3PJXA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, p32
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 155
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjxA01
4Y9PA 1RT2A 1SUQA 1C0TB 1DTTB 5KFQA 1S97A 4OL8A 3LP1B 2ZKUA 1T03A 5DGBA 2JEFA 3OLBA 2J6TA 4RW8B 3NBPA 4Y34A 4PWDA 1XR5A 5DG8A 3QGIA 4I2QB 5KG2A 5J2QB 2YKMB 1IKWB 2WOMB 4O4GB 4K4XA 5C24B 1U09A 2RF2B 4IG0A 2UUWA 3IG1A 3T1AA 1JLEB 1S1UB 4YQWA 3KK1B 4F4YA 2WTFA 3EPIA 3GV7B 2BQRA 5J1EB 2FVRA 1RT6A 4KIEA 3DYAA 4JV1A 5DGAA 3PJUA 1S1WB 4RUCA 4XPCA 4J9SA 2WONB 3DLEB 3SFUA 3MEEB 2BQUA 2R8HA 3U2EA 3PW5A 3C6UB 1XR6A 1QE1A 2I1RA 4O44B 5F8LA 4KO0A 4WYLA 5DLGA 1ZTTA 1TKZA 5KFLA 5KG7A 5HROB 2HMIA 3M8QA 2FLPA 4RW4A 1LW2B 2R8KA 3DLGA 3QO9A 5J2PA 3GG0A 4WFXA 2C2DA 4O3QA 5MKGB 1RTDB 1RTIA 2WCXA 3OL9A 5F8NA 1JKHA 3IGVA 1C1CB 1HARA 2VG6B 2E9ZA 3I5BA 3CDEA 5KT3A 3OSNA 1C2PA 5C25B 3CIZA 2ATLA 2E9TA 3MFHA 1LW0B 4Y9OA 5KFOA 4M94A 4K4VA 2AQ4A 4IR1A 3Q8QB 1KLMA 4EBDA 4G1QA 5KFRA 1HNIA 1N56A 5T14A 4RNIA 3PHEA 3OLAA 1TP7A 4ED0A 1EP4A 1RTJA 1RT7A 4TQRA 4ZVEA 4I2PA 2F8EX 3UR0A 1S0MA 3HVTA 2IM2A 4IR9A 3GQCA 3GFXA 3DRSB 4NRTA 4ES4A 3PR4A 2YNFA 4H4OA 4QWCA 3M9NB 3BGRA 5CYQB 2R2SA 3PW7A 2RKIA 2V0NA 1J5OB 2HAIA 3JYTA 1W25A 3C6TB 2V4RA 4QWEA 1FKPB 4Q43A 3PR5B 4K4SA 3V6HA 4URQU 5JUMA 1S1TA 4RNFA 4Q6JA 1RT3A 4KSEB 2XI2A 3PW4A 4WFZA 4AFYA 1T05B 2FLNA 3KLIA 3V4IA 2GIRA 4MH8A 4JV2A 5M1TA 1TKXA 1JLFA 4NRUA 3IS9B 4K4WA 2HNYA 1JLAB 4Y2AA 1VRUB 4IFYA 4ZP7A 5J2MB 4F50A 3GFYA 4DL2A 3DMJB 4NLDA 1JLGA 2YNGB 4MFBA 1N5YB 4F3HA 3N6NA 3KHLA 2XCAA 3KK3A 1IKVA 1S1VA 3MR2A 5KG5A 2R2RA 3V81A 5I3UB 3ITHA 3H59A 5HBMB 3JSMA 4FS2A 5D3GA 1HMVA 4PQUA 1HQEB 1S6PA 5HLFB 4FOJA 4MK7A 4XO0A 4ECVA 4B3OB 4RW6A 1S0OA 3HVAA 5KFZA 4FBTA 3LAMA 3MR6A 4Q0BB 4IRCA 1RDRA 3KLHB 4RW9B 5KFJA 1TKTB 5KFEA 4PUOA 1QAJA 4WZMA 4WE1A 2B43A 3VQSA 3QGHA 4LSNA 1IKXB 2W7OA 2OPQB 3QGGA 4MK8A 2HNDA 2C2RA 2I5JB 2FVPA 2YNIB 3OSPA 3ISND 4ZP6A 3KLGB 3HV8A 3GFZA 4J9QA 3NAIA 4K4TA 2IM3A 1SH3A 1RYSA 1S9EB 4FS1A 5C42A 1DLOA 1RA6A 1JXLA 1SV5B 1UWBB 5DQGA 1S9GA 1T94A 4K50A 1BQMA 1REVA 1TL3A 1KHVA 4WYWA 2UVUA 1HPZB 5DLFA 3BR9A 1TV6B 4J9MA 4FBUA 1N6QB 4RZRA 2W7PA 4Q8FA 2YNHB 3NMAA 3I0SA 1C1BB 2CJQA 3DM2B 1R0AB 3FFIB 4TQSA 2AGOA 2UVVA 3M8PA 4QPXA 2W9CB 1C0TA 1DTTA 3KLVA 2AX0A 3LP1A 2W9BB 3CDUA 4NLGA 2B6AB 3UPFA 1HYSB 3QIPA 5KG4A 3NGDA 3KK2B 1RT1B 5KFDA 3M9OB 3H2LA 3BQ1A 1RT5B 5J2QA 3LP2A 4J40A 4Y8EA 3E01B 4IH7A 1LWEB 5EUHA 4QWAA 4F4XA 3PW0A 2BASA 1QAIA 1IKYB 2IC3A 3HHKA 4RUAA 1S1UA 3KK1A 1JX4A 4J9OA 5J1EA 4QW8A 4GC6A 3LANA 4HU3A 3MECB 3T5JA 2BQ3A 3DOKB 4O3OA 4ED6A 3MEGA 1S1WA 2HNZB 1EETA 2WONA 3DLEA 2ZD1B 3MEEA 4ECQA 2J6SA 1S49A 1CSJA 3DRRB 4NLTA 2R6OA 3FQLA 3C6UA 4R5PB 4FOKA 4NLOA 4O44A 4YMEA 3MR3A 1IM4A 4IH6A 1LWFA 5FDLB 3GIMA 1LW2A 1S1XB 4DL3A 3V6DB 2ILZA 4KB7A 4NLPA 3OHAA 3MR5A 4H4MB 2W8LA 3I0RB 5KFBA 1LWCB 1BQNB 5MKGA 5CYMA 2WRMA 1RTDA 2J6UA 4YP3A 2IM0A 3MFIA 4ICLB 5KFCA 1C1CA 4LJ3A 4K4UA 2VG6A 4LSLB 1RTHB 4RNJA 2BRKA 2VG7B 3OL6A 1NHVA 3KZPA 4J9PA 2AGPA 3RB4A 1JLCB 2IJNA 4WFYA 4ZPCA 2C28A 3BSAA 3BQ2A 2R8GA 3GIJA 2R8IA 4ED1A 4R8UB 2B5JB 4MKAA 5F9LA 4EEYA 3DI6B 2YKNB 1T03B 3GILA 1S9FA 1SH2A 4WZQA 3CO9A 1WNEA 2IA6A 1FKOB 3UDLA 3RAQA 4PWDB 4U6PA 3DRSA 3N6MA 1S6QA 5CYQA 4Y9MA 1XR7A 2CKWA 4XPEA 3I5CA 1J5OA 4IG0B 4DG1B 1S48A 3IG1B 3C6TA 1FKPA 1VRTB 2O5DA 4TY8B 3Q8RB 4YR2A 4TY9A 5I42B 4IG3B 4KV8B 1NHUA 2FJWA 2JEJA 1T05A 3LP0B 2AGQA 4ZVFA 1JLQB 4IDKA 4Y2CA 4DL6A 2BANB 3H5SA 4IFVB 4ZVGA 4K4ZA 5J2MA 5KG6A 4KO0B 3DMJA 3M8QB 5MF5A 2D3UA 2YNGA 3G6YA 1N5YA 3G6VA 3OL7A 2AU0A 4Q8EA 1K1SA 4LQ3A 3GV5B 1RYRA 2RDJA 2AX1A 2IMWP 1FK9B 2R2UA 1HQEA 2JEIA 3S83A 4X2BA 2BR0A 4B3OA 4TYAA 2FVSA 4Q0BA 1RT4B 3KLHA 1KLMB 1C0UA 1TKTA 5L1LA 1HNIB 2JC1A 1IKXA 2D41A 4TYBA 4ED3A 4DL7A 3RB3A 3GIKA 2HWIA 4Y9NA 4ZHRB 1TL1A 1RT7B 2I5JA 2XI3A 2XWYA 2YNIA 3H5UA 3ICLA 4NLRA 5J2NB 4EO8A 3SI8A 1YVFA 3CDWA 4ED2A 4NLYA 4ECZA 2YNFB 1S9EA 4H4OB 4H54A 1SH0A 1GX6A 5K14B 1I6JA 1UWBA 3JYTB 2OPRB 4NYZA 5L9XA 5KFYA 5DQIA 5L1IA 4ZVHA 2VG5A 2XCPA 1S0NA 4NLXA 1DTQA 1TV6A 4O4RA 3PVXA 5EWEA 3KJVA 2QV6A 1N6QA 3DOLB 2YNHA 3KLIB 3QLHA 3BJYA 1C1BA 4NCGB 4ED8A 3RBDA 3DM2A 1R0AA 2JEGA 3T5LA 3FFIA 4O3NA 3TAMA 2IAJB 2HNYB 4RNHA 3DRPB 2W9CA 4EYHB 3H5XA 4DEZA 2W9BA 2IJFA 3MEDA 5KT6A 3N3TA 2B6AA 3LALA 1JLGB 3BSNA 3GIIA 4G3IA 1KHWA 1TVRB 3IRXB 3CJ2A 3V81B 2VA3A 3MTKA 4HYKA 4I7FB 5KT5A 1HQUB 5HP1B 3JSMB 3KLEB 4Y3CA 3E01A 4ZP9A 3BQ0A 1LWEA 1HMVB 2W27A 3CJ4A 1IKYA 2XC9A 4AG0A 2R2TA 3RB6A 1NNDA 5DG7A 2QE5A 2FJXA 4ZP8A 3PW2A 4IH5A 4KHMA 3H4BA 4EYIB 4KE5A 3MECA 4RW8A 1HNVB 3DOKA 4PUOB 4M95A 5F9NA 4I2QA 3OL8A 2YKMA 1IKWA 2WOMA 2ZD1A 3LAKA 4O4GA 2FVCA 3BSCA 5KG3A 1Z4UA 5C24A 3DRRA 4LYKA 3D5MA 5EDWA 2RF2A 4ZPBA 1ZTWA 2ZE2B 4NLSA 4R5PA 4J9NA 1JLEA 5KT4A 1JLBB 4MK9A 2BRLA 4U7CA 3PJWA 2ILYA 4RW7B 5FDLA 3PJXA 3V6DA 3H98A 3V6KA 5KT2A 1DLOB 2XGPA 4H4MA 2W8KA 3I0RA 1S9GB 1BQMB 1BQNA 4QWBA 4Q45A 4KFBB 3T5HA 5KT7A 3KLFB 4J9KA 4ICLA 4KKOB 3TQ1A 4F48A 2BE2B 1TQLA 2VG7A 4NLVA 5HROA 4ED7A 2OPSB 3I0SB 4KAIA 2OPPB 3M8PB 1MMLA 3CJ3A 3DLKB 4ID5B 4TXSA 2B5JA 4R8UA 1D1UA 3Q8SB 1MU2B 1T3NA 3DI6A 2YKNA 2OH2A 4NLUA 3QIPB 1QUVA 3EZUA 4MIBA 4ECSA 1FKOA 2D7SA 5C25A 2C2EA 2ASJA 2HWHA 5DQHA 4F4WA 3NL0A 1LW0A 3LP2B 1RT2B 1SUQB 4DG1A 4RNOA 4WXOA 5EWGA 2IC3B 3V6JA 2ALZA 3PZPA 5L1KA 1VRTA 4TY8A 4RNMA 4EBCA 4ECRA 3RAXA 5I42A 5F8GA 4IG3A 2ASLA 2IBKA 3QIDA 3NBPB 4Q44A 4KV8A 5KFPA 3KMSA 4ECWA 3MEGB 4DL5A 2R8JA 3LP0A 1EETB 1JLQA 4DL4A 3NAHA 3TVKA 2JLEA 2BANA 2WB4A 5KFXA 1D0EA 4IFVA 2FLLA 3BSOA 5KFTA 2EC0A 3QYYA 3KHRA 4FOUA 1LWFB 1RT6B 3SY8A 3DYAB 3MF5A 3I5AA 1ZETA 5KFGA 5CYMB 3H5YA 5L1JA 3GG1A 4LQ9A 4RNNA 4URSA 1QE1B 3IS9A 1FK9A 1JLAA 3M9MB 1VRUA 2HMIB 4F4ZA 1TKZB 4WXWA 4RW4B 3DLGB 1RT4A 3QO9B 5J2PB 5KFNA 4YR0A 4ECUA 3KMQA 3OHBA 3PFMA 1RTIB 2WHOA 1JIHA 4KHRA 5I3UA 3G6XA 1JKHB 3HVWA 5HBMA 3KHHA 3FDSA 4EBEA 4ZHRA 2VA2A 4HU4A 5HLFA 3CJ0A 5J2NA 4O3PA 2UVRA 1S4FA 1S6QB 3PJTA 4QWDA 3T19A 4MKBA 4RW9A 4NLWA 5K14A 4G1QB 3SFGA 3QZ8A 5KFHA 4MIAA 4IRDA 2OPRA 3NKYA 4JUZA 3BREA 5F8JA 3CJ5A 2OPQA 5KFAA 5DG9A 1EP4B 1RTJB 4RU9A 4ECXA 1K1QA 2V4QA 4R0EA 4I2PB 2IM1A 3FQKA 2GC8A 3HVTB 5KG0A 3DOLA 3E51A 5KFKA 4J9LA 4NCGA 3Q8PB 4IDKB 3BGRB 4EO6A 2DPIA 2RKIB 4NZ0A 1SV5A 2IAJA 3DRPA 5KG1A 3RBEA 4K4YA 3KNAA 1HPZA 3KOAA 3CVKA 1S1TB 5KFMA 1RT3B 4NLQA 1TVRA 3IRXA 3V4IB 4ECYA 4I7FA 5KFWA 1TKXB 1GX5A 1HQUA 2D3ZA 3KHGA 5HP1A 1JLFB 3KLEA 3T5KA 3HV9A 5F8HA 4IFYB 5KFUA 4HKQA 1HYSA 3RB0A 5KFVA 5EWFA 3KK2A 4ZMMA 1RT1A 4MFBB 4GC7A 2AWZA 2GIQA 1HNVA 1RAJA 3KK3B 1C0UB 1IKVB 1S1VB 2E9RX 1RT5A 3ITHB 3ISNC 3KLGA 5D3GB 1TL1B 3D28A 4PQUB 1S6PB 2ZE2A 3HKWA 5C5JA 2UUTA 5JXSA 4ECTA 4TLRA 3FRZA 4KBIA 1JLBA 4RW6B 4ZPAA 3GV8B 4O3SA 4ZPDA 4QW9A 2XGQA 4IRKA 4RW7A 5KFFA 5F8IA 2WK4A 4YR3A 2FVQA 4O3RA 4WE1B 2HNZA 3CWJA 4LSNB 4URGA 5F8MA 4HJFA 4KFBA 2VG5B 3GYNA 2HNDB 3KLFA 1RA7A 1DTQB 1OS5A 4KKOA 3N6LA 3KJVB 2V9WA 2BE2A 4IQXA 2ASDA 2UVWA 4J9RA 3QLHB 2OPSA 2RDIA 3UQSA 1S1XA 5C42B 3TLQA 3TAMB 4IOBA 2OPPA 3DLKA 4IKAA 3IGNA 1REVB 1LWCA 1TL3B 4ID5A 3FSIA 3IN5A 1MU2A 3G86A 3MEDB 4TN2A 3H40A 1S10A 5KFSA 1N48A 5KFIA 2JC0A 1RTHA 4LSLA 3EPGA 2DPJA 1N4LA 2C22A 2W9AA 1JLCA 3H4DA 3DDKA 3QZ7A 2FJVA 4JV0A
chains in the Genus database with same CATH superfamily
1CG2A 1Y7PA 1SUQA 1RB0A 3LP1B 4LMZA 1SXLA 3FXYA 3FSUA 2KXFA 2N82B 4ILMA 3OJSA 2DHGA 4ACZA 2WSCC 4LAOA 2AKWB 2RHGA 3CYJA 3QGIA 4I2QB 2ZUSA 5G1MA 1KLYA 1XTZA 3HU7A 2OQYA 1U09A 3IIPA 1R38A 3ITOA 4LH8A 1AH3A 4ZCLA 3PV8A 4FXSA 4ZO9A 5DGAA 3EMTA 1XYFA 3KOXA 5FI8A 4DV3F 3U2EA 2AW0A 3GUGA 3SV3A 4X0NA 5C0QA 1IJEB 4GJJA 2ZH7A 1FDZA 2K06A 1UEVA 5MKGB 3KUHA 1APSA 4LRBA 4MWAC 2PTZA 3NZQA 4GUIA 3GVWA 2BJDA 1A5MC 2XMKA 1MUCA 2VD9A 4JN6A 1L5UA 2PD9A 2AQ4A 4ZXLA 5IC6B 2JF6A 2OJ3A 1U2FA 4LF1A 5CPSA 3EPNA 1CJVA 1PB0A 3G2GA 4N8NA 4Z1CA 1RKIA 1SYTA 4QBXA 2HAIA 4B9TA 4M5GA 2HEJA 4OOZA 4E8CA 3TQ0A 5EU9A 4OZJA 2PDJA 4YDXA 1D9DA 2QEXS 3DHXA 2XVNA 3UG4A 3H2MA 3PZIA 1MW1A 4GCAA 2N3LA 1VCGA 1VIWA 2O67A 2XI2A 3GU0A 3OQ8A 5IWAF 2VWTA 4AC7C 1AMYA 5CZ0A 5J2MB 1CECA 3PVFA 2GIFA 1FRBA 4KS0A 1EYEA 1X4HA 2IXVA 2ZM6J 1Z9AA 3LGDA 1N5VA 3W88A 1S6UA 3N6NA 3MP4A 4USHA 3ULHA 1FXPA 3H59A 4FS2A 1B4SA 2DJLA 4HTJA 4AZ7A 4J3UA 4JFUA 1GW1A 4WZMA 4PUOA 3DYMA 3GR0A 2W7AA 5THWA 3VQSA 2L41A 2FVPA 3V18A 4B91A 2I5JB 2QUTA 1DFDA 1IZJA 3GBEA 6FDRA 3B9NA 1RYSA 2XWXA 3UNTA 5FSEC 4V1Ak 4UQGA 2O3DA 5CSSA 1AQHA 2VT0A 2LVWA 1Q81T 4Q32A 4ZPWR 1H11A 3FUYA 3U4AA 4PB3A 4RWXA 4GKKJ 1GT8A 4KGKA 3KL5A 3ZLFA 2KXNB 1I94J 1PVNA 3WFZA 1PX4A 4P52A 3CDUA 3NGDA 2VFSA 1UR4A 4Q6XA 3EOUA 2DP3A 4B9YA 3TRGA 4XWUA 2A0NA 3ZIZA 1WG5A 3BAYA 3EDFA 2QDHA 4QR0A 2JEQA 3LP2A 4IH7A 2QCCA 3CV6A 4I6KA 4FA3A 1O0PA 1HL9A 1CEOA 3J81U 5HXMA 4HACA 4ROPA 5A2AA 4AMCA 2W4CA 1B1YA 3KBWA 3IAPA 4Q5VA 2HNZB 1EETA 3LDVA 4ES1A 4OZ1A 4LB4A 2CQIA 3QJPA 5IRPA 2PC4A 3MV11 3AWOA 3KCOA 5DDQC 8ATCB 4YMEA 2HRYA 2FVKA 1NWRA 3HG2A 1AA1B 1X8CA 4BKNA 2EF9A 1KLZA 4ZEPA 4PUKA 5HANA 2WRMA 1WX0A 3VGHA 1TL7B 3WUFA 4ZITA 4QNEA 2Z29A 1BGAA 4BFAA 1HJVA 4IPNB 1E6PA 1TMQA 3K58A 3ENVA 1SZRA 3BSAA 3HT0A 5LXEA 4R8UB 1UA3A 2R3VA 1XEZA 4WZQA 1XQKA 2PP3A 3PPGA 2CPEA 3GXDA 3T1YJ 1KRBC 4ES3A 3DRSA 3RM9A 4ML9A 4PMYA 2YH0A 4GNJA 4XPEA 3VGEA 3L4UA 2W63A 4HMDA 3C6TA 2FFCA 4OI2A 2O4QA 1ME7A 2RS8A 3Q8RB 3WF0A 1B31A 1H74A 4XZNX 2AGQA 1EHAA 2W2OP 2HBRB 4USTA 3LHTA 1K6WA 1I6NA 4FF5A 4R53A 1NH7A 3KTSA 1XLLA 2V67A 4GHRA 4O1BA 2BE9B 1DJQA 4Z2GA 3NP5A 5DCDA 2NT1A 4HHLA 4WIQA 2GHWA 4K6AA 3WLIA 3ATYA 2NXUA 1GOKA 4PCFA 3KOZA 1N8RT 4G8TA 1JXEA 5BYSA 2CQHA 3UPBA 3G1RA 1GMWD 5D03A 4Q0BA 2PFHA 4BHYA 3G5EA 1KLMB 2NX9A 4IPLA 4DJBA 1CULB 3OTBA 5LGXA 1SJRA 3DHUA 5KTLA 3NVDA 3D67A 5D4LA 4RZBA 4ZOBA 2DR5A 1YPFA 3CDWA 2CWXA 3GNRA 2OSXA 4J2MA 1KFLA 3O6DA 1GX6A 1TZZA 2V3FA 2M70A 3CCQS 5KFYA 2E6AA 4TV6A 4WCEQ 3SRHA 3KRUA 2CJAA 1IBLJ 1EWEA 1WKYA 3CEPA 4P73A 3FHQA 2W67A 4M8UA 2QV6A 2RGMA 1RWPB 2KXHA 2MJUA 3T6CA 2DB1A 3FFIA 1VQTA 3LOUA 1NSAA 1FTCA 4C1NB 3D3CJ 1SPBP 5A8WA 5MHBA 5A6KA 4JIIX 2VA3A 1JUKA 2FMOA 2JALA 3KP1A 1B3YA 4NXSA 1OFDA 1QHZA 3ARPA 3BQ0A 1M68A 4DZIA 2OJPA 4HHUA 2J74A 3MBDA 4HZ7A 3TSBA 4ZP8A 3H4BA 4KPYA 4KYZA 2VDIA 1CB2A 3GTNA 2HS0A 4KWWA 3R7NB 3GZAA 2FVCA 3QW3A 5ABHA 2TSYA 3R2CJ 2XGBA 3C0QA 3PWIA 2E29A 3LH2S 3OR2A 1NVMA 1YRXA 5ETVA 2HVIA 2CVEA 2QN6B 1RJQA 1VHFA 1KWMA 2A2IA 1S77D 4D9PA 3UDEA 3LNPA 3D2WA 2BDPA 5J04A 4JICA 4QWBA 3GDBA 1WKKA 5DCEA 4TO8A 4NF7A 5D2WA 4GUJA 3PRDA 1S3TC 3NNCA 1KBKA 3LEPA 3TJ4A 3VFCA 2DH9A 2UBPC 3C61A 3C0JA 2BV9A 3POCA 2NZCA 4ZENA 4I7UA 3LGHA 4FLRA 1IXNA 4KCUA 4ID5B 2XZ9A 4XD4A 1NLKL 4Q8NA 1Q4NX 3GW0A 4NMXA 3RG6A 4IGMA 3AMGA 3C14B 5AHNA 5K4XA 1VD6A 3R7BB 2AGTA 1QOPA 3B4MA 1KTBA 3R25A 3QGKC 4P72A 4EPBC 3V6JA 1GORA 2WNWA 4W89A 2ALZA 2AYGA 5I09A 2VC0A 5C9WA 4GVHA 2Y5EA 4H6EA 3BAIA 3E1F1 2OTJS 1F5BA 4N6EA 3C46A 3M6UA 3MEGB 4FF3A 5E33A 3FEXB 1TR9A 3CQ0A 4UNIA 2GSJA 2W92A 2VHLA 3LD5A 4AY7A 3UDCA 4XDCA 4X64J 2Y7EA 2QKFA 1E73M 2KFNA 2ALYB 4RUHA 2JHEA 3AD7C 5KFGA 5DF0A 1E5JA 1VCFA 3QF0A 3IS9A 1JLAA 3B9AA 4U95A 5D09A 1HG3A 1LOQA 4ECUA 3QO9B 1DJWA 5D0GA 2UV8G 1JJ2R 1X6NA 4JI2F 5FAGA 2WHOA 4OUIA 3PAJA 1XMOF 2DEJA 4HU4A 1S5TA 1VKFA 2JVRA 3DLBA 1YRTA 3LQGA 4JCMA 1R3WA 3EX1A 3SFGA 2YCIX 3MVTA 3STPA 4RXFA 4ZK7M 4C6QA 3SJ3A 4DWIA 5DEZA 3EICA 3VIKA 2QAPA 4BF7A 1BAGA 2BXJA 1ITUA 3GHSA 4OZ2A 3NRBA 4HZ8A 3TX0A 1SV5A 3NG3A 1MUWA 1WHXA 2YPYA 3CSKA 2R7WA 2IKGA 4ITSA 1VQPS 1L3KA 2OB3A 2CJKA 3T8LA 4ZQCA 4FXRA 2A79A 1GKQA 5G0RB 5HVGA 2ZKTA 4QR2A 3OQEA 4CN4A 4GYPC 3K7RA 3JAMY 2QF7A 2YBVA 2ZZ4A 4ZQNA 4EXAA 3LCGA 4WU3A 1RLCL 4IUOA 1B4EA 3ZM8A 4DUZF 2PA3A 3PZUA 5EWFA 1QHOA 3AHTA 5BYWA 2XM1A 4MAVA 4S3BA 5ETOA 4F36A 4CWBA 2XO7A 1XYLA 1SW7A 1TPVA 1BRLA 1WZAA 4XZBA 3TUUA 2XIIA 1V3HA 1NKEA 4N77A 4RW5A 5A6WA 4RW6B 5EMKA 2XGQA 1FWSA 4LSBA 1C3FA 4X2PA 4YMZA 4O3RA 1XLJA 3E0WA 5D77A 1WUEA 3J7YU 4LR8A 3LTYA 4RE0A 2E5JA 3K8VA 3NQ6A 1NOWA 4KKOA 3ZR4A 1HT6A 3NTYA 5KZMA 4IQXA 2ZC1A 1JAKA 2RDIA 1UVIA 2QA1A 1OYBA 5IZHA 2VM8A 2OPPA 2ZRYA 3R89A 1L6FA 3IGNA 4DOZA 1R46A 5I0DA 2XWDA 5BMWA 2J47A 3N2OA 4UTWA 4K3ZA 3G86A 1XFCA 1N48A 4XZWA 1AW5A 2I16A 1CLXA 4UTTC 1AVAA 4JV0A 4IQLA 1SFSA 4FNHA 1P0KA 3SCNA 4A48A 4HCDA 1CLKA 1BMQB 4PWDA 3W72A 2WSRA 3QQ0A 4DJEC 2V2ZA 1XH1A 3LK6A 3PBMA 3W1NA 5F3ZA 4JYEA 4GWEA 2UUWA 2O66A 4PBGA 1W1VA 3NEVA 2WTFA 2FVRA 1DJIA 5GNZA 1WDPA 1HVXA 4B2DA 1PJ7A 4NL1A 1WHYA 3MUXA 3DLEB 4DR2J 1TR0A 2FJDB 1XR6A 3TANA 2KZZA 5BMXA 1KDNA 3I32A 5HK4A 4IHCA 2OLAA 3C15A 2NQ5A 4BF5A 4WFXA 3UG5A 3AYTA 1YBQA 3WIUA 2EGZA 1DJ0A 1U6FA 5I5RA 3Q0AA 1BQXA 5AC7A 1GOIA 3LQLA 5C25B 4HVXA 1NU5A 1RAOA 3MFHA 3CCUS 1UD6A 3A8KA 3SZ2A 1W56A 2E7XA 3WQOA 3WJYA 1MRAA 2ALRA 2CZFA 2WV8A 3MI6A 3NA8A 4NI8A 3CNYA 2X2GA 3HBLA 3B8HA 1YNYA 2J25A 1QSLA 1VQ6S 1FHTA 2LCWA 1FFQA 2ISFA 3T1HF 3V0UA 3UW6A 2FDSA 5F0WA 3DU6A 3PR5B 1BF2A 3GNOA 1ZAXA 4I9AA 3ZR5A 1E4NA 1Z44A 3NQ7A 5DELA 1S1TA 1XD1A 1VI7A 3M8YA 3QRRA 3BH4A 4AZCB 3ZC4A 1Q6CA 2PDIA 4Q8VA 1CGUA 4JNYA 4LF5F 2I2YA 2TRSA 1ITPA 3DN5A 1P8GA 5D8WA 2NXCA 1L8NA 3SSJA 4L72B 1HHTP 2H9ZA 1H7OA 2YX7A 2XCAA 2DU2A 3UXLA 5BXPA 1DYSA 1AUDA 3VVUA 2VRJA 1SO6A 3UVJB 3WLTA 4DZ5A 5D2TA 1AQ0A 1HQEB 3IIXA 2WM1A 2OLWA 2V6AA 3HGOA 4N76A 1P1MA 4RW9B 3S1XA 4NILA 3VCNA 3QGHA 3KRBA 3F1QA 2YNIB 3LCHA 5K9FA 3N4FA 3OTEA 3KZSA 4H6KA 1ZHAA 4MTPA 4PR4A 3NAIA 4K4TA 1HGYA 2EFOA 5I3KA 4ZJLA 2D3LA 3RCNA 4KGLA 2CADA 1WAWA 1YLXA 2P1FA 1S3HA 2PD1A 2CLIA 3FLUA 4QEEA 3OUYB 1X31C 1N6QB 4DF0A 4CQBA 3AFBA 5ETTA 4Y00A 2E9MA 1ZJBA 1R0AB 1RAGB 4WR3A 2QZRA 4H7VA 2XHYA 3NO1A 3DRXA 1C0TA 1UMYA 1RI7A 2BLEA 3V5CA 1RT1B 2ZKMX 4G6VB 3R4IA 2I5GA 1L6SA 3TUIC 1Z8AA 3VKKA 5EUHA 3E01B 1OSEA 4F4XA 3QFEA 4AISA 3VDAA 3FCWA 2YXGA 3UJRA 3KK1A 4J9OA 3MECB 3QPEA 5BRBA 3QY6A 4O19A 1PC4A 4UOCA 4NLTA 3ZXWA 3CE8A 4ALZA 1EQCA 3RYLA 4UFJA 1ONWA 2AP6A 2CJYB 5JIPA 1J6PA 3DOMB 3ZVIA 2W8LA 4PUEA 2RRBA 1CC8A 1MN9A 1RP8A 2FLOA 1DJHA 1BTCA 1P9QC 2D24A 4AIOA 1VK3A 2LA4A 3E5PA 1CJUB 3OL6A 4DEFA 1CPZA 2GLKA 3CH0A 2C16A 2A6OA 2KVIA 4LFAJ 4IXHA 1VBKA 4MKAA 3G8RA 3KAOA 5BXTA 4GVBA 3AHVA 2AZ1A 1C9WA 1MVYA 3RAQA 1N54B 3KCLA 5HQMA 4GD0A 3ZZUA 3MWCA 1OHLA 1PXGA 4OJ1A 3W61A 1EO5A 1L0PA 2Y5SA 5D2YA 3VZXA 2VL1A 5D6GA 4NUWA 3WJZA 1ZJIA 2QCHA 3FGCB 3E49A 3GXNA 4PAAA 3AIQA 5H2ZA 1FWBC 4FN5A 2QUNA 1JNZB 4JBCA 4IP4A 1NJIT 1VLOA 1FRIA 3KW3A 3T6BA 3VIGA 1JB0C 1AL7A 4Z1BA 4QPTA 4PTVA 3GC2A 3N14A 2EHHA 5D8ZA 4PCQA 9RUBA 4PABA 2XTJP 1XRTA 3FYOA 1P0DA 2YJQA 1K1SA 3BKUA 4C8LA 1V8EA 3D1QA 1ECQA 1P9YA 1RBLA 1B0IA 4TYAA 2XIQA 1EUNA 1NM2A 2DZPA 3WQ4A 3WLSA 2BY1A 1C0UA 2RNEA 3MV01 4PMRA 4USUA 5F0UA 1G4EA 4C8MA 3RB3A 1NARA 2FZMA 3BARA 3GXMA 1BXBA 2WBKA 2UUAJ 2MMYA 2M7SA 1VK8A 1FWDC 3TOQA 2GVJA 4NLYA 3OPSA 4AE5A 1SH0A 3RR8A 1K8ZA 3B8DA 1FXRA 5FLXU 4LVDA 1N2VA 5K9CA 1A3XA 2Y6ZA 2DNQA 1TV6A 2GO9A 3VX0A 2KZHA 3LA0A 2MZTA 1NMEB 4GISA 3NWGA 1ZBCA 5DT5A 3G9CA 1FX2A 1FWHC 2ZX8A 2ZUVA 3CMJA 3M0XA 4ZSTA 4HHJA 1IF2A 1SO5A 4OHWA 3L7OA 3A64A 2YKAA 3AD9C 3MZ2A 1OYAA 3WQGA 2AJ4A 3RRKA 3AJDA 1ZBKA 3R1ZA 4X3ZA 1JNEA 2F4VJ 5EMMA 2R2TA 1NNDA 1V5IB 5HR6A 4IH5A 6PTDA 2QEZA 1ISVA 2ZH1A 1ZP4A 4PUOB 2J7EA 3B8TA 2YGYA 4NWBA 3DRRA 1OVDA 3D5MA 3IR6B 2GJXA 3I4KA 2VQFJ 3L7RA 3G0SA 2PDMA 1E6VB 4ZVPB 5KT4A 1Z7AA 1VC6A 4XBSA 1IEWA 3OIHA 3VKCA 2YL8A 1TPWA 2E9BA 3VGBA 2OT1A 2ZXQA 4E38A 4WGHA 3SRDA 2PRLA 1BQNA 3HJVA 4ZOAA 3ZO9A 5TIMA 4JI3F 1T9XA 3SN0A 4J9KA 3Q37A 1MNEA 4N9BA 4G1PA 2V2VA 5HROA 2ZX7A 1W54A 3LS9A 1NDLA 4J5NA 1IGWA 5GJMA 1NJYA 2H9AA 3ARSA 2P8BA 4IZGA 4DWSD 4YTRA 2PDKA 2FDNA 2EFPA 1P1TA 4EPDC 2FB0A 3O44A 3LP2B 3FC9A 5L9NA 1P6CA 3CUGA 2QSWA 4HACB 2GSEA 3W7CA 2R8JA 4BR1A 2A1BA 1ZBWA 3EEZA 1EETB 3W27A 2BHYA 2GVGA 4BHQA 1O12A 1QNQA 2I57A 3TJAA 4DV3J 4A8WA 3CCTA 1UEKA 3PF3A 2QG9B 1C8YA 4H04A 3KHRA 3R0KA 1OIAA 3VTIA 3MCOA 3AMKA 1BVZA 3W7DA 3HF3A 1KFJA 1MXDA 1LM1A 3NCRA 5LSLA 4K2SA 3I4HX 2VU5A 3VNYA 5LIXX 4RW4B 4ZL1A 2POZA 3CV1A 3PYFA 3ONCA 4F79A 3AT1B 1OCJA 4CLTA 4ZHRA 1N36F 1D3WA 1BQCA 1MNZA 2VENA 3A4AA 1PGZA 5DY3A 3NQ8A 4WDTA 3UNDA 1D8YA 3CIXA 4US5D 5DX7A 5GAEU 2C3OA 1E71M 1BWLA 1B5TA 4XDDA 4BC7A 1KXQA 3NZ1A 1RUSA 2WSEC 3SFKA 4NCGA 2DPIA 4LIWA 1TO3A 1QXLA 2HQAA 4GY0A 3BV4A 5JJBA 4C6DA 3CDAA 5E3PA 3KOAA 1G1XA 3B0YA 2I9SA 2GPTA 3K1DA 4PSPA 2X0SA 2ROPA 3N2XA 1LYXA 3L2IA 3GE9A 1ZPTA 1SCJB 1XHGA 4MM1A 4MJKA 4FR6A 1KTNA 1JLFB 4JI0J 2DNGA 1XLFA 4GUGA 3HQPA 2WQDA 4ZQRA 5HJXA 1SJQA 3ERPA 2X1SA 3ZJ6A 4XUGA 3G1AA 2UY5A 1A5BA 1K0TA 3ARXA 4M1BA 5CZSA 1QO5A 4E8UA 4JD4A 2HHUA 1Q2SA 2WLYA 2RMLA 3BBBA 2W91A 1IXQA 1F3VA 1HBNB 2Q6CA 3M7WA 3NM3A 2VHGA 2H90A 4KT0C 4U9RA 2FLIA 3L12A 1EH9A 4QJ1A 4HHHA 4EVZA 3MHGA 4K7VA 2VNCA 3S2MA 4Y6IA 4AIEA 4GNVA 4HJFA 3F2DA 3H2NA 3GYNA 4FIRA 2ZOMA 2PDXA 5TBOA 4CUCA 3FBFA 2QX0A 3N6LA 3DG7A 5BW6A 2ASDA 5TQLA 1J0HA 2H65B 4KGZB 3OTOJ 4DYKA 5AC5A 2BM0A 4DYEA 1LP6A 1R3VA 1URNA 1REVB 4LRCA 1MU2A 5A8WB 1KQSR 1UWQA 2FB2A 4GK8A 3U5YA 5KFSA 1XLCA 1XG4A 4YTSA 3WH6A 3TXZA 3N19B 4ZR8A 4G1KA 3HFTA 3CCRS 3BDKA 4JOMA 1YIXA 2HISA 2D74B 3W83A 4DQIA 2EK1A 3HG5A 4MNMA 3WBZA 4KFOA 2NXJA 4ZTXA 3ZO7A 2A3BA 4Y34A 3IJQA 4V33A 3A21A 1W2PA 2E25A 3E5BA 1V77A 5CC5A 3RW6A 2HYIB 1YZ6A 3OR2B 3MO7A 2ADAA 1JRBA 4F02A 1XYAA 3EPIA 2BHUA 1KOOA 2OD4A 3J80Y 1RT6A 5DM6Q 4PE8A 3KCJA 3QPZA 4RDWA 2WONB 3SFUA 1ZA1B 1YBUA 2A6MA 1RKJA 2YPZA 1H41A 2QCMA 1BSLA 2IJRA 4A8XA 1B99A 4KO0A 5FJ4A 4Q4QA 1Q8AA 1XF0A 2GGJA 1DIEA 3BSGA 3OYZA 2O0TA 4N4QA 3ZNUA 2ZUNA 2C2DA 3ICJA 3IVSA 3P6YC 4OJHA 2WZEA 1R43A 3O07A 1RWXB 2ZZ3A 4XZMX 3TYEA 1GVIA 1JRCA 3RDKA 2FZKB 2J9DA 2Z00A 4E5TA 4UTHA 4I6WA 1TZ7A 4MNLA 1ZTVA 2HGMA 1SQEA 1E1CA 3UWZA 1WORA 4J1OA 3WMSA 1L6WA 4DQPA 4E4UA 4KBXA 1UOZA 2WM0A 5F41A 4MHBA 1TCDA 1HWLA 3L4WA 5IBXA 4JIQA 1KXTA 1US3A 3M4HA 1VGAA 2LEPA 1GUVA 1G2EA 2WQPA 5KTQA 4LRTA 2RUGA 2V50A 1P0NA 2O01C 2UY2A 1RD5A 3KBSA 3T81A 2FLNA 3PDNA 5CQGA 2TYSA 5E5NA 2O9TA 3STCA 3CMQA 1WJ9A 1N0UA 2XULA 2IPGA 3IS9B 1OB0A 1JLAB 1IV8A 1JZ4A 4O8AA 4NA1A 1RWWB 5IV3A 3DHPA 3U9IA 1UPPA 4UY85 5LJ5Y 2WVFA 5KETA 3W7QA 4IJCA 2Z2ZA 4S3FA 1C92A 2P53A 1MROA 3DXSX 1Q6RA 4ZLNA 1SU5A 4OFCA 4FOJA 2VBXA 2D0GA 2X0YA 4M24A 2DT0A 3BPWA 4NQ1A 1DWGM 3LAMA 1CGXA 3LUTA 2X30A 5KFEA 1GOXA 4OV6A 4D8ZA 1IKXB 2NLWA 2VZTA 3M2VA 1UD3A 5JMUA 3ISND 4HNOA 2L9DA 1ONXA 3PYDA 3WUEA 1H2JA 4L3NA 1S1PA 2CNKB 2GGPA 3NS6A 2A21A 1QW9A 1PV8A 2XSFA 1E0XA 2DIVA 1PYMA 2OZTA 1SV5B 4HI1A 4N5SA 2V5HG 5G4DA 1TUGB 3APYA 1JDDA 4QRNA 2XO6A 2K7KA 2LEAA 3PEHA 4C6LA 3AO0A 5FESA 1XDMA 4PMJA 4MJMA 4LOCA 1UROA 3GCXP 3TCEA 2AKZA 2HFZA 1NDZA 1B3VA 2VQUA 1KFEA 4ZO8A 2HVEA 2PC6A 2GGEA 4UZSA 3WH5A 2XY5A 4NZ1A 1BRLB 2VZUA 3HHKA 4S39A 1WTFA 5I3PA 1S1UA 1K9FA 2IW0A 4OQJA 3CO0P 4NOHA 4DBDA 5ETNA 1WV2A 3NXFA 1YHTA 1YNQA 4LUJA 2G0IA 3B06A 3S4TA 3IARA 4MDPA 5LNUA 4R5PB 3S8HA 4X65J 3UCQA 2VICA 4AFFA 4HMCA 1RA5A 5EA9A 3MOJB 4D6EA 4OI4A 2WCAA 1C1CA 3EX6A 1CJKB 7A3HA 3GSDA 1GOOA 2CZVC 4JDBA 4A29A 5IM0A 1FNXH 3Q8UA 3RCYA 3U48A 3BQ2A 4Z1AA 5M03A 3POTA 1EPXA 1RAEB 1YITS 4KF1A 3BVJA 3WQVA 3FV9A 1JJHA 1TAQA 5GADU 2IA6A 4PWDB 3W0KA 4EZ6A 3HPXA 1M04A 4OZ3A 3UVIA 4EAYA 2CKWA 3VFLA 4JEJA 1OO0B 1E6YB 3M9YA 2GO8A 1JL8A 4TY8B 4YR2A 3N6QA 2YCLB 2WSPA 4LTSA 2C2MB 2LFVA 5JQ9A 1JYWA 3H20A 2V3GA 2O4MA 1TV2A 4XV0A 3DI0A 2D3UA 1FWWA 4CIOA 5CD4H 1KNZA 3RLHA 3P93A 2YOCA 4CZCA 2E0PA 1S57A 2XNQA 3GV5B 2YKQA 1MDRA 4LFCJ 1B4KA 4Q8MA 2IMWP 4JI2J 4LUTA 3HSJA 3ITCA 1GVYA 1B3ZA 3NG8A 4FYXB 2QA4G 2VDGA 2M2BA 4DU8A 3JZEA 1V02A 4PYSA 1MMFA 1OFPA 3KWXA 4YL2A 1C8VA 1N52B 2HIQA 4DL7A 4DQWA 5CPTA 4F9JA 1TK5A 4MFDA 5HNUA 1QPNA 4YY3J 4U3CA 1ME8A 5A69A 1FHLA 3L23A 3T2OA 3NCPA 4ES2A 4OYAA 4DZHA 2MZRA 1HP5A 5L1IA 4KETA 1TIMA 3IACA 3B8IA 4O4RA 2RU3A 3E38A 4DR5J 1NELA 2GHVC 3ABRA 4QIUA 4MYUA 1RE1B 3ONBA 1SJBA 2W9CA 3NIYA 3IC1A 4CD8A 4P7NA 2JGQA 3DU5A 2B0MA 2XNRA 1BGGA 1HNWJ 2VFDA 2A7NA 1HQUB 1WOSA 1YBAA 4GJ1A 4YNGA 5SUHA 3A4XA 1F4AA 1L3UA 1RPKA 2FGBA 4C98A 3OR1A 4LV4A 4KE5A 1Q6FA 4K36A 1EX1A 1GMVA 3K1GA 3NGUA 2Y62A 3KLGB 3DDMA 4LYKA 5LA1A 4ENOA 3DLLQ 1H51A 3TQVA 2L08A 1VQLS 3O1LA 4XIMA 4IMDA 3RU8X 3VAJA 1IXKA 4A21A 3MUTP 2VBZA 2W8KA 1KBRA 3SCRA 3K0JA 1M0SA 1DQ9A 5PTDA 3S2LA 4H2CA 4L73A 3ZVHA 3ENQA 2R7QA 1RP9A 1S39A 3TYCA 1RY0A 2GGHA 4DIAA 1SZGA 1Y5WA 3H12A 1EZZB 4HBKA 3UR2A 4DUXA 4TIMA 6REQB 4DSIA 2UUBF 4V2XA 2YWKA 2PDQA 2GJRA 1RV8A 4NLUA 4Y2WA 1HD1A 4W8BA 4UB9A 2NUWA 4KTQA 3UW1A 3Q23A 1JQVA 2G4BA 3S2JA 3W7PA 1W26A 3A5FA 3LRLA 1LQ0A 2Y1JA 1Q78A 2W79A 2WMFA 3T0CA 3KBJA 3KRZA 4FB7A 2QLXA 1VRTA 1DP0A 3C66A 3CHEA 5F8GA 4O0ZA 3VIPA 4DL5A 2KVQE 3U3HA 1WKFA 3EX4A 3LP0A 1FFRA 3W22A 1MWQA 3MW7A 5H91A 3W70A 2VOMA 2VFGA 4AZHA 5CCZA 2YKKA 4ADSA 1NDKA 4NZ4A 1JFXA 1HA1A 2GMJA 1VRUA 3TC7A 4IOAQ 1WZLA 2AJQA 1UB3A 2P5NA 4FXVA 1GVOA 3C19A 1HJQA 3SGGA 3QJAA 3PX6A 1GGOA 1OWQA 3M0KA 3JZUA 1SL0A 4KHRA 1Q6QA 1QNSA 2CQBA 3M46A 4L1GA 2MLXA 2F61A 4WZHA 4QWDA 5AJ3J 5M2FX 2EXOA 3L95X 4PG7A 4IRDA 1O1ZA 4GIAA 2OPRA 3E2EA 1X8FA 2CU0A 1TPEA 3KXDA 3QT8A 1KQFB 4LY8A 3W37A 1BYBA 4KGJA 3EGWB 3QR0A 1A7GE 3DOLA 3HSDA 3VGGA 3ES8A 1VBGA 3RBEA 3KKFA 1HBUA 2W4XA 2QL5B 4M63A 4CO5A 1HL8A 4B9MA 2MB0B 4JBRA 4OE7A 3CUNA 3IUDA 1W1YA 3JQMA 3KLEA 2EBGA 1IUJA 4LX4A 2PWGA 2YPIA 2A3CA 1LDCA 1UC5A 3BLFA 1C0UB 2OTLS 1M1BA 2V5KA 1H1YA 4X66J 3NM1A 4PG6A 2MLZA 1K9TA 4OV9A 3D1OA 2QMKA 3UP8A 4ZPDA 2HMCA 1VCVA 5E3QA 2DV0A 2ZX9A 3BGOP 5C9RA 3VXGA 4AH7A 4NEZA 3LGEA 2QCLA 2CKRA 5GNXA 3DCAA 1VYSX 2XIMA 1WXJA 1FESA 2OPSA 2GAGC 3J81j 1TV5A 3SCJE 2DKOB 3MMDA 1J96A 2J9XA 2NX3A 2VRQA 2GDQA 3MJYA 1RWKB 1NHKL 4RE4A 1V3SA 5A76A 3VZZA 2CQ0A 3VAGA 1GJUA 5IDIA 4F40A 1Y4ZB 1N34F 3GYGA 2YFNA 3W60A 5ECUA 2GUUA 5A6TC 3KDNA 1J18A 2MHNA 1WOBA 3TN3A 5DG8A 2QR6A 1XMQF 3AB2B 1EBHA 3QC3A 3HFKA 4B3RJ 3BLOA 3PG9A 5DRIA 3WDRA 3W82A 1NK6A 3NL2A 3GV7B 1D3CA 3MEKA 2KT5A 2C3PA 3PJUA 4ONVA 2PGCA 2IYIA 3TTSA 3MMBA 3P45B 2ZZ5A 3WNNA 5F8LA 5HROB 4J5OA 1VBHA 1QASA 2E68A 3CQJA 3Q94A 3VGDA 5J2PA 3CPWR 1F3XA 4V15A 1AD4A 1LWHA 4O3QA 1W8SA 2WCXA 5F8NA 4LUIA 1TQJA 1S59A 3I5BA 3X1LB 2H9AB 3TWAA 4E2VA 4B3TF 4ZOSA 3CV7A 2NXEA 1J2BA 2QC3A 1SR9A 1RBAA 2QLYA 2BY0A 3TW0A 3BJTA 4A47A 2BY3A 2MTLA 2OHDA 5E41A 2PDYA 2Z1BA 3M4XA 2CPFA 4RDZA 5LIKX 5SZTA 3HHLA 1UAWA 4NI2B 4I7WA 4QWCA 5CLTA 1GKPA 2XIBA 4ZVTB 2GVYA 4KJIA 4IFKB 1LJYA 2RH9A 4QDWA 1LK5A 2ZX5A 4Q4OA 1PX3A 5JUMA 4Q4KA 2QMXA 4RNFA 2GV1A 2EBNA 1K70A 3PC0A 3Q65A 5M1TA 4AAJA 3PSWA 2PEBA 1NPRA 5AT1B 1CW2A 2J79A 2X2YA 1TKDA 4G56A 5D0RA 4ZP7A 3GFYA 1V79A 3V0TA 1CS4B 5ETKA 2XGZA 5A6MA 3P4UB 2YNGB 3RU0A 4BWLA 1J5TA 3PZMA 4F3HA 1XIIA 3KK3A 4AY8A 3V81A 3VAVA 4HPGA 3BG3A 1F9FA 1I45A 4U7UK 2H3DA 2DY9A 5D3GA 4JX5A 4CTAA 3TVZA 5GAGI 4AZIA 2MNRA 2OLHA 2PTDA 3TAOA 2EK6A 3NCQA 4DM2A 2E09A 3WLLA 1S0OA 4DFMA 2VPYB 1RDRA 3HHEA 1EIYB 1E0VA 4Z42C 1TKTB 3PKMA 5CD4A 2KFZA 1MZHA 4Z2KA 2B9EA 3LTPA 4K5RA 5AE1A 5D02A 4O52A 3PBUA 4J9QA 4Z2XA 2VURA 4PG5A 3RAOA 1UWBB 3AUJA 2I1OA 1E6RA 1QMLA 1F73A 2FZ9A 3L4XA 1ZCOA 3MWAA 2W5FA 4BA0A 3S9YA 1LG2A 1J0IA 1E0WA 1VRQC 1S7HA 1WBJA 1GHSA 3ZTPA 4DJDD 3F4DA 1QDUB 1XRFA 2AX0A 3FHAA 3V35A 2J9YA 2F84A 3TN5A 5DO2A 1HNXF 4OYWA 4GIYA 1AFIA 2G4FA 2WBMA 3OQ2A 4DFJA 4EZ9A 1R47A 1H1NA 1L3VA 3RFAA 4J40A 4Q8PA 4KWOA 4Y8EA 2E7WA 1MQQA 3GXPA 4M7TA 2VP8A 2UXDF 3M0IA 4JY9A 1SBRA 2ZXDA 4Q7BA 5J1EA 3S47A 1I2PA 4JDYA 4CQCA 4LF6F 3BGUA 3EWZA 1ONRA 4FYYB 1VBZA 3W2LA 4HI2A 2WHMA 4DFKA 3MMJA 4JI5J 4XBJA 3GFHA 3CHVA 2IHR1 5CHCB 3SB0A 3GIPA 1VDHA 2NYHA 4H4MB 1UJ5A 4JI7F 3C16B 4ZE4A 3NR0A 4YP3A 5M5DA 1UD2A 1EJ7L 2OU4A 3TROA 3HCXA 4ICLB 3KP0A 4LJ3A 4AL5A 1J79A 4J9VA 3C0LA 3S1VA 2R4FA 4LS0A 2FYMA 2V5CA 3FDGA 2KZMA 2E44A 3G24A 3RCMA 4GMKA 4UMAA 3HD1A 4EEYA 3UZWA 3I7QA 3VDBA 3NPUA 5LXRA 7CGTA 2QLFB 3W9IA 2J88A 1SZFA 3LSCA 3L9ZA 3K13A 3DESA 4CM2A 3WDHA 5GPRA 1J5OA 1RK6A 2HQCA 1WBHA 4TQTA 1FKPA 2O5DA 4B4FA 2VX5A 2MGZA 2YVSA 1DQ8A 1QAPA 4KV8B 5K8OA 2P10A 4K7YA 3HURA 4IICA 3D0HE 3IBFB 4GVLA 5M2PA 4ZVGA 4GH3A 2R7SA 4KO0B 3HOJA 3AD8C 2UV8A 3FGVA 2MSSA 2GGIA 2AU0A 1LUCA 1HJXA 1N7KA 2MKKA 4GQQA 4P7RA 1UVNA 1K3UA 4FKYA 1CJTB 1NJXA 3N12A 3H4XA 1IZKA 4B02A 1JNRB 4XK2A 1MI3A 4O4VA 4OQVA 5CAKA 1X7VA 2WSFC 1FWRA 1EL3A 1FBAA 2WPBA 5A6BD 3R6LB 2B7CB 1E1CB 1AQFA 3AMCA 2PU1A 4FF2A 4ILLA 3BO9A 1WOOA 3MURP 4XAKA 3GCWP 3L2MA 3A12A 3T08A 1ZLPA 1I1XA 3V5RA 3RO6A 1RISA 3QY7A 2KT2A 1XKYA 2IKIA 2J6VA 3AS3A 1ZY9A 2C13A 3R0DA 2PRMA 3SCOA 4ED8A 1O51A 4J7RA 2QDGA 3DZ1A 3CF5Q 3K5OA 1FDNA 2IAJB 3CBWA 5KT6A 4NJIA 3SCVA 1NB2A 3M30A 3GIIA 1MZRA 3W7GA 1D3HA 3RPTA 4FLSA 4DXKA 1TVRB 3C8YA 4D8LA 3APTA 1VJSA 3IGHX 4GKJF 4NVTA 1MROB 2RHQB 4Y3CA 3G71S 2E4TA 4O11A 4LRFA 4PMVA 4L6HA 1IKYA 1Q8LA 2PI6A 2HXUA 1V6WA 4RW8A 3VIOA 4EXBA 4TTGA 3LAKA 3VR1A 3M2VB 7REQA 2KDOA 3BSCA 2DZUA 4HYWA 2RRAA 3OVQA 3ITXA 3RGTA 1WKDA 4J9NA 5D9OA 2R9LA 2NV2A 3ARWA 4QR6A 2K3IA 3DX5A 2GGPB 2VBWA 4RW7B 1OK6A 2B4PA 3V6DA 8RUCA 2V34A 2QMWA 1VLIA 2W01A 3CEUA 5KT7A 2VFUA 1NSJA 1TE1A 1A4LA 2ZYFA 1WF1A 1DVJA 1I51B 2R1LA 3IIZA 2RH3A 5CSUA 4N42A 2OSWA 1GQIA 2FPVA 4YVVA 4JYDA 3ETMA 2DHHA 2YH1A 2B31A 1PO6A 1I2NA 3IWPA 3KE0A 3TZXA 5B0DA 5CSRA 2UZ9A 3IK4A 4UOHA 3ITGA 4HH1A 2YA2A 3A22A 4NEYA 1ZZFA 5E1QA 1F4HA 2B56A 4IG2B 5A1AA 2ZUUA 4UY8T 4QR1A 1C9DA 2KN4A 1SJFA 2C19A 5CZXA 2DT2A 3FW6A 4AL6A 3WLPA 2WMIA 1B3XA 1T02A 1ZETA 2IKHA 1FXDA 2ROGA 2C15A 4L1WA 4AWSA 4CQ9A 9CGTA 4H9TA 1GPFA 4QLKA 3KNGA 4LQ9A 1Q5YA 4OX8A 4URSA 2BVZA 4TU8A 3M9MB 4U31A 5LGZA 4K68A 1H49A 1CEZA 1SFJA 1UWUA 4FKXA 5IM0B 4JGDA 2VDHA 3GTYX 3WK0A 1TPUA 5K5MA 1GONA 3UI3A 2B0GA 1JIHA 3NSMA 5I3UA 4JI4F 5HBMA 1XC6A 4TTUA 3BO2A 3CTLA 2VBYA 3DHWC 5E0KA 2G3IA 3L4ZA 4LNCA 3PZGA 5B0CA 1M7XA 5L8RC 5HINA 1YXDA 5HUPA 1KV8A 2FH8A 1JJKA 3PNUA 4XSMA 3HVTB 3EEGA 4NZFA 3JAMU 4L1XA 4A8YA 1R6WA 3AHPA 5DFAA 1Q5MA 2ZUTA 3P5TL 2GVDB 4JYFA 3TU9A 4M19A 4INFA 2EJAA 5T41A 4Q8QA 2F9DA 1DXIA 1V5XA 3NGRA 3S1UA 4CLYA 4RX6A 4X62F 3MUAA 4IFYB 5AC6A 2G37A 1BWEA 4RR5A 3O3RA 1OPIA 4GC7A 3IRSA 2GIQA 1KC7A 1LRTA 1UMJA 1S1VB 4HCHA 3N25A 4JCLA 4DFPA 2ZE2A 3EMZA 5HMEA 1OF6A 5A94A 3UBPC 3NURA 1XIFA 3PS7A 4YR3A 3R9LA 2FHOB 2DK2A 1REQB 2X3DA 4OX7A 6TAAA 1UR8A 4ZVRB 1YQHA 4IQJA 1ZAHA 3AY0A 1XPYA 1QTNB 5DS7A 1WO2A 4TKTA 1CXFA 1LRNA 2Q3OA 3EZOA 4H9MA 3FJLA 5FA5A 2F63A 1ZRQA 3F56A 1NU4A 2KI2A 3IN5A 4PMOA 4C9DA 2BY2A 2XISA 2PS2A 3FYPA 1A49A 1WQ5A 2FHKA 4KW2A 4Y9PA 1U6BA 1S97A 4HMEA 5KFQA 4J35A 4XIAA 1PJ5A 3HPOA 2Z1VA 5C54A 1PBUA 1RABB 4LCQA 3OR1B 3IJ7A 2HCVA 2VR5A 2CPYA 2WZMA 3NBPA 2R91A 2VCBA 4KR0B 1IR2A 3PIPQ 1X6UA 4M6UA 2CA9A 4HK6A 4EE9A 4MZYA 2DVUA 3I31A 4RLIA 1JZ5A 2GJPA 2YCJA 3QRHA 2X1AA 5HJLA 3SDOA 1H2TZ 1S1WB 4J9SA 2X1RA 5FJTA 3NGTA 1ZUAX 4R34A 4CDIA 3TDFA 2JOQA 2OPJA 3WELA 5GQBA 3SBFA 2HS3A 4KQZA 2J9EA 1Q85A 4F9DA 4PRRA 3D6FB 5AC4A 3DKLA 3GIRA 4WY0A 2NV1A 1NB7A 3CW2C 1BG4A 1WKEA 1OCQA 5FOOA 3CDEA 3UWEA 1C2PA 3IRWP 1OJ4A 1XV8A 4Y9OA 2XN2A 3SCTA 1IQTA 4G1QA 1KN6A 1BKHA 5E6ZA 1YJ9S 5JVGQ 3C2EA 3GDRA 4P75A 4U3AA 1W3IA 2C2KB 2J4GA 2DDXA 1NK8A 4JTTA 4IR9A 5FF0A 4WKAA 3PHAA 3A3HA 3TN4A 4V19J 2ZWZA 4I56A 1ZQ5A 3JYTA 3KTQA 3PZVA 3QHOA 3PHTA 3Q86A 1I0DA 3P80A 5GJNA 1QTMA 1CI1A 2U2FA 3TSDA 3TYDA 3UR7A 2GIRA 2YWWA 3MAAA 2B9YA 1TKXA 2UU9F 3OGVA 3ZTQA 1GVRA 4MGGA 4B9NA 1VRUB 2CLPA 4YU1A 4MB5A 4O16A 4Y2IA 4FAMA 4A8OA 3N6JA 4QLLA 3QVQA 3BG5A 3NNTA 3TR2A 2KL8A 3TVAA 5FEXA 2XYHB 4XKYA 3R94A 4M5HA 2R2RA 2R1KA 2XN1A 2FHMA 1G6CA 4LALA 3E0LA 1HMVA 4YB5A 4ERAA 2PTWA 2PMHA 4MK7A 4DLFA 2J66A 3NPWA 2ROEA 4RL1A 3M2UA 4HK5A 4P7QA 4JN7A 4BF9A 2G1DA 1K9MT 4M7SA 3TEVA 1FX4A 1WDTA 1WNOA 2HNDA 2XH2A 3S2NA 3R5JB 3CJSA 3IR5B 3L2LA 2HHHJ 4U2YA 3PTDA 1AK5A 1OYEA 4LAUA 1SPQA 1R3YA 3M44A 2M8DB 3G0UA 4XZLX 2VUYA 1S9GA 3RU6A 1CBKA 3ANUA 3DH7A 4AIBA 2NVCA 3BR9A 1T8EA 1CGWA 3WD3A 5I6SA 4HNTA 3AB4B 4AMAA 1HI1A 5E3CA 3VGUA 5CZKA 4DO7A 2DGUA 2ZE3A 3PZQA 1DTTA 1N32F 4CNPA 3D1HA 5CGTA 4H4KC 5A8QA 2P50A 2ABAA 1E43A 3L4YA 5DANA 4PWWA 1XXXA 5IV4A 2GCFA 2Q3PA 3H2FA 3WG6A 2XLKA 2OTDA 1UUQA 1U24A 2AJ1A 1CIUA 4P7TA 4RKUC 3CEDA 1EA9C 2CLLA 3GNDA 4C48A 3ZT5A 1U83A 3NO3A 4DJFD 3TE9A 1R8LA 2AL1A 3JRKA 2AMGA 3T5JA 2BQ3A 4ED6A 2O7QA 4X0VA 2YDRA 4RBVA 3NAVA 4QDPA 1IBKF 1IR0A 5EMJA 2JL9A 5FDLB 3GIMA 4NLPA 3OHAA 3E74A 5I3FA 1FJCA 1QAYA 3VNJA 3MFIA 3AWNA 1FJEB 3ME3A 2PRHA 3TYBA 4RNJA 2OCZA 3MMUA 4JHOA 5K3VA 4OYPA 4WFYA 5K8MA 1Y0HA 2AAMA 4ED1A 3OT9A 1JULA 4DSEA 3DI6B 2YKNB 3W2WB 4OWGA 1SH2A 4A3YA 4JIRA 1EAYC 2XM2A 2KRRA 4AYGA 5CBIA 1E72M 1S6QA 3KVKA 3OZPA 3CS2A 4BQ5A 1AZ2A 3KUEA 1UQYA 3PPFA 3I5CA 3KWSA 2WVTA 1EFZA 2Z2LA 4WDUA 4UR9A 2Y70A 2YB4A 1WOPA 2X16A 3FSYA 3LXCA 3EXTA 1Q7LB 4TY9A 2YBUA 4TU7A 2ADCA 4S38A 1NHUA 4KPCA 4F8RA 1T05A 1GQJA 3ANVA 1BTMA 3OBEA 1POJA 4CNUA 1CXEA 1WUUA 1CNVA 5ENLA 2Z58B 5I23A 3C3NA 3UQNA 3AA8A 1IVZA 4D3HA 2YA0A 4I0WA 3G6YA 2A4AA 5D4YA 2HS4A 1Z41A 3QTGA 2NXIA 2PWUA 2H5JB 5DMMA 3UXKA 1FK9B 4LBIA 1FO1A 2G3MA 3KUMA 5J5RA 3WQEA 4PEEA 2DJWA 3U8GA 4DCPB 1G5AA 1ME9A 2OEMA 1G94A 1UCWA 1UBPC 3HGJA 4KWSA 5LM7E 4A2SA 1Q7ZA 3G77A 3UYIA 5B7YA 2YCEA 5A8KB 4NX0A 4OV4A 4QG8A 2KHDA 1S9EA 1B9ZA 2XYLA 4IOCQ 3FNNA 3TA9A 4K8RA 3EPMA 1OMSA 5CC3A 1O66A 5AYIA 3CQIA 3UYCA 1QUPA 1TIWA 3RBDA 4K8HA 1UWRA 3QPIA 4PUNA 2AD9A 2QV4A 3ZJ7A 4I4BA 2HSAA 1XLAA 1A5KC 1NXIA 1U7LA 4OYOA 3THAA 3V81B 3R97A 2DJXA 4C60A 1ZYQA 1KO0A 3AIWA 3BOXA 3GP9A 3ALFA 4B15A 3HLUA 5DG7A 3PW2A 4YDDB 2Z24A 2Z7KA 3PP7A 5B08A 4M95A 5F9NA 4WK1A 1YK9A 2YKMA 2H8ZA 3FAWA 4N9DA 5RUBA 2GJNA 3NS7B 3NQAA 3RUBL 4AEEA 3KJQB 1FVQA 4JI1J 4KRUA 3PJXA 3LCIA 2MQMA 5KT2A 3UGRA 3KRSA 3EXYA 5IS2A 2HHSA 4NZ6A 4BCEA 3V16A 1KXVA 1EC8A 5HJYA 4QP0A 4GVFA 1CXLA 1TQLA 4F67A 3IA0A 1TPFA 3GBDA 1Y9OA 1J5SA 1CBGA 2YYTA 4KAIA 5EBUA 5JVHQ 1X4DA 4C11A 2DORA 1NDVA 3ORWA 3K2YA 1DBTA 3SCIE 5FF3A 3W7MA 3D6HB 1X4BA 2V2CA 3ZTRA 2ZZ6A 1GQNA 3ZT7A 5TNVA 3L5AA 1VQ7S 1J0ZA 1TTJA 2FGZA 2DZVA 4WXOA 3P7YA 3MP3A 2UXCF 5EPDA 2PPGA 3U2CA 1FTXA 1F3FA 3IR7B 2VFRA 4AL7A 4LF7F 3DFPA 2FVLA 2OEKA 3O63A 4LB3A 3NAHA 4JX6A 1V08A 2IKJA 2BANA 2WB4A 1VBYA 1KVIA 3CL6A 1FHDA 3W01A 3PXGa 5C7VA 3QV8A 3MF5A 2VPWB 5CGMA 4PXEA 4CU7A 4M5KA 1VC5A 2MZSA 3CD7A 2ZRZA 1YQ2A 4ZIWA 2MUCA 1QM9A 3MTJA 3F44A 2JVOA 3BLIA 3DENA 3NEKA 3R1HA 2YDAA 2NQPA 3TTOA 3H22A 4ZVJA 2NYIA 1XIDA 5I3GA 1Q6GA 3E6EA 4AZ5A 2CVIA 4G7FA 1EP3A 1YRUA 4PULA 1YJTA 3C2RA 3NGSA 3MM9B 1E40A 2OWXA 3IEBA 2UY3A 2MLYA 4DPUA 3C56A 4GO7X 3TA1A 3FXGA 1SO3A 3VIHA 1FJ7A 1OFAA 1HJSA 3GZ7A 1P6BA 5KG0A 5DMLA 2R7RA 2FUG9 5KFKA 1L3SA 5HA7A 4MKVA 2V81A 5HPOA 2OO6A 1E4LA 1XERA 2VX7A 4DV0F 5DZ6A 3TR9A 3N11A 3NVTA 4ETXA 4NLQA 4R25A 1LUCB 2Q09A 1A5CA 1FQ0A 3AXXA 1E6NA 4FX7A 4DI8A 5DRKA 5T7LB 3A47A 5KFVA 4KESA 4ZMMA 5A3HA 2Z26A 1N33F 1O60A 2IPJA 4USKA 3BN7A 4PCTA 4XAZA 2P9GA 1GPWA 1S6PB 3HKWA 3ILIA 3AJXA 3PR2A 3BBFA 5JXSA 2NW0A 2B7OA 3WX7A 1D3GA 1JLBA 5M2RA 1KSPA 4F25A 3PZNA 1VH7A 2FVQA 3GKAA 2QSFA 1TELA 4UFMA 4WKHA 1T7LA 3WL0A 4W9TA 1RK5A 1NCLA 3D9BA 5U7SA 1VC0A 3AU6A 4IOBA 4CP5A 2IPWA 4IKAA 4DWSA 2WHJA 2DXFA 4FX6M 1OC6A 4C6JA 2QYCA 2ABYA 2V8GA 4QAWA 2MYFA 4LVFA 1HNXJ 1OYDA 3AIBA 3GS6A 1HWUA 2BOAA 4PFMA 5EDWA 1DJYA 1N5QA 1RQ0A 4MWAA 4BEUA 4N56A 2JFKA 1T03A 3J80U 1Y0EA 5DGBA 1V3KA 1VIOA 1W3JA 2JEFA 4RW8B 1IXPA 3R8GA 4ZFMA 2PDHA 3OBKA 4CNOA 5KG2A 3GR8A 2XHCA 1X6LA 2G95A 1R3RA 2JE8A 3P3BA 3LPPA 2EJ1A 2PSNA 5LL6d 3W1LA 3UD4P 4JIHA 3MC5A 3VOCA 4NAFA 3A5VA 1ML1A 1H5YA 1G4SA 3BJFA 1LQ2A 1R7OA 3D46A 2XMTA 1UA0A 5C9XA 5I79A 1US0A 2XMMA 5BOOA 8XIMA 4JI7J 3CB8A 3OU8A 4LY4A 2HMIA 1C7TA 1TKZA 3M8QA 1MG7A 1LW2B 3W7KA 1PWMA 2CZ4A 2RJZA 3SV4A 2OG9A 4I9TA 5IM51 3PRBA 4DPTA 4JTQA 1U45A 4NJJA 4P8XA 1HW8A 3CZLA 3FFSA 2E9ZA 4HR2A 3DHFA 4HHMA 3TYTA 2XHWA 1TWIA 4U10A 2GZOA 1T99A 3Q8QB 1BPLB 4ZN1A 1J0KA 3CMFA 2NQ9A 1VBUA 4JQ2A 1UVLA 1BXCA 1RTJA 1BWVA 2Z8QA 2ZUAA 4HNVA 2AL2A 3MUIA 4UTKA 3S5OA 4ES4A 4PXDA 3PR4A 1JMTA 2HQ3A 2IPFA 4M5LA 2V4RA 1O6IA 3VCRA 4QWEA 3O6CA 4K4SA 3KL3A 1GG0A 1RJJA 4MAZA 3K8MA 2WMIB 4KSEB 2DXEA 3VKDA 5CPNA 3V4IA 1R8AA 2GYIA 3D0GE 4HQVA 4BZYA 2OGYA 1GVFA 2C1IA 1PBAA 2ZM6F 4QOTA 2WKGA 3CJPA 2JH3A 1VF8A 1N5YB 1SQ7A 3VVTA 2GJIA 4O12A 4Q7NA 1IKVA 3CJKA 5I3UB 5BU6A 2OFHX 5HBMB 1WWHA 2WSQA 3HG4A 2DZSA 1IBMJ 5HNNA 2IQ0A 3KLHB 3I7RA 4CO2A 1NK4A 4WE1A 4LSNA 5E0OA 3MZNA 1HKWA 3UF9A 3H23A 5AHLA 3QFHA 3AIRA 4UFHA 4L4PA 3RRXA 3UGVA 3RRAA 3ID7A 4KH0B 4FS1A 1GJPA 4YTTA 1T94A 1BQMA 1CT5A 4IL2A 2D23A 4DPPA 4JKMA 5DLFA 2ZNYA 2PIIA 1H7NA 1FWFC 3R10A 4GKKF 2BOGX 2AYMA 1IXOA 4BBYA 4YCPA 2CJQA 1B57A 2DXDA 1I94F 4A35A 1ZM2A 4GKJJ 3LP1A 4HDHA 1VEOA 4HTBA 3W3OA 1I5OB 1H1ZA 4WKRA 1KR0A 2OGJA 1CQMA 2YQ0A 2VX4A 1IEQA 1ZFJA 1HKIA 1K77A 2Y8VA 3KHDA 3T42A 2P9CA 4XQ6A 1ADSA 2YCKX 3MP5A 3TMLA 3LNMA 3USZA 1HQTA 5DT7A 3O8AA 2D2OA 3LCLA 1KKHA 2ZD1B 3R0UA 1PKMA 2BACA 1CSJA 2AQOA 2G97A 3S6OA 1HR0F 4QNWA 1W1PA 5EHHA 1IWAA 3PZOA 2BKNA 4LF9J 1PIEA 1YTKA 2Q79A 5MKGA 4PC8A 3UVAA 1I9CB 3GHUA 4FPSA 2XM3A 4AQYJ 1F0XA 2DD8S 2CW6A 2FPHX 4ED5A 3H54A 2V5LA 3GIJA 3BOFA 5BROA 3T1YF 1PSCA 3B4DA 3V2UC 2PZ0A 1WNEA 3N4WA 4PFHA 4GXWA 2X42A 1TTQA 1FKOB 4W7WA 1S76D 1B0VA 4Y9MA 2DIUA 3LCXA 4AWUA 2HK3A 3NOYA 5I42B 4IG3B 2W3ZA 4CLKA 3I6TA 2E1RA 3TWBA 1JLQB 4ZKAA 1IQ8A 2VC9A 4AVNA 1UD8A 2ZXAA 4QQ3A 5J2MA 3G3DA 2PGFA 4OJYA 2PBGA 4WY0B 1UKOA 3GU2A 4NZCA 2PC8A 1LL6A 4A8NA 1Y3JA 3OLGA 5CPLA 2AX1A 4ZMGA 3QR1A 5XIAA 3HPZA 4O1FA 2OXNA 3N29A 2VQTA 3VVGA 5C7PA 2JC1A 4GZ7A 5CC6A 4TYBA 4GXPA 4LUSB 2GDUA 4ZCWA 4F0KA 2I5JA 3WLJA 3O6QA 3ICLA 4BY3A 3H70A 4OZ5A 4NJGA 2VPZB 2DEPA 1ZOTA 5HQLA 4ECZA 1K7XA 2RIJA 4NZ5A 1KM4A 3B6BA 5IT9U 2G2OA 1IBLF 3JYTB 3MI3A 3UR8A 2QT3A 2CLKA 3GWCA 1E0UA 4HT3A 1RU2A 1HO4A 3IV8A 4D8AA 3QT7A 3QM3A 3TA6A 2TODA 3NQCA 2X1GA 3P6LA 2XVLA 1HNYA 2BP1A 5FJRA 2V0TA 3DRPB 4RNHA 3W07A 2XYPB 1X38A 4MTVA 2IJFA 2C0HA 4X62J 3AQOA 1EQMA 2HRUA 3IRXB 4XKYB 2ZWYA 2GK1B 3OLIA 3W7OA 2MKCA 5D2VA 1Q82T 3G1VA 2J7FA 3BE7A 1CCWB 3ZJKA 1HMVB 3MD1A 1OX5A 2PDPA 5CBBA 3LBMA 3FVDA 4RV3A 3M2UB 1VRXA 3E0FA 1JF6A 1HNVB 1IEVA 2M5YA 5F1VA 3T6JA 1ZTWA 3KFTA 2OZ0A 2Z4GA 1GEHA 2E8ZA 2D9PA 2INZA 4YLWA 1B90A 2J9CA 1YJRA 2DUXA 5B0BA 3P67A 4NHVA 5A8NA 1S9GB 3OIXA 3MYPA 2P88A 1TL7A 2AOSA 2J7KA 1JNDA 4OZ0A 4DV1J 1Z89A 4JIPA 3W4RA 1BE4A 3TQ1A 3C2PA 3IJ9A 4EWND 2C2NA 4Q8OA 1XSJA 3EX7B 3M7SA 1E6XM 2QS8A 3VD3A 2FJAB 2IPOB 4PG8A 4C6AA 3DLKB 5CCLA 4MFEA 4R8UA 2YKOA 4ANCA 3SSRA 3CQHA 3EZUA 2ACYA 1GFWB 4F4WA 2BODX 3FDKA 5CPOA 1YIJS 2PB1A 4F8XA 1XLBA 2QIWA 4YYFA 3DBNA 5L39A 5HDRA 3AZRA 4ZLPA 4Q44A 2LXUA 5KFPA 2PCQA 3QAEA 2KB2A 1RLDA 1X4EA 1S2CA 2IVFB 1Q45A 4X64F 1CGVA 3LHVA 3K5PA 1OD8A 7TAAA 3QBCA 2GHPA 2OMAA 1Y5VA 3W76A 3CZGA 3EWXA 1ENUA 3VA8A 3GC5A 5L1JA 3GG1A 4CN1A 4U7UD 3WF4A 3PUGA 3IAS9 4IYQA 1U1NA 3B0UX 1WD6A 4O0NA 3CZEA 1X8DA 2Y8WA 2CITA 4HB7A 4HU0A 1PTDA 2ODOA 4EU0A 4GYPA 1HWJA 3PBVA 1J0JA 4XAPA 3L0NA 1C8QA 3G1DA 4HYVA 5LHFA 3WNKA 4OZNA 1M5PC 1CULA 1PZ0A 3TFXA 1W1A1 3PUEA 3TC6A 3UNGC 1H7WA 3ETOA 2XZTB 3TOYA 3M8SA 1FJGJ 4OVXA 2CFFA 2QGHA 3PJTA 3QPYA 3HJZA 5A2BA 1S6QB 1KRCC 1VHNA 1H0IA 2I8EA 5TD4A 2A3LA 1R85A 5LOQA 4ZB0A 4WKYA 3G1FA 4GQRA 1A3HA 4OX9J 1WC0A 4I2PB 2QJIA 2HZGA 3NQBA 1U2YA 4FXWA 1F2GA 5LMUF 3QFWA 2RKIB 4CO3A 3GDMA 2DQWA 3WQFA 1F8IA 4S3JA 2CG8A 2LA6A 2RDXA 2BHZA 2EG7A 1KCXA 4IJBA 4CVWA 3M8ZA 3MQTA 2YLAA 3C8NA 2XU2A 3P5YA 2LECA 1Q16B 2PBOA 2RUSA 3IAQA 3UO0A 5F8HA 3PY8A 4JTKA 1U1PA 3CWOX 1VFOA 2ZX6A 4HKQA 3SQMA 2XZWA 4W8AA 3VIMA 4D3GA 2XZ7A 4GQBA 2QTWA 4HLBA 5CCMA 2HQFA 5FEZA 4S0MA 1YADA 4CQAA 4BI7A 4GUFA 4DJEA 1TFWA 3RXZA 3BAJA 3M8RA 4IRKA 2DNKA 4B17A 1CWYA 4FMVA 4URGA 3LV5A 3EA2A 4C8NA 1VFUA 2UVWA 3B9EA 1Z42A 3GK0A 3B40A 3PUOA 4XVDA 4YJ5A 2NX1A 2NT0A 5CSYA 1XWLA 4ID5A 3PNIA 1LWCA 4AEFA 4MMOA 2OI2A 4TN2A 3QMTA 2FJUB 1QK0A 1FWNA 3N6HA 2VF3A 5EGYA 4I7VA 3Q2DA 3UJ2A 3C14A 1UQZA 2DVIA 1D7FA 2PLKA 1JLCA 1EOMA 3ARZA 3ENWA 4W85A 4K8EA 2ZKUA 5E7OB 3HIJA 1RWOB 2IYGA 2HPIA 3AZSA 1A80A 2YKMB 2J7UA 4C7FA 3WKZA 4Z2LA 3GNPA 3B4YA 1QOXA 4ROQA 2ZBRA 1XUZA 3CGTA 4JI6F 4YQWA 2E1DA 4E0DA 5FEPA 1KGUA 2ONEA 1AH0A 1EGMA 4KIEA 2MXYA 4DR2F 3Q24A 5CKSA 3V5OA 4LF4J 3C6UB 1YTEA 2I1RA 3R2DJ 3TW7A 5KG7A 4DUWA 2FLPA 3W6MA 4IIGA 3QO9A 1OWXA 1EJSC 3W87A 1Z69A 2CESA 1XP3A 3EX2A 1RTDB 2HQDA 5AHIA 2VGFA 4GBUA 2P3ZA 4HGXA 1UH4A 4DBUA 2PN6A 3WIJA 5KT3A 4MY8A 1LL7A 4Z2IA 2NR0A 1O68A 2DZAA 4HSNA 1ZENA 3DLHA 4IR1A 3F4VA 2HBVA 4X4QA 3W71A 4AD2A 1NK5A 3EDJA 4RNIA 5HVFA 3Q45A 1TP7A 3GSIA 2OYKA 2JNJA 4JNZA 3GFXA 4IX2A 2NQLA 1F05A 3GSMA 1FWJC 4E4FA 4CLLA 2WCGA 4DUTA 1KFDA 2E5BA 3EOLA 3MUZ1 4X2RA 1VISA 3G8SA 2QJNA 3W9ZA 3BSMA 5G0RA 1XG3A 3PG8A 2XSJB 1E3XA 5C2XA 4GYKA 5K2ZA 2HNYA 1HFBA 3DMJB 1QW7A 3LPOA 2HHQA 4JR5A 1UJ6A 2FYXA 3NPVA 1QO2A 4AB4A 5HNRA 4Z7YA 2CYYA 1FCBA 2ZNZA 1KCLA 4PH6A 4C8OA 3EGJA 2A3AA 2XSXA 4B3OB 2YL5A 4RW6A 1GKRA 1TRIA 1XDLA 3QMQA 5KFJA 3LI1A 2VZ9A 1S5VA 2P6TA 2Z30B 2LP4A 1QDSA 3M2RB 4MK8A 2R24A 2JKPA 5A95A 3WEMA 1V3ZA 3Q58A 1HI0P 1SJ3P 2EVZA 2Z2AA 4MYAA 2OWWA 3AIEA 3D3BJ 1QNPA 1IYXA 1KHVA 4F2UA 3CNQP 2UVUA 4LF2A 2KAUC 2BM1A 5HR7A 4FBUA 3OO2A 4W4MA 3MAHA 1VEMA 3BGGA 1T96A 3KVJA 1C1BB 4PCSA 2AIRB 1DIOA 2BVWA 4ZCMA 3TYZA 4HDGA 3W7HA 1TJ0A 4IXXA 3KG1A 1ZGDA 2VEFA 4C6OA 4DPOA 3GHTA 4CD7A 1GH8A 3W73A 2FHCA 3EOOA 4KY3A 3HDSA 4QTGA 2PD5A 2OOFA 5GVJA 2A2DA 5G1YA 3VIJA 1DTUA 1NWUA 1D2KA 4EGLA 4AEOA 4RUAA 4NNCA 2RILA 3G96A 4ELTA 3AMLA 3JUGA 1HF6A 4GC6A 2D2GA 3Q4DA 2PWFA 3DLEA 2BB0A 4KEVA 4UOJA 2AJ0A 1EQPA 3DGRA 1DWIM 1ICQA 1NF0A 4UOZA 3ZWSA 1LLOA 4UMBA 1MN7A 1IM4A 5JU6A 1LWFA 4HNNA 3T0TA 3C2OA 4XD6A 4DR7F 4EACA 3T41A 4QIVA 5KFCA 1U5VA 2Z57B 4PYDA 1NHVA 1UZ4A 4M5PA 2QL7B 4M1KA 1BFNA 4ORMA 4MWAB 3WH9A 2ZA3A 2B5JB 2V5JA 3IANA 3HFVA 1T03B 2CERA 5BXIA 3CO9A 4R3UA 3KX6A 2PGWA 2VCCA 1XSIA 3HG3A 3THUA 1P7TA 3O2LA 3R3TA 4QJ3B 1VFMA 2A3HA 3E9AA 1TPC1 1XR7A 5IC4B 4DG1B 1NP0A 2WJZA 2NCKL 1RH9A 2OMLA 1CLFA 2Y88A 2HS6A 1GNKA 4NAFB 3SEPA 3K8KA 4LBPA 1SR0A 4B3LA 3LM7A 4AZCA 3O5TB 3JVAA 2CWNA 3IFEA 1HBOA 2HHVA 3M8QB 3Q2SC 1YJNS 4DN0A 4OJGA 1ZS6A 2ABBA 2RQMA 3T9ZA 4EI2A 1RYRA 4KCTA 1X5TA 3JTNA 1HQEA 1LOSA 1B3OA 1KW1A 2Z7GA 2VONA 2JWNA 1WF2A 2LYVA 1AJZA 1WC1A 1V02E 2VWSA 2YNIA 4BWJA 2AL2B 3IS4A 4O4WA 4H54A 5HO4A 2QVHA 4Y90A 1UVMA 3HHLD 4ZGYA 5IBXC 4YS1A 3XISA 3M32B 4ALDA 3OUYA 3PVXA 4A8LA 1N6QA 3KJVA 4MKSA 4MSSA 1KB3A 1W5NA 2F4FA 1J27A 1R0AA 3O1NA 4GNKB 4UOQA 5D04C 3P2VA 4X4TA 2J7WA 1KRAC 4O23A 4JTGA 3M7VA 5ABFA 3KYLA 2DZXA 5AVHA 2GQ2A 3EBVA 4OI6A 1W37A 3CJKB 4MB4A 1X1NA 1ODUA 1N33J 3E01A 2YDSA 1XCWA 2QMUB 4MJ2A 2KRBA 4KT2A 4DRSA 3E2SA 3N9RA 4PMDA 3MGJA 3UD6A 4CH0S 2WW8A 3MECA 2QUMA 2BX6A 3OL8A 2G41A 2R7TA 3HJEA 2VQFF 3IK2A 3IVTA 1FEEA 4DBQA 2GUYA 3DOMA 3VNZA 3I6RA 4CLMA 1SFTA 3VZIA 3VHQA 1LLZA 4U28A 5GAHU 1BQMB 3U02A 1X0FA 2ZJQQ 3KLFB 1ZJHA 1AODA 4DNMA 3N9SA 2Q8XA 5T9CE 3W1YC 1CJUA 3LXBA 1EC9A 4D71A 3J81Y 1XK8A 1XBYA 4I1TA 1DZ5A 2ZZ2A 2DNZA 3FBEA 4C7QA 2XJ7A 2M8HA 2PMZD 1OIFA 3QTPA 4IMFA 1U4BA 4GMEA 1DXEA 1CXIA 3M5XA 1JR1A 4Z7CA 4H83A 1BC6A 3AMDA 4LS1A 5L1KA 1A5AA 3CIWA 1RHUB 3FGCA 1JPKA 2NVDA 3EGNA 2ASLA 4Q4MA 3W2NA 3EJMA 3QIDA 4ECWA 3M0YA 3TAPA 1IGSA 3LI0A 4OHXA 3LA4A 1FCQA 4JEQA 1VYPX 1H5VA 1KM0A 2VYOA 4CNNA 8AT1B 4F2SA 4WXZA 2ESCA 4FOUA 1KTQA 1X4GA 2ZVSA 1JXJA 1SL1A 1UP3A 2DSKA 3VNIA 1WP6A 1A0OB 3VAIA 3NGFA 1AZSB 2Q02A 1GXUA 1OBAA 3GLJA 4WXWA 3P0WA 5A6BA 2KJVA 1QUMA 3DLGB 2F2HA 3QLLA 2RQCA 1UR2A 1NPKA 5K9DA 2OKOA 3ABQA 3W1AA 4KHPJ 3FDSA 1XLDA 1J0YA 3QSTA 3NL5A 2FDMA 2K1RA 3IO1A 3N1AA 5REQB 3QZ8A 2A5HA 3GTFA 5F8JA 3CL8A 1CZ1A 1F2HA 2KKHA 2OPQA 4DM1A 2RDWA 4NZJA 4CCZA 4O1DA 2E5IA 1Q5VA 2WVEA 5HWJA 5LIYX 2QT7A 1E70M 2FFIA 2DZWA 4Q8TA 4HL9A 3B9OA 1WPCA 3OJGA 1Q8IA 1PYOB 2ZWPA 3GE7A 1UMLA 3OFHA 3TUZC 2Q6BA 3F0NA 1KRMA 2H6RA 1U5JA 4CLPA 4JI0F 2M3DA 3OHMB 4K7QA 1ZL1A 1HW6A 3M5VA 4I6AA 5L38A 4CT9A 4PRFA 4LVOP 3W1QA 5KFUA 4LNYA 4O1EA 3BLEA 4NYOA 4USIA 1EP2A 1GZGA 4P71A 1Y00A 2CQDA 3PJ9A 3KTCA 3B0XA 3EZ4A 1E6VA 4QW9A 3VNDA 1WDDA 3LHYA 5F8IA 2OZ3A 2VZOA 3MPVA 2QHAA 3A4WA 3K57A 1NSQA 3MO4A 5H8PA 3OVGA 1TTIA 5BJRA 3NYZA 1OS5A 2WB1D 4B5XA 3OTOF 1QWGA 5E3RA 3LF0A 2CUYA 1HL2A 2V8VA 3GVVA 3UQSA 3PZTA 1TMHA 3TEHB 4CLUA 4Y0FA 3UFCX 3F5JA 2AMCB 2BZNA 2XH4A 4XTDA 4ZJOA 4XZ9A 3E3XA 3QZ7A 2YIHA 3S01A 1XD0A 1BYCA 4C8YA 2A10A 3HSGA 1KVKA 1OT2A 3CT7A 2VL4A 5D4OA 5A6PA 3H7RA 2B81A 1UW9A 1ZM9A 5T26A 2KYZA 3FKBA 5J2QB 3MMWA 4K4XA 4GX9A 5G5IA 4E4PA 4YEAA 3M0LA 1IN0A 4EKJA 4F4YA 3WQ5A 4JV1A 1Q6DA 1FNMA 4K2JA 2CDRB 1UH2A 1HR0J 5A8RA 1AW1A 1SIZA 2BW7A 2YQ3A 4TU9A 1R9ZA 2HHXA 1U1OA 3P61A 4OT7A 2VEMA 3MUCA 1X5OA 5I03A 3A9IA 5FJUA 5IDZA 1C90A 4RW4A 2CBJA 4ZQMA 1UWAA 1KM3A 3DFNA 1RVGA 3RJYA 1QU4A 4RE3A 3JXOA 3TJ8A 1A0EA 3OSNA 1EC7A 1DURA 1S5NA 2E9TA 5BCAA 3W23A 3CPGA 1X4FA 1YDNA 3LBOA 4K4VA 1UD5A 4K39A 4U8VA 4LRSA 2BA9A 1SGJA 1X4CA 3PO4A 2G5WA 2HQGA 3S6EA 4W84A