1UKUA

Crystal structure of pyrococcus horikoshii cuta1 complexed with cu2+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords periplasmic divalent cation tolerance protein CutA
publication title Structural implications for heavy metal-induced reversible assembly and aggregation of a protein: the case of Pyrococcus horikoshii CutA.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 31
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ukuA00
2J9DE 3AHPA 4WK1A 3N5BA 1HWUA 3AA9A 4C3KA 3MHYA 4NYOA 4OZNA 4USIA 3O5TB 4IYQA 4CO4A 3O8WA 2XG8A 1V6HA 3HLUA 4C3MA 4YB5A 4D3HA 2J9CA 2XZWA 4CO3A 4CNYA 3L7PA 1UL3A 5L9NA 2ZFHA 2GW8A 4CO0A 4Y6IA 5D4NA 3NCRA 2JJ4D 3X3UA 2XBPA 5DS7A 2RD5C 3LF0A 5DRKA 2V5HG 4E98A 2NUUG 4OZLA 5D4OA 1Q1KA 4C3LA 1VFJA 1XK8A 3DFEA 4Y65A 3CE8A 2EG2A 2E66A 4CO5A 4YB6A 4WK3A 2O66A 4CNZA 4YB7A 2O67A 1NH7A 4USHA 4RLEA 1VHFA 3AH6A 1V3RA 2J9EA 5D4LA 1OSCA 2GNKA 3GSDA 2DCLA 3OPKA 2VD3A 1O5JA 1NAQA 1O51A 1PILA 1V3SA 2GX8A 4CO1A 1P1LA 1UFLA 5D4PA 1KR4A 3NCPA 2NS1B 1J2VA 3NCQA 2ZOMA 4RWXA 2PIIA 1NH8A 1UKUA 4D3GA 1H3DA 4RX6A 3TA0A 1GNKA 2EG1A 3BZQA 4R25A 4NYPA 2CZ4A 2J9DA 4OZJA 4USJC 4AFFA 2Z0GA 4CO2A 3AA8A 2NUHA 1QY7A 1UMJA 2XULA 4RWWA 3M05A 1NZAA 1V9OA 4ZK7M 3T9ZA 3TA2A 3TA1A
chains in the Genus database with same CATH superfamily
3DCAA 3R7BB 3K57A 2E5GA 4C7QA 4MT1A 3CJKA 1X5SA 1EAYC 2EW9A 2YPZA 3OL6A 2V68A 5ETQA 2HNYB 3BH6B 3VQSA 2M2BA 3RR8A 4YUDA 4J9VA 2DNPA 3N28A 2NSCA 2LQ8A 4FNHA 1MU2A 3BGRB 2W9AA 1B4SA 1YJVA 2EC2A 1N5SA 4KSEB 4UF4A 3M2RA 2YWGA 2FVPA 4DCJB 2EFGA 1C4CA 1JLEB 1FK9A 2DNLA 1WI6A 1HW8A 5KT2A 4DPXA 3S01A 1U1QA 5CXTA 4OJHA 3PW5A 3RYLA 3M6WA 1SIZA 1WC3A 2B9WA 3KJFB 1LXJA 2B56A 2V2VA 2HNZB 2I9SA 4AFFA 3I31A 2XULA 4UTGA 4FVCA 2FTRA 1EARA 1NO8A 3GFZA 4ECZA 3D1QA 3AA9A 4C3KA 1RZMA 1IR2A 1N5VA 1RWMB 3TEHB 4TNOA 1S97A 4OFZA 3G6VA 4EBCA 1MMLA 4IOBA 3K5LA 4A8WA 3ETMA 4X2BA 2BYCA 3UNGC 1X0FA 1YJWS 1FJGF 2RSQA 2GMJA 2V8DA 4KC5A 3G82A 3FK4A 1VQ5S 2IVMA 1XMOF 3MTJA 3BGUA 1VFJA 4BS2A 1U0HA 3THVA 2YX7A 3TQEA 3D68A 3WC2A 2IYIA 2BX6A 3BKTA 2RF2B 2FJVA 4A8YA 1X31C 5AE2A 1BLUA 3RB3A 3RRKA 1NCLA 4ZJLA 2G0CA 3NL0A 3J81Y 4I69A 2ZKTA 3TJAA 3NCQA 1YK9A 5D0EA 1K1SA 2XQCA 4EBDA 1RWPB 2FHJD 2BANA 4XTTA 3OUYB 2C3OA 3UVJA 1RWWB 4DF4A 4NLPA 3D5MA 4KR0B 4J9UE 5A0YB 1P8GA 3CCWA 2KVQE 4DQQA 4N56A 3DGVA 1HNIB 1DLOB 4AE5A 3MEDB 1Z2ZA 1YG0A 3MHYA 3HMJG 3TZYA 2KFNA 2R7SA 1NK8A 2HHVA 2FC8A 1IKXA 4I2QA 5L9NA 5GAHI 3M2UA 2F4FA 1CC8A 3DRXA 3W5ZA 1FVQA 2BDPA 4PKDB 4A8OA 1U49A 3HZGA 3RGIA 1XK8A 2R8HA 5HP1A 2OPQB 1FJGJ 2CQ4A 1XMOJ 5DLGA 4C11A 3GP9A 3I55S 3ILLA 5F8JA 2DEJA 4UW2A 4USHA 2GJ2A 3NWRA 4ZPAA 2ZE2B 2W2PP 5FJ4A 1P1LA 5KFPA 5D4PA 2ROGA 3GJRB 4MK7A 2CXEA 4NLYA 1Y5IB 1QAIA 3IWLA 3CCRS 3D9BA 1CC7A 2YNHB 3FUYA 1ACMB 1NZAA 1WTFA 3A3PB 3R5GA 1NBEB 5F3ZA 1TK8A 5HJXA 4DV0F 3CCQS 1FJCA 1CJTB 4CO4A 3TNVA 3A12A 4NXNJ 2VG7B 2J0SD 1JQGA 1XR7A 2OIHA 2GA7A 3OR2A 3RAQA 4UY8T 3RZAA 3EDQB 1B3TA 3CB4A 3FEYB 2H9ZA 2PC6A 1A9NB 4OZ5A 2R7WA 4DV3F 1U1LA 1D09B 1DQ9A 3FNNA 3TRGA 1DQAA 4KYZA 2KVIA 4P2MA 1NMEB 4LIWA 4P52A 1RLCL 3M8PA 2CQPA 4K4WA 5CD4A 4I67A 5C2CA 4QWEA 1KVJA 2PGCA 1TKTA 1GXTA 3I5BA 5L1KA 3UD4P 1N88A 1LWCB 3CXCR 2AU0A 3HJFA 1SKWA 1YZ6A 2EG1A 2NPFA 4R25A 3RBDA 4DV4F 3MAQA 2VF3A 2DNYA 4G65A 1R0CB 3BSAA 3HSZA 2HWIA 1WOPA 3AOAA 2DO0A 5HSPA 1WEXA 2W01A 1JKHB 3LWMA 1QSYA 5CZVA 3VAHA 1SQEA 1X9SA 1NKEA 3SQGA 2M7SA 1TL7A 1TMMA 4DV0J 2PO4A 1EB0A 1RAAB 3HKZD 1X4AA 2ZDPA 3CJ5A 3ZXWA 1OY9A 1N36F 4X62F 2RRBA 1VRUA 3DLBA 4CCHA 1SJRA 3I0RA 5CA5A 4DV3J 3RW7A 2NCKL 4LQ3A 2LXFA 2HMIB 3BR8A 3NGTA 5IQQA 2DD8S 4ITSA 4LF9F 1VQMS 5ETRA 4DX7A 4NL5A 4HT5A 3GZ7A 5IS2A 4DXLA 3W9IA 2VPWB 5L1LA 2ZC4A 2VC1A 3JSMA 1C1CB 3TA2A 2ZH5A 1YIJS 4DV4J 1HNVA 3B54A 2MQPA 2IM0A 1HBUB 2H54B 5DQHA 3MUVP 4X4SA 1XEZA 2BKNA 5H9FK 4CO3A 3OW2R 3MMBB 4C97A 3I4HX 2MPUA 3ISND 1J5OB 4EYHB 2X1AA 3UDLA 4Z7CA 1GT8A 1KVKA 1WEYA 2OD4A 4KGMA 5DZ6A 3DHXA 1Y3KA 2W4CA 5CHCB 2V94A 4X62J 2IM2A 2KO1A 1TZ0A 1PC4A 4WYWA 5GMEA 2V4JB 2DHAA 2F9JA 3ILJA 1VGYA 2AKWB 3DKDA 3NMAA 1T9UA 4NA1A 1EKRA 2FJDB 2IMWP 3LWLA 2Q3PA 4LF9J 2GHVC 4C9DA 4KGXB 2CYYA 4YDXA 4X4UA 3PJXA 2AJ0A 1C1BB 1LWFA 4E0DA 3M8QA 2HIYA 1QY7A 2D7SA 1RXOB 3MOJB 5IT9Y 1U1OA 2NXUA 3DLJA 4DN9A 3CJ4A 5B0DA 3NGRA 4OHZA 3MFIA 2VA2A 3SFUA 3MFHA 3ZZOA 2W4DA 1N48A 3PRVA 4EI2A 3DOLB 2CNNB 5EX0A 2V50A 5C25A 4AL7A 4B9TA 2W4PA 1RABB 4J9PA 3SZ2A 2K1RB 3KLIA 3D1HA 1FVSA 4U95A 1KVIA 4M95A 3GG0A 2EC0A 1GH8A 3QWUA 5G4DA 2ZOGA 1DFDA 2FIUA 3BGLA 5DGBA 4ES1A 4PABA 4MIBA 3JS9A 2PT0A 1I5OB 4DN0A 3NS6A 2V9WA 3MCSA 4AXJA 1E6YB 2QZ8A 4HH0A 4ES2A 4YP3A 3MOZA 4I7FA 2AMCB 2HQIA 1LFWA 2DH9A 3T6BA 4I2PA 5A8KA 4ZK7M 2MKSA 3BQ2A 2FVRA 2XMKA 1R89A 5FDLB 3H5YA 2ZJQQ 2CPJA 4IDKA 1RAIB 3LGHA 3DOMA 2J6SA 2QE5A 2QN6B 1U4BA 3P3DA 1AFJA 1TL1B 1B7YB 4IFVB 2YPYA 1IKWB 4TU9A 5J2NA 4RO0A 3QSYB 1JLBB 2ZFHA 3Q8SB 5J1PA 5E3CA 3HULA 2LEBA 1F1BB 4L76A 4FBTA 2ATLA 5KFLA 4HKQA 4O44B 3M8ZA 1M0SA 1LQ9A 5KFHA 1FDAA 2OPSA 2QC3A 4NZ0A 5EWGA 2KFZA 2Z2MA 4H4KA 3JYTB 3MM6A 2HHPA 1C4AA 2R7QA 2FHMA 2BZ2A 3CDUA 1PSDA 1WG5A 2KFYA 3MXHP 3K8VA 4R5PA 2HZCA 3JQMA 4ZJQA 4FF1A 4ECSA 2NQPA 1WORA 4Y0FA 2D3ZA 1S1WA 2XSFA 1PJ6A 3HHLD 3TVZA 1Q53A 3W9HA 3SCKE 2BM1A 1R6VA 3JAMU 2G2OA 3TX0A 4Q5VA 2DY9A 5DG7A 1BQMB 2RQ4A 1TVRB 4MTPA 3NEKA 4TQRA 2M8HA 2P5VA 5JXSA 1T0TV 4CLUA 1SUQA 3PX4A 3J7YU 1CJKB 1HBNB 1U6FA 2MY8A 5GADI 3JQJA 2UXBF 1I51B 4PWUA 5DJBA 3IRWP 3QZ8A 1WC5A 3M9OB 4PUOA 5KFVA 1N5TA 4JI8F 2YWFA 3D0HE 2X3GA 1CJVB 1JLCB 3DRSA 3UFCX 5CCMA 1KBRA 2B9EA 2E1AA 1HNZF 4O3QA 1L3TA 2E7WA 4F50A 3KG1A 4WCEQ 1KFDA 3UR3C 4W90B 2VB6A 3C2PA 2YKPA 2FJWA 3JTNA 3C14A 4CQ1A 2Y8WA 3ENWA 3PFOA 4Q43A 3KK2B 1E6VB 4J91A 2BE2A 2HK3A 4WP3A 4LF1A 1XC9A 4ZN3A 1Y0HA 2YBVA 3IWXA 3OFEA 4U96A 2DHHA 3CJKB 2HQ3A 3GE9A 1F60B 4J9NA 3B4MA 2XHCA 3TW0A 2F8EX 5KG2A 5HVGA 1R0BG 3WHIA 5CD4H 2ASDA 1XMQF 1M5PC 4S0MA 1VQSA 3PRDA 1PJ7A 3E01B 2ZZMA 1MWZA 3HD1A 4QYZJ 4KV8A 4CM0A 2LCWA 3VAFA 4DUZJ 1MU2B 3ISZA 1HFEL 4OX9F 2YWHA 1KEKA 3PJ9A 2PA8D 3OXLA 1VC5A 3MDFA 4NWBA 3M8SA 3BYRA 3M2RB 2UXBJ 2RQMA 2VKZG 3N01A 1KRPA 3PYDA 3DM2A 2XZTB 1FK9B 2GGPA 1FNOA 1S1UA 4JI8J 5J1NA 5KFSA 2QA4G 1CEZA 5DQIA 2MSTA 4DSLA 5HJYA 3LPEA 3F56A 1ZETA 2DK2A 1HNZJ 3DRYA 2E1RA 3MPYA 2IDLA 3ZC4A 2HBYB 3N79A 3UWTA 1XNQF 3LA0A 4DU7A 4F3OA 3TAQA 2FLLA 1QM9A 4E8UA 2OELA 3L95X 3KOAA 3MGJA 2FY8A 2HEKA 2F7VA 4EZ6A 1RTIA 1FRMA 2I8EA 2HFUA 2O1PA 1DY3A 3BSNA 4IG0A 3VQTA 2DB1A 2RJZA 4NX9A 4TY9A 1Y5NB 4LFAJ 4OYMA 2VFUA 3G82B 3EZ5A 4C3MA 1XMQJ 1U0HB 1FXRA 5L38A 3AJ2A 3DLEA 1S6QA 4ZPWR 1N6QA 3HO1A 1S1XA 4OX9J 3GFYA 2YWEA 4URGA 3ISNC 3CO0P 1X4HA 4Z37A 5B7WA 2VL1A 2B6AA 4RNNA 1EKSA 2OUGA 4GVBB 1NH7A 2MY7A 4RW7B 3BKFA 4C48A 1TQLA 4I0WA 1T9TA 2DIUA 3ILIA 3UVJB 3B82A 4OI3A 1H98A 4NRUA 1GEHA 2AZ3A 1MROB 1NJIT 1XNQJ 3R6GB 1P6TA 1QTMA 1RHUB 5LM7E 4QWCA 1T3OA 2J9DE 1BMQB 3MR5A 1IKXB 3A3OB 2WB4A 4I2QB 2Q66A 3M2UB 1RTZA 4DL4A 4NPOA 4WJBA 4P9SA 2RRNA 3HVRA 2JJ4D 4C11B 4OJGA 5HLFA 2MQNA 1SKSA 4ZHRA 4BCAA 2VFTA 3MPWA 4DR5F 2ZH8A 4HLBA 5ETMA 4MK9A 1NSKL 1M1KT 3DGPA 5KFGA 2JEFA 3FCWA 5GVQA 1HBMA 3T1AA 4CLZA 1SKRA 4EFAC 2WRMA 3FQKA 2FGOA 2HIQA 2Q1LA 4OJ3A 1WOSA 2K7KA 3HPOA 4X66F 1V5IB 2RNEA 2CDRB 4TVAB 4EBEA 4UQTA 2DEIA 3V4IA 1XN9A 2HQFA 4OL8A 4DG1A 3OR2B 5A6PA 1CJUA 3BS9A 3PTWA 3ZTQA 4NASA 3DXSX 2IRYA 2LU1A 1W2IA 1L3KA 1VRTA 4OIXA 1U1RA 2E7VA 1YZ7A 1BGXT 1F3FA 1X0PA 1SJFA 2GIQA 1WG4A 3M8PB 2HWHA 4RBUA 1VS3A 4NZ6A 2IFXA 1FRHA 3OJUA 2DR9A 1NPKA 4G1PA 4USTA 1PYTA 3KMQA 3KG4A 1FNXH 2CRLA 2FHKA 1TKTB 3CDBA 4DR5J 3BEGB 5KFAA 3HCXA 2VG5A 2W7PA 3EJMA 3SDEA 3PACA 2GX8A 2UUBF 4RZRA 1F9HA 1OPZA 2I1RA 1NB7A 3OR1B 1RWUA 1RGVA 3NKYA 3D3BJ 3HHLC 3A3NB 4DPTA 2LDIA 4F4ZA 1UEUA 2MKIA 5KFKA 4BC9A 3H2UB 1PCAA 1Q86T 1TL7B 4PQAA 1MN9A 1WJ9A 2ZUAA 4GC7A 2B7CB 3M4XA 3QZ7A 1V6HA 2GS8A 5F0WA 1MWYA 3IGNA 1NK9A 2FDNA 5ETVA 2DTJA 5EN1A 1DHMA 2KJWA 4DV7F 1TKZA 3MM7B 2MXYA 4NLRA 1BY9A 1Q8LA 5LXYA 1Q7YT 3NP5A 5F8GA 1MMNA 5K8PA 3IC1A 3FRYA 3WQPA 2UXCF 2WSCC 3MTKA 5ITHA 5CYMA 4O3PA 1RT3A 3WX8A 5D0RA 2BR0A 2R8IA 3JSMB 3LP0B 4ES3A 4TY8B 4HL9A 4OYAA 2XEXA 3ULHA 1HNVB 2UUBJ 4ZVTB 4CLSA 1QLNA 4UT4A 5DDOC 2HGNA 5KTQA 3PKMA 4MAKA 1I94J 3FSYA 1JJHA 2W9BA 1K0VA 3V4MA 2K2PA 3UCZP 1WACA 2W9CA 1U1MA 2ASJA 2XMMA 4K4SA 1LK7A 1A7GE 3DXBA 1UL3A 1HIYA 3HVWA 4YEAA 2GJIA 4MKVA 3I82A 2AGPA 1U1PA 3OXFA 1MN7A 3FBCA 4DV7J 2ZOFA 2UU9F 2L9NA 2VONA 2Z2LA 2XYPB 4PXBA 4RJVA 5AE3A 3TZXA 1F9FA 3W62A 5D4LA 2GNKA 2QLXA 3TJ9A 3K8WA 2UXCJ 1AA1B 2XO6A 1LWFB 3U1MA 5CABA 3M8QB 5C42A 1VOMA 1UJ6A 3D6MB 3OL9A 3D7SB 2BE9B 4QR0A 4ELTA 1XBWA 2RILA 1ZTTA 4ZVHA 1YJNS 1FERA 4F8RA 3F44A 2ZH2A 4KGVB 4F26A 1YJTA 4OLOA 1VLYA 4W98A 4ZVEA 2MKYA 4OZNA 1Q8IA 2ZH1A 4HI1A 1Z1ZA 3FJ2A 3KLIB 1FRLA 1G1XA 5DDQC 2EFVA 5CH7B 4NCGB 2IAJA 4DCPB 3MI7X 3FRZA 4DFKA 5HBMA 4LRDA 3TVYA 3FZ2A 3CF5Q 2CWXA 2YQ1A 1HHTP 3MURP 1TMJA 3CSKA 2C3UA 4NLDA 3MM5A 4WWSA 3AQPA 3T6JA 4DS5A 1CULA 2C28A 4ED6A 2EBGA 3D6FB 1U2RA 4U7CA 6FD1A 2UU9J 1ITPA 4I7FB 3FSIA 4DFJA 3PYFA 3V6DA 4C8ZA 4I2PB 5A8KB 1FCAA 2CPXA 4PXEA 2Z2YB 4IDKB 1Q4RA 1YWXA 3VGTA 4LRAA 3TR5A 3UI3A 4LUBA 3N9UC 2DVIA 1H38A 2IYGA 5J2NB 2AYGA 2Y3YA 3EGWB 4OV6A 4U8VA 4MJKA 4G1IA 4I56A 3MR3A 4PWDB 4GO7X 1KQKA 2EK1A 2GMHA 3RB6A 3G6ES 3R3TA 2R7XA 2VG6A 2KYZA 4DV2F 8ATCB 2VBZA 3PJWA 1AZSB 3MM6B 2NUUG 1RU2A 4TYAA 1HA1A 5DM6Q 2VICA 1RUSA 4R5PB 2HQDA 1FKPA 1S1WB 3DU6A 2RDDA 4OZ0A 1Y3JA 1IBLF 1Q82T 2XNQA 4L74A 5E2QA 1S57A 2MDAA 2OMOA 4F4AA 2GHPA 5KFMA 3W3SA 1TUVA 3P6YC 2CPFA 5HAOA 1ZS6A 1SUQB 2DO4A 5A8RA 3RBXA 1S59A 4G6VB 1FHTA 2H5IB 4ILMA 2YNGA 4OHYA 1RTJA 1G6BA 3GYGA 4M5IA 2ZKUA 3OFHA 5THWA 1FJEB 2BMBA 4RUHA 4PUOB 1X4CA 5IC6B 3GJQB 4K4YA 2HAIA 3DRSB 4U8YA 2GFFA 2HHHF 1KLNA 1XERA 4DR6F 2WBRA 3B8HA 4TU8A 2CZVC 4JI7F 2D9OA 2B3TB 4C0HA 4DV2J 1RAEB 3PG9A 5F41A 3OTOF 3DLLQ 2DGQA 1PBUA 4DV6F 4M94A 1FFSB 1X5TA 3C14B 2OSQA 3PVXA 4DR1F 5B08A 4B9SA 4Q45A 4EGLA 2BQRA 2BE2B 4CH7A 5GMKa 2GMLA 4B9MA 4FPRA 2DCLA 2HZAA 1AUSL 3CCVS 2LKZA 1HMVA 1LFPA 5KG3A 4EO6A 2F5GA 1GX5A 3GIIA 3ITHA 3G6XA 1IBLJ 5KG0A 4LF4J 4YR2A 4QYRA 4JI2F 4J9OA 1EETA 3LGMA 2HBZB 5KG5A 1EHWA 4QW8A 3QRQA 4Y2AA 3H20A 3X1LB 1GTEA 2ZVSA 1I6JA 4DR7F 4KV8B 3MM9A 4IR1A 3W61A 4YR3A 2N4CA 1MWQA 3PW0A 1YBUA 1RWOB 5HQ8A 3QGPA 1A6LA 1CG2A 3PHEA 4ZPBA 4CLLA 1O6XA 2D69A 3DM2B 5L1JA 1TV6A 3R5BA 3DLHA 2DR8A 2GGPB 6AT1B 1S1UB 4Q0BA 3LF0A 1K9MT 4ZVGA 1S9GA 2HHHJ 2Y1IA 3HF5A 2SXLA 4DR6J 3UPFA 3AJ1A 2O66A 2VHGA 2BV3A 3QO9A 1TL5A 2P6SA 1RHKB 1U2FA 4RUCA 2M52A 2V8PA 3ZZRA 4DR1J 3AD8C 2E29A 4XDCA 2MZSA 1S9EA 2KXHA 4DX8H 3KLHA 3D0IE 2FUG9 1QAYA 1RTIB 1KOHA 2CJXB 1HPZA 3LANA 3NNAA 1TU0B 3OTEA 4IG0B 3IRXA 1F5CA 1U02A 1HD0A 3W5XA 4JI2J 2YTCA 4HYKA 4DR7J 2QIFA 2CVEA 3DLEB 1S6QB 1N6QB 2HFVA 2CQCA 4CT9A 5KFWA 2HHWA 2HFSA 4MK8A 1B0VA 5CCLA 1JJ2R 1WC6A 4LBPA 2B6AB 1N34F 4QU6A 6FDRA 3Q23A 3OJSA 2FHOB 2MQMA 4C3LA 5IT4A 4F36A 1KC8T 4AL6A 2G0JA 5F8IA 1RSCA 4C8NA 1U25A 2XMWA 3IN5A 1QSLA 2EEYA 3L7UA 2ZJPQ 2XS5A 4WFZA 1T7PA 1T9VA 4ZP7A 1FDNA 2VFSA 4ECQA 1G2EA 2CQIA 1D8ZA 4CH1A 2COLA 1WI8A 4P73A 1GMWD 2ZBRA 4FXVA 1PKUA 3OLAA 1RHMB 2H4WB 3N6LA 5HI7A 5F9LA 2PE8A 1HWLA 2PMWA 1JNZB 1PIEA 4LQ9A 2AZ1A 1PG5B 5HLFB 4J37A 4ZHRB 3D3CJ 3A8EA 1XJWB 3IS9A 1U09A 1XR6A 2POKA 3VHQA 1RISA 3M30B 2KYXA 3QSIA 3EWGA 1HBMB 3CO9A 2KKHA 1N34J 3C66A 3GIMA 2HLTA 4CZCA 2M8DB 1T3NA 3FBFA 3TUPA 4ED4A 5E33A 1H6KX 1AB8A 5HROA 3UN2A 1T9YA 1Q0NA 3J80U 3K89A 1RI7A 1RHRB 4FYXB 4DG1B 1CJUB 2HWTA 2JSXA 2LU2A 3W2WA 1N5QA 1RKIA 3EUNA 3BH7B 4WK1A 3ET6A 3H90A 3CEDA 1Q16B 3DMJA 3ZNUA 3QGHA 1VYAA 2IDEA 4CIOA 4QCLA 2L08A 4A4JA 4BBYA 2DNGA 2VFRA 1RWXB 5LJ3Y 4ECYA 1F6TA 1AT1B 2YXLA 4U6PA 5DS7A 5FIIA 4DQSA 2DH7A 3HP6A 1JB0C 2FHJA 4FVMA 2YQ0A 4FYVB 3SDEB 4K7QA 2NXJA 2RU3A 1Q7LB 1IJEB 4A48A 3KUEA 4YB7A 3EXYA 2L3MA 3Q8PB 4YDDB 4JV5F 1V3RA 5AXMA 2C2KB 1IBKF 3JTOA 3NNCA 1NKBA 3CD7A 3CDEA 2GV1A 3BO2A 3BQ0A 5KFUA 2LQBA 4OX6A 5A2QU 1NJXA 3IMQJ 1QVGR 2AHOB 1KFSA 2YVSA 2P9CA 1FEEA 3AHPA 3ZZYA 3QWPA 3TANA 1HWUA 4ZKAA 3POTB 3M32A 2G1HA 3EXCX 4U7UK 1G4CA 4A8MP 2I38A 2VV5A 2DHSA 1SPBP 1ZZFA 3VZHA 5FLXU 4IO9Q 2BJ7A 3IAS9 4WFAQ 1N33F 5KOXA 2YNIA 2WONA 5B0EA 5CYMB 2XO7A 3JSRA 1X7VA 4X84A 1RT3B 1SIWB 3KLGA 3HX9A 4DOZA 4O23A 3A8IA 2B7BB 4JUZA 4OHVA 4ZPCA 2CNOB 1RWVB 1KONA 2XS7A 3GSDA 4N47A 1HYSA 1YBAA 4N76A 1H2UX 2DNRA 4JV5J 1RBOB 1IBKJ 4LREA 4OZ3A 1M90T 3EE3A 2W9BB 4DPUA 3FDSA 1R8PA 1VMBA 2Y1JA 2D74B 2MQ8A 2DY1A 2WCXA 4LFCF 2CJQA 4DZ6A 3HSJA 4NA3A 3D6TB 4DF8A 2HKEA 4F4KA 3S7RA 2LVWA 2V69A 1UPMB 4YB5A 1AYEA 1OYEA 3D66A 2R2SA 1VQLS 2AJ1A 2R7UA 1RE1B 2LA6A 4F3QA 4NYZA 4ETXA 2BVZA 4JI5F 4OI0A 5EDWA 2WVDA 4X64F 1IBMF 1S1VA 2C3YA 1N33J 2L9DA 2RKIA 4ZS6A 5C42B 2J0XA 4TLRA 2CQ1A 5B0GA 2DR6A 2MJNA 3CCUS 2OAUA 1JLAA 4ZCIA 2O3DA 3HFKA 1UVJA 3PIOQ 2G2ZA 1SQFA 4RUAA 2BACA 2FGCA 4XDDA 4MKYA 2X3DA 1LWXA 3IO1A 3GB0A 2CUYA 3Q86A 4TLQA 1MG7A 4Y34A 3V81A 5J2MA 2AJ4A 2XY6A 2GIRA 5ETNA 2MHEA 1RBAA 3UN3A 4YHHF 4F04B 3MPVA 2IAJB 2J7KA 3KYLA 2W2NP 1Z2LA 2CQGA 2V8VA 3ELHA 5HBMB 5HATA 3JB9k 1T03A 4LFCJ 5DETA 3M6UA 5J2PA 1QVFR 2QA4S 2CPHA 3VAJA 1HLWA 1KTQA 5D4NA 1FA0A 3MM5B 5J2QA 1CULB 2WVBA 5DO2A 5BYRA 4NLXA 1QD1A 5K8OA 2HFOA 1UVLA 5EWEA 5LMUF 5MAOA 4JI5J 1X4GA 4BHQA 3OBIA 3V6DB 3CMQA 4X64J 2RHSB 5LOQA 3DRRA 3IWNC 2DRAA 3UNYA 3VV2B 3HM9A 2FC9A 2UXDF 4FYYB 2AJ2A 1CLFA 3BSOA 2J8AA 5F0UA 2QX0A 3EYZA 4IRCA 3EPIA 1S72S 2XMAA 2AGQA 1WKKA 3KXDA 1Q8KA 2AX1A 3KK1A 4UUXA 1UVNA 5SZTA 2DPJA 1U47A 4FF4A 2V8GA 2J76E 2VG6B 2JLGA 4DL3A 3K2YA 4KT0C 4X4PA 4UQGA 1PGZA 4CT8A 4YHHJ 3H59A 2DYAA 1WEZA 3GLJA 4AXIA 4ICLA 2EBEA 4OI4A 4WPAA 3H40A 4DWIA 2ZC3A 2MKCA 4M5MA 5C2GA 4B9NA 2YKOA 4GKKF 4LMZA 1X5OA 5LMUJ 3NXZA 4X65F 4EUVA 1TL3A 1JLFA 4L73A 4DV1F 1UVKA 4NLSA 4C8MA 3MR7A 3L4BC 2YNGB 1RTJB 4XIUA 3HKWA 2YQ3A 1K73T 2UXDJ 3KJVA 2NUHA 4RW9B 5K14A 4J9QA 3G2XA 1K0TA 3J81U 1PYSB 2RH3A 2RRAA 1TAUA 1OSDA 3OTDA 4IYQA 1UAWA 1L3UA 1PO6A 2MGZB 1RT1A 2VIHA 2LA4A 4ZPDA 2C1EB 3L09A 3WC0A 2JRSA 4JB8B 4FF2A 3ZNJ1 3QJPA 4CO0A 2BJ8A 5IFMA 4F0HA 5D4OA 1T05A 4DZDA 2HHQA 3RRHA 2WVEA 1HMVB 4AYBD 2W24A 3RAMA 3H7HB 3ITHB 4I6YA 4GKKJ 2J9EA 3BR9A 2GAHC 1EETB 4H4MA 4TQSA 1SJ1A 5I3UA 2F1FA 4DU8A 4X65J 4MIWA 3MM9B 2C2DA 1NK6A 4DV1J 3F0NA 2AP6A 3CTRA 2FVQA 2ADBA 3SV3A 1JNRB 4YFUA 1S0MA 3OTBA 3R5CA 3BSCA 3VVUA 1NB2A 1ZM9A 1TV6B 2KN4A 2PDAA 3ZTOA 1CBKA 4Q0BB 2PMHA 3PM9A 5BJRA 3CCZA 1PBAA 1WF1A 2UUCF 3ENVA 1IM4A 4WBFA 2UP1A 2R42A 4C8KA 2Z2ZA 3QO9B 4V19J 3DU5A 3HHLA 1PAEX 4MYTA 4WKYA 2OTLS 1N5YA 3G4SS 4QYZK 4WU3A 3PZPA 1VK3A 2FB0A 1S9EB 3AD7C 2GAGC 3KLHB 3THPA 2KL8A 1HPZB 2MJUA 5D78A 3P49B 1BE4A 3KMSA 1NK5A 2I5JA 3MMCA 3IRXB 4J9MA 3GCWP 2ALZA 1VJWA 1TR0A 4O3RA 2WOMA 1R7IA 4MH8A 4EMDA 5HANA 3W63A 4ANEA 2YWKA 1SJQA 1RT4B 3NY0A 4URSA 4RBVA 2FZCB 2B4UA 3TA1A 4WU2A 2H5JB 3N6MA 2DGVA 4IRDA 2VJUA 3HT3A 3F41A 3QRRA 3BF4A 3NGKA 4DL7A 1KLMA 1IR1A 5AJ3F 2N82B 2UUCJ 3A8JA 4KKOA 5IQ6A 2R9LA 2VDIA 1BQXA 2R7RA 2QGFB 2WTFA 1RT5A 4LR7A 2DNNA 4OZ2A 1LV5A 1Q78A 2RS8A 4UZCA 4HHHA 3CJQA 2O67A 2VBYA 1B64A 1FO1A 1U2CA 4RW6B 4ZLLA 2RIJA 2IRUA 4V1Ak 2HK2A 2CPDA 3HD2A 4ZVSB 1WELA 4N5SA 5GAEU 5KFZA 2PI5A 5C24B 3LQVA 2QA1A 2APOA 4HT7A 4OX7A 4XPEA 2M3DA 3MPDA 3U02A 1ZAXA 3IS9B 3BM7A 3LW5C 4RBTA 3Q8UA 5D8HB 3QPIA 4GMKA 3PIPQ 3FQLA 5KFJA 4MKAA 2J9CA 3UW1A 4QIGA 4KPCA 4M5GA 5D6GA 2NPIA 1C0TB 1FWPA 4ZP6A 3X3UA 3K0JA 3KHLA 2E1PA 5B0CA 4B17A 2OO4A 1ELOA 1YRTA 5AJ3J 4LBHA 4RW8A 2Y8YA 1LEOA 3I0SA 5HROB 1WHVA 2XC9A 4LF7F 2ZBIA 1X4DA 4GO5X 4B9LA 2BKOA 3RTVA 1ZM3A 4KAIA 2B0GA 4Q7AA 4O0IA 2V67A 3CCLS 1UPPA 3TP2A 1Q95G 2F4VF 4K4VA 3W2WB 4M5NA 4FP9A 1UJ5A 2PIIA 3HDSA 4LF8F 3ET6B 1DJ0A 7FDRA 2ZHBA 2PMZD 4JV0A 2ZJRQ 2DGWA 4CM2A 3A13A 1L3VA 3G71S 1ZBTA 2DISA 3DMJB 3VTIA 2RF2A 1ZZNA 1Y11A 2V9KA 3B78A 1UW9A 4C98A 1NNDA 2BJEA 2HBQB 3KWMA 4KIAA 2K3IA 2XMJA 1S1TB 2OPRB 4QZVB 4DSFA 1NSQA 1H7WA 4JI0F 1ZOTA 7AT1B 2FZGB 1WDTA 3E8OA 3F73A 4IG3A 3BPDA 3TJ8A 5IT9U 4ZLNA 2C42A 3OD2A 4PRFA 3NWGA 2X7IA 2XGPA 1SV5A 1Q1KA 4RW4A 3KK3A 2CNKB 2AD9A 4WE1A 1FTCA 1KS2A 3MUMP 2BEFA 2HRUA 3M8YA 3HHNB 3P96A 1RA7A 3GYNA 3MEDA 3RU0A 1C2PA 4C8OA 5KT4A 4K4ZA 1DTTA 3QIDA 1OO0B 1NPRA 2DGSA 3J7ZT 4QWBA 4ECRA 3HI9A 3AH6A 1TELA 1BXNA 4WIQA 2BBEA 4LF7J 1HQUA 2KXNB 2VD3A 2K06A 2KDOA 2V8HA 3KNGA 5ADZA 5K20B 1NH8A 1WTBA 1ZM4A 3C6TA 2BXJA 2VODA 2QO3A 2F4VJ 2E1CA 4ZLJA 4BLGA 2M9KA 1RT2A 4OI1A 3M32B 4ER8A 5U47A 1FFGB 4LF8J 2BM0A 4LRFA 3ZZZA 4DL5A 2JZ5A 3CIMA 2QL7B 2QSWA 3QT5A 2CKWA 4F2SA 3I96A 2MHNA 2GCFA 2CADA 3ONQA 2YNIB 4FKXA 1RQ0A 2WONB 3DOKA 3HVAA 2VKRA 2DRBA 5LMNF 3R2CJ 3KLGB 4OYWA 2XWYA 1IWGA 4UOCA 4JI0J 1YJ9S 1CQNA 2B5JA 1TKXA 1F0XA 3NAHA 4DR2F 1UZDA 1EJ7L 4F4XA 1NHKL 1NJZA 2E66A 2EVZA 2G4BA 5ETSA 4RNOA 1HYSB 4WP8A 5A76A 3PR4A 4WXWA 2W7AA 2DITA 3H5UA 2CFXA 4IO1A 3B4DA 3CPWR 1X4EA 2LEPA 4PPDA 4X4RA 1V3SA 3M9NB 4ZA1A 1IQZA 3QIPA 3RBEA 5GAGU 3IR6B 1S77D 1GNKA 4X4NA 3IA0A 1JLQB 2B4OA 5DLFA 4LT6A 4KE5A 5I3PA 2ZVIA 2BKPA 4K4XA 4I4BA 5AE1A 2VOPA 1SH3A 2F3JA 3O3LA 2NLWA 2N3LA 1UA0A 3CNQP 1N36J 1JJCB 1LWCA 4M5DB 3PO5A 3R1LA 2IA6A 1S1VB 2HVDA 2XS2A 2RKIB 1YRXA 3FKBA 4PR6A 1VBZA 1REGX 3S8SA 5LMNJ 1HHQA 2ALYB 5IWAF 2KT5A 4KB7A 5DGAA 2ZITA 4DR2J 4QW9A 1MW7A 4AL5A 4CWBA 3FMBA 1CVJA 3NOCA 2ZM6F 4E2FB 3MM8A 3KUHA 1UW4A 2AWZA 4RWXA 3V81B 4ZVPB 3QGIA 2F65A 4DPWA 3E51A 2W8LA 1BWVA 4DPYA 5DZ7A 3M9MB 2BW7A 2ACYA 2HYIB 3BDPA 2XNRA 2ZEJA 5K8NA 2QLJB 1F2GA 5K9FA 4TN2A 2QFJA 3IBCB 5EGYA 4IOCQ 4ED1A 2P9EA 4O4GA 2XLKA 3IXQA 3BQ1A 3CCMS 4JV2A 2VJVA 1KKHA 2RD5C 1UJ4A 3DRRB 2ACMA 1DRZA 2VU5A 2QLWA 2UUWA 2XHWA 4Y28C 2ERRA 3G96A 3SXLA 3M8WA 4CH0S 4WYLA 1HBUA 4ILLA 5IWAJ 3CCSS 2MSSA 3IM9A 5E3AA 2ROEA 3G8SA 1U8SA 1GAOA 2UUAF 2CQ2A 3RR7A 5KG4A 5DDRC 4DEZA 2MB0B 2XLIA 3KK1B 4EO8A 2Z30B 1S49A 2ZM6J 1IR0A 4MFBA 4ECXA 2QMUB 2MKJA 3S1TA 3GILA 4RNMA 4K8RA 1GX6A 1RTHB 2XYHB 5J1EA 2F9DA 4ECTA 1OJ4A 4DFMA 3CDWA 4M8LA 4ICLB 1KTVA 3R8YA 3M2VA 2JWNA 2CPIA 5KT3A 5KG7A 1KD1T 2QFIA 2RQKA 2V34A 9ATCB 2B4PA 3RG6A 3GV7B 2XLJA 4GKJF 4WFYA 2U2FA 5D3GA 1RAJA 1DTQA 3NMRA 4M5LA 2BJDA 4DLGA 2J8SA 1MMDA 1TL3B 1JLFB 1YDLA 5CYQB 4F3MA 3QLHB 2PSZA 2BOAA 3Q8YA 1FE0A 1FT8A 3W64A 1C0UA 4PXDA 2HHTA 5F3TA 4NLVA 4KO0A 2JL9A 3KJVB 3PRBA 2BJ9A 5K14B 3W8GA 3KLEA 1VQKS 4PPZA 2EKYA 2LP4A 1DZ5A 4HACA 1FKAF 2K1RA 2UUAJ 1RP5A 3C15A 1UP1A 5HK4A 4K5SA 4QIVA 3PXGa 2PFDA 1ZYQA 5KG1A 4HI2A 1RT6A 3C19A 1RT1B 4JI1F 2BRLA 2BA9A 3GONA 3OLBA 3ZZUA 2DH8A 1DBDA 1JXVA 4ED7A 3MMJA 3TX8A 3JSBA 1JLGA 3AY0A 4H4OA 2E44A 4EEYA 1T05B 1W25A 2EFOA 4LF5F 4UZBA 1X8DA 2MTLA 3N0VA 1IJFB 3UDEA 2C2EA 3H5SA 1WF2A 2EG2A 5FDLA 1R8AA 4GKJJ 5KFDA 4N8NA 1FJ7A 3W1YC 4LF6F 2D41A 5I3UB 1TL1A 4FDFA 5AXKA 2VPXB 4IFVA 2EXUA 1Y00A 4RKUC 2H1YA 4UOFA 5ETPA 1ZA1B 3FBEA 4LF2A 1VJQA 5SUHA 2B8PA 4O4RA 1HWJA 4Q2MA 4TKTA 4WTYA 1XMBA 1SJ3P 1UKUA 4V19X 3BBFA 5H1SV 5GMDA 4KHPF 4Q8FA 1NEEA 3RRGA 3JYTA 2FQQB 4OI6A 5ETTA 2C3MA 5LL6d 3VGUA 2QLBB 3ENQA 4N8OA 4OMFG 3MEGA 1R6YA 5L39A 4JI1J 2DR5A 1VI7A 3VF0B 3HHLB 2QG9B 3CWJA 4ECUA 1F2HA 4Q44A 3MCOA 2UVWA 3WDOA 1N32F 4DS4A 4M5JA 3DI6A 4LF5J 1LK5A 4CTAA 2A2DA 2W1BA 1QAJA 1LW2A 3I4PA 1RHQB 3SEOA 3VCDA 3NGUA 3EX7B 1MLAA 2I5JB 2OFGX 3MMCB 3MEKA 1YBTA 2XI3A 4K2XA 3CCTA 2WOMB 3M8RA 3R7SB 2X1BA 1WUUA 3NOGA 4LF6J 1HNWF 2WW4A 1NJYA 2HFZA 3SV4A 2GO9A 2AX0A 1UFLA 2OLWA 2VA3A 2ZOMA 5LXRA 3GFXA 1JX4A 2R2TA 4LJMA 2JC1A 4D3GA 1H3DA 5K5MA 3TAMA 2E5HA 1JLCA 4L75A 2VDHA 4G3IA 2VPYB 3VAGA 4HEA9 4IH7A 1NUEA 1OYDA 1EP4A 1RCXB 4KHPJ 5KFOA 5LT5A 4OJ1A 1KLMB 3BJYA 3RJMB 3CD6S 3KDNA 3J7YI 2DPIA 8RUCA 5C5JA 4USMA 2OEMA 2XM3A 1NDCA 4KKOB 3FC9A 1HNXF 1RT5B 3PX6A 5GAHU 1FE4A 1VQPS 2DGUA 4O3SA 2HS4A 1N52B 4Y65A 3ENAA 3KHGA 2BANB 1N32J 2DKOB 3TAPA 2R3VA 1F5BA 4WFBQ 3PX0A 4DBQA 3E01A 2X1FA 3D6HB 2VH7A 2CJBA 4PQUA 4FXDA 3EM1A 1HNWJ 3V5RA 1V9OA 4NLUA 3VAKA 5HP1B 2BOPA 3GU0A 1SL0A 1VQ9S 4A8FA 3CJTA 4NEYA 1S6PA 2JEJA 1D3WA 4IH6A 2D3OR 3VGSA 5D77A 4MMOA 1AROP 3I6PA 1VC6A 4D3HA 3VALA 3DYAA 1T11A 4RW8B 2YKAA 3A4TA 1WNEA 3I0SB 3G87A 3LH2S 1TUWA 4RNFA 2UVRA 4KGKA 2XMTA 2NXEA 2IY5B 1HNXJ 1NDKA 2KT2A 3QFWA 3EMTA 4KRWA 1D1UA 2W8KA 2Q79A 3PW7A 2WB1D 1IVZA 5HVFA 2HGMA 1RYRA 4PYAA 2X51A 3GYXB 2MYFA 2JVRA 2Y9HA 2CG8A 3AFGA 2NS1B 3SSQA 4WKRA 5I3QA 1TL4A 3LUYA 1VRQC 3WIUA 4TYBA 3QT8A 2QMWA 3I5AA 3IFEA 2OGUA 1HWKA 1L3SA 4RWWA 1RADB 1RAFB 2AV5A 4ANCA 3OHBA 4GVBA 4MIAA 3LP1A 3R5JB 4IG3B 4RW7A 3J7Z5 4HVZA 1PC5A 4B02A 1SV5B 4RW4B 2IVFB 4PAAA 2BJ1A 3KK3B 3G6YA 3K5MA 4WE1B 4WTOB 4UUWA 4NXNF 4CDIA 4PG7A 5D0GA 1MROA 1A0OB 1DTTB 1UVMA 3NRBA 1Q79A 4A46A 4B3SF 1VCTA 2YKQA 2IRXA 1GMWA 2GQ2A 1UZHA 1HQUB 4C2MA 1WC0A 3CJ8A 4LSNA 2HLUA 4LR8A 4Y2IA 5IM0A 3AD9C 4DI6A 4RU2A 1OPIA 2P6TA 3JXOA 3C6TB 1OIAA 2X1GA 3OHAA 1URNA 1ULRA 1ZTWA 3D54A 4X4TA 4X66J 3SQGB 1RT2B 2G0IA 4P2FA 1RB0A 4YR0A 2VUGA 4CLTA 2HW3A 3UCUP 1H73A 4ZIVA 4FYWB 4RX6A 2JEIA 1S0OA 2FJAB 1VRUB 5HO4A 4DX6A 4F2RA 1NKCA 2CDQA 2JFDA 3DOKB 3I0RB 1AUDA 4KHMA 5CAAA 4I1TA 4ED0A 4KJIA 3SSRA 3UDVA 3SBMA 3QMQA 2B5JB 4ANDA 1TKXB 3IBWA 3SQOP 2E5IA 4KHRA 1Y4ZB 4B3RF 1XIQA 3K5NA 2GVDA 1KQFB 1U24A 1RBLA 3R97A 1YVFA 5IT0A 5DRKA 5H9EJ 3AB4B 2M0GB 2JFKA 4JP8A 2V6AA 3TARA 9RUBA 3P45B 3Q0AA 1X9MA 2A0FB 5KFFA 1CSJA 2CIMA 4B3SJ 3DNCA 3QIPB 1R31A 1Q5VA 3T5KA 1CS4A 2N7YA 2JLEA 2B51A 4QIEA 1H72C 3AOCA 3AB2B 2R4FA 3WZ0A 4U7UD 4USJC 1HBOA 2AEMA 3CCJS 2LQ5A 4P71A 1VC0A 2ZD1A 1O8BA 4A8KA 3HFZB 3WX4A 3TO8A 3T5LA 4URQU 1FDDA 2XZDB 4JYAF 3PKYA 1BWEA 1FXDA 4B9VA 1F5AA 3OR1A 4FBUA 3U1LA 4IFYA 4LRCA 1FDBA 3DLGA 1GK8A 4NCAA 1SL1A 1KSPA 4PG4A 1FEHA 2LXUA 4B3RJ 2E7XA 1S6OA 3A8KA 3SYZA 3MM8B 2KRBA 2GHWA 4U67Q 2PN6A 4J9RA 2CAJA 3NAIA 4RLEA 4G1QA 3IR7B 4LBIA 2DGOA 2A10A 4P75A 2RHQB 3KLFA 3OPKA 1NLKL 4USKA 5T41A 4C0BA 2DNMA 1B0TA 3CC7S 1YQHA 1TP7A 1S6UA 3EGNA 4ZN1A 3MM7A 5C25B 5IV3A 4ZLPA 2CJKA 1WC4A 4A8QA 1HKAA 3CVKA 3ZO7A 2KJVA 4ZPVR 5CQGA 2AW0A 2HS3A 4Y00A 4ZIWA 1SB6A 2VOOA 3IAM9 2JH3A 2MMYA 5FD1A 4RUBA 1IKVA 4O4GB 2QRRA 1S7HA 5KFNA 3BV8A 4X4VA 1GMUA 3LP0A 4F25A 4TY8A 4JYAJ 3BDEA 4CYUA 4R8UA 4YOEA 3BO3A 2XB2D 2BQUA 4YMEA 2OH2A 4J90A 2PEBA 3BBCA 3HSDA 1WG1A 3LP2A 3CIZA 1VHFA 1EIYB 3BB5A 3DOMB 1D0EA 4MFBB 1DQ8A 5KFXA 4ZVRB 2YNFA 5M2UA 1LW0A 5AT1B 2VC0A 3TUJC 5HQLA 4CP5A 3QRPA 3U1NA 5DG9A 4HR2A 5J1EB 2HZVA 1BHNA 2Z0GA 1OY8A 1NJWA 1VIXA 3M2VB 4FS2A 3OVSA 2OPSB 2AJQA 2E5JA 2OSRA 2ZHAA 3CJSA 3MEEA 1HQ2A 2Z56B 2W2QP 4CLYA 2O5DA 1D9FA 4P72A 2M5YA 5D3GB 1XQIA 5KFRA 5GADU 1DTQB 4ENOA 3MAAA 2D3O1 2N3OA 1RAHB 2JX2A 4OLPA 2OHDA 3M6XA 1S12A 3P5TL 3PCOB 4OHWA 2DNZA 4WF9Q 5HL7Q 3TYTA 1EX8A 3K5PA 1C0UB 3V6JA 4KO0B 3MD3A 1G3OA 2XGQA 3PYEA 2AIRB 1RK8A 4ILRA 3UN5A 3KLEB 4EK2A 3PW4A 1D9DA 4HACB 2IVYA 4JI3F 1N56A 3KTQA 4C6AA 2R2RA 4FYDA 3C15B 4PEOA 1O51A 3GV8B 4NCGA 4NI2A 1RT6B 5IV4A 2KH9A 1VLOA 1FRXA 3TQ1A 4QOTA 3D67A 1MNEA 2AYMA 2LLZA 5CZXA 3LALA 1FF2A 2CQ0A 3DLKA 4DQIA 4ZVOB 1JLGB 1IUJA 4H4OB 3EGVA 3BGOP 4DSEA 1YHQS 3T5HA 1S0NA 2ZWPA 3GFHA 3W5YA 5ETKA 1UFKA 2ZUGA 2DT9A 2XTJP 2CPEA 1HW9A 4QIFA 3UR0A 2IJNA 3R6LB 4DCOB 4IH5A 3QYYA 3T3FA 1RHJB 2LFVA 1YKWA 3PEJA 3FSXA 1WF0A 3MECA 5A6WA 3FBBA 4F0MA 3FZBA 3CJ0A 4CO5A 5E3PA 2A1BA 1XR5A 4NZ7A 3T41A 3ZTRA 4PWDA 4USWA 4DUTA 3M1VA 2ZBCA 4ZOSA 3MPUB 4F67A 2H4YB 1S4EA 4JI3J 2I6WA 1ICEB 2G9OA 1AZSA 1UEVA 2IM1A 3KNAA 2DXFA 5BYQA 3R2DJ 3PDNA 3MEGB 3SMZA 3KLVA 2FLNA 2PD1A 4J7CA 2IIHA 4Q2LA 3PNIA 1JXEA 3TVKA 2KHDA 1NK4A 5HMWA 1ROFA 2E1MC 3UQSA 2XG8A 3QATA 3DI6B 4CTAB 2YY3A 4ELVA 1LW2B 4KGZB 2O01C 5BXIA 4JI7J 4ED2A 4DUZF 3MR6A 3DRPA 3OTOJ 4DV6J 4LVOP 4PZVA 3CW2C 3QJLA 3CC2S 3KJQB 2ZHOA 4R0EA 2YX4A 2UUTA 1FNMA 2IM3A 1N0VC 1T8EA 1HI8A 1I3OB 2V4RA 2XMUA 2UV8A 2Z57B 1VBXA 2CWKA 2ROPA 1CQMA 3R5AA 3TAMB 2CPYA 4DQRA 2E5LF 4ALZA 4CO1A 3VZIA 3PEHA 1W7WA 4TXSA 1EP4B 8AT1B 3HXMA 2QJ3A 4I6AA 3TA0A 1BD6A 3GV5B 2HG4A 4JBCA 3CD5A 3IG1A 3RUBL 1S1XB 3AA8A 4A8SA 2VQEF 3M05A 4I6WA 2ZH7A 1S76D 1UWBA 4J5OA 2JOQA 1VBYA 3H4BA 2G2YA 2Q6BA 2V2KA 2NSBA 3Q8QB 2KM8B 2HBRB 4DDFA 3CJ2A 2RAQA 1U8WA 1OS5A 1UEKA 1M1HA 2NZ4A 2ZH6A 3G8QA 1P27B 4PG8A 4LFAF 4I68A 2QYCA 5KG6A 2MZRA 1K47A 1V3ZA 2WAQD 4OZLA 4LIRA 2FYXA 1SH2A 2A2CA 1FFWB 1U45A 4WZMA 3HZEA 4PQUB 2R7TA 4EZ9A 4ZCKA 1QTNB 3WBZA 4DMZA 2LQ9A 3TZZA 4B3OA 1NPPA 2KTQA 2WSFC 4X4QA 3PHTA 2E9RX 2H51B 1R8BA 2PI4A 1KR4A 2AT1B 2I0XA 2MEWA 3W8PA 2FY1A 2W2OP 2WK4A 3GR0A 1KP6A 3T19A 2ILZA 3KG0A 2BABA 1HD1A 2E5LJ 2KU7A 4A8XA 2YKMA 2J9DA 1S6PB 1HHSA 3KFWX 2KHCA 2D1CA 4CLPA 1RLDA 2F40A 4QWDA 4KH0B 1SCJB 1P1TA 3SFGA 2OMLA 2BW2A 2VQEJ 3DYAB 2MZ1A 1Q5YA 3MCNA 3VAIA 1ZH5A 5KAKA 3DGPB 2B9YA 3C6UA 2FZKB 2J0WA 3M6VA 1AFIA 3OVBA 2M88A 4KBIA 2YH0A 1QE1A 2R7OA 1XNRF 1WOOA 1UFWA 2FPHX 4LSZB 4IUFA 3CGIA 4PG6A 2R8GA 2V5HG 5JJBA 1YSJA 1U0SA 2N4DA 2DR7A 1EQMA 2RDIA 2ZNZA 3EVOA 5KT5A 3NGSA 1K8AT 1VQYA 4LFBF 3V4IB 4PWWA 3GIRA 1S7IA 4OYZA 2J7UA 5EWFA 2HURA 2KRRA 3JAMY 2NYHA 1VIOA 1O5JA 3BREA 1VRTB 3GMGA 4OYBA 4LSLA 3FCHA 4K4TA 3EPGA 3UD5A 4MKBA 4OYPA 2UVVA 1HQEA 3LP1B 4NLGA 5IXUA 3BPSP 4BDPA 2DJWA 3I9V9 1SI9A 1SC6A 1U26A 5I4MA 1U1KA 4IKAA 3OVAA 4NLWA 2F8HA 2HQCA 1EQ0A 2HVIA 4NYOA 4P10A 3MMAA 2J6UA 1OQ6A 1TUGB 2WW8A 5F8NA 3GWCA 2OTJS 1N8RT 2FVCA 3H5XA 2M4MA 2LYVA 2VG5B 1SC4B 2ZBQA 3DN9A 1SC1B 3CUNA 3G86A 4Y6IA 2C2RA 4LSNB 4A47A 1FXLA 5IOLA 2IJRA 5B0AA 5IM0B 5T14A 2AYBA 1XNRJ 4DHVA 4KY3A 4QU7A 2AGOA 5KFBA 1J27A 3ZTSA 4KFBA 2OP5A 4CNZA 2BUNA 3OFGA 3AXKA 3J7A1 4QPXA 3Q22A 2ASLA 2ABYA 3NS7B 3V6KA 1T95A 2J0QD 2RUGA 2EFQA 2VBWA 1NSAA 2CG4A 4LFBJ 5G0RA 1NAQA 4QR1A 3AODA 5L46A 3W2VA 2NYIA 4M5HA 2KXFA 4DL6A 1RACB 3M30A 1WHYA 2Y1LB 1VISA 4Z2XA 2GO8A 3HFVA 1VHIA 1LWEA 4JI6F 5B0FA 3EZOA 3TOQA 3AAWB 3P4UB 1TKZB 2DCUB 5MLCV 1KHWA 3TWZA 4ZCMA 3LO3A 4Y3CA 4UY85 1RCOB 2FJBB 2LDYA 5T7LA 4DR3F 2HAFA 5ETOA 4KQZA 4QJVA 3NGDA 2GVDB 3RW6A 4CLWA 3ADAC 3FEXB 3SI8A 4KTQA 3QAUA 3Q89A 3I5CA 2M70A 2DNHA 4JV1A 2XSJA 1IXKA 2MLXA 2V63A 4HDHA 2JNJA 2ZBPA 2HVEA 2CQBA 3HVTA 3DHWC 3W9JA 1CS4B 3MR2A 2PFFB 3TEGA 1T94A 2CNLB 4F02A 4LVNP 5LSLA 3NG8A 2FJEB 3IGVA 1X9WA 2BQ3A 2W9CB 2NZCA 4UOHA 3SCLE 3VWSA 2Q43A 1HBOB 2R7VA 5F8MA 2QT7A 1YX2A 2ZD1B 2C2NA 1N0UA 3CULA 1FWLA 4FS1A 3UE2A 3D0GE 2DBBA 4Y2CA 3JQKA 2B43A 1WC1A 4RNHA 3Q8VA 2K3KA 1NM2A 2KG1A 2RS2A 1UTAA 5A8WA 3D2WA 4JI6J 1HI0P 1WKLA 3MUTP 4PXCA 4ED5A 1RT7A 4IOAQ 2DNKA 2ZZNA 4IFYB 1NRKA 1I94F 1V5VA 3DLGB 1R8CA 5M2PA 3HSGA 4DR3J 4TU7A 1R0AA 1LXNA 2J6TA 4WFXA 4NOHA 2ZH3A 3HHDA 3KDOA 5L1IA 4C4WA 2A6MA 4O3NA 1YJRA 4G1QB 1P9YA 3QBCA 4RPFA 3NBPA 1X60A 3KLFB 1NZ8A 4X4OA 1BQNA 3POTA 5DDPC 3GJSB 1UA1A 1NDLA 5KFEA 3D4JA 2R8KA 1DURA 1N4LA 1HWIA 2QL9B 1OQ3A 3O6QA 1T02A 3G9CA 2ILYA 3C3LA 4WZQA 1HR0F 4DL2A 1IKVB 5H9FJ 1M5KC 2HRTA 2KI2A 2DGXA 3EDRB 1RTDA 1SC3B 2QTWA 4YQWA 4B9UA 2KG0A 2RT3A 3SCIE 3OTCA 3M7VA 4C0OC 1R3NA 4CYUB 1OY6A 4KH1B 2B8QA 4R8UB 4AT1B 2VQFF 2IJFA 1PAUB 4ED3A 3W65A 5E5NA 4P2SA 1WSRA 1IBMJ 1FKOA 3LP2B 3T1HF 3NS5A 2DHGA 2MZTA 4DSIA 2FD2A 1RDRA 1NHVA 1W2BR 2F8MA 4WK3A 2WVCA 5JMNA 2G1DA 3JTPA 2YNFB 2P2CB 3K59A 4DV5F 3MF5A 1LW0B 2HHXA 3CJ3A 2MLZA 4ZITA 2LMIA 4F0KA 4WP9A 4NRTA 1QUPA 2G13A 1NSPA 1W26A 2RU9A 1ZPVA 3EZUA 3MEEB 3QQCD 1TK0A 5L9XA 4Z7YA 4ZPTR 5E0OA 1HR0J 2LQJA 3RAXA 3MAAB 4OV1A 2Y0BB 1KOOA 1RYSA 5DQGA 2WHOA 1FKPB 2GVZA 3GG1A 4QPTA 2GQCA 1GXLA 4WXOA 2IMOA 3IR5B 2JHEA 2MQOA 2AEFA 4XK8C 3BKUA 1YI2S 1VQ6S 1IBCB 5E3RA 2BJ3A 2VQFJ 5KFTA 1FI4A 1FTRA 5A8RB 4NE9C 2UVUA 3T1HJ 2OKQA 3J81j 2J5AA 2P9GA 4JI4F 1KWMA 4NI2B 2QYGA 2DGTA 1L5UA 1REVA 4L3NA 3L7OA 1ZPWX 3LAMA 3IBFB 4NCBA 1GFWB 4DV5J 1NXIA 1PILA 4ZVQB 2HFNA 2XY7A 2XWXA 3B6BA 5CYJA 3DLKB 2R2UA 1VQ7S 2I2YA 3I87A 2ATCB 3SSSA 2WZ1A 3H98A 5HMYA 4OZJA 4IRKA 2MKHA 2FVSA 5F8HA 3ILOA 5KT7A 1RWNB 1Y9OA 3TZWA 3Q24A 1FD2A 1VK8A 2CA9A 2KZMA 2XI2A 3SCJE 1TFYA 1Z4UA 1YITS 4ETZA 3MECB 1N54B 4ZDNA 3PO4A 1XWLA 3E3XA 5HMZA 4QWAA 1KNZA 1PJ5A 1AXQA 1T9XA 3M1VB 1H2TZ 2OPPA 3FFIA 2A18A 1XTZA 2HGLA 1G7CB 2RB7A 2N7CA 4JI4J 1LOUA 2Y1RI 4USUA 4BC7A 3ZFVA 3UDCA 4GRSA 2CZ4A 4CO2A 4OI2A 1UMJA 2IC3A 4LF4F 1S9GB 1VQNS 3AT1B 5B09A 2EPIA 1BC6A 3TI0A 2VFVA 4W92B 1X4FA 3N5BA 1RWKB 4NLQA 3W60A 1H7XA 1SVDA 3UD3P 1GQEA 4USIA 1GMVA 1KDNA 1Y5LB 2XCPA 3DRPB 3N5FA 5I42A 1VR6A 3AOBA 2V2QA 3FGVA 4FZVA 4DR4F 1YTYA 2W2MP 3H42A 3CJRA 3T9NA 2HVZA 3U7JA 3K58A 4RW9A 1IWAA 3K7RA 4HDGA 4ZVFA 3D1OA 1U6BA 1NHUA 3C16A 2KB2A 1QSSA 4K59A 4ID8A 3T1YF 3GSIA 1RA6A 1KHVA 2XY5A 3C8YA 2B4VA 2MGZA 4YY3F 1DAXA 2HNDA 1Y10A 4OYIA 2XCAA 2DXEA 3IG1B 4PYDA 1UETA 3ZZPA 3L3CA 2YH1A 2YKNA 1B7FA 1J2VA 1UWBB 1KQGB 2EKNA 4F4YA 3GQCA 4B3TF 4ID5A 2E9TA 1SBRA 4WFNQ 4RR5A 2PEHA 4Y2KA 2Z4PA 2J7WA 3AJDA 4QQBA 3KKFA 1WHXA 3LPYA 4M5KA 3T9ZA 4AQYF 2OD6A 1YJ7A 3QAEA 2A3JA 4CI0B 2QSFA 1IKYA 1IM6A 3DDIA 3C46A 2WBMA 4OQJA 2CQ3A 2RDJA 3CMES 1HI1A 4QIWD 3ETOA 3CDAA 1QJHA 3NCRA 1TKDA 5JUMA 2HS0A 4USVA 4DR4J 2HNYA 2VBXA 4ZMMA 4B3OB 3GCXP 4MYUA 5AXLA 3VR1A 3V6HA 4GC6A 1O0PA 1YGYA 5DM7Q 1HARA 2OFHX 4HTJA 3BGRA 3T1YJ 3LAKA 1R27B 3KUGA 2VZ9A 2YKMB 1R8HA 5E3QA 4R0JA 3NCPA 4YY3J 1WDDA 4FF3A 1JLEA 2L41A 2JLFA 2BE7D 2IBOA 3C6UB 2Y0SD 2MQLA 4ZCLA 4B3TJ 3P8BB 2RUSA 4GVLA 1QE1B 4XO0A 2JVOA 5HN0A 4WIIA 2OJ3A 3QGGA 2HNZA 4RU9A 3I56S 4LRBA 4AQYJ 3OQ2A 4DQPA 1QDUB 4CNYA 4N77A 1VQ4S 3U27A 2QMXA 2IBKA 4K4UA 2GJFA 2KT3A 1RT4A 1TAQA 1JK9B 1S79A 2V2ZA 1LNQA 2EI5A 4LR9A 2R8JA 4YB6A 5D15A 1P9QC 5E7OB 1UCNA 4LSLB 3K17A 5HMXA 3LTOA 2DNQA 2EK6A 2WVFA 1HQEB 3W66A 4NEZA 3UO0A 1TTHB 1KQSR 2NREA 4XAKA 4HH1A 3TUZC 1T9WA 2L9WA 1M5OC 3A1YG 4YS2A 3MMAB 3PR5B 5LSOA 2CQHA 3I9ZA 2NXNA 1VBKA 1VDHA 4C8LA 1EZZB 4H4KC 4RW6A 3OUYA 3PV8A 5A0YA 5D0HA 2WSEC 3PW2A 1Q8BA 4ECWA 4CLFA 1NK7A 1HNIA 1U7LA 1DLOA 2XZWA 1SXLA 3AXMA 3VVTA 4N7TA 5B0BA 1JWWA 5C24A 4KFBB 2XBPA 2MQQA 4NLTA 4H54A 3UCGA 3DFEA 1Y7PA 4K2JA 4U9RA 1ZAVA 3O2IA 5G0RB 3W2VB 2QEXS 3QNWB 1FESA 2OPQA 3CMAS 4Y2MA 3DDNA 1APSA 2DNOA 1LWEB 4CLKA 2HVHA 3HJVA 4K5RA 3PYGA 4DPOA 5KFCA 1C0TA 2AEJA 2V4QA 5LJ5Y 5GAEI 3D28A 2PA3A 1D8YA 5T7LB 2ZE2A 1S9FA 4YN3B 3H8YA 4BWMA 1HL6A 3IM8A 5BR8F 1J5EF 2EFNA 1I1GA 3K5OA 3IP0A 4IQMA 4EYIB 1WSVA 2W25A 2YNHA 3MWBA 2XSJB 1GTHA 3BYPA 3DC2A 4NLOA 5E41A 1IN0A 4FPIA 1OMSA 4P2XA 2D3UA 3O1LA 5HVHA 3HVTB 1CJTA 2VG7A 2YX1A 2K7JA 1D9AA 3CE8A 1YRUA 2DIVA 2VPZB 4OYOA 4P7VA 3QT6A 1VQOS 2JEGA 3H2LA 1S1TA 2D9PA 2OPRA 4DUYF 3N4WA 3FMWA 4XPCA 1UVIA 5H9EK 3HHEA 4P7TA 2HQGA 1K44A 2CZ9A 5F9NA 4M1KA 5A8WB 3QJJA 2GC8A 2AJFE 4IR9A 1RT7B 1FD8A 4M63A 1SL2A 3DDKA 2ADCA 3OT9A 3OSNA 3KHHA 3CD0A 3EVMA 2RMLA 1Q81T 3Q2TC 3GJTB 2FJXA 1R0AB 1JIHA 5EHHA 2OEJA 5BR8J 1J5EJ 2QLFB 2H48B 2V0NA 2CVIA 3Q83A 2A6OA 2F63A 3HHKA 2QV6A 1U48A 5EUHA 7FD1A 3R7NB 1K1QA 2GQQA 3EGZA 1JKHA 3NBPB 1JLAB 4QR2A 1WWHA 2ZNYA 3RB0A 4F4WA 4DFPA 4EWTA 2LXIA 4FKYA 1FRJA 4O0NA 1QAXA 2H65B 2CPZA 3HT0A 1BQNB 2YWWA 5KOWA 2OI2A 4UOGA 2LECA 2HSEB 3QFHA 3CCES 5AXNA 2JC0A 4L72B 3NNHA 3GPAA 5KFIA 3GIKA 1CPZA 2FLPA 5J2MB 3VGVA 4HHUA 1B70B 3LGNA 3KJNB 3OXGA 3FCVA 2ZDOA 2CJYB 3R27A 1RU1A 1M5HA 3P5BP 1ZA2B 4DUYJ 4OX8A 1T03B 1YLXA 2MZJA 5J2PB 2HMIA 1BUXA 4RL1A 3I32A 1RTDB 5DG8A 3O44A 2CQDA 5L8RC 3BZQA 1S0VA 4NYPA 5J2QB 2UZAA 1M5SA 3AQOA 2DRDA 4EU0A 1X4BA 5IZHA 3FVYA 1R43A 1UWAA 2ASYA 2KM8C 3QT7A 4Q8EA 4J9KA 3E2EA 1C1CA 1S99A 1FKOB 3ZTPA 2ZH4A 3VAMA 1U6ZA 4DSKA 4CRJA 3OL8A 4ATNA 3L7PA 1TFWA 1WKJA 4ZVUB 4B3MF 4ELUA 1RJJA 4IQXA 2Z58B 1JLQA 3R9LA 2C22A 2H3EB 3MMBA 5ETLA 2Z8QA 3J80Y 1FWKA 4P74A 1J5OA 2RE1A 3PFEA 1KN6A 3ICLA 2KZZA 4M5DA 4P6QA 3KHRA 4NA2A 3OFFA 1NK0A 4AD6A 4W4MA 1YJUA 4HTIA 2AF6A 2E9ZA 3H2VE 2V4JA 3JSYA 5GAGI 3H25A 3GIJA 3Q8RB 2NR0A 2CJ9A 2GVZB 2MLYA 1FX2A 5KT6A 3N6NA 5K8MA 4HHJA 4ZP9A 2C2ZB 3MD1A 1C1BA 4ZP8A 2MKKA 4FNIA 3EVWA 3MCMA 1S4FA 3EICA 2K8GA 1GXUA 4C8YA 2IPOB 2HHUA 4NMXA 4NXMF 1S48A 2OEKA 2HRYA 3BO4A 4PCQA 3DOLA 3ZZTA 2ZH9A 1REVB 4B3MJ 3T5JA 3TUIC 4O3OA 3GTYX 2DHXA 5A2QY 2XYGB 3LOUA 4JOUA 1FRKA 3W7BA 4K0KF 1FRIA 2UV8G 5BYSA 4OZ1A 3BN4A 2IHR1 3BGFA 5JVGQ 1S5ZA 5JVHQ 5LSRA 5C7PA 4NMLA 1URRA 2MZQA 4J9SA 3CT9A 3OSPA 4BWJA 5KFYA 1SH0A 1E6YA 4OHXA 5FLXY 1TK5A 3CC4S 3BN7A 4OYXA 4AUKA 2P8IA 1U1NA 1M5VC 4N41A 3H4DA 2IA0A 3SIPB 1OWXA 3L9ZA 2RVJA 2LEAA 3GR1A 3HK2A 3Q2SC 3HLUA 1NDPA 2EFPA 2C2OB 1SJ4P 4H4MB 3OL7A 3RB4A 4ERDA 3G8TA 1RKJA 2B9XA 2OPPB 3FFIB 1S10A 4B08A 4J9LA 4E98A 4NXMJ 1LKZA 2ZWOA 1IKWA 4QBUA 3RBZA 3THTA 4ED8A 1JLBA 4DL0C 1RTHA 2XMVA 4YB1P 5M2RA 4K50A 1WHWA 2QA2A 3H0PA 4O44A 1OSCA 3BBBA 1SKUB 4K0KJ 1RAOA 2CJAA 2DXDA 3MZIA 2L48A 2IC3B 1X5PA 2GIFA 4DX5A 2AYEA 1VQ8S 4PG5A 4KPYA 1H0HB 3NLCA 1QUVA 2C3PA 1ZM2A 1N5YB 5CYQA 3US5A 2U1AA 3QLHA 5I42B 3WIVA 1JMTA 4I64A 4F7VA 1WD6A 2NXCA 3O5TB 1BQMA 2H5EA 3O8WA 1NU4A 2W7OA 2JDJA 5IC4B 1TVRA 1AW0A 1M1GA 2C2MB 3PY8A 1B99A 1JJ4A 3S6EA 5F8LA 5RUBA 3C16B 2GW8A 1ZAWA 1B0PA 4FN5A 4ECVA 5KFQA 3J7AN 1CJKA 1HBNA 1SQGA 4L6V3 2VASA 3OV7A 1RAGB 3ZZ0A 1PYOB 3V2UC 2HNDB 2ZZTA 1H74A 1MSWD 2AQ4A 1JXLA 1H2VZ 2RQCA 2YKNB 4DSJA 1CJVA 2BRKA 4DLEA 4ID5B 4FXWA 1F9EB 2EWHA 2Q6CA 1DARA 5HQMA 4DJBA 1IQTA 4L3KA 3R5DA 2QL5B 3FEZA 2HHSA 2HPUA 2GZOA 1IKYB 1F3VA 2FLOA 5EX3A 3KK2A 1E6VA 1FX4A 3R1HA 4ZJOA 3MAHA
chains in the Genus database with same CATH topology
2IYGA 3DCAA 3OVAA 3K57A 4NLWA 2E5GA 2F8HA 4C7QA 4K4XA 5J2NB 4I4BA 2AYGA 2HVIA 5AE1A 3CJKA 1X5SA 2VOPA 1SH3A 4NYOA 2EW9A 2F3JA 3O3LA 2NLWA 3EGWB 3MMAA 2N3LA 2J6UA 3OL6A 1OQ6A 4MJKA 4G1IA 2WW8A 4I56A 5F8NA 3MR3A 3GWCA 4GO7X 4PWDB 1KQKA 2EK1A 1UA0A 2HNYB 2OTJS 1N8RT 2FVCA 1LWCA 2M4MA 4M5DB 3PO5A 2LYVA 3H5XA 2VG5B 3R1LA 3DN9A 3VQSA 2GMHA 3RB6A 3CUNA 3G6ES 2M2BA 3RR8A 3R3TA 3G86A 2IA6A 4YUDA 1S1VB 4Y6IA 2VG6A 2R7XA 2XS2A 2RKIB 2C2RA 2KYZA 1YRXA 4LSNB 4DV2F 2DNPA 4A47A 3N28A 1FXLA 4PR6A 1VBZA 2NSCA 2VBZA 5B0AA 3PJWA 5IM0B 5T14A 3MM6B 2NUUG 2AYBA 4FNHA 3S8SA 1MU2A 4TYAA 3BGRB 1HA1A 4DHVA 2W9AA 5DM6Q 4QU7A 2AGOA 4R5PB 5IWAF 1YJVA 1N5SA 5KFBA 2KT5A 4KB7A 5DGAA 4KFBA 2OP5A 4CNZA 2ZITA 4KSEB 4QW9A 2BUNA 3M2RA 3OFGA 2YWGA 3J7A1 4QPXA 3Q22A 1FKPA 1S1WB 2ASLA 1MW7A 2ABYA 2FVPA 4AL5A 3V6KA 2EFGA 1T95A 2J0QD 2RUGA 1C4CA 2EFQA 3DU6A 1JLEB 2VBWA 2CG4A 1FK9A 2DNLA 3FMBA 1CVJA 4OZ0A 1WI6A 1HW8A 1Y3JA 1IBLF 5KT2A 1Q82T 2XNQA 5G0RA 1NAQA 4QR1A 5E2QA 3S01A 2ZM6F 1U1QA 3MM8A 5CXTA 2MDAA 3W2VA 2NYIA 4OJHA 2OMOA 3PW5A 3RYLA 3M6WA 1UW4A 2GHPA 2KXFA 1SIZA 4DL6A 2AWZA 3M30A 2B9WA 4RWXA 1WHYA 1LXJA 4Z2XA 3V81B 2GO8A 5KFMA 3W3SA 3QGIA 1TUVA 1LWEA 2B56A 3VQTA 3P6YC 4JI6F 3E51A 2CPFA 2W8LA 5B0FA 3TOQA 3AAWB 1TKZB 1SUQB 2DCUB 1KHWA 2HNZB 2I9SA 3I31A 4AFFA 5MLCV 3M9MB 2DO4A 5A8RA 2XULA 4ZCMA 4FVCA 3LO3A 4G6VB 4Y3CA 1FHTA 2ACYA 4ILMA 2YNGA 2HYIB 4OHYA 1RTJA 4UY85 2FTRA 3BDPA 2FJBB 2XNRA 1G6BA 1NO8A 3GFZA 4ECZA 2LDYA 5T7LA 4DR3F 3D1QA 3AA9A 4KQZA 5K8NA 4C3KA 2ZKUA 1F2GA 3OFHA 5THWA 4QJVA 3NGDA 1N5VA 3RW6A 4TNOA 5K9FA 1FJEB 4TN2A 1S97A 4RUHA 4PUOB 1X4CA 4OFZA 2QFJA 3G6VA 4K4YA 4EBCA 4IOCQ 3FEXB 5EGYA 1MMLA 2HAIA 3DRSB 4IOBA 3K5LA 4A8WA 3SI8A 4KTQA 4ED1A 2P9EA 3QAUA 2GFFA 3I5CA 4O4GA 4X2BA 2HHHF 2XLKA 2BYCA 3IXQA 3UNGC 1KLNA 1X0FA 3BQ1A 3CCMS 1YJWS 1FJGF 2RSQA 4JV2A 2M70A 1XERA 2GMJA 2V8DA 4DR6F 2DNHA 2RD5C 4KC5A 4JV1A 2WBRA 3B8HA 1VQ5S 2IVMA 2XSJA 1XMOF 1IXKA 3BGUA 3MTJA 1UJ4A 1VFJA 4TU8A 4BS2A 2CZVC 3DRRB 4JI7F 3THVA 2D9OA 2YX7A 2B3TB 4C0HA 1DRZA 5F41A 3OTOF 4HDHA 3DLLQ 3WC2A 2DGQA 4DV6F 2IYIA 4M94A 2QLWA 1X5TA 2UUWA 2CQBA 3HVTA 2XHWA 3DHWC 2RF2B 4Y28C 2FJVA 4A8YA 3MR2A 2OSQA 3PVXA 4DR1F 5B08A 3G96A 3SXLA 2ERRA 4B9SA 4CH0S 4Q45A 2PFFB 4WYLA 4EGLA 1HBUA 1T94A 5AE2A 4F02A 1BLUA 2BQRA 4LVNP 5LSLA 2BE2B 3NG8A 4ILLA 2FJEB 3IGVA 1X9WA 3CCSS 2BQ3A 2MSSA 3RB3A 4CH7A 5GMKa 2W9CB 2GMLA 5E3AA 3RRKA 2ROEA 4B9MA 3G8SA 4FPRA 2DCLA 3SCLE 1U8SA 1GAOA 3CCVS 2LKZA 3VWSA 2Q43A 2UUAF 1HMVA 2CQ2A 1HBOB 2G0CA 1LFPA 3RR7A 2R7VA 5KG4A 5KG3A 5F8MA 4EO6A 3NL0A 2QT7A 5DDRC 3J81Y 1GX5A 3GIIA 2ZD1B 4I69A 2ZKTA 1N0UA 3ITHA 4DEZA 2MB0B 3NCQA 3CULA 2XLIA 3G6XA 5KG0A 3KK1B 4EO8A 1S49A 4YR2A 4FS1A 1K1SA 4QYRA 3UE2A 1IR0A 4JI2F 4J9OA 3D0GE 4EBDA 1EETA 2FHJD 3LGMA 2DBBA 4Y2CA 2BANA 4MFBA 3OUYB 2C3OA 4ECXA 2B43A 4DF4A 4NLPA 5KG5A 2MKJA 4QW8A 4RNHA 3S1TA 2K3KA 3GILA 3D5MA 4KR0B 2KG1A 4Y2AA 2RS2A 4RNMA 3H20A 3X1LB 1GTEA 5A0YB 5A8WA 1P8GA 2ZVSA 3CCWA 3D2WA 4KV8B 1I6JA 4DR7F 1HI0P 3MUTP 3MM9A 4PXCA 1GX6A 4ED5A 4DQQA 1RT7A 4N56A 4IR1A 1RTHB 4IOAQ 5J1EA 1HNIB 4YR3A 1DLOB 4AE5A 2F9DA 3MEDB 4ECTA 1Z2ZA 2DNKA 1YG0A 2ZZNA 2N4CA 3MHYA 3HMJG 4DFMA 3CDWA 4IFYB 4M8LA 1NRKA 4ICLB 3PW0A 1KTVA 1I94F 3DLGB 5HQ8A 3QGPA 1A6LA 1R8CA 3M2VA 2KFNA 2JWNA 5M2PA 2CPIA 5KT3A 2R7SA 5KG7A 1KD1T 1NK8A 1CG2A 3PHEA 4ZPBA 2HHVA 4TU7A 2FC8A 1IKXA 2RQKA 1R0AA 1LXNA 4I2QA 3DM2B 5L1JA 1TV6A 2B4PA 5L9NA 3R5BA 5GAHI 2J6TA 4WFXA 3DLHA 4NOHA 2ZH3A 3M2UA 3GV7B 2DR8A 2XLJA 2GGPB 3HHDA 1S1UB 1CC8A 5L1IA 3DRXA 4GKJF 1FVQA 2BDPA 4WFYA 4Q0BA 3LF0A 4PKDB 2U2FA 4A8OA 5D3GA 1RAJA 1U49A 1K9MT 4C4WA 3HZGA 4ZVGA 4O3NA 1XK8A 1YJRA 4G1QB 1DTQA 2R8HA 3NMRA 5HP1A 1S9GA 2OPQB 3NBPA 2Y1IA 3HF5A 2BJDA 2SXLA 3KLFB 2CQ4A 3UPFA 3AJ1A 4DLGA 1MMDA 2O66A 1TL3B 1JLFB 5DLGA 5CYQB 4X4OA 4C11A 1BQNA 2BV3A 3POTA 3QO9A 4F3MA 1TL5A 3QLHB 2PSZA 5DDPC 3I55S 2P6SA 5F8JA 4UW2A 4USHA 2GJ2A 1FE0A 1U2FA 1UA1A 1FT8A 4ZPAA 4RUCA 2M52A 1C0UA 4PXDA 2HHTA 5KFEA 5F3TA 2ZE2B 2R8KA 1DURA 4KO0A 4NLVA 3ZZRA 2JL9A 4XDCA 2E29A 3KJVB 1N4LA 1HWIA 5FJ4A 2MZSA 3PRBA 1OQ3A 1P1LA 5KFPA 1S9EA 2KXHA 3O6QA 5D4PA 4DX8H 1T02A 2ROGA 4MK7A 3KLHA 3G9CA 5K14B 2ILYA 3KLEA 1VQKS 3D0IE 1QAYA 2FUG9 4PPZA 4NLYA 1RTIB 1Y5IB 2EKYA 1QAIA 3C3LA 3IWLA 1DZ5A 1FKAF 2K1RA 1KOHA 4WZQA 1HR0F 1HPZA 3LANA 3NNAA 1RP5A 3OTEA 3CCRS 4IG0B 1UP1A 4DL2A 3IRXA 1CC7A 4K5SA 1IKVB 4QIVA 3PXGa 1F5CA 5H9FJ 1ZYQA 1M5KC 2YNHB 1NZAA 2KI2A 5KG1A 4HI2A 1RT6A 1HD0A 2DGXA 1RTDA 4YQWA 2YTCA 1WTFA 4B9UA 1RT1B 4JI1F 2KG0A 2BRLA 2RT3A 3SCIE 2BA9A 5F3ZA 4HYKA 3OTCA 4C0OC 1TK8A 2QIFA 2CVEA 3OLBA 3CCQS 1R3NA 3DLEB 3ZZUA 4DV0F 1S6QB 2DH8A 1FJCA 1DBDA 1N6QB 4CO4A 3TNVA 2CQCA 4ED7A 3MMJA 3TX8A 3JSBA 4CT9A 2VG7B 2J0SD 4R8UB 1XR7A 2OIHA 5KFWA 2GA7A 2HHWA 1JLGA 3AY0A 4H4OA 2E44A 4EEYA 1T05B 3OR2A 3RAQA 1W25A 2EFOA 4UY8T 4LF5F 3RZAA 4MK8A 1X8DA 1B0VA 3N0VA 5CCLA 2VQFF 1JJ2R 3CB4A 3FEYB 1IJFB 2IJFA 2B6AB 2C2EA 2H9ZA 3H5SA 2PC6A 4ED3A 1A9NB 4OZ5A 5E5NA 4P2SA 1N34F 2R7WA 4QU6A 1WF2A 1FKOA 6FDRA 4DV3F 3LP2B 3Q23A 3OJSA 3T1HF 3NS5A 1U1LA 2FHOB 1DQ9A 2DHGA 2MQMA 4C3LA 3FNNA 5IT4A 1KC8T 2EG2A 2MZTA 4DSIA 5FDLA 2FD2A 1RDRA 1NHVA 1DQAA 1R8AA 3TRGA 4AL6A 1W2BR 5F8IA 2KVIA 4C8NA 5KFDA 2F8MA 4N8NA 1FJ7A 4WK3A 1U25A 2XMWA 3IN5A 4LIWA 2G1DA 3JTPA 1QSLA 2YNFB 3K59A 4LF6F 3M8PA 4DV5F 2D41A 3MF5A 1LW0B 5I3UB 2ZJPQ 2CQPA 1TL1A 4WFZA 2XS5A 4K4WA 2HHXA 5AXKA 1T7PA 2VPXB 3CJ3A 4IFVA 4I67A 1Y00A 4RKUC 4ZP7A 1FDNA 2LMIA 4QWEA 1KVJA 2VFSA 2PGCA 4ECQA 1G2EA 2CQIA 1TKTA 4NRTA 1GXTA 1D8ZA 3I5BA 5SUHA 4O4RA 1HWJA 4Q2MA 5L1KA 4TKTA 3UD4P 1QUPA 1N88A 1LWCB 3CXCR 4WTYA 2AU0A 3HJFA 2G13A 1XMBA 1SKWA 1SJ3P 1UKUA 4CH1A 4V19X 2RU9A 2COLA 1WI8A 1ZPVA 3EZUA 2EG1A 2NPFA 4R25A 5H1SV 3MEEB 3RBDA 1TK0A 4DV4F 4Q8FA 4KHPF 4FXVA 3MAQA 2DNYA 5L9XA 4ZPTR 3OLAA 5E0OA 1NEEA 3BSAA 2LQJA 3RRGA 2HWIA 3JYTA 2DO0A 3RAXA 1WEXA 4OI6A 1JKHB 3N6LA 5HI7A 5F9LA 3LWMA 1QSYA 4OV1A 2C3MA 5LL6d 2PE8A 1KOOA 1HWLA 3ENQA 4N8OA 4OMFG 5CZVA 5DQGA 1JNZB 1RYSA 3VAHA 2WHOA 1SQEA 1FKPB 4LQ9A 3MEGA 1R6YA 5L39A 1X9SA 1NKEA 2DR5A 1VI7A 3SQGA 3GG1A 3VF0B 5HLFB 3HHLB 3CWJA 4ECUA 4J37A 2M7SA 4QPTA 2GQCA 4ZHRB 4Q44A 2UVWA 1GXLA 3A8EA 2PO4A 4WXOA 3IS9A 2IMOA 1U09A 3HKZD 1XR6A 3WDOA 1X4AA 2POKA 2ZDPA 1N32F 3CJ5A 3IR5B 2JHEA 4DS4A 2MQOA 1N36F 4XK8C 1RISA 3M30B 2KYXA 4X62F 1YI2S 3DI6A 2RRBA 1VRUA 5E3RA 1VQ6S 3DLBA 1LK5A 5KFTA 4CTAA 2A2DA 1QAJA 4CCHA 1FTRA 1LW2A 3I4PA 1HBMB 3CO9A 3SEOA 5A8RB 1SJRA 2KKHA 3C66A 3VCDA 2UVUA 3I0RA 5CA5A 3GIMA 3EX7B 2HLTA 2I5JB 2OFGX 3MMCB 4CZCA 2M8DB 2OKQA 3MEKA 3RW7A 4PRFA 2J5AA 1T3NA 2P9GA 4LQ3A 4JI4F 2LXFA 2XI3A 2DGTA 4K2XA 2HMIB 1L5UA 3BR8A 3CCTA 1REVA 4L3NA 5IQQA 3L7OA 1ZPWX 2WOMB 2DD8S 3LAMA 4ITSA 4LF9F 5E33A 1VQMS 3M8RA 1H6KX 2X1BA 4NCBA 5HROA 4NL5A 4HT5A 1HNWF 3GZ7A 1PILA 1NJYA 2HFZA 3SV4A 2GO9A 5IS2A 2AX0A 1UFLA 2HFNA 2XY7A 2XWXA 2OLWA 2VA3A 2ZOMA 1RI7A 5CYJA 5LXRA 3DLKB 2R2UA 3GFXA 1JX4A 2VPWB 2R2TA 4LJMA 2JC1A 4D3GA 1H3DA 1VQ7S 4DG1B 2I2YA 3I87A 5K5MA 3SSSA 3TAMA 3H98A 5HMYA 2E5HA 1JLCA 5L1LA 2HWTA 4OZJA 2JSXA 4IRKA 2MKHA 2FVSA 4G3IA 2ZC4A 2VPYB 3VAGA 2LU2A 3W2WA 4HEA9 1N5QA 4IH7A 5F8HA 2VC1A 3JSMA 1C1CB 1RKIA 5KT7A 3EUNA 3TA2A 2ZH5A 1YIJS 1EP4A 1Y9OA 4WK1A 1HNVA 5KFOA 3Q24A 5LT5A 4OJ1A 3CEDA 1KLMB 1FD2A 1VK8A 2MQPA 2IM0A 3BJYA 1Q16B 3CD6S 1HBUB 3DMJA 3J7YI 2KZMA 2DPIA 2XI2A 3QGHA 5DQHA 3SCJE 5C5JA 1TFYA 3MUVP 4CIOA 4X4SA 1Z4UA 1YITS 4ETZA 4QCLA 1XEZA 3MECB 4KKOB 2L08A 1N54B 4A4JA 4CO3A 4BBYA 2DNGA 2VFRA 3OW2R 1HNXF 1RT5B 3MMBB 5LJ3Y 4C97A 5GAHU 3PX6A 3I4HX 4ECYA 1FE4A 2MPUA 3ISND 1VQPS 4U6PA 5DS7A 2DGUA 5FIIA 4DQSA 4O3SA 1J5OB 2DH7A 4ZDNA 2X1AA 4EYHB 3HP6A 1XWLA 3PO4A 3UDLA 2HS4A 1N52B 1GT8A 1WEYA 2OD4A 1JB0C 3E3XA 4KGMA 5HMZA 4Y65A 3HHNB 3DHXA 3KHGA 2BANB 1Y3KA 2FHJA 4QWAA 1KNZA 4FVMA 2W4CA 1AXQA 5CHCB 3TAPA 2V94A 3M1VB 1H2TZ 2OPPA 3SDEB 3FFIA 1F5BA 2A18A 4WFBQ 3PX0A 2RU3A 1Q7LB 4DBQA 1IJEB 4A48A 2IM2A 4YB7A 2KO1A 1TZ0A 3E01A 2X1FA