3O8WA

Archaeoglobus fulgidus glnk1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
104
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLVDLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGEEEVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of GlnK1, a signalling protein from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-1)
total genus 20
structure length 104
sequence length 112
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o8wA00
4YB5A 2DCLA 2J9CA 4CO5A 4USHA 4YB7A 3AA8A 1Q1KA 4C3LA 3AHPA 1UMJA 5D4OA 4CO0A 3BZQA 3NCQA 4CO3A 2GW8A 2O66A 4Y65A 1QY7A 1NH8A 4NYOA 1UKUA 3TA1A 2J9EA 4C3KA 3GSDA 2J9DE 2XULA 1UFLA 3NCRA 3TA0A 4Y6IA 2GX8A 3AA9A 1UL3A 1VHFA 3X3UA 4NYPA 1NZAA 3TA2A 1J2VA 3L7PA 4CO4A 2JJ4D 4OZJA 4CNYA 1NAQA 2GNKA 2CZ4A 3MHYA 4E98A 2ZOMA 1XK8A 1V6HA 5DS7A 5L9NA 5D4NA 2E66A 4R25A 3M05A 3HLUA 2XBPA 4RLEA 3O5TB 1V9OA 2J9DA 2V5HG 1NH7A 2O67A 4C3MA 4CNZA 2XZWA 3OPKA 2EG2A 3LF0A 5DRKA 3O8WA 4ZK7M 1HWUA 4D3GA 4CO1A 4D3HA 1KR4A 4WK1A 2EG1A 3DFEA 4OZNA 4AFFA 3CE8A 4RX6A 3NCPA 4OZLA 1O5JA 2NUHA 1O51A 1GNKA 3N5BA 4USIA 3AH6A 4WK3A 2XG8A 5D4PA 2RD5C 1H3DA 4CO2A 2NUUG 1V3RA 1OSCA 5D4LA 1P1LA 2ZFHA 4IYQA 1PILA 2PIIA 2Z0GA 1VFJA 4RWWA 4RWXA 4YB6A 1V3SA 3T9ZA 2VD3A 4USJC 2NS1B
chains in the Genus database with same CATH superfamily
1XR6A 4DL2A 3CSKA 2AKWB 5E5NA 3R7SB 4FBTA 2ZVSA 2Y9HA 2QC3A 3M8RA 1I94J 2VIHA 3VV2B 3HK2A 2UUCF 2YX4A 3BSCA 3CJTA 3UN5A 5FLXU 1OY9A 4X4OA 4RJVA 4X66F 1Q7LB 3KHHA 2O3DA 3M8ZA 1IBCB 1RCOB 3MTKA 1T9TA 3GFYA 4MTPA 2H54B 2HPUA 3RB6A 1R8BA 2KXNB 3CCUS 1IJEB 1GAOA 3GONA 4XDCA 1M0SA 5LJ3Y 3IWLA 3M8YA 3NS5A 2MB0B 1LFWA 2IMOA 4H4KC 4Q44A 3DLEA 1UVNA 5FJ4A 2AEFA 3JSYA 2DNGA 1QSSA 2FUG9 2WW4A 2IPOB 1UFLA 3D1HA 5L46A 4O44A 1BUXA 1K73T 1R8AA 1UVIA 1FK9A 1LWXA 2WB4A 3DN9A 2DHXA 1WDDA 1B0PA 3D5MA 4DS4A 2EC2A 3ISNC 4A46A 3Q86A 1VYAA 2O01C 1S6UA 2OAUA 2DR9A 2KO1A 2VODA 4EI2A 2MZQA 2VG6B 3TZYA 5F8IA 1Y5IB 4G3IA 2QLBB 3TA2A 4FN5A 2HBQB 3HJFA 4IOAQ 5IT9Y 5I3UB 2ADBA 4GVBA 2YNIB 1FEEA 5F8HA 4CNYA 1O0PA 3UE2A 2UUBF 1KS2A 4J5OA 1X31C 5JXSA 3Q23A 4DL5A 1MMLA 2MQPA 4UTGA 1NJWA 4C4WA 4TY8B 3QJLA 2VPZB 3CCTA 1XK8A 3HJVA 4UW2A 3PX6A 4I2PA 4OYMA 2F3JA 3F73A 4KQZA 2FJXA 4F4AA 1QJHA 1ZAXA 4F4WA 1YJUA 5M2RA 2CVEA 2GA7A 1VS3A 2NLWA 3AOBA 4M1KA 2LCWA 4B08A 4UOFA 2YNGA 4PYDA 1U02A 1NB2A 4PXBA 3VZIA 3BGRB 3DNCA 4CLPA 2ROPA 5KFJA 2J5AA 2C3OA 4LF6F 2IY5B 2UXCJ 4YR0A 2KRBA 2WVEA 4J9MA 1R0AB 2QSWA 1BQNA 1QD1A 1SKRA 5IWAJ 2AYMA 2Q43A 4C48A 2X1BA 3CMES 4P52A 4DPTA 2BMBA 4K4ZA 1HR0F 4GC6A 3QWPA 4RNOA 1RT6A 3QGIA 4D3HA 2R7UA 3RR7A 1XQIA 4O23A 5B0CA 3ENQA 3MTJA 5D0EA 5KFFA 2W8KA 1P8GA 1ICEB 2QZ8A 4H4OA 1RT7A 4QW9A 4BS2A 2IM2A 3HSGA 1RADB 4QIEA 5IQ6A 1ZAVA 2MKKA 3TJAA 3HFKA 4DX8H 1RA7A 2OUGA 3O1LA 2W4CA 2ZZTA 3C2PA 2A18A 3L4BC 2R7WA 2R7XA 1IQZA 2DVIA 2C2KB 2XY6A 3DKDA 4KB7A 1G1XA 4IKAA 5G0RB 3KLHB 3CXCR 3OFHA 1UEVA 3VZHA 3CCMS 5L8RC 3VTIA 1I1GA 4DL4A 1IKWB 3TANA 2DCUB 4LF7F 1RWXB 1WHWA 4Z7CA 4F0KA 3H8YA 3MPDA 2KJWA 4URQU 2XCPA 4ANCA 2VC0A 2H4WB 4V1Ak 4QWAA 1SL2A 3IXQA 4Q0BA 1S4EA 2AJ0A 3G8QA 4JI1J 4QU7A 4WFZA 2YKPA 1RB0A 3O2IA 4DR2F 4R5PA 5AXNA 3OHAA 1NDKA 3CNQP 1RKJA 1J5OA 4FPIA 2U1AA 1FDAA 1OSCA 2AJ4A 2AP6A 2LU2A 3MFHA 3KK3A 1PILA 3D1OA 2OTLS 3K57A 3CO9A 4FZVA 4WE1A 2HRYA 4ZKAA 4RWXA 3EUNA 4QWBA 3BDPA 2Z2ZA 1S9GA 1V3SA 1JLCA 4FNIA 3CULA 3HVAA 1ZPVA 2HFSA 3VAHA 3DOLB 4DR7J 3I6PA 2BJ1A 2W25A 4NI2A 2M5YA 3D2WA 4DJBA 3CO0P 2SXLA 4B02A 1Q1KA 1HNVA 1VIXA 2IJRA 2QTWA 1MLAA 4TYAA 3A8IA 4X4SA 4C3LA 2XS2A 1QVGR 4DI6A 4F4ZA 2CDQA 1MN9A 4LSNB 3SSQA 3NGUA 2CPIA 1N48A 1UJ5A 3D54A 4CLTA 2LXFA 1N88A 2HZAA 4LFBJ 4DMZA 3GLJA 2JOQA 2WBMA 1H7XA 3MM6A 4M5MA 1FKOB 1OSDA 3CD7A 4Y65A 2CPJA 4FPRA 1QY7A 2VZ9A 4OZ3A 3VQTA 1VK3A 2D9OA 3TA1A 1PO6A 2VBXA 3M8WA 2RAQA 4AQYJ 4KO0A 1CJUB 1KWMA 4OHWA 4I68A 4ZJLA 3TR5A 3G96A 2R8JA 2K1RB 4A8FA 3H5XA 4WPAA 3ETOA 3HT3A 4DEZA 2GO8A 3VVTA 2J7UA 3CC4S 2AJQA 4ZCMA 2BE9B 2DEJA 4GRSA 5KG0A 2FQQB 4Q45A 4GO7X 5LMUF 3BGFA 4NXMF 5CA5A 1FJ7A 3T5KA 4CH7A 4FYXB 3C16A 2VA3A 3ILIA 1K47A 4JV5J 5L39A 1WSVA 3GCXP 4KIAA 1OO0B 4DR7F 1U47A 1XJWB 4E98A 4UQGA 3H4BA 3DRSB 2BKPA 4H4OB 4PG6A 5DS7A 3NAHA 2AZ3A 4A4JA 3CCQS 5L1KA 2HHVA 1T7PA 1SB6A 3HLUA 1M5VC 3UQSA 5HP1B 2CJBA 3BS9A 3FKBA 2BEFA 4DLGA 4M5NA 3NAIA 5CZXA 2DT9A 3FNNA 5IXUA 4XPCA 1RAHB 3HMJG 2HGNA 4Y00A 4ZVFA 4E0DA 3VGUA 3OR1B 2W9BB 2V9KA 5J2QB 2B4OA 4ZDNA 1S1VB 4PXCA 4Q2LA 2V2VA 3O8WA 3QGPA 1JK9B 5CCLA 1QSLA 2M9KA 1EJ7L 1ELOA 4QWEA 4B3TJ 4L76A 4RW7B 1KR4A 2KYXA 3DFEA 3D6TB 2I8EA 1C1CB 4V19X 1S1UA 4P2XA 4KJIA 3M1VB 1HPZB 1CS4A 1DTQB 1YZ7A 2K3IA 2WSFC 1B99A 3TVYA 4YMEA 2Y1LB 2EBEA 3GJQB 4NMLA 3SDEA 3V5RA 4WFAQ 2G2OA 4DCJB 2NUHA 3BBBA 4LFCJ 1F3VA 1S9GB 4USMA 3QZ8A 2R7SA 1CJKB 2KH9A 2H5JB 2MZRA 4KT0C 1C0UB 3HVTB 1VR6A 2J0XA 1BWVA 1LK7A 1R6VA 2CWKA 3BKFA 5DZ6A 5A6WA 3OL9A 2DNRA 2XG8A 5GAGI 5U47A 5DO2A 1B64A 3R5GA 1KDNA 2ZH9A 3RBDA 4K50A 2AIRB 2ZH4A 4U67Q 3QLHA 1O6XA 3UD3P 2AT1B 4CLSA 1SL1A 1RLCL 5KT6A 2FHJA 1M1GA 1TK0A 1DHMA 2AX1A 2Y8YA 2DGTA 3UR0A 4PQUB 1RWPB 1TL3A 4HTJA 4R0JA 3OUYB 5K14B 3E2EA 2IC3B 3RRHA 3RRKA 2KJVA 2OD6A 4HL9A 1Q0NA 2Z0GA 3GR1A 4ELVA 4ANDA 2F4VF 2OEKA 1KTQA 1TL5A 1TVRA 3DOMA 3EJMA 4OFZA 2RQ4A 1U0HA 2QV6A 2V8VA 3TUPA 4K4UA 2NS1B 3KK2A 1VRQC 3A3OB 2WOMA 5HQLA 2DXEA 5KFBA 1MNEA 3OVBA 2N82B 3CCJS 4KGKA 1OPZA 1TAQA 1T94A 4LUBA 5E33A 1NJXA 4CH1A 2YWHA 1S1TB 3AA8A 1TKZB 5BR8F 2HGMA 4U96A 2WSEC 1B0TA 3BKTA 5E3PA 5B09A 3AHPA 1IBKJ 4NLOA 1RDRA 3W62A 1D1UA 4L72B 4CI0B 3CB4A 1FDDA 2I9SA 2IM0A 2ZH1A 2X51A 4K4XA 3FEXB 3CDWA 3TWZA 4X64F 3DDKA 5DZ7A 2UUWA 3M32B 2ZM6J 2O66A 3CD5A 1TKZA 3D3CJ 1NH8A 4NYOA 4OLOA 1FJGJ 2ZKUA 2GGPB 3BSAA 1Q8BA 2KRRA 4C3KA 2J9DE 5KT5A 3HM9A 4PG4A 4NA3A 1Y3JA 1CULA 2DNZA 2XNRA 4Y6IA 2KI2A 5A8RB 4HR2A 3CC2S 3ENVA 4I0WA 2BR0A 1U6ZA 2VA2A 4TKTA 2MKIA 2V2ZA 1NMEB 1FE4A 5FDLA 1SV5A 4AE5A 1SJ3P 3IR6B 3MM7A 3MECB 3CJKB 2M52A 3PW2A 1T0TV 1ZOTA 3UR3C 1S1VA 2CADA 5K8MA 3Q0AA 3FQKA 5I3UA 5H9FJ 2BRKA 2YNIA 1M5HA 3EVOA 3H20A 3GCWP 2DXFA 1XEZA 5KG6A 4NZ6A 4R0EA 1FTCA 3K59A 1F5BA 3IRXB 1FKPA 2HAIA 3C3LA 2KFZA 5C2GA 2KG1A 3PZPA 2JEJA 2XWYA 5GVQA 1JJCB 4OJ1A 4RO0A 3VAIA 2FYXA 2CG4A 3EVMA 5KFMA 4BC9A 2UXBF 2XZTB 5CYMA 4EYHB 3U1LA 4O44B 2ZD1A 2A0FB 1NPRA 2HFZA 2R2TA 4X62J 4ECXA 4IFVB 5HMWA 2YKAA 4N76A 3ZTRA 1T9VA 3TQEA 2UVVA 2O67A 2WOMB 4MK7A 1C1BB 3ZZZA 4JYAJ 3AJ2A 3DLGB 4KV8A 2XY7A 2L9WA 1YJTA 1KBRA 4HDHA 4LR7A 1X0FA 1U48A 1WC0A 1S97A 2R4FA 3NGSA 4A8SA 3TI0A 2ZITA 2OPQA 3FBBA 2XMMA 5ETSA 1E6VA 1U25A 1RHUB 4F25A 2XSJA 2P8IA 3HP6A 3M8QA 4WZQA 3OUYA 2GIQA 3GP9A 1EQ0A 5DETA 2OTJS 4PQUA 4ELTA 3TZZA 1QM9A 4DV6J 3GIMA 3D9BA 1PAUB 3J80U 1WHVA 1E6YA 2YNFB 3MF5A 3QWUA 2Z58B 1YRUA 3BEGB 5KFUA 3HO1A 1VIOA 4NMXA 3CDUA 2CKWA 1O51A 2ATCB 2CDRB 3JSMB 4W4MA 2R2SA 4MKAA 4C0HA 4ZVGA 5KFYA 5D0RA 4QBUA 5LSLA 1DY3A 1I6JA 3PJ9A 4KYZA 3OTOF 3DLHA 2R7OA 2BOAA 4N5SA 2HHHJ 4I6WA 3G8TA 3KLGA 3H5YA 3LA0A 1JX4A 3UCUP 5AJ3F 4NRTA 3MM7B 2KG0A 5GMDA 3V6KA 3B4MA 3M7VA 3SCJE 1SL0A 4BDPA 4ED8A 5L1IA 2VONA 1FWLA 1XERA 4ITSA 1AFIA 1S99A 4J9RA 4M5DA 5JVHQ 2HWHA 2KXFA 2V68A 5BJRA 2DNKA 1S1XA 3MEKA 2VPYB 4JI0F 1U45A 4JI5J 4NA1A 2BZ2A 2RQCA 5GADI 3MMAA 1G7CB 1S5ZA 2IM3A 2HQ3A 3ONQA 4NLRA 2OKQA 3UFCX 4OX9F 4O3RA 2XCAA 3AAWB 2M8DB 1FFWB 2R42A 3QZ7A 4GVBB 2JC1A 1TR0A 2CUYA 2V6AA 2BJEA 3IG1A 4PPZA 3T9ZA 4YDDB 4RU9A 2D3OR 1Q8KA 1N36F 1ZETA 2XGPA 1IWGA 2HQIA 3RB3A 4L74A 2FVPA 5EX3A 1HKAA 5BXIA 2I5JA 3C15B 4FNHA 2YQ3A 3OHBA 4DV7J 2YKQA 3MR3A 3GV5B 3IMQJ 1VBXA 1AB8A 2CG8A 2Q1LA 4Q0BB 2F9JA 4K4WA 1CG2A 3WHIA 2KVQE 2E9TA 2W01A 3UO0A 4MYTA 1U09A 3KDNA 1FA0A 2VKRA 3J7YU 4DV0F 4PG8A 1TL1A 4TQRA 4ED7A 1I51B 1IKXA 2MPUA 3IBWA 4Y3CA 5AXKA 1T8EA 4WIQA 1RTDB 2OPSA 4DR4F 2J9EA 1GH8A 3R5DA 2XULA 3CJ2A 1SJFA 3ENWA 1VQNS 3NCRA 4ZPWR 4LFBF 2CQPA 3V2UC 2ZH5A 1CLFA 3DOLA 2M2BA 3LW5C 1OQ3A 4RW9A 5T7LB 1YJVA 1FD8A 4ECYA 1HI8A 4M94A 3QBCA 1D9DA 3LP2A 3BPDA 2I1RA 4MH8A 1W2BR 3ZZTA 1SC4B 3UDEA 1IVZA 2WBRA 5AXLA 3ITHB 1CEZA 2RQMA 3L7PA 1T9XA 4WP8A 2X7IA 4OZJA 4MJKA 1H0HB 3LO3A 4EK2A 2GMHA 4C8YA 5C42A 7FDRA 3RAMA 1VQ4S 2MKJA 4F3MA 3TEHB 4F4YA 4PEOA 1M5KC 1IQTA 2N4DA 3G6ES 3C6UA 1S7IA 3JAMU 3TARA 1R0AA 1RU2A 1SUQB 1YWXA 3LGHA 4UQTA 4QYZK 1IBLF 1N5SA 2G1HA 2VPXB 4MK9A 5BYQA 4DXLA 2KN4A 3PRBA 1N34F 1GXLA 2YNHA 2CPDA 3Q8VA 4P7TA 2HLUA 4IRCA 2D3ZA 1HBMB 1TKXA 3CCVS 1QUVA 2CPEA 2CNLB 1RWOB 4LT6A 4I2PB 3JTNA 3G6VA 3F44A 2XZWA 1S0MA 3T1HF 4WTYA 1NLKL 4I6YA 3MR6A 2KT3A 4ECUA 2WTFA 5J2QA 4Q8FA 2W4DA 1A9NB 2FJBB 1KKHA 5HI7A 3J81Y 1JJ2R 4CM0A 4LBIA 4EO8A 1WF2A 2OJ3A 4M5HA 4UY8T 2NSBA 2IYIA 3DGPB 4OZNA 3ULHA 4ICLB 2AGQA 2PD1A 1HMVB 2RDIA 5JUMA 5KFKA 3HPOA 1N33J 2MEWA 2B8QA 2QJ3A 1RAIB 1DQ8A 2VQFF 1CBKA 1FESA 1TFWA 3POTA 1PJ6A 4DG1A 4ZLJA 2QLFB 2DH7A 4L75A 1JQGA 5K20B 2D9PA 3MEDB 3AH6A 1ZM3A 2IBKA 2B7CB 3M2RB 3O3LA 2VDIA 3C14A 3D67A 4A8MP 2AHOB 3QRRA 2AEJA 1QAIA 2GS8A 3N4WA 4M95A 3O6QA 4XDDA 2IHR1 5KFOA 4A8KA 1U1QA 4B3SJ 2R7TA 1ZZFA 3MEDA 1S9EA 2Z2YB 3B54A 2VJVA 4QYRA 3C66A 3A8EA 4WU2A 2A6OA 1D0EA 4IDKA 1S1WB 2ERRA 2GJFA 1VQ6S 4I67A 4C9DA 3IM8A 2V69A 2ZFHA 3C6UB 2F40A 1PC5A 2M4MA 3GIRA 2ZUAA 2FZKB 3M4XA 4I7FB 3J80Y 1IR0A 2JL9A 1U24A 2AMCB 1FRIA 3B4DA 3KXDA 4P72A 1GXTA 3MUTP 2ZJPQ 2XY5A 3T6JA 2C2EA 1FWPA 5KT2A 4USVA 4ZN1A 4Y34A 1S1WA 4OI2A 3LP2B 5AE2A 4U9RA 4JV5F 2BBEA 4CO5A 4K4YA 3UD4P 2NYHA 4FF3A 4X65F 2DNQA 4Z7YA 4J37A 2VQEF 1S6QA 3VF0B 4DL7A 3GFXA 2ZH8A 1LNQA 5ETQA 3OXLA 4PR6A 1GMWD 3KKFA 2RU9A 1HQEB 5F3TA 1OWXA 1H72C 4TY8A 3E3XA 3SIPB 2GHVC 3NRBA 1TU0B 1XR5A 1MWZA 3HSZA 2VUGA 2AZ1A 2DGQA 1EARA 3L7UA 1DZ5A 5IC6B 1VDHA 2HWIA 1QAXA 2FLNA 4X66J 1WACA 2OHDA 1T9UA 5K5MA 3UN3A 1M5PC 3P45B 2WVDA 2HIYA 4ZLNA 4HHHA 5A0YB 4DQQA 1KN6A 3ADAC 2FJAB 3O44A 4X64J 3ILOA 3TQ1A 3UD5A 3AB2B 4YP3A 1QSYA 1UEUA 3HX9A 4LFCF 4ZVTB 3QAUA 4UF4A 3UVJB 3UDLA 1IUJA 2XNQA 2HS0A 3H7HB 1XMOF 1HI0P 1JWWA 3QJPA 3LTOA 2ASYA 2E7VA 2BJ7A 3QGHA 2RS8A 3S7RA 3KHGA 1K44A 3BM7A 1UVMA 2B3TB 4S0MA 3ENAA 2GIRA 2XMAA 4EWTA 4GMKA 2OMLA 2HEKA 1LFPA 5F8LA 3GTYX 3VR1A 3TEGA 4ZA1A 1S0NA 1N6QA 3OVSA 5D4NA 4R25A 3EZUA 5HL7Q 1T9WA 1ROFA 1A6LA 2CQ4A 2WHOA 1DLOB 1V9OA 2YNHB 3ISND 3O5TB 4PWUA 5A8RA 2NCKL 4HACA 2E1MC 2V5HG 3MCNA 1HL6A 4LFAF 1S4FA 5CCMA 3A1YG 2Y1JA 2FHKA 3E01B 2ZDPA 2QLXA 4LIRA 4JI2F 3T5HA 2HYIB 4A8QA 1MU2A 3LF0A 3P8BB 3SSRA 3TUIC 4ED0A 2VG5A 1VQLS 2RH3A 3JQKA 2FZGB 2UVUA 3RJMB 3Q83A 4LFAJ 1OQ6A 4R5PB 1FK9B 4LMZA 1JLGA 1FXDA 5HJXA 3RUBL 1S9EB 2FDNA 3BBCA 5DG9A 3V6DB 4DSJA 2RB7A 2FTRA 1TUWA 2K8GA 1XNRJ 3CCWA 4OQJA 1ULRA 4CTAB 2F9DA 1FDBA 2GQ2A 2GJ2A 2JZ5A 2XMUA 4HEA9 4IG0B 5EWEA 3SV3A 2HHWA 2OO4A 3QFWA 1ZM2A 4O0IA 1S72S 4K0KF 2RT3A 4DV6F 4OYAA 4WFNQ 4NCBA 5HVFA 3R8YA 3Q8RB 3DLGA 3MM8B 4L73A 2O1PA 1TL3B 3ZO7A 2B9YA 4LJMA 1S6QB 1S7HA 5KFNA 3J81U 3ILLA 2RD5C 5HK4A 4CCHA 5HN0A 5I42B 3GFHA 2F4VJ 1SJ4P 1UA0A 1RTIA 4G1QA 2DPIA 3DMJA 5D4LA 4RUAA 4BHQA 2V4JB 2VASA 1BQNB 3BV8A 4M8LA 5CYQB 3BKUA 2DH9A 2HFOA 2QL9B 1CC7A 4N41A 2LQ8A 2I2YA 3IO1A 4ID8A 3V6HA 1RTZA 1Q78A 2NREA 4HACB 2WVFA 2YVSA 2N3OA 2VFTA 2AYBA 1SKUB 2BDPA 1RGVA 2J9CA 4K2JA 4RNHA 5EWFA 1VC6A 2HNDA 1BQXA 1RABB 2AF6A 5H9EJ 2CJXB 2XO7A 2CQ2A 4OJHA 4P6QA 3KLFB 5EUHA 3LPEA 3NWRA 4Y2KA 2JEGA 3H90A 2WK4A 4DV1J 1HNZJ 5MAOA 5KFRA 4CP5A 2P9EA 4NLWA 1MROA 2NXEA 1WC3A 4IR1A 3JTOA 2WRMA 2HMIB 3T1YJ 3CJ5A 1K1SA 1IXKA 3OBIA 2Z4PA 2HQCA 1HHSA 3J7ZT 1MW7A 2XYHB 2CNKB 1RWNB 3QATA 1MMDA 2HLTA 4Q7AA 3CJ8A 3SSSA 4EFAC 3HXMA 1RHQB 2MKYA 2Z2MA 1H2VZ 4I2QA 4J91A 1APSA 1T95A 3PV8A 3DHWC 5J2PA 3KHRA 3Q2TC 4K4VA 4ZCKA 4UZBA 1NK6A 2HHUA 2JJ4D 2WONA 4DX5A 1FTRA 1Q95G 1P6TA 2RKIA 2KTQA 3M8PB 3KDOA 2FVCA 2CQCA 4M5JA 4M5IA 2JNJA 1UFKA 2FHJD 4H4MA 3MM9B 4HHJA 4OLPA 4PPDA 1N4LA 5CXTA 1XMQF 4JI7F 1YIJS 1C1BA 4CTAA 3QAEA 5K14A 2ZHBA 3M05A 4JV1A 2IRUA 5FD1A 2ILYA 1LXJA 3IM9A 3EICA 3KLGB 4RW8B 2DXDA 1VJQA 2G0IA 3OLBA 5L1LA 4ANEA 3A8KA 3PW7A 4U7CA 2HVIA 4H54A 1GMWA 4QCLA 2LKZA 5IT4A 1LWCA 4UUXA 4FS1A 4WP9A 1FFGB 3ZZUA 4JI7J 5HROB 2M88A 3VVUA 4I7FA 1HNIB 1MU2B 1MSWD 1Q5YA 3KMSA 3ITHA 3Q8UA 1ITPA 1NUEA 4DF4A 4DFJA 2J6TA 4DPWA 3NBPA 2E7WA 4QR2A 3M9OB 2QA4S 4NASA 2O5DA 1XWLA 4K5RA 3R1HA 4FS2A 2KT5A 1RT5A 4IG3A 4LREA 1Q81T 4WYWA 1YHQS 3TUJC 1HA1A 2WZ1A 1IM6A 4NI2B 4TY9A 5LXYA 3OTBA 2PFFB 3MR7A 2DO4A 2L41A 2DGVA 5JJBA 1TAUA 1SQGA 3CC7S 4KPCA 4U95A 1BMQB 6FD1A 5J1EB 2KDOA 2CJYB 1HBNB 3M2VB 3FFIA 3N5BA 4USIA 3PG9A 3V4MA 4PYAA 4DUTA 4XPEA 2QFJA 4OYBA 4DF8A 4DSIA 1X4BA 2EKNA 4O4GB 5MLCV 1FVQA 2C2DA 3IBFB 2XSFA 3A12A 3M6WA 3R5CA 3K5MA 2ZOFA 3W5ZA 2JRSA 3KG0A 4ZVSB 3EZ5A 2G4BA 2OPPB 5IC4B 4IH6A 5KT4A 4NXNF 5HP1A 4X4UA 1GT8A 4OZ5A 2LYVA 4NYZA 2OEMA 3H42A 3IG1B 1KVJA 4KKOA 3G6XA 1QDUB 2XYPB 3D6MB 4KHPJ 1B7YB 1Q8IA 4USWA 1VQMS 1FNMA 1UPMB 2IA0A 2EFGA 3GG0A 3OXGA 4H4MB 2YXLA 3ISZA 2AU0A 2GFFA 1B3TA 1JB0C 3GYGA 4KH0B 5D0GA 3GG1A 1JIHA 4OHXA 1B0VA 3NG8A 3IGNA 4LBPA 3H40A 1FRHA 5ETPA 3CJ0A 3HD1A 3LQVA 3TOQA 4AXJA 4DV4J 4NOHA 2E1PA 1RT3A 1S1XB 1UWAA 4JI8J 2Y0BB 3PFOA 4ZPBA 2MKHA 4NL5A 4ALZA 2VFUA 2ZWOA 4BC7A 5LSRA 3EYZA 1Z2LA 4RKUC 2Z8QA 5IV4A 4OHZA 1FEHA 3KLIA 2W7OA 5HVGA 2XM3A 1UVJA 3GFZA 3SYZA 3GSIA 1FRKA 2H65B 4LF5F 1S6PA 2BANA 2E1RA 1NO8A 1RT1A 2OD4A 5K8OA 1YSJA 2CNNB 3EMTA 2MYFA 3DDIA 2DIVA 4CYUB 4P2MA 1Y10A 1C0UA 1KHWA 5DQGA 3BZQA 1I3OB 2XMJA 1OMSA 1CC8A 1X4GA 2P6TA 3DLLQ 4RUBA 5DLGA 2GW8A 1JLQB 4OYOA 2V4RA 2FGOA 1E6YB 2YNFA 2MQNA 3SQOP 1RI7A 2VOPA 2ALZA 3TJ9A 2RILA 4FF1A 4ETZA 3MMCB 4WZMA 2H4YB 4AT1B 4QW8A 5GAEI 2BUNA 2ZNYA 1WC4A 2Z2LA 3X3UA 4WYLA 4QQBA 4PUOA 4C11A 1DTTA 3I55S 1UCNA 2GHPA 4UUWA 3FRZA 3ET6A 3PKYA 1HNXJ 2BJ8A 2QG9B 2HBYB 5HMZA 3PVXA 1F3FA 2QEXS 3K58A 2GNKA 1ZM4A 3R5JB 5E2QA 1HNWF 1EQMA 4OYWA 4OMFG 1YG0A 5AT1B 3RBXA 3CEDA 3NEKA 3ZZRA 2W2OP 3PTWA 5DDOC 3GZ7A 1VHIA 5ETNA 4URSA 4QWCA 2C2NA 3QRPA 1S1TA 3D0GE 3VWSA 4HTIA 3DGVA 3BQ0A 7FD1A 3M2UB 4ZCLA 5A0YA 2F4FA 2HWTA 2OP5A 3MZIA 1S0OA 5A8WB 1RTHB 3FFIB 2J6UA 2C3UA 1YITS 2RRNA 4C98A 2QLJB 2CJQA 4NXNJ 2UXBJ 4X4RA 3P5TL 1RT2B 2R8GA 3BB5A 5LMNF 2IMWP 2ZKTA 5DRKA 4P9SA 4ZCIA 4GKJJ 2FC8A 1RAFB 3CDAA 5HBMA 4D3GA 1GQEA 4B3RF 2HHQA 2MSTA 3M6UA 4H4KA 5A76A 1JNZB 2LDIA 2C3YA 5DQHA 3MAQA 4IFVA 5HANA 4CLFA 1KD1T 1WD6A 1KLNA 4NEYA 3GYNA 5F8MA 3V6DA 4J9VA 4LF4J 4O3QA 4I2QB 4AFFA 4TLQA 1X5PA 2ZEJA 2XHCA 3CIMA 1Y3KA 4Y0FA 2MGZA 1JLQA 4X4VA 2B6AB 1NBEB 3NCPA 3MUMP 4OZLA 3CW2C 4GKKJ 1RWMB 1OY8A 2HNZA 4ZVHA 2DRAA 1JLEA 1GNKA 4I1TA 2HIQA 4ZPDA 2MJNA 3IRXA 4LF4F 1HQ2A 5LL6d 4F26A 1X8DA 4OL8A 1MROB 2B56A 3ZNUA 5GAHI 4AUKA 3PX4A 3CCRS 2C1EB 2MY7A 3DM2B 1RHJB 4C11B 1N33F 4U8VA 3SFGA 1H3DA 3THPA 5HQMA 2U2FA 4KFBB 3BYPA 1N5VA 1TZ0A 2HHPA 4DQRA 4YB1P 4F4KA 3OL6A 4DX7A 4DR1J 1ZH5A 4WP3A 4DV5F 1KNZA 2AWZA 1PKUA 4K2XA 4W92B 3MAHA 5DM6Q 2CQ3A 2H5IB 2OFHX 1R8CA 2E44A 4U7UK 2BRLA 3EX7B 4J9QA 2XEXA 1U1LA 3AJ1A 4CWBA 1WI6A 2QYGA 2N7YA 3M2UA 3HCXA 1VRTB 3FDSA 3UNGC 4C0BA 1XC9A 4USHA 1HHQA 2F1FA 1RK8A 4ZIVA 4XO0A 1NHUA 2JX2A 2LQ9A 1FKAF 2B7BB 4GKKF 3AXMA 2PMWA 3G2XA 4I64A 4MAKA 4LR9A 3W9JA 1MN7A 3SQGB 4J7CA 1FVSA 4MIAA 3J7YI 1VGYA 5BYSA 4G6VB 4F4XA 3IFEA 2VOOA 5J2PB 1MMNA 3KG4A 4B3OB 1OS5A 3IS9A 3GV7B 2JC0A 2XMTA 3FSXA 3I0RA 4YY3J 5HQ8A 2MZTA 4X62F 2WB1D 4O3SA 3CMQA 1YRTA 3JYTB 3K0JA 3L09A 1CULB 3QT5A 1RTHA 2H9ZA 3QIDA 1DBDA 2ASJA 2RHSB 2WAQD 1JLGB 4F8RA 2BW2A 4ECSA 4IO1A 3T1YF 1X5OA 3MEEA 1C2PA 3P5BP 5CH7B 1FJGF 2DRDA 4IQMA 3NY0A 1UFWA 1EIYB 2ZH2A 1YJ7A 4M63A 1NRKA 4JBCA 3M9MB 5J2MB 1HHTP 3EPIA 1EKSA 3UWTA 2VH7A 3PYEA 4JUZA 3SFUA 1VBZA 4ZJQA 4HDGA 1YLXA 1NK9A 9ATCB 5KFWA 5K8PA 3F56A 3I4PA 2C2MB 3E01A 3MEEB 2ZH3A 1D09B 1F0XA 3MUVP 3AFGA 2AJ1A 4J9KA 2ZNZA 1ZTWA 1RT4B 4ERDA 1QVFR 2CYYA 2HHHF 1WG4A 1NKEA 2FY1A 4ZVEA 1CPZA 3M2RA 1HI1A 3E51A 3UNYA 4RBTA 4F0MA 2M0GB 2C2RA 3NNHA 2QMWA 2IC3A 1AUSL 1TL1B 3EGNA 3R7BB 2MKSA 4KV8B 3UDCA 3OV7A 2XI3A 1N34J 3MCMA 3W64A 1W25A 2E5JA 2ZE2B 1QTNB 3QIPB 4M5GA 3MR2A 3GE9A 2BACA 3CGIA 3SQGA 3ZC4A 3KK1B 1XBWA 2HVZA 2LQBA 1TL7A 2PDAA 2YWWA 4L3NA 4WK1A 3THTA 2PI4A 1VMBA 1R3NA 2I5JB 1EX8A 2Y3YA 4B3MJ 2HFNA 2VBZA 3G6YA 2VG5B 3K5NA 3ICLA 4OX6A 2GAHC 5IS2A 4JB8B 2UUTA 4RBUA 4CLKA 4EYIB 2F5GA 5GAHU 2HGLA 1AYEA 4Q5VA 3M30B 1NNDA 1H74A 5J1EA 2IAJA 1X0PA 4DCPB 1IN0A 5EDWA 2V0NA 1REVA 2QA1A 4AQYF 4JP8A 2DR6A 3LOUA 2ZBCA 3FCVA 4F67A 4DV0J 2NUUG 3VHQA 3PDNA 4X4NA 2I38A 1U8SA 1TUGB 4U8YA 2YPYA 1REVB 4LVOP 4XIUA 4DN0A 5D8HB 4DG1B 3ZFVA 1U0SA 4DN9A 5LSOA 2KM8C 4ZMMA 2DGXA 2NXJA 3BYRA 4UOCA 3MMBA 5KG4A 3CIZA 2XO6A 1S10A 4PWDA 1JMTA 2PN6A 2W2NP 5A8KA 2VJUA 4OV6A 4KGMA 4YR2A 5A2QY 1RYSA 1QAJA 4CH0S 1UETA 4K8RA 4YB6A 2QFIA 5D77A 1YJWS 2YKNA 3K89A 3KUGA 3CCLS 4ED2A 2OFGX 3LP1B 1HBNA 3M2VA 2HVDA 2ROEA 1XN9A 3S1TA 3TVZA 1FJEB 4LF1A 4PG7A 4JI0J 1RACB 1IR2A 2EK6A 4P2FA 3PKMA 4IDKB 4WFYA 2ALYB 5B0GA 1ZPWX 3KLIB 2UU9J 4KGVB 2C3MA 3HSDA 3IGVA 1S79A 3OR2A 4ZP6A 4DOZA 1UMJA 3GJTB 4OX8A 3GJSB 4RU2A 4RW7A 1VQKS 2JFDA 1RHRB 2HS4A 2OI2A 2J8SA 5BYRA 3DLBA 1TMMA 2GQQA 1N32F 4N8NA 1GK8A 4DZDA 3JB9k 1AW0A 2R7VA 1H98A 5KG1A 3MOZA 1IBKF 3HHLA 1Q53A 2BJDA 4ZVQB 3W1YC 4ATNA 2MZJA 3OLAA 4DWIA 4M5KA 3CD6S 5D3GA 1VBKA 3PEJA 5ETKA 2G1DA 4OZ2A 2GQCA 3DOKA 2EFQA 2Y1RI 5T41A 4Q8EA 1S76D 3BGUA 2GX8A 1U7LA 1LOUA 4V19J 1JKHA 1NXIA 2BJ3A 5L9XA 2HNYA 3LGMA 1PIEA 2YKOA 3OFEA 2QYCA 4ZPVR 4ZHRA 4FXDA 3WDOA 1HFEL 2CNOB 4CT9A 2JWNA 3DHXA 3HD2A 3HVTA 4MKVA 4TU9A 2MQOA 2JLEA 1FKOA 1LQ9A 3A3PB 3D0IE 5D3GB 2ZC4A 2DB1A 1U1MA 3BO2A 5LXRA 2K7JA 1KRPA 1TV6A 3FEZA 4LF2A 3PIOQ 2L9DA 3TVKA 2JLGA 1JXVA 1GMVA 1U6BA 4KHMA 3VGTA 1PGZA 4ID5A 3JSRA 1JLAB 3T1AA 4G1IA 5EN1A 1RQ0A 2ZH6A 1HPZA 2DK2A 5ETOA 4P71A 3TAQA 2H3EB 1HARA 1HBUA 2CAJA 3D66A 2UU9F 3NS7B 4TU7A 2V2QA 4ED5A 1OYEA 2V8DA 4U6PA 4Q2MA 1RT4A 2VFRA 1N54B 2FPHX 2EEYA 4P75A 2QSFA 2DY9A 3LWLA 3TW0A 4DL3A 4DSKA 1KOOA 2X3GA 3M30A 2DYAA 1F60B 1NDLA 3LP1A 4LSLB 8ATCB 1B70B 5KFQA 4DV4F 1PSDA 1AZSB 3WC0A 4L3KA 5HMXA 5KT3A 3TAPA 1IBLJ 3AD8C 3L7OA 2DPJA 3G82B 3H2VE 3RR8A 4DSLA 1N0UA 1ZA2B 4FP9A 3RG6A 3BR9A 5C42B 2DKOB 3TZXA 1X9MA 3VGVA 2E1CA 4CO1A 4ECTA 4C0OC 1MG7A 2B51A 4OI0A 3CMAS 2OELA 1GX5A 1H73A 3T19A 2CQGA 5L38A 1LW2A 1FRJA 1GTHA 1QE1B 2MLXA 1AROP 4KSEB 3W66A 1U1OA 4EZ6A 2MQ8A 4I4BA 4RX6A 2KHCA 3G9CA 1AXQA 1D8ZA 1JLFA 3CDEA 5B0DA 4DBQA 5KFZA 4DU8A 3DRXA 1RE1B 4CT8A 3HVRA 2GJIA 2ZM6F 3HHDA 1KOHA 2IJFA 2JH3A 4QPXA 3GILA 1WKLA 3HFZB 5DDPC 3OT9A 1YZ6A 3FBEA 3R27A 2W1BA 1TK5A 3N6LA 3SBMA 6FDRA 1SCJB 5HSPA 4C8KA 2LMIA 3KMQA 1LV5A 4A8OA 3CJRA 4MFBB 4FF2A 3IR7B 1RP5A 1RT6B 1N32J 3IRWP 4DUYF 2KXHA 1N5YA 2C42A 5HAOA 2UUAF 1V5VA 2CQDA 1X9WA 2EI5A 2LXUA 2KZMA 3AQPA 1FFSB 1LKZA 1FKPB 2K7KA 2AD9A 5DGBA 1PJ7A 1R7IA 3FZ2A 4PXEA 1U26A 3LWMA 4AXIA 3MM6B 5CYJA 2V9WA 3TX8A 4EMDA 1D9AA 3DXBA 3MD3A 1O8BA 1H2UX 3HHLB 4BCAA 2MGZB 4GC7A 2B9WA 4WU3A 1M5OC 4ZP8A 3ET6B 1J5EJ 2GMJA 1YK9A 2L08A 3BO3A 3SI8A 4JI5F 3ILJA 4B9LA 1U1PA 3VAFA 4ECQA 3PX0A 2BOPA 1Y9OA 3D4JA 1Q82T 3W3SA 4YB5A 3OL8A 5KG2A 3BDEA 3BGOP 1HNWJ 3OJSA 4AL6A 2AGOA 4OX9J 2H1YA 4IG0A 4C8MA 3R6GB 4RNFA 4ES3A 5I3QA 1FX4A 3K5OA 1PC4A 1U2CA 2VBWA 3NBPB 5F9LA 5DG8A 3KUHA 5HMYA 1TV6B 4B9UA 2HHSA 1TMJA 1VLYA 4KRWA 3J81j 3U02A 4CO0A 3H4DA 4LR8A 1F2GA 3HULA 4PZVA 3I9ZA 3UW1A 4DV3J 4FYWB 1N0VC 4EO6A 5DM7Q 4I6AA 4NLQA 4B3RJ 2EK1A 5GMEA 3DLJA 1XIQA 3IN5A 1ZS6A 2V63A 3JSBA 2GV1A 3D68A 4KAIA 4DR3J 1H6KX 2NZCA 5CD4H 4K7QA 2IJNA 2R3VA 1TL7B 1KFDA 1ZBTA 2CPZA 2JVOA 4I56A 2CPXA 4X4QA 2LA4A 3SXLA 1BQMA 1EETB 3BN4A 4DPUA 5IM0A 1C4CA 2J6SA 2WW8A 2FC9A 2QMUB 1A7GE 3KJVA 3EWGA 2ROGA 1K1QA 3PYDA 4DR3F 1C0TA 1HW8A 1J2VA 2BKOA 1SH2A 2OPQB 2YH0A 1NKBA 3I31A 1IJFB 4MIWA 1S57A 2B0GA 2RDDA 4MMOA 4CLLA 3IAM9 3MURP 2CFXA 4ZS6A 2ZBQA 2W9AA 2QMXA 2A3JA 4ID5B 1I94F 5E3RA 3IS9B 3POTB 5CZVA 3CPWR 4ECZA 1NJYA 4WKYA 1R0BG 2DEIA 4N7TA 5ETTA 3ZTOA 1LW2B 4OJGA 2BQUA 4KR0B 4OJ3A 5C2CA 4IFYB 4FF4A 2RUGA 3EGVA 1FWKA 1XR7A 4Y2AA 4HT5A 2DRBA 2DNLA 5KAKA 3R3TA 3HKWA 1WI8A 2J76E 1UEKA 1N5QA 2P5VA 1T11A 2M7SA 4C7QA 4EUVA 4KTQA 1X4AA 4O3PA 3J7AN 4PWDB 2B4PA 2E5HA 1OPIA 2B6AA 3NLCA 2GIFA 1NK8A 2LP4A 3I5CA 3BJYA 1RTJB 3IP0A 1JLBB 2V34A 2HHXA 1Y11A 4F50A 4TXSA 2V67A 3Q8SB 4AD6A 2Q6CA 4DU7A 4X2BA 2CPFA 3X1LB 1CS4B 1DTQA 1SH3A 1S59A 2PA8D 4O3NA 5M2UA 3UPFA 3RAXA 3HI9A 4IO9Q 2DHHA 2OMOA 1IKXB 3QT6A 3L3CA 3RTVA 2ACYA 1LW0A 4E8UA 4N47A 4YY3F 1X7VA 1F1BB 3SCIE 4URGA 1U1NA 1LEOA 2V8PA 4ILMA 3GYXB 4J9SA 1WJ9A 1T03B 3GPAA 1RAJA 3DRRB 4HT7A 4IRDA 2PE8A 3RZAA 3ZZPA 3HFVA 3HZEA 2W9BA 2VICA 5HO4A 1YBAA 1FDNA 4X4TA 2ZHAA 4DSFA 1CQNA 4OX7A 1VOMA 5CYMB 1RLDA 2CQ1A 1XMBA 3AB4B 3MCOA 3NNCA 2FLOA 4TU8A 2ILZA 4RBVA 4RW8A 1WF0A 3HHEA 3PJWA 1JKHB 1M1HA 4CQ1A 2D69A 3IAS9 4F0HA 4ECRA 2ADCA 5IZHA 3W2WB 4NCAA 1HYSA 5ETLA 2W7AA 3PCOB 3OSPA 2HRTA 1N36J 2HK3A 2BA9A 2BE2A 2KKHA 1PBUA 4LIWA 2ZHOA 3I96A 4IYQA 1KQSR 1HR0J 1TFYA 2AYEA 4KGZB 4MKBA 4B9TA 5KFTA 4ZITA 3NXZA 4JV0A 1FF2A 1TVRB 3DOMB 4OYPA 4BWJA 2A2DA 3J7A1 1PAEX 3C16B 2A1BA 4USJC 5ETVA 1KC8T 4M5DB 4YN3B 3P96A 4ECVA 1UZHA 4P2SA 2DCLA 4KKOB 2FJVA 2JEIA 1U8WA 1KLMB 4MIBA 3M6VA 4J9NA 1LWEA 1VJWA 5J2NA 4IH7A 2B9XA 5KFGA 3W60A 1BXNA 2XZDB 4YFUA 1XMQJ 3SMZA 3W61A 1FRXA 2XTJP 1S12A 1UZDA 5LT5A 4P73A 5M2PA 4QIFA 2UV8A 4PCQA 4FDFA 3AD9C 2MQQA 3PO5A 2QRRA 2YX7A 3K17A 5KG5A 4HI2A 5IT0A 2RDJA 4J9PA 2E5LF 1PYOB 1EHWA 1SC6A 4DDFA 1FT8A 1LW0B 3NWGA 1NK5A 3L95X 3CD0A 2IYGA 3P3DA 5E3QA 1VQ7S 3G87A 2MKCA 5IT9U 3C14B 1WHYA 2HNDB 2VQFJ 3TJ8A 4C97A 4ECWA 3KFWX 1NU4A 3Q89A 4FKYA 4M5LA 1OJ4A 2BM1A 2PFDA 3EPGA 2E5LJ 4WKRA 2G0JA 2Z56B 3DM2A 3I32A 4LRDA 4WBFA 2IM1A 2D3UA 4HVZA 5E3AA 2KZZA 1TP7A 2R8KA 1UPPA 2FY8A 1NJZA 1BY9A 3JTPA 5D6GA 4ZLPA 2VG7A 3W2WA 2NXUA 1EAYC 4IOBA 2XLIA 1HBOB 4R8UB 3EGWB 1GX6A 2G13A 3T9NA 4CLZA 4C8ZA 5B7WA 3PFEA 1URRA 3FMBA 3GU0A 2XBPA 2IDEA 1RSCA 4YEAA 2FJDB 3MEGB 4BWMA 5KG7A 3KWMA 5I42A 1N5YB 2W9CA 2I0XA 5IOLA 3TYTA 2RQKA 3CJ4A 3QYYA 2RRAA 1WF1A 2H51B 4OI3A 5KTQA 5KFEA 3OPKA 2X1AA 3DLKA 3I0SB 3ZZ0A 4DSEA 2DNHA 3QT8A 3NGRA 5F0WA 4JI8F 4Z2XA 1RTDA 4B9VA 2XMVA 3CT9A 1ZA1B 4UT4A 2HURA 4ZK7M 2IRYA 3IBCB 1VQYA 2HQDA 5KG3A 2FVRA 3R2DJ 3QQCD 2G0CA 3NKYA 4ED4A 3MMCA 2LQ5A 5L1JA 5DG7A 3SZ2A 2E7XA 2HQFA 3IA0A 3ZZYA 3CE8A 5CQGA 2IIHA 1Q86T 2FJEB 3LP0A 2UVWA 2ZJQQ 3EXCX 1KHVA 1SVDA 4JI4J 1V5IB 1CJUA 2NYIA 8RUCA 1NPKA 2L48A 1RAEB 2LA6A 3JSMA 4DR6F 3W2VA 2MSSA 5KFHA 2AJ2A 2ZBRA 1BHNA 5HROA 1DRZA 1IBMJ 2RU3A 3EM1A 1PCAA 4ES2A 2GMLA 2HQGA 1S6OA 2IVYA 1WDTA 4WK3A 3ZTPA 5KT7A 1UVKA 3DXSX 4K0KJ 1R8HA 4FXWA 3I5BA 2DISA 1DAXA 1LWEB 1LWFB 2MTLA 1YX2A 2MQMA 3DCAA 1PJ5A 3DDNA 3EE3A 4IFYA 4RNNA 3V81A 5I4MA 1V3RA 4LBHA 1N5TA 3DRPB 2ZH7A 5DJBA 2Y8WA 1SKWA 1URNA 2J0QD 1WG5A 2QE5A 4QZVB 1OYDA 5DQIA 4ELUA 3FBCA 2E29A 2BYCA 3BBFA 5E0OA 1LWFA 1VFJA 2VB6A 4ZPTR 2LLZA 4FXVA 4MYUA 4X65J 2RE1A 1KQKA 2PC6A 2UUCJ 2OLWA 3AD7C 5E7OB 4RUHA 2P9GA 4LRFA 5D0HA 4DPYA 1XMOJ 1G2EA 3BH7B 4DLEA 1MWYA 1CJTB 1FXRA 2KYZA 3MEGA 3RBEA 2DR5A 2W9CB 2DGWA 5GMKa 1X5TA 5C24B 4FVMA 4EU0A 1HD1A 3OTEA 4IUFA 5I3PA 3UDVA 3LGNA 1RBLA 2FB0A 5B0FA 1XNQF 3OTCA 1RAOA 1QAYA 3I82A 4K5SA 5RUBA 4FYDA 2KU7A 4CIOA 3CJ3A 2MLZA 1GEHA 5D15A 5A6PA 2ZE2A 4YS2A 2DGSA 3CVKA 2R2UA 1L3VA 2L3MA 3MMJA 3DI6A 4DR5F 3QRQA 1IKWA 1TUVA 1B4SA 3W9HA 2P9CA 1NJIT 4W98A 2UV8G 4XAKA 2IVMA 4QOTA 4DS5A 3QNWB 4NZ0A 3MECA 5C7PA 2MZ1A 2RS2A 3HHKA 2WONB 1NCLA 4LF5J 1FERA 4TYBA 4TVAB 4CM2A 4HHUA 5LMUJ 3K8WA 4KFBA 2IDLA 4P10A 5F9NA 1N8RT 1SPBP 1BC6A 1SXLA 1KTVA 3DU5A 4OV1A 2KB2A 2DNPA 2DY1A 3TAMA 2KVIA 5C25B 5F3ZA 1YI2S 1T05A 1VQPS 2CA9A 1XTZA 2W2MP 4WE1B 5K9FA 1FNXH 4DQIA 3ZNJ1 1L3TA 1FHTA 3JQMA 5ADZA 4LF8F 1F6TA 1SJRA 2HKEA 3N79A 4YHHJ 2M3DA 4JYAF 2VG7B 3MDFA 1RAAB 2CZ4A 2ZDOA 3MHYA 3PR5B 2N3LA 3FCWA 2DNNA 4LRBA 2GO9A 4RW4B 1ZM9A 4LF6J 2VDHA 5C25A 2VF3A 2ZOMA 5H9FK 1HD0A 2J0WA 2OSQA 5BR8J 1YJ9S 3RRGA 3GIKA 5ETMA 3R6LB 4NLPA 3PXGa 3GIIA 1HQUB 1Y5LB 2F65A 2YQ0A 1ZTTA 3T5JA 2V50A 4WTOB 2GVZA 2JDJA 3A4TA 2XSJB 2HBRB 5KFCA 5E3CA 5F8JA 2LQJA 1KEKA 3T41A 2K3KA 4WXWA 4EBEA 2UXDJ 1RT5B 2ABYA 2LEAA 1YJNS 2BXJA 3PHTA 4PG5A 5G0RA 3R1LA 4DUYJ 3S6EA 2WVCA 3I0RB 5KFAA 3OVAA 4J90A 3EVWA 4F2SA 2CIMA 4USTA 2PI5A 2W4PA 1TELA 3MCSA 4CZCA 2EFNA 3PYFA 5HJYA 5LOQA 2J8AA 3WQPA 2HVHA 1WSRA 2AW0A 1H38A 1NSAA 5CAAA 3OTOJ 5KFPA 2CJ9A 1UJ6A 3OW2R 4OIXA 3BO4A 1RHKB 3QFHA 4U7UD 4HI1A 1NSPA 2GCFA 2A6MA 3MPYA 5AJ3J 2NQPA 2KFNA 4MFBA 3S8SA 1VCTA 1IKYB 1U2FA 3B6BA 4WCEQ 4YQWA 1O5JA 3PNIA 3TO8A 3HHLD 4BBYA 2XLKA 2CJKA 3QIPA 4RUCA 4P7VA 3W7BA 2R8HA 4RL1A 4DR2J 3T5LA 3A8JA 2UZAA 3H25A 3MMAB 3N6MA 4NX9A 4DV1F 4QIGA 1Q4RA 3BH6B 5FDLB 2KHDA 3KG1A 1KQFB 3B8HA 5D4PA 3BREA 5F0UA 3BQ2A 1ZAWA 4F36A 4CO2A 1P1TA 2BJ9A 4ZP7A 2CQ0A 4DL0C 5EHHA 5IWAF 3BN7A 2CXEA 2XYGB 5JMNA 1W2IA 3SV4A 4EEYA 1HYSB 2HZVA 2MMYA 2XI2A 3H0PA 5K8NA 2LVWA 4ED6A 3CWJA 1SQFA 4RW4A 4EBDA 3D0HE 1RAGB 1YGYA 4Q43A 1R27B 1TKDA 3QO9B 2LXIA 1BLUA 3LAMA 2VG6A 3IC1A 4BLGA 3G4SS 2N7CA 3D1QA 3AXKA 2HRUA 1WG1A 2ZWPA 3DRRA 3K5LA 3DC2A 2Z57B 3MGJA 1I5OB 4PWWA 3B82A 3H2UB 4NZ7A 3ZZOA 3CUNA 1VQOS 1D9FA 2EWHA 2H5EA 2E1AA 1WOOA 4LF8J 2QX0A 5HLFB 3UCGA 4YHHF 2RHQB 4ED3A 4ZN3A 2EFOA 1UWBB 3KOAA 2F7VA 2JSXA 3H59A 4A8XA 1H2TZ 3GIJA 3H98A 1F2HA 1V3ZA 2OIHA 1U0HB 3AOCA 1FCAA 2YQ1A 2VV5A 4JI6F 4B3OA 3KJVB 1RU1A 2BE2B 3EDRB 1Q8LA 5B0EA 1WKKA 5EX0A 3KTQA 1AT1B 2GVZB 1RWWB 5D78A 1UKUA 5J1PA 1HQUA 1Y7PA 2BQRA 1IKYA 3PW4A 2FLPA 3I9V9 1S0VA 1TKTB 1DJ0A 2EPIA 3MR5A 3GMGA 1U6FA 5LJ5Y 3R5BA 2UUBJ 1VRUB 4XTTA 3J7Z5 2JVRA 4F02A 4C8LA 2DR8A 2QA2A 2D74B 1NZAA 2RMLA 3G82A 4RW6B 2F8EX 1D8YA 4DR4J 3HF5A 2FIUA 4HH1A 5CHCB 4B9MA 3MPWA 1SI9A 2NPIA 3PR4A 1F5CA 2CQBA 2DGUA 2AV5A 4OYIA 4DCOB 5GADU 3OSNA 4F3OA 2BW7A 2VFSA 2NXNA 3ZTQA 2OPRB 2MZSA 4NCGB 3PHEA 3HSJA 3KLHA 1RZMA 1KQGB 1V6HA 1F9HA 1NDCA 2R7RA 4JI3F 1C1CA 1YVFA 2HHTA 5ETRA 1C0TB 3M1VA 2CRLA 4MK8A 3U7JA 3FSIA 2PT0A 3MD1A 2JFKA 2CWXA 1EB0A 3V81B 3WIUA 4RLEA 5C5JA 4F2RA 3FEYB 2K2PA 3N6NA 3WX4A 4ETXA 4CLUA 1XNQJ 1YJRA 1DARA 2OPRA 2PO4A 4KY3A 4QYZJ 1T9YA 2LU1A 3N9UC 2NPFA 3FC9A 4OI4A 1T3OA 3DI6B 2L9NA 4USUA 3OR1A 4C3MA 3L9ZA 1IR1A 4KPYA 1BGXT 1S49A 3W5XA 5DDQC 4P74A 4AL5A 3KJQB 1TQLA 3ETMA 3KUEA 2KM8B 2BKNA 3VQSA 5J1NA 4MT1A 4NXMJ 2C28A 1HWUA 2CZVC 4C8NA 3R7NB 1FX2A 1UW4A 3BR8A 3KK1A 2EG1A 3KLEA 3OD2A 1VC0A 1FXLA 4OZ0A 1W7WA 3DU6A 3TAMB 2VC1A 1KLMA 2HG4A 1AUDA 1Z1ZA 3KJFB 4DFKA 4OZ1A 5B0BA 1R6YA 2OPSB 3M8SA 5CD4A 3RB0A 4K4SA 4NRUA 3GJRB 3H5UA 5G4DA 4DUZF 2PEHA 2R2RA 3FQLA 4FYYB 1JLAA 2DNOA 3IR5B 1HQEA 1Q16B 1GMUA 1HBMA 1RCXB 1TKXB 1Q5VA 1QUPA 1TTHB 2IAJB 3H2LA 3TRGA 1Z4UA 3QGGA 1UTAA 4A47A 2XQCA 1UA1A 4JI4F 1BQMB 1EETA 1WOSA 1QE1A 2CZ9A 1SJ1A 2V8HA 4F7VA 4YR3A 4UOGA 1X9SA 1VC5A 1SBRA 1F5AA 4RW6A 3JXOA 2ZUGA 4YDXA 2AX0A 3AQOA 2V94A 3DRYA 1EZZB 5A8WA 1U2RA 1NB7A 1PYTA 1VRTA 2B8PA 1KVKA 1VI7A 4F04B 1G3OA 2IBOA 1X4FA 4DV2J 4O3OA 4DFPA 3WC2A 1P1LA 2VQEJ 1AZSA 1FRMA 2VFVA 2WCXA 3EXYA 2C2OB 1SJQA 2YWEA 3KNGA 4O4GA 2NXCA 3MMBB 4QIWD 4J9OA 1F9EB 4RZRA 4AYBD 1KSPA 3QPIA 1OIAA 4Y28C 1SIWB 4DR1F 3BGRA 4IRKA 3M6XA 1TK8A 3RYLA 1NPPA 4PUOB 4QWDA 1QLNA 1HBUB 2D7SA 1X4DA 2JLFA 2OSRA 3U27A 1P27B 3BQ1A 2ACMA 1S1UB 1JLFB 1HLWA 2QT7A 1UWBA 4RNMA 4YB7A 2QGFB 3LPYA 5GAGU 5ITHA 3HVWA 2IVFB 4J9LA 1WOPA 3WIVA 1RTJA 1WC6A 5KFDA 3M9NB 2CJAA 2Q79A 1JNRB 4DZ6A 4LSZB 5EGYA 4JI3J 4WWSA 5D4OA 1JXLA 3VAGA 2Y0SD 1U49A 1K0VA 2WVBA 3PJXA 3MOJB 5H9EK 2M8HA 3B78A 5KFXA 2UP1A 3PACA 4PXDA 2XS5A 4WFXA 1NM2A 2ASLA 1VQ9S 2HSEB 4YUDA 5THWA 4MKYA 4O4RA 1WNEA 3F41A 2XMWA 4PRFA 1B7FA 3VGSA 3GR0A 3K8VA 4G65A 1F9FA 3FGVA 3DOKB 4PAAA 4CLYA 5IFMA 2QO3A 1H7WA 1N52B 4Y2CA 5KOWA 3W9IA 4O0NA 2IRXA 1WTBA 2KT2A 1WKJA 1FE0A 2GZOA 3DRSA 1IM4A 4ZOSA 1SKSA 1LXNA 2EFPA 4ZJOA 4DR6J 2UVRA 2JHEA 3FK4A 4ZVPB 2P2CB 2E5IA 5HBMB 3N28A 1AFJA 1RXOB 3FUYA 3W5YA 2Y1IA 1R8PA 3HDSA 2E9ZA 1VQSA 2OGUA 2F63A 4NCGA 5KFLA 4ZIWA 4K4TA 2UXCF 2DTJA 3AT1B 3W65A 1GFWB 3CF5Q 2ZJRQ 1L5UA 2G2YA 4NE9C 1JJHA 5A2QU 2R8IA 2HFVA 4C8OA 3RU0A 4KGXB 2ZZMA 5IM0B 1HWLA 1RKIA 1FNOA 1NKCA 3QJJA 2HBZB 3C19A 4X84A 3MXHP 2YH1A 1EP4A 4ZVRB 5KOXA 4FBUA 4DV5J 3VCDA 1SC1B 4QIVA 3SCLE 4KO0B 2HNYB 3A13A 3FCHA 4ZHRB 1DURA 5CABA 1JJ4A 5F8NA 2FHMA 4ILRA 4NEZA 1Y0HA 4JOUA 4CNZA 4HYKA 2Q66A 3QO9A 4NLYA 2IFXA 3DLEB 3LP0B 3K2YA 3TNVA 2B5JB 3DYAB 3OFFA 3TP2A 4DV2F 1NZ8A 2XMKA 4LSNA 5GAEU 3I5AA 1UP1A 1Y00A 2BE7D 2AGPA 1BE4A 4LF7J 3U1MA 2CPYA 4TNOA 4K59A 4OI1A 4C6AA 1GXUA 1NHKL 2CPHA 2HAFA 4IG3B 4LQ9A 4NLTA 4NLDA 4RR5A 2AYGA 4KBIA 2AJFE 3PW5A 3MFIA 5FIIA 1N6QB 1CJVA 1RT2A 1WWHA 2BV3A 3TX0A 5LMNJ 2B4UA 4X4PA 2VBYA 3KHLA 1JLBA 2ASDA 1WUUA 1R89A 4LQ3A 1SH0A 3V4IA 1YDLA 1SC3B 3PRDA 3AODA 3BPSP 2PMHA 1HMVA 3NS6A 1EKRA 2QLWA 3G86A 2D3O1 1J5OB 2ZZNA 3KK3B 1M1KT 5A8KB 3UVJA 1Y5NB 2HFUA 2OPPA 3C15A 3HKZD 2FJWA 3WX8A 1WELA 3BGLA 4CLWA 4ES1A 1QTMA 2B9EA 1RBAA 2BANB 1S6PB 4A8YA 2NR0A 2MY8A 2CVIA 1P9YA 2Z30B 1UAWA 3NOCA 4UY85 3KNAA 2W2QP 2QL7B 4KHRA 5SZTA 4EBCA 2DJWA 2D41A 3HZGA 6AT1B 3K7RA 2V4QA 2MQLA 2FZCB 3MAAB 4NA2A 3CDBA 2COLA 3LH2S 4F3QA 2BX6A 1CSJA 3OR2B 2RKIB 2VD3A 1YQHA 3NGKA 2PMZD 3U1NA 4EGLA 2AQ4A 4B3TF 4IR9A 3C6TB 2B4VA 4YOEA 3FJ2A 1MWQA 1U1KA 2YBVA 4OI6A 3MM5A 3CCSS 4DHVA 3MPVA 2Q6BA 5EWGA 1VLOA 4WF9Q 1FRLA 2GGPA 4Y2IA 5HLFA 2V2KA 1WEXA 2RIJA 2C2ZB 3ZXWA 3QLHB 5AE3A 2G2ZA 1XNRF 2APOA 5C24A 4ZPCA 1K9MT 2DBBA 1X4EA 3UI3A 2HK2A 4CYUA 5HVHA 3Q22A 3NCQA 4CO3A 4GVLA 1KP6A 2LEBA 3NMAA 4LSLA 2QL5B 1R43A 2DHGA 3CJQA 2YY3A 2YPZA 3CTRA 3KJNB 3PEHA 3PYGA 4LRCA 2XLJA 3LUYA 4ED1A 2GC8A 1NK7A 1T05B 4JV2A 2YKMA 3P49B 2F8HA 1R31A 1CJVB 4OHVA 1HNVB 4IH5A 2YNGB 3BSNA 1VQ5S 4JI6J 2EW9A 4RW9B 5T7LA 1UL3A 2DGOA 3MM9A 3Q8QB 3M8QB 3AJDA 4N56A 4B17A 2K06A 4DR5J 4WJBA 2JEFA 4QU6A 3RBZA 4OYZA 3RW6A 2HS3A 2BQ3A 2XB2D 3VALA 3DYAA 4CO4A 1RJJA 1YKWA 2PA3A 4B3MF 3D7SB 2B5JA 2AEMA 4DV7F 4ZPAA 1G4CA 1WC1A 3E8OA 1DQAA 4Z37A 2RF2B 1NK4A 3DMJB 1HNIA 4LVNP 7AT1B 1WC5A 2V4JA 4G1QB 4LF9J 2A2CA 1WEZA 4HKQA 4N77A 3LAKA 4ICLA 2XC9A 3T1HJ 4EZ9A 4PQAA 2WSCC 3GWCA 2W2PP 1L3SA 4AL7A 2EBGA 2X1GA 5B0AA 2RNEA 4FVCA 1TKTA 2E5GA 2RF2A 4TQSA 3KLVA 1CJTA 5KFIA 1NH7A 1Q79A 2GVDA 4NLUA 5SUHA 1RYRA 4B9NA 2PGCA 3C6TA 5JVGQ 3W63A 1HWIA 2N4CA 3I56S 3OQ2A 2EG2A 2DO0A 3JYTA 4E2FB 3UN2A 3FRYA 2BABA 3I4HX 1Z2ZA 3S01A 2EC0A 2RRBA 5E41A 4OHYA 1WORA 1C4AA 4KC5A 9RUBA 1BD6A 1W26A 1WEYA 3NP5A 4TLRA 3US5A 4QJVA 3D3BJ 4DPXA 3VAKA 3QSYB 1RT7B 1KFSA 3GB0A 2MJUA 3TUZC 2W8LA 2OH2A 1RISA 3CJSA 5DLFA 8AT1B 2I6WA 3LANA 1WTFA 2QIFA 3JS9A 5AXMA 3QT7A 1FO1A 1ZYQA 1JLEB 1SIZA 2YKNB 3N01A 4ZVOB 4DFMA 3NMRA 2HNZB 4B3SF 2CQIA 4NPOA 5AE1A 3NNAA 2DIUA 4JI1F 1NDPA 1NSKL 1T03A 1DFDA 3ZTSA 1GTEA 3ELHA 1DQ9A 4PKDB 1UVLA 3JAMY 2W7PA 3T3FA 2DHAA 3TZWA 3V6JA 2GAGC 3VAMA 5B08A 1WHXA 3NGDA 2W24A 1DLOA 2YX1A 2YWGA 3SDEB 3G71S 2FVQA 1HW9A 1VISA 5F8GA 4W90B 1NHVA 2RUSA 3FZBA 1FI4A 2J0SD 1E6VB 4CDIA 4WIIA 1M5SA 4QPTA 1ZZNA 2YWFA 2IA6A 2FD2A 2XHWA 1RWVB 1HWKA 4NWBA 3PM9A 2HVEA 5HATA 1Y4ZB 1RHMB 4J9UE 1KVIA 1HWJA 2LECA 2YKMB 4WFBQ 3F0NA 4RPFA 3IWNC 3OTDA 3Q8YA 3R2CJ 1JLCB 2XWXA 1YTYA 3FSYA 3MPUB 2XS7A 1FJCA 1X60A 3OXFA 2R9LA 1UJ4A 4DL6A 1K0TA 4Y2MA 1G6BA 2K1RA 4KHPF 2D1CA 1VQ8S 2ZBIA 2MHNA 5F41A 3C8YA 3DGPA 1J5EF 2M70A 5LM7E 2FHOB 3W8GA 1T3NA 2A10A 3Q24A 1EP4B 1RA6A 5J2NB 2FVSA 1BWEA 2VPWB 1RBOB 4LF9F 2VU5A 4ENOA 3NOGA 2KFYA 2EKYA 3PO4A 2HW3A 4NLXA 2PSZA 2UXDF 3CCZA 1NK0A 3MM8A 4I69A 1RWUA 3BSOA 3NL0A 3SEOA 2DITA 2XGQA 4A8WA 3Q8PB 2VHGA 5H1SV 1DTTB 3C46A 2Q3PA 2DH8A 4IOCQ 3OJUA 3KLFA 1SV5B 1N56A 2ZOGA 3RGIA 3K5PA 4FYVB 3D28A 3KYLA 3GSDA 4QR0A 4NLGA 3DRPA 3TA0A 1JXEA 1R0CB 4NLVA 3AA9A 3RAQA 2GVDB 2J7WA 1VHFA 1M90T 1Q7YT 1K8AT 2HZCA 1S9FA 2X1FA 2NSCA 3LALA 1NSQA 2LDYA 2RVJA 1ACMB 4NYPA 3KLEB 1HNZF 3M32A 2H48B 3PIPQ 4ZLLA 3FVYA 4LRAA 4PABA 5J2MA 5KFSA 1RWKB 3QSIA 1NAQA 1RT1B 2KL8A 3W2VB 2P6SA 4OYXA 2C22A 1VRUA 3P4UB 4A48A 2BVZA 1IKVB 4HH0A 3R97A 4DX6A 5DDRC 2POKA 1YBUA 4B9SA 5L9NA 4FKXA 2E66A 3D6HB 3MM5B 3WZ0A 3CJKA 2QA4G 2GHWA 4GKJF 3W8PA 3R9LA 3JQJA 3EGZA 4C2MA 2X3DA 1RT3B 2J9DA 4QR1A 2LEPA 3PY8A 1UW9A 1PYSB 4WXOA 3M8PA 3I87A 1X5SA 1S48A 3SCKE 4ZVUB 4IQXA 2CQHA 3MWBA 1YBTA 2FLLA 1CVJA 3N0VA 3MAAA 3OFGA 3R5AA 4CRJA 2FGCA 3DLKB 3I0SA 1A0OB 2MDAA 4KE5A 1NEEA 2EXUA 4DQSA 3HHNB 4GO5X 2V8GA 1S77D 1REGX 1YRXA 2ZD1B 1OY6A 1VK8A 4HLBA 2NZ4A 3VAJA 1LWCB 5IV3A 1RTIB 3PRVA 1U1RA 2RJZA 1HBOA 4R8UA 2MXYA 1HNXF 4DQPA 4KH1B 1AA1B 2E9RX 3PW0A 2DNMA 1KONA 2G9OA 2F8MA 2C3PA 3Q2SC 3QMQA 3A3NB 1LK5A 3N5FA 2RSQA 3WBZA 1CJKA 1IWAA 2J7KA 1U4BA 3THVA 2QN6B 3T6BA 2LFVA 1PG5B 1TL4A 3KK2B 3H5SA 2MLYA 2ATLA 2MHEA 4XK8C 2DNYA 2DD8S 3RB4A 2ZBPA 3AOAA 3CCES 4N8OA 2DR7A 2PEBA 3AY0A 1VBYA 4DV3F 3D6FB 5DGAA 2YWKA 1X4CA 3EZOA 4JI2J 4L6V3 4NLSA 4TN2A 3IWXA 4USKA 5IQQA 3UCZP 3P6YC 3EDQB 3OL7A 1IBMF 2BM0A 2OEJA 3FMWA 1PBAA 4UOHA 4UZCA 1D3WA 1CQMA 1P9QC 5KFVA 2ZC3A 4DUZJ 3GV8B 2ZVIA 1SUQA 1IKVA 3HHLC 3NGTA 3G8SA 3MI7X 1L3KA 2PIIA 5CYQA 2B43A 3RW7A 2R7QA 3FBFA 4RWWA 5T14A 2EFVA 2DHSA 2VL1A 2EVZA 4G1PA 4ER8A 1HIYA 5FLXY 4DPOA 2HMIA 4ILLA 2YTCA 3BF4A 1X4HA 1FD2A 1SQEA 1RUSA 3HT0A 4ZP9A 3GQCA 3V4IB 1T02A 1L3UA 1J27A 2VKZG 2UUAJ
chains in the Genus database with same CATH topology
1XR6A 4DL2A 3CSKA 5E5NA 4FBTA 2ZVSA 3M8RA 3HK2A 2UUCF 2YX4A 3BSCA 4X4OA 4X66F 1Q7LB 3KHHA 2O3DA 3MTKA 3GFYA 4MTPA 2HPUA 3RB6A 1R8BA 2KXNB 3CCUS 1IJEB 1GAOA 4XDCA 5LJ3Y 1M0SA 3IWLA 3NS5A 2MB0B 1LFWA 2IMOA 4H4KC 4Q44A 3DLEA 1UVNA 5FJ4A 3JSYA 2DNGA 1QSSA 2FUG9 3D1HA 1UFLA 4O44A 1K73T 1R8AA 1UVIA 1FK9A 2WB4A 3DN9A 2DHXA 3D5MA 1B0PA 4DS4A 3ISNC 4A46A 2O01C 2OAUA 1S6UA 2DR9A 2KO1A 2VODA 2MZQA 2VG6B 5F8IA 1Y5IB 4G3IA 3TA2A 5IT9Y 4FN5A 3HJFA 4IOAQ 5I3UB 2ADBA 2YNIB 1FEEA 5F8HA 4CNYA 1O0PA 3UE2A 2UUBF 1KS2A 4J5OA 5JXSA 4DL5A 1MMLA 2MQPA 1NJWA 4C4WA 4TY8B 3QJLA 2VPZB 3CCTA 1XK8A 4UW2A 3PX6A 4I2PA 2F3JA 3F73A 4KQZA 2FJXA 1QJHA 1ZAXA 4F4WA 1YJUA 5M2RA 2CVEA 2GA7A 1VS3A 2NLWA 4M1KA 2LCWA 4B08A 2YNGA 4PXBA 5KFJA 3VZIA 4LF6F 3BGRB 3DNCA 2ROPA 2J5AA 2C3OA 4YR0A 2KRBA 1R0AB 4J9MA 2QSWA 1BQNA 1SKRA 2AYMA 2Q43A 2X1BA 3CMES 4K4ZA 1HR0F 4GC6A 3QWPA 4RNOA 1RT6A 3QGIA 4D3HA 2R7UA 3RR7A 4O23A 5B0CA 3ENQA 3MTJA 5KFFA 2W8KA 1P8GA 2QZ8A 4H4OA 1RT7A 4QW9A 4BS2A 2IM2A 4QIEA 5IQ6A 1ZAVA 2MKKA 3HFKA 4DX8H 1RA7A 3O1LA 2W4CA 3C2PA 2R7XA 2A18A 2R7WA 1IQZA 2DVIA 2XY6A 4KB7A 1G1XA 4IKAA 5G0RB 3KLHB 3CXCR 3OFHA 1UEVA 3VZHA 3CCMS 5L8RC 3VTIA 1I1GA 4DL4A 1IKWB 3TANA 2DCUB 4LF7F 1WHWA 3H8YA 2KJWA 4URQU 2VC0A 1SL2A 4QWAA 3IXQA 4Q0BA 4QU7A 2AJ0A 3G8QA 4WFZA 2YKPA 3O2IA 4DR2F 4R5PA 5AXNA 3OHAA 1RKJA 1J5OA 2U1AA 1FDAA 1OSCA 2AJ4A 2AP6A 2LU2A 3MFHA 3KK3A 1PILA 3D1OA 2OTLS 3K57A 3CO9A 4FZVA 4WE1A 2HRYA 4ZKAA 4RWXA 3EUNA 4QWBA 3BDPA 1S9GA 1V3SA 1JLCA 4FNIA 3CULA 3HVAA 1ZPVA 3VAHA 3DOLB 3I6PA 2W25A 2M5YA 3D2WA 4DJBA 2SXLA 4B02A 1Q1KA 1HNVA 1VIXA 4X4SA 3Q23A 4TYAA 4C3LA 2XS2A 1QVGR 4F4ZA 2CDQA 4LSNB 3SSQA 2CPIA 1N48A 1UJ5A 3D54A 2LXFA 1N88A 4DMZA 2JOQA 2WBMA 1H7XA 3MM6A 1FKOB 1OSDA 3CD7A 4Y65A 2CPJA 4FPRA 1QY7A 2VZ9A 3VQTA 1PO6A 1VK3A 2D9OA 3TA1A 2VBXA 4KO0A 3TR5A 4OHWA 4I68A 3G96A 2R8JA 3H5XA 2K1RB 3ETOA 3HT3A 4DEZA 2GO8A 2J7UA 3CC4S 2AJQA 4ZCMA 5LMUF 4NXMF 5KG0A 4Q45A 4GO7X 3BGFA 1FJ7A 5CA5A 3T5KA 4CH7A 2VA3A 5L39A 4KIAA 1OO0B 4DR7F 1U47A 4E98A 3H4BA 3DRSB 5DS7A 4H4OB 4PG6A 3NAHA 4A4JA 2HHVA 3CCQS 5L1KA 1T7PA 1SB6A 3HLUA 1M5VC 3UQSA 5HP1B 2CJBA 3BS9A 4DLGA 3NAIA 5CZXA 2DT9A 3FNNA 5IXUA 4XPCA 3HMJG 2HGNA 4Y00A 4ZVFA 4E0DA 3OR1B 2W9BB 2V9KA 5J2QB 2B4OA 4ZDNA 1S1VB 4PXCA 4Q2LA 3O8WA 3QGPA 1JK9B 5CCLA 1QSLA 2M9KA 1ELOA 4QWEA 4RW7B 1KR4A 2KYXA 3DFEA 1C1CB 2I8EA 4V19X 1S1UA 4KJIA 3M1VB 1HPZB 1DTQB 2K3IA 2WSFC 3TVYA 4YMEA 2EBEA 4NMLA 3SDEA 3V5RA 4WFAQ 2NUHA 1S9GB 3QZ8A 2KH9A 2MZRA 4KT0C 1C0UB 3HVTB 2J0XA 1LK7A 3OL9A 5A6WA 2DNRA 2XG8A 5GAGI 5U47A 5DO2A 1B64A 3RBDA 2ZH9A 4K50A 2ZH4A 1SL1A 4U67Q 3QLHA 3UD3P 5KT6A 1TK0A 2FHJA 1DHMA 2AX1A 2DGTA 3UR0A 4PQUB 3OUYB 1TL3A 4HTJA 4R0JA 3E2EA 5K14B 2IC3B 3RRHA 3RRKA 2KJVA 2OD6A 4HL9A 2Z0GA 3GR1A 4ELVA 1KTQA 1TL5A 1TVRA 3DOMA 4OFZA 2RQ4A 2V8VA 2QV6A 4K4UA 2NS1B 3KK2A 2WOMA 5KFBA 1MNEA 3OVBA 2N82B 3CCJS 4KGKA 1OPZA 1TAQA 1T94A 4LUBA 5E33A 1NJXA 4CH1A 2YWHA 1S1TB 3AA8A 1TKZB 5BR8F 2HGMA 2WSEC 1B0TA 5E3PA 5B09A 1D1UA 3AHPA 4NLOA 1RDRA 4L72B 4CI0B 3CB4A 1FDDA 2I9SA 2IM0A 2ZH1A 2X51A 4K4XA 3FEXB 3CDWA 4X64F 3DDKA 2UUWA 3M32B 2O66A 3CD5A 1TKZA 1NH8A 4NYOA 4OLOA 2ZKUA 2GGPB 3BSAA 1Q8BA 2KRRA 4C3KA 2J9DE 5KT5A 3HM9A 4PG4A 4NA3A 1Y3JA 2DNZA 2XNRA 4Y6IA 2KI2A 5A8RB 3CC2S 3ENVA 4I0WA 2BR0A 1U6ZA 2VA2A 4TKTA 2MKIA 1FE4A 5FDLA 1SV5A 4AE5A 1SJ3P 3IR6B 3MM7A 3MECB 3CJKB 2M52A 3PW2A 1ZOTA 3UR3C 1S1VA 5K8MA 3Q0AA 3FQKA 5I3UA 5H9FJ 2BRKA 2YNIA 1M5HA 3H20A 5A8WA 5KG6A 1XEZA 3K59A 4NZ6A 4R0EA 1FTCA 3C3LA 1F5BA 3IRXB 1FKPA 2HAIA 1FJCA 2KFZA 2KG1A 3PZPA 2JEJA 2XWYA 5GVQA 4OJ1A 3VAIA 2CG4A 5KFMA 2UXBF 4BC9A 5CYMA 4EYHB 3U1LA 4O44B 2ZD1A 2HFZA 2R2TA 4ECXA 4IFVB 5HMWA 2YKAA 4N76A 2UVVA 2O67A 2WOMB 4MK7A 1C1BB 3ZZZA 3AJ2A 3DLGB 4KV8A 2XY7A 2L9WA 1YJTA 4HDHA 1X0FA 1U48A 1S97A 2R4FA 4A8SA 3TI0A 2ZITA 2OPQA 2XMMA 4F25A 1E6VA 1U25A 2XSJA 3HP6A 3M8QA 4WZQA 3OUYA 2GIQA 5DETA 2OTJS 4PQUA 4ELTA 1QM9A 3GIMA 4UQGA 1WHVA 1E6YA 2YNFB 3MF5A 3QWUA 5KFUA 1YRUA 3BEGB 3HO1A 1VIOA 3CDUA 2CKWA 1O51A 3JSMB 2R2SA 4MKAA 4C0HA 4ZVGA 5KFYA 4QBUA 5LSLA 1I6JA 3OTOF 3DLHA 2R7OA 4N5SA 4I6WA 3G8TA 3KLGA 3H5YA 1JX4A 3UCUP 5AJ3F 4NRTA 3MM7B 2KG0A 3V6KA 1SL0A 3B4MA 4BDPA 3SCJE 2VONA 1AFIA 5L1IA 1XERA 4ITSA 1S99A 4J9RA 4M5DA 5JVHQ 2HWHA 2KXFA 5BJRA 2DNKA 1S1XA 3MEKA 2VPYB 4JI0F 1U45A 4NA1A 2BZ2A 2RQCA 5GADI 3MMAA 1G7CB 2IM3A 2HQ3A 3ONQA 4NLRA 2OKQA 3UFCX 4OX9F 4O3RA 2XCAA 3AAWB 2M8DB 3QZ7A 3T9ZA 2JC1A 1TR0A 2HVIA 3IG1A 2BJEA 4PPZA 4YDDB 2D3OR 4RU9A 1N36F 1ZETA 2XGPA 2HQIA 3RB3A 2FVPA 5EX3A 3OHBA 2I5JA 4FNHA 2YQ3A 2YKQA 3MR3A 3GV5B 1VBXA 4Q0BB 2Q1LA 2F9JA 4K4WA 1CG2A 2E9TA 4MYTA 1U09A 1FA0A 2VKRA 3J7YU 4DV0F 4PG8A 1TL1A 4TQRA 4ED7A 1IKXA 2MPUA 3IBWA 4Y3CA 5AXKA 1T8EA 1RTDB 2OPSA 4DR4F 2J9EA 1GH8A 3R5DA 2XULA 3CJ2A 1SJFA 3ENWA 1VQNS 3NCRA 4ZPWR 4LFBF 2CQPA 3V2UC 2ZH5A 1CLFA 3DOLA 2M2BA 3LW5C 1OQ3A 4RW9A 5T7LB 1YJVA 1FD8A 4ECYA 1HI8A 4M94A 1D9DA 3LP2A 2I1RA 4MH8A 1W2BR 3ZZTA 2WBRA 5AXLA 3ITHB 1CEZA 2RQMA 3L7PA 4OZJA 4MJKA 1H0HB 3LO3A 4C8YA 2GMHA 5C42A 7FDRA 3RAMA 1VQ4S 2MKJA 4F3MA 4F4YA 1M5KC 1IQTA 2N4DA 3G6ES 3C6UA 3TARA 1R0AA 1SUQB 1YWXA 4UQTA 1IBLF 1N5SA 2VPXB 4MK9A 5BYQA 2KN4A 3PRBA 1N34F 1GXLA 2YNHA 2CPDA 4P7TA 2HLUA 4IRCA 1HBMB 1TKXA 2D3ZA 3CCVS 1QUVA 2CPEA 4LT6A 4I2PB 3JTNA 3G6VA 3F44A 2XZWA 1S0MA 3T1HF 4WTYA 4I6YA 3MR6A 2KT3A 4ECUA 2WTFA 5J2QA 4Q8FA 2W4DA 1A9NB 2FJBB 3J81Y 5HI7A 1JJ2R 4EO8A 1WF2A 2OJ3A 4UY8T 2NSBA 2IYIA 4OZNA 3ULHA 4ICLB 2AGQA 2PD1A 1HMVB 2RDIA 5JUMA 5KFKA 3HPOA 1DQ8A 2VQFF 1FESA 1TFWA 3POTA 4DG1A 2DH7A 2D9PA 3MEDB 3AH6A 1ZM3A 2IBKA 2B7CB 3M2RB 3O3LA 4A8MP 1QAIA 3N4WA 3O6QA 4XDDA 2IHR1 5KFOA 4A8KA 1U1QA 2R7TA 1ZZFA 3MEDA 1S9EA 4QYRA 3C66A 3A8EA 4WU2A 1D0EA 4IDKA 1S1WB 2ERRA 1VQ6S 4I67A 4C9DA 4NLDA 2ZFHA 3C6UB 2F40A 1PC5A 2M4MA 3M4XA 4I7FB 3J80Y 1IR0A 2JL9A 1U24A 1FRIA 3B4DA 2XY5A 3MUTP 1GXTA 2ZJPQ 3T6JA 2C2EA 5KT2A 4Y34A 1S1WA 4OI2A 3LP2B 5AE2A 4U9RA 4JV5F 2BBEA 4CO5A 4K4YA 3UD4P 4FF3A 4X65F 2DNQA 4J37A 2VQEF 1S6QA 3VF0B 4DL7A 3GFXA 2ZH8A 3OXLA 4PR6A 3KKFA 2RU9A 1HQEB 5F3TA 1OWXA 4TY8A 3E3XA 2GHVC 3NRBA 1XR5A 1MWZA 2VUGA 2DGQA 1DZ5A 2FLNA 2HWIA 1QAXA 1WACA 5K5MA 1M5PC 4DQQA 5A0YB 1KN6A 2FJAB 3O44A 3TQ1A 3AB2B 4YP3A 1QSYA 1UEUA 3HX9A 4LFCF 3QAUA 3UDLA 1IUJA 2XNQA 2HS0A 1XMOF 1HI0P 3QJPA 3QGHA 2ASYA 2RS8A 3S7RA 3KHGA 3BM7A 1UVMA 2B3TB 2GIRA 4EWTA 4GMKA 2OMLA 1LFPA 5F8LA 3VR1A 1S0NA 4ZA1A 1N6QA 3OVSA 5D4NA 4R25A 3EZUA 5HL7Q 1ROFA 1A6LA 2CQ4A 2WHOA 1DLOB 1V9OA 2YNHB 3ISND 3O5TB 5A8RA 2E1MC 2V5HG 1HL6A 4LFAF 1S4FA 5CCMA 3A1YG 2Y1JA 2FHKA 3E01B 2ZDPA 2QLXA 4LIRA 4JI2F 3T5HA 2HYIB 4A8QA 1MU2A 3LF0A 3SSRA 3TUIC 4ED0A 2VG5A 1VQLS 2RH3A 2UVUA 4R5PB 1OQ6A 1FK9B 4LMZA 1JLGA 1FXDA 5DG9A 3V6DB 1S9EB 2FDNA 4DSJA 2RB7A 2FTRA 2K8GA 3CCWA 4OQJA 1ULRA 4CTAB 2F9DA 1FDBA 2GQ2A 2GJ2A 2JZ5A 2XMUA 4HEA9 4IG0B 5EWEA 3SV3A 2HHWA 2OO4A 4K0KF 1ZM2A 4O0IA 1S72S 2RT3A 4DV6F 4WFNQ 4NCBA 3Q8RB 3DLGA 3MM8B 2O1PA 1TL3B 2B9YA 4LJMA 1S6QB 1S7HA 5KFNA 2RD5C 4CCHA 5HN0A 5I42B 3GFHA 1SJ4P 1UA0A 1RTIA 4G1QA 2DPIA 3DMJA 5D4LA 4RUAA 4BHQA 2V4JB 2VASA 1BQNB 4M8LA 5CYQB 2DH9A 2HFOA 1CC7A 4N41A 2I2YA 3IO1A 4ID8A 3V6HA 1Q78A 2NREA 2BDPA 2YVSA 2N3OA 2VFTA 2AYBA 1RGVA 2J9CA 4RNHA 1VC6A 2HNDA 1BQXA 2AF6A 5H9EJ 2XO7A 2CQ2A 4OJHA 4P6QA 3KLFB 5EUHA 4Y2KA 2JEGA 2WK4A 5MAOA 5KFRA 2P9EA 4NLWA 1MROA 4IR1A 3JTOA 2WRMA 2HMIB 3CJ5A 1K1SA 1IXKA 3OBIA 2Z4PA 3J7ZT 1HHSA 1MW7A 3SSSA 1MMDA 2HLTA 4Q7AA 4EFAC 3HXMA 1APSA 4I2QA 2Z2MA 1H2VZ 1T95A 3PV8A 3DHWC 3KHRA 3Q2TC 4K4VA 4ZCKA 2HHUA 1NK6A 2JJ4D 2WONA 1FTRA 2KTQA 1P6TA 2RKIA 3M8PB 2FVCA 2CQCA 2FHJD 4HHJA 4H4MA 3MM9B 4OLPA 4PPDA 1N4LA 5CXTA 4JI7F 1XMQF 1YIJS 1C1BA 4CTAA 3QAEA 5K14A 2ZHBA 3M05A 2IRUA 5FD1A 2ILYA 1LXJA 3KLGB 4RW8B 3OLBA 5L1LA 3PW7A 4U7CA 4H54A 4QCLA 2LKZA 5IT4A 1LWCA 4UUXA 4FS1A 3ZZUA 5HROB 2M88A 4I7FA 1HNIB 1MU2B 1MSWD 3KMSA 3ITHA 4DF4A 4DFJA 2J6TA 3NBPA 2E7WA 4QR2A 3M9OB 2QA4S 2O5DA 1XWLA 4K5RA 3R1HA 4FS2A 2KT5A 1RT5A