1UKUA

Crystal structure of pyrococcus horikoshii cuta1 complexed with cu2+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
b'MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords periplasmic divalent cation tolerance protein CutA
publication title Structural implications for heavy metal-induced reversible assembly and aggregation of a protein: the case of Pyrococcus horikoshii CutA.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Metal binding protein
total genus 31
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ukuA00
4CO2A 2NUHA 1P1LA 2NUUG 4NYOA 4D3GA 5L9NA 2ZFHA 3GSDA 4CO0A 4WK1A 1UFLA 2VD3A 1KR4A 2ZOMA 4E98A 1V9OA 3TA2A 2PIIA 2J9EA 4CNYA 3L7PA 4C3LA 4RWXA 2RD5C 4USIA 1H3DA 3TA1A 1O5JA 4NYPA 4WK3A 1VHFA 1NAQA 2XZWA 2EG1A 1QY7A 1V3RA 5D4NA 3AA9A 3M05A 4ZK7M 4R25A 2O67A 3AH6A 3LF0A 2J9DA 4AFFA 1UMJA 1VFJA 3AHPA 3N5BA 5D4OA 3T9ZA 3MHYA 1NH7A 4OZJA 4C3MA 3OPKA 3NCPA 4RLEA 1PILA 1O51A 2O66A 2V5HG 2XG8A 4IYQA 2J9CA 4CO1A 3DFEA 1GNKA 1UKUA 2GX8A 4YB7A 4CO4A 4USHA 5DRKA 4OZNA 4RWWA 5D4PA 1NH8A 4YB5A 4USJC 2J9DE 5DS7A 3O8WA 3NCQA 2EG2A 5D4LA 3X3UA 1NZAA 2Z0GA 4OZLA 4RX6A 2XBPA 1OSCA 4C3KA 1J2VA 2XULA 4Y65A 1V3SA 4CO3A 3BZQA 3CE8A 2E66A 1V6HA 4YB6A 2NS1B 1UL3A 1XK8A 4Y6IA 2CZ4A 2GNKA 3NCRA 1Q1KA 3O5TB 4CO5A 3TA0A 1HWUA 4CNZA 2GW8A 3AA8A 4D3HA 2JJ4D 3HLUA 2DCLA
chains in the Genus database with same CATH superfamily
5T41A 2DNNA 2W25A 5L1JA 3R7BB 3CDAA 1C4CA 4P2FA 3TJAA 3LGMA 1PC5A 2XNRA 3MCOA 3RAXA 4LF1A 5BR8J 4LF6F 3JAMY 3DGVA 2IIHA 2K8GA 3UCZP 4RWXA 1RAFB 4KH0B 1UWBA 3KK2A 4IO1A 1MN9A 4DSIA 5A8WA 3SCKE 3MGJA 4JI8J 2IMOA 4RBUA 3BGOP 3PX0A 3KLEB 3CEDA 1N34F 1Q0NA 4LSLB 1R8AA 2RILA 1I6JA 4LSNA 4I6YA 5D4PA 5KT7A 2L3MA 2LVWA 1Q79A 5D0RA 1SJ1A 3BGRA 3Q8VA 4JI0F 4LRAA 3BH6B 4KFBA 1SI9A 2BRKA 2LEPA 2MHNA 1VLOA 5KAKA 3N9UC 4EO8A 2E1MC 1HBMB 3MPUB 3BM7A 1MMNA 4NCGB 1QDUB 5C5JA 2W7PA 2A6OA 1JLEB 5BXIA 3GWCA 3DN9A 1OY8A 4QIGA 1R31A 3TNVA 5HQMA 1JIHA 2VD3A 3PJ9A 4DG1B 1HKAA 3QSIA 4GKKJ 1RHQB 4NLTA 2R7RA 4J9QA 4V1Ak 2AYMA 1YZ6A 2DY9A 5HROA 4AUKA 4ZS6A 4QWCA 2CJQA 3T9ZA 3PO4A 4QIVA 4ZVQB 3HHLB 4GMKA 4DL7A 1UVIA 2J7KA 2ALZA 1KP6A 5CH7B 2NXJA 3TI0A 2V34A 1GNKA 2DR5A 4LR9A 2JSXA 4ZPCA 4ZMMA 1RTJB 3DOMA 1YTYA 3AY0A 1RTHA 3H59A 5HJXA 2XYHB 1FD2A 3PZPA 4OJGA 5EDWA 3L7OA 3BBCA 1TAQA 2QT7A 3THPA 2CZ4A 2CPDA 4Y28C 1HWIA 4CDIA 4EYIB 4LIRA 3M8PB 5DM6Q 3NGKA 3NWGA 3HHEA 5ETNA 1J27A 1V3ZA 5J1PA 1OIAA 1FEHA 2V94A 4NZ6A 1G3OA 4C8OA 3W5YA 4C48A 4DXLA 2GAGC 2HVZA 1CVJA 4DCOB 3SQGA 1YHQS 4ICLB 2QA2A 3FFIA 3I5BA 3CIZA 4CI0B 5G4DA 3CWJA 3TZXA 2YKPA 3GPAA 3PIOQ 3OJSA 1KWMA 4YY3F 4JI2J 4C0BA 1CJUA 5KT6A 1Y10A 3WZ0A 1FRJA 3BH7B 1NNDA 4AXIA 2NXCA 4KKOA 4KT0C 4CLFA 2OEJA 2HHWA 4F4WA 4FBUA 1V3SA 4Z7YA 3T1HJ 4RW9B 1X8DA 2R4FA 3M30B 3LGHA 5A6WA 3UNGC 1U09A 3PRVA 2VFUA 2Z2MA 3NNHA 2WVBA 2RHSB 3D1QA 2K3KA 4UQTA 1RAOA 3MMBA 3RZAA 4IFVB 1G4CA 2E5LJ 3TAMA 3C2PA 2HHXA 5FIIA 5EWGA 3RW6A 1UFLA 4IDKB 3M2RB 3V81A 2LP4A 2QN6B 3Q2SC 4IR1A 3K17A 2DGSA 4USIA 2KYZA 2XGQA 4OI4A 1O5JA 1RSCA 3HD2A 3TARA 2P9EA 1GXTA 1IN0A 3IM9A 2BBEA 2FVCA 3KLHB 2D41A 3TQEA 1QSSA 1WDDA 1BMQB 3F73A 3NL0A 5DG9A 2WW4A 3MR3A 3GV7B 2MLYA 1IKYA 1FRHA 1RWKB 2DKOB 3AOCA 2V4JB 1UW9A 1JXEA 4RU2A 1GXLA 4JV2A 3HDSA 2OI2A 4JV5J 3VAFA 2DXDA 3IBCB 3CO0P 3W9HA 1IM4A 3CMAS 4I69A 2M9KA 4B3RJ 2DVIA 1P9YA 4DQQA 1N52B 2VBYA 1S72S 3CJ3A 4BC9A 2W2QP 1XR7A 3WBZA 1NHKL 1HWUA 3C19A 3MOZA 1UZHA 3KMSA 4NX9A 5ETSA 4IOBA 1NK7A 4TLRA 3CNQP 1U2CA 5JVGQ 1RZMA 3ZTPA 5C2CA 4WFAQ 1RQ0A 2ZKUA 4RW4A 5CCMA 2JLEA 1YG0A 4Y00A 3MM7B 1H2TZ 1S99A 2J0WA 3J81Y 3IBFB 3OFGA 4OHWA 5D78A 2WBMA 3I0RB 3GJQB 1YVFA 4A48A 2VQFF 1RT6A 1BQNB 5KG0A 2EK6A 5IV4A 1L3UA 2CAJA 1S9FA 4C8LA 4KB7A 4CM0A 1HI1A 2FLPA 4BHQA 5D0EA 3Q83A 1CULB 3QGHA 4PG5A 2LKZA 2CADA 4G6VB 2HVEA 1NDLA 2YNFB 2LMIA 4QW8A 1FDNA 5DLGA 1HBUB 2GGPA 1T3OA 2BE9B 4IG3A 2CQBA 3RGIA 4DL0C 5LJ3Y 3M8ZA 2HG4A 2ALYB 2BABA 3DXBA 2QMXA 2VFSA 1Z2ZA 3CMES 1CJVA 1KBRA 2F9JA 3PHEA 5A6PA 3QT6A 1DRZA 1JXVA 2X1FA 4I0WA 1QSYA 3FJ2A 5IQ6A 2RAQA 2YKMA 1J5EF 3C16B 2RF2A 1WNEA 3BS9A 2QLJB 1GH8A 2MZQA 4R8UB 2YKOA 3DHWC 1WDTA 4RW8A 2XMJA 4YDDB 1Q7YT 4URQU 3KNAA 3O2IA 1VISA 1Z2LA 2QL5B 2FHJD 2KG1A 3JSRA 3DLKB 4YHHJ 1NSQA 5LXYA 4H4MB 2XEXA 5C42B 4IRDA 5B0BA 2YX7A 3PCOB 3BDPA 3DGPA 2AJ4A 4OX8A 1HA1A 5CCLA 2DTJA 2AT1B 2AEJA 2HWIA 5K8MA 1VBXA 2C2KB 8AT1B 2Q6CA 2XNQA 4ENOA 4ZK7M 2J76E 2H4WB 3CD5A 3GV8B 1VQOS 5J1EB 4USUA 4KGMA 2C3PA 5KG7A 4NCAA 1RE1B 1PBAA 3Q23A 4JI8F 1H0HB 4PPZA 1RXOB 2L08A 1TMMA 4ALZA 3P96A 4OZ2A 4OX9F 3HP6A 4HL9A 3ZTQA 1RT7B 3H2VE 2F3JA 2C2EA 1LK7A 2Y8WA 1XJWB 1WI8A 3PEHA 2RT3A 1WHVA 4PEOA 2ZE2B 4JI5J 4QR2A 4ZPDA 3GFYA 2NUHA 2I5JB 2UUBF 4K50A 3QRRA 3JSMB 2X3GA 2G1HA 7AT1B 1KD1T 1O8BA 2VG7B 1LQ9A 2VG6B 3R6LB 4WKYA 1OQ3A 3D54A 2B56A 2C22A 3IR7B 3FUYA 4NLSA 3CJ8A 1T7PA 4PG7A 1UWBB 4MFBA 4OYBA 3FBCA 3KK2B 4KGZB 3W9JA 1WSRA 4C3MA 5A8WB 1MU2A 4O4RA 2BKPA 2DGTA 3VVUA 4EBCA 4DQSA 3ZZPA 3O8WA 4LSNB 2M52A 2COLA 3GIJA 3H42A 4AXJA 3VALA 1NUEA 1F9HA 1SQGA 4F2SA 2ABYA 1NCLA 3NGSA 1UTAA 4DL3A 3K5MA 1KOHA 3I6PA 1T9XA 4NEYA 1B99A 1APSA 3N6LA 3JYTA 3S8SA 2ROGA 4ZJLA 3B4DA 3ENAA 2PFFB 3PJXA 4O3RA 2W9BB 2RS2A 3D9BA 2IBKA 2QTWA 1WKLA 1BGXT 4Q8EA 2OLWA 1A9NB 2HQCA 4MIAA 3J7YI 1U0HB 3GU0A 2KI2A 2GHVC 1VGYA 2P5VA 1NRKA 2XMWA 4CT8A 1F5CA 2MZTA 1VQNS 5ETQA 2YWEA 2IJFA 5SZTA 2EFOA 3MM5B 3N01A 2BQRA 1M5HA 3R5AA 2GHPA 4KV8A 2AZ1A 3H40A 1QM9A 2ROEA 3X1LB 1X9MA 2ZBIA 1OSCA 2X1AA 1ZZFA 4ID8A 5HSPA 3JS9A 2JVOA 4ZHRA 4ED1A 3M6UA 3CDEA 1V6HA 4H4KA 1H2VZ 1YSJA 4OHVA 2W4CA 3O1LA 2GNKA 2DNRA 5KFQA 2G13A 1BE4A 4MJKA 4HLBA 3TA0A 4F2RA 1JJ4A 3GJSB 4M94A 2JC1A 5J2QA 4YEAA 4U7CA 2JWNA 5HMXA 3CD7A 3MD1A 2ZOFA 1HL6A 5IT0A 2YTCA 2W9CA 4RL1A 2HPUA 2E5LF 4YOEA 3GYGA 1RAGB 3TW0A 3V6HA 2RUSA 5F0UA 2VIHA 2R7TA 4JV0A 5GAHI 5JUMA 1RTDA 5B0GA 5EWFA 2ZC4A 2B9WA 3QGGA 1BY9A 5LMNJ 4QWBA 3FC9A 4R25A 3SQGB 1S9GA 4AFFA 4GKJJ 2ERRA 1WF1A 5HLFA 1N5TA 3F44A 3DMJB 1UKUA 2RHQB 5HMWA 2V2QA 1RA6A 3GIMA 4USJC 4YUDA 1CBKA 4K4WA 1CJUB 4HI1A 2MZRA 3MMCA 4H4KC 3FCHA 3GP9A 3W8GA 1MLAA 3A1YG 5ETKA 4JV5F 2ZH7A 2L9WA 2UUCF 4DJBA 2OTLS 3MFHA 1OO0B 2Y1LB 2XMTA 4C4WA 4B3RF 1IJEB 4O0IA 1CPZA 3FSXA 2OSQA 2UUTA 1JNRB 5HL7Q 4N5SA 4FYWB 2V2VA 5H9EJ 1SJQA 3EE3A 3BV8A 3Q8YA 1WF0A 3EGWB 1U8WA 4CCHA 2E1AA 2PD1A 3MMBB 4DCJB 1K0TA 1VQYA 3EDQB 1R0BG 3BPDA 2XHCA 3TAMB 2NREA 2FJAB 2BW2A 4DQPA 2QSWA 1S6QA 4O3OA 3DRRA 3NLCA 3V81B 1XMOF 3HSJA 1HNIA 4QU7A 2C28A 4L3KA 1U45A 1NSAA 2CNLB 1N5YA 2CDRB 2HYIB 3E51A 3D6TB 3AD9C 1S4EA 3J80U 3KDNA 1UZDA 3QIPB 1FRIA 4KQZA 2YWKA 4JI6F 4F4KA 2E5JA 3LH2S 1NDCA 1RT5A 4RX6A 2XBPA 1TU0B 2IM3A 3TZYA 2C3OA 2P8IA 2H4YB 3RBXA 3HSDA 3A8JA 2G2YA 1GX5A 2HZAA 3DNCA 2FB0A 3TAQA 4WZQA 5B09A 2X1GA 4OHXA 4F04B 2VKRA 1EHWA 3W9IA 2ZH3A 1CJTA 4M5MA 2H65B 3D4JA 4QPTA 4DS4A 3VAIA 4DR2J 4ZVFA 4FXVA 3FSYA 1C1CA 2DH9A 3PW2A 2ZDPA 3TX8A 3HFZB 4G1QA 2HWTA 2Z4PA 3SFUA 3HCXA 1U2RA 3MTJA 4X64J 4J91A 1CC8A 4AT1B 4J9KA 3G86A 3KYLA 4G1IA 3QJLA 2VICA 4DV1F 1YKWA 3N5BA 4K4YA 2FHOB 3TJ8A 5BJRA 1S6PA 4OZ0A 4CLLA 1LW2A 1WI6A 5FLXU 1U6BA 1PYSB 4LF5J 1JLCA 2OIHA 2HLUA 2D3O1 1TL1A 4U8VA 2C3MA 2XCAA 1QE1A 1M1GA 2HHPA 3CCRS 4UOHA 3ZZ0A 3BSAA 1N6QB 1T03A 2QYCA 3RU0A 3NBPA 4N8NA 2ZZNA 2XWXA 1RT6B 4B3SF 2OSRA 3HFKA 2KTQA 2DH7A 4ZVRB 1FJGF 3LPYA 2ZWOA 2I38A 3HVTA 2UXDJ 2AGPA 2D7SA 3BN4A 3Q8PB 4CLSA 3I56S 4ELUA 4IO9Q 4FYXB 1N0UA 1ZM3A 2VA2A 2KJVA 1HQUA 4JYAJ 2XZWA 3R27A 3QT7A 4M1KA 1H98A 2ZH2A 3A8EA 1UJ6A 1U26A 4I2QB 4YR3A 2YWWA 3R5GA 4PZVA 3FCVA 2WB4A 5B0DA 3DM2B 3T9NA 1CJVB 3PM9A 2JFDA 1KKHA 1YQHA 4U6PA 4J9MA 3I31A 1CEZA 3WQPA 2BMBA 3PW4A 3WDOA 4WFBQ 2YKMB 4UOCA 1C2PA 3BYRA 1EIYB 4L72B 2NSBA 2GMJA 1WC6A 3PW0A 3Q2TC 2RU3A 5D6GA 3IBWA 1W26A 1P6TA 3TX0A 4TU8A 3FNNA 1PBUA 1RT3A 4ZP7A 1IKVA 1U47A 3SV4A 1PGZA 4D3HA 2BJEA 2JLGA 1TELA 4Y3CA 1WWHA 4JI5F 4NYOA 5L9NA 3G6VA 2AKWB 1KR4A 4B08A 3BN7A 2AYBA 2LXFA 1G1XA 4L74A 3UR3C 3S7RA 1JLQA 4Z2XA 2HHQA 1K1SA 4ETZA 2R7SA 2IMWP 3KUEA 2LYVA 2OPRA 5CAAA 3OTBA 1HD1A 3NCPA 1MWYA 2EFGA 2DCUB 1S57A 2MB0B 1VQ8S 4DDFA 3CD6S 4DPUA 2OHDA 4OQJA 2LCWA 1RA7A 2YPZA 3UPFA 1KVIA 5K9FA 4PCQA 2LA6A 3NGUA 1X31C 2ZBPA 2DR6A 1RAHB 5GAEU 3ZTRA 4ECZA 3OVSA 3MUVP 2IC3B 2DRAA 1TUWA 3LW5C 3QQCD 5KFNA 3M8WA 2K7KA 4J9UE 2GIQA 2A2CA 4A8MP 2VPYB 2HS4A 4KGKA 2KXHA 5KFYA 2G4BA 3I87A 4CWBA 2E1RA 2M8HA 3CW2C 1Q8LA 2B7CB 2WB1D 3PX4A 4N76A 4K5SA 3BBBA 1NLKL 4KY3A 4WIQA 4DPWA 2HHHF 1RHKB 3HZEA 4X62F 4O3QA 2RH3A 5F8NA 1N48A 1EKSA 1WUUA 3L3CA 5DQGA 3AH6A 3PACA 2B5JA 4MFBB 4OLPA 1DBDA 2QLXA 2E9TA 3JAMU 2HNZB 3GCWP 2DR7A 3H5XA 5IM0A 1MU2B 2HGMA 5IS2A 2YPYA 4LBHA 4M63A 5CD4H 1FFSB 2HMIB 2OELA 4B9MA 4GVBA 1Y00A 2GQ2A 4QIFA 2V9WA 4C8YA 2M8DB 1YITS 3C6UB 4YR2A 3DLEB 1REGX 3CCWA 3OLBA 2MMYA 4X66J 3CCJS 2DHHA 3DHXA 1XMQF 4DL6A 1RB0A 4NI2B 1HYSA 2R7QA 1WHWA 3JYTB 2H48B 1ZM4A 4QPXA 4XPCA 3WHIA 2QYGA 1XMBA 1XNRF 3MEGA 2QLWA 2VBXA 2IY5B 4X4UA 2F4VF 1TKZA 2IDLA 3DC2A 5L8RC 1TR0A 2MZSA 3F41A 2IVMA 2E5IA 3MEKA 4U95A 3R5JB 5KFBA 5LMNF 4DLGA 3UN2A 3GE9A 2ROPA 2AJ0A 2L9DA 3PW5A 1PIEA 2MKSA 1Q81T 4CLWA 1FXRA 1NHVA 1FO1A 1C0TB 2V5HG 1SKWA 2M5YA 3VQSA 1E6VA 4CO1A 3B78A 1YX2A 4NLXA 4KV8B 2RMLA 2N3OA 5H9FJ 3IGVA 5KFWA 5F8JA 1X4CA 3BREA 3PRDA 1FRLA 2AJ2A 3PR5B 3I32A 3KK1B 4NZ0A 3HHNB 1LKZA 1MN7A 5C2GA 2RE1A 1WEXA 1WG1A 4ZHRB 2JL9A 3A8KA 3J81j 4WKRA 1ZOTA 2QIFA 3OXFA 1XBWA 2R8JA 1M5PC 3BQ2A 3TVZA 5C24A 4DV5J 1HW9A 2RDJA 2W9CB 3ENVA 4DR1F 3MI7X 5ETLA 3I5AA 1VK8A 5AJ3J 3PYDA 4CQ1A 4DL2A 1HBNB 4ZVSB 4QBUA 2EG1A 4N47A 4LVNP 3GG0A 1QAXA 1WHXA 1H7XA 3MHYA 2R9LA 4JBCA 1XNQJ 2RS8A 5C25A 4CRJA 2M4MA 5HLFB 5B0AA 1U8SA 1RTZA 2IJRA 4WTOB 2VV5A 4OI2A 3I5CA 4QYZK 2VQEJ 5HVFA 3A13A 2UP1A 3MMCB 2CQ4A 4QWEA 1D1UA 1KTQA 3ILOA 1FWKA 4HEA9 2KU7A 3FEXB 3W61A 1F6TA 2JHEA 4USMA 5I3UA 3OXGA 1FX2A 4O0NA 3KHHA 2K3IA 1EP4A 2O01C 3MM8A 2DITA 1ZM2A 2HHTA 4DR5J 2VFVA 2WONA 2JX2A 2QSFA 2RRNA 1MWZA 3CJ5A 2A1BA 4FS2A 2FJEB 2OPQB 1FKPB 5E5NA 5LOQA 2O1PA 1FDAA 1YRXA 2XQCA 4YMEA 3UDCA 2CKWA 1UPMB 1FRMA 4I67A 2OD4A 1RABB 3CJ0A 2DNPA 1KOOA 3U02A 3EVMA 1V3RA 3CCMS 5KFFA 3UCGA 4X64F 1HNIB 2G2ZA 4NA3A 1X5PA 4CP5A 1U2FA 2QE5A 4RBTA 1KVKA 1IWGA 1RK8A 1N5YB 1NSKL 2H5EA 3HVAA 1RWVB 3MTKA 4LF5F 1KEKA 3QAUA 1BQMA 2CNOB 3X3UA 2YWFA 4PYDA 1RWNB 2EFPA 3BKTA 4FS1A 5HP1A 3OBIA 1LXNA 5J2NA 2QFJA 3MF5A 4WTYA 3VGSA 2HNDB 4ZVEA 1RT5B 3IRXA 4DPTA 5SUHA 2XMUA 4HT5A 2CQPA 5I42B 2F63A 3E01A 4ZVUB 3CJKA 4TN2A 1S1XB 1YRUA 4P52A 3ILIA 2E5GA 2M2BA 3KJVA 1TKDA 2XM3A 5J2MB 4DU7A 1TKTB 4Q2MA 2HIYA 2GC8A 1C1CB 4ZP8A 3KWMA 2NZCA 2B51A 5H1SV 5FDLA 1IBKJ 1Y3KA 2LQ9A 4G1QB 3G8QA 4JYAF 3JQMA 2XSJA 2V8DA 1NEEA 2I1RA 1TKXA 1R8CA 2DIUA 4YB1P 3PVXA 3C14A 2ZHOA 3LALA 3G2XA 1JLCB 4DX7A 2XS5A 3K57A 4FDFA 3OVAA 2F8EX 1TL1B 5L9XA 4UUWA 3GTYX 3J81U 2ZNYA 1VRTA 4U96A 2CA9A 4ZP9A 3CGIA 3NBPB 2UUAF 4KAIA 1H73A 4ZCKA 4HHUA 4EGLA 1AW0A 2NQPA 1Q16B 3HKZD 2BANB 2M7SA 2WAQD 3EDRB 2HVIA 3D0GE 3HVTB 2A10A 2XWYA 1N33J 4PYAA 4OV6A 4J9RA 5HAOA 1ZPWX 2ASJA 4KRWA 2MGZB 5FD1A 4C0HA 2DBBA 3DDKA 3IG1A 3IAS9 2DNOA 1V5IB 4LBPA 2BDPA 2AV5A 3NS5A 4K5RA 1E6YB 2LU1A 3QAEA 4ZOSA 2ZHAA 1VIOA 3TUIC 4CT9A 3QO9A 4GO7X 5A2QY 2CJBA 4ED8A 2VC1A 2XULA 2LQJA 3IA0A 2CFXA 2DHGA 2OO4A 3H5UA 4DX8H 4W90B 2MKJA 2QFIA 3UCUP 2R42A 2JRSA 4DFPA 1K44A 4YDXA 1VMBA 4WIIA 4KHPJ 2VDIA 3ITHA 1JKHA 2XMVA 3LO3A 2VH7A 4DV0J 1H6KX 4I4BA 3V4IA 2LDIA 2OJ3A 1KVJA 1P1TA 5HMYA 2DEJA 2R7WA 3IWLA 4WF9Q 5CZVA 4L76A 2VJUA 4K4ZA 3L7PA 5K8NA 5KT3A 2AGOA 2YNIA 3SSSA 1S1VA 4USVA 2GJIA 2ILYA 4B3TJ 3LGNA 3M9OB 3UD3P 4MKYA 4B9UA 4I2PB 3KXDA 4NL5A 1R8PA 1TFYA 5M2PA 3T6BA 4OZ5A 1U1LA 4L75A 1T9YA 4USTA 1RISA 1RT1A 2CNNB 4WFZA 2OEMA 3P4UB 3SXLA 4CLTA 5GMDA 3PKYA 1LV5A 4DHVA 4I56A 3N5FA 1GTHA 1JX4A 4LRFA 2YBVA 1HBOB 4ZPTR 3C6TB 1ZAVA 4OJHA 3F0NA 1JQGA 4R5PB 2QO3A 3AB2B 1X60A 2GVZA 4X66F 2FUG9 2FJWA 4L6V3 1WACA 1WD6A 2JVRA 1FKOA 3CJTA 2FJXA 1ZTWA 2V8GA 2RSQA 2OUGA 3V5RA 4BCAA 1M5VC 3FEZA 2KL8A 2QZ8A 1QTNB 4ER8A 3DOLB 4RNFA 3KG1A 4DI6A 3RBDA 1S0VA 1IBLJ 4JI1J 1VFJA 4DR6J 1NH7A 2DR8A 3CB4A 1DJ0A 5LSLA 1G6BA 3GFXA 3I0SA 4WYWA 4OHZA 5K8OA 3GILA 3R2CJ 2N82B 4TY8A 3UFCX 4GRSA 1LWXA 2IM0A 3IP0A 5DS7A 1S1WA 2BQ3A 3POTA 1TUGB 4LFAJ 2DNKA 3A4TA 2FLNA 1GTEA 3MCMA 5AE3A 3AD8C 3IR6B 4LIWA 4J9LA 3K89A 4JV1A 3W64A 1KFDA 4JI7J 4NLGA 7FDRA 2PA3A 2R8IA 1FFGB 2G0CA 1UVLA 3Q0AA 2OPPB 4O44A 1IM6A 2QLBB 4DV6J 1FK9A 1P1LA 1HYSB 1F3VA 5F9LA 3BKUA 3CF5Q 3AJ2A 4PXBA 3OFEA 3H5YA 2FZGB 1U02A 5LT5A 3RG6A 4NLYA 2H3EB 3DLGB 2ACYA 3M1VA 4PR6A 2GO8A 5KG2A 2VONA 1R43A 2PA8D 3H7HB 1KTVA 3MECA 5CHCB 1FNMA 4Q8FA 2HNYA 4BLGA 3CT9A 2Y1IA 3MD3A 1LWFB 1E6VB 1CSJA 1YBAA 4ECXA 3UE2A 2H5IB 3BB5A 2HQDA 2CG4A 5KOWA 4CTAA 1UVKA 4KC5A 2E66A 3ZZOA 1EQMA 1GMWD 2OTJS 2OFGX 2DH8A 2R2SA 1X9SA 5EN1A 2AZ3A 3OHAA 1MMDA 2AW0A 4U7UK 3DRXA 4OI1A 1CS4B 2VU5A 3FGVA 5ETPA 1IWAA 4DSJA 1LW0A 1Q82T 3BGLA 3GQCA 2P9CA 2BM1A 1YRTA 3IXQA 2UVWA 1FHTA 5F8MA 3W1YC 3FMWA 3HVWA 1ROFA 4LF8J 4H4OB 3DLLQ 4F8RA 3HSGA 2IRXA 4WZMA 2XS7A 2C2NA 2FGOA 3M6XA 4ZN3A 4NPOA 2UZAA 4Y2MA 1X5TA 4NYZA 1K0VA 1CJKA 3HHKA 3E2EA 5C25B 2EI5A 3HO1A 1Q8BA 3ICLA 3CVKA 2AJQA 3DRSB 5CYQA 1HQ2A 4BS2A 3FMBA 1EX8A 1S6UA 4P75A 4BWJA 1SCJB 4OYIA 1FF2A 3R97A 3A3PB 2C2OB 4UOFA 2F9DA 3LP0B 3G96A 4C8MA 4KGXB 2CQGA 3PKMA 2GS8A 1R8BA 2DJWA 4RU9A 1FKAF 4DR4F 3MM8B 3SCLE 2WVCA 4F3QA 1L3KA 4OYWA 1JLAB 2WONB 1FJCA 2BR0A 3LUYA 3UDEA 3NAHA 4NLDA 5IWAF 2DNZA 4WPAA 3OFHA 1NPPA 1QTMA 3EX7B 1TUVA 4NLUA 4ZLNA 1SKSA 3MPDA 5E41A 1IBKF 3ZZZA 4QWDA 1C1BB 4J9PA 1D8YA 3AHPA 4NMXA 1N32J 2ZH4A 1UFKA 2CWKA 1W2BR 1NK5A 4NXMF 4ZPAA 5HO4A 3DYAA 3SSQA 3M8YA 2Z2ZA 2MHEA 4KPYA 1SBRA 3US5A 1K1QA 2QV6A 4IFYA 5HN0A 1OMSA 2DGXA 1RP5A 2HHSA 2NR0A 1TL3A 2DO4A 1DAXA 3HFVA 4YB6A 3QFWA 1FWLA 4U7UD 1WC5A 2WCXA 5GAGU 4MKVA 1S1TB 2KHCA 4X2BA 1NK4A 1FERA 3VHQA 5J2PB 1VQMS 3GJTB 5HJYA 4EBDA 1FVQA 3KK3A 2E7WA 4O4GA 3QZ7A 4I6WA 2ZKTA 1KHVA 4W98A 3E01B 1JLFA 1YJ7A 3OTOJ 4IRKA 2YXLA 2KB2A 3SBMA 3KJVB 3JTOA 5KFRA 3QT5A 4DUZF 3T1YJ 4ZIWA 4HKQA 1S77D 3C15A 3M2UA 4B17A 2U2FA 1GFWB 5FDLB 3NWRA 1HNVB 3KFWX 3ZC4A 1PYOB 1DQ8A 4ID5B 3UW1A 1L5UA 4ZLPA 2XSJB 3ET6B 3I82A 1VRUB 1FI4A 1TKXB 2VZ9A 4UUXA 1ZTTA 1R7IA 3PG9A 2MSSA 3C14B 2VG5A 2B9EA 4ZVHA 1HW8A 1A6LA 2F65A 4QIEA 1REVA 4FP9A 2YKQA 3QLHB 2BVZA 2RKIB 2AX0A 2OPSB 5EUHA 4CZCA 1W25A 4UF4A 1F9FA 1UWAA 2K1RA 2A3JA 4X4SA 2ZITA 1PJ6A 4OZ3A 3W5ZA 2AWZA 1S0NA 3NP5A 1S79A 2EKNA 4CO0A 4ZIVA 1Z4UA 2ZM6J 1XTZA 2CXEA 2ZZTA 2W4PA 3N28A 4FNHA 2RQKA 4AD6A 4GC7A 2YNGA 4B3TF 1MMLA 1Q8IA 4ECRA 4K4UA 2KHDA 1PAEX 1QVFR 2RIJA 4IG0A 4HACB 1HPZB 2DB1A 3VGTA 2UXBJ 4I7FB 5KFUA 2R7XA 1OYEA 1L3VA 4FXDA 1S59A 2CVEA 3W7BA 2PN6A 4BBYA 5ITHA 3QO9B 1EKRA 4QWAA 2FVPA 4B3MF 2ZVIA 3G87A 3B82A 1M5OC 1N5SA 1ZH5A 4NASA 4CYUB 1B70B 1KRPA 3T1AA 4ECQA 3NCRA 3V6DA 2HK3A 3C66A 2NLWA 2UXCJ 3PFOA 2HW3A 3E8OA 3MMJA 3ZTSA 4RZRA 3SQOP 3UVJA 4G65A 3HSZA 2XYGB 1TFWA 3H98A 3NGTA 1B7YB 1F5BA 2LFVA 2GMLA 6FD1A 4JI3F 2H5JB 3FQLA 1D9FA 4WP9A 5B0EA 2PFDA 1Y4ZB 2YNIB 3EJMA 2DNLA 2EW9A 4A46A 4JI1F 1K9MT 3MMAB 1G2EA 2NXUA 1S5ZA 1F5AA 2ZVSA 4YB5A 2I0XA 2WOMB 1TL7A 4ZLJA 2W7OA 4AL6A 3KLIA 3P8BB 4USKA 3K5LA 2BJDA 5IZHA 4O3PA 4MYUA 1BQXA 2Q79A 1SJRA 1VCTA 2MJNA 2IHR1 4TYAA 3W3SA 6AT1B 3TUZC 1DZ5A 3RR8A 1DQAA 2HBQB 2BE7D 4JI7F 4K2XA 4L73A 3CPWR 1LWEA 4H54A 2DCLA 2KN4A 3D28A 4LF7J 1RCOB 1RUSA 4KYZA 2EPIA 2NUUG 4D3GA 1HNXJ 1AFJA 2GHWA 1FKOB 1HD0A 2KG0A 2ADCA 1D0EA 4DV2J 4W92B 5LSRA 1P9QC 1GMVA 2CJXB 2Z57B 3EZUA 1LWCA 2VOPA 5U47A 5CA5A 1F0XA 4N41A 4EO6A 3HX9A 3ZNUA 3NMRA 2AGQA 3D68A 4K4SA 3S01A 2J7WA 1K47A 4LBIA 3DFEA 3WIUA 2KVIA 5L1KA 4AL5A 3HD1A 4P7VA 5AE1A 4DR3J 1AFIA 4TY8B 4LREA 2RQCA 4DV4F 2CWXA 1ULRA 1S1WB 2VBWA 2DPJA 4G3IA 3POTB 2HBRB 4FYDA 4J9NA 1ZBTA 4DF4A 1IBMJ 2L41A 4Y2IA 3MDFA 2OMOA 1XQIA 2VKZG 1PJ7A 4TVAB 2B4VA 1KLMA 1AUSL 4TNOA 4NXNF 1U1OA 2P6TA 2ASDA 1RWWB 4LQ9A 3PYEA 4CO2A 1D9DA 5KG3A 5KTQA 3GG1A 2HFZA 4O44B 1OSDA 2A2DA 1Y3JA 5IT4A 1FK9B 3PO5A 1N5VA 2BYCA 4FKXA 3T6JA 1BWEA 2GZOA 3MM6A 2YQ0A 1Q5VA 1Q7LB 3OUYA 1WTFA 4MIWA 2UU9J 2EFNA 1FTCA 1LNQA 5KFSA 5HBMA 3TUPA 5D4OA 1N36F 3M1VB 2FD2A 1VC6A 2QEXS 3R6GB 3ULHA 3MECB 2XLIA 2FLOA 5D15A 2HVDA 2HNYB 3IS9A 4ZLLA 4PXCA 2I9SA 5KG6A 1MROA 5DQIA 2HGNA 3T41A 3FEYB 1YIJS 2B9YA 2L48A 4WCEQ 2ZJQQ 3D67A 3IC1A 4PXDA 3ZXWA 2G2OA 3MOJB 3N4WA 1ZAWA 4EEYA 4NLWA 1FESA 4PXEA 3AA8A 4C11A 3CJQA 3QATA 1B4SA 5CYJA 3U1NA 1VYAA 4MIBA 1NK9A 4ECUA 1GX6A 4UW2A 1RHRB 2DNGA 4TYBA 3G6XA 4DUTA 1QAIA 4RUHA 3G8TA 2JC0A 1Q86T 2W1BA 2N3LA 2QA4G 3R1LA 3QWPA 4DQRA 4EZ9A 2N7YA 2DR9A 3CCQS 2DGQA 2VODA 4USHA 1XWLA 5DRKA 5L39A 5F0WA 2PEHA 2KXFA 4ZVTB 1P8GA 4NMLA 4K4TA 1PSDA 3KLEA 8ATCB 1MG7A 3KKFA 1P27B 4ZDNA 1NJXA 4X4QA 4K0KJ 4FBTA 4DS5A 2K2PA 2EWHA 2LXIA 1VQSA 4AQYF 2UV8A 3PFEA 4OI3A 1WELA 1VJWA 3L09A 2FQQB 3QNWB 3KJQB 2HQIA 3UDLA 2X51A 1YDLA 1HBMA 3OV7A 2CUYA 3PY8A 3EPIA 4ECVA 2FDNA 4TU9A 2DISA 1VDHA 4F02A 5CABA 3T1YF 4BDPA 1B7FA 1SV5B 1S0OA 1KQFB 3MCNA 3SSRA 3DDNA 4QW9A 3QRPA 1KNZA 4R0JA 4PRFA 4F0HA 3LQVA 3U27A 3SFGA 1SUQA 5KG4A 2KDOA 3RRKA 4Y2CA 3L7UA 5E3PA 5IXUA 5ETTA 1WF2A 3CCLS 2Z2YB 2C2ZB 3N0VA 3D6HB 3HHLA 3ADAC 1NZAA 3LANA 3L9ZA 4YR0A 1H7WA 2BV3A 1N34J 3TZZA 3JXOA 4F50A 3OL7A 3T5HA 1RTJA 1AA1B 2DGVA 3I4PA 3W62A 4DSLA 5CXTA 5T7LB 3K59A 4EZ6A 1TL3B 2ZNZA 2FY1A 4JI0J 1RTIB 5L1IA 2GFFA 4DSKA 2FTRA 1ZA1B 1UVJA 2R8KA 4O4GB 2HGLA 2C3UA 3M8RA 4XDCA 1JLFB 2D9OA 1HMVB 1BC6A 3DKDA 4ILRA 4ECWA 1S76D 4JOUA 4QZVB 1UPPA 2W9AA 4C8ZA 3FBFA 1RGVA 1KLNA 5DGBA 2HBZB 2RDDA 1VQ9S 3QBCA 1J5OA 2HRTA 3SEOA 3LF0A 3OTEA 3GZ7A 2MLXA 1BLUA 4LR8A 4OFZA 4ICLA 1RBOB 3T5JA 2FLLA 1WEZA 3NXZA 2F4FA 2WBRA 4DZDA 1RU1A 2KRRA 1NJZA 4F36A 4DFMA 3RRGA 4KHMA 3P49B 4B9LA 3ILLA 3KDOA 2PMZD 2VG5B 4LFCF 3M2VB 5DG7A 5KFOA 1U25A 3DI6B 1WEYA 4WE1B 1F2GA 1FE0A 4ELVA 4J9OA 5E0OA 2JEIA 5BR8F 4ANDA 2UXCF 1GXUA 3MXHP 2GW8A 3RAMA 2K1RB 1TV6B 1A0OB 2MKIA 2JLFA 2LLZA 4PQAA 4URGA 5CYMA 2WVEA 1FEEA 4RKUC 5HMZA 2D3ZA 4IFVA 1AZSA 1QLNA 4HH0A 3PJWA 4IDKA 5THWA 4HVZA 3CCZA 1NK8A 3M2RA 2CQ2A 3MEDB 4OX6A 4PABA 2D3UA 3UNYA 2HFUA 4CM2A 2YNGB 1IKXA 1R27B 1L3SA 4OI0A 1N0VC 1HI8A 2Q1LA 5DDOC 4C2MA 4IG0B 1GK8A 5HQLA 2KZMA 2GJFA 4LR7A 3I9V9 5HK4A 3TR5A 1RYSA 1XERA 4ED7A 3VZIA 1OY9A 4YY3J 1TZ0A 4DU8A 3HJVA 3BGFA 2YH1A 1VHIA 3D7SB 2IFXA 1S9EB 4KTQA 2V4JA 2B8PA 1VK3A 4NA2A 4K4VA 2CQ1A 1SH0A 3CDUA 1JXLA 3RRHA 2XY7A 1Y9OA 3O5TB 4ED4A 2VUGA 2KKHA 4PWUA 5A2QU 3V6DB 4GKKF 3N6NA 5T14A 2VC0A 4ZVGA 4MAKA 1X4BA 5KOXA 1H72C 4X4OA 3NEKA 3HJFA 3TEHB 4OJ3A 4ITSA 1GMUA 4ZITA 2R8HA 1X4FA 2PI5A 3AQOA 2EK1A 4RW7A 2N4DA 1FWPA 2J9DA 3M9MB 1NO8A 4KIAA 3CCTA 1TVRA 3TZWA 3BGRB 1ZZNA 3GIKA 3MM7A 4RUCA 4KFBB 2GA7A 5D0GA 4A8XA 1IQZA 3QIDA 4KSEB 1FX4A 4DR3F 3FBEA 4ECYA 2XZDB 3NGRA 3FRZA 5KFGA 2RQMA 4WXOA 3F56A 1Q53A 1TL7B 3PYGA 4X65J 3KLIB 5LXRA 2VPXB 5KFZA 2XI3A 1F1BB 2CPEA 1RT2A 1O6XA 1VR6A 1X4EA 4RO0A 4RNMA 4E0DA 3QT8A 3FSIA 1IVZA 4HTJA 2XMMA 4CNZA 3FZ2A 4WU3A 5E2QA 1BHNA 3ZZYA 1W2IA 3P45B 2XGPA 2AHOB 1CULA 5HROB 1T8EA 2CG8A 3FBBA 4KO0A 1JMTA 1T3NA 3WC2A 2D9PA 4JI2F 4IH6A 2PT0A 2ILZA 3OVBA 1I3OB 4K7QA 2UU9F 3K8WA 4BC7A 2G9OA 3DOMB 3R5BA 1RTHB 4RNOA 2M70A 3T1HF 3PTWA 1RAIB 1HNZJ 4LVOP 2XO7A 1V5VA 5KFKA 1ICEB 1SPBP 1TK0A 3TWZA 3PW7A 1T95A 3D5MA 3C16A 2VQFJ 1YK9A 1R89A 1IR1A 4HYKA 1BD6A 3CSKA 4R8UA 1YJWS 4DFJA 4V19J 5KFEA 2ZC3A 5LJ5Y 1EZZB 4TQSA 3HLUA 4WFXA 3UR0A 1KLMB 2Y1RI 3P3DA 1SIZA 2PI4A 4A8YA 1B0TA 1UEKA 3FFIB 3DRYA 3CIMA 2EFQA 1HFEL 4C3LA 2PMWA 1TK5A 2VPWB 4H4MA 3OTDA 1LFWA 2RUGA 2F1FA 5E7OB 2XLKA 1F2HA 3MCSA 2I2YA 4KGVB 2B4UA 3GFZA 3MM6B 3GV5B 3OUYB 4P10A 4KKOB 2FHKA 3WX4A 3NMAA 2IRYA 5HBMB 4PG4A 1GT8A 5IC6B 4MKBA 1FD8A 4P74A 4MK7A 5J1EA 4RWWA 3VR1A 3FZBA 4ZJQA 5F9NA 2IVYA 4X4TA 3HT3A 4DL4A 1RBAA 2BJ8A 3BQ1A 4EFAC 3BO2A 4B3OA 3U1MA 3D3CJ 3D1OA 3VF0B 1MROB 1J5EJ 4DBQA 5DZ6A 4B02A 2HHUA 4B9VA 3H25A 2DHSA 2CZVC 5MAOA 4DV7J 5JMNA 3CJ2A 5F3TA 2VFRA 5GAGI 1RT7A 2XYPB 5GVQA 1JB0C 4V19X 3OL6A 4MKAA 3W5XA 3CTRA 2V68A 2QGFB 2ZE2A 5A76A 4LRBA 3MFIA 2B8QA 4I64A 4Y2AA 2EXUA 1PAUB 5DG8A 2PSZA 5A8RA 3KHRA 5M2RA 3ZNJ1 3H4BA 2CQDA 3OL8A 5HANA 2VG7A 2G0JA 4PKDB 1IKYB 1JJHA 2VG6A 2DYAA 2CPIA 3ZZRA 3GSIA 3HKWA 1KFSA 4WFYA 2MQPA 4R0EA 4DL5A 4OYAA 1AXQA 3VQTA 2O66A 5J1NA 2R3VA 1IKWA 3AJDA 4YB7A 2WSCC 2JDJA 1ACMB 2WVDA 3SCIE 4TY9A 5G0RA 1YGYA 5D4LA 3GONA 1X0PA 3AODA 3WX8A 2PO4A 2CZ9A 1KS2A 1I5OB 2XY5A 5K20B 3DLJA 4FNIA 2WSEC 4F3OA 2EBGA 4OX9J 1KN6A 5KT4A 2O3DA 4I6AA 4A8QA 4IR9A 2KT5A 5RUBA 2VB6A 4NWBA 4KR0B 1T11A 2DGUA 4RW4B 3S6EA 2PIIA 1GAOA 5I3PA 4EWTA 2W9BA 5ETMA 3HT0A 2BW7A 2J6UA 2YX1A 3OXLA 2Z56B 2VOOA 2UUBJ 3VV2B 1QVGR 4C8NA 2UVVA 1LXJA 3FDSA 3IN5A 1U0HA 4M5DA 3THTA 5D3GA 1PO6A 2X7IA 3K5PA 1PILA 5IFMA 3VTIA 4NCBA 4DLEA 3MM5A 1X4DA 2V4QA 1FNOA 1SUQB 1RCXB 2LXUA 4J9SA 4C6AA 1DTTA 2EBEA 3V2UC 1VQ7S 1U0SA 3H4DA 3NS6A 4O23A 5L1LA 4YHHF 1RYRA 2ZWPA 3QRQA 3SDEA 3WC0A 2E44A 4FZVA 3CDBA 4PG6A 2J5AA 3Q8SB 1SIWB 4IQMA 2V50A 2JNJA 3B8HA 1Y5IB 2GGPB 1VS3A 4IG3B 5AE2A 2CPYA 4IRCA 4OV1A 2E7XA 4MTPA 2F8HA 2ZD1A 1RLCL 2FHJA 5IC4B 5HVHA 2RJZA 5KFXA 2Y1JA 3EUNA 2AP6A 4N8OA 4DPXA 4DX6A 1J5OB 2OEKA 3SMZA 2ZBCA 2RF2B 4IYQA 3T5LA 1MNEA 1H74A 3M9NB 4RW8B 4LT6A 1RDRA 3DMJA 3CC7S 4KPCA 3CUNA 2DRBA 2HFVA 4UY85 3BO4A 1UL3A 4JB8B 1JK9B 1D9AA 4NLOA 2FGCA 1EARA 1CQNA 1X4HA 3IR5B 2HSEB 3BBFA 3SI8A 3OR1A 4NRTA 2V67A 4WU2A 3ETMA 3DGPB 2J0XA 3UD5A 2HS0A 1S6OA 4CIOA 1LOUA 4F4AA 4J90A 5LMUJ 3Q86A 1HHTP 5CYMB 3R8YA 4CH0S 3MAAA 1AZSB 4DSEA 2W2OP 1WKJA 4M5IA 3LP2A 5CZXA 3NY0A 4TXSA 4EUVA 4PUOA 2AEMA 1UA0A 3IWXA 4CO4A 2LDYA 1IKXB 4HR2A 2HEKA 2VBZA 2N4CA 5EWEA 2LA4A 2Z2LA 3QIPA 3O44A 1S10A 5DDPC 2CNKB 5CD4A 5H9EK 4LF2A 4X65F 3KMQA 3PR4A 4DWIA 1B0VA 5KG5A 3O6QA 2E1PA 1URNA 2NYHA 1NXIA 2NXNA 4QR1A 1SB6A 3NRBA 1VBKA 1T9VA 2V8VA 2UUCJ 2HQFA 3NG8A 3C46A 4OHYA 4UY8T 1TQLA 1VC0A 2BE2A 1YJVA 3CCUS 4ES3A 3NKYA 1RWMB 3VVTA 1LK5A 2ZH8A 4DSFA 2VDHA 2XC9A 3OR2A 4NA1A 2KVQE 2P2CB 3W66A 2J6SA 5JVHQ 4KBIA 3NOGA 1RBLA 5K8PA 1FXLA 1HWJA 2R7UA 4LMZA 4ATNA 3BPSP 4RW7B 3HF5A 3FQKA 5KFHA 3K5OA 3D1HA 1XMOJ 2U1AA 4PWDA 1U7LA 1N5QA 2C2RA 1TVRB 3QJPA 5EHHA 1H2UX 1GEHA 1HNZF 2E7VA 3J7A1 3PHTA 1YBTA 4DFKA 5I4MA 1U1MA 4NOHA 4JI6J 1RAEB 1SXLA 3K58A 1XEZA 1N6QA 3MAHA 3JTNA 4CO5A 5GMKa 2ZHBA 1RT2B 3R5CA 2MQQA 2F5GA 2XI2A 5DDRC 2WRMA 4S0MA 2HBYB 3W63A 3ZZTA 2DPIA 2CPJA 2ZOMA 3M7VA 2MEWA 4M95A 4GKJF 4CLYA 5AXMA 1VQKS 4KO0B 3GCXP 4K4XA 4ZP6A 3J7Z5 2HQ3A 3VAHA 3IGNA 2MKYA 2UVRA 1KDNA 5EX3A 2JH3A 1QAJA 1OYDA 1M5SA 3JQKA 4IH5A 1NB7A 1ZS6A 5M2UA 3OPKA 1HARA 4ILLA 1U1PA 1IJFB 3GLJA 2PE8A 3AAWB 1FA0A 3JSYA 4KE5A 4RW6A 1KQGB 1UFWA 4DV1J 4Y2KA 2K06A 1WJ9A 1T02A 4I2QA 1CQMA 3GJRB 1K8AT 1SQFA 2GO9A 4CH1A 4NRUA 1EETA 4N77A 3DM2A 4FF2A 1YI2S 1MSWD 3R7NB 2DGOA 5J2QB 1VRQC 4XK8C 2MYFA 3FVYA 4LF9J 4JI4J 3UQSA 3HULA 1YJNS 3QWUA 4QYRA 2AU0A 3NOCA 2BZ2A 5DQHA 4B3SJ 3T5KA 3I55S 4DV7F 3OD2A 5LSOA 3LAKA 4UZCA 1RTDB 1OS5A 4CLUA 3R9LA 4NZ7A 1YJUA 3DDIA 1FJGJ 1N88A 2QMUB 2Q66A 4N7TA 1FXDA 4WP8A 3M6VA 1S9GB 4IUFA 1NPRA 2A6MA 2XS2A 4F4XA 4F4ZA 3M8SA 3JQJA 2FVSA 1NBEB 3M05A 1SL0A 5IT9Y 4WJBA 2ZUAA 3P5TL 5KFCA 4A8FA 3QFHA 1C4AA 2L9NA 1QAYA 3SCJE 2LQBA 4ZPWR 1S49A 4RJVA 3GMGA 3EZ5A 1HWLA 1CLFA 1R8HA 3J7ZT 5C7PA 3ENWA 3WIVA 3MR2A 2CYYA 3RYLA 2WVFA 2ACMA 4USWA 4ZCLA 8RUCA 3CE8A 3HMJG 3SYZA 3EZOA 3K5NA 2DIVA 4B3OB 4DR2F 1WC4A 1Y5LB 3CULA 3NNCA 4XO0A 4JP8A 1C0UA 3IMQJ 1LEOA 4HHJA 2IC3A 3CJ4A 4AE5A 4AYBD 5JXSA 1S6QB 3Q89A 3TVKA 3DRRB 3PYFA 2FHMA 3OSNA 2D1CA 3KUHA 4C9DA 4TKTA 3CC2S 4Q0BA 2GJ2A 3A3NB 1RHUB 2IBOA 1TP7A 1ZPVA 1S1UA 3AXKA 1NAQA 2NYIA 3RUBL 5D4NA 5DGAA 5A8RB 1YJTA 1RT4A 3MWBA 2FJBB 4OYMA 5ETVA 3T3FA 5E3QA 3OTCA 3TQ1A 2WZ1A 5DLFA 2GQCA 3KLFA 2KXNB 3DOKA 4X84A 1IKWB 2CPXA 3V6JA 2M88A 2HNZA 5G0RB 3GIRA 1U4BA 1NHUA 3O3LA 2UXDF 3LTOA 1NKEA 3SZ2A 2HMIA 3CD0A 2KFZA 5ADZA 1S0MA 1CJTB 3VCDA 1QSLA 4LFBJ 4JUZA 4X4RA 3C6UA 2NPFA 3DU5A 4P73A 2ZUGA 4C8KA 2HWHA 3NAIA 3MR6A 1YWXA 5KFDA 1XC9A 5AT1B 3DLEA 1X5OA 1L3TA 4NLVA 2VPZB 3MURP 1T9TA 4NI2A 3EMTA 1SJ4P 3M32A 3LAMA 3CCES 1PKUA 4CNYA 4OYPA 3RJMB 3AJ1A 1S6PB 2OAUA 1LW2B 1B3TA 2BJ1A 1UMJA 1NDPA 2HK2A 1Q95G 3EVWA 5A8KA 1QE1B 2HHHJ 4X62J 3RB3A 4M5DB 2FY8A 4AL7A 5D3GB 1T03B 3OL9A 1VQ4S 5DJBA 2GIRA 2HRYA 3RTVA 3I9ZA 2LECA 3ZFVA 1CG2A 1VQ5S 1C0TA 3D6MB 5ETOA 4ZCMA 4HT7A 4OIXA 4Q45A 4CO3A 1RWPB 1DTTB 3QZ8A 2ASYA 4WBFA 3ISNC 1Y7PA 4QOTA 3KK1A 1SL2A 4XAKA 1UEVA 5DDQC 2B4OA 2Z30B 2KJWA 2V2ZA 5K14A 3ZZUA 2W7AA 3SDEB 2WW8A 3W2VA 1DFDA 4A8WA 4QR0A 2J0SD 1HQUB 4OI6A 1Z1ZA 1WOPA 2R2UA 4E98A 1XMQJ 2IA6A 1HI0P 4MK9A 2MTLA 5LMUF 2GVDA 1AB8A 1H3DA 2MKCA 3Q8UA 1NB2A 2DNHA 2QLFB 2ZD1B 3HM9A 1XNRJ 1NKBA 2MLZA 3Q8RB 2F4VJ 1HBNA 5H9FK 3RB0A 4MT1A 4DR7J 3PNIA 2XSFA 4ANCA 1H38A 1FRXA 1VC5A 1SKUB 3CJSA 1OWXA 4P72A 5KFJA 4Y34A 4F7VA 1IR2A 2YWGA 2W2NP 2RQ4A 2G0IA 3C8YA 2DO0A 2NS1B 1RT3B 3KJFB 1IKVB 2FJDB 1FDDA 4FYVB 2KZZA 2XCPA 3BDEA 1VOMA 2IAJA 1SKRA 2XMKA 1BXNA 2CJYB 4KH1B 3VAJA 3HVRA 1JLBA 3I4HX 3RW7A 3HPOA 3GR1A 3TJ9A 1IR0A 2HAFA 3IAM9 3KG4A 4URSA 3OR1B 2CQHA 4E8UA 1JLQB 1HIYA 2VL1A 1JNZB 3AOAA 4OMFG 4WK1A 3EGNA 3DRPA 1YZ7A 2OPRB 4ECTA 1EQ0A 2MZ1A 2DGWA 1HR0J 1RU2A 2OPQA 1FKPA 2QMWA 4PAAA 2CQ0A 2GV1A 4ZPVR 1FJ7A 1NK0A 3MAAB 1AROP 1XN9A 4DR1J 2X1BA 1FCAA 2CPHA 2HS3A 3OT9A 4BWMA 1OJ4A 3EM1A 1URRA 3LP2B 2CQ3A 3RB6A 2E9RX 3QMQA 2RRAA 4PUOB 3H2LA 3TVYA 3QGIA 5HI7A 3HI9A 4OZLA 2EEYA 2V63A 1EAYC 4C3KA 4EU0A 3MEEA 2EFVA 3CCVS 2LQ8A 2GMHA 3L95X 1Q1KA 2YKAA 4DCPB 3A12A 2HNDA 3EXYA 3VAGA 1N4LA 1WSVA 4C98A 1WORA 2QL7B 3RBZA 3ONQA 5I42A 2NSCA 4U8YA 1UCNA 1S1XA 1ITPA 2OH2A 2DHXA 4NLRA 2BE2B 2B5JB 4QJVA 3H2UB 5J2MA 2H51B 1TKTA 3OR2B 3RB4A 2Y9HA 1T05A 3W60A 3H5SA 2QX0A 1U49A 2JZ5A 5IM0B 3G6ES 1TAUA 3CO9A 4ZKAA 4RBVA 1VLYA 4GVBB 5BYQA 1UJ5A 2CQIA 5KFAA 1VI7A 1YJ9S 4PWDB 1U48A 1YJRA 2R2RA 5IQQA 3A8IA 1J2VA 2O5DA 1IBCB 2BM0A 1HWKA 4HDHA 1WC1A 2VJVA 1KC8T 2WHOA 4ED0A 4CLPA 2QJ3A 4F3MA 4DV5F 2BEFA 1YLXA 3MEGB 4LF9F 3ISND 2DNMA 5E3AA 4JI4F 2C2MB 4ES1A 3Q24A 4PWWA 5AJ3F 3V4MA 1TKZB 3PEJA 1FRKA 5KFTA 3GSDA 4P2MA 2YVSA 2D69A 3PIPQ 4FF4A 2J9EA 2BANA 5EX0A 2OP5A 4P71A 2HFNA 4Q43A 5AXKA 1SC3B 1XNQF 5KFVA 5KFMA 5I3QA 1CC7A 4CLZA 3IM8A 2O67A 2MGZA 3LWLA 5LL6d 4LF4J 1DQ9A 3ETOA 4OZJA 1WTBA 2VQEF 3MAQA 4A8OA 3MM9A 2KM8C 1S7HA 1E6YA 5DO2A 3QPIA 4RW6B 5GADU 4PPDA 2Q3PA 1AUDA 2ZOGA 2J8SA 4UTGA 4NLQA 1EETB 4DR5F 3VGUA 4QYZJ 2CDQA 1UVMA 3MR7A 2HIQA 4W4MA 4XIUA 5C24B 2V2KA 3S1TA 3IO1A 4ES2A 1NKCA 2UUAJ 3W65A 3G71S 3UI3A 3BO3A 1ZETA 3B4MA 2CIMA 2IJNA 5F8HA 1A7GE 2Z58B 2MQNA 4A4JA 2W2MP 3P6YC 1RLDA 2MXYA 3OHBA 4IQXA 3BSCA 9ATCB 2KO1A 4GO5X 1X0FA 1RAAB 4DV3J 2XB2D 4I2PA 2BUNA 4UQGA 5KT2A 2V9KA 5I3UB 2YH0A 2HAIA 2IYGA 4EK2A 1EP4B 2MY7A 3B6BA 3BEGB 4ZN1A 4I68A 4WWSA 5KT5A 2BOAA 4FKYA 2ZDOA 5HVGA 4HTIA 4LFBF 3M8QA 1HBOA 2BJ9A 1AYEA 2J8AA 2K7JA 3C6TA 3W2WA 4K8RA 3BR9A 2JJ4D 1C0UB 4ETXA 5JJBA 4R5PA 5L46A 1QJHA 2B3TB 1SC1B 1NZ8A 4LJMA 2Y8YA 3HZGA 1NDKA 4J7CA 3R5DA 4Q0BB 2V69A 2IYIA 2QC3A 2FPHX 3K0JA 3OQ2A 1S1UB 2AQ4A 1BQMB 4YN3B 4M8LA 1QD1A 3DOLA 4DZ6A 5KG1A 2YQ3A 4RLEA 1O51A 1RT4B 4IH7A 3GIIA 5HP1B 2IM2A 3JB9k 5J2NB 2V0NA 3UD4P 2R7VA 4M5LA 2J7UA 3IRXB 1QUPA 3KLFB 5B0FA 4NLPA 2RDIA 1OPZA 3DOKB 1QUVA 4Y65A 5DM7Q 3TUJC 3CJKB 4EI2A 1WC3A 2PDAA 1KONA 2MQMA 9RUBA 4ERDA 4A8KA 1Q5YA 3KNGA 3EXCX 1N33F 4KJIA 2QA4S 4L3NA 4WP3A 1F9EB 4YP3A 3TP2A 4ZVPB 2OMLA 1LFPA 2V8HA 3M6WA 5E3CA 1VBYA 4QCLA 1I1GA 1SC6A 2ZEJA 3GFHA 5D0HA 1JLGA 2OPPA 4LQ3A 1N54B 3M32B 3MR5A 2W8KA 1FVSA 1Q4RA 3ENQA 1Y11A 4MYTA 2BA9A 2EKYA 1RJJA 1PCAA 3DXSX 4C7QA 2C1EB 2QRRA 2E5HA 3AQPA 3LPEA 2CJAA 2XO6A 3DLGA 1D3WA 3ELHA 5A8KB 4DR7F 1R6YA 1DARA 1NH8A 2DHAA 4RUBA 1VRTB 4KHRA 2LQ5A 3D66A 1JJ2R 5GAEI 4EMDA 3N6MA 2NZ4A 4KHPF 1LWFA 4OJ1A 4DV0F 1KQSR 4P6QA 3DCAA 3TEGA 3P5BP 5FJ4A 2BJ3A 1RI7A 2OFHX 2AJFE 5AXNA 5HQ8A 2DK2A 4QU6A 1G7CB 5K5MA 2QA1A 1N8RT 3JTPA 1DLOA 4FVMA 5B08A 5K14B 2DRDA 1ZAXA 3J7AN 1TL4A 2KYXA 3W2VB 1JWWA 3IG1B 3TA2A 1R0AA 1CS4A 3MPWA 5GMEA 3FKBA 2RD5C 3RBEA 2ZJRQ 2HURA 3CXCR 2KFYA 2ZH6A 3KLVA 1HR0F 4IOAQ 2GVDB 2PGCA 2XLJA 2NCKL 4QQBA 1HLWA 3CDWA 2C2DA 3G9CA 4Q44A 2CRLA 4H4OA 3TOQA 2XG8A 4Z37A 2MJUA 1S97A 4UOGA 4E2FB 3ILJA 2MQOA 1DTQA 2BX6A 4F25A 1DURA 2HZCA 2IVFB 1AT1B 3TAPA 3T19A 2NXEA 2DNQA 3MPYA 1HQEA 3ITHB 3R2DJ 1JKHB 2J0QD 3V4IB 1N56A 1KSPA 2G1DA 3DRSA 3PV8A 5A0YA 1GQEA 4P7TA 5F3ZA 2BRLA 3G6YA 2X3DA 5IV3A 1Q78A 4J37A 2IAJB 4P9SA 1RHJB 3QGPA 2RVJA 2CPFA 2HRUA 3TANA 1FTRA 1S1VB 2ZBRA 2GAHC 1JLBB 3LP0A 2GCFA 2IM1A 1IBLF 2D74B 4PG8A 4DR6F 1IUJA 2YNHA 4ZPBA 3UN5A 2WSFC 4LSZB 3DRPB 2VFTA 4RPFA 3EYZA 3CMQA 1JLAA 3C3LA 1D09B 1SVDA 2F8MA 3BGUA 2HFOA 1X4GA 1RT1B 1I94J 2DY1A 2HFSA 4TQRA 4LFAF 2I6WA 2KT2A 1RAJA 2J9CA 1C1BA 2CQCA 3TYTA 3D2WA 1WG5A 2J9DE 4ED3A 2OKQA 4HHHA 4OYXA 3GYNA 3R3TA 1RWXB 2PMHA 4EYHB 1WG4A 2ZH5A 2ATCB 1VJQA 2GVZB 3MEEB 4FXWA 4HDGA 1X4AA 3BQ0A 4DV6F 4DPYA 3MUTP 2AIRB 3BYPA 4F26A 2YKNA 2Z8QA 2B6AA 2VHGA 2EC0A 1S1TA 2VA3A 1M5KC 5J2PA 3N79A 3AB4B 1RHMB 4ED5A 2EC2A 4PQUA 2JFKA 4ZA1A 2GIFA 1DY3A 4XPEA 3AFGA 2F40A 4A47A 1FNXH 4DR4J 2AMCB 5KFLA 1WKKA 4XTTA 4ANEA 1QY7A 4C97A 3I0SB 2FJVA 2Q43A 2RNEA 5IWAJ 2JEGA 4DMZA 3KUGA 3G82A 1T05B 4LF4F 3LP1A 4LRDA 3E3XA 4CLKA 2E1CA 5LM7E 1HNVA 4U67Q 4ID5A 4ZCIA 4LRCA 1TK8A 4I1TA 1VQ6S 3ET6A 2Q6BA 4NXMJ 1VRUA 1NM2A 4FVCA 4Q7AA 3NGDA 2E29A 4ILMA 1BWVA 2E9ZA 4YS2A 1XK8A 4X4VA 1ZA2B 2KM8B 2IRUA 1SJFA 3AXMA 3BSNA 4OL8A 1S12A 1UAWA 3R1HA 2NPIA 2W4DA 4X4NA 5KFIA 3QLHA 2RKIA 2OPSA 2AF6A 3H0PA 1RKIA 4LF8F 3VWSA 3CJRA 2KFNA 3HK2A 1GMWA 4O3SA 1EJ7L 2PC6A 4WYLA 3A3OB 4DEZA 1EB0A 4DUZJ 5D77A 4OYZA 2CJ9A 4F0MA 1SL1A 4NEZA 4DN9A 3KLGA 3OLAA 3SV3A 2RU9A 4RNHA 3NNAA 4DV3F 4CTAB 2FYXA 4LUBA 2AJ1A 2MPUA 3RAQA 2P9GA 4HACA 3MM9B 1HPZA 4I7FA 1FE4A 3L4BC 1W7WA 2M0GB 3H90A 3VZHA 4DQIA 3LOUA 4FF1A 4J5OA 1HNWJ 2ATLA 2HQGA 2A0FB 3AT1B 4TU7A 2B4PA 1LW0B 1I51B 4CYUA 1VBZA 2OGUA 1VQLS 1KQKA 4OX7A 3GB0A 1VQPS 1OY6A 3BF4A 1FT8A 4B9NA 5BYSA 2R7OA 1N32F 2AEFA 1PC4A 3TA1A 1SQEA 3IFEA 5CQGA 1F60B 3LA0A 2HKEA 4UZBA 3AA9A 2XY6A 4MMOA 1CJKB 5B0CA 3I96A 4LSLA 2CPZA 2AD9A 1M90T 2MSTA 1PG5B 2ZH9A 4GVLA 5CYQB 1R0CB 5IT9U 1TMJA 4OLOA 5KFPA 1M1KT 4M5JA 5IOLA 4DUYJ 1UVNA 3MMAA 3KOAA 2WTFA 4K2JA 3BZQA 1K73T 2YX4A 2WOMA 1T0TV 2HLTA 4Y6IA 1WC0A 3OTOF 4NCGA 2FC9A 1HHSA 1JLEA 2MQ8A 4B3MJ 3QSYB 5AXLA 2XTJP 1T9UA 4Y0FA 4M5NA 3M8QB 4DG1A 3W2WB 1UEUA 3G4SS 4LF6J 4EBEA 1U1NA 1WHYA 2VF3A 3MUMP 1ELOA 4DOZA 1YBUA 1D8ZA 4WK3A 1VHFA 1S4FA 2A18A 4A8SA 2DNYA 2BQUA 4M5HA 4JI3J 3DYAB 3QYYA 4U9RA 3QJJA 3UN3A 1IQTA 4IFYB 2ZH1A 4DF8A 4FF3A 3K2YA 3ZTOA 4F4YA 2V8PA 2FC8A 2POKA 1Y5NB 1X7VA 2FVRA 3NCQA 2BACA 2EG2A 1WOSA 3RR7A 3EICA 3UWTA 5D8HB 3R7SB 1U1QA 3VAKA 2Y0SD 2CJKA 1BUXA 2MQLA 2YWHA 3KK3B 3M8PA 4G1PA 4J9VA 2UV8G 2HVHA 2CVIA 3IRWP 2QG9B 4HI2A 2ZM6F 1X5SA 3C15B 3M2UB 3AD7C 3D0IE 1PYTA 1R3NA 3DLBA 3FRYA 3HHLC 3KTQA 2B0GA 1F3FA 2MDAA 1JLGB 2P6SA 3U1LA 3OJUA 1R6VA 2UXBF 3HXMA 3EGVA 1OQ6A 2VASA 2C42A 5B7WA 1M1HA 2PEBA 2B9XA 2RB7A 3OSPA 4Q5VA 3D0HE 4X4PA 2QL9B 1NSPA 1UETA 3V6KA 2DXFA 2OD6A 2JEJA 4RW9A 1REVB 1TL5A 1NK6A 3M30A 1NJYA 3SIPB 1UW4A 1VIXA 1MWQA 2UVUA 2C3YA 2B7BB 4DV4J 1XR5A 2ASLA 1T9WA 2XHWA 1NJIT 3TRGA 2XZTB 4CH7A 3M4XA 4B9SA 3ZO7A 2EVZA 1X9WA 3J7YU 2BKNA 3H8YA 2LEBA 4FPRA 1UP1A 7FD1A 2ZFHA 2FZKB 1DLOB 3J80Y 4ED2A 1U6FA 4NXNJ 2W01A 1B64A 4RNNA 2B43A 4C0OC 1R0AB 3KLHA 1NJWA 2ZZMA 2V6AA 1U6ZA 1RWOB 2Y0BB 2SXLA 2BJ7A 5DETA 4F0KA 2YY3A 3IWNC 4YQWA 1I94F 3GR0A 1RKJA 2ADBA 4O3NA 2KH9A 4F67A 3D3BJ 3PDNA 4FN5A 5MLCV 3EVOA 2KRBA 2XMAA 1B0PA 1N36J 2F7VA 4OYOA 4IKAA 4RUAA 4B9TA 3VAMA 3DLHA 4FPIA 2JEFA 4IOCQ 1DTQB 4NE9C 3PX6A 1JJCB 3UVJB 2W24A 1RWUA 3UO0A 2J6TA 4LF7F 2H54B 3BJYA 1HQEB 1NU4A 1RADB 1HNXF 1ZM9A 5HATA 4MH8A 5F8IA 2LU2A 3NS7B 2DXEA 3OFFA 4DV2F 5A0YB 5ETRA 5GAHU 3UDVA 1U24A 1DHMA 3W8PA 1ZYQA 5E3RA 4ZJOA 5FLXY 2ZJPQ 4NYPA 2HZVA 2MKKA 2YNHB 1XIQA 2MZJA 2AX1A 3FCWA 4XDDA 3VGVA 4RR5A 1M0SA 4MK8A 1SV5A 3I0RA 5L38A 4N56A 3G8SA 2GX8A 1S7IA 2LEAA 2BOPA 1BQNA 3DU6A 1TTHB 2MKHA 1IBMF 2WK4A 3LWMA 5F41A 5E33A 1UA1A 1UJ4A 1PJ5A 3KHGA 2FIUA 4TLQA 2JOQA 1SH3A 2IPOB 5GADI 1LWEB 2H9ZA 4P2XA 2M3DA 2W2PP 4DPOA 1RACB 3MPVA 2YNFA 1WOOA 5T7LA 2BXJA 3FK4A 4AQYJ 2APOA 2YKNB 3K7RA 3AOBA 1RTIA 2B6AB 2AYGA 2YQ1A 4GC6A 1HBUA 5F8LA 3MZIA 3GYXB 1LWCB 1FFWB 3JSBA 4K59A 3ISZA 3EGZA 4PQUB 1NPKA 3HHLD 1HMVA 2GQQA 4M5KA 2DD8S 4P2SA 1FDBA 3CC4S 3KJNB 1Y0HA 1FJEB 4HH1A 1O0PA 2RRBA 1OPIA 3G82B 1Q8KA 5DZ7A 3LP1B 1SC4B 1U1KA 1IXKA 2IA0A 2Z0GA 2R2TA 3KG0A 2BKOA 3B54A 3Q8QB 4ED6A 4ELTA 3DLKA 1XR6A 1HNWF 3TO8A 2IDEA 3M2VA 1KHWA 4UT4A 3BKFA 3D6FB 4FYYB 2AYEA 6FDRA 3DI6A 1S48A 1HHQA 5C42A 4WE1A 5F8GA 2H1YA 2ZBQA 1SH2A 3BR8A 3Q22A 3PRBA 2DEIA 5EGYA 1V9OA 2Y3YA 4DX5A 2W8LA 1TV6A 3KHLA 4M5GA 4DN0A 4QIWD 3EPGA 2R8GA 2D3OR 1MW7A 1NMEB 2I8EA 3H20A 3PXGa 3K8VA 4WFNQ 4WXWA 2N7CA 3IS9B 3MEDA 5BYRA 2KT3A 1U1RA 4Q2LA 3OW2R 3THVA 4K0KF 4OZNA 3KLGB 3BSOA 3U7JA 4OZ1A 4Z7CA 3HHDA 1SJ3P 1T94A 4YFUA 2V4RA 4ZVOB 4ECSA 2HHVA 4DUYF 3EWGA 2FZCB 4C11B 3CCSS 2FVQA 1S9EA 2DT9A 2MY8A 2UUWA 2I5JA 4LFCJ 3JSMA
chains in the Genus database with same CATH topology
5T41A 2DNNA 1UVJA 2W25A 3ONQA 3BQ2A 5I42A 2R8KA 4O4GB 5L1JA 2NSCA 2HGLA 1C4CA 3CDAA 3TVZA 2C3UA 3M8RA 3LGMA 1PC5A 5C24A 2XNRA 1S1XA 3RAXA 4XDCA 1HW9A 2RDJA 1JLFB 2OH2A 2W9CB 2DHXA 2D9OA 4NLRA 1HMVB 1BC6A 3ENVA 4DR1F 3MI7X 2BE2B 3I5AA 3JAMY 1VK8A 4LF6F 4ILRA 2B5JB 2K8GA 4ECWA 4RWXA 3UCZP 4QJVA 3H2UB 1UWBA 5J2MA 4CQ1A 1S76D 4JOUA 4DL2A 1TKTA 4QZVB 2W9AA 1HBNB 4C8ZA 4QBUA 3KK2A 2EG1A 3OR2B 1RGVA 4N47A 1KLNA 4IO1A 5DGBA 3RB4A 4LVNP 1T05A 1VQ9S 4DSIA 5A8WA 1J5OA 3GG0A 3H5SA 3SEOA 1QAXA 3LF0A 1U49A 1WHXA 2JZ5A 1H7XA 5IM0B 3SCKE 3OTEA 3MGJA 3MHYA 3G6ES 3GZ7A 2R9LA 1TAUA 1BLUA 4OFZA 4ICLA 2IMOA 4RBUA 3PX0A 3CO9A 3KLEB 4JBCA 3CEDA 3T5JA 1N34F 2FLLA 4ZKAA 4RBVA 2RS8A 1VLYA 5C25A 1WEZA 4LSLB 1R8AA 2RILA 2WBRA 1I6JA 4LSNA 5BYQA 2M4MA 4I6YA 5D4PA 1UJ5A 2CQIA 5KFAA 1VI7A 5KT7A 5HLFB 2KRRA 5B0AA 1U8SA 2L3MA 1YJ9S 1NJZA 2VV5A 2LVWA 4PWDB 1Q79A 4OI2A 1U48A 3I5CA 4DFMA 1SJ1A 3RRGA 1YJRA 3BGRA 2R2RA 5IQQA 4KHMA 3P49B 4B9LA 1J2VA 4JI0F 2UP1A 2O5DA 3MMCB 4KFBA 2PMZD 2BM0A 2VG5B 1SI9A 2BRKA 1HWKA 2CQ4A 4QWEA 1D1UA 4LFCF 1KTQA 2LEPA 3M2VB 5KFOA 5DG7A 2MHNA 4HEA9 2KU7A 4HDHA 3FEXB 1KC8T 2WHOA 1U25A 3DI6B 2JHEA 4ED0A 1WEYA 4WE1B 5KAKA 5I3UA 3N9UC 4EO8A 3OXGA 1F2GA 1FE0A 2E1MC 3KHHA 1HBMB 4J9OA 4ELVA 4F3MA 5E0OA 4DV5F 3BM7A 2K3IA 2JEIA 5BR8F 1EP4A 1MMNA 2O01C 3MEGB 3MM8A 2DITA 4NCGB 4LF9F 3ISND 1GXUA 2DNMA 5C5JA 5E3AA 2UXCF 1ZM2A 4JI4F 4ES1A 3Q24A 2W7PA 3MXHP 2GW8A 5AJ3F 1JLEB 3V4MA 3RAMA 2HHTA 3GWCA 2VFVA 2WONA 2JX2A 2QSFA 2K1RB 3DN9A 1TKZB 2RRNA 4QIGA 1MWZA 1TV6B 3CJ5A 3PEJA 1FRKA 2MKIA 2JLFA 2A1BA 2LLZA 5KFTA 4PQAA 3GSDA 4FS2A 2FJEB 1R31A 3TNVA 2OPQB 1JIHA 1FKPB 5CYMA 4URGA 2VD3A 2YVSA 5E5NA 4DG1B 3PIPQ 2O1PA 4FF4A 1FDAA 2BANA 2J9EA 5EX0A 1FEEA 2OP5A 1YRXA 4RKUC 5HMZA 2D3ZA 4IFVA 4NLTA 4YMEA 2HFNA 3UDCA 2R7RA 4Q43A 2CKWA 1QLNA 4HH0A 1FRMA 4J9QA 4I67A 2OD4A 2AYMA 3CJ0A 3PJWA 5AXKA 2DNPA 1KOOA 1XNQF 3U02A 5KFVA 4IDKA 4AUKA 5THWA 1V3RA 4HVZA 3CCZA 5HROA 3CCMS 5KFMA 5I3QA 1NK8A 3M2RA 2CQ2A 3MEDB 1CC7A 4ZS6A 4OX6A 4QWCA 2D3UA 5KFFA 3UCGA 4X64F 2O67A 2MGZA 3LWLA 5LL6d 2CJQA 1HNIB 4NA3A 1X5PA 3T9ZA 1DQ9A 3PO4A 1U2FA 3ETOA 2QE5A 2YNGB 4OZJA 4QIVA 4RBTA 1IKXA 1R27B 3HHLB 1WTBA 4GMKA 4DL7A 1L3SA 1UVIA 2J7KA 1RK8A 2VQEF 1N5YB 4OI0A 2ALZA 5CH7B 1N0VC 2H5EA 3HVAA 1HI8A 2Q1LA 5DDOC 3MAQA 3TI0A 2DR5A 1GNKA 3MTKA 4LF5F 1KEKA 4A8OA 4IG0B 4C2MA 3QAUA 1BQMA 3MM9A 2KZMA 2JSXA 4ZPCA 2KM8C 4ZMMA 1S7HA 1RTJB 3DOMA 3I9V9 1YTYA 1E6YA 3X3UA 2YWFA 3TR5A 1RYSA 5DO2A 2EFPA 3QPIA 1XERA 4RW6B 4ED7A 3VZIA 3AY0A 1RTHA 5GADU 4PPDA 4FS1A 1TZ0A 2YH1A 5HP1A 3BGFA 4FXDA 3H59A 3OBIA 1FD2A 1S9EB 2IFXA 1LXNA 2Q3PA 5J2NA 3PZPA 2V4JA 1AUDA 2ZOGA 4OJGA 1VK3A 2QFJA 3MF5A 4WTYA 5EDWA 2HNDB 3L7OA 4ZVEA 1RT5B 4NA2A 4K4VA 2CQ1A 4NLQA 1SH0A 1EETB 3IRXA 1TAQA 3CDUA 5SUHA 4DR5F 1JXLA 2XMUA 4HT5A 2QT7A 3THPA 2CZ4A 2CQPA 4QYZJ 2CPDA 3RRHA 2XY7A 4Y28C 1HWIA 1Y9OA 2CDQA 4EYIB 1UVMA 3O5TB 5I42B 2VUGA 4LIRA 3M8PB 2KKHA 2HIQA 3E01A 4PWUA 3CJKA 5DM6Q 3NGKA 5C24B 3NWGA 4TN2A 1S1XB 3HHEA 4XIUA 1YRUA 2V2KA 2E5GA 3V6DB 1V3ZA 4GKKF 2M2BA 3KJVA 3S1TA 3N6NA 1TKDA 5J1PA 1OIAA 1FEHA 3IO1A 5T14A 2V94A 4ES2A 1NKCA 4NZ6A 2VC0A 1G3OA 5J2MB 4C8OA 1TKTB 4ZVGA 3G71S 4Q2MA 4MAKA 1X4BA 5KOXA 2GC8A 3UI3A 3BO3A 1ZETA 4X4OA 3B4MA 2CIMA 1C1CB 2IJNA 4ZP8A 5F8HA 3HJFA 4OJ3A 1A7GE 3KWMA 2HVZA 2MQNA 4ITSA 4A4JA 1CVJA 3SQGA 2B51A 5H1SV 2R8HA 3P6YC 1YHQS 4ICLB 5FDLA 1X4FA 2PI5A 2QA2A 1Y3KA 2LQ9A 3AQOA 3FFIA 3I5BA 2EK1A 4G1QB 2MXYA 3G8QA 4JYAF 3CIZA 4CI0B 4RW7A 5G4DA 3OHBA 2N4DA 2J9DA 3CWJA 2XSJA 3M9MB 1NO8A 2V8DA 1NEEA 4KIAA 4IQXA 2YKPA 3BSCA 2I1RA 3CCTA 1TKXA 2KO1A 3PIOQ 4GO5X 1R8CA 3OJSA 1X0FA 4YY3F 2DIUA 1TVRA 3BGRB 2XB2D 4I2PA 4C0BA 4YB1P 2BUNA 3PVXA 1ZZNA 5KT6A 2ZHOA 3GIKA 3MM7A 4RUCA 3WZ0A 4KFBB 1FRJA 2GA7A 4UQGA 3LALA 4A8XA 1IQZA 3QIDA 5KT2A 1NNDA 4KSEB 4AXIA 1JLCB 2V9KA 2XS5A 4KKOA 4KT0C 3K57A 4DR3F 4ECYA 3OVAA 2F8EX 1TL1B 3FRZA 2RQMA 5KFGA 2HHWA 4F4WA 4WXOA 5I3UB 3F56A 5L9XA 4UUWA 2YH0A 4FBUA 1Q53A 2HAIA 1V3SA 2IYGA 4RW9B 3KLIB 5LXRA 2ZNYA 1X8DA 2VPXB 5KFZA 1VRTA 2R4FA 3M30B 1EP4B 2XI3A 2CPEA 2MY7A 1RT2A 3BEGB 4I68A 5A6WA 4ZP9A 1X4EA 3CGIA 3NBPB 5KT5A 4RNMA 2UUAF 4KAIA 3UNGC 2ZDOA 4E0DA 3FSIA 1U09A 4HTIA 4ZCKA 4LFBF 4HTJA 4EGLA 1AW0A 2VFUA 2XMMA 2Z2MA 3NNHA 3M8QA 2NQPA 1HBOA 2J8AA 4CNZA 2K7JA 3C6TA 2K3KA 3D1QA 1Q16B 3FZ2A 3W2WA 3HKZD 4UQTA 3BR9A 2BANB 3MMBA 2M7SA 3RZAA 2WAQD 2JJ4D 4IFVB 1C0UB 2HVIA 4ETXA 3D0GE 4WU3A 5JJBA 5E2QA 3HVTB 3ZZYA 3TAMA 2A10A 2XWYA 4R5PA 3C2PA 2HHXA 1W2IA 5FIIA 2XGPA 1QJHA 5EWGA 5HROB 1UFLA 4IDKB 3RW6A 1T8EA 4KO0A 4J9RA 3M2RB 1JMTA 2B3TB 1ZPWX 3V81A 3Q2SC 2ASJA 4LJMA 4IR1A 4KRWA 2MGZB 1T3NA 5FD1A 3HZGA 2DGSA 4USIA 3WC2A 2KYZA 2XGQA 4OI4A 1O5JA 4C0HA 2D9PA 3R5DA 4Q0BB 4JI2F 2DBBA 2IYIA 3DDKA 4IH6A 3TARA 2PT0A 3IG1A 2ILZA 2DNOA 3IAS9 3OVBA 2P9EA 1GXTA 1IN0A 2FPHX 3K0JA 3OQ2A 1S1UB 2BBEA 2FVCA 3KLHB 2BDPA 2UU9F 2AQ4A 1BQMB 2AV5A 2D41A 3K8WA 3NS5A 4BC7A 2G9OA 1QSSA 4K5RA 4M8LA 3DOLA 1E6YB 3F73A 5KG1A 2YQ3A 4RLEA 5DG9A 3NL0A 3R5BA 1O51A 3MR3A 1RT4B 1RTHB 4RNOA 2LU1A 2M70A 3GV7B 3QAEA 1IKYA 4IH7A 4ZOSA 3GIIA 5HP1B 1FRHA 2ZHAA 2IM2A 1VIOA 3T1HF 3TUIC 3JB9k 5J2NB 2V0NA 2V4JB 4CT9A 3QO9A 3UD4P 2R7VA 4GO7X 1JXEA 5A2QY 4RU2A 2CJBA 2J7UA 3IRXB 1GXLA 4JV2A 3HDSA 1QUPA 3KLFB 4LVOP 5B0FA 4NLPA 2RDIA 4ED8A 2VC1A 2XO7A 1OPZA 2XULA 3DOKB 3VAFA 2LQJA 1QUVA 4Y65A 3IA0A 5KFKA 1IM4A 5DM7Q 3TUJC 1TK0A 3CJKB 3CMAS 4I69A 2M9KA 2CFXA 2PDAA 2DHGA 3PW7A 1KONA 1T95A 2MQMA 4ERDA 2DVIA 3D5MA 4A8KA 2OO4A 3H5UA 4DQQA 4DX8H 1N52B 3KNGA 2VBYA 1S72S 4W90B 3CJ3A 3EXCX 1N33F 1R89A 4BC9A 2QA4S 4L3NA 4KJIA 1XR7A 2MKJA 3TP2A 3WBZA 4YP3A 4HYKA 3UCUP 1BD6A 2JRSA 1HWUA 3CSKA 4R8UA 4DFPA 1YJWS 4YDXA 1VMBA 4DFJA 4WIIA 3ITHA 4V19J 3MOZA 1JKHA 5KFEA 2XMVA 2ZC3A 2VH7A 3LO3A 1H6KX 5LJ5Y 4I4BA 4TQSA 3V4IA 3HLUA 2LDIA 2OMLA 2OJ3A 1KVJA 3KMSA 4WFXA 1P1TA 1KLMB 1LFPA 2V8HA 3M6WA 3UR0A 4NX9A 2Y1RI 5E3CA 1VBYA 5HMYA 2R7WA 3P3DA 3IWLA 1SIZA 4QCLA 2PI4A 1I1GA 4IOBA 1NK7A 4A8YA 4TLRA 1B0TA 1SC6A 3FFIB 3DRYA 3CIMA 4WF9Q 5JVGQ 3GFHA 5CZVA 4K4ZA 3L7PA 1JLGA 2OPPA 4LQ3A 2EFQA 1HFEL 5K8NA 5KT3A 2AGOA 4C3LA 2YNIA 3SSSA 1TK5A 1N54B 1S1VA 2VPWB 2GJIA 3M32B 4H4MA 3MR5A 2ILYA 3OTDA 1FVSA 1LFWA 1Q4RA 2RUGA 3ENQA 1RQ0A 2F1FA 5E7OB 2ZKUA 4RW4A 5CCMA 2XLKA 3LGNA 3M9OB 2JLEA 3UD3P 4MKYA 3MCSA 1YG0A 4B9UA 2I2YA 4I2PB 4MYTA 2B4UA 2BA9A 2EKYA 4Y00A 1RJJA 3GFZA 4NL5A 3DXSX 3MM6B 3MM7B 4C7QA 3GV5B 2QRRA 3OUYB 2E5HA 3AQPA 1H2TZ 1S99A 1R8PA 2J0WA 2CJAA 3J81Y 1TFYA 5M2PA 4KKOB 2FHKA 3OFGA 3WX4A 4OHWA 3DLGA 3T6BA 3NMAA 2IRYA 1D3WA 5HBMB 4OZ5A 4PG4A 1U1LA 1GT8A 4MKBA 1FD8A 5D78A 5A8KB 4DR7F 4MK7A 1R6YA 1DARA 1RISA 2WBMA 4RWWA 5J1EA 1NH8A 3I0RB 1RT1A 4WFZA 3VR1A 2DHAA 3FZBA 5F9NA 1YVFA 2IVYA 1VRTB 4A48A 4KHRA 3SXLA 4X4TA 3HT3A 2VQFF 2LQ5A 4DL4A 1JJ2R 5GAEI 3PKYA 3BQ1A 1LV5A 1RT6A 4DHVA 1BQNB 3N6MA 4I56A 4EFAC 2NZ4A 3N5FA 3BO2A 4B3OA 5KG0A 3U1MA 2EK6A 1L3UA 1LWFA 4KHPF 1GTHA 1JX4A 4OJ1A 1S9FA 4C8LA 3D1OA 1HBOB 4DV0F 1KQSR 4ZPTR 3C6TB 1ZAVA 4KB7A 3VF0B 4OJHA 1MROB 1HI1A 4DBQA 4P6QA 3DCAA 4B02A 2FLPA 5FJ4A 1RI7A 2HHUA 4B9VA 2OFHX 3H25A 4BHQA 2DHSA 2AJFE 5AXNA 4R5PB 2CZVC 2QO3A 5HQ8A 3AB2B 5MAOA 4X66F 2DK2A 4QU6A 1G7CB 3CJ2A 2FUG9 5F3TA 3QGHA 4PG5A 2FJWA 2LKZA 2VFRA 5K5MA 2QA1A 1N8RT 4L6V3 1RT7A 1WACA 5GAGI 5GVQA 4G6VB 1JB0C 1WD6A 3JTPA 4V19X 2JVRA 1FKOA 1DLOA 3OL6A 4MKAA 2YNFB 3CTRA 4FVMA 5B08A 2LMIA 5K14B 4QW8A 2FJXA 1ZAXA 1TL4A 2KYXA 3W2VB 1ZTWA 3IG1B 2V8GA 1JWWA 3TA2A 2RSQA 2ZE2A 1FDNA 3MFIA 1R0AA 4I64A 3V5RA 5DLGA 4Y2AA 4BCAA 3MPWA 1M5VC 1HBUB 3FEZA 5DG8A 2PSZA 2RD5C 5A8RA 3RBEA 2GGPA 2ZJRQ 1T3OA 3CXCR 3KHRA 2KFYA 2QZ8A 4IG3A 2ZH6A 3KLVA 3DOLB 5M2RA 4RNFA 3KG1A 1HR0F 2CQBA 4DL0C 3H4BA 2CQDA 5LJ3Y 4IOAQ 3OL8A 3RBDA 2PGCA 2VG7A 4PKDB 1IKYB 1S0VA 1JJHA 2HG4A 2VG6A 3ZZRA 2CPIA 1VFJA 2BABA 2XLJA 3DXBA 3HKWA 1KFSA 2QMXA 4QQBA 3CDWA 4WFYA 1NH7A 2MQPA 2C2DA 2VFSA 2DR8A 3G9CA 4Q44A 4R0EA 1Z2ZA 4DL5A 2CRLA 1DJ0A 3CB4A 5LSLA 3CMES