3PJXA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, p32
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
total genus 155
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjxA01
1S9GA 3EPIA 2FJWA 1HMVA 4KFBB 2WOMB 1LWFA 4K4XA 3LP0B 3MTKA 4URGA 3Q8SB 4TY8B 1C2PA 2WCXA 3C6TB 1IKYB 3DLEA 2IM2A 3HVTB 1HQEA 1SV5B 4K50A 1C0TB 2R8JA 2VA2A 3LAMA 4QWCA 5J2NA 2FVQA 2I5JB 4NCGA 3UPFA 4ECUA 1HQUB 3PJTA 1LW2B 5J1EB 5EDWA 2C2RA 3KK2A 5MF5A 3DMJA 3SI8A 3DI6A 2AGQA 2UVUA 4Y8EA 4Y34A 2ASJA 4KIEA 4ED3A 4ID5B 4NYZA 3OLAA 2IMWP 5HBMB 1TKXB 4KHMA 1VRUB 2BE2A 2XGPA 3UDLA 2W9CA 3V4IA 4PQUB 4NLRA 4NLPA 3DOKB 2AX1A 4IH6A 3BSAA 3QLHB 4RNMA 2BQUA 4B3OB 4I7FB 3C6UB 4ZP9A 5DG8A 4G1QA 4HU4A 4EBEA 1N6QA 2HMIB 1UWBA 5D3GA 2WRMA 3LANA 4LSLB 3GFXA 4RNJA 4R8UB 3CDWA 3BREA 4RW8B 3KLFA 2E9TA 3NAIA 4IG0A 4F4XA 1IKXB 4RNFA 5KFDA 5L1KA 4F4WA 4Y9MA 2AQ4A 4IR1A 3T5HA 4FOKA 2D7SA 4NLWA 2VG7B 4RW4B 1GX6A 3KLEB 1QAJA 1RTIA 2ILZA 4H4OB 2B6AA 2D3UA 3SY8A 5DQIA 3EPGA 1RT5A 5F8JA 1N56A 2JEIA 4ES4A 4MK7A 1ZTWA 4MKAA 3OL8A 4IH5A 3MEDB 2ATLA 2YKMA 3N6MA 4QWAA 4QPXA 4HYKA 4ZHRB 4EEYA 1HNVA 3CJ5A 3UQSA 5KFFA 3GIJA 1FKOA 5KFIA 4RNNA 4WYWA 2W9BB 4PWDA 4QWBA 4DL5A 4Q8EA 1S1UA 1JLFB 5CYQB 2FVSA 1JLQA 4TLRA 2V4QA 4Y9PA 4I2QA 4RUAA 3GG0A 1J5OA 1MU2B 2B5JB 3PW5A 4J40A 3TQ1A 3PJWA 3Q8PB 1BQMB 1LW0B 3SFGA 5L1LA 1EP4A 5KFSA 1N5YB 1JXLA 1FK9B 1SUQA 3PR5B 3N6NA 3QO9B 4F50A 4ZP7A 2XWYA 3PW4A 3S83A 3QGHA 3MEGB 2J6TA 1WNEA 1JKHB 4K4VA 4NLOA 5KT2A 4TYAA 5JXSA 5KT6A 2IM0A 4KKOA 4RW7B 4LYKA 1JLQB 2ASLA 1T3NA 3U2EA 2C2DA 3N3TA 3FFIA 2QE5A 2XCPA 3GV8B 4EYIB 1S1VA 5J2QA 4KAIA 4PUOB 4RW9A 3KOAA 4WYLA 4YR0A 3QZ8A 2RF2A 5C24A 5KFXA 5KG4A 4F4YA 2W8LA 1T03B 5K14A 1RT6B 5J2MB 1IKVB 3GV5B 3SFUA 1JLEA 3BGRA 1HPZB 5FDLA 4DEZA 1C1BA 3FRZA 3KHGA 4IRKA 4ECZA 2V4RA 4RW8A 2ZE2B 2W8KA 4RNHA 2UUWA 3IG1B 3LP2A 5FDLB 4TN2A 5KFLA 1BQMA 1LW0A 2XI2A 4IH7A 3UR0A 4IRCA 1HYSA 2WHOA 1DTTA 3FQLA 3TAMA 3KLFB 5DG9A 1N5YA 2AWZA 4DL3A 2OH2A 3IS9A 5KFGA 3D28A 4LSNA 4O4RA 5KFCA 1ZETA 3I5AA 2JEJA 3DLEB 3H4DA 4FBUA 2J6SA 1C0UA 3I5CA 4O4GB 4AG0A 3BSNA 3MR2A 2R2RA 3IGVA 4KB7A 2WTFA 4GC6A 3V6DA 3PW2A 3DYAB 5KT4A 1HPZA 3KHLA 3PFMA 1K1QA 3CJ3A 3QGIA 2RDJA 2UVVA 3DRPA 2HAIA 1HNVB 4Q0BB 4ECQA 5KFKA 5KFNA 4NRTA 4KSEB 4NLUA 4AFYA 1S97A 3H5UA 5KFPA 2HNDA 4Y3CA 2OPSB 4HJFA 3MR5A 3OL9A 5KFJA 1VRTA 2OPQA 3QIPA 5KFHA 4Q45A 4J9LA 2BANB 1S1TA 1SH0A 1TKTB 3DOLB 3M9NB 3CVKA 3GIIA 1BQNA 2YNGA 4ICLA 3IG1A 1QUVA 1LWCB 3I0RA 4EO6A 3GFYA 2W9AA 1ZTTA 4QW8A 1UWBB 4I2PA 4KV8B 2YNIA 3HHKA 2FVRA 2WOMA 2R8HA 2UVRA 2BASA 3RB4A 5KFEA 4DL2A 4ID5A 4JV0A 2JEFA 3H5SA 5EWGA 4RZRA 4Q44A 2UVWA 3NBPB 4ECRA 2BE2B 2GIQA 5KFMA 4EBCA 3V4IB 2AU0A 2FLPA 3V6DB 3FFIB 3DYAA 5CYMA 2YNHB 3N6LA 2V9WA 3BSOA 1U09A 4IFVA 4ECSA 3NKYA 3MEDA 4DL7A 2R8KA 1T94A 2YKNB 3G86A 4O3NA 5M1TA 2QV6A 3PHEA 4ED0A 3IGNA 3ISND 4JV1A 3M8QB 4LQ3A 1JLBB 4ECTA 4EO8A 1JLGB 1RT1A 3IN5A 1RTDB 2E9RX 5KG5A 4ED2A 5KT7A 2O5DA 3IRXA 1FKPA 2IC3A 1RTDA 2YNFA 1TL1B 4I7FA 3LP2B 2OPRB 1IM4A 3MEEA 4Q43A 3LP1B 4J9MA 2OPQB 3QGGA 3MR3A 3T19A 3C6TA 3QIDA 2GIRA 1KHVA 3E01B 3H2LA 5KFBA 4IFYB 1JIHA 3V6HA 1T03A 5EUHA 1D1UA 3DRRB 5MKGA 4ECXA 4R5PB 3JYTA 3GG1A 3T5KA 5D3GB 2JLEA 4QW9A 4NLGA 3KLGB 4FS1A 2CJQA 2HNYA 3DLGA 4ZPBA 2D41A 1S1VB 5J2QB 4NCGB 2B6AB 2HWIA 3CJ2A 3DRSA 5C25A 3CJ0A 5KFOA 2FLNA 4KKOB 5HBMA 4J9SA 3JSMB 3I0SB 3TLQA 3LAKA 3LP1A 4IKAA 1TKTA 1JLCB 5DGAA 3KJVB 1C1CA 1BQNB 1S6QB 5DLFA 2OPSA 2FJXA 3QO9A 1KHWA 5KFAA 4ED8A 4IQXA 3DM2A 2IJNA 2BANA 4O3OA 1LW2A 1HMVB 1C1CB 3GYNA 4KFBA 4Y2AA 4K4SA 3PJXA 2IBKA 4EBDA 3H40A 5KG7A 3DRPB 4Q0BA 1C1BB 1IKYA 2WB4A 1RT1B 4YMEA 5HROB 1S9EB 2JC1A 5DLGA 3RBDA 3OSPA 2UUTA 4I2QB 5KG2A 1J5OB 2R8GA 4IRDA 1N4LA 3CJ4A 3E51A 3HKWA 3KHHA 4J9RA 4IR9A 1VRUA 3KZPA 3MECA 2FVPA 1EETA 1T05B 2XGQA 3KMQA 2BR0A 2CKWA 5J1EA 3FQKA 4WFYA 4ZVGA 1S6PA 5MKGB 2WONA 4HKQA 1RA7A 3LALA 4RW7A 5KG3A 5KFUA 1DLOB 5I42A 1RTHB 2R8IA 2JEGA 1S1XA 1KLMB 2ZE2A 2AX0A 3CIZA 1REVB 4H4MB 4KV8A 4XPEA 2IAJB 4URSA 1JLAA 1FKPB 2IC3B 4YP3A 4GC7A 1S9FA 4IG3B 4M94A 3DOLA 2IAJA 5L9XA 4U6PA 1S49A 4KBIA 2WK4A 3ITHA 4LSNB 5C42B 4KE5A 4WE1B 4ZVHA 1JLEB 3I5BA 1TP7A 2HNDB 3VQSA 4ED7A 3HVAA 3M9MB 3MF5A 2JC0A 3FSIA 1RT2B 1N48A 5HLFA 5F8NA 3PW7A 3KLIB 4ZVFA 4Y2CA 5KT5A 4TQRA 3KLGA 3KLHB 1S0NA 4K4ZA 4MFBA 2VG6A 3T1AA 3KK3A 3JYTB 3CWJA 1TV6A 3GV7B 3MFIA 3T5JA 2C28A 3Q8QB 2AGPA 3KHRA 4OL8A 3KNAA 1EETB 4O3PA 3OSNA 3OLBA 4WFXA 1QAIA 3HV8A 3BR9A 2FVCA 3T5LA 2XI3A 5KG0A 3TVKA 3M8PB 1JX4A 3DLKA 4WE1A 4ECYA 1HQUA 4NLYA 4WZQA 5I3UB 4MIBA 3H59A 4F3HA 2EC0A 2BQRA 3H5YA 3V81B 2XCAA 1TKZB 5I3UA 1JLBA 3V6KA 3RB6A 2AGOA 3I0RB 2R2SA 4ED6A 3CDEA 4J9PA 1QE1B 4WXOA 4R0EA 1TL1A 2YNFB 5DQHA 2FLLA 2BRLA 1S1WB 1S1TB 3GQCA 4IOBA 1JLGA 1EP4B 2BQ3A 4NLVA 3C6UA 3JSMA 4NLDA 4U7CA 4DL4A 3PJUA 1TVRA 2E9ZA 3NBPA 1S4FA 4YR2A 4ZP8A 2ZKUA 4ED1A 5J2PA 2ASDA 1T05A 1N6QB 4ZP6A 2C2EA 5C5JA 5JUMA 4K4TA 4X2BA 4F48A 1IKWA 2YKMB 5J2PB 2D3ZA 4I2PB 4TQSA 1TV6B 3V6JA 1RYRA 3MR6A 3H98A 4Q8FA 2RKIA 5HP1A 2W9BA 3KLHA 2VA3A 3PW0A 1QE1A 2VG7A 4RW4A 3MEGA 3NAHA 1TL3A 1HNIB 1RAJA 5DGBA 1S9EA 4ECWA 1R0AB 3FDSA 2HWHA 5F8IA 3OL6A 1DTTB 3IRXB 3TAMB 3DI6B 4J9OA 3RBEA 3G6YA 1RT4A 4TYBA 2VG5A 3MFHA 2ILYA 4KHRA 2OPRA 4J9QA 3KJVA 1VRTB 5C42A 4H4OA 3QYYA 4O3RA 1TKZA 2IM1A 3DLKB 4MH8A 3NGDA 2YKNA 4IG3A 2BRKA 4ZMMA 2RDIA 4RW6B 1K1SA 2YNHA 3M8QA 3M9OB 1JLCA 3EZUA 3DOKA 1NNDA 4O44B 1S1XB 1W25A 4PWDB 2VG6B 5EWFA 1IKVA 3BSCA 4TY8A 2HNYB 3DDKA 5KFVA 2DPJA 2HMIA 1RT7B 2GC8A 4HU3A 3DRSB 4ECVA 3CO9A 1RT7A 1YVFA 3PVXA 4IFYA 4NRUA 4NZ0A 2IJFA 1TVRB 1NHVA 5F8MA 4RUCA 3KLEA 1JKHA 5F8GA 3E01A 1GX5A 4Y9NA 2YNGB 4ICLB 3OHBA 1RT5B 4TXSA 1C0TA 2R6OA 1HNIA 3OL7A 4J9NA 1LWCA 2W27A 4NLTA 4O3SA 4LSLA 4R8UA 3RB0A 3PZPA 3GFZA 4G3IA 2I5JA 1S9GB 1RA6A 1IKXA 5KFRA 1DLOA 1XR6A 1LWEA 3LP0A 4QWEA 5T14A 2W7OA 5F8LA 1CSJA 1MU2A 2B5JA 4FBTA 4K4UA 5KFTA 3QLHA 4B3OA 2VG5B 3HVWA 4NLXA 3M8PA 1HQEB 5KG1A 4RW9B 4YQWA 2DPIA 5DG7A 3H5XA 3BGRB 1NHUA 4YR3A 4O44A 3G6VA 1SH2A 3KLIA 3DRRA 2B43A 4MK8A 3D5MA 4O3QA 4FS2A 3KK3B 4QWDA 4ZPAA 2YNIB 1DTQA 5DQGA 2F8EX 3GIKA 3DMJB 2R2UA 5HLFB 5F9LA 1SH3A 4URQU 3IS9B 3QZ7A 4WFZA 2C22A 1RTIB 5HROA 4IDKA 1LWEB 1S1WA 5KFYA 1I6JA 4JV2A 1HYSB 4Y9OA 1TQLA 3CDUA 5KT3A 3NL0A 5F8HA 4ZVEA 1R0AA 4ZPDA 3Q8RB 5J2NB 1SV5A 4RNIA 4LQ9A 4KO0A 5KFWA 3H4BA 5L1IA 4K4WA 2OPPA 1OS5A 1S6QA 1RTHA 1S0MA 4H54A 1S10A 1RT6A 5J2MA 4KO0B 4Q6JA 1HARA 4H4MA 5EWEA 1S6PB 2WONB 5CYMB 1S0OA 1D0EA 4TY9A 2RF2B 5C24B 2RKIB 4RU9A 4RNOA 3HV9A 3KK1A 5I42B 5HP1B 4DL6A 2ALZA 1RYSA 3DLGB 2J6UA 5K14B 3ISNC 3RB3A 1LWFB 1Z4UA 1TKXA 5KG6A 5F9NA 2W9CB 3KK1B 3BQ1A 5L1JA 4J9KA 3RAQA 4PQUA 4K4YA 3KLVA 4MK9A 1JLFA 5CYQA 4PUOA 1S48A 4WXWA 5KFQA 3RAXA 3KMSA 3ITHB 2FJVA 2R2TA 4R5PA 3GILA 4XPCA 3ICLA 2IM3A 3MEEB 4F4ZA 1C0UB 2W7PA 4O4GA 4RW6A 4MFBB 1XR5A 3DM2B 4IG0B 4NLSA 3V81A 1FK9A 1RTJA 1SUQB 2HNZB 4IDKB 4DG1B 3OHAA 3KK2B 4EYHB 1KLMA 4M95A 2HNZA 1RTJB 1RT4B 4DG1A 4WZMA 3I0SA 4FOJA 4NLQA 4JUZA 3BJYA 2OPPB 2I1RA 3BQ0A 4ZPCA 1TL3B 3NMAA 1REVA 3HVTA 5C25B 3QIPB 3MECB 4MIAA 4IFVB 1JLAB 4XO0A 1MMLA 4MKBA 3PR4A 2XC9A 3BQ2A 1FKOB 1RT3A 3GIMA 4G1QB 5KFZA 4LJ3A 1IKWB 1S1UB 1RT2A 4ZHRA 2ZD1A 2V0NA 1XR7A 4FOUA 2IA6A 1RT3B 3G6XA 1DTQB 1RDRA 2ZD1B
chains in the Genus database with same CATH superfamily
2KH9A 4AMAA 4OZOA 1GOOA 3GYXB 3OFFA 1XBZA 1AJ2A 3CPWR 4LTSA 2WCXA 4JI0J 4RZ5A 2X1AA 3E3XA 3W6MA 1AD1A 3NQBA 1J96A 4NXMJ 1UUOA 3PBVA 3CD0A 3FGVA 4AWEA 2ON3A 2GL5A 3SI8A 4ZOSA 2XS5A 4ZR8A 1TJ0A 4AQYJ 3MUAA 3CXCR 5LNUA 2UV8A 4ORIA 5H1WA 3ZZUA 2M8DB 3VCDA 4ZFMA 2N3LA 1UVMA 1PGZA 2F4VJ 1VRUB 3OFGA 2DZAA 1FTRA 5GADI 3J7AN 1FWGC 2CLLA 2V69A 2V9DA 5DM6Q 4KW2A 4XZNX 1TZ0A 2HMIB 3VTIA 2DISA 4YLWA 4O12A 4I6YA 1E55A 1V3HA 4HZMA 5A6PA 4IG0A 2V82A 2VQEJ 6FDRA 1JPHA 1MWYA 1T9XA 3J81Y 3L4BC 3GVVA 3K59A 5GMDA 3GIQA 1OVDA 1EP2A 1V79A 1H0IA 1MZRA 1PKLA 2JGQA 3DU5A 1H7XA 5IOLA 1KNZA 1EAYC 4FHAA 2E66A 4WDUA 4JI4F 4XO7A 5KFIA 1FRIA 3VMPA 1Z44A 3SRKA 4Q8EA 1GQKA 2V6AA 1B9ZA 4PFMA 3UR8A 3S42A 1JLQA 2J7EA 4RUAA 3BEGB 1ZJHA 2V3DA 4PUDA 1GK8A 1C8XA 4HK6A 2ZE3A 4UCFA 3TQ1A 3ENQA 3W2WB 3PKYA 1IBCB 2WSCC 2Z57B 3WEZA 3S4TA 1JXLA 5IFPA 2Y70A 2BHZA 5AYBA 1NP2A 1I4NA 3HFKA 3QGHA 3D5HA 4P7QA 4ZCKA 3SAZA 4CLTA 5C9RA 1Q63A 1F3EA 3T07A 3UNTA 4RW7B 4OU1A 2ISVA 1IZKA 1E9ZB 3VU2A 2NWRA 2IKJA 3P8IA 3AOCA 5LOQA 1ME7A 2QAFA 1QRQA 3U7JA 4WYLA 1CLFA 2PLCA 5IWAF 3UW1A 4JPGA 1UC4A 4IL0A 4KGMA 4L65A 1DWFM 4KJIA 1VFFA 3OB8A 1XMQJ 4OYXA 3PTKA 1H3DA 4TNOA 2ZE2B 3CJKB 4MIMA 5CPMA 3LPGA 4E0CA 4EK2A 4IRCA 3OR2B 1BHNA 4UTJA 1XIGA 5LNVA 1XRSA 1Q86T 4LF6J 1TMHA 3ANYA 2YX0A 1K1DA 3RR8A 1OCBA 3FUYA 2ZNZA 1RLDA 3MT1A 4LT6A 5A8NA 4DR6F 1OD0A 3GVWA 4CDIA 1SQGA 2ZWOA 3LHTA 2A3EA 3W5ZA 5HQEA 1LM1A 2SXLA 2NQHA 1KA9F 5KFPA 2WPBA 5L38A 2E3ZA 2OR2A 3IK4A 3A5VA 2BANB 1QO2A 3FXGA 4GGBA 2GYIA 4QG9A 5CZXA 3IR7B 2AYEA 4KWVA 1LTDA 3LRLA 2MSTA 4DV4F 1BKHA 1HL9A 1YW1A 1WNOA 1UB3A 4ADTA 2M3DA 2A7NA 1U5JA 1EKRA 1RQ0A 1WC1A 3NOEA 3SCNA 3TTQA 5KFEA 4ID5A 4LRTA 3THUA 4JI6J 3SCJE 2UVWA 3W3SA 1MEWA 2PMWA 1T3OA 1BHGA 4L6HA 3OJSA 4EBCA 4K8EA 4ZN3A 1SI9A 5CJNA 5D4PA 4MNJA 4J9UE 3RRGA 3ZC4A 1U09A 1KOOA 1D3CA 5M1TA 3PHEA 2GGHA 2HXUA 4K5RA 4J37A 1KRCC 4EO8A 4YHGA 4JIRA 2E9RX 1S2UA 5KT7A 2E0PA 1BGXT 3PXGa 1RTDA 1WKDA 1E6YB 1TL1B 4IIBA 2YNFA 4DSFA 4LCSA 4QNEA 2CHOA 3DN5A 3CQKA 5H6HA 4Z37A 2YCJA 4UMBA 5EUHA 3F4DA 1KC8T 1E3ZA 1XYAA 4FLQA 2XGIA 3K4AA 3K0JA 1JAEA 4U31A 4CCEA 2WBMA 4ZLLA 3R1ZA 1FH8A 2E67A 2WJZA 3F2DA 3GB6A 2Z1VA 2UUCF 3PX4A 1VQNS 1IJEB 1V08A 3KTCA 4M7TA 1HWLA 1TKTA 2YB1A 2R9RA 3C14B 1ECEA 1HBNB 2GNKA 4KFBA 4QR1A 1Q5YA 4USIA 3MQTA 3ZZPA 4XUYA 1IJFB 2QV4A 2B4UA 3GZ7A 2I57A 3OBIA 4OLPA 1KLNA 4H9UA 3V35A 3OSPA 5KG2A 4CLMA 2NQ5A 3POTA 3UPWA 5DRKA 2R4FA 5JMUA 1UMYA 3W23A 1IBLJ 1HIYA 1XTZA 3O05A 2WJDA 1ZQ5A 2Q02A 3RLVA 1FOBA 5J5RA 3R7BB 4MADA 1LUCA 2KG0A 1RAIB 4M29A 3CXOA 3GH4A 2JEGA 2K1RA 1IT8A 1DIDA 3O0FA 3MD3A 3W1RA 4UQCA 4CO0A 2B9XA 4RE0A 4H8HA 2H1YA 4FNSA 2XN1A 3FA5A 1T9UA 1LWIA 5CEWA 3HHNB 1P9YA 1LLZA 3WMCA 2MGZA 4KKXA 3VQSA 4X4PA 2NCKL 1LJYA 1TKDA 3QMRA 4ZODA 3GYEA 1A5NC 1Y00A 3FSYA 4K4ZA 1RCOB 1OFBA 4LW7A 3OTOJ 3F4VA 4MFBA 3AA8A 3AD9C 4KEMA 4UZCA 5E70A 1VZWA 4JYAF 2E5JA 4O3PA 1Z1ZA 3A24A 4YCPA 4H6KA 1X5TA 3TA2A 3I4EA 3B04A 4L6OA 4WZQA 3M8WA 4MIBA 1XF0A 3RTVA 4F3HA 1V6TA 3AOBA 4K59A 1B0VA 1YQHA 3AOAA 3DLBA 5BWAA 2QSFA 1N5VA 2C3UA 3I0RB 3S7RA 2VURA 2IPOB 3OTBA 4ZQOA 3N9KA 2V50A 3RCYA 3QGAC 3K5MA 1YXDA 4I68A 3PJUA 4MVAA 2JZ5A 2RDWA 1S4FA 3V1PA 2ZKUA 1DJNA 5RUBA 4X2BA 4JYEA 2VENA 2W79A 1UYQA 1QNPA 2Z1XA 1Q6OA 4ZTXA 1WC6A 2Z00A 2XZ9A 3TOYA 3LPEA 3TEGA 2TRSA 3F5KA 3L4ZA 2VC0A 2FTPA 4IG3A 4AX7A 3MSDA 1LOSA 1XIHA 3BGGA 1UR2A 3EOUA 3FGCA 4PL1A 3STFA 1LFWA 4OI6A 3QQWA 2YLLA 4EZ9A 1HN1A 3TZZA 2NUYA 1QJHA 4A8SA 3PP7A 4DM2A 1TIWA 5KFVA 4CD6A 3ZIZA 3M8SA 4JI0F 1NM2A 1FCAA 2PWVA 3SGZA 3SUWA 3CMQA 4S3KA 3RM4A 1LT8A 1YVFA 3AD8C 3GR4A 2L9DA 1V7AA 1TVRB 4IG2B 1UA0A 3V18A 3LW5C 4X65J 2P8CA 5DCBA 1W3TA 2MMYA 3LA4A 1JJHA 1DE5A 4IO1A 2P50A 4WEVX 2NXNA 4NLTA 5E3QA 5IRPA 4F79A 4HN8A 1J5EF 1CC7A 3RN6A 2QLJB 6ALDA 3R3TA 2E5CA 4PUKA 3O8AA 4M5MA 2D69A 5FD0A 1GEQA 2PTDA 1CJTB 1YDVA 1U8SA 3GU9A 3DRRA 4MY9A 5LNSA 3F1QA 4LFCJ 5T7LA 3CL7A 1GTEA 4WWSA 3CTRA 3CCZA 3OVPA 4GI4A 5DDRC 1BWVA 2IXVA 4R7OA 3UD5A 5F9LA 3W7HA 3P6LA 4KPYA 1S99A 4HPHA 2PTWA 1BQXA 1S1WA 5G4WA 4ZQNA 2CZDA 3PF3A 3ZJKA 3JUGA 1NRKA 1Y5WA 5F8HA 3M2RB 4MLJA 3OTCA 2UZAA 2P3EA 2JKAA 4ZPDA 5J2NB 2MZSA 4KO0A 2VGBA 3KXQA 2K7KA 2GGEA 2HRWA 2VEPA 1H0HB 1UW4A 5BRPA 3PYDA 3TARA 1VPQA 3VVUA 3PPGA 2B4VA 2HGLA 3MM6A 4RNOA 4ZJOA 3V4BA 4ZQCA 4FPSA 1CVJA 5BR8F 5HO4A 4M1KA 3KFWX 1V5IB 3I3DA 3KNGA 1SL2A 3JZUA 4PUOA 2YL6A 2B9YA 1B0TA 1PAEX 3JS9A 2W2OP 1KFWA 4LYPA 2NX3A 4HDGA 2OUGA 1QBAA 3D66A 4JKLA 3BWWA 3CH0A 3OVRA 3SGUA 1NU4A 4IG0B 3TZWA 4IDKB 1DFDA 5B0EA 3IGHX 4YPJA 1TUXA 1SO4A 2YQ1A 1QW9A 4QLKA 3HG3A 1LQAA 4RCXA 5LSMA 4H4KC 4TU7A 2I1RA 1NMEB 2K1RB 3CT7A 5SWUA 3VAKA 3MUVP 4HQVA 3O1LA 5EMYA 5G0RB 1U1NA 2IKIA 5CPSA 3IEBA 1B70B 1M65A 4G1NA 4QDMA 4YVXA 5G2WA 2CNLB 4NI2B 4PTVA 1SR0A 3BG9A 1OYDA 4DCPB 3WUFA 4G2DA 4HD5A 4N9BA 1FBAA 4X4UA 4UFMA 5I09A 1UVJA 3WD3A 1OYBA 5BXTA 3LN3A 2XSAA 1XC4A 3UZJA 4DV1J 3GXTA 1AODA 4GY0A 3H22A 4D2JA 5HINA 1ZGDA 1KDNA 4C4WA 2G3FA 3CCES 1YDLA 2QLBB 3TYDA 3PACA 4AIOA 3RR7A 4HOXA 2WMHA 3A4WA 3MP5A 3ATZA 4R9XA 1ZM9A 5K4XA 4OT7A 1R8CA 2QIFA 2CQBA 3BLEA 4FXFA 2POZA 4RW8B 3R89A 2DY1A 3GFHA 3FCPA 4LRDA 4DQIA 2QG9B 3M0JA 4ELUA 2NUHA 3TX0A 4IR1A 3NXFA 2OSXA 2XNRA 4RU2A 2NUXA 2KT2A 3SY8A 3T6BA 3H2FA 4NEZA 1V5XA 4QWAA 1KKHA 2HQDA 2ZYFA 4WX2A 2XU2A 4RNNA 2W9BB 5AXMA 5IHRA 4ZJLA 1T5AA 3NQ7A 4YN5A 4AQLA 1W1IE 4HPXA 1F9EB 1PVNA 4V1Ak 3BLDA 3Q37A 2A7PA 4PXBA 3PJWA 4W7VA 1ZPTA 4QTGA 1G94A 5A95A 3FBBA 2WW5A 3PW4A 4JR5A 3ZSSA 3AU6A 1A4LA 3CYVA 1S4EA 1QAYA 3QMTA 2HFUA 1L0PA 3MM9A 2HFOA 4PMOA 2QE5A 4EYIB 1I2PA 3OEXA 4HSNA 2XVGA 4L3KA 5K8NA 4L1XA 4ES2A 3DYMA 3NR0A 2LMIA 3GV5B 2PLKA 1R8HA 3IFEA 4N56A 4DEZA 3KHGA 2F6XA 1U2YA 3NEKA 3P49B 3TJLA 2QV5A 2V8GA 3IG1B 5KFLA 1EOKA 2XI2A 5F3TA 1GQEA 1AQFA 4XQ6A 3EVMA 4F36A 2G8ZA 2XNQA 4HMEA 5DG9A 3K17A 1MNSA 1D7FA 1H5YA 2NQJA 4LSNA 1SZRA 3GDTA 5K3VA 5IC6B 5C9XA 1ZZFA 3QR0A 3OGRA 3F56A 1TPC1 2P0IA 4L6V3 2RH3A 5C7VA 3AIWA 1X31C 1KC7A 3Q8VA 1H1NA 4NLUA 1C9DA 2WCGA 3QTPA 5IXUA 3JAMY 1H50A 1OX5A 3ZT5A 1Q81T 1TWWA 4LC6A 2IYGA 4NX9A 3ZR6A 4ICLA 4CCCA 4C8ZA 3GVGA 1XD1A 3GDMA 2YXGA 4C8NA 5M17A 3DU0A 1WKFA 3SJ3A 1K7EA 2Z2ZA 4B4FA 2GQ2A 4JV0A 3UD4P 2PB1A 3H5SA 3KP1A 1FT8A 4X66F 1N32F 2GSJA 1VQSA 4LIWA 1KKOA 3L09A 5BXRA 2ZBTA 2ZX7A 3AS2A 2YWKA 4DR6J 2HHHJ 2V9WA 2C91A 5GQBA 4P7NA 3HSJA 4UFIA 1T94A 5H9FJ 2A2CA 4CNSA 3BDPA 3VPLA 3I56S 4FEZA 3C0QA 1DHMA 2LEPA 2OFHX 2MQOA 4LF9J 3EGWB 3AOFA 4CQBA 3BW2A 1YE4A 3IVTA 1FVSA 2YWHA 4I6WA 3DGRA 4J9MA 1MWOA 2DUZA 2XDFA 3VZIA 3ITGA 3H2LA 3IO1A 2LXFA 5E41A 4R5PB 2RGLA 4DQPA 1KTBA 3HSZA 4C6OA 4P6QA 1NQ6A 5D9PA 5IWAJ 4ZPTR 4WF9Q 2YWFA 2ATSA 3NGFA 5A8RB 4DF1A 3NSNA 4LJMA 2LQJA 2V2DA 1EQPA 1UP0A 2ZTKA 4J9SA 3E2SA 4QCEA 3RRAA 2BBFA 3CJPA 1GMWA 1CENA 2WVBA 4DR3J 1PC4A 1PHWA 5D4NA 3PBMA 5KFAA 4BDPA 5CAKA 3S6EA 4IQXA 4LFBJ 3RU8X 2QULA 4UUXA 3VGTA 3LWMA 3VGFA 4JTSA 4ID8A 4MAVA 4KWUA 3JQJA 4YMEA 1J6OA 4E5TA 1RT1B 5DLGA 1TG7A 2LFVA 1PYMA 2J9DE 1P4CA 2WOQA 3GR8A 3IRDA 4GY7A 4CO2A 1XYCA 2J27A 3P5YA 3CIMA 1HP4A 3VKJA 1UKUA 3CWHA 2HRYA 2EG6A 2Z2LA 1AH0A 4QAWA 2XZWA 4UOFA 2ZXAA 3GU2A 2NXGA 3DRXA 4DV3F 3ILLA 2AQVA 1DV7A 5EX0A 4FVMA 2PF8A 2DRDA 3CPRA 3LGDA 4K38A 2HHVA 4XUGA 4U6PA 4KBIA 1JYVA 4HOWA 2DNRA 2WZ1A 3FW6A 4WXYA 1ZFJA 1F73A 3PW7A 3PTWA 3EWDA 3P5ZA 3LUTA 1M5KC 5EFFA 4Q4KA 4KESA 1ZUAX 2WVVA 4H6EA 1ZBCA 4JTLA 2X42A 2CQPA 5K4ZA 1PILA 1WDQA 1JX4A 4B5TA 2AAAA 3E0FA 5I3KA 2ATMA 1W9DM 2XCAA 1JLBA 2VR2A 4BKNA 5K7JA 3UD3P 2H3BA 3EX6A 1B4KA 2ZWYA 5I00A 1V3SA 3W86A 4G5DA 2E1DA 4UQDA 1Q7YT 2G37A 3TZFA 2EKYA 2XM3A 2XZ7A 1X6UA 3NBPA 2CNOB 3CL8A 3KVMA 1ELSA 1PTDA 5HR7A 1VIOA 4YB7A 5XINA 4AZCB 4DJFD 3D0GE 4B9ZA 2B4PA 2CBVA 4FSAA 4CNNA 3A4TA 3MR6A 3NNTA 2EWHA 5IFMA 1CPZA 5D05A 4JI4J 4KT0C 5M2FX 3FDSA 3NXZA 3OL6A 2CPYA 1JB0C 2D24A 2A3LA 3M6YA 1ITPA 3KJVA 1UJ5A 1FWSA 5JIWA 2F2HA 3NGDA 8A3HA 7REQA 2FJEB 3VDHA 4JN7A 3KM8A 5I3QA 5DM7Q 3SUSA 3ID7A 5IBXA 1TWDA 4OIXA 3ZNJ1 4JL1A 1WI8A 1K7FA 4UWMA 3HO1A 1MQRA 2VFRA 2Q66A 3HPFA 2GJXA 2E29A 1GMVA 1S12A 2EJ1A 2J6XA 3QSIA 1R0BG 1Q4WA 4QOTA 1I94F 1RT5B 3IV8A 3RX2A 2DUXA 5DDQC 3PKMA 4R8UA 2OJPA 3A4AA 3U1LA 3WJWA 4UNLA 3GDBA 4J3SA 2NXEA 4S3GA 4NZ7A 4K4UA 4KMQA 4JTCA 4V27A 4UR7A 1TPFA 3WQ6A 2P6SA 2CERA 3QV7A 1VLYA 4Q4MA 1TL7B 3WQVA 1OC5A 2Q79A 3UVJA 4ED4A 1XSIA 4QIVA 4J5OA 3T9ZA 1P1XA 4ZPAA 3GG8A 4GQ0A 3TXVA 2BKOA 1OIMA 1KM3A 2OXNA 2XIBA 1J5SA 1KVJA 3CD7A 3K89A 3B0PA 3C46A 2ABAA 3N9RA 5LIKX 4W84A 1SQFA 3QV6A 2WKJA 4F0MA 2EC2A 3T7VA 1B3OA 4WHBA 3C8NA 1OS5A 2MY8A 3W70A 3IACA 2AMGA 1Q2RA 2IJRA 5CH7B 1OZMA 1WG5A 2CJAA 1AFSA 1XC9A 1S38A 5I42B 2PBOA 1Z4UA 1YTDA 2A1YA 2PGFA 2HBYB 4EPKA 1E9LA 3R13A 3FS2A 4NASA 1HBMA 3OUYA 2V8HA 4XPCA 4F2UA 4O4GA 1EJTC 4CLWA 1HW6A 3UEQA 4DFKA 4FMVA 1S5WA 4ZBCA 2HNZB 1H7PA 1BXCA 3FDKA 1K47A 1RALA 1V02A 4CNYA 3PB2A 2X2GA 1RTJB 3R1HA 4WZMA 3R2DJ 3E74A 1GKQA 1JNDA 2DT2A 4Q8VA 1MXDA 1ELOA 2IHR1 3UN3A 1FDBA 4JICA 5F1VA 3UBPC 2XFYA 2PLMA 4MIAA 2BJ9A 3WC2A 1Q85A 3BO2A 1U6ZA 3R2CJ 3DXSX 4P75A 5FF3A 4DBDA 5CYJA 1RWKB 3G6XA 3QR3A 2YGYA 3G8TA 4I9TA 3SCIE 1HX0A 3GW0A 3P93A 3R4IA 2BZNA 3V0SA 2WOMB 1O95A 7A3HA 3PZTA 5D32A 3HHDA 3NS5A 4JTJA 5AZ1A 2FGLA 2Y3YA 4P8XA 1K9DA 3T2QA 2KHCA 1T8XA 3GU0A 4TUFA 2PPGA 2OYMA 2VP8A 2R8JA 3H25A 4J2PA 4QAIA 1N88A 1UR0A 4CI0B 4D6CA 4PUMA 3F7JA 4TMBA 2C2RA 4LY8A 2YZ5A 1FI4A 1WC0A 1LXJA 1CGYA 3VF0B 4JY8A 1T02A 4YHHF 3LBOA 3N15A 2FJAB 3SV4A 2C15A 3WG6A 2V5JA 4OX7A 1N0UA 2BE2A 4KH0B 4IH6A 2AD9A 3QLHB 2DZTA 4I5XA 5F2GA 4Y00A 4IOCQ 1JDAA 3CZKA 3UE2A 4KGVB 4V15A 3BREA 2C13A 4ATWA 3PZNA 2XIMA 1U83A 3SQOP 5L1KA 4PFHA 5K5MA 1XG4A 1F9HA 4A48A 2IVYA 3BARA 3EPGA 1G4CA 2GA7A 2YBUA 4P5UA 4RWXA 3W2VB 3MEDB 2CLKA 3KBNA 1URNA 2WQDA 3F5JA 4JI7F 3EA2A 2Q8ZA 4PWDA 4O54A 1SQEA 1GW9A 3TN5A 4PB5A 2XMJA 5CYQB 1TZZA 2PSNA 4WY0B 3W7OA 4AWSA 4W85A 2HQFA 4GBUA 1RVGA 2B31A 4EMDA 1F7BA 3NQ6A 3OR2A 4QNWA 4CN4A 2OLSA 3FYPA 2XWYA 4PMZA 3IJLA 2PA3A 2VPWB 2IBOA 1R38A 6TAAA 5IM0A 1VC0A 3PUEA 2D74B 1FHUA 1GUVA 1YLVA 3G9CA 3TAKA 5A8RA 2FHCA 3MKVA 2PD9A 2XFRA 4OYPA 5KFXA 2W2PP 4JTDA 3HQ1A 3HTWA 2XZDB 3KVJA 3W26A 5FSDC 4EWND 3SSSA 2CDRB 2JEPA 2C16A 3OLIA 3FJ4A 2MY7A 5JVGQ 3RPDA 4QEHA 1D8YA 2VD9A 3C66A 3EAUA 3L12A 1N0VC 2AWZA 2ZE0A 1RHKB 2WO5A 3DLEB 1TFYA 1C0UA 3F73A 5GMKa 2VC9A 1NAL1 3WYZA 2R2RA 4MGGA 3IGVA 4KB7A 3V6DA 1NSAA 1HPZA 3AXIA 4E0DA 4M1RA 2KDOA 3GH5A 3UCZP 3BYRA 3LOUA 3OU8A 1KBLA 3K8VA 3CU2A 4AL6A 1G7CB 1JDDA 1H41A 5F4WA 3QIPA 4DV6J 4L80A 4W86A 1RHQB 4KIAA 4M5NA 3W27A 4RPFA 1HBUB 2ROEA 3L95X 3ZM8A 1GOKA 1RADB 2OLAA 1P6CA 1Q2SA 2VYOA 1ZTTA 4CZCA 3L2LA 2C3ZA 3OFHA 1JJ4A 3HHKA 4JX4A 4YY3F 2BASA 2P8IA 4QYRA 5M2RA 3JSRA 1NDCA 2FHJA 4OI0A 2FLPA 1UEUA 3ARRA 5CYMA 2G4FA 3W8GA 4FXSA 3TO8A 1XERA 2R8KA 2WBGA 4UCGA 3G86A 3IJ8A 3C19A 3N6JA 3M8QB 4OX6A 5HQ8A 3QY8A 4KRTA 3EE3A 3UDCA 1R86A 2O5DA 5CBBA 1MDRA 1MNZA 3RMEA 3M0VA 5IM51 3C56A 4JI3J 3MXHP 1JIHA 4G1KA 1LQ2A 3O16A 2GGPB 4NLGA 1N36J 4AD2A 5HVFA 4PTNA 2E6FA 3DFQA 1IBMF 4OMFG 1PTGA 4MWAB 3D47A 3R0KA 3I6RA 1IYXA 1RAKA 3WJYA 1X8DA 1YTEA 3A9IA 3UXKA 4CQ1A 3KJVB 1OO0B 4R9OA 2PDBA 2FJXA 4DPPA 4O3OA 4AYSA 2MGZB 1C1CB 2IMRA 2VGFA 4A8LA 1FKAF 3HFYA 4Q0BA 1ZAJA 5ETVA 4WOQA 4JD4A 3QAEA 4HHUA 2O4MA 3KZPA 3W00A 3MHUA 5KAKA 2FY8A 1V3MA 3TW0A 5AYIA 4DELA 3DGPB 3R5DA 3GIYA 4RW7A 5I42A 1C8YA 5I4MA 3OGVA 4FNQA 3CBWA 2MDAA 3WLOA 2HQAA 2ZH3A 1RWMB 1FP8A 4LS2A 4LF4J 1DURA 3CC7S 1BVNP 1OX4A 2HIQA 2Y8WA 1DKWA 4OHXA 4NAEA 2DZSA 1HBMB 1WOSA 3I6EA 5C42B 2BM0A 2DRAA 1W1VA 3M0YA 1P6BA 4HCDA 3HVAA 4WTOB 2JC0A 1RT2B 2BHUA 4DLFA 4DV4J 1WYIA 3OZOA 5FJRA 2PODA 3N4AA 4NZ4A 4DR1J 2QAPA 4AWUA 3PULA 2GFTA 3GLJA 4ED5A 4DS5A 2CHNA 1ODUA 2ZFHA 1NDVA 4OZLA 1L3UA 2EC0A 3V81B 3MPWA 1HKAA 1L6GA 1CI1A 3CCWA 1TRIA 2MKIA 5B7ZA 3GLCA 4L6DA 5HANA 4ES1A 4PRWA 3VOIA 5HVHA 2E09A 1WF1A 1TVRA 2FB3A 3DIPA 5FLXU 1HGYA 2ISSA 3OTDA 4FYWB 4DV5F 5ETMA 1TB3A 2D1CA 2C2EA 3DERA 5B7WA 1KR4A 1L2UA 3W5YA 1FF2A 3TJXA 2VOMA 4LBSA 3AZRA 3MM6B 2YW3A 3HF3A 4B90A 3UGVA 1FE0A 4QIUA 3BOLA 3H2MA 1K73T 3WIUA 4WKAA 3OD2A 1EL3A 2UY2A 2REQA 2QA4G 1AVAA 1IGWA 2I1OA 2K7JA 1OSEA 2NX1A 2JRSA 3IXQA 3L4TA 3EZUA 1IM6A 3DOKA 1FCVA 2OSQA 2ZCGA 2AW0A 1S1XB 4J2MA 1SKUB 5JMNA 3BSCA 2DB1A 4LYRA 5T7LB 2VUGA 2CG8A 3SSRA 3I55S 3DRSB 3G6MA 1W1B1 4IG2A 4WDTA 3LA0A 3BN4A 3PVXA 3UJ2A 1XICA 1QTNB 4GO9A 4U5KA 4AL5A 3ES8A 3T9PA 3I6PA 2L9WA 4D72A 2BOFX 5H1SV 2HVEA 2YNGB 3G1YA 4QDWA 3ZR4A 4BI7A 4NJHA 5A6TC 3UD6A 2GOKA 2OO0A 3CEDA 4BC9A 1HJUA 4G3IA 4A3QA 1J2WA 3UPBA 2KM8B 2YDAA 3IJ7A 4UFHA 4B3SF 3T8LA 1N8IA 4Q8UA 2ZWPA 4JNYA 5EMLA 2ASHA 3MD1A 3ABQA 4FALA 4DUZJ 2HS4A 1VHNA 3DHFA 1RACB 1UKTA 4UUWA 1B1YA 4MFDA 2YNIB 3TQVA 3ZLGA 2YA0A 1DBDA 3ECQA 3AXHA 2ZIDA 1EKSA 2GVZB 3D68A 1EPVA 5HROA 1LWEB 1O5JA 4MSSA 4B3RJ 1L5UA 4LALA 3KKFA 1EZWA 3V5OA 1R0AA 1FRHA 1I94J 3T09A 3PZVA 3SBFA 1OGBA 2BOEX 1S6QA 2XSFA 3IBWA 2XYHB 1MW2A 1XIIA 1B90A 3CQ0A 4FPRA 4OV9A 5I07A 4PMVA 2POTA 1MNEA 1OJ4A 1RYSA 1YI2S 1EHNA 1I2NA 3RB3A 3ALFA 2YL5A 4IJCA 4YL2A 3IAQA 2PI4A 2VKZG 3GAKA 3UERA 2ZBCA 4BI6A 4BFAA 4S3CA 1OQ6A 2DEPA 4L4OA 3K5PA 4L73A 3THQA 3QOKA 4MFBB 5LL6d 1FK9A 4DG1B 4WCJA 1VYRA 5K20B 1Z69A 3R8HA 1ZAIA 2VO5A 4W87A 5FJJA 1S2WA 3QXBA 1Q95G 4CTAB 3UDVA 1KD0A 3BGLA 1B0PA 2G9OA 3OTOF 2BVYA 2E9LA 3NWRA 4E3VA 4PMRA 3NGUA 1W3HA 3GSMA 3BQ2A 1U4BA 1H1ZA 5CZTA 1VYAA 1NJXA 1HR0F 3W7PA 2Z2AA 1EWDA 3U02A 1S9GA 3UGRA 2ZDOA 3TR5A 3LTOA 3GC5A 3M1VA 2DNZA 2ZC3A 3AHXA 1IIHA 4KPLA 2ALDA 2JQXA 4UTWA 4NJKA 2WQPA 2F63A 1XFBA 2EG8A 2XG9A 1FCQA 4C1NB 2QMUB 2X0HA 4DF0A 4X84A 5BXIA 1HQUB 5J1EB 1TMMA 2DUAA 4USMA 1G7UA 3TANA 1TTIA 1AQ0A 1L6YA 2QCGA 5JJBA 4LFAF 4PTMA 4NYZA 3VX0A 3UDLA 3T0DA 4JEQA 4ZENA 4AC1X 4DX3A 3E38A 1N8FA 1CYGA 4KGLA 2OYLA 5FIIA 1SYTA 4FDFA 3R5EA 2Q09A 3KTXA 3MWCA 1P0DA 2ZRYA 4B17A 3RPTA 4LSLB 3L9CA 4Q33A 4N8NA 1DZ5A 4ZB5A 2B6AA 1O12A 2MPUA 2DGVA 4RUHA 4M0XA 4BHQA 1T7PA 4Z2JA 4HHJA 3TYZA 2IQTA 2VICA 4HH1A 1QVBA 2WMIA 2IDEA 1SU5A 3EICA 1PDZA 2LU2A 2E5GA 4HK7A 1YSJA 1WD6A 1O0PA 3EKLA 4O1AA 5CG0A 2O9OA 2CCRA 4FX7A 4HI1A 3H8YA 3I9V9 4LANA 2OX1A 1OWXA 2QXWA 1W1YA 1SUQA 4WIQA 1NZ8A 3L5AA 1HBNA 3B0XA 1GVIA 4LNYA 5J04A 3ABRA 1YKWA 3MEGB 3NQ2A 4ILLA 3A64A 4LAZA 4PL2A 1JK9B 5KT2A 1ROFA 1JFHA 5ETRA 2OMAA 3UETA 1FKXA 2WCSA 3WQGA 1Z3NA 2IYIA 3N3TA 2WM1A 3GV8B 4Z2LA 4Q22A 1S1VA 3WX8A 3MDUA 1HT6A 3HHLC 1PBUA 2CU0A 3WL1A 5C24A 3CAKA 1EA9C 5C6MA 3EWGA 3PX0A 2RQ4A 2J25A 1TMLA 3ZZZA 1N5TA 5J2MB 2JJ4D 1UMJA 5GVJA 2Z1WA 4PRFA 3R0UA 3M0KA 3W07A 4N5SA 1H3GA 3H7UA 4RW8A 4RR5A 4QSHA 1RQHA 1L3KA 5ETPA 2YXLA 1RLCL 1N5YA 1UFLA 3AS0A 3IS9A 3TR9A 4IP7A 4OVXA 4KFNA 1VBRA 1XK8A 1DJXA 4CNOA 4XAFA 3AIVA 1FXQA 1X7VA 5KZ6A 1P0BA 1W1ZA 1I2RA 2Y7GA 3NSMA 3KYLA 3CM4A 1QM9A 3URNA 5IT0A 1JXKA 4GUHA 1WG4A 2Q3PA 1GZ1A 4NRTA 1J18A 2QF7A 5LSOA 1B3ZA 2RD5C 3E5PA 3IR6B 4JIHA 4ILMA 4DU8A 2ISFA 3GIIA 4IWWA 4IOTA 3N0VA 2ZH5A 1RPXA 4UQBA 1ITQA 4CYUA 3CAWA 4IM4A 1KVKA 2R8HA 4UOQA 3ENVA 3LV6A 5EWGA 4LVNP 4XBJA 3EEGA 3B8IA 4XDCA 3NQGA 3T0BA 1RJRA 5HJYA 1RI7A 1MN7A 2B7PA 4JI1F 2ZKMX 3LRMA 4JP8A 2G3MA 4DL7A 1GVRA 4O4WA 4LVBA 4WR3A 4O3NA 3GXDA 2OWCA 3MAAB 4H19A 3FXYA 3U7VA 3RGTA 1BFNA 4OQVA 3CWOX 4O23A 3BO3A 4NILA 4POCA 1TV7A 3TCSA 2IC3A 2HVDA 1M90T 2DNYA 3LP1B 3DNCA 4EUVA 2Y7DA 3H26A 4Q8QA 2CETA 3NO1A 2YH0A 3MM8B 1N52B 3A3NB 1TTJA 4AU0A 4CH0S 3AH6A 2Y0BB 3SDEB 2A3AA 5AOUA 2JLEA 2H9ZA 4QE4A 4ZPBA 2HNEA 1CGXA 1XWLA 2I7GA 1FA2A 4S3BA 3WC0A 5J2QB 3LM3A 5IV3A 4KKOB 1PCKA 1OBAA 3HP6A 3W61A 3I0SB 4X64J 4CO1A 1BYAA 4DUOA 4OYAA 2FDSA 5DBTA 5KMYA 3DXIA 1BY9A 1HWKA 2ZX8A 3MCNA 1EUNA 1QI4A 2WNQA 5CJMA 4KQZA 4EANA 4M5KA 4DMZA 1C1BB 5HROB 1VIZA 2UUTA 3LCHA 4J9RA 5LA1A 2QEZA 1KONA 3KG0A 1AW5A 3NZQA 3UWTA 1D9FA 4L4PA 2OFGX 2GUYA 2BR0A 2W0UA 3B4YA 3JB9k 4C8LA 4NZFA 4U2ZA 3EXTA 1CDGA 1DJQA 1ZY9A 3AO0A 1TMQA 3R25A 2NSOA 2V67A 2WW4A 5D4LA 2QFIA 1DRZA 4JL2A 3DOLA 2CZEA 4UY85 2F8HA 1NDYA 4OIFA 3WDIA 1I9CB 5ETSA 3PYFA 2O9TA 3TWAA 3MF5A 3P0WA 8XIMA 2HRUA 5K9CA 2Z2MA 1RP5A 2QA2A 2CQGA 4QIFA 5KT5A 3T1HJ 3Q2SC 1S0NA 1SKWA 3EOOA 2AYBA 1W7WA 1TUFA 4JYDA 3TV8A 1YLXA 3W7BA 4AIEA 4DSIA 3MU7A 1QAIA 3Q58A 2RJGA 3WX4A 2CPIA 3DLKA 1RA5A 5HPCA 3VQTA 2ZBPA 4Y65A 4LF9F 3QT6A 2DIKA 3K5LA 1GCYA 2YBTA 1E73M 2C1HA 3SUUA 5G2HA 3CIVA 3PO5A 1WC5A 1LCOA 3NLCA 4DCJB 4PN2A 5EB8A 3JTNA 4BZYA 1KW1A 3GQCA 4IOBA 4DO5A 2BQ3A 4XVEA 2RAGA 4OYIA 3IM8A 1D3HA 3FJ2A 3FHAA 1LG2A 3G18A 3IUDA 1MMNA 1NPPA 1JCJA 2PDAA 3ZNUA 1I51B 4H01A 2KRBA 4NYOA 2VPXB 4D6IA 3LH2S 3PW0A 3BBBA 1NJJA 4HACA 1X1NA 2HWHA 1DTTB 3IRXB 4X60A 1RT4A 3FSTA 2VG5A 5IC4B 4OZ1A 4PXDA 4J9QA 1RBAA 1IEXA 3N2XA 2CDQA 4H4OA 1S59A 3FSUA 2CUYA 3K1GA 1H73A 1LXNA 3L2IA 1YRRA 2JLGA 3TVZA 2QMWA 3VM7A 3ZZOA 3K7RA 4UQEA 4DNMA 4NVTA 2J7HA 4HCHA 5K2ZA 2R7UA 1RAHB 2D0FA 4D6HA 1BG4A 2EFVA 1CS4A 3ZJ7A 2Z2BA 1Q8JA 1KLZA 1SJDA 4FKXA 2ADAA 1QI0A 3GE7A 2GJRA 4HK5A 1WX0A 3QC3A 4FNPA 5HPOA 2EO7A 4DUWA 1DY3A 3QNWB 5B0FA 1M5OC 5FI8A 3QRHA 1NHVA 1MUMA 2P5VA 1KM1A 4CD4A 4HZ6A 3EDKA 4QU6A 1V3KA 5E6ZA 4LRAA 3KL3A 4ZO7A 4QM1A 1L6FA 4C6AA 4DI6A 3AHZA 3OTRA 3GCXP 2CJBA 1PSDA 1N34J 3PZPA 4QSFA 3EVOA 4YXGA 2PTXA 3LP0A 4PCNA 4HH0A 4QWEA 1U26A 4UTGA 4DWDA 2A3JA 5KFTA 5DMNA 1EA0A 1HKJA 1UBPC 2PDNA 3GX9A 4HA0A 1RPKA 2ERRA 4DUTA 3G6VA 2ACMA 3VIJA 3WQDA 2DNNA 4GVLA 2OKTA 2J0SD 1W8GA 1IE7C 2XG8A 3KK3B 1E5NA 3RG6A 3W1NA 4A2RA 4DZIA 4ZKAA 2EQDA 1M5SA 5GNZA 3KUGA 5BRQA 3ITTA 1RSCA 4IFRA 5CSSA 1S6OA 1SH3A 4EFAC 3EEZA 4CT9A 2ONEA 1NDWA 2OQHA 3QFWA 1T96A 3QFHA 1T8EA 1YZ6A 2I17A 3GVRA 8XIAA 3WFAA 2VZSA 1YRUA 2WSFC 2NQZA 5G5IA 2MUCA 3IAPA 3DHXA 3H4BA 4RDZA 4X2PA 1GOQA 3EMZA 1QJWA 1ZALA 5J2MA 5ABGA 1C29A 3GTHA 1QTWA 1X60A 5EY5A 4ZQPA 2YVSA 3HKZD 2RQCA 1DQWA 3WNKA 4BK9A 5DY3A 5K14B 1EGMA 4F3QA 2NQ9A 2EKGA 2Z4PA 4S3FA 4NL1A 1EF3A 4L64A 1HNZJ 1NFPA 2C0AA 1G4SA 2ZRZA 2UY5A 3GXNA 3JQKA 2KVIA 3N2MA 2KT5A 3TC6A 2MHNA 3N9UC 1VQ7S 1CBGA 5FCZA 3OQEA 4RW6A 1DL3A 1VK8A 5A6BA 2EFOA 1MFVA 2YA2A 1PB0A 1QHPA 3CHVA 5KITA 1RTJA 1SUQB 1YXYA 3PFRA 4M95A 3A47A 4EPEC 1XFCA 1NKEA 3EMCA 3K2GA 4GC3A 1GMWD 2GO9A 1K4GA 1UH4A 5CD4H 3C14A 2E1CA 1AZSB 1X6NA 3SV3A 2NW0A 1REVA 3HVTA 3NMAA 1UD6A 1R9XA 2NV1A 2ZH4A 1EP1A 4DZDA 4MJ4A 4FXDA 1MSSA 1DXIA 5A2AA 1KV5A 3H2UB 4QJ1A 4A8YA 3K30A 1RJQA 2W2QP 3UNGC 3K57A 1KQYA 5E0KA 2IPJA 4J3ZA 4CYUB 4J7RA 4AYBD 3EPIA 5IFTA 1HIZA 1LWFA 1MQQA 2VPYB 3Q8SB 5D9MA 1VD6A 2EFNA 3MYOA 2Z1SA 3F41A 2PDQA 3BL3A 4O4VA 2OEMA 1VLIA 5MLCV 1ZBKA 1F6YA 3G1DA 2LA4A 4TX9A 1XUUA 3EWCA 3TW9A 1JZ5A 2BW7A 2O67A 3FNNA 2I5JB 3W7EA 1VS1A 4MB4A 4F04B 1EX8A 1J0KA 2L9NA 3W62A 3M47A 4ACZB 1S5TA 2B9EA 3I7QA 2DHHA 4ACYA 1R3NA 4HU8A 3V4IA 2XGPA 3VUSA 1DYSA 3MKKA 4NLPA 4RNMA 1WJ9A 1CEZA 5DG8A 3PFOA 1CULB 2DSZA 3AIUA 2TAAA 2A18A 4MY1A 1W17A 2WM0A 4J9VA 3DENA 2ATCB 1NQKA 4DR5F 4P8UA 1FXPA 3UP8A 4DJED 3PC0A 2DT3A 2D2GA 4L7ZA 4RNFA 2BGNE 2KXNB 1RY0A 3TP4A 4DJBA 1RCQA 1WF2A 1W3NA 4ENOA 4K37A 4FVCA 1UKPA 4AE5A 3HJFA 1VQOS 1VQMS 2KL8A 4GIRA 1D8ZA 2CFXA 2YKMA 2PEBA 3U6WA 3CUGA 3CJ5A 4DBSA 1P1LA 3CV1A 4IGHA 4F4AA 2FQIA 1ONRA 4A3RA 4ER8A 4DL5A 3HFTA 4C91A 1R6VA 1UETA 2DRBA 4H04A 4NRRA 3VUPA 2B51A 4X65F 1A5BA 1B5TA 1UA1A 3OYZA 2YPYA 4DR1F 5CCMA 3OFEA 4YWIA 3M2RA 3FSXA 4O57A 2OMOA 1T0OA 1EXPA 2ISDA 3GUGA 2FTRA 2GVJA 2PWDA 3W01A 2VFVA 2VR4A 1NK0A 3MUZ1 4QITA 3A12A 4K7YA 4NLOA 3MUXA 2D23A 5JXSA 4Q3MA 3CUFA 5E2QA 5KT6A 4KKOA 3W76A 4DAFA 3KUHA 3VIMA 3HG2A 1C4AA 2XCPA 1XRTA 2C2DA 1WHXA 2Q71A 5J2QA 1K70A 2BE7D 1NDPA 4PUOB 1JPIA 4X62J 3KOAA 4JZ5A 2GSEA 1VHIA 3ZFVA 4E2FB 2EBEA 4OI1A 2E1PA 4AEOA 1ADSA 2GVLA 3LSCA 4XZMX 3QYQA 1EZ2A 3W73A 2E1MC 1V02E 2DQXA 4A8WA 3FMWA 3RJXA 3M64A 4DBUA 2UP1A 2WHOA 2HCVA 3KLFB 1B3YA 3VNZA 4X2RA 2QZRA 4B92A 2PU1A 4U95A 3APYA 3FCHA 3EGZA 4NMXA 3VIGA 3G77A 2XWXA 3J7YI 3BQ5A 3DG3A 3BSNA 4KWSA 3M44A 1DARA 4RBVA 1XH2A 3LMZA 1NF7A 1YX1A 1UA3A 2NZ4A 4Q0BB 3RPMA 1P7TB 3C86A 4R53A 1ISWA 3W0KA 3WQ4A 3JTOA 1TK5A 4AD6A 2INEA 4UNKA 2W4PA 2AMXA 4TVAB 3VGVA 4FZVA 2AEFA 2PP0A 5KFHA 5DXYA 2YWWA 4AW7A 3M6XA 2WMFA 5D0HA 3TR2A 2JFEX 4IFOA 1UVNA 1KCLA 1LRQA 1QVGR 3MAQA 4GQBA 4ATLA 1E6RA 3EVWA 3NQ8A 3I4HX 2G0WA 3WCZA 3HGJA 4C6JA 4C9DA 3WN6A 2X7WA 3RB4A 3DU6A 3PIPQ 3NBPB 2EAWA 3ILIA 3J80Y 4ANDA 3FFIB 1UZ4A 1T6MA 5ECUA 5C2CA 4DPQA 4DN0A 1K44A 3UR3C 2E8ZA 1FP9A 3BJSA 3QW4B 3TOPA 4LBUA 5DMLA 4DPXA 3SGGA 2DGWA 4L75A 4ZCMA 2Z29A 2B7QA 1OFDA 1LT7A 4IJRA 1O8BA 1YPFA 4GYKA 1FKPA 3UCDA 2HS8A 1GYMA 4TIMA 3S1VA 5KFBA 2BVWA 1GOXA 4N9DA 5JBEA 4ECXA 2MLZA 3HVRA 2MEWA 2J7BA 1QPNA 2X3GA 5M5DA 1QOPA 3S2CA 2HNYA 3ISZA 1WEYA 4DUXA 1NOWA 3K58A 3Q2DA 3DFSA 3N25A 2R8WA 3JSMB 2Z6IA 4P7RA 1YJRA 3OHMB 3NOYA 1W3LA 3VKAA 1C1CA 3GTYX 3H2NA 3NL3A 1LW2A 1HMVB 4B9NA 2HSEB 2K3IA 3AU2A 5THWA 5KG7A 3MA8A 2EBGA 4DV2F 1D9DA 3GE9A 4LCQA 6TIMA 2WB4A 4MZ8A 2UY3A 1E72M 3LPOA 4Z17A 2R3VA 3DHPA 3HKWA 1N4LA 1QWGA 3IANA 3NEVA 4DZAA 4H9MA 1DEDA 4MKYA 2X1IA 1X4DA 2NX9A 3CH9A 1R43A 3LSBA 1IWGA 4DFPA 4H1ZA 3AS1A 1GONA 5J8LA 5IOBA 4HKQA 3BOXA 1QW8A 1ZOTA 1S1XA 1KLMB 5KEZA 4P71A 5M2UA 1XXXA 1S9FA 1E6XM 1JJKA 4GYJA 2CPZA 4B3TJ 4FP1A 3WDOA 4LSNB 2BOGX 1AH4A 4WE1B 1HKKA 1F8MA 5CC3A 4G56A 3L3CA 1Q4NX 3C4UA 3EYPA 4IMEA 3P96A 2QMKA 2DNHA 1NWRA 2FUG9 4TQRA 1U47A 1QDUB 3C2FA 3O6DA 4B5SA 3BSGA 1KO0A 4AQYF 4H41A 3Q8QB 4MWAA 3WF3A 4GO5X 3OSNA 3KOFA 5GPRA 2GUUA 3HV8A 2WKLA 2F84A 2CPXA 1RHUB 2XI3A 3O2IA 2MZRA 3FBCA 4N4PA 4PUUA 4YVVA 1W56A 1U5HA 1IEQA 1UC5A 2YQ0A 2GVDA 3HD2A 5G1YA 5I3UA 5GAGU 3MO7A 4B5VA 1CTNA 1ZP4A 2AL2A 2FLLA 3HQOA 1H38A 4K0KJ 7FD1A 1WTFA 2WJFA 3H6OA 4CLLA 1PCAA 1SKSA 1N6QB 1HF6A 1LRTA 3OXFA 3LB0A 1GPFA 1FEHA 4MLRA 4AHOA 4I2PB 1TV6B 3G2GA 5CXTA 4HKPA 2VI0A 5DFAA 5L9NA 4DF4A 2Y7EA 1GG1A 3NAHA 3D6MB 5I3GA 1EJUC 3NQAA 1Z6KA 3LO3A 3WQFA 1XUZA 5BRBA 5C42A 3MMAA 1U45A 1EQ0A 2GK1A 1JULA 2DH8A 1XX1A 1S76D 3QZAA 3ZZRA 3M9OB 3ITCA 1Q4RA 4H7ZA 4DR7J 4GG9A 4EVZA 2ZEJA 1HNXF 2J9XA 1HO4A 2D0GA 5F41A 2HW3A 4CIOA 2DZVA 3A5FA 4Q2MA 5AECA 1JGMA 1RA0A 1OT1A 3CO9A 4QRNA 1BC6A 1PYOB 1U1PA 2CC0A 1U1RA 2QJGA 2JWNA 3CJSA 3KLEA 2P6TA 3E01A 4E8UA 3C15A 3K13A 2DZUA 3ITOA 3EXYA 2FHMA 2QEXS 2V63A 4P7TA 2OMLA 4NZ1A 2BXYA 3GFZA 3LCGA 2I5JA 3M7WA 4N7TA 4DCOB 5JQ9A 3CCRS 4QS6A 4ZXOA 1KN6A 4C97A 5I06A 1BQGA 3DESA 4PCTA 4K8RA 1C93A 3BSMA 3S1TA 3BGRB 3WBEA 1UAWA 2WB1D 1W5NA 6XIMA 5IT9U 2CNCA 4WLCA 5DELA 3H90A 4MK8A 3E0VA 5A2CA 1U0SA 5AVNA 5D33A 4Z1AA 3GXIA 3VCRA 3J7A1 4URQU 3SIMA 4GCAA 1H49A 2VFEA 4P7VA 3CMAS 5AXKA 3KDNA 4XSLA 3APGA 3UFCX 1I6JA 1HYSB 3CDUA 4WJEA 4ZVEA 1JPMA 3AMLA 4ZVQB 2F6UA 1TWZA 3UYIA 3QPZA 1OPIA 4E2DA 1RTHA 1S10A 3UG4A 4FP9A 1V77A 4MYUA 3ZS4A 4Q8OA 2A1BA 1S6PB 2DNGA 4NCBA 3SADA 3OXLA 4J3XA 1AROP 1N8WA 3PZGA 2RKIB 3H20A 3CF5Q 2QCFA 5A1AA 4LF1A 3LWLA 3MKCA 1J27A 4GH3A 3ARUA 1JLFA 4WXWA 1CXFA 2C3OA 1C3FA 3GC2A 4MJZA 4H00A 4R5PA 3KL0A 2WBKA 1ENUA 4NT0A 3SN4A 3HF5A 5I03A 4DFJA 1VHCA 4PUJA 3VZZA 1Q8IA 4NLSA 3G22A 3NOGA 4LC8A 4C6KA 3LEPA 2FHBA 3GR7A 4EYHB 3ZTQA 1Y4ZB 2WANA 4CU6A 4P72A 6PTDA 3FK4A 3C2OA 4FOJA 4KWOA 3VVTA 3G3DA 2J8FA 1HBOA 3IA0A 2B3TB 4UIOA 4WKHA 1LROA 3I68A 4M24A 3HI9A 4JOUA 1XH1A 2WZEA 2UUBJ 2JLFA 1GVQA 2GJNA 1EDGA 4FF3A 2IA6A 4DLEA 1W8SA 1RDRA 1EHAA 4AAJA 3R8YA 1BG9A 4FX8A 3IP0A 4IIDA 1A47A 2DNMA 3V2UC 4I64A 5KOWA 2HXTA 3BH6B 4XAGA 3W64A 4P74A 4YCOA 1YXCA 1FESA 1SV5B 3GM8A 2KXFA 1FWJC 4WU2A 1C0TB 5AHNA 1N7KA 4JOMA 1VHFA 4PYAA 1W0MA 2HEJA 4USVA 4ETZA 1TV8A 3HPXA 3TNOA 2G3JA 3NCRA 4GZIA 1L9WA 4QLLA 4R33A 3W4RA 1YQ2A 2AGQA 4QQUA 3N4FA 3DXBA 1XDLA 2FYMA 3UJFA 1PKYA 1FRKA 4Z2XA 3ITLA 4PMJA 1Y7VA 4ENLA 1HD0A 3HG4A 1H11A 4TLQA 3DOKB 4RDWA 4DX7A 3J7ZT 1P0KA 1IBKF 1LOLA 1GEHA 1CCWB 4XTIA 1QI3A 1YE6A 3KLFA 4M5PA 3ZVHA 4HSOA 4F4XA 2Z26A 3QHMA 4F4WA 3UPMA 4EXQA 3KS5A 1BF2A 3FOKA 1RTIA 2F6KA 2JEIA 2PFDA 1ZTWA 3W6YA 1CB2A 1SR9A 3A3XA 3W74A 1X4GA 1EIYB 3EDFA 1FKOA 2A2IA 3BJFA 1ZS2A 1S1UA 1TTPA 4MNKA 1Q3NA 1TO3A 1O60A 1TPEA 4Y9PA 4WVXA 1ISYA 1J5OA 1PKUA 3SO7A 4LUYA 1AW0A 1OABA 1T9VA 5CZKA 1L3VA 3BPWA 2VQFF 1BXNA 5L1LA 1N5YB 5H8UA 1V7YA 2PIIA 1TR0A 3KBMA 2PE8A 3VGSA 2FVLA 3VNIA 4UC5A 5HUOA 4K4VA 1CX9A 2UUAF 3LPFA 4UQ9A 2C8NA 2JE8A 1YJUA 2YW4A 5K9DA 5DZ7A 2LECA 4Q4PA 2V0TA 3U2EA 1J11A 4JTAA 5D9NA 5HMFA 1BEUA 5L6UA 3HZEA 4LU0A 4XISA 3VGBA 5A6JA 4E2VA 1E6ZA 1RU1A 3SCVA 5GAHU 1H98A 1ISXA 2WZMA 1NOFA 4GOAA 4ZJQA 4GI6A 3MC5A 4F4YA 2VC6A 3GQYA 4FN5A 1PDYA 3OODA 2BODX 5BXPA 3AB4B 3SFUA 3SQGA 3BGRA 4MYXA 3S2NA 4U4MA 4GI8A 1E4LA 4OLOA 1LBLA 3LP2A 3UY7A 2MZJA 1MUCA 4QHRA 4E2BA 3BR8A 3KCOA 1VR6A 4AL7A 1HQTA 3UR0A 3TAMA 1X8FA 1X96A 3N04A 1XR2A 4O4RA 4M5IA 5LXEA 1DJ0A 3OG3A 3GS6A 3W1QA 3H4DA 3TA9A 5BCAA 3KOWA 2HE8A 4K7VA 5I3JA 4CGTA 1U6BA 4JHOA 1K6AA 4A21A 3QW3A 3QGIA 2Z30B 4JKMA 3BLKA 3CZEA 3DRPA 4REQB 2XYGB 1YZ7A 4LFYA 5KFNA 3E1F1 3CZGA 3VGGA 3E0LA 1F07A 4KTQA 3G1VA 3GP9A 3LCFA 5HATA 4EACA 1S1TA 2BJ7A 4Q8WA 4OBRA 1QT1A 3QGPA 2W25A 4J3WA 4XAYA 3D67A 2KFZA 3GBDA 1QUVA 2EGZA 3GFYA 3NCOA 2P76A 1R46A 3TA6A 1PBGA 2HHQA 1JCYA 3HMCA 5BXSA 3AZTA 5AY7A 3NY0A 1E6NA 3IC1A 2ZUGA 3C0SA 2KB2A 3O06A 1OJXA 2DJLA 2ODOA 2BE2B 1GT8A 2BW2A 3DYAA 3RO6A 4OI4A 5DDPC 4IUFA 3N6LA 1QNSA 5F0WA 1Q6EA 2QR6A 3W2NA 4YTSA 3A21A 2QV6A 3MOJB 4LQ3A 3ISND 2PDMA 4HDHA 1R6WA 1M5PC 3USBA 3IJIA 3W7KA 1Q16B 2MKYA 3NZGA 3CUJA 2DDXA 2OG9A 2HK2A 4GIYA 4UZBA 2XTKA 1WG1A 4HR2A 2OPQB 3T8QA 1YBTA 4BWJA 3E01B 3C15B 1H7RA 4AXJA 4YHHJ 4O0IA 3HK2A 2A79A 5GADU 4IP5A 4OZ2A 3GG1A 4G7EA 2I9UA 4QISA 2CNNB 3W53A 1EJWC 3C2VA 4PRTA 2MSSA 4JTFA 4NCGB 2B6AB 2HWIA 4UT4A 2WVVB 3ZR5A 2L08A 3DGBA 5AN7A 2CLIA 1THFD 5FACA 1VQ4S 4UMCA 2GZXA 1ZA1B 4BLGA 4GYPA 3NWGA 3EX2A 3FN9A 1JZ2A 2OPSA 4UMAA 3D3FA 3UY8A 3TQPA 2NXUA 4QIEA 4N9EA 1H1YA 3GYNA 5HA7A 4Y2AA 1XNQJ 1XSJA 2IUZA 3T41A 3TW7A 4AXIA 3MMTA 5FJ4A 3HFZB 1LKZA 5EN1A 2QUNA 3L0KA 2QPXA 4ANCA 2CW6A 4GI9A 2OJ3A 2XN2A 1GVFA 1S6PA 5MKGB 3PCOB 4NXNJ 2C79A 3GNOA 1FWHC 2VASA 4RR4A 4G65A 1LK7A 4NA2A 3IGSA 3PTDA 1QY7A 3L4WA 2DEIA 1Y0EA 3NM1A 4LF7J 3MTWA 1F3FA 4YP3A 2ZVSA 5E3PA 4MB3A 4X66J 3PNZA 4IPLA 3OW1A 1EJSC 1X4EA 4FLSA 3UWVA 3PVFA 1FJCA 3MI7X 4OV4A 5D8HB 4XZWA 1V3IA 3V1HA 3D0IE 3ORWA 3TUUA 3CIXA 3ISIX 3B0UX 1WUFA 1EETB 2M9KA 2VCBA 3SZ2A 4P2XA 2YX4A 1HNWF 3VNMA 3OV7A 2Q3RA 2IA0A 4JQ3A 4FR6A 2V94A 2YDRA 3B82A 1T41A 3M8YA 2E44A 3CT2A 1M7JA 3NL2A 4C6DA 2N4CA 2TODA 3ERPA 5JUVA 3LGMA 3UCGA 4DL4A 5FLXY 1F1BB 4C8OA 5KINA 4RWWA 2HGMA 5C5JA 2DIJA 2XH4A 3UESA 3W7MA 1WOPA 4TQSA 3SIZA 5DRCA 5IDZA 4Q8FA 3LXAA 5EX3A 2CWNA 3DFHA 3A1YG 5F8IA 3W7JA 2ADBA 2JFDA 2VX7A 3G6YA 3MFHA 1EWEA 3OIXA 3KAOA 2PF0A 3AUOA 4NYUA 1KM6A 4ZMMA 1K1SA 3MAAA 2FQQB 2DGXA 3DDNA 3P5BP 3GTFA 1SC3B 2ACYA 1M04A 4QR6A 4A3YA 1EJVC 1VBKA 4I1TA 2YZRA 5B0CA 4H6QA 2BKPA 4EAYA 5EMUA 2IMOA 1XLIA 1KV8A 3LLFA 9XIMA 4I7UA 1RU2A 1CJVA 3TRGA 5LNWA 3BANA 3CO4A 1FRBA 1ZB5A 4ZEPA 1JKHA 5GAGI 2ZHBA 2GPTA 3C5QA 4KGJA 2DZWA 1GX5A 1QSYA 1T9TA 3WX7A 1FWTA 3NQFA 3ARSA 3SCLE 4XZ9A 4UTTA 3D7SB 4LSLA 2MLXA 2BOPA 2QVNA 1ZENA 2VFTA 4YN3B 2WBRA 1HXJA 1PS9A 2XMUA 4ILSA 2EBNA 3GU1A 3PZOA 5LA0A 1DXEA 3U48A 3ZLHA 2F9DA 4NLXA 3NNHA 1SL1A 3O44A 3FA4A 1M3UA 4DJEA 2F8QA 2GZOA 1WKEA 2IQDA 1SH2A 4B5WA 1PHQA 3UJSA 2YX1A 2ZOMA 4OX8A 4B08A 5LXRA 1HWJA 2A6MA 2IPWA 2VC7A 1M6JA 2YXOA 3V5CA 2HDJA 1VFLA 4EP8C 4NWBA 5CC7A 1Q6LA 1RTIB 4CQDA 1ICSA 1Q66A 1JQGA 3QJJA 3M9YA 1TV3A 1E1CB 1GJUA 3Q8RB 4M6QA 4LQ9A 1X0PA 4CVUA 4E8DA 1H6KX 3FZBA 2OELA 2C7FA 1LBMA 3LZ3A 4KFPA 1LUCB 1HGWA 1J6PA 1JUBA 3EM1A 1LZOA 2HSAA 4GA8A 1CXEA 4EZ6A 1WELA 1DQXA 4CUCA 2QJMA 3W6LA 1PAUB 2CJ9A 2JKPA 3BOFA 3DLGB 3J7HA 2J9CA 4B3RF 2XHCA 3MV11 2VGIA 1RV8A 1F4AA 3QLDA 2HHPA 2OFJA 3UO0A 3RAXA 4X9SA 2ZZ4A 3IAS9 2R2TA 2FJVA 3IVSA 3WK0A 4LF4F 2AQWA 2E6DA 2ZH1A 2PE4A 2WK2A 3V81A 3R7MA 3ABXA 3B4UA 1OF6A 3ITXA 4E4PA 3I7SA 2ZRUA 1ZU8A 4RXFA 4DXVA 3NQDA 2EEYA 1H7OA 1IXPA 1J10A 3NSXA 4DRSA 1OX4B 4NXSA 3TTYA 2MNRA 3CCSS 2R7VA 1A5SA 4MM1A 3SECA 2O1PA 1U0HA 1SO3A 1MMLA 2ZUWA 2DGSA 1FKOB 2IRYA 3TI0A 4PG5A 1GJWA 1CWYA 1RT2A 3HZGA 2WSQA 1XLKA 3E02A 3HGSA 1K8CA 4WFNQ 2C2MB 2ZD1B 1VQ6S 2JIEA 4CLSA 4HCLA 3RBZA 4URGA 4MUZA 2V5HG 1UZDA 1LLWA 1C2PA 1RJJA 3G8EA 1IKYB 1O5RA 3QWPA 1M7OA 2BY1A 5B0GA 3ZJ8A 1AH3A 1OG0A 1S39A 4O8AA 4AY8A 4FXVA 3EB4A 4D8LA 3QJAA 4ROQA 4E6MA 1S2CA 4A3UA 4LV9A 5FAJA 1MW3A 3KK2A 2EHHA 2XYPB 1EF2A 5ABTA 4B02A 4IQJA 4A47A 1U1LA 3GSIA 2KX9A 4TX6A 4ERIA 4KHMA 2A0FB 4US5A 5A6MA 2PC6A 2BQUA 4FIRA 4I7FB 1LL7A 1ICPA 4FNUA 4LREA 4YVPA 1WSVA 4EBEA 1TJ2A 3JQMA 4G7EB 4ATDA 1ITUA 2RDXA 2HS6A 4RNJA 1NWSA 5CLTA 4CH1A 4HT7A 2OQLA 3BZGA 3EDEA 3WH8A 3AUJA 3AQPA 2PD5A 1KQFB 4CO3A 1D7KA 3UW6A 1QAJA 3UCUP 5DQIA 5F8JA 1PWLA 2I5IA 2QA4S 2CIPA 1DHPA 3OL8A 1WOAA 2QO3A 1F76A 5CC6A 3VO0A 6REQA 3K2YA 3DDIA 3GIJA 2WMGA 3TJ4A 1W2IA 2J8AA 5PTDA 4YWSA 1X5OA 3RM8A 2V4QA 4AIBA 3LLXA 2HHXA 3GG0A 5D15A 4FNRA 2DTJA 5CQGA 4Y90A 2R7WA 1EOMA 4PABA 3RCMA 4MOZA 3CTTA 4WFBQ 3PBUA 3VAJA 2DJXA 1VQPS 1KXQA 9XIAA 1VFTA 1JKHB 4QYZJ 3W1YC 1U1QA 1JZ6A 2EK1A 4USTA 4GKKJ 4AH7A 1MXSA 4IX2A 4NA1A 2R24A 4LAKA 3QZ8A 4AX6A 1U6FA 1EJRC 2QDEA 1TPWA 3DOMA 1T03B 2EG2A 1ZL1A 4L74A 4LAMA 4F2SA 3FRZA 1R8PA 2JDJA 3CEPA 1TE1A 1FFRA 3BICA 4K2SA 1UD3A 3W7GA 5A8QA 1TAUA 4V28A 5CXPA 3MS8A 4PPDA 3FRYA 3D28A 3PPHA 4EK7A 3L7OA 3JAMU 4GO8A 2PRHA 1GPWA 2DCLA 2AT1B 4RV3A 4GK8A 4PG4A 3CB3A 3N13A 4PC8A 3PW2A 1HHQA 2FFCA 3QRPA 4I5RA 1X1ZA 3NG3A 4KSEB 2P88A 4GIEA 3KVKA 2HNDA 2OZTA 4QEEA 3DGVA 4IQEA 4OJHA 4OOZA 4O53A 1TFVA 5M03A 2XJ7A 4C8MA 1QO5A 3WUEA 4EO6A 2PEVA 3W63A 2W9AA 1TCMA 2HMCA 5IZHA 2A5HA 4USKA 1GYLA 4X3ZA 4DL2A 3Q24A 3SJNA 3RHGA 3AIQA 4J27A 1V6XA 3AXMA 5EBUA 3NQCA 2IW0A 4HP5A 3BAJA 3CGTA 3NDYA 2NQPA 4IUOA 1RAOA 4LCRA 2BLEA 5I23A 1TKKA 4JTQA 1LBFA 3O0KA 2ZA2A 2BWGA 3N19B 3IGNA 4JV1A 5E6YA 1JLGB 1S5VA 4M1BA 3NNCA 3IRXA 1XNRJ 1ODZA 3M0ZA 2HZCA 1MN9A 2PWEA 2FHOB 1EEPA 2V2VA 3QGGA 1VBJA 4LXFA 1CGUA 2YXXA 5AJ3J 4L76A 1HW9A 3VIIA 2XY6A 1F3XA 1VPYA 2XGZA 4XAPA 4ZSTA 3DN9A 2FPTA 4NI2A 3EJMA 2HPIA 2CJQA 4I9AA 4HZ8A 2E28A 1CS4B 5EMKA 1KSPA 4NX0A 4XO6A 1UEKA 1BF6A 4A46A 1NARA 3M41A 3LP1A 1K0TA 2CLFA 2VZVA 4MG4A 4QXIA 1WKKA 4UTHA 1KFJA 2FB0A 2CPDA 4PA8A 2GGIA 2IJNA 3DM2A 3S1UA 1RHCA 1WXYA 1EC7A 5DS7A 3CNQP 2EKCA 2H9AB 2QDDA 5TF0A 3H40A 3S1XA 3ARPA 4Z1YA 5KZDA 1J01A 5D0EA 3DYOA 2R8GA 4DY1A 5E5CA 4LEQA 1KRBC 4WCEQ 1XJBA 4ZB0A 4F2RA 4DV6F 2FVPA 4U7UD 1UH2A 5J1EA 2BJ1A 2CNKB 1Q7MA 1I6NA 3ONQA 2LDIA 4LBRA 3WQWA 1GJPA 4HMNA 3A8KA 2NUWA 5C54A 3CNYA 4UW2A 2J9ZA 3V7PA 2AF6A 5AZ0A 3HMJG 1FKPB 1RWWB 3OTEA 2NS1B 2VJUA 2E25A 3E2RA 1N54B 1QI2A 1M53A 3FDGA 4XAKA 5EL1A 3SB0A 1U1HA 3CMGA 3G1FA 1NPKA 4ERDA 2UU9F 2VRKA 3FSIA 4NP7A 2CZ4A 3M8ZA 2FTYA 1AFIA 4Q8PA 1DWIM 5HR6A 4C0OC 3T1AA 2X7IA 4X4QA 1TV6A 1SCJB 2GVEA 5CKSA 2ZZ1A 4WFXA 3MZNA 4BCEA 2YL8A 3AD7C 1QCWA 1ZS6A 2NWSA 2OIHA 2C2OB 5I3UB 3H59A 2VOOA 6XIAA 3BK0A 3QOMA 3PS7A 3SY5A 3W71A 1FVQA 2XULA 4B9VA 4N6EA 3KX6A 3QT5A 1XLDA 4LF8F 4WXOA 1GYNA 3MMBA 1QAXA 1R3TA 2BRLA 4MNMA 3WLTA 4XIMA 5E3RA 3T6CA 1HG3A 3HPAA 2G95A 1YBQB 1YX2A 1NFBA 5J2PA 1MROB 3QY7A 2H3DA 5C9WA 3CW2C 4AEEA 2IKGA 4J1OA 3QFEA 2RKIA 1FNOA 4IQMA 3KLHA 2BUNA 5GJMA 2GQ8A 5FJPA 5IV4A 3VXGA 1FWBC 2PA6A 5FL0A 4OOUA 1R3WA 4R5EA 3HULA 2DYAA 3RBXA 4YU1A 4NNCA 3ZOAA 3C16A 3QYYA 4DJFA 1SJFA 2XHYA 1LYXA 1O68A 5AHEA 1EO5A 3BV7A 1OIAA 3BBCA 4A8NA 4CLKA 4Z0SA 4U3CA 2X0YA 3B06A 1QSLA 3MI2A 3GY1A 2PI5A 5G1TA 1NJWA 1R9ZA 4HNTA 3GIPA 4XD5A 4ZPVR 1A5OC 5CPQA 1H72C 3RU6A 4D1JA 3B54A 4ECVA 3N2CA 5F2LA 1WDRA 2VZUA 3OVGA 1VEPA 4D8ZA 4QE1A 2BG5A 3D46A 3VI2A 3W84A 3DHWC 1H2UX 2M5YA 2HFZA 3B4DA 3BXWA 1KTQA 4C3LA 3OHBA 2DNKA 1SQ7A 1A5UA 1IR0A 2J77A 2FGZA 2XY5A 2EPKX 4J4KA 4NJJA 4I4BA 3W1TA 4JFUA 1XR6A 5DJBA 2B5JA 2DVUA 3NVTA 2LQ5A 5FJTA 3NYZA 5KG1A 4YQWA 4LV4A 3ICJA 3FEXB 3FY1A 4U7UK 3LDVA 1XLMA 3I87A 4CVWA 3FJ6A 4H3DA 1VJZA 1J9YA 4UTTC 1UZHA 2DGTA 2XMKA 2PDJA 2EG1A 3OBEA 3GIKA 3IRWP 4GHRA 3EXCX 1E4MM 3SURA 3W85A 4CEUC 1FRJA 4D9PA 1FO1A 2HBRB 3NCPA 1EYWA 3AI0A 5CSUA 3TYEA 2N7YA 5ABHA 1BSLA 2YPIA 3RW7A 1XH0A 4DF2A 3QN3A 2KG1A 3G0XA 3KW3A 4K39A 2DT9A 5L1IA 2VV5A 3NVDA 1H60A 4M5HA 3B8TA 5EWEA 1O4UA 2WONB 3R27A 1D0EA 2ZADA 1H74A 2GJ2A 4UTLA 4F2TA 5AE3A 4B3KA 1SJQA 4FS9A 1SC4B 4PRRA 4QP0A 4K0KF 2IPFA 3N17A 3PG8A 3BQ1A 4X63A 1MWZA 2DZXA 3NG8A 3ANVA 5GVQA 5BMXA 1A3XA 5KFQA 2EJAA 4WSJA 2QUUA 1FNXH 1R3RA 3AIRA 3IRSA 2IM3A 4PG6A 1M5VC 1B3XA 1FX6A 4K8GA 2QCNA 5ETKA 1VBHA 1DIOA 3BMXA 4YHEA 1Q1KA 3HD1A 3WMSA 1VS3A 1DP0A 1FKWA 2CPEA 3BLPX 3ENLA 5ABFB 3I0SA 1TELA 4DHVA 4IXHA 3BN7A 4CLYA 2XVKA 2CLHA 3ZZTA 2FD2A 5C2GA 4ZO6A 4TU8A 2D20A 4R85A 3HOJA 4MKBA 2XC9A 3V3WA 3W1UA 3T1HF 4FOUA 3PNUA 1EJ7L 1AFJA 4AMCA 4CM0A 3H0PA 4INFA 3KWMA 4KFBB 3WLJA 2PEHA 4BF7A 2J66A 2R1KA 2V5CA 1SB6A 2ZDPA 3HFVA 3QV8A 1V6YA 3P4UB 4K50A 1DWGM 3EDDA 1XLEA 4WJ8A 1BWLA 2R7QA 1U22A 5A8MA 3FKRA 3CV2A 4ZE4A 1S7HA 5MHBA 1V4YA 2GHPA 3UPFA 3PJTA 3O63A 2A7RA 3ZT7A 1DOSA 4ZO8A 3TN6A 3L5LA 5U7SA 2A10A 3V16A 1ME9A 5A6AA 3G2XA 4IGMA 1DPMA 4KY3A 4E98A 2FY1A 3R43A 4URIA 7REQB 2BKNA 1ZAXA 2J62A 4LVGA 2DGOA 3KJFB 1PCWA 3C52A 5D3GA 1HNYA 4HHLA 2CG4A 4O1FA 4USJC 2RMLA 3VAVA 3WLQA 1NLKL 1SJ4P 4JI5F 2C2ZB 3QPIA 4MUPA 5CAHA 4DR7F 3VMNA 4WP3A 1Q8KA 4IOAQ 3UXDA 4XKMA 1ULRA 4OTKA 1S5MA 2D3UA 1FJGJ 1JDEA 4HTYA 1E0XA 2GJXB 2ZDSA 3NEHA 3OJGA 3K8WA 1FX2A 2F2KA 9RUBA 3CUXA 4OUEA 2NSXA 1FE4A 2R1NA 1NEEA 3W2LA 4MTPA 3GJTB 4A6GA 2LDYA 2RVJA 1PKMA 1O5KA 4YS1A 3B9OA 1F0XA 4GX9A 2VBXA 4IUGA 3D1HA 3Q8PB