2AYEA

Crystal structure of the unliganded e2 dna binding domain from hpv6a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
b'SATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein E2
molecule tags Transcription
source organism Human papillomavirus type 6a
publication title The recognition of local DNA conformation by the human papillomavirus type 6 E2 protein.
pubmed doi rcsb
total genus 19
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ayeA00
1WEYA 2DNNA 2CJKA 3EX7B 1P1TA 1Q7YT 3CCSS 3RW7A 1U1NA 3VAKA 3SMZA 2D3OR 2CPFA 2LYVA 2X1GA 2KH9A 2MMYA 1DZ5A 1WG4A 2FY1A 1KQSR 2MZRA 3FEXB 4Y0FA 5GAEU 3PIPQ 4IOCQ 4Z2XA 4P6QA 2MSSA 2MZQA 3US5A 2PE8A 4EGLA 2LECA 3B4MA 1M90T 2E44A 2CQGA 1X5PA 2YWKA 2KFYA 3UWTA 3CCMS 2DHSA 1WWHA 2CPDA 2YH1A 4OZ1A 2NZ4A 2EVZA 3JB9k 2MZ1A 2KM8C 2QEXS 1OO0B 4TU8A 2XNRA 1SJ3P 4PRFA 2KN4A 1ZZFA 1YTYA 4WKRA 3MUTP 1A7GE 3TYTA 3MDFA 2VODA 2UP1A 2DNOA 2MSTA 5GADU 5GMKa 3CCES 2CQCA 4CH1A 2O3DA 1M5VC 5LSLA 1SXLA 2CQBA 3D2WA 1DRZA 2M8HA 2RS8A 3DXBA 4YOEA 5LJ5Y 2LKZA 2DGUA 3DLLQ 2G1DA 3CCJS 1VQPS 2SXLA 3CCQS 2XB2D 1SJRA 1WF0A 3VAFA 1Q82T 3ZZZA 4PKDB 2KI2A 2MGZA 2HGMA 4ED5A 1S72S 2RRAA 1YJWS 1UW4A 4UY8T 4ERDA 2KG0A 5DDRC 2DO4A 2XSFA 2DNLA 2VOPA 4F25A 2M8DB 3CMAS 5IM0B 3S01A 5IM0A 4A8XA 1M5KC 1X4BA 5BJRA 3J7YU 2MHNA 2KHCA 2YKAA 4FXWA 1QVFR 1N54B 2DNKA 2MB0B 1FO1A 2RS2A 2M88A 1WI8A 1WELA 5JVHQ 3R1LA 4IO9Q 2LXUA 4IOAQ 2E5GA 3BO3A 2E5IA 2EK1A 2MKIA 2X1BA 1JJ2R 1D8ZA 1XN9A 2DITA 4TU9A 2L41A 2XS5A 3P5TL 2CPIA 2F9JA 3CCLS 2RUGA 2CQ4A 3EGZA 1X4AA 2WBRA 2DH9A 1U2FA 2M52A 2J0SD 4OZ0A 2CQ1A 2DNMA 1R8PA 5D78A 4TU7A 2MY7A 1QM9A 5CXTA 2YTCA 3EGNA 3ULHA 3CCRS 4W90B 3MUMP 1U6BA 2KT5A 4QQBA 3G4SS 2RRBA 2CPJA 3LPYA 2DGTA 2DISA 3UD3P 1DBDA 2CQIA 3Q2SC 4U67Q 1FJ7A 1X4HA 2RVJA 3K0JA 1VBXA 1H6KX 2K8GA 3VAGA 2I2YA 1N8RT 3I56S 5DDOC 2A3JA 1O0PA 2B0GA 4QU7A 1UP1A 4QPTA 2HGNA 3CMES 3MOJB 1KOHA 2LXIA 2MQMA 2KU7A 1X5TA 2J0QD 4CIOA 2X1AA 3SDEB 1N52B 2MZJA 3U1LA 2CQPA 3HI9A 1YJ9S 1VQ7S 3HHNB 2CPXA 2RQ4A 2K3KA 4QU6A 4C4WA 5DDQC 2E5JA 1FJEB 5GAGU 2N7CA 2M9KA 4M5DB 1FJCA 1YITS 2MKCA 1VQ5S 2DGVA 2DGXA 3IRWP 3UCUP 1JJHA 1QVGR 2CQ3A 5MLCV 2DNQA 2KG1A 3S6EA 1NO8A 2ZJPQ 3R1HA 1U1MA 1PGZA 2DB1A 2XNQA 1SJ4P 2KXFA 4WFAQ 1K73T 3NNHA 1HD0A 2LMIA 2DNZA 1X5SA 2DH8A 5IQQA 4BS2A 2HGLA 5FJ4A 1X4FA 1RKJA 2AYBA 2DGQA 2BOPA 2QFJA 2CPEA 2JX2A 3N9UC 3PIOQ 1VQ9S 2J76E 1X0FA 2MQNA 2U2FA 1SJQA 4LIRA 5IFMA 3MD3A 1U6FA 2BZ2A 1KC8T 4C0OC 4LJMA 4FXVA 2MY8A 1FHTA 2JVRA 1FXLA 3CD6S 5GVQA 1W2BR 1JJ4A 1X4EA 5JVGQ 2G4BA 4WFNQ 2ZJQQ 2HYIB 2AYEA 3G6ES 3CPWR 4LMZA 3VAHA 1PO6A 4TLQA 2OIHA 5DETA 1WG5A 1HL6A 2DNRA 2N3LA 3Q2TC 5ITHA 1R8HA 2DK2A 2DIVA 2E5HA 2OSQA 2MYFA 1NJIT 2X1FA 3BEGB 2VONA 1VQ8S 1WEXA 5HL7Q 1U1KA 1WF1A 2CQHA 1X4GA 3P49B 2EK6A 3TO8A 1S79A 2DH7A 2CPZA 1VC0A 4W92B 1SJFA 5LJ3Y 1H2TZ 1NU4A 1ZH5A 3G9CA 1OWXA 2DGOA 3THTA 1VQNS 1X4CA 3BO4A 2F3JA 1VQMS 1G2EA 1B7FA 5DM6Q 1U1LA 1HA1A 1YJNS 4WF9Q 1L3KA 1WHWA 3NS6A 3MURP 1VC6A 3TP2A 3VALA 2RU3A 2L9WA 3CCUS 2NLWA 2M70A 2CQ2A 1M5OC 3VAMA 2MGZB 4PR6A 4WIIA 1WTBA 1YWXA 2KYXA 3MXHP 2L08A 3P3DA 2HVZA 2ZJRQ 1WHYA 3UD4P 2OTLS 5CYJA 2KVIA 5GAHU 3L3CA 3CCVS 2M7SA 3CTRA 4C7QA 2FPHX 2LA6A 3MUVP 4YB1P 2YH0A 2ADCA 1M5PC 1D9AA 2N82B 1A9NB 3LQVA 2LEBA 1VC5A 3SXLA 2DO0A 2CPHA 4IUFA 3CUNA 2MKSA 1VQ6S 3I55S 2ERRA 2RNEA 3R27A 2F9DA 1U1QA 2MQOA 3IWNC 1OPIA 2HZCA 1H2UX 2PEHA 3MD1A 2LQ5A 2M0GB 3VF0B 1CVJA 3CULA 3NS5A 2AYMA 1KD1T 1FT8A 2RT3A 3ZZYA 1P27B 2JWNA 3UE2A 1VQOS 1VQKS 2CQ0A 2DIUA 3H2VE 3S8SA 2MPUA 3VAJA 3S7RA 3UCZP 1WEZA 1U1OA 1U1RA 4CH0S 2KRBA 2MKKA 1Q86T 3U1MA 3BO2A 5LXYA 2ADBA 2RQCA 4V19X 3MI7X 1AUDA 2V94A 2DNYA 2JRSA 3CC7S 5HO4A 2KM8B 1URNA 3G8SA 3UCGA 2KRRA 2DHAA 2AYGA 2DNGA 2GO9A 1ZZNA 4F02A 2MQLA 2M4MA 2AD9A 2XS7A 2D9PA 2OJ3A 1WG1A 2M2BA 1KOOA 2MQPA 1JMTA 1UAWA 2MKJA 4WCEQ 1N88A 3FEYB 1YI2S 1VQLS 5LSOA 2JVOA 2DHXA 3SDEA 1DHMA 1X4DA 1U1PA 1VBYA 5CA5A 4ZKAA 2DGSA 1YHQS 2DHGA 3CC2S 2MXYA 3CC4S 2FC8A 2MJUA 4UQTA 3V4MA 1FNXH 3THPA 3J7ZT 5DDPC 4CQ1A 2KXHA 1WI6A 2DNHA 3BS9A 2MZTA 2G0CA 2MQQA 2MKHA 1RK8A 2N3OA 1M1KT 5H1SV 2XS2A 1HD1A 1VBZA 1Q81T 1BY9A 3P6YC 3CF5Q 3B4DA 2QA4S 4F26A 4Y00A 2CQDA 2Q79A 2J8AA 1X5OA 2D9OA 2OSRA 1UFWA 3G8TA 1K8AT 2CPYA 3RW6A 3CXCR 3VAIA 1OIAA 1YIJS 2DNPA 1H2VZ 2FC9A 1IQTA 2FHOB 2LCWA 1VQ4S 2LEAA 2VOOA 5D77A 4WFBQ 1WHVA 2LA4A 2KXNB 5LXRA 3G71S 1WF2A 2MJNA 3G96A 2GHPA 3OW2R 1K9MT 5DM7Q 4RU2A 4J5OA 3NNCA 1WHXA 2I38A 3NMRA 2MZSA 2U1AA 4YUDA 3H2UB 3NNAA 1F9FA 2DGWA 5EN1A 2OTJS
chains in the Genus database with same CATH superfamily
4L75A 4WP9A 5HLFB 1HHTP 1IR1A 3JTOA 2BE2A 4R8UA 4EBDA 4RUBA 4NLYA 5HP1A 3ZZRA 4IH6A 2G2OA 1S49A 3CCSS 1CJKA 3F0NA 7FD1A 5KFJA 1NK6A 2G0IA 2OPRA 1T9UA 2HRUA 5KFUA 1GMUA 2PA8D 3CCZA 3VAKA 4ECTA 4ECUA 2XY7A 1LWEB 1XR5A 8ATCB 3BN4A 4DCOB 2D3OR 1LWEA 2RHSB 1HQUB 1HNXJ 4K50A 1V3RA 2CPFA 2X1GA 3FZ2A 5K8OA 4PG5A 2E7VA 1YJVA 1C4CA 2IJNA 3H5UA 5JXSA 5J2QA 1U09A 4DN0A 1KQSR 2PD1A 3MM5A 3M9NB 2FY1A 1HARA 3ZTRA 4DU8A 2DPIA 4KJIA 4C8OA 4ZPCA 5GAEU 3PIPQ 2CADA 2FGCA 3TUIC 3OTOJ 2QA1A 1TZ0A 3CJKB 3MMBA 2JC0A 1X9SA 1DLOB 4J91A 1DLOA 5CZVA 3OL7A 2Y0BB 2AZ3A 2CQGA 4OQJA 3NWRA 2LU2A 1U48A 1N5QA 3FFIB 2KFYA 2E9RX 3BBFA 3H0PA 5D6GA 3CCMS 4ECWA 2CPDA 3ZO7A 3Q22A 3ZTSA 4HI1A 3UD5A 2YH1A 2BKOA 2MZ1A 3F56A 2RKIB 3GG1A 1OO0B 2C3UA 4TKTA 1SJ1A 4JUZA 2G9OA 2IRUA 4DHVA 3CDWA 2XNRA 3I0RA 3PKMA 2FJVA 5D4OA 2G1HA 2GJFA 3W5ZA 4PRFA 1NNDA 3MCOA 3MUTP 1Z2LA 3ZXWA 2FIUA 1YVFA 4URSA 4DUTA 4LRFA 1R0AB 3GP9A 2UXDF 4ECRA 1PC4A 3TYTA 2B4VA 1IBLJ 1MWZA 2V69A 3WIVA 4EUVA 4JI3J 2DNOA 1RP5A 1HBOA 4LF8F 5GADU 2L9NA 1NRKA 5KG1A 3Q24A 3FZBA 4I2QB 4Y3CA 4OIXA 1LOUA 4CH1A 4KT0C 1QSSA 2XZWA 3E51A 2GIFA 4ZVFA 1FK9B 3NGUA 3LTOA 1T03A 2C42A 4KYZA 5I42A 2M8HA 1TK5A 1Q5YA 2RS8A 4DQIA 2EEYA 4NX9A 3LP1A 2ZEJA 4YOEA 2Y1LB 3LP1B 1NHKL 2NXCA 2R8GA 1HYSB 2ZH1A 5HMZA 2XI2A 5KFCA 3KHHA 4NLDA 3OTBA 1QTNB 4PG4A 4LF1A 1VQPS 1SJRA 5KFBA 1RHQB 2VFUA 1KSPA 2KI2A 3DRXA 4RO0A 5A8RA 2R7RA 3FJ2A 3HSZA 1DQAA 4KBIA 3EPIA 2RRAA 5KFLA 4DR6F 4GKKF 3PYGA 3HVAA 4BC7A 1YJWS 2E5LJ 4UY8T 4DG1B 3K5LA 1IKXB 4USHA 3ZZUA 4ED4A 5I4MA 2R2TA 4JI8J 5L1IA 2XB2D 4K4VA 4AL6A 2VOPA 3CMAS 1S9FA 5IM0B 4YP3A 5LMUF 4GVLA 1RBLA 4KGXB 3HHEA 4A8XA 1M5KC 2XSJA 4Z7CA 5BJRA 2UUCF 2UXCF 2R7UA 1RT5A 1WKLA 2XGPA 2MHNA 2KHCA 2YKAA 4USVA 5ETTA 2V4QA 2OH2A 4QJVA 5CYQA 4DQSA 2DNKA 2N4CA 2VJVA 1D9DA 1PJ7A 3MMCB 1FRLA 1FDNA 1S4FA 2M88A 1WOOA 1S1VA 1EX8A 5I3UA 4IO9Q 3BB5A 4M8LA 3OQ2A 4IFYA 2XLJA 3IR5B 1YRUA 1AW0A 1V5IB 1S1TB 2MKIA 4ZMMA 3BO3A 1HI0P 2W4DA 2B4OA 4P2XA 4DS4A 2DITA 1HR0F 2UXBF 4NL5A 2K7JA 2F8MA 4YDXA 4QCLA 2F9JA 3N0VA 4JV5J 1SC1B 3M9MB 4NZ7A 3QRPA 3DLGB 2KYZA 1I5OB 4ID5A 3T5LA 2CQ4A 2XI3A 4ED6A 1X4AA 1U2FA 3TQ1A 2M52A 4ER8A 1GNKA 1RAAB 2F1FA 3MEGB 3A8EA 2VFRA 3SQGA 1VHIA 1IBLF 2QFIA 2MY7A 4QYRA 2BANB 1TUVA 5E3AA 3D5MA 5D4LA 3RGIA 1NZAA 5KFVA 5B0DA 3KLGA 5HROB 3FC9A 4KQZA 4WP3A 4JV1A 4W90B 3EZOA 3VVUA 1U6BA 4P2MA 3L9ZA 4J9KA 7FDRA 5RUBA 3RTVA 1FVQA 2GIQA 2HWHA 1S0NA 4K0KF 4NWBA 3UD3P 1ZM2A 2V4JA 4U67Q 1BXNA 4RWXA 1DTTA 4OZJA 3SZ2A 1IR0A 3T1YF 1N6QB 3K0JA 3WZ0A 1VBXA 1S0OA 1H6KX 1LEOA 4ZCMA 2GS8A 3OFHA 3G86A 1O6XA 3AAWB 3HT3A 1BHNA 4MYUA 4PZVA 4LFCF 1S76D 1T9VA 3M30B 2KL8A 2JZ5A 3PJ9A 1NJZA 3I56S 1N8RT 2COLA 3DRSA 5DDOC 2HNYB 3PX0A 2HQ3A 3MMAB 1VQ9S 4DWIA 3MMAA 1QTMA 1EQMA 4RLEA 1OSCA 4ETXA 5KFKA 2VPWB 1KOHA 3DOMA 3T1AA 4FYWB 3A4TA 2KU7A 1RJJA 1X5TA 2QE5A 4CIOA 2OFGX 2Y1JA 1N36J 3D68A 2GFFA 2WHOA 4USIA 5F8LA 4LIWA 1R27B 1NZ8A 4ZVUB 4CO1A 4QW9A 3U1LA 1LW0B 2OPPB 2FLOA 4YB7A 3HHNB 2HBQB 1Q53A 2CPXA 2QC3A 4RU9A 4B9MA 2YKNB 1F5CA 4M5GA 4ED3A 4C4WA 2HVDA 3UR0A 2E5JA 3A8IA 3CW2C 1UWAA 4M5DB 1KVIA 1YITS 3I5CA 3VVTA 2HBZB 2NUUG 3GILA 1JXEA 2ZDOA 3AJ1A 1N33F 2DGVA 4NLUA 4RBVA 5L46A 1FNMA 1B99A 5F41A 3IRWP 1RB0A 2E66A 4DL7A 1YBTA 2FLLA 1QVGR 1DARA 2AJFE 1LWFA 2CQ3A 1UKUA 1GH8A 1FFSB 3M6XA 4ZVEA 1GTHA 3QAEA 3NKYA 5C7PA 4DI6A 3R8YA 1QAXA 1U1MA 1MMNA 3MM8B 3Q8QB 3RU0A 3N79A 4IG3A 3ZNJ1 5ADZA 2JEGA 1E6VA 4UW2A 4IOBA 4YY3J 2BQ3A 5AXLA 2LMIA 2VU5A 2PDAA 4RW8B 3SSQA 4RNOA 3T5KA 4FDFA 2DH8A 4CLFA 3QIPA 5M2RA 3E01A 3GIMA 4JI4J 3KNAA 2ZZTA 5IQQA 3I6PA 1E6YA 3IRXB 3M8YA 3ETOA 2J9DA 4LSZB 2AYBA 3DGPB 1T05B 1VBKA 2CPEA 3DGPA 3M8QB 1U2CA 1T05A 1BLUA 2LFVA 3PIOQ 2Q6BA 2V5HG 4PXBA 1F5AA 2K1RA 4K2JA 3JYTA 2J76E 3K5MA 4J9RA 3IXQA 2XMTA 2YVSA 1XK8A 1K44A 4CYUB 3T3FA 4PPDA 2MQNA 2U2FA 3JTNA 4KSEB 4TN2A 1Y5LB 2HWTA 4DPOA 2VZ9A 3G82B 4G1PA 2HHTA 1U8WA 4CI0B 3TANA 4LF9J 1VIXA 3D6FB 3R5BA 3RBZA 1U6FA 2IAJB 3HVWA 3EDRB 3HMJG 3BQ0A 4B9LA 1X31C 2MTLA 2V67A 3B78A 3L7UA 4USKA 1L3SA 4E0DA 2BBEA 2PFDA 4PYAA 1VLOA 3QGGA 3JQMA 2FZGB 1TP7A 5GVQA 1W2BR 4DX7A 3LUYA 4JI0J 4G1IA 5HBMA 3FBEA 4OHZA 5HBMB 3DHXA 1NSPA 3A13A 3P8BB 2W9AA 1QUPA 2G4BA 1U6ZA 1S1WA 3CT9A 4ZPAA 3FBCA 3K8WA 2AEFA 1EETA 2J0XA 3GTYX 4PAAA 3MR7A 4ZA1A 2CNOB 2UU9F 3JTPA 4DR7F 1BWVA 1I1GA 5KFRA 4LMZA 1VRUB 5K5MA 2UUCJ 1CULA 2F8HA 5DETA 3GIIA 4ED1A 2J6TA 1KLNA 3A1YG 1P8GA 2N3LA 3NWGA 3OTCA 4HH1A 1WC3A 4FS1A 3LP2A 4NPOA 2GMHA 4B3MF 2DTJA 3CCTA 1YJUA 5EDWA 2DIVA 1R8CA 3M32A 3NCQA 3DLEB 2E5HA 3UDEA 5AJ3F 4ES1A 4FF1A 1Q4RA 4NRUA 2MYFA 3D67A 4FYYB 2Q1LA 1FWPA 1HI8A 2XC9A 2RILA 5E0OA 4CLUA 2VONA 2WTFA 5J1PA 1WEXA 1OQ3A 1VQ8S 3K8VA 4DV4J 1KTQA 2RF2A 2YKPA 5D8HB 4F50A 1T3OA 1KN6A 2ASDA 1H2TZ 3KLEA 3RB4A 2H5EA 1ZH5A 1S12A 3I0RB 3NAIA 3RUBL 1TTHB 1RKIA 4F8RA 1XIQA 4CDIA 4X4UA 4K4UA 1HBUB 2IPOB 5E5NA 4NLXA 1G2EA 4EU0A 2WW8A 5HJXA 1U1LA 3BZQA 4P72A 1NXIA 2HKEA 3MGJA 3DM2A 3PXGa 1JLGA 1S6PB 1MMLA 3MTJA 2HMIA 4WF9Q 2YWFA 4ZOSA 4DPTA 1YRXA 4M5MA 3VZHA 3QZ8A 4OJ1A 3OPKA 5IT4A 3HZEA 4TYBA 4KV8B 4OZLA 3O1LA 2VBYA 4KV8A 2FJWA 1GAOA 2DXEA 2D7SA 2HQCA 2OMOA 1R6VA 1ZA1B 2VKZG 5J2MB 5A8RB 3GV5B 3CJ5A 4EBEA 1M5OC 1WOPA 1O51A 4M5HA 2MGZB 3H5YA 1UPPA 2RRNA 2I0XA 3TJ8A 1R6YA 1YDLA 1R8BA 1UFLA 4WIIA 2ZE2A 3GG0A 4ZITA 2VQEJ 4ELUA 4UY85 3GFYA 3N28A 3BR8A 3EM1A 4WIQA 5ETSA 2W01A 2LEPA 4ATNA 3BSAA 3P3DA 2W24A 5HLFA 2ZJRQ 3WQPA 3PR5B 5DZ7A 1T9WA 5A8KA 3UD4P 4D3GA 5GAHU 5F8NA 1F2GA 3LGMA 1LWXA 3P4UB 2DJWA 4RUAA 4PWDB 1W25A 3G87A 5L38A 4PG7A 1N32J 1C1CA 3KWMA 4C7QA 2EFQA 1EKSA 2LA6A 1C1CB 1F5BA 3H2LA 2QMUB 3QQCD 1S1VB 5D4PA 5U47A 3V5RA 2VL1A 3GQCA 2H54B 1N48A 3D3CJ 1M5PC 3GCXP 2NZCA 3W8PA 1LKZA 5GAHI 1HHQA 3GV8B 1A9NB 2PMHA 1VYAA 3LQVA 1VRTA 1KQFB 5J2NB 5F8HA 1SH3A 1Q8KA 1M1GA 3HVTA 3ISNC 3JQKA 2V4RA 2XMMA 3FRYA 3HVTB 3OVAA 2VC1A 3QIDA 4X62F 3KLHB 1VQ6S 2Y9HA 1U49A 1GMWA 2W2MP 3IS9A 3MPUB 3IWNC 3NBPB 1H2UX 2PEHA 3IGVA 1SQGA 2LQ5A 4DPXA 4LF5F 3MEDA 1C4AA 3DOLA 3CULA 2ZWPA 4LBPA 1KD1T 2IM1A 1U25A 1P27B 3D6MB 1VQOS 1VQKS 2CKWA 2KVQE 2V2KA 4ECZA 2DIUA 3H2VE 4FVMA 1JLCB 2L3MA 3DXSX 4B17A 2ROGA 4HT5A 3S7RA 4N41A 2VG7A 5D0EA 3NL0A 2A10A 3KLFB 3BDPA 1LFWA 2FUG9 3D7SB 3UCZP 4L3KA 3IBWA 1U1OA 2IRYA 2IBOA 3HKZD 4U7UK 2R9LA 1U1RA 3M8PA 3QWPA 2ZVIA 5KFGA 4JV2A 3U27A 2XCPA 2RQCA 3Q83A 3MI7X 4HH0A 2V94A 5D0RA 5HJYA 3KHRA 1R0AA 1PJ6A 3MPYA 1AUDA 4ITSA 4RW7A 3ZFVA 1HWJA 4PYDA 2J5AA 4KGMA 1A0OB 4KGZB 3QO9B 2C3MA 3GR1A 5KFHA 2Z8QA 4Y28C 4UTGA 3CD7A 3N4WA 1IUJA 2P9CA 2HNYA 2BE9B 4HVZA 5SUHA 3SFGA 5B08A 3PYFA 2XS7A 3BYPA 4DOZA 2IHR1 5LMNF 4K4YA 1WG1A 1T03B 2OJ3A 4B3OA 2F8EX 3FNNA 5IOLA 1TK8A 2E9TA 2MKJA 1OYEA 2HFOA 2E29A 5THWA 2Q43A 5I3PA 2KJVA 1Q0NA 3W9HA 4B3RF 4ELVA 2IYGA 1UETA 2DHXA 2EG1A 3HX9A 3LALA 4OYBA 1HMVB 4WYLA 5A6WA 1T02A 2BJ9A 1PYSB 3HD1A 3T1HF 2FVRA 2BDPA 1CQNA 1DHMA 4ZVGA 2AF6A 3LF0A 3MM5B 3PFEA 1PSDA 4RJVA 4AQYJ 2OMLA 3CJTA 2ALZA 4ZKAA 2UVRA 4HEA9 2C2OB 3C15A 2DHGA 1XMQJ 4JI1J 1HNWF 4JI7F 3PRBA 5C25A 1RTZA 2HIYA 2KKHA 3AXMA 2YKMB 3I82A 4KGVB 3ZTOA 2MHEA 3FUYA 2LXFA 4UQTA 4FKXA 4LRAA 4DQRA 5H9EK 4DFKA 2EC0A 4QR0A 3CIMA 4ZN3A 2KXHA 1WI6A 5HANA 3C14B 1VOMA 4P2SA 3C66A 2R8IA 3OR1A 3MPDA 5H1SV 5DQHA 3ET6A 3TJ9A 2DRDA 2EI5A 4NLOA 4C3LA 4H4KA 2Y0SD 3T6JA 4U9RA 3O2IA 1NUEA 3M2UB 1VBZA 1Q81T 2J6SA 3CF5Q 3BR9A 2RQKA 4ETZA 5IS2A 3KLVA 4PQUB 2ZOFA 3F41A 1S1TA 2C2KB 4LFBF 2Q79A 3DI6B 3P45B 4OYAA 2AGQA 1GTEA 3BBBA 3PV8A 1HBOB 1X5OA 4PUOA 5L9XA 4ECVA 4ALZA 1Y9OA 2CZ9A 3N6LA 4NZ0A 1UFWA 2WOMB 4XPEA 2L9DA 4QBUA 4MKBA 3MFIA 2HHHF 3PY8A 4M95A 2J8SA 4G3IA 1K8AT 2CPYA 1WACA 2CNLB 3X3UA 1WC4A 1ELOA 2WW4A 1RT4A 2HW3A 2LQJA 1XMOF 2V2QA 2DNPA 2VA3A 1H2VZ 2HFZA 2ZBIA 1WDTA 3MM6B 1HWLA 2LDYA 4OMFG 5HN0A 4F4ZA 3KYLA 2EPIA 3AFGA 2VOOA 4Q5VA 2E7XA 4QIWD 4YR3A 3G2XA 2YX1A 4KTQA 1SBRA 2XWXA 1KQKA 4ZLJA 2BV3A 4I2PA 4ICLA 2LA4A 5L1JA 3G96A 1TKTB 3H20A 2POKA 2N7YA 4P2FA 3MFHA 1YZ7A 1G4CA 3LA0A 1FRMA 1IKXA 3M4XA 4QIGA 4TLRA 4V1Ak 2LVWA 4DXLA 2GW8A 2BMBA 4BCAA 2YQ1A 2MZSA 4DR4J 3HM9A 3QT6A 5KFPA 4Q2LA 3PJXA 1ZTTA 2OTJS 1RSCA 2H5JB 4MFBB 1D0EA 1YSJA 4V19J 2RU9A 4OYWA 3TUJC 1P1TA 3QT7A 5DG8A 4LF6J 1Q7YT 2AJ4A 4G1QB 3GJSB 3ISZA 3VQTA 1EETB 3NGRA 1CJKB 4FNHA 4QWCA 4DV7F 1U1NA 1FESA 3R7NB 4URGA 5A8WB 3QRQA 3HSJA 2KFZA 5A8WA 2EFGA 4GKJF 1Q95G 4JI4F 1HQUA 4A8FA 2MMYA 1T9XA 1UEKA 1WC0A 2BUNA 2C2NA 4PQAA 1FRIA 4P74A 3W1YC 2V63A 5IV3A 2HRYA 1I94F 4WZQA 3LP2B 2MZRA 3FEXB 1B0PA 4L74A 5J2QB 1L3VA 2V9WA 3PR4A 4Y0FA 5B0BA 8AT1B 4Z2XA 2XMWA 1KHVA 4RKUC 3KMSA 1ZTWA 3DDIA 1TFWA 1NH8A 1NSQA 4EGLA 2UUBJ 2C2DA 3PRVA 3BSOA 1XJWB 3B4MA 4M5DA 1VR6A 1M90T 1REVA 2E44A 5BYQA 2KO1A 5HQLA 2XZDB 3HFVA 2YWKA 2PMWA 4KO0A 4QZVB 4R25A 4ECQA 3AA9A 3UFCX 1CBKA 2B9EA 3R9LA 3PFOA 4OZ1A 2YWWA 4CLSA 5IT9U 5LM7E 5HROA 3TJAA 3KLEB 2QEXS 5IV4A 4N8OA 4TU8A 4DR5F 1RAEB 4IFVA 2ZBPA 4N77A 2CNNB 2CYYA 4KAIA 4FPIA 4JI5F 3M6WA 3OTDA 2KN4A 1TL4A 4WKRA 2FQQB 5EUHA 1QLNA 2NXNA 2M3DA 3MM8A 4K2XA 2ZZNA 2A1BA 2JSXA 1C0TA 1C0TB 3AQPA 3BDEA 1H74A 3MDFA 4DV5F 2UP1A 3JAMY 1SC4B 2HIQA 2GQ2A 4DV1J 2I9SA 1Y3KA 2ASJA 3I87A 5KG5A 1HBNB 2CQCA 4XTTA 2P5VA 3CVKA 3AA8A 3DM2B 5LL6d 1XNRJ 2VB6A 2GMLA 2HNDB 2IMOA 1SXLA 2ZBRA 3GJRB 3MEEB 2HNDA 1FX2A 4OLPA 4DR1J 4PWUA 3D2WA 1HNVA 2B4UA 1VFJA 2WSCC 3BF4A 4NXNF 1DFDA 2KT2A 5LJ5Y 4Y2AA 1ITPA 2DGUA 2H4WB 3OXLA 5GMDA 1H3DA 4NA2A 3CCQS 5CYMB 3H98A 4M5NA 5F3TA 3J7Z5 1W2IA 1Q82T 3CCWA 2ZH5A 4PKDB 1S57A 1LW0A 4ED5A 3O8WA 1S72S 5EWGA 3HD2A 2FJBB 2AJ1A 3I4PA 1AA1B 1JLEA 1UW4A 1SH0A 3O44A 4DV6J 3W64A 2V0NA 2RMLA 4B9SA 4DG1A 2KG0A 1WUUA 5GMEA 2DO4A 4EBCA 2PN6A 1UJ6A 2DNLA 2WZ1A 1B4SA 3RBEA 1TFYA 5IM0A 2FHJA 5KT5A 1AYEA 1ZM3A 2B5JB 2F5GA 3MPVA 4NEZA 2AJ0A 1PJ5A 4NRTA 3J7YU 3BN7A 2JLGA 4DL4A 1S9GB 2FD2A 2R8KA 4FXWA 1NDCA 4N56A 1S97A 2Y3YA 1N54B 2NYIA 4DX6A 2MB0B 1CJVB 1FO1A 1NDLA 5JVHQ 2EKYA 1RZMA 2ZD1B 1SQEA 1LFPA 4OFZA 4RW6B 1UMJA 1UJ4A 3FQLA 3NY0A 1MWYA 2E5IA 3UVJB 1JJ2R 3BKFA 1TKDA 4TU9A 1S99A 2J0WA 3KLHA 2XS5A 1FTCA 2AP6A 3GIRA 2CPIA 3MM7B 3P5TL 3CCLS 1KP6A 3K58A 4R0JA 1CG2A 3D28A 4ZLPA 5CAAA 4NLTA 3AT1B 1NDKA 5DRKA 3CMQA 2B6AA 3M32B 4AL5A 4OLOA 2WBRA 5HAOA 5B09A 4DPUA 3RB6A 5ETKA 1NB7A 4ECSA 1S1XB 1FFGB 1Z4UA 3V6JA 3GIKA 1EKRA 3MEGA 2CQ1A 4OZ0A 1TMJA 1R8PA 5KFFA 5D78A 3IN5A 1NKBA 1FJGJ 1HWUA 3EE3A 4LUBA 4ZVSB 4B3TJ 2AT1B 2BANA 1FXRA 2VBZA 3ULHA 1RT6B 1H73A 2Z58B 1EZZB 4FVCA 3BGUA 4HHUA 3HF5A 3CCRS 4PG8A 2QX0A 3SSSA 2PC6A 1XQIA 2RRBA 3V4IB 2CPJA 2YNGA 3PRDA 4NLWA 1NK8A 3UQSA 1DBDA 2CQIA 1RYSA 3RAQA 3Q2SC 4LF4J 1FRHA 4JI6J 1FJ7A 2JL9A 3DFEA 4J7CA 5DLFA 4B9UA 1K0TA 4DV3J 4TY8A 1H98A 3ITHB 4TY8B 4B08A 4WKYA 3THVA 2K8GA 3AD9C 4CLLA 3CJ0A 3CIZA 4H4OA 1P1LA 4C0BA 4TNOA 3I4HX 1CC7A 2HPUA 4J90A 1S1WB 3DRSB 1O0PA 2RD5C 3KLIB 4QU7A 5C24B 2E1RA 2GA7A 4OYIA 1S0VA 1IN0A 1RT2B 4MJKA 3PVXA 1SV5B 2D3ZA 1RT2A 3OL9A 1RHJB 2MQMA 3OXGA 2MKYA 2W2QP 5F8MA 5F8IA 3K5NA 3MPWA 4I56A 5D0HA 5HQMA 1D3WA 4RW9A 4DUYJ 2CQPA 1TR0A 4DV7J 2X3DA 1YJ9S 2XLKA 3JXOA 4EZ9A 1VK8A 1Q79A 4J9LA 4WE1B 5EX3A 3DYAA 4QU6A 2AW0A 1AT1B 2VG6B 3BGRA 1G3OA 2N7CA 3ELHA 5KFEA 3SYZA 1Q7LB 5J1EA 3KUGA 4I68A 3IO1A 4QIFA 1VQ5S 4N47A 2OI2A 1ZS6A 3PW2A 4Q43A 3E2EA 1OMSA 2FDNA 1IR2A 2WSEC 3C14A 4UUWA 5K8NA 4IRKA 3UCUP 3EJMA 4IDKB 4OI3A 2EBGA 1NM2A 3GYNA 1LW2B 5AXNA 3NAHA 3LO3A 3UO0A 4ZLNA 3Q8SB 3RB0A 4A48A 2UXCJ 3FK4A 5LMUJ 2KG1A 1EP4A 5KT3A 3EWGA 2XZTB 4WU3A 2KZMA 1PGZA 1AXQA 1B0VA 4DSKA 1JKHB 4WK3A 2DT9A 2DB1A 2XNQA 3KUEA 1FF2A 4IG3B 2KXFA 2LU1A 1SJ4P 5F8JA 1Y7PA 2RH3A 2A6OA 2PEBA 1ZM9A 2WBMA 4ZJOA 4PUOB 3CDEA 1MN9A 2BJ7A 1UL3A 3H4DA 4C8YA 1CJTA 2D3UA 4L6V3 5E3RA 3T6BA 4RL1A 2PMZD 2C3OA 3W60A 1XMOJ 3NGKA 3UW1A 4JI5J 2OGUA 1EB0A 1S6PA 3E8OA 1NPKA 2GVDB 4BS2A 1RT4B 1JNRB 3HSDA 4AFFA 2B43A 1ZPWX 2DGQA 1FD8A 3DOLB 1R43A 4JYAF 2I5JA 4U6PA 2ZM6J 4J9QA 2FYXA 2YNFB 1S1UB 4YFUA 5K14B 1J2VA 2GGPA 1XMQF 1HNWJ 4LVNP 1YRTA 3VR1A 2W9CA 1KS2A 2HS0A 1HNZF 1N34F 1FNOA 2UV8A 4ICLB 4WFXA 3W65A 1T9TA 1NSAA 2HFSA 5ETOA 3EPGA 2HWIA 4DR4F 4NXNJ 2BZ2A 1KC8T 5BR8F 2GJIA 2XYPB 2R8JA 4PXEA 4OHVA 1BMQB 3CJQA 5IWAJ 1H7WA 2JOQA 1RWMB 2PO4A 2CG4A 2MY8A 2YX4A 4J9UE 4OZ3A 2ZH7A 4C11A 3W66A 1KTVA 2UZAA 3RBDA 4FNIA 4MFBA 4DEZA 2FTRA 3FCVA 3K59A 4RWWA 2C2EA 1X4EA 3M8SA 5HP1B 3I31A 4NEYA 2UUAJ 2V8VA 4OYOA 3LWLA 3J7YI 1FWKA 3D1OA 2OPRB 2ZJQQ 4B3OB 2W2PP 4ZS6A 4F7VA 2IA6A 1SH2A 1VQYA 2AYEA 3G6ES 1HKAA 4W4MA 4XO0A 3VAHA 3DRRB 4LBHA 2FHKA 3T41A 1FRKA 2KZZA 4ZCKA 4KC5A 4TLQA 3H5SA 3CO0P 1QY7A 2MLYA 2GZOA 2HHHJ 2I8EA 3MR5A 4DL5A 2DNRA 4DF4A 2Z0GA 2VPYB 3C6UA 2PI4A 4LQ3A 3Q2TC 4DSLA 5ITHA 3MR6A 2Z4PA 1M5HA 3K2YA 2CNKB 1MU2B 2LQBA 3TEGA 2DYAA 3GB0A 1OY8A 4KFBA 3MMBB 1LXNA 1MSWD 4NI2A 1GX6A 2Q6CA 3P5BP 1PAEX 4K8RA 1T95A 3VHQA 1NHVA 1RTDB 2W2NP 4GO7X 1SL2A 3BEGB 1Y5NB 3NGSA 1FKPA 2AMCB 2HHXA 4X4NA 4X64J 3P49B 4LT6A 2EK6A 2RF2B 1S79A 1TV6A 4U8VA 5B7WA 2CPZA 5CD4H 1TV6B 4YR0A 2XQCA 4DV0F 4W92B 2IYIA 2GAGC 3OL6A 3I9ZA 5HSPA 3KLFA 1NU4A 5E7OB 1N33J 2PI5A 1XR6A 2KJWA 5ETPA 1YX2A 5KFTA 2JLEA 1UPMB 1YQHA 4K5SA 3THTA 4OJGA 1DY3A 1L3UA 4C0HA 4JP8A 3MR2A 1VQNS 3AH6A 3NGDA 1G6BA 3ILOA 3DI6A 4DL6A 4FBTA 4KY3A 4A47A 4Q8FA 1B7FA 1HNIB 4HDHA 4FYDA 4KRWA 1AFJA 1BQNA 3CDUA 2BRLA 1AROP 1RBAA 3K57A 3EMTA 1FE4A 2D69A 1JB0C 2XMKA 1IQZA 3DN9A 3GR0A 4H4MB 5FDLB 3T9NA 1HNVB 1RAHB 2EXUA 2JC1A 3GFXA 1R31A 1L3KA 1WHWA 4IYQA 4MMOA 5BR8J 2G0JA 3POTB 2XMAA 3OHAA 3NS6A 4B3MJ 3C16A 1BGXT 3MCNA 3AODA 1B7YB 1REGX 1HQEB 4LQ9A 3TP2A 3VALA 1HQEA 1SUQB 2XYGB 2ZBCA 2RU3A 2KHDA 1OYDA 4QWAA 3CCUS 1RU2A 1C0UB 3VAMA 2CJAA 3N5BA 3LW5C 4PR6A 1WKKA 5ETLA 2XO6A 4DFJA 4FF2A 2VF3A 2ZE2B 4K4SA 3EUNA 1UVMA 2YKMA 1NH7A 1XNQF 4ZPTR 2YPYA 3BGFA 1TVRB 3SQOP 3MWBA 1TVRA 1NKEA 5EWEA 4MK9A 3DRYA 3BYRA 2BE2B 4CO0A 4R8UB 1X9WA 4K4WA 3HCXA 3AB4B 3KK2B 1KBRA 5K8PA 3AD7C 3MMCA 3CD5A 3ICLA 2UVVA 2Z30B 1R89A 1RQ0A 3BKUA 4WFYA 2ZKUA 4I6AA 3DKDA 2QGFB 3IC1A 4F4XA 2LEBA 1VRTB 5J2NA 2YKQA 2DO0A 4B3TF 2CPHA 4DR6J 2UU9J 3CUNA 1UVNA 1CS4A 1TL7A 1WSRA 1P9YA 2RNEA 4DV0J 3GLJA 2F9DA 2C3PA 5KT2A 2FVPA 3PEHA 1F9HA 4UOHA 3V6HA 1SKSA 3CJKA 3GMGA 2F7VA 2FZCB 3QFHA 3ZNUA 3D4JA 5A0YA 3NOCA 1V3SA 3VWSA 2GO8A 5F8GA 1CVJA 3H5XA 3ZZYA 1XC9A 3G6XA 2A2DA 4MIAA 1MN7A 3NP5A 4PXDA 1OQ6A 2RIJA 3OT9A 4A8KA 3CGIA 3SCLE 2N4DA 1Q1KA 1JLQA 1VIOA 1UWBA 1X8DA 5CD4A 3KK3A 3W3SA 1AFIA 4IQXA 2MKKA 4FS2A 3OSPA 5DO2A 1WOSA 4F3MA 1LK5A 3J81U 5LXYA 3C19A 2ZH8A 2DNYA 2JRSA 1KHWA 3H40A 4BC9A 4IG0A 1F60B 2J9CA 3NXZA 2CJQA 5KAKA 1X7VA 3ZZOA 4I7FB 2KRRA 2OAUA 2O67A 3DNCA 1IKYA 3KJQB 3LAMA 3J81Y 2BQRA 1HBMA 5B0AA 2GO9A 2BX6A 2HBYB 4JOUA 4UOGA 5BXIA 5KFWA 1ZZNA 2AD9A 4ED8A 1J5OA 1VK3A 2FLNA 2E9ZA 4ZDNA 2M2BA 4DN9A 1KOOA 1X60A 4ANCA 4YHHF 1JMTA 1UAWA 4WCEQ 2J9DE 2HS4A 3FKBA 5IQ6A 3I0SA 3TZXA 4P71A 1RWKB 3D66A 2RUSA 3DLKB 3I0SB 2FVSA 3RR7A 3DLKA 2R7WA 1CPZA 2QLXA 5LSOA 3IG1B 5CYMA 4ILMA 1TAQA 2CDQA 1SQFA 4LSNA 3SDEA 4TXSA 1IJFB 2W8KA 2ZOMA 1X4DA 1FJGF 3CJRA 5CA5A 3I96A 1JLEB 3QGIA 3PZPA 4M5IA 5M2UA 4NMXA 3V6DB 4K4ZA 2W1BA 3B54A 4YB5A 3CC4S 1UVIA 1FKAF 4CLKA 2YKOA 4ED7A 1CEZA 3V4MA 1FNXH 3Q8PB 1IBKJ 3M7VA 4O23A 4USTA 4NXMJ 3MM9B 4QIEA 1WD6A 1WSVA 3W2WA 4DU7A 5DDPC 4GMKA 3ZC4A 3MAHA 4J37A 1FXDA 3KJVA 5KFZA 1NJWA 4NCBA 3BS9A 3HZGA 1MROA 4NOHA 5KFNA 2ZC3A 1D9FA 1M5SA 3AHPA 4X4TA 1U24A 1KWMA 2CJBA 3O6QA 4ZVTB 4CLWA 4WU2A 4HL9A 3TAQA 4LF4F 2XS2A 4YS2A 4CLZA 2ZNZA 1HD1A 3P6YC 2AX0A 4B9VA 5KFAA 2QA4S 3B4DA 3PEJA 4PQUA 4JI6F 4F26A 5L1LA 5AT1B 2FVQA 2B9WA 2CQDA 3BGLA 4L3NA 2J8AA 1FD2A 2Z57B 2ASYA 5LMNJ 3M2RA 2AGOA 1NK4A 2D41A 5G0RA 3MM7A 1NPPA 2D9OA 5FLXU 1YBUA 4NLRA 4BDPA 2JFDA 1IKVA 3N6NA 3TUZC 3ISND 1QAJA 4JYAJ 2CWKA 1FRJA 3UNGC 4WFZA 4DCPB 3RW6A 5EHHA 3HKWA 4JBCA 4GC7A 1EQ0A 3CXCR 4KHPF 1YIJS 2FVCA 4OL8A 1FRXA 2C2MB 2GC8A 3MHYA 4PPZA 2IVMA 5AXKA 2FC9A 1IKWA 1GMWD 5GAGI 2LCWA 2O5DA 1VQ4S 4CYUA 4ZPBA 1V5VA 3TAMB 2LEAA 4OX6A 4KIAA 4Q2MA 3TZWA 4TQSA 3FQKA 5D77A 4QWEA 4WFBQ 3G82A 1Q8LA 2QN6B 2RDDA 4QYZK 2HEKA 5LXRA 1WF2A 1RGVA 2YNGB 2GHPA 4NYZA 2NREA 5B0GA 2JH3A 4F3OA 4J5OA 1W26A 3NNCA 3AOBA 1WHXA 1T7PA 1DTTB 4LRDA 2HK3A 2CFXA 4HTIA 4C2MA 4OI4A 4F4WA 2I38A 4NLPA 5J2PA 1I94J 1RHRB 2ACYA 4LR7A 1MMDA 1OSDA 2OEMA 4NA1A 2FJEB 1S59A 3C8YA 3H2UB 3GIJA 4F02A 2DGWA 2VDHA 2AU0A 2BW2A 1YGYA 2VH7A 3OLAA 1WJ9A 4B02A 1K1QA 2Q3PA 4AUKA 4DR3F 5F9NA 1FA0A 4HKQA 3WBZA 5KT6A 1JLBA 3OFEA 1SV5A 3QATA 4M1KA 3SMZA 1JLBB 3W2VB 2P6SA 3LANA 2VQEF 4OI0A 1VCTA 2OO4A 3BSNA 2P6TA 4ANDA 2KH9A 4OHXA 1QJHA 4OYZA 3TX0A 2VFSA 1GT8A 3UPFA 2O1PA 3I9V9 1DZ5A 1T3NA 3I32A 3GJQB 1MU2A 3G8QA 5KFDA 4KPYA 1IVZA 3SBMA 4C3KA 4IOCQ 1KEKA 2MSSA 2MZQA 2YKNA 4NYOA 3US5A 2OPSB 1BUXA 1EJ7L 2R7QA 2GHWA 2Z56B 3BGRB 4NYPA 1UEUA 5K8MA 1RWXB 4KO0B 1F0XA 1PYTA 3PHEA 3N6MA 4LRCA 3U1NA 4BWJA 2NZ4A 3IR6B 4QW8A 2Y1RI 3G6VA 2NS1B 2ILZA 5E3QA 4CLPA 2JEFA 3OFFA 1H0HB 2EC2A 1SJ3P 3IAS9 1FVSA 2Y8WA 4Q0BB 1ZZFA 4BLGA 2HVEA 1A7GE 4KR0B 1TU0B 2XM3A 1JKHA 1FKOB 2IFXA 5HI7A 1E6VB 2LQ8A 5BYSA 3IBFB 2QA4G 6FDRA 2EG2A 3DCAA 2OEJA 2MSTA 3LAKA 3RAMA 4ZP7A 4F0MA 5GMKa 3CCES 1XTZA 3RAXA 4U96A 2XMJA 3OJUA 4RW4A 2O3DA 1M5VC 2C1EB 1ACMB 5LSLA 4IO1A 5K9FA 2MDAA 4O4GA 1UVLA 2BM0A 3M05A 4O4GB 2GVDA 2I6WA 1KVKA 2BEFA 1GEHA 1RBOB 2E1AA 3EVOA 1ZOTA 3IR7B 1DRZA 2F4VF 3TEHB 3DXBA 3RJMB 1XNQJ 4FKYA 2AEMA 4O0IA 2NCKL 2YNFA 4RZRA 3NEKA 2LKZA 3QGHA 3R7SB 2XLIA 3JYTB 3LWMA 2C22A 2BM1A 4EO8A 2VJUA 2D1CA 3DLLQ 1IWAA 3M9OB 4Z7YA 4CNZA 2SXLA 3K7RA 1XEZA 2DCUB 2HZAA 2VDIA 5HK4A 4OYPA 1R0CB 4DL0C 3CWJA 3ZZZA 4RW9B 4CT8A 3VAFA 1CJUB 4LFCJ 2MGZA 2HGMA 5D4NA 2OPPA 4YHHJ 1C2PA 3H7HB 2FJAB 4ERDA 3SV3A 2AKWB 3AJ2A 3MCSA 5DDRC 4X64F 4WWSA 4XPCA 4AD6A 3HHKA 4HHHA 2HK2A 3S01A 4A8SA 1RCOB 4KH0B 4F2RA 1X4BA 1N0VC 2NUHA 9ATCB 1SCJB 3QT5A 3O5TB 4C8NA 4LSLA 4UF4A 5JMNA 1C1BB 3CJ3A 1SL1A 3R2CJ 4GKKJ 1EHWA 1QVFR 2XHCA 3RRHA 2WB4A 3WHIA 3MR3A 3BQ2A 4A46A 4DV5J 1GXUA 2J7KA 2L48A 1WI8A 2OEKA 2QT7A 2F40A 4R0EA 2R2UA 3JSBA 3RB3A 3BH7B 2LXUA 2ZD1A 3KJFB 2CDRB 4HYKA 1IBKF 2O01C 3UDLA 1RI7A 4IOAQ 2E5GA 5C42B 1D1UA 3OR2A 5C42A 3HP6A 3DLHA 3OR2B 4Q44A 2X1BA 1WORA 2NXEA 1S7HA 2O66A 3C6UB 2YBVA 3VZIA 1CS4B 1RADB 1TL7B 2QL5B 4ZPVR 3D1QA 4DFMA 1AB8A 3M6VA 2VPXB 2QTWA 1J27A 4FPRA 5BYRA 3G6YA 4ZIWA 2RUGA 4LF6F 4X2BA 2QLBB 1VS3A 1F3FA 4NI2B 3OXFA 1E6YB 3IRXA 4OI2A 1KRPA 2J0SD 3HJVA 3MECA 3SV4A 4JI3F 4WXOA 5T7LB 4O3OA 3J81j 4LF8J 2C28A 5T7LA 1B0TA 4ZHRB 4TU7A 2WVCA 2HSEB 2V2ZA 2YTCA 5T14A 1LXJA 4DV4F 2H4YB 5DS7A 2DXDA 1CSJA 3QGPA 2V9KA 2KT5A 4WJBA 1RT3B 3G4SS 1S6QB 3QZ7A 1NK7A 1IBMJ 5JUMA 1T0TV 4ZPWR 3HHLC 5HVHA 3LPYA 4MKVA 2GV1A 2LQ9A 2EFVA 1CQMA 3LP0B 3KUHA 4ZN1A 3RRGA 4DUYF 1XMBA 4LR9A 4USWA 5B0EA 2OFHX 1YJTA 3VAGA 4RU2A 1HBMB 1G1XA 2R7XA 4F36A 4RUHA 1KLMB 2XMVA 3Q8UA 4O3NA 2V8GA 4OX9F 3W61A 1ZAWA 2YWGA 2B0GA 3KG4A 5KT4A 1UEVA 2AJ2A 1UP1A 1WKJA 2ZUAA 5B0FA 1VJQA 1U47A 4QPTA 3QJPA 2VASA 3B82A 1QSLA 3CMES 3KJNB 2DPJA 2BXJA 2LXIA 4N7TA 4DR1F 3MCMA 4J9PA 2DR7A 2DEJA 3IG1A 2X1AA 4GVBA 1XNRF 4ED2A 2W7PA 1HMVA 4WP8A 1N52B 5IXUA 4PCQA 3GSDA 2BKNA 2B51A 3DMJB 4ES2A 2GQCA 3UN2A 4ZK7M 3HI9A 2IJFA 3C15B 5ETNA 5IZHA 1VQ7S 2Y1IA 4MYTA 2W7OA 3C3LA 3TR5A 4IR1A 2WVDA 3DLEA 5MAOA 1KONA 1U4BA 4P75A 4EI2A 1FJCA 5GAGU 3R5DA 2UVUA 3DRPB 2RDIA 4OZ5A 3MM9A 2RB7A 2MKCA 4DJBA 3MOZA 4JV0A 1ZAVA 2FJDB 3TZYA 2R2RA 2DVIA 4F67A 1BQXA 2DGXA 4RPFA 4PWDA 2LDIA 4CO2A 1FEEA 3BM7A 4UZCA 1FX4A 3OR1B 1L5UA 3Q89A 3M6UA 2R7TA 3W9IA 3PX6A 2DEIA 5MLCV 1ZETA 1NO8A 2IA0A 1RUSA 3D0GE 3R1HA 3E3XA 1RWOB 2ADCA 2H48B 4TYAA 5H9EJ 4RBUA 2G2YA 3M1VA 4WFAQ 5T41A 1K73T 4FF3A 5G0RB 3M1VB 4IRDA 5DZ6A 5KG7A 2KDOA 5KT7A 1RTJA 1BQNB 3D0HE 4P9SA 2GIRA 3ETMA 5DG9A 4X65J 1LV5A 4QPXA 1X9MA 4ZVRB 2ZBQA 3OV7A 3OL8A 4PABA 4H4MA 1SVDA 5FDLA 4K0KJ 1IBMF 3SCJE 1Q8BA 2HGLA 3L09A 2QL7B 1G7CB 2BOPA 2XY6A 2K06A 4U7UD 1JLAB 1S48A 3CEDA 3QAUA 2JX2A 3N9UC 4Y2KA 3DC2A 3GSIA 3W63A 3F73A 2V2VA 2F63A 1SL0A 1S1UA 1N5YB 3DLBA 3W5YA 3L4BC 5E2QA 2BJDA 2YWHA 3WX4A 3TARA 1SJQA 4I64A 1ROFA 2V6AA 3DU5A 3UR3C 4DL3A 1BWEA 4LIRA 2VBXA 4PWWA 1R8AA 3EICA 1Q16B 4X4QA 1WNEA 3MD3A 3PTWA 1UTAA 5HMWA 3Q0AA 4DLEA 4FXVA 4DFPA 2K2PA 2HFUA 3CJ8A 2JDJA 2RE1A 3OTEA 4P7VA 1BQMB 4CRJA 1FDDA 3MZIA 3CD6S 2DR8A 2E7WA 2V8PA 3ENAA 1FWLA 1RWNB 3K17A 4G65A 5L8RC 1YK9A 1IKYB 1VRQC 4EWTA 8RUCA 3UDCA 2DHHA 3AOCA 5JVGQ 4NCGA 3VTIA 3OD2A 1RT1A 2QG9B 1I6JA 2IDLA 2GNKA 4IH5A 4DV3F 2WVFA 4JI2J 4J9VA 2HYIB 3W2VA 5LSRA 4PEOA 3KHGA 5I3UB 3CPWR 4EO6A 4JI0F 1A6LA 1PBAA 3DGVA 4KGKA 5LOQA 3WX8A 3FMBA 4AYBD 4M5JA 1WG5A 4YDDB 1N56A 4CO3A 3IP0A 1ZAXA 4Y34A 4CH7A 2VA2A 4OX7A 3A8JA 2JFKA 2ZM6F 3EXYA 2A2CA 2WVBA 4CLTA 1R8HA 1S9EA 1BD6A 2V34A 4ID5B 3SSRA 4DR2F 3BV8A 2IVFB 1HNZJ 2OSQA 5A0YB 1Z1ZA 1NJIT 3M8WA 2X1FA 3SQGB 5FIIA 1U1KA 2QMWA 1XR7A 2UUTA 3VV2B 1WF1A 3HPOA 4FP9A 3TVZA 3JQJA 3FBFA 4BHQA 3TO8A 4ENOA 2DH7A 1UVJA 1JLCA 1FFWB 2FGOA 2JJ4D 3TQEA 1SJFA 5LJ3Y 1MLAA 1JXLA 2YNIA 1IWGA 2M5YA 4Q0BA 3G9CA 3P96A 2QIFA 1OWXA 5CCLA 2XCAA 1RTHA 1TKXB 4LF5J 2P9EA 3M2UA 4Y6IA 1PAUB 3BO4A 4P10A 1U0HA 4QR1A 2RHQB 3PW7A 2F3JA 3EVWA 4DR3J 3UN3A 2XULA 1VQMS 3VGVA 4QOTA 4RW8A 5IT9Y 5L9NA 4DLGA 4OHYA 2LP4A 2Z2ZA 4F04B 3QO9A 4RW4B 1HA1A 3NCRA 1B70B 4U95A 4I2QA 1PG5B 3HHDA 3E01B 4F4KA 1MNEA 1QE1A 3QYYA 3PKYA 4ECYA 4NMLA 1PKUA 1YJNS 2AEJA 1J5OB 2B56A 4DV2F 5AXMA 2FLPA 3TVKA 5A2QY 3M8QA 2A0FB 3UDVA 2PGCA 3POTA 3QBCA 3QT8A 1HFEL 1WTFA 1YLXA 1VC6A 3WC2A 1HYSA 2L9WA 3JS9A 4LSNB 4X4SA 2CQ2A 3V2UC 3K5OA 5I3QA 4IH7A 4EYHB 2H1YA 1RAGB 3ZZPA 1EARA 2B9XA 2YWEA 3WIUA 1N32F 2EWHA 3LGHA 2BACA 1HW8A 2CIMA 2ZC4A 4JI2F 5C25B 3OJSA 4FZVA 2KYXA 2L08A 4X4RA 2XY5A 3GE9A 5E33A 3QSIA 4HT7A 4DPWA 2HAFA 4RX6A 5DGBA 1WHYA 3QJLA 5DG7A 4KPCA 2OTLS 2Z2MA 5CYJA 1C1BA 2WVEA 3CCVS 2VFVA 3OTOF 1FI4A 2WB1D 3TA2A 3CTRA 1ZYQA 1B3TA 3LH2S 3EGWB 3TA1A 3MUVP 4YB1P 2YH0A 1NK0A 1HHSA 1YG0A 2N82B 4UQGA 3FSXA 1TUGB 4LF7J 3EYZA 5HMXA 3W62A 1NAQA 4QR2A 4F4AA 2MQ8A 3QMQA 1NB2A 2HHVA 2DRAA 2PA3A 4IUFA 4F0HA 1UVKA 4FBUA 3I55S 3CJ2A 3FSYA 1QUVA 3R27A 2F4VJ 1U1QA 4QYZJ 3I5BA 2HZCA 4NASA 5HATA 1VLYA 2ZH4A 3MD1A 1SC6A 3C2PA 4J9SA 2OP5A 2RJZA 2YPZA 3A12A 4O4RA 4DZ6A 2RT3A 2W8LA 3UE2A 2JWNA 5ETVA 2PSZA 2VQFF 3HULA 3R5CA 2H5IB 1URRA 1SIWB 3S8SA 1RISA 3D6HB 3OHBA 1UW9A 4AXJA 3SEOA 5AE1A 1UA0A 1RT3A 1WEZA 2X3GA 2K3IA 4MK7A 3KKFA 3TA0A 2KRBA 1LWCB 4DZDA 2XHWA 2ASLA 3DDKA 4ZPDA 1Q86T 3PO5A 3U1MA 2EFNA 3BO2A 4OJ3A 4DR5J 3LP0A 4LRBA 2ADBA 4V19X 1FKOA 2V4JB 2VKRA 1OJ4A 5GADI 5HO4A 2KM8B 4MT1A 2KTQA 3R6LB 1J5EF 1HPZA 4IG0B 2W4PA 2H51B 5FD1A 3UCGA 2DRBA 3ENVA 4B3RJ 2UUWA 5LT5A 2AYGA 1Q78A 1RLDA 4DUZF 3M30A 2M4MA 2VUGA 3R7BB 4G1QA 1NHUA 4DR7J 2D9PA 2HHSA 2CUYA 5C24A 3KDNA 4NE9C 3H90A 4A8MP 2CJXB 4JI1F 1TK0A 5C5JA 1N88A 1KQGB 2W25A 3DU6A 2CXEA 2HBRB 1R7IA 1S6UA 2E1MC 2JNJA 4L72B 1VQLS 1CULB 3D1HA 3KOAA 3MAAA 4KKOB 5J2MA 1GQEA 2PIIA 1VGYA 1FDAA 3PX4A 4DMZA 4B3SF 4NLQA 3W9JA 1JK9B 1T9YA 1Y11A 4X84A 4O3QA 3CDAA 3DOKB 5H9FJ 2VD3A 3SCKE 3CC2S 2MXYA 2P2CB 4EMDA 4Y2IA 2FC8A 2IMWP 3RBXA 2KT3A 3KHLA 2MJUA 4ZVQB 1GFWB 1ZA2B 4MK8A 5EGYA 2LLZA 3AXKA 4CTAA 1P6TA 2DY1A 1U45A 3CB4A 3W2WB 3I5AA 1RA6A 2DNHA 3KG1A 3NRBA 9RUBA 1R0BG 4X65F 1RE1B 1VISA 5HMYA 1R3NA 4AQYF 3UNYA 2MKHA 1N4LA 1M1KT 1JIHA 3QWUA 4O0NA 2HFVA 3OSNA 4QIVA 4AE5A 1LWFB 1EP4B 3B8HA 2QL9B 3RR8A 3IMQJ 4Q7AA 3KTQA 4RW6A 4HACB 4I4BA 4E8UA 2PT0A 4KH1B 4AT1B 1RTIA 1HBUA 2OPQA 4Y00A 1HIYA 1RTIB 2OPQB 3VGTA 4A8WA 2HG4A 4BBYA 2EFOA 2OUGA 5KFMA 4DX5A 2OSRA 1HBNA 2CJ9A 3QPIA 3IS9B 5AE2A 3HJFA 1FCAA 3G8TA 5C2GA 2B6AB 4URQU 1Q5VA 5H9FK 5DQIA 1JXVA 4X66J 3T5HA 5KTQA 3MEDB 3A3NB 3QLHA 3MTKA 4DL2A 2XMUA 3R5GA 1DJ0A 4U8YA 1N5YA 2DR9A 2K1RB 2FHOB 1VJWA 3GU0A 4R5PA 2RDJA 1UZHA 3K5PA 3TAMA 2HHUA 1Y4ZB 3D54A 4NXMF 1KDNA 5CZXA 1RT7B 3CDBA 4Q8EA 2MJNA 2ZWOA 3BPDA 4MIBA 1PYOB 5E3PA 3A8KA 1K9MT 4O3RA 2QRRA 1XWLA 3NCPA 3PDNA 1S4EA 3BQ1A 4WYWA 3GCWP 2HZVA 1S10A 3DDNA 3PW0A 3NGTA 2YQ0A 3T9ZA 2HNZB 2D74B 3R2DJ 1SB6A 3T1HJ 5EN1A 4YB6A 1WEYA 4LREA 4RUCA 4FYXB 2QSFA 2DNNA 2AQ4A 4NCGB 3EX7B 1RXOB 1ULRA 2CJKA 3ILLA 5F9LA 4CCHA 1Y3JA 2UXBJ 3OVBA 3VGUA 1TL3A 3RW7A 1FE0A 1IXKA 1CJVA 3KG0A 4Y65A 1HR0J 4XAKA 4YMEA 3DLJA 2QYGA 4I67A 3C6TA 1U7LA 2B9YA 2QMXA 4G6VB 2LYVA 2V50A 3H8YA 4GVBB 4PXCA 2F65A 1H72C 4DPYA 4E2FB 3HVRA 3JAMU 1WG4A 4UOCA 4XDDA 4HR2A 4ILLA 2DCLA 2HHWA 4ZVPB 1MG7A 5E3CA 2EW9A 2VHGA 5D15A 1QAIA 3OLBA 4EZ6A 1SI9A 5F0WA 1UCNA 4KFBB 1U26A 3HHLA 4P6QA 3U7JA 2NXJA 1AZSA 4WE1A 2PE8A 4USUA 3DYAB 5G4DA 1FTRA 1UFKA 4MKAA 2LECA 4RNHA 1UA1A 3DRPA 4DSEA 2BE7D 1X5PA 2H3EB 3UWTA 4N5SA 2YNHA 4OV1A 1HNXF 3TAPA 2DHSA 1HQ2A 4JI8F 3ONQA 1F3VA 1WWHA 3MEKA 2IM2A 2EVZA 3T1YJ 3JB9k 1RWPB 2E5LF 2J9EA 2KM8C 2YNIB 1RT6A 2DBBA 4ZVHA 1JJCB 2D3O1 3V81A 1DTQA 3PG9A 5KG4A 2W9BA 1NK9A 3V81B 1YTYA 1OPZA 2HHQA 3WDOA 3LPEA 1RHMB 3HSGA 1RWVB 3AY0A 4IQMA 3KK1B 2VQFJ 1OY6A 1SC3B 4RW7B 2VODA 1CLFA 1SKRA 1JX4A 4NLVA 3L7OA 3ITHA 2ROEA 1RTJB 1U8SA 1M1HA 3ADAC 1CJTB 2P8IA 3PYEA 5KOWA 4DV2J 1O8BA 2GQQA 4OI1A 3FRZA 3PACA 4NLSA 2WONB 1N36F 1TL5A 2Q66A 4OZNA 2CQBA 4P73A 2R7SA 4FYVB 4WK1A 4KE5A 1JLAA 4O3PA 2VV5A 4RNFA 3SCIE 4DX8H 1OS5A 2GGPB 2DY9A 1SUQA 4ID8A 1NPRA 1RLCL 2B3TB 2R42A 3OVSA 2G1DA 3CCJS 4QWDA 4F0KA 5A76A 2IC3B 1GX5A 4I1TA 1WF0A 3TW0A 4H54A 4XDCA 4Z37A 4XIUA 3AJDA 1TL1B 2WSFC 3DMJA 3BBCA 1UZDA 3JSRA 3NG8A 3TX8A 2RAQA 5DQGA 1HI1A 1TKTA 3LOUA 2AV5A 2WCXA 2DR5A 2VG6A 2XTJP 4EYIB 4OYXA 1BQMA 2XSFA 5GAEI 5D3GA 4F25A 2M8DB 5D3GB 3FSIA 2XSJB 3IFEA 1I3OB 5A8KB 4LF2A 4USMA 2VPZB 2DR6A 2W4CA 3EDQB 5KOXA 3QFWA 1FERA 3N01A 3PJWA 4NLGA 4ED0A 1IBCB 4DV6F 1BC6A 5CCMA 2RS2A 3R1LA 1WELA 3R5AA 4H4KC 3IAM9 1RHKB 3DRRA 2UV8G 4CM0A 3M2VA 3RRKA 2Y8YA 3FDSA 2JLFA 2QZ8A 2X7IA 3BH6B 1P9QC 3M2VB 5EX0A 3KNGA 2EK1A 1JNZB 2ACMA 4Y2MA 4CM2A 1D8ZA 4A8QA 1XN9A 2L41A 3BGOP 2PFFB 2I1RA 4DBQA 5F3ZA 2G2ZA 3GPAA 4ZP6A 3BJYA 3EGZA 5DGAA 2XGQA 2DH9A 2BYCA 1RAOA 1W7WA 4USJC 1WC5A 1Y10A 3NOGA 2DNMA 2CG8A 3KLGB 2GAHC 1QM9A 2B7CB 1T94A 2DD8S 4UOFA 4ZHRA 4X4PA 4A8YA 5CXTA 4LFAF 1ZM4A 2NR0A 1N0UA 3EGNA 2ZNYA 2HURA 1NEEA 1UWBB 3MUMP 2ZH3A 3KDOA 1LWCA 3U02A 4C48A 4QQBA 4I2PB 3KXDA 4X66F 4FXDA 1RTHB 1S6QA 1TKXA 2ZITA 3D6TB 4JV5F 2DGTA 1KKHA 2DISA 4F2SA 2ROPA 4MKYA 6AT1B 1RACB 5HVFA 2XG8A 2HRTA 1Q8IA 1VMBA 1X4HA 2RVJA 2W2OP 3W5XA 4KHPJ 3FBBA 5ETRA 4DUZJ 1HLWA 4OX8A 2NSBA 3OUYA 3M8RA 1RU1A 5IC4B 3ZTQA 2I2YA 4IR9A 1RWUA 1V3ZA 3QNWB 4CO4A 1ZPVA 2A3JA 5AJ3J 2ATCB 1RT1B 2GMJA 2JEJA 4ANEA 4C97A 4NCAA 1CC8A 2HGNA 1KFSA 2XEXA 2QO3A 2EKNA 3DOMB 1H38A 3MOJB 3QRRA 5A6PA 1EIYB 4B3SJ 3IA0A 2J0QD 2B8PA 2CZ4A 1S77D 2NQPA 2X51A 4HDGA 4RR5A 1DQ9A 3NS7B 3SDEB 2MZJA 3R6GB 1FDBA 1GXLA 3AB2B 5DLGA 5JJBA 1Z2ZA 3GWCA 2VFTA 2GX8A 1QSYA 1S9EB 2RQ4A 3PYDA 5K20B 2ZH2A 2AJQA 2FJXA 2K3KA 5DDQC 1FJEB 4N8NA 2M9KA 1B64A 1REVB 3J80Y 2CVEA 4HLBA 3ZZ0A 3FFIA 3BREA 3JSMB 3KJVB 2B5JA 3ZTPA 3JSMA 2C2RA 5CABA 3UN5A 3D3BJ 2FY8A 1RDRA 5KG0A 5HVGA 1RCXB 4YEAA 3Q8YA 4MIWA 5CYQB 4B9NA 2QV6A 1S0MA 1JJHA 2CVIA 1RAIB 2GCFA 2HQIA 3ILIA 5IC6B 1RWWB 2DNQA 4HACA 3S6EA 2ZJPQ 2C3YA 2GVZB 1NSKL 3GZ7A 3ILJA 2ZOGA 2GVZA 3SFUA 4DV1F 3HFKA 1D8YA 3VQSA 1K0VA 2Z2YB 3NNHA 1HD0A 2DNZA 5KG3A 2B7BB 1S5ZA 4WZMA 1UJ5A 1X5SA 1KVJA 1DQ8A 4OI6A 4L73A 5KFSA 1ICEB 2WOMA 5ETMA 2IM3A 3ENWA 1FK9A 1T8EA 5FJ4A 1X4FA 4UZBA 1RKJA 4D3HA 2QFJA 4C3MA 5AE3A 1OY9A 1IKWB 1X0FA 1TAUA 4R5PB 4WPAA 3LGNA 4K5RA 3SIPB 1RYRA 1NLKL 2P9GA 3ENQA 4PG6A 2H9ZA 2R3VA 2K7KA 3D0IE 2WAQD 5ETQA 5IT0A 2ATLA 2GHVC 7AT1B 1NK5A 4LVOP 3CO9A 2OELA 5IFMA 4GRSA 3V4IA 4ILRA 4OZ2A 1WDDA 4C0OC 2BJEA 2QLJB 4LJMA 3FCHA 3J7A1 4I69A 3X1LB 3ZZTA 1SKUB 1FHTA 2JVRA 3L7PA 4TY9A 1FXLA 2OD4A 1X0PA 4XK8C 1JJ4A 4U7CA 2BABA 2CA9A 4H4OB 1H7XA 1NBEB 2V68A 3EGVA 2A6MA 3TNVA 4CO5A 4S0MA 4Q45A 4AL7A 1NJXA 1EAYC 2F4FA 4WFNQ 2HLTA 1TL3B 3KK2A 4JI7J 3MAQA 3CSKA 1U0SA 2AGPA 1IM6A 4ZP8A 4X62J 4M63A 5KFQA 1IM4A 4ZCIA 4LF9F 2HQGA 2ZDPA 1SIZA 2QSWA 4IFYB 2NPFA 3IM8A 1PO6A 2OIHA 1NCLA 5C2CA 2ABYA 2RQMA 4UT4A 4I6WA 1VBYA 3MAAB 1YJ7A 2QLWA 1HL6A 4KKOA 3AD8C 3HLUA 4O44B 4ZP9A 1RABB 2NYHA 3H42A 2CJYB 4MTPA 2BVZA 4OJHA 4O44A 4J9NA 3HHLB 3OBIA 4YN3B 1AZSB 1D09B 1N5SA 2B4PA 2DK2A 2XYHB 3FEZA 3H25A 4CWBA 1QDUB 5A2QU 3IWXA 4MH8A 2QA2A 1GMVA 1S1XA 2BW7A 1VHFA 3CJSA 4JB8B 3UI3A 1HWIA 5HL7Q 3R5JB 1O5JA 2J7UA 2CQHA 1X4GA 2BJ8A 2NPIA 2ALYB 3GFZA 4ZLLA 5FLXY 1VC0A 4HTJA 3W7BA 2BR0A 4DSJA 2RKIA 1DTQB 4AXIA 2W9BB 1JWWA 2FB0A 2ZH9A 4IFVB 2NXUA 3KK3B 5D0GA 4ZCLA 4DF8A 1LNQA 2DXFA 3H59A 2VICA 2DGOA 4IKAA 2NSCA 1Y0HA 2APOA 4X4OA 3IGNA 1V9OA 1X4CA 4CP5A 4DS5A 3T5JA 2AWZA 4E98A 1U0HB 1N6QA 1KFDA 3IWLA 3HFZB 4C98A 2VIHA 4LBIA 4C6AA 5DM6Q 3M2RB 2KB2A 1HPZB 3K89A 3HXMA 1GXTA 2HVIA 2ZVSA 2UXDJ 3QIPB 1N34J 4WBFA 2IVYA 5M2PA 3A3OB 4L76A 3VCDA 1RHUB 3TI0A 4CZCA 3TWZA 1QE1B 3AOAA 2CRLA 3MEEA 3KLIA 5L39A 2QYCA 5IWAF 5I42B 2I5JB 1VQSA 1M0SA 2OHDA 3R3TA 3MURP 4C8KA 1DURA 2WK4A 2Z2LA 4ES3A 4HHJA 1PBUA 2VG5B 2OKQA 2HAIA 3Q86A 3RZAA 2VG5A 4NZ6A 5SZTA 2NLWA 2M70A 2YQ3A 3DHWC 4OHWA 2YX7A 2IDEA 4WXWA 4CT9A 4F3QA 4RNMA 2R7VA 2W7AA 1HW9A 1K47A 1KR4A 4DDFA 3DOKA 2IAJA 4O3SA 3GONA 5KFXA 2JEIA 3B6BA 2ZHBA 1JLFA 3V6DA 1WTBA 4OX9J 3PO4A 1JLFB 1YWXA 5J2PB 2MEWA 3MXHP 1U02A 2ZHOA 2HVZA 5J1EB 1RAFB 2EFPA 2HNZA 3BPSP 3EXCX 2QLFB 3PW4A 4X4VA 4FF4A 3AQOA 2KVIA 4LSLB 3L3CA 1F6TA 3T19A 1RT5B 2ZUGA 2H65B 3NLCA 2M7SA 3W8GA 2MLZA 4A4JA 4C8ZA 1SKWA 1MROB 3MF5A 1S9GA 3HDSA 4EEYA 2AZ1A 3WC0A 3TRGA 2FPHX 3J7AN 3GV7B 2DKOB 1YBAA 1YZ6A 1PCAA 1MWQA 2FZKB 2IRXA 4K7QA 2MLXA 3PHTA 4RBTA 1D9AA 2J7WA 4DQQA 2YXLA 1F1BB 1T11A 2IM0A 3C6TB 4KHRA 3Q8VA 4QWBA 1NJYA 4A8OA 4P7TA 1NKCA 3GYXB 1N5VA 1VC5A 3SXLA 2BA9A 1QAYA 4LFAJ 3UVJA 2MKSA 2ERRA 1I51B 2FHMA 1N5TA 1PILA 1IKVB 2J6UA 2G13A 3EVMA 3O3LA 1OPIA 4I6YA 2AIRB 3DLGA 4WTYA 3TZZA 2MQOA 2B8QA 2OPSA 2ZHAA 4DCJB 4M5KA 2M0GB 3VF0B 1ZBTA 3A3PB 3TVYA 4EFAC 2E1CA 4N76A 3BSCA 2AHOB 3NS5A 2AYMA 1FT8A 1Y5IB 4LR8A 4ECXA 4GO5X 4DR2J 5K14A 2CQ0A 1S6OA 3FVYA 4DSFA 1TQLA 3QJJA 2MPUA 2HLUA 1Y00A 2VG7B 3J80U 3VAJA 1VI7A 1PC5A 3C46A 2HS3A 2CWXA 4ZIVA 4Y2CA 2UVWA 1K1SA 4CH0S 2XO7A 2R2SA 1RT7A 4DQPA 1F2HA 3RG6A 3VGSA 5B0CA 4TVAB 4B9TA 5KG2A 3KK1A 3CC7S 3KMQA 1S7IA 2OLWA 1URNA 1RAJA 3N5FA 4C11B 3EZ5A 3RYLA 3OFGA 3G8SA 2V8DA 1DAXA 2UUAF 4M94A 2DHAA 4NA3A 2IY5B 1KLMA 4BWMA 2DNGA 2MQLA 1JLGB 3PNIA 5KG6A 4MAKA 3IBCB 1TKZA 2HMIB 3HO1A 1BE4A 3S1TA 1TKZB 1IJEB 1XERA 4OV6A 4P52A 3PW5A 3M8ZA 1L3TA 1NDPA 2ILYA 2MQPA 4LFBJ 2XWYA 2VBWA 2A18A 2E1PA 3PCOB 3CE8A 1VRUA 1V6HA 1YKWA 2ZKTA 3CJ4A 3HT0A 3H4BA 4FN5A 4F4YA 3FEYB 1YI2S 4WTOB 2JVOA 2IC3A 3GYGA 2BJ1A 5CQGA 3QSYB 1FEHA 2BJ3A 3D9BA 1C0UA 1U1PA 1RA7A 3KFWX 4C8MA 3R97A 3PM9A 4EK2A 1APSA 2DGSA 1YHQS 3IM9A 5KFIA 2BOAA 5F0UA 5CHCB 1WC6A 2JHEA 3EZUA 3FGVA 2YY3A 3GFHA 1JQGA 3Q8RB 1RTDA 4ELTA 3MMJA 3THPA 3J7ZT 3NMAA 1FKPB 2YNHB 4CTAB 2C2ZB 4CQ1A 2V8HA 3CNQP 5EWFA 1J5EJ 2MZTA 2EBEA 2G0CA 1U2RA 3HHLD 1RK8A 5HQ8A 2N3OA 2MQQA 3ET6B 3CD0A 3Q23A 4J9MA 1GK8A 3FMWA 4IDKA 2HHPA 3SI8A 5KFYA 1LW2A 3HK2A 2R7OA 2ZFHA 2GJ2A 5DJBA 2BKPA 4CNYA 1F9EB 1YJRA 2IBKA 2OD6A 1BY9A 4W98A 4CLYA 1LQ9A 2WRMA 4YQWA 2HQDA 1MW7A 4OYMA 2BRKA 4K4TA 3TOQA 3TUPA 1TMMA 2CAJA 1QD1A 1HNIA 2BQUA 2IJRA 2QJ3A 3F44A 1AUSL 4UUXA 5CH7B 2WONA 4ZJQA 3NBPA 1WC1A 4M5LA 6FD1A 4J9OA 4LF7F 1KNZA 4GKJJ 3GJTB 4TQRA 4GC6A 3L95X 2HVHA 3VAIA 2IIHA 1OIAA 4KB7A 3MECB 4ZJLA 3MM6A 1NMEB 2AX1A 4KHMA 3QLHB 3BKTA 3C16B 4IRCA 5J1NA 2KFNA 1XBWA 1VDHA 1IQTA 2XBPA 4YY3F 2R4FA 4K4XA 2W9CB 2HFNA 3FCWA 2UUBF 1CJUA 1JLQB 1TL1A 4YR2A 2FHJD 1HWKA 4ZVOB 1WHVA 3M8PB 1SPBP 2KXNB 3G71S 2R8HA 2ZH6A 3V6KA 4HI2A 2ZZMA 1LK7A 3OW2R 5DM7Q 3JSYA 5KFOA 4C9DA 1TELA 1TUWA 5L1KA 2VC0A 4RNNA 5E41A 4C8LA 4K59A 3NMRA 1PIEA 2U1AA 2CZVC 2RSQA 4I0WA 4YUDA 3OUYB 4I7FA 4DSIA 3NNAA 1F9FA 2HQFA
chains in the Genus database with same CATH topology
1HHTP 5HLFB 4EBDA 3JTOA 2BE2A 4R8UA 4NLYA 5HP1A 3ZZRA 4IH6A 1S49A 3CCSS 7FD1A 5KFJA 1NK6A 2OPRA 2HRUA 5KFUA 4ECUA 2PA8D 3CCZA 3VAKA 4ECTA 2XY7A 1LWEB 1XR5A 3BN4A 2D3OR 1LWEA 1HQUB 4K50A 1V3RA 2CPFA 2X1GA 3FZ2A 5K8OA 4PG5A 1YJVA 1C4CA 2IJNA 3H5UA 5JXSA 5J2QA 1U09A 4DN0A 1KQSR 2PD1A 3MM5A 3M9NB 2FY1A 1HARA 4KJIA 2DPIA 4C8OA 4ZPCA 5GAEU 3PIPQ 2FGCA 3TUIC 2QA1A 1TZ0A 3CJKB 3MMBA 2JC0A 1X9SA 1DLOB 1DLOA 5CZVA 3OL7A 2CQGA 4OQJA 2LU2A 1U48A 1N5QA 3FFIB 2KFYA 2E9RX 5D6GA 3CCMS 4ECWA 2CPDA 3Q22A 2YH1A 4HI1A 2MZ1A 3F56A 2RKIB 3GG1A 1OO0B 2C3UA 4TKTA 1SJ1A 4JUZA 2G9OA 2IRUA 4DHVA 3CDWA 2XNRA 3I0RA 3PKMA 2FJVA 5D4OA 4PRFA 1NNDA 3MUTP 1Z2LA 2FIUA 1YVFA 4URSA 1R0AB 2UXDF 4ECRA 1PC4A 3TYTA 2B4VA 1MWZA 4EUVA 4LF8F 2DNOA 1RP5A 1HBOA 5GADU 2L9NA 1NRKA 5KG1A 3Q24A 3FZBA 4I2QB 4Y3CA 4OIXA 1LOUA 4CH1A 4KT0C 1QSSA 2XZWA 3E51A 4ZVFA 1FK9B 1T03A 2C42A 1TK5A 5I42A 2M8HA 2RS8A 4DQIA 4NX9A 3LP1A 4YOEA 3LP1B 2R8GA 1HYSB 2ZH1A 5HMZA 2XI2A 5KFCA 3KHHA 4NLDA 3OTBA 4PG4A 1VQPS 1SJRA 5KFBA 2VFUA 2KI2A 3DRXA 5A8RA 2R7RA 3FJ2A 1DQAA 4KBIA 3EPIA 2RRAA 5KFLA 4DR6F 4GKKF 3HVAA 4BC7A 1YJWS 4UY8T 4DG1B 3K5LA 1IKXB 4USHA 3ZZUA 5I4MA 2R2TA 4K4VA 5L1IA 4AL6A 2VOPA 3CMAS 1S9FA 5IM0B 4YP3A 5LMUF 3HHEA 4A8XA 1M5KC 2XSJA 2UXCF 5BJRA 2UUCF 2R7UA 1RT5A 2XGPA 2MHNA 2KHCA 2YKAA 2V4QA 2OH2A 4QJVA 5CYQA 4DQSA 2DNKA 2N4CA 1D9DA 3MMCB 1FRLA 1FDNA 1S4FA 2M88A 1S1VA 5I3UA 4IO9Q 3BB5A 4M8LA 3OQ2A 4IFYA 2XLJA 3IR5B 1YRUA 1AW0A 1HI0P 1S1TB 2MKIA 4ZMMA 3BO3A 1HR0F 2W4DA 2B4OA 4DS4A 2DITA 2UXBF 4NL5A 2K7JA 2F8MA 4YDXA 4QCLA 2F9JA 3N0VA 3M9MB 4NZ7A 3DLGB 2KYZA 4ID5A 3T5LA 2CQ4A 2XI3A 4ED6A 1X4AA 1U2FA 3TQ1A 2M52A 1GNKA 2F1FA 3MEGB 3SQGA 3A8EA 2VFRA 1IBLF 2MY7A 4QYRA 2BANB 1TUVA 5E3AA 3D5MA 5D4LA 5KFVA 1NZAA 5B0DA 3KLGA 2FVRA 5HROB 4KQZA 4JV1A 4W90B 1U6BA 4J9KA 7FDRA 3RTVA 4K0KF 1FVQA 2GIQA 2HWHA 1S0NA 4NWBA 3UD3P 1ZM2A 2V4JA 4U67Q 4RWXA 1DTTA 4OZJA 3SZ2A 1IR0A 3T1YF 1N6QB 3K0JA 3WZ0A 1VBXA 1S0OA 1H6KX 4ZCMA 3OFHA 3G86A 3HT3A 3AAWB 4MYUA 4LFCF 1S76D 3M30B 2JZ5A 1NJZA 1N8RT 3I56S 2COLA 3DRSA 5DDOC 2HNYB 3PX0A 2HQ3A 3MMAB 4DWIA 3MMAA 1QTMA 4RLEA 1OSCA 4ETXA 5KFKA 2VPWB 1KOHA 3DOMA 3T1AA 2Y1JA 2KU7A 1RJJA 1X5TA 2QE5A 4CIOA 2OFGX 2GFFA 2WHOA 4USIA 5F8LA 4LIWA 1R27B 4QW9A 4CO1A 3U1LA 1LW0B 2OPPB 2FLOA 4YB7A 3HHNB 1Q53A 2CPXA 4RU9A 4B9MA 2YKNB 1F5CA 4ED3A 4C4WA 3UR0A 2E5JA 4M5DB 1KVIA 1YITS 3I5CA 3GILA 2NUUG 1JXEA 2ZDOA 3AJ1A 1N33F 2DGVA 4NLUA 4RBVA 1FNMA 5F41A 3IRWP 2E66A 4DL7A 2FLLA 1QVGR 1DARA 2AJFE 1LWFA 2CQ3A 1UKUA 1GH8A 4ZVEA 3M6XA 1GTHA 3QAEA 3NKYA 1QAXA 1U1MA 1MMNA 3MM8B 3Q8QB 3RU0A 3N79A 4IG3A 5ADZA 2JEGA 1E6VA 4UW2A 4IOBA 2BQ3A 5AXLA 2LMIA 2PDAA 4RW8B 3SSQA 4RNOA 3T5KA 2DH8A 3QIPA 5M2RA 3E01A 3GIMA 3KNAA 5IQQA 3I6PA 1E6YA 3IRXB 3ETOA 2J9DA 2AYBA 1T05B 2CPEA 3DGPA 3M8QB 1T05A 1BLUA 3PIOQ 2Q6BA 2V5HG 4PXBA 1F5AA 2K1RA 4J9RA 3JYTA 2J76E 3K5MA 3IXQA 2XMTA 2YVSA 1XK8A 3T3FA 4PPDA 2MQNA 2U2FA 3JTNA 4KSEB 4TN2A 1Y5LB 2HWTA 4DPOA 2VZ9A 2HHTA 4G1PA 4CI0B 3TANA 1VIXA 3R5BA 3BQ0A 3HMJG 1U6FA 2IAJB 3HVWA 4B9LA 4E0DA 3B78A 1L3SA 2BBEA 3QGGA 1TP7A 5GVQA 1W2BR 3LUYA 4G1IA 5HBMA 4OHZA 5HBMB 3DHXA 2W9AA 1QUPA 2G4BA 1U6ZA 1S1WA 3CT9A 4ZPAA 3K8WA 1EETA 2J0XA 4ZA1A 2UU9F 3JTPA 4DR7F 1I1GA 5KFRA 4LMZA 1VRUB 5K5MA 3GIIA 2F8HA 5DETA 4ED1A 1KLNA 3A1YG 1P8GA 2N3LA 3NWGA 3OTCA 4HH1A 4FS1A 3LP2A 4NPOA 2GMHA 4B3MF 2DTJA 3CCTA 1YJUA 5EDWA 2DIVA 1R8CA 3M32A 3NCQA 3DLEB 2E5HA 5AJ3F 4ES1A 4FF1A 1Q4RA 4NRUA 2MYFA 2XC9A 2Q1LA 1HI8A 2RILA 5E0OA 2VONA 2WTFA 5J1PA 1WEXA 1OQ3A 1VQ8S 3K8VA 1KTQA 2RF2A 2YKPA 5D8HB 4F50A 1T3OA 1KN6A 2ASDA 1H2TZ 3KLEA 3RB4A 2H5EA 1ZH5A 3I0RB 3NAIA 1RKIA 4F8RA 4K4UA 1HBUB 5E5NA 4NLXA 1G2EA 4EU0A 2WW8A 1U1LA 3BZQA 3MGJA 3DM2A 3PXGa 1JLGA 1S6PB 1MMLA 3MTJA 2HMIA 4WF9Q 2YWFA 4ZOSA 1YRXA 3VZHA 3QZ8A 4OJ1A 3OPKA 5IT4A 3HZEA 4TYBA 4KV8B 4OZLA 3O1LA 2VBYA 4KV8A 2FJWA 1GAOA 2OMOA 2D7SA 2VKZG 5J2MB 5A8RB 3GV5B 3CJ5A 4EBEA 1M5OC 1O51A 2MGZB 3H5YA 2RRNA 2I0XA 1R6YA 1R8BA 1UFLA 4WIIA 2ZE2A 3GG0A 4ELUA 4UY85 3GFYA 3N28A 3BR8A 2LEPA 4ATNA 3BSAA 3P3DA 2W24A 2ZJRQ 3PR5B 5A8KA 3UD4P 4D3GA 5GAHU 5F8NA 1F2GA 3LGMA 4RUAA 2DJWA 4PWDB 1W25A 5L38A 4PG7A 1C1CA 3KWMA 4C7QA 2EFQA 2LA6A 1C1CB 1F5BA 3H2LA 5D4PA 3V5RA 1S1VB 3GQCA 5U47A 3SV3A 2VL1A 1ZTWA 1N48A 1M5PC 5GAHI 1LKZA 3GV8B 1A9NB 2PMHA 3LQVA 1KQFB 1VRTA 5J2NB 5F8HA 1SH3A 3HVTA 3ISNC 2V4RA 2XMMA 3FRYA 3HVTB 3OVAA 2VC1A 3QIDA 4X62F 3KLHB 1VQ6S 1U49A 3IS9A 3IWNC 3NBPB 1H2UX 2PEHA 3IGVA 4LF5F 2LQ5A 3MEDA 1C4AA 3DOLA 3CULA 1KD1T 2IM1A 1U25A 1P27B 1VQOS 1VQKS 2CKWA 2V2KA 4ECZA 2DIUA 3H2VE 4FVMA 1JLCB 2L3MA 3DXSX 4B17A 2ROGA 4HT5A 3S7RA 4N41A 2VG7A 3NL0A 2A10A 3KLFB 3BDPA 1LFWA 2FUG9 3UCZP 1U1OA 3IBWA 2IRYA 2IBOA 3HKZD 4U7UK 2R9LA 1U1RA 3M8PA 3QWPA 5KFGA 4JV2A 3U27A 2XCPA 2RQCA