2HFNA

Crystal structures of the synechocystis photoreceptor slr1694 reveal distinct structural states related to signaling
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
b'SLYRLIYSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYELSDNFFLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synechocystis Photoreceptor (Slr1694)
publication title Crystal structures of the Synechocystis photoreceptor Slr1694 reveal distinct structural states related to signaling.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hfnA01
1N5TA 1CC8A 3HX9A 3TNVA 1X8DA 4FNIA 2XMVA 4HH1A 3CJKA 1FE0A 2HLUA 2LQBA 2Q3PA 4DPOA 2GCFA 2N4DA 1KVJA 1XBWA 1GXUA 1P8GA 3BF4A 1U7LA 2BJDA 2XMUA 1Y3JA 1P6TA 2XMKA 4HL9A 2CRLA 4A48A 2ACYA 2BYCA 2OFHX 1Y3KA 2RU9A 3IWXA 1TUVA 2LXFA 1VQSA 2OFGX 2OD4A 2RILA 3KNGA 1TZ0A 3GZ7A 1Q8BA 3BGUA 1OPZA 3VTIA 3HHLB 2GGPB 1X0PA 1GXTA 2PD1A 3WDOA 4FNHA 3HHLA 4OJGA 1N5QA 5B08A 1JWWA 2FHMA 1YJVA 3CJKB 2K2PA 1SB6A 2K7KA 2LDIA 2IYIA 1S6OA 2W4CA 3HHLC 3BDEA 3KG0A 4Q2LA 4QOTA 2ROGA 3DCAA 3HF5A 4U9RA 4HI1A 5KAKA 2ROEA 2W4DA 1LQ9A 1K0VA 1FD8A 2FIUA 3LO3A 2ASYA 1AFIA 2GV1A 1CPZA 3IWLA 1S6UA 2OD6A 3I9ZA 5B0DA 2QIFA 5IXUA 1JK9B 4Y2MA 3TRGA 1SI9A 1QUPA 1TL4A 3BM7A 4YEAA 4EFAC 1Q8LA 2VV5A 3HDSA 2FB0A 2AW0A 3KKFA 1KVIA 1YJUA 2L3MA 3MZIA 1OSDA 2FTRA 2LQ9A 5B0AA 1URRA 2GFFA 4HI2A 1Y9OA 4DN9A 5B0BA 1CC7A 1AFJA 1Q53A 3HFKA 2N4CA 2IFXA 2QYCA 1OQ6A 1N5SA 2ZDOA 4NPOA 2EW9A 1FVSA 4HH0A 2KYZA 4A4JA 2XMMA 2KT3A 2K1RB 1FVQA 3FGVA 2N7YA 1FESA 3BR8A 2XMWA 2K1RA 2BUNA 2W4PA 1RJJA 2HQIA 4ZA1A 4DL0C 3BN7A 2QLXA 4Y2KA 4Q2MA 2RMLA 2HIQA 2OKQA 5B0FA 2HFOA 2KT2A 4OIXA 5B0GA 5K9FA 3UDCA 5F0UA 1N5VA 2ZDPA 2G9OA 3K7RA 2KKHA 5F0WA 2XMJA 4OJ1A 1MWYA 3TOQA 2ROPA 5T7LB 2OMOA 2HLTA 3LGMA 1Y0HA 1YJTA 3DXSX 3E8OA 3QGPA 3MCSA 5T7LA 4F67A 2IYGA 1IUJA 1AW0A 1W2IA 5B0EA 5A6WA 2K7JA 1VQYA 2GA7A 2HFNA 4YDXA 2AJ0A 2VH7A 2BBEA 3FRYA 3BB5A 3FMBA 5A6PA 2GO8A 3KG1A 1SQEA 4A47A 3F44A 4ZOSA 1OQ3A 1TL5A 3T9NA 1YRXA 1MWZA 1X7VA 2OAUA 4A46A 1YG0A 2QLWA 1APSA 2AJ1A 5B09A 2XMTA 3QMQA 2BJEA 2JDJA 1FE4A 2AP6A 1ULRA 1KQKA 3LGNA 1WD6A 1R6YA 4OJHA 1TR0A 4NL5A 4Y2IA 2GGPA 1Q4RA 2OP5A 2PGCA 3HHLD 4OJ3A 5B0CA 1V3ZA 2RSQA 1YJRA 1FEEA
chains in the Genus database with same CATH superfamily
4EUVA 3CO0P 4MKYA 4X4QA 4B3OB 1SC6A 1U1LA 2OFGX 4Y3CA 1P1TA 2XYPB 2ZH8A 3BSCA 1LWXA 5HMYA 4BS2A 3TANA 1WHYA 4IG0A 2VA3A 4RL1A 2E44A 4IH5A 3MM9A 5L1IA 1FKAF 4I6YA 2OEKA 4IOCQ 1NLKL 1WOSA 4O44B 4EYHB 4DV2F 3CB4A 7FDRA 2DNRA 1JKHA 2BX6A 1RU2A 1TL3B 3KUHA 4RUCA 2UUTA 3NRBA 4LF4F 1VQNS 2CPFA 4C3MA 1SH0A 2AJ0A 1H2UX 3HK2A 2AEFA 1NO8A 1T8EA 4G65A 3L9ZA 4DZDA 2ACMA 1J5OA 3EXYA 3CC4S 2OTJS 4ECVA 4A47A 3OXGA 3DM2B 1KN6A 4QJVA 1HNWF 2VQEJ 2RQCA 3W9JA 3J7YI 4DI6A 3THPA 2BYCA 2W2NP 3MM8A 5EDWA 1RK8A 1EQ0A 1DRZA 5KFEA 3HZEA 3MHYA 2PD1A 2MYFA 4ZP8A 1JLBB 2ZBIA 3JYTA 1PJ6A 2E5LJ 4UOGA 2H5IB 3BBBA 3NGDA 2AF6A 2DK2A 3TWZA 4JI5F 2MB0B 2J7WA 1YWXA 1OSDA 2LQ9A 3M6XA 1RHKB 1N5SA 5KFZA 2GVDA 1HBNB 1VRUB 4QIFA 1IBCB 2YNIB 1VQOS 1PJ7A 3FVYA 4LSZB 3MPUB 2RQMA 4KGMA 3GILA 3H2LA 1RTDB 1FA0A 2XCAA 3W8GA 2B5JA 1RT5A 3H4DA 3SYZA 1VCTA 1Z2ZA 3ET6A 1PYOB 1VIOA 3DLLQ 4PWUA 2YKNB 2BANA 4PABA 4NL5A 2J8AA 1NDCA 3ZZUA 1HD0A 2ZH7A 2DBBA 3CJKA 3J7YU 4M5DB 5L39A 4OI0A 1EHWA 4MFBA 2LEPA 4ES2A 5KFNA 1H72C 1UFKA 4UZBA 2J0XA 2DPJA 3NP5A 5KFLA 1BY9A 3ADAC 2LVWA 3VAKA 1R0AB 1EB0A 1WOOA 3LP1A 2FVQA 3CPWR 2W9CB 1VC0A 4YHHJ 1S0MA 2AHOB 5HBMA 3PJXA 3SFUA 1IWGA 1V5IB 3A8JA 1YJUA 2MQPA 3QWUA 2OUGA 4OLOA 4X4TA 2MPUA 3CD6S 2NXNA 5DM6Q 1DBDA 3QT7A 2YY3A 3GPAA 5AXNA 2ALYB 3Q8UA 2QLFB 4WF9Q 1KBRA 1JB0C 2D41A 5CD4A 3CDWA 3ITHB 3CC2S 3HJFA 4RUBA 1TUWA 5IZHA 4FF2A 5KFQA 1S9EA 3X3UA 1RACB 2GJ2A 1KP6A 2E5LF 4M5LA 3HFVA 3VWSA 1ZAXA 1C4AA 1UPMB 4ZP7A 3CGIA 5AXLA 3PKYA 5FIIA 3GJTB 3P49B 3BREA 4DL4A 4UW2A 3NCRA 2RRAA 4NLRA 3WIVA 1IBMF 4LF5J 1CJVB 3HHKA 1CEZA 3OSNA 2NZ4A 2M88A 5HROB 3C66A 4UOHA 3IR7B 1R6VA 2J0QD 3IA0A 3A13A 1DJ0A 2PDAA 2P5VA 2YWHA 5KT2A 1K9MT 3MGJA 2HNZB 1PKUA 2YNGB 4KO0B 4J37A 2X3DA 1RWOB 2W7PA 5L1KA 3DOLB 4LFAF 1LNQA 4OYAA 4NMXA 4YY3F 3KLFB 4J90A 4FPRA 3W3SA 1M5VC 5KFWA 3KDOA 1NH8A 1UA0A 1RT3A 1HI0P 2H4YB 5CYMA 2W7AA 3BGFA 1RT6A 2M4MA 2OAUA 4ZPAA 2FLPA 3T19A 2E29A 5G0RB 3IM9A 1JLFA 2AJ2A 3A12A 1PGZA 1Q86T 4CQ1A 2ABYA 2UXDF 2I5JA 1FDAA 5HAOA 3H42A 1RYSA 4ZN3A 4YB5A 2ZH1A 2VQFF 1GMWA 2R2RA 4HI1A 4NCGA 4PUOA 4N76A 4HEA9 2PC6A 4CTAB 4CO0A 5EWGA 4QPTA 2P9EA 3NGTA 3SDEA 2CWKA 5IFMA 2DJWA 1U1OA 2IMWP 1JLCA 4DQIA 3PO5A 4RPFA 3JS9A 3GYGA 2V68A 2ZOFA 2ROPA 2XSJA 5KG3A 4LQ3A 4BBYA 5DZ7A 3SXLA 5A6WA 1X9MA 3TAPA 2VFTA 1C1BA 3U27A 2CPIA 4C8YA 3GIMA 2HHTA 5E33A 3R1LA 4A8MP 1N34F 5B0CA 5CXTA 1X60A 3S8SA 4TLRA 3WBZA 5DLGA 1V6HA 1Y5IB 3OD2A 1FF2A 2KVQE 2DB1A 2MHNA 3PR5B 4C3KA 3FEZA 4MKBA 4R0EA 3RJMB 2QA2A 1FWPA 4BCAA 3SI8A 5LM7E 5J2PB 1DTTB 5B0DA 2DR9A 4H4OB 2HFSA 2DNHA 1XMQJ 4K4VA 5A8RA 4WFBQ 1FVQA 3VR1A 2V6AA 4LF8F 2HGMA 5LOQA 2LU1A 4MK7A 2OPPA 2YWFA 1ELOA 3FCHA 4USTA 4R5PA 2QGFB 3OL8A 5DGBA 4DWIA 5KG2A 1QAIA 5E3QA 1V5VA 1TKDA 2R42A 4PXDA 3IFEA 3NCQA 1UEUA 3PRVA 1TKTA 2B6AB 5I42B 2DHGA 4P6QA 4IRKA 3Q23A 4KFBA 4C2MA 3UNGC 1YVFA 1FERA 3MR2A 2QLBB 3H0PA 2G2ZA 4NLOA 1IR1A 4FBUA 3OXLA 3G71S 2FIUA 3TX0A 4ZVGA 3PFOA 3NMAA 2QT7A 4TU8A 2BJ8A 1F5AA 3TZYA 2MKKA 3UPFA 3JSRA 3M9OB 4BDPA 3CD0A 1YBAA 4LR9A 4B9NA 3OVAA 2K1RB 2OMLA 1S1VB 4KKOB 3TAQA 1SC1B 2XMJA 3D67A 3UD3P 2IRYA 1MMNA 3EZ5A 5D78A 2MGZA 3M8QA 2ERRA 3R2DJ 3AJ2A 4YFUA 4DUZJ 2C2DA 4DV3F 3BPSP 4B9MA 4ED6A 2V94A 1Q0NA 4PG6A 3I96A 1Q4RA 1HD1A 2YTCA 3EICA 1PBUA 1EKSA 4EYIB 5DQIA 2LEAA 4M95A 3C16A 4C11A 2LFVA 2B7CB 1RHUB 4AFFA 2BE7D 4LRFA 4N5SA 2C2MB 4ZP6A 2W4CA 3KG0A 4EO8A 1AFIA 2EFGA 1WSRA 4ED3A 1OY9A 2BXJA 4F4AA 2QC3A 2DITA 5DLFA 2C2KB 4OYPA 3BJYA 4ILMA 4I69A 5A0YA 3MAHA 3QSYB 3KHRA 4NZ0A 1EKRA 2B56A 1LK5A 2YQ1A 3FDSA 3RBXA 2NS1B 3LGHA 1L3VA 4DCJB 1XR5A 4HVZA 1WORA 3ENWA 2YKOA 2XI3A 2Y8YA 5AT1B 4KV8A 4WKYA 3SEOA 2X1AA 2M3DA 4CH0S 5C42A 4I64A 2AYEA 1T7PA 2R7XA 2QSFA 1RWNB 4ED8A 1TVRB 4WK3A 4QW9A 4QWAA 1HQUB 3JSMA 5DETA 1S7HA 4KAIA 1U2RA 4LSLA 2DR6A 4QYRA 4NYOA 3WDOA 3QLHA 2OPRB 2CVIA 3HVTA 2HURA 2WVBA 3HF5A 5ETTA 1ITPA 1X9SA 4DUZF 2IIHA 2UUCJ 4ENOA 2AWZA 3BSAA 2EW9A 3GJSB 1NSPA 1YK9A 4Y0FA 1PJ5A 2PO4A 1KNZA 3EVWA 3SCJE 5A2QY 4MIWA 3C14B 2HLTA 5C7PA 3H4BA 2EPIA 4X62J 3HM9A 3N28A 2CJ9A 3AY0A 4JI2J 3FJ2A 1FK9B 5IC4B 3C6TA 4WU3A 3PTWA 1VRTB 3PCOB 2IY5B 3ILLA 3CDEA 3LH2S 4P2MA 1WC0A 4B17A 2MZQA 5HL7Q 3D6HB 2O67A 2QZ8A 2C3PA 4FNHA 4ED1A 2JSXA 1WDTA 2ZBCA 1FJCA 2NXEA 1BWEA 2VG7A 3NAIA 1JLAB 4DR4F 3KUEA 3CJ4A 2IFXA 1S1UB 2XYHB 3QT6A 4Y00A 4DXLA 4WFZA 3TR5A 4DR1J 1LKZA 5LJ3Y 2GMHA 2KI2A 5F0WA 4UT4A 1ZTTA 1CJUB 1U6ZA 1VIXA 1EZZB 1PSDA 1IKYA 4PQUB 1NBEB 2HQFA 3JQJA 2MKIA 1SCJB 4NEYA 4X84A 4RUAA 2E5IA 3KLVA 1HR0F 3NG8A 4DL6A 1X4HA 3M2VA 3TZZA 1KHWA 3DC2A 5KTQA 3BDEA 4ZLJA 1XBWA 2Q6CA 4ZHRA 1MMDA 1B0VA 1FJGJ 3LW5C 3OR1B 4HACB 3DLGA 2WONB 2MDAA 3KJVB 2NUUG 2EK1A 4F0MA 3LO3A 2HG4A 2ZNYA 1LWEB 3D66A 3BO2A 2O01C 2VPZB 1VR6A 4JB8B 3MZIA 2B4OA 2W2QP 1IBKJ 1PBAA 4KSEB 3P96A 3VGVA 4KH1B 3N4WA 2ZNZA 4DDFA 2XLIA 1GMVA 3MR7A 2HIQA 2DNPA 2KT2A 4KRWA 3PX6A 3SQOP 4EEYA 1RBOB 3DU6A 4F67A 4CIOA 3MEEA 1AW0A 3DOMA 1XC9A 1JLQB 3JSBA 1TL7B 3QO9B 4NZ7A 2ZC4A 4OV6A 1OYEA 1HW9A 1HBOB 1OY6A 2Z4PA 1FI4A 1RP5A 5L1JA 1KQKA 4F50A 1NK8A 5EX3A 2VPWB 4ID8A 5HJYA 3WIUA 1QM9A 3PR4A 3DYAB 3GR1A 5K8PA 4DR5F 3CC7S 2GAGC 3GG1A 1DZ5A 1R27B 4K7QA 4CLYA 2V63A 3HHLA 3P3DA 3KLHA 2CZ4A 3BBFA 1WSVA 2OSQA 1G4CA 1N32F 3V5RA 2K3IA 4RW4A 1KHVA 1ZOTA 2HEKA 4E8UA 3TJ9A 5KT5A 3D28A 3M7VA 2BUNA 5LSRA 2HNYA 4C0HA 2L08A 4CO4A 5JMNA 1ZM9A 3HULA 4ZPTR 3SSRA 1ZM3A 1T03A 1Y7PA 5AE1A 2YNHB 1G1XA 2GC8A 2IYGA 2VC1A 4ZN1A 3UN3A 5HO4A 1JJCB 2VU5A 4RW9B 3V6KA 3LTOA 4DV7F 3O44A 5HVGA 1RT4B 1HPZB 4DS4A 4KGKA 3CVKA 4DSKA 1YTYA 1S6QB 1X4GA 1RDRA 2OJ3A 2ZHOA 1E6YA 3CJ3A 1K1QA 2ZWOA 4F26A 4IQXA 5KFMA 4OZJA 4DG1B 4KGVB 1W25A 5K14A 3RRKA 1HFEL 2HHHJ 5LMNJ 2D3ZA 2EWHA 1U47A 1ZTWA 1DQ8A 4LF9J 2J0WA 4OMFG 4ECWA 1YJVA 3DI6B 2KFYA 5IWAJ 1T9UA 5KFRA 1GMWD 1FFSB 3F0NA 3ICLA 4GKKJ 3MEGB 3QZ8A 1S59A 4J9NA 2R4FA 5HATA 4HDGA 5C25A 2VPXB 5HN0A 4BLGA 2RUGA 2MZTA 2VFVA 1RAFB 3NEKA 4F2RA 3IM8A 2JEJA 3GSIA 5GAHI 3F73A 2O3DA 2V8VA 3OW2R 4KH0B 1KOHA 2M9KA 1MWYA 2EG1A 4ED4A 3RGIA 4L3NA 1H73A 4OZ0A 2BE9B 3C6UA 4B9TA 2DHXA 2UVRA 2FUG9 1WKLA 2RKIA 4QU6A 1Q8KA 3HVRA 3NS7B 2KB2A 4ANDA 1O8BA 5AE2A 1RAGB 2HZAA 1WELA 3DGPB 4K0KF 2PN6A 3L7OA 4PG8A 3KLGB 1WWHA 2DEJA 5IT9U 1S9GA 4CYUB 3I32A 4C0BA 1T95A 3FBCA 4K4TA 4MK9A 4WTOB 3D6MB 1VQ6S 3UQSA 2H48B 3EX7B 5KFIA 3RBEA 5I3QA 1S6UA 1K44A 2GIFA 8RUCA 2OPQA 1S49A 5IT4A 4ED0A 3HDSA 3AHPA 2FGCA 4P52A 1H98A 4IR9A 3KK2A 3MM6A 2G0IA 3CWJA 1FJ7A 3IBFB 5GAHU 2ZD1B 1WC5A 3LUYA 3R7BB 3FBBA 2C2NA 5B0FA 1S0VA 3LGMA 1TL1A 5HQ8A 3KOAA 4RU9A 2QA4G 2UUAF 5L9XA 1PYTA 3FRYA 4PEOA 1RHRB 2YWGA 2NPFA 5RUBA 2JWNA 4X4VA 2JC1A 1UL3A 1UWBB 1CJKA 4DX7A 2C22A 5BR8F 4OI6A 2Q3PA 2HLUA 2QA1A 4WZQA 4GKJJ 4ECQA 2HK2A 1RLCL 3T1AA 4LF6J 4Z37A 4LUBA 2ZKTA 2SXLA 3QFHA 1VFJA 1IN0A 3AOCA 2C2EA 2F1FA 4DPUA 3TUIC 1X4EA 4PG7A 1H74A 1GXTA 2W1BA 2YNFB 3S01A 4DL5A 1K0TA 1B0PA 2FVRA 2MSSA 1LW2B 1TL4A 4DHVA 5HMWA 1VS3A 2CQPA 4F36A 2HS4A 2MXYA 2XMMA 4CRJA 2QL7B 3FGVA 4A8SA 3UE2A 5HLFA 3DLEB 3RAXA 4B9LA 2PSZA 3MMCB 5KFDA 2R8GA 4CT8A 1U1PA 1XQIA 2VB6A 4U8YA 3PNIA 3QGPA 3KDNA 4D3GA 3I56S 1RQ0A 3U1LA 3JXOA 3T1HJ 3QATA 1NK5A 3T9NA 3PW2A 3C19A 5B09A 1N56A 2DXFA 4ECTA 2GGPA 2IDEA 4FS1A 3DM2A 1VQPS 3VAJA 3CCTA 2IHR1 3MPVA 2RT3A 2D9PA 3ZTOA 3ILIA 2XMKA 1SV5B 2ZE2B 4BC9A 4J9OA 3M8ZA 4DUTA 4DR6F 4X64J 4W90B 3M8WA 2GHPA 4JBCA 1YBTA 1S77D 1M90T 2F9JA 2RRBA 2ZZTA 2HHWA 2ZVSA 4Z2XA 4MKAA 4Y6IA 1OWXA 4LVNP 4IDKB 5LT5A 2UXBJ 3VF0B 1ZPWX 2YKQA 4FYYB 3MM7B 1FTCA 1OQ6A 3V81A 5IOLA 1FFGB 2BJ3A 4L3KA 2JNJA 2KT3A 5HVHA 3GYXB 3KLIA 4GO5X 2XMWA 4FXWA 3OR2B 2F4VF 1HYSA 5IS2A 1A6LA 3D1HA 4LF6F 5T7LB 5DO2A 4MH8A 1FD2A 1RTDA 4P72A 1RTJB 1X5TA 2JEFA 3QRPA 1IXKA 3QIPA 1S7IA 3M05A 2DY9A 1IJEB 4RZRA 2VC0A 1S79A 3BKTA 4C9DA 1CC8A 1JLGB 1SJRA 4C4WA 4ZCMA 1Q78A 3VAFA 3UVJA 3DGVA 2CQ2A 4RWXA 3FZBA 3MD3A 3IS9B 3D2WA 4DV1F 1HMVB 4QU7A 4DQPA 4ECUA 3G2XA 4JI3J 2MKCA 3IBCB 2CZ9A 2LDIA 1Z1ZA 2VJUA 1B70B 2Y1IA 3FFIB 2WB4A 4AUKA 3QRQA 3TRGA 3T1HF 3OTOJ 3MCMA 1R0BG 4CO1A 1B4SA 5BYSA 1HNXJ 1C0UB 2KFZA 3A4TA 4USHA 3DRXA 1JNZB 5CCLA 1ZM2A 2MZRA 3M2UB 1LEOA 4W4MA 4B3MF 3V2UC 1KR4A 3D0GE 2OPSB 2HFNA 2MKYA 5C2CA 2FJWA 3PM9A 4QZVB 1NSAA 4MIBA 4QQBA 2FY8A 1S6PA 1WUUA 3OUYB 1HBUA 2C2OB 2UXBF 2KM8B 4OX6A 3RR8A 3IP0A 4DEZA 3NCPA 4CO3A 5FLXU 2DHAA 1J5EF 2KH9A 1LW0B 4PR6A 2R7VA 2BW7A 1Q8BA 2X1GA 5E7OB 4JI0J 2EFQA 4R8UB 4JI8F 4Y28C 4ECYA 2W8LA 1QE1A 3T6JA 3HKZD 1S0NA 5HROA 4JOUA 2VV5A 4X2BA 2AW0A 3TUJC 4RU2A 3PW5A 1DTQB 1MROB 2YNGA 3AD7C 1UWAA 2XZTB 3DLJA 3Q2SC 4O3NA 5KFVA 3CXCR 1NDKA 1OIAA 4PXBA 5A8KA 4NXMF 3G96A 1VI7A 2VONA 2MY7A 1RI7A 4RX6A 4ZK7M 4ZVSB 3CSKA 4Q43A 3TVKA 2WW8A 3DDNA 1HNVA 4IOAQ 4LFCJ 1KLMA 3N6LA 1TR0A 4NPOA 3NGKA 3NOGA 1OO0B 3OTOF 1UW9A 5G0RA 2LA6A 5ETPA 2CQ3A 4DX5A 1HNXF 1R43A 4TY8A 4HR2A 4RNOA 2NYHA 3L09A 2HHSA 2DO4A 1VQMS 2DNZA 3K0JA 3BGRA 1OPIA 3KK3A 3ISNC 5CYQA 5DQHA 3I5AA 1NH7A 3M6VA 3NL0A 4PYDA 2R7SA 2W4DA 3WX8A 2J0SD 5KFGA 5SZTA 3BGOP 1X5SA 4RKUC 4DPTA 3DNCA 3E01B 4NLYA 3HCXA 5K5MA 2F8EX 1R8HA 3KJFB 4IO9Q 4HHJA 1U6FA 1RTHA 4WBFA 4CLPA 3MD1A 2AEJA 2GA7A 4ELUA 1ZZFA 2A18A 2M7SA 1MWZA 2I1RA 1LV5A 1VQ5S 2JFDA 2X1BA 3OQ2A 6AT1B 2MSTA 3MM5B 3N6MA 3ZZ0A 4F25A 3NBPB 4MYUA 1HNZF 1IM4A 3FQKA 4EBCA 2CQBA 3BQ1A 1WTBA 4QR0A 4M94A 2CA9A 2CG4A 2LLZA 2C2RA 2I6WA 3VQTA 3VVTA 1GFWB 2CIMA 4PKDB 4OJGA 2DKOB 2K2PA 3R6GB 2PFDA 1TKZA 2E7WA 2HYIB 1QSYA 3X1LB 3I9ZA 5J2PA 4DL2A 5U47A 4XO0A 2B9EA 4ATNA 4RNNA 4ZJQA 1P1LA 1M5HA 3ZC4A 1HNIA 3MECB 2HKEA 2BVZA 1RAHB 2DGWA 1R7IA 1UCNA 4WFXA 4OFZA 4B3TF 3KK1A 2HAFA 2XLKA 4K4UA 1U24A 2HNDB 4ZVTB 3DOKA 2R8KA 4TN2A 1IKWB 1EIYB 4DX6A 2MQQA 3BPDA 5DG7A 5CH7B 3B8HA 4EZ6A 3MMJA 2GMJA 1ZPVA 2Z2LA 2ATLA 2RIJA 5E5NA 1KDNA 3J7A1 2UUWA 3G82B 1L3SA 5DQGA 1XR7A 4ZDNA 3OL7A 2U2FA 3UI3A 3W9HA 3GFHA 1WC1A 3DRPB 4CLWA 2ADBA 4YB7A 4KTQA 3W5YA 4CZCA 4ID5B 2VG6B 1ICEB 3H59A 4HT5A 1JJHA 3SMZA 3C2PA 3H20A 3V6DB 4UF4A 1XERA 5LMUJ 4KBIA 3M9MB 4N8OA 3MDFA 2HFZA 2K1RA 4ZVRB 5DDRC 4EZ9A 4C8NA 2MKHA 3MUMP 5H9EJ 1FRIA 2CKWA 4ED5A 5CYJA 2MMYA 2QO3A 1S5ZA 1QTNB 3W60A 1X7VA 1DLOB 5M2PA 2HK3A 2MY8A 4ZVQB 2WW4A 1CULB 3SV4A 1CS4A 3B6BA 2GHVC 3OSPA 2GVZB 2H51B 3VVUA 3AAWB 3J80U 4KHMA 3EXCX 3IWXA 3B4MA 4IFVA 1AYEA 2RILA 3L95X 2JZ5A 1HI1A 2VFSA 3OT9A 4Y2AA 1QY7A 4F04B 2P9GA 3MMBB 1CG2A 4DU8A 1GTEA 2CNNB 3K5NA 1B3TA 4J9SA 3NY0A 3M2RA 2VG5B 3IMQJ 2YKPA 2D3O1 2IJRA 4DUYJ 4OHXA 4OZ2A 3W64A 5L9NA 1REVB 4MKVA 1D0EA 1S99A 4U8VA 2KO1A 2HVHA 3VALA 4NA3A 2V9KA 2KZZA 3Q89A 3CE8A 4B3SJ 3G8TA 3W2WA 1RBLA 3T5JA 1Q82T 3KG1A 5C24B 4DR2J 2E5JA 1NUEA 3EWGA 3W5XA 5E3PA 3A1YG 3HI9A 3C15B 1U02A 1UTAA 1PAEX 3QJLA 1FRMA 1RAAB 5A8WA 2HHPA 4I56A 1WC6A 2LMIA 2RF2B 2JEGA 3UO0A 3KTQA 2DYAA 2LCWA 5IM0A 4PZVA 2WOMB 1AUDA 4WE1B 4F3MA 2RQ4A 4U9RA 4RWWA 2DNMA 2A10A 3TAMA 3FQLA 2V69A 5E3AA 4O3QA 1YJNS 2EG2A 4GVBA 3HVWA 4HI2A 3O2IA 1HLWA 3KJNB 3KHHA 4LRBA 3OXFA 3LP2B 1KFSA 4FDFA 2J76E 4I7FB 1EETA 3EGZA 2ZBQA 2YKAA 3M1VB 3ZTPA 4P2SA 4ILLA 2UU9J 1NDLA 2GW8A 3ETMA 3UNYA 4DCOB 3D54A 4YDXA 2MLZA 1XNRJ 4CH7A 4I1TA 3K5LA 1KQSR 1S1WB 4FBTA 5B7WA 1H2TZ 2FD2A 1VRQC 4OQJA 5LXYA 2OEMA 1DAXA 1VMBA 3GG0A 3HT3A 4A8YA 3RZAA 1NB7A 4DL3A 3V4IB 1FKPB 1K1SA 3NNAA 1TZ0A 1SJQA 4ECZA 5HVFA 3CCVS 1K0VA 3TEGA 3BO3A 4O4GA 1IBLJ 2EFVA 2MJNA 1CJTA 3I82A 1HQEA 3CJQA 4C0OC 2QLJB 4DV4F 4ER8A 1FKOA 3BKFA 2D69A 4OZ3A 5HQMA 1EX8A 1T11A 3M8SA 5C5JA 2ZBPA 1RJJA 1RHQB 1Y00A 4XPEA 3G9CA 5E3RA 3UCGA 2NR0A 3DHXA 2ZUAA 1FX2A 1NK6A 1CJUA 3ILJA 3MM9B 1IUJA 1OS5A 3R7SB 4AXJA 1ZH5A 1HWLA 4F4WA 2Z2YB 4XPCA 4ICLA 5GAEU 2XLJA 4JI1F 2E5GA 1X4CA 3MR5A 4DFJA 1JQGA 2DNYA 4DF4A 3R5JB 2HFUA 3J81j 1XEZA 1SH2A 4UUWA 1HWKA 1KRPA 1J5OB 2PFFB 1OJ4A 2W9BA 5BJRA 2IM3A 4B9VA 1WC3A 4ZLNA 5CHCB 1S12A 1Q5VA 2WONA 5D0EA 3LA0A 1I94J 2MLYA 4BC7A 4LBIA 2D7SA 5JUMA 2RUSA 2FHJD 2CJQA 3JYTB 3E3XA 2C28A 2UUBF 1T05A 2F4FA 1JLEA 1FO1A 3GIKA 3TX8A 4J9VA 2NQPA 4XDDA 2KDOA 1GTHA 2XY7A 3OLAA 2GVDB 2HZCA 1TV6B 1FTRA 5CAAA 1P9YA 3W1YC 3CO9A 2JLGA 2CUYA 1T02A 4OI3A 1X5PA 3E2EA 1IBLF 3QAEA 2A2CA 2IC3B 2PEBA 5ETKA 1RT5B 2E1MC 1X8DA 5DS7A 3ET6B 3UDLA 1RABB 1NJWA 1L3UA 3PW7A 5GADU 1JJ4A 2ACYA 1GX5A 1QVGR 2BANB 1XR6A 4DN0A 2BV3A 3CCQS 4EMDA 3CJKB 4MFBB 2PI4A 1ZBTA 3NS6A 3HSGA 2GQQA 5ETVA 3TYTA 1RT2A 3HHNB 3T41A 4IOBA 2WHOA 3GCWP 3Q8RB 3CNQP 2NLWA 1SUQB 3LP1B 1RWPB 2R8IA 4TLQA 3UR3C 4DCPB 1WF1A 1NNDA 3QBCA 2N7YA 4QIWD 3VZHA 5KFCA 4XAKA 3RAQA 1M5PC 1GXLA 2HQIA 4QIEA 2AZ3A 1AT1B 2O1PA 1IR0A 1WDDA 4TVAB 1HHSA 2ASLA 3T9ZA 2XZDB 4CCHA 1MG7A 4U7CA 1I94F 3H98A 1RTIA 1WI6A 3ZZRA 1RT4A 4C97A 5CA5A 1IR2A 4BHQA 3OJUA 1S9EB 4ED2A 1F6TA 4LREA 4JI7J 1P8GA 5D0RA 1UVMA 1V3RA 1TTHB 3MMAA 3WX4A 1JMTA 3DRRA 3QIDA 5IQ6A 2RDDA 4AT1B 1NPRA 1KKHA 1RSCA 3DI6A 5CD4H 4M5MA 3QYYA 3VGSA 2H54B 2HAIA 3U1NA 2R2SA 4JYAJ 2IVFB 3EVOA 3SSSA 1U49A 3J7Z5 4WZMA 2OHDA 2HMIA 4RUHA 3MPDA 1NRKA 1JIHA 5D0GA 3G4SS 3POTA 2PMHA 1O51A 1T9YA 2F8HA 4IYQA 4O3SA 1RHMB 2QLXA 2ZH9A 4Y2KA 1C0TA 4YS2A 3CIMA 3PXGa 3GCXP 1DQ9A 2XEXA 3TVZA 3I0RA 3MAQA 1HA1A 1TFYA 1RHJB 1ZA1B 2V2KA 4K2JA 3RB4A 4LF7J 3P8BB 1N33F 3PO4A 4G1QA 4IRDA 2IA6A 4XDCA 3MEKA 4JI4F 5J1EA 4X65J 1YX2A 1ZAWA 3HD2A 1RT3B 3DFEA 5CYMB 3SZ2A 4PRFA 4YN3B 4NLSA 2IVMA 3SV3A 3DGPA 1G2EA 4K5SA 1FFWB 1RT6B 3W63A 3Q83A 4IG3A 1X0PA 1OMSA 1JLFB 3GFXA 1KC8T 2AYMA 1D3WA 2ZH4A 3KJQB 3EGVA 1D8ZA 4Y2MA 3SBMA 3J81Y 2I5JB 3HSDA 2WVDA 2QA4S 4HDHA 1N52B 3I0SA 3CCWA 3K5OA 5DJBA 1M5SA 4NCGB 3T5LA 4PUOB 5K8MA 1FCAA 3LANA 4J9PA 4JI7F 1M1HA 3RR7A 2ZBRA 3GTYX 3SIPB 4JV5J 3THVA 2ZM6J 4U67Q 3ZZYA 3AD9C 1VK8A 4WP8A 5B0EA 2JLEA 1NJZA 1X4DA 4I68A 3MFHA 3N5BA 2CQCA 2VHGA 4O3OA 5DG8A 4JYAF 2EXUA 3QJPA 2XSJB 1C2PA 4GRSA 3N6NA 3MWBA 3BH6B 1FEEA 1UWBA 2WZ1A 4DR3J 1C1BB 4G6VB 2XI2A 2B4PA 4FKYA 4JI6F 1F0XA 2ILZA 2UXCJ 1RB0A 4C8KA 2YKMA 3FMWA 4LBHA 5B08A 4QCLA 3T1YF 1XMOJ 4PG5A 2RU3A 4ELVA 2BQ3A 1D9FA 2YNFA 1X31C 7AT1B 3RB3A 3IWLA 4E2FB 2XCPA 4A8FA 3SCIE 4LF7F 1QUVA 3P6YC 3EZOA 3R5AA 4OYMA 5DRKA 2K3KA 3BH7B 1SJ3P 1NJXA 2D3UA 4P7VA 2LQ8A 3M8PA 3Q8VA 1VQ8S 2HRUA 2MEWA 1UJ4A 2OKQA 4USWA 2E7VA 3ENAA 1FDBA 1N5VA 2CVEA 2XY5A 4OJ1A 5C2GA 3N0VA 1NDPA 4FN5A 1GQEA 4NX9A 5A8RB 2GZOA 1CBKA 1SC4B 2CQ1A 3PYFA 4XIUA 2OPPB 1KVKA 1RKIA 2QMXA 2J9EA 3O5TB 1AROP 2QLWA 4ZKAA 5DGAA 2JC0A 3D3BJ 4R5PB 1RWUA 2CPJA 2I38A 3KXDA 2W2OP 4B3RJ 2ZH2A 5DDPC 3NKYA 3ISZA 2AIRB 2G2YA 1QSLA 4MMOA 2ZE2A 1EJ7L 1R8PA 4UTGA 2AU0A 3OTCA 1RBAA 1HBMA 3G86A 3O8WA 1NAQA 1TKTB 2K7KA 2ZM6F 4PQAA 2VQEF 4X66J 2RD5C 2V0NA 5HP1A 4KFBB 3W61A 3FSIA 3IGNA 2ZH6A 5B0AA 3IBWA 2DXEA 4LMZA 3D6TB 2KFNA 3VZIA 1RKJA 2FYXA 1U6BA 4O0NA 5EHHA 1X5OA 4BWMA 4ZIWA 4LRCA 3LQVA 1MNEA 2W2MP 5FJ4A 5JXSA 2G0CA 5KFPA 5T7LA 2QV6A 3PW0A 2MLXA 1RTJA 1B64A 3A8IA 4AXIA 2C42A 4PYAA 2W25A 1F9HA 2J7KA 3OHBA 2FZGB 3IG1B 4QWCA 4ZMMA 1YDLA 4B08A 2MGZB 2V4JA 3M8QB 2CNLB 3HLUA 1FNOA 2GCFA 2J9DA 1BXNA 3G8SA 4H4MA 4LVOP 1X9WA 3C3LA 3K5MA 2DH7A 3IS9A 3NXZA 1VBYA 3C16B 2B43A 5HQLA 3M9NB 2FB0A 2B4VA 4I2QA 4K4YA 3KHLA 2AZ1A 2J5AA 4RBTA 2VBYA 4DU7A 1QAYA 3CCMS 4FF4A 4YHHF 2LA4A 5F9LA 4WIQA 1AZSA 3VV2B 2RQKA 3Q24A 2MTLA 3HSZA 2L9DA 1WTFA 2QMUB 5GMKa 3R3TA 2BW2A 4MK8A 3KFWX 4OYBA 2V4QA 1SC3B 4X66F 3QMQA 2JEIA 1HWJA 1S72S 2IJNA 3HO1A 4QWDA 5KOWA 4KV8B 3W2VA 2VZ9A 2M0GB 4CWBA 1TUVA 3SCKE 4QPXA 3JAMU 4WPAA 2VODA 4ED7A 4YR0A 3UCZP 2A6OA 3JSMB 1S6OA 3OTBA 4UUXA 1SXLA 2NYIA 4LSLB 2O5DA 1LFPA 2L3MA 3PFEA 3M8RA 1ZAVA 1LFWA 3QLHB 4P2XA 1RT7B 2CJXB 3HVTB 1GK8A 4A8WA 3HD1A 1L5UA 4LF5F 1WACA 4MT1A 4JP8A 1RCXB 2EC2A 3FK4A 4ELTA 1G3OA 1MW7A 5FDLA 2CQ4A 3HSJA 5K9FA 5KFKA 2HHQA 1RA7A 1WEZA 1XTZA 4M5HA 2NXUA 1ZYQA 2OO4A 2K7JA 3B54A 3NS5A 3WC0A 1NZ8A 3ISND 2YWWA 2DH8A 2D1CA 1EARA 2AJ1A 2ZWPA 3LWMA 4ECXA 3AJDA 4OZNA 5CZVA 1T9XA 2QG9B 1ZETA 2H65B 1SIZA 3C6TB 1GXUA 1RUSA 4DV5J 3L3CA 4M5JA 3QQCD 4ZPWR 1GH8A 4B9UA 2J9CA 2UZAA 1N5QA 2CJBA 2WSCC 4MTPA 3ZZPA 5DM7Q 1R89A 2E9RX 4WP3A 3HHLC 2ZEJA 1YQHA 1TMJA 1WF2A 3PV8A 2AJ4A 3A8KA 3KKFA 3AH6A 3Q8YA 2IMOA 5CCMA 2GQ2A 2AJQA 2DGTA 2H9ZA 5IC6B 1U2FA 3CJ8A 3BZQA 2VIHA 4YP3A 2QL5B 3KHGA 2VG7B 2Q43A 3BEGB 3US5A 3DLHA 3B82A 3ENQA 1A0OB 2DRAA 2H5JB 4J9LA 3W62A 3MFIA 1FNXH 2NXCA 4FPIA 1YJ9S 2CQDA 4C8OA 3R5DA 4KGXB 2KHCA 3PJWA 1IKYB 2Z8QA 1R6YA 4NLWA 1U48A 1Z4UA 1N5YA 3T5KA 3M2VB 4EWTA 3BGUA 3MTKA 4NRUA 2Y1RI 1RT1A 5KFTA 4ZHRB 2IJFA 5AJ3J 2HS3A 3LAKA 3R2CJ 4U96A 3DLGB 3IGVA 4ZLPA 2V2ZA 2A0FB 4M8LA 3IXQA 1U8SA 1WKKA 3ZZZA 4U6PA 3MECA 5BYRA 3LP0A 2RMLA 2OH2A 2GMLA 2FC8A 1VC6A 4FXVA 3GP9A 3JTPA 3GIJA 3IAS9 2QX0A 4CI0B 1XMQF 4F0HA 1Q7YT 1QDUB 5F3TA 4WFAQ 5KT7A 2FZCB 2RH3A 2WTFA 5H9EK 2H4WB 3MEEB 2FY1A 3FSYA 3DOMB 3HX9A 3TNVA 5F9NA 3CCES 4CM0A 3MEDA 5AXKA 1F3FA 2FPHX 1D9DA 4M5NA 3TZWA 2PEHA 4NA1A 1HL6A 3V4MA 2C3YA 2JFKA 2P6TA 5KG1A 2FHMA 1HARA 4RW8A 3RW6A 4N41A 3FRZA 3VCDA 2R8JA 2VBZA 1MU2A 4IFYA 3BM7A 1FXLA 3CJTA 1RAJA 4DX8H 2P2CB 3D4JA 3KLHB 4R0JA 2VOPA 1BMQB 5H1SV 1C1CB 3ZTSA 4RW4B 2H5EA 1UVLA 1Q5YA 2R7RA 1UA1A 5BXIA 3IRXA 2HBZB 4GVLA 3IRWP 1IQTA 2HNYB 3BR9A 1TKXA 4L76A 3BV8A 3PYGA 4URQU 4LFBJ 4UY85 4CLUA 4CO2A 1FRJA 4DR7J 1VBZA 1DLOA 3CCSS 1T03B 2EEYA 5J2NA 4P9SA 3DMJA 2NXJA 3M8YA 4C8ZA 3BBCA 2Y0BB 1QAXA 3DRSB 1OYDA 4WP9A 4IKAA 2KXNB 1PC5A 4WXOA 5T14A 1OPZA 3N5FA 3VHQA 1E6YB 2B3TB 5I3UA 1QAJA 2C1EB 5K14B 1YRUA 2VASA 2Q1LA 1BQNA 2DIVA 2DEIA 3W5ZA 4CH1A 2IRUA 4U7UD 5IT0A 4V1Ak 2G2OA 3HT0A 4Y2CA 2QJ3A 1CC7A 2QL9B 3BKUA 4USIA 2ILYA 3FCVA 5K20B 1J27A 1U0HA 2OSRA 4FF3A 3NWRA 5C25B 3R6LB 2BQRA 2WBRA 1UW4A 2R7UA 3SQGA 3C8YA 3H25A 2APOA 1HKAA 1S1XA 1FJEB 1W2IA 4N7TA 2AJFE 4RNHA 2FVSA 3DRYA 5DZ6A 2EKNA 2YX4A 4MAKA 1FXDA 2BKNA 4CT9A 2N3LA 2B9XA 4C8LA 2MQ8A 1NHVA 2GJFA 4Q0BB 3CCRS 1WHWA 3C6UB 5IQQA 4NWBA 1FE0A 1AUSL 2HVZA 3KG4A 2CJYB 3CJ2A 2XMUA 2RKIB 3MAAA 2PI5A 4HL9A 2YQ0A 3M30B 3RU0A 2BRLA 2XO7A 5HK4A 2EFPA 3GZ7A 1PO6A 3I55S 2Z0GA 5D4OA 4NLTA 5LJ5Y 2B9WA 4M5KA 3OJSA 1SKRA 4QOTA 4F4ZA 1S9GB 1NMEB 1SPBP 3ENVA 1U0SA 5L1LA 4LF4J 4J9QA 3PX0A 4NLPA 3EZUA 5J2QA 3UFCX 2EFNA 2BKPA 3T3FA 3FCWA 5GMEA 2W8KA 5MLCV 2A6MA 2WVEA 1WEYA 4PAAA 2CPZA 1S9FA 1VQKS 2FC9A 2AYGA 1HNWJ 3KK2B 3MM6B 4R25A 4ZVFA 2UUCF 4KPCA 1U1QA 5KT6A 5A6PA 2DR5A 2B9YA 1S1TA 1VISA 4TQSA 4KB7A 2D9OA 2DHHA 4C6AA 3PACA 1LWCA 1U8WA 2BJ7A 4ZIVA 1TL1B 2AYBA 4J9KA 2R9LA 4DPOA 3D68A 4C3LA 1KD1T 4X62F 2DR8A 1B7FA 4JI2F 4A48A 4L74A 4USMA 2JLFA 1N6QA 2M8HA 2JOQA 3AOAA 3BGLA 2RS2A 2GS8A 4Q8EA 4OLPA 4RBUA 3IR5B 4DSLA 2X3GA 2ZC3A 3EYZA 1QSSA 2XS2A 2XTJP 1F2GA 1X4AA 2EK6A 1FT8A 3RUBL 2AKWB 1RAOA 2DNOA 4NI2B 2ZFHA 2JJ4D 3UN5A 1BHNA 3GR0A 3BN7A 3RG6A 3SSQA 5KFFA 2HFOA 1BLUA 2UVVA 2OMOA 3P5BP 4C48A 2YPYA 4X4SA 4EU0A 3L7UA 4I2PA 5HLFB 2BE2A 1WHVA 4FYXB 3F44A 4CLSA 4DR1F 3IO1A 1T94A 2EKYA 2MZ1A 2DO0A 2AP6A 1SKWA 3LGNA 1H7XA 2PGCA 1TAQA 1KSPA 4KJIA 1U4BA 5D3GA 2E1CA 3G8QA 3TARA 1FWLA 4OHYA 2GGPB 2XMAA 5F8MA 3PHTA 4S0MA 1N36J 3VGTA 3H90A 3EUNA 1JJ2R 1YJWS 4I6AA 1NSQA 4DV0J 3ZNJ1 4DQRA 1FJGF 3B4DA 1Q8LA 2FVCA 4IQMA 3JB9k 1MN9A 4DV6J 3CTRA 2RHQB 4PPDA 4HKQA 1EP4A 3ZZOA 4DL7A 2XYGB 2DGVA 2CAJA 2F8MA 1UZDA 2P8IA 1S57A 3V81B 2D3OR 2XNRA 1IBKF 2DCLA 3WHIA 3AA8A 4RW6A 3KLIB 3Q8SB 1RADB 2XWYA 1LWFB 1HYSB 1TV6A 3HXMA 3OFHA 4F02A 3FEYB 2FJEB 3CDBA 4ZCIA 1RWVB 1VLYA 3ZTQA 3H7HB 1IBMJ 2V4RA 3BQ0A 2CPYA 2IC3A 4ILRA 3MR6A 1RE1B 4ZPVR 3RBDA 5L8RC 2LKZA 1OY8A 1KFDA 3DLKA 3PIOQ 3KLEA 2FLNA 3QIPB 1H2VZ 4AE5A 3R8YA 2Z30B 1TK0A 4AYBD 2WSEC 2VPYB 4OZ1A 3LAMA 2ZHBA 2DH9A 1KTQA 2DIUA 2F40A 2C3MA 4LFAJ 4YY3J 2N3OA 1TFWA 3K2YA 4Y34A 1U09A 3FKBA 3CMES 3UVJB 4LSNA 1JK9B 3H5YA 2W24A 5L46A 3HPOA 1BQMA 1URRA 1CQNA 1Q53A 2YPZA 2DNKA 2DY1A 1PG5B 1SUQA 5F3ZA 3CDUA 3DKDA 4TKTA 2AT1B 1E6VA 2ZJPQ 1GT8A 1F3VA 2KRBA 2IA0A 3K58A 1Q8IA 4FS2A 1BD6A 2HVEA 4I6WA 4CO5A 1T3NA 1N36F 2UXDJ 4WCEQ 2CQHA 5ETSA 2ZHAA 4K8RA 5F8JA 3D0IE 1PYSB 4DV0F 3LWLA 4JV0A 5JVGQ 1RCOB 1RGVA 4ZPDA 2VQFJ 2COLA 2HVDA 2VFRA 4DV6F 1P27B 2J6SA 2WK4A 3GV7B 2PT0A 1Y3KA 2M52A 4MIAA 1S6PB 3I5CA 1HBUB 2IBKA 1FRKA 1VHIA 3U02A 4LIRA 3EGWB 2WCXA 5D4NA 2MZJA 3PJ9A 2VBXA 5LSOA 1F2HA 2GV1A 1RU1A 2QMWA 4URSA 5FD1A 4DMZA 4RNFA 2HHHF 5LMNF 1NHUA 1EQMA 4LF9F 3M32A 2IAJA 4L75A 1QE1B 2LXIA 5IWAF 2KXFA 3D1OA 4RW7A 2UP1A 3HVAA 4GKKF 2WAQD 1N34J 2YVSA 2KKHA 4DPWA 2DNQA 1IKXB 4LQ9A 3OL6A 2AGPA 1R8CA 1J2VA 2OELA 3MOZA 2RDJA 5KFSA 1RA6A 2U1AA 4WKRA 3EGNA 1CLFA 4V19X 5H9FJ 1VJQA 1OQ3A 1TL5A 4B3OA 2DGUA 4ZPCA 4HTJA 1BE4A 1ULRA 5A8KB 1F9FA 3PRBA 3V6HA 2P6SA 2RSQA 2MHEA 1JXEA 4EO6A 2XMVA 2DNNA 1URNA 3AOBA 2NZCA 4J9RA 4EBEA 1PIEA 5EN1A 4N8NA 1HNVB 3CJ0A 4JUZA 1KLMB 2CDRB 1LXJA 4LF8J 3FBEA 4O44A 4TY8B 2CJAA 3BQ2A 4KY3A 5IXUA 3QT8A 1TL3A 3BGRB 3G6XA 3KK3B 3IWNC 5CYQB 5F8GA 2HZVA 3TUPA 4J9MA 1WHXA 4H54A 3NMRA 1BUXA 2L41A 1TU0B 2HIYA 3MPYA 4ZA1A 2PA8D 4LBPA 1H0HB 4CLKA 3ELHA 1R31A 5IT9Y 2WVCA 3MI7X 2I9SA 3R27A 1Z2LA 4AD6A 3GONA 2YX7A 1K8AT 5ETNA 5F8LA 1D09B 1NZAA 4TU9A 4Q7AA 4KYZA 4WYWA 1RTHB 2W01A 1N48A 1NK9A 3LPEA 1JLBA 3NGRA 5KFAA 2DRDA 1LOUA 2A1BA 1O6XA 1VHFA 1WEXA 5HMXA 3OFGA 3TQ1A 4B9SA 1RLDA 4ZJLA 4FVMA 1HBNA 1VRUA 4UQTA 4GKJF 2YNIA 7FD1A 2HGLA 1UVJA 1SL2A 3P4UB 1Y9OA 3PKMA 1MN7A 3VAMA 2ZDOA 1TKZB 2LECA 3I4HX 4DQQA 2X7IA 4DV3J 2I0XA 1ZS6A 4USJC 2DGOA 4DBQA 4OYZA 2FLOA 2YKNA 1K73T 4OYXA 1BGXT 3PYDA 2AV5A 4ZS6A 3GMGA 4NYPA 1HNIB 3OLBA 1GMUA 2ZITA 4M5DA 1NJIT 4D3HA 1IM6A 5KG4A 4CNYA 3KK1B 3TZXA 2BJEA 3KMSA 2W7OA 2IPOB 2J8SA 3DOKB 5JVHQ 1R0AA 2HWTA 4CLFA 1L3TA 2W9CA 4EBDA 3CCUS 1U1KA 2GX8A 4L73A 2UV8G 4IH6A 1Y11A 5LSLA 3H5SA 2W2PP 1TAUA 3EJMA 5EUHA 4OX7A 4CLZA 4FYVB 2J6UA 2EVZA 4GC6A 2XGPA 3RB0A 3ITHA 3GB0A 4O23A 2DPIA 4X64F 3M6UA 2OEJA 2JHEA 2X51A 4ZVEA 3UN2A 2RDIA 4K4ZA 1PAUB 3BDPA 2AMCB 3AXKA 2MJUA 2KU7A 1VQ4S 2VF3A 3TO8A 1R3NA 2L48A 1P9QC 1B7YB 3S1TA 2MZSA 1T3OA 4M1KA 3IG1A 3JQMA 4NXNJ 1CJVA 3CF5Q 5A2QU 3GV8B 4NZ6A 3KYLA 1UAWA 3GLJA 1UEKA 3PHEA 4X4OA 2CZVC 1CS4B 2HNZA 1FX4A 4KO0A 1I1GA 4NE9C 1HW8A 2ASDA 2IYIA 1K47A 4OYWA 4MJKA 3DOLA 4KPYA 5HI7A 4DS5A 4NCAA 3KLFA 4IFVB 4O4RA 2H3EB 4OHVA 2AD9A 4KT0C 4RJVA 3OPKA 4W98A 2B51A 1TMMA 4JI3F 2XY6A 3TA2A 3J7ZT 1A9NB 2W4PA 3M2RB 2CWXA 3D5MA 2KN4A 3K7RA 1X0FA 4F8RA 2HRYA 1BQXA 3UR0A 4YB6A 2KVIA 3UDEA 2FJVA 3I5BA 2FHKA 2BA9A 4OJHA 2KJWA 2EBGA 1IWAA 3W2WB 1H6KX 2XB2D 4IUFA 1BWVA 4CTAA 4DR4J 3MCNA 2HBYB 2ZVIA 1X4FA 4ETZA 2IM2A 3AA9A 1SB6A 5A8WB 3UD5A 2N7CA 2E9TA 4WWSA 5IV3A 2QEXS 4UOCA 4V19J 3DLBA 2ADCA 5IM0B 1JX4A 2YH0A 3ZXWA 4JI0F 4HH0A 3D6FB 2DNGA 2NCKL 1RT7A 1NXIA 3TAMB 4NXNF 1WC4A 3CD7A 1HR0J 4PWDB 2L9WA 4X4RA 5F41A 2G9OA 2WSFC 1IKVB 4GVBB 5FLXY 4DSEA 1VQ9S 2MQOA 3RRGA 2Y8WA 3AQPA 4GO7X 1KOOA 1EETB 2GNKA 4P10A 3TVYA 3MCOA 5DDQC 1NB2A 1YRXA 3D0HE 2E7XA 1PILA 3HHLD 2YH1A 3UCUP 1SL1A 3PZPA 2HQCA 1TELA 4NOHA 2DISA 1Y3JA 3HHEA 1DTTA 2AEMA 3D3CJ 2GIRA 3EVMA 2BM0A 4H4OA 1CVJA 2I8EA 2LP4A 4G1PA 2R2TA 4LFCF 4DLEA 4QR2A 3L4BC 1VBKA 1O0PA 2Y9HA 4YOEA 4URGA 2HPUA 4M5IA 2IM1A 3OFFA 1M0SA 1T9VA 5KOXA 2YBVA 3IR6B 3EPGA 4JV2A 1RAEB 1W26A 4TYAA 3AXMA 4O4GB 2Y1LB 1F1BB 1CJTB 1HQEB 2GHWA 4ZJOA 5D15A 2YQ3A 4OIXA 4OZ5A 2EBEA 4Y65A 1FKOB 5LL6d 1S4FA 4PXCA 5J2MB 4WU2A 4DR5J 2B6AA 4PXEA 1SQEA 4N77A 4CDIA 5K8NA 4YR3A 3SCLE 5I42A 3I87A 3S7RA 4OJ3A 1RXOB 4EI2A 1H7WA 1B0TA 2XC9A 2BMBA 2ZUGA 1N32J 4ICLB 2ZJRQ 2Z2MA 4RO0A 1VLOA 2K06A 2RHSB 3W66A 4USVA 2V8HA 3FZ2A 1FNMA 2EFOA 3DCAA 3K17A 2NPIA 2CNKB 2Q79A 1S1VA 4KKOA 2HQGA 2QIFA 2W9BB 2VKZG 4EFAC 5EGYA 3J7AN 4KHRA 4YDDB 4RNMA 4RLEA 2CJKA 4DV7J 3OVBA 4DL0C 4PWWA 4Q2MA 2XQCA 4KIAA 3AJ1A 5I3PA 3HKWA 1KQFB 3AD8C 1I5OB 4CLTA 3PW4A 4FKXA 1I51B 1SL0A 2BRKA 1VOMA 5KFHA 4P7TA 1T05B 1JLEB 1ZZNA 2IRXA 1UP1A 3PRDA 1VYAA 2AX0A 3THTA 2CFXA 4WXWA 1WD6A 2Y1JA 2V8GA 3TA0A 4ES1A 2WB1D 1RYRA 1V3SA 2J9DE 1UVKA 3KMQA 1HHTP 1IJFB 2IVYA 1FDDA 3OBIA 2CPEA 1NK7A 3H2UB 4DOZA 1PCAA 2KG0A 2RNEA 4WK1A 4K4XA 3ZFVA 3Q22A 4OV1A 1XMBA 1RZMA 3R5BA 5HANA 3G6VA 3I4PA 2N4CA 5D8HB 3GWCA 3TP2A 3CMAS 1HHQA 3L7PA 1RT2B 1WG1A 4ECRA 1C1CA 2GQCA 2KHDA 2JRSA 2WBMA 2R7TA 3CJ5A 4OHWA 2ASJA 4K0KJ 1TVRA 1T0TV 1VQYA 5LMUF 3QGHA 1JNRB 1HQUA 1UKUA 1M1KT 4QIVA 4YB1P 2J6TA 1UETA 3Q2TC 4Y2IA 3U7JA 2QTWA 4FNIA 2OPRA 2AQ4A 1BC6A 4NLDA 3BF4A 3OFEA 5THWA 4DF8A 2B8QA 2FQQB 3DRSA 1W2BR 2DGSA 1RTIB 3I6PA 2FJBB 4LRDA 1Y5NB 2BKOA 4UOFA 5J1NA 1ROFA 1LQ9A 3DN9A 4QYZJ 3KWMA 4HYKA 2HFVA 3MMAB 2M70A 3R1HA 3DRRB 1D9AA 5EWEA 3K59A 3C14A 4OI1A 2UUAJ 3QFWA 3FSXA 3K57A 2VJVA 1FK9A 5ITHA 3QGIA 3JQKA 1CQMA 1MWQA 2HMIB 1VRTA 5BR8J 2DNLA 3J80Y 3POTB 3H8YA 4QWBA 4DUYF 1RWMB 1N0UA 1C0TB 2M5YA 4E0DA 3I0RB 4NLGA 3R5CA 5BYQA 4Q0BA 4DSJA 1VGYA 3U1MA 4KGZB 1UPPA 4G1QB 4B3SF 4DR2F 2LXFA 2F65A 4QW8A 2VL1A 3M30A 3R7NB 1JLAA 5J1EB 3MUTP 1S1UA 2ROGA 3A8EA 2XNQA 2YWEA 1UFWA 3JTNA 4WJBA 4IG0B 2R3VA 3N01A 4G1IA 5CABA 4NLXA 4IG3B 3MOJB 3NWGA 3UDVA 2HW3A 5KG7A 4FXDA 2HHVA 3HFKA 2CG8A 2QYCA 1SH3A 2I2YA 4PQUA 3LPYA 3QWPA 3I31A 1JKHB 3RW7A 4ZLLA 5HJXA 2F5GA 2DTJA 5B0GA 2BJ1A 3I0SB 8AT1B 4PPZA 1DURA 2Y3YA 3DDIA 1KONA 2PMZD 1L3KA 1YBUA 5EWFA 2CDQA 1TUGB 4ZOSA 5GAGI 2LYVA 3FBFA 3OR1A 4HACA 4C7QA 4DR6J 2YX1A 1ZA2B 4IO1A 2Z58B 3HMJG 2UVUA 2UU9F 3H2VE 2JH3A 1F5BA 3KJVA 1B99A 4HHHA 4OX8A 2CRLA 3MM8B 1LWEA 1XNRF 2CPXA 3KNGA 9ATCB 4TY9A 2ZZMA 4ETXA 2E1RA 4WFNQ 4Q2LA 2F4VJ 3O6QA 1G6BA 2V2QA 1LK7A 2RJZA 1KS2A 2QRRA 1Q95G 3NAHA 2B7BB 4O3PA 2YKMB 5DDOC 1QLNA 3OV7A 5F8IA 4LT6A 1U26A 4LR7A 2VDIA 1UVIA 3TJAA 1JLQA 3LALA 3CMQA 4NI2A 4FYDA 2FGOA 1TL7A 3PIPQ 2XZWA 3QO9A 4IRCA 1XWLA 4UQGA 2BQUA 1M5OC 3EDQB 2G4BA 2VDHA 2ZH3A 1SJ4P 1HBOA 2XS7A 2B5JB 4UZCA 3MCSA 2W9AA 3M8PB 4U7UK 1YRTA 1HQ2A 2KYXA 3K5PA 4QWEA 3WQPA 5GAGU 2DVIA 3DYAA 4ECSA 4DV1J 4J91A 3S6EA 4J9UE 2CQGA 3GJRB 2E9ZA 2JDJA 2FJXA 2FJDB 1HWIA 2ZZNA 4MYTA 3DXBA 4Q45A 4YMEA 5IV4A 2JVRA 1KVJA 2JX2A 3MPWA 2KM8C 3QNWB 1W7WA 1FRHA 3KNAA 1C4CA 1JWWA 4WTYA 1KEKA 4KC5A 1UJ6A 5HBMB 1SVDA 2UVWA 3HHDA 3HJVA 1NKCA 3NOCA 1SQFA 3E51A 4Q44A 2VBWA 4A8KA 4B3MJ 4F0KA 2BOPA 3RYLA 1HBMB 3NLCA 2YNHA 4ITSA 1XNQJ 4RW9A 5HP1B 1RWXB 1RWWB 1HPZA 1S6QA 2KZMA 1J5EJ 1U2CA 2HSEB 1NCLA 3FMBA 5D0HA 1LWFA 4DG1A 5ETRA 4DZ6A 2VD3A 1OSCA 2R7QA 4K59A 2JVOA 1SJ1A 4JI8J 3W9IA 1S0OA 2CQ0A 2LQ5A 2B4UA 3QRRA 4NEZA 4UY8T 1U7LA 1R8BA 3PYEA 1U1MA 1FRXA 1MLAA 2Z56B 3MEGA 3A3NB 2PIIA 2V8PA 1F5CA 1X4BA 2DGXA 3AQOA 6FDRA 2ZOGA 2ZOMA 2IM0A 2V4JB 3QJJA 5ETOA 3GFZA 2F63A 2MKJA 3QSIA 5DG9A 2ASYA 4H4MB 3V6JA 2BR0A 2XM3A 1QUPA 4NXMJ 4OL8A 1AFJA 5KFYA 1D8YA 4ANEA 1YKWA 1XK8A 1SBRA 2HWHA 3BYRA 4KHPJ 3UDCA 4I2QB 4N56A 1S97A 5F8NA 3NGUA 2NSBA 3CT9A 2FHJA 4E98A 3H5XA 1REGX 1YZ6A 2AGOA 3KLGA 1DARA 1AZSB 2RAQA 3MUVP 3GIRA 1VDHA 4CYUA 4LR8A 1G7CB 1V9OA 5A76A 4IH7A 1HI8A 2Y0SD 4DPXA 3HZGA 3N9UC 2XO6A 2R7WA 2OI2A 4ANCA 1XNQF 5H9FK 4FP9A 3NGSA 2F9DA 2E1AA 3A3PB 5E3CA 1N54B 2V67A 1LXNA 2V9WA 3EPIA 4XK8C 3W65A 2KL8A 2LU2A 3W2VB 2ZD1A 3QT5A 5D77A 4DFMA 4YEAA 3SDEB 2VICA 2QYGA 4HHUA 4DN9A 2KT5A 4EK2A 3CJRA 1JLCB 4P73A 3TA1A 1UVNA 1TP7A 4QR1A 2OIHA 4QIGA 3PDNA 4C8MA 4OZLA 2FHOB 2HS0A 2Q66A 4FVCA 2GJIA 2DRBA 1IKXA 4Z7CA 3H5UA 4ZVUB 2GO9A 1HNZJ 3CDAA 5FDLB 3MR3A 1RISA 5D4LA 3GJQB 4K2XA 3DHWC 2DXDA 1WI8A 1FE4A 3K89A 1RWKB 1N4LA 1V3ZA 1YJRA 3ZNUA 2R7OA 3I9V9 3ZTRA 3GIIA 1N88A 4OYIA 4O3RA 1NJYA 3G6ES 5KFOA 1LW2A 3AT1B 3K8VA 4TYBA 4KHPF 2LQJA 1GAOA 4X65F 1WG5A 3ULHA 3ZZTA 3NNHA 3D1QA 4B3TJ 3DLEA 4F3QA 2DHSA 4ZPBA 3MMCA 5KT3A 3ETOA 1S4EA 3HP6A 4PG4A 2EI5A 5AXMA 2RE1A 3RAMA 2BACA 2RS8A 4C98A 3CW2C 1ACMB 1QTMA 3CEDA 4LIWA 2FLLA 2NSCA 5F0UA 1KWMA 3R9LA 1IQZA 2BEFA 2HHXA 1YJTA 4X4PA 4BWJA 1SKSA 2HBQB 1NU4A 4H4KC 3NNCA 3CCZA 1MMLA 4HTIA 3CCLS 1UMJA 2QSWA 2BDPA 1SV5A 1FWKA 2XULA 2QN6B 4RR5A 2VKRA 4JV5F 4HH1A 4Z7YA 4L6V3 3UD4P 3D9BA 1N8RT 5K8OA 4ZP9A 2DGQA 2HBRB 1VQSA 2G1DA 4K4SA 4IDKA 3VTIA 2Z2ZA 2V50A 3MM7A 3M4XA 1R0CB 3JTOA 3AB2B 1N5YB 4DR3F 3OR2A 3CCJS 3M6WA 3RRHA 3QPIA 4OI2A 1SI9A 5KG0A 2FZKB 4FYWB 1RT1B 3TI0A 2NUHA 1KTVA 3F41A 4CNZA 2UXCF 4GMKA 1XMOF 3P5TL 4JV1A 2IDLA 2H1YA 3TOQA 3F56A 1DFDA 4ZCLA 4OYOA 1JLGA 3LP0B 2HQ3A 1APSA 3BSOA 3R5GA 2ZJQQ 1HMVA 2OGUA 8ATCB 1NKBA 1N5TA 1NHKL 1FHTA 4ZITA 4C11B 2BJDA 5SUHA 4J7CA 3FFIA 4ZCKA 4IR1A 1Q81T 1XIQA 4NRTA 1VJWA 1R8AA 2R8HA 2IBOA 4M5GA 4M63A 2BABA 3W7BA 3UWTA 3MEDB 4B3RF 1C0UA 2M2BA 1H3DA 1WJ9A 3DU5A 1YITS 4HT7A 5E0OA 4ZVPB 1MSWD 2ZH5A 5A0YB 3M2UA 1M1GA 4RW8B 2OPSA 3PVXA 1YJ7A 4F4XA 4OI4A 2RRNA 1MU2B 4Q8FA 3FUYA 3W8PA 4IFYB 2ZDPA 2CXEA 3OUYA 2KG1A 1NPPA 1AB8A 3RTVA 1RTZA 3T5HA 4N47A 3BB5A 4NCBA 1LW0A 1WKJA 5C42B 1Q16B 4NLUA 2A3JA 3IRXB 2E5HA 4R8UA 3GQCA 2A2DA 3BN4A 2F3JA 1SKUB 1TKXB 2L9NA 2OLWA 3LF0A 1QJHA 1TK8A 2AGQA 4HLBA 2V5HG 2CPDA 5CZXA 5J2NB 1NK0A 3DMJB 2YWKA 1DTQA 1MROA 3H40A 1CPZA 1NPKA 2OD6A 2QE5A 9RUBA 4TXSA 3GYNA 3N79A 5I3UB 3WZ0A 1FXRA 2QFIA 3VAIA 2VA2A 4DSFA 1FESA 1BQNB 1Q7LB 2VFUA 4F2SA 4KE5A 1Q1KA 1GNKA 1U45A 3E8OA 5T41A 3T6BA 3TQEA 3ILOA 1IVZA 2R2UA 1T9TA 4NLQA 2KRRA 1M5KC 5E41A 2GO8A 1U0HB 2HQDA 1VQ7S 1NKEA 1UFLA 4LF1A 5E2QA 3SQGB 2HVIA 1S1XB 2VUGA 2XHWA 5HSPA 4DFKA 2N4DA 2AX1A 1EAYC 4DV4J 1Q79A 2LXUA 2RU9A 4YQWA 2WRMA 3G6YA 3PEJA 2KXHA 2OD4A 4ES3A 3TJ8A 3E01A 1AA1B 4F3OA 2MKSA 1JXVA 2V2VA 3VGUA 2EC0A 3MAAB 4EGLA 4G3IA 1Y4ZB 2RB7A 1S10A 4I0WA 2C2ZB 3MURP 2ATCB 3A3OB 4CP5A 1GEHA 5M2UA 4KR0B 4OHZA 4RBVA 1D1UA 3DDKA 3AODA 4JI1J 3OL9A 3IAM9 3CIZA 2HGNA 4O0IA 2DD8S 3JSYA 4PWDA 5J2QB 2UV8A 4USKA 1F60B 1IKVA 3BS9A 1Y0HA 4USUA 1CSJA 4I67A 4AL5A 5ETMA 3JAMY 3WC2A 4A8XA 4A8QA 2BBEA 3MM5A 3B78A 2M8DB 3NBPA 1SQGA 2BJ9A 2POKA 1I6JA 3EE3A 1UZHA 2XBPA 4Q5VA 1S1TB 1P6TA 1UJ5A 2OFHX 2D74B 1LWCB 4YUDA 5KFBA 5GAEI 2N82B 4P2FA 2FDNA 2UUBJ 5I4MA 5M2RA 5KG6A 1S48A 2XG8A 1WF0A 3OVSA 1ZM4A 2MQLA 3OTDA 2CNOB 4J5OA 3Q0AA 4DV5F 4FF1A 1YHQS 4ERDA 1N6QB 2CQIA 1NK4A 1KVIA 3QAUA 4XTTA 4K50A 2B8PA 4F4KA 4LRAA 5LXRA 2YXLA 3GE9A 2MQMA 1SJFA 1FRLA 4GC7A 2HNDA 2F7VA 4DPYA 1IKWA 3GU0A 3BR8A 4DFPA 4WIIA 1Y5LB 4K4WA 3EMTA 3PY8A 1A7GE 4L72B 1DQAA 2KTQA 2Q6BA 2HHUA 1RAIB 2PMWA 2ZKUA 3GFYA 5J2MA 3TEHB 4NASA 2FJAB 5KFXA 2DR7A 1NEEA 2RVJA 3G82A 5ADZA 4KQZA 3IC1A 4WFYA 1FEHA 2GIQA 1U25A 3MTJA 3BSNA 1HWUA 4TU7A 2G1HA 4I2PB 2BE2B 3DRPA 4CLLA 1VQLS 3RBZA 1S76D 2Z57B 4ID5A 2VG6A 3UW1A 3ONQA 3K8WA 3VAHA 4FZVA 1TK5A 2V8DA 3HHLB 3V6DA 2DT9A 4NLVA 1O5JA 1KLNA 2J7UA 4DJBA 5D3GB 1YIJS 5GADI 1JXLA 5KT4A 1YZ7A 3FNNA 2XSFA 1WG4A 3MF5A 3O3LA 4H4KA 2BM1A 3CULA 2KJVA 2FVPA 1FVSA 2KYZA 4A4JA 3OTEA 1XN9A 5HMZA 2DCUB 2BZ2A 3BYPA 4P71A 5AJ3F 1XJWB 3EDRB 4LF2A 2PE8A 2C3OA 4PCQA 1CULA 1EP4B 1U1NA 4TNOA 4U95A 3QZ7A 3P45B 2XWXA 4YR2A 1VK3A 2GVZA 5G4DA 1GX6A 4CM2A 4A8OA 1VBXA 2XS5A 4OX9J 4F7VA 4AL7A 3FC9A 4W92B 2OP5A 4RW6B 3MMBA 3HFZB 3TUZC 2LQBA 4AQYJ 4QBUA 5ETLA 1UEVA 2VG5A 5JJBA 5GMDA 2G0JA 3Q8QB 1KQGB 2PA3A 5D6GA 3Q8PB 1WNEA 1HIYA 3DLKB 3BO4A 3KLEB 5KAKA 2ROEA 3Q86A 1FD8A 3TW0A 3C46A 1REVA 4I4BA 1NM2A 1VC5A 2GAHC 4NA2A 2FTRA 2WVFA 4X4UA 5AE3A 2XHCA 2VOOA 1N33J 4ALZA 2E1PA 4LSNB 5C24A 4QYZK 2ALZA 4JI4J 1YLXA 1BQMB 3O1LA 2E66A 3DXSX 2G13A 3EM1A 1FDNA 5D4PA 3MXHP 3VAGA 3CJSA 3J81U 3C15A 1SIWB 2JL9A 1E6VB 2VH7A 3PEHA 3QGGA 1QVFR 2K8GA 2MQNA 5ETQA 5F8HA 4A46A 2RF2A 5MAOA 2BOAA 2XMTA 1T9WA 3FEXB 4DV2J 3CD5A 2WOMA 2X1FA 4WE1A 3PG9A 3GV5B 1YI2S 4LFBF 3ZO7A 1DHMA 4F4YA 1F9EB 3LOUA 2LEBA 2O66A 3G87A 4DSIA 4DR7F 3R97A 2CYYA 4DLGA 1WOPA 4P74A 1I3OB 5EX0A 3LP2A 2CPHA 2C3UA 2XGQA 2OPQB 4I7FA 1YSJA 4ZVOB 1Y10A 4ZVHA 2NREA 4LJMA 4DQSA 5KG5A 2LDYA 5L38A 5KFJA 1QD1A 5KFUA 3M1VA 5B0BA 2GFFA 1N0VC 4OX9F 5CQGA 3SFGA 2HRTA 2OTLS 3CUNA 1NSKL 1U1RA 2HWIA 1H38A 2V34A 1AXQA 5J1PA 4AQYF 4K5RA 3AFGA 1S1WA 4TQRA 6FD1A 1PC4A 5GVQA 3M32B 2IAJB 4B02A 2B0GA 4NMLA 2CADA 4AL6A 4JI5J 4WYLA 3KUGA 3IN5A 4RW7B 4JI6J 3V4IA 3RB6A 1TQLA 1YGYA 1FKPA 1DY3A 1YG0A 2QFJA 3D7SB 3OHAA 1CJKB 4NYZA 3T1YJ 4X4NA 3VQSA 2P9CA 4P75A 3AB4B 3GSDA 3PX4A
chains in the Genus database with same CATH topology
1CC8A 4OZNA 4EUVA 3TA0A 4ES1A 1JLGB 5CZVA 1SJRA 4C4WA 2WB1D 4ZCMA 1ZETA 1Q78A 1RYRA 1V3SA 1SIZA 4MKYA 3C6TB 3VAFA 1GXUA 4X4QA 2J9DE 1UVKA 3KMQA 3L3CA 1HHTP 1IJFB 4B3OB 2IVYA 1SC6A 1FDDA 1U1LA 3OBIA 2CQ2A 2OFGX 2CPEA 4RWXA 3FZBA 3MD3A 3IS9B 3D2WA 4ZPWR 1HMVB 4DV1F 1GH8A 4QU7A 4Y3CA 4DQPA 4ECUA 1NK7A 4B9UA 1P1TA 3H2UB 2J9CA 2UZAA 1N5QA 2CJBA 2WSCC 4MTPA 4DOZA 3ZZPA 5DM7Q 2KG0A 2MKCA 1R89A 2RNEA 2ZH8A 2E9RX 4WK1A 2LDIA 3HHLC 4K4XA 1Z1ZA 3BSCA 1YQHA 3ZFVA 3Q22A 1WF2A 3PV8A 2Y1IA 3FFIB 4OV1A 5HMYA 2AJ4A 2WB4A 4BS2A 4AUKA 1XMBA 3TRGA 3TANA 3T1HF 1WHYA 3KKFA 3AH6A 3R5BA 4IG0A 2VA3A 2IMOA 3G6VA 5CCMA 2GQ2A 3I4PA 2AJQA 2N4CA 4CO1A 2DGTA 5BYSA 2H9ZA 2E44A 4IH5A 3MM9A 5L1IA 5D8HB 1C0UB 1U2FA 4I6YA 1FKAF 4IOCQ 3GWCA 4O44B 3TP2A 2KFZA 4EYHB 4DV2F 3CMAS 3L7PA 3CB4A 7FDRA 3BZQA 1RT2B 2DNRA 4YP3A 1JKHA 1WG1A 4ECRA 3KHGA 2VG7B 2Q43A 1C1CA 3BEGB 2GQCA 3US5A 2KHDA 2JRSA 1TL3B 4RUCA 4USHA 3DLHA 2WBMA 2R7TA 3DRXA 3CJ5A 1JNZB 2UUTA 3B82A 3ENQA 3NRBA 4OHWA 5CCLA 1ZM2A 4LF4F 1VQNS 2MZRA 2CPFA 3M2UB 2DRAA 4B3MF 2ASJA 3V2UC 4C3MA 4J9LA 1KR4A 1SH0A 1TVRA 1VQYA 3D0GE 2OPSB 2HFNA 2AJ0A 5LMUF 3QGHA 1H2UX 1JNRB 1HQUA 3MFIA 2FJWA 3PM9A 4QZVB 3HK2A 1FNXH 1NO8A 1T8EA 4MIBA 1YJ9S 4QQBA 1UKUA 1M1KT 4QIVA 2CQDA 4YB1P 1J5OA 1S6PA 2J6TA 3EXYA 3CC4S 4C8OA 3R5DA 3OUYB 2KHCA 1HBUA 1UETA 3PJWA 3Q2TC 2OTJS 4ECVA 1IKYB 4A47A 4Y2IA 3U7JA 3OXGA 3DM2B 2Z8QA 1R6YA 2UXBF 1KN6A 2KM8B 4QJVA 4NLWA 1HNWF 4OX6A 1U48A 4FNIA 2OPRA 3RR8A 2RQCA 2AQ4A 1BC6A 4DEZA 1Z4UA 3NCPA 4CO3A 3J7YI 4NLDA 1N5YA 3BF4A 3OFEA 3T5KA 2DHAA 3THPA 1J5EF 5THWA 4DF8A 2KH9A 2BYCA 1LW0B 4PR6A 3DRSA 1W2BR 3M2VB 3MM8A 5EDWA 4EWTA 2DGSA 1RK8A 1RTIB 2R7VA 3I6PA 1Q8BA 2X1GA 3BGUA 5E7OB 3MTKA 5KFEA 1DRZA 2EFQA 4NRUA 4R8UB 3HZEA 2Y1RI 2PD1A 2MYFA 3MHYA 4ZP8A 1RT1A 2FJBB 1Y5NB 4JI8F 1JLBB 2ZBIA 3JYTA 5J1NA 5KFTA 4Y28C 4ECYA 4ZHRB 2W8LA 1ROFA 1LQ9A 2IJFA 3DN9A 3NGDA 4QYZJ 3KWMA 1QE1A 4HYKA 3T6JA 3HKZD 3MMAB 2M70A 2AF6A 2DK2A 2HS3A 1S0NA 4JI5F 3LAKA 3R1HA 3DRRB 1D9AA 5EWEA 5HROA 3K59A 2MB0B 3DLGB 3IGVA 2VV5A 4JOUA 4X2BA 2J7WA 2AW0A 4ZLPA 1YWXA 1OSDA 2LQ9A 3TUJC 3M6XA 4M8LA 4OI1A 4RU2A 3IXQA 1N5SA 1U8SA 3PW5A 3FSXA 1DTQB 5KFZA 1MROB 2YNGA 3ZZZA 1HBNB 3K57A 1VRUB 4QIFA 4U6PA 3MECA 5BYRA 1FK9A 3DLJA 2YNIB 5ITHA 3LP0A 3Q2SC 4O3NA 2RMLA 5KFVA 3CXCR 3QGIA 2OH2A 1CQMA 2GMLA 2FC8A 2HMIB 1VQOS 1OIAA 1VC6A 4FXVA 1VRTA 3FVYA 4PXBA 2DNLA 5A8KA 4NXMF 3J80Y 2RQMA 4KGMA 3GILA 3H2LA 3G96A 1FA0A 1RTDB 3POTB 3JTPA 2XCAA 3H8YA 2B5JA 1VI7A 3GIJA 1RT5A 3H4DA 3IAS9 3SYZA 2VONA 2MY7A 1Z2ZA 4CI0B 1XMQF 1RI7A 4QWBA 4RX6A 1VIOA 4DUYF 4ZK7M 3DLLQ 1Q7YT 1N0UA 1C0TB 5F3TA 4WFAQ 4PWUA 3CSKA 4Q43A 2YKNB 5KT7A 3TVKA 2WW8A 3DDNA 1HNVA 2RH3A 2BANA 2WTFA 4IOAQ 4E0DA 1KLMA 3N6LA 3I0RB 1TR0A 4NL5A 4NLGA 3MEEB 2J8AA 2FY1A 3FSYA 4NPOA 3NGKA 3ZZUA 1HD0A 1OO0B 2ZH7A 3HX9A 3TNVA 3R5CA 2DBBA 5BYQA 5F9NA 3OTOF 3CJKA 3J7YU 5G0RA 4M5DB 5L39A 3CCES 2LA6A 4Q0BA 4OI0A 4MFBA 2CQ3A 3MEDA 5AXKA 4DSJA 2LEPA 2FPHX 1D9DA 1VGYA 3U1MA 1HNXF 1R43A 4TY8A 4ES2A 5KFNA 2PEHA 4B3SF 4G1QB 4NA1A 4RNOA 1HL6A 4DR2F 3V4MA 2J0XA 2DPJA 3NP5A 2LXFA 3L09A 5KFLA 2HHSA 2C3YA 4QW8A 2VL1A 3M30A 2DO4A 1JLAA 2JFKA 2DNZA 5J1EB 1VQMS 3K0JA 1BY9A 1OPIA 3BGRA 3KK3A 2LVWA 3ISNC 2P6TA 3VAKA 1R0AB 3LP1A 5KG1A 5CYQA 5DQHA 2FHMA 3I5AA 3MUTP 1NH7A 1S1UA 2FVQA 3CPWR 1HARA 3M6VA 2W9CB 1VC0A 3NL0A 1S0MA 4RW8A 2R7SA 2ROGA 3A8EA 4N41A 2XNQA 2W4DA 3RW6A 3FRZA 3VCDA 2YWEA 5HBMA 1UFWA 2J0SD 3JTNA 5KFGA 3PJXA 3SFUA 2R8JA 2VBZA 1MU2A 4WJBA 4IG0B 5SZTA 4IFYA 3N01A 4G1IA 1X5SA 3BM7A 4NLXA 4IG3B 4RKUC 1FXLA 3MOJB 3NWGA 1YJUA 2MQPA 1RAJA 3QWUA 5KG7A 2HW3A 4FXDA 3DNCA 2HHVA 3E01B 4NLYA 3HFKA 4OLOA 4DX8H 2QYCA 3KLHB 4R0JA 4X4TA 1SH3A 2MPUA 2I2YA 4PQUA 3CD6S 3LPYA 3QWPA 5DM6Q 3I31A 2VOPA 5K5MA 1DBDA 1JKHB 3RW7A 2F8EX 5H1SV 1C1CB 2YY3A 5AXNA 1R8HA 2DTJA 5B0GA 4RW4B 4IO9Q 4WF9Q 4HHJA 2H5EA 1U6FA 3I0SB 1UVLA 1JB0C 2D41A 1RTHA 3CDWA 4PPZA 2R7RA 1UA1A 1DURA 3IRXA 3ITHB 3CC2S 3HJFA 3IRWP 1KONA 3MD1A 5IZHA 2PMZD 4FF2A 1IQTA 1L3KA 2GA7A 5KFQA 1S9EA 2HNYB 3BR9A 1TKXA 3X3UA 4ELUA 5EWFA 4URQU 2GJ2A 2CDQA 2E5LF 4ZOSA 1ZZFA 2A18A 3VWSA 5GAGI 1ZAXA 2M7SA 4UY85 1MWZA 2LYVA 4CO2A 3OR1A 1FRJA 1C4AA 1VBZA 4C7QA 1DLOA 3CCSS 2YX1A 2I1RA 1LV5A 4ZP7A 4IO1A 3HMJG 1T03B 1VQ5S 5J2NA 2JFDA 3CGIA 2UVUA 5AXLA 3DMJA 2X1BA 2UU9F 3H2VE 4C8ZA 2JH3A 1F5BA 3OQ2A 3KJVA 2MSTA 3MM5B 4OX8A 3N6MA 3ZZ0A 4F25A 1QAXA 3PKYA 3NBPB 4MYUA 5FIIA 3DRSB 2CRLA 3MM8B 1HNZF 1LWEA 1IM4A 3FQKA 1XNRF 4EBCA 3P49B 3BREA 4IKAA 2CQBA 4DL4A 3BQ1A 4UW2A 4QR0A 2CPXA 3KNGA 1PC5A 4WXOA 2KXNB 1WTBA 2CG4A 2LLZA 3NCRA 5T14A 4M94A 1OPZA 2C2RA 3N5FA 3VQTA 2RRAA 4NLRA 2CIMA 4PKDB 4OJGA 1IBMF 1E6YB 2B3TB 5I3UA 4TY9A 2ZZMA 2K2PA 4ETXA 3HHKA 2E1RA 4WFNQ 1CEZA 4Q2LA 1QAJA 1TKZA 2E7WA 3O6QA 1G6BA 2HYIB 1LK7A 5K14B 1YRUA 1QSYA 2VASA 3OSNA 3X1LB 2Q1LA 2NZ4A 2RJZA 1BQNA 2DIVA 2M88A 1KS2A 3I9ZA 4CH1A 5HROB 2QRRA 3C66A 3IR7B 2IRUA 5J2PA 4DL2A 2J0QD 3IA0A 1DJ0A 2PDAA 2P5VA 5IT0A 5U47A 2YWHA 5KT2A 1K9MT 3NAHA 2B7BB 4O3PA 2YKMB 4Y2CA 5DDOC 4XO0A 3MGJA 1CC7A 2HNZB 1QLNA 4ATNA 3OV7A 4RNNA 1P1LA 2YNGB 4KO0B 5F8IA 4LT6A 1U26A 4J37A 1M5HA 2W7PA 3ZC4A 1HNIA 5L1KA 3MECB 1UVIA 1JLQA 2BVZA 3DOLB 3LALA 4LFAF 4USIA 2ILYA 4FYDA 4YY3F 2DGWA 2FGOA 3PIPQ 2XZWA 3QO9A 3KLFB 4IRCA 1R7IA 1XWLA 4WFXA 2OSRA 4OFZA 4UQGA 2BQUA 4B3TF 4FF3A 3KK1A 1M5OC 2G4BA 5C25B 2ZH3A 4FPRA 1SJ4P 2XLKA 2BQRA 3W3SA 2WBRA 1HBOA 1UW4A 5KFWA 1M5VC 2XS7A 2R7UA 4K4UA 3SQGA 3C8YA 1U24A 2B5JB 3H25A 1NH8A 2APOA 3MCSA 1UA0A 2HNDB 1S1XA 2W9AA 3DOKA 2R8KA 3M8PB 4TN2A 1W2IA 1IKWB 1FJEB 4U7UK 1YRTA 1RT3A 1HI0P 2AJFE 4RNHA 2KYXA 2FVSA 3K5PA 3DRYA 5CYMA 4QWEA 2YX4A 4MAKA 2W7AA 2MQQA 1FXDA 5GAGU 3BGFA 2DVIA 4CT9A 3DYAA 4ECSA 2N3LA 3S6EA 5DG7A 1RT6A 2OAUA 2M4MA 2B9XA 2CQGA 4C8LA 5CH7B 2E9ZA 1NHVA 2JDJA 2FJXA 3B8HA 2FJDB 4ZPAA 2FLPA 4EZ6A 3T19A 3MMJA 2E29A 4Q0BB 1HWIA 5G0RB 3CCRS 1WHWA 3C6UB 5IQQA 2ZZNA 4MYTA 2GMJA 1ZPVA 4NWBA 1JLFA 2Z2LA 3DXBA 4Q45A 1FE0A 4YMEA 2JVRA 1KVJA 2HVZA 1PGZA 2JX2A 2ATLA 3KG4A 3MPWA 3CJ2A 2KM8C 2RIJA 5E5NA 1Q86T 2XMUA 2RKIB 3J7A1 2UUWA 4CQ1A 2ABYA 2PI5A 1L3SA 4HL9A 2UXDF 1FRHA 3M30B 3RU0A 2BRLA 2XO7A 3KNAA 2I5JA 2EFPA 1C4CA 3GZ7A 5DQGA 1FDAA 1XR7A 4ZDNA 1PO6A 3OL7A 3I55S 2Z0GA 2U2FA 5D4OA 3UI3A 4NLTA 1JWWA 1RYSA 5LJ5Y 3GFHA 4WTYA 3DRPB 2ADBA 2B9WA 4YB7A 1KEKA 4KC5A 4QOTA 1UJ6A 4YB5A 3OJSA 2ZH1A 1SKRA 4KTQA 2VQFF 5HBMB 2R2RA 4CZCA 4F4ZA 4HI1A 2UVWA 4NCGA 4PUOA 4ID5B 3HHDA 2VG6B 1NKCA 3H59A 1S9GB 4N76A 4HEA9 2PC6A 4HT5A 3ENVA 4CTAB 4CO0A 3E51A 5L1LA 5EWGA 4QPTA 4Q44A 4J9QA 2P9EA 2VBWA 4NLPA 1JJHA 3SMZA 4A8KA 3PX0A 2BOPA 3C2PA 3EZUA 3SDEA 4C9DA 5J2QA 3H20A 3RYLA 3UFCX 2EFNA 3V6DB 5IFMA 2DJWA 1U1OA 1XERA 1HBMB 2IMWP 3T3FA 4KBIA 3NLCA 2YNHA 3M9MB 2W8KA 4N8OA 5MLCV 3MDFA 4ITSA 2HFZA 1JLCA 2K1RA 4RW9A 4DQIA 5HP1B 1WEYA 3PO5A 2CPZA 5DDRC 1S9FA 2FC9A 1VQKS 4EZ9A 4C8NA 2MKHA 3MUMP 2ZOFA 5H9EJ 2ROPA 1FRIA 1HPZA 2XSJA 5KG3A 2CKWA 2AYGA 3KK2B 4ED5A 3MM6B 5CYJA 1S6QA 4LQ3A 4BBYA 4R25A 4ZVFA 2UUCF 2MMYA 3SXLA 5A6WA 1X9MA 2QO3A 3TAPA 2KZMA 1U1QA 2VFTA 1C1BA 5KT6A