3PJXA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, p32
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 155
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjxA01
1RTJA 3VQSA 2ALZA 4MFBA 5F8NA 2XC9A 4WE1A 3U2EA 5EWEA 4FS2A 5FDLB 4TLRA 2V4RA 4KKOA 5EUHA 4WZMA 4TQRA 3UDLA 5I3UA 1JLCB 4EBEA 3ISNC 4EO8A 5J2PA 5DGBA 2BANB 4NLGA 5J2MA 4WFXA 4ZVGA 3KLHA 4OL8A 2RDIA 3SI8A 3V81A 1S9GB 1SH0A 4ZP9A 1QE1B 1RT1A 2IAJA 2VG5A 1Z4UA 3BQ0A 2OPSB 3BREA 3MEDA 5KFHA 4YR0A 1TL3B 4TY9A 3MR3A 3G6YA 1EP4B 2OPQA 3M8QB 4J9MA 4QPXA 4J9RA 3MR6A 1TKXB 4DL7A 1C2PA 4NLOA 4NLDA 1LW2B 3IGNA 3RB6A 4ECXA 1HNIA 3HVWA 5DQHA 4Q8EA 1DLOB 4LQ3A 3PFMA 4PQUA 3JYTA 5EDWA 2JEFA 2AX1A 5HROA 4I2QB 4MK7A 1TV6A 2AU0A 4DEZA 4F4YA 3MTKA 4EO6A 3C6UB 3I0SA 1RYSA 3TAMB 1T05A 2ZKUA 2JEGA 4F4WA 4IH6A 1MU2B 2FLPA 3KK3B 1S0OA 4KO0A 3FFIA 4LSNA 1RT7B 4O44B 4RUCA 2IM2A 4URGA 4RW6B 2YKMA 1JLEB 1SUQA 1RT6A 3CDUA 3V6DA 4TN2A 2RF2A 1RTIA 3FQKA 3PJWA 3QGHA 4MKBA 5CYMB 1S6PA 3NBPB 3T1AA 4IH7A 3HHKA 1HARA 3MF5A 3KLGA 1S10A 4WZQA 3DMJA 4DL2A 4KB7A 1JLFB 3DLKA 4Y9NA 1IKXA 4KHMA 2VG6B 5I42B 4KSEB 4J9PA 2AGQA 3GQCA 1HMVB 3Q8RB 1IKWA 1VRTA 2W7PA 4IRDA 3CJ2A 1S1XB 4Q0BB 3H59A 4G1QA 1QAIA 4MK8A 2R8GA 1S1UB 1C0UA 3JSMA 1RTHB 1LWFB 2HWIA 1JLQB 2OPRA 1S9FA 4XPCA 3IG1A 3LALA 2J6TA 4ECZA 2VA3A 3DOLB 4Y2AA 4TYBA 2R2UA 1JLAB 3V6HA 5HP1A 1T03A 2GC8A 2R8KA 3DM2A 3MEGB 4ECTA 3DRSB 5KFEA 5L1JA 2WONA 1DTQB 3Q8QB 1JIHA 2W8KA 1D0EA 4DL3A 3HV8A 5L1KA 4R0EA 3QZ8A 2YNHA 1EETA 4ECUA 1TQLA 1SH2A 1K1SA 3RB3A 5F9NA 1N5YA 3QLHB 2RKIA 1SV5B 3HVTB 4ECWA 2GIQA 3GFZA 4H4OA 4G3IA 2AX0A 2W9BB 3SFGA 3GIMA 2ZD1B 4MKAA 4Q44A 1S1TB 5MKGA 4RNJA 4I2PB 2BE2A 4URSA 1T3NA 5MF5A 4AFYA 3BR9A 3UPFA 2BQUA 1HPZA 4HU3A 1GX6A 1IKVA 1J5OA 5F8MA 3DI6B 3GYNA 3OL8A 1RAJA 2OH2A 1JKHB 4MIAA 4ZPAA 3DOKB 2HNZB 4RZRA 1C1CB 4IRKA 4JUZA 2XGQA 4NLSA 3KJVB 3RBEA 1I6JA 2B6AA 2R8JA 1HNVA 3KLIB 2E9RX 3M9MB 2J6UA 5DLFA 4WYLA 3I0RA 3FQLA 2VG7A 5C25B 4B3OB 3CWJA 4KE5A 5KFFA 3Q8PB 3KLFA 4ZHRB 1KHVA 3DYAB 5KFIA 3MEEA 1REVB 2C28A 2XI3A 1FKPB 1BQMB 3KK1B 2B5JB 2IM0A 4ZPDA 3PW4A 2F8EX 3LP0A 4I7FA 2HNYB 3HV9A 2YKNB 4Y3CA 3GILA 4K4WA 5KFGA 3DDKA 4ZP7A 5KG4A 3MFIA 2ASDA 3PR4A 1N56A 2WK4A 2FJXA 5KFKA 3TQ1A 4F48A 2UUWA 3LANA 1QUVA 4O4GB 5KFDA 3CJ0A 2ASLA 1HQUA 2HWHA 3BGRB 4RW8A 1RT2B 3E01A 2BR0A 1LWEB 4K4UA 4RW9B 4KBIA 2YNGB 3PW0A 3CDEA 2BRKA 4KHRA 2WHOA 3GV7B 3H40A 4EYHB 3RBDA 3M8PB 3I5AA 2IM3A 4DL4A 3M9OB 2BANA 2UVWA 1S6QA 3CJ4A 2R6OA 1LWCB 2IJFA 4QW8A 2FJWA 3LP2B 4F50A 1S9GA 4O3NA 5KFRA 4IFYB 1QE1A 1R0AA 4U7CA 4ZPBA 2OPSA 1S48A 3CIZA 3G6VA 4PWDB 5J2QA 3H98A 1TL1B 2QV6A 2ZE2B 1UWBB 3GFYA 3T5HA 1TKXA 1W25A 1LW0B 4NLYA 2IMWP 3QIPA 4Q6JA 2C2EA 4NLTA 2I5JB 1LW2A 1FK9A 5K14B 1NHUA 3ITHB 3KK2A 1DLOA 4LQ9A 2YNIB 3OHBA 1XR7A 4I2QA 4NCGB 4QWCA 4FOJA 4ES4A 4O3PA 1S1WA 3IGVA 5KFXA 4KKOB 2GIRA 2V4QA 1HQEA 3C6UA 2BRLA 3MECB 4TXSA 1TKTB 3TAMA 3OLAA 2C2DA 1RT5A 3LAKA 5KFPA 4RW7A 4NLVA 3H2LA 3H5SA 4Q43A 4WFZA 3V81B 1RDRA 4TY8A 2IM1A 1IKYA 4ZP6A 4FOUA 5HLFB 2C2RA 4FBTA 2JEIA 3MEDB 5CYMA 3GIJA 2C22A 1C0TB 1K1QA 2OPQB 3NBPA 4WXOA 5L9XA 5KFVA 1RT3B 4ZP8A 3OLBA 3QGIA 2W7OA 2EC0A 3N6LA 1JLFA 4IDKB 1HNIB 4DL6A 2IJNA 4RUAA 3Q8SB 3FSIA 4J9SA 5I42A 4PQUB 1HMVA 3C6TA 1VRUB 1D1UA 3QO9A 4RW4B 5EWGA 5HROB 1S97A 4Q0BA 2D3UA 3DLEB 5T14A 4HYKA 5KFMA 3TLQA 1RTHA 2HAIA 4KFBA 4Q45A 1T94A 5KG1A 4O3RA 3UQSA 4ECVA 1S1VB 4KV8B 4ICLA 2IC3B 1FKOB 3KLVA 4LJ3A 3DOLA 4NLRA 4YQWA 4LSNB 1JLAA 2WTFA 2AWZA 2WCXA 3QGGA 3KMSA 3SY8A 2V0NA 4ED8A 5DGAA 2YKMB 1S0MA 4J40A 5KFQA 1OS5A 1RT6B 3DRSA 3BSAA 4GC6A 1RTDB 1RTIB 4LSLB 3PW2A 2ILYA 2WRMA 4U6PA 3IRXA 4QW9A 3KHHA 2VA2A 4F4XA 3KLGB 3GFXA 2FVCA 3KHLA 4ED6A 3CVKA 1HYSB 3KLEB 3DLKB 5DG7A 2HNDB 2IBKA 3PJUA 4AG0A 5DG8A 1TKZB 4DG1B 1IKWB 5C42B 1VRTB 3H5UA 1S9EB 4J9LA 5KT2A 2W9CB 5HBMB 4IG3B 2AGOA 2FJVA 4IFVB 5JXSA 3OL7A 2FVQA 4O3SA 2OPPA 3OL9A 1C0UB 5F8HA 1ZTWA 4NLWA 4J9OA 2R2SA 4MH8A 4O3QA 5C24B 3IN5A 2OPRB 5J1EA 1WNEA 4JV2A 1BQNB 4IG0A 3GV5B 4ID5B 1C1BA 2CJQA 2QE5A 1T03B 3H5XA 3DM2B 1JKHA 1KHWA 3DOKA 1S0NA 4QWDA 3MR2A 2YNFB 3PJXA 5D3GB 3CO9A 3HKWA 3M9NB 2B43A 3BJYA 4EEYA 4ED0A 2ASJA 1EETB 3KLIA 3CJ5A 5KT4A 4XPEA 2HMIB 4K50A 4ECYA 3MR5A 4PUOA 4H4MB 3V6JA 1JLBB 3IS9A 4B3OA 1SH3A 1TVRA 2RKIB 1KLMB 4MIBA 4WXWA 3GG1A 4RNHA 2WOMB 2E9TA 2D7SA 3TVKA 4H4OB 4MK9A 4ED3A 3DYAA 4EBCA 3V4IA 1REVA 5KFWA 3PW5A 3KK1A 1FKPA 1BQMA 4F3HA 1JLGA 4M95A 5DLGA 2B5JA 2V9WA 3PR5B 4EYIB 4LYKA 2HNYA 2YKNA 4TQSA 3KHGA 3N6MA 2RDJA 1N6QB 3DLGA 4HU4A 3RB0A 4ED7A 1RT4A 1J5OB 2UVVA 4IR9A 3T5JA 4DL5A 3FDSA 3BGRA 3OSPA 3LP1A 1RT2A 2DPIA 2JC1A 3KNAA 3H4DA 4RW9A 3NAIA 2R2TA 4IOBA 2BASA 1HNVB 1DTTB 4ZVFA 3UR0A 5FDLA 3T5KA 3RAXA 4Y2CA 4Y9MA 3M8PA 5CYQB 4FS1A 5KFCA 4R5PB 2R8IA 2DPJA 3DRPB 1JLCA 2I1RA 3DRRB 1LWCA 4O4RA 4JV1A 3LP2A 3CJ3A 3KLFB 5KG2A 3T5LA 3BQ2A 4NLUA 3MEEB 4Y9PA 5KT7A 5KFJA 1YVFA 3ICLA 4PWDA 4Y8EA 4M94A 4I7FB 4KAIA 1TL1A 1TL3A 1UWBA 5F8JA 5JUMA 5KG3A 4YP3A 3KMQA 1EP4A 2JC0A 3M8QA 2I5JA 5K14A 4RU9A 4ZPCA 4F4ZA 2FLNA 3ITHA 5J2NB 4R8UB 5KG5A 4HJFA 1JX4A 3E01B 4NCGA 3PW7A 2XI2A 1RTJB 2AQ4A 3NL0A 4MFBB 2ILZA 3MECA 4WE1B 1TKTA 1ZTTA 5KG0A 3N6NA 5I3UB 5F9LA 3H4BA 2YNIA 4XO0A 4K4TA 1S6QB 4RNFA 1QAJA 1MU2A 5J2PB 3D5MA 3KK3A 2XWYA 5J2MB 3NKYA 5L1LA 5HLFA 4ZMMA 1RT7A 3KLHB 1ZETA 4O44A 1R0AB 1N48A 3KOAA 4K4ZA 4RW6A 4RNMA 2VG5B 1RT1B 1JLEA 2IAJB 3QZ7A 4YR2A 5J2QB 2BQRA 1C0TA 4K4YA 2E9ZA 3G86A 1RT3A 2O5DA 3QIPB 4J9QA 2AGPA 1FK9B 5KFUA 3MFHA 1NHVA 3HVAA 4IDKA 3KK2B 3PVXA 2ATLA 2JEJA 1VRUA 3SFUA 4FOKA 4RW4A 2FVSA 2VG6A 2J6SA 3OL6A 3DLEA 3JYTB 2JLEA 4GC7A 5KG6A 4FBUA 1S1WB 1S1XA 4WFYA 3T19A 2XGPA 1HQEB 1S49A 1TV6B 1XR6A 1S1UA 3PHEA 1S1VA 4KV8A 1RT5B 1LWFA 2IC3A 1JLQA 1FKOA 3I0SB 4RW7B 4NLXA 1T05B 1N6QA 3NGDA 3FRZA 4KO0B 3FFIB 3I5BA 4TY8B 1IKYB 5KT3A 2XCPA 4J9KA 2BQ3A 2UVUA 4HKQA 3GV8B 4K4VA 5F8LA 1RTDA 4LSLA 3MEGA 1SUQB 3EPGA 3V6DB 2RF2B 3BSCA 5DQGA 1DTQA 4X2BA 1S6PB 3GIKA 3BSNA 1HYSA 3KLEA 2HNDA 3DMJB 1TKZA 3C6TB 4DG1A 4YMEA 3QO9B 5C42A 1IKXB 1S9EA 2D41A 2W9CA 1TP7A 1GX5A 2CKWA 3QLHA 1IM4A 4IG3A 5HBMA 1SV5A 4IFVA 4NLPA 4ECRA 3HVTA 4K4SA 3RAQA 3CDWA 4KFBB 5C24A 4G1QB 3S83A 3I5CA 3GIIA 3PJTA 3JSMB 2W9BA 2ZD1A 2R2RA 2R8HA 4J9NA 1S1TA 4ICLB 5KFBA 3IG1B 4I2PA 4QWBA 2W27A 1BQNA 5KFYA 4ID5A 4KIEA 3RB4A 2IA6A 4RNNA 5KFOA 3NMAA 5KG7A 3DI6A 4RNOA 1MMLA 5HP1B 3LAMA 5KFTA 3BSOA 1RA7A 2YNFA 5D3GA 4ED1A 5KFLA 4ED2A 2WONB 2HNZA 3IRXB 1C1CA 2WB4A 4O3OA 4ECSA 3KJVA 3V6KA 4Y9OA 2HMIA 2YNHB 4TYAA 4H4MA 1RA6A 1JLBA 4NRTA 1N5YB 1KLMA 1XR5A 2XCAA 1JXLA 1CSJA 5C25A 2WOMA 5DQIA 3N3TA 3E51A 2OPPB 4NYZA 4ZVHA 4ZHRA 4JV0A 5F8IA 5J1EB 5M1TA 3EZUA 5MKGB 4EBDA 4QWAA 2BE2B 4IG0B 5KFAA 1C1BB 1HPZB 2D3ZA 4NRUA 3QYYA 2UVRA 1IKVB 4IRCA 5KT5A 4O4GA 4K4XA 5KFNA 3ISND 5F8GA 2FVPA 5KT6A 4IH5A 4RNIA 1DTTA 1LWEA 3OSNA 4WYWA 2YNGA 4ZVEA 5KFZA 2B6AB 5CYQA 4H54A 4R5PA 4ECQA 4PUOB 1U09A 3DRPA 2FLLA 3BQ1A 3IS9B 4IR1A 1TVRB 3DRRA 4Y34A 3I0RB 3D28A 2VG7B 4URQU 3H5YA 4Q8FA 3V4IB 3KZPA 3GG0A 1JLGB 4IFYA 2UUTA 4NLQA 5DG9A 1NNDA 3KHRA 4IKAA 4QWEA 5KFSA 3LP0B 3NAHA 1RYRA 3DLGB 2ZE2A 4YR3A 2W8LA 3QIDA 1LW0A 1RT4B 4NZ0A 4R8UA 3EPIA 5J2NA 3PZPA 2FVRA 5EWFA 3G6XA 3LP1B 3OHAA 5L1IA 1N4LA 4IQXA 1S4FA 5C5JA 1HQUB 4RW8B 2W9AA
chains in the Genus database with same CATH superfamily
3HN3A 4JHMA 5F8NA 1H7PA 4FS2A 5FDLB 2IHR1 1UD5A 1MZHA 3R1HA 3D5HA 1A4LA 1ELSA 4PRFA 3SY1A 2AP6A 4QCEA 2H6RA 2XMUA 2VFRA 3ENAA 4JIIX 3ZFVA 4N0RA 1JYXA 1HW8A 4PEEA 3R5EA 4KWOA 1HKIA 4MHBA 4NLOA 4AZ7A 1VFSA 1HJVA 1M7JA 4ATNA 3M0HA 3BSGA 2E66A 3RMJA 4NL5A 3LDVA 5GJNA 3WQ5A 4MK7A 2X1RA 4L65A 2QV4A 2KRBA 2J0QD 1T05A 1MXGA 2V82A 4YCPA 1F9HA 3KK3B 3DYOA 1S0OA 4Q2MA 3HURA 2WZIA 4FYVB 1W1YA 1SUQA 3LO3A 3T7VA 3PTMA 5EBAA 1LQ0A 1KBLA 4CLUA 3W70A 2H4WB 4P2SA 2FGOA 1LOLA 4B5XA 3HHKA 1KM3A 2MQMA 4AH7A 4KB7A 3MXHP 2HLUA 1IKWA 2VC0A 4PUUA 2DZSA 3GC4A 1XIMA 3A9BA 3PAJA 4ZOCA 1RTHB 2HVZA 2K1RB 1X4GA 1P48A 3QF0A 2AMXA 4E98A 4F4AA 2C3OA 3TAPA 3BOXA 3CL6A 5GADU 3CASA 2GZOA 2P1FA 3GR8A 2HRWA 4ZENA 4IQEA 4DF2A 3R7NB 5HXMA 4NZ6A 3G3MA 1M01A 3M0JA 2ZKMX 5L1KA 1SH2A 3KLLA 2BOEX 4AXKA 5F9NA 2X09A 4NZFA 4ZK7M 1KC7A 8TIMA 1YLXA 2WVBA 4KFNA 4KPYA 2O1PA 4LC6A 3W02A 1QSLA 1CXLA 4C1KA 4IHCA 1PBUA 3JUGA 3QHMA 5HJYA 4GZEA 3LW5C 1KB3A 2NPIA 1US3A 5IZHA 3SJ3A 1IKVA 1OMSA 2H9AA 3I3EA 1RAJA 2RDXA 4OE7A 3U48A 2DSKA 3G1VA 2V69A 2DNZA 2XGQA 2I7GA 4M5KA 1KR1A 5K5MA 5DLFA 3GRIA 4XO7A 4OTKA 2X3GA 4KE5A 3WL0A 1FCVA 2RU9A 3NG8A 2G2OA 1U83A 3CT9A 1BQMB 3WD2A 4BWLA 2IM0A 4Z2HA 3D1HA 3GW0A 4C7DA 4KEVA 1HVXA 3H2UB 4TU8A 2ZZ1A 4GIYA 5HNRA 2Y1RI 3CCWA 5GAHI 1AXQA 2ZHBA 2HYIB 3W00A 5C55A 1ME8A 4YWIA 3OTDA 4FA3A 4YMZA 4FKXA 4EIVA 1LOQA 3GV7B 1FTXA 4KH0B 2BANA 1E6XM 4A47A 1K6WA 4LBRA 3IA0A 1S9GA 2A3BA 2AL2B 4P10A 3AT1B 1V0LA 3VTRA 3FBBA 2K8GA 2QV6A 5DS7A 2OHDA 2PFFB 4IMDA 2HQ3A 3VFCA 2NLIA 1E6YA 4JTJA 2M0GB 3VMNA 2WC3A 1HBNB 5LIWX 3H7HB 4AEFA 4CD5A 4JPGA 3JTOA 4FVCA 4QWCA 4FOJA 1N34F 4PUEA 2A85A 2PF0A 3GG7A 4M6UA 3K8VA 3TAMA 1D8ZA 1LXNA 2NW0A 2DNGA 1XPYA 1R3QA 4CCDA 5A69A 1IKYA 1YDLA 3FXGA 3LTOA 3N4WA 4OI3A 1RADB 4FXFA 2N7YA 3EDQB 3C2VA 3FSIA 3WDHA 4GIEA 4M5JA 2VL4A 4J37A 3OEXA 4FNRA 4ZODA 3TLQA 2J6VA 4JYDA 2Q09A 3GDBA 1RHRB 3NSNA 2QCNA 4JBRA 1OINA 4OX8A 4GCAA 3VI2A 4KCWA 2Z1XA 2EXUA 4ED8A 4M24A 1UUOA 5IT4A 4CN4A 4LF1A 3BV7A 3OFFA 4M5IA 2F38A 2KTQA 4CLLA 3KLGB 3KLEB 1G01A 2CQGA 3AJ1A 1S2CA 1V3KA 3A22A 4QROA 1DQUA 1UD8A 3S5ZA 4MOZA 4ZOAA 2XIBA 3P67A 2WWDA 5ENLA 4HU0A 5B08A 4KEZA 2UUBJ 3AFGA 1JUEA 1KM1A 2XSFA 2NQ5A 1BQNB 4B9TA 4UQAA 4LWWA 2CJQA 2XIOA 1TFWA 1GK8A 2X8RA 2BWGA 5IBXA 3S7RA 3BO9A 3EX6A 3HPSA 2LVWA 3W7GA 3L7RA 3RRGA 1HQ2A 3CJ5A 1QAXA 3BGGA 3VUSA 4XZ9A 1BF2A 3J7AN 1GG0A 1NWRA 2F7VA 3QEZA 2HPMA 4RWWA 3SCJE 2XWDA 5A6AA 2HURA 3PK7A 4B02A 4JKKA 2EPIA 3PW5A 4MFDA 1ZALA 4M95A 2B5JA 5BRPA 2DO4A 1GTEA 4QX4A 4JV5F 1SMAA 4I1TA 2RDJA 1GZGA 1XQKA 3E2RA 5G1TA 2MY8A 4PXEA 2W4DA 3KCLA 3HHDA 4FKYA 3T3FA 4U3CA 2CLMA 1L3UA 3GTYX 4NZ3A 4WY0A 3DC0A 3UR0A 2H5JB 3BWWA 1WUUA 2OEJA 2NSOA 1SKSA 2BYCA 3VABA 4G5DA 4HN4A 1T96A 3KLFB 2EJAA 5G0RB 3BQ2A 1NY1A 1H38A 1E3XA 2QVNA 4DV4J 1YVFA 2E6YA 2OJ3A 2VBXA 3KUHA 5KG3A 4YS1A 2FLNA 3WMSA 5CC3A 2KFZA 4XUYA 2R42A 3QMSA 2V5JA 1XH1A 2XI2A 4WD0A 5LKYA 5EFFA 4MFBB 2XGIA 1ZTTA 5JJBA 4EX4A 5I3UB 1EB0A 4D6FA 2Y1JA 2FHJA 4MNLA 1C9DA 4KGKA 1TL5A 5E3PA 1VS3A 2WVFA 2RDDA 3CMAS 2PZNA 4WOZA 1JLEA 3QZ7A 1WBJA 2GHVC 1Q86T 4ZFMA 4FX6M 3G86A 2IKHA 2V67A 3AS3A 3G96A 1UR4A 3CWHA 1UWTA 1FE0A 2GVZA 2G2ZA 3OYZA 4LUSA 5GAEI 3TUJC 3MMBA 4KW2A 4DV6J 5MHBA 3OQ8A 4GK8A 1S1WB 1S1XA 3LENA 3ZSTA 3FDKA 3OTOF 5JVGQ 2W91A 2P0IA 3MO4A 4N4PA 3UG4A 5CKSA 5CCLA 3OLEA 2G0CA 3DC8A 3PRVA 4OQJA 3UZJA 4HA1A 3MMCA 1QNSA 4URIA 4H9TA 2K3IA 1EL3A 2PD9A 2R8WA 3UY7A 1DFDA 3B03A 2N3LA 2VOPA 3TW6A 2VUYA 3SI9A 3MCMA 1GVOA 3T1HJ 4CLTA 1OPZA 1F2JA 3WQCA 1K3UA 1PKLA 3SSZA 1GX5A 3D0CA 1A6LA 3WG6A 3WDOA 2WPGA 4NLPA 4LRTA 1O5RA 3HVTA 4Q8VA 4G1QB 3QHOA 3ZXWA 5JMNA 3N13A 3SCPA 3A3HA 3A4JA 3FRYA 4DUYJ 3RB4A 2UY3A 3HD1A 2H3DA 1NF0A 2UU9J 3JTNA 1YJRA 4AZCB 3S8HA 1NDYA 3VZIA 4WU3A 3WQWA 3T42A 1XBVA 2Z0GA 2GS8A 3QTPA 1OWXA 1J0JA 3PZVA 4KFOA 4LFCF 5J8LA 2GA7A 5G4HC 2GZXA 2VUNA 4L4PA 1TJPA 2YCLB 3W7JA 4YB5A 4JV0A 3FY1A 1A5MC 3I68A 1LEOA 4JNZA 1NBEB 4FSAA 5F3ZA 3G8RA 3UCCA 3OR1A 2OZ8A 4DJEC 1TU0B 3FUYA 1XIIA 3GNOA 3P5TL 2D3ZA 5LSRA 1PBAA 2QLYA 1E5JA 2A79A 2J76E 2E77A 2G4FA 2YW3A 2JF6A 4DI8A 4QHRA 1OCJA 1UR8A 4JQAA 4QCFA 2B6AB 3PIOQ 1U09A 1FWFC 3IS9B 2CUYA 4UY8T 3CS2A 1C90A 1YE4A 5F2MA 1H1NA 2OVLA 1HFBA 2W63A 1VQ9S 3IAPA 1WI8A 2D69A 3WLQA 4N9BA 2ZH3A 4J90A 1FKAF 2L08A 1FKXA 5EYWA 1W3NA 3N2BA 1HO1A 2C8NA 3QC3A 3UXIA 1VHIA 2K7JA 3PZPA 2WYSA 3BJSA 1N4LA 1TUGB 3GPAA 5C5JA 1VJSA 1PIFA 1VQ4S 1OK4A 2QDDA 2V4RA 4LU0A 3T81A 3O05A 1Q45A 3AO0A 4IT1A 4HEA9 1RWMB 1N32J 2W61A 3H90A 2HQGA 2VG5A 3VAJA 3PKMA 4EWND 2HRTA 4LRAA 3M8SA 4GI9A 2N4DA 1G1XA 2VWTA 1IF2A 3MR6A 1OC6A 3RRXA 4J5NA 5KINA 4KWSA 2OGYA 4Q8EA 1FWAC 3R3TA 3L66A 2YDQA 3B8WA 1PYFA 1U26A 4DV3J 4L9YA 4ASTA 3I96A 1L3VA 3A9IA 1FRMA 3BL3A 3CMJA 3NCOA 4MB3A 4DB7A 5B09A 4MTVA 1P6TA 4AD4A 3OUYB 4LVBA 3KVLA 1OFAA 4UXDA 4Z42C 1XICA 4ZB2A 4RUCA 4GINA 2DJLA 4BS0A 4MZ8A 2LDIA 3Q58A 3TC6A 1U49A 4RXGA 4E2BA 3OZPA 3LBOA 2CZ5A 3MPGA 4QISA 4LSBA 1G4TA 2DVUA 4WKRA 2INEA 1IKXA 1XD1A 2G95A 1XDJA 3V1PA 2LXFA 2XZTB 4Q0BB 1VIZA 4UTGA 2CZVC 4RBTA 1SSDA 2QIFA 2PDYA 3LCLA 3LM3A 3WLOA 2AYMA 2J5AA 1W1A1 3WUEA 2FZMA 1PL9A 3DFQA 3R0KA 2FJDB 3SV4A 3RUBL 3DM2A 4JKMA 4OZJA 4XZMX 3PPFA 1A0EA 1H5VA 2V9KA 1HNWF 5ETVA 1CWYA 4N6EA 2KL8A 5LHEA 4IQMA 4ZFCA 1R7AA 4NF7A 1Q8KA 1WTBA 4JTHA 4OIXA 3OVRA 2ISWA 5M2UA 4XD5A 4LCQA 1KV8A 4AD1A 1TPB1 2CKSA 1W1IE 3UPFA 1RLCL 5LZLA 3D0GE 3ARRA 2VEIA 4GBUA 1ZRQA 3RPTA 3GJQB 3EBVA 2HG4A 3AA9A 4JUZA 1EJRC 3WLIA 3HHLC 3DLHA 3QYSA 3RX4A 2DHSA 4H9MA 6XIMA 3POTB 3C2EA 3AJ7A 4FX8A 3W61A 4RDWA 3PKYA 3E9AA 3AALA 3N4AA 2GJIA 5ETMA 2VT0A 1EJVC 3TW9A 3M64A 2Z24A 1QAPA 4I7FA 1XIQA 3WBWA 4NNAA 5KG4A 3J7YU 3TYTA 3PM9A 4JTLA 4J3XA 3UCDA 4PTVA 2ZXBA 3LPFA 3B8TA 3ZR5A 4O4GB 2YCKX 1PYTA 2QUMA 1RT2B 3M0LA 1VIXA 4GQQA 4YY3J 3MHYA 4N02A 3WBZA 4UFHA 3LU2A 2BRKA 3AZRA 4DR6F 2TSYA 1OQ6A 3TTYA 3M8PB 4Q8WA 1UA0A 3VAVA 4F50A 1GQKA 4EU0A 1R8PA 1XLKA 4CO5A 3HA1A 4GVIA 3WF4A 4CM0A 2GAGC 2VR2A 2IMWP 3AYSA 3FKBA 1WDRA 4X4SA 4OWGA 4P73A 1NHUA 1F6YA 4R0JA 2HBVA 1TV8A 5CJMA 4I8DA 4LBHA 4CZCA 1X9WA 4QYZK 2LQ8A 5LIKX 4NCGB 3W71A 1XFBA 5I5RA 1OCNA 1GHRA 1EO7A 1XMBA 1EPXA 3EDFA 2WBMA 2C2DA 3GJRB 1IBKJ 2B8QA 1V08A 2J66A 3WK0A 4AYBD 4A8XA 3TUPA 2CJBA 2E7WA 1WKJA 4OHXA 4H9YA 2Z2UA 4S3FA 4XK8C 5C9ZA 4AL7A 2EJ1A 5U7SA 2KU7A 2F2HA 1NKBA 5LJ5Y 2EC0A 3LOUA 3N6LA 2W1BA 1YXYA 3Q8SB 2R9LA 4O18A 1NP2A 2WVTA 1N0UA 4AD2A 2MYFA 2AJQA 4WHBA 4CD7A 1RTHA 2KDOA 4O3RA 1RQEA 3MGJA 3MDWA 3W5YA 2YH1A 3TONA 5I00A 1TV3A 1UUMA 1NSQA 2Q79A 3KMSA 2OTJS 1ZJHA 2EBEA 3L4TA 5H91A 1FWWA 4QIVA 3TJ9A 4PRTA 3W0KA 1OPIA 3B97A 1H63A 1RTIB 3N5FA 1M1KT 1WYIA 2CQHA 2POTA 2CQPA 1SPBP 4GZIA 3TC3A 1HR0F 1M7OA 1PWLA 3PJUA 2ISDA 1S77D 2IVMA 1NWTA 2VC6A 3M7WA 3P61A 3W3OA 2HFUA 3TAOA 1BVWA 1XPGA 4F4RA 2QGHA 4ZEPA 4MJ4A 4CO1A 4NHVA 1XLJA 1B31A 3GTXA 4DCPB 5CC5A 5G4DA 4JV2A 4DNHA 2C1IA 5DMYA 4Z2LA 4PQAA 4RPFA 2LU2A 3QRRA 3N0VA 3D3BJ 3W86A 4ILLA 4U95A 1F5BA 2C18A 4P72A 3M9NB 2D2HA 2PDWA 5FF0A 5KT4A 2OAUA 1XIJA 3CO4A 1MDLA 3IBCB 1SH3A 5F4WA 1K73T 2D7SA 4CGTA 4NEZA 1FNOA 1BQMA 4MT1A 3CD0A 3NRBA 4OI2A 5AXLA 3V16A 2GGJA 2DITA 2YPYA 3U2OA 3BCDA 3VIMA 2ZFHA 3T5JA 1SZNA 5LNVA 1UBSA 2CYGA 3GR7A 3G77A 3Q0AA 3RR1A 2KT5A 1EHAA 3R4IA 2R82A 3RAMA 1OT1A 4FS1A 3LWLA 4R5PB 1TVLA 2I1RA 1RPXA 2U2FA 4C0OC 3AWNA 3E02A 2AL2A 1OO0B 4IUOA 4NLUA 1NU4A 5KT7A 1GOQA 2OGUA 5EU9A 1QI5A 3WDRA 4BF5A 2YKAA 1YJWS 1HBNA 3LCIA 4J27A 4DUZJ 1TVPA 1IZJA 3BGAA 3ZZYA 2WW5A 5KTLA 1OGGA 3GXIA 2UXBJ 1BGAA 4RK8A 1H5YA 1W0MA 3CZEA 1VFUA 1VFHA 1BQCA 4PZVA 3BR8A 1AQMA 4UTTC 4Z08A 1S72S 3WUBA 3FVMA 2A3AA 3H70A 1U5VA 2E9ZA 3NURA 1KXQA 4Y2IA 4HKPA 1PYSB 1THFD 3CZKA 5G4WA 1DJQA 1US0A 2OI2A 3FZBA 4NI2A 4L1GA 1WOSA 2BJ1A 4E4PA 4JI8F 4BDPA 1QI2A 4K36A 4DO5A 5ITHA 3RX3A 1NH8A 4AD3A 4NNCA 3RBXA 1EGMA 3E12A 4UY85 2Z29A 4B3TF 4K5RA 3U2ZA 2Y85A 2RU3A 3M5VA 1QSYA 1I2OA 3BDKA 3ZLHA 5I3PA 1NOFA 2HXUA 3NQVA 2ATSA 3HQNA 3QAUA 3MUXA 4ICMA 5F8LA 1G3OA 4G6CA 3PTDA 2NXNA 5DQPA 1CEOA 3R7BB 3VDAA 1HHSA 1WC5A 2N82B 3KLEA 3LLXA 1AFSA 3NPUA 4ENOA 4GO9A 3DFSA 3F7JA 1W2PA 1TP7A 3QLHA 2CKWA 2J78A 2MGZB 3O8WA 3AIRA 1NZ8A 4V19J 3NQ6A 2EK6A 3GVVA 3IANA 5F1UA 1BQNA 1HX0A 1DQAA 3BC9A 1A0DA 3LAMA 3TSMA 2H3BA 3VOHA 2Z8QA 2QLWA 2Y4SA 3OPKA 2Q6ZA 3WH9A 2ZOMA 3FJLA 3O07A 4O3OA 4DPOA 2XLJA 2E1PA 4UOZA 3W62A 1DBTA 2W3ZA 4XAZA 4EZ9A 5JBFA 3TA0A 3UGRA 2VU5A 1XUUA 1HFEL 5DRKA 4LF4J 1YIJS 5I3QA 1CG2A 2DGUA 4CRJA 2N7CA 4D1JA 4ZVHA 2PIIA 4UFMA 3AS2A 1X9MA 2W66A 4NIRA 1VS1A 4HSOA 4YIWA 4DR3F 3H25A 1T9UA 4CLSA 1DHPA 1XKYA 4IFKB 2NVAA 2VJVA 4JKLA 1VC0A 3AIBA 1GCYA 3L0NA 5E09A 1W5QA 4OU1A 1RAHB 2IW0A 3MI7X 2FVPA 1B0PA 3LYEA 5KT6A 4H6EA 3OSNA 1VRDA 3NCRA 4USKA 4J3VA 4L1WA 2QKFA 4LF6F 3PFEA 3MSGA 2WZTA 3BQ1A 3GC5A 3M6VA 1IV8A 2HS4A 3EMCA 3UPBA 3QGAC 3W7EA 5DETA 3TTSA 3V4IB 1YBQB 2FIQA 5DN1A 1RBLA 5DG9A 1JK9B 3C2FA 3S6DA 1W8GA 3PRBA 1JDDA 3WLJA 3GH7A 2JK2A 2GMHA 3G1DA 4H41A 4X2RA 5DRCA 1FWGC 2FLIA 3ZZOA 2UY5A 1S4FA 1RHUB 1OZMA 3NZGA 3BJYA 4ZMGA 4MFBA 2DYAA 4IPIA 3VZHA 4A21A 5I3UA 1WE5A 3DHDA 1DBDA 1SJQA 2C3UA 3TJ8A 4EBEA 3HQPA 3A47A 4ZLPA 3BMVA 4EO8A 2PUZA 1EIYB 4MIMA 4MM1A 2Z1KA 1HUVA 4ADTA 2GHWA 1XBYA 4Z1DA 4AAJA 1ZM4A 4XV0A 1Z4UA 3W1MA 3EAUA 3X1LB 4GNJA 2OPQA 3MUZ1 1FDNA 2CIPA 4J91A 4ZDNA 1WEYA 1WF0A 1LW2B 4LF5J 1HNIA 2J6XA 3PFMA 4PQUA 4LBSA 3TMLA 3LCWA 3IARA 1ZA1B 1OY0A 2FYMA 2X1IA 3OVPA 4PMQA 5JQ9A 5FD1A 4CVWA 3OBEA 3QRQA 1I8JA 4LRCA 2BNJA 3PTWA 4K7QA 1W9PA 1NU5A 1YJ7A 2KXNB 4U4MA 3TCEA 4FLQA 2G1HA 4I6WA 3NR0A 4WJ8A 3QGHA 5CYMB 2RHQB 4IX2A 3SYZA 1KRPA 1Q78A 2KJWA 3SQOP 1SL0A 3DDNA 4MYUA 1RGVA 5KITA 2DNMA 2VI0A 3ES7A 4G1QA 3A4XA 5EFDA 4ILSA 1JDAA 2IMRA 3NJ3A 3EXTA 3EXCX 4H6KA 3B54A 4Y2AA 1LWHA 3R10A 2B4OA 1MW0A 1TTQA 2WSPA 3O63A 4WSJA 1OY6A 3R5GA 4AZCA 2MQNA 5HQEA 5H9FJ 4FF2A 2KT3A 1KCKA 1HF6A 2BJ3A 1EETA 2E5GA 1FHDA 2Q01A 1JD7A 4JYFA 4NEYA 1UVNA 1VPQA 4IIFA 1JPKA 2YCLA 2O7SA 2AX0A 2DNNA 4GWEA 3NG3A 2ZD1B 3ELFA 4Q44A 5H1SV 2J9DE 4O8RA 3R6GB 1CENA 3IJ9A 3PACA 3AISA 3BZJA 4KHPF 3GYXB 2ERRA 4DYJA 1W3KA 5F3TA 3W64A 3BF4A 4HGXA 1J5OA 5CCZA 3EXYA 3OJUA 4JCMA 3PM6A 2YLLA 1WDTA 4RXFA 3IJIA 1CJUB 2B6AA 3U6WA 2GV1A 3EGZA 3MV11 1HNZF 2XVPA 2Y7DA 1YRUA 3MM6B 3FSTA 1S2TA 3KUMA 2Q1LA 3BAXA 3CCTA 3BLLA 2Z1WA 1KHVA 2F65A 2HISA 2E9BA 3U27A 9CGTA 3CMQA 1U0SA 1VHFA 5KFGA 2XTKA 3QWUA 2IRXA 3K5LA 2RT3A 4O4WA 4GJ1A 1P0KA 1IQZA 3K0JA 1E6ZA 3WY1A 1Y7PA 2RAQA 1O51A 2CAJA 2AMGA 1DWIM 4KHRA 2BM1A 3OVAA 2EHHA 4DR7F 4FVMA 1GVQA 2PODA 2QUVA 2REQB 3LH2S 2UVWA 1XIDA 3CJ4A 1VEMA 2PWDA 1LWCB 3HIJA 4POCA 2YWGA 3KG4A 4X84A 3OGRA 3S5OA 2F6KA 2GGEA 1KCXA 3KCJA 2EK1A 1RAOA 4JEJA 5XINA 4ENLA 1P1XA 1U1HA 2GUBA 1TTHB 3LSCA 4OYIA 3WHIA 1EKSA 4QJ5B 4ZE5A 4ES4A 2JFEX 3OOQA 3MECB 1CVJA 4XD6A 5L8RC 1U8SA 3AIWA 2BDQA 3OUYA 1DJYA 1P5BA 3PCOB 2JQXA 4AXIA 2M2BA 3NMRA 1O7AA 5FLXU 3C5QA 3KRBA 4NYYA 2JEPA 1VIOA 4CQDA 4M6QA 4ZQCA 2EG8A 4WXOA 4AW7A 2RQCA 1GJUA 1S2UA 2W7OA 3W7LA 3VGGA 3PZIA 2PDHA 2OUGA 3C6TA 4M3PA 1HBOB 3C61A 3FOKA 1FH8A 2CXGA 4O19A 1R3SA 1FVQA 1WHVA 2AIRB 4Q0BA 1DE5A 2OCZA 2F9DA 1P9YA 4KFBA 3PIPQ 2A10A 3BS9A 3QBCA 4MYAA 1VBXA 3GVGA 2BY2A 4LJ3A 1V3RA 4HMCA 3WC2A 1M7PA 3XISA 1N34J 4MDOA 5A8OA 1HLWA 2PTZA 4IJBA 3WO8A 1I75A 1P1LA 3IVUA 2M9KA 4D3HA 3GFXA 3OXGA 2E7FA 1SW0A 4TTUA 3B78A 3WX8A 2QMJA 3GONA 1N2VA 5GVQA 3K8WA 2ZH1A 2VMFA 1Z44A 3OL9A 4G7EB 2QEZA 3M44A 1C0UB 3K58A 1WNEA 2V2KA 4ONVA 4GKLA 5J1EA 4P7OA 2ZRVA 1VQOS 3UXAA 2TODA 1UP1A 1BSIA 4BHYA 3FCWA 3E5BA 1X4CA 3H5XA 1MEWA 1ICEB 4D6DA 5CA5A 3N9UC 4E0CA 1Q5MA 2TRSA 2ZX6A 4RPPA 1KQFB 3HM7A 3PR2A 1GONA 5BROA 3M0VA 2PC4A 1UEUA 4W4QA 1FXDA 4KKXA 4L6HA 2Z57B 5AOUA 1YZ6A 1DXFA 2FPTA 1F9EB 4IOTA 3FN9A 2EG6A 4DS5A 5DLGA 1D2KA 1W9XA 4QS6A 3PR5B 1FP9A 3BH4A 3KFWX 3N6MA 3TW7A 1WKFA 1P27B 3CC2S 4UF4A 4JTDA 4X0VA 3M8YA 2K2PA 4UUWA 2OWWA 4DL5A 3PN8A 1RT2A 5DELA 2MKHA 4RV8A 2NLWA 1JDCA 4LB4A 1QDUB 4F36A 2OKTA 2W0UA 3QM3A 3M8PA 5CYQB 3S46A 2YWHA 2HQFA 1OBAA 3IV3A 3SADA 4Z1CA 4M5GA 1VIWA 2YDAA 3RRHA 2OSQA 1QWGA 3ILIA 2ACUA 3MEKA 2CERA 1G0CA 4FIQA 3WLTA 2O4MA 4M51A 3MWAA 2RRAA 1NK4A 1I2RA 1FRKA 3KFTA 1TL3A 2DZBA 5IBXC 1EP4A 2JC0A 2QJ3A 3F4CA 1F3XA 4GPNA 2D3LA 4HJFA 1TWIA 1KV5A 3DUGA 3R58A 2Y7EA 1RHKB 4NCGA 2XLIA 2EVZA 4JV5J 2DY9A 5C9UA 2XVKA 4ETZA 3CAWA 4IG2B 3UD3P 2E9LA 4A2SA 1QD1A 4LUTB 4BA0A 3W87A 3WD1A 3WNNA 4LIWA 2JL9A 1HL2A 4B3SF 5REQB 1HZYA 3IRSA 3AYTA 4PSRA 3RG6A 4AL6A 2J7FA 2MQQA 1B0VA 4WUIA 1JQVA 2PB1A 5L46A 3M16A 1KEKA 5CBJA 5KG6A 5AC7A 2RVJA 1N8IA 3M2UA 1TV6B 1GYLA 3IUDA 4MAVA 2NUXA 5LA0A 4NXSA 2ZEJA 4RW7B 3GXTA 1VAHA 4HCDA 1POKA 3WMLA 1O95A 3XIMA 2MB0B 2BHYA 3S1XA 4AVFA 4C7QA 4K4VA 1Y5VA 1ISWA 4EOUA 2Y0SD 1LG1A 3Q8UA 1P0BA 1XBXA 3MKCA 2WSRA 2XWEA 4M5PA 1ZPWX 3WQPA 5A8WB 3LRLA 1OSCA 4GA8A 3GIRA 4X66F 3CWNA 1PO6A 1EFZA 4DXXA 1IM4A 3CQIA 4MZYA 2YYTA 3ELHA 3EB3A 5T9CE 1U0HB 1X5PA 4IFOA 4B2DA 3GIIA 1Y5WA 3NQMA 3APYA 4XIMA 3QHNA 1WO2A 2EPLX 1K9EA 3AHTA 3A4AA 3N9SA 1G6CA 5CGMA 4GUGA 3UZ5A 3VKBA 4N8OA 2MNRA 3TTOA 3UY8A 2A1BA 4X60A 1WCGA 2ZH9A 1H62A 5CGQA 3UU0A 4ED2A 4W93A 3V6KA 4N4QA 2VRQA 3GFHA 1FRHA 1OSEA 4ROPA 2YNHB 1AVAA 2LQ9A 1REQB 1NHKL 3IIOA 4F2SA 3E0LA 4O0QA 1HBMA 1ME7A 2VXNA 4DJDC 5KETA 1QATA 3N17A 2E6AA 3ITYA 4EXBA 3ZNJ1 4AFFA 2H51B 6CGTA 2H3EB 3VNDA 3ZR6A 2PRHA 3IAS9 4EBDA 3VU2A 1TRIA 4FLRA 5KFAA 4ZJQA 4HMDA 4GQRA 5K8PA 3NUKA 1ZTVA 5KT5A 1MO0A 1E55A 5M2FX 2NLYA 3WNMA 3L12A 4ZVEA 1GMWD 1F60B 2YB4A 4R5PA 2BVYA 3GYCA 1IXNA 1MRAA 2J88A 5GNYA 4Q8FA 4OYPA 4LW7A 4UOQA 1NNDA 2HZGA 3PZ9A 2PT0A 3PS7A 3GKFA 3SFWA 1RK8A 2CQBA 5EMUA 2XN0A 3L5LA 1RT4B 1UA1A 1JYVA 3G0SA 4RW8B 4EBCA 1OADA 1Z89A 2OT0A 4YHHJ 3VGVA 2PDUA 3W07A 5AVNA 4CH7A 5LGXA 2MPUA 2PU0A 2WAQD 3OBKA 4DN9A 1X6NA 1MNZA 3GNPA 4UR9A 4OL8A 3AUOA 2HBXA 1QE1B 2OPSB 4TY9A 4ZQOA 1TMHA 1S59A 1Q65A 4ROQA 3KWMA 1MFUA 4Z1YA 4KT0C 2KHCA 2HVHA 3WZ0E 3LZ3A 2IPOB 1WX0A 1KVJA 2R7TA 2M88A 1NK8A 4DQSA 1UWSA 1U02A 1Z69A 1B54A 4L7ZA 4AD5A 1KFKA 3I4EA 3B8DA 4N9EA 1UD4A 1PZ0A 4QPTA 4A8IA 4D6IA 4E2VA 4ADUA 4F4WA 1Q8LA 4EACA 1TKDA 5CEWA 3BJFA 2OB3A 1LBLA 4MJ2A 2BZ2A 2ZUGA 1R30A 4M8UA 5DMNA 2DSZA 1GPFA 3ME3A 4MKBA 5AC6A 1BVZA 3MP4A 3NBPB 1YTYA 4QG6A 1IWGA 2JFKA 3G9CA 1U47A 4IWWA 2DHHA 2VG6B 3GQCA 4OLOA 3VZXA 2MGZA 1Y3KA 4FO4A 1WDQA 1KQYA 3B0VC 2D23A 5FF7A 1TWSA 2ZDRA 3IGXA 3K7RA 2OWXA 3Q2SC 4PG6A 2OPRA 4U31A 3EWUA 1GVSA 2QL7B 4ECZA 3VGDA 2L9NA 1D3GA 4CD6A 4YB7A 5I3KA 2GK1B 2FIUA 4TQTA 4KYZA 3V6HA 1J5EF 4LY4A 1RJPA 5KFEA 1B4KA 1DTQB 4LMZA 4XKMA 2DPEA 2QX0A 1V6UA 3RB3A 1UOZA 2ZTKA 4M29A 1NO8A 1HKMA 2DH3A 3JW7A 1CULA 2Y7FA 3CTRA 2CRLA 4CT8A 3MDUA 1UAWA 1V5VA 4MKAA 1WF2A 4IGSA 5I2UA 4LYPA 3VOJA 3Q2DA 4ZQPA 1R31A 3UP8A 3TZYA 4B9LA 4WXYA 3WBXA 4H9VA 4UFLA 3WD0A 5CD4A 1ZAVA 3C14B 4ZLNA 1UJPA 3JSYA 3JR2A 3R94A 1C1CB 1SQ7A 4IRKA 3VOCA 1WZAA 1HNVA 1YRXA 1KQSR 5DANA 5C71A 3US5A 4W5UA 3ZJ7A 4IUFA 3AD8C 4HMNA 2OMAA 1H51A 3R0UA 1XHGA 3DFEA 5IT9U 1IR0A 1YBQA 1PPIA 3HCXA 3BDPA 1Q8BA 2GNKA 1LQ2A 1LRTA 3UBPC 1XYFA 1Q6LA 2DVTA 4KQZA 1FEHA 1UHVA 2OX1A 2R1PA 4EMDA 3MA8A 4I5RA 2IYGA 2G5WA 3K89A 3TQ1A 4ZVSB 5KFDA 2WNQA 2VFTA 1K9MT 2YBUA 3N15A 2AT1B 5D77A 3W76A 2VDGA 4JQ4A 2LMIA 4PRWA 3H54A 3FVDA 3SQLA 1T9YA 1V02E 3MOZA 2OLHA 1VH7A 3UVAA 2R6OA 3WSUA 1Q13A 3IJ7A 1VISA 5FIPA 1YBAA 5DMLA 2ZOFA 3GTHA 3VDCA 2G0JA 3CIZA 3KUGA 1H0HB 1ZA2B 3KL0A 4LVAA 2PWUA 2E5LF 1LW2A 5LNUA 2J47A 3N2MA 1PCAA 4HJWA 1Q16B 2VFGA 4C11B 1FVPA 3UCGA 1XRFA 2IJRA 3O06A 4DWSD 1JXVA 3IJQA 1HVQA 2CFFA 1W37A 1UC5A 3ARUA 3V81B 1RDRA 4OYXA 2PE4A 3Q83A 3VGTA 1IIHA 2IQ0A 4NSBA 2HS3A 4G1KA 1JIBA 1FERA 5CYMA 4DV0J 4DZAA 3NM1A 3ZVHB 1M41A 1FWKA 5KFVA 1CTNA 4NJIA 4ZP8A 5AYYA 3HBLA 2FGZA 4IDKB 3ZZTA 3LGMA 2WPBA 2XIIA 4M5MA 3QO9A 2KVQE 3L2MA 3HT0A 4TMBA 1B5TA 4GABA 4W8AA 2VKRA 2ALDA 3QR3A 3KTQA 3FX4A 1UIOA 3VUPA 1T94A 5KG1A 3MO7A 3FK4A 3MT1A 4NLRA 3N29A 2PLMA 4OHWA 5HK4A 2VBZA 2ZJRQ 3NTYA 4QJ1A 1Q79A 3TR9A 2V3DA 5FF2A 2YKMB 5DGAA 4DFMA 2W2MP 2VEFA 1SBRA 3SSRA 3LTSA 4GC4A 1U24A 1FJ7A 4F0KA 1LBFA 2GGIA 1Z2ZA 2EI5A 4QW9A 3P8IA 4RKAA 2ZUWA 1XYMA 5I06A 3GVRA 1NDWA 4INFA 4PUMA 1VRTB 3PZGA 1SO4A 2Q8XA 1Q7ZA 4IF2A 5HBMB 2FVQA 1XRVA 2LQJA 5JXSA 3O16A 2OPPA 5AJ3J 1A7GE 4DU7A 5B7ZA 5K9FA 2G50A 1EGZA 1W8SA 4YCOA 2OGJA 3H20A 3HGOA 2GUYA 4YPJA 3M2RA 1KWMA 3TNOA 1CQMA 1C1BA 1HTIA 4LFAJ 2XFYA 1VK3A 3LBMA 1MWOA 1D3WA 2G13A 4C6DA 4JZ5A 1U1MA 2PDPA 2IPWA 1SR0A 2XBPA 4NZJA 2RKIB 3GBDA 3JQMA 1TZZA 1E6VB 3PDNA 2CU0A 2DR8A 4QDMA 1XH0A 4DQRA 3RU6A 3T78A 3DBNA 3LI1A 3LG3A 4Y9AA 2QL9B 1HR0J 4QTGA 4LYKA 3WK3A 2ZRYA 4W8LA 2MZJA 1FNXH 4ZA1A 3CHEA 3H53A 4J28A 2DH7A 3M05A 1H6KX 2PEVA 4E4UA 3AOBA 3GTFA 2OSXA 3DFPA 4X4OA 2CZFA 4V33A 2V63A 3P96A 3WDQA 4FF7A 1B9BA 4AIEA 4ELTA 3LNMA 1OHLA 3AXHA 4H8NA 3SY5A 3CUGA 3K8MA 4ZPVR 4HA0A 3P62A 1LWCA 4HHPA 1YX2A 3CJ3A 4WJXA 3DXBA 3RRAA 4BS2A 1S12A 3UZYA 1BG9A 3VD5A 4C6MA 1MXDA 3IGHX 1V7AA 1GHSA 3TXZA 1ZPTA 4V27A 3KZSA 4A8WA 2C42A 3P5BP 1A5SA 1LQAA 2Z00A 4IIEA 1WJ9A 4KAIA 4CH0S 5GVJA 4J4KA 1JAEA 1KTCA 1YJ9S 5A2QY 4PKDB 4DV1J 1W1ZA 3MCOA 4Q7BA 1O5JA 3NIYA 2ZUNA 1J12A 2WLZA 3FHQA 3QQ0A 2XMKA 2ROGA 3MECA 1TJ0A 4CQAA 5HO4A 1LOSA 3TA9A 3GDRA 3VKDA 2V3FA 1IBLJ 5LMUJ 1MMDA 1SI9A 4ERIA 1MU2A 1WNOA 1XP3A 2ZUAA 3PNIA 3ZNUA 5L1LA 3KHJA 2VENA 4RNMA 1U5HA 2R1MA 2FJUB 2LA4A 6AT1B 3NQEA 3GG8A 4LAMA 3OB8A 4PCNA 2UBPC 3QJLA 3NXLA 3ZWSA 3BYRA 1HBOA 1FKWA 2J6SA 4BZYA 3ZT7A 4ZQMA 7A3HA 4Q32A 2JE8A 2JLEA 4DLGA 4FBUA 3PZNA 3DI1A 4D8LA 4QJ4B 3DLJA 3P8BB 1F2GA 2LEPA 2DFAA 2H5IB 1LWFA 1DEDA 1JLQA 2EF9A 3BG3A 1GOIA 3NQGA 1RR2A 1Q7MA 4GACA 2G4JA 2BQ3A 1AFIA 3MI2A 3AZTA 4MG4A 1EJUC 5LNWA 2C14A 2O9RA 4Q8TA 3MEGA 2ZA3A 3NNTA 5GAHU 2ZRWA 1NKCA 1FXPA 3H2NA 1J2WA 1Z41A 3TZWA 3EWYA 1XSIA 2EG7A 2V2ZA 2YA2A 4G56A 4CNUA 2Y62A 3T1YJ 1VQTA 1S7HA 1K03A 3I5CA 5CQGA 3JSMB 3N11A 1BFNA 1EQMA 1IZCA 4DM1A 4E8GA 4C6JA 1QXLA 1MSSA 4I2PA 4JI8J 1UG6A 1E43A 3NGSA 2IPJA 4AD6A 1KBKA 1KM0A 1J0HA 2XNRA 4DR2F 3BSOA 4ED1A 4A8MP 3P2VA 2YPZA 2E1CA 1NDVA 3FYYA 3WL1A 1WACA 3NL2A 2WVEA 3BW3A 2CA9A 3WF1A 4B5UA 1EHNA 3TR2A 1V8EA 4XZHA 3NQ2A 1S46A 1CXEA 4S3EA 3DFOA 2XMVA 1X6UA 4TOQA 2QJJA 4Y2MA 3BLKA 4Y7EA 2X40A 1TCDA 1Z1ZA 1ONRA 5D2VA 3V5FA 4AMAA 4MWAC 4DZDA 2CJKA 5HSPA 4PTNA 1WUEA 1IEWA 1KBRA 1BMQB 5CYQA 2CNNB 3LCXA 3N2TA 3EX7B 4DSIA 3JXOA 2QMUB 4NA3A 5K9CA 1B70B 1OABA 2NT1A 4X3ZA 2J8FA 4IL2A 2EFOA 2VR5A 1IIGA 3ZLGA 1AZSB 4B3RF 2XZDB 3HU7A 3ITVA 1W26A 2WJDA 4HSHA 4OZ5A 4AF0B 4BK9A 4EVZA 2NXEA 1RYRA 1TR0A 4B9UA 3QIDA 1XCWA 4YJ5A 5DY3A 3UQNA 2A7PA 1XH2A 4DPYA 3W63A 1PAUB 3WLHA 4YN5A 4MZ1A 4Y8FA 2HSEB 2ALZA 1KM2A 2XULA 1NPRA 4NQ1A 1MYRA 4KKOA 4WKFA 1EC7A 2QCEA 3AMLA 2MQ8A 1A47A 3CT2A 2R94A 4HQVA 1H11A 3UJSA 4LUTA 2X0YA 2EEXA 3WLNA 4S23A 1VFMA 2FVKA 4N8NA 3S2CA 1ROFA 4ILMA 3LI0A 1VFFA 4OHZA 3MR3A 3N14A 1EUAA 3UD6A 3W1NA 1Q0NA 4TIMA 3NOYA 1RTZA 4ZCKA 1TUVA 5IOBA 4ECXA 5DQHA 3IVSA 1DLOB 2C1HA 3FEZA 3E3XA 2AX1A 4HDGA 4YNGA 5GAGI 3AHZA 7REQB 3KL3A 4JDYA 1TV6A 1PE1A 3M2VA 2HS6A 3WJSA 1I94J 2LECA 1N54B 3W1LA 2XY7A 1J0IA 4TLQA 5IFTA 1S57A 1F5AA 1RT6A 2V68A 5DJBA 2HHSA 4HBKA 2HVMA 3AB4B 3CLWA 2YCJA 8XIMA 4QU6A 5A8WA 3CPRA 3MF5A 4WZQA 1DIDA 3NO3A 5AECA 4USIA 2AYGA 2GHPA 2O67A 2Q43A 2D0GA 3MI6A 3JSBA 4KSEB 2RKXA 4YXGA 1JL8A 3I6TA 3AD7C 3U0HA 3SCTA 1U0HA 3BLEA 4S3BA 3VIKA 2CWNA 4MYXA 1RAIB 1YBTA 2QA4S 1MSWD 5E70A 4XPCA 1R7IA 1F05A 1XSJA 1FA0A 4Z2JA 1RJQA 4O15A 4JD4A 1EKRA 3H7VA 3T6CA 4X63A 3P7YA 4EUVA 2EWHA 4REQA 2OEKA 4Q4PA 2RUSA 5L1JA 1SZEA 1OD8A 4DM2A 1A80A 2YNHA 3LQLA 3MSDA 2R7UA 2CZDA 5CG7A 4WSHA 3KP0A 5MAOA 1BWKA 2GDUA 4XX6A 1SFSA 2LU1A 2W9BB 1UMYA 3PBWA 2J74A 1X96A 1PJ7A 2JGYA 2C2ZB 3GX9A 5H8MA 2HHXA 2HWGA 2FDNA 3A8EA 4URSA 1C9WA 3CGIA 3E0IA 2PI6A 3OG2A 3MTJA 5IM0B 3MUY1 3UWYA 2OFGX 5SZTA 1XMQF 3UWQA 1V5XA 4ZPAA 9RUBA 1ZENA 1UQZA 1RAFB 4UTMA 9ATCB 1PGZA 5GAEU 1I6JA 3HTWA 4HNCA 2R8JA 4C8MA 2XMWA 5AXMA 2P3ZA 4KETA 3ETMA 4WYLA 3PPCA 1X5SA 2XY5A 2VICA 2EPNA 2JX2A 3P5YA 4DQQA 4RDVA 2E5IA 2JIWA 2Y1IA 2L48A 5KFIA 3C6CA 2VHLA 3S8SA 2Y89A 2ASDA 2WZHA 4X64F 1MWZA 2BXVA 2FJXA 4HMEA 3LANA 3E2SA 3EB2A 4RZ5A 5EMLA 3C66A 4RW8A 4U67Q 5ETPA 1KW1A 2LA6A 4KBIA 4IMCA 1KKRA 4PWWA 3VNZA 4PCSA 2EPMX 2NCKL 2E5HA 2DR5A 1SSGA 1UKPA 3KHDA 2QL5B 4YTSA 3SR7A 4ELUA 2WSYA 3VM5A 2IRUA 3TRGA 1CJKA 5KFRA 2XVNA 3QY6A 1M9HA 3WN6A 1QE1A 3L9ZA 2OPSA 5IWAJ 3ZT6A 2BV3A 1FD2A 3VC6A 1HNZJ 2L3MA 1KCLA 2I5JB 4CUCA 2E1MC 4F0MA 1V3SA 2IMOA 4A4AA 3PZMA 4DELA 2NVCA 1I9CB 2UV8A 1J9YA 4YWSA 2GVGA 1UMLA 5E6YA 1IGSA 3OLAA 3QJJA 4OX9F 3ATYA 2KFNA 3QATA 2VZ9A 3H5SA 4IMFA 4WGHA 3IUIA 4CEXC 3B0YA 4ZP6A 4JI1J 1X4HA 3QMRA 2ZX9A 2J7WA 2C16A 1HBUA 2KZZA 1LYXA 4AZGA 3BDEA 3NBPA 2C22A 3VX1A 3CUNA 1R5YA 2YX4A 1KFDA 4ZZ9A 1XM3A 4QE1A 4RUAA 2DO0A 3W2VA 3SW6A 5C7HA 1ZB5A 3ICJA 3NXFA 3FGCA 2FH8A 5HROB 4FP9A 2X3DA 1F07A 3DLEB 2FPHX 4H1ZA 4N5SA 1VCFA 3D66A 2DVXA 2GOKA 1YKWA 4O1CA 4A2RA 3M8ZA 4ZO8A 3SCRA 3ONCA 4KWWA 1SJBA 1NSKL 4CQBA 1I1GA 5IS2A 3CPGA 5XIMA 1TIWA 3IRXA 2HPUA 4H6QA 4LXFA 4F9DA 4I56A 2DORA 3DLKB 4CH1A 1T02A 5C42B 2VZTA 2RAGA 3THVA 5HINA 2BSLA 3HHLB 2EFPA 1JWWA 2EQDA 2WB1D 3DXSX 3QT6A 4TVDA 2QG9B 2NZ4A 4J5OA 2RMLA 4QJ3B 4LS2A 3H21A 1Y65A 3LXCA 3R6LB 3T2QA 3CW2C 3C14A 5AXNA 3MKKA 1M53A 3QSYB 2C2KB 3BH7B 4BWMA 4PH6A 2CEQA 2J62A 2VQUA 3P6LA 5HWJA 1R8BA 3TVYA 3LWMA 2LDYA 3MM5B 1NLKL 2PWEA 3W7HA 3RJMB 2ZWYA 4RNHA 2VRJA 4L4LA 4MUZA 3I4PA 2RH3A 2EBGA 2X51A 3NEKA 2FH6A 3CU2A 2V8VA 2HVDA 1ITQA 3QR1A 1IXPA 5DXXA 1VBRA 3DLGA 4Z7CA 4USTA 2B9YA 4ACYA 3FDSA 1OM0A 2GJPA 2Y88A 4AHOA 1I2QA 2V5LA 4LH8A 5EBUA 3GTIA 5BOOA 5ECVA 1W5MA 2HRYA 3JZEA 2GJLA 5DEZA 5IDIA 3NL5A 2VV5A 2ABBA 3EPMA 2V5BA 4WGXA 4AWEA 3N28A 4L72B 2BUNA 3T5LA 3W2WB 1RQ0A 3BJTA 4RW5A 1R2TA 2ISFA 4ZS6A 4JFWA 2FVMA 2HZVA 3PWIA 4PBGA 2ASYA 3ZTQA 4RU9A 4C1NB 2QIIA 5BMXA 2G3IA 2XDFA 4H9ZA 1D8WA 4O17A 2V3EA 1JQGA 1LK5A 3ZO7A 4FNUA 4HK7A 4LUJA 4C11A 3FBCA 3N6JA 4DF4A 2CVIA 4ZQNA 1DURA 2Z2LA 4ZVRB 1J93A 3K17A 2DZXA 2CESA 2EAWA 3INPA 2WWCA 5J2PB 1QR7A 5J2MB 1OIFA 4LRDA 2MUCA 2MANA 3C8NA 4E8DA 2MZTA 3W2UA 1NQ6A 2VQFJ 2HHHF 2QGYA 2ZNYA 4I69A 1JNEA 3W7CA 2DGOA 2AGPA 1FRJA 2YDSA 5E5NA 5KFUA 4IDKA 3J80Y 4O12A 3HFZB 3C52A 3MWBA 3OD2A 4QR2A 5ABFA 3CYVA 4WFYA 3KVMA 4F3QA 2WMIB 1S49A 5A6LA 1RAGB 2FZGB 2VASA 3AXXA 5DBTA 3HZ3A 5A8QA 4U28A 2RQMA 3NZ1A 2OZ3A 1X5OA 1X38A 5D8HB 2HVOA 2HZCA 4OHVA 1UOKA 4C3KA 4ERAA 1U1OA 3UCQA 4WKYA 4X4TA 3EPGA 3S5YA 4WK1A 1S39A 1ECEA 1AROP 3DGRA 1HKJA 4FNHA 2CZEA 1Q8IA 1VLYA 1DY3A 1U1PA 2Y5SA 1T0OA 4XSLA 3IBFB 3S1VA 5HBMA 4HZMA 1LFWA 4KMQA 4DF8A 3G3DA 3B04A 3OTBA 4QG8A 1JF6A 3BAJA 1ZAIA 2X2YA 4IIGA 4PGLA 3R9LA 1V3IA 4RNNA 2XS5A 4EF9A 4F0SA 3NMAA 2FZDA 2ZBIA 3D67A 5KG7A 1IWPA 1VF8A 3CB8A 1WOPA 2PA8D 4RNOA 5KFTA 3ITTA 3EDRB 3RW7A 2VH7A 2AKZA 3BSHA 4ZIVA 4NVTA 5BWFA 1UBPC 1B3XA 3CV6A 3IIVA 3T08A 5EN1A 2Z4GA 1E6VA 2XGZA 4GKTA 5HDRA 4HA4A 4NYZA 5A76A 2LYVA 3OQ2A 1BXBA 4EZ6A 3D0HE 1G1YA 4K2XA 2Z2AA 4A8YA 1QHZA 3MS8A 3OZMA 2EFGA 3VGSA 4JFUA 5BU9A 4X66J 3V1HA 3C86A 4NRUA 3QYYA 1PJ5A 4JIRA 2V94A 1FFWB 4IYQA 3W7RA 4IIHA 2QJNA 1LWEA 3BLOA 3M4HA 2UV8G 2YNGA 3CO0P 4WYWA 5J1PA 4U96A 3ZS4A 2RDTA 2FLLA 3E5PA 4D6CA 3L95X 2QJMA 4C8NA 4UOJA 5H1WA 3I0RB 3PHAA 1K9DA 3IBWA 2E28A 3GCXP 4B9MA 1BWLA 2HMCA 5FEXA 3IXQA 4RWXA 4BEQA 2ADBA 3KHRA 1SC1B 1CLXA 3R8YA 3N12A 3KWXA 2ZE2A 3G82B 1Y5IB 3BARA 1TL7B 2O3DA 5DDPC 3HHNB 1YDNA 2FJKA 3CXOA 4AIBA 1F3WA 1HQUB 3EGWB 3BUVA 5DT5A 1VJQA 5CPMA 1VQ8S 4WZMA 2GGPB 4AC7C 3W28A 4DQPA 1NFPA 3PB0A 3ZT5A 4DLEA 2AGTA 2FTRA 4HVXA 1Q81T 5B0BA 3TX0A 4ZP9A 3MURP 3D1QA 5C9RA 3ENVA 4PFHA 2NVDA 4IPJA 2B7NA 4I9JA 4PEKA 3M8QB 2EKNA 2WHLA 2ZA2A 1C2PA 1OCQA 4NLDA 1FRXA 2NQHA 4WDWA 2DSUA 3C2RA 3B8HA 5C9XA 4CNYA 3Q23A 2BOPA 1IQ8A 4IGHA 1XL9A 3SO7A 2QUUA 1HG3A 4HH0A 3C16B 4OQVA 4ZGYA 2PU1A 2P2CB 3HJZA 1KTQA 2GJXA 4BWJA 1XSKA 4F2TA 1JPHA 4O44B 1B7FA 1YPFA 3QLLA 2YA0A 2J0WA 1VQPS 1V0KA 2DKOB 3TC7A 3FBEA 3NQAA 3RYLA 3REQB 4AB4A 1S10A 2ZBTA 1XIFA 1F0XA 5AC8A 1HMVB 1X4AA 4MNKA 5A8RA 5AHNA 3CJ2A 1C4CA 3IWNC 1GOWA 2R8GA 3JSMA 2WHMA 1N5VA 3TA1A 1P0EA 2D3O1 2C2MB 3MMJA 3CDBA 2R2UA 1V3HA 3KTCA 1EZ2A 4LAZA 1R6VA 1N5TA 5F7UA 2WVSA 2OODA 2X7IA 1UP2A 3VC5A 1JZ5A 3CPWR 3TP2A 4MPKA 3BCFA 4LRSA 1EZWA 3PUEA 4H4OA 3O1NA 4ZO7A 1B1YA 4G3IA 2FGCA 1H2UX 3EX2A 3VAGA 4ZVUB 3QJPA 1GZ1A 1EWEA 3BCJA 2B4UA 1JAKA 2ZRZA 1T3NA 1LL4A 3S4TA 5F8MA 3MMWA 1P1TA 4JI5J 3QZAA 1TR1A 2BGNE 1DJNA 1PKYA 4NLSA 3QSIA 2J8TA 5C7VA 4QIEA 3VDGA 3MM7A 2RFGA 4FR6A 3M0ZA 2H1YA 1VHCA 2ZM6J 1HJQA 5CZXA 2DU2A 1QVGR 1J5EJ 4PC8A 4N6FA 4PCFA 2GIFA 1TV2A 1AZSA 2FC9A 1REVB 3HFYA 4AF0A 1KM4A 4IPPA 3GILA 4HTYA 2YKNB 3NXZA 4K4WA 3DDKA 2GJFA 1NVMA 2VTFA 1Y5NB 3SGGA 2UUWA 3W1YC 3NQ8A 4H8HA 5D2WA 4H8UA 1JCYA 3W7QA 2ZCGA 2ALYB 4CCZA 2DNRA 1IHIA 1RSCA 2W9MA 4RBUA 1R0CB 4H2CA 1QT1A 3HT3A 3CNYA 3KOFA 3DZ1A 2IM3A 4NXMF 2NQZA 3K13A 3SN1A 8CGTA 1JJ4A 4DUWA 1PKMA 1FFSB 2KJVA 1AA1B 4DV5J 1TELA 2PCQA 3KL5A 3NY0A 1WSRA 1J6PA 4EK7A 1G4CA 3GFYA 1UWBB 1S7IA 4NLYA 1JULA 2C2EA 5K14B 3CTTA 1DLOA 1F9CA 1L6WA 1HHQA 3C4UA 2HEJA 3GU1A 2P88A 1JFXA 4KR0B 3BLIA 7REQA 3FAWA 3JVAA 4HPXA 3RU0A 4TXSA 1M1HA 3C2YA 2Y8VA 3TNBA 2B9EA 1BWEA 3VKKA 1RT5A 3LAKA 2AV5A 2H48B 3Q45A 4TY8A 3SDEB 3DCAA 5HQLA 1K4HA 4FALA 3WQVA 3MPUB 1RAEB 3S5NA 3ZZ1A 1SJCA 3OLBA 5CPSA 4MVAA 3VALA 1YNYA 3OW1A 2YX0A 4W7UA 4DL6A 2PLKA 2W2OP 4XVDA 5L38A 4JI0F 1OX5A 2YFNA 1OYCA 1W9BM 1FJCA 1K7XA 2BTMA 3QTGA 2WK2A 2DRBA 4UNKA 2E5LJ 4NXNJ 3FEQA 2YXLA 3IC1A 1S0MA 3CQ0A 3GDTA 2EKGA 1QMLA 2ZXDA 1A3HA 3GUGA 4NY2A 1PO9A 4KRUA 4AZIA 3NOCA 2MQLA 1HYSB 2WM1A 4O50A 1LBMA 2CWXA 2QT3A 1IKWB 1QOQA 1VYRA 3H5UA 1XNRF 4KWVA 2WC7A 4R9OA 4UTHA 3KS5A 3D1OA 4MY1A 1KGXA 2QCMA 1MXSA 4J9OA 4PAAA 3NNCA 1KKHA 2WBKA 4L6V3 1TK5A 2J7CA 2CZ4A 3EOLA 5A2CA 3MV01 5IM0A 3ZZ0A 1S0VA 1QDSA 1RD5A 2YL5A 3WNOA 3TU9A 3Q37A 4ZTXA 3PJXA 1SXLA 4LF7F 1XWYA 3ZTOA 4ED0A 3G2XA 1DQWA 5HPOA 1GGOA 1IQTA 2N4CA 2IFXA 4H4MB 4UUXA 3MZIA 3CZGA 3GYGA 3QT5A 2V9WA 3M8RA 1WDPA 3P80A 2BY1A 3SZ8A 4KERA 1DJ0A 2Z56B 3A3OB 3DRYA 1WSVA 1T3OA 2CLKA 2H9AB 5D4PA 3UEQA 3AOFA 3WQ6A 2WSEC 4AY7A 3KNAA 2BBFA 4IIDA 1P4CA 4MLRA 2CNOB 1WTFA 3FEXB 5DRIA 4Y9MA 1EQ0A 5A2BA 1JZ4A 2R8IA 3VNMA 4AYGA 2VODA 3KW3A 3V36A 3VOFA 1VQ6S 3TYEA 3W22A 5IFMA 2E8ZA 3VNIA 1O12A 3H22A 5D03A 4BI7A 1DQ9A 3HB9A 2DTJA 3D6MB 1HKWA 1U33A 4LF9F 1TB3A 3TJIA 5JUMA 1DWGM 3QOMA 2I5JA 1X97A 3OTEA 3G24A 3B8IA 2IXUA 2OZ0A 2VC7A 4M0XA 3FMBA 3EA1A 3KOXA 3MBFA 2AZ3A 1PIEA 2XUCA 2QVHA 3TDFA 2G0IA 2MKJA 4OYWA 5AZ1A 3SUWA 3N6NA 2J7HA 2F6XA 2LP4A 3BO2A 2NT0A 2CZVA 1T95A 3C15B 2DSVA 3W2MA 2HHQA 2TMDA 3UXLA 1L6GA 4A3RA 3TJXA 3PAOA 5HATA 3UWTA 4NASA 1E6YB 1ME9A 1FJGJ 4X0NA 5TD4A 2I9UA 4ZSUA 3VIOA 3DLEA 2X16A 4R7OA 1M5HA 2A6NA 5C2CA 1R6YA 1KRAC 4NOHA 1JUKA 1SO3A 1CXIA 3QPEA 5T26A 3VDBA 1Z2LA 4CEUC 5B0GA 1KA9F 3NQCA 3CPUA 1PKNA 3GS6A 1IKYB 2UVUA 5LIYX 3ECQA 4PMJA 2GSEA 2WZ1A 3SGZA 3VM7A 3MAAB 3W85A 3NWRA 2EFVA 5BR8F 2ZE0A 4HDHA 1GMUA 5EGYA 3N34A 3BV4A 5AHFA 1SKWA 5C42A 1EGVA 3MFIA 2ZC1A 3T0DA 3HHLA 4JICA 3QAEA 3KXQA 2QNEA 5IHRA 4Q8MA 3SCKE 3G4SS 5A3HA 1H49A 1JPIA 2G2YA 1LUCA 1E51A 3V3WA 4ZN1A 4FR1A 1EP1A 3VYLA 4C4WA 5FIIA 2JRSA 2C13A 2OYLA 2PDAA 3W7BA 4GI8A 2WW8A 2POKA 2QC3A 3WDPP 2ZE3A 1RA6A 1XN9A 5A94A 2XCAA 1XLGA 5CAAA 3HP6A 4UZUA 1TO3A 2WXDM 4CO4A 2RDUA 5E7OB 3U7JA 4GYFA 3EJMA 1QFEA 5KMYA 4OX7A 1Q4NX 3MTWA 2D3NA 5D2YA 1E6SM 4FN5A 2BE2B 1GXTA 4NJJA 2F9JA 1H2JA 3RLHA 2HHTA 4K4XA 2BA9A 3VVTA 3CL7A 3BMXA 4MKNA 5E3QA 3MUIA 3AC0A 4A48A 2HWTA 2WVUA 2QIWA 2NSXA 2JSXA 3GVQA 3EYZA 3DOPA 3KX6A 4IKAA 2B7QA 1RVKA 3SM0A 2GFFA 1Q95G 1VQ7S 1GW9A 2WMKA 3DHUA 4C1NA 1S76D 2PLCA 3ES8A 2DH8A 1CCWB 2V0TA 3B0PA 3TW0A 3B40A 1VYPX 1XGZA 3V4BA 2JZ5A 1O6IA 2W9AA 3A13A 1YK9A 3AOCA 3P81A 2X1FA 3LERA 2OTDA 4I6KA 2G3JA 3N9RA 5KSWA 1JZ3A 4LCSA 1XINA 3QV8A 4X9YA 1BE4A 5J2PA 5DGBA 5J2MA 3IJ8A 1H61A 2P8IA 3BAKA 3TR5A 3EX4A 3IK4A 3FKRA 5FJJA 4C2MA 3SUVA 3CF5Q 3MEDA 1N82A 1HJXA 5B0AA 1E0WA 3KYLA 4B17A 1B64A 5HNTA 1ZL1A 2BM0A 3CV1A 2FZNA 3QBUA 2DBBA 3UG8A 2ZADA 3IGNA 3QGPA 2FB2A 4O1DA 1YZ7A 2DGTA 1WXYA 3COTA 2C15A 3CEDA 4I2QB 3ZFHA 2R1NA 1U45A 3UT0A 5JXQA 4EO6A 2X1UA 2EO7A 3HM9A 2FD2A 4LR8A 2YJQA 5C6MA 1SYTA 3GB6A 3N04A 1C92A 3EDDA 4BC9A 4ECLA 3KBWA 3K46A 1I3OB 4PXCA 1JLEB 1L3KA 1A5LC 1A5OC 5BU6A 4NRRA 4S3JA 4FPSA 4ZLLA 1FY6A 1W56A 1P6WA 2ZTJA 1SPQA 1FQ0A 4XK2A 3WNKA 4LUSB 1LL6A 3GLJA 4Y9NA 3IACA 2YCIX 3MMBB 1LG2A 1LROA 5CPTA 2VX5A 4Q6XA 1YJUA 2B4PA 5LA2A 1S1XB 2K06A 4JFTA 1MQQA 4QLJA 4E3VA 1FWLA 1N36F 4JGDA 1PG5B 2H8XA 2YWKA 3AYRA 4QFUA 4XBJA 3MMCB 1PBGA 3HFKA 2ZHAA 2HK0A 1Z32X 1FO1A 4ECTA 4B2DD 4AD0A 3RRKA 3EPNA 4CD8A 2PE8A 3OO2A 3HV8A 3AHVA 1T40A 1MWYA 2HFOA 2POZA 1NRKA 3C0LA 3G1XA 4USVA 2BB0A 3CEPA 1UUQA 2NYIA 2B3TB 2YKPA 4ES1A 5CZVA 2I56A 3GJSB 3HVTB 2J77A 4P5UA 4Q2LA 1RABB 3OFEA 5HMXA 3WLSA 4JDBA 4C65A 1GQEA 2MQOA 2ZUUA 1VBZA 4PXBA 7PTDA 5AE1A 4AFYA 4DDFA 2IS7A 2NYHA 1T8EA 3QYQA 3GYNA 3JB9k 3SQMA 2A21A 3MHFA 2OO6A 1RK5A 5CZKA 4MIAA 2VX4A 4RZRA 4ANCA 4S38A 4L61A 3MMAB 3SEOA 1LFPA 4O14A 2PBGA 2R7OA 5KTQA 3M9MB 4OV9A 4XISA 3E49A 3I0RA 3FQLA 5CHCB 2YWEA 4O0KA 4AEEA 5FEPA 3DYAB 2BVWA 2DUXA 4P71A 2CG8A 4UTTA 2JDJA 4LSZB 4OYZA 1M04A 3OR1B 1B3VA 1YTDA 2Q6BA 3LXBA 3UA3A 5KFKA 3S6TA 1X4BA 3UCUP 1L2UA 1QUVA 4UR8A 1KFCA 1HQUA 3W2LA 2XYHB 1S6UA 2UUCF 1A9NB 1GTHA 3W5XA 8A3HA 4RW9B 5IT0A 2HNEA 3CDEA 1FCBA 2XIJA 2R1LA 5CXTA 2HNHA 1F1BB 4B5TA 4PE8A 5D9OA 1OFPA 2IJFA 1B30A 4G1NA 3VMOA 2W62A 2DXFA 2CW6A 5CAKA 1K8AT 3L5MA 1TL1B 2A5HA 1H3GA 4IQJA 5CSUA 2ABAA 3VD7A 4H04A 1SMDA 2WVDA 1EAYC 4NX0A 4O3PA 1UASA 5KFXA 2WJZA 2Q3RA 1HQEA 2RJGA 4ERGA 2WQDA 2BRLA 1NJYA 3VIPA 4X64J 3B82A 3DIPA 1P8GA 3ETOA 2H9ZA 4L3KA 2LQBA 1MROA 5HLFB 1BXNA 4ELVA 4ZO9A 4HP5A 3C0JA 3GIJA 5F2GA 2XS7A 3REQA 3SEPA 2QFIA 2WJFA 2V2VA 2ZXQA 3TZXA 1GKPA 2ZFAA 1UR0A 3QT7A 4YHGA 2OFHX 1HMVA 3CCSS 2FJEB 3CIMA 3N5BA 3TAQA 4A46A 1U25A 4RU2A 3PX6A 4I90A 1QTMA 3DBPA 1XG3A 1GNXA 4ICLA 3VCCA 2F63A 1YTKA 1JJCB 4YQWA 2P6TA 4TV6A 2PDFA 3VTIA 4NJGA 4PUNA 1F8MA 4J40A 3O2IA 1K0TA 5AHMA 1RTDB 1TUXA 4AEOA 4PL1A 3H12A 3ILJA 1A5UA 1YHQS 3EEZA 3KHLA 3W37A 5FLXY 2F9RA 1E9YB 4IPNB 1HP4A 2IBKA 3N2XA 5KOXA 1SFJA 4LEFA 1VBYA 3HPAA 3KOYA 3LX9A 4PTXA 1ZTWA 1QUMA 1E15A 2WMHA 1QPQA 3RJYA 3AA8A 2FVLA 2PWVA 3BBCA 4MJKA 4QG9A 2MKIA 3I10A 1LWXA 1R8HA 1D9DA 2Z58B 4C90A 1K8XA 1YGYA 3W1XA 2Z7KA 2QE5A 3DM2B 2HBRB 4DBSA 2V81A 1GORA 2VGFA 5LOQA 4CTAB 3AXKA 3VGFA 4XPEA 3SRDA 3SIMA 3WQ4A 3IM8A 1K7EA 2BXJA 5DXYA 4ZA0A 4CYUB 1M1BA 4KCTA 4M6PA 1JLBB 3V6JA 1TVRA 4MIBA 1GYMA 3IK2A 3U9IA 3RAOA 3TVKA 4LFBJ 3GW3A 2WSKA 2RDWA 3AQUA 1REVA 4OMFG 4JI2F 2F7FA 4OZOA 2YKNA 1FRIA 2CJAA 3TH6A 3V0UA 4DPXA 4YUDA 1T7PA 3VZYA 4N7QA 1UETA 3LP1A 2J0SD 2NREA 3ARYA 3LF0A 1HT6A 4UTJA 3NSXA 5C7PA 4LF8J 4IOBA 4JI6J 4ZB5A 4ZN3A 2OZTA 2CLFA 4C7GA 2ZZNA 2OLWA 8ATCB 1XGEA 4FEZA 1Q5VA 3UNYA 1W1B1 3ZTPA 4O4RA 2L41A 1JYWA 1TUWA 3K2YA 2W4CA 3VNYA 1G4PA 1OCBA 4LNCA 5JVHQ 3KRSA 2J9DA 3N01A 2QDHA 3UI3A 4GC3A 1VC4A 4EPDC 3OZYA 4I7FB 1UWBA 4L3NA 5K14A 3E3HA 1JD9A 1JCMP 1WHYA 4LR9A 1NIUA 3EOSA 4KPCA 3B8SA 1M65A 4DXKA 2AQ4A 1KVIA 5M3WA 1AJ2A 5HJLA 2VFVA 1EB3A 1XR2A 2X0HA 3ONBA 2IXVA 3ENWA 1E9LA 4D9PA 2B9WA 2ZH4A 2DR7A 2IKGA 3AROA 1FWJC 3M1ZA 3SB0A 3T44A 3THTA 1FE4A 3CV7A 4GGHA 3SDEA 1DJWA 4P74A 1ZETA 3MUTP 1TPC1 2OYKA 1UYQA 3GHSA 1HNXF 3U5YA 4WXZA 1O66A 3HHEA 1ZBCA 4K4YA 2CYYA 2HBYB 1U1RA 3I6PA 4HPHA 3OYXA 2DNHA 2PA6A 1Y11A 2JEJA 1V6VA 2ZVSA 2FLOA 4AYSA 3OL6A 1V3JA 4JQ2A 2OQHA 1YPXA 2PF8A 2AYEA 3I82A 4G6VB 1XR6A 1S1UA 4KY3A 1S1RA 3THCA 1R2RA 3GU0A 4OUIA 3FFIB 1IEVA 2V30A 4QJVA 1X9SA 1MMNA 1GW1A 3PB2A 4DX8H 2HHWA 1DZ5A 1VQNS 2VFIA 3V6DB 1K70A 1KWKA 2A7RA 1EJTC 2RF2B 2Y8YA 2YA1A 1E6QM 4OJYA 1CXFA 1HYSA 1RB0A 1WDWA 3HQOA 3O7UA 1CJTA 4O57A 4UTUA 1SV5A 2WQPA 3IVTA 5JIWA 3GDMA 3PEJA 2R2RA 3O3LA 1S1TA 2A2IA 1I5OB 1NOUA 4UC5A 3IG1B 4QSFA 4OJHA 4QLLA 2XYGB 1TPFA 2GLKA 1X8FA 1S5VA 1YXCA 2FHMA 3U1NA 2HNZA 2X2GA 3ZOAA 3HD2A 3QOKA 4H4MA 3S1GA 4DYEA 4BY3A 4HACB 1FI4A 1X8CA 4PUDA 3GNNA 3W83A 2CKRA 2XNQA 1X7VA 2GMJA 2GVDA 4EXAA 5E2QA 3KRUA 5BOFA 4ZHRA 5F8IA 1Y4ZB 3LV6A 4R9XA 2J9CA 3IIPA 4GBDA 5D38A 4BFAA 3EZ4A 3NGJA 5DLCA 4J9UE 5E41A 1YITS 1KRCC 2UUAJ 3H2EA 2IKIA 1KFEA 3BKTA 4DCOB 1JRBA 1TPEA 4RNIA 3M32A 2VHGA 3LHZA 4DFJA 4P8XA 1Q8AA 1SM9A 1WV2A 4YB1P 1UR2A 4H9XA 4B9VA 4HYWA 4UQ9A 4NCBA 4OYOA 3ZJ8A 3W1RA 4GUFA 1Y10A 2BY0A 5U47A 4QWEA 3G1AA 1AW1A 1U1KA 2ATMA 5KFSA 3BB5A 1R38A 3SCIE 2XSBA 3EPIA 1NKEA 1LW0A 1ZGDA 3FDGA 1O68A 3E96A 3PTKA 5I09A 3O0FA 1B2YA 2YNIA 3R89A 2LCWA 2NPFA 4O1BA 2EFQA 4DR5F 3LA4A 3WF2A 5EUHA 1I51B 4C6BA 1EWDA 2DNLA 3EWDA 3UETA 2F2KA 3VIJA 3OT9A 4E3TA 2W2PP 2FPVA 1K1DA 3C15A 1QTNB 3QFWA 3VDHA 2DT1A 4LV4A 1UP0A 3AMCA 4H7CA 4ZOBA 1W9DM 3T9PA 4HOZA 2I57A 4PMNA 4DL7A 3RMEA 1D8CA 1WHWA 1RWOB 4XDDA 3TV8A 2RHGA 1XQLA 4OZ3A 1SL2A 3R8GA 5H9EJ 1QJHA 5T91A 4A8SA 1SJ3P 1NK6A 3T0TA 5AB3A 4DEZA 2AQWA 4XAGA 3S42A 4DUOA 2DZAA 2FB3A 1MEIA 2XINA 2M3DA 3P14A 4UWMA 3N4FA 3FHAA 1JNRB 4C0HA 2VC1A 4XAYA 1X0PA 2GWGA 4URGA 1SIWB 3GY1A 2KN4A 3MAAA 3J7YI 3RZAA 3L0GA 4JYAF 1Q6RA 2IUZA 3CUZA 4NI2B 3H0PA 1FBAA 4HR2A 2LFVA 3JSRA 3DG7A 3VE7A 4JXCA 1F3EA 1QAIA 3TMQA 2ACYA 2C3YA 1NM2A 3IJ6A 2QDEA 3CUJA 5C70A 3LALA 2J6TA 3W29A 4WP3A 3LGGA 4TYBA 1JLAB 1FP8A 2DGAA 2XM2A 3RO6A 1T03A 2PZ0A 2TYSA 1T11A 3ABQA 1EX8A 3Q8QB 4NZ1A 3T9ZA 5BXTA 5D4OA 3TN3A 4E4FA 4PUJA 2YCEA 2B81A