1UKUA

Crystal structure of pyrococcus horikoshii cuta1 complexed with cu2+
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural implications for heavy metal-induced reversible assembly and aggregation of a protein: the case of Pyrococcus horikoshii CutA.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Metal binding protein
molecule keywords periplasmic divalent cation tolerance protein CutA
total genus 31
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ukuA00
3TA2A 2J9DE 3AH6A 1NZAA 3GSDA 1V6HA 3X3UA 1V3SA 2ZOMA 1HWUA 2J9CA 2JJ4D 3AA9A 1NH8A 1GNKA 1XK8A 1Q1KA 2GX8A 5D4OA 4WK3A 4OZNA 3O8WA 3BZQA 3OPKA 3CE8A 4WK1A 2DCLA 2GNKA 3L7PA 2XZWA 3AHPA 5D4PA 3M05A 4AFFA 3NCRA 2CZ4A 4D3GA 2NUHA 2RD5C 4Y6IA 1UKUA 3AA8A 4CO4A 4YB6A 2NS1B 1OSCA 4Y65A 1V9OA 4RLEA 4CO2A 4IYQA 2V5HG 4CNZA 1QY7A 1H3DA 2J9EA 1NAQA 2VD3A 4RX6A 2EG1A 3TA0A 4USHA 4NYPA 2J9DA 5DRKA 1J2VA 3LF0A 4YB7A 5D4LA 3O5TB 3NCQA 1O5JA 2GW8A 4CO0A 2XULA 1O51A 1V3RA 3DFEA 4OZJA 4R25A 3TA1A 4CO3A 2EG2A 1UL3A 3HLUA 4D3HA 2E66A 3NCPA 1VFJA 4CO1A 1UFLA 2Z0GA 4RWWA 1KR4A 5DS7A 2NUUG 2O66A 2ZFHA 4C3MA 1PILA 4CNYA 4USIA 4ZK7M 2O67A 3MHYA 2PIIA 4USJC 5D4NA 4CO5A 4C3LA 4RWXA 1VHFA 2XBPA 4C3KA 2XG8A 4YB5A 5L9NA 4NYOA 1UMJA 3T9ZA 4E98A 1P1LA 1NH7A 3N5BA 4OZLA
chains in the Genus database with same CATH superfamily
3GMGA 3OFEA 3EYZA 1GAOA 2H3EB 5CYQB 4CTAA 1GT8A 3G6VA 4J9RA 2RS2A 5IZHA 4DQQA 2CZVC 2ZE2A 1HBUB 3T6JA 5ITHA 2AJ1A 2QMXA 5KT7A 1C4CA 5J1EB 1WF0A 4RO0A 2XO6A 1PIEA 2YKNB 5D0EA 3A3PB 5F8HA 5DM6Q 1NKCA 2G4BA 1XMQF 2QYCA 1CJUA 5HO4A 2CQ0A 5KFEA 3LGMA 4DR5F 3R2CJ 4M5LA 5BXIA 1VBKA 3C16A 3JQKA 4R8UA 1RYSA 3EWGA 1VQLS 3P45B 2VPWB 2C42A 3T5JA 3KLHA 1VOMA 2CQ4A 2MHEA 3DGPA 4ZVUB 3C14B 2V9WA 4CYUB 2GS8A 2R7VA 2ZC3A 2YKQA 3Q22A 4HACB 1IBLF 2FLLA 2V34A 1OSDA 4WK3A 1RAJA 1QVGR 3KXDA 4RW8B 3B78A 3AY0A 2M2BA 3OR2A 1KTVA 1S5ZA 3FFIA 4WIQA 5GAGI 3EUNA 4LSLA 2GMHA 5CH7B 2UUAJ 1CULB 3PY8A 3FNNA 5HJYA 5EX0A 4WKRA 4O3NA 2YQ0A 4OV1A 4O4RA 1HQUB 1GQEA 1NNDA 1AUSL 3W8PA 3CDEA 5C2GA 1U45A 3CDAA 4DOZA 1SUQB 3RR7A 1BHNA 2DH8A 2PMWA 2J5AA 2XTJP 3BN4A 4OZ3A 2VFRA 4IG3B 4QYRA 4USVA 2E1RA 1G7CB 3DYAB 2C3YA 4J7CA 3VGVA 3WQPA 4WZMA 1WDTA 2CPXA 1B99A 1SCJB 2B56A 2Y3YA 4F0KA 2J7WA 4ERDA 2AEJA 4NEYA 4OHVA 2BJ1A 2AGPA 2XYGB 5IM0A 4V19X 1B7YB 1H3DA 1LXNA 3HHLD 5A8RB 2B8QA 4IFYB 3BV8A 4N5SA 3B8HA 3UI3A 3Q8RB 1NJYA 4GKJF 2COLA 2WONA 1X60A 1F60B 2OMOA 4NLDA 4ZPVR 4BWJA 3DOKB 1MU2B 3KDNA 3ZZRA 5DQHA 3CCLS 3H20A 2LDYA 1E6VB 4NCGB 4DPTA 4OJ1A 1UJ4A 2BABA 3BN7A 3ZZTA 4Q44A 3GTYX 4QU6A 1HHSA 2XSJA 3QMQA 2OUGA 1XWLA 3ZXWA 1FDBA 3J7Z5 3D0GE 2YNGA 4A8QA 4PWDA 5GAGU 5HVGA 1XMQJ 1TL5A 3SBMA 3F44A 2MQLA 5SUHA 5JXSA 1Q7YT 5J2PB 2KRBA 5AJ3J 1RAAB 1WOSA 4PXDA 3VWSA 5AXMA 4DL2A 5EUHA 2DH9A 2GJIA 2E66A 3GB0A 3NMAA 1I5OB 2XYPB 4UY8T 1H72C 4KO0A 3DLKB 4RW8A 1Y9OA 3J81Y 2ZDOA 3FFIB 2DNMA 2LEAA 1T7PA 3RRGA 1FI4A 2XWXA 3CJSA 3TZZA 3TAQA 4KTQA 4ZIWA 1B0PA 2HNZA 3DLJA 3TNVA 4U67Q 4DV2F 4O3OA 3RBZA 2DIVA 1RCXB 1D9FA 2WVFA 4URQU 2W01A 1OY9A 2HZVA 4ZCLA 3TR5A 4C6AA 1DQAA 1T3NA 2AYEA 1U1PA 2KFYA 3GJRB 1SH3A 3J81j 2E5GA 5EHHA 3A3NB 2PSZA 2GV1A 3KNGA 2PC6A 1LW2B 2B5JB 1JLEA 3DRSB 4PXEA 4RW9B 2EFVA 3W8GA 4C3KA 1DURA 2YNHA 2XS7A 4ECWA 2H4YB 1NO8A 1S48A 2DHAA 3FBFA 4AT1B 3M8RA 2RRBA 4EO8A 5C25A 1FRHA 3OT9A 4ECYA 1WSVA 2QT7A 3DDIA 4MIBA 1YJTA 3CJ2A 4DV1F 3R5BA 3OVAA 1Q7LB 4DMZA 1T3OA 5HN0A 3K17A 5A76A 1R89A 2LDIA 2BJ8A 3KLFB 4DLGA 3D68A 4B3TJ 1FNXH 4WBFA 3UN5A 2RF2A 1BUXA 4DPXA 3T5KA 3M9OB 1XR5A 5FLXU 2OP5A 3J7YU 2D3ZA 2APOA 2GFFA 4JI1J 3MFIA 1S1VA 2J7UA 5HP1B 1YVFA 3BDEA 1PBUA 1TUWA 2HQDA 3BPSP 3DLKA 1DHMA 2D74B 1RT2B 3OTOJ 4ZCMA 3PEHA 3G9CA 2VFTA 3Q89A 4WIIA 4C2MA 1SC1B 4QQBA 4RNNA 1ZTTA 1MN9A 1P1TA 1XK8A 1N54B 4F0MA 4DUTA 4OHYA 2CIMA 2GO8A 4ZVPB 5A6WA 2OFGX 5C7PA 4U7UD 3HVTA 2RH3A 3M8QB 2DRBA 5KFCA 3CSKA 1JLBB 4IG0B 1WC0A 5K8NA 3PHTA 2WB4A 3K89A 3W2WB 1VBYA 1FRIA 3L7PA 4KKOB 2J6TA 1J5OB 1YJUA 2IM2A 4D3GA 3OXFA 2VBZA 2DR7A 2ZITA 3C66A 1U1NA 2RHQB 2JWNA 5GMEA 3ET6A 3CJKA 4Q2LA 1RAFB 3V81A 1TL7A 5KT3A 3C6UA 3BDPA 2YNIA 3BGRB 2XO7A 3CT9A 3O6QA 5DQIA 2YH0A 3OXGA 1YWXA 2XSFA 1U09A 3I32A 3SQGA 4CO2A 4ZP8A 2V5HG 4CNZA 1SL1A 2YTCA 4LFBJ 4WFXA 4DR3F 3A3OB 3KLGA 2QA4G 3ZTSA 5HMYA 2IC3B 4CCHA 4F02A 4OZ5A 1HNIA 1BE4A 2KL8A 1M1KT 1NPKA 1WC3A 4DHVA 1IJFB 5F8MA 2ZH7A 2VZ9A 4B3TF 1BQNB 2VHGA 2EFQA 2R3VA 1UPPA 3EXYA 3OJUA 3FZ2A 2H5IB 2KJVA 1URNA 1U0HA 4NI2A 3EZOA 3NCQA 1WELA 3OTBA 1ZM9A 1IR2A 4JI1F 2WW4A 1LEOA 1CJKB 1VRUA 1X4GA 3M32A 4QW8A 4WTOB 4NLOA 2KT3A 3DFEA 2MZ1A 2QLXA 4NL5A 2BJDA 3AOCA 3BB5A 1RWPB 1PCAA 4FXWA 4NMXA 2DR9A 5K14B 2Q66A 2EG2A 1IWAA 1S6PB 1SBRA 2P6TA 3LQVA 1H98A 3LP0B 2CWKA 1VFJA 4HTJA 1AUDA 2RMLA 1FVQA 2ADCA 1N8RT 4DN9A 1TELA 2EEYA 3H7HB 2L3MA 2EFNA 2YQ3A 4LIWA 1SC6A 2PDAA 3TYTA 4QIFA 5CYMB 3UDEA 2MGZA 1QAXA 1TKTB 2FIUA 3KLEB 3JTNA 4O44A 5CABA 4ED8A 2ZFHA 2Y8WA 2BUNA 3K2YA 1QAYA 3G86A 1GMUA 3PACA 4G65A 1OIAA 2VC1A 1U6ZA 4LBIA 3SMZA 3TAMB 2WVBA 3TX8A 3CJKB 4DV2J 3ENQA 1OYEA 1CC8A 4X62J 3NS5A 2OPQA 4USIA 4OI0A 2P8IA 1X5SA 1HPZB 1K47A 4K2JA 3NGKA 4MT1A 4Q7AA 5E3RA 4GC6A 2MJNA 2V4JA 3T1YJ 1YITS 1T8EA 1R7IA 2HGLA 2O1PA 4HEA9 1S79A 4WZQA 3DRXA 1KLMB 3KHLA 2JLEA 4OYBA 4I6WA 5HMXA 5LXRA 1S72S 1EQ0A 1LKZA 1U25A 3M4XA 5CCLA 1JJHA 2CVIA 2VODA 4TU9A 2OEMA 2L08A 1LNQA 3GZ7A 1XR7A 1EIYB 1C1BB 1FCAA 1HBNB 4FNIA 3C19A 2X3DA 3T19A 4F36A 2NXCA 1DTTA 4EBEA 1N4LA 1QSSA 3NY0A 3HHLB 2FC8A 4DQIA 1MROB 5C5JA 5F8GA 4ANCA 3OQ2A 1GXTA 4M5KA 2XCPA 4OZ1A 3SV3A 1G2EA 3CJRA 4QW9A 4M5MA 4AL7A 1HI1A 1PAEX 2B7CB 5FD1A 2DNGA 1RT6B 4X65J 2QE5A 4ICLB 1NZAA 4LF4J 4LFAF 2BMBA 1X8DA 4CDIA 3Q8QB 2ROGA 3M6XA 3H5UA 2Y0BB 3AFGA 5ETQA 1JLQA 2E5HA 4DPWA 6AT1B 5LOQA 1QM9A 4LBPA 5GVQA 1TVRA 2IBOA 2EK1A 2V63A 4WP8A 3AA9A 1U4BA 4PG4A 2KG1A 1NH8A 1NU4A 1JB0C 1H2UX 1Q8LA 1WACA 2DRDA 4I6YA 2HVHA 1N56A 3BJYA 2FHMA 4XDCA 1KP6A 2ZUAA 5CCMA 4O4GB 1ZM4A 4W98A 1KFSA 2E1AA 3PJ9A 4UZCA 3THPA 4BCAA 2BOAA 4YFUA 1KKHA 3OUYA 4DR6J 2Z8QA 3ISND 3D6MB 4ZPWR 2QX0A 3RRHA 4OYPA 2DITA 3CE8A 4ZPAA 3RBEA 2DXEA 2B4VA 3THTA 2W9AA 4ANEA 2IM3A 2LECA 2V4JB 5I3UA 1IKYA 2CJYB 2R4FA 3UDLA 2W7PA 2AYBA 2CZ4A 4DV0J 2OKQA 5FDLB 2HNYA 3NS6A 2X1BA 2Y1LB 2GVZB 1HKAA 3IWLA 4RZRA 5D3GA 3IGVA 1S12A 2DH7A 3EVWA 3CD6S 3LAMA 1JJCB 2ACMA 1NJWA 3TX0A 2BJ9A 4RUHA 1YI2S 4OL8A 2KZZA 4ZP6A 3GV7B 4RNMA 1UP1A 3HP6A 1VQKS 2IM1A 1UJ6A 2WSFC 1RB0A 2B9EA 2G9OA 2WB1D 3K7RA 4AD6A 1IWGA 2HNZB 2K7JA 4ZLJA 4DR3J 3PR5B 4P52A 4H4KC 3J81U 1Q53A 3A12A 2EG1A 3SFUA 3TA0A 3M30B 2ZWOA 4NX9A 3UCZP 4MFBB 1J2VA 4ZITA 3BSOA 3NL0A 4U9RA 1M5VC 3CPWR 3B82A 3FCWA 3O5TB 4QCLA 3BO4A 2VG5A 1FKOB 1QTNB 1M0SA 5CZVA 4UW2A 3NBPB 2WSEC 4TQSA 4QWCA 3MMCA 4N8OA 2GQQA 2W2NP 1V5VA 3MEGB 2E44A 3P5TL 1HWIA 3KLEA 4KH1B 1UTAA 3M8PA 2E1CA 1ZS6A 5C42A 4ECVA 4QJVA 1M1HA 2O3DA 3QGIA 2HG4A 2JSXA 3DI6B 4DN0A 4ZLPA 1VBXA 4BBYA 2DYAA 4R5PB 2UVVA 2QLWA 3LOUA 2UU9J 4Q8FA 5KFZA 2NLWA 3ZO7A 1WSRA 4LRDA 2ZH3A 4P6QA 1QUVA 1JLFB 3TJ8A 4FBTA 3ELHA 4DQRA 1VBZA 2VBXA 1IQTA 1TV6B 2BE7D 1FFWB 2E9RX 4WFBQ 2E1MC 3R5DA 4ZN3A 1ZH5A 3TUJC 1TAQA 4CM2A 3Q8PB 3PO5A 1RZMA 4GO7X 4C7QA 5KFTA 5ETSA 3M2UB 2IVYA 2YX4A 4UQGA 2VU5A 1FHTA 3MEDB 5K20B 2MJUA 2G2ZA 2LQ5A 3ETOA 1RTJA 2FGOA 5JJBA 3MFHA 1VQ5S 1UVNA 5HATA 1YIJS 4M63A 5THWA 5D0GA 3WIVA 2FVPA 1FRJA 1Y11A 5FLXY 3H40A 1NJZA 4GKJJ 3FGVA 5FJ4A 2M4MA 2MY7A 3I0RA 3GYGA 1N36J 1U2FA 1BMQB 4XO0A 3VCDA 2RNEA 1NH7A 2W8LA 2M8DB 2HBRB 3D54A 3JTPA 1WHYA 3AB2B 2AP6A 4IKAA 3RB6A 3MUMP 4DL3A 3CDWA 1F6TA 1DBDA 2R8KA 2QTWA 1LQ9A 4ILRA 1CJUB 3MM6A 1RBOB 2PD1A 1VHIA 4Z37A 4X66F 1TMJA 1DQ8A 2VJUA 3NBPA 4KHPF 1U2CA 1ZPVA 1TL7B 2OLWA 3BGFA 1X4AA 3GJSB 3ILIA 4HHJA 4ZP9A 3C3LA 2XNRA 4EYHB 2DBBA 2ZVSA 3I5AA 3CCWA 4ZPDA 4RBVA 1FEHA 1MLAA 4PG5A 5K9FA 1HHQA 4PPZA 4IO1A 2RE1A 3HT0A 2VUGA 4FS1A 3EDRB 3JQJA 5BR8J 4DSEA 1HYSA 3QATA 4ILLA 1YZ6A 2NQPA 3CJ4A 1TTHB 2W7AA 3DLGA 3AXMA 2KU7A 3SCKE 2QL9B 4DR7F 2B4OA 2HVEA 1C0UA 3M6WA 1KVKA 1R8PA 1S10A 4NE9C 5HVFA 1KQSR 4TQRA 3ONQA 2JHEA 2YKOA 4WYWA 5KG4A 3MWBA 3KLHB 3LWLA 1YLXA 4LF9J 3QLHB 4F25A 1ITPA 1KEKA 1HD0A 4F3MA 3FJ2A 3BQ1A 3UCUP 3GE9A 3MCMA 1RKJA 1DFDA 1CQMA 4WF9Q 4EZ9A 2ZJQQ 1FA0A 3JSYA 4C98A 1FD8A 4ID5B 4IDKB 3ICLA 4BC7A 4CP5A 1S6PA 1JX4A 3HKZD 3NNAA 2QJ3A 3VAMA 2C3OA 5E41A 3BBCA 1IBKJ 4OX6A 3V4MA 3DOMA 4RUCA 1RYRA 3HDSA 9ATCB 3KK1A 4ZOSA 4IR9A 2HHPA 3IN5A 4K8RA 4W4MA 3UVJA 2G1HA 2V2ZA 3K5LA 4NCBA 2PEBA 3RW6A 3PDNA 2XY7A 4KB7A 1QAIA 1AROP 2IAJB 2GO9A 3T9NA 5KFNA 2F4FA 3Q24A 1EARA 3TANA 2V4RA 2LA6A 1B4SA 4F04B 3HD2A 1MG7A 1Y0HA 5B0DA 3GIMA 5LT5A 4NYPA 2CAJA 2JC1A 2OPQB 2P6SA 1YJNS 1J5EF 3I6PA 4LRFA 5KFYA 5LJ3Y 1D09B 3CULA 5A8RA 1JLCB 2AV5A 2JVRA 3RAMA 3ZNUA 3MPYA 1NHUA 2XMMA 3CD5A 2OMLA 4B3OA 2ASYA 2F8HA 3AB4B 1HNWF 2IMOA 4RL1A 2VG5B 1LWXA 2JL9A 1REGX 1MMNA 4PG6A 4JI4J 4B3RJ 4HH1A 2MZQA 2OI2A 2DT9A 1P27B 2RDIA 3JAMU 3RB4A 2NXJA 4N47A 3SFGA 4LREA 4DR7J 2EFPA 1HQEA 4LVNP 4W92B 1T0TV 5DO2A 4USWA 1TK0A 2EFGA 2CG8A 4DV6F 5JVHQ 4ED7A 3US5A 2KYXA 1KS2A 2V9KA 2XHWA 5ETKA 4J9KA 1D1UA 3J7YI 3QAUA 1YBAA 2VQEJ 2VONA 4P73A 2FVRA 2KDOA 1UZHA 2MXYA 4A8YA 5A8WB 2ZZMA 2HRUA 1JLFA 3NG8A 2IJFA 1RT5B 2FC9A 1L3UA 1A6LA 2HYIB 4DV4J 2FHJA 4DU8A 1NK4A 1RACB 3DOMB 1I6JA 2Z56B 2Z58B 3JQMA 3L09A 4K4SA 1VK8A 1U1RA 4FPRA 5KT5A 1X4EA 4B9NA 4TY9A 4G1QB 3SXLA 3GV5B 1FRMA 3KJVA 3FRYA 5DLGA 5HMZA 3KLFA 4NYOA 1FX2A 1SPBP 3U1NA 1MNEA 2XMAA 4CT9A 2B9WA 1OPZA 1JKHB 1P6TA 3TEHB 1PJ5A 3LGNA 4BLGA 4J9UE 4I2PB 1LW0B 2OPRA 3EGWB 3TVYA 4X4SA 5H9FK 2JNJA 5IT0A 3OL7A 4IUFA 1LWCA 4H54A 3MURP 4O0NA 1GMWD 1RKIA 2VFUA 4OYMA 3TQ1A 4EYIB 3I4HX 1Y3KA 2NYHA 3S01A 4UZBA 1REVB 1BWVA 3DM2A 5KG5A 1Q8BA 1X0PA 3T41A 2BR0A 4YY3J 4ILMA 5KG1A 5A8KA 4U6PA 3QWUA 4Q5VA 4ED1A 3AODA 2DD8S 2DNNA 1CJVA 3X3UA 2UUCF 3ITHA 5C24A 2OEJA 3S7RA 1Z1ZA 2CJ9A 4YR2A 3OL9A 2OPSA 1H38A 4QIEA 2W2QP 2KRRA 3R1LA 4MTPA 4OX7A 4DCPB 2HHHF 1F5CA 4DSKA 4B9SA 3NOGA 3WX4A 1UW9A 2UUTA 2X7IA 2HNDA 3RGIA 4X4QA 5E5NA 3JXOA 4LF2A 2WAQD 5AXKA 4C8MA 5DG7A 1IKXB 1SQFA 1JNRB 4FZVA 5M2UA 4E0DA 1RT2A 1FVSA 1U7LA 2PA3A 1OMSA 3HFZB 3NWRA 4WXOA 3PXGa 3MEDA 3OPKA 4ENOA 4ZIVA 2GNKA 4Y0FA 2AD9A 4F3QA 2GVDB 5D4PA 3M05A 2BVZA 4LJMA 3Q8VA 3CCES 3W3SA 5F8IA 1HBOB 3MPVA 3PTWA 3EMTA 3DLEA 2ZBCA 2ZZNA 4K4YA 3MM9A 4LF8J 1TU0B 2ZD1A 3BSCA 3OBIA 5F41A 1TL1B 2F8MA 1WTFA 4M5DB 4UY85 3FCVA 1SIZA 4J5OA 2OSQA 2R7QA 1IBKF 1HI0P 4KRWA 1LK7A 2UUAF 1RHKB 1YRUA 2L9WA 1I3OB 2V67A 1QE1B 4ES2A 1SJ4P 4RW4A 4LMZA 3DMJA 1NKEA 3MM6B 2CPDA 3KLVA 3T1YF 1RWVB 1YK9A 2HURA 2E29A 1EJ7L 1NAQA 2IPOB 4M8LA 5HK4A 3L95X 1WORA 2DKOB 2IA0A 1U02A 4KSEB 4PYDA 4RX6A 3MMBA 1IBMF 2RHSB 1UZDA 5KG3A 5J2QB 4Q2MA 4ED0A 1F5AA 4KGZB 4XPEA 2DXDA 5DRKA 3MEEB 2JFKA 2BEFA 5K14A 3O1LA 1FF2A 4L3KA 4NASA 3LP0A 1RT3B 2VG6B 1F1BB 2VC0A 3HMJG 1RTJB 2LEBA 4DZDA 4ZCKA 2M9KA 2GHVC 3PV8A 4L75A 1Q95G 2NXEA 5BYRA 2D3O1 2IJNA 2NZCA 2XQCA 3S8SA 3B54A 2CQGA 3KLIB 1CULA 5F9NA 2JFDA 3R8YA 4D3HA 1I94F 2Y8YA 1Z4UA 2MKHA 3ISZA 2WVEA 3TVZA 3VGUA 3NCPA 1TL3A 5J2MB 5KFHA 2B43A 3OTCA 1S59A 5SZTA 3P6YC 1GXLA 2I0XA 3LH2S 1UFWA 2AIRB 3BEGB 3LO3A 5L1LA 4EO6A 4IH7A 4LRCA 4USTA 3WIUA 7FDRA 2NUUG 1HQEB 2H65B 4ID5A 4IDKA 3QYYA 1LFPA 3GONA 2VBYA 5LJ5Y 3NAHA 1BQMB 1S1XA 2GGPB 4IQMA 4X4OA 5DQGA 1NDCA 2V6AA 3C14A 4NCAA 4A4JA 3D2WA 1RBAA 3G8QA 2AX0A 2BE2A 3TUIC 1YTYA 1WC6A 2BM1A 2QGFB 2RT3A 3MHYA 2HBZB 5G4DA 4DV0F 4JI7J 3QWPA 1LWFA 4PXCA 1SQGA 4NZ7A 1DQ9A 4O3QA 3SQOP 3E8OA 1AFJA 3R5AA 2FY1A 3IRXB 1VC5A 4ZPCA 4ZVQB 4ED2A 2HQ3A 1UJ5A 3PHEA 4PQAA 1C1CA 3WX8A 3CIZA 5T14A 4MJKA 4N77A 1RWKB 4ALZA 4E8UA 4E98A 5L46A 4CIOA 2DGXA 1TZ0A 1XQIA 1HR0F 4G3IA 1KLMA 3MZIA 2MTLA 3J7AN 3VAKA 3C6TA 1IJEB 3MI7X 3W2VA 3N28A 5HVHA 1GEHA 4RKUC 1HPZA 3GPAA 3AH6A 4CRJA 1S6OA 2XB2D 3IO1A 2DHGA 3M2VB 1FJGF 1YGYA 2JEFA 3GP9A 1IKWB 4I7FB 5KFVA 2UVRA 2E7VA 3GG0A 3UD3P 1ZPWX 2VDIA 3HHLA 4LRBA 2F1FA 1NJIT 1QTMA 3I55S 3QT8A 5EWEA 4B3MJ 2C1EB 2P9EA 4DPYA 2EVZA 2DHSA 1X7VA 4JP8A 4K7QA 1CVJA 5F3ZA 1YX2A 5CQGA 3VHQA 3PX4A 2R7UA 2OD6A 2C2NA 2V4QA 1XNQJ 1GNKA 3Q8UA 2RS8A 1DTTB 3W7BA 5A8WA 3G96A 2X1AA 1JLAA 3D7SB 5CA5A 5KOXA 1WG4A 4GKKJ 2DEIA 1RT4A 3K8WA 2VOOA 4ECZA 2I38A 2Q6CA 3QBCA 4G1IA 3C15A 2YNHB 3PG9A 1W2IA 2M70A 1FRXA 2Q1LA 4MIWA 2DCLA 2G0IA 3UWTA 3AOAA 3VAIA 2XLJA 2XZWA 2HBYB 3G8SA 4DLEA 2BQUA 4NXMJ 1Q0NA 4DV3J 3QIPA 1HNXJ 2R8GA 4EZ6A 3HVRA 2XMUA 3DU5A 1RT1A 4GO5X 1NRKA 2GVDA 5KFSA 2KH9A 1UKUA 3DRPA 4FPIA 5LSRA 1KHVA 1X4BA 2W24A 1DY3A 4KFBB 1FJEB 1JQGA 4UQTA 3IBWA 3M2RB 4NRTA 3IWNC 4KJIA 2PEHA 3OLBA 2QL7B 2WBRA 3TEGA 3IM8A 2B4PA 2VASA 3MM7A 5FDLA 2XZDB 2XS2A 1SXLA 5AT1B 4QWBA 5MLCV 2AYGA 3MR3A 1JNZB 4LF6J 3KK2A 1FERA 2LQ8A 3H4DA 3DDKA 1RAIB 4I68A 2LQ9A 4K5RA 3GYNA 2CJKA 2K1RB 4M5JA 1SC4B 4ZLNA 1X4DA 2A1BA 3V2UC 4TLQA 5GADU 1D9AA 2NR0A 1KHWA 5J1NA 3CCVS 2N4DA 3MMJA 2QG9B 4Y2MA 3KYLA 4JV1A 5LMUF 1WHXA 1C0TA 2XULA 2B7BB 1K1SA 1PC5A 3GU0A 3WC0A 4K50A 4OZJA 1IBMJ 1WNEA 2W9CB 4HI1A 2Q3PA 4LIRA 2DGWA 3KG1A 1T9YA 3KLGB 1CPZA 2IYIA 3MOZA 1BGXT 1UL3A 1N88A 4RBTA 2NSBA 2F40A 1P9YA 3KDOA 3QFWA 1JKHA 3MGJA 5BR8F 3OSPA 2DGOA 3HJVA 2CJXB 2L9DA 2MKYA 2LQJA 2QSFA 3DGVA 3PO4A 1RHQB 2YNIB 3BGRA 1Q79A 3P96A 4PEOA 2VG7A 2V69A 3QO9B 5HSPA 4J9SA 3C8YA 5B0AA 5T41A 4CYUA 2HRTA 4KYZA 2KXFA 4X84A 3LALA 1K44A 1WC4A 4NLXA 3UW1A 4R0JA 1F0XA 1VMBA 4I6AA 1RA6A 2UP1A 1PILA 1Y00A 1UEUA 1NK6A 1R3NA 3C16B 3DRPB 2QA4S 3LP1A 3PJXA 1DLOB 3OHBA 3HVTB 1EKRA 2FZGB 4LFCJ 4BC9A 4JYAJ 2W2MP 1RU1A 2HSEB 2GQCA 1U6BA 1FE0A 3D6HB 4DU7A 3Q2TC 3VGSA 4DSLA 3G4SS 1JJ4A 3BSNA 3V4IA 2G13A 2ZE2B 2M0GB 1VS3A 2IMWP 2BBEA 2XM3A 1RDRA 4CLLA 1G3OA 3DU6A 3SYZA 1X4CA 1GK8A 3DYAA 2AYMA 3A1YG 3R6GB 7AT1B 4ZVRB 5JVGQ 3QJPA 1UMJA 2FB0A 2HFUA 3N5BA 4TVAB 3TO8A 4FF4A 4CT8A 2JRSA 1Q5YA 1RT3A 2VG6A 4J9PA 3G82B 1CG2A 4KGMA 2ABYA 2LFVA 1T94A 3QPIA 4NLUA 4C48A 4OHZA 2BV3A 1VC6A 4NEZA 2AGQA 4JI4F 4B3RF 3T3FA 1JWWA 2JH3A 3R97A 1VQPS 4PWWA 3W62A 3DGPB 4DG1A 2MQMA 2WTFA 3EE3A 4YY3F 4A8MP 3NLCA 4LSNA 4NLVA 1HR0J 3W5YA 4QYZJ 3U1MA 3K5NA 2X1FA 2W4DA 4DUZJ 1LXJA 1IKWA 3RU0A 4TY8B 2KHDA 1C1BA 1HBNA 1SB6A 4M5IA 3PNIA 1RADB 4RW4B 4MYTA 2DEJA 3ZZZA 4DV5F 1J5EJ 3O3LA 2E5LJ 3NAIA 2VQEF 5HQLA 2QMUB 1SH0A 1VRUB 1GX5A 2P5VA 3M32B 4OJGA 4N76A 4H4OA 4PUOB 2DCUB 1WOOA 3I31A 4DUYF 3IMQJ 1IR1A 2K3KA 2LXFA 3GJQB 4PCQA 4ZVSB 2SXLA 5LL6d 1DAXA 5D4OA 2VIHA 1RT7A 1RISA 1IKVA 1FNOA 4MH8A 2IVMA 3HF5A 1PYSB 4WKYA 4E2FB 4QWDA 1R8BA 3BPDA 3GLJA 1CSJA 3AQOA 2HBQB 1JLQB 1QSYA 3HK2A 2ATCB 3SCLE 4Y00A 2W2OP 1DZ5A 2LCWA 4DL0C 4K2XA 3CJ3A 3E2EA 1Q5VA 2WSCC 4USMA 1S7HA 4Q45A 3CCRS 1BQXA 2FZCB 1T9VA 1RCOB 2YBVA 3BYPA 2A10A 2N3OA 1XNRJ 2IHR1 1U24A 3TAMA 5EX3A 1VC0A 2GQ2A 4YB6A 2D3UA 3V5RA 1SKRA 1WHWA 3C46A 4OZ0A 5M2RA 5CAAA 4L74A 1N0VC 3EZ5A 2QZ8A 2ZEJA 1C0UB 4M5GA 1NMEB 1KBRA 3PW0A 2MQ8A 2HMIB 2M3DA 9RUBA 2RVJA 2DB1A 2PN6A 2VQFJ 1EAYC 5F8LA 2M7SA 3HM9A 3CC2S 2B9YA 3QGGA 4TU8A 4JYAF 4F2SA 4U96A 2Z2YB 3MR6A 3PKMA 4PRFA 1H6KX 1S1WB 4B02A 4DQPA 2V0NA 3W9IA 3DOLA 2V8PA 2H1YA 3DXBA 4BWMA 4CO0A 3OSNA 2BDPA 5LXYA 5KAKA 2OELA 2B6AB 2HVDA 4RPFA 2BQ3A 3IGNA 3ENAA 2Z2MA 4R25A 3QJJA 3MOJB 4LR8A 4ECQA 1JLCA 2UZAA 1IKYB 1VISA 1KOHA 4LF7J 1B0TA 2PI4A 2AU0A 3I56S 5A0YA 2AW0A 3N6NA 4RW7B 5GAHU 3WDOA 2AGOA 1FDNA 4CLZA 4DDFA 1NSKL 3GIJA 2KFNA 5DS7A 2LMIA 1EHWA 4ZKAA 2KG0A 1X9MA 3DLLQ 1N6QA 4DQSA 1CBKA 1RT1B 2MY8A 3B6BA 1G1XA 3TUPA 3MMCB 2Q6BA 3BO2A 2KN4A 2YKMB 3OTOF 4YOEA 2BW7A 3MR7A 3MUVP 1EQMA 2NZ4A 2FZKB 3M8QA 4OYXA 2HWHA 1NDPA 1HNVB 4CNYA 2HHUA 4K4XA 4WFZA 5DDOC 2V8HA 2XCAA 1QD1A 1U26A 3TZXA 4KKOA 1ZETA 3N01A 1ZZNA 5J2NA 1U48A 4U8VA 2ZUGA 2G2YA 4KHMA 4C3LA 3WBZA 2CG4A 2W4CA 4Y2CA 3AJ2A 1JLGB 2GAGC 3NWGA 5BYQA 1WKJA 4Z7YA 2GIRA 3QIDA 1A9NB 1KWMA 5L39A 4URSA 2HQCA 4ATNA 2YX7A 3HHKA 4Z7CA 4NZ0A 3PYEA 1AB8A 2YWHA 4OZLA 1TK8A 3PCOB 2XLIA 2F9JA 3UD4P 3ITHB 4YMEA 4ZPBA 4GVBB 3G71S 3KTQA 1FJGJ 5T7LA 4KPYA 2U1AA 5RUBA 3R1HA 4Y2AA 1B70B 2UUBJ 1TR0A 2QFIA 2YNFA 1TK5A 2ILZA 2B9XA 3BO3A 2MQPA 4A8WA 4AQYJ 4DZ6A 2DHHA 2WVDA 1Y5IB 2ILYA 3R6LB 2N82B 1RTZA 2VA2A 4TLRA 3EGVA 1NK8A 4J9MA 3SV4A 1AYEA 5DLFA 1LW0A 1RQ0A 2OPRB 1S9FA 2CADA 1KQFB 1FK9B 1YJ9S 3HZEA 2GX8A 2WW8A 3QGPA 4FKXA 4JI7F 1AFIA 4PUOA 5A6PA 1HFEL 3LP2A 4ELTA 4OZNA 1WI6A 1VJWA 1ZAWA 1RK8A 4WFYA 3HPOA 1U1KA 4J9VA 2C3MA 1TKTA 5B0FA 2ALYB 1TKZA 5L8RC 4ETZA 3F0NA 2YQ1A 5DETA 3CEDA 4ZHRB 5L1KA 1U47A 2BW2A 2CJAA 3K5MA 5C24B 3DMJB 1E6YA 4G6VB 1RUSA 1RE1B 2IFXA 3QT6A 3VZHA 4JV2A 2FJEB 1ROFA 2OTJS 4DR2J 1M1GA 2FLPA 1U0HB 3GILA 1JIHA 2EXUA 2BYCA 3A13A 4OX8A 4NLGA 1RJJA 3DLEB 2XMTA 3W5XA 4DPUA 4F0HA 2R2TA 1ZM2A 2J0XA 4DJBA 5L9XA 2ZBIA 4QU7A 1KSPA 5K8OA 2HQGA 2I5JB 1LFWA 2DXFA 3IXQA 5GAEU 2CPYA 2HLTA 5T7LB 3SSSA 5KG6A 2DGUA 3ZZ0A 3ULHA 4YR3A 3QRPA 2OFHX 2X3GA 4ZVEA 5I3QA 5L1IA 1DLOA 4GC7A 3FUYA 4V1Ak 3FRZA 1FRKA 2RUSA 4X65F 1O5JA 1D3WA 2EK6A 3I4PA 3IS9B 3PFEA 5KFFA 3CCMS 3M8ZA 2OHDA 3DOLB 4P7VA 1YBTA 2LP4A 2KJWA 4IR1A 3MPWA 3HLUA 2Q43A 3SZ2A 3PW5A 4AE5A 3GFHA 2QRRA 1RABB 3CCJS 3D6TB 4EBCA 2GGPA 1DARA 1DJ0A 2MB0B 4HTIA 2J8SA 2ZVIA 4RWWA 4CLKA 3MTKA 1PC4A 4MYUA 4F7VA 5KG2A 3BM7A 5I42B 1YJWS 2H48B 3GJTB 5KFRA 2MSSA 3MM5A 3KK1B 3TZWA 3JYTB 1IBLJ 2ZM6F 4JI0J 4FP9A 4KGXB 2R2RA 2CJQA 2LU1A 1SH2A 3TRGA 4ZLLA 3PW2A 4LF4F 3M1VA 4P7TA 4JI2F 2IAJA 2B0GA 3SSQA 1PKUA 1WTBA 3HT3A 1RLCL 1RTIA 4ZK7M 2YWFA 3ZZUA 4QBUA 3W61A 4C0BA 4X2BA 2FVQA 4JBCA 2ERRA 3CMQA 1OYDA 1SV5A 1VIXA 2UUWA 1RWWB 2C2ZB 4TNOA 2MKIA 2ZH5A 2ASDA 1N5YB 2I2YA 3R2DJ 1TAUA 3W66A 5KT4A 3E01B 2A18A 2N3LA 5J2NB 1IM4A 3EM1A 5CYJA 1HD1A 3BH6B 4UT4A 5HROB 2KZMA 3FBCA 1KN6A 1VRQC 2D9PA 4K4UA 3HFKA 2ZBQA 3U02A 5I3UB 2LEPA 2ZOGA 4WYLA 2IYGA 4OYOA 2E7XA 2VKZG 2XLKA 4MKVA 3BQ2A 3DLHA 2ZDPA 5BYSA 2YX1A 4ZP7A 1P8GA 1UWAA 3MXHP 1IXKA 3VAJA 1AZSB 4IH6A 4ZJOA 2JC0A 3OJSA 1CS4B 4IFVB 4IG0A 2DO4A 3W2WA 2XMKA 4UTGA 2AMCB 3GIIA 4P74A 1V3SA 3VZIA 1HWUA 1N5QA 2J9CA 3H25A 3OR1B 1S1VB 3CJ5A 4J9QA 3C15B 1ZTWA 2MKJA 3DRRB 5D78A 2BA9A 3A8IA 3ETMA 4OJHA 1HWLA 2DNKA 5D3GB 3CJ0A 3BR8A 4H4MB 1S0OA 5IT4A 1FK9A 4K59A 4MK8A 5EWGA 1BC6A 1RTIB 5KG7A 4FF2A 5EN1A 3G8TA 3HHEA 2VBWA 4PAAA 2Q79A 5J2PA 1S97A 1SKWA 3H0PA 4QIWD 3M30A 1PSDA 1KQKA 2R7OA 3EXCX 3OVSA 3LUYA 5D77A 3PX6A 4DL6A 3OXLA 2CNKB 4B08A 3TZYA 1RHUB 1I1GA 1S9GA 3EJMA 3R5GA 2NPFA 2VFVA 4UUXA 3AXKA 2UXDJ 1N6QB 2CPZA 1A7GE 2QLBB 4HHHA 4KFBA 2BZ2A 3D5MA 1EP4B 4KV8B 4Y2KA 1KVIA 8ATCB 1R0AB 1S9EA 5F9LA 1U49A 1NK5A 4I2QA 3P5BP 4S0MA 3DI6A 2M5YA 3I96A 5CHCB 5DZ7A 2A6OA 1VQYA 5HANA 1T03A 4GVLA 3VVTA 4C8OA 3QAEA 2EPIA 1O51A 3MAAA 2ZHOA 1WKKA 1Z2ZA 2PO4A 1OPIA 1S1TA 3PYFA 1S57A 4L6V3 3U7JA 3ZNJ1 5K8MA 1HL6A 3HHLC 3HX9A 5KFQA 4DF8A 1DTQA 4ER8A 3SI8A 1HWKA 2HGMA 4YHHJ 2A2CA 2BKPA 3PIPQ 2DIUA 3IR6B 3ILOA 4LF9F 1K0TA 2EWHA 4JI8J 4RW6A 3PIOQ 5LSOA 2EFOA 4BDPA 2R7SA 2XS5A 2W9CA 2YKAA 2X1GA 3Q8YA 4F4KA 1HQ2A 1MWZA 4IH5A 2NXNA 2OO4A 1E6YB 5K5MA 2CNOB 3B4DA 2B8PA 4ZVTB 3G6ES 1U2RA 3DOKA 5IC6B 3RYLA 1BWEA 3QSYB 4RBUA 4OYAA 5DDPC 2BKOA 4A8KA 1RBLA 3QSIA 1CLFA 2PA8D 4H4KA 2BXJA 3PYGA 4TXSA 1UETA 1XEZA 3N4WA 2HKEA 3NP5A 2FLOA 1N5VA 3CTRA 4I64A 3MEEA 5E0OA 2VPYB 2IA6A 4N41A 2DPJA 4FXDA 1MMLA 4XK8C 2A0FB 3GCWP 4DI6A 1VQSA 2R7TA 2CQCA 1HW8A 3T9ZA 2Y0SD 1N36F 2ACYA 4L72B 2D3OR 1UCNA 4OLOA 4LF5F 2CQ1A 2CQBA 4B3MF 4XPCA 2M88A 4PR6A 5DGBA 4O4GA 3BF4A 4TYAA 1SJQA 4TY8A 2WZ1A 2UXBJ 4PG8A 2OSRA 1SKUB 2MZTA 4KT0C 1U0SA 1U1MA 3MAAB 4QPXA 1YBUA 2HIYA 3CCTA 4HT5A 2GHWA 4IQXA 4ZDNA 4C8ZA 3AD9C 3UDCA 5CZXA 2IRYA 1FX4A 1GFWB 2BKNA 2FDNA 3MD3A 3D9BA 3U1LA 1VR6A 2ZOMA 3KG0A 3GR0A 1G6BA 2DJWA 2YVSA 3SCIE 4DG1B 5HL7Q 3NMRA 2LU2A 2YH1A 2JJ4D 3HD1A 4DR4F 4QR2A 2MYFA 3PW4A 2IC3A 2W1BA 2DNRA 3M1VB 3G82A 3AJ1A 2OTLS 2V8DA 4JI3J 2J0QD 3M2VA 3CJ8A 5KFBA 5U47A 2ZH9A 2YY3A 5KFOA 4O3SA 4NA2A 4P71A 3TOQA 3IG1B 3O8WA 3PYDA 2V2VA 4ZVOB 5MAOA 1HBUA 3P8BB 5E3QA 5KTQA 4P10A 1L3KA 2WHOA 3NOCA 3AHPA 5IT9Y 4PXBA 3F41A 4AFFA 1RT7B 5E33A 1WF2A 2QN6B 1VK3A 4FYVB 5E2QA 1T9UA 1NDLA 2HQIA 3NGDA 2DR5A 4M95A 1PGZA 2NYIA 2FJVA 3FSYA 1F9HA 3CVKA 3OL8A 4TKTA 1OSCA 4YN3B 3P49B 2GVZA 4NXMF 4F67A 4CLWA 5I42A 2AJQA 4DV3F 1HNXF 5HP1A 4HACA 3KJNB 3ZTOA 1QY7A 4CLUA 2KXNB 1S1WA 4LUBA 3L4BC 3T1HJ 2IY5B 2R7XA 1RT5A 3FKBA 1UFKA 2CNLB 3GQCA 4DBQA 1RP5A 4FF3A 3D0IE 5ETMA 2HFZA 3H2UB 4RR5A 5KFUA 3VGTA 4WE1B 3THVA 2HMIA 2HK2A 4YB7A 5D4LA 3PRBA 4DL7A 1D0EA 5ETLA 3FZBA 3QJLA 1FXRA 1SV5B 3CUNA 1GTEA 3BR9A 2RDDA 3PW7A 1TV6A 2UV8G 1WI8A 3CCSS 1R8HA 1REVA 3DM2B 2UUBF 1RAOA 4C8YA 4HVZA 1MWQA 2BANA 4J37A 3SIPB 4FN5A 1AT1B 1ZOTA 3D1HA 3HJFA 2K1RA 1M5SA 2OPPB 2ZHAA 2DNYA 2RU3A 3AT1B 3NS7B 2V2KA 4FXVA 1MMDA 1KR4A 3MF5A 3SQGB 4CWBA 3KHHA 2IBKA 3MTJA 5DJBA 2ZM6J 4DV6J 2J0SD 1T95A 5D0HA 3N5FA 4AQYF 3MM7B 2POKA 1OY8A 2GZOA 4RW7A 5KFGA 2GJ2A 2HVZA 1FDAA 3JB9k 4OYWA 4HHUA 4R0EA 2KO1A 2OPSB 2F8EX 2GJFA 2ZH1A 4M1KA 1TMMA 1M5PC 1S9GB 3MCNA 2YXLA 3M6UA 2A6MA 2PIIA 2R8HA 5D4NA 4F4AA 4WFAQ 3HFVA 3L7OA 1FO1A 3UDVA 3M8YA 4ZN1A 4MIAA 2K2PA 2H5EA 4OJ3A 3MM9B 2VA3A 4DL4A 3EPGA 4JV0A 4M5DA 4DEZA 2H51B 3D3BJ 4U95A 3B4MA 1FFGB 1BD6A 3MM8B 2QIFA 3UN2A 1TFWA 1S1UB 2L48A 1ICEB 4NLPA 1FE4A 5KFIA 4QWEA 3UNGC 4DV7J 3I0SA 1ZA1B 3SDEB 4JI5F 2OJ3A 1VLOA 3BH7B 2KT5A 4Y3CA 4DUZF 5ETNA 4WFNQ 2F4VF 1O8BA 1ZAXA 3QZ7A 1NB7A 3OTDA 4QIGA 2ASJA 1B0VA 2CQDA 2D1CA 2O5DA 2DNQA 2Z2LA 1FXDA 3OL6A 3CCQS 1X9WA 1N34J 1I94J 1QUPA 1FJ7A 2DGSA 3IBCB 3QLHA 1JMTA 1IKXA 1ZA2B 2MQOA 1VQ4S 1KTQA 1U1QA 4X4RA 4ECTA 4W90B 1RSCA 4MKAA 3MDFA 5AXNA 2XY6A 1U8SA 3CC4S 2XGQA 3HSJA 1WEZA 4ED4A 3ZTQA 1Z2LA 5DG8A 3V6JA 1B64A 2F9DA 4RUBA 1VRTB 3TJ9A 3D3CJ 1NCLA 3LP1B 2FJBB 3I5CA 5C25B 1C0TB 2VH7A 4GKKF 1WF1A 2IIHA 4YDXA 5H1SV 4LQ3A 2JOQA 3M7VA 4B9LA 1HYSB 4B17A 1VQ9S 2GA7A 4YP3A 4EBDA 4HKQA 3FSIA 4LQ9A 4I2QB 2UV8A 2VF3A 5J1EA 4DV5J 5D6GA 1KLNA 3IBFB 4P75A 3ZTPA 4XIUA 3MECA 3SSRA 1IM6A 3HHNB 2QO3A 4MAKA 3CWJA 4JI2J 4PPDA 2R7RA 2UXCF 1S1XB 2LVWA 1V3ZA 3FK4A 2W8KA 4DUYJ 3TAPA 3MEGA 2HAFA 3BKFA 3EZUA 1GMVA 2AZ3A 4JI0F 4LF8F 2Y1IA 3RTVA 4B3OB 2QLJB 3J80Y 3M6VA 4USUA 2DRAA 3KMQA 2HVIA 2VL1A 2XMWA 4RLEA 1PBAA 2P2CB 2VV5A 3CJQA 3LTOA 3O44A 4RNHA 5B0GA 3CD7A 3F73A 3V6DB 3MPUB 5KFWA 2AZ1A 4BHQA 1SKSA 3RBXA 4LFBF 2WCXA 2HHWA 1LWEA 3H2LA 4WP3A 2HFVA 1TP7A 2VD3A 3IM9A 4U7UK 5KG0A 2WVCA 1SL2A 3J7A1 2VOPA 2PE8A 1HI8A 5J2MA 1WG5A 2J9DA 1SJFA 3K59A 2FJXA 3FMBA 4C8KA 2WOMB 1N32F 1YSJA 2J6UA 1MWYA 1NZ8A 1H7XA 1WC5A 3LF0A 5LSLA 4I56A 2YKNA 3KHRA 4IRKA 4C0HA 2E5JA 5G0RA 4ELVA 4J9OA 1Y7PA 2XC9A 3D28A 2CPHA 3FBBA 2V2QA 3KK3B 3CGIA 1XBWA 3WZ0A 1Y5NB 3BREA 1X31C 4WU2A 3GG1A 1MU2A 1FNMA 2BE2B 3UPFA 4K4VA 5IQQA 1JXEA 1TQLA 3KJQB 2HEKA 8AT1B 3HHDA 3CB4A 4DV4F 3MECB 3V6HA 1SJ3P 1YJ7A 1UA0A 1Q16B 4ED5A 2O66A 1T05B 1F5BA 2ZNZA 4ECRA 2GCFA 2KM8B 2C22A 4PKDB 4C11B 4DFMA 3QNWB 1U8WA 4I2PA 3G2XA 5KOWA 3R7SB 1J5OA 1HQUA 4NLQA 2I8EA 1YZ7A 2D41A 3PR4A 1SUQA 3I82A 5F3TA 3JYTA 5IV3A 1D8YA 4MFBA 3W63A 4UOHA 3PRDA 2J8AA 1H0HB 2JLGA 1VCTA 2EKNA 2DTJA 3K58A 1UWBA 1JLAB 1FFSB 2AJ2A 4CM0A 3VR1A 2AJFE 3CF5Q 5AE3A 1W25A 3ILJA 4J9LA 2XG8A 3D1QA 2I9SA 4YB5A 2F3JA 4DXLA 4ED3A 1Y10A 3P4UB 1T9XA 4FYYB 2MLZA 4WE1A 2EW9A 4XTTA 3PKYA 4CH1A 3IR5B 1P1LA 5IXUA 2Y9HA 4I67A 4FDFA 4ZVGA 3FMWA 2EC0A 1L3TA 1MN7A 1S1UA 4B9VA 2DY9A 2XSJB 2CPFA 2CZ9A 3CO9A 1QJHA 3SDEA 3TA2A 2ZH2A 2HS3A 5HAOA 1NSAA 1HMVA 3ILLA 2J7KA 1JLGA 3PZPA 2LA4A 5DG9A 4LF6F 2I1RA 1I51B 1WEXA 5AXLA 1EETA 2RKIB 4LBHA 5D0RA 1F9EB 3AD7C 4CLYA 2MZJA 2OAUA 1ACMB 3CIMA 3GSDA 4M5HA 4PYAA 4KBIA 4CH7A 2KKHA 4ES1A 3IR7B 1U1OA 1AZSA 1ZYQA 1HNVA 2QA2A 4DPOA 4A8FA 4X4NA 5F8NA 3OD2A 1Q8KA 4WTYA 2JEGA 1WD6A 4J9NA 4ETXA 1W2BR 1NJXA 4LR7A 4RJVA 3S1TA 4AL5A 3OUYB 1URRA 4GVBA 1XNQF 3DNCA 1VRTA 4FNHA 4EFAC 1CJTA 5CD4H 2UU9F 3ENWA 4ZCIA 2E9ZA 1QAJA 1AW0A 1JLEB 2OIHA 1YKWA 1RWUA 3JSMB 2JVOA 3BZQA 4YB1P 3IC1A 3EPIA 5A0YB 3QRRA 2CFXA 1Q86T 4TYBA 1S4EA 1KOOA 2DNLA 4NMLA 4WXWA 4URGA 5LMNF 1OJ4A 3P3DA 4JV5F 3ZZPA 2DR6A 2ZH6A 4ECXA 2W9BB 2KTQA 3MUTP 4QYZK 4WP9A 1NBEB 2AEMA 2NUHA 2RD5C 5BJRA 2CKWA 3PFOA 3QGHA 2OPPA 1MW7A 5I3PA 5DDQC 2RF2B 5L38A 1TL1A 2JLFA 2V8GA 1KVJA 2G1DA 3AOBA 5E7OB 3E3XA 3KLIA 1K0VA 2YNFB 2FTRA 2QV6A 3D66A 4OQJA 5EWFA 2CVEA 2C2OB 2IRXA 1HBMA 1SI9A 1T03B 2MQNA 1RWMB 4ZPTR 1C2PA 2FJWA 4C9DA 1UA1A 3HSDA 1M5OC 1HMVB 4IOBA 3T5LA 3W64A 3H59A 2LKZA 3BBBA 4DSIA 3H5XA 1B3TA 4DR4J 1DRZA 4F4XA 4KGVB 4U8YA 4B3SF 3PRVA 2ZHBA 1EP4A 4KV8A 3QZ8A 3OW2R 1L5UA 1Q82T 3POTA 5KFXA 3K57A 3TA1A 4WU3A 1WJ9A 2XYHB 2I5JA 4C97A 2QEXS 1SL0A 2KHCA 1HW9A 4IRDA 5HBMA 3H8YA 3I0SB 2A3JA 2BRKA 3HZGA 3V81B 3KMSA 3CD0A 3N79A 2GC8A 2J76E 3NGUA 2HK3A 4NI2B 1X5OA 1JLBA 1K1QA 2VDHA 2XI3A 3VAGA 4RUAA 1XNRF 2K3IA 1Y5LB 2LXUA 2GIFA 4OI1A 2OH2A 2VPXB 1KD1T 4RW6B 3TP2A 4FYDA 1TL4A 3DN9A 4OX9F 5KT2A 3GV8B 3PVXA 2P9GA 3VF0B 3MR5A 4OHXA 1RLDA 4OI2A 4L76A 1FKPA 5H9EJ 4JI3F 4UUWA 1AA1B 1RXOB 2RIJA 4USJC 3M9NB 3T1HF 4DSJA 4P2MA 2BRLA 4HT7A 2RILA 2U2FA 4J91A 4JI6J 1RWXB 1SC3B 2RAQA 3RZAA 2MGZB 1E6VA 3JS9A 4ZVFA 1QVFR 2HNDB 1C4AA 3ZFVA 3R9LA 3R27A 1BY9A 4DV7F 2HWIA 3DHXA 2QC3A 2H4WB 4DR1F 5HLFB 2NREA 4R8UB 3VQTA 1YJRA 4UOFA 3KKFA 1WG1A 3I9V9 4DL5A 1RTDA 1UPMB 3LGHA 2R7WA 3L9ZA 4UF4A 2J9DE 5ETTA 4IG3A 4CLPA 1N34F 3W2VB 3VALA 4OIXA 4KAIA 1TUGB 2BJ7A 1APSA 1UAWA 2KYZA 3R5JB 3R7BB 1IKVB 3ISNC 1L3SA 2HWTA 4O44B 1PJ7A 4K4TA 3QIPB 1Q4RA 1PYTA 1FESA 1V6HA 4KIAA 3W60A 1KDNA 2JZ5A 2RQMA 3NXZA 2ROPA 2I6WA 3QQCD 5DM7Q 2C2RA 5IT9U 2JDJA 3J80U 3GFZA 3SCJE 2FVSA 5AE1A 2R2UA 4QPTA 1H7WA 1VQNS 1RTHB 2HFOA 3HCXA 3I87A 4G1QA 4QIVA 3ZC4A 3M9MB 4Y2IA 1S77D 1NHVA 3OFFA 2C2EA 4DX5A 1S0NA 4J90A 1Q81T 3L7UA 1RWOB 2WOMA 4GMKA 3E01A 4ICLA 1D8ZA 5H9FJ 2FHOB 2ALZA 4EUVA 2B6AA 3JSRA 1VQ8S 4OX9J 5KFJA 1H2TZ 4IRCA 4G1PA 1NLKL 4AYBD 3GWCA 3JSMA 4HDHA 4OLPA 4LT6A 4F4WA 1F3FA 2VB6A 2AJ0A 2YKMA 3FC9A 3K5PA 2NCKL 4XDDA 5DZ6A 1WKLA 1UEVA 3W5ZA 5B0CA 1ZZFA 1RAGB 4RU9A 2QA1A 4WWSA 3HO1A 4RNFA 4Y6IA 2R8JA 2HHSA 2HZCA 1TUVA 2WRMA 2NXUA 3AA8A 3F56A 4JI6F 4JUZA 2DVIA 4JOUA 3OVBA 4IFVA 2DHXA 1OY6A 4Y65A 1V9OA 3TQEA 3UR3C 2YNGB 4DFJA 2HQFA 2EC2A 5IV4A 1T05A 2CQPA 1WUUA 5D15A 1ULRA 1S99A 3PJWA 2DNPA 2XNQA 1WWHA 5A2QY 1HLWA 4ED6A 1P9QC 1FTRA 1TVRB 3RR8A 4ELUA 1EZZB 3IFEA 1XR6A 4USHA 1HBMB 5IS2A 1VDHA 2G0CA 1UVKA 3H98A 2MMYA 3A8EA 3NRBA 2ZOFA 3PM9A 1IVZA 2GMLA 2CXEA 5L1JA 4I1TA 4Y34A 3HVWA 1UVLA 1V3RA 3Q86A 2J6SA 5B7WA 3ZZOA 4ECUA 4DCJB 3KHGA 2BM0A 2HZAA 3EX7B 1Q8IA 2YPZA 1T9WA 2RUGA 1PO6A 5I4MA 1N33F 1R31A 4O23A 1VI7A 2IRUA 2W25A 4LF7F 1R6VA 2IM0A 3Q83A 1FRLA 1M5KC 3BGOP 4PQUA 2HHXA 1SJ1A 2LXIA 2PFFB 3PEJA 2G2OA 2BANB 2AJ4A 1VLYA 5ETVA 2ZJPQ 4EEYA 5KFPA 1YHQS 2ZBRA 6FDRA 4RNOA 4DR6F 4HDGA 3TARA 3WHIA 4OI6A 2E5IA 1ZM3A 1XTZA 3BBFA 4PZVA 2KXHA 1S4FA 3MD1A 5ETRA 3FEZA 1S6UA 2MHNA 2XI2A 2FHJD 7FD1A 2AWZA 4H4MA 4NWBA 2CDRB 2V68A 2FJDB 2AEFA 5B09A 2CDQA 2RJZA 4I69A 2HRYA 2ZWPA 3NGTA 1R0CB 4NXNF 2HHQA 3RAQA 4N8NA 3RW7A 4I4BA 2H54B 3KUEA 4A8OA 3LP2B 1FD2A 2RRNA 4B9MA 1BLUA 1KONA 4EI2A 3W65A 1N32J 2MKSA 3EGNA 4L3NA 1T9TA 1XERA 3G87A 1LV5A 1F3VA 1TL3B 4WPAA 1NUEA 2M52A 3CO0P 1ZAVA 4V19J 2FUG9 3H2VE 1H2VZ 3DC2A 3Q8SB 2MLYA 2R9LA 4KE5A 2W9BA 1NK7A 1F9FA 4AL6A 1N0UA 4CH0S 1NDKA 2CPIA 2IDLA 1Q78A 1QDUB 1XN9A 4OI4A 5HJXA 2XZTB 4ZS6A 3NGSA 5LMUJ 2IDEA 3I0RB 3N6MA 2L41A 2QFJA 4LF5J 4Q0BB 4WCEQ 1RAHB 2QYGA 2H5JB 4P2SA 1GTHA 4DFPA 3C2PA 1HNIB 3BGUA 1HNWJ 4CLTA 2FHKA 3OR2B 4EWTA 4FS2A 4Q8EA 3I5BA 3KK2B 3KG4A 1F2HA 2C3PA 2MQQA 2O01C 4FF1A 4EK2A 5B0EA 3R7NB 2MZRA 4L73A 3JAMY 3MEKA 2EI5A 4NA3A 1DTQB 1FKPB 2DGQA 4HLBA 1RTHA 3D6FB 3CMAS 5KFDA 3D1OA 1MSWD 2HPUA 3N6LA 5DGAA 2AF6A 2CPEA 4WK1A 2CQ2A 3C6TB 3GYXB 2GAHC 3IP0A 3M2UA 3RB3A 2CRLA 4DX8H 4DCOB 4U7CA 3DRYA 3HVAA 1K9MT 2JX2A 3FEYB 3POTB 4DR2F 1HNZJ 3TJAA 1X5PA 4JB8B 1N48A 1YDLA 3LPYA 5HQ8A 2FJAB 5IOLA 5KFAA 3VTIA 3CNQP 4DS4A 2RQCA 3UFCX 4QR0A 4NRUA 1NPPA 3CW2C 3L3CA 2E9TA 4PWDB 3H5YA 2WONB 5HLFA 1KQGB 5HMWA 5CYMA 1X5TA 3HI9A 3K5OA 1FWPA 3IS9A 2V8VA 2X51A 5IQ6A 4B3SJ 1VQ6S 4C4WA 1UVIA 3UO0A 1OWXA 3UD5A 2B3TB 3NKYA 4KR0B 5B08A 5JUMA 2ZH8A 4K0KJ 1WDDA 2VQFF 1CC7A 4YUDA 2Y1RI 5KFLA 3M8WA 3E51A 3GR1A 3J7ZT 4IO9Q 4F3OA 2RB7A 4EU0A 2HIQA 5IWAJ 4FYWB 2FLNA 2C3UA 1WHVA 4DR5J 1SVDA 2WBMA 4NLTA 1RT4B 1HBOA 3CJTA 4K4WA 3BGLA 1LK5A 2E7WA 1S6QA 2EBGA 2OD4A 3KUGA 4Q0BA 1UVJA 1QLNA 2ATLA 1LWEB 3UVJB 3MR2A 4ZA1A 1TKDA 2Y1JA 1FEEA 1TFYA 4TN2A 1K73T 2HFNA 5EGYA 3K8VA 5M2PA 4MMOA 2RQ4A 3FQLA 5KFMA 1VJQA 1Y3JA 4AUKA 3A8KA 2ZJRQ 5EDWA 2G0JA 2XY5A 2PMZD 3EVOA 4FBUA 4YQWA 1FWKA 4X66J 1CQNA 3V6DA 2KVIA 3ZZYA 4F4YA 4O0IA 4KHPJ 3N9UC 5E3AA 4LFAJ 1NPRA 3LA0A 4CO1A 1EKSA 4AXIA 2QMWA 3R3TA 1WC1A 4X62F 3OR1A 5CXTA 2FYXA 2ROEA 1RTDB 2UVWA 4NYZA 4JV5J 3D4JA 1FJCA 3BKUA 3RRKA 4Y28C 1UEKA 1U1LA 1IBCB 4X4PA 2HNYB 3AD8C 2VICA 4FYXB 3TVKA 1L3VA 1TKXB 4C3MA 3IRWP 5G0RB 5KFKA 4M94A 4X4VA 3KWMA 3OLAA 5F0UA 2RDJA 3CMES 3AJDA 5LMNJ 2O67A 1R43A 2XWYA 3CDUA 2Z4PA 4CO5A 1NSPA 1OQ3A 2EBEA 3IRXA 2F5GA 3NEKA 4EMDA 3H4BA 5ETPA 3BYRA 1KRPA 1YRXA 2C2MB 1VHFA 2LQBA 1CS4A 2OEKA 2XBPA 2ZKUA 1UW4A 3HSGA 4H4OB 3CDBA 3UQSA 4A8XA 1KFDA 2BE9B 3UCGA 2GMJA 4OV6A 3G6XA 2GIQA 4PABA 2GHPA 4K5SA 4XAKA 1V5IB 1Y4ZB 3U27A 1NEEA 2FD2A 3DHWC 2R8IA 1D9DA 1JXVA 1X4FA 4DR1J 4ZVHA 4OYIA 3VV2B 2BX6A 4KPCA 5IWAF 3RBDA 2BACA 2HLUA 4LRAA 1SIWB 2HS0A 4DX6A 3UN3A 2P9CA 4I7FA 3QFHA 2MKKA 1RAEB 4Q43A 1X9SA 4EGLA 3OHAA 5GMDA 4K4ZA 1IN0A 1SQEA 1R0AA 1ELOA 4MK9A 1RU2A 3W9HA 2QSWA 1B7FA 2CUYA 3OV7A 3FQKA 5F8JA 4A8SA 4PQUB 3MPDA 2EKYA 4NLWA 1AXQA 5JMNA 4ZHRA 3DCAA 4CZCA 5AJ3F 2PI5A 1N52B 1X4HA 3GFXA 1G4CA 5E3PA 1RHRB 3IAM9 5GAHI 1C1CB 2LLZA 2XMVA 1S1TB 2FY8A 3GIRA 2BOPA 5HI7A 2CPJA 1LWCB 2DGTA 3KFWX 1IQZA 6FD1A 4LVOP 1GXUA 1N5SA 1N5TA 3IWXA 3LW5C 2N7CA 2ADBA 2NPIA 2NSCA 2C2KB 3QRQA 2YWEA 4F4ZA 2HW3A 2VKRA 1R8CA 2MPUA 4CQ1A 3DKDA 1VGYA 1EETB 2RKIA 4F50A 4X4TA 2HAIA 1RHJB 3NCRA 3M8PB 3MCOA 2ZKTA 1YG0A 1TKZB 1S9EB 4LSNB 4KC5A 1X0FA 2CJBA 3ZTRA 4CO4A 3R5CA 4NXNJ 2RQKA 4YDDB 4ITSA 4DF4A 3MMAB 3BQ0A 4F2RA 2UXCJ 4IYQA 2HGNA 3JSBA 4C8NA 1HNZF 3FSXA 1CJVB 2UXDF 2J9EA 4K0KF 2B4UA 3SEOA 4QOTA 1R27B 2KI2A 2YWKA 4A48A 2CQ3A 1CJKA 1YRTA 1O0PA 4M5NA 3W9JA 4X64F 2ZD1B 4B9TA 5D8HB 3TI0A 1OQ6A 3MM8A 3MM5B 1XMBA 2CQHA 2ZBPA 1H74A 3T1AA 4CLFA 1FXLA 2MKCA 4KQZA 3H42A 2GW8A 2CNNB 2IJRA 4Z2XA 2LYVA 3RAXA 1YJVA 1XMOJ 2HHTA 3EDQB 1PJ6A 1S6QB 2PFDA 3HULA 3M2RA 2F7VA 4ECSA 2K7KA 2KFZA 5LM7E 2MEWA 1BQNA 5CYQA 4CTAB 3QT7A 5GMKa 4ZJQA 4NA1A 4CO3A 4QR1A 4C11A 4YHHF 2MZSA 2XGPA 1QSLA 1NHKL 2VPZB 5J2QA 5B0BA 2HHHJ 2ZNYA 2VG7B 3QO9A 1FKAF 2CA9A 1FDDA 3NNHA 4MKYA 3GFYA 3HKWA 1FWLA 1RHMB 1HIYA 5HROA 2FPHX 4O3RA 3D0HE 4F8RA 5IM0B 4WJBA 2AX1A 3WC2A 2C28A 1QE1A 2B51A 2PMHA 4P9SA 4N56A 2FVCA 3KK3A 3CXCR 2KB2A 3TW0A 3N0VA 3OTEA 4KHRA 3IG1A 3UNYA 3H5SA 3X1LB 2ASLA 4A47A 3G6YA 4IOCQ 2BJEA 2WK4A 3RJMB 3NNCA 3ENVA 2KVQE 2W7OA 4BS2A 3Q23A 4FVCA 4LFCF 1NKBA 2HS4A 2V94A 4F26A 1RT6A 3FBEA 1A0OB 2RSQA 4OYZA 2L9NA 5HBMB 5KT6A 1XJWB 2UVUA 4KH0B 1K8AT 1S76D 4NOHA 3A4TA 1O6XA 2RRAA 1RWNB 4P72A 5ETOA 3O2IA 1MROA 3IA0A 3GCXP 4DX7A 1GMWA 3LAKA 1M5HA 2W4PA 3T5HA 3FDSA 3MMBB 2N4CA 4OFZA 4FVMA 4C0OC 2DNOA 2V50A 4DWIA 1EX8A 1ZBTA 5GADI 3UE2A 1NB2A 1VQ7S 3GIKA 2HHVA 2DGVA 4OZ2A 4UOCA 1M90T 3Q0AA 2UXBF 2CYYA 3OFHA 4PWUA 4KY3A 1XMOF 4HL9A 2HFSA 4A46A 1U6FA 4NLYA 4DSFA 2YPYA 3LWMA 4DS5A 2XEXA 1HHTP 2DR8A 3V4IB 3MAHA 4LF1A 4AXJA 3I9ZA 3CC7S 3HXMA 3FCHA 3BKTA 2DPIA 1VQOS 1FTCA 5AE2A 3KOAA 5IFMA 3H90A 1IUJA 2E5LF 1OS5A 4NLSA 5FIIA 1TKXA 3GSIA 2E1PA 1LW2A 2B5JA 1LWFB 3CCZA 3DRSA 4N7TA 1J27A 4RW9A 3K0JA 4MKBA 1Q1KA 1BQMA 2KM8C 3M8SA 2R42A 5H9EK 2Z30B 1PAUB 2PT0A 1N33J 2F63A 1S49A 3FVYA 1WOPA 2FQQB 4HI2A 4YS2A 8RUCA 4KO0B 1JJ2R 1SJRA 4X4UA 1W7WA 3KJVB 3VAFA 2N7YA 4ID8A 4ES3A 5E3CA 4DFKA 2J0WA 2W2PP 4JI5J 3DXSX 2XMJA 2YWWA 1FT8A 2H9ZA 3T6BA 3TWZA 4OI3A 2NS1B 3FEXB 1F2GA 2DNHA 3MCSA 1VIOA 1XIQA 2M8HA 3RB0A 2F65A 3D67A 1RA7A 2KT2A 3A8JA 2AHOB 1UWBB 3RUBL 3VQSA 3VVUA 4QWAA 1YQHA 1NXIA 1PG5B 2D7SA 4NCGA 2D9OA 4HR2A 4ANDA 2F4VJ 2CQIA 1T02A 4MK7A 1WEYA 4QZVB 3VAHA 3PX0A 3HSZA 4KGKA 2JEIA 2XHCA 2DISA 1CJTB 3DDNA 4GRSA 3AQPA 3BSAA 2R2SA 1R0BG 4C8LA 1S0VA 3OFGA 4JI8F 4TU7A 3AAWB 2QLFB 4RU2A 1N5YA 2YKPA 3BS9A 1T11A 2AKWB 5ADZA 2IVFB 2PGCA 3S6EA 5C42B 5J1PA 2JEJA 4HH0A 2ZZTA 4LR9A 4R5PA 4X64J 1RGVA 3EICA 1OO0B 1RI7A 5IC4B 3ET6B 3W1YC 1NM2A 5CD4A 3NGRA 1FKOA 4OMFG 1IR0A 3UR0A 2VJVA 2YWGA 1NK0A 4USKA 1NK9A 3JTOA 1UFLA 2Z0GA 3KJFB 2AQ4A 1KC8T 1KNZA 2MSTA 2FGCA 3RG6A 1S0MA 4FKYA 2MDAA 5F0WA 1HARA 2VFSA 4YEAA 3MAQA 4P2XA 2K06A 3CCUS 3KNAA 3DLBA 2OGUA 2RU9A 1PYOB 1S7IA 2D69A 1H73A 2CWXA 4LSZB 1GX6A 4OHWA 4ZJLA 1R8AA 2BJ3A 3EVMA 4PG7A 5GAEI 5HQMA 1HA1A 5DDRC 3V6KA 2MLXA 4O3PA 4NZ6A 1VYAA 5A2QU 3MMAA 3QT5A 2A2DA 4NPOA 1JXLA 2Z57B 4LSLB 3EGZA 2ZH4A 3ADAC 4CLSA 3TUZC 1JK9B 1XC9A 3DRRA 2QL5B 5C2CA 5K8PA 4RWXA 1EB0A 4P2FA 2DK2A 4DV1J 2DNZA 2DY1A 4CI0B 1VQMS 1W26A 1GH8A 3Q2SC 4I0WA 1HWJA 4UOGA 2K8GA 2ZC4A 5A8KB 2Z2ZA 5L9NA 1NSQA 4B9UA 1UVMA 1CEZA 2AT1B 4YR0A 2DO0A 3C6UB 3KUHA 4HYKA 1R6YA 3LANA 4ZMMA 1BXNA 1LOUA 3DLGB 3IAS9 4NLRA 2C2DA 4IOAQ 4IFYA 2UUCJ 3LPEA 2BQRA
chains in the Genus database with same CATH topology
3GMGA 3OFEA 3EYZA 1GAOA 3G6VA 5CYQB 4CTAA 1GT8A 4J9RA 2RS2A 5IZHA 4DQQA 2CZVC 2ZE2A 1HBUB 3T6JA 5ITHA 2AJ1A 2QMXA 5KT7A 1C4CA 5J1EB 1WF0A 2J6TA 1NKCA 2YKNB 5F8HA 5DM6Q 2G4BA 1XMQF 2QYCA 5HO4A 5KFEA 2CQ0A 3LGMA 4DR5F 4R8UA 1RYSA 1VQLS 2VPWB 2C42A 3T5JA 3KLHA 1VOMA 2CQ4A 2MHEA 3DGPA 2R7VA 2V9WA 2ZC3A 2YKQA 3Q22A 1IBLF 2FLLA 1OSDA 4WK3A 1RAJA 1QVGR 4RW8B 3B78A 3AY0A 2M2BA 3OR2A 1KTVA 3FFIA 5GAGI 3EUNA 4LSLA 2GMHA 5CH7B 3PY8A 3FNNA 5EX0A 4O3NA 4OV1A 4O4RA 1HQUB 1GQEA 1NNDA 3CDEA 3RR7A 3CDAA 4DOZA 1SUQB 2DH8A 3BN4A 4QYRA 2J5AA 3CMES 2VFRA 4IG3B 4WZMA 2E1RA 1G7CB 3DYAB 2C3YA 2CPXA 2B56A 4ERDA 2J7WA 4OHVA 2AGPA 5IM0A 4V19X 3HHLD 1H3DA 1LXNA 5A8RB 4IFYB 4N5SA 4GKJF 3B8HA 3UI3A 3Q8RB 1NJYA 1G1XA 2COLA 2WONA 2OMOA 1F60B 4NLDA 4BWJA 4ZPVR 4WKRA 3DOKB 1MU2B 3ZZRA 5DQHA 3CCLS 3H20A 2LDYA 1E6VB 4NCGB 4OJ1A 1UJ4A 2BABA 3BN7A 3ZZTA 4Q44A 4QU6A 1HHSA 2XSJA 3QMQA 1XWLA 1FDBA 3J7Z5 3D0GE 2YNGA 4A8QA 4PWDA 5GAGU 1TL5A 3F44A 2MQLA 5SUHA 5JXSA 1Q7YT 5J2PB 2KRBA 4PXDA 4DL2A 3VWSA 5AXMA 5EUHA 2DH9A 2GJIA 2E66A 3GB0A 3NMAA 4UY8T 4KO0A 3DLKB 4RW8A 1Y9OA 3J81Y 2ZDOA 3FFIB 2DNMA 2LEAA 1T7PA 3RRGA 2XWXA 3TAQA 4KTQA 1B0PA 2HNZA 3DLJA 3TNVA 4U67Q 4DV2F 4O3OA 2DIVA 1D9FA 4URQU 4ZCLA 3TR5A 1DQAA 1T3NA 2AYEA 1U1PA 2KFYA 1SH3A 2E5GA 5EHHA 2PSZA 2GV1A 3KNGA 2PC6A 1LW2B 2B5JB 1JLEA 3DRSB 4PXEA 4RW9B 2EFVA 4C3KA 1DURA 2YNHA 2XS7A 4ECWA 1NO8A 1S48A 2DHAA 3M8RA 2RRBA 4EO8A 5C25A 1FRHA 4ECYA 2QT7A 4MIBA 1YJTA 3CJ2A 4DV1F 3R5BA 3OVAA 1Q7LB 4DMZA 1T3OA 5HN0A 3KLFB 4DLGA 1R89A 2LDIA 3C3LA 1FNXH 3T5KA 2RF2A 3M9OB 1XR5A 2OP5A 3J7YU 2D3ZA 2APOA 2GFFA 3MFIA 1S1VA 2J7UA 5HP1B 1YVFA 3BDEA 3G9CA 3DLKA 1DHMA 2D74B 1RT2B 4ZCMA 3PEHA 2VFTA 4WIIA 4C2MA 4QQBA 4RNNA 1ZTTA 1P1TA 1XK8A 1N54B 2CIMA 2GO8A 5A6WA 2OFGX 3HVTA 2RH3A 3M8QB 2DRBA 5KFCA 3CSKA 1JLBB 4IG0B 5K8NA 2WB4A 3W2WB 1FRIA 3L7PA 4KKOB 1J5OB 1YJUA 2IM2A 4D3GA 3OXFA 2VBZA 2DR7A 2ZITA 3C66A 1U1NA 3CJKA 2JWNA 4GKKF 4Q2LA 3V81A 5KT3A 3C6UA 3BDPA 2YNIA 3BGRB 2XO7A 3CT9A 3O6QA 5DQIA 2YH0A 3OXGA 1YWXA 2XSFA 1U09A 3I32A 3SQGA 4CO2A 4ZP8A 2V5HG 4CNZA 1SL1A 2YTCA 4WFXA 4DR3F 2QA4G 3KLGA 5HMYA 2IC3B 4CCHA 4F02A 4OZ5A 1HNIA 1M1KT 4DHVA 5F8MA 1IJFB 2ZH7A 4B3TF 2VZ9A 1BQNB 2EFQA 3EXYA 3OJUA 3FZ2A 1URNA 2KJVA 3NCQA 1WELA 3OTBA 1ZM9A 4JI1F 4QW8A 1VRUA 3M32A 1X4GA 2MZ1A 2R2TA 5JVGQ 4NLOA 2KT3A 3DFEA 2QLXA 4NL5A 2BJDA 3BB5A 2DR9A 4FXWA 5K14B 2Q66A 2EG2A 2P6TA 1S6PB 1SBRA 3LQVA 1H98A 3LP0B 1VFJA 4HTJA 1AUDA 2RMLA 1FVQA 2ADCA 1N8RT 4DN9A 2L3MA 2EFNA 2YQ3A 4LIWA 1SC6A 2PDAA 3TYTA 4QIFA 5CYMB 2MGZA 1FJCA 1QAXA 1TKTB 2FIUA 3KLEB 3JTNA 4O44A 4ED8A 2ZFHA 2BUNA 3K2YA 1QAYA 3G86A 3PACA 3SMZA 3TAMB 1OIAA 2VC1A 1U6ZA 3TX8A 3OVSA 3CJKB 4OI0A 3ENQA 1CC8A 3NS5A 2OPQA 4USIA 1X5SA 1HPZB 4Q7AA 3NGKA 5E3RA 4GC6A 1YITS 2MJNA 2V4JA 1T8EA 1R7IA 2HGLA 2O1PA 4HEA9 1S79A 4WZQA 3DRXA 1KLMB 3KHLA 2JLEA 5LXRA 4I6WA 5HMXA 1S72S 1LKZA 1U25A 3M4XA 5CCLA 1JJHA 2CVIA 2VODA 4TU9A 2L08A 3GZ7A 1XR7A 1C1BB 1FCAA 1HBNB 4FNIA 1N4LA 1QSSA 3T19A 2VA3A 1DTTA 4EBEA 3HHLB 2FC8A 4DQIA 1MROB 5C5JA 5F8GA 3OQ2A 1GXTA 2XCPA 4OZ1A 3SV3A 1G2EA 4QW9A 4AL7A 1HI1A 2B7CB 5FD1A 2DNGA 1RT6B 2QE5A 4ICLB 1NZAA 1X8DA 3Q8QB 2ROGA 3M6XA 3H5UA 1JLQA 2E5HA 1QM9A 5GVQA 1TVRA 2IBOA 2EK1A 1U4BA 3AA9A 4PG4A 2KG1A 1NH8A 1NU4A 1JB0C 1H2UX 1Q8LA 1WACA 4I6YA 2HVHA 1N56A 3BJYA 2FHMA 4XDCA 5CCMA 4O4GB 1ZM4A 1KFSA 2E1AA 3THPA 4BCAA 3OUYA 4YFUA 2Z8QA 3ISND 4ZPWR 3RRHA 2DITA 3CE8A 4ZPAA 3RBEA 3THTA 2B4VA 2W9AA 5I3UA 2IM3A 2LECA 2V4JB 1IKYA 2R4FA 3UDLA 2W7PA 2AYBA 2CZ4A 2OKQA 5FDLB 2HNYA 3NS6A 2X1BA 5D3GA 3IWLA 4RZRA 3IGVA 2DH7A 3CD6S 3LAMA 1NJWA 4OL8A 4RUHA 1YI2S 2KZZA 4ZP6A 3GV7B 4RNMA 1UP1A 3HP6A 1VQKS 2IM1A 1UJ6A 2WSFC 1VBYA 2G9OA 2WB1D 3UCUP 3K7RA 2HNZB 2K7JA 3PR5B 4H4KC 1Q53A 3SFUA 2EG1A 3TA0A 3M30B 4NX9A 3UCZP 4MFBB 1J2VA 3BSOA 3NL0A 4U9RA 1M5VC 3CPWR 3B82A 3O5TB 4QCLA 3BO4A 2VG5A 1FKOB 1M0SA 5CZVA 4UW2A 3NBPB 2WSEC 4TQSA 4QWCA 3MMCA 4N8OA 2GQQA 3MEGB 2E44A 3P5TL 1HWIA 3M8PA 2E1CA 5C42A 4ECVA 4QJVA 1VBXA 2O3DA 3QGIA 2HG4A 2JSXA 3DI6B 4DN0A 4ZLPA 2UVVA 4BBYA 4R5PB 2QLWA 3LOUA 4Q8FA 5KFZA 2NLWA 2ZH3A 4P6QA 1QUVA 1JLFB 4FBTA 1VBZA 4DQRA 1IQTA 2VBXA 1TV6B 2E9RX 4WFBQ 2E1MC 3R5DA 1ZH5A 3TUJC 1TAQA 3Q8PB 3PO5A 4GO7X 4C7QA 5KFTA 3M2UB 2IVYA 2YX4A 4UQGA 3MEDB 2MJUA 2LQ5A 3ETOA 5JJBA 1RTJA 2FGOA 3MFHA 1VQ5S 1UVNA 1YIJS 4M63A 5THWA 2FVPA 1FRJA 5FLXY 3H40A 1NJZA 3FGVA 5FJ4A 2M4MA 2MY7A 3I0RA 1U2FA 4XO0A 3VCDA 2RNEA 1NH7A 2W8LA 2M8DB 1S76D 3D54A 3JTPA 1WHYA 3AB2B 2AP6A 4IKAA 3RB6A 3MUMP 4DL3A 3CDWA 1DBDA 2R8KA 4ILRA 1LQ9A 3MM6A 2PD1A 4X66F 4Z37A 1DQ8A 4KHPF 3NBPA 1ZPVA 2OLWA 3BGFA 1X4AA 4ZP9A 4HHJA 2XNRA 4EYHB 2DBBA 2ZVSA 3I5AA 3CCWA 4ZPDA 4RBVA 1FEHA 4PG5A 5K9FA 4PPZA 4IO1A 2RE1A 4FS1A 2VUGA 1HYSA 4DSEA 2NQPA 3CJ4A 3DLGA 2W7AA 4DR7F 2KU7A 3SCKE 2B4OA 1C0UA 3M6WA 1R8PA 1S10A 1KQSR 4TQRA 3ONQA 2JHEA 2YKOA 4WYWA 5KG4A 3MWBA 3KLHB 3LWLA 3QLHB 4F25A 1KEKA 1HD0A 4F3MA 3FJ2A 3BQ1A 1RKJA 3GE9A 1DFDA 1CQMA 4WF9Q 2ZJQQ 1FA0A 3JSYA 4C98A 1FD8A 4ID5B 4IDKB 3ICLA 4BC7A 1JX4A 1S6PA 3NNAA 3HKZD 3VAMA 2C3OA 5E41A 4OX6A 3V4MA 3DOMA 4RUCA 1RYRA 3HDSA 3KK1A 4ZOSA 4IR9A 2HHPA 3IN5A 3RW6A 4NCBA 3K5LA 3PDNA 2XY7A 4KB7A 1QAIA 1AROP 2IAJB 2GO9A 3T9NA 5KFNA 3Q24A 3TANA 2V4RA 2LA6A 1Y0HA 5B0DA 3GIMA 5LT5A 4NYPA 2JC1A 2OPQB 2P6SA 1YJNS 1J5EF 3I6PA 3CULA 5KFYA 5LJ3Y 5A8RA 1JLCB 2AV5A 2JVRA 3RAMA 3MPYA 1NHUA 2XMMA 3CD5A 2OMLA 4B3OA 2ASYA 2F8HA 3AB4B 1HNWF 2IMOA 2VG5B 2JL9A 1MMNA 4PG6A 4HH1A 2MZQA 2DT9A 1P27B 2RDIA 3RB4A 4N47A 3SFGA 2EFPA 1HQEA 4LVNP 4W92B 5DO2A 1TK0A 2EFGA 4DV6F 4ED7A 5JVHQ 3US5A 2KYXA 1KS2A 2V9KA 2XHWA 4J9KA 1D1UA 3J7YI 3QAUA 1YBAA 2VONA 2FVRA 2KDOA 2MXYA 4A8YA 5A8WB 2ZZMA 2HRUA 1JLFA 3NG8A 2IJFA 1RT5B 2FC9A 1L3UA 1A6LA 2HYIB 2FHJA 1NK4A 1I6JA 3L09A 4K4SA 1VK8A 1U1RA 4FPRA 5KT5A 1X4EA 4B9NA 4TY9A 4G1QB 3SXLA 3GV5B 1FRMA 3KJVA 3FRYA 5DLGA 5HMZA 3KLFA 4NYOA 3U1NA 1MNEA 4CT9A 2B9WA 1OPZA 1JKHB 1P6TA 3LGNA 4X4SA 4I2PB 1LW0B 2OPRA 3EGWB 5IT0A 3OL7A 4IUFA 1LWCA 4H54A 3MURP 1RKIA 2VFUA 3TQ1A 4EYIB 3I4HX 1Y3KA 3S01A 1REVB 3DM2A 5KG5A 1Q8BA 1X0PA 2BR0A 4ILMA 5KG1A 5A8KA 4U6PA 3QWUA 4Q5VA 4ED1A 2DD8S 2DNNA 3X3UA 2UUCF 3ITHA 5C24A 3S7RA 1Z1ZA 2CJ9A 3OL9A 2OPSA 1H38A 4QIEA 3R1LA 2KRRA 4MTPA 4OX7A 2HHHF 1F5CA 4DSKA 4B9SA 3WX4A 2UUTA 2HNDA 4X4QA 5E5NA 4C8MA 2WAQD 5AXKA 5DG7A 1IKXB 1JNRB 4FZVA 5M2UA 4E0DA 1RT2A 1FVSA 1U7LA 2PA3A 4WXOA 3PXGa 4Y0FA 3MEDA 3OPKA 2AD9A 2GNKA 4F3QA 5D4PA 3M05A 2BVZA 4LJMA 3CCES 3W3SA 5F8IA 1HBOB 3MPVA 3DLEA 2ZBCA 2ZZNA 4K4YA 3MM9A 2ZD1A 3OBIA 3BSCA 5F41A 1TL1B 2F8MA 1WTFA 4M5DB 4UY85 1SIZA 4J5OA 2OSQA 2R7QA 1IBKF 1HI0P 4KRWA 1LK7A 2UUAF 2L9WA 1YRUA 4LMZA 1CPZA 1QE1B 4ES2A 1SJ4P 4RW4A 3DMJA 1NKEA 3MM6B 2CPDA 3KLVA 3T1YF 2E29A 1NAQA 4M8LA 3L95X 4RX6A 4KSEB 2IA0A 1RTDA 3MMBA 1IBMF 5KG3A 5J2QB 4Q2MA 4ED0A 1F5AA 4XPEA 5DRKA 3MEEB 2JFKA 5K14A 3O1LA 1FF2A 3HMJG 3LP0A 1RT3B 2VG6B 2VC0A 1RTJB 2LEBA 4ZCKA 2M9KA 2GHVC 3PV8A 5BYRA 4DR6F 2IJNA 3S8SA 5F9NA 2CQGA 3KLIB 2JFDA 4D3HA 1I94F 1Z4UA 2MKHA 3ISZA 3TVZA 5J2MB 5KFHA 3NCPA 1TL3A 2B43A 3OTCA 5SZTA 3P6YC 1GXLA 2I0XA 3LH2S 1UFWA 3BEGB 3LO3A 5L1LA 4EO6A 4IH7A 7FDRA 2NUUG 1HQEB 4ID5A 4IDKA 3QYYA 1LFPA 5LJ5Y 2VBYA 3NAHA 1BQMB 1S1XA 2GGPB 4IQMA 4X4OA 5DQGA 4NCAA 4A4JA 3D2WA 3TUIC 3G8QA 2AX0A 2BE2A 1YTYA 2BM1A 2RT3A 3MHYA 5G4DA 4DV0F 3QWPA 1LWFA 4PXCA 4NZ7A 1DQ9A 4O3QA 3E8OA 1AFJA 3R5AA 2FY1A 3IRXB 1VC5A 4ZPCA 4ED2A 2HQ3A 1UJ5A 3PHEA 4PQAA 1C1CA 3IRWP 3CIZA 5T14A 4MJKA 4N77A 4ALZA 4E8UA 4E98A 4CIOA 1M5PC 1HR0F 2DGXA 1TZ0A 4G3IA 1FHTA 1KLMA 3MZIA 3VAKA 3C6TA 1IJEB 3MI7X 3W2VA 3N28A 4RKUC 1HPZA 3AH6A 1S6OA 2XB2D 3IO1A 2DHGA 3M2VB 1FJGF 1YGYA 2JEFA 4I7FB 1IKWB 5KFVA 2UVRA 3GG0A 3UD3P 1ZPWX 3HHLA 1NJIT 2F1FA 1QTMA 3I55S 5EWEA 2P9EA 2EVZA 2DHSA 1X7VA 1CVJA 5F3ZA 5CQGA 3PX4A 2R7UA 2OD6A 2V4QA 1GNKA 2RS8A 1DTTB 3W7BA 5A8WA 3G96A 2X1AA 1JLAA 5CA5A 5KOXA 1WG4A 2VOOA 1RT4A 3K8WA 4ECZA 2I38A 2Q6CA 4G1IA 2YNHB 1W2IA 2M70A 1FRXA 2Q1LA