O3RA 3C6TA 1C0TB 3BR9A 2OPSA 3UDEA 4Z7CA 5J1EA 2MGZA 2XQCA 4DFJA 4LFBJ 2EI5A 4EEYA 1VOMA 3MM5A 4HACB 1TL3B 4M5LA 2HS4A 2ROEA 3E8OA 2GX8A 3MPUB 3QPIA 4HTJA 1D9DA 4DV2F 1SQGA 2QJ3A 2GC8A 2LVWA 1S97A 1S76D 2V4JB 1HMVA 2Q43A 2XNQA 2D41A 5KOWA 2XY7A 4N77A 4EO8A 3UI3A 5IQ6A 5C5JA 4NYPA 3NGDA 4U7UD 1I5OB 1VQ8S 3Q8UA 4J37A 5CD4A 2BJ3A 3FUYA 2HNZB 2CXEA 3LGNA 2XB2D 4C0OC 1S9EB 4OZNA 4R8UB 3OTOF 2FD2A 2CIMA 2V9WA 1H2TZ 4U7CA 2MGZB 1R0BG 3RJMB 1UEUA 3EZUA 2RF2A 4GVBB 3SYZA 4ECRA 4WF9Q 2OPQA 4IKAA 4EUVA 2V94A 3QT7A 5H1SV 4X4TA 1N5YA 4K4ZA 2E7XA 5MLCV 1AUSL 3MAQA 1PJ6A 2EFQA 4H4MA 2C22A 1M5VC 3DLHA 2GMJA 2LA4A 3G8QA 4B9UA 1GK8A 4OYOA 1LOUA 4LF8J 1TMJA 4F26A 1T8EA 2G1HA 4DR1J 1HMVB 5IT9Y 4ZVUB 1Y9OA 2YTCA 3DHWC 5ETMA 4CI0B 1UTAA 4ZK7M 2NXNA 2XZTB 5J2PA 4Q0BA 3SMZA 1QUPA 2MKIA 1ICEB 3T3FA 1Q82T 1LFPA 1NLKL 3EGNA 5KT6A 3MUVP 1CS4A 2ALYB 4RPFA 1DZ5A 4ZCLA 3EZ5A 1IN0A 2Y1IA 1RDRA 3I96A 5JVGQ 1LV5A 2B8QA 2B6AB 2D3O1 1FCAA 3A3PB 4OJ3A 4Y3CA 2ASYA 2B4VA 3UCGA 4N76A 1JLCB 2VBZA 4QYZJ 2EBEA 5DLFA 3IWXA 3M2UA 4XTTA 4ED4A 3SFUA 4ATNA 3R6LB 3BYPA 4K2JA 4CH0S 4CZCA 3EICA 4DFPA 1RKJA 5A0YA 5HK4A 1RT3B 2ZDOA 1TL1A 1VQPS 4EYIB 2AW0A 1DTTA 2C2OB 5DG8A 2E5IA 4WU3A 1TL1B 4TN2A 1S1VA 3JSYA 4WTOB 1UVNA 2I8EA 1TKXA 3F56A 1K1SA 4IRCA 2M88A 5IXUA 4D3HA 2RMLA 3FSYA 4PPZA 2VQFJ 2YWHA 4MK7A 4B3MJ 3W60A 1KVJA 3KFWX 3QIPA 1ELOA 3EJMA 1M5OC 4J9PA 1PC5A 1UVKA 3OR2A 5D0EA 2HNYB 1MLAA 4OYAA 3BBCA 3DGVA 1M1KT 1Q8KA 2VUGA 4XO0A 3GWCA 4C11A 2EVZA 3RG6A 3MF5A 4J9QA 4TY8B 5BR8J 2KG0A 3SZ2A 2AP6A 2PO4A 1RTHA 1S4EA 2V5HG 5ADZA 4RNMA 1U6BA 2YNIB 4RJVA 1PILA 2H4WB 4ZIWA 3PW2A 2HZAA 4X66F 2GVDA 2XLKA 1JJHA 5K8PA 1LW2A 1JJ2R 1NRKA 3OFGA 2V0NA 4UOFA 5GMEA 2XYGB 4ID5A 1CQNA 2RAQA 2VB6A 4Y2KA 3UDCA 3KHHA 4DR2F 1KQFB 1J5EF 2FJWA 1VQKS 4OJGA 4ITSA 3GIRA 2VD3A 3ICLA 1PC4A 1YRUA 2APOA 1U02A 1RT6A 1Z2LA 2WONB 3OSNA 1VQLS 3K5PA 1IR0A 2QLXA 2OPPA 3IS9B 5AJ3F 2E44A 3KUEA 2R2TA 3V6JA 2LQBA 2IHR1 3G86A 1DURA 3VAJA 2VICA 4ZLJA 3RB6A 2PI5A 5HQ8A 2KYXA 2EW9A 3NGSA 4WIQA 3HZEA 3U1NA 1BC6A 2R7QA 4LIWA 3T9NA 1JLBB 2J5AA 5A8KA 2KZZA 4FBTA 2LKZA 5DDRC 1R0AB 3OFEA 3KK2A 3CCLS 1M5HA 1Q53A 2M4MA 3CNQP 5D78A 1HA1A 3MMAB 3AY0A 3Q8SB 1OYDA 5FJ4A 2M8HA 2EFVA 2EEYA 4BHQA 3KNGA 1HNWJ 3NMAA 1FRXA 2VH7A 3FRYA 2PD1A 2J0QD 2PMHA 2P6TA 4NRTA 3NNCA 1PYTA 2OUGA 2V4JA 1GT8A 2AMCB 1N0UA 2XULA 4UZBA 3RB0A 3PYDA 4RUCA 2DGOA 2B51A 4ETXA 2QE5A 3U1LA 5ETVA 1RCXB 4CLZA 4CM2A 3JB9k 2DR9A 2Y1RI 2PMZD 2B4OA 4CM0A 2L9WA 2RVJA 3QAUA 4C11B 4RUBA 5H9FJ 1Z1ZA 2C2MB 3J80U 3SV4A 4EBDA 2ADBA 4C3KA 3C6TB 1U2CA 1D1UA 3BH7B 4ES2A 1AUDA 4GO5X 3EUNA 3CJ2A 1UA0A 1K1QA 4K8RA 4QR0A 4QIVA 1JK9B 2M9KA 3ZNUA 2GVZB 2FJVA 3OT9A 2RQKA 3PYEA 3TI0A 3LP0A 4F02A 3H2LA 3QT8A 1XNQJ 1FK9A 3BDEA 3D9BA 2JEFA 3W2VA 3CW2C 4DQSA 4LR9A 2NCKL 3BEGB 3GCWP 4AFFA 2DBBA 3IGNA 3JSMB 4PG4A 5A0YB 2MLXA 1L5UA 3G6ES 4XDDA 3EXCX 3TVYA 4K4XA 1QAYA 2AJ2A 3D6HB 4MFBA 5HVFA 4JI7F 1WSVA 3C15A 4IFYA 3K58A 3VAFA 3ZTOA 3ZTPA 2J0SD 3MCSA 1DQAA 2PI4A 1WC3A 2VHGA 4CH7A 4ILLA 4OIXA 1BQMA 5CHCB 2HK2A 4ZVSB 2CYYA 3TX8A 3TVZA 1VJWA 3U27A 5CABA 2DNHA 3D66A 4WFBQ 1X4EA 5F9LA 4OI3A 1X5TA 1YJVA 2DGUA 2JEJA 2HNDB 2N4CA 4HDHA 2YKPA 4M1KA 4AE5A 4C98A 1FFSB 2NXUA 3FBEA 5F8HA 2KFNA 3ONQA 3KLHA 5LSRA 1Q5YA 1HPZA 1XN9A 1VQ6S 3PX6A 3DI6A 1NHKL 2F4FA 2PT0A 4DR5J 2QLJB 3E3XA 1WNEA 5CYMB 1VHFA 2VG7A 2XS2A 1JIHA 2MSSA 2XM3A 4JI2J 4DR3J 4LJMA 2YWGA 4HH1A 1MN9A 2W2NP 2OEJA 3LAMA 1VC6A 3WC2A 1RZMA 3LWLA 2FQQB 5EWEA 1T9WA 2FJBB 4CLYA 1H73A 5KT3A 3HVAA 1HWLA 3CJRA 3MMCA 3L7OA 2OEMA 1FKPB 2Y3YA 1NNDA 2O3DA 2BV3A 2HRYA 2JC0A 4U7UK 1MMDA 5L1IA 2J7WA 4F8RA 2JSXA 3M1VB 3KWMA 3V2UC 3LA0A 5C25A 3BS9A 2AJFE 4RX6A 3V4IA 4B3TF 3C3LA 4DOZA 2XMAA 1K8AT 3OLBA 3KLEB 4ZPVR 3FEYB 2B5JB 4JI8J 4NLXA 3MR5A 3KMQA 4PXBA 3UN3A 4ECVA 1NKCA 2DR5A 1S77D 2YX4A 1PBUA 3T1AA 3S01A 1YJNS 1WUUA 1BXNA 3W7BA 2Z2ZA 4YB1P 1L3UA 4JI0F 3L7PA 5C42B 3PX0A 5G0RB 1W26A 3RRHA 2VG5B 2K06A 3IM9A 2MDAA 4WXOA 4JV2A 3J7AN 1JLEB 4I68A 4HTIA 2YX1A 2J6TA 3M6WA 2WOMB 1C2PA 1HQUB 2FY8A 3GJRB 3OTBA 3RRKA 5K8OA 1B3TA 4OX9J 1TKDA 4GVLA 2HBRB 1EZZB 3T1YJ 5H9EK 1NJZA 1CC7A 2MQQA 1AROP 3PTWA 3GB0A 5LSOA 3CCES 3GLJA 1JMTA 1U7LA 3T1HF 1Q7LB 1ZZFA 1UW9A 1WHVA 3NS5A 1FEEA 4QIFA 3MI7X 1PKUA 2IIHA 1TELA 2XI2A 4X4PA 4FYYB 3PW4A 4RW9A 2QO3A 1VQ4S 2H1YA 5LSLA 2DH9A 2CPXA 2QL5B 3D5MA 2ZVSA 4WIIA 5B0CA 5C42A 1S72S 4PXEA 3CC4S 4U95A 1GX5A 2EBGA 3MFHA 3HFKA 4HHHA 1RSCA 1AFIA 2YKNB 2NQPA 2VJUA 5AE1A 3G4SS 1VQ7S 1OY9A 4NYOA 1HBUA 3DXSX 3O5TB 4TNOA 3D3BJ 4W92B 1WOOA 5AXNA 3DLKA 2E66A 1L3KA 3BJYA 1RACB 1TKTB 2OFHX 3BBFA 3HSJA 4F3QA 2GHPA 3KLEA 3BN4A 5LMNJ 1X0PA 5GAGI 1VRUA 3HI9A 3R5CA 2CPZA 3G82A 2GGPB 2GZOA 1W25A 3P45B 2WVDA 5K8MA 2KU7A 5L8RC 1NU4A 1JJCB 1SQEA 1OO0B 2P5VA 1AYEA 3DRSB 3K7RA 3QNWB 1OY6A 2CQ1A 1FE4A 3L7UA 5D15A 3WZ0A 2LXFA 1SV5A 1E6VA 1H6KX 1R0CB 4ERDA 3R5GA 4DDFA 2HQDA 3HVTB 1UP1A 1XNRJ 5GAEI 4CTAB 5DDPC 1GMWD 4YR3A 2QT7A 5HL7Q 4DUTA 3G71S 4DFMA 1T03A 1SKRA 5T7LA 1DQ9A 4C6AA 3VAHA 4M94A 2NPIA 4CLSA 3HKZD 3ZZYA 4JI5J 1UKUA 2DR6A 2QFIA 2GCFA 3OR1A 2UZAA 5K8NA 3KK1A 3K5MA 4X4NA 3NNAA 3WX8A 5HVHA 5D6GA 5KAKA 2WVFA 4LQ9A 3HZGA 2QL9B 2V8HA 2VKRA 2VV5A 3N4WA 4K59A 5BYSA 4P73A 5AXKA 1UPMB 3LANA 1CJTA 1RP5A 2MKCA 1UMJA 3BGRB 4USJC 1OSDA 1LKZA 1QSSA 2C3MA 1KR4A 3OXFA 4CT8A 3CDUA 2D3OR 2DYAA 3NBPB 2W9BA 2VU5A 2LMIA 3NS6A 5KFHA 4AQYJ 2UUBF 4AXJA 3TARA 2K1RB 2NS1B 5EWFA 2KKHA 2H5EA 2OD4A 4HVZA 2XO7A 1F3VA 2DHSA 3IBFB 2HBZB 4R0JA 2MXYA 1YJWS 1KBRA 3TQEA 4B17A 2RU9A 1RWKB 2DXDA 1UWBA 3NG8A 1RAIB 1HWUA 1X60A 5KG2A 2KXNB 4DV4J 4CH1A 4DF8A 3TANA 1S9FA 4P7VA 1SQFA 4M5JA 5EDWA 2CJKA 4JI3F 3I9ZA 2EG2A 2JL9A 1GX6A 3MM8A 3NY0A 4NPOA 2AYMA 3B78A 3GFHA 1S0NA 4ELUA 3B82A 2ZUAA 3OTEA 3IN5A 5K5MA 2ABYA 5DG9A 2HHXA 2IRXA 1YWXA 1I3OB 2VBYA 2DISA 2YVSA 4MYUA 3R7SB 4UOHA 4EK2A 2CPYA 2QMWA 3Q23A 1MU2A 3T9ZA 2FLNA 2JLEA 2K1RA 2VG5A 2YQ3A 5CQGA 2F9DA 2QYGA 2Y0BB 3LUYA 3OD2A 4UOGA 3OLAA 5KFCA 3CD7A 4J9MA 1IKVA 2V2QA 4KPYA 1NK5A 3MEDB 4LUBA 2MQMA 4QWCA 4GKJF 1A9NB 1X5PA 3KG1A 5A6WA 1RA7A 3MMAA 3FGVA 2D9OA 3MURP 3Q0AA 4EWTA 2RRAA 4WE1B 3PJWA 3HPOA 4NZ6A 1C1BA 3UQSA 1Y7PA 1GXLA 2ROPA 3MMJA 3W9JA 2W2MP 4O0IA 3EZOA 4DHVA 2AIRB 4JI4F 1Q81T 5KFVA 1UCNA 3GFYA 4CYUB 1F2GA 3DU5A 2YKNA 4LSNA 1RWMB 4PUOA 3KUGA 1CQMA 4CYUA 1ZTTA 3TEGA 3IRXA 2Q6BA 3I5BA 3IG1A 2WB4A 3MHYA 5HP1A 4I6WA 2KZMA 2HAIA 3NGUA 3HXMA 1EETA 2OMLA 1KFDA 4KGKA 1RAEB 1V6HA 3G82B 1JXLA 1WG1A 4CLUA 4LIRA 3EGZA 3R5BA 2DH8A 3US5A 1UPPA 3WHIA 2IM0A 3RB3A 4DV6J 4TU9A 1M90T 2BZ2A 3M6XA 3W9IA 1SJRA 2YNFA 3MAHA 1S1TA 3EVWA 4ZJLA 2GJFA 3OTDA 2W2OP 3TWZA 1IKVB 1X4HA 3JXOA 4Z37A 2IVMA 2B9EA 2J7UA 2LXIA 1F9EB 2ZD1A 3UD3P 2CNNB 2HQIA 5C24B 2BJ7A 2CWKA 4KH0B 2IM1A 1IBLJ 3RAMA 5IWAJ 1DBDA 3PO4A 4A8QA 3SV3A 2DXFA 1WTBA 2W7PA 2HS0A 4LRFA 2DR8A 2PA3A 1SC6A 2J0XA 5A8RA 1H7XA 4YUDA 1VRTB 2D3UA 2E9ZA 1C1BB 2DHAA 2DHXA 3GP9A 4LR7A 1NDLA 3DOKA 4F3MA 2AJ4A 2MYFA 1JQGA 3M2UB 1KHWA 4UUWA 3V4MA 1EAYC 1TL7A 2HNDA 3AB2B 3J7YU 1FJGF 2CQ0A 3MM8B 2C2EA 2E5GA 1CJKB 1ZM4A 1U25A 4YDXA 4DXLA 3TYTA 1YZ7A 2BM0A 2FHJD 3B8HA 4ZHRB 2CVIA 2MHEA 2XMUA 2FVSA 1WOPA 2A10A 2K2PA 3IG1B 5LM7E 3Q8QB 3C15B 3RRGA 2KB2A 1Q7YT 1TVRB 4ZPAA 2IDEA 2AF6A 2KT5A 2MZSA 4FKXA 3TJAA 3LPEA 4MMOA 4QZVB 4RU2A 1PG5B 3ZC4A 2J6UA 4A8FA 3HHLA 4DQRA 3X1LB 2DNLA 3QYYA 1X4DA 1FRKA 3AXKA 4L76A 4YEAA 3K17A 2H54B 2CVEA 2CNKB 1FRHA 3DRRB 3PYFA 4OZJA 5HATA 5KFGA 4ECXA 3TQ1A 1VQ5S 4B3SF 2FPHX 4CO5A 4H4KA 4LSLB 1T05A 4A8SA 1UA1A 2OPQB 2VC0A 2EPIA 2HGLA 4U9RA 2XS5A 1U0HB 2FC8A 4KFBB 4DV7F 2NUUG 4ELVA 2R8KA 3WIVA 1WEZA 5AE2A 4LF9F 2ZE2B 3PFOA 2UV8G 3GIKA 5K14A 2PSZA 4DV0F 4PEOA 2ZBIA 3DMJA 2CJBA 5I3PA 1KN6A 1FE0A 2IY5B 4J5OA 2JNJA 2JFDA 5BJRA 3PZPA 2O5DA 2EK6A 3M8QB 2XGPA 4MFBB 3NXZA 4NA2A 4OLOA 1S6UA 4Z7YA 4TKTA 1X4FA 4I6AA 1HBMB 2CUYA 4ED2A 3G6XA 4LF4F 1HW8A 4ECSA 4IRKA 1O51A 1ZYQA 2XMWA 2JVRA 2CFXA 2CJQA 3PRDA 1FK9B 5D0GA 3W5XA 1JX4A 4WYLA 2MKHA 5GAHU 3HT0A 4H4KC 4NLRA 2VJVA 3TAPA 2XSFA 1R27B 4KJIA 3NKYA 2P9CA 4ALZA 3VHQA 3A12A 1HQEB 2W7AA 2FGCA 3I0SB 5KFJA 1T3NA 1YDLA 4ZLNA 1WC0A 5KG6A 1LWFA 2EC0A 4IFYB 4K4WA 4WCEQ 2QSFA 3MECA 2GMHA 2DHHA 4C8MA 2ZJQQ 1VJQA 4JI1F 4N5SA 4K4UA 4XDCA 3MM9B 1UETA 4C3MA 2H9ZA 4P2MA 1FKOA 1H3DA 2BE2B 3HP6A 1GTEA 2QA4G 2NZ4A 4KQZA 2W24A 1WKJA 2V9KA 2F8EX 1VDHA 1RHQB 5IS2A 5J1PA 1CULB 3I0RA 1LWXA 1YKWA 1QM9A 2U1AA 1ZM3A 1HHSA 1EKRA 1IVZA 3BQ1A 1KLMA 3P8BB 1MROB 1R8AA 2ZBPA 4A48A 2GV1A 2HQFA 2YNFB 4K7QA 2QV6A 5D77A 1TL4A 1WTFA 3T6BA 2OELA 4F0HA 4I67A 2MQOA 1CBKA 4IYQA 1LXJA 1QAXA 1WHXA 3MM6B 4Y2MA 2E1PA 4ZPCA 1PO6A 3JYTB 4DV5F 3Q8PB 4UQTA 2V50A 2E29A 2GJIA 1ACMB 3C46A 2O1PA 1DFDA 5IOLA 4N47A 1FDBA 1FFWB 4NASA 3W61A 1DLOA 2RJZA 1LWCB 2XWYA 2R7TA 3VZIA 1EARA 1YRTA 1IKYA 4PCQA 3NAHA 2ZOMA 4E0DA 1SKWA 2EFNA 4Q5VA 1S1WB 2HZCA 1TU0B 2QYCA 3HHLD 4CLWA 2PFDA 3Q22A 4DUZJ 2HQ3A 2Z56B 3DOLB 2CPFA 3I6PA 3QWUA 1N32J 4M63A 5HAOA 4QIEA 1G2EA 3A3NB 1S79A 1RTHB 1UWAA 1QDUB 2R2RA 3SEOA 1HIYA 2VG6A 3ILLA 2V8DA 4QIWD 2RH3A 2XCPA 3KJNB 2V2KA 4ZLLA 1S6QB 3M9OB 1YJUA 1V3SA 1YBUA 1HBUB 2IBOA 4RW6B 4ANEA 4EGLA 5DETA 2DNRA 3LH2S 1X8DA 4J9VA 3UWTA 1P9QC 4OYPA 2RE1A 3LF0A 3UVJA 4NCGA 5A76A 1RAGB 3A13A 3D0IE 3DYAA 4B9NA 1SI9A 2P2CB 4OZ2A 3FCWA 4ZITA 4YR2A 1KD1T 4IR9A 4RNNA 1GXTA 5G4DA 2UVRA 5ITHA 2MKSA 5DQIA 4AL6A 2OP5A 4DR7J 2BQUA 2FHMA 2HFZA 4NMXA 2KM8C 1FKOB 2BE2A 4DCOB 4ED1A 2RHSB 4LF8F 4HACA 3IA0A 4DR1F 3HCXA 1WDDA 1YITS 2PFFB 3W64A 2BRKA 4DX6A 1WF1A 3N01A 5HMXA 4LF6J 4TYBA 2FHOB 2FLOA 1IBMJ 4NCBA 1LNQA 3M32B 2YWFA 2V34A 2M5YA 2FVRA 2PC6A 3H7HB 4LF7F 3W9HA 2UU9F 4DUYF 4PAAA 2JOQA 4F25A 3BKTA 2V63A 3J7YI 4ED0A 2HEKA 2VQEJ 4HYKA 1Q79A 2LEPA 1E6YB 2GIQA 2WBMA 2IRUA 3HD1A 5CZXA 4AT1B 5F8IA 5E3CA 3ZZRA 4URSA 2BOPA 1PSDA 3M7VA 5HJXA 4KBIA 1F2HA 2MJNA 3HJFA 1S1XA 2HIYA 3K89A 3SBMA 4EMDA 4I2QB 3MM5B 3M9MB 2LEAA 2EK1A 1U49A 3OVSA 4M5MA 3T6JA 4H4MB 4DN0A 4DV1J 1N5YB 1WWHA 1MWZA 1VIXA 4H4OB 3D6MB 1WC1A 5FIIA 5K14B 5LXRA 1HHQA 4K5SA 2ZE2A 2CPIA 1VS3A 3E01A 2RQCA 4DL6A 1KTVA 3FDSA 4DS4A 2FUG9 2GIRA 4NLQA 4EU0A 4DR4F 4WBFA 4WP8A 3S7RA 3WX4A 3KTQA 2CNOB 3AA9A 3Q89A 2DGWA 1N33F 3PEJA 4O3NA 3CPWR 2E5LF 1AZSA 2R3VA 2HGNA 1TK5A 2J8SA 4NXMJ 2G0JA 4OJHA 3M8SA 5HLFA 2K7JA 3RW6A 3BREA 1B99A 5GADI 3PM9A 1W7WA 4IR1A 3CE8A 1RWNB 1Q8LA 3FBBA 1UFWA 1HNVB 2GVZA 2UUCJ 5E5NA 4BDPA 2DGVA 1TL3A 4CWBA 2XMMA 5AXMA 1IM6A 4H54A 1K44A 3SCLE 3KJFB 4DX8H 4DL2A 4WK1A 2RUSA 2W4CA 2X7IA 3IR7B 4IDKA 1TUGB 3NCQA 2ACYA 2B9YA 3ETMA 4USIA 3QFWA 2IC3B 1RCOB 1F9HA 1WHWA 1HNXJ 5B0FA 3VVUA 1KTQA 4C2MA 2POKA 4L6V3 1B7YB 2E5JA 2HNZA 4FKYA 3CUNA 4JOUA 2HFNA 3FVYA 1S0OA 1PAUB 3RZAA 3GZ7A 1REGX 2FTRA 5C7PA 5KFQA 1VRQC 2DD8S 4ES1A 4ED5A 1O8BA 2NZCA 3HHLB 1U1LA 1IQZA 2ZNYA 2C3YA 1AT1B 1S49A 4NEYA 2Z58B 5A8RB 3R1LA 3MTKA 1NSPA 3R97A 5KFAA 5J2MA 1JLAB 4QBUA 3IMQJ 2JLFA 3W2VB 3J7A1 2RDIA 1VMBA 2IM2A 4KH1B 1JLBA 4O44B 1QAJA 2KJWA 3O8WA 4QWAA 3DHXA 2J7KA 2O67A 2QMXA 2HGMA 4R0EA 2Y1LB 2L41A 4C8KA 3DLGB 4ZP8A 5FDLA 4NLYA 2GQQA 2VFTA 2VPWB 2D69A 3HO1A 2EFPA 3FZ2A 5D4LA 5M2PA 3KK3A 2ZZTA 4YHHJ 1K73T 1RWPB 1D8YA 1RTDB 3RAQA 3KDOA 1J5OA 5L46A 1NK9A 1D9FA 1WELA 4OYZA 5C2GA 4USHA 3SCJE 2AQ4A 2OPRB 2J0WA 1HKAA 4FVCA 4LBPA 2ZZNA 1FF2A 1RT4B 1S6PA 2DNNA 1VFJA 4G65A 4G1QA 2HPUA 4J91A 2R2UA 1U1KA 4O44A 4NXNJ 3GR0A 2F3JA 1JKHA 2JEGA 5KG0A 4AL7A 3UW1A 2P9EA 2LYVA 5T41A 3WC0A 5B7WA 4M95A 2YKQA 3M2VA 3OSPA 2BXJA 2HLTA 5E3AA 4IFVA 5FDLB 2MQPA 1S0MA 3ZZZA 2B56A 5KG4A 2AZ1A 2WHOA 2PGCA 4KC5A 3GJSB 4N7TA 3VWSA 4RW8B 4ZVRB 2F5GA 2ZM6F 4QW8A 3IS9A 4LF5F 1UVJA 3HSZA 4OV1A 5F3TA 5U47A 3CDBA 4DZDA 1RAFB 1NZ8A 1FKPA 1VQSA 4B08A 1SJ3P 1Q86T 5D0RA 1HBMA 2RS8A 3MM9A 2RDJA 2DKOB 1BUXA 4WTYA 4ZDNA 3UR0A 1IQTA 3O3LA 1YBTA 1SKUB 2X3DA 2ZOFA 3FFIA 4F4KA 2VDHA 3S1TA 3SFGA 1XWLA 4DL0C 1WHYA 4UQGA 1N5TA 1WI8A 2K8GA 3TUIC 5KFFA 3EXYA 3EX7B 1EHWA 4A8XA 5HQMA 3VGUA 2AZ3A 2CQIA 4C3LA 2FZKB 4QCLA 2W8KA 4KGVB 5IT4A 1UL3A 3EYZA 2A2CA 1V3RA 1TZ0A 3DLEA 2IAJB 4J7CA 5E2QA 5T14A 4IG3A 3CF5Q 1CJUB 4LRBA 3SSQA 3HD2A 4ZVHA 2VIHA 3HX9A 3AJ2A 3OHAA 2WCXA 1HBNB 2H65B 3QRPA 2X3GA 1DARA 1RT5A 3CULA 1D8ZA 1YVFA 3I55S 4GMKA 1LWEA 2XI3A 3VAKA 1W2BR 3TO8A 2MEWA 2G2ZA 4OX6A 4B9MA 1ZS6A 5D4NA 3HK2A 1OQ6A 4USKA 4B3TJ 4DLEA 1R6YA 1V9OA 1C1CB 3FNNA 3QGGA 2RQ4A 3KG4A 4OYMA 3RB4A 4ZKAA 1FTRA 1JWWA 2HS3A 1RHMB 2V6AA 3BO4A 2CG8A 5RUBA 2HK3A 3KLGA 2XGQA 3JSMA 4WFNQ 2ASLA 1NKEA 4A8OA 1RU1A 3G96A 4MIBA 1R7IA 3VAMA 2C42A 3I0SA 4DS5A 1T05B 3AODA 3BGRA 1J2VA 2YPYA 2XBPA 4ZLPA 2CQ3A 4F4YA 4DLGA 3LTOA 4P2XA 3JQKA 1CS4B 3K2YA 3WBZA 3GG0A 5EUHA 4DPOA 2OSQA 3M8PB 1TKTA 2NXCA 3O6QA 2W9CA 2ZH3A 4NMLA 5I42A 4OX9F 4LF2A 1KONA 4YMEA 2NXJA 1F0XA 2ZH2A 3QJPA 3CJ5A 3GYXB 2C2DA 3J7ZT 5BXIA 2KJVA 3SSSA 4I7FA 2HLUA 4HH0A 2J76E 3M8QA 2HFSA 4WFXA 1N5SA 2AEMA 4IQMA 1S99A 3UDLA 1UJ5A 1XK8A 1HNZF 1ZTWA 1XJWB 5HSPA 1XIQA 1N48A 1M5PC 3OVAA 4B3OA 3LP1A 4I56A 5JVHQ 1H2UX 2DNGA 3QRQA 1A6LA 1RA6A 1CJTB 1NJWA 4YHHF 4IOCQ 4DSKA 2R8IA 2JZ5A 1NHVA 3SCIE 3MWBA 5SUHA 3QZ8A 1RWXB 2IVYA 4NI2B 4F7VA 3UVJB 2LECA 4G1IA 1GH8A 4X84A 1EQMA 1FNOA 2B8PA 4X4RA 3MEEA 1GMUA 3ZNJ1 3ZTSA 1SH2A 1WKLA 1SC1B 2DITA 2ROGA 1JXEA 2VOOA 3QBCA 2BRLA 1NXIA 1YGYA 1R6VA 4U96A 5MAOA 2R9LA 4C8ZA 4KHPF 4K5RA 2YQ0A 1VQ9S 3R5JB 4L75A 4Y0FA 1X0FA 1QD1A 2GO9A 2XSJB 1LW0B 4IH7A 4OHWA 3HHNB 1WJ9A 2LQ8A 2WVCA 4FZVA 1R43A 1YTYA 2LXUA 4ZP7A 3C14A 4ZVOB 2J6SA 4DX7A 2W2QP 1M5SA 4P6QA 1LWCA 8RUCA 4G3IA 2M70A 3PV8A 2ZWOA 3TZWA 3MEEB 4OZ5A 2HRTA 4FYDA 2RB7A 2I0XA 1N8RT 1KNZA 4LFBF 5H9EJ 2AYEA 3MPYA 1SIZA 3N5BA 5M2RA 1TR0A 2NPFA 4ANCA 2RS2A 3BSAA 1H74A 1RB0A 2V8VA 4NLPA 3ZZPA 2HNYA 4X4QA 2XLIA 1T9UA 4CLTA 4IRDA 3IRXB 3DXBA 3R8YA 3TA2A 1S1UB 1SUQA 2CJ9A 1UZHA 2MQNA 1NBEB 3HHKA 4F36A 5GAEU 3M9NB 4DV2J 2UUAF 4B3OB 4OL8A 1TUWA 5A8WB 4CNZA 5L9NA 2IA0A 3W2WA 1I94J 2GNKA 2VONA 3I0RB 4P10A 2GFFA 4I7FB 4WJBA 2QZ8A 5J2MB 3RTVA 3UCUP 2VODA 2COLA 1RUSA 3NL0A 3H98A 2QC3A 4C4WA 1OIAA 3H40A 3KLHB 3VAGA 2UV8A 2JDJA 2N3OA 3R9LA 2ILZA 3VALA 1FFGB 1H98A 3ISND 1N4LA 3NGRA 2F1FA 3A8KA 3MOZA 4KRWA 1FO1A 1Y00A 1LEOA 3B54A 3H20A 3HHLC 1WC6A 4ILMA 4AYBD 2B9WA 3M30A 2KHDA 1AW0A 3FKBA 4OMFG 4RKUC 4DX5A 4M5HA 5LJ3Y 4DV4F 1VI7A 4GRSA 2GMLA 3ZZOA 1CPZA 3TX0A 2DHGA 4EI2A 4ECZA 2EKNA 2HBQB 4A8MP 3P49B 3R27A 3ADAC 3LQVA 5DGAA 2RKIB 2XYPB 4URQU 4C0BA 2B3TB 3O44A 3H90A 3IAM9 2FLPA 1FD8A 3MMBA 4DG1B 5KFIA 2RRBA 2WSFC 3A3OB 1T0TV 2FJDB 4TY9A 2AGOA 4F67A 1UEKA 4OI2A 2VOPA 3DLBA 2KM8B 3DNCA 1X4AA 4B9SA 2ZBRA 1N36J 3WQPA 1ZA2B 1RT5B 5AE3A 1H7WA 2BQ3A 2DGXA 4USUA 1YI2S 2UP1A 2LQ9A 3M32A 4WZQA 1VCTA 1WEXA 1CC8A 1IR2A 4U67Q 1X4GA 2MMYA 1NK6A 4P74A 2IRYA 4C97A 2N82B 4LQ3A 3P4UB 1X9SA 5KFUA 2OTJS 3PJ9A 2UUWA 4CLFA 3M8WA 4I64A 2ZITA 1HNVA 5E3PA 3TA0A 4ECQA 2EG1A 2VFRA 3FCHA 3QWPA 4F2RA 1GTHA 2JFKA 1N54B 4IO1A 2YWWA 4KKOA 4FF4A 1MN7A 2CA9A 1OYEA 4I2QA 3FC9A 4ED6A 1URNA 2R7SA 5L1JA 2H51B 2MLYA 3AT1B 2JH3A 3HHEA 3M8ZA 3IRWP 4B3RF 1U8WA 1U0HA 1KOHA 1BHNA 2BMBA 2CJYB 2KT2A 2RDDA 4KFBA 5E3QA 5B0EA 4A46A 1NKBA 1F60B 4QYZK 1YJ7A 1T9XA 2MY8A 2LCWA 2CQBA 2MZRA 1HFEL 4URGA 3ISNC 4FYXB 2A0FB 1VBZA 3AA8A 1QLNA 5KTQA 3ILOA 3DGPA 3TEHB 3DN9A 4NWBA 5THWA 1RBLA 4LFCJ 4OX7A 1Y4ZB 2XS7A 2NLWA 4K4SA 3NLCA 4K0KF 4JV5J 1P8GA 2DJWA 1EP4B 1U1MA 1H72C 4Y28C 1UVLA 2JVOA 1S6OA 2OKQA 2R7WA 1TL7B 4OI6A 4DV6F 4DR2J 1VYAA 1TK0A 1JKHB 4IOAQ 1TAQA 2UXCJ 2DPIA 4J9RA 3EVMA 3H2UB 2B7BB 2GVDB 2QIFA 3ISZA 3BV8A 3CVKA 1XMOJ 3LOUA 3W8GA 1FI4A 1ZZNA 1IBLF 1FXLA 3I31A 5IWAF 4RW8A 3PY8A 1CVJA 3IP0A 1BE4A 3PR5B 2ATLA 3A8JA 1M1GA 4PG8A 2WAQD 4IG3B 5DS7A 4MKAA 1VBXA 4Y2IA 3RUBL 1IM4A 4LMZA 2VFUA 4LRCA 1JXVA 4RBUA 1X9WA 1HQUA 2BKNA 4PG7A 5BYQA 3DKDA 4F0KA 3C8YA 4IQXA 8ATCB 4DF4A 1JLQA 4RW4B 3CCTA 3D7SB 2QA4S 2W25A 4V19J 1G7CB 2VG6B 4Q2LA 3QJJA 1WF0A 1NZAA 1FHTA 2KL8A 2R7XA 1I1GA 3EMTA 4KV8A 3NMRA 4ZMMA 4GKKJ 5A8WA 3TAMB 4DV3J 2AKWB 1JLGB 2Q1LA 2W4PA 3CTRA 1PAEX 2MKYA 4EFAC 5A2QY 2L08A 4MK8A 1G1XA 2L48A 2BE7D 2RQMA 2HSEB 1WG5A 2LQJA 1FX4A 2RT3A 3QAEA 1HBOB 3NS7B 4FNHA 5D4OA 1YG0A 2VBWA 3A8EA 1NDPA 5HBMA 2NSBA 2LP4A 5DQHA 1O5JA 1PJ7A 4DEZA 4KAIA 3CDAA 2ADCA 1S6QA 1EB0A 3W63A 5A8KB 1ULRA 1VHIA 2HQGA 3EDRB 2HHPA 4FS2A 2PEBA 2CQGA 2IJFA 4JB8B 2GA7A 4ZCIA 5EHHA 4UTGA 3CXCR 4WU2A 4NCAA 2NREA 4GC6A 2AYBA 4HHUA 1U45A 2AT1B 4KHRA 4M5IA 5ETRA 4DV7J 3GIIA 4JI7J 3MOJB 4LF9J 2XZWA 4R5PA 3BSCA 3THVA 2B7CB 2C3UA 3DC2A 4EZ6A 1G6BA 5HN0A 2R7RA 2GS8A 4RW9B 3QSYB 3OXGA 5CXTA 3OUYB 1AXQA 1S59A 3K59A 3UDVA 1YK9A 5KT7A 1SL1A 1AZSB 2N7CA 3BO3A 1VQOS 4DCJB 1Q16B 4X62J 2BJ9A 5J2NA 1NHUA 3POTB 3I9V9 2CWXA 4N8NA 1H2VZ 1HNWF 2RF2B 4GVBA 1RTDA 2M0GB 5DQGA 2H4YB 2C3PA 1RT2B 3Q8YA 4ILRA 1JNRB 3U02A 4ANDA 2BKOA 4MYTA 1FRMA 2XMVA 4UY8T 3L95X 5E7OB 1RBAA 4JI2F 3KYLA 2MB0B 5KT2A 1HW9A 1UZDA 3CD6S 4IOBA 4U6PA 2VFVA 2R2SA 4QQBA 3MCOA 1AA1B 2ZH7A 2R4FA 4DFKA 3EGVA 2MTLA 2HQCA 4FVMA 4LVOP 1DTTB 1YJTA 4Y2AA 4BS2A 1B64A 3DI6B 1FNXH 2IA6A 2R7UA 3PCOB 4Y2CA 4DI6A 2A3JA 5KG7A 4N56A 3MD1A 3VGVA 5H9FK 1TVRA 3M8PA 2W9CB 4L3KA 1BD6A 2HMIA 2ERRA 4Z2XA 2BJEA 1SL0A 1XR5A 1SJFA 1VR6A 1ZOTA 5ETPA 4LR8A 2B6AA 3OFHA 4QWEA 2E9TA 3TZXA 2OHDA 4YFUA 5FD1A 1ZH5A 2X1AA 4X65F 1TTHB 2MPUA 3M05A 3UPFA 2I9SA 3CJTA 2BEFA 2VFSA 3IXQA 8AT1B 3GJQB 1X31C 1VBYA 1MWYA 1NMEB 1S1XB 4BC9A 1ZETA 1S48A 4B9LA 5I3UB 5F9NA 1TP7A 2DB1A 2DEIA 2MQLA 2HURA 2OFGX 3GTYX 3NCRA 3NBPA 2W9BB 4JI0J 1WF2A 2FZCB 3I56S 2YQ1A 2FJEB 3T41A 3G6VA 2HVZA 4HL9A 2HWHA 3KLVA 2DNQA 5IV3A 4R5PB 2DNOA 1SH3A 6FDRA 7FDRA 3CC2S 1IBKF 2D7SA 2A2DA 4OYBA 1GXUA 1YZ6A 4ZCKA 3M2RA 3G8SA 4ZPBA 2ZH4A 2CPJA 3T1YF 4X64J 1UW4A 4CQ1A 5F0UA 1MMLA 3LGMA 1XC9A 1LXNA 2ATCB 2P8IA 1U6FA 1KQKA 3VGTA 1GFWB 1N32F 2ZHBA 2DVIA 3PRVA 5EN1A 1R31A 3BF4A 3KHLA 1Y5NB 1GQEA 3MXHP 2BDPA 1BQMB 3P6YC 3KJVB 4UUXA 5B0DA 2DGQA 2ZNZA 2DRBA 3OTCA 4MIAA 3R7NB 2GAGC 5L38A 4PWDA 3UE2A 3BKFA 1KQGB 1BY9A 2WSEC 3DOLA 4W4MA 5JUMA 2SXLA 5A2QU 1YIJS 2FLLA 3R3TA 1FDDA 3DRXA 4ZOSA 2FY1A 3DU6A 2BQRA 1H0HB 3MAAB 5FLXU 3D1HA 2BM1A 1Q5VA 3DYAB 3THTA 5HMWA 2ZHAA 1FERA 4K50A 4NLOA 5CYQA 4LSNB 3JSRA 2IJRA 1KDNA 2B43A 3J81Y 1V5IB 2R8HA 5ETLA 2BW2A 3G2XA 1XEZA 1FVQA 2YNHA 3UO0A 2VF3A 2YH0A 1P27B 2BR0A 3PIPQ 3RYLA 1JLQB 1WORA 1VISA 3HF5A 4HEA9 4RW4A 3BDPA 1REVA 4ID8A 5DG7A 3FSXA 2G13A 1JNZB 2DCLA 4DPWA 1X5OA 2JLGA 1BMQB 1RAHB 3QIPB 3OTOJ 1NB2A 1D09B 4RWWA 3ZZUA 2QEXS 3CMQA 3DOKB 1JJ4A 4CLKA 5KFZA 3DLLQ 4OYWA 1XNRF 4ELTA 4LF7J 3EPIA 1RK8A 2P9GA 2RNEA 3OUYA 3D6FB 4E98A 4DUYJ 3GMGA 2RHQB 3C19A 3AAWB 3DDNA 3ITHB 2HHVA 4I4BA 3UN5A 1CSJA 2WRMA 3MECB 4CNYA 4NCGB 1V5VA 2W4DA 4RW7B 1QTNB 2M52A 3IBWA 3N6LA 1U1RA 3AOBA 1F1BB 2HFOA 1T9VA 2V67A 2F65A 2FJAB 3LP2A 1OSCA 1RT2A 3IO1A 4X4VA 4XIUA 2WVBA 4OHXA 5KFSA 2LEBA 1R8HA 2A6MA 3JQMA 3T19A 4IG0B 3BBBA 1RWWB 3UNGC 3DCAA 5C25B 2ZKUA 1T02A 3V4IB 2M2BA 4FP9A 4P71A 1SBRA 5CYQB 5DDOC 4WZMA 1HBOA 2DXEA 3BPDA 3HSDA 4S0MA 4QJVA 1R8PA 4USTA 3BSOA 2MKKA 1RYRA 1FKAF 1WSRA 4EZ9A 4ID5B 5IZHA 3GSIA 3TR5A 2GQCA 1VLOA 1FJGJ 3CCZA 5D3GB 3MEGA 2M3DA 7FD1A 3KLFB 3IFEA 1WC4A 4NXMF 3MPWA 3PX4A 3THPA 3DM2A 5F8MA 2DNMA 3CD5A 5SZTA 4ETZA 2XY6A 1FD2A 3IBCB 2UXDF 3DGPB 2ZJRQ 3KUHA 1LFWA 2IYGA 3MMCB 4DZ6A 1FRJA 4I1TA 3EE3A 2NYHA 2DTJA 2FHKA 1U0SA 4LSLA 5KFLA 5ETSA 1IR1A 4ECUA 2OIHA 2AGPA 4DR6J 4J9NA 4B02A 1OJ4A 1QE1B 3JAMY 2ZOGA 3PR4A 5LJ5Y 1HNXF 2ZH1A 1JLGA 3OBIA 5IT9U 2C1EB 4AXIA 1PYSB 2XYHB 4IH6A 3ET6B 3DMJB 3TVKA 4DJBA 3TUZC 3KLGB 3D0GE 4X66J 1QSYA 4DWIA 3LWMA 5DM6Q 1MU2B 2Q66A 3DRPB 5KFNA 3BQ2A 1SV5B 3V6DA 4CO0A 1LWFB 4RBTA 1D9AA 1JLCA 1YBAA 2DNKA 3H5SA 3I5CA 3LO3A 2F4VJ 3ENAA 2G9OA 3PFEA 1MSWD 2K7KA 2JRSA 1RLDA 2DIUA 3CCQS 5DO2A 1C0UB 2Q79A 3A1YG 4A47A 4RZRA 3HJVA 1N34F 3L9ZA 5AJ3J 2KXHA 2LFVA 3ILJA 1M5KC 1VRUB 3AFGA 3RAXA 3LP0B 2WW8A 4DL7A 3QLHB 2YKMA 3DOMB 2ALZA 4JI4J 1T11A 1HNIB 2Y8YA 4ED7A 1SIWB 3AHPA 7AT1B 4G6VB 1ZPVA 4R25A 3OL9A 4KO0B 3FRZA 4KR0B 3KOAA 1LK5A 3BB5A 4KGZB 3B6BA 3MMBB 4LF1A 3FQLA 4A8KA 2CJAA 3DRPA 3SSRA 3V6DB 3PW5A 3EDQB 3MM7A 2HWIA 1RQ0A 4WKRA 5D8HB 2FDNA 4ZPDA 5E33A 2JJ4D 4YS2A 4CTAA 2ZJPQ 4EYHB 4NLDA 1RHRB 4JUZA 1Q95G 4WFAQ 4B9VA 4O23A 3ZZ0A 2HHHJ 3H5UA 3IC1A 3V6KA 4NXNF 3RR7A 3PHEA 1RISA 2F7VA 1QE1A 3HMJG 2V4RA 2X1FA 5LMUJ 1HI8A 1X5SA 2ZHOA 1HR0F 5IFMA 2HRUA 4NLSA 1N88A 2M7SA 2W1BA 3W3SA 3JQJA 4FPIA 4OLPA 1PYOB 3RBEA 3DRRA 4JI6F 2KXFA 3CIZA 3S6EA 1IKXA 3LALA 3KHRA 2ZM6J 1XNQF 4LF5J 2NYIA 1T94A 1VIOA 5C24A 3JAMU 2IMWP 1TQLA 1DRZA 1HYSB 1FWPA 4RNFA 3PVXA 1NM2A 1SJ1A 2BANB 2HBYB 2MHNA 2OI2A 2Q6CA 5D4PA 4CO4A 4KGMA 3UNYA 5CCMA 2KVIA 3K5LA 4F4XA 2VA3A 2X1BA 4WWSA 3AQPA 4USMA 4UW2A 1A0OB 5KT5A 1DTQA 1EX8A 5KG3A 5F3ZA 2DNZA 1SVDA 3M1VA 5K20B 3Q8RB 4IG0A 2R8JA 4F0MA 4K4VA 2KHCA 3I4PA 1B4SA 4HKQA 1B70B 2D1CA 4OZ0A 5CH7B 2CQCA 4IDKB 5M2UA 2QA1A 4PR6A 1Q8IA 1TKZA 1TV6A 2OD6A 5E0OA 4CDIA 2AU0A 3M2VB 4OHYA 3DLGA 4OZLA 1L3TA 2IM3A 1KWMA 4RW7A 4NLVA 4DQIA 2XEXA 1L3SA 5KFMA 2HKEA 4Y00A 4TXSA 3NNHA 3FCVA 3NEKA 4XK8C 5GAGU 4YY3J 1KRPA 1J5EJ 1Y0HA 3UFCX 5F41A 1CJVA 2MLZA 4E2FB 1HD0A 2G0CA 1F5CA 2OPRA 2R42A 1XERA 2W2PP 1RABB 3D68A 4PXDA 2H5IB 4XAKA 3GV8B 3K57A 1MMNA 1MNEA 2FB0A 3F0NA 2GQ2A 3AQOA 2DNYA 3C16B 2W7OA 3QLHA 4F4WA 3SQOP 3CJKA 2KI2A 4PG6A 2XY5A 2C3OA 1WC5A 3GILA 4TU7A 1EETB 4H4OA 1KSPA 2OH2A 5F8GA 3D4JA 3IR5B 3QGHA 1RTIA 4BBYA 5IV4A 3HVWA 3N0VA 4WPAA 5JJBA 2XO6A 3D0HE 2RRNA 2O66A 2BABA 3F44A 1WD6A 5G0RA 2IMOA 3MM7B 4FN5A 4JI8F 2IFXA 3NRBA 2QLWA 5HQLA 1OPZA 4KSEB 4Y34A 3C2PA 1ITPA 2G0IA 3ILIA 3T5LA 1R3NA 3LPYA 1YQHA 2AEJA 2HFVA 3BGUA 5KFKA 4Q45A 2ZH9A 2CDQA 1HYSA 1KS2A 1RHJB 2MZQA 4PG5A 3DRYA 3VTIA 2I5JB 3JS9A 1RGVA 3PIOQ 2NR0A 2CAJA 1OWXA 2XHCA 3UCZP 4F4AA 1LWEB 2HVEA 2AHOB 3NP5A 4NA3A 3KKFA 5KFEA 5CAAA 1YJRA 2Z4PA 2P6SA 4LFAJ 3KJVA 1C4CA 3BZQA 4P75A 2R7OA 4WE1A 2L3MA 4X4SA 4RU9A 3W66A 3OR1B 4NI2A 1RWOB 3CT9A 3I82A 3KK1B 4JI1J 4DU8A 4DU7A 1RT1B 3H4BA 1HWJA 3GG1A 4FYWB 1B0PA 3MTJA 2AX1A 1F5AA 3DM2B 3EWGA 3JTPA 4J90A 4KKOB 3LP1B 2UVVA 4CO2A 1TFYA 1WACA 2D74B 1NEEA 1U4BA 2HHWA 3CMES 2AJ1A 3H4DA 1XMQJ 2Z0GA 3HVTA 1RADB 3NCPA 5J2QA 4JYAF 4KTQA 3BM7A 2LA6A 3D54A 5HLFB 4KHPJ 2DGSA 3IAS9 2UVWA 4OI4A 4Q2MA 5HANA 1U2FA 4KY3A 2B4PA 3ELHA 1VGYA 2W9AA 1B7FA 1H38A 3GR1A 3DOMA 1SB6A 5ETTA 3IGVA 4ER8A 4DV5J 2EWHA 1R8BA 3DLJA 2VBXA 3KLIB 3QMQA 4TQRA 3JSBA 1UVIA 3H5XA 4ZCMA 4ZN1A 1RAAB 4EBEA 5JXSA 5KFTA 4DMZA 2V4QA 4PXCA 2OPPB 5KOXA 1PJ5A 3X3UA 2FIUA 1FRLA 2VPYB 3L4BC 3QZ7A 2AV5A 1L3VA 1LK7A 4QIGA 2FYXA 2GW8A 1CLFA 4MH8A 4DUZF 2QL7B 4LBHA 3T5HA 1JB0C 1NSAA 1UFKA 4JV0A 4RWXA 4M5NA 2UXBJ 3J81j 3RU0A 1Q1KA 4RNHA 5B09A 4L3NA 5J1EB 2CPHA 3MFIA 3PACA 3G87A 4M8LA 2UUAJ 2YPZA 3Q2TC 3BGOP 4GO7X 2R8GA 4A4JA 2DRDA 1O0PA 1OPIA 1P1TA 2Q3PA 2GGPA 3Q2SC 4ZVGA 3VVTA 4GC7A 2YH1A 4ENOA 3QJLA 1NJIT 4NA1A 1T9TA 2HG4A 2ZBCA 1VQYA 2K3KA 2LU2A 2IAJA 4JI5F 3KK2B 1FESA 3VR1A 3BPSP 1Y5LB 3RBDA 3SQGB 3MCMA 1IKWB 1Y3JA 3HKWA 3D1OA 3FSIA 3EVOA 4HI2A 4KGXB 4UT4A 5KFWA 3SI8A 2HHTA 3N5FA 5L1KA 4YOEA 2HZVA 3CO9A 1QVFR 5EX0A 2MKJA 2N4DA 4G1PA 5K9FA 4A8WA 1T03B 2ZUGA 1I6JA 3AJ1A 3F73A 1DJ0A 4A8YA 2XWXA 3ET6A 3CJ8A 4KE5A 4OJ1A 4QPTA 3AJDA 3MCNA 5F0WA 1NO8A 3FEXB 4WKYA 1BQNA 3B4DA 3BGLA 1N5VA 4AQYF 1S1WA 2UUBJ 2DO0A 2QX0A 1T9YA 2V68A 3MD3A 4RUHA 4LF6F 1ZPWX 3C16A 1TMMA 5ETQA 5KFXA 3OL8A 1FX2A 1SPBP 1IBMF 2YNIA 2DT9A 2I1RA 2AJQA 4RBVA 3ZTQA 4XPEA 2FGOA 2OTLS 1ZAXA 2ASJA 5HROB 2CDRB 1N36F 4JI3J 4YR0A 3C14B 3FZBA 3IR6B 1FWLA 2ZC3A 4CO1A 4YDDB 3VGSA 2FJXA 5DJBA 5IQQA 4OI1A 5GAHI 2X51A 3R5AA 3NWRA 2U2FA 3MEGB 5GMKa 3Q8VA 2C2NA 4J9SA 2JC1A 2RILA 4PUOB 2C2RA 5EX3A 2DY1A 3B4MA 5KFPA 1Z4UA 3ITHA 4M5GA 5I3QA 1GMWA 1KFSA 1D3WA 2C2ZB 4USWA 5DM7Q 3H8YA 2ZC4A 1ZM9A 4TYAA 5F8LA 3N79A 3CCJS 4DV1F 1IJEB 2UVUA 3CIMA 2DGTA 4CP5A 2YBVA 1FTCA 1N5QA 3R6GB 1RT3A 3BSNA 2JEIA 5I3UA 4F3OA 1UJ6A 3IWLA 1XR7A 3J7Z5 2GHVC 3CJKB 2HW3A 1U09A 4GKJJ 2KN4A 4DR4J 2KRBA 4B3RJ 1XR6A 1TUVA 2QSWA 2IYIA 1WDTA 3E01B 4LVNP 5KFDA 3C6UB 3E2EA 1XMBA 2VPXB 4OHVA 2CADA 1MROA 2YKAA 1HQEA 1FJ7A 4DSFA 2QLBB 3AB4B 1SC3B 3M2RB 4EO6A 5LXYA 1CJVB 3C66A 1NSKL 4NZ0A 4PRFA 2YWEA 2YNHB 3R1HA 4LFCF 4OZ1A 5F8JA 1F9FA 1S1VB 1ZAVA 3OFFA 1U47A 2VQFF 3CJSA 4CLLA 3CCMS 2A6OA 4B3MF 3CCSS 4NLGA 4ZA1A 1VQNS 4ZVPB 2PA8D 2ZH8A 1QUVA 3NAIA 1URRA 3QGPA 1FXRA 3M4XA 1HNIA 2UXCF 2LU1A 2ZEJA 4QW9A 3NOCA 2Y9HA 2I2YA 1S7HA 4BLGA 2HYIB 4V19X 1RAOA 3TAQA 2ACMA 1EP4A 5BR8F 2Z57B 1XMOF 1VBKA 3CJ3A 4W98A 3A8IA 1DQ8A 4HLBA
chains in the Genus database with same CATH topology
1UFLA 4QPXA 2DNPA 3JTOA 1IUJA 4JBCA 4HT7A 4PKDB 4BWJA 3BR8A 4MTPA 2RSQA 5B0GA 1SXLA 2PE8A 2E9RX 3K0JA 1YRXA 2GJ2A 3H5YA 3SDEA 5AXLA 2CZ4A 2XG8A 3SDEB 2QA2A 1GNKA 1FNMA 2VPZB 4O3OA 4PWDB 2J9EA 4ZP6A 2XNRA 4QYRA 3D1QA 3KNAA 3L3CA 2HVHA 1FXDA 2OSRA 4NLTA 3RW7A 1UAWA 4ZVFA 4OQJA 4YP3A 2MSTA 5L1JA 1WEYA 3K8WA 5GVQA 4BWMA 3RBDA 3PKYA 5B08A 1FT8A 1WG4A 2NUHA 1S4FA 3POTA 1VLYA 2AYGA 3CDEA 4WK3A 4NLWA 3KLFA 2HHSA 4I6YA 4P2SA 3VQTA 4O3QA 4K2XA 4X2BA 1HHTP 3MZIA 4ED8A 2C28A 2VL1A 1VRTA 4TU8A 1MW7A 3GIMA 3N9UC 1YJ9S 4RUAA 2VZ9A 3HT3A 2J9DA 3L09A 4DQPA 4W90B 4KV8B 2YKMB 4TY8A 5B0BA 1LQ9A 2ZKTA 1VC5A 3JYTA 4WYWA 2ZD1B 5HROA 1AFJA 2QRRA 1WI6A 2WBRA 4CIOA 4J9LA 2KYZA 4IFVB 3ZFVA 1JLFB 3JTNA 4M5DB 4X62F 1FRIA 4Y65A 4KB7A 3OHBA 3QO9A 4O3SA 1X9MA 3R5DA 3D2WA 2D3ZA 5HI7A 5D3GA 3CD0A 3BO2A 3P5TL 5DGBA 5EGYA 1FVSA 4NL5A 2Z2LA 5KG5A 4YQWA 4Y6IA 2HIQA 2RUGA 4FPRA 4G1QB 4ZVEA 4RNOA 1G3OA 1RT4A 1S6PB 1Y3KA 1QTMA 1DLOB 2CPDA 2OLWA 2LLZA 3CCWA 3H59A 5L9XA 4I2PA 1OQ3A 4O4GA 2KO1A 2RIJA 2XHWA 5HMYA 2NSCA 3CMAS 2F40A 1UEVA 4YB6A 3G8TA 3U1MA 4Q7AA 1JLFA 4M5DA 3VCDA 4C8YA 1N52B 3EPGA 1KLMB 4DR5F 2MZJA 4FS1A 1N6QB 1C4AA 2XMKA 3V81B 4DR3F 2JWNA 2ASDA 1P6TA 3D28A 3J80Y 1QAIA 4C8NA 4YB5A 1RJJA 5KFYA 3PKMA 2PEHA 4CCHA 5F8NA 2A18A 2E1RA 2FHJA 2UUTA 2LDIA 4MJKA 4J9KA 2DPJA 1X4BA 2DIVA 1IKYB 1NK4A 1U2RA 1U6ZA 1RYSA 4QU7A 3V5RA 2CG4A 1IKXB 2ZH6A 1U48A 2IC3A 3KLIA 3MM6A 1NH7A 2CQ4A 1U1PA 2VASA 3F41A 1DHMA 4NYZA 4Q0BB 4X64F 3CCVS 2IBKA 1SJ4P 1FJCA 4TQSA 5HO4A 2DRAA 1RT7A 4I2PB 4O4GB 1IJFB 2G4BA 2DK2A 5T7LB 2MZ1A 2B9XA 2F8MA 2G1DA 2BUNA 3VQSA 4PQUA 2CQPA 1Q8BA 2E1AA 2Z2MA 4FBUA 4XPCA 2YX7A 4F4ZA 1HI1A 3OVBA 4NZ7A 2LQ5A 2OPSB 5KFOA 3MEKA 3DRSA 1W2IA 3P3DA 4MAKA 4IO9Q 2FVQA 1YSJA 4Q44A 2IJNA 1NK8A 1SKSA 4FF2A 4C0HA 4ED3A 3GV7B 3TOQA 2HMIB 1CEZA 1BGXT 1HWKA 6FD1A 4C7QA 3H2VE 3BQ0A 2I38A 1QSLA 2WK4A 4MK9A 4FXWA 4HDGA 2Y1JA 4DN9A 4NX9A 2W8LA 1E6YA 2HWTA 3HLUA 4OX8A 3N6MA 4KT0C 4DL4A 1M0SA 1Q78A 3EGWB 4N8OA 3CSKA 5DDQC 5LMNF 4KIAA 3NMRA 2J9CA 4EYIB 1C0TA 3SXLA 2CQHA 2KDOA 1T95A 2L9NA 3K8VA 2GO8A 5CZVA 4CT8A 4ZHRA 4IUFA 4DR7F 5CA5A 3MR6A 3C6UA 2J8AA 3I4HX 4IH5A 3S8SA 1CG2A 3VZHA 3BGFA 2CKWA 3TP2A 1BQXA 4PPDA 2XC9A 3OL7A 1S9EA 1V3ZA 3DLEB 3GYNA 2DH7A 2CQ2A 3TA1A 5EWGA 3FJ2A 4QR1A 3Q24A 4JV1A 1I94F 3ENVA 3HDSA 3UD4P 2FC9A 1RTJA 1RT7B 1S10A 3PDNA 3G6YA 1S9GB 1TL5A 4I0WA 4DBQA 4X4OA 2VQEF 1ZM2A 4ECYA 2AD9A 2XCAA 4UY85 5B0AA 4RW6A 5DLGA 2EFGA 5KFRA 5IT0A 3SCKE 3ETOA 4C8OA 1KEKA 4ZS6A 2DO4A 4ECWA 5LL6d 1FDNA 4I69A 3G9CA 2RD5C 1RT6B 2WONA 3K5NA 2JHEA 4PQAA 2CZVC 2WSCC 4EBCA 1U8SA 2I5JA 1Q4RA 4NRUA 1VK8A 3GSDA 4WXWA 2M8DB 2BANA 3WDOA 3CB4A 3OQ2A 3CDWA 3ENWA 1KVIA 4DR6F 3PNIA 4FNIA 5KFBA 1NH8A 1HI0P 1QVGR 2AWZA 4O3PA 5L39A 5E3RA 4QOTA 3PO5A 4X4UA 3I32A 2N3LA 4RLEA 3MUMP 2DCUB 1N6QA 4K4YA 3RR8A 3GFXA 1K0TA 4P7TA 1SH0A 3SQGA 3CCUS 1HPZB 1YHQS 3MR2A 2UUCF 2V8GA 5HBMB 5IM0A 2ZFHA 3I87A 2F4VF 1QY7A 5J2NB 4E8UA 4ES3A 1TKXB 4QWBA 1BWEA 5LT5A 1OS5A 1REVB 2VC1A 1A7GE 2AX0A 4TLQA 4WFYA 5I4MA 2E1CA 5DRKA 2R7VA 1TFWA 4ICLB 5BYRA 1VC0A 2WTFA 1R89A 3FMBA 2J9DE 4F50A 4O4RA 3K5OA 1LW0A 1UJ4A 2OJ3A 1NAQA 1T3OA 2BVZA 2KH9A 1KQSR 1ZBTA 2B5JA 1KOOA 2VG7B 3PJXA 3OPKA 3PXGa 5L1LA 4JV5F 4ZPTR 3PW7A 1T7PA 4BC7A 1RKIA 3M8RA 4KHMA 5KT4A 1D0EA 2HHHF 2Y0SD 4FF3A 2BBEA 2YKOA 2MJUA 5LMUF 5E41A 1DAXA 2B0GA 1NK7A 3BN7A 1B7FA 2PDAA 4DSJA 2LDYA 4CT9A 2EFOA 2YNGA 3VF0B 3IWNC 2AJ0A 4HI1A 3M6VA 3TRGA 2X1GA 4N41A 1HL6A 3ENQA 5CYJA 4AL5A 1FA0A 5CYMA 3ULHA 4NOHA 4FF1A 1RT1A 1F5BA 1P1LA 4NLUA 4UOCA 3CC7S 2QFJA 3O2IA 4KO0A 4D3GA 5I42B 4MKBA 4OHZA 1U26A 3UR3C 3QGIA 3CCRS 3T5KA 1X7VA 3MEDA 3PEHA 2OMOA 4OFZA 4GKKF 1C0UA 4DV3F 5J2QB 3OJSA 3AH6A 3GIJA 4HHJA 1B0VA 2K3IA 1NJXA 2YWKA 2OO4A 5KG1A 3CJ4A 3KMSA 3FFIB 4WFZA 4J9OA 5HMZA 4Q43A 1NK0A 4ICLA 4PQUB 2O01C 2EKYA 1PGZA 1RTIB 2VA2A 2KFZA 1HARA 3O1LA 4ZP9A 1TK8A 2PIIA 3TW0A 4YY3F 1NJYA 3DDKA 3V81A 1FEHA 1RI7A 3GV5B 2BYCA 3KK3B 1VK3A 3DLKB 2VKZG 2F8HA 2MZTA 1N0VC 2E1MC 3MGJA 2FVPA 2RKIA 2DR7A 4OI0A 2XLJA 4DL5A 3W2WB 1C1CA 3MUTP 4MKYA 1X4CA 3DFEA 3P96A 4AUKA 1JLAA 1N56A 2BJDA 2YNGB 2BA9A 4TLRA 3OXLA 1S1TB 2ZDPA 4K4TA 1E6VB 1TKZB 1TV6B 3PW0A 2MY7A 2N7YA 4DL3A 1HBNA 3OL6A 5IM0B 3KHGA 1RAJA 1FJEB 4DQQA 3MPVA 2IVFB 1U1NA 4FXVA 2RU3A 3KG0A 3PRBA 2CRLA 3FEZA 4BCAA 1R0AA 4C8LA 3CJ0A 2CPEA 2ZH5A 1ROFA 2PN6A 3VAIA 2Z8QA 5HP1B 4QU6A 4LFAF 3TUJC 3LP2B 2E7WA 1TAUA 3ZZTA 2XMTA 4QWDA 4DG1A 1K9MT 4Q8EA 1RWUA 2ZZMA 3QIDA 5A6PA 2XSJA 3GFZA 1SJQA 1KC8T 2AGQA 1S1UA 1SUQB 1RTJB 1U24A 3LAKA 3V6HA 2HHQA 1LW2B 3OW2R 5GADU 4C9DA 3TNVA 1KHVA 2B4UA 2CQDA 3TAMA 5FLXY 1NB7A 3M30B 1XMQF 4L72B 3NGKA 3NWGA 3GQCA 1QJHA 4MIWA 1Z2ZA 1HWIA 2GHWA 2KRRA 3TA0A 2A1BA 1QAJA 3CGIA 3N28A 1BLUA 3MR3A 1Y5IB 1GAOA 3HHDA 1U1QA 3CEDA 1KLNA 1HD1A 3U7JA 2OAUA 3OR2B 1U1OA 4ZPWR 5J1NA 2WOMA 1BQNB 1ZAWA 2KT3A 3OV7A 4R8UA 4CO3A 3H25A 2E5HA 3I5AA 2F9JA 1SL2A 1SKRA 3N6NA 3OJUA 1S9GA 1IXKA 2KG1A 3M6UA 4PWUA 4DSEA 3CWJA 4Q8FA 3LW5C 2KFYA 5J2PB 1B0TA 4HT5A 5CD4H 2KTQA 2WB1D 1K0VA 4B9TA 1IKWA 4ECTA 4FXDA 1XTZA 1APSA 1FDAA 2ILYA 4QR2A 1VQMS 2JX2A 1J5OB 2BACA 3E51A 3MDFA 1XBWA 3QO9B 1R8CA 2XMJA 3FMWA 4YB7A 2FVCA 5CCLA 2YY3A 1DTQB 4LT6A 3FQKA 3HVRA 2D9PA 2HVIA 1UWBB 1JLEA 2L9DA 2HHUA 3GE9A 4O3RA 3C6TA 1C0TB 3BR9A 2OPSA 2MGZA 5J1EA 4DFJA 2EI5A 4EEYA 1VOMA 3MM5A 1TL3B 2HS4A 2ROEA 3E8OA 2GX8A 3QPIA 4HTJA 1D9DA 4DV2F 2GC8A 2LVWA 1S97A 1S76D 2V4JB 1HMVA 2Q43A 2XNQA 2D41A 5KOWA 2XY7A 4N77A 4EO8A 3UI3A 5IQ6A 5C5JA 4NYPA 3NGDA 1VQ8S 4J37A 2HNZB 3LGNA 2XB2D 4C0OC 1S9EB 4OZNA 4R8UB 3OTOF 2FD2A 2CIMA 2V9WA 1H2TZ 4U7CA 2MGZB 1UEUA 3EZUA 2RF2A 3SYZA 4ECRA 4WF9Q 2OPQA 4IKAA 4EUVA 2V94A 5H1SV 4X4TA 1N5YA 4K4ZA 2E7XA 5MLCV 3MAQA 2C22A 2EFQA 4H4MA 1M5VC 3DLHA 4B9UA 2GMJA 2LA4A 3G8QA 1LOUA 1T8EA 4F26A 1HMVB 5IT9Y 2YTCA 1Y9OA 3DHWC 4CI0B 4Q0BA 4ZK7M 5J2PA 3SMZA 1QUPA 2MKIA 1Q82T 3T3FA 1LFPA 3EGNA 5KT6A 3MUVP 1DZ5A 4ZCLA 3EZ5A 1IN0A 2Y1IA 1RDRA 3I96A 5JVGQ 1LV5A 2B6AB 1FCAA 4OJ3A 4Y3CA 4N76A 2ASYA 2B4VA 3UCGA 1JLCB 2VBZA 4QYZJ 2EBEA 5DLFA 3IWXA 3M2UA 3SFUA 4ATNA 4CH0S 4CZCA 4DFPA 1RKJA 5A0YA 1RT3B 2ZDOA 1TL1A 1VQPS 2AW0A 1DTTA 5DG8A 2E5IA 4WU3A 1TL1B 4TN2A 1S1VA 3JSYA 1UVNA 2I8EA 1TKXA 3F56A 1K1SA 4IRCA 2M88A 5IXUA 4D3HA 2RMLA 3FSYA 4PPZA 2YWHA 4MK7A 1KVJA 3KFWX 3QIPA 1ELOA 1M5OC 4J9PA 1PC5A 1UVKA 3OR2A 2HNYB 1M1KT 2VUGA 4XO0A 3GWCA 4C11A 2EVZA 3MF5A 4J9QA 4TY8B 2KG0A 3SZ2A 2AP6A 2PO4A 1RTHA 2V5HG 5ADZA 4RNMA 1U6BA 2YNIB 1PILA 3PW2A 4X66F 2XLKA 1JJHA 5K8PA 1LW2A 1JJ2R 1NRKA 3OFGA 2V0NA 2J6TA 4ID5A 1CQNA 4Y2KA 2VB6A 3UDCA 3KHHA 1VQKS 4DR2F 1KQFB 4OJGA 4ITSA 2VD3A 3ICLA 1PC4A 1YRUA 2APOA 3OSNA 1RT6A 1Z2LA 2WONB 1VQLS 3K5PA 1IR0A 2QLXA 2OPPA 3IS9B 5AJ3F 2E44A 3V6JA 2R2TA 4B9SA 2LQBA 2IHR1 3G86A 1DURA 3VAJA 2PI5A 3RB6A 4IQXA 5HQ8A 2KYXA 2EW9A 3HZEA 3U1NA 1BC6A 2R7QA 4LIWA 3T9NA 1JLBB 2J5AA 5A8KA 2KZZA 4FBTA 2LKZA 5DDRC 1R0AB 3OFEA 3KK2A 3CCLS 1M5HA 1Q53A 2M4MA 5D78A 1HA1A 3MMAB 3AY0A 3Q8SB 5FJ4A 2M8HA 2EFVA 4BHQA 3KNGA 3NMAA 1FRXA 2VH7A 3FRYA 2PD1A 2J0QD 2PMHA 2P6TA 4NRTA 3NNCA 2V4JA 1GT8A 1N0UA 2XULA 3RB0A 4RUCA 2DGOA 2B51A 4ETXA 2QE5A 3U1LA 3JB9k 2DR9A 2Y1RI 2PMZD 2B4OA 4YHHF 2L9WA 2RVJA 3QAUA 4C11B 5H9FJ 3SV4A 1Z1ZA 4EBDA 2ADBA 4C3KA 3C6TB 1D1UA 4ES2A 1AUDA 4GO5X 3EUNA 3CJ2A 1UA0A 1K1QA 4QR0A 4QIVA 1JK9B 2M9KA 2FJVA 2RQKA 3TI0A 3LP0A 4F02A 3H2LA 1FK9A 3BDEA 2JEFA 3W2VA 4DQSA 3BEGB 4AFFA 2DBBA 3IGNA 3JSMB 4PG4A 5A0YB 1L5UA 3G6ES 4XDDA 3EXCX 3TVYA 4K4XA 1QAYA 4MFBA 4JI7F 3VAFA 4IFYA 3K58A 2J0SD 3MCSA 1DQAA 2PI4A 4CH7A 4ILLA 4OIXA 1BQMA 5CHCB 3TX8A 2CYYA 3TVZA 1VJWA 3U27A 2DNHA 4WFBQ 1X4EA 5F9LA 4OI3A 1X5TA 1YJVA 2DGUA 2JEJA 2HNDB 2N4CA 4HDHA 2YKPA 4M1KA 4AE5A 4C98A 2NXUA 5F8HA 2KFNA 3ONQA 3KLHA 5LSRA 1HPZA 1XN9A 1VQ6S 3PX6A 3DI6A 2PT0A 3E3XA 1WNEA 5CYMB 1VHFA 2VG7A 2XS2A 1JIHA 2MSSA 4LJMA 2YWGA 4HH1A 1VC6A 3WC2A 3LAMA 3LWLA 5EWEA 2FJBB 5KT3A 3HVAA 1HWLA 3MMCA 3L7OA 1FKPB 5L1IA 1NNDA 2O3DA 2BV3A 2HRYA 2JC0A 4U7UK 1MMDA 3T5JA 2J7WA 4F8RA 2JSXA 3M1VB 3KWMA 5C25A 3V4IA 3BS9A 2AJFE 4RX6A 4B3TF 3C3LA 4DOZA 1K8AT 3OLBA 3KLEB 4ZPVR 3FEYB 2B5JB 4NLXA 3MR5A 3KMQA 4PXBA 4ECVA 1NKCA 2DR5A 1S77D 2YX4A 3T1AA 3S01A 1YJNS 3W7BA 4YB1P 1L3UA 4JI0F 3L7PA 5C42B 3PX0A 5G0RB 3RRHA 2VG5B 2MDAA 4WXOA 4JV2A 1JLEB 4I68A 4HTIA 2YX1A 3M6WA 2WOMB 1C2PA 1HQUB 3OTBA 3RRKA 5K8OA 1TKDA 1NJZA 1CC7A 2MQQA 1AROP 3GB0A 3CCES 1JMTA 1U7LA 1Q7LB 1ZZFA