3A3PB

Crystal structure of complex between e201a/sa-subtilisin and tk-propeptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3a3pB00
3GCWP 2W2NP 3P5BP 3BPSP 1SPBP 4JP8A 1V5IB 2E1PA 2Z58B 3CNQP 3QFHA 4K8RA 2W2PP 4NMXA 1ITPA 3H42A 3AFGA 4YN3B 2ZWPA 2ZWOA 4OV6A 2Z30B 3WIUA 1SCJB 3VHQA 2Z2YB 2W2OP 2XTJP 3CO0P 2QTWA 2W2QP 3A3PB 4NE9C 3T41A 3BGOP 3WHIA 3A3OB 3A3NB 2Z56B 2PMWA 1R6VA 3VV2B 3WIVA 3SQOP 2W2MP 2Z57B 2Z2ZA 3GCXP
chains in the Genus database with same CATH superfamily
1R89A 5JVGQ 3LALA 1M5SA 4XO0A 4UQTA 3KJNB 5A8RB 4QQBA 4JI4J 1REGX 4C9DA 3G96A 2B7BB 2V2VA 3R5DA 3TI0A 4KB7A 1I6JA 4IQMA 5JXSA 2C2MB 1N5YB 1RI7A 3ZNJ1 3ET6A 3DLLQ 4LMZA 2E1PA 5E3CA 1RTIB 3PRDA 4JI6F 2M8DB 4OLPA 2VPZB 4HH0A 3D6MB 4B3MJ 1S6QA 1JKHA 5ETRA 3PW5A 2VG6A 4DX6A 1GQEA 4HR2A 4PG4A 3TUJC 3MM7A 3L7PA 3SCLE 5HQMA 1VC0A 2C3OA 3VALA 5IM0B 4A46A 2N3LA 4I2PA 1KLMB 5LXYA 4ZJQA 1U0SA 4DU7A 3TUZC 5C42A 1CULA 5BYQA 3BM7A 3JYTA 4H4OB 1UKUA 4ELUA 3CEDA 1X4EA 5IT4A 3F41A 5GAEI 2HHQA 3DLJA 3AJ1A 2LP4A 5L39A 5GADI 3MEGA 2QRRA 4ZVGA 1PCAA 2CQ3A 4X65J 3ADAC 1ZYQA 3SQGB 1PYSB 3HSZA 1TELA 2X3GA 3HI9A 4I69A 4ZK7M 1T11A 2VG7B 1RAHB 2ASJA 4LF7F 2BJEA 2LQ8A 4KC5A 3CDAA 4D3GA 3OL9A 4LBPA 4Z7CA 3MDFA 1BXNA 2DR9A 2KVIA 3TEHB 1X4BA 3LANA 2MQPA 3MUTP 5F8GA 4I7FA 3LWLA 2VUGA 4KAIA 4HT7A 2E5JA 1SKSA 3LP2B 1T9YA 4BWJA 2NZ4A 2JVOA 2EFOA 4G6VB 3H20A 4H4KA 1N34F 3NWGA 2RUSA 4DR3F 3E01A 3BYRA 2YX7A 9RUBA 2HVIA 3CDEA 4J91A 5D0RA 3LAMA 1RBOB 4LSLA 1VHIA 3RRKA 4ECUA 4KTQA 2DNKA 2RS8A 1NK7A 2DYAA 2N4DA 2ZE2B 2HFOA 2BYCA 3C14A 3D67A 1YJNS 1FVSA 2IRXA 3CJQA 2VASA 2Z56B 2ZITA 3BREA 3HVRA 1LWFB 2RRNA 3KLEA 4CLFA 1VI7A 3PR4A 3V6HA 2F9DA 4CNZA 3NGRA 3M2RB 5F9NA 4KE5A 3AB4B 1OSDA 4ZPTR 1H2UX 2ALZA 3W62A 3NCPA 4NLSA 2HAFA 3GWCA 2B8QA 5B7WA 3KLVA 1T7PA 2K1RA 2GHVC 2KG0A 5KFWA 5ETPA 1F5AA 2CG8A 2WVFA 4FP9A 3TJ8A 3PTWA 1RHRB 2AP6A 2LVWA 1HBUA 3W5XA 3TAPA 1FD2A 3EICA 3E8OA 2BKPA 3AQOA 2ROGA 4GMKA 1IKYB 2F8EX 1C4AA 4L74A 2ROPA 1DRZA 3M9OB 1VBXA 3CJ5A 1NHVA 3CJKB 1VBKA 4O3RA 1RT3A 4XPCA 1PJ7A 2V8VA 2P9CA 4DN0A 3WHIA 4LJMA 2WVBA 2CPFA 1JXLA 2HVHA 2Y0BB 3RAQA 3K8WA 1GMWD 3BSCA 4QIWD 3V6DA 2YPYA 4RNMA 5E7OB 4NXMJ 1RBLA 2E5GA 1EAYC 3D54A 1LWXA 1KQFB 4DSEA 1JLAA 5F8IA 4A8WA 5C2GA 1SH0A 4J9VA 3QRQA 3C19A 7FD1A 2HRTA 1VC6A 3R1LA 2L08A 4FPIA 3DLEA 3UR3C 3V81A 2EFNA 3OFHA 4ZCLA 3K5MA 1UMJA 1S9GA 1MMNA 1VQLS 4OHWA 2DGSA 3DKDA 2F63A 2JRSA 1Q7LB 2AGQA 4KHPJ 4DLEA 1MN7A 1Q8IA 1JLEA 1SQGA 2LMIA 4NYOA 1FTRA 1VQKS 1RGVA 2R2RA 4RBVA 2HIYA 1H38A 2EBGA 3DOMA 3B4DA 2RS2A 4OYIA 3W2WA 2W01A 4Y34A 2QLFB 4IR1A 1V3RA 4I2QB 4RW9B 4HI2A 2KT2A 5H9EJ 4DV1J 2ZJRQ 2IM1A 4LRBA 2LLZA 1PJ5A 2IJNA 2XNQA 4JI4F 4DFPA 1RT6B 1UETA 3E3XA 2DGQA 4C97A 8RUCA 4W92B 5ETMA 2H5EA 3B54A 5AE1A 2YKNB 4RUBA 2N3OA 2BE2A 3MR2A 3J81Y 1VIXA 1IQTA 2QMUB 3KFWX 4CO5A 1F6TA 4Z2XA 3TZWA 1PYOB 4B9TA 2KRBA 4PKDB 2EG2A 3DMJB 2PSZA 1CS4A 1T3NA 1RAJA 4NMLA 4DV5F 3RYLA 4IG0A 4QIGA 1ZM4A 2XM3A 1C1CA 4M5HA 1BD6A 3BDPA 3M9MB 2OMLA 3GCXP 3QLHB 1JNZB 3W9HA 4EO8A 3WC2A 1WTBA 4K59A 2ZD1B 4ZLPA 3N0VA 3FNNA 4OMFG 1WKLA 1KSPA 3V4IA 4I0WA 1HI1A 2EXUA 4OV1A 1JLQB 5KFMA 4NMXA 2UVWA 1J5EJ 3UD3P 2HGMA 3LWMA 1ZM3A 3CB4A 4YFUA 4RU2A 4C0HA 4LFBF 3HPOA 2NUUG 1S72S 3PIOQ 2G2YA 2FZCB 2HFVA 3MMAA 4ATNA 2ZH2A 2BX6A 3RB3A 3DRRA 2ZH5A 2QLWA 4HH1A 2OEKA 5IS2A 3MPVA 2J6SA 3ENAA 4WIQA 2MQMA 1BC6A 1WJ9A 1RBAA 2QJ3A 1YQHA 2G9OA 5AT1B 2UXCJ 1REVB 1U8SA 3TUIC 3JSBA 5THWA 3DI6A 2QA1A 1R8CA 4K0KJ 1FNXH 5GMDA 3QPIA 3C6TB 3JS9A 4GVBA 3NKYA 3QZ7A 1HBMA 2UUCJ 3PNIA 3HD1A 4OZ0A 1W2IA 2HHHF 1I3OB 1KLNA 4FN5A 1IBMF 2VPXB 5HJXA 1GEHA 1S0MA 1ZH5A 3G2XA 1PGZA 3KUEA 4TY8A 1NZAA 4F8RA 2KM8C 1P6TA 1XMOJ 1TMMA 3CCSS 3M1VA 1QY7A 1NJZA 3HZEA 5KFOA 1YGYA 1KTVA 2B9XA 3KK2B 1UJ6A 5HANA 4DL6A 5G4DA 2GVDB 1OIAA 3MAAA 4WP3A 1Q5VA 5BYSA 4OX9J 1S6OA 1RA6A 1NJYA 3JSMB 3G87A 4NZ6A 1ZA2B 4URSA 1WEXA 2HBZB 2W7AA 4FNIA 1XNRJ 2R7XA 4CH7A 4KKOB 2EK1A 1TL4A 1N52B 3N6LA 4PXCA 1VQ5S 1L3VA 1L5UA 4OYMA 4FPRA 4WFZA 4B9NA 2WVCA 4MK7A 5CH7B 5A8RA 2GMHA 5E3PA 1RHKB 2ZBQA 1VR6A 3MURP 3PHTA 4EUVA 4P6QA 4WFAQ 4WU3A 1N5YA 3BDEA 4ED1A 1SCJB 3ZFVA 5B09A 1RTIA 1YHQS 4C8OA 2XNRA 3US5A 2DNPA 4P75A 4EZ9A 1QLNA 1D8ZA 3DCAA 4ER8A 4LQ9A 2DGVA 1RDRA 3EMTA 3R7SB 4NPOA 5IM0A 3CVKA 3BEGB 2YH1A 1SXLA 2ZHAA 4DR7J 2Q79A 1KLMA 1SJ4P 3PO4A 4DZ6A 2YWWA 4JI8J 3I82A 3HLUA 1X4AA 2IAJB 3W7BA 1WF0A 4NASA 1Q7YT 2O66A 2CIMA 3JQMA 2DHAA 2GHWA 3NMRA 2V8HA 2R7VA 4H4OA 2B7CB 2ZVSA 3I6PA 2C3UA 4CWBA 5I3QA 1RTDB 3RUBL 2OEJA 2CNLB 3N5FA 3CMQA 4P72A 4ZCIA 1U1PA 5GAEU 1QVFR 4DR6J 3HULA 2DNOA 3CJ3A 1QE1B 1RUSA 3MPDA 5F8NA 4Y6IA 5CABA 3UCUP 1HARA 5HQLA 1MSWD 2E9ZA 3SQGA 1EJ7L 2Q1LA 5A0YB 5LJ5Y 4YR3A 1RYSA 2VG7A 2KTQA 3P96A 2J0SD 4ZS6A 2LDYA 1QUVA 1Q81T 3WZ0A 2VFSA 4C8MA 3OLBA 1NPKA 3CJ0A 2M4MA 1IBLF 1UP1A 3PJXA 4Y00A 3N6NA 4N7TA 3ZZPA 4MK8A 3LP2A 3Q23A 2APOA 5KFZA 5J2NB 4O3PA 3LPEA 2ROEA 1OQ3A 2ZKTA 1RYRA 4PRFA 1HQEB 4Y65A 4DV3F 3CCUS 2ACYA 3VAJA 2CG4A 1Y5IB 4LF9J 2ZE2A 4B3TF 4X66J 3AAWB 4ELVA 3GCWP 3EVMA 2AJ1A 4N8NA 1RHQB 1LWFA 1RTJB 1TKXB 2B6AB 3O2IA 1XIQA 4P52A 4WXWA 4DQIA 2UXBF 1UJ4A 4AFFA 2J9DA 2CWKA 3M2RA 1S6UA 1XTZA 4OZ2A 2QLJB 4J5OA 3M05A 4KHMA 2F40A 2BKNA 1KVIA 4FF2A 2A1BA 3MD3A 1TU0B 3I9ZA 3CTRA 3PO5A 2FJBB 2WZ1A 1H0HB 4PAAA 5F8MA 3AXKA 1IKYA 1HIYA 4J9KA 4X4QA 1JMTA 2RU3A 1S1VB 2BJDA 2HS3A 1C4CA 2IRUA 2LQ9A 3CJKA 4MT1A 5HVFA 2RQ4A 1U2FA 4X84A 4YMEA 2Y1JA 3H40A 4RLEA 4QU7A 4ZVEA 2UUCF 1WACA 1BLUA 1TUWA 2G2ZA 3HF5A 2QT7A 3RU0A 3D68A 2ZDOA 4F04B 4DL5A 1LXJA 2NXCA 3KLGB 1N0UA 4HI1A 1BWVA 2IBOA 5AXNA 1JLFB 3QIPB 4X4UA 2E9RX 1N5VA 3P45B 4DPYA 1SC4B 4C3LA 4CDIA 1NEEA 2RNEA 3DLKB 2V0NA 4EU0A 2QMWA 3K5PA 3HHLB 4O3QA 4NLQA 2IC3B 4KV8B 2CQ2A 2YQ3A 2Y8YA 1PIEA 4IH6A 1LK7A 4V1Ak 3NGSA 2EEYA 3NS5A 3QT5A 1FJGJ 4B9MA 1HR0J 3HT0A 1U1KA 1SL2A 2K8GA 4OI0A 4J9NA 1XC9A 4NYPA 4OJHA 4KGXB 4O4GB 3BGOP 3H7HB 2MKYA 3I4HX 4BWMA 3BQ0A 4TYAA 1D9DA 2BBEA 3SSSA 3EXYA 2DNGA 4I2QA 1WF2A 1WI6A 4RW9A 1Q4RA 1EIYB 5G0RB 2Q6BA 4K5SA 2DNNA 1DQ8A 2RD5C 4JV5J 1RAIB 3D1OA 3M2VB 1RT6A 3OUYB 3OR2B 4ED8A 3QAEA 2BKOA 2VDIA 4WPAA 3DU5A 2PD1A 3LUYA 3L95X 3OTCA 2HFZA 2YKNA 1KRPA 3T6BA 2E1MC 1S77D 1RSCA 4IKAA 3DMJA 3D1HA 4U7CA 2HKEA 4KR0B 4ED4A 4OX6A 3EGWB 2COLA 5K8OA 2G0CA 1UWBB 4Q5VA 4DR2J 1RWNB 3QMQA 4RNNA 5B08A 1NLKL 3B6BA 4K4TA 4XK8C 3QLHA 2PMZD 2ATCB 1IBKF 1HBOB 1RXOB 4O4RA 2ZD1A 1X5SA 1IM6A 3AD9C 3UD4P 1E6YB 5C25B 4Q8EA 2MLXA 1KS2A 2DHHA 1F0XA 5M2PA 4Y3CA 3J7YU 4Q2MA 2OD6A 4ZP6A 2Z30B 1JJCB 2ZZTA 2KXNB 5GMKa 1JLQA 5DS7A 2KU7A 1RE1B 3PZPA 3HFZB 2WONB 2WSEC 4F4ZA 2NZCA 3KOAA 3R97A 5EWFA 4A8FA 2UP1A 3SMZA 4QW8A 5BXIA 2E5LF 5CCMA 5BR8J 2X1AA 5KTQA 1B0PA 3CWJA 2HAIA 1PBAA 3BYPA 2XGPA 2WVEA 1NH8A 5IQQA 4FXVA 5LMNF 1REVA 4WYWA 2QTWA 5KT5A 3A3OB 2MYFA 4ID5B 2QYCA 5KG4A 1P9QC 5F0WA 3C6TA 1Q82T 2MLYA 1N54B 3CJRA 3ZTRA 5I42B 4M5KA 1RWVB 3C16B 2W1BA 3G6XA 1A0OB 1C1BB 4PR6A 1KEKA 2MLZA 1NDKA 3BBFA 1RCXB 2ADCA 2OHDA 4NLWA 1RT1B 1WHXA 2C2DA 4HDGA 3PM9A 4ECZA 2CZVC 1I1GA 1D0EA 3Q2SC 4ECRA 4CYUB 1PILA 3QGIA 4QYRA 1HNXJ 2DXDA 3X1LB 3UCGA 2VOOA 1B4SA 3L4BC 4Y28C 1HWJA 5D0HA 1KQSR 1P1TA 2CPXA 2FVQA 2C28A 3KK2A 3OLAA 5ADZA 1R8HA 4K4XA 4NLXA 3MMCB 3TVZA 3L3CA 2YWKA 2GVDA 1FXLA 4CO1A 3N6MA 3SCJE 2IM0A 4J9RA 1TTHB 3ZZOA 1Y0HA 5E0OA 4MKYA 4F26A 3JSMA 3OL6A 4MIWA 1N5SA 4CRJA 1Y5NB 1S5ZA 1Y00A 3EVOA 4XDCA 4KKOA 2RHSB 1RT2B 1WG1A 2IHR1 1TL3B 1WC6A 4QIEA 4FF1A 2VQFJ 1G6BA 3H59A 5AJ3J 4K5RA 2QZ8A 1I94J 4DWIA 1JLGB 1N5TA 4RNOA 4HTJA 2DHSA 4UF4A 1IR0A 3OHAA 4XDDA 1H3DA 4X4RA 1FFWB 4PWDB 3FEZA 1S79A 4Q0BB 5KFRA 1IR2A 4TXSA 1R0AB 3FZBA 4AXIA 4URGA 1U6FA 1TAUA 2I9SA 2KI2A 3BO4A 3BQ2A 2F7VA 3DRSB 4WJBA 2IAJA 1XMQF 1OPZA 5CYQB 2HZVA 2RU9A 3OT9A 3Q8VA 2IY5B 2R2UA 1U0HB 2N7YA 4JI3J 3GG1A 2MB0B 4DR1J 1IN0A 9ATCB 1FCAA 2YKPA 2H4YB 3T1YJ 4JI0J 1RTDA 3ULHA 4I67A 1Y3KA 3D4JA 3MR6A 2FHJA 5J2QB 2M3DA 3N5BA 2HS4A 1FJGF 2C3MA 1WKJA 2D1CA 1IKWB 4QW9A 1QE1A 1Q5YA 2E7VA 2GJFA 5KOXA 1AFIA 2LCWA 5SZTA 5A0YA 3J7ZT 1DTQB 2UV8A 1V5IB 1KC8T 3W63A 2HBRB 5KG1A 3HK2A 1MWQA 4CLTA 2MGZB 1RAFB 3NL0A 4D3HA 3FJ2A 4FYYB 2FDNA 4FYDA 3ETOA 3CD5A 2BQ3A 4I68A 4ZDNA 3IG1B 1XMBA 4G1QB 1RP5A 3CCZA 4WTOB 4JYAF 4K4WA 1M90T 3ITHB 5D77A 2QYGA 4DCJB 1ZM9A 2EG1A 4ECYA 2FHMA 1UPMB 3CJTA 5J2NA 1CJVB 4AQYJ 5KG6A 2EK6A 3A12A 2VFVA 3MOZA 1JJHA 2GC8A 2BJ1A 2H48B 3TQ1A 3BZQA 1HQEA 3HHKA 4L6V3 2HVZA 4P74A 2MJUA 5B0BA 2DNHA 1IJEB 5LJ3Y 4L3NA 4MIBA 1UW4A 4WKYA 3G6ES 4OQJA 4ANDA 1TAQA 2FQQB 4DPTA 1RTJA 1TKXA 2B6AA 4ECVA 4LF1A 1R6VA 4HKQA 4OI6A 1IWAA 3IWLA 3VAKA 4C0BA 3D6HB 1B0VA 4OIXA 1WD6A 2VHGA 1J2VA 1RKJA 1W7WA 3R9LA 3KUHA 2ZWOA 2VL1A 2CQHA 2VZ9A 2E1AA 2AGOA 3RR8A 4X62F 3IMQJ 4Q43A 2IA0A 1H98A 2Z2MA 3M8QB 2VQEJ 2E1RA 3CJSA 1Z1ZA 3I5AA 3W1YC 5CD4A 3PYFA 3HJVA 2ZM6J 4MYTA 4DV7J 1XERA 4LF5F 1FJEB 2VC0A 2UV8G 1HQ2A 3EYZA 2IDEA 5EUHA 1S99A 1GXUA 3MM6B 1S1VA 2RVJA 4UOHA 4NYZA 4DF4A 1VQNS 3DRPB 1FFGB 5KT2A 4FS1A 1YI2S 4GKKJ 5EWEA 3U02A 1AXQA 1RWXB 3MAQA 2PFDA 2KZZA 2OELA 4JI2F 1HBNB 1FWLA 4M5MA 4USUA 5DDPC 3SV3A 2AYMA 5HQ8A 2DNRA 5DM6Q 1YRUA 2IYIA 1Q78A 1U1MA 2MKKA 1X5TA 2YX1A 2XCPA 4LIWA 3BSOA 3KLGA 3KLFB 4IRDA 1JLFA 1AROP 3AA8A 2OEMA 3QIPA 4R8UB 2I5JB 3OTEA 4CI0B 4TU8A 3DLKA 3VR1A 3W2VB 3W5ZA 4DMZA 3HHLA 1WG4A 3WBZA 2IC3A 4KV8A 4JOUA 2QLXA 2L41A 2FJXA 3CDUA 1N0VC 1OSCA 5AE2A 3C66A 2FVSA 2HRYA 4DSLA 4DV4J 3VVTA 4C11B 2BABA 4F25A 5LSLA 4O4GA 3TX8A 1HI0P 5EX3A 4JI7F 4F3QA 4ZVSB 3AA9A 4ECXA 3ILLA 3OL8A 3UN3A 2AX0A 3MR7A 1HHSA 1VQ8S 5G0RA 3BKUA 3AOAA 5CYMB 1BWEA 3JXOA 1YWXA 3MEDB 2CQDA 3M2VA 1HPZB 3OUYA 4M5DB 3OR2A 2RUGA 2AYBA 1YSJA 2VBYA 4DUYF 5H9FJ 3DDNA 2R3VA 2FJVA 2HK3A 4J9OA 2B56A 1VQ4S 4LFCJ 4YEAA 3UQSA 2V68A 4FXWA 4QYZK 1VK8A 3FKBA 4ZIVA 1NSQA 3UWTA 1YJWS 3VZIA 1H7XA 1NU4A 2EBEA 3AY0A 2KL8A 1VOMA 1UWBA 2I2YA 5HN0A 4DX8H 1HNVB 2M52A 3AJ2A 1FFSB 2BM0A 5DO2A 3SSQA 4E98A 2F5GA 4RL1A 3KNGA 3K5LA 1BMQB 2HVEA 1HBOA 3H5SA 4JI3F 3V4MA 3MM9B 2XY5A 4ZVQB 4ZPAA 3KK1A 1FT8A 1E6YA 5C25A 3W3SA 4USTA 4BDPA 1SC3B 3H2LA 2XO7A 1FK9B 1UJ5A 2WONA 3P8BB 4KGMA 4P9SA 2VONA 5KT6A 5LSOA 1P1LA 1BE4A 2WRMA 4OYPA 3BBBA 3TEGA 4NLOA 2J9EA 3ILIA 3KYLA 1H74A 1QAJA 2HNDB 3LP0B 1QDUB 1TV6B 3H42A 3FSXA 1YRTA 2UVVA 3CGIA 4ZPVR 1CSJA 1HWLA 2MZTA 1NB2A 3SDEB 1W25A 1WDDA 3GONA 1XR7A 2OH2A 3NG8A 4NXNJ 2XCAA 4J37A 1UA0A 1RABB 4ID5A 4YB6A 2IVYA 1H2TZ 3J7Z5 5I42A 3C16A 3OD2A 2EFPA 1C1BA 3J7A1 5IZHA 2HVDA 1F3FA 4DV6J 1QTMA 1RT1A 2QFJA 2N7CA 3DHWC 3MAHA 1FE4A 4CYUA 5KFUA 1UFKA 4NEZA 3BPDA 4FXDA 1KVKA 4MIAA 2KJWA 3D6TB 4LBIA 4KIAA 2V67A 2Z2LA 3WIVA 2V4RA 4OHVA 1YIJS 4PG5A 2W2NP 3K7RA 2QLBB 2GA7A 3MMCA 5ETVA 3ENWA 1BY9A 5EDWA 1YVFA 5DM7Q 2MKJA 3KLHB 4A8XA 1JK9B 5L1IA 2PMHA 2RF2B 2HQDA 4ALZA 5I4MA 4HT5A 3VAIA 1U45A 2E7XA 2XI2A 3CCQS 4LR8A 2CVIA 2MDAA 3R27A 3D28A 4FKXA 1RT2A 3P3DA 1IUJA 1FVQA 1TL3A 3QT8A 3CF5Q 4CIOA 4HHUA 3OV7A 3PIPQ 1N88A 5CZXA 3AD8C 4KGZB 3LQVA 4A47A 3RJMB 1JLGA 3EPGA 2ZBPA 3CCES 4J7CA 3WX4A 1GX5A 4PWDA 4E2FB 4Q0BA 5DGBA 2A6MA 1TR0A 3DNCA 1OY8A 1D9FA 2QA4S 2NXEA 1R0AA 2DEJA 1NHKL 3GG0A 2LXUA 2UXDF 2PE8A 4QWCA 2YVSA 1R7IA 5DQGA 4TU7A 2RQMA 4I6WA 4NL5A 3D0IE 1HFEL 2RE1A 3DRSA 1RQ0A 1WSRA 2XBPA 4TLRA 4LF4J 1FXDA 5CYQA 3KK3B 4M8LA 3PX4A 1U0HA 3M8WA 2F1FA 1KDNA 2JEIA 1RB0A 1CC8A 4O0NA 3GJRB 1RA7A 2RRBA 3GV8B 5IXUA 1T9XA 1O6XA 1Q8KA 2V4JB 2ZH1A 5J2QA 1TUGB 3S1TA 1PKUA 4ZJLA 1QAYA 2E1CA 4DJBA 3RAXA 4TNOA 1KP6A 4KPYA 2GHPA 1VBZA 5RUBA 3FFIB 1IKWA 4NLPA 1I51B 4ITSA 2NYHA 3VGVA 4LF8F 3B8HA 1F1BB 1NSAA 1VCTA 2OO4A 2CJ9A 4I1TA 3JTOA 1G4CA 4P7TA 3S01A 3ZZUA 1NNDA 3T1HJ 2MGZA 1SJRA 1NJWA 5HAOA 4ECTA 4RUHA 4USVA 4WIIA 3IGVA 2C2RA 4C8KA 2RT3A 3K5NA 3IG1A 4ZPDA 4G1QA 4C8YA 1KWMA 1X9MA 2LA4A 3ITHA 1P8GA 4PZVA 1CJVA 3U1NA 2CDQA 1IWGA 3DYAB 2WSFC 4LSNB 3EM1A 3G8QA 5A8WB 2R7WA 2ILZA 3RTVA 3DDKA 2CJKA 2G0JA 3GSDA 1SIWB 3P6YC 1DHMA 1BQXA 2QSFA 2ACMA 2H5JB 3S6EA 2P6SA 2LXIA 2NCKL 4WBFA 3VAMA 2R7QA 2X1FA 3R7NB 4UW2A 4IQXA 4OLOA 5CD4H 4USKA 5T41A 3RBDA 2GW8A 2HHPA 2FZKB 4I6YA 2ZJPQ 2XZDB 2JLGA 1B99A 3EDQB 1GMWA 4F0KA 4WYLA 4U8YA 1LW0B 2BW2A 1FXRA 1CJUB 1U1NA 2I0XA 3FUYA 1SJQA 2GFFA 5E33A 2IPOB 2J0WA 5DJBA 2EC2A 2PA3A 1T95A 1S6PB 1JJ4A 3OFEA 3ICLA 1HNWF 1YJRA 1XR5A 1MWZA 1JIHA 4DL7A 4Q7AA 3M8QA 4UZCA 3KMSA 1U47A 1IQZA 2R8KA 1CC7A 4CM0A 2F9JA 2O1PA 2YWHA 1U1LA 1F2HA 3OTOF 1TQLA 2JC0A 4W4MA 4U95A 4IO9Q 3TAMB 2GNKA 2CPHA 2OTLS 2ATLA 2FHOB 1OY9A 5EN1A 3IBWA 4OYXA 3MM6A 2ZNYA 1UEVA 2QA4G 1S76D 4F0MA 3DRPA 2XWYA 2L9DA 2DD8S 4LR9A 7FDRA 4ELTA 2VJVA 3W60A 1HBNA 1F60B 3C15B 4X4SA 3CD7A 1NSKL 2XS2A 2J5AA 3LGHA 1N36F 5U47A 2VDHA 1SKWA 4Y0FA 2XS7A 1LWEB 1FRHA 1Q86T 2PN6A 2U1AA 4DR5F 2J9DE 3KLFA 1GTEA 1TKDA 4UOGA 2R7RA 2F4VF 1X4FA 1ZTTA 4WWSA 1A6LA 4R8UA 4DPUA 3HSDA 4X4NA 4RKUC 2I5JA 3H5UA 1N32J 3SBMA 1Q1KA 3QGHA 5JMNA 2VV5A 5B0GA 3W2VA 2KDOA 4RW4B 1R8AA 3TWZA 2M2BA 4E8UA 1Y5LB 5KFXA 3IC1A 3NP5A 2B0GA 2B5JB 3KNAA 3TOQA 1Q53A 4FDFA 3GV7B 3LGMA 1U1OA 4C11A 4IYQA 2IMOA 4DXLA 1ZPVA 2EPIA 3CDBA 2MZSA 5LSRA 2HK2A 2AEJA 2VPWB 4O3SA 3KJQB 2ZNZA 5JUMA 5IWAJ 1WHWA 2BANB 3CNQP 4UOCA 3MPUB 4N5SA 3GIRA 5FLXU 2XYPB 5CYMA 2KZMA 3EWGA 4AL6A 1RLCL 3MEDA 4XIUA 1HPZA 3L9ZA 1KOHA 2H51B 2P8IA 4Y2CA 1GMUA 3GIJA 4M5DA 2KFNA 4B9SA 3W61A 1RAGB 1LV5A 1QSLA 4USHA 3RW7A 4ES1A 4YDDB 4F7VA 3GYXB 2W2OP 1OY6A 3OXFA 2GV1A 4B9VA 1YBTA 2E66A 3CT9A 3GSIA 1OPIA 1NRKA 2GAGC 1NSPA 4O44B 4X4OA 4JI5F 5FDLB 3VGSA 2I6WA 2B4UA 4X64J 1XWLA 5ETQA 1HNVA 1FJ7A 2AYEA 2PI4A 1G3OA 4O0IA 2IRYA 5LMUJ 2DIVA 1RU2A 3P5BP 4JP8A 4DSIA 1VGYA 1KHVA 3H4DA 3MM9A 1RACB 1S9FA 3VCDA 2Z57B 1S1UB 3OQ2A 1QUPA 3GP9A 3IS9B 2WBRA 4QOTA 1FK9A 1O0PA 4RUAA 4B3SJ 1DQAA 3KKFA 4MAKA 4USIA 4DUZJ 4NE9C 4ILMA 1W26A 4RWWA 4NLUA 4QR2A 4ICLB 1KONA 3OR1B 2XYHB 3IN5A 1T9WA 3JQKA 3I31A 2R8HA 2B4VA 3K0JA 4YN3B 5CXTA 2HNDA 2YNIB 3LP0A 3D0HE 3GE9A 1TV6A 3P4UB 3KG4A 3QAUA 1SVDA 2YNGB 1SI9A 3BPSP 3SDEA 4I4BA 2W7PA 1OO0B 4X4TA 5A76A 3SYZA 4WU2A 2ASLA 2LXFA 3BQ1A 3BKTA 2V8GA 3CSKA 2BW7A 2MMYA 2E5HA 3OPKA 3HVTB 2WHOA 1UL3A 2JFKA 5D3GB 1K0VA 4EO6A 3LTOA 4WZMA 2LQ5A 1TK0A 3TA2A 1FKOB 4M5JA 1N33F 2VKRA 1S4EA 3UDVA 4ECWA 2GGPB 1WC5A 2JC1A 3MGJA 2RRAA 5DZ6A 4FS2A 3O1LA 1V6HA 4KHRA 4YOEA 1V9OA 1ICEB 2ZBIA 2W9AA 2ZJQQ 1AUDA 2QE5A 1NK9A 3A8JA 2UUAJ 1FEHA 2ZC4A 2A18A 4DV2J 3KLHA 2QA2A 1OS5A 4DCOB 4RNHA 3ZZYA 3FCVA 2V69A 2RF2A 1KFSA 4R25A 1VFJA 3QATA 2DO0A 4QZVB 2YKMB 2MQNA 4HEA9 1PJ6A 5J2PB 2AEMA 4ZVHA 2BEFA 4ZCMA 4ED5A 4PWWA 5CYJA 3MFIA 4CT9A 4R0EA 3W8PA 3H5XA 4EGLA 3I5CA 4K4ZA 2Y1LB 4OX8A 1QM9A 3T5HA 3WQPA 3MCNA 2HQIA 1U6ZA 4LVNP 4ANCA 2MZRA 5DLFA 1LFWA 5B0DA 4LFAF 4PXEA 3T1AA 5I3PA 4QU6A 1FRIA 3UO0A 3PFEA 2B4OA 2V8DA 1XN9A 2VOPA 3ILJA 4ZVUB 1TUVA 1GXTA 4B9UA 5LOQA 2VPYB 1EQMA 3KK3A 4QJVA 4X2BA 1IM4A 5DDQC 4ZVTB 2G0IA 4OJ1A 1B0TA 4M94A 2DR5A 5KFLA 4PUOB 1E6VB 1JLBB 4ZLLA 3CXCR 2V4JA 2CA9A 2C1EB 5F8LA 3IAS9 5AXKA 4YS2A 3GU0A 4DV0F 2YX4A 3AOCA 4RNFA 5CA5A 4M5GA 3FFIA 3WDOA 4JI1J 2M70A 4LR7A 3RB6A 5ITHA 1XEZA 5GVQA 2R7TA 3M8RA 2ZH9A 4B3RJ 1D3WA 4G1IA 4DQQA 2R4FA 5KT4A 1UPPA 2GX8A 3W66A 1O5JA 1VS3A 1SJ3P 3EZOA 1B70B 1H72C 1X4GA 3TA0A 5HP1B 4EEYA 5DQHA 4KGKA 1PBUA 4MK9A 2DIUA 4OZNA 3VV2B 1QD1A 1NBEB 5BYRA 3ISNC 3VAHA 3T9NA 1S49A 1TK8A 2AJFE 1V5VA 2FLNA 1WORA 4HVZA 1WELA 4HLBA 2DGUA 1PC5A 4OYOA 3RZAA 3DYAA 4K2JA 2MQ8A 4LSNA 1FERA 7AT1B 5A8WA 2DR7A 2CQ1A 5C2CA 2Q66A 2R2SA 4C2MA 1S12A 5C24B 5E2QA 2CPJA 3T3FA 3Q8SB 3EGVA 2PT0A 1V3SA 2OPRB 2XYGB 3RB0A 1RT4B 3H2VE 3MEEB 2A3JA 1BHNA 4RW8B 2MQLA 2H54B 1K8AT 5DETA 1IKXB 2YH0A 4B08A 1H7WA 4N41A 1MNEA 3NGUA 4QCLA 1VQMS 3X3UA 2C2NA 2DR6A 4HHJA 4LF2A 4L3KA 3KJFB 2DPIA 2FIUA 4DUTA 1LW0A 4LRAA 1CJUA 1XQIA 2W9CB 1WOSA 5K8PA 2D3ZA 4KH1B 5A6WA 4RWXA 1FJCA 3GR1A 1S6PA 1RZMA 2LU2A 2FGOA 1UZDA 3ONQA 4NI2B 2RQCA 2LU1A 3PX0A 4QWDA 1Y9OA 3SFUA 2DJWA 1T9UA 4QPTA 4NEYA 1KNZA 4ERDA 4FYWB 3MPYA 2ADBA 2YNHB 1AZSB 4WFXA 3TAMA 4USWA 4QR0A 2L9WA 2BJ3A 1RLDA 3UN2A 2D3UA 1EHWA 2E9TA 2KYZA 4O23A 3ZTSA 2VJUA 1HHTP 4EWTA 1LK5A 3T19A 2EFQA 4B3MF 5KFEA 3JSYA 2DITA 1NK8A 2DHXA 4YB1P 3C15A 3PKYA 5K14B 2RB7A 1UVIA 2HG4A 2M88A 5KFQA 1UCNA 5L9NA 2BJ7A 3ZZTA 4J9SA 2CQIA 1LWEA 5KFGA 5DQIA 4M5IA 1FNOA 1Z2ZA 1IVZA 3G8SA 4QWAA 3GIKA 2YKAA 5ETTA 4K2XA 2JJ4D 3LPYA 1X0PA 2Y8WA 2VC1A 2ZWPA 1UTAA 3J7YI 3CD6S 4KH0B 3H4BA 2AV5A 1FWPA 3TJAA 2M0GB 3RGIA 4RW4A 3FRYA 4LF6J 3AODA 2QIFA 3QGGA 1HNZJ 4GC6A 1PO6A 4OYBA 1TFYA 1WTFA 2CZ9A 3Q8UA 2FHJD 5D6GA 4JB8B 1S1XB 4B17A 2B5JA 1QSYA 2UVRA 4X65F 2A2CA 2P9GA 3TNVA 4EYHB 4PQAA 2J9CA 3MUMP 2V50A 2IJRA 1FRKA 1H2VZ 4CLUA 2ZFHA 2I8EA 4ZHRB 2AF6A 2LYVA 2M5YA 4ZVPB 4DSFA 2BANA 3OHBA 3GZ7A 3Q89A 2Y1RI 1T8EA 1WHVA 4DBQA 5H1SV 3JB9k 2IFXA 3RRHA 1FEEA 4CZCA 5EHHA 3IXQA 2DRAA 2JZ5A 2DB1A 3GFHA 4F2RA 4X4PA 2CDRB 5B0FA 3K89A 2VA2A 3RRGA 2OMOA 2P6TA 1AYEA 6AT1B 2NPIA 5F8HA 1PC4A 4ZCKA 4N77A 4TQRA 4M95A 2E44A 2DH8A 2GJ2A 4EBCA 4ZJOA 2FY1A 4RO0A 3NGDA 4TN2A 4F0HA 4P2FA 4O44A 5FDLA 5KFHA 4PYAA 1WHYA 4M5NA 2YNFB 1SC1B 3ILOA 4JI6J 3CO9A 1NKBA 2WW8A 3HFVA 2DNLA 3HP6A 4GVLA 3GIMA 2SXLA 2K7JA 3HO1A 2KO1A 4U7UK 4AL5A 5FJ4A 2DNQA 3W9IA 3VWSA 1S1UA 3IS9A 3CO0P 4AXJA 2R42A 4Y2KA 2EKYA 5KFCA 4O3OA 3L09A 8AT1B 3NS6A 4CO0A 1S0NA 4ICLA 3I32A 4F4WA 2AEFA 5CCLA 3OR1A 2Q3PA 1FRMA 3BR9A 3SCKE 2HPUA 3P49B 3SI8A 4ZVRB 2YNIA 3N01A 4DQRA 2C2KB 5LT5A 2D69A 1KTQA 1NJIT 2MSTA 2YNGA 3PRBA 3UN5A 3QRRA 1SH3A 5C7PA 3HX9A 2HNYB 1GX6A 2AD9A 2F8HA 4K50A 1O51A 4LBHA 2ZOFA 3ZXWA 1RWOB 3A13A 3BS9A 4K4SA 1SKRA 3HVTA 1F9EB 5D3GA 4NXMF 3Q22A 3KHRA 2P5VA 4WXOA 1AUSL 2ZH7A 2HHUA 1FKOA 3B82A 3RBZA 4FVCA 1UZHA 3RAMA 4J9QA 1TFWA 4ES2A 2GGPA 1TVRB 3ZO7A 1N48A 3FGVA 3HVAA 4CO2A 1EARA 4MKAA 5KAKA 4UTGA 4RR5A 4P71A 2XEXA 3FK4A 1N6QB 4DR3J 4I64A 2XTJP 5KG5A 2WTFA 3T41A 1WOPA 2BE7D 3B4MA 2XS5A 4PG8A 5CHCB 4KHPF 3N28A 4EK2A 1LXNA 2C3YA 1T9TA 2NXNA 4DEZA 1PSDA 2HIQA 4DDFA 4OYWA 2ZZMA 2YKMA 2L48A 3AH6A 2GIQA 3MM8B 5J2PA 4Y2MA 4RW7B 3PXGa 4OI4A 4DV1F 1F5CA 3S7RA 5F0UA 2Y9HA 4DX5A 1F2GA 2JVRA 3C6UB 4WKRA 2DHGA 5L8RC 4IFYB 2Z2YB 4OX7A 2QO3A 3R2DJ 2LFVA 1C0UB 1QJHA 2XHCA 1P9YA 1UVJA 2O67A 1UFWA 2W24A 1WOOA 2RDIA 3OW2R 4MKVA 3NXZA 3TO8A 4ZIWA 2VU5A 3KTQA 5E3AA 3T5LA 2NR0A 5KT3A 2YTCA 2XB2D 4IOCQ 3IR5B 2IBKA 2MHEA 2MKHA 1SPBP 4KSEB 1JLCB 1J27A 4CP5A 4PUOA 1E6VA 3MCMA 1JLBA 1U49A 4HACB 4ZP8A 5AE3A 1J5EF 4WTYA 1HNZF 2WVDA 5HL7Q 4E0DA 2QL5B 1RAEB 5LL6d 1D8YA 4LREA 5D8HB 1FRJA 2RMLA 3M1VB 4FF4A 3SXLA 3F0NA 3J80U 3K8VA 3PJWA 2Q6CA 3OXLA 1WC4A 3R5BA 1FX4A 2M7SA 4NOHA 2UXCF 3VZHA 2DKOB 2PC6A 4OZ3A 4K0KF 5DG7A 1JXEA 5HP1A 2W2MP 2CQBA 3GB0A 2HMIB 2BE9B 2BOAA 2V63A 6FDRA 3U27A 3F44A 1M5PC 4J9PA 5D4LA 2PMWA 3ENVA 3PW0A 3IWXA 3NBPB 5FLXY 2EVZA 5K5MA 2ZOGA 4ED2A 1GK8A 4F4AA 2WAQD 4IH7A 5C24A 3TQEA 1XMOF 1H6KX 4CLPA 1U24A 2OPRA 5KFIA 1RT4A 2NS1B 3DGVA 3MEEA 4YR2A 3NMAA 4RW8A 3HXMA 5DDOC 3I0RB 1IKXA 4L73A 1WDTA 2IVFB 2VFRA 3EUNA 2JSXA 1VISA 4DV5J 4YB5A 4OX9F 2FC9A 1WG5A 3SV4A 1KKHA 2XMJA 2L9NA 1X7VA 2W9CA 4NLDA 3TZZA 2V4QA 1FF2A 5HROB 1DAXA 3HVWA 1OQ6A 2JLFA 2D7SA 3K58A 1XNRF 2KRRA 4ID8A 4W98A 1RHJB 3AHPA 3LA0A 4NI2A 4YY3J 1OMSA 1FO1A 1GAOA 3QT7A 3CJ8A 3LO3A 1LW2B 2X3DA 2KFZA 2MEWA 2BA9A 4MJKA 3M8SA 2YNHA 1AZSA 3AB2B 3KG0A 4K4YA 3AOBA 5CQGA 2VBZA 2W2QP 3MMJA 4LFBJ 2K3KA 3OSNA 2DVIA 2HFSA 2HNZB 4OHYA 4J90A 2J8AA 1T0TV 2XG8A 3CIZA 1OJ4A 5K14A 4C8LA 3K17A 2JEJA 4U67Q 3G9CA 2AJQA 3U1MA 4C6AA 1U1RA 3M6UA 2MPUA 4DR7F 5AXLA 4OI3A 4EZ6A 3GJTB 3QWPA 1MMDA 1TMJA 4U96A 4JI8F 2DXFA 1KQGB 5ETOA 4B02A 2BRKA 2CFXA 2ASDA 2BQRA 1YJTA 2OSQA 1QVGR 3F73A 4RW6B 2JDJA 1VRUB 3MUVP 2K06A 2XMKA 4RX6A 2K3IA 1HLWA 4G3IA 4OHXA 3R6GB 2HHHJ 1G1XA 1S48A 4J9MA 1IBMJ 4P2XA 2JHEA 2XLIA 3RR7A 2RDDA 5D4OA 3O5TB 3BBCA 2BZ2A 1CVJA 2PFFB 4DR6F 2KKHA 1MW7A 2BOPA 4GRSA 1VQ9S 2ZOMA 3ZZRA 1S1XA 2W9BB 3Q86A 1HMVB 3PG9A 1RWMB 2DGOA 2UZAA 2FY8A 4JV0A 1SUQB 4C0OC 5HK4A 2PO4A 4EBEA 2GIFA 4NA3A 5D0GA 2YWEA 1UAWA 1XR6A 4ZHRA 4FZVA 4F67A 2ASYA 1CQNA 1FX2A 4KQZA 3IWNC 1XJWB 3BH7B 1R8PA 3POTB 2ZH4A 5HJYA 2C2OB 1YDLA 5F3ZA 4V19J 4N76A 5IV4A 1VDHA 2HGNA 1X5OA 5IC4B 3FCWA 3Q8PB 2UUWA 4BHQA 1DFDA 4IH5A 3SSRA 4R5PB 2GJIA 4OJ3A 3GJSB 4A4JA 1EB0A 1MROB 4IRKA 2XSJB 5J1PA 4IR9A 4KO0B 4GKJJ 1NO8A 2B3TB 2ZH3A 3D7SB 5KFPA 5ETKA 2W2PP 1U7LA 2GMJA 1LEOA 3OTDA 2XY6A 4LF9F 3EDRB 3KG1A 4X66F 2KM8B 3TZYA 1YITS 5K20B 2YNFA 3IFEA 3IRXB 2QGFB 4DFJA 2MXYA 1R27B 4DS4A 2R7UA 2ZVIA 1UFLA 3D9BA 1FE0A 2DISA 3HFKA 2KH9A 2MZQA 3FEYB 3DN9A 4FF3A 3O3LA 1ZOTA 1RKIA 1NK4A 3NNHA 2VODA 4PG6A 4ZVFA 2RAQA 5KFNA 2ZBCA 2GAHC 2MTLA 4WCEQ 4N56A 1C0TB 3OXGA 1WUUA 2GVZB 3HHLC 3TR5A 4QR1A 4CNYA 3NNCA 2V8PA 2HW3A 4DPWA 5A2QU 2C42A 2MZJA 2U2FA 3TUPA 2YKOA 4NCBA 4N8OA 1U8WA 2HURA 1ZAVA 1LOUA 4DS5A 2AJ0A 3CIMA 3ELHA 4J9LA 3CC4S 1B7YB 4P73A 2HNYA 1YZ6A 4NLRA 4WE1B 1X4DA 5E3QA 3HT3A 1RU1A 1X4CA 2GQ2A 4ZPCA 3C46A 3Q8QB 4DQPA 5KFKA 2V34A 3WIUA 3TP2A 3TVYA 3GFXA 3M6XA 1EP4B 1OYEA 2PIIA 1X0FA 1DARA 5E5NA 1KD1T 5A6PA 3H5YA 2WB1D 4YQWA 4Q2LA 2WBMA 5JJBA 1EQ0A 2Y0SD 1HHQA 3JTPA 3FVYA 1IBLJ 2RKIB 2OPSB 3NLCA 3IRWP 1TVRA 3AJDA 3IGNA 4ZMMA 1Y3JA 2DEIA 2G1HA 4L76A 3TW0A 1N6QA 2FJDB 5KFAA 2GZOA 4C3MA 1HR0F 4IG3B 5KOWA 2F65A 1RADB 3M6VA 4DV3J 1OYDA 3Q8RB 3V2UC 3BKFA 3LF0A 4B3TJ 2YQ1A 3R7BB 1ZTWA 3V6KA 3IBFB 5T14A 1CJKB 4EFAC 4YY3F 3MM8A 2UXBJ 2BUNA 5KG0A 2KHDA 3TARA 4RW7A 3MXHP 5I3UB 4K4UA 4BS2A 3VF0B 3THTA 2QSWA 2KXFA 2CPIA 4JV5F 1RISA 3A8KA 3C6UA 5FD1A 5J2MB 4UOFA 4DCPB 3QBCA 2AIRB 5ETLA 1YZ7A 4DFKA 2O5DA 4WF9Q 4IFYA 2JH3A 1EKSA 2Z2ZA 2YQ0A 4CLSA 2MKCA 1C0UA 3W8GA 4I6AA 4NLTA 3FDSA 2O3DA 2B51A 3AT1B 2J6TA 5H9EK 3AD7C 3QZ8A 5DZ7A 2D3OR 4HL9A 2B9EA 2CPDA 5K9FA 5B0EA 2Q43A 2OD4A 3UFCX 3DRYA 4DR2F 3KDNA 4FKYA 5L1LA 4CT8A 2BXJA 3G82B 1PG5B 2ZH6A 3H0PA 5GAHU 3CDWA 4C8ZA 2DPJA 2E5IA 3O44A 2KG1A 5IOLA 3RBXA 2HYIB 3QSIA 3A8EA 1JLCA 1U25A 3WC0A 2CQPA 1GMVA 4HACA 3PY8A 5C5JA 2D9PA 5JVHQ 3S8SA 3UNGC 1YJUA 1VQ7S 3M30B 1S10A 3FBEA 3IR7B 1FA0A 1G2EA 1FESA 1WEZA 1FKAF 1X8DA 1LWCB 3G4SS 5BR8F 2W8LA 2RILA 2CPZA 3MF5A 3ZTOA 3QJPA 3IR6B 5ETSA 1Q16B 1F9HA 1FNMA 3W64A 3I9V9 3PRVA 4PQUB 5KG2A 4ENOA 2ZC3A 2PEBA 4S0MA 2FYXA 2DNZA 4FYVB 1S1WB 4QWBA 4BCAA 3BJYA 3N9UC 4G1PA 2JFDA 2HMIA 3PHEA 3V6JA 2HWIA 3R8YA 1RTZA 4QYZJ 2DNYA 3T5KA 4GKJF 1HWUA 3M8YA 3NBPA 3BGUA 1NK6A 1YBUA 4LRFA 4KYZA 3MTKA 1IBCB 1WC1A 3PX6A 3H25A 2Y3YA 1VC5A 3BGRB 3BGLA 2H65B 2VICA 2LDIA 1UEUA 2WCXA 4C4WA 5DG8A 1Q95G 2RH3A 1D9AA 3GJQB 1DY3A 5EWGA 1HNXF 4WK1A 2DY1A 1LNQA 2EI5A 4ZPWR 2N82B 3I0RA 2AW0A 2QC3A 4OZ5A 3UVJB 3GPAA 3EE3A 1EX8A 4L72B 5KFFA 2J8SA 5B0AA 1W2BR 3BB5A 3GYNA 4KPCA 1QAIA 3GFZA 1SH2A 3JAMU 1G7CB 4ZOSA 1MLAA 2B9WA 4EBDA 4YDXA 3D1QA 1SL0A 5HMYA 3A3PB 3M2UB 1QTNB 4RBTA 3CULA 3NAIA 2VG5B 5HROA 4DX7A 1RCOB 2KYXA 4C48A 2FTRA 1SQFA 1L3KA 1X31C 5HATA 1PAEX 3L7OA 1M1KT 1U6BA 3CMAS 1IBKJ 1S7IA 1WEYA 1YJ9S 4CCHA 1LKZA 1LW2A 1FI4A 3MD1A 4QPXA 4LSZB 1SKUB 5F41A 2VQFF 5AJ3F 4JUZA 3NEKA 1I94F 1ZZNA 3M8PB 5LM7E 3FQKA 3PYEA 1VQYA 3K57A 3BH6B 2G2OA 2VD3A 5MLCV 1NUEA 2IDLA 2J0QD 2QX0A 4C98A 5GADU 2HNZA 1VHFA 3FSIA 1JWWA 2QL7B 1S7HA 4IUFA 2B9YA 2E5LJ 3ZTQA 3D3CJ 4DF8A 4IOBA 1R8BA 5IT9U 4RU9A 2PGCA 5CZVA 3PVXA 5LMNJ 1VLOA 3DLBA 4RBUA 2J7WA 4FBTA 4C7QA 1ZAWA 3MFHA 1M0SA 1U26A 1M5OC 4CM2A 2CXEA 3Q24A 3EGNA 4KT0C 2XMVA 1ZZFA 1SJFA 2UU9J 4DR1F 1HW8A 2GCFA 4RW6A 4F36A 2CUYA 1VRUA 2NSBA 3QFWA 1T03B 2D3O1 4UUXA 4URQU 3T1YF 4JI0F 1NHUA 2QN6B 2DT9A 3GMGA 2WK4A 5IC6B 4PCQA 3BF4A 2F4FA 1WWHA 4YB7A 3C3LA 3B78A 5HVGA 1MWYA 4NA2A 2W9BA 2MKIA 3BGFA 1HMVA 3BR8A 3IBCB 1PAUB 2J76E 3QJJA 4QIVA 1K9MT 4OYZA 2GS8A 4IOAQ 2CQ0A 1SUQA 1UA1A 4HYKA 1ITPA 1CJTB 2X1GA 4DL2A 5CAAA 2R7OA 1DBDA 1TL7B 4ZLNA 2LEBA 1S1TB 3POTA 4NX9A 3DM2B 2DGWA 2XZWA 3HM9A 3D66A 1U4BA 2FLPA 2CNKB 2WSCC 3CUNA 1APSA 2KJVA 3MTJA 4F4YA 4R5PA 2MSSA 2BQUA 4DU8A 2DGTA 3D5MA 4L75A 1MROA 1R0BG 4AQYF 1XNQJ 2HQ3A 2XSJA 3G86A 1BUXA 4KO0A 4IDKB 1HW9A 1RJJA 3L7UA 4TQSA 4XAKA 3EGZA 1IKVB 3QT6A 2XLJA 3TYTA 3KMQA 2XMTA 2IIHA 2FB0A 1FDDA 1DQ9A 3JSRA 2PA8D 5L46A 2XMWA 2OTJS 3A4TA 3IRXA 5HMWA 2H4WB 1HD0A 2ZH8A 4QBUA 2DRDA 3KXDA 4DN9A 2W8KA 2BJ8A 4MFBB 1RWWB 4HDHA 4KFBB 2BVZA 1NKCA 1KFDA 1VLYA 4P2SA 2ZKUA 2LEAA 4FVMA 3T6JA 2VFUA 1XMQJ 1HA1A 1MG7A 3OFFA 3I0SB 2CQCA 1C0TA 2VQEF 4FNHA 5A8KB 4P10A 4PEOA 2GVZA 2V2QA 5KFSA 2HQFA 3RB4A 3ZTPA 2ZM6F 4H4MB 3DGPB 4DV7F 3HJFA 2X7IA 1FKPB 2XSFA 3MMBB 3DHXA 3HHDA 5D78A 2JWNA 1TK5A 2CADA 2D41A 3MZIA 3MWBA 2QL9B 1RT5B 4GKKF 5HLFB 1KQKA 1SL1A 1K0TA 2V9KA 1KOOA 4F3OA 4WE1A 3J80Y 3R6LB 4UT4A 1RAAB 2QG9B 2DH7A 4PABA 3CCTA 1EP4A 1S57A 1B3TA 4Z37A 2OPQB 1A9NB 1KHWA 5EX0A 2KXHA 4ED0A 4U8VA 1VK3A 5DLGA 2RKIA 4H54A 2OPSA 1OWXA 2CJAA 2LQJA 3QFHA 2XO6A 1HL6A 3UDCA 5GAGI 2CWXA 1X60A 4WZQA 4DHVA 1FWKA 4JYAJ 2FD2A 1ZETA 3MHYA 1N4LA 4GO5X 1U1QA 1HWKA 2HQGA 1HYSB 2ERRA 3SCIE 5IV3A 4IG3A 2ZUGA 1JXVA 5KFTA 4J9UE 2HLTA 2F3JA 4IFVB 2R8GA 1RWUA 2JL9A 1F5BA 4DV4F 3KJVB 2ALYB 5D4NA 1NDLA 3FBFA 2OP5A 3OFGA 4BBYA 4DPXA 8ATCB 2NUHA 1TL1B 2DO4A 1DTQA 5F8JA 2AZ3A 4U6PA 1XK8A 1CJKA 4ZP7A 1J5OB 1R31A 4LRDA 3MOJB 3GILA 4BC7A 3AQPA 2V9WA 1VYAA 2CKWA 3PFOA 3DDIA 3KK1B 2UUBJ 5I3UA 3EJMA 1ACMB 1VRTB 4DSKA 3G6YA 1IJFB 3SEOA 4C3KA 3HKWA 3PW7A 3VQSA 2IMWP 3CCMS 2XC9A 3GV5B 5J2MA 1VIOA 4UY8T 4X62J 2MZ1A 3SQOP 2Z58B 3R5CA 4LFCF 1T9VA 4RPFA 2HFUA 2CJBA 2G4BA 1X9SA 4JV1A 4CLKA 1GNKA 4DL4A 4YR0A 2RSQA 3R3TA 4LF5J 4LT6A 4M1KA 3UR0A 1HQUB 3FQLA 5D15A 3LH2S 4OV6A 2R8IA 1AB8A 5FIIA 4NCGB 2OSRA 1TKTB 1UVNA 4OZJA 4ED7A 1EKRA 2OLWA 3A3NB 4TY9A 3G82A 2OAUA 2P2CB 4JI2J 5F9LA 2UU9F 1T02A 1NH7A 3CC2S 3DXSX 2FJEB 2DNMA 3VGTA 4NZ7A 2NPFA 1RTHB 2XZTB 1GTHA 2ZEJA 5M2RA 3EZUA 3DOKB 2AJ2A 5HBMB 4DQSA 3M30A 1VQ6S 1YX2A 3PEJA 1T94A 3M9NB 1WKKA 3PYDA 1LWCA 4AYBD 3M32B 4LIRA 3ISND 5J1EB 1R43A 1RT7B 2NREA 2XQCA 3Q0AA 1Q8LA 3VQTA 1SV5B 1VQOS 1QAXA 3FSYA 2VA3A 4PQUA 4OI2A 2HS0A 4NXNF 1H73A 1UW9A 3UDLA 4YP3A 2GQCA 4Q8FA 2VFTA 1S1WA 3KWMA 4JBCA 2VH7A 3I4PA 3HCXA 4MTPA 4OYAA 1GH8A 5D4PA 4JI7J 1M1HA 1AA1B 4DV6F 3H90A 3HSJA 1XNQF 2GMLA 4B3OB 1RHMB 3VAGA 2WOMB 1X9WA 2V5HG 5T7LB 1YG0A 1KBRA 3HHEA 3ENQA 2HGLA 2MQQA 1VQSA 3BGRA 2XMAA 1UEKA 1CBKA 4LUBA 2HHVA 4DUYJ 3HSGA 1K44A 4MYUA 1M5HA 2R8JA 3IO1A 3UVJA 1TKZB 3PW4A 4NLYA 1YK9A 5KG3A 3J81j 2AKWB 3HDSA 3GIIA 5IFMA 3NRBA 4F50A 2CJYB 3AFGA 4W90B 2OIHA 2V2KA 1L3SA 4DG1B 4TVAB 2GO9A 2DY9A 5L38A 4CO4A 2OFGX 3NGTA 3M2UA 4ZN3A 1EETB 2VG5A 1FHTA 3OVSA 2HLUA 2QMXA 5K8MA 2AU0A 3I56S 4WK3A 1Y11A 2WB4A 2EWHA 5IT0A 1UVLA 1GT8A 3I87A 3OJUA 1IR1A 2BACA 5M2UA 2KN4A 4NZ0A 2AQ4A 2CQGA 3UW1A 4U9RA 3M8PA 4F4XA 3DOLB 4QIFA 2MKSA 1S9EB 2XI3A 2V2ZA 1P27B 1X5PA 1L3UA 2AWZA 5A2QY 1ZAXA 1N8RT 3O6QA 4EI2A 3MECB 4WFYA 3R5JB 2XWXA 4DOZA 2IM3A 2NYIA 1R6YA 2JX2A 4PWUA 1ROFA 3FZ2A 2VIHA 4LF4F 3U7JA 1YBAA 4ILLA 4A8SA 1RWPB 4DSJA 3HMJG 1HNIB 2W4DA 4KGVB 4CTAB 2HEKA 2ABYA 3QIDA 4ECSA 1K47A 1T03A 4V19X 1DLOB 4OHZA 1NMEB 2DK2A 2PEHA 3ZZZA 4KY3A 2XY7A 2BDPA 3PCOB 2HWHA 3E2EA 4KRWA 3NY0A 2AX1A 3GLJA 4M63A 2W4PA 4ILRA 4CO3A 2FZGB 4CLYA 3MEKA 1YLXA 4GC7A 3VGUA 1CJTA 1DTTB 1LFPA 4CLWA 1JX4A 4AL7A 2I38A 2W25A 1TL7A 3T1HF 3GFYA 1S1TA 2C2ZB 2UUBF 6FD1A 2H9ZA 3DM2A 4LVOP 4ANEA 3PV8A 4NCAA 2XULA 3OVAA 4JV2A 1AT1B 1Y4ZB 1NDPA 3NOGA 2IVMA 4DI6A 3ZNUA 1GXLA 3THPA 5EGYA 4F2SA 3Q83A 3R5GA 1VJWA 1K1SA 4K4VA 2X51A 2A6OA 5KFBA 3KHGA 3MCOA 1MU2B 4IDKA 1F3VA 3M7VA 3CCWA 2C2EA 1IKVA 2LQBA 1EZZB 4NRTA 2PDAA 4OJGA 4UY85 3CD0A 2I1RA 1R3NA 4CLLA 1FRXA 3NWRA 2HHWA 1YRXA 1F9FA 3J7AN 3F56A 4DPOA 1FRLA 4PXDA 5DRKA 1MN9A 4RZRA 2Z4PA 3DXBA 2YWFA 4MFBA 4CLZA 4DZDA 5K8NA 3MCSA 4KFBA 1B64A 4A8YA 2UXDJ 2BR0A 1T05B 1BQMB 1M5VC 2DCLA 1NM2A 1HD1A 4A48A 2CNNB 2M8HA 3NS7B 3QWUA 1RAOA 3H2UB 4C8NA 3R5AA 3I0SA 2JEFA 4ZA1A 3BN4A 4MKBA 5A8KA 3EPIA 3QJLA 3N4WA 5KFVA 1U2RA 2EW9A 4A8KA 4H4MA 3UPFA 1CG2A 3DGPA 4DL3A 1BQNB 1Y10A 1FKPA 3IAM9 1Z2LA 4ETZA 3MMBA 3OBIA 2V6AA 2MHNA 1U02A 3PDNA 3DLHA 3THVA 5IQ6A 3OVBA 3QRPA 1U2CA 2BJ9A 2FUG9 4UZBA 1RT5A 5HLFA 1CEZA 2GIRA 3FMBA 2NXUA 3EX7B 3KLIB 4A8OA 4LF8J 3HD2A 3MM5B 1N56A 3CCRS 2FPHX 1K1QA 3MR5A 3UD5A 3VTIA 4PYDA 4P7VA 2YXLA 5GMEA 2ZUAA 2OPQA 4A8MP 2RDJA 1UVKA 3CMES 5D0EA 3M8ZA 2HBYB 3LP1B 5HVHA 3UNYA 3SFGA 1N32F 4F3MA 4WP8A 2DR8A 2CPEA 3Q2TC 4TLQA 2KVQE 5GAGU 2HHTA 1R0CB 2VKZG 3DLGB 4XTTA 2C3PA 2NQPA 2HZAA 3BSNA 1HYSA 2YWGA 1K73T 2JEGA 3G71S 4EMDA 3R1HA 1ZM2A 2BRLA 3JTNA 4IFVA 3V5RA 1AFJA 1URNA 3TJ9A 3KJVA 2IYGA 1FTCA 2CQ4A 3TA1A 4AUKA 2K2PA 1Q0NA 1TL1A 1SQEA 1NPPA 1ZPWX 4R0JA 2HWTA 1VJQA 3JAMY 1J5OA 2CNOB 4A8QA 3FCHA 5F3TA 5IWAF 3UCZP 1ELOA 2CJXB 1S0OA 4EYIB 1NDCA 1VRTA 1KN6A 2EFVA 2CJQA 3QO9B 2BM1A 4HTIA 1Q8BA 4PPZA 1WSVA 2Y1IA 1HNWJ 3TRGA 4K8RA 3AXMA 3FRZA 4XPEA 2YBVA 2OPPB 3PYGA 2POKA 2NLWA 2W7OA 2ZBRA 3J81U 2J7KA 3OTOJ 3MI7X 1Y7PA 2MJNA 3R2CJ 3NAHA 1SC6A 2B8PA 1SJ1A 3QQCD 2BV3A 1HQUA 1NK0A 4X64F 4AD6A 3ET6B 3GQCA 4DR4J 4NCGA 1ULRA 5LMUF 3CPWR 1TKTA 4LRCA 2R2TA 5H9FK 1S6QB 1JKHB 4AT1B 5DG9A 2VG6B 3T9ZA 3VVUA 3MM7B 1A7GE 3ETMA 3OSPA 5IT9Y 3CE8A 3IP0A 4ETXA 2FVPA 1RK8A 3KDOA 4NLGA 3NNAA 4I2PB 3RG6A 1RTHA 1N36J 3CW2C 4U7UD 2HBQB 4DR5J 5SUHA 1VRQC 4B3SF 3DOKA 1NK5A 5HBMA 2F4VJ 4DUZF 5C42B 1CULB 1ZS6A 3JYTB 3K2YA 2JLEA 1TP7A 1S4FA 5KFJA 2XGQA 3M32A 1XBWA 1QSSA 5J1EA 1RT7A 2FJWA 2UUTA 4IRCA 1SV5A 4WFNQ 3MPWA 3CC7S 3GTYX 2L3MA 1PYTA 2DH9A 2R7SA 3MEGB 3W65A 1UWAA 3SIPB 3Q8YA 4TKTA 1NJXA 2DBBA 3K5OA 3EVWA 1T3OA 3QGPA 1NCLA 3I96A 2XLKA 4TYBA 5KFDA 3H8YA 3DRXA 2H3EB 1NAQA 3BO3A 4NA1A 5KT7A 4M5LA 3RBEA 1NPRA 2OUGA 3NGKA 4B3OA 3BN7A 2WOMA 3O8WA 5T7LA 3DU6A 2CVEA 2AHOB 1DZ5A 3SZ2A 2H1YA 2OJ3A 3G6VA 3FBCA 3UE2A 4I7FB 4CH0S 3D2WA 3TZXA 4LQ3A 3PACA 2DRBA 2OFHX 2XHWA 2MQOA 2MY8A 2A2DA 1U48A 4ZPBA 2RIJA 5B0CA 2XMMA 4F4KA 4QWEA 3E01B 1TKZA 2IA6A 1WNEA 4ZN1A 3KHLA 2E29A 3FC9A 3TANA 4LSLB 1TL5A 3PW2A 2UUAF 4RJVA 3G8TA 3H98A 3HZGA 4DV2F 4DG1A 2NSCA 1YKWA 4IO1A 1CQMA 3D0GE 2Z0GA 3C14B 1U09A 2LEPA 3IA0A 4Q45A 4GO7X 4JI5J 2PI5A 4OZ1A 1JB0C 1EETA 2IJFA 3JQJA 2HSEB 2X1BA 2D9OA 3KUGA 3LOUA 3KLEB 1JJ2R 5HI7A 1KVJA 4YHHJ 3LGNA 4NRUA 5ETNA 3TAQA 2OI2A 4OFZA 2G1DA 5E41A 3RW6A 3MR3A 2AMCB 4WP9A 3HHNB 3M4XA 2VB6A 4KBIA 2K1RB 3BV8A 2LKZA 2DTJA 4ZITA 1NB7A 2YY3A 2ZHOA 4DLGA 3OTBA 1CLFA 4CQ1A 2KB2A 3DOLA 5HMZA 3I5BA 4Z7YA 1S9EA 1V3ZA 3VAFA 2QFIA 5KG7A 3PEHA 2DGXA 3GYGA 1VBYA 2XMUA 1HBUB 5MAOA 3MECA 2AT1B 3DC2A 5LXRA 2WW4A 2YPZA 2HQCA 2C22A 2MY7A 4PPDA 2G13A 1RT3B 3TVKA 5HO4A 3CCLS 4OZLA 4RUCA 5L1JA 3K59A 1HNIA 3PKMA 1YTYA 4CTAA 1FDBA 4K7QA 3QYYA 2CRLA 5DGAA 2KT5A 1DLOA 3CCVS 2B43A 1WI8A 2ZHBA 3GR0A 3A1YG 3OL7A 3V6DB 3W5YA 3CJ4A 1S59A 2IM2A 4ZKAA 4ZP9A 3BO2A 1JLAB 3UI3A 1URRA 4NLVA 4UQGA 1UVMA 1N33J 1S0VA 3FMWA 3ZZ0A 1TZ0A 4JI1F 3DLEB 1NKEA 3V81B 4OL8A 3FEXB 2FLLA 3OJSA 4ED3A 2OKQA 3W9JA 1SB6A 4B3RF 1S9GB 3T5JA 2CYYA 3LAKA 1DTTA 4YUDA 1YJ7A 2LA6A 2N4CA 1KR4A 1BGXT 2FVRA 2O01C 2BMBA 1D1UA 4FBUA 1I5OB 1NZ8A 1O8BA 2FGCA 2EC0A 2B4PA 4Q44A 1JLEB 4DFMA 3ZC4A 2E7WA 2JOQA 3DOMB 3NCQA 2ILYA 3FBBA 4LF7J 3W2WB 2AYGA 1SIZA 2K7KA 3ISZA 2EFGA 1DURA 1FDAA 3C8YA 1RHUB 2HHXA 3HKZD 1VQPS 1MU2A 2CZ4A 4ZVOB 4OI1A 5E3RA 1GFWB 1JQGA 3D6FB 2HZCA 2FHKA 4MH8A 3M6WA 1LQ9A 2HFNA 2VBWA 1HWIA 2QEXS 4DR4F 2YKQA 2NXJA 2D74B 2BE2B 1N34J 4KJIA 4O3NA 3HHLD 4BLGA 4B9LA 1Z4UA 2A10A 1Q79A 1CS4B 2AJ4A 3P5TL 5HMXA 2R9LA 3EXCX 1DJ0A 4LFAJ 4IG0B 2EKNA 3IM8A 4N47A 1CPZA 3D3BJ 1NXIA 3NCRA 5BJRA 4MMOA 3WX8A 1C1CB 2FC8A 2J7UA 3CJ2A 1T05A 1BQMA 2ZDPA 1X4HA 2ZZNA 3TX0A 2J6UA 3QSYB 1IXKA 4TU9A 1FDNA 3DFEA 3A8IA 4H4KC 3PJ9A 4HHHA 2AZ1A 2CPYA 1RWKB 3V4IB 5AXMA 1M5KC 2DXEA 1BQNA 5KFYA 2GQQA 2HRUA 1B7FA 1SBRA 3I55S 2AGPA 2FLOA 3LW5C 3E51A 1AW0A 4DV0J 1L3TA 2OGUA 2DCUB 4UUWA 4Y2IA 5J1NA 4PXBA 1FD8A 3MMAB 3KLIA 2Z8QA 4WFBQ 2UVUA 3DRRB 3PR5B 4G65A 3N79A 2A0FB 1C2PA 3MM5A 2GO8A 4F02A 1YJVA 2W4CA 4NWBA 2QV6A 3KHHA 3BSAA 2FVCA 4CH1A 5HSPA 3DI6B 5GAHI 4GVBB 1WF1A 1HBMB 1MMLA 4DL0C 4ED6A 4I56A 3LP1A 4PG7A 5L1KA 1HI8A 1WC3A 3QNWB 4LF6F 2VF3A 5DDRC 3C2PA 2RJZA 3DLGA 4TY8B 1S97A 2JNJA 1HKAA 2V94A 2F8MA 1N5QA 1VMBA 2P9EA 2HHSA 3IM9A 3VHQA 4ES3A 3NOCA 2J0XA 1ZBTA 1ZA1B 4FYXB 4YHHF 4Y2AA 1M1GA 2KFYA 4P2MA 3MAAB 3CCJS 2RQKA 4AE5A 2RHQB 3EZ5A 2M9KA 2KHCA 4ZLJA 3UDEA 4X4VA 4ECQA 3QO9A 1JNRB 2VBXA 2KT3A 3U1LA 1D09B 4USJC 2H5IB 1WC0A 2FJAB 2LECA 5L9XA 4USMA 4BC9A 2OPPA 2CAJA
chains in the Genus database with same CATH topology
3GCWP 2W2NP 3P5BP 3BPSP 1SPBP 4JP8A 1V5IB 2E1PA 2Z58B 3CNQP 3QFHA 4K8RA 2W2PP 4NMXA 1ITPA 3H42A 3AFGA 4YN3B 2ZWPA 2ZWOA 4OV6A 2Z30B 3WIUA 1SCJB 3VHQA 2Z2YB 2W2OP 2XTJP 3CO0P 2QTWA 2W2QP 3A3PB 4NE9C 3T41A 3BGOP 3WHIA 3A3OB 3A3NB 2Z56B 2PMWA 1R6VA 3VV2B 3WIVA 3SQOP 2W2MP 2Z57B 2Z2ZA 3GCXP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCW P;  2W2N P;  3P5B P;  3BPS P;  1SPB P;  4JP8 A;  1V5I B;  2E1P A;  2Z58 B;  3CNQ P;  3QFH A;  4K8R A;  2W2P P;  4NMX A;  1ITP A;  3H42 A;  3AFG A;  4YN3 B;  2ZWP A;  2ZWO A;  4OV6 A;  2Z30 B;  3WIU A;  1SCJ B;  3VHQ A;  2Z2Y B;  2W2O P;  2XTJ P;  3CO0 P;  2QTW A;  2W2Q P;  3A3P B;  4NE9 C;  3T41 A;  3BGO P;  3WHI A;  3A3O B;  3A3N B;  2Z56 B;  2PMW A;  1R6V A;  3VV2 B;  3WIV A;  3SQO P;  2W2M P;  2Z57 B;  2Z2Z A;  3GCX P; 
#chains in the Genus database with same CATH topology
 1R89 A;  5JVG Q;  3LAL A;  1M5S A;  4XO0 A;  4UQT A;  3KJN B;  5A8R B;  4QQB A;  4JI4 J;  1REG X;  4C9D A;  3G96 A;  2B7B B;  2V2V A;  3R5D A;  3TI0 A;  4KB7 A;  1I6J A;  4IQM A;  5JXS A;  2C2M B;  1N5Y B;  1RI7 A;  3ZNJ 1;  3ET6 A;  3DLL Q;  4LMZ A;  2E1P A;  5E3C A;  1RTI B;  3PRD A;  4JI6 F;  2M8D B;  4OLP A;  2VPZ B;  4HH0 A;  3D6M B;  4B3M J;  1S6Q A;  1JKH A;  5ETR A;  3PW5 A;  2VG6 A;  4DX6 A;  1GQE A;  4HR2 A;  4PG4 A;  3TUJ C;  3MM7 A;  3L7P A;  3SCL E;  5HQM A;  1VC0 A;  2C3O A;  3VAL A;  5IM0 B;  4A46 A;  2N3L A;  4I2P A;  1KLM B;  5LXY A;  4ZJQ A;  1U0S A;  4DU7 A;  3TUZ C;  5C42 A;  1CUL A;  5BYQ A;  3BM7 A;  3JYT A;  4H4O B;  1UKU A;  4ELU A;  3CED A;  1X4E A;  5IT4 A;  3F41 A;  5GAE I;  2HHQ A;  3DLJ A;  3AJ1 A;  2LP4 A;  5L39 A;  5GAD I;  3MEG A;  2QRR A;  4ZVG A;  1PCA A;  2CQ3 A;  4X65 J;  3ADA C;  1ZYQ A;  3SQG B;  1PYS B;  3HSZ A;  1TEL A;  2X3G A;  3HI9 A;  4I69 A;  4ZK7 M;  1T11 A;  2VG7 B;  1RAH B;  2ASJ A;  4LF7 F;  2BJE A;  2LQ8 A;  4KC5 A;  3CDA A;  4D3G A;  3OL9 A;  4LBP A;  4Z7C A;  3MDF A;  1BXN A;  2DR9 A;  2KVI A;  3TEH B;  1X4B A;  3LAN A;  2MQP A;  3MUT P;  5F8G A;  4I7F A;  3LWL A;  2VUG A;  4KAI A;  4HT7 A;  2E5J A;  1SKS A;  3LP2 B;  1T9Y A;  4BWJ A;  2NZ4 A;  2JVO A;  2EFO A;  4G6V B;  3H20 A;  4H4K A;  1N34 F;  3NWG A;  2RUS A;  4DR3 F;  3E01 A;  3BYR A;  2YX7 A;  9RUB A;  2HVI A;  3CDE A;  4J91 A;  5D0R A;  3LAM A;  1RBO B;  4LSL A;  1VHI A;  3RRK A;  4ECU A;  4KTQ A;  2DNK A;  2RS8 A;  1NK7 A;  2DYA A;  2N4D A;  2ZE2 B;  2HFO A;  2BYC A;  3C14 A;  3D67 A;  1YJN S;  1FVS A;  2IRX A;  3CJQ A;  2VAS A;  2Z56 B;  2ZIT A;  3BRE A;  3HVR A;  1LWF B;  2RRN A;  3KLE A;  4CLF A;  1VI7 A;  3PR4 A;  3V6H A;  2F9D A;  4CNZ A;  3NGR A;  3M2R B;  5F9N A;  4KE5 A;  3AB4 B;  1OSD A;  4ZPT R;  1H2U X;  2ALZ A;  3W62 A;  3NCP A;  4NLS A;  2HAF A;  3GWC A;  2B8Q A;  5B7W A;  3KLV A;  1T7P A;  2K1R A;  2GHV C;  2KG0 A;  5KFW A;  5ETP A;  1F5A A;  2CG8 A;  2WVF A;  4FP9 A;  3TJ8 A;  3PTW A;  1RHR B;  2AP6 A;  2LVW A;  1HBU A;  3W5X A;  3TAP A;  1FD2 A;  3EIC A;  3E8O A;  2BKP A;  3AQO A;  2ROG A;  4GMK A;  1IKY B;  2F8E X;  1C4A A;  4L74 A;  2ROP A;  1DRZ A;  3M9O B;  1VBX A;  3CJ5 A;  1NHV A;  3CJK B;  1VBK A;  4O3R A;  1RT3 A;  4XPC A;  1PJ7 A;  2V8V A;  2P9C A;  4DN0 A;  3WHI A;  4LJM A;  2WVB A;  2CPF A;  1JXL A;  2HVH A;  2Y0B B;  3RAQ A;  3K8W A;  1GMW D;  3BSC A;  4QIW D;  3V6D A;  2YPY A;  4RNM A;  5E7O B;  4NXM J;  1RBL A;  2E5G A;  1EAY C;  3D54 A;  1LWX A;  1KQF B;  4DSE A;  1JLA A;  5F8I A;  4A8W A;  5C2G A;  1SH0 A;  4J9V A;  3QRQ A;  3C19 A;  7FD1 A;  2HRT A;  1VC6 A;  3R1L A;  2L08 A;  4FPI A;  3DLE A;  3UR3 C;  3V81 A;  2EFN A;  3OFH A;  4ZCL A;  3K5M A;  1UMJ A;  1S9G A;  1MMN A;  1VQL S;  4OHW A;  2DGS A;  3DKD A;  2F63 A;  2JRS A;  1Q7L B;  2AGQ A;  4KHP J;  4DLE A;  1MN7 A;  1Q8I A;  1JLE A;  1SQG A;  2LMI A;  4NYO A;  1FTR A;  1VQK S;  1RGV A;  2R2R A;  4RBV A;  2HIY A;  1H38 A;  2EBG A;  3DOM A;  3B4D A;  2RS2 A;  4OYI A;  3W2W A;  2W01 A;  4Y34 A;  2QLF B;  4IR1 A;  1V3R A;  4I2Q B;  4RW9 B;  4HI2 A;  2KT2 A;  5H9E J;  4DV1 J;  2ZJR Q;  2IM1 A;  4LRB A;  2LLZ A;  1PJ5 A;  2IJN A;  2XNQ A;  4JI4 F;  4DFP A;  1RT6 B;  1UET A;  3E3X A;  2DGQ A;  4C97 A;  8RUC A;  4W92 B;  5ETM A;  2H5E A;  3B54 A;  5AE1 A;  2YKN B;  4RUB A;  2N3O A;  2BE2 A;  3MR2 A;  3J81 Y;  1VIX A;  1IQT A;  2QMU B;  3KFW X;  4CO5 A;  1F6T A;  4Z2X A;  3TZW A;  1PYO B;  4B9T A;  2KRB A;  4PKD B;  2EG2 A;  3DMJ B;  2PSZ A;  1CS4 A;  1T3N A;  1RAJ A;  4NML A;  4DV5 F;  3RYL A;  4IG0 A;  4QIG A;  1ZM4 A;  2XM3 A;  1C1C A;  4M5H A;  1BD6 A;  3BDP A;  3M9M B;  2OML A;  3GCX P;  3QLH B;  1JNZ B;  3W9H A;  4EO8 A;  3WC2 A;  1WTB A;  4K59 A;  2ZD1 B;  4ZLP A;  3N0V A;  3FNN A;  4OMF G;  1WKL A;  1KSP A;  3V4I A;  4I0W A;  1HI1 A;  2EXU A;  4OV1 A;  1JLQ B;  5KFM A;  4NMX A;  2UVW A;  1J5E J;  3UD3 P;  2HGM A;  3LWM A;  1ZM3 A;  3CB4 A;  4YFU A;  4RU2 A;  4C0H A;  4LFB F;  3HPO A;  2NUU G;  1S72 S;  3PIO Q;  2G2Y A;  2FZC B;  2HFV A;  3MMA A;  4ATN A;  2ZH2 A;  2BX6 A;  3RB3 A;  3DRR A;  2ZH5 A;  2QLW A;  4HH1 A;  2OEK A;  5IS2 A;  3MPV A;  2J6S A;  3ENA A;  4WIQ A;  2MQM A;  1BC6 A;  1WJ9 A;  1RBA A;  2QJ3 A;  1YQH A;  2G9O A;  5AT1 B;  2UXC J;  1REV B;  1U8S A;  3TUI C;  3JSB A;  5THW A;  3DI6 A;  2QA1 A;  1R8C A;  4K0K J;  1FNX H;  5GMD A;  3QPI A;  3C6T B;  3JS9 A;  4GVB A;  3NKY A;  3QZ7 A;  1HBM A;  2UUC J;  3PNI A;  3HD1 A;  4OZ0 A;  1W2I A;  2HHH F;  1I3O B;  1KLN A;  4FN5 A;  1IBM F;  2VPX B;  5HJX A;  1GEH A;  1S0M A;  1ZH5 A;  3G2X A;  1PGZ A;  3KUE A;  4TY8 A;  1NZA A;  4F8R A;  2KM8 C;  1P6T A;  1XMO J;  1TMM A;  3CCS S;  3M1V A;  1QY7 A;  1NJZ A;  3HZE A;  5KFO A;  1YGY A;  1KTV A;  2B9X A;  3KK2 B;  1UJ6 A;  5HAN A;  4DL6 A;  5G4D A;  2GVD B;  1OIA A;  3MAA A;  4WP3 A;  1Q5V A;  5BYS A;  4OX9 J;  1S6O A;  1RA6 A;  1NJY A;  3JSM B;  3G87 A;  4NZ6 A;  1ZA2 B;  4URS A;  1WEX A;  2HBZ B;  2W7A A;  4FNI A;  1XNR J;  2R7X A;  4CH7 A;  4KKO B;  2EK1 A;  1TL4 A;  1N52 B;  3N6L A;  4PXC A;  1VQ5 S;  1L3V A;  1L5U A;  4OYM A;  4FPR A;  4WFZ A;  4B9N A;  2WVC A;  4MK7 A;  5CH7 B;  5A8R A;  2GMH A;  5E3P A;  1RHK B;  2ZBQ A;  1VR6 A;  3MUR P;  3PHT A;  4EUV A;  4P6Q A;  4WFA Q;  4WU3 A;  1N5Y A;  3BDE A;  4ED1 A;  1SCJ B;  3ZFV A;  5B09 A;  1RTI A;  1YHQ S;  4C8O A;  2XNR A;  3US5 A;  2DNP A;  4P75 A;  4EZ9 A;  1QLN A;  1D8Z A;  3DCA A;  4ER8 A;  4LQ9 A;  2DGV A;  1RDR A;  3EMT A;  3R7S B;  4NPO A;  5IM0 A;  3CVK A;  3BEG B;  2YH1 A;  1SXL A;  2ZHA A;  4DR7 J;  2Q79 A;  1KLM A;  1SJ4 P;  3PO4 A;  4DZ6 A;  2YWW A;  4JI8 J;  3I82 A;  3HLU A;  1X4A A;  2IAJ B;  3W7B A;  1WF0 A;  4NAS A;  1Q7Y T;  2O66 A;  2CIM A;  3JQM A;  2DHA A;  2GHW A;  3NMR A;  2V8H A;  2R7V A;  4H4O A;  2B7C B;  2ZVS A;  3I6P A;  2C3U A;  4CWB A;  5I3Q A;  1RTD B;  3RUB L;  2OEJ A;  2CNL B;  3N5F A;  3CMQ A;  4P72 A;  4ZCI A;  1U1P A;  5GAE U;  1QVF R;  4DR6 J;  3HUL A;  2DNO A;  3CJ3 A;  1QE1 B;  1RUS A;  3MPD A;  5F8N A;  4Y6I A;  5CAB A;  3UCU P;  1HAR A;  5HQL A;  1MSW D;  2E9Z A;  3SQG A;  1EJ7 L;  2Q1L A;  5A0Y B;  5LJ5 Y;  4YR3 A;  1RYS A;  2VG7 A;  2KTQ A;  3P96 A;  2J0S D;  4ZS6 A;  2LDY A;  1QUV A;  1Q81 T;  3WZ0 A;  2VFS A;  4C8M A;  3OLB A;  1NPK A;  3CJ0 A;  2M4M A;  1IBL F;  1UP1 A;  3PJX A;  4Y00 A;  3N6N A;  4N7T A;  3ZZP A;  4MK8 A;  3LP2 A;  3Q23 A;  2APO A;  5KFZ A;  5J2N B;  4O3P A;  3LPE A;  2ROE A;  1OQ3 A;  2ZKT A;  1RYR A;  4PRF A;  1HQE B;  4Y65 A;  4DV3 F;  3CCU S;  2ACY A;  3VAJ A;  2CG4 A;  1Y5I B;  4LF9 J;  2ZE2 A;  4B3T F;  4X66 J;  3AAW B;  4ELV A;  3GCW P;  3EVM A;  2AJ1 A;  4N8N A;  1RHQ B;  1LWF A;  1RTJ B;  1TKX B;  2B6A B;  3O2I A;  1XIQ A;  4P52 A;  4WXW A;  4DQI A;  2UXB F;  1UJ4 A;  4AFF A;  2J9D A;  2CWK A;  3M2R A;  1S6U A;  1XTZ A;  4OZ2 A;  2QLJ B;  4J5O A;  3M05 A;  4KHM A;  2F40 A;  2BKN A;  1KVI A;  4FF2 A;  2A1B A;  3MD3 A;  1TU0 B;  3I9Z A;  3CTR A;  3PO5 A;  2FJB B;  2WZ1 A;  1H0H B;  4PAA A;  5F8M A;  3AXK A;  1IKY A;  1HIY A;  4J9K A;  4X4Q A;  1JMT A;  2RU3 A;  1S1V B;  2BJD A;  2HS3 A;  1C4C A;  2IRU A;  2LQ9 A;  3CJK A;  4MT1 A;  5HVF A;  2RQ4 A;  1U2F A;  4X84 A;  4YME A;  2Y1J A;  3H40 A;  4RLE A;  4QU7 A;  4ZVE A;  2UUC F;  1WAC A;  1BLU A;  1TUW A;  2G2Z A;  3HF5 A;  2QT7 A;  3RU0 A;  3D68 A;  2ZDO A;  4F04 B;  4DL5 A;  1LXJ A;  2NXC A;  3KLG B;  1N0U A;  4HI1 A;  1BWV A;  2IBO A;  5AXN A;  1JLF B;  3QIP B;  4X4U A;  2E9R X;  1N5V A;  3P45 B;  4DPY A;  1SC4 B;  4C3L A;  4CDI A;  1NEE A;  2RNE A;  3DLK B;  2V0N A;  4EU0 A;  2QMW A;  3K5P A;  3HHL B;  4O3Q A;  4NLQ A;  2IC3 B;  4KV8 B;  2CQ2 A;  2YQ3 A;  2Y8Y A;  1PIE A;  4IH6 A;  1LK7 A;  4V1A k;  3NGS A;  2EEY A;  3NS5 A;  3QT5 A;  1FJG J;  4B9M A;  1HR0 J;  3HT0 A;  1U1K A;  1SL2 A;  2K8G A;  4OI0 A;  4J9N A;  1XC9 A;  4NYP A;  4OJH A;  4KGX B;  4O4G B;  3BGO P;  3H7H B;  2MKY A;  3I4H X;  4BWM A;  3BQ0 A;  4TYA A;  1D9D A;  2BBE A;  3SSS A;  3EXY A;  2DNG A;  4I2Q A;  1WF2 A;  1WI6 A;  4RW9 A;  1Q4R A;  1EIY B;  5G0R B;  2Q6B A;  4K5S A;  2DNN A;  1DQ8 A;  2RD5 C;  4JV5 J;  1RAI B;  3D1O A;  3M2V B;  1RT6 A;  3OUY B;  3OR2 B;  4ED8 A;  3QAE A;  2BKO A;  2VDI A;  4WPA A;  3DU5 A;  2PD1 A;  3LUY A;  3L95 X;  3OTC A;  2HFZ A;  2YKN A;  1KRP A;  3T6B A;  2E1M C;  1S77 D;  1RSC A;  4IKA A;  3DMJ A;  3D1H A;  4U7C A;  2HKE A;  4KR0 B;  4ED4 A;  4OX6 A;  3EGW B;  2COL A;  5K8O A;  2G0C A;  1UWB B;  4Q5V A;  4DR2 J;  1RWN B;  3QMQ A;  4RNN A;  5B08 A;  1NLK L;  3B6B A;  4K4T A;  4XK8 C;  3QLH A;  2PMZ D;  2ATC B;  1IBK F;  1HBO B;  1RXO B;  4O4R A;  2ZD1 A;  1X5S A;  1IM6 A;  3AD9 C;  3UD4 P;  1E6Y B;  5C25 B;  4Q8E A;  2MLX A;  1KS2 A;  2DHH A;  1F0X A;  5M2P A;  4Y3C A;  3J7Y U;  4Q2M A;  2OD6 A;  4ZP6 A;  2Z30 B;  1JJC B;  2ZZT A;  2KXN B;  5GMK a;  1JLQ A;  5DS7 A;  2KU7 A;  1RE1 B;  3PZP A;  3HFZ B;  2WON B;  2WSE C;  4F4Z A;  2NZC A;  3KOA A;  3R97 A;  5EWF A;  4A8F A;  2UP1 A;  3SMZ A;  4QW8 A;  5BXI A;  2E5L F;  5CCM A;  5BR8 J;  2X1A A;  5KTQ A;  1B0P A;  3CWJ A;  2HAI A;  1PBA A;  3BYP A;  2XGP A;  2WVE A;  1NH8 A;  5IQQ A;  4FXV A;  5LMN F;  1REV A;  4WYW A;  2QTW A;  5KT5 A;  3A3O B;  2MYF A;  4ID5 B;  2QYC A;  5KG4 A;  1P9Q C;  5F0W A;  3C6T A;  1Q82 T;  2MLY A;  1N54 B;  3CJR A;  3ZTR A;  5I42 B;  4M5K A;  1RWV B;  3C16 B;  2W1B A;  3G6X A;  1A0O B;  1C1B B;  4PR6 A;  1KEK A;  2MLZ A;  1NDK A;  3BBF A;  1RCX B;  2ADC A;  2OHD A;  4NLW A;  1RT1 B;  1WHX A;  2C2D A;  4HDG A;  3PM9 A;  4ECZ A;  2CZV C;  1I1G A;  1D0E A;  3Q2S C;  4ECR A;  4CYU B;  1PIL A;  3QGI A;  4QYR A;  1HNX J;  2DXD A;  3X1L B;  3UCG A;  2VOO A;  1B4S A;  3L4B C;  4Y28 C;  1HWJ A;  5D0H A;  1KQS R;  1P1T A;  2CPX A;  2FVQ A;  2C28 A;  3KK2 A;  3OLA A;  5ADZ A;  1R8H A;  4K4X A;  4NLX A;  3MMC B;  3TVZ A;  3L3C A;  2YWK A;  2GVD A;  1FXL A;  4CO1 A;  3N6M A;  3SCJ E;  2IM0 A;  4J9R A;  1TTH B;  3ZZO A;  1Y0H A;  5E0O A;  4MKY A;  4F26 A;  3JSM A;  3OL6 A;  4MIW A;  1N5S A;  4CRJ A;  1Y5N B;  1S5Z A;  1Y00 A;  3EVO A;  4XDC A;  4KKO A;  2RHS B;  1RT2 B;  1WG1 A;  2IHR 1;  1TL3 B;  1WC6 A;  4QIE A;  4FF1 A;  2VQF J;  1G6B A;  3H59 A;  5AJ3 J;  4K5R A;  2QZ8 A;  1I94 J;  4DWI A;  1JLG B;  1N5T A;  4RNO A;  4HTJ A;  2DHS A;  4UF4 A;  1IR0 A;  3OHA A;  4XDD A;  1H3D A;  4X4R A;  1FFW B;  4PWD B;  3FEZ A;  1S79 A;  4Q0B B;  5KFR A;  1IR2 A;  4TXS A;  1R0A B;  3FZB A;  4AXI A;  4URG A;  1U6F A;  1TAU A;  2I9S A;  2KI2 A;  3BO4 A;  3BQ2 A;  2F7V A;  3DRS B;  4WJB A;  2IAJ A;  1XMQ F;  1OPZ A;  5CYQ B;  2HZV A;  2RU9 A;  3OT9 A;  3Q8V A;  2IY5 B;  2R2U A;  1U0H B;  2N7Y A;  4JI3 J;  3GG1 A;  2MB0 B;  4DR1 J;  1IN0 A;  9ATC B;  1FCA A;  2YKP A;  2H4Y B;  3T1Y J;  4JI0 J;  1RTD A;  3ULH A;  4I67 A;  1Y3K A;  3D4J A;  3MR6 A;  2FHJ A;  5J2Q B;  2M3D A;  3N5B A;  2HS4 A;  1FJG F;  2C3M A;  1WKJ A;  2D1C A;  1IKW B;  4QW9 A;  1QE1 A;  1Q5Y A;  2E7V A;  2GJF A;  5KOX A;  1AFI A;  2LCW A;  5SZT A;  5A0Y A;  3J7Z T;  1DTQ B;  2UV8 A;  1V5I B;  1KC8 T;  3W63 A;  2HBR B;  5KG1 A;  3HK2 A;  1MWQ A;  4CLT A;  2MGZ B;  1RAF B;  3NL0 A;  4D3H A;  3FJ2 A;  4FYY B;  2FDN A;  4FYD A;  3ETO A;  3CD5 A;  2BQ3 A;  4I68 A;  4ZDN A;  3IG1 B;  1XMB A;  4G1Q B;  1RP5 A;  3CCZ A;  4WTO B;  4JYA F;  4K4W A;  1M90 T;  3ITH B;  5D77 A;  2QYG A;  4DCJ B;  1ZM9 A;  2EG1 A;  4ECY A;  2FHM A;  1UPM B;  3CJT A;  5J2N A;  1CJV B;  4AQY J;  5KG6 A;  2EK6 A;  3A12 A;  2VFV A;  3MOZ A;  1JJH A;  2GC8 A;  2BJ1 A;  2H48 B;  3TQ1 A;  3BZQ A;  1HQE A;  3HHK A;  4L6V 3;  2HVZ A;  4P74 A;  2MJU A;  5B0B A;  2DNH A;  1IJE B;  5LJ3 Y;  4L3N A;  4MIB A;  1UW4 A;  4WKY A;  3G6E S;  4OQJ A;  4AND A;  1TAQ A;  2FQQ B;  4DPT A;  1RTJ A;  1TKX A;  2B6A A;  4ECV A;  4LF1 A;  1R6V A;  4HKQ A;  4OI6 A;  1IWA A;  3IWL A;  3VAK A;  4C0B A;  3D6H B;  1B0V A;  4OIX A;  1WD6 A;  2VHG A;  1J2V A;  1RKJ A;  1W7W A;  3R9L A;  3KUH A;  2ZWO A;  2VL1 A;  2CQH A;  2VZ9 A;  2E1A A;  2AGO A;  3RR8 A;  4X62 F;  3IMQ J;  4Q43 A;  2IA0 A;  1H98 A;  2Z2M A;  3M8Q B;  2VQE J;  2E1R A;  3CJS A;  1Z1Z A;  3I5A A;  3W1Y C;  5CD4 A;  3PYF A;  3HJV A;  2ZM6 J;  4MYT A;  4DV7 J;  1XER A;  4LF5 F;  1FJE B;  2VC0 A;  2UV8 G;  1HQ2 A;  3EYZ A;  2IDE A;  5EUH A;  1S99 A;  1GXU A;  3MM6 B;  1S1V A;  2RVJ A;  4UOH A;  4NYZ A;  4DF4 A;  1VQN S;  3DRP B;  1FFG B;  5KT2 A;  4FS1 A;  1YI2 S;  4GKK J;  5EWE A;  3U02 A;  1AXQ A;  1RWX B;  3MAQ A;  2PFD A;  2KZZ A;  2OEL A;  4JI2 F;  1HBN B;  1FWL A;  4M5M A;  4USU A;  5DDP C;  3SV3 A;  2AYM A;  5HQ8 A;  2DNR A;  5DM6 Q;  1YRU A;  2IYI A;  1Q78 A;  1U1M A;  2MKK A;  1X5T A;  2YX1 A;  2XCP A;  4LIW A;  3BSO A;  3KLG A;  3KLF B;  4IRD A;  1JLF A;  1ARO P;  3AA8 A;  2OEM A;  3QIP A;  4R8U B;  2I5J B;  3OTE A;  4CI0 B;  4TU8 A;  3DLK A;  3VR1 A;  3W2V B;  3W5Z A;  4DMZ A;  3HHL A;  1WG4 A;  3WBZ A;  2IC3 A;  4KV8 A;  4JOU A;  2QLX A;  2L41 A;  2FJX A;  3CDU A;  1N0V C;  1OSC A;  5AE2 A;  3C66 A;  2FVS A;  2HRY A;  4DSL A;  4DV4 J;  3VVT A;  4C11 B;  2BAB A;  4F25 A;  5LSL A;  4O4G A;  3TX8 A;  1HI0 P;  5EX3 A;  4JI7 F;  4F3Q A;  4ZVS B;  3AA9 A;  4ECX A;  3ILL A;  3OL8 A;  3UN3 A;  2AX0 A;  3MR7 A;  1HHS A;  1VQ8 S;  5G0R A;  3BKU A;  3AOA A;  5CYM B;  1BWE A;  3JXO A;  1YWX A;  3MED B;  2CQD A;  3M2V A;  1HPZ B;  3OUY A;  4M5D B;  3OR2 A;  2RUG A;  2AYB A;  1YSJ A;  2VBY A;  4DUY F;  5H9F J;  3DDN A;  2R3V A;  2FJV A;  2HK3 A;  4J9O A;  2B56 A;  1VQ4 S;  4LFC J;  4YEA A;  3UQS A;  2V68 A;  4FXW A;  4QYZ K;  1VK8 A;  3FKB A;  4ZIV A;  1NSQ A;  3UWT A;  1YJW S;  3VZI A;  1H7X A;  1NU4 A;  2EBE A;  3AY0 A;  2KL8 A;  1VOM A;  1UWB A;  2I2Y A;  5HN0 A;  4DX8 H;  1HNV B;  2M52 A;  3AJ2 A;  1FFS B;  2BM0 A;  5DO2 A;  3SSQ A;  4E98 A;  2F5G A;  4RL1 A;  3KNG A;  3K5L A;  1BMQ B;  2HVE A;  1HBO A;  3H5S A;  4JI3 F;  3V4M A;  3MM9 B;  2XY5 A;  4ZVQ B;  4ZPA A;  3KK1 A;  1FT8 A;  1E6Y A;  5C25 A;  3W3S A;  4UST A;  4BDP A;  1SC3 B;  3H2L A;  2XO7 A;  1FK9 B;  1UJ5 A;  2WON A;  3P8B B;  4KGM A;  4P9S A;  2VON A;  5KT6 A;  5LSO A;  1P1L A;  1BE4 A;  2WRM A;  4OYP A;  3BBB A;  3TEG A;  4NLO A;  2J9E A;  3ILI A;  3KYL A;  1H74 A;  1QAJ A;  2HND B;  3LP0 B;  1QDU B;  1TV6 B;  3H42 A;  3FSX A;  1YRT A;  2UVV A;  3CGI A;  4ZPV R;  1CSJ A;  1HWL A;  2MZT A;  1NB2 A;  3SDE B;  1W25 A;  1WDD A;  3GON A;  1XR7 A;  2OH2 A;  3NG8 A;  4NXN J;  2XCA A;  4J37 A;  1UA0 A;  1RAB B;  4ID5 A;  4YB6 A;  2IVY A;  1H2T Z;  3J7Z 5;  5I42 A;  3C16 A;  3OD2 A;  2EFP A;  1C1B A;  3J7A 1;  5IZH A;  2HVD A;  1F3F A;  4DV6 J;  1QTM A;  1RT1 A;  2QFJ A;  2N7C A;  3DHW C;  3MAH A;  1FE4 A;  4CYU A;  5KFU A;  1UFK A;  4NEZ A;  3BPD A;  4FXD A;  1KVK A;  4MIA A;  2KJW A;  3D6T B;  4LBI A;  4KIA A;  2V67 A;  2Z2L A;  3WIV A;  2V4R A;  4OHV A;  1YIJ S;  4PG5 A;  2W2N P;  3K7R A;  2QLB B;  2GA7 A;  3MMC A;  5ETV A;  3ENW A;  1BY9 A;  5EDW A;  1YVF A;  5DM7 Q;  2MKJ A;  3KLH B;  4A8X A;  1JK9 B;  5L1I A;  2PMH A;  2RF2 B;  2HQD A;  4ALZ A;  5I4M A;  4HT5 A;  3VAI A;  1U45 A;  2E7X A;  2XI2 A;  3CCQ S;  4LR8 A;  2CVI A;  2MDA A;  3R27 A;  3D28 A;  4FKX A;  1RT2 A;  3P3D A;  1IUJ A;  1FVQ A;  1TL3 A;  3QT8 A;  3CF5 Q;  4CIO A;  4HHU A;  3OV7 A;  3PIP Q;  1N88 A;  5CZX A;  3AD8 C;  4KGZ B;  3LQV A;  4A47 A;  3RJM B;  1JLG A;  3EPG A;  2ZBP A;  3CCE S;  4J7C A;  3WX4 A;  1GX5 A;  4PWD A;  4E2F B;  4Q0B A;  5DGB A;  2A6M A;  1TR0 A;  3DNC A;  1OY8 A;  1D9F A;  2QA4 S;  2NXE A;  1R0A A;  2DEJ A;  1NHK L;  3GG0 A;  2LXU A;  2UXD F;  2PE8 A;  4QWC A;  2YVS A;  1R7I A;  5DQG A;  4TU7 A;  2RQM A;  4I6W A;  4NL5 A;  3D0I E;  1HFE L;  2RE1 A;  3DRS A;  1RQ0 A;  1WSR A;  2XBP A;  4TLR A;  4LF4 J;  1FXD A;  5CYQ A;  3KK3 B;  4M8L A;  3PX4 A;  1U0H A;  3M8W A;  2F1F A;  1KDN A;  2JEI A;  1RB0 A;  1CC8 A;  4O0N A;  3GJR B;  1RA7 A;  2RRB A;  3GV8 B;  5IXU A;  1T9X A;  1O6X A;  1Q8K A;  2V4J B;  2ZH1 A;  5J2Q A;  1TUG B;  3S1T A;  1PKU A;  4ZJL A;  1QAY A;  2E1C A;  4DJB A;  3RAX A;  4TNO A;  1KP6 A;  4KPY A;  2GHP A;  1VBZ A;  5RUB A;  3FFI B;  1IKW A;  4NLP A;  1I51 B;  4ITS A;  2NYH A;  3VGV A;  4LF8 F;  3B8H A;  1F1B B;  1NSA A;  1VCT A;  2OO4 A;  2CJ9 A;  4I1T A;  3JTO A;  1G4C A;  4P7T A;  3S01 A;  3ZZU A;  1NND A;  3T1H J;  2MGZ A;  1SJR A;  1NJW A;  5HAO A;  4ECT A;  4RUH A;  4USV A;  4WII A;  3IGV A;  2C2R A;  4C8K A;  2RT3 A;  3K5N A;  3IG1 A;  4ZPD A;  4G1Q A;  4C8Y A;  1KWM A;  1X9M A;  2LA4 A;  3ITH A;  1P8G A;  4PZV A;  1CJV A;  3U1N A;  2CDQ A;  1IWG A;  3DYA B;  2WSF C;  4LSN B;  3EM1 A;  3G8Q A;  5A8W B;  2R7W A;  2ILZ A;  3RTV A;  3DDK A;  2CJK A;  2G0J A;  3GSD A;  1SIW B;  3P6Y C;  1DHM A;  1BQX A;  2QSF A;  2ACM A;  2H5J B;  3S6E A;  2P6S A;  2LXI A;  2NCK L;  4WBF A;  3VAM A;  2R7Q A;  2X1F A;  3R7N B;  4UW2 A;  4IQX A;  4OLO A;  5CD4 H;  4USK A;  5T41 A;  3RBD A;  2GW8 A;  2HHP A;  2FZK B;  4I6Y A;  2ZJP Q;  2XZD B;  2JLG A;  1B99 A;  3EDQ B;  1GMW A;  4F0K A;  4WYL A;  4U8Y A;  1LW0 B;  2BW2 A;  1FXR A;  1CJU B;  1U1N A;  2I0X A;  3FUY A;  1SJQ A;  2GFF A;  5E33 A;  2IPO B;  2J0W A;  5DJB A;  2EC2 A;  2PA3 A;  1T95 A;  1S6P B;  1JJ4 A;  3OFE A;  3ICL A;  1HNW F;  1YJR A;  1XR5 A;  1MWZ A;  1JIH A;  4DL7 A;  4Q7A A;  3M8Q A;  4UZC A;  3KMS A;  1U47 A;  1IQZ A;  2R8K A;  1CC7 A;  4CM0 A;  2F9J A;  2O1P A;  2YWH A;  1U1L A;  1F2H A;  3OTO F;  1TQL A;  2JC0 A;  4W4M A;  4U95 A;  4IO9 Q;  3TAM B;  2GNK A;  2CPH A;  2OTL S;  2ATL A;  2FHO B;  1OY9 A;  5EN1 A;  3IBW A;  4OYX A;  3MM6 A;  2ZNY A;  1UEV A;  2QA4 G;  1S76 D;  4F0M A;  3DRP A;  2XWY A;  2L9D A;  2DD8 S;  4LR9 A;  7FDR A;  4ELT A;  2VJV A;  3W60 A;  1HBN A;  1F60 B;  3C15 B;  4X4S A;  3CD7 A;  1NSK L;  2XS2 A;  2J5A A;  3LGH A;  1N36 F;  5U47 A;  2VDH A;  1SKW A;  4Y0F A;  2XS7 A;  1LWE B;  1FRH A;  1Q86 T;  2PN6 A;  2U1A A;  4DR5 F;  2J9D E;  3KLF A;  1GTE A;  1TKD A;  4UOG A;  2R7R A;  2F4V F;  1X4F A;  1ZTT A;  4WWS A;  1A6L A;  4R8U A;  4DPU A;  3HSD A;  4X4N A;  4RKU C;  2I5J A;  3H5U A;  1N32 J;  3SBM A;  1Q1K A;  3QGH A;  5JMN A;  2VV5 A;  5B0G A;  3W2V A;  2KDO A;  4RW4 B;  1R8A A;  3TWZ A;  2M2B A;  4E8U A;  1Y5L B;  5KFX A;  3IC1 A;  3NP5 A;  2B0G A;  2B5J B;  3KNA A;  3TOQ A;  1Q53 A;  4FDF A;  3GV7 B;  3LGM A;  1U1O A;  4C11 A;  4IYQ A;  2IMO A;  4DXL A;  1ZPV A;  2EPI A;  3CDB A;  2MZS A;  5LSR A;  2HK2 A;  2AEJ A;  2VPW B;  4O3S A;  3KJQ B;  2ZNZ A;  5JUM A;  5IWA J;  1WHW A;  2BAN B;  3CNQ P;  4UOC A;  3MPU B;  4N5S A;  3GIR A;  5FLX U;  2XYP B;  5CYM A;  2KZM A;  3EWG A;  4AL6 A;  1RLC L;  3MED A;  4XIU A;  1HPZ A;  3L9Z A;  1KOH A;  2H51 B;  2P8I A;  4Y2C A;  1GMU A;  3GIJ A;  4M5D A;  2KFN A;  4B9S A;  3W61 A;  1RAG B;  1LV5 A;  1QSL A;  4USH A;  3RW7 A;  4ES1 A;  4YDD B;  4F7V A;  3GYX B;  2W2O P;  1OY6 A;  3OXF A;  2GV1 A;  4B9V A;  1YBT A;  2E66 A;  3CT9 A;  3GSI A;  1OPI A;  1NRK A;  2GAG C;  1NSP A;  4O44 B;  4X4O A;  4JI5 F;  5FDL B;  3VGS A;  2I6W A;  2B4U A;  4X64 J;  1XWL A;  5ETQ A;  1HNV A;  1FJ7 A;  2AYE A;  2PI4 A;  1G3O A;  4O0I A;  2IRY A;  5LMU J;  2DIV A;  1RU2 A;  3P5B P;  4JP8 A;  4DSI A;  1VGY A;  1KHV A;  3H4D A;  3MM9 A;  1RAC B;  1S9F A;  3VCD A;  2Z57 B;  1S1U B;  3OQ2 A;  1QUP A;  3GP9 A;  3IS9 B;  2WBR A;  4QOT A;  1FK9 A;  1O0P A;  4RUA A;  4B3S J;  1DQA A;  3KKF A;  4MAK A;  4USI A;  4DUZ J;  4NE9 C;  4ILM A;  1W26 A;  4RWW A;  4NLU A;  4QR2 A;  4ICL B;  1KON A;  3OR1 B;  2XYH B;  3IN5 A;  1T9W A;  3JQK A;  3I31 A;  2R8H A;  2B4V A;  3K0J A;  4YN3 B;  5CXT A;  2HND A;  2YNI B;  3LP0 A;  3D0H E;  3GE9 A;  1TV6 A;  3P4U B;  3KG4 A;  3QAU A;  1SVD A;  2YNG B;  1SI9 A;  3BPS P;  3SDE A;  4I4B A;  2W7P A;  1OO0 B;  4X4T A;  5A76 A;  3SYZ A;  4WU2 A;  2ASL A;  2LXF A;  3BQ1 A;  3BKT A;  2V8G A;  3CSK A;  2BW7 A;  2MMY A;  2E5H A;  3OPK A;  3HVT B;  2WHO A;  1UL3 A;  2JFK A;  5D3G B;  1K0V A;  4EO6 A;  3LTO A;  4WZM A;  2LQ5 A;  1TK0 A;  3TA2 A;  1FKO B;  4M5J A;  1N33 F;  2VKR A;  1S4E A;  3UDV A;  4ECW A;  2GGP B;  1WC5 A;  2JC1 A;  3MGJ A;  2RRA A;  5DZ6 A;  4FS2 A;  3O1L A;  1V6H A;  4KHR A;  4YOE A;  1V9O A;  1ICE B;  2ZBI A;  2W9A A;  2ZJQ Q;  1AUD A;  2QE5 A;  1NK9 A;  3A8J A;  2UUA J;  1FEH A;  2ZC4 A;  2A18 A;  4DV2 J;  3KLH A;  2QA2 A;  1OS5 A;  4DCO B;  4RNH A;  3ZZY A;  3FCV A;  2V69 A;  2RF2 A;  1KFS A;  4R25 A;  1VFJ A;  3QAT A;  2DO0 A;  4QZV B;  2YKM B;  2MQN A;  4HEA 9;  1PJ6 A;  5J2P B;  2AEM A;  4ZVH A;  2BEF A;  4ZCM A;  4ED5 A;  4PWW A;  5CYJ A;  3MFI A;  4CT9 A;  4R0E A;  3W8P A;  3H5X A;  4EGL A;  3I5C A;  4K4Z A;  2Y1L B;  4OX8 A;  1QM9 A;  3T5H A;  3WQP A;  3MCN A;  2HQI A;  1U6Z A;  4LVN P;  4ANC A;  2MZR A;  5DLF A;  1LFW A;  5B0D A;  4LFA F;  4PXE A;  3T1A A;  5I3P A;  4QU6 A;  1FRI A;  3UO0 A;  3PFE A;  2B4O A;  2V8D A;  1XN9 A;  2VOP A;  3ILJ A;  4ZVU B;  1TUV A;  1GXT A;  4B9U A;  5LOQ A;  2VPY B;  1EQM A;  3KK3 A;  4QJV A;  4X2B A;  1IM4 A;  5DDQ C;  4ZVT B;  2G0I A;  4OJ1 A;  1B0T A;  4M94 A;  2DR5 A;  5KFL A;  4PUO B;  1E6V B;  1JLB B;  4ZLL A;  3CXC R;  2V4J A;  2CA9 A;  2C1E B;  5F8L A;  3IAS 9;  5AXK A;  4YS2 A;  3GU0 A;  4DV0 F;  2YX4 A;  3AOC A;  4RNF A;  5CA5 A;  4M5G A;  3FFI A;  3WDO A;  4JI1 J;  2M70 A;  4LR7 A;  3RB6 A;  5ITH A;  1XEZ A;  5GVQ A;  2R7T A;  3M8R A;  2ZH9 A;  4B3R J;  1D3W A;  4G1I A;  4DQQ A;  2R4F A;  5KT4 A;  1UPP A;  2GX8 A;  3W66 A;  1O5J A;  1VS3 A;  1SJ3 P;  3EZO A;  1B70 B;  1H72 C;  1X4G A;  3TA0 A;  5HP1 B;  4EEY A;  5DQH A;  4KGK A;  1PBU A;  4MK9 A;  2DIU A;  4OZN A;  3VV2 B;  1QD1 A;  1NBE B;  5BYR A;  3ISN C;  3VAH A;  3T9N A;  1S49 A;  1TK8 A;  2AJF E;  1V5V A;  2FLN A;  1WOR A;  4HVZ A;  1WEL A;  4HLB A;  2DGU A;  1PC5 A;  4OYO A;  3RZA A;  3DYA A;  4K2J A;  2MQ8 A;  4LSN A;  1FER A;  7AT1 B;  5A8W A;  2DR7 A;  2CQ1 A;  5C2C A;  2Q66 A;  2R2S A;  4C2M A;  1S12 A;  5C24 B;  5E2Q A;  2CPJ A;  3T3F A;  3Q8S B;  3EGV A;  2PT0 A;  1V3S A;  2OPR B;  2XYG B;  3RB0 A;  1RT4 B;  3H2V E;  3MEE B;  2A3J A;  1BHN A;  4RW8 B;  2MQL A;  2H54 B;  1K8A T;  5DET A;  1IKX B;  2YH0 A;  4B08 A;  1H7W A;  4N41 A;  1MNE A;  3NGU A;  4QCL A;  1VQM S;  3X3U A;  2C2N A;  2DR6 A;  4HHJ A;  4LF2 A;  4L3K A;  3KJF B;  2DPI A;  2FIU A;  4DUT A;  1LW0 A;  4LRA A;  1CJU A;  1XQI A;  2W9C B;  1WOS A;  5K8P A;  2D3Z A;  4KH1 B;  5A6W A;  4RWX A;  1FJC A;  3GR1 A;  1S6P A;  1RZM A;  2LU2 A;  2FGO A;  1UZD A;  3ONQ A;  4NI2 B;  2RQC A;  2LU1 A;  3PX0 A;  4QWD A;  1Y9O A;  3SFU A;  2DJW A;  1T9U A;  4QPT A;  4NEY A;  1KNZ A;  4ERD A;  4FYW B;  3MPY A;  2ADB A;  2YNH B;  1AZS B;  4WFX A;  3TAM A;  4USW A;  4QR0 A;  2L9W A;  2BJ3 A;  1RLD A;  3UN2 A;  2D3U A;  1EHW A;  2E9T A;  2KYZ A;  4O23 A;  3ZTS A;  2VJU A;  1HHT P;  4EWT A;  1LK5 A;  3T19 A;  2EFQ A;  4B3M F;  5KFE A;  3JSY A;  2DIT A;  1NK8 A;  2DHX A;  4YB1 P;  3C15 A;  3PKY A;  5K14 B;  2RB7 A;  1UVI A;  2HG4 A;  2M88 A;  5KFQ A;  1UCN A;  5L9N A;  2BJ7 A;  3ZZT A;  4J9S A;  2CQI A;  1LWE A;  5KFG A;  5DQI A;  4M5I A;  1FNO A;  1Z2Z A;  1IVZ A;  3G8S A;  4QWA A;  3GIK A;  2YKA A;  5ETT A;  4K2X A;  2JJ4 D;  3LPY A;  1X0P A;  2Y8W A;  2VC1 A;  2ZWP A;  1UTA A;  3J7Y I;  3CD6 S;  4KH0 B;  3H4B A;  2AV5 A;  1FWP A;  3TJA A;  2M0G B;  3RGI A;  4RW4 A;  3FRY A;  4LF6 J;  3AOD A;  2QIF A;  3QGG A;  1HNZ J;  4GC6 A;  1PO6 A;  4OYB A;  1TFY A;  1WTF A;  2CZ9 A;  3Q8U A;  2FHJ D;  5D6G A;  4JB8 B;  1S1X B;  4B17 A;  2B5J A;  1QSY A;  2UVR A;  4X65 F;  2A2C A;  2P9G A;  3TNV A;  4EYH B;  4PQA A;  2J9C A;  3MUM P;  2V50 A;  2IJR A;  1FRK A;  1H2V Z;  4CLU A;  2ZFH A;  2I8E A;  4ZHR B;  2AF6 A;  2LYV A;  2M5Y A;  4ZVP B;  4DSF A;  2BAN A;  3OHB A;  3GZ7 A;  3Q89 A;  2Y1R I;  1T8E A;  1WHV A;  4DBQ A;  5H1S V;  3JB9 k;  2IFX A;  3RRH A;  1FEE A;  4CZC A;  5EHH A;  3IXQ A;  2DRA A;  2JZ5 A;  2DB1 A;  3GFH A;  4F2R A;  4X4P A;  2CDR B;  5B0F A;  3K89 A;  2VA2 A;  3RRG A;  2OMO A;  2P6T A;  1AYE A;  6AT1 B;  2NPI A;  5F8H A;  1PC4 A;  4ZCK A;  4N77 A;  4TQR A;  4M95 A;  2E44 A;  2DH8 A;  2GJ2 A;  4EBC A;  4ZJO A;  2FY1 A;  4RO0 A;  3NGD A;  4TN2 A;  4F0H A;  4P2F A;  4O44 A;  5FDL A;  5KFH A;  4PYA A;  1WHY A;  4M5N A;  2YNF B;  1SC1 B;  3ILO A;  4JI6 J;  3CO9 A;  1NKB A;  2WW8 A;  3HFV A;  2DNL A;  3HP6 A;  4GVL A;  3GIM A;  2SXL A;  2K7J A;  3HO1 A;  2KO1 A;  4U7U K;  4AL5 A;  5FJ4 A;  2DNQ A;  3W9I A;  3VWS A;  1S1U A;  3IS9 A;  3CO0 P;  4AXJ A;  2R42 A;  4Y2K A;  2EKY A;  5KFC A;  4O3O A;  3L09 A;  8AT1 B;  3NS6 A;  4CO0 A;  1S0N A;  4ICL A;  3I32 A;  4F4W A;  2AEF A;  5CCL A;  3OR1 A;  2Q3P A;  1FRM A;  3BR9 A;  3SCK E;  2HPU A;  3P49 B;  3SI8 A;  4ZVR B;  2YNI A;  3N01 A;  4DQR A;  2C2K B;  5LT5 A;  2D69 A;  1KTQ A;  1NJI T;  2MST A;  2YNG A;  3PRB A;  3UN5 A;  3QRR A;  1SH3 A;  5C7P A;  3HX9 A;  2HNY B;  1GX6 A;  2AD9 A;  2F8H A;  4K50 A;  1O51 A;  4LBH A;  2ZOF A;  3ZXW A;  1RWO B;  3A13 A;  3BS9 A;  4K4S A;  1SKR A;  3HVT A;  1F9E B;  5D3G A;  4NXM F;  3Q22 A;  3KHR A;  2P5V A;  4WXO A;  1AUS L;  2ZH7 A;  2HHU A;  1FKO A;  3B82 A;  3RBZ A;  4FVC A;  1UZH A;  3RAM A;  4J9Q A;  1TFW A;  4ES2 A;  2GGP A;  1TVR B;  3ZO7 A;  1N48 A;  3FGV A;  3HVA A;  4CO2 A;  1EAR A;  4MKA A;  5KAK A;  4UTG A;  4RR5 A;  4P71 A;  2XEX A;  3FK4 A;  1N6Q B;  4DR3 J;  4I64 A;  2XTJ P;  5KG5 A;  2WTF A;  3T41 A;  1WOP A;  2BE7 D;  3B4M A;  2XS5 A;  4PG8 A;  5CHC B;  4KHP F;  3N28 A;  4EK2 A;  1LXN A;  2C3Y A;  1T9T A;  2NXN A;  4DEZ A;  1PSD A;  2HIQ A;  4DDF A;  4OYW A;  2ZZM A;  2YKM A;  2L48 A;  3AH6 A;  2GIQ A;  3MM8 B;  5J2P A;  4Y2M A;  4RW7 B;  3PXG a;  4OI4 A;  4DV1 F;  1F5C A;  3S7R A;  5F0U A;  2Y9H A;  4DX5 A;  1F2G A;  2JVR A;  3C6U B;  4WKR A;  2DHG A;  5L8R C;  4IFY B;  2Z2Y B;  4OX7 A;  2QO3 A;  3R2D J;  2LFV A;  1C0U B;  1QJH A;  2XHC A;  1P9Y A;  1UVJ A;  2O67 A;  1UFW A;  2W24 A;  1WOO A;  2RDI A;  3OW2 R;  4MKV A;  3NXZ A;  3TO8 A;  4ZIW A;  2VU5 A;  3KTQ A;  5E3A A;  3T5L A;  2NR0 A;  5KT3 A;  2YTC A;  2XB2 D;  4IOC Q;  3IR5 B;  2IBK A;  2MHE A;  2MKH A;  1SPB P;  4KSE B;  1JLC B;  1J27 A;  4CP5 A;  4PUO A;  1E6V A;  3MCM A;  1JLB A;  1U49 A;  4HAC B;  4ZP8 A;  5AE3 A;  1J5E F;  4WTY A;  1HNZ F;  2WVD A;  5HL7 Q;  4E0D A;  2QL5 B;  1RAE B;  5LL6 d;  1D8Y A;  4LRE A;  5D8H B;  1FRJ A;  2RML A;  3M1V B;  4FF4 A;  3SXL A;  3F0N A;  3J80 U;  3K8V A;  3PJW A;  2Q6C A;  3OXL A;  1WC4 A;  3R5B A;  1FX4 A;  2M7S A;  4NOH A;  2UXC F;  3VZH A;  2DKO B;  2PC6 A;  4OZ3 A;  4K0K F;  5DG7 A;  1JXE A;  5HP1 A;  2W2M P;  2CQB A;  3GB0 A;  2HMI B;  2BE9 B;  2BOA A;  2V63 A;  6FDR A;  3U27 A;  3F44 A;  1M5P C;  4J9P A;  5D4L A;  2PMW A;  3ENV A;  3PW0 A;  3IWX A;  3NBP B;  5FLX Y;  2EVZ A;  5K5M A;  2ZOG A;  4ED2 A;  1GK8 A;  4F4A A;  2WAQ D;  4IH7 A;  5C24 A;  3TQE A;  1XMO F;  1H6K X;  4CLP A;  1U24 A;  2OPR A;  5KFI A;  1RT4 A;  2NS1 B;  3DGV A;  3MEE A;  4YR2 A;  3NMA A;  4RW8 A;  3HXM A;  5DDO C;  3I0R B;  1IKX A;  4L73 A;  1WDT A;  2IVF B;  2VFR A;  3EUN A;  2JSX A;  1VIS A;  4DV5 J;  4YB5 A;  4OX9 F;  2FC9 A;  1WG5 A;  3SV4 A;  1KKH A;  2XMJ A;  2L9N A;  1X7V A;  2W9C A;  4NLD A;  3TZZ A;  2V4Q A;  1FF2 A;  5HRO B;  1DAX A;  3HVW A;  1OQ6 A;  2JLF A;  2D7S A;  3K58 A;  1XNR F;  2KRR A;  4ID8 A;  4W98 A;  1RHJ B;  3AHP A;  3LA0 A;  4NI2 A;  4YY3 J;  1OMS A;  1FO1 A;  1GAO A;  3QT7 A;  3CJ8 A;  3LO3 A;  1LW2 B;  2X3D A;  2KFZ A;  2MEW A;  2BA9 A;  4MJK A;  3M8S A;  2YNH A;  1AZS A;  3AB2 B;  3KG0 A;  4K4Y A;  3AOB A;  5CQG A;  2VBZ A;  2W2Q P;  3MMJ A;  4LFB J;  2K3K A;  3OSN A;  2DVI A;  2HFS A;  2HNZ B;  4OHY A;  4J90 A;  2J8A A;  1T0T V;  2XG8 A;  3CIZ A;  1OJ4 A;  5K14 A;  4C8L A;  3K17 A;  2JEJ A;  4U67 Q;  3G9C A;  2AJQ A;  3U1M A;  4C6A A;  1U1R A;  3M6U A;  2MPU A;  4DR7 F;  5AXL A;  4OI3 A;  4EZ6 A;  3GJT B;  3QWP A;  1MMD A;  1TMJ A;  4U96 A;  4JI8 F;  2DXF A;  1KQG B;  5ETO A;  4B02 A;  2BRK A;  2CFX A;  2ASD A;  2BQR A;  1YJT A;  2OSQ A;  1QVG R;  3F73 A;  4RW6 B;  2JDJ A;  1VRU B;  3MUV P;  2K06 A;  2XMK A;  4RX6 A;  2K3I A;  1HLW A;  4G3I A;  4OHX A;  3R6G B;  2HHH J;  1G1X A;  1S48 A;  4J9M A;  1IBM J;  4P2X A;  2JHE A;  2XLI A;  3RR7 A;  2RDD A;  5D4O A;  3O5T B;  3BBC A;  2BZ2 A;  1CVJ A;  2PFF B;  4DR6 F;  2KKH A;  1MW7 A;  2BOP A;  4GRS A;  1VQ9 S;  2ZOM A;  3ZZR A;  1S1X A;  2W9B B;  3Q86 A;  1HMV B;  3PG9 A;  1RWM B;  2DGO A;  2UZA A;  2FY8 A;  4JV0 A;  1SUQ B;  4C0O C;  5HK4 A;  2PO4 A;  4EBE A;  2GIF A;  4NA3 A;  5D0G A;  2YWE A;  1UAW A;  1XR6 A;  4ZHR A;  4FZV A;  4F67 A;  2ASY A;  1CQN A;  1FX2 A;  4KQZ A;  3IWN C;  1XJW B;  3BH7 B;  1R8P A;  3POT B;  2ZH4 A;  5HJY A;  2C2O B;  1YDL A;  5F3Z A;  4V19 J;  4N76 A;  5IV4 A;  1VDH A;  2HGN A;  1X5O A;  5IC4 B;  3FCW A;  3Q8P B;  2UUW A;  4BHQ A;  1DFD A;  4IH5 A;  3SSR A;  4R5P B;  2GJI A;  4OJ3 A;  3GJS B;  4A4J A;  1EB0 A;  1MRO B;  4IRK A;  2XSJ B;  5J1P A;  4IR9 A;  4KO0 B;  4GKJ J;  1NO8 A;  2B3T B;  2ZH3 A;  3D7S B;  5KFP A;  5ETK A;  2W2P P;  1U7L A;  2GMJ A;  1LEO A;  3OTD A;  2XY6 A;  4LF9 F;  3EDR B;  3KG1 A;  4X66 F;  2KM8 B;  3TZY A;  1YIT S;  5K20 B;  2YNF A;  3IFE A;  3IRX B;  2QGF B;  4DFJ A;  2MXY A;  1R27 B;  4DS4 A;  2R7U A;  2ZVI A;  1UFL A;  3D9B A;  1FE0 A;  2DIS A;  3HFK A;  2KH9 A;  2MZQ A;  3FEY B;  3DN9 A;  4FF3 A;  3O3L A;  1ZOT A;  1RKI A;  1NK4 A;  3NNH A;  2VOD A;  4PG6 A;  4ZVF A;  2RAQ A;  5KFN A;  2ZBC A;  2GAH C;  2MTL A;  4WCE Q;  4N56 A;  1C0T B;  3OXG A;  1WUU A;  2GVZ B;  3HHL C;  3TR5 A;  4QR1 A;  4CNY A;  3NNC A;  2V8P A;  2HW3 A;  4DPW A;  5A2Q U;  2C42 A;  2MZJ A;  2U2F A;  3TUP A;  2YKO A;  4NCB A;  4N8O A;  1U8W A;  2HUR A;  1ZAV A;  1LOU A;  4DS5 A;  2AJ0 A;  3CIM A;  3ELH A;  4J9L A;  3CC4 S;  1B7Y B;  4P73 A;  2HNY A;  1YZ6 A;  4NLR A;  4WE1 B;  1X4D A;  5E3Q A;  3HT3 A;  1RU1 A;  1X4C A;  2GQ2 A;  4ZPC A;  3C46 A;  3Q8Q B;  4DQP A;  5KFK A;  2V34 A;  3WIU A;  3TP2 A;  3TVY A;  3GFX A;  3M6X A;  1EP4 B;  1OYE A;  2PII A;  1X0F A;  1DAR A;  5E5N A;  1KD1 T;  5A6P A;  3H5Y A;  2WB1 D;  4YQW A;  4Q2L A;  2WBM A;  5JJB A;  1EQ0 A;  2Y0S D;  1HHQ A;  3JTP A;  3FVY A;  1IBL J;  2RKI B;  2OPS B;  3NLC A;  3IRW P;  1TVR A;  3AJD A;  3IGN A;  4ZMM A;  1Y3J A;  2DEI A;  2G1H A;  4L76 A;  3TW0 A;  1N6Q A;  2FJD B;  5KFA A;  2GZO A;  4C3M A;  1HR0 F;  4IG3 B;  5KOW A;  2F65 A;  1RAD B;  3M6V A;  4DV3 J;  1OYD A;  3Q8R B;  3V2U C;  3BKF A;  3LF0 A;  4B3T J;  2YQ1 A;  3R7B B;  1ZTW A;  3V6K A;  3IBF B;  5T14 A;  1CJK B;  4EFA C;  4YY3 F;  3MM8 A;  2UXB J;  2BUN A;  5KG0 A;  2KHD A;  3TAR A;  4RW7 A;  3MXH P;  5I3U B;  4K4U A;  4BS2 A;  3VF0 B;  3THT A;  2QSW A;  2KXF A;  2CPI A;  4JV5 F;  1RIS A;  3A8K A;  3C6U A;  5FD1 A;  5J2M B;  4UOF A;  4DCP B;  3QBC A;  2AIR B;  5ETL A;  1YZ7 A;  4DFK A;  2O5D A;  4WF9 Q;  4IFY A;  2JH3 A;  1EKS A;  2Z2Z A;  2YQ0 A;  4CLS A;  2MKC A;  1C0U A;  3W8G A;  4I6A A;  4NLT A;  3FDS A;  2O3D A;  2B51 A;  3AT1 B;  2J6T A;  5H9E K;  3AD7 C;  3QZ8 A;  5DZ7 A;  2D3O R;  4HL9 A;  2B9E A;  2CPD A;  5K9F A;  5B0E A;  2Q43 A;  2OD4 A;  3UFC X;  3DRY A;  4DR2 F;  3KDN A;  4FKY A;  5L1L A;  4CT8 A;  2BXJ A;  3G82 B;  1PG5 B;  2ZH6 A;  3H0P A;  5GAH U;  3CDW A;  4C8Z A;  2DPJ A;  2E5I A;  3O44 A;  2KG1 A;  5IOL A;  3RBX A;  2HYI B;  3QSI A;  3A8E A;  1JLC A;  1U25 A;  3WC0 A;  2CQP A;  1GMV A;  4HAC A;  3PY8 A;  5C5J A;  2D9P A;  5JVH Q;  3S8S A;  3UNG C;  1YJU A;  1VQ7 S;  3M30 B;  1S10 A;  3FBE A;  3IR7 B;  1FA0 A;  1G2E A;  1FES A;  1WEZ A;  1FKA F;  1X8D A;  1LWC B;  3G4S S;  5BR8 F;  2W8L A;  2RIL A;  2CPZ A;  3MF5 A;  3ZTO A;  3QJP A;  3IR6 B;  5ETS A;  1Q16 B;  1F9H A;  1FNM A;  3W64 A;  3I9V 9;  3PRV A;  4PQU B;  5KG2 A;  4ENO A;  2ZC3 A;  2PEB A;  4S0M A;  2FYX A;  2DNZ A;  4FYV B;  1S1W B;  4QWB A;  4BCA A;  3BJY A;  3N9U C;  4G1P A;  2JFD A;  2HMI A;  3PHE A;  3V6J A;  2HWI A;  3R8Y A;  1RTZ A;  4QYZ J;  2DNY A;  3T5K A;  4GKJ F;  1HWU A;  3M8Y A;  3NBP A;  3BGU A;  1NK6 A;  1YBU A;  4LRF A;  4KYZ A;  3MTK A;  1IBC B;  1WC1 A;  3PX6 A;  3H25 A;  2Y3Y A;  1VC5 A;  3BGR B;  3BGL A;  2H65 B;  2VIC A;  2LDI A;  1UEU A;  2WCX A;  4C4W A;  5DG8 A;  1Q95 G;  2RH3 A;  1D9A A;  3GJQ B;  1DY3 A;  5EWG A;  1HNX F;  4WK1 A;  2DY1 A;  1LNQ A;  2EI5 A;  4ZPW R;  2N82 B;  3I0R A;  2AW0 A;  2QC3 A;  4OZ5 A;  3UVJ B;  3GPA A;  3EE3 A;  1EX8 A;  4L72 B;  5KFF A;  2J8S A;  5B0A A;  1W2B R;  3BB5 A;  3GYN A;  4KPC A;  1QAI A;  3GFZ A;  1SH2 A;  3JAM U;  1G7C B;  4ZOS A;  1MLA A;  2B9W A;  4EBD A;  4YDX A;  3D1Q A;  1SL0 A;  5HMY A;  3A3P B;  3M2U B;  1QTN B;  4RBT A;  3CUL A;  3NAI A;  2VG5 B;  5HRO A;  4DX7 A;  1RCO B;  2KYX A;  4C48 A;  2FTR A;  1SQF A;  1L3K A;  1X31 C;  5HAT A;  1PAE X;  3L7O A;  1M1K T;  1U6B A;  3CMA S;  1IBK J;  1S7I A;  1WEY A;  1YJ9 S;  4CCH A;  1LKZ A;  1LW2 A;  1FI4 A;  3MD1 A;  4QPX A;  4LSZ B;  1SKU B;  5F41 A;  2VQF F;  5AJ3 F;  4JUZ A;  3NEK A;  1I94 F;  1ZZN A;  3M8P B;  5LM7 E;  3FQK A;  3PYE A;  1VQY A;  3K57 A;  3BH6 B;  2G2O A;  2VD3 A;  5MLC V;  1NUE A;  2IDL A;  2J0Q D;  2QX0 A;  4C98 A;  5GAD U;  2HNZ A;  1VHF A;  3FSI A;  1JWW A;  2QL7 B;  1S7H A;  4IUF A;  2B9Y A;  2E5L J;  3ZTQ A;  3D3C J;  4DF8 A;  4IOB A;  1R8B A;  5IT9 U;  4RU9 A;  2PGC A;  5CZV A;  3PVX A;  5LMN J;  1VLO A;  3DLB A;  4RBU A;  2J7W A;  4FBT A;  4C7Q A;  1ZAW A;  3MFH A;  1M0S A;  1U26 A;  1M5O C;  4CM2 A;  2CXE A;  3Q24 A;  3EGN A;  4KT0 C;  2XMV A;  1ZZF A;  1SJF A;  2UU9 J;  4DR1 F;  1HW8 A;  2GCF A;  4RW6 A;  4F36 A;  2CUY A;  1VRU A;  2NSB A;  3QFW A;  1T03 B;  2D3O 1;  4UUX A;  4URQ U;  3T1Y F;  4JI0 F;  1NHU A;  2QN6 B;  2DT9 A;  3GMG A;  2WK4 A;  5IC6 B;  4PCQ A;  3BF4 A;  2F4F A;  1WWH A;  4YB7 A;  3C3L A;  3B78 A;  5HVG A;  1MWY A;  4NA2 A;  2W9B A;  2MKI A;  3BGF A;  1HMV A;  3BR8 A;  3IBC B;  1PAU B;  2J76 E;  3QJJ A;  4QIV A;  1K9M T;  4OYZ A;  2GS8 A;  4IOA Q;  2CQ0 A;  1SUQ A;  1UA1 A;  4HYK A;  1ITP A;  1CJT B;  2X1G A;  4DL2 A;  5CAA A;  2R7O A;  1DBD A;  1TL7 B;  4ZLN A;  2LEB A;  1S1T B;  3POT A;  4NX9 A;  3DM2 B;  2DGW A;  2XZW A;  3HM9 A;  3D66 A;  1U4B A;  2FLP A;  2CNK B;  2WSC C;  3CUN A;  1APS A;  2KJV A;  3MTJ A;  4F4Y A;  4R5P A;  2MSS A;  2BQU A;  4DU8 A;  2DGT A;  3D5M A;  4L75 A;  1MRO A;  1R0B G;  4AQY F;  1XNQ J;  2HQ3 A;  2XSJ A;  3G86 A;  1BUX A;  4KO0 A;  4IDK B;  1HW9 A;  1RJJ A;  3L7U A;  4TQS A;  4XAK A;  3EGZ A;  1IKV B;  3QT6 A;  2XLJ A;  3TYT A;  3KMQ A;  2XMT A;  2IIH A;  2FB0 A;  1FDD A;  1DQ9 A;  3JSR A;  2PA8 D;  5L46 A;  2XMW A;  2OTJ S;  3A4T A;  3IRX A;  5HMW A;  2H4W B;  1HD0 A;  2ZH8 A;  4QBU A;  2DRD A;  3KXD A;  4DN9 A;  2W8K A;  2BJ8 A;  4MFB B;  1RWW B;  4HDH A;  4KFB B;  2BVZ A;  1NKC A;  1KFD A;  1VLY A;  4P2S A;  2ZKU A;  2LEA A;  4FVM A;  3T6J A;  2VFU A;  1XMQ J;  1HA1 A;  1MG7 A;  3OFF A;  3I0S B;  2CQC A;  1C0T A;  2VQE F;  4FNH A;  5A8K B;  4P10 A;  4PEO A;  2GVZ A;  2V2Q A;  5KFS A;  2HQF A;  3RB4 A;  3ZTP A;  2ZM6 F;  4H4M B;  3DGP B;  4DV7 F;  3HJF A;  2X7I A;  1FKP B;  2XSF A;  3MMB B;  3DHX A;  3HHD A;  5D78 A;  2JWN A;  1TK5 A;  2CAD A;  2D41 A;  3MZI A;  3MWB A;  2QL9 B;  1RT5 B;  4GKK F;  5HLF B;  1KQK A;  1SL1 A;  1K0T A;  2V9K A;  1KOO A;  4F3O A;  4WE1 A;  3J80 Y;  3R6L B;  4UT4 A;  1RAA B;  2QG9 B;  2DH7 A;  4PAB A;  3CCT A;  1EP4 A;  1S57 A;  1B3T A;  4Z37 A;  2OPQ B;  1A9N B;  1KHW A;  5EX0 A;  2KXH A;  4ED0 A;  4U8V A;  1VK3 A;  5DLG A;  2RKI A;  4H54 A;  2OPS A;  1OWX A;  2CJA A;  2LQJ A;  3QFH A;  2XO6 A;  1HL6 A;  3UDC A;  5GAG I;  2CWX A;  1X60 A;  4WZQ A;  4DHV A;  1FWK A;  4JYA J;  2FD2 A;  1ZET A;  3MHY A;  1N4L A;  4GO5 X;  1U1Q A;  1HWK A;  2HQG A;  1HYS B;  2ERR A;  3SCI E;  5IV3 A;  4IG3 A;  2ZUG A;  1JXV A;  5KFT A;  4J9U E;  2HLT A;  2F3J A;  4IFV B;  2R8G A;  1RWU A;  2JL9 A;  1F5B A;  4DV4 F;  3KJV B;  2ALY B;  5D4N A;  1NDL A;  3FBF A;  2OP5 A;  3OFG A;  4BBY A;  4DPX A;  8ATC B;  2NUH A;  1TL1 B;  2DO4 A;  1DTQ A;  5F8J A;  2AZ3 A;  4U6P A;  1XK8 A;  1CJK A;  4ZP7 A;  1J5O B;  1R31 A;  4LRD A;  3MOJ B;  3GIL A;  4BC7 A;  3AQP A;  2V9W A;  1VYA A;  2CKW A;  3PFO A;  3DDI A;  3KK1 B;  2UUB J;  5I3U A;  3EJM A;  1ACM B;  1VRT B;  4DSK A;  3G6Y A;  1IJF B;  3SEO A;  4C3K A;  3HKW A;  3PW7 A;  3VQS A;  2IMW P;  3CCM S;  2XC9 A;  3GV5 B;  5J2M A;  1VIO A;  4UY8 T;  4X62 J;  2MZ1 A;  3SQO P;  2Z58 B;  3R5C A;  4LFC F;  1T9V A;  4RPF A;  2HFU A;  2CJB A;  2G4B A;  1X9S A;  4JV1 A;  4CLK A;  1GNK A;  4DL4 A;  4YR0 A;  2RSQ A;  3R3T A;  4LF5 J;  4LT6 A;  4M1K A;  3UR0 A;  1HQU B;  3FQL A;  5D15 A;  3LH2 S;  4OV6 A;  2R8I A;  1AB8 A;  5FII A;  4NCG B;  2OSR A;  1TKT B;  1UVN A;  4OZJ A;  4ED7 A;  1EKR A;  2OLW A;  3A3N B;  4TY9 A;  3G82 A;  2OAU A;  2P2C B;  4JI2 J;  5F9L A;  2UU9 F;  1T02 A;  1NH7 A;  3CC2 S;  3DXS X;  2FJE B;  2DNM A;  3VGT A;  4NZ7 A;  2NPF A;  1RTH B;  2XZT B;  1GTH A;  2ZEJ A;  5M2R A;  3EZU A;  3DOK B;  2AJ2 A;  5HBM B;  4DQS A;  3M30 A;  1VQ6 S;  1YX2 A;  3PEJ A;  1T94 A;  3M9N B;  1WKK A;  3PYD A;  1LWC A;  4AYB D;  3M32 B;  4LIR A;  3ISN D;  5J1E B;  1R43 A;  1RT7 B;  2NRE A;  2XQC A;  3Q0A A;  1Q8L A;  3VQT A;  1SV5 B;  1VQO S;  1QAX A;  3FSY A;  2VA3 A;  4PQU A;  4OI2 A;  2HS0 A;  4NXN F;  1H73 A;  1UW9 A;  3UDL A;  4YP3 A;  2GQC A;  4Q8F A;  2VFT A;  1S1W A;  3KWM A;  4JBC A;  2VH7 A;  3I4P A;  3HCX A;  4MTP A;  4OYA A;  1GH8 A;  5D4P A;  4JI7 J;  1M1H A;  1AA1 B;  4DV6 F;  3H90 A;  3HSJ A;  1XNQ F;  2GML A;  4B3O B;  1RHM B;  3VAG A;  2WOM B;  1X9W A;  2V5H G;  5T7L B;  1YG0 A;  1KBR A;  3HHE A;  3ENQ A;  2HGL A;  2MQQ A;  1VQS A;  3BGR A;  2XMA A;  1UEK A;  1CBK A;  4LUB A;  2HHV A;  4DUY J;  3HSG A;  1K44 A;  4MYU A;  1M5H A;  2R8J A;  3IO1 A;  3UVJ A;  1TKZ B;  3PW4 A;  4NLY A;  1YK9 A;  5KG3 A;  3J81 j;  2AKW B;  3HDS A;  3GII A;  5IFM A;  3NRB A;  4F50 A;  2CJY B;  3AFG A;  4W90 B;  2OIH A;  2V2K A;  1L3S A;  4DG1 B;  4TVA B;  2GO9 A;  2DY9 A;  5L38 A;  4CO4 A;  2OFG X;  3NGT A;  3M2U A;  4ZN3 A;  1EET B;  2VG5 A;  1FHT A;  3OVS A;  2HLU A;  2QMX A;  5K8M A;  2AU0 A;  3I56 S;  4WK3 A;  1Y11 A;  2WB4 A;  2EWH A;  5IT0 A;  1UVL A;  1GT8 A;  3I87 A;  3OJU A;  1IR1 A;  2BAC A;  5M2U A;  2KN4 A;  4NZ0 A;  2AQ4 A;  2CQG A;  3UW1 A;  4U9R A;  3M8P A;  4F4X A;  3DOL B;  4QIF A;  2MKS A;  1S9E B;  2XI3 A;  2V2Z A;  1P27 B;  1X5P A;  1L3U A;  2AWZ A;  5A2Q Y;  1ZAX A;  1N8R T;  3O6Q A;  4EI2 A;  3MEC B;  4WFY A;  3R5J B;  2XWX A;  4DOZ A;  2IM3 A;  2NYI A;  1R6Y A;  2JX2 A;  4PWU A;  1ROF A;  3FZ2 A;  2VIH A;  4LF4 F;  3U7J A;  1YBA A;  4ILL A;  4A8S A;  1RWP B;  4DSJ A;  3HMJ G;  1HNI B;  2W4D A;  4KGV B;  4CTA B;  2HEK A;  2ABY A;  3QID A;  4ECS A;  1K47 A;  1T03 A;  4V19 X;  1DLO B;  4OHZ A;  1NME B;  2DK2 A;  2PEH A;  3ZZZ A;  4KY3 A;  2XY7 A;  2BDP A;  3PCO B;  2HWH A;  3E2E A;  4KRW A;  3NY0 A;  2AX1 A;  3GLJ A;  4M63 A;  2W4P A;  4ILR A;  4CO3 A;  2FZG B;  4CLY A;  3MEK A;  1YLX A;  4GC7 A;  3VGU A;  1CJT A;  1DTT B;  1LFP A;  4CLW A;  1JX4 A;  4AL7 A;  2I38 A;  2W25 A;  1TL7 A;  3T1H F;  3GFY A;  1S1T A;  2C2Z B;  2UUB F;  6FD1 A;  2H9Z A;  3DM2 A;  4LVO P;  4ANE A;  3PV8 A;  4NCA A;  2XUL A;  3OVA A;  4JV2 A;  1AT1 B;  1Y4Z B;  1NDP A;  3NOG A;  2IVM A;  4DI6 A;  3ZNU A;  1GXL A;  3THP A;  5EGY A;  4F2S A;  3Q83 A;  3R5G A;  1VJW A;  1K1S A;  4K4V A;  2X51 A;  2A6O A;  5KFB A;  3KHG A;  3MCO A;  1MU2 B;  4IDK A;  1F3V A;  3M7V A;  3CCW A;  2C2E A;  1IKV A;  2LQB A;  1EZZ B;  4NRT A;  2PDA A;  4OJG A;  4UY8 5;  3CD0 A;  2I1R A;  1R3N A;  4CLL A;  1FRX A;  3NWR A;  2HHW A;  1YRX A;  1F9F A;  3J7A N;  3F56 A;  4DPO A;  1FRL A;  4PXD A;  5DRK A;  1MN9 A;  4RZR A;  2Z4P A;  3DXB A;  2YWF A;  4MFB A;  4CLZ A;  4DZD A;  5K8N A;  3MCS A;  4KFB A;  1B64 A;  4A8Y A;  2UXD J;  2BR0 A;  1T05 B;  1BQM B;  1M5V C;  2DCL A;  1NM2 A;  1HD1 A;  4A48 A;  2CNN B;  2M8H A;  3NS7 B;  3QWU A;  1RAO A;  3H2U B;  4C8N A;  3R5A A;  3I0S A;  2JEF A;  4ZA1 A;  3BN4 A;  4MKB A;  5A8K A;  3EPI A;  3QJL A;  3N4W A;  5KFV A;  1U2R A;  2EW9 A;  4A8K A;  4H4M A;  3UPF A;  1CG2 A;  3DGP A;  4DL3 A;  1BQN B;  1Y10 A;  1FKP A;  3IAM 9;  1Z2L A;  4ETZ A;  3MMB A;  3OBI A;  2V6A A;  2MHN A;  1U02 A;  3PDN A;  3DLH A;  3THV A;  5IQ6 A;  3OVB A;  3QRP A;  1U2C A;  2BJ9 A;  2FUG 9;  4UZB A;  1RT5 A;  5HLF A;  1CEZ A;  2GIR A;  3FMB A;  2NXU A;  3EX7 B;  3KLI B;  4A8O A;  4LF8 J;  3HD2 A;  3MM5 B;  1N56 A;  3CCR S;  2FPH X;  1K1Q A;  3MR5 A;  3UD5 A;  3VTI A;  4PYD A;  4P7V A;  2YXL A;  5GME A;  2ZUA A;  2OPQ A;  4A8M P;  2RDJ A;  1UVK A;  3CME S;  5D0E A;  3M8Z A;  2HBY B;  3LP1 B;  5HVH A;  3UNY A;  3SFG A;  1N32 F;  4F3M A;  4WP8 A;  2DR8 A;  2CPE A;  3Q2T C;  4TLQ A;  2KVQ E;  5GAG U;  2HHT A;  1R0C B;  2VKZ G;  3DLG B;  4XTT A;  2C3P A;  2NQP A;  2HZA A;  3BSN A;  1HYS A;  2YWG A;  1K73 T;  2JEG A;  3G71 S;  4EMD A;  3R1H A;  1ZM2 A;  2BRL A;  3JTN A;  4IFV A;  3V5R A;  1AFJ A;  1URN A;  3TJ9 A;  3KJV A;  2IYG A;  1FTC A;  2CQ4 A;  3TA1 A;  4AUK A;  2K2P A;  1Q0N A;  1TL1 A;  1SQE A;  1NPP A;  1ZPW X;  4R0J A;  2HWT A;  1VJQ A;  3JAM Y;  1J5O A;  2CNO B;  4A8Q A;  3FCH A;  5F3T A;  5IWA F;  3UCZ P;  1ELO A;  2CJX B;  1S0O A;  4EYI B;  1NDC A;  1VRT A;  1KN6 A;  2EFV A;  2CJQ A;  3QO9 B;  2BM1 A;  4HTI A;  1Q8B A;  4PPZ A;  1WSV A;  2Y1I A;  1HNW J;  3TRG A;  4K8R A;  3AXM A;  3FRZ A;  4XPE A;  2YBV A;  2OPP B;  3PYG A;  2POK A;  2NLW A;  2W7O A;  2ZBR A;  3J81 U;  2J7K A;  3OTO J;  3MI7 X;  1Y7P A;  2MJN A;  3R2C J;  3NAH A;  1SC6 A;  2B8P A;  1SJ1 A;  3QQC D;  2BV3 A;  1HQU A;  1NK0 A;  4X64 F;  4AD6 A;  3ET6 B;  3GQC A;  4DR4 J;  4NCG A;  1ULR A;  5LMU F;  3CPW R;  1TKT A;  4LRC A;  2R2T A;  5H9F K;  1S6Q B;  1JKH B;  4AT1 B;  5DG9 A;  2VG6 B;  3T9Z A;  3VVU A;  3MM7 B;  1A7G E;  3ETM A;  3OSP A;  5IT9 Y;  3CE8 A;  3IP0 A;  4ETX A;  2FVP A;  1RK8 A;  3KDO A;  4NLG A;  3NNA A;  4I2P B;  3RG6 A;  1RTH A;  1N36 J;  3CW2 C;  4U7U D;  2HBQ B;  4DR5 J;  5SUH A;  1VRQ C;  4B3S F;  3DOK A;  1NK5 A;  5HBM A;  2F4V J;  4DUZ F;  5C42 B;  1CUL B;  1ZS6 A;  3JYT B;  3K2Y A;  2JLE A;  1TP7 A;  1S4F A;  5KFJ A;  2XGQ A;  3M32 A;  1XBW A;  1QSS A;  5J1E A;  1RT7 A;  2FJW A;  2UUT A;  4IRC A;  1SV5 A;  4WFN Q;  3MPW A;  3CC7 S;  3GTY X;  2L3M A;  1PYT A;  2DH9 A;  2R7S A;  3MEG B;  3W65 A;  1UWA A;  3SIP B;  3Q8Y A;  4TKT A;  1NJX A;  2DBB A;  3K5O A;  3EVW A;  1T3O A;  3QGP A;  1NCL A;  3I96 A;  2XLK A;  4TYB A;  5KFD A;  3H8Y A;  3DRX A;  2H3E B;  1NAQ A;  3BO3 A;  4NA1 A;  5KT7 A;  4M5L A;  3RBE A;  1NPR A;  2OUG A;  3NGK A;  4B3O A;  3BN7 A;  2WOM A;  3O8W A;  5T7L A;  3DU6 A;  2CVE A;  2AHO B;  1DZ5 A;  3SZ2 A;  2H1Y A;  2OJ3 A;  3G6V A;  3FBC A;  3UE2 A;  4I7F B;  4CH0 S;  3D2W A;  3TZX A;  4LQ3 A;  3PAC A;  2DRB A;  2OFH X;  2XHW A;  2MQO A;  2MY8 A;  2A2D A;  1U48 A;  4ZPB A;  2RIJ A;  5B0C A;  2XMM A;  4F4K A;  4QWE A;  3E01 B;  1TKZ A;  2IA6 A;  1WNE A;  4ZN1 A;  3KHL A;  2E29 A;  3FC9 A;  3TAN A;  4LSL B;  1TL5 A;  3PW2 A;  2UUA F;  4RJV A;  3G8T A;  3H98 A;  3HZG A;  4DV2 F;  4DG1 A;  2NSC A;  1YKW A;  4IO1 A;  1CQM A;  3D0G E;  2Z0G A;  3C14 B;  1U09 A;  2LEP A;  3IA0 A;  4Q45 A;  4GO7 X;  4JI5 J;  2PI5 A;  4OZ1 A;  1JB0 C;  1EET A;  2IJF A;  3JQJ A;  2HSE B;  2X1B A;  2D9O A;  3KUG A;  3LOU A;  3KLE B;  1JJ2 R;  5HI7 A;  1KVJ A;  4YHH J;  3LGN A;  4NRU A;  5ETN A;  3TAQ A;  2OI2 A;  4OFZ A;  2G1D A;  5E41 A;  3RW6 A;  3MR3 A;  2AMC B;  4WP9 A;  3HHN B;  3M4X A;  2VB6 A;  4KBI A;  2K1R B;  3BV8 A;  2LKZ A;  2DTJ A;  4ZIT A;  1NB7 A;  2YY3 A;  2ZHO A;  4DLG A;  3OTB A;  1CLF A;  4CQ1 A;  2KB2 A;  3DOL A;  5HMZ A;  3I5B A;  4Z7Y A;  1S9E A;  1V3Z A;  3VAF A;  2QFI A;  5KG7 A;  3PEH A;  2DGX A;  3GYG A;  1VBY A;  2XMU A;  1HBU B;  5MAO A;  3MEC A;  2AT1 B;  3DC2 A;  5LXR A;  2WW4 A;  2YPZ A;  2HQC A;  2C22 A;  2MY7 A;  4PPD A;  2G13 A;  1RT3 B;  3TVK A;  5HO4 A;  3CCL S;  4OZL A;  4RUC A;  5L1J A;  3K59 A;  1HNI A;  3PKM A;  1YTY A;  4CTA A;  1FDB A;  4K7Q A;  3QYY A;  2CRL A;  5DGA A;  2KT5 A;  1DLO A;  3CCV S;  2B43 A;  1WI8 A;  2ZHB A;  3GR0 A;  3A1Y G;  3OL7 A;  3V6D B;  3W5Y A;  3CJ4 A;  1S59 A;  2IM2 A;  4ZKA A;  4ZP9 A;  3BO2 A;  1JLA B;  3UI3 A;  1URR A;  4NLV A;  4UQG A;  1UVM A;  1N33 J;  1S0V A;  3FMW A;  3ZZ0 A;  1TZ0 A;  4JI1 F;  3DLE B;  1NKE A;  3V81 B;  4OL8 A;  3FEX B;  2FLL A;  3OJS A;  4ED3 A;  2OKQ A;  3W9J A;  1SB6 A;  4B3R F;  1S9G B;  3T5J A;  2CYY A;  3LAK A;  1DTT A;  4YUD A;  1YJ7 A;  2LA6 A;  2N4C A;  1KR4 A;  1BGX T;  2FVR A;  2O01 C;  2BMB A;  1D1U A;  4FBU A;  1I5O B;  1NZ8 A;  1O8B A;  2FGC A;  2EC0 A;  2B4P A;  4Q44 A;  1JLE B;  4DFM A;  3ZC4 A;  2E7W A;  2JOQ A;  3DOM B;  3NCQ A;  2ILY A;  3FBB A;  4LF7 J;  3W2W B;  2AYG A;  1SIZ A;  2K7K A;  3ISZ A;  2EFG A;  1DUR A;  1FDA A;  3C8Y A;  1RHU B;  2HHX A;  3HKZ D;  1VQP S;  1MU2 A;  2CZ4 A;  4ZVO B;  4OI1 A;  5E3R A;  1GFW B;  1JQG A;  3D6F B;  2HZC A;  2FHK A;  4MH8 A;  3M6W A;  1LQ9 A;  2HFN A;  2VBW A;  1HWI A;  2QEX S;  4DR4 F;  2YKQ A;  2NXJ A;  2D74 B;  2BE2 B;  1N34 J;  4KJI A;  4O3N A;  3HHL D;  4BLG A;  4B9L A;  1Z4U A;  2A10 A;  1Q79 A;  1CS4 B;  2AJ4 A;  3P5T L;  5HMX A;  2R9L A;  3EXC X;  1DJ0 A;  4LFA J;  4IG0 B;  2EKN A;  3IM8 A;  4N47 A;  1CPZ A;  3D3B J;  1NXI A;  3NCR A;  5BJR A;  4MMO A;  3WX8 A;  1C1C B;  2FC8 A;  2J7U A;  3CJ2 A;  1T05 A;  1BQM A;  2ZDP A;  1X4H A;  2ZZN A;  3TX0 A;  2J6U A;  3QSY B;  1IXK A;  4TU9 A;  1FDN A;  3DFE A;  3A8I A;  4H4K C;  3PJ9 A;  4HHH A;  2AZ1 A;  2CPY A;  1RWK B;  3V4I B;  5AXM A;  1M5K C;  2DXE A;  1BQN A;  5KFY A;  2GQQ A;  2HRU A;  1B7F A;  1SBR A;  3I55 S;  2AGP A;  2FLO A;  3LW5 C;  3E51 A;  1AW0 A;  4DV0 J;  1L3T A;  2OGU A;  2DCU B;  4UUW A;  4Y2I A;  5J1N A;  4PXB A;  1FD8 A;  3MMA B;  3KLI A;  2Z8Q A;  4WFB Q;  2UVU A;  3DRR B;  3PR5 B;  4G65 A;  3N79 A;  2A0F B;  1C2P A;  3MM5 A;  2GO8 A;  4F02 A;  1YJV A;  2W4C A;  4NWB A;  2QV6 A;  3KHH A;  3BSA A;  2FVC A;  4CH1 A;  5HSP A;  3DI6 B;  5GAH I;  4GVB B;  1WF1 A;  1HBM B;  1MML A;  4DL0 C;  4ED6 A;  4I56 A;  3LP1 A;  4PG7 A;  5L1K A;  1HI8 A;  1WC3 A;  3QNW B;  4LF6 F;  2VF3 A;  5DDR C;  3C2P A;  2RJZ A;  3DLG A;  4TY8 B;  1S97 A;  2JNJ A;  1HKA A;  2V94 A;  2F8M A;  1N5Q A;  1VMB A;  2P9E A;  2HHS A;  3IM9 A;  3VHQ A;  4ES3 A;  3NOC A;  2J0X A;  1ZBT A;  1ZA1 B;  4FYX B;  4YHH F;  4Y2A A;  1M1G A;  2KFY A;  4P2M A;  3MAA B;  3CCJ S;  2RQK A;  4AE5 A;  2RHQ B;  3EZ5 A;  2M9K A;  2KHC A;  4ZLJ A;  3UDE A;  4X4V A;  4ECQ A;  3QO9 A;  1JNR B;  2VBX A;  2KT3 A;  3U1L A;  1D09 B;  4USJ C;  2H5I B;  1WC0 A;  2FJA B;  2LEC A;  5L9X A;  4USM A;  4BC9 A;  2OPP A;  2CAJ A; 
#chains in the Genus database with same CATH homology
 3GCW P;  2W2N P;  3P5B P;  3BPS P;  1SPB P;  4JP8 A;  1V5I B;  2E1P A;  2Z58 B;  3CNQ P;  3QFH A;  4K8R A;  2W2P P;  4NMX A;  1ITP A;  3H42 A;  3AFG A;  4YN3 B;  2ZWP A;  2ZWO A;  4OV6 A;  2Z30 B;  3WIU A;  1SCJ B;  3VHQ A;  2Z2Y B;  2W2O P;  2XTJ P;  3CO0 P;  2QTW A;  2W2Q P;  3A3P B;  4NE9 C;  3T41 A;  3BGO P;  3WHI A;  3A3O B;  3A3N B;  2Z56 B;  2PMW A;  1R6V A;  3VV2 B;  3WIV A;  3SQO P;  2W2M P;  2Z57 B;  2Z2Z A;  3GCX P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...