3O8WA

Archaeoglobus fulgidus glnk1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
104
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLVDLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGEEEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-1)
publication title Structure of GlnK1, a signalling protein from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 20
structure length 104
sequence length 112
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o8wA00
4Y65A 1UMJA 1XK8A 4NYPA 3AA9A 3AA8A 3M05A 4RWXA 3X3UA 3LF0A 4USJC 4Y6IA 2J9CA 4IYQA 1V6HA 4CO2A 2JJ4D 2RD5C 4CO0A 1V3SA 2O66A 4AFFA 2O67A 4YB6A 2XULA 4WK1A 4CNYA 2ZOMA 3NCRA 4OZLA 3MHYA 4C3MA 3N5BA 3TA0A 4RLEA 2EG2A 1UFLA 3L7PA 1O51A 3OPKA 2GW8A 1NH7A 3BZQA 3O5TB 1OSCA 4D3HA 5DS7A 4WK3A 5D4NA 2GNKA 2Z0GA 2XZWA 1H3DA 3NCQA 3HLUA 3O8WA 2E66A 2V5HG 5D4PA 1O5JA 4ZK7M 4OZJA 2XG8A 1VHFA 3CE8A 3T9ZA 5D4LA 1UL3A 4USIA 1UKUA 4YB7A 1GNKA 2CZ4A 3TA2A 5L9NA 4OZNA 1P1LA 2GX8A 1PILA 1V3RA 1KR4A 4USHA 4CO3A 2NS1B 4C3KA 1QY7A 2PIIA 5D4OA 2ZFHA 1Q1KA 3DFEA 1NZAA 2DCLA 1J2VA 1VFJA 4RX6A 3NCPA 3TA1A 1HWUA 4CO4A 4CO5A 2J9DE 4CO1A 2VD3A 1NH8A 4RWWA 2NUHA 4D3GA 4E98A 2XBPA 4R25A 3GSDA 4CNZA 2NUUG 5DRKA 2J9DA 4YB5A 1NAQA 2J9EA 3AH6A 4NYOA 4C3LA 1V9OA 2EG1A 3AHPA
chains in the Genus database with same CATH superfamily
2CZ9A 1JX4A 2CPFA 2BRLA 1R0AA 1REVB 2A3JA 2FJBB 2IMOA 2ZJQQ 2GA7A 1VGYA 3CPWR 4ZVOB 2B9EA 2CG8A 2GO9A 3F41A 3R6LB 1RKIA 3TI0A 3N9UC 3GFYA 2EFOA 1A0OB 4KJIA 2W9BB 3A3OB 4E2FB 4WIQA 4L3KA 3N6LA 3QSIA 2H1YA 5DG9A 2GS8A 2JC0A 2X1FA 1S6PA 2CNLB 1AUSL 3OTBA 1Q0NA 1OQ6A 1UVNA 1RWWB 1B7FA 3BYPA 1RZMA 3FBCA 2GC8A 4C4WA 4MT1A 1CPZA 4MK9A 4DX7A 3HJVA 4ZCLA 2Y1JA 1FA0A 4IUFA 1U8SA 1I1GA 2R7WA 1C2PA 3EZUA 4JI8J 3FEYB 5KFTA 3BBCA 4PYAA 3QGHA 2H65B 2MY7A 1W2IA 2MQNA 2OTJS 4CLUA 4ZPAA 2QC3A 4EGLA 4ED8A 1UWBB 4I69A 4C3MA 1O6XA 2MHEA 1OJ4A 2RUSA 4O0NA 1YJUA 3HO1A 3DNCA 2DNMA 1R6YA 3W5YA 4AL6A 3TW0A 2Z2MA 3I9ZA 3SEOA 5D4LA 1FRJA 4XPEA 2QSWA 3U1MA 5L9NA 3M6VA 4A8KA 3AD9C 3H59A 6FDRA 2EFNA 3GFHA 1KDNA 1FXDA 1GQEA 3UDEA 3EJMA 2IRXA 2ERRA 4RW7B 2OH2A 1FJ7A 1RWUA 3H4DA 1VDHA 3DGPA 3W65A 2CNNB 3GONA 2ZH3A 4M1KA 2QA4S 1JKHB 2WZ1A 1R6VA 5KFWA 2OGUA 4RUBA 2ADBA 4C0HA 3GFXA 4P2FA 2M7SA 1IBLJ 1TV6A 3IGNA 2V9WA 3AA8A 2VBWA 3OFFA 2RVJA 3QFWA 4P2XA 4WU2A 3RU0A 2HIYA 3PDNA 2KJWA 3I0SB 1RADB 1RCXB 1FNOA 3CCES 1R43A 1N0VC 1A6LA 4UW2A 5KFXA 2FVSA 4NRUA 1CSJA 3ZTOA 3S7RA 3I5AA 4K5RA 3CJ0A 2DGUA 4KBIA 5L1KA 1RT6B 3D0HE 3JTPA 2ILYA 2B3TB 3I96A 1AFJA 1SL1A 4RR5A 1K0VA 1UP1A 3BPSP 2BE2B 1NZ8A 3QGIA 2LEAA 5HI7A 4LFBF 2XS2A 4PPZA 3UCUP 4H4MA 3P3DA 1JLQA 2IM1A 3T5LA 3H5YA 4I7FB 4PR6A 1U1QA 4R0EA 2XMAA 4WFXA 5KG2A 1YK9A 5AT1B 4KAIA 1MG7A 4D3GA 1FFGB 2ZEJA 4B3SJ 2HNZA 5HN0A 2DT9A 1JXVA 2N7CA 2AYEA 2ZBCA 3G8SA 3HVWA 1DZ5A 3AB4B 1R8AA 1FXRA 2RD5C 3ADAC 1S1TA 4X62J 3ZZPA 3UPFA 2ZHAA 4OZLA 2JWNA 1UETA 2HK2A 3KJFB 3M7VA 3W9JA 1ZH5A 2L48A 4QWBA 3RRKA 2RF2A 1E6VA 3CJSA 3GJTB 2VA2A 1OPIA 2YNHA 1O5JA 1WF2A 2IM3A 2W2PP 4YEAA 1TMMA 5LMUJ 4FNHA 1YG0A 2CADA 3MEGA 1KR4A 3ILIA 5KT7A 3PIOQ 3GYNA 5HQMA 2XZDB 2KZMA 4DV1J 1HMVB 1OY6A 1BE4A 2JVOA 3V6HA 3ISZA 2E44A 4KPYA 4RW4B 1JLAB 2J7UA 4OX9F 5F8NA 2BEFA 1KC8T 3I31A 4UT4A 1HLWA 1U0HA 3NS7B 3GFZA 4RBTA 4CM2A 2R8HA 2J0XA 2LEBA 4B3TJ 1F5BA 4B9NA 1DAXA 3HKZD 1CS4A 2OPPA 4NLTA 2B0GA 3LALA 4B3MF 2HHQA 3MDFA 4PQUB 1GX5A 1UZHA 1T94A 8ATCB 3J7Z5 2M3DA 1S10A 2I5JA 3QO9A 3A12A 3CD6S 1WEYA 2WB1D 3FNNA 1VQPS 5E3QA 2VFUA 2FYXA 4Y0FA 1X9MA 4ED2A 2OPPB 4DG1A 5T41A 2A10A 1RHJB 1N52B 1VRUB 3EMTA 4HL9A 1WOPA 2GIRA 3HD2A 2OAUA 1JNZB 3QO9B 3NGRA 3VQTA 5KFIA 4DHVA 3BEGB 4CO4A 2LA4A 2C42A 2DH7A 4ID8A 4OFZA 4DG1B 3F44A 4JYAJ 4G1PA 3A8EA 1ZA1B 4K0KF 1NSAA 4NCAA 4LBHA 1RWVB 1TL1A 3KMSA 2WSEC 1IKYA 4OX7A 4J9PA 3JQMA 4Y6IA 1UAWA 5KG5A 1SQGA 3C2PA 5H9EK 1ZZNA 4Y00A 4OI3A 1AUDA 3JTNA 4OI2A 2YWGA 2XYHB 1M1KT 3KLHB 1TL1B 2GAGC 4K59A 3A8IA 3OL8A 1WI6A 1ZOTA 4NZ6A 4DR7F 4TY8A 4H4OB 3ZTRA 2KFZA 3EZOA 3EUNA 2MKIA 4ZJQA 1GMVA 1F9EB 3DXBA 2ZFHA 4PG7A 1MN7A 1ZS6A 4I2QB 2CWXA 4ED4A 3TZYA 1HWUA 1NHVA 2V8PA 2LA6A 4DUZJ 5CYMB 3C8YA 4C8LA 3W3SA 3UFCX 1D0EA 3PX4A 3EZ5A 1DQ8A 4J91A 2DRBA 3LP0A 1RAFB 3SI8A 2B5JA 4DPOA 5A8KB 1S79A 2RH3A 4DXLA 4J5OA 5HQLA 3G8QA 2BKPA 3F56A 4DCPB 3W2WA 4DV4J 1WEXA 4M5JA 3T5HA 3NAIA 3UNGC 4E8UA 4NCGB 4OLOA 1HA1A 3A3PB 1T7PA 1QTNB 3OFEA 3I9V9 4K8RA 2YX4A 4DQPA 5K8NA 5G0RA 5L38A 2ZWPA 4ETZA 2HZAA 4ETXA 5KFGA 4ALZA 5B0DA 5HLFA 4LBPA 4CTAA 4ZHRA 1VQ7S 1WD6A 1XC9A 1X9SA 2V2QA 2OO4A 4N41A 4CZCA 2IC3A 2QMXA 1SPBP 2MDAA 2Z8QA 2DH9A 1UTAA 1UWAA 1G6BA 2N4CA 3I5BA 3P96A 4F4AA 4HYKA 2RKIA 2PSZA 2DRDA 1L3TA 2NXNA 2JJ4D 2AJ0A 2P9GA 3UDCA 1T05A 3Q8YA 1HQUB 2XI2A 4QQBA 4ATNA 4AYBD 2HHPA 1AROP 1URNA 3DOMA 5BYRA 2B4PA 3NS5A 1QUPA 1WF0A 2CJQA 4QIVA 3MPUB 1X4FA 5KG7A 4M95A 4LUBA 4PEOA 3KJNB 1S7IA 3Q86A 1BLUA 3E3XA 4ED7A 1J5OA 4USTA 2CZVC 4PXBA 1SUQA 2BW7A 2EK1A 4HDHA 3M9OB 4R8UA 1D9AA 2LXIA 1KONA 5CCMA 5B08A 4N8NA 4RBVA 2QLJB 2V68A 3E8OA 3QQCD 5C25A 2JSXA 3VAFA 2C2KB 4X4QA 3CIMA 4J37A 4HR2A 1N32F 2MZTA 2VKRA 4L75A 4K7QA 2C1EB 1J5OB 3TVYA 3JYTB 2IJRA 5F8JA 2KB2A 1Y11A 4IRKA 3M8ZA 1SUQB 1GMWD 1XR6A 3CVKA 2XMWA 1TK5A 5D3GA 3ETOA 1L3SA 1WOSA 2WW4A 1XQIA 1ZM2A 2A6OA 4F2RA 1S1VA 1WDDA 3CC4S 3D9BA 1V6HA 4Q43A 3F0NA 4ECRA 2O66A 5C25B 2ZM6J 4DL0C 2XSJB 2HAIA 2HS0A 3SIPB 1OY9A 4MAKA 4O3PA 1TU0B 1Q78A 3D67A 1K47A 3UNYA 1X7VA 4HHUA 5D4NA 3H40A 2E66A 1IJFB 3OXGA 2NQPA 3RJMB 1Z4UA 4X4PA 1VQSA 3UD4P 4HLBA 2AJFE 2EBEA 4B9SA 2PN6A 1NPRA 2PMZD 5BJRA 2KT5A 5GMEA 3R1LA 3T1YJ 1W26A 1RBLA 3VWSA 2WVCA 3DMJB 2R8KA 3M9NB 3ONQA 1DFDA 3W1YC 4RW9A 5ETPA 1SJ1A 2YNGB 2NUHA 3TWZA 5J2MB 2IPOB 3H8YA 4N77A 2J76E 2MLYA 1MROB 5DZ6A 2A6MA 4NYOA 2DHHA 3D3CJ 3AJDA 5IT9U 1MMNA 3P45B 2IM0A 4Z7YA 2E1RA 2KFYA 2R2SA 4ECSA 4MKAA 3W60A 4K4ZA 1HWKA 3T1AA 4DPUA 2XMTA 4EK2A 1HD0A 3EGNA 4WE1B 2GV1A 4FYXB 1IKXB 2HHVA 2I9SA 1E6YA 4ICLB 1Q7YT 5D4PA 2ALZA 1VC0A 4ZP9A 2GIQA 3M8RA 3CD0A 4LR8A 4JI1J 3A8JA 5HL7Q 1WTBA 3BQ2A 3G2XA 3GB0A 3M8QA 1RTHB 4EYIB 4KH0B 2PA3A 2HNDA 3D6HB 3KHLA 3V4MA 1L3UA 4C98A 1NM2A 4ZITA 1I94F 2W9CB 2DYAA 3ZZ0A 4QOTA 4WU3A 1VRTA 2HQCA 2I8EA 3IP0A 4KHPF 4ZJOA 4R25A 2ROGA 1TKZB 3QIPA 2GIFA 2XY6A 3PYGA 3NG8A 2VG7A 4EZ6A 2AHOB 3AHPA 1HNZF 4BBYA 5KFVA 2DGQA 2YKAA 3M8QB 2Q66A 1P27B 1YJRA 2CWKA 2HNDB 4RUCA 4TU7A 5AXLA 2XM3A 2Y9HA 2JRSA 3TO8A 4DV2F 4NPOA 4WK1A 4CNYA 1HI0P 2EW9A 4C0OC 2DHAA 4DPWA 1C1BB 2EXUA 2VG7B 1KBRA 4V19X 3M6UA 2V5HG 1S48A 3ILLA 1NXIA 3ET6A 3TUIC 3FMBA 3MM8A 3H5UA 4HH1A 2YKNB 4BC7A 2QYGA 2AZ1A 3NEKA 1FKOB 1RAAB 1UVJA 3OL6A 2FZKB 1U7LA 3ELHA 4CP5A 2ACMA 1HBNB 2YQ0A 1WUUA 2V63A 3SSQA 3VVTA 2LECA 2P6TA 1NK4A 1VFJA 1N5YA 2GJIA 4M5KA 2VPZB 4QU7A 3OJSA 4QWEA 3NBPA 2VL1A 4JV5F 1LFPA 3QGGA 1KLMA 3MTKA 3R6GB 2B8QA 4NX9A 3GSIA 1WACA 1M5HA 4H4KC 4LFBJ 3RRGA 1RWPB 2F4FA 3T1HJ 3FBBA 1RWXB 1F3FA 5F3ZA 4G1QA 1AW0A 1CEZA 1IN0A 1T9XA 3D66A 2CQ4A 3L7PA 1FRMA 2PEBA 3MCMA 1FKPB 5LSRA 2AGPA 2QN6B 4URSA 4R0JA 2FB0A 4FF3A 4C8ZA 2ZH2A 1UJ5A 3KHGA 3K0JA 2FVPA 2HQ3A 1N56A 1HNVA 1U47A 3IS9A 1PILA 3R5AA 3LANA 4B9TA 4TXSA 4DV6F 4U96A 1S0MA 1AT1B 1DURA 4RX6A 2FJXA 4CT8A 3IBFB 3LPYA 1YIJS 4DFMA 3CMQA 1TKTB 2FY1A 4KO0A 2PD1A 1HNVB 4CLZA 2MPUA 2QMWA 3WX8A 1B3TA 2M9KA 2J6TA 3U02A 1NKBA 4X4SA 4YP3A 4OX6A 4KO0B 1UFKA 2V50A 1UEKA 4MH8A 2R7QA 4NLDA 3I82A 3R2DJ 1X31C 4WFBQ 1TKXA 2QIFA 1RBOB 5A2QY 1ACMB 2O3DA 4DL4A 4UUXA 3WIVA 4DL5A 1UA0A 1KVJA 4B3MJ 3KUHA 3OVAA 3FDSA 3ICLA 1U0SA 2DHSA 1FJEB 4CM0A 1NRKA 3G96A 2AX1A 2FC9A 5ETVA 3IRWP 3H42A 4DN9A 4CO5A 1SH3A 1IR2A 1OSDA 4ECWA 2DGXA 2L3MA 5J2QB 3MMBB 4USUA 4ZVHA 2ZWOA 1NMEB 3I32A 1JNRB 2APOA 3CCRS 2IMWP 4RWXA 2FHKA 3DKDA 1HR0J 1K0TA 1YJ9S 4QBUA 4DUTA 1NEEA 2BE7D 1RXOB 2WVDA 3R1HA 1KFSA 5KFMA 1UFLA 1JK9B 1H7XA 1RT1B 5B0AA 4DFPA 3KK2A 2C3OA 1OO0B 4DFJA 3UE2A 1ZAVA 1DLOA 2YWEA 4K0KJ 2LCWA 2FQQB 3CCZA 3BV8A 3PNIA 5T7LA 1NSPA 2DPJA 4URGA 4KQZA 3QJJA 3SMZA 1I6JA 4U95A 2CZ4A 5L9XA 2W25A 4KB7A 4TKTA 2VB6A 3EDQB 2CG4A 3BPDA 4MFBA 3MUTP 3A4TA 3KK2B 3PEJA 4WJBA 2AEMA 1DLOB 2EC0A 4AL7A 5T7LB 3KDNA 4MIWA 4QCLA 3FBFA 4F3QA 3DI6B 1QE1B 4FPIA 4A8XA 5JMNA 5GAHI 5L46A 2XMVA 2Z57B 3MMAA 2MEWA 5HROA 3QATA 3NGSA 4F4ZA 1YVFA 2IDLA 2W2QP 1N48A 5D78A 4NEZA 1NLKL 1ZA2B 1SH0A 3RB0A 1HNXJ 3GYGA 4NMLA 4UZBA 2JL9A 1NNDA 4F8RA 2Q43A 3MEEB 1RE1B 2LXFA 3DRXA 3HKWA 4M5DB 3GR1A 3MGJA 2KM8C 5AE1A 1WKJA 4KFBA 2JLGA 5HROB 3R2CJ 4M63A 3NCQA 1AZSA 4ZJLA 4FS2A 4NCBA 2I1RA 5HBMA 2MGZB 3AQPA 4YFUA 1RLDA 1FNMA 1UL3A 4IRDA 4C11A 3VALA 2IAJA 3MAAA 3B78A 3CW2C 4LRDA 3FUYA 3JSMA 1LWEA 2GZOA 2VODA 4JI0J 3Q23A 2KVQE 5KFCA 3NY0A 4EI2A 4GKJF 4C11B 4DI6A 2IHR1 2JX2A 2QLFB 5KFHA 1RAJA 2HIQA 4DZDA 1YRXA 2NXJA 3KLFA 5FD1A 1TKDA 4BWJA 1RK8A 1NJXA 3PRBA 2CQDA 4U8YA 4GVLA 2XSFA 2YH1A 1H74A 2MQ8A 4NLWA 1NHUA 1Z2LA 5L1IA 2QRRA 2UV8A 1S1UB 2ZNYA 1VYAA 4YDXA 1H2TZ 3T6JA 1RT3B 3CO9A 2HBZB 2GQQA 3NS6A 1RISA 2X1AA 4DMZA 3ENWA 3PX6A 1QLNA 4R5PA 3MFHA 4HHJA 3BR9A 4O4GB 2WVBA 5IQ6A 2XNQA 2VONA 1RU2A 1NO8A 3BGRA 1M5OC 4LSNA 2FHOB 4NLGA 4L74A 1S9FA 3E01A 1TVRB 2HGLA 2IM2A 4I2PB 2ZVIA 4ZMMA 3C14A 2B56A 4DV7J 2ZHBA 1DTTA 2GHWA 3NMAA 2JEGA 2HG4A 4IG0A 4DR3F 3DLKB 5C2CA 3OR1A 3HZEA 1KQGB 2CYYA 5EWFA 3D2WA 2BE9B 3H0PA 2E7VA 4BHQA 5DDPC 1CJTB 4CH0S 5DDQC 1N32J 4ZPCA 3KJVB 1UW4A 3CCWA 3CDUA 2OPSB 2NSBA 2B6AB 2ZUGA 2K06A 1TUGB 3UCGA 1N8RT 2DR9A 1ULRA 4ZN3A 4KSEB 2W7PA 3O8WA 4HI1A 2AV5A 2OKQA 3C46A 4QIEA 3HMJG 3P5BP 1CJVB 1NPKA 1WHVA 4FKYA 5IV4A 3I4HX 3FEZA 5K20B 2F7VA 4OL8A 4F0KA 4J9NA 5AJ3J 2HBRB 1R8PA 3KTQA 3MCNA 1LXJA 3BGUA 5LMNF 4JB8B 1SQFA 3G71S 2EI5A 4MIBA 2WCXA 4PYDA 3J7YI 4YHHJ 2W2MP 4ZVUB 2VBZA 2NUUG 3M2VA 4DV3J 4TU8A 2BJ7A 3K57A 2MZQA 2CQ0A 1UPMB 5D0HA 2BXJA 4NI2A 5CHCB 2JLEA 4WPAA 3GILA 1PYOB 3R5DA 3G82B 5CAAA 2FIUA 2FHJA 3UWTA 1FWPA 1H2UX 2G2YA 3M2VB 3ILJA 5DG8A 3Q8PB 1JLBB 3LOUA 2HWHA 1EJ7L 2UU9J 1JLEA 2J0SD 3LW5C 1WKLA 2C3UA 4LF4J 1WG1A 1D1UA 2ROPA 4NI2B 4TVAB 1HBUA 3V5RA 1H6KX 1NDCA 1CJKA 4FVCA 1P1LA 1M5SA 2MB0B 2MKSA 1ZZFA 4PPDA 3BKFA 4P10A 1S9GA 4LVNP 4JI6J 4C9DA 1N4LA 1X4EA 2BQ3A 3CJ5A 2D3OR 3FC9A 3U27A 4OYMA 2CQ1A 1HL6A 3MI7X 2HWTA 2PEHA 4OYZA 3IWXA 2ZD1A 5B0CA 4QYZK 3GSDA 4XPCA 5DRKA 2JH3A 1CJKB 1QSSA 4X64F 1KRPA 1T11A 3ISND 4U7UK 2IA0A 3MPDA 2CJBA 6AT1B 1UMJA 2BANA 3NGKA 5ETOA 2WTFA 3LF0A 3G87A 2VKZG 4YB6A 2RQCA 1WJ9A 1Y3JA 3ENVA 4DR4F 2ZBRA 4XIUA 3KLGA 1HYSB 1FRIA 4UOCA 2E1CA 1PC5A 1C0TB 4KHPJ 2KJVA 1PJ6A 1SKUB 5A6WA 2PT0A 5SZTA 1HWJA 5A8RA 5EWGA 3EVWA 4LR9A 5K8PA 5MLCV 1X4AA 2ZE2A 3TQEA 4PWWA 4DV2J 4YB7A 4ZS6A 1APSA 1FFSB 3UR3C 3QNWB 3DOLA 5IOLA 4IG3A 2KI2A 3EM1A 4OYIA 2UXBF 4B3RF 2DCLA 1XR5A 2PO4A 3SCLE 3R5CA 3EICA 2CNKB 2ZE2B 2ZZMA 3DM2B 1VQKS 1X4GA 5HAOA 3V6DA 4ZIWA 4WFZA 1D9DA 2HYIB 1MU2B 3CO0P 4LJMA 2B9XA 1ZAXA 3DOLB 4JI7J 3BR8A 3GP9A 1RTDB 1IM6A 2QA4G 1VJQA 2C2OB 4ID5B 2V8VA 3MECA 2VG5A 1TAUA 4DL2A 3CJTA 1SV5B 1WSRA 1D8ZA 4CRJA 2RUGA 5DZ7A 4V1Ak 2VG6B 4A8WA 5IC4B 4LF6J 7FD1A 1NPPA 2Y1LB 3Q2TC 4BWMA 3DLHA 1R3NA 3AXKA 2E5JA 3CB4A 4J9LA 2G9OA 1FESA 3ZTQA 3I0RA 3SQGA 3K5OA 1WTFA 2DXEA 2F9JA 2RS2A 2VG5B 2DO0A 2GVDB 1FTRA 1LK5A 1S6QA 5HJXA 2RU9A 4J9KA 5LSOA 4YMEA 1RT4B 2K3KA 2FGOA 3ILOA 4OYAA 5GVQA 4FYVB 1N6QB 1RT5A 3GYXB 4O0IA 4DF4A 3S6EA 4C8NA 3HFZB 2HWIA 2CJYB 4DLEA 2G0IA 4DLGA 3D68A 1YJ7A 3OLBA 4I67A 1U1RA 3DLGA 2F63A 1JMTA 3M30B 2MQQA 5DQGA 1YKWA 3HVAA 2K7KA 3C6UB 5FLXY 3L9ZA 2QSFA 2VFSA 1U2CA 1FDAA 2BJDA 5KFFA 4ZPDA 1VR6A 4C2MA 1RTIB 4J90A 4FBUA 4ECUA 4ZPTR 3P4UB 3GTYX 3HSDA 3ZC4A 1GK8A 2P5VA 2W7OA 3OHAA 3W9HA 1HBMA 3H25A 3MM5B 4URQU 4NA1A 4OZ3A 2VC0A 1OMSA 1VS3A 3W2VB 3THPA 1DJ0A 1S97A 2PGCA 3HHNB 1KVIA 4F7VA 3M9MB 1BMQB 2BJEA 1RWMB 4DPYA 3HSGA 1B4SA 5HMXA 1HBMB 4K2XA 4Y28C 3W5ZA 3QLHA 4ZLNA 3C16B 3NCPA 4YS2A 4ZP8A 2HPUA 5L39A 3MM6A 4LF5F 1U49A 4DSFA 2CQ2A 3PHEA 3KNAA 1Q81T 2E9ZA 2Z56B 1QVFR 3RUBL 1S1WA 1X9WA 4K50A 2YPZA 1VQOS 5T14A 3J81j 1UFWA 3MPWA 3ZZRA 4LF9J 3RAQA 1SJQA 3QLHB 3IG1B 4WP9A 1VQ5S 2FJAB 3W9IA 1XBWA 5KFNA 3PO5A 2U2FA 2GVZA 4FNIA 3KYLA 1T3OA 2Z2LA 1VIXA 3AD8C 1HHSA 1N34F 5KFSA 4DX8H 3CCUS 1K8AT 2XZWA 2G4BA 4LBIA 2P6SA 4OZJA 2D3ZA 4Y2MA 1DTQA 3T6BA 5GAHU 1HD1A 2GVZB 4UY85 3POTB 4OHWA 3B54A 4FS1A 4U67Q 2E5GA 4CT9A 3P5TL 5KFLA 2AEJA 2V94A 3BDPA 4ILLA 1IKVA 3R5BA 2KN4A 3DRRA 2GHPA 4GC6A 4ZCIA 1DTQB 3OXLA 4HI2A 1NH8A 5A8WA 2BKOA 3BGLA 4M5MA 2MQOA 2HHHF 4GC7A 3D28A 5JXSA 4WKRA 2DY1A 2OMLA 2P2CB 2HFOA 2F65A 3T5JA 4DQRA 1CJUA 3EPGA 5DGAA 1WDTA 2EFQA 4X4OA 2HVEA 4NOHA 1S1XB 5C5JA 4DFKA 1FO1A 1KOOA 3HM9A 4X4RA 3CMES 2LFVA 3CC2S 2YBVA 5B7WA 2HNYA 4OI1A 3N5FA 2KHCA 4IKAA 1O8BA 2F1FA 4B17A 4YQWA 3K2YA 4U9RA 4Y2IA 1RAIB 2DK2A 3DRSA 3N6NA 2Z58B 1XERA 4P52A 2DISA 3D3BJ 1QDUB 2W2OP 1HPZA 1N33J 2KT2A 5EWEA 3QT5A 1IXKA 2BDPA 3GQCA 1J5EJ 2XY5A 4OJGA 1HNIB 2F8HA 1L3VA 4USHA 3SQOP 2VJVA 3K58A 1IBKF 2BR0A 4WXOA 1QY7A 1RTJA 2YNIA 2WHOA 1KFDA 3TRGA 3ZZTA 4DR1J 4I6AA 3O2IA 3DRSB 3MM7B 4Y2AA 4PCQA 3MTJA 4FVMA 4MTPA 4KYZA 3R5GA 3KLVA 3TARA 1D8YA 1X5PA 3JSRA 1N5VA 3VGSA 3BN4A 4F4YA 2J0WA 3LGHA 2XI3A 4CO2A 2W24A 2CQIA 4FDFA 2C2DA 2WW8A 4DV0J 4LQ3A 1HW8A 1G7CB 1WHYA 3RB6A 3M32A 4AXJA 2IJFA 4HACA 5IXUA 3CJKB 2PE8A 4B9VA 3J81Y 3BKUA 3HHLC 3MXHP 4YR2A 4MK8A 5C7PA 2E1MC 2X1GA 3OSNA 3C15A 4F2SA 3WX4A 1PGZA 1G2EA 3RW7A 4IR9A 5LL6d 1K9MT 2HHXA 4W90B 5I3PA 1FWKA 3W8PA 2E29A 2RDDA 2Y1RI 1HQEB 1FNXH 1PIEA 3TR5A 1WNEA 2ZOGA 2Y0BB 4NMXA 2V4JA 1U6ZA 2GJFA 1U6FA 2ZOFA 1FDDA 3CJQA 1U26A 3TZZA 1RHRB 3DRPB 3MZIA 4CH1A 3Q22A 2K1RB 4OHVA 2ASDA 5DLFA 1KHVA 2J9DA 1RDRA 3K17A 1Q8BA 1S0OA 2D74B 4L3NA 3UVJA 4A8SA 5IQQA 3AOCA 4IDKA 1Q5YA 2ZUAA 2VOOA 5CYQA 1AB8A 4RNNA 3M2RB 1QSLA 3FK4A 2EG2A 3C19A 3EE3A 5MAOA 2MYFA 2VDHA 4NE9C 4NLYA 2R7XA 1BUXA 3AOAA 3DYAA 2BRKA 4DR3J 1C4AA 4BLGA 1FVQA 3E51A 2XCAA 3I4PA 3UVJB 3J7YU 3Q24A 2Z2ZA 1EQMA 3IO1A 5K8OA 3H98A 4O44B 3AODA 4DU7A 3S8SA 1TZ0A 5EGYA 4C7QA 1IWGA 1JLFB 3VQSA 2YTCA 3BQ1A 2R2TA 4K2JA 1UW9A 1BQMB 1C1CA 3FFIB 1ITPA 4ECXA 2KL8A 4KR0B 4AQYF 1RA7A 5HATA 3N4WA 4UUWA 2VICA 2NPIA 1T0TV 3M8PB 5D0RA 1S59A 4YY3F 4IH7A 1SJFA 2WOMB 4DCJB 2DHGA 4NXMF 2V69A 4IFYA 4P71A 1C1CB 2VF3A 3OW2R 2UVWA 5LMNJ 3AOBA 2MTLA 1UEUA 1AA1B 3MR5A 2ZZTA 5IT4A 2R3VA 3LP1A 3KFWX 3OUYB 2EC2A 2VV5A 3M2UA 5I42B 3HK2A 1P8GA 4IFYB 1Y9OA 3TUPA 2D41A 4TLQA 2HMIA 1TFWA 1AFIA 3DDIA 3OHBA 2E5HA 4N76A 3EDRB 1XNRF 3QRRA 4P7VA 1GFWB 3MEDA 5I3QA 1U1LA 4X4NA 3AB2B 2EEYA 3PO4A 2W4DA 2FLLA 1S0VA 3HI9A 2Q1LA 1FCAA 2QFIA 1KQSR 4YB5A 4JI2J 3MURP 2C3MA 2DNLA 1RWOB 2GHVC 4J9SA 3R7NB 4Y65A 5LJ3Y 4TYAA 1IVZA 4NLXA 2HLTA 2CPHA 4QU6A 3D6FB 3KUEA 4CDIA 3NXZA 3IR5B 2OTLS 1KQKA 1RBAA 4UZCA 3SV3A 2GGPA 4M5HA 3TA0A 1P9QC 1ZYQA 3I5CA 3O1LA 4FZVA 1XNQF 5IS2A 2EKYA 2ZHOA 1SCJB 2I0XA 2DO4A 4X64J 1Q7LB 5CH7B 3WZ0A 3TAMA 4E0DA 1JXEA 3C6TB 3HSZA 3VTIA 5CXTA 1REVA 2MMYA 4A48A 1HIYA 1ZETA 1VQ9S 5IWAJ 3LGNA 1RUSA 2GJ2A 4HT7A 4S0MA 5E0OA 1JLGB 4ZPWR 3NLCA 1T9TA 3ZZUA 3QWPA 2UUAF 1HHQA 2RSQA 4LSZB 2HQDA 2BX6A 4CO1A 3S01A 3WDOA 2HGNA 3KK1B 5KFZA 4LVOP 3BYRA 3EXCX 4LF7J 1RHKB 1TFYA 2UXBJ 4AT1B 4K4XA 4LIWA 4MKVA 3MUMP 3KXDA 1JQGA 1Z1ZA 4WFAQ 2DBBA 2CVIA 2MXYA 3PW5A 5U47A 3D0IE 4IO1A 1S5ZA 3SBMA 3V81B 2H48B 4HTIA 5FDLB 5DS7A 2UXDF 5CYJA 1KLNA 3NNHA 3J80U 2GNKA 2DNOA 3IRXB 1NSQA 3H90A 5B0FA 4UF4A 1CQNA 1H98A 3T9ZA 5AE2A 1UWBA 2UP1A 3KWMA 1JXLA 2HFZA 4WZMA 5JVGQ 2DNZA 4OHYA 1MLAA 2WVEA 3VZIA 1DBDA 4DX6A 4QWDA 2XMJA 3PW4A 4QIGA 2E9TA 1LW2B 3BSAA 1XMQF 3A13A 5KT2A 1MNEA 4DUYJ 2Y1IA 3M8SA 1NB2A 1WG5A 2E5LJ 1YHQS 1YJVA 2CJKA 1SJ4P 2R7UA 1LWFA 5D0EA 1SC1B 2GQ2A 3H7HB 1FX2A 2GQCA 2IRUA 3IR6B 3LTOA 3BSNA 2DEIA 4RW7A 4PWDA 1XMOF 2ROEA 2M52A 2KU7A 1Y00A 2FD2A 1F9HA 1JKHA 1HNWJ 2YWKA 2LDIA 1LWFB 5DO2A 2FJVA 1C0UB 2IY5B 3R5JB 1GMWA 4NYZA 2H3EB 5I4MA 4PWDB 2ZJPQ 3I0SA 2AWZA 1M90T 2BOAA 2FZGB 4EZ9A 1RAOA 3GWCA 2QL5B 1U24A 3P49B 5HK4A 4B9UA 1RT6A 1Y7PA 4GVBA 1KS2A 4P74A 4NA3A 4PUOB 2V2VA 3OTDA 1ROFA 2DR8A 3BM7A 2BE2A 3OVBA 2EFPA 4L6V3 4C8OA 3MF5A 2O67A 2XCPA 3DN9A 2XULA 1S9EB 2F3JA 4I7FA 2VPYB 2MHNA 4MYTA 4IFVA 2Y8YA 1XWLA 1RKJA 4GVBB 4DV5J 3SFUA 1SL0A 2MQLA 3TJ8A 4K4SA 4QIWD 3V6JA 3JSYA 3FRZA 4J9MA 3HULA 2ATCB 4B08A 2QA1A 3HVTA 4AXIA 3DLEB 4RUHA 5KFAA 4IFVB 3GZ7A 3W61A 2GX8A 3THVA 1U48A 1N34J 1QUVA 4JUZA 3KOAA 2AZ3A 3ETMA 3KG1A 1YGYA 4N7TA 2VA3A 2HGMA 2RE1A 3HVTB 1DQAA 2CPIA 2RDJA 2OELA 4DR5J 1SXLA 2LQ8A 4EYHB 2FZCB 5H9EJ 3AH6A 3PACA 2DNQA 2U1AA 1K1SA 5C24B 1XK8A 3AJ2A 1Y0HA 4ENOA 1HMVA 1EIYB 3DU5A 1FDBA 2DNHA 3QJLA 4QPXA 3IR7B 1RSCA 4NLPA 4RW4A 3OTOJ 1JLAA 1X5OA 1YX2A 2V2ZA 4QYRA 4NLOA 2HRTA 4ANDA 2FVQA 1PAUB 2CA9A 2QLXA 4OYPA 2B9YA 4FKXA 4IRCA 2W8KA 3BSCA 1KEKA 3TQ1A 1EETB 3D6TB 2WONA 2IYGA 1B99A 5JJBA 3GCWP 2V6AA 4QR2A 1W2BR 4PQUA 3ZZOA 3QRPA 4QJVA 4A8YA 1DHMA 4NWBA 4IOCQ 1UJ6A 2AGQA 4FF4A 2FJEB 1F0XA 3KUGA 4XDDA 1B0VA 5HJYA 1CC7A 3BKTA 4OMFG 5KFEA 4C6AA 2JHEA 3MCSA 4XO0A 2WONB 3AT1B 4OHXA 4W98A 1VRUA 2XWXA 4EFAC 2FDNA 4HH0A 3RR8A 4F0HA 2LQBA 3ITHB 1N5QA 3FVYA 4Y2KA 2C2NA 2A0FB 2VFVA 4OJ1A 2HSEB 1VK3A 4Q8FA 3AXMA 1RT7B 4D3HA 4WK3A 3RBEA 5I3UA 7AT1B 1T95A 3DOKB 2C22A 3N79A 1ZM9A 3QT6A 2EPIA 4I6YA 4LQ9A 2MKJA 3OBIA 2QLBB 4G6VB 2G1HA 3CD7A 2H51B 3RBXA 5GMKa 3G6YA 2RMLA 5E5NA 2NLWA 2XLJA 4KKOB 1SJRA 1PCAA 3KLHA 2RQKA 1RB0A 4X84A 4RW6A 2IVFB 5I3UB 3MOJB 1BQNB 4DZ6A 1YBUA 1RAGB 3GJQB 2XLIA 1W7WA 4B3SF 4JI4J 2LEPA 3FQKA 5F8IA 2YQ3A 4H4OA 3VAMA 5M2UA 4M8LA 5DDOC 4C8KA 1M5KC 2UUBJ 4F26A 2ZBPA 3GJSB 4I1TA 1VRQC 3FQLA 2RQMA 2VC1A 4X62F 5KT4A 5IT0A 4RW6B 1CVJA 1FK9A 4I2QA 3CCLS 3JQJA 3VV2B 2G2OA 4DR2F 1RYRA 3RYLA 1IBMJ 4G65A 2DHXA 5CYMA 2BJ3A 1R8CA 2ZVSA 3K7RA 4CLSA 4CLYA 2PI5A 2B7BB 5A8KA 5J2PB 5ETKA 5LMUF 3G9CA 1FK9B 2RRAA 4YUDA 4B3OB 2FLNA 1CQMA 3TOQA 4DV1F 2E7WA 5DQHA 3RTVA 3G6ES 1VQ8S 3SXLA 1PBAA 3D6MB 3SYZA 2K7JA 4RZRA 3LAKA 3PX0A 4NCGA 1WKKA 3VAIA 2IYIA 2ZDPA 2XQCA 2YNFB 4X66J 1S72S 2W2NP 2BABA 4GO5X 2YKOA 1IBCB 2WSFC 1LKZA 3R9LA 3BB5A 4B3TF 3AA9A 1XJWB 4IYQA 2R9LA 3KJQB 3JAMY 2OFGX 2UUCF 2E9RX 4RW8B 3MOZA 1O51A 3OPKA 4WKYA 4JI5J 2L9NA 2OI2A 5F8GA 2J6UA 3VZHA 4I4BA 1FJGJ 1EZZB 3SFGA 3J7ZT 4J9VA 2J0QD 1QAYA 4O3NA 3HF5A 4U6PA 3GIMA 1H72C 5HVHA 1ZBTA 3IA0A 1HQUA 3RB4A 4TYBA 5GMDA 1N36F 3A1YG 2QX0A 3OFHA 4CCHA 3KHRA 3V6KA 3M8YA 4CYUB 3D1QA 3L7OA 1YI2S 4EO6A 4LRAA 2R8JA 3AY0A 3WBZA 4KGVB 3WHIA 3D0GE 2XO7A 2OD6A 4OYBA 2K3IA 1RHQB 1PKUA 5LT5A 5ETMA 5KFKA 2R4FA 1EP4B 3OD2A 3J7AN 1OYDA 2D7SA 4CO0A 2EBGA 4Q0BB 2QGFB 1Q8LA 1V5VA 1VISA 3JYTA 1T9YA 3B4MA 1ZM4A 3AJ1A 1LV5A 1ZM3A 2NPFA 4XDCA 3PHTA 1SC3B 4MIAA 2HFUA 3VAHA 4CIOA 5DM7Q 3NOGA 3OR2B 2NXUA 3OVSA 2RRBA 3MFIA 3CDEA 2XSJA 1TUVA 2G0JA 5EHHA 1YSJA 4IR1A 1MW7A 4ZPBA 5CZXA 3BGOP 4YR0A 1MMDA 2IBOA 2QL7B 2V8HA 2DGTA 5HP1A 1P9YA 5KG6A 4WTOB 2OEKA 1VC6A 1FWLA 4K4UA 5E7OB 4DQIA 1BGXT 4LF8J 1N5SA 1WF1A 2P9EA 1PAEX 4QPTA 3HPOA 3CDAA 1OQ3A 4LFAJ 1U45A 5HP1B 1I3OB 4WP8A 2ZKTA 2ASJA 3PXGa 5E33A 1KD1T 1WC3A 4PXEA 3DMJA 3PKMA 4DV4F 1GAOA 3D4JA 5DM6Q 2YNGA 5J2MA 2VIHA 4MKBA 1HARA 4OZ0A 1TR0A 1MROA 1X8DA 3D54A 2F8MA 3CT9A 4GMKA 1TL7B 1VIOA 4FXDA 1G4CA 2LQ9A 2Q79A 1IM4A 2Y0SD 1N0UA 5J1PA 3MM9B 2CJXB 3DGVA 1SBRA 4WE1A 3M6XA 1IKXA 2UXDJ 2H5EA 1U1MA 2C3YA 3K89A 4ICLA 2CRLA 3T19A 3US5A 2M8DB 1LQ9A 1D09B 2I2YA 4KY3A 1WEZA 4FYDA 2LDYA 1R27B 3DLBA 5RUBA 1FT8A 2H5JB 4EO8A 3K8VA 5K9FA 2M70A 1RTHA 1SL2A 2J9CA 2VQEF 3PV8A 1TP7A 1L3KA 2KH9A 2MQMA 1YZ6A 4BCAA 2LYVA 1XMQJ 5HMZA 2W9CA 4RLEA 1KHWA 3PIPQ 4FXVA 2UUWA 3MMJA 1RTZA 3R7SB 1TKZA 3AFGA 2QE5A 4M5NA 4OQJA 2V67A 2FLPA 1RU1A 2DIUA 2MKKA 1VHIA 4WXWA 3B82A 2DIVA 3HHLB 1FERA 2CUYA 1VLOA 1XMOJ 1PJ5A 5ETLA 2XO6A 4ZP6A 2V2KA 4ER8A 4C3KA 2KO1A 4OI6A 2PIIA 1C1BA 1X60A 1WC6A 3ZTSA 4LRFA 3JS9A 1R0CB 3TEGA 4F25A 4B9MA 1KN6A 2YKMB 1AYEA 1LWCB 2B43A 2JZ5A 9ATCB 3DC2A 4G1IA 1WHWA 2C2ZB 3UN5A 2YKNA 2QMUB 4CNZA 4KPCA 2EFVA 1GXLA 2XHWA 1U6BA 1FKOA 4EU0A 2DGWA 3R97A 3GPAA 2XGQA 4OJHA 1HBNA 3NAHA 4TN2A 2KG0A 4B02A 2UXCF 2G0CA 3FEXB 1SKSA 5L8RC 5AXNA 2BOPA 2BMBA 1UZDA 1FFWB 2ZKUA 4DDFA 4YDDB 2CJAA 1C4CA 4F4KA 3HLUA 2ASYA 2CQCA 2VFTA 3OSPA 4DR6F 1M5PC 4NLSA 1URRA 3M6WA 3T1YF 3HSJA 3GG0A 1HW9A 1RJJA 5ETRA 1FKPA 1R0AB 5F8HA 2IVYA 2R7RA 2DNKA 4OZ2A 4KT0C 2BA9A 2ZBIA 4Q2MA 3W5XA 5B09A 1V3ZA 2VHGA 1FD2A 2J9DE 1U1NA 3HP6A 2D1CA 3O3LA 2HK3A 4ZVGA 3W8GA 4TLRA 3CSKA 1GTEA 5GAGI 3N0VA 1UEVA 3LA0A 1IKWA 3ZO7A 3HD1A 1X4HA 2DD8S 4UOFA 3TZWA 4KV8A 1S6PB 1SB6A 1BXNA 1YJNS 2VPXB 1TKTA 3L09A 3UW1A 1TL3A 3ZZZA 4USMA 3HJFA 2R7SA 4PG8A 2AJ4A 3GIRA 4JI1F 1T9VA 2PMHA 4W4MA 2MLZA 2CDRB 3NKYA 3I87A 2BQUA 1IKWB 5F3TA 2BJ1A 1U2RA 4AL5A 5HANA 4HT5A 2KXNB 4KV8B 5CD4H 3JB9k 2JLFA 4OV6A 1TL3B 3H5SA 2ZH1A 1XEZA 2KYZA 2HFVA 1LK7A 4ZA1A 2C2MB 2MZSA 1XR7A 3FBEA 1EKSA 2CNOB 4QR1A 1UVLA 1DARA 4OX9J 3QGPA 2B8PA 3UD3P 2LQJA 5KT3A 4F02A 2Y3YA 5IM0A 1TL4A 2LU1A 4MJKA 2JVRA 3N5BA 3FGVA 5LOQA 5J2QA 3TJAA 2AF6A 3MMBA 4ECQA 1X5SA 1TK0A 1F5AA 4O3OA 3TAQA 4JV2A 2ZDOA 2QYCA 4IOAQ 1RABB 2OSQA 4MMOA 1VHFA 2HQIA 5K8MA 4IH6A 3DGPB 5IM0B 1BC6A 4ZVFA 2BVZA 2BYCA 4BC9A 3SSSA 1RT1A 3L7UA 3LUYA 4EMDA 2H4WB 1TV6B 3VCDA 2XEXA 1NSKL 1NUEA 4DSIA 3QSYB 4NASA 1Q16B 3V4IA 2DXDA 2HAFA 5JVHQ 2AU0A 2HFSA 2K8GA 3L95X 1RWNB 1VQYA 3IM9A 3T1HF 3H4BA 1VBYA 2YWWA 3TUZC 1RAEB 2HKEA 3GV7B 1S77D 5B0BA 5J1EA 3IBWA 1IUJA 4XK8C 3SCJE 3L3CA 2B4VA 1TAQA 3NWGA 3IMQJ 2V9KA 3V4IB 1S7HA 2ADCA 1GT8A 3FZBA 3FMWA 1Q53A 2EFGA 2R7OA 3HFVA 3BZQA 3VHQA 3DI6A 1QE1A 3H2LA 2CPJA 3U1NA 3HVRA 5IC6B 5LM7E 4Z37A 4ZVTB 4H4MB 2ZJRQ 4LFCF 1ZTTA 2FVRA 1JLQB 4ZLPA 4JBCA 3RAXA 3BQ0A 3ZNUA 2RNEA 5J1EB 3CCMS 4L76A 4NEYA 2E1PA 4JV0A 2GCFA 3MEEA 4DR2J 2CQBA 5FJ4A 2HNZB 3EWGA 5CABA 2OUGA 1VK8A 4M5DA 5DQIA 4DR7J 3C66A 3KHHA 4PWUA 3KDOA 1UCNA 2DPIA 1S1TB 1HBOA 2MGZA 5D6GA 5D15A 1LFWA 2HFNA 4OHZA 3UDVA 4L73A 2F5GA 1YLXA 3HHEA 2HHSA 1DQ9A 4DSEA 3Q2SC 4C48A 2RF2B 1E6VB 4GO7X 2YNHB 3Q8RB 3AAWB 1LNQA 2UVVA 3TP2A 3WC0A 3I55S 2QEXS 1HBOB 4NXNF 3QZ7A 3LGMA 2X1BA 3GIIA 3PYDA 2JEJA 1WHXA 4F4WA 2KFNA 3MEGB 1SJ3P 2YKQA 4I56A 5E3PA 5ITHA 3PVXA 4C97A 5A2QU 3DU6A 4OZ1A 3EVOA 1RP5A 2VBXA 1AXQA 1HWLA 4USWA 3JXOA 4M5IA 3QMQA 1QM9A 1HI8A 2UUCJ 1NK9A 4MK7A 2N4DA 4CO3A 2X3DA 1U0HB 3K59A 3GJRB 3Q83A 5HQ8A 4OZ5A 1S1UA 1S6UA 2CAJA 1JWWA 2IRYA 2FPHX 3KLEA 1RT3A 4ZVEA 3A8KA 1IJEB 1CS4B 3HDSA 2GFFA 4P72A 2DR7A 2VD3A 3IXQA 3GV5B 2XZTB 4EBCA 4O4GA 4U7UD 1PG5B 4CLLA 1N36J 1F2HA 1HR0F 5F0WA 4ZVPB 4DS5A 2YX7A 2I5JB 5KFJA 1R8HA 1VBXA 4JOUA 2QJ3A 3NWRA 3EXYA 1TVRA 2BM0A 3KLEB 4ZLLA 4I2PA 4DOZA 5F9NA 5AXMA 4USVA 1YJTA 3MD3A 3PEHA 1U02A 3HHLD 5GAEU 2ZH9A 2LVWA 2MJUA 3NL0A 1PO6A 1OSCA 1YZ7A 4LF2A 3DLKA 1QD1A 4OIXA 1ZPWX 2MY8A 4N56A 1PC4A 3DDKA 4LRCA 1GNKA 1CJTA 4G3IA 4Q7AA 3MR2A 1MWYA 3KJVA 3UR0A 4HEA9 2I6WA 3RG6A 4PRFA 5HSPA 1V3RA 3E2EA 2OPSA 4O23A 2B6AA 1FRXA 3T9NA 5D4OA 1IKYB 1U4BA 2D69A 4QYZJ 2XC9A 3W64A 3QPIA 1CJVA 2XMMA 2RRNA 1VQLS 4C8MA 3CJ8A 4WIIA 4ILRA 4C3LA 2G2ZA 1HNXF 4CLPA 3IWNC 2UUTA 2R7TA 3TANA 1I5OB 4TY8B 2IVMA 1Y3KA 1F60B 3R7BB 1B7YB 2Z4PA 2DNNA 5J1NA 2M2BA 3B4DA 2A2CA 2N82B 1CULA 2DGOA 4P73A 4RBUA 5KFRA 2X51A 1TK8A 3A3NB 2DNPA 3BBFA 3G82A 3CUNA 3H2UB 1YBAA 2B4OA 4JI0F 2QG9B 3LP0B 2B5JB 1MWZA 2VOPA 1JLBA 5DLGA 2KTQA 1CULB 4F50A 5HVFA 3PJWA 2M8HA 1XTZA 2Q6CA 1REGX 3IFEA 2HQGA 4LF1A 4GKKF 1IR1A 3W2WB 3EPIA 1M1GA 3DCAA 4A8OA 2D3UA 4RUAA 3RR7A 1NJYA 1FEHA 3NRBA 1FRHA 1RA6A 3EGWB 1M1HA 4WTYA 1BQXA 3QBCA 2ZOMA 4QR0A 5IT9Y 4LRBA 5J2NA 5G0RB 2XNRA 4A8FA 4LSLA 2FJWA 2VDIA 2QTWA 2ZH5A 5HLFB 4CTAB 5A6PA 4ZHRB 2O5DA 4DX5A 1LW0A 2EWHA 2LU2A 1RHMB 1RLCL 2VBYA 1UVKA 4ZK7M 2SXLA 2VQEJ 4YOEA 1BD6A 2IC3B 1D3WA 1Q5VA 2PDAA 2Z30B 5HVGA 1O0PA 1HYSA 1FRKA 5GADI 4Z2XA 3CJ3A 4AUKA 4KTQA 5J2NB 1C0TA 3TYTA 3BH6B 3Q89A 3DLJA 4LSLB 3KG0A 2RKIB 2M88A 1LW0B 3I56S 4DV7F 3PY8A 3W66A 4PG5A 1T05B 1Q79A 2BBEA 1NK6A 4WYWA 2AYBA 1I94J 4E98A 3TX8A 4DQQA 1HI1A 4CLTA 5KFOA 1P1TA 2EK6A 3DOMB 2EG1A 3TVZA 4KRWA 1QAIA 4ECTA 4P75A 4ELVA 3CGIA 5K14A 1HNZJ 2D9PA 3OL7A 3CF5Q 2FJDB 3PW7A 4M5LA 1H73A 1CBKA 2R42A 4FF1A 3DM2A 4R8UB 2R8GA 1NBEB 1FEEA 1LXNA 2KT3A 1MU2A 5HO4A 4ELTA 4DEZA 3CJRA 1U2FA 3LAMA 2F4VF 1YQHA 1RTDA 3FCHA 3RBDA 1NDKA 4ID5A 5K14B 2KXFA 2UXCJ 4YB1P 3PR5B 3QJPA 1VBKA 2D3O1 1SV5A 3UO0A 4GRSA 2G1DA 2JFDA 5AJ3F 5D3GB 2VG6A 5GAGU 4ED0A 1S1VB 4Z7CA 1ZTWA 4CQ1A 4EEYA 3EGZA 1BHNA 1VC5A 4P7TA 4QZVB 2D9OA 4LR7A 2OPQA 4YHHF 2NYIA 2CKWA 2I38A 4DR6J 4DV3F 2GVDA 4RWWA 2LKZA 2YWHA 2OSRA 2NYHA 1G1XA 3VF0B 1RT4A 3BO2A 3UN3A 1EHWA 3DDNA 2WK4A 4JV5J 4DPTA 3OLAA 4FYWB 4RNHA 1RYSA 1N6QA 4ZOSA 5B0GA 3FSIA 2OPQB 5KFUA 1VI7A 2CVEA 2UU9F 3MR7A 5KOWA 3O5TB 4DQSA 4LF4F 3M30A 3CTRA 2Z0GA 3MCOA 3C6UA 4OV1A 4RW9B 3R3TA 4K4YA 1RTIA 5CD4A 2V4QA 3CCSS 3MR3A 3H2VE 4I6WA 8RUCA 3HCXA 4JI6F 1R89A 2XMUA 3R8YA 2RIJA 3G86A 3FSYA 3BO3A 4K4VA 1HWIA 2XGPA 1VCTA 2DR6A 3RBZA 3MM5A 3N28A 4N5SA 3JQKA 4DSLA 4DV6J 5H9FJ 3BSOA 3JSBA 3W2VA 1FXLA 3FKBA 1Y5LB 2MZJA 2N7YA 4PG6A 4ZP7A 4ZVSB 4TNOA 5HMWA 2AX0A 1V9OA 1E6YB 1KTQA 3UN2A 1KP6A 4IH5A 3BO4A 5DG7A 3OT9A 4DJBA 4X4TA 1X4BA 1YRUA 3C16A 2RT3A 4UOGA 1SKRA 3K8WA 1N5TA 2B51A 2A2DA 2OFHX 5CCLA 3VGTA 4HKQA 1Q82T 4J7CA 3W63A 1OPZA 3PW2A 2H54B 3QYYA 2HHUA 4KGKA 2OJ3A 4ECZA 3MR6A 5B0EA 4Q2LA 3AD7C 3IG1A 1VRTB 3ZZYA 3PRVA 5HMYA 4CLWA 1UKUA 4AD6A 1PBUA 2FGCA 1S76D 2WBRA 3PJ9A 3QIPB 1PYTA 4TQRA 4ED6A 2X7IA 2KHDA 2GO8A 4UQTA 1JJ4A 3N6MA 2CPDA 4ZIVA 3NGDA 4OI4A 4FPRA 5KOXA 3X1LB 2H5IB 1JJ2R 3PRDA 4JI7F 3O44A 2XBPA 3QIDA 4O3RA 2J7KA 3POTA 1YDLA 3ENAA 2HLUA 2YVSA 1NB7A 2CQHA 4RPFA 3Q8VA 1YTYA 3ET6B 5DETA 1Q8IA 1JIHA 3MM8B 2VJUA 2GMJA 4LF6F 3AQOA 3EVMA 3PW0A 1WC1A 2ZZNA 2HBQB 3PCOB 3CJ2A 5CZVA 5EUHA 4ZPVR 2XYGB 1N5YB 2MZRA 8AT1B 2B7CB 2FLOA 4RO0A 1R8BA 1S1XA 2M0GB 1A7GE 4DBQA 3DXSX 3IN5A 4NZ0A 1PYSB 2AYMA 2LXUA 3NBPB 5KT5A 1X0FA 1KLMB 3PFOA 3IGVA 2RJZA 2EKNA 5H9FK 3BDEA 4LFCJ 1SIZA 4G1QB 3Q8SB 3FSXA 3W62A 2AMCB 5FLXU 4OYWA 2HS3A 2AP6A 1X5TA 2OIHA 3CC7S 4Q44A 1KWMA 1HNIA 2MZ1A 3K5MA 3CULA 2CPXA 2P8IA 1T03A 5IZHA 5C42A 3B8HA 2NR0A 3MM7A 2C3PA 1NKEA 5JUMA 2WBMA 3RRHA 3IS9B 5KG3A 3CWJA 2NXEA 1JB0C 4K4TA 1X4CA 5AXKA 3TAPA 4RL1A 1IQTA 5M2RA 4DCOB 4FP9A 3W7BA 3CJ4A 1NDPA 1SC6A 1T03B 4RU2A 2PI4A 5C42B 3R27A 3T41A 4NXNJ 4O3QA 4ED1A 1NK5A 4KH1B 4ZCKA 4OX8A 3HHKA 2DRAA 1RHUB 2DXFA 3CJKA 1NZAA 4UQGA 1SIWB 3MMCA 4N47A 4YN3B 5E3AA 1IWAA 1X4DA 2DR5A 2CQPA 2DVIA 4LF9F 3VGUA 4GKJJ 4X65F 2W1BA 1S4FA 2X3GA 3K5NA 5DGBA 4U7CA 5KFPA 1HQEA 3FCVA 1JLCA 4K5SA 2W01A 1TKXB 2JNJA 3MMCB 2NSCA 3G6XA 1VQMS 3LO3A 3D5MA 3DRPA 2K1RA 3FRYA 3MWBA 1B64A 3RZAA 2PFFB 2MSTA 3TNVA 1Y4ZB 5E41A 3EGVA 3DRYA 4H4KA 1UA1A 2ZH7A 3T3FA 1TTHB 1JLCB 3M2RA 2RB7A 3TA2A 3QFHA 1PJ7A 4UY8T 3RW6A 2IBKA 2R8IA 2MJNA 5LXYA 2W9AA 3FJ2A 1VJWA 4ECYA 2YH0A 1MN9A 1B0PA 4PQAA 4X2BA 4M5GA 3THTA 3CDWA 2MKCA 3HX9A 3MPYA 2NZCA 4O44A 4V19J 2MQPA 1FX4A 1NAQA 2L9WA 4CLKA 4FXWA 1SH2A 2BW2A 2JEFA 5D0GA 1H2VZ 3QZ8A 1JLFA 2DEJA 2BACA 3M4XA 1R7IA 4ES2A 2Q6BA 1BQMA 4NLRA 3FFIA 4USKA 3PR4A 3CXCR 4MFBB 3PYEA 1N33F 2A18A 1SI9A 2HW3A 1WWHA 3M1VA 3G6VA 5DDRC 3M8PA 1Z2ZA 4QW8A 3TZXA 5IFMA 3NP5A 1J5EF 2IDEA 1FJCA 2WOMA 3QWUA 2R2RA 2F8EX 3TX0A 4ED3A 2C28A 1K1QA 4DR1F 2JC1A 3MMAB 2VFRA 3TJ9A 2VQFF 1RACB 1VBZA 1VLYA 3QT7A 3RGIA 5ADZA 5KFDA 3KG4A 3OUYA 3M1VB 4MKYA 2DY9A 1RWKB 5I42A 2DNGA 3F73A 5G4DA 2HHWA 3NGUA 3OFGA 4KGXB 5F41A 3PM9A 4FN5A 4F3MA 2ILZA 1ZPVA 4KFBB 2KVIA 2RQ4A 1S49A 1AZSB 5HBMB 3OJUA 4RNOA 2HVZA 2XHCA 4DV0F 5GADU 3SCKE 4ZN1A 3SDEA 2IAJB 3MAAB 3J81U 4NA2A 3JSMB 1LWEB 5F9LA 1GXTA 1UVMA 2QV6A 3TUJC 4I0WA 2RS8A 4GKKJ 1WORA 3BGFA 2C2EA 1U1OA 3RAMA 4Q45A 4DL7A 1KTVA 5LSLA 2KZZA 4CWBA 1V5IB 1KSPA 2AYGA 2J8AA 2AJ1A 3SDEB 2VUGA 2JOQA 4ZKAA 3KLFB 4F4XA 3GMGA 5THWA 3DFEA 3C6TA 1S57A 2IJNA 2E7XA 1U09A 1S6OA 3M8WA 3IM8A 4Y2CA 2ATLA 3SZ2A 1OS5A 3J7A1 2EVZA 2J9EA 3GG1A 4ECVA 1QJHA 2DTJA 1JLGA 3M05A 5F8LA 1T8EA 4R5PB 3NCRA 2PMWA 1JJHA 2BUNA 2FVCA 1NK7A 3KK1A 4DR4J 2XTJP 3L4BC 4CLFA 3BGRB 4J9OA 4LSNB 4B9LA 4ES3A 3E01B 4J9RA 1MSWD 1ICEB 2RDIA 3C14B 2OHDA 3PG9A 3QAUA 2GAHC 1Q4RA 1OYEA 1OY8A 1DTTB 9RUBA 2ZC3A 1XIQA 4DSKA 1RGVA 4IG0B 5KFYA 5C2GA 1N88A 3EYZA 3V81A 2RHQB 2QA2A 2F40A 5FDLA 4Q5VA 1Q86T 3OR1B 4L72B 2KG1A 2FUG9 3VGVA 1FE0A 3IRXA 3S1TA 2F4VJ 3OXFA 2KRRA 4B3RJ 1HHTP 1VOMA 3IAS9 3B6BA 4JI3F 4DS4A 2DGVA 1EAYC 5BR8F 2JFKA 1NCLA 4IOBA 1FI4A 3LWMA 2DKOB 3HXMA 3FZ2A 1R0BG 2VZ9A 3NNCA 2KM8B 3X3UA 2J7WA 5EN1A 2HZVA 1U1KA 1F2GA 1LW2A 4O3SA 2B4UA 1GMUA 1LOUA 2V4RA 4ITSA 1Y10A 2DNYA 5D77A 4O4RA 3ENQA 2HEKA 1NDLA 3KLIA 1K73T 5EX3A 4USIA 4XAKA 4KHMA 5ETNA 4EBEA 3HT0A 2XWYA 5KG4A 1SQEA 1F9FA 1T9WA 4WWSA 4ES1A 1KQFB 2POKA 3CIZA 1J2VA 1KOHA 3MAHA 3TA1A 3IC1A 4KGMA 1C0UA 3KLIB 4FYYB 4NZ7A 3K5LA 4JI2F 2V34A 2BZ2A 1VQ6S 1FKAF 2AT1B 1JLEB 4BS2A 1TMJA 2CQ3A 1XN9A 1DY3A 3CDBA 3O6QA 1HBUB 4NLQA 2CIMA 1G3OA 1Q8KA 2AD9A 5D8HB 1X0PA 4PUOA 4OYOA 2MLXA 4AE5A 2OMOA 1S9GB 4P6QA 1S99A 5ETSA 5IWAF 1R31A 1FD8A 1BWEA 3IBCB 4A47A 3CEDA 2IFXA 3MD1A 4TU9A 4HTJA 1S9EA 2ZD1B 3LQVA 2GMHA 1B70B 1RT2A 2QL9B 2FTRA 2YX1A 1QVGR 5BYSA 3V2UC 3VR1A 2BANB 2DB1A 1KVKA 1Q1KA 2MKHA 4DSJA 2QLWA 2HHTA 2HS4A 4DU8A 3KLGB 2A1BA 4WZQA 2H9ZA 3DLEA 3G4SS 4LF5J 1RT2B 4LF7F 5EDWA 4RNMA 4WBFA 5KFQA 1RQ0A 3UD5A 1H7WA 5A8RB 4UOHA 3GIJA 3CNQP 4PZVA 5IV3A 4HHHA 4DN0A 1FRLA 5M2PA 3K5PA 2V8GA 5EX0A 2IA6A 2GW8A 1QTMA 4IG3B 4ZVRB 1NH7A 4HVZA 1EKRA 4RNFA 2AJ2A 1CLFA 4F04B 2R7VA 5C24A 1RI7A 1MMLA 1L5UA 2NREA 4OI0A 2ZC4A 2G13A 2CPZA 4FBTA 4JI8F 3V6DB 2R2UA 3PJXA 4F0MA 4QW9A 2KDOA 2COLA 5CA5A 4DUYF 1NK0A 3MECB 1PSDA 1T3NA 4LREA 2V0NA 2E5LF 3DHWC 3GE9A 1EETA 4H54A 4IQMA 5E3RA 2ZNZA 2Q3PA 4P2SA 2JEIA 3GCXP 5A76A 2CQGA 2HHHJ 2YY3A 2RU3A 2ZBQA 3I0RB 2ABYA 3SQGB 5LJ5Y 1ELOA 4EBDA 1S6QB 2BV3A 1HNWF 1LEOA 2AW0A 2XYPB 2AIRB 1FDNA 3QRQA 4KE5A 2CJ9A 1GTHA 4WYLA 1F6TA 1OIAA 1RT5B 1UVIA 4YR3A 3ZNJ1 4X4UA 2LMIA 2YPYA 3ITHA 4DWIA 3SV4A 1EB0A 1WELA 2VASA 2YQ1A 2J6SA 2OPRA 1B0TA 3DLGB 2WVFA 2QFJA 1WC4A 1QAXA 1WOOA 1IBLF 3VVUA 1RT7A 4PG4A 1IBKJ 2ACYA 1U1PA 1IQZA 3DOKA 3JTOA 1XMBA 4F3OA 1WC5A 3CD5A 1F3VA 1YWXA 2DITA 1KNZA 3GR0A 3UI3A 3TVKA 3WC2A 2JDJA 2OPRB 3G8TA 1H0HB 4KKOA 2CPEA 4PAAA 1Q95G 3ZTPA 2O1PA 1BY9A 1GEHA 2B9WA 4KC5A 7FDRA 1UJ4A 1BQNA 4UTGA 3MPVA 2HRUA 3NGTA 4DV5F 3ULHA 1WC0A 5L1LA 5LXRA 1NHKL 2XLKA 1EQ0A 3UQSA 5KG0A 1H38A 3IWLA 4X65J 4U8VA 2HRYA 3MM6B 3BREA 2L9DA 4P2MA 2J5AA 2N3OA 1S1WB 4ZDNA 3CCQS 2FY8A 2W7AA 3KK3A 2L08A 3TEHB 2M4MA 2HZCA 5E3CA 2DCUB 4CI0B 4OJ3A 2XB2D 4EUVA 3NMRA 3BJYA 3Q0AA 2C2RA 5J2PA 4ERDA 4DR5F 2AKWB 4RU9A 4B3OA 4DPXA 3Q8UA 2W8LA 3BN7A 3KK3B 2DNRA 2KKHA 1A9NB 3CCVS 3OQ2A 3ZXWA 1TELA 2PA8D 4HDGA 4OYXA 5K5MA 3DHXA 4WFYA 3OTOF 1I51B 2DGSA 1WG4A 2HVHA 2ZH8A 1S0NA 5BYQA 2UVRA 3MEKA 2YNFA 2Z2YB 5KAKA 2N3LA 1F1BB 3D1HA 1IKVB 3GLJA 2UV8G 3OTEA 4IO9Q 4A46A 3DRRB 1BWVA 4KIAA 2QO3A 2QT7A 3CE8A 1P6TA 5A8WB 2PC6A 4A8QA 1RCOB 2XY7A 2OD4A 4RW8A 4FF2A 4K4WA 4OZNA 2W4PA 5KTQA 3MUVP 3VAJA 1CJUB 2RAQA 2AQ4A 2HQFA 1NU4A 4TY9A 2HNYB 3N01A 4M94A 2DJWA 1FHTA 1D9FA 1M0SA 4AQYJ 1LWXA 2VQFJ 4CYUA 1HPZB 2CPYA 4PABA 3MAQA 4USJC 2YKPA 2E1AA 4RKUC 3IAM9 1VQ4S 4AFFA 3DLLQ 2HURA 4YY3J 2LLZA 2ZITA 4Y3CA 1EARA 1YBTA 3KNGA 2YWFA 4NXMJ 1Y5NB 2W4CA 5SUHA 3LPEA 1RTJB 4A8MP 2YNIB 2VPWB 3LWLA 4TQSA 3HFKA 4J9UE 1H3DA 2OEJA 5ETTA 4I64A 4WP3A 3WIUA 1EP4A 2VU5A 1WI8A 3SCIE 4C0BA 3QT8A 4DL6A 3HT3A 4Q0BA 4JYAF 5KG1A 5E2QA 3VAGA 2FHMA 1W25A 2LQ5A 2FHJD 1S4EA 3CCJS 2M5YA 4EWTA 3D1OA 4JI4F 4LIRA 3T5KA 2HVIA 2ZH4A 1T02A 3OR2A 4RJVA 4WCEQ 3GV8B 1XNRJ 4KGZB 1VQNS 1NKCA 1TUWA 4XTTA 4DF8A 2UUBF 2ASLA 5AE3A 2BM1A 1J27A 2P9CA 1U8WA 3M32B 3OTCA 2GMLA 3OL9A 4HACB 1TQLA 1GX6A 4NYPA 3LP2A 2ALYB 1SC4B 5CQGA 1U25A 3PKYA 4ANCA 1IBMF 4OLPA 2UVUA 3C15B 2HBYB 4QWAA 3H5XA 3NNAA 2NZ4A 3QAEA 1IR0A 3PFEA 1Y5IB 2PFDA 1XNQJ 3P8BB 4Y34A 1HFEL 2V4JB 3LP2B 5GAEI 4NL5A 1WSVA 5F8MA 4DUZF 4PKDB 5KFBA 3Q8QB 1YRTA 1T9UA 4BDPA 4P9SA 4N8OA 3VAKA 2WRMA 4NRTA 4IDKB 3WQPA 5CYQB 5H1SV 4ANEA 2AGOA 4I68A 3PZPA 1TL7A 1MWQA 4X66F 1FVSA 2KRBA 3CMAS 4ZVQB 1EX8A 1NJZA 2ZH6A 4C8YA 4ED5A 4A4JA 2UUAJ 1YITS 2AEFA 1SKWA 2BKNA 3GIKA 1CG2A 2BJ8A 2V8DA 3MM9A 3JAMU 1GXUA 4ILMA 3DYAB 4F36A 4NLUA 2O01C 2K2PA 3BH7B 4KHRA 4CH7A 2OP5A 1V3SA 4JI5F 3HZGA 1NJWA 1M5VC 1RAHB 4X4VA 3D7SB 1YJWS 2KYXA 4NLVA 1FJGF 1TL5A 2AJQA 4JI3J 2RILA 2WB4A 3U7JA 3EX7B 3C3LA 4ZCMA 5BR8J 3LH2S 3H20A 3U1LA 4JP8A 4W92B 2HVDA 6FD1A 4PXDA 4WF9Q 2L41A 2BJ9A 2MKYA 5DJBA 4F67A 2DH8A 3J80Y 2FC8A 3CCTA 1FE4A 1F5CA 4ELUA 1CC8A 2MSSA 1K44A 2QZ8A 2VH7A 1NK8A 4LT6A 3GU0A 2OLWA 2XS5A 4J9QA 5FIIA 4DL3A 3HHLA 4Q8EA 1JJCB 2H4YB 3PTWA 3UCZP 3PYFA 4QIFA 2OEMA 1UPPA 3HHDA 3UDLA 1VMBA 1KKHA 3SSRA 2NCKL 3LP1B 2YXLA 1HQ2A 3M2UB 2XS7A 5A0YA 2CXEA 3BBBA 3I6PA 3ISNC 3NOCA 1ZAWA 2RHSB 3BF4A 2Y8WA 2HMIB 3MHYA 2YKMA 1OWXA 1LWCA 2IIHA 1FF2A 5L1JA 2F9DA 4JV1A 3FCWA 1N54B 4MYUA 1NJIT 3RB3A 4QWCA 3MEDB 2J8SA 3KKFA 5BXIA 2CDQA 2WSCC 2E5IA 2XG8A 5A0YB 2LP4A 2UZAA 4ZLJA 2KXHA 1QAJA 1QSYA 4IQXA 5F0UA 2BQRA 1GH8A 5ETQA 2NS1B 2NXCA 1S12A 4WFNQ 1HKAA 2WAQD 5KT6A 3OV7A 3BS9A 1FTCA 4LF8F 2ZM6F 2XMKA 1SVDA 3KMQA 2GGPB 4PXCA 4LFAF 3P6YC 2W9BA 4LMZA 2CFXA 3ZFVA 3TAMB 1DRZA
chains in the Genus database with same CATH topology
2YVSA 1JX4A 3FQLA 1NB7A 3DLKB 2CPFA 2BRLA 2CQHA 2RQMA 1R0AA 3OR1A 3HZEA 2VC1A 1KQGB 1REVB 2CYYA 2A3JA 4X62F 5KT4A 5EWFA 3D2WA 1YTYA 5DETA 2FJBB 2IMOA 5IT0A 4RW6B 2ZJQQ 2GA7A 1CVJA 1Q8IA 1FK9A 4I2QA 3CCLS 1JIHA 1VGYA 4BHQA 3CPWR 3MM8B 5DDPC 2GMJA 4LF6F 4CH0S 2GO9A 3F41A 1RKIA 5DDQC 4DR2F 4ZPCA 1RYRA 3KJVB 1UW4A 3TI0A 3RYLA 3N9UC 3CCWA 3CDUA 3AQOA 2OPSB 3GFYA 2NSBA 3PW0A 2B6AB 2DHXA 2EFOA 5CYMA 2ZZNA 4KJIA 2ZUGA 3CJ2A 3UCGA 5CZVA 2W9BB 1N8RT 1R8CA 2DR9A 1ULRA 5EUHA 2ZVSA 3K7RA 4ZPVR 4KSEB 2W7PA 3O8WA 4HI1A 1N5YB 2AV5A 2MZRA 2OKQA 2PI5A 2B7BB 5A8KA 5J2PB 4QIEA 2B7CB 3HMJG 3C46A 2FLOA 3N6LA 5LMUF 3G9CA 1R8BA 1S1XA 2M0GB 1A7GE 1FK9B 3DXSX 4DBQA 3IN5A 4NZ0A 1WHVA 2RRAA 4YUDA 2AYMA 5DG9A 4B3OB 2FLNA 2LXUA 2JC0A 3NBPB 5KT5A 2X1FA 3I4HX 3FEZA 1CQMA 1S6PA 1X0FA 1KLMB 3TOQA 3OTBA 1OQ6A 4DV1F 1UVNA 3PFOA 2E7WA 3IGVA 5DQHA 2F7VA 3RTVA 3G6ES 4OL8A 1VQ8S 1B7FA 3SXLA 4J9NA 2RJZA 3SYZA 2K7JA 3BDEA 1R8PA 2GC8A 4C4WA 3KTQA 4MK9A 1CPZA 4RZRA 4ZCLA 1SIZA 3LAKA 2Y1JA 3PX0A 4NCGA 4G1QB 3VAIA 1FA0A 2IYIA 3Q8SB 1U8SA 1LXJA 4IUFA 3BGUA 3FSXA 5LMNF 2ZDPA 1I1GA 3G71S 2R7WA 2EI5A 2YNFB 4MIBA 2HS3A 2WCXA 2AP6A 1X5TA 2OIHA 3CC7S 1C2PA 4Q44A 3J7YI 1S72S 3EZUA 3FEYB 2MZ1A 1HNIA 2VBZA 2NUUG 3M2VA 5KFTA 2BABA 4GO5X 3K5MA 2YKOA 2WSFC 3QGHA 4TU8A 3CULA 3K57A 1LKZA 3BB5A 2MY7A 2MZQA 1W2IA 2CPXA 4B3TF 1T03A 3AA9A 2MQNA 2CQ0A 2OTJS 5IZHA 4IYQA 5C42A 3B8HA 2NR0A 2BXJA 3MM7A 5CHCB 4ZPAA 2JLEA 2R9LA 4EGLA 2C3PA 4ED8A 3JAMY 1NKEA 1UWBB 3GILA 4I69A 5JUMA 2OFGX 3R5DA 2WBMA 2FIUA 3RRHA 4C3MA 2UUCF 2E9RX 4RW8B 3IS9B 3MOZA 2FHJA 3UWTA 2MHEA 5KG3A 3CWJA 1O51A 3OPKA 4WKYA 2L9NA 1JB0C 1H2UX 5F8GA 2J6UA 4K4TA 1X4CA 5AXKA 1YJUA 3M2VB 3VZHA 3TAPA 5DG8A 3HO1A 3Q8PB 3DNCA 1JLBB 4I4BA 1IQTA 3LOUA 2DNMA 2HWHA 5M2RA 4FP9A 3W7BA 1JLEA 1R6YA 2J0SD 3LW5C 3CJ4A 4AL6A 3SFGA 3TW0A 1SC6A 2Z2MA 3J7ZT 1T03B 3I9ZA 2C3UA 2J0QD 4RU2A 1QAYA 1WG1A 4O3NA 3SEOA 1D1UA 2PI4A 5C42B 3HF5A 4U6PA 2ROPA 5D4LA 1FRJA 4XPEA 1HBUA 3R27A 3GIMA 4O3QA 2QSWA 1ZBTA 3U1MA 3IA0A 1H6KX 3V5RA 1HQUA 4ED1A 5L9NA 3RB4A 4FVCA 1P1LA 3M6VA 1M5SA 4A8KA 4TYBA 1N36F 3H59A 3A1YG 6FDRA 1NK5A 2EFNA 3OFHA 4ZCKA 2MB0B 4CCHA 3GFHA 3KHRA 3V6KA 2MKSA 1ZZFA 4PPDA 4OX8A 1FXDA 3D1QA 3HHKA 2DRAA 3L7OA 1S9GA 4LVNP 1YI2S 1GQEA 3CJKA 4C9DA 4EO6A 1NZAA 4UQGA 1N4LA 1X4EA 2IRXA 3CJ5A 2D3OR 2BQ3A 1SIWB 3MMCA 2R8JA 3AY0A 4N47A 3U27A 3WBZA 2ERRA 4RW7B 2OH2A 2CQ1A 1FJ7A 1RWUA 3H4DA 1HL6A 3MI7X 5E3AA 1X4DA 2HWTA 2PEHA 3D0GE 3DGPA 2DR5A 2XO7A 2CQPA 2ZH3A 2OD6A 2K3IA 3IWXA 2ZD1A 4M1KA 1JKHB 2QA4S 5B0CA 2DVIA 3GSDA 4XPCA 5DRKA 2JH3A 5KFWA 5LT5A 4LF9F 1QSSA 4X64F 1KRPA 3ISND 2ADBA 4C0HA 3GFXA 4X65F 1S4FA 4U7UK 2X3GA 3K5NA 2IA0A 2M7SA 5DGBA 2CJBA 4U7CA 1TV6A 1UMJA 3IGNA 5KFKA 2V9WA 2BANA 2R4FA 3NGKA 5KFPA 3AA8A 2WTFA 3LF0A 1EP4B 1HQEA 2VBWA 3OFFA 2D7SA 2RVJA 1JLCA 2VKZG 4K5SA 4CO0A 1TKXB 4WU2A 4YB6A 2RQCA 3MMCB 3RU0A 2NSCA 3G6XA 1VQMS 3PDNA 3LO3A 1Y3JA 2EBGA 2KJWA 3D5MA 3I0SB 4Q0BB 3ENVA 4DR4F 4XIUA 3KLGA 1HYSB 3DRPA 1FRIA 2K1RA 4UOCA 1Q8LA 2E1CA 3JYTA 1PC5A 1C0TB 1FNOA 3CCES 1R43A 3B4MA 1ZM4A 2KJVA 3AJ1A 1N0VC 1A6LA 4UW2A 3FRYA 3MWBA 5KFXA 1ZM3A 1LV5A 2FVSA 5A6WA 1B64A 2NPFA 4XDCA 4NRUA 4MIAA 3RZAA 1CSJA 2PT0A 5SZTA 3VAHA 3S7RA 1HWJA 4CIOA 5DM7Q 5A8RA 2MSTA 2PFFB 3I5AA 3TNVA 1Y4ZB 3OR2B 4K5RA 2NXUA 5E41A 5EWGA 3CJ0A 3DRYA 2DGUA 4KBIA 5K8PA 5MLCV 4H4KA 1UA1A 3OVSA 2RRBA 3MFIA 2ZH7A 5L1KA 1X4AA 3T3FA 2ZE2A 1JLCB 1RT6B 3CDEA 3D0HE 3JTPA 2XSJA 4YB7A 2ILYA 1TUVA 4ZS6A 1APSA 3M2RA 2B3TB 2RB7A 3I96A 5EHHA 3TA2A 1AFJA 1YSJA 4IR1A 1MW7A 1SL1A 3UR3C 4ZPBA 5CZXA 1K0VA 4YR0A 4UY8T 1UP1A 3DOLA 1MMDA 2IBOA 2V8HA 3RW6A 2BE2B 4IG3A 2DGTA 5HP1A 2IBKA 2R8IA 2KI2A 3QGIA 5KG6A 2LEAA 2MJNA 2UXBF 4B3RF 5HI7A 1VC6A 4LFBF 2XS2A 5LXYA 4PPZA 3UCUP 4H4MA 2W9AA 3FJ2A 5E7OB 2DCLA 1VJWA 4ECYA 2YH0A 4DQIA 4K4UA 1XR5A 2PO4A 3P3DA 3SCLE 3R5CA 1JLQA 2IM1A 3T5LA 1BGXT 3H5YA 4I7FB 1B0PA 4PR6A 4PQAA 1U1QA 4R0EA 4WFXA 5KG2A 4X2BA 2ZE2B 2ZZMA 3THTA 3CDWA 2MKCA 3DM2B 4KAIA 1VQKS 1X4GA 1N5SA 1WF1A 2P9EA 3HX9A 3MPYA 4D3GA 4O44A 4QPTA 3V6DA 4V19J 2MQPA 4WFZA 1D9DA 2HYIB 3HPOA 1MU2B 2HNZA 3CDAA 1NAQA 1OQ3A 2L9WA 2DT9A 4LJMA 5HN0A 4FXWA 1SH2A 2B9XA 1ZAXA 2BW2A 3DOLB 2JEFA 1U45A 1H2VZ 3BR8A 3QZ8A 5HP1B 2N7CA 1RTDB 2AYEA 1JLFA 2ZBCA 2ZKTA 3G8SA 2ASJA 2QA4G 2BACA 3HVWA 1DZ5A 3AB4B 3PXGa 1R8AA 4ID5B 2V8VA 3MECA 1FXRA 2RD5C 2VG5A 3M4XA 5E33A 1R7IA 4ES2A 2Q6BA 4PXEA 1KD1T 1S1TA 3DMJA 1TAUA 4DL2A 3PKMA 1SV5B 1BQMA 1D8ZA 4NLRA 3ZZPA 3UPFA 2ZHAA 4DV4F 4OZLA 2JWNA 1UETA 2RUGA 3FFIA 1GAOA 5DM6Q 2YNGA 3PR4A 3CXCR 2VG6B 5J2MA 4A8WA 4MKBA 1HARA 4MFBB 7FD1A 1ZH5A 4OZ0A 1TR0A 1N33F 1MROA 2A18A 1SI9A 2L48A 4QWBA 4BWMA 3RRKA 3Q2TC 3DLHA 2HW3A 1X8DA 3D54A 2RF2A 1E6VA 1WWHA 3M1VA 1R3NA 2F8MA 5DDRC 3G6VA 2VA2A 3M8PA 3CT9A 1OPIA 1Z2ZA 2YNHA 4QW8A 2E5JA 3CB4A 4J9LA 5IFMA 2G9OA 3NP5A 4GMKA 1O5JA 1FESA 1VIOA 1J5EF 1WF2A 3I0RA 2IM3A 3SQGA 4FXDA 1FJCA 3K5OA 2WOMA 1WTFA 2F9JA 2RS2A 2VG5B 2DO0A 1FTRA 1LK5A 2LQ9A 3QWUA 2R2RA 2Q79A 2F8EX 1S6QA 1IM4A 2RU9A 2Y0SD 4YEAA 4J9KA 4ED3A 1N0UA 5LSOA 4YMEA 5J1PA 2C28A 1RT4B 4FNHA 3MM9B 1YG0A 2K3KA 1K1QA 3MEGA 1KR4A 4DR1F 2JC1A 2FGOA 3MMAB 2VFRA 5KT7A 3PIOQ 2VQFF 1SBRA 4WE1A 3M6XA 5GVQA 1IKXA 3GYNA 1VBZA 1N6QB 2H5EA 1RT5A 1VLYA 2KZMA 1U1MA 2C3YA 5ADZA 1HMVB 3KG4A 5KFDA 3OUYA 3M1VB 4ICLA 2CRLA 3GYXB 3T19A 4O0IA 4MKYA 3US5A 2M8DB 1LQ9A 2I2YA 4DF4A 2JVOA 5I42A 2DNGA 3ISZA 3V6HA 2E44A 1WEZA 3S6EA 3F73A 5G4DA 4FYDA 2HHWA 3OFGA 4C8NA 4KPYA 2HWIA 4RW4B 5F41A 3PM9A 4DLEA 2LDYA 4DLGA 1JLAB 2J7UA 4FN5A 4OX9F 1R27B 3DLBA 5F8NA 3OLBA 4I67A 1KC8T 3I31A 4F3MA 1FT8A 1U1RA 2ILZA 3DLGA 1JMTA 1ZPVA 3M30B 4KFBB 2MQQA 2KVIA 5DQGA 2RQ4A 4EO8A 3HVAA 2K7KA 1S49A 3C6UB 3K8VA 3GFZA 5FLXY 5HBMB 5K9FA 4RBTA 2M70A 1RTHA 2QSFA 3OJUA 2VFSA 2R8HA 1SL2A 2J9CA 2VQEF 3PV8A 4RNOA 2HVZA 2J0XA 1FDAA 2BJDA 5KFFA 1TP7A 1L3KA 2KH9A 2MQMA 4DV0F 2LEBA 4ZPDA 1F5BA 5GADU 4C2MA 4BCAA 4B9NA 1RTIB 1DAXA 2LYVA 3SCKE 4FBUA 3HKZD 3SDEA 5HMZA 2W9CA 2OPPA 2IAJB 4NLTA 4ECUA 4ZPTR 4RLEA 2B0GA 3LALA 4NA2A 4B3MF 1KHWA 3PIPQ 4FXVA 2UUWA 3MMJA 3JSMB 1LWEB 5F9LA 1GXTA 3ZC4A 2QV6A 1UVMA 3TUJC 4I0WA 2RS8A 2HHQA 3MDFA 4PQUB 2P5VA 1GX5A 1TKZA 2QE5A 2W7OA 3OHAA 4OQJA 1HBMA 3H25A 1T94A 3MM5B 3BGFA 3J7Z5 4URQU 2C2EA 2FLPA 2DIUA 2M3DA 1U1OA 1S10A 2MKKA 4NA1A 4WXWA 2I5JA 3RAMA 3QO9A 2VC0A 3B82A 1VS3A 3W2VB 1KTVA 2DIVA 4Q45A 4DL7A 3HHLB 5LSLA 3CD6S 3THPA 2KZZA 1WEYA 2WB1D 1DJ0A 3FNNA 1KSPA 1S97A 2PGCA 1VQPS 3HHNB 1KVIA 5E3QA 2AYGA 2VFUA 1FERA 2J8AA 4Y0FA 1X9MA 3M9MB 2AJ1A 2BJEA 3SDEB 4ED2A 2VUGA 2OPPB 4DG1A 5T41A 2A10A 2JOQA 4ZKAA 1N52B 1VRUB 2V2KA 4ZP6A 3KLFB 4C3KA 2KO1A 4F4XA 4OI6A 2PIIA 3GMGA 4HL9A 5HMXA 5THWA 1C1BA 1HBMB 4K2XA 4Y28C 3DFEA 3QLHA 2GIRA 3NCPA 3C6TA 2OAUA 1JNZB 4ZP8A 2IJNA 2HPUA 3QO9B 5L39A 3VQTA 3MM6A 5KFIA 4DHVA 4F25A 4B9MA 4LF5F 3BEGB 4CO4A 1KN6A 1U49A 4DSFA 2CQ2A 2E7XA 1U09A 2LA4A 2YKMB 2C42A 3PHEA 1Q81T 1S6OA 1LWCB 2B43A 2DH7A 2E9ZA 4ID8A 4OFZA 2JZ5A 1QVFR 3DC2A 4G1IA 1WHWA 1S1WA 1X9WA 4K50A 2YKNA 4Y2CA 2ATLA 4CNZA 4DG1B 3F44A 2EFVA 1GXLA 2XHWA 3SZ2A 1U6BA 1OS5A 1VQOS 4G1PA 3J7A1 3A8EA 4K0KF 2EVZA 2J9EA 1FKOA 5T14A 4NCAA 1TL1A 2DGWA 3GG1A 4EU0A 3KMSA 4ECVA 1QJHA 2DTJA 1UFWA 3MPWA 2XGQA 3ZZRA 1JLGA 4OJHA 2WSEC 1IKYA 3M05A 1HBNA 3NAHA 4OX7A 4TN2A 2KG0A 4J9PA 4Y6IA 1UAWA 5F8LA 3RAQA 1SJQA 3QLHB 5KG5A 1T8EA 3IG1B 1VQ5S 2FJAB 4B02A 2UXCF 1XBWA 5KFNA 3PO5A 2G0CA 3C2PA 2U2FA 4R5PB 4FNIA 3NCRA 3KYLA 4Y00A 4OI3A 3FEXB 1ZZNA 1SKSA 1T3OA 5L8RC 1AUDA 1JJHA 2BUNA 2FVCA 3JTNA 4OI2A 2YWGA 2Z2LA 5AXNA 1VIXA 1NK7A 2BOPA 3KK1A 1HHSA 1N34F 5KFSA 1M1KT 3KLHB 2ZKUA 4DDFA 3BGRB 4J9OA 4YDDB 4DX8H 3CCUS 4LSNB 1TL1B 2CJAA 4B9LA 1C4CA 4ES3A 1K8AT 4F4KA 3E01B 4J9RA 2XZWA 1MSWD 3HLUA 2ASYA 2CQCA 2G4BA 2VFTA 4K59A 3OL8A 2P6SA 2RDIA 4OZJA 2D3ZA 4Y2MA 3OSPA 1DTQA 4DR6F 1WI6A 3QAUA 3T6BA 1M5PC 1Q4RA 4NLSA 1ZOTA 1URRA 4NZ6A 1DTTB 5GAHU 4DR7F 4TY8A 1HD1A 4H4OB 2ZC3A 2KFZA 4UY85 3M6WA 3T1YF 3EUNA 1RGVA 4DSKA 3POTB