3PJXA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, p32
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
430
structure length
423
Chain Sequence
b'AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 155
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjxA01
4RNFA 2IMWP 2DPJA 3JYTB 4I7FA 1HYSA 3MEGA 1N5YB 3QIDA 3M8QA 3KLHB 2B5JA 4K50A 2IBKA 3H5SA 4J9KA 5HBMA 4J9OA 3PW2A 1FKOA 4KHRA 4IG3A 4ZPDA 4ZPAA 3JYTA 1ZTWA 1HPZA 1N5YA 3SY8A 3T1AA 3KLHA 3PW5A 5L1JA 3HKWA 3GQCA 3CDUA 3LALA 1VRTB 5DQHA 2WK4A 1TL1A 2FLPA 3GIIA 1Z4UA 4HU3A 4AFYA 5KG3A 4RUAA 2ATLA 2C2RA 5L9XA 1QAJA 1EETB 5JXSA 3QGHA 4ED8A 3VQSA 3NAHA 1N48A 4NRTA 3BQ1A 1S1XB 1WNEA 3MR6A 3SFUA 3HVWA 3QLHA 4RW7B 1LW0A 1EETA 3MEDB 2I5JB 1D0EA 5F9LA 3H4BA 4JV1A 3Q8SB 5C42A 3KLIB 3N6LA 2FLNA 4QWBA 5F8GA 2W8LA 4NLYA 3DMJB 4MK8A 5KFZA 4O3OA 1N4LA 1S9GB 2IM2A 3LP2B 3QGIA 2YNFB 3QZ7A 4K4UA 4DL5A 1SH0A 4MFBA 3KLVA 4J9QA 5KG6A 3DMJA 1FK9B 1XR5A 3Q8RB 3CVKA 1S9GA 2IAJB 1QE1B 3DOLB 1GX5A 3LP2A 4WXOA 2YNFA 3DYAB 1HQUB 2HWIA 5KFVA 5EUHA 1JKHB 1S10A 5F8LA 1FK9A 4OL8A 3OL6A 1R0AB 1C1CA 5KFOA 1RT2B 5I42B 3E01B 4ID5A 4LSNB 5HP1B 3DYAA 1HQUA 1SH3A 4NLUA 3HVTB 5DQGA 1JLCB 4ECQA 4DL6A 3BSOA 4B3OB 4R5PB 1JKHA 3QYYA 4TYBA 3LAKA 1DTTA 1R0AA 4NLSA 4G3IA 2R2UA 1RT2A 4J9RA 4LSNA 3ITHB 4NLWA 4ZVGA 5HP1A 4WYWA 4HJFA 1RT1B 5I3UA 1JX4A 1FKPB 5F8MA 2E9TA 3IGVA 5M1TA 4EBDA 2UUTA 2IM0A 5KFQA 1RT7B 3ITHA 2RF2B 1C0UB 4NLDA 4F48A 4LJ3A 4F4XA 4Y3CA 2C2EA 3T5HA 2QE5A 2V0NA 1JLGB 4MKAA 4XPEA 3KK3B 1S9FA 2RF2A 3GFYA 5MKGA 1C0UA 1BQMB 3OLBA 3DRPA 3LP0B 2BQ3A 3GV8B 4ZP8A 3M9MB 4TY8B 4ECWA 1JLGA 2YNGB 5KFXA 5C5JA 4ED1A 3KK3A 3PJTA 5KFMA 5KFHA 1BQMA 4ED0A 2I1RA 3LP0A 3NMAA 3KHLA 2ZKUA 4MKBA 2W9BB 3HVAA 1ZETA 1MU2B 2R8HA 5K14A 3GFZA 4EBCA 1TQLA 2UVVA 2J6TA 4FOUA 1GX6A 5CYMB 4ECXA 4ECSA 3BSNA 3H5UA 2XGPA 1D1UA 2V9WA 2E9RX 3BSCA 2HMIA 2VG7A 2W9BA 3KK2A 1SUQB 1S0NA 2IJFA 3N6NA 5T14A 2AWZA 3DLGA 4U7CA 2C28A 4EO6A 4ZPCA 1IKYB 4ZHRA 4G1QB 2JC1A 1RTJB 5CYMA 1RT4B 4LQ9A 2CJQA 3DRSB 1RYSA 4PQUB 4FOKA 2XWYA 1S1VA 3GV7B 4Q0BB 1C1BB 2ILYA 1C2PA 1S1UA 4IFYB 2GIQA 3C6TA 3IS9B 4J9NA 3UPFA 1RT4A 4RNJA 3FFIB 4LSLB 2J6UA 3OL8A 4PQUA 4NLVA 3DLKA 3KK1A 4JV2A 3IG1B 1C1BA 1N6QA 2AX0A 4IFYA 2W8KA 3EPGA 3GG1A 1NHUA 4DL2A 3ICLA 5KFAA 3PJXA 3IS9A 3I0SB 5KG4A 2J6SA 1TKTB 2OPRA 4RNMA 2O5DA 5DLFA 1RTIB 3C6UB 3PJWA 2OPQB 1S48A 4PWDB 1KHWA 2ZD1B 2GC8A 5KFSA 1REVA 3KHGA 2F8EX 3DRRB 2RDIA 5KFFA 3I0SA 5J2PB 1MMLA 3OL7A 5J1EB 2D41A 3C6UA 4PWDA 2FVPA 4IR1A 2BR0A 3PHEA 1S49A 2BRLA 4NLTA 3GG0A 1IKXA 3OSPA 3DRRA 2R6OA 1HQEB 3UR0A 5F8HA 3CDWA 3H98A 5EWGA 4K4WA 5J2PA 2JEFA 1S1WA 3OL9A 1VRUA 4MIAA 4J9PA 5FDLB 5C25B 1HQEA 3KMSA 5F8NA 3FSIA 2R8KA 4IH5A 3LP1B 4WFXA 4ZP9A 4QW8A 1RTHB 3OLAA 1ZTTA 2HMIB 1LWCB 3G6YA 3DM2B 2JEIA 3GIKA 4H54A 4NLRA 4QW9A 3Q8PB 1DLOB 3NBPB 3V6HA 2AX1A 3IGNA 4IR9A 5KT6A 3DDKA 3FQLA 1LWCA 3DM2A 3PJUA 2FJVA 2YNIB 3ISNC 4J9LA 1VRTA 4F4WA 4FS1A 1J5OB 4I2QB 1DLOA 3V6JA 3RBEA 3V6KA 2HNZB 1K1SA 4YQWA 1YVFA 2VG6B 4IOBA 4TYAA 4RZRA 3H40A 1S6QB 3CJ4A 3CIZA 5KFPA 4J9SA 4I2QA 2ILZA 3RAXA 4LQ3A 1S1XA 4KSEB 3RB4A 2HNZA 4URGA 4YR2A 4F4ZA 3RAQA 2DPIA 4IRDA 4RW7A 4O3QA 2VG6A 5KFIA 3MEDA 2I5JA 4WFZA 5J2QB 1S6QA 1C0TB 3PVXA 3GIMA 2XC9A 3KLIA 4X2BA 4J40A 3KNAA 2W9AA 3HHKA 3TVKA 5KFWA 2ASDA 5J2QA 1C0TA 4HKQA 4WE1B 3QO9B 4RW4B 3NKYA 1UWBB 1JLFB 2WOMB 4TN2A 4IFVB 5DQIA 3KLEB 2AGQA 3NL0A 4ED3A 3RB6A 2IAJA 1QE1A 3DOLA 5KFDA 5CYQB 3GILA 2W7OA 3OHBA 3BQ2A 4WFYA 2AGPA 1S6PB 3MF5A 3QO9A 4RW4A 3KLEA 1UWBA 1JLFA 4MK7A 5C24B 3PR4A 5HLFB 4ECYA 4QWEA 2C22A 4K4VA 3TLQA 3IRXB 1T03B 4K4SA 4O3NA 1N56A 5I42A 3E01A 1IKWB 4KAIA 4ED7A 3V81B 1QUVA 2XI3A 3HVTA 2R2RA 1JLCA 1S6PA 4B3OA 2YKMB 5HROB 4R5PA 5J2NB 5DGAA 3H5XA 1S0MA 3BR9A 1LWEB 4FBUA 1DTQB 1KLMB 4ECZA 1T03A 5KT4A 3V81A 4Y9PA 2IM3A 3E51A 3FDSA 4ICLB 3GFXA 1RT1A 4KFBB 5KT3A 2XGQA 2RDJA 4Y9MA 1FKPA 5KG7A 5J2NA 3PW7A 5HROA 1RDRA 1RT7A 2JC0A 4ICLA 4KFBA 2OH2A 3LANA 4K4YA 3T5LA 3BQ0A 2D3ZA 4DL4A 4Y8EA 3V6DB 4Y9OA 4I2PB 5KFUA 5KG0A 5J2MB 4U6PA 4QWDA 2WB4A 4RUCA 3KJVB 2W7PA 4Q8FA 1S9EB 2FJXA 4NCGB 2BE2B 5F8JA 4KO0B 3DLEB 1JXLA 4IH7A 2UUWA 4IDKB 1NHVA 2VG5B 4ZVFA 4H4MB 4TY8A 1IKVB 2YNGA 5J2MA 1T05B 3QIPB 4DEZA 2BE2A 4XPCA 4KV8B 3RBDA 3DLEA 5L1LA 1RTDB 3TAMB 3BGRB 4JV0A 5KG1A 2VG5A 4O4GB 3MR2A 1T05A 1TKZB 4TLRA 2R2TA 1MU2A 3M9OB 2RKIB 2R2SA 4DL7A 2BASA 1LWFB 1W25A 3NAIA 2R8IA 3KZPA 3I5AA 4EYIB 4KV8A 4ECRA 2VA3A 4R8UB 4Q44A 2ASJA 4H4OB 1RT5B 1SUQA 4O3SA 1TKZA 2WRMA 5DG9A 3V4IB 1IKYA 2XI2A 1TVRB 4G1QA 1RTJA 3MFIA 3I5BA 2R8JA 3DRSA 4KKOB 3H5YA 5KG2A 1RT5A 4K4XA 3JSMB 2JEGA 1HMVB 3V4IA 3TQ1A 1TVRA 3KHRA 1RA6A 1RT3B 1EP4B 3FFIA 4LSLA 5KFLA 2FVQA 3IG1A 1JLBB 4EBEA 4ZVHA 4IG0B 4ZP7A 3JSMA 1HMVA 1HNIB 5F8IA 5KFJA 4TQSA 4O4RA 5D3GB 2FVRA 1LW2B 1TKTA 4EYHB 4GC7A 1RTIA 3LAMA 2OPQA 4Y2CA 5DGBA 4WZQA 3CJ5A 2ZD1A 1JLBA 4IG0A 1HNIA 2BRKA 1HNVB 3HV8A 5D3GA 1LW2A 4NLXA 3PZPA 1TL3B 4DG1B 5J1EA 4RNNA 3BREA 3GV5B 1RAJA 4TXSA 3EZUA 1TKXB 1U09A 4K4TA 2HNDB 3FRZA 1S97A 4RNOA 5JUMA 2EC0A 1RA7A 1TL3A 4DG1A 4RW9B 5KT5A 3MEEB 5KFYA 2AGOA 2AU0A 5FDLA 2WCXA 5C25A 2HNDA 1SV5B 4QPXA 3M8QB 2IJNA 2B5JB 1KHVA 1XR7A 3G6VA 3LP1A 1S0OA 2ZE2B 3CJ2A 3MEEA 1RTHA 4ECVA 4MIBA 5HBMB 3OHAA 1FKOB 3IN5A 4R0EA 3G6XA 3M8PB 4IRCA 4ECTA 2BQUA 2V4QA 1HPZB 2XCPA 4F4YA 1SV5A 5EWEA 3NBPA 4FS2A 2BANB 4Y9NA 4DL3A 4F3HA 2ZE2A 3PFMA 4NLOA 5KFNA 5KG5A 4AG0A 3Q8QB 4Q0BA 3M8PA 2YNIA 2IC3B 3BSAA 1TL1B 2GIRA 1J5OA 2BANA 4Q8EA 4K4ZA 5KFKA 3HV9A 1BQNB 4URSA 2QV6A 4Y34A 2IC3A 3BJYA 4YP3A 4NYZA 1JLEB 4JUZA 2UVUA 3PR5B 3NGDA 3N3TA 4FBTA 2OPPB 3QLHB 4ZP6A 1LW0B 4XO0A 3MTKA 1BQNA 4NRUA 3T5KA 4YMEA 2FVSA 3UDLA 3QZ8A 5DG7A 3GYNA 1IM4A 3CJ0A 4O44B 5C42B 4HYKA 1JLEA 3EPIA 3S83A 2OPPA 1JLAB 1T3NA 3MFHA 4GC6A 1OS5A 4KE5A 3T19A 3KLGB 2UVRA 2D7SA 4O44A 4WE1A 2YNHB 4MFBB 5KFGA 5EDWA 3CWJA 5L1IA 1JLAA 2UVWA 2WOMA 2BQRA 4IFVA 2CKWA 4KB7A 4KIEA 4MH8A 3T5JA 4NLQA 1K1QA 4RW8B 3KLGA 4M95A 1HARA 5CYQA 3PW4A 3UQSA 2YNHA 1RT6B 1XR6A 2HNYB 5HLFA 4IRKA 4PUOA 5C24A 1C1CB 3H59A 3IRXA 4ID5B 2XCAA 4RW8A 1IKWA 4NLGA 1RT6A 4YR0A 2YKMA 2HNYA 4URQU 1DTTB 1LWEA 4RW6B 4WYLA 4F50A 1NNDA 1DTQA 1KLMA 2JEJA 4WZMA 3I5CA 1S1TB 1TP7A 2HWHA 5I3UB 3D28A 4ECUA 2D3UA 2OPSB 4RW6A 5DLGA 2B43A 2YKNB 1S1TA 4KHMA 3MECB 2AQ4A 3CJ3A 2W27A 4IKAA 3N6MA 1CSJA 2ALZA 2OPSA 2IM1A 3V6DA 5MF5A 4PUOB 2YKNA 4I2PA 2B6AB 5MKGB 3CO9A 4NZ0A 3GIJA 3KJVA 3DRPB 1S9EA 3MECA 4NCGA 4LYKA 5F9NA 4KO0A 3RB3A 2ASLA 1SH2A 4TQRA 1QAIA 4Q43A 4EEYA 4QWAA 3CDEA 4IDKA 3H2LA 4H4MA 1IKVA 2B6AA 3G86A 4ED2A 2R8GA 2FJWA 3QIPA 2V4RA 5KFRA 1RYRA 1RTDA 3TAMA 3BGRA 4HU4A 4O4GA 5KT7A 5K14B 2WONB 4RU9A 3OSNA 4NLPA 3KMQA 3SFGA 5KFEA 4ZMMA 3KLFB 2RKIA 1JIHA 5KT2A 1LWFA 3M9NB 4IQXA 3MR3A 4TY9A 2FVCA 2VG7B 4R8UA 5KFBA 3KK2B 1T94A 4H4OA 4IH6A 3DLGB 4ES4A 2WONA 3H4DA 4ZHRB 3KLFA 3I0RB 4RNIA 3SI8A 4O3PA 4ZPBA 5L1KA 4RNHA 4KKOA 1S1VB 4Y2AA 3DOKB 1S1UB 4FOJA 2HAIA 4M94A 1JLQB 3C6TB 3PW0A 5KFCA 3I0RA 3DI6B 4QWCA 1RT3A 3KHHA 1EP4A 3DLKB 3KK1B 4ED6A 1N6QB 3DOKA 3FQKA 4Q45A 3U2EA 1I6JA 4O3RA 1JLQA 1TV6B 2OPRB 5DG8A 2FLLA 3DI6A 4EO8A 4YR3A 2C2DA 4MK9A 4ZVEA 4WXWA 1REVB 3ISND 4Q6JA 2W9CB 1TV6A 3KOAA 2WHOA 1HNVA 4KBIA 4J9MA 3D5MA 2IA6A 3QGGA 1S4FA 1IKXB 2JLEA 1TKXA 2W9CA 4I7FB 5KFTA 3MEGB 2VA2A 1HYSB 2E9ZA 1S1WB 3MR5A 2WTFA 3RB0A 1VRUB 4RW9A 5EWFA 4IG3B
chains in the Genus database with same CATH superfamily
1PX4A 1VRQC 2J9XA 4UMCA 4K50A 2O9OA 4UR7A 1O60A 2B4OA 1VLWA 4OVXA 1XUUA 4GQQA 5AHLA 3C0SA 4M24A 1HPZA 3T40A 4P7QA 4CVUA 1ZTWA 4CNZA 1X1NA 5DX7A 1TKKA 3EXTA 1HBNA 5HA7A 5G0RB 5A76A 3DRYA 2XG9A 1SL0A 1YNPA 3EDEA 4ED8A 2V5BA 2PFDA 2J8AA 2BB0A 3NOEA 3SADA 2DITA 3O8WA 4I6KA 2EAWA 4KGXB 3HPAA 3F4NA 5EFDA 3H4BA 3EKZA 1LKZA 3LBCA 3FY1A 1UJQA 4PTNA 3RX3A 5DXYA 1JXKA 2K7JA 1SUXA 1LWJA 3KLVA 5AXMA 2VL1A 1J5EF 4USTA 1UW9A 2XO7A 3EZOA 5EBAA 2GDUA 2P3EA 3LDVA 4HHPA 2H65B 2OAUA 3PM6A 4MUZA 4AL7A 4O0ZA 3GVRA 1P43A 4ZBCA 1HQUA 3L95X 4R7OA 3W37A 3QYYA 2WZTA 4GC4A 4TYBA 5K8PA 2Z2MA 4ZQNA 1ZPTA 2ZXDA 1BXCA 1OY6A 2OFGX 2VZOA 2BV3A 1OY9A 1W9DM 1IBCB 4WDXA 1X0FA 2XLJA 2IM0A 4AZCB 1BYDA 1RT7B 1LL4A 1C8QA 4OJGA 2VXNA 2DNYA 2F3JA 2MGZA 3U4FA 3S1GA 2CW6A 4J3SA 1IJEB 2PEBA 2J8GA 3L4WA 2I57A 1G6CA 1W5OA 3TSBA 1J11A 4GWEA 3OLBA 1B4KA 4DV0F 3DRPA 3WC0A 4A8WA 3D4JA 1DQ9A 1FFRA 4TY8B 2XTKA 2DZPA 3R5CA 3M0LA 1HD0A 3VNZA 3T6BA 1UIPA 4PAAA 2Z0IA 3R7NB 1UFLA 5K4XA 3LP0A 1EX8A 4LS1A 2ZUWA 1PZ3A 1RLCL 1TVPA 2R8HA 2DXFA 3KXDA 3QFHA 4AIBA 4LQ1A 2HRTA 3P82A 4BF9A 2WQDA 4DM1A 4C6DA 2VG7A 2BNJA 3MTJA 3SBFA 2C28A 1CJUB 4TVAB 1LL6A 2CLEA 1YK9A 2OYKA 2VC9A 5J04A 1EBHA 4CU6A 2V5JA 3K8VA 1FJCA 1GG1A 4MTPA 1G2EA 5F2IA 1EJTC 2J6UA 1RLDA 1GJUA 3ZNJ1 3PBGA 2ZUGA 3LV5A 4E2OA 5JJBA 4HHJA 1XIHA 4FF3A 5KG4A 2GZOA 4BBYA 1KCXA 4Z7CA 2XQCA 1HJWA 1WKEA 2Z4GA 4AL5A 2JWNA 4FALA 1RWPB 2D41A 4N41A 2BX7A 3PHEA 4FPRA 1FERA 5J1PA 2V8HA 1R8LA 3CDWA 3PWAA 3WX7A 3IJ8A 1LG2A 4JTDA 4FKXA 1A5MC 2QVHA 1DAXA 1UYQA 3DBPA 3SIZA 2FGZA 5AXKA 5CBJA 4X0NA 4OHZA 4ZP9A 1J0YA 3OFGA 5F0UA 3KOWA 4G8TA 5CH9A 2WCSA 3PV8A 3CLWA 4J5NA 3CQHA 3WQGA 4DLGA 3WCZA 3P6YC 3MM5A 1FXLA 1ZAWA 3MI6A 4X2PA 3PZOA 1YLXA 4CN1A 3NG8A 4F4KA 1OB0A 3H7UA 5EN1A 2MY8A 3V16A 3FW6A 3QLDA 1HFBA 3A24A 4RDZA 3CIZA 3RAXA 3MHFA 1IQ8A 5A8KB 3BGJA 3UY8A 4KMQA 1FWWA 4S3BA 1H1ZA 3CYVA 3ELFA 1EAYC 3MEDA 2Q71A 3M0YA 4Z0JA 4JDYA 4F7VA 3W81A 4XD3A 3GTXA 4PC8A 1ITXA 4PB4A 4W4QA 2Y9HA 4P2SA 2KO1A 4DI9A 5AYYA 2A2CA 1VFLA 1V7YA 2KFYA 1JLFB 4TN2A 2ACRA 2WLYA 4GYKA 2CLIA 1SZEA 4FLQA 1HFEL 4UOHA 5BWFA 4X66F 4LFYA 3KJFB 1F9HA 3CMES 3WDPP 2D9OA 4G65A 1T0TV 1XGEA 5TQLA 4DFMA 4GQ0A 2PDGA 5JIPA 1IGWA 1XJWB 1RU1A 4YN3B 1P0KA 2G41A 3C3UA 4FX6M 2OO4A 5KINA 2OGUA 3AHPA 3VGHA 3W7IA 1OCJA 4AEOA 3J7YU 2F4VF 1RDRA 5AYIA 3VFLA 3O6YX 2ZA1A 2XYPB 3MVIA 4GKJJ 1GQJA 4DL4A 3JB9k 3KUMA 2X2GA 4I90A 1NDCA 4ILLA 5E09A 4LUTB 4L6OA 3RAMA 3CHVA 4RUCA 4A47A 2RSQA 4DS5A 2U1AA 4I8DA 1XHGA 3ITXA 4AD1A 4DV0J 1KB3A 4M5LA 1CIUA 3RBDA 1ECEA 1UQYA 2YQ1A 4XAFA 1VFSA 5DEZA 1EOKA 3UWYA 4O4GB 2A4AA 4LVNP 4K3ZA 4EYIB 3W70A 2DNPA 2IVYA 1ICQA 3G6MA 1REGX 1N52B 1X0PA 4E98A 4RDYA 4GZIA 3A23A 3QV8A 3I5BA 3JAMU 4LF9J 3R8HA 3QC0A 5FIIA 1TV4A 3P49B 1UWSA 3SFKA 3RO6A 4G1KA 3TQ1A 1U8SA 2CESA 3VZHA 3PTWA 1RA5A 4PMOA 4QQ3A 2Q66A 1S4EA 5DXXA 2FC9A 2JK2A 3GIRA 4PKDB 1CJKB 5KZEA 3HTWA 2CLPA 4OYXA 4KY3A 4F26A 1PAUB 5KOWA 4XBSA 5REQB 3R1HA 3GV5B 2PDWA 4IMEA 1IT7A 1FH8A 4YHGA 3AXMA 5I02A 3MP3A 3FRZA 1S97A 1K6AA 4ZFCA 1TL3A 2ZUTA 2AGOA 2YA1A 2WCXA 4OZ5A 1KOHA 4AZBA 3SRFA 2P8CA 2Z00A 1ZBWA 1XM3A 1XPGA 1ZPWX 4DB7A 2Y5JA 1W3LA 4HI1A 3WQFA 3AB4B 3COTA 4ROQA 2V4QA 4M5DA 4F4YA 5D04C 5I24A 4LUSB 3EYPA 5D0HA 4Q4SA 2BVZA 3OP2A 3V36A 3BSAA 3AHVA 2CQ1A 2FDSA 2YXGA 3WMBA 4U2YA 1FE4A 1Q8BA 3VZIA 3ZZ0A 1GW9A 4M5KA 2FVMA 1L3UA 3OVRA 4YP3A 4NYZA 2PBOA 2KTQA 1QPOA 3CK5A 1TR1A 3HJZA 3ZJ7A 4DYJA 1CJVB 2DNNA 1KC7A 1S6OA 4KHPF 1UPPA 2I17A 3J81U 3LG3A 4HTJA 3H2UB 1V3HA 3O6CA 3ZYZA 3S5YA 2LKZA 1KGXA 2PLKA 3MFHA 3UWTA 2XLKA 3AIVA 3I3DA 2YNHB 4MFBB 5KFGA 3CWJA 2QIWA 3BK0A 3TYAA 3K8LA 2A0FB 4MJZA 4OLOA 4QYZK 2CG4A 1SJBA 1DZ5A 1QVFR 2O66A 2XNQA 3VO0A 2JOQA 3NVTA 3AFGA 4GKKJ 2PLJA 2FGCA 4LIWA 3IRXA 3C15B 2VCAA 4RWWA 2ZBTA 4X66J 2DGTA 3IV3A 3R8YA 3NOCA 3AODA 4E2VA 2YKMA 1HKIA 1IGSA 4QQUA 1E70M 3EX7B 1H1YA 3W5ZA 3E12A 2MKYA 4E0DA 3W2MA 1LFWA 3ONQA 4JAWA 4AZ7A 3ET6B 3NQMA 2XZ9A 4KHMA 1YRUA 2IYIA 3F4WA 2VWTA 3P7YA 2WYSA 3W65A 3L4BC 5C70A 5CXPA 2KZHA 5BYWA 4O17A 3ZFHA 1H2VZ 1BAGA 4Q43A 3IBWA 2ZZMA 2ACSA 4LAMA 4LVGA 4AWTA 2BJ7A 2G1DA 4WU2A 5AYBA 4M82A 1S38A 3HP6A 3MANA 3AD9C 2Q09A 4HHHA 1A7GE 3UWUA 3GNNA 3MSGA 1KFSA 3NCPA 3IIZA 2K8GA 4ES3A 1YNQA 4ACZA 4K8EA 2FPHX 1QUMA 3DN5A 1YBAA 4XWUA 1VB9A 2VUYA 2VUNA 2FY1A 4DBSA 3SI8A 3PK7A 4ZPBA 2HGNA 3F5LA 2YYUA 1TRDA 4YJ5A 1KFEA 1GOQA 3T9NA 3SM0A 1Q4WA 3NXFA 4R7JA 5KEZA 2NPFA 3FQKA 3O6QA 3VMNA 2EO7A 2YTCA 2G50A 2BA9A 1ZRQA 2CKSA 2FLLA 1IEWA 4EO8A 3Q86A 4YN5A 1XD0A 2OT0A 4IGSA 2AJ2A 1XERA 4CLFA 3DI0A 1EO7A 3PNIA 4F9JA 2CHNA 4O50A 4AD4A 2XIBA 5I03A 3G22A 2EPIA 5FESA 1SJDA 3D6HB 2DIEA 5AT1B 2PLMA 3MZIA 3W73A 1ZAVA 1GOOA 3GNRA 3JQKA 2X51A 1T95A 3BM7A 1MUWA 3CD6S 1BG4A 3AMDA 1WACA 5D0RA 1PKYA 2GSHA 3N14A 2W9MA 2RRBA 3OR2B 4DCPB 4Z08A 3CDBA 2DUZA 6XIAA 4PCQA 4CP5A 3CDUA 4B9UA 1VRTB 1QATA 3DKDA 1UTAA 1NQ6A 2V8VA 3HG4A 1V6YA 2VB6A 3MMAA 4K0KF 3WBZA 2VOTA 4IMFA 3VAIA 1S1XB 4HACB 3D6FB 1MROB 5GADU 1OJ4A 4DBEA 2VJUA 3ARUA 4MK8A 4HNNA 2C0HA 4EK7A 3NY0A 3P5BP 3QGIA 1SBRA 3DLJA 3S3GA 3H8AA 1KWKA 2QLJB 4ZOSA 2EPNA 3IIXA 4G7EA 2DHSA 3N25A 5KFVA 1LROA 3L2LA 1XKYA 4TO8A 5HP1B 6REQB 2VPYB 4PWUA 4B3OB 2XHWA 2Z2LA 4R5PB 3W1NA 3TR9A 4KESA 3G2GA 1LRQA 2C1HA 2OI2A 4KGMA 3WLTA 6A3HA 4HTYA 1WKYA 1JZ3A 1R2TA 1DBTA 2PDBA 3EJMA 2UUTA 4ID8A 2ZVRA 4NJGA 3CPWR 4F4XA 2ZXAA 1YBQB 1H2TZ 3CIXA 2PB1A 2Y85A 2VQEJ 1JGIA 2PE8A 5KTQA 2ZE3A 1JLGA 4WIIA 4B4HA 1X4AA 1S5ZA 4CNNA 1X7FA 3W7CA 4ASTA 3SUSA 4KH2A 2W62A 1PX3A 2XMKA 1R43A 5D4PA 4DQRA 1PHQA 1E0XA 4L1XA 3H5UA 3VVTA 4FZVA 3ILLA 4DJBA 1CJTB 3VKAA 1ZAHA 1WYIA 2VC5A 3EPNA 3DRSB 1W54A 3SURA 1U48A 3WF2A 3GV7B 1C1BB 2GIQA 5G4EA 3L09A 4M29A 4LF2A 4NU7A 4DV2J 1TUFA 4Z17A 1ZJHA 1NDPA 4DZIA 3HDSA 3ZZ1A 3C6UB 1WCGA 1XYBA 2VBZA 3NPVA 3EM1A 5KFSA 2Y3YA 4I56A 1TREA 4ED5A 1YNYA 4K6AA 5C2XA 3CNYA 3GDLA 3OQ8A 1LBFA 1A5KC 5CKSA 4PWDA 4OYWA 3C2PA 1XDJA 4DUYF 2D3O1 1IKXA 2R6OA 3AYTA 4ZO6A 3U48A 1TR9A 2WHKA 2PA3A 4O23A 4DCJB 1VFMA 3GWQA 5FDLB 2J7CA 3LTSA 4HT7A 3IMQJ 2BABA 3W66A 2N3LA 1G5AA 1MQQA 3BVJA 3BW4A 1ZHAA 4DF0A 1V02A 1OYCA 4DV5J 4ZVPB 3SQSA 2BACA 2VCCA 2LXIA 2E5BA 2PDCA 2DSWA 3SY1A 3GIPA 2V2HA 3ZWSA 5AC6A 3KKFA 5BR8F 4OI0A 1JYWA 1QSYA 2MZ1A 5B0CA 1UD8A 4GKLA 2HWGA 2JF6A 3U1LA 3MM8A 3V6KA 4N6FA 2OT1A 2A7RA 1C4CA 4P5UA 2WSPA 4HNLA 1GJWA 1PV8A 1XXXA 4BS2A 2MJNA 3LCXA 4GX9A 1KV8A 4XKYA 4IRDA 2QLXA 1Y5VA 3MOJB 2C3MA 1ZBTA 5A8WA 1U45A 1RQ0A 1I6NA 2WVDA 2C3ZA 1R6YA 2PRLA 2CXGA 3MWAA 1F8IA 4U2ZA 3TNOA 4U96A 3TVKA 2WXDM 1KQZA 5A6TC 5CXTA 2RS8A 1E56A 4M51A 5JVLA 1RJRA 1R89A 3TN4A 2IAJA 4P7RA 2H8XA 3AAMA 2GV1A 5HMSA 3LZ5A 3LGMA 5AHMA 3UERA 2PDAA 4RW4A 3OW1A 1Q5VA 5C24B 2C22A 4BZYA 3WX4A 1IKWB 3SQOP 1UVIA 3G1RA 1QUVA 1YADA 3CAVA 3P2VA 4MFEA 3NSNA 3WH9A 1JLCA 1U22A 2YDQA 5B0FA 3HX9A 3JQJA 2BZNA 2JNJA 1M9HA 3MHGA 2CZ4A 3LMZA 2CDRB 2HS0A 1GVSA 3VD9A 4M5IA 1GNXA 1BUXA 4ZQOA 3B4UA 2YL5A 2V67A 4O8AA 1Y0EA 1SO5A 2ZH8A 1SSDA 1A5LC 1BF2A 4N77A 4IIGA 4A8SA 3AWOA 2WSCC 1XV8A 1DIOA 3R0UA 1XGDA 2WK2A 4P8WA 5B0BA 4M1BA 2YNGA 3OGSA 2GGJA 1KXTA 2E68A 1DXEA 5F1VA 2B9XA 4PXCA 3O15A 3G71S 1ZL1A 1EUNA 3CD7A 5DMMA 5LA1A 4RX0A 1FD2A 1E6SM 2Z7KA 4UF4A 3V4IB 3HD1A 3CJPA 1PWLA 4YOEA 1E40A 1Q6QA 4NUWA 4R53A 4UBPC 4JTLA 5AC5A 3KG4A 1PS9A 2NXIA 2DEJA 1ZZNA 2XS5A 1I9CB 5KFLA 1EIXA 5FOOA 4DPWA 4O4WA 3DAQA 3CQJA 4WGHA 3GXFA 2J8SA 1IZJA 1HNIB 3MBFA 5KFJA 1B0VA 5GAHU 2FVRA 1LW2B 4IIFA 3LAMA 4CQDA 1W1ZA 2UU9J 3VZZA 1B3VA 1NDWA 2D2GA 4PTVA 3W6YA 1ALDA 1OBAA 4HPJA 3A4XA 3L4YA 2EC0A 5EGRA 3MEEB 1EQPA 4JIEA 4JD4A 2SXLA 3K5XA 4QEEA 3NTYA 4LEQA 3ZJ8A 3WQ8A 4PMRA 1FFWB 1JNDA 1KHVA 3BAKA 1FKOB 1YE6A 4OUEA 5F3ZA 1O95A 1AZ1A 1RWVB 4UT4A 5EWEA 1XBZA 4J3WA 3PULA 3AOFA 1TMHA 3SRDA 1KGUA 4B5WA 4PYAA 5I3DA 2IQTA 4WDTA 1OZMA 1JDEA 4F2UA 2UVUA 1J0ZA 4DQIA 4HN4A 2ZUAA 2ZWZA 2HTMA 3OA3A 2E7WA 3W82A 4AU0A 3UDLA 2VFIA 1ZALA 5C42B 1VBKA 1GCYA 1JLEA 2E7FA 1LORA 3AJ7A 4DUZJ 3IVTA 4K7QA 2RKXA 2DFAA 2F7VA 3VGTA 3N19B 1JLAA 3C14B 3TQ0A 3RRGA 3PS7A 1OQ6A 4L61A 2GSEA 1B4EA 3PTDA 1M5PC 1D2KA 4V27A 4NJJA 3ITTA 4EX4A 1RD6A 3B8WA 4AVFA 1UD5A 4HN8A 5H9FJ 4OBTA 4IIHA 3Q22A 1LWEA 5I09A 3T78A 2XY7A 3ZLHA 3I5CA 3E02A 2NQHA 4KWUA 1KSPA 2PMQA 2J4GA 4MLJA 1WHXA 1NPRA 4KGZB 1YHQS 2VHLA 2KZMA 3H22A 2ALZA 1RAKA 1EDTA 2Y62A 4QCEA 4BWJA 3B8SA 2V81A 3WLNA 4L80A 2VJVA 4TQRA 3GHTA 3HCXA 4XSMA 2J9ZA 1PTAA 2AT1B 4JI6F 5DBUA 3DHFA 3F03K 1ZS6A 1QASA 3WDRA 2YW4A 4B9ZA 5F4WA 1CXFA 2V69A 1V3SA 1WOOA 3PPFA 5CGMA 3FNDA 5KT7A 4NX5A 2VP8A 4JTGA 3AJ2A 4W4MA 3OBEA 1HX0A 3NL2A 4R8UA 3W9IA 3R2CJ 3LGEA 1PBGA 1JYVA 3DLGB 2UY3A 1OZQA 2EFPA 4RU2A 2KG1A 3CCJS 4KKOA 4DQPA 1K9MT 3DOKB 2OQYA 3OG2A 4CNPA 4EFAC 3C6TB 2J7DA 3EZ4A 4G56A 5KFCA 2GGGA 3DGPB 2ZZ1A 2D73A 3QT8A 2WMIA 3ILJA 2AQWA 3W1UA 1DQUA 4WVXA 1Y0HA 2MZRA 1LRTA 1W1YA 1DJQA 2HZAA 3D1QA 2G37A 4JFTA 4M6PA 3S2MA 3W75A 2QCDA 2YW3A 2IA6A 2BE9B 3SSSA 3EOUA 1AQMA 1TKXA 2ZBIA 3CHCA 3MEGB 2W24A 4CRJA 2KM8C 1IQTA 1M01A 3QMTA 4DWSC 3MO4A 3MMBB 1N34F 4O0QA 2E77A 2V82A 1I0DA 2AZ3A 3C66A 3KUGA 5CZSA 1LQ9A 4HHMA 3T9ZA 2XVKA 1R8BA 6XIMA 4OHQA 4C6BA 3ZO7A 4KT0C 8ATCB 1XISA 4Q8UA 2NXEA 1N5YA 4WK9A 3RR4A 1PJ9A 1E1CB 4O54A 1EQMA 4JI2J 1GQKA 2QLYA 4XZWA 4I5XA 4CN6A 4EE9A 1TL1A 4DFJA 5T9BG 4P8UA 4LBRA 5JXQA 2NREA 1Q45A 1UR2A 4B90A 4CNUA 1R46A 1EKSA 1F4HA 1QOQA 4FXWA 2OJ3A 2CLLA 2LA4A 1SZNA 3KBJA 2WSQA 2GNKA 2MEWA 1YW1A 5IZHA 4QWBA 3IJ9A 3L3CA 4H00A 1G94A 2XM2A 3ANYA 3VIMA 1FRMA 1OMSA 2OXNA 5G1TA 3DFEA 1J0KA 2J27A 4YLWA 2XMWA 1ZJAA 1APSA 4PEOA 2GSJA 4TVDA 3WLHA 1KFDA 4K4UA 3UP8A 4D1JA 4KH0B 1Q0NA 1F1BB 1IZCA 3SQGB 3Q8RB 4RX6A 3UXAA 2B4PA 2INEA 3GHRA 3OHMB 2YKPA 3UGRA 4QIUA 1QBBA 4DZ5A 3B82A 2FIQA 3GH4A 1RHUB 4PMXA 4C11B 1WDWA 2EJ1A 1W7WA 4XUYA 3HVTB 3BSOA 1JKHA 2GMLA 1E9YB 1R8AA 1P1LA 4PG7A 4C6LA 1RT2A 2CWNA 2W61A 1Q81T 4IX0A 5HATA 4UFKA 3CCZA 4DI8A 2HFVA 4QCLA 3T1HJ 1WUFA 3QSRA 2B7CB 1P6CA 4LF4J 3LQVA 1TV7A 1EBGA 4OZOA 4OJYA 5EU9A 4L75A 4HK7A 1B5TA 4X4TA 2A2IA 4V15A 3CE8A 3ABQA 3B03A 1QO5A 2LP4A 1BQMB 3M30B 3Q45A 3A8KA 3K30A 4DR6J 1UAWA 1KM4A 4NZ5A 4RKUC 2ZKUA 1UIOA 3GPAA 4EZ6A 1WEYA 3GFZA 3RTVA 1NB7A 2QDEA 3OODA 3FVMA 4QP0A 3PUGA 4JY8A 4P10A 4RLIA 2J8TA 2JBMA 5C7HA 4D1IA 4RW5A 1EZZB 3EZ5A 3RU8X 1V0NA 5C9UA 1IKYB 1OQ3A 4W87A 3PJ9A 1K4HA 2HS3A 4LRAA 4A21A 3QTGA 3L7PA 4H8NA 2ZOMA 2ZJQQ 5GNXA 3VZXA 5FEPA 3WY1A 3L7OA 2X1RA 4HPGA 3VIHA 4C6CA 1N36F 1I2PA 2P9GA 1ISWA 4L6DA 1X31C 3RLUA 1X9WA 4W90B 4DX8H 1K3UA 3WK3A 1HKMA 4MY9A 2DY9A 2L48A 1ONWA 3DKJA 1GAOA 3Q8UA 2M9KA 3H7RA 1HQEB 5EWGA 1YSJA 5K9CA 3UG4A 5AE3A 1Q6RA 1VYRA 2ZRXA 4W84A 2RQCA 2WCGA 3A4JA 5A2QU 2FYMA 4LVFA 4UY8T 3CYJA 5HMYA 1EEPA 4I5RA 3W2UA 1N5SA 4GACA 3DM2B 4PL2A 3IC1A 1ZUAX 4M5JA 2DSVA 2WZEA 3NBPB 2JALA 1TPC1 3CCRS 4DUXA 3SCOA 4HNTA 1FESA 1Q13A 3ATZA 1XG3A 1GYLA 3SQMA 4A22A 4JIRA 3MR7A 3GDBA 1J5OB 1ONRA 5C6MA 3BGUA 3OTDA 2HNZB 4WY0F 2GAHC 1HVXA 3UJ2A 1KV5A 3W1QA 1XIEA 5D8ZA 4FX8A 4MM1A 1PYSB 1MNSA 4W85A 1XFCA 2DT3A 2DPIA 2NSBA 4XQ6A 5IHRA 3TH6A 3U5UA 4X62J 3D3AA 3G5EA 2OMAA 4IP4A 2ROGA 1BQCA 4MY8A 4DYEA 4WIQA 2PAJA 5D2WA 1FJ7A 4OLPA 4OYAA 1C0TA 3NZQA 3TN3A 2ZH1A 1H60A 1I8JA 2Z1VA 5IDZA 4O0IA 2ZDOA 3MKKA 2XY6A 2PUZA 2E8YA 5AC8A 4JQ2A 2V63A 4DL0C 3CJTA 1PIEA 3ZWTA 4PUOB 3UW6A 4S38A 1XC9A 4K4SA 1JQVA 3QHMA 4UTJA 3E01A 3TW0A 3TANA 5HROB 3TJLA 1VQTA 1RH9A 5KETA 4DBQA 4XZHA 4JNYA 4Z1BA 3DDIA 4Q7IA 5E5NA 3L7RA 2ZNYA 3PRVA 4DR1J 4Q32A 3PO5A 5D2TA 3V5FA 1FKPA 3O9NA 3S8HA 2QJGA 3ONBA 4UZSA 1X96A 3S6TA 3N0VA 3T8LA 3U5YA 3CDAA 1WHVA 1B7FA 4B9YA 3ABZA 2XIOA 3VK5A 3V6DB 5BNKA 4LR7A 3Q4DA 1XLFA 3AMGA 5KFUA 5KG0A 1Z6KA 2IQDA 4NZ4A 5BOEA 3X3UA 3PM9A 2EFVA 2ZX9A 1IF2A 1OHLA 5FF3A 1S6UA 3IJ7A 3MUAA 3SN0A 2GIFA 2YWFA 3DLEB 1CPUA 2W25A 4IH7A 4OHWA 5DCDA 4MKSA 1T05B 1KQFB 1IKVB 2Y1LB 1AW2A 3G0XA 3VAVA 5A69A 4HIBA 2BE2A 1A4MA 3URBA 4F0KA 2VPZB 3EDDA 5XIAA 5ETLA 5CC6A 2C14A 1HWUA 3C6CA 3PG8A 3D6TB 3GXDA 4KV8A 1KFBA 1H1NA 2DCUB 1PO6A 1M5VC 1RT5B 4GI9A 3BLLA 1MSSA 1Q7ZA 4U9RA 1H11A 2P6SA 1R6WA 4G2DA 3MCNA 3S5NA 5KG2A 4G5DA 1Z41A 1G69A 3CNQP 1JCYA 1UZDA 4YWIA 5EB8A 3K89A 4C1NA 3VGBA 1JLBB 1EA9C 3MJYA 4IG0B 2VODA 4FR1A 1HMVA 3DEQA 2KI2A 2RT3A 1N5TA 3VGVA 3ZR6A 2AKWB 3W74A 4F2SA 5FJIA 1W2IA 2EG2A 2QUUA 3GIQA 5BU9A 5LSRA 1M41A 4GNVA 1GH8A 5IV4A 2J0XA 3DI1A 4KYZA 4HYRA 3WH6A 4Y90A 4DJFC 2FTPA 2PFFB 4CQAA 2PWUA 3T81A 3GCXP 2HRUA 4P7VA 1CWYA 5BYRA 2YB4A 3T4CA 3CQ0A 5B7YA 4J9UE 4KRWA 2DT2A 2Z2UA 4QR2A 1XRFA 2FY8A 2RUGA 4DJDA 1V8EA 2JE8A 3H2CA 4B5UA 1VBXA 1BWKA 4AUBA 4QE1A 2IJNA 2MKKA 3G6VA 1XLJA 4MIBA 2JDJA 3KNGA 3WQWA 3PB2A 2V94A 1JNEA 3W2VB 5LMUJ 4D2JA 1ZBKA 3IEBA 1Y3JA 3LHTA 2NPIA 1DEDA 2BXZA 2W3ZA 2VURA 2P5VA 3UYCA 1UC4A 1XS2A 4HKPA 3S2JA 1YRXA 1B70B 1NJJA 2V4JB 2ATMA 1BQNB 1M5KC 3AD7C 4DV1F 3RNDA 3LQGA 3M46A 1L6SA 2CWKA 3T5KA 3GO2A 2LA6A 3CJ0A 3PC0A 3L5MA 5C0QA 1NO8A 3LBOA 5CZKA 2IJRA 2PBGA 3QM3A 4ZLJA 1YTYA 3MAHA 2QT3A 4KPYA 1I1WA 3G6LA 2Z24A 3WO8A 4KCTA 4U3AA 2QAPA 3KFTA 1XC6A 2OEJA 2CKWA 2D2HA 2A3EA 4PCPA 3ZJ6A 3BH4A 4J3VA 5CYQA 2AL1A 2MZJA 1ML1A 2J74A 5DCBA 3ULHA 1XR6A 1I2OA 1RJPA 3L23A 1Z44A 3CC7S 3W9JA 2X1IA 3OJUA 2VR5A 1RT6A 4XBJA 3QGKC 3PAJA 4RW6B 1I60A 4XTDA 2HS8A 3EWCA 4QJVA 1S1TB 2QA4S 4C6PA 3N2TA 5HJXA 4W92B 2PDPA 2W63A 2OPSB 5EL1A 5K9DA 3O63A 4ZXLA 5IDIA 3B54A 2QR6A 4BS0A 2VEKA 4FP9A 4IKAA 1EA0A 2DZVA 2CNNB 4J2PA 2XMJA 3PZQA 3W7MA 2NLYA 4MZ8A 2L08A 1SH2A 4IDKA 3LHVA 3MPVA 5E5CA 1TU0B 5LMNJ 1WA3A 3TV8A 2A1YA 3AHTA 1R31A 3UDEA 1Y5XA 1RTDA 3QSIA 1IEIA 5K14B 2L5HA 2YWKA 1PVNA 4W88A 1LWFA 4XK8C 1EKOA 3GAYA 4NAEA 4IH6A 2REQA 4I7VA 5ABFA 1K03A 3CV1A 3RM8A 7REQA 5B0EA 3A13A 1VEPA 1LZOA 1E6NA 4DR4J 2HHHF 2R9LA 3H2AA 3VE9A 1PKNA 4CLZA 2P8BA 4OTKA 5LJ5Y 4IP5A 3PVFA 4GRSA 1TV6B 2V3FA 4FYDA 3W7LA 3R7MA 3K46A 1D8WA 4TQTA 1N2VA 4BI6A 4O12A 1NWUA 2Y5SA 4JTRA 3OQEA 1KP6A 1VBHA 1U1QA 1MI3A 4FSAA 3FBBA 4F25A 1TJPA 3GNPA 1FRKA 5T26A 1R27B 3ZLGA 3M32A 3M2RB 2W0UA 4QBUA 5G4DA 1KTQA 3CH9A 1R2SA 4XVDA 3ZTSA 2DPJA 4CTAB 2GGHA 4G1IA 1M6JA 3U1NA 4J9KA 4RJVA 1ZAIA 4ZPAA 3HMCA 3SECA 2H8ZA 4Y28C 3C61A 4UB9A 1R3YA 3SY8A 3WDJA 2DO4A 3T1GA 1OFEA 3GW3A 4PTWA 3INPA 3A4WA 1R30A 4X65F 4GYPC 4HU3A 4USVA 1JULA 1PB0A 5I3QA 4BKNA 2LMIA 5BW6A 1J93A 3RILA 1VH7A 1IWGA 1W32A 5G0RA 2HBRB 4V33A 4LSBA 2Z2YB 3TZXA 2NQ9A 1A0EA 2KJVA 3BAIA 1M68A 5ETOA 3T44A 3Q8SB 4LPCA 3ZS4A 2OLSA 2BX6A 1WKDA 2AJFE 4INFA 2TRSA 1HWJA 3OXLA 4B5VA 1M5WA 3LP2B 3GC4A 1H09A 3LA4A 4J9QA 3WKZA 3GNOA 1FK9B 2QYGA 3TTSA 1JPKA 2IPFA 2A85A 1NY1A 1SW7A 3OD2A 2VQTA 3DFYA 3HBLA 4OI6A 5F8LA 1MZRA 3AIQA 3NCRA 1UUMA 4MADA 3BR8A 2GFFA 3H21A 1OX6A 4C91A 4NVTA 2HVIA 2JLFA 2RRAA 3THVA 2LQ5A 3T07A 4B08A 2C8NA 4D3HA 3OTOF 1DARA 5D09A 2E9TA 1FKAF 3W7HA 1RAAB 5A6SA 5U7SA 3QV7A 4UNLA 2BHUA 2IW0A 5E0OA 1UR3M 2W1BA 1TVLA 2PDKA 2IYGA 2PT0A 3DHWC 3S1VA 5A6MA 4XZBA 1WSRA 3LI1A 2BQ3A 1UH2A 2OTDA 1KBRA 2V9DA 1LEOA 3D2WA 1S72S 5KFXA 3OVBA 3H25A 3FAXA 1REQA 5I6SA 3B4MA 4UR8A 1EX1A 1FWKA 1RWNB 4MKBA 1BSLA 4AEFA 4CH7A 4IQDA 2QO3A 1HJUA 1ZETA 3RLHA 8A3HA 4PUKA 3TVZA 3I4PA 4FOUA 3GR1A 4LIRA 2XO6A 2XGPA 1OX4B 2LLEA 1VFOA 2C91A 2WMFA 5AHEA 2L3MA 3CJRA 3N4EA 3DXIA 2BZ2A 2KVQE 4CD8A 2W2OP 5F1UA 2VT0A 1LT8A 4GIAA 3RU6A 2I0XA 1FH7A 1LNQA 2XUCA 3S8SA 1X97A 4BCAA 1CJUA 3FJ4A 3AA9A 1FP8A 4JV2A 4PXEA 2A7PA 4FO4A 1NH8A 2OPRA 3CC2S 3WBXA 4C5YA 1JQGA 2I14A 1Z2LA 2QCCA 5TNVA 4USJC 2RDDA 3W00A 1IHIA 2ZRVA 1P9YA 4AL6A 1HO1A 4JI8J 2ZIDA 1OGGA 2QG9B 1S5TA 5BXRA 4J3ZA 2YFNA 4J9PA 3A12A 4LAZA 1OSCA 4C6FA 1BGGA 2DW7A 3W88A 2PP0A 3R5AA 4ZO9A 4HTIA 2WSRA 4GQRA 4DF8A 4QW9A 2J7BA 3IPWA 4CYUB 3MCSA 1X38A 2QCHA 5CAKA 4QIEA 3L5LA 4F4WA 3SSJA 5IHSA 1BKSA 1D8ZA 3V6JA 3S9YA 2XSBA 4XO6A 3PTKA 1CULB 3LLDA 2X7IA 2XFWA 1YVFA 4M3PA 2MYFA 1NKCA 3N4AA 3SI9A 4UUXA 3VIFA 4F4ZA 4DN9A 1WAWA 1QAYA 1RCOB 5H2ZA 3VF0B 3QGAC 4FKYA 1NQKA 4PEEA 1R7IA 2E1DA 2QUVA 1CZ1A 1GW1A 4C60A 3D1OA 4QROA 5D02A 1DHPA 4WE1B 1Q5MA 1QLNA 4FR6A 3QO9B 5IOLA 4ATDA 1NFPA 3BBFA 4TTGA 2ZRZA 4DAFA 1DTNA 5KFDA 3CEUA 4JTSA 4L72B 4WFYA 2DGWA 1S6PB 3W7KA 4TMCA 4HHUA 3T0DA 5HLFB 1JLFA 4DO4A 2IMOA 4K4VA 1PIIA 1T03B 1D7KA 1AQ0A 3TMLA 3LCWA 3V81B 1HHTP 1IBMJ 1RY0A 5DGAA 3NCOA 1MN7A 1B3OA 4O53A 1HNZJ 4ELTA 1LDCA 3CO8A 3WEZA 3W1AA 4GPNA 3O1NA 5JH2A 4ERDA 3NEHA 2A6NA 4KCUA 3OIHA 1CT5A 4DV4F 4DO6A 4QWDA 5AE1A 4CCEA 5K5MA 1Y5IB 1WXZA 2E9MA 5AOUA 2W2MP 1JI2A 3U7VA 3BPSP 2RH3A 2ZH4A 1OC6A 3ZFVA 2DH2A 4LUTA 1GNKA 4MB1A 3BS9A 1EIYB 3MUMP 2HBVA 3CTTA 1U4BA 5M2RA 1UJ6A 1VR6A 4AHOA 4BR1A 1S5NA 4WQ6A 1FF2A 4ECRA 2HPUA 1KC8T 2HXTA 1RUSA 1GHRA 1SUQA 2FZKB 4TR9A 2NWSA 4LBUA 3PRBA 2J6VA 3D7SB 4QZVB 2V5DA 3BPWA 1KKRA 2P0IA 1KBLA 3V0SA 1GMVA 3AOAA 3OZOA 4L6V3 1AUDA 1RT3B 1XBWA 3MMDA 2I8EA 3QR1A 1UD3A 3ARXA 3L4UA 2B9YA 1CBGA 4AC7C 3PHTA 4KGJA 3KTQA 2OPQA 3M7WA 4MB5A 2ZD1A 3SGGA 2BGSA 3EMTA 2FQIA 3HK2A 1E4LA 1ZCOA 3BG5A 3HV8A 4LBIA 1N54B 3HFZB 1CJKA 4JL2A 1MDRA 4PPDA 3JU2A 3VCCA 3NO1A 4OHVA 5JUMA 2UZ9A 2UBPC 2BJ8A 3GJTB 4Q6XA 3IK4A 4NI2B 1QNPA 2BEFA 2G0WA 3AXKA 4M56A 2VFTA 1XR7A 3HIJA 3K5OA 2ZE2B 1IXQA 1TWDA 1WDDA 1RD5A 3BGGA 3CJ2A 3LP1A 2BY0A 1SL2A 1V3IA 3NYDA 1HPZB 4WKAA 1RADB 3MB9A 4EVZA 3Q2SC 1JPIA 3GU0A 2YPZA 1W5MA 2PP3A 1UPMB 2OWWA 4LUSA 4YY3F 4GVIA 3HKZD 1GMUA 3DENA 1ADOA 4QG9A 3BJYA 4O1BA 4FBTA 1M3UA 1VFJA 1UCWA 1A6LA 4XO0A 4CUCA 1GPWA 4DIAA 1RI7A 1EB0A 4Y2IA 3LM7A 5DF0A 2OJPA 1WXJA 2D2OA 2UVRA 3MURP 4FNTA 4TVCA 3BDPA 1O8BA 3SJ3A 1SZRA 2ZX6A 3N5BA 4KIEA 1TJ1A 2ZXQA 1U1KA 2YNHA 5BZAA 2EHHA 3GZAA 3UR3C 4BHQA 3ICJA 3FJ6A 4D6HA 3V0UA 5FL0A 3EOOA 3GLCA 3ITCA 3MYPA 3WNOA 3B6BA 1M7XA 3KDNA 2ISDA 1M0SA 1YJVA 4OHXA 2BVDA 1VBJA 5DY3A 3C15A 4WYLA 1RAOA 1UD6A 3AJDA 5IM0A 3MCMA 2DR6A 3VYLA 3ZZOA 3UQNA 3MBDA 3RMEA 3UR2A 2HQDA 3TTOA 4LOCA 3CF5Q 3E0IA 3EICA 4QDWA 1OSEA 2GVEA 4CI0B 2MGZB 2V3GA 4HMNA 1ZJIA 3I68A 3ZXWA 3GDMA 3DFNA 2PTYA 4ZTYA 3DRPB 3JXOA 5L9NA 3IV8A 4DV4J 3MTWA 2PA8D 4QWAA 3CDEA 4H4MA 2FJWA 2V4RA 2CPDA 1GPFA 4GO8A 1MUMA 1B9BA 1JCXA 5FJRA 3IVSA 4L9ZA 1CBKA 3V3WA 3OSNA 3KMQA 3W2WA 3KTSA 5KFEA 4PBGA 4GHRA 3LH2S 2FJDB 3D54A 2VG7B 4H4OA 3WF1A 4Y2KA 2ZRWA 4N9DA 3GXIA 4JNZA 3TRGA 3M64A 2D22A 2XIJA 4CNTA 3R11A 4S2BA 2R1MA 2BOEX 2MANA 4QWCA 1QK2A 3DC2A 4K1GA 4PTXA 4I7WA 4O11A 3ID7A 2ZX8A 2VD8A 1CC7A 4RPQA 3M6WA 1VQYA 4FX7A 1KFJA 1QWGA 1X5TA 3W7NA 3ZM8A 1KD1T 5FD1A 4Q6JA 2W9CB 3DC8A 1JDDA 2VNCA 1HO4A 3G8EA 2KJWA 3W86A 2GHVC 2LU1A 1V6VA 2DSZA 4GNKB 1MRQA 3BF4A 3D5MA 2VFDA 3NPWA 4DWDA 1IN0A 4WP9A 3QRRA 4WBFA 3BLPX 2VC7A 4RW9A 4MYUA 1JXVA 3CZJA 1KM6A 1R0MA 2F6KA 3ADAC 1PYMA 2P2CB 8XIAA 5L6UA 5GMDA 3EDKA 2BKOA 4AVNA 2ZM6J 4YWSA 2HQAA 3ENQA 3V5CA 3PW2A 4CLUA 3YPIA 1E15A 1A0CA 3T1AA 2IPWA 1HL6A 1BF6A 2J7EA 3BLOA 2HBZB 3ZSSA 1RAEB 5FJOA 3APYA 3L21A 9XIAA 2YYTA 1QJHA 5D15A 5DQHA 3STGA 4JTKA 1PO9A 5KG3A 4RUAA 4O1DA 2WNZA 4GJJA 3E49A 5IT0A 2XFFA 1CW2A 1WBJA 2KT5A 4YY3J 3BH6B 3POTB 4GCXA 3S5SA 2OD6A 1FWAC 3SFUA 1TIMA 3MEDB 5LJ3Y 1MFUA 1J2WA 2HE5A 1XQKA 3MI7X 1HJSA 4A46A 2I16A 3DMJB 1NIUA 2WCAA 2POZA 3WLQA 2J77A 1FDAA 2XGZA 1MROA 2D3OR 5H8PA 3PPCA 1TFYA 1FT8A 3HHEA 3WUEA 3VNLA 2V5HG 1W31A 1AD4A 4XAYA 1EO5A 2B7NA 3U1MA 3GKAA 2B3TB 1K9TA 4JQ4A 2GK1A 3MPUB 4C3KA 3W8PA 4UY85 3GG7A 4PMZA 5KOXA 4DL6A 1P6WA 5A2BA 4UZBA 2R1KA 1DTTA 1BXBA 1FD8A 2DZBA 5HI7A 3D67A 3MQTA 2HHQA 3ITHB 3HGSA 4NLWA 3GFHA 5HP1A 3L0KA 2D20A 5EY5A 1VCFA 2H5JB 1DQXA 1MRAA 2FH8A 4QXIA 4V1Ak 3UNGC 1E0VA 2X1SA 1JNZB 4LV9A 1XBXA 2XH4A 5DZ6A 1Q8JA 5CGTA 5SUHA 2QE5A 3A64A 3VMOA 5A6BA 4BI7A 4GBDA 1YBQA 1OEPA 4I4BA 4U5KA 3M16A 3TYCA 4IFKA 3PJTA 1S0VA 5EMYA 4IMCA 3FXGA 3HZ3A 3UT0A 4I5UA 2FHCA 4JCLA 3WMLA 4WGXA 2DNZA 4ECXA 1FXPA 4YCPA 1LOUA 3KK2A 3UN2A 3H12A 1VBUA 1LQAA 4W8LA 4ZGYA 4UOZA 2KDOA 2P3ZA 4I0WA 3A8JA 4LQ9A 2QCFA 4J35A 1BGAA 1SVDA 2OYLA 1FJGF 4PMNA 4IG2A 1PX8A 5IBXA 1F7BA 2VKZG 1CJTA 1U24A 4JI4F 1OIAA 1UZ4A 5GPRA 2EG1A 1FP9A 1C1BA 3HHLC 2YCJA 3EPGA 1EJWC 4U33A 2IIHA 2A3BA 4IIDA 2NT0A 4M80A 5DDOC 4ZOCA 2QL9B 1BQGA 2PCEA 3W3OA 1FCUA 4C0BA 3UZZA 2F8EX 3DRRB 4BLGA 4JKKA 2FPTA 5KFFA 2KG0A 1IWAA 4F3QA 2PCQA 4PYSA 5G2IA 2OEMA 4ONVA 3ZVIA 3C6UA 1O6IA 1K73T 3OSPA 4NZ6A 1AFIA 3H98A 4PBFA 1JUBA 3PYFA 3B05A 3LEPA 4Y8FA 5LIKX 4Y65A 2RAQA 3FBEA 3FVYA 4HYVA 2IY5B 2QJNA 5FF0A 4M5DB 4NLRA 3SGUA 1OINA 1AJZA 3RCMA 5K3VA 1WD6A 1Q1KA 1MQPA 1OF8A 3EPMA 3GY1A 2FJVA 2CVEA 2D74B 2RILA 5CZJA 2V2KA 4I2QB 3L67A 2YKKA 1UD4A 4O0KA 2H6RA 4NG3A 1H0IA 1GOWA 1S6QB 1ZAXA 1Q66A 1KR0A 3G1SA 1K8YA 3LZ3A 2EPOA 3V0TA 2WNNA 2H9AB 4DF2A 1EXBA 3OYXA 4UWMA 3FJNA 3V5OA 4AZ6A 5LA0A 4MFDA 2XC9A 3PVXA 2FTRA 4AYBD 1MQRA 4L9XA 4MTVA 4C6IA 5HNUA 4C2MA 3BKFA 5CG7A 2X1TA 1SJFA 3CCQS 4O57A 4N7TA 1W9XA 4GLEA 3VU2A 5DQIA 3RGTA 3NL0A 1FY6A 4GVHA 2VTFA 2QZ8A 3RB6A 4ZSUA 3BQ2A 3FYPA 3FS2A 2B7BB 1E4IA 4X2BA 3NURA 4ECYA 3IRXB 4LUJA 1Q8AA 2YKMB 4UFLA 3A5VA 4HSHA 1JVNA 3JW7A 4P7OA 4FBUA 1X4FA 3LHUA 1TZ7A 3TSDA 4EF9A 3VNIA 3ZMRA 3WNLA 1TWZA 4Y9PA 1MW3A 5KT3A 4YXGA 4DR3F 2ATCB 5CCZA 3JZUA 3C0LA 5EBUA 3R8RA 4GZ7A 2Y88A 4DJDD 2JC0A 2J0QD 3MS8A 3AS0A 4K4YA 1QNSA 1S3HA 1LF1A 2IPJA 3PTMA 5J2MB 2XIMA 3C52A 3CCMS 2Z6IA 1E4NA 1QI3A 3DFPA 3V4BA 2G1HA 3MCOA 4OZ3A 2DORA 3PZTA 2E5HA 6TIMA 3IRDA 1BRLB 3N4FA 2GQ9A 1LK5A 4EPEC 4J90A 1S39A 3CUXA 4D6CA 1HBUA 4QSHA 5DMLA 5J5RA 2CLFA 2YIHA 4O8RA 2ZITA 2JFKA 1QW9A 3VOGA 4GO9A 4Q44A 4WOZA 3W1MA 4NNBA 3AFBA 3QJJA 2C6QA 3VFCA 5DG9A 3EVOA 2WSKA 4MYTA 2EPMX 4CLTA 2XI2A 4CIOA 2BP1A 2F4FA 1NDKA 3DFSA 3EX2A 3JSMB 4ALDA 3V4IA 4NNAA 1T7LA 2VH7A 2WPGA 4NWBA 3K8WA 4LSLA 6FD1A 2HZVA 4L4LA 3IG1A 1FWJC 1S7IA 4JI4J 5H8UA 3BMVA 4EWND 3GTIA 1VQ6S 7ENLA 4TQSA 1KXHA 2IUZA 4X22A 4F0HA 2H5EA 5F0WA 3B8HA 3K4WA 2XN1A 2PTZA 4MGGA 1HNIA 1N0UA 4JHZA 4PRTA 4AE5A 3DLHA 2CEQA 1LW2A 4B2DA 4NLXA 3LK6A 3UW1A 2ZZ2A 1YPIA 2AZ1A 1OD8A 2GJLA 2YA2A 4Q3MA 4BWLA 1HW9A 1TTHB 4JFWA 2DY1A 3M47A 3URQA 4CDIA 4GX8A 2EFNA 3UWVA 4R5EA 4B3ZA 3SCVA 2IMRA 1SJ3P 4QG8A 4C5ZA 3LCLA 3R7BB 4JNMA 1OC7A 2V5KA 3UPBA 4OX9F 4ECVA 3MEEA 2CFXA 4JP8A 2VQFJ 5PTDA 1WB0A 2XVPA 3LPGA 4MNMA 3WK1A 3LW5C 1ROFA 3IJIA 3GHUA 2D3NA 3QY7A 4YB7A 2TSYA 3MV01 5B7WA 2WVCA 2IC3B 2YNIA 5IV3A 5AXNA 2I2YA 2XMUA 3BG3A 1O7AA 4Q8EA 3O5TB 3HV9A 1ZJBA 1I3OB 1NZ8A 3M7VA 1F6KA 1XMOJ 2CIPA 4YL2A 3DU5A 3PR5B 3N3TA 1NAL1 1SC1B 2BFGA 1BFNA 3WH8A 2AD9A 1SQEA 5GAEI 2NVDA 1QT1A 2VEGA 3GH5A 3B97A 2AEFA 1RAHB 2ZA3A 3GJSB 1Q63A 3THTA 4OV9A 4OGZA 1IZKA 2W4PA 4B9SA 1JZ6A 3U4AA 3H2NA 3V1PA 2H51B 4N9EA 3OJGA 4L1GA 1ZP3A 4KB7A 3TTEA 3R43A 4MH8A 3NO3A 4NLQA 2ACYA 2CPXA 3G1YA 3C14A 2KT3A 1F5BA 2MXYA 1YBTA 4PYDA 2BS9A 2MKHA 4W8AA 3APGA 3SDOA 1WF2A 1EOMA 4PRFA 2WVTA 5CPOA 2RRNA 3B9EA 1IXNA 1CEZA 4Z37A 3TA1A 2NSXA 2NLWA 2PGFA 1BYBA 2B43A 3EX3A 3EAUA 4DQWA 2HVOA 4CQBA 4U8YA 5JBDA 2WKGA 4K68A 3VAHA 2Z1BA 1ZTVA 5MF5A 1UKSA 4Q8MA 4CGTA 4NZ0A 2VZVA 1CPZA 4NF7A 1VCGA 1S9EA 1VQ5S 2FZBA 1NSQA 2ASLA 2HS6A 4WFBQ 3KRZA 2XGBA 4YU1A 4BK9A 4CLWA 1FWNA 2DH8A 3BLFA 4NXKA 2OMOA 5KFRA 1HR0J 3TAMA 2ISFA 4PULA 2NT1A 4FXDA 2IKIA 3KBSA 2MJUA 2WONB 4NLPA 4KERA 7XIMA 1VHNA 1XKJA 1Y10A 2FVCA 3W1YC 1ME7A 4F79A 2R82A 3IIPA 2GQAA 2OSXA 2FZGB 3IBCB 2V5CA 4V1XA 1J18A 5AJ3F 5K20B 1NSJA 1US3A 3SSRA 2ZWPA 4LF7J 4FOJA 3ANVA 1JLQB 3PW0A 2KYXA 3H4GA 3W71A 1WDSA 3NL5A 4QR0A 1OVDA 3VCRA 4A8IA 3DOKA 2E7XA 3HZEA 2HDJA 2HVDA 2F8MA 3OFHA 2MQQA 1HQ2A 1GK8A 2CBUA 3DGPA 3HQPA 2B51A 1RV8A 3OZYA 1AVAA 4JYAJ 2QDHA 5C71A 2BGQA 2YVSA 3SEOA 4ZJLA 1ITQA 4OI1A 1W5QA 5HOSA 1IKXB 3K2YA 4ZLNA 4UNKA 2HVZA 2VX5A 2WSYA 1J9YA 4XV0A 3MEGA 2KL8A 2PDNA 3KLHB 2IBKA 1U2CA 3MMBA 1B64A 2B9WA 4R25A 5F41A 2IS7A 3QVQA 2Y2WA 2E1PA 2VPWB 4WJXA 1N5QA 2IVFB 3R10A 4EZ9A 2G3MA 4AFYA 3WH5A 2HK1A 1E1CA 4C9DA 2IDLA 1S2WA 1CC8A 1ZENA 2HFSA 5JXSA 3G8SA 1M65A 3CXOA 3NL6A 2EFOA 2QJMA 2CNCA 3NAHA 1JB0C 7AT1B 3TKFA 1D0EA 3I55S 4JV5F 4USKA 4WIWA 1IR1A 1RP8A 2HK0A 5F3TA 2W8LA 1YQ2A 5M2FX 1KWMA 3MP5A 1XLIA 4ILSA 4CH1A 3KVMA 2EEYA 3UFCX 3IR6B 2CKRA 3S46A 1WOSA 2YNFB 2YWWA 3NQFA 1UKQA 1Q2SA 4DV6J 1L3SA 5DFAA 1ODUA 3M4HA 4UFJA 2IAJB 3PB0A 5F2MA 1GX5A 3VC6A 2X3GA 3HPZA 3DYAB 1NTHA 3M0VA 5L39A 2OKOA 4P52A 4LS0A 2X05A 1C9DA 2WJEA 4P8VA 4JTIA 4X2RA 3AU6A 3SQGA 1ADDA 2GVDB 3VNDA 1JG9A 2FQQB 1D9FA 1JLCB 1U1RA 3N2XA 2Z6JA 2FHJA 4EPBC 2WVEA 1NKBA 2V8GA 4NLSA 4G3IA 4C11A 3VNYA 5ETMA 2OD4A 3M5ZA 2BGNE 1JX4A 3Q67A 2Z30B 3D6NA 5IWAF 3EMZA 3KWXA 2RF2B 2OU4A 2ADCA 5HWJA 3A4TA 3WDIA 1H50A 5I3FA 1W6TA 3OR1B 4ZVUB 5CPMA 3GFYA 4PSRA 2CXEA 2XN0A 1K9EA 4UQCA 4L5ZA 4B3RF 3VD4A 2YNGB 1L3VA 3E0VA 1DY3A 4LF5J 1DFDA 1BQMA 5I78A 4JTEA 1F3EA 4PCSA 2MQLA 1P5BA 1WSVA 3BTNA 5E3RA 3S01A 1GOIA 2IXVA 3ES8A 4DPTA 1SQGA 4ECSA 3BSNA 3W85A 3HA1A 1DWIM 3DH7A 3ZT6A 3N6NA 1SI9A 1K1DA 1UEVA 4U7CA 3EXYA 4R34A 1YIXA 1J0IA 4PE8A 3AMKA 2MZTA 5EMLA 3S1UA 4OIXA 3TZWA 4NZCA 1CXIA 3EWZA 1JCTA 4GISA 1PHWA 3UWQA 1VIXA 1NH6A 2R7TA 4XK2A 3LLFA 4J9NA 1RISA 1SSGA 1KTBA 4A3RA 1Q6EA 4O1FA 2HJPA 3TP4A 3PEHA 2QGYA 4OZNA 5CC3A 2VEPA 5D30A 4H41A 4GFIA 2O5DA 5LSLA 1U0HB 3RZAA 4N4PA 5AVNA 1KHWA 3NGRA 5G4WA 3URAA 3KOZA 4LFAF 1RKIA 2BXVA 4X64F 2FVPA 4IR1A 2YZRA 1I0BA 2FVSA 5A0YB 1GYMA 1AZSB 3PDNA 5B0DA 4K4WA 5CSRA 2ZQ0A 2F9DA 1WC5A 3DFOA 3ZOAA 3VM7A 1HQEA 1DWAM 3S47A 3A3HA 3B9AA 3W2LA 1LWCB 4W98A 5H9EJ 3K7RA 3Q8PB 3BOLA 3LCGA 3WBAA 1YZ7A 3HVRA 1HVQA 1LWXA 1E3XA 3DM2A 1U5JA 3PZIA 1ZH5A 1UFWA 2F7FA 3I9V9 4JTHA 1X6LA 1K6WA 2IDEA 4FI4A 3ORWA 3KW3A 3LGGA 4LQ3A 2HNZA 4URGA 1DORA 2JFDA 3DCAA 1GG0A 2CZDA 2NX3A 1HZYA 3AHYA 3HPFA 4F2TA 1UP2A 1AXQA 4HT5A 2CJKA 1LYXA 2KXHA 4JIPA 5CYJA 2DTJA 3OB8A 4L56A 4DSJA 2C2ZB 4OMFG 4JIQA 3B9OA 1V7AA 2EFQA 1O1HA 3NKYA 1UWBB 3CUFA 1ZU8A 3DOLA 2W7OA 3BKTA 4FF4A 3A6OA 2W79A 5LGXA 1K7FA 2WVBA 3IACA 4DMZA 1FVPA 1PPIA 1TX2A 4MB3A 4MKVA 1MEHA 2H3DA 3BARA 3KZSA 5HJLA 1E9IA 3PBWA 5I42A 4KAIA 2QCGA 4LF1A 4R0JA 3IWXA 5DM7Q 2MMYA 2ABYA 1J4EA 5EMUA 4LALA 1LWEB 3B9NA 3A3PB 1WELA 2E5GA 2JLGA 1UKOA 5I3KA 1YDOA 4I68A 3FDSA 4KFBB 2XGQA 4W9TA 5HROA 1XD1A 3F5JA 4Y9MA 3QOKA 3WSUA 1G9HA 5EA9A 5CZXA 4J28A 3E96A 1FEHA 1B90A 5A6KA 3F2CA 4PMYA 3T3FA 4AFFA 4RPFA 3EYZA 4FZIA 4XDCA 1A0OB 3B04A 1AMKA 4C8YA 3EB3A 5I79A 1TZ0A 1TJ0A 4UR9A 5LSMA 1T5AA 1VBGA 2ZTJA 1NHVA 1GHSA 3L5AA 3PP7A 3ZSTA 3UBPC 3EA2A 4DEZA 4B3RJ 4A2SA 3DLEA 3RJXA 4JV0A 1NJYA 2C2MB 1T05A 3DKLA 3MSRA 4K5RA 1JF5A 2OLAA 2R2SA 3I82A 4QAIA 4UCFA 2D1CA 3SCUA 4Y7EA 3I5AA 1Q4NX 4R8UB 1W2BR 4R88A 4GH1A 5CAHA 1ME8A 4O3SA 4LT9A 5U47A 2EG7A 2LCWA 4GA8A 4G1QA 3O44A 3L4TA 2YY3A 1NWTA 4KKOB 3I7RA 1RT5A 3K59A 3AMCA 1RU2A 4B02A 2WMIB 4KKXA 1FXQA 2AAAA 5IT9Y 2V2DA 4KPCA 3VX1A 4ZQRA 1G1YA 1WAUA 1V9OA 3CJ5A 5HNTA 1JLBA 3VHQA 2CFFA 3ZLFA 4IG0A 2B4VA 3QAEA 4DYKA 4M19A 4J91A 2XMMA 3DU6A 4HCHA 2J5AA 5F2GA 4Q8TA 4H2HA 3UF9A 5H8MA 1TKXB 1T41A 2GJPA 3H0PA 2WZMA 3GSMA 3ITVA 4I7UA 1R86A 3N3MA 1LQ0A 4X64J 2NZCA 3ARPA 3LN3A 5FEXA 1UP1A 3CCUS 1Q78A 2V2VA 3ENAA 4JL1A 3RRAA 4OU1A 4I9AA 4IF2A 5G4HC 1FFGB 3IUDA 2ZRUA 3C0JA 2FIUA 4F3HA 3CEPA 2VJXA 3T08A 4YHHJ 1U6BA 3VC5A 1TL1B 4U67Q 5T9CE 2DJWA 1OFDA 5CGQA 4DX5A 2DIUA 3M8RA 2ADAA 5CABA 2QV6A 2YQ3A 3FGVA 2KM8B 1D7FA 1FXDA 4UZCA 4RZ4A 1R8PA 2CYYA 3VDBA 1BQNA 4NXSA 1J8VA 3GYNA 5FSEC 3TJ9A 2ESCA 4CO0A 1KQGB 1HW8A 1XEZA 4NXNJ 2ZHBA 2VZTA 1G3OA 3BCFA 2UVWA 5LIUX 1VAHA 4IFVA 4AQLA 3GSDA 2Y70A 1XJBA 3T4WA 4EAYA 2HNYB 3EB2A 1X5PA 1YZ6A 2ZOGA 1BSIA 3J80U 1OD0A 4QJ4B 1SO3A 1FWHC 1ZM3A 4ZA0A 4B9TA 1W3IA 4IPNB 4UTMA 1KLMA 2KXNB 4QJ3B 1PIFA 2ZDRA 3B8DA 3Q2DA 3N9SA 3DIPA 3TFCA 4LF8F 2G96A 1KBJA 3UZJA 3S9IA 4RW6A 5DLGA 3W0KA 1S1TA 1WKLA 3NS5A 5D9PA 3SEPA 4DJEC 1TG7A 2DB1A 2E1CA 1IBKJ 2OPSA 4LTSA 4OYPA 3EWBX 3OLIA 2B8QA 1RP5A 3CO9A 2XVGA 1DQAA 5E33A 4DI6A 3GIJA 1XNQF 4ZB0A 4LYKA 2C7FA 1TX0A 4Q7BA 2W4XA 1Q6GA 3TWZA 2AEMA 3KUEA 2G5WA 3NL3A 2PN6A 3MZNA 1V4YA 2KAUC 2X1AA 1TCDA 1TB3A 2PC4A 5M5DA 2J78A 4DLMA 3KLFB 4IQXA 1DQWA 2CPUA 4FYVB 2DHAA 4GD0A 1P4CA 3TN5A 4QQBA 1SFJA 1MWOA 2CETA 1F2GA 3CB8A 2ZZ4A 3DHXA 5FJJA 3TUJC 1EH9A 2J88A 4KBXA 2RDTA 3UJSA 1MXGA 4CCHA 2I5IA 1QAXA 3D6MB 4UTFA 3D3FA 3K5NA 4OJ3A 1I6JA 1TPVA 3KVKA 3STCA 2C2DA 3U57A 5LXXA 3TUUA 4MWAC 3UXLA 1TV6A 5CZVA 2XSJA 1XINA 3A3XA 1VENA 3MXHP 5KFTA 3D0IE 2ZNZA 2GPTA 1QTWA 3T0TA 4IG3B 4UTIA 2G3IA 6PTDA 4F2RA 3OG3A 3P62A 4FP1A 3M2RA 2BDPA 5BRBA 3CJKB 3WG6A 1DJ0A 1JUEA 1OFPA 4A3UA 3OOQA 3NO5A 1DIKA 4DPUA 2NQZA 2HVEA 4CTAA 3KBWA 2XINA 5A6BD 2WZ1A 1DJNA 4YB6A 1RJQA 1DWHM 1OG0A 3TTYA 3HI9A 1Q6LA 1SW0A 5IFTA 1PGZA 3THUA 4NRTA 4BJHA 3GTFA 2E1AA 2VGBA 2FFCA 3I7QA 2DIVA 2MPUA 3UPWA 3WQDA 3UCZP 2EKCA 1Q85A 5D8HB 1M5SA 1HWLA 1NK8A 5XINA 2ZBRA 3MSYA 4CLKA 3UNDA 3QZ7A 1BVNP 5LXRA 1NK6A 4R7WA 2CPFA 3FKRA 3OHIA 1BWVA 1K7XA 1R7AA 1IYXA 1T8XA 4AB4A 3LP2A 5CBIA 3ZZYA 4ZLPA 5DETA 5DDRC 3SN4A 5EUHA 1FK9A 1V3LA 1C1CA 1E5NA 1DVJA 6TAAA 3E01B 4ID5A 3OVAA 1VS3A 2JEIA 3HXMA 3AOCA 1KNZA 3DOPA 3T41A 2VENA 2EF9A 3VNMA 2Q1LA 1S2AA 1JDAA 2GVJA 5FD0A 4C6JA 2JF7A 1UVKA 4ZVGA 2ZH5A 3VDGA 3BJTA 1FKPB 2DV0A 1S5WA 4DS4A 1C0UB 5C9WA 2C2EA 4Y3CA 2YDRA 5D77A 3ISZA 2PLCA 2GVZA 5GNYA 1MXSA 1DL3A 4AIUA 3QRQA 2NS1B 1S9FA 2FZNA 3UJEA 4L3KA 3OIXA 4YYCA 3ZVHB 2OZ3A 2QT7A 5BWAA 1YDVA 1UVMA 1FWCC 2I1RA 5CLTA 4XB3A 3CUHA 3E3HA 3LPFA 1UWQA 3ANUA 5C5YA 4PODA 1VYAA 4B5XA 1XMQF 1TQLA 1L8NA 1SFTA 1GX6A 4XBKA 4X4RA 3GB0A 4MSSA 2IJFA 1LLWA 5T14A 1QNRA 1FRXA 2E9LA 4JICA 3TW7A 1ZM9A 4XZMX 3NQ7A 3Q83A 1RXOB 3WK2A 3S1XA 4RNJA 1PWMA 3LB0A 3OL8A 3BLKA 3SCQA 3W38A 2F65A 1DQ8A 3DLKA 4P75A 3KK1A 2VOPA 1VQ7S 3VUSA 1RPKA 5KFAA 3AMLA 2J6SA 4RNMA 3AISA 2QEZA 2ZVSA 1YDYA 1ZPVA 2GC8A 5AC4A 1REVA 2LQBA 3ERPA 3E5PA 4XZ9A 4P7LA 5D9NA 2HISA 4DV7F 3SR7A 4DR7F 1U8WA 1H74A 1HNWF 4AXKA 4X4OA 1Z1ZA 4WOQA 4UTWC 1PL9A 2CDQA 4NT0A 4CQ9A 5GJNA 3LU2A 3GE9A 2NXCA 1TQXA 5A2CA 4EANA 5D4LA 2DVXA 3BLIA 3WN6A 1JQXA 4NX0A 1CGVA 1UUQA 1CXKA 2X41A 1U7LA 2XMVA 3D3BJ 3V6HA 2GZXA 4LB3A 4A8FA 1ECQA 1Q6OA 4JI0J 1KLYA 5CJNA 9RUBA 5AN7A 4ZJQA 1TPUA 4CYUA 4RLEA 3HJFA 4GO5X 2P9CA 1RWWB 1NAQA 5AHIA 2EVZA 4IT1A 1J5TA 1XP3A 2UWFA 4JFSA 3P96A 2E5CA 4H4KC 4YR2A 1PC5A 4HSOA 3RX4A 5CSSA 3R13A 1MSWD 1O5QA 4WLCA 3KEHA 6ENLA 2PMWA 3N5FA 3UDCA 2NXJA 3W7OA 3BANA 4GUGA 1HL2A 2DGSA 3CPRA 1KTCA 1LWIA 1TO3A 2BLEA 5LGZA 5CYQB 3OHBA 4K2SA 3MF5A 1O51A 3QO9A 4H8UA 5H9FK 4YFUA 4S2CA 2FHBA 2PWEA 3LX9A 4QWEA 4ATLA 1U1MA 2ANUA 1N56A 1E43A 3MI3A 2Z25A 1S6PA 3CGTA 3WBYA 4B2DD 1T03A 1R5YA 2KHDA 1Y8BA 3SCSA 1BLIA 3V81A 2R1LA 2F2HA 3H7HB 1RT1A 4YCOA 1TVNA 4S3DA 4U7UK 1Q86T 2PRMA 1JL8A 5I3IA 4DFPA 1WC1A 2D3ZA 4WF9Q 4Y8EA 4L4PA 2H3BA 4OX6A 2DT0A 3LXAA 2ISWA 3BDKA 4AF0A 1B3XA 3MWBA 3KRBA 4IDKB 2PDHA 2VG5B 1RBOB 3AQUA 1XCWA 2KRRA 1K77A 4OBRA 4LRCA 3DLLQ 2P5NA 1DPMA 3SUWA 1WZKA 5AHNA 3OT9A 3F44A 4ZPTR 3DX5A 4DO7A 1RTDB 4N76A 2DSKA 2J24A 1TKZB 1MU2A 3M9OB 3H2OA 1LWFB 1W25A 4MWAE 4KEZA 2FB3A 3NAIA 2R8IA 1V03A 3PUEA 4GNJA 5CPTA 1R3RA 1HI1A 4XAZA 4G9PA 4PTMA 1Q4RA 3PR2A 1LQ2A 4JOUA 1OYAA 4HNOA 4KEUA 7REQB 4PA8A 2A3LA 3VAMA 2DVUA 3OFEA 1KONA 3QY8A 3BW2A 1IWBA 1KTNA 2BOGX 2OSWA 3NQGA 2R7OA 5ECVA 4PCNA 1WKJA 3WX8A 4EBEA 1X4DA 2M8HA 4GC7A 1RTIA 3R89A 1MWZA 3GG8A 3PFOA 2EEXA 4NIRA 3A8EA 2UY2A 2J9YA 2I6WA 1Q53A 3PKYA 3NG3A 4ROPA 2A3HA 2EGZA 1JZ2A 4IICA 1VLOA 4PABA 3VAGA 3OVPA 4DV7J 4RNOA 1XLGA 2QKFA 4DR7J 4FNSA 1YLVA 4OIFA 1J79A 1GXTA 4GXPA 1QNOA 3E2SA 1S0OA 1UEUA 3UCDA 3NAVA 3OTEA 2E6DA 3DG7A 3W1LA 4WTOB 3IN5A 3HG3A 4NI2A 2Z1XA 4QS6A 4Z2IA 3K4AA 5C7PA 4MY1A 3R5JB 2ZE2A 2GJXA 2EPLX 1OG6A 2QA4G 3PX4A 2CLMA 5BMWA 1WZMA 4IPLA 2Q79A 1KXQA 3PNZA 1LCOA 2ICSA 5ETRA 1TPB1 2NQ5A 3D47A 5HBFA 1DE5A 2HHXA 5E93A 3IUHA 1M7OA 2R1PA 4RZBA 4QYRA 3IM8A 2X09A 3QZ8A 2ADBA 1UP0A 2XWEA 4F4AA 1H4PA 2EJAA 1FX4A 3UXDA 5DY2A 2WC4A 2V34A 4A4JA 3CT2A 3QHOA 5D32A 3M2VA 2Z0GA 2ZA2A 3T5JA 2WVSA 3L65A 2POTA 3LS9A 3AHZA 4DF1A 5T8GA 1VBZA 1G67A 3TYTA 1Z32X 4O52A 5THWA 2DXDA 2DR8A 1F5CA 1JCLA 2PWDA 4LAUA 3N2MA 3Q65A 1FJEB 3MM7B 2NSOA 1CB2A 4D71A 4NLGA 3B9DA 4BEUA 4K8RA 4ZOAA 4Z2HA 1O6XA 1PDZA 2AKMA 4CNOA 1XYLA 2UXDF 1KD0A 1KM1A 2D3UA 3UA4A 2GS8A 4U28A 5B09A 3OGVA 1JZ4A 2AQ4A 2ZUUA 3CJ3A 3EOLA 3FJLA 3QZEA 4X63A 4GKJF 2G4BA 4S3CA 2XZDB 4GH3A 2IM1A 4C6MA 1XIFA 3UY7A 2PDJA 4M1KA 2UUCF 2DUAA 4WK3A 1CS4A 1KN6A 1HNYA 5JIWA 4KO0A 2V30A 1PKUA 4GVLA 1QAIA 3N1AA 4EEYA 3N13A 5I3GA 1W1TA 5HINA 2WB5A 1REQB 1UHVA 3FHQA 2LEAA 3BQ5A 4ETZA 2WKJA 4WCEQ 1KR4A 4AAJA 3IWPA 2CJBA 3PBVA 3KFWX 4LW7A 2YXLA 2F5GA 3BH7B 5HQ8A 2DVIA 1L8PA 5G2WA 4GK8A 3J7Z5 1WC0A 3O1LA 4A8OA 2GUUA 2MKCA 2BVWA 5D8WA 1CQNA 1FA2A 1UKTA 4MUPA 1EWEA 3QMSA 4O3PA 3G4SS 4IJRA 4LF9F 4PUWA 4NAFB 3SCKE 1O1ZA 2Y6ZA 3B40A 3UEQA 2VU5A 1X6UA 3O6AA 1S59A 3IFEA 1NDLA 2O4QA 4CQ8A 4FEZA 2DYAA 3I3BA 2XISA 1KVIA 3C2YA 1HHSA 2OPRB 4YTUA 5D03A 5DG8A 3QSYB 3EKLA 5CZ0A 1G7CB 2Y7FA 2GUBA 1HKWA 1DTUA 1V3KA 3C16A 3W60A 1HNVA 4ZSTA 1S2UA 4N2YA 3B8IA 2FHJD 1GQLA 4F40A 5BXPA 3GYXB 3S0CA 2W9CA 2P1FA 3UZYA 1XUZA 4A6GA 4X84A 2E9ZA 3LPPA 3ARQA 1BVWA 3QXBA 3ARRA 2JX2A 2RB7A 1WOPA 3QFWA 2IMWP 1SYTA 4PRWA 4RL1A 1ZOTA 1XH0A 3P67A 2OSRA 4NASA 1X7IA 1QOPA 5HBMA 3W27A 4A29A 4FLOA 4WFAQ 3I31A 1F6TA 3KBNA 1SO4A 4Q22A 1HP5A 3O2LA 1S77D 4UMBA 4JX4A 3GIIA 3EEGA 5T7LB 4GY0A 4C8LA 4R9OA 1TL7B 2EKGA 3L4XA 4ZO7A 4NYYA 1AW1A 1EETB 2DHGA 1SR9A 1QVGR 4C3LA 4JEJA 5HVGA 3ZTOA 2UXBF 3QQ0A 2UP1A 3UI3A 2P76A 4HZ7A 4OX7A 3TJ4A 1I1GA 1W9VA 3N12A 3JRKA 3POTA 1GWJA 3N6LA 1XLKA 3GBEA 3ZZZA 2ERRA 4W7UA 1RB0A 2H3EB 4DOZA 1B57A 1LM1A 5GAHI 1VQPS 2MLYA 3IJDA 2QUNA 5KG6A 2CNKB 3DMJA 3NPUA 4CZCA 4ZVSB 1C93A 4WK1A 2A10A 3N17A