1UKUA

Crystal structure of pyrococcus horikoshii cuta1 complexed with cu2+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords periplasmic divalent cation tolerance protein CutA
publication title Structural implications for heavy metal-induced reversible assembly and aggregation of a protein: the case of Pyrococcus horikoshii CutA.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Metal binding protein
total genus 31
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ukuA00
1J2VA 1VHFA 1OSCA 3O5TB 5DS7A 4D3HA 3CE8A 4USHA 4C3LA 2ZFHA 3HLUA 4CO4A 1V6HA 1UFLA 5D4LA 2XG8A 5L9NA 5D4OA 1QY7A 1UL3A 4AFFA 4CO3A 4NYOA 2DCLA 2NS1B 1GNKA 4OZLA 3AA9A 1VFJA 4OZJA 4Y6IA 2XBPA 5D4PA 2O66A 4YB7A 2O67A 3TA0A 1V9OA 4YB6A 2GX8A 4RWWA 3OPKA 2CZ4A 1H3DA 2XULA 1NAQA 1HWUA 5DRKA 2RD5C 3LF0A 2EG2A 4USIA 3NCQA 3GSDA 3DFEA 4CNYA 1P1LA 5D4NA 3AHPA 4WK1A 3T9ZA 3TA1A 1O51A 1O5JA 4NYPA 3NCPA 4Y65A 3NCRA 4D3GA 4CNZA 2ZOMA 2VD3A 2EG1A 3L7PA 1PILA 3AH6A 4C3MA 4RWXA 2J9DE 2J9DA 2Z0GA 3O8WA 4OZNA 1KR4A 4RX6A 4CO5A 1NH8A 4CO2A 4USJC 1XK8A 2J9CA 2XZWA 2JJ4D 4ZK7M 4RLEA 2NUUG 3X3UA 3BZQA 4R25A 3MHYA 4E98A 1Q1KA 3N5BA 2PIIA 4WK3A 4CO0A 2J9EA 4CO1A 2E66A 1V3SA 1NH7A 1NZAA 2GW8A 2V5HG 3TA2A 1V3RA 3AA8A 1UKUA 2NUHA 4IYQA 4YB5A 3M05A 1UMJA 4C3KA 2GNKA
chains in the Genus database with same CATH superfamily
4X4TA 4WFBQ 4KAIA 3OSPA 4DR1F 2JH3A 1DQ9A 3FRZA 3SIPB 4C0HA 4YFUA 3GMGA 1R8AA 1NK5A 2X7IA 5KFQA 2WSCC 4CLUA 1MROB 4DG1B 4F2SA 2F40A 2BJ3A 2D1CA 4AXJA 4DUZF 3KJFB 2HHHF 3MM7B 2HNDA 2EW9A 4GVBA 2B9WA 1KVKA 1KBRA 4H4MB 5G0RB 4DUYJ 2GVDB 3LA0A 1UZDA 5I3UA 4C0OC 1FX4A 2FDNA 3POTA 1IKYA 4UQTA 5HN0A 2YNHA 5C5JA 4N76A 1LW0A 4O4GA 4PUOB 2F63A 4F25A 5KT6A 4CM2A 5I42A 2J8SA 1SC1B 2YNGB 2VDHA 3GQCA 3JYTB 4EYIB 5F3TA 5C24B 3VV2B 3IWXA 2DHSA 1RAHB 1T7PA 1ZPVA 4ZVTB 2GIRA 2VG5A 3BKUA 3A8EA 3MEKA 3ZZ0A 2UV8A 2HURA 2WRMA 3GFZA 4LF7J 2X1FA 2DNGA 1FI4A 1GFWB 3V81B 2FLNA 2A6MA 4B08A 2IIHA 2DITA 1URNA 4OFZA 4DV1J 1Z1ZA 1BC6A 5EHHA 4ILMA 1K8AT 1VQPS 2ZBPA 4ZVRB 2XI3A 4YY3F 4U7UD 4DS5A 3MCNA 4JI6J 4NMLA 4DV5J 1EX8A 4JI4J 4B02A 5EGYA 2DXDA 4UOGA 1TAUA 1KONA 5HANA 4DSEA 2MQNA 3KUEA 2I8EA 4ZVPB 2HG4A 1NJZA 4OL8A 3JQJA 1IBCB 2DKOB 4TU9A 4DQQA 4CLFA 1QSYA 2DNRA 3NWRA 4PQUB 4WCEQ 3C3LA 5SZTA 1ZETA 2KL8A 4OJ3A 3L09A 2MKSA 3RW7A 3RBXA 4RPFA 2ZDOA 3GONA 4CLPA 3ITHA 4GKJF 5CYMA 4RNFA 3SMZA 1SQEA 4ZN3A 3CJTA 2ZHAA 1VRUB 2LVWA 5KT5A 3SQGA 2IAJA 1SKSA 1SQGA 3PKYA 1ZAVA 4RWWA 1Q53A 2YVSA 1FFWB 1DLOB 5K8PA 4XO0A 4LF5F 1H3DA 5H9EK 2C2RA 4DWIA 3QATA 3SEOA 3GSDA 2F5GA 2YH1A 2ZE2B 3Q8UA 5DLFA 2RQ4A 3W61A 4RX6A 1S77D 1K47A 3DLEA 3KLVA 2HFZA 1TL1A 3UCUP 3QO9A 4X4SA 3MR7A 2XSJA 1Y10A 4CH1A 3SV4A 2R7XA 5B0EA 4J9UE 2RQKA 4I69A 1N88A 5IS2A 2MHNA 2VUGA 3VVTA 4DR7F 2F3JA 3EX7B 2RS8A 1R0CB 2LQJA 2G0JA 1YJVA 2ACYA 2RRAA 3KMSA 1FJGJ 1LXJA 2QSFA 3M8RA 1CULA 4NLYA 1PJ5A 3CD7A 5C25A 1MW7A 4NLDA 3T3FA 3C15A 2KRRA 4NZ6A 1DAXA 1DTTA 4DFMA 4ECTA 2HQ3A 2MQ8A 1HNZF 2XLIA 1CG2A 1F6TA 3C16A 2NXUA 3ENVA 4QIVA 2MGZB 3N28A 1RT5A 2COLA 4RNMA 3VQTA 2J9DE 1XC9A 2MZJA 5JVHQ 4DV4J 5BYRA 4XIUA 2W1BA 1VQ7S 3PRDA 1NSQA 3CW2C 3UWTA 2QYCA 2CPYA 4Q44A 4DU7A 1H98A 4WP9A 4F4XA 5CCMA 1IKVB 4TVAB 3E01A 3SFGA 4DEZA 1OS5A 2KJVA 1FVSA 1VYAA 3CD0A 1CC8A 3THVA 4FF1A 3GG0A 2K2PA 5DG9A 2DH9A 5AXMA 3OTDA 3GSIA 5DS7A 2VOPA 3CDAA 1UEKA 1HWKA 1T3OA 1GXTA 3FBCA 3DDIA 4I64A 1S6OA 2LA6A 1F3FA 2ZWOA 1GX5A 2EKNA 1DARA 4G1IA 2DTJA 3UN3A 4OZLA 4DLEA 1N0UA 4EUVA 2CVIA 1EQ0A 3R7SB 3DGVA 5RUBA 4C8LA 1S6PB 2E5JA 4I7FA 2JFKA 1H7WA 3JXOA 2ZH1A 2VPXB 3BKTA 4FKYA 2DR6A 4HACA 5JJBA 3CULA 4ECUA 3P4UB 4ZJQA 4ID5B 2L08A 3FC9A 1LQ9A 1FT8A 5F8NA 4IRDA 1S5ZA 1SUQA 4JI5J 2W2NP 2KB2A 2AJ4A 2A3JA 2J9CA 2MZRA 3DOKA 3CC7S 4ZLJA 3BS9A 1B0VA 2IMOA 1NB7A 1N0VC 1FRKA 2LLZA 2XHWA 1W2IA 2JLFA 3DRPA 1S99A 1U7LA 1WF2A 4IOBA 4NWBA 1Q82T 4J9VA 2DNLA 2F7VA 4OYMA 1N5QA 4DR6F 4XK8C 2XBPA 4ED5A 2YQ1A 2BDPA 4USMA 4ELUA 4CLWA 3KTQA 3NOGA 1K1SA 3MECB 4UOFA 1XR6A 1NPPA 1EP4A 3V6JA 5IV3A 4URGA 1SJ1A 2Z58B 4ILRA 4OX8A 5B0FA 1OIAA 5CA5A 2DIUA 1M1GA 3OLBA 1IKXB 2KM8B 2Q6BA 4B3RJ 4RWXA 1RTDA 2QTWA 4ZVQB 2R8JA 3Q8VA 1WC3A 1VRTB 2BW7A 4ZK7M 3TUZC 4PWUA 2X3DA 3IGNA 4DOZA 2DNYA 5I3QA 5IXUA 3JTOA 4P2XA 1JLBA 2RSQA 2OELA 2IHR1 1Y00A 3CIMA 3V4MA 1Y5NB 3M05A 3BO4A 3M8SA 3QAEA 4ED1A 1LFPA 4AE5A 1KVIA 3H25A 3T1HJ 1RTIB 1M0SA 3EWGA 2QLFB 1Q7LB 1ZH5A 3OTBA 3AQOA 4OZJA 2Z2MA 1RBLA 1HR0J 4IDKA 5IWAF 4O3SA 3BB5A 4C8KA 2GCFA 4DSJA 1BY9A 5ADZA 4HT5A 3WBZA 1A9NB 3IBCB 3PYDA 2IM1A 3HHLC 3RR8A 4WXWA 2IM2A 5KFGA 4GO7X 5KT2A 3KJVA 4DV6J 3BQ2A 3QSIA 2FUG9 4X66J 2X1GA 5F8IA 3DMJB 3GV5B 2F9JA 1Q8BA 2YNIA 3TZZA 4FF2A 2H5EA 4JV2A 1HMVB 2OD4A 2XZWA 2E7XA 1R0AA 2F4FA 1TKZA 2E5GA 3TOQA 1NHVA 2IPOB 4IH6A 3D6MB 2HZAA 1QE1A 3LP1B 1PAEX 2M3DA 3R1LA 3SCKE 3EXYA 1ZA2B 3NRBA 4USHA 5GAHU 3LTOA 3DLLQ 2WOMA 1HBMA 1SKUB 2XYHB 4DZDA 3HSGA 1FDAA 4I4BA 3BEGB 4A47A 1D9AA 3G6YA 1FK9A 3LUYA 1LWEB 2DH7A 3NGRA 4PYDA 3FDSA 5CZXA 2FD2A 3GJTB 1JJ4A 4E0DA 2H54B 1RT2A 2EFPA 1SKWA 3OL9A 2MJNA 4QU6A 4TKTA 2BV3A 1AUSL 5A0YA 3KUGA 1U8SA 1FESA 5KFRA 2BANB 5D0HA 2R8GA 5SUHA 1FKPB 1GMWA 3IMQJ 3RU0A 1X4DA 2ASJA 3WQPA 2W4PA 5F0UA 5FLXY 4X62F 2LKZA 2AYGA 2NQPA 1FXRA 3C6UA 1VLOA 3HJVA 3ISZA 2ZH9A 4WFNQ 3CMES 1C1CB 1X4CA 2MQMA 1X5OA 1YJUA 2R2TA 4CP5A 2N4CA 4E8UA 3TAMA 1JLCA 1YVFA 2CNOB 4L3KA 2ASLA 1YJNS 1H2UX 2ZVIA 2PO4A 2VZ9A 3ZZTA 4C8NA 2W7OA 2AT1B 2D9PA 4G6VB 5LMNF 4CCHA 3QYYA 1XMOJ 5EWGA 2FZGB 4R5PA 1S1UA 3MM6B 3H2VE 2W4CA 2WB4A 1RTZA 2OMOA 5DQIA 4YR0A 1TL3A 1YHQS 1CLFA 4QIWD 3CJSA 1UJ5A 2MZTA 1OY8A 2CADA 4C11A 2XLJA 3T6BA 2FVQA 2VQFJ 3CJRA 3QT6A 2KYXA 3L7PA 1SKRA 2GIFA 2KG0A 3M1VB 1XK8A 4JI3J 2G9OA 5IT9Y 1EKSA 4H4OB 2P5VA 1KRPA 1K44A 4O4RA 2BE2B 1RT6A 1HWLA 4ZVHA 3AOBA 4OI0A 4DZ6A 3F41A 2H5JB 4KFBB 1JLEA 4USTA 5B0GA 5DDPC 1Q8IA 2VFSA 2VHGA 3OHAA 3CO0P 1KEKA 2RVJA 2DT9A 4K7QA 1U8WA 2UXBJ 1LW2A 1RLCL 3IG1B 2JVRA 4K0KJ 2AD9A 3OLAA 5ETOA 4PXDA 3W8GA 5AE2A 5HVHA 2V8PA 3RBDA 4EGLA 1Y5LB 4P52A 3DLGB 2C2KB 2JHEA 3QLHA 1S12A 2I38A 1HWUA 2RDJA 2XYPB 3TJAA 4LVOP 4PG5A 4KH0B 1QSLA 2RHSB 1REVA 2JEJA 3A3OB 2VICA 3TAQA 4W4MA 1AZSB 3D6TB 3CJ0A 5J2QA 4NPOA 1GMVA 1YX2A 4X4PA 5D0RA 2XC9A 4RLEA 3X3UA 3T5LA 1RI7A 4LBPA 2VC1A 2GVZB 1KQGB 2HNYB 1NPKA 2POKA 4ECVA 4F4WA 1C4CA 1RAJA 2MKIA 1XMQJ 4MFBA 4WFZA 3KLIA 4ZVUB 2V5HG 2M4MA 3OXGA 5KFBA 3AA8A 1CJKB 2FYXA 3FRYA 4X2BA 1TL4A 3QWUA 4ZVFA 4IRCA 4JUZA 4C2MA 3CE8A 3MEDA 1KFDA 4FKXA 4RU9A 1NO8A 3PZPA 1R8BA 2W7AA 4FS1A 3J81j 4J9SA 1U1RA 2YKMA 3WZ0A 3SXLA 3H4BA 4NLWA 2OIHA 1YWXA 3CJKB 4L76A 1AA1B 2HYIB 4MH8A 1UVLA 3FBFA 2CPHA 5U47A 1AFJA 2LU1A 1EIYB 5CZVA 2VPZB 3J81U 2OHDA 3DRRB 3QT5A 3BSNA 2VIHA 2W9AA 3OR1B 3R8YA 2M7SA 2Y8YA 1MN9A 4CLLA 3WC2A 4OI2A 5KFAA 3MM5A 4EZ9A 1HNWF 2PE8A 3PACA 2CQIA 4M95A 3RJMB 1R8HA 5F0WA 1FRMA 2HGMA 2A2DA 3AB4B 1CQMA 4OHYA 1T9XA 3DOMA 1NNDA 3CJ3A 2C22A 2GO9A 4DQIA 2YX4A 4OI6A 3W5XA 2YTCA 2MJUA 4Q43A 2C3YA 2XO6A 4ES1A 3HHKA 5H1SV 4TU7A 3BGOP 2R7WA 3P6YC 2CQ3A 1R31A 4J9MA 4QW8A 4DR3J 3D54A 4FYXB 2WZ1A 4ZP7A 4YB7A 2QRRA 4NLTA 1GEHA 2KTQA 1RTHA 3UR0A 4IG3A 2CJQA 1OO0B 2XMVA 2DHXA 3EZUA 3FFIB 2YX7A 3I0RB 1J5OB 4DR1J 5EUHA 3C14A 5C2CA 5C42A 2NPFA 2DHGA 1R7IA 2WTFA 4M5LA 4FNHA 2BKPA 3FZBA 4DUZJ 1Q86T 2HHHJ 3GIJA 1GMWD 1WNEA 5KG6A 1TELA 1WOOA 1X0PA 2KXHA 3QSYB 2ATLA 2N4DA 1JKHB 1UKUA 2Y0SD 1IBLF 1S79A 3KDOA 4DCJB 3KLFA 4Z7CA 4U8VA 2NXNA 2ZFHA 2IA6A 2DVIA 5ETRA 1TMMA 1FWPA 2DNHA 1JLQA 4FNIA 4H4KA 2FHMA 1T03B 4O4GB 4PCQA 3HCXA 2YPZA 4EMDA 2IBOA 5I42B 3CCJS 3PG9A 4DDFA 4ZPVR 2AZ1A 5CCLA 3E3XA 1ZTWA 3C19A 1RWNB 4OZ5A 2MXYA 2KZMA 2MDAA 3RGIA 4BC9A 3P3DA 1FRIA 1PYOB 3QIPA 1F3VA 2BKOA 2F1FA 4OHWA 2BVZA 4M5IA 3UI3A 3TUJC 4ZJLA 4M94A 1XEZA 4RNOA 4MKBA 3M2UA 1UPMB 4Q7AA 3UD5A 1DQAA 2NUUG 2V4RA 4HI2A 2B9XA 4DXLA 2OEMA 1HBUA 4NLRA 2VQEF 4YY3J 2E44A 3KK3A 3C2PA 5KFIA 2ZKUA 2HHVA 3CDWA 1BWEA 5HO4A 2CNNB 1FE4A 2P6TA 2WSFC 4QYZJ 1WDDA 2XY5A 3ISND 1S49A 4DCOB 5D4OA 2HZCA 4DSIA 1SL1A 1HQEA 1NJYA 2W7PA 2RB7A 3JB9k 4JI7J 2GMHA 1KDNA 2UVVA 3M32A 2KZZA 4Y2MA 4BHQA 5HK4A 1VHIA 1NK6A 1H74A 4GKJJ 2AYMA 4QQBA 2EC0A 4DSFA 1TTHB 4A8XA 1E6YB 3CPWR 3PX0A 4GMKA 5LXRA 2XGQA 2C2EA 4QWAA 2MQPA 3HXMA 3JSMB 5DZ6A 4P74A 5CYMB 2HBYB 2N3LA 3GLJA 3A8KA 1RT1A 2BE9B 3G6VA 4JI0F 2MY7A 4K2XA 2U2FA 1LXNA 5KG4A 2Y9HA 4C0BA 3D3BJ 3DRSB 2MLXA 3VAIA 3D68A 2MQOA 2Y8WA 2V9WA 4XAKA 4BBYA 2CQ1A 3IXQA 2CRLA 4GC7A 2QLJB 3KJQB 4P75A 2CPEA 2QL9B 4LUBA 4BCAA 3ZZZA 2NPIA 2R3VA 2OPQA 1ZOTA 4DQSA 1YBUA 2XWXA 5J2MB 4ED6A 1GMUA 1CJUA 3RRHA 2BJEA 1UFWA 1ZZFA 3MOZA 2AP6A 2FVPA 2DY1A 4U96A 1RZMA 4N47A 2UVUA 3Q2SC 3QNWB 2YNFA 3IRXB 5IOLA 4ZPBA 3PFEA 4J9RA 1VI7A 2YKNB 3K8WA 1R8PA 3NCRA 4CNZA 5E2QA 2Z4PA 3CDEA 3QRPA 1U6ZA 2HIYA 1B0TA 3OFEA 1T9TA 3MAAB 2OSRA 5K9FA 2HPUA 4NOHA 1B7FA 9RUBA 1GT8A 3I56S 2FHOB 2J9EA 2DGQA 4U7UK 2GMJA 2CQBA 3FMWA 5LJ3Y 1F60B 3D1OA 1HNZJ 3SYZA 2OEJA 2J5AA 1SI9A 4O44A 2ZUGA 1XR7A 4B3OB 3SBMA 4M8LA 3C15B 2C42A 1RISA 4RW8B 3VVUA 1X4AA 2VFRA 2XG8A 1TKDA 2CZVC 4CYUB 2K1RB 5L1IA 5LL6d 1RT5B 1OQ6A 2MSSA 3ILOA 2UZAA 2CIMA 2B51A 4F7VA 3I96A 1MROA 2HW3A 4DG1A 4DMZA 3QGHA 3EGVA 5KFXA 2VFVA 1JNRB 1YG0A 5I4MA 1HWIA 3HD1A 2YQ3A 4EFAC 4H4MA 5G0RA 3H42A 4M1KA 5HI7A 2GVDA 3I32A 1YRUA 4L72B 2ZH3A 2FVSA 3F44A 2DNKA 2VA2A 4CO5A 4LMZA 2CUYA 4PUOA 1DBDA 3MMAB 1Q0NA 3AB2B 1IJEB 1H72C 2HQIA 1L3VA 2YNGA 2CG8A 2H48B 3EGNA 4AL6A 3NGUA 1LV5A 3JYTA 1U2RA 1X0FA 3K2YA 1B7YB 2DR7A 2QFJA 2NUHA 4MT1A 3NBPB 2JC0A 4DHVA 4DFKA 2R7SA 3B78A 3W60A 2GNKA 2W9BB 1WKJA 1Z2ZA 9ATCB 4KR0B 2F8HA 3KHGA 1YJTA 2UUWA 4ETXA 3MFIA 3OUYB 2CQ0A 3CJ2A 1T05B 4X64J 2RKIB 3CTRA 5E3CA 2MKYA 3KG0A 3V81A 3WDOA 2L9WA 1VC6A 2XULA 5HMYA 1VCTA 3I4PA 4HTJA 1D8ZA 3GU0A 1FDDA 1NRKA 4OYXA 3HSJA 4WK1A 3H5YA 2WONB 3NS6A 1PYTA 4PXBA 2RRNA 4DR6J 4L6V3 2PA8D 3HKZD 5FD1A 5F8JA 3MURP 1RU2A 4Q5VA 1HQUB 2QYGA 2LXUA 4HH1A 1D1UA 1RHKB 2LQ5A 3PX4A 1YGYA 3CGIA 1KTQA 3CCLS 4LRBA 1NSPA 1HKAA 2WHOA 1ZM9A 3KMQA 4PQUA 2DK2A 3IFEA 2I2YA 2YWHA 2CZ9A 3R2CJ 2FIUA 2MZ1A 5KG1A 3FEZA 2EVZA 1AB8A 4G1QB 4K4TA 1OMSA 3VHQA 1VRQC 4FF4A 5L8RC 2NCKL 1IBMF 1S6QB 1VRUA 4DL7A 4W92B 2HAFA 5E7OB 1FVQA 3JAMY 1GXUA 4J9OA 3FEYB 4B9TA 1WC6A 4LQ9A 4KO0B 1DLOA 4K50A 1Y4ZB 2QL5B 1RXOB 1ZM3A 2D3ZA 2NXCA 1UVMA 3LGMA 3DLBA 4EBCA 3CCQS 2J9DA 3KHHA 2AJ0A 4ANDA 4ETZA 5IWAJ 2ZE2A 4XDCA 1SXLA 3PW0A 1SIWB 3HZEA 1RHMB 3M8YA 4OZ1A 3C46A 1C4AA 3BREA 3R5JB 3W1YC 1Y11A 2EC2A 5IT4A 4CLYA 5H9FJ 2PI4A 4OJ1A 1PO6A 3S7RA 2CPIA 4I0WA 2B56A 2N82B 2CG4A 1ELOA 3KOAA 2R7TA 3TX0A 3SCJE 1M90T 1QTMA 3R2DJ 3FZ2A 1BQNB 4NCBA 4U67Q 5B0BA 2MEWA 3OXLA 1VQYA 2YKQA 5CYQB 1AXQA 4NRTA 3UNGC 3J7Z5 3OFGA 4KGXB 3I5BA 2OTJS 4V1Ak 3UCZP 4CLKA 3CJ5A 3CDBA 2QC3A 3OTEA 3MAHA 2MGZA 1P6TA 1IR1A 2RUSA 4I56A 3SCIE 4EBEA 1KOHA 4RBVA 3BZQA 1X31C 5BYSA 3HMJG 2BM0A 1HBMB 4DPXA 1S0MA 1JIHA 2IBKA 5LMUF 1IKVA 4AQYF 4PEOA 2HQFA 1SVDA 1VK8A 4MAKA 3SV3A 4BS2A 3HLUA 1LK7A 1BQMB 2BEFA 3WIUA 3UPFA 1VR6A 1M5SA 4PWDB 2GHPA 1S0OA 2B5JB 2CPJA 4WF9Q 4X62J 3LP0B 2HK3A 5HATA 1QLNA 2QMXA 1S6PA 2OUGA 4B3MF 2ZH7A 4I1TA 5HVFA 1NSKL 1F1BB 1O51A 1VIXA 3VWSA 1X7VA 4MIWA 4D3GA 4WIIA 2KT2A 1KSPA 2GAHC 5KG3A 2Y1JA 3UQSA 2I1RA 2IRXA 4OZNA 4A8OA 5LMNJ 4ID5A 2YXLA 3MCOA 2KFZA 2ZHBA 1HA1A 4AUKA 1D9DA 5B0AA 4C6AA 4C97A 1RA6A 1UTAA 3NNAA 1OY9A 2M2BA 2HFUA 5EWEA 2EFQA 1UZHA 3RB0A 2LXIA 2W8KA 2N7CA 1N5VA 4R5PB 1Q79A 5M2UA 1NCLA 1GXLA 3HDSA 3TW0A 2MZSA 1VISA 4CT8A 2ZH4A 4NEZA 4KYZA 3R6GB 2ZH8A 3V4IB 3OR2B 5GAGU 4ZPTR 3ENAA 4JB8B 1SJQA 1OJ4A 2IA0A 2JSXA 3DLJA 4ZITA 1F5BA 4WE1B 1S9GB 4UY85 4UZBA 3OL6A 1PGZA 3D2WA 2ZEJA 3MECA 4AL7A 3IGVA 3HHLB 2LDIA 3JAMU 4NA2A 1JLFB 2V2VA 3VAHA 4NA1A 1IKXA 2AZ3A 1PJ6A 4WFAQ 3EVMA 2V2ZA 1VRTA 4QIEA 1VBYA 3JTNA 2HS3A 2MSTA 1VQ8S 1RHRB 3PTWA 3X1LB 3DOLB 5IM0A 1YI2S 2QT7A 1S1XB 2XZDB 1WHXA 2CQ4A 1QAIA 1Y0HA 1DHMA 3TAPA 1LK5A 4NXNF 3MMBB 3C6TB 2B3TB 3GJSB 2BQ3A 4CM0A 2PEHA 1RTIA 4ATNA 3PW2A 1YSJA 3ZTOA 4DX7A 2HK2A 1LWFB 2GX8A 1S72S 1YRXA 1YDLA 2L9NA 1YITS 4DL6A 1SH0A 4KY3A 2FJXA 2YWKA 1U47A 1NJWA 3MPWA 3DXSX 8ATCB 2CWXA 1WELA 4WFYA 3WHIA 2QSWA 2DY9A 4ECXA 1X9MA 4X84A 2ATCB 3I9ZA 1IKWB 1SCJB 4KGMA 3DMJA 1IN0A 2M70A 2D3UA 2OGUA 3QGIA 3ILLA 3M6XA 1HMVA 5EWFA 1RAIB 4A46A 2MKKA 5CXTA 2R2SA 3B82A 1E6VA 5HMWA 4DF4A 4NASA 3MUTP 3MI7X 3BH7B 4PAAA 1WTBA 2DPJA 3I9V9 2KN4A 2X3GA 3LP1A 4LIWA 3MD3A 1TUGB 1O0PA 1HNWJ 1FO1A 1WG5A 3GJRB 3US5A 2LEPA 1IXKA 4OYAA 3OQ2A 2DCLA 5A6PA 3Q8RB 4M5GA 2G1HA 4IR1A 4AL5A 5LSRA 1ACMB 2ROEA 2FJAB 2F8EX 4ERDA 1FA0A 1NDPA 1LWEA 4A8YA 3U27A 1F9FA 2JOQA 3LWMA 4DL0C 1RAAB 3HHEA 4YR2A 3DOMB 1SJFA 4A8SA 4OYOA 4OQJA 1HNVB 2W25A 5T41A 4PXCA 4LF9F 2CXEA 3G2XA 5FDLB 1JB0C 4N41A 3UR3C 4DL2A 1D09B 2ZZMA 1FKPA 3R9LA 2EWHA 2FZCB 3UDLA 4RNNA 3PXGa 2HKEA 3CMQA 4F0MA 2E29A 3CWJA 4YN3B 4QBUA 5DQHA 2D74B 3C66A 5BJRA 3O2IA 3O5TB 4P10A 1C1CA 4USUA 2CJKA 3C14B 4ALZA 2QA4S 5J2PB 4IFYB 4PQAA 1IBLJ 4P9SA 1URRA 2ZZNA 2DGVA 2YBVA 3ETOA 3MM6A 4LF1A 5DDOC 4L73A 5AJ3J 2ALYB 4ECSA 2PT0A 3OTCA 1UW4A 4BC7A 1P27B 1LEOA 2KVQE 2UU9F 1T3NA 4YQWA 1Q5YA 4LF4F 1QVFR 4NZ7A 2KT3A 2W24A 3M1VA 2RS2A 2XMAA 3KNAA 3A13A 2RQMA 1EJ7L 1YK9A 5GVQA 3BO3A 1BD6A 1T9WA 2XM3A 4H4OA 4M5HA 2BE2A 5DM7Q 2V8VA 1XERA 2LA4A 4Y0FA 4I2QB 4F26A 2CNLB 4KFBA 2RHQB 3D0HE 3Q24A 1F5AA 2E9RX 2VQEJ 1N54B 2C3PA 4PG8A 3MAQA 1VIOA 2WVCA 3OVSA 3IG1A 3PHEA 2OAUA 2XTJP 4KHPJ 2MY8A 2ZD1B 3G96A 1WI8A 1GQEA 3DLGA 2DYAA 2LDYA 2E5IA 3CCUS 2NR0A 4DPOA 3IP0A 1F2GA 2XCAA 5A2QU 4GKKF 3IN5A 3MOJB 1AZSA 1CJVA 2PMWA 3QWPA 4ZVGA 1NKCA 1HQ2A 1JXLA 2GVZA 2GW8A 5KFUA 2HNYA 3MXHP 4W98A 3ELHA 4ECYA 4ZCLA 3M32B 4RL1A 1CJKA 3KG1A 3Q86A 2HLUA 3AAWB 4RO0A 2CPZA 1WKKA 1VC5A 3L7OA 4OI4A 4JI0J 1M1KT 2VODA 1RABB 2CQHA 4ELTA 4RZRA 1X4FA 5KFYA 2VV5A 1Y9OA 2OMLA 2DGWA 1MMLA 2XZTB 3PJXA 3H7HB 3QZ7A 1NHUA 3DLKB 2E1PA 1YIJS 2AW0A 1CEZA 3B8HA 3CJKA 4KHRA 1NXIA 4F4KA 2AJ2A 2R2RA 3DRRA 2ZOMA 5A8KB 1IR0A 1BGXT 3OR1A 2J7UA 4LFAF 4JV0A 4FPIA 2FC9A 4LJMA 2KG1A 1NDLA 4QOTA 2FB0A 1YBAA 2E1MC 1NK7A 2Q79A 4OHVA 2ACMA 2JC1A 1W2BR 4PXEA 1KNZA 3ZZPA 1M1HA 2CQGA 3M8WA 4PG6A 1VMBA 5L1KA 4YEAA 4PWWA 3EDRB 3ZZUA 5KFZA 4KGKA 5ETNA 1Y3JA 2J0QD 1HIYA 3M8PA 4RKUC 4Y2IA 1YRTA 1NUEA 4DR4F 4RBUA 2C1EB 4IH5A 2QEXS 7FD1A 1KOOA 2N7YA 2V8DA 2OH2A 4ECZA 3P96A 1B70B 3HHDA 4OYWA 2D41A 2KXFA 1N34J 2R2UA 1JNZB 2MKJA 1SL2A 2BQUA 1WC0A 1QD1A 4OJGA 4CLZA 3M8ZA 3FFIA 4NYPA 3K7RA 3I0RA 5K5MA 1U26A 1J5OA 4CZCA 3KUHA 2OPRB 3AFGA 3QAUA 2BW2A 2HRUA 5IT0A 5KT3A 4YDDB 3BR8A 1ZTTA 2B7BB 2ZJRQ 3IR7B 3W66A 3AQPA 3W2VB 2OD6A 2EK1A 4J9LA 2OKQA 1TL7B 4RW4B 1NH7A 4Y3CA 3A3NB 2RILA 2DEJA 3AD9C 4WYLA 3QRRA 2L48A 3K5PA 4O3PA 2R7OA 4FXDA 1JKHA 3V5RA 4M5NA 3SI8A 2W9CB 3MCSA 3PYFA 2WVBA 3G82B 4N56A 4F3QA 1PJ7A 1UFLA 3D5MA 5G4DA 4ELVA 4AFFA 1RKIA 4DSKA 4JYAF 3H4DA 4DV1F 3W9HA 5C7PA 1Z4UA 3VAKA 1S1VB 4O3OA 1T03A 2MB0B 2ZBIA 3HULA 1OY6A 3TO8A 4RU2A 2D3O1 3A12A 3LPEA 3V6HA 4MIAA 1FNXH 3KK2B 3M2VB 3R5AA 4LREA 3TNVA 5A8WB 3CO9A 3L4BC 1NSAA 2XS5A 3ZXWA 4USVA 2UUBJ 1N5YB 5D78A 1F2HA 5CAAA 5THWA 3TZWA 3H2LA 3H5XA 3PNIA 4F3MA 1S0NA 1TFYA 1O6XA 3HP6A 4C7QA 3THPA 3RZAA 2V4QA 4JP8A 1Q16B 5KOXA 1EHWA 2LQ8A 2BM1A 2K3IA 1RSCA 4DQRA 4RW7A 1RACB 1RWMB 5H9EJ 2EEYA 2IVFB 3OL8A 1OWXA 3ZTRA 2J0XA 2K7KA 2NSCA 1CBKA 4HEA9 1Q5VA 4YMEA 2UXDF 2IDEA 4IOAQ 1HFEL 1X9WA 1QVGR 2RJZA 4N8NA 1H6KX 2BJ7A 3BO2A 1E6YA 1FDNA 1UPPA 1T02A 4URQU 4RNHA 1U02A 5ETKA 2DR9A 5FJ4A 3JSMA 1K9MT 4Y2AA 4J9PA 5DG7A 4ZPCA 1BE4A 3BPSP 1X5PA 1IUJA 3DRSA 5E5NA 1JWWA 2WVEA 5KFOA 3EGZA 3UCGA 5CABA 1UW9A 4ZCKA 3HSDA 2HHSA 2XWYA 1UL3A 3BN4A 1QAJA 4TLRA 3RUBL 1S7IA 5LSLA 3QT7A 1WWHA 5J2MA 1XNRF 2EXUA 1ROFA 3T9NA 2NXJA 5K20B 2HWHA 1TZ0A 2BRLA 4ENOA 3PO5A 2CJYB 4RUCA 5GMDA 2WVFA 3IRXA 4K4SA 3Q8PB 1RWXB 3CUNA 2YKNA 1KKHA 2BJDA 2B4VA 4RUHA 4X4RA 4DR2F 1H38A 2G4BA 5DZ7A 2GHWA 1VQMS 3MAAA 3OJUA 3NY0A 3CJ4A 1KQSR 1AT1B 4P7VA 1SIZA 1B64A 5L38A 2QL7B 2QX0A 4ZVEA 1IQTA 3W7BA 1J2VA 1SC6A 4ZKAA 2HBRB 3SFUA 5EX0A 3UO0A 1KN6A 3I4HX 3SSRA 4B3OA 1UJ6A 2AMCB 3BR9A 4CT9A 4RW6B 4RW8A 2M8DB 4OV1A 2CVEA 3CNQP 5IFMA 4CYUA 1UP1A 2K1RA 3VAFA 4ZVSB 5KFHA 1TKTB 1S4EA 5LMUJ 2QIFA 2H4WB 2EFOA 4OHXA 5K14B 3AJ1A 3OVAA 4CRJA 3FSIA 1PKUA 4YR3A 1NLKL 3UDVA 3CC4S 2FJVA 4J9KA 1QAYA 3MMCB 4DL4A 3DN9A 1U1LA 5E3PA 2CPFA 3GR1A 1XIQA 3NLCA 3BQ0A 1SPBP 3N6MA 4LR9A 2W2OP 4B3MJ 4DV2F 5CD4H 4WU2A 1B3TA 3MMAA 1YTYA 4KPCA 3TYTA 2XCPA 1FE0A 3MCMA 2BXJA 3MEEB 2QV6A 3OBIA 2ABYA 4ED7A 3NBPA 2B9EA 3RB3A 4Z37A 3DGPB 4CLSA 3K0JA 3VAMA 2RIJA 4KQZA 3G8QA 4X4OA 2W9BA 3ZZYA 1GNKA 4TY8B 1UEUA 1VQ4S 2R42A 3BGUA 1BLUA 4P2FA 3OUYA 5AT1B 2EBEA 4L3NA 1YKWA 5AXNA 3CCRS 1WHVA 1T05A 2HS4A 2HHXA 2RKIA 3U1MA 4YHHJ 2DJWA 1C2PA 3CMAS 2C3OA 1WC4A 3PRVA 3ZTQA 1I6JA 2HHUA 3TI0A 3PJ9A 1U4BA 2FGOA 5DLGA 1IQZA 2WONA 1PSDA 1NK4A 1YJRA 5J1NA 3NMAA 3ENQA 3HZGA 4LVNP 5D8HB 3VZIA 5HMZA 2BJ1A 3BV8A 1WI6A 3G8SA 1S1WB 1HQUA 1TQLA 3TA2A 3LQVA 4X4VA 4ZCIA 3HFKA 2UUTA 5KFJA 2DCUB 4P72A 3LAKA 1HARA 1OSCA 3MGJA 2Y1IA 1QUPA 4TYAA 3DDKA 2HWIA 2JLGA 2AHOB 4G1QA 3RB4A 1FEHA 2KT5A 1TFWA 4FF3A 4N77A 5ETLA 1S6QA 4X66F 3M9MB 3LGNA 1HBOB 4NXNJ 2XO7A 1VK3A 5D4NA 3IWNC 1PAUB 2V9KA 1HI1A 4KO0A 4Y65A 3EPIA 1WORA 5IM0B 4C4WA 5KAKA 2CJBA 4WP8A 4DS4A 4UOHA 3MEGB 1UVKA 2HQGA 3OFHA 3DDNA 2EFVA 3GILA 2HHQA 2HGNA 3F56A 1S48A 2EBGA 2GA7A 2XHCA 4QPXA 1NZAA 4LF6F 3QJJA 1KHWA 2AGPA 3BGFA 1RT3B 1TP7A 4GC6A 2BQRA 4B3SJ 3HJFA 3KKFA 4CLTA 1FTCA 3HK2A 1VJQA 3NXZA 3ZNJ1 4AXIA 2OPSB 3K59A 2C3MA 1XBWA 2OO4A 3TUPA 2HIQA 3M2RB 4NX9A 4MYTA 3CJQA 1MWQA 3RW6A 1W26A 1X4BA 4ZMMA 2O66A 5CD4A 5D3GB 3F0NA 1IM4A 5J2NB 1KWMA 1BQNA 2GIQA 2XQCA 1D9FA 4LQ3A 3HFVA 2Z2YB 1E6VB 1RP5A 3J80Y 3ZTSA 3D1QA 2RE1A 5CYQA 1YJ9S 1Y5IB 2VD3A 3AH6A 2VJVA 2U1AA 4FDFA 4UUWA 2P2CB 2ZH5A 4EYHB 4HTIA 4JI1J 2IRYA 2PEBA 4UTGA 5AE1A 2F4VF 4CO1A 1OSDA 5GAEU 3J81Y 2E5LF 3FEXB 2Z8QA 3V6KA 1YBTA 2QFIA 4Y34A 4LF9J 4J37A 4D3HA 2KJWA 2QGFB 4J91A 3U02A 2SXLA 3L95X 5D4LA 1XMOF 4RUBA 3QIDA 4LRDA 4ZA1A 3W65A 4C8MA 4XDDA 1QY7A 1ZAWA 4ER8A 2FTRA 3K17A 1BQMA 1M5KC 4PWDA 4NLUA 3CD5A 2B5JA 5T7LB 3EPGA 1P8GA 3LP0A 1TV6B 1TUVA 1WHWA 2XNRA 5D15A 2RRBA 1RAOA 3ET6B 2HVHA 5LJ5Y 2L3MA 1U1MA 2CFXA 3R97A 1TMJA 3TVZA 3CC2S 1NPRA 2FPHX 3GTYX 1CS4B 1NHKL 3CSKA 4KTQA 2MLZA 4USKA 3WX4A 4WZQA 1N52B 4YP3A 3GYNA 1JK9B 2LEBA 4F4YA 3QQCD 4OX9F 5E0OA 3M6UA 2GQ2A 2V6AA 4CO0A 4NXMF 4KH1B 1I3OB 1HWJA 2CPDA 5FIIA 1N5TA 3DM2B 3KK1B 3G8TA 2D9OA 4TNOA 3WC0A 3HT3A 3J7A1 2OI2A 3UD4P 2CJ9A 3G9CA 4OYZA 5HBMB 5JMNA 3ZTPA 2UU9J 1TVRB 3HF5A 2O01C 3IR6B 4USWA 4Q2LA 1ICEB 1LWCB 4RBTA 3Q89A 4LF4J 2VKZG 2KU7A 3MM8B 5GMEA 3LWLA 2DGTA 3M6WA 5ETVA 2AYBA 5DDRC 5KFKA 3FBBA 2QMWA 2HFOA 1IJFB 2Z57B 3V4IA 3OR2A 1U1KA 2WSEC 1FRLA 1NJXA 1CSJA 2KHDA 3AXMA 4IH7A 4DCPB 2Q43A 1HBNB 4WE1A 1S9GA 3TQEA 1RA7A 1S7HA 5DM6Q 4A8WA 3TWZA 3HVTB 1S10A 2XI2A 5KT7A 2JX2A 1G1XA 3EXCX 1D8YA 2BX6A 3GCXP 1RHJB 4CO2A 3HHLA 3EMTA 4NZ0A 1JLFA 2B0GA 1HI8A 3G4SS 3MUMP 2XY7A 1ZM2A 1M5VC 2XMKA 1EETB 3H2UB 5HROB 1HNXF 2Q6CA 4F36A 4FYYB 3MR2A 4ZLLA 3W2WA 1PIEA 4AD6A 3DOLA 3I5AA 3P8BB 1S1XA 4GKKJ 1X8DA 5I3PA 4G65A 4EWTA 3DI6B 3MMBA 3C6TA 3CCTA 5E33A 5KTQA 1TL5A 1CJVB 4RW9B 3ILJA 4HT7A 2C2ZB 1LWFA 1F0XA 3DU5A 4P71A 2ILYA 2JZ5A 5E3AA 2EG2A 4J9QA 1SBRA 1WJ9A 1U24A 4I67A 1HPZB 1O5JA 3K89A 4UOCA 5GMKa 1U0HB 1TKXB 2RH3A 1NH8A 3DNCA 3JQMA 2JJ4D 3O6QA 3OXFA 1BMQB 1S1TB 1NK9A 3N9UC 1IKWA 5F8MA 3N5BA 1N48A 2FLPA 3J80U 2AEMA 3DLHA 1PG5B 1UCNA 3QJPA 2WW4A 4JBCA 5KFEA 2BE7D 1M5OC 1JLGB 3CCWA 1BQXA 2UUAF 1RKJA 3NMRA 5DDQC 1VOMA 1UVJA 3PW7A 5E3RA 3K58A 3LP2B 3EM1A 5T14A 3CXCR 2KFYA 3IR5B 4C8YA 1NK8A 4LFCF 5D0EA 3JSYA 5D0GA 2YWGA 3LGHA 1C1BB 4DR4J 5AXKA 2LEAA 2ZH6A 2DD8S 4M5KA 3FCVA 1HNVA 3M8PB 3VCDA 1R8CA 4Q0BB 3T5JA 5FDLA 3OJSA 2AGQA 4IO9Q 1NU4A 3OFFA 2Z2LA 3RAXA 3JSBA 3R5CA 4HLBA 2ZOFA 4QCLA 1H2TZ 4RUAA 1P1TA 2IY5B 4A48A 5A8RB 5KFNA 1L3KA 2NYHA 3GCWP 2RU3A 2B6AB 4P6QA 2LECA 3EUNA 3EYZA 1SH3A 3P45B 1NK0A 2Y0BB 1N8RT 3MMJA 2NS1B 4X4UA 3HSZA 2M0GB 3ZC4A 2FJDB 3TVYA 1HYSB 5J2PA 2DH8A 2ZJPQ 1S57A 2AJFE 2Y1RI 4IFYA 1WOPA 3BBCA 4DPYA 1EZZB 1RCXB 1X4HA 2FHJA 2WK4A 3LAMA 3NWGA 4FYVB 4JYAJ 2NLWA 3QPIA 1VBKA 3BYPA 4K4VA 3LANA 4J5OA 4NRUA 4Z7YA 3H8YA 4ZHRB 3GWCA 1F9HA 3MHYA 1FERA 4ZIWA 1WEZA 1YZ6A 2R4FA 3D0GE 2PSZA 4Z2XA 1NBEB 3D67A 1SJ3P 4WBFA 2A0FB 2GV1A 5LT5A 2PFDA 1C0TA 1U09A 1QM9A 1N33F 2PDAA 3VAGA 2WVDA 4WXOA 3T41A 5DQGA 3MZIA 4NLVA 3I0SB 4JI7F 4I2QA 5D77A 1N6QB 2GJFA 1MSWD 2XGPA 3TA0A 3OPKA 3D4JA 1KC8T 2BA9A 3BQ1A 2LQ9A 3M9NB 4ZVOB 2HRYA 5DG8A 3TZXA 4KKOB 3CEDA 3GIMA 3AOCA 2JNJA 1FKOB 4ZN1A 5D6GA 3MPUB 2ZD1A 4F50A 4NA3A 1HHSA 2P8IA 3CDUA 3U1NA 3OTOF 3HHLD 3B4MA 5L1JA 4CTAB 1XMBA 1KLMB 1TR0A 1NB2A 1U48A 4A8FA 3IC1A 4RW7B 3BGLA 3MDFA 3PEHA 4DPWA 4XPCA 1KS2A 2QLXA 2UXDJ 2J0SD 3M8QB 2DGOA 5GAEI 4FXVA 5HL7Q 1N36F 1HW9A 4ZDNA 1V5VA 2RQCA 3R6LB 1RUSA 2DXEA 4LSLB 3DXBA 2ZC3A 3M9OB 4W90B 1HHQA 1K0VA 3EGWB 1VGYA 2WBMA 2YKAA 5L46A 5B0DA 4KPYA 1RWKB 3CF5Q 3DLKA 4ED0A 4LF5J 3NKYA 1I1GA 2LYVA 3T9ZA 3AY0A 4JI8F 3NCPA 3DRYA 5DGAA 2HMIB 4NCGB 1TUWA 4EO6A 3M30B 1HD0A 4OJHA 1ITPA 5A8KA 1NJIT 1MWZA 1VQLS 1Q1KA 1VS3A 1XNRJ 4WPAA 2HFSA 2VJUA 2XNQA 4HH0A 2OP5A 1Y3KA 1NDKA 2GJIA 2KO1A 2I5JB 2DISA 2GMLA 3SCLE 8AT1B 4YB1P 1RBAA 3BGRB 3MM9B 4DR2J 2G13A 4DR7J 3W5YA 1FD2A 1ZM4A 2UUCF 4F4ZA 4O3NA 2IYIA 2HAIA 5D4PA 2MLYA 1MN7A 1Q8LA 2ZOGA 3AJ2A 1UA1A 4FXWA 4I68A 2LCWA 5KFVA 3H59A 1V5IB 4B3TF 1SJRA 3H98A 2HBZB 2M9KA 4NLPA 4UW2A 5K8MA 2V4JB 2WB1D 3WX8A 2GO8A 2R7QA 1UJ4A 2QA2A 3RB6A 2DIVA 2FGCA 1J5EF 3GYXB 1VQOS 2H3EB 2OPRA 2CYYA 2APOA 4HHHA 3GP9A 4XPEA 4R25A 2RNEA 1SC4B 4RR5A 2A18A 2JVOA 2J6UA 4A4JA 2DNQA 2KHCA 3W2VA 1Y7PA 3TEGA 4PABA 4TQRA 1SQFA 3UN5A 4IFVB 1TL7A 4RW4A 2W2PP 2LXFA 4DX5A 2VU5A 4CDIA 3HD2A 5K8NA 3NP5A 4K59A 1JQGA 4U8YA 1FNMA 5M2PA 4TXSA 4X64F 4AYBD 3THTA 2W9CA 4ZP6A 3PCOB 2DNOA 2B43A 3G82A 2HZVA 3EJMA 3VGVA 4DV2J 3BDEA 1VQSA 1JLAB 4NI2B 4JOUA 1FEEA 1S6UA 3TQ1A 4YB6A 5KG2A 4CIOA 2XLKA 3SSSA 1EQMA 2MKHA 3JS9A 1S1VA 3PJWA 2FHJD 3PM9A 2FQQB 2BMBA 5ETMA 3FK4A 5F9NA 2OSQA 1RAEB 1T95A 3TP2A 2H51B 1RBOB 1L5UA 3KLGA 1WSVA 4N8OA 4OIXA 3Q22A 2Z0GA 4EK2A 4ED3A 3NAHA 3KK2A 5HP1B 1HW8A 2FLOA 3T6JA 3M2VA 4OI1A 4ES3A 4NMXA 2FC8A 2ZBRA 4G3IA 2R7RA 1IVZA 2FVRA 1I94F 5A8WA 4NLOA 4RJVA 1SH2A 4F02A 5HAOA 3ONQA 3T1YF 2I6WA 1N5YA 2QE5A 1PYSB 4F3OA 4QW9A 2X1AA 4P7TA 4JV5F 5GADI 3OT9A 1EAYC 3TR5A 3IBWA 4URSA 1NM2A 2MHEA 2V34A 4L74A 5JUMA 3GYGA 3HX9A 1FDBA 2Q66A 3T5HA 1N4LA 1R27B 4OZ0A 3K57A 1M5HA 3LH2S 5MLCV 3PR4A 2AQ4A 4QR2A 1UWBA 3A8IA 3QMQA 4HL9A 3CCZA 1VBZA 3MTKA 1CVJA 1SV5B 4F4AA 3R5DA 2E7WA 1W25A 4EZ6A 1RU1A 1N56A 3ISNC 3OSNA 1B4SA 3Q8SB 4YB5A 2IJNA 4IO1A 3OW2R 4XTTA 3KNGA 1WEXA 4M5DB 3PIOQ 1H7XA 1HNIB 3CVKA 4JI2F 3DHXA 4FS2A 2PGCA 4PRFA 2EFNA 2ZC4A 3FGVA 4LSZB 4DL5A 2VBXA 4U9RA 1KVJA 1G3OA 4LF6J 2ZBQA 4PZVA 4DV3F 3W62A 2CJAA 1IBKF 1KLNA 2HNZB 2CZ4A 4K4YA 3UVJB 4EBDA 1JJHA 2IJFA 3IO1A 3QGPA 3LF0A 4O0IA 1FFGB 1RK8A 4ICLB 2W01A 2R8HA 4OX6A 1N32F 4QZVB 4YUDA 3VQSA 4JV1A 4KC5A 5KG5A 1G6BA 2ZH2A 4OLOA 4MYUA 3GV7B 1R0BG 2DO4A 1AYEA 5LM7E 3CIZA 2UXCF 4BDPA 3Q2TC 2C2OB 2YH0A 1ZPWX 4Q2MA 3R5GA 3N6LA 3QFWA 3DRXA 2VFUA 4DN0A 1C0UB 2CAJA 5ETTA 1VQ6S 2F65A 4DBQA 1MU2B 4CO3A 2YWFA 4IR9A 4KHMA 4MK8A 3R27A 2F4VJ 3ZO7A 2LU2A 4RW6A 2E5LJ 3GIIA 1S59A 1ZA1B 4ILLA 1TKTA 5K14A 3LW5C 2KFNA 3TEHB 2QLBB 2GGPB 1T9YA 4ZOSA 1MLAA 2AV5A 3TVKA 4PYAA 4OV6A 4O3RA 3C8YA 4IOCQ 4R8UB 3H0PA 2R7VA 3KHLA 1V3ZA 3MMCA 2DR8A 1T9VA 2YWEA 3EICA 3TJ9A 2AX1A 1WHYA 4OYBA 4K4XA 2EPIA 1B0PA 3RRKA 1XTZA 3OHBA 3GFYA 3IWLA 1D0EA 2VKRA 4IG0B 4S0MA 1DTQB 2VB6A 2NREA 2C3UA 3GE9A 1VJWA 2OPPB 1RADB 3VGSA 3Q23A 3MEEA 4I6WA 2IFXA 4EU0A 4X4NA 1AROP 2G2YA 3FQLA 2M52A 4OX9J 3DGPA 4NXMJ 1TK5A 3R3TA 4TY8A 2HSEB 4ZPDA 4KBIA 3PIPQ 2H4YB 1P9QC 2A2CA 2C2MB 1RT4B 3O3LA 4CNYA 1P1LA 3OVBA 1REGX 2HRTA 1IWGA 1K1QA 2W8LA 1WSRA 4DF8A 3AODA 3IM9A 1JXEA 5LXYA 3H5SA 1B99A 2QA1A 1HLWA 2IC3B 4IKAA 3G6XA 4P73A 1RT7B 2MMYA 3GV8B 1FWLA 5B0CA 2OFGX 3GZ7A 2XMMA 4H4KC 4ANEA 4DV0F 3L9ZA 3TX8A 1S1WA 2HLTA 1CPZA 3BPDA 3HO1A 1WTFA 2KVIA 2X1BA 5J1EB 4I6YA 1V6HA 4B9SA 4PG4A 2FJBB 4K4UA 3W64A 2OEKA 1HNXJ 4F67A 3IRWP 3NGDA 2D3OR 2YKOA 3HM9A 1RTJB 2CQCA 1SJ4P 3F73A 4TY9A 4USIA 3VAJA 2I0XA 3DFEA 1G4CA 4OYIA 5KFFA 3TANA 3W2WB 1HBOA 3W3SA 2F8MA 1LWXA 3KWMA 3IA0A 4I6AA 2XS7A 2PA3A 3LOUA 5HJXA 3L3CA 2QLWA 3PV8A 2HHTA 2G0CA 3MEGA 3K5LA 2K7JA 2B8PA 3IS9A 4MK7A 2E66A 3ADAC 1FJCA 2B4UA 3V6DB 4FN5A 1ZZNA 4DX6A 1ZYQA 4O0NA 2GQQA 5B09A 1IR2A 1RT3A 1VHFA 5JVGQ 2VG7B 2OFHX 1W7WA 1NDCA 2HHPA 2BKNA 5A2QY 3D9BA 4K8RA 2QG9B 2OPSA 1CJTB 2IVYA 4ED2A 3M2RA 1RB0A 4P2MA 1S9EB 7AT1B 5A6WA 3LALA 1EARA 1FRJA 3DC2A 3RG6A 3HVWA 4KRWA 5FLXU 2D69A 5D3GA 5IC6B 2UUAJ 1H0HB 2BRKA 3UW1A 5L9XA 2DPIA 5J2NA 3LO3A 3W8PA 3ILIA 2W2MP 4IQMA 4I2PB 5BXIA 3PW5A 2RF2B 4LSNB 3NNHA 2JFDA 3W9JA 5AE3A 1UVIA 3NGTA 2HFVA 3FJ2A 1RQ0A 1WDTA 2VG6B 3KLEB 1FFSB 1UWAA 2QA4G 4KV8B 2FY1A 3VZHA 4LF2A 1OPZA 3RR7A 4LFCJ 5DJBA 2ZVSA 1AW0A 1DJ0A 4DI6A 2HVDA 3S6EA 3ZZRA 1YJWS 1DFDA 1ZBTA 1OPIA 1XJWB 3KHRA 2DGXA 3AJDA 3UNYA 4C98A 3JQKA 2E1AA 2DRBA 5E3QA 4CO4A 2V8HA 1YQHA 1UFKA 3DU6A 4DN9A 3G6ES 1GK8A 2VONA 2E5HA 2RMLA 2VBYA 1ZS6A 5JXSA 1GTHA 2CJXB 2MZQA 2HNDB 2JEGA 4GVBB 4OLPA 5IT9U 3JTPA 5I3UB 3K5NA 5AJ3F 4DLGA 3POTB 3NG8A 1IKYB 4OMFG 2YNHB 1R43A 4Y2KA 1A7GE 4ZCMA 5T7LA 1LW0B 2PMZD 2AIRB 5F3ZA 1TV6A 4ZP8A 4DUTA 4J90A 2BJ8A 3ET6A 3GFXA 3S01A 1G2EA 2EG1A 3EVOA 2YPYA 4WFXA 3I6PA 1CS4A 2J6SA 2OTLS 2ZITA 3PEJA 3NS5A 4OI3A 4HDHA 4KJIA 3QGGA 3IBFB 3P5TL 2A6OA 4WWSA 2ZM6F 1BXNA 4YOEA 3I82A 1JMTA 4ZPWR 4WU3A 2VG5B 3BF4A 3DM2A 3KK1A 4C3LA 1EKRA 3B6BA 5IC4B 5HBMA 1RLDA 2RU9A 4K4WA 1AFIA 1TVRA 3ICLA 2AEJA 4FBTA 2BACA 2GAGC 5DGBA 2G2ZA 1LWCA 4QWEA 4HI1A 4KHPF 3FBEA 3MM8A 4QPTA 4DV7F 1WUUA 4DFJA 4DJBA 2HBQB 4OYPA 4NYZA 2K3KA 1A6LA 5GAHI 2NYIA 5ETSA 1N33J 1GX6A 1A0OB 3S8SA 2WBRA 5BR8F 2LMIA 3BBFA 2ALZA 1HBNA 4DQPA 2V68A 3HVTA 5HJYA 1C0TB 3FUYA 2R8KA 3Q8QB 4O23A 4WTOB 1T9UA 3DHWC 2HHWA 1N5SA 4CH0S 2IM3A 2V2QA 2ZZTA 3QZ8A 4LF8F 3ITHB 4WKRA 1EETA 3NOCA 4Q8EA 3FVYA 3B54A 4HYKA 5HROA 2VOOA 4MKAA 3SDEA 4B9NA 4X65F 3OTOJ 1HD1A 4J7CA 3SSQA 3H40A 4C9DA 3SQGB 2IAJB 2ZNYA 4X4QA 2DXFA 4QYZK 2BZ2A 1T11A 4LFBF 1LNQA 4HHJA 2ZWPA 4TN2A 4UQGA 3DI6A 1K0TA 1O8BA 6FD1A 1XWLA 2FLLA 1PC4A 2NZCA 2A1BA 3PW4A 2V67A 4MKYA 1PCAA 1S97A 2JEFA 1N36J 3RBZA 5DETA 5HQLA 4RW9A 2VFTA 3BDPA 3I5CA 2IM0A 3AHPA 2BR0A 4FVCA 3FSXA 3BH6B 3Q0AA 3DLEB 3BN7A 4C3MA 1TL1B 2R9LA 2PD1A 3QO9B 1HPZA 2YX1A 2UV8G 3M4XA 3VR1A 3R7NB 1U0HA 2XSJB 3BSOA 1FF2A 1TKXA 3TRGA 2BUNA 5HMXA 4DR5F 4HDGA 2PIIA 1CC7A 2Y3YA 3MR6A 5L39A 3QFHA 1S1TA 2FVCA 5HLFA 4K4ZA 2W4DA 4N7TA 4JI8J 4YS2A 2XMWA 5K8OA 3KLHA 4UUXA 3N6NA 4QWDA 2I9SA 5KFWA 1JLGA 2GC8A 3UDEA 2YY3A 3UN2A 2RDIA 2KRBA 1CULB 1OQ3A 4ID8A 4BWJA 4WTYA 2VH7A 5C25B 3CJ8A 1N34F 5A76A 2EKYA 3DYAA 1WD6A 2WCXA 4MJKA 2E9ZA 3RAMA 3GB0A 1VC0A 1H73A 3FKBA 1DTTB 3LP2A 3HKWA 5IV4A 3C16B 2MYFA 3ZZOA 2G2OA 1XNQF 1U45A 4IQXA 3EVWA 1WC5A 2ZBCA 4HKQA 2UUCJ 4C48A 1C1BA 3T1AA 5LSOA 2A10A 4QWCA 3MM7A 4K2JA 3AD7C 1U0SA 1QTNB 4NCAA 1X60A 4MMOA 2OLWA 2FJWA 3E01B 4E98A 4GVLA 2ADBA 5KG7A 5KFLA 1WF0A 4B3TJ 4LT6A 3FSYA 3HVRA 4Q0BA 3PY8A 2CQDA 3J7YU 5KT4A 2QZ8A 1FJEB 2K8GA 1FXLA 1EB0A 1T8EA 4DUYF 5A8RA 4TLQA 1J5EJ 1UEVA 5ETQA 3T5KA 4Q45A 2VPYB 4LBHA 2CNKB 4ZLPA 5C24A 5KFDA 2B6AA 4HHUA 3QJLA 4I7FB 2O1PA 3D6HB 4ANCA 4ZLNA 3OD2A 3V2UC 1V9OA 4HACB 3UDCA 3Q83A 4G1PA 1HI0P 3MF5A 3M7VA 2MQQA 3GR0A 1HYSA 2IVMA 3HVAA 1MMDA 5KFSA 3J7ZT 1SUQB 1Z2LA 4HVZA 1RYRA 1KQFB 1PILA 5IZHA 2XB2D 3DOKB 4ES2A 1XR5A 5F8HA 2P9CA 1FTRA 3CCES 2AWZA 2UUBF 2J8AA 1Q78A 4PKDB 3B4DA 2V2KA 1R6YA 2R7UA 2WAQD 4LF7F 4ZHRA 5BYQA 3EZOA 3DRPB 2AGOA 3PYEA 2ASDA 5F9LA 3K5OA 1F5CA 1TK0A 2JWNA 2QO3A 3GG1A 2VPWB 5B7WA 5ETPA 1RWWB 1HHTP 4JI6F 4DV5F 4C8ZA 2K06A 4JI4F 2J7KA 3NS7B 3MPDA 2P6SA 4EEYA 2LFVA 3KLGB 1Q95G 4FZVA 3MWBA 1I94J 5HVGA 3I0SA 3BKFA 2E1RA 3MUVP 4DFPA 1N6QA 2L9DA 4M63A 1EP4B 1SC3B 3T1YJ 2VA3A 1U6BA 1U1NA 3HI9A 2V8GA 4A8KA 1FKAF 2VF3A 1RAFB 2ROPA 4KKOA 1RTDB 4WP3A 4FPRA 2E9TA 1FKOA 4JV5J 4EI2A 4UF4A 3MPVA 5F8GA 1X5TA 1X5SA 4ZP9A 3R7BB 4DL3A 4KIAA 4USJC 2J7WA 4LR7A 1JLBB 1WACA 2AEFA 4CTAA 4MTPA 2GQCA 5LOQA 1KLMA 1R6VA 2HFNA 1XN9A 2C2DA 2FHKA 2Z30B 2AYEA 3NGSA 5CYJA 2WW8A 1BWVA 3S1TA 3R1HA 4Q8FA 3BBBA 2HWTA 3BSCA 4PR6A 3M8QA 3DKDA 4O3QA 5KFMA 2KI2A 4GRSA 1FD8A 4F04B 3GIRA 4OZ3A 4IDKB 1VQNS 3RTVA 5B08A 3M6VA 4FVMA 3AD8C 4LBIA 2IJRA 1RYSA 1UWBB 4LSLA 1DZ5A 2ZNZA 3E2EA 2FJEB 3MTJA 2FZKB 1NAQA 4YDXA 3KJVB 4UY8T 4HR2A 1IBMJ 4KGVB 3HT0A 2KM8C 3CCVS 3D0IE 1WOSA 3HHNB 4JI2J 2CQPA 2UP1A 2M88A 2YNIB 3TARA 3PKMA 2HVZA 2PN6A 2DNZA 4PPZA 1R0AB 1OYEA 1TAQA 1T94A 3EZ5A 1IM6A 1VQ9S 2HMIA 4NCGA 3BYRA 1TKZB 4DV3J 3I87A 1IBKJ 1JJCB 3M30A 1HL6A 1G7CB 1FJGF 1KQKA 2BOPA 2E1CA 1QE1B 1WKLA 3D3CJ 1BUXA 2XEXA 1N32J 1FJ7A 2C28A 5M2RA 2VBWA 2Q1LA 3MR3A 4LIRA 1SL0A 4F0KA 1S9FA 2WOMB 5IQQA 3P5BP 2I5JA 5H9FK 4ECQA 2BJ9A 1FK9B 4MKVA 3TZYA 2YKPA 5J1PA 3D7SB 4CI0B 2UXCJ 1SB6A 3BGRA 3MM9A 3EDQB 4Y6IA 2GFFA 1RT2B 4DX8H 3U1LA 4ECWA 3RAQA 1LFWA 4M5MA 5DO2A 4DV4F 2BYCA 1YJ7A 3D1HA 2E7VA 1APSA 2ROGA 1KTVA 4OX7A 5F8LA 2MPUA 1QAXA 4E2FB 2CDRB 5DRKA 2RD5C 2JLEA 5A0YB 3CCMS 2VASA 3T19A 3PYGA 1D3WA 3A4TA 5E41A 3N5FA 1L3SA 1FWKA 3ZNUA 2V4JA 4FYWB 3G86A 3G87A 3UE2A 4J9NA 2J0WA 3C6UB 2ASYA 4BWMA 1JX4A 3I31A 2YWWA 4Y2CA 3KXDA 3TUIC 1K73T 3D6FB 4IYQA 3TAMB 1JLCB 2VDIA 2DHHA 5EN1A 3W63A 4LR8A 5ITHA 1YZ7A 2M8HA 4IFVA 4R0EA 3HPOA 3R5BA 4AQYJ 4B9VA 1S1UB 3E51A 1T0TV 3N79A 3PX6A 4JI5F 4YHHF 2W2QP 4A8QA 4LRFA 4NLQA 1TL3B 2B7CB 3W5ZA 4KE5A 1JLAA 4C11B 3NL0A 4NI2A 5KFPA 3FCHA 4DSLA 4V19J 1FRHA 2DO0A 2UVWA 2B4PA 2H9ZA 1KFSA 5HQMA 4ZS6A 1QUVA 4K5RA 2D7SA 4N5SA 1RHUB 3QBCA 2PI5A 4TU8A 3JSRA 3G71S 2HVIA 4V19X 2CDQA 1Q81T 5HP1A 3VALA 2HQCA 4FBUA 4GO5X 1RT6B 3BSAA 3KG4A 1FX2A 4PG7A 1FXDA 1JLEB 1V3RA 2G0IA 2NSBA 1U1PA 4C3KA 5L1LA 1NEEA 3ULHA 2BBEA 1LOUA 3AXKA 4BLGA 1LW2B 1QSSA 2AX0A 4ED8A 4QU7A 3AT1B 4B3RF 4EO8A 3K8VA 1RJJA 1AUDA 2HS0A 4F8RA 4DV0J 2JL9A 3QLHB 2QMUB 2V0NA 4M5JA 3KFWX 3VGUA 1PBUA 3RBEA 3LPYA 2NZ4A 1REVB 1GH8A 1NKEA 2R8IA 2DGSA 3NAIA 3GFHA 2XMUA 3UD3P 2B9YA 5J2QB 2BOAA 1ZAXA 1UAWA 3O44A 3J7AN 4WZMA 1NZ8A 5IQ6A 4MK9A 1WF1A 2KH9A 1QDUB 4ITSA 1XQIA 2AJQA 3T1HF 3SQOP 2M5YA 2N3OA 1OYDA 4MFBB 4QJVA 1DURA 3WIVA 3KLIB 3MPYA 4QYRA 2LP4A 3BJYA 1R3NA 2G1DA 1HR0F 1RWUA 1U1OA 4B3SF 1SV5A 3GIKA 3VGTA 1U2FA 4K5SA 2GZOA 3MEDB 4KB7A 4R0JA 1RE1B 3J7YI 2QJ3A 4QR0A 2CWKA 1RHQB 3SZ2A 1RWOB 1RWVB 8RUCA 4M5DA 5AXLA 2YKMB 4DV6F 1HNIA 2DHAA 1F9EB 2CPXA 1FCAA 3N4WA 1I5OB 3OL7A 1X9SA 2DEIA 1RWPB 3PDNA 3DCAA 4DPTA 7FDRA 1S4FA 3H5UA 5KOWA 4MIBA 2HNZA 1J27A 1P9YA 3IS9B 3NCQA 3UVJA 3ETMA 2KXNB 2O5DA 2Z2ZA 1RDRA 5HQ8A 3MM5B 4FYDA 1ULRA 4ICLA 4DPUA 4JI1F 3H20A 3A1YG 2VBZA 4KSEB 3MR5A 2KYZA 3D66A 2GS8A 3RYLA 1NKBA 2MTLA 3D28A 2EFGA 4KT0C 3AOAA 2CA9A 3CB4A 2AKWB 2VC0A 4A8MP 4QWBA 3KJNB 4CH7A 3L7UA 4ECRA 4U7CA 5MAOA 2HQDA 4B17A 1V3SA 2BANA 2P9EA 2DB1A 1KHVA 1FRXA 1YLXA 4Y00A 3PFOA 4PPDA 1U1QA 5KFCA 1C0UA 4NLSA 2DGUA 2LQBA 3Q8YA 1S76D 2XYGB 2FY8A 1TK8A 1DRZA 1RTHB 2ZJQQ 1MU2A 4IG3B 3FQKA 3KYLA 1H2VZ 1WG1A 2O67A 3O1LA 3U7JA 3NGKA 1QJHA 4B9LA 1WEYA 3KDNA 5C42B 2BABA 3UFCX 1U25A 3GPAA 3FNNA 4U6PA 4ZJOA 1PBAA 4NL5A 2DNNA 4H54A 4UZCA 3N01A 4NLXA 2GGPA 2IMWP 2RT3A 3IM8A 3CCSS 4R8UA 4L75A 5F41A 2CQ2A 4B9UA 1VQKS 4DU8A 4OZ2A 3BM7A 1IWAA 5HSPA 3OV7A 1KP6A 4QR1A 3KLFB 4CWBA 3VTIA 2HGLA 4OHZA 1X4GA 1MWYA 4WKYA 2ZUAA 1JLQB 4IG0A 1DTQA 3K5MA 2ILZA 3NNCA 4TYBA 4P2SA 5CQGA 2VQFF 2OPPA 5KG0A 2X51A 2B4OA 3A3PB 2ZM6J 6AT1B 3QRQA 1FNOA 1WG4A 4CQ1A 4JI3F 4IUFA 5KFTA 1KD1T 2PMHA 3QIPB 2XY6A 3N0VA 1NMEB 2EI5A 2DBBA 1U6FA 2RDDA 4NE9C 4TQSA 2P9GA 2IRUA 4WIQA 3TA1A 1R89A 1RT4A 3M2UB 2ERRA 3MFHA 4FP9A 1U49A 4DV7J 1L3TA 4WJBA 1RGVA 1Q7YT 3E8OA 3FMBA 2F9DA 1HBUB 4AT1B 2ZHOA 1M5PC 2IDLA 3KK3B 2B8QA 2UXBF 2AJ1A 4IRKA 2JDJA 4K0KF 2DRAA 2IC3A 1Q8KA 5BR8J 1BHNA 1RT7A 3P49B 3TJ8A 1UVNA 4NLGA 4KGZB 2XMTA 3CD6S 4B9MA 5C2GA 4QIFA 1HQEB 2V69A 1DQ8A 5J1EA 2MKCA 4WYWA 3NEKA 2O3DA 3HFZB 2J6TA 2JRSA 1S0VA 2XS2A 1VFJA 1GAOA 3FCWA 4LF8J 4QIGA 2KDOA 1JXVA 2AF6A 1XMQF 4X65J 3RRGA 2DRDA 4C8OA 3QT8A 3PRBA 2JEIA 1RTJA 3VF0B 4LFBJ 1PC5A 2DNMA 1RT1B 2DR5A 3O8WA 2Q3PA 1KR4A 3SDEB 2H5IB 2ZDPA 1CQNA 1RCOB 3PHTA 3W9IA 2GJ2A 2MQLA 2H1YA 2Y1LB 2PFFB 2J76E 3PVXA 4NEYA 5EDWA 4ZPAA 1VQ5S 3IAS9 2HVEA 3ZFVA 1TU0B 5CHCB 4ZIVA 2C2NA 1L3UA 1WC1A 2IYGA 6FDRA 2VL1A 1MMNA 5CH7B 3V6DA 2PC6A 2RAQA 2XMJA 1VLYA 3CT9A 3EE3A 2V94A 2YQ0A 2OPQB 3A8JA 5L9NA 2NXEA 2V50A 1GTEA 1UETA 4NYOA 4Y28C 4DR5J 2VG7A 1CJUB 1MNEA 3AA9A 1Q4RA 1RAGB 3PR5B 1I51B 2V63A 4F2RA 1FHTA 3I55S 2H65B 4LRAA 2UVRA 4ED4A 2YNFB 1CJTA 2KKHA 2RUGA 2GHVC 1S9EA 1VBXA 1DY3A 1LKZA 3MD1A 3IAM9 2OJ3A 4F0HA 5HLFB 5GAGI 1U2CA 4UT4A 2XSFA 1UA0A 1X4EA 4U95A 5EX3A 2ZKTA 4I2PA 4LRCA 2CKWA 3KLHB 2RF2A 2L41A 2ADCA 1VDHA 4LSNA 2QN6B 3ENWA 4LFAJ 2VG6A 1JJ2R 3KLEA 3PO4A 2DNPA 4WK3A 4KV8A 2AU0A 4DR3F 5GADU 3GJQB 1XNQJ 4O44B 2EK6A 3DYAB 1MG7A 2Z56B 2HEKA 1UMJA 3H90A
chains in the Genus database with same CATH topology
2GQQA 5B09A 2UUTA 5KFJA 2DCUB 4X4TA 3LAKA 1HARA 1RT3A 1OSCA 1VHFA 4KAIA 4WFBQ 3MGJA 3OSPA 4DR1F 2Y1IA 1QUPA 5JVGQ 2JH3A 2VG7B 4TYAA 2W9BB 3DDKA 1Z2ZA 2HWIA 2OFHX 1DQ9A 2JLGA 4KR0B 2HHPA 3FRZA 2F8HA 5A2QY 3KHGA 4C0HA 4YFUA 1YJTA 2UUWA 3GMGA 4G1QA 4ETXA 3OUYB 3MFIA 1R8AA 1NK5A 2OPSA 3RB4A 5KFQA 2CQ0A 1FEHA 2WSCC 1MROB 4DG1B 4F2SA 2F40A 2D1CA 2KT5A 3CJ2A 4AXJA 1T05B 2IVYA 4ED2A 4DUZF 1TFWA 2RKIB 3M2RA 4FF3A 3CTRA 5E3CA 2HHHF 1S9EB 5A6WA 3KG0A 3LALA 3MM7B 4N77A 2HNDA 3V81A 3WDOA 1FRJA 2EW9A 2L9WA 2B9WA 3DC2A 1VC6A 2XULA 3HVWA 5HMYA 3I4PA 4HTJA 4KRWA 5D3GA 1S6QA 4X66F 1D8ZA 1H0HB 3M9MB 2BRKA 3LGNA 4H4MB 5G0RB 3UW1A 1HBOB 5L9XA 1FDDA 4C0OC 5I3UA 2DPIA 1NRKA 5J2NA 2FDNA 3LO3A 2XO7A 3POTA 1VK3A 5D4NA 1IKYA 4WK1A 4UQTA 3IWNC 5HN0A 3H5YA 2YNHA 2V9KA 2WONB 4IQMA 3NS6A 1HI1A 4I2PB 4KO0A 4Y65A 5C5JA 3EPIA 4PXBA 4N76A 1LW0A 2RF2B 4O4GA 3PW5A 5IM0B 4PUOB 4C4WA 5KAKA 4LSNB 3NNHA 4F25A 5KT6A 2RRNA 2CJBA 2JFDA 5AE3A 4DS4A 5I42A 1UVIA 3FJ2A 3MEGB 1RQ0A 2VG6B 3KLEB 4L6V3 1UVKA 2QA4G 2PA8D 3HKZD 5FD1A 5F8JA 3MURP 3OFHA 4KV8B 2YNGB 3DDNA 2EFVA 3VZHA 3GQCA 2FY1A 4Q5VA 1HQUB 3GILA 2HHQA 2HGNA 3F56A 2LXUA 4HH1A 1OPZA 3JYTB 5F3TA 4EYIB 1D1UA 1S48A 2LQ5A 3PX4A 2EBGA 5C24B 1YGYA 3RR7A 3CGIA 2GA7A 1KTQA 4QPXA 5DJBA 3CCLS 2ZVSA 1AW0A 1DJ0A 1NZAA 3S6EA 4LF6F 3ZZRA 3QJJA 1YJWS 1DFDA 1ZBTA 1OPIA 2WHOA 3KHRA 3IWXA 1ZM9A 3KMQA 1KHWA 4PQUA 2AGPA 2DHSA 3BGFA 2DGXA 1RT3B 2DK2A 3IFEA 2I2YA 1TP7A 4GC6A 2YWHA 2BQRA 2FIUA 2MZ1A 5KG1A 1T7PA 4C98A 3FEZA 2EVZA 3HJFA 1ZPVA 2E1AA 3KKFA 2DRBA 2GIRA 1FTCA 3HK2A 4G1QB 5E3QA 2VG5A 4AXIA 2V8HA 1YQHA 4CO4A 2OPSB 4K4TA 3K59A 3DU6A 4DN9A 2C3MA 1XBWA 3G6ES 2OO4A 3A8EA 3MEKA 2VONA 2HIQA 2E5HA 2RMLA 2VBYA 3M2RB 4MYTA 4NX9A 3ZZ0A 2UV8A 4FF4A 2WRMA 3GFZA 5JXSA 1GTHA 3RW6A 2X1FA 2DNGA 2MZQA 5L8RC 3V81B 2HNDB 2FLNA 2JEGA 1X4BA 4ZMMA 2O66A 4B08A 4OLPA 1IBMF 2DITA 5D3GB 1S6QB 1VRUA 4DL7A 4W92B 5E7OB 1URNA 1FVQA 4OFZA 3JTPA 3JAMY 5I3UB 3K5NA 5AJ3F 1GXUA 4DLGA 1IM4A 1Z1ZA 5J2NB 4J9OA 1BC6A 5EHHA 3POTB 4ILMA 3FEYB 1VQPS 1K8AT 3NG8A 1IKYB 1BQNA 4B9TA 2GIQA 4OMFG 2YNHB 4LQ9A 2XI3A 1R43A 4Y2KA 1D9FA 4LQ3A 4YY3F 1A7GE 4KO0B 4ZCMA 1DLOA 5T7LA 1LW0B 2PMZD 4DS5A 4K50A 1Y4ZB 4NMLA 5F3ZA 1ZM3A 1TV6A 4ZP8A 4B02A 2D3ZA 1E6VB 5EGYA 1RP5A 3J80Y 1UVMA 3LGMA 3DLBA 4EBCA 3D1QA 2RE1A 3GFXA 5CYQA 1TAUA 1KONA 3S01A 1Y5IB 1YJ9S 2VD3A 1G2EA 4DSEA 2EG1A 3AH6A 3CCQS 2J9DA 2MQNA 2U1AA 3KHHA 2I8EA 2AJ0A 4UUWA 4WFXA 3I6PA 4ETZA 2ZE2A 2ZH5A 2HG4A 4XDCA 1NJZA 4OL8A 1SXLA 2J6SA 4EYHB 2ZITA 2OTLS 4TU9A 3PEJA 3NS5A 4HTIA 4DQQA 4OI3A 3PW0A 1SIWB 4HDHA 2IRYA 1QSYA 4KJIA 2DNRA 3HZEA 3QGGA 4OZ1A 3C46A 1C4AA 4PQUB 5AE1A 4WCEQ 2F4VF 3C3LA 4CO1A 3P5TL 5SZTA 2ZM6F 1ZETA 3BREA 1OSDA 4OJ3A 5GAEU 4YOEA 3I82A 3L09A 3J81Y 2E5LF 2MKSA 3FEXB 3RW7A 1JMTA 2Z8QA 4ZPWR 3V6KA 4WU3A 2VG5B 3BF4A 5IT4A 4Y34A 2ZDOA 3DM2A 3KK1A 5H9FJ 3ITHA 4GKJF 4J37A 5CYMA 4D3HA 2PI4A 4OJ1A 2KJWA 4C3LA 4RNFA 1PO6A 3U02A 3SMZA 1SQEA 2SXLA 3L95X 5D4LA 5HBMA 1XMOF 3S7RA 3QIDA 2RU9A 2CPIA 4K4WA 4I0WA 4ZA1A 1AFIA 1TVRA 4C8MA 4XDDA 1QY7A 1ZAWA 3ICLA 2B56A 2N82B 2ZHAA 2CG4A 2BACA 4FBTA 1ELOA 3KOAA 2FTRA 1VRUB 1BQMA 2LVWA 5DGBA 2R7TA 5KT5A 1LWCA 4QWEA 3SQGA 2IAJA 3SCJE 4HI1A 4KHPF 1SKSA 3MM8A 1M90T 4QPTA 4DV7F 4DFJA 1QTMA 4DJBA 3PKYA 3FZ2A 1M5KC 1BQNB 4NCBA 4U67Q 4PWDA 1ZAVA 3CD5A 4NLUA 4NYZA 5B0BA 4RWWA 1Q53A 2K3KA 2YVSA 1A6LA 1DLOB 2B5JA 5T7LB 5K8PA 4XO0A 4LF5F 3EPGA 1P8GA 1H3DA 2C2RA 4DWIA 3LP0A 5GAHI 2NYIA 3OXLA 1TV6B 1VQYA 1TUVA 1WHWA 2XNRA 2RRBA 2YKQA 1GX6A 3S8SA 2WBRA 2HVHA 5CYQB 5BR8F 1AXQA 3SEOA 2LMIA 3GSDA 5LJ5Y 2L3MA 4NRTA 3UNGC 3J7Z5 2ALZA 3OFGA 1U1MA 2CFXA 3TVZA 3I5BA 1HBNA 4DQPA 3CC2S 2FPHX 2YH1A 2ZE2B 2OTJS 3CSKA 4KTQA 5DLFA 3UCZP 3CJ5A 2RQ4A 3CDBA 3HVTA 3OTEA 1C0TB 4RX6A 3WX4A 3MAHA 4WZQA 1N52B 2MGZA 1S77D 3DLEA 1P6TA 4YP3A 3KLVA 2R8KA 4I56A 2HFZA 3SCIE 1TL1A 1JK9B 3GYNA 3Q8QB 4F4YA 1KOHA 4EBEA 4RBVA 2LEBA 3BZQA 3UCUP 3QO9A 5BYSA 3HMJG 4OX9F 5E0OA 3M6UA 2BM0A 4O23A 1HBMB 2GQ2A 4X4SA 3DHWC 2HHWA 4CO0A 1S0MA 4NXMF 2XSJA 1HWJA 4CH1A 3SV4A 1N5SA 2CPDA 5FIIA 2R7XA 1JIHA 4CH0S 2IM3A 1N5TA 5B0EA 2IBKA 3DM2B 3KK1B 3G8TA 3QZ8A 5LMUF 4LF8F 2D9OA 2RQKA 4TNOA 3ITHB 3WC0A 4WKRA 4I69A 3HT3A 3J7A1 1EETA 1IKVA 1N88A 3UD4P 4Q8EA 4AQYF 3FVYA 4HYKA 5HROA 2CJ9A 5IS2A 2VOOA 3G9CA 2MHNA 1VK8A 4MKAA 5HBMB 2VUGA 4DR7F 3SDEA 4B9NA 1TVRB 2F3JA 2O01C 3HF5A 4MAKA 4X65F 3SV3A 4BS2A 1HD1A 3IR6B 3HLUA 3EX7B 4Q2LA 1LK7A 2RS8A 1BQMB 3SSQA 3H40A 1LWCB 4RBTA 3SQGB 4C9DA 2IAJB 2ZNYA 4X4QA 2VKZG 2KU7A 2BZ2A 2LQJA 3MM8B 3LWLA 1YJVA 2ACYA 2DGTA 3UPFA 3M6WA 2RRAA 3KMSA 2AYBA 5DDRC 1M5SA 4LFBF 4PWDB 2GHPA 4HHJA 1S0OA 1LXJA 5KFKA 2B5JB 2QSFA 3M8RA 2CPJA 4TN2A 4UQGA 4WF9Q 2QMWA 2HFOA 1IJFB 3DI6A 3LP0B 4NLYA 3V4IA 1K0TA 1O8BA 3OR2A 6FD1A 1XWLA 2FLLA 1PC4A 3CD7A 5C25A 3PW4A 2A1BA 1U1KA 1MW7A 2WSEC 1FRLA 1NJXA 1CSJA 4NLDA 3T3FA 2KHDA 1S97A 2JEFA 2QMXA 4MKYA 1S6PA 1QLNA 4IH7A 5DETA 4B3MF 2ZH7A 4I1TA 2Q43A 1HBNB 4RW9A 4WE1A 1S9GA 2KRRA 2VFTA 3BDPA 4NZ6A 3I5CA 1DAXA 2IM0A 1RA7A 1S7HA 3AHPA 5DM6Q 1DTTA 4A8WA 4DFMA 4ECTA 2HQ3A 3HVTB 1O51A 2XLIA 1CG2A 2XI2A 4FVCA 2BR0A 1S10A 3FSXA 3Q0AA 1HNZF 2NXUA 1VIXA 5KT7A 3VWSA 1X7VA 2JX2A 3ENVA 4MIWA 4QIVA 1G1XA 3EXCX 2MGZB 4D3GA 3N28A 4WIIA 1RT5A 3BN7A 2COLA 2KT2A 3DLEB 4RNMA 1KSPA 5KG3A 3VQTA 1D8YA 4C3MA 1TL1B 2J9DE 3UQSA 2I1RA 2IRXA 2PD1A 4OZNA 4A8OA 2R9LA 2Y1JA 1XC9A 3QO9B 4ID5A 1HPZA 2YX1A 2UV8G 2KFZA 2MZJA 2ZHBA 4CO2A 5JVHQ 1HA1A 4AUKA 3M4XA 5BYRA 5B0AA 3HHLA 3VR1A 4XIUA 1D9DA 1VQ7S 2XSJB 4C97A 3PRDA 1RA6A 3NNAA 3BSOA 4NZ0A 1FF2A 1JLFA 1TKXA 2B0GA 2BUNA 3TRGA 3UWTA 5HMXA 2M2BA 2QYCA 1HI8A 4DR5F 3G4SS 3MUMP 2CPYA 4Q44A 5EWEA 2XY7A 4HDGA 1H98A 2EFQA 1ZM2A 2PIIA 1CC7A 1M5VC 2XMKA 3MR6A 1EETB 1IKVB 5CCMA 3H2UB 4F4XA 5L39A 5HROB 3E01A 3SFGA 1HNXF 2Q6CA 1S1TA 1OS5A 2FVCA 4DEZA 5HLFA 3RB0A 3MR2A 2LXIA 4K4ZA 2KJVA 1FVSA 1N5VA 2N7CA 2W8KA 2W4DA 3CD0A 4R5PB 3W2WA 1CC8A 1Q79A 3THVA 5M2UA 4FF1A 3GG0A 2K2PA 1GXLA 5DG9A 3HDSA 2XMWA 2DH9A 5AXMA 3OTDA 3TW0A 5K8OA 3KLHA 4UUXA 3N6NA 3DOLA 5DS7A 2VOPA 3CDAA 3I5AA 4QWDA 2I9SA 1S1XA 5KFWA 1HWKA 1JLGA 1GXTA 1T3OA 1X8DA 2MZSA 2GC8A 5I3PA 4EWTA 2YY3A 4CT8A 2ZH4A 4I64A 2RDIA 1S6OA 2LA6A 3DI6B 2KRBA 1GX5A 1OQ3A 1DARA 3MMBA 4G1IA 3C6TA 2ZH8A 4ID8A 4BWJA 2DTJA 3OR2B 4WTYA 3V4IB 5GAGU 4ZPTR 1SJQA 4OZLA 1N0UA 2VH7A 4DLEA 5C25B 4EUVA 3CCTA 2CVIA 1N34F 2IA0A 5E33A 5KTQA 4C8LA 2JSXA 3DLJA 1TL5A 1S6PB 2EKYA 3DYAA 2E5JA 1WD6A 4I7FA 2JFKA 1F5BA 2WCXA 4MJKA 2E9ZA 3RAMA 4RW9B 4WE1B 1S9GB 3GB0A 1H7WA 1VC0A 4UY85 4HT7A 3OL6A 1LWFA 1DTTB 1F0XA 2VPXB 3LP2A 3DU5A 3HKWA 2ZH1A 2MYFA 2ILYA 3ZZOA 2JZ5A 5E3AA 1PGZA 3D2WA 2EG2A 5JJBA 3CULA 4ECUA 1XNQF 4J9QA 1SBRA 3MECA 1U24A 1U45A 4I67A 4IQXA 4AL7A 4ID5B 1HPZB 1O5JA 2ZBCA 2L08A 1LQ9A 4UOCA 1FT8A 5F8NA 3IGVA 4HKQA 3HHLB 2LDIA 5GMKa 4IRDA 1C1BA 4NA2A 3T1AA 1JLFB 1TKXB 2RH3A 1SUQA 5LSOA 1NH8A 2A10A 3VAHA 4NA1A 4QWCA 2KB2A 2AJ4A 3MM7A 2A3JA 1IKXA 2J9CA 3DNCA 4NCAA 2JJ4D 3O6QA 3OXFA 4MMOA 2MZRA 2OLWA 2FJWA 3E01B 3DOKA 4WFAQ 1S1TB 1NK9A 3N9UC 4E98A 3CC7S 1VRTA 1IKWA 4QIEA 3N5BA 5F8MA 3JTNA 2ADBA 1VBYA 2HS3A 1N48A 5KG7A 5KFLA 2FLPA 2MSTA 1WF0A 1VQ8S 4LT6A 3DLHA 3FSYA 3HVRA 4Q0BA 3BS9A 1B0VA 3QJPA 3PY8A 2IMOA 3X1LB 1NB7A 1N0VC 1FRKA 2LLZA 2CQDA 4JBCA 5KFEA 2XHWA 3DOLB 3J7YU 1W2IA 5IM0A 2JLFA 1YI2S 2QT7A 1S1XB 3DRPA 1M5OC 1JLGB 3CCWA 1S99A 2QZ8A 5KT4A 1WHXA 1FJEB 1U7LA 2K8GA 2CQ4A 1QAIA 1FXLA 1WF2A 1BQXA 1Y0HA 2UUAF 1RKJA 1T8EA 1DHMA 4DUYF 4IOBA 3NMRA 3TAPA 5A8RA 4NWBA 1LK5A 4TLQA 1Q82T 4NXNF 5DDQC 3MMBB 2DNLA 3C6TB 2B3TB 1UEVA 1VOMA 3T5KA 1UVJA 4Q45A 2VPYB 2BQ3A 2F7VA 2PEHA 4ZLPA 5C24A 1RTIA 2B6AA 4ATNA 1YSJA 5KFDA 3PW2A 1N5QA 3QJLA 3PW7A 4I7FB 2O1PA 5E3RA 4DR6F 4XK8C 2XBPA 1LWFB 3K58A 3LP2B 3V2UC 1V9OA 2GX8A 4ED5A 5T14A 1S72S 3CXCR 3UDCA 2BDPA 4G1PA 1HI0P 4ELUA 3MF5A 3KTQA 1YRXA 2KFYA 2L9NA 1YITS 1K1SA 3MECB 2MQQA 3GR0A 4DL6A 1SH0A 3IR5B 4C8YA 1NK8A 2FJXA 1XR6A 4LFCF 2YWKA 1U47A 1HYSA 1EP4A 3V6JA 2IVMA