3PJXA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, p32
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 155
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjxA01
3DM2A 1S1TB 1VRTB 3BGRA 4IRKA 4IR9A 3BSAA 1DTQA 5DGBA 2FLLA 4DG1B 3KK1A 1TVRA 4IOBA 3H4DA 2HNYA 4O3OA 3EZUA 3KLEA 4K4UA 1OS5A 1T03A 4J9MA 4TLRA 4IH6A 1FKOB 1FK9B 1LW2A 2FVPA 5KFGA 5KFBA 5EWEA 5KG7A 2XC9A 1S4FA 1JLQB 2AQ4A 1N4LA 4F4ZA 1JXLA 4Y2AA 5KT3A 1IKXA 1S9GA 2OPRB 1UWBB 3KHGA 2E9ZA 4Y3CA 3GIIA 3T5HA 4M94A 4MFBA 1HQUB 4H4MB 5KG2A 2J6UA 2C22A 2ZE2A 2FVCA 3DOKA 3SFGA 1REVA 3V6DB 1HNVB 1KHWA 2R8HA 2JEGA 2D7SA 3TAMA 2FJXA 5KT2A 3KMSA 3QGGA 3DM2B 4URGA 4Q0BA 4OL8A 3PW2A 2XI3A 3KLGB 5D3GA 1DTQB 3GFZA 2IA6A 4O3QA 1TVRB 2GIRA 2HNYB 3M8QB 4ICLB 4ZPAA 4ZVFA 4QWEA 4ECUA 4G3IA 3PJTA 1J5OB 1D1UA 4ECZA 1T03B 3BR9A 1RTJA 4ED7A 4NCGA 1C0TB 4Y9MA 2YKNA 1S10A 3GIJA 4ED8A 2EC0A 1LW2B 2W27A 2VG5A 1RAJA 4RW8A 3E01A 5L9XA 2YNHA 4ID5B 4WE1A 3KOAA 1IKXB 1S9GB 4IFVB 3BQ1A 3PW4A 4I7FB 5KFOA 4PUOB 4I2PB 1RTDA 3IS9A 3GV7B 4PWDB 4RNFA 3D5MA 2ZE2B 3HVTA 3I0SA 2IMWP 3RB3A 4RUCA 2ILZA 4MK9A 2OPSA 4KAIA 5DLGA 3TAMB 4YP3A 4F4WA 1JX4A 4M95A 4WYWA 2CJQA 3KHHA 2OPQB 2D3UA 3MF5A 5DGAA 3OLAA 1VRUA 5KFMA 5KFQA 4YR0A 4ZVHA 2BQRA 1GX6A 3M8PA 3MECB 2BQ3A 3V81A 4HJFA 4ED0A 1SH0A 4KFBA 5KFAA 1S49A 4AFYA 3KLFA 4IG3A 4O4GA 5I42B 3M9MB 2W7PA 5F8JA 2HWIA 3Q8SB 4ECXA 4NCGB 3H5YA 4IQXA 2VG5B 5KFKA 4Q8FA 4RW8B 1JLFA 3LALA 1XR6A 1LW0A 1RA7A 1RT6A 5EWFA 3OHBA 3RAQA 1DLOA 1S48A 3G6YA 2HNZA 2UUTA 4QWCA 5KFVA 5J2MA 1R0AB 1LWEA 4HU4A 4KO0B 2I1RA 1RTDB 2AX1A 5HBMA 2HMIB 3I0SB 3HVTB 4ZPCA 4NLQA 2R8GA 3GIKA 2OPSB 4TYBA 1S9EA 1D0EA 2JEIA 3HVAA 1RYRA 3D28A 5DQGA 4NLOA 5KFCA 4F4XA 2W9BA 3KJVA 2V4QA 5DQHA 4RNOA 1IKYA 2ZKUA 3CDWA 2W8LA 3DRSA 3M8PB 3NKYA 3V81B 2FLPA 4KFBB 4FOKA 3KLFB 4NRUA 5J2PB 1JLAA 3KHRA 4ED1A 4JV2A 3IGNA 2R2RA 1T3NA 2J6TA 1HNIA 1LWFA 3CO9A 2VG7B 3PHEA 5KFZA 3CJ3A 4LYKA 2R8IA 4NLGA 3V4IB 4ECVA 3CJ4A 3ISNC 3UDLA 3RBDA 4EO6A 5C5JA 1LW0B 1RT6B 4DG1A 5DG9A 3H5XA 2IM0A 4DEZA 1DLOB 2IJNA 5J2MB 2HNZB 3DYAA 5HLFA 2OPPB 2YKMA 3MEDA 1LWEB 3H4BA 4ZVGA 3PZPA 3N6NA 5HBMB 3DDKA 5J2NA 1FKOA 1FK9A 1FKPB 4WFZA 3JYTA 4ECYA 5KG5A 2ATLA 2R8JA 3MFHA 1HMVB 1LWCA 4TQRA 4ECSA 3OSPA 3QIPB 2W9BB 1S1XB 1S6PA 3MTKA 3NAIA 4RNIA 1S1WA 1UWBA 3GYNA 3DRRA 1IKYB 1S0MA 2UVVA 5CYMB 3DRSB 1HQUA 3MEGB 4H4MA 4J9KA 2AGOA 2R6OA 1U09A 1QAJA 3M9OB 3V6DA 1HNVA 2XCPA 3GG0A 1JLAB 4HYKA 1ZTWA 4RW7B 4TQSA 1JLGA 4NLPA 4ZVEA 4LSNB 4K4VA 1IM4A 1RTHB 4H4OA 1HNIB 4RNJA 1LWFB 5KFTA 5KG3A 4WZMA 3CJ0A 3BSNA 3KLGA 5F8GA 1XR7A 4ZPDA 5C24A 3LAMA 5K14A 3M8QA 4ICLA 3DYAB 1EP4A 2BANA 2YKMB 4Y8EA 3MEDB 4ZP8A 1QUVA 3TLQA 2AWZA 3BREA 3T5LA 1T05A 1J5OA 1C0TA 4IFYB 1QAIA 3N6LA 5J2NB 4J9LA 4KB7A 3JYTB 3EPGA 3LP1A 4U6PA 5DQIA 1LWCB 4ID5A 4EO8A 3V6JA 3GFYA 1S6PB 5KFDA 2ZD1A 4IFVA 1RT4B 2QV6A 1S1WB 2BRKA 3DRRB 3PR5B 3S83A 1QE1A 3CWJA 4I7FA 4I2PA 4ZHRB 4PUOA 4LQ9A 4PWDA 3U2EA 3LANA 3VQSA 5KFWA 2WONA 5HROA 3IN5A 2JEFA 4XPCA 5DLFA 4ECQA 3SI8A 3PJUA 1JLGB 4ED2A 2OPQA 2RF2A 4H4OB 3C6TA 1HPZB 2O5DA 3CVKA 2WCXA 3MECA 1RTIB 5J2QB 3I5BA 1MU2A 4MIBA 5C24B 4RNMA 1HQEA 5K14B 4K4SA 5KT6A 4J9RA 1EP4B 2BANB 5I42A 1KHVA 3CJ5A 1T05B 3H98A 2IM2A 2WTFA 2AGQA 3BSCA 4ZPBA 1K1SA 5KG4A 5KT7A 2D41A 1S6QA 3LP1B 4RNNA 4HKQA 1IKVB 1JLBA 3KNAA 2RDJA 4GC6A 5KT4A 2IAJA 2ZD1B 2YNGA 4KKOB 2WK4A 4NLXA 1QE1B 4ZMMA 4Y9NA 4DL5A 4NLWA 5CYQA 1R0AA 4KO0A 2JEJA 2UVRA 3GFXA 1XR5A 4ED6A 3PFMA 5HROB 2C28A 2HMIA 2WONB 4Y9OA 2V0NA 3UR0A 3G6XA 2AGPA 4NLRA 4WFYA 1N5YA 3RBEA 2UVWA 4DL7A 4FBUA 4ZP6A 2RF2B 3T5JA 3C6TB 3QGHA 4H54A 4R0EA 5EUHA 1C0UA 5KFLA 1MU2B 2IBKA 1HQEB 3NMAA 4KV8B 5J2PA 4NLDA 4DL3A 4ECRA 3N3TA 3MFIA 4TY9A 2VG7A 1S6QB 1RYSA 4K4TA 1JLBB 3V4IA 3BQ0A 4NYZA 5M1TA 3IRXA 2IAJB 3LAKA 2YNGB 1S1VA 2D3ZA 2OPPA 3V6KA 2E9RX 5CYQB 2BR0A 4ES4A 2AX0A 2JC1A 3SFUA 4MKBA 4RUAA 2C2RA 1FKPA 1SUQA 3MR3A 1N5YB 1TL1A 5F8LA 2W8KA 3HV9A 4WZQA 1HMVA 3QIPA 4URQU 1S1XA 4Q44A 2W9AA 2F8EX 2RDIA 2WRMA 5KG0A 2XGPA 2UVUA 5CYMA 4KHMA 1C0UB 3MEGA 3H2LA 3DI6B 4F3HA 3GIMA 3QO9B 3QLHB 2VA2A 2GC8A 4U7CA 4JUZA 1Z4UA 2VG6A 3T1AA 1N6QB 4RW7A 4QPXA 4Q45A 3OL6A 1C1BB 4LSNA 1RTHA 4MK8A 3NAHA 1EETA 4ECTA 3Q8RB 4X2BA 4RW6B 4IG0A 3IRXB 1JLEB 2E9TA 5C25B 4QWDA 3CDUA 3RAXA 5KFSA 1S1VB 5KFXA 2ILYA 3DLKA 4GC7A 3GILA 1S97A 1K1QA 2VA3A 4IFYA 2BQUA 2R8KA 4MKAA 2JC0A 1SUQB 3ISND 4KBIA 4IH7A 1TL1B 4NLUA 3CJ2A 2XGQA 5FDLA 5KG6A 3KK2B 3H40A 3Q8PB 4EBDA 3PW5A 1RT4A 5I3UA 4RZRA 2YNIA 4IH5A 5KFEA 5EWGA 1SV5B 1N48A 4ZHRA 4XPEA 4K4ZA 3PW7A 4R5PA 1RT7B 5KFRA 5F8MA 3PVXA 3IG1A 2VG6B 4F50A 4J9QA 5MF5A 4G1QA 3GQCA 2BE2A 4RW4A 3MEEB 4TXSA 5KFNA 2IM1A 5T14A 1HPZA 3BJYA 3DOLB 1EETB 1RTIA 1S1UB 4QWBA 5J2QA 4IG0B 4Q8EA 4F4YA 3N6MA 1JLCA 2I5JA 3DLKB 3OL7A 1ZTTA 3I5AA 2AU0A 4I2QA 1DTTA 4J9OA 5HP1A 1IKVA 3LP0A 4KE5A 5FDLB 4NRTA 4WXOA 3FQLA 5EDWA 2ASDA 4YMEA 4ZP7A 1SH2A 2IJFA 4YQWA 1HYSB 2XI2A 3DLEA 2UUWA 2YNIB 4KKOA 5I3UB 3SY8A 2FVRA 1RT2A 3H59A 5J1EA 4O3RA 1JKHB 2B43A 4R5PB 1GX5A 3DLGA 5L1KA 3RB4A 2BRLA 2W9CB 2C2EA 2WOMB 3IG1B 5KFPA 5KFJA 5KFYA 3CDEA 3GV8B 2HNDA 4G1QB 4Q6JA 2BE2B 3CIZA 4RW4B 4IKAA 4TY8B 3QZ8A 2J6SA 3UQSA 2B6AA 3I0RA 2C2DA 3MR5A 1BQNA 3KLIA 3C6UB 4WXWA 1JLCB 1RT1A 2I5JB 4KV8A 1TKXB 3KHLA 4IDKB 5MKGA 3PW0A 3DRPB 2IC3A 2ASLA 1TL3B 3NBPB 1RT5B 3HVWA 3QYYA 3BSOA 2FJVA 2HAIA 2HWHA 5JUMA 4I2QB 1DTTB 1IKWA 5JXSA 2V4RA 5HP1B 4LQ3A 3LP0B 4B3OB 4LSLA 3OL9A 3DLEB 4NZ0A 1TKZA 3TQ1A 1RT3B 4FBTA 3QGIA 5F9LA 1RT2B 5J1EB 1SH3A 3FFIA 3DLGB 3BGRB 3BQ2A 4FS1A 4R8UA 4JV0A 3FQKA 3LP2A 4WFXA 2CKWA 4RU9A 5DG7A 2OH2A 5KG1A 3KK1B 2HNDB 4Q43A 1I6JA 3H5SA 3IGVA 3OL8A 3OSNA 3KLEB 1C1CA 4TN2A 5KT5A 2B6AB 3FDSA 3I0RB 1NNDA 1BQNB 3DI6A 3KLIB 3QO9A 1TKTA 3QIDA 3QLHA 3Q8QB 1RT1B 4MH8A 2FVQA 4K50A 4F48A 2B5JA 1N6QA 2R2SA 2V9WA 5MKGB 4IRDA 1C1BA 2IC3B 3FSIA 4ECWA 2RKIA 3GG1A 4MFBB 4O44A 1IKWB 5L1IA 3V6HA 3DOKB 2R2UA 1REVB 4K4YA 4LSLB 4RW6A 4KSEB 1JLEA 4QW9A 2ALZA 1NHUA 5KFHA 5C25A 3OLBA 1TKZB 5F8IA 4RW9A 4QW8A 4LJ3A 4NLSA 3NGDA 4AG0A 2FLNA 4Q0BB 3FFIB 3EPIA 5F9NA 4R8UB 3LP2B 5D3GB 5KFFA 3DMJA 4EEYA 4J9SA 2ASJA 3HV8A 3HKWA 1T94A 3KK2A 3NL0A 1C1CB 3PJWA 3UPFA 5F8NA 1MMLA 1RTJB 3MR2A 1SV5A 4IRCA 4RNHA 2YKNB 4HU3A 4Y2CA 1C2PA 4WYLA 1TKTB 4J40A 1RT7A 4ED3A 4FS2A 3JSMA 2B5JB 3E01B 2YNHB 1TP7A 4WE1B 4FOJA 1CSJA 4K4WA 1TV6A 3RB6A 2RKIB 3MEEA 4O4RA 3KMQA 2BASA 4O44B 5KFUA 4YR3A 3IS9B 4PQUA 1KLMA 3DOLA 3T19A 1S1UA 1BQMA 2JLEA 3OHAA 4DL6A 2W7OA 4J9NA 5L1LA 1WNEA 3PJXA 3M9NB 4MK7A 3KZPA 4RW9B 2XWYA 3KLVA 5C42A 1VRUB 4O3PA 2IM3A 4J9PA 3HHKA 1S0NA 3DMJB 3QZ7A 1TQLA 4XO0A 2FJWA 2R2TA 2WHOA 4IR1A 3ITHA 3KLHA 4EBCA 5L1JA 4IG3B 4O4GB 3KK3A 1HYSA 3G6VA 4NLTA 4Y34A 2YNFA 3ICLA 5DG8A 2QE5A 4YR2A 3GV5B 4O3SA 4JV1A 1JKHA 4FOUA 4K4XA 3E51A 1S1TA 1VRTA 4DL4A 3H5UA 2W9CA 3JSMB 1JLFB 2WOMA 4DL2A 4QWAA 1S0OA 3I5CA 1TV6B 4TY8A 1N56A 2GIQA 3RB0A 1HARA 4MIAA 3T5KA 1S9FA 4O3NA 5KFIA 4KIEA 1W25A 1KLMB 1RA6A 4EYIB 5HLFB 2DPIA 4PQUB 1BQMB 3TVKA 3MR6A 4Y9PA 3C6UA 1S9EB 2XCAA 1JLQA 4NLYA 1TKXA 2WB4A 5F8HA 4IDKA 4ZP9A 2OPRA 3KJVB 3DRPA 1TL3A 3NBPA 1RT5A 4URSA 5C42B 2DPJA 4TYAA 2FVSA 1ZETA 4B3OA 3FRZA 3ITHB 1YVFA 4NLVA 3PR4A 3KLHB 1JIHA 4KHRA 3KK3B 1NHVA 3G86A 1RT3A 4EYHB 2YNFB 1RDRA 4EBEA
chains in the Genus database with same CATH superfamily
4JR5A 3A3HA 3G2GA 1PYTA 2VR2A 3A8IA 1IZJA 3AWOA 3N18A 3KBMA 3TN5A 3N4EA 4J9MA 3VC6A 1W5MA 1SI9A 3NS7B 5D2TA 3DH7A 2RILA 3QQ0A 1N4LA 1WACA 4CT9A 2IRXA 1BVZA 2W1BA 1OY8A 4H4MB 3B0XA 3AMGA 4RKAA 5I78A 2F3JA 1IXPA 3SCLE 5AYIA 4ZVUB 5K9FA 3TSMA 2ZUVA 2EXOA 4NASA 4UFJA 4EVZA 2BABA 4PC8A 4XZLX 1DTQB 3R4IA 3MSRA 3HPFA 3E2SA 5A2CA 4A8OA 2TAAA 2BW2A 4DBEA 1XUZA 2YCLA 3L2MA 3WH7A 1CC7A 2X05A 3E01A 3ARRA 1VJSA 2HFNA 1J18A 1REQA 4H3DA 4OZ0A 4L9XA 2X40A 3PW4A 2VL4A 2FFIA 2HBVA 3SGGA 1R5YA 3IS9A 5A95A 4BLGA 1CEZA 3O63A 1F73A 3HQPA 3T2PA 5AOUA 4WDXA 3LXAA 7REQB 4KAIA 1WDTA 5A6AA 3TOQA 3NDYA 1HKJA 1THFD 3PAOA 4UQTA 4NSBA 1GX6A 5E70A 5GVJA 2C3MA 1I9CB 2Q71A 3HULA 4RPFA 2CDQA 3S6OA 3M9MB 1TCDA 3VGSA 2C2KB 2ALDA 2XG9A 4BA0A 3W2KA 2AGTA 1E4IA 2CU0A 3FCHA 3DFHA 4HA3A 4PCPA 4FALA 4PYDA 3QAUA 2HNZA 1DWGM 4AVOA 2XULA 4FNHA 4KRTA 2PEVA 1DP0A 3U8GA 2EBGA 1DJXA 1FI4A 4JBRA 4TU9A 2ZYFA 2A0NA 1S9EA 1YXDA 3RRAA 5IDZA 5DRKA 3D28A 5DQGA 4Z1CA 1M5WA 2W9BA 4JTLA 2WB1D 2I9EA 4JQ1A 4C1NA 2W5FA 3UNGC 1XH1A 2GPTA 4OX9J 4D2JA 3N79A 3W5ZA 4TVUA 2J7BA 2BJ7A 2WBGA 2EQDA 4DV0F 1Q6OA 4QBUA 4O1DA 4DZAA 4WXYA 2Z4PA 2WHLA 8A3HA 2D74B 1SR9A 4B9TA 5C7PA 5U47A 1KTVA 1N8IA 4LFBJ 1UP3A 4GY7A 3UDLA 1ZPVA 2MPUA 3KBSA 3G6MA 4MJMA 4OYIA 2P50A 3V5OA 4PB5A 2PZ0A 3PZPA 3B03A 2CJKA 3ARPA 1M3UA 1Y5XA 1FKOA 2H8XA 2R8JA 3M2VA 1CULB 1XKJA 4IP7A 3MGJA 4HJWA 4F2UA 1RABB 2Z29A 4RNIA 2F4VF 2KZZA 4RJEA 3CCMS 2QUUA 3DRSB 1R7OA 2HSEB 4CCHA 2E4TA 1W37A 4IL0A 3PRVA 1IEWA 2GSJA 1FWHC 3WLPA 1QSLA 1BQCA 2PS2A 2DZTA 2OMAA 4HT5A 5G4DA 1OF6A 5HUOA 5D6GA 1M1BA 5F8GA 2FPYA 1XRTA 3GKFA 4KQZA 5FL0A 3KUMA 3M4XA 3BREA 4ICNA 2HVZA 3PTKA 1CJTB 3CJKB 1IEIA 2OR2A 2GWNA 2XO7A 1S6PB 1RT4B 1CLVA 5A2QY 4LF1A 4M63A 1PTDA 1PZ3A 5KFWA 1HBMB 3TZYA 1JDFA 2JEFA 3MEKA 4E8GA 3TA1A 2GL5A 3MUCA 2P8CA 3C86A 3URBA 1REGX 2G3IA 3IAQA 3WZ0E 3GR8A 1X98A 4DV1J 3PFEA 1HQEA 5K14B 2GZOA 1EP4B 4XK8C 4I3GA 3CF5Q 3ZJKA 4Z2GA 4OI6A 4ATWA 4QRNA 3GU0A 1WF0A 3UFYA 1E6NA 3C16B 2PDGA 1Q8JA 2C3YA 4LFAJ 4AL5A 2WK4A 3GFXA 3UJFA 5HROB 1AFSA 4LH8A 2ZZ1A 2V0NA 3TQVA 1LOLA 4TIMA 1JWWA 3IS4A 1AYEA 3QY8A 1FHUA 3W7KA 2VFVA 1EARA 2XLIA 4DRSA 1RVGA 3CBWA 4ADTA 1KM5A 3U1NA 4A8KA 4RR4A 4GY1A 5KITA 5I79A 4E2OA 2WKGA 3IBWA 1ZJBA 1V0KA 3FKRA 1XBVA 3PEHA 1B4EA 3LAKA 4P73A 3PAJA 3S8SA 3ITVA 3HVRA 2D3ZA 2E9RX 1V93A 3RO8A 1EB3A 3FJNA 4UMBA 1QD1A 2EG2A 4AISA 4LB4A 4URQU 4DUZF 1XI3A 1K0VA 2PCEA 1OY0A 2NV1A 1E4MM 4W93A 4HCLA 2XWDA 4OJGA 2XSXA 3C3LA 4Y90A 3WYZA 4AD2A 1MEHA 4U7CA 3E96A 4GINA 4EAMA 5FOOA 3LQVA 1RTHA 3WQGA 3HT3A 3PACA 1XMOF 3TCEA 7TAAA 4P7QA 3DXSX 1VC5A 1FFQA 4F66A 3MAQA 1S5WA 3EVMA 2NQJA 5J8LA 3SQSA 3BCDA 2UV8A 4GVIA 4H8NA 3DLKA 4DOZA 1ZM9A 3SURA 5AZ1A 1LEOA 1UVNA 3VHQA 2BOAA 4OZ5A 5KFEA 5BOOA 3THQA 1KBRA 3KEHA 5D03A 2D3OR 4ATNA 1KXVA 3PW7A 1Q6RA 2L9DA 3R11A 3CXCR 2GVZA 1UR1A 1PIFA 2QA4G 3V1PA 3W7LA 6TAAA 2YDSA 3SCUA 1ENUA 4LAMA 3W07A 4TXSA 4HZ6A 1ML1A 1M6JA 1S1UB 4AF0A 3W73A 4J5NA 4GYJA 1LFPA 2JDJA 2VX5A 1LFWA 5A6TC 1OMSA 5E6YA 2KJVA 1MSSA 1HKIA 2IPFA 4L72B 4YMEA 2A5HA 3TONA 4PSPA 3WD0A 1XRSA 2VC9A 1RT2A 3NCQA 4WY0B 2YX1A 2UV8G 3ILOA 1DHKA 2IBOA 3MDWA 5CG7A 1P7TB 3TV8A 4RR5A 3DGPB 2HNDA 3CCSS 1J0JA 3HMJG 4EWJA 4IKAA 4L56A 3CT7A 3VU2A 1P6CA 4UR9A 2OODA 1V3ZA 1GZ1A 3KYLA 5BROA 1D2KA 1CTNA 2ZOXA 4GO5X 3MU7A 2WNNA 5MKGA 1DBDA 2IC3A 5D9MA 1FRBA 3GR1A 5ETTA 2INZA 1Q4RA 4FBTA 4ZTXA 2HMCA 5I3QA 3QHNA 3Q86A 2M5YA 3DLGB 4ZS6A 4FS1A 4QROA 2ZUNA 3AJ2A 2YW4A 3KK1B 1UC5A 3VOJA 2WSQA 4UB9A 4HK6A 3PYFA 3J7AN 4JI4J 3DI6A 3I6EA 2KT2A 4HIBA 2JVOA 2B5JA 4A3RA 1N6QA 4LAOA 3PUGA 2I14A 1OIMA 4CQ9A 1CEOA 2FHMA 4UMAA 1MDLA 4KSEB 1YADA 1HNWF 3CQJA 5E6ZA 2G4JA 4RW9A 1SU5A 3DERA 4DV4F 2NXUA 3SSSA 4D6FA 3D68A 4V19X 3VOIA 3LPYA 2QUTA 1X38A 3KCJA 3LP2B 2V9DA 5E7OB 3KP1A 5FLXY 4J9SA 1S2CA 1RISA 3NL0A 2PF8A 3QHMA 3UESA 1LRQA 2CPYA 4WF7A 3AHXA 3TJ9A 4UY85 1WC5A 2UXDJ 1VQ9S 5T9CE 3V3WA 3O2LA 3SQGB 3G1DA 3GY1A 1C90A 3J7A1 2YWGA 3E3XA 2EFPA 2J9DA 3JZEA 2RKIB 4O44B 3W1AA 4NUWA 1F3TA 4A8WA 2JLEA 1NO8A 3FBCA 3WC0A 2CXGA 1UBSA 3CUJA 4HNLA 4KIRA 1GMWD 3HGSA 3KLVA 2EO7A 3B8IA 3GIYA 3K59A 3KBVA 5FESA 4CD7A 1F9FA 3W2VB 1SFSA 3ELFA 3W7NA 4D6GA 4TKTA 4O4GB 3MKKA 4GA8A 3OA3A 4PXDA 3G6VA 2N4DA 2Y8WA 1HYSA 2BNJA 3ICLA 3DKLA 3G1FA 1Q81T 4O3SA 3LYEA 3R1ZA 4H9MA 1VIXA 1Q6CA 1S1TA 3JSMB 4DO4A 4IHCA 1XLGA 1VPXA 3WEOA 2G0WA 3CIWA 3AZSA 3THDA 5AE3A 4S3AA 3MO4A 3RG6A 2NSCA 1QI2A 3M0JA 2W0UA 3PZMA 4NLYA 1V9OA 1S7IA 3VAKA 2GV1A 4PODA 3NBPA 1X5OA 3FW6A 1NU4A 3PTQA 1DJYA 3E3HA 3DN9A 4P2XA 1JF5A 4HHLA 4HHMA 5HDRA 3WJSA 4XO6A 4PKDB 2OZ8A 1S5TA 8AT1B 2WQPA 1I75A 4JFWA 1WDRA 5DGBA 2FLLA 1CB2A 3LGEA 1WPCA 3OW2R 3KBNA 5EMKA 2N82B 3PX6A 1IBKJ 3Q8YA 4BK9A 5KG7A 1UUMA 3NQFA 1RAFB 3IJLA 1OK6A 2DCUB 4WY0F 3ZLHA 2ISWA 3TW7A 4MFBA 3E0WA 5FF3A 3DOKA 4K8GA 2HFOA 5IHRA 3T09A 1T9YA 3MM6A 4OKDA 3VOFA 3BKTA 3QPZA 2G2ZA 3UD3P 5LNUA 3DU5A 3KLGB 2DGTA 1IJEB 1EQ0A 2GIRA 4ZVFA 4ICLB 3F44A 4N77A 5SUHA 2Q6BA 4HSHA 3VNDA 2MLYA 2EC0A 3EWBX 5K8PA 2VG5A 4V27A 5LOQA 1EEXA 5BRBA 4PE8A 4NXMJ 1OCQA 4K1GA 4JQ3A 3FA4A 1GOXA 5CGTA 1VJQA 4ZQRA 3BW3A 3U5UA 3O8WA 1T9TA 3QTGA 2ZE2B 3RB3A 5EKYA 3MZNA 1R2SA 3Q2SC 1M5PC 3PTWA 4JOMA 4XAZA 3BC9A 5A8RA 3FHAA 2XY7A 4DI6A 4M5NA 4M6UA 4YMZA 2RSQA 4AHQA 1H41A 2FVKA 3CJ8A 4RW8B 4FLOA 4MDPA 1J9YA 1XC4A 3T6CA 2W2MP 3KS5A 2QNEA 2M8DB 1M90T 2KDOA 3I0SB 5HXMA 2NSBA 2ZA1A 4CLMA 1D0EA 5LGZA 1FXQA 3RN6A 2JEIA 4AIEA 1FE0A 4NLOA 4PWUA 1DIOA 4HHUA 3PV8A 4PYSA 2LEPA 3E02A 4W87A 3GVQA 1XD0A 3CDWA 2F9RA 4IMFA 1X8CA 3C46A 2OJ3A 2RRBA 1IT7A 4J35A 4JD4A 4KKXA 1RD6A 4WSHA 3TVZA 2KFZA 5CD4H 2DP3A 4DUOA 5F0WA 3NXFA 2AYGA 3BGGA 3I4EA 2VODA 4DG1A 4KBXA 3OP2A 1TWWA 4NYYA 5A6JA 4J3VA 1JZ4A 3QR0A 1XQIA 4NX9A 2WVUA 2JK2A 3RM8A 3RR4A 2OLHA 1E6ZA 1VBHA 5GAEU 2OFHX 2P5NA 1B0IA 1JIBA 4WGXA 5CD4A 4A35A 4TQRA 2Y6ZA 4X64J 3EEGA 3IJ7A 4DJFA 2EF9A 2UVVA 1IKYB 1HIYA 4N4PA 1AMKA 3VO0A 4RZ6A 5FJRA 5HA7A 3GG0A 1F4HA 1JLAB 2PTZA 1U48A 1JLGA 2XLJA 2I5QA 2QCFA 3CHFA 1NJXA 1HWLA 4H4OA 3KHJA 3WO8A 1US0A 3CJRA 4HT3A 2Z25A 1SL1A 1XR7A 3P2VA 1QUPA 1IXQA 2IYGA 4KCVA 4LF5F 4EIVA 1KM2A 3OPKA 1G1XA 1VHFA 2CNCA 3ZZYA 2R24A 4XZIA 3VX0A 4J3WA 2QMJA 1W5OA 1GVFA 4EACA 4JQ2A 4JTTA 4Q4QA 3MMAB 4K7VA 1Q66A 1BXCA 2PDFA 3DRRB 4N8OA 1KFWA 3QHOA 1WQ5A 1M1KT 2BJDA 2BV3A 5CPTA 4RDVA 4Q8OA 4TXEA 1QOXA 2XEXA 4WTOB 3NGTA 4NI8A 2ZIDA 4GGBA 3A3OB 4USHA 1LL4A 3TA2A 3R97A 2CLEA 1RTIB 2C2OB 1UP0A 2GVLA 3M7VA 1PTAA 2QULA 4TX9A 2MZRA 5HMXA 3W7HA 4UR7A 2YKPA 2J9XA 2RJHA 4GZ7A 4Q4PA 2Z0IA 3KNAA 2KFYA 2IQDA 3FA3A 3J7YI 2E1RA 4PMDA 2YNGA 3CCVS 3FKBA 1QE1B 4DL5A 4W90B 4KO0A 3SAZA 2UVRA 1QAXA 3HJZA 1OG6A 2WONB 1Y8BA 4D6HA 2ZWOA 4Y9OA 3M05A 2ZZNA 4XZMX 3NL5A 2ZITA 1X0FA 2LXIA 1QPNA 3EYPA 1HFEL 1NFGA 2NQ5A 2Z58B 1V3JA 4GVHA 3C6TB 4ZPVR 5KFLA 1VENA 3GIRA 1RWUA 2RDUA 2W61A 4XKMA 4CNTA 1OYBA 3TXVA 2GDVA 2G3JA 3VOHA 5BRPA 1S6QB 2CLMA 2D2JA 2A0FB 1L3VA 4NZCA 5GAHI 2OPPA 3TX8A 4UOZA 1WB0A 4ES4A 4USIA 3DFYA 4M0XA 2PI5A 5FEPA 1SUQA 2LA4A 1TKKA 1N5YB 1Q8LA 1V4YA 4ICCX 5CPNA 1HMVA 2HZVA 1S1XA 3F4VA 3PZTA 2BM0A 1TUGB 3USBA 1AVAA 4QM1A 3QLHB 1B90A 2V63A 3PO4A 2V2DA 3VIGA 3GH5A 5JH1A 4RW7A 3FVYA 5T41A 3IWLA 1A9NB 3GQYA 3R7BB 1DYSA 1WUUA 2QLBB 4MB1A 4AZ6A 4YYFA 2BEFA 3K89A 5I23A 4N6EA 1JLEB 1CGTA 1Q85A 3B05A 4DS5A 1CQNA 5KFXA 2V5JA 2PUZA 4FYDA 1RAKA 1E1CA 4OX8A 3KVJA 2VGIA 3N9RA 1N36F 5K4ZA 2M88A 5KG6A 2ZZMA 1G4TA 2E5IA 1R8BA 4B15A 2FIQA 1X5TA 4GZJA 4XPEA 2ZOFA 4K4ZA 3EDEA 1SL0A 5D4PA 3F1QA 2V2HA 1HKAA 2VOOA 4H9TA 1VB9A 2W3ZA 3I9ZA 3ZZUA 1F7BA 2R1LA 4AT1B 3W7DA 5HJXA 3GR0A 4QDPA 3M43A 4I8DA 3WIVA 2QIFA 4ZCKA 3QPIA 1VIWA 1E5NA 3CJQA 2VB6A 1CBKA 3W8GA 4S3CA 2B3TB 3QT7A 4LBIA 2AU0A 4I2QA 1E9ZB 1BGGA 3P3DA 1M7OA 4OIFA 3CJSA 3EDJA 1XCXA 2YNIB 1NK5A 1KNZA 3T42A 1PJ5A 3H59A 1AW2A 3KCLA 2Z1BA 4UFKA 4D1JA 2ACMA 1DFDA 2WOMB 3J80Y 2J8TA 4R53A 2NVCA 3P5YA 2CQHA 1AH0A 2Q3OA 4MNMA 1PDYA 4D72A 5D2XA 4P8XA 2OGJA 2ZTJA 1XNQF 2CJ9A 2EG1A 3ZFVA 3AIVA 4XZWA 3STCA 1FP8A 4KEZA 2KHCA 5DFAA 3EOOA 2HE5A 1F3FA 3QYYA 1OK4A 2IKJA 2VDGA 2I38A 3LP0B 1O12A 1E71M 4MVAA 5DANA 3M6VA 4Q33A 3UWQA 1TKZA 1ME7A 2EGZA 2P3EA 1HUVA 4WWSA 1X0PA 4X4RA 1NIUA 4Q4OA 2GIFA 1EWEA 2UY2A 2G4FA 4GQRA 3NCOA 4KS0A 3OL8A 4M51A 4P2FA 3OGVA 3W29A 3B40A 4ZE4A 3M8SA 1DE5A 4B5SA 1L8PA 2HVDA 2HRWA 2EPLX 2OGYA 1S3TC 4YJ5A 2ZXAA 1BC6A 4OYXA 1TV3A 4FX7A 5ABEA 1VCGA 3EPNA 2CWXA 2I1OA 2C14A 2OZTA 3KOFA 2DR9A 1SJCA 1NAQA 1TPEA 1IM6A 4HZ7A 3UPMA 1FEEA 3EOSA 4P71A 2PDWA 1C1CB 1IEVA 2MY7A 2XH4A 3MR2A 4AL7A 5IV4A 1MUMA 4Z2KA 2V5HG 1P6WA 2G50A 2PDYA 4KGZB 4IMDA 2E28A 4W98A 1B3YA 3KNGA 3KMQA 4M7SA 4JKLA 2YLAA 1B99A 4AQYJ 4Y2WA 3ONCA 1OYCA 2NWSA 4LEQA 4DMZA 4XTDA 2U1AA 2CJXB 3L7RA 1R3TA 1XLJA 4AZBA 5LKYA 4AUKA 3EX1A 3KK3A 1CW2A 1HF6A 1GOIA 4S1FA 3CUGA 4J3ZA 2E5GA 1MXDA 3GV5B 3GBDA 3IUIA 2IPGA 1T40A 3MM9A 3TTSA 1TREA 1XDMA 1UWSA 4DSLA 1T96A 2BJ3A 3MM7A 2BUNA 5KFIA 4ZQPA 3HHLA 3WDRA 3WEZA 3H2VE 3EWWA 1VQYA 4ACYA 4DBDA 1FRMA 3QBCA 3T4WA 1CVJA 4ZP9A 2RNEA 5C42B 2QRRA 1EO7A 1F74A 2E1DA 3AHYA 4U67Q 2W2OP 3D7SB 1YTDA 2DNNA 5D0GA 3T7VA 1KLNA 2GOKA 3PYEA 2YNFB 3UDCA 2J6VA 4NYOA 3BGRA 4F79A 4BC7A 3BSAA 4FR1A 2B9WA 4DR4F 5I02A 3HLUA 4OHWA 1P5BA 4PA8A 2H5EA 5ETMA 1EZWA 4MPQA 2OKQA 2VBWA 3F4WA 2W67A 1WOAA 1YE4A 1PV8A 2E5LJ 3QSTA 3WF0A 3Q8UA 1NP2A 1XLIA 4URGA 4OL8A 3BLFA 5CZKA 4CQCA 1F5ZA 1Y0HA 3ZVHB 3YPIA 4K2SA 2Z24A 3M7WA 2EKYA 4CNNA 3BPDA 2BKPA 4EUVA 4L3KA 4CNZA 4CQ8A 2QCNA 3S6TA 3PBWA 3EXYA 2GS8A 1NFPA 1WOPA 2RKXA 1NDLA 1AG1O 4ECLA 2QVNA 1V3IA 2WCAA 1EFZA 2YBTA 1ZH5A 3AO0A 1CPZA 3OJGA 3TAMB 4MAKA 3WH9A 3DYPA 2ZRYA 1EPVA 5KFQA 4WKHA 5HMSA 1JZ5A 3M0VA 1RK5A 5H9FJ 2ZA2A 1RLCL 3DNCA 2HXUA 2J5AA 3Q8SB 4NCGB 1P1MA 3COTA 1D3GA 3QVQA 2DGUA 3UR3C 5DMYA 1VYRA 2DY3A 5A69A 2NV2A 4HU4A 3M16A 3FKKA 4WUIA 5EPDA 4ZPCA 4M6QA 2OPSB 3LI0A 1ZA1B 1SJBA 3E49A 1JD7A 5KFCA 2XN0A 3IFEA 3FA5A 3TA0A 5AXMA 1UA1A 4OUEA 4CO5A 4HU0A 1QMLA 3V81B 3RPTA 3U2OA 2BV9A 1U45A 4NRUA 1VS1A 1JRBA 1TQJA 4GBUA 3RO6A 1HN1A 2HISA 2CNKB 3W65A 2VG7B 2OYKA 1FDAA 2BE7D 4LYKA 4B92A 4O18A 3CJ4A 3RBDA 3H5XA 1RT6B 3R2DJ 3AD9C 4M8LA 3S2CA 2HNHA 3NM3A 3CAKA 2K7JA 3TQ0A 4O16A 2GJXA 2ATLA 1UL3A 4DV6J 3OXFA 3G71S 2WC7A 2E8ZA 1Q13A 3S1UA 4DBQA 4HTJA 1CX9A 4QBXA 5JUVA 4BEQA 4QR0A 3WNPA 2FB0A 2GQ8A 1POKA 1BGAA 2NPFA 2VL1A 3W02A 4I6YA 1VPYA 2X1BA 1TR0A 1FH9A 3EVOA 3CC2S 3V16A 1ZTVA 5HAOA 2YDRA 1YLXA 4C6BA 3VAVA 4LSNB 1IM4A 1LWFB 1ZOTA 1UVIA 3Q2DA 3QYSA 3HZ3A 5DRCA 4K8EA 2QAPA 2WQDA 3TOPA 1F1BB 4HPXA 4GXMA 3RTVA 4YOEA 1KCXA 2X1AA 3JYTB 4M5LA 4X63A 5DQIA 3VD3A 3DOMA 3NOCA 2IKHA 3SN1A 1T9UA 1DQ8A 4ZJQA 2XQCA 3A47A 3VQSA 3OFEA 1YBQB 2O3DA 2QGFB 3MUMP 4BS2A 4UQEA 2DO0A 2RF2A 3QPYA 1RUSA 1Y7VA 2BXZA 2NQHA 5DXXA 4IYQA 4HQVA 3M0LA 3RR7A 3P5TL 4LPCA 4XUGA 3AJ7A 1TVLA 1HLWA 5C9RA 2XY5A 5IFMA 2DZPA 2QT3A 1F6PA 4FX8A 1VLIA 2IAJA 3EXCX 1QWKA 3M2UA 3H7VA 1TUFA 3GSIA 5CH9A 2AGPA 3VIPA 2EVZA 3GG7A 2ABYA 3PPFA 2IFXA 1W5NA 1KKHA 1RBOB 2DU2A 4XTTA 2COLA 5C9XA 3IRSA 1C0UA 3USZA 3GDMA 4AWSA 3J7ZT 3GIPA 1MU2B 4U4MA 1X6UA 2XTJP 4DF8A 5DM6Q 5FAJA 3PZUA 3MFIA 1B7FA 1ZYQA 3ABSA 2FLOA 4U31A 3V4IA 4B3TJ 1AFIA 1PL9A 1ZBCA 1SZEA 5EYWA 3LGGA 3SRDA 4DJEA 1PZ1A 2HPMA 1FA2A 1E1FA 2CLFA 2HPUA 2JC1A 3W26A 4RE4A 4B9VA 1G2EA 1ZAWA 5F8LA 1RADB 1G6CA 4IMGA 3AOBA 1XV8A 1EC9A 4DBWA 3OG2A 4F3HA 5HI7A 1BWEA 1ZBWA 1NOUA 3FYPA 2ZDRA 4AY8A 2ZX6A 3W2WB 3OUYA 1RHQB 1V3SA 1A7GE 1X96A 4IJCA 4O15A 1JYVA 1QVBA 2ZRVA 1W2PA 4IG0A 4JYFA 3VNYA 2WVDA 1US3A 2DT9A 4E2FB 2EG8A 5IBXA 4JN6A 5GPRA 4IFYA 2H5IB 2RFGA 1XGEA 1GT8A 2WW4A 3BZJA 4KBIA 4NLUA 3TJAA 2FJUB 3KWXA 2FDMA 4FYVB 3Q8PB 4FSAA 4UMCA 3D6TB 4WFNQ 3LTYA 5KZMA 4RZRA 3FAWA 2F40A 4JTUA 5TAOA 3W7OA 2J9YA 3LLDA 2VZ9A 3UN5A 2R94A 5LIUX 1RT7B 4JNMA 4DY1A 2CPDA 2ZBCA 4A8MP 3KG1A 2VQEF 4DPXA 2DZBA 3OHMB 4NRRA 2A6MA 3URAA 3SO7A 4CH0S 2WXDM 4DNMA 2FQQB 1L8NA 4LSZB 1B3WA 2B9XA 4FLQA 3UT0A 2VKRA 1X4CA 3D67A 2VICA 3WLQA 1RV8A 5ETLA 5FDLB 2MEWA 2VEPA 2PP0A 3GCWP 1SH2A 1D09B 3IJ8A 3D2WA 1EJVC 3CWOX 4JI3J 4U33A 1HHSA 1GORA 3UY7A 2QO3A 1EYEA 1X1ZA 3VD5A 1Y00A 1IR1A 3LCXA 5TBOA 4J91A 4ZEPA 3GU1A 3CIZA 4TY8B 4CGTA 1OC7A 5K8MA 1LDCA 2GGEA 4NZ6A 1C8XA 1KFDA 2QKFA 1OWXA 4JFVA 4PB4A 2JOQA 3JZUA 1T8EA 1YPIA 1V3LA 1HBOB 1IWPA 3BAWA 2I8EA 3NQBA 5I2UA 3MUXA 4FZIA 3MS8A 5AE2A 2AJ1A 1ROFA 4QOTA 7ODCA 4N9EA 1OY6A 3OW1A 3BAYA 1K7XA 4GACA 3IEBA 1SH3A 1ZP3A 5DG7A 4JV0A 3R1HA 3IACA 3AIUA 4URIA 2ONEA 5EBUA 2E5DA 5SZTA 3CUIA 2A3BA 1XGDA 4KRWA 2PDIA 1HVQA 1BQNB 2Q43A 4E0DA 1ZM2A 4NEYA 1KSPA 3GXIA 1P9YA 4JI8F 3MO7A 5BXIA 1L5UA 5A6BA 1B0VA 1EX8A 3N01A 3QSYB 5A8OA 5C2XA 5KOWA 3VD4A 2F6UA 3QJAA 3ZTOA 2QCEA 3DFTA 1UBPC 2WCGA 3L2IA 1EDTA 1VH7A 3NGDA 1W1IE 2Y3YA 3NURA 5D3GB 1Q5MA 3MA8A 1UOKA 4X22A 4PPDA 1SV5A 3H22A 4BKNA 1N32J 4ED3A 1AW1A 2HK3A 1VOMA 2JLGA 2DV0A 1TP7A 3T6JA 3MZIA 1F0XA 8RUCA 2CQCA 4HNCA 4WK3A 2ALRA 4ZO7A 3BR8A 3A12A 3L5LA 3W81A 4B5TA 3WIUA 4AYBD 3MZ2A 2MKIA 4B9MA 6AT1B 3WCZA 1E0WA 3G6LA 2OTJS 1L6YA 4C11B 1HNXF 3LENA 4QFUA 4ZOAA 3IM8A 1ODZA 4DCJB 4RBVA 3KLHA 3PSVA 3NPXA 2CQ3A 4YR2A 2ZHBA 5CSYA 2JFEX 2RVJA 2F4FA 1UD5A 1LTDA 4FI4A 3V1HA 2FHJA 5B0FA 2B81A 1TZZA 3H5UA 1TR1A 4QNWA 3UYIA 5HWMA 4LFBF 3FV9A 2BDQA 5E0CA 5T8GA 1FE4A 3BEGB 3TJIA 1FWFC 2XFWA 5EMUA 4LUSB 2ZX9A 2QMKA 1Y9OA 3PZIA 2NCKL 3HURA 2HZAA 3U7VA 4LVNP 5C2CA 3HPSA 1VK8A 3H2UB 1B1YA 1VFTA 1AA1B 4U9RA 5FF0A 2PDPA 3EZOA 2QMXA 4OOZA 2XHCA 3B3DA 1TJ2A 3MPYA 2CG4A 4D6EA 1VRTB 4DX8H 3K5XA 1SJ3P 3MVTA 4IOBA 1IBLJ 1XLBA 3TEHB 4JB8B 3GPAA 2Y5SA 3EKGA 2Y0SD 3A4AA 3MUZ1 4WRHA 4B02A 5KFBA 1OFQA 2XC9A 1HG3A 1F61A 1LRNA 1SC6A 3DYMA 4TU8A 1RWOB 3LRLA 1BYDA 2EFNA 2VFUA 3MCNA 1UJPA 4J3TA 3OR2B 4IOCQ 1UUOA 4WFAQ 5KT2A 4PYAA 3W63A 1EZZB 3PPHA 4Q0BA 1EH9A 2MDAA 2UUCJ 2DK2A 2Z8QA 3VC5A 1OIFA 4LS0A 4DPPA 1VFFA 1KBJA 1XSIA 1ZJIA 2PP1A 2RDWA 3A4JA 4QQ3A 2PU0A 1PJ7A 3THCA 3G96A 5L9XA 2K3IA 2BHZA 2WYSA 5LIKX 2O56A 2YA2A 1BXNA 3W84A 2CQ4A 5IC6B 4PWDB 3VZXA 3Q2TC 4USUA 4M7TA 4WP9A 3S9IA 2X1IA 2X7VA 5K4XA 2O7QA 4KJIA 4W8AA 3LOTA 4XD4A 1JDDA 1JAKA 4ZVHA 1OFRA 3GC2A 4BF9A 5D4NA 4K37A 4ED0A 4KFBA 5E9AA 4QHRA 1MG7A 4I9MA 3T6BA 2A3HA 3C0JA 3CMGA 4DUYJ 2HE8A 4KMQA 1ZCOA 5A8PA 5KZDA 3WQFA 1UEKA 4FF5A 1PO6A 1H1ZA 1JNRB 2D9PA 1PAUB 4OX7A 1X97A 5HOSA 1A0DA 2HMIB 1YLVA 2R8GA 4UR8A 3GU9A 3KL5A 5CSSA 2P9EA 4ELVA 5BW6A 3BW2A 5M2PA 1GOKA 3R5AA 4C3MA 1QATA 4QE4A 4QTGA 4H7VA 5AHEA 2WAGA 2CLIA 3MDUA 2VONA 1M53A 1XNRF 1QBAA 2BTMA 4YN3B 4PULA 5HN0A 5CQ1A 1ZENA 2GQ3A 4QR1A 1FXLA 3CYVA 4NLGA 2CZEA 3MMCB 2BZNA 4X3ZA 3TYEA 1YXCA 2HNZB 3UVJA 4ATLA 3KDOA 2A2DA 2E40A 2QV5A 1E6VB 3P7YA 3U02A 2FGOA 1Q8KA 2DISA 1JZ2A 3R79A 1VC6A 1LWCA 2FYMA 4ILRA 2W9BB 1S1WA 1N54B 4C1NB 2AJ4A 1S0MA 1MNSA 1XYLA 4HSOA 2AGOA 4WJXA 4DLFA 3M9OB 2ANUA 4IQLA 2POTA 3QRPA 3EWGA 2MKKA 3FNDA 3PX0A 2PMQA 4GC3A 4R34A 5KG3A 4A8NA 4DV5F 1HR0F 2RU3A 3MY9A 4HA1A 3CAVA 2EC2A 1K7FA 1KFLA 1TR9A 1R2TA 4OT7A 4UTWA 3NDZA 2MXYA 4ZVGA 2HHPA 2FTWA 2J0WA 3BS9A 4ZDNA 1YJUA 2A79A 1RHCA 2BMBA 3FMWA 1WXZA 2BGQA 1QAIA 3NXZA 3DDIA 4O1CA 2XVNA 1DXEA 3LP1A 3JXOA 2NUWA 2CZ9A 1KR1A 2XZ9A 2VZTA 4REQA 5IWAJ 4GO9A 4GKTA 4PG4A 1JCTA 4I2PA 1NK4A 4LQ9A 2VKZG 4ZFCA 3AOAA 3Q89A 1UD3A 3W25A 3ELHA 1VQOS 1VYPX 3AIQA 1UIOA 2GQCA 2W79A 3R5GA 2WCXA 3MECA 1V0MA 4X4UA 2J88A 3CASA 1R31A 2BA9A 4J9RA 1L3KA 1V5VA 1ICQA 1VP5A 5I42A 1JYNA 3R0DA 3O3LA 3L7UA 1W9XA 2AGQA 2A85A 6FD1A 3WQPA 2WMIA 4HKQA 5D9OA 3TYBA 3PIPQ 4YY3J 2D24A 4KKOB 1OT1A 3Q45A 3MYOA 3EEZA 3WNKA 3SV4A 4NLWA 1Q78A 3MMTA 2OOGA 3G6XA 3UA3A 3NNCA 2OT1A 4ZO9A 2FHFA 2HGLA 3T41A 1VYAA 1XCFA 3VGVA 2V5CA 5H8PA 3M0ZA 4E6MA 2HIQA 3CAQA 1NB2A 4DSJA 4ZE5A 1HQEB 1J0HA 4KV8B 2E44A 2L9WA 3GX9A 4X66J 3NQEA 2H54B 2YL5A 2N7CA 3LY0A 2XMTA 5FL1A 4WJBA 1G4EA 4YS1A 4ZXOA 1HJVA 2X1FA 2RAQA 1XRVA 2CNOB 1NBEB 2D22A 4J7RA 4IPLA 1X7VA 1KFSA 5AC4A 4UOCA 4DZIA 3HZEA 2C79A 4TTGA 4W92B 1LOSA 2FJDB 5D04C 4ETXA 4HNTA 1WBHA 3FSUA 1O95A 2AKWB 3CWHA 3LHTA 3GIMA 4JV5J 1V02E 1XQKA 1ZQ5A 3QO9B 3CTRA 4P7TA 3W3SA 1NSPA 5AXLA 4YEAA 4QYRA 1UD8A 4F3OA 3X1LB 2BGSA 4ERGA 3PZ9A 4HPNA 2LDYA 1O5KA 2VHGA 4KFPA 4AX7A 3N19B 1SIZA 4B3RF 2C8NA 2INFA 5DCBA 3M5ZA 2NW0A 3DGVA 2IUZA 4E98A 3GILA 3VGHA 1X1NA 3M6DA 1QNQA 2Q8ZA 3EGVA 5F0UA 2DY9A 1N33F 3WMSA 4DYKA 1RK6A 4JHZA 1OBAA 1A3HA 1O51A 1KO0A 1F9EB 4ZHRA 5BWAA 4OBSA 3VKDA 1MVYA 4NL5A 4I9AA 2YQ3A 1VBYA 1UKUA 2ZC3A 3C15A 1ELOA 4CTAA 3BKFA 4G1QA 1Z41A 3G1HA 2ISSA 3DC0A 1B3VA 3GH7A 2C15A 3P93A 4PMNA 3DLKB 3OL7A 1ZTTA 5IXUA 2PDNA 1XPYA 1BLIA 4ZP7A 3QLDA 3HX9A 3EYZA 1TFYA 2NREA 5J1EA 5FEWA 4O3RA 1SZRA 4LV9A 3GP9A 4DV7J 2UU9J 2K7KA 2BRLA 2GVZB 1BRLB 3EKZA 4MYAA 3KP0A 5JMUA 2XMMA 2J6SA 4OBRA 1VBXA 4ZSUA 1U8SA 1N8WA 1DQAA 2V2QA 1X4BA 2BY0A 3AXXA 4H6QA 3R6GB 3MKVA 2DNKA 1MSWD 3HOJA 2PDJA 2J62A 4ZBCA 2G2OA 1TG7A 5JXSA 1IEQA 4KERA 4B3OB 3ZT5A 3BOLA 2EJAA 3AIRA 4H6EA 1IV8A 2V50A 2KM8B 2W66A 3QGIA 2X41A 1RT2B 3TQEA 4KWSA 2PBGA 3R25A 4U96A 4R8UA 4WFXA 1FDZA 1PYFA 3I4HX 2HNDB 3B82A 5D30A 4WPAA 3IGVA 3VIKA 3OSNA 1N34J 3W6YA 1T0OA 1FVPA 2XIQA 3WLIA 2ZZ3A 3TMLA 3OT9A 4AD5A 2V5BA 2VXNA 4L80A 4NXMF 4WIWA 2Z1VA 3WSUA 5MKGB 2IC3B 5BYQA 3FSIA 3WNOA 4ECWA 2NZLA 3GNNA 3VF0B 4AZHA 3CTLA 4NA3A 2GK1A 1VDHA 1TTJA 1LQ9A 2EEXA 4LCQA 3WD4A 3N73A 3OBKA 3BKUA 5KFHA 2HHWA 4F02A 2QMWA 3QQWA 2HZCA 3B8WA 4XWUA 2FY8A 4PB3A 5ITHA 1KN6A 3TI0A 3C8FA 1TYGA 1UWAA 2V3EA 1YEYA 2XS5A 4ZCWA 3TUIC 2QDGA 5A2AA 4KEUA 3CYJA 4ZVJA 1NP0A 2XHWA 3MPUB 2E9BA 4QR2A 1EYWA 3UZXA 1OB0A 4OI0A 1S1PA 4B3KA 2B5JB 1YRUA 2QCLA 1U1LA 4QISA 1VBRA 4PFHA 2W2NP 2M0GB 3LHVA 3MPVA 3W82A 1RWKB 1Q6QA 2MANA 6ENLA 4GKLA 4A8RA 2XZDB 4LC8A 1MEWA 4UOGA 4USKA 4RW9B 4HNNA 3NSXA 3S2MA 1QVGR 1FP9A 2GA7A 2X2GA 1FCAA 2FQIA 2JH3A 2MSTA 3ITHA 5FJTA 4HTIA 1GKQA 3VIJA 1RCXB 2HK1A 4MKSA 5HJLA 2JQXA 1J2VA 4AXKA 4JI5F 2JJ4D 2QT7A 2V82A 4FOUA 1AQFA 3WNNA 1OJ4A 4GQQA 1W6TA 2XDFA 1LT8A 2VJXA 3ARSA 2DYAA 2PDAA 4MNKA 4ZOEA 4HOXA 3E2EA 2YZ5A 3TYAA 3M44A 4NMXA 1R3WA 4P72A 4KIEA 1J5EF 2GWGA 2OX1A 2RS8A 3FOKA 4CO1A 1FWEC 3AMDA 1FY6A 1IXKA 2WVEA 4IDKA 2WHJA 2POZA 2MGZB 2PC6A 1KOHA 4NF7A 1FWDC 3PPCA 2WO5A 3UI3A 4AH7A 3N2BA 3U7BA 2VMFA 4KFOA 4ITSA 1S1TB 1TTPA 1U1JA 1N52B 1KKOA 3GR7A 1WC6A 2KHDA 3NFUA 4UFIA 3VIMA 1TVRA 2Q01A 2IQ0A 1R6WA 2XS2A 4B5WA 4G1KA 1U6BA 4OLPA 2BZ2A 2JVRA 1H6KX 3QMQA 1LW2A 1KXQA 1AUSL 4ZVOB 2QL9B 2NX3A 3SCSA 4JKKA 4NYPA 4F04B 3BSGA 2VC1A 2PGRA 1U1HA 4EPKA 1HKKA 1KRBC 1J2WA 2HVOA 5KG2A 4Y6GA 2BODX 2J8FA 1YTEA 2LDIA 3E8OA 3HFTA 3IJQA 2P9GA 4W84A 1VBUA 1VK3A 3R12A 3PNIA 2WPGA 3NUKA 2LEBA 1K77A 4O3QA 4ZPAA 1WD6A 2XSFA 3SR7A 2VOTA 4GFSA 3NO3A 4Y9MA 3ZLGA 1V5IB 3C2YA 3I10A 1RAJA 3A24A 2OKTA 3TO8A 2RHSB 2WHMA 3DXBA 4PEKA 1CJKA 2W4CA 1RTDA 3HVTA 1IN0A 3MM6B 3DFQA 1QRQA 4CO2A 2H6RA 2Z1XA 4HYVA 4WJ8A 2G2YA 1I6NA 5G2HA 3TRGA 1GVYA 4C5YA 2KH9A 2R7OA 3HU7A 4ZLLA 3J7YU 3KM8A 2WSPA 2HWIA 3W5YA 2E29A 3EGWB 4YS2A 1W7WA 3QQ1A 2J75A 3A9BA 2FY1A 1ISWA 2VG5B 5D0HA 1NF7A 1WTBA 1FT8A 1SQEA 2PRMA 3ARYA 5AYBA 2Z57B 3BYRA 2J66A 3VNLA 2X09A 3HA1A 1LWEA 1QTWA 4L76A 1KNWA 1YJRA 1SZGA 4JIEA 3IARA 2VFHA 3ZSTA 4Z7YA 4H8UA 4N02A 2QFIA 3UVIA 2O01C 2PMZD 3NZ1A 5GAHU 5A8RB 4DV0J 2C13A 4I5XA 2GJFA 2E66A 2WSFC 4TVDA 2VCAA 4GUFA 4DAIA 3O8AA 3KVLA 1T3NA 2WVVA 2EPNA 3CNQP 3PY2A 1O6XA 2CC0A 3WLKX 1JUEA 4P5UA 3EOLA 1CXIA 4UXDA 3CCJS 1WORA 3A5VA 3LHUA 1GXTA 2IS7A 1KGUA 3MEDA 3LWMA 4H6RA 1J0KA 1YJVA 3C2EA 4N7QA 3DDKA 1OZMA 4PUKA 1YDOA 5KG5A 1X7IA 1XH0A 3TR2A 2DW6A 2O4QA 1ZCCA 3P62A 3HSJA 3QIPB 2F4VJ 3VCRA 1WDPA 5C2GA 2OI2A 2YWWA 5F3TA 5LHFA 2KRBA 2DNQA 4XIUA 2R6OA 4EMDA 3H7HB 1W56A 2ZWZA 4PUDA 4QU6A 2HS4A 4K1WA 3N6QA 4O1EA 1VCVA 3BBCA 3O06A 2WJZA 1D8ZA 3MANA 4B90A 1RY0A 1J01A 3BSNA 5D2YA 3FXGA 4RL3A 5EX0A 2ZC4A 2DITA 2CG8A 2JEPA 3URQA 1NOWA 3TJXA 3PEJA 1PCWA 2JE8A 4FXDA 2XO6A 4WEVX 1OVDA 2GUBA 3FBBA 2G1HA 4FZVA 3C2FA 2ACQA 2F2KA 1PYOB 4PXBA 1HI8A 3S83A 1GQEA 1Z2ZA 4L1XA 5EGYA 4R9OA 2Q8XA 4OWGA 3LCFA 3HFYA 2N3OA 1VC4A 1EHAA 4LVOP 1R30A 1JLGB 4OI2A 1X4HA 1XG4A 1BUXA 4CD5A 4H4OB 1JCNA 1X9WA 1VAHA 1XERA 3NPVA 5HMWA 4N9BA 2AF6A 4POCA 1F6TA 1O5XA 3BGOP 1LJYA 4GQGA 3PBVA 3AIEA 3CJ5A 2EG7A 3S9YA 2HW3A 5A8QA 5CPOA 2F8HA 1X6LA 3BAJA 1JLBA 5CXPA 3EGZA 3H7RA 4LXFA 4CNYA 4A8SA 1IT8A 4K6AA 4ZMMA 3C3UA 3LGMA 1NSKL 3GXPA 2WK2A 2C28A 2HK2A 4JPGA 3TNOA 1S1RA 3BBBA 1Q79A 2N3LA 5B0GA 4A3UA 3V0SA 3CS2A 4WIIA 1TU0B 2ZFHA 1QWGA 4JTAA 1S2VA 4A48A 5IQ6A 4L6HA 4PQAA 4ROQA 2AT1B 1T7LA 4JL1A 1UCWA 2KVQE 4FKYA 4F2TA 3CLWA 7ENLA 3BH6B 3LG3A 2VEGA 2WZHA 2WVCA 2BJEA 4DO5A 1ZP4A 2RGLA 3EX3A 1JQXA 4PG6A 5GQBA 4AVFA 2YNGB 1JZ6A 4YUDA 4K8HA 4H8VA 4RUAA 1SKUB 4X4TA 1XBZA 4JTDA 4B5VA 2J76E 4QCLA 4DUZJ 2ZKTA 4DF1A 4FK9A 2QUMA 2RDIA 5ETQA 2WNQA 3BCJA 5K7JA 4I90A 3DRYA 4BWLA 2R8WA 3H2LA 4LOCA 3FN9A 4UOJA 3K5LA 1U2YA 1GVSA 3KRBA 4I68A 5A8KB 3WZ0A 4OJ1A 3HXMA 4FXWA 1XMOJ 1TIMA 1JDEA 3RAXA 4XQ6A 1B7YB 3CV1A 3OTEA 1A53A 3CHEA 1Q5YA 2XZWA 4H9UA 1OD0A 2IVMA 4MKAA 3B4YA 1SUQB 3ARTA 3CJ2A 3HT0A 4C0OC 2ZA3A 4WDTA 3LPGA 2QCCA 1EIBA 3KHDA 3PIOQ 2W2QP 2Z6JA 5LM7E 6REQA 3KOZA 4A29A 2M4MA 1FHTA 2BE2A 1K8YA 3LPFA 4XDCA 1Z2LA 1HPZA 4WOQA 1ICSA 3D6NA 1EJSC 5J2QA 3NOGA 1R8LA 5CPSA 3HPOA 3UETA 3F5KA 4AZCA 1E1CB 4UTJA 1RAEB 1A5SA 1R8HA 4WGHA 3OVRA 1GVRA 3HHLD 4O10A 4H8HA 2XI2A 2UUWA 4B2DA 3FC9A 4NI2A 2CEQA 2ZUSA 1WELA 1HKWA 2BOGX 4IJBA 3GV8B 3FLUA 1PDZA 2K3KA 2KG1A 1ICEB 1FF2A 3I0RA 2YWHA 3UPBA 4HD5A 3JW7A 2AP6A 1R0BG 1JVNA 3IIZA 2C3OA 3PW0A 1OY9A 1IZKA 3HVWA 1NQ6A 4I2QB 1DTUA 2DH8A 4AXJA 1L3TA 4J4KA 4LVFA 3VDHA 3OL9A 1SJ1A 4HYRA 3DLHA 3H2OA 1UJ4A 3U57A 3N17A 3VVGA 2AJ2A 2CKRA 3FJ4A 2VM8A 5E5NA 1DL3A 3VD7A 3HG3A 4RUBA 3JSBA 1KVIA 1SIWB 1T9VA 1Q5VA 4CLLA 3BANA 1URRA 4HI2A 4RE0A 4E4PA 2D23A 1F07A 3ID7A 2R2SA 1C1BA 2QDHA 1QHOA 1FCVA 3LCHA 2O92A 2PD9A 4CD6A 1BPLB 1ZHAA 5AJ3J 3JQJA 2Z1KA 1TKZB 1FWWA 2J7HA 3K2YA 3J81Y 1R89A 2BKOA 2PMWA 3DMJA 6XIMA 1IWGA 2CXEA 5A2QU 1GXLA 1Y5NB 3N2CA 3RR1A 5E3AA 1URNA 4IRCA 3MSYA 5GNZA 4KT0C 1NOFA 2DVUA 2FZDA 1VKFA 1GMWA 4KFNA 2BWGA 3C4UA 1C7SA 2P3ZA 3RCMA 5GMKa 1UMYA 2ZUWA 3MEEA 2V8VA 4YHEA 2WM0A 1UP2A 3T19A 1XBYA 2V4JA 4EPEC 1KOOA 2LLEA 4WP8A 2XYPB 4D3GA 2NR0A 3GTIA 2YR1A 5I3JA 1UP1A 4Q7AA 3QJLA 1GCYA 1U02A 2BY1A 3KL0A 2D2GA 4CVUA 1GWJA 3GTFA 2RDXA 2Y7DA 1ALDA 1WX0A 2YGYA 2WC4A 2B7CB 4CEXC 5HR6A 3QZ7A 3TUZC 1MNEA 5JXQA 4F0RA 3T81A 3GSDA 2DIKA 2QUNA 2GJNA 4FA3A 5C55A 1CQMA 4IG3B 4DU7A 4CUCA 4W5UA 4Y34A 2KYXA 3SQOP 4NAFB 3MJMA 2W9CA 3L4XA 1JQVA 2HHHF 3K5NA 2PCQA 4QWAA 3I5CA 2GCFA 3P0WA 3VV2B 3RB0A 3W6LA 2BLEA 1TJ1A 3H4GA 2XMVA 3W76A 5KOXA 3BUVA 2GGGA 2XCAA 4W8LA 4Y2MA 4F9JA 1TUVA 3Q37A 4RZ4A 1WOOA 3L9ZA 2Y1IA 4EOUA 4NJKA 3POCA 4IGMA 3IRDA 3I6TA 4D6IA 4V1YA 3H54A 4PTDA 3MPWA 3PR4A 2TSYA 3KK3B 3AICA 3TW0A 4DHGA 1HL9A 2G37A 3GC5A 3K58A 1OFOA 3ENLA 4JX6A 3CV7A 4H7CA 4LBPA 3NRBA 2MQOA 4LBRA 3CXOA 1AUDA 5EHHA 3TIMA 2FHKA 4BF5A 2VCCA 3C0LA 3K17A 3QW4B 4MNLA 3BDPA 3ARZA 1FK9B 3ZZTA 1RQEA 4NNBA 2F7VA 2AQ4A 2GVGA 3PCOB 1LWJA 3O6AA 1B30A 2ERRA 4MY9A 3T5HA 4N76A 3NZRA 1CIUA 1M7XA 2QW5A 3RCYA 1EKOA 3S47A 2FVCA 3A4XA 2NXJA 3TUJC 1VFJA 3V6DB 4ZVTB 2RD5C 3SUVA 2FB3A 1MQRA 2J7DA 3V5CA 1AJZA 5DQPA 3IANA 3GVRA 2GGHA 4ZMGA 3PW2A 2J7WA 4TX8A 4DR3F 2I9SA 5AVHA 4ORMA 4M5IA 2DR6A 1OC5A 2NQLA 3NZQA 3F4NA 4ECUA 9RUBA 3FEMA 3WK1A 3BDEA 2YKNA 3WQWA 1S10A 4ED8A 3SW6A 3RYSA 2CCRA 4ZO6A 2YNHA 3H6OA 3M8ZA 1C7TA 1FFRA 1GKPA 4U3AA 4YWIA 1LLWA 3D5MA 3QY7A 3HN3A 4I6KA 3I31A 4JS3A 4HTYA 1HT6A 4F4WA 1X39A 3WENA 2DNLA 4M95A 1WKJA 2OPQB 3LN3A 3NAVA 5KFMA 2Y5JA 3LA0A 1EUAA 4WSJA 1E51A 3UZWA 4HJFA 5B0CA 1SH0A 3KLFA 3BG5A 3G8SA 4F67A 5F8JA 1J11A 2QF8A 1VBGA 4LQ1A 4IQXA 1OX5A 3NM1A 2NUYA 1LKZA 1EQPA 1ZAVA 1Q7LB 1SR0A 2BJ8A 2QCDA 1DLOA 3RRXA 4M5HA 4A3QA 2DSKA 1GYMA 2RQMA 2XGIA 2CPIA 3GIKA 2GUYA 1G0CA 4ANDA 2VNCA 3H21A 3AXKA 2LECA 2YH1A 1RE1B 2V2VA 1QJHA 3ARQA 4CQAA 3PBUA 1NH8A 1TTQA 4UY8T 2HS0A 2PIIA 4G56A 1M03A 5GAEI 5A6PA 2UZAA 3KHRA 4ED1A 1M1GA 5CJNA 1J2BA 4YL2A 1W1TA 3ZZPA 3PHEA 3OR1B 4YNGA 3MI7X 1EXPA 3UXLA 1OFPA 4HZMA 4F3MA 1P0KA 3DI0A 3OEXA 4IZGA 3BVJA 3RLGA 3GS6A 4Q8PA 3S0CA 1UROA 2C0AA 5BU9A 3OBEA 3Q65A 3KKFA 3I4KA 3NQ7A 2K8GA 3GYNA 3AY0A 4F4KA 3H90A 1DZ5A 4E4UA 3WDJA 4W8BA 3CO0P 1VJWA 2Y0FA 4OJYA 1E72M 3N04A 3G1XA 1UQZA 1FRIA 3M30A 1HNVA 3LLFA 5ENLA 3UCZP 4WLCA 3QFWA 1OFBA 2ZCGA 5REQA 4K68A 2NQZA 5FLXU 1XRFA 3DGRA 4ZPDA 4LF5J 3M8QA 4CYUA 4ZP8A 3HHLC 3TLQA 1H0GA 4C6AA 5H1WA 3O1LA 4QLLA 3UDEA 4XDDA 2MZ1A 2GJXB 2ZXBA 4KGXB 4U6PA 2GQ2A 3KRUA 1BD0A 3OTCA 4GK8A 4AYGA 1YK9A 4LU0A 4ID5A 4PXCA 4L4LA 4PUOA 3EM1A 3FDGA 4ZVRB 3ZM8A 4WXZA 2AQVA 2PPGA 1PAMA 4H4IA 3SI8A 3PJUA 2IXUA 4CCCA 2E6DA 2Q1LA 2I0XA 1EJWC 4IUFA 4EI2A 3TX9A 4ERAA 2HQCA 1UR0A 2HS6A 4H00A 4MMWA 2B7OA 1FWCC 1XYFA 4DCOB 2CQBA 4QIFA 3CNYA 5KG4A 2QHAA 4B9UA 4MF4A 2PBOA 1UFLA 3C14A 1SBRA 3DOMB 3TR5A 5I7GA 4ZVQB 4WKFA 3NS6A 5DDOC 3KWMA 2VUGA 1RAAB 1R0AA 1FNMA 1N5QA 3TOYA 3GDTA 3LGDA 1SC1B 1V77A 1H3GA 4JIPA 1W1PA 4KW2A 3N9KA 4WK1A 4RJVA 1PX8A 4R7WA 1XIHA 3NQAA 3B04A 3BG9A 4MJKA 2RF2B 1ZAXA 4FB7A 3RW6A 2VHLA 4J9VA 3S5OA 2JFKA 2B4OA 4H4KC 1QPOA 5FACA 4GH1A 4AD4A 4GNJA 4NA1A 3CL6A 4C65A 3OXLA 1EDQA 1VCTA 3C2OA 1AZ1A 3AS2A 3G0XA 1DY3A 3BQ0A 1R38A 3IRXA 1RHKB 3P45B 2IAJB 1YWXA 1HP4A 2YCEA 3M2UB 3R8RA 1TA3A 1BEUA 5LNVA 2AX0A 4DJDA 3VGFA 1NJIT 1K70A 5A6BD 1MN7A 4YIWA 5G0RA 3DFPA 4GIEA 2E25A 5FJOA 3U4AA 3IPWA 3R94A 3QAEA 4U8YA 1C0UB 4OHZA 1PB0A 3IJ9A 1QTNB 1TL7B 4W7VA 3JR2A 1E9IA 2ZKMX 2YXLA 2FC8A 5I06A 1VEPA 4DR1J 1JZ8A 2DNHA 1X1OA 1M7PA 4NZ1A 1VQ6S 2XH2A 1XYBA 4BR1A 1YXYA 2DCLA 5C25B 3CPUA 3MWAA 1BGXT 2N7YA 3WD2A 2F84A 4GC7A 4K7YA 1K1QA 1VQ4S 2BVZA 5D09A 3NOYA 2FJKA 3ISND 4RO0A 1BLUA 2OX4A 1N36J 3IMQJ 4DF0A 3TMQA 5B7ZA 3MV11 1FHLA 2F2HA 4DO6A 8CGTA 2FVMA 3SDOA 1YRTA 3LNMA 4F36A 4J9QA 5MF5A 5G4EA 2VPXB 2UBPC 4NZ5A 3MJYA 2IY5B 1MO0A 1JJCB 2BJ1A 1KFEA 3CL8A 4QWBA 4IG0B 1QSYA 1QR7A 2WMHA 1A80A 7A3HA 2WWCA 1P0BA 3M8WA 4J5OA 3C52A 2KU7A 2KX9A 3KOYA 2B4GA 1DTTA 1WZKA 3QMSA 1UKOA 3MB9A 1H1YA 4C7FA 1SJFA 2XMWA 2O4MA 1KV5A 3O6QA 1XMQF 5U4NA 3W7MA 3O9NA 3OVAA 1FTCA 4L9YA 1FXPA 4UFHA 1I2PA 4NZFA 1YZ7A 1LORA 5HSPA 1RD5A 4IL2A 1NH7A 2DJXA 1XNQJ 1T5AA 1OF8A 1W8SA 1U26A 1NWUA 4DHVA 4XV0A 1EF3A 3C6UB 2XLKA 3MV01 2G3FA 1TKXB 1OC6A 2ASLA 1TL3B 1U0SA 1PC5A 4XTIA 3US5A 2JGYA 3NYDA 4DWIA 2EK6A 4NA2A 3R5DA 5BR8F 1OYDA 4ED4A 4YB7A 3CIXA 1TL4A 4ZJLA 1R6YA 5K8OA 4YCOA 2QIWA 3A23A 4XO7A 5DO2A 4OV6A 2CKWA 4J2MA 2ADCA 3K8KA 3H2EA 3S46A 1S6UA 4XD3A 1XGZA 1XEZA 3CPGA 4JFTA 4N4QA 1KTQA 2BBEA 3O1NA 2MHEA 2WZEA 3I9V9 3PUDA 3GJRB 4TV6A 4MJ2A 3T2OA 2V9WA 4RW3A 4P74A 1EIXA 3GG1A 4M6VA 3EDDA 2FH8A 3GKAA 1QI5A 4HU8A 2XM3A 4NCBA 1J0YA 5CAHA 3P49B 1TJ0A 2HBZB 3NSNA 2Z56B 3RRHA 5DMLA 1XMBA 4EPDC 4DLEA 3VMPA 5FJIA 2PT0A 1LUCB 5LGXA 2PGFA 4GX8A 5T7LA 3DBPA 3PUOA 3VNJA 1NEEA 4AC7C 2B4PA 1TFVA 5I09A 3NIYA 4O1AA 1N5VA 4Y2CA 4UQ9A 4F2RA 2AL2A 1FKAF 4MB3A 4ZPTR 2G41A 3MHGA 4HP5A 1DKWA 3WLTA 2GUUA 4MWAB 2YYTA 1CI1A 2BOFX 1E3XA 3AWNA 1TPWA 4JTQA 4OMFG 3RB6A 3CD6S 4IP4A 2V3GA 2GGPB 1Q6EA 1XQLA 3GDKA 4DJEC 3UWWA 4WKYA 5L1LA 1VC0A 1PUDA 1ZS2A 3DFOA 1YRRA 1R9YA 1T99A 4BQ5A 3LPOA 4CO4A 1BY9A 1R43A 1XWLA 4XO0A 1ONEA 1L3SA 5JU6A 1FA0A 3ILIA 4Q4SA 2R2TA 1AL8A 3LM7A 4C8OA 2FFCA 4Q8MA 1QDUB 3S01A 5LMUF 3QH2A 5JVGQ 3HM7A 3GK0A 4K0KF 5XIMA 1KONA 3IM9A 2MQQA 2GIQA 4MDOA 1JYXA 1HARA 1S9FA 1H5VA 2NX1A 4EYIB 4DFJA 1RA6A 4Y7EA 2B4VA 4QIEA 3ES8A 5HPOA 3P60A 3PYGA 1A47A 4TQTA 1FH7A 3C8YA 4K39A 1L6WA 2CQ1A 4U3CA 4KQNA 1E40A 4P7NA 4NX0A 1IQTA 2A1YA 3MUAA 5D77A 3KLHB 3OXGA 5ABHA 2RDTA 1J8VA 3PXGa 4CN4A 3ZVIA 1ODUA 2D0GA 2NX9A 3OODA 5A6MA 2CNLB 2XNQA 5U7SA 7CGTA 3R1LA 4CVWA 5EFFA 2A3CA 2XN2A 1TWZA 2X42A 5H91A 1YRXA 1BF2A 2HNYA 4KH0B 4LF8F 4JTKA 1DHPA 4MGGA 3F2BA 1T03A 3LRMA 4K8RA 4IFOA 4X84A 5FSDC 1OG0A 5D32A 1JG9A 1JXLA 4USJC 3BAXA 1TTIA 4PTWA 4W89A 2OSRA 5D4OA 5BYWA 4LMZA 4OZOA 4Y3CA 1TPH1 3KJQB 3GIIA 2DIUA 5C71A 1HQUB 5PTDA 1KBKA 3OBAA 4QYZK 1UMJA 1NY1A 2R8HA 4IX2A 2MLZA 3L09A 3G1AA 2Z1WA 5CXTA 3R5BA 3LW5C 1O0PA 2IKGA 4G5DA 3P61A 4YTQA 3W66A 1E0XA 1MRAA 3L7PA 5HMDA 1F5AA 4CT8A 4QWEA 3DCAA 4NIRA 2VBXA 3FZBA 2ABBA 1RTJA 3PFRA 3V0TA 3RX3A 4ZLNA 3ILLA 1L6FA 5LMNF 3MI6A 1W5PA 1I1GA 2Y1RI 4FVCA 4K59A 4EF8A 1PO9A 3GDBA 5KFOA 3MUTP 1VQ8S 4Q22A 3CJTA 2GO9A 4DDFA 3FIGA 1RTZA 1W1YA 1Z42A 2DH3A 3PB0A 3KHHA 1NDCA 2QJMA 4GX9A 1CXLA 1VRUA 5LXRA 3M1VA 3SCNA 2PF0A 3A3PB 3QGVA 1HJWA 4XG1A 3K57A 1ONWA 1KQZA 1FWGC 2X3DA 3UR5A 2RDDA 1RWVB 3W1PA 1KFCA 1W1A1 3BB5A 3J80U 2DH2A 2W4PA 1T0TV 1US2A 3I96A 5ABGA 2QQ6A 4MAZA 1YJ7A 1HWKA 2WM1A 1MWZA 5KFVA 2DNOA 2E1WA 3QFEA 4QWCA 4FLRA 2W2PP 4Q4MA 5IM0A 4GIRA 3NG8A 1D8CA 5HBMA 1OGBA 1FRLA 3K8WA 3HVAA 2A1BA 1RYRA 4LAKA 4AFFA 4NXSA 3FAXA 4ES1A 3U1LA 4IOTA 1GVEA 4QE5A 4JV5F 3HP6A 2ZH1A 4KFBB 1EGMA 2ZWPA 5HVHA 2Y1JA 1MUCA 4M5GA 4G2DA 1X4DA 4F0KA 3JUGA 1H73A 2R2RA 2FDSA 1A5NC 4GG9A 4BJHA 1XJBA 4DV3F 3PZOA 1BYAA 3ISNC 2KXNB 2OZ0A 1HGYA 2PU1A 2IM0A 4E8DA 5HLFA 1YW1A 2NYIA 3V5FA 2ZNYA 1G7VA 3TQKA 1ESWA 4GNVA 5DELA 3THAA 1AW5A 3MFHA 1FBAA 3D0IE 1H3DA 3LNPA 1BMQB 3BSMA 1GUVA 2JIWA 5CYMB 4YB5A 3MEGB 1Q4WA 2MSSA 4QX4A 4H4MA 1DBTA 3DECA 2WNWA 1H72C 1RXOB 3DZ1A 2ZH9A 5FF2A 3VCDA 4ZVEA 1M01A 3GM8A 2OJPA 3EVWA 3VI2A 4GYPA 4ZCLA 4UTTC 3W60A 1CXHA 2HURA 3PKMA 3UVJB 4UUWA 2CITA 3FGCA 3O07A 4G8TA 4XIAA 5B08A 4J9LA 3VKAA 2CVIA 3TK7A 2EHHA 4O0KA 4ER8A 1PGZA 1LWCB 3R6LB 4XZHA 2QV6A 1S1WB 3PUEA 4HPGA 4FF3A 2GQQA 4ZSTA 3IGXA 1FOBA 4N7TA 3GXMA 2MZSA 3LANA 2UU9F 2HVEA 4BZYA 7REQA 1Y10A 4E2DA 2JIEA 5L38A 3DFSA 2DPEA 4GH3A 2HGNA 4PRFA 1H51A 3SZ2A 1TIWA 2VT0A 2C7FA 3WC2A 4A21A 3OLEA 4QR6A 3OQ8A 3UD6A 4E3VA 1UA7A 1D7FA 1W1B1 2NT0A 3ANUA 3WK2A 1NDVA 4B3SF 3GIQA 2VR5A 1RPXA 4DWSD 1EUNA 1C4CA 3LP1B 1A5CA 1F9CA 3EA3A 1IKVB 4RNNA 3PN8A 1KEKA 4REQB 3RFAA 3MW7A 2VI0A 1SM9A 1U2RA 5C9WA 3JAMY 5J5RA 2JEJA 3TP4A 4JI7F 3SM0A 5DXYA 3PB2A 2XMUA 4TOQA 2RGMA 4FBUA 1N34F 4JTRA 3RILA 2QEZA 3P6LA 3QGHA 4R0EA 3OJUA 3WL0A 4LY4A 4E8UA 2PE4A 3GG8A 3T78A 5F2MA 3KG4A 4GQBA 4A2SA 2VP8A 1B64A 1NLKL 2FZ9A 4FF7A 1BWVA 3PVFA 5B7WA 3C2PA 4J27A 4K4TA 2REQA 3ABXA 2OD6A 2EBNA 3TNBA 4OTKA 5KTLA 2NYHA 4MZ1A 5I3DA 3MCMA 1MI3A 4RUHA 3LS9A 3SCWA 3ZNUA 3T40A 2VO5A 2KAUC 4ZOCA 3AROA 5G1TA 4XZ9A 2BR0A 5CSRA 1OGGA 1CGVA 5M5DA 1G4SA 3CMAS 4Q8TA 3N4WA 5A8WA 1R3VA 4Z2IA 2WPBA 1CULA 4O12A 2W8KA 1C93A 1VQTA 4OYMA 3KXDA 2LMIA 2YWKA 4EWTA 5L8RC 3UWVA 2AL1A 3LUYA 2W92A 2Z2ZA 4AL6A 2ZBQA 4HNUA 3AZTA 2CPJA 3RU6A 4NY2A 4IIHA 3QFHA 1MW2A 3ILJA 1Z4UA 2UXBF 4QPXA 1HP5A 2OO6A 4IGNA 4X4NA 4DPQA 4O8RA 2Z2LA 3NAHA 3UXKA 1RALA 3WKZA 4Q8UA 4UT4A 4M3PA 4JEQA 4P8UA 5KSWA 2IDEA 1XFBA 3CJPA 5IRPA 1WTFA 1UZHA 4LUYA 4AZIA 1CJTA 4JTEA 2R8KA 3KS6A 3TJLA 2XYHB 3AQOA 3KK2B 3QGKC 1PX4A 1A3WA 4IPIA 1RT4A 3QRRA 4IH5A 1RA0A 1UJ6A 3K30A 4DX5A 3JTPA 3NCRA 3CGIA 3NGKA 1RZMA 4WX2A 1D9FA 1VZWA 1HBMA 1T3OA 4CI0B 2ZE3A 2VQEJ 4QJ3B 4RX0A 3UFCX 2NZ4A 3T1YF 3DOLB 4Z17A 4Q8EA 3NZGA 4I5UA 2MYFA 3W61A 4KY3A 5DX7A 1UJQA 4GVFA 4X2RA 2ASDA 2MJNA 3AS0A 4X2BA 2YFNA 1TE6A 5FIIA 1MW3A 3HMCA 3ITTA 1U1UA 3LV6A 4OU1A 4E2BA 1MZRA 5EA9A 1KLYA 3C15B 4CTAB 3QW3A 4G1QB 3IR6B 4JI0J 1V8EA 2J7KA 3FYOA 5XIAA 2LCWA 4DF2A 4GKJF 4UTWC 2DT1A 1OCBA 4F0HA 1AROP 1XCWA 4WHBA 2J7UA 1PKUA 4QIGA 1HW6A 1KA9F 3PWIA 1LWHA 2Z0GA 1H5YA 4KESA 2FJVA 2KZMA 2HAIA 4JHMA 1K6WA 3D9BA 5E9XA 4LSLA 5I77A 3CZ8A 2DHAA 2HWGA 4NZ0A 4O57A 3B9DA 3M5YA 4IQEA 2DR8A 1HWIA 5J1EB 1NJZA 2X7WA 2CIPA 3ARVA 2R7UA 1E70M 3VILA 3EICA 4IR9A 1CJVB 2DEPA 2OH2A 1F6YA 4F0MA 2WZ1A 3FSYA 3H5SA 3KLEB 4TN2A 2X0YA 1OGSA 3NA8A 3QR1A 3QV9A 1TKTA 3AHVA 4B9NA 1XUUA 2HBQB 4WQ6A 4B4HA 1DURA 4TUFA 4GJJA 5D8WA 3NY0A 1KQFB 1D9DA 1Z48A 4JI8J 4FAMA 1X4GA 2BM1A 4JZ5A 4G1NA 3RJMB 4JFUA 4BBYA 5IOBA 3NTYA 4JIHA 2FHOB 4K38A 5F7UA 4O50A 4KGJA 2L48A 1W2VA 3IAM9 1RP5A 4R8UB 4RK8A 2HSAA 1YG0A 4LRDA 2ASJA 5MHBA 2WMGA 4KT2A 1ISZA 1U47A 3RR8A 1X6NA 3ZOAA 3VCCA 1KQGB 1NSAA 4FS2A 1T9XA 4ZVSB 1YJ9S 1XYCA 5D02A 2XWXA 1NWRA 1ME8A 4HZ8A 4X61A 4HT7A 3I7QA 3AJ1A 3ZO7A 2GK1B 2QLYA 1U5VA 1S1UA 5HO4A 2G9OA 3FEXB 1E6QM 1OFAA 1TZ9A 3M2RA 1HNXJ 4QCEA 1LG2A 3OPSA 2FGLA 4FPIA 4J7CA 5CBIA 2QDDA 2HZGA 1U5JA 1V6VA 1VBZA 1FESA 3CT2A 4WU3A 1Q45A 5D8HB 4EZ9A 1DJNA 1P7TA 1YHQS 4LJMA 1OZQA 4M80A 4C1LA 4IUOA 1S2AA 1U5HA 3FHQA 2NXIA 1JXJA 4XAPA 3DHPA 3ENQA 3KJVB 3S1WA 1L0PA 2HS3A 4PRRA 2Y8VA 5I3PA 1ISVA 1VR6A 3GHSA 1DWAM 1ZETA 2A7PA 4JTGA 3ITHB 2RUSA 4JN7A 3LBMA 3ATYA 1RDRA 1JD9A 1XN9A 3CCTA 3DM2A 4RWWA 4XAKA 2Y85A 4J1OA 3M07A 4FXSA 2GJIA 3KK1A 3VZIA 1WDQA 3ET6A 1KFKA 2CFFA 1TPUA 2NLWA 1GOMA 3TUPA 1FRXA 5F2LA 2WNZA 2UY5A 3SQMA 3CIMA 4GKKF 3TYCA 1HD0A 4CD4A 4TLQA 1Y65A 2DUXA 1VQ7S 2W6RA 2C22A 4J2PA 3R5JB 2AEMA 2DGSA 2IQTA 3HM9A 3UR8A 1YBAA 1S5ZA 3KJNB 1WCGA 3QGGA 2ZZ2A 4DSFA 1Y3JA 3T0BA 3BDKA 3KAOA 4MZYA 1TVRB 3KFTA 2A3JA 4GMEA 4ED7A 1WAUA 1C0TB 1FHDA 5DEZA 1LW2B 5H1SV 2WVSA 3VUPA 2WMKA 1P48A 1Z7AA 3SQGA 4PCQA 3INPA 4L6V3 2AMGA 3WUGA 4IFVB 2WW5A 3WBAA 3O05A 3M1ZA 2VFRA 3B0UX 5BZAA 3FGVA 3Q22A 1VGYA 2G3MA 2Z2AA 2DHXA 3OVBA 4C6EA 3ZWSA 4PBEA 3AS1A 1GYNA 3DLJA 2OIHA 4LUBA 3TFCA 3FZ2A 3H8AA 2HRUA 4O4GA 3L65A 2JRSA 3L4TA 1SSDA 3A22A 3UNYA 2P2CB 1VFLA 5KFKA 1EKRA 3D0HE 5B0AA 3GUGA 3U7JA 4IFKB 2UUTA 1U8WA 2P9CA 1QLNA 4DQPA 1RTDB 4AMAA 3QM3A 4Q3MA 3WBXA 3HVTB 1LWXA 5I3FA 1TV8A 4GGHA 4JY9A 2F65A 1OCJA 4C6NA 5LIXX 5CCLA 4B5UA 2ZBRA 2PDKA 4L4PA 3M5XA 3VGEA 4ELTA 3BLKA 2W91A 3SUTA 1LCOA 1K03A 1UD2A