3PJXA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, p32
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
total genus 155
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjxA01
1K1QA 2QV6A 4RW8B 4ICLA 4Q45A 4LQ9A 1C0TA 3MECA 3PJTA 4IG3A 1TP7A 4B3OA 4JV0A 3TQ1A 3DOLA 3MR6A 5DQIA 5D3GB 2D3UA 3V6DA 4HYKA 1RT7B 5F8NA 1S6QA 1RTJB 3KMQA 4O3PA 1HPZB 2UUWA 3KLGA 1RT5B 2BANB 2FLPA 1S1WB 2WOMA 3QO9B 2J6SA 1KLMA 3GG0A 4F4YA 2BE2A 3T5KA 4MK7A 3DMJB 4U7CA 3KLHA 1CSJA 1RYSA 4FOJA 1GX6A 4ZHRB 1HNIB 3E51A 2VG7A 1DTQA 3FDSA 4ED3A 4J9SA 3PW7A 1SV5B 3HV9A 3M8QB 3BSOA 1N5YB 4HKQA 1JLAB 5J2NA 3EPIA 3I0SB 1EP4B 4ZVGA 3HHKA 5HBMA 4HJFA 5KFIA 1DLOB 3PJWA 4RW7A 5HROB 4IDKB 4RNMA 2IC3B 2YNHA 5DLFA 1IM4A 1R0AA 1JLFB 1LW0B 3BREA 3MEDB 4O4GB 3U2EA 4ECZA 3TVKA 2GC8A 5F8MA 3V6HA 4EEYA 3KNAA 3DRSA 3PW4A 1FKPB 5KG1A 2HMIB 3CWJA 3MEEA 3N6NA 5I3UB 1LWCB 2AU0A 4K4VA 3DOKB 2FLLA 1LW2B 5KG7A 3NBPA 2FLNA 2WRMA 2J6TA 3DRRA 3IGNA 3LAKA 4YMEA 1IKVA 2OPRB 3LP2A 4WFYA 4TY9A 5MF5A 4J9OA 1RTIB 3QIDA 4K4XA 4LQ3A 3DLEB 3QZ7A 1C0UA 4ECSA 4NLOA 1C1CB 2W27A 3FQLA 5DGBA 4ZP9A 1C1BB 4J9RA 4FBUA 1KHWA 4DG1B 4ECRA 3CO9A 4IG0A 1JX4A 2ZD1A 5EUHA 3Q8QB 2ASJA 4URSA 4R8UA 1MMLA 4DL4A 4K50A 3MR3A 2IAJB 1LWFB 4FS1A 4PUOB 4KHRA 1HYSB 5CYQA 3DLKB 4KSEB 3G6VA 3H5UA 4O4RA 5KFWA 5KG4A 3KLVA 3GV7B 4GC6A 5HLFA 3KLEB 2YNFA 3DLGB 1T3NA 4F4ZA 4IR1A 2RKIA 5KFDA 1HARA 2I5JA 4ECWA 4RNHA 1BQNB 1RT6B 4H4MA 5C5JA 5F8JA 2GIRA 2R2TA 3FFIB 3NGDA 2JEJA 1DTTB 2OPSB 3I0RB 5KFZA 2YNGA 3PJUA 3NAHA 3DI6B 3DM2A 5MKGA 5F8HA 2V9WA 1S4FA 2D7SA 5M1TA 4KV8B 4NRUA 4DL6A 2CKWA 2JC1A 1VRTA 4TQRA 3QLHB 1C2PA 1HMVB 1EETB 4TY8A 5DG9A 2UUTA 3C6UA 3KK2B 4I2PB 3M8PA 4AG0A 1S1UB 4MK8A 1JLBA 1NHVA 2YNIB 1IKWB 3EPGA 4IKAA 2R8IA 2YKNB 2W9AA 4KKOB 4RW4B 4IQXA 1TV6B 4DEZA 2UVRA 4RNIA 4RW9B 3IS9B 4NCGB 1N4LA 1LWEA 4ID5B 1MU2B 2ZKUA 4RNNA 4O3QA 3BGRB 4EBEA 5DG8A 3BGRA 4IH7A 2VG6A 2OPQA 4H4OA 3RB3A 4FOUA 1JKHB 1S1TB 3T19A 1RT3B 1RT1B 2VG5A 2D3ZA 4ZP6A 4RW4A 4YR2A 4K4UA 3KZPA 4O3OA 5KFQA 2W8KA 4GC7A 2XWYA 4MK9A 4RNFA 4IOBA 1IKWA 2FJXA 2XI2A 4MFBA 4K4TA 3PW2A 2AQ4A 5F8LA 2RF2B 4LSNB 3M8PB 4Q0BA 3DYAB 2C2DA 4I2PA 3KK2A 4WZQA 1TKXA 1T03A 4F3HA 1EETA 1HMVA 4TN2A 4TY8B 4DL7A 2HWIA 4QWAA 2HNYA 2HNYB 4EYIB 4F4XA 1FKOA 3TAMB 1TKZB 3IG1A 1T03B 3N3TA 2IM3A 5CYMB 4ZMMA 2BRKA 5MKGB 4XPCA 4TLRA 3GIKA 2R8GA 1JIHA 4Q0BB 3OSPA 2IM0A 1XR7A 5KFGA 4ZPAA 3S83A 3CVKA 2ILYA 3M9NB 4ZPBA 2FVCA 3CIZA 2VG5B 1RT1A 4NLXA 4QPXA 2XCAA 3SFGA 4ECUA 2IA6A 1JLGB 3CDWA 1JKHA 1S1TA 4DL5A 2XGPA 4URQU 4KO0A 2GIQA 2AX0A 2VG6B 4ES4A 5KFTA 3HVAA 4NLTA 3KLEA 4ZP8A 2JC0A 3LALA 4ED6A 1TVRB 3DLKA 5KFXA 5CYQB 5L1JA 3QGIA 3ISNC 3T5HA 3KOAA 4TQSA 1MU2A 3HKWA 4ZVFA 1LWEB 2QE5A 2BQRA 1RA7A 3CJ5A 3IS9A 4KFBB 4MH8A 4NCGA 4R5PA 1TV6A 3MR5A 5L1KA 3TLQA 3ITHA 3PHEA 1C1BA 1IKYB 4K4ZA 2ASLA 2OPPB 2YNIA 4KIEA 4Y2CA 1S1UA 4O3RA 2FVPA 3LP2B 4U6PA 3CJ4A 3FQKA 2BASA 3RB0A 2ASDA 3PFMA 1IKVB 5KG6A 2R2RA 3MEGA 3IGVA 4O44B 3G6XA 2UVUA 4Q8EA 2IBKA 4KFBA 4ZP7A 4R5PB 3M9MB 4DL2A 4KV8A 1LWCA 3MFHA 3V6JA 5KT2A 2W9CA 4FOKA 5L1LA 4HU4A 4KHMA 2HMIA 3HVTA 1FKPA 4NLDA 1N48A 5KFAA 3BQ0A 1JLGA 2IMWP 1BQNA 2E9TA 2W7OA 5KG5A 3KHRA 3MEDA 3CDEA 2IC3A 2YNHB 3MF5A 1DLOA 4ZVHA 5HROA 4IRKA 2C28A 3Q8SB 4ZPCA 2YNFB 3DLGA 3QYYA 4J9LA 3IN5A 1SH3A 1T94A 3HVTB 4O3NA 1N5YA 2HWHA 5F8GA 4Y2AA 5KT7A 4XPEA 2W9CB 5DQGA 5CYMA 4PUOA 2BQ3A 4QW8A 1QUVA 4EYHB 1TKZA 3IG1B 4R0EA 1FKOB 3TAMA 4IG0B 3KLHB 3KHLA 3MEGB 4O44A 4KAIA 3RB4A 2V4QA 1KLMB 2IM1A 2ATLA 3QO9A 1XR5A 4H54A 3D5MA 3DYAA 3OL8A 1C0UB 4KE5A 2XGQA 2DPJA 3DLEA 2VA3A 4MFBB 4IR9A 1W25A 2OPPA 4Q6JA 2OPRA 1RT7A 3FRZA 5F9LA 1IKYA 1S48A 3ITHB 4NLSA 4NLUA 5KT5A 5KFCA 4J9MA 4QWDA 4ZVEA 1RT3A 4WXWA 5EWGA 4ED7A 4YR0A 3MEEB 2ALZA 4ICLB 4H4OB 2OPQB 3PJXA 1TQLA 5KFKA 1ZTTA 1TVRA 3T1AA 5K14B 2WB4A 3H59A 3PW5A 4KO0B 4ID5A 3KMSA 3CDUA 4RW9A 2BRLA 2F8EX 2DPIA 4IRCA 2JEIA 1S9FA 4WYLA 2R8HA 4QW9A 1JLBB 4IH5A 4RW6A 5KFPA 3GQCA 2O5DA 1J5OB 3T5LA 2V4RA 2JLEA 4ZHRA 1VRTB 1HQUB 2D41A 4LYKA 5L9XA 2BE2B 3GIJA 1TKXB 4Y9OA 5J1EB 1QAIA 1RTDA 1HNVB 3GG1A 3QGHA 4IRDA 2RF2A 4LSNA 4Q8FA 1HPZA 3I0RA 2OPSA 3OLAA 3H5YA 1RTJA 1DTTA 4QWEA 3FFIA 2ILZA 3Q8RB 4WYWA 4H4MB 3SI8A 3MTKA 1GX5A 4TXSA 3ICLA 2XI3A 3PR4A 2I5JB 2W7PA 1ZTWA 3QGGA 5KFNA 4B3OB 1C0TB 3H4DA 3OL7A 5KG0A 3UQSA 3H5SA 3RBDA 4JV1A 4K4YA 3LP0B 4XO0A 2VA2A 3KK1B 4HU3A 2ZD1B 5KFRA 3JSMB 4F50A 4KKOA 3JYTA 2YKNA 1JLCB 3GFYA 1TKTB 3CJ2A 4WE1A 4ED2A 1QE1A 5C42B 1S0NA 2R6OA 1IKXB 4EO8A 3KHGA 2FJWA 4IH6A 4MIBA 5KT4A 1RTIA 4URGA 4NLQA 3M9OB 1S49A 3DDKA 2AGOA 2E9RX 3C6UB 4KB7A 5EWFA 4ECVA 2I1RA 2YKMA 1VRUB 1RYRA 1D1UA 3QLHA 3DRRB 4WFZA 4J40A 3NBPB 1LW2A 3DOKA 3I5BA 5I3UA 3GIIA 4ED1A 1WNEA 3PZPA 3DM2B 3DI6A 1YVFA 3BSNA 2YNGB 2AGPA 2R8JA 4J9KA 3DRSB 4WFXA 4I2QA 1TL1B 1RT6A 3D28A 5KFBA 3I5AA 1S1VA 4MKBA 5J2QA 1N6QA 3PVXA 2RKIB 4RNJA 2B6AA 4RW7B 1R0AB 5EDWA 5HBMB 5JUMA 1S6PA 5C24A 4QWCA 1EP4A 3I0SA 3MR2A 3V6KA 4ZPDA 5HLFB 2HNZA 1HYSA 1RT2B 1LWFA 2IAJA 2VG7B 2AGQA 4R8UB 4TYAA 5KFFA 2BR0A 2C2EA 4I7FB 5KFUA 4EO6A 4Y9MA 3OSNA 3BJYA 3DMJA 4DG1A 5DLGA 3E01B 4G1QB 3GILA 2RDJA 1FK9B 5KFLA 3OLBA 1C1CA 4NZ0A 5T14A 3KLGB 3BQ1A 1BQMA 4IFVA 1D0EA 3RB6A 4MIAA 2J6UA 3IRXA 3NL0A 3V6DB 4RZRA 4WXOA 4QWBA 4NYZA 4YR3A 3QZ8A 5I42A 2C2RA 4O3SA 2E9ZA 3DOLB 3CJ3A 2W9BB 1S1XA 3BR9A 4IG3B 3MECB 3G6YA 2B43A 1S9EA 3LANA 4RW8A 2V0NA 4Y34A 1S9GA 5KFEA 2AX1A 3CJ0A 4Y3CA 1S9GB 1U09A 2IJNA 1S9EB 3EZUA 3LAMA 3SFUA 3FSIA 2W8LA 3KK3B 5FDLB 1RT4B 5F9NA 3KJVB 5F8IA 3I5CA 5HP1B 2BQUA 5I42B 4FBTA 1JLFA 1LW0A 4O4GA 3N6MA 4EBDA 4ECTA 3HV8A 4IDKA 4X2BA 4K4SA 3IRXB 2FJVA 2XC9A 3H2LA 1T05A 4FS2A 2FVRA 3UR0A 2HNDB 1JLEB 4EBCA 4JV2A 1JLAA 5J2NB 3M8QA 1SV5A 4YQWA 1DTQB 4NLRA 1FK9A 3UPFA 5KFJA 3PR5B 1HNIA 5JXSA 4ED0A 3E01A 3G86A 4G1QA 5DGAA 1HQEB 3BQ2A 4LSLA 4LSLB 3BSCA 3H40A 3OL9A 3NMAA 1RTHB 4ECYA 3UDLA 1SH0A 3RBEA 2EC0A 5DQHA 5L1IA 1Z4UA 1RT2A 2WOMB 1S1WA 4G3IA 4TYBA 4ECXA 2HNZB 2BANA 1RDRA 1RT5A 3N6LA 2HNDA 5EWEA 1QAJA 1UWBB 5J2PA 1S6QB 2B6AB 2WTFA 4M94A 3GIMA 3VQSA 2WK4A 4NLGA 5D3GA 4OL8A 3GV8B 4LJ3A 3KJVA 1RT4A 5FDLA 2UVWA 3NAIA 1TL3A 3PW0A 4J9NA 2HAIA 5DG7A 4K4WA 3V81A 2R2SA 5KFMA 4WZMA 5C25A 5KT3A 5J2MB 3NKYA 3ISND 1S0MA 3RAQA 1JLQA 1S1XB 2W9BA 3KLFB 4PWDA 4DL3A 5KG2A 4RU9A 4RUAA 3C6TA 3DRPA 3LP1A 1VRUA 2YKMB 2WCXA 1I6JA 4Q44A 4RNOA 1ZETA 4F48A 4IFYB 2R2UA 4PQUB 2B5JB 4NLVA 1BQMB 4IFVB 4NLYA 2B5JA 2ZE2A 5KFSA 1QE1B 5C42A 1S97A 3MFIA 1TKTA 1JLCA 2IM2A 1REVB 4WE1B 3V4IA 3KHHA 2C22A 3JYTB 2FVQA 2OH2A 3JSMA 4PWDB 3KLFA 4I7FA 1JLQB 4J9PA 2WONA 4MKAA 3H4BA 1SUQB 4NLPA 4KBIA 5C25B 3QIPA 5KFVA 4NLWA 1NNDA 1S6PB 5C24B 1TL3B 1S0OA 1OS5A 3H5XA 1NHUA 3GFXA 3KLIA 1S1VB 5J2QB 2AWZA 1N6QB 3GYNA 4YP3A 3KLIB 1KHVA 1TL1A 4I2QB 3T5JA 3HVWA 2IJFA 2FVSA 3OHBA 1UWBA 5J2PB 4F4WA 2JEFA 3OL6A 1S10A 3H98A 4ECQA 1HNVA 2RDIA 3QIPB 5KT6A 5J1EA 1RTDB 1K1SA 1SUQA 3RAXA 2WONB 5KFOA 1RTHA 3GV5B 1RAJA 1RA6A 4RUCA 5KFHA 4M95A 4NRTA 1HQUA 1HQEA 2R8KA 4AFYA 3GFZA 1N56A 4Q43A 1REVA 3V4IB 3SY8A 1J5OA 2ZE2B 3BSAA 4RW6B 1SH2A 1JLEA 1IKXA 4JUZA 4PQUA 2UVVA 1T05B 4IFYA 2WHOA 5KG3A 3OHAA 3DRPB 3C6TB 3LP1B 2JEGA 3Q8PB 5HP1A 2CJQA 4J9QA 4Y9NA 4Y9PA 5KFYA 2XCPA 3KK1A 3KK3A 4ED8A 5J2MA 1JXLA 4Y8EA 3LP0A 1XR6A 5K14A 3V81B
chains in the Genus database with same CATH superfamily
1WEXA 2CZ4A 3P74A 4W90B 1YBAA 1UD3A 4Q7BA 5GJPA 4XX6A 4W85A 1X4HA 1OIFA 4YMZA 4HNUA 1IYXA 2WMFA 3W70A 4PSPA 1XQKA 1DTNA 1TMMA 2A7RA 3VAIA 1DOSA 3N5BA 4C8YA 3IGSA 2BGSA 2ODOA 3T1HF 2BE2A 3T5KA 2DNNA 3NEHA 2GV1A 3E0LA 3MD1A 3MHGA 4MJKA 3UD3P 4ED3A 4J9SA 1EUNA 4M63A 1VFMA 1XIGA 4HN4A 4CM0A 5MLCV 3SCPA 4C6JA 5A6AA 2C91A 4GYPC 1PIIA 4O1BA 5DLFA 4RW7A 3MPGA 4PG6A 2INFA 5LJ3Y 4XZLX 5CSYA 1LXJA 1TX2A 4YL2A 3RAMA 2NXGA 2GVGA 5A6BD 1D3HA 2H65B 3M5VA 2NQ5A 1TMLA 3K13A 3NSXA 5AFDA 1RAHB 3LSBA 3IGHX 2E29A 4FF5A 5CZJA 1UA0A 3Q58A 1N0VC 4ALZA 4XZMX 1XX1A 1GOMA 3KZSA 3A8KA 1JDEA 1S2WA 4DWIA 2GS8A 3ARSA 3THUA 1M68A 4AZ7A 1UG6A 4CD4A 1S6OA 2BHZA 2DJWA 3BS9A 3DDMA 6TAAA 3AOCA 4ZR8A 5EGRA 2VJVA 4AE5A 4K50A 4DLMA 2GFFA 1ZZMA 1N8WA 3HQOA 3KLEB 2UV8G 1Z6KA 1NMEB 2P0IA 4XZWA 2I5JA 3OVPA 3RRAA 4LU0A 1YZ7A 3MUZ1 4GZIA 2ZTJA 3FFIB 2ZH8A 3H8YA 4PE8A 4P7TA 1Y5IB 4TNOA 4UTKA 2V5BA 3WC0A 5HO4A 3W63A 1PAMA 4KV8B 1L6FA 2BFGA 2VFVA 4DX3A 3D0IE 3MA8A 2VOMA 3UVAA 1VRTA 1FHDA 3TUIC 1FWNA 3QV6A 4PBEA 1XK8A 2WSPA 4Y65A 3O2LA 4J3UA 1KA9F 5C9XA 3MZIA 2ZH1A 4F8RA 1S1UB 3T07A 3G8SA 4L73A 1Q6FA 1P9YA 1V0LA 1JDCA 4O3QA 4E8DA 1KTCA 3VABA 1N36J 4XD5A 1WKFA 2QGHA 4FOUA 2X1GA 1BPLB 5AHFA 3QGPA 1EZ2A 3EGZA 2CPDA 3KZPA 1EX8A 2XWYA 1X6NA 3EOLA 1J4EA 1WD6A 2XI2A 3D9BA 2NUWA 2V94A 4RZ4A 4Q4MA 5EMLA 4WZQA 1TTIA 2VC5A 5G1YA 4DWSC 4F3HA 2YWKA 1EDTA 4NEZA 3M30A 2YB4A 1XLKA 2RH3A 5JUVA 1P1MA 2BRKA 5CH7B 3WIJA 3VKDA 4AXNA 3T6JA 3OR2A 2PTDA 2C3MA 1PX4A 5T41A 3C52A 1XINA 4L3KA 4W92B 1WF0A 1NOFA 1RT1A 1S2CA 3GIQA 3U1MA 2QUTA 3NWGA 3LRMA 4YPJA 2NLWA 1ZU8A 5KFTA 4HACB 2VURA 2D73A 1RVKA 2ATMA 2BQRA 2VZVA 1K03A 4PG5A 4JI1F 2EEYA 4NXMJ 5G5IA 1RP9A 4AVOA 3DNCA 4ZCMA 1R31A 3HPZA 2UU9F 5EBUA 1E9YB 2VQUA 1HBUA 1FDJA 1XKYA 2LECA 4JB8B 4MPQA 5IQQA 1OX5A 2XVGA 2P1FA 2GAHC 5HDRA 1XBVA 4CQCA 2Q6CA 2IVMA 2PIIA 5D2WA 3MFHA 1HBMB 3HVTA 1WYIA 5BYWA 3QV9A 1PTAA 1T7PA 4DPWA 3OTRA 1HL6A 2PA3A 3JB9k 2OU4A 4KQNA 2CLMA 2W7OA 3H22A 3K5NA 3PHAA 1UWSA 4P8VA 5LMUJ 3Q8SB 4MTVA 4GIEA 2YNFB 4N02A 3UA3A 2FPVA 4CKQA 4O3NA 7FDRA 1N5YA 2WMIB 5AY7A 1JIBA 2RSQA 4E2FB 3V0UA 4JZ5A 2K7JA 2PLMA 2O9PA 3NMRA 5FJTA 3RB4A 3TR2A 4ILRA 3G82A 1XR5A 4WY0A 3DYAA 2Q43A 4MFBB 3BC9A 1EHAA 4RPFA 4ONVA 1VRDA 3DFYA 5DM7Q 4WFBQ 3LBCA 1W1ZA 4NLSA 2IQ0A 5K7JA 4J9MA 4GO5X 2GWNA 1HJSA 1FHLA 4HHMA 3ME3A 2VZSA 5E9XA 2D2GA 1LQAA 4ZVQB 4P2SA 5LSLA 2HZGA 3LU2A 4ID5A 3IBFB 4R33A 3WSUA 3I9V9 1Y9OA 3MMBA 2F4FA 4WYLA 5D77A 3SDEB 3TJ9A 1KWGA 4OHYA 2PI6A 1U2YA 1H50A 4DAIA 3R2DJ 3QTGA 3WY1A 5JVGQ 1BTCA 3J7YU 4FNPA 3APTA 2PDQA 1TYGA 1TG7A 1UR1A 4IRDA 1LCOA 3GG1A 2J8AA 4F2TA 5HJLA 3I0RA 2OJ3A 3JU2A 4X2PA 4B3SJ 1KGWA 1X97A 4Z0JA 2V82A 2GAGC 4FNTA 1Q2RA 2DUXA 4I3GA 3N2BA 1TPFA 4JKKA 3WLRA 4GUHA 3KNGA 1VFTA 2E40A 4UQ9A 2OZTA 4XO0A 3CHEA 4HMNA 2CJ9A 2K8GA 3OA5A 3IK4A 3TA1A 1DJYA 4UOFA 3N4EA 1MXSA 1TKTB 2CPZA 3CK5A 1V5VA 3HP6A 1IKXB 5E3QA 1S6UA 5DEZA 3C16A 3TTSA 2P8IA 2O9RA 2Y8UA 3R25A 3P2VA 2NV2A 3R97A 2Q79A 3DOKA 1WNEA 3WO8A 5A6LA 3DM2B 2VF3A 4JI3F 1GCYA 3N18A 2B8PA 3X1LB 2RKXA 4I2QA 1H3GA 1VC5A 1RT6A 5A95A 1S1VA 5J2QA 3AXIA 2RRBA 3H20A 2DH7A 1FE4A 4PN2A 3N04A 3WFZA 3EMZA 4PODA 3T2PA 1TPC1 1LORA 3C2PA 3VFLA 4B3LA 2X51A 3AD8C 4ZJOA 2C3UA 3LF0A 1SB6A 3BGOP 3GXMA 5DLGA 3GAKA 1KWKA 2YH0A 4EPEC 1YRUA 1T8XA 5FOOA 1PHQA 2KFYA 4PG4A 3ENVA 3WJYA 4ANEA 5HMZA 4UNIA 2XJ7A 5IT9Y 1X38A 3MUY1 2E9ZA 4J2MA 4JCLA 1SZFA 3ENAA 1N33F 1S9EA 1XIDA 2Q6ZA 2OQYA 4Y34A 3R2GA 1EIBA 1PVNA 4RO0A 3UYCA 4IYQA 4AZBA 4CO2A 1U09A 2BZ2A 3V1PA 1BVZA 3OIHA 4Y2WA 4I4BA 3B0UX 2VX4A 5AB3A 1LW0A 4OI6A 2DJLA 3FRYA 2VEGA 5BCAA 5ITHA 1CENA 1OZMA 2PDGA 1FJ7A 3GKFA 5AVNA 3W23A 2PI5A 2PSNA 1SV5A 3R7BB 1LQ9A 1JRBA 3UWUA 5A8PA 3GVWA 4OZOA 2KG0A 2ZBCA 3PZNA 3TYTA 2VR2A 1EP2A 1RT5A 1QAJA 3KTQA 3ZZUA 3P6LA 5AYIA 1WEYA 2WTFA 3MCOA 2VFRA 3PRDA 1UQYA 2ACRA 2QW5A 4IL0A 3VQSA 4GPNA 1TUVA 3IS4A 3EDQB 2R14A 1ZQ5A 2DNLA 4HZMA 1RT4A 3S1VA 3AFGA 1KBLA 2DSWA 5LL6d 5CD4H 5XIAA 4QJVA 1VQ6S 3DDNA 2ZBQA 4Y8FA 3SRFA 4A8KA 4XTTA 3KLFB 3CO8A 4H8VA 4RUAA 1JJCB 3SCNA 2E9LA 1ICPA 4LF7J 1HR0F 1ZENA 1BGAA 1X0PA 4OV4A 2LU2A 3MKVA 1RBAA 2HLUA 4YHHF 2IM2A 5BYQA 1UP3A 2C22A 3VKCA 2CLHA 3I87A 4J9PA 4YS2A 3PRBA 2XO6A 3H4BA 1H3DA 1VH7A 1LFWA 4ZMGA 1GVRA 3G1HA 1NNDA 1FRBA 3RJYA 2HXTA 2IBOA 4JL2A 2AWZA 1WTBA 1LRTA 4YP3A 4LR7A 1Q16B 2YCKX 3SEOA 1X5PA 2BJ7A 3P5ZA 3FDKA 2NVCA 3I4EA 5IT4A 1GJUA 2FVSA 3G9CA 4B9LA 4F4WA 1OC6A 1HF6A 3ES7A 2XN1A 2POZA 5C70A 4HNTA 1QLNA 2DR7A 1NM9A 5IM0B 1WDQA 3WD4A 3I65A 1FCUA 4G7EA 1JLEA 2N4CA 1CEZA 3NG3A 3OHAA 4QROA 3B9EA 4C8MA 1HJXA 3DC8A 3S6OA 3AISA 4RPPA 3OR1A 3LP0A 3OPSA 4LRDA 2MLXA 3ISZA 3S3GA 4TU1A 4EXAA 3UN3A 3CIXA 3S4TA 3VAVA 3VVUA 4LF4J 1G3OA 3KUGA 3VF0B 4B91A 4DM2A 1HWKA 4BI6A 4BY3A 1ZGDA 2MLYA 2ZXQA 3B8DA 3GW0A 1T5AA 3GSIA 2GJXA 4F4YA 3R5BA 3NR0A 1ZOTA 3SURA 3CT9A 4ERGA 4ALDA 3QM3A 1HNYA 1F2HA 2G41A 4LFYA 2WV8A 3KJFB 1REQB 1W3LA 3OGRA 1DLOB 1VS3A 1W3NA 3CPUA 1IM4A 1YBQB 3GVQA 1EGMA 3UU0A 2GC8A 2F8MA 3OTDA 1B4EA 4X4TA 3ABZA 4PTNA 1K9MT 1FWJC 2QDEA 2XIQA 2VFSA 1ICEB 4F7VA 2MQMA 1NK6A 4O50A 2VC1A 1I9CB 1YW1A 5LIWX 2WZ1A 1UVIA 1OK6A 4NCAA 5DZ6A 1X98A 1FJEB 3SCLE 4LS0A 1WJ9A 5A2QY 3R1HA 1A3HA 2CLIA 3BCDA 2ZD1A 1NWTA 3BAJA 1QOPA 4HHPA 5F1VA 2Q8LA 3TZWA 3MUMP 3QNWB 3ANUA 3W5YA 4PUOB 3C0LA 3SV3A 4O4RA 3GKAA 4LVAA 2ISVA 2ZH6A 3URNA 1EFZA 4EVZA 3BAYA 5A8NA 2DZWA 4ZENA 2JBMA 4DFMA 4JX5A 3FCWA 3HFZB 2DFAA 1JCLA 3T2OA 2J0WA 4V2XA 1YX1A 4LBUA 4JTHA 2DSKA 1AQMA 3KWMA 2J25A 3VMPA 3VIKA 1CJVA 5A5WA 1DQ8A 1O51A 3S8HA 4X9SA 2NXHA 4MK8A 3N6JA 3KG4A 1UH3A 4HN8A 4RW4B 2UVRA 3WF3A 5ECVA 3EX2A 4K59A 1UOKA 3I7QA 1F3XA 2DH9A 4FF2A 1BEUA 1X0FA 4OHVA 3CCSS 4BR1A 1OY9A 4LFAJ 1YDVA 5DG8A 1Q5YA 3RB3A 1S1TB 1DPMA 3LQLA 5K9CA 2AZ3A 3WYZA 1RT3B 3H24A 3NGRA 4WRHA 4BQ3A 3CJQA 4RV3A 2WC3A 1WB0A 3HPXA 1OGSA 3WG6A 2QUMA 3PW2A 2C0HA 3CUHA 2XB2D 3W75A 1R8PA 3VIGA 4Q5VA 2VD3A 1AZ2A 2HG4A 4C8KA 1K0TA 3KOFA 3T09A 2V30A 2QCEA 4JN6A 4E2VA 2NXIA 1KFLA 3G77A 3ITOA 4MJZA 4CLFA 2IM3A 4CNSA 2QMXA 1B4KA 2GCFA 4NL1A 4PH6A 1TPWA 1VLWA 3V0SA 3M64A 2ABBA 3NGKA 4CCEA 2ILYA 3BLPX 3NPUA 3M9NB 3VU2A 4C6CA 5JJBA 4A8RA 2FVCA 4C0OC 1S46A 2NLYA 1EJWC 1HG3A 4GY1A 1JLGB 1U02A 1Q2SA 3POHA 3ZOAA 3A47A 4YTQA 2N3LA 2HFSA 5KFXA 3AICA 2BM1A 2KI2A 5CPNA 4E38A 3M8RA 1E40A 1WZAA 2HVIA 2CPJA 3LLXA 5SZTA 4MB1A 4CU8A 2XFWA 4PUDA 4E8CA 3WQPA 1BKSA 1GNKA 4KKXA 1H0IA 4JTJA 4LF5J 5FL1A 3BSMA 3CJ4A 2TODA 3EDJA 5D03A 1HJUA 3CLWA 2VOTA 1UP1A 3AROA 3K2GA 1TFVA 3J81j 4IUGA 2HMIA 4KHMA 5CC6A 4C5ZA 1PWMA 3F5KA 1ISVA 3GXPA 4USTA 3Q94A 2I5QA 2CYYA 2DRAA 3LGGA 3RXZA 1BQNA 3B8VA 1KGUA 1CXFA 3T9ZA 4DXKA 4AT1B 2GOKA 4ZVHA 1GPFA 3CO0P 1EBGA 3N73A 4ZQNA 1WDTA 1MN7A 2EG2A 4NQ1A 2CPUA 3NDOA 4FEZA 1K73T 4YU1A 5CC3A 3ECQA 3ZVHA 4TTGA 4IIFA 3EA2A 3BCFA 1X8DA 4A8NA 4USVA 3BBBA 1Q81T 2IM1A 3IA0A 2LXIA 4ACZB 1C0UB 4PC8A 2HGMA 5GAGU 1TL5A 2OPPA 2REQB 3ITHB 1QNOA 4QHRA 5KT5A 3GNXA 3HHLA 1B57A 1S2AA 1NSJA 2EPMX 2ALZA 5KFKA 1TZ7A 4JI8F 1ENUA 1BYAA 4FYXB 3PIPQ 3H2AA 3W37A 2PLKA 4JD4A 4PTVA 3QW4B 3WEZA 3BV4A 4RBUA 4FX7A 3QR1A 4P52A 2ZNZA 3N0VA 1YTKA 2YKAA 4XAPA 4OI1A 4YCOA 2D41A 1M41A 1Q8IA 5JMNA 3G6MA 3DN5A 3MM9B 4Y9OA 3N9UC 3S2CA 4U7UK 2Y0SD 4N9DA 4IISA 1GHSA 3GIRA 5FI8A 3OLAA 4PG8A 1RTJA 2ZXAA 5IC4B 4BJHA 1KOOA 4XUYA 3LZ3A 1HWIA 1DHKA 4LBPA 1VC4A 4KBXA 1SC4B 1TL7B 5E6YA 1W2BR 3IWXA 1XIMA 3V2UC 4DV7F 4L75A 4FDFA 2XTKA 4ZLJA 3WNPA 4QBXA 1IXNA 1PJ6A 3HD2A 4UOJA 3LY0A 4PRRA 1YLVA 4GYJA 5LIYX 4KHPF 5BXRA 2CAJA 1T8EA 1JD9A 1CZ1A 3S6TA 1U5HA 2CESA 1S7IA 4MIBA 4TIMA 1OYCA 2E9RX 1P48A 1MEIA 1JEZA 5ETVA 3U57A 3QLHA 3NOEA 2NW0A 2M8DB 2UUAJ 2NXCA 3CJPA 3LM3A 3OZYA 1XIBA 4H00A 1YVFA 3L4YA 5A6PA 3T1YF 4NXNJ 3UXIA 4XWUA 1UPMB 1OC7A 1F05A 3L9ZA 1Q1KA 3PC0A 5DF0A 3M0YA 3BOLA 4AL5A 4YNGA 3OUYB 1H51A 4ZPDA 4O1CA 4AWSA 4GX8A 4JYDA 3ELHA 3NQ7A 1YJRA 3WK1A 2YWGA 3B4MA 3FSXA 1U1UA 4NAFB 3AHTA 2MZ1A 1MNSA 1SW3A 2F9JA 2KX9A 5AC6A 3VWSA 1DWIM 2K3IA 5T14A 1JCNA 1XJBA 6PTDA 4EFAC 2MQ8A 1XMOJ 4MIAA 3AJXA 2CWXA 1HNZJ 3B04A 2F1FA 2Z1BA 4UQDA 3MTWA 4CLPA 1R46A 1FI4A 1T3OA 1X1ZA 2R82A 2FZ9A 2DR6A 3CAWA 3GR7A 2QDGA 5ECUA 1RGVA 4DBQA 1RJQA 3WH7A 3N2CA 1TIMA 4AHPA 4K5RA 1D3CA 2UXBF 3VGSA 2RH9A 5GNYA 4DVOA 3I5CA 2J77A 4ZODA 1PV8A 1U6BA 3O6CA 3H7VA 4U3AA 1GVQA 4K2SA 3E49A 1TSIA 5CH9A 3ZXWA 4MOZA 2K1RB 2U1AA 1XD0A 1PKYA 4FP9A 2HNHA 4P72A 4FSAA 2I9EA 4WDTA 4TVAB 1CB7B 3RBEA 2CNKB 5DQHA 2VP8A 1FTRA 4AISA 5FKYA 1DWGM 2XTJP 5HULA 2AQVA 3P61A 4DV1J 3P5YA 4JAWA 4M1BA 3FKKA 1B3ZA 1EAYC 3KOZA 4KEZA 3O05A 3I96A 3REQB 2HAIA 4M0XA 5IHRA 1KSPA 3GYCA 3EX4A 4JTSA 1NDPA 3W73A 1X4AA 4FXSA 1IXPA 2MXYA 2Z28A 1RAIB 4G2DA 3RR1A 4P7VA 3UVIA 2B7NA 4L61A 4ENLA 3CHCA 5F4XA 4IFYB 1NAL1 5LNWA 2QCLA 4XIUA 1GQJA 2XWEA 3NO1A 1NIUA 3C19A 2OMLA 5HSPA 4PL1A 5I77A 3FSYA 4DR6J 1G01A 1FE0A 2QJHA 4PXDA 4WJ8A 5EX3A 1IEXA 1DIDA 5L38A 2NSXA 4WGHA 1Q5VA 2AZ1A 3CL8A 3H6OA 2QLFB 2RHSB 1QI5A 2ZVRA 2DGWA 4DQQA 3SCOA 2WVFA 5D2VA 1XSIA 4X60A 3QHMA 3WQ8A 3QIPB 5EMYA 3MANA 2PD9A 3IIPA 3PYGA 2GQCA 1RTHA 2H9AA 1V6WA 1UJPA 3QT8A 1WV2A 2CKSA 1NELA 3ENLA 4GIAA 6AT1B 4Q43A 3LMYA 3SY8A 2E1PA 1X1NA 2PDWA 4KGLA 3V5FA 1KRPA 1AJ0A 2CVEA 4LYQA 1JZ3A 5JIWA 5KG3A 3CMAS 3D46A 3TA2A 5D15A 3AHXA 2JEGA 2CC0A 2ZZTA 4J3XA 3KVJA 3SUUA 4ED8A 2IRXA 1JXLA 3FAWA 4C1NB 2YZRA 4J3WA 2WKGA 3K58A 1WX0A 4LBHA 4LQ9A 3K5LA 3PJTA 3OJSA 3IVTA 1NDKA 3B4UA 5DQIA 3PZQA 1UH2A 3G2GA 2GO8A 1SKUB 1EO7A 4J4KA 1QCWA 1S1WB 2H3DA 4WLCA 3V5CA 1XI3A 3LHTA 2LQ8A 4U7CA 1MW1A 1F9CA 1I5OB 1W9XA 1YBTA 3FDSA 4FPSA 4KQZA 1UW9A 3B4DA 1EP4B 4C8OA 4DXLA 2KVIA 5HQMA 3LHZA 2WVUA 3QJLA 4JICA 3BGAA 1KD0A 4HU8A 2BZNA 1F3TA 5GJMA 4D6GA 2MZJA 3IRDA 2QCFA 2E7XA 2DP3A 3WBAA 4DR1J 2OELA 2MKYA 3V4BA 2W2MP 4C8ZA 1EDGA 4QIUA 4TVUA 1Q8BA 2FZNA 1GVOA 4NI3A 3W29A 4ZXOA 1QY7A 4Q33A 3HJFA 2B7PA 2ZRVA 3IEBA 1FF2A 5I3KA 1DJ0A 4IG2B 3Q23A 2X1AA 2J7DA 3JVAA 3RUBL 3WK2A 4DXVA 4J3TA 4HA0A 5HJYA 1ISXA 2QX0A 1CJKA 1YNPA 3BB5A 4JIPA 4QR6A 3UERA 3FNNA 2ZDSA 2CZVA 1KBJA 1W3IA 4DQWA 5I09A 3EYPA 3QPYA 4D8AA 1H72C 2E8ZA 1KTVA 3CSKA 3T8QA 1Y65A 4ZVTB 1RHQB 3R5JB 2BJ3A 2ABAA 1ICSA 4PPDA 2OMAA 4ZITA 1VQTA 4J7CA 3S0CA 3FZ2A 2BKNA 4MM1A 2IW0A 2KYZA 1AK5A 1XDMA 4K2JA 1LFPA 2FY1A 1UFLA 5T7LB 4HPNA 2E7WA 1R8LA 2IDEA 2R8IA 3VIMA 2VICA 2V34A 1LG2A 2NLIA 3R12A 2H1YA 3BG9A 2QRRA 1UD2A 2YFNA 4EGLA 1FWGC 1H38A 1IWAA 1W3TA 2DGXA 4X61A 2ZKUA 2XYHB 2YL9A 3SQSA 1RAEB 2FGZA 5TBOA 3SECA 3BSGA 2EJ1A 3R2CJ 2VG6A 4JTFA 3SIPB 4UFMA 4ZP6A 3DG7A 1PAEX 5KMYA 2NUHA 3C2VA 4DBEA 3ZLFA 3L3CA 3WLMA 3VC5A 5I00A 1TR1A 5FEZA 3NJ3A 3GVRA 1AQ0A 1W1A1 2WSRA 4AY7A 3IUDA 3CD5A 3UWQA 2C2DA 2NUXA 3NWRA 2VL1A 3R3TA 5BMXA 1XLHA 5LJ5Y 1UR2A 3KTCA 3KP1A 1SW7A 4WJXA 2BM0A 4HA1A 2ZHAA 3L4VA 4A8LA 4I1TA 4B9UA 1TO3A 4UZUA 4Y6GA 3N29A 1FFRA 3S83A 3W64A 3KBMA 1RWOB 1GXUA 1R86A 3FJ4A 1NO8A 4AC1X 1CEOA 5ABTA 4AD3A 2ZX6A 3WLPA 3TJ4A 2ZWOA 1OGGA 3ISNC 3T2QA 3GR0A 1AFJA 5C2CA 1TV6A 2POKA 3D68A 5G1MA 4K4ZA 2QQ6A 4NYUA 2PC4A 1N34F 1NKBA 3TR9A 3L66A 3F4NA 1ME7A 1TIWA 2PTYA 5TIMA 2AJ0A 5JIPA 3AQPA 2R2RA 2SFPA 4DL2A 4R34A 4ZVSB 1W9VA 5L1LA 1UA3A 4MAVA 4HU4A 1E6YB 4MF4A 1FDYA 2LDIA 1IR0A 1IBLF 1RHUB 4J28A 2Y7GA 2KZZA 5KG5A 1LYXA 2DGSA 5BRPA 5IDZA 5HJXA 3W7LA 1H7NA 3JXOA 4DJFD 3TOYA 4C5YA 4EKJA 2G4JA 2W9CB 4UTGA 1RKIA 4I8DA 3GIPA 4DJED 3VALA 4IOAQ 3GSMA 2WSQA 3GXDA 1WPCA 1OFOA 4QNWA 5C7PA 1XMBA 1SFTA 4UB9A 1RAFB 4L9ZA 3QC3A 4WCEQ 4F66A 1RT7A 1S48A 3SUTA 3LLFA 1VC0A 1WXZA 2ZXDA 1N55A 4M80A 1K8YA 2F6UA 3UWEA 4WXWA 3AA8A 3PSWA 1RHKB 5LT5A 3UETA 5K9XA 3EWZA 4P7OA 3H59A 1AUSL 2OD6A 4S3FA 3DFHA 1X39A 3KMSA 4DV6F 2VUNA 3I32A 5AYZA 2HRUA 4DN1A 2BRLA 2DPIA 3TYDA 3I7SA 2ZZ4A 1R27B 1R89A 4FPIA 1SJCA 1NH6A 4QR1A 2MSSA 3ZWSA 4FLQA 3ZZTA 2J9ZA 5IC6B 3QBCA 2QLBB 3T5LA 5THWA 2J7HA 2UXCF 4BC9A 4FXRA 3EEZA 3TP2A 2C2MB 1L6GA 4H6KA 2HCVA 3C8FA 3TTOA 2NYHA 3ES8A 3ONBA 3HA1A 2QV4A 3K5OA 4BQ5A 1XYLA 2KL8A 4F8XA 2W5FA 2IUZA 4TXSA 5CAHA 3WDHA 5G4HC 1U0HB 2ZM6J 1RU1A 4HYVA 3MD3A 1RY8A 1I2RA 4K4YA 3TLLA 4AQYF 4CZCA 2WBGA 2VA2A 2WAGA 3GS6A 2OT1A 4XBJA 3NCPA 4MB3A 4AYSA 4F50A 2YKNA 1TZ0A 4IG2A 3BE7A 2ZRUA 1DJIA 4HNNA 4DUYF 3W1NA 3CJSA 4D3GA 3GK0A 3VVTA 5L46A 4J40A 1MW3A 1A5KC 1MW2A 3HXMA 4UQEA 3NAVA 3A4AA 4E6MA 2WXDM 2DB1A 3UCQA 1GOOA 3RFAA 2CPIA 1R7OA 1BGXT 4WFXA 2PB1A 3VGDA 2PT0A 8CGTA 1B30A 4BA0A 2IVFB 3CU2A 2V3GA 4MZ1A 1S6PA 3RK8A 1EP4A 1CGUA 5HLFB 4KGJA 1ZA1B 5I0DA 4LMZA 4ZVUB 4JBCA 4QU6A 1F6KA 3W2MA 1D2KA 4RR4A 2QIFA 3M2UA 2GZOA 1ML1A 4ADUA 2NZCA 4G7FA 2HJPA 3NO5A 2YKPA 1IQZA 1WDDA 1IN0A 4UFIA 3T6CA 4DR2F 1S1XA 4ELTA 4WKFA 3G6YA 4DR4J 3G1XA 3MC5A 3MI6A 3QJJA 1XEZA 2GMHA 3CJ0A 4MIMA 4MKYA 4WTOB 1LBFA 4EI2A 4QDMA 2OWWA 1DTUA 2G97A 2CLFA 1WACA 2V8HA 3BZJA 4X2BA 2PD1A 3BPDA 2WVVB 5H9EK 2Z6IA 1AD1A 2ZUSA 3AO0A 2HNDB 4GG9A 1ZJHA 4O1FA 4XIAA 3Q2SC 3E96A 4Q2MA 2UY4A 4LSLB 2CUYA 3WUGA 3HZ3A 1RTHB 3EB2A 4WGXA 1KC7A 5IDIA 4D1JA 4FLSA 3N6LA 1A0DA 4UY8T 4IIDA 4CCCA 4IMCA 1VK8A 4MKVA 3T1GA 3AWNA 2RS8A 5DN1A 5D3GA 2DUAA 5DLCA 3C8YA 3EGJA 1YXCA 1GNXA 2CFFA 2J0XA 3OQ2A 3RGIA 5BJRA 4DF0A 4J9NA 2EQDA 4K4WA 1K9TA 3CASA 1JYXA 1D9AA 1UKTA 4TVCA 2Y5JA 2W9BA 5G2HA 4UTWC 1EIYB 1B3XA 1QHZA 4QQ3A 2ZZ6A 3WEMA 3K1GA 1NSQA 2V5DA 3UNDA 4KGVB 5KFSA 1QE1B 2J8FA 5TF0A 1CXHA 3KHHA 2OQLA 4Z2XA 1XLLA 2WVDA 1JXKA 1OEPA 4W98A 4LBSA 3Q22A 2XMJA 4UTUA 3PJ9A 1TZ9A 3T1HJ 3VV2B 2ESCA 2ZTKA 1QXLA 3L4TA 1WTFA 2CLKA 1LEOA 3REQA 1MUCA 4WCJA 3DXSX 3H5XA 1RZMA 3TN4A 1CULA 4D1IA 1TL1A 2GX8A 4GXPA 3TXVA 5KAKA 3F5LA 4QTGA 4ZXLA 4Q3MA 5KTLA 2FB2A 4Z0SA 3H98A 1HNVA 1TE1A 3QY7A 3EKZA 5CABA 4OECA 1TRIA 5CSSA 2FKPA 1RA6A 1TAQA 4QPTA 5KFHA 3NQBA 2QA4S 4ERDA 2XMUA 2DR8A 2ZE2B 2PDCA 3VR1A 1WC0A 2RDDA 4YFUA 1C8XA 1RJRA 4FLRA 4OWGA 3HQ1A 2HRYA 4QLLA 5U47A 1QUMA 2NUUG 3Q8PB 2JEPA 5E93A 3PM6A 4DJFC 2MB0B 1APSA 3VKJA 3C5QA 2ZIDA 5M2FX 4M6VA 4BKNA 1OO0B 3W2WB 1X60A 1DQUA 5G4DA 1XWLA 3BW3A 4KHPJ 1HPZB 2UUWA 2Z2AA 3R6LB 5C8BB 1CG2A 4AMAA 1JXEA 2HWTA 2ZA1A 4DYKA 4NAFA 3DU5A 4MWAD 5L6UA 3VDCA 3K4WA 2J24A 1GK8A 1GX6A 3EMCA 4DR2J 1UPPA 3PPCA 2GUUA 3F2BA 1IGWA 4L72B 4K7YA 2M70A 3MW7A 3OUYA 1FWBC 2TPSA 3LNPA 1MWOA 2IC3B 1BF2A 4NX0A 2OPJA 5JXQA 1ACMB 4LF4F 6TIMA 5B7WA 4FNQA 4WSHA 3N19B 4HK6A 4X4SA 1SFLA 4L6OA 3HQNA 4PUMA 4LV4A 1YGYA 4PRFA 1LWCB 2FLLA 1ZH5A 1FJGJ 1R3SA 2AOSA 2HS6A 3VAGA 5HN0A 1UKUA 1IV8A 2GQ2A 3QIDA 2X30A 1HQ2A 4N2YA 4CLWA 3DKDA 1E72M 2XFFA 4DJBA 2NSCA 3WBYA 5B0BA 1R3YA 4CLSA 3WQVA 4JTCA 2G50A 2BXJA 3QC0A 3VOIA 3HG3A 2LVWA 2QS8A 3S1XA 3M1VB 1MROB 5B0DA 2XM2A 1M04A 2CZEA 1KXVA 2RKIA 2ZH3A 3EOOA 3AIBA 2Z1VA 3DU0A 4KT2A 4BK9A 4ECWA 1KONA 2MKSA 5J04A 3AIEA 3L68A 3TDFA 1OPZA 3LQVA 3O15A 3D7SB 4CVUA 5C5JA 2JEJA 3ZZ1A 3M8SA 4KWUA 2VEKA 5I2UA 2V9WA 3P5TL 4PUKA 3DFOA 1WC4A 1Q8AA 2PMHA 4NZ6A 2DH2A 1XRVA 4PTMA 1PTGA 4JFWA 3EVMA 4IQMA 4YHHJ 3M8PA 6XIMA 1U49A 2AMGA 4LTSA 2FVKA 2KKHA 1PO6A 4HZ7A 4PCTA 1E0WA 1K77A 3OZMA 5U4NA 2O92A 3PEJA 3TP4A 1LWEA 4LPCA 2I17A 4ZSUA 4ZOCA 3WHIA 2CHNA 2XLJA 3P62A 3CQIA 1JKHB 1EUAA 1EGVA 2HHSA 3N15A 4IPLA 5KFQA 4IOBA 4NY2A 3LXAA 5LNVA 1KR1A 2N4DA 3OW2R 4E0DA 1KCZA 1S59A 4ACZA 3CPWR 2OODA 1FJGF 2V67A 2EPIA 2OGJA 1WORA 1PB0A 3HGSA 3M0XA 4URIA 4G6CA 2EHHA 4XKMA 1R8CA 1ITUA 4TLQA 3GQYA 1SPBP 2XO7A 4TLRA 3MMUA 4Q0BB 2XNQA 2YH1A 3B40A 1P6WA 1XV8A 1VENA 2CJXB 4L4MA 2FTWA 2D3O1 2UY5A 2V81A 5CZKA 4DCJB 1WKDA 4DBSA 5GMEA 3AYVA 1Q3NA 1UUMA 1IHIA 4K3ZA 1GWJA 1XRSA 3PN8A 3KRUA 1P1TA 1RADB 1T9XA 1Z9AA 4B9ZA 2D9OA 2Z2UA 4F0MA 5EHHA 3WLKX 2PWVA 3M4HA 2HK2A 1XYMA 3LHYA 4CYUB 1IBLJ 4PPZA 2P2CB 1RB0A 4LC8A 4LFBF 1WI8A 1ICQA 1KRMA 4B08A 4RJEA 1ECQA 2VX7A 4E2DA 2VZ9A 1Y10A 4HMEA 3UPBA 1QHPA 3LERA 3PZUA 4MG4A 4IMDA 3M0JA 2PGWA 4K68A 1M5PC 5F0WA 1JLGA 2CXGA 3VNZA 1WOAA 1KQYA 2DXDA 2J0SD 3UCGA 7TIMA 4HK5A 4ZPCA 1OYEA 4DFPA 4BEUA 2G8ZA 2WZTA 3EB3A 5HMSA 5E6ZA 2B0MA 4N5SA 4KW2A 1FWKA 3R9LA 3L5MA 5B09A 3RJMB 3FZBA 2UP1A 4FXJA 1MXDA 4CGTA 1VBZA 2VKZG 3SBMA 1TCDA 2PRLA 2OPRA 3FKBA 2OO0A 1RA0A 2ZOGA 2IKIA 1RT3A 2PWFA 3FVDA 4MT1A 3AYTA 1TVRA 2MY8A 3T1AA 2V3DA 2W2NP 1SSDA 3IWNC 3THCA 1TPH1 1W5NA 2WBMA 1XFBA 2JEIA 4MJMA 2AL2A 5HXMA 2R8HA 1OHLA 3HU7A 2VOPA 1W1VA 3BOFA 4K6AA 5DO8A 3WMBA 2FPHX 2FLIA 1KCLA 4YTUA 1Y4ZB 5IM51 2HK1A 4LXFA 4IFRA 4PEOA 1RTDA 1XICA 4LSNA 3W1RA 3U1LA 3L67A 2UV8A 5M03A 2ILZA 1I6NA 1XCXA 3TW6A 4GKJJ 2CPYA 1C0TB 1V0KA 1U6FA 2NX9A 2B4GA 3ZZRA 3AXXA 4QG6A 3JSRA 5KG0A 4NXNF 1PCAA 1AUDA 4NRRA 3M6WA 2B7QA 2VZUA 1V0NA 4DI9A 2UUAF 2CLEA 2ZD1B 3C2FA 1GOWA 4C65A 3GFYA 1TA3B 4G5DA 3QT7A 1QSLA 3BH6B 2DXFA 2VTFA 2DZVA 4EAYA 4IH6A 3GZAA 5LNSA 4C0HA 4URGA 2VPZB 6A3HA 3TAKA 4DY1A 4NZFA 5SUHA 3WDRA 1IBCB 3B8HA 1D1UA 4NWBA 3F73A 2W67A 1M1GA 3AZTA 3PX4A 1A5AA 1IR2A 1XL9A 4TR9A 4OHZA 4DO4A 2YNGB 2YXXA 4J9KA 3NQ6A 4DPXA 3CMQA 4C60A 3S1WA 3ZNUA 3NZ1A 1XH0A 1VBYA 1Y5XA 1REQA 1CGVA 1U1JA 3V6KA 1H6KX 1XGEA 4FYVB 1IWGA 2YZ5A 2CBUA 3A8EA 1BXNA 2IAJA 3AXHA 2AGQA 1O4UA 4CO5A 3SFKA 3W9HA 1LRNA 1BWLA 5KFLA 2RS2A 1S72S 1YJNS 5K5MA 1F74A 3M05A 1UKPA 4OZ0A 2HV5A 2D3LA 4ZVOB 2J6UA 1XYZA 4B15A 2HPUA 4O3SA 2F8HA 4ZZ9A 2DT0A 3URBA 1T95A 3W07A 5B0GA 4ES2A 1K7EA 5IZHA 1YRTA 2V4JA 5AXMA 3ATYA 4B2DA 3GM8A 1Q6EA 3W5ZA 4JTIA 5FDLB 3KJVB 3MCNA 3CV7A 1FVSA 5J8LA 1EGZA 3BZQA 4LF7F 3N6MA 2D69A 4IDKA 4KF1A 4OV9A 2F38A 1XIEA 3H2LA 2OZ0A 4OHWA 3MBFA 3LI0A 1JLEB 2Y1LB 2NXNA 3IV3A 4ZOSA 2F3JA 5I3GA 4QZVB 3UPFA 4NASA 3TJLA 5AYBA 3E01A 3H7HB 1W9PA 3CJTA 1BQXA 3I6PA 4ECYA 2JF6A 1I1GA 2VQEJ 2XUCA 3M44A 1MN9A 1QK0A 1SO3A 3E2SA 4M5HA 4W5UA 3DAQA 5ETOA 3BYPA 1MNZA 1MNEA 4IGMA 1RR2A 4CH0S 1HI0P 2PDHA 1WKKA 3GHSA 3C3LA 1E6VB 2Z2ZA 4AF0B 4B90A 1AJ2A 4DUVA 2XU2A 1YDYA 5G1TA 4ACYA 2RB7A 2ZKTA 1VQOS 3RAQA 5JQ9A 3WDQA 4DU7A 4DL3A 4G1NA 1SC1B 5A8KB 1KR4A 1RP5A 2YKMB 3DOMA 3JQJA 4AD5A 3QPIA 5D4LA 2FYMA 4YHGA 4F48A 2OD4A 3ABQA 1TUFA 4REQA 4IFVB 4LF5F 3HGJA 4NLYA 5C42A 4JI7F 4DO5A 1GXTA 3MFIA 1GW1A 1REVB 3A1YG 2B0GA 4DV6J 3KLFA 4HD5A 3UD6A 2DIEA 4UCFA 4I7FA 2A10A 2GQQA 4H9VA 5BOEA 2QEXS 2WO5A 1SUQB 1GEQA 3DGRA 4O18A 3KG0A 4U2ZA 4AD4A 1QMLA 3Q83A 2X2GA 3AIQA 1F60B 1PAUB 4DF2A 4A8FA 3GBEA 4ORMA 3IC1A 1ZYQA 4F4RA 3NLCA 3QZEA 3SUVA 2CWKA 1FBAA 3IJLA 1EQ0A 3CNQP 2DHAA 3TANA 3B78A 3NIYA 4LAMA 1CGXA 3SCIE 4DMZA 3RAXA 3A24A 3F03K 2JIEA 2HMCA 1B7FA 1IVZA 4NRTA 3CUJA 1Q6CA 2W62A 1U45A 1BRLA 5LYRA 4ADTA 1XYCA 4GISA 4GY0A 3T4CA 4DCOB 5A6TC 2WHOA 2PRMA 3LP1B 1PIEA 4M5DB 4UOGA 2J7EA 4GNVA 3P93A 4WVXA 3LA4A 2PD5A 3EWDA 2CA9A 1UZDA 3MWAA 1YE6A 4IL2A 2CIPA 3CCES 3MMWA 3V81B 1VPXA 2HFOA 4ICLA 4M29A 1EKRA 3UXKA 1L9WA 3L4ZA 1JPHA 4QIWD 5F8NA 3KLKA 3NSMA 1LF1A 4GRSA 2KHCA 3MP5A 4CN1A 2FZGB 5L9NA 4I5RA 1QAYA 2WOMA 4C6NA 1YTEA 3QGAC 3TW7A 5DDOC 2WM0A 1V08A 2XH4A 4J1OA 1I2PA 3FA4A 4HTBA 2VRKA 1QOQA 4QM1A 3KLHA 2H51B 4QYZJ 4CDIA 4YN3B 3HV9A 1HNZF 1IQTA 2ZUGA 4M3PA 1OY6A 1K7FA 3PJWA 5HROB 1HLWA 2G0JA 1CTNA 3IK2A 4V1Ak 3A13A 4LANA 4CQBA 5H9FJ 1QBAA 3BWWA 3KRZA 3BLEA 3MKKA 1AG1O 3ISIX 4CM2A 3WMSA 3STPA 3GJSB 3DOKB 3SIMA 4H7ZA 4X4PA 2FLNA 2G3JA 4M5KA 2G13A 1GW9A 2AAMA 4I64A 1JZ7A 5MF5A 3C16B 2WWCA 5HQ8A 2B8QA 1M5HA 5D02A 4Z2KA 3IRWP 1VBHA 1C1BB 2NSOA 2OOGA 3ZTOA 4FBUA 5A6KA 2PU0A 1XIQA 2B7BB 4DL4A 2WSCC 4EK7A 3WIUA 1ZB5A 4AL6A 1LL6A 5KFWA 3GV7B 4I90A 3EXCX 2RJGA 1ZP3A 2Q1LA 1NDVA 1P5BA 5RUBA 5HA7A 3PF3A 4DYEA 3R58A 4YHEA 2IMRA 1XS2A 4KFOA 3W7NA 2FB3A 3CUFA 4HGXA 4LUSA 2VZOA 2MKJA 1Z48A 3I0RB 4NJJA 3CIWA 1XWYA 4DR7F 4UY85 5MKGA 4Q8PA 3BURA 3VIFA 2CADA 4DR4F 3VM5A 4DL6A 2XLKA 1UZHA 1VFHA 4JY9A 1JG9A 1C2PA 2DBBA 4TY8A 1TJ0A 1NPRA 1F2GA 3MI3A 4OFCA 1Q7YT 3FLUA 4LGXA 1PYMA 4ZJQA 4AG0A 3SDEA 4X62J 1XUUA 4IKAA 2YXLA 5DETA 2W9AA 3AS0A 1I0DA 2PGFA 4W8LA 5HNUA 2KO1A 4ZVRB 5CD4A 4IF2A 4ID5B 3K5MA 3TH6A 1R2RA 2V3FA 1JPDX 4L56A 1Q66A 4NYYA 3WLOA 2CJBA 1VP5A 3BGRA 4OI3A 2DVIA 5LSOA 1CC8A 2VG5A 2D3ZA 3W84A 2UU9J 2QCDB 4DAFA 3OJUA 3PBYA 1IKWA 4K4TA 5BZAA 4MFBA 3S5YA 4AYGA 3DYAB 2HHWA 2Z2MA 4JKLA 1JJKA 3Q24A 1EEXA 1JVNA 2MGZA 4A8WA 2F40A 3VGEA 2JH3A 2MGZB 2WB1D 3MVIA 3SGZA 3N3TA 3FMWA 2RQCA 2QLJB 4Q8NA 3AU2A 4L65A 2PPGA 4JS3A 2DY1A 3NQFA 4K39A 2VG5B 2HVEA 4ECUA 3A12A 4ZTYA 1UASA 1SC6A 1KFJA 1TWZA 2IS7A 3AXMA 4ES4A 4HLBA 1IXKA 2J47A 2OFHX 5IWAJ 3ARXA 4HNLA 4TQSA 1VR6A 2Y3YA 3GDMA 2QCGA 2ZEJA 2AJFE 2ZM6F 3CZJA 1UIOA 3W74A 2PDYA 5XIMA 4UC5A 2C3PA 1N36F 4YJ5A 4DPOA 4RR5A 4ES3A 2GNKA 4OLOA 2IMOA 1XLCA 3W66A 3V6JA 1X9SA 4FN5A 4OKDA 2V3EA 1KRAC 2VH7A 1A47A 4HOWA 3DHUA 4PMJA 3VGHA 4LUSB 1YRRA 2GJLA 4KETA 3QQWA 1RWPB 3L0NA 1IQ8A 4OT7A 1UR9A 3G3DA 1CXIA 2Y8KA 1MLAA 5GNXA 2HDJA 3BW2A 1U5JA 3OR2B 3LENA 1D8YA 2VUYA 3KS5A 4YN5A 3FJ6A 3SAZA 3E2EA 4PB5A 5FJJA 4FKYA 2NQPA 4IMEA 3VD5A 3ENWA 5PTDA 4O44A 2RHGA 1HKVA 2NYIA 4KAIA 3AB2B 1MW0A 2ATLA 4H54A 2ZBIA 1NXIA 1OABA 2G3IA 4WOQA 5D32A 2RVJA 3G2XA 1ESWA 5F9LA 3GRIA 2ZOFA 5IFMA 4RE2A 5D8HB 4CU7A 4ZVEA 1FFSB 2ZBRA 1JPKA 2ZDPA 3WBWA 4AWTA 3D0HE 2HHQA 1WCGA 4KO0B 2IJRA 3BGUA 4GVFA 3KXDA 4WUIA 2DEPA 4GKJF 2ACSA 4S3AA 4ZE5A 3EMQA 1QR7A 2YCLA 2PEBA 3E5PA 5K2ZA 3X3UA 3WJWA 4IGSA 1IEQA 2DZTA 4M82A 5FEWA 4IH5A 3GH5A 4MWAB 1OQ6A 3GQCA 4ANCA 1H09A 1R38A 5CPMA 1R6WA 2V4RA 4DQPA 5LXEA 5HNNA 1VRTB 1FO1A 3C66A 1NDCA 1TKXB 4W86A 2QYCA 2VFTA 3VAKA 2XS2A 1JYVA 5IOLA 4AZHA 4S3BA 3FFIA 4WYWA 2FPTA 1HIYA 3ICLA 2XI3A 2L48A 2I5JB 1O7AA 3DKJA 1AYEA 3OL7A 3MU7A 1JK9B 3UWTA 1WQ5A 4QJ4B 3MPYA 1F07A 1NPPA 3NNTA 1KOHA 1X9WA 4EK2A 1G6BA 1E73M 1WZMA 4ZQCA 2ISWA 5TD4A 3WF4A 1BYDA 4BWLC 5A1AA 1GMUA 2FTRA 1S57A 2C19A 2XM1A 4EO8A 5KT4A 4NEYA 4BI7A 2MQQA 1X5OA 4K7QA 2I1RA 3QYSA 4N42A 4ECLA 3CO4A 1IZKA 4HOZA 3PZPA 3B8WA 3T55A 1EZZB 3C2OA 3TYEA 3NGFA 1X6UA 4MAKA 2G0WA 2W3ZA 3CTRA 2VEIA 1WHWA 1TWWA 2O9TA 3MVTA 4O54A 1P0KA 4MKBA 2VO5A 3GU2A 3R7MA 4RW7B 1E70M 3UWWA 1UFWA 3Q2TC 3C4UA 3VD3A 1HYSA 4GACA 3UESA 4OU1A 4WQ6A 4TYAA 4I7FB 3FYPA 2Y5SA 3SZ2A 3Q4DA 2EKGA 3EBVA 3F2CA 3W9JA 3KS6A 3CCQS 4B3MJ 1T0OA 1C1CA 1HL9A 2QMJA 3BQ1A 1ZAIA 4IFVA 1E6NA 1V5XA 3KTSA 3IRXA 4JX6A 3IIXA 2RHQB 1O5QA 3AMDA 1O94A 4UR7A 5F1UA 1UR8A 1QI4A 1TX0A 3CJ3A 3J81Y 2R7WA 1AD4A 4D72A 1U0SA 3Q86A 2CWNA 3UZXA 4CP5A 2E1RA 2IJNA 1E6VA 3VUPA 3CD0A 3TWAA 4FBTA 4L4PA 2QV5A 4EBDA 2KJVA 1DVJA 3GCXP 3W4RA 4U8VA 3SSZA 4QG9A 5A8MA 5IS2A 2D0HA 3A21A 3GR8A 3LYEA 2W2OP 4EBCA 4XUGA 3NPWA 1W3JA 2CU0A 1DTQB 1HNIA 3KVLA 2ONEA 3NURA 4W88A 2CPHA 2GGPB 2BMBA 2ZX9A 4QE4A 4EF9A 3ABXA 3H55A 2EC0A 4DV7J 1OM0A 2YW3A 3NS7B 3F0NA 1X4GA 4WJEA 3M5ZA 5D0GA 3RGTA 3N2XA 4USKA 1VIWA 3CF5Q 4ERIA 3GV8B 3KJVA 2VENA 5FDLA 2BW2A 4IX0A 1FFGB 2R1MA 2BVWA 2I57A 1R9ZA 2R2SA 4DR1F 3TIMA 3FVMA 4EX4A 3DBNA 2HQIA 1NKEA 3BQ5A 2Y1HA 1CGWA 1A4MA 2MKIA 2B5JB 3IJ9A 2FC8A 2XH0A 2CZ9A 5HMYA 2A2DA 3UR5A 4GBUA 3DU6A 4LUTB 1S97A 2FVQA 1SJ1A 2HEJA 3ZLHA 3RR7A 1R9XA 4DO6A 4KBIA 4PCNA 3K8VA 1G4TA 3HM7A 5IWAF 2FQQB 3TTQA 3W1PA 3TQEA 4L6DA 3AOAA 1HR0J 4WP3A 4WR3A 3H21A 3PANA 3KLIB 4FZIA 4LALA 4EXBA 2MHEA 3JSYA 1YJVA 3NEVA 4CEUC 4N0RA 1S10A 4WY0F 4ECQA 3GHUA 1AT1B 5J1EA 3BMVA 4AQYJ 4TXEA 3V4IB 3BV7A 2I9UA 4ZN1A 4HPHA 2RQ4A 1B0VA 3W8GA 2HISA 1P0EA 4EP8C 1TA3A 3LHVA 4DX7A 1OCJA 4HEA9 1ONWA 2GQAA 3VD9A 1Q6DA 1TTQA 4CO3A 1N5SA 4DPPA 4BEQA 1QWKA 3OGSA 3TFXA 4P2VA 2QV6A 1XBZA 3EYZA 4Q45A 1C0TA 1W1IE 2XGIA 4C6MA 3NOGA 4US5D 4F2RA 3KOXA 1F8IA 1B4SA 2D3UA 1NHKL 4N8OA 4NL5A 1CT5A 2KG1A 1UVNA 2P3ZA 3EXTA 3RPDA 3IIOA 2OMOA 1QPOA 3P6YC 3E3XA 1TJPA 3WH8A 3QR0A 1KM1A 3WBXA 3OT9A 4RE3A 4XZBA 3ID7A 1F7BA 1S5TA 2MLZA 3MPUB 4WU2A 4PR4A 2AL2B 2PDXA 1M03A 1SIZA 3S46A 3I6TA 4ANDA 5G2WA 4OX9J 2WHLA 4FO4A 2DHSA 1YIJS 3AD9C 1RU2A 1BQGA 2Z00A 1DHPA 3T8LA 2A3AA 2FH8A 5AHLA 3ANYA 2AYBA 3DFSA 1ONRA 1LL7A 3AFBA 3N6NA 2AU0A 3SN1A 3TMQA 1ZBKA 2UUBJ 1KFKA 1VS1A 4JTQA 4B92A 1MSSA 2EBNA 2OPRB 3LP2A 1RUSA 4DXXA 5GNZA 3D4JA 4OJ3A 3BJFA 2Z26A 4LF8F 2EPKX 3CULA 2HEKA 1J2WA 2VV5A 3P45B 1CBGA 4E4UA 3HF5A 4OZ5A 3JZEA 4J9RA 2B9WA 2QUUA 3UCCA 3CYVA 1JX4A 2VWTA 4PBFA 4Q4OA 4GZ7A 1FOBA 2YPZA 3F44A 3CH0A 2IPFA 4AXJA 3RX2A 4DHVA 3SMZA 2HHHJ 3U4AA 2OGUA 3D6TB 4K5SA 4RNHA 5KSWA 2V8PA 3P82A 5BOFA 2ZWYA 2GIRA 2A21A 1KM5A 1R7IA 3HCXA 2R2TA 1FXQA 4UCGA 2DCLA 3DI6B 3JSBA 2NVDA 2YOCA 4XISA 4CTAA 3W27A 2JC1A 2V2ZA 3V3WA 1BXBA 3C6UA 1UP0A 1ZAWA 1JCTA 5IXEA 3SXLA 1Z1ZA 4CYUA 1OYBA 2FVMA 2R42A 4QLKA 4ZFCA 1XMOF 1QAXA 2ISSA 1GZGA 1T9UA 5FF7A 1O1ZA 1XIJA 4GH1A 4RNIA 1TKKA 2VDGA 3QBUA 1EX5A 2AEMA 3HD1A 5DX7A 2FJDB 2HE5A 2YTCA 3DGPA 2ZJQQ 2P5VA 1G7CB 1GOKA 3B97A 3OTOF 2W01A 3PY8A 2KRRA 5F2GA 1KWMA 3GBDA 4DJEA 4C97A 5K8MA 3PP7A 3KYLA 1FESA 1FDBA 4M19A 2YJQA 2RF2B 4Q0BA 1MMNA 1SGJA 4DO7A 1VQ4S 4DZHA 1EETA 2ZOMA 4A4JA 1TPDA 3J80Y 4XBSA 3NQVA 3O3RA 5BU9A 2G95A 4EYIB 3A3OB 4KGXB 3GTYX 3BQ6A 2BY1A 3VNKA 2F5GA 2AGTA 4CCDA 3QZ6A 1NZAA 3KUHA 4ZDNA 2YL8A 3IARA 1UFKA 3B8UA 4W5ZA 1OINA 2ALRA 2V5CA 3KL0A 4OE7A 4OX9F 2WJZA 2WM1A 5KEZA 3MM7B 3MGJA 1TUXA 5FEPA 1JKHA 4S3CA 1A3WA 3LALA 2GK1B 3R89A 3VVGA 4IIBA 5CZVA 2ZBTA 3HKWA 2GVZB 1X31C 1LWEB 2QE5A 3W2KA 3EICA 4ZVFA 1NJXA 4ZB0A 5ETSA 1J9YA 4GCXA 4L7ZA 4MMWA 1RE1B 4F04B 4AZIA 3KLLA 2XIOA 2YB1A 5DCBA 1N52B 1L6WA 4C1LA 1NF0A 2J7CA 1FWAC 2BWGA 1NH8A 5KG6A 2CG4A 2PZNA 1YJ7A 4FOKA 3L0GA 1NCLA 4CO1A 3M0ZA 2ZQ0A 1HBOA 3FKRA 3ARWA 4BCEA 2HFVA 4C8NA 1C3FA 3QOKA 4E0CA 5BXPA 2DZUA 1SZGA 1ZJAA 2BX7A 3WK3A 4DV2F 2VQEF 3VE7A 2D22A 4DLFA 4EYHB 4PCFA 3W7MA 2BQ3A 3MSGA 4X66J 3LSCA 5LNRA 3CNYA 1TFWA 1HI1A 3BR8A 3QO9A 2FTPA 3AHPA 3OL8A 1WXYA 3PWAA 1S5MA 1MWZA 2EK6A 4TO8A 2PRHA 4PRTA 3N4AA 3THAA 4W87A 2RILA 1SFJA 1OCQA 4NLUA 1XLGA 2WJFA 2OFGX 3AOFA 4JP8A 3P14A 3U8GA 1RK6A 5J1PA 2OPQB 1ZTTA 2ZDRA 4LWWA 1QPNA 2QLXA 3WD0A 1Z3NA 2QZRA 3I3EA 5D9PA 3IUIA 1Q85A 1ZJBA 3DECA 1M0SA 1MZRA 1DY3A 3EZOA 4DLGA 4ZSTA 4QW9A 4HMCA 3UA4A 4UTTC 2BYCA 3UO0A 4WWSA 4DOZA 1ALDA 4LYKA 4QYZK 3PB2A 3QH2A 5CZTA 2BGNE 5T9BG 3S6EA 4W4QA 1HPZA 2XMWA 4NI2A 3H5YA 4NMXA 5LA2A 2KM8C 5DRKA 3F4CA 2HWGA 2A6LA 1VI7A 1XN9A 4FF4A 3DOPA 2RJZA 3FXGA 2DNPA 3LQGA 1V02A 4LVDA 5U7SA 3K89A 1E4NA 1DURA 1MFUA 4E5TA 2VDHA 3LPPA 1JFXA 2O0TA 4WIQA 3DGVA 4ROPA 4GC4A 5A2AA 3PUEA 1W8SA 2VDIA 5CJMA 3TOPA 4LRCA 3VZIA 2QC3A 2V8VA 4R0JA 1C8QA 3P8BB 3M9OB 3L4XA 4B5VA 4RXGA 4ECVA 1JUEA 3LTOA 3QN3A 3FEQA 1NQ6A 2VX6A 1FX6A 8XIMA 1NK0A 2QNEA 1AL7A 1UW4A 2WVBA 3MEKA 3GHTA 1TL1B 2IKHA 1DWAM 3AALA 3AOBA 3ZZ0A 4OJHA 2PGRA 1O95A 1RY0A 2A0NA 3FHQA 1BSIA 1EDQA 4DB7A 1RT2B 3TJ8A 1OT2A 1RPXA 3H0PA 4MYXA 4ZQRA 1UP2A 1OK4A 3V0TA 3C15B 2C0AA 4G1QB 3T40A 3DH7A 2RDJA 3OLBA 1A0EA 4W7UA 1KR0A 3S2NA 2B81A 2J6XA 2Z2LA 3VHQA 2AJQA 1WDRA 4NJKA 1X7IA 4I7VA 4NYZA 1XBYA 2C2RA 2W9BB 2M9KA 4DUZJ 3GJRB 3YPIA 1S0VA 3E1F1 3THTA 3BAKA 2E25A 5E0KA 1IT0A 2ZC3A 3WMLA 2CNLB 5H6HA 4DSJA 4ZLLA 2DNOA 4HYWA 3WIVA 2GW8A 1E5JA 3VOCA 1JLFA 4FP1A 3EDRB 1FEEA 1RISA 2QTWA 4FS2A 2FVRA 1Q6QA 2IPGA 2DVUA 4FIQA 3HHNB 2Z6JA 3FEYB 5D05A 2BEFA 5DGAA 1EC8A 1RH9A 4DR5F 4LSLA 1AW0A 1E0UA 2H3BA 3LTYA 2JHEA 3OL9A 2VFEA 4ECXA 3CQJA 2HNZB 2BANA 3ULHA 3GNOA 2HNDA 5EWEA 4MLJA 2B6AB 3R4IA 2G4FA 2Q71A 4YS1A 3RM9A 1OSDA 2J7WA 1JZ2A 2OI2A 2MPUA 2UVWA 1WKLA 4XKYA 4V28A 3CIVA 4QIVA 5I3HA 3WQFA 3A4JA 1ECEA 1S1XB 4LFBJ 4UWMA 1TVPA 2CFXA 1KQZA 2WKJA 1VRUA 2OSRA 1VQKS 1GKPA 2X05A 4GVBB 3HT3A 5MAOA 1TTHB 3BGJA 4UTIA 3A22A 4TQTA 5DELA 1BSLA 4A3QA 5I7GA 4LRTA 1OADA 4MKAA 4H9YA 4NF7A 2DGOA 2OLHA 2EG1A 2BY3A 3NTYA 4OI0A 3DENA 1YSJA 4X64J 2HQ3A 1T6MA 1S6PB 1XC9A 1S0OA 1O1HA 4H6RA 4HQVA 3CAQA 3GR4A 3GYNA 3CL7A 4M8UA 3VILA 5A69A 1V6HA 2QGFB 2V6AA 3OHBA 2BVZA 4XAKA 1J0ZA 1V3KA 3TX0A 3TYBA 2YPIA 3UY8A 3VTIA 3M6XA 1HQUA 5D2YA 2VX5A 5FAGA 1RAAB 3FVYA 3IAS9 1J5OA 4C6PA 3NZQA 4RW6B 5DANA 4LF9J 4PQUA 5IV4A 5JVLA 3C6TB 4LBRA 2ZC4A 3NVDA 3NQCA 3LMZA 4XVDA 4XO7A 3PM9A 3U7JA 4NILA 1ADDA 4B5SA 1BWVA 1OFPA 3OBKA 1H5YA 3FGVA 3XIMA 3RU8X 5K14A 4F0LA 6REQA 3M2VA 4K7VA 4LJMA 2QVNA 3MECA 3DGBA 5A8GA 4LSZB 2M8HA 1HGWA 1PZ0A 4RLIA 1AA1B 3VAJA 3V6DA 2XMTA 1DWJM 1J96A 2XGZA 4H2CA 4KEVA 4CT8A 3U02A 2GFTA 3KLGA 3RNDA 1CIUA 3CDAA 2OZ3A 1U2RA 3WF2A 4RUBA 2KB2A 3DMJB 1RYSA 3BYRA 1FWIC 1DBTA 1WKYA 4NZ1A 4I6AA 1H98A 3M8QB 5J2NA 1OJ4A 1SMDA 5ADZA 1Y11A 5KOXA 3WELA 3HHKA 1HQTA 4HCDA 2GJNA 1R0AA 4L1GA 5HI7A 4DUYJ 1FH8A 4INFA 5F8MA 1LL4A 3EWCA 3UP8A 2O55A 3WNMA 3O8WA 4K2XA 2J7GA 1XC6A 4Y90A 1JCYA 2VGIA 2HVMA 2YA2A 4A3RA 4X66F 3NGTA 5BXSA 3NBPA 1ZZNA 5ABFB 2YXOA 2LU1A 5A76A 3O1NA 2VXNA 3QVQA 4ERAA 3HJZA 4Q4PA 1U1HA 1N2VA 2QSWA 4DG1B 2FHCA 4DZ6A 5EUHA 1GTEA 1IF2A 4R8UA 5LMNJ 3M6UA 1LWFB 1MWQA 2H54B 3VOHA 2F6KA 4FR6A 4NNAA 4AY1A 3TZZA 4M81A 1RQHA 1G4EA 1PPIA 4MYAA 4IT1A 3CJRA 4JYAF 4U67Q 3KCLA 1PE1A 3HULA 5F8JA 2EWHA 2R7UA 4POCA 3NGDA 4X62F 3AUOA 3WQEA 2OPSB 2IRYA 3EA1A 3QW3A 4HH0A 4LCRA 2RU3A 3N4WA 3R0UA 2N82B 3RRKA 2CKWA 4KCWA 2VU5A 3B82A 2UUTA 2V9DA 2PFDA 4Q8UA 2VKRA 2LEPA 2POTA 3M0HA 2RMLA 4LT9A 1E1CA 4KKOB 8TIMA 1TV6B 1FH9A 1CBKA 4EOUA 2HBYB 3BN4A 3FDGA 4RNNA 2GVEA 3H2NA 4LC6A 4UTFA 4GGHA 1B0TA 3T19A 5GAHI 3G1VA 2G96A 8AT1B 4ZPVR 2W8KA 2EO7A 4RNFA 2JKEA 2XVPA 3ENQA 3L7UA 5HMWA 2H6RA 4DFKA 3PNUA 4ER8A 3HJVA 2ZH2A 3T6BA 3TAMB 1TPVA 3W7OA 5A8WA 2C42A 3SN4A 3WH5A 1Z89A 3B8IA 2BXYA 2JGQA 2E1CA 2IM0A 4U9RA 1GMWA 5CAAA 3WZ0E 1PHWA 2UZAA 2PTXA 4TKTA 4MB4A 9XIMA 3MHYA 3FW6A 3D6FB 2IPWA 3QWUA 2VG6B 2GQ9A 1MMFA 4HSNA 5F2IA 1G69A 4LAUA 9RUBA 1ZSXA 2ZKMX 3VX0A 3GNPA 5CAKA 3PPHA 3UG8A 4MH8A 3B06A 3VXGA 4PTDA 4IPNB 2R3VA 1V6TA 3BTNA 1LWJA 3HSZA 5D4NA 2WWDA 1K6AA 2EGZA 4J3ZA 2HS8A 2C16A 3IM9A 1SKWA 3HTWA 1IKVB 3WFLA 1D3WA 4V1XA 2KT5A 4LVNP 1F6PA 2QMKA 3POCA 2DGVA 3ZJKA 3LO3A 5CYJA 3DLLQ 1ZALA 1R47A 1N48A 2ZRZA 2BX6A 2XZWA 5KFAA 3RYLA 2E09A 4JR5A 3U9IA 1R3QA 1S7HA 3VCRA 1KVIA 4ZKAA 1IJFB 1R3VA 1WP6A 4UNLA 1UVKA 2YNHB 3FGCA 1M7JA 1SC3B 4IRKA 1UVJA 2OWCA 2PWUA 3LGMA 3T1YJ 2V2VA 1HUVA 1SSGA 1VQMS 1J18A 1OB0A 4L1WA 5D30A 3AS2A 1TKZA 2XULA 5DO2A 2CDRB 1MG7A 3MEGB 2ZFAA 1KLMB 1VLIA 1F6YA 2FLOA 1R0MA 4LEQA 1N5VA 2H48B 4HB7A 4TU9A 1AFIA 3IPWA 3O6AA 2GA7A 1ODUA 5BR8F 3FRZA 4AH7A 1IKYA 2INZA 3ADAC 1ZAHA 1W6TA 2D9PA 2GDUA 2ZC1A 1SJ4P 3GNNA 3F4WA 4HDHA 3MMTA 4J9JA 3V1HA 1UMYA 3PW5A 3U4FA 5DXYA 1F3FA 4H01A 4LY8A 4D6JA 3NPXA 2OKTA 2QMUB 4RDVA 3WLQA 1C4CA 1VYAA 3W3OA 2E66A 3LBMA 3W25A 1ZL1A 2QZ8A 5KFPA 2A3JA 3TZXA 1ZPTA 1QNQA 4PB4A 1VYRA 1OY8A 3KX6A 1XIIA 2QUNA 3ITYA 1FT8A 3BMWA 1T40A 3BL3A 4YB6A 2XGBA 3M5YA 4E98A 4GX9A 2IVYA 4LFCF 4W93A 4XD3A 4S2CA 1KFDA 3ALFA 4MUPA 1YTYA 3MJMA 2XHYA 1NB2A 2N7CA 2PEVA 3KFWX 1J5SA 1ELSA 3FV9A 3OGVA 3DERA 4RK8A 1YE4A 1J2BA 3CBWA 1R0CB 3D0GE 4KEMA 2DPEA 4JV1A 1M1HA 2FZ8A 3PO5A 1TAUA 1E43A 2AP6A 4HU3A 2XG9A 3B0YA 3JSMB 1XDLA 2VC9A 1JLCB 1TR0A 5B7YA 4WE1A 3E0IA 1OBAA 5AT1B 2XSBA 1BQCA 2MNRA 2DVTA 3L0KA 1RQBA 3G24A 4PTWA 4M6PA 5H8PA 2AGOA 3SGUA 4DPTA 4OHXA 2COLA 2CJYB 3OVBA 1F9HA 1O5RA 3BAWA 3H90A 2P88A 5JH2A 1PDYA 1S79A 3BLFA 1UJ4A 3ONQA 3K5PA 1I2OA 1ELOA 4H9MA 1E6PA 4QP0A 3DFTA 3OD2A 2DSVA 1ZFJA 2BE7D 2BY2A 3W72A 1M1BA 4CLYA 3LCHA 4ZA1A 3PBVA 4YVXA 3G0XA 1UR4A 4DN9A 2XINA 3QJAA 2CQ3A 1BVWA 1GTHA 3D2WA 3VIJA 1VFSA 1Q5MA 4C9DA 4QOTA 1H11A 4IP7A 3K8WA 2TYSA 4IUOA 3VZYA 1N8FA 4C6LA 1UD5A 4IPPA 1QJWA 5AC8A 3CTTA 2Y0BB 3HVRA 5CC5A 1TV7A 4IJBA 2ICSA 1OG0A 2KN4A 1D0EA 1V3ZA 1PKLA 3GTFA 1CJTB 5GAGI 4YR3A 1DXFA 5I42A 1YDNA 1IIHA 4ENOA 4JI2F 4IG3B 3VM7A 1LLOA 4F02A 5KFEA 4TOQA 3DYMA 4J3SA 4C8LA 4NJHA 2HSAA 2GWGA 2W8LA 1S5WA 2V5JA 2EBEA 1QTMA 4JOMA 3VFCA 1KS2A 5I42B 4KMQA 5FJ4A 2PLCA 3WLLA 1RWKB 4K4SA 5I5RA 1PIGA 1RI7A 3LPOA 3CJ8A 1TWDA 2QYGA 4MMOA 4B5WA 3UR8A 3LGNA 1XPYA 3IGXA 4KERA 3AI0A 5JXSA 2CPFA 2L5HA 1VIXA 4OIFA 4K37A 1AL8A 4UXDA 1RBLA 2RNEA 3CLMA 3DX5A 3BZGA 3CXCR 2VVSA 5GQBA 4P10A 3AIVA 2R7SA 5I3JA 1QFEA 1Z7AA 4M94A 1O5JA 4Z2LA 3LI1A 3EE3A 5BYRA 3UG5A 2J27A 3U2OA 2EBGA 3D6MB 1V3IA 2B9YA 2WW4A 3PFOA 1YKWA 4B3MF 2DY3A 4PWUA 4Z2HA 1W26A 4W9TA 4WZMA 4WXYA 2MKCA 3EVWA 2M0GB 5C25A 4G8TA 4H04A 3ISND 1H7PA 5KG2A 3D6NA 3RLHA 5D8WA 3QPEA 1UEVA 3M7SA 3HMJG 5H8UA 4TMBA 1N34J 3G18A 3N01A 1JLCA 4WE1B 4CI0B 4A22A 3JSMA 4I7WA 4MDOA 3VGUA 3JRKA 3C3UA 6XIAA 4P8WA 3KE0A 1JLQB 3N28A 1OF6A 2XISA 3H4WA 3BJSA 1UD4A 1ZBCA 4EPKA 1SJAA 4XDDA 3O0KA 4RW3A 4C3KA 3W1AA 1EJVC 2KTQA 1CLVA 3DFQA 5LHFA 4B5TA 4MZYA 1J11A 4N9BA 2YBVA 4LAZA 4M5MA 1OT1A 3Q45A 1P0NA 1KXHA 3TOQA 2CHOA 3CCJS 4X65F 3HPSA 4N7TA 3QJPA 3WLTA 5K8NA 5HVHA 2DYAA 1XW8A 2V69A 3LA0A 1N56A 1UKSA 4KEUA 3CHDA 2WZEA 2PWEA 1SQFA 1GOXA 2DNKA 2RQKA 1W54A 1JJ2R 4HPGA 2C71A 1SZRA 2HVOA 2FIQA 4Y9NA 2DH8A 4F3OA 4MJ2A 5J2MA 2Q01A 3CWNA 4DV5F 4QIFA 2X1FA 2X42A 3K1DA 4GKLA 1KKRA 1TL7A 4MNLA 1E56A 4NZ3A 2P9CA 3S5ZA 4HYKA 1ADOA 2IXVA 3TTEA 1RTJB 1TWIA 4ZB5A 4JI0F 2FLPA 4PSRA 2ZZMA 3IWPA 5FCZA 4KH2A 1KLMA 1XLDA 5SWUA 2OSXA 3MCMA 4MK7A 5HNTA 2V5KA 5C9UA 4DDFA 2CERA 2XLIA 5DRIA 2VFFA 3EPIA 2NWSA 4W89A 1OYDA 5KFIA 3CGIA 2YSWA 2ZX5A 2YNHA 3HURA 3IJ7A 4CLZA 1A5UA 2DT1A 4AD1A 4LVBA 1VHIA 3CH9A 3UW1A 3DRSA 4YY3F 1G1YA 2QJIA 4XV0A 4R5EA 2KJWA 2HFNA 4CQ1A 3PUOA 1QATA 3QWPA 2BVDA 1AVAA 3HHLB 4FI4A 2JOQA 3ZT7A 1IKVA 1CLKA 3OB8A 4AB4A 3NYZA 2BDPA 3Q89A 2FD2A 3IO1A 4LIRA 1NRKA 3M0MA 2XG8A 3QGVA 1IWBA 3CV6A 1C0UA 4ECSA 2W27A 3HT0A 1LP6A 4BWLA 3CZLA 5DGBA 4CO0A 4BWJA 3PK7A 4CQ9A 1D9FA 1Q13A 1NWUA 3R8YA 3U2CA 3QGKC 3CCWA 4DSEA 2J7FA 4QX4A 2J7UA 4LIWA 3O06A 1GZJA 1BQNB 1VJQA 3S01A 4YYFA 1QDUB 3BUVA 2C14A 3CAKA 3PJUA 2HAFA 3L95X 3W61A 3W86A 1QSSA 4P8UA 3M32A 3HJEA 4C7DA 5DXXA 4KRTA 5DG9A 4NRSA 2PDPA 2YX4A 3HO1A 2FHBA 1TE6A 2V0TA 1EA9C 3NM3A 4NMLA 3J7HA 4LW7A 3VD7A 1NSAA 3MPDA 1TR9A 4KWOA 1K4HA 2QL9B 3QPZA 3P96A