2AYEA

Crystal structure of the unliganded e2 dna binding domain from hpv6a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
SATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein E2
publication title The recognition of local DNA conformation by the human papillomavirus type 6 E2 protein.
pubmed doi rcsb
source organism Human papillomavirus type 6a
molecule tags Transcription
total genus 19
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ayeA00
4CH0S 3NMRA 4IUFA 2JVOA 1YITS 1DHMA 2U2FA 3B4DA 1OO0B 2XB2D 2DIUA 1X5TA 2DNZA 1OPIA 2FC8A 3CTRA 2OSQA 2VOOA 5LSLA 3CCMS 2DK2A 5JVHQ 2E44A 4RU2A 2DB1A 2RQ4A 4TU9A 1WHVA 2MQMA 1F9FA 2KH9A 2DNNA 2HGLA 1U6BA 1X0FA 3NS5A 3CULA 3CCQS 2KI2A 1YWXA 2MGZB 3Q2TC 2DNKA 2M8DB 5IM0B 5DM6Q 2MJNA 1X4FA 3I56S 2L08A 1NU4A 2MKHA 2YH0A 2DNLA 3CCSS 1RK8A 2DNMA 3CC7S 2DGUA 4F25A 2N7CA 3MUTP 2K3KA 2KYXA 2VONA 1U2FA 2N82B 2KHCA 3H2VE 1W2BR 2DH7A 3MOJB 2DNGA 3G96A 4TU7A 2MZRA 2MJUA 1YJ9S 4P6QA 3HHNB 5LJ3Y 2DGSA 2OIHA 2UP1A 2DGQA 1VQLS 1H2UX 1WTBA 2HVZA 1FHTA 2J8AA 1B7FA 3HI9A 4LMZA 2E5HA 5D78A 1HL6A 2FHOB 2DNHA 2CQHA 3PIPQ 1JJ4A 1WF2A 1U1LA 4ZKAA 5HL7Q 1X5OA 2MMYA 2YKAA 1H2VZ 3MUVP 2CQPA 3G8TA 1OWXA 2DGTA 2I38A 2MB0B 1VQ5S 3OW2R 2MY8A 1FT8A 1FXLA 2HGMA 2LA6A 1UP1A 2JRSA 2SXLA 4U67Q 3MUMP 2MKCA 4FXVA 4ERDA 2LA4A 2DGWA 2DHGA 4Y00A 4IOCQ 3IRWP 1M90T 3Q2SC 4V19X 1KC8T 1ZZNA 1HA1A 4PKDB 2RRBA 5LJ5Y 2DGOA 2DNQA 1P1TA 2LCWA 3CCJS 5CYJA 2HZCA 4YB1P 1YJWS 3BS9A 2KVIA 1H2TZ 2KXHA 3SDEB 2KU7A 2N3LA 1CVJA 2X1BA 1UAWA 4Z2XA 5GADU 4WFAQ 2DHXA 2K8GA 1RKJA 1U1RA 1VC5A 2JVRA 4OZ1A 1YHQS 2F3JA 2EK6A 2E5GA 3G8SA 2Q79A 2DH9A 1VC6A 2HYIB 2VODA 3ZZZA 3RW7A 1VQMS 5GAHU 3BO3A 4IO9Q 5IFMA 4C4WA 1VQKS 1X4EA 2DHSA 4C0OC 1K8AT 2M88A 2KFYA 2DO4A 3UD4P 2OTLS 2KXFA 3CCVS 1HD1A 3VAIA 1VQ7S 3EGZA 1QVFR 4M5DB 1U1NA 1X5SA 2E5IA 2I2YA 1WHWA 5GAGU 3CC2S 3BO4A 2QA4S 2N3OA 5DDPC 3LQVA 5JVGQ 2XSFA 3US5A 3D2WA 4PR6A 3VF0B 2MQQA 2RQCA 2CPEA 1FJEB 4TLQA 1Q82T 4CQ1A 2DNOA 2EK1A 2A3JA 2OJ3A 2RT3A 2JX2A 2M0GB 1NO8A 3THPA 1DBDA 3VAKA 2ADBA 3S7RA 2X1GA 3RW6A 1U1OA 1VBYA 4WFNQ 5LXYA 2RRAA 1WHYA 1X4AA 1G2EA 4CH1A 3MXHP 1SJ4P 2MKSA 3UWTA 4QU7A 1KOHA 1M5OC 3MD3A 2MHNA 1JMTA 1Q7YT 1FJ7A 3R27A 1YTYA 1K73T 4LIRA 3SMZA 1OIAA 1PO6A 1X4HA 2L9WA 2DNYA 2CQ3A 2MQNA 4J5OA 3UCUP 2VOPA 3CMES 1Q86T 2YH1A 5DM7Q 2LECA 3SXLA 2F9JA 5LSOA 3CD6S 2MZTA 5DDOC 5H1SV 3I55S 2AYMA 2MKIA 4IOAQ 2E5JA 2GHPA 2MQOA 1L3KA 2ERRA 4F02A 3TP2A 3JB9k 1QVGR 4LJMA 1WG1A 4YOEA 2M4MA 2KRBA 4W90B 2KXNB 2MPUA 1X5PA 1VQ8S 3N9UC 3CCES 2ZJPQ 2D9PA 1S72S 3MD1A 5DDQC 1IQTA 1WF1A 3UCZP 4W92B 3P6YC 2CQGA 2LXUA 4UY8T 2YWKA 1WELA 1FJCA 1URNA 1AUDA 2KT5A 2CJKA 3B4MA 2MXYA 3S8SA 2ZJQQ 1X4CA 3L3CA 1SJ3P 1M5VC 1WHXA 2LQ5A 2U1AA 1U1PA 1U1QA 2DGXA 5EN1A 4F26A 2QEXS 4QPTA 2M70A 2LYVA 3G4SS 3CCUS 4WKRA 1VQ6S 1WEXA 2FPHX 2LXIA 2KM8B 3J7YU 2CPXA 3ULHA 1VQPS 1JJHA 1UW4A 3EX7B 1U1MA 5BJRA 1U1KA 2MGZA 4ED5A 2M8HA 1D8ZA 1WWHA 1M5KC 2AYEA 5IM0A 2MKJA 2DISA 1VQ4S 2J76E 1HD0A 4YUDA 1VQNS 1VBZA 3PIOQ 3G6ES 2CPJA 2JWNA 3BEGB 1M5PC 2LEBA 4PRFA 3R1LA 2AYBA 2OSRA 3FEXB 2DO0A 2XS2A 3DLLQ 2MZ1A 2M52A 5HO4A 3IWNC 5MLCV 2M2BA 3CUNA 1WG4A 2CQBA 2B0GA 5IQQA 2M7SA 2DHAA 1A7GE 3V4MA 5D77A 2LMIA 4A8XA 2ADCA 2NZ4A 2CQ1A 3CPWR 3EGNA 2CPZA 2LKZA 4WCEQ 2M9KA 1H6KX 2MKKA 2CQ2A 1QM9A 3U1LA 4WFBQ 2FY1A 4UQTA 2J0SD 2XNQA 5CXTA 3MDFA 1VBXA 1YJNS 3VAHA 4TU8A 3VAGA 1A9NB 2AYGA 3CCRS 2D3OR 2DGVA 2MYFA 3NNAA 1XN9A 2EVZA 3CC4S 1K9MT 3MURP 2KRRA 1KQSR 1R8HA 5DDRC 2RNEA 2MQLA 1VQ9S 3K0JA 3S01A 2CPHA 1X4BA 3CXCR 4WF9Q 1VC0A 1WG5A 2CPIA 2KG0A 1YIJS 1DRZA 1X4DA 3BO2A 2YTCA 1YI2S 2MZJA 2XNRA 2RS2A 1JJ2R 3CCLS 3CF5Q 1SJFA 2KG1A 3G71S 2LEAA 2CPDA 2O3DA 1DZ5A 2ZJRQ 4WIIA 1WEZA 4C7QA 3VAJA 3SDEA 3TO8A 2RS8A 3VAFA 2CQ0A 2V94A 5DETA 3UD3P 2OTJS 4Y0FA 3VALA 3G9CA 2J0QD 3ZZYA 3P3DA 1O0PA 1S79A 1R8PA 3LPYA 2BZ2A 5CA5A 4CIOA 2XS5A 5GAEU 2PE8A 1PGZA 1M1KT 1FNXH 2CQIA 3NNHA 4EGLA 1KOOA 3S6EA 4QQBA 1N54B 1ZZFA 1WEYA 2AD9A 3VAMA 2CQ4A 1N52B 2G0CA 2MQPA 1SXLA 2QFJA 1Q81T 3TYTA 1WI6A 1WI8A 2KM8C 1ZH5A 5GVQA 2L41A 1N8RT 2CQDA 2DITA 1UFWA 2CPYA 2DIVA 2MY7A 1N88A 2RUGA 2BOPA 5ITHA 2WBRA 2DH8A 1NJIT 1KD1T 3P5TL 3MI7X 2DNPA 2MZQA 3P49B 1U6FA 3NS6A 2HGNA 3CMAS 1SJQA 2G4BA 2KN4A 2MSTA 2RU3A 3R1HA 1FO1A 2MZSA 3THTA 2GO9A 4QU6A 2F9DA 2G1DA 2FC9A 4FXWA 3DXBA 3U1MA 2RVJA 3UCGA 3NNCA 4OZ0A 2XS7A 1SJRA 4BS2A 2NLWA 1VQOS 2X1AA 2CQCA 2DNRA 1X4GA 5GMKa 2D9OA 2CPFA 3J7ZT 3UE2A 2X1FA 2PEHA 5FJ4A 1BY9A 3FEYB 2MSSA 3H2UB 5LXRA 1P27B 1D9AA 1WF0A
chains in the Genus database with same CATH superfamily
1RYSA 4B9NA 1CJKA 4K59A 1LWEA 2I0XA 3CCMS 3M2UB 2WOMB 2KH9A 4ZPDA 3FEZA 1VLYA 1XNQJ 2JOQA 2L9NA 2E5LJ 2AJ4A 2DR7A 1RT5B 4B9LA 5KFOA 1RT3B 2GJIA 4TY8B 2DY9A 4DSFA 5DLFA 4X4SA 5SUHA 4NLSA 3HSZA 2HVHA 2N7CA 2N82B 1J5OB 2HURA 3JXOA 2DH7A 2ZITA 1CULA 3NXZA 2DRDA 2C2DA 1YJ9S 4R5PB 1QJHA 2VJUA 2W7PA 3HI9A 3ZTPA 4RNFA 4LMZA 4JOUA 4O44B 2FHOB 4O3SA 1HHTP 2CWKA 1CC8A 1JJ4A 5HL7Q 1WC0A 3RUBL 4DV6J 3PKYA 3IM8A 1UP1A 1D9FA 2V8HA 2DGWA 2J9DE 1KP6A 3OFEA 3MM7A 2K1RB 3A13A 1EKRA 4PKDB 2DGOA 3BGRB 1Q78A 3HVWA 1UL3A 1SC6A 4LFCF 1CG2A 3A8IA 3AHPA 1GMWD 5KFNA 4OI4A 2RHQB 4QJVA 2HHPA 1WOOA 1UVNA 2R3VA 4K7QA 4RBTA 2HYIB 4I1TA 4YHHF 1QDUB 3BR8A 4DX6A 5ETOA 4WBFA 1NK4A 2O66A 4UQGA 4I6WA 5L1LA 5CQGA 2AGOA 3BO4A 5AXNA 4FKXA 4ZPCA 1Q5YA 2LQJA 2FJEB 2WONA 2ADBA 3GWCA 3P45B 1NSKL 4DL4A 1RHJB 3AOBA 2YBVA 4GVBB 2EFVA 5CAAA 3MD3A 3DRRA 1SQEA 2J9CA 5RUBA 1C0TB 3BV8A 3C19A 2B4PA 2PN6A 4QPXA 3OV7A 4ELUA 2WVFA 2ZUAA 2FHJD 3MM5A 1LQ9A 4B3SJ 5L1IA 1RAAB 3AD7C 4WYLA 4F02A 3C8YA 5I3QA 4LJMA 4YOEA 2M4MA 4X84A 1RUSA 4IFYA 3ZTQA 3E2EA 4KYZA 2RIJA 4OJ1A 3K7RA 2CQGA 2LQ8A 5I42B 3B4MA 3PJXA 1KKHA 1JLEB 1DQ8A 1PCAA 4EBEA 4IRDA 2DCUB 3WQPA 4P2SA 4HKQA 2CAJA 2XWYA 2DJWA 4KB7A 4RUCA 1UW4A 2DTJA 1U8SA 4EO8A 2Z2LA 3AD9C 1RWMB 2FVCA 2IM2A 1S1TB 3N6LA 2HRUA 4CO0A 2CPJA 2VQEJ 4KFBB 1S10A 2CJYB 1JJCB 1RTDA 2M52A 1SC3B 4ANCA 3KJVB 3EDQB 2DT9A 4UUWA 4R8UA 4TVAB 5HATA 4C0HA 1M5SA 3A8JA 1NLKL 3EGNA 3M30A 4WP8A 2GQQA 2PD1A 1KFDA 4A8WA 3GJQB 4LF1A 2IPOB 1FRKA 2F8MA 1R8HA 4RW4B 4JI5J 4F50A 2Z4PA 3CD5A 4J9QA 3BN7A 3AB2B 3DOMB 4WF9Q 5BYSA 1X4DA 3ILLA 1G4CA 4MKVA 2Q1LA 1RAIB 4HHUA 1DZ5A 1DLOB 2HIQA 4N76A 3VAFA 4UOFA 3QLHA 5J1EB 4Y0FA 3VALA 2FDNA 2N4CA 1URRA 3V6HA 3OFHA 1PGZA 2NR0A 3KWMA 3MM6A 2JL9A 1RLCL 2CQ4A 3TAMA 2QSWA 2UUTA 3NOGA 4B9MA 3TVYA 1OS5A 1RYRA 4ZP6A 2HGNA 1C0UB 1KTVA 4DN0A 2XMUA 4CDIA 1S6QA 5KG4A 1CLFA 3MCMA 4BC9A 2X1FA 2E1AA 4P7VA 4JI4J 1LK7A 3BSNA 3CJ0A 2JVOA 2YQ3A 1YDLA 4TYAA 4UT4A 1WC1A 2E1MC 5K8MA 4PWWA 3KOAA 2V63A 4QYZJ 2EFNA 2APOA 2G2YA 1I6JA 2A10A 1XR7A 4JI8J 1YWXA 2M8DB 5D0EA 4FF1A 4IH5A 5HMYA 1X4FA 3I56S 2MKHA 4OI3A 1DTTB 2H54B 1R0CB 3CJ8A 2EC0A 1NK0A 2QMWA 3A12A 1KHVA 2JC1A 1S1VA 3FZ2A 2ROPA 3F0NA 1TK0A 2Z0GA 2IFXA 2VKRA 1FRXA 4QIGA 3I4PA 3AOAA 3TA1A 3G8TA 1VRQC 4OYIA 1X8DA 3WIUA 4K4YA 3BGLA 5C25A 2AQ4A 5DG9A 2RILA 5F8IA 5C7PA 1RT7A 3LF0A 3IRWP 3C6TA 1S99A 2RRBA 4A4JA 1TFWA 5CYJA 2ZBPA 2XMWA 3LP2B 3HHDA 2ZOFA 1N0VC 4JYAJ 2KU7A 3Q0AA 3HHLD 2RDIA 3BDEA 3KLGB 4KKOA 2O1PA 4C97A 1TKZA 3Q83A 3T5HA 3G8SA 1S1XB 2HHUA 1RWNB 2UUBF 1PAUB 2IRYA 2RUSA 2ZC3A 5J1NA 3BO3A 3N0VA 2GAHC 4K4VA 1KVJA 3BSCA 5JMNA 4DUZJ 2V68A 4ZVGA 5KG2A 3C3LA 5JXSA 2JFDA 3JS9A 4XDCA 2WSFC 4RJVA 1IR0A 1FI4A 2Q6BA 2QA4S 5BXIA 2XSFA 4PR6A 3KUHA 2MQQA 2CNKB 1NK7A 2AX1A 4JI6J 1ZTWA 1F3FA 2RT3A 1O6XA 2CJBA 2ZH4A 5LSRA 4L3KA 4YDXA 4B3SF 3LP0A 1RWOB 2NYIA 5LM7E 1Q7YT 3RGIA 5E2QA 5KFQA 1RU2A 1K73T 2VC0A 1CJKB 4Q5VA 4JI0F 1LWEB 2OELA 3AB4B 3EDRB 1T9VA 3I55S 3A8KA 2GHPA 1JLGA 2HRYA 2RDJA 8AT1B 2BKOA 3PCOB 5HANA 2C22A 2IMOA 4LRBA 3BPDA 4NZ7A 1GEHA 3QWPA 2HZAA 1WELA 4B17A 1URNA 2Z2MA 1AUDA 4FF3A 1XR5A 1CULB 2GQCA 3H40A 1B0VA 5KT4A 1X4CA 2W25A 2LQ5A 2MLZA 5HMWA 1KQKA 2VG7A 3K5LA 2Z58B 1VQPS 4MFBA 2CJXB 4X4UA 4NXMJ 1HQEA 3FCWA 2ABYA 3VR1A 5KT6A 1H74A 3MM7B 3JSBA 2JWNA 5EX3A 5F8NA 2OEJA 1HBMA 5B7WA 3HT3A 5KFYA 3M6WA 3CE8A 3CPWR 1Y10A 2CPZA 2EBEA 1QM9A 3B82A 4I7FA 2FY1A 1C1CA 4ZPTR 3MDFA 1YJNS 4ED3A 5DJBA 3RBXA 4A46A 3H5YA 4F2RA 2KRRA 2LQ9A 1GNKA 3TAQA 1TK5A 3KMSA 4HACA 5CYMA 1ULRA 3IC1A 1XMBA 3OJUA 2QYGA 4Z37A 2YTCA 2B3TB 4FVMA 2LEAA 1RABB 3TANA 3JYTA 3JAMU 3UD3P 2WONB 1O0PA 3W5YA 2RHSB 3GYXB 2C3OA 2VG6A 4NPOA 3ADAC 3CO0P 3DRRB 5BYQA 4ENOA 1UA0A 1NJZA 2KKHA 1U2RA 3SSRA 3AA8A 1JLFA 2V2QA 1WI8A 2D74B 1N33J 4ZIVA 3UN3A 3NBPA 3MM5B 3ZXWA 2E29A 3W62A 2QIFA 3DXBA 1ZTTA 1SJRA 2PT0A 4EUVA 3ICLA 4IFYB 2X1AA 5K8OA 2LXFA 3QAUA 1VQOS 2UUCJ 3TW0A 2DNRA 4KO0A 4NZ0A 4Y28C 4WZMA 4JBCA 1EHWA 3J81U 1TP7A 5GMEA 2ZOMA 2GMHA 2DNZA 3PHEA 4YB6A 2ZZMA 1OQ3A 2YQ0A 4TLRA 3CCQS 4N47A 4KGMA 4B3OA 4ZK7M 2NXJA 3BSAA 3QGHA 2DNLA 2DVIA 4DV5J 2NZCA 4F25A 2V8VA 3QZ7A 2D3UA 2XO6A 2W2QP 1MLAA 4R8UB 1MU2A 2G1HA 3Q8RB 3KK1A 4B02A 1FHTA 1SH0A 2LU2A 3M30B 2D69A 2R7QA 2YKAA 1H2VZ 2EWHA 2W4PA 4MK9A 4WP3A 2UZAA 4B3MF 2IJRA 4DX5A 1HW9A 2BABA 1TL4A 1MMDA 4Y00A 3FDSA 1BWEA 1HA1A 2CUYA 3MHYA 2HZCA 4YB1P 1YJWS 4FS2A 4DPYA 2KHDA 2BDPA 5KFGA 2XYHB 3DRPA 3QLHB 2FIUA 5L1KA 2F3JA 1YZ6A 4M5LA 4FYWB 4LF7J 1V5IB 9RUBA 1SL0A 4C8OA 2DHSA 3K5PA 4C0OC 4NRTA 2OTLS 3CCVS 1GQEA 4Q2LA 4NE9C 1ZYQA 3BREA 3RB6A 3ZZRA 1S6QB 3VAKA 2ZZTA 5KFBA 3S7RA 5KFUA 1X9WA 1U1OA 5D6GA 3AJDA 5SZTA 1MWYA 2RH3A 2B51A 4JI2F 4JI7J 2NREA 4YQWA 3W9JA 1SUQA 4ZPAA 2LFVA 1W2IA 1T03A 2A2DA 4C48A 4J9MA 5KFIA 1E6VA 3TAPA 4F3MA 1JLQB 2AIRB 1KHWA 4O4GA 3FC9A 1KVIA 3PHTA 3KUGA 2AX0A 4C2MA 2Z56B 1HWIA 5IXUA 2Y3YA 4UY8T 2YWKA 1RXOB 2XQCA 2YX7A 4ED4A 3T19A 3S8SA 4D3GA 1S1VB 2EI5A 3KTQA 2COLA 4DDFA 1TAQA 2HWIA 2W9CA 1LWCA 4U8VA 3T6JA 1JJHA 1CJVA 1UA1A 2M8HA 1S9FA 3Q8QB 3JTNA 2Q3PA 2OPSA 4P9SA 1FKAF 2Y1LB 5C25B 2YQ1A 4OHXA 2R8HA 1RT7B 1ZAXA 2LEBA 4GC6A 3C6TB 1TKTA 3P96A 1UEUA 2HW3A 2FJXA 3R3TA 1XR6A 4DR4F 1YJVA 2IBOA 3M8YA 1SJ1A 2ZBRA 3MMCA 5HP1A 1TELA 1I5OB 2BE9B 2XGPA 5D77A 1HNIA 3DLGA 1UVLA 3ILOA 4CNYA 1XIQA 4AD6A 1TKZB 1QY7A 2HNDA 5DO2A 1RP5A 4NYPA 3S01A 4ED0A 3TNVA 2ZM6J 4H4MA 3N28A 1EKSA 2F4VJ 3JAMY 5C42A 3CCLS 2RF2A 2GQ2A 3U02A 2MLYA 2CPDA 3VAJA 3T1AA 4HTJA 3LP1A 2V94A 3PEHA 1HMVB 3ZTRA 3ZZYA 2R8GA 4WKYA 1P9QC 1LW2A 3D0HE 2XS5A 1HNXF 3I9V9 4CWBA 3LP0B 3S6EA 2HQCA 3GJRB 2F4FA 1FFGB 3LTOA 2HIYA 4TQRA 4CT8A 1SIZA 1XMOJ 2RDDA 2VDHA 4DR6F 2H9ZA 3J7A1 5GVQA 1YRUA 3D66A 2DITA 1UFWA 4A8QA 3HHEA 4F0MA 1KD1T 2JC0A 5IZHA 1JWWA 3TI0A 2G4BA 1JLGB 3NS7B 2BJDA 4NLOA 3K89A 1NK8A 5A2QU 2RJZA 3BGFA 1KEKA 3J81Y 2AT1B 1FEEA 3KG4A 3ZTOA 1HWLA 2YY3A 4R0JA 4OYZA 3C6UA 1L5UA 2VBWA 5DGBA 1K1QA 3W7BA 1O8BA 3DM2A 2FC8A 4DJBA 2XLKA 4ITSA 3HX9A 3EZOA 4KRWA 4MFBB 2OPRA 2PEBA 1YRXA 4CLZA 2B4VA 2CJ9A 4HLBA 3N79A 5G4DA 1SL2A 1KQGB 1CC7A 4YP3A 1HQEB 2BVZA 4IQXA 5DRKA 4K4WA 4NLGA 4DPOA 2AZ1A 1IKWB 3KXDA 2AMCB 2J9DA 3G96A 4F4XA 1HBMB 3TVKA 2EFPA 4FYVB 3ZTSA 1Q53A 5HN0A 1YJ7A 3KYLA 1BLUA 2QX0A 5KFZA 1J5EF 4I7FB 1C1CB 4KHMA 4ZVEA 4G3IA 2VU5A 3MR2A 1QAJA 1U1LA 4X65F 4KPYA 2MMYA 3OQ2A 3Q22A 3HF5A 5B0CA 4FYXB 2DEIA 4HACB 3RRHA 3PEJA 5CYMB 1UETA 3O5TB 5ADZA 4NXNF 5KFFA 3AA9A 5HROA 2V69A 2LCWA 4J9VA 1AZSA 3SEOA 2BJ1A 1T95A 3Q86A 1RAFB 5U47A 3OXLA 1TKXA 1UVKA 1GMVA 3JYTB 4IDKA 4I64A 1S0VA 2XZWA 4KGXB 2VBZA 3GFHA 2EK6A 1NBEB 2HHHJ 1S12A 4XO0A 4A8FA 3JSYA 2VG6B 1MNEA 4K50A 3M9OB 4QIVA 1JXVA 2AJ2A 2UXCJ 1JLFB 1GMWA 4ZCIA 3VZHA 3P4UB 1PSDA 3KHLA 4ZVRB 3NBPB 4URQU 4UZCA 1U6ZA 3AQOA 2JLEA 1R0AA 4H4KA 3B6BA 4DU7A 1YRTA 3D6TB 4IR1A 3RZAA 5IT0A 1I51B 3QBCA 2OJ3A 4ZPBA 1HARA 4KO0B 2LEPA 3WBZA 1VBYA 4DOZA 4ECQA 1GTHA 1NDPA 1GK8A 4L73A 1WC5A 3J7Z5 3CMES 3QFHA 3OVSA 4HR2A 4X64J 4Y2MA 4AQYF 2BA9A 3QJJA 2HNZB 3GLJA 3EPIA 1UW9A 1IBKJ 1C2PA 4DLGA 4B3OB 5L8RC 3N9UC 3GR0A 1B4SA 4M63A 2KJVA 3UD5A 1WF1A 6FDRA 1R43A 2DRAA 1XERA 2FHJA 3K59A 1SJ3P 1J27A 4YFUA 3KK1B 2W4DA 2D3O1 1VCTA 4JI1F 1X9SA 2ILYA 2R8IA 3ENAA 3JQKA 2LXIA 2KM8B 2BXJA 4DR2F 4DX8H 1AROP 4USMA 4DR1F 3DI6A 2FQQB 1NM2A 3N4WA 3OTOJ 4FP9A 2GIFA 3POTA 3BEGB 3IG1A 2IMWP 2FD2A 1RCXB 4ETXA 4C11A 2XSJA 2CWXA 4LFAF 4OX9F 1T9UA 1IBMF 5KOXA 1PYSB 4DSIA 1UJ4A 1FD2A 4Y2CA 3D5MA 4DFMA 5AJ3J 4UZBA 4DR5J 3KK3A 1WC6A 2DGVA 2H3EB 3JTOA 1RAJA 2B8PA 2RNEA 2I9SA 2UXDF 3NWGA 3TOQA 2H1YA 2FY8A 2KG0A 3BQ1A 1WC3A 4HT5A 1OQ6A 1X9MA 5L1JA 3G71S 4EBCA 4RO0A 1Q8IA 1B3TA 3UR0A 4N5SA 3RAXA 3FFIA 4DFPA 1XMOF 5B0EA 2VG5A 1R8PA 2NXUA 4LF6F 2V9WA 5H9FK 2VL1A 3KLVA 2JH3A 1RAHB 1FERA 2CNLB 3MMBA 4NOHA 4A8KA 4I6AA 1SUQB 4XK8C 2F1FA 3NGTA 1T03B 4NCGB 5A2QY 4A8OA 2DH8A 3MI7X 2MZQA 4A8MP 1E6VB 1SJQA 1FO1A 2W2PP 1W25A 4O4GB 3PW7A 5E3AA 4GC7A 2C42A 3BDPA 2UUWA 2PEHA 5F9NA 3TUJC 1FXDA 3FEYB 1HFEL 3GONA 2BQ3A 4ZLJA 3BM7A 1YITS 4USWA 1N34F 4FF2A 3MAQA 2OSQA 4FYYB 2W9CB 2A6OA 5KT2A 4ZMMA 1LWCB 4J9RA 3FBFA 1CJVB 1YKWA 2V0NA 2AGQA 2FJBB 4ZA1A 4PPZA 4U8YA 2OPSB 5B09A 4NWBA 1IJEB 2OPPA 3D6HB 1EB0A 3K5OA 1RK8A 4USHA 4J37A 1WORA 1Y9OA 1RT6A 3OJSA 1TKTB 2V4JA 2CVIA 2QL7B 3MMCB 2BOAA 5HP1B 1R6VA 4CCHA 1NDLA 2DGSA 2OIHA 2UP1A 5A8RA 1JLAA 1HNIB 3DLGB 3KK2A 3UW1A 2E5HA 3FBCA 1P6TA 1RWKB 2HNDB 2FLLA 2CQPA 1R7IA 3KJFB 2LA6A 1IR2A 1I94J 1HR0J 3PX6A 4H4MB 4WWSA 1B64A 4BCAA 3DLKA 1PYOB 4V19X 4RW8A 5C42B 2RF2B 3U1NA 3M1VA 1FVQA 1WUUA 4WXWA 4CT9A 1H2TZ 3LP1B 3U27A 2VFUA 1WD6A 2UU9J 4Y2KA 1RWXB 1LW2B 1R3NA 2E5GA 1EQ0A 1VC6A 1VQMS 5GAHU 4ZVPB 4IO9Q 3TZXA 2DXDA 3K2YA 2KXFA 1HD1A 3HHLA 1LOUA 4QR0A 4ED8A 5LOQA 4NLRA 5THWA 1ELOA 2R8JA 2DNOA 1RTHA 3KUEA 5LT5A 3UN2A 1XBWA 2HQIA 4CP5A 3HDSA 3L9ZA 4NI2A 3C6UB 4EEYA 4RWWA 4ZVHA 3DM2B 1WDTA 2MHNA 2HHWA 1AB8A 4DF4A 1OIAA 2MQNA 4DL6A 4P75A 4DV3F 3SXLA 1KS2A 5LMNJ 5M2PA 1GXTA 2OPRB 3V6DA 1QVGR 1S1UA 4PCQA 2KRBA 5J2PA 3WIVA 1D0EA 4CNZA 2JLFA 3MMAA 3JQMA 1IQTA 4DV4F 2ZFHA 5IC6B 5DQGA 4P2XA 1Q16B 2IA6A 3W8PA 1CS4A 3R5JB 3QWUA 2XMVA 2Y1RI 3DLJA 3KDNA 3QYYA 2D1CA 3BN4A 2M70A 2BM0A 4WKRA 1SB6A 3EXYA 1RWWB 3MTJA 3OUYA 1NXIA 1UZHA 5BJRA 4LQ9A 4PG4A 2EKYA 3IA0A 2AYEA 2E9RX 2KO1A 2BV3A 3IM9A 3VHQA 3PIOQ 1VBZA 1B7YB 5HROB 1SKWA 2OSRA 4FNIA 5D0GA 1AZSB 3IR7B 1TKXB 2M2BA 4FZVA 4M1KA 2B4UA 2M7SA 3N01A 4OJHA 3D6FB 4DU8A 3PRVA 4IDKB 1Q8LA 2ADCA 4M5IA 1KONA 2QMUB 4CLKA 1YG0A 5A6PA 4QOTA 4L72B 3FBEA 4NMXA 2VPXB 2AYGA 4UOCA 4ER8A 4G1PA 2HZVA 3IWLA 4QR2A 2EG2A 1X4BA 3NGSA 2DXEA 1DRZA 4DR7J 1DURA 3OFGA 1V6HA 1SJFA 3G87A 1WEZA 4RL1A 2R7RA 2IRXA 2CQ0A 3KG0A 5HQMA 3QSYB 1RHMB 4X2BA 1BC6A 4ZHRB 4G65A 1JK9B 1RZMA 2BZ2A 2OO4A 4DHVA 3DGPA 4OHWA 2HQ3A 2ZC4A 3D1QA 4EGLA 2P8IA 3AT1B 1M1GA 3FMWA 2IA0A 3G82B 2Z30B 3OT9A 2BOPA 4YR0A 2WBRA 4F2SA 2Z57B 4RX6A 4PUOA 4KAIA 4WXOA 4J9SA 4IRKA 4J91A 2F7VA 3KNGA 2LDIA 5DQIA 4OLPA 3SI8A 1OYEA 2D9OA 4LR8A 3OR2B 2OPQA 3E8OA 3IXQA 1EJ7L 3H2UB 1RACB 4AFFA 1VJQA 3OTCA 2C2EA 2AP6A 5KFLA 3H59A 1DQ9A 1BD6A 5LSLA 2R7UA 2ZD1A 5JVHQ 2P6TA 1FRMA 2CDRB 2C2MB 2HGLA 4B3RF 4LF4J 4ZVOB 3SFUA 3DI6B 4NLPA 5GAHI 2MJNA 3DHWC 1LFPA 1SIWB 1YBAA 5ETMA 4NEYA 3POTB 3OHBA 5A6WA 1LWFA 3IG1B 3MUTP 3UN5A 2DNGA 4C11B 2MZRA 2XSJB 5B0GA 2UXBJ 2MDAA 2QLBB 2L9DA 4I67A 3BQ2A 4B3TF 2HVZA 2QFIA 1NH7A 2HHTA 4X4NA 3KK3B 1X60A 3GJTB 4ES2A 4K2XA 4DV1J 3MMJA 4YY3J 2W2OP 2MY8A 5EHHA 3MUMP 3RB3A 2QLJB 9ATCB 4DV2F 2NSBA 3QRQA 1ZZNA 3DLEA 2LDYA 1LK5A 2ZEJA 3BZQA 2DR9A 2R4FA 4ZVUB 3NAHA 2WSEC 3FFIB 1V5VA 2VG5B 1VC5A 3GYGA 4C98A 2DH9A 2VHGA 1NSAA 4WE1A 2IHR1 3TJAA 1CEZA 3MMBB 2ZVIA 2V6AA 1NRKA 2VUGA 3DGVA 3EGZA 1WKJA 2ZH2A 4FYDA 1T0TV 3LGHA 2GV1A 3EVMA 1WHWA 3D7SB 3LQVA 2ZDOA 4LFBF 2XI3A 3FCHA 2CPEA 1Y5IB 2BKNA 2ASDA 3A3OB 2EFQA 3IN5A 5T41A 1TZ0A 4YEAA 5E7OB 1G2EA 1WHYA 4HH0A 5E3QA 4Q8EA 2PI4A 4OQJA 1KOHA 4ZLPA 1SH2A 4O3NA 4EZ6A 1FJ7A 4YDDB 3W2WA 2HQGA 2L9WA 2W24A 3I0SA 3ZNUA 1H38A 2W8KA 2B8QA 2MZTA 1ITPA 3ISNC 4A48A 1F9HA 4TXSA 2HKEA 1S4FA 1G3OA 5CCLA 1U8WA 2Y8YA 2J9EA 3LANA 3KFWX 5LMUJ 3GIMA 2WAQD 3UCZP 1RT6B 2V4JB 1N36J 3ISZA 4DR3F 2VV5A 1M5VC 2U1AA 3SCJE 5A8RB 1JLAB 3BGUA 4F26A 4K4ZA 4QPTA 2LYVA 1DY3A 4GRSA 1CPZA 3MPDA 3H4BA 2HHVA 2CXEA 4C0BA 3QMQA 1F1BB 2FLOA 3CWJA 5CYQA 1VQ4S 2V67A 2JFKA 1TV6B 4F4AA 2BYCA 5KFWA 3DLKB 4RW8B 2UUAF 1WSVA 4LT6A 4RBVA 2CQBA 1HNZJ 3KNAA 1A7GE 3FJ2A 3J7AN 1F9EB 1FXRA 4Z7YA 1XNRJ 2X3GA 3PM9A 3PJWA 4WCEQ 4WFBQ 3KG1A 4GMKA 5LL6d 2CVEA 2VQFJ 2IRUA 2WHOA 1RHQB 3ZZ0A 1M1HA 2XO7A 4YS2A 1HHSA 2HFZA 3HHLB 3MR6A 1M0SA 3K8WA 1NHUA 4M94A 4DCOB 2Q43A 2O3DA 3RBDA 3B78A 3IWXA 3K5MA 3ILIA 2C28A 4ED2A 2QA4G 1RWVB 4O3RA 2PE8A 4NI2B 1GXUA 3ENQA 4CO5A 3OVAA 3KLFA 4ECZA 3AXMA 2DRBA 3AY0A 5CH7B 1RBLA 4F3OA 4DUYF 3TEGA 1YVFA 4IOBA 4DWIA 4AXJA 4BDPA 2Z8QA 1TAUA 1IQZA 3M32A 2WVDA 3P49B 4DZDA 2JNJA 2BUNA 1RISA 4OHVA 4QCLA 3V6DB 2OUGA 3PX4A 3GJSB 1S1UB 5E3CA 3SCLE 2J7UA 5J2PB 3UCGA 3KLHA 3MMAB 2R2RA 2VA2A 2E66A 1U48A 2ZHAA 2ZH7A 1BE4A 2GJFA 1Z1ZA 3IAS9 1OSCA 1DJ0A 4LFCJ 3GIJA 3LGMA 5D15A 3O2IA 2R7SA 2FB0A 4OI1A 5AXLA 1N5QA 4KV8A 2ZHBA 1QD1A 2H65B 4ID5B 2MQMA 1SKUB 4YHHJ 2UVRA 2GAGC 3OFFA 1PJ7A 3OUYB 1DLOA 5EWGA 1F0XA 3JQJA 1E6YA 5J1EA 1XEZA 3CC7S 1V3RA 3IGNA 2BRLA 2MEWA 5I4MA 2HK2A 2ZH3A 4WIQA 5KFXA 3PYGA 1IUJA 3GIKA 1S97A 2YVSA 4QW9A 2E9ZA 4YY3F 4OHYA 3HVRA 3TA0A 3W66A 2ZBQA 1VJWA 1HWKA 1NCLA 3QATA 3BR9A 3FVYA 3PJ9A 3G86A 1PG5B 3UFCX 2QTWA 4RNNA 5E33A 5E5NA 4FN5A 2XHCA 1R8BA 4WZQA 4OYPA 1YBTA 5HVHA 2EEYA 2AZ3A 2EC2A 3TQ1A 1M90T 3IRXB 1AYEA 4NYOA 2DNQA 4OZJA 4LQ3A 3B54A 2HVIA 3DCAA 3ENVA 5HK4A 2N3LA 2LVWA 4QIWD 3A3PB 1NSPA 2JVRA 3DGPB 4ECRA 3TJ8A 4Y2AA 4ES1A 2VPZB 5IV4A 3SSQA 2BE7D 2GVZA 3NOCA 3NAIA 1SC1B 5FLXU 3D2WA 3VF0B 4PUOB 5F8LA 4WFXA 2RQCA 2YPZA 1FJEB 1HI1A 1Q82T 2QLWA 4O3OA 2V4QA 4DPUA 1RU1A 3T6BA 2GS8A 3NRBA 1ZM3A 2FJWA 3TX8A 2R2UA 2QMXA 2MKSA 1PJ6A 2YXLA 4WJBA 4Q43A 5DLGA 2BACA 3HSJA 2ZD1B 1FVSA 3FUYA 2MKIA 3CDWA 1WC4A 2JDJA 3DNCA 3QIDA 3TQEA 2KXNB 1X5PA 3KLGA 3PR5B 2BJ8A 2J7WA 3W2VA 4ECTA 4P10A 3W3SA 3FK4A 1LWFB 4ECWA 3Q23A 1FJCA 4P2FA 2QC3A 1CSJA 1NKCA 4KHPF 3L3CA 4QR1A 2CZVC 3O1LA 2DGXA 3MR7A 3LH2S 4HH1A 1U49A 2PO4A 4DL7A 3H4DA 3EYZA 3EX7B 1ZS6A 4ZLLA 3ENWA 4X4VA 1WWHA 3TEHB 1S6UA 2J76E 4FNHA 3HO1A 4Q45A 1BQNA 1MN9A 3PACA 1UWAA 1M5PC 2YNFA 3R1LA 2F5GA 5GMDA 3FEXB 3DLEB 2XS2A 5HO4A 3QFWA 3C16B 4IG0A 5A0YA 3HXMA 2X7IA 3DDKA 2DKOB 3PYFA 4D3HA 3OL9A 1GFWB 4WE1B 2EVZA 4WFYA 1FFWB 5DDRC 4NYZA 5HLFA 3GG1A 4MKBA 3CXCR 2JLGA 4ZN1A 1ZOTA 2VKZG 3RYLA 3H8YA 5I3UA 2WVCA 2AGPA 1S9GA 4P2MA 2B56A 3K8VA 4EZ9A 4E8UA 1S79A 3KLEA 1JQGA 3LPYA 1HI0P 4I6YA 3I4HX 4ZOSA 3OL7A 5KG6A 3LALA 2K7KA 2CQIA 4PXBA 2WVBA 1WEYA 3SQGA 3W2WB 4NA2A 1Q81T 3TARA 3I0SB 5F3ZA 3I5AA 5ETLA 3T1HF 3R97A 4UOHA 2HMIA 4U96A 4QU6A 2F9DA 4X4QA 3IS9A 3NNCA 5F8HA 1HI8A 1TKDA 1U25A 1S7HA 1VHFA 3TUPA 3JTPA 3TZZA 2J6TA 2HVEA 1NH8A 2MSSA 2NUUG 2G13A 3H5XA 2WVEA 2K3IA 3NMRA 2MQ8A 4JV1A 4DFJA 3K5NA 4CO3A 2ZNZA 1RHKB 2DK2A 3GCXP 4LRCA 4PQUA 3IP0A 3G6YA 2UUBJ 3V6KA 4NLQA 1U6BA 1MSWD 1TVRA 1PIEA 3CULA 1XMQF 3HKZD 5CYQB 3BBCA 3LPEA 1DAXA 2YH0A 1HQUA 2GCFA 1S9EA 3QGPA 4K4SA 1VRTA 3AOCA 4P74A 4A8SA 1FWLA 3L09A 2XY5A 4W4MA 3M05A 5LJ3Y 1U2CA 4JV0A 4USVA 2BJ3A 1G6BA 4OL8A 3KKFA 1BGXT 2MKYA 1V3ZA 1EARA 1IN0A 4DV7F 2WBMA 2MB0B 1FT8A 4JI0J 4L3NA 2CIMA 4RUAA 1UZDA 2RQKA 2QT7A 1RQ0A 2F65A 2CJAA 5HQ8A 5IC4B 3KDOA 4G1IA 2FVPA 5DS7A 3SV3A 3NY0A 2OKQA 1RKJA 4PG8A 1ICEB 3E01A 1WOSA 3CD0A 2Q79A 3T9NA 1HYSB 3KLFB 2QA2A 5FLXY 4U7CA 4EBDA 4KC5A 3M8QA 5D0HA 2OGUA 2P5VA 3QT6A 4O3QA 4LVOP 2QA1A 4QWEA 3GR1A 3NP5A 4LRAA 3QNWB 5DDPC 4U6PA 3M32B 2XHWA 4ZS6A 2ZOGA 5ETQA 2C2ZB 2OLWA 4B9VA 2ZH6A 1N5YA 2V34A 4RUBA 2A3JA 4OI6A 4V1Ak 3QRPA 1EAYC 1ZBTA 3Q89A 3KLHB 4KIAA 5A8KA 4QWAA 2R42A 1S0OA 3DRSA 3MPUB 4ZVQB 3DKDA 4NA3A 4DLEA 4HDHA 2FJAB 4KV8B 1WKKA 2LECA 2F9JA 2QG9B 1T3NA 2E5JA 5D4OA 2IM1A 3BKTA 1RWUA 1E6YB 4YB7A 4IFVA 3AD8C 1H73A 2D9PA 3CJKA 2RB7A 2V50A 1HNWF 1Z2LA 3H90A 3I96A 2XLIA 4B9UA 4OV1A 2UV8G 3VQSA 1K1SA 2YWWA 2RU9A 3CCUS 4IO1A 1IKXB 4TN2A 2HPUA 1FJGF 2HG4A 3VGVA 3SZ2A 1REGX 1M5KC 2VFRA 2LU1A 2OI2A 2HBQB 5DZ7A 2AU0A 2ALZA 1DFDA 4CO1A 1RTZA 2HFUA 3ISND 3EUNA 5C2CA 2ZHOA 3D28A 1Z4UA 4NCBA 2VBYA 5MLCV 4EU0A 2G9OA 4M95A 5HVFA 1B70B 2ASYA 1GXLA 1YX2A 3IR5B 5M2RA 4J9OA 3L95X 1IBCB 4A8YA 2GGPA 3CC4S 3DOKB 4GKJF 1JLQA 2VFSA 2JEIA 2H4WB 2MQLA 3HD1A 3R2CJ 1FA0A 1JNZB 2GVZB 1RADB 4CH7A 3IO1A 2KG1A 1YK9A 4FF4A 2EFOA 4ILMA 3WC2A 3TO8A 3MWBA 4DS4A 4C8MA 1NMEB 1UEVA 4OYXA 3F44A 5CA5A 2B5JA 5GAEU 2E1PA 1FNXH 2UV8A 1TMJA 4DV0F 5FD1A 3NGKA 2FTRA 2QFJA 2BMBA 1S76D 1N8RT 4K5SA 4DSLA 4JP8A 1IKYA 1GTEA 3I6PA 3M6XA 4RUHA 4AL5A 4FXDA 3AQPA 2DCLA 4B3MJ 5BR8F 2XYPB 4N8OA 5AE1A 3U1MA 2RVJA 2FYXA 2HAIA 1U24A 3W2VB 3HLUA 4MK8A 3UE2A 1T3OA 2GHVC 3GV8B 1N6QA 5D4PA 4RLEA 1DHMA 1OO0B 4IH6A 1X5TA 3R2DJ 4UY85 1CJTA 5KFVA 1WNEA 3RBEA 2KTQA 1F9FA 4F8RA 3NS5A 1Q5VA 3UDCA 2YWGA 4O0IA 3WC0A 4UF4A 2L08A 1BQXA 3UQSA 1HMVA 3M2RA 1BQNB 4X66F 1XWLA 4KR0B 3D1HA 2YNFB 2VONA 1R89A 5KTQA 3MOJB 4IH7A 4X4PA 2MJUA 4DMZA 3HHNB 4USKA 2R7VA 1VQLS 4IG0B 3DDNA 4ZP9A 5L9NA 1MMNA 1WTBA 1GH8A 5A0YB 4CTAA 5D78A 1H7WA 2DHHA 4NASA 4MMOA 1NHKL 2UVUA 2N7YA 4F36A 4JI2J 3CB4A 1NK5A 1VIOA 4ES3A 2HGMA 2QO3A 5HLFB 2Z2ZA 4CLPA 2R2TA 3DC2A 3HK2A 2HK3A 1OYDA 3NCRA 1KLNA 5KFTA 1Y0HA 4C8NA 5KFHA 5KFEA 1L3SA 2ATCB 5C24A 4QW8A 4V19J 5I3UB 4TKTA 3M8ZA 1S9GB 5F9LA 1JLCA 2NPIA 3UDLA 4TY9A 3AFGA 3KLEB 3MAHA 1RI7A 3RG6A 2HFVA 4CZCA 3T1YF 4ZLNA 5KOWA 2FZGB 1UMJA 4M5GA 3SQGB 1JKHB 1UVIA 1H72C 3MCSA 2P9GA 5T14A 1BMQB 1IKWA 2A18A 1P9YA 2J8SA 2HFNA 2HMIB 1IM6A 3D3CJ 1OJ4A 2QV6A 3IS9B 2YKMA 4ILLA 3QGGA 2V8DA 2G2OA 3HKWA 2W2NP 4DR4J 2IJNA 3MEEA 1FE0A 5D4NA 1JMTA 4GO5X 4KE5A 1AFIA 3W9HA 3ZNJ1 3W1YC 4KHRA 5DM7Q 4PQUB 3CJRA 4DPTA 3M6UA 1QUPA 1TVRB 4FPIA 4OZ3A 2ERRA 1EIYB 5D4LA 3AJ1A 1U7LA 4YMEA 4HHHA 1WG1A 1MMLA 2ATLA 4M8LA 5HMZA 1HQUB 3WX4A 1NPRA 4G1QA 2ZH9A 1S9EB 2KVQE 1VRTB 2ZE2A 2Y8WA 5K5MA 4DF8A 1UKUA 1FF2A 3CDEA 4ECXA 4DQPA 1U1QA 2PGCA 1VMBA 4IQMA 5IV3A 1S4EA 2QEXS 1WOPA 3DDIA 5K20B 3G4SS 1WEXA 1HNXJ 3C66A 2FPHX 3J7YU 2CPXA 1O5JA 3PW0A 5GAEI 5DQHA 1P8GA 2W9BA 2HWTA 1IBLF 1W7WA 4OZLA 4NLTA 2BJEA 1RSCA 4FKYA 1TUWA 1CBKA 4DR6J 3DRXA 2J7KA 3E51A 5HVGA 1UTAA 2DO0A 2XMMA 1XQIA 1MROA 5IQQA 4OZ2A 2PMHA 4OYAA 1V9OA 2NZ4A 1N32F 3GYNA 1PAEX 3O3LA 2M9KA 1VK3A 3E01B 4C3MA 2YWHA 5EWEA 2FVSA 1TFYA 2HNZA 2JEFA 3ZZPA 1PC4A 2J0WA 2M3DA 1WKLA 1VQ9S 4FS1A 3M8QB 1V3SA 1VC0A 3IBCB 3IBFB 1YI2S 2MZJA 2RS2A 1WSRA 1EQMA 1N56A 4Q7AA 3R7NB 2RS8A 1N5YB 4U9RA 1UCNA 1OMSA 4E2FB 5A8KB 4OMFG 3SCKE 2EG1A 1GT8A 4TNOA 1XJWB 3DRSB 4O23A 3GFZA 2CNNB 3VAMA 4ZJLA 4C8LA 4URGA 4KGKA 1N5SA 3TYTA 1WI6A 3LUYA 1J5EJ 4FDFA 2DIVA 4L76A 4X65J 4ETZA 1IXKA 2W1BA 2YKNA 3DXSX 4Y65A 4QWCA 4IFVB 2G1DA 2FC9A 4NXNJ 5M2UA 3FGVA 1S6PA 2AEMA 3VZIA 2A1BA 4LF8F 3CJKB 3T5KA 1RGVA 4KPCA 1P27B 2FLPA 2U2FA 5KT3A 4RU2A 1FWKA 1GX6A 5EWFA 3QAEA 3W61A 3KMQA 4RNMA 5L46A 4GKKF 4LSLA 3KHGA 3A8EA 4R25A 2KYXA 5KFDA 4N8NA 1S7IA 3H5UA 4K4TA 4AYBD 2XY7A 1N0UA 2FZCB 2W9AA 1D1UA 4F0KA 2OP5A 1H2UX 4B9SA 4NCGA 1HL6A 2DNHA 2PFDA 1T9TA 3J80U 2NQPA 2GGPB 2HS0A 2C2NA 3RJMB 4CLSA 3ET6A 2JRSA 2BE2A 1RKIA 3Q8VA 4DBQA 3GG0A 3ONQA 4ZIWA 4GVLA 2ALYB 2GJ2A 4ECVA 2B4OA 1U47A 3MPWA 4AQYJ 2X3DA 4XPEA 4JI3F 3H0PA 4QYZK 3MPYA 5F8JA 1RHUB 5A76A 2F8HA 4KJIA 3PFEA 1UAWA 2B9YA 4RBUA 5GADU 4OZ1A 1MN7A 1YBUA 1T9YA 2KT2A 2B5JB 2K2PA 3ZZZA 3HD2A 2FHMA 4EWTA 4DXLA 3QIPA 3QT5A 3EWGA 2KFYA 2JZ5A 4MIAA 2UVWA 4JI1J 3E3XA 2VH7A 4N41A 4K0KF 2H51B 1IKYB 3BPSP 4DR2J 4X62F 3MECA 3MR3A 4DR1J 3J7YI 4KH0B 4OJ3A 2I1RA 4OV6A 3LWLA 5BYRA 5C2GA 3FZBA 1F2HA 1X4AA 5KG5A 1RDRA 3FMBA 2H5JB 2AEFA 1M5OC 1N6QB 4LFAJ 4OX9J 3SMZA 1IBMJ 1X4HA 3VGTA 1CJTB 1F5BA 1N48A 3CGIA 1KNZA 3H20A 4XDDA 3H2LA 3GFXA 1SI9A 2DD8S 3R5GA 5F8GA 1L3KA 3TP2A 1Q8KA 2PA8D 1ZAVA 4Q0BA 3SSSA 1S6OA 2UXDJ 4W90B 4ZP8A 3M2RB 4LF5F 5DDQC 5JJBA 4Q8FA 2IC3A 4OYOA 4XIUA 3RAQA 2D41A 4ELTA 2ZH1A 5KFRA 3FSYA 1SPBP 4ATNA 4CTAB 3ZO7A 4LF6J 3THVA 3Q8PB 3TX0A 1HBUA 4CM2A 1IVZA 1FX4A 1HD0A 4YUDA 1SV5A 4BHQA 2P9CA 3SBMA 1Z2ZA 4OJGA 2DPJA 2XM3A 3CUNA 5C24B 4USJC 1JB0C 1NKEA 1JLCB 2CADA 4U7UK 2W4CA 2BEFA 5L39A 4UQTA 1TL3A 2ROEA 4CLUA 3A1YG 4TU8A 3KHHA 4MIBA 2D3OR 4JB8B 4EMDA 2CG4A 3BBBA 3MAAA 1N34J 1F2GA 3CCTA 1SQGA 3TWZA 1OPZA 3ZZUA 1HPZA 2V8PA 2JEJA 4K4XA 2A0FB 3FRYA 3LWMA 4KBIA 3VGUA 1KN6A 2MHEA 2VPWB 1XK8A 4PYDA 2XLJA 2YKMB 1TUVA 2ZKUA 5HI7A 3CIZA 2ZBIA 2J5AA 1IWAA 3MEEB 3BQ0A 2R7XA 2ZDPA 4QWBA 3EPGA 3BH6B 3CO9A 1SC4B 1REVA 4RNHA 2CRLA 2QL9B 2AJQA 2CPYA 2I8EA 2KFZA 4Q44A 3PVXA 2DNPA 5D8HB 4DFKA 3W5XA 2MSTA 4PAAA 2HBYB 4DEZA 3EICA 3O8WA 5B0BA 4J9UE 5AE3A 2KZMA 8ATCB 1YQHA 4BWJA 4G1QB 1ROFA 2FJVA 2ZE2B 4KSEB 3H7HB 1FRHA 4YN3B 4PXEA 1RE1B 3PRDA 2ASLA 3TR5A 2IBKA 3CJQA 2DIUA 3D54A 5B0AA 4JV5F 2VOOA 1Q4RA 2E44A 4LR9A 1KSPA 4LUBA 2RQ4A 4TU9A 3A4TA 5GADI 1FK9A 1SBRA 2W9BB 4MTPA 4LF9F 4KY3A 2UVVA 3HPOA 3UPFA 2HRTA 4F67A 4ZHRA 1CQMA 4IYQA 2K3KA 4P7TA 4QBUA 3H2VE 4ED6A 1MROB 4ECSA 4NA1A 3J80Y 2QLFB 2Y1JA 1F3VA 1Q95G 2ROGA 3BYPA 2J8AA 3G82A 1FKPA 2AJ0A 1HLWA 4CRJA 1ZA2B 3RTVA 3R7SB 1FDDA 5CD4A 4PEOA 3RRGA 2CFXA 2VFTA 1EETA 4RU9A 1SVDA 4DV3J 1FWPA 3QQCD 3C14A 1HWJA 2CZ4A 4IOCQ 3OR2A 1KFSA 1U26A 1P1TA 4L74A 4QIEA 4O0NA 5ETPA 4G6VB 2HQDA 2ZVSA 1APSA 2KXHA 2NCKL 2IM3A 4H4OA 4X4OA 1CVJA 2HFOA 4NX9A 4WFAQ 4DV4J 4KGVB 1XNQF 2VODA 1NJWA 2E5LF 3PDNA 2Q6CA 2W7OA 2V8GA 4USIA 1BHNA 5IT4A 3EZ5A 1QVFR 1U1NA 3D68A 4ANEA 5GAGU 1HBOB 3OL8A 4MH8A 4HHJA 2YKNB 4TLQA 2PMZD 1KLMA 1NO8A 2X1GA 3EM1A 5J2MA 1S6PB 5LXYA 2GZOA 5J1PA 2W2MP 5HAOA 5CZVA 2RAQA 4DQIA 3OTDA 4DV6F 4ECUA 4YR2A 4PXCA 1UJ6A 2M5YA 3CW2C 2Y9HA 4LIRA 2RQMA 1SKRA 2VOPA 4LBHA 1QUVA 7AT1B 4USUA 1NKBA 3MR5A 2CZ9A 3GV5B 1YGYA 3CD6S 5DDOC 2LLZA 4IOAQ 3LO3A 4OX8A 2MQOA 3MEDA 2XEXA 2QL5B 4LSLB 3CJ5A 2QLXA 5J2NA 3MD1A 1FKOA 4NL5A 2XMKA 2LXUA 3HHKA 2GW8A 1J2VA 1UPPA 3D3BJ 1S48A 3UR3C 3R8YA 2KT5A 3DMJA 2Y0BB 3I5BA 4TQSA 3UO0A 2GVDA 4QYRA 2KYZA 3VGSA 4NLYA 3TUZC 3CNQP 4NRUA 4K2JA 2N4DA 2V2KA 4PQAA 3ET6B 1LEOA 2BE2B 1KWMA 1ACMB 2GC8A 1FNMA 3G6ES 5H9EK 4PWDB 2OEMA 4Y34A 1WG4A 1QLNA 3V4MA 4A8XA 5KG7A 3HMJG 3UDVA 2ZWPA 1H6KX 1X7VA 5A8WB 1IJFB 2YPYA 1NB7A 2VZ9A 1TL1A 1XN9A 3QIPB 2KDOA 2YKOA 1XC9A 3K0JA 1WG5A 4ILRA 2GO8A 2WB4A 5ETSA 2R2SA 1YIJS 3PW5A 2ACYA 1JJ2R 4B3RJ 1RTJA 4E98A 3MECB 4WU2A 2W8LA 3GV7B 3SDEA 1S0MA 1UPMB 5F0UA 1FDNA 4EO6A 4DI6A 2E7XA 1T05A 2J6SA 4NZ6A 5IT9U 2B9XA 3JSRA 4CIOA 3PR4A 4JUZA 2VIHA 2E1RA 1FESA 3GB0A 3TZWA 4MKAA 3NNHA 1PBAA 1KOOA 3FQKA 4QQBA 2G0JA 3DN9A 5KAKA 2FGCA 2XCAA 1TV6A 4UUXA 4B3TJ 1PBUA 1T8EA 7FD1A 2CQDA 3M8RA 1N88A 2VQEF 5ITHA 3Q8UA 1U6FA 4ZPVR 1W26A 2RKIA 4Q0BB 4OLOA 4DV2J 1UFKA 1F5AA 1Q0NA 5GMKa 5KG3A 3B8HA 2R7TA 3OL6A 4EI2A 1N5TA 2VJVA 1RT2A 2IC3B 2I5JA 1SL1A 1PJ5A 3UDEA 4IUFA 4JI5F 2XB2D 1Y4ZB 3CJSA 1BUXA 3HVTA 3LAKA 1F60B 2QYCA 1VHIA 1HBUB 1SKSA 1X0FA 3F73A 1LXNA 3V5RA 4M5JA 1TK8A 4P71A 1S1WA 1NU4A 2QJ3A 4IKAA 2XTJP 3VTIA 2OH2A 1SV5B 5FIIA 2ZH8A 4LFBJ 3WHIA 1U2FA 2RMLA 4I2QA 5GAGI 1U09A 3V6JA 4DS5A 4OZ5A 3W63A 1TL3B 3CIMA 3KJQB 1WF2A 2YNHA 4J9NA 3DOLA 2DGTA 2C3UA 3N6MA 4OIXA 3D6MB 3MAAB 2VASA 4U67Q 1HPZB 1KBRA 2IDEA 4C8KA 5ETNA 4RNOA 2JJ4D 4JI4F 3UVJA 2X51A 2WRMA 4ICLA 2KZZA 5AE2A 4CO4A 1EP4A 1PILA 1RA7A 2HLTA 4Z2XA 1U1RA 5K8PA 4NMLA 4ID5A 2DYAA 1OY9A 4CI0B 3R7BB 1FNOA 1VGYA 3RW7A 3PKMA 4JI8F 1VQKS 1X4EA 4DR3J 3PY8A 1REVB 1X5SA 2I2YA 3CC2S 5DG7A 2BRKA 2N3OA 4LRDA 1NNDA 2RSQA 1RAOA 1QAIA 2GFFA 4PABA 2YWEA 2XZTB 1DBDA 4ZDNA 1NDCA 1RAEB 2CNOB 2FLNA 2UUAJ 5KFAA 3UWTA 4XTTA 1RT4A 1RTDB 2AHOB 1ZM4A 2OFGX 1TTHB 2CQ3A 4J5OA 4KT0C 3FSIA 1B0PA 2YH1A 2R7WA 1L3UA 3LA0A 5C5JA 3IRXA 4I2PA 5K14A 2IIHA 2EPIA 4C3KA 5KFJA 2BJ9A 1FK9B 4JYAF 4BLGA 3GTYX 4RZRA 3Q24A 2F8EX 4DPWA 3PYDA 3QZ8A 2C3MA 2XYGB 4WYWA 4RR5A 4I56A 4Y6IA 4DUZF 2PFFB 2IY5B 5E0OA 4C6AA 5CZXA 1SQFA 1R31A 1FKPB 3AODA 3PNIA 4W98A 5KFKA 3MM6B 3OVBA 4DUYJ 5IM0A 4JI6F 5H9FJ 2DISA 3W9IA 1EETB 4F4YA 3GIIA 3TAMB 3EXCX 2HHSA 1A6LA 3C14B 3EVWA 3C15A 4WU3A 3O6QA 1LFWA 3M7VA 4F3QA 3L7UA 2ZBCA 2AJ1A 2LQBA 4H4OB 3VCDA 2GA7A 3DU6A 1K0TA 5AXKA 3NEKA 2MKKA 4DSJA 3MCNA 1RWPB 3R5CA 3ILJA 2WCXA 5H9EJ 2QRRA 1K47A 4PG6A 3GQCA 1IM4A 4RW9A 2C3PA 4CO2A 2BQRA 4M5HA 4FVCA 3BO2A 1H0HB 4PG7A 1S49A 1M5HA 1HKAA 5IT9Y 3OSPA 4LSNA 1KR4A 3EJMA 2OEKA 1KLMB 2D3ZA 1U45A 2OD6A 3EZUA 3NLCA 3P3DA 1QSLA 2B9WA 5AXMA 5J2MB 2Y1IA 4QIFA 2XMJA 3HT0A 1IKVA 3OR1A 4DL0C 4NXMF 1LW0A 3GPAA 2E7WA 4CM0A 3ETOA 2G0CA 2F63A 3ZZTA 2MQPA 4OX7A 4DSKA 4HYKA 4X4RA 3SIPB 2HBRB 2L41A 3MOZA 3K58A 2KN4A 1YJTA 3C16A 3MEDB 3DYAA 4L75A 1L3TA 2ZKTA 2BW2A 3NKYA 4BWMA 4FPRA 1YJUA 5J2NB 1FKOB 3QJLA 1NZ8A 2KT3A 4DL2A 1X31C 3DMJB 3HP6A 3NMAA 1AA1B 2GVDB 5I3PA 3B4DA 2VBXA 1OPIA 1PYTA 2DB1A 4KKOB 1RTIA 2PMWA 2HBZB 2DPIA 2DNNA 1N5VA 2VF3A 3HFZB 3FCVA 4PYAA 5DM6Q 1Y3KA 3T9ZA 3HJFA 1R0BG 3CCSS 2BBEA 5IQ6A 2DGUA 1VR6A 2GX8A 3F56A 3I0RA 1ZM2A 3OPKA 4Y2IA 3X3UA 1F5CA 2GIQA 2RRNA 2K06A 1N33F 3MCOA 3I5CA 3PIPQ 3NG8A 2YKPA 1TL1B 1D8YA 4DQRA 1OWXA 1WACA 1TQLA 3D1OA 3OTBA 1S5ZA 2MKCA 4ERDA 3WX8A 2P9EA 2C2KB 4NCAA 2KL8A 2DHGA 2UUCF 2BKPA 1VOMA 1RTJB 2DR8A 2KVIA 3SDEB 4OFZA 4C8YA 2B43A 2X1BA 2DHXA 1T05B 1VISA 1YHQS 4ZCLA 2HHXA 2OFHX 3L4BC 1ZPVA 3DFEA 1JX4A 2ACMA 1FRIA 3GCWP 2OMOA 5IFMA 4F04B 4KHPJ 3QPIA 2XGQA 2IAJA 3UD4P 2HFSA 3VAIA 2CG8A 2H48B 2XY6A 1LWXA 2VG7B 4DV5F 3BGOP 3UNYA 2WK4A 5JVGQ 3US5A 4MKYA 3HSGA 4DUTA 3G6VA 3HVAA 2RKIB 3N5FA 3CJTA 3THPA 2D7SA 1IR1A 3AJ2A 2HNYA 1TL7A 1EZZB 2NSCA 2VA3A 3IGVA 4CH1A 3BF4A 4ZVSB 2JEGA 4QU7A 1RT2B 2I5JB 2C2RA 5KFMA 1VDHA 4R0EA 1Q79A 2PSZA 3HVTB 1KRPA 2L48A 3OXGA 3R9LA 1LXJA 1MG7A 4HT7A 5H1SV 2AYMA 4HI1A 4AUKA 1FE4A 3I82A 3TUIC 2LP4A 3OLBA 2WSCC 1S1WB 1NEEA 2MPUA 2QZ8A 3PW2A 1NJYA 2BX6A 4LF7F 4I2QB 1HYSA 2CJKA 2ZJQQ 3SYZA 2GHWA 3C2PA 1WHXA 4LSZB 1VQYA 5EN1A 4CLLA 3ZC4A 3NL0A 5DGAA 5JUMA 2PI5A 1BQMA 1DQAA 2BR0A 2YNHB 3DOLB 1NPPA 4ED5A 1PKUA 3W65A 1D8ZA 2XMAA 4DQSA 2MKJA 3OBIA 1FEHA 1QSYA 5F41A 2B7BB 3GFYA 3T1HJ 3UVJB 3DLLQ 4I69A 2MZ1A 4ICLB 2K7JA 2B0GA 2C2OB 4K4UA 4JI7F 3N6NA 1EP4B 5E3PA 2CQ1A 1FFSB 4RKUC 2LKZA 2YNGA 2BQUA 3VAHA 1HWUA 2XI2A 3CCRS 2VFVA 4ZCKA 3OD2A 5KT5A 2J6UA 4ANDA 2BW7A 4BBYA 2FZKB 2AV5A 3BKUA 3EGVA 4M5NA 3CCZA 3LOUA 4A47A 3CF5Q 5J2QA 3R5BA 1XMQJ 3X1LB 4WIIA 3M4XA 3QO9A 5HSPA 5DETA 4ZPWR 4KH1B 1HW8A 3G9CA 2J0QD 4CLYA 1Y7PA 4QZVB 1IKXA 3CMQA 2DXFA 4OYMA 1JXEA 1RT4B 3DLHA 1ZZFA 2AD9A 3CJ4A 1MU2B 2KM8C 2IDLA 3RB4A 4RW6A 2RUGA 1NDKA 1HQ2A 4I2PB 3P5TL 4UOGA 5K14B 3MPVA 3I31A 4DV7J 3ITHA 1RHRB 3THTA 2NS1B 5EDWA 3RU0A 3D0IE 2NLWA 4H54A 2WW8A 1YSJA 4DX7A 1TMMA 1B99A 3M9NB 3SFGA 3DOKA 2CDQA 2R7OA 5F0WA 1I1GA 4L6V3 3QJPA 3DRPB 1VK8A 2W01A 1TU0B 2ZM6F 2F4VF 1RA6A 1WHVA 3HSDA 2FGOA 4OYBA 1L3VA 1MWQA 1UVMA 3K57A 3R5DA 5KFPA 1FDBA 1SCJB 3Q2TC 2FHKA 2HQFA 5IM0B 1T9XA 4F0HA 4ZVFA 2AEJA 4WTOB 4HEA9 1VRUA 2DNMA 2P6SA 4AL7A 3KLIA 3ZFVA 3C15B 4PWUA 1B0TA 1GMUA 2QN6B 1T9WA 4K5RA 4P6QA 3MFHA 2YX1A 2QE5A 1BWVA 2CQHA 1R6YA 3PXGa 2CKWA 1WDDA 1FXLA 4RW9B 4WFZA 2B6AA 1C1BA 2IYIA 4DL5A 1T7PA 2KFNA 3CCJS 1RAGB 3BS9A 4ZJQA 3MTKA 3MM9A 4LSNB 3ELHA 4YR3A 2YX4A 3A3NB 2HAFA 4ALZA 5EUHA 1QE1A 4TYBA 4PPDA 4XPCA 1CQNA 3GP9A 1YJRA 2O5DA 1FX2A 1HNWJ 3C46A 1IKVB 3VVUA 3M6VA 5CHCB 3OR1B 3R6GB 2GIRA 4DN9A 1S77D 2IVYA 3V4IA 2M88A 1LW0B 3O44A 3OTEA 3GSDA 4DPXA 1NHVA 1RJJA 4S0MA 2DEJA 1Y11A 1FJGJ 1R8CA 3K17A 3PO5A 4LF2A 2R8KA 3MF5A 3DYAB 1NK6A 2BM1A 1EX8A 2FVQA 4LRFA 2HLUA 2V4RA 1JLBA 4USTA 3RW6A 3NCQA 1HBNA 1DTQA 3CDAA 3GE9A 4NLVA 2OD4A 1FTRA 3R27A 1YTYA 1PC5A 4WPAA 3R6LB 4Z7CA 1QAXA 5ETRA 1Q86T 5IS2A 1AT1B 2I6WA 1RTIB 3V81A 1R8AA 3CJ3A 1BXNA 4GKJJ 4J9PA 3PX0A 2VD3A 1WTFA 4CYUA 1HNVA 4UW2A 3CCES 2ZJPQ 2P2CB 1S72S 3P6YC 4YB5A 3I0RB 2HHHF 4B08A 1K44A 3V2UC 2OHDA 1U0HA 4AXIA 1JKHA 2VICA 1U1PA 1FDAA 4ZCMA 3S1TA 2UXCF 2PDAA 4M5KA 3HFVA 3G8QA 2MGZA 4DV0J 1JIHA 3VWSA 3GU0A 4HVZA 4CLWA 3NGDA 2GMLA 3G6XA 3PG9A 3SCIE 1YZ7A 4PRFA 2AYBA 1RBAA 1K0VA 1RT1A 4KTQA 2KJWA 2AKWB 3IR6B 4ECYA 2J0XA 1ZPWX 1QTMA 1VI7A 5BR8J 2DY1A 2WW4A 1WJ9A 1TR0A 3M2VA 2J0SD 4J7CA 5CXTA 4X64F 2AJFE 4HL9A 1Y5LB 5KFSA 3VAGA 5G0RA 3NNAA 3L7PA 3MURP 3LW5C 3CSKA 5DZ6A 1IBKF 2IAJB 5HBMA 2CPIA 1FD8A 5EX0A 2XNRA 2B7CB 3CVKA 4ZJOA 3GSIA 1NJXA 5ETKA 5D3GA 2ZJRQ 1I3OB 1ZA1B 2EW9A 4X66J 2HNYB 4URSA 1TL7B 3RAMA 2W7AA 6FD1A 4NLUA 4IG3A 2H5IB 1KQFB 1N54B 4GO7X 3H98A 3ZZOA 1N52B 3HCXA 4M5DA 3OTOF 1X0PA 2YKQA 3CEDA 5HJXA 1G1XA 4P72A 3PFOA 2GO9A 4FXWA 4RWXA 1VYAA 2C3YA 3J7ZT 5AJ3F 4DR5F 2C1EB 2ZZNA 3DRYA 1D9AA 4CH0S 5T7LA 3HJVA 2CYYA 3RRKA 1VLOA 3CTRA 4DCJB 2BJ7A 2IYGA 1S59A 4DG1A 1BQMB 2PA3A 3T1YJ 2KI2A 3H42A 3DU5A 2DNKA 4ZVTB 1CJUA 2JSXA 3I32A 4U7UD 4OZNA 3EMTA 4J9KA 4N56A 2KHCA 1W2BR 4LR7A 3JSMA 4H4KC 4KGZB 5CCMA 1R0AB 3RBZA 2XMTA 2DGQA 4ID8A 5IWAJ 1B7FA 2YNGB 4PG5A 1VBKA 5E3RA 3P5BP 3MM8A 4ZKAA 3L7OA 4LVNP 3MUVP 3AAWB 5HQLA 1VQ5S 4I4BA 4UTGA 2F40A 4WTYA 2GMJA 4JV2A 1KC8T 3FKBA 1SH3A 5J2QB 1GX5A 3MEGA 3QO9B 3RR8A 3IMQJ 2YNIA 4Y3CA 1XTZA 4OI0A 4RW7A 2L3MA 3VVTA 4CLTA 5HJYA 2V2VA 5HMXA 2RD5C 4EYIB 3N5BA 2XC9A 4C4WA 2BANA 2IJFA 3T5LA 1Q1KA 2DO4A 3W8GA 4DQQA 3FRZA 1S0NA 1F6TA 4EK2A 5FDLA 3M8SA 4O3PA 4RW6B 4MAKA 2ZH5A 3OHAA 3UI3A 3PO4A 4RPFA 2E7VA 5KG0A 4DL3A 3PRBA 2Z2YB 1DARA 3ITHB 1IBLJ 4CQ1A 2OMLA 3BYRA 3EVOA 1A0OB 2M0GB 2VB6A 3FQLA 2EXUA 1U4BA 4WFNQ 5B0DA 2MTLA 3M8PA 1UWBA 2Q66A 1JXLA 4DCPB 1O51A 4LBPA 1N32J 1I94F 1HR0F 2DNYA 1G7CB 1LNQA 1C4CA 1FRJA 5LSOA 2QGFB 3PW4A 3D4JA 3CDBA 1NAQA 2EFGA 3D67A 3PYEA 3EGWB 4OHZA 2ILZA 4ZP7A 3HZGA 2HWHA 2UU9F 1R27B 1VRUB 5K9FA 4W92B 5E41A 3KLIB 2V5HG 3TRGA 3R5AA 1RCOB 2MXYA 4MYTA 1QAYA 2E1CA 3KJNB 2NXNA 1UEKA 4LBIA 5IOLA 2B9EA 3M2UA 2WOMA 1Q8BA 1VQ6S 1D9DA 1U1KA 1MW7A 1RT5A 4NLDA 1RT3A 1HIYA 4TY8A 2B6AB 1C1BB 2NXCA 1MWZA 3SV4A 1J5OA 4N7TA 4F7VA 2HHQA 2EKNA 1T11A 3MM9B 3NGUA 4R5PA 3WDOA 2DHAA 1NK9A 2LMIA 1QSSA 2FVRA 1QE1B 4O44A 1KTQA 4LF8J 4K8RA 2Y0SD 5LMNF 4MIWA 5KG1A 1AFJA 1A9NB 2VPYB 3OSNA 2MYFA 5L38A 1KQSR 3V4IB 2NXEA 4P73A 4DZ6A 4MYUA 2K1RA 4B9TA 3P8BB 1H98A 3AH6A 4XAKA 2DBBA 3BKFA 8RUCA 3BGRA 3WZ0A 1VQSA 3GMGA 2XULA 4GKKJ 2JHEA 2XWXA 3NGRA 2H4YB 3OXFA 2OPPB 1JLBB 2KB2A 1T02A 3W64A 1HBNB 1DTQB 3HZEA 2NUHA 3AXKA 4MK7A 2VC1A 2WZ1A 1AW0A 1VFJA 3Q8YA 3HFKA 5CABA 3VV2B 3MZIA 3KHRA 3BBFA 3KK2B 5DG8A 2MY7A 1NPKA 3V81B 1NJIT 3FSXA 2HEKA 3R1HA 2RU3A 1HHQA 2MZSA 1U0SA 3NCPA 4ED7A 4CYUB 4J90A 3QRRA 1HNVB 2XS7A 4BS2A 1RB0A 2CQCA 4MJKA 4HI2A 3UNGC 1OY8A 3D0GE 5FJ4A 1BY9A 4JI3J 4GVBA 3BH7B 3M1VB 5LXRA 1WF0A 1U0HB 1C0TA 4E0DA 4AT1B 2PC6A 4DR7F 4C9DA 4OYWA 1YLXA 4QWDA 3G2XA 4AL6A 1Y5NB 2XBPA 2MGZB 1IWGA 2DR6A 3GILA 5AT1B 3HHLC 4NLXA 5IWAF 2WB1D 6AT1B 4K0KJ 5I42A 3MEKA 3TVZA 2XZDB 1LKZA 4X62J 1RT1B 4TU7A 3QGIA 3SQOP 1JLEA 3QT7A 3VQTA 4WK1A 1D3WA 5ETTA 5F3TA 2NYHA 1RTHB 3CT9A 3CDUA 2CA9A 4LREA 4DSEA 5EGYA 3M2VB 1KVKA 2GNKA 4Q2MA 2VDIA 3M9MB 4I0WA 3H25A 1X5OA 5G0RB 4OX6A 5B08A 1N4LA 3IFEA 2I38A 1OY6A 1Y00A 3OW2R 1QTNB 2QSFA 2SXLA 1S1TA 4FXVA 2LA4A 5HBMB 4C3LA 1KDNA 4WK3A 3T5JA 3Q2SC 4KFBA 5LJ5Y 1GAOA 1VS3A 2YWFA 1S57A 3KJVA 5D3GB 2R9LA 2IVMA 2XCPA 1UVJA 4ZN3A 5K8NA 3LGNA 2DR5A 4LF5J 1AUSL 2K8GA 2WTFA 1D09B 1Y3JA 1CS4B 1ZM9A 2HSEB 4IG3B 4LF4F 3CJ2A 4HTIA 1K8AT 4NEZA 4RW4A 2PIIA 2EBGA 1ZAWA 5L9XA 3TZYA 3DOMA 1VQ7S 4M5DB 1FRLA 3QSIA 5KFCA 2E5IA 2FUG9 1JNRB 1FCAA 4PXDA 4F4KA 2FJDB 4LIWA 3OLAA 3Q8SB 2UXBF 3LAMA 2EK1A 4FBUA 3CCWA 2JX2A 2G2ZA 5MAOA 4C8ZA 3RR7A 4X4TA 4M5MA 2RRAA 3MXHP 1SJ4P 4BC7A 4DV1F 4IR9A 2POKA 5T7LB 1PO6A 1RBOB 3UCUP 2ZUGA 3TA2A 1UFLA 4DG1B 4AE5A 1C0UA 3JB9k 3HM9A 3EE3A 1C4AA 2ZNYA 5KT7A 3PTWA 1VQ8S 1LV5A 1CJUB 1NB2A 3IBWA 1AXQA 2HS4A 1NSQA 4EYHB 2O67A 3JSMB 2ZWOA 3D9BA 3RB0A 2HVDA 1FTCA 4U95A 4WP9A 1HBOA 2O01C 1U02A 4F4ZA 3J81j 3DLBA 4ZITA 3MM8B 3ULHA 3DHXA 1U1MA 3BJYA 3MGJA 1TUGB 3HULA 1TL5A 7FDRA 1H3DA 4PZVA 1DTTA 1VQNS 4ED1A 1OSDA 3PV8A 4J9LA 4FBTA 4P52A 3F41A 2V9KA 3IWNC 3MEGB 2ASJA 2MLXA 2YNIB 4IRCA 2IM0A 2G0IA 4EFAC 2CQ2A 4RW7B 3U1LA 3H5SA 4MT1A 2XNQA 5B0FA 1VBXA 2OPQB 2A2CA 1Q7LB 1K9MT 4CLFA 2IVFB 2BANB 4OI2A 4JV5J 2CPHA 4KQZA 5LMUF 4F4WA 5FDLB 3U7JA 2V2ZA 3BB5A 2E9TA 3FBBA 4HDGA 1VIXA 3ETMA 3I9ZA 4I68A 3LP2A 1N36F 4C7QA 4LF9J 1P1LA 1ZETA 2CJQA 2OTJS 2RE1A 3IAM9 3GIRA 3T3FA 2HS3A 3M8WA 1S1XA 3I87A 4ELVA 3NWRA 4N77A 1M1KT 3M8PB 2AWZA 1UWBB 3QT8A 2AF6A 1NUEA 3CD7A 4NLWA 1SXLA 1NZAA 1ZH5A 4PWDA 3T41A 3GZ7A 2AW0A 1T94A 3MFIA 1RLDA 1UJ5A 1H7XA 2OAUA 3NS6A 3W5ZA 3CMAS 2A6MA 1HNZF 3W60A 1XNRF 5CD4H 4OZ0A 5D0RA 5ETVA 2H5EA 5A8WA 1X4GA 2XG8A 4O4RA 2CPFA 5F8MA 3FNNA 3PZPA 2NPFA 2VQFF 3BSOA 3TJ9A
chains in the Genus database with same CATH topology
5D4PA 1RYSA 4RLEA 3BM7A 1YITS 1DHMA 5I3PA 4B9NA 1N34F 3B4DA 1OO0B 4IH6A 1X5TA 2VBXA 4K59A 4FF2A 1OPIA 1LWEA 4UY85 3MAQA 2OSQA 5KFVA 2I0XA 3CCMS 3M2UB 1WNEA 2WOMB 2DB1A 4KKOB 2W9CB 3RBEA 1RTIA 2KTQA 5KT2A 4ZMMA 1F9FA 2KH9A 4ZPDA 3FEZA 1VLYA 1LWCB 4J9RA 2DPIA 2DNNA 4F8RA 2JOQA 2L9NA 3NS5A 1N5VA 2V0NA 2AGQA 3UDCA 2YWGA 2FJBB 4ZA1A 2AJ4A 4O0IA 2DR7A 1RT5B 4PPZA 4B9LA 3WC0A 5DM6Q 1Y3KA 2OPSB 3T9ZA 5B09A 5KFOA 4NWBA 3HJFA 1IJEB 1BQXA 2L08A 1RT3B 2GJIA 2OPPA 1HMVA 3UQSA 3RRHA 4TY8B 3M2RA 4DSFA 1BQNB 3CCSS 5DLFA 3K5OA 2BBEA 1RK8A 4X4SA 4USHA 4X66F 5SUHA 1XWLA 2DGUA 4J37A 4NLSA 5IQ6A 1Y9OA 4KR0B 2GX8A 3D1HA 3F56A 1RT6A 2YNFB 3I0RA 2N7CA 1ZM2A 3OJSA 2HVHA 2VONA 1R89A 1TKTB 5KTQA 2N82B 1J5OB 2V4JA 3MOJB 2DH7A 2ZITA 4IH7A 2CVIA 4X4PA 3OPKA 2MJUA 2C2DA 4DMZA 3MMCB 1YJ9S 5HP1B 4Y2IA 3X3UA 4R5PB 3HHNB 4CCHA 1QJHA 2DGSA 1F5CA 2OIHA 2UP1A 5A8RA 1JLAA 1HNIB 3DLGB 4IG0B 1VQLS 3DDNA 4ZP9A 5L9NA 1MMNA 3KK2A 2GIQA 3UW1A 1WTBA 1GH8A 5A0YB 2W7PA 3HI9A 4CTAA 4RNFA 4LMZA 2E5HA 2RRNA 1H7WA 5D78A 1N33F 4JOUA 4O44B 2FHOB 4O3SA 1HHTP 3I5CA 4MMOA 1CC8A 3PIPQ 1JJ4A 2UVUA 5HL7Q 3NG8A 2YKPA 2N7YA 1P6TA 2HNDB 1TL1B 1D8YA 4DQRA 2FLLA 2CQPA 1OWXA 1R7IA 3CB4A 1WACA 3PKYA 1NK5A 1VIOA 1TQLA 4ES3A 3D1OA 2HGMA 2LA6A 1UP1A 3OTBA 2QO3A 2MKCA 5HLFB 1D9FA 4ERDA 2V8HA 3PX6A 2DGWA 2J9DE 4H4MB 3OFEA 3MM7A 2P9EA 2K1RB 4BCAA 1B64A 2R2TA 3DLKA 4NCAA 2DHGA 3DC2A 2UUCF 4V19X 4RW8A 4PKDB 5C42B 2DGOA 3HK2A 2RF2B 3NCRA 1VOMA 1KLNA 5KFTA 3U1NA 1Y0HA 3M1VA 1FVQA 3BGRB 4C8NA 5KFHA 5KFEA 1RTJB 2DR8A 1L3SA 4WXWA 1Q78A 4CT9A 3HVWA 2KVIA 1UL3A 1SC6A 1H2TZ 5C24A 4QW8A 4V19J 5I3UB 4TKTA 4LFCF 3SDEB 1CG2A 1S9GB 3LP1B 3U27A 3AHPA 5F9LA 4OFZA 4C8YA 1JLCA 2B43A 2VFUA 2X1BA 2NPIA 5KFNA 4OI4A 2DHXA 3UDLA 1WD6A 1T05B 4TY9A 4QJVA 4Y2KA 2HHPA 4ZCLA 3KLEB 1YHQS 1UVNA 2HHXA 1LW2B 1R3NA 2OFHX 2E5GA 3MAHA 1RI7A 4RBTA 1ZPVA 3DFEA 1JX4A 1VC6A 2HYIB 4I1TA 4CZCA 1FRIA 4YHHF 3BR8A 1VQMS 5GAHU 4IO9Q 2OMOA 5IFMA 3T1YF 1NK4A 5KOWA 3QPIA 2XGQA 1UMJA 3SQGB 1JKHB 2IAJA 3K2YA 3UD4P 2KXFA 3MCSA 2P9GA 2O66A 5T14A 1UVIA 4UQGA 4I6WA 5L1LA 1HD1A 3VAIA 5CQGA 3HHLA 2AGOA 2XY6A 1LOUA 3BO4A 5AXNA 4QR0A 2VG7B 4DV5F 1IKWA 2WK4A 5JVGQ 3US5A 4MKYA 4ZPCA 2A18A 4ED8A 4NLRA 3G6VA 5THWA 3HVAA 1ELOA 2HFNA 2HMIB 2R8JA 2LQJA 2DNOA 1RTHA 2RKIB 5LT5A 3N5FA 2QV6A 2FJEB 2WONA 3THPA 2ADBA 3IS9B 2D7SA 2YKMA 4ILLA 3QGGA 1XBWA 2HNYA 3AJ2A 2V8DA 2HQIA 3GWCA 3HKWA 2NSCA 3HDSA 3IGVA 2VA3A 4CH1A 4DL4A 3C6UB 3BF4A 4EEYA 4RWWA 2JEGA 2IJNA 4ZVHA 1RT2B 3MEEA 4QU7A 2EFVA 2I5JB 3DM2B 1FE0A 2MHNA 1JMTA 3MD3A 4GO5X 5D4NA 3DRRA 2C2RA 4KE5A 5KFMA 1SQEA 2J9CA 4R0EA 2HHWA 1AFIA 4DF4A 1C0TB 1Q79A 1OIAA 2MQNA 2PSZA 2B4PA 2PN6A 4DL6A 4DV3F 4KHRA 3HVTB 5DM7Q 1KRPA 2L48A 4QPXA 3OXGA 3SXLA 3OV7A 4ELUA 4PQUB 1KS2A 1LXJA 4HT7A 5H1SV 2AYMA 5M2PA 1GXTA 3M6UA 1QUPA 1TVRB 2FHJD 3MM5A 4HI1A 1LQ9A 4AUKA 1FE4A 2OPRB 5L1IA 3I82A 2ERRA 4WYLA 3TUIC 4F02A 5D4LA 3V6DA 3C8YA 1QVGR 3AJ1A 1U7LA 4YMEA 5I3QA 4LJMA 1WG1A 4YOEA 1MMLA 1S1UA 3OLBA 2WSCC 2ATLA 2M4MA 4PCQA 2KRBA 5J2PA 4M8LA 1D0EA 1S1WB 5HMZA 1NEEA 2MPUA 4X84A 4CNZA 1HQUB 2JLFA 2QZ8A 3MMAA 4IFYA 1IQTA 3E2EA 3WX4A 2ZH9A 4G1QA 2RIJA 4OJ1A 4DV4F 2ZFHA 3K7RA 1S9EB 5DQGA 3PW2A 2CQGA 1Q16B 5I42B 1NJYA 1VRTB 2IA6A 4LF7F 1VC5A 2ZE2A 4I2QB 1HYSA 2CJKA 3B4MA 3QWUA 3PJXA 5K5MA 4DF8A 1UKUA 2XMVA 2ZJQQ 1JLEB 2Y1RI 1DQ8A 2GHWA 3SYZA 1FF2A 3CDEA 4ECXA 4DQPA 3C2PA 1WHXA 3DLJA 4EBEA 4IRDA 2DCUB 1U1QA 2PGCA 1VQYA 1VMBA 4IQMA 3QYYA 5EN1A 4P2SA 2QEXS 3ZC4A 2D1CA 3BN4A 2M70A 2BM0A 3G4SS 3NL0A 4HKQA 4WKRA 1WEXA 3C66A 2FPHX 2XWYA 2DJWA 4KB7A 1SB6A 3EXYA 2CPXA 3J7YU 5DGAA 1O5JA 5JUMA 4RUCA 1BQMA 1DQAA 2PI5A 1UW4A 2BR0A 3MTJA 3OUYA 2DTJA 5BJRA 2YNHB 3PW0A 4LQ9A 4PG4A 1U8SA 3DOLB 4EO8A 5GAEI 4ED5A 2EKYA 1P8GA 2Z2LA 5DQHA 1D8ZA 3IA0A 2FVCA 2IM2A 2HWTA 2W9BA 2AYEA 1IBLF 4OZLA 4DQSA 4NLTA 2E9RX 2BJEA 2KO1A 2MKJA 2BV3A 3OBIA 1S1TB 1FEHA 3N6LA 1QSYA 2HRUA 1VBZA 3PIOQ 3DRXA 5F41A 4CO0A 2J7KA 2CPJA 3E51A 5HROB 1SKWA 4KFBB 2B7BB 2OSRA 4FNIA 3GFYA 1S10A 2DO0A 2XMMA 3IR7B 3DLLQ 4I69A 2MZ1A 1RTDA 2M52A 4ICLB 1MROA 1TKXB 2K7JA 2M2BA 4FZVA 3KJVB 2B0GA 2DT9A 4M1KA 2B4UA 5IQQA 4UUWA 4R8UA 4K4UA 2M7SA 3N01A 4OJHA 4C0HA 1M5SA 4JI7F 2PMHA 3N6NA 1EP4B 5E3PA 1V9OA 4IDKB 1Q8LA 2ADCA 2NZ4A 1N32F 2CQ1A 3EGNA 3GYNA 1KONA 3O3LA 2LKZA 4RKUC 2M9KA 1VK3A 2YNGA 3E01B 3M30A 2BQUA 2GQQA 1YG0A 4C3MA 2PD1A 2YWHA 4QOTA 5A6PA 5EWEA 2FVSA 4L72B 2VPXB 1HWUA 3VAHA 1KFDA 2XI2A 4A8WA 2AYGA 2HNZA 3CCRS 1TFYA 2JEFA 2VFVA 4ZCKA 3ZZPA 5KT5A 2J6UA 1PC4A 1FRKA 4UOCA 2J0WA 2M3DA 2F8MA 1R8HA 4RW4B 4G1PA 3IWLA 4BBYA 4F50A 1VQ9S 4FS1A 2Z4PA 3CD5A 3M8QB 4QR2A 2EG2A 4J9QA 3BN7A 1V3SA 1X4BA 3AB2B 4WF9Q 1VC0A 2AV5A 1DRZA 5BYSA 1X4DA 3CCZA 1YI2S 2MZJA 3LOUA 2RS2A 4A47A 1DURA 3OFGA 1V6HA 3CF5Q 1SJFA 5J2QA 1N56A