3PJXA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, p32
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
total genus 155
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjxA01
3BREA 2IAJA 3T5HA 3KMSA 3NMAA 3BSAA 4B3OA 2IM3A 4HKQA 4F4YA 1S0MA 2W7PA 1IKYB 5C42B 3JYTA 5EWEA 3DRPB 2E9TA 3DRPA 5KT6A 2GIRA 3IS9B 5DQIA 4LQ9A 1VRUA 1N5YA 5KFQA 2IC3A 1T05B 1SV5A 1RT5B 4ZVGA 4IQXA 2R8KA 3Q8RB 4KHRA 2W7OA 3IRXA 2OPQB 3VQSA 1RTDB 2R8JA 2BRKA 2ZE2B 3QIPA 3Q8QB 3GV5B 2J6SA 2R2RA 2HNYB 4DL5A 4MFBB 2B6AB 2ASJA 3ISND 4O3PA 4Q44A 4NLXA 4Y2AA 4O44A 2XGQA 3IRXB 3M9NB 4WE1B 4TXSA 3I5AA 1IKWA 4K50A 1TKTA 2WONB 3N6LA 3SI8A 3HVTB 3N3TA 3ITHA 1VRUB 3ITHB 3NGDA 4H4MB 4IKAA 5EDWA 3MFIA 3KK2B 4R5PA 4Q6JA 2CJQA 3RB4A 4HU4A 4O3RA 4K4YA 3PFMA 2YNIB 3JSMA 3KK1A 1JLBA 3H98A 4IG0B 5L1IA 2RF2A 1C1CB 2HNZB 1VRTA 4KBIA 4IH7A 1BQNA 1D1UA 3MR5A 3G86A 3DYAB 1OS5A 3RBDA 3GV7B 2YNIA 3KLFA 4QWAA 4IR1A 5MF5A 3PJWA 2B5JB 3SFUA 3BSCA 1S0NA 5J2QB 2BRLA 1S9GA 2VG5B 3MF5A 1RT6A 3QYYA 5KFTA 1REVB 4NLYA 4ZPDA 3FFIA 2HMIA 5KFKA 4WE1A 4PQUB 4PUOB 3KLGA 4IOBA 3LANA 3IG1B 3CJ4A 3RAXA 1TL3B 5HROB 3CDEA 4ECVA 1N6QA 3H40A 4JV1A 4J40A 5KFNA 2JEIA 5DQHA 1RA7A 1C0UB 2EC0A 4JV0A 4RU9A 1LWFB 3HVAA 1S9FA 3BGRB 4NRUA 1XR6A 1SV5B 2R8HA 4F4WA 3M8PA 3PJTA 2IJFA 1IM4A 5I42A 2FVCA 2V4QA 4WFXA 4J9QA 1TKTB 2WONA 3KHGA 1FKOB 5C25A 3V81A 1S6QB 2UVVA 3M8QA 5KFIA 5KFUA 3N6MA 4I2PA 4IRCA 4EO6A 3TAMA 5F8HA 3OLAA 2VG6B 4KO0B 5M1TA 3UQSA 3KLFB 4EYHB 4J9NA 4Y9MA 1JIHA 3DRSA 1QAIA 3G6YA 4RW4A 2WOMB 5CYQA 2ILYA 4ID5A 5FDLB 1BQMB 1S1TB 1RT5A 3H5UA 1RT6B 3I0SB 2BASA 4B3OB 3CJ5A 4MIAA 3OL8A 3GV8B 3KK1B 4TYAA 3FQKA 5KFBA 1LWCB 3KZPA 4XO0A 3GIKA 4NLUA 1FKOA 5C25B 3V81B 1JLAA 1ZTWA 5C42A 3MEDB 4IH5A 4JV2A 2XGPA 3NBPA 1JXLA 2OPRB 2IA6A 1SUQB 3PHEA 1S4FA 5KG6A 3H59A 5KG7A 4Y8EA 4TYBA 2HNDA 2E9ZA 3LP2A 2RF2B 1RYSA 1S1VA 1MU2A 5EUHA 2XI3A 4NZ0A 5I3UB 3BSOA 3T5LA 3QGIA 4Q0BA 4NLOA 5KFRA 1RT7B 4F50A 1TKXA 1CSJA 5DLGA 1S10A 1HQEB 2XCPA 2ASDA 3BQ0A 3RB6A 3M8PB 4H54A 2AX1A 4Y9OA 4TY8A 5K14A 4ZHRB 4J9KA 4J9RA 1RTJB 1LW2A 3CVKA 1JLFB 3PW5A 2AQ4A 4Y9PA 3DI6A 3IS9A 3FSIA 1C0UA 4J9OA 4YR3A 3PZPA 2VG7A 5FDLA 4TQRA 3QO9B 4ZVEA 1TL3A 4KB7A 5HROA 3OHBA 2J6TA 1XR7A 4RNOA 3DRSB 4NLQA 1YVFA 1DTTB 3GG0A 4KV8A 4FOKA 3EZUA 3LP1B 3MEGB 3FRZA 2R2TA 4ED6A 3H5YA 4I2PB 2YNGA 3MR3A 3LAKA 2FLNA 5K14B 3V4IB 4RNIA 2R8IA 3E01B 3KLEB 2C22A 3GFXA 1RT4A 4K4XA 2ZD1B 1TL1A 3LP0B 4ED7A 4FBTA 1QAJA 1C0TA 3HVWA 1GX6A 3QIDA 4O44B 1LWFA 1IKXA 2WTFA 1SH3A 2B43A 2RKIA 2BE2B 3KK3A 3H4BA 5HBMA 4ECQA 4DL4A 5KT2A 2AGOA 5KFSA 1TKZB 4ED1A 1K1SA 2R2UA 3KJVB 4K4VA 1S1WA 1S9EA 5DG9A 3QIPB 3HHKA 1KHWA 3IN5A 4H4OB 2C2RA 2OPRA 4ECXA 2YKNA 5T14A 1KLMA 5F8MA 2IC3B 1T05A 2VA3A 4ICLA 4ED0A 5KFXA 1EP4A 2W9BB 2FLPA 2HNYA 1S1TA 4RW6A 2FLLA 1WNEA 5J1EB 2JEJA 3KNAA 2WOMA 4ECUA 1NHUA 3OSPA 1RYRA 4WZQA 1NNDA 5KFFA 2GIQA 5DGBA 2XC9A 3TQ1A 5KFEA 4K4UA 3KLHA 5KFOA 3HV8A 4KO0A 4FOUA 4NRTA 4I2QA 5CYMB 2W9CB 4PWDA 2BQRA 4YP3A 2YKMB 4RZRA 3GIMA 3DRRB 1RDRA 2WK4A 3DLEA 4LSNA 3KHHA 3PW7A 3PJXA 4ES4A 4F4ZA 4U6PA 5F8NA 4F48A 1JLCB 1HNIA 4NLRA 3T1AA 3H5XA 4X2BA 2FVRA 2AGQA 3DMJB 3FDSA 4RW8B 1U09A 4XPCA 2YNHB 4RW7A 3UR0A 1UWBA 3DOKA 2JC1A 5DQGA 2V4RA 4MFBA 4O4GB 1JLGB 2BANB 1S1UA 3M9MB 1N6QB 5KFCA 2FVSA 1RTHB 3KLEA 4EBDA 1FKPA 4KHMA 1TV6B 3HKWA 3DM2B 3DLEB 2AWZA 3PW2A 4DL2A 4AFYA 5KFWA 4NYZA 4RNMA 4WZMA 2JC0A 5J2PA 2QV6A 3DOLB 5JXSA 3PW0A 2I5JB 1JLEB 3SFGA 1HMVB 4ZPCA 4ZPAA 5F8LA 1S6PA 2OPPB 1RT2A 3NAHA 5JUMA 1DLOB 4MH8A 4LSLA 5HP1A 5EWFA 5L9XA 5KFGA 4ZP8A 1HNVB 1LW0B 1NHVA 3GG1A 5KT4A 4J9MA 4ICLB 4RNJA 4Y34A 3MTKA 3QLHA 4RW8A 5KT5A 3QGHA 3GIIA 3OL7A 2UVRA 2YNFB 4EYIB 1K1QA 1JX4A 3C6TB 1W25A 5C24B 1RT7A 4HJFA 1JKHA 2R6OA 2I1RA 4IFYB 5L1JA 4LJ3A 1DTQB 2R2SA 4IH6A 2BANA 1J5OA 3TVKA 4I2QB 1RTIA 5CYMA 2W9CA 4G3IA 4ZP7A 2JLEA 2UVWA 3HV9A 1GX5A 1RT3B 3QZ8A 4EBEA 3SY8A 2FVQA 3MFHA 2V9WA 5HP1B 1R0AB 3I5CA 4WXWA 4LQ3A 1FK9A 4M94A 1TVRB 4M95A 5KFPA 4FS1A 4RW9A 2I5JA 1RT1B 1TQLA 4F4XA 1XR5A 4KKOB 5F8GA 3V6JA 4IRDA 3MEGA 3TLQA 4YQWA 4QW9A 1T03B 2WB4A 4ZVFA 4K4TA 3MEEA 3GILA 1IKYA 3JYTB 1RTHA 4NCGA 3BQ2A 3EPIA 2V0NA 2OPSB 2AU0A 1IKVB 2J6UA 1HMVA 4IFVA 5MKGB 1EP4B 1T94A 1HQUB 2W9BA 4FOJA 1EETA 2IM0A 5KG3A 1J5OB 1JLQA 1QE1A 3Q8SB 4ZPBA 4Q8FA 1RT4B 1C1BB 4RNHA 2RDIA 4NLSA 5DGAA 4NLVA 4Q0BB 4MK7A 3CJ3A 4GC7A 1S0OA 4Y2CA 1JLQB 3DLGB 4YMEA 3KK3B 4ECYA 3CDWA 3KOAA 3LP2B 3QZ7A 1QUVA 5KFAA 2VA2A 5MKGA 4HU3A 3V6DB 5KT3A 2BQUA 5J2MB 5J1EA 3FFIB 1ZTTA 4PQUA 2W8KA 3DLGA 4TQSA 3GIJA 1JLEA 3Q8PB 4IR9A 4I7FA 1S49A 4O4RA 5KFZA 2BR0A 5F8IA 2W27A 3CJ0A 4IDKA 4Q43A 4Y9NA 4DEZA 1BQMA 3I0SA 1DTTA 5C5JA 3RB3A 4ED3A 2JEGA 3KMQA 4DG1A 1SH2A 3I0RB 2DPJA 2DPIA 4Q45A 1SH0A 4R8UA 1FK9B 3QO9A 3MECB 5KFHA 4O3SA 1S1UB 1VRTB 2D7SA 3ISNC 3CWJA 5HBMB 1LWEA 4ECZA 3NKYA 2OPSA 3DI6B 5J2MA 5D3GB 2UUWA 1S6PB 1TP7A 2OPPA 3M8QB 2XCAA 4TN2A 1RA6A 3DLKA 4YR0A 3GYNA 3KLIB 4O3NA 1DTQA 4R5PB 1SUQA 1S97A 2YKNB 5KG5A 1JLCA 1HNIB 4URSA 3DDKA 4ECTA 1HQEA 3H4DA 3PVXA 3E01A 4AG0A 1IKWB 3C6UA 4FBUA 1RT1A 2OH2A 3KJVA 3DRRA 3CDUA 2YNFA 2IBKA 4MK8A 3GFYA 4ZP9A 4URGA 2B6AA 2C2DA 2C28A 4HYKA 3T5KA 4DL3A 2ILZA 3KLHB 4FS2A 1QE1B 3M9OB 3MR2A 4NLPA 2ZD1A 5D3GA 2OPQA 4WYLA 2YNHA 4RW7B 3UDLA 4U7CA 1I6JA 1LWEB 5DG7A 5KG2A 1S9GB 3PJUA 3D28A 3T19A 3TAMB 2ATLA 2YNGB 2ZKUA 2D3UA 4NLWA 3OL9A 1JKHB 4IFYA 2HWIA 4QPXA 4LYKA 5EWGA 3CIZA 5KFJA 1C1BA 4KV8B 2FJXA 3DM2A 5CYQB 3LALA 3GFZA 4IDKB 3DLKB 4H4OA 3KHRA 3DYAA 2D3ZA 5F8JA 2IAJB 1HQUA 3BSNA 4DL7A 1TVRA 1IKVA 3NAIA 3MECA 2W9AA 1HYSA 3JSMB 5J2NB 1RT2B 3OSNA 4ZVHA 3V6DA 3G6VA 4KE5A 3E51A 2R8GA 1RT3A 4Y3CA 4RUAA 2RDJA 4H4MA 4QWBA 5J2PB 4ED2A 4ECSA 1T03A 4PUOA 2XWYA 2GC8A 4IG3A 5KT7A 5DG8A 2FJWA 4RW9B 4ED8A 3GQCA 3NL0A 4MKBA 3C6UB 4F3HA 2YKMA 1FKPB 2B5JA 4JUZA 3U2EA 1S1VB 4ECWA 3LP1A 2UVUA 4YR2A 4ID5B 5KFLA 1KHVA 3KLIA 1JLGA 4O4GA 3IG1A 3BQ1A 3IGVA 1EETB 4ZMMA 1IKXB 1RTDA 4RNNA 3KLGB 4J9LA 1RTIB 5J2NA 4KFBB 5HLFB 2VG5A 3LAMA 4IFVB 4WYWA 1TL1B 3LP0A 5J2QA 1DLOA 5KG0A 1LW2B 4R8UB 3RB0A 3D5MA 3OL6A 3C6TA 4OL8A 3RAQA 3MEEB 4DG1B 4TY8B 4LSNB 1KLMB 3KLVA 1T3NA 3DOLA 4QWDA 5I42B 4URQU 2IJNA 4QWEA 1S9EB 4PWDB 1S1WB 1BQNB 3RBEA 4R0EA 3BGRA 4TY9A 1N48A 3PR5B 4EBCA 1HNVA 1LW0A 2FJVA 2RKIB 1JLBB 2UUTA 2WRMA 3BJYA 4NCGB 4J9PA 2BQ3A 2O5DA 1R0AA 3I5BA 5DLFA 5KFVA 4DL6A 1C2PA 1UWBB 3V6KA 4EO8A 3NBPB 1RTJA 4NLTA 2HWHA 4MK9A 4WFZA 1REVA 4KKOA 5L1KA 2HMIB 1N5YB 3CJ2A 1LWCA 2W8LA 3OLBA 3MR6A 4J9SA 5KG4A 4NLGA 1N4LA 1TKZA 2XI2A 3OHAA 3V6HA 3PR4A 3G6XA 4KAIA 2IMWP 4TLRA 4IRKA 1HARA 1HPZA 5F9NA 5KFDA 3DOKB 2D41A 4O3OA 5KFMA 2HNDB 1C0TB 2CKWA 3H5SA 3EPGA 2FVPA 1C1CA 4QW8A 4XPEA 1S48A 4IG0A 4Q8EA 3N6NA 4NLDA 1JLFA 4WXOA 5F9LA 4KSEB 5C24A 4EEYA 1JLAB 3I0RA 3UPFA 4RNFA 4QWCA 1ZETA 2E9RX 2QE5A 4G1QA 3PW4A 3QLHB 4RUCA 4KFBA 4O3QA 5HLFA 2IM2A 4I7FB 5KG1A 5I3UA 2ASLA 2HNZA 1RAJA 1TV6A 2F8EX 4RW4B 1MU2B 1HPZB 3CO9A 4GC6A 2C2EA 2IM1A 3QGGA 4LSLB 4MKAA 4RW6B 4K4ZA 2VG6A 2ALZA 2VG7B 3FQLA 3IGNA 4ZP6A 1S1XB 2BE2A 1D0EA 4K4SA 2WHOA 2WCXA 2HAIA 3HVTA 4IG3B 3KK2A 1S6QA 3MEDA 4WFYA 4ZHRA 3DMJA 4G1QB 1N56A 4KIEA 1TKXB 1S1XA 3V4IA 3H2LA 2AGPA 1MMLA 4ECRA 1Z4UA 3ICLA 5L1LA 3S83A 3BR9A 4K4WA 2AX0A 3KHLA 4MIBA 2JEFA 5KFYA 2ZE2A 1HYSB 3T5JA
chains in the Genus database with same CATH superfamily
3O44A 2W92A 3POHA 2X1GA 3GTIA 4S3FA 2QLJB 3F1QA 3NMAA 4DJFA 1I5OB 2W7PA 3UT0A 1LOQA 1R3TA 3SR7A 2DZXA 3DCPA 3CE8A 1XDMA 1UB3A 4QFUA 1MQRA 1J0YA 2CLHA 1F8IA 2WAQD 3B9AA 2R8KA 1U2YA 2WVUA 4QG6A 3FJNA 3EJMA 3U4FA 3OLDA 2GFFA 3OTBA 4E2DA 1WEZA 1MWYA 3VAHA 3CJ8A 1AD4A 3JTOA 2NQHA 2ZX9A 2PDHA 4X65F 4DMZA 2YPIA 1F5CA 4NMLA 2HXUA 2PDPA 1YDNA 5CCMA 3S8HA 1S7IA 3T40A 1VJQA 3ITHA 4IJBA 4US5A 1Z2LA 3WC2A 4N8OA 3LRLA 4S39A 2WSPA 4O3RA 3PFMA 2MJUA 3BDEA 1FWGC 1I8JA 3IC1A 2HNZB 3APTA 2M4MA 1D1UA 4OYZA 1L3KA 3QYQA 1HHQA 1NDVA 4L7ZA 4GKJF 5K9XA 1GOQA 3GCXP 3B8UA 3SQSA 1ZJHA 4X62F 1XLJA 4UNIA 3RN6A 4C3MA 3NOGA 4PB3A 2O9PA 3EKGA 3SCOA 2VFEA 3WX8A 1JXVA 4NXKA 5IRPA 1UA1A 1KDNA 5E0FA 3IG1B 2J9YA 2FQQB 1XLGA 4CU7A 5CD4H 3W26A 3BANA 1XLAA 4BC9A 3CCSS 3RGTA 1ULRA 1ADSA 4RU9A 3VHQA 2DV0A 2FJEB 4TV5A 2B7OA 1Z48A 4PMRA 2PE8A 3ENVA 1W1PA 1L3UA 4DVOA 2DBBA 2D69A 1OCBA 1SO5A 2UVVA 1YIXA 4K2JA 4LU0A 3VAFA 3CZEA 5F8HA 3SM0A 2NSXA 2YWKA 1GORA 1LORA 2YH0A 1XC9A 3UVAA 1CZ1A 3RR4A 5K8OA 1NJWA 1Q5VA 3VIKA 3H2AA 1LRQA 4CNPA 3H90A 4ICCX 3B0VC 3OVSA 2XO7A 4A8KA 3UYCA 2PGRA 3C2FA 1BYDA 3OD2A 4DX5A 4DPYA 3OXFA 1ZTWA 1KXQA 5FCZA 4UMCA 2KZZA 2X1UA 1W2IA 3O9NA 3D1QA 1R7OA 2U1AA 4MJZA 4TYBA 5CPMA 3I55S 1SW7A 2HNDA 1HR0J 4H9YA 4NZ0A 2Q71A 4H2HA 1EZZB 4X9YA 2XFFA 2WM1A 2FMNA 5A2AA 2G1DA 4UF4A 3EB3A 4J9RA 2GJXA 2QT3A 2CKRA 1KV8A 1VEOA 4J9OA 1KTVA 1EPVA 2BM1A 4DBUA 4DR7F 1UWIA 2Z1SA 3UU0A 4R27A 4AZ5A 2QLBB 2NUUG 1IIHA 1PZ0A 3QZAA 3DRSB 1WAWA 2E5HA 3WF2A 3EWZA 3SQOP 3VTIA 3EA2A 3MV11 4NP7A 2IMOA 4G6CA 3N9KA 2FLNA 3V5FA 4NX5A 4YTQA 3VD3A 3MMWA 1WC5A 1KFWA 3NOCA 3JTNA 4IMFA 2CNNB 2ACSA 3HN3A 2NCKL 1XJWB 2UUAF 4WJBA 4MWAA 4DL4A 3VKCA 2AGOA 3WEMA 3N2OA 1K1SA 1VFMA 1P1XA 4MHBA 3FBEA 1CJKA 4UZUA 2EPIA 2PDBA 5FKYA 4Q7NA 3GNRA 2ZBTA 1U6ZA 3IIOA 4KPLA 2CADA 1EP4A 1CECA 2Y3YA 2ONEA 3KNAA 2WOMA 1M01A 3WLRA 2GX8A 2GIQA 1WX0A 2HBQB 4JX4A 1CJUB 3KKFA 1LV5A 3UW6A 4JN7A 1H7PA 4Y8FA 1F9HA 3SGGA 1Q5YA 2K3KA 3UR3C 4ER8A 1Z6KA 4DU7A 3UNDA 1DQWA 1KFKA 4W5ZA 1KFEA 1VHNA 1UUOA 4PR6A 2CPJA 3QV7A 3M9MB 5CZVA 1UD4A 2C1GA 4K7VA 1RTHB 1NSQA 1TPWA 4CIOA 4QCLA 4DX3A 5FLXY 3PW2A 2JVRA 1F8MA 5K3VA 2QV6A 3LU2A 2ZFAA 3ET6B 1BVWA 4XUGA 1DJHA 3VIPA 4UTHA 4IJRA 4UY85 3CUHA 1NQKA 2ZKMX 1O5JA 3G1YA 3U7VA 4NWBA 3GIIA 1TJRA 4UBPC 1QFEA 3T4CA 2ZH3A 1CXFA 5C24B 2XYGB 4LJ3A 4I5UA 1J5OA 2Y8WA 1RABB 5F1UA 4X4SA 3JW7A 3MFHA 4B9TA 2VVSA 1B30A 4HNUA 4GY0A 2DVXA 1L9WA 4P2SA 2N3LA 3PANA 2PWDA 5CSRA 2BOEX 1A5BA 4PMYA 1F6KA 4QAWA 1DJXA 2YDAA 1C8XA 2YLLA 4AY8A 2PCEA 1FBAA 4JTEA 1UH2A 3II1A 4Z1BA 4GX8A 4N9CA 2QV4A 5FEZA 4EIVA 1HL6A 1JLQA 1VC6A 4DX7A 8RUCA 1QDUB 3N15A 3C8NA 2JZ5A 1S2VA 3UP8A 3VMNA 2ALRA 1A9NB 4Q5VA 4UOHA 2ZZNA 4MK7A 2E5IA 2QX0A 5FSDC 3FMBA 3MM9A 1GOKA 3H7RA 4MZYA 3OR2B 4J3VA 4JYEA 4LF6F 1UTAA 3A8KA 1CLKA 2XFWA 5CSYA 3UZYA 2L9WA 4J3TA 2HHUA 3NZGA 1UR4A 4KTQA 2OR2A 4IR9A 1S5ZA 1W17A 4O8AA 4WZHA 1P8GA 2BR0A 1K4HA 2OWXA 1BWLA 2W61A 3MTWA 2ZTJA 4AD3A 1XLBA 2VDGA 4U3AA 1J5EJ 1JGMA 3TEVA 4DXVA 3JU2A 2HVZA 1M5OC 1JCMP 1RADB 1VRTB 1CG2A 4U33A 3AWOA 2DNPA 1GCYA 1S6PB 3FKBA 4L9ZA 3N11A 2HBVA 4GYFA 1RWUA 4LVFA 3OTEA 1CX9A 4HOZA 1PAUB 5GMDA 1PZ1A 4JYDA 4UFMA 1U8WA 1EZ2A 3QPEA 1AL8A 4A05A 3WQFA 2J7GA 1Q6CA 4HYKA 1RP9A 1MROB 4DUZJ 1DPMA 4DS5A 1HNYA 2HHVA 2J0SD 3EXTA 2CAJA 1KFSA 1XPYA 2ISDA 4ATDA 2VFSA 4EOUA 3D1OA 2NPIA 3M6UA 5AOUA 2FHOB 3OL9A 3QJJA 2YDRA 2OMOA 1PAEX 5KFJA 1Z44A 3VABA 1HKWA 2CIMA 4J9VA 5LXXA 3HGJA 4K7QA 6ALDA 4V27A 1RU1A 2OOGA 4JL1A 3IANA 2LCWA 3BQ6A 3QTPA 3BO9A 2V63A 4R9OA 3AAWB 4XWUA 1LROA 3UG3A 1FXDA 4F66A 1EKOA 3RU0A 4LUBA 4H9MA 2JKPA 3U5UA 1QNRA 5C5YA 7AT1B 4C3LA 1P1TA 2Y88A 1E40A 3PYEA 3NYZA 1FESA 4A4JA 2AHOB 2OYMA 3IGSA 4WIWA 1GOXA 4HP5A 4I6YA 4X0VA 1JAKA 2Z4PA 2VPZB 4IFVB 2C2KB 5HDRA 3TW9A 1XYZA 3MP5A 4R8UB 1W8SA 3S1VA 1DORA 1T7PA 1VQNS 1G7VA 4GPNA 3IMQJ 2Z1KA 3OR1A 4URQU 3VX0A 3KBSA 4EXAA 3BGRA 3DC2A 4H9XA 3FSUA 2YX7A 3K4WA 2XG8A 2P0IA 3ET6A 1MWQA 2FPVA 1M5SA 2HLUA 4YTRA 3FRYA 3GH4A 2F63A 2H51B 1OT1A 4F0RA 4A8YA 5KG4A 4FVMA 4JI7J 4WQ6A 4CLWA 3K0JA 4OMFG 4D8ZA 1R86A 3D0GE 3ENLA 2ZH4A 1CPUA 2WSEC 4DS4A 3HBLA 1OIFA 1OY9A 5IFTA 2H4YB 4QW8A 4DV4F 2NVCA 1MRAA 4DV0J 2RT3A 3C3LA 6REQA 3RW6A 3BEGB 5C7HA 1B4KA 4FF1A 4MY8A 3P3DA 2NV2A 2DGQA 2ZX8A 4IG2B 4DZ5A 1REGX 2FKPA 2IM2A 5C9WA 5I3UA 2HNZA 3C2YA 4YN5A 2PU0A 1CEOA 3ITLA 2IM1A 4NAFA 1PWMA 1TUGB 3KRUA 1YHTA 2EEXA 3BAKA 3W7LA 2Z1BA 2P10A 3C2OA 1MMDA 2GGGA 1F07A 4IG3B 4E4UA 3B9OA 1W5NA 3NSXA 1JB0C 4S3KA 2OQHA 3AUOA 1Q4NX 3GWQA 4L6V3 2GSEA 4N77A 4L1WA 3RR8A 1TA3A 2LKZA 3EVWA 3TZZA 3BR9A 3ARUA 4ACZB 3L67A 1TPDA 1GTEA 2HHHJ 3RLVA 3C2VA 2PB1A 4KFPA 3BSAA 1RAAB 1QM9A 2WPBA 5C42B 1UWQA 1FJGJ 4UXDA 4Q4MA 1RWPB 5D6GA 1XUZA 3AMLA 2GQ2A 4ZVGA 5ETOA 3HHLB 4HI1A 3CYVA 2ZZ2A 1DE5A 4DJEC 4PE8A 4YFUA 2PRLA 1YIJS 1RQBA 3PZTA 4AZ6A 1NDYA 4Q33A 4Y2AA 4NY2A 1J0HA 3Q2SC 4NZ4A 5DXXA 4W85A 4D71A 1AH3A 4R5EA 1TV5A 2NUWA 2MZRA 3Q89A 1WHWA 3TU9A 1E6XM 1QPNA 4HU4A 2V5BA 1PX3A 4X66J 4NZFA 3MUY1 3SRFA 4EWTA 1RA0A 3AYRA 2CQGA 1VBRA 1VHIA 1ZUAX 2PC4A 3DYAB 3GV7B 1HWUA 1CQNA 2EI5A 2Y0BB 1WHVA 3O2IA 2OXNA 4NZ1A 3BSCA 1XV8A 1ZJBA 1TFYA 3W1QA 3TARA 1Y65A 5A8RA 2HQAA 2Q6BA 4JCMA 1P0BA 2OX1A 4WSKA 1GOOA 2Y5JA 3VZIA 3JR2A 5DQHA 1PE1A 1RA7A 1C0UB 1ZNNA 2QMJA 1PL9A 1CXKA 2ZHAA 1KTBA 2XLJA 2DRDA 3PJTA 1A5UA 1X8DA 1XIHA 1R7AA 1TE6A 3GNPA 3QW4B 3W7MA 1GYMA 2F6XA 4WFXA 3KHGA 4V15A 3Q8UA 4FF4A 2B7NA 1NKBA 4DEFA 5C9ZA 1CGVA 1TWZA 4L6HA 3M7VA 4J9NA 1O1ZA 3L68A 2HGLA 1FKWA 2FDMA 3QMRA 5CH9A 3XINA 4TU8A 2XLKA 1KXTA 3RYLA 4XO0A 3U7BA 5KFBA 4OLPA 3U1MA 4C8ZA 2WBGA 4IJCA 3QC3A 1Y5NB 4S3EA 2CLKA 5TBOA 1FRKA 3TYDA 2ZH2A 1OADA 1O5XA 1EQCA 1CJTA 4GVFA 3TYBA 4QYRA 6FDRA 1WOOA 1QNOA 5I3UB 1B90A 4PYDA 1PKUA 1QVBA 3TTEA 1XG3A 3KHDA 2ASDA 1K4GA 3LPPA 3BQ0A 4H54A 4OJ1A 5LMNF 1N82A 4NJKA 5A3HA 3B97A 2Q79A 3PZPA 1W1ZA 4N76A 3IRSA 3PZQA 4JEJA 4OHQA 3AJ2A 5IBXC 3NRBA 4C1KA 2W2QP 2W91A 4BK9A 2BMBA 3GXDA 4J7RA 2KFYA 2OOFA 3H5YA 4XO7A 3J7Z5 4PWUA 2LP4A 2YNGA 1JNZB 1XDJA 3WNLA 3LAKA 4CVUA 2H4WB 4HHHA 1LWHA 4Q8VA 2VEMA 3ATZA 4YY3J 2HV5A 3QIDA 2D0GA 1V6TA 3M0HA 1PKYA 2FPYA 2BWGA 4CTAA 1VD6A 3IGXA 3VC6A 5FA5A 3M30B 1G9HA 4K4VA 1CYGA 5THWA 4IFKB 2GGIA 4QNWA 3T08A 3W76A 5F8MA 2WKGA 1RSCA 2R42A 3OFFA 4DCOB 3CMJA 3IS4A 4DV1F 1GTHA 1WNEA 4FI4A 5HPOA 1W9PA 4QCEA 3WMCA 1E4MM 1XIBA 4PCQA 4GISA 3O06A 1EEXA 1KLYA 4C8KA 4P9SA 4PXBA 4Y6IA 1IQTA 2JIWA 2F8HA 3AISA 4GA8A 1PXGA 2YCLB 4FZVA 4UZBA 4F3QA 3FHAA 1KN6A 1AXQA 3GIPA 3CD7A 5FF3A 3VDCA 3KG0A 5BU9A 3A22A 4RW8B 3UR5A 1TPUA 4PTVA 1KD1T 2V3FA 5D9OA 3BGAA 4KMQA 5KFCA 4UOCA 3JS9A 3WFAA 1JQXA 2DRBA 1R87A 2PMZD 4WDTA 4PB5A 2YL6A 1W3LA 4DWIA 5FJOA 1XCXA 5JXSA 3R5BA 1QO5A 1OQFA 2G96A 3R4IA 1HMVB 4B3RJ 3GVWA 3NQ7A 5JUMA 4N7QA 3CJRA 3ARWA 3O15A 1O5RA 4QSFA 3MQTA 2PCQA 5BXSA 4X60A 3GIRA 3NPVA 4USTA 3AIVA 3UXAA 4OI0A 4H41A 2E5LF 3GC2A 5FSEC 4I7UA 2FZ8A 1MW0A 2NR0A 2QUVA 1I2OA 4F26A 4GNJA 3T3FA 5L1JA 2UV8G 3DYPA 2ZADA 1X97A 3OXLA 5B7YA 3IXQA 2FHJA 3L7RA 2Z4GA 3HV9A 1QHOA 2SXLA 4M5IA 2F9JA 3UJEA 3AS2A 4W7VA 2P3EA 1JK9B 4M95A 3SRKA 4JHZA 1N34F 2OP5A 1TVLA 3WQ8A 3LZ3A 4DR2F 4MJ2A 4QW9A 1ZBCA 1MNSA 3HVRA 4RW5A 5AY7A 1R2SA 4TKTA 1FX6A 1XQIA 2VTFA 2ZEJA 3MEEA 5LMNJ 1OFBA 3SB0A 1V6VA 5HANA 2F5GA 5FACA 3LZ5A 4U28A 3MO4A 3RRAA 2CLOA 1TMMA 4ZPBA 3UWVA 3KUHA 5AYIA 4QDMA 1Z3NA 5CCZA 4ENOA 4G56A 1GZGA 3GHTA 3SMZA 3B9EA 3D6TB 1JLQB 1HZYA 3QMQA 5D8ZA 4QJVA 1IEWA 3AQOA 1XNRF 1LWIA 4FXWA 5L38A 1GNKA 1NTHA 3D0HE 3DFNA 3RCNA 2BQUA 2ZBIA 3G87A 3DUGA 3GIJA 1MSSA 2MEWA 3CC1A 1S49A 3USZA 3TJ9A 5T9BG 4WKFA 2W27A 3PB2A 1OC7A 1KWGA 1AJ2A 2CQ0A 3CQJA 3C15A 3E49A 4OVXA 3FBFA 3KLKA 3ADAC 3R6LB 3ITCA 4EXQA 3EGVA 2QAPA 4R8UA 4J5OA 2GV1A 3GM8A 4CT9A 2DUZA 1BE4A 4EK7A 4NUWA 4Y9AA 2XCAA 2V2ZA 3J7ZT 4R5PB 1YDVA 4CQ1A 3F5LA 1IKWB 1RTZA 1U1NA 2OH2A 2WCAA 4PWWA 5L39A 5IXEA 5DELA 2C28A 1JYXA 2PMWA 3TOPA 4FS2A 1XG4A 1QE1B 2GW8A 4FN5A 3H2VE 1NM9A 1V3RA 3UDLA 2DEPA 4RW7B 1AL7A 3DECA 3QMSA 7PTDA 2J7UA 1SL2A 3HJEA 4DF2A 4NA3A 3E0VA 1O51A 4UTGA 4JTJA 5K2ZA 3R89A 2OB3A 1VC5A 4JOMA 3LV6A 3R6GB 3BICA 3U57A 5F8JA 3MMUA 2ZX5A 3AXKA 4AD4A 4M51A 2PTZA 2XMKA 3NAIA 2W9AA 3LMYA 5DX7A 2Z8QA 2QJGA 3T41A 1N5SA 2FQIA 2J13A 3TMLA 3OGVA 3IEBA 4ZENA 3R0DA 2I6WA 4I6WA 2XGZA 4R88A 3CCZA 2J8GA 3IM9A 4RW9B 3KOFA 3GSDA 5FLXU 5DT7A 5CZSA 5AXMA 3K5XA 3TAKA 2CNLB 1J79A 3ZNUA 3M0VA 3VUPA 1VEPA 2MLYA 3CM4A 1D9FA 4BF5A 5EGYA 1EA0A 1BF6A 4WYWA 1UJ6A 1G1XA 1RAOA 2UUCJ 5XIMA 2ZC8A 3BLEA 3BGJA 1EP1A 4R7OA 5F7UA 3VD7A 1RHQB 2ZDPA 2F7FA 3JRKA 4O19A 2PMQA 1TL4A 3L7PA 4NIRA 1CJKB 1E6VB 3GXMA 3M2UB 2CJXB 2VH7A 3R2CJ 4K0KF 2J8AA 2BQ3A 2NVAA 1MYRA 2W63A 4ZK7M 3ALFA 4PG8A 2MKKA 5EBAA 1KLZA 1C2PA 3PY8A 4J28A 4CO0A 1XLMA 3T42A 3E3HA 4MAKA 2GSHA 2VFGA 5EA9A 2JFEX 1BHNA 2R1MA 1FHTA 1US2A 2IKJA 1XINA 1L2QA 3V6HA 1SKWA 3RILA 3VFCA 2RKXA 5KFMA 2RJGA 2MZ1A 4M6UA 4JAWA 2LEPA 4CCDA 1IZJA 2APOA 4WXOA 2MKYA 3OODA 2IRYA 3AYTA 3NDOA 5CQGA 4URIA 5G1TA 4UR8A 3KBMA 4EZ9A 5KG1A 1E6YA 3CCES 2C2EA 4L74A 2XWDA 5GAGU 3C6CA 1ZPWX 6CGTA 3HPSA 2I8EA 2KT2A 1BVZA 3MA8A 1PV8A 3FQLA 3BAIA 4HZ8A 1R3VA 5HN0A 3H4GA 3W24A 3S9IA 1DBDA 4XD5A 4AIUA 4NASA 1QY7A 5F2IA 5HSPA 1Z69A 2B0MA 4ROQA 4C7QA 3GPAA 1S1RA 4JB8B 3NCRA 4A46A 1HYSB 4N4PA 1KCZA 2DNHA 3T5HA 5H8UA 3OOQA 1L8PA 3DFQA 3OZPA 2OHDA 2QVNA 4AX7A 4BI7A 3WJSA 5A8WA 1V0KA 5KT6A 3ENQA 4BY3A 2NSOA 5KZMA 3PHTA 2RUGA 1N5YA 3LPOA 4CLTA 3Q8RB 1S3HA 1MRQA 3C5QA 2DT0A 3RITA 1AQFA 2XVKA 4BQ3A 3HULA 4CLUA 3H7HB 3EGJA 2OT1A 3QRRA 1QR7A 4OOUA 3ZVIA 1HF6A 3VGGA 2FB3A 4NJJA 1P4CA 1FXPA 4OU1A 4K4YA 4UCFA 2R7SA 3K13A 4JY8A 2AJ4A 1V77A 2AKMA 4IICA 4ZQPA 5A2BA 3IM8A 4PUMA 2XULA 4IIFA 3LSBA 1GQIA 5BYSA 2BXVA 5CAHA 2EFQA 1KB3A 4FYWB 1QJWA 1M68A 2KH9A 2QSFA 4JI2F 3U6WA 3WJXA 3EDRB 4QP0A 1QPOA 3KOWA 3G0SA 3NQMA 2X2GA 2VG5B 5H8PA 1SJDA 3ZLFA 4PQUB 2JRSA 4LRCA 1GVEA 3W7JA 4PMUA 2BDPA 4D6DA 3OIXA 2F6UA 2NUHA 1XR2A 2RQKA 2DJLA 3W8PA 2QA1A 4F4WA 3G0UA 5CKSA 5J04A 2RDXA 3G2GA 4HA4A 4HPNA 1SPBP 5A2QY 4USVA 4GHRA 1FF2A 1P9QC 2CA9A 1FKOB 4LUSB 4CD5A 4UTKA 2O9OA 3ZZTA 2VG6B 1H4PA 4HK5A 2V8PA 2AZ3A 3J7YU 3DRSA 1L6GA 1RKJA 2C79A 3SURA 3AOCA 1VP5A 1RPXA 1RT5A 1S1TB 2BASA 4JR5A 1XWYA 4B15A 3EDJA 2KN4A 8ATCB 4G1KA 3V81B 4KESA 1NJJA 2UY5A 4IH5A 1LTDA 3WF0A 2XGPA 1ZPVA 2IA6A 5KG6A 1AODA 2C19A 5A8QA 3H59A 4Y8EA 5DDQC 2VYOA 1UPPA 2ZRYA 4ZOBA 1GAOA 5AFDA 4UUIA 2KHCA 3LP2A 3VE7A 4CEXC 1VDHA 5C8BB 2DR6A 3CHFA 2QMWA 3FBCA 1IN0A 2XMJA 2ZNZA 3D66A 3L21A 3O6DA 1S5VA 1VFTA 1EWEA 3BDKA 1DWHM 3W83A 2AEFA 2CDRB 4H19A 2JF6A 4IGHA 3DI6A 4K37A 5IS2A 2CWKA 2VG7A 4IHCA 2PT0A 1DHMA 1P6CA 4NRSA 3FEYB 1HQ2A 1Q6RA 5F3ZA 4QOTA 2CBUA 2F6KA 4PMJA 3LP1B 3CZKA 1T40A 1T5AA 4PMOA 4UQTA 2G4FA 2B4GA 4HNOA 2CBJA 3NGSA 1N8WA 2UXDJ 4HNNA 3CQIA 4WIQA 5K14B 4C1NB 2PLKA 5U7SA 1RT4A 3B0XA 5HQMA 2DU2A 2P50A 3JSBA 3R6IA 2A7NA 1ZENA 1W91A 1SH3A 3N04A 1HNWF 2Z27A 5KT2A 1AK5A 1S1WA 5BJRA 4O10A 3HHLC 2ZWZA 3BXWA 2R7UA 4OBRA 2VA3A 1MEHA 3KXQA 3DYOA 2WMIA 4CNTA 3W75A 2HNYA 4USJC 3ZWTA 4QHRA 1TJ0A 3HURA 2ZBRA 2EEYA 2FTRA 1RV8A 2XC9A 3TQ1A 4GQRA 2RUSA 4H9ZA 1N7KA 4X61A 1FDNA 3KLHA 2O3DA 3TUIC 3KVJA 1M7OA 2R9RA 4KKXA 4CQ8A 1RDRA 3DLEA 3PPCA 2ODOA 4AIOA 5G2HA 3F2DA 4U6PA 4WK3A 2FGOA 3HZEA 2FYMA 2TSYA 3EWDA 3WMBA 3V3WA 3CGIA 3IWNC 3S6OA 1OZQA 1MWZA 2HNHA 4MB5A 3DN9A 3HPAA 1K7EA 3N2BA 2FYXA 2ZDSA 4V28A 4DWDA 4MF4A 4C8LA 1BFNA 4ZCKA 2O7SA 4U3CA 2GS8A 3STEA 5AN7A 2KB2A 3SCIE 2IHR1 2WM0A 4F9JA 2E40A 2FGZA 3FS2A 5C9XA 2IBOA 1EC7A 2Q8XA 3WD2A 4WIIA 3K2YA 1Q1KA 1U1OA 3MJMA 1HD0A 2IPJA 4DO4A 4A8RA 3MM7B 1DJGA 3VAJA 2UVRA 5C2CA 4DSEA 3HK2A 4JV5F 3P45B 3C2EA 4I6AA 1VJIA 1OF6A 1W25A 2I1RA 5D38A 3EX7B 3AS1A 1DYSA 2BANA 1BHGA 1IJEB 4FF3A 4ZP7A 1D7KA 2HS3A 3VCNA 2FVQA 3VQTA 1RISA 1R0AB 4WXWA 2D20A 4XAGA 3UZJA 4MLRA 4CH1A 4ZA0A 2ZH9A 4C0OC 1HJVA 3PBVA 1PUDA 1T9YA 3KRZA 2QXWA 3NQ6A 3J80U 2DSUA 4GINA 1KRCC 2XMUA 3VM7A 2CZVA 2W9BA 1JL8A 1EETA 2ISWA 1HW8A 3KM8A 4CUCA 3TCEA 4JYAJ 1GVQA 3WBYA 3FJ6A 4JI0J 4AZGA 2HFOA 1C1BB 3ZM8A 1E71M 3BCFA 3UN2A 3DN5A 1TIWA 3E9AA 3O0FA 4BWLC 2Z24A 3CJ3A 4BWJA 4YLWA 2XO6A 1F3EA 1V6HA 5DM7Q 1UR8A 2DCLA 2AMCB 2O01C 3AA9A 3RAOA 4W88A 3AHPA 5KFAA 2CZ5A 3TR9A 1X4AA 1AT1B 1HGYA 1KGUA 4GYPA 1AZSA 2YKAA 1HKJA 3TFCA 3DLGA 3VO0A 1UFLA 3CCUS 3SCKE 2V94A 1GJPA 1W32A 2GK1A 3O1LA 4IDKA 1GMVA 4AYGA 1UA0A 3NP5A 3OTRA 4KWOA 5C6MA 5BXRA 4A21A 1SH2A 4H8HA 4QDWA 4QZVB 3IJ9A 3WLKX 3VOIA 1S1UB 2CLPA 4KCWA 4J37A 2AJ0A 4ECZA 2ZRXA 5B09A 5D3GB 4ZPWR 3N25A 2XIJA 1SUQA 3G8TA 4USKA 1HQEA 1UL3A 4NEZA 1UR9A 2CU0A 2QDEA 5F0WA 4FPRA 4P73A 3VOJA 4DL3A 1US0A 1VPYA 3WIVA 1YDYA 4GO8A 1KKRA 1V7AA 3K1DA 4U7CA 3K5MA 5KG2A 4KWUA 2Z1VA 4QLJA 3T1YJ 1RH9A 3TAMB 2A3JA 2RVJA 2KT5A 4IFRA 2VRJA 3TEGA 1DBTA 2AOSA 4KV8B 1IWAA 3WQWA 1JI2A 1H0GA 3WH6A 4O57A 5IWAF 4DR5F 1X4EA 2PA6A 1VBYA 2P5VA 2BOGX 3JSMB 2ZUAA 2J27A 1RT2B 1HNZJ 5BRPA 1VISA 3DXSX 2MKIA 2ZZ4A 4CO5A 1N0UA 4MMOA 4D6CA 1EJTC 1MUMA 4PUOA 2QCDB 3AODA 2GUYA 1Z1ZA 2VCBA 1V3JA 4G2DA 3T0TA 7XIMA 2OUGA 5D2YA 4EPEC 2E5BA 1FKPB 3BZQA 1YX1A 1TR0A 2CHOA 3A3WA 4IP5A 4PH6A 3E6EA 2CZDA 2ZNYA 5EY5A 1OCNA 3PPGA 1JNEA 3PTKA 1OWXA 1RAEB 3KLGB 2DH8A 3TX9A 3DDNA 5FESA 3B9DA 3K46A 3RJYA 3DERA 4HOWA 1T6MA 2QT7A 2VB6A 3GQYA 5LXRA 5G4EA 3HPZA 2N4CA 4ZOCA 3DOLA 1KKOA 3QR0A 2I57A 2EKNA 2DZSA 4GNVA 1SJCA 3EA1A 3AD8C 3H6OA 4WKHA 1D8ZA 1UZHA 1BG9A 2KVQE 2PIIA 2PTWA 1FCUA 1K0VA 4R9XA 3EGZA 3H2OA 3JAMU 4NKCA 2GO9A 4DUWA 3PXGa 2HZVA 3L4TA 3ILLA 3GHSA 2WW4A 4PSPA 4NMXA 3BAWA 1Z41A 3D3AA 5EBUA 1GVSA 1ZQ5A 1YTDA 2VXNA 3H5SA 1A80A 1C1CA 1W1TA 3TWAA 4IG0A 1IGSA 4MWAD 5DRIA 2RHQB 1F3VA 1NDKA 4LALA 3D68A 5AZ0A 2VGBA 3MM5A 1ONWA 4O4VA 3QLHB 5JJBA 3PW4A 4LY4A 1OEPA 1VQOS 1J5EF 2DGVA 4H6QA 2ZA1A 1S72S 2PFFB 1XS2A 2B9WA 4P7NA 1CQMA 2OELA 3N28A 1UKOA 1TKKA 1SC1B 1SFTA 1QHZA 3AJ1A 5A1AA 5L1LA 1VFLA 4K4WA 3VTRA 4IQMA 3KJNB 3W2WA 2DNOA 2V34A 1FWRA 1M7XA 4CD7A 2J25A 5CPTA 5AVHA 3GU0A 2GVLA 3QJPA 2CKSA 3A9BA 3BLOA 1KM4A 2ZRUA 4ORMA 2Z2BA 3RIKA 2XYHB 3ABSA 2V2HA 1IT7A 4DQQA 2YKOA 1W7WA 3ANUA 3W7QA 3TE9A 2FHFA 2CJYB 2R7OA 1MI3A 3E96A 4FNIA 1EGMA 3OFEA 3OJSA 4XTIA 3G22A 5T41A 2YBVA 3TNBA 1X4GA 4LVOP 4DQIA 1DTNA 4DL0C 2YW3A 3NQ2A 4AXNA 2G5WA 2CNKB 1GQKA 2UY2A 1JFXA 4LAZA 1LQ2A 3N6JA 1VK8A 1QI3A 3O0KA 2UUBF 1FP8A 3MR5A 4HPJA 3G86A 3KEHA 2HHHF 5M03A 4C97A 3RBDA 4L73A 1FRHA 2WMKA 5HWJA 1VBZA 2PP3A 1WAUA 2YCIX 1KWMA 2DZWA 2ZUWA 1GK8A 1R8HA 3FAXA 1YDLA 3R0UA 3KLGA 1U22A 2PURA 1VQ8S 1C7TA 4DV7F 1QNPA 4UNKA 4DX8H 4DFKA 4V19J 3TNOA 1OIAA 4OHXA 2QCLA 4OTKA 4PR4A 1WORA 4JV0A 3N4WA 1S9FA 1Q4WA 3ZZPA 3BW3A 5SUHA 1N32F 3SSZA 3IARA 2GUUA 4ZZ9A 3VWSA 5C25A 3QJLA 1Y0EA 1X9WA 4IUFA 2XMWA 3HQOA 3MOZA 4AQYJ 4MM1A 4RBUA 3BCDA 2X41A 2AYGA 1E9IA 3VOGA 4AXIA 5L9NA 1X4FA 3HFKA 2M3DA 2Q6ZA 1S3TC 3CT7A 1AG1O 3N14A 4BHQA 2WHLA 4M3PA 3KK1B 4M80A 3R8YA 4X63A 3FA5A 4FX7A 3I9ZA 1JXLA 2PI4A 4NI8A 4FP9A 4TR9A 1CXIA 1Y5VA 1ROFA 1HNXJ 1I6NA 2EPOA 3RU6A 1YE4A 4GE8A 4E2OA 4TVCA 3KL0A 2V4JB 3C8YA 1SL0A 5CGMA 1K0TA 2XEXA 3W2WB 1AW1A 2Y7FA 3ZO7A 3T5LA 4NLOA 4ECLA 1ZZNA 4LVAA 1HQEB 1E9LA 1I1GA 2C14A 1WDSA 2GVEA 3FHQA 1GOMA 3G0XA 3CMFA 4JIIX 3ZLHA 1FWPA 1ADOA 1FWEC 3T9PA 1S5MA 4NYUA 2KYXA 2I38A 3AU2A 3RR1A 7REQB 4RV8A 2OFGX 5HR6A 2KZMA 2HMCA 1AJZA 5D33A 2AEJA 3FRZA 4HH1A 1KFDA 4AZIA 5I78A 1FH9A 1UKPA 3LA4A 2FLOA 3V4IB 1ICSA 2J7BA 4P7RA 4QR0A 4U8YA 4FNPA 4YB5A 4XISA 3BYPA 2EXUA 3R5JB 2FTYA 4YJ5A 1VFHA 3VGFA 2GVZB 3KDOA 2OZ3A 3LHVA 4XDDA 4KCVA 5I6SA 2R2UA 4HR2A 1ZZFA 5HMSA 4QQ3A 5DETA 2YKNA 1XICA 2YDQA 1YBQB 2MHNA 4ICLA 4ED0A 2ZXBA 4LV4A 5JQ9A 3T0DA 3UWYA 2W9BB 2EPNA 3L4WA 1C29A 5TQLA 1SZNA 1RU2A 2DSZA 1NHUA 1PHQA 3W28A 4ZQOA 4A22A 5KFFA 1RY8A 5MLCV 1U7LA 4Q8MA 4B92A 4O0ZA 2VPWB 5CYMB 2W9MA 2MY8A 3S4TA 1NH7A 2WK4A 4CLLA 1Y9OA 4Q4SA 2EGZA 3P82A 2J77A 3H5XA 1A5AA 4M6QA 5JIWA 3W7NA 1UEUA 3MI7X 4OKDA 4WJEA 4RO0A 3DI1A 1PEZA 2BANB 1C3FA 1J01A 3TC3A 1M04A 4NZ5A 4HNVA 1FKPA 4G6VB 4X0NA 1TCMA 2AWZA 4OHWA 2WZTA 1BLIA 1C8YA 4JIRA 1H3GA 1TTIA 4WZMA 8AT1B 5HOSA 2I5JB 3SFGA 1IXNA 5DS7A 3RJMB 3AXIA 4IOTA 3W72A 1RT2A 4Z1YA 4E2BA 5HP1A 1UQZA 4IPJA 4OIFA 1U47A 5GNZA 4DX6A 4N6FA 2YLAA 1J27A 3LOTA 4Y34A 1WE5A 5K5MA 2V69A 3VZYA 3BE7A 3DRXA 1QBAA 5C7VA 2IS7A 1DJ0A 3HQNA 2L9DA 1H5YA 3PDNA 2HXTA 3C2RA 2W9CA 4G3IA 1X7FA 3W71A 4NI3A 3QZ8A 2PLCA 3LLXA 2E7VA 3BSMA 4LQ3A 1B0VA 2GZOA 1K8AT 1VFJA 3GMGA 3G8SA 2BE9B 3V6JA 1JI1A 4KKOB 4IRDA 4F4AA 2QNEA 4V1XA 1OYAA 2RJZA 2BY1A 1YGYA 2O1PA 4GQQA 1TWWA 3TYZA 2XIMA 3B8WA 4U10A 1KVJA 3E38A 2UP1A 4FOJA 3EX4A 4C8MA 3RMEA 2F7VA 2BV9A 3OUYB 2UUAJ 2VONA 2GK1B 3G2XA 1XLKA 1EPXA 4BC7A 3AS3A 4NZ7A 4K3ZA 3CCQS 3HPOA 1PYMA 1MW3A 3DLGB 3EUNA 5H9FK 3WLQA 5K4XA 1BXBA 4S3GA 2CEQA 1EGZA 4DJDD 1KTQA 3R11A 4RE0A 2EBGA 3SRDA 5I3GA 4HT3A 2BX6A 1IEXA 3LY0A 1YLXA 3B8TA 1BRLB 3D46A 3CPRA 2Y1LB 2JEGA 1CBKA 4NYYA 4JOUA 4KBXA 4Q45A 4M82A 1I1WA 5E7OB 3I68A 1D8CA 4PB4A 3A3XA 1M1HA 3DI6B 4C8OA 4JIEA 1NDWA 3THUA 3TC7A 2A18A 3UD4P 5G4WA 1SL1A 4URSA 4B5TA 2BEFA 4ELUA 3H4DA 4MB1A 2Y1RI 4DR1J 1LWJA 1AW2A 4YUDA 4KGZB 1F6PA 1UJQA 1XL9A 3KXDA 1KR1A 3KOZA 3GTXA 2MQ8A 3VCDA 1Q7MA 2OPQA 1GZJA 2KFZA 3SGUA 2Y0FA 3A4XA 2ATCB 3TZWA 1U4BA 3FA4A 1QRQA 1QVGR 1OY8A 4NLWA 6FD1A 4Z0SA 3SCRA 3J7A1 4QDPA 2X0YA 2M9KA 2P88A 4C90A 4K1GA 1QOQA 3A3HA 2W4DA 3RRKA 2RRNA 2HLTA 3MB9A 3VNLA 1TVRA 1KM2A 1Y8BA 3TMQA 3UGRA 3AY0A 4S0MA 4H00A 2HHPA 3D6HB 5CH7B 2CZFA 1H7OA 3C3UA 1JQVA 5BXPA 2M5YA 4JI6J 4TU7A 4ALDA 4CLKA 3GQCA 1B3YA 4GH1A 3FSXA 5H9EJ 5F2GA 1REQA 2X8RA 1H74A 3KUMA 1N2VA 3QKZA 2GMLA 3IVTA 3EB4A 3ZOAA 5A8NA 2DCUB 5LSRA 1C92A 3EXSA 1ZRQA 1WSVA 5IT4A 1BQGA 1LT7A 2LDIA 3A24A 3D4JA 4RNNA 3A47A 2VG5A 1JDFA 5LMUJ 1DFDA 4E3VA 1PTAA 4GI4A 5DCDA 4JQAA 2Q3OA 4DG1B 2EPLX 2PF8A 4LT6A 4KW2A 4LTSA 1BY9A 4P10A 4UMAA 2FJVA 4L64A 4NCGB 1R30A 4CN1A 4LBIA 2KAUC 4DV6F 1E0TA 2WMIB 4HKPA 4DL6A 1VQMS 1REVA 1QSLA 5FI8A 1F3TA 4HQVA 3W1XA 4QX4A 3OVGA 3MVIA 2ZICA 2DXFA 4IOCQ 1IM6A 3PX4A 3DLBA 3BMVA 5BR8J 2VURA 2XMMA 2E8YA 1ISWA 4F0HA 2KZHA 3HGRA 1N33F 3D5HA 2FB2A 1YHQS 2YQ1A 2OPJA 4AX6A 2ZC4A 4F0SA 4DO7A 2UUCF 5T7LA 2CVIA 2E9RX 5I7GA 2WCSA 3GR8A 4O0QA 4GY1A 4RUCA 2N82B 1H5VA 3WZ0A 1NCLA 3KBJA 3H2NA 1PJ7A 3UCGA 5I3QA 2P8BA 4J27A 2XH7A 1XK8A 2DD8S 2VG7B 1D0EA 4CO3A 1PCKA 3QNWB 2G3MA 3EKLA 4LRSA 1H72C 4LFCJ 2PZNA 4PA8A 4MT1A 4DR6J 2X16A 3HG5A 3CF5Q 1Z4UA 3W1MA 1M1KT 3T2OA 4KWSA 5KFYA 1FA0A 2IAJA 3WF1A 3QQ1A 3ANVA 4F4YA 4M1RA 2BJ1A 4FF5A 1P0KA 2GGPA 4ZPVR 2ZZ7A 3N9RA 4WVXA 2DEJA 1V3HA 5EX0A 2BODX 4OX9F 4QITA 5LHEA 2MZJA 1U1PA 1RT5B 1RP8A 3S6EA 2I16A 2ZXDA 3UZ5A 1XWLA 1XKJA 4BQ2A 3UN3A 1B0TA 2PGCA 2R2RA 1YRXA 2B6AB 3ISND 1TPB1 2A79A 3KVMA 2B7CB 1G6CA 3IIVA 2G0WA 3SRHA 4R3UA 1R3NA 1RKIA 2V2VA 3IJ7A 4DV2F 3SI8A 3S46A 2H54B 5KTLA 2XZTB 1EJXC 2QUUA 4A3UA 3QAUA 4Q6JA 3RB4A 3QY7A 2NWSA 4UNLA 3FLUA 2YNIB 4PTXA 4FXVA 2QIWA 3NQ8A 3WBXA 3K5OA 3VGSA 5HMXA 4W8AA 2F8QA 1RI7A 3MTJA 1V03A 1KM1A 4M5JA 2OEJA 1Y11A 1QI4A 5FJ4A 4LUTA 1EB0A 3KLFA 2AJQA 2WKJA 4XZIA 2Y7EA 3CUFA 5IOLA 2B5JB 4LAMA 1SKRA 3SFUA 4NXMJ 3KBNA 3AZTA 4HPXA 3U3HA 1GJUA 3NPWA 1S9GA 3E0IA 3BJFA 1C7SA 5HQ8A 1BQXA 2ZQ0A 3LANA 4GQGA 3GDLA 3RAXA 4IIBA 4ECVA 1RHKB 4AYSA 2GO8A 3B06A 3DLLQ 5DBUA 3R10A 2ISFA 1RAGB 2R8HA 3M8WA 3MR7A 1KP6A 2IJFA 2JE8A 2A85A 4RLIA 4DV0F 4D6FA 3AQPA 3K2GA 3UNYA 4XV0A 4KO0B 4X4PA 1GWJA 4LR7A 1XX1A 2R4FA 3NS5A 1W9UA 4X22A 5FDLB 1JD7A 5L9FA 2NT1A 2V67A 4HT5A 2NZ4A 3DNCA 5C25B 4HHLA 3N2XA 2SFPA 2FY8A 3CCMS 2CHNA 2MGZB 4OX7A 2VX6A 1BWKA 3EOLA 4KPYA 2RF2B 3TH6A 4E8UA 3ILIA 4AT1B 2XI3A 1R8BA 4BWLA 1SKUB 1NJIT 4DN0A 3MAAB 2PTXA 3T05A 5DLGA 1K03A 3NGTA 2IQDA 4WFBQ 1KXVA 4GZEA 2H48B 4QEHA 2ZBPA 3RRGA 3CVKA 1EARA 2AQ4A 2VU5A 2OQLA 3MUXA 2HCVA 3MVTA 1TL3A 2XHCA 3LTOA 3SFKA 1SXLA 3CJSA 3OTCA 3UDEA 8CGTA 1Y7VA 1IXPA 2G3NA 4DM1A 3R2DJ 1CXLA 3WENA 4LNYA 5AYBA 2Z6IA 2BZNA 5K8MA 2WPGA 4K4XA 2V5CA 1F3WA 2XH4A 1TL1A 3LP0B 4OI2A 1XGZA 3RRHA 2F38A 1L3TA 1JNRB 3SN1A 4TX6A 1CT5A 4C6LA 4J9UE 1GX6A 3MP3A 1SW3A 1LWFA 1WDTA 5ETNA 4EF9A 4NU7A 3ZTQA 1UZDA 3GVQA 3J81U 4J90A 2C2RA 4MKYA 4IISA 2Q6CA 1AYEA 2AYMA 4P75A 5T14A 4ZTXA 2QPXA 3MCOA 3C0QA 1T95A 3H7UA 4XG1A 3QLDA 5J1EB 2J0QD 3ZIZA 1RHUB 1XBYA 3L7OA 1MEWA 2MHEA 4DF8A 4QIVA 1SZGA 1OVDA 2WOQA 4JI2J 3PW7A 1ZM2A 4O54A 4ZJQA 4K8RA 4ZA1A 3OB8A 4K68A 2FDNA 2AGQA 4GYJA 4GI6A 1J93A 2XTJP 1UZ1A 4LNCA 1UWBA 3BKUA 4I64A 3H8AA 4ZR8A 3E0LA 1S1UA 1DHKA 3I96A 1N6QB 1POJA 2VFRA 3BUVA 4RXFA 2D73A 3KLEA 3CHEA 1NVMA 2HW3A 4M56A 5IZHA 1TPEA 4GUFA 1YX2A 3BV8A 5CPOA 1WC3A 4ZO8A 2EQDA 5KFWA 4RU2A 1SMDA 1WKFA 4PEEA 2OPPB 4X4TA 2XJ7A 1TYGA 2IDEA 4C11A 4LFAF 5EWFA 3DESA 4JS3A 2H9ZA 2E5DA 1YRTA 1EYWA 5HI7A 2VFUA 2C13A 3LPGA 3KW3A 3M7SA 3ORWA 2NWRA 5FJIA 3O3LA 2YNFB 4UTWC 1K1QA 1JPIA 2G3JA 2H3DA 1LRNA 2ZH1A 2ADCA 4HJFA 2XPKA 5IDIA 2PN6A 1ME7A 4PMQA 5CZXA 1LRTA 4ZE4A 5JBEA 2JF7A 1J0IA 4MIMA 3F4VA 3M6DA 1GX5A 2XMVA 3LG3A 4X66F 2JQXA 3TI0A 3UN5A 4QR2A 4MOZA 4ZVJA 1FK9A 5D02A 4IMEA 3UYIA 1Q45A 4PRRA 2L9NA 2VC7A 3HIJA 2MTLA 2YGYA 1QTMA 5AVNA 1Q8LA 4MYTA 2ZIDA 3B40A 3HQPA 4YVXA 6XIMA 2WB4A 1XLCA 3GILA 2DHXA 3TW0A 2JGQA 1P43A 3SUTA 1ITPA 5AJ3J 4RPQA 2HPMA 1HBNA 4FP1A 4DUYF 1FD2A 5JMNA 1GJWA 2VGIA 4FALA 2QHAA 2A2IA 2PWFA 5FJTA 1KLNA 4GABA 5DGAA 1E4IA 4X4RA 4NLVA 3TOQA 2BY3A 4MZ1A 2HRTA 1R85A 3B9NA 1MMFA 5GNXA 5LNUA 3HA1A 3REQB 5K4ZA 4R53A 2QCDA 2VFIA 4ZFCA 2P8CA 4U9RA 3N6QA 1UD6A 3M7WA 3T0AA 2NV9A 4DYEA 2Z25A 5H8MA 1Y10A 2AP6A 1CDGA 4C3KA 1F76A 2LDYA 4EK2A 4ES3A 1JCYA 1BQMA 3W22A 4HHUA 2PSNA 3I0RB 2DPIA 1TUWA 1U1JA 4E8GA 3A9IA 1FFGB 3WUFA 5GAEU 3ISNC 3LERA 4C6BA 1SJFA 4BCEA 4LREA 2GWNA 3DLKA 4M1BA 1AMYA 4Y2WA 2A3AA 3PK7A 4AG0A 1I4NA 5LSMA 3WKZA 2IJRA 4YMZA 3CDUA 5CGTA 3VYLA 2BDQA 1B9BA 1EB3A 3WEOA 4HJWA 1NWTA 1XIDA 3KLHB 1HKVA 1X6LA 4XZWA 5K9CA 4HIBA 5D3GA 1S76D 3H4XA 3PR2A 3IACA 1E1CA 1FEEA 3B8VA 1VH7A 1VKFA 3QWUA 3OLIA 4ITSA 4LYKA 1NK8A 5BNKA 4CQDA 3GTFA 4WK9A 4IDKB 4V33A 3JAMY 3UCCA 3M5XA 3PPHA 2DGWA 5D77A 4DL7A 1PILA 4A29A 3PF3A 3QR1A 2M8HA 1PKMA 3QY6A 1G0CA 3ZZ1A 4ZVHA 2R8GA 3N19B 3AROA 4H4MA 4J3ZA 4QBXA 1H50A 3UJFA 2GC8A 3N29A 4HCHA 2IPOB 5E0OA 1KCLA 4B5WA 2J7EA 2X3GA 3C6UB 1XIGA 3BKFA 4XAYA 1T9UA 1FOBA 1JPMA 3LP1A 2CZEA 4J3UA 3F56A 3TQKA 4WKRA 1TZ7A 4BHYA 2FZKB 3M0IA 1EETB 1O94A 5H9FJ 4ZKAA 2PDJA 3F5JA 5HLFB 1JJ4A 4YTUA 2JKEA 1TV2A 3URQA 3TA6A 4IOAQ 1OPZA 1FX4A 4QWDA 2HHXA 3KS6A 2DT1A 1DQXA 2CFFA 1T99A 4GFSA 3P6YC 1KFCA 2P9GA 1T9XA 2R7QA 1A5LC 1SO4A 2XSJB 3UDVA 4C6MA 1A3XA 3D6MB 4BQ5A 2WRMA 1R0AA 3A23A 3NGJA 1GXUA 4BLGA 2CG8A 1YTEA 2BTMA 4IL0A 3V75A 2ZH6A 5KFVA 1NOWA 4YU1A 4ZN3A 3TUZC 4JNYA 1FRBA 5IFMA 3G1FA 4GJIA 2RSQA 1IIGA 3FBBA 3H4WA 4OZ3A 4NLGA 5K7JA 3M30A 3DFSA 2IMWP 4TLRA 4PRFA 3K8KA 4CN6A 1WO2A 3RBXA 1W0MA 4IO9Q 2FVPA 4U5KA 1S48A 1O8BA 5SZTA 4LBRA 4EEYA 4RZ4A 3GSIA 4G1QA 3M5VA 3EPOA 2J62A 4KFBA 2QZ8A 4RW4B 2JHEA 2A5HA 3LM3A 4JFVA 3A3NB 3BZGA 2K1RB 3UG5A 4WXYA 3SQLA 1DXFA 2YL9A 4AU0A 1U1LA 2RHGA 1PG5B 1N56A 2PZ0A 2G3FA 3GZ3A 4ILSA 4EXBA 2VD3A 4B02A 4KR0B 5A6KA 4XTTA 3LPFA 3ICLA 1V02A 3GYEA 3CIMA 4L3NA 3FY1A 4DJDA 4YTSA 2ZE2A 3N0VA 5M2RA 3PRBA 3SCQA 5G4HC 3TJIA 2C3PA 1BEUA 3UY8A 4YYCA 4DV4J 3EBVA 2MSTA 4M19A 4LQ9A 2RB7A 4W7UA 3V1PA 1NK6A 2YX4A 1B4SA 1F05A 1UWRA 4EX4A 3M0KA 2Y63A 2DHAA 3FCHA 1W9DM 3FEMA 2XGQA 4GVHA 4ZO7A 4TXSA 1IZKA 3HVTB 3KS5A 1M5HA 2OGYA 3IO1A 2J0XA 3AHZA 2FJKA 4WU3A 1YK9A 2OZ0A 3L0GA 3LCIA 2ZHOA 5GAEI 4LS2A 3TIMA 3CPGA 4DUXA 1V93A 4JI1F 2WZHA 3AOFA 5HMWA 1AH0A 4MADA 4F2BA 3HPFA 3DKLA 3PFOA 3VGTA 2DGTA 1HL2A 1XSIA 2O4QA 4O0NA 1R89A 4W98A 4ZVQB 3PJWA 3KP1A 2VBWA 4G5DA 5D0GA 4MPKA 2O66A 1QW9A 5KFKA 1VFOA 3M4HA 4PQAA 1E6ZA 3PTQA 1NB7A 5F4XA 4AY1A 3QSRA 5HROB 2B3TB 1TMQA 1Q6QA 9ATCB 2TODA 4V1YA 1FWKA 1CGTA 1LG2A 1S5WA 1TIMA 1FH7A 3JTPA 3N73A 4IGSA 1SV5B 3WMSA 3MURP 2X0SA 3CWNA 4Y2KA 3V81A 5KFIA 1OFPA 3N6MA 5KFUA 2D1ZA 3RYSA 2PEVA 3MU7A 2J0WA 3A8IA 1ZA2B 3MYOA 4QCFA 3ZZYA 4Y9MA 4J2PA 3M41A 3BGFA 3EGNA 1Y3JA 2AT1B 3DFHA 2ILYA 1TWSA 5D0EA 4B3OB 1JXKA 2ZZ3A 3GZAA 3LCHA 1HXJA 4NLUA 1FKOA 4ELVA 2A6LA 3LSCA 1JYNA 1WZAA 5C42A 4N4QA 4PRWA 1T8QA 4DPWA 2ATMA 3OQ8A 2PEHA 4ZN1A 1WZKA 3N9SA 3PHEA 3QC0A 5ENLA 2JOQA 1FRMA 3CCLS 3URNA 2E68A 1MU2A 4B08A 1YXDA 2PC6A 1N88A 1U83A 5D0RA 4F50A 4XO6A 1CSJA 2OODA 2G9OA 3HSGA 1O5KA 2VICA 3P2VA 3CXOA 2VC1A 4UTTC 4CKQA 4PUWA 3PV8A 5I5RA 2VL4A 3DG3A 1OX5A 2VJVA 4FZIA 4EWJA 2Y4SA 4ZVEA 4REQA 2BBEA 4MJMA 4DBQA 4RNOA 3QAEA 2ABAA 4O50A 3W6LA 3GBDA 3MEGB 3TWZA 4JFTA 3NLCA 1QAYA 5J5DA 1PWLA 2FJUB 4NYOA 3E8OA 3NUKA 2VC0A 5D4OA 3QV6A 4NL5A 3M0MA 3OFGA 3UE2A 3R7NB 5D2XA 5LOQA 3VMPA 2VBYA 3THDA 3HVWA 4AUKA 3H4BA 1M5PC 2RKIA 1XW8A 2BE2B 3LPYA 4YOEA 2DO4A 2QF8A 5BR8F 4OX8A 2U2FA 3KJVB 5D4YA 1S9EA 1FE4A 4GRSA 1RE1B 1EJUC 1GOWA 3LI1A 1XI3A 1H38A 4S3JA 1D9DA 5C7PA 1KD0A 2W0UA 3PWAA 4L9XA 4KIAA 1PX8A 2DGSA 2FLPA 4OYWA 3WDHA 1GHSA 3CHDA 4WZQA 4ZL1A 3M0LA 2MQOA 1MN7A 4J5NA 2I7GA 1K77A 2JSXA 1A53A 1Q7QA 4KIRA 1JZ5A 2C15A 3BGLA 2QLFB 4M1KA 5DY3A 4NG3A 2VKZG 5CZKA 1IQ8A 3B4UA 2LQ9A 1X9MA 2ANUA 4DSIA 1U1RA 2V4RA 2A3EA 4I9JA 3H7VA 4JX6A 3EEZA 5FF4A 4C91A 1I3OB 4DU8A 4RJVA 4EBDA 4QU6A 5GPRA 4IUOA 1E6YB 2QYGA 4G7FA 5GADU 1LBMA 2Y0SD 1U30A 1WC6A 4DFJA 3NAHA 2ZUTA 4WK1A 4LF4J 3DIPA 1JPKA 3DEQA 1G7UA 1SJ1A 4HD5A 3BG5A 4FX8A 2GUBA 3VAVA 3SCUA 3W02A 2EBNA 4FS9A 1FTCA 2LU1A 3MI6A 3QMTA 3GXPA 4HACB 4PYSA 7ODCA 4LF7F 3BLKA 4JNZA 1VC0A 2DZVA 4IX2A 4JEQA 3SY8A 2V2QA 5D0HA 1VLIA 4DQRA 2V9WA 1R3YA 4DXXA 4CWBA 5AC4A 3O6AA 4LFYA 4IP4A 2VZVA 4FS1A 4KRWA 1E6VA 4ZJLA 1JPHA 1QASA 3WC0A 3MEGA 1WG5A 1SIZA 4UTJA 2MZQA 4GVLA 3CU2A 3MPDA 7FDRA 3MHFA 3W3SA 1TK8A 2XS5A 4M8UA 4JCLA 1H09A 3GR1A 1EP4B 3NG8A 4OZOA 1NU4A 2EC2A 5I79A 1KWKA 2BE7D 4DI6A 2GJ2A 1ODZA 3DHFA 4ERIA 3P62A 5AKQA 2AKWB 3MUVP 3AIQA 3AALA 1U0HA 2C1EB 1SUXA 3BC9A 1B9ZA 1SSGA 5ABHA 4AUBA 4F8RA 1GKPA 3DAQA 1GONA 3E12A 3H2CA 4L65A 4TQSA 1V79A 1YJVA 4FNTA 2H5EA 2OTDA 3PC0A 4HACA 2DDXA 2DNLA 2R7WA 5KFZA 2PFHA 2NZLA 3DLHA 4IZGA 5C2XA 2DZPA 3TZFA 5BOFA 3WQCA 5D04C 2HZGA 4DHVA 3H2EA 1DEDA 3MPYA 3UXLA 1LFWA 3P14A 4F3MA 4FKXA 3HGOA 2HIYA 3GR0A 1Z32X 3G1HA 5KFHA 2TPSA 3PTDA 2WSKA 4GC4A 2AL1A 2NSBA 5L46A 3QGAC 4Q4KA 1HW6A 1EA9C 1H51A 4YR0A 4EGLA 3W9IA 5MHBA 1JQGA 3F44A 5EX3A 3MBFA 2YL8A 4X4NA 4P7OA 3EAUA 3PBUA 3TLLA 1OINA 5D15A 1NWUA 3MR2A 2WMFA 2HFVA 2HS0A 2F3JA 2IKIA 5DFAA 3DHUA 3T19A 5FF7A 1TRDA 3TFXA 3BO4A 2ASHA 2HVDA 3LOUA 2I5QA 3EA3A 2D3O1 3SQGB 3KHRA 4OI3A 4ZGYA 4QE5A 4YWSA 1S2CA 4YDXA 2JK2A 3ONQA 3W61A 4CTAB 4JY9A 3VNZA 1FJGF 3LX9A 3MECA 3BYRA 2RQCA 1WDRA 3OSNA 2FHCA 1EXBA 2JEPA 1U02A 1UYQA 1DWIM 1RT3A 4NE9C 4DV3F 1W31A 1T03A 1OFRA 4LF1A 3W70A 3V4BA 1SM9A 3WLIA 2PD1A 3FK4A 3WIJA 4Q8QA 4LMZA 2X40A 4JUZA 1PZ2A 1X8FA 3IBFB 3BZJA 1HN1A 3R7BB 2BSLA 5KFLA 2LXIA 3KLIA 3DZ1A 3IG1A 4ERDA 1X0PA 4F2SA 4I5RA 4JN6A 3NOEA 3PCOB 1U0SA 1GG0A 2WVVA 1WBJA 3MEEB 3KLVA 3IR6B 1W1VA 4XK8C 3L2MA 4MNJA 4QWEA 3UPWA 1VYAA 1K70A 4XD3A 4DJDC 4Q8TA 1WD6A 1S2UA 3TANA 2LU2A 2E5JA 2XWXA 3NO5A 1WUEA 4REQB 4IXXA 1DY3A 3NL3A 3E0WA 4KY3A 2J4GA 3L95X 3V6KA 1YKWA 4NLTA 2QGFB 4UW2A 3V0TA 4MK9A 2V8DA 4QLKA 4GUHA 4YY3F 3PM6A 2IRXA 3MR6A 2K1RA 2VEGA 1NB2A 4CN4A 2HKEA 3Q0AA 3Q8YA 1QUPA 4KAIA 1UD2A 1U26A 3MCNA 3M8YA 1TPFA 1Q6EA 3I31A 1ZPTA 2V68A 4KYZA 3R1HA 2MLZA 1XLIA 4HNLA 2AEMA 1B3TA 4RNFA 4J7CA 1TE1A 4DBWA 3W29A 4WF9Q 4DZDA 4O28A 1PIGA 2V2DA 3CO9A 4YNGA 5A6SA 3EX6A 5HMDA 3NXFA 4RW6B 1NK7A 1FCAA 4K4ZA 4AF0B 4OFZA 1S1XB 2XZ7A 3LGDA 2WHOA 1KBKA 4K5SA 3GKAA 4B90A 1M5KC 2IVYA 1KM6A 3CD0A 3MMAA 4CGTA 3AH6A 1K1DA 4LH8A 2Y8YA 4HNCA 3T5JA 2YKKA 1HHSA 2J5AA 4GKJJ 2BFGA 4HVXA 3VALA 2RDWA 1Q7YT 5HNRA 4UQCA 1B99A 4M7TA 3THPA 2J9EA 1ELOA 2G2OA 2NQZA 1LOUA 4LXFA 2HEJA 1W9XA 1DQAA 4JTDA 3DFYA 1ZFJA 2OVLA 4FF7A 5LNRA 4GCXA 4JI8F 2DNGA 3AFBA 4Q4OA 2PO4A 5BYRA 2CJKA 3O07A 4O3PA 1H61A 1VF8A 3SUSA 2OI2A 3M9NB 4GO9A 4QJ4B 2BJ3A 4DV3J 2GIFA 3WLNA 2TAAA 2BKOA 4EWND 5BOEA 3T44A 2DUAA 3AIUA 4H4MB 3ULHA 3TAPA 4NNAA 4I7VA 4N5SA 1R3QA 1IR0A 1FRIA 4UOZA 3U4AA 3VOHA 2DH2A 1D2KA 4EF8A 4KBIA 1F5ZA 2E44A 4AZHA 1O95A 4JTIA 2M2BA 2ALDA 2NXEA 3G1RA 3AJDA 1XYCA 2C18A 3G1SA 4LSZB 1VS3A 1E43A 1M03A 5CHCB 2VFHA 4ZPDA 2Y70A 5DRCA 3AHTA 3Q2DA 3QHMA 2ZCGA 4I8YA 4X4OA 1GMUA 1IV8A 2Z2YB 5KFNA 4JI5J 1QWKA 1OMSA 1X4CA 2JEIA 3KL5A 2VPYB 5FJPA 1D3WA 2EFGA 5DJBA 3TOYA 4PG5A 2PBOA 1V6UA 1UC5A 3VAKA 1WXYA 2BHUA 1AUDA 5D8HB 4UUWA 7TIMA 3NSNA 4DLMA 1U5VA 1UPMB 3K8MA 3VNYA 1WF0A 3IUDA 3VX1A 4RW4A 5HJXA 4OECA 2QO3A 4GIYA 1BQMB 3W7OA 4MIAA 2WCGA 2WBMA 1UVLA 1UW9A 1XNQJ 4J3WA 1KFJA 4A4AA 4PMVA 4AYBD 1OIMA 3P0WA 3L5LA 3UO0A 1GOIA 2E4TA 4XIAA 4LC6A 3UWZA 4P8UA 2D3NA 5HUOA 4O15A 1U48A 4B9NA 5DMNA 4C6QA 1L3VA 2VGGA 4NA1A 2Y7DA 2LEAA 4D2JA 4E5TA 2KHDA 3IA0A 4NXNJ 3PW5A 2VFTA 3R9LA 2D3OR 1RCXB 4AL5A 1M1GA 2DK2A 4PL1A 3R7MA 5I0DA 5CA5A 1XR7A 4GQBA 1OJ4A 1LOLA 4TVDA 3HJFA 3BN4A 4OZ5A 3PAOA 5M5DA 2P8IA 2O9TA 4AC7C 4AD5A 2G13A 1FTXA 2I9UA 4KRUA 2C22A 1SJ4P 4OUIA 3NGFA 1US3A 1TVNA 4QISA 2PI6A 3RPTA 5HMYA 4X64F 3C2PA 3IV3A 3VF0B 3AWNA 1KGXA 2VC9A 3ZYZA 3D6FB 2B43A 1XLHA 2ACRA 4JHOA 4P8WA 5HL7Q 1EX1A 1TUFA 4GBDA 4HN4A 1YITS 4E0DA 2EKGA 4DIAA 1TZ9A 5KFXA 4XDCA 3W85A 3PZ9A 3PNIA 1DKWA 4DBEA 1ZU8A 2VOMA 4LYPA 1FH8A 4JFUA 5AE3A 4DLEA 1O68A 3EWGA 4G1IA 4U5IA 2UXCJ 3AIEA 1SFSA 3VIJA 5KFOA 1QUMA 2ZRZA 3GTHA 3AMDA 4WDXA 4ACZA 2WSCC 2DT9A 4QIGA 1LXJA 1NPRA 1M9HA 4LSNA 1B57A 1E9YB 1Q8IA 4ES4A 4RWWA 2CERA 3CWOX 1C9WA 4X2BA 1UVKA 1WZMA 3L4XA 1QAPA 2PMHA 4FX6M 2NX3A 3WHIA 1ISZA 4ZOEA 2JC1A 5KOWA 1Q5MA 2YA2A 3CCTA 4ZVPB 4QGCA 5A6MA 2WLZA 3W5XA 3EB2A 5IHSA 5E2QA 3KRSA 3M1VA 3MMAB 3EYZA 1PB0A 4AMCA 4B2DD 1JNDA 2OD6A 3DM2B 1VCFA 3UWEA 4AZ7A 2VP8A 1G4SA 3W6YA 1DARA 2CJAA 2Y8VA 4LCSA 4L75A 4ZPAA 1GNXA 1E70M 1EWDA 2VX7A 1SQGA 1WG1A 3CMQA 3VOFA 5KFGA 1HNVB 1NHVA 2A1BA 3VR1A 4G9PA 2XG9A 5D9MA 1UJ4A 3B0UX 3I4EA 4OV6A 4HCDA 4RNJA 4ZQMA 1J8VA 4G7EB 2QJJA 3TQVA 1ME8A 1QVFR 1WZLA 5ETSA 4XSMA 1JKHA 1Y5XA 3TRGA 3M64A 1DWFM 1B0PA 4HEA9 3P84A 2GGEA 3PRVA 1OBAA 4I2QB 1E51A 3VCRA 1KTNA 4I9TA 3GIYA 2YFOA 3TJ4A 3AHVA 1FWHC 4B4FA 1RT3B 2B9YA 1CEZA 3RCMA 1CLFA 1S6UA 3S47A 4OLOA 1E0UA 1OGGA 1XRSA 4FXSA 3DGVA 4NNCA 4NILA 2K7KA 2AL2B 3ZQ9A 1KOOA 3NDZA 4PUDA 2QGHA 1T3OA 1HFEL 2Z28A 2CQ3A 1WOSA 4K4TA 3FGVA 2O92A 1IKYA 3UCDA 3JYTB 5D03A 4EU0A 4IFVA 1K6WA 1HBNB 4XVDA 5MKGB 2YH1A 3PBMA 1HQUB 4IPLA 3AJXA 1E6NA 3PM9A 1J5OB 3L7UA 3FDKA 1BSIA 2V81A 4EMDA 4ID8A 6ENLA 4DRSA 2CPZA 2G50A 4I67A 4HMNA 1WC1A 1A5CA 3T81A 3VDGA 3NNAA 1DIDA 5LJ5Y 1FNMA 4HU3A 1MFUA 1K9EA 4QIWD 4LUYA 1XH2A 4IFOA 3WLMA 4BF7A 1ZLPA 1XBZA 4ANDA 3OVPA 3OLGA 4W9TA 1RLDA 5GAHI 3UGVA 4I1TA 5C5JA 4FVCA 2F65A 4GWEA 3TXZA 1E9ZB 1W3HA 2XLIA 2PBGA 3MECB 4O3SA 2CPEA 1IBMJ 3W2VA 2GJPA 2R24A 3NKYA 5K20B 1NU5A 4K8EA 3WFLA 2OPPA 2RRBA 4ATWA 1RA6A 3VU2A 1AQHA 1DTQA 3LW5C 4C6FA 4H6EA 5G5IA 4GO5X 5CJ5A 3PVXA 4FBUA 2ZZMA 1U2FA 1A3WA 4AWEA 3NPXA 4ZP9A 3KCOA 1CJUA 2C2DA 3VGUA 4N42A 2ESCA 1G01A 3HQ1A 2CJBA 1PZ3A 5ETQA 3M9OB 4O52A 3RMJA 4DWSB 1XLFA 4CH7A 3MANA 1ITUA 2PAJA 4U8VA 1S9GB 1DIEA 1W3NA 4XVEA 3S01A 4X4QA 4JIPA 4A3QA 2ZE0A 2WSYA 1FHLA 3M9YA 1R27B 1VQYA 1H49A 3J7YI 3HPXA 1MZHA 2QF7A 3MI2A 2L48A 3PULA 1NFPA 2R1KA 4GH3A 1SPQA 4B17A 3HZ3A 3DFEA 2NW0A 3ARXA 2CLMA 1J2VA 1BLUA 4HT7A 2KG1A 4K38A 5LA1A 2RDJA 4ZB0A 3LXBA 3ZT6A 4ECSA 5EB8A 3T0CA 1LF1A 1UUQA 2E6FA 5CC5A 4B5VA 2Z0IA 5G4DA 2ZRWA 4F3HA 1EBGA 1S1VB 1IT8A 2XVGA 2X51A 3DDIA 4ZE5A 3S1GA 2MKJA 4YR2A 1WNOA 4O4GA 2JKAA 4HHJA 7FD1A 2K2PA 2QUMA 1EX8A 4XZHA 1TL1B 3LP0A 2X0HA 3F4DA 1OB0A 2GJXB 1XCFA 4CLPA 3D5MA 1KBBA 4U4MA 3W9HA 4Q4RA 2KT3A 1NF0A 2GA7A 5C70A 2BJ7A 4ZSTA 2AGKA 4F4RA 5A6WA 2Z29A 1FFWB 3IIXA 4RPPA 2ZX7A 4XZMX 3W0KA 2DIKA 4H9UA 1JLBB 4P2MA 5LSLA 5I3FA 2X7IA 3AB2B 4KHPF 2OFJA 4PFMA 2HURA 4DN1A 1XDLA 3WQ5A 5D9PA 2HWHA 2OIHA 5L1KA 5D4NA 1T8EA 4Q8PA 4IIGA 1NFBA 2PDGA 2TYSA 4JTKA 1WG4A 3G96A 2PDIA 3TA9A 3OLBA 1TK5A 1O6IA 1K8XA 1R9ZA 4CEUC 3T8QA 1SJAA 3GVRA 3I6RA 2CUYA 4OJHA 2E8ZA 5KZDA 1LBLA 1FWLA 3UXKA 4A8QA 4DN9A 3W2MA 2CG4A 2PRMA 1UIOA 1AW5A 2HS6A 1HI8A 1C0TB 3DCAA 3W2VB 5D32A 3RCYA 3W1UA 2DIEA 4ED4A 1WJ9A 1YADA 1U5HA 1QTNB 1NP2A 2OYKA 3T4WA 2IYGA 3UPBA 3VMOA 1AA1B 1WHYA 4LRDA 3IVUA 3UR7A 3OZYA 4QJ5B 5D4PA 2CBVA 3S0CA 2CPYA 1WUFA 2ZTKA 4XAZA 1FWBC 1C93A 1FFQA 2DGOA 4DI8A 4OE7A 2FLIA 2BE2A 1D3CA 3DC8A 3ITVA 4IIDA 2G2ZA 3DXBA 1R8LA 1NM2A 1EJVC 1HJSA 2WLYA 5FF0A 1ELSA 3BARA 5K9DA 1XD0A 4DSKA 3S83A 1YBAA 4K59A 3FKRA 4P2FA 1OSDA 2A0NA 5EFDA 1Q85A 1EFZA 4AD0A 3SDEB 3QRPA 2CWNA 4H8UA 3WN6A 2R7RA 1FJ7A 5B7WA 1EYEA 1IKYB 3JYTA 1IR1A 1EXPA 5EWEA 3IJQA 2IIHA 5GVQA 3M0XA 3P8BB 2GHPA 3YPIA 1VJSA 3N5BA 2OO6A 3LHYA 2G0JA 5DO8A 3PG9A 2AL2A 3IP0A 2J7DA 3E74A 3N17A 2DNNA 4N7TA 1KNZA 3Q8QB 1I2PA 1FDJA 3KX6A 2OZTA 1TMLA 3MUTP 4FSAA 4MG4A 3MSYA 4WE1B 4XIUA 4O1BA 2JIEA 3QZEA 4H2CA 1WELA 3KLLA 2VELA 3KK2B 5PTDA 3MDFA 3LENA 2PP0A 4AQYF 2CJQA 1HNWJ 3QQWA 3M44A 5ETLA 1V5IB 2JL9A 4S2BA 3SIMA 2WB1D 3NM3A 4LIRA 3WMLA 1H98A 3F41A 4FLRA 3FEQA 3ZJ7A 4UQ9A 2CZ9A 3D9BA 3ISIX 2J7FA 1WKDA 2HFZA 1TTPA 1W1B1 3EOUA 3LNMA 2BVTA 2RAGA 3WBWA 2VBXA 2MQNA 3EYPA 3EE3A 1XC6A 4PCTA 1K02A 3EVMA 3MZ2A 1JZ2A 1X4DA 1QPRA 3F2BA 1W9BM 1RVKA 3FFIA 3LCLA 3GP9A 1WKEA 3MPVA 1UR0A 3UXIA 2YCKX 3TQEA 4D6EA 3TSDA 1HBUA 1UR3M 2HQIA 4HH0A 4JI0F 3RXZA 4P8VA 3O8AA 1K9FA 4UIOA 3LQVA 3ZJ6A 1A50A 4EVZA 3BBBA 3M32A 2IY5B 3BMWA 3VNKA 3OTOJ 3D7SB 4LOCA