2AYEA

Crystal structure of the unliganded e2 dna binding domain from hpv6a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
SATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Regulatory protein E2
publication title The recognition of local DNA conformation by the human papillomavirus type 6 E2 protein.
pubmed doi rcsb
source organism Human papillomavirus type 6a
total genus 19
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ayeA00
2KXFA 3TYTA 4J5OA 2DB1A 1NJIT 2DIUA 5IM0B 5CYJA 3MD1A 2CQ0A 1R8HA 5DETA 2XS5A 2AYMA 2HZCA 1VQ9S 2KN4A 1K8AT 2DH9A 2MKCA 1WHYA 2LXIA 1VQ8S 2CQ2A 3CTRA 3S8SA 1SJ4P 1Q7YT 4LIRA 4CQ1A 2XS7A 4QQBA 3G8SA 2KG1A 2DHSA 2MKKA 1N54B 2B0GA 1OIAA 2YWKA 5FJ4A 2MPUA 4F26A 2MZTA 2NLWA 1WF0A 5GAGU 2MY8A 4IUFA 3THTA 2ADCA 1YIJS 1VQ5S 2LYVA 2RU3A 1YWXA 2G0CA 3CCVS 2MJUA 1YTYA 1X0FA 2J0SD 3RW6A 1BY9A 3G71S 3RW7A 2D3OR 3N9UC 1L3KA 2DHXA 1D8ZA 3EGNA 2FY1A 2AD9A 4TLQA 3UCUP 2CPHA 2E5GA 3BO4A 1X5PA 2MZQA 5JVGQ 1R8PA 4TU9A 3TP2A 1NU4A 5DDRC 3MXHP 1X5TA 1DHMA 4IOAQ 2DK2A 1VQOS 2RT3A 2KM8B 1VQMS 1ZH5A 1M5PC 2RS8A 3BS9A 2OTLS 2MB0B 4WIIA 2LKZA 3CCMS 3SXLA 1U1NA 2DH7A 2RRBA 1FNXH 2X1FA 2K8GA 2CQCA 2DNGA 4ERDA 4TU8A 2N82B 3UD3P 1UFWA 3I56S 2DNPA 4CIOA 2HGLA 4P6QA 2CPDA 2FPHX 1VBXA 1Q82T 1KD1T 2DNHA 3J7ZT 1UW4A 2KG0A 1M5VC 1YJ9S 1G2EA 3R1LA 1B7FA 2EVZA 1N8RT 3CF5Q 5DDOC 1OPIA 1M1KT 4RU2A 5LJ5Y 1X4FA 4Y00A 5LSOA 2CQDA 2DNZA 4IO9Q 3NNCA 2MKIA 1PGZA 2J0QD 3SMZA 3FEXB 2DGXA 2JVRA 2LA4A 1DBDA 3CCRS 2M9KA 3EX7B 3CULA 1AUDA 2MJNA 3R27A 2D9PA 3G96A 2XNRA 1YHQS 1X4DA 1WTBA 5D77A 3OW2R 3U1LA 2DNYA 1O0PA 1OO0B 2M88A 2MKSA 3CD6S 4CH1A 2M52A 1URNA 3MUTP 1U1QA 2OIHA 2D9OA 2MYFA 2MZJA 1WHVA 5DM6Q 1YJWS 2VOOA 1D9AA 2LCWA 2FHOB 3UCZP 2DNMA 2DH8A 2RVJA 3CMES 4C4WA 2MQNA 2LECA 2XSFA 2L41A 2V94A 1Q86T 2OSRA 3UE2A 3UD4P 5LJ3Y 2M0GB 1X4CA 3BO3A 1SJ3P 1FJ7A 2ZJRQ 2DGOA 3ULHA 4FXVA 2DIVA 2ZJQQ 4WFBQ 2RQ4A 1WWHA 3VAGA 2KFYA 2M8HA 3G4SS 1HL6A 5H1SV 2XS2A 1WI6A 2KXNB 1M5OC 1FXLA 4EGLA 4W90B 3BO2A 2CPFA 2F9JA 5MLCV 3K0JA 1WHXA 1YITS 3B4MA 3PIOQ 2LEBA 2I2YA 3JB9k 1KC8T 2E5IA 4QU6A 2MQLA 3VF0B 1WHWA 1VQNS 5D78A 5IFMA 3LPYA 2DNRA 2J76E 2CQBA 2DGSA 2DHGA 1X4GA 1WG5A 1VQ7S 1VQLS 2L08A 3VAFA 4BS2A 1CVJA 3Q2TC 2CPEA 2Q79A 1QM9A 1N52B 3SDEA 3I55S 4FXWA 4WFAQ 1QVGR 1U1OA 1H6KX 2PEHA 1FO1A 2HVZA 5HO4A 3S01A 4WKRA 3IWNC 3NS6A 1NO8A 2X1GA 3P5TL 3CCJS 4OZ0A 2A3JA 2ERRA 4W92B 2MZ1A 3NMRA 2CPXA 2CPJA 4A8XA 2ADBA 2YKAA 2CPYA 1U6BA 2JX2A 5BJRA 1W2BR 1VC6A 1KOOA 2VONA 1SJQA 3J7YU 2RUGA 3BEGB 1P1TA 2KI2A 2LXUA 4V19X 1FJCA 3PIPQ 4F25A 1JJ4A 3CCLS 2LMIA 2FC9A 2UP1A 2KRBA 4WF9Q 1ZZNA 3NS5A 2YH1A 1X5SA 1WG1A 1VQ6S 1U1PA 2RNEA 2KU7A 2OTJS 2LEAA 4YB1P 2CPZA 1Q81T 3NNHA 2CQ4A 2G4BA 4M5DB 5DM7Q 1X4BA 2DO4A 3FEYB 2ZJPQ 1VQ4S 4PRFA 1JJHA 3SDEB 5IQQA 2E5JA 3VAHA 1WEZA 2G1DA 2AYGA 5DDPC 5CA5A 2VODA 1HD1A 3P49B 2PE8A 1X5OA 1PO6A 2BZ2A 4LMZA 2JVOA 1DRZA 3ZZYA 2M8DB 3VAIA 3P3DA 1K9MT 1FHTA 3G8TA 1FT8A 1H2TZ 1FJEB 2DNKA 1U1KA 3CCUS 1RK8A 2HGNA 2DITA 4WCEQ 3UWTA 2N3OA 2KXHA 3VAMA 5GAEU 2MSSA 3D2WA 2U2FA 3CCSS 2RRAA 5GMKa 1OWXA 1ZZFA 2JRSA 2AYBA 2MQPA 2CQIA 1P27B 2DGUA 1JMTA 1WG4A 1X4EA 1WF2A 1XN9A 1KQSR 3HHNB 1A9NB 3DXBA 3H2VE 3MD3A 2EK6A 3B4DA 2DNQA 2RS2A 4UQTA 2U1AA 2OJ3A 2DNLA 2KVIA 3CC4S 1U1MA 1DZ5A 2F3JA 2MHNA 2MY7A 2MGZA 2KHCA 4IOCQ 5ITHA 2M4MA 1SXLA 3L3CA 2KRRA 1VC0A 4ED5A 2O3DA 2DO0A 5CXTA 2WBRA 4YOEA 2BOPA 1VBZA 4QPTA 3V4MA 2X1AA 3VAJA 1H2VZ 3MOJB 1IQTA 3MUVP 3MUMP 2JWNA 4CH0S 3US5A 2QEXS 2MQOA 4QU7A 4Y0FA 3G6ES 2M2BA 1YI2S 1SJRA 1M5KC 1WEYA 3TO8A 3MURP 2GO9A 2CQ3A 2AYEA 4F02A 2E44A 2YTCA 2M7SA 2CQPA 2DGWA 2CPIA 2KT5A 3DLLQ 2DNNA 2YH0A 2MXYA 2J8AA 2XNQA 1X4HA 1A7GE 4U67Q 1RKJA 2M70A 3CC7S 3NNAA 3CXCR 2QFJA 5DDQC 2KM8C 1F9FA 4C0OC 2MGZB 3CMAS 2LQ5A 5GAHU 2K3KA 2CQHA 5HL7Q 2CQGA 4ZKAA 5LXYA 2SXLA 1K73T 4UY8T 2GHPA 2MKJA 1U2FA 1SJFA 2MSTA 2MQQA 2X1BA 1QVFR 3R1HA 3CCES 2QA4S 2RQCA 2DGVA 1S72S 4LJMA 3CC2S 2DISA 2KYXA 1UAWA 5GADU 5IM0A 1WELA 1WEXA 1U6FA 2DGTA 3S7RA 2XB2D 3CPWR 1VC5A 1H2UX 2CQ1A 4TU7A 5JVHQ 3U1MA 3G9CA 1HD0A 2EK1A 3IRWP 3MDFA 2HGMA 1HA1A 3VALA 3MI7X 3THPA 1VBYA 3CUNA 2E5HA 4PR6A 4OZ1A 2DNOA 2DHAA 2MMYA 3HI9A 2FC8A 2MQMA 1WF1A 2LA6A 3VAKA 3EGZA 2NZ4A 4C7QA 1U1RA 1S79A 1X4AA 1WI8A 2I38A 2MKHA 4WFNQ 2KH9A 3CCQS 1U1LA 4Z2XA 1KOHA 2F9DA 2MZSA 2HYIB 3ZZZA 2N3LA 3UCGA 2DGQA 4YUDA 2CJKA 3H2UB 3LQVA 1N88A 3Q2SC 1UP1A 1YJNS 3P6YC 3S6EA 1M90T 5GVQA 4PKDB 5EN1A 5LSLA 1JJ2R 2MZRA 1VQKS 2OSQA 1VQPS 2VOPA 5LXRA 2L9WA 2N7CA
chains in the Genus database with same CATH superfamily
3TYTA 1N32J 2QA1A 3L7PA 1X0PA 1DLOA 1U26A 4UZCA 3KTQA 4ECWA 4DR2J 3BSNA 2HFZA 3RJMB 4WK3A 1Q95G 2V34A 3LF0A 5HLFA 4JI3J 4DL4A 2JLGA 1GXUA 2R7OA 3LOUA 3MM5B 4LIRA 5KG4A 2XS7A 3TZZA 3JQJA 2C2MB 2R7QA 1Q5YA 2YWEA 1NJWA 5DLGA 2BKOA 1P1LA 3U02A 4OL8A 4B9MA 5IWAF 2GGPB 3A12A 3GIMA 4DJBA 1D8ZA 1RISA 2FLNA 4V1Ak 1R8PA 2MEWA 2B6AB 4NA3A 2AU0A 3MMBA 5ETMA 4PCQA 3W2VA 3BGRA 1LW2B 1VQMS 1ZH5A 5HQLA 4FNIA 5E41A 1QSLA 1RT6B 3PHTA 2DH7A 1U1NA 1FNXH 1NRKA 3PJWA 3J7YI 4UQGA 1UFWA 3KG1A 1CULB 1KD1T 3GV5B 2DXEA 4JI7J 1TP7A 2AJ2A 2AZ1A 2HHUA 4RW6B 1CPZA 3MM7A 1FXDA 5K8MA 3PX4A 4QYZK 3VVUA 1GH8A 1NK4A 4MAKA 3POTA 4ELUA 3QFWA 4PXEA 1NZ8A 1M5HA 3C46A 2PGCA 2NYHA 1U8SA 2D9PA 2VFVA 5KT3A 4USUA 4C2MA 1QAIA 3OT9A 1HNIB 1YJWS 3HO1A 1N5QA 5CYQB 4DQRA 3DLGB 5EX3A 4NLGA 3IR5B 3BQ2A 1KFDA 1WORA 1VQSA 1RBAA 5H1SV 5D15A 3ISNC 4K4UA 1Y00A 2BEFA 4YMEA 2A18A 1YKWA 2C2RA 3QRRA 4URQU 3VF0B 1ZPVA 1G6BA 4QWEA 2RHSB 4DV0F 2HFNA 3MMAA 1RT1A 3OVSA 4B3SJ 3HHDA 2ZEJA 3UW1A 3MZIA 3FVYA 1FNMA 3IO1A 1XR7A 1N33F 1URRA 1O8BA 3D28A 4DV6J 3DOMB 3OTOJ 4W92B 3RBXA 3BKTA 3GFYA 3ZTOA 4ECTA 4FDFA 3MOZA 4CLUA 4K4YA 1IBLJ 4DEZA 1H38A 3MR5A 1ZAVA 1JLFB 4C8KA 4AL6A 2C2OB 3PO5A 4CYUB 4LF5J 2DO4A 4A8QA 4DUZJ 4Q45A 1H0HB 3BR8A 2AYGA 1I1GA 1LWEB 4LMZA 2JVOA 3DU6A 5D4PA 1ZYQA 2V50A 2DBBA 2GMLA 1NK6A 1LWXA 2U2FA 5K20B 4A48A 2JRSA 2W2NP 3W3SA 1TV6A 4DBQA 2IPOB 4DPYA 1R43A 1PBUA 2Q43A 4KRWA 3KG0A 3M6XA 2CNNB 3FZ2A 1XJWB 1BC6A 1DY3A 4LFCF 4LBPA 2XHWA 1N0VC 3UNYA 3RRGA 4FYYB 5L9XA 1SH0A 2AF6A 3GQCA 4AUKA 1S6QA 4B3OB 4OZJA 2IVYA 2CJ9A 3PTWA 3JSBA 1H74A 5KT7A 1S1UB 2FJVA 2UVUA 3FBEA 3MUMP 2ZITA 4ECQA 1FRXA 2W4DA 1HWIA 4K4SA 3OFEA 3PHEA 3WZ0A 2AYEA 2ZVSA 4USMA 2G2OA 1RKJA 1NK5A 2UU9J 2VUGA 3M2RB 2BABA 4DG1B 3ENWA 1T8EA 2YNIB 4ETXA 1YJ7A 2CJAA 1P9YA 2R2RA 1IKXA 1SJFA 4YB5A 4MK7A 2IIHA 3HHLB 2ACYA 5KFKA 3GIRA 3LP1A 4EBDA 1NSAA 3RG6A 3CT9A 2H1YA 5T7LA 1VK3A 1UVKA 3I32A 2FC8A 1A6LA 1UEUA 3VAKA 5E2QA 3IC1A 1S79A 5D6GA 1RAGB 3CD0A 1TL7B 3HK2A 3DDNA 3DRSA 6AT1B 2BR0A 1Q8LA 2Z2MA 3ZZZA 2QLWA 4CLYA 3RB4A 4OV1A 2DYAA 1SL0A 1SL1A 3C3LA 2A6OA 3NWRA 2DR6A 4GVBB 1UCNA 1HNWF 1FCAA 2XS5A 4TY8B 1MWZA 3AODA 3MR7A 2EG1A 4ER8A 5I42A 4HYKA 1K8AT 4RNMA 4C8ZA 2DH9A 5A8KA 1S9FA 2I6WA 2X3DA 1D9FA 2UXDJ 1G7CB 4YY3F 2VFSA 1SV5B 2FVPA 2P9EA 1JB0C 5E33A 2UXBJ 4WU2A 3TAMB 2YWFA 2ADCA 1VQ5S 4K50A 4LFAF 2YQ0A 4P10A 2E1RA 1BY9A 1HQ2A 2C2KB 1WC3A 3I0RB 2V68A 2VA2A 2DR7A 3T1HJ 5HVHA 1X5TA 2EC2A 4ED1A 5AT1B 4QIFA 4JI1F 8RUCA 3TUJC 4OZLA 2Y3YA 4J9SA 2IM0A 4TQSA 2FVSA 3V6DB 2VJUA 4Q2MA 1EX8A 2H9ZA 2ZKTA 3PY8A 4LFBF 3D1OA 3LA0A 1L3VA 4JI6F 2HQDA 2IA0A 3H2LA 1B7FA 4LRDA 5LMNJ 5LSOA 1C0TB 2DNZA 4IO9Q 3NNCA 2FUG9 2J0QD 2DGXA 2QRRA 1TAQA 2OPPA 4KGXB 2ALYB 3QT8A 3R27A 3UDVA 3MAHA 2XNRA 1YHQS 3KHRA 2B5JA 2J7KA 3CW2C 3CD6S 4DF8A 1N6QA 4A8OA 1RB0A 3HT3A 1QJHA 1EETB 2LCWA 3BM7A 1SCJB 3GFHA 3CMES 2LECA 5KFOA 4Y2IA 5G0RA 4QOTA 1SQFA 1X4CA 3VVTA 4KYZA 4A8KA 5EWEA 3I82A 3AOCA 4Y65A 5DQIA 3MM9A 4Q0BB 1RXOB 4L73A 4L76A 1FJGJ 1YITS 3ZTSA 2NZCA 3WBZA 1RHUB 4OJ3A 5CYMA 4EFAC 1UWAA 3JB9k 3FQLA 2GIQA 3TZXA 3N4WA 2BM0A 2B8PA 3PW7A 4RNHA 4M5DA 2L08A 3VAFA 4ZS6A 2HHXA 2B9YA 5J1EB 5B0AA 2I5JB 3ONQA 5HO4A 2BM1A 2FGCA 1OPZA 4ZOSA 1NO8A 3MFHA 1SI9A 1GMWD 2ERRA 2MKYA 4RW4A 2D1CA 2Y0SD 2UZAA 2FHKA 3J7YU 3BR9A 4F25A 2B4PA 3AD8C 3EGVA 2KRBA 3GP9A 4U95A 1WG1A 4Y2CA 2KU7A 1RWMB 1KP6A 3GE9A 4M5IA 2ZHBA 2GQCA 4HH0A 2RQMA 1C1BB 3M9NB 2PE8A 3ETOA 1MWQA 1PO6A 1N48A 4GO7X 4NLRA 1GT8A 2W25A 2ILYA 1TL1A 1KLMB 4UUXA 2CQIA 1X4EA 3OR1A 5IOLA 2V2VA 1BWVA 4B3RF 2H5IB 4ZCKA 4GKJF 5B08A 3BJYA 2F3JA 3E3XA 4L75A 1D1UA 2G2YA 4ZVRB 4I4BA 2C2ZB 5IC4B 3KLFB 5CXTA 2HHHF 3HZEA 2VBXA 4YB6A 3W62A 4BLGA 2XMAA 1H2VZ 1AA1B 5KT6A 2AGQA 3GV8B 2XMTA 2QEXS 2ZE2A 1KNZA 4JI5F 4K5RA 3GIKA 5ETQA 4NLYA 4J9QA 2CPIA 2DNNA 5LMUF 2D3O1 1BQMB 2UUWA 4DV1F 2B4UA 2J9DE 2ZH5A 3HPOA 2PI5A 3N6MA 4WBFA 1SC6A 1NAQA 2W2MP 5HATA 2E9TA 1R7IA 5LXYA 4KH0B 2GHPA 1NK0A 5KG7A 1JQGA 2YNFB 1TMMA 3C16A 4HR2A 2KYXA 4ICLA 5GADU 1WELA 2GQ2A 3NXZA 4G65A 2XB2D 2CQ1A 4DFKA 3TJ8A 1HARA 1WJ9A 3OL6A 4LF1A 1KSPA 3CUNA 1T03B 1EP4B 2E5HA 2DRBA 4IQXA 5L46A 3EWGA 2MQMA 3FUYA 2LA6A 5B0CA 1X4AA 5KFPA 1HR0J 4PABA 3MM6A 2WTFA 2HZAA 3CWJA 1HPZA 3ZZPA 1PJ7A 1JJ2R 2XHCA 1EZZB 3I4PA 4DV4J 1VQ9S 4O44B 4G1PA 3I9V9 3HVWA 3ILIA 1DJ0A 2LXIA 5BXIA 2YXLA 1C2PA 3MPWA 3J7A1 4NLSA 2Q66A 1OIAA 3LWLA 3GCWP 2NLWA 2RDJA 4IUFA 4H4KA 3IS9A 3IR6B 5D8HB 3CVKA 2EKYA 2MQ8A 2BJ3A 2CPHA 4EZ6A 1JLBA 4NXNJ 2RU9A 3ET6A 4Y34A 3IRXB 4IG0B 2B9EA 2BACA 5KFVA 3H42A 1REGX 4CNYA 4ERDA 3AT1B 1EQMA 3ITHB 2ZNYA 2OI2A 1ITPA 4ECSA 3W9HA 4L6V3 2RUSA 3JTNA 4TVAB 2VG5B 1NDPA 2H5EA 3QGPA 2K2PA 3QPIA 1K1QA 1TU0B 2Q6CA 3SV4A 3T19A 1J5EF 2M88A 1AB8A 4NXMJ 3EPIA 2ASDA 2JSXA 2D41A 3TRGA 3DKDA 3MEEA 2YNGB 1ZM2A 1I5OB 1Q86T 4RL1A 3OUYB 1VOMA 4B9SA 1GTEA 4P72A 1K0VA 2XI2A 3LGMA 3FBCA 3QIPB 3H20A 4NA1A 2V0NA 3M30A 5DG7A 1C4CA 3D6FB 1KC8T 1WHWA 4EO6A 1OQ3A 1OSCA 2DGSA 4QR2A 3UQSA 2YPYA 4DI6A 4FXDA 1WOPA 1CJTA 2Q79A 3J7Z5 3QZ8A 2V5HG 1RWOB 1WOSA 1F2GA 3F56A 1DTQA 2IDLA 4ZN3A 3QWPA 5A2QU 3J81U 5J2NA 2ZOGA 1UFKA 1U6BA 5BJRA 2AGPA 1OYEA 2Y9HA 3GU0A 1FEHA 1SJQA 5KG2A 3IFEA 2J0WA 2RUGA 1P1TA 4DZ6A 4XIUA 5IT9U 2OAUA 1GQEA 4P9SA 2UP1A 1FXRA 2IJFA 4N5SA 2GW8A 2VZ9A 3JSMA 4F4WA 2H54B 1HW9A 1N32F 2RNEA 2FD2A 3R7NB 3NNHA 2Y1IA 5DM7Q 2KKHA 2ZJPQ 4ID5B 2F1FA 1U0HA 3FQKA 4CO5A 2DPIA 2VODA 1NJXA 2CVEA 2QO3A 3N5BA 1L5UA 1HBMB 1CJUA 2HQIA 2HSEB 4J9NA 1KEKA 2ALZA 4KFBA 2AIRB 1WC4A 3TUPA 1WUUA 2HHPA 2FIUA 4LBIA 3U27A 3A8JA 2OMOA 3KKFA 2NS1B 3BB5A 5D0EA 3KLEA 3MPUB 3QSIA 4DPTA 2IBOA 4GRSA 1ICEB 4ALZA 2OH2A 3DGPB 2HMIA 4JI0J 3MEGA 3MHYA 4Q2LA 1KBRA 1IQTA 4QIEA 3WC2A 5ETOA 3T5KA 4JI7F 3VHQA 3R5GA 4HDGA 1UTAA 1VFJA 1VISA 2FLPA 3DRPA 1W2IA 2X3GA 3NOGA 2QFJA 4NCBA 4O4RA 4OX8A 2F63A 2MGZB 3CMAS 4DSIA 5HMXA 5KFIA 5B7WA 4DZDA 3KLIB 5CABA 1U2FA 1RACB 3BYRA 3IG1A 3D67A 4H4KC 1FD8A 2QV6A 3W2WA 2V67A 1RWWB 3Q24A 1VC5A 2DHHA 1T9TA 3JSRA 2J9CA 4A47A 1UA0A 2VPXB 3AJ1A 3F41A 3RAQA 2FY8A 4H4OA 4C98A 2NZ4A 3HFVA 4DR4J 2NXJA 1R27B 1EJ7L 1S9EB 3V4IB 4OHYA 1YGYA 2XY5A 4ZVQB 2H4WB 2VOPA 1JLQB 1FRKA 3NBPB 3E8OA 4DL0C 2DB1A 3MEDA 1E6YB 1R8HA 4QBUA 2KJVA 3HMJG 4ED6A 2F7VA 3MTJA 2Z30B 4N56A 2ZH3A 3EPGA 1JKHA 2L48A 3OTOF 3G8SA 3ZZRA 3OSNA 1T02A 3N5FA 2MPUA 3C6TA 2NUHA 2MY8A 2HLUA 1JLGB 1S49A 1IBLF 5KOXA 4DV2J 3F0NA 3N9UC 1L3KA 4PAAA 2MZQA 4LF5F 4DUZF 5DDRC 2PA3A 3OFFA 2W4CA 4DU8A 2GAHC 3DLJA 1M5PC 3ZTRA 4P2MA 3TZWA 1NHVA 5KFAA 3M1VB 2V8HA 2KHDA 4R8UA 4CO3A 5HN0A 4DLGA 1UWBA 2G2ZA 2PA8D 2YNHA 1HHSA 2XGPA 4M5LA 4OYAA 3D0IE 4Y00A 1PGZA 3SMZA 5HVFA 2C22A 4FF1A 2HNDA 5D4NA 1CS4A 2MJNA 3R7SB 1NPKA 1Q1KA 3SSSA 1HYSA 4V19J 1C1CB 1VJWA 3KUHA 2B7CB 2G13A 4P2SA 5A8WA 4UW2A 3ZZOA 3M8YA 2B6AA 2W7AA 1KONA 3DLEB 2BQ3A 5CZXA 3OFHA 2KTQA 4EI2A 3KLHB 1RT6A 2HFOA 4XTTA 3UN5A 1RT2A 4YB7A 3M4XA 2I9SA 2KO1A 1AXQA 1U4BA 1SQEA 2Y1JA 2A6MA 4KIAA 2KT3A 2UUCF 2BQUA 2CQBA 4OJHA 2NQPA 5AE2A 1QAYA 4P71A 4D3HA 5HQMA 5I3QA 4ZIVA 4C8MA 2CPEA 2APOA 1FE0A 3ENQA 2ZC4A 4LRFA 2OPSB 4M5NA 1RT3A 2JC0A 2IM1A 2CPJA 1WACA 4C9DA 4X4VA 2JX2A 5EX0A 3SIPB 4AL5A 3DLGA 4FPIA 3HD2A 2F4VJ 1ZZNA 2QGFB 4AXIA 2OTJS 1IBKJ 2LU1A 4FBTA 2GV1A 4NYOA 1JJHA 1QSYA 3KNGA 1B64A 2VV5A 4PWDA 3VZIA 3NCRA 5ETRA 4CLTA 1VYAA 2QJ3A 3P3DA 2R7TA 1S0MA 2HZVA 2UXBF 1F1BB 3FFIA 1U1KA 3M2UB 3D2WA 2ZH4A 2F5GA 4ZPWR 2CXEA 2C3UA 1JMTA 2RQKA 2W9AA 2DCLA 4DV5J 2HK2A 4HTJA 3HHNB 3Q89A 2V8GA 3B4DA 2U1AA 4FN5A 2OD6A 3T1HF 2QMUB 3IM9A 4N47A 3DCAA 1CLFA 2N7YA 3GMGA 4OZ5A 2XYPB 3PXGa 3VAJA 3E51A 4E2FB 4ZPTR 3MUVP 1H73A 7AT1B 4X4PA 1S0NA 2ZH8A 4S0MA 2GCFA 5E3CA 2AX0A 1HNXF 4J90A 3TO8A 1V6HA 2GO9A 4F7VA 1FRMA 3CSKA 4LF8J 4WJBA 4ZP6A 3PYGA 3OVAA 5LMNF 2XNQA 2ABYA 4YP3A 1CJVB 2QIFA 1TQLA 3MPVA 4A8WA 3BSOA 2CVIA 2R3VA 1DTTB 2ZDOA 3TVKA 1J5OB 2RH3A 5DG8A 2GJ2A 3BKUA 4HLBA 4HDHA 1YX2A 3TX8A 1SIZA 1NK7A 1TVRB 4IOBA 1FF2A 2EBEA 1YJVA 5FDLB 3KK3B 2JLFA 3KUEA 3CPWR 1S0OA 4OX6A 2XGQA 3FDSA 3JXOA 3O1LA 2E9RX 4IH5A 4YHHJ 2XG8A 3OHAA 1CJKA 3PW2A 4PG5A 1WF1A 3EGZA 1NM2A 1RHRB 3N79A 1U1RA 2KH9A 4WFNQ 2DXFA 1WNEA 1FJGF 2HHVA 2VFRA 2CJKA 3OL9A 4CLZA 2V4JA 1UVIA 3DU5A 2XMUA 1FESA 1LW0A 3MGJA 2V4QA 2FB0A 5GMDA 2CQ0A 4JV2A 4KB7A 3K8WA 1DQ8A 5E3PA 2CDQA 2FJWA 1A0OB 3FSYA 4PUOB 1RTIB 1SB6A 3P45B 5KFMA 2BDPA 1NH8A 3BGOP 2B0GA 1IM6A 3UR0A 4F8RA 4F4YA 4UY85 1RHKB 1YWXA 4ILLA 1JLAA 2QZ8A 2BJ8A 1FA0A 3EGNA 4B9LA 4QIGA 3ADAC 3TW0A 3QT7A 2LDIA 3KJQB 1E6VB 4U6PA 1R89A 3Q23A 3HJFA 3ZTQA 2E7WA 2VB6A 3I96A 4HHHA 1T9VA 5E3QA 4N7TA 1BQXA 2KJWA 1RTDB 4K4VA 3CJ0A 4RUAA 3J7ZT 2C2DA 5IWAJ 3C2PA 3MCNA 5E7OB 4RBVA 4H4MA 4NL5A 3PW4A 4WFZA 3NL0A 5G4DA 4I2QB 1SBRA 1B0TA 3GSIA 4ZVUB 4Q5VA 2XULA 3M9MB 2BJEA 1Y3KA 2YVSA 1YJTA 2BJDA 2WW8A 4FXVA 5KFSA 1FVSA 1TL3A 1Q79A 4NLQA 4N8OA 1GFWB 2JL9A 2R8IA 3EZ5A 3GG0A 2CPFA 5L1KA 3HX9A 2MQLA 2J6TA 1VQNS 1VRUA 2O66A 2C3MA 3BSAA 5KFNA 1S97A 1TZ0A 1RA6A 2JEJA 5HVGA 3A3PB 1BXNA 4IQMA 2HBYB 3ILOA 2DEJA 4ZVEA 5AXNA 2W7OA 2V8PA 3S01A 4ZCLA 3HXMA 3AJ2A 2A3JA 3QO9A 4U96A 2ADBA 3I5BA 3DDKA 4DU7A 3M8PB 4CTAB 2XMVA 4DSLA 3W9JA 3PIPQ 1GXLA 5F41A 3CCLS 4MT1A 4WK1A 4N76A 3H5XA 3CJSA 4DV4F 4ID8A 1RT4B 2CPZA 1NZAA 4CDIA 2G4BA 2BANB 2J7WA 2WOMB 3P49B 1N33J 1DRZA 1PCAA 2XWXA 1K9MT 2C1EB 1VS3A 3UDCA 3VGUA 1YDLA 5C25B 3OVBA 1X8DA 1HQEB 2RSQA 5J1PA 3KLGA 4ZK7M 2XCPA 2A2CA 1ZA2B 4RU9A 4J9VA 3NAHA 2J7UA 1HWLA 2EFOA 1GMUA 1PAEX 4WP9A 4DX6A 4NI2A 1S1XA 3EVOA 1DZ5A 2AP6A 5F9LA 1VRTA 4P7VA 3HSJA 4FYWB 1UVNA 2M4MA 3X3UA 1QTNB 4DN0A 2O3DA 3OQ2A 1U2RA 2WBRA 1KRPA 1Q53A 1S1WA 4QIVA 2OPRB 1Z4UA 2NCKL 8ATCB 4CH0S 1S5ZA 4RLEA 2MTLA 4IDKB 3T9ZA 5A6WA 2UV8A 1IR0A 3W65A 5K14A 1IN0A 4DUYJ 2IM2A 1CSJA 1M5SA 3BBBA 4CO1A 4HHUA 4NWBA 1PG5B 2SXLA 3I0SB 3R1HA 3QJPA 3GCXP 4NXMF 4JV0A 4UOFA 4ETZA 2PFFB 4NLDA 1N5YB 4W4MA 1ZTTA 1V9OA 4DPUA 3THPA 4KGZB 3W8GA 3KHHA 3K2YA 3LP2A 2IYGA 4MKAA 3R7BB 4I2PB 4JV5J 3T1AA 5M2PA 4ZVGA 3OTCA 1VQKS 2OSQA 3E2EA 4EBCA 1Q8BA 1TFYA 5EWGA 1PYTA 2YKNB 1JWWA 4RKUC 1LXJA 5E3AA 1V3RA 2HG4A 4DCOB 4JP8A 2A1BA 4G3IA 2ACMA 2OPQA 4OHWA 2AEMA 3LALA 2V6AA 4C8YA 1REVB 4JI2J 5FJ4A 2R8GA 2CG4A 1XERA 1QE1B 2LYVA 1AZSB 4AD6A 3KJFB 5AXKA 1AYEA 2J0SD 3CJKB 1JLEA 1F5CA 3DOKB 4F4ZA 2FVRA 5LSRA 2RB7A 3C66A 4DV7F 1HNWJ 2W4PA 3R5CA 2KZMA 2KM8B 4ZN1A 3UFCX 2HNZB 3BSCA 5HROA 1FERA 4NRTA 5K9FA 1R31A 2FPHX 2G1HA 5H9FJ 3UI3A 4QPXA 5EUHA 2XMJA 3G82B 5F3TA 1NB2A 2N4DA 4NYPA 3R8YA 3FEXB 3K7RA 1HQUB 3EX7B 1U0SA 2FLOA 1OQ6A 1X4DA 3OW2R 3H5SA 1OO0B 4JI0F 3MAAB 3MEKA 2ZBQA 3SQOP 1KS2A 1HBOA 4FNHA 4WFXA 2MQNA 2L41A 3RB6A 2M0GB 1M0SA 3TAPA 4ZIWA 2A10A 4KHMA 1UW9A 4ZHRA 1DAXA 2HS3A 2KXNB 1M5OC 2ZH9A 3K0JA 4DHVA 4MJKA 4FS2A 1G1XA 1HIYA 1LFPA 1UEKA 1TELA 5JMNA 4TXSA 2CA9A 2XZWA 2GAGC 2BQRA 1GMWA 1RTJA 2QLXA 1RWVB 3H90A 4KV8A 1MW7A 4RNOA 5ADZA 3T5JA 2JZ5A 2KDOA 2FVCA 4Z7YA 2HHWA 2HWHA 3B6BA 4OYMA 4DR4F 1S6PA 1KLNA 2VDHA 3LO3A 4KKOA 2LXUA 3BQ1A 4V19X 1XMOF 2GVZA 4NZ6A 3OUYA 2K3IA 1R0AB 1XMQJ 1S77D 2DJWA 1SL2A 3IA0A 5F9NA 5J2MA 2CAJA 3AH6A 3KFWX 1FDBA 1S7IA 1RTZA 4IFVA 3GYNA 4M5HA 2VG7A 5E5NA 3VAHA 2H5JB 5DDPC 4O3SA 2HRUA 4MKYA 1TUGB 3KJNB 3TR5A 4CT9A 2HNYB 2IYIA 1SVDA 3CCWA 5THWA 2O01C 2OEJA 2AYBA 2D74B 1HI0P 4R5PA 4DMZA 2DGUA 3V6HA 1NK9A 1U2CA 4USKA 1XN9A 3HSZA 4DV2F 1ACMB 2OELA 1ZOTA 3BGLA 3M32B 2XC9A 4XAKA 4B17A 3FRZA 4IG3B 3UDEA 3CDBA 3QRQA 4R0EA 5KT4A 3U1NA 3D9BA 1R8BA 3R6LB 4OYIA 3G87A 4PG7A 4CLSA 3I31A 5L9NA 4K2XA 1N34J 3NGSA 2X1AA 4HVZA 2MDAA 4M8LA 2HFSA 3DLKB 2GIFA 3SSQA 1V5VA 2A0FB 4J9UE 1S9GA 5J2PB 2V69A 4ID5A 3EZOA 1WEYA 2JC1A 2GJFA 1IKVB 4AL7A 3QIDA 1RCOB 2QYCA 4B3RJ 4IFYB 3DI6A 3PYDA 1X4HA 4KO0B 3DYAA 4U67Q 2H4YB 1WDTA 3GJQB 4L74A 4DL2A 3WHIA 4L3KA 1WSRA 4UY8T 2J6SA 2MKJA 2MQQA 2GVDB 3DOLB 1Z1ZA 4P74A 2BXJA 2DGTA 1NEEA 4JI5J 3FKBA 3NCPA 1HBNB 4B3MJ 2HAFA 4KHRA 5GMEA 4ATNA 4C48A 4DV1J 4C7QA 1ZBTA 4C6AA 3CCQS 1U1LA 3GR1A 1GX6A 3W7BA 2MZSA 2XSJA 3NWGA 3Q8YA 2CWXA 5EN1A 4RWWA 4O3QA 4ZDNA 3M2VB 3OJSA 4KE5A 2CZVC 3AFGA 4ZPVR 1FKOB 3E01A 3I6PA 2AKWB 4M63A 3CTRA 2AWZA 3IBWA 1SUQA 3S8SA 3MCMA 1HBUB 1ZM9A 3FCVA 2DHSA 5BYRA 1TKXB 5GAGU 1S1VA 4OYPA 4ZITA 1RAIB 3FEZA 4ECUA 1RTHB 3UVJA 3GIJA 4CH7A 3KK1B 4EU0A 2D3OR 4OX9J 4PXDA 3AQOA 4NLPA 1DLOB 2O1PA 5F8NA 5B0BA 1KR4A 1SC1B 2RT3A 3N6LA 3PCOB 4OYWA 4DR7J 5HLFB 1WTFA 2RS8A 3GTYX 1T9UA 5HQ8A 2X1FA 4ED3A 4TU8A 3TJ9A 2J9DA 2HGLA 4OYOA 1NPPA 5DG9A 2AGOA 3HVTA 4DV5F 2DNHA 1O51A 1VBKA 1RWUA 2C42A 1G4CA 2QLBB 2ZZMA 5IQ6A 3MMBB 2BKNA 2YKQA 3W2VB 3BGRB 2CYYA 2JLEA 1XBWA 2W2PP 3OBIA 4WWSA 4CH1A 1URNA 1XR5A 2VOOA 3VR1A 3SSRA 3G6XA 1RSCA 3J80U 4URSA 2PIIA 1S59A 4DR6F 4NZ0A 1I3OB 4QIWD 3N0VA 2G0IA 3ULHA 3MM7B 4LF8F 4ES3A 2JJ4D 3CNQP 3OLBA 4GC7A 1HL6A 4DFPA 3POTB 5K5MA 1HI1A 4EGLA 1FWKA 3KK2A 3HVRA 4LSLA 2E29A 3B4MA 4DPWA 2GC8A 2B4VA 2QL5B 1GTHA 5B0DA 2BYCA 3GYXB 1M1GA 2DCUB 1HI8A 4OX7A 4CO2A 3OV7A 2F8HA 2IRXA 4BHQA 2GMHA 4X66F 2W9BA 2HAIA 2D7SA 1XR6A 2IJRA 3LAKA 1UVLA 1RAOA 2QSWA 2HVZA 2K7JA 3D66A 5CCLA 3NMRA 3PEJA 1CQMA 1UPPA 3VTIA 4YFUA 3MTKA 1NDLA 4R25A 3BEGB 3QNWB 4MKBA 2E1MC 1FK9A 1T3OA 1XNQF 2NR0A 1VIXA 3IXQA 1RAJA 3MMAB 3JYTA 1RT1B 4HI2A 1Q81T 2ZNZA 3RZAA 4MK9A 1X4BA 4AXJA 3DRRA 4ZJLA 1NLKL 4DR3J 4PPZA 1UPMB 3K5LA 2BA9A 2XO7A 3H8YA 5D4OA 4FBUA 2XBPA 4U8YA 4RW7A 1N5SA 3D68A 1MROA 2ZZTA 2YX4A 4A8SA 5KT2A 1MN7A 2YKOA 3GSDA 1LWFA 3D1HA 3QGHA 3NGRA 2WSCC 3N01A 5DS7A 1ZS6A 3FMWA 2RHQB 3QJJA 1RT5B 5H9EJ 2K7KA 4LF9J 5HMWA 1B7YB 2QTWA 3US5A 2ZH2A 1TV6B 3HZGA 1SJRA 4F02A 2YX7A 3IMQJ 5DQHA 1SC3B 3SCLE 3HHLD 3HFKA 3Q83A 1BWEA 5B09A 1NHKL 1HHTP 4DQQA 1NDCA 5AXLA 3PFOA 1YRXA 3LUYA 3NS7B 1TKDA 3CCES 4XK8C 4JV1A 1YQHA 4WZMA 3RBZA 4LJMA 1TKZA 5DZ6A 1FTCA 2HBQB 5JVHQ 3OR2A 3KJVA 5A76A 4O4GB 3I9ZA 4CZCA 2FZCB 5KFHA 4MK8A 1KOHA 2KT2A 2IFXA 5KAKA 2ZH6A 1KWMA 4K59A 3R3TA 3OSPA 1X9SA 1UP1A 3P6YC 3NGTA 2HVHA 1KHVA 1IKXB 5LSLA 1WOOA 4OHXA 2KXFA 4DCPB 2RRNA 3LTOA 2I0XA 3NGUA 1Q8KA 2AEFA 4F04B 4RJVA 2HZCA 2HFUA 2KN4A 4LVNP 3LP1B 2HURA 3ZZUA 3VQTA 1BLUA 3MMCA 5T7LB 3GB0A 1AFJA 3SYZA 1KKHA 2HW3A 1OJ4A 1Q7YT 3F44A 1MU2A 1Q7LB 2MKKA 1N54B 1IQZA 1R0CB 1TAUA 3LP0A 3DRSB 4Z7CA 4I7FA 4DN9A 1FKAF 4AE5A 3GFZA 4F4AA 2VJVA 3CCVS 2MJUA 2HQFA 1KVJA 1NSPA 2ZKUA 2HQCA 3RW7A 2DHXA 3EMTA 2ZM6F 3UCUP 4IR9A 4E0DA 2WRMA 3QAEA 3MXHP 2CKWA 4F0KA 5I42B 1JLCA 2FHJD 5A8KB 2BE9B 3LGNA 3QGGA 1QTMA 3BS9A 4ECVA 4WXOA 2BE7D 2K8GA 2CQCA 4DSFA 3EJMA 2N82B 5C5JA 3I56S 2H51B 4NLTA 1FI4A 1VBXA 4EYHB 4IYQA 2IY5B 3R1LA 5IS2A 4PUOA 5GADI 3MM8A 1OPIA 3ZC4A 1RE1B 1IXKA 3MAQA 2WVBA 4QJVA 2XYGB 1AUSL 1Z2ZA 5MAOA 2CJBA 4NLWA 4P73A 1YVFA 1U24A 2M52A 1ELOA 3KLVA 2DNMA 2H3EB 3UD4P 5LJ3Y 2O5DA 4NRUA 1F9HA 5D0GA 1JIHA 3PV8A 2B3TB 4LREA 1XEZA 4DUYF 1SJ1A 5MLCV 4M1KA 2OPPB 4CLWA 1RLDA 4I69A 5JXSA 4K0KF 2B5JB 4YR0A 3DRXA 2EFGA 2XM3A 3ZZTA 3PM9A 2LQJA 3MWBA 1MMDA 2BJ1A 2IAJA 5G0RB 2JEFA 1WC6A 1FWLA 2QSFA 1U1OA 4ZCIA 4F3OA 2RE1A 2AJ4A 1UA1A 1QY7A 3MM9B 4JV5F 2QYGA 3DGVA 3D6TB 2ZD1A 5GAHI 1VJQA 4ZVHA 2P9CA 4ANCA 5CYMB 4I56A 4ZA1A 2AV5A 2UUCJ 2IA6A 1U47A 2ZOMA 3AB2B 4EUVA 3GV7B 1C0UA 4M5DB 1PYOB 3EXYA 1N5VA 1RWXB 4WKYA 4OI2A 2UV8G 1W7WA 4RZRA 4KR0B 1FHTA 5HANA 1FT8A 4JI2F 1RK8A 4C97A 1BE4A 3Q0AA 4WXWA 4RW4B 2QLFB 2R2SA 2E7XA 4Y6IA 4DL5A 3DLBA 3C19A 5FLXU 1FRHA 3CC4S 1U1MA 2ZVIA 5CH7B 5J2QA 1RAEB 4PYDA 1NJZA 1SXLA 2GZOA 3M8QA 4OJGA 3S1TA 1IKYA 2FJDB 2VDIA 1VLOA 3SCIE 1WKJA 5I3UA 2F8MA 4QU7A 2UXCJ 3MURP 2JDJA 2R4FA 4J9RA 3VGVA 5HMZA 1I94J 2CNKB 3OR1B 2CQPA 2KT5A 1HLWA 1FRLA 2I1RA 1PJ6A 4TLRA 3VCDA 3H0PA 3M05A 2K3KA 1HKAA 5B0EA 1KQKA 5KFJA 5RUBA 3CEDA 1QLNA 4MFBA 2RQCA 2DGVA 4USJC 2EC0A 3KHGA 2ZE2B 3AHPA 3QLHB 1HD0A 2E66A 1HNXJ 2HGMA 2YY3A 4IH7A 4TYAA 1BD6A 4FYDA 2BUNA 3DHXA 4IKAA 4LR7A 3TNVA 3PG9A 1SQGA 2N3LA 1RP5A 1HMVA 3T1YF 1F2HA 1N4LA 5HBMA 1S1TA 4KHPJ 1VQPS 4ECRA 4PXBA 3C16B 4ICLB 2DIUA 2WSEC 2IHR1 5DETA 1XC9A 3PVXA 3QBCA 2B9WA 2GHVC 1C4AA 1APSA 1LKZA 2DTJA 3PW5A 3UD5A 3C6UA 4X62F 1IBMF 5JJBA 1HPZB 3FRYA 5D3GA 1XMQF 3RW6A 2UVRA 1RABB 5A0YA 3SCKE 2LXFA 2NXEA 1SH3A 4OMFG 4HACA 3PX0A 2YKMA 1XMBA 4TYBA 3Q22A 4KT0C 2DPJA 5DQGA 5CD4H 1SC4B 4J9KA 2VPZB 4HI1A 3OHBA 1NSKL 1O5JA 2VIHA 4PWWA 5E3RA 2FJEB 3IS9B 2P5VA 1Q82T 1BMQB 1AT1B 3UPFA 1M5VC 4JBCA 3NCQA 5T41A 4L72B 5A2QY 3J81Y 1PYSB 2MKIA 2HBZB 2YWHA 2RKIA 2POKA 5IT9Y 3VZHA 3ET6B 3G96A 5HK4A 5C7PA 3U1LA 1N34F 3CO9A 4DLEA 3BBFA 2VG6A 2BE2B 3HD1A 5AXMA 3I4HX 3W5XA 4LF4F 2ZHOA 1B0PA 4WIQA 2DIVA 3HSGA 2QMWA 1WC5A 1JXLA 2E9ZA 3C14A 1IVZA 2XS2A 3BPSP 4WPAA 1K1SA 4C11A 2I2YA 4LVOP 2M3DA 3RYLA 3CGIA 4G1QA 5CZVA 2RF2A 2DHGA 2R7UA 2RD5C 4UOCA 2V2ZA 4DR5J 1WG5A 4ZLLA 5KFCA 3R9LA 3MEEB 1X9WA 4M5KA 4RUCA 4JOUA 5FD1A 1K0TA 4FXWA 4UT4A 4B3MF 3CB4A 2IVMA 4EWTA 4LBHA 4B9VA 1RGVA 2MZ1A 1PBAA 3QGIA 2ILZA 3DLHA 4NASA 4FZVA 3M30B 4LR8A 2KI2A 1FJCA 3M6WA 1KVIA 4WE1B 2WCXA 2Z56B 1UETA 3HF5A 2H48B 2HVIA 5C42A 2EEYA 1UJ4A 1CJTB 1G3OA 3FJ2A 1NH7A 4Q43A 1PC4A 2BKPA 1XTZA 2QFIA 1X5OA 1DTQB 2Z2LA 5L1IA 3VAIA 1LV5A 2G0JA 3W8PA 1IKWA 5J2NB 1FJEB 2QLJB 4TNOA 4CP5A 4WCEQ 3UWTA 2IC3A 3VAMA 1S76D 2HQGA 2NREA 5FIIA 4KAIA 3BDEA 2W2QP 1FD2A 4USVA 4KPYA 4OX9F 3JSMB 4Y3CA 4ZPBA 2AT1B 2CZ9A 2B4OA 5KFTA 3R97A 5KFRA 1Y10A 2E5LF 4LSNB 2I8EA 1U0HB 2HWIA 3L3CA 2JNJA 4DR7F 4OIXA 1CJUB 2DR8A 3HVAA 4FF3A 3FZBA 3MOJB 1HNVA 1WKLA 2OGUA 4HT7A 1F5AA 4Y2AA 4Y0FA 1ULRA 3CMQA 3P5BP 4A8FA 4EBEA 3Q8UA 5B0GA 2YH0A 3DM2A 3KLEB 1XWLA 3MR2A 4FPRA 4RW8A 3J81j 3D1QA 3CD7A 5GAHU 2NXUA 4USTA 4DL6A 2E1PA 2OFGX 3A13A 2IDEA 1K47A 4C8NA 2HMIB 3MEGB 2XEXA 2DRDA 1TUVA 5IM0A 1WEXA 3S7RA 2UUBJ 2BJ7A 2ZBIA 4RUHA 3G9CA 4TKTA 2YX1A 1Z2LA 4PR6A 2VQEJ 4OZ1A 3DRPB 1RHMB 2MMYA 3A1YG 2R2TA 3PRDA 2AX1A 1RT7A 3A4TA 4TN2A 5ETLA 4PKDB 4O0NA 2MZRA 2MLXA 3IG1B 4IO1A 5DZ7A 4C8LA 4WTOB 1NJIT 3W2WB 1RUSA 1VRQC 2PI4A 1JNRB 3RB3A 1OY9A 2CQ2A 4N41A 1RA7A 5C24A 5DLFA 2FJAB 4LR9A 4H4OB 3M8WA 3NGKA 4FF4A 2YKPA 2RDDA 3NG8A 3WDOA 3ZO7A 1X0FA 3KDNA 9RUBA 5ETKA 2QC3A 2P6TA 1HWJA 2IMOA 2AD9A 3D0HE 4TLQA 2IBKA 2HS0A 3MEDB 1ZETA 2VU5A 3D6HB 1NU4A 4IOAQ 4DR3F 3QMQA 2DY1A 1U8WA 1JKHB 4WIIA 4CNZA 3CCMS 2FDNA 2ZUGA 1LWCA 4CIOA 5KFBA 2IRUA 1KQGB 2B7BB 2MLZA 2ZDPA 5F8GA 4RW9A 4HH1A 3HFZB 5LJ5Y 1HBUA 4OI3A 4DV7J 2MHEA 3NMAA 1DBDA 3Q8QB 3CCRS 2M9KA 1IUJA 2CUYA 3I5AA 4DFMA 5D77A 4P2XA 4U7CA 1YRTA 3G8QA 2WHOA 4WYLA 2OP5A 3I5CA 3ICLA 2VHGA 3LGHA 2BW7A 2P2CB 2XTJP 4LF9F 4B08A 4R8UB 4G6VB 1RZMA 2V94A 4XPCA 1UWBB 1TKTA 3UR3C 4AYBD 1FJ7A 2YNHB 3SQGA 2ROEA 2AMCB 4ES2A 2ZJQQ 2CDRB 4MIAA 3MECA 1HW8A 3PW0A 2UVWA 3T6BA 1QSSA 4FYVB 1UKUA 2F9JA 4DV3J 2HNDB 1CS4B 1L3UA 2LEBA 5D78A 1HYSB 3TI0A 1NB7A 2J76E 3K89A 4NCAA 5A8WB 1X4GA 4QR1A 1LEOA 3PRBA 3C15A 4MYUA 3AA9A 1N52B 3SDEA 1NNDA 2EPIA 4GKKJ 3X1LB 4DX5A 1Y0HA 1LQ9A 4Y28C 3NS6A 3P5TL 5A8RA 1T7PA 5L1LA 1RT2B 2EXUA 1FDAA 3Q8SB 2W9CA 4W98A 1VC6A 1JNZB 1PAUB 2V2KA 3H40A 4NX9A 3BBCA 4ELVA 4CO4A 4QWDA 4U7UK 3WX8A 2AHOB 1MSWD 2E1CA 5L38A 3TWZA 2V8VA 3TA0A 2BMBA 3J7AN 2EWHA 2ASYA 4ZVFA 5IQQA 2E5JA 5CA5A 4KQZA 2VC0A 1RKIA 1VR6A 1RT3B 1XK8A 2Z8QA 4CT8A 3CCUS 2XLKA 3DHWC 2RRAA 2KZZA 2UVVA 4P75A 3QAUA 1TFWA 2XZDB 1B99A 4NLVA 4FS1A 1XMOJ 2Z57B 1ZM4A 4DR1J 3JTPA 3D5MA 4ANDA 1P8GA 1SKUB 1KN6A 3FSXA 2X51A 4X4TA 3FC9A 5HP1A 1NKBA 1T9WA 4PWDB 2Z0GA 4ED5A 1Q4RA 4ECYA 3JAMU 2DO0A 2N4CA 4M5GA 3FFIB 4OZ3A 5HI7A 5B0FA 3G2XA 1D9DA 2QX0A 3R2DJ 2WONA 5F8MA 1UZDA 3IWXA 3GR0A 1T05A 1H7XA 1A7GE 5LOQA 2G9OA 3CXCR 2GQQA 1FKPA 4OLPA 3PEHA 3V81A 3NY0A 1Y4ZB 3NEKA 2CG8A 4FF2A 3OL7A 1X7VA 4RO0A 2R9LA 1R8CA 1ZM3A 3OXLA 3IGVA 1U6FA 1IR1A 4CCHA 3BN4A 4KGKA 3RGIA 2Y1RI 3VALA 1VBYA 4NPOA 4D3GA 4JB8B 5BR8J 1FVQA 3H4DA 1IM4A 3MM5A 1RT5A 4DDFA 5F0UA 1N36J 1WI8A 3B78A 2QG9B 4DSKA 5KG0A 1RLCL 2DGQA 3NLCA 1N88A 3RBEA 6FD1A 5GVQA 1ZAWA 2PDAA 3SZ2A 2GGPA 2OHDA 4J5OA 4JYAF 4YDXA 4DL3A 5CYJA 3GWCA 4F2RA 1YJRA 4DWIA 4F67A 1YJUA 1LW2A 1CJKB 1VCTA 3CJ3A 1RI7A 2YWKA 3O44A 2HHSA 2HWTA 3PDNA 5SZTA 1RHQB 4PPDA 4AFFA 1CULA 2V4JB 2MLYA 4RW6A 6FDRA 3G71S 4BCAA 2LP4A 3QSYB 2YQ3A 1LW0B 3ILLA 3BO4A 4O4GA 1FEEA 2BV3A 5I3PA 5KG3A 2PO4A 4ZP8A 3A3OB 2PSZA 2DR9A 1H7WA 5ETTA 2OTLS 2MB0B 4J7CA 4OQJA 2EW9A 1HNIA 2BJ9A 1J27A 4J91A 5CYQA 5E0OA 1RU2A 1M1HA 1JLAB 2GIRA 3PYEA 1Y3JA 3D4JA 2ASJA 2COLA 4RU2A 5KFZA 4ECZA 2PD1A 2OO4A 4DPXA 2LA4A 4OV6A 2CNLB 3GONA 5KFGA 2K06A 1XNRF 1GMVA 3OXFA 3H25A 2VASA 4X65J 3EDRB 3T3FA 3HDSA 5GAEI 1RDRA 5DM6Q 3UCZP 2RMLA 3W1YC 2XCAA 3F73A 2XSFA 2UXCF 1H3DA 5K8OA 3GJSB 2H65B 2P6SA 1SJ3P 4UTGA 1I94F 4I64A 5IC6B 1MMNA 3AAWB 2YBVA 4WFBQ 3DOMA 1TL4A 1JK9B 3G4SS 2HHQA 5HMYA 4X4RA 2V9WA 2F65A 2Z2ZA 1WHXA 4ZJOA 3GILA 1RBLA 4H4MB 4I68A 3H7HB 1JLFA 2DNRA 2WVDA 4HEA9 1D09B 4X64J 2L3MA 5F8JA 3M7VA 3FGVA 1VQLS 3O2IA 4CYUA 1FDDA 2EG2A 4NZ7A 4A4JA 4F4XA 1VI7A 4DR6J 1BQNB 3DMJB 4Q8FA 1GEHA 1LWEA 4WYWA 1TL3B 2HRYA 4QR0A 1OY6A 1MG7A 4FVMA 2WB1D 2UUAJ 1RAHB 3AD9C 2CPYA 2IVFB 3GJRB 2IM3A 2FC9A 4KHPF 1VRUB 4X66J 4Q8EA 1TK0A 4ZLJA 3M8SA 4I67A 1W25A 1WEZA 1EHWA 4DPOA 4B3OA 3QO9B 1H2TZ 2DNKA 4NLUA 2HGNA 1S1UA 4ZP9A 4QYZJ 3CCSS 2XLJA 1LOUA 3TX0A 2AQ4A 2CNOB 3T6JA 1Q78A 4DCJB 2EK6A 4DQIA 1XNQJ 2JHEA 4JI8F 2DNQA 2QN6B 3VV2B 1IBCB 3EGWB 3M2RA 4IOCQ 4P52A 4DG1A 2YNIA 4LF7J 2J9EA 4C0BA 4QPTA 3V4MA 4AQYJ 1NPRA 1NBEB 2EI5A 3D6MB 3R6GB 3HHLA 1DFDA 4YQWA 3G6ES 3KLGB 3NP5A 1AFIA 3DLLQ 1QAJA 2XO6A 3FSIA 4NI2B 1S1XB 1DARA 4NLXA 2EKNA 1B4SA 3L7UA 1TL7A 1VRTB 2W8LA 5H9FK 4PQUB 4QW9A 4KTQA 2QA4G 3L4BC 4PYAA 1IWAA 2V8DA 4RBTA 1QVFR 1S1WB 4C3LA 1U7LA 3DC2A 4GVBA 1U25A 3V6JA 4TY8A 3VWSA 2XZTB 4HKQA 4X4QA 1J2VA 4ECXA 2EK1A 1GNKA 4QWAA 3SFGA 2WVFA 1GX5A 3AD7C 2DHAA 1SV5A 3HI9A 4DFJA 4WP3A 1TK5A 3Q8VA 4HL9A 4U9RA 4Z2XA 5K14B 3TAMA 2F40A 2Z2YB 2HYIB 5HJXA 3HLUA 3BYPA 1YZ7A 3I0RA 2L9WA 4DR5F 3UDLA 3A8IA 4A8YA 3QRPA 2GHWA 2R8KA 3ISZA 3V2UC 4OJ1A 4HHJA 2MKCA 1VQ8S 4KH1B 2LQ8A 2HVDA 2W1BA 3W60A 1SJ4P 1DQ9A 1PSDA 1VDHA 3LP2B 4CQ1A 4M95A 5DGBA 3V6DA 2LQ9A 3M8RA 2AJQA 1WF0A 3EICA 3QLHA 5K8PA 2G0CA 2FHJA 1YTYA 1R3NA 3G6VA 1T94A 2OD4A 2FLLA 2HS4A 2M5YA 3HT0A 1C0TA 1PILA 2HIQA 3TEGA 3TANA 2DK2A 1U45A 5J1NA 2ZH1A 1Y5IB 2OPQB 3ILJA 3SEOA 4URGA 5DGAA 2RRBA 4XO0A 1EETA 2NXCA 3CIMA 5IV4A 2Z58B 5KFQA 4F0HA 4P6QA 4F36A 1VIOA 1JLEB 5KG5A 1G2EA 2XI3A 4JUZA 3AY0A 2D3UA 5DDOC 4ANEA 1M1KT 2ZM6J 4Q0BA 3T41A 4EYIB 1NUEA 4WTYA 3O6QA 3IBCB 4K4XA 4B3TJ 4DSEA 2DNYA 2VL1A 3IM8A 2ZBCA 2MZJA 3IBFB 4MYTA 5HROB 2DVIA 2RVJA 2GMJA 4X2BA 4IRDA 2HEKA 3KNAA 5J1EA 2I5JA 4FKYA 2LFVA 1WI6A 1FXLA 4DQSA 9ATCB 4J37A 1I51B 2YWGA 4QU6A 7FD1A 5IFMA 1WC1A 4ZLNA 2ZUAA 5GAGI 1HBOB 2FGOA 4BS2A 4B9UA 4OI6A 2ZHAA 2UUBF 4KY3A 1UVJA 3I55S 1C1BA 4JI4F 1CEZA 4K7QA 2GA7A 3W66A 2VQEF 3UN3A 2X1GA 3L09A 4ZHRB 2BE2A 2CPXA 1W2BR 1KLMA 2RJZA 3HSDA 1JJ4A 3D3CJ 4K0KJ 3HHLC 3NS5A 2YH1A 2C3YA 2K1RB 1EAYC 4KSEB 3B8HA 3MCOA 4OI4A 4ZCMA 2LEAA 3ZZ0A 2VH7A 3PFEA 1RTJB 4PRFA 4KV8B 5JUMA 2FYXA 1R6YA 3ZZYA 1OSDA 2WVEA 2JEIA 1IJEB 3KLFA 2R7WA 2VA3A 2DITA 2N3OA 1S6PB 5GAEU 5IV3A 2MSSA 2VFUA 1OWXA 1Y9OA 5KFWA 1ZZFA 3UN2A 3PRVA 3WX4A 3ISND 2C2NA 4KKOB 4PXCA 5HSPA 4RNNA 2GVZB 1ROFA 3ETMA 1KHWA 1KQSR 1A9NB 3MD3A 1MNEA 1ZA1B 5AJ3F 2EFVA 1BQMA 5J2MB 4IFVB 2VG7B 3QQCD 3I87A 1L3SA 1CC7A 2GNKA 1GXTA 1RAFB 3RR7A 4WE1A 3FBFA 1KDNA 1YBUA 2YNFA 4USHA 4MTPA 1WD6A 4C8OA 2MQOA 4R5PB 1S6OA 1TUWA 1KTVA 3NAIA 1T03A 1EP4A 4TY9A 3B82A 2J6UA 4X4NA 3CC7S 2EFPA 3NNAA 4OZ2A 4WP8A 4C0OC 2B8QA 2LQ5A 2B56A 4LF6J 3JSYA 1H98A 4USIA 3QFHA 1ZAXA 2R7VA 4M5JA 1S72S 1B70B 3CC2S 2AW0A 1TK8A 1RADB 4DX7A 2DISA 4O3NA 3FMBA 1S9GB 4O44A 4DR2F 3R5BA 4LSNA 3MDFA 1HA1A 2B9XA 2HLTA 4JI3F 3CD5A 3R5AA 3DI6B 3BN7A 3DYAB 2W7PA 3CCZA 5HJYA 3GPAA 4DV3F 1FFSB 4UZBA 2VF3A 1BGXT 3Q2SC 3BF4A 1XIQA 3S6EA 4X4SA 2LDYA 1S12A 2Q1LA 3TJAA 2GFFA 1V3SA 2R8HA 1RWNB 3K8VA 3DRYA 4GKKF 2FVQA 4ITSA 1S48A 3CJ8A 3BKFA 3IRXA 4IG0A 3OFGA 4QQBA 3H5YA 2PMHA 5F3ZA 2AJ0A 4F26A 1X31C 3J80Y 2JOQA 2XSJB 3ITHA 3K17A 2XMMA 3T1YJ 3PO4A 2VBZA 3KWMA 2XY7A 2FY1A 3BZQA 1S4FA 3TARA 5AE1A 2E5GA 2VG5A 3QT6A 4TU9A 3LANA 3D3BJ 3TP2A 1MWYA 1DHMA 2C2EA 2VICA 3E01B 3GG1A 1HFEL 1FDNA 4LUBA 4DXLA 1SUQB 4DOZA 3MPYA 3A8KA 2XWYA 4OHVA 2DNGA 4X62J 1Y7PA 3V6KA 2NPIA 1IBMJ 1S1VB 2YNGA 1S7HA 4DR1F 5EHHA 3UVJB 4YR2A 1HNZJ 2Z4PA 1S10A 3QIPA 3SCJE 2HK3A 3IAS9 3O8WA 5EDWA 5LM7E 1WTBA 2ROGA 1O0PA 2L9DA 3MUTP 1F3VA 2D9OA 2MYFA 4B3SF 2YQ1A 2CZ4A 1T3NA 3BREA 3UE2A 3CJTA 3BO3A 3HVTB 5KT5A 3FK4A 2GX8A 1P9QC 3TZYA 3PR5B 3C8YA 1PC5A 5H9EK 3MF5A 4DV6F 3UO0A 3BQ0A 2KFYA 2M8HA 1B0VA 3GJTB 5D0HA 3BO2A 4NE9C 1FRIA 4AT1B 5EGYA 5BYQA 3D7SB 2XMWA 5KFDA 3A3NB 3EUNA 2BBEA 4A46A 4BBYA 4DF4A 3MMJA 2LQBA 2EFQA 4LF4J 3K5PA 1QM9A 4ZVTB 4BC9A 4WFAQ 5L1JA 3PKMA 5BR8F 4WKRA 1HBMA 3WIVA 2NUUG 4PG6A 1FRJA 4E98A 1N36F 1TL5A 3WQPA 3KK2B 4LSLB 4NCGB 3RBDA 4CI0B 1FFGB 3HHKA 4F3MA 3EXCX 4WF9Q 4USWA 5I4MA 4XPEA 1X5SA 2W9BB 3VGTA 5L8RC 3QWUA 1R0BG 3DDIA 1HD1A 2FJXA 2HQ3A 1NCLA 4CM0A 3DGPA 4OLOA 1SH2A 2WZ1A 4DSJA 4WU3A 2DKOB 1BHNA 4BWMA 3U7JA 2BRKA 1FX4A 1WG4A 4IH6A 1FK9B 2IMWP 1RWKB 3H2VE 3P4UB 1NKEA 4ED8A 5D0RA 3JYTB 1DURA 4K2JA 2KVIA 2UU9F 3TQ1A 2MHNA 2MY7A 2MGZA 3TAQA 3DRRB 4OZNA 3KLIA 3PX6A 1VBZA 3RU0A 4RW7B 2FHMA 4GMKA 3KHLA 1MMLA 1MROB 3Q8RB 4EZ9A 3R5DA 2M2BA 1JJCB 4KJIA 1FTRA 2CQ3A 2BX6A 2KFZA 1F3FA 3THVA 2CWKA 1LWFB 3H4BA 2J8AA 4CM2A 3ENVA 5F8IA 4RUBA 1OY8A 2E5LJ 3NRBA 2CQHA 5HL7Q 1TMJA 1S9EA 3V4IA 3CJ4A 3HULA 4X65F 1RCXB 3RR8A 1JLQA 4IRCA 3NBPA 3N6NA 4X4UA 1E6YA 1QUPA 3DFEA 1Q5VA 4FP9A 3MI7X 4RX6A 2W8KA 2UXDF 4K4TA 3VQSA 4K4WA 2KL8A 2MKHA 2Y1LB 4KPCA 2B51A 1JLGA 3UCGA 2ZC3A 1S4EA 2A2DA 4I6YA 4X64F 1BUXA 5LXRA 4OYXA 1TKZB 4U7UD 3O3LA 2AYMA 3EE3A 2QMXA 3QYYA 3GYGA 4PZVA 4P7TA 4CLKA 3OR2B 1ZPWX 4IR1A 1N5TA 3KJVB 3HKZD 2VQFJ 3TOQA 1RYRA 2UUAF 3M1VA 2CJQA 3FCWA 2ZOFA 3KMQA 2HBRB 2R7XA 4DS5A 3O5TB 1U09A 1NK8A 2DT9A 4I6WA 4YR3A 3HP6A 3MMCB 3IN5A 1B3TA 1C1CA 1UJ6A 5IZHA 3TVZA 1MU2B 1R6VA 4ZPCA 2VBYA 2NSBA 4QWBA 2ATCB 4O3PA 5KFXA 4A8MP 3LP0B 4I7FB 3DN9A 2CPDA 4K8RA 4ZPAA 3DLEA 2UUTA 3CDUA 2LLZA 2KG0A 1YJ9S 4DX8H 1Y5NB 2HKEA 3KLHA 3B54A 3CJRA 2CQDA 4DQPA 1SIWB 5CD4A 3M6VA 2JVRA 1UMJA 1JLCB 1Q16B 1T11A 4LF7F 2ZFHA 4QCLA 4AQYF 1U1QA 1NDKA 2DH8A 1L3TA 2WAQD 2V4RA 1UVMA 2OSRA 2ZWOA 3T5HA 2ZJRQ 2OPSA 4CLFA 1CBKA 2WBMA 7FDRA 3MM8B 1CQNA 3NOCA 3HHEA 3AA8A 2VD3A 1EKRA 2QE5A 2R42A 3BH6B 3PIOQ 1SKWA 4LIWA 2JEGA 5EWFA 4ZP7A 4J9PA 5FLXY 1UFLA 3ENAA 1FWPA 2OKQA 3L7OA 5BYSA 4O23A 2PEHA 1SKSA 4QW8A 1YSJA 2JH3A 3CCJS 5M2RA 2FZGB 3AQPA 2Y8YA 3M2UA 2J5AA 3K59A 4A8XA 3OJUA 2YKAA 4F3QA 2CJXB 1KOOA 2BW2A 2VONA 1WDDA 1S6UA 5KG1A 1S6QB 2LU2A 1LNQA 1CG2A 1TTHB 4MIWA 1VQ6S 2QT7A 4EO8A 1HWUA 2CQ4A 3M9OB 3FEYB 1VQ4S 3OTBA 2IAJB 5C2CA 2LEPA 3IR7B 4ZPDA 4F2SA 3BH7B 1YZ6A 3LW5C 2C3PA 4GO5X 2RAQA 3G8TA 1MN9A 1I6JA 3DNCA 3SFUA 2ZD1B 4LRBA 2C3OA 3TEHB 3OLAA 1BQNA 4ED2A 3L9ZA 3DMJA 1QAXA 1WF2A 4PG8A 3VGSA 3IAM9 1VQYA 2CRLA 2RS2A 4E8UA 2OJ3A 3CJ5A 1CJVA 2DNLA 1C0UB 1VLYA 1WC0A 3BPDA 3H98A 1LK5A 3AJDA 4NLOA 1DTTA 5D4LA 3ZTPA 2YPZA 1WKKA 1J5OA 2ZBPA 4PWUA 1KVKA 3SI8A 1IJFB 1T0TV 5KFFA 3BDPA 1TVRA 3TUIC 5CCMA 5FDLA 4CO0A 3KK3A 3SV3A 3FCHA 2QA2A 1YBTA 5CAAA 2R7RA 4BC7A 3TA2A 4C0HA 2NSCA 4I6AA 3RRKA 4B9TA 1HR0F 1KTQA 3LWMA 3H5UA 2WVCA 5J2QB 2B43A 4CLPA 4B3TF 2CFXA 1RBOB 1QUVA 3M8QB 2XY6A 4ILMA 4RWXA 4OHZA 2PMZD 2X1BA 2QA4S 1IKYB 4J9MA 4DV0J 1UAWA 1X60A 5C2GA 3Q8PB 5U47A 5KOWA 3RAMA 5I3UB 4ZVPB 4HT5A 4TU7A 1YBAA 4LT6A 4MIBA 2IRYA 1RTIA 2DRAA 1PKUA 4DS4A 4EK2A 4I1TA 5K8NA 2PMWA 4BDPA 1FNOA 4K5SA 4RBUA 3K5NA 2OEMA 2VPYB 2HRTA 5F8LA 3Q86A 4LF2A 2LVWA 2HVEA 4IRKA 4MFBB 3GLJA 2PFDA 3LH2S 3JQMA 3GFXA 4QWCA 1UZHA 4EEYA 3MD1A 2IJNA 4NXNF 1E6VA 4PQUA 2RILA 1F60B 3SBMA 2V63A 1CC8A 4ZVSB 2JFKA 4KGMA 4LRAA 3A8EA 1YIJS 4NMLA 1HMVB 2RU3A 1RTDA 4YS2A 2P9GA 1VHFA 3HKWA 5HBMB 1S1TB 3OL8A 1N6QB 4CWBA 3W61A 2DEIA 2R2UA 1X9MA 4JYAJ 4LFCJ 1HWKA 2R8JA 8AT1B 2ZZNA 2AEJA 4MMOA 5HAOA 2CADA 4O3OA 4M5MA 3ZNJ1 2GS8A 4I2QA 3L95X 3C6UB 3SXLA 2J8SA 3EVMA 3OTDA 4OYZA 1NHUA 4RR5A 1H72C 2DNPA 2VFTA 1VHIA 4ZMMA 1S57A 4PEOA 2JFDA 5D3GB 1UW4A 2DXDA 5A0YB 2EVZA 4HACB 3CIZA 1N56A 2YKMB 4FYXB 1RWPB 1YLXA 5ETPA 3K58A 3EVWA 3CULA 1AUDA 3EZUA 3GIIA 3LAMA 2MKSA 3UNGC 3T9NA 2XYHB 1S99A 2AZ3A 2FHOB 3AOBA 2QL9B 1U48A 3QATA 2ROPA 2C28A 3ZNUA 2W01A 5DJBA 1EIYB 2J0XA 1UJ5A 3W9IA 2KVQE 2WK4A 3CDWA 2RQ4A 3N28A 1EB0A 3BV8A 3WIUA 5F0WA 2L9NA 2RKIB 1JX4A 3PJ9A 1D8YA 4OI0A 3MCSA 3M8PA 2OFHX 4LF6F 4CTAA 4ILRA 1XNRJ 3TUZC 5LT5A 4UOGA 4WZQA 4I0WA 2NPFA 2VG6B 1RT4A 1TL1B 1VQ7S 1RQ0A 1CVJA 1LFWA 2E7VA 3RTVA 2WSFC 2BANA 1QVGR 1VK8A 2WOMA 1FO1A 5ETVA 3KDOA 2FZKB 2EFNA 2V9KA 4OZ0A 3K57A 4YY3J 3C14B 5C25A 2QL7B 2VBWA 1HQEA 4NEYA 4LFAJ 4C11B 1QD1A 1YK9A 1NXIA 3P8BB 2LMIA 3QZ7A 3NKYA 4G1QB 2YWWA 2RF2B 1IR2A 1U1PA 1DQAA 4YB1P 5IXUA 3G86A 1S0VA 1N0UA 3JQKA 4JI1J 3W5YA 1T95A 2HFVA 2KFNA 4F4KA 3CO0P 5A6PA 2OPRA 1VGYA 3QT5A 2KXHA 5GMKa 3MFIA 2X7IA 2NYIA 4Q44A 4LFBJ 2Q3PA 5AE3A 4JI6J 4J9OA 5C42B 3P96A 4IDKA 4DUTA 3V5RA 2ZH7A 4M94A 4XDDA 2P8IA 3CJQA 4KGVB 4ZJQA 3MR6A 5ITHA 1EARA 3I0SA 3R5JB 5KG6A 4YOEA 4GC6A 1IKWB 2K1RA 1F6TA 1UEVA 2IC3B 1OMSA 2PT0A 2JWNA 3TVYA 3MM6B 2Y8WA 1N5YA 4P2FA 3KYLA 1JXVA 2XQCA 3AXKA 4ED7A 1HNZF 1FFWB 1W26A 2ASLA 2YTCA 3KUGA 3AOAA 2GJIA 4JI8J 3OD2A 2MXYA 3RAXA 3OXGA 2OLWA 4I2PA 4NYZA 4QZVB 2V2QA 1Y5LB 4NEZA 2CQGA 3FBBA 2HHTA 1U02A 1K73T 3CDAA 2WB4A 3EYZA 1JXEA 5CHCB 1HNVB 2D69A 2F8EX 2YKNA 3U1MA 1U6ZA 4N77A 2DNOA 5DO2A 2ATLA 3DM2B 1REVA 5SUHA 1JLBB 4EMDA 5IT0A 2F9DA 3M8ZA 4RW8B 3PJXA 3PR4A 1QE1A 1AZSA 3AB4B 4U8VA 1NMEB 1NJYA 1YRUA 4ES1A 1M90T 3CJKA 2W24A 3NGDA 1V5IB 3DOKA 1UL3A 3FNNA 2N7CA 4LQ9A 4K4ZA 5IM0B 2BOAA 1RJJA 4UUWA 2OMLA 3OTEA 3MR3A 1WHYA 3RB0A 3HM9A 3KG4A 1LK7A 3CCTA 2HNZA 3WC0A 4YEAA 3QJLA 2KG1A 5KTQA 1EKSA 4NOHA 1NKCA 2MZTA 1FX2A 3THTA 1RT7B 4UOHA 2WW4A 5KFLA 1F0XA 2AJ1A 4ED0A 5F8HA 3G82A 4CLLA 3EDQB 4ED4A 1VMBA 2Q6BA 4YN3B 1QDUB 2BVZA 1X5PA 4Y2KA 5JVGQ 4N8NA 5KFYA 2F4FA 4GKJJ 4LRCA 1HQUA 1D3WA 1PIEA 1VQOS 1GAOA 3DXSX 2D3ZA 3MAAA 5C24B 2LKZA 2HHHJ 3R2CJ 3CDEA 3UD3P 3TQEA 1O6XA 4H54A 4C3MA 4KC5A 2BRLA 1N8RT 3CF5Q 4ENOA 3KOAA 5LMUJ 1EQ0A 1X4FA 2XMKA 1K44A 4RPFA 3LPEA 3PYFA 1F9EB 4RNFA 1YG0A 4BWJA 1XQIA 1ZTWA 4OFZA 3PNIA 4PG4A 2RDIA 4O0IA 4X84A 2VKRA 2E1AA 3GZ7A 5CQGA 4B02A 1SKRA 2OIHA 2KYZA 1WHVA 1D9AA 3RUBL 4TQRA 1LWCB 4C4WA 1AROP 4J9LA 5T14A 3ELHA 2DGOA 4F50A 3TA1A 4DL7A 1WWHA 4RW9B 3VAGA 1RU1A 3IWLA 4QYRA 4W90B 2FTRA 2DD8S 4MH8A 2XLIA 2EBGA 2E5IA 2GO8A 2F4VF 4FVCA 1R0AA 3LPYA 2OEKA 4KFBB 4NA2A 5KFEA 1IBKF 3ZXWA 1OS5A 3Q2TC 1Q0NA 1GK8A 4KBIA 3HJVA 5IT4A 1TKTB 1H6KX 2VPWB 4LSZB 3T5LA 5ETSA 3IWNC 3SQGB 3JAMY 1RYSA 2HNYA 2O67A 3H59A 3MECB 5LL6d 5L39A 1AW0A 2CIMA 4L3NA 2R7SA 1R8AA 1HHQA 4CRJA 2FQQB 1RAAB 1Q8IA 2RIJA 3M32A 2PEBA 4IG3A 3C15B 4ZVOB 2HIYA 3JS9A 3SDEB 2G1DA 2DR5A 4Z37A 4JI4J 1FE4A 3ZFVA 2NXNA 2BZ2A 3AXMA 4MKVA 1KFSA 2W2OP 1P6TA 2M8DB 2PN6A 2VQFF 5A8RB 1NSQA 4ZLPA 2PC6A 3M6UA 3W63A 3W64A 3DLKA 2W9CB 3G6YA 2VC1A 2MQPA 5J2PA 1P27B 1IKVA 3DXBA 4UQTA 1RHJB 4IFYA 3D54A 4KO0A 1D0EA 5KFUA 1MLAA 1TR0A 1LXNA 3EM1A 2KHCA 4NCGA 3BGUA 3W5ZA 2KRRA 3HCXA 1VC0A 1T9XA 4NMXA 1J5EJ 4O3RA 4F0MA 2GVDA 2BOPA 4PQAA 3DOLA 4G1IA 2KB2A 4OYBA 4WFYA 1KQFB 2ZBRA 1YI2S 3K5OA 1M5KC 2DY9A 1HBNA 4YHHF 5M2UA 2E44A 1SPBP 2M7SA 4LQ3A 2DGWA 1WSVA 4B9NA 5AJ3J 3RRHA 3KMSA 2M70A 3K5MA 5DDQC 2KM8C 1F9FA 3IP0A 4Q7AA 2VKZG 5HP1B 2CJYB 3MPDA 4ZKAA 3PKYA 2Y0BB 4X4OA 1Y11A 1F5BA 2MSTA 3CJ2A 4HTIA 3IGNA 5DRKA 4FKXA 1OYDA 3KXDA 1U49A 2ZWPA 3C6TB 3M2VA 3BGFA 4GVLA 4UF4A 2AJFE 1H2UX 1FKOA 3IRWP 2WONB 2OUGA 1T05B 3OPKA 3CE8A 4Y2MA 4YDDB 1T9YA 2I38A 4XDCA 1FKPB 1IWGA 1TKXA 3D0GE 3JTOA 3V81B 4YUDA 3H2UB 2FJBB 3LQVA 4C3KA 4R0JA 4OI1A 1YJNS 3PACA 4ELTA 1RTHA 5ETNA 2HPUA 1PJ5A 1V3ZA 3PZPA 3KK1A
chains in the Genus database with same CATH topology
1LW0A 3MGJA 3TYTA 2GFFA 2V4QA 2QA1A 4ICLB 2FB0A 2DIUA 1V3SA 3L7PA 2R8HA 1X0PA 2WSEC 2IHR1 2CQ0A 1DLOA 5DETA 1U26A 3PVXA 3K8VA 1XC9A 4JV2A 4KB7A 2B9WA 2GHVC 3DRYA 3KTQA 4ECWA 1C4AA 3BSNA 4GKKF 3K8WA 2HFZA 2FVQA 1DQ8A 4ITSA 1S48A 5E3PA 4WK3A 1APSA 1LKZA 2CDQA 2FJWA 3LF0A 2DTJA 5HLFA 3FSYA 3PW5A 4DL4A 4PUOB 3IRXA 2JLGA 1GXUA 2R7OA 3LOUA 4IG0A 1RTIB 1SB6A 3MM5B 3C6UA 4LIRA 5KFMA 2BDPA 5KG4A 3OFGA 4QQBA 3H5YA 2XS7A 1NH8A 2B0GA 2PMHA 5F3ZA 2AJ0A 4F26A 4X62F 3UR0A 2R7QA 1IBMF 3J80Y 4F8RA 4F4YA 4UY85 2JOQA 2XSJB 3ITHA 2XMMA 5JJBA 2YWEA 1HPZB 1YWXA 5DLGA 1NJWA 4ILLA 1P1LA 3U02A 3FRYA 3PO4A 1JLAA 2VBZA 4B9MA 4OL8A 5D3GA 1XMQF 3RW6A 2QZ8A 2UVRA 3KWMA 5IWAF 2GGPB 5A0YA 3SCKE 2LXFA 4OMFG 1SH3A 1FA0A 3GIMA 2XY7A 3EGNA 4DJBA 1D8ZA 2FY1A 4B9LA 3BZQA 4QIGA 1S4FA 3PX0A 3TARA 1RISA 2YKMA 5AE1A 2E5GA 2FLNA 2VG5A 3TW0A 1R8PA 4TU9A 1XMBA 3LANA 4TYBA 2LDIA 3Q22A 2B6AB 4KT0C 4NA3A 3TP2A 2AU0A 5DQGA 1E6VB 3MMBA 1MWYA 4U6PA 5CD4H 1DHMA 2C2EA 4J9KA 1R89A 2VPZB 4HI1A 4PCQA 3E01B 3W2VA 3OHBA 3Q23A 3BGRA 3HJFA 3GG1A 1HFEL 1LW2B 1VQMS 1ZH5A 2E7WA 1FDNA 2VB6A 4LUBA 4FNIA 1SUQB 4DOZA 5E41A 1QSLA 3MPYA 1RT6B 1O5JA 3I96A 1U1NA 2DH7A 1FNXH 2XWYA 4OHVA 1NRKA 3PJWA 2DNGA 5E3QA 3J7YI 1Y7PA 3V6KA 4UQGA 2NPIA 5E3RA 1UFWA 1S1VB 2FJEB 2YNGA 1BQXA 3IS9B 3KG1A 2KJWA 1KD1T 2P5VA 3GV5B 1Q82T 1RTDB 3CJ0A 4RUAA 4K4VA 1S7HA 1TP7A 4DR1F 2HHUA 4RW6B 5EHHA 3UPFA 4YR2A 3J7ZT 2C2DA 1M5VC 1CPZA 4JBCA 2Z4PA 3MM7A 1FXDA 3NCQA 5T41A 4L72B 5A2QY 3J81Y 5K8MA 3PX4A 1S10A 3C2PA 1GH8A 1NK4A 5E7OB 3QIPA 3SCJE 2MKIA 4MAKA 3POTA 4ELUA 2YWHA 4PXEA 2RKIA 1M5HA 3C46A 3IAS9 3O8WA 2PGCA 4RBVA 2POKA 5EDWA 5IT9Y 3VZHA 1U8SA 4H4MA 2D9PA 3G96A 4NL5A 2VFVA 1WTBA 3PW4A 2ROGA 3U1LA 4WFZA 3NL0A 5G4DA 1O0PA 5KT3A 1N34F 3CO9A 4C2MA 2L9DA 1QAIA 4I2QB 4DLEA 1SBRA 1B0TA 2VG6A 2BE2B 5AXMA 3MUTP 2D9OA 2MYFA 1HNIB 1YJWS 3I4HX 4B3SF 3HO1A 4LF4F 2CZ4A 1N5QA 2ZHOA 4Q5VA 5CYQB 1T3NA 2XULA 3M9MB 4DQRA 3BREA 3DLGB 5EX3A 3UE2A 4NLGA 2BJEA 1Y3KA 3IR5B 3BO3A 3HVTB 5KT5A 3BQ2A 1B0PA 1KFDA 2GX8A 1P9QC 3PR5B 2YVSA 1YJTA 2BJDA 2WW8A 3C8YA 1PC5A 4FXVA 1VQSA 3MF5A 5KFSA 2DIVA 1FVSA 1TL3A 4DV6F 2QMWA 1Q79A 3BQ0A 4NLQA 2KFYA 1JXLA 2M8HA 4N8OA 2E9ZA 1B0VA 5H1SV 2XS2A 2JL9A 3ISNC 4K4UA 1Y00A 2R8IA 3BO2A 4YMEA 3EZ5A 3GG0A 2CPFA 1FRIA 5L1KA 1K1SA 5EGYA 2A18A 2C2RA 5BYQA 4C11A 2I2YA 2XMWA 4URQU 3HX9A 2M3DA 2MQLA 4LVOP 3VF0B 5KFDA 2J6TA 1VQNS 1VRUA 1ZPVA 2O66A 3RYLA 1G6BA 3EUNA 4OI0A 2C3MA 3CGIA 2BBEA 4QWEA 3BSAA 4G1QA 5KFNA 5CZVA 2RF2A 1TZ0A 4A46A 4DV0F 1S97A 1RA6A 2HFNA 4BBYA 2DHGA 4DF4A 3MMAA 2R7UA 2RD5C 4UOCA 1RT1A 3OVSA 1WG5A 2JEJA 3MMJA 5KFCA 2LQBA 2EFQA 3K5PA 3MEEB 1X9WA 4IQMA 1QM9A 4RUCA 3HHDA 4JOUA 5FD1A 1K0TA 4FXWA 4BC9A 4WFAQ 5L1JA 4B3MF 4ZVEA 3PKMA 3UW1A 5AXNA 2W7OA 3MZIA 3FVYA 1FNMA 3CB4A 3S01A 2IVMA 3IO1A 1XR7A 4ZCLA 1HBMA 1URRA 5BR8F 1N33F 4WKRA 4EWTA 1O8BA 3D28A 2NUUG 3HXMA 3AJ2A 4B9VA 2A3JA 4PG6A 3QO9A 1FRJA 1RGVA 4W92B 4E98A 1N36F 2MZ1A 1TL5A 3QGIA 2ILZA 3GFYA 2ADBA 3DLHA 3I5BA 4FZVA 3M30B 4ECTA 3KK2B 3DDKA 4LSLB 3M8PB 4NCGB 3MOZA 3RBDA 4CTAB 4CI0B 2XMVA 4K4YA 4DSLA 2KI2A 4DEZA 1FJCA 3HHKA 3PIPQ 1H38A 4F3MA 1GXLA 3MR5A 5F41A 3M6WA 3CCLS 3EXCX 1KVIA 4WE1B 1ZAVA 4WF9Q 1JLFB 2WCXA 4C8KA 5I4MA 4XPEA 4AL6A 1X5SA 4WK1A 1UETA 4N76A 3HF5A 3H5XA 3PO5A 2HVIA 5C42A 2W9BB 4DV4F 4ID8A 1UJ4A 1RT4B 2CPZA 1NZAA 2G4BA 1G3OA 5L8RC 2DO4A 3FJ2A 4A8QA 1NH7A 3QWUA 4Q43A 1PC4A 4Q45A 1XTZA 2BANB 2J7WA 1H0HB 3BR8A 2AYGA 1HD1A 2WOMB 3P49B 1I1GA 1LWEB 1X5OA 2FJXA 4LMZA 1DTQB 2JVOA 1DRZA 2HQ3A 3DU6A 2Z2LA 5L1IA 3DGPA 3VAIA 2XWXA 1LV5A 1K9MT 4OLOA 5D4PA 1ZYQA 1SH2A 1IKWA 5J2NB 1FJEB 1VS3A 3UDCA 2DBBA 2GMLA 4TNOA 4WCEQ 1NK6A 3UWTA 2IC3A 3VAMA 1S76D 4DSJA 4WU3A 2U2FA 5C25B 4A48A 2JRSA 2NREA 3OVBA 1X8DA 1HQEB 2RSQA 5J1PA 3W3SA 1TV6A 5FIIA 4KAIA 3BDEA 4BWMA 3KLGA 4ZK7M 4DBQA 3U7JA 2BRKA 1WG4A 2XCPA 2A2CA 1FD2A 4IH6A 1R43A 1FK9B 4RU9A 4KPYA 3NAHA 2IMWP 3H2VE 2J7UA 1HWLA 2Q43A 1NKEA 2EFOA 3KG0A 4KRWA 4OX9F 4ED8A 3JSMB 3M6XA 4Y3CA 4ZPBA 3JYTB 1DURA 3FZ2A 1BC6A 2B4OA 5KFTA 1S1XA 4LFCF 2XHWA 2KVIA 1N0VC 1DZ5A 2UU9F 2AP6A 3RRGA 5KFRA 5F9LA 1VRTA 4P7VA 3TQ1A 2E5LF 2MHNA 2MY7A 4LSNB 2MGZA 3TAQA 2I8EA 2HWIA 1UVNA 5L9XA 3DRRB 1SH0A 2M4MA 2AF6A 3X3UA 3L3CA 4DR7F 4OIXA 4OZNA 3GQCA 3KLIA 4DN0A 4AUKA 1S6QA 3PX6A 2O3DA 2DR8A 3OQ2A 4B3OB 1U2RA 2WBRA 4OZJA 1KRPA 1Q53A 2CJ9A 2IVYA 1VBZA 1S1WA 3RU0A 3JSBA 3HVAA 4FF3A 4QIVA 5KT7A 2OPRB 1S1UB 3FZBA 4RW7B 3MOJB 2FHMA 2FJVA 2UVUA 1Z4UA 4GMKA 1HNVA 3MUMP 2ZITA 4ECQA 1FRXA 2W4DA 3KHLA 1MMLA 1MROB 4CH0S 3Q8RB 4HT7A 1F5AA 1HWIA 3R5DA 4Y2AA 4EZ9A 4Y0FA 1ULRA 2M2BA 4K4SA 4RLEA 3OFEA 3PHEA 3WZ0A 4KJIA 1FTRA 2CQ3A 2AYEA 4A8FA 2KFZA 2ZVSA 4EBEA 3THVA 5B0GA 1LWFB 3H4BA 2YH0A 2J8AA 3DM2A 4IDKB 3T9ZA 3KLEB 5A6WA 1RKJA 1NK5A 2UV8A 1XWLA 3ENVA